1O91A

Crystal structure of a collagen viii nc1 domain trimer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
131
structure length
131
Chain Sequence
b'EMPAFTAELTVPFPPVGAPVKFDKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPMMYTYDEYKKGFLDQASGSAVLLLRPGDQVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COLLAGEN ALPHA 1(VIII) CHAIN
publication title Crystal Structure of the Collagen Alpha1(Viii) Nc1 Trimer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 24
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o91A00
4E4SA 1XU1A 3ALQA 1RJ8A 4QQHA 4KGGA 3B93A 3V56A 1C28A 2WNVC 1D4VB 2ZJCA 4MXVA 1TNFA 1S55A 3URFA 5TSWA 2X29A 3B94A 1WCKA 2JG8C 1GR3A 2WNUC 4D7YA 2QDNA 4NN0A 1C3HA 5L19A 4G4FA 3L9JT 4MXWB 4MXWA 1O91A 4OUMA 4EN0A 1TNRA 4RSUA 1PK6B 3K48A 2Z5WA 3TYJA 2R30A 2QE3A 2RE9A 4G3YC 1JH5A 3TWIA 4HT1T 4N90A 1D0GA 3B9IA 4J6GA 1OQDA 2JG8B 2R32A 2JG9C 1A8MA 4DOUA 1KXGA 2Q1MA 4E4DX 2WNUB 3K51A 4QQ2A 3FC0A 1PK6A 1I9RA 2O0OA 4GIQA 1ALYA 2TUNA 3LKJA 4OUSA 1IQAA 2RJKA 5HBAA 1OSGA 4QQPA 2HEWF 2ZPXA 2WNVB 2OIIA 2HEVF 2WNVA 4QPYA 3MI8A 2Q8OA 5KC5A 5KWRA 3AB0A 1U5ZA 1DU3D 2AZ5A 4KGQA 2E7AA 4TSVA 3QBQA 3ME2A 5CIRA 5L36A 2JG8A 4QQLA 1XU2A 2HEYF 2WNUA 2JG9B 4OULA 2JG9A 4KG8A 2KA3A 1JTZX 1KD7A 3QD6A 4MSVA 1U5XA 3IT8A 5BNQA 2RJLA 5KC6A 4DB5A 4QQOA 4TWTA 2R6QA 1OQEA 1D2QA 1U5YA 4F3JA 2TNFA 3WD5A 1RJ7A 1DG6A 1PK6C
chains in the Genus database with same CATH superfamily
4FOWA 3KD4A 4QU1A 1S4CA 1UKGA 4E4SA 1JN2P 2RVAA 3ZN5A 4LBLA 4W6XA 3HT1A 5FQ0B 2UY9A 3KVBA 1CIYA 2ZEWA 5C8CB 2H0BA 3D4KA 4QPGA 4ATFA 3VDBA 5LW9A 3LFIA 3BODA 5J09A 4W6YA 2C6SA 1WZXA 4R9DA 2X8KA 3ASIA 1UX7A 3POFA 4LLOA 1S0BA 5BXXA 1S55A 2C26A 1H9PA 2H6BA 3EB7A 3R05A 2YC0A 1BKZA 3WW4A 2SBAA 3THTA 2PTMA 3FHIB 4AQ6A 3E97A 1IS3A 5BYNA 3CO2A 4AEKA 1MPXA 2FDGA 1AR62 2ARXA 4WBBA 1B35B 3KHBA 5DAQA 5FYVA 1V6OA 3WHTA 3EO6A 2GNMA 4A4AA 2WQ4A 1VALA 3WDUA 4XQWA 1IPSA 3ZMNA 1AR92 1HKDA 4XYXA 3FN9A 4YFWA 2GH8A 1ZREA 2XKPA 1RVF3 1U12A 2C5DA 2XLFA 3ST7A 1OF4A 4NJ4A 4H2AA 2XLAA 1F4AA 4XJZA 2VL4A 1W06A 1MZ6A 2G1MA 2YHJA 4ZZ5A 2VMCA 5E89A 3WG1A 2WS91 2VVDA 4LK7A 3VBSB 5FYUA 3USUA 4GH4A 1MS0A 5LEKA 4COVA 3AP7A 5CNAA 4OMCA 1VIWB 2G4IA 1A8MA 2J1SA 4PF5A 5FZCA 3NVCA 2FMDA 4XF3A 3RWKX 3VBRB 3N7KA 3KVAA 4F83A 3N9LA 1N1SA 3RZMA 1OD3A 4FP3A 3DYMA 2JB8A 2O14A 3J7LA 1VBB1 1YRZA 4KU8A 2VMIA 3DYOA 2XJVA 4TXWA 1AR73 4HN0A 1HXS2 1Q5OA 4OMDA 3OPWA 5FZLA 2RMU2 1O8PA 2XVKA 2ZGUA 3OY8B 3NNMA 1HRV3 2WNVB 3AJYA 3DXTA 3ES4A 3QH6A 4LPLA 3WP4A 4CEYB 3HQUA 4CEWA 1NXD1 1PVC2 1W2OA 2HKXA 1NLRA 1W8UA 5KXCA 3H1MA 4D6RA 1OA3A 1PGW1 2WQ8A 4P9GA 1ZRIA 5F37A 1GZTA 3M3CA 4XF1A 4CCJA 1S2KA 2Z42A 4A42A 2ENRA 3KB5A 2Q8CA 4BH9A 4IEXA 3LFMA 4HVRA 2B8MA 4Y5TA 3UV9A 4HL0A 4M0NA 4IW3A 4B4RA 2D6LX 2PAEA 2ZBJA 4GQ7A 5L7OB 4TTGA 3I2OA 1W2UA 5FPUA 1UL9A 5DDJ1 4XFFA 1K42A 1XB9A 5BNOB 1YQ8A 3I49A 1CAXA 4JDNA 2VQAA 3ORJA 4AI1A 1JOJA 2UURA 4NROA 1JOPA 3T0DA 1OQEA 4FOVA 4FAGA 1ZRRA 1R1A1 2E51A 5G04L 5JR7B 5FZIA 4P08A 4H14A 2FDHA 2WT1A 2JDUA 2BWCA 4YM1A 1EUUA 1YFYA 5EQUA 2MEV3 4U2AA 2VNRA 1OOPA 1OA2A 2EIDA 3O0XA 5C3QA 3VBUC 2BNMA 3MF9A 1XU1A 1JZ8A 4JZRA 5LCWL 5D8AC 2GC3A 1ZBE3 5F1RA 1EP0A 3H9AA 4GJYA 4OLLA 3VHOA 1LU2A 4PDWA 1RUH3 1XYNA 5GJ6A 2JKBA 1RUE2 1RUD3 1QJU3 3LQCA 3FBMA 4Q8KA 2VOXA 3NMBA 4PLMA 4WZFA 1Q56A 3ZIXA 2WFF3 4D3WA 4KL1A 2JDPA 2Z79A 3MPPG 3HN3A 1O4TA 4AOCA 1WCSA 4L8QA 5EJ1B 1EAH1 2WWJA 4B3NA 3UK9A 1OVSA 2PHUA 5L19A 4XJUA 4ZONA 2IC1A 5A3MA 4NMIA 2JECA 4Q4V1 4QX5A 1TME2 4TLGA 3FUQA 1DP0A 2GDFA 5FZEA 4WVMB 2VU9A 3MPBA 4XVHA 2X5IA 2VW2A 4S2DA 3ZFFB 3DV8A 1UPIA 3H8XA 4OYUA 4GB32 1A78A 1KEXA 1JS9A 2IUWA 1OF3A 3RGBA 3VBHC 3OOXA 3PUAA 1DIWA 1HQNA 2VQTA 1LHVA 1IS5A 3DN7A 1W6OB 1PO12 1PHMA 2R1BA 3MEPA 4P5YA 5A7WA 3SCFA 5FOJB 1CR7A 1CD3G 2HWE2 1Q8VA 2YY1A 3C7HA 1NA1C 4XCAA 1LOGA 4M3CE 3KM5A 1EPWA 5IFTA 4P14A 2TEPA 4R4ZA 3WNLA 1VBC2 2LROA 4IV3A 3WNXA 1RUJ3 1RHI1 2AENA 1I9RA 1RUOA 3BTAA 2DVAA 3AM2A 1B09A 4N43C 3O5SA 2BGCA 3I2FA 3JXSA 3I59B 1JYCA 2JIGA 3T4HB 1ZA4A 2HEVF 3MI8A 5JI9A 1LU1A 4QGNA 2DVDA 5A1FA 3T30A 2QQIA 5FZFA 1LHUA 3NV4A 4TSVA 4WVVA 1VBA2 2VR4A 4Z07A 3WUDA 2JICA 3BPZA 5CIRA 5C4WC 3I3MA 4YVSB 4BA6A 4GZ9A 3EYPA 4DUVA 4EWEA 1XNDA 2R0HA 5EJ3A 3S6PA 1T6BX 4DFSA 3DCQA 4LHNA 1AYN3 1CJDA 4YWAA 1UWWA 3BI3A 2W1UA 4IDZA 4EYUA 5IJRA 3ZOIA 4XMIA 4GALA 4DY5A 3I3DA 3LB9A 1DYPA 1DYOA 4HVOA 2I45A 2DVGA 2EA7A 2J22A 5E1RA 4META 4AEJA 4RR3C 5IATA 3H3UA 5DUVA 5EYYA 4Q4Y3 1K5MB 3V65A 3ZN6A 1DGRN 2RS13 3POEA 4TWTA 4BMEA 1GUIA 4ONUA 4JGZC 1ND2B 1Y9QA 1QXJA 4FPFA 2WNOA 2FMYA 1QWRA 4QX2A 1W9TA 2WJSA 3P3NA 1PGL2 3AMNA 4CDQC 4B1LA 4FO9A 3VHPA 1YFWA 3WVJA 1UMHA 2B39A 3NW4A 3ZSEA 4M0HA 2WRAA 1Z7S2 2KD7A 5LRRA 4QX8A 3WX5A 3PUQA 4QPGB 1OH3A 1AX0A 2BVBA 2PQSA 1DQ6A 1RIRA 3B93A 3IPVA 1J58A 3VBFA 4W4ZA 3G7DA 1JYTA 3N9NA 4F8AA 1JZ4A 1RINA 1QJEA 2LW8A 3I2GA 3RZHA 1XXNA 1QMJA 1A34A 4M3CB 3AYDA 3MGUA 3ACLA 3UL2A 5I91A 1HN0A 5I0DA 1HW5A 3USSA 2GC2A 5CU1A 1QJX2 2BJSA 1DZTA 3LOIA 4YGBA 2XG3A 5KR7A 2V72A 4JGYB 5FZHA 1AZDA 1DZQA 1NXMA 2W95A 5C6CA 1VP6A 4CUCA 1ZZCA 3A7QA 2GNDA 1X33A 