1RIRA

Crystal structure of meso-tetrasulphonatophenylporphyrin in complex with peanut lectin.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galactose-binding lectin
publication title Crystal structures of the PNA-porphyrin complex in the presence and absence of lactose: mapping the conformational changes on lactose binding, interacting surfaces, and supramolecular aggregations.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 50
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1rirA00
1Y7BA 5KXDA 4U36A 2GNBA 1HDKA 1S0EA 2D3RA 4YM2A 4XOGA 4XJ8A 4AWDA 1FV2A 1Q8OA 4YW2A 2PHFA 2DVFA 3RMXA 2SBAA 4P14A 1WW4A 2DURA 1D0HA 2DVDA 3V0AB 2GN3A 3O0XA 1HQWA 1GBGA 1LOFA 1VALA 3N7LA 4LBQD 3ZSKA 2D3PA 4AVSA 1JN2P 1MS4A 1V6IA 4BM8A 4LBLA 3WV6A 4AVVA 5DUUA 4H55A 2ZGSA 4YGEA 2DTWA 5GJ6A 2NMNA 2E53A 3KM5A 3RQ0A 4F83A 4Q8LA 3ZXFA 3VV1A 4Y24A 1H9WA 1ULCA 1G9CA 4HL0A 4R9DA 1LHUA 3AXDA 1QKQA 3O0VA 1DGLA 2NYYA 4Z8BA 3APBA 4SLIA 2P3KA 1OQ1A 4YZ2A 1QOTA 3UL2A 3WLUA 1FNYA 4ASMB 4IQPA 3AZYA 2D6MA 4Q26A 1CIWA 1ZA4A 2YROA 4FVVA 2P3JA 3AXEA 1ULGA 1GV9A 4YM0A 1LU2A 1VAVA 3KQRA 3QLQA 5DG1A 4LBKA 2WNEA 2PHTA 1R1ZA 2A71A 3AZXA 1WLCA 5H9QA 3SISA 3T1LA 3HN1A 3R05A 2KM2A 3IPVB 5CNAA 1JYCA 1LGNA 2FHRA 4GKXA 1GNZA 1AF9A 4I30A 5E8AA 1LJ7A 1G8WA 3NV4A 5GLTA 4WZFA 3R4SA 1N1VA 2ZGQA 5DUXA 4LBOA 3AJYA 4XMAA 2G4IA 3WCRA 4GKYA 1UPSA 2A3YA 4R9AA 2VW1A 2CNAA 3OBRA 3WDVA 1KDKA 3RG0A 3W58A 3WDYA 2UWBA 4DS0A 4XTMA 4NOTA 3ASIA 4GALA 1S0BA 3SH3A 1W6PB 1G9AA 3H0OA 4Q2FA 3WUCA 1QDOA 2W08A 1V6OA 3OYWB 1MS3A 3WOGA 2EF6A 1YYNA 3A0NA 4AYUA 3RSJA 5EYYA 4BQ1A 3DGTA 3MW3A 1VLNA 1WD3A 2ZGTA 3MEPA 5GLZA 3AYCA 1HLCA 1QU0A 5EYXA 1IS6A 3LSEA 2VW0A 3UK9A 1QOSA 2ZZJA 2E6VA 3AZWA 3IMNA 2EAKA 1YO8A 2E7TA 1DFQA 1OKQA 1PZ7A 1AXYA 1V6KA 4FP3A 2Q5TA 1JYIA 2VW2A 3HR9A 5CAZA 3A4UA 2JJ6A 2DVAA 1MZ5A 3N3HA 1LOEA 2P2KA 1S0CA 4YM3A 1HKDA 1SACA 4Y1XA 1BXHA 3AX4A 1CQ9A 5GZDA 1ENSA 4LBQB 1SLBA 4CRQA 1GNHA 3JUUA 1W6QB 4UW4A 1CVNA 4XBNA 5DXDA 4GWNA 4R9CA 4LBNA 4AGVA 1D2SA 4FPKA 1DLLA 1A78A 1FX5A 1A3KA 2JKBA 4WV8A 1QNWA 3AP7A 3N7MA 4AVTA 1AJOA 1KRIA 1JUIA 3V0BB 1GZCA 1LOAA 1AX1A 4FPFA 4AGGA 2TEPA 4PQ9A 3M3OA 1KDMA 2A6WA 4OZXA 2ZGRA 1BQPA 3Q9OA 4P9WA 1DIWA 2DTYA 4XZPA 3ZXEA 3AJZA 1AX2A 1NXD1 1W0OA 3VUOA 3M3EA 4PCRA 1CESA 5E89A 4ATEA 4W65A 1GICA 3AFKA 1RINA 1QGLA 1AXKA 1IS5A 4K20A 3WDUA 2D43A 3WHUA 2UURA 3UJOA 1KITA 2D6OX 1S1AA 1W6OB 3N7KA 2GMPA 3OPZA 3PJQA 4HANA 4XTPA 2UWCA 1LEDA 4YGDA 1JW6A 1V6LA 2W39A 3AZVA 4PBOA 3ILFA 1DQ1A 4YW4A 5JLVA 2VY0A 4FOYA 3WNXA 2AH2A 4XJWA 3B69A 5GLVA 2A3WA 3V0AA 3WG1A 2PHXA 5H9SA 2WT1A 5FREA 1BZWA 4YFWA 4FQ4A 1LENA 1LODA 4K1YA 1MS1A 5HCBA 2YXSA 2ZGUA 2ZBJA 3WUDA 4YG6A 3TAYA 2JECA 1F9KA 3WDXA 3ATGA 3VKLA 5KXEA 2ZGLA 1MR5A 2DVBA 3BOPA 4DRVA 2DU1A 4YZ3A 5F5QA 2CL2A 2B7YA 1DBNA 5KXBA 2I2SA 1IS4A 4FPCA 1I1EA 2A7AA 2R0FA 1LOFC 4BOWA 1SBFA 1N3OA 4YGBA 2AENA 1N1TA 4YLZA 5H9PA 5JOYA 3MW4A 4RL7A 5BYNA 4ATFA 1V6NA 3ZVXA 3WDTA 2DUQA 3D5OA 1FV3A 2EXHA 1NLSA 1UX6A 2YZ4A 4XE9A 3D6EA 2GALA 5GALA 2R1DA 4D69A 4XILA 1C1FA 1N3QA 1FATA 3N35A 1UL9A 1CONA 3IPVA 3WCSA 5JOWA 3MW2A 2AR6A 4RA0A 1ENQA 2A6ZA 3POWA 2SLIA 3WHTA 1DQ0A 5HCAA 5T54A 4Y1YA 3PVNA 2D44A 2JE9A 1BJQA 1S0GA 5JMCA 1ULEA 1C1LA 1MS5A 1F5FA 3BTAA 2DUOA 1YIFA 2WLQA 4XBLA 4YM1A 2WT0A 1CPNA 1IOAA 3ZPYA 1ULFA 4GWMA 5DUVA 2D6KA 2GNMA 3AYEA 1V6JA 3USUA 4ISQA 2GNTA 2P34A 1Q8QA 2C9AA 4Y1UA 1WW6A 4M3CA 1SFYA 1SLTA 2AREA 3OYWA 3SH5A 1GKBA 5SV8A 2ZGOA 3V65A 1WBLA 2YV8A 4K21A 4YW1A 2UWAA 3U4XA 2DUPA 1WLDA 1Q8SA 2E7QA 1AVBA 4PF5A 1S0DA 1Z0HA 3WG3A 5LK5A 2A6YA 4FOQA 4FOVA 5HCFA 3M2MA 2ARBA 4DPNA 4FQZA 2A70A 2ARXA 2VUAA 1IKQA 3FLRA 2E51A 4Q1PA 5JVVA 3O5SA 1Q8PA 2ZGMA 3W59A 4LBMA 3QCWA 3OY8B 5KXCA 4LBQA 1W0PA 4ZXKA 1W6QA 3V64A 2RHPA 4TZDA 1GLHA 1WD4A 1WUVA 3AP6A 4FOWA 1F31A 1MZ6A 2ZHNA 3WG4A 1SLAA 5IT6A 3OJBA 3MPPG 1MS9A 4XJZA 3PVOA 2P37A 4XHBA 1W6NB 5AVAA 3IM0A 1LGCA 4FPYA 1GZWB 1UN1A 4FPEA 5T5LA 1FYUA 1WBFA 3M3QA 4DFSA 2ZHLA 1I3HA 1SBDA 2A5ZA 3NV3A 1LHNA 3SNMA 4BMEA 3ILNA 1MS0A 2P3IA 3AP4A 5JOZA 4M3CF 4BPZA 5DZGA 1DQ2A 1ENRA 2NN8A 1W6MB 2YMZA 3C2UA 2ZA9A 4M01A 1JBCA 1QDCA 1WLWA 2OUJA 4Y20A 1UMZA 4FPLA 3M3CA 3POYA 4YW5A 4YZ1A 5GLUA 2NP0A 1BKZA 2R1BA 2A3XA 5IK7A 5T5JA 2AUYA 1DHKB 1KJLA 4P9YA 4XJ9A 4FPHA 5GZFA 4Q8KA 4XMIA 4Y22B 1HQLA 2ZMKA 1JOJA 4L8QA 1FNZA 3WDWA 3JU9A 5DZFA 3R4UA 5GZCA 4YZ4A 2GMMA 5H9RA 5T55A 1IKPA 1CN1A 3VKOA 3FLPA 3ZXLA 2DVGA 1V00A 2A6VA 1MACA 1WW7A 1Z78A 2D7FA 2LTNA 3LSDA 3ZXKA 2H0BA 1LOCA 1LULA 4GXLA 1V6MA 3OBTA 1YXWA 1JHNA 1Q8VA 3OGGA 2ZKNA 1KJRA 2W68A 4XIKA 2ZGNA 1WW5A 2CYFA 2GMEA 2AGSA 1SLCA 4WVVA 2C5DA 2V73A 2DV9A 2DWRA 1MVQA 2WSUA 4UW5A 3UJQA 1H9PA 2CY6A 2ZHMA 2CWMA 1A8DA 1QMJA 4TYSA 1GYKA 4BLJA 2EXJA 1URXA 3NV1A 4CTEA 1AJKA 3B01A 3FBYA 4LBJA 4XBQA 5GM0A 3INAA 1GANA 3VKMA 4UW6A 1LHWA 1S0FA 1S0JA 2ZHKA 3ZYPA 2V5YA 3B00A 3AP5A 1O4ZA 1PZ9A 1LU1A 3ILRA 4R9BA 1VIWB 1GZ9A 1LHOA 2OW4A 4YW3A 1H30A 1WCSA 3I4IA 1CJPA 2W52A 3FUOA 1CPMA 1N3PA 4FPJA 2XB6C 2GNDA 5IUQA 3RS6A 3B3QE 5L73A 1G9DA 4XJAA 1LTEA 4AGRA 2VU9A 3AP9A 1YI7A 1C4RA 1XQNA 2JE7A 