1RIRA

Crystal structure of meso-tetrasulphonatophenylporphyrin in complex with peanut lectin.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Crystal structures of the PNA-porphyrin complex in the presence and absence of lactose: mapping the conformational changes on lactose binding, interacting surfaces, and supramolecular aggregations.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rirA00
3ZXFA 4Y1VA 4YM2A 5IUQA 2D7FA 2DVFA 1UAIA 1GICA 1JBCA 1F9KA 1SBEA 5GZDA 3MW2A 2A6ZA 2ARXA 3AP9A 1W6NB 3ZXLA 2ZGKA 4U36A 5H9PA 4XJWA 4AVVA 1VAVA 1IS4A 1JOJA 2A7AA 2GMEA 3UL2A 5CB7A 3WG1A 2VW1A 1UPSA 2A5ZA 2ZGUA 1LESA 1KRIA 1QGLA 1ENRA 1SBFA 2NZ9A 3FUQA 5KXCA 3SITA 1IS3A 3ZSMA 2ZHKA 2A6VA 3HN1A 4GWMA 1MVEA 4ATFA 3MW3A 3N7KA 3AP6A 2E6VA 3O12A 3C2UA 2C5DA 3WDUA 3AP4A 2AENA 2P3JA 5E89A 4XIOA 2CL2A 4GA9A 1Q8PA 5H9RA 3FLPA 4Y20A 4LBMA 5EXOA 4BMBA 4FOQA 1GLHA 1LOAA 2OW4A 3RSJA 1FV3A 1ULEA 3NV3A 1N1SA 1WW6A 1B09A 2PHFA 2DUPA 4LBQA 4XXPA 3ASIA 1DHKB 1X50A 4YGDA 1MS1A 1SLCA 1OQ1A 2WNEA 2GN7A 1ULFA 1ENSA 1OFSA 4C1WA 1C4RA 4Y1UA 4WZFA 5JDBA 1WD4A 3V65A 2ZGTA 1TEIA 4Y22B 3WCRA 1SCRA 1AX2A 1DQ2A 1AXZA 1U0AA 5L73A 1UKGA 2GDFA 2VY0A 1GZWA 2TEPA 1FYUA 1SLIA 1S0EA 2UURA 2SLIA 4Q26A 4UW5A 1LULA 2YZ4A 4R9DA 4AVTA 4XJAA 4ISRA 2NMNA 4YZ5A 4BOWA 2PHRA 1GNHA 2GMPA 4LBJA 1H30A 2ZACA 4YM1A 4BMEA 1N3PA 5JLVA 1BYHA 2PHWA 2ZGQA 1G9AA 1UMZA 2WT1A 3PMEA 2P3IA 5DZGA 3V0BA 2P3KA 3OGGA 4FPHA 3NV2A 2LTNA 4NO4A 3VKMA 1C1FA 4GKYA 1LGCA 3SH3A 2YY1A 2GN3A 3N36A 1JHNA 4TYSA 1LHNA 3DGTA 4FOVA 1UZYA 3M3CA 2NP0A 1SBDA 2W68A 1JXNA 1JYCA 3BIWE 2DUQA 2Q5TA 1A3KA 3ZYPA 3OY8A 2D6KA 2ZHLA 2ZGRA 1QOOA 3BODA 3N7LA 2DVGA 1QNYA 3RG0A 1Q8QA 2FMDA 3UJOA 2B7YA 1LHOA 2ENRA 3BTAA 1GZCA 2DVDA 4Y26A 4NOTA 2D6MA 4FPJA 4K20A 1V6OA 4DRVA 1H9PA 5FREA 4M01A 4Y24A 3WV6A 2WT0A 5T5JA 1DQ6A 4HANA 1CQ9A 2E53A 2CNAA 5HCBA 4YLZA 3RRDA 5IK5A 3WG4A 4FPFA 2AH2A 4YM3A 1CVNA 1SACA 1WW4A 1MZ5A 2D6LX 3IPVA 1LU2A 1J1TA 5GZGA 1DGLA 2WQZC 4DPNA 1SCSA 1DZQA 1WBFA 4C1XA 4F83A 2A3YA 4GXLA 1G9BA 2VXRA 2XB6C 1A8DA 1GV9A 4AWDA 4Q1RA 2UWAA 3AP5A 2ZAAA 2XG3A 2VH9A 3V64A 1QDOA 4XJZA 3IM0A 3OYWB 4XMIA 2AREA 5GLVA 3USUA 2CWMA 4ZKTB 1ZA4A 3V0AB 1VAMA 1DFQA 1LHUA 2OUJA 4BQ1A 5T5PA 1Z78A 4AGRA 5DUVA 2ZABA 5GLWA 4WVVA 4K21A 1SFYA 1N1TA 4XTMA 2DU0A 3AZYA 2ZGMA 4XOGA 1YIFA 2VW2A 1MS4A 3NWKA 3WG3A 5KXDA 1PZ8A 2H0BA 2E51A 5F5QA 3ZXJA 3M2MA 4XTPA 1W6MB 3UJQA 1DYKA 3Q9OA 1SLAA 2ES3A 2KM2A 2D44A 1MACA 3WUDA 1QNWA 4XDQA 1KITA 4Q27A 2A6YA 3AZZA 2R16A 5IK4A 3NV4A 4R9CA 5GJ6A 5JOWA 2W39A 1DBNA 2CYFA 3TB0A 3TAYA 4K1ZA 4XE9A 1URXA 4XHBA 2JJ6A 3NV1A 1BZWA 2EAKA 4PCRA 1N47A 2NMOA 4M3CE 4XYXA 4JCKA 1LU1A 4YW2A 4P9YA 5F9TA 4Y20B 1DQ0A 1YRZA 4Q1PA 1LOFA 3PVOA 1WLCA 4I30A 4LBQD 5FRAA 2DVBA 1WD3A 3AP7A 3RMYA 4BM8A 4OZXA 4LBQB 2WSVA 4M3CF 4FPKA 1IOAA 3ATGA 3FLTA 1AJKA 1ULGA 3M3EA 3SH5A 5CA6A 5T54A 1QKQA 5SV8A 1VIWB 3VKLA 3WUCA 2NYYA 3VUOA 2ZMKA 3WDWA 1S1AA 3RS6A 1FV2A 4IQPA 3U4XA 4ATEA 5DG1A 5JMCA 3N7MA 1GKBA 3BOPA 1C57A 1CJPA 1RIRA 1S0IA 1FX5A 1WW7A 1ZM1A 4PQ9A 1ONAA 1PZ7A 2ZGNA 2ZGPA 2ZMLA 2PHXA 4KBBA 1V6KA 4XILA 5LK5A 5CNAA 3D5OA 1MZ6A 3SISA 2LALA 3POSA 3ILRA 5EWSA 3AZXA 1QOSA 1QOTA 2ZBJA 3POYA 1R1ZA 2EF6A 4XIKA 1F5FA 2GNMA 1BQPA 1FAYA 2E7QA 1IKQA 1Q8VA 1FATA 2ZGOA 3JUUA 4YW5A 1ULCA 3WDXA 4XHXA 3R4UA 1LEMA 4MYEA 1HKDA 3AXDA 3INAA 2UWCA 3W58A 1SLBA 3WLUA 5KXBA 3A0NA 4XJUA 1MS0A 1UN1A 3OY8B 5BYNA 4XBNA 3I4IA 3O0XA 1Y7BA 1AVBA 1SLLA 2ZMNA 3WVJA 2A6WA 4FOWA 4YG6A 1G7YA 1VALA 1BKZA 4YFZA 4Y1ZA 4UW4A 3RMXA 3B69A 5IK7A 5GLUA 4YFWA 5CBLA 3ZXEA 1YXWA 1LGBA 2BQPA 4M3CB 4FVVA 3D6EA 1D0HA 4CZSA 1DQ5A 3N3HA 4CRQA 2HYKA 5T55A 1V6MA 2UWBA 3B01A 4P14A 3T1MA 1W6OB 3MW4A 1W6QA 1Z0HA 1DIWA 1HQWA 3O0WA 1VLNA 2DU1A 2EALA 1AX1A 4DFSA 2ZZJA 1DLLA 3LCPA 1LOFC 1V6IA 2VU9A 4Q8LA 2R0HA 4GKXA 1FNZA 1Q56A 5GALA 1G9CA 1PZ9A 1W6PB 1S0GA 4XBQA 1AXYA 1OKQA 3MEPA 1LENA 2JE9A 1CN1A 4FQZA 4DRRA 2DURA 1LHVA 5IK8A 3ZVXA 3POWA 2WKKA 4PBPA 2ZHMA 3QCWA 2CTVA 2R1DA 4R9BA 5GLZA 1IKPA 1YYNA 2AYHA 2D6OX 1GSLA 1O4ZA 2EXJA 1GBGA 1MR5A 1WLWA 4P9WA 2V5YA 4AGVA 3A0KA 2EXIA 1MS9A 2GMMA 4FPOB 2GNBA 3SNMA 5AVAA 1CPMA 2E7TA 3AYDA 5KXEA 1HDKA 1UZZA 3AZVA 1D2SA 4ITCA 5T5OA 3VKFC 1LEDA 1XQNA 1ULDA 5GLTA 1WUVA 1A78A 2A3WA 3GNEA 2ZA9A 4BLIA 3N35A 4TZDA 1CIWA 5T5LA 5DUUA 1BXHA 1LOBA 2VUAA 4ZXKA 4FOYA 2D6NA 1ENQA 4DS0A 1G9FA 3APBA 4YZ4A 2Z42A 2DTWA 2WSUA 4AGGA 1MVQA 3ZSJA 1S0CA 3ZYRA 5HCAA 3OYWA 4YW4A 5H9QA 3V0AA 1CPNA 2A71A 4K1YA 5EYYA 3QLQA 3H0OA 1DQ1A 4WV8A 3WNXA 4Z8BA 3WZ1A 4YM0A 2D3PA 3B00A 3LSEA 2GNTA 1H9WA 1MS8A 2JECA 3AYAA 2DV9A 4YZ3A 1KDKA 3R05A 1AZDA 1QU0A 2WLQA 2EXHA 2GNDA 3AX4A 1W6MA 5DUWA 1V00A 2D43A 3LSDA 4YGEA 2DVAA 2YV8A 4RL7A 3VKNA 1HQLA 1KJLA 2RHPA 4JC1A 1GZWB 3JU9A 1N3QA 3SLIA 1V6LA 3M1HA 3AJYA 3AJZA 1KDMA 3PJQA 1O4YA 2DYCA 1SLTA 4FQ4A 1LODA 1CR7A 2C9AA 5GM0A 1KQRA 4FPYA 3OBTA 4HL0A 1WCSA 1G9DA 2ARBA 1JN2P 2NM1A 1W6NA 4FP2A 4RA0A 1MS3A 3FFZA 5T50A 1IS5A 3OJBA 1WBLA 3V0BB 3D4KA 1LGNA 3A4UA 3R4SA 4UW6A 1GANA 3ILFA 4D69A 4FPCA 5JOXA 2PHUA 2EIGA 5DXDA 3PVNA 3B3QE 4YG3A 2DWRA 4XZPA 4P9XA 