1RIRA

Crystal structure of meso-tetrasulphonatophenylporphyrin in complex with peanut lectin.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galactose-binding lectin
publication title Crystal structures of the PNA-porphyrin complex in the presence and absence of lactose: mapping the conformational changes on lactose binding, interacting surfaces, and supramolecular aggregations.
pubmed doi rcsb
total genus 50
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rirA00
4GALA 2P37A 4P9YA 3V64A 4BLJA 4AVTA 5GZDA 3WHTA 4XJ9A 3INAA 2JD4A 2Z42A 1Q56A 3T1LA 1VAVA 5T54A 4Y1YA 3WG1A 3WHUA 5IK5A 2CY6A 2DVBA 2XG3A 1GZWB 1YXWA 3ZXKA 3V65A 3FFZA 3MEPA 1SLBA 4K21A 2GN3A 2Q5TA 2WKKA 2WT0A 4YGEA 5LK5A 3ZSKA 1VIWB 4C1WA 1QOTA 1UKGA 2DUPA 2AENA 2DTWA 2PHTA 3ILRA 4FQZA 4AGVA 2GNDA 3WLUA 4JC1A 1JYCA 2D6PA 5T5PA 4PF5A 1RITA 1AXYA 3IN9A 1QMJA 2EXKA 4GWNA 5DZFA 1C57A 2DVAA 4PQ9A 2DURA 5EWSA 4DS0A 4FPHA 1WCSA 1MVEA 1A3KA 2WJSA 1LGNA 3NWKA 1W6OA 1F5FA 1DQ2A 3MPPG 5H9RA 5HCAA 1DZQA 1BYHA 3M3CA 2UWAA 2R1BA 3V0BB 4L8QA 2ZBJA 3ILNA 3SLIA 1DQ5A 3GALA 1G9CA 1R1ZA 4WVWA 3OGGA 4XJWA 3NV4A 5DUWA 4FPYA 5E88A 2YXSA 1MZ5A 2E7TA 4OZXA 3POSA 1Q8VA 1WLWA 1Z0HA 5GLUA 2ZGUA 1GBGA 2UWCA 2PHRA 1V6IA 4JRAA 1CN1A 2ZACA 1AXKA 1GYKA 1S0DA 3BIWE 4M3CF 2YROA 5GLTA 3O0XA 3V0AB 3W59A 4R9DA 1YYNA 3SH5A 4WZFA 4YW4A 2CWMA 1MR5A 1ENSA 3AP7A 2ZKNA 3B9CA 2OW4A 4D69A 1U0AA 4XJAA 3ZYPA 2CTVA 2GN7A 2AH2A 1W0PA 1DLLA 1S0IA 1W6PB 2DYCA 2UWBA 1DFQA 3KQRA 2ES3A 2NMNA 3USUA 4BMBA 2LALA 1CPNA 3AYAA 4LBQA 3RG0A 4YG6A 1JUIA 1GZCA 1LHOA 2D6OX 5JDBA 3AFKA 3VKNA 1J1TA 3B3QE 1BQPA 4M3CA 2GDFA 3WDWA 3OJBA 2W52A 4LBJA 5CA6A 1N47A 1GLHA 3AZZA 1FNZA 2PHUA 2D6LX 1QDOA 3ZVXA 4XJ8A 3VKOA 1DHKB 5HCBA 3PMEA 5T55A 3SH3A 2GNBA 2JE9A 3ASIA 1N1VA 2AUYA 5HCFA 4UW3A 3AP4A 5DUXA 4PBPA 1JW6A 4AGRA 4XHXA 1V6JA 1Q8SA 3AP9A 1WD4A 1FX5A 1UZYA 1JOJA 3IPVB 3I4IA 2NMOA 2BQPA 1WW6A 4Y1XA 5IUQA 2KM2A 2NYYA 2YY1A 3HN1A 3N7LA 3WNXA 1CIWA 5GLZA 2ENRA 3ENRA 4K1ZA 1BKZA 4TYSA 1MS8A 1PZ8A 3ZXJA 1OKQA 2ZGQA 4XTPA 2R0FA 1WBLA 1HKDA 1KDMA 4BMEA 5IK8A 5H9SA 2AREA 1LOFC 2D6KA 1YIFA 4XZPA 1QF3A 4U2AA 1MACA 4YM2A 2WSUA 1S0BA 3R05A 4FPCA 1LU1A 4BQ1A 3FLTA 1UAIA 2D6MA 2C5DA 3AP6A 2VXRA 5CNAA 3T2TA 2E7QA 2D7FA 5GJ6A 2DTYA 3SITA 4FOYA 1MVQA 4M3CE 4Q8KA 5T5JA 3WG2A 1QNWA 1LGCA 2A3WA 2W68A 4U36A 3OY8A 4YZ5A 1F31A 4FPFA 4XXAA 1G9BA 2R49A 4YG3A 3SISA 1AZDA 4LBMA 1LHNA 4XMIA 1G9FA 1ENRA 3B69A 1F9KA 1KITA 3WDYA 4YFZA 3PVNA 2VW0A 3U4XA 3ZSLA 4CZSA 4YM3A 3AXDA 1SACA 3PVOA 3AZXA 5SV8A 2ZGSA 4XTMA 3APBA 3N7KA 3QLQA 4BPZA 1DQ0A 3AYEA 3ZXEA 3SH4A 2VUAA 1DYKA 3CNAA 3HR9A 1DGLA 1V6LA 2VY0A 2ZGPA 4XBQA 1Q8OA 1GZWA 3T1MA 4IQPA 1IOAA 1IS5A 1WLDA 4Q1PA 4Y22B 4DRRA 3OYWB 5BYNA 4Y1ZA 4XYXA 5JVVA 3HMYA 1DQ1A 4AYUA 1MS1A 1H9PA 4YZ4A 5IT6A 4Q26A 1A78A 1Z78A 3M2MA 5AVAA 1UPSA 4YM1A 3DGTA 2D6NA 1ULGA 1IS6A 1DIWA 1I3HA 4M00A 2JDZA 1HDKA 4XHBA 1LU2A 1WBFA 2ZMNA 1C1FA 3WV6A 5DG1A 4PBOA 1LGBA 4UW5A 3V0BA 2A7AA 2A6ZA 1HQLA 5GZFA 3IM0A 3M3EA 1YI7A 2A6XA 1PZ9A 4Q1RA 3AJZA 5CBLA 1NXD1 2FMDA 1KDKA 3IMNA 3VKFC 3W58A 1G7YA 2D3PA 2UURA 1N3OA 4ZKTB 2GNMA 1JXNA 2ZHNA 3FLPA 2AGSA 3M3QA 3OPZA 4KBBA 2D44A 3AZWA 4XMAA 1SFYA 3TB0A 3ZSMA 1QOSA 1FV2A 3V0AA 1SBFA 2OUJA 3B00A 4YZ2A 2ZGTA 2ZGKA 1CQ9A 3N3HA 1APNA 3GNEA 3Q9OA 4YLZA 2A6VA 1ULDA 4FP3A 2FHRA 5DG2A 1IKPA 1DQ6A 1MS4A 1LOGA 2P3KA 2ZHLA 4R9BA 1ZA4A 2E6VA 1ZM1A 1DBNA 2EXJA 1I1EA 4XBLA 3KM5A 1UZZA 4FQ4A 4K20A 1LECA 2EF6A 3WUDA 3IKWA 1EPWA 3RMYA 5IK4A 2WLQA 1VAMA 4YGDA 5DZGA 3N7MA 3POWA 4UW6A 1MS3A 3WOGA 1KRIA 4TZDA 1MS0A 3RQ0A 4GXLA 1GICA 2NZ9A 2PHXA 4YFWA 1IS3A 4YM0A 1SBDA 5F9TA 1YRZA 1DQ4A 3ZYRA 1GZ9A 2A75A 1N1YA 4GWMA 2DVDA 1UN1A 1W0OA 2ZABA 4WVVA 4YW5A 3WG4A 3FLRA 2DUQA 1QNYA 3VKMA 2XB6C 1QDCA 1LCLA 3N7JA 5JOYA 3IPVA 1ULFA 1S1AA 4XILA 2ZZJA 1W6QB 1WW5A 3OBRA 1N3PA 4YG0A 3WDXA 2A5ZA 2A6YA 4ISQA 2YV8A 4PCRA 4XJZA 3UJOA 2EIGA 3FUQA 1UL9A 5FRAA 4C1XA 1S0CA 2EXHA 2ARBA 3RSJA 4Q2FA 4AVSA 4YW3A 1AX2A 2A6WA 4I30A 1KQRA 2ZHMA 4XIKA 2V73A 2AR6A 1W6NA 2EXIA 4M01A 1S0FA 1FV3A 1LOEA 2GALA 3AZVA 1OFSA 1S0GA 1BZWA 2WT2A 4P14A 3UK9A 1X50A 5F5QA 1A8DA 1GANA 1FNYA 1JN2P 3NV3A 3WVJA 1C4RA 3ILFA 4Y20B 2SLIA 3UL2A 4FPJA 1VALA 4YGCA 1LESA 4AGGA 1H30A 3R4SA 2EALA 2PELA 1D0HA 3N35A 1W6MB 3POYA 2ZMLA 3NV2A 1N1TA 4WV8A 1LOCA 2DU1A 2JECA 4LBNA 1MZ6A 3R4UA 4K1YA 4LBQD 1URXA 1AF9A 5JMCA 4BLIA 2D3RA 3D6EA 2ERFA 1DYPA 1CJPA 3H0OA 2V5YA 3O0WA 3NV1A 3ZXLA 1UX6A 5T5OA 2ZGNA 4LBOA 5KXBA 5CB7A 1LHUA 2WQZC 1SCSA 4Q8LA 2OVUA 4Y1VA 1V6MA 5JOZA 1FATA 3O5SA 2HYKA 2GNTA 5GZCA 3RRDA 1SLAA 4RA0A 4Y22A 3AZYA 2R16A 1SLLA 1D2SA 1TEIA 3OYWA 3OY8B 4FPOB 4R9AA 2VU9A 1LEDA 5JLVA 4AVVA 2GMMA 1HQWA 1MS5A 1LTEA 4YZ3A 3WDTA 4YZ1A 3LCPA 4ITCA 2E53A 1IS4A 3RS6A 2NN8A 1LJ7A 1S0JA 1BXHA 1ULEA 4ASMB 2I2SA 4CRQA 4LBLA 1ENQA 1JBCA 3LSEA 2CYFA 5KXCA 3OBTA 1MS9A 3AX4A 4FPEA 2DU0A 4DFSA 2ARXA 1GNHA 3ATGA 1SBEA 1KJRA 2W39A 3WUCA 2P3IA 5FREA 1GV9A 1S0EA 5EXOA 1VLNA 2DV9A 5KXEA 1H9WA 2D3SA 2ZGOA 4DQAA 1NLSA 5GZGA 2G4IA 3WZ1A 1QKQA 2R1DA 3AK0A 5H9PA 4FPGA 1AX0A 3ZSJA 4H55A 1GNZA 5DZEA 4P9XA 4GA9A 