1O91A

Crystal structure of a collagen viii nc1 domain trimer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
131
structure length
131
Chain Sequence
EMPAFTAELTVPFPPVGAPVKFDKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPMMYTYDEYKKGFLDQASGSAVLLLRPGDQVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Collagen Alpha1(Viii) Nc1 Trimer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords COLLAGEN ALPHA 1(VIII) CHAIN
total genus 24
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00386 C1q C1q domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.40 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1o91A00
3TYJA 2QE3A 4N90A 2JG9B 4QQHA 4G3YC 3B9IA 1U5ZA 4QQLA 2R30A 2AZ5A 4OUSA 3WD5A 4KGGA 2R6QA 2KA3A 2RJKA 3B93A 1IQAA 2E7AA 2JG8C 3K51A 1OQEA 1I9RA 2HEVF 4QPYA 1D4VB 5L36A 1TNFA 3B94A 2TUNA 1U5YA 2ZPXA 2RJLA 2JG9C 1KXGA 4KGQA 2OIIA 3URFA 2ZJCA 2WNUC 1U5XA 4HT1T 2WNVB 3LKJA 5BNQA 2JG9A 4DOUA 4RSUA 2WNUA 4MXWA 5L19A 2QDNA 5KWRA 2R32A 3L9JT 2Z5WA 2X29A 3K48A 4G4FA 2WNUB 4MXWB 3QD6A 4KG8A 3V56A 2WNVA 2JG8B 2RE9A 1RJ8A 4OUMA 1TNRA 3QBQA 2HEWF 2WNVC 4EN0A 1C3HA 3MI8A 1OQDA 1D0GA 1KD7A 2HEYF 1PK6C 4QQOA 5KC5A 1PK6B 4E4DX 1XU1A 4J6GA 1ALYA 3FC0A 4MXVA 1JH5A 2JG8A 1DU3D 4D7YA 1PK6A 1C28A 1O91A 3ME2A 2TNFA 4TWTA 4F3JA 5KC6A 1GR3A 2Q8OA 4E4SA 5HBAA 4GIQA 1D2QA 4TSVA 4MSVA 5TSWA 1A8MA 3IT8A 4DB5A 3ALQA 1RJ7A 4NN0A 4OULA 4QQ2A 3AB0A 1S55A 1DG6A 2Q1MA 1JTZX 4QQPA 1OSGA 1WCKA 1XU2A 5CIRA 2O0OA 3TWIA
chains in the Genus database with same CATH superfamily
3SH5A 1FMD3 2GH8A 1RVF1 1OHFA 2Y0OA 2XKPA 3MIDA 4XQDA 5FCCA 5DMYA 1O5UA 1MEC1 1W9WA 3UV9A 1FV2A 1RUE1 3G7DA 2IVIB 1LRHA 4D6QA 1RUH3 4C0HA 3WNXA 4CCKA 4BE3A 4CEYB 2GNBA 3VDDA 1RUD2 3THDA 2MHFA 5FO8B 3DYMA 1REEA 3UGFA 5ANQA 2IVJA 3E5XA 1ZBE1 2HEVF 5CAZA 4QPYA 4XFGA 2RS11 3GHMA 1HDKA 2VO5A 2YC4A 1COV1 1OD3A 2MNGA 2QFEA 3MZHA 2D6NA 3WNLA 1AR83 2EA7A 5A1FA 4KQ7A 3WCRA 1J1LA 1KXGA 1U0AA 1V6NA 3K77A 4RQPA 3WNKA 4NIDA 1GOFA 1HV1A 1OLME 4CCOA 2J1TA 1QXJA 5C5UA 1R64A 4I02A 3M70A 3WVJA 4ES9A 4OMDA 1QJX3 2HBTA 5HI0A 1UPIA 4Q26A 3DYOA 3Q8AA 5FMOS 1AR93 3RQ0A 1CQ9A 2YU2A 3SISA 3ZPOA 4CDUB 1VBA3 2ZTNA 3KT1A 1RUG1 2XG3A 3U75A 2ZMNA 2V72A 1NXD1 4MADA 4LHLA 5FLJA 1RIRA 3DYPA 4FFIA 1UF2C 3QD6A 1JZ2A 2ZAHA 3H7JA 4BQ1A 1DQ1A 2RHPA 4INDA 4CPBA 3PVBB 2VOVA 2DYCA 4PQQA 4QGMA 1H9PA 5DQ0A 5FAXA 4QX8A 1AX1A 4RN5A 4KBZA 4K9SA 1BBT3 4UAPA 2BBVA 3A0NA 4UFHA 5G04L 1SCRA 4AZZA 2W39A 5F3IA 2G9FA 4Q4Y2 4H55A 3GZEA 1LGBA 4Q4W2 3U37A 3ZN6A 4URAA 5KHKA 5FYIA 1U12A 4LITA 3RRDA 3M4FA 1VBC3 5IAXA 4J6GA 1VRBA 4AEDB 3ENRA 1WZXA 2TBVA 3W9AA 1E57A 3PMEA 4LOSA 5JSOA 2WBKA 1DU3D 4M4RA 4YW2A 1QJEA 4XAEA 4XCAA 1S0FA 5E88A 1W0PA 1UN1A 1O91A 1F5FA 4QWNA 3UESA 4LUMA 2Q8OA 3UT0A 3BGAA 1T6BX 2IXKA 1LULA 3N35A 3WQ7A 1WD4A 2LROA 5CKNA 1YFYA 3VBUB 5A3WA 4A7ZA 1WCQA 5GZCA 2DCYA 4DXRA 5C8WA 1ACCA 2VZTA 3AKSA 3VHNA 4CSWA 4FTEA 2EAKA 5C70A 3AB0A 4PT6A 3GHNA 4CDXC 1BEV1 2DUQA 4DUWA 3USSA 4K1ZA 1C1FA 3U4SA 2XHNA 3BPSA 2XLGA 4XUPA 2ET7A 1O59A 1BBT2 2YROA 3BVCA 5EFUA 5ABJB 2IFWA 3T0BA 4Y1VA 1K3IA 4BQXA 4A4AA 3O1OA 3INAA 2LALA 3CEWA 3H8XA 4Q8LA 4UFKA 4AL9A 3VHPA 4AOCA 4WVMB 1OPMA 1AYN1 1AXKA 1R091 2ZCWA 5K0UC 1QH7A 4JDOA 2BGOA 1XNCA 5JSRA 1KS5A 3T09A 3WD5A 3ZMOA 4UW4A 1K5MC 2ZGKA 1FOD1 1W9TA 2YFZA 5F5AA 1WWYA 3CNAA 1OQEA 3IAQA 4DS0A 2D43A 2YV8A 4UT5A 2D5HA 3C7GA 2QQMA 5F8PA 4YZ5A 1TNFA 2ZEYA 4NVPA 4IGQA 4P5HA 4Q0VA 1NYWA 1JS9A 1XXNA 3AZWA 4Q4X3 1HRV2 1H8VA 1CAWA 2PAEA 5D1IA 3T4VA 2L9LA 5BPXA 3GJBA 4D94A 1W9SA 5FPBA 4Z8BA 3VZMA 3OBZA 2Y6HA 2HWE3 3VL8A 3DL3A 2UY8A 3EO6A 4A44A 3FUOA 3VBFC 3OBAA 4OMCA 1PVC1 2HWC2 4MH0E 4A3XA 3IN9A 4QPGC 1NKGA 4JDMA 4MV2A 3U0ZA 3KQRA 3ZO0B 1QOSA 2PLV1 1T2XA 4QDQA 4QGLA 4RSUA 3RYKA 1MVEA 4LULA 3ZMNA 2QDNA 2WABA 3AMPA 4QPGA 5F6KA 1QXRA 5L9VA 2WN2A 4IE7A 2QQOA 3K75B 4XFIA 2X29A 3JXSA 3THPA 4LA2A 3T2TA 4WVMA 1R082 2P3KA 2YDEA 4FPOB 2VBBA 2LM3A 3A0KA 3USUA 5IW0A 2N7GA 3WQBA 4BK5A 5FZ3A 1RJ8A 2GH2A 3ZFEA 2C24A 3EXUA 3CZUA 3BCWA 4YW6A 1OPOA 3PU3A 3SH3A 1V6LA 1A8DA 2ZHNA 3T30A 1AL22 4YG3A 2RMU3 3ZXKA 3IB3A 3TEWA 1ENRA 4OI4A 4QX7A 4M0NA 5FDBA 4TLGA 3UKTA 3AZYA 2NM1A 3LOBA 5HCAA 4PF1A 3DPRB 5KC5A 1C1LA 4QXKA 1CPNA 2XUMA 3FMGA 1S1AA 3KCXA 3T0DA 3HR9A 4ITCA 2GC3A 1SLCA 2YGLA 5BYNA 2FMDA 1DZTA 1OQ1A 1RUE3 1GOGA 2FHRA 2OVUA 2JKBA 2P6CA 5FBJA 4CCLA 1IZ3A 4EN9B 4Y4YA 1BLZA 2DU0A 2YY1A 1BHGA 4PCRA 4Y22B 3VGIA 3O0WA 4B4QA 1VMHA 1NG0A 3WNOA 3VZNA 4Z82A 2VGDA 1MQTA 2PFWA 3ZFGA 3O1MA 3HNYM 1I5ZA 5JOYA 2JECA 2E9QA 2W08A 4IV3A 4WM7B 3CIHA 4J1XA 5FY4A 4ZXEA 2WZPP 2ZKNA 4E9KA 4QPWA 2ETEA 3I2JA 1RJ7A 4I3PA 1MS9A 4LLFA 3S6PA 3NJVA 5BUVA 1QJFA 4QQ2A 3WW4A 3JD72 4WV8A 4IEOA 1LOFA 2WC2A 1W2OA 4QX0A 5DUWA 1LAJA 1M06G 5C9AB 4BZ4A 1W8UA 1APNA 2C0ZA 5JVVA 1J3RA 1A34A 2D6OX 2O0OA 3TWIA 4LK7A 1LU2A 1YQ8A 3MF9A 1IS3A 3FHAA 3JQXA 5FY9A 1ZZ7A 2XGXA 3LDKA 2JG9B 3JB4C 1RUJ2 2DCZA 3QACA 5JMOA 1U5ZA 1UZ0A 3DXUA 4NRQA 4QT6A 4CDWB 3PURA 2RS12 1X7NA 3O0VA 4HANA 2ILMA 3ZYIB 3VHOA 1W6OB 2WZR3 5FQ0B 4Q1RA 4IEUA 5FZLA 2DCKA 5FMBA 3MIHA 1ND2C 3H8RA 2GNDA 1PGL1 3WNPA 2XJVA 2ZX3A 2NP0A 