1O91A

Crystal structure of a collagen viii nc1 domain trimer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
131
structure length
131
Chain Sequence
EMPAFTAELTVPFPPVGAPVKFDKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPMMYTYDEYKKGFLDQASGSAVLLLRPGDQVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords COLLAGEN ALPHA 1(VIII) CHAIN
publication title Crystal Structure of the Collagen Alpha1(Viii) Nc1 Trimer.
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o91A00
2Q8OA 4QPYA 4KGGA 1A8MA 1GR3A 5CIRA 3ME2A 4MSVA 1U5ZA 1PK6C 3LKJA 2AZ5A 1D2QA 2R6QA 2JG8A 2JG8B 1OQDA 4HT1T 1C3HA 5HBAA 2RJKA 2O0OA 2JG8C 1ALYA 2R32A 2Z5WA 1PK6A 4GIQA 1PK6B 1TNFA 1D4VB 5L36A 2HEVF 2R30A 1C28A 4QQ2A 2KA3A 3L9JT 4E4DX 5KC6A 4DOUA 4F3JA 1OQEA 4MXVA 5TSWA 3V56A 4N90A 1TNRA 5BNQA 1O91A 2TUNA 1RJ8A 2ZJCA 2ZPXA 1JH5A 5KC5A 1DG6A 2Q1MA 3ALQA 3WD5A 2QE3A 4J6GA 3TYJA 4QQLA 1XU1A 2RJLA 3URFA 5KWRA 2OIIA 1KXGA 3K51A 2JG9C 2X29A 3IT8A 2WNUA 3FC0A 2HEWF 2TNFA 2WNUB 1I9RA 4OULA 4G4FA 1U5XA 1WCKA 1DU3D 3B93A 1IQAA 3QBQA 2WNUC 4MXWA 3TWIA 3B9IA 5L19A 4MXWB 1D0GA 4QQHA 2E7AA 3B94A 2JG9A 2WNVA 3AB0A 4NN0A 2JG9B 2WNVB 4RSUA 2QDNA 4QQOA 4KGQA 1OSGA 2RE9A 4DB5A 4KG8A 1XU2A 4E4SA 4D7YA 4EN0A 4OUSA 2WNVC 1KD7A 1JTZX 4G3YC 3QD6A 2HEYF 1RJ7A 4QQPA 4TSVA 1U5YA 3MI8A 3K48A 1S55A 4OUMA 4TWTA
chains in the Genus database with same CATH superfamily
1X8MA 1JOJA 2WO1A 1YQ6A 4K21A 1W8HA 1K12A 4YGEA 1NXD1 1KS4A 3WP5A 4CDQB 1GP4A 4LBQB 1OD5A 1NXMA 2BU9A 4H14A 5A7NA 5HCAA 1SLLA 1IPKA 3BU0A 1XYNA 1LCLA 2VQAA 4AEDA 1OA2A 2FHRA 4AF9A 1TME1 4MGKE 2HWC3 4WV8A 1D0HA 1NYWA 2GH2A 1H8VA 2F4LA 4N43B 4AEDC 3MIBA 1KFUL 2NZ9A 1C8M1 1W03A 1DQ4A 2CNAA 4UFJA 3UJOA 1OOPB 4I01A 1RUC2 2HWE3 5FPVA 4AOCA 1AL21 2W08A 1CX4A 4CEWA 5FOBB 4QB6A 2Z79A 4WBBA 2LALA 1CQ9A 2A3XA 1D4M1 4AW7A 3AK0A 3N7LA 3AJYA 4SLIA 5IATA 2QQPA 1Q8OA 1MACA 1O5LA 1Q3EA 1VBC1 2FBEA 5CNAA 2I74A 1BK1A 1R1A3 4P9LA 3RI8A 1HB1A 4Q4Y2 1NY71 4QHOA 1ASJ2 3I3QA 3K4DA 4FPEA 1EPWA 3VBUA 4HFSA 3BI3A 5EZWA 3ZYRA 4YGDA 4M0NA 4Z92B 1PO21 2VMIA 1YFUA 5LA2A 3USUB 4IEWA 1W6OA 2D98A 2ZMKA 3SNMA 1AR92 2IFRA 3VBUC 3H1WA 3T3YA 3TNPB 1RUI2 3ZDVA 4KQ7A 4QM8A 2ZAHA 3SITA 3J9SA 3BIWE 3T4HB 1WA4A 5FMOL 4FSJA 4W6YA 1WMFA 2HWB2 3RYPA 2D6PA 5KXEA 1VBA3 5I8YA 1JI6A 4J25A 4QGMA 4H7LA 1QEXA 3V0AA 5DZGA 1CJDA 2D3RA 3BGAA 5FQ0B 3ZFFB 3WDYA 5F9TA 1XPWA 4YVWA 3KQ4B 2VOXA 4UW6A 4D94A 4OI4A 1ZBE2 1DU3D 3HNMA 4LBQD 3RYKA 1WLDA 1H4GA 4CP9A 3AL6A 5FWEA 2LROA 2ZCWA 4FPJA 5L19A 4NHXA 4YVWC 2YBKA 1B35B 2E51A 3RPQA 1Q56A 1RINA 3E6CC 2VCAA 2ZMNA 1YFXA 3LOIA 4WM7A 4FTEA 2W47A 1PO12 2AUYA 2DURA 4LKEA 3LQCA 2JDZA 4L97A 4TYSA 4Z07A 1GP6A 1XU2A 2HJIA 3RYRA 5LEKA 2QFEA 4DXZA 4GMP0 3S30A 3OUJA 4YZ5A 1IGOA 4WM7C 1ZRDA 2C0ZA 3BKZA 3W59A 2X10A 1RUC1 3MICA 2ATFA 3HOBA 3T2TA 4WM8C 5F3CA 4XAEA 1LENA 4A2UA 2JJ6A 5HPOA 1WD4A 2ZXQA 4R9CA 5LY2A 3I3BA 3MPPG 1LHWA 3G6JB 5I0RA 3DV8A 4M3CA 2QVSB 5FY5A 5I0DA 1JYWA 3ZYGA 1IS3A 2BFUL 3THPA 3POIA 1XE0A 2RR13 2F6BA 4Q4Y1 5EIYB 5FLJA 4CYDA 2RM22 1CIWA 2HKXA 1JZ8A 2ZHMA 3MLKA 4LBNA 1PK6C 4MZUA 3KV9A 4SBVA 1W04A 5ABJA 1JZ2A 3T2OA 3OEBA 3KV5A 4GJYA 2CTVA 4YFWA 3PU8A 2MHFA 1PZ9A 1CAVB 1A8DA 1AR91 1WCSA 3J7HA 1STMA 2PLV1 1T2XA 3H3UA 1Y9QA 4IE7A 5EFUA 1RUI1 4AFBA 2C24A 5ABJC 1XNDA 3O1RA 4D3WA 1OT5A 2J1SA 3N7MA 4RGGA 4COUA 5C3PA 5FP8A 2A75A 1HKDA 3VL8A 2HWB1 2AEZA 3GZAA 3J7NA 5L9VA 1XQNA 2V72A 3Q8EA 2QTWB 1GZTA 2UWCA 5I93A 1DYOA 4EN9B 4MO3M 4CDXB 3IZOA 3OGSA 2WNOA 2R062 3OD0A 1IS4A 3VDDA 5C9AB 3ZN5A 3NAPB 4MG2A 3N9OA 4ARYA 4F3JA 2JE7A 4PIXA 4DZGA 2WL1A 1PGL1 2LS6A 5DN2A 4MGQA 1AVBA 3T1LA 3NRUA 4IL7A 4B4QA 5BNQA 1UIJA 2XQXA 2VL4A 3VDDC 4AYUA 2ZPXA 4BXSV 4HK8A 3FBMA 3CJXA 4UOJA 1PO11 3G7DA 2XMLA 3OBZA 5FYCA 5LEJA 1K5MA 1F5JA 2DUQA 4AQTA 1J3QA 1AX1A 4AFCA 3ALQA 3MYXA 4FVVA 5A1LA 3JZVA 1RUE3 2E32A 2DCTA 1H1IA 3MO4A 1K5MC 2HWD3 4NAMA 4Q8LA 4XUPA 5ANQA 5FBJA 2O14A 4M3CF 1DF0A 3MF9A 4AI8A 2FD8A 2G1MA 1G9DA 3H8OA 4S2DA 4C0BA 1MVQA 2E9QA 2KXLA 4CPBD 2Y0IA 2RG4A 3VGIA 3AZVA 5A7OA 5IK8A 5ACA3 5KXDA 4R4XA 2J1RA 3VZJA 2AEYA 3U11A 2RM21 1NOVA 3DGTA 4GKYA 5FTTC 2JECA 5FZMA 5LRRA 3I2DA 1UU5A 2NP0A 4MADA 4QXHA 2ZGLA 1FAYA 2WNVA 4CP0A 1IZ3A 4NN0A 2VNGA 5FZOA 3AJZA 3RJ2X 4GALA 3INAA 5KHJA 2DCYA 3WP6A 2OA2A 3NJXA 1AJKA 3UKVA 4D7YA 2BEOA 1X8EA 3ZXLA 2P6HA 2WNVC 4XFGA 3WNMA 3HMYA 2ARAA 1AZDA 1J84A 3NNLA 4DMIA 2Y6LA 1Z78A 1O8PA 3AZWA 3QD6A 1AR63 4G3YC 4QPIA 5GLWA 4EZ4A 4XF1A 5C3QA 4QQPA 1RUF3 1Y7BA 5C6CA 5KHKA 3RZMA 3MI8A 1SZBA 4QGLA 1OI6A 1GMMA 3E6DA 4B1MA 4QHZA 4YZ2A 4QPIC 3DYOA 3AFGA 1HRV3 2R061 5IJRA 3O1MA 4JDOA 5J36A 2QQMA 2J1UA 3WNKA 3HQUA 3VB9A 4AGVA 1JN2P 1OA3A 4BH9A 2WNEA 3RVHA 2EVXA 1W0NA 3D5OA 5IAVA 5FV3A 1Y9GA 4R9BA 1SLCA 4QM9A 2GN7A 2PHXA 4PHZA 3ZYPA 4YW7A 5LA0A 4CTEA 1VB2A 3ECQA 2VUJA 5C3SA 1VR3A 5JPMB 1BQPA 2VMDA 1YIPA 5FYYA 5DMYA 4WVZA 1MEC2 4AVTA 4YARA 3I2OA 1NZIA 5LA1A 4Y22B 3ZSKA 4IEZA 4COZA 2YU2A 5FYHA 1UL9A 1G7YA 3VBHB 3LWCA 1X33A 3AMNA 1KGYA 4FBFA 2JIJA 3FFZA 5D21A 5JSPA 1CIYA 4AI0A 3O1SA 5FY8A 3RDIA 2Q1ZB 4ZU4A 3RFRA 3DXTA 3T08A 5FZ8A 3TBDA 4MXVA 2ZX3A 4BISA 