1O91A

Crystal structure of a collagen viii nc1 domain trimer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
131
structure length
131
Chain Sequence
EMPAFTAELTVPFPPVGAPVKFDKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPMMYTYDEYKKGFLDQASGSAVLLLRPGDQVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COLLAGEN ALPHA 1(VIII) CHAIN
publication title Crystal Structure of the Collagen Alpha1(Viii) Nc1 Trimer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 24
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o91A00
4G4FA 2O0OA 2QDNA 2ZJCA 1U5XA 3LKJA 5HBAA 2X29A 2RJLA 3B93A 1I9RA 4DB5A 1OQEA 3B9IA 1KXGA 1C28A 2RE9A 1PK6C 1D0GA 2HEYF 2JG8A 4QQLA 2WNUB 1IQAA 4OUSA 1U5ZA 2TUNA 3ALQA 4D7YA 3IT8A 1ALYA 1RJ7A 2JG9C 4NN0A 1XU2A 2R32A 1O91A 4OULA 2TNFA 2Q8OA 1WCKA 4TSVA 5BNQA 5KWRA 2Z5WA 1S55A 1TNFA 2HEWF 4TWTA 4N90A 5CIRA 4G3YC 1U5YA 3QBQA 4F3JA 1C3HA 1D2QA 1PK6A 5KC5A 5KC6A 4MSVA 4RSUA 1TNRA 2JG9A 2OIIA 2KA3A 4MXWA 1DG6A 1OSGA 4EN0A 2WNVC 1A8MA 4OUMA 1PK6B 2JG8B 2Q1MA 4KGGA 3WD5A 2HEVF 3QD6A 1JTZX 1OQDA 2QE3A 3K48A 4MXVA 4GIQA 2JG9B 2R30A 1KD7A 3K51A 3B94A 3ME2A 4E4DX 2WNUC 1RJ8A 5TSWA 2RJKA 3FC0A 4E4SA 2E7AA 4HT1T 5L36A 1XU1A 4DOUA 4QQOA 3AB0A 3TWIA 2WNVA 2AZ5A 3MI8A 4QQHA 3URFA 5L19A 3V56A 1JH5A 4QQ2A 4QPYA 2ZPXA 2JG8C 4QQPA 1DU3D 3L9JT 1D4VB 4KGQA 2WNUA 2R6QA 4J6GA 4KG8A 4MXWB 3TYJA 1GR3A 2WNVB
chains in the Genus database with same CATH superfamily
4ZS3A 4E2SA 5ISLA 2QDRA 5FMBA 3WDVA 1WW5A 4LKFA 1Q5OA 1XNCA 2J1VA 3OY8B 3ZLIA 1HRV2 3VZOA 4DUWA 5KHKA 4ZHNA 4Q29A 5JSOA 3C7OA 2ZACA 3AVSA 4QB6A 3HOBA 1ZBA3 5EWSA 5CG9A 3N9QA 1OLRA 1MS8A 3ATGA 1N47A 4PQ9A 4AFBA 1RUJ1 5F2SA 2OYZA 1OD5A 4LLFA 2RS31 3DYPA 2WNUB 4M0HA 1WA4A 5IWFA 4Y5TA 4Q8KA 1ASJ3 2RHPA 4XCBA 3ZR5A 3FLTA 3J8F2 1GP6A 4PLOA 1VBC3 3CU7A 1UW8A 4OHWA 3VL8A 2RM23 1UZ0A 1JYXA 4QX1A 2C9KA 1QKQA 2JJ6A 2R071 3VB9A 2LW8A 5FZ7A 5A7WA 3NAPA 4XBLA 4Y1VA 4PCRA 2EIDA 4QM9A 3DYMA 1XYOA 4UXAA 5CEHA 3OGSA 1SLBA 4QB1A 2RS53 4IEZA 5FMCA 2QQIA 5DZFA 2VO5A 1NCQA 3J7MA 1GSLA 1QDOA 5HXMA 1A34A 1TZOA 1J84A 5HPOA 4P5HA 3ST7A 4LKDA 1RMU1 1PNFA 2Q4SA 1UYYA 4ZONA 5I8YA 1AR73 2X10A 3OG2A 3RG0A 3PU3A 4CA9A 3I54A 3MV01 5CNAA 2W87A 3VHOA 4PT6A 2D6OX 2J1UA 2JG9A 1J1LA 2WZR3 3FFZA 4XAEA 4ES9A 2RR13 2A6ZA 2Y34A 1F31A 1CAXA 1RHI1 3K3NA 3RSJA 1CN1A 4LULA 4XJWA 3HR9A 4XUQA 1SPPB 4UFIA 4YVSA 4XZUG 3D6EA 1RUOA 4I0BA 1UOBA 1IPKA 4P08A 1UYZA 4Y24A 1FOD3 1LGCA 2A71A 1QJZA 3O1TA 3LDBA 5FO9B 2MEV2 4CP9B 2VL4A 1AJKA 3W21A 2FDFA 2FCTA 4AL9A 1OI6A 2CNAA 1W04A 1R1A3 4AFDA 3DGTA 2VCAA 4FOYA 2D3RA 4PI2A 3JQXA 3GBGA 1FNZA 4WVVA 5FO7B 3RYPA 1NCRB 1NQDA 5KHGA 1EPZA 2D98A 1W9SA 2H0BA 5GZEA 3AMMA 3DL3A 2ADEA 2J1RA 3AZXA 1OOPB 2XL7A 4AGGA 4CUGA 2K2SA 4AI3A 1XU1A 5C7GA 2ZZQA 4QQOA 1OLMA 4LT5A 3PVEA 3CIHA 2AZ5A 2HWE3 3C2UA 1RGSA 3ZYFA 5A6YA 4KWJA 3BU7A 3VL9A 3IN9A 1JYVA 3MW3A 3SITA 4OHYA 2AR6A 5K0UB 2VXJA 1PGL1 1CZTA 2N7GA 5GLZA 3N4MA 2PELA 4QQ2A 2ZPXA 4L9BA 3AJZA 1EAH2 1UWWA 2GMMA 4IEYA 5CVRA 3V0BA 3I3EA 3LIHA 4BQ1A 4QDSA 4V1PA 3I2OA 1DGWA 1OA3A 4C8DA 3P6BA 5CFDC 3IMNA 3MIGA 4JTNA 1R092 1DCSA 4NHKA 3LOIA 5T50A 1RUF1 2RDSA 3GJAA 4LA3A 3T3YA 4AGRA 3NL1A 1DLLA 2DU1A 3POBA 4MLOA 1GR3A 2SLIA 4LBQD 4ZKTB 1RMU3 3AKQA 3TN93 1HRI1 1KITA 4BK4A 1XBFA 5M0TA 1AYM3 2QDNA 4YRDA 2JXAA 1DHKB 2E33A 1FPN2 4XBQA 5HBAA 4JQTA 5FY7A 2GC3A 4Q4X2 3DEMA 4WVWA 1NUKA 3H7YA 1XOYA 3E5UA 1OQEA 2VPVA 3D8CA 1GU3A 3AL5A 2YHJA 3EHKA 4PJYA 5EHDA 4CP9A 4ZU7A 1PNGA 1IG0A 3HD8B 4R8HA 1AR81 3CMGA 1H8TA 3U75A 1PO11 4A6SA 1TME3 5F9TA 1C1FA 2PLV2 3D0SA 3WP4A 1FAYA 2QTWB 2R063 1W2TA 4I30A 3BTAA 4PBPA 5I8TA 2G4IA 3FLPA 1EY2A 4ZZ8A 1RVF3 1LHOA 4OCTA 2YU1A 2JB4A 2D93A 3DN7A 3WP6A 2PYTA 4RR3B 2R043 2OW4A 3O1SA 3ZFEA 2VNVA 4FPKA 3VBSC 2C6SA 1O4YA 4HMZA 4U2AA 3BGAA 3UGGA 2PHFA 2KXLA 1Q8OA 1W8UA 4GULA 3VDDC 3ZDSA 3GYDA 3MF6A 4IEQA 3POIA 3KT1A 3UESA 1OFSA 2ORZA 4FI9A 4DEQA 2WWJA 2GNTA 1Z78A 3NJYA 2ZGKA 2DFBA 1SG3A 5F8PA 1XSRA 4NMIA 1O7FA 4RGGA 2P2KA 3TEXA 2QQNA 1HKDA 2LS6A 4NUBA 5FY1A 1NKGA 3NNMA 1W9WA 1OSGA 1WCUA 4LBNA 4KMQA 4RL7A 2DUQA 3K4ZA 5D21A 5HCBA 4ES8A 4CEWC 5T5LA 2OX0A 5C5TA 1HXS2 1US2A 2V73A 1MEC2 2Y6KA 3Q9OA 4LE3A 3WQ7A 4RHV1 2VVEA 4AFAA 1UZYA 1BEV1 1BK0A 1MR5A 2XL9A 5FY5A 1K5MC 4QX8A 2XOMA 4XABA 4HVRA 2TEPA 1AR93 3FN9A 1UKGA 2VZQA 2WABA 5HCHA 2Y6LA 1GWMA 1GNZA 1UOFA 2W47A 2UURA 2YU2A 3H3LA 4H3WA 1WD3A 1SEFA 2HWC2 5IK4A 2QVSB 1CX1A 1KDMA 3CJXA 2VMGA 2JE9A 5FY9A 1CAWA 2ZS6B 5FZ9A 3TNPB 4WVZA 3PNAA 5FKCA 3TBDA 2WLPA 4IV1B 3ZO0B 3GZEA 3E6CC 3MI8A 2NLRA 5FPXA 1PO13 4Q0VA 1H2LA 2WO7A 5ERLA 1W8ZA 3MYXA 4F83A 3ZYBA 3J8F3 1W6OB 4G9SB 2W5FA 4AEJA 3NNJA 4Y3OA 1K45A 2I2SA 4ZY9A 1XYNA 3KZ4C 3LCPA 4JV4A 1XQNA 3PTRB 4Y22B 2FDIA 2JD9A 1RUC2 5C4WC 1ZZBA 2XGXA 1O4TA 4CXYA 3IM0A 4PQQA 4AYUA 3POYA 3KCYA 3U4XA 3RVHA 1UYXA 3EYPA 3HQRA 1J59A 3PUQA 4KNCA 1Q8VA 4CDWA 3B00A 3JXSA 2ARXA 1YLLA 4LJHA 1QQP3 5GLTA 3BKZA 3SKVA 5C9AC 4Q4W2 1ULDA 3FBMA 1ZBE1 1FMD2 5B2GB 4MGSA 2UY8A 2V4AA 2VTFA 3VBHC 3WHTA 3I97A 1LTEA 2RG4A 1WLWA 3ETPA 4XJAA 4N9HA 5E16A 3UETA 3KT7A 4BQ5A 5JMOA 1CGPA 2BGCA 1T2XA 5A1FA 1O5LA 