2UYAA 1BEV1 1FMD3 1TMF2 1KDMA 4JAAA 1TNRA 1OURA 2VOWA 3KV4A 1POV1 3G6JB 3WQBA 2FCTA 4CU8A 5B4XA 3RYPA 1FV3A 1RTVA 3K2OA 3U11A 3V0BA 2C0ZA 5FBJA 2PLV2 2VE1A 3N7MA 3AJZA 1R64A 2HWF3 3B7MA 4M01A 1UOGA 1UCXA 2XL9A 2ETEA 5FZ8A 5IAVA 3JD71 1KITA 4Q4X2 2CGNA 2D6KA 4I0WB 3A23A 2IZWA 1ZRDA 1RUI2 2A75A 2JG8B 1V9U2 4JV4A 5K0UC 1QKQA 2JG9C 2BNNA 2ZMLA 2B9VA 2IVIB 4NPLA 3ATGA 1LODA 2WZR3 3POYA 3WF3A 1CJPA 3LAGA 3OB8A 4DXSA 1H2NA 1WGPA 3H1WA 3FHQA 3PMEA 5F5IA 3EHKA 1BZWA 4CDWB 2R041 1ZVFA 2D5FA 3PU3A 1W6PA 4R8HA 4EV0A 4Z8BA 1CAWA 2BQPA 2XVGA 2J1TA 3J26N 1ZBA3 2C1FA 1RMU1 5DUWA 4DXTA 4RGKA 3CEWA 1MQTB 4QPYA 4AAXA 1I6XA 2WT0A 2Y38A 3KZ4C 3ZPYA 2OZJA 5DQ0A 1DU3D 2JE8A 1QJY3 1VBD2 2ZZQA 2ZGKA 4RN5A 1RB8G 1QDCA 4LO8A 5L9VA 4NR1A 4PCRA 5ANQA 5CB7A 1NE4A 3NV3A 3P6BA 3A21A 1H1AA 3PL0A 4CRQA 1OHFA 1PZ8A 1U5IA 2AC1A 2N7GA 1RVF1 4KH9A 4RL7A 3L2YA 4OI4A 1UYYA 4QD2A 4ZU7A 3TEWA 1D7PM 1WKYA 3LIGA 5DUUA 5C3OA 5JZGA 5FZBA 1ASJ1 5EV7A 4ZS2A 5KC6A 3MLKA 3QOPA 4NHMA 5HBAA 2VNOA 3VLBB 3CJIB 1PNFA 4QQOA 2WA4A 5B2GB 3O1VA 1QOOA 1BHGA 1J3PA 4CZSA 1JZ5A 2HJIA 2QBXA 1FPN2 1RUF2 5ACA2 1NKGA 4IEVA 1AYM1 2MNGA 2YROA 1HIXA 4BQ5A 2Y0OA 2NQYA 3W59A 2YC4A 1UD1A 1LAJA 2R071 3LEMA 2ZMKA 2WAOA 3C8XA 3T0BA 1OA4A 1SCRA 3IAPA 1QY4A 3VBOB 1AR71 1ND3A 1ZA7A 2EXIA 2GNBA 4IEYA 3THDA 5I0UA 3HNBM 1XQNA 5APAA 3GBFA 4FSJA 3N35A 2A71A 4JQTA 1IKPA 4FAHA 2UU8A 1RGSA 1XJAA 2F4LA 3W5MA 4XJWA 1JMUB 2HWB2 2RS31 2WYSA 5FPAA 2LM3A 2X29A 3AMQA 5FJHA 4PBOA 3AKQA 4CCCA 1MACA 4XBQA 4IEPA 2ZGRA 2ZEYA 3OBAA 3MLJA 5F2WA 4QX7A 1NQDA 3VZNA 3CJXA 4FPYA 3TNPB 4D7SA 2DF7A 1L7LA 3ZXDA 2CGPA 1OBNA 2BFUS 3J8F3 2WS93 1GOFA 1XNBA 1TVGA 3LIHA 1C5IA 1KS4A 1UOFA 5JR2A 4COYA 3SITA 2YGMA 3K4AA 1W3XA 1GWKA 1WUVA 2W94A 3H3LA 1CONA 3OEBA 5A80A 1W8WA 3FJSA 3UNPA 4IV1C 4Z82A 2YPJA 5LATA 3H1YA 1QXPA 2GC0A 2X5IB 4JTOA 3PUSA 2VBPA 5FPZA 4ASLA 2CHHA 1VBB3 5DABA 4GKYA 3PIGA 2D3RA 1W3VA 2GSYA 1RUC1 4WV8A 4LMFA 1JH5A 1MR5A 3EJKA 3POWA 4X6RB 5HV4A 4BE3A 1TQ5A 1GOGA 2FCUA 4XPVA 5FYCA 5FYYA 1W8NA 5T5JA 2DUQA 4FQ4A 1OQDA 5CKMA 1R082 1B35A 2ES3A 3CHXA 5A3OA 2X05A 1E5RA 1UY4A 4LBOA 5FBZA 3TAYA 4O65A 1LHNA 4Y1ZA 3AL6A 5F39A 3GGLA 2GALA 4C90A 2ZGTA 4Y33A 1HRI2 4UI9L 3OGRA 1BBT1 5D21A 1R092 2RJKA 4JC1A 1ONAA 2RG4A 2VG9A 1W0NA 4A44A 4RS5C 1XYPA 4MLOA 5DDJ3 2B42B 2JDKA 2AH2A 4CCMA 3PU8A 4FVVA 2HYKA 3VBSA 4CP0A 4NHLA 1R1A3 1Y9GA 3GBGA 3GYDA 5DZEA 1IS4A 2Z4FA 4OFGA 2WZEA 3ACIA 2BUKA 3B3QE 1WMXA 3D0SA 3VBRA 3ZFEC 3OF1A 5FZ1A 3BPSA 1V0AA 2DU0A 4JX0A 4NIHA 3ZXJA 3OYWB 2FHRA 3CIHA 3NV1A 5ABJB 3N9OA 3PUHA 4Q4W2 2XKOA 2WL1A 4W8JA 1UU4A 3IT8A 1O59A 4CXXA 4NIDA 5K8SA 1RXGA 1QHDA 1CAUB 5FP8A 4I3PA 3QCWA 3CKHA 3RYKA 1FNZA 4A6OA 3U4XA 4WVWA 1UYXA 2PHLA 5FZ6A 2R6QA 4F3JA 2HLEA 4CEYA 2QDRA 2P6CA 3MIEA 3VHRA 2VZ1A 5AVPA 1LEMA 3WCSA 5D2AA 4OVEA 4AG4A 2DUOA 4OQ8A 1Y4WA 2ZOEB 2GP5A 1W05A 1COV3 2ILMA 1XE8A 4L0PA 1XE0A 1OVPA 3S7EA 4HLTA 1DGRA 1PNGA 4K1ZA 3RSJA 4YW3A 1CAVB 1UZZA 1VMHA 2CYFA 4KGGA 2WKKA 4FPLA 3AX4A 2WR9A 3VBFB 2ORZA 5L7OA 4Q4V3 3O0VA 2XHKA 3UKTA 3MZHA 5BNOA 3O1SA 5AC91 5F3CA 3B94A 2VVFA 4D94A 1EY2A 3BU0A 2W2IA 3ZFGC 5DUXA 1GNYA 1V6IA 2VZRA 1UMZA 4MO3M 5C5TA 1F31A 4BMBA 1RITA 2BTVC 3MLLA 4D7YA 4OI1A 3O1MA 4PI0A 1GMMA 3VKLA 2E63A 4XFGA 2Y8KA 1OQ1A 2W91A 4LXLA 3O1RA 1S0DA 2YBSA 3L9JT 2ZX4A 1UY3A 4A7KA 5F3IA 5LASA 5FMCA 4MG2A 2YFUA 1VB2A 2IXCA 1W99A 5IHRA 4MOAA 3GZEA 3WG3A 1X82A 3GZTB 1K45A 1ULGA 5LA0A 4Q4Y1 1YC61 2YV8A 4YW6A 1VBE3 2ZHKA 1BYHA 4YGEA 1M06G 3FX3A 1BVP1 2W0XA 3KWVA 5J98B 4Y26A 1LEDA 2R30A 1TZOA 2V09A 3K3NA 1NCQC 1NCRC 2RE9A 4XAEA 1O4YA 2FZ1A 1PGSA 1V70A 4GJZA 3ETPA 1N1VA 5KBFA 2ADDA 4INDA 3C3VA 5C8CC 1D0GA 3I2KA 3WQ1A 4CDUB 1QXRA 1H2MA 2ARAA 2VY0A 2ZGNA 3FMGA 1MVEA 3WDWA 4YZ4A 5H9RA 2WNUB 1F4HA 3NJXA 5A32B 4P5HA 1H0BA 2JKXA 2B5HA 5L73A 1AJKA 3NAPB 3SEEA 3VZJA 1UAIA 3JQWA 3RNSA 4EROA 4Z1VA 4Q0VA 3O1TA 4M4RA 4WM7C 2D6OX 3ON7A 2GU9A 5DAPA 1WCDJ 3UGFA 3CF6E 5ANNA 5FOBB 1FYUA 2ARBA 1BVVA 5A3TA 4BQ4A 2AZ5A 5FP4A 5G05L 2E7AA 2HWD1 1WLCA 3WT3A 5H9QA 4ZHNA 2I07B 2WA3A 1W6OA 4NPMA 1FMD1 4AVTA 5JAXA 3HD8B 1G6NA 4LR4A 2WO3A 4AXOA 1GQHA 5FUNA 2BU9A 1EUTA 4NIAA 2GMPA 3SISA 1X9PA 4XACA 4AEDB 4LKEA 1XC6A 4LKFA 3LA7A 3ZYRA 2I74A 1CGPA 2HYXA 3O0WA 3QACA 1J3RA 4FFFA 2HWF1 3OBRA 3I2HA 4LNVA 1RUG1 2L9LA 4IETA 4RGGA 5FKCA 5FY4A 4BQXA 4K8FA 4KNCA 3POIA 3RMXA 3LZZA 3RI8A 1FX5A 1O3TA 3UJQA 3I59A 4XQ4A 5FY7A 2E26A 5C3RA 2RDRA 2XOMA 4QT6A 2A6VA 3S57A 1ENSA 2QFEA 4CTEA 1DYKA 1SG3A 1UNBA 1SBEA 1V00A 3WY6A 5J3UA 3RZJA 3D3AA 4H3WA 3K75B 4P02B 1EAH2 4XUOA 2A6YA 3LOBA 3F95A 2EVXA 3A22A 2LTNA 3LPFA 4YVSA 4B4PA 2P5BA 2HH9A 4FP2A 2BERA 4V2WA 4BB3A 4NWVA 4QQHA 2B9UA 4UFIA 3VD4A 1ZBA1 2XUMA 1IOAA 4AGVA 5A70A 2WNVC 4BIFA 2IXLA 5FZ3A 2UWAA 1BEV3 5HV0A 2ZX3A 4QB1A 3ZKYA 4GWJA 5A6XA 1WD3A 2DCZA 2OPKA 4NHYA 4YVWB 3ZXGA 5I93A 1K5MA 5H9SA 1W6QB 5AVAA 3GZUC 1FAYA 1LKNA 4Y1VA 3SC7X 5CBLA 3VKMA 1BMV1 5JXIA 4XTMA 3AC0A 1NX9A 1VAKA 5CG9A 1WMFA 3JD73 4LA2A 2P3KA 2V4AA 4DRVA 4S2GA 4YNIA 4EN8B 4OUMA 2VUDA 4F7ZA 1C57A 2XJQA 3T2OA 4HK9A 2WBKA 3AKTA 2PQQA 4QMAA 1O4ZA 2DDUA 3VBUA 1UXXX 4JKKA 1XNKA 2A3WA 5IUQA 