4JCKA 2CWSA 1JHNA 2P34A 3BODA 5EYYA 3FUOA 3JU9A 2PHWA 1W6OB 1KJLA 2D43A 2DUOA 2JJ6A 2NM1A 2VW1A 1PZ7A 2ZGLA 3D4KA 1LULA 4NO4A 3WDVA 4Y1UA 4BM8A 4UW4A 3AJYA 3A4UA 1W6PA 1UMZA 1G86A 1WUVA 2C9AA 1V6KA 1V6NA 4XDQA 2YMZA 4Y24A 1IKQA 2WNEA 1SLTA 2RHPA 4FOWA 1N1SA 2ZGRA 5IK7A 4R9CA 1Q8QA 5E89A 3MW4A 1SLIA 3WCRA 4CTEA 3FBYA 1LOFA 2AYHA 1CPMA 1Y7BA 3BOPA 3O0VA 4P9WA 4FOVA 2VW2A 4XBNA 5GM0A 2A3YA 4XOGA 4Y26A 1ULCA 3PVEA 3WDUA 1WW7A 3TAYA 1WW4A 1LHWA 1CONA 4XXPA 3VKLA 2OUHA 4BOWA 1LOAA 1N3QA 4DPNA 1AJOA 3USUB 4ATEA 1JYIA 3MW2A 2GMEA 2DWRA 1LODA 1WD3A 3BTAA 3PJQA 4FP2A 2VH9A 4GKXA 5DXDA 1W6QA 4LBQB 5H9QA 1ONAA 2GMPA 3I8TA 2A70A 2EAKA 1SLCA 2H0BA 1AXZA 2WSVA 4FOQA 1AVBA 3JUUA 4M3CB 1YO8A 3O12A 4GKYA 4HANA 3A0KA 5DUUA 1Q8PA 3AXEA 1OQ1A 2NP0A 3B01A 1LHVA 5KXDA 5E8AA 1XQNA 3L2YA 1G8WA 2ZMKA 5GLWA 2W08A 2ZHKA 4ZXKA 3RMXA 3DUIA 1G9AA 1RIRA 4HL0A 3N36A 2SBAA 3C2UA 4YW2A 5T52A 5JOWA 1CR7A 4XE9A 4XJUA 2P3JA 1SCRA 4SLIA 4YGBA 3AYDA 1AX1A 3SNMA 4FPLA 3LSDA 2LTNA 2ZGMA 2JE7A 4Y20A 1QU0A 2CL2A 2B7YA 2WT1A 5DUVA 1LENA 5JOXA 1G9DA 4W65A 4FVVA 2DVGA 2YZ4A 3M1HA 1QGLA 4NOTA 5GZEA 1GKBA 1LEMA 5GLVA 5L73A 1V00A 2CNAA 4Z8BA 1O4YA 5T50A 1LOBA 1WLCA 1W6MA 3D5OA 2JKBA 4Q27A 3QCWA 3WG3A 1W6NB 1B09A 1GSLA 4XIOA 1AJKA 1FAYA 3UJQA 2PHFA 1BJQA 2ZAAA 1HLCA 4ISRA 4YW1A 5GALA 2A3XA 2E51A 5EYXA 1RINA 1CVNA 3AP5A 1O4ZA 3M3OA 4ATFA 1QOOA 1C1LA 4RL7A 3VUOA 2A71A 5T5LA 2R0HA 3A0NA 2TEPA 2ZA9A 4MYEA 3ZPYA 3WCSA 1V6OA 4LBKA 1CESA 2DVFA 2P2KA 3VV1A 4FPKA 5CAZA 1FYUA 4AWDA 3ZXFA 3AYCA 3MW3A 4F83A 4DRVA 2UU8A
chains in the Genus database with same CATH superfamily
1OPOA 1ZZ8A 2PYTA 2QQUA 5F3IA 2Z42A 5EPAA 1QWRA 1VAVA 5IK5A 1UY1A 2CY6A 3KZ4C 1EUUA 2OQ6A 2XG3A 1GZWB 1FOD1 2RVAA 5ERLA 3WSOA 3ZFGC 4L0PA 4JV4A 4BQWA 5FIXA 4OULA 1ZRFA 4FQZA 3ILRA 3K46A 2Y33A 4L99A 2PHTA 3LEKA 4Q0PA 5CYYA 5LCWL 2D6PA 3UV9A 1RITA 1AXYA 1U5ZA 2HH9A 3AMHA 4E9KA 3I3DA 4XQDA 3ZO0B 4GWNA 3GHNA 1C57A 3NMBA 5FZGA 3VD9A 4Q4Y2 1FMD1 5KHJA 4Z92B 2DURA 1NE6A 3JBG1 4DS0A 3KGZA 4O61A 1JZ2A 3MGUA 1PHMA 1AR82 3ACIA 4QPIA 2WJSA 1NYWA 1KD7A 1F5FA 2HEYF 2OZ6A 5H9RA 1DZQA 3PJYA 3RWNA 2R1BA 4LE4A 3O1UA 2RM22 3ILNA 4IEQA 4L8QA 1G9CA 3O1OA 1IPKA 4XJWA 2Q1ZB 3U07A 3NJZA 3HJRA 1LAJA 3S0MA 1DZTA 1GBGA 1HN0A 3BTXA 2PHRA 4AI9A 3K75B 3CIHA 4JRAA 1AL21 1AXKA 2ZACA 5B4XA 3ZN6B 2XBO3 3DEMA 4IERA 3W59A 4CYDA 2CV6A 2GC3A 3KLSA 1YYNA 4K3UA 1YFUA 1ODMA 3D0SA 2CWMA 2J1RA 3T30A 2BGPA 3POIA 3ABZA 5FCCA 1NCRB 4OLLA 4LKDA 2XLGA 4XUNA 4XJAA 1W8OA 2CTVA 4O65A 1H2KA 3ZYPA 1VBD2 1X33A 5F8PA 1XNKA 2C9KA 1ZRCA 4IEZA 3BTYA 2NMNA 1YLLA 5JSOA 1RUJ2 3MFAA 4QX3A 4E4DX 5FLHA 3VBUA 2R062 4LBQA 5A3UA 1K12A 1LHOA 4XQWA 4B1MA 3VHNA 4CXYA 3THDA 1S2KA 2VZPA 2WABA 3CHXA 4NHKA 2B5HA 2UYBA 4LLOA 5C5UA 3FBMA 5G04L 3ZN5A 2GNBA 2JE9A 1BVP1 2J1UA 2AUYA 2YBKA 5HCFA 4UW3A 3SCFA 1JW6A 2BBAA 1RUI3 2CGPA 2FCUA 4IV3A 3JZVA 1RJ8A 4KWJA 1WD4A 2QDNA 3BPZA 2E63A 2OZJA 1O3QA 4FFHA 1H4GA 2JDPA 5FZ7A 1CGPA 5GLZA 2ENRA 2HWD1 4IEPA 3ENRA 1FPN1 3WP3A 1MS8A 2ET7A 4COYA 4BB3A 4GD4A 5HV0A 3ZXJA 2ZGQA 1HX6A 1RHI2 2D40A 2R0FA 1WBLA 2YU1A 2K9ZA 3DV8A 4Z07A 4S2DA 4CP9B 4WVZA 4PLMA 1UIJA 3ZXAC 1XE8A 3LIGA 3ZFEB 2AREA 1VMFA 4CDUB 3CEWA 4RQPC 2PLV3 1CAVA 4YM2A 5FYSA 4EN6B 4GZ9A 4UFKA 1SDWA 1S0BA 3R05A 1RUH2 5DN2A 3FLTA 1UAIA 5FZKA 1W03A 2GP5A 5I0SA 3AMNA 1COV2 1FXZA 4E8CA 4H3WA 3RJRA 3SITA 4FOYA 2WS91 1YEWA 2VG9A 2ZX1A 1LGCA 2W68A 4YZ5A 2HWB1 2FDKA 2ZEYA 4HVOA 1G9BA 1PIV3 1X36A 1G9FA 1ENRA 1MEC2 3WDYA 1HRV1 1WMXA 2CHHA 3S7EA 2H6CA 5FYVA 3OTFA 4RR3C 3LPFA 1SACA 4YVWC 5SV8A 4WVMB 3APBA 2PMWB 2RJLA 3VHOA 1OC1A 5DDJ2 4DY5A 3SH4A 4IXLA 1YJLA 2VUAA 3CNAA 3B7MA 1DGLA 2ZGPA 4HONA 2V72A 1RTVA 2QZ2A 3EYPA 3GDBA 1IOAA 4Y22B 4DRRA 4Y1ZA 5ANNA 4BQXA 5JVVA 2WNOA 1KFXL 3MV11 5FWJA 1O5UA 1W8FA 4EZ4A 3C7OA 5FY1A 4XURA 1W9TA 3ACGA 5K4LA 2NPIA 4Q26A 4URTA 3AKTA 5I0DA 5IT6A 1GNYA 5EIYB 2WNUC 4AQTA 2D6NA 3WP4A 2Y26A 3D3AA 5HXMA 3R4DB 2PQQA 4IE7A 1WBFA 4AEDC 4A4AA 4AW7A 1DU3D 5K0UA 1AR62 4PBOA 2IUWA 2DFCA 3D82A 2VCCA 1NCQA 3OG2A 4B29A 4CCDA 3O1TA 2A7AA 3GZEA 4JQRA 4Q4Y3 5LY1A 5GZFA 4ZY9A 4AI1A 1AR83 4D7TA 1YI7A 4CUAA 5C33A 4Q1RA 5A6ZA 4N43A 1OBNA 4HVQA 1MZEA 3MIFA 4IEWA 4COVA 4PLNA 1G7YA 1WZXA 2KR2A 2UURA 3GZTB 4N8MA 1AL0G 5DAPA 2GNMA 2RM23 2ZHNA 4YW6A 2AGSA 4KBBA 1BK1A 2QUOA 3TNQA 4F7ZA 2E32A 1SFYA 4Z2AA 4COUA 5BNOB 4LKFA 4EQVA 1VBA2 3MLKA 3ST7A 5A6XA 4OHYA 4AFBA 2BYVE 5F32A 2P5BA 1PX4A 3ME2A 2G9GA 5DG2A 2RR11 1DQ6A 1H8TC 1NLRA 1MS4A 4NAOA 4R9BA 2WA4A 4K8RB 5FPVA 3PU8A 1RMU2 2Y8KA 4JAAA 5CFCA 4XUPA 1Y9GA 4HZFA 4IEVA 2Y0IA 1MQTB 4MO3M 2Y64A 3VHRA 4AEKA 4GJYA 5C70A 1GOGA 4CDXC 2WFF2 5IVEA 1EPWA 2HWC1 2OA2A 1VBD3 3JCIA 4YGDA 1DG6A 4ASKA 1KRIA 4BIFA 2JDHA 1MS0A 2W1SA 1RUJ3 4LTAA 1J83A 4GXLA 2WN3A 5D8AB 5J7MA 1WMFA 2QVSB 2R063 3N9OA 2HWE1 2PHXA 4YFWA 1IS3A 2ZZQA 5DAQA 5FFOC 3ZDSA 1UY0A 1SBDA 2UY9A 4CPBA 5L7OC 3DXTA 4I0AA 4S2FA 4XQ4A 1DQ4A 5BV6A 2YUEA 1K5JA 4P5HA 1W0OA 4JGYA 1TG7A 4MGSA 4YW5A 2DUQA 4A7ZA 5JOYA 3N7JA 1S1AA 4AL9A 2ZZJA 2XMLA 1ND2A 1F15A 2JE8A 1N3PA 5BXXA 1GWLA 5LB6A 1LRHA 1WMEA 4XJZA 2YV8A 1XBFA 4J1WA 3FUQA 