2A3WA 5FFOC 3JB4C 1F4AA 4KI5M 1MS9A 2R32A 1S2KA 1S1AA 1VBE2 2EIGA 4YFWA 5IATA 1HDKA 3K75B 5A3NA 4LHNA 1YIPA 1GICA 1BEV3 1OUXA 2XJPA 1YQ5A 4QPGC 3VKMA 4QPIC 4N53C 1DZTA 3CZUA 3BUCA 1O3SA 2YXSA 5T54A 3MPBA 1U5YA 4L11A 4MX3A 1HB1A 3VBFA 4AVAA 2D6PA 1ENXA 4F3JA 1AZDA 1DBNA 5T5OA 1GOGA 4QXHA 3A4UA 3WW2A 1O3RA 1PK6A 4NIGA 1JU3A 4NR1A 1MVQA 1G9CA 2PMWB 1AL0G 4RS5B 2ZOEB 2AEZA 1LOFA 2K9ZA 4V2WA 4AOCA 2HH9A 2Z4FA 5APAA 1BJQA 1MZEA 3H50A 3LEMA 4IE6A 2D6MA 3F95A 5DDJ2 3U4SA 1NZCA 2VNGA 2WRAA 3FE5A 2EALA 1GYKA 2P6HA 3WG3A 5IHRA 1VP6A 1W6QB 2E9QA 5B4XA 2D44A 3BOPA 4N9IA 2NZ9A 1PIV2 3NJXA 2WYSA 2JG8B 1BBT3 3KV6A 3ZOIA 5FQ0A 4LPLA 4DQAA 1W8HA 1D4M1 2XB6C 2YY1A 1H1AA 1L7QA 1FV2A 1SLAA 3KCCA 1ODNA 2WWUA 3K77A 2Y64A 4WM8A 4HANA 4ONUA 1ZYBA 4OYUA 1GLHA 3HVDA 3A7QA 2IVJA 4URAA 4Q4V1 2D5HA 1AL21 3AXEA 1OHFA 4IV3C 2WNVA 4D3WA 5BXXA 5IW0A 3JCIA 4BQ2A 4OVEA 1YC61 1DIWA 1IQDC 1QXPA 5GLWA 3S5AA 3WUDA 1X9TA 1XRUA 2XKPA 4QKNA 3I2JA 2EICA 2XJVA 1DU3D 2BOIA 3WZ1A 2NM1A 5LCWL 2X5IB 3TYJA 5E8AA 4RS5A 4KL1A 4ZU5A 2W95A 4JGYA 5BNNC 2WSUA 1DFQA 4WM7A 2H6BA 2WN2A 3VBOA 2YGLA 4G4FA 4XE9A 1A3KA 2CSGA 4KBZA 2ZJCA 1QNYA 1WMXA 3R05A 3OOXA 3RRDA 4AZZA 1H6XA 3JD71 4HONA 4A7ZA 3CHXA 3UKNA 1GWLA 5JI7A 4CDUA 3E6DA 2NP0A 1QNWA 3M8LA 1N1VA 1RUI3 2P37A 4XDQA 2XUMA 1SCRA 2H6CA 1I1EA 3R4DB 3R4UA 4AQ2A 1W05A 4CUCA 2JG8A 4GMP3 1ND3A 1C8M3 4K1ZA 2BEOA 4LMFA 3PMEA 4YZ5A 1PHMA 1DLCA 4XTPA 4EWAA 3FFQA 2UYAA 2WO3A 1S0GA 4CP0A 2Y8KA 1CWPA 3MW2A 1BK1A 4NN0A 1YIFA 2CWSA 4HN0A 1QJY3 4UI9L 3TEWA 1WCKA 4TSVA 1FX5A 2A3XA 1O3QA 4A7KA 2JDYA 1B35B 3F2ZA 3G6JB 3OGGA 5FZFA 2GMEA 5KWRA 2Z5WA 4CUBA 3VD7A 2QQOA 4XUOA 2FDGA 1HB3A 2BP6A 3ZM8A 4XDPA 2E7QA 3NW4A 2A7AA 3J7LA 5FPAA 1FT9A 3EQEA 3ASIA 5KHIA 2PQSA 2HKXA 5K7PA 1CR7A 2ZGTA 2CYFA 5BNOB 2XXZA 1O8PA 2CDOA 2F6BA 1UX7A 1VAVA 2B39A 2JDPA 3P5BA 5FYHA 3VBRA 2C4XA 2BGPA 4DS0A 1UY0A 5FZLA 1K42A 2IXIA 4BMEA 1DQ5A 1GZTA 1UN1A 2OIIA 4DZGA 3ZSLA 3ABZA 4AHZA 4SBVA 3I2FA 3RWKX 4B3NA 1PMJX 5BPXA 1LENA 3OGJA 3LEGA 4P14A 4CCDA 1QOTA 1RYYA 2GC1A 3I2GA 2Y33A 3CBNA 1VBB2 3AP9A 2WIIB 4Q4Y2 4YVWC 5C5UA 3I3MA 1W28A 2E7TA 4Q26A 4YW3A 1CJPA 1Q8SA 4LNVA 2HEVF 2VOKA 2VCMA 3B7MA 2VQAA 1S0JA 3BTYA 5JMCA 3SLIA 1ENRA 1ZBA2 5JWPA 1SZBA 1W9YA 1F35A 1WZXA 5FZEA 2PHXA 4ISRA 3B9CA 3MUY1 2ZGRA 1UAIA 1V9U3 1RUH3 1J1TA 1PGW2 4IW3A 4C90A 1CESA 2PQQA 3DF0A 4M00A 1TMF3 3N35A 4Z2AA 4P9WA 1R1ZA 1BCXA 4Q4W3 3WUCA 2VZPA 3J26N 1ASJ2 2XHNA 4GJZA 1NXD1 1V6NA 2BERA 2WT0A 4GZ9A 2GC0A 1BMV1 1VBC2 5FZMA 1FV3A 2RM22 4BH9A 5DUWA 1W8FA 3AP4A 5LWBA 2WO1A 4J1XA 5GLUA 1WBLA 2LTNA 3HQUA 4QKDA 5FXWA 1NA1B 2RS52 3WXPA 5A3MA 1YFUA 3BPSA 3PL0A 4XQ4A 5D8AB 4QQPA 4M3CA 3MV11 1US3A 3WNNA 1HV0A 5BNOA 1CX4A 1Q3EA 3IDEA 4Z92B 1QGLA 2PHTA 3AZZA 1CQ9A 1MS4A 2AACA 1W39A 3QACA 3LWCA 4AVVA 1PVC1 4CVUA 1JUHA 2BDRA 1HV1A 1JYNA 3JBG2 2JB8A 2V72A 2G1MA 3BN6A 5T55A 2DF7A 4IGQA 4E2QA 2Y6FA 2WZR2 2XDVA 2YPDA 3MDPA 4RQPA 3WT3A 2RR12 1I9RA 1RINA 3H9AA 4PDWB 4XHBA 1REDA 1KXGA 2HYXA 3B9IA 5FMOS 2RE9A 3IDCB 3LF7A 1MS3A 4XURA 3T0DA 1FOD2 2FHRA 4FTSA 3MLJA 3VBUB 1JI6A 3N9MA 5L9VA 4OI1A 3AMQA 3VKOA 3PLQA 4A6OA 4R4ZA 2HYKA 1LNSA 1QOOA 1XYPA 2ZEYA 1RXFA 2QJVA 4IE4A 3POEA 1NZIA 4IE5A 4J1WA 4LQRA 3WDWA 5JPMB 1HQLA 4UT5A 4D6RA 2BW8A 5KXBA 2ZEZA 2I07B 4D7TA 3OEAA 2VM9A 1R1A2 4L92A 1S0DA 1X9PA 3WW4A 4UFMA 5I0SA 2OUHA 1H4HA 2CGPA 4CU6A 3HBKA 4GD4A 4Y4RA 2D40A 4LORA 4AI8A 4Z2WA 3VZLA 3GZAA 2PTMA 5A80A 3VD3A 2CHHA 2ZTNA 3WP5A 4E27A 2JICA 5JDBA 1U5IA 2HWE2 2AUYA 3J7HA 4FP3A 4HSLA 3I49A 3KV5A 3VD9A 5JXGA 4UYBA 1NA1A 3WCSA 2YFUA 2NQYA 4EZHA 1F2NA 1FYUA 1UZWA 4B4PA 4C0BA 1BVP1 1JXNA 1O8SA 3UNPA 3GNEA 2G9FA 2R072 1JYCA 2HWF1 3PVNA 4UF0A 2WQ4A 4HPKA 1HJFA 2BFUS 3KS7A 5CADA 2OQ6A 5FYCA 4NHXA 2LRPA 3ZKYA 4DUVA 2JDHA 2ZHNA 1AVBA 1VPHA 3RZGA 1QJX1 2DVFA 4AVTA 5J09A 3C7FA 1YWKA 3O1MA 1TG7A 2OA2A 2RV9A 3UGFA 1IHMA 1RMU2 5SV8A 2CWMA 3TN92 4KGGA 1ULEA 4PDWA 3ZXGA 2VR4A 3AJYA 5ABJB 3S30A 3VBUA 1WW4A 2ZEWA 3IBMA 1YHFA 1LESA 3ACHA 3DKWA 4RD7A 4BLJA 3RQ0A 3RJ2X 4LBJA 1JZ7A 1BHGA 1RHI2 5L36A 1YFXA 4BISA 3I3QA 1TME2 3HWJA 4HKLA 2WFF3 4S2DA 3M1HA 1OT5A 2QQVA 1RUNA 3B5LB 1OKOA 4DMIA 2WC2A 4NHLA 2E53A 1AYN1 1AR63 1PMHX 3NNFA 3VKNA 2I45A 4XACA 4FFFA 4DNYA 1JH5A 3MIDA 4ARXA 2BPA2 5FK7A 2R042 3CDZB 2DUOA 1ODMA 3WDTA 4FOQA 4FPOB 4KGQA 4QWNA 5F3CA 1VBA1 4Z1VA 3ORJA 1POV0 4HKOA 1KJLA 5FYYA 1QJU1 1WLDA 2GSYA 2QQWA 4OZXA 5J98B 5LBCA 4BU2A 4LUMA 1DP0A 4JAAA 4XFAA 3GXUA 2XQXA 3VGIA 1G9DA 2VOXA 1D2SA 1MZFA 3E5QA 2OXBA 1URXA 3H8UA 5FJKA 4HOOA 3PUIA 4GB31 2B42B 5C8WA 1J58A 3WLUA 4TTGA 5ACA3 2HEYF 3LZZA 2BFUL 3MGUA 1IQAA 4XUTA 5FXXA 3FHQA 5A1AA 2JIGA 4INDA 5EQUA 3S7EA 1LEDA 2OQ7A 5JZGA 3BIEA 1ZA7A 2E31A 3WV6A 4W50A 2PN5A 2YFZA 5DG2A 3EJKA 5ABJA 2OZ6A 1JYTA 1TE1B 2VNOA 4OULA 4IESA 2G9GA 2Z2SB 4ASKA 2PHDA 4GALA 1QWRA 1AR92 4GH4C 2E63A 3UJOA 1GQGA 2B8MA 4JKMA 4IEPA 1POV1 3C7EA 5A33B 5I0DA 3ZXAC 2HEWF 2GNDA 4DUXA 2VNRA 5EYYA 1NOVA 4YARA 1S0FA 1XJAA 5SV5A 3I3DA 2XBO3 3RJRA 3CJIA 2GP3A 5CB7A 4UOJA 4MZUA 4QDRA 4EV0A 2GH2A 1MQTA 1PO12 2DVAA 3ZFGC 1SLIA 3NJVA 5IT6A 1LULA 2DDUA 4X8PA 2W0XA 4EWDA 4LR4A 