5A7OA 4YGCA 5FKBA 5BUVA 1YO8A 3H8RA 1RHI2 2QNKA 1PIV2 2R043 4JDOA 3FBYA 3NL1A 5T5PA 3MW3A 1OLME 1MS9A 4S2FA 4J1WA 1S2BA 3MW4A 3E5UA 4M3CA 1DQ2A 4CP2A 1RMU3 2BW8A 2R062 4TZDA 5T3NA 4WZCA 4FPHA 4PLOA 1W2TA 1C1LA 1CX4A 1ZM1A 5EIYB 4K8RB 3Q8AA 4JGYA 3N7LA 2DFCA 2LS6A 3ZKUA 4E4DX 1JHNA 1W2AX 3ZM8A 1JYWA 3KHCA 3AFGA 1CWPA 2EF6A 3BVCA 4XFAA 2CNAA 2EIEA 3MFAA 5EJZB 4A6SA 1H1MA 2JE7A 5F8PA 5FXWA 3WCRA 3RMYA 3TN91 4KG0A 1SLIA 4GIQA 5CG8A 3IZOA 5T5OA 1IQAA 3J7HA 2PAMA 5KXDA 2RS52 4IEZA 5FXXA 2QZ3A 2RDQA 1FATA 4OHXA 1S2EA 1W0OA 1ASJ3 3MIGA 2FDIA 1DBNA 3ITQA 3J8F1 2C4XA 4M3CF 1UIJA 1VE0A 4Z92B 1HDKA 2JG8A 3LWCA 4Y1YA 4AHXA 4FBFA 3Q8FA 1GFF2 4O9GA 1AYM3 1NZIA 4QHBA 3LF7A 1OLRA 1Q8PA 2WWUA 5FTTC 1JTZX 2R073 3LE0A 3R0RA 5FFOC 4CDWA 5DZGA 4FFIA 3LEKA 3WG4A 3JBG2 2ZEZA 5FZAA 3TRSB 2XJSA 5C7GA 4XDOA 4OZXA 5BPXA 1LCLA 2V4VA 1GZWA 1UY0A 4JHTA 3RQ0A 1KGYA 1WA6X 3VDAA 1H2KA 1QH7A 2MPFA 2H6CA 1AR82 2ADEA 1MQTA 1W28A 2Y64A 4QDQA 1L7RA 2RS33 2VZPA 4N9HA 2RHPA 4LHKA 3PMSA 5GKAC 1N47A 3AXDA 2ZGOA 1DG6A 3BN6A 4N7UA 1MS3A 4C8DA 1AL22 5FREA 3WW1A 5FWJA 2D6PA 4GMP0 5CKQA 4AGRA 1RJ8A 4RHV2 5C4WA 4LQRA 1ENRA 1PM4A 4KI5M 3A0NA 4DUWA 1UYPA 3SXWA 4LO4B 3KF5A 2RDSA 2DVFA 4GWNA 4PIXA 2RM21 2ZCWA 4FTEA 3V0AB 1I3HA 1ZZ8A 2A3XA 4L11A 3CJIA 3RZLA 3BOWA 1VMFA 1W39A 3POJA 3B69A 2W3JA 2JDMA 3SKJE 2XDVA 4CDXB 4HG6B 3AKSA 1COV2 1RUC3 4KWUA 1AXZA 1C3HA 4WM8B 4RQPB 3PUIA 5CFCB 5IWFA 3LEGA 2JDYA 1PZ9A 5A3NA 2WYFA 1IPKA 4CXYA 3VBOA 1PK6B 3AKRA 2FDJA 1WMEA 3RYRA 4R9AA 2QQPA 2EXKA 3MW2A 4QPIC 3POSA 3LGRA 4NVPA 4FPGA 3I7DA 5IVYA 3ELNA 2VZ3A 2Z69A 2ZKNA 4AYUA 3M3EA 4YG3A 1UU5A 4IQPA 4P9YA 3UESA 2CDPA 2K2SA 2P3IA 1VR3A 1BBT3 2VUAA 2W87A 3I3BA 1HB4A 2VMGA 5FZGA 4N90A 1DGWA 1H30A 3ZIWA 2IXKA 5FP7A 5LY2A 4DZGA 2HWC3 3JCIA 2XLGA 4C0BA 3T4VA 4XQDA 2A6WA 1PX3A 5FUPA 2Q1ZB 1YLLA 2Q1MA 2UYBA 4LT5A 3ENRA 2W5FA 5GZDA 4CXWA 4JHZA 3WNMA 3GCXA 3FFQA 2KR2A 5F2SA 1RC6A 3FL7A 4UW3A 2VNVA 3DKWA 4ZZ8A 5LY1A 4OUSA 1STMA 4Q27A 3LA3A 2WZPP 2GNTA 4DMIA 1O5LA 1E5HA 1SHWB 1GOHA 3OSDA 1OMIA 4Y20A 4OQ9A 4AFBA 5GLWA 4PBPA 4Y4RA 1I5PA 1WA4A 3VZKA 3H8UA 4OI0A 3RPQA 1PMHX 5GALA 4CCNA 2WNEA 2JJ6A 3KF3A 3HIFA 4ZKTB 4CU7A 5LA2A 2P1BA 1S0IA 4QKFA 3HR9A 3ZXKA 2B46X 5K0UA 2ATFA 1VBE1 2JG9A 4KG8A 4OULA 4FOYA 2DTYA 3WF1A 1AR72 3QD6A 2Y6JA 1GSLA 2P6HA 4QX3A 4S2HA 5FO7B 4OHYA 1D2SA 1JYXA 4XUPA 2PLV3 5L9BA 3SKVA 4GH4C 1HRV2 5LZ6A 5F6KA 2FCVA 2OXBA 3ROUA 4AW7A 3BKZA 4DIQA 4K9SA 1NY72 1VRH3 3T08A 4AEMA 2PMWB 4NIIA 2WUHA 4QHOA 4QXBA 4YW5A 5AC93 4K20A 2CU5A 1DFQA 2DWRA 2WZ8A 4CCEA 5GLVA 1UU6A 1UZWA 1QNWA 5BNNC 4CU6A 1X8MA 1LHOA 4N9IA 3CDZB 4NRQA 2WLPA 2ZAHA 4XDQA 3T2QA 3ALQA 3O12A 2W52A 4HZFA 2VCAA 5EPAA 3OYWA 5ABJA 3C7GA 1O7FA 3H7YA 3KMHA 4N53C 1KRIA 2VMHA 4CEWC 2JDAA 2PN5A 2FDKA 3W21A 2K9ZA 3L2HA 1CAUA 3ZSJA 2DCYA 4B7KA 2G9ZA 2K0GA 2DU1A 3EQEA 3M70A 4MX3A 5DZFA 2QQLA 4QGLA 3WDVA 1WMDA 2VGDA 2MEV2 1KQRA 3CL1A 1KJRA 4LHSA 1C1FA 1SLAA 3O1UA 1AR91 1UY2A 4MXWA 1AHSA 1LGCA 5F5QA 1AXYA 2CAUA 4YM3A 1ZBE2 2W08A 5CFDC 2QCSB 1CAVA 1RUH2 3A0KA 2BOJA 5LBCA 3AK0A 3VBUB 2WFPA 1O8SA 1RUD2 2WN2A 3GJAA 3R4SA 1QJU2 3DYPA 3MIBA 4PI2A 5D8AB 2WFF2 4K40A 3U1XA 2F4PA 3RZGA 3OPTA 1JU3A 5T50A 2WQZC 4P9XA 1WW7A 2QE3A 4B29A 4EZ4A 4PJYA 4EN6B 5IYYA 1OOPC 4XFBA 4HT1T 4XC9A 2EXJA 4Y22B 3KS7A 5FK8A 3MF6A 1O5UA 3KCYA 1X8EA 4GXLA 5F5CA 2Q8EA 2ZABA 4PDWC 3WUCA 3KLSA 4LBQB 5FY1A 1KXGA 4QU2A 2HWD3 3RI9A 4ASMB 1D4M2 3IDCB 5FZDA 1JZ6A 5A33B 1HXS1 5FDBA 2WT2A 4XTPA 2RMU1 4Y5SA 4IEUA 2ZHLA 3HVDA 5GZEA 4ORFA 1ALYA 3W5NA 2EIGA 3RZKA 2D98A 1QGLA 3PHMA 3MIHA 1G9CA 5C3SA 1YXWA 1PVC1 4IV1A 4HXCA 1RUG3 4QKNA 4YZ3A 5FAXA 5GLUA 5GZGA 2ZKLA 3WHUA 3KCXA 4J1XA 3VBHB 5I8TA 5K9YA 2ZGQA 1US2A 1H4GA 3LEIA 5DN2A 1JI6A 1G86A 1QF3A 3KGLA 4B7EA 4CCOA 4CDUA 4YW4A 5IK8A 4AWDA 5CISA 3J7NA 2YZ4A 1PMIA 3SQOA 4MH0E 2WNUA 1V6MA 1RUJ2 3MFCA 2D40A 3KT7A 5I8SA 5A32A 2OT7A 2KA3A 3HEIA 1JZ2A 1LOEA 4MSVA 1NA1B 4FFGA 3NAPA 2VM9A 1MEC3 5SV8A 2QQKA 2PHTA 1OPOA 3KV9A 4URTA 1C5HA 1HB1A 5FUIA 3K77A 4Q5OA 2BYVE 1GZWB 3ILNA 1YQCA 4LUKA 4IE0A 4BQYA 3HWJA 3FE5A 5FY0A 3VKFC 3GHNA 4IL7A 1LR5A 3U07A 2OKXA 4N43B 3WDTA 4BWOA 1IQDC 2VAUA 4KBBA 3RFRA 4RS5A 3WD5A 4Q26A 3VD7A 4IV3C 2EXHA 4ISRA 1JYNA 3ZXAC 4ZS3A 3OGSA 3NKGA 5C9AC 4IE7A 1AYN2 1KS5A 4AEDA 2AGSA 5C4WB 2D6MA 3RJ2X 2XWJB 1C8M3 4XABA 1RUE1 4XF4A 4EN7B 4DUXA 4Y5Z0 1C28A 1E57A 5FPLA 2VMFA 2NYYA 2BDRA 3HNMA 2JDHA 3KSCA 2W92A 4XCBA 3PTYA 4D8MA 2RS12 1FNYA 1G9FA 2VBBA 3WINE 4XF0A 4HKLA 4P00B 1AVBA 3U14A 4I01A 2YG0A 4RR3B 4CUGA 1F8VA 4V2VA 3TOJA 5JXJA 4AVVA 3CNAA 1W0PA 3C7EA 1WLDA 2AYHA 4JGZB 3VZOA 4EZHA 1TME1 4G4FA 4BPZA 1ODMA 1Q3EA 1QOTA 5LBBA 4B8EA 3SH5A 4PHZA 4Q1RA 4CDQB 2DCJA 1ULPA 2J1UA 1NOVA 3UYJA 2VZVA 3WF2A 5JOZA 3VZLA 5IVCA 1N1YA 4GB31 1ODNA 2AEYA 3T3YA 4IE4A 2ZACA 4E27A 2YGLA 1UY1A 3TYJA 2QTWB 2JB4A 5DAXA 3TN93 2YU2A 3J4UH 4D6SA 4YVWA 1PO11 2R1DA 3NSTA 3N4MA 3TWIA 1W6QA 5A3PA 1O6UA 2LALA 4AI3A 3BALA 1F9KA 1MZFA 1UYZA 2W1QA 5EFUA 1UIKA 3ZFGA 5HCHA 5FPXA 5T54A 1IG0A 5F6LB 1FMD2 1YQ6A 2VBDA 1VBC1 3ZDSA 4AQ2A 1UO9A 1H6XA 2QQJA 4QX1A 2ET7A 1YI7A 4CU9A 1W6NB 2VULA 4BYYA 5FO8B 