4IV1B 5FPBA 3ZXGA 3NL1A 1JYVA 3WR0A 4Y4RA 2ARBA 3RSJA 4Q2FA 3RDIA 3AMQA 4AVSA 3VL8A 4I30A 3KF5A 2EXIA 4JGZC 4L9BA 2RDRA 3LA7A 1RHI3 3EXUA 3LDRA 2JB4A 3SC7X 4RYDA 1W2UA 3AZVA 2BV4A 3LWCA 1S0GA 4CXXA 2R30A 1H0BA 2ZX3A 5F5QA 1A8DA 1ST8A 3NV3A 3ZFGA 5J09A 3BU7A 1C4RA 4BJ0A 2XBO1 1RUE2 4OI1A 4FPJA 4N9IA 4AF9A 2JG9B 1VALA 2F4PA 3MIHA 1K5MC 3T0AA 1RUH3 2PHLA 3S5QA 1NY71 3E5UA 2QQKA 2PELA 4E4HA 4CCEA 1TME2 3RVHA 1JH5A 1I6XA 3HT1A 4UF0A 5F39A 1COV3 5FY5A 1LOCA 4DNYA 3JD72 5A32A 2VZ3A 1MZ6A 3R4UA 1URXA 1J58A 2WZR2 1UU4A 1HB4A 1DYPA 3H0OA 1OVSA 1WMDA 1YCIA 4OHZA 1REEA 5JUVA 2A73B 1TMF2 1RL3A 1MEC3 2ZS6B 5EHDA 1LHUA 1STMA 2YC2A 4Q8LA 4YYOA 5KHGA 2E26A 1RUC3 4FXGB 1H6XA 2VZRA 4QB1A 4Y1VA 5BUVA 5C9AB 3OGVA 3RRDA 4ZZ8A 1H1AA 1SLAA 2HKXA 2RS12 3HWJA 3AZYA 3T2OA 5BNQA 1W8TA 1C3HA 5DDJ3 3RFRA 5JLVA 3W9AA 1R082 3LAGA 2GMMA 3BALA 3GCXA 5HXVA 1RUI1 4AEMA 2E53A 2JG9C 1J3RA 1IS4A 5FY9A 2NN8A 3RS6A 1ULEA 4XAAA 2WO3A 3ON7A 3NKGA 2FDIA 5AVPA 1JBCA 1OUSA 1UYPA 4LA2A 4DEQA 5KXCA 1QQP2 1ZRIA 3B94A 3PU3A 2DU0A 2GC0A 2YZ4A 5D1IA 3HOBA 5LEKA 2ADDA 4FCAA 3LA3A 1TNRA 1WCDJ 2OS2A 4QD2A 2Q8DA 4NIHA 2VTFA 3P5BA 4KGGA 4I0BA 5IAVA 4P9GA 1AR63 5A3OA 1HN1A 5FOJB 2XJPA 4FPGA 2IFRA 2PLV1 5FUPA 2OIIA 4LLFA 2IVIB 5IFPA 4XVHA 4Q0SA 3ZN6A 5C4WC 2EICA 2P34A 4P9IA 3I2OA 5JXGA 1C8M1 4R8HA 3POBA 3E5XA 4QPIB 1OF4A 2PHWA 1KJLA 5IATA 2XHKA 3NSTA 3WDVA 1W9YA 5J36A 4UW4A 3PDQA 1VBA3 2XXZA 3AJYA 3FZ3A 4I2OA 3T0BA 4D7SA 3UETA 1ULPA 2PHDA 3HN3A 2RS51 1PIV1 4TN7A 2BTVC 4I3GA 2BNOA 1SLTA 4Q29A 4A3ZA 4AHZA 5IK7A 4B1LA 1YFYA 3I2FA 4MG2A 1PGL1 3LB9A 1PM4A 3FBYA 2AYHA 3LZZA 2TUNA 4META 1KEXA 2E7AA 2WFF3 5FZLA 3ZYGA 4XBNA 2YGMA 1KS5A 5JXJA 2JENA 3WDUA 2QQNA 4NIGA 3H7JA 3JQWA 3M7AA 3LKJA 3TAYA 5F6KA 4XXPA 1HB1A 3ELNA 2OUHA 4NRQA 3S30A 5FZ4A 2PAKA 4CCJA 4CUGA 1AJOA 3BTAA 1U5IA 1VBE3 3PJQA 4FP2A 2VH9A 4GKXA 5DXDA 1W6QA 4LBQB 3VBSC 2WZPP 1ONAA 1QJX2 3I8TA 2EAKA 1HIXA 2XLAA 3CZJA 4IEXA 1AXZA 2VZQA 4HG6B 2WSVA 3KV5A 3LQCA 4G9SB 2XVGA 4J25A 4LUKA 4OHWA 2ZAHA 3JUUA 1UZWA 2ORXA 3IZOA 1YO8A 3O12A 4FFFA 5IYYA 5DUUA 2C1FA 5JPMB 2BDRA 2Q8OA 2NP0A 4XFCA 3AB0A 5I93A 1JHJA 4RR3A 3E1F1 2Q30A 1XQNA 3N9QA 2ILMA 2XWBB 4YVWA 4L11A 3GM8A 2ZMKA 3OF1A 2W08A 2XJVA 4Q4Y1 4ZXKA 3RMXA 1DCSA 4AFCA 3RGBA 3IB3A 1AR81 1XU1A 2SBAA 2WYSA 2NLRA 3C2UA 3HQRA 3NVCA 1JODA 4IV3B 4ARYA 5C8WA 5JOWA 1SCRA 4SLIA 4YGBA 3WQ7A 3WNMA 2OPKA 2VMFA 3SNMA 3VBFC 2RM21 3S5AA 2LTNA 4BU2A 5FK8A 2QJVA 2W5FA 5DUVA 1LENA 1X8EA 3QD6A 1G9DA 4W65A 4FVVA 2DVGA 2JD9A 1OA4A 1F4HA 1QGLA 1GQHA 1GKBA 1LEMA 2DBNA 2RDSA 3OD0A 1V00A 5EZWA 3T09A 3LF7A 3AC0A 1O4YA 4Z8BA 1BK0A 1WLCA 2B46X 4QU1A 2O14A 1RUE3 1SEFA 4Q27A 3H3UA 5FDBA 2VULA 1VBB2 3HVDA 1VBC2 3OPTA 3I3EA 4XCAA 4AEDA 3UJQA 5E1RA 1BJQA 4B4PA 4LO8A 1CAVB 1HLCA 4ISRA 1TME3 3CZUA 3WW1A 2A3XA 3NAPC 4CDWC 3JD73 1VBD1 4RGKA 1CVNA 5C3QA 1O4ZA 2ADEA 2WZR3 5FJKA 5BNNC 4CU9A 5ACA2 4ATFA 3ZFFC 1RUJ1 5FZCA 2R061 1YQCA 1O59A 3PTRB 3WX5A 2RG4A 1UWWA 1TMF3 3O1VA 2R0HA 3E6BA 4QX5A 5D2AA 2LS6A 4MYEA 4K7JA 1GOFA 2WA3A 4CE8A 4XFIA 3AMPA 5L9BA 2DVFA 2P2KA 3WDXA 1ZRRA 1SFNA 2BP6A 5FO8B 3MUY1 2RS13 3DYOA 3AYCA 2F6BA 4NHXA 1H8TA 3WG4A 4S2HA 5LRRA 3H50A 4HN0A 3V64A 5IVBA 4AVTA 5JI9A 3PHMA 3INAA 2JD4A 1JZ3A 1OOPC 2J1VA 4AVCA 5L19A 2DVBA 2N7GA 3HBKA 4EYUA 3FHAA 4MX3A 1HW5A 3OGSA 2JDUA 4ET7A 1QQP3 3FFZA 3MEPA 2Q5TA 3MUZ1 5CZKA 1QOTA 4C0BA 2DTWA 4AGVA 4D6QA 1PNGA 4RSUA 1BHGA 4JKLA 2GNDA 1RHI1 4N90A 5IJRA 3WLUA 2BU9A 4PF5A 1PGSA 5FMBA 2VCMA 3ZMNA 2ARAA 5L7OA 1RB8G 1QMJA 2VNVA 2I74A 2R6QA 2LROA 4NUBA 5DZFA 1BCXA 2IXIA 4PQ9A 2VGDA 5EWSA 2VVDA 1JMUB 2Q0AA 3MFCA 1EV12 4HK9A 1LGNA 2Y6HA 4J6GA 2Z4FA 3RYPA 1RUH1 3DN7A 5HCAA 1DGRA 2DDUA 1BYHA 1NCQB 2XVKA 4BDVB 4LA3A 4QT6A 3VB9A 2ZBJA 2H6BA 2FZ1A 1VPHA 1R1ZA 1OD5A 3NNGA 1YC61 3OGGA 1COV1 2J42A 4QPYA 4WVWA 5E88A 3ZR6A 2YXSA 1MZ5A 4NHLA 4B3NA 1ODNA 2E7TA 1FI2A 1Q8VA 4N43B 2JIGA 2BWCA 4DINB 5CG8A 5FMOS 4M4RA 1V6IA 1WGPA 4UFJA 1VJ2A 1S0DA 3POFA 4G4FA 4XF0A 2OKXA 4JKKA 4JGZA 2R042 5HI0A 1W39A 2W2IA 5FYCA 1MEC1 2Q4SA 4AFAA 4DXTA 4MVTA 2QQOA 1ENSA 3A22A 4LKEA 3S6PA 3ZXDA 5A1FA 2MHFA 3K4DA 1U0AA 4HXCA 4RGAA 4Z2WA 2WWSA 2AH2A 3I54A 3BTZA 1W0PA 1S0IA 1W6PB 4Y4YA 1VB4A 2C0ZA 2ZEZA 4HVRA 3KQRA 1AYN1 5FP8A 3RZZA 4BMBA 1K5MA 2ORZA 2TNFA 5FYTA 1JI6A 2YBSA 4PHZA 1C28A 4YG6A 3KCYA 1JUIA 1VMHA 2W1WA 1H1MA 1C5HA 3RG0A 5JDBA 3DL3A 5FYUA 3I97A 1J1TA 4PDWC 4AE2A 5CKMA 4CP2A 2IFWA 5DABA 4DMIA 2VBBA 1W3VA 3LFMA 3OJBA 1QJFA 2W52A 1PGW2 3OSDA 1N47A 3AZZA 4E4SA 1FNZA 1QJX3 1NZCA 1UY3A 2D6LX 1NE4A 4XJ8A 3VKOA 1GFF2 2FDFA 4NPMA 2QQMA 4LHKA 5J37A 1N1VA 4XZUG 5DUXA 4JGYB 3O1RA 5AC92 2BGCA 5A3LA 1V6JA 3GYDA 3MIGA 3I2GA 3OGRA 4XF3A 1AR61 1L3JA 1RC6A 5FPXA 1FX5A 3CLPA 4QKDA 1WW6A 5IUQA 4CCCA 1ND2B 1UYXA 3DXUA 2V4VA 4UXAA 2VBPA 4E2QA 4K1ZA 1SMVA 2IXLA 4LPLA 1PZ8A 2I07B 2JG9A 3ECQA 3TEXA 3MHZA 4L92A 1KDMA 1BEV2 2WBKA 4BMEA 1W8ZA 2O8OA 4MXWA 2OQ7A 1VBA1 1ZRDA 2VMIA 5I0RA 2FZ2A 1LOFC 2D6KA 3VD4A 5LY2A 2FDJA 5L9VA 4XZPA 1XJAA 4U2AA 1MACA 2E33A 1HRI2 5FZ8A 4XFGA 5FZFA 4A45A 1VBB3 3ZFGB 4IE6A 1VBC3 3WP5A 3HAGA 1RMU1 1GP6A 4DUVA 2C5DA 