4IUGA 2HWB3 2WJSA 4JC1A 5FPZA 3AZYA 5FYIA 5FYUA 1LHNA 2VW1A 3VLBB 5C6CA 3FUOA 1MS5A 2C5DA 3WG1A 2ZGMA 4XZPA 3RYKA 3DPRC 2BVBA 3H42B 1AXYA 3EB7A 3WQ1A 1W9FA 3AP6A 2BZDA 4Y5Z0 1W2UA 3DXUA 2GNBA 4CDQA 2A3YA 4K6BA 1V6OA 3WINE 3BTXA 4Q1RA 3GBFA 1OQDA 1AX1A 5EJZB 4PBOA 3WCRA 4CDXB 4Y33A 2WS93 1QQP2 2L9LA 3GGLA 5GZGA 1CD3G 1ND2C 4Z07A 3JBG3 5F3IA 4YYOA 5DZGA 4FPGA 3WEZA 1YRZA 4BIFA 4CPBD 2FQPA 5KR7A 3KHCA 1WUVA 2F4LA 3PUHA 3SEPA 3VBSB 5F7UA 4IETA 3ZFFB 1QJEA 2AGSA 1OPMA 4YGCA 2VZSA 3WDXA 1COV1 3WX5A 3ZXDA 4BZ4A 3O1OA 1GZ9A 4AEMA 3VDDB 3OY8A 2B4KA 3KGZA 2YC2A 5LB6A 1W2AX 4QX5A 5FYTA 1FI2A 5C3SA 1V6LA 2RVAA 3RNSA 1BEV2 4PLMA 4AG4A 1RUG1 2Z79A 5DUVA 1HQNA 1RUE3 1V6MA 2W3JA 3FL7A 4KWUA 3W9AA 2FDKA 2XLFA 1JU4A 4YM3A 3O0XA 2XMLA 1JW6A 4NIDA 3LOBA 3SEEA 2WNUA 3CO2A 2XHKA 4KG8A 1Y9GA 3H8RA 3S5QA 1RUD1 3EMRA 4K40A 3T09A 1W03A 3AC0A 4JTOA 4AXOA 2FCVA 1BKZA 5F6KA 4FFHA 3KV4A 4HBNA 3LA2A 2PXJA 2ATFA 5D2AA 5JUVA 2VBPA 3HBZA 2VQTA 2VULA 2ZX3A 3NAPC 4FOVA 5FZCA 5LA2A 5JOWA 4FO9A 4S2FA 1RUJ3 2WZPP 1H8VA 4DRRA 2RS33 1E5SA 2W2IA 5FUIA 4C0HA 4RFRB 3AP7A 5T5JA 1HN0A 1F5JA 1K5MB 3GF6A 1X8EA 3OD0A 4RGKA 5IVEA 4XC9A 5F5IA 1VBD1 3QLQA 3T1LA 1MVEA 3KGLA 5JOYA 5AFBA 3J7NA 2R073 1NT0A 4I0WB 1H9WA 2DU0A 5F32A 4EN6B 3ETQA 4IEVA 3ZYIB 3RMYA 3OPTA 2VUJA 3NWKA 4CDXA 4AI9A 1XXNA 4LO6B 1BBT2 4D7YA 2JG9C 2ETEA 4H7LA 3T2QA 5C8CB 3SH3A 4IEOA 5CZKA 5C3RA 3TEZA 4LOTA 3WNOA 2XONA 3ZSKA 3FLRA 3U0ZA 4QXCA 4XDOA 4YVSC 3N7LA 4M4RA 3ZYGA 3ZFFA 3UKVA 1SPPA 4TWTA 1ZVFA 4QX2A 1Q8PA 1T6GC 1LU2A 1S0BA 1OH3A 3AKRA 5JVVA 3TNQA 1X82A 2OKXA 3MEPA 4R9CA 4AE2A 1E5IA 4KU7A 4MVTA 4YWAA 2Y38A 2ZBJA 1SACA 1WMEA 5C4WB 4L99A 2WFPA 2RMU1 1RHI3 1YJLA 3WDYA 5IFTA 1XNTA 1KS5A 1VRH1 2QKDA 3NNGA 4QAWA 1E5HA 2IVIB 3LIGA 4NRQA 4RA0A 1NCRA 1BLZA 2UY9A 5J7MA 3LSEA 3UV9A 5CFCB 1HRV1 4GJYA 5EIYB 5I91A 4M01A 5C9AB 1OOPA 5A32B 5L73A 4NIAA 1ZRDA 2Y0IA 3AKSA 2J1SA 1UU4A 4OFGA 3MIBA 3VBHB 1LRHA 2JEMA 5C3QA 4CP1A 4K9SA 5GJ6A 2IXJA 2QZ3A 1DQ0A 2R49A 2RS11 2WBKA 1JTZX 2A6VA 1JOBA 2Q5TA 5GALA 5K0UA 5A1LA 4KWLA 4NWWA 3HPNA 1WBFA 4E8CA 1VMJA 2W1SA 1RUI2 3INAA 4EE2A 4Q0PA 3VZNA 1UYPA 5J36A 1XE0A 5CA6A 3NV4A 1DGWX 4XIOA 5LATA 3UJQA 5C8CA 1C8M2 4EN8B 4L8QA 3DECA 3H7JA 3KQRA 2R0HA 1YI7A 4YM0A 3SH5A 3WNKA 1VIWB 1REFA 3HQXA 3VZKA 3WVJA 3W20A 1EV11 1HIXA 2DCJA 4XVHA 3ZXFA 3S0MA 4BQYA 4FPYA 1QJY2 1ULFA 1XPWA 1YO8A 1GZCA 2XJRA 2YMZA 2A75A 4D94A 1RXGA 1RUF3 5LRSA 3MZHA 2V5YA 4JGZA 5C70A 3JZVA 3AFGA 1H8TC 3D3AA 5DAPA 4X6RB 3BYWA 1J3QA 5LY1A 1HRI3 3IAQA 4FPHA 3OD4A 1D4VB 1KFUL 1OA4A 1OUSA 1L7LA 4PIYA 3SCGA 1AJOA 4NRMA 2VMHA 3RZHA 4JGZB 4Q4V2 5FO8B 2QUOA 4RYDA 1IPSA 5D1IA 5FCCA 5H9PA 2VZRA 1STMA 4ZZ5A 2X8KA 3ZFEC 5CFCA 5JPNB 3E5XA 1NE6A 2JKBA 1AR83 3A21A 3QCWA 5FIXA 1JN2P 2RMU3 4RR3A 5A70A 3IAPA 1LHVA 3VHRA 4IXLA 2WT2A 4FTBA 4COUA 5H9SA 5A3OA 5ANNA 2BQPA 3DUIA 4WZFA 1N3QA 4XFBA 3FWEA 4QQLA 3E6BA 3JU9A 2JX9A 2J7MA 3IDAA 1MPXA 5DG1A 3FUQA 1E5RA 1S0CA 3WQBA 4MOAA 3P1IA 4D0QA 4BQ4A 2P5BA 1NLRA 2R1DA 3HT1A 3VKLA 3W58A 2ZGNA 2VQUA 4IV3B 3AYAA 4S2GA 3A0KA 4N7UA 2FZ1A 3PVOA 1YYNA 1Z7S1 3H8OA 3MF9A 2QZ2A 5BNQA 1QH7A 5E88A 5FPUA 3J9SA 1V9U2 2CU5A 4CCMA 1RUH2 1TMF2 1VMHA 5FYSA 3RGBA 2PAEA 1XE7A 5JI9A 3PTYA 3KVAA 1EAH1 3ZXKA 4N43B 4I09A 3OYWB 4ATFA 1J3PA 4XF0A 4MH0E 1Y9MA 4EN7B 1NQJA 1R091 1U12A 3AYDA 2ID4A 5LA0A 5BNNB 4MHUA 1UL9A 3AX4A 1Y7BA 4PIZA 4YZ3A 4YVSB 2AEYA 3AL6A 3WNLA 4OHZA 4H14A 4JKLA 4Q8LA 1LJ7A 1ULCA 1LOEA 1L3JA 5GLVA 4OHVA 4RHV3 4ZS2A 1K5JA 1FPN1 5T52A 1HQWA 4JZRA 4Q4X1 1LOCA 2PHUA 4I3PA 5E89A 2EAAA 5C71A 5FP8A 4FPCA 3IKWA 4IV1A 4M3CE 4FQ4A 4UW5A 5FAXA 1OF3A 4EROA 3HN3A 4KWKA 2ZGPA 3BODA 4NHMA 3ACGA 4GMP0 3QD6A 4COVA 3BI3A 2DVGA 5FLHA 1GV9A 5JAXA 5FDBA 1EUUA 4CCJA 4JDOA 3ZXLA 1W6OA 2ADDA 3KHBA 2PLV1 1RTVA 2CY6A 4LIUA 3A0NA 4B8EA 3O12A 5EJ3A 1S0IA 4BJ0A 3ZIXA 1AHSA 4E4ZA 4Y22A 2XVGA 4IEUA 2MHFA 3H1YA 5FPVA 4JRLA 4NOTA 1W8WA 4SLIA 3UYJA 5FP4A 3ZPOA 4BE3A 3UT0A 2W9XA 5AC91 2UWBA 4JQRA 5FKBA 4GXLA 2I74A 2DCYA 4CDWC 1G9BA 3O7OA 3CEWA 5FY4A 4ASMB 3GDBA 1LR5A 4TZDA 2CDPA 3I7DA 3THTA 1CAUB 4MV2A 5KXDA 3M4FA 3WQ0A 3CL1A 2GZWA 1ULOA 5L7OB 5DQ0A 1OURA 5LRRA 4OHXA 4N43A 3WR0A 3OYWA 4TYSA 1QF3A 2R0FA 1Z7S3 4GA9A 4LITA 2VZTA 3QOPA 2Q8DA 3WP3A 2WNEA 1IOAA 5L9BA 1A8DA 5GZFA 5F5CA 3T0BA 5BNNA 1JHNA 3SNMA 5FZHA 2E51A 1BXHA 1H4GA 1ZBE3 3W5NA 4YVWB 1NAEA 1U5XA 2J42A 4B7EA 2JDNA 3LKJA 1W90A 4CCEA 4DXTA 1HXS1 1YQ2A 1MEC1 3EO6A 5JXIA 4XJUA 3VBFC 1MS0A 2XPJA 1W6PB 1YCIA 2CTVA 2VVFA 1PK6C 1R081 1IS6A 2FMDA 5HV0A 5LA1A 2ARCA 4W4ZA 4YZ1A 1U5ZA 3MUZ1 3OPZA 1XNAA 3BB6A 3LE0A 1VRBA 1LOFC 5LASA 4HVQA 2HWC1 5FPBA 3K4AA 1SFPA 3N9OA 5LK7B 2P3KA 4N7IA 1F9KA 2TNFA 3EXUA 2VZOA 1LU1A 3WNXA 2D3SA 4FFGA 4NAMA 3GZTB 2DV9A 1G9AA 4K8FA 1DYPA 1XC6A 3MLLA 4O65A 4QHZA 3D0JA 5J3UA 5KHJA 4QKBA 3VZJA 4MADA 2FMYA 5K4LA 1LEMA 1ENSA 1S55A 1TNFA 2XJSA 1AUYA 1CAVB 4UW3A 3T4HB 3TB0A 1W6QA 1UY4A 4LOSA 4D69A 1GZWB 3CZJA 2O1QA 3LD8A 3V65A 3GM8A 5K8SA 2R1BA 1CAUA 2WFF2 1ONAA 2ZGLA 3ES4A 1Y43B 1TEIA 4WBBA 1P8JA 5FXVA 1RUC1 1V0AA 5L7OA 1DYOA 2CL2A 1AR62 1X8MA 1QY4A 5AC93 4WM8C 2JWPA 1FNYA 2VECA 3LEIA 4ORFA 