4HXCA

Crystal structure of a putative glycosyl hydrolase (bacuni_00951) from bacteroides uniformis atcc 8492 at 2.15 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
255
structure length
255
Chain Sequence
TTTAVSYSKSLKAPETDSLNLPIDADGYITIFDGKSLDGWRGYGKDKVPSRWIIEDGCLKFCGTGTGEGQTGEGGDLIFAHKFKNFELELEWKISKGGNSGIFYLAQEVTSKDKDGNEVLEPIYISAPEFQVLDNANHPDAKLGKDNNRQAASLYDMIPAVPQNAKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWTEMLQASKFSEEKWPLAFELLNNCGGENHEGFIGVQDHGDDVWYRNIRVKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative glycosyl hydrolase
publication title Crystal structure of a putative glycosyl hydrolase (BACUNI_00951) from Bacteroides uniformis ATCC 8492 at 2.15 A resolution
rcsb
source organism Bacteroides uniformis
molecule tags Hydrolase
total genus 74
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06439 DUF1080 Domain of Unknown Function (DUF1080)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4hxcA00
1Y4WA 2XQRA 2OXBA 3U75A 4CCDA 5FK7A 3S5QA 4B1MA 4UFLA 3KF5A 5FIXA 2QQUA 3NMBA 3UGFA 4HXCA 3U14A 3OSDA 3LDKA 1UYPA 3PIJA 5FKBA 4QHZA 4CCCA 2ADDA 4JQTA 5FK8A 3ZR6A 3ZR5A 4AZZA 2ADEA 5FMCA 3LEMA 4FFFA 4FFIA 4EQVA 3LF7A 3H3LA 3LIGA 1Y9MA 3LFIA 2QQWA 4FFHA 3SC7X 5ANNA 3IMMA 3U1XA 3HBKA 1W2TA 3LDRA 4FFGA 3KF3A 4UFIA 1ST8A 3UGGA 2AC1A 3UGHA 4B1LA 3PIGA 4UFHA 2QQVA 4CCEA 5FKCA 2AEYA 4UFKA 4UFJA 5FMDA 3RWKX 1Y9GA 5FMBA 4UFMA 2AEZA 3LIHA
chains in the Genus database with same CATH superfamily
4OUMA 5GZGA 1BBT3 5D21A 1J84A 4GKYA 1CAUA 1XC6A 4CEYA 1QDCA 3M4FA 2DUQA 4A6SA 1GNYA 4CTEA 4BE3A 5C3PA 3HNYM 4QGMA 5FMCA 5HXMA 4YFZA 5ACA2 3F95A 5B4NA 4JDNA 4YVSA 3VD4A 5J37A 1RUF2 4QXHA 1JYXA 5CAZA 1H2MA 2J1AA 1W8WA 4CCNA 1ENRA 2ZX2A 4FO9A 5GKAC 4XQDA 2VG9A 5CZKA 1BQPA 2G4IA 3UGHA 4HVOA 5JOWA 2VZPA 1OUXA 1GLHA 4IL7A 5JMCA 2WFF1 5J09A 4I3GA 2X09A 2ZPXA 2JDAA 3POSA 4NRMA 4V2WA 1STMA 2Q1MA 2WWSA 5I93A 5IVJA 1K5MA 2RVAA 4DUXA 5LBCA 3MLJA 1AR61 1N3PA 1UIJA 3M8LA 4MXWA 4E9KA 5FO9B 2X29A 1ND3B 1MZFA 3M3OA 4XDPA 4AHYA 3IN9A 1ND2C 1ZRRA 1V6LA 2EXIA 4HETA 5BNNA 2PQQA 1QWRA 4LO8A 1P8JA 3WDWA 4WZCA 2R072 1WD3A 4Q0SA 5HCFA 4D0QA 1RUI1 1PMIA 1VB2A 5FXXA 5D8AB 3RQ0A 4IEUA 1RUJ2 5DG1A 2BGPA 1EV13 2D6NA 1UQXA 2JKXA 5BNQA 5LRSA 2Y6KA 5FZ8A 3JD73 1N1SA 2QQLA 4BXFA 5L7OB 5BV6A 2GAUA 2AZ5A 5FY7A 4YW7A 2WSVA 1I1EA 4JHZA 1LU2A 4LBMA 2A6XA 1N3QA 3GCXA 4QQHA 2V4AA 1CQ9A 1TQ5A 3LPFA 4K20A 4M3CB 4XMAA 4DB5A 1PK6B 1XE8A 4OLLA 4L99A 3USUB 5JAXA 3CLPA 2B46X 3MIFA 1YEWA 4GA9A 3VZMA 4AI9A 3VD7A 1YLLA 5FY0A 1GNZA 3HNMA 5C33A 1O5LA 4Y1VA 4YM1A 3GBWA 1FMD2 4BQWA 3PUQA 3WG3A 5AC93 4P9GA 1ASJ3 4RL7A 3K4ZA 3NAPC 3ABZA 2A1XA 5F3IA 4RSUA 1AYN2 4K8RB 5FP3A 1A78A 4IQPA 4B1MA 3IT8A 3UNPA 4CP1A 2WT2A 3I2OA 5APAA 1IG0A 3RFRA 1EP0A 3KLSA 5C5UA 1ND2A 1ODNA 4L11A 2ZZJA 3P5BA 2PAMA 4I01A 5FZGA 5HI0A 3P3NA 4RR3C 5I0SA 2PHUA 4S2HA 3OUJA 5C9AB 3I2JA 3ASIA 3NKGA 3LDRA 4FFGA 4YG3A 3A22A 1OPOA 3UESA 4A45A 2JD9A 3DEMA 3GGLA 3MBWA 1V70A 4JGYC 4NPLA 3RWNA 2ZAHA 4JRLA 3WP6A 2IFRA 3FFQA 4O9EA 3ZXJA 4AI0A 2YBPA 5FJHA 1CVNA 1KD7A 1KQRA 2HYXA 1X50A 1REFA 1UX7A 2KM2A 2NMNA 4OULA 2IXCA 5IAXA 2QQOA 3OPWA 1IOAA 1E5IA 1FX5A 2NN8A 4NJ4A 2UWBA 2PYTA 4C90A 3LDKA 4NHKA 4FTSA 2XBO1 4ONUA 4Q8KA 1H30A 1OFNA 2AGSA 5CVRA 5FLIA 4MGIE 4C91A 1RUI2 2WZEA 1YQ6A 2DYCA 2E63A 3FLRA 1ZZ6A 3H3LA 3GZUC 3OPTA 4XJZA 5T50A 1D2QA 3RJ2X 1I9RA 1V9U2 4RS5B 4JVAA 3ACHA 1OUSA 1GZWB 3H50A 1LJ7A 4GB31 4E2QA 3B02A 1HRV2 2QFEA 4Y26A 2NZ9A 2PA7A 1WW4A 1UZVA 4LO4B 3V0AA 5KC6A 2YBSA 2VUJA 1U5ZA 4IV1B 2PLV3 1IS3A 4LITA 3GJBA 3N9LA 3NAPA 4M3CE 3CHXA 2OXBA 2ZAAA 3LSEA 3C7OA 3VBOC 3BALA 1HXS1 3SKJE 3B5LB 3LSDA 2GH8A 3WNXA 4IEQA 4E2GA 1DQ2A 1OD3A 2RE9A 2A6ZA 4YZ4A 1FOD3 3HT1A 3IPVB 2P4EA 5EFUA 2IVIB 3PHMA 5BNOA 5FWJA 3WHTA 3ZPOA 1W6QA 1OA4A 1ENXA 3MLKA 2WNUB 2VCBA 4N8MA 3WQBA 3MZHA 1RC6A 5E1RA 4AVBA 2A3XA 2A7AA 4Q2FA 1R1A2 5H9QA 4QQ2A 2ZMKA 4JGYA 5CFCB 1LGNA 2RS53 4CEYB 5J1XA 2XONA 3N7KA 3PUSA 5IVBA 1VRH1 4EWAA 5FZ9A 4HN0A 5JOXA 4FAHA 3ORJA 4U2AA 1O3RA 2VQAA 4L2NA 3DGTA 3ZFGC 4Z2WA 1POV0 1NCQC 3BI3A 2WDBA 4H2AA 3DN7A 4UW6A 1AL21 5A7WA 3WNPA 5ACA3 4JQRA 1QJU1 5LA2A 4UBGA 4MGYE 5FXZA 4PIYA 2OZ6A 1YFWA 5T5JA 4GH4C 4TTGA 3L2YA 1RUF3 3JQXA 1ULFA 3NJVA 1OT5A 4AG4A 4F3JA 4LBOA 1GP6A 2BFUL 2O0OA 4NWVA 4DS0A 3K75B 4ORFA 4OI0A 2CV6A 3TN91 3AP6A 1K5MB 1H4GA 5LEKA 1OHFA 2HLEA 4LHSA 1W0NA 3DYPA 3AKRA 5BNPC 3RPQA 2W46A 4MXWB 2ZGOA 1UMHA 3VBOA 2W52A 3U4XA 2HWC1 4FVVA 1FI2A 4P5HA 4A3ZA 3B3QE 1Y43B 4XYXA 3ACFA 1WLDA 3BPSA 5BNNB 4LIUA 3LZZA 4RFRB 1RUD1 3HEIA 3I59A 1Z0HA 5FZFA 5HV0A 4FP3A 4OHYA 3WV6A 4HMZA 4FXGB 3FX3A 1GQHA 1ZBA1 2JDNA 5F7UA 5J36A 1GSLA 2R073 3N35A 4NOTA 2YB7A 4XF0A 3A7QA 1V00A 4NHYA 2EIBA 1AR93 1NQJA 5LCWL 5IK7A 1XNAA 4OHWA 5FMOL 1HXS2 1CAWA 1SFNA 3BU7A 3AYEA 3K48A 1YFUA 4XTPA 1OSGA 4S2DA 4YRDA 5BPXA 1ZBE1 2Y6LA 4N53A 3SCHA 2HWD2 4LMFA 3NQHA 4JKKA 3IZOA 2JX9A 3B9CA 3ZXKA 3THPA 1S2KA 1V6OA 1W2AX 4D3WA 4CCKA 5JOZA 5F37A 4CDUC 4FPYA 2B39A 3C3VA 2O8QA 3T0DA 4QKDA 4QD2A 2EVXA 1HRI3 4GH4A 4ITCA 5FZOA 2Q8CA 4Z1VA 4PLOA 1QXPA 2NQYA 1XYNA 4DEVA 5JXGA 5HBAA 1X8MA 2LW8A 3ZSEA 3KWVA 4QM9A 3PUAA 4IEPA 3B69A 4CCLA 3NWKA 2XLGA 1URXA 3QCWA 1FMD3 4EN9B 1A34A 1ZRIA 2R062 