1KITA 1B35A 1ULDA 1VAMA 3CL1A 5FZ1A 5L73A 1G9CA 1NOVA 3NNGA 1I1EA 4ISQA 3DPRC 3BUCA 4MOAA 1R093 3VBHB 3WQ0A 1MZEA 5A3PA 1GZWB 2QQJA 3GZAA 5A7WA 4I3GA 3N4MA 5IJRA 4RHV2 3OGVA 1U5XA 2VUDA 1C5IA 1ASJ1 2W94A 5FR3A 1RITA 4YVWA 3TN92 4Z92B 3RZGA 1VAKA 4XFAA 4DOUA 4LBJA 2Q8EA 4OHXA 1D4M3 1PGW1 4P9IA 1F15A 2UWBA 1UY3A 1OD5A 5FP7A 1GZTA 2P37A 1LGCA 3PTRB 4LO6B 4Y1XA 4MXWB 5EXOA 5FZ0A 1SLAA 4CVUA 4O65A 2OT7A 4DUVA 4XUOA 3S7EA 3T2PA 4MHRA 2XOMA 4COUA 3CU7A 4Y4RA 3HAGA 3VZJA 4CTEA 4S2FA 4EN7B 4N53B 2W46A 3J7MA 2OQ6A 3UK9A 1IPSA 1Y9QA 5IK4A 5A6XA 1Z7S1 3MI8A 4YZ3A 1HJFA 4HMZA 4JHTA 4AVCA 1L3JA 1XE7A 1RUJ3 1UU5A 4IGOA 2J1RA 4AG4A 5DG2A 3R4DB 4DEQA 2VNOA 3CMGA 1ND3A 4OI0A 4NIAA 4K8RB 3CHXA 2MEV2 3C2UA 4P00B 4M3CE 1VJ2A 2HWE1 3ZDSA 3KCYA 1PZ8A 3K4DA 4NHMA 4IERA 5C3PA 3ILRA 5LRSA 5L7OA 5C5TA 5C3OA 2V4AA 2PN5A 5C9AA 4FFGA 3VHRA 1QQP1 3P3NA 1UXXX 2Y33A 4N9IA 3OSDA 4CP1A 1MZFA 2J7MA 5HBAA 1V9U1 2ZGLA 3HN1A 3VDCA 2FCVA 5A1AA 1Z78A 5SV8A 1BEV2 4AHZA 4DNYA 1A8MA 4DB5A 2X05A 2ZGUA 4E2QA 3LZZA 1YFUA 3ALQA 3AZVA 2VXJA 5C4WC 5JXHA 4AFCA 3NNMA 4P9JA 1IPJA 5KXDA 1MQTB 4CU9A 4GMP3 4E4ZA 4OHZA 5B4NA 1PHMA 2QQWA 2A6VA 1EY2A 4FOQA 3IIAA 4XACA 2HWC3 4HBNA 2WN3A 5CVRA 1AJKA 2XL7A 1RVF2 2R073 4D3WA 4HPKB 1FATA 4FSJA 3H8OA 4FXKB 5ERLA 1DZQA 4NHXA 2PQSA 1N3PA 3O7OA 4UW3A 5FFOC 3WDVA 1S2EA 3KZ4C 3WDYA 3ZIXA 1XSQA 1Z7S2 2HH9A 2QQKA 4B3NA 4F7ZA 4KWKA 4BB3A 3V0AA 1D2SA 3AMMA 4JVAA 2H6CA 3N3HA 3MICA 4I01A 4CA9A 2HLEA 2VZUA 2R1BA 4CP2A 1W2AX 2VOXA 1OMIA 1YCIA 2VMGA 4NIGA 5DAVA 2F17A 1ULFA 3P5BA 2JDHA 1QQP3 4E2SA 1RHI1 2GNMA 1GZCA 2VUAA 1CAUB 2E7QA 5H9PA 4XHXA 3V64A 2RR11 4KNCA 3MIFA 5FY0A 1U5YA 3ZSJA 1S0BA 4GB33 5FYSA 4KGQA 4LBNA 3CKHA 4NROA 3BTXA 5IFPA 3CJIC 1V6OA 5DPNA 1YJLA 5AFEA 5JMCA 1J1TA 3EMRA 2QBXA 1ULEA 4FXGB 5FUNA 4QB2A 5FPUA 5KXEA 4XF0A 3CJIA 1Q8QA 2ENRA 2XVLA 4JGYB 1JUIA 4MYEA 2ZGMA 3H7YA 1XSRA 2NMNA 4Y1YA 5D8AA 5FZMA 2DV9A 5FZ4A 2VCCA 4JTOA 1X82A 3AYDA 5CA6A 2DVBA 3RPQA 2H0VA 5CNAA 3ZVXA 1OH3A 1ZBA2 5JIAA 1AR62 4MHUA 1MEC3 4MO3M 5A1LA 4CP9B 1MPXA 2DU1A 3ZKYA 4BOWA 1ENQA 2NPIA 1HRV1 1BMV2 3UGHA 4XF3A 1VBD3 4LTAA 2BFUS 5FZFA 4E4HA 4IESA 3BB6A 3B3QE 4KBBA 4EN0A 3MUZ1 3VV1A 3OCPA 2AEZA 4IETA 4W6XA 4NOTA 4PBPA 2YG0A 1D7PM 2GC2A 5FYTA 3ZDVA 3KSCA 1YNAA 3AFGA 4AFAA 5GLVA 1IGOA 1PO23 1XYPA 3IPVA 4GA9A 4PBOA 1JW6A 1AR73 1RGSA 3V65A 1JOPA 3T08A 3ZR6A 4XJZA 3VBRB 4FPEA 2Y6GA 3I59A 4XFHA 3OUJA 4OYUA 5FO7B 1TMF1 2V5DA 4RFT0 5I93A 5A3MA 3CDZB 3ZSMA 3JU9A 2BERA 2QVSB 4NAMA 3BODA 3LIHA 2PLV2 4P9YA 4ATFA 2BGCA 4LBQD 4CEYC 1VBE1 4QPGB 1UQXA 1YUDA 2IXHA 1UU4A 2WZR1 3FBYA 2W2IA 4NE9A 4W50A 1XYNA 1S0EA 3BN6A 3GM8A 1NCQA 3U10A 1N3QA 4XXAA 1RUD1 3I3DA 4AQ2A 1YQ6A 4I2OA 5IATA 4HLTA 1IOAA 2JDMA 1JHNA 5FY5A 1Y9MA 4S2GA 1J83A 3R4UA 4JGZC 4QXBA 1BKZA 4IV1B 2VVFA 3H50A 4DPNA 1QGLA 5FP9A 4GXLA 4Z1VA 2A1XA 3GCWA 1FMD2 4OHWA 2EXKA 2R063 2WFF2 3NKGA 3WINE 2PHLA 2ZX0A 1F4HA 2JDZA 2Q0AA 2VOTA 4DXZA 1W6QA 4QKFA 3AKRA 1BMV1 2HYXA 1UY0A 4FQZA 4YWAA 3W21A 2UYBA 4NHLA 3C7OA 4GH4A 1OXCA 5AVPA 3HMYA 5FLHA 4CP9A 4LKSA 1DYPA 2HJIA 3WP3A 3I3MA 3TN93 4NPMA 1QWRA 2AENA 4YW4A 5I0DA 5FZEA 5I0SA 4BIOA 5A6QA 3O14A 3KCCA 3POWA 4N9HA 4FOWA 4AI1A 4JQRA 4L97A 4YVSC 5JZGB 1NCRA 3HT2A 5F5IA 5BNPC 3FLPA 4IE4A 4V2VA 3AP4A 2WJSA 3PUHA 4IE6A 1OKOA 1W2TA 3MFAA 2PYTA 4A45A 2WIIB 2JG9A 3SKVA 3KQ4B 4AK3A 1AZDA 3VKFC 2RDRA 1RXGA 4LHNA 4WM7A 3VBSA 4YPJA 4CU6A 5C4WA 1STMA 1JBCA 1VALA 1ODNA 3D4KA 4UW5A 5EYYA 4CDUA 1W0OA 3ZFEC 5C8CA 1QEXA 1UD1A 3O1VA 4ASLA 4DXTA 2G9ZA 2K46A 4GWJA 5A7OA 1DQ2A 3W5NA 1JU3A 1QOOA 2X5IA 5JXIA 4F83A 1UYZA 4Q4Y1 4XAAA 5A80A 2YUEA 4JGYC 4LXLA 4AVBA 1ND2A 1SLTA 2WYFA 3NAPC 4ZU4A 1NCRB 1KJRA 1JYCA 2EICA 1OQDA 4XF1A 4XC9A 3LFMA 3KGLA 1D0GA 5F37A 4OQ9A 1PK6C 3I2IA 3I8TA 3U14A 1BK1A 1NA1C 3N9MA 1G7YA 1C4RA 1PVC3 1I3HA 1XQNA 2Y64A 1X50A 3B69A 4FPLA 4LBLA 2Y38A 3ZFFA 4D0QA 5AFBA 4CEWC 5FTTC 2VR4A 3LEGA 1VMJA 3NJYA 5A6YA 5APAA 1V6IA 1COV2 2YB7A 1JYXA 2R49A 4LIUA 3ZYHA 4UWDA 1MQTC 3VBHC 5DUVA 3ELNA 5FYHA 2EIEA 4L8QA 1RHI3 2BU9A 4IL7A 1ZNPA 2ZX2A 1I5PA 2OX0A 3I3BA 3NNLA 1NQDA 4LO8A 3RZZA 4CDXA 2YC2A 3J7NA 4YM3A 4ATEA 4U36A 3RVHA 1YHFA 3Q9OA 1WMEA 4H2AA 5LW9A 2JE7A 4IV1A 3LPFA 1HN0A 3NW4A 5GM0A 1QJZA 3F95A 1AYN3 4D6SA 2XJPA 4RS5B 5CFDA 4LORA 4LBKA 4XFBA 4LT5A 1XE0A 2QZ2A 4DFSA 1W8OA 1TME2 1WCKA 1WLCA 3KF5A 3AP7A 4Q4Y3 3L2HA 1DHKB 1LOGA 1ND3B 4EROA 3O1RA 1SLBA 3JCIA 3UGGA 1VRH3 1XYOA 1OF3A 2GMMA 1MS8A 1QY4A 1SQ4A 2WINB 3CF6E 1QH6A 3N7JA 3X29B 2ZX4A 2FZ1A 1VBB3 2KD7A 4G3YC 3PUQA 4YNIA 1KJLA 2SLIA 1UAIA 4LOTA 1G9BA 3B9IA 5A3LA 4Z2WA 4B4RA 4CCCA 2UWAA 5EP9A 3SKJE 3LPGA 2W95A 2R6QA 2A6ZA 1COV3 4QDSA 3WP5A 3J8F1 1MEC2 3FLRA 2E7AA 4Q0SA 3AYCA 3LSEA 5JOZA 1VB4A 3ZLIA 3FX3A 4R52A 3WG3A 1DYOA 1UZVA 1PGL2 1XNBA 5IFTA 3HN3A 3RZMA 2A6XA 4LKEA 1RUOA 1V0AA 2LUWA 2WS91 1DF0A 4QPIB 4NIIA 1PM7A 1JXNA 4HK9A 5JCTA 2IXCA 3B00A 2VZRA 3H42B 3MW2A 5BNNC 1LR5A 2Q30A 2WNEA 4KL1A 2YPJA 1OLRA 1OVSA 3LKJA 3I2HA 4DRRA 4PF5A 3ZX7A 2XJSA 1RYYA 1W8NA 3N9QA 4MX3A 2VNGA 3CZJA 2GMPA 2RJ2A 4COYA 2DCJA 4C91A 1W6PB 5BV6A 3BIWE 4JGZA 4NPRA 1H1IA 2O14A 3WP6A 4K8FA 1WCSA 1AR91 2XDVA 