2P6CA 5C9AA 2VXRA 3QBQA 2WFF1 4MHUA 2DTYA 3FJSA 3MIBA 4C0HA 5T5JA 3WG2A 4LT5A 2A3WA 1NG0A 4D94A 3AVRA 1OMIA 1F31A 5ACA3 5C4WA 4FPFA 3HNMA 4K8FA 3CKHA 1HB2A 1ULOA 2PAMA 2R49A 4O9GA 4HETA 4LBMA 1LHNA 2KA3A 4XMIA 3URFA 1K3IA 3B69A 1F9KA 2XKOA 5LBCA 2BRTA 3PVNA 2VW0A 3Q8CA 3U4XA 3ZSLA 2JDMA 4CZSA 4YM3A 3AXDA 5JXIA 3PVOA 3AZXA 4GMP0 2ZGSA 4XTMA 4YARA 3N7KA 4B8EA 4CXWA 3AYEA 5EJ1B 2VMEA 4TTGA 3BPSA 3UT0A 3N9NA 3LOIA 3WNLA 4LK7A 1W04A 2DBIA 2BFUL 3L9JT 1WLDA 1IS5A 3BB6A 5BYNA 3SKJE 1GWKA 1S2BA 3H42B 4XYXA 5FLJA 4L97A 5LBFA 1XE7A 1W9FA 2OT7A 4KMQA 2Y0OA 3NNJA 2JX9A 2X09A 3WW3A 4JVAA 2IWGB 1A78A 3MBWA 3M2MA 5F2SA 5LK7B 2JDKA 5F3CA 1YQ6A 2W94A 4QXHA 1R1A2 2VUJA 3WNOA 4M00A 2JDZA 1HDKA 1LU2A 2ZMNA 4I02A 2MNGA 2Q8CA 3WV6A 5DG1A 2VECA 3FHIB 5FYZA 1POV3 3NQHA 4UW5A 3VDBA 3V0BA 1HQLA 2WQ4A 4XFAA 3IM0A 1RUE1 1F5JA 1REFA 2AZ5A 4Q0QA 1EV13 2A6XA 1PZ9A 4QX1A 2IXHA 3V56A 3DKQA 3W58A 1KDKA 5FPAA 1PK6C 2D3PA 3GBWA 3J7MA 3OEBA 1IPJA 4ZKTB 2GSYA 1ND3C 3M3QA 3MI8A 3N9MA 1TME1 4YVSC 5FZOA 3TB0A 5C7GA 1E5RA 1QOSA 1YJKA 3JD71 4X8NA 4CEYC 3V0AA 2BUKA 5A7PA 1CQ9A 2WZR1 2XUMA 5FO9B 2IXJA 4FXKB 3U10A 4FP3A 1IKPA 2P3KA 3DYMA 1TMF1 2R043 4W6WA 3LGRA 2E6VA 1JZ6A 2W95A 2FCTA 2VNRA 2BNMA 2EXJA 1I1EA 3K51A 1UZZA 4FQ4A 5JSPA 5K7PA 5A33A 1GQGA 3WT3A 4YSFA 4H14A 2RS11 4DUWA 4OI4A 1EAH2 4GAZA 2R073 4P00B 3RMYA 1VAMA 3JXSA 2JEMA 3N7MA 3POWA 2QQWA 4FI9A 5DZGA 2Y6KA 5J48A 3H8XA 1R081 3RQ0A 3LPGA 2Q1MA 4UWDA 1YWKA 2XJSA 5FY4A 3LEIA 4DXZA 3IDCB 4X6RB 2YGLA 2NZ9A 4RQPB 5JR7B 3W20A 5F9TA 4DZGA 1UF2C 3NAPA 4CDWA 1YRZA 5LZ6A 4UYBA 5A7WA 1AR91 2A75A 1N1YA 1YQ5A 1YQ2A 2DVDA 5BNNA 4WM7C 2RDNA 3ZMOA 3H3ZA 1NXMA 3OCPA 1ZBE2 2VOWA 5LEJA 1WA4A 3IPVA 5IWFA 1ULFA 2LW8A 1OHFA 1W6QB 3PIGA 3SMHA 1OXCA 1WW5A 3OBRA 4IGOA 1IQDC 5AC93 3UJOA 4P5YA 3CMGA 4COZA 2WLPA 4A6SA 3GXUA 3KWVA 5C8CC 4FTEA 4QGMA 1E5SA 4A3XA 3OUIA 4RR3B 1AX2A 3C7GA 1KQRA 4YVWB 4EN7B 4EWDA 3FFQA 4XIKA 4AI8A 5B4NA 2I45A 1UOGA 1QJEA 3I3BA 4MZUA 4COWA 2BOJA 1OOPA 2WAAA 1LOEA 1RJ7A 3ZOIA 3I59A 2Z79A 5ANQA 5E6HA 1BEV3 1OFSA 1DF0A 4J1XA 1BZWA 4P14A 4HKLA 5K9YA 2PQSA 5K8SA 1WCKA 2VZ1A 1FNYA 2YG0A 3WVJA 1EY2A 2MPFA 2WWUA 3SEEA 4ARXA 1HRI3 1DGWA 3O7OA 2VCAA 2FQPA 4MGTA 1H30A 3OEAA 3R4SA 4Y33A 1W8NA 4NPLA 4CVUA 1Z7S2 3N35A 2WNUB 3FL7A 3IIAA 3POYA 3NV2A 3I2JA 1N1TA 4I0WB 4WV8A 3TN92 2JECA 4LBNA 3KQ4B 5FBZA 4B4QA 4K1YA 4LBQD 2C26A 5JMOA 1AF9A 3HNBM 4AEDB 4EJRA 2D3RA 3D6EA 2XUEA 1RUC2 5CU1A 1UNBA 2V5YA 3KD4A 1O8SA 4A44A 2RS32 4JTOA 3UGFA 3ZXLA 2GAUA 3Q8EA 2ZGNA 2W91A 5KXBA 1I5ZA 1UYYA 5CB7A 4NIAA 3O1PA 2GNTA 4PF1A 4NAMA 2EA7A 1QJX1 2VCBA 2R16A 1W8UA 3OYWA 4R9AA 2BVVA 2VU9A 3FMGA 2XONA 3ACLA 5F6LB 1XB9A 3LCPA 5JSRA 5CISA 1LJ7A 2WNVC 1L7RA 4OUSA 4MHRA 4QXKA 4XFHA 1H8TB 2BBVA 5JWPA 3NJVA 3QH6A 3LSEA 4JQTA 2PAEA 3OBTA 4QAWA 3ZLIA 3VDCA 4Z82A 4QX2A 2ARXA 4EWEA 1CX4A 3ATGA 1SBEA 1KJRA 3CO2A 4A6OA 1E57A 4MLOA 1EUTA 3WUCA 5AFBA 1X9PA 1NQJA 1H4HA 4TLGA 4CCMA 1U5XA 1PO12 1H9WA 1PM7A 2ZEXA 1R1A3 2CDOA 3ETQA 3H1MA 3H1WA 2ZX2A 2G4IA 4IE5A 4PDWA 5KHKA 3TBDA 2VD7A 2R1DA 5L9RA 1NZIA 4FFGA 1O91A 2IXKA 3MICA 2CAUA 3C7EA 1PX3A 1OT5A 5FZ9A 1S4CA 4H55A 4MGIE 1JOBA 1R092 4AFDA 2X10A 2JICA 1VBB1 2CWSA 2WIIB 1VBC1 3H8UA 4QHOA 5CEHA 2VOXA 4MGYE 3K3NA 4D6SA 2ZX4A 1QIQA 2W0XA 5KWRA 2VOKA 2ZGLA 4FAHA 4IE4A 4BXSV 1BMV2 1W6PA 4XC9A 5ACA1 1G86A 5JPNB 1WUVA 2EAAA 4XDQA 4A7KA 1IKQA 2WNEA 1HJGA 4OI0A 3VBOC 4RD7A 3B93A 5FUNA 1Q8QA 5HBAA 3BUCA 4C90A 4E2SA 1LOFA 4JGZB 3F95A 2R7EB 2Z2SB 1J3QA 4OYUA 1M4WA 4NIDA 2VW2A 1EAH3 2A3YA 3FN9A 4QPGC 2D97A 1ULCA 3PVEA 3WNNA 5ABJC 2DCKA 1VBE2 1WW4A 5FKCA 5FAXA 1CONA 1XYNA 1YNAA 3K77A 3P1IA 4XF1A 1LOAA 1N3QA 4LULA 4NR1A 5F5IA 1K5MB 1H1IA 2VNOA 4AR2A 4BA6A 3AKPA 2GMPA 2EIDA 4C91A 4TLFA 1ZBE3 3A0KA 2BWAA 2KD7A 1CX1A 1Q8PA 4CCOA 1XNCA 3IIIA 4A42A 5E8AA 1POV1 5C3PA 1IGOA 3RZMA 1G8WA 1WLTA 4E8DA 2PN5A 1PO22 3ACHA 3DUIA 4IEUA 1RIRA 2XR4A 4HL0A 3N36A 1RGSA 2F17A 4HN1A 5T52A 2WO2A 2P3JA 3GBFA 2WDBA 3VBHC 1AX1A 4FPLA 3E6DA 4RS5C 3D0JA 1T6GC 3E97A 1J84A 2WO1A 1J1LA 3LSDA 2FBEA 4N53C 4KWLA 4Q4X2 4Y20A 4AK3A 2RJ2A 5JOXA 5FUIA 3CDZB 1OLME 3M1HA 5GZEA 5IVYA 5FQ0A 3MDPA 5GLVA 5A7OA 4BZ4A 2CNAA 4PI2A 3A7QA 2J7MA 3ROUA 5CG9A 3NNFA 5FYHA 3D5OA 4GH4C 2WAOA 4AVAA 4MXWB 5CKQA 1W6NB 5KHIA 1IQAA 4NN0A 3J7HA 4XIOA 1FAYA 3CQOA 1BBT2 5DPNA 3RZHA 1WWYA 2V09A 2ZAAA 3S7IA 1Z7S3 1ALYA 1YQ8A 2D5HA 4YW1A 5GALA 3VDDC 1SG3A 5KR7A 3TN93 5FWEA 4JDOA 3HEIA 3ZX7A 3SEPA 5FYBA 2HBUA 3KF3A 5KC6A 3IBMA 2V5DA 1V9U2 4IESA 1QOOA 3CJIC 4LO5B 4QQ2A 1PK6A 3ZIXA 4RL7A 4P9LA 5FY8A 1UOJA 1ND3A 2RS33 1CWPA 1PMIA 4CEWC 3SQOA 2TEPA 4XW3A 3T0DA 3ZPYA 1F4AA 2P4EA 3AFGA 2WINB 3DKWA 3WCSA 5C4WB 1OD3A 5JIUA 1ZBA2 1XNAA 4AWDA 1HXS2 3KV6A 4Y5SA 4KGQA 1QHDA 4DRVA 2UU8A 3T4HB 4GALA 2P37A 4BLJA 5GZDA 1UO9A 5AC91 4XJ9A 3WQBA 1Q56A 3PUQA 4R4XA 3GHMA 1VAKA 4Y1YA 3WG1A 3WHUA 4HPKA 3BN6A 1BLZA 4QX7A 1KXGA 1QXPA 1YXWA 2W87A 2BGOA 2XPJA 1SLBA 4YGEA 2GN3A 3NNLA 4BQ2A 3MF6A 5A6QA 3WQ1A 1QJY2 1VIWB 2AENA 4KBZA 5CFDB 1JYCA 3RZJA 4JZRA 1BEV1 1CIYA 1PMJX 1PO13 5FZ1A 3WF1A 3IN9A 4BHPA 3WY6A 2VUCA 2EXKA 2QCSB 5FP9A 3R6SA 