2VR4A 2G9ZA 4COYA 3BOWA 5JMOA 1NCRA 2VCMA 1G9AA 3O1UA 5A3WA 2R0HA 4E8CA 1XE7A 4OI4A 4CU6A 2YC0A 1C8M3 1HW5A 1SBEA 2YGLA 3CEWA 1KXGA 1Q43A 2D3RA 3LWCA 3RG0A 4BISA 2WR9A 3ZYIB 3ZR6A 1UOGA 5D2AA 5LA9A 3EBRA 3I7DA 4MGTA 4GMP3 3D3AA 5A3OA 1Q8VA 1VMFA 3AKSA 4XEZA 2Q8EA 3S7EA 5DDJ3 3VUOA 1VP6A 4JHTA 2VGDA 2FDJA 4HSLA 2XXZA 3POFA 1D4M2 3O1VA 4Y4YA 5H9RA 1H9PA 1MR5A 1XJAA 1GWMA 5IVCA 3BYWA 1F8VA 1IKPA 2D40A 3B94A 2ZKLA 4GXLA 4WM8C 1W28A 2BTVC 4K21A 3AM2A 4ATFA 3MUZ1 4MGQA 4QU1A 4CCOA 1OKOA 1XBFA 3MI8A 1TMF1 1JHJA 4XXPA 4DQAA 2FDIA 2CDOA 2PAEA 1G9BA 2W92A 2D6MA 3ZN4A 3E5QA 4BA6A 2WQZC 2XJTA 5A3LA 5I0TA 3CZJA 3EYPA 1D0GA 4OMCA 2WYFA 5FYHA 2IXJA 2JB8A 3NV3A 3PJQA 4U36A 1VBA1 2VZQA 5F6LB 2CWMA 5A1AA 5JIAA 3ZYFA 3NAPB 2VVDA 1HRV3 5FXWA 1IQAA 1NKGA 1XSQA 1SMVA 1O3QA 4CCEA 2WO2A 4YM0A 1W05A 2JDHA 1WCUA 1WMEA 2XVGA 5FPAA 1A8MA 4L92A 1LOCA 1CJPA 4XJWA 5FY5A 1Z78A 4AVVA 3RZMA 4A44A 1WA4A 4PI0A 3ZOIA 5BNOB 2J42A 3R6SA 1W6QB 2R043 4YW2A 4CE8A 4IW3A 4AI3A 2GZWA 2D6OX 4TZDA 3I3EA 4AQ6A 3VHPA 4FFIA 5IK5A 1AF9A 4MGKE 1NY71 4NVPA 5A6XA 4JGYB 2WNVC 2C4XA 1SDDB 1YQ5A 2RDNA 3RZZA 1HQWA 4EZHA 2ATFA 1HIXA 3OF1A 2WZR2 4NUBA 4PBOA 3DXUA 2BZDA 1R1A3 4Y4RA 2WUHA 5D1IA 4D6QA 4EWDA 5BUVA 3W9AA 3DV8A 4WM8A 3NNLA 1DQ6A 1JS9A 3VB9A 1J1LA 1L7QA 2MHFA 1QXJA 1LECA 2IUWA 3AYDA 1VBC1 4FPCA 2HWB1 3FBMA 3THCA 1N47A 4B8EA 2RS12 1CONA 4QHZA 1GWLA 1WLCA 3C7FA 3DKQA 3IAQA 2R16A 2ZGQA 3ZFEC 1LOFC 2DV9A 4I0BA 1VMJA 3WP4A 1QJX1 4V1PA 4CEWA 4DY3A 1UKRA 3DYMA 3A0NA 4A7KA 1OPMA 1BBT1 2W08A 2H0BA 4QAWA 4BB3A 4Q4V2 5F5CA 1PGSA 2W3JA 3J7MA 3BIEA 4W6XA 4IE0A 4A3XA 1UZYA 4XCAA 4AXOA 5A7QA 3ZN5A 2ZEWA 4CRQA 2ZX1A 2ZACA 1TME3 3KHBA 2BUKA 2VZSA 2Y26A 1IPSA 2DCTA 3FC0A 2OYZA 3VBOB 1SLBA 3IDEA 4UFHA 5FZ4A 3BTZA 1SBDA 5F3CA 5FPXA 4GJZA 2RR11 2PTMA 4XUPA 2WN2A 4N7IA 1RVF3 4HKOA 3I59B 3GHNA 4EN7B 4EV0A 1WMDA 5FY9A 1GANA 1VBD1 1ZA7A 3KF5A 2QQUA 3SMHA 5GZEA 5A3NA 1VB4A 4UBHA 1JI6A 2RMU2 1RHI3 4XFIA 4OQ9A 5FLHA 4P5YA 4ET7A 1VMHA 3KMHA 3VN4A 2Y8KA 3MV11 2ARBA 2WNVA 1CD3G 1YIFA 3WCSA 4AE2A 4W4ZA 5JIUA 1BMV1 1BEV2 1CAWB 2OPKA 3D5OA 5FYMA 2VNVA 2UY8A 5IT6A 2I74A 4N53B 1EAH1 3OBRA 3ZYGA 1KS4A 3WXPA 4BLJA 5FZLA 3AP9A 2EA7A 4JTNA 2E6VA 3KVAA 2C6SA 3ZFEA 5FZAA 4AF9A 2WSUA 2CSGA 2YG0A 4WZFA 1PM7A 1EV11 2VVEA 1SFYA 2RJLA 3OSDA 4GH4B 4GMP0 4PLMA 4OHZA 5CEHA 5K8SA 3JD71 2GN7A 2ADEA 4META 3SCGA 2JDZA 4HPKA 4M4PA 3JBG2 4H7LA 5JXHA 4Q27A 5KHJA 5I8YA 4XFHA 4GIQA 2ZGMA 4GQ7A 1NE6A 2CAVA 4CUGA 3PDQA 2P17A 1NCRB 2D44A 5EQUA 1H8TC 1V6JA 1ND3C 4AFCA 4FCAA 3CKHA 3FLTA 2NLRA 3QH6A 1QGLA 3CMGA 4UFJA 2BU9A 2ZGSA 3OTFA 3VBRA 1PGW1 1US2A 4Q5OA 5FZEA 4ZY9A 3VBHB 2E9QA 3H7YA 4N90A 3KM5A 4PDWB 1DZQA 2DFBA 1H4HA 2BGOA 1J59A 2QNKA 1SCRA 2CDPA 3NO8A 3LQCA 4QX0A 5D8AC 4IERA 3GALA 2PFWA 3PIJA 4MGZE 1LB2A 1LRHA 3LEMA 3VBFA 2D98A 1PNGA 2BJSA 3O1MA 4YG0A 2RV9A 3D82A 5GM0A 3OGRA 2QQKA 4YGCA 2WQ8A 4Q26A 1ZVFA 2QQJA 4NRQA 5FP9A 2K9ZA 4NR1A 4QX1A 2F6BA 1PK6C 3N3HA 3WCRA 3ON7A 3M3CA 3DPRB 4FPJA 4DMIA 1JZ7A 4AK3A 4HANA 3WF4A 4AVAA 1AX2A 4XURA 2HWE1 1M06G 5DUXA 2GP5A 2VL4A 5F6KA 4H55A 3NMBA 2Q30A 2C0ZA 2YXSA 4AFMA 1SDWA 4KGQA 3GYDA 1EUTA 1ZRFA 1HLCA 1LTEA 5IHRA 4MGSA 2P37A 2DVGA 2QQMA 4BQ2A 2H6CA 4GZ9A 1QQP3 3TRSB 5IW0A 1RUOA 4I0WB 4QQOA 4WVMA 3VZKA 2Y38A 3OEBA 2DCYA 1H8TA 1BJQA 1QJY3 1UU4A 2ZJCA 5G04L 3KGLA 4LORA 2K2SA 2VC9A 4CUAA 2C5DA 2RG4A 1DDLA 1EV12 3FBYA 2XMLA 4BK4A 4E4HA 1REDA 2BVVA 3JQWA 1XNKA 1OVSA 5D8AA 1NQDA 4B4PA 4R52A 1NAEA 2VZTA 4HL0A 3H7JA 4SLIA 3KV5A 4LEJA 2VY0A 2Y6HA 5FO7B 4GAZA 1OBNA 1LEMA 3LA7A 3ZXEA 1VJ2A 3O1RA 2NPIA 3ZO0B 2XJUA 3SHRA 3SXWA 5HCBA 5F5AA 3AJZA 1ZM1A 5CG8A 3WP3A 3HN1A 2XH6A 2WZR3 2JDYA 3AP7A 4O7XA 3TNQA 3HBKA 2VW1A 1VAVA 4M3CA 2D3SA 4ASKA 1R082 4HT1T 4K7JA 1A8DA 4KBBA 2BBVA 3E6BA 5AC92 4RS5C 1PZ9A 4CEWB 1ASJ2 5IK8A 3PVNA 1GBGA 3N9PA 2B45X 2RS51 4KI5M 1HV1A 1MS4A 2ZMNA 1W0PA 1DF0A 2F4PA 3DXTA 4IV1C 5KBFA 4OQ8A 1F5JA 2VBPA 1W6PB 4CU9A 4D8MA 5J3UA 3AKQA 1VBE3 4JX0A 1WCKA 2PELA 3FE5A 5FP7A 1PZ8A 2QTWB 2WWUA 3RZGA 3L9JT 4CPBA 4QXCA 1PO23 5ACA1 5A80A 5GZCA 3PJYA 4LHLA 1XNBA 3I2FA 3UJQA 2OW4A 3H8XA 3NSTA 2YHJA 4TWTA 1RUF1 5I0DA 1ZREA 2QVSB 4AHXA 2WNUC 5C5TA 1ZRDA 1MVEA 4FP2A 4P14A 1QU0A 5CFCC 4FTEA 1ULGA 4P02B 5LY2A 2BGCA 1UN1A 2V5YA 1KFUL 2VQ0A 2R0FA 3BCWA 2JG9C 5FKBA 3NV2A 3VDAA 3S0MA 2GMMA 3WW1A 3OGSA 2ZEXA 1QOSA 2WFPA 2DBIA 4LO6B 5LWBA 2FD8A 3OEAA 1J3PA 1BEV3 1OI6A 4XIOA 5B4XA 1JZ8A 2DUPA 2MPFA 4L8QA 4D6RA 1EY2A 5EV7A 1JW6A 5GALA 4V2VA 3VDCA 3URFA 1UY2A 3ZFEB 1G7YA 2R071 5JPMB 3C7HA 1YI7A 2PLV2 3WG1A 3T3YA 2AACA 1PHMA 2R32A 4Q4Y3 1AR91 1RUJ1 3DCQA 4QKBA 2FDKA 2ZX3A 5FPVA 1W9SA 2FDHA 2LM3A 1YQ2A 3KSCA 1DYOA 1YXWA 4BM8A 5A32A 1FOD2 2VPVA 1IGOA 3AZZA 3GDBA 4JZRA 4DNYA 1JZ4A 4RFT0 1CWPA 1CAXA 3AZYA 3THTA 4CUCA 2BV4A 5E16A 5FBZA 1UY3A 1F4HA 2GC0A 3IKWA 3VBRB 2BERA 3VKLA 1GWKA 3OBAA 4ATEA 4QHOA 4NO4A 1HV0A 1H0BA 3MW3A 4XFCA 4INDA 1U5IA 5KWRA 5FPZA 2WAOA 2RS52 2XLAA 2GP3A 2Q1ZB 4L9BA 1ULEA 4RGAA 2EF6A 1YUDA 4BQXA 4C1WA 3JB4C 1SPPA 2WAAA 1S0JA 2E26A 2UYAA 1FMD1 3GBGA 3VBFB 4LBQD 5CFCA 1IKQA 5A33B 3BTXA 5I91A 1QOOA 1GMMA 1S55A 2LS6A 4PBPA 2JG9A 3TEYA 3S7IA 4K8FA 4Z92B 1AYN1 4J6GA 3AP4A 3WDXA 4ISRA 3VBSA 1PIV3 2WZPP 5ISLA 3CJIC 2E51A 3N7MA 4OHVA 