3ES4A 4GWNA 2HWC2 2Y38A 1UAIA 5FP4A 3WQBA 1TNRA 5LBCA 2WRAA 4NMIA 3VBSB 4GD4A 3I3DA 1HXS3 3OG2A 1SQ4A 3EQEA 2TUNA 5LBFA 2BDRA 3C7GA 3ZSMA 3OBAA 1L7RA 5T5LA 1BBT2 3B9CA 2HWE2 2WSUA 1SG3A 1JODA 2IVJA 4B1LA 3MLLA 4CA9A 2CDOA 1YHFA 3ZR6A 2K9ZA 5G04L 2PAEA 3THCA 3RZGA 3IT8A 3N3HA 1ZZ8A 2WNUB 1R1A2 3B5LB 1S0CA 5FMOS 1DYKA 3B93A 1NX9A 3ZXEA 3TWIA 3WG4A 2GNBA 1ZM1A 3NJVA 4IEVA 4BK5A 4BB3A 4H2AA 5FY1A 4QU1A 3SQOA 4CEYA 3ZFEC 3UL2A 3AM2A 3MW2A 2QZ3A 3AX4A 1GOFA 1YEWA 1WD3A 4CCLA 1S2KA 4IV1C 4Q5OA 1VBE3 3N9NA 3Q8AA 2QDRA 2XHKA 4CEYC 1ND3B 1WA6X 1VBA2 3WV6A 2Q30A 2VR4A 4MOAA 3KCYA 4NR1A 5EYYA 4BQWA 1Z0HA 2R072 3ASIA 4PF1A 1MEC1 2PELA 4FOYA 2VE1A 2VBBA 3OYWA 1MZ5A 3GCWA 4FPOB 4LHKA 4CCJA 3JD73 1H2NA 3JB4C 4QKNA 2PN5A 2OZ6A 1SLIA 3U75A 1VBB3 3PUHA 4E9KA 3TB0A 2J1EA 1MQTA 3UYJA 4ZKTB 4TN7A 3N7KA 4HVOA 5DUXA 1H4HA 2RDSA 4OLLA 4QXBA 5FUPA 2WZR2 2RS33 1RUD3 2BP6A 1UY0A 3OOXA 3WY6A 4BK4A 1E57A 2AREA 3CU7A 2QQUA 1JU3A 1MQTC 2BV4A 1XBFA 4K40A 4AQSA 2HWC1 2ZGTA 4I0AA 5JMOA 4E8CA 5A3LA 2JG8A 2QNKA 4HXCA 1H8TB 4PDWA 1CAUB 1OQDA 2GP5A 3HQXA 1QXPA 3FLRA 2A6VA 3AP5A 4FXGB 2ZABA 3VHOA 2EAAA 4GZ9A 1OFSA 2LM3A 2YU1A 4XJ9A 1E5IA 2Y8KA 1UMZA 4D7TA 3NNGA 5BV6A 1BBT1 2JG8C 4PDWC 2VY0A 1C5HA 2HWE1 2AGSA 5BNOC 3ZKYA 1L3JA 4NUBA 3IDCB 2XWJB 2YROA 4I30A 3PUIA 1V0AA 4U2AA 1H9WA 2DVGA 1VAVA 1AYN3 5LBEA 1YQCA 1R1A1 1UZ0A 4CP2A 1ZREA 1NLQA 2ARXA 4XQ4A 2DYCA 1ASJ3 5IUQA 1HB2A 4Z1VA 5FDBA 3MIHA 4OI0A 4QQ2A 5K0UA 3L9JT 3K3OA 1YI9A 2IVIB 3GZTB 2Y0OA 5KC6A 4CUBA 1ZRFA 4XJZA 1R083 4FPGA 3NJZA 4CCKA 1AR93 1GV9A 4CU7A 5B2GB 4GWIA 4UXAA 5K0UC 3WQ1A 1QF3A 2VTFA 1AUYA 2YFUA 4Q8KA 4COYA 5JXJA 4JX0A 4ITCA 1EUTA 2DCZA 4HPKB 1RJ8A 1ZBA3 4MGSA 4NRPA 5EXOA 3UV9A 3F95A 1VIWB 2WBKA 2VCBA 3GYDA 5FMBA 5C8CB 3BTAA 3MUZ1 4XFCA 4MX3A 3W21A 1VBA1 1EPZA 1OD3A 1MS5A 4NHKA 3ZXJA 4J6GA 3RG0A 3WCSA 3O0WA 3F2ZA 2NMOA 3BALA 2D7FA 5KHIA 2JG9C 1VRH3 1UZZA 2TNFA 2GAUA 4KI5M 1QJEA 1CJPA 1ZBE3 2E7QA 1X36A 1OUXA 3IAPA 5JIAA 3LSDA 4CZSA 4ZS2A 2D6NA 1R64A 2WZR1 5FPLA 5FXWA 3B02A 3WT3A 1BVP1 1W28A 1EY2A 1O4ZA 1NCRA 3ELNA 4N53B 2WN3A 2LTNA 2A73B 5AC93 1SFYA 5GLZA 2ADEA 2XONA 3ZSJA 4JVAA 1CPMA 2V09A 3UKTA 3IN9A 2WFPA 4H3WA 1OSGA 4DB5A 1AF9A 3A4UA 3NMBA 3OUIA 4OCTA 4D69A 4IE4A 4XTMA 2K46A 4A7ZA 3VD9A 1MS4A 5KBFA 2HWD2 1XC6A 2QUOA 2Y64A 3NV3A 1XNBA 4MVTA 4QB2A 5GZCA 5GZGA 2JDMA 4JDMA 3WF3A 4QHBA 2BBVA 3GNEA 4E2SA 1CAWB 2A70A 5D8AA 1S55A 3OGGA 4N43C 2RR11 3DPRB 3LAGA 1GWKA 1C4RA 4IQPA 4QX2A 4AQ6A 1DDLA 4Y5SA 3WDTA 1A8MA 1OOPC 2EIEA 5D8AC 5JPNB 2JE9A 1OC1A 1Q43A 4IESA 2D6LX 3Q9OA 4QB1A 3ZIXA 4BXFA 2ZX1A 1W3VA 3WNNA 4JC1A 2PQQA 1JZ3A 4RQPB 2XJQA 4W8JA 2P34A 1UW8A 4COWA 3BTZA 1G9CA 5CFCA 1MZ6A 4XCBA 4OZOA 4EWEA 4GXLA 2OX0A 5K7PA 4IEPA 4YW1A 3NO8A 2Y60A 4HVRA 5H9SA 1J3PA 1GQGA 1RUF2 2ZACA 5LBBA 1UU4A 2PHRA 1X50A 2VW2A 5DZEA 1DYPA 1CPNA 5CFCC 5IYYA 4LBKA 4JKKA 4O7XA 3U1XA 3N7JA 4AGGA 5GLTA 2VTXA 2R063 2NN8A 4XBQA 2A3WA 1WMDA 3I2GA 2MNGA 1UY1A 2W0XA 3AP9A 3KGLA 4N9IA 4Y1UA 5FRAA 1BXHA 4M0HA 4W65A 5J3UA 2KA3A 3V64A 5F5IA 4YG3A 1TG7A 3RGBA 3WF2A 1Y9MA 1W05A 3RRDA 2A71A 3E5UA 4O65A 2GNMA 2ZX2A 3OY8A 1LGNA 4EYUA 4YZ1A 4QT6A 5A7QA 2HWF3 3S6PA 4PJYA 1OH3A 2GN3A 4WZFA 4Q29A 5A3NA 1H0BA 3H9AA 3HQRA 1M4WA 1N3OA 3P3PA 2GMMA 2JB4A 5IVJA 2IXHA 1F4AA 5FIXA 1UYXA 2B9VA 2WQ8A 5GKAC 3JQXA 2CWSA 1G9AA 2FDHA 5BY5A 4ZHNA 1RXGA 4BHPA 3AVSA 3W58A 1O7FA 3ZO0B 1OPOA 2ZKLA 3I59A 2HWD1 2Q8EA 1N1SA 4I0WB 1XXNA 3ETQA 4NPRA 4JHZA 1NA1A 4GB33 3WHTA 2RHPA 4YZ3A 2JICA 4OQ9A 1AYM3 4C8DA 3VD3A 1POV1 2A6YA 2OT7A 5FPZA 5C4WB 1PMHX 1PGW2 4XJ8A 2VMEA 1W2NA 1ODMA 3O0XA 5ACA1 4TTGA 1EYBA 4KG0A 4MYEA 2Q4SA 2Q5TA 5F3EA 3H8XA 3M3IA 4ARXA 5AFEA 3K77A 4DUVA 1SBEA 2VUAA 1XB9A 3GDBA 1HXS2 4UT5A 3P1IA 1N1YA 1UWWA 2VJXA 3O5SA 1BHGA 3K75B 5HCFA 1J59A 4IGQA 4Z2AA 5FJHA 3PDQA 2YDEA 1G86A 4Y1VA 4XQDA 5J48A 4D6QA 1SHWB 4XUNA 1HB3A 1W0PA 2PHFA 2UY9A 4GH4A 2VZOA 3DECA 4N7UA 1AR61 4R9DA 3R4DB 4Q4W3 1T6GC 5EJZB 5FY9A 4E8DA 4BOWA 3KVBA 1RUF1 5BNPA 1LKNA 3H8UA 4QAWA 1YXWA 2JB8A 4ES9A 1QJU3 1RYYA 2C9KA 2DVBA 2CSGA 2WAAA 4MUVA 1BEV3 2YYOA 1Z7S2 1QDOA 2A6ZA 4XJUA 4CU8A 3KCXA 2HYKA 4YVSA 5EPAA 2Y6FA 1W6PA 4A7YA 2W52A 1GOGA 2W9XA 4DUXA 1X9TA 4IEOA 4K1YA 1P8JA 4Q0UA 3TEYA 1W6MA 1CONA 4QX1A 3V0BB 4UBGA 1GR3A 4R9AA 1H2LA 5D2AA 4YVSC 2AENA 3ME2A 3WDXA 2X5IB 4HKOA 4JGYB 2R1BA 4C1WA 2WS93 2VVEA 2EXJA 3E97A 2VMFA 3K3NA 5I0SA 1S0IA 3Q8CA 3W9AA 4EN7B 1GU3A 5IW0A 4ZXEA 4CRQA 1VBE2 1O6UA 4JGZA 1V6MA 1WGPA 1W6NB 3EB7A 2EXIA 3SXWA 5JUVA 3WNXA 5LCWL 1F4HA 5A3UA 3GGLA 2ZHLA 4PT6A 2CHHA 4JGZC 1YYNA 4NVPA 4P9YA 3AC0A 2DF7A 1F2NA 3JD72 4LK7A 5A7WB 2XLAA 2PAMA 3AFKA 1TNFA 4DPNA 1DLCA 3AP7A 5FZCA 1WW6A 2R043 3W5MA 5ISLA 1OHFA 1ZZ9A 5J37A 2VZTA 2QQJA 3D8CA 1JYIA 4JCKA 4DNYA 4IE6A 4BZ4A 1V6OA 4PBOA 1GICA 1GBGA 2XXZA 3FZ3A 1HDKA 1C28A 1RUD2 2RS32 1PGW1 4UBHA 4XUOA 5CADA 1ENRA 3PMSA 2Z42A 2J1TA 4XJWA 1BVVA 1DCSA 5DAWA 1XE8A 2WABA 5DAPA 1SMVA 2XJSA 3LDKA 4DOUA 2YBPA 1LOEA 3U37A 3JB8A 3VBOB 3VD5A 1N1VA 4LORA 1V9U3 1J83A 4GMP3 1AXZA 1AR83 1LU1A 2ZKNA 4N90A 3IDAA 1HXS1 3R4SA 5CKMA 4ZPIA 5FUIA 3EHKA 4Y5TA 1OURA 1IPSA 4MGYE 