3RZJA 1SQ4A 4I3GA 3PURA 4Y4YA 2JDMA 3W5MA 4AQSA 4IEXA 4ZPIA 5BNPC 4OI0A 2WNVC 2WDBA 2YYOA 3DXTA 2DTYA 3M3IA 2VC9A 4C1WA 5J96B 4FPJA 4UAPA 4ATEA 2DCTA 4UBGA 1D4M3 1FMD1 1IKPA 3U14A 4CEYC 3OUJA 2Q8CA 1OF4A 2QE3A 3N7JA 1IKQA 4CEYB 3MW4A 1LOAA 3WY6A 1N3PA 3KM5A 3ZSMA 4Q4V3 2R30A 3AYEA 3WDUA 4LO4B 4CU9A 1AL23 2EXJA 4E4DX 1X50A 3AKPA 1VBE1 5ACA2 2RDRA 4JGYC 4IERA 3THCA 3WHUA 4XPVA 3TRSB 1SFYA 4WM7C 2X5IA 4Q1PA 3HNYM 2XUEA 3VBOC 1H2NA 5BY5A 5FZ6A 1M06G 1G8WA 5DZEA 1LECA 1EPWA 1QJX2 4QMAA 4OI4A 2W91A 4R52A 4CDUC 2Z69A 5FYVA 1PM4A 5GM0A 2IWGB 4MYEA 2WT1A 3SHRA 2WO2A 3M7AA 4I0AA 2VVDA 2FCUA 2JDZA 2JG8C 4GWNA 1ND3C 1AXZA 1H0BA 1GZWA 2W52A 5FYZA 4GKYA 4M3CF 2BBAA 1CPMA 4QXBA 2R6QA 4XETA 4F8AA 1GNYA 2P17A 3PUAA 1JODA 1UNBA 2JD4A 2BV4A 2XBO2 3ENRA 3JD73 3OSDA 4R9AA 4YGDA 5DABA 5DDJ1 1UQXA 3U1XA 1WA6X 4YG0A 1W3XA 1PO21 5FP3A 2QQLA 1W0NA 2MPFA 4AVCA 2EF6A 3I4IA 1NLQA 4ITCA 1IS4A 4PHZA 3DKQA 2Y0OA 3LAGA 4Y20B 1KS4A 2OZJA 2W92A 4UFHA 2J1EA 1EYBA 1B35A 2HWB2 2Q1ZB 4UW6A 3V64A 4DB5A 4DXZA 5FP9A 2FD8A 2CGOA 4LO8A 2VTXA 3HN1A 3N9NA 2ORXA 3DV8A 2ILMA 3IMMA 5IVVA 3E97A 3IIAA 2V5DA 1EUTA 2HWD1 5BV6A 5I93A 5EP9A 3JQWA 4YW5A 5FP7A 4IDZA 5FY0A 3VBRC 2VXRA 2VUAA 3ALQA 3NMBA 1W99A 4LKEA 3SKJE 4AVSA 3FX3A 5LW9A 4ZXKA 2NPIA 1S2EA 1H6YA 4NO4A 2VG9A 2VUDA 4TLFA 4OLLA 1QJU2 1O91A 1G9FA 2ZZJA 2WS92 4HN1A 1YXWA 1QMJA 1YFWA 3B02A 2QQMA 4P9GA 3R6SA 4A44A 1GFF2 3ACIA 1BYHA 3NKGA 2C26A 4NPLA 1XSQA 4GB32 1GQHA 5AFEA 2BNNA 3KF5A 4YG3A 3ZKUA 4K21A 3BALA 1OFNA 2NN8A 1GWKA 3RDIA 4A42A 5KC5A 4NIIA 2W1WA 1QXJA 3VHNA 1H9PA 1UZVA 3HAGA 4BYYA 2B7YA 3FHAA 2UWCA 4NAOA 5CISA 1YFYA 1C8NA 1V00A 2DBNA 2ZX2A 1JMUB 3I59B 3NVCA 4XXPA 5A3UA 4I2OA 1SBDA 1RUE2 4CU7A 4K1YA 3OBRA 1TQ5A 4DIQA 3ZPYA 4GQ7A 4E8DA 3PU8A 4I01A 1JBCA 5FZBA 4DO0A 1V6JA 4LBKA 2YROA 1A78A 4XHXA 2WKKA 1T6BX 2DTWA 1KFXL 3ES1A 3OBTA 4Y20A 4AEDC 1WW7A 4XF4A 5FOBB 3MO4A 3V0AB 2Q1MA 1XB9A 5FK8A 4LO7A 5HI0A 4QD2A 1RUJ2 4NPRA 3I2HA 4LHKA 2RS32 4GIQA 3H8XA 2ZA9A 1PZ7A 2VQ0A 2YV8A 3IZOA 3N9LA 4QPWA 4QHOA 2ZGOA 3OUIA 4J25A 4AAXA 4PI0A 2BWCA 2RJKA 3GALA 4HK8A 1OLME 1Q43A 5D8AA 2Z42A 3NSTA 4NE9A 3ZN6B 5IVJA 1S2BA 5EYXA 2YPJA 3MHZA 4AR2A 4DOUA 4OUEA 2BGOA 5FYMA 1QHDA 2VW0A 4A7YA 4QQHA 4RQPC 4URTA 3UL2A 1G86A 5F3GA 2YBSA 4CCCA 1GMMA 3M3CA 2VGDA 5JIAA 2YG0A 2A70A 3MLKA 1SDDB 3OTFA 1JS9A 5ANQA 1ENQA 4HKWA 4OI2A 4AEKA 4DFSA 1PVC3 1VR3A 3L9JT 4P9YA 4Q0SA 1JZ6A 2E6VA 4LTAA 4J6GA 4NVPA 3LPGA 4LK6A 4MXWB 3BTZA 5JXJA 4IGOA 4HZFA 3ECQA 1W2OA 2LM3A 4FPEA 3ACLA 4FAHA 4BLIA 3DPRB 3EBRA 4LBQB 5FMOL 3M2MA 4EWEA 1JZ2A 1PX4A 2O0OA 2VMCA 3APBA 1VBB1 1WLCA 4A2UA 3U78A 1PX3A 4Q4Y1 3ZSEA 2RJLA 1NY71 1RIRA 4KH9A 1PZ8A 4GAZA 5LEKA 4BXSV 2BTVC 2VD7A 4H55A 1RUG2 1UIKA 2HBUA 3N36A 3DCQA 4FXKB 4NWVA 3T08A 3WNMA 3V0AA 4AVBA 2JE7A 1VE0A 1OA2A 5FZ4A 5IJRA 1X7NA 1NA1C 1POQA 1NLSA 1PGW1 1IZ3A 3WSOA 1RUD2 1V6KA 4YW6A 3WF2A 5CG8A 3KD4A 3SC7X 3OPWA 3USUB 2Q8OA 4UW4A 1ASJ1 4OZOA 2J1TA 5FZOB 3A23A 1VBC1 1SBEA 2PHWA 3OB8A 1LODA 4YM2A 2RM21 3I2IA 2ZX4A 4Q2FA 3WG2A 1M4WA 4LIVA 2B45X 4D7SA 1PGL2 1DF0A 2IXCA 1J83A 3N9PA 4MUVA 1ZA4A 3L2HA 3C3VA 2RS51 1Q8QA 4PDWC 2XWJB 4JCKA 2HWF3 4QX7A 3PIJA 1XNBA 2W94A 1WCDJ 4Q5OA 5EXOA 3BOWA 4B1MA 4BDVB 3HIFA 4AF9A 1AF9A 1AR71 1U0AA 1TNRA 2A73B 2P34A 3NAPB 5A7WB 3T30A 1QJX3 1RUF2 2VMDA 4XILA 2PAKA 4MXWA 5CKQA 3N7KA 2WLQA 4FBFA 4Q0UA 3MICA 3RS6A 1HRI2 4BMBA 4NRPA 4LBQA 1KDKA 3Q8BA 4FPFA 4XJ8A 2Y26A 1F15A 2RR11 3CKHA 3FJSA 1NE4A 1V70A 2O8OA 2WWSA 3KV9A 2GNMA 5F5AA 3W59A 3WNPA 5HCAA 1C1LA 1AXKA 1I5PA 5LBEA 4TN7A 1Y4WA 4Y1UA 3SISA 3WD5A 3RFRA 1FOD1 3AZVA 5CFDB 5K9YA 5AVAA 4HSJA 1AR82 3VV1A 2JG9B 2RMU2 1YQCA 3ZR6A 4WZCA 3K51A 3ME2A 5F1RA 1W8OA 3ZYPA 1OKQA 5GKAC 2NYYA 1R1A1 4XUPA 3AK0A 1UU5A 1AYN3 2A6WA 3M3QA 2VOVA 3MIEA 3USUA 2BBVA 3AB0A 2D6NA 3D4KA 3M3EA 5LBFA 4P00B 2B9UA 1CZVA 1JYWA 4D6SA 5FZOA 1CIYA 2XJQA 2FDJA 4QT6A 4XQDA 4IE0A 3GJBA 4AWDA 4DINB 5J37A 4QPYA 1VBA3 4IQPA 2RS12 2HWE1 1QJU3 1UMZA 2BUKA 2AREA 1DGRA 5C3PA 2WN3A 2Y60A 3P3PA 4UBHA 5JZGC 2BWAA 4W6WA 3WG4A 3THPA 5CBLA 5C33A 3AMPA 5T3NA 1DYKA 2CGNA 5ABJC 5F5QA 2VMIA 1S4CA 4XMIA 5JR7B 1FATA 2W46A 4GB33 5IAXA 2QQPA 2X09A 1OQ1A 1JOPA 1DQ6A 2Y6HA 1G6NA 3ELNA 4FFIA 1PMIA 1YEWA 4E2GA 2X29A 1YQ6A 4CCKA 3NV3A 2ZEXA 1EV12 4A45A 3V0BB 5A3PA 1WW6A 3TN91 5A33A 4X8NA 2ENRA 2VE1A 4AK3A 1LOBA 5LEJA 1AYM1 4RHV2 1C28A 4GWJA 3CJIC 1UXXX 5JSRA 4YW1A 3L2YA 2O8QA 4XYXA 2JKXA 4AQTA 2AC1A 1MQTC 4FAGA 4WVMB 4DY5A 5FZGA 5CFDA 2W68A 3LA3A 4FCAA 4P9LA 1W0PA 3D5OA 3IT8A 1LKNA 1POV3 3VN4A 4F7ZA 4FT8A 4AHYA 3H3UA 4OQ9A 4MGZE 4YW7A 1HX6A 4FP2A 3POJA 1SMVA 4CEWB 1TME1 2CAUA 5FJHA 3O1VA 1WWYA 2R061 3ZDVA 3RI9A 4YGBA 3LDKA 5JIUA 1WMDA 2PAMA 1RVF1 1UY1A 2VZ1A 4G3YC 1HJGA 1NCQC 2IZWA 2JDAA 3B69A 3LGRA 2R041 1H8TB 1CVNA 4CDQC 3U10A 4H7MA 4XCAA 2QQUA 5DPNA 3IB3A 3O1RA 1VALA 2P4EA 3KWVA 3HT2A 1ZZCA 4BB3A 2GN3A 1W2NA 2E32A 2IFWA 2W39A 1SCSA 4R9BA 5J1XA 2BJSA 3P3NA 4B4QA 2ZX1A 3OCPA 3WF3A 1DG6A 3ZFEB 1KRIA 3H1MA 3BU0A 4JKKA 1O4ZA 2UWAA 1Z7S2 3VBSA 1OH4A 2QBXA 1W06A 3WOGA 4D6QA 1SLTA 1HN1A 1ZRIA 4B7KA 4CCOA 3LDRA 5FZ0A 1ZRFA 5FZKA 4OMDA 