4GULA 4DO0A 4COWA 2WS93 2D5HA 1Q8SA 2GC2A 2P3IA 3FJSA 3T2OA 4IE7A 2PXJA 3ZSJA 2XJSA 4Y1ZA 3ITQA 5DDJ1 1GP4A 1D2SA 1OQEA 3J7HA 3NL1A 4BPZA 5JOYA 5HCHA 3T0BA 5FYTA 1RUH2 1BCXA 2GC3A 3BU0A 5C8CC 4HZFA 1DU3D 5J96B 4CSWA 3HQRA 3VKOA 2HYKA 1X82A 4NHMA 1CZTA 5GZFA 3X29B 4YZ2A 2YU2A 1ZZ7A 1ODMA 3TBDA 2Q0AA 2JE8A 3PURA 1PO12 2TUNA 4WVMB 1NOVA 1QNYA 4PI2A 4J25A 5BY5A 3K77A 1H8TB 3AZVA 1POV3 1K45A 5CU1A 4D94A 5JXJA 4Q4X2 3R05A 4QDSA 4XZUG 2QQNA 2EIGA 4KU8A 5KXBA 3QACA 3T0AA 4DXZA 1NG0A 1O3SA 1W39A 1GOHA 1NLRA 5FUNA 4Z82A 3VZLA 4QWNA 2QQPA 2Q8DA 1U0AA 4ZXEA 1AR92 1V9U1 4F83A 1SZBA 1GQPA 2HEWF 3TEXA 3WW3A 1XOYA 1XRUA 3JZVA 1HRV1 3NNJA 4LXLA 2DFCA 5FMOS 1SG3A 1VLNA 2LROA 4GALA 5GLWA 4DOUA 3O14A 4JV4A 4MLOA 2YZ4A 2W1QA 3ECQA 2W2IA 2FZ1A 1YFYA 4X8PA 5EYYA 3I3BA 4JDMA 4HKWA 4AQTA 2XKOA 1BVVA 3T09A 2VOKA 5T5PA 1F35A 1MS8A 1UMIA 4IEXA 4YW4A 2VZRA 4N9IA 3CJIA 1M4WA 3T30A 1AJOA 1HRI2 2RM23 4QDQA 2VZVA 2Z69A 2C9AA 2K0GA 5I0UA 1AXZA 3NW4A 2CGNA 1ENSA 1R083 1FNYA 1FXZA 4MZUA 4Q29A 1UY0A 1Z7S3 3AFKA 1R1A1 4BIFA 5C8CA 5IVVA 1NUKA 2E32A 1AR82 5CBLA 2ZABA 4FXKB 1O6UA 4XE9A 4QKNA 5DG2A 4AEMA 5FUPA 5J48A 1C8M2 4G9SB 1EYBA 1LEDA 2YFUA 2DVDA 1CJDA 4Q0UA 4TLGA 4IDZA 2VTFA 1CESA 3E5XA 4KGGA 4LBJA 5BNOC 4K6BA 1X8EA 1XXNA 5DDJ2 1WBLA 3BIWE 1WCSA 2GALA 2EIEA 3ENRA 4YZ5A 1N1TA 5JCTA 4W8JA 1W8UA 3KS7A 2HEYF 3FLPA 4DFSA 3RS6A 5J7MA 2FDGA 5EP9A 3QD6A 4IE4A 4J1XA 1LODA 2ZHNA 3WNNA 2GH2A 2J1UA 2E7QA 1DYPA 2KD7A 4I09A 4I2OA 2WRAA 4O65A 1DQ0A 2R1BA 4R4ZA 5L73A 2UURA 2XHKA 3B7MA 4A41A 1DQ5A 2G9FA 1NZIA 4YGDA 2YYOA 4LA3A 1B09A 1W9YA 1C1LA 3BOPA 4YZ3A 2DCKA 4AVSA 2P6HA 2ZX4A 4I0AA 4LULA 4XFFA 5T55A 1OMIA 3VKFC 1FYUA 4UI9L 2G9GA 3OB8A 2NMOA 2XHNA 3SNMA 3VDBA 2XOMA 3WF1A 2W47A 3FN9A 3VGIA 3PU8A 1OF3A 3NV4A 1MS3A 1R093 5KHGA 1EPZA 1UOFA 1LNSA 1HDKA 2Q1FA 1SLCA 1Y3TA 1E5RA 5F3EA 5CYYA 4ZS3A 5A32B 2F17A 5JDBA 3T1MA 1O8PA 4FPGA 1CAXB 1NT0A 4WVZA 2W1SA 4E4SA 1JYIA 1UYPA 3M70A 1R1ZA 2CTVA 3LFMA 2R042 1ULPA 2EALA 5A3TA 5CKMA 1TNFA 5IVEA 2HWD1 2WKKA 4FFFA 4QGLA 2W5FA 3ZX7A 2Y34A 4XFGA 1LAJA 3N36A 3N9QA 1DLLA 5FZ7A 1X9PA 2DU1A 5FOJB 1GNHA 1JYNA 1FPN2 2D3PA 4HOOA 1E57A 4Q0PA 3U10A 2E53A 1SPPB 1A3KA 2YBKA 4XFAA 5ABJB 4MV2A 3MHZA 2JG9B 2ZGLA 1CR7A 3LDBA 3OD4A 2YUEA 4CCDA 3NNGA 1QH7A 2BP6A 4N53C 2VXJA 4BXSV 2VMFA 2R061 3VBSB 3GZTB 2WBKA 4PHZA 3OG2A 5CG9A 3ZPYA 1YCIA 5KC5A 4OUSA 1NE4A 5TSWA 2JIGA 4XDQA 4F7ZA 2WNOA 4IV3A 2ZBJA 3BKZA 1PX4A 3PMEA 5FOBB 5CFDB 4BHPA 4XHBA 1RMU2 3WR0A 4UFIA 1TME2 3AZXA 1U5XA 2A70A 1XPWA 4RHV3 2CNAA 4LR4A 5EJ1B 5I8SA 1D4M1 2W87A 4TN7A 4UW4A 1RUH3 2HJIA 1NCRC 1RVF2 2ZZQA 2CYFA 1ALYA 1XQNA 4Y33A 4DEQA 4TXWA 2KR2A 3WF2A 1AYM3 4E8DA 1RUC3 1X33A 2X8KA 1PO13 3ETPA 2HWF3 5JLVA 2JWPA 4YM3A 1RHI2 2NYYA 3VBHC 3ES4A 4PDWC 3FUQA 3WINE 2FBEA 5F5IA 3PUHA 4Q4X3 3DL3A 3AYCA 1QF3A 3AFGA 4XF3A 5FZDA 5HPOA 3D0SA 3TNPB 2JD4A 2WA4A 3LEIA 5CIRA 1SLTA 3H8RA 5DQ0A 1K3IA 1L7RA 4CCJA 4LE4A 4FAGA 1JYVA 2VOXA 4COZA 3J7NA 4MSVA 2PN5A 1JOPA 2DVAA 3GZEA 5JSOA 4JTOA 3MEPA 3HVDA 5LRRA 1RITA 1C57A 4AYUA 4QDRA 4MX3A 3DPRC 3CJIB 2P5BA 1AXYA 2ADDA 4FPLA 4SBVA 2A3WA 4KH9A 3AVSA 4YLZA 1ULOA 2D43A 1ZNPA 4QKFA 1KJLA 1RJ7A 2P2KA 3Q8FA 4MADA 4HONA 5FPLA 1VBB2 4M01A 2FZ2A 1N1YA 4XJAA 5C8CB 1FV2A 2KA3A 3W20A 4JAAA 4CPBD 1GYKA 2VQUA 2X05A 4XACA 2IXLA 5FY8A 2WZR1 1MEC2 5GZDA 3U07A 3I4IA 1JOBA 4TSVA 5A7NA 2FCUA 1C8NA 4NHLA 5FP4A 5L9RA 1AR83 3ROUA 4AAPA 2YDEA 3VBUB 4P9LA 1W9TA 4QB6A 1DGWX 4PIXA 3ACLA 4QPIA 1UF2C 2OQ6A 4Q0VA 1AR73 2JEMA 2RS11 4XBNA 5DABA 4URAA 5EJZB 1W8ZA 2GDFA 5F2SA 1JMUB 2JDKA 3VBHA 3MIHA 3ZYBA 4PDWA 3ALQA 3SQOA 2P3YA 4DXSA 1PMJX 1DQ4A 1W06A 4K1ZA 2BBAA 3LA3A 1JZ5A 4QQPA 1H2LA 1KGYA 3CQOA 4Q4V1 3JXSA 4P9WA 3S30A 1S0DA 4M4RA 2ZTNA 1IPKA 3TYJA 4UWDA 3WW4A 3UKVA 3VDDB 4N9HA 4LO7A 5DAWA 2QDNA 2GMPA 3MF9A 5FMDA 4KWKA 3MYXA 3WSOA 2Y6FA 5FQ0A 2VW0A 2ENRA 2FHRA 4RD7A 1NYWA 4YVWA 3ZXFA 3EMRA 2HH9A 3CBNA 1Q8OA 4KL1A 3DPRA 4XOGA 2ARCA 4NPRA 2ZGTA 3WX5A 3MLLA 5GLTA 4AZZA 4CEWC 3R4DB 3HAGA 4FOVA 2E31A 2VH9A 2CY6A 1UXXX 3E1F1 1LCLA 5CA6A 5M0TA 1RJ8A 1QQP2 2RMU1 3MW2A 1JYWA 1GOFA 3KF3A 1QKQA 2Y60A 3I97A 3ZMOA 3ZSLA 1QJY2 2XR4A 4LOSA 5FWEA 1HB4A 1BEV1 3NVCA 4PLNA 2P1BA 1AR63 2IZWA 1IZ3A 3APBA 4G3YC 5CKQA 2V4VA 2D7FA 5J98B 2UU8A 4IEOA 3VZJA 2QQIA 4NN0A 3RZLA 3LA2A 2AREA 2ET7A 1JN2P 1KRIA 3JB8A 4YWAA 2VU9A 4ES8A 5FYBA 4W6WA 1RUE2 4E4DX 3CDZB 4BCUA 2WZ8A 1GICA 2EXHA 2FCVA 5I0RA 5GJ6A 2VECA 2ET1A 1JUIA 4HLTA 2ZHLA 4LLOA 4ASLA 3LE0A 5LBBA 3RRDA 1HJFA 2OPWA 1FPN3 1RUG2 1W6OA 3JBG1 3UGGA 4NAMA 1CIWA 4YW1A 4K40A 3RVHA 5C3OA 2OIIA 2QQVA 4NPMA 1OFSA 4AFAA 2VNGA 3WVJA 2VJXA 5KHIA 1JHNA 3J8F2 4BQ3A 4BMEA 3RNSA 1K12A 2UY9A 3LAGA 2QJVA 2RHPA 4IV3B 3SEPA 3I2HA 3OOXA 4JCKA 2Y0OA 5IATA 1UKGA 3MICA 1V6NA 4BH9A 1HQLA 3QLQA 1YJKA 4A7ZA 3PUIA 4DINB 1W0OA 1VBE2 4BLIA 5FUIA 4C0BA 3O1TA 1Q5OA 3HD8B 3OBZA 5K0UA 3BTYA 1CAVA 1YIPA 4ASMB 4Q4W2 5A6YA 1ZYBA 5FZ1A 1W6PA 2FCTA 2OKXA 3IMNA 1NA1A 1PO22 1JODA 1RMU3 4FI9A 1JTZX 3RDIA 2UWCA 3MIEA 3K51A 3OY8A 5FFOC 3HNBM 3VBRC 2A6YA 5C4WC 2RS32 2A5ZA 4EROA 1TG7A 1ZZBA 2O1QA 2VAUA 4JDOA 2VMIA 1W9WA 4XXAA 1YYNA 3VL8A 5LA0A 1MQTC 2XKPA 4CUBA 2B7YA 2PAKA 3HMYA 4QGNA 4XJUA 1F2NA 5EWSA 3ZXDA 1CX1A 1BYHA 4K9SA 1Q56A 3A4UA 3H1WA 