2ZJCA 5FZGA 3VZLA 5EQUA 1W2OA 2DTYA 1BBT3 4WVWA 1SPPB 4DY5A 4LHLA 5CVRA 5CBLA 1CD3G 2XWBB 1H1MA 2DV9A 4IEXA 4EJRA 4B8EA 5FOJB 3U0ZA 1YO8A 2VZQA 4XF4A 4FQZA 3A0KA 2QE3A 2VZRA 1K45A 5FBZA 1NKGA 1AYN2 3WP4A 1RXFA 5CZKA 1QH7A 2XB6C 5DAQA 1S0FA 4OULA 3LDRA 3WX5A 1Q8QA 4CCOA 2VD7A 2W1SA 2PHUA 2WQ4A 2CU5A 3H3ZA 2ZEZA 3OF1A 1R082 2AACA 4C90A 2MPFA 3ZYIB 2KD7A 4ZZ5A 3PUSA 1W6QA 4OI2A 4P9XA 1E5HA 2EXKA 5JMCA 2YC0A 1FYUA 1ZBA2 5FYVA 1YCIA 1VBE1 1W9WA 3ZYJB 4RSUA 4K3UA 2TEPA 1MS3A 1VPHA 1DQ5A 1SLTA 2G9GA 2CV6A 4EN0A 4XW3A 2B39A 2VXJA 1SLAA 2R073 1I5ZA 1JXNA 1YI7A 1Y4WA 4OHXA 1LESA 2VMHA 2BERA 2D43A 3DKQA 1VRH2 4K8FA 3T0BA 1D2SA 1LEDA 3JD71 3NSTA 5L7OB 5FUNA 1SCSA 1VBB1 2ZEYA 2NLRA 1VRBA 4PQQA 3T2PA 1RUOA 5AVPA 3POEA 3GCXA 3PJQA 4UFHA 4A41A 1JHNA 1FNZA 4META 2YB7A 2VOTA 2WZR3 4LO4B 1HJGA 2RS31 1RUD1 3NQHA 3FLPA 4I0BA 4QPYA 3UJQA 1OLMA 4L11A 1DGRN 2D6OX 2EIGA 2ORZA 5CIRA 3KD4A 3QH7A 4BCUA 5AC92 4AI3A 2Z4FA 4WM8A 3WUDA 4LMFA 3M3CA 4DINB 1PM7A 2ZZQA 1W2TA 1WUVA 5FXZA 3CIHA 3AKRA 3L2YA 4E2QA 4UFKA 2B8MA 5JWPA 3T2QA 2PHLA 3UGGA 2K0GA 1O4TA 5A6ZA 4EN6B 4DXTA 1FOD2 3U78A 5BNNA 2OQ6A 3PMEA 5A33B 1PK6A 4GAZA 1IOAA 5K8SA 5FXVA 4WZCA 3WW2A 3RI9A 5CU1A 3KZ4C 1AYN1 2VZSA 4Y1XA 5G05L 3J7LA 1LEMA 3S57A 3MFCA 4EQVA 1ASJ1 2WN2A 2BPA2 2ZOEB 2NM1A 1UD1A 2HEVF 5BNNC 1ZRCA 3ABZA 1R093 3I2IA 4LOSA 4Z2WA 2XR4A 1ONAA 1QQP2 1R081 5CAZA 5JDBA 3MZHA 2W1WA 4EZHA 5FKBA 5DAXA 2YPJA 4CSWA 1KDMA 4QX3A 5FZEA 1F5FA 1IKQA 4NHYA 3CJIB 1WBFA 3ZFGA 1ZZCA 1QNYA 1ZBA1 1W06A 1O8SA 5IVEA 1EAH2 4XUQA 3IB3A 5FAXA 5LASA 1JH5A 4A6OA 1APNA 2D5FA 5DG1A 5KC5A 3JCIA 2XUMA 4QMAA 3VZMA 3QCWA 5CKNA 1DG6A 4XETA 4FPYA 3NW4A 3ZFGC 1AX0A 1RTVA 2G4IA 3ATGA 3ZM8A 1ULOA 5GJ6A 3U07A 4XBLA 3TEWA 4HLTA 4CDWB 2A6XA 1OKOA 1QMJA 2O8OA 4Q1PA 4KWJA 3UK9A 1VRH1 3ZN6B 5BNOB 1JZ4A 4FTBA 3GBGA 4IV3B 2VMCA 3QH6A 4RA0A 4Z82A 3GBWA 1ZBE1 4PIZA 3UT0A 1I9RA 1U5XA 1QXJA 2UY8A 1SBDA 3U4SA 3KT4A 1OPMA 3FX3A 5IWFA 4OHZA 4HBNA 2CGNA 2C6SA 4V2VA 2HWF2 2J1AA 1L7LA 3N35A 1HW5A 2ETEA 2D93A 4CP1A 4P9GA 4UW5A 1RUH2 5AC91 5J96B 3VKLA 3ROUA 1R1ZA 4YWAA 3THTA 3BVCA 1LAJA 2CAUA 1VAKA 2UYAA 1COV3 2QDNA 4J1WA 4QGNA 5LATA 3ACIA 2Q8CA 3TN93 2YC2A 4I3GA 3UKNA 2RE9A 2VTXJ 2ORXA 4TXWA 4JDNA 4RFRB 3N9QA 4QX0A 5DDJ2 3SKVA 2ZEXA 4XF9A 3D82A 4ONUA 4GB32 3E5QA 1ND2A 3CO2A 1AYM2 1POV3 1YJKA 3CEWA 2ZA9A 5FY7A 1ZA7A 5E8AA 2QQNA 1AJOA 4XDQA 4OQ8A 4DXSA 4YSFA 4TWTA 1MZEA 5LK7B 1UXXX 3EYPA 2PFWA 4XVHA 1ND2C 3BTYA 4KGGA 1WZXA 3OPTA 3WUCA 4FPCA 1HQNA 3WW1A 1HX6A 2IXJA 2VUCA 3POYA 4LLOA 5GALA 3VD7A 3M4FA 1U5ZA 2WAOA 1OBNA 4JTOA 4OUEA 3WQ0A 4GWJA 1OXCA 1QHDA 4Y20A 4AEDB 5IVFA 3R05A 5LB6A 1BYHA 3ITQA 5IAXA 3P5BA 1AL0G 2XBO2 2DU1A 1EAH1 3KT7A 5F6KA 2PHWA 3FWEA 5FO9B 1MS0A 4Q4W2 5FZLA 5EJ3A 1UPIA 2JKXA 5FZ9A 2DBIA 4ISQA 4Y4YA 1RIRA 3R0RA 3TRSB 2Z5WA 1QJU2 1KITA 1H30A 2LW8A 1BEV2 1QNWA 1MS1A 1QJZA 1TEIA 2ZGRA 2BNMA 2RV9A 3DN7A 3DL3A 4CEWB 5JI7A 4PIYA 4ET7A 2A7AA 2AYHA 2VO5A 3AZZA 3GM8A 1CAXA 3ACFA 4AE2A 4LKFA 1NCQA 1QWRA 1DQ1A 2D44A 2ERFA 2P3YA 2WS92 4BQ1A 2XLGA 4E4DX 4XHBA 4E4ZA 3AKTA 3VBUB 2HWF1 5FKCA 3Q8FA 2XLFA 4M00A 5A6XA 3WQ7A 2E31A 1W8OA 1RUH1 4BA6A 1NCQC 5I8TA 1W6OB 1HJFA 5GLVA 1GZ9A 1CZTA 1LRHA 2YBSA 1UIKA 2WYFA 3AMQA 2BGCA 2BOJA 1SCRA 4XTPA 2FDKA 4PCRA 3VKNA 5BYNA 4AGRA 5A32A 3O1OA 2RJ2A 1QOSA 4DO0A 1K5JA 3MDPA 3PLQA 5JIUA 4N53C 5DDJ1 1VAMA 2R042 1PX3A 1XU1A 4GB31 4YM3A 3VDBA 5KWRA 2JWPA 3K51A 4O9EA 1AYM1 2WFF3 3C3VA 3V0AB 2O8QA 1EV12 3B01A 4A3ZA 4Q4X2 2D6MA 4AAXA 1LOCA 5GZDA 1MS8A 1MVEA 4YVWB 4LQRA 2YC4A 1XNTA 4PI0A 3OPWA 3WHUA 3K46A 4L0PA 4NPLA 3CMGA 5DQ0A 4CP9B 4MXWA 3ZDSA 1V9U2 5FP3A 5JZGA 4PF5A 1AR82 2VQUA 2CL2A 2JEMA 4NIHA 2VMGA 2XOMA 4A45A 2BBAA 3NNMA 3SH5A 4V1PA 4EWAA 5FCCA 4NRMA 5JZGC 3T1MA 2P1BA 3OTFA 4WM7B 1JZ7A 2ZS6B 4FI9A 4X8PA 3LEKA 4Q4W1 2BOIA 3JU9A 3LEMA 3ZVXA 1NT0A 3R6SA 3ES1A 1RITA 4ISRA 1HV0A 1QJU1 1SFPA 5T54A 2BJSA 1BEV1 3P3NA 2PHTA 1Z7S3 4XFHA 4Y4RA 3H7JA 4DY3A 4AAPA 4BM8A 3ZFEA 3LF7A 1ST8A 3EXUA 2GDFA 1LHNA 2IXLA 2YHJA 1LHUA 4IV1A 4LO6B 3ZPYA 4M3CB 5JXHA 5JAXA 3MW4A 1OH4A 2UWBA 2GALA 3WNPA 2WS91 3BOWA 3LFIA 3SEPA 3BTXA 5F32A 2BNOA 2RVAA 5ABJB 4AHWA 4KWUA 4YW2A 1SFNA 3ZYFA 1A34A 1TZOA 4LA2A 2FCTA 1C3HA 3VBRA 4JKLA 2GNTA 4WVMA 5FZDA 5A1FA 3NKGA 5CFDA 5JCTA 1F9KA 3KMHA 4HKWA 4RYDA 2C5DA 4JQRA 1PMIA 3LD8A 4XDPA 3VBRC 2JKBA 2BVVA 4UWDA 1JZ6A 2R041 5F2SA 4LULA 1VLNA 2MEV3 3IMMA 4EV0A 1MR5A 4XFIA 2WLPA 2CGPA 4UI9L 3ZN4A 4NIIA 2I2SA 5CFDC 3LEGA 3N9MA 1EV11 1HN0A 4OHVA 4K7JA 2ET1A 3AMPA 1DLLA 3C7EA 2OS2A 1UCXA 4COVA 1REDA 3E5XA 3RWNA 3E1F1 4DUWA 3WEZA 3IBMA 4AL9A 4QD2A 1LTEA 3VDDB 1V9U1 1V70A 2P6CA 1ODNA 1OQEA 3AXEA 1G9FA 1AR81 4GMP1 5FJKA 2YY1A 5FP9A 5BXXA 3TAYA 2PA7A 1LOAA 4L99A 4BU2A 2XDVA 2RDQA 1S2EA 4XZUG 3WW3A 2RMU2 1AXKA 1UKRA 2WT1A 3VBFA 3VL9A 3VD4A 2ZGMA 4INDA 3IDBB 1SLBA 4UFIA 4XFFA 3PNAA 3IDEA 1OQ1A 1XSRA 4KL1A 3ZLIA 3O1UA 4OHYA 1K5MB 2XH6A 4AK3A 2Q1MA 4NROA 4RR3A 1VBD2 4YW5A 1N1TA 3TOJA 4MHRA 3VBFC 3WD5A 3CKHA 1FV2A 3FN9A 3LDBA 3LIGA 2EALA 3NKTA 4HVQA 4P5HA 4BJ0A 2P3KA 2XJRA 1GKBA 1LOGA 1KXGA 3IPVA 5CKQA 4F8AA 4XUTA 1OUSA 4RS5A 