4C1WA 4CP1A 2JEMA 4AFDA 1JOBA 2W1SA 3I2DA 1JUHA 2HWF2 1REDA 4UFMA 3KV5A 1S0GA 4Y20B 3D6EA 3C7OA 5LBEA 4BJ0A 4Z2AA 2Q8OA 3A4UA 3APBA 1HLCA 1VBA1 3HMYA 5JI7A 5KWRA 1U5ZA 5C33A 1DGLA 1NCQA 1NCRA 2BZDA 4ZXKA 3IKWA 3THCA 2WZR2 1G9DA 1L7QA 3KGZA 3WNNA 2CV6A 5A6QA 3IN9A 2I2SA 4HSLA 4H7MA 3DGTA 1QDOA 1H8TC 5CAZA 2A70A 5K0UB 4IUGA 2JG9B 1UX6A 1GQPA 2XMLA 3RZZA 1QEXA 1KD7A 1HJFA 3E6DA 4FT8A 4KQ7A 3GM8A 1ZBA2 4DXRA 1EV13 3SCGA 1YI9A 4ES9A 1W8FA 3IBMA 2V5YA 3VKOA 3ZXFA 5IK4A 2VCBA 4MV2A 3EBRA 4X8NA 3N9PA 2GAUA 2J42A 4XEZA 2OYZA 1LULA 2OA2A 1IS6A 2W46A 1QJY2 1FOD3 2HWC1 2IFWA 2VZOA 1PGL1 2RM23 3VB9A 2XONA 1N3PA 4ISQA 5FO9B 4FPJA 4MYEA 3N9MA 2TNFA 3OCPA 3NNJA 2BGPA 2XBO3 2AEZA 4GD4A 4MGZE 2VUJA 3AMHA 1GP6A 3DPRC 2W39A 5JSRA 3P1IA 3T2TA 3ZYGA 4R4XA 3WP3A 2WO7A 1H2LA 1OC1A 5FZOB 1FV2A 4MGIE 3N3HA 3VD9A 3UGGA 4XHXA 4MGQA 3EMRA 3VDDC 4LJHA 5FR3A 4XE9A 1PMJX 5J7MA 5T52A 4E2SA 3IAQA 5CYYA 1QJX1 1Y9MA 4NWWA 3PURA 1LB2A 4LO6B 1QH6A 4FTBA 3AP6A 3HAGA 3MO4A 5EWSA 4LBQD 2VW0A 5F32A 2H0VA 4MHRA 1HQWA 1JXNA 1LGNA 4W50A 5JZGC 3AVRA 1TMF1 4MXWB 2NLRA 2XH6A 1UN1A 1CPNA 2OS2A 4LIVA 5A7SA 4YW2A 2Q5TA 1OLMA 3INAA 4GA9A 4OZOA 4COZA 1JW6A 1SLTA 1R1ZA 2A7AA 1OXCA 2PLV1 2WO2A 2VQUA 4NHKA 3THPA 1VPHA 3IWZA 1MS4A 1VRH1 4CCLA 2ZGMA 3BB6A 5A7PA 5JMCA 4HMZA 1Y43B 2D93A 2YYOA 4Q4X1 4H55A 2BP6A 3BCWA 4Q1PA 4XOGA 4P9LA 3V0AA 5BNPC 1RUI1 3RS6A 1V9U1 4OCTA 5FP3A 1LOFC 1ND3C 1Y3TA 3CQOA 3HJRA 2CAVA 4FPEA 1Y7BA 4CDXA 4YZ5A 2BVVA 2WS92 3UGHA 1RL3A 1PO23 4WM8A 2XL7A 4ITCA 4NUBA 4RQPA 2A1XA 1PVXA 5CFCA 2VH9A 1SMVA 1LJ7A 1NG0A 3K46A 2Q4SA 2RR13 4J25A 1PK6A 1QQP3 5CADA 5IFPA 2P37A 3MIDA 2O0OA 4LK6A 1GBGA 4EE2A 4LA3A 1UMIA 1VBB2 2A5ZA 1LNSA 1LTEA 2E6VA 3GHMA 2ZGLA 4HBNA 5I0RA 2A73B 3B9CA 4IV1B 2EAKA 4NRPA 4R9CA 5EYXA 5FPVA 4CUBA 4YG0A 3TB0A 1VBD1 3IDAA 5KHKA 1ENXA 5JPNB 4BQWA 2DVBA 3N7JA 4ZU5A 4AZZA 2JIJA 2QVSB 4K6BA 5K7PA 3QBQA 1A6CA 3PJYA 1KJLA 1HB2A 4Z2WA 2D43A 1US3A 4MGTA 1PGW2 2J1AA 4QAWA 4GMP3 2XXZA 2JX9A 3JU9A 4E8CA 4BDVB 3OUIA 5LK5A 2E53A 4BIOA 5IVFA 4OHZA 4MGYE 4JDMA 1JYIA 3V64A 4AI8A 4PIZA 4Q0PA 1ULDA 5DDJ2 3M4FA 1AJOA 1FPN1 1RUF1 4QKDA 4QXHA 1B35C 1EPZA 1WLTA 2BFUL 3ZYPA 4AI0A 4LBNA 4RD7A 1R1A2 4LE4A 4RS5B 3CZJA 4K3UA 3B01A 4LOSA 1AR63 4I0AA 5HXVA 3ES1A 1DQ0A 1L3JA 2LRPA 4YW1A 2PYTA 3ACHA 5FZMA 3ACFA 2J1VA 4AAPA 3DEMA 1ULCA 1AR93 4I3GA 4XFIA 1ZYBA 1CN1A 3ZFEB 1UPSA 2X09A 4COUA 3AVSA 3PNAA 3POGA 3I3QA 3NNGA 1HN1A 2ZJCA 4YPJA 3PJQA 4QDRA 3VBSC 5FLJA 3WXPA 3WW2A 3BTXA 5TSWA 2DFBA 3FUOA 1SPPA 5A3UA 3LCPA 2Y0IA 3PTRB 2O1QA 2NN8A 5JWPA 2XUEA 1GYKA 3VBRC 1J1TA 2FD8A 3CBNA 1APNA 1LESA 2XPJA 3M3OA 3NNFA 4H7LA 2QDNA 4P9JA 3WW3A 2E7QA 2XHNA 5GZCA 3SNMA 2ZXQA 5LB6A 2P3JA 2D3PA 1MEC1 4EN0A 1X7NA 2VTFA 2HBTA 1LOCA 3E6BA 3K48A 4BISA 2E7TA 5JOXA 3I3EA 5JOYA 3BOPA 3GALA 1DGWX 2CL2A 4KU7A 1XRUA 4Q4V2 3VL8A 4XUQA 3WOGA 3JBG3 4UFHA 4AF9A 4CEYC 4BCUA 2X53S 5JIUA 5KXBA 1HXS3 2VZUA 3H7JA 5J36A 1I5ZA 2RMU3 1POQA 2Y6GA 4LKDA 4I2OA 2E33A 4GKXA 5LRSA 3AZVA 4OI2A 4TLFA 1A8DA 5KHIA 3PLQA 1AXKA 2KXLA 4OHVA 1R081 2E31A 4CA9A 4MVTA 1PVC3 1T6GC 2Y34A 3W9AA 4FFHA 3ZFGB 4Y1XA 5L7OC 4DOUA 1C8M1 4AHYA 3B02A 2CSGA 1HRI1 1J3QA 1V6LA 1NUKA 4E2GA 5BNOC 3FC0A 4W65A 2VZTA 4I0BA 1F5FA 1R091 5FIXA 2EICA 4XAAA 4XW3A 5GLZA 3WZ1A 4KWJA 3X29B 3AXEA 4JKMA 1BJQA 4FXGB 4OUEA 2ZA9A 5D8AA 4UYBA 2HEWF 5HCFA 1VB4A 1OUSA 4LUMA 4QPIA 1X50A 3T2PA 5CA6A 4UT5A 3ZYJB 3GBWA 1MS8A 5IK7A 3JUUA 1DZRA 1GV9A 4IE5A 3UKNA 1NCQB 1NCRB 4Y22A 2W68A 1ZZ9A 3U10A 2PHDA 1H8VA 5LA1A 2LUWA 4UAPA 1ENQA 3VL9A 1S0CA 3JZVA 3PVBB 4LBQA 4Q4W1 3VD3A 4HPKB 3ZLIA 4ZPIA 1SFNA 3IMMA 2VVEA 3AP9A 5A33A 5A3LA 1Q8OA 4LBMA 1UW8A 3DUIA 1W90A 5FMOL 1U5XA 1MVQA 3FZ3A 5EXOA 1ZZ6A 5DXDA 4CCDA 1RUE3 3SCHA 3E5XA 4ARYA 2AR6A 4Q0UA 3E6CC 4BHPA 3FLTA 3AZXA 3MBWA 3MUY1 3DL3A 4QM8A 4WM7B 4QB2A 3ZVXA 3H0OA 4QKBA 3PVOA 4FQZA 2VOTA 2O8OA 4QDSA 3VBHA 1HQLA 1JHJA 5A1LA 5M0TA 2WO1A 5I0TA 3M7AA 1TE1B 3MYXA 5FYIA 2VW1A 1RYYA 3DXUA 4XJ8A 3ZFFC 3ZPOA 4AI2A 1H6YA 3SEPA 5HCAA 5JCTA 1TME3 2R16A 4DNYA 5A6ZA 5JDBA 5FJKA 2VTXJ 1NA1A 1JU4A 5J1XA 2DV9A 3LA2A 3U4SA 2EIBA 3FFZA 4MXVA 4GULA 2CY6A 2WN3A 3NJZA 4GB33 1WCKA 1IKQA 1XPWA 1J1LA 2NMOA 4GWMA 4IGOA 5FYSA 4CP9A 4UBGA 4N43A 4I02A 1WW5A 4M00A 3M3QA 3DECA 4XFCA 1PO13 4DQAA 5DMYA 3AFKA 1KDKA 3WP5A 2ZGSA 5E88A 1CQ9A 4CUAA 4E2QA 1IPJA 2HWE3 3NV2A 2WC2A 1G7YA 5AFBA 1CZTA 1S0JA 1EV11 4UFKA 2ZX0A 3NKTA 5BNNA 5IVBA 3JB8A 2MHFA 4YW7A 1BEV2 5HCBA 4D69A 1VBC3 2WWSA 3B5LB 3S5AA 4M4PA 4A3ZA 2PXJA 1ZX5A 2IFRA 3LSEA 2JE9A 1FOD1 2CWMA 4E8DA 3LDKA 3SHRA 4N53A 3K4DA 4ZY9A 2OQ6A 1N1TA 1UQXA 3NO8A 2XBO1 4YVSC 2CDOA 5GLTA 4HOOA 3ZYHA 4RR3A 4QGMA 3JD72 2ZX1A 4MUVA 1DDLA 2ET1A 2OPWA 1GANA 2R32A 1VBA3 3NRUA 4JGZA 3BGAA 3WSOA 3S7IA 1A3KA 1CZSA 4NE9A 4K21A 4BLIA 3O7OA 4MGSA 3IDEA 4UW6A 2W47A 3T1LA 4MZUA 1N3OA 4CDQA 2ORXA 1K5MC 5FRAA 2VXRA 3S30A 4NIGA 1W8TA 2GN7A 2R042 4FPCA 1Q43A 1ND2C 4XUNA 4YGDA 5CFDA 4E4HA 3VUOA 5ISLA 3KQ4B 3MV01 2Y6KA 4YARA 4XXPA 1YYNA 2ZPXA 5FMBA 3WDXA 3N36A 3HNYM 1RMU2 2SLIA 1LGBA 2DCTA 2YMZA 2DCKA 3K4ZA 1WCQA 1XNAA 4QPGC 5LEJA 1AX1A 1YEWA 3ZR6A 2P4EA 1Q8SA 