4QX2A 5ACA3 3R4SA 4CDQB 3PVEA 2ZACA 5FKCA 5FLIA 5A6ZA 5FZHA 5BNPB 1VE0A 3IAPA 5K0UA 5JUVA 4BYYA 3VDBA 3U4XA 3AP9A 4JZRA 4MUVA 2RS32 1FMD1 1FX5A 3IMNA 5HXMA 4QHBA 2Y6LA 1W04A 1NZIA 4LE3A 3TBDA 3A21A 3HNBM 4JX0A 3FZ3A 1F9KA 4Q27A 1VBA1 3AZZA 2XWJB 1HRI3 1UPSA 4OUEA 3U07A 3VBSB 5DUUA 1W90A 2OUHA 3I2FA 1CAUA 1CJDA 4LQRA 5FREA 4W4ZA 5CKMA 5HXVA 4BM8A 3OD4A 1XPWA 2F4PA 5FBZA 2WA4A 2FD8A 5GLZA 1OOPB 4YW3A 4CCMA 5DZGA 3W5MA 3ZPYA 1RUC3 4NHKA 3EYPA 4Q0UA 2QQLA 2TEPA 3UETA 1TEIA 4QKDA 1C8M1 3AMQA 2ZX1A 4UFIA 4WVWA 1LKNA 4BXFA 3TN91 4TWTA 1L7LA 5A7QA 1MZ6A 3GF6A 4PLNA 1SCSA 3PHMA 1SPPB 4ZHNA 1F31A 1PIV3 1SFYA 5FYZA 3MUY1 5JI7A 3SEPA 3WHTA 3KHBA 3KWVA 2J22A 4LE4A 4EWEA 4XIKA 5IHRA 5BNNB 3JBG2 5E16A 4AI3A 4FFFA 5JOWA 1LECA 2FDFA 2MEV3 3ZXEA 5F5CA 5KHIA 1MACA 2D3SA 1QNWA 1V00A 1BXHA 2CV6A 1OSGA 2QZ3A 5FYYA 4AGRA 5FK8A 5IVVA 1XU2A 2BTVC 2ZZQA 5HV0A 1GZ9A 4DO0A 1SFPA 1PO13 3TNPB 4ORFA 2ARXA 5AVAA 2Y6JA 1R1A3 4OI1A 1VMFA 3MYXA 4GWNA 3NL1A 2YU1A 4L11A 5FZDA 3JZVA 4WZCA 1NE4A 4Q0PA 3B02A 3OOXA 4PJYA 5KXBA 1JU4A 2XMLA 2XVGA 2WZEA 2FDIA 1RUD3 3RNSA 2X5IC 5FZKA 1DBNA 4RS5A 3WR0A 1O6UA 3JBG1 3DCQA 4M3CF 5LY1A 2RJKA 1EPWA 2GZWA 2XHKA 2W92A 3MV01 4JTNA 2VW0A 4MGQA 4D7TA 2BV4A 1VBA2 5FZGA 4GULA 3VBHA 1HQWA 4PIZA 4AE2A 5LK7B 1D4VB 2KM2A 4CEYA 2CWMA 2R062 2PTMA 2TUNA 3ASIA 3LGRA 2WZ8A 4OLLA 4JAAA 1ASJ2 3MIGA 3ZYBA 3PIGA 1H8TB 1YYNA 2JE9A 1H1AA 3WW2A 2A6YA 3C7FA 1PNFA 2DUOA 1W8TA 1UX7A 2XR4A 3KM5A 1CGPA 1ONAA 2ZJCA 1ULCA 1VBD2 3I59B 1H4HA 4L92A 3HBKA 4H7MA 4YLZA 4YFZA 5DG1A 2EF6A 2Y0IA 5F1RA 2DUPA 5T5OA 2VJXA 2WSUA 1LHVA 4MXWA 5DDJ3 5EYXA 4HG6B 5KWRA 3R05A 3L9JT 5JDBA 2Z5WA 4A2UA 2QUOA 5LBCA 4IV1C 4LLOA 4PQ9A 3K48A 1YIFA 4LEJA 1FOD2 4HN0A 1VBB1 4IUGA 4YRDA 1DGLA 3V56A 3E6DA 1RINA 4SLIA 5FK7A 1V9U3 2UY9A 2A6WA 2RE9A 5J09A 2XPJA 1UL9A 4AGGA 3WDUA 3HQUA 3K2OA 4NJ4A 4CU7A 1AYN2 1BK0A 3IWZA 3NKTA 3VZLA 1AXYA 1H6XA 5DUXA 4K7JA 4NWVA 2EXJA 5K0UB 1V70A 1CZTA 1VLNA 2HEYF 2NYYA 4NO4A 4Q4V1 2FCUA 2IZWA 4AWDA 3N7LA 2ZEXA 4LPLA 3WF1A 5LBFA 1A78A 1Q5OA 2XL9A 3KT4A 3OPTA 4FBFA 1VBB2 2I74A 3LE0A 3R0RA 5BNNA 4RHV3 2RM23 2R0HA 4XBQA 4LBOA 2J1VA 1V9U2 4BCUA 3J7HA 1OT5A 2PHXA 4XZUG 1AYM2 1C28A 4N43A 2HKXA 2WWJA 4Q29A 4XJWA 3PIJA 4ARYA 1XNDA 1D0HA 2ZGOA 5LWBA 5IYYA 1OOPA 3WOGA 2HWB1 1OBNA 1TME3 5KC6A 2DVGA 2JEMA 3VBSC 4LO4B 1PVC2 2HWC1 1HXS1 2B4KA 4QMAA 1ZZ6A 4Q4X2 4TSVA 4XEZA 4YGCA 1QJU3 2E53A 3J8F3 1HN1A 1J59A 1JODA 1Q8OA 2PXJA 2OPWA 4OULA 4Q0QA 1M4WA 2FZ2A 3THTA 4G9SB 4LMFA 3UJOA 1PGW2 1QF3A 2D6PA 5DAPA 1DQ5A 3E97A 1HB2A 5EPAA 1DG6A 2WRAA 3ATGA 1AYM1 2AH2A 2Y60A 1ST8A 3IDCB 3ETQA 4NAOA 1VR3A 3T3YA 2G19A 1LODA 5FZBA 3DXTA 4Y5SA 1ZYBA 3GBWA 3AKTA 3E1F1 3OEAA 3I3QA 3ZSLA 2FDGA 5LB6A 2ADEA 1ASJ3 1DIWA 3UL2A 2C5DA 2ORXA 2WLPA 3VD5A 1REFA 1EV12 2VCMA 4N7UA 3ZXGA 2X10A 1W28A 3FE5A 5KR7A 1TZOA 4ZU5A 4KWJA 1SBDA 2AZ5A 2ZGRA 3VD4A 2ARCA 5C7GA 5IVEA 3KV4A 4BHPA 1QOTA 4OQ8A 1CAVA 4Q5OA 1QJU1 1IKPA 3HQRA 3TAYA 1ZREA 3KVAA 3DN7A 5IK8A 4QX1A 2RS33 1H1MA 2EVXA 2D3PA 2R043 4N7IA 1WMFA 4XF9A 2Q8CA 3SITA 1GOHA 1X36A 1ZZBA 1RUG2 2C1FA 2VZQA 3KMHA 2ADDA 4HVRA 4MGYE 3SCHA 2ZPXA 3ZSKA 2B46X 1SG3A 3CJXA 4EN6B 3RWKX 4I09A 1JI6A 4XBLA 4UFMA 3Q8CA 1DQ0A 4XTPA 1S0IA 4BQYA 1XRUA 2P3IA 5FZ7A 3URFA 2CAVA 2ZZJA 2LRPA 4OHYA 3MFCA 2NQYA 1AR92 3GNEA 5CFCA 5CISA 4AHYA 1JYVA 4YYOA 2D3RA 2HWD2 1WMXA 4RR3C 1BBT1 1PX3A 3JD71 1WKYA 1GU3A 1QMJA 3LEIA 4ZS3A 2W0XA 1GP5A 3AJZA 2EIDA 2BFUL 2JJ6A 3WF2A 4RR3A 5A3TA 5K7PA 3ZOIA 5FPAA 4AI8A 2VZ1A 2R061 3OPZA 2FDJA 3AMHA 3TEXA 1C8NA 2UU8A 1SLIA 3T2OA 3AL5A 1H8TC 2IXJA 1O4YA 5A32A 3EHKA 1Q8SA 1XC6A 2VMCA 2WO2A 4CCDA 1PO11 1UW8A 1AR81 1S0CA 1SDWA 4HSJA 1K5JA 3ZXAC 2HEWF 2WNVC 2B8MA 1C3HA 2JDNA 5JR7B 1ZZCA 3H1WA 4KMQA 2MEV1 3B7MA 3D82A 2WDBA 4KG0A 4LKFA 3J8F2 4MGIE 4YM0A 1MS4A 3VD9A 4QQOA 4UOJA 1J84A 2BNMA 5L9RA 4ZU7A 5GLTA 4Y33A 3RS6A 1PIV2 1PMJX 1O4TA 4RQPC 3OBRA 3OEBA 2PAMA 4Y20B 2VZSA 5H9QA 3SMHA 1RUH2 5C71A 5E1RA 3SLIA 2WAAA 2VMDA 4QXHA 4LHSA 1W8ZA 4XABA 5FZOA 3AVRA 4H3WA 4IEXA 4O9EA 3PJQA 4B8EA 2VCBA 3N36A 1EV13 1S0DA 2CU5A 5IVFA 1ZBE3 1GBGA 3BOPA 2CTVA 2XONA 3I3EA 4GZ9A 2P3YA 3ZN6B 5CG8A 1FNZA 3IT8A 4HKLA 5I0UA 5TSWA 4FPKA 4AXOA 3O1PA 2DBIA 5T5JA 2O8QA 4B1LA 3PNAA 2YPDA 2VNVA 2VC9A 3EJKA 4S2HA 3BOWA 5FIXA 5A3NA 1RUH1 1E5SA 3PUAA 2Q1MA 5F32A 2RMU1 4MG2A 2RS52 2X5IB 4D8MA 5FUPA 4QQPA 2WT1A 4YVWB 3WX5A 1UXZA 5T52A 3WV6A 1X9TA 2OQ7A 2PMWB 4FOVA 1ZRDA 2VG9A 4XYXA 3LEKA 3NNJA 1LESA 4A41A 4META 3TYJA 1WA6X 2MPFA 1ZRCA 3VBUA 4WM8B 2YGMA 4BJ0A 4MGKE 2Q1FA 2WFF3 1PO22 4OUSA 2WT2A 3DKQA 4A7YA 1AX2A 4FPYA 1DP0A 1TQ5A 2GNTA 5L7OC 2KA3A 1NX9A 5T50A 3WF0A 2JG8C 2ORZA 2GDFA 3POJA 3HNMA 3VBOA 1B35C 3APBA 3LA7A 1C8M2 2Q5TA 1I9RA 1V6JA 1XB9A 3ZYRA 5CKQA 3BALA 4LKDA 2FBEA 4UI9L 2ZAAA 4XZPA 5J3UA 2PA7A 1OUXA 5G05L 2BDRA 5M0TA 1DFQA 2Z42A 4DMIA 5CFCC 1R092 4DIQA 2ZGPA 5IVCA 1G86A 2F6BA 2OIIA 2H0BA 3PVOA 4M00A 1UCXA 4LK6A 2VVEA 3NWKA 2P2KA 3PUIA 4FVVA 4BK4A 4YSFA 3TEZA 1A3KA 5J36A 1SZBA 5DDJ2 2JENA 3ZSEA 4Y3OA 1T6GC 2ES3A 2JXAA 4FCAA 5KHHA 5L19A 3AXEA 4P9WA 4Y20A 3S30A 3J9SA 5KXCA 5C3SA 2Y26A 3FN9A 3OGGA 4M3CA 1F35A 