2CY6A 3M3OA 5E8AA 3RQ0A 1DQ4A 5JVVA 2YXSA 2V73A 3L2YA 1HLCA 1S0BA 2EXKA 4FPLA 4YGBA 5JOZA 3W59A 2ZHNA 2JDZA 1C1LA 3AK0A 4M00A 5GZFA 4BPZA 4YW1A 1AXKA 4FP3A 4Y1XA 2CWSA 1G86A 1GZ9A 2GALA 1LTEA 1WLDA 2W52A 2P34A 4XJ9A 3AYCA 3AZWA 1N3OA 1W6QB 4U2AA 1RITA 1Q8SA 2JD4A 4DQAA 2OVUA 1V6JA 3T1LA 1I3HA 4CTEA 1LOEA 1KJRA 4AYUA 2AR6A 3WCSA 1W0PA 4GALA 2WT2A 3IPVB 4XBLA 4Y22A 3CNAA 3WHUA 4LBLA 1NLSA 4XXAA 3AYEA 2NN8A 3ENRA 1YO8A 2DTYA 1EPWA 1FNYA 4R9AA 5T52A 2SBAA 1AF9A 3IKWA 3FBYA 1LJ7A 2P2KA 1JW6A 1CONA 1YI7A 2ERFA 2JKBA 5DG2A 1F31A 3USUB 5CAZA 3WHTA 4L8QA 3M3QA 2A3XA 3FLRA 4GWNA 3AXEA 3ZXKA 2YROA 2I2SA 1QF3A 2OUHA 3WDYA 2A6XA 2PELA 2FHRA 4H55A 1LOCA 2YMZA 2D6PA 2R1BA 1GYKA 1UL9A 3ZSKA 3ZPYA 2WJSA 3T2TA 4ISQA 5GZCA 1LCLA 1V6NA 3I8TA 4FPGA 3IN9A 4YG0A 3VV1A 4LBNA 3WDVA 4UW3A 5GZEA 2DUOA 2R49A 4M3CA 4SLIA 1IS6A 1UX6A 1BJQA 3IMNA 1W0OA 3PVEA 1JUIA 4WVWA 4BLJA 4ASMB 4LBOA 5IT6A 1N1VA 2PHTA 1I1EA 2ZKNA 2ZGSA 4W65A 3WDTA 4YW3A 4XMAA 5DUXA 1W6OA 2A70A 3KQRA 3N7JA 1AJOA 4YZ1A 1S0FA 2G4IA 2R0FA 3DUIA 3B9CA 4LBKA 3SH4A 5E88A 4JRAA 3O5SA 1MS5A 4Q2FA 3AFKA 2UU8A 1DYPA 2JE7A 3OPZA 1RINA 1LHWA 1QMJA 5JOYA 3OBRA 5HCFA 1S0JA 3ILNA 3HMYA 4PF5A 4Y1YA 1LOGA 2ZGLA 1QDCA 2A75A 1W6PA 4AVSA 2P37A 5DZEA 1NXD1 3KM5A 1WW5A 2D3SA 5DZFA 2AUYA 2W08A 1JYIA 1S0DA 1AX0A 1GNZA 3WG2A 3O0VA 1APNA 1CESA 2VW0A 2AGSA 3HR9A 4YGCA 5H9SA 3MPPG 3VKOA 2D3RA 4YZ2A 1Q8OA 5EYXA 3FUOA 1G8WA 4XJ8A 3UK9A 3ZSLA 4Q8KA 1N1YA 1LECA 4PBOA 4FPEA 3WOGA 3GALA
chains in the Genus database with same CATH superfamily
3S5QA 4DXZA 2O8OA 3VBHC 3KV6A 1NY71 5IUQA 2DVFA 4WVMB 3I2JA 4AI8A 5JSRA 1FXZA 2DCKA 1COV2 1ZA7A 2KD7A 2WRAA 3N9NA 1WCQA 5GZDA 3RZLA 1BMV1 4AFDA 4UFJA 1ZX5A 1W90A 4XJWA 4FAHA 2WQ4A 1IS4A 2B5HA 2ZGUA 1BEV2 2VNGA 3VBSA 2ORXA 3W9AA 4COVA 1ENRA 2NZ9A 3FUQA 3B9IA 1RVF3 1C8M2 3NAPA 3VDCA 3G6JB 1O4TA 2ZHKA 1VBE3 2WUHA 4ATFA 5A32B 3AP6A 2ARCA 1VMJA 2C5DA 3AP4A 4EWDA 2VZUA 2P3JA 4KWLA 3D0SA 2C26A 3VHOA 5CFDC 5FV3A 4PDWA 2WZR3 4MGQA 5FMCA 5FO7B 2OW4A 4OLLA 3CJIA 4NUBA 3PU3A 1ULEA 1N1SA 3JQXA 3SHRA 1U12A 4YGDA 3HBKA 1DHKB 3VBOB 4NWVA 1L7LA 2XVGA 3K3NA 4XQ4A 4Y33A 2ETEA 2RM23 2V72A 3CZUA 4AAPA 1O3QA 3ZYFA 1WD4A 2HWD1 2ZX4A 5A1LA 2ZGTA 1HIXA 5FKCA 1EAH3 1WZXA 3WW4A 4EYUA 4DUXA 1OSGA 1ZZBA 1Y9MA 3P1IA 2JG9A 2GDFA 4GJZA 2IXHA 1GZWA 3U10A 2QQMA 3JD73 1ZRIA 4Q26A 4UW5A 4IEPA 2G9ZA 4R9DA 4XJAA 1JODA 4ISRA 2XJQA 3WNPA 5M0TA 1A34A 4YPJA 2PHRA 4BA6A 1GNHA 4BOWA 2XVLA 4LBJA 2VNRA 4RD7A 1NE6A 5JR2A 2WAOA 2Q4SA 2Q1MA 2PHWA 2JDNA 2ZGQA 3EJKA 4XFFA 1G9AA 2WT1A 1R1A1 1EP0A 3OGGA 4YNIA 2LTNA 4NO4A 4TN7A 4LKEA 3TEZA 1C1FA 2QVSB 2MEV3 3N36A 5L7OA 1JHNA 4X8NA 1LHNA 3DGTA 5D21A 3M3CA 5FPZA 5LA0A 3OUIA 4K9SA 2G19A 2Q5TA 1CZVA 3ZYPA 3ETPA 3UJOA 1R64A 3ACFA 4EQVA 2DVGA 1QXJA 4FT8A 2WO7A 5J09A 1GZCA 1V0AA 2TBVA 3VDAA 4BQXA 2WWSA 1JZ6A 3KSCA 3IDCB 3WNNA 1UNBA 2XVKA 5IFPA 1AL23 2HWE1 4M01A 1YQ2A 3WV6A 1UOFA 4Q4W1 1MPXA 1Y9GA 2VQ0A 1DQ6A 4IV3A 1C3HA 1CQ9A 2RDQA 3N9OA 5T5JA 5HCBA 3L9JT 5I91A 1PM4A 4YM3A 3HEIA 1F2NA 1FPN2 1SACA 1MZ5A 3E97A 3IPVA 1J1TA 5F39A 1PGW2 2PLV2 4X8PA 5CU1A 4C91A 5GZGA 4MLOA 4W4ZA 3OEBA 1XB9A 4C1XA 3C7EA 3CBNA 4DUVA 2XB6C 4GMP0 1VMFA 5A6QA 4Q1RA 2R6QA 5K8SA 3AP5A 1H2MA 4HKLA 3U37A 3UV9A 5GLVA 4BDVB 4JHTA 3V0AB 1RMU3 1WMFA 1VAMA 4IEUA 1HB1A 3DYPA 4AEDC 4AGRA 1JH5A 4N53C 5F3IA 3DKQA 4K21A 1X36A 2XQXA 4RQPB 2D93A 1YIFA 2VW2A 3O7OA 5BPXA 4DOUA 1R093 4QT6A 4OUMA 2W1QA 1NG0A 4EE2A 3J8F3 5TSWA 1TG7A 3ZFFB 1W03A 1PZ8A 5F5QA 3M2MA 5K9YA 4XTPA 4O9GA 3Q9OA 4XFBA 4NIAA 3PLQA 1POQA 4KGQA 3KF3A 4A7ZA 2G1MA 5ABJB 4TXWA 3KT4A 1UY2A 4NIGA 5C9AA 1SHWB 1V9U3 5KBFA 1KITA 4Q4X1 3VHRA 4V2WA 2A6YA 5C4WC 1IG3A 2GSYA 1B35C 4OUSA 5GJ6A 3BCWA 3WEZA 5IFTA 5FYMA 2CYFA 3OBZA 3TB0A 4K1ZA 1R081 2HWB2 1URXA 4XURA 3NV1A 1ZNPA 1BZWA 2EAKA 4FAGA 2JDAA 4LULA 2BU9A 4P9YA 3MFCA 1YRZA 1PVC1 4Q1PA 5FRAA 1A8MA 3PVBB 5FP9A 2C6SA 4L11A 3ELNA 4GWJA 1JS9A 2HEVF 4NN0A 4QPGB 5FPVA 2BBAA 3BYWA 4FPKA 4UXAA 2Y6GA 4LOSA 4PIXA 3EYPA 4CDQB 3TRSB 5F2SA 5FO9B 2ZX2A 4RHV2 1AJKA 1ULGA 3SH5A 5A7OA 1QKQA 2Y6LA 3UKTA 2JG8C 4QGMA 1XU2A 3VKLA 3WR0A 1JYWA 4E4HA 3HAGA 4QXBA 4IQPA 1HB3A 3PL0A 4ATEA 5DG1A 4KMQA 3N7MA 4UYBA 1F15A 3BOPA 5FZEA 2BP6A 2LUWA 1AYN1 1S0IA 3OUHA 4AF9A 4Q4W3 4PQ9A 4BQ4A 2ZGNA 3OD4A 5IATA 2ZMLA 5FY8A 4BISA 4OMCA 3BOWA 2C24A 4XILA 4WVMA 5CNAA 1MZ6A 3ECQA 1PO12 2LALA 3POSA 3ZFGC 2XLGA 4B4RA 3AZXA 2WS91 4FFGA 2JDYA 4F3JA 5J7MA 3POYA 1AR61 4E4ZA 4XIKA 4XUOA 1OF3A 1W8OA 2BVVA 4LO4B 1ULCA 4DXTA 5FY7A 2H6BA 3RZZA 2FCVA 4RS5C 1U5IA 3WLUA 4BCUA 1AR91 4Z82A 3H8UA 5FP4A 2ZXQA 5A32A 1UN1A 5BYNA 3W5NA 3T30A 1JUHA 2XDVA 3QOPA 2ZS6B 5JMOA 1JOBA 4CVUA 2B9UA 3O0XA 1SLLA 4AI9A 2R043 3UETA 1CAWA 2K9ZA 1H0BA 1DZRA 2RS31 3FHAA 4XFHA 5FYCA 4RN5A 3JBG1 3RMXA 3FE5A 1YC61 2ATFA 4CCDA 2YC2A 1W04A 4QDSA 4YFWA 2H6CA 4YSFA 2BQPA 2B39A 5LRRA 1FOD2 1REEA 2VM9A 2ZOEB 3ZR5A 4HVRA 4XVHA 5AC92 1F8VA 3HQUA 2IXIA 3M70A 4IE7A 3H7JA 1MEC1 1EV11 2IVJA 4LITA 3T1MA 4W8JA 3LKJA 4QM9A 1S2EA 4JV4A 4UAPA 4N43B 1SFPA 2W5FA 3LA7A 2EALA 4IEQA 1JYXA 2VVFA 3A21A 4DFSA 1XNCA 1LOFC 1BLZA 