1ZBE2 3VDDA 3WF1A 4XFHA 4P9XA 4META 4IGPA 4MXVA 4N8MA 2YB7A 4XF9A 3PUSA 2ZAAA 1SLLA 4IL7A 1JZ8A 2BNOA 2WNUC 3KF3A 1COV3 3MIFA 4WVMA 2QFEA 1I3HA 1MS1A 1OLQA 1W6MB 2W1QA 3VUOA 1OXCA 2E7AA 2LROA 1AR91 4EN9B 2EXKA 4FPLA 4XJZA 2GMPA 2Q8EA 4CEWA 3TWIA 1RUG3 2EIBA 1I5ZA 4A3ZA 1QIQA 1SLCA 4CP2A 3VDAA 3NRUA 2GP5A 3V56A 3OBZA 2C24A 1J3RA 2XLAA 5EPAA 1VAKA 5T5PA 2ZKNA 1RUD3 4L0PA 2ZCWA 1F4HA 3LA7A 4JDNA 1K5MA 4UWDA 4AI1A 4BK5A 4C91A 3LFMA 3C7GA 4YZ2A 5FR3A 3H1WA 2ZGUA 4NJ4A 2X53S 3J8F1 3RZZA 4CDXC 2KD7A 1CAWB 3OEBA 4R4XA 3ZX7A 3AM2A 3SXWA 4LE4A 3T2TA 1WKYA 4QPGB 4QPIB 1W3VA 4N53B 1B09A 1O5UA 2ZAHA 1VBD3 5I0UA 3ZVXA 5AC92 3ZFFC 4KG0A 4XW3A 5IAVA 2FBEA 3VDCA 3POFA 5FY8A 2A6YA 3ROUA 1UMHA 2C0ZA 3I2DA 4ZXEA 1RB8G 4CE8A 4B1LA 2VOTA 1D0GA 4O7XA 1C5HA 2G19A 1ULPA 3C8XA 1V6IA 5CKNA 1QQP1 3G7DA 3OBAA 4K7JA 2TUNA 1D4M2 3SQOA 3CF6E 5FZIA 3LEKA 1PVXA 5C4WA 1UF2C 4QX0A 1RJ7A 3T4VA 1H1IA 1LHWA 5EV7A 2QNKA 2JENA 2RJ2A 5AVPA 1NCRC 3U11A 5KXCA 1W6MA 2EA7A 2EVXA 4CDWB 4MGIE 4BQXA 1GP4A 4AFMA 1AL22 4EJRA 1OOPC 3E1F1 4B29A 3HMYA 1H2MA 3FBYA 4Y1YA 2MEV1 4N90A 5DUXA 2Y6JA 5C9AA 5A32A 5IVBA 5DN2A 2P1BA 2YUEA 1OD3A 3IWZA 4HG6B 1VRH3 4XFIA 4WV8A 1R082 5KHHA 3VBHA 2GAUA 5GZCA 5K0UC 3AKTA 1BVVA 3KCXA 1HRV3 1BQPA 2YC0A 3OJBA 4PLNA 1HW5A 3LB9A 4E9KA 5JR2A 2QQJA 4YLZA 3CNAA 3VD5A 2VCBA 3GHMA 3ZN5A 5C8CC 1Q56A 3ILNA 4Q27A 2ZKLA 1GOFA 3Q8AA 2A1XA 1KJRA 1SHWB 2D6LX 2RDNA 1VAMA 2WL1A 3GHNA 4QPGA 1OBNA 1ZZ9A 2RS13 4NHYA 4N53A 4QPIA 2VZVA 4XF1A 3VBFB 2IC1A 4CTEA 1ACCA 4DEVA 3JD72 4YW2A 3PJYA 1JZ3A 3RMXA 5A7NA 5F3EA 1PK6B 4AAPA 3QH6A 2ES3A 3T2OA 5A6ZA 2VY0A 3CLPA 2VTXJ 2G9ZA 4HK9A 1Z0HA 2OS2A 2VMFA 3TOJA 3M70A 5DAVA 4JGZC 1N1TA 2KM2A 3S57A 1F8VA 2B5HA 4UFKA 3I3BA 4YZ4A 5FXZA 3RI8A 5C3OA 3PVBB 5KBFA 1ZZ6A 1YQ8A 4DRVA 2VBBA 1BBT1 1UO9A 2V4VA 3B94A 3Q8CA 4XTMA 4HLTA 3A22A 4CUAA 4NIHA 1CJDA 5FZ3A 2OPKA 4O9EA 4CU8A 2WINB 1EV13 3AVRA 3ZMOA 2DCKA 2BYVE 3AXDA 2GALA 5DAWA 1UY3A 4D8MA 2RDQA 5FZ1A 1QH6A 5HV4A 4XQWA 3U07A 1E57A 2K0GA 5F2WA 3ZN4A 5CFCC 1Y3TA 1DZQA 4RR3C 3RZMA 5FQ0B 1DGLA 2JDKA 1OVPA 2AYHA 2P3YA 4LHLA 1AX0A 1MZ6A 1QEXA 1GOHA 3H0OA 4W6YA 1IPJA 2R16A 1WCSA 4OMCA 1N3OA 2UYBA 2B9VA 3KMHA 4WM8B 4YNIA 1YNAA 4CXWA 3USSA 1ZREA 3AMHA 2IXKA 2VOWA 1UX6A 3K46A 4K8RB 2WQZC 1PZ9A 2MEV3 3FMGA 3SH4A 5BNPB 3RZKA 2NMNA 2WNVB 2WUHA 4EQVA 1C57A 2VH9A 1S0EA 3C7HA 4HVOA 2WZEA 2XVLA 3GCXA 4IV3A 3AYCA 3OUHA 3O0WA 5FMDA 2ZMLA 5B4NA 1TVGA 1YUDA 5CYYA 3VZMA 3Q8FA 2VU9A 1OMIA 4PF5A 5IVYA 1CONA 4CRQA 2ET7A 3N3HA 5FWEA 3GBWA 4RN5A 3LPFA 5E6HA 1EP0A 3THDA 2D43A 4OUSA 4HL0A 4CCLA 1RUI1 1ZM1A 2WNOA 4JGYB 3ZSJA 3GZUC 2H0VA 4WM7B 4X6QB 3B3QE 2YC4A 3AFKA 4Y26A 5FLIA 4W65A 3VBOB 3WW3A 4YFZA 4GMP1 4ZU4A 1C8M1 1LCLA 5HCFA 1IS5A 1KEXA 1PO22 5JCTA 4COZA 4O61A 3DYOA 4Y5SA 4CDUB 5FLJA 1EAH3 3T0AA 2DFCA 5DAQA 3BVCA 3LSDA 5CU1A 1BMV2 3UGHA 2E26A 2WZ8A 2ARBA 5DXDA 4LHSA 2LUWA 2VCCA 5CIRA 1CPNA 4QGLA 1QJY1 5JSPA 1R093 4IV1C 1ND3B 4BWOA 5FYBA 3TAYA 4A41A 1D0HA 2YDEA 3WW1A 1XNKA 4DY3A 5I8SA 5CAZA 3RWNA 2FZ2A 2HWD2 1NXMA 3O5SA 4UFJA 1QJFA 1W0OA 1H30A 5A6XA 2DVDA 2DWRA 4MSVA 4QGMA 1UXZA 4QM8A 1FPN3 4RSUA 4XOGA 2ZX0A 3M3OA 4OQ8A 4Q4X3 2VAUA 2EXHA 4GWMA 1LB2A 4XF3A 2PFWA 4LO5B 1K12A 3UKTA 3ZXJA 5BNPA 2AENA 1PVC2 4AGVA 2OT7A 2Q1FA 4LLOA 1A8MA 2BVVA 4HETA 2EIEA 3LQCA 4R9DA 2CAVA 4P5YA 4CSWA 2D3PA 2PLV3 5FPLA 2XJUA 3K3OA 1RL3A 1PGSA 2VUCA 4XEZA 4ASLA 3VBRB 4Y1ZA 2WSVA 2Q0AA 1ST8A 4U36A 4N43C 2VZUA 3ZIWA 4AW7A 2D7FA 1L7RA 2XH6A 3K4DA 3Q8EA 5LK5A 2GH8A 2ZMNA 4L2NA 5TSWA 3ZMNA 1X36A 2VZ3A 3FC0A 1O3TA 1LAJA 2YBPA 3OF1A 4MGKE 4HT1T 2LALA 4LEJA 4YG6A 4LBMA 4LKSA 1IG3A 1V9U1 3SCHA 1R64A 1RUH1 2DCZA 1DDLA 5FREA 4A4AA 1TMF1 1W6NB 3HNBM 5FBZA 3AMNA 1LHUA 4YVWA 5A7OA 5IVFA 4Q4W1 5LA9A 3ON7A 2PA7A 4HFSA 5FZAA 3IPVB 1GQPA 4QKFA 1ULGA 3BCWA 4A3XA 1DQ1A 2C1FA 5G05L 1CZSA 3VHPA 4ET7A 2SBAA 3R0RA 4LA2A 4AI0A 2A6XA 4BHPA 4CYDA 2ERFA 2AH2A 4AHWA 1W6PA 5IYYA 4E4HA 1VJ2A 3RPQA 2PHRA 4CZSA 4DPNA 2JE8A 5A7PA 2GC2A 2XQRA 4MG2A 2IFRA 4RS5C 1HXS3 5A6QA 1MEC3 4B4RA 2HWF2 3NV2A 3PMSA 1IS3A 4QU2A 3VDBA 2BOJA 4LBOA 4AEDB 3QH7A 1R083 1NX9A 4AI2A 4BM8A 5J48A 3POSA 3ITQA 5FWJA 3B93A 1GBGA 1WMFA 4MGQA 5IK8A 3ILFA 2JDUA 1UPIA 1JHJA 4MO3M 2HWC3 4NROA 1CAVA 3IDBB 4M3CB 4QDQA 1HB2A 1O59A 5FUPA 2X05A 5I0RA 5G04L 3RZLA 1IGOA 4M4PA 5DMYA 3MFCA 5L7OC 1MACA 2CV6A 3PDQA 5JLVA 1ALYA 3O0VA 1YJKA 1XU2A 2D5FA 2YZ4A 4K3UA 2F17A 3NQHA 3R4SA 4IEWA 5LBBA 4RQPB 1LOGA 4BOWA 2FDHA 1ZNPA 4BA6A 4TLGA 4EYUA 2VBDA 4XFCA 1PIV1 1NY72 3VD4A 5E1RA 4QHBA 1RUC3 4PF1A 4Q0QA 5IUQA 1W6NA 4FTEA 1AYN2 3PHMA 1JOJA 1C3HA 3PJQA 4XUNA 4AHXA 4LXLA 5EFUA 3S7IA 3IPVA 2YGMA 2UU8A 5HXVA 1QU0A 1W8TA 1UKRA 4S2HA 5JOZA 3POGA 5KC6A 2ET1A 4CEYA 2NMOA 1CIWA 1WGPA 1GKBA 1XNDA 1VBA2 4JRAA 2W08A 2J1AA 3AP5A 4W8JA 4MGYE 4FSJA 1DQ4A 2X5IC 1FMD3 1H1MA 4RFT0 5JOXA 4P9JA 2OUJA 4EN0A 2XR4A 2YBKA 1OPOA 3NV1A 5BUVA 3MPPG 3NKTA 1GANA 4AEDA 1JZ4A 2F4PA 4PIXA 2WAOA 2XVKA 2D97A 2DYCA 4QXKA 1A6CA 2OPWA 5FZ8A 3LFIA 5IVCA 1VBE3 2QCSB 3K48A 5FBJA 1JYIA 3ZXEA 4P02B 2DURA 1SDWA 1VMFA 2XLGA 1F5FA 1KD7A 3KB5A 4W6XA 2JIJA 4LK7A 1RJ8A 3ZYHA 4BPZA 4BXFA 