5FLIA 4WM7A 3JB8A 2DVAA 4XETA 5SV5A 5A3TA 1D4VB 4PIZA 3T08A 3KHBA 4FPHA 1MVEA 5FZMA 3UNPA 1K42A 1VRH2 1R093 1DQ2A 3MPPG 4JKMA 3VBSB 1LB2A 2HBTA 5FZBA 2UWAA 4HK8A 3V0BB 1DQ5A 1LKNA 3GALA 4LORA 5I8YA 3NV4A 4CA9A 4FPYA 2R32A 1D2QA 3I2DA 2HWF2 4OZXA 4YWAA 4W6YA 1Z0HA 5C8CA 2ZGUA 3RWKX 4Z1VA 4R4ZA 1UW8A 3KT4A 1W99A 2ZPXA 3BIWE 1GYKA 5FZOB 3WF2A 1DGRN 5GLTA 3O0XA 3V0AB 3KV4A 3T2QA 3IMMA 4R9DA 1W90A 4RHV2 4WZFA 4RQPA 4YW4A 3SH5A 5IAXA 1W2AX 3AP7A 2QQJA 2FCVA 2ZKNA 3VBFB 2OW4A 4D69A 3EQEA 4HKWA 1DLLA 1DFQA 2ES3A 3USUA 4WBBA 1REDA 2LALA 3VZJA 4B7EA 1XNBA 5A33B 1CPNA 3AYAA 3WP6A 1W9SA 1F35A 1ACCA 1GZCA 2D6OX 4Q4V2 3VKNA 4CDXA 2B8MA 5BNPC 4NWVA 1X8MA 5FZ0A 3B3QE 5IVVA 4SBVA 2GDFA 3ES4A 1KGYA 2Z5WA 4FO9A 4LBJA 5CA6A 2W9XA 1HRV2 2PHUA 5DQ0A 4QQHA 3NAPB 5HCBA 3PMEA 5JI7A 5A7WB 3AL6A 5T55A 4Y5TA 1XC6A 4CDWB 2QDRA 1QH6A 1V70A 4QGLA 1R1A1 4AGRA 4PBPA 5BNNB 3GZAA 1WCQA 5CIRA 3ZFFB 4LO4B 5F5AA 3IPVB 4HKOA 1GZTA 3TWIA 1PO23 4C8DA 2NYYA 2W46A 3HN1A 3N7LA 1OSGA 3OB8A 4QXCA 4IGPA 5L7OB 1PNFA 1ZNPA 2RV9A 4GWIA 1OPMA 1C5IA 1OKQA 3KT1A 4QGNA 3TRSB 2VMHA 4ZU7A 1FOD3 4D3WA 4Q4X3 3WNKA 2WNUA 3LIHA 1H6YA 3VDAA 2QQIA 4UFLA 2GH8A 2J1TA 2GP3A 3MF9A 5LBBA 5F3GA 1AYM2 1OOPB 4OFGA 2WQ8A 5FP3A 3I59B 3VZMA 4CDQC 3VZOA 2J1SA 2WZEA 3GF6A 4O7XA 4PQQA 2AEYA 1TZOA 4GB32 4ASLA 4W6XA 3OUJA 4AFMA 3IWZA 1SQ4A 1BBT3 1QEXA 2VQTA 3VLBB 4A41A 5CNAA 3T2TA 4URAA 2E7QA 2D7FA 2ZX0A 3I2IA 1EAH1 2CU5A 4M3CE 4NRMA 3VBUC 4DEVA 5FV3A 1IZ3A 1QNWA 4Q8KA 4DO0A 4AI2A 5E16A 4XXAA 1V9U3 1X82A 3SCGA 3SISA 3WW4A 1GOHA 3I2KA 5FZ6A 2WO7A 3RZKA 1KITA 3PLQA 2VMGA 3ZYIB 4YFZA 4NHYA 2DCYA 3UKNA 1OFNA 3RZLA 2B9VA 4OZOA 5FYIA 4BPZA 5FZHA 4FSJA 1DQ0A 5JIAA 1ZBA3 1JS9A 4QXBA 3T4VA 1UCXA 1ZBE1 1HXS3 3RI8A 1V6LA 3VBOA 1Q8OA 1UKRA 3DF0A 4OUEA 4Q1PA 5C3RA 1JZ4A 2HWC2 3GCWA 3OYWB 4GIQA 1UPIA 4QMAA 3HMYA 5FXVA 1Y9QA 3ZYBA 2XH6A 4QPGA 4AYUA 1I9RA 2HWE2 3J7NA 4HLTA 2B45X 1HJFA 1Z78A 3UESA 1UPSA 4M4PA 3DGTA 5A7NA 1QJY3 5F37A 1ULGA 4CSWA 3IAQA 1VE0A 1O3SA 2X5IC 3I49A 1I3HA 4O9EA 2X53S 1C1FA 1YUDA 1LGBA 3C8XA 2CSGA 1ZX5A 1WKYA 4Y3OA 2F4LA 1NQDA 2VBDA 2Y38A 4PDWB 3LFIA 2D98A 1XSRA 4JHTA 3G6JB 4NRPA 4OHXA 4LOTA 2XQRA 5C3OA 1VRH3 1NXD1 2FMDA 3VKFC 4KWKA 3OBAA 1N3OA 1JXNA 2XKPA 1Z7S1 1ZZBA 2D44A 3AZWA 3QOPA 3GGLA 1VRBA 3ITQA 3ZSMA 2Z69A 3NO8A 5FP4A 3TN91 4BQ5A 2HWF3 2DCJA 2QFEA 4ES9A 2ZGTA 2ZGKA 4Q4W2 3N3HA 4Y5Z0 1APNA 3BU0A 2P3YA 1RUC1 2UYAA 3VBHA 4B7KA 4FTBA 3VBRC 2VMCA 4RS5A 1TNFA 2XJRA 2RS31 1YFWA 4FFIA 4AI0A 4N53A 1ZA4A 2R072 3LEGA 3WEZA 2QQPA 1H8VA 1B35B 5DDJ1 3GBGA 3FHQA 2ZJCA 4GJZA 4MOAA 4RHV3 4XBLA 4MUVA 4UT5A 5A7QA 1ZZCA 1LECA 3AKQA 4MGKE 2H0VA 5T3NA 3WUDA 4CP1A 5A1AA 2WLQA 4LKSA 1MS3A 3Q8AA 4GH4A 4TZDA 2GC2A 1PVXA 4UBGA 4UAPA 4QB6A 1X7NA 5JZGC 3M8LA 1GICA 1UY2A 2W47A 1H2NA 1O8PA 2WS93 1S55A 4Q4V3 4YM0A 3VDDA 4OCTA 4XFFA 1GZ9A 3X29B 1UN1A 2G19A 2ZABA 5EJ3A 1A6CA 1C8NA 1SZBA 4LHLA 2FDHA 3CJIA 5FP7A 1HRV3 5A70A 1OLRA 3VKMA 1QDCA 3T2PA 1AUYA 2XVLA 4KG0A 4XILA 1DYOA 3POEA 4CEWA 3H7YA 1PO11 4YG0A 4DIQA 2L9LA 1VB2A 2Y6LA 1ZVFA 2A5ZA 2A6YA 1B35C 2JB8A 3G7DA 4ISQA 3VGIA 3NJYA 1UL9A 2QTWB 4C1XA 4MV2A 2EXHA 3P3PA 2C4XA 3GJAA 4M0NA 2BW8A 5EP9A 2A6WA 3HIFA 2WR9A 2ZHMA 1RYYA 4KNCA 1W6NA 1NA1C 2ARCA 2YC0A 2VOTA 3PMSA 2GALA 1D4M2 4L2NA 1XRUA 2WUHA 5C3SA 3EB7A 3PUSA 5A80A 2WT2A 1W2OA 2HEWF 2DCTA 3UYJA 5BY5A 1JN2P 5LBEA 2G9FA 1AYM3 3ILFA 4Y20B 3UL2A 3Q8BA 3N9PA 1VMJA 4HBNA 4IL7A 1RUOA 5J96B 1E5IA 5FQ0B 3KCCA 1LESA 4AGGA 1PMHX 4GB33 2OPWA 2PA7A 3J4UH 3M4FA 4RGGA 4QDSA 3RPQA 4BK5A 4DUXA 2HEVF 1UQXA 1ZZ9A 2DU1A 1XYOA 1JYNA 3WF0A 5JMCA 4BLIA 1KFUL 4I09A 1C8M2 1CJPA 1EP0A 1L7QA 3ORJA 1VBE1 3BYWA 3FX3A 2VZOA 4AHYA 3HQXA 1YFXA 1SFPA 1UX6A 1VP6A 5FMDA 5JXHA 1UMIA 3EJKA 2WQZC 4JRLA 1SCSA 3N4MA 2Q8EA 4CP0A 4D8MA 2RS52 5JOZA 1FATA 1PK6B 3O5SA 2HYKA 4BWOA 4AHXA 4CCNA 3PURA 1ND3B 4YVSB 1SLLA 1D2SA 1TEIA 4QB2A 2VL4A 3OY8B 4NE9A 1RVF2 3FC0A 4CEYB 3Q8FA 3NJXA 3VZKA 4YZ1A 4UFHA 3WDTA 4ITCA 4AXOA 3PVBB 1G6NA 2HWC3 4P02B 4CRQA 3BI3A 2JG8B 1PO21 1JU4A 2ID4A 4WM8C 1MS9A 1L7LA 3AX4A 4FPEA 4BK4A 3R0RA 2VZSA 3UGHA 4ZU4A 2HWE3 2X8KA 2EIEA 2W39A 4BIOA 2P3IA 4HPKB 1GV9A 3VBSA 4E2GA 3SCHA 1HB3A 5EXOA 5BNPA 4N7UA 4KI5M 1IPSA 1OH4A 1UX7A 2D3SA 4Q4X1 3VZLA 5GZGA 5LA0A 3WINE 1U5YA 3NNMA 4E27A 1Y43B 2PFWA 3AK0A 1A8MA 1AX0A 1YI9A 4KH9A 2B4KA 2VC9A 5EFUA 3ZSJA 5DZEA 2JXAA 2VVEA 5FR3A 2J22A 1NUKA 4JCKA 3ZSEA 4CU8A 4HSLA 1UY4A 1JHNA 4WM7B 2E31A 5EYYA 3SXWA 1BBT1 4ZU5A 3CBNA 3DECA 3HQUA 3AM2A 3JU9A 2NM1A 3EBRA 2DUOA 2JJ6A 4LHNA 2VW1A 1PZ7A 3D4KA 4HFSA 5FY0A 3VBFA 2RMU2 1Q43A 4W50A 1M06G 2JG8C 2J1EA 1RXGA 3PIJA 3KVAA 4NROA 4Q4W3 5CKNA 1UMZA 3POJA 5FPLA 2GZWA 3KVBA 5EQUA 2C9AA 1V9U1 1V6KA 1V6NA 5FO7B 2XJQA 2YMZA 2YU2A 3PUHA 4Y24A 1GMMA 5C8CB 1PVC2 3POGA 1N1SA 2ZGRA 4EV0A 3IDBB 1OLMA 1SLIA 2C6SA 2WZ8A 3D8CA 3MW4A 5A3WA 4LE3A 3WCRA 4UI9L 3O0VA 4P9WA 3U4SA 3BOPA 4GWJA 1ZREA 2BZDA 4FOVA 1ZBA1 2CGNA 1SPPA 1HXS1 5GM0A 4CCLA 4CDQA 4XOGA 4Y26A 4AOCA 2VJXA 3AL5A 1UYZA 4QPWA 1QQP1 1TVGA 2W3JA 4D0QA 3ZFFA 4DPNA 3J8F2 3MIEA 3USUB 1JYIA 1CAXB 2DWRA 1LODA 3T3YA 4QM9A 2A70A 2H0BA 