3FHQA 3H0OA 3I54A 4HKLA 2GC2A 2RDNA 1UZVA 1GZWA 2WWSA 1R092 4RR3C 1QDCA 2GMEA 4QPGA 5A3MA 2VBDA 4AVCA 5F3IA 4M3CE 3HNYM 4KU8A 4CDUA 5CISA 1RVF2 3BPZA 4AHXA 1A78A 3PVBB 1IQAA 1O59A 4JHTA 4WVVA 4RS5C 4Q4V2 3L2HA 4YRDA 4IXLA 5JSOA 2VGDA 2VULA 2N7GA 4W6XA 1FMD3 3OUHA 3DUIA 1CVNA 4QPGC 1CESA 2VOVA 1ZZ6A 3KV4A 4UF0A 2JDYA 4AR2A 2WC2A 4BMBA 3POFA 5GM0A 2JG9A 4QDQA 1XNKA 3HJRA 4CDUC 4Y26A 5CEHA 2WNVB 1RUJ2 2H0BA 2JX9A 3HPNA 4FOWA 2W68A 5FZOB 1S4CA 5LK5A 4AG4A 4HSLA 2R071 1DZRA 1VP6A 3SC7X 4E27A 1EP0A 2ZGSA 1KQRA 3KB5A 4S2GA 1PVC3 3RMYA 2WKKA 2YZ4A 3MIFA 2EAKA 4XF0A 3RZKA 1NQJA 2W1UA 4QPIB 1DQ2A 4IGPA 2PMWB 3J8F3 1DZTA 2R49A 4QKFA 4OMCA 2UWAA 4P14A 1U5IA 2E63A 5CG9A 4MGTA 3THDA 1PGSA 2VCMA 1PHMA 2F4PA 4HN1A 5FO7B 4QWNA 3WZ1A 5M0TA 4CDQA 2XUEA 3BUCA 1JZ5A 4LBQA 5L73A 4KWKA 4QX8A 5IVVA 4IE5A 4GJZA 1F8VA 1JS9A 4DFSA 3HD8B 4BQYA 1HRI2 1COV2 2R6QA 4CDQC 1UOBA 5AVAA 3SCFA 3JQWA 3H7YA 3TN92 1GANA 1UZWA 3SHRA 2AC1A 5HBAA 4F7ZA 4N43A 4NIDA 1PZ7A 4O61A 3O14A 4D8MA 1FOD3 1X82A 2Y6GA 3VHNA 3FFQA 5J7MA 1OOPA 2G9FA 3B3QE 4JV4A 2NQYA 3I97A 3PU3A 3RJRA 2DTWA 4BQ3A 3GHNA 4E4HA 2A5ZA 3CLPA 1REFA 2YUEA 1W99A 5DZFA 3LEIA 1UQXA 3K2OA 3HBKA 1R091 1UY2A 2GC3A 1W9SA 3ACLA 1EUUA 3APBA 2SLIA 4JTNA 1QQP3 1S0BA 1CGPA 4NIGA 1G6NA 4QX7A 3WINE 3KT1A 1ZRRA 2OUJA 3AKQA 4Q4V1 4MGIE 2BQPA 1SBFA 4BIFA 5D1IA 4XABA 3USUA 1DGWA 2P17A 4AI9A 5F1RA 4N8MA 3BU7A 5JXIA 1EAH3 3T0DA 1O3SA 3CQOA 2B5HA 5EHDA 4Q26A 5F7UA 5FYUA 1RUJ1 3MEPA 4BYYA 1ULEA 3AZXA 1WLWA 2BW8A 4X6QB 3BN6A 4YM0A 3JBG2 4ORFA 1BMV2 3VHPA 3U4XA 2AH2A 2D5HA 2XQRA 3VKOA 4LXLA 3ILNA 4N9HA 3POJA 3R4UA 5F37A 5FQ0A 2JDNA 3ZFFA 1PIV2 3AYDA 1UOGA 5JOWA 1Y43B 1K42A 2V5DA 4YNIA 2FDJA 3JUUA 4FPKA 2ZX0A 3X29B 1LULA 1XJAA 3NV4A 2VM9A 4JQTA 3OJBA 1CZSA 3AKPA 1XYOA 3OBRA 1QJX2 3USSA 2VW1A 3QBQA 3ZFFC 3DCQA 4OI1A 2QQLA 3ZXKA 3WF4A 1B35A 1RUH3 1W2UA 4YW3A 1WCUA 3RNSA 1LODA 1DQ0A 1YQ2A 2OVUA 4N7IA 5DUUA 4CEYB 1C57A 4DEVA 2V73A 1N47A 4P00B 1COV1 4Q0QA 5L9RA 3TN91 3GBFA 2DUPA 1B35C 4FAGA 3CHXA 4KG8A 5DDJ3 3O1PA 4LNVA 3FBYA 3MV01 4AXOA 3ZYHA 1GZCA 4ATFA 1QIQA 4E2GA 1QXRA 4TZDA 3BIEA 2XGXA 1TVGA 2E26A 3I8TA 1VE0A 2WFF2 4PLOA 4RFT0 5DXDA 4RN5A 4H55A 2A3YA 4XAAA 2EIBA 3OYWB 2D3PA 1W9FA 2OPKA 4LJHA 5EYXA 5LW9A 5C70A 5DABA 2Z69A 5EWSA 4M4RA 1UO9A 3PURA 2OQ7A 2WZ8A 3H3LA 1UN1A 4OUMA 1JOBA 2OYZA 3WVJA 5FZKA 3B00A 1MQTB 3C2UA 3LZZA 3T09A 4CPBA 5J1XA 4DXRA 3OPZA 2VUDA 1X9PA 4YG6A 1JYTA 1YWKA 2E33A 3NV2A 4NOTA 2VXRA 4L8QA 1WCDJ 3LKJA 3MUY1 2RS52 1CAVA 1NLRA 2XBO3 1WBLA 4Q2FA 2JG8B 4PDWB 1JHJA 2G9ZA 4F83A 1OFNA 3CZJA 3Q8BA 3MV11 2Q8DA 3ZKUA 2WWUA 2O1QA 3KQRA 3OGVA 2XKPA 1XSQA 2ZTNA 3SLIA 5IT6A 2ZGOA 1LNSA 3M2MA 5CB7A 5FYIA 3ZPOA 2XHNA 5A6YA 1GWLA 2I45A 2ET7A 3WG2A 3PIGA 3PUQA 4HZFA 4Y1ZA 2X09A 4EWDA 4Y3OA 5K9YA 4NO4A 1PIV1 5KXBA 1S0JA 4CDXA 3AKSA 2F17A 2WA3A 1ZZBA 3ORJA 5L36A 4LITA 4AI2A 4YPJA 2ZGPA 3IIAA 2HLEA 4BWOA 1UOJA 1AR73 1UF2C 5C9AA 3NAPA 3A23A 5K0UB 1QJX1 2VBPA 2QKDA 4CE8A 3H1YA 4EN8B 5LZ6A 4CDXC 4AQ2A 1NQDA 4NHLA 3DEMA 3S5QA 1BZWA 4RD7A 1SDWA 4DQAA 3S5AA 1ZRIA 5C9AC 2W94A 1WKYA 3SCHA 1FPN3 3NAPC 4XE9A 5J09A 3EMRA 3H50A 4QKBA 2W2IA 3N9LA 4HANA 4UAPA 2VC9A 2XJPA 4Y5Z0 5T55A 3LA3A 1A3KA 4FP2A 2KM2A 3UETA 3WSOA 1RUG2 5GZFA 3QOPA 2R0HA 4CXWA 3N9PA 2MEV2 5KHHA 3O12A 1M06G 3OD4A 2WFF1 1GNHA 3HT1A 1EV13 1W3XA 2EXHA 3PTRB 2OIIA 1HQWA 4Q4X3 5F6LB 3FC0A 4AEJA 2QQKA 3NWKA 4XIOA 4Q1RA 2ZEWA 4UW3A 3SCGA 1OF3A 3FMGA 3KCCA 2ZZJA 2EF6A 1QJY3 1IKPA 3M8LA 3VZKA 1XNCA 5L9BA 2DVAA 1WMEA 3LA2A 4PLNA 1GOHA 1WW4A 2OW4A 4LE3A 1RUNA 2DU0A 2PHDA 1W8TA 2E7AA 2WINB 1NCRB 5DPNA 1K3IA 5A3WA 4RL7A 1RHI3 2RS51 2B46X 2HYXA 4NWWA 4RHV2 4JRAA 4ZY9A 2J42A 3AP4A 4QQOA 1IS6A 2YXSA 1PMJX 2W91A 3TEZA 2AR6A 1HQLA 4UFLA 2XJUA 2ZX4A 2D6KA 5JVVA 4CUAA 5DAVA 2B9UA 4KWLA 5HXMA 1JTZX 1XNAA 1Z7S1 1AXYA 2HEYF 4IW3A 4ASKA 3MLJA 1QOTA 5LY1A 3NVCA 2J22A 3HT2A 2GH8A 5E6HA 1AX2A 2YGLA 1O3QA 1O3RA 2BGOA 3KF3A 1YQ5A 3I2HA 4R52A 5D8AB 3RQ0A 4HSJA 2JXAA 2Q8OA 4A3XA 1JU4A 5T5OA 4I2OA 4OHWA 1FMD2 4B7EA 2WT0A 3IAQA 3ZIWA 4FXKB 1W8NA 2JIGA 2QZ2A 2RS13 2WO3A 5KR7A 4Z8BA 2V4VA 5C71A 4CEWC 4URTA 2AZ5A 1H1AA 4OMDA 2A1XA 1DGRA 5CG8A 2R7EB 4KNCA 1BCXA 5FYTA 1GQHA 2BYVE 2I07B 1J1TA 1PVC2 2UU8A 3ILFA 4LBJA 2DBNA 4LBLA 5FFOC 5CFCB 3H8RA 1YUDA 4BQ4A 1TMF3 1QU0A 2WLQA 2PLV2 3OBTA 3J8F2 3ZXDA 1RUG1 4YW4A 2MEV1 4IE0A 5ERLA 1NZCA 3M7AA 4Y22A 4A44A 1N3PA 3VBHA 4QXCA 3I2KA 3FLTA 4XURA 1VMHA 5A7SA 5C8WA 5LWBA 1IPJA 5KXCA 3CZUA 5C5UA 5FP7A 2IZWA 3DYMA 2E7TA 1UYZA 2R30A 4XEZA 2VQ0A 2FDIA 2ZGUA 3KWVA 5SV5A 3V65A 1YC61 1PNFA 1FNYA 3VBHC 2EICA 4XFAA 4CCCA 3ETPA 1FX5A 1DFQA 3KHBA 2WO2A 3UGHA 1S0GA 4YM1A 2G19A 2RMU3 3OY8B 4FPLA 4DRVA 3MPBA 3AMHA 4ZONA 5I8SA 3VBSA 2VECA 5A1AA 5H9QA 3HN3A 3O0VA 1WW7A 1SEFA 1PGL2 2V5YA 4RHV1 2WSVA 1H2KA 1JBCA 2Q1FA 2VNVA 1VBD3 3BCWA 4GA9A 3VBSC 2IXCA 4KU7A 2D40A 2ILMA 1ENQA 4J1XA 3AZYA 4XHXA 5JR2A 4QQLA 5JOZA 4CCMA 2GNDA 3I59B 4NIAA 2WNUA 2W39A 4AEKA 4XDOA 2HEWF 2JDKA 1NA1B 3S7EA 3BODA 3LCPA 1Y3TA 2GZWA 1FT9A 3KVAA 1RVF3 3ZXAC 1U12A 5FZFA 2OKXA 4Q4V3 2PAKA 1J1LA 3WW4A 2Y33A 4FO9A 2LUWA 2WNUC 2FMYA 4X6RB 