4JX0A 1AR72 4UF0B 4HPKB 4DXSA 2XWBB 4ARYA 5KXEA 1HLCA 4JVAA 2GDFA 2MNGA 4YGEA 1MZ5A 2IXLA 1G7YA 5EZWA 4XFFA 2XKOA 4M0NA 4BCUA 3TEYA 3I8TA 2WA4A 3AZWA 1B35C 3URFA 1QOSA 4MHRA 5H9RA 1UD1A 1I6XA 2DVBA 1N1SA 2VW2A 1H2KA 3FZ3A 2W1UA 1PM7A 3KVBA 4GKXA 4JHZA 3JB8A 4XMAA 5EJ1B 4O9GA 2IXHA 2WFF1 2BNMA 2ZMKA 5DDJ3 3ILRA 2ZABA 5LY2A 1PO23 1AR61 1UU6A 1JZ5A 1ZX5A 5L9RA 5BNOC 3D82A 4XJ9A 1ZZ7A 3S6PA 3WF4A 1PIV3 4XAAA 5LZ6A 4GH4B 2TBVA 2PHLA 4MGTA 3NO8A 1DGRN 4P9IA 1QDCA 4XIKA 3B01A 3BIWE 5FOJB 1LGNA 4FVVA 4ISQA 1SFNA 1XE8A 2HWD3 1GUIA 4XFGA 2JECA 1UPSA 2EXIA 3MIHA 1APNA 3JUUA 4AFCA 3ZFGB 4XBNA 2XG3A 4COYA 1KQRA 4K20A 3MBWA 2OVUA 3T1MA 5IK7A 5ACA1 1ZRCA 1UOGA 1UIJA 2P3JA 1GNHA 4LBLA 1UY2A 5DUUA 2Q30A 3OGRA 2V09A 4AQ6A 1UZZA 2XJTA 4BQ3A 2C9AA 4CPBA 3NJZA 1D7PM 3I59A 4RGAA 3SCFA 4BIOA 5F6LB 4C1XA 1W9TA 4QB2A 4TXWA 4BQWA 1COV2 2ARAA 1Y9QA 3BPZA 5FV3A 3POWA 2ZGQA 2HJIA 2B46X 2HBTA 2BRTA 3QBQA 3KT4A 3PIGA 1AYM2 1D2QA 5A3TA 5JZGB 3HJRA 3ZYRA 1UCXA 1FXZA 2GN7A 1ND2B 2DUPA 4UFLA 5BYNA 2WQ8A 1ZBA1 1REEA 1QXRA 4NPMA 1NG0A 2WR9A 3KLSA 2XBO1 4YPJA 5D8AC 1N1YA 2KA3A 2IUWA 3UK9A 4GWIA 4IE7A 4L97A 1BZWA 3SMHA 2VMEA 1ZRRA 3ACFA 2WYFA 5JXHA 4GH4A 1WLTA 2K46A 2O14A 3KQ4B 3ZN6A 2P6CA 4QX3A 4YSFA 2R062 4OUMA 3H3ZA 2HWB1 2VJXA 2HLEA 1RITA 1RVF2 3FHIB 5A3WA 3J4UH 5GZDA 1JUIA 2D6KA 1C5IA 3CJIB 4Z82A 1GP5A 4Y1XA 1MQTB 5FZDA 3MFAA 3I2KA 4Z8BA 1OVSA 2P3IA 3OGVA 1HB4A 2BU9A 1VBD2 1SBFA 1VLNA 3O14A 4KU8A 3IIIA 3K2OA 4FOWA 4KQ7A 3ZFGA 2WA3A 3N7MA 4JDMA 1DQ2A 1UOJA 3O1UA 4COWA 1W8NA 3VBUC 4HXCA 3X29B 1YI9A 2J22A 1K3IA 2R7EB 4E4SA 1NYWA 2WAAA 1DZRA 3ZYJB 4QU1A 3WF0A 2WS91 4EZ4A 5F37A 5FTTC 2Y6GA 1ZZ8A 5IFPA 5DAXA 3HEIA 4LUKA 1WD4A 1OC1A 5FUNA 1O6UA 5IK5A 2ZHLA 3JBG1 5A7QA 1NCQB 4JHTA 1X33A 3DPRA 4YM1A 5FRAA 3VKFC 1C4RA 2WZR1 4DXRA 4CDQB 3HNMA 1AX2A 4FXGB 4KBBA 3T2PA 4CCNA 1VB2A 2ZHKA 3CQOA 3KSCA 2ZHMA 3GCWA 4FQZA 3U37A 5L19A 1LGBA 5F39A 1VB4A 2KR2A 2QQKA 2ZXQA 5H9QA 3NNLA 5I0TA 3RYRA 4CXXA 5A3LA 2EAKA 5A7SA 5CKMA 2GU9A 4YW4A 2DBIA 4QGNA 1UMIA 1ND2A 3O1PA 1VBB3 4H2AA 1CAXB 4I02A 1WCQA 1KGYA 1RUE1 1VRH2 4Q4Y3 2ZGSA 4V2VA 2A5ZA 4XXAA 1RC6A
chains in the Genus database with same CATH topology
4E2SA 2QDRA 3WDVA 1WW5A 1Q5OA 1XNCA 3OY8B 5KHKA 1HRV2 3VZOA 4Q29A 5JSOA 2ZACA 1ZBA3 5EWSA 5CG9A 1OLRA 1MS8A 3ATGA 1N47A 4PQ9A 4AFBA 1RUJ1 2OYZA 1OD5A 4LLFA 2RS31 2WNUB 4M0HA 1WA4A 4Q8KA 1ASJ3 2RHPA 3FLTA 3J8F2 3VL8A 4PLOA 1VBC3 3CU7A 1UW8A 4OHWA 2RM23 2JJ6A 1QKQA 2R071 3NAPA 4XBLA 4Y1VA 4PCRA 4QM9A 4UXAA 1XYOA 1SLBA 2RS53 4IEZA 5DZFA 1NCQA 1GSLA 1QDOA 4P5HA 3ST7A 1RMU1 1PNFA 2Q4SA 5I8YA 1AR73 3RG0A 3I54A 5CNAA 3VHOA 2D6OX 2JG9A 1J1LA 2WZR3 3FFZA 4ES9A 2RR13 2A6ZA 1F31A 1CAXA 1RHI1 3RSJA 1CN1A 4LULA 4XJWA 3HR9A 1RUOA 4YVSA 3D6EA 4I0BA 1IPKA 4Y24A 1FOD3 1LGCA 2A71A 1QJZA 5FO9B 2MEV2 1AJKA 1OI6A 2CNAA 4AFDA 1R1A3 3DGTA 4FOYA 2D3RA 3RYPA 3JQXA 3GBGA 1FNZA 4WVVA 5FO7B 5KHGA 1NCRB 1NQDA 1EPZA 2D98A 2H0BA 5GZEA 3AMMA 3DL3A 3AZXA 1OOPB 2XL7A 4AGGA 2K2SA 4AI3A 1XU1A 2ZZQA 4QQOA 4LT5A 3PVEA 2AZ5A 2HWE3 3C2UA 1RGSA 4KWJA 3BU7A 3VL9A 3IN9A 4OHYA 3MW3A 3SITA 2AR6A 5K0UB 1PGL1 2N7GA 5GLZA 3N4MA 2PELA 4QQ2A 2ZPXA 4L9BA 3AJZA 1EAH2 2GMMA 4IEYA 5CVRA 3V0BA 4BQ1A 4V1PA 1DGWA 1OA3A 5CFDC 3IMNA 3MIGA 4JTNA 1R092 4NHKA 3LOIA 5T50A 1RUF1 4LA3A 4AGRA 3NL1A 1DLLA 2DU1A 4MLOA 1GR3A 2SLIA 4LBQD 4ZKTB 1RMU3 3AKQA 3TN93 1HRI1 1KITA 1AYM3 2QDNA 4YRDA 2JXAA 1DHKB 1FPN2 4XBQA 5HBAA 2GC3A 4Q4X2 4WVWA 3H7YA 4JGZB 3E5UA 1OQEA 2VPVA 3D8CA 4PJYA 4ZU7A 2YHJA 3EHKA 1PNGA 3HD8B 4R8HA 1AR81 1H8TA 1PO11 1TME3 5F9TA 1C1FA 2PLV2 3D0SA 3WP4A 1FAYA 2R063 4I30A 5I8TA 3BTAA 4PBPA 2G4IA 3FLPA 1EY2A 1RVF3 1LHOA 3DN7A 3WP6A 2D93A 2PYTA 4RR3B 2R043 2OW4A 3ZFEA 3VBSC 4FPKA 4HMZA 1O4YA 4U2AA 2PHFA 2KXLA 1Q8OA 4GULA 3VDDC 3ZDSA 3GYDA 3MF6A 4IEQA 3KT1A 1OFSA 2GNTA 1Z78A 2ZGKA 2DFBA 1O7FA 4RGGA 2P2KA 1HKDA 4LBNA 1OSGA 5HCBA 4ES8A 4RL7A 2DUQA 4CEWC 5T5LA 1HXS2 2V73A 1MEC2 3Q9OA 4LE3A 3WQ7A 4RHV1 2VVEA 4AFAA 1UZYA 1BEV1 1MR5A 2XL9A 1K5MC 4HVRA 2TEPA 1AR93 1UKGA 1GNZA 2UURA 4H3WA 1WD3A 1SEFA 2HWC2 5IK4A 2QVSB 1KDMA 3CJXA 2VMGA 2JE9A 1CAWA 2ZS6B 3TNPB 4WVZA 3PNAA 3TBDA 2WLPA 4IV1B 3ZO0B 3E6CC 3MI8A 2NLRA 5FPXA 1PO13 4Q0VA 1H2LA 3MYXA 4F83A 3J8F3 1W6OB 4G9SB 4AEJA 2I2SA 1XYNA 3KZ4C 3LCPA 4JV4A 1XQNA 4Y22B 1RUC2 5C4WC 1ZZBA 2XGXA 1O4TA 3IM0A 4AYUA 3POYA 3KCYA 3U4XA 1J59A 4KNCA 1Q8VA 4CDWA 3B00A 2ARXA 1YLLA 1QQP3 5GLTA 5C9AC 4Q4W2 1ULDA 3FBMA 1ZBE1 1FMD2 5B2GB 2UY8A 3VBHC 3WHTA 1LTEA 1WLWA 5E16A 4XJAA 4N9HA 3KT7A 1CGPA 2BGCA 1O5LA 2A3WA 5FFOC 3JB4C 1MS9A 2R32A 1S2KA 1S1AA 1VBE2 2EIGA 4YFWA 1HDKA 4LHNA 1YIPA 1GICA 1BEV3 2XJPA 4QPGC 3VKMA 4QPIC 4N53C 1DZTA 1O3SA 2YXSA 5T54A 3MPBA 1U5YA 4L11A 4MX3A 3VBFA 4AVAA 2D6PA 1ENXA 4F3JA 1AZDA 1DBNA 5T5OA 3WW2A 1O3RA 3A4UA 1PK6A 4NR1A 1MVQA 1G9CA 1AL0G 4RS5B 2ZOEB 1LOFA 2K9ZA 1BJQA 1MZEA 3H50A 2D6MA 5DDJ2 1NZCA 2VNGA 3FE5A 2EALA 1GYKA 3WG3A 1VP6A 1W6QB 2E9QA 2D44A 3BOPA 4N9IA 2NZ9A 1PIV2 2JG8B 1BBT3 5FQ0A 4DQAA 1D4M1 2XB6C 2YY1A 1H1AA 1FV2A 1SLAA 3KCCA 4WM8A 4HANA 4ONUA 1ZYBA 1GLHA 4Q4V1 2D5HA 1AL21 3AXEA 1OHFA 4IV3C 2WNVA 4D3WA 