4CDXB 1A34A 5FZEA 1LR5A 1QJY1 1RUD2 1W28A 1NT0A 1UIKA 2E9QA 5F5CA 4HANA 3N9LA 3CF6E 4EE2A 5IHRA 3AXEA 3B01A 1LHVA 5F1RA 1VR3A 3GZUC 3TEWA 2QE3A 3EO6A 2QBXA 2YBPA 2QZ3A 4JHZA 3ZIWA 5I91A 1QXRA 1ZZ6A 3KHCA 4QHBA 2IC1A 4OQ9A 3TEYA 4YW2A 1VRH1 1IHMA 2VQUA 1KS4A 4PJYA 4XE9A 1E5HA 1OLQA 2C24A 3KV9A 5EV7A 1NCRC 2WWJA 3NRUA 4H2AA 5CFDC 2Y60A 2JE7A 3ZYHA 4EWAA 1QU0A 3CJXA 4LIVA 2WT1A 3NW4A 4XABA 2HWF1 3H8OA 1D4M3 4YPJA 4NJ4A 5A3MA 2LUWA 5LA2A 2WNVB 5I8TA 4XF4A 2O0OA 2ZTNA 5FKBA 3K3OA 1W6MA 3RJ2X 3OPWA 1DZRA 3NKTA 4LITA 1OA2A 1HV1A 2X5IA 4EN0A 1B09A 2EVXA 2G9ZA 5J98B 4RHV1 4EROA 4F3JA 4PT6A 4AZZA 3U37A 2VPVA 4IEOA 5F2WA 3AKSA 1OI6A 3OD4A 5EYXA 3AP5A 3KCXA 2AEZA 4JTNA 4FTSA 4BQ4A 4OMDA 1C8M3 3WD5A 3M3IA 2FMYA 2P1BA 1JTZX 3VUOA 2JDAA 2A71A 4LR4A 3J26N 4XFBA 3JB4C 4Q4V1 4XCBA 4LIUA 4ZPIA 5FXWA 5T5LA 3A0NA 2ZA9A 3KSCA 4QKFA 4QQLA 2IVJA 1CD3G 1V6OA 1CESA 1GR3A 2RS53 2CDPA 3LA2A 3RI9A 4X8PA 3SKVA 2V4AA 1FYUA 5FZDA 3ZXFA 4CU6A 3VBRA 3A21A 3MW3A 3U11A 4GULA 3KGLA 4LK6A 3UKTA 1RVF3 4P9YA 2FD8A 1Q3EA 4KG8A 2VVFA 3WHTA 5DAXA 3ZFEC 1QXJA 4PLOA 3HNYM 4V2VA 2VZUA 4CDUC 2BFUS 1AYN2 5DAVA 3T1LA 5T54A 1W0NA 3VBOB 5C71A 3MZHA 3DPRB 2RJKA 3THCA 3ZXKA 3RZGA 3V65A 2BERA 4LO7A 2ZKLA 4K21A 2WKKA 2WT0A 1XNTA 3I7DA 5LK5A 3ZSKA 5JZGA 4C1WA 4MXVA 1ASJ2 1UKGA 2DUPA 2MEV2 3UGGA 3THTA 1JYXA 3U0ZA 2D5FA 1CAUA 4JC1A 2HJIA 4QPGB 1XPWA 5T5PA 4DXSA 1UZ0A 1D0GA 5ABJB 5FZIA 4BCUA 1CAWA 3I3MA 4QX0A 4YW7A 5FOBB 4XDOA 2ET1A 3QACA 1J3PA 1RUG2 4E4ZA 2IXCA 1AYM1 1GP5A 1BVVA 3I2HA 1WCSA 2WC2A 1A3KA 5FYYA 3NWKA 1W6OA 3P6BA 1JZ5A 5KBFA 1AR72 2BVBA 3M3CA 4GB31 4ZHNA 3SLIA 1B35A 2O1QA 4XF9A 5DUWA 2CGOA 4XACA 1QY4A 3U78A 2JKXA 3WQ0A 3POSA 1WLWA 5GLUA 3IT8A 1CJDA 2RMU3 3ES1A 1QJU2 1RUF2 1Y4WA 2UWCA 3DPRC 3RYKA 3L2HA 1CN1A 4KU7A 4M3CF 2DCZA 2YROA 1NA1A 3PTYA 2ETEA 4LMFA 4V1PA 1PVC3 4Q5OA 3PUAA 5IVFA 3H8RA 4BE3A 4DY3A 5CVRA 1MR5A 1TQ5A 1OF3A 2VNGA 3VBHB 5DAWA 5FPUA 3B9CA 3USSA 4RS5B 1U12A 2GN7A 4N53B 2ZCWA 4EZHA 2DYCA 2UWBA 4P9JA 3O1SA 5LA1A 4NWWA 1NOVA 5JAXA 3CU7A 3VD5A 2HYXA 4KU8A 3AFKA 1JU3A 1UU5A 4GH4B 2XWJB 3J8F3 1BQPA 2QQVA 3MLLA 4M3CA 4ZS2A 3WDWA 1QJZA 4WZCA 3HPNA 4DB5A 3OOXA 1RXFA 5IVCA 1GLHA 1TE1B 3UKVA 3A23A 1QDOA 4IETA 5FZAA 3ZVXA 2JDNA 3VDDB 2VQ0A 1DHKB 3WNPA 1RUD3 3SH3A 5BNOC 3ASIA 2X05A 4LOSA 3AP4A 1NKGA 4HSJA 2BJSA 1O3TA 4XHXA 1POV0 3MYXA 1EV11 3CJIB 1Q8SA 3AP9A 2JWPA 5C6CA 4W8JA 1UZYA 1JOJA 3I4IA 2NMOA 2BQPA 4Y1XA 4CEWB 2KM2A 2YY1A 1FOD2 3WNXA 1XXNA 1CIWA 2AC1A 1FT9A 4OI2A 3S57A 2QNKA 1BKZA 4TYSA 1ENXA 1J59A 2VTXJ 1O5LA 1MQTC 2PTMA 4Q0VA 3VHPA 2IZWA 5FXXA 3AKRA 2ZXQA 4XTPA 1SHWB 1HKDA 3RYRA 4QKBA 1DDLA 4XDPA 1UD1A 4YRDA 2YB7A 2W92A 4I01A 4X6QB 5IK8A 2XJTA 3W21A 4WM8A 5H9SA 3B9IA 2R041 2G1MA 4FBFA 1W8WA 4Q4W1 1YIFA 1FMD2 4QKNA 1NLQA 3JBG2 3BVCA 4QDRA 5D8AC 3K4AA 3PNAA 1QF3A 5JCTA 2VOVA 2WL1A 4MADA 1JZ7A 3VN4A 1WA6X 5M0TA 2WSUA 1AHSA 1GU3A 2ATFA 3F2ZA 3KB5A 4FPCA 1LU1A 4BQ1A 2R071 4CUCA 3MIDA 1T6BX 5APAA 2D6MA 4QQPA 3AP6A 2WFPA 4CPBD 2YPJA 1MZFA 5LASA 5GJ6A 3WW2A 2X29A 1MVQA 5IW0A 1I5PA 1YHFA 2B39A 4U36A 4YVSA 4RFRB 3OY8A 1AL22 4CEYA 4A7YA 5FYMA 4YG3A 3C3VA 3ZYFA 4AQSA 1AZDA 3AMMA 1Y9MA 4IV1C 4UOJA 1PGW1 3TYJA 4K40A 1DLCA 4IEYA 4V2WA 1XSQA 2QKDA 4BQYA 2JG8A 3QLQA 2VAUA 5J3UA 5LATA 3ZXEA 4BH9A 4LNVA 3HR9A 1DYKA 4EN9B 3B02A 5C5TA 2VY0A 4XBQA 3HD8B 1GZWA 3T1MA 4IQPA 2VZTA 3ETPA 4FAGA 4XPVA 1O4TA 1YIPA 2XQXA 4OQ8A 4MSVA 1W3XA 1AYN3 1GQPA 1LNSA 1DQ1A 4YNIA 3DYPA 1US2A 1UOFA 1NAEA 1MS1A 2YDEA 1H9PA 4YZ4A 4ZS3A 2OYZA 2JIJA 2ZEWA 1H2MA 5B2GB 5AVAA 1D7PM 4YM1A 5FY7A 4N7IA 2OXBA 4JDMA 1AR92 1ASJ3 2Y34A 2MEV3 4KQ7A 4AQ2A 4P08A 1IS6A 1DIWA 4TSVA 1UU6A 4JX0A 4XHBA 1D4M1 1HRI1 3ALQA 1RUG3 1P8JA 4AQ6A 2GH2A 4K6BA 5BNPB 5FTTC 2A6ZA 2WYFA 2HWD2 4BYYA 3M3EA 1FPN2 3W5MA 3AJZA 5CBLA 3IMNA 5C9AC 1AR73 3FLPA 3OPZA 4XMAA 4QWNA 2NQYA 2LM3A 3ZKYA 1FV2A 2GC1A 1EYBA 5FMOL 1SBFA 2OUJA 3B00A 2DF7A 1K45A 4A2UA 4YZ2A 3OGJA 4D7YA 5LWBA 4DOUA 1QJU3 1RUF3 3GNEA 3Q9OA 4Q0UA 4XUTA 4YLZA 2A6VA 1ULDA 2FHRA 1NCRA 5CFDA 5IVJA 1LOGA 4LUMA 2ZHLA 1ZM1A 1DBNA 5LRSA 3ACFA 1CZTA 3KM5A 2P6HA 4TXWA 3BIEA 1CAXA 1UXZA 4K20A 2EF6A 3IKWA 4H7MA 4KWUA 4AAPA 4NVPA 1S2EA 2WS92 3WOGA 4UW6A 1RMU3 1RVF1 5FZ3A 2OX0A 2HWB2 2GU9A 4IE0A 4JDNA 3O1MA 5TSWA 5HV4A 4KL1A 3MPBA 4TWTA 1SPPB 1UOBA 2BOIA 4IGQA 4CDQB 1F8VA 1H2LA 1W06A 3IDEA 3BKZA 3WF3A 1DGWX 4AEJA 5I8SA 4LO6B 3ZYRA 1OUXA 4RN5A 4GWMA 5ISLA 1W2TA 2JDYA 2P17A 4GMP3 4WVVA 4CCKA 5J1XA 3FLRA 2UY8A 1QNYA 1W9WA 2FDGA 2XB6C 1JOPA 1LCLA 2XL7A 4QPIC 4H7LA 1HV0A 3VBUB 5F3EA 3WXPA 1OURA 3PL0A 5IK4A 4K9SA 4PCRA 1JUHA 2EIGA 3ZM8A 4AVBA 5FRAA 2CAVA 1S0CA 2WNVA 4OVEA 5FMCA 2BNNA 5I0TA 4M0HA 2B42B 3U14A 4CP9A 2YPDA 4YW3A 4LXLA 4OMCA 2AACA 2V73A 1GP4A 2AR6A 4OUMA 3ZFEA 5F7UA 4CDUA 1W2NA 4M01A 1S0FA 1FV3A 3E6CC 3IAPA 4XUOA 3MV01 1R64A 5A3NA 5LW9A 2PXJA 2RMU1 3UK9A 1OKOA 1X50A 3W5NA 1GANA 4BISA 2VXJA 1XNDA 4XAEA 1FMD3 2SLIA 2EIBA 3JBG3 2YFZA 1T2XA 3LE0A 3U75A 4FT8A 3J9SA 4YGCA 1PVC1 1V0AA 3H1YA 4QX8A 4AG4A 2EALA 1D0HA 1W6MB 2ZMLA 4QM8A 2X5IB 3J7LA 3CL1A 3THPA 3C7FA 2ERFA 4F8AA 5GKAC 1AL23 4AI3A 2RR12 