5FZ7A 1FMD1 1HLCA 3B9IA 3MIEA 3ST7A 1ENSA 2XPJA 3AMMA 3A0NA 3IIIA 1W0OA 4AFMA 2W87A 5IHRA 4B29A 3WDUA 1RUJ3 4L9BA 4XCAA 4AFDA 3T0AA 1OLRA 2R16A 2J7MA 3T30A 2NMNA 4IEYA 2K2SA 1ND3A 1PVC1 1DHKB 2ID4A 1FATA 2XVLA 4K9SA 4OUSA 2B4KA 4P9IA 4B4PA 4GH4B 3O1TA 1JOPA 1JW6A 3J8F1 5FZAA 5BNPB 5AFBA 1GP5A 1ND3C 3I2FA 5IK7A 3CDZB 4AVBA 1GNZA 3M1HA 4NWVA 1ULDA 4YVSB 2FQPA 5T50A 3ZOIA 2FZ1A 1W6PB 3POGA 3KM5A 3POSA 1RMU2 1KS5A 3J4UH 1W6MB 2WZPP 3POWA 4AHYA 1HRI3 1KJRA 4PI2A 3BB6A 1U0AA 3VHRA 2RDRA 1LOBA 2WIIB 1H8TA 3N36A 1CAUA 4ZU7A 1IG3A 2DDUA 5ANNA 3A21A 2PYTA 4QDSA 3U14A 2WR9A 4HT1T 4X8NA 1V6IA 4HONA 3M70A 3FHIB 2CY6A 5JXGA 3C7HA 4JGZB 2ENRA 2QCSB 1FOD1 4XACA 1G8WA 4XILA 4AVVA 1S0EA 4YG0A 1OMIA 1H8TC 1TQ5A 1JYVA 2JDUA 3LSEA 5FY0A 1ALYA 5FMDA 4W6WA 1GLHA 5FZ3A 3AXDA 5C5TA 4BE3A 3PVEA 1IS5A 3HR9A 4QX5A 2D3SA 5C7GA 3S0MA 3POBA 2FCVA 1LHVA 1RC6A 2PTMA 4AVSA 1D4VB 2ADDA 3T4VA 3ON7A 4OFGA 1QQP1 1A6CA 1ULGA 2FMDA 4OZXA 2E53A 4Q27A 4CCNA 4CUCA 1QGLA 3NV1A 4LUMA 5FZBA 5BPXA 4FPFA 4LO7A 4LIVA 3OGJA 4IGOA 4BIOA 4AEMA 5TSWA 3V56A 1BJQA 1V6NA 1DZQA 3FL7A 1N3QA 4DRRA 2WZEA 5FREA 1S0DA 2YMZA 2UURA 5FMCA 3TNQA 4K6BA 1ZVFA 3U10A 2HH9A 2WO7A 1F15A 4HPKA 4LO5B 2WUHA 4LR4A 2BVBA 2JD9A 4NJ4A 4DEQA 3D0JA 5FZ0A 3JBG3 4AHZA 5C8CA 4MLOA 1WCQA 2VPVA 1F35A 1LGCA 4YGBA 1NUKA 3KHCA 3VKFC 2LRPA 1NE6A 2L9LA 4Q0PA 5A3PA 2BGPA 1O4YA 1E5SA 3FUQA 1PIV3 2H6CA 3URFA 5IK4A 4CXXA 5C8CC 5FYBA 3HAGA 4FFFA 2A6WA 3WOGA 2ES3A 4L92A 1AR72 1J3RA 1QJX3 4KMQA 1IG0A 3UNPA 3OSDA 4GKXA 3CF6E 2ARBA 1UU6A 1GNYA 1RMU1 1WLCA 2BWCA 3UESA 1Q8PA 2D97A 4N53A 4QQHA 1DBNA 3IWZA 1I6XA 3K4ZA 1FPN2 5DUVA 3B94A 1W6QB 5IK5A 1W8WA 2ZAAA 3ILRA 3AB0A 5H9RA 3ZYBA 4ATEA 1O5UA 1OKQA 4XMIA 4DS0A 4FCAA 3PVNA 3FUOA 2DUOA 1GYKA 1PX4A 4KGQA 2Q0AA 3GHMA 4R8HA 1ZYBA 3B7MA 3BOPA 4CCEA 3OGRA 1FV3A 1VALA 5HXVA 2DFBA 2GMPA 1ENXA 5HCHA 5F8PA 1RJ7A 1BLZA 4XJAA 4HETA 4BQXA 2B45X 3BPSA 1CAWA 3AYAA 4LBMA 4NAOA 2IFWA 1ZA4A 2VQTA 3DPRA 1QJY2 2TBVA 2C26A 4L2NA 4NRQA 1NAEA 2QQWA 3VN4A 4YFZA 2EIDA 4PQ9A 1PNGA 5C3RA 1W2AX 4BQ2A 4BLIA 3RWKX 4B4RA 2QBXA 5IVCA 4FT8A 3WP3A 3IM0A 3DPRC 1RHI2 2RS53 2P4EA 1QJFA 2XBO1 3J7MA 3PVOA 2R0FA 1Q8VA 4KBZA 1V6LA 2IWGB 3NNFA 3O1VA 1W8UA 2DFCA 1POV0 4RQPA 1POQA 4FP3A 4WM8B 5HV0A 1CZVA 3SH3A 3ZXGA 4HMZA 4BPZA 5KHGA 3LA7A 1TME3 1H6YA 2W3JA 4ES8A 1UY4A 2VAUA 1UYYA 3S7IA 1JYXA 1GSLA 3VUOA 1UMHA 4FFIA 4Q0SA 3VDAA 1CX1A 4XC9A 4RQPC 1H6XA 2R32A 4LPLA 5K4LA 4ZU5A 1C8M3 1YLLA 1C5IA 2CAVA 5BNNB 4S2HA 1QOOA 1PK6B 4IEQA 4FPHA 3WLUA 4I09A 1AL23 2X53S 3GXUA 4IDZA 4JZRA 4LKDA 3H42B 1UMIA 4OVEA 1AR71 3WNOA 2VOKA 1D4M3 4EE2A 5FZIA 3I4IA 1VBC3 4LEJA 4LO8A 5FZ1A 4TLFA 3M3QA 4I3PA 4XOGA 3GZEA 4KH9A 1ULCA 2RS12 5F39A 2J1VA 5FYSA 3TEXA 2W46A 4Q0VA 3HIFA 1NG0A 1W39A 1FPN1 3ACHA 1WW5A 1O3TA 1PO23 3I49A 3D0SA 3KF5A 3WG3A 3ZFGB 1BKZA 3KLSA 4YM2A 2BTVC 4LBOA 2B7YA 4AFAA 3WXPA 4BMEA 5JSRA 1TMF2 1WWYA 2YG0A 1QH6A 3D3AA 4C0HA 1RUG3 5FWJA 4P5YA 3FJSA 1X7NA 2QQIA 1PVXA 2WQZC 3C7OA 3M3EA 3OCPA 5JI9A 2X05A 3M3OA 3NL1A 4XXAA 3J26N 3NJYA 4Q4X1 5EV7A 4FAHA 5I91A 1UPSA 3C8XA 5FYZA 2RJLA 5HV4A 1UNBA 1RL3A 4AVAA 4OYUA 1GWMA 3AVRA 3OB8A 5C4WA 1LHOA 4QXKA 1CWPA 1QJY1 4EROA 2IXIA 4ASLA 1DQ6A 4XIKA 3LIHA 5E89A 3RZJA 1OLME 2P3IA 1D0GA 3GZUC 3HVDA 5EJ1B 4C91A 5C4WC 3QACA 4K8RB 1NLSA 1UKGA 2ZHKA 3HN1A 4IUGA 4MH0E 1HV1A 1RHI1 3GF6A 2P3JA 2VNOA 1REEA 4RHV3 2SBAA 1UOFA 4I02A 3EBRA 5F5AA 5GZEA 2BNNA 1OA4A 4YZ4A 3CBNA 1QY4A 1ZNPA 1OVPA 3DF0A 4E4SA 4LLFA 1Q8SA 2JDHA 3FHAA 1JUHA 2P5BA 2BFUS 3MF6A 3O7OA 2H0VA 3AYEA 4QKDA 5J98B 4FTSA 2C4XA 2E6VA 3KGZA 2P37A 4QPWA 2FDFA 4Y1YA 3WDWA 4TSVA 1DP0A 1ND2B 3GJAA 3HBZA 1RUC3 2VH9A 4HL0A 1YRZA 1KEXA 2BZDA 2OXBA 1KJLA 3K48A 4XYXA 4UW4A 2QQOA 2HBTA 4JAAA 4LKSA 4CU9A 3MGUA 3W20A 4R4ZA 3I3EA 3EJKA 3V0BA 4GWMA 4B3NA 1XRUA 5T52A 1GUIA 2VW0A 4Y24A 5I0TA 3WNLA 2X5IA 2RS11 2RR12 4JGYA 4Q4Y3 4LA3A 3JXSA 1OLQA 3NNJA 1VMJA 4QDRA 5FPXA 1C1FA 2ZGQA 1NE4A 3MW3A 3AYCA 2ZGNA 3MIGA 1D2QA 5H9PA 4Y20B 4PLMA 2ZHNA 1JMUB 1W6NA 2X5IC 4JGYC 1YFYA 4FOQA 2VZVA 5T5JA 4XFBA 3C7FA 4LE4A 1H2MA 1LECA 3ZR5A 1TMF1 2RJKA 2PLV3 1RUI3 1WMXA 3VZNA 5FXXA 5JOYA 3RMXA 1DGLA 3PJYA 4IEUA 5A7WA 2KR2A 2H6BA 4C1XA 1SDDB 5JLVA 4LK6A 2HWB3 2B42B 3ZSEA 1I1EA 4YW6A 3H1MA 2VZPA 1C8NA 4KBBA 4PBPA 4LHNA 4AI1A 3B69A 4P9WA 1S1AA 1S2BA 2BUKA 5A70A 3CL1A 2Y6HA 3ENRA 4HG6B 2FDGA 4P02B 3I2JA 4FFHA 4NE9A 4P08A 1OF4A 5FYMA 3IKWA 1FXZA 1CAXB 3LGRA 1NCQB 2DCJA 1W9TA 2DCKA 3VBOA 1US3A 1W8ZA 2RMU1 2YGMA 3GJBA 3N4MA 4P9JA 5JR7B 5C33A 2C1FA 4ZZ8A 2FCUA 2X8KA 1LR5A 4M4PA 1L7QA 1FI2A 2OZJA 3A22A 2IXKA 3LB9A 2GSYA 4Y33A 5B4XA 2WJSA 4XBNA 1QKQA 3VBOC 1SPPA 1VBD1 1KDKA 3AL5A 1LOFA 5FK7A 5BUVA 3DXUA 3PTYA 1PO13 5A32B 3EO6A 2PXJA 3RZHA 1V6KA 1VB4A 3WCRA 1XYPA 3ACGA 2FZ2A 1HIXA 2OPWA 2BWAA 1NCRC 2XL7A 5E16A 4UFMA 4URAA 1LOFC 2VOWA 4TLGA 5FPAA 3VKMA 1W90A 3RSJA 3LPFA 1RUE2 2ARCA 2PQSA 2Y6JA 1RVF1 2CWMA 4G4FA 1YJLA 4LTAA 2VNRA 2WDBA 2XVGA 1DIWA 3AP6A 2XVKA 1Q5OA 1JUIA 4IERA 4YYOA 4MHUA 4D7SA 2WA4A 5FPBA 1KFXL 2NPIA 4MXWB 4S2FA 5JZGB 1LGBA 5ACA2 4ASMB 3RZZA 2DWRA 4O9GA 2RM23 4GULA 5FK8A 4CU6A 1DGWX 