1X36A 4HONA 1WW6A 4D0QA 2TBVA 2J1RA 2PHXA 2VNGA 1Z7S3 1LRHA 5F3GA 1WBLA 4LORA 3WQ0A 2BOIA 1W6NA 1RVF2 2OX0A 4URAA 1I1EA 2QZ2A 1F15A 2RJLA 2ZAAA 4GAZA 2VMEA 1UZYA 2JXAA 2GMEA 2O8QA 4BK4A 1CVNA 3ZO0B 4EJRA 1ASJ2 1REFA 4PT6A 5FCCA 3AMPA 1Q8QA 1D2QA 1YCIA 4NO4A 4AI9A 4JGYC 4A41A 1PO21 3OBTA 5E16A 4DS0A 5I8YA 1LOAA 1SFPA 1S0EA 1YWKA 3NNLA 1QJX3 1HX6A 5KHGA 1UOBA 1CIWA 1AYM2 2RR11 2XJPA 1J84A 1QQP1 3WR0A 1XYOA 3J7MA 1D4M3 2R072 3LSDA 1FXZA 1W03A 2VXJA 3I2IA 1TMF3 1LHWA 1IGOA 2Q30A 3M2MA 4AFAA 4Q2FA 2FBEA 2G9FA 2A3YA 1W6MB 3JB4C 3Q9OA 4Q29A 3OGGA 1UZ0A 1POV0 5DAVA 5EP9A 3WDYA 4CYDA 3URFA 3OD0A 4YZ2A 1SPPB 1V6JA 1YJKA 2JG8C 4BK5A 2RS32 1K5JA 2YXSA 4Q4X3 2ZGPA 1YIPA 3ZSKA 1O3QA 1SLBA 1H9WA 3TEXA 2R0FA 4Y1UA 4NN0A 1GNHA 1RUI3 1U0AA 4GMP1 5FZ9A 4YM2A 4CDWC 1V9U3 4XJAA 2BBVA 5F9TA 3OPZA 2V73A 1XNTA 1C8NA 3N9QA 4HVQA 3IDBB 2EALA 4HK8A 3VZMA 4CE8A 2F6BA 3KQRA 1BXHA 3JQXA 1PIV1 5FZOA 5C9AA 5DAWA 1MQTC 2J7MA 3H42B 5IW0A 5HXMA 1LOBA 5A6YA 4C0HA 4O9EA 5C3PA 3BU7A 4XIKA 1GZ9A 4DY3A 2WIIB 1ACCA 4G3YC 2F17A 2R061 1SLLA 4XURA 1AR61 2GZWA 3DKQA 5FY8A 4DXZA 2PHFA 4C91A 4HN1A 4BQ3A 1RUC2 4U36A 4L2NA 1GLHA 4PQQA 2K46A 2W9XA 4ES8A 1OUXA 1VBD3 2D6NA 2ZMNA 5FY9A 5LBFA 2QQOA 2D3SA 1NT0A 4NOTA 4EQVA 5C71A 1PZ7A 1J83A 1W04A 2PHWA 2XR4A 3Q8BA 5CZKA 1JZ3A 1OH4A 2P34A 4FPKA 2Q1FA 3RWNA 1WW4A 4QX0A 4DEVA 2D7FA 2GH2A 3CJIC 5KXEA 2VCMA 2RS51 2TUNA 4EWDA 4ARXA 3FHAA 4FPOB 4UF0B 3VD5A 4LTAA 4QQPA 1ZRFA 4QPIB 1BBT2 4X6QB 4XMAA 1IHMA 1VLNA 2W1WA 3PVEA 5FYBA 4HFSA 2Y60A 3AB0A 2C9KA 1V6KA 3NJVA 5H9PA 3IIIA 2AREA 1SDDB 2HWC2 1VJ2A 4LOTA 4QPWA 1FPN3 1RUF3 2YB7A 1DLCA 5FXZA 5FYTA 3VBOC 5ACA3 5JSOA 1OFNA 3ZSMA 1CX1A 4AL9A 1LECA 2IVJA 2BNOA 1OKOA 5LK7B 3PIJA 4KWKA 2OUJA 3ECQA 4RGAA 3JBG1 3W58A 2JDZA 4FXKB 2BWAA 1W8OA 1SCSA 1T2XA 5BNQA 2VQ0A 2QUOA 3F2ZA 1AR81 4NRMA 2VZSA 4QM9A 1TEIA 3VN4A 1WWYA 4Y3OA 2ZX2A 2HWB3 4LEJA 3MICA 1U5YA 1O3SA 1F2NA 2ZTNA 2QQMA 4OHWA 3HQXA 2OVUA 2FDFA 2OW4A 3PVNA 3Q8CA 4JRLA 1Z0HA 5FYHA 4IEWA 4LLFA 5C5UA 1KFXL 1K12A 4UWDA 3BUCA 4AHZA 3NJYA 1AL21 3TEZA 1RJ7A 2B4KA 5JPMB 4AQTA 2ID4A 3AL5A 4RHV1 3BIWE 2RJ2A 3MUZ1 2ZZJA 3EXUA 5FZKA 5JXGA 5FXVA 2IXJA 2X5IC 5A1AA 4AHWA 3KV6A 2R7EB 5A7QA 3V56A 2VOVA 2DUPA 2WDBA 4LBKA 4QXCA 1NE6A 4ZU4A 3HPNA 1H8TA 3OTFA 4JQRA 4XZPA 1GZCA 1ULOA 2ARCA 5LWBA 1OD5A 1VRH2 3HBZA 2WINB 1MZEA 2PFWA 4PIYA 2JWPA 5L9RA 4C1XA 1COV1 5AC92 1GICA 3USUB 4CP9B 2QQNA 3AP5A 4GH4B 4AE2A 1SEFA 4LULA 1YQ2A 3CMGA 5JMOA 5CVRA 1FI2A 4L9BA 3D82A 4JKLA 3ZR5A 3BIEA 1O91A 4IE6A 1R083 3ABZA 5B4NA 3OBZA 2VPVA 4FI9A 4A2UA 3R4UA 5C70A 1NZCA 1Z78A 5BNNB 1YIFA 1J59A 4LKSA 1QNYA 4RFRB 1GP5A 3MHZA 1OLQA 2VJXA 3PDQA 3AYEA 1HRI3 2C24A 3DPRA 4Q8LA 2ZEXA 5GZFA 3ZFEA 5KHJA 2YBKA 4YSFA 3QLQA 4Q4Y2 1W9SA 3CLPA 1R093 4N53B 2E9QA 2P3YA 1NLQA 2DBNA 4JCKA 3ZXEA 4AK3A 3I2JA 4CEWB 1ULFA 2UWBA 3J9SA 1S1AA 4B4QA 1JBCA 3VDDA 1C4RA 2WSVA 3AKPA 3NWKA 1DHKB 1ST8A 1QOSA 5IAXA 3GNEA 1M4WA 4ET7A 5EZWA 1XOYA 3H8OA 3RJRA 5ABJC 3S0MA 2PAKA 1F5JA 5FMDA 4IERA 3W20A 3R6SA 3ZYIB 1V6NA 5KHHA 3K51A 2X10A 4FOQA 1VMJA 4QB6A 2A6XA 4XJ9A 3WF4A 2B45X 3H3ZA 4XFHA 3R4DB 2XQXA 4Q4W3 4YZ1A 3I54A 4IESA 3O14A 1CAXB 5FZ0A 5CFDB 2DBIA 3D0JA 3I8TA 3LD8A 1OSGA 1MZ5A 4AFCA 3E1F1 4IEOA 2WAAA 4KGQA 4NPRA 5CKNA 1CZVA 5ERLA 2HWE1 3POBA 3Q8EA 5BNPA 1OOPB 1BLZA 1QU0A 2IXIA 5L36A 4QQLA 2HWD2 3OEAA 3IIAA 1AUYA 3IM0A 1DF0A 4X8PA 4K1YA 3VBFC 5JSPA 4HETA 5GM0A 1LOFA 5SV5A 1WD4A 3OUJA 1HJGA 5FZ4A 2XWBB 4DINB 2AACA 1YHFA 5JXHA 2YU1A 4PDWB 2JDNA 4BXFA 3K3OA 4LITA 3OD4A 1HRV1 2EAAA 4LBJA 1S0FA 4IGQA 2GC1A 3C2UA 3T0AA 4AQSA 4XETA 4Y4YA 4Q0QA 3U78A 4XBLA 3WEZA 1NY71 5T5LA 2J1EA 4AR2A 1IG3A 1RUG2 2QQWA 5FV3A 3CZUA 4BXSV 4LIUA 1SBDA 1UF2C 4YFZA 3WNKA 4N7IA 5IT6A 4E9KA 2P17A 4NAOA 4AFMA 1UOJA 2WABA 2NZ9A 5FPBA 5D1IA 1MS1A 3KT4A 1MS5A 4CVUA 1GU3A 5FQ0A 3ZX7A 4AVAA 5C8CA 3GF6A 3M1HA 4HPKA 3WG2A 1MEC2 2V5DA 3ACGA 5FYZA 3UKVA 2DURA 5JUVA 2P2KA 1F35A 5FP9A 3BTYA 5DG1A 4YG6A 3VGIA 3AYAA 4MHUA 4XHBA 4LE3A 3M3IA 3KT1A 4G9SB 5FY5A 1JUIA 3GJBA 4CDUC 2UWCA 2MEV1 2ZHMA 2YFZA 1GR3A 1SACA 1URXA 4AVBA 1XSRA 1QIQA 4UFLA 3P5BA 2WNUC 5A7WB 4QXKA 4A7ZA 4WM7A 4D7TA 1VRBA 5BY5A 1CESA 4CPBD 2VC9A 4RA0A 1ZBE1 3I4IA 1Z7S1 3GXUA 3NAPC 5FYMA 3U75A 1BMV2 1RUH1 1OT5A 3C7FA 5F3EA 5A7NA 1K3IA 3SH3A 3VHNA 3ZDVA 5C8WA 1C8M2 3FLRA 1RUD1 5JLVA 4IV3B 1QJU1 1ULEA 3CU7A 4KMQA 5E6HA 2WFF1 4IGPA 5AFEA 5C9AB 1JYVA 4XXAA 4YRDA 2QKDA 5DG2A 1UKRA 4D6QA 2XJRA 1ZZBA 2XJUA 2BRTA 3GZAA 3RG0A 4DO0A 1XE7A 5DPNA 2R49A 2WLQA 1NAEA 2RV9A 2Y33A 1RXFA 4UW4A 1H1IA 2VO5A 4P9WA 4AEDC 3U0ZA 1XNCA 1DCSA 5EHDA 1IZ3A 1GQGA 1TG7A 1RUNA 4SBVA 3ZYBA 4YYOA 1D4M1 5FLIA 5CEHA 1YFXA 4MADA 1BK1A 2FQPA 4QQ2A 1VAVA 2VMDA 2Q8DA 1OFSA 2XJTA 4FCAA 5IVEA 3VV1A 1BK0A 2D44A 2GN3A 4LO5B 2QQUA 3WNOA 3GDBA 1G9AA 3HOBA 4HANA 3LKJA 1JZ7A 3TNQA 3AZYA 3TN92 3ZN6B 2DTWA 4HKOA 4O7XA 4BM8A 3OY8A 1NQJA 3AZZA 3IB3A 2QQVA 3ILFA 2WNVA 1WLWA 3LDRA 1EYBA 2OQ7A 5KC5A 2YPDA 4Y24A 4FTSA 1W9YA 3SH4A 4A3XA 5J96B 1WCUA 4WVZA 2D5HA 1G8WA 1YQ5A 2UY8A 1BCXA 3ME2A 5BV6A 2GP3A 2A6ZA 2PA7A 2YC2A 3J8F2 5LA9A 4W6WA 1HV1A 1RUJ1 1SQ4A 1ZZ7A 1EAH3 2VUCA 