3M70A 3O0WA 4WVMA 3NV1A 3MLJA 3PUIA 4ORFA 2YFUA 5T5OA 4LBOA 4AAXA 1JYWA 4NIIA 2VO5A 3U1XA 2Q1FA 3J8F1 2W1QA 1OA3A 3LDKA 4IV3C 2OVUA 2XHNA 1V6MA 4BXFA 4ES8A 2Y6JA 5GZCA 3WF4A 3DPRA 4RA0A 4Y22A 3ZYJB 3VL9A 1X9TA 4FPOB 3K48A 3E5QA 1RUD1 1LEDA 1UXXX 3ZN4A 4AVVA 5DMYA 1CZSA 3MO4A 1HQWA 1MS5A 1LTEA 4YZ3A 1W8HA 4EN8B 4QHZA 2RDQA 3ZKUA 4HMZA 5ABJA 1S0JA 1BXHA 3VBRB 4ASMB 1GWMA 2I2SA 4XEZA 4LBLA 4D6RA 1R083 1ENQA 3FE5A 2CYFA 1XYPA 1ZZ7A 2BEOA 3BOWA 3DCQA 3VD7A 5HCHA 4DFSA 4MH0E 3O14A 1GNHA 4IUGA 3P3NA 5FREA 1S0EA 4QDQA 5FJHA 1AR93 1O7FA 2XLFA 1GUIA 2DV9A 1VLNA 5EJZB 5FBJA 5KXEA 1W05A 2ZGOA 3EHKA 1NLSA 4DQAA 5JZGB 4MGZE 4NMIA 3WZ1A 4B4RA 1QKQA 2QQLA 2O8QA 3EMRA 1F2NA 2A1XA 5H9PA 1CAUB 4ZONA 2BPA2 1CAWB 2K0GA 2YYOA 1GNZA 5BNOA 2HWD3 4P9XA 4GA9A 1FPN3 3GJBA 2Y6FA 4PI0A 1MPXA 3SHRA 3BODA 5I0UA 5LA9A 4QU2A 1DP0A 3FUOA 1W6OB 1IG0A 2D43A 2RE9A 4OHVA 5K0UB 4BM8A 1LULA 4NO4A 4Y1UA 2W1UA 3KS7A 4UFMA 4ONUA 3A4UA 5BPXA 5HPOA 4LJHA 4N9HA 2D93A 4XUQA 1MQTA 2XBO2 1JYTA 1XE0A 3C7HA 4LHSA 1Y3TA 4R52A 2RHPA 4FOWA 2WRAA 1RUNA 3HT2A 3AVSA 3HBZA 4R9CA 5E89A 1NY72 4QQOA 3BCWA 4CTEA 2VM9A 2VMDA 1ZA7A 2XL9A 1NA1B 1CPMA 1Y7BA 3H9AA 3LEMA 4HOOA 2K46A 2XDVA 2ZOEB 5D8AA 4AHWA 1OVPA 1WW7A 3RNSA 3KT7A 2HWB3 1SDDB 1LHWA 3LD8A 3VKLA 2YHJA 4S2GA 5CFCB 3ZPOA 4RFT0 4BOWA 3VZNA 2VZVA 4ATEA 3MW2A 2GMEA 3JQXA 1WD3A 3IDAA 1WCUA 3OBZA 5K0UC 1HQNA 5H9QA 4NPRA 1NCQC 3QH7A 2KXLA 1SLCA 3B5LB 1POQA 5G05L 3VD3A 5FXZA 4UBHA 1ASJ1 4FOQA 1AVBA 3LDBA 4GQ7A 2MEV1 4IV1A 4M3CB 5A7SA 1IG3A 4GKYA 5D21A 5KC5A 2XOMA 4N43C 1RUI2 5IFTA 1OQ1A 2VTXA 4IW3A 5KXDA 4ZZ5A 1OQDA 1R091 2J1AA 2Y6GA 3L2YA 1RUG1 5GLWA 2ZHKA 1G9AA 2VE1A 2VR4A 1UZVA 4I3PA 2TBVA 3LOBA 3K4ZA 5A3PA 2HLEA 1CR7A 1US3A 2XGXA 4XJUA 1AR71 2DFBA 3K2OA 5AFEA 5JR2A 3AYDA 1ZYBA 1BMV1 4ZXEA 2WN2A 2ZGMA 3I3QA 4G3YC 1XOYA 1QH7A 2B7YA 2CL2A 4NHMA 5CFCC 4NOTA 5L73A 1QJU1 1RUF1 5T50A 2PLV2 1LOBA 2B9UA 4CUBA 2YC4A 3OUHA 3KMHA 4WM8B 2JKBA 3WG3A 3QCWA 2XJUA 4MGQA 4DXRA 4CU7A 1JZ8A 4PIXA 4LEJA 1NX9A 5A6YA 1GSLA 1AJKA 2PHFA 2VUDA 1Q5OA 2LRPA 4PIYA 1EPZA 1OH3A 2E51A 3ZDVA 1CZVA 1RINA 5CADA 4LQRA 3M3OA 1XU2A 3BGAA 4UFIA 4JGYC 3TEZA 3TOJA 1O3RA 1C1LA 1PIV2 3ZR5A 4INDA 2RR13 2K2SA 4IDZA 2VQAA 3FWEA 1ND2C 5A1LA 1PGL2 4UF0B 5FPZA 4LBKA 1UMHA 5A32B 3VV1A 1O6UA 5L36A 1OQEA 4FPKA 4GMP1 5CAZA 4W4ZA 4HT1T 5FK7A 3H3LA 3TNPB 4BQ3A 5KHHA 4F83A
chains in the Genus database with same CATH topology
1OPOA 1ZZ8A 2PYTA 2Z42A 1QWRA 1VAVA 5IK5A 3KZ4C 2CY6A 2XG3A 1GZWB 1FOD1 3ZFGC 4JV4A 4OULA 1ZRFA 4FQZA 3ILRA 4L99A 2PHTA 4Q0PA 2D6PA 3UV9A 1RITA 1AXYA 1U5ZA 3AMHA 4E9KA 4XQDA 3ZO0B 4GWNA 3GHNA 1C57A 4Z92B 4Q4Y2 1FMD1 5KHJA 2DURA 1NE6A 3JBG1 4DS0A 3KGZA 3MGUA 1PHMA 1AR82 4QPIA 2WJSA 1NYWA 1KD7A 1F5FA 2HEYF 2OZ6A 5H9RA 1DZQA 3PJYA 3RWNA 2R1BA 4LE4A 2RM22 3ILNA 4IEQA 4L8QA 1G9CA 1IPKA 4XJWA 2Q1ZB 3U07A 3NJZA 3S0MA 1DZTA 1GBGA 2PHRA 4JRAA 1AL21 1AXKA 2ZACA 3ZN6B 2XBO3 4IERA 3W59A 4CYDA 2CV6A 2GC3A 3KLSA 1YYNA 4K3UA 1YFUA 3D0SA 2CWMA 5FCCA 1NCRB 4OLLA 5CFDB 2XLGA 4XJAA 3ZYPA 2CTVA 1H2KA 1VBD2 1X33A 1ZRCA 1XNKA 4IEZA 2NMNA 1YLLA 5JSOA 1RUJ2 3MFAA 4E4DX 5FLHA 3VBUA 2R062 4LBQA 1LHOA 4XQWA 3VHNA 1S2KA 4NHKA 2B5HA 2UYBA 4LLOA 3FBMA 3ZN5A 2GNBA 2JE9A 1BVP1 5HCFA 2AUYA 3SCFA 4UW3A 1JW6A 1RUI3 4IV3A 3JZVA 1RJ8A 4KWJA 1WD4A 2QDNA 3BPZA 2E63A 2OZJA 1O3QA 1H4GA 1CGPA 5GLZA 2ENRA 2HWD1 4IEPA 3ENRA 1FPN1 3WP3A 1MS8A 2ET7A 4COYA 3ZXJA 2ZGQA 1HX6A 1RHI2 2D40A 2R0FA 1WBLA 3DV8A 2K9ZA 4Z07A 4S2DA 4WVZA 4PLMA 1UIJA 3ZXAC 1XE8A 3ZFEB 2AREA 4CDUB 3CEWA 4RQPC 2PLV3 1CAVA 4YM2A 4EN6B 1SDWA 1S0BA 3R05A 1RUH2 3FLTA 1UAIA 5I0SA 3AMNA 1COV2 1FXZA 4H3WA 3RJRA 3SITA 4FOYA 2WS91 2VG9A 2ZX1A 1LGCA 2W68A 4YZ5A 2HWB1 4HVOA 1G9BA 1PIV3 1X36A 1G9FA 1ENRA 1MEC2 3WDYA 1HRV1 3S7EA 2H6CA 3OTFA 4RR3C 4YVWC 1SACA 5SV8A 4WVMB 3APBA 2RJLA 3VHOA 5DDJ2 4DY5A 3SH4A 4IXLA 1YJLA 2VUAA 3CNAA 3B7MA 1DGLA 2ZGPA 1RTVA 2QZ2A 1IOAA 4Y22B 4DRRA 4Y1ZA 5JVVA 1KFXL 1O5UA 5IT6A 2NPIA 4Q26A 4URTA 3AKTA 2WNUC 4AQTA 2D6NA 3WP4A 2Y26A 3R4DB 2PQQA 1WBFA 4AEDC 4AW7A 1DU3D 5K0UA 1AR62 4PBOA 2DFCA 3D82A 4B29A 1NCQA 2A7AA 4JQRA 4Q4Y3 5GZFA 4AI1A 1AR83 4D7TA 1YI7A 5C33A 4Q1RA 4N43A 4HVQA 1MZEA 3MIFA 4IEWA 4COVA 4PLNA 1G7YA 3GZTB 2UURA 5L7OB 1AL0G 2GNMA 2RM23 2ZHNA 2BPA2 2AGSA 4KBBA 1BK1A 2QUOA 3TNQA 4F7ZA 1SFYA 4COUA 5BNOB 1VBA2 3MLKA 3ST7A 4OHYA 4AFBA 2BYVE 3ME2A 2G9GA 5DG2A 2RR11 1DQ6A 1H8TC 1NLRA 1MS4A 4R9BA 2WA4A 5CFCA 1RMU2 4JAAA 4HZFA 4IEVA 2Y0IA 1MQTB 3VHRA 4AEKA 2WFF2 1EPWA 2HWC1 2OA2A 1VBD3 3JCIA 4YGDA 1DG6A 1KRIA 4BIFA 1MS0A 1RUJ3 4LTAA 4GXLA 5D8AB 5J7MA 1WMFA 2QVSB 2R063 2HWE1 2PHXA 4YFWA 1IS3A 2ZZQA 3ZDSA 5FFOC 5L7OC 1SBDA 2UY9A 4I0AA 4S2FA 4XQ4A 1DQ4A 5BV6A 2YUEA 4P5HA 1W0OA 4JGYA 4YW5A 2DUQA 4A7ZA 5JOYA 3N7JA 1S1AA 2ZZJA 1ND2A 1N3PA 5BXXA 1LRHA 1WMEA 4XJZA 2YV8A 4J1WA 3FUQA 4IV1B 3ZXGA 3NL1A 3WR0A 2ARBA 3RSJA 4Q2FA 3RDIA 3AMQA 4AVSA 3VL8A 4I30A 2EXIA 4JGZC 4L9BA 3LA7A 1RHI3 3EXUA 1W2UA 3AZVA 3LWCA 1S0GA 2R30A 1H0BA 2ZX3A 5F5QA 1A8DA 3ZFGA 3NV3A 5J09A 3BU7A 1C4RA 2XBO1 1RUE2 4OI1A 4FPJA 4N9IA 4AF9A 2JG9B 1VALA 2F4PA 3MIHA 1K5MC 1RUH3 