3CNAA 3SITA 3ZSJA 1X50A 4JC1A 1UZZA 1DQ6A 1YRZA 2NZ9A 4Y1VA 3AYAA 1ULDA 4K1ZA 1LOBA 3O12A 5FRAA 1IS3A 4BLIA 2PELA 2JD4A 4XXAA 3WZ1A 1EPWA 2NMOA 3GNEA 5DZEA 2PHWA 4JRAA 1PZ8A 3WG2A 4ZKTB 5JOXA 2OUHA 4Y1ZA 1KQRA 2ZMLA 1JXNA 3M1HA 4M00A 4P9XA 1AXZA 3IN9A 5T50A 1N47A 3WVJA 2WKKA 3SLIA 1W6PA 2ERFA 2ENRA 2PHUA 4ITCA 1DQ4A 1LHVA 4Q27A 4KBBA 2ZABA 1AX0A 1MS8A 2EALA 3ZXJA 1CR7A 2GDFA 2WT2A 3T1MA 3TB0A 1SLIA 2ZMNA 4WVWA 4YG3A 4XJUA 2XG3A 2YY1A 1UKGA 2BQPA 4MYEA 3N36A 5JDBA 3ENRA 2OVUA 1ZM1A 1DYKA 5GZEA 1BYHA 1QF3A 3FUQA 2FMDA 2DU0A 5DG2A 2WQZC 1U0AA 4YG0A 4Q1RA 1S0IA 2LALA 1SBEA 2PHRA 5IK5A 3USUB 2D3SA 1ONAA 1MVEA 3NV2A 2UU8A 2NM1A 2EIGA 1G86A 3OY8A 4M3CB 2JDZA 3LCPA 3SH4A 4DRRA 5GZGA 3IKWA 2ZAAA 3GALA 5CB7A 4YGCA 1C57A 4FP2A 1LCLA 3DUIA 2D6PA 2D6LX 5DUWA 1DQ5A 2A75A 1W6NA 1AZDA 1RITA 3BODA 4DQAA 1GZWA 3AYDA 3RRDA 5CA6A 3V0BA 2WSVA 1LEMA 3O0WA 3ZSLA 5EWSA 1J1TA 1GSLA 2ZACA 1O4YA 1QNYA 1SCRA 4C1WA 3AK0A 4YFZA 4XYXA 1W6MA 5CBLA 5E88A 1FAYA 4U2AA 1G9BA 3POSA 1OFSA 1TEIA 4ISRA 5IK8A 1LESA 1SLLA 2ES3A 2AYHA 1RIRA 4XIOA 3AZZA 2R0HA 2WJSA 4XDQA 4Y22A 5T5PA 1QOOA 4XHXA 3RMYA 1UZYA 3T2TA 3HMYA 1N1YA 2HYKA 3FFZA 4NO4A 4FPGA 1W6OA 5T52A 1N1SA 1LECA 4PBPA 5GLWA 5T5OA 1UAIA 4FPOB 2ZGKA 4M3CE 4C1XA 2DYCA 4Y26A 3PMEA 2GN7A 2ZGPA 2Z42A 3PVEA 4GA9A 3FLTA 1B09A 3A0KA 2A6XA 3NWKA 4JCKA 4XXPA 2VH9A 3BIWE 2R16A 1DYPA 2EXIA 2R49A 3D4KA 4UW3A 4Y20B 3VKFC 1G7YA 4YZ5A 1LGBA 1Q56A 2EXKA 3B9CA 5IK4A 3I8TA 4BMBA 4CZSA 1G9FA 1DZQA 3N7JA 3ZSMA 5F9TA 1LOGA 2CWSA 2VXRA 3VKNA 2CTVA 1APNA 3L2YA 1VAMA 5EXOA 3ZYRA 2D6NA 1SCSA
chains in the Genus database with same CATH superfamily
2VBBA 4TXWA 2RJ2A 1UPIA 2CGNA 4CDWB 5A33B 4XOGA 4AWDA 3B93A 4V2VA 1COV2 1RUJ3 4NVPA 4YW2A 1F8VA 1JU4A 4HBNA 4N8MA 2DURA 1D0HA 5LW9A 2RS32 1UOFA 4B1LA 2W1WA 2JB8A 5KC6A 3BUCA 1RUE3 1CAWB 4HN1A 1FOD3 1D4M3 1UNBA 2C4XA 3ZOIA 1JN2P 3ZSKA 1QWRA 5L7OC 3GF6A 4LBLA 3SHRA 5DUUA 2ZGSA 3BTYA 2JG8C 4QKBA 2IXJA 1RXGA 4X8PA 1E5IA 4M4PA 5BPXA 5A7QA 4F83A 1ZBE2 4Q8LA 4CCNA 1YQCA 3WP4A 2VMDA 5DPNA 5FP7A 4HL0A 1LHUA 3O0VA 1QKQA 5G04L 4BU2A 5IJRA 4CCMA 4DXZA 1RUE1 4ZS3A 4SLIA 1FOD1 1D4M1 2OPWA 1OQ1A 2P3YA 2XKPA 3KVBA 4URTA 4YVSB 5AFEA 3KT7A 4FO9A 3UL2A 5FYCA 2O0OA 5FY0A 2HWD2 4QHZA 2RMU3 4UF0B 3VDDA 2VOKA 2GAUA 4XW3A 4NMIA 3AXEA 4NHMA 4QQLA 1RUI2 3MIBA 3PVBB 1CJDA 5CG8A 4AF9A 4AK3A 1WA6X 1GQGA 2B46X 5FPUA 5FAXA 2FDIA 3AZXA 1WLCA 3GDBA 3T1LA 1VR3A 2YFUA 2W1UA 4AHZA 4A7KA 1JOBA 3IMMA 2RMU1 4UAPA 1LJ7A 5E8AA 4EZHA 4AOCA 4NWWA 4WZFA 3S7IA 3UNPA 2ZX2A 1DDLA 1T2XA 4E4ZA 1PMIA 4IV3A 1OA3A 4CP0A 4HKWA 2VD7A 2G4IA 1QHDA 1AYN2 1UPSA 1X82A 2VTFA 5FCCA 4AFMA 1ND3C 3GBFA 3WDYA 2EA7A 3AM2A 1C28A 1ODNA 1UZWA 5KHJA 5FZ7A 3MV01 1S0BA 2IXIA 1G9AA 3ZFGC 3MBWA 1LB2A 3SKVA 5C5UA 2KXLA 2N7GA 3ELNA 3OYWB 1IQAA 4OUEA 4PJYA 3RSJA 3NNMA 2P1BA 2Z79A 3DGTA 4PI0A 5EYYA 1BMV1 4LXLA 3MEPA 5GLZA 2NPIA 1NZCA 3AYCA 2DCJA 5EYXA 2WQ4A 4O61A 2WYSA 4YYOA 4CEWB 1IS6A 2VW0A 2WAOA 1HIXA 4HMZA 4AI8A 3AZWA 1YO8A 1W2NA 3ZXAC 4QPGA 2W3JA 1TQ5A 2ZX3A 5A32A 4MGSA 4NROA 2Y6FA 2ZX0A 4NN0A 3TN93 1NY72 5KHGA 1MZ5A 4IV1B 1RTVA 5ACA2 5JPNB 1ZX5A 1LOEA 3RNSA 3D8CA 1TME2 2R072 4CDXB 4YM3A 5C8WA 3KZ4C 1BXHA 3AX4A 1CQ9A 4AVBA 1SLBA 2B4KA 1XC6A 2A1XA 5C3RA 5DXDA 3OGJA 5HV0A 5EJ3A 2HBUA 3HWJA 4E2QA 2WN3A 4WBBA 1OPMA 2JIJA 2JDKA 2B39A 4KWLA 1O3TA 1FX5A 1OBNA 4V2WA 1XNAA 2PTMA 1AJOA 3KCXA 4W6YA 3DXTA 1NA1B 1X36A 4FPFA 5ABJB 1QXRA 4PQ9A 4DXRA 1KDMA 2YGMA 4OZXA 2ZGRA 4P9WA 1R083 4IXLA 3N9QA 3LIHA 4QPIA 1NCQB 3DPRB 4PCRA 2WYFA 4QDRA 4W65A 2MEV2 4GJYA 1Y4WA 2GU9A 4NWVA 1WCUA 5FZ9A 3UYJA 2UURA 4E8CA 2BWAA 1YHFA 4GH4C 4B4PA 3N7KA 2XJRA 1H1IA 1I6XA 4HANA 4KU7A 5FP3A 2UWCA 5A33A 4CDWA 4YGDA 5AFBA 1JW6A 1R081 2W39A 4PBOA 3ILFA 2BEOA 2D5HA 4QHOA 3J9SA 3JQXA 4XJWA 1HRI2 2XHKA 3MICA 2K46A 3WG1A 1UZ0A 1SG3A 1CAWA 4I0BA 2WT1A 4ZU4A 4C8DA 5CISA 1RGSA 2WA3A 4JGZC 3K3OA 1REEA 4JRLA 3E1F1 1MS1A 2J22A 4PT6A 2YBSA 1XOYA 3KGZA 2ZBJA 3WUDA 4URAA 1UIJA 3ZR6A 1RL3A 1WZXA 3U37A 3WDXA 5L7OB 2ZGLA 4LE3A 4DRVA 2OKXA 2JG8B 5F5QA 2CL2A 4XETA 1QJX3 3ALQA 4FCAA 4YVSA 5AC91 5KXBA 5F6LB 2I2SA 1IS4A 3VDCA 3H1WA 1ULPA 1W2AX 2C0ZA 2Q1FA 3OF1A 4PLOA 3LOBA 2PN5A 1N3OA 3CDZB 1ASJ3 1MQTC 1NKGA 1N1TA 4LR4A 4O65A 4UF0A 3FZ3A 5H9PA 3RYPA 1JYNA 4ATFA 2JKXA 2FQPA 5LY1A 3ZVXA 3SMHA 3WDTA 3OPWA 2EXHA 5FP9A 2VTXA 3M4FA 2VZ3A 4D69A 1QJX1 1VB2A 3M7AA 3MW2A 4E4SA 3BIEA 3ZYGA 1UY1A 5HCAA 3CIHA 3NVCA 1ASJ1 4Y1YA 5T54A 5FZEA 5IATA 2OA2A 5JMCA 5FKCA 4UFJA 1OOPA 2X5IC 1C8NA 1VJ2A 4BH9A 2WT0A 1CPNA 3ZPYA 2C1FA 1UX7A 3VBSC 5FTTC 1EAH2 3A21A 3HBKA 1NYWA 3L2HA 1W28A 1NAEA 3T08A 2DF7A 4Y1UA 2C9KA 4LT5A 2HWF2 1H6XA 1WCQA 3OYWA 4Q4X2 4XQ4A 5FK7A 4E2GA 1ND3B 3VB9A 2VMCA 1WBLA 2YV8A 4Q4W1 2WDBA 4QDSA 3WQBA 3IIIA 1F2NA 3ZFGB 3CEWA 4RFRB 2E7QA 1JZ6A 3JBG3 4CEWA 4FAGA 3KCCA 4N53C 2G19A 4IE5A 4QQPA 5B2GB 2H6BA 3FC0A 3MGUA 2E31A 1CWPA 4XFCA 4E4DX 1R093 3M2MA 4LE4A 4FQZA 4L99A 2VCMA 2R7EB 3K51A 2LW8A 4IV1A 4COYA 5D2AA 3O1OA 3U14A 2DCKA 4XUPA 3W59A 4CDXA 4COZA 3JBG1 4QKDA 1GFF2 4CYDA 4EV0A 3A23A 3OY8B 4EQVA 1W0PA 4LIUA 3T0DA 1OQEA 2WRAA 2RHPA 3UKNA 1GLHA 