5BXXA 3JCIA 4OVEA 1DIWA 1QXPA 5GLWA 3WUDA 1XRUA 2XKPA 2XJVA 1DU3D 3WZ1A 2NM1A 2X5IB 3TYJA 5E8AA 4RS5A 4KL1A 4ZU5A 4JGYA 5BNNC 2WSUA 1DFQA 4WM7A 2H6BA 3VBOA 2YGLA 4G4FA 4XE9A 1A3KA 3RRDA 3W58A 2ZJCA 1QNYA 3R05A 3JD71 4A7ZA 3UKNA 5JI7A 4CDUA 3E6DA 2NP0A 1QNWA 3M8LA 1N1VA 1RUI3 2P37A 4XDQA 2XUMA 1SCRA 2H6CA 1I1EA 3R4DB 3R4UA 4AQ2A 2JG8A 4GMP3 1ND3A 1C8M3 4K1ZA 2BEOA 3PMEA 4YZ5A 1PHMA 4XTPA 4EWAA 3FFQA 2UYAA 4CP0A 1S0GA 3MW2A 1BK1A 4NN0A 1YIFA 2CWSA 4HN0A 1QJY3 1WCKA 4TSVA 1FX5A 2A3XA 1O3QA 4A7KA 3G6JB 1B35B 3OGGA 2GMEA 5KWRA 2Z5WA 2E7QA 3NW4A 2A7AA 1FT9A 3EQEA 3ASIA 5KHIA 2HKXA 5K7PA 1CR7A 2ZGTA 2CYFA 5BNOB 2F6BA 1VAVA 2B39A 3VBRA 4DS0A 2IXIA 4BMEA 1DQ5A 1UN1A 2OIIA 4DZGA 3ZSLA 4AHZA 4SBVA 4B3NA 5BPXA 1LENA 3OGJA 4P14A 1QOTA 2GC1A 1VBB2 3AP9A 2WIIB 4Q4Y2 4YVWC 2E7TA 4Q26A 4YW3A 1CJPA 1Q8SA 4LNVA 2HEVF 2VOKA 3B7MA 2VQAA 1S0JA 5JMCA 3SLIA 1ENRA 1ZBA2 5JWPA 2PHXA 4ISRA 3B9CA 2ZGRA 1UAIA 1V9U3 1RUH3 1J1TA 1PGW2 4C90A 1CESA 2PQQA 3DF0A 4M00A 1TMF3 3N35A 4P9WA 1R1ZA 1BCXA 4Q4W3 3WUCA 3J26N 1ASJ2 1BMV1 1NXD1 1V6NA 2WT0A 2GC0A 1VBC2 1FV3A 2RM22 4BH9A 5DUWA 3AP4A 4J1XA 5GLUA 1WBLA 2LTNA 1NA1B 2RS52 3WXPA 5A3MA 1YFUA 4XQ4A 5D8AB 4QQPA 4M3CA 5BNOA 1HV0A 1CX4A 1Q3EA 3IDEA 4Z92B 1QGLA 2PHTA 3AZZA 1CQ9A 1MS4A 1W39A 3QACA 3LWCA 4AVVA 1PVC1 1JUHA 1HV1A 3JBG2 5T55A 2DF7A 4E2QA 2WZR2 4RQPA 3MDPA 3WT3A 2RR12 1I9RA 1RINA 3H9AA 4PDWB 4XHBA 1REDA 1KXGA 3B9IA 5FMOS 2RE9A 3IDCB 1MS3A 1FOD2 2FHRA 4FTSA 3MLJA 3VBUB 4OI1A 3AMQA 3VKOA 3PLQA 4R4ZA 2HYKA 1QOOA 1XYPA 4CEYC 2QJVA 4J1WA 3WDWA 5JPMB 1HQLA 2BW8A 5KXBA 2I07B 4D7TA 1R1A2 4L92A 1S0DA 3WW4A 5I0SA 2OUHA 1H4HA 2CGPA 2D40A 4AI8A 4Z2WA 3VZLA 3GZAA 2PTMA 2ZTNA 3WP5A 4E27A 2JICA 5JDBA 1U5IA 2HWE2 2AUYA 4FP3A 4HSLA 1NA1A 3WCSA 2NQYA 1F2NA 1FYUA 4B4PA 4C0BA 1BVP1 1JXNA 3GNEA 2G9FA 2R072 1JYCA 2HWF1 3PVNA 2WQ4A 4HPKA 2BFUS 3KS7A 5CADA 2ZHNA 1AVBA 1QJX1 2DVFA 4AVTA 5J09A 1YWKA 2OA2A 1IHMA 1RMU2 5SV8A 2CWMA 3TN92 4KGGA 1ULEA 4PDWA 3ZXGA 3AJYA 5ABJB 3S30A 3VBUA 1WW4A 3IBMA 1YHFA 1LESA 4BLJA 3DKWA 4RD7A 3RQ0A 3RJ2X 4LBJA 1RHI2 5L36A 1YFXA 1TME2 3HWJA 4HKLA 2WFF3 4S2DA 3M1HA 1RUNA 3B5LB 4DMIA 2WC2A 4NHLA 2E53A 1AYN1 1AR63 3VKNA 4DNYA 2BPA2 2I45A 1JH5A 3MIDA 2R042 2DUOA 3WDTA 4FOQA 4FPOB 4KGQA 1VBA1 4Z1VA 1POV0 4HKOA 1KJLA 5J98B 1QJU1 1WLDA 2GSYA 4OZXA 4LUMA 4XFAA 4JAAA 3VGIA 1G9DA 2VOXA 1D2SA 1MZFA 3E5QA 1URXA 3H8UA 4GB31 2B42B 5C8WA 1J58A 3WLUA 5ACA3 2HEYF 3LZZA 2BFUL 3MGUA 1IQAA 4INDA 3S7EA 1LEDA 5JZGA 3WV6A 2PN5A 5DG2A 3EJKA 5ABJA 2OZ6A 1TE1B 2VNOA 4OULA 4IESA 2G9GA 2Z2SB 2PHDA 4GALA 1QWRA 1AR92 4GH4C 2E63A 3UJOA 1GQGA 2B8MA 4IEPA 1POV1 5A33B 3ZXAC 2HEWF 2GNDA 2VNRA 5EYYA 1NOVA 4YARA 1S0FA 5SV5A 2XBO3 3RJRA 3CJIA 5CB7A 4MZUA 4EV0A 2GH2A 1MQTA 1PO12 2DVAA 3ZFGC 1SLIA 5IT6A 1LULA 4X8PA 2W0XA 4EWDA 4LR4A 2HWB3 2WJSA 4JC1A 5FPZA 3AZYA 1LHNA 2VW1A 3VLBB 5C6CA 3FUOA 1MS5A 2C5DA 3WG1A 2ZGMA 4XZPA 3RYKA 3DPRC 2BVBA 3WQ1A 1AXYA 3AP6A 4Y5Z0 1W2UA 2GNBA 4CDQA 2A3YA 4K6BA 1V6OA 3WINE 4Q1RA 3GBFA 1OQDA 1AX1A 3WCRA 4PBOA 4CDXB 2WS93 1QQP2 5GZGA 1CD3G 1ND2C 4Z07A 3JBG3 4YYOA 5DZGA 4FPGA 1YRZA 4BIFA 2FQPA 1WUVA 3VBSB 4IETA 3ZFFB 2AGSA 1OPMA 4YGCA 3ZXDA 3WDXA 1COV1 3WX5A 4BZ4A 1GZ9A 4AEMA 3VDDB 3OY8A 3KGZA 4QX5A 1FI2A 1V6LA 3RNSA 1BEV2 4PLMA 4AG4A 1RUG1 2Z79A 5DUVA 1HQNA 1RUE3 1V6MA 3W9AA 2XLFA 4YM3A 3O0XA 1JW6A 3LOBA 2WNUA 3CO2A 2XHKA 4KG8A 1RUD1 4AXOA 4K40A 4FAHA 4JTOA 1BKZA 5F6KA 4HBNA 3LA2A 2ATFA 3HBZA 3NAPC 2ZX3A 2VULA 4FOVA 5JOWA 4FO9A 4S2FA 1RUJ3 2WZPP 1H8VA 4DRRA 2RS33 4C0HA 3AP7A 5T5JA 1F5JA 1K5MB 3GF6A 1X8EA 3OD0A 1VBD1 3QLQA 3T1LA 1MVEA 3KGLA 5JOYA 5AFBA 2R073 4I0WB 1H9WA 2DU0A 3ETQA 4IEVA 3ZYIB 3RMYA 2VUJA 3NWKA 4CDXA 1XXNA 4LO6B 1BBT2 4D7YA 2JG9C 2ETEA 4H7LA 5C8CB 3SH3A 4IEOA 3ZSKA 3FLRA 3U0ZA 4YVSC 3N7LA 3ZYGA 3ZFFA 3UKVA 4TWTA 1ZVFA 1Q8PA 1T6GC 1LU2A 1S0BA 5JVVA 3AKRA 3TNQA 1X82A 3MEPA 4R9CA 4AE2A 4KU7A 4MVTA 2Y38A 2ZBJA 1SACA 1WMEA 5C4WB 4L99A 2WFPA 2RMU1 1RHI3 1YJLA 3WDYA 1KS5A 1VRH1 2QKDA 4RA0A 1NCRA 2UY9A 5J7MA 3LSEA 3UV9A 5CFCB 1HRV1 5I91A 4M01A 5C9AB 1OOPA 5A32B 5L73A 1ZRDA 2Y0IA 3AKSA 1UU4A 4OFGA 3MIBA 3VBHB 1LRHA 2JEMA 4CP1A 4K9SA 5GJ6A 2IXJA 2QZ3A 1DQ0A 2R49A 2RS11 5GALA 1JTZX 2A6VA 5K0UA 2Q5TA 4KWLA 4NWWA 1WBFA 1RUI2 3INAA 4Q0PA 3VZNA 5J36A 5CA6A 3NV4A 1DGWX 4XIOA 3UJQA 5C8CA 1C8M2 4EN8B 4L8QA 3H7JA 3KQRA 2R0HA 1YI7A 4YM0A 3SH5A 1VIWB 1REFA 3HQXA 3VZKA 3WVJA 1EV11 1HIXA 2DCJA 3ZXFA 3S0MA 4FPYA 1QJY2 1ULFA 1YO8A 1GZCA 2XJRA 2YMZA 2A75A 4D94A 1RUF3 5LRSA 3MZHA 2V5YA 4JGZA 3JZVA 3AFGA 1H8TC 4X6RB 1J3QA 1HRI3 4FPHA 3OD4A 1D4VB 1KFUL 1OA4A 4PIYA 3SCGA 1AJOA 2VMHA 4Q4V2 5FO8B 2QUOA 5D1IA 5H9PA 5FCCA 2X8KA 3ZFEC 5CFCA 5JPNB 3E5XA 1NE6A 2JKBA 1AR83 3QCWA 1JN2P 2RMU3 4RR3A 1LHVA 3VHRA 4IXLA 2WT2A 4FTBA 4COUA 5H9SA 2BQPA 3DUIA 4WZFA 1N3QA 4XFBA 3FWEA 4QQLA 3E6BA 3JU9A 2JX9A 5DG1A 3FUQA 1S0CA 1NLRA 2R1DA 3HT1A 3VKLA 2ZGNA 4IV3B 3AYAA 4S2GA 3A0KA 4N7UA 2FZ1A 3PVOA 1YYNA 1Z7S1 3MF9A 2QZ2A 5BNQA 1QH7A 5E88A 3J9SA 1V9U2 1RUH2 1TMF2 2PAEA 1XE7A 5JI9A 3PTYA 1EAH1 3ZXKA 4N43B 4I09A 3OYWB 4ATFA 1J3PA 4XF0A 4MH0E 4EN7B 1NQJA 1R091 1U12A 