2PHLA 1NY71 3E5UA 2PELA 1TME2 1JH5A 1I6XA 3HT1A 4DNYA 1COV3 1LOCA 3JD72 5A32A 1MZ6A 3R4UA 1URXA 1J58A 2WZR2 1UU4A 1DYPA 3H0OA 1WMDA 1YCIA 4OHZA 1REEA 2A73B 1TMF2 1RL3A 1MEC3 2ZS6B 1LHUA 5KHGA 4Q8LA 4YYOA 1RUC3 4FXGB 4Y1VA 5C9AB 5BUVA 3RRDA 1H1AA 1SLAA 2HKXA 2RS12 3HWJA 3AZYA 5BNQA 1C3HA 5DDJ3 5JLVA 3W9AA 1R082 3LAGA 2GMMA 3BALA 5HXVA 1RUI1 4AEMA 2E53A 2JG9C 1J3RA 1IS4A 3RS6A 2NN8A 1ULEA 3NKGA 5AVPA 1JBCA 4LA2A 5KXCA 1QQP2 3B94A 2DU0A 2GC0A 5D1IA 5LEKA 4FCAA 3LA3A 1TNRA 1WCDJ 4QD2A 4KGGA 4I0BA 4P9GA 1AR63 5FOJB 2XJPA 4FPGA 2IFRA 2PLV1 2OIIA 4LLFA 4Q0SA 3ZN6A 5C4WC 2P34A 4P9IA 1C8M1 4R8HA 3E5XA 4QPIB 2PHWA 1KJLA 2XHKA 3NSTA 3WDVA 5J36A 4UW4A 1VBA3 3AJYA 3FZ3A 4I2OA 4D7SA 2PHDA 2RS51 1PIV1 2BTVC 4I3GA 2BNOA 1SLTA 4Q29A 4AHZA 5IK7A 1YFYA 1PGL1 3LB9A 3FBYA 2AYHA 3LZZA 2TUNA 4META 2E7AA 2WFF3 3ZYGA 4XBNA 2YGMA 1KS5A 2JENA 3WDUA 3H7JA 3JQWA 3M7AA 3LKJA 3TAYA 5F6KA 4XXPA 3ELNA 2OUHA 3S30A 2PAKA 1AJOA 3BTAA 1U5IA 1VBE3 3PJQA 4FP2A 2VH9A 4GKXA 5DXDA 1W6QA 4LBQB 3VBSC 2WZPP 1ONAA 1QJX2 3I8TA 2EAKA 1HIXA 2XLAA 4IEXA 1AXZA 4LUKA 2WSVA 4OHWA 4G9SB 2XVGA 3WP6A 2ZAHA 3JUUA 1YO8A 3O12A 5DUUA 2C1FA 5JPMB 2Q8OA 2NP0A 4XFCA 3AB0A 5I93A 4RR3A 2Q30A 1XQNA 4YVWA 2ILMA 2XWBB 4L11A 2ZMKA 3OF1A 2W08A 2XJVA 4Q4Y1 4ZXKA 3RMXA 4AFCA 1AR81 1XU1A 2SBAA 3C2UA 2NLRA 4IV3B 5C8WA 3NVCA 5JOWA 1SCRA 4SLIA 4YGBA 3WQ7A 2OPKA 3SNMA 3VBFC 2RM21 2LTNA 2QJVA 5DUVA 1LENA 1X8EA 3QD6A 1G9DA 4W65A 4FVVA 2DVGA 2YZ4A 1OA4A 1QGLA 1GQHA 1GKBA 1LEMA 3OD0A 1V00A 5EZWA 4Z8BA 1O4YA 1WLCA 2B46X 1RUE3 1SEFA 4Q27A 3H3UA 5FDBA 2VULA 1VBB2 1VBC2 4AEDA 3UJQA 5E1RA 1BJQA 4B4PA 4LO8A 1CAVB 1HLCA 4ISRA 1TME3 3WW1A 2A3XA 3NAPC 4CDWC 3JD73 1VBD1 1CVNA 1O4ZA 2WZR3 5BNNC 5ACA2 4ATFA 3ZFFC 1RUJ1 2R061 3WX5A 1TMF3 2R0HA 3E6BA 4QX5A 4MYEA 4K7JA 2WA3A 4XFIA 3AMPA 2DVFA 2P2KA 1ZRRA 1SFNA 5FO8B 2RS13 3AYCA 2F6BA 3WG4A 1H8TA 4S2HA 5LRRA 3H50A 4HN0A 3V64A 4AVTA 3PHMA 3INAA 2JD4A 1OOPC 4AVCA 5L19A 2DVBA 2N7GA 4MX3A 1HW5A 1QQP3 3FFZA 3MEPA 2Q5TA 1QOTA 4C0BA 2DTWA 4AGVA 1PNGA 4RSUA 2GNDA 1RHI1 4N90A 3WLUA 4PF5A 1PGSA 5L7OA 3ZMNA 1RB8G 1QMJA 2I74A 2R6QA 5DZFA 1BCXA 2IXIA 4PQ9A 2VGDA 5EWSA 2VVDA 2Q0AA 3MFCA 1EV12 4HK9A 1LGNA 4J6GA 3RYPA 1RUH1 3DN7A 5HCAA 1DGRA 2XVKA 1BYHA 1NCQB 4LA3A 4QT6A 2ZBJA 2H6BA 2FZ1A 1R1ZA 1OD5A 3OGGA 4QPYA 4WVWA 1COV1 5E88A 2YXSA 1MZ5A 4NHLA 4B3NA 2E7TA 4N43B 1FI2A 1Q8VA 2BWCA 4DINB 5CG8A 5FMOS 1V6IA 1WGPA 1VJ2A 1S0DA 4XF0A 4G4FA 4JGZA 2R042 5HI0A 1W39A 1MEC1 2Q4SA 4AFAA 4MVTA 1ENSA 3S6PA 3ZXDA 2MHFA 1U0AA 4RGAA 4Z2WA 2WWSA 2AH2A 3I54A 1W0PA 1S0IA 1W6PB 4Y4YA 1VB4A 2C0ZA 4HVRA 3KQRA 1AYN1 3RZZA 4BMBA 1K5MA 2TNFA 1C28A 4YG6A 3KCYA 1JUIA 3RG0A 1H1MA 1C5HA 5JDBA 3DL3A 1J1TA 4PDWC 4AE2A 4CP2A 2IFWA 4DMIA 3OJBA 2W52A 1PGW2 1N47A 3AZZA 4E4SA 1FNZA 1QJX3 1NZCA 2D6LX 1NE4A 4XJ8A 3VKOA 1GFF2 4LHKA 5J37A 1N1VA 5DUXA 4JGYB 5AC92 2BGCA 5A3LA 1V6JA 3GYDA 3MIGA 4XF3A 1AR61 1L3JA 1RC6A 5FPXA 1FX5A 3CLPA 1WW6A 5IUQA 1ND2B 4UXAA 4E2QA 4K1ZA 1SMVA 2IXLA 1PZ8A 2I07B 2JG9A 3ECQA 4L92A 1KDMA 1BEV2 4BMEA 2O8OA 4MXWA 1ZRDA 1VBA1 2FZ2A 2VMIA 5I0RA 1LOFC 2D6KA 4XZPA 4U2AA 1MACA 1HRI2 4XFGA 1VBB3 3ZFGB 3WP5A 1VBC3 3HAGA 1RMU1 2C5DA 5C9AA 2VXRA 3QBQA 2WFF1 2DTYA 3FJSA 3MIBA 4C0HA 5T5JA 3WG2A 4LT5A 2A3WA 1NG0A 4D94A 1OMIA 1F31A 5ACA3 5C4WA 4FPFA 4K8FA 2PAMA 2R49A 4O9GA 4HETA 4LBMA 1LHNA 2KA3A 4XMIA 3URFA 3B69A 1F9KA 2XKOA 3PVNA 2VW0A 3U4XA 3ZSLA 4CZSA 4YM3A 3AXDA 3PVOA 3AZXA 4GMP0 2ZGSA 4XTMA 4YARA 3N7KA 4B8EA 3AYEA 3LOIA 2BFUL 3L9JT 1WLDA 1IS5A 3BB6A 5BYNA 1S2BA 4XYXA 5FLJA 4L97A 1XE7A 2Y0OA 2JX9A 3WW3A 4JVAA 2IWGB 1A78A 3M2MA 5LK7B 1R1A2 2VUJA 4M00A 2JDZA 1HDKA 1LU2A 2ZMNA 4I02A 2MNGA 3WV6A 5DG1A 2VECA 3FHIB 1POV3 4UW5A 3V0BA 1HQLA 2WQ4A 4XFAA 3IM0A 1RUE1 1F5JA 1REFA 2AZ5A 4Q0QA 1EV13 2A6XA 1PZ9A 3V56A 2IXHA 3W58A 1KDKA 1PK6C 2D3PA 3GBWA 1IPJA 4ZKTB 2GSYA 1ND3C 3M3QA 3MI8A 4YVSC 1TME1 3TB0A 1QOSA 1YJKA 3JD71 4X8NA 4CEYC 3V0AA 2BUKA 1CQ9A 2WZR1 2XUMA 5FO9B 2IXJA 4FXKB 3U10A 4FP3A 1IKPA 2P3KA 1TMF1 2R043 4W6WA 3LGRA 2E6VA 2VNRA 2BNMA 2EXJA 1I1EA 3K51A 1UZZA 4FQ4A 5JSPA 5K7PA 5A33A 1GQGA 3WT3A 4YSFA 4H14A 2RS11 4OI4A 1EAH2 3RMYA 2R073 5IK4A 3VGIA 1VAMA 2JEMA 3N7MA 3POWA 5DZGA 5J48A 1R081 3RQ0A 2Q1MA 1YWKA 2XJSA 4DXZA 3IDCB 4X6RB 2YGLA 2NZ9A 4RQPB 5JR7B 5F9TA 4DZGA 1UF2C 3NAPA 4CDWA 1YRZA 1AR91 2A75A 1N1YA 2DVDA 5BNNA 4WM7C 3ZMOA 3H3ZA 1NXMA 3OCPA 1ZBE2 2VOWA 5LEJA 1WA4A 3IPVA 1ULFA 1OHFA 1W6QB 3SMHA 1WW5A 3OBRA 5AC93 3UJOA 4COZA 2WLPA 5C8CC 4FTEA 4QGMA 4A3XA 4RR3B 1AX2A 1KQRA 4YVWB 4EN7B 4EWDA 3FFQA 4XIKA 4AI8A 2I45A 4MZUA 4COWA 1OOPA 1LOEA 1RJ7A 3I59A 2Z79A 1BEV3 1OFSA 1DF0A 4J1XA 1BZWA 4P14A 4HKLA 5K9YA 5K8SA 1WCKA 3WVJA 1FNYA 1EY2A 2MPFA 1HRI3 1DGWA 3O7OA 2FQPA 1H30A 3R4SA 1Z7S2 3N35A 2WNUB 3POYA 3IIAA 4I0WB 3NV2A 4CDXC 1N1TA 4WV8A 3TN92 2JECA 4LBNA 5FBZA 4B4QA 4K1YA 4LBQD 1AF9A 4AEDB 4EJRA 2D3RA 3D6EA 1RUC2 5CU1A 2V5YA 3KD4A 2RS32 4JTOA 3ZXLA 2GAUA 2ZGNA 5KXBA 1I5ZA 5CB7A 2GNTA 2EA7A 1QJX1 2R16A 3OYWA 4R9AA 2BVVA 2VU9A 3FMGA 3ACLA 5F6LB 3LCPA 5JSRA 1LJ7A 2WNVC 4OUSA 4QXKA 4XFHA 1H8TB 2BBVA 5JWPA 3QH6A 3LSEA 2PA