1WD4A 4FOWA 1R091 1FPN2 1MZ6A 2VECA 4FXGB 2ZHNA 3U11A 2WBKA 1JYTA 3OJBA 2HKXA 2VQAA 1VE0A 2P37A 4IGOA 4QKNA 4XHBA 2IVJA 2BBAA 2HEVF 2VG9A 1LGCA 4FPEA 1NA1A 4XF3A 2HEYF 3W9AA 4N9IA 3SNMA 5JOZA 4A7YA 3VLBB 2P3IA 1MEC2 1US2A 3POIA 4XAAA 5DZGA 1HRV2 1ENRA 4KG0A 2ZA9A 1OPOA 3HNBM 1Q43A 2QQMA 4Y20A 1UMZA 1NCQA 3Q8BA 3DPRA 3KV6A 4I02A 1H1AA 2CGOA 4GB33 3BALA 3KHBA 4QQOA 4P08A 1PM4A 4XMIA 1HQLA 2XVKA 4QD2A 4BJ0A 3PURA 5JZGC 3LEMA 2W87A 1A6CA 1W3VA 4KI5M 2ZKLA 2BDRA 1VBA2 3UV9A 3CZUA 1IKPA 1W9TA 5T55A 5A7PA 3I59B 2VZUA 3U10A 4GH4B 4GB31 2IXKA 4B8EA 4CCJA 1QH6A 1H2MA 1Z78A 2D7FA 2LTNA 2YBKA 4QGMA 2H0BA 2XLGA 4F8AA 1LOCA 1LULA 5CFDC 4N43C 3KV5A 1V6MA 2QFEA 1Q8VA 3KSCA 4G9SB 2W68A 3T4VA 5LBCA 1X9PA 5L7OA 5AVPA 2WSUA 4JGZB 5DAVA 1WLTA 3BCWA 3ZFEA 4DO0A 2QKDA 4WM8A 3EBRA 4BLJA 1GYKA 3O1RA 1W8TA 4CTEA 2ZX1A 3HQXA 2VBDA 1QQP3 3CMGA 1JZ2A 2RDNA 4OHZA 3VKMA 1H4HA 5FY1A 4UW6A 1VBB2 1WA4A 3FMGA 3WF0A 3IWZA 3AP5A 4ARYA 2R062 3NNJA 1GZ9A 1D4VB 2OW4A 1IZ3A 1MQTB 3KB5A 1ND2B 3PIJA 3I4IA 1GWKA 2HWC2 1N3PA 1QQP1 1YWKA 3O14A 4IEZA 3RS6A 4BQ5A 5B4NA 4HVOA 3TEWA 1W90A 4XJAA 5L9RA 4IESA 3UKVA 3UGHA 4LTAA 3OUJA 5LCWL 4D0QA 3J26N 3CNAA 4GAZA 2QTWB 1UZZA 2NZ9A 1ZZ8A 3AL6A 2O8OA 5FRAA 3O12A 2XBO2 4LO4B 1OH3A 2NMOA 3N4MA 1CD3G 3LEKA 1XE0A 2Y34A 2X5IB 2Y0IA 5LZ6A 4Y1ZA 1FT9A 1TMF2 2B8MA 3WVJA 3IN9A 5J3UA 2JICA 3SLIA 3LFMA 3M3IA 3VBSB 2ENRA 5SV5A 3ON7A 4ITCA 1XXNA 1ND3A 4KBBA 5LA9A 2H6CA 1DGWA 2BNNA 1AX0A 2WABA 2EALA 1O6UA 1CR7A 2X8KA 2WT2A 5FZMA 3ZFGA 4DMIA 5FFOC 1YUDA 2P4EA 4PLMA 2BQPA 3N36A 5I8YA 4XC9A 1NCRC 1DYKA 4AEDC 3KD4A 2DU0A 1OLMA 2WQZC 5FZOA 2V5DA 4N53B 4ES8A 3LF7A 1S0IA 2Y26A 4HKOA 1RVF3 1HN0A 2D3SA 2QE3A 1RUC2 2XMLA 3FWEA 2BGCA 5A3UA 4XF4A 3HQUA 4EYUA 2EIGA 3OY8A 4RGGA 3WINE 5I0DA 3SH4A 4DRRA 5BUVA 4AXOA 1NZIA 2BWCA 5BXXA 5ISLA 3K75B 1W8ZA 4IEWA 5IVYA 3I2JA 5FLHA 4DXTA 2WZPP 5C9AC 1SFPA 2AEZA 2XJSA 2D6LX 5DUWA 3LEGA 3SCHA 4I3GA 4LHKA 1AHSA 3KS7A 4NE9A 2AZ5A 1RVF1 2PA7A 5D8AA 2JEMA 5LBEA 3HIFA 2OQ6A 4EN9B 3RRDA 5CA6A 2ATFA 2WSVA 3LQCA 3KLSA 5A7SA 4B7KA 5EWSA 1GSLA 3I3BA 4Q4Y3 4P9GA 2JG9C 1YI9A 4XYXA 3R0RA 1NUKA 2VNRA 4MUVA 1G9BA 1OFSA 1SLLA 4JDMA 2Q8OA 2AYHA 4BQWA 2RR13 3NQHA 3AVRA 5FXVA 5F6KA 1OD3A 1TZOA 3D0SA 3RZZA 2ZAHA 4Z07A 4FFHA 1PGW2 1N1YA 3Q8FA 2YU2A 3FFZA 4L2NA 4Q4Y1 2RVAA 1WMEA 4OQ8A 1ZRFA 2VZVA 1BLZA 2ARCA 1QJY2 5GLWA 4UOJA 5JZGB 3I59A 1XSRA 2ZGKA 4FXKB 1WWYA 1VBE3 2ET1A 2DYCA 2RR11 4GH4A 3JCIA 2GN7A 1DF0A 2VMIA 4LKEA 2Z42A 5HV4A 3U0ZA 2VQUA 1ZNPA 3RJ2X 1WCKA 4XXPA 1R1A3 2CSGA 3E5QA 1BBT2 1DYPA 2EXIA 2LUWA 2R49A 2R16A 1CAUB 4DNYA 3DKWA 3TEZA 1L7RA 4IETA 1E57A 4CUCA 4AZZA 4E9KA 1LOGA 2DBNA 4UFKA 2JE8A 5CFDB 4NR1A 4N43B 4AI2A 3GHMA 1VBE1 1UU4A 1VAMA 2V4VA 3L2YA 3Q8AA 1IQDC 2ETEA 3IDBB 2D6NA 2W94A 3ZSEA 3BKZA 2Y64A 1R1A1 4KBZA 1CAXB 2D3RA 1J1LA 3LAGA 4XJ8A 1FV2A 4MXVA 1Q8OA 1NLQA 3PU8A 3AMHA 3RMXA 2SBAA 4P14A 4ASLA 5L19A 3E6CC 2JDMA 2P6CA 4LITA 5FZ6A 3S5QA 3ZN6A 4LBQD 1GBGA 1VALA 2YDEA 4M3CE 5FMOS 2JDUA 1ND2A 1V6IA 1CX4A 3OOXA 3RVHA 2IXCA 3FHIB 3LFIA 1AR82 1K12A 4V1PA 3H7YA 5GJ6A 2BV4A 2E53A 1H4GA 3KM5A 5FXWA 1DLCA 2NQYA 3P3NA 2WFF3 3ETQA 5FYTA 5FXZA 3TEXA 5CFCC 1PVC2 2XUMA 5CKMA 4PLNA 3MIHA 5E6HA 1LKNA 3PUIA 1UY3A 2GC0A 2HWB3 4QU1A 5BNPA 2VNGA 1BK0A 4ONUA 1K5MC 4XAEA 5F1RA 1M06G 2AC1A 5DDJ2 4W50A 4YZ2A 3MZHA 5CKQA 3KF3A 1YLLA 3WLUA 5FY9A 4IQPA 1RUD2 2X5IA 1S2EA 3GZUC 1ZA4A 4FFFA 2WFF1 4AI3A 4CCOA 5FZAA 1ULGA 3VBSA 1GV9A 1LU2A 4XFFA 4BK5A 4JX0A 2JDNA 5DG1A 5F3CA 3VN4A 2HWB1 4CPBD 4HVQA 2WZR3 2A71A 1VPHA 5JR2A 5H9QA 1RUH3 4WM7C 3HBZA 1PGSA 5CNAA 4Q0UA 2FHRA 3RFRA 2E26A 3K4DA 1NE4A 3ECQA 1EYBA 4DOUA 1QJEA 1G8WA 2HH9A 2XKOA 5GLTA 3VL9A 2GP5A 3R4SA 1N1VA 4HG6B 1JZ3A 5T3NA 4CEYC 1DZRA 3DCQA 4BA6A 1KGYA 4GKYA 4NPMA 4B4QA 2WZR1 2IVIB 2RS13 1RUH1 4LUKA 3OBRA 1NCRB 1KDKA 1Y9MA 5KHHA 2UWBA 2W1SA 3B9IA 2OXBA 1X8MA 3NJXA 1LNSA 2R042 4GALA 4AEDB 4W4ZA 3B5LB 4OFGA 3LKJA 5EFUA 1MS3A 4NRPA 1BEV2 3WOGA 3ZX7A 2TBVA 4AYUA 3MW3A 2OZJA 5J1XA 3NAPC 2HWE3 1C8M2 1W05A 2W0XA 2G1MA 3HVDA 5FPXA 2RS11 4NIDA 4Z1VA 2ZJCA 1JUHA 1XYOA 2VGDA 3M70A 5CADA 3UK9A 3IMNA 3NNFA 2EAKA 2E7TA 3TWIA 1OKQA 5C9AB 1PZ7A 1OXCA 1V6KA 1ZYBA 4LJHA 4NIGA 2Q5TA 2VUDA 3KGLA 3FJSA 5A3MA 4LOTA 4OVEA 5CAZA 3VHOA 1US3A 4HPKB 3D0JA 4I0AA 1SQ4A 1IG0A 1YQ5A 2DFBA 2DVAA 2HWE1 4AE2A 4AGGA 5A6QA 5C33A 2P2KA 2RJKA 3KV4A 1SACA 4NHKA 4Y1XA 5FK8A 4CCDA 2JG9B 4LLOA 4CU6A 1ENSA 4FBFA 1ZBE3 4QGLA 4JDOA 1GNHA 4UW4A 1K42A 1CVNA 2K9ZA 4NJ4A 4XBNA 4GWNA 4LBNA 4RHV2 2BYVE 4F3JA 4AGVA 1UYYA 5FO7B 1EPZA 4HK8A 2YUEA 4YVWC 4MGIE 4K40A 1A3KA 1DYOA 1YQ2A 2HWD3 1JUIA 5I0UA 3VZLA 1XPWA 3WY6A 1GZCA 1ODMA 2P17A 3TNQA 4B1MA 1ZBE1 2XUEA 4OUMA 5IHRA 1W0NA 3AKPA 2TEPA 2QCSB 1RUI3 3KCYA 1IHMA 3H9AA 3ZXEA 2CAVA 2F6BA 4N7IA 4RD7A 1AX2A 1O3RA 3VUOA 4FSJA 4JTOA 2E32A 3W5NA 3AFKA 5CFDA 1RINA 3H8OA 1QGLA 1W9SA 2HWD1 4JZRA 4N43A 1EV12 1IS5A 1OI6A 4JQTA 4K20A 1GMMA 5E16A 3CU7A 3WHUA 5JXGA 2VXJA 4CE8A 1LR5A 2Z4FA 4W6XA 4XFAA 2D6OX 1RUI1 1W6OB 3DL3A 2Q1ZB 3PJQA 1UYPA 1CAXA 3FX3A 3T3YA 3HNMA 1AYN3 1V6LA 2WS92 4E27A 4IE4A 5FO9B 4YW4A 4LIVA 3FBMA 2OS2A 