3U37A 1W9FA 3VDCA 1GWMA 2JD9A 1X9TA 5FWEA 5FZ7A 3IPVB 1AX2A 4KBZA 4XILA 1QJFA 1GWLA 1ZNPA 4YVWC 1W8HA 2Y6FA 1AL0G 1W9WA 3AZWA 4PF1A 4PQ9A 5I0SA 3QH7A 4LO7A 4JRAA 2Y6HA 5FMOS 1P8JA 2ERFA 4PLNA 1OPMA 2G9GA 3MV11 2XVLA 2XB6C 4RYDA 4XF9A 2RDNA 3OGVA 4XDPA 2NP0A 1E5IA 3BTZA 4I30A 1HV0A 1KFUL 2DYCA 3MIFA 4ASKA 4P9IA 1BQPA 3P3PA 4L99A 5A3WA 4AVCA 5HI0A 4L92A 4IEQA 4JVAA 5JIAA 3ETQA 3HT2A 1AYN1 4JTNA 1GNZA 1W2NA 4YLZA 3ZYFA 4BZ4A 3TEYA 2VECA 5JVVA 5FK7A 4BQ2A 1E5SA 2JENA 1D0HA 1SBFA 4UBHA 3RVHA 3UT0A 2CWSA 2Z2SB 4LHLA 3RDIA 2C9AA 2G19A 3ZSLA 4CSWA 3GCWA 4GWIA 4TYSA 1EV12 3RRDA 2RS11 1D4VB 1SFYA 3SLIA 3T1MA 1H8TB 2KM2A 3ZN4A 4A45A 3V0BB 1TNFA 1RHI3 1OKQA 2PHRA 4BQ1A 4BU2A 2NMNA 5FLHA 4DEQA 1PIV3 4E4ZA 1FOD2 3NQHA 1LENA 2RM22 5ACA1 1SZBA 2VOKA 4V1PA 1SDWA 2AUYA 2OUHA 2WSUA 1CPMA 2XBO2 4SLIA 2Q0AA 1XSQA 2R063 2YDEA 1XBFA 1PM7A 3FLPA 2NM1A 3OGJA 1NLSA 1YUDA 1QJZA 4N8MA 5F5AA 4BLJA 4EN9B 2E32A 4BOWA 5JOWA 4ATEA 1O3RA 1HB3A 3LPGA 1G9BA 2HBUA 2PELA 4RSUA 5T55A 1W6PB 4DPNA 4HSJA 1YNAA 2OZ6A 2Z5WA 3H50A 4MGKE 1CAWB 2B7YA 4QHZA 3WQ7A 4DRRA 3DPRB 4WVMA 2HWB1 4B1MA 1OI6A 3ZFFA 2IXHA 1W6MA 1DLLA 3AYCA 4HKWA 2RS53 1DQ5A 1ZRCA 3LDBA 3VDDB 1SLCA 3B00A 4QWNA 3OJBA 3B9IA 2ZHNA 3D8CA 4J6GA 3E5QA 4COWA 4CCKA 3SMHA 3I97A 5J48A 3UETA 2Y6LA 3HBKA 1UXZA 3WV6A 3WNPA 4EWAA 4UFJA 3O1OA 4XUTA 4KWLA 5JZGB 3D5OA 3O1PA 3WLUA 4RFT0 1DQ4A 5E8AA 4AVSA 1GP4A 1UZVA 5K4LA 2VZQA 5IVVA 2D97A 5J37A 2BEOA 2YBPA 3HN1A 4TN7A 1W8ZA 4XIOA 4XZUG 5F7UA 3UJOA 1REEA 2BPA2 3ZXLA 2OIIA 2VD7A 4IXLA 4R52A 4XBNA 1H4HA 3OUHA 4UXAA 3ILRA 1AR83 2WZR1 3BYWA 2BBAA 1JODA 5HPOA 3TBDA 1PO22 5BNPB 4Q0SA 4L97A 3HQRA 1YFUA 2VCCA 3OG2A 1XU2A 2HEYF 3IMNA 1ND3B 4YM0A 1NYWA 3T09A 4CPBA 1VAMA 1AL23 2XQRA 2XGXA 1FT9A 2RR12 1QQP2 1DQ1A 2CTVA 1WBFA 2CGOA 1PX4A 2YUEA 2IWGB 2BGOA 4RHV3 5IVJA 1VBE2 3WF0A 4UOJA 1YJLA 2NPIA 3AMMA 2Y26A 1POV3 3AP4A 3DF0A 3M8LA 1QJY1 3FWEA 3WP6A 4CDXC 4DB5A 5IK5A 4AGGA 2VTXA 2ZS6B 4UF0A 4A7YA 2FZ2A 3VKNA 1N3QA 1ND2A 2JD4A 2QJVA 4R9BA 2GMMA 4RQPC 4WM8C 4I09A 4O61A 2BV4A 3MDPA 4ZXEA 5CFCC 4UW5A 4NHXA 3ZMOA 3KCCA 1AF9A 1GKBA 4K7JA 4NAMA 3S5QA 1PK6C
chains in the Genus database with same CATH topology
4FOWA 3KD4A 1UKGA 4E4SA 1JN2P 3ZN5A 4LBLA 4W6XA 3HT1A 5FQ0B 2UY9A 5C8CB 2H0BA 3D4KA 4QPGA 4ATFA 3BODA 5J09A 4W6YA 4R9DA 2X8KA 3ASIA 5BXXA 4LLOA 1S0BA 1S55A 2H6BA 1H9PA 3R05A 3WW4A 2YC0A 1BKZA 2SBAA 3THTA 2PTMA 3FHIB 4AQ6A 3E97A 1IS3A 5BYNA 3CO2A 4AEKA 1AR62 2ARXA 4WBBA 1B35B 1V6OA 3WHTA 3EO6A 2GNMA 2WQ4A 1VALA 3WDUA 4XQWA 3ZMNA 1AR92 1HKDA 4XYXA 4YFWA 2GH8A 1ZREA 2XKPA 1RVF3 1U12A 2C5DA 2XLFA 3ST7A 4XJZA 2XLAA 1MZ6A 2YHJA 5E89A 3WG1A 2WS91 2VVDA 3VBSB 3USUA 4GH4A 1MS0A 3AP7A 5CNAA 1VIWB 2G4IA 1A8MA 4PF5A 4F83A 3NVCA 2FMDA 4XF3A 3VBRB 3N7KA 1N1SA 4FP3A 1VBB1 1YRZA 4KU8A 2VMIA 2XJVA 1AR73 4HN0A 1HXS2 1Q5OA 2RMU2 2XVKA 2ZGUA 3OY8B 1HRV3 2WNVB 3AJYA 3ES4A 3QH6A 3WP4A 4CEYB 4CEWA 1NXD1 1PVC2 2HKXA 1NLRA 5KXCA 3H1MA 1OA3A 1PGW1 4P9GA 3M3CA 4XF1A 1S2KA 2Z42A 2ENRA 3KB5A 4BH9A 4IEXA 4HVRA 2B8MA 3UV9A 4HL0A 4M0NA 5L7OB 4B4RA 2D6LX 2PAEA 2ZBJA 4GQ7A 1W2UA 1UL9A 5DDJ1 4XFFA 5BNOB 1CAXA 4JDNA 2VQAA 4AI1A 1JOJA 2UURA 1OQEA 4FOVA 4FAGA 1ZRRA 1R1A1 2E51A 5JR7B 4H14A 2WT1A 2BWCA 4YM1A 1YFYA 2MEV3 4U2AA 2VNRA 1OOPA 1OA2A 3O0XA 3VBUC 2BNMA 3MF9A 1XU1A 5D8AC 2GC3A 1ZBE3 5F1RA 1EP0A 3H9AA 4OLLA 3VHOA 1LU2A 4PDWA 1RUH3 1XYNA 5GJ6A 2JKBA 1RUE2 1RUD3 1QJU3 3FBMA 4Q8KA 2VOXA 4PLMA 4WZFA 1Q56A 3ZIXA 2WFF3 4D3WA 4KL1A 2Z79A 3MPPG 1O4TA 1WCSA 4L8QA 4B3NA 1EAH1 3UK9A 2PHUA 5L19A 4XJUA 5A3MA 2IC1A 2JECA 4Q4V1 4QX5A 1TME2 3FUQA 2GDFA 4WVMB 2VU9A 3MPBA 2X5IA 2VW2A 4S2DA 3ZFFB 3DV8A 1UPIA 4GB32 1A78A 3VBHC 1DIWA 1HQNA 1LHVA 1IS5A 3DN7A 1W6OB 1PO12 1PHMA 2R1BA 3MEPA 3SCFA 5FOJB 1CR7A 1CD3G 2HWE2 1Q8VA 2YY1A 1NA1C 1LOGA 4M3CE 3KM5A 1EPWA 4P14A 2TEPA 4R4ZA 1VBC2 3WNXA 4IV3A 1RUJ3 1RHI1 2AENA 1I9RA 1RUOA 3BTAA 2DVAA 3AM2A 1B09A 4N43C 3O5SA 2BGCA 3I59B 1JYCA 1ZA4A 2HEVF 3MI8A 5JI9A 1LU1A 4QGNA 2DVDA 1LHUA 3NV4A 4TSVA 4WVVA 1VBA2 3WUDA 4Z07A 2JICA 3BPZA 5CIRA 5C4WC 4YVSB 4BA6A 4EWEA 1XNDA 2R0HA 5EJ3A 3S6PA 4DFSA 4LHNA 1AYN3 1CJDA 4XMIA 4GALA 4DY5A 3LB9A 1DYPA 4HVOA 2I45A 2DVGA 2EA7A 5E1RA 4META 4AEJA 4RR3C 3H3UA 5DUVA 5EYYA 4Q4Y3 1K5MB 3V65A 3ZN6A 1DGRN 2RS13 4TWTA 4BMEA 4ONUA 4JGZC 1ND2B 1Y9QA 1QXJA 4FPFA 2FMYA 1QWRA 2WJSA 3P3NA 1PGL2 3AMNA 4CDQC 4FO9A 3VHPA 1YFWA 3WVJA 3NW4A 2B39A 3ZSEA 4M0HA 1Z7S2 3WX5A 5LRRA 4QPGB 1AX0A 2BVBA 1DQ6A 1RIRA 3B93A 3IPVA 1J58A 3VBFA 3G7DA 4F8AA 1RINA 1XXNA 1QMJA 4M3CB 3AYDA 3MGUA 3ACLA 3UL2A 5I91A 1HW5A 3USSA 2GC2A 5CU1A 1QJX2 1DZTA 3LOIA 4YGBA 2XG3A 4JGYB 1AZDA 1DZQA 1NXMA 5C6CA 1VP6A 1ZZCA 2GNDA 1X33A 2UYAA 1BEV1 1FMD3 1TMF2 1KDMA 4JAAA 1TNRA 2VOWA 1POV1 3G6JB 3RYPA 1FV3A 1RTVA 3U11A 3V0BA 2C0ZA 2PLV2 3N7MA 3AJZA 2HWF3 3B7MA 4M01A 1UCXA 2XL9A 2ETEA 3JD71 1KITA 4Q4X2 2CGNA 2D6KA 4I0WB 2IZWA 1ZRDA 1RUI2 2A75A 2JG8B 1V9U2 4JV4A 5K0UC 1QKQA 2JG9C 2BNNA 2ZMLA 3ATGA 1LODA 2WZR3 3POYA 1CJPA 3LAGA 1H2NA 1WGPA 3H1WA 3PMEA 3EHKA 1BZWA 4CDWB 2R041 1ZVFA 2D5FA 1W6PA 4R8HA 4EV0A 4Z8BA 1CAWA 2BQPA 2XVGA 3J26N 1ZBA3 2C1FA 