4XPVA 1ULFA 4BQ5A 1PM4A 4HOOA 4D0QA 2VVDA 2XJTA 1H9PA 1MPXA 2ZGKA 3LFMA 4XXPA 2VZ1A 1CN1A 2DVFA 2XL9A 1UZYA 1UX7A 1YNAA 2Y34A 1ZX5A 2XJVA 5L7OA 3RZLA 3RS6A 5FLIA 4LUKA 5FZHA 5E88A 4JRLA 2Y6KA 1I3HA 3HWJA 1HN1A 1XOYA 4BLJA 5IFPA 4XF3A 1AR62 5GLUA 3MFAA 1JYNA 4FOVA 2XKOA 3KS7A 3ZFEB 5FR3A 3BYWA 2CGOA 1URXA 3VV1A 2CYFA 5L7OC 1UYPA 1TE1B 2JENA 1RMU3 3KSCA 4LHSA 3DKWA 2VZ3A 4IV1B 4CXYA 2VZUA 1W8FA 4U36A 4B7KA 2V4AA 1HRI1 1HRV2 5A3OA 4G9SB 4MSVA 2GC1A 5FO8B 2DVDA 2QJVA 3WDVA 5DG2A 4A4AA 2ZMLA 3HNBM 1PZ8A 3WF1A 2YFZA 1UXZA 1XE7A 4AWDA 4XMAA 5E1RA 5IVBA 1IQDC 3MBWA 4RGAA 3SH4A 3VBRB 2YPDA 3HEIA 4A6SA 4A7KA 4NHMA 4W50A 5T3NA 4H7MA 4WVMB 5CYYA 5A3TA 2O0OA 4YLZA 3VZOA 5CFDB 1LJ7A 4MGZE 5A33A 1V6JA 3WF0A 2YV8A 3KV6A 2EA7A 4LT5A 4FQ4A 2JDPA 3I3MA 4GIQA 1CR7A 3P6BA 1UY3A 1W9YA 4NPMA 4DIQA 5B4NA 2VCCA 1G9BA 1RUE1 5F5QA 5F5CA 2JD4A 4K1ZA 4ZS3A 3DYPA 2W1QA 4HN0A 2QQVA 2C9AA 5T5PA 1GQPA 3WG1A 1UX6A 2GP3A 3D4KA 4W4ZA 1GFF2 2CDPA 4QU2A 5IVYA 4YGCA 5FZ6A 1C1LA 2VVFA 3PHMA 3PUAA 3CJIA 1MZFA 1NA1C 1TME2 4GQ7A 3I7DA 4HK9A 5C3OA 1T6BX 2HBUA 1LB2A 3K4AA 5F2WA 1BMV1 1O91A 3JBG1 1US2A 3VBFB 5IFTA 2VG9A 4IETA 4UYBA 1C8M2 3CJIC 4JKMA 2P2KA 1I5PA 3PIJA 5CA6A 2JE8A 1WLTA 1MS9A 4CDWA 4CCDA 5BNOA 4RR3B 5DUWA 3VLBB 3TYJA 3LE0A 5APAA 3ZN6A 5FLHA 1AL22 4IV3A 2WT2A 1V00A 3CNAA 2R1DA 2X29A 5JOXA 3IPVB 5HI0A 1D4M2 2Y26A 2ZBJA 3FE5A 4K20A 4RS5B 1RGSA 1ZZ7A 4CUGA 2W95A 2GC0A 1VBC2 4LIUA 5FZ4A 2VU9A 2XG3A 1GZWB 3WR0A 3ZMOA 4A42A 1WCKA 4CDWC 1HB4A 3IMNA 4QPGB 4D6RA 4IV3C 1NY72 3A7QA 3ZX7A 2IUWA 1F31A 4GH4C 5A7PA 3QLQA 4CDUB 2UYBA 2Z2SB 4LOTA 2W5FA 1HRV1 5BNPC 3W5NA 1PO22 2BRTA 4V2WA 3D6EA 1RB8G 3PL0A 4CVUA 4D6SA 3MIDA 4XZPA 5LRSA 3LOBA 2OUHA 2WWJA 4UF0B 1YIFA 1ACCA 5I0UA 3MHZA 5HCBA 1E5RA 1J58A 1VMFA 2JG9B 4MV2A 3GALA 4M01A 5FPUA 4ZXKA 3SMHA 1OVSA 5F3GA 2WYSA 2IC1A 2GU9A 5LA9A 5A80A 1YFWA 1BK0A 1SACA 1YQ8A 3OEAA 3ZXFA 1KRIA 1KD7A 3ZMNA 3ZSLA 5A6QA 1JYCA 1D7PM 3E6BA 3SEEA 4BDVB 5FY4A 4FFGA 1ULPA 5EP9A 1AHSA 2JDAA 2W92A 1U5YA 1MEC3 4XQWA 3SISA 3SKJE 1VJ2A 3VDCA 3UGFA 4AZZA 1IHMA 1LU2A 2NYYA 4RGKA 5SV8A 3LPGA 1B09A 1VBB2
chains in the Genus database with same CATH topology
1X8MA 1JOJA 4K21A 4YGEA 1NXD1 1KS4A 3WP5A 4CDQB 4LBQB 1OD5A 1NXMA 4H14A 5HCAA 1SLLA 1IPKA 1XYNA 1LCLA 2VQAA 4AEDA 1OA2A 2FHRA 4AF9A 1TME1 4MGKE 2HWC3 4WV8A 1D0HA 1NYWA 2GH2A 1H8VA 4N43B 4AEDC 3MIBA 1KFUL 2NZ9A 1C8M1 1DQ4A 2CNAA 3UJOA 1OOPB 4I01A 1RUC2 2HWE3 1AL21 2W08A 1CX4A 4CEWA 5FOBB 2Z79A 4WBBA 2LALA 1CQ9A 2A3XA 1D4M1 4AW7A 3AK0A 3N7LA 3AJYA 4SLIA 2QQPA 1Q8OA 1MACA 1O5LA 1Q3EA 1VBC1 2FBEA 5CNAA 2I74A 1BK1A 1R1A3 4P9LA 3RI8A 4Q4Y2 1NY71 1ASJ2 4FPEA 1EPWA 3VBUA 4HFSA 5EZWA 3ZYRA 4YGDA 4M0NA 4Z92B 1PO21 2VMIA 1YFUA 3USUB 4IEWA 1W6OA 2D98A 2ZMKA 3SNMA 1AR92 2IFRA 3VBUC 3H1WA 3TNPB 1RUI2 4KQ7A 4QM8A 2ZAHA 3SITA 3J9SA 3BIWE 1WA4A 5FMOL 4FSJA 4W6YA 1WMFA 2HWB2 3RYPA 2D6PA 5KXEA 1VBA3 5I8YA 4QGMA 4H7LA 3V0AA 5DZGA 1CJDA 2D3RA 5FQ0B 3ZFFB 3WDYA 5F9TA 4YVWA 2VOXA 4UW6A 4D94A 4OI4A 1ZBE2 1DU3D 4LBQD 3RYKA 1WLDA 1H4GA 2ZCWA 4FPJA 5L19A 4YVWC 1B35B 2E51A 3RPQA 1Q56A 1RINA 3E6CC 2ZMNA 1YFXA 3LOIA 4WM7A 4FTEA 1PO12 2AUYA 2DURA 2JDZA 4L97A 4TYSA 4Z07A 2HJIA 1XU2A 3RYRA 5LEKA 2QFEA 4DXZA 4GMP0 3S30A 4YZ5A 1IGOA 4WM7C 1ZRDA 2C0ZA 3W59A 1RUC1 3MICA 2ATFA 3T2TA 4WM8C 1LENA 4A2UA 2JJ6A 1WD4A 4R9CA 3MPPG 1LHWA 3G6JB 5I0RA 3DV8A 4M3CA 2QVSB 3ZYGA 1IS3A 2BFUL 3THPA 2RR13 2F6BA 4Q4Y1 5FLJA 4CYDA 2RM22 1CIWA 2HKXA 2ZHMA 3MLKA 4LBNA 1PK6C 4MZUA 4SBVA 5ABJA 2CTVA 4YFWA 2MHFA 1PZ9A 1CAVB 1A8DA 1AR91 1WCSA 2PLV1 3H3UA 5EFUA 1Y9QA 1RUI1 4AFBA 5ABJC 1XNDA 4D3WA 3N7MA 4RGGA 4COUA 2A75A 1HKDA 3VL8A 2HWB1 3GZAA 1XQNA 2UWCA 5I93A 4EN9B 4CDXB 2R062 3OD0A 1IS4A 3VDDA 5C9AB 3ZN5A 3NAPB 4F3JA 2JE7A 4PIXA 4DZGA 2WL1A 1PGL1 3T1LA 1AVBA 4IL7A 4B4QA 5BNQA 1UIJA 3VDDC 4AYUA 2ZPXA 4HK8A 3FBMA 3CJXA 1PO11 3G7DA 5LEJA 1K5MA 1F5JA 2DUQA 4AQTA 1J3QA 1AX1A 4AFCA 3ALQA 3MYXA 4FVVA 3JZVA 1RUE3 2DCTA 1H1IA 1K5MC 2HWD3 4Q8LA 4M3CF 1DF0A 3MF9A 4AI8A 1G9DA 4S2DA 4C0BA 1MVQA 2E9QA 2KXLA 2Y0IA 3VGIA 3AZVA 5IK8A 5ACA3 5KXDA 4R4XA 3VZJA 3U11A 2RM21 1NOVA 3DGTA 4GKYA 5FTTC 2JECA 5LRRA 3I2DA 1UU5A 2NP0A 2ZGLA 1FAYA 2WNVA 4CP0A 1IZ3A 4NN0A 2VNGA 3AJZA 3RJ2X 4GALA 3INAA 5KHJA 2DCYA 3WP6A 2OA2A 1AJKA 3UKVA 4D7YA 2BEOA 1X8EA 3ZXLA 2WNVC 4XFGA 3HMYA 4DMIA 1AZDA 4G3YC 1Z78A 3AZWA 3QD6A 4QPIA 1AR63 5GLWA 4XF1A 4QQPA 1RUF3 1Y7BA 5C6CA 5KHKA 3MI8A 4QGLA 1OI6A 3E6DA 4YZ2A 4QPIC 3AFGA 1HRV3 2R061 4JDOA 5J36A 4AGVA 1JN2P 1OA3A 4BH9A 2WNEA 2EVXA 3D5OA 4R9BA 1SLCA 4QM9A 2GN7A 2PHXA 3ZYPA 4CTEA 1VB2A 3ECQA 2VUJA 1VR3A 5JPMB 1BQPA 1YIPA 4WVZA 1MEC2 4AVTA 4YARA 4Y22B 3ZSKA 4IEZA 4COZA 1UL9A 1G7YA 3VBHB 3LWCA 1X33A 3AMNA 4FBFA 3FFZA 5JSPA 4AI0A 3RDIA 2Q1ZB 4ZU4A 3TBDA 4MXVA 2ZX3A 3ES4A 4GWNA 2HWC2 2Y38A 1UAIA 1TNRA 3VBSB 1HXS3 1SQ4A 3EQEA 2TUNA 3ZSMA 5T5LA 1BBT2 3B9CA 2HWE2 2WSUA 3MLLA 1YHFA 2K9ZA 2PAEA 3IT8A 3N3HA 1ZZ8A 2WNUB 1R1A2 3B5LB 1S0CA 5FMOS 1DYKA 3B93A 3ZXEA 3TWIA 3WG4A 2GNBA 1ZM1A 4IEVA 4CEYA 3ZFEC 3UL2A 3AM2A 3MW2A 2QZ3A 3AX4A 1WD3A 1S2KA 4IV1C 1VBE3 2QDRA 2XHKA 4CEYC 1ND3B 1VBA2 