1ULCA 4ARYA 5C6CA 3KD4A 3VBFC 2MEV2 3KGZA 4XW3A 2A73B 3HQXA 3HT2A 5FY4A 4I3PA 1WGPA 2ZEYA 3LB9A 3OGJA 1JBCA 1W2TA 5FREA 1POV1 4A42A 3D0JA 4M00A 3HIFA 2WLQA 2XJQA 4XABA 2XBO3 4IESA 4CA9A 1QXRA 1ZZ9A 4CDQB 1LR5A 4YW5A 3KQ4B 1U5YA 4Q4Y2 5EJ3A 4QX5A 5JZGB 3M3QA 1MS1A 3V0BA 1OURA 4GB33 4LHKA 3THDA 1YNAA 3VKNA 4LKEA 1RTVA 4OVEA 1UW8A 5FDBA 5A7OA 1MPXA 2OVUA 4W6YA 3RYPA 4P9YA 2VNOA 4AVTA 1WKYA 5C3SA 1UPIA 1V6MA 3N7LA 4EE2A 1VBB3 2WWJA 3FL7A 3E5UA 3LOIA 1ST8A 4BU2A 3W21A 4E2SA 5JXIA 1QDOA 1TVGA 4GWIA 1S4CA 2WT1A 4RA0A 1HX6A 4QPIB 1MEC3 3VD9A 5C4WA 1AL0G 1TEIA 3C7EA 1H6XA 4NRPA 2YPDA 3WOGA 2R7EB 3MUY1 1R081 3KV4A 2P3JA 1JXNA 1O7FA 2OS2A 3ZYJB 1F5FA 4A7YA 1MQTA 3O1PA 5AC91 4IGOA 3ST7A 4XETA 4AEKA 1W03A 2FMDA 1ASJ1 3AVRA 3POBA 1UZ0A 2JXAA 5LBEA 4KWLA 3P1IA 3PTYA 3WHUA 2N7GA 5IFPA 3PVOA 3TEWA 1KDMA 4XMIA 5A33A 1PIV2 1HB1A 3N9NA 3TWIA 1PGL2 3WF3A 5T5OA 4ARXA 4UW5A 1JU3A 2A3YA 2DURA 5FQ0B 3I3MA 2WS92 4XPVA 4YVWB 2E33A 4M3CF 4UAPA 2MNGA 2JJ6A 4OYUA 4B4RA 4FQZA 4BMBA 1Q8PA 1S2EA 1AL23 4ZU4A 1V6IA 3U11A 1YQCA 1Y4WA 2XQRA 3IIIA 4CP0A 1QJU3 1XSRA 2PMWB 2ES3A 1E5HA 4NIGA 2GNTA 4OHXA 4AI2A 4D7YA 1J3RA 1O4YA 1HB2A 1OVPA 4MYEA 4PQQA 5FAXA 4NMIA 4MUVA 5L9BA 4ZU7A 2B8MA 4HVQA 2ZGRA 3RZKA 1PVC2 1SCSA 1T6GC 1DZRA 4AHZA 4XZPA 2VMDA 4MHRA 3JUUA 1W9FA 3NV1A 3WDUA 1AX0A 2DVBA 2ZGKA 4FPEA 1DFQA 1YC61 4LKSA 2HWC3 3T1LA 2IXHA 4FBFA 2ZKNA 3J4UH 5DAXA 1XYPA 1R64A 2VUDA 1RUD3 3LGRA 4XILA 4C8DA 4LPLA 4FSJA 3LIHA 2HKXA 3V56A 2BOIA 4Y5TA 5EIYB 4HVRA 4WBBA 3S5QA 2VTXA 4C1XA 3OUHA 2PLV1 1RUE3 5H9SA 3DECA 1AHSA 3IAPA 1FV3A 2JDUA 5FK8A 4A6OA 5EYXA 3UV9A 2ZXQA 1H9WA 3MPBA 1W6OB 4KU7A 4NIDA 1GZCA 3WUCA 3BN6A 1UIKA 3HJRA 3DF0A 2LTNA 2RM22 2XLFA 3SC7X 5FO8B 3I54A 1ZBE3 1FOD1 1JOJA 1RUG3 1SHWB 2G19A 5DMYA 2DUOA 3PIGA 5C3RA 4RQPC 3M1HA 5FZMA 3GM8A 2P6CA 4XQWA 1C5HA 1SACA 2W95A 3ETQA 3VD5A 2AEZA 4R9AA 4FPOB 4S2GA 1Z7S2 1FATA 2LRPA 3J8F3 4YG6A 1LHOA 3J7LA 5IUQA 1WW5A 1G9DA 4C0HA 4CVUA 1UYXA 3EQEA 2B4KA 4MOAA 1S0EA 4FOQA 3FHAA 1UL9A 3A0KA 4HFSA 4KQ7A 1OA2A 5K4LA 3F2ZA 4XIKA 1CAVB 3RMXA 3VZOA 1UZWA 5K0UB 2VVFA 1NA1B 1I3HA 2XB6C 3KV9A 2BNOA 4EN6B 1B35A 1C1FA 3CJXA 2D97A 4OMDA 1NLQA 2ETEA 2VZ3A 4QB1A 4Q4W3 4YARA 1GKBA 2BWAA 3JU9A 3OY8B 3POGA 3PVBB 3J26N 1RINA 5FPBA 2C26A 4HKLA 1CZVA 2XGXA 1MS0A 2WABA 2WNEA 1ZX5A 2VZOA 4LUMA 1WLWA 3CF6E 1YRZA 4Y22A 5I8TA 3ZKUA 5CISA 4XDOA 2RS33 4IGPA 4ZKTB 2UWAA 3WQ0A 1S0GA 1UWWA 4P00B 3E97A 3CU7A 2SLIA 1HN1A 3H9AA 5ABJC 2BPA2 1DHKB 4RYDA 1RUH1 3PNAA 3KCYA 3IDAA 3S57A 3AJYA 2MEV3 4QX7A 2YROA 5AFBA 1BXHA 3VBSC 1LENA 4GWMA 4XJ8A 1PO11 4R9BA 2PHDA 1TMF3 4XC9A 4QPGA 1C3HA 3O7OA 1HN0A 3OD0A 2YPJA 1X36A 4Q4X1 4RQPA 3ZMNA 4NIAA 4X8NA 4TYSA 4DUVA 4COVA 2AR6A 4D69A 1R092 2J1VA 4KG0A 4LKFA 3V0BB 5CFDC 1U12A 2VMCA 2WT0A 1V0AA 3GBFA 4QXBA 4UFLA 3FHQA 4LIVA 5LZ6A 1VBA3 3O12A 2WIIB 1S0CA 3AC0A 4IE5A 4LOTA 4AAXA 4Z8BA 4WVWA 2QZ2A 5FZBA 2DCZA 5F8PA 1L7LA 5SV8A 1GV9A 2JDPA 5E89A 4K1YA 3AMMA 5FTTC 5LK5A 5E88A 3VL9A 2AH2A 1QJEA 4ZZ8A 5C4WB 2CGOA 3AP5A 2J1EA 3LPGA 4XFBA 3WW2A 2ZX0A 4D6SA 5DUWA 1GP5A 1HRI1 1MQTB 2QUOA 2Y6GA 4TLFA 4BWOA 3K4AA 5IJRA 2TBVA 1UU6A 5FYSA 4BQ1A 2XG3A 3HN3A 1I5PA 1VE0A 4Y20A 2R6QA 3EHKA 4EYUA 1GZTA 2CU5A 3L2HA 1O4ZA 5ABJA 1OOPA 1D0HA 2VNRA 1AR81 3OBTA 4EN8B 1NXD1 5C8WA 5FYIA 1J1TA 3H1YA 1DCSA 1H2NA 5F3GA 3RZJA 1C8M1 1AJKA 1COV3 4WM7B 1VBC3 5JWPA 1JYCA 2HWB3 4CXWA 4Y1UA 1WA6X 2JG8A 1OXCA 2JB4A 3IMMA 3NNMA 5FZ6A 2P34A 2QE3A 2W68A 4AQ2A 4GMP1 4CP9B 4AEDA 3R0RA 2BFUS 3D6EA 3GF6A 3MV01 4L0PA 4RHV2 3N4MA 2OUHA 4HSJA 1OLME 2V73A 5CFDA 2IXKA 2WC2A 5FK7A 1XU2A 1CIYA 4Q0QA 2DTWA 1W8OA 3ES1A 3T4HB 2Q5TA 5C71A 4MG2A 1AYM2 1RUC2 1F15A 3GNEA 4H7MA 4BK5A 2HWF2 1PM4A 1YI9A 2XJVA 2XL9A 2ZA9A 1W6MA 3AL5A 4L97A 5FV3A 3IWZA 3VBUC 3LIGA 1PVC3 5F2WA 1JYTA 3V64A 2RR13 1ZZCA 4S2FA 5DXDA 2DF7A 4ZHNA 2VW2A 3AX4A 1VIWB 1VBD3 5F5QA 4YPJA 3FZ3A 3VZNA 4A2UA 1XNDA 4DPNA 5DUVA 3KCCA 2J1RA 3V65A 2HBTA 5FIXA 4AGGA 3VDDC 4D7TA 4XAEA 5F39A 1JZ3A 2X10A 2TEPA 2XPJA 3T2TA 1W2OA 3W5MA 3ZXLA 3LD8A 1OA3A 4XF4A 1WWYA 3KQRA 2JE7A 1EAH3 1QNWA 2PQSA 3AB0A 2XVKA 1OD5A 1LOAA 2DWRA 2R041 4P9IA 4PJYA 2VCCA 1US3A 4XHXA 2H6BA 3U1XA 1OQDA 4G4FA 2JE9A 3ACIA 5C70A 2AC1A 1JH5A 3RI9A 2PHLA 2OA2A 3MPPG 4AL9A 5A7SA 2PHXA 4LUKA 3HPNA 1GR3A 2ILMA 4KWUA 3INAA 1FPN1 1BVP1 1QJFA 2WO1A 5FZ3A 4YSFA 4FPFA 1I5ZA 4PIZA 4UF0A 5L9VA 3KT1A 2V5DA 1LHNA 3UGFA 3OJBA 2OQ7A 1UXZA 1B35B 1W3VA 1K5JA 2AYHA 3RI8A 3WNLA 1AR72 2XUEA 2JIJA 2V72A 3IIAA 4IETA 5IVYA 1ZZ8A 3O1SA 2ERFA 4YGEA 3OCPA 3VBUA 1CGPA 3CIHA 2W94A 4JKMA 1JZ2A 1QY4A 2YY1A 1UYZA 2IVJA 2WA3A 4Y22B 1DGRN 2B9VA 4YW3A 5L19A 5JSRA 2A6VA 2ZCWA 4W65A 2FDFA 2Q8OA 5KHKA 4UT5A 3KVBA 3NNFA 1UY4A 4QMAA 3AMNA 1MZEA 4CDWC 3RSJA 1RMU1 1TME1 2EXJA 2X5IB 2CGPA 2Y6JA 1AXKA 3J9SA 4KWJA 3KCXA 3VDDA 4OI1A 2ZGNA 3WUDA 4CU7A 2NM1A 2BDRA 2QDRA 3M3IA 3C7GA 2A6WA 1FNZA 1LHWA 5F9TA 1RVF1 3W58A 2IC1A 4FPHA 5IYYA 4QPGB 2ZHMA 2Y0IA 5KHHA 1J58A 1LHUA 4EQVA 4HK8A 3WG2A 3PMSA 1H8VA 1NX9A 2WJSA 4RQPB 4IV3C 3USSA 4JC1A 2WO7A 2WFF2 3B9IA 2HWE3 4Y3OA 1RHI1 4X6QB 3MIDA 2PHFA 2VD7A 2JICA 2BWCA 2GN3A 3WDVA 5H9PA 1AR62 4UFMA 3ZM8A 1MACA 2HEVF 1LHVA 1OC1A 3PTRB 3WT3A 5A6QA 3U75A 2I07B 3T2QA 1RGSA 5A3UA 1S2BA 4J1WA 1N1VA 1EPWA 