5C3QA 3WNXA 5IW0A 3J7NA 5LB6A 1UY0A 4JHTA 2WNUC 4B4RA 4BCUA 1V70A 5FREA 1Z7S2 4HSJA 2ZZQA 4YSFA 2Q1MA 3RZKA 4KL1A 4Y3OA 3TYJA 1LODA 5FUNA 5FPLA 5A3OA 1AYN1 5HCBA 3ZXDA 2ZGUA 1W8HA 3DXUA 4YARA 2VMEA 3OD0A 4MGTA 1XU1A 2VVDA 4JKKA 1CIYA 1XJAA 4CCKA 1YCIA 1MR5A 2DVBA 2X53S 3BOPA 3WNNA 2Y0OA 1DBNA 4HETA 3OEBA 5CFCB 4Q0QA 1CZVA 2JDHA 4IEXA 1LOFC 1SBFA 2K2SA 4BXSV 4YLZA 4ET7A 4HVRA 4CP9B 1K5MB 3ZR5A 1GU3A 3UESA 1S4CA 3H8UA 1V6NA 4AFAA 5A3NA 3W5MA 1RHI3 2DUQA 3O1PA 3D5OA 1FV3A 1CZTA 4GULA 4IERA 3G7DA 2J7MA 1U5IA 2R1DA 3DN7A 1AR62 1N3QA 1FATA 1HXS2 1CONA 2Y33A 3IB3A 3WCSA 3JD72 2AR6A 5JOWA 3POWA 1REDA 4BISA 1DQ0A 4RGAA 3ZDSA 3NJVA 3RZHA 4F7ZA 1BJQA 1O7FA 1C1LA 3BTAA 2VAUA 1RHI1 2DUOA 3H3ZA 3MUZ1 4Q5OA 4WM7B 4YM1A 3QH6A 2LS6A 2QQWA 4HK9A 4AHWA 5JSRA 2GSYA 4XUQA 4AHXA 3AYEA 1V6JA 3GJAA 5CG9A 4BQ4A 5EV7A 4CEYB 1Q8QA 2C26A 1UF2C 1ZZ9A 4QHBA 1SFYA 1SLTA 2L9LA 2MEV3 3SH5A 4PHZA 3K4AA 4RYDA 4OHXA 1GKBA 2EIEA 2ZGOA 1U5YA 4S2GA 5SV8A 4AI9A 1UYXA 4OMDA 2CV6A 2DUPA 3CLPA 1WLDA 1Q8SA 2RE9A 4IEYA 2B45X 3MLJA 1FXZA 3MPBA 4CUGA 1S0DA 3WG3A 5LK5A 4K6BA 4FOVA 3NAPB 3KV9A 5C9AA 3IDEA 1KS5A 3ZMOA 5IVCA 1V9U2 5JUVA 2MEV1 4I3PA 2WR9A 2ARXA 4LEJA 3CJIC 1RUJ2 3FLRA 4HPKA 4BXFA 3VDAA 1VAKA 4EN6B 1PNGA 5C8CC 5FMBA 4CXYA 2JG9A 4EJRA 1FOD2 1D4M2 3PLQA 5KXCA 5CKNA 1AR72 1F31A 4LHLA 2ZPXA 3WG4A 1SLAA 1VRH3 3CF6E 4A4AA 4HONA 4Q0PA 3RZJA 4XJZA 3H3LA 1DG6A 3PVOA 4O7XA 4KWUA 4AAXA 3LGRA 3S0MA 5BNQA 3HEIA 4NIIA 4A41A 2WWSA 1WBFA 5A3TA 5FR3A 4DFSA 2ZHLA 1SBDA 4BMEA 1AL23 1LHNA 4KWJA 4P9LA 4YVWB 1MS0A 3MFAA 3AP4A 4ZS2A 3ZXGA 5LEKA 4NRMA 1XNBA 4Z2AA 3HN3A 1VRH1 1POV3 3AB0A 2W2IA 2XJUA 4M01A 3ZN5A 3POYA 3DEMA 4IL7A 1OMIA 1BKZA 2R1BA 2E33A 2O1QA 3ACLA 4UBHA 1VMHA 3L9JT 5C3OA 5IK7A 3AKSA 5GZFA 4UBGA 3WQ7A 5A7WA 1BCXA 2ZMKA 1AL21 3DYMA 4CDQC 5FZHA 3ZO0B 1FNZA 3WDWA 4QPWA 3R4UA 4UI9L 2JENA 1POV1 2VZTA 3I2HA 1EAH3 4MHUA 1BMV2 3FLPA 1C5HA 4ZU7A 3ZDVA 4CUBA 4IUGA 2R30A 2DVGA 2BFUL 1V00A 1MACA 3C8XA 2VM9A 5JAXA 4BQYA 4Q4X3 5FY5A 4GXLA 5FLJA 4KMQA 4D8MA 3H1YA 3LWCA 1EY2A 3OBTA 4PDWC 3T4HB 5AC93 3OB8A 1JHNA 3ST7A 4E4HA 1W8WA 1SDWA 2Z2SB 2GH8A 3ZFFC 2CYFA 1EAH1 2Q30A 2AGSA 4LA3A 5FZBA 3KHCA 3RZLA 2DV9A 2JXAA 4UW5A 3UJQA 1HN1A 4AW7A 2CY6A 2VZRA 2XJTA 2ZHMA 4XDPA 2ILMA 2HWF1 3ACFA 2VBPA 1URXA 3NV1A 1YFXA 4JVAA 3DV8A 4Q4X1 2UY9A 5CFCA 3H1MA 4J1WA 4XBQA 2BNMA 5FYIA 1NG0A 2FCVA 1LHWA 4I01A 1S0JA 1UXZA 2ZHKA 3AMQA 4CP9A 1K5MA 1ZZBA 2V5YA 2WO2A 4H14A 3TN92 5LWBA 3SCGA 1I5ZA 4O9EA 1STMA 1O4ZA 1PZ9A 2AEYA 1LU1A 5FY7A 1L7LA 1VIWB 2Y6HA 1FPN3 2P5BA 1H30A 1NQJA 1WCSA 5F39A 2BBVA 2YC2A 3WW4A 3FUOA 1CPMA 5FYZA 4FPJA 5I0TA 2GNDA 2R32A 3FFQA 4XUOA 4ZXEA 1OHFA 1K5JA 3RWNA 5FJHA 5I0RA 2WIIB 3ZYFA 3LPFA 4YW6A 2JE7A 4WM7A 4AEMA 1UCXA 4ZPIA 3THDA 3H42B 1KD7A 3P6BA 1YRZA 1DQ6A 1CZSA 1MEC3 4C91A 5BNOC 4PIYA 4BLIA 3EB7A 4Q4W3 5JI7A 1FPN1 2PELA 5I91A 2JD4A 3WZ1A 2YPDA 1UQXA 1UY4A 2PHWA 2XVGA 4CEYA 5JOXA 5I93A 2ZMLA 4LPLA 3ETPA 4P9XA 2WZ8A 2ZCWA 2XGXA 4JDNA 2VOWA 1N47A 4KGGA 4D3WA 4JKMA 4CVUA 5FYSA 1TVGA 1OKOA 4IE7A 1J84A 2XHNA 1ZA7A 3E6BA 3B94A 1OUSA 3JB8A 5FIXA 2VPVA 1MEC1 3CL1A 4WZCA 1MS8A 2IXHA 3WR0A 2GDFA 2FD8A 1SLIA 2ZMNA 2W92A 3HAGA 1GWMA 2VE1A 3NAPA 4JGYC 2QZ2A 3ROUA 5EIYB 5JDBA 4QB6A 2RDRA 1QF3A 1NQDA 2X29A 2FMDA 2ZEWA 4C1WA 3ZKYA 4Q1RA 2FZ1A 1IPKA 1SBEA 2PHRA 3POFA 5IK5A 3DYPA 2RV9A 3J4UH 4M3CB 4PF1A 2VC9A 3CJIB 4AR2A 4UYBA 2XQXA 2ZAAA 5CB7A 4O9GA 4YGCA 4IGQA 5C8CB 3DUIA 2D6PA 2QQLA 1DQ5A 1DGRN 3GCXA 1AZDA 3BODA 4FT8A 4GIQA 1PIV2 2QJVA 4MHRA 4UWDA 3AYDA 1QJX2 2BTVC 1LEMA 1HB4A 3GZAA 3O0WA 1QY4A 4YVWA 5DN2A 3ZSLA 1O4YA 1SCRA 1EUTA 4YFZA 3GZTB 5FZ0A 2R063 3WP5A 5ABJA 1F4HA 5CBLA 1ASJ2 2E7AA 3THPA 2B42B 3AKQA 4DZGA 3VHNA 2ES3A 2FZ2A 1NE6A 3RPQA 1HB3A 5FPZA 4QX5A 4XIOA 3WF3A 3I2GA 4BHPA 4D94A 3K2OA 4IGPA 4DUVA 2R0HA 1UIKA 4XDQA 4D7TA 3N9MA 4A44A 2OYZA 3RMYA 1UZYA 3ZIXA 3HMYA 2ADEA 2HYKA 5J37A 2R061 4XEZA 4NO4A 1SHWB 4AEJA 4ZY9A 1A8MA 3H50A 1LECA 4QPYA 5T5OA 1OVSA 4CDQB 3OUHA 4C1XA 4X6QB 1RUOA 4Y26A 1VBD3 2ZGPA 1MZFA 3PMEA 1JYXA 3PVEA 3A0KA 3T09A 2A6XA 3IDCB 3NWKA 5A3PA 3WQ0A 2WZEA 3BIWE 1FMD2 5FBJA 4YZ5A 1JZ5A 1ACCA 5FMCA 1G7YA 5FOJB 2EXKA 3USUB 3B9CA 3I8TA 1JOPA 2WN2A 4BMBA 1G9FA 1DZQA 4QQ2A 3EJKA 4AHYA 4IW3A 3NKGA 3VKNA 2CTVA 1APNA 4PDWB 1VBD1 1XNKA 2LM3A 2ZEYA 3AVSA 3ORJA 4LO5B 3MIDA 2XPJA 2RDQA 4RQPC 5KXDA 2JG8A 1V0AA 3LD8A 3ZFFB 3BPZA 3RZGA 1UZVA 2GNBA 1HDKA 1NLRA 1S0EA 2OPKA 1T6BX 4YM2A 2JB4A 1ZBA2 2WO3A 1RUC3 1WW4A 2DVDA 3GYDA 4KG8A 3WNKA 4COVA 3S5AA 2B9UA 2VNVA 3NKTA 1XE8A 4PI2A 2IFWA 2GN3A 3V0AB 3O7OA 1LOFA 3N7LA 4AVSA 1J83A 1GP4A 1MS4A 1HJGA 2ZEZA 3JXSA 4FFIA 3WV6A 1HJFA 4H55A 4BDVB 4CP1A 2NMNA 4EROA 2VUCA 2QBXA 4IEQA 3RQ0A 1BK1A 4S2HA 4CCCA 3ZXFA 3VV1A 4Y24A 1H9WA 1RUC1 1ULCA 3MFCA 1G9CA 2MNGA 2LROA 4LKDA 3MLKA 5A1LA 1YQ6A 3AXDA 5DMYA 1UD1A 3APBA 2O8QA 5T50A 2P3KA 1DGWX 1PX4A 2VJXA 3VBFC 1FNYA 1QXPA 3CKHA 3KQ4B 4ASMB 2D6MA 3IZOA 1NOVA 4XQWA 4EZ4A 5F32A 3VD9A 1WMFA 2YROA 5BNOB 1NXMA 1UU6A 4C90A 5A6ZA 5FZ4A 5IVFA 5BV6A 1REFA 1VAVA 3KQRA 3VZMA 3QLQA 3ZYIB 5J36A 4LBKA 4XF1A 1H2KA 1R1ZA 5I8TA 1O8SA 3SISA 