2VU9A 4JGYB 1QJY2 4QXHA 2BOJA 5FYBA 3UNPA 1ND3B 4AHYA 2RS11 1BCXA 3D3AA 1VBD1 5FZLA 1S0GA 2J1AA 2WN2A 4BZ4A 1AXYA 1OKQA 4XFCA 1LENA 4DIQA 4UWDA 2XOMA 4OI2A 3WF0A 4D6SA 1OVPA 2WFF3 1AYM2 4A6SA 3I3MA 1NZCA 2RR12 5EFUA 4EJRA 5IK8A 4PBPA 2WKKA 4RGAA 2FDGA 2ZHMA 1ZZ8A 5GLZA 4RFT0 5IVEA 1IKPA 3JZVA 4QB6A 3LD8A 1O4ZA 1Y3TA 1HV1A 4PF1A 1W8NA 2C0ZA 2EXJA 5C3OA 3JXSA 3ACLA 4MX3A 3VZJA 1WLWA 5KC5A 3NNLA 4W50A 1PHMA 1OLME 5JAXA 3MIFA 1VRBA 3NJYA 5G04L 3T09A 1QQP1 3LDBA 1XU1A 5LK7B 4IEZA 1UY4A 5A3TA 3KCYA 3GCXA 1F35A 1IHMA 2B4KA 1OF4A 4GAZA 1LEDA 1ULDA 2K0GA 3O1SA 2W46A 2HKXA 2E32A 3GNEA 1VBB1 1JZ2A 5J1XA 1E57A 3N35A 5DUUA 2QNKA 3OBAA 4CUAA 3HQRA 1UXXX 1G9FA 5C7GA 1OVSA 1XNBA 2IWGB 4D6RA 2BVBA 3FWEA 1UZWA 3ZYRA 1XSQA 3V0AA 1CPNA 1OUXA 2A71A 1YIPA 3DN7A 3B94A 3I3QA 3H0OA 1DQ1A 3JB8A 3KF5A 4WV8A 3QBQA 5JPMB 3L2HA 1YNAA 4LHSA 4RQPA 3OB8A 1H9WA 5A7SA 1MS8A 1OPMA 3IDEA 4Y4YA 3PURA 4AQ2A 3HNMA 4JRLA 5A3UA 3S57A 1IPJA 1AZDA 2VCMA 3MO4A 2TUNA 1W99A 3AL6A 1X9TA 5DUWA 2D43A 3LSDA 3GJAA 1MEC3 1EV13 4QX7A 4AHXA 1HQLA 3AVSA 4JC1A 2XL9A 1QJFA 3M1HA 1UYXA 1RUE3 1S55A 4MH0E 4YWAA 3WF3A 5ABJA 1O4YA 2QCSB 4FXGB 4FFFA 1DLCA 2IUWA 4FQ4A 1CR7A 5FR3A 2RMU1 3TBDA 1FMD1 3ZIXA 5A6XA 5F3CA 3ZLIA 1WCSA 5J98B 2ARBA 2GAUA 4IE0A 4FP2A 1J58A 1KEXA 5T50A 3OJBA 1WBLA 1PIV2 3U1XA 3V0BB 1SG3A 3R4SA 4A7KA 1CAVA 2YBPA 1VBC2 2Y33A 2ADEA 5JWPA 5SV5A 1D4M1 2XQRA 3IAQA 4EN7B 1OT5A 2VJXA 2DWRA 4QPGA 4P9XA 2CY6A 2J7MA 3M3OA 5I0SA 2FDKA 4OHYA 3MPBA 2YU2A 5E8AA 4CDQA 2JDUA 5FYYA 2JEMA 3GXUA 1HLCA 4FPLA 4MGZE 4XEZA 4YGBA 4I2OA 5JOZA 2ZHNA 5A3OA 4IESA 1C1LA 1IZ3A 1GQPA 5A3LA 4AOCA 4BPZA 1AXKA 1W05A 3W5MA 1T6BX 1QQP3 4LOTA 3LB9A 2RG4A 4BJ0A 3RZMA 2GALA 1ALYA 1OKOA 1WLDA 3VGIA 1WMDA 1H1MA 1W6QB 1BEV1 2JDKA 3OEAA 4H7MA 5FP3A 4CUGA 1Q8SA 2JD4A 4HXCA 4DQAA 3ZM8A 3BUCA 3T1LA 1VBB3 2DCJA 4NRQA 4GH4C 5ACA1 1PMIA 1W0PA 4XBLA 2WT2A 1KS5A 1SZBA 2IXJA 3WHUA 1XOYA 3DPRB 5FYTA 4LUMA 4B29A 1YO8A 4MV2A 1BBT1 2WNVB 1O8PA 1LJ7A 3MUZ1 2P2KA 1DG6A 5DG2A 4ONUA 2HEWF 4S2DA 4S2HA 5C8WA 1H4GA 5FBJA 5A7NA 3RZJA 2CAUA 1VJ2A 2R072 3B93A 3I97A 2BERA 3BKZA 4GWNA 4P08A 2YROA 4IGPA 1F5JA 4CA9A 3A23A 1RUI2 3OGJA 2VZQA 4H55A 1LOCA 2YMZA 2D6PA 3FL7A 2R1BA 4D7YA 1YHFA 2FDJA 1W8HA 2BNOA 4G9SB 4Q4Y1 5C33A 5FLJA 5BXXA 1LCLA 5F6KA 1H8TA 3OF1A 5L9VA 4Q5OA 1DGRA 3MIDA 2VMIA 2XGXA 4AFBA 2QDNA 4L0PA 1OI6A 1TQ5A 4QD2A 4MVTA 5GZEA 5A7PA 3EB7A 4LHLA 5G05L 2R49A 3MUY1 2E63A 4AL9A 5A80A 1IS6A 4WVWA 1W0OA 4BLJA 3J7LA 4FCAA 4JGZC 4LO8A 4ASMB 1RUC1 2ZX3A 4LE3A 4W65A 3WDTA 2WWUA 3EMRA 4ZS3A 4XMAA 2VZRA 1E5SA 4A4AA 4N43A 5J48A 1QWRA 2Z2SB 4HSJA 2ZTNA 1RUG2 3U4SA 1TME2 2FDFA 2XJTA 1RINA 4B3NA 3OBRA 3DEMA 5HCFA 3VBRA 4E2SA 4HONA 2XKOA 2ZGLA 3M8LA 1K5MB 1ACCA 2A75A 3ORJA 2ZEYA 5DZEA 1HXS1 1WW5A 3KM5A 2GP3A 2X05A 2D3SA 4UOJA 4WM8A 5DZFA 2W08A 1JYIA 1AX0A 1GNZA 3K4ZA 4EWAA 1APNA 1CESA 1OURA 2W92A 4V2VA 5C3PA 4YGCA 3LWCA 2J1VA 3VLBB 1Q8OA 4MXVA 4QXCA 4WM7B 1QIQA 3FUOA 3UK9A 1BEV3 3ZSLA 5C3SA 4Q29A 2OQ7A 2ZAHA 4PBOA 4Q0VA 3GALA 3ZXFA 5GKAC 3WT3A 4YM2A 2WNUB 2VGDA 4CDWC 1GICA 4GB32 4MADA 3BTYA 1F9KA 3ZKYA 2BDRA 1W6NB 2ZGKA 2X53S 3AKQA 5FZGA 5E1RA 1OH4A 3VBFA 1QJX1 2A7AA 3DV8A 4QWNA 5JIAA 3WG1A 2A5ZA 4UT5A 4URTA 5A1FA 1DZTA 1ZZCA 4GJYA 3C7GA 3ZSMA 1IS3A 2ZZQA 4IETA 1YJLA 1WCUA 3H7YA 1BVP1 2A6VA 4GWMA 1NQJA 1MVEA 3N7KA 4X6QB 2E6VA 2J1TA 3AKPA 3C2UA 4UBGA 5F2WA 5FZHA 3UGFA 3LEMA 5E89A 2XJPA 2CL2A 4GA9A 2YDEA 1NCQC 4Q4Y3 4LBMA 5JR7B 4NR1A 4QPWA 3W21A 3D0JA 3SCHA 1QY4A 3RSJA 1FV3A 4P9LA 4MGTA 1NCRA 3GGLA 4LBQA 4XXPA 2DUPA 4CUBA 1VAKA 4IEXA 5DAQA 3WINE 1MS1A 4AZZA 4FSJA 4C1WA 4WZFA 1GWMA 2PHDA 2Y38A 5JI7A 3RYRA 2BTVC 4B8EA 4L2NA 2HWB1 2JDHA 1HRV2 4Y22B 4TLFA 3H1YA 1RUJ1 1RUC3 2XJRA 4QGLA 2VBDA 5IHRA 2TEPA 2RDNA 4Q4V1 1SLIA 1EYBA 1S0EA 2UURA 2NPIA 3MLLA 3PUSA 1AR72 1LULA 2YZ4A 3CLPA 3EQEA 2VMEA 2DCZA 2HWF2 3DYMA 4P9GA 3U75A 4YZ5A 2Q1ZB 1J3RA 4D7TA 2GMPA 2OPWA 1H30A 4JAAA 2ZACA 5FBZA 1GWKA 3NSTA 4LO6B 4RGKA 1OHFA 2ORZA 3GF6A 2VMGA 4R52A 1UMZA 3PMEA 1STMA 4JDNA 5DZGA 5CFDB 3V0BA 2VOKA 4FPHA 4GKYA 3SH3A 1H1IA 2RJKA 2ZEWA 4CP1A 2XUMA 4TYSA 1PO22 4FOVA 1RVF1 4FTSA 3ACGA 3VBUC 4ZU5A 1JYCA 2W47A 2PFWA 1NLQA 3BIWE 3ME2A 1A3KA 1VBE1 4K40A 4XDOA 1W9FA 2D6KA 2Q1FA 3ZFEC 3N7LA 4ARYA 5ISLA 1O3SA 2QQWA 3T0AA 2FMDA 1PO11 3PUAA 1LHOA 4Y26A 2JWPA 2PLV3 4OZOA 2R7EB 2WZR1 2ID4A 1ASJ2 4DB5A 2D6MA 4UFMA 1VBA2 4AK3A 1RHI2 1W39A 2QQNA 1RB8G 1LR5A 5FYIA 3O1RA 1QJX3 2YFZA 3PIGA 1ZRFA 3CJXA 5CVRA 1WKYA 4IDZA 2YC4A 4PIZA 4QQHA 4XF1A 2VECA 4O9EA 1W3XA 1MZEA 2CNAA 2UYAA 3LZZA 3VBSC 1ZBA2 2JE8A 3WG4A 4DXRA 2NLRA 5A33B 1CVNA 3GDBA 2RDRA 3VD3A 1EAH1 5FQ0B 2RJ2A 3WF2A 4OI0A 3NAPC 4IGOA 5BUVA 3RZGA 3DPRA 1HRI2 4F83A 5FUNA 1U5YA 4ES9A 1G9BA 2WNVA 4QDRA 5F5IA 4TWTA 3JD71 1HQNA 2ZAAA 1YCIA 1ST8A 4QHOA 3V64A 5A6ZA 3VD4A 1QDOA 3IM0A 4XMIA 2AREA 4PDWC 4Y3OA 1ZA4A 3ZYIB 4XCBA 2OUJA 1I6XA 1Z78A 4W6YA 2ZABA 1L3JA 1L7RA 4WVVA 1IPSA 2DU0A 4LUKA 2CGOA 5AVPA 1OD5A 2EIBA 4WBBA 1X8MA 2OZJA 1U5ZA 4MGYE 3WW1A 1XPWA 2H0BA 1I9RA 2E51A 2HWB3 2PTMA 1YFYA 2MEV1 2VQUA 4HBNA 3ZN6B 3ZXJA 1DYKA 2N7GA 4LNVA 