3DUIA 3OGGA 1RXFA 4ZS2A 3W59A 4AFBA 2W1UA 4QB2A 2WL1A 4JKLA 1W8FA 3O0WA 1CZSA 2R49A 4P08A 5DN2A 5C3QA 1HB3A 4LT5A 4KMQA 1X9TA 3O0VA 3ZXAC 3D8CA 5FLJA 3ZDSA 1NXMA 3NJZA 3AKTA 5IFTA 2CHHA 1IHMA 2ORXA 2CWSA 1UCXA 3PU3A 4Y20B 4AOCA 1UOBA 4N7UA 2DVFA 4NIIA 3AXDA 1TNRA 2BNNA 4XF9A 1K42A 1C5IA 3GJAA 1OOPB 1VBB1 1D7PM 4CDWA 2AENA 2B42B 2IXIA 3LOBA 5A3PA 2VUAA 3OYWA 3BODA 1S0IA 3U14A 3UT0A 1MEC1 1UU5A 1N3OA 4JQTA 2TNFA 3RYKA 4NIHA 4XUTA 5FZCA 2JG8B 1DYKA 4IE6A 4R9CA 4XQ4A 5A7PA 5T5LA 4CDQC 2J1TA 2E7TA 1KJRA 3FMGA 3LCPA 3PVEA 4RR3A 3UK9A 1W2NA 4AEDB 4BZ4A 1T6BX 5K7PA 3S5AA 1YWKA 1AUYA 1CX4A 1O91A 5JR7B 1POQA 4QXKA 4YYOA 5JZGC 1KITA 1RIRA 4K3UA 5ANNA 2DDUA 2GU9A 3TEZA 1CAUB 1WD4A 2RDQA 3WDYA 3GHMA 5BYNA 1UNBA 3Q8AA 3NJYA 1G9FA 4DUWA 5ERLA 1YFXA 1BK1A 1HKDA 3KT7A 3LKJA 5IK4A 3A21A 3VD3A 4F8AA 2GNBA 3RYRA 2ZEZA 5AVPA 2A71A 3WG4A 4YVSB 3MIBA 1W6MB 2Z2SB 2XL7A 1OH3A 3FHIB 1DGWA 1UO9A 4QPIC 3P3PA 2YGMA 4JGZC 2WINB 5LY1A 1DLCA 3U4SA 3E6DA 3LEKA 1BZWA 4XJ9A 5LW9A 2ARAA 2CAUA 4ZXKA 2D6LX 4URTA 1PMHX 4N43C 3UYJA 1WW6A 3GZAA 1O4TA 1UY1A 2FMYA 2KXLA 1QQP1 1I6XA 4DIQA 4OFGA 5SV5A 4Y5Z0 5FMBA 2XBO2 2LUWA 3O1OA 1UOJA 5FZIA 4YNIA 3WLUA 2C9KA 1QJY1 3ILRA 4YVWC 5LB6A 3ZYHA 4B29A 2ID4A 5C7GA 3BB6A 4DXTA 2VOVA 4CDQA 3SH4A 4RN5A 5DAPA 1NLSA 4XUNA 4GB32 4QX8A 1QJZA 3ZIXA 4LNVA 5FZKA 3AL6A 4Z07A 5JPNB 4DXRA 1RUE1 5F1RA 1H6YA 5JZGA 4CP2A 3CL1A 1S0FA 1YQ8A 5GLVA 4W50A 3CZUA 2D6PA 4I02A 2C1FA 1C28A 4FQ4A 1RUJ3 1O59A 1GU3A 4UF0B 1F31A 3I2DA 4LBNA 3D4KA 4UFKA 4NHXA 3Q8EA 1DBNA 1G9CA 1RUG1 4DZGA 2VZ1A 3POEA 3ZFGA 1NCQA 5LBFA 3ZFFC 1SLIA 4IEYA 4IEVA 3WQ1A 1F4AA 2GNMA 4JGZA 3J8F1 2X53S 3AZWA 1WCDJ 4AR2A 2J1SA 4ZU5A 2DTYA 2YU1A 4LJHA 1Y9MA 2BRTA 2QQWA 1OKQA 1CPNA 4B3NA 4N43A 1VRH2 3WNMA 3DKWA 1VBE1 4LO5B 5GLZA 2L9LA 4Q4W1 4Y1YA 5BNPA 5A70A 4ZPIA 3WNOA 1AYN3 1LOBA 1PO21 1BK0A 1PVXA 2RJ2A 2QCSB 3EXUA 1AL22 3K3NA 4LA2A 3K4DA 4BQYA 4BQ4A 1ND2B 1QJU2 3KV6A 5FZ0A 4JRAA 3T2PA 1W8HA 3SISA 3ZSMA 4HN1A 2RS31 3HWJA 3ZSKA 4QT6A 1UMZA 1DGLA 3IBMA 3TB0A 2DBNA 3VLBB 4EZ4A 1RYYA 3ZLIA 1GQGA 3TN92 5FYCA 1H2KA 3NJXA 1QIQA 1UYYA 2WFF3 5K0UC 1VAMA 1UZZA 5JI9A 1G8WA 2HBUA 3H42B 3SITA 1NA1C 2MEV1 2HWC2 4AW7A 2GMEA 4PF5A 2W0XA 2XJPA 3N9OA 4LBQA 4QX3A 4RGKA 1H1MA 3QOPA 2VM9A 4XCBA 4XTMA 3POYA 5B2GB 2VBBA 4GD4A 1RUD2 2I2SA 4COUA 3VV1A 3ZFFA 2Z5WA 1F9KA 2EICA 5FCCA 3ZN6A 4M0HA 4CDUA 3RZHA 1ZBA2 3IDBB 5DZFA 4AI1A 1ONAA 3IDCB 4XBQA 2Z79A 1RUI3 2B9UA 4Q4Y1 1KEXA 2OX0A 3V0AB 2VUCA 2GNDA 4XF1A 5JSPA 1V9U3 5DZEA 3MFCA 4XVHA 1S1AA 1OF4A 5LASA 1O8SA 1TE1B 3W5NA 4CDWB 1ZBE2 2DCJA 4ZONA 5K9YA 1NZCA 3ZDVA 3OYWB 4CCMA 2LALA 1RB8G 1IG3A 2R30A 3TAYA 1ZA4A 2ZHKA 3EB7A 3HR9A 4GWJA 4IGQA 5F32A 4B7EA 1ACCA 5ANQA 1GOGA 5HV4A 4MVTA 1W8TA 4HXCA 1KFXL 4QHBA 4RR3B 2GC1A 3SH3A 3NKTA 1ZRCA 2W39A 4XUQA 1G86A 4M0NA 1WLTA 3I49A 4FT8A 1FT9A 1HQNA 3IB3A 4YZ1A 1UAIA 3ILNA 2XJRA 3H1MA 1LESA 1APNA 3TOJA 1COV1 1PIV1 1O5UA 4YGBA 2K46A 3G6JB 1W8NA 1BLZA 1PGL1 4GKXA 3Q8CA 3MF6A 4DY5A 5LA1A 5A7WB 2WS91 4HG6B 4MO3M 1QH6A 3AMHA 3MDPA 5KR7A 2D6KA 2CL2A 3JCIA 3Q9OA 4AVCA 2EXKA 1E5SA 3VKMA 3POJA 1DGRA 4NAOA 5AVAA 3WDTA 5FPUA 4BJ0A 5A1LA 2W9XA 1BKZA 4AWDA 2C24A 4AGRA 2W91A 2VE1A 1W6NA 3BVCA 4I30A 1RUNA 2VQTA 2JENA 3EJKA 1TZOA 4MXVA 2PHWA 3UKTA 3B01A 3OGVA 4GJYA 1TMF2 1AX1A 4B4QA 4A4AA 1XE0A 1OLMA 1OQ1A 1PVC1 1XB9A 1IS5A 5EZWA 1Q3EA 3H3ZA 4WM7C 4CDXC 5KXEA 2P3KA 2ARXA 5FZHA 1MS9A 4FPKA 1JU4A 3R4SA 1LKNA 4NE9A 5FJKA 5T3NA 1CPMA 5CKNA 4QU2A 3HBZA 1DQ1A 3H3UA 1VBA2 1LU1A 2WN3A 3N9MA 2VMGA 4XAAA 4ZZ5A 3SH5A 3BGAA 4EWEA 3T4VA 1MZ6A 3U78A 4KNCA 1LULA 5FBJA 3WP5A 4UW3A 3ZKYA 4FOWA 1J83A 5LK7B 2QZ3A 1LGBA 1SQ4A 3I2IA 3KZ4C 4CZSA 4D7SA 2VTXJ 5DAVA 4YM2A 1X7NA 1GUIA 5L36A 1Y9QA 3M3EA 3PLQA 5IWFA 4AHWA 1XNTA 1MZ5A 1H1IA 2H0VA 1HXS3 3I2GA 3ZFGB 3AKPA 3MW4A 2RM21 1NCQB 1SLLA 3U0ZA 3KT4A 1DIWA 4CXXA 2HWD3 4B1LA 1LOFA 2W1WA 3C8XA 1MS5A 2Y64A 4JGZB 1UPSA 1WZXA 4OI2A 3ACGA 4PF1A 5T52A 3S6PA 1OLRA 4YW6A 1NY72 5FZOB 5HXVA 1VAKA 2BQPA 5AFEA 1O3TA 4BIOA 1Z7S1 1LOGA 5GLUA 3FUOA 4LK6A 4N43B 3PL0A 1WW7A 1YHFA 2JECA 3LF7A 3QBQA 1W04A 1S0BA 4Y1XA 1LOEA 1HJGA 3LFIA 4O9GA 1COV2 1SBFA 3NRUA 1VBC2 4R8HA 2BW8A 2HWB2 2XWBB 2ZMLA 4Y5SA 5BNPB 4H14A 1VRH3 3HQUA 2XDVA 1T2XA 5CADA 2QKDA 2BVBA 5JI7A 2R063 4PCRA 4QQLA 4WM7A 2O8OA 2OZJA 2SBAA 4R9DA 5CB7A 4CDXA 1QJX2 3K2OA 2WLPA 2RDSA 1C4RA 1RL3A 1BBT2 4CYDA 4QPWA 2XQXA 4CP9A 1LGCA 3CO2A 2Q4SA 2YFZA 2XVLA 4LKDA 3ELNA 4Q1RA 1DG6A 1ENQA 2VMHA 3KB5A 3ZXGA 4AGVA 2VOTA 5JUVA 5L7OC 4KG8A 3E6CC 1W2UA 1W99A 3O0XA 3ZVXA 1PNFA 2ZS6B 1KDKA 1VPHA 3M7AA 4NWWA 3RGBA 1D4M3 1EUUA 3TN93 1B35C 1IQDC 3A23A 2E7AA 4LBQB 4LQRA 2RR12 3U37A 1GFF2 5LEJA 2BEOA 2UYBA 3WEZA 1VBD2 5JVVA 3ZFFB 5FYUA 1QHDA 3ZN6B 4CDUB 2R1DA 3I2KA 3T08A 1YJLA 1KS5A 1OH4A 4QPYA 5E8AA 1PZ7A 2Y33A 1IS4A 4AFDA 3FWEA 1IS6A 2F4LA 3MIGA 4KBZA 3I3DA 4UXAA 1BMV2 4P9JA 1ZBA3 1R091 1PX3A 2ZGPA 1YO8A 3QH7A 4P9XA 2X5IC 4PT6A 4MH0E 1EAH2 1OLQA 4QX2A 4BDVB 3R4UA 1D4VB 3WF0A 3AYAA 3IM0A 1Q8QA 1ND3A 3MGUA 3RJRA 3EO6A 3BPZA 4BQ5A 2NP0A 2Z4FA 4QPGC 4UYBA 2JDMA 3WQ7A 1JUHA 1UD1A 3AK0A 3B00A 1J3QA 2XWJB 1Y9GA 1WBFA 5C9AC 3OPZA 4WVVA 2YV8A 3JD72 4R4XA 5A3MA 2YC2A 4Q1PA 3BTAA 5EPAA 4IEWA 2D93A 3POIA 2PHRA 3I8TA 3ZIWA 3H0OA 