4BIFA 1KDKA 1US2A 4GMP0 4EWDA 5FZOB 1C5HA 1FNYA 3BKZA 3ZYFA 4OZXA 3AYAA 2D93A 4UFJA 3FHIB 3WF4A 1UYXA 1QIQA 4HFSA 4CXXA 4FFHA 3OB8A 4MGZE 4XHBA 2DFBA 3I4IA 3ZYPA 1O3TA 3PDQA 1W2NA 3GXUA 5FWJA 3O1TA 1GANA 4GB31 4Q4X1 2WS93 1JZ7A 2RR13 1IQDC 4GH4C 3BTAA 1YEWA 5LA1A 4MZUA 3M3OA 4L0PA 2CL2A 4IEYA 1OH4A 1LOEA 3MEPA 2RM21 3W20A 2OYZA 4IW3A 1X9PA 4QX3A 4RR3B 2BBAA 5H9SA 2DTYA 4LO7A 1XU1A 5FXVA 1WLTA 1QJY1 3D6EA 5C9AC 4MGSA 1JOJA 5FYMA 4CUCA 2E7TA 2ZGSA 5I0TA 3P1IA 5D21A 1TME1 3H1YA 1GUIA 2GAUA 2GMEA 2QCSB 1RUC2 4H7LA 2YHJA 2WWUA 3A4UA 2R041 3ME2A 4GAZA 4XILA 3N9PA 2CYFA 4AVSA 5LEJA 1HIXA 2PHWA 2GC1A 2RG4A 5F5QA 5HCHA 4B7EA 2EIGA 1GQGA 1VBC1 1YQ5A 4W8JA 2ZXQA 4JDNA 5FZ6A 1Q3EA 4PDWB 1W6MB 4YW5A 3T4HB 4AVTA 2C9AA 5K4LA 1I6XA 3O0XA 4IV3C 4Q4W1 1FAYA 2WZR2 1Q8PA 4HVOA 4QPIC 2CGPA 5DDJ1 1K12A 1CESA 4CCJA 4NRPA 4RQPB 5JPNB 4CUBA 1IHMA 5GZFA 5H9RA 1A6CA 5ANNA 4I0WB 3O1SA 1LOFC 2VAUA 4IXLA 4MGTA 1WCUA 4ZXKA 1Q8VA 4N90A 5C4WB 2CY6A 2VTFA 1VB2A 2Y6FA 2XBO1 3AMNA 3WF3A 5FZAA 1NXMA 1W6NA 1H2LA 3OY8A 4AI2A 4AQTA 2ATFA 1PM4A 3MBWA 2WWSA 4BA6A 3LD8A 1E5HA 2R0FA 5LASA 2VMIA 4GWIA 5C3QA 5F6LB 3RZJA 2PHUA 1S0GA 1WW4A 1FV3A 3GALA 1JZ4A 1RUF3 2GC0A 2WQZC 4Y5TA 1G6NA 3RDIA 3VZOA 5FPLA 3DKWA 2B5HA 4R9DA 4YM1A 3FUQA 4XMIA 3IDAA 2G9GA 2OW4A 3NSTA 2QQVA 1R1ZA 4YW1A 3POIA 3U1XA 5HV4A 1AR61 1BJQA 1LHNA 2DURA 3GZTB 2VQ0A 3WSOA 3R6SA 5ABJA 3RZKA 1HXS2 2B9VA 4K6BA 3QLQA 1NAEA 1W6OA 5KBFA 1UZYA 1V6KA 2VL4A 1PMHX 1G9AA 3N9OA 4AGVA 4N43B 2WQ4A 4XQ4A 1N1YA 5GZGA 3UYJA 3GDBA 4IGPA 3KHCA 2GALA 5GKAC 1IS4A 1GP4A 1CWPA 5I8YA 1GNHA 1OLMA 3KT7A 2XQXA 3H8UA 4LBMA 3VD3A 3ZM8A 4BMBA 4EJRA 1UOGA 5EJ3A 5F3GA 4EQVA 1OI6A 3VBUC 2B45X 1NZCA 4JRLA 3ZXJA 3QOPA 1URXA 3Q8FA 4HETA 2DVDA 3CLPA 1JHJA 2R16A 2BUKA 2YBKA 2ZHLA 1EV11 2VBDA 5IUQA 5F9TA 1NLRA 2DBNA 3O1UA 4M4PA 4OUMA 1POV0 1YQCA 3AKQA 4P9LA 2HWF1 5JZGA 2HYKA 2QQUA 2ZS6B 1PZ9A 3SH4A 2IXLA 4CEWB 1KD7A 4A42A 1UOFA 2RS51 5GLWA 4CCEA 2O1QA 2VZPA 3H1MA 2A75A 5FY8A 4E4DX 4DZGA 1J3QA 2AC1A 3EQEA 2VQTA 2E32A 3VBFA 3ZXDA 5A7PA 1FXZA 4BQ5A 3FFQA 5F2SA 3BI3A 1RUI2 2JG8A 1UO9A 2UWCA 4AQSA 4ES8A 4QKNA 4XETA 3LAGA 2E63A 4XDQA 1W6MA 2A3WA 1LCLA 2W47A 4E4SA 4K20A 4D69A 4WM7C 5CG9A 4QPIA 5F2WA 3S57A 1Y43B 4ZZ5A 4DINB 1AJOA 2IWGB 3LOIA 2CDOA 2DCTA 2E26A 4HPKA 4RGAA 1UKGA 4Q1PA 2VU9A 5E89A 1PGSA 3OYWB 4BH9A 3TB0A 1L7RA 2VW2A 1GKBA 4ZZ8A 4OHVA 1YFWA 3USUB 2RS53 1HB1A 1NQJA 1HRI1 1TMF2 1KDMA 2BW8A 3GGLA 4AEDC 4Y1UA 1GYKA 2BGPA 3VKLA 1OF4A 3ZFFB 2VM9A 1W03A 1UIKA 4LNVA 5JXGA 1KGYA 4FPFA 4XBNA 1WA4A 5EWSA 3DUIA 4QQHA 2W1UA 2I07B 4YGEA 2EXIA 3IZOA 5LBEA 5FY1A 1ZA7A 2R30A 2JD4A 2V73A 4CXWA 2OUJA 4LR4A 4FPGA 4QGNA 2ARAA 3FJSA 4P9XA 4C8DA 3VLBB 4CDXB 1H4GA 4CRQA 3K51A 5A7NA 5B2GB 3POEA 1CAWB 1DGRN 1VBE3 2A70A 4P14A 2HWD1 1G9FA 5FYCA 5FRAA 2D5FA 5L36A 1DLCA 3POGA 5CZKA 5FZ9A 4NMIA 3ZYJB 4WM8A 4PIYA 2QJVA 1ZBA1 1WW7A 3IKWA 1O7FA 5D8AC 3NV3A 1RUC1 1E5IA 1LHUA 2BYVE 2BZDA 2JDUA 3NV2A 5D8AB 2AEYA 1JYWA 1R081 2QQIA 1RUI1 3VDDB 4CCNA 1MZ5A 3J26N 5T5LA 4CUGA 2V09A 1UYPA 3WZ1A 4FPCA 1VRH1 3H3LA 1RB8G 1K45A 4AAPA 4FTSA 1BVP1 3PJYA 1R1A2 3ABZA 2VULA 1Z0HA 1LHWA 5FMCA 2JX9A 4ZONA 5C8CC 3AFKA 2D6KA 2R32A 4IE5A 2ZGQA 2BOJA 5FUIA 1KS4A 3WHUA 3U78A 3D5OA 2EXHA 4UF0B 4XUNA 1J3PA 1S2KA 3TOJA 4HVQA 5JIUA 2XBO3 3GCXA 2BEOA 5DAQA 5A7SA 2WNVA 4EZHA 1K42A 4V2WA 5FKBA 1LENA 2ZEWA 3IBMA 5JI9A 3WNNA 4UBGA 3LDBA 4AEJA 1D4M2 1POQA 2B9UA 3QBQA 2DF7A 1NA1A 3HT1A 4Y24A 4N53C 2RVAA 1H0BA 5IAVA 3RWNA 3WDXA 5E6HA 4RL7A 1RUF1 3WDWA 4NIHA 2RS31 4D6RA 2BNOA 4RHV1 1OLQA 1B35B 3ZFGB 1QJY3 3LB9A 3ZYGA 2NZ9A 1Y3TA 4QKBA 1UMZA 1ZM1A 4JGYA 1JUHA 2JDKA 5I91A 4JGZB 1TE1B 4Q4V3 4CDWC 4AW7A 5AC91 2PHTA 3UJQA 4YARA 2A3YA 1HW5A 3BYWA 1YFXA 4D7YA 1PK6A 1CX4A 1VPHA 4IV3B 4HXCA 4UF0A 2E6VA 2Z79A 4CDWA 2TNFA 1HB4A 3LIGA 3POFA 5FPVA 3WEZA 2Z4FA 3BU7A 4CPBD 5LA0A 1DLLA 1O4ZA 2K9ZA 2VCAA 2C6SA 1BZWA 1FOD3 1VP6A 1D2QA 3DPRA 4DEVA 4TYSA 4K40A 1UY4A 2VY0A 4M01A 1L7QA 3IPVB 1FPN3 3LWCA 4RGGA 3AYEA 1JZ3A 3AP6A 2P4EA 4H14A 4WBBA 3QH6A 3WCSA 4P08A 5JR2A 2WS92 4Q4V2 3W59A 3J4UH 1Y9GA 4IEQA 1DQ4A 1LGNA 4MLOA 4YG6A 3ACGA 2V5YA 2XQRA 4BPZA 3A22A 4E8CA 1RUE2 4CDQC 2VZ3A 2OA2A 2ZGTA 1WCDJ 1JYNA 5FXZA 1F5JA 1H2KA 2HWB3 3L2YA 5JZGC 1HRI2 3I2GA 4COVA 4CDQA 3HD8B 3A23A 2C26A 4OVEA 4EE2A 2D40A 2A3XA 4DY5A 2I45A 3MLLA 1YO8A 4GALA 5I8SA 4PLMA 4TN7A 1ODMA 4WM8C 3C7HA 4K21A 5CB7A 2RS13 4QHZA 4XPVA 1LU1A 5FOBB 1JZ8A 1AX0A 4F8AA 2VD7A 3D8CA 5FYVA 3WLUA 2CWSA 4DUXA 3MPPG 2VBPA 4A6OA 4N43C 4A6SA 1SLLA 4AVAA 3B94A 4FI9A 3MV11 3E5UA 1OOPC 4U2AA 5AC92 4FAHA 1WLDA 3ROUA 3V0BB 2R1DA 3K4ZA 4ONUA 1QU0A 2JG9C 2Q1ZB 4ZPIA 1RTVA 2P17A 4M0HA 1GNZA 2OZJA 4XMAA 2B42B 1PVXA 3OJBA 1KFXL 1ZBA3 2DTWA 2F4LA 4JQTA 2BP6A 1W99A 2OZ6A 2WR9A 3MDPA 1GQHA 3WUDA 1X33A 3AX4A 4XIOA 4YVSA 1R1A1 3AXDA 3KLSA 1W9YA 3OGSA 5LBBA 3WG2A 1JYTA 5DZFA 2J42A 2RDNA 5DABA 1S2BA 3CBNA 2JD9A 3CQOA 3FHQA 1LOAA 1MR5A 3V0AB 3F2ZA 4FT8A 4JKKA 4W6WA 1QJX1 1QKQA 1W39A 1PNGA 2ARBA 2XH6A 2C4XA 4CE8A 5JWPA 1W05A 2PQQA 4N8MA 5DXDA 4QAWA 4E27A 4QXCA 3ZN5A 2FDHA 2K2SA 1NCQC 2G4IA 3FLTA 1R083 1GWKA 4JV4A 4LHKA 3VDDC 4DQAA 