3WV6A 2Q30A 3KCYA 4NR1A 5EYYA 1Z0HA 2R072 3ASIA 1MEC1 2PELA 4FOYA 4FPOB 4LHKA 3OYWA 1MZ5A 3JD73 1H2NA 3JB4C 2PN5A 2OZ6A 1SLIA 1VBB3 4E9KA 3TB0A 1MQTA 4ZKTB 3N7KA 4HVOA 5DUXA 1H4HA 4OLLA 2WZR2 2RS33 1RUD3 3WY6A 1E57A 2AREA 3CU7A 1MQTC 4K40A 4AQSA 2HWC1 2ZGTA 4I0AA 5A3LA 2JG8A 2QNKA 4PDWA 1H8TB 1CAUB 1OQDA 3HQXA 1QXPA 3FLRA 2A6VA 3AP5A 4FXGB 2ZABA 3VHOA 2EAAA 1OFSA 2LM3A 4XJ9A 4D7TA 1UMZA 5BV6A 1BBT1 2JG8C 4PDWC 2VY0A 1C5HA 2HWE1 2AGSA 1L3JA 3IDCB 2XWJB 2YROA 4I30A 4U2AA 1H9WA 2DVGA 1VAVA 1AYN3 1R1A1 1ZREA 4CP2A 2ARXA 4XQ4A 2DYCA 1ASJ3 5IUQA 4Z1VA 5FDBA 4OI0A 3MIHA 4QQ2A 5K0UA 3L9JT 1YI9A 5KC6A 3GZTB 2Y0OA 1ZRFA 4XJZA 1R083 4FPGA 3NJZA 1AR93 1GV9A 5B2GB 4UXAA 5K0UC 3WQ1A 1QF3A 1AUYA 4Q8KA 4COYA 4ITCA 2DCZA 4HPKB 1RJ8A 1ZBA3 3UV9A 5EXOA 1VIWB 3GYDA 5C8CB 3BTAA 4XFCA 4MX3A 1VBA1 1EPZA 1MS5A 4NHKA 3ZXJA 4J6GA 3RG0A 3WCSA 3O0WA 2NMOA 3BALA 2D7FA 5KHIA 2JG9C 1VRH3 1UZZA 2TNFA 2GAUA 1CJPA 1ZBE3 2E7QA 1X36A 5JIAA 3LSDA 4CZSA 2D6NA 2WZR1 3B02A 3WT3A 1BVP1 1EY2A 1O4ZA 1NCRA 3ELNA 4N53B 2LTNA 2A73B 5AC93 1SFYA 5GLZA 3ZSJA 4JVAA 1CPMA 2V09A 3UKTA 3IN9A 2WFPA 4H3WA 1OSGA 4DB5A 1AF9A 3A4UA 4D69A 4XTMA 4A7ZA 1MS4A 5KBFA 2HWD2 2QUOA 3NV3A 4MVTA 1XNBA 5GZCA 5GZGA 4JDMA 2BBVA 4QHBA 3GNEA 4E2SA 1CAWB 2A70A 5D8AA 1S55A 3OGGA 4N43C 2RR11 3DPRB 3LAGA 4IQPA 1C4RA 4AQ6A 1DDLA 3WDTA 1A8MA 1OOPC 5D8AC 5JPNB 2JE9A 1Q43A 4IESA 3ZIXA 2D6LX 3Q9OA 2ZX1A 4JC1A 2PQQA 4RQPB 2XJQA 2P34A 1UW8A 4COWA 1G9CA 5CFCA 1MZ6A 4EWEA 4GXLA 5K7PA 4IEPA 4YW1A 3NO8A 4HVRA 5H9SA 1J3PA 1GQGA 1RUF2 2ZACA 1UU4A 2PHRA 1X50A 2VW2A 5DZEA 1DYPA 1CPNA 5CFCC 4LBKA 3N7JA 4AGGA 5GLTA 2R063 2NN8A 4XBQA 2A3WA 1WMDA 4Y1UA 2MNGA 2W0XA 3AP9A 3KGLA 4N9IA 5FRAA 1BXHA 4M0HA 4W65A 5J3UA 2KA3A 3V64A 4YG3A 3RRDA 2A71A 3E5UA 2GNMA 2ZX2A 3OY8A 1LGNA 4YZ1A 4QT6A 2HWF3 3S6PA 4PJYA 4WZFA 2GN3A 4Q29A 1H0BA 3H9AA 1M4WA 1N3OA 3P3PA 2GMMA 2IXHA 5GKAC 3JQXA 2CWSA 1G9AA 5BY5A 4BHPA 3W58A 1O7FA 3ZO0B 1OPOA 2ZKLA 3I59A 2HWD1 1N1SA 4I0WB 1XXNA 3ETQA 4NPRA 3WHTA 1NA1A 4GB33 2RHPA 4YZ3A 2JICA 1AYM3 1POV1 2A6YA 5FPZA 5C4WB 1PGW2 4XJ8A 5ACA1 3O0XA 1EYBA 4KG0A 4MYEA 2Q4SA 2Q5TA 3M3IA 5AFEA 1SBEA 2VUAA 1HXS2 1N1YA 3O5SA 5HCFA 1J59A 2YDEA 1G86A 4Y1VA 4XQDA 5J48A 1W0PA 2PHFA 2UY9A 4GH4A 4N7UA 4R9DA 3SISA 1AR61 3R4DB 4Q4W3 1T6GC 4BOWA 1RUF1 5BNPA 1LKNA 3H8UA 1YXWA 4ES9A 1QJU3 2DVBA 4MUVA 1BEV3 2YYOA 1Z7S2 1QDOA 2A6ZA 4XJUA 3KCXA 2HYKA 4YVSA 1W6PA 4A7YA 2W52A 4IEOA 4K1YA 4Q0UA 1W6MA 1CONA 3V0BB 4UBGA 1GR3A 4R9AA 1H2LA 3WDXA 4YVSC 2AENA 3ME2A 2X5IB 4HKOA 4JGYB 2R1BA 4C1WA 2WS93 2VVEA 2EXJA 3E97A 5I0SA 1S0IA 3W9AA 4EN7B 4CRQA 1VBE2 4JGZA 1V6MA 1WGPA 1W6NB 3SXWA 2EXIA 3WNXA 2ZHLA 4JGZC 1YYNA 4NVPA 4P9YA 3JD72 2DF7A 1F2NA 2XLAA 2PAMA 3AFKA 1TNFA 4DPNA 3AP7A 1WW6A 2R043 1OHFA 1ZZ9A 5J37A 1JYIA 3D8CA 4JCKA 4DNYA 4BZ4A 1V6OA 4PBOA 1GICA 1GBGA 3FZ3A 1HDKA 1C28A 1RUD2 2RS32 1PGW1 4UBHA 5CADA 1ENRA 3PMSA 2Z42A 4XJWA 1BVVA 1XE8A 1SMVA 2XJSA 4DOUA 1LOEA 3VBOB 3JB8A 1N1VA 1V9U3 4GMP3 1AXZA 1AR83 1LU1A 2ZKNA 4N90A 1HXS1 3R4SA 3EHKA 4MGYE 3VZLA 2ZJCA 5CBLA 2DTYA 4WVWA 1BBT3 4DY5A 4LHLA 5CVRA 1CD3G 2XWBB 1H1MA 2DV9A 4IEXA 4EJRA 4B8EA 5FOJB 3U0ZA 1YO8A 4XF4A 4FQZA 3A0KA 2QE3A 5FBZA 1AYN2 3WP4A 1QH7A 2XB6C 1S0FA 4OULA 3WX5A 1Q8QA 2PHUA 2WQ4A 3H3ZA 3OF1A 1R082 4C90A 2MPFA 3ZYIB 1W6QA 4OI2A 4P9XA 2EXKA 5JMCA 2YC0A 1FYUA 1ZBA2 1YCIA 1VBE1 3ZYJB 4RSUA 4K3UA 2TEPA 1MS3A 1DQ5A 1SLTA 2G9GA 2CV6A 4EN0A 4XW3A 2B39A 1SLAA 2R073 1I5ZA 1JXNA 1YI7A 4OHXA 1LESA 2VMHA 2D43A 5L7OB 4K8FA 1VRH2 1D2SA 1LEDA 3JD71 3NSTA 1SCSA 1VBB1 2NLRA 1RUOA 5AVPA 3PJQA 1JHNA 1FNZA 4META 2WZR3 4LO4B 2RS31 1RUD1 4I0BA 3FLPA 4QPYA 3UJQA 4L11A 1DGRN 2D6OX 2EIGA 5CIRA 3KD4A 3QH7A 4BCUA 5AC92 4AI3A 4WM8A 3WUDA 3M3CA 4DINB 1PM7A 2ZZQA 1WUVA 3AKRA 3L2YA 4E2QA 2B8MA 5JWPA 2PHLA 2K0GA 1O4TA 4EN6B 1FOD2 5BNNA 3PMEA 5A33B 1PK6A 1IOAA 5K8SA 4WZCA 3WW2A 3RI9A 5CU1A 3KZ4C 1AYN1 4Y1XA 1LEMA 3MFCA 1ASJ1 2BPA2 2ZOEB 2NM1A 1UD1A 2HEVF 5BNNC 1ZRCA 1R093 4Z2WA 1ONAA 1QQP2 1R081 5CAZA 5JDBA 3MZHA 2YPJA 1KDMA 1F5FA 1IKQA 3CJIB 1WBFA 3ZFGA 1ZZCA 1QNYA 1ZBA1 1EAH2 5FAXA 1JH5A 1APNA 2D5FA 5DG1A 5KC5A 3JCIA 2XUMA 4QMAA 3VZMA 3QCWA 1DG6A 4XETA 4FPYA 3NW4A 3ZFGC 1AX0A 1RTVA 2G4IA 3ATGA 5GJ6A 3U07A 4XBLA 4HLTA 4CDWB 2A6XA 1QMJA 2O8OA 4Q1PA 5BNOB 4KWJA 3UK9A 1VRH1 3ZN6B 4FTBA 3GBGA 4IV3B 4RA0A 3QH6A 4Z82A 3GBWA 1ZBE1 4PIZA 1I9RA 1U5XA 1QXJA 2UY8A 1SBDA 3KT4A 1OPMA 3FX3A 4OHZA 4HBNA 2CGNA 2HWF2 3N35A 1HW5A 2ETEA 2D93A 4CP1A 4P9GA 4UW5A 1RUH2 5AC91 5J96B 3VKLA 3ROUA 1R1ZA 3THTA 2CAUA 1VAKA 2UYAA 1COV3 2QDNA 4J1WA 4QGNA 3TN93 3UKNA 4I3GA 2RE9A 4JDNA 5DDJ2 4XF9A 3D82A 4ONUA 4GB32 3E5QA 1ND2A 3CO2A 1AYM2 1POV3 1YJKA 3CEWA 2ZA9A 5E8AA 1AJOA 4XDQA 4YSFA 4TWTA 1MZEA 5LK7B 2PFWA 1ND2C 4KGGA 3WUCA 4FPCA 1HQNA 3WW1A 1HX6A 2IXJA 5GALA 3POYA 4LLOA 3M4FA 1U5ZA 4JTOA 3WQ0A 4Y20A 1QHDA 4AEDB 3R05A 1BYHA 1AL0G 2XBO2 2DU1A 1EAH1 3KT7A 5F6KA 2PHWA 3FWEA 5FO9B 1MS0A 4Q4W2 5EJ3A 1UPIA 4ISQA 4Y4YA 1RIRA 3R0RA 3TRSB 2Z5WA 1QJU2 1KITA 1H30A 1BEV2 1QNWA 1MS1A 1QJZA 1TEIA 2ZGRA 2BNMA 3DN7A 3DL3A 4CEWB 5JI7A 4PIYA 2A7AA 2AYHA 3AZZA 1CAXA 