4CCJA 4DZGA 1F4HA 3O1VA 2E26A 5LBCA 1SLAA 2JG9C 4AEJA 2XXZA 3H3LA 1FI2A 4CSWA 1MACA 3RDIA 3WUDA 4AFMA 4BYYA 3MIHA 4XDQA 4RSUA 2R30A 1PK6C 5L9RA 2PMWB 4RHV3 3ZMNA 2ET7A 3ZO0B 4C8DA 4N8MA 3TAYA 5K0UA 4XE9A 1ZYBA 4XHBA 1H2KA 3H9AA 1AL21 2XH6A 4M3CE 3N9QA 1GQGA 4Y20B 1DQ0A 1H2LA 4XQDA 4ET7A 4LBQD 3UGGA 2DVBA 2Y0OA 4AEDB 1WD3A 3AP7A 3RMYA 4N53B 5L7OC 1J59A 2Y26A 3AC0A 4M3CF 3M4FA 1TVGA 4XAAA 5FYUA 4CCEA 4ZZ5A 1RUD2 5FZ0A 3AB0A 2I07B 3E5UA 2P4EA 5SV8A 1VIWB 1PO13 3K3OA 4LORA 2QKDA 3NMBA 3CU7A 2WINB 2YBSA 3SC7X 4N9IA 4C0HA 2BWAA 1SPPB 4MGSA 1O5UA 5JMCA 1RMU1 3LAGA 4WM7A 3ZIWA 1C57A 1J83A 1CJPA 1RIRA 3DXTA 4GIQA 2XBO2 5FAXA 1ONAA 2ZGPA 4KBBA 2WNUA 4IV3C 5C4WB 1LAJA 1R091 4OYUA 3U11A 1B35B 5LK5A 3RYKA 3J8F1 1JYVA 5FYZA 1POV0 3VZMA 3S7EA 4NROA 3GM8A 3QH6A 5EWSA 3I2OA 2Q0AA 1DU3D 1QOTA 2ZBJA 5FO8B 3WQ0A 4B4PA 1W8TA 5FXXA 2GNMA 3THDA 1FAYA 1IKQA 1Q8VA 2ZGOA 4LKFA 4XAEA 3N9LA 3Q8FA 1NLRA 1VR3A 1LEMA 1V9U1 2W1SA 3B7MA 3GJBA 1IPKA 3LPFA 3INAA 1ZVFA 2VOVA 3P6BA 4HPKB 3C7FA 4ZHNA 1AR82 2PA7A 1YEWA 4CUCA 1F4AA 1MS0A 3T3YA 4A3XA 3OY8B 5IWFA 1FOD3 2JG8B 4LIVA 5DN2A 1UU4A 3HN3A 3KMHA 2R061 5CADA 3BU0A 3PTRB 5AC93 1AVBA 4QB1A 4DXSA 4MGKE 1JZ5A 5FZKA 3SMHA 5FLHA 3SEEA 4OMDA 2OS2A 2QE3A 4KWJA 4UW4A 4Y1ZA 3ST7A 3RNSA 4QPIC 1O7FA 4YFZA 2H0VA 3B69A 4GULA 3H8OA 4WZCA 5FP7A 5JUVA 1DYOA 1QJY3 1LGBA 4OHXA 1IQDC 2WABA 3ZXEA 3D6EA 4BQ5A 1QJZA 3I54A 2Q8DA 1BHGA 1DQ5A 3ZFGB 4AQ6A 2VTXJ 2E33A 1XYPA 1VMHA 1JU4A 1V6MA 4AE2A 5LY2A 1VBC1 3CMGA 4HETA 2VZVA 1QJU2 2AACA 1AYM3 3AMQA 3SEPA 1Z0HA 4IUGA 1DIWA 2RR13 2YUEA 4PI2A 3MIEA 2DBIA 4RS5B 3FC0A 2HBUA 4PT6A 4I3GA 3T2OA 1GQHA 3KS7A 4LXLA 4XUQA 5F3GA 5HXMA 1I5ZA 2VNOA 5EPAA 5EJZB 4BWOA 5KHGA 4B7KA 1O91A 3OGRA 3D8CA 3LPGA 1FNZA 1W6PB 5E16A 1QH7A 4HMZA 5CFDA 3VD9A 3MEPA 4RR3C 1RUH2 2VMDA 2MHFA 1XXNA 4AHWA 3TWIA 3ZVXA 3POWA 4XF0A 3IDBB 4EV0A 5BNNC 4R9BA 2DFBA 1YI9A 2XR4A 1XNDA 4RGGA 4JDMA 3U14A 2D6OX 3LDKA 4QQOA 1GSLA 3RVHA 1H2NA 3J9SA 5EHDA 3MV11 2VD7A 1GBGA 4P9WA 3G7DA 1SQ4A 5FMOL 2V5YA 3H8XA 4CYDA 2OKXA 2FCUA 5AVAA 2FCTA 2D98A 2BUKA 2R041 2ZCWA 3AYDA 4ZONA 3LE0A 5JZGA 5KXEA 1HDKA 4LR4A 1MQTA 4QAWA 5C70A 3AZVA 1XNTA 4KU8A 3IB3A 4ITCA 2X29A 2PAKA 5C5UA 5FOBB 3CKHA 1VRH2 4GZ9A 3FHIB 2A3WA 3PUQA 4CCLA 4KG8A 2R071 3GZTB 3ALQA 4EWEA 2VULA 2QUOA 4FFIA 4LTAA 2JB8A 4N7UA 2XLAA 4UI9L 5A33A 2RS52 1JHJA 5FZCA 1K5JA 1ENQA 4OUEA 5JSPA 4DS0A 2XPJA 1TMF2 2R063 2Z42A 3O1MA 1UF2C 2V09A 3OSDA 2VZOA 5ERLA 1W3VA 4H2AA 1WMEA 4IE4A 3ZSJA 3IZOA 4COZA 1LB2A 5FJKA 4YW4A 5H9QA 1RJ8A 3B02A 4K1YA 5EYYA 3QLQA 3OTFA 1XYNA 3WZ1A 5BNPA 5KR7A 3FBMA 2WIIB 2W95A 4MUVA 5LEKA 4FTBA 1H1AA 2JECA 5FY5A 2CGNA 1OLRA 5I93A 2DV9A 4YZ3A 1KDKA 1RUNA 3R05A 5IYYA 2WFF1 4GMP3 2EXHA 2F4LA 3ZN6A 1ZRDA 1PIV3 3J4UH 1JMUB 2YPJA 4M4PA 2DVAA 2BGPA 4OI1A 4QXKA 3GBFA 1KJLA 1VBC3 3AKTA 2VMHA 3VKNA 4XF4A 4CDXA 1V6LA 3AJZA 1Z7S2 1KDMA 1TME1 2OQ6A 1Y4WA 2VCBA 2VOTA 3PJQA 4Y5Z0 4AI1A 1PGL1 1XBFA 3FZ3A 3WW2A 1LODA 1OMIA 3POGA 1QXPA 2C9AA 1WMXA 2X5IC 2TNFA 4O7XA 3PDQA 2WZ8A 3V56A 1C28A 3TNPB 3H8RA 2E9QA 3FFZA 1IS5A 4NJ4A 2BV4A 3D4KA 1OA2A 4Y5SA 2MNGA 1GANA 3E5XA 5D8AC 4FPCA 3WF1A 1ZBE2 1VPHA 2EIGA 4IGQA 3MF6A 3T08A 3PVNA 4M0HA 3DYOA 3B3QE 2WL1A 1JTZX 4N53A 2P1BA 4XZPA 4YG3A 3VZNA 5HV0A 5JVVA 3WSOA 2XJUA 2V73A 3L2YA 1W8FA 4OHWA 2IC1A 2HYXA 4HVQA 3JQWA 1GUIA 2Q8OA 2AEZA 2JDZA 2LRPA 5CISA 1QXRA 3TN91 4M00A 4OVEA 5DDJ2 1TZOA 4YW1A 4NVPA 5FZFA 5I0RA 1W2TA 1ULOA 4KL1A 4JKMA 1W8WA 4YVWC 3N4MA 1SPPA 1G86A 4AQTA 1I5PA 2J22A 2OPKA 2P34A 2VAUA 3AYCA 4XJ9A 1P8JA 5I8YA 2XJVA 5FY4A 3VBOA 3WX5A 4DEQA 1JI6A 3OCPA 1QHDA 1W06A 4BM8A 4MHRA 2VE1A 3K51A 5C4WA 1UD1A 2R073 3Q8AA 5FZ8A 5F1RA 1B35A 4UFKA 5FZAA 5BV6A 3WCSA 3E5QA 4IEOA 3ZPOA 1UYPA 2A73B 4QQ2A 1YJKA 2BOIA 1RUI3 2NN8A 3IIIA 3SCGA 3MHZA 4BE3A 3AKRA 5F5CA 2J1UA 4Q0QA 4UFLA 1RUE1 5E6HA 1EY2A 1YI7A 1CONA 2ERFA 1RUF2 2JKBA 2PHLA 1F31A 2WO2A 3NJVA 3BALA 4JKLA 3USUB 5B2GB 5CAZA 2Y60A 4HPKA 1WA6X 4F7ZA 2A3XA 3ZXKA 2W0XA 4TTGA 1QF3A 2VUDA 5LCWL 2JG8A 3I2FA 4AG4A 1M06G 3DXUA 5FZOB 3TNQA 4KBZA 3PTYA 2JX9A 4QMAA 3T2TA 4TSVA 5DAXA 4ISQA 4FPGA 3FHQA 3VV1A 4Z92B 2B46X 2GC1A 4LBNA 1LNSA 3HOBA 3WDVA 4XC9A 3ZYJB 1RUG3 2HWF1 3J7MA 1TME3 2DUOA 4GH4B 3VZOA 2BJSA 2QDRA 3RJRA 2PAEA 4IW3A 1NY72 2XWBB 2YU1A 4CP9B 1BJQA 2Y0IA 3IMNA 5BNOC 4DINB 3LIGA 2IXCA 5HI0A 2ZEXA 1ENXA 2ZGSA 5FFOC 1W8ZA 4P00B 2Y6FA 1BMV2 4YZ1A 2A70A 4N9HA 2G4IA 4NHXA 3DUIA 1PO21 1MS5A 1H6YA 2L9LA 2ZPXA 3AFKA 4Q2FA 4RS5A 1JZ7A 3I2HA 1QMJA 2QJVA 4Y1YA 1LOGA 3K4AA 1QDCA 4AVAA 4IV1C 3KV4A 3VDDC 2QQPA 1W6PA 5FDBA 4NAOA 4GB33 3P5BA 4JDOA 3TN93 3I3EA 3RPQA 4AHZA 1YWKA 3ZOIA 3O1PA 1DP0A 3ON7A 3HR9A 4YZ2A 2D3RA 4LEJA 5EYXA 3CO2A 5C3RA 3ZSEA 1QH6A 4PIYA 1CD3G 1YQ5A 1N1YA 1HN0A 1LECA 2BFUL 4K6BA 4N90A 1GZTA 4I0WB 1JZ4A 3I3BA 1D4VB 4Y1VA 3WP5A 4IEWA 3GZUC 2PXJA 3E6DA 2D7FA 4NHLA 3THCA 1OOPC 2VCCA 3DCQA 4IL7A 2HWD2 5LWBA 4JGZB 3H1MA 3OD0A 3ZFFA 1UY1A 3MW2A 2A6ZA 2ARXA 3AP9A 4HG6B 2AEYA 3AMHA 3GBWA 3ZXLA 5H9PA 4JTNA 4AVVA 4R8HA 4K8RB 4JTOA 2BRTA 4DY5A 2GMEA 3WP6A 1T2XA 3I3DA 1GP6A 3TEXA 4BH9A 4AFCA 2KXLA 1KRIA 