2XKOA 1YLLA 4UBHA 4Q8KA 3POSA 2W9XA 3OF1A 1DZRA 1JN2P 2XJQA 2DFCA 2H6BA 2XJRA 2VVDA 2JE8A 3MF6A 5EZWA 1RUG3 2XLFA 1C8M3 2ZKLA 4L9BA 1TMF3 3RYPA 2WNOA 1VRH2 4LIVA 5T3NA 1OFNA 1XNKA 4CXYA 4GJYA 3GBFA 4Z2AA 5IWFA 5C8CB 2XB6C 1W6NB 3OY8B 3K3OA 4HSLA 3JBG3 4HOOA 2XJTA 3C8XA 4Y22A 2BWCA 2AUYA 1JH5A 5HCBA 1SBEA 5CEHA 2Y34A 4IEPA 2XUEA 3SCGA 3ZKUA 4XDOA 3N7MA 4AEKA 2GP5A 1HLCA 2LTNA 1OFSA 3NMBA 1GLHA 2Z69A 3ILNA 4HL0A 2JIJA 3HVDA 3SQOA 1EPZA 1XJAA 2ZHKA 1ND3C 4Q2FA 4YFWA 3BIEA 3NRUA 4RGKA 3THCA 5A33A 1PZ7A 1YI9A 4DY3A 2ET1A 4R4ZA 4MSVA 3Q8EA 3BTZA 5DZEA 2QNKA 2QQNA 4Z07A 5DN2A 4LBQB 5FPXA 1XOYA 4FP3A 4OCTA 2KXLA 3LCPA 3ZFGC 2XJUA 2JB4A 1UIJA 1UKRA 5LA2A 2VTXA 3OUHA 4BWOA 3K4AA 4QD2A 4CUAA 1KFUL 4E2GA 3ETPA 1QJX2 3NVCA 5JOXA 1UNBA 2A5ZA 3GBGA 2LW8A 2WT0A 5FWEA 3VBOB 3AC0A 3SXWA 3KVBA 2VECA 1VBD1 2VE1A 5CADA 3PTYA 4R9AA 2VXRA 1P8JA 2D97A 1MS5A 3ORJA 5FP3A 1POV3 3AM2A 1GQPA 4B1MA 3U11A 4OFGA 2P34A 4QHOA 4TTGA 1MS1A 5J98B 3A7QA 3DEMA 2BVVA 2YMZA 4BXSV 4B7KA 4KU7A 5BXXA 1AL21 1IS5A 4XJAA 4Y1ZA 5GZDA 2O8OA 1IQAA 1CZVA 3SC7X 4XE9A 2WUHA 5FJHA 2WL1A 4NHYA 5J96B 3KV9A 1EYBA 1EAH2 1NLSA 2ZABA 1SMVA 3FBMA 5FMDA 1CONA 1GFF2 2VZOA 4AFMA 4AQ6A 3UKNA 1EUUA 1CR7A 3SHRA 4K1YA 3ACHA 4YW7A 1WLWA 3OBTA 3T1LA 4FPHA 3ST7A 4EYUA 3MIEA 4JHZA 4R9CA 1FI2A 1VBE2 1LJ7A 2D6MA 3VBRC 4HK8A 2SBAA 1NE6A 2VOWA 3UNPA 2VZVA 4QU2A 1Y7BA 4NRMA 3MIBA 1DYKA 4UFLA 3KV5A 2JB8A 1DQ6A 2J1SA 3VBRA 5ACA2 1TG7A 2RR12 4XQWA 3NO8A 1EAH3 3ZXLA 1RHI2 1S0JA 1CPMA 2JICA 2YBSA 2YXSA 2B7YA 2GP3A 1WUVA 4XURA 2BNNA 3ECQA 2JKXA 2W1QA 1QJY2 2UYAA 3Q8BA 3RZHA 2P5BA 3G6JB 3HPNA 2Q8DA 1W6QB 4URTA 1AR63 2KR2A 2QDRA 3M3IA 3OPWA 1O3QA 1UYYA 4UYBA 2WYSA 1YJKA 2W3JA 4B29A 4O61A 2ID4A 2BVBA 1N1SA 3OYWA 1H2MA 5GZEA 5CFDC 4KWUA 5J1XA 3C3VA 3ON7A 1IG3A 3VBOC 4JRAA 5JPMB 3H9AA 4RFRB 3TNQA 1IG0A 4I0AA 1QQP2 4Q4W3 3HJRA 5A7WB 1DGWX 1QJU2 5EJ1B 2XBO2 4YM2A 1HB3A 3B01A 2YC0A 1AR72 1PK6B 1UZZA 3IMMA 3RFRA 4AVVA 2HBUA 2BJSA 3WW3A 2YFUA 2P1BA 1W8WA 4R4XA 4AYUA 4JKMA 4MXVA 1QXPA 5F7UA 3RMXA 3UKVA 4LA3A 5EHDA 1V6MA 5BNOC 1XNAA 2W52A 1ULPA 4FQ4A 4FO9A 4RA0A 3S5AA 5E8AA 2NLRA 3J7LA 3P6BA 1JYIA 5JSPA 5FZ8A 2AGSA 1CZSA 1WBFA 2IFRA 1WW5A 4BU2A 4GJZA 1CD3G 5FJKA 4GIQA 5JLVA 2EAAA 2VTXJ 1AVBA 3ES1A 2X8KA 5A3UA 1CIWA 1FPN2 3E6CC 1VBC2 1DDLA 3M7AA 1LEMA 2JDAA 3WP4A 1BEV3 4YGBA 5CU1A 1UWWA 4I0BA 3M2MA 3M3CA 3NNFA 4PI0A 1UMHA 1YIPA 4HONA 2GN3A 1SHWB 1S55A 2DVFA 1W2UA 2AACA 4AAXA 1GMMA 2HWE2 5LATA 5B4XA 1HV0A 1JTZX 2WO1A 3EB7A 3PVNA 1WMDA 4C1WA 3T2QA 2XVKA 3LSDA 2R071 1ZVFA 2HWB2 3JQWA 3LQCA 1YQ2A 5CIRA 3SNMA 4QDRA 3RI8A 1GWLA 4YG0A 4DRVA 1RUF2 3VD7A 4X8NA 3BTYA 3ZFFC 2WSVA 5LK5A 1LOCA 1HKDA 4BQ3A 1RXFA 5EV7A 1H2NA 3IDEA 4YZ4A 3TRSB 2JDYA 3OGRA 1EAH1 1UY1A 2IC1A 2FDKA 3B93A 1MS0A 3B9CA 4PI2A 1ULGA 3RG0A 1E5RA 3LA2A 1HXS3 1N3OA 1OKQA 1Y4WA 2WAOA 3N9NA 4AHWA 2ZEZA 5J37A 4COWA 1W9FA 3RSJA 1NCRC 4DXSA 3HEIA 3VL9A 3RYRA 2QQPA 2XWBB 3AP5A 3C7EA 3D3AA 5K8SA 3WY6A 1S4CA 2ZBJA 4BDVB 2RMU2 1W06A 4P9GA 3DF0A 1NA1B 2WFF1 3WXPA 4YZ2A 5C6CA 1OURA 2VPVA 1W0NA 3K3NA 2RM22 5F3CA 5BNOB 2J1AA 1RUJ1 4QB6A 4AI9A 2K0GA 2YYOA 2W91A 1KQRA 3MGUA 4IDZA 3MLJA 3PU8A 4IEZA 4LO5B 2UURA 2WO7A 4R8HA 3D0SA 3I49A 1KRIA 4GQ7A 1O5LA 5FP4A 1J58A 1NY72 2C9KA 3E6BA 4PHZA 3VDAA 1N1VA 1Q56A 4KI5M 4NUBA 4P5YA 4WZFA 3GJAA 3PUSA 1SACA 2YBPA 1HJGA 2WNUB 1ZZ8A 5LZ6A 2BOIA 3NV4A 3IIIA 4KG8A 1PIV1 1AF9A 2AREA 2BPA2 4KWLA 2XXZA 4X6QB 4B4PA 3MW3A 4YVSB 1ZZ9A 5HPOA 4IE0A 5LCWL 3BU0A 1G8WA 2P6HA 1BQPA 3JB8A 2VUCA 1D4M1 1LOBA 2DWRA 2GU9A 2PHDA 4UXAA 1NLQA 5F39A 3VBFB 1OA2A 3ZR5A 2VOKA 3HIFA 2JDPA 3WUCA 1AR71 1SFNA 2G1MA 1OUSA 3KGZA 4ARXA 4AFDA 1Q43A 1LEDA 4A7KA 2WFPA 3M1HA 3M3EA 4RYDA 1ALYA 1WBLA 3AL6A 4BISA 4XCBA 1CJPA 4EV0A 4YZ1A 1CAXA 4X8PA 5CFDB 3E5QA 5I8TA 3CJIB 1POV1 5K9YA 1JMUB 4O7XA 1G9DA 1GICA 5FZCA 4CEWA 1PMIA 1FYUA 3WDTA 1UU6A 3AJYA 1C57A 3WG1A 3D0JA 3ACFA 3B5LB 3NAPB 3OTFA 1B09A 2AYHA 4OZOA 5L9BA 3S0MA 1PO21 5HCFA 3MHZA 4RD7A 1N1TA 1OVPA 5EIYB 4TXWA 5SV5A 5EJZB 2ZOEB 3LDRA 4EN8B 5ACA1 2E31A 2VQUA 5FPZA 5ABJC 3H3UA 1MVQA 1W8FA 3I54A 1EUTA 4XFFA 1ENSA 3MW4A 5FQ0A 4MVTA 3VB9A 1QDOA 2D7FA 3OD0A 1CN1A 4WVVA 3OGJA 3WNMA 3ZIWA 2W1SA 4HKOA 2QE3A 4I30A 1LTEA 5A3OA 2ZMKA 2BRTA 1LHOA 3BPZA 1ULOA 3NV1A 4LBQA 4GD4A 4NPLA 1LNSA 3HWJA 2DVAA 1JZ5A 5T55A 4JC1A 5CBLA 1JZ6A 2VQAA 4BLJA 2J1UA 1YXWA 1SDDB 3AZXA 1YWKA 4QM8A 1PO12 2EALA 2EIBA 4P02B 2QTWB 5BNOA 2W68A 5ISLA 2ZA9A 1REDA 2CGNA 4HZFA 2OS2A 3ITQA 4QX5A 5BNPA 3GYDA 3WQ1A 5FOJB 4XTMA 4XUTA 1K5MA 1QDCA 1GZWA 1SBFA 2PHRA 3IDBB 4KU8A 1RC6A 5A33B 1WGPA 3ES4A 1W8HA 4J25A 4EWAA 2RJLA 1CIYA 3RJ2X 2IUWA 5BY5A 5FMOL 4HN1A 4QB1A 2ERFA 2VMHA 1LB2A 5GLUA 2A7AA 3AKPA 3M3QA 4AEMA 2PHFA 4ET7A 4HT1T 2WNVB 5DAXA 4FTBA 1O8PA 4J1WA 5BNQA 1H9WA 1OA3A 2CHHA 2PAKA 2Y8KA 4Y5Z0 4ASKA 1RMU3 4IEWA 5IVBA 2WA3A 3RZLA 5FY7A 3N7KA 1WD3A 3K46A 4EZ4A 2X09A 3I97A 2A73B 3VZKA 3WG4A 2VW1A 2OKXA 2CSGA 2VNRA 1EP0A 3WT3A 2WLQA 4XW3A 4ISRA 1HRV3 1W6PA 5FYBA 5T5PA 3RJRA 1ND2B 1UMIA 3T1MA 3RI9A 4AFBA 4BQ4A 1H30A 4CDUC 5KHJA 4K3UA 2A71A 4C1XA 3SCFA 5C3RA 1TNRA 3PLQA 5DAWA 1UOJA 1AUYA 3I2DA 1AYM3 2QKDA 