3HN1A 1D0GA 2KM2A 3AKTA 3IPVB 4GB32 1J3RA 4QWNA 2RM23 1JYCA 4J25A 5F5CA 4B7EA 4AQ6A 5DAWA 1GNZA 1AF9A 5FMDA 1QJY3 5JSOA 5ERLA 2I45A 1JYWA 4A6OA 3NNGA 5KR7A 2PFWA 3AJYA 3I2IA 2BZDA 4B3NA 5A1AA 4IEUA 4R9AA 1BBT3 1PGW1 2QVSB 3AMPA 4JGYB 3ZM8A 5B4XA 3S6PA 3WDVA 3HJRA 3ZYHA 4NHXA 4OI1A 4DS0A 2RM21 2XL9A 4XTMA 2A73B 3ASIA 3SH3A 1W6PB 3CJIA 2C6SA 3RYKA 1QJY1 4Q2FA 4CCEA 2W08A 5DAPA 2WNVC 1V6OA 3SXWA 2IXLA 3MV11 3ZPOA 2EF6A 5C3PA 1YYNA 3A0NA 4DUXA 5C6CA 4BQ1A 4FTEA 5C8CA 4FTBA 1WD3A 2ZGTA 1POQA 4S2DA 2WAAA 2QZ3A 3SKJE 1D7PM 1QU0A 2GP3A 1PMHX 2PAMA 1BBT1 2QQUA 3LSEA 5C7GA 1QOSA 2ZZJA 2E6VA 5HI0A 4LHSA 4W6WA 2XLAA 5FJKA 3URFA 4QX8A 4XQDA 3CQOA 3WNLA 2Q8EA 3IBMA 3MUY1 3NRUA 4OI4A 4YNIA 5JIAA 4XUNA 1HKDA 2CAUA 4H3WA 1ZZ7A 5GZDA 3I3QA 4CRQA 3J8F3 3PL0A 2PQQA 3MDPA 3T2QA 4XFGA 3JUUA 4GMP3 1W6QB 1PVC3 5FYBA 1YC61 5FYMA 4R9CA 1OLQA 1D2SA 1H0BA 3JB4C 5EJ1B 4FPKA 4M0NA 4QPGC 5DDJ3 4MSVA 1A78A 5FYYA 5FO8B 2BGPA 3W20A 2JKBA 1M4WA 1QNWA 2F17A 2ZX4A 3AP7A 3N7MA 4CDQA 1CGPA 3C7FA 3V0BB 1RB8G 1RUD3 4KNCA 1VMFA 3WW3A 4R52A 1AX1A 3J8F1 5LATA 1ST8A 4GMP1 5F7UA 1PVC1 4QM8A 2Y60A 2A6WA 1HV1A 2I07B 3Q9OA 4CU7A 5FV3A 1DIWA 2DTYA 5M0TA 4N7UA 4JTNA 1NXD1 2W46A 5DDJ1 3D3AA 3M3EA 1Y43B 1CESA 2D98A 1F5JA 1UOGA 1PK6C 2VOXA 1AXKA 4ORFA 1RUD1 3BB6A 3LIGA 4PDWA 2D43A 3MF6A 3WDUA 2WFPA 3PTRB 5FXXA 4JGZA 3NNLA 1OLME 1KITA 3OUIA 4K8RB 4I09A 1W04A 3OEAA 3ZFFA 1S1AA 3I54A 3HOBA 3OPZA 4XABA 4NRQA 4XTPA 4EN7B 3ZKUA 5LA1A 1VMJA 4I0WB 5F5IA 1UWWA 5IFTA 1J58A 1XSQA 1DCSA 1DQ1A 2Y6KA 5F8PA 1W03A 4NHYA 1ZRIA 4EWEA 2VY0A 3NO8A 2AH2A 4RQPB 3B69A 2R043 2A3WA 3SQOA 4DEQA 3V0AA 2PHXA 4CXWA 3K77A 1VRBA 1RUF3 2BVBA 4AVAA 5HPOA 3BGAA 1BZWA 1XNTA 4YFWA 1MQTA 2BW8A 2J1RA 4FQ4A 3WF2A 2GZWA 3VD5A 5FP8A 1OSGA 2YXSA 3HT2A 2ADDA 3MHZA 4KWKA 5CU1A 4YG6A 5DQ0A 5HXVA 3TAYA 4CDUC 2JECA 4E2SA 3VKLA 1QEXA 5KXEA 2JWPA 2Y8KA 3S57A 4BZ4A 2R041 4RGKA 4L9BA 2DU1A 4RSUA 2XLFA 3LA3A 3RGBA 2E9QA 1DZTA 4G3YC 1RJ7A 1VBC3 1RUF1 1W8OA 4HSLA 1GQPA 2EAAA 2VQ0A 3KT1A 1I1EA 2A7AA 1T6GC 5F3IA 4BOWA 3R4DB 4YGBA 1TG7A 1W99A 2WL1A 3E5UA 1C8M1 1B35C 4Y4YA 1TE1B 4LMFA 4E8DA 5IWFA 2RS52 3VBFB 4G4FA 4R4XA 4XE9A 4BIOA 1UX6A 1PO13 3D6EA 4P9IA 4ZZ5A 1X9TA 3IIAA 5GALA 5D21A 4OQ9A 4XILA 1RUG3 3NSTA 1ZRCA 3N35A 1VBC1 1UL9A 1XNCA 3IPVA 2FDJA 4XCBA 4WVZA 2A6ZA 4YVSC 3K3NA 3VGIA 5ANNA 2DCTA 2FCUA 2D44A 2G9FA 3AC0A 5FDBA 1S0GA 3POBA 1ULEA 1WCDJ 1MS5A 2WINB 3KVAA 3W21A 4P9JA 1PO22 1W9FA 1PO11 1LAJA 1ULFA 4ASKA 4QX2A 3EMRA 4BB3A 1YFUA 3JZVA 2G9GA 2VL4A 1RUG1 2Y6LA 4JGYA 4N53A 4PIXA 5DUVA 5FYHA 5A3WA 1ALYA 3USUA 4ISQA 2C9AA 2OX0A 4RS5C 1WW6A 3KT4A 1R1A2 2XJVA 1W2TA 4LQRA 2AREA 1PGL2 4A6SA 2YFZA 4KQ7A 4R8HA 3V65A 3WNOA 1AYM2 1OOPC 1JODA 2UWAA 2VVFA 3ITQA 4IEVA 4K21A 4QB2A 4YW1A 1KS4A 4AFDA 2PLV2 3MF9A 3U4XA 1F4AA 1O3SA 1DP0A 1KEXA 1U5XA 2WNVB 2JD9A 4BQ2A 4TLGA 4H7MA 3SC7X 4FOQA 4A7ZA 3MO4A 3VZJA 1COV3 5HCFA 4DPNA 1S55A 5F3GA 3TBDA 4HXCA 4CCLA 3A22A 2A70A 2VUAA 4CA9A 2RS33 2V09A 3HD8B 4QAWA 2PMWB 1Z7S3 4P5YA 4DINB 3O5SA 5K7PA 2ZGMA 3RZMA 3QCWA 1SFNA 2VZ1A 4NPLA 4L11A 4ZXKA 1W6QA 2XXZA 3I97A 2QQPA 3OG2A 3OTFA 1COV1 4LO6B 3VBHC 3WXPA 4LO8A 2O14A 2XVLA 1RMU2 5IT6A 2RS31 1JYVA 2PQSA 3MPPG 5CYYA 3MIEA 5KBFA 3OGRA 1Z7S1 3K46A 4LLFA 1W6NB 3PTYA 3IM0A 3P3PA 4FPYA 1GZWB 1UN1A 1XU2A 2HWB2 5JZGA 4QPGB 1I3HA 2J1SA 3U4SA 5FZCA 4M3CF 1DQ2A 4AG4A 1W6MB 3C2UA 1JZ8A 2BUKA 1JBCA 5D1IA 1CAUA 1AR63 3THCA 1GQHA 4FPLA 4EN8B 1HXS3 3QD6A 4YW5A 2W1QA 2NP0A 3JD73 1UW8A 3ES1A 1W2OA 2AUYA 1DHKB 1KJLA 2JDYA 4XJ9A 4FPHA 4Y22B 4MLOA 1H8TC 3JU9A 1PK6B 4AL9A 2VNOA 5H9RA 2GMMA 2J42A 4LUMA 1AR61 4QX1A 1HXS1 3C3VA 3JD71 4RQPA 4INDA 1XNDA 3S30A 2A6VA 3C7GA 4D7YA 2RS12 3ZXKA 3E5XA 3PUQA 4MZUA 3N9OA 3PMSA 1YXWA 4IEPA 1MZEA 4NIAA 4ARXA 3ZMNA 1KJRA 1AR92 5BY5A 2ZGNA 3NW4A 1WW5A 4WVVA 2C5DA 2K0GA 2V73A 3F95A 5FPVA 1H9PA 2HWE2 1GZTA 4XF0A 2CWMA 1A8DA 2FBEA 1V9U3 1HB1A 2EXJA 1AJKA 1W39A 3FBYA 5A7NA 4CDUB 4LBJA 3RI8A 3U07A 2R6QA 2ET7A 5GM0A 3INAA 1GANA 5IAVA 4BIFA 3QACA 1S0FA 4P5HA 3ZYPA 4DUWA 5ACA3 3POGA 3UETA 3VBUC 4C0HA 1TME3 1PX3A 2R073 4Q0SA 3VBFA 4JKLA 4TSVA 5IVBA 4R9BA 1JTZX 1AR73 4MADA 4QXCA 5G05L 3ZFEC 4XVHA 1V9U1 4YW3A 1QJU2 5JI9A 5FPAA 1B35B 2QQVA 4QX0A 4WM8C 1JH5A 4DB5A 1CJPA 2GC1A 2W52A 2C24A 2WO7A 5FPBA 2BJSA 1RUJ1 2XB6C 4MGQA 5IUQA 5L73A 3K48A 1NY71 3OGVA 4Q4V2 4AGRA 2VU9A 4AQSA 5ACA1 3U78A 1YEWA 3WT3A 1TME1 2R071 4LORA 4QB1A 4XFBA 4BYYA 4D6RA 3ZSJA 5BNNC 1X50A 4ES9A 1AR71 1Q3EA 4Y1VA 2BVVA 3AYAA 1ULDA 4K1ZA 1LOBA 3WEZA 2W5FA 2W9XA 1GOHA 4BWOA 2CHHA 2J1EA 3MI8A 3BTZA 3WG2A 4ZKTB 4D7SA 3GBGA 1NCRA 1NX9A 1JXNA 4M00A 5FZ3A 4AEDA 1AXZA 2FCTA 3C7EA 5JXJA 2WKKA 4HKLA 3DF0A 2QQOA 5KC5A 2YGLA 2YU1A 1DQ4A 5FY4A 1A34A 2ZABA 3B7MA 5CVRA 4CU8A 4KU8A 4RS5B 3T1MA 3TB0A 2WNVA 5A6YA 1UY2A 2RJLA 3WW2A 2XG3A 1X33A 1YIPA 4GMP0 2YYOA 5JWPA 2D5FA 1OOPB 2OVUA 1ZM1A 2Q4SA 1C3HA 3J7LA 3FUQA 1HRI3 1E5SA 1U0AA 1JMUB 2EICA 1GP5A 2LALA 5CZKA 3VBOC 1W8UA 1JHJA 1MVEA 3IT8A 3NV2A 2NM1A 5FBZA 1G86A 2JDZA 2GC3A 1NT0A 1YJLA 1RUE2 4HN0A 4NAMA 5GZGA 2IUWA 3VHPA 3H8XA 4X6RB 3IKWA 3GALA 3NJYA 3CZJA 5IYYA 4Z2WA 