3HNBM 5FWJA 3ZKUA 1G6NA 1SBFA 4COWA 3EHKA 4H14A 4J1WA 4YVSC 3LFIA 5C71A 3HN1A 3WY6A 4FI9A 3O12A 3UKVA 5A7WB 1YFUA 3WDUA 3LFMA 4CP0A 2VG9A 4LPLA 1ND2C 2J1SA 1HRV3 4XIOA 1Q8PA 5H9RA 1R1A2 3FLPA 2XJSA 4JQRA 2VO5A 4P9JA 4BMBA 4C90A 4FOQA 1CZSA 1GLHA 1LOAA 5JXGA 4NE9A 4ORFA 3Q8BA 4AQSA 3NV3A 2PHFA 1H8TC 1JZ8A 3O1UA 1AR73 1XE0A 3ASIA 1X50A 4OI4A 2HWF3 1SLCA 2WNEA 2MPFA 4CDWB 5KC6A 1C4RA 3WXPA 5DAVA 2Z4FA 3V65A 4E27A 1UX7A 5FPXA 1COV1 1W2UA 4J6GA 1UYYA 3RI9A 4PI0A 1M4WA 1C5IA 1H6XA 1TEIA 1NX9A 1AX2A 1DQ2A 2VTXA 4XF9A 3UESA 5L73A 2W1WA 2A1XA 2SLIA 4CEWC 1UZ0A 5C6CA 1QJEA 2GH8A 2HWE2 1PO23 3PHMA 3BB6A 4OHVA 3ROUA 1C8M1 1OXCA 2YBKA 2PN5A 2VZ1A 4W6XA 4YM1A 5IVYA 4BMEA 5J37A 3LDRA 1WGPA 3VBRC 5IAXA 4P5HA 3VZLA 3KV9A 4CEYC 1AHSA 4DMIA 2P3IA 4BIOA 5A1AA 1NCQB 3NV2A 4PLOA 1ASJ3 4WM8C 4E8CA 1VBA3 3VKMA 1LGCA 1RHI3 1S2BA 2YY1A 2Z69A 2GN3A 4IEYA 4J1XA 1OLMA 4AI0A 3NNGA 1XRUA 1SBDA 2QQOA 3PUHA 5FIXA 3RWKX 1UWWA 3WNOA 2DUQA 3ITQA 4PQQA 1ZBA3 3RG0A 2ZHLA 2ZGRA 1QOOA 3BODA 2HWC2 5DMYA 2D5FA 3LQCA 1EPZA 3EXUA 4CDUC 4NOTA 1HRI3 1GNYA 4AVCA 4K20A 5FYVA 1V6OA 1NOVA 1H9PA 2ADDA 2OX0A 2QZ2A 4IXLA 5FREA 5LA2A 4Y24A 4CU7A 5BY5A 3ZX7A 3VBFC 4QGNA 2WT0A 4LO5B 2V4VA 1U5XA 2E53A 5IAVA 4DNYA 4NPMA 3ZXGA 5IK5A 2AH2A 1Y9QA 2D6LX 4XFGA 4OQ8A 4Q4X2 2D97A 1DGLA 4FPEA 1SCSA 1DZQA 2HLEA 4E2GA 2DFCA 2Z5WA 2Q8CA 3IBMA 2A3YA 3RWNA 1R082 3WD5A 3FFQA 4LA3A 1A8DA 1L7QA 5LA9A 3T4VA 1KFUL 2VH9A 1XJAA 4XJZA 1UU6A 1PVC2 3M3IA 1UIJA 2CWMA 3USUA 3VBUB 1ZRCA 1DFQA 4JGYA 1NE4A 3MYXA 2VBPA 1ND3A 1NCRC 2B8MA 5GLWA 2VVDA 5FWEA 3RFRA 3ZFEB 4A42A 4XTMA 2WZPP 5CG9A 3AZYA 1DGWA 2ZGMA 4XOGA 5ANQA 5FZOA 1XC6A 1MS4A 2JIJA 1COV3 3WG3A 5KXDA 4CU8A 4META 2QTWB 1O5LA 2WLPA 1W6MB 3UJQA 3POEA 4S2GA 3NW4A 2EAAA 4SBVA 1W9WA 1US2A 1W9SA 2D44A 2KM2A 1AYN2 3VBSB 4BK4A 4MXWB 4GH4A 1EUUA 1NUKA 3E6BA 1FPN1 1C8M3 1QNWA 3A22A 4Q27A 5CKQA 5DAPA 1PGW1 2PLV1 3N9MA 3NAPB 1RUD3 4AVBA 5IK4A 5JOWA 2Y8KA 4PHZA 3HJRA 4JZRA 1REFA 4XDPA 4BHPA 4QKDA 2WS92 1N47A 4ES8A 5LRSA 4YW2A 3PU8A 1AR62 2YGMA 4PDWB 5CKMA 4L99A 3J7NA 1HJFA 3PVOA 1KXGA 4EN8B 3BIEA 2XBO3 4G4FA 4P9IA 4XUNA 2WSVA 1LKNA 1IOAA 2FQPA 3MBWA 3ATGA 2XL7A 1AR92 1TNRA 2HEYF 3M3EA 4HLTA 4RYDA 5CA6A 5T54A 3VHNA 4M0NA 3WUCA 1J1LA 4HK9A 5CFCC 1NA1C 2GC3A 4MOAA 1NYWA 3MI8A 3PUIA 3WDWA 3WNMA 5C8CC 3NQHA 2VR4A 3RS6A 2OT7A 3AM2A 4S2FA 5KHKA 3U4XA 4AEMA 2JG9B 1GU3A 2RS32 3I2GA 2E31A 4H7LA 1WW7A 1FX5A 3KT7A 4HZFA 3JBG2 2UYBA 3VBHB 4I3PA 5I0TA 1ODMA 3H3ZA 3LEIA 2PHXA 1AR83 1PK6B 1XE8A 1PGSA 5IW0A 3T0DA 1VB2A 3ILRA 5HXVA 1QOSA 3SKVA 4KGGA 1W2OA 3OG2A 1EV12 2EF6A 4QM8A 1F5FA 5FZDA 3X29B 1RL3A 3KLSA 3JUUA 4HN1A 1FATA 4UFHA 2WO3A 4P02B 4XHXA 4AFAA 5L7OB 4CCMA 1SMVA 1RXGA 3AXDA 2V4AA 2UWCA 3W58A 1SLBA 3ZN4A 2CDPA 4QX5A 4RHV1 2GU9A 4QDQA 4XJUA 1O6UA 1DF0A 4BXSV 3HWJA 1GR3A 2RS12 4QHBA 1VBD2 2ARAA 2BBVA 3I4IA 3S6PA 3WVJA 4COUA 4BB3A 1E5HA 3HBZA 4CXXA 1QJU3 1JU3A 1VALA 2W94A 1CX4A 5LZ6A 1AUYA 1MZFA 5DAWA 3UYJA 2CAVA 1O3TA 4JX0A 3D82A 4CXYA 1W0NA 5GLUA 4CDWA 1YXWA 4M3CB 2VCAA 4FVVA 1FPN3 5APAA 2W87A 3I2DA 2Q30A 2UWBA 5FZ1A 3B01A 1QQP2 2HJIA 3OPWA 5K0UC 1W6OB 3J7HA 3MW4A 1ZBE1 1W6QA 1VLNA 3S5AA 1O3RA 1AX1A 2J1EA 4LLFA 3TOJA 1PX3A 5FCCA 3BI3A 1V6IA 3HVDA 4Q8LA 1BVVA 2WBKA 2R0HA 2CGPA 4QPYA 2CU5A 3AKSA 4GKXA 1Q56A 5GALA 2BNNA 1OQDA 4L97A 1G9CA 3NJXA 4YRDA 3O1TA 4CCKA 1NCQA 2JE9A 1HX6A 3LGRA 4FQZA 3VN4A 3CDZB 3FX3A 4Q0UA 3MFAA 5A3MA 4XFAA 3QCWA 1VRH3 2CTVA 4QPIB 1VP6A 2LW8A 4B7EA 4HN0A 2QBXA 3CJIC 5BNQA 1H8VA 4BQYA 5LBBA 1W9TA 1XE7A 2BGCA 1FOD1 1KD7A 1GOHA 4NHKA 1PVXA 4AGVA 3A0KA 5AC91 1MS9A 2GMMA 2RS53 2GNBA 3LEKA 4OHZA 1CPMA 2E7TA 2RDSA 3O14A 3C3VA 1UZZA 1KFXL 1UXZA 3GZEA 2CV6A 1XQNA 3OGVA 5GLTA 1WUVA 2XHNA 1A78A 3RYPA 1OQEA 2Y34A 4HK8A 1WA4A 4HT1T 5HV4A 1QJY1 2ZA9A 4NHMA 4KWUA 3HT2A 4BLIA 1CX1A 1CIWA 2RMU2 5B4XA 1LOBA 1FMD2 2VUAA 3HQXA 4FOYA 3RJ2X 5EZWA 2WO1A 5CG8A 3FN9A 4RR3B 1BK0A 4YZ4A 1AYM1 3HD8B 2HH9A 4AGGA 2WSUA 2I74A 2RR11 1HB4A 3WP4A 1VB4A 1JYNA 5CZKA 2VQTA 5HCAA 5BNNB 4IEVA 5FZ7A 3VBUA 1K12A 1K45A 1QEXA 3ABZA 1Z7S3 1D4M2 5F5AA 4D94A 2LM3A 4BQ3A 4Z8BA 2YB7A 5I8TA 4KG0A 2IVIB 1K5MA 3B00A 4D8MA 1UKRA 2VL4A 3IWZA 2VQAA 1YQ6A 1QU0A 2WLQA 2JICA 2D40A 2GNDA 4FBFA 1BK1A 1W6MA 4X6RB 1UPIA 1V00A 1O59A 4YGEA 2YV8A 4RL7A 5ANNA 2WC2A 3SLIA 1OC1A 2RHPA 3JU9A 1N3QA 4C0BA 1ZBE3 1GOGA 2QZ3A 3AJYA 4EN0A 4DUWA 4I0AA 4R4ZA 2DYCA 3ZR6A 2PAMA 4MXWA 2VZPA 3POBA 5FY0A 1SLTA 2C4XA 4LK6A 2RVAA 3ZDVA 2WDBA 3OBTA 4CXWA 3FJSA 5ACA2 3MLJA 1OUSA 1PNFA 2NM1A 1W6NA 4BIFA 5DDJ3 3LF7A 3PJYA 5FPAA 1LGNA 3A4UA 3OUJA 1W2AX 2P5BA 3ILFA 1HW5A 4D69A 1CAWB 1BBT2 1X8EA 4E2QA 4MO3M 5DXDA 3VDBA 5FK8A 4I01A 3AFGA 3QD6A 2EVXA 3RQ0A 5IVVA 2YXSA 4E4DX 3S7IA 2OYZA 3HPNA 1CIYA 1J84A 1OLQA 3W59A 3AMPA 1GWLA 1RJ7A 2FDHA 4HKWA 5GZFA 2CHHA 2FZ1A 4FP3A 1UZVA 2KR2A 4Y1XA 5JZGC 2CWSA 4Q4Y2 4J25A 1GZ9A 4RFRB 2W52A 1MQTC 1NQDA 1AL0G 3BPSA 3C8XA 4ARXA 1N3OA 5JPNB 1RITA 1RUF3 1WLTA 3VBHA 2Q8EA 3VL8A 2OVUA 2WZEA 2X5IB 1Y43B 2JIGA 1PK6A 4JQTA 5L19A 5C9AC 4CTEA 4I0BA 3BGAA 2FDIA 4UFIA 4GALA 4GMP1 1DDLA 1PX4A 4Y22A 2Y64A 3M7AA 4LBLA 