3HOBA 3PL0A 1ZA4A 2VH9A 2OPKA 5AC93 3V0BA 4CZSA 5J48A 1ZRRA 1U5IA 1NT0A 3NAPA 3IM0A 2VMEA 4QU1A 1HQNA 2W5FA 3ZN4A 3FL7A 3FC0A 4IQPA 2IXIA 4XXPA 3M8LA 2CGOA 2FMYA 3DGTA 5LA9A 2GN7A 3ILFA 5T54A 1AL0G 2P3JA 4FOYA 1Z7S3 3ZXFA 3VN4A 5IK7A 5F3EA 1AHSA 2E33A 3DECA 1QHDA 1GR3A 2OXBA 4O9GA 3KV6A 5FXWA 1GSLA 2NN8A 2R7EB 4HKWA 5LEKA 3HQXA 2CAUA 1YC61 4NN0A 2PELA 4GMP1 4AF9A 4BLIA 3RMYA 1ZRFA 3WW1A 2J1EA 4JKLA 3W58A 5EQUA 3KS7A 4NR1A 1FPN1 5L7OB 3FFZA 4XOGA 3VKNA 2RDSA 1IKQA 1H8TA 5CYYA 3ZFEB 5FYUA 4BQ2A 4D7SA 5C33A 1RMU1 1RMU2 4PDWA 2FQPA 1GP6A 2HWF2 3S7IA 1IS6A 4S2DA 1SEFA 4FAGA 1O3SA 4ASMB 1SPPA 4AI0A 5A70A 1BYHA 5KHGA 4PDWC 4SBVA 4XF4A 1ZRIA 5CFCB 1HQLA 4LUKA 5IK5A 1X8MA 1WW6A 1N47A 4QQLA 4LJHA 4XVHA 3VUOA 2RV9A 5GALA 2BQPA 4KGGA 2ZGNA 3FWEA 4Y26A 5FZIA 3QH7A 2B39A 2GSYA 2I2SA 2V4VA 3VKMA 4TLFA 1UOBA 5IVYA 4AR2A 5LY2A 2DDUA 5J7MA 3TEYA 3S5QA 3QCWA 5JAXA 4PIXA 1RUNA 3ACLA 3N9LA 5JXJA 1XE8A 2JWPA 2W87A 1UY2A 2WKKA 4TZDA 3LA3A 2FCTA 1BCXA 4M3CB 4XJ9A 2D6LX 3AK0A 3MPBA 4CP0A 4L99A 3DV8A 4XJUA 2CNAA 4BQWA 3CO2A 1FT9A 1F4AA 1K5MB 3OG2A 4W65A 4A3ZA 1GV9A 2WNUC 3KB5A 4ZY9A 2VMFA 4GKXA 1NY71 3LF7A 4GWMA 3POBA 2D98A 1YI7A 2HWD3 2R042 1F8VA 1DCSA 4W6YA 4KH9A 3NQHA 2WNUA 3MLKA 4CU8A 3JUUA 4ZKTB 1O3RA 1YRZA 1UX6A 2Y6KA 1AXZA 3KD4A 4X6RB 1AL23 1IPKA 1CX1A 3MO4A 3SEEA 3GZUC 2D44A 2W1WA 3H0OA 4G4FA 1QNYA 4NWWA 3EBRA 4AHXA 5IT6A 4FP2A 3ACIA 4COZA 3HBZA 1RUI3 2XLAA 2Q4SA 4IEVA 4BMEA 2YZ4A 1OC1A 4L2NA 2JG8B 3KF3A 1OA4A 2VUJA 2E51A 1CAVB 4XUQA 2BWAA 1RL3A 2AR6A 3NJXA 3O5SA 3OUIA 1US3A 4PLOA 1ZX5A 3LFIA 3PMSA 2ZHMA 1H6YA 1NUKA 5FP8A 3H3ZA 1W3XA 5I0RA 1HX6A 5IVJA 1JOBA 1VAVA 3O12A 4JCKA 4V1PA 1KEXA 2RDQA 2X53S 3I7DA 4OI2A 4C0BA 1MS3A 1DGWA 1F2NA 4WVZA 4XDPA 3I2KA 3I2OA 3VKOA 2HWF3 4QM9A 1UZWA 1BVVA 1NCQB 1RVF3 2R072 5FV3A 3RGBA 4F3JA 1VIWB 3T0AA 4UW6A 1DGRA 4CYDA 4GB32 1X8EA 1AR82 1GWMA 1W3VA 2ZMLA 1GNYA 3LEMA 2JIGA 5FXXA 3NJZA 4YGDA 2Z2SB 2NMOA 1XNTA 4E8DA 3POYA 4AEDA 2WO3A 2WQ8A 5FO9B 5GJ6A 1CVNA 4C90A 4XFCA 1CAXB 1O8SA 4FPJA 3JD73 4GKYA 1XBFA 2CDPA 1TVGA 4R9BA 5A32B 1ENXA 4XJ8A 2PLV3 3P3PA 3AVSA 4GH4B 1PX4A 5D2AA 4YVWC 4N53A 5LRRA 2LS6A 1ZBE2 4RS5C 4ZS2A
chains in the Genus database with same CATH topology
3SH5A 1FMD3 2GH8A 1RVF1 1OHFA 2Y0OA 2XKPA 3MIDA 4XQDA 5FCCA 1O5UA 1MEC1 3UV9A 1FV2A 1RUE1 3G7DA 1LRHA 1RUH3 4C0HA 3WNXA 4BE3A 4CEYB 2GNBA 3VDDA 1RUD2 2MHFA 5FO8B 1REEA 3E5XA 1ZBE1 2HEVF 5CAZA 4QPYA 4XFGA 2RS11 3GHMA 1HDKA 1COV1 2MNGA 2QFEA 3MZHA 2D6NA 1AR83 2EA7A 4KQ7A 3WCRA 1J1LA 1KXGA 1U0AA 1V6NA 4RQPA 1HV1A 1QXJA 4I02A 3M70A 3WVJA 4ES9A 1QJX3 5HI0A 1UPIA 4Q26A 5FMOS 3RQ0A 1AR93 3SISA 1CQ9A 4CDUB 1VBA3 2ZTNA 3KT1A 1RUG1 2XG3A 2ZMNA 1NXD1 4LHLA 5FLJA 1RIRA 1UF2C 3QD6A 2ZAHA 3H7JA 4BQ1A 1DQ1A 2RHPA 4INDA 3PVBB 2VOVA 2DYCA 4QGMA 5FAXA 1H9PA 1AX1A 4K9SA 1BBT3 2BBVA 3A0NA 1SCRA 2W39A 2G9FA 4Q4Y2 4H55A 4Q4W2 1LGBA 3ZN6A 5KHKA 1U12A 3RRDA 3M4FA 1VBC3 4J6GA 4AEDB 3ENRA 2TBVA 3W9AA 1E57A 3PMEA 5JSOA 1DU3D 4YW2A 1S0FA 5E88A 1W0PA 1UN1A 1O91A 1F5FA 4LUMA 2Q8OA 2IXKA 1LULA 3N35A 3WQ7A 1WD4A 1YFYA 3VBUB 4A7ZA 5GZCA 2DCYA 5C8WA 3AKSA 4FTEA 3VHNA 2EAKA 3AB0A 3GHNA 4CDXC 1BEV1 2DUQA 3USSA 4K1ZA 1C1FA 2XLGA 2ET7A 1BBT2 2YROA 5EFUA 5ABJB 2IFWA 4Y1VA 3INAA 2LALA 3CEWA 4Q8LA 3VHPA 4WVMB 2ZCWA 1AYN1 1AXKA 1OPMA 1R091 5K0UC 1QH7A 4JDOA 1XNCA 5JSRA 1KS5A 3WD5A 3ZMOA 4UW4A 1K5MC 2ZGKA 1FOD1 3CNAA 1OQEA 4DS0A 2D43A 2YV8A 2D5HA 4YZ5A 1TNFA 4NVPA 4Q0VA 4P5HA 1NYWA 1XXNA 3AZWA 4Q4X3 1HRV2 1H8VA 1CAWA 2PAEA 5D1IA 5BPXA 4D94A 4Z8BA 3VZMA 2HWE3 3VL8A 3DL3A 2UY8A 3EO6A 3FUOA 3VBFC 4A3XA 1PVC1 2HWC2 4MH0E 3IN9A 4QPGC 4JDMA 4MV2A 3U0ZA 3KQRA 3ZO0B 1QOSA 2PLV1 4QGLA 4RSUA 3RYKA 1MVEA 4LULA 3ZMNA 2QDNA 3AMPA 4QPGA 5F6KA 1QXRA 4XFIA 2X29A 3THPA 4LA2A 3T2TA 4WVMA 1R082 2P3KA 2YDEA 4FPOB 2LM3A 3A0KA 3USUA 2N7GA 1RJ8A 2GH2A 3ZFEA 3EXUA 3BCWA 1OPOA 3SH3A 1V6LA 1A8DA 2ZHNA 1AL22 4YG3A 2RMU3 3ZXKA 1ENRA 4OI4A 5FDBA 4M0NA 3UKTA 3AZYA 2NM1A 3LOBA 5HCAA 5KC5A 3DPRB 1C1LA 4QXKA 1CPNA 2XUMA 3FMGA 1S1AA 3KCXA 3HR9A 4ITCA 2GC3A 1SLCA 2YGLA 5BYNA 2FMDA 1DZTA 1OQ1A 1RUE3 2FHRA 2OVUA 2JKBA 1IZ3A 4EN9B 4Y4YA 2DU0A 2YY1A 4PCRA 3VGIA 4Y22B 3O0WA 4B4QA 1NG0A 3VZNA 4Z82A 2VGDA 1MQTA 2PFWA 3ZFGA 5JOYA 1I5ZA 2JECA 2E9QA 2W08A 4IV3A 4WM7B 4J1XA 2WZPP 4E9KA 2ZKNA 2ETEA 1RJ7A 4I3PA 1MS9A 4LLFA 3S6PA 5BUVA 4QQ2A 3WW4A 3JD72 4WV8A 4IEOA 1LOFA 2WC2A 5DUWA 1M06G 5C9AB 4BZ4A 2C0ZA 1APNA 5JVVA 1J3RA 2D6OX 2O0OA 3TWIA 1LU2A 3MF9A 1IS3A 3JQXA 1ZZ7A 2XGXA 2JG9B 3JB4C 1RUJ2 2DCZA 3QACA 1U5ZA 4QT6A 4CDWB 2RS12 1X7NA 3O0VA 4HANA 2ILMA 3ZYIB 3VHOA 1W6OB 2WZR3 5FQ0B 4Q1RA 4IEUA 2DCKA 3MIHA 1ND2C 2GNDA 1PGL1 2XJVA 2ZX3A 2NP0A 1KITA 1B35A 1ULDA 1VAMA 3CL1A 5L73A 1G9CA 1NOVA 1I1EA 4ISQA 3DPRC 1R093 3VBHB 3WQ0A 1MZEA 1GZWB 3GZAA 4I3GA 3N4MA 4RHV2 1U5XA 1C5IA 1ASJ1 1RITA 4YVWA 3TN92 4Z92B 1VAKA 4XFAA 4DOUA 4LBJA 4OHXA 1D4M3 1PGW1 4P9IA 2UWBA 1OD5A 2P37A 1LGCA 4LO6B 4Y1XA 4MXWB 5EXOA 1SLAA 3S7EA 4COUA 3CU7A 3HAGA 3VZJA 4CTEA 4S2FA 4EN7B 4N53B 3UK9A 1Y9QA 5IK4A 1Z7S1 3MI8A 4YZ3A 4AVCA 4HMZA 1L3JA 1XE7A 1RUJ3 1UU5A 4AG4A 5DG2A 3R4DB 2VNOA 1ND3A 4OI0A 2MEV2 