1HRI1 4FP2A 1LCLA 3AMMA 4DXSA 4QKFA 3PNAA 3R6SA 5L36A 2IZWA 3RWKX 2J1TA 3JQWA 4OZOA 1W6NA 2W95A 5K9YA 1RITA 2KA3A 3VBHB 4DQAA 2OZ6A 1GZWA 4EN0A 1O59A 4GZ9A 4PIZA 1JZ4A 2D93A 1F35A 1IPSA 2IC1A 4TN7A 3UT0A 2V72A 1Q5OA 2VQTA 4LKSA 4OHVA 1W6MA 3QOPA 2CDPA 2YPJA 3POSA 1TEIA 2RMU2 4ISRA 4Q29A 2FDKA 1RHI2 5ANQA 4AFBA 2XJPA 3OBZA 5EZWA 4Y22A 5D8AC 2PAKA 5T5PA 1QOOA 4XHXA 1DU3D 3FN9A 3TN91 4TTGA 2CGPA 3WQ1A 3WNPA 2KD7A 1PK6A 4GQ7A 4W8JA 1OA4A 1W6OA 5T52A 5DAQA 1SMVA 1W9YA 4HZFA 1UAIA 4FPOB 3CJXA 2CU5A 3I49A 1E5HA 1H8TB 3FLTA 1B09A 4X8NA 1H1MA 1X7NA 1MPXA 4JCKA 4YW7A 5F2SA 1H6YA 2HWF3 4AAPA 3D4KA 4UW3A 4XCAA 4Y20B 2BPA2 4HFSA 4CZSA 1KFXL 3N7JA 3PDQA 3ZSMA 2AACA 2WNUB 4FTSA 2ZXQA 2CWSA 4QQHA 5FZIA 2VXRA 1RUNA 3X29B 1ZRRA 4AFCA 3WF1A 3HNYM 5K4LA 4YWAA 4OHWA 1TNRA 1Y7BA 2ID4A 2TUNA 3PJYA 4Z82A 4D6QA 1Y3TA 2J1VA 4U36A 3BN6A 4CDUA 5C70A 3O1UA 5FOBB 3VZNA 4AEKA 2PHFA 2DVFA 1UYZA 2ZS6B 5EP9A 4TLFA 4LNVA 2HEWF 2QQKA 1L3JA 1U12A 3GM8A 3I3MA 3O0XA 3I7DA 1HQWA 2BOIA 2WWUA 4QX7A 2D3PA 2PYTA 5K8SA 4BM8A 1B35A 2WNOA 2WO1A 1ZZCA 3AFGA 2E63A 4RR3C 3GCWA 4YGEA 4AVVA 3VBUB 2DTWA 2FDHA 3RYRA 2Q8DA 1RC6A 5TSWA 1GWLA 3KWVA 3ZFEB 1CX1A 1VRH2 3VD7A 1PIV3 1HQNA 4WM8B 3FE5A 2XWBB 2DCZA 1YFWA 3RJRA 4R9DA 4Z8BA 1DGLA 2NYYA 3CO2A 4XACA 1OA2A 1QOTA 1UOJA 4COUA 5FZ8A 1CAVB 1HRV3 1ND2C 2QDNA 3ACGA 4HLTA 3AZYA 3NJZA 1AL22 4Q26A 2WUHA 4AI0A 3U1XA 2JIGA 3LOIA 5BNNB 1CIWA 1BHGA 5FZKA 4FVVA 2P3JA 2Y6GA 5J09A 4AI1A 1SPPB 4YM0A 1PIV1 1IG3A 2WNEA 1R082 5FWJA 2PHTA 2NLRA 3T30A 5L9BA 4LOSA 2VCAA 4RS5A 5A1FA 5BNPC 3R05A 1JZ7A 5C4WC 1LGNA 1HRV1 4GKXA 2D40A 5LA2A 4J1XA 3ABZA 4I30A 5JMOA 4AVCA 1KXGA 1VBA3 3IAPA 3NV4A 3UKTA 4NIHA 2ZGQA 5JXHA 2QQNA 5DUXA 2OQ7A 3H3UA 2YC4A 4LBOA 3GGLA 4OI2A 3SEPA 5HBAA 4XMAA 3WCRA 4ZU5A 2A3YA 3OCPA 1FMD3 5IFPA 4EE2A 3P1IA 2VW1A 2CNAA 5FQ0B 1AL0G 1YJKA 3RG0A 3W58A 2RDSA 5K0UC 4NOTA 4XURA 5A7OA 4GJZA 3H0OA 3WUCA 1QDOA 2FDGA 1VBA1 5JR7B 5C5TA 5KHKA 3VBOB 5AC92 3O1TA 1S2BA 1WKYA 2ZEXA 4NUBA 2W91A 1VLNA 1OUXA 1VP6A 3Q8CA 5GKAC 4QXKA 2J1AA 2HLEA 4OLLA 1HLCA 4CSWA 1AUYA 1S2KA 1FMD1 4XPVA 2FDFA 3LA7A 3VBHA 4JAAA 3OD4A 3O1VA 4GD4A 1ZBA3 2Z69A 1DFQA 2Y38A 1VBB3 1AXYA 1OFNA 1X8EA 4UFMA 1KFUL 4FP3A 5FZOB 1JYIA 2BERA 2VW2A 3EYPA 3HR9A 2LRPA 2CDOA 3VDBA 1W2UA 3A4UA 2J1UA 2JJ6A 4NHLA 4MOAA 5A3LA 5DAXA 3N3HA 4A2UA 1PHMA 4Y5SA 1S0CA 4Y4RA 5FUIA 1PNFA 2HJIA 2HWC3 4LBQB 4UT5A 1ZBA1 3EO6A 1JS9A 4QM9A 4LK6A 1RJ8A 1VBB1 4UFLA 5HXMA 3F2ZA 3O1SA 1ZRDA 1DLLA 5F37A 5IVVA 4Z92B 4FFGA 5D8AB 5EJZB 4WV8A 3LA2A 3T0AA 4C0BA 2UYBA 2XOMA 2XBO3 4IEOA 4AVTA 1KRIA 4H7LA 1XB9A 3E97A 1K3IA 1LOAA 1H8TA 2HWC1 2D97A 3PU3A 2JDAA 4Q4W2 1DGRA 2WQ8A 3EXUA 2XL7A 4N9HA 1HX6A 1TMF3 1W9WA 3M3OA 4MGZE 2BFUS 4MXWB 2XWJB 1BQPA 2VTXJ 4N90A 2VOVA 3HQRA 4XZPA 4AQ2A 3AJZA 2EVXA 1W0OA 2UY8A 1YNAA 2WNUA 1IPJA 2YBPA 5E89A 4A3ZA 4ATEA 5C3SA 1GICA 1R64A 2XBO1 1UMHA 1QJZA 1L7QA 3ACIA 3UJOA 1XYPA 3PUAA 1OQDA 1U5ZA 1TMF1 1OC1A 1E5RA 2GMPA 3VD4A 3JBG2 1LEDA 3UGFA 3AZVA 3GHNA 3ZLIA 3LDBA 3N9PA 1PMJX 3J7HA 1UO9A 2YB7A 3PUSA 2B5HA 3PUHA 4FOYA 5FZFA 5JLVA 1R092 5GLVA 5FWEA 5LK7B 4NAOA 5FLIA 2ORXA 1PVXA 4QMAA 5H9SA 3TOJA 3VBRC 4R4ZA 3I2KA 5LRRA 1OD5A 3WF4A 4JV4A 2VCBA 1LENA 3VBUA 4K1YA 2VR4A 3AMNA 3GXUA 1SZBA 3ZN4A 3O1MA 1J3QA 2HYXA 2PHDA 4LULA 1YFYA 3LE0A 1F9KA 3B02A 3ATGA 4Q0VA 4RR3B 4YZ3A 4MO3M 3H7JA 2B7YA 2Z5WA 4D6SA 5A70A 4QU2A 4FPCA 1W3XA 2WA4A 1CAVA 2R0FA 1TNFA 2VUJA 4GWIA 2VZOA 2AENA 1UMIA 4DEVA 5BNNA 3WD5A 5JOYA 5LY2A 3MW4A 4RL7A 5BYNA 3POEA 4OUSA 3ZN6B 2KR2A 1G6NA 4MGYE 5FMOL 1SPPA 3LEIA 2YZ4A 1NLSA 3HT1A 3NL1A 4YPJA 4AQTA 2GALA 1W8NA 2VVEA 1C1FA 4CU9A 3CBNA 4I2OA 4A42A 4RA0A 1ENQA 1OLRA 2SLIA 1O5UA 3WHTA 2W47A 3PVNA 4L92A 4H2AA 5L9VA 4OI0A 5KWRA 1RXFA 1OT5A 2JE9A 5BNPB 2YC0A 1F5FA 1O4TA 1YIFA 5C4WB 2WLQA 4XBLA 1K45A 2VMGA 1IOAA 4KH9A 3T0BA 5CIRA 3VDDC 4GWMA 1RYYA 2DDUA 2H0VA 2VO5A 3BU0A 2EIBA 4Y5Z0 2BP6A 4K7JA 2PHLA 2D6KA 2GNMA 5FYUA 4J6GA 3S7EA 5FQ0A 1VBD2 3THTA 2GNTA 2P34A 5CEHA 3WSOA 4M3CA 1QXJA 3I2DA 4K3UA 3FHQA 5FKBA 3VBOA 4CUAA 2Q0AA 4BK4A 3LB9A 5A6XA 1P8JA 5K0UB 2HBTA 3I3EA 2DBIA 1POV0 3ZYBA 3ZYJB 4A45A 1UU5A 1AVBA 4IV3C 4PF5A 4WVMB 1Z0HA 4B29A 4FAHA 2A6YA 2JX9A 2ARAA 4QGNA 4JQRA 5I0SA 2PXJA 2ARBA 2WLPA 1LRHA 2VMHA 2X05A 1GP6A 2IWGB 3DKQA 1IKQA 4LO7A 1O8PA 1QQP2 1SDDB 2E51A 1OH4A 2EIDA 5FYVA 4Q1PA 5JVVA 5E1RA 4QXHA 1Q8PA 2BU9A 1W06A 3BOWA 4LBMA 1AR83 4UXAA 2ORZA 4LBQA 1GNYA 3V64A 2XH6A 2YHJA 4TZDA 3V56A 1WUVA 2BRTA 3AP6A 1I9RA 4DY5A 1HW5A 1MS9A 1Y9GA 2WWJA 5LA0A 1H2LA 3ACHA 3MIFA 1XRUA 5AVAA 5IVEA 3PHMA 5T5LA 4ZHNA 1AR81 1FYUA 3M3QA 3P5BA 3NV3A 2B9VA 3USSA 2A5ZA 4QXBA 3ILNA 5EQUA 2RS53 5IVJA 4UFHA 4BPZA 5LBBA 3D82A 1IGOA 2NN8A 2YMZA 3EHKA 4FI9A 4LK7A 4MXWA 3WX5A 4BE3A 1QDCA 1WLWA 2OUJA 4HT1T 5J96B 1D2QA 3ME2A 1ZREA 3M3CA 4YZ1A 5GLUA 3QBQA 1EUUA 2A3XA 3LDRA 5T5JA 5FY8A 3AL5A 4P9YA 4Q8KA 3C7HA 3LZZA 4CPBA 1JOJA 4YRDA 4QX3A 4M0HA 2RS51 3TRSB 2V4AA 4L8QA 2RM22 3HPNA 4MGKE 5DZFA 1PO23 2P6HA 1VB4A 3OSDA 4YZ4A 1O3QA 2XONA 3G6JB 2OIIA 3VKOA 1CN1A 4XFIA 3T2PA 3ZXLA 4M4RA 5JXIA 4XF9A 1W8FA 4QPIC 1WW7A 2ZTNA 3LSDA 3BU7A 