1PIV1 1NLSA 4AEKA 1XNKA 4XXAA 4BK5A 4FTEA 5D8AB 3OPTA 1RUC2 4NHYA 4K8FA 4XFIA 4V1PA 1FNYA 4R9AA 4B1LA 2BW8A 1AF9A 2SBAA 4ZS2A 3IKWA 4AI2A 2EICA 2WA4A 5LY1A 1CZTA 1WCDJ 2O0OA 2RV9A 4LE4A 5FYHA 3WQ7A 1YLLA 1DCSA 4L8QA 5EJ3A 2C9KA 4HOOA 3AMNA 3AXEA 3POFA 4LK7A 1E5RA 4ZU7A 1POV3 2I2SA 4E9KA 5BNPC 3TEYA 2OUHA 3B5LB 5LBFA 2DBNA 3LOBA 2FBEA 1HB2A 2PELA 4LO7A 1HXS2 4MGIE 3VZKA 3WNKA 3RZHA 4YVWB 3BN6A 1GYKA 1PMJX 1UL9A 1RGSA 2OXBA 3ZPYA 4WVZA 1UOGA 1RUOA 3IN9A 4YG0A 4IE6A 2ILMA 4AXOA 2LS6A 3K2OA 3KWVA 3AMMA 4CDXC 4UW3A 3HIFA 3QACA 4R4XA 4M3CA 3ZYGA 3GCWA 3EBRA 2AZ5A 3DKWA 2Y6KA 2O1QA 3WQ1A 1TE1B 4AW7A 5IT6A 1I1EA 4COYA 2ZKNA 2JKXA 3SXWA 4YW3A 1TNFA 1W6OA 3HNYM 3RZKA 4KU7A 1UMHA 5FXWA 3B9CA 2Z79A 5E88A 1QJX2 3GHMA 1IQAA 2XUEA 3O5SA 5A7QA 4ASKA 5A6YA 2UU8A 4NIHA 1DYPA 3OPZA 4NPRA 1D0GA 5I8SA 5JOYA 4PF5A 3HMYA 2DDUA 2EIEA 4HFSA 5FQ0A 3ACIA 2HWC1 5FMOS 4AVSA 1RUI1 2P37A 2P3YA 1PNGA 2WN3A 4XW3A 2HWD3 2JXAA 5DABA 1X7NA 1S0DA 2G9FA 2VW0A 2AGSA 4KWKA 5EP9A 2X10A 3VKOA 3MPPG 4B4QA 4URAA 5F37A 4QPIA 1WWYA 5FZIA 5LEJA 4Q8KA 4CCNA 3C7OA 3PNAA 1JYTA 3ZXDA 1K3IA 3GYDA 3WOGA 3ES1A 3SKJE 3VBOC 1GMMA 3U78A 1UAIA 4NIDA 1UY0A 5BNOB 3DF0A 1JBCA 4D6QA 3WP3A 3J26N 4I09A 4TLGA 1SBEA 2WA3A 5IVJA 4U36A 5I0DA 1R1A3 1RUJ2 1VAVA 2WFPA 4M4RA 4PLNA 1CAVB 1JOJA 1OA3A 2RE9A 3UL2A 5CB7A 1RUG1 3MF9A 2VW1A 1UOBA 1UPSA 2W91A 2OZ6A 1LESA 3KD4A 4Q4V2 2XWJB 5J3UA 1QGLA 5KXCA 4A7YA 3IIAA 4IV1B 4Q0PA 3SITA 1OFNA 3VDDB 2YYOA 4LHNA 3I7DA 2YHJA 3MW3A 5I0UA 4EZHA 2UY8A 2AC1A 4RR3A 5LBEA 2AENA 1UO9A 2VUCA 1C8NA 5FOJB 1GP5A 1T6GC 3BPZA 1UMIA 3NKTA 4Y20A 5JXHA 5BNNA 4UF0B 5EXOA 1SDDB 4AEDA 1ZRRA 5K7PA 1WW6A 2HWE3 1B09A 1GFF2 1RVF2 5C3QA 2XKPA 3OOXA 5A3PA 1OQ1A 4QX3A 2GN7A 2GP5A 1ULFA 1ENSA 1OFSA 1OOPB 4L9BA 4Y1UA 2VPVA 1VBE2 2XONA 4GB31 5JDBA 2IZWA 4Y4RA 2WWJA 3JCIA 1DGRN 3WCRA 1SCRA 1AXZA 1U0AA 2WZR2 1UKGA 3BU7A 3P3NA 2UY9A 4NRPA 4NWWA 5FYSA 5JCTA 2VY0A 1FYUA 1NAEA 4GQ7A 2K46A 2F6BA 3KZ4C 1ZZ6A 4AVTA 2VNVA 3K48A 1CGPA 2NMNA 2RM22 4ZU4A 4YVSB 3USSA 2VC9A 3IT8A 3I59B 1N3PA 5JLVA 2HWC3 2JD9A 1BYHA 2KA3A 1EAH2 1ND2B 5FTTC 5AFEA 2OA2A 2P3KA 4EZ4A 4LHKA 3P3PA 5FZBA 1YUDA 2X8KA 3KHCA 3JD72 3LEGA 1H8TB 3I49A 1W28A 1UZYA 1IG0A 2NP0A 2B42B 2W68A 2Y6JA 3ETQA 1JXNA 3WF4A 2YPDA 3OY8A 2GZWA 4NMIA 1QNYA 3NKGA 1Q8QA 3Q8CA 4RQPC 4Q4X3 3T2PA 2B7YA 4BQWA 1HRV1 2ENRA 2DVDA 3BTAA 3FMGA 3K46A 4A2UA 3K4DA 2WR9A 4CPBA 3ZFFC 4FPJA 1R083 3F2ZA 1A6CA 3KB5A 3ZN5A 4A3ZA 4CEWB 4DRVA 2MEV2 1CAUB 1AR71 2E7AA 3ZYBA 5FPLA 1PVC3 3KVAA 4HANA 4B1MA 2X5IA 5ABJC 1UW8A 4XZUG 4YLZA 4NAMA 3RRDA 4FPFA 2VMFA 3VBRB 3NJZA 5DPNA 3ZFGA 1GOFA 1WW4A 4CEYB 2EIDA 1LU2A 2WQZC 4DPNA 1O8SA 1WBFA 3U07A 1PMHX 5CIRA 4GXLA 4WM8B 5D8AA 1CWPA 2VXRA 2ZX0A 3KT1A 4O65A 1GV9A 4AWDA 2UWAA 4INDA 1AL22 2XG3A 5FXVA 2ZEZA 3TEWA 3OYWB 5FP8A 3C7HA 3SCFA 1UCXA 1W2NA 4ZKTB 1LHUA 2DCTA 4W6WA 4BQ1A 5T5PA 1UIKA 1HN1A 4YYOA 1AYN3 5DUVA 5FY9A 4QPGC 1SFYA 1N1TA 4PLMA 4Z2AA 3JB4C 3VD7A 4CDQC 3H3UA 4CDUB 3MICA 2W2IA 3NWKA 4XCAA 4CP2A 1ASJ1 4YVWA 3GZAA 3I2KA 3S30A 2J42A 1VBA1 4LT5A 1RHI1 3H50A 1XNAA 2WS93 4IE5A 4QX0A 1RTVA 4MG2A 1AR63 3VBFB 1RMU2 2ES3A 3KVBA 1CAXB 3MIBA 2WYFA 1ZBA1 4LKDA 1PM7A 2JENA 3K75B 3VHPA 3AZZA 2R16A 1R092 3NV4A 4R9CA 1AR93 2QQUA 3TYJA 1HRI1 5KHJA 2W39A 1DBNA 2Y6HA 3J8F2 3PMSA 3ZXAC 5F7UA 2JJ6A 2ZX1A 1UY3A 1ODNA 1W8UA 4PCRA 2NMOA 3NNJA 5F9TA 4MSVA 3CF6E 1LU1A 4JCKA 4XYXA 3E6CC 2BWCA 3THTA 5FJHA 4LMFA 1LOFA 4XPVA 1WLCA 4I30A 2RS33 4AI3A 4A44A 2W9XA 5FZMA 1NCRB 2BFUS 3RGBA 3IMMA 3JBG3 4FO9A 2YFUA 4LBQB 1V9U2 4OZXA 4QX1A 1OD3A 1RYYA 3CZJA 2G9GA 2LROA 3FLTA 3BTXA 4QQLA 2IFWA 1UYZA 2NYYA 2ZMKA 2R062 2B9VA 4Y5TA 1S1AA 3U0ZA 2IXKA 1FV2A 1W9YA 2ET1A 2V5DA 3BVCA 1GKBA 2VVEA 1Q5OA 5FMDA 4OFGA 5AFBA 1ZM1A 1OA4A 1H4HA 1PZ7A 3CIHA 4LA2A 3NNMA 1US3A 1V6KA 5BNOA 4PJYA 3D5OA 4MZUA 2RS13 3SISA 3WW3A 4YARA 4K7JA 1XSRA 3WQBA 1VBD3 2PYTA 5CYYA 3MIGA 2D5HA 4A45A 1R1ZA 5FXZA 4YW6A 5A70A 1BQPA 2E7QA 4QX8A 4QKFA 4YW5A 2B45X 5EV7A 5F3EA 3WDXA 4N43C 3R4UA 3KGZA 4Q4W2 3GBGA 4MYEA 2GC0A 4ZZ8A 2JDPA 4KNCA 1HKDA 4JKKA 4IV1A 4HVOA 3RI8A 4BU2A 3VDDA 1RUD1 5KXBA 3A0NA 1SFNA 4JGYC 4EROA 3URFA 1ND3C 2ZJCA 2RJLA 3NO8A 4Z1VA 4KI5M 4G3YC 5CFCB 1Q3EA 1NA1B 5C8CB 4QU2A 4XBNA 5LA1A 5JXIA 1WCKA 1Y7BA 2ZMNA 3AVRA 3F95A 5F32A 2DCYA 4CPBD 4DEVA 2A6WA 2W1UA 4UF0A 1X9PA 1D7PM 4FOWA 1G7YA 4YG6A 2IXLA 1BKZA 2WQ8A 1E5IA 3R0RA 5EJ1B 4E4SA 1HJGA 2QQVA 2XBO1 5HPOA 2J1RA 3GHNA 5J36A 5JIUA 1ZZ9A 5FUPA 5IVBA 1OOPA 5CBLA 2QQJA 1D0HA 3UGHA 4CZSA 2YG0A 3N3HA 2YGLA 4CRQA 4LJHA 3LA2A 2HYKA 5T55A 4QX2A 4A41A 5CKNA 4CE8A 2C1FA 2R042 3HT1A 3ZMOA 1J3QA 3KV5A 4NRMA 4P14A 2BYVE 4XUTA 5HBAA 5FZ4A 1NZIA 3ZYHA 1HQWA 3O0WA 1FT9A 2BZDA 3NRUA 5CEHA 2DU1A 3S0MA 2ZZJA 4IERA 1DLLA 3LCPA 3I2IA 3CEWA 1AR81 3Q8EA 1YFWA 4YVSA 2XHKA 5FY1A 3I59A 5EQUA 2IFRA 3T2QA 1PZ9A 1ND2A 4XBQA 5A3NA 3IAPA 1ZREA 2F4PA 4ASLA 3ES4A 5C5TA 1CN1A 1RXFA 4DRRA 2DURA 1LHVA 1S2KA 3N9PA 2XLFA 2R1DA 5FPUA 4CU6A 1YYNA 2YC0A 5A3WA 4D3WA 2AYHA 5JXJA 2FD8A 3CHXA 2OIIA 4NIIA 5FMBA 1MR5A 2RMU3 5D1IA 1FMD3 1HV0A 2VOWA 2EXIA 4FPOB 4H3WA 5IK7A 3SNMA 