3K46A 3AXEA 1QMJA 3ZR5A 1L3JA 2GSYA 2J7MA 2IWGB 2WQ4A 5L7OA 2J22A 3POWA 3N7JA 4FTBA 3ZYPA 2PHTA 1WMXA 2WYSA 3G7DA 4LLFA 4WM8B 5EHDA 3SLIA 2ZOEB 2AUYA 5DAQA 3K3OA 4IEZA 2DU0A 3HOBA 4HK9A 1H1AA 1PGW2 1WUVA 2VO5A 3O5SA 1V6KA 3AMQA 1PK6A 5KXDA 2D5FA 2VBDA 3USUA 2EAAA 4Y24A 3UKNA 2ORZA 5A6ZA 2RS13 3C2UA 5FYZA 4EJRA 1VRBA 3LEGA 3H8UA 3ATGA 4XBLA 1ULDA 1UX6A 3SCFA 4LE3A 5A1FA 4OZOA 4OZXA 2RJKA 2B5HA 5KXCA 1REEA 5E6HA 3MFAA 4RHV1 1JZ6A 2ZGUA 3WY6A 2VULA 4BYYA 1W6NB 2EAKA 1BHGA 2VXRA 4LK7A 1OOPC 4Q4V3 5DZGA 3WZ1A 2X5IA 3MO4A 1WCQA 1DP0A 4OCTA 1RXGA 3DYOA 3UL2A 3P6BA 5BXXA 4PQ9A 1FAYA 3ILFA 4NROA 5LATA 2OT7A 1AYM1 4X6RB 1RUC1 1CN1A 4B7KA 1MVQA 5IVFA 2VCAA 2HWF1 2HWE2 1AZDA 2JG8C 4Q8LA 5T54A 1VALA 5EXOA 4BOWA 4IUGA 3OUIA 4DRVA 4E27A 2G1MA 5FRAA 4AEDC 4LHNA 3VHOA 3CNAA 2XUMA 5C9AA 4ES9A 1IPJA 2BNMA 4DRRA 2BYVE 1W3XA 3WNKA 2BOJA 4AQSA 4CEYC 3SEEA 1AVBA 2WNVB 4E4ZA 2WO3A 4WV8A 2RMU3 4RGGA 4EN0A 3UJOA 5FR3A 5FY1A 1SEFA 4OUEA 4LTAA 1QOTA 4FOYA 4YVSC 1W90A 3Q8BA 2V09A 4MHUA 5FYYA 4UOJA 4FFHA 3I3QA 3KHCA 5G05L 2FQPA 2VZUA 3WD5A 4AI8A 4XUOA 1XNCA 1XYOA 3SKVA 5HCAA 2RDRA 2YC4A 3ME2A 1G6NA 2AEYA 4RS5A 3RWKX 5FYVA 1GZWA 2O14A 4HPKB 3GXUA 1SLAA 1XU1A 4AEJA 4ISQA 4O61A 5DUUA 4IV1A 1K5MC 2VMEA 3B93A 1QEXA 4QM8A 2VOWA 4H3WA 1SFPA 3VHNA 4CCCA 4CU8A 5IAVA 4LBLA 3JBG3 3ZYRA 2I45A 3RMYA 5DPNA 5FXVA 5CNAA 5FP8A 2EIDA 1GZ9A 4HBNA 2A75A 2Z42A 5BNNC 1Y7BA 2IFWA 1AR71 2OUJA 3GCWA 4CDXB 3IPVA 4IXLA 4YFWA 4Z2AA 3BUCA 3M2MA 2YMZA 2QBXA 4CXYA 3AMPA 3UETA 4GWNA 1WMFA 2WNUA 5FKCA 2JKBA 1VR3A 3VHRA 1QJX3 1DZTA 4LBKA 1A6CA 5JR2A 3FFZA 3H8OA
chains in the Genus database with same CATH topology
1Y4WA 2XQRA 2OXBA 3U75A 4CCDA 5FK7A 3S5QA 4B1MA 4UFLA 3KF5A 5FIXA 2QQUA 3NMBA 3UGFA 4HXCA 3U14A 3OSDA 3LDKA 1UYPA 3PIJA 5FKBA 4QHZA 4CCCA 2ADDA 4JQTA 5FK8A 3ZR6A 3ZR5A 4AZZA 2ADEA 5FMCA 3LEMA 4FFFA 4FFIA 4EQVA 3LF7A 3H3LA 3LIGA 1Y9MA 3LFIA 2QQWA 4FFHA 3SC7X 5ANNA 3IMMA 3U1XA 3HBKA 1W2TA 3LDRA 4FFGA 3KF3A 4UFIA 1ST8A 3UGGA 2AC1A 3UGHA 4B1LA 3PIGA 4UFHA 2QQVA 4CCEA 5FKCA 2AEYA 4UFKA 4UFJA 5FMDA 3RWKX 1Y9GA 5FMBA 4UFMA 2AEZA 3LIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y4W A;  2XQR A;  2OXB A;  3U75 A;  4CCD A;  5FK7 A;  3S5Q A;  4B1M A;  4UFL A;  3KF5 A;  5FIX A;  2QQU A;  3NMB A;  3UGF A;  4HXC A;  3U14 A;  3OSD A;  3LDK A;  1UYP A;  3PIJ A;  5FKB A;  4QHZ A;  4CCC A;  2ADD A;  4JQT A;  5FK8 A;  3ZR6 A;  3ZR5 A;  4AZZ A;  2ADE A;  5FMC A;  3LEM A;  4FFF A;  4FFI A;  4EQV A;  3LF7 A;  3H3L A;  3LIG A;  1Y9M A;  3LFI A;  2QQW A;  4FFH A;  3SC7 X;  5ANN A;  3IMM A;  3U1X A;  3HBK A;  1W2T A;  3LDR A;  4FFG A;  3KF3 A;  4UFI A;  1ST8 A;  3UGG A;  2AC1 A;  3UGH A;  4B1L A;  3PIG A;  4UFH A;  2QQV A;  4CCE A;  5FKC A;  2AEY A;  4UFK A;  4UFJ A;  5FMD A;  3RWK X;  1Y9G A;  5FMB A;  4UFM A;  2AEZ A;  3LIH A; 
#chains in the Genus database with same CATH topology
 4OUM A;  5GZG A;  1BBT 3;  5D21 A;  1J84 A;  4GKY A;  1CAU A;  1XC6 A;  4CEY A;  1QDC A;  3M4F A;  2DUQ A;  4A6S A;  1GNY A;  4CTE A;  4BE3 A;  5C3P A;  3HNY M;  4QGM A;  5FMC A;  5HXM A;  4YFZ A;  5ACA 2;  3F95 A;  5B4N A;  4JDN A;  4YVS A;  3VD4 A;  5J37 A;  1RUF 2;  4QXH A;  1JYX A;  5CAZ A;  1H2M A;  2J1A A;  1W8W A;  4CCN A;  1ENR A;  2ZX2 A;  4FO9 A;  5GKA C;  4XQD A;  2VG9 A;  5CZK A;  1BQP A;  2G4I A;  3UGH A;  4HVO A;  5JOW A;  2VZP A;  1OUX A;  1GLH A;  4IL7 A;  5JMC A;  2WFF 1;  5J09 A;  4I3G A;  2X09 A;  2ZPX A;  2JDA A;  3POS A;  4NRM A;  4V2W A;  1STM A;  2Q1M A;  2WWS A;  5I93 A;  5IVJ A;  1K5M A;  2RVA A;  4DUX A;  5LBC A;  3MLJ A;  1AR6 1;  1N3P A;  1UIJ A;  3M8L A;  4MXW A;  4E9K A;  5FO9 B;  2X29 A;  1ND3 B;  1MZF A;  3M3O A;  4XDP A;  4AHY A;  3IN9 A;  1ND2 C;  1ZRR A;  1V6L A;  2EXI A;  4HET A;  5BNN A;  2PQQ A;  1QWR A;  4LO8 A;  1P8J A;  3WDW A;  4WZC A;  2R07 2;  1WD3 A;  4Q0S A;  5HCF A;  4D0Q A;  1RUI 1;  1PMI A;  1VB2 A;  5FXX A;  5D8A B;  3RQ0 A;  4IEU A;  1RUJ 2;  5DG1 A;  2BGP A;  1EV1 3;  2D6N A;  1UQX A;  2JKX A;  5BNQ A;  5LRS A;  2Y6K A;  5FZ8 A;  3JD7 3;  1N1S A;  2QQL A;  4BXF A;  5L7O B;  5BV6 A;  2GAU A;  2AZ5 A;  5FY7 A;  4YW7 A;  2WSV A;  1I1E A;  4JHZ A;  1LU2 A;  4LBM A;  2A6X A;  1N3Q A;  3GCX A;  4QQH A;  2V4A A;  1CQ9 A;  1TQ5 A;  3LPF A;  4K20 A;  4M3C B;  4XMA A;  4DB5 A;  1PK6 B;  1XE8 A;  4OLL A;  4L99 A;  3USU B;  5JAX A;  3CLP A;  2B46 X;  3MIF A;  1YEW A;  4GA9 A;  3VZM A;  4AI9 A;  3VD7 A;  1YLL A;  5FY0 A;  1GNZ A;  3HNM A;  5C33 A;  1O5L A;  4Y1V A;  4YM1 A;  3GBW A;  1FMD 2;  4BQW A;  3PUQ A;  3WG3 A;  5AC9 3;  4P9G A;  1ASJ 3;  4RL7 A;  3K4Z A;  3NAP C;  3ABZ A;  2A1X A;  5F3I A;  4RSU A;  1AYN 2;  4K8R B;  5FP3 A;  1A78 A;  4IQP A;  4B1M A;  3IT8 A;  3UNP A;  4CP1 A;  2WT2 A;  3I2O A;  5APA A;  1IG0 A;  3RFR A;  1EP0 A;  3KLS A;  5C5U A;  1ND2 A;  1ODN A;  4L11 A;  2ZZJ A;  3P5B A;  2PAM A;  4I01 A;  5FZG A;  5HI0 A;  3P3N A;  4RR3 C;  5I0S A;  2PHU A;  4S2H A;  3OUJ A;  5C9A B;  3I2J A;  3ASI A;  3NKG A;  3LDR A;  4FFG A;  4YG3 A;  3A22 A;  1OPO A;  3UES A;  4A45 A;  2JD9 A;  3DEM A;  3GGL A;  3MBW A;  1V70 A;  4JGY C;  4NPL A;  3RWN A;  2ZAH A;  4JRL A;  3WP6 A;  2IFR A;  3FFQ A;  4O9E