4AE2A 1NCQA 1QWRA 1DQ1A 2D44A 2ERFA 4BQ1A 2WS92 4E4DX 2XLGA 4XHBA 4E4ZA 3AKTA 3VBUB 2HWF1 2XLFA 4M00A 3WQ7A 1RUH1 4BA6A 1NCQC 5I8TA 1W6OB 5GLVA 1GZ9A 1LRHA 1UIKA 3AMQA 4XTPA 2BGCA 1SCRA 4PCRA 3VKNA 5BYNA 4AGRA 5A32A 1QOSA 3MDPA 3PLQA 5JIUA 4N53C 5DDJ1 1VAMA 2R042 4YM3A 1XU1A 4GB31 5KWRA 3K51A 4O9EA 1AYM1 2WFF3 3C3VA 3V0AB 2O8QA 1EV12 3B01A 4Q4X2 2D6MA 1LOCA 5GZDA 1MS8A 1MVEA 4YVWB 3WHUA 4MXWA 3ZDSA 1V9U2 5JZGA 4PF5A 1AR82 2CL2A 2JEMA 2VMGA 3SH5A 4V1PA 4EWAA 5FCCA 5JZGC 3T1MA 3OTFA 4WM7B 2ZS6B 4X8PA 4Q4W1 3JU9A 3ZVXA 3R6SA 3ES1A 1RITA 4ISRA 1HV0A 1QJU1 5T54A 1BEV1 3P3NA 2PHTA 1Z7S3 4XFHA 4DY3A 3H7JA 4BM8A 3ZFEA 3EXUA 2GDFA 1LHNA 2IXLA 2YHJA 1LHUA 4IV1A 4LO6B 3ZPYA 4M3CB 5JAXA 3MW4A 2UWBA 2GALA 2WS91 3BOWA 2BNOA 5ABJB 4AHWA 4YW2A 1SFNA 4LA2A 3VBRA 1C3HA 2GNTA 4WVMA 3NKGA 5CFDA 5JCTA 1F9KA 3KMHA 4HKWA 2C5DA 4JQRA 1PMIA 3VBRC 2JKBA 2BVVA 2R041 4LULA 1VLNA 2MEV3 4EV0A 1MR5A 4XFIA 2WLPA 2CGPA 3ZN4A 2I2SA 5CFDC 1EV11 4OHVA 4K7JA 2ET1A 3AMPA 1DLLA 4COVA 1UCXA 1REDA 3E5XA 3RWNA 3IBMA 4QD2A 1LTEA 3VDDB 1V9U1 1V70A 4GMP1 3AXEA 1OQEA 3ZXDA 1G9FA 1AR81 2YY1A 5BXXA 3TAYA 2PA7A 1LOAA 4L99A 3WW3A 2RMU2 1AXKA 1UKRA 2WT1A 3VBFA 3VL9A 2ZGMA 4INDA 3IDBB 1SLBA 4XFFA 3PNAA 3IDEA 1OQ1A 4KL1A 4OHYA 1K5MB 2XH6A 4AK3A 2Q1MA 4RR3A 1VBD2 4YW5A 1N1TA 3TOJA 3VBFC 3WD5A 1FV2A 3NKTA 2EALA 4HVQA 4P5HA 4F8AA 2P3KA 2XJRA 1GKBA 1LOGA 1KXGA 3IPVA 4RS5A 3H0OA 3I54A 4HKLA 2GC2A 1GZWA 2WWSA 1R092 4RR3C 1QDCA 2GMEA 4QPGA 5A3MA 4AVCA 4M3CE 4KU8A 4CDUA 1RVF2 3BPZA 4AHXA 1A78A 3PVBB 1IQAA 4WVVA 4RS5C 4Q4V2 3L2HA 4YRDA 4IXLA 5JSOA 2VGDA 2VULA 2N7GA 4W6XA 1FMD3 4QPGC 3DUIA 1CVNA 1CESA 2VOVA 1ZZ6A 2WC2A 4BMBA 5GM0A 4CDUC 2JG9A 1XNKA 4Y26A 2WNVB 1RUJ2 2H0BA 2JX9A 4FOWA 2W68A 5LK5A 4AG4A 4HSLA 2R071 1DZRA 1VP6A 4E27A 1EP0A 2ZGSA 1KQRA 3KB5A 4S2GA 1PVC3 3RMYA 2WKKA 2YZ4A 3MIFA 2EAKA 4XF0A 1NQJA 4QPIB 1DQ2A 3J8F3 1DZTA 2R49A 4P14A 2UWAA 1U5IA 2E63A 5CG9A 1PGSA 1PHMA 2F4PA 4HN1A 5FO7B 3WZ1A 4CDQA 4LBQA 5L73A 4KWKA 1F8VA 4DFSA 3HD8B 1HRI2 1COV2 2R6QA 4CDQC 5AVAA 3SCFA 3JQWA 3H7YA 3TN92 1GANA 3SHRA 5HBAA 4F7ZA 4N43A 1PZ7A 3O14A 1FOD3 1X82A 3VHNA 3FFQA 5J7MA 1OOPA 2G9FA 3B3QE 4JV4A 2NQYA 3RJRA 2DTWA 3GHNA 2A5ZA 3CLPA 1REFA 2YUEA 5DZFA 1R091 2GC3A 3ACLA 3APBA 2SLIA 4JTNA 1QQP3 1S0BA 1CGPA 1G6NA 3WINE 3KT1A 1ZRRA 2OUJA 3AKQA 4Q4V1 4MGIE 2BQPA 1SBFA 4BIFA 5D1IA 3USUA 1DGWA 2P17A 5F1RA 1O3SA 3BU7A 1EAH3 2B5HA 4Q26A 1RUJ1 3MEPA 4BYYA 1ULEA 3AZXA 1WLWA 2BW8A 4X6QB 4YM0A 1BMV2 3JBG2 4ORFA 3VHPA 3U4XA 2AH2A 2D5HA 3VKOA 3ILNA 4N9HA 5FQ0A 3R4UA 3ZFFA 1PIV2 3AYDA 5JOWA 1Y43B 4YNIA 3JUUA 4FPKA 2ZX0A 3X29B 1LULA 3NV4A 3USSA 3OJBA 3AKPA 1XYOA 3OBRA 1QJX2 3ZFFC 2VW1A 3QBQA 4OI1A 3ZXKA 1B35A 1RUH3 1W2UA 4YW3A 3RNSA 1LODA 1DQ0A 2OVUA 4N7IA 5DUUA 4CEYB 1C57A 2V73A 1N47A 1COV1 4Q0QA 3TN91 3GBFA 2DUPA 1B35C 4FAGA 4KG8A 5DDJ3 4LNVA 3FBYA 4AXOA 1GZCA 4ATFA 4E2GA 1QXRA 4TZDA 2XGXA 3I8TA 4PLOA 4RFT0 2WFF2 5DXDA 4H55A 2A3YA 3OYWB 2D3PA 2OPKA 5EYXA 2Z69A 5EWSA 1UN1A 4OUMA 2OYZA 3WVJA 3B00A 1MQTB 3C2UA 3LZZA 3OPZA 4YG6A 1YWKA 3NV2A 4NOTA 2VXRA 4L8QA 1WCDJ 3LKJA 2RS52 1CAVA 1NLRA 2XBO3 1WBLA 4Q2FA 2JG8B 4PDWB 4F83A 1OFNA 2O1QA 3KQRA 2XKPA 5IT6A 2ZTNA 3SLIA 2ZGOA 3M2MA 5CB7A 2I45A 2ET7A 3WG2A 4HZFA 4Y1ZA 4EWDA 5K9YA 4NO4A 1PIV1 5KXBA 1S0JA 4CDXA 3AKSA 2WA3A 1ZZBA 5L36A 4AI2A 2ZGPA 3IIAA 4BWOA 1AR73 1UF2C 5C9AA 3NAPA 5K0UB 1QJX1 2QKDA 3H1YA 4EN8B 4CDXC 4AQ2A 1NQDA 4NHLA 1BZWA 4RD7A 1SDWA 4DQAA 5J09A 5C9AC 3SCHA 1FPN3 3NAPC 4XE9A 3H50A 4HANA 2XJPA 4Y5Z0 5T55A 3LA3A 1A3KA 4FP2A 2KM2A 1RUG2 5GZFA 3QOPA 2R0HA 2MEV2 5KHHA 3O12A 1M06G 3OD4A 2WFF1 1GNHA 3HT1A 1EV13 2EXHA 4Q4X3 2OIIA 1HQWA 5F6LB 3FC0A 4AEJA 3NWKA 4XIOA 4Q1RA 4UW3A 3SCGA 3FMGA 3KCCA 2ZZJA 2EF6A 1QJY3 1IKPA 3M8LA 3VZKA 1XNCA 2DVAA 1WMEA 3LA2A 4PLNA 1WW4A 2OW4A 4LE3A 1RUNA 2DU0A 2PHDA 2E7AA 2WINB 1NCRB 4RL7A 1RHI3 2RS51 2B46X 4NWWA 4RHV2 4JRAA 3AP4A 4QQOA 1IS6A 2YXSA 2AR6A 1HQLA 2XJUA 2ZX4A 2D6KA 5JVVA 2B9UA 4KWLA 1JTZX 1Z7S1 1AXYA 2HEYF 3MLJA 1QOTA 3NVCA 3HT2A 2GH8A 1AX2A 2YGLA 1O3QA 1O3RA 4R52A 5D8AB 3RQ0A 4HSJA 2JXAA 2Q8OA 4A3XA 4I2OA 5T5OA 4OHWA 1FMD2 4B7EA 2WT0A 3ZIWA 4FXKB 2QZ2A 2RS13 4Z8BA 4CEWC 4URTA 2AZ5A 1H1AA 1DGRA 5CG8A 4KNCA 1BCXA 1GQHA 2BYVE 2I07B 1J1TA 1PVC2 2UU8A 3ILFA 4LBJA 4LBLA 5FFOC 5CFCB 1YUDA 1TMF3 1QU0A 2WLQA 2PLV2 3OBTA 3J8F2 1RUG1 4YW4A 2MEV1 1NZCA 3M7AA 4Y22A 1N3PA 3VBHA 5C8WA 3FLTA 1IPJA 5KXCA 2IZWA 2E7TA 2R30A 4XEZA 2VQ0A 2ZGUA 5SV5A 3V65A 1PNFA 1FNYA 3VBHC 4XFAA 1FX5A 1DFQA 1S0GA 4YM1A 2RMU3 3OY8B 4FPLA 4DRVA 3MPBA 3AMHA 3VBSA 5I8SA 2VECA 5H9QA 3O0VA 1WW7A 1SEFA 1PGL2 2V5YA 4RHV1 2WSVA 1H2KA 1JBCA 1VBD3 3BCWA 4GA9A 3VBSC 2IXCA 4KU7A 2D40A 2ILMA 1ENQA 4J1XA 3AZYA 4XHXA 4QQLA 5JOZA 2GNDA 3I59B 2WNUA 2W39A 4AEKA 2HEWF 1NA1B 3S7EA 3BODA 3LCPA 1Y3TA 2GZWA 1FT9A 1RVF3 3ZXAC 1U12A 4Q4V3 2PAKA 1J1LA 3WW4A 4FO9A 2LUWA 2WNUC 2FMYA 4X6RB 3ST7A 1FMD1 1HLCA 3B9IA 3MIEA 1ENSA 2XPJA 3AMMA 3A0NA 1W0OA 4AFMA 4B29A 3WDUA 1RUJ3 4L9BA 4AFDA 1OLRA 2R16A 2NMNA 4IEYA 2K2SA 1ND3A 1PVC1 1DHKB 1FATA 2XVLA 4K9SA 4OUSA 4P9IA 4B4PA 4GH4B 1JW6A 3J8F1 5BNPB 5AFBA 1ND3C