3NNFA 2GC2A 2WFF2 1QJU1 5K0UB 4CEWA 2P6HA 2VMCA 1D2SA 5T5OA 3VKFC 1CAUA 4NPLA 3H42B 4LLOA 4ZY9A 2O8QA 1D4M3 3A7QA 1PGL2 4CCCA 4TZDA 2FMYA 5T5LA 3MZHA 4Q0SA 4CEYA 1BXHA 4ZXKA 4CP9A 2P17A 4FFHA 5KWRA 2D6NA 1V70A 4BXFA 3KQ4B 1YQ8A 1JOPA 3APBA 1RUH1 4FXKB 2VOXA 2DTWA 4XQWA 3VL9A 1MVQA 4GD4A 2NQYA 1S0CA 3CQOA 1X33A 4UBHA 3OYWA 1C5HA 5F6LB 3AL5A 3CJIB 3WNXA 3UT0A 2JDMA 4YM0A 2D3PA 3LSEA 2GNTA 1NT0A 1S4CA 1CJDA 1IGOA 2VBBA 2O14A 4CDUA 2JB4A 3AYAA 4OCTA 5ACA3 2BPA2 4GWIA 1JZ3A 2WNOA 3TN92 3AX4A 2WYSA 1K42A 3OGSA 1UU5A 3LOIA 1VRH1 4CU9A 5LW9A 1GZWB 1EUTA 1BBT3 5T3NA 4P5YA 1CAXA 5HCHA 3POJA 2P6CA 2W3JA 4L92A 5GM0A 1KQRA 2RS51 3EO6A 4FPYA 4JGZA 5J96B 1KS4A 4HL0A 5FZ3A 1G9DA 3KCCA 5FKBA 3E1F1 4F8AA 1JN2P 1TMF1 2XMLA 4RA0A 1MS3A 4UW6A 1MEC2 3DPRC 3DECA 3MDPA 3ACHA 3R6SA 4DO0A 2X09A 4ZXEA 1XYOA 2WNVC 4JHZA 1RUE2 2PHUA 4QQPA 4XACA 5JOXA 1OH3A 3H1WA 5JSOA 5IVFA 4K3UA 1D2QA 5EIYB 1DQ4A 3BTZA 1S0BA 2EXKA 2I45A 5A7WA 3QH7A 1YQCA 3AK0A 4LIUA 4EN6B 1SEFA 4I02A 3MGUA 2QQLA 5FK7A 2EA7A 3THPA 1UQXA 1LTEA 2ZKLA 4QKNA 1Z7S1 5FLIA 3AZWA 4U2AA 5LB6A 1NXMA 5D2AA 4Z07A 1YFXA 1V6JA 2CDOA 4IV3B 5K4LA 5FZ9A 1I3HA 2R32A 4A6OA 1KGYA 3KHBA 4HSLA 1UOJA 2PQSA 4HKOA 3T4HB 5FPBA 3SQOA 1LOEA 1KJRA 4AYUA 2AR6A 3IPVB 4BQ2A 4D7SA 3CNAA 4KQ7A 3DL3A 3O1OA 3AYEA 1HXS3 2VZSA 3ENRA 4JVAA 2DTYA 4OULA 5JI9A 4QB2A 1EPWA 1RUH3 5T52A 2BGOA 5FZ6A 3FBYA 5IVCA 1JW6A 5FUIA 3WNLA 3WHTA 3VUOA 1VBB2 3VD5A 3M3QA 1DGWX 2F17A 3ZDSA 3FLRA 1SDWA 5F8PA 2QQIA 1K5MC 5DDJ1 3POIA 3WDYA 5CFCA 1NA1A 1ZZ7A 5C8CA 2A6XA 3MV01 2FHRA 5JZGB 3NVCA 3ZSKA 2WJSA 4QKBA 1MQTB 4QU1A 1ULPA 5GZCA 1V6NA 4Z2WA 3I8TA 3UKNA 1REDA 4XF3A 2QFEA 2PQQA 4XABA 1GP4A 3LA3A 3W20A 2GH2A 5LATA 4WM7C 4YW7A 2FZ2A 4N7IA 2RM21 3KCXA 5LASA 4DY3A 5C9AB 2BEOA 4SLIA 5KHHA 5B4NA 4D0QA 3LIHA 2WNUC 1UX6A 4LKSA 3PVEA 1JUIA 5L36A 2HBTA 2VZ3A 1NKGA 4LBOA 1N1VA 2PHTA 4XETA 4CCOA 1TMF3 4KH9A 4OQ9A 5DUXA 3CL1A 3KQRA 3N7JA 3MLKA 1AJOA 1OBNA 3PIJA 1S0FA 4XUPA 2R0FA 4LBKA 1RUF1 3SH4A 4JRAA 4EN9B 1RC6A 2DF7A 2JE7A 2QQKA 2VTFA 5IJRA 1LHWA 2WAAA 2VZTA 1S0JA 2BNMA 3ILNA 5BNPB 4LQRA 2VXJA 3KGLA 2VUJA 3IDAA 1LRHA 1NXD1 4E8DA 5L9BA 1Q43A 2CSGA 2AUYA 1J3PA 4AR2A 3WG2A 4AAXA 1X82A 3O0VA 3NL1A 4ZPIA 4O61A 2K2SA 5KHIA 5DQ0A 5H9SA 1RUJ3 4QHZA 3VB9A 1OPOA 4CDXB 3T0BA 4Q4V3 1VE0A 1G8WA 4MHUA 4XJ8A 3R4DB 3ZFEA 3K77A 1POV1
chains in the Genus database with same CATH topology
4DXZA 2O8OA 3VBHC 1NY71 5IUQA 2DVFA 4WVMB 4AI8A 5JSRA 1FXZA 2DCKA 1COV2 5GZDA 1BMV1 4AFDA 1ZX5A 4FAHA 4XJWA 2WQ4A 1IS4A 2B5HA 2ZGUA 1BEV2 2VNGA 3VBSA 3W9AA 4COVA 1ENRA 2NZ9A 3FUQA 3B9IA 1RVF3 1C8M2 3NAPA 3G6JB 1O4TA 2ZHKA 1VBE3 4ATFA 5A32B 3AP6A 2C5DA 3AP4A 4EWDA 2P3JA 4KWLA 3D0SA 3VHOA 5CFDC 4PDWA 2WZR3 5FO7B 2OW4A 4OLLA 3CJIA 1ULEA 1N1SA 3JQXA 3SHRA 1U12A 4YGDA 1DHKB 3VBOB 4NWVA 2XVGA 4XQ4A 2ETEA 2RM23 1O3QA 1WD4A 2HWD1 2ZX4A 2ZGTA 1HIXA 3WW4A 1EAH3 1OSGA 1ZZBA 2JG9A 2GDFA 2IXHA 1GZWA 3U10A 4Q26A 3JD73 4UW5A 4IEPA 4R9DA 4XJAA 4ISRA 2XJQA 4BA6A 2PHRA 4BOWA 1GNHA 2XVLA 4LBJA 2VNRA 4RD7A 1NE6A 2Q4SA 2Q1MA 2PHWA 2ZGQA 3EJKA 4XFFA 1G9AA 2WT1A 1R1A1 1EP0A 3OGGA 4YNIA 2LTNA 4NO4A 1C1FA 2QVSB 2MEV3 3N36A 5L7OA 1JHNA 4X8NA 1LHNA 3DGTA 3M3CA 5FPZA 4K9SA 2Q5TA 3ZYPA 3UJOA 2DVGA 1QXJA 4FT8A 5J09A 1GZCA 2TBVA 2WWSA 3KSCA 3IDCB 2XVKA 1AL23 2HWE1 4M01A 3WV6A 4Q4W1 2VQ0A 5T5JA 1DQ6A 4IV3A 1C3HA 1CQ9A 5HCBA 3L9JT 5I91A 4YM3A 1F2NA 1FPN2 1SACA 1MZ5A 3E97A 3IPVA 1J1TA 5GZGA 1PGW2 2PLV2 4X8PA 5CU1A 4C91A 4MLOA 4C1XA 2XB6C 4GMP0 4Q1RA 2R6QA 5K8SA 3AP5A 1H2MA 4HKLA 3UV9A 5GLVA 3V0AB 1RMU3 1WMFA 1VAMA 4IEUA 4AEDC 4AGRA 1JH5A 4N53C 4K21A 1X36A 4RQPB 2D93A 1YIFA 2VW2A 3O7OA 5BPXA 4DOUA 1R093 4QT6A 4OUMA 1NG0A 3J8F3 5TSWA 3ZFFB 1PZ8A 5F5QA 3M2MA 5K9YA 4XTPA 4O9GA 3Q9OA 4XFBA 3PLQA 4KGQA 4A7ZA 5ABJB 3KT4A 5C9AA 1V9U3 5KBFA 1KITA 4Q4X1 3VHRA 2A6YA 5C4WC 2GSYA 1B35C 4OUSA 5GJ6A 3BCWA 2CYFA 3TB0A 4K1ZA 1R081 2HWB2 1URXA 3NV1A 1ZNPA 1BZWA 2EAKA 4FAGA 4LULA 4P9YA 3MFCA 1YRZA 1PVC1 4Q1PA 5FRAA 1A8MA 3PVBB 4L11A 3ELNA 4NN0A 4BM8A 2HEVF 4QPGB 4UXAA 4FPKA 4PIXA 4CDQB 3TRSB 5FO9B 2ZX2A 4RHV2 1AJKA 1ULGA 3SH5A 1QKQA 3UKTA 2JG8C 4QGMA 1XU2A 3VKLA 3WR0A 3HAGA 4IQPA 4ATEA 5DG1A 3N7MA 3BOPA 2LUWA 1AYN1 1S0IA 4AF9A 4Q4W3 4PQ9A 2ZGNA 3OD4A 2ZMLA 3BOWA 4XILA 4WVMA 5CNAA 1MZ6A 3ECQA 1PO12 2LALA 3POSA 3ZFGC 2XLGA 4B4RA 3AZXA 2WS91 4F3JA 5J7MA 3POYA 1AR61 4E4ZA 4XIKA 4LO4B 2BVVA 1ULCA 2H6BA 3RZZA 4RS5C 1U5IA 3WLUA 4BCUA 1AR91 4Z82A 3H8UA 5A32A 1UN1A 5BYNA 1JUHA 3QOPA 2ZS6B 2B9UA 3O0XA 1SLLA 2R043 1CAWA 2K9ZA 1H0BA 1DZRA 2RS31 4XFHA 3JBG1 3RMXA 3FE5A 2ATFA 4YFWA 2H6CA 4YSFA 2BQPA 2B39A 5LRRA 1FOD2 1REEA 2ZOEB 4HVRA 5AC92 1F8VA 2IXIA 3M70A 3H7JA 1MEC1 1EV11 3T1MA 3LKJA 4QM9A 4JV4A 4N43B 3LA7A 2EALA 4IEQA 2VVFA 4DFSA 1XNCA 1LOFC 2VU9A 4JGYB 1QJY2 1ND3B 4AHYA 2RS11 1BCXA 1VBD1 1S0GA 4BZ4A 1AXYA 1OKQA 4XFCA 1LENA 4OI2A 2WFF3 1AYM2 1NZCA 2RR12 5EFUA 4EJRA 5IK8A 4PBPA 2WKKA 4RGAA 2ZHMA 1ZZ8A 5GLZA 4RFT0 1IKPA 3JZVA 1O4ZA 1Y3TA 1HV1A 2C0ZA 2EXJA 3ACLA 4MX3A 3VZJA 1WLWA 5KC5A 1PHMA 5JAXA 3MIFA 1QQP1 1XU1A 5LK7B 4IEZA 3KCYA 1IHMA 1LEDA 1ULDA 