A;  3ZXJ A;  4AI0 A;  2YBP A;  5FJH A;  1CVN A;  1KD7 A;  1KQR A;  2HYX A;  1X50 A;  1REF A;  1UX7 A;  2KM2 A;  2NMN A;  4OUL A;  2IXC A;  5IAX A;  2QQO A;  3OPW A;  1IOA A;  1E5I A;  1FX5 A;  2NN8 A;  4NJ4 A;  2UWB A;  2PYT A;  4C90 A;  3LDK A;  4NHK A;  4FTS A;  2XBO 1;  4ONU A;  4Q8K A;  1H30 A;  1OFN A;  2AGS A;  5CVR A;  5FLI A;  4MGI E;  4C91 A;  1RUI 2;  2WZE A;  1YQ6 A;  2DYC A;  2E63 A;  3FLR A;  1ZZ6 A;  3H3L A;  3GZU C;  3OPT A;  4XJZ A;  5T50 A;  1D2Q A;  3RJ2 X;  1I9R A;  1V9U 2;  4RS5 B;  4JVA A;  3ACH A;  1OUS A;  1GZW B;  3H50 A;  1LJ7 A;  4GB3 1;  4E2Q A;  3B02 A;  1HRV 2;  2QFE A;  4Y26 A;  2NZ9 A;  2PA7 A;  1WW4 A;  1UZV A;  4LO4 B;  3V0A A;  5KC6 A;  2YBS A;  2VUJ A;  1U5Z A;  4IV1 B;  2PLV 3;  1IS3 A;  4LIT A;  3GJB A;  3N9L A;  3NAP A;  4M3C E;  3CHX A;  2OXB A;  2ZAA A;  3LSE A;  3C7O A;  3VBO C;  3BAL A;  1HXS 1;  3SKJ E;  3B5L B;  3LSD A;  2GH8 A;  3WNX A;  4IEQ A;  4E2G A;  1DQ2 A;  1OD3 A;  2RE9 A;  2A6Z A;  4YZ4 A;  1FOD 3;  3HT1 A;  3IPV B;  2P4E A;  5EFU A;  2IVI B;  3PHM A;  5BNO A;  5FWJ A;  3WHT A;  3ZPO A;  1W6Q A;  1OA4 A;  1ENX A;  3MLK A;  2WNU B;  2VCB A;  4N8M A;  3WQB A;  3MZH A;  1RC6 A;  5E1R A;  4AVB A;  2A3X A;  2A7A A;  4Q2F A;  1R1A 2;  5H9Q A;  4QQ2 A;  2ZMK A;  4JGY A;  5CFC B;  1LGN A;  2RS5 3;  4CEY B;  5J1X A;  2XON A;  3N7K A;  3PUS A;  5IVB A;  1VRH 1;  4EWA A;  5FZ9 A;  4HN0 A;  5JOX A;  4FAH A;  3ORJ A;  4U2A A;  1O3R A;  2VQA A;  4L2N A;  3DGT A;  3ZFG C;  4Z2W A;  1POV 0;  1NCQ C;  3BI3 A;  2WDB A;  4H2A A;  3DN7 A;  4UW6 A;  1AL2 1;  5A7W A;  3WNP A;  5ACA 3;  4JQR A;  1QJU 1;  5LA2 A;  4UBG A;  4MGY E;  5FXZ A;  4PIY A;  2OZ6 A;  1YFW A;  5T5J A;  4GH4 C;  4TTG A;  3L2Y A;  1RUF 3;  3JQX A;  1ULF A;  3NJV A;  1OT5 A;  4AG4 A;  4F3J A;  4LBO A;  1GP6 A;  2BFU L;  2O0O A;  4NWV A;  4DS0 A;  3K75 B;  4ORF A;  4OI0 A;  2CV6 A;  3TN9 1;  3AP6 A;  1K5M B;  1H4G A;  5LEK A;  1OHF A;  2HLE A;  4LHS A;  1W0N A;  3DYP A;  3AKR A;  5BNP C;  3RPQ A;  2W46 A;  4MXW B;  2ZGO A;  1UMH A;  3VBO A;  2W52 A;  3U4X A;  2HWC 1;  4FVV A;  1FI2 A;  4P5H A;  4A3Z A;  3B3Q E;  1Y43 B;  4XYX A;  3ACF A;  1WLD A;  3BPS A;  5BNN B;  4LIU A;  3LZZ A;  4RFR B;  1RUD 1;  3HEI A;  3I59 A;  1Z0H A;  5FZF A;  5HV0 A;  4FP3 A;  4OHY A;  3WV6 A;  4HMZ A;  4FXG B;  3FX3 A;  1GQH A;  1ZBA 1;  2JDN A;  5F7U A;  5J36 A;  1GSL A;  2R07 3;  3N35 A;  4NOT A;  2YB7 A;  4XF0 A;  3A7Q A;  1V00 A;  4NHY A;  2EIB A;  1AR9 3;  1NQJ A;  5LCW L;  5IK7 A;  1XNA A;  4OHW A;  5FMO L;  1HXS 2;  1CAW A;  1SFN A;  3BU7 A;  3AYE A;  3K48 A;  1YFU A;  4XTP A;  1OSG A;  4S2D A;  4YRD A;  5BPX A;  1ZBE 1;  2Y6L A;  4N53 A;  3SCH A;  2HWD 2;  4LMF A;  3NQH A;  4JKK A;  3IZO A;  2JX9 A;  3B9C A;  3ZXK A;  3THP A;  1S2K A;  1V6O A;  1W2A X;  4D3W A;  4CCK A;  5JOZ A;  5F37 A;  4CDU C;  4FPY A;  2B39 A;  3C3V A;  2O8Q A;  3T0D A;  4QKD A;  4QD2 A;  2EVX A;  1HRI 3;  4GH4 A;  4ITC A;  5FZO A;  2Q8C A;  4Z1V A;  4PLO A;  1QXP A;  2NQY A;  1XYN A;  4DEV A;  5JXG A;  5HBA A;  1X8M A;  2LW8 A;  3ZSE A;  3KWV A;  4QM9 A;  3PUA A;  4IEP A;  3B69 A;  4CCL A;  3NWK A;  2XLG A;  1URX A;  3QCW A;  1FMD 3;  4EN9 B;  1A34 A;  1ZRI A;  2R06 2;  2VR4 A;  2G9Z A;  4COY A;  3BOW A;  5JMO A;  1NCR A;  2VCM A;  1G9A A;  3O1U A;  5A3W A;  2R0H A;  4E8C A;  1XE7 A;  4OI4 A;  4CU6 A;  2YC0 A;  1C8M 3;  1HW5 A;  1SBE A;  2YGL A;  3CEW A;  1KXG A;  1Q43 A;  2D3R A;  3LWC A;  3RG0 A;  4BIS A;  2WR9 A;  3ZYI B;  3ZR6 A;  1UOG A;  5D2A A;  5LA9 A;  3EBR A;  3I7D A;  4MGT A;  4GMP 3;  3D3A A;  5A3O A;  1Q8V A;  1VMF A;  3AKS A;  4XEZ A;  2Q8E A;  3S7E A;  5DDJ 3;  3VUO A;  1VP6 A;  4JHT A;  2VGD A;  2FDJ A;  4HSL A;  2XXZ A;  3POF A;  1D4M 2;  3O1V A;  4Y4Y A;  5H9R A;  1H9P A;  1MR5 A;  1XJA A;  1GWM A;  5IVC A;  3BYW A;  1F8V A;  1IKP A;  2D40 A;  3B94 A;  2ZKL A;  4GXL A;  4WM8 C;  1W28 A;  2BTV C;  4K21 A;  3AM2 A;  4ATF A;  3MUZ 1;  4MGQ A;  4QU1 A;  4CCO A;  1OKO A;  1XBF A;  3MI8 A;  1TMF 1;  1JHJ A;  4XXP A;  4DQA A;  2FDI A;  2CDO A;  2PAE A;  1G9B A;  2W92 A;  2D6M A;  3ZN4 A;  3E5Q A;  4BA6 A;  2WQZ C;  2XJT A;  5A3L A;  5I0T A;  3CZJ A;  3EYP A;  1D0G A;  4OMC A;  2WYF A;  5FYH A;  2IXJ A;  2JB8 A;  3NV3 A;  3PJQ A;  4U36 A;  1VBA 1;  2VZQ A;  5F6L B;  2CWM A;  5A1A A;  5JIA A;  3ZYF A;  3NAP B;  2VVD A;  1HRV 3;  5FXW A;  1IQA A;  1NKG A;  1XSQ A;  1SMV A;  1O3Q A;  4CCE A;  2WO2 A;  4YM0 A;  1W05 A;  2JDH A;  1WCU A;  1WME A;  2XVG A;  5FPA A;  1A8M A;  4L92 A;  1LOC A;  1CJP A;  4XJW A;  5FY5 A;  1Z78 A;  4AVV A;  3RZM A;  4A44 A;  1WA4 A;  4PI0 A;  3ZOI A;  5BNO B;  2J42 A;  3R6S A;  1W6Q B;  2R04 3;  4YW2 A;  4CE8 A;  4IW3 A;  4AI3 A;  2GZW A;  2D6O X;  4TZD A;  3I3E A;  4AQ6 A;  3VHP A;  4FFI A;  5IK5 A;  1AF9 A;  4MGK E;  1NY7 1;  4NVP A;  5A6X A;  4JGY B;  2WNV C;  2C4X A;  1SDD B;  1YQ5 A;  2RDN A;  3RZZ A;  1HQW A;  4EZH A;  2ATF A;  1HIX A;  3OF1 A;  2WZR 2;  4NUB A;  4PBO A;  3DXU A;  2BZD A;  1R1A 3;  4Y4R A;  2WUH A;  5D1I A;  4D6Q A;  4EWD A;  5BUV A;  3W9A A;  3DV8 A;  4WM8 A;  3NNL A;  1DQ6 A;  1JS9 A;  3VB9 A;  1J1L A;  1L7Q A;  2MHF A;  1QXJ A;  1LEC