3C2UA 3ZDSA 4M3CE 1VJ2A 2HWE1 3KCYA 1PZ8A 4NHMA 4IERA 3ILRA 5LRSA 5L7OA 2PN5A 5C9AA 3VHRA 1QQP1 3P3NA 4N9IA 4CP1A 1MZFA 5HBAA 1V9U1 2ZGLA 3HN1A 1Z78A 5SV8A 1BEV2 4AHZA 4DNYA 1A8MA 4DB5A 4E2QA 2ZGUA 3LZZA 1YFUA 3ALQA 3AZVA 5C4WC 4AFCA 4P9JA 1IPJA 5KXDA 1MQTB 4GMP3 4E4ZA 4OHZA 1PHMA 2A6VA 1EY2A 4FOQA 3IIAA 2HWC3 4HBNA 5CVRA 1AJKA 2XL7A 1RVF2 2R073 4D3WA 4HPKB 1FATA 4FSJA 4FXKB 1DZQA 3O7OA 1N3PA 4UW3A 5FFOC 3WDVA 3KZ4C 3WDYA 3ZIXA 1Z7S2 4B3NA 4F7ZA 4KWKA 3V0AA 1D2SA 3AMMA 4JVAA 2H6CA 3N3HA 3MICA 4I01A 2R1BA 4CP2A 2VOXA 1OMIA 1YCIA 2VMGA 1ULFA 1QQP3 4E2SA 1RHI1 2VUAA 2GNMA 1GZCA 1CAUB 2E7QA 5H9PA 4XHXA 3V64A 2RR11 4KNCA 3MIFA 1U5YA 3ZSJA 1S0BA 4GB33 4KGQA 4LBNA 3CJIC 1V6OA 1YJLA 5AFEA 5JMCA 1J1TA 4FXGB 1ULEA 5KXEA 4XF0A 3CJIA 1Q8QA 2ENRA 2XVLA 4JGYB 1JUIA 4MYEA 2ZGMA 3H7YA 4Y1YA 2NMNA 5D8AA 2DV9A 4JTOA 1X82A 3AYDA 5CA6A 2DVBA 3RPQA 2H0VA 5CNAA 3ZVXA 1ZBA2 5JIAA 1AR62 1MEC3 2DU1A 4BOWA 1ENQA 2NPIA 1HRV1 1BMV2 4XF3A 1VBD3 4LTAA 2BFUS 4IESA 3BB6A 3B3QE 4KBBA 4EN0A 3VV1A 3OCPA 4IETA 4W6XA 4NOTA 4PBPA 2GC2A 3KSCA 1YNAA 3AFGA 4AFAA 5GLVA 1IGOA 1PO23 1XYPA 3IPVA 4GA9A 4PBOA 1JW6A 1AR73 1RGSA 3V65A 4XJZA 3VBRB 4FPEA 3I59A 4XFHA 5FO7B 1TMF1 4RFT0 5I93A 5A3MA 3ZSMA 3JU9A 2QVSB 3BODA 2PLV2 4P9YA 4ATFA 2BGCA 4LBQD 4CEYC 1VBE1 4QPGB 1YUDA 2IXHA 2WZR1 1UU4A 3FBYA 1XYNA 1S0EA 1NCQA 3U10A 1N3QA 4XXAA 1RUD1 4AQ2A 4I2OA 4HLTA 1IOAA 1JHNA 4S2GA 3R4UA 4JGZC 1BKZA 4IV1B 2VVFA 3H50A 4DPNA 1QGLA 4GXLA 4Z1VA 1FMD2 4OHWA 2EXKA 2R063 2WFF2 3NKGA 3WINE 2PHLA 2ZX0A 2JDZA 2Q0AA 4DXZA 1W6QA 3AKRA 1BMV1 4FQZA 2UYBA 4NHLA 4GH4A 5AVPA 3HMYA 5FLHA 1DYPA 2HJIA 3WP3A 3TN93 1QWRA 2AENA 4YW4A 5I0SA 4BIOA 3O14A 3KCCA 3POWA 4N9HA 4FOWA 4AI1A 4JQRA 4L97A 4YVSC 5JZGB 1NCRA 3HT2A 5BNPC 3FLPA 3AP4A 2WJSA 3MFAA 2PYTA 2WIIB 2JG9A 4AK3A 1AZDA 3VKFC 4LHNA 3VBSA 4WM7A 5C4WA 1JBCA 1VALA 3D4KA 4UW5A 5EYYA 4CDUA 1W0OA 3ZFEC 5C8CA 1UD1A 4ASLA 1DQ2A 2X5IA 1QOOA 4F83A 4Q4Y1 2YUEA 4JGYC 4AVBA 1ND2A 1SLTA 3NAPC 4ZU4A 1NCRB 1KJRA 1JYCA 4XF1A 1OQDA 3KGLA 1D0GA 1PK6C 3I8TA 1BK1A 1NA1C 1G7YA 1C4RA 1PVC3 1I3HA 1XQNA 3B69A 1X50A 4FPLA 4LBLA 3ZFFA 2Y38A 5AFBA 4CEWC 5FTTC 1V6IA 1COV2 2R49A 1MQTC 3VBHC 5DUVA 3ELNA 4L8QA 1RHI3 4IL7A 4LO8A 1ZNPA 2ZX2A 3RZZA 1NQDA 4CDXA 4YM3A 4ATEA 4U36A 1YHFA 3Q9OA 1WMEA 2JE7A 4IV1A 3NW4A 5GM0A 1QJZA 1AYN3 2XJPA 4RS5B 5CFDA 4LBKA 4XFBA 4LT5A 2QZ2A 4DFSA 1TME2 1WCKA 1WLCA 3AP7A 4Q4Y3 3L2HA 1DHKB 1LOGA 1ND3B 4EROA 1SLBA 3JCIA 1VRH3 1XYOA 2GMMA 2WINB 1MS8A 1QY4A 1SQ4A 3CF6E 1QH6A 3N7JA 3X29B 2ZX4A 2FZ1A 1VBB3 4G3YC 4YNIA 1KJLA 2SLIA 1UAIA 1G9BA 3B9IA 5A3LA 4Z2WA 4B4RA 2UWAA 2R6QA 2A6ZA 1COV3 3WP5A 3J8F1 1MEC2 3FLRA 2E7AA 4Q0SA 3AYCA 3LSEA 5JOZA 1VB4A 3FX3A 4R52A 3WG3A 1PGL2 1XNBA 2A6XA 1RUOA 2LUWA 2WS91 1DF0A 4QPIB 1PM7A 1JXNA 4HK9A 5JCTA 2IXCA 3B00A 3MW2A 5BNNC 1LR5A 2Q30A 2WNEA 4KL1A 2YPJA 1OLRA 3LKJA 4DRRA 4PF5A 3ZX7A 2XJSA 4MX3A 2VNGA 2GMPA 4COYA 2DCJA 4C91A 1W6PB 5BV6A 3BIWE 4JGZA 4NPRA 1H1IA 3WP6A 4K8FA 1WCSA 1AR91 5ACA3 3R4SA 4CDQB 3PVEA 2ZACA 5FLIA 5BNPB 5K0UA 4BYYA 3U4XA 3AP9A 4MUVA 2RS32 1FMD1 1FX5A 3IMNA 4QHBA 4LE3A 3TBDA 3FZ3A 1F9KA 4Q27A 3AZZA 1VBA1 2XWJB 1HRI3 1UPSA 3VBSB 3U07A 5DUUA 2OUHA 1CAUA 1CJDA 5FREA 5HXVA 4BM8A 3OD4A 2F4PA 5FBZA 2WA4A 5GLZA 1OOPB 4YW3A 5DZGA 3ZPYA 1RUC3 4NHKA 4Q0UA 2TEPA 1TEIA 1C8M1 3AMQA 2ZX1A 4WVWA 1LKNA 3TN91 4TWTA 1MZ6A 3GF6A 4PLNA 1SCSA 3PHMA 1F31A 1PIV3 1SFYA 5JI7A 3WHTA 4LE4A 4EWEA 4XIKA 5BNNB 3JBG2 5E16A 4AI3A 5JOWA 1LECA 2MEV3 3ZXEA 5KHIA 1MACA 2D3SA 1QNWA 1V00A 1BXHA 2CV6A 1OSGA 2QZ3A 4AGRA 1XU2A 2BTVC 2ZZQA 1GZ9A 1PO13 3TNPB 4ORFA 2ARXA 5AVAA 1R1A3 4OI1A 3MYXA 4GWNA 3NL1A 4L11A 3JZVA 4WZCA 1NE4A 4Q0PA 3B02A 4PJYA 5KXBA 2XVGA 1RUD3 3RNSA 2X5IC 1DBNA 4RS5A 3WR0A 3JBG1 4M3CF 2RJKA 1EPWA 2GZWA 2XHKA 4JTNA 2VW0A 4D7TA 1VBA2 5LK7B 4GULA 3VBHA 1HQWA 4PIZA 4AE2A 1D4VB 2KM2A 4CEYA 2CWMA 2R062 2PTMA 2TUNA 3ASIA 3LGRA 4OLLA 4JAAA 1ASJ2 3MIGA 1H8TB 1YYNA 2JE9A 1H1AA 3WW2A 2A6YA 1PNFA 2DUOA 3KM5A 1CGPA 1ONAA 2ZJCA 1ULCA 1VBD2 3I59B 1H4HA 4L92A 4H7MA 4YLZA 4YFZA 5DG1A 2EF6A 2Y0IA 5F1RA 2DUPA 5T5OA 2WSUA 1LHVA 4MXWA 5DDJ3 5EYXA 5KWRA 3R05A 3L9JT 5JDBA 2Z5WA 4A2UA 2QUOA 4IV1C 4LLOA 4PQ9A 3K48A 1YIFA 4LEJA 1FOD2 4HN0A 1VBB1 4YRDA 1DGLA 3V56A 3E6DA 1RINA 4SLIA 1V9U3 2UY9A 2A6WA 2RE9A 5J09A 2XPJA 1UL9A 4AGGA 3WDUA 1AYN2 3IWZA 3NKTA 3VZLA 1AXYA 5DUXA 4K7JA 4NWVA 2EXJA 5K0UB 1V70A 1VLNA 2HEYF 2NYYA 4NO4A 4Q4V1 2IZWA 4AWDA 3N7LA 4FBFA 1A78A 1Q5OA 2XL9A 3KT4A 1VBB2 2I74A 3R0RA 5BNNA 4RHV3 2RM23 2R0HA 4XBQA 4LBOA 1V9U2 4BCUA 2PHXA 1AYM2 1C28A 4N43A 2HKXA 4Q29A 4XJWA 1XNDA 1D0HA 2ZGOA 1OOPA 3WOGA 2HWB1 1TME3 5KC6A 2DVGA 2JEMA 3VBSC 4LO4B 1PVC2 2HWC1 1HXS1 4QMAA 1ZZ6A 4Q4X2 4TSVA 4XEZA 4YGCA 1QJU3 2E53A 3J8F3 1J59A 1Q8OA 4Q0QA 4OULA 1M4WA 2FZ2A 3THTA 4G9SB 3UJOA 1PGW2 1QF3A 2D6PA 1DQ5A 3E97A 1DG6A 3ATGA 1AYM1 2AH2A 3IDCB 3ETQA 1VR3A 1LODA 1ZYBA 3GBWA 3AKTA 3ZSLA 1ASJ3 1DIWA 3UL2A 2C5DA 2WLPA 1REFA 1EV12 4N7UA 3ZXGA 3FE5A 4ZU5A 4KWJA 1SBDA 2AZ5A 2ZGRA 4BHPA 1QOTA 1CAVA 1QJU1 1IKPA 3TAYA 1ZREA 3DN7A 5IK8A 2RS33 1H1MA 2EVXA 2D3PA 2R043 4N7IA 1WMFA 4XF9A 3SITA 1X36A 1ZZBA 1RUG2 