2K0GA 2HKXA 3GNEA 1VBB1 1E57A 3N35A 5DUUA 2QNKA 1G9FA 2IWGB 1XNBA 2BVBA 3FWEA 3ZYRA 3V0AA 1CPNA 2A71A 3DN7A 1YIPA 3B94A 3H0OA 1DQ1A 3JB8A 4WV8A 3QBQA 5JPMB 3L2HA 1YNAA 4RQPA 1H9WA 1MS8A 1OPMA 3IDEA 4Y4YA 4AQ2A 4JRLA 1IPJA 1AZDA 2TUNA 5DUWA 2D43A 3LSDA 4AHXA 1MEC3 1EV13 1HQLA 4JC1A 2XL9A 3M1HA 1RUE3 1S55A 4MH0E 5ABJA 1O4YA 2QCSB 4FXGB 4FQ4A 1CR7A 2RMU1 3TBDA 1FMD1 3ZIXA 1WCSA 5J98B 2ARBA 2GAUA 4FP2A 1J58A 5T50A 3OJBA 1WBLA 1PIV2 3V0BB 3R4SA 4A7KA 1CAVA 1VBC2 5JWPA 5SV5A 1D4M1 4EN7B 2DWRA 4QPGA 4P9XA 2CY6A 3M3OA 5I0SA 4OHYA 3MPBA 5E8AA 4CDQA 2JEMA 1HLCA 4FPLA 4MGZE 4XEZA 4YGBA 4I2OA 5JOZA 2ZHNA 4IESA 1C1LA 1IZ3A 5A3LA 4BPZA 1AXKA 1QQP3 3LB9A 2GALA 1ALYA 1WLDA 3VGIA 1WMDA 1H1MA 1W6QB 1BEV1 4H7MA 1Q8SA 2JD4A 4DQAA 3T1LA 1VBB3 2DCJA 4GH4C 5ACA1 1PMIA 1W0PA 4XBLA 2WT2A 1KS5A 2IXJA 3WHUA 3DPRB 4LUMA 4B29A 1YO8A 4MV2A 1BBT1 2WNVB 1LJ7A 2P2KA 1DG6A 5DG2A 4ONUA 2HEWF 4S2DA 4S2HA 5C8WA 1H4GA 2CAUA 1VJ2A 2R072 3B93A 4GWNA 2YROA 1F5JA 1RUI2 3OGJA 4H55A 1LOCA 2YMZA 2D6PA 4D7YA 2R1BA 1YHFA 2BNOA 4G9SB 4Q4Y1 5C33A 5FLJA 5BXXA 1LCLA 5F6KA 1H8TA 3OF1A 1DGRA 3MIDA 2VMIA 2XGXA 4AFBA 2QDNA 1OI6A 1TQ5A 4QD2A 4MVTA 5GZEA 4LHLA 2R49A 2E63A 1IS6A 4WVWA 1W0OA 4BLJA 4FCAA 4JGZC 4LO8A 4ASMB 1RUC1 2ZX3A 4LE3A 4W65A 3WDTA 4XMAA 4N43A 5J48A 1QWRA 2Z2SB 4HSJA 2ZTNA 1RUG2 1TME2 2XJTA 1RINA 4B3NA 3OBRA 5HCFA 3VBRA 4E2SA 2XKOA 2ZGLA 3M8LA 1K5MB 2A75A 5DZEA 1HXS1 1WW5A 3KM5A 2D3SA 5DZFA 4WM8A 2W08A 1JYIA 1AX0A 1GNZA 4EWAA 1APNA 1CESA 4YGCA 3LWCA 3VLBB 1Q8OA 4MXVA 4WM7B 3FUOA 3UK9A 1BEV3 3ZSLA 4Q29A 2ZAHA 4PBOA 4Q0VA 3GALA 3ZXFA 5GKAC 3WT3A 4YM2A 2WNUB 2VGDA 4CDWC 1GICA 4GB32 1F9KA 1W6NB 2ZGKA 2X53S 3AKQA 5E1RA 3VBFA 1QJX1 2A7AA 3DV8A 5JIAA 3WG1A 2A5ZA 4URTA 1DZTA 1ZZCA 3ZSMA 1IS3A 2ZZQA 4IETA 1YJLA 3H7YA 1BVP1 2A6VA 4GWMA 1NQJA 1MVEA 3N7KA 4X6QB 2E6VA 3AKPA 3C2UA 4UBGA 5E89A 2XJPA 2CL2A 4GA9A 2YDEA 1NCQC 4Q4Y3 4LBMA 5JR7B 4NR1A 3D0JA 3SCHA 1QY4A 3RSJA 1FV3A 4P9LA 1NCRA 4LBQA 4XXPA 2DUPA 1VAKA 4IEXA 3WINE 1MS1A 4FSJA 4C1WA 4WZFA 2Y38A 2PHDA 5JI7A 3RYRA 2BTVC 4B8EA 4L2NA 2HWB1 1HRV2 4Y22B 4TLFA 3H1YA 1RUJ1 1RUC3 2XJRA 4QGLA 2TEPA 4Q4V1 1SLIA 1EYBA 1S0EA 2UURA 2NPIA 3MLLA 1AR72 1LULA 2YZ4A 3CLPA 3EQEA 2DCZA 2HWF2 4P9GA 4YZ5A 2Q1ZB 1J3RA 4D7TA 2GMPA 4JAAA 1H30A 2ZACA 5FBZA 3NSTA 4LO6B 1OHFA 3GF6A 2VMGA 4R52A 1UMZA 3PMEA 5CFDB 4JDNA 5DZGA 3V0BA 2VOKA 4FPHA 4GKYA 3SH3A 1H1IA 2RJKA 4CP1A 2XUMA 4TYSA 1PO22 4FOVA 1RVF1 4FTSA 3VBUC 4ZU5A 1JYCA 3BIWE 2PFWA 3ME2A 4K40A 1A3KA 1VBE1 2D6KA 3ZFEC 1O3SA 3N7LA 2FMDA 1PO11 1LHOA 4Y26A 2PLV3 2WZR1 1ASJ2 4DB5A 2D6MA 1VBA2 4AK3A 1RHI2 1W39A 1RB8G 1LR5A 1QJX3 1ZRFA 3CJXA 5CVRA 4PIZA 4QQHA 4XF1A 2VECA 4O9EA 1MZEA 2CNAA 2UYAA 3LZZA 3VBSC 1ZBA2 3WG4A 2NLRA 5A33B 1CVNA 1EAH1 5FQ0B 4OI0A 3NAPC 5BUVA 3DPRA 1HRI2 4F83A 4ES9A 1U5YA 1G9BA 2WNVA 4TWTA 3JD71 1HQNA 2ZAAA 1YCIA 3V64A 1QDOA 3IM0A 4XMIA 2AREA 4PDWC 1ZA4A 3ZYIB 2OUJA 1I6XA 1Z78A 4W6YA 2ZABA 1L3JA 4WVVA 2DU0A 4LUKA 2CGOA 5AVPA 1OD5A 4WBBA 1X8MA 2OZJA 1U5ZA 4MGYE 3WW1A 2H0BA 1I9RA 2E51A 2HWB3 2PTMA 1YFYA 2MEV1 4HBNA 3ZN6B 3ZXJA 1DYKA 2N7GA 4LNVA 4DZGA 1SLAA 2JG9C 4AEJA 1FI2A 1MACA 3RDIA 3WUDA 4AFMA 4BYYA 3MIHA 4XDQA 4RSUA 2R30A 1PK6C 4RHV3 3ZMNA 2ET7A 3ZO0B 3TAYA 5K0UA 4XE9A 1ZYBA 4XHBA 1H2KA 3H9AA 1AL21 2XH6A 4M3CE 1GQGA 4Y20B 1DQ0A 1H2LA 4XQDA 4LBQD 2DVBA 2Y0OA 4AEDB 1WD3A 3AP7A 3RMYA 4N53B 5L7OC 1J59A 2Y26A 4M3CF 3M4FA 1RUD2 3AB0A 2I07B 3E5UA 5SV8A 1VIWB 1PO13 2QKDA 3CU7A 2WINB 4N9IA 4C0HA 2BWAA 1O5UA 5JMCA 1RMU1 3LAGA 4WM7A 3ZIWA 1C57A 1CJPA 1RIRA 4GIQA 2XBO2 5FAXA 1ONAA 2ZGPA 4KBBA 2WNUA 4IV3C 5C4WB 1R091 3U11A 1B35B 5LK5A 3RYKA 3J8F1 1POV0 3VZMA 3S7EA 3QH6A 5EWSA 2Q0AA 1DU3D 1QOTA 2ZBJA 5FO8B 3WQ0A 4B4PA 2GNMA 1FAYA 1IKQA 1Q8VA 2ZGOA 1NLRA 1VR3A 1LEMA 1V9U1 3B7MA 1IPKA 3INAA 1ZVFA 2VOVA 4HPKB 1AR82 2PA7A 1MS0A 4A3XA 3OY8B 1FOD3 2JG8B 1UU4A 3KMHA 5CADA 2R061 5AC93 1AVBA 4MGKE 3SMHA 5FLHA 4YFZA 2QE3A 4KWJA 4UW4A 4Y1ZA 3ST7A 3RNSA 4QPIC 1O7FA 2H0VA 3B69A 4GULA 4WZCA 1QJY3 4OHXA 1LGBA 3ZXEA 3D6EA 1QJZA 3I54A 3ZFGB 1DQ5A 4AQ6A 1XYPA 1V6MA 4AE2A 1VBC1 4HETA 1QJU2 1AYM3 3AMQA 1Z0HA 1DIWA 2RR13 2YUEA 3MIEA 4RS5B 3FC0A 4I3GA 1GQHA 3KS7A 1I5ZA 2VNOA 5KHGA 4BWOA 4B7KA 1O91A 3D8CA 1FNZA 1W6PB 5E16A 1QH7A 4HMZA 5CFDA 3MEPA 4RR3C 1RUH2 2MHFA 1XXNA 4AHWA 3TWIA 3ZVXA 3POWA 4XF0A 3IDBB 4EV0A 5BNNC 4R9BA 2DFBA 1YI9A 4RGGA 1XNDA 4JDMA 2D6OX 4QQOA 1GSLA 1H2NA 3J9SA 1GBGA 4P9WA 3G7DA 1SQ4A 5FMOL 2V5YA 4CYDA 5AVAA 5JZGA 2D98A 2BUKA 2R041 2ZCWA 3AYDA 5KXEA 1HDKA 4LR4A 1MQTA 3AZVA 4KU8A 4ITCA 2X29A 2PAKA 5FOBB 1VRH2 3FHIB 2A3WA 4KG8A 2R071 3GZTB 3ALQA 4EWEA 2VULA 2QUOA 4LTAA 5A33A 4N7UA 2XLAA 2RS52 1ENQA 5JSPA 4DS0A 2XPJA 1TMF2 2R063 2Z42A 1UF2C 2V09A 3ZSJA 1WMEA 4COZA 1LB2A 4YW4A 5H9QA 1RJ8A 3B02A 4K1YA 5EYYA 3QLQA 3OTFA 1XYNA 3WZ1A 5BNPA 3FBMA 2WIIB 4MUVA 5LEKA 4FTBA 1H1AA 2JECA 2CGNA 1OLRA 5I93A 2DV9A 4YZ3A 1KDKA 1RUNA 3R05A 2WFF1 4GMP3 2EXHA 1ZRDA 3ZN6A 1PIV3 3J4UH 2YPJA 2DVAA 4OI1A 4QXKA 3GBFA 1KJLA 1VBC3 3AKTA 2VMHA 3VKNA 4XF4A 4CDXA 1V6LA 3AJZA 1Z7S2 1KDMA 1TME1 4AI1A 3PJQA 4Y5Z0 1PGL1 3FZ3A<