A;  2IUW A;  3AYD A;  1VBC 1;  4FPC A;  2HWB 1;  3FBM A;  3THC A;  1N47 A;  4B8E A;  2RS1 2;  1CON A;  4QHZ A;  1GWL A;  1WLC A;  3C7F A;  3DKQ A;  3IAQ A;  2R16 A;  2ZGQ A;  3ZFE C;  1LOF C;  2DV9 A;  4I0B A;  1VMJ A;  3WP4 A;  1QJX 1;  4V1P A;  4CEW A;  4DY3 A;  1UKR A;  3DYM A;  3A0N A;  4A7K A;  1OPM A;  1BBT 1;  2W08 A;  2H0B A;  4QAW A;  4BB3 A;  4Q4V 2;  5F5C A;  1PGS A;  2W3J A;  3J7M A;  3BIE A;  4W6X A;  4IE0 A;  4A3X A;  1UZY A;  4XCA A;  4AXO A;  5A7Q A;  3ZN5 A;  2ZEW A;  4CRQ A;  2ZX1 A;  2ZAC A;  1TME 3;  3KHB A;  2BUK A;  2VZS A;  2Y26 A;  1IPS A;  2DCT A;  3FC0 A;  2OYZ A;  3VBO B;  1SLB A;  3IDE A;  4UFH A;  5FZ4 A;  3BTZ A;  1SBD A;  5F3C A;  5FPX A;  4GJZ A;  2RR1 1;  2PTM A;  4XUP A;  2WN2 A;  4N7I A;  1RVF 3;  4HKO A;  3I59 B;  3GHN A;  4EN7 B;  4EV0 A;  1WMD A;  5FY9 A;  1GAN A;  1VBD 1;  1ZA7 A;  3KF5 A;  2QQU A;  3SMH A;  5GZE A;  5A3N A;  1VB4 A;  4UBH A;  1JI6 A;  2RMU 2;  1RHI 3;  4XFI A;  4OQ9 A;  5FLH A;  4P5Y A;  4ET7 A;  1VMH A;  3KMH A;  3VN4 A;  2Y8K A;  3MV1 1;  2ARB A;  2WNV A;  1CD3 G;  1YIF A;  3WCS A;  4AE2 A;  4W4Z A;  5JIU A;  1BMV 1;  1BEV 2;  1CAW B;  2OPK A;  3D5O A;  5FYM A;  2VNV A;  2UY8 A;  5IT6 A;  2I74 A;  4N53 B;  1EAH 1;  3OBR A;  3ZYG A;  1KS4 A;  3WXP A;  4BLJ A;  5FZL A;  3AP9 A;  2EA7 A;  4JTN A;  2E6V A;  3KVA A;  2C6S A;  3ZFE A;  5FZA A;  4AF9 A;  2WSU A;  2CSG A;  2YG0 A;  4WZF A;  1PM7 A;  1EV1 1;  2VVE A;  1SFY A;  2RJL A;  3OSD A;  4GH4 B;  4GMP 0;  4PLM A;  4OHZ A;  5CEH A;  5K8S A;  3JD7 1;  2GN7 A;  2ADE A;  4MET A;  3SCG A;  2JDZ A;  4HPK A;  4M4P A;  3JBG 2;  4H7L A;  5JXH A;  4Q27 A;  5KHJ A;  5I8Y A;  4XFH A;  4GIQ A;  2ZGM A;  4GQ7 A;  1NE6 A;  2CAV A;  4CUG A;  3PDQ A;  2P17 A;  1NCR B;  2D44 A;  5EQU A;  1H8T C;  1V6J A;  1ND3 C;  4AFC A;  4FCA A;  3CKH A;  3FLT A;  2NLR A;  3QH6 A;  1QGL A;  3CMG A;  4UFJ A;  2BU9 A;  2ZGS A;  3OTF A;  3VBR A;  1PGW 1;  1US2 A;  4Q5O A;  5FZE A;  4ZY9 A;  3VBH B;  2E9Q A;  3H7Y A;  4N90 A;  3KM5 A;  4PDW B;  1DZQ A;  2DFB A;  1H4H A;  2BGO A;  1J59 A;  2QNK A;  1SCR A;  2CDP A;  3NO8 A;  3LQC A;  4QX0 A;  5D8A C;  4IER A;  3GAL A;  2PFW A;  3PIJ A;  4MGZ E;  1LB2 A;  1LRH A;  3LEM A;  3VBF A;  2D98 A;  1PNG A;  2BJS A;  3O1M A;  4YG0 A;  2RV9 A;  3D82 A;  5GM0 A;  3OGR A;  2QQK A;  4YGC A;  2WQ8 A;  4Q26 A;  1ZVF A;  2QQJ A;  4NRQ A;  5FP9 A;  2K9Z A;  4NR1 A;  4QX1 A;  2F6B A;  1PK6 C;  3N3H A;  3WCR A;  3ON7 A;  3M3C A;  3DPR B;  4FPJ A;  4DMI A;  1JZ7 A;  4AK3 A;  4HAN A;  3WF4 A;  4AVA A;  1AX2 A;  4XUR A;  2HWE 1;  1M06 G;  5DUX A;  2GP5 A;  2VL4 A;  5F6K A;  4H55 A;  3NMB A;  2Q30 A;  2C0Z A;  2YXS A;  4AFM A;  1SDW A;  4KGQ A;  3GYD A;  1EUT A;  1ZRF A;  1HLC A;  1LTE A;  5IHR A;  4MGS A;  2P37 A;  2DVG A;  2QQM A;  4BQ2 A;  2H6C A;  4GZ9 A;  1QQP 3;  3TRS B;  5IW0 A;  1RUO A;  4I0W B;  4QQO A;  4WVM A;  3VZK A;  2Y38 A;  3OEB A;  2DCY A;  1H8T A;  1BJQ A;  1QJY 3;  1UU4 A;  2ZJC A;  5G04 L;  3KGL A;  4LOR A;  2K2S A;  2VC9 A;  4CUA A;  2C5D A;  2RG4 A;  1DDL A;  1EV1 2;  3FBY A;  2XML A;  4BK4 A;  4E4H A;  1RED A;  2BVV A;  3JQW A;  1XNK A;  1OVS A;  5D8A A;  1NQD A;  4B4P A;  4R52 A;  1NAE A;  2VZT A;  4HL0 A;  3H7J A;  4SLI A;  3KV5 A;  4LEJ A;  2VY0 A;  2Y6H A;  5FO7 B;  4GAZ A;  1OBN A;  1LEM A;  3LA7 A;  3ZXE A;  1VJ2 A;  3O1R A;  2NPI A;  3ZO0 B;  2XJU A;  3SHR A;  3SXW A;  5HCB A;  5F5A A;  3AJZ A;  1ZM1 A;  5CG8 A;  3WP3 A;  3HN1 A;  2XH6 A;  2WZR 3;  2JDY A;  3AP7 A;  4O7X A;  3TNQ A;  3HBK A;  2VW1 A;  1VAV A;  4M3C A;  2D3S A;  4ASK A;  1R08 2;  4HT1 T;  4K7J A;  1A8D A;  4KBB A;  2BBV A;  3E6B A;  5AC9 2;  4RS5 C;  1PZ9 A;  4CEW B;  1ASJ 2;  5IK8 A;  3PVN A;  1GBG A;  3N9P A;  2B45 X;  2RS5 1;  4KI5 M;  1HV1 A;  1MS4 A;  2ZMN A;  1W0P A;  1DF0 A;  2F4P A;  3DXT A;  4IV1 C;  5KBF A;  4OQ8 A;  1F5J A;  2VBP A;  1W6P B;  4CU9 A;  4D8M A;  5J3U A;  3AKQ A;  1VBE 3;  4JX0 A;  1WCK A;  2PEL A;  3FE5 A;  5FP7 A;  1PZ8 A;  2QTW B;  2WWU A;  3RZG A;  3L9J T;  4CPB A;  4QXC A;  1PO2 3;  5ACA 1;  5A80 A;  5GZC A;  3PJY A;  4LHL A;  1XNB A;  3I2F A;  3UJQ A;  2OW4 A;  3H8X A;  3NST A;  2YHJ A;  4TWT A;  1RUF 1;  5I0D A;  1ZRE A;  2QVS B;  4AHX A;  2WNU C;  5C5T A;  1ZRD A;  1MVE A;  4FP2 A;  4P14 A;  1QU0 A;  5CFC C;  4FTE A;  1ULG A;  4P02 B;  5LY2 A;  2BGC A;  1UN1 A;  2V5Y A;  1KFU L;  2VQ0 A;  2R0F A;  3BCW A;  2JG9 C;  5FKB A;  3NV2 A;  3VDA A;  3S0M A;  2GMM A;  3WW1 A;  3OGS A;  2ZEX A;  1QOS A;  2WFP A;  2DBI A;  4LO6 B;  5LWB A;  2FD8 A;  3OEA A;  1J3P A;  1BEV 3;  1OI6 A;  4XIO A;  5B4X A;  1JZ8 A;  2DUP A;  2MPF A;  4L8Q A;  4D6R A;  1EY2 A;  5EV7 A;  1JW6 A;  5GAL A;  4V2V A;  3VDC A;  3URF A;  1UY2 A;  3ZFE B;  1G7Y A;  2R07 1;  5JPM B;  3C7H A;  1YI7 A;  2PLV 2;  3WG1 A;  3T3Y A;  2AAC A;  1PHM A;  2R32 A;  4Q4Y 3;  1AR9 1;  1RUJ 1;  3DCQ A;  4QKB A;  2FDK A;  2ZX3 A;  5FPV A;  1W9S A;  2FDH A;  2LM3 A;  1YQ2 A;  3KSC A;  1DYO A;  1YXW A;  4BM8 A;  5A32 A;  1FOD 2;  2VPV A;  1IGO A;  3AZZ A;  3GDB A;  4JZR A;  4DNY A;  1JZ4 A;  4RFT 0;  1CWP A;  1CAX A;  3AZY A;  3THT A;  4CUC A;  2BV4 A;  5E16 A;  5FBZ A;  1UY3 A;  1F4H A;  