4P02B 3OBAA 3T2OA 4QT6A 3WNMA 1BEV3 3MLLA 1RVF2 3LPGA 5FUPA 1PO21 1AYM3 3OGGA 2ZKNA 3I2FA 2Q8CA 3IAQA 4MV2A 4XIKA 2PLV3 3MIGA 3VBRB 5LEJA 1C8M3 2GMEA 3ES4A 4UFIA 1SLCA 2VZSA 3Q8EA 3SEEA 1QJFA 2DWRA 4CDWC 1MVQA 2ZOEB 3AKRA 3DYOA 5FZGA 4RR3A 2G9ZA 4TYSA 1QMJA 2VZPA 1JI6A 4K8FA 3MYXA 3B01A 1BVP1 3KMHA 1H8VA 1BEV1 1AYM1 1ZVFA 5FZDA 4ZZ8A 1Y9QA 2MHFA 5I8SA 1JU3A 3VZKA 3TEYA 2PLV1 3B00A 1SEFA 4PQQA 4DY3A 2VULA 4Q4Y2 2TNFA 2QNKA 4RFT0 5BNOA 3ILRA 2VZQA 1WMXA 1LHOA 5F2WA 1OF4A 3I2OA 2MPFA 1ZZ6A 4OCTA 1RMU3 4RHV3 2OT7A 5LRSA 3J8F2 2RR12 3WP6A 1O5LA 2VMFA 3B3QE 3OGSA 1F15A 4XZUG 1ULOA 1LTEA 4RN5A 4Y33A 3RDIA 1G9DA 4DIQA 3AP9A 4EWAA 1C4RA 1YI7A 3GBWA 1OURA 1XQNA 3VZOA 5APAA 5C4WA 5JSPA 3BVCA 3BI3A 4JC1A 2F4LA 3I3DA 3WW1A 3BTXA 3FHAA 1IS3A 5C71A 3EQEA 1XYNA 4XXAA 1RMU1 1EPWA 3GNEA 4RHV1 4Y5TA 4JRAA 1GR3A 1PZ8A 5DZEA 1VBE2 2OUHA 3KF5A 1KQRA 3M1HA 3SITA 4KGQA 5GZCA 5EHDA 5J98B 1HB2A 3VDDB 4BQXA 1W6PA 2ERFA 2FMYA 2PHUA 4MX3A 5EPAA 3LDKA 4OYUA 3QH7A 5K0UA 1EV13 1LHVA 4Q27A 1EP0A 3UGGA 2GH2A 1BVVA 3ZXJA 3VL8A 4LA2A 4L0PA 4WVWA 4YG3A 1C5IA 4META 4K9SA 4WVMA 4XJUA 2YY1A 5A80A 1UKGA 1UXXX 4MYEA 2WS93 3VD3A 3ENRA 2VOTA 1QH7A 5GZEA 3SCFA 1BYHA 3CHXA 4XFHA 1UKRA 5FZLA 4IV3B 5DG2A 3NMBA 3ZIWA 2BNOA 3BPSA 1EV11 3GZEA 4YG0A 2GC2A 2QUOA 2UYAA 3GJBA 2XDVA 3J7MA 5JCTA 4MVTA 5HCHA 1ONAA 2UU8A 2IFRA 1HV0A 2XQRA 1AR93 4LKFA 1RUF2 3LCPA 2WS91 2JDPA 4XDOA 4CEWC 4IDZA 1OF3A 3U75A 5IAXA 3DECA 1C57A 3H8RA 3N9NA 2A75A 2WFF2 4TWTA 1GOFA 5FZ1A 2BOJA 3WP3A 4IV1C 1XBFA 1J3PA 1AR91 1QIQA 5FP4A 4A3XA 3V0BA 1VBC2 2RG4A 1O91A 3OPTA 4CDXC 1YQ8A 1J1TA 2XJQA 2ZACA 1QNYA 1XE7A 3C7OA 4JHZA 5A32B 3AK0A 2X10A 2X09A 5DABA 4MG2A 5E88A 1FAYA 4U2AA 5IK8A 4EWDA 1QJU3 2DCYA 3POJA 5JPMB 1LESA 4OHYA 5LASA 2Y6JA 1RIRA 1PM7A 4OULA 2VCCA 1PO12 3FL7A 3AZZA 3TNPB 3BYWA 3VHRA 4OMCA 2WJSA 4Q4V3 3N9LA 4ZONA 5LBFA 4COWA 1RUG2 3PIGA 4S2FA 2WZR2 3T2TA 4SBVA 1NA1C 1RUH2 3A7QA 3K4ZA 4P00B 1OVPA 2I74A 2PAEA 4NPRA 4FPGA 1FI2A 4GWJA 5ABJC 1N1SA 1H2NA 1J59A 1QJU1 1PGL1 4PBPA 4XUTA 1GOGA 1UOBA 2BGOA 4L97A 3M8LA 4CP2A 1WGPA 1ENXA 4LHNA 1NCQC 4GA9A 4Q4V1 1WMDA 3DPRC 5KHIA 5J48A 1GUIA 2VH9A 4CXXA 3VKFC 2YG0A 1I5PA 5JIUA 5IK4A 1LGBA 1Q56A 4MH0E 3RI9A 4IE0A 4QPIB 4HOOA 2F4PA 5F3EA 5F9TA 3VBRA 2WC2A 2QQIA 5J7MA 5F5AA 5A7WB 2DFCA 4BQ3A 2QQJA 3E6DA 3IDAA 4IE6A 4QDQA 5EXOA 2QDRA 3ZYRA 2XR4A 1SCSA
chains in the Genus database with same CATH topology
1UPIA 2CGNA 4CDWB 5A33B 4XOGA 4AWDA 3B93A 1COV2 1RUJ3 4NVPA 4YW2A 1F8VA 4HBNA 2DURA 1D0HA 2RS32 5KC6A 1RUE3 1CAWB 4HN1A 1FOD3 1D4M3 3ZSKA 1JN2P 1QWRA 5L7OC 3GF6A 4LBLA 3SHRA 5DUUA 2ZGSA 2JG8C 2IXJA 4X8PA 4F83A 5BPXA 1ZBE2 4Q8LA 3WP4A 4HL0A 1LHUA 3O0VA 1QKQA 4DXZA 1RUE1 4SLIA 1FOD1 1D4M1 4URTA 1OQ1A 2XKPA 4YVSB 5AFEA 3KT7A 4FO9A 3UL2A 2O0OA 2HWD2 2RMU3 3VDDA 2VOKA 2GAUA 4XW3A 4QQLA 3AXEA 4NHMA 1RUI2 3MIBA 3PVBB 1CJDA 5CG8A 4AF9A 4AK3A 1GQGA 2B46X 5FAXA 3AZXA 1WLCA 3T1LA 1VR3A 4AHZA 4A7KA 2RMU1 5E8AA 1LJ7A 1DDLA 4NWWA 4WZFA 3S7IA 2ZX2A 4E4ZA 1PMIA 4IV3A 1OA3A 4CP0A 4HKWA 2G4IA 1QHDA 1AYN2 1UPSA 1X82A 5FCCA 4AFMA 1ND3C 3GBFA 3WDYA 2EA7A 3AM2A 1C28A 5KHJA 1S0BA 2IXIA 1G9AA 3ZFGC 1LB2A 2KXLA 2N7GA 3ELNA 3OYWB 1IQAA 4PJYA 3RSJA 5EYYA 2Z79A 3DGTA 1BMV1 3MEPA 5GLZA 2NPIA 1NZCA 3AYCA 2DCJA 5EYXA 2WQ4A 4YYOA 4CEWB 1IS6A 2VW0A 1HIXA 4HMZA 4AI8A 3AZWA 1YO8A 3ZXAC 4QPGA 5A32A 1TQ5A 2ZX3A 2ZX0A 3TN93 4NN0A 1NY72 5KHGA 1MZ5A 4IV1B 1RTVA 5ACA2 5JPNB 1ZX5A 1LOEA 3RNSA 3D8CA 1TME2 2R072 4CDXB 4YM3A 5C8WA 3KZ4C 1BXHA 3AX4A 1CQ9A 4AVBA 1SLBA 5DXDA 3OGJA 5EJ3A 3HWJA 4E2QA 4WBBA 1OPMA 2B39A 4KWLA 1O3TA 1FX5A 2PTMA 1AJOA 3KCXA 4W6YA 1NA1B 1X36A 4FPFA 5ABJB 1QXRA 4PQ9A 1KDMA 2YGMA 4OZXA 2ZGRA 4P9WA 1R083 4IXLA 4QPIA 1NCQB 3DPRB 4PCRA 4W65A 2MEV2 2GU9A 4NWVA 2UURA 2BWAA 1YHFA 4GH4C 4B4PA 3N7KA 2XJRA 1H1IA 1I6XA 4HANA 4KU7A 5A33A 2UWCA 4CDWA 5AFBA 4YGDA 1JW6A 1R081 2W39A 4PBOA 3ILFA 2BEOA 2D5HA 3J9SA 3JQXA 4XJWA 1HRI2 2XHKA 3MICA 3WG1A 1CAWA 4I0BA 2WT1A 4ZU4A 1RGSA 2WA3A 4JGZC 4JRLA 1REEA 1MS1A 3KGZA 2ZBJA 3WUDA 1UIJA 1RL3A 3WDXA 5L7OB 2ZGLA 4LE3A 4DRVA 2JG8B 5F5QA 2CL2A 4XETA 1QJX3 3ALQA 4FCAA 4YVSA 5AC91 5KXBA 5F6LB 2I2SA 1IS4A 3H1WA 2C0ZA 3OF1A 4PLOA 3LOBA 2PN5A 1N3OA 1ASJ3 1MQTC 1N1TA 4LR4A 5H9PA 3RYPA 3FZ3A 4ATFA 2FQPA 3ZVXA 3SMHA 3WDTA 2EXHA 3M4FA 4D69A 1QJX1 1VB2A 3M7AA 3MW2A 4E4SA 3ZYGA 5HCAA 3NVCA 1ASJ1 4Y1YA 5T54A 2OA2A 5JMCA 2X5IC 1OOPA 1C8NA 1VJ2A 4BH9A 2WT0A 1CPNA 3ZPYA 2C1FA 3VBSC 5FTTC 1EAH2 1NYWA 3L2HA 2DF7A 4Y1UA 4LT5A 2HWF2 3OYWA 4Q4X2 4XQ4A 4E2GA 1ND3B 1WBLA 2YV8A 4Q4W1 1F2NA 3ZFGB 3CEWA 2E7QA 3JBG3 4CEWA 4FAGA 3KCCA 4N53C 5B2GB 4QQPA 2H6BA 3FC0A 3MGUA 4XFCA 4E4DX 1R093 3M2MA 4LE4A 4FQZA 4L99A 3K51A 4IV1A 4COYA 2DCKA 3W59A 4CDXA 4COZA 3JBG1 1GFF2 4CYDA 4EV0A 3OY8B 1W0PA 1OQEA 2RHPA 3UKNA 1GLHA 1WD4A 4FOWA 1R091 1FPN2 1MZ6A 2VECA 4FXGB 2ZHNA 3U11A 3OJBA 2HKXA 2VQAA 2P37A 4XHBA 2HEVF 2VG9A 1LGCA 4FPEA 1NA1A 4XF3A 2HEYF 3W9AA 4N9IA 3SNMA 5JOZA 4A7YA 3VLBB 2P3IA 1MEC2 5DZGA 1HRV2 1ENRA 4KG0A 2ZA9A 1OPOA 1Q43A 4Y20A 1UMZA 1NCQA 3DPRA 4I02A 1H1AA 2CGOA 4GB33 3BALA 4QQOA 4XMIA 1HQLA 2XVKA 