2C1FA 4HVRA 3KMHA 4MGYE 3SCHA 3ZSKA 2ZPXA 2B46X 3CJXA 4EN6B 4I09A 4XBLA 1DQ0A 4XTPA 1S0IA 1XRUA 2P3IA 3URFA 2CAVA 2ZZJA 4OHYA 3MFCA 2NQYA 1AR92 3GNEA 5CFCA 4AHYA 4YYOA 2D3RA 2HWD2 4RR3C 1BBT1 3JD71 1QMJA 2W0XA 3AJZA 2BFUL 2JJ6A 5K7PA 4RR3A 4AI8A 2R061 3OPZA 3AMHA 1C8NA 2UU8A 1SLIA 1H8TC 2IXJA 1O4YA 5A32A 3EHKA 1Q8SA 1PO11 1UW8A 1AR81 1S0CA 1SDWA 4HSJA 3ZXAC 2HEWF 2WNVC 2B8MA 1C3HA 5JR7B 1ZZCA 3H1WA 2MEV1 3B7MA 3D82A 4KG0A 3J8F2 4MGIE 4YM0A 1MS4A 4QQOA 2BNMA 4ZU7A 5GLTA 3RS6A 1PIV2 1O4TA 4RQPC 3OBRA 2PAMA 4Y20B 5H9QA 3SMHA 1RUH2 5E1RA 3SLIA 4H3WA 4IEXA 4O9EA 3PJQA 4B8EA 3N36A 1EV13 1S0DA 1ZBE3 1GBGA 3BOPA 2CTVA 3ZN6B 5CG8A 1FNZA 3IT8A 4HKLA 5I0UA 5TSWA 4FPKA 4AXOA 5T5JA 2O8QA 3PNAA 3EJKA 4S2HA 3BOWA 1RUH1 2Q1MA 2RMU1 2RS52 2X5IB 4QQPA 2WT1A 4YVWB 3WX5A 5T52A 3WV6A 4FOVA 1ZRDA 2VG9A 4XYXA 1LESA 4META 3TYJA 2MPFA 1ZRCA 3VBUA 4WM8B 2YGMA 4MGKE 2WFF3 1PO22 4OUSA 2WT2A 4A7YA 1AX2A 4FPYA 2GNTA 1TQ5A 5L7OC 2KA3A 5T50A 2JG8C 2GDFA 3VBOA 1B35C 3APBA 3LA7A 1C8M2 2Q5TA 1I9RA 1V6JA 3ZYRA 3BALA 4XZPA 2FBEA 5J3UA 2ZAAA 2PA7A 1DFQA 2Z42A 4DMIA 5CFCC 1R092 2ZGPA 1G86A 2F6BA 2OIIA 2H0BA 3PVOA 4M00A 1UCXA 2VVEA 3NWKA 2P2KA 4FVVA 4YSFA 1A3KA 5J36A 5DDJ2 2JENA 3ZSEA 1T6GC 2ES3A 2JXAA 4FCAA 5KHHA 5L19A 3AXEA 4P9WA 4Y20A 3S30A 3J9SA 5KXCA 2Y26A 3OGGA 4M3CA 4BIFA 1KDKA 4GMP0 4EWDA 1C5HA 1FNYA 4OZXA 3AYAA 2D93A 3FHIB 4HFSA 4MGZE 4XHBA 2DFBA 3I4IA 3ZYPA 1O3TA 1GANA 4GB31 4Q4X1 2WS93 2RR13 4GH4C 3BTAA 4MZUA 3M3OA 2CL2A 4IEYA 1LOEA 3MEPA 2RM21 2OYZA 4RR3B 5H9SA 2DTYA 4LO7A 1XU1A 1WLTA 1QJY1 3D6EA 5C9AC 1JOJA 2E7TA 2ZGSA 5I0TA 1TME1 3H1YA 2GAUA 2GMEA 2QCSB 1RUC2 4H7LA 2YHJA 3A4UA 2R041 3ME2A 4XILA 2CYFA 4AVSA 5LEJA 1HIXA 2PHWA 2GC1A 5F5QA 4B7EA 2EIGA 1GQGA 1VBC1 4JDNA 1Q3EA 4PDWB 1W6MB 4YW5A 4AVTA 2C9AA 1I6XA 3O0XA 4IV3C 4Q4W1 1FAYA 2WZR2 1Q8PA 4HVOA 4QPIC 2CGPA 5DDJ1 1CESA 5JPNB 4RQPB 1IHMA 5GZFA 5H9RA 1A6CA 4I0WB 1LOFC 4IXLA 4ZXKA 1Q8VA 4N90A 5C4WB 2CY6A 1VB2A 3AMNA 2XBO1 1NXMA 1W6NA 1H2LA 3OY8A 4AI2A 4AQTA 2ATFA 2WWSA 4BA6A 2R0FA 2VMIA 5F6LB 2PHUA 1S0GA 1WW4A 1FV3A 3GALA 1RUF3 2GC0A 2WQZC 1G6NA 3RDIA 3VZOA 3DKWA 2B5HA 4R9DA 4YM1A 3FUQA 4XMIA 2G9GA 2OW4A 3NSTA 1R1ZA 4YW1A 1AR61 1BJQA 1LHNA 2DURA 3GZTB 2VQ0A 3R6SA 5ABJA 1HXS2 5KBFA 4K6BA 3QLQA 1W6OA 1UZYA 1V6KA 1G9AA 4AGVA 4N43B 2WQ4A 4XQ4A 1N1YA 5GZGA 2GALA 5GKAC 1IS4A 5I8YA 1GNHA 4LBMA 3KT7A 4EJRA 3H8UA 4BMBA 5EJ3A 1OI6A 3VBUC 2B45X 1NZCA 4JRLA 3ZXJA 3QOPA 1URXA 4HETA 2DVDA 3CLPA 2R16A 2BUKA 2ZHLA 1EV11 5IUQA 5F9TA 1NLRA 4P9LA 4OUMA 1POV0 3AKQA 2HWF1 5JZGA 2ZS6B 2HYKA 3SH4A 1PZ9A 2IXLA 4CEWB 1KD7A 2RS51 5GLWA 2O1QA 3H1MA 2A75A 4E4DX 4DZGA 1J3QA 3EQEA 3VBFA 3ZXDA 1FXZA 3FFQA 1RUI2 2JG8A 2UWCA 4AQSA 4ES8A 4XETA 3LAGA 2E63A 4XDQA 1W6MA 2A3WA 1LCLA 4E4SA 4K20A 4D69A 4WM7C 5CG9A 4QPIA 1Y43B 4DINB 1AJOA 2IWGB 3LOIA 4HPKA 2DCTA 5E89A 4RGAA 1UKGA 4Q1PA 2VU9A 1PGSA 3OYWB 4BH9A 3TB0A 2VW2A 1GKBA 4OHVA 1YFWA 3USUB 2RS53 1NQJA 1HRI1 1TMF2 1KDMA 2BW8A 4AEDC 4Y1UA 1GYKA 3VKLA 3ZFFB 1UIKA 4LNVA 4FPFA 4XBNA 1WA4A 5EWSA 3DUIA 4QQHA 4YGEA 2I07B 2EXIA 2R30A 2JD4A 2V73A 2OUJA 4LR4A 4FPGA 4QGNA 3FJSA 4P9XA 3VLBB 4CDXB 1H4GA 4CRQA 3K51A 5B2GB 4P14A 1CAWB 1DGRN 1VBE3 2A70A 2HWD1 1G9FA 5FRAA 2D5FA 5L36A 3ZYJB 4WM8A 4PIYA 2QJVA 1ZBA1 1WW7A 3IKWA 1O7FA 5D8AC 3NV3A 1RUC1 1LHUA 2BYVE 3NV2A 5D8AB 1R081 3VDDB 1RUI1 1MZ5A 3J26N 5T5LA 2V09A 3WZ1A 4FPCA 1VRH1 1RB8G 4FTSA 1BVP1 3PJYA 1R1A2 2VULA 1Z0HA 1LHWA 2JX9A 5C8CC 3AFKA 2D6KA 2R32A 2ZGQA 1KS4A 3WHUA 3D5OA 2EXHA 1J3PA 1S2KA 3TOJA 4HVQA 5JIUA 2XBO3 2BEOA 2WNVA 1LENA 3IBMA 5JI9A 4UBGA 4AEJA 1D4M2 3QBQA 2B9UA 1NA1A 2DF7A 3HT1A 4Y24A 4N53C 1H0BA 3RWNA 3WDXA 4RL7A 1RUF1 3WDWA 2RS31 2BNOA 4RHV1 1OLQA 1B35B 3ZFGB 1QJY3 3LB9A 3ZYGA 2NZ9A 1Y3TA 1UMZA 1ZM1A 4JGYA 1JUHA 5I91A 4JGZB 1TE1B 4Q4V3 4CDWC 4AW7A 5AC91 2PHTA 3UJQA 4YARA 2A3YA 1HW5A 1YFXA 4D7YA 1PK6A 1CX4A 4IV3B 2E6VA 2Z79A 4CDWA 2TNFA 3BU7A 1DLLA 1O4ZA 2K9ZA 1BZWA 1FOD3 1VP6A 1D2QA 3DPRA 4TYSA 4K40A 2VY0A 4M01A 3IPVB 3LWCA 1FPN3 4RGGA 3AYEA 3AP6A 4H14A 4WBBA 3QH6A 2WS92 4Q4V2 3W59A 3J4UH 4IEQA 1LGNA 1DQ4A 4MLOA 4YG6A 2V5YA 4BPZA 1RUE2 4CDQC 2OA2A 2ZGTA 1WCDJ 1F5JA 1H2KA 2HWB3 3L2YA 5JZGC 1HRI2 4COVA 4CDQA 3HD8B 4OVEA 2D40A 2A3XA 4DY5A 2I45A 3MLLA 1YO8A 4GALA 5I8SA 4PLMA 4WM8C 4K21A 5CB7A 2RS13 4XPVA 1LU1A 5FOBB 1AX0A 4F8AA 3D8CA 3WLUA 2CWSA 3MPPG 4N43C 1SLLA 4AVAA 3B94A 4U2AA 3E5UA 1OOPC 5AC92 3V0BB 4FAHA 1WLDA 3ROUA 2R1DA 4ONUA 1QU0A 2JG9C 2Q1ZB 1RTVA 2P17A 4M0HA 1GNZA 2OZJA 4XMAA 1PVXA 2B42B 3OJBA 1KFXL 1ZBA3 2DTWA 2OZ6A 3MDPA 1GQHA 3WUDA 1X33A 3AX4A 4XIOA 4YVSA 1R1A1 3AXDA 3KLSA 3WG2A 5DZFA 1S2BA 1LOAA 1MR5A 3V0AB 4FT8A 4W6WA 1QJX1 1QKQA 1W39A 1PNGA 2ARBA 2XH6A 5JWPA 2PQQA 5DXDA 4E27A 3ZN5A 1NCQC 2G4IA 2K2SA 3FLTA 1R083 4JV4A 4LHKA 3VDDC 4DQAA 2XKOA 1YLLA 4UBHA 4Q8KA 3POSA 3OF1A 1DZRA 2XJQA 1JN2P 2DFCA 2H6BA 2XJRA 2VVDA 3MF6A 5EZWA 1RUG3 2XLFA 1C8M3 2ZKLA 4L9BA 1TMF3 3RYPA 1VRH2 5T3NA 1OFNA 1XNKA 3GBFA 5C8CB 2XB6C 1W6NB 3OY8B 4HSLA 3JBG3 2XJTA 4Y22A 2BWCA 2AUYA 1JH5A 5HCBA 1SBEA 4IEPA 3SCGA 4AEKA 3N7MA 1HLCA 2LTNA 1OFSA 4HL0A 1GLHA 2Z69A 3ILNA 1EPZA 2ZHKA 4YFWA