1RMU1 5DUWA 3CEWA 1MQTB 4QPYA 1I6XA 2WT0A 2Y38A 3KZ4C 3ZPYA 2OZJA 1DU3D 1QJY3 1VBD2 2ZZQA 2ZGKA 1RB8G 1QDCA 4LO8A 4NR1A 4PCRA 5CB7A 1NE4A 3NV3A 1H1AA 4CRQA 1OHFA 1PZ8A 1U5IA 2N7GA 1RVF1 4KH9A 4RL7A 3L2YA 4OI4A 4QD2A 4ZU7A 5JZGA 5DUUA 1ASJ1 5EV7A 5KC6A 3MLKA 3QOPA 4NHMA 2VNOA 3VLBB 3CJIB 1PNFA 4QQOA 2WA4A 5B2GB 1QOOA 4CZSA 1J3PA 2HJIA 1FPN2 1RUF2 5ACA2 4IEVA 1AYM1 2MNGA 2YROA 1HIXA 2Y0OA 2NQYA 3W59A 1UD1A 2R071 2ZMKA 1OA4A 1SCRA 1QY4A 3VBOB 1AR71 1ND3A 2EXIA 2GNBA 4IEYA 5I0UA 1XQNA 3GBFA 4FSJA 3N35A 2A71A 1IKPA 4FAHA 2UU8A 1RGSA 4XJWA 2HWB2 2RS31 2LM3A 2X29A 3AMQA 4PBOA 3AKQA 1MACA 4XBQA 4IEPA 2ZGRA 3MLJA 1NQDA 3VZNA 3CJXA 4FPYA 3TNPB 4D7SA 2DF7A 3ZXDA 2CGPA 2BFUS 3J8F3 2WS93 1XNBA 1C5IA 1KS4A 4COYA 3SITA 2YGMA 3SLIA 3T1MA 1WUVA 1CONA 3FJSA 4IV1C 4Z82A 2YPJA 3H1YA 1QXPA 2GC0A 2X5IB 4JTOA 5FPZA 4ASLA 1VBB3 4GKYA 2D3RA 2GSYA 1RUC1 4WV8A 1JH5A 1MR5A 3EJKA 3POWA 4X6RB 4BE3A 1TQ5A 4XPVA 5T5JA 2DUQA 4FQ4A 1OQDA 1R082 1B35A 2ES3A 4LBOA 5FBZA 3TAYA 1LHNA 4Y1ZA 2GALA 4C90A 2ZGTA 1HRI2 1BBT1 1R092 2RJKA 4JC1A 1ONAA 2VG9A 4RS5C 1XYPA 4MLOA 5DDJ3 2B42B 2AH2A 4FVVA 2HYKA 3VBSA 4CP0A 4NHLA 1R1A3 3GBGA 3GYDA 5DZEA 1IS4A 4OFGA 2BUKA 3B3QE 3D0SA 3VBRA 3ZFEC 3OF1A 2DU0A 3ZXJA 3OYWB 2FHRA 3NV1A 5ABJB 4Q4W2 2XKOA 2WL1A 1UU4A 3IT8A 5K8SA 1QHDA 1CAUB 4I3PA 3QCWA 3RYKA 1FNZA 3U4XA 4WVWA 2PHLA 2R6QA 4F3JA 4CEYA 2QDRA 3MIEA 3VHRA 5AVPA 1LEMA 3WCSA 4AG4A 4OVEA 2DUOA 2ZOEB 2ILMA 1COV3 1XE8A 3S7EA 4HLTA 1DGRA 1PNGA 4K1ZA 3RSJA 4YW3A 1CAVB 1UZZA 2CYFA 4KGGA 2WKKA 4FPLA 3AX4A 3VBFB 5L7OA 4Q4V3 3O0VA 2XHKA 3UKTA 3MZHA 5BNOA 5AC91 3B94A 2VVFA 4D94A 1EY2A 3ZFGC 5DUXA 1V6IA 1UMZA 1F31A 4BMBA 1RITA 2BTVC 3MLLA 4D7YA 4OI1A 3VKLA 2E63A 4XFGA 1OQ1A 1S0DA 3L9JT 2ZX4A 4A7KA 1VB2A 2IXCA 3WG3A 1X82A 3GZTB 1ULGA 4Q4Y1 2YV8A 1VBE3 2ZHKA 1BYHA 4YGEA 1M06G 3FX3A 1BVP1 2W0XA 5J98B 4Y26A 1LEDA 2R30A 2V09A 1NCQC 1NCRC 2RE9A 1O4YA 2FZ1A 1PGSA 1V70A 1N1VA 4INDA 3C3VA 5C8CC 1D0GA 3WQ1A 4CDUB 1QXRA 1H2MA 2ZGNA 2VY0A 3FMGA 1MVEA 3WDWA 4YZ4A 5H9RA 2WNUB 5A32B 4P5HA 1H0BA 2B5HA 5L73A 1AJKA 3NAPB 3VZJA 1UAIA 3JQWA 3RNSA 4EROA 4Z1VA 4Q0VA 4WM7C 2D6OX 2GU9A 1WCDJ 3CF6E 5FOBB 1FYUA 2ARBA 1BVVA 2AZ5A 2E7AA 2HWD1 1WLCA 3WT3A 5H9QA 2I07B 2WA3A 1W6OA 1FMD1 4AVTA 5JAXA 3HD8B 1G6NA 4LR4A 4AXOA 1GQHA 4AEDB 2GMPA 3SISA 5JCTA 3ZYRA 3LA7A 2I74A 1CGPA 3O0WA 3QACA 1J3RA 2HWF1 3OBRA 4LNVA 1RUG1 4IETA 4RGGA 4K8FA 4KNCA 3RMXA 3LZZA 3RI8A 1FX5A 1O3TA 3UJQA 3I59A 4XQ4A 4QT6A 2A6VA 1ENSA 2QFEA 4CTEA 1DYKA 3WY6A 1V00A 1SBEA 4H3WA 1EAH2 2A6YA 3LOBA 2EVXA 2LTNA 4YVSA 4B4PA 4FP2A 4NWVA 4QQHA 2B9UA 1ZBA1 2XUMA 1IOAA 4AGVA 2WNVC 4BIFA 2IXLA 2UWAA 1BEV3 2ZX3A 1WD3A 2DCZA 2OPKA 4YVWB 3ZXGA 5I93A 1K5MA 5H9SA 1W6QB 5AVAA 3GZUC 1FAYA 1LKNA 4Y1VA 5CBLA 3VKMA 1BMV1 4XTMA 1VAKA 5CG9A 1WMFA 3JD73 4LA2A 2P3KA 4DRVA 4S2GA 4YNIA 4EN8B 4OUMA 4F7ZA 1C57A 2XJQA 4HK9A 3AKTA 2PQQA 4QMAA 1O4ZA 3VBUA 1XNKA 2A3WA 5IUQA 5BUVA 4YGCA 1YO8A 1RHI2 2QNKA 1PIV2 2R043 4JDOA 3FBYA 3NL1A 5T5PA 3MW3A 1MS9A 4S2FA 4J1WA 1S2BA 3MW4A 3E5UA 4M3CA 1DQ2A 4CP2A 1RMU3 2BW8A 2R062 4TZDA 5T3NA 4WZCA 4FPHA 4PLOA 1ZM1A 1C1LA 1CX4A 4JGYA 3N7LA 2DFCA 4E4DX 1JHNA 3AFGA 2EF6A 4XFAA 2CNAA 3MFAA 1H1MA 2JE7A 3WCRA 3RMYA 3TN91 4KG0A 1SLIA 4GIQA 5CG8A 5T5OA 1IQAA 2PAMA 5KXDA 2RS52 4IEZA 2QZ3A 1FATA 4OHXA 1W0OA 1ASJ3 3MIGA 1DBNA 3J8F1 4M3CF 1UIJA 4Z92B 1HDKA 2JG8A 3LWCA 4Y1YA 4AHXA 4FBFA 1GFF2 4O9GA 1AYM3 4QHBA 1OLRA 1Q8PA 5FTTC 1JTZX 2R073 3R0RA 5FFOC 4CDWA 5DZGA 3WG4A 3JBG2 3TRSB 2XJSA 4OZXA 5BPXA 1LCLA 1GZWA 3RQ0A 1H2KA 1QH7A 2MPFA 2H6CA 1AR82 1MQTA 2RS33 4N9HA 2RHPA 4LHKA 3PMSA 5GKAC 1N47A 3AXDA 2ZGOA 1DG6A 4N7UA 1MS3A 1AL22 5FREA 3WW1A 2D6PA 4GMP0 4AGRA 1RJ8A 4RHV2 5C4WA 1ENRA 3A0NA 3SXWA 4LO4B 2DVFA 4GWNA 4PIXA 2RM21 2ZCWA 4FTEA 3V0AB 1I3HA 1ZZ8A 2A3XA 4L11A 3CJIA 3BOWA 1W39A 3B69A 4CDXB 3AKSA 1COV2 1RUC3 1AXZA 1C3HA 4WM8B 4RQPB 5CFCB 1PZ9A 1IPKA 3VBOA 1PK6B 3AKRA 3RYRA 1WMEA 4R9AA 2QQPA 2EXKA 3MW2A 4QPIC 3POSA 3LGRA 4NVPA 4FPGA 3I7DA 3ELNA 2Z69A 2ZKNA 4AYUA 3M3EA 4YG3A 1UU5A 4IQPA 4P9YA 2K2SA 2P3IA 1VR3A 1BBT3 2VUAA 2VMGA 4N90A 1DGWA 1H30A 3ZIWA 2IXKA 4DZGA 2HWC3 3JCIA 2XLGA 4C0BA 4XQDA 2A6WA 2Q1ZB 1YLLA 2Q1MA 2UYBA 4LT5A 3ENRA 5GZDA 3FFQA 1RC6A 4UW3A 3DKWA 4OUSA 4Q27A 3LA3A 2WZPP 2GNTA 4DMIA 1O5LA 4AFBA 5HBAA 1OMIA 4Y20A 5GLWA 4PBPA 1WA4A 3VZKA 3H8UA 4OI0A 3RPQA 5GALA 2WNEA 2JJ6A 3HIFA 4ZKTB 1S0IA 3HR9A 3ZXKA 2B46X 5K0UA 2ATFA 1VBE1 2JG9A 4KG8A 4OULA 4FOYA 2DTYA 1AR72 3QD6A 1GSLA 5FO7B 4OHYA 4S2HA 1D2SA 2PLV3 4GH4C 1HRV2 5F6KA 3ROUA 4AW7A 4K9SA 1NY72 1VRH3 4AEMA 5AC93 4YW5A 4K20A 1DFQA 2DWRA 5GLVA 1UU6A 1QNWA 5BNNC 1X8MA 1LHOA 4N9IA 2WLPA 2ZAHA 4XDQA 3ALQA 3O12A 2W52A 4HZFA 3OYWA 5ABJA 3H7YA 1O7FA 3KMHA 4N53C 1KRIA 2VMHA 4CEWC 2PN5A 2K9ZA 3L2HA 1CAUA 3ZSJA 2DCYA 4B7KA 2K0GA 2DU1A 3EQEA 3M70A 4MX3A 5DZFA 4QGLA 3WDVA 1WMDA 2VGDA 2MEV2 1KQRA 3CL1A 1KJRA 1C1FA 1SLAA 1AR91 4MXWA 1AHSA 1LGCA 5F5QA 1AXYA 2CAUA 4YM3A 1ZBE2 2W08A 5CFDC 2QCSB 1CAVA 1RUH2 3A0KA 3AK0A 3VBUB 2WFPA 1RUD2 3R4SA 1QJU2 3MIBA 5D8AB 2WFF2 4K40A 2F4PA 5T50A 2WQZC 4P9XA 1WW7A 2QE3A 4B29A 4PJYA 4EN6B 1OOPC 