4QD2A 5JZGC 1A6CA 2ZKLA 1VBA2 3UV9A 5T55A 1IKPA 3I59B 3U10A 4GH4B 4GB31 2IXKA 4B8EA 1QH6A 1H2MA 1Z78A 2D7FA 2LTNA 4QGMA 2H0BA 2XLGA 4F8AA 1LOCA 1LULA 5CFDC 4N43C 1V6MA 2QFEA 1Q8VA 3KSCA 4G9SB 2W68A 5L7OA 5AVPA 2WSUA 4JGZB 3ZFEA 1WLTA 3BCWA 2QKDA 4WM8A 3EBRA 4BLJA 1GYKA 4CTEA 2ZX1A 3HQXA 1QQP3 4OHZA 3VKMA 1H4HA 4UW6A 1VBB2 1WA4A 3FMGA 3IWZA 3AP5A 2R062 1GZ9A 1D4VB 2OW4A 1IZ3A 1MQTB 3KB5A 1ND2B 3I4IA 2HWC2 1N3PA 1QQP1 1YWKA 3O14A 4IEZA 3RS6A 4HVOA 4XJAA 4IESA 3UKVA 4LTAA 3J26N 3CNAA 2NZ9A 1UZZA 1ZZ8A 2O8OA 5FRAA 3O12A 2XBO2 4LO4B 2NMOA 3N4MA 1CD3G 2X5IB 2Y0IA 4Y1ZA 1FT9A 1TMF2 2B8MA 3WVJA 3IN9A 5J3UA 2JICA 3SLIA 3M3IA 3VBSB 2ENRA 5SV5A 4ITCA 1XXNA 1ND3A 4KBBA 2H6CA 1DGWA 2BNNA 1AX0A 2EALA 1CR7A 2X8KA 2WT2A 3ZFGA 4DMIA 5FFOC 1YUDA 4PLMA 2BQPA 3N36A 5I8YA 1NCRC 1DYKA 4AEDC 3KD4A 2DU0A 2WQZC 4N53B 4ES8A 1S0IA 2Y26A 4HKOA 1RVF3 2D3SA 2QE3A 4XFFA 1RUC2 3USUB 3FWEA 2BGCA 4XF4A 2EIGA 3OY8A 4RGGA 3WINE 3SH4A 4DRRA 5BUVA 4AXOA 2BWCA 5BXXA 4IEWA 5FLHA 2WZPP 5C9AC 2XJSA 2D6LX 5DUWA 3SCHA 4I3GA 4LHKA 1AHSA 3KS7A 2AZ5A 1RVF1 2PA7A 5D8AA 2JEMA 3HIFA 4EN9B 3RRDA 5CA6A 2ATFA 2WSVA 3KLSA 4B7KA 5EWSA 1GSLA 4Q4Y3 4P9GA 2JG9C 1YI9A 4XYXA 3R0RA 2VNRA 4MUVA 1G9BA 1OFSA 1SLLA 4JDMA 2Q8OA 2AYHA 2RR13 5F6KA 3D0SA 3RZZA 2ZAHA 4Z07A 1PGW2 1N1YA 4L2NA 3FFZA 4Q4Y1 1WMEA 1ZRFA 1QJY2 5GLWA 5JZGB 3I59A 2ZGKA 4FXKB 4M3CE 2RR11 1VBE3 2ET1A 2DYCA 4GH4A 3JCIA 2GN7A 1DF0A 2VMIA 3U0ZA 2Z42A 1ZNPA 3RJ2X 1WCKA 4XXPA 1R1A3 3E5QA 1BBT2 1DYPA 2EXIA 2LUWA 2R49A 2R16A 1CAUB 4DNYA 3DKWA 4IETA 1E57A 4E9KA 1LOGA 5CFDB 4NR1A 4N43B 4AI2A 3GHMA 1VBE1 1UU4A 1VAMA 3L2YA 2ETEA 3IDBB 2D6NA 3ZSEA 1R1A1 1CAXB 2D3RA 1J1LA 3LAGA 4XJ8A 1FV2A 4MXVA 1Q8OA 3AMHA 3RMXA 2SBAA 4P14A 4ASLA 5L19A 3E6CC 3ZN6A 4LBQD 1GBGA 1VALA 2YDEA 5FMOS 1ND2A 1V6IA 1CX4A 2IXCA 3FHIB 4V1PA 1AR82 3H7YA 5GJ6A 2E53A 1H4GA 3KM5A 2NQYA 3P3NA 2WFF3 3ETQA 5CFCC 1PVC2 2XUMA 4PLNA 3MIHA 1LKNA 2GC0A 2HWB3 5BNPA 2VNGA 4ONUA 1K5MC 5F1RA 1M06G 5DDJ2 4YZ2A 3MZHA 1YLLA 3WLUA 4IQPA 1RUD2 2X5IA 3GZUC 1ZA4A 2WFF1 4AI3A 1ULGA 3VBSA 1GV9A 1LU2A 5DG1A 3VN4A 2HWB1 4HVQA 2WZR3 2A71A 5H9QA 1RUH3 4WM7C 3HBZA 1PGSA 5CNAA 4Q0UA 2FHRA 1NE4A 3ECQA 1EYBA 4DOUA 1G8WA 2XKOA 5GLTA 3VL9A 3R4SA 1N1VA 5T3NA 4CEYC 1DZRA 4BA6A 4GKYA 4B4QA 2WZR1 2RS13 1RUH1 4LUKA 3OBRA 1NCRB 1KDKA 5KHHA 2UWBA 3B9IA 4AEDB 1X8MA 2R042 4GALA 3B5LB 4OFGA 3LKJA 5EFUA 1MS3A 3WOGA 1BEV2 3ZX7A 2TBVA 4AYUA 3MW3A 2OZJA 3NAPC 2HWE3 1C8M2 2W0XA 5FPXA 2RS11 4Z1VA 2ZJCA 1JUHA 1XYOA 2VGDA 3M70A 5CADA 3UK9A 3IMNA 5C9AB 2EAKA 2E7TA 3TWIA 1OKQA 1PZ7A 1ZYBA 1V6KA 2Q5TA 3KGLA 5A3MA 3FJSA 4OVEA 5CAZA 3VHOA 4HPKB 3D0JA 4I0AA 1SQ4A 2DVAA 2DFBA 2HWE1 5C33A 4AE2A 2P2KA 2RJKA 1SACA 4NHKA 4Y1XA 2JG9B 4LLOA 4FBFA 1ENSA 1ZBE3 4QGLA 4JDOA 1GNHA 4UW4A 1CVNA 2K9ZA 4XBNA 4GWNA 4LBNA 4RHV2 2BYVE 4F3JA 4AGVA 5FO7B 1EPZA 4HK8A 2YUEA 4YVWC 4MGIE 4K40A 1A3KA 2HWD3 5I0UA 1JUIA 3VZLA 3WY6A 1GZCA 2P17A 3TNQA 1ZBE1 4OUMA 3AKPA 2TEPA 2QCSB 1RUI3 3KCYA 1IHMA 3H9AA 3ZXEA 2CAVA 2F6BA 4N7IA 4RD7A 1AX2A 1O3RA 3VUOA 4FSJA 4JTOA 3AFKA 5CFDA 1RINA 1QGLA 2HWD1 4N43A 5E16A 1EV12 1IS5A 1OI6A 4K20A 3CU7A 3WHUA 1LR5A 4W6XA 4XFAA 2D6OX 1RUI1 1W6OB 3DL3A 2Q1ZB 3PJQA 3FX3A 1CAXA 1AYN3 1V6LA 2WS92 4E27A 5FO9B 4YW4A 3FBMA 3WNXA 2WNUC 4B4RA 4BCUA 1V70A 5FREA 1Z7S2 4HSJA 2ZZQA 4YSFA 2Q1MA 4KL1A 3TYJA 1LODA 1AYN1 5HCBA 3ZXDA 2ZGUA 4YARA 3OD0A 1XU1A 2VVDA 1YCIA 1MR5A 2DVBA 2X53S 3BOPA 2Y0OA 1DBNA 4HETA 5CFCB 4Q0QA 4IEXA 1LOFC 1SBFA 2K2SA 4YLZA 4HVRA 1K5MB 3H8UA 1V6NA 4AFAA 1RHI3 2DUQA 3D5OA 1FV3A 4GULA 4IERA 3G7DA 1U5IA 2R1DA 3DN7A 1AR62 1N3QA 1FATA 1HXS2 1CONA 3WCSA 5JOWA 3JD72 2AR6A 3POWA 1REDA 1DQ0A 4RGAA 3ZDSA 4F7ZA 1BJQA 1O7FA 1C1LA 3BTAA 3H3ZA 1RHI1 2DUOA 4WM7B 4YM1A 3QH6A 4HK9A 4AHWA 5JSRA 2GSYA 4AHXA 3AYEA 1V6JA 5CG9A 5EV7A 4CEYB 1Q8QA 1UF2C 1ZZ9A 4QHBA 1SFYA 1SLTA 2MEV3 3SH5A 4OHXA 1GKBA 4S2GA 2ZGOA 1U5YA 5SV8A 2CV6A 2DUPA 3CLPA 1WLDA 1Q8SA 2RE9A 4IEYA 2B45X 3MLJA 1FXZA 3MPBA 1S0DA 3WG3A 5LK5A 4K6BA 4FOVA 3NAPB 5C9AA 3IDEA 1KS5A 3ZMOA 1V9U2 2MEV1 4I3PA 2ARXA 4LEJA 3CJIC 1RUJ2 3FLRA 4HPKA 1VAKA 4EN6B 1PNGA 5C8CC 2JG9A 4EJRA 1FOD2 1D4M2 3PLQA 5KXCA 1AR72 1F31A 4LHLA 2ZPXA 3WG4A 1SLAA 1VRH3 3CF6E 4Q0PA 4XJZA 1DG6A 3PVOA 3LGRA 3S0MA 5BNQA 2WWSA 1WBFA 4DFSA 2ZHLA 1SBDA 4BMEA 1AL23 1LHNA 4KWJA 4P9LA 4YVWB 1MS0A 3MFAA 3AP4A 3ZXGA 5LEKA 1XNBA 1VRH1 1POV3 3AB0A 2XJUA 4M01A 3ZN5A 3POYA 4IL7A 1OMIA 1BKZA 2R1BA 3ACLA 2O1QA 4UBHA 5IK7A 3L9JT 3AKSA 5GZFA 4UBGA 3WQ7A 1BCXA 2ZMKA 1AL21 4CDQC 3ZO0B 1FNZA 3WDWA 3R4UA 2JENA 1POV1 1EAH3 1BMV2 3FLPA 1C5HA 4ZU7A 2R30A 2DVGA 2BFUL 1V00A 1MACA 5JAXA 4Q4X3 4GXLA 5FLJA 3H1YA 3LWCA 1EY2A 3OBTA 4PDWC 5AC93 1JHNA 3ST7A 2Z2SB 1SDWA 2GH8A 3ZFFC 2CYFA 1EAH1 2Q30A 2AGSA 4LA3A 2DV9A 2JXAA 4UW5A 3UJQA 4AW7A 2CY6A 2XJTA 2ZHMA 2ILMA 2HWF1 4JVAA 1URXA 3NV1A 1YFXA 4Q4X1 3DV8A 2UY9A 5CFCA 3H1MA 4J1WA 4XBQA 2BNMA 1NG0A 1LHWA 4I01A 1S0JA 2ZHKA 4C90A 3AMQA 1K5MA 1ZZBA 2V5YA 3TN92 4H14A 3SCGA 1I5ZA 4O9EA 1O4ZA 1PZ9A 1LU1A 1VIWB 1FPN3 1H30A 1NQJA 1WCSA 2BBVA 3WW4A 3FUOA 1CPMA 5I0TA 4FPJA 2GNDA 2R32A 3FFQA 1OHFA 3RWNA 5I0RA<