3AYDA 5BNNB 4YZ3A 1UL9A 3AX4A 1Y7BA 4PIZA 4YVSB 4OHZA 4H14A 4Q8LA 1LJ7A 1ULCA 1LOEA 1L3JA 5GLVA 4OHVA 4RHV3 1FPN1 5T52A 1HQWA 4Q4X1 1LOCA 2PHUA 4I3PA 5E89A 2EAAA 4FPCA 3IKWA 4IV1A 4M3CE 4FQ4A 4UW5A 5FAXA 4EROA 4KWKA 2ZGPA 3BODA 4NHMA 4GMP0 3QD6A 4COVA 2DVGA 5FLHA 1GV9A 5JAXA 5FDBA 4JDOA 3ZXLA 1W6OA 2PLV1 1RTVA 2CY6A 3A0NA 4B8EA 3O12A 5EJ3A 1S0IA 4E4ZA 3ZIXA 1AHSA 4Y22A 2XVGA 4IEUA 2MHFA 3H1YA 4JRLA 4NOTA 4SLIA 4BE3A 5AC91 2UWBA 4JQRA 4GXLA 2I74A 2DCYA 4CDWC 1G9BA 3O7OA 3CEWA 4ASMB 1LR5A 4TZDA 3I7DA 3THTA 1CAUB 4MV2A 5KXDA 3M4FA 3WQ0A 3CL1A 2GZWA 5L7OB 5LRRA 4OHXA 4N43A 3WR0A 3OYWA 4TYSA 1QF3A 2R0FA 1Z7S3 4GA9A 3QOPA 3WP3A 2WNEA 1IOAA 1A8DA 5GZFA 5BNNA 1JHNA 3SNMA 2E51A 1BXHA 1H4GA 1ZBE3 4YVWB 1U5XA 4B7EA 3LKJA 1HXS1 1MEC1 3EO6A 4XJUA 3VBFC 1MS0A 2XPJA 1W6PB 1YCIA 2CTVA 2VVFA 1PK6C 1R081 1IS6A 2FMDA 4YZ1A 1U5ZA 3OPZA 3BB6A 1LOFC 4HVQA 2HWC1 5LK7B 2P3KA 4N7IA 1F9KA 2TNFA 3EXUA 1LU1A 3WNXA 2D3SA 3GZTB 2DV9A 1G9AA 4K8FA 1DYPA 3MLLA 5J3UA 3D0JA 5KHJA 3VZJA 2FMYA 1LEMA 1ENSA 1S55A 1TNFA 2XJSA 1AUYA 1CAVB 4UW3A 3TB0A 1W6QA 4D69A 1GZWB 2O1QA 3V65A 2R1BA 1CAUA 2WFF2 1ONAA 2ZGLA 3ES4A 1Y43B 1TEIA 4WBBA 1RUC1 5L7OA 2CL2A 1AR62 1X8MA 1QY4A 5AC93 4WM8C 1FNYA 2VECA 4ORFA 1SQ4A 4I3GA 4Y4YA 4AQSA 4IEXA 5BNPC 4OI0A 2WNVC 2YYOA 3M3IA 4C1WA 2DTYA 5J96B 4FPJA 4ATEA 2DCTA 4UBGA 1D4M3 1FMD1 1IKPA 2QE3A 3N7JA 1IKQA 4CEYB 3MW4A 1LOAA 3WY6A 1N3PA 3KM5A 3ZSMA 4Q4V3 2R30A 3AYEA 3WDUA 4LO4B 1AL23 2EXJA 4E4DX 1X50A 3AKPA 1VBE1 5ACA2 4JGYC 4IERA 3WHUA 4XPVA 3TRSB 1SFYA 4WM7C 2X5IA 4Q1PA 3VBOC 1H2NA 5BY5A 1M06G 1G8WA 5DZEA 1LECA 1EPWA 1QJX2 4QMAA 4OI4A 4CDUC 4R52A 2Z69A 5GM0A 2IWGB 4MYEA 2WT1A 3SHRA 3M7AA 4I0AA 2VVDA 2JDZA 2JG8C 4GWNA 1ND3C 1AXZA 1H0BA 1GZWA 2W52A 4GKYA 4M3CF 1CPMA 2R6QA 4XETA 4F8AA 2P17A 3ENRA 2JD4A 2XBO2 3JD73 4R9AA 4YGDA 5DDJ1 4YG0A 1PO21 2MPFA 4AVCA 2EF6A 3I4IA 4ITCA 1IS4A 2Y0OA 3LAGA 4Y20B 1KS4A 2OZJA 1EYBA 1B35A 2HWB2 2Q1ZB 4UW6A 3V64A 4DB5A 4DXZA 2CGOA 4LO8A 3HN1A 3DV8A 2ILMA 3E97A 3IIAA 5I93A 2HWD1 5BV6A 3JQWA 4YW5A 3VBRC 2VXRA 2VUAA 3ALQA 4AVSA 3FX3A 4ZXKA 2NPIA 4NO4A 2VG9A 4TLFA 4OLLA 1QJU2 1O91A 1G9FA 2ZZJA 2WS92 4HN1A 1YXWA 1QMJA 1YFWA 3B02A 4P9GA 3R6SA 1GFF2 1BYHA 3NKGA 4GB32 1GQHA 5AFEA 2BNNA 4YG3A 4K21A 3BALA 1OFNA 2NN8A 3RDIA 5KC5A 1QXJA 3VHNA 1H9PA 3HAGA 4BYYA 2B7YA 2UWCA 1YFYA 1C8NA 1V00A 2ZX2A 4I2OA 3I59B 3NVCA 4XXPA 1SBDA 1RUE2 4K1YA 3OBRA 1TQ5A 3ZPYA 4GQ7A 4I01A 1JBCA 1V6JA 4LBKA 2YROA 1A78A 4XHXA 2WKKA 2DTWA 1KFXL 3ES1A 3OBTA 4Y20A 4AEDC 1WW7A 4XF4A 5FOBB 3V0AB 2Q1MA 4LO7A 5HI0A 4QD2A 1RUJ2 4NPRA 4LHKA 2RS32 4GIQA 2ZA9A 1PZ7A 2VQ0A 2YV8A 2ZGOA 2BWCA 2RJKA 3GALA 4HK8A 1Q43A 5D8AA 2Z42A 3NSTA 3ZN6B 1S2BA 5EYXA 2YPJA 4DOUA 1QHDA 2VW0A 4A7YA 4QQHA 4RQPC 4URTA 3UL2A 1G86A 3M3CA 2VGDA 5JIAA 2A70A 3MLKA 3OTFA 1ENQA 4HKWA 4OI2A 4AEKA 4DFSA 1PVC3 1VR3A 3L9JT 4P9YA 4Q0SA 2E6VA 4LTAA 4J6GA 4NVPA 4MXWB 4HZFA 3ECQA 2LM3A 4FPEA 3ACLA 4BLIA 3DPRB 3EBRA 4LBQB 5FMOL 3M2MA 4EWEA 2O0OA 3APBA 1VBB1 1WLCA 4A2UA 4Q4Y1 3ZSEA 2RJLA 1NY71 1RIRA 4KH9A 1PZ8A 5LEKA 2BTVC 4H55A 1RUG2 1UIKA 3N36A 4FXKB 4NWVA 3V0AA 4AVBA 2JE7A 1OA2A 1X7NA 1NA1C 1NLSA 1PGW1 1IZ3A 1RUD2 1V6KA 5CG8A 3KD4A 3USUB 2Q8OA 4UW4A 1ASJ1 1VBC1 1SBEA 2PHWA 1LODA 4YM2A 2RM21 2ZX4A 4Q2FA 3WG2A 1M4WA 2B45X 4D7SA 1PGL2 1DF0A 2IXCA 4MUVA 1ZA4A 3L2HA 3C3VA 2RS51 1Q8QA 4PDWC 2XWJB 4JCKA 2HWF3 1XNBA 5EXOA 1WCDJ 3BOWA 3HIFA 4AF9A 1AF9A 1AR71 1U0AA 1TNRA 2P34A 2A73B 3NAPB 1QJX3 1RUF2 4XILA 2PAKA 4MXWA 3N7KA 2WLQA 4FBFA 4Q0UA 3MICA 3RS6A 1HRI2 4BMBA 4LBQA 1KDKA 4FPFA 4XJ8A 2Y26A 3FJSA 2RR11 4EN6B 1NE4A 1V70A 2O8OA 2WWSA 2GNMA 5HCAA 1C1LA 1AXKA 4Y1UA 3SISA 3WD5A 1FOD1 3AZVA 5CFDB 5K9YA 5AVAA 4HSJA 1AR82 3VV1A 2JG9B 2RMU2 4WZCA 3K51A 3ME2A 5F1RA 3ZYPA 1OKQA 5GKAC 2NYYA 1R1A1 3AK0A 1UU5A 1AYN3 2A6WA 3M3QA 2VOVA 3MIEA 3USUA 2BBVA 3AB0A 2D6NA 3D4KA 3M3EA 2B9UA 2XJQA 4QT6A 4XQDA 4AWDA 4DINB 5J37A 4QPYA 1VBA3 4IQPA 2RS12 2HWE1 1QJU3 1UMZA 2BUKA 2AREA 1DGRA 3P3PA 4UBHA 5JZGC 2BWAA 4W6WA 3WG4A 3THPA 5CBLA 5C33A 3AMPA 5T3NA 1DYKA 2CGNA 5ABJC 5F5QA 2VMIA 4XMIA 5JR7B 1FATA 4GB33 2QQPA 1OQ1A 1DQ6A 1G6NA 3ELNA 4E2GA 1PMIA 2X29A 3NV3A 1EV12 3V0BB 1WW6A 3TN91 5A33A 4X8NA 2ENRA 4AK3A 1LOBA 5LEJA 1AYM1 4RHV2 1C28A 3CJIC 5JSRA 4YW1A 3L2YA 2O8QA 4XYXA 4AQTA 1MQTC 4FAGA 4WVMB 4DY5A 5CFDA 2W68A 3LA3A 4FCAA 4P9LA 1W0PA 3D5OA 3IT8A 1LKNA 1POV3 3VN4A 4F7ZA 4FT8A 4AHYA 3H3UA 4MGZE 1HX6A 4FP2A 4CEWB 1SMVA 1TME1 2CAUA 2R061 3RI9A 4YGBA 5JIUA 1WMDA 2PAMA 1RVF1 4G3YC 1NCQC 2IZWA 3B69A 3LGRA 2R041 1H8TB 1CVNA 4CDQC 3U10A 4H7MA 1VALA 3HT2A 1ZZCA 2GN3A 2IFWA 2W39A 1SCSA 4R9BA 3P3NA 4B4QA 2ZX1A 3OCPA 1DG6A 3ZFEB 1KRIA 3H1MA 1O4ZA 2UWAA 1Z7S2 3VBSA 3WOGA 1SLTA 4B7KA 1ZRFA 3VDDA 1ZBE2 4XFHA 4P9XA 4META 4MXVA 4XF9A 2ZAAA 1SLLA 4IL7A 2BNOA 2WNUC 1COV3 3MIFA 4WVMA 2QFEA 1I3HA 1MS1A 1OLQA 1W6MB 2E7AA 1AR91 4EN9B 2EXKA 4FPLA 4XJZA 2GMPA 4CEWA 3TWIA 1RUG3 1I5ZA 1SLCA 4CP2A 3V56A 1J3RA 2XLAA 5T5PA 1VAKA 2ZKNA 1RUD3 2ZCWA 3LA7A 4AI1A 4JDNA 1K5MA 4C91A 4YZ2A 3H1WA 2ZGUA 2X53S 3J8F1 3RZZA 4CDXC 1CAWB 3ZX7A 4R4XA 3AM2A 3SXWA 4LE4A 3T2TA 4QPGB 4QPIB 4N53B