4XFBA 4HT1T 2EXJA 4Y22B 3KS7A 3MF6A 1O5UA 3KCYA 1X8EA 4GXLA 2ZABA 4PDWC 3WUCA 3KLSA 4LBQB 1KXGA 4QU2A 2HWD3 3RI9A 4ASMB 1D4M2 3IDCB 5A33B 1HXS1 5FDBA 2WT2A 4XTPA 2RMU1 4IEUA 2ZHLA 5GZEA 4ORFA 1ALYA 2EIGA 2D98A 1QGLA 3PHMA 3MIHA 1G9CA 1YXWA 1PVC1 4IV1A 1RUG3 4YZ3A 5FAXA 5GLUA 5GZGA 2ZKLA 3WHUA 3KCXA 4J1XA 3VBHB 5I8TA 5K9YA 2ZGQA 5KBFA 1H4GA 5J3UA 5LEKA 1G86A 1QF3A 3KGLA 4CDUA 4B7EA 4YW4A 5IK8A 4AWDA 2YZ4A 1PMIA 4MH0E 2WNUA 1V6MA 1RUJ2 3MFCA 2D40A 3KT7A 5I8SA 5A32A 2KA3A 1LOEA 4MSVA 1NA1B 3NAPA 1MEC3 5SV8A 2PHTA 1OPOA 4URTA 1C5HA 2BYVE 1GZWB 3ILNA 4LUKA 3HWJA 3FE5A 3VKFC 3GHNA 4IL7A 1LR5A 3U07A 3WDTA 4N43B 4BWOA 4KBBA 4RS5A 3WD5A 4Q26A 4IV3C 2EXHA 4ISRA 3ZXAC 3NKGA 5C9AC 1AYN2 1KS5A 4AEDA 2AGSA 5C4WB 2D6MA 3RJ2X 2XWJB 1C8M3 1RUE1 4XF4A 4EN7B 4Y5Z0 1C28A 1E57A 2NYYA 3KSCA 3PTYA 2RS12 1FNYA 1G9FA 3WINE 4XF0A 4HKLA 1AVBA 4I01A 4RR3B 1F8VA 3TOJA 4AVVA 3CNAA 1W0PA 1WLDA 2AYHA 4JGZB 3VZOA 1TME1 4G4FA 4BPZA 1Q3EA 1QOTA 4B8EA 3SH5A 4Q1RA 4CDQB 2DCJA 1NOVA 5JOZA 3VZLA 1N1YA 4GB31 2ZACA 4E27A 2YGLA 3TYJA 3TN93 3J4UH 4YVWA 1PO11 2R1DA 3NSTA 3N4MA 3TWIA 1W6QA 2LALA 4AI3A 3BALA 1F9KA 1MZFA 5EFUA 1UIKA 3ZFGA 5FPXA 5T54A 5F6LB 1FMD2 3ZDSA 1VBC1 4AQ2A 2ET7A 1YI7A 1W6NB 2VULA 4BYYA 5FO8B 4C1WA 4CP1A 2JEMA 4AFDA 3I2DA 1JUHA 2HWF2 1REDA 1S0GA 4Y20B 3D6EA 2Q8OA 3A4UA 3APBA 1HLCA 1VBA1 3HMYA 5JI7A 5KWRA 1U5ZA 5C33A 1DGLA 1NCQA 1NCRA 4ZXKA 3IKWA 2WZR2 1G9DA 3KGZA 2CV6A 3IN9A 2I2SA 4HSLA 4H7MA 3DGTA 1QDOA 1H8TC 5CAZA 2A70A 5K0UB 2JG9B 1UX6A 3RZZA 1KD7A 3E6DA 4FT8A 4KQ7A 1ZBA2 1EV13 3SCGA 1YI9A 4ES9A 3VKOA 3IBMA 2V5YA 3ZXFA 5IK4A 4MV2A 4XEZA 3EBRA 4X8NA 2OYZA 2GAUA 1LULA 2OA2A 1IS6A 1QJY2 1FOD3 2HWC1 2IFWA 1PGL1 2RM23 4ISQA 1N3PA 5FO9B 4FPJA 4MYEA 2TNFA 3OCPA 2XBO3 4MGZE 2VUJA 3AMHA 3DPRC 2W39A 5JSRA 3T2TA 3ZYGA 4R4XA 3WP3A 1H2LA 1FV2A 4MGIE 3N3HA 4XHXA 3VDDC 5J7MA 4XE9A 5T52A 4E2SA 1QJX1 4NWWA 1LB2A 4LO6B 1QH6A 4FTBA 3AP6A 3HAGA 5EWSA 4LBQD 2VW0A 2H0VA 1HQWA 1JXNA 1LGNA 5JZGC 1TMF1 4MXWB 2NLRA 2XH6A 1UN1A 1CPNA 4YW2A 2Q5TA 4COZA 3INAA 4GA9A 1JW6A 1SLTA 1R1ZA 2A7AA 2PLV1 4NHKA 3THPA 3IWZA 1MS4A 1VRH1 2ZGMA 3BB6A 5JMCA 4HMZA 1Y43B 2D93A 2YYOA 4Q4X1 4H55A 3BCWA 3V0AA 4Q1PA 4XOGA 4P9LA 5BNPC 1RUI1 3RS6A 1V9U1 1LOFC 1ND3C 1Y3TA 4CDXA 2CAVA 4FPEA 1Y7BA 4YZ5A 2BVVA 2WS92 1RL3A 1PO23 4WM8A 2XL7A 4ITCA 4RQPA 5CFCA 1PVXA 2VH9A 1SMVA 1LJ7A 1NG0A 2Q4SA 2RR13 1PK6A 1QQP3 5CADA 2P37A 3MIDA 2O0OA 1GBGA 4LA3A 1VBB2 2A5ZA 3GHMA 1LTEA 2E6VA 4HBNA 2ZGLA 5I0RA 2A73B 3B9CA 4IV1B 2EAKA 5EYXA 4R9CA 4YG0A 3TB0A 1VBD1 5KHKA 1ENXA 5JPNB 2DVBA 3N7JA 4ZU5A 2QVSB 4K6BA 5K7PA 3QBQA 1A6CA 3PJYA 1KJLA 4Z2WA 2D43A 1PGW2 4GMP3 2JX9A 3JU9A 5LK5A 2E53A 4BIOA 4OHZA 4MGYE 4JDMA 1JYIA 3V64A 4AI8A 4PIZA 4Q0PA 1ULDA 5DDJ2 3M4FA 1AJOA 1FPN1 1RUF1 1B35C 1EPZA 1WLTA 2BFUL 3ZYPA 4AI0A 4LBNA 4RD7A 1R1A2 4LE4A 4RS5B 4K3UA 3B01A 1AR63 4I0AA 5HXVA 3ES1A 1DQ0A 1L3JA 4YW1A 2PYTA 1ULCA 1AR93 4I3GA 4XFIA 1ZYBA 1CN1A 3ZFEB 1UPSA 4COUA 3PNAA 2ZJCA 3PJQA 3WXPA 3VBSC 5FLJA 3WW2A 5TSWA 2DFBA 3FUOA 3LCPA 2Y0IA 2O1QA 2NN8A 5JWPA 1GYKA 3VBRC 1J1TA 1APNA 1LESA 2XPJA 3M3OA 4H7LA 4P9JA 2QDNA 3WW3A 2E7QA 5GZCA 3SNMA 2P3JA 2D3PA 1MEC1 4EN0A 1X7NA 1LOCA 3E6BA 3K48A 2E7TA 5JOXA 5JOYA 3BOPA 3GALA 1DGWX 2CL2A 4KU7A 1XRUA 4Q4V2 3VL8A 3WOGA 4COVA 3JBG3 4AF9A 4CEYC 4BCUA 2X53S 5JIUA 5KXBA 1HXS3 3H7JA 5J36A 1I5ZA 2RMU3 4I2OA 4GKXA 5LRSA 3AZVA 4OI2A 4TLFA 1A8DA 5KHIA 3PLQA 1AXKA 2KXLA 4OHVA 1R081 4MVTA 1PVC3 1T6GC 3W9AA 3ZFGB 4Y1XA 5L7OC 4DOUA 1C8M1 4AHYA 3B02A 1HRI1 1J3QA 1V6LA 4E2GA 5BNOC 3FC0A 4W65A 4I0BA 1F5FA 1R091 4XW3A 5GLZA 3WZ1A 4KWJA 3X29B 3AXEA 1BJQA 4FXGB 5D8AA 2ZA9A 2HEWF 5HCFA 1VB4A 4LUMA 4QPIA 5CA6A 1X50A 3ZYJB 5IK7A 3GBWA 1MS8A 3JUUA 1DZRA 1GV9A 3UKNA 1NCQB 1NCRB 4Y22A 2W68A 1ZZ9A 3U10A 2PHDA 1H8VA 2LUWA 1ENQA 3VL9A 1S0CA 3JZVA 3PVBB 4LBQA 4Q4W1 4HPKB 1SFNA 2VVEA 3AP9A 5A33A 5A3LA 1Q8OA 4LBMA 1UW8A 3DUIA 5FMOL 1U5XA 1MVQA 3FZ3A 5EXOA 1ZZ6A 5DXDA 1RUE3 3SCHA 3E5XA 2AR6A 4Q0UA 3E6CC 4BHPA 3FLTA 3AZXA 3DL3A 4QM8A 4WM7B 3ZVXA 3H0OA 3PVOA 4FQZA 2O8OA 3VBHA 1HQLA 5I0TA 3M7AA 1TE1B 3MYXA 2VW1A 4XJ8A 3ZFFC 4AI2A 5HCAA 1TME3 2R16A 4DNYA 5JDBA 1NA1A 2DV9A 3LA2A 3FFZA 4MXVA 4GULA 2CY6A 3NJZA 4GB33 1WCKA 1IKQA 1J1LA 2NMOA 4GWMA 4UBGA 4N43A 4I02A 1WW5A 4M00A 3M3QA 4XFCA 1PO13 4DQAA 3AFKA 1KDKA 3WP5A 2ZGSA 5E88A 1CQ9A 4E2QA 1IPJA 2HWE3 3NV2A 2WC2A 1G7YA 5AFBA 1S0JA 1EV11 2ZX0A 3NKTA 5BNNA 3JB8A 2MHFA 5HCBA 1BEV2 4D69A 1VBC3 2WWSA 3B5LB 1ZX5A 2IFRA 3LSEA 2JE9A 1FOD1 2CWMA 3SHRA 4N53A 1N1TA 3NO8A 2XBO1 4YVSC 5GLTA 4RR3A 4QGMA 3JD72 2ZX1A 4MUVA 1DDLA 2ET1A 2R32A 1GANA 1VBA3 4JGZA 3S7IA 1A3KA 4K21A 4BLIA 3O7OA 3IDEA 4UW6A 3T1LA 4MZUA 1N3OA 4CDQA 1K5MC 5FRAA 2VXRA 3S30A 2GN7A 2R042 4FPCA 1Q43A 1ND2C 4YGDA 5CFDA 3VUOA 4YARA 4XXPA 1YYNA 2ZPXA 3WDXA 3N36A 1RMU2 2SLIA 1LGBA 2DCTA 2YMZA 2DCKA 4QPGC 5LEJA 1AX1A 1Q8SA 1X36A 1WW6A 2TBVA 2PHXA 2VNGA 1Z7S3 1LRHA 1WBLA 3WQ0A 1W6NA 1RVF2 1I1EA 2QZ2A 2RJLA 2ZAAA 1UZYA 2JXAA 2GMEA 2O8QA 1CVNA 3ZO0B 4EJRA 1ASJ2 1REFA 5FCCA 3AMPA 1Q8QA 1D2QA 1YCIA 4NO4A 4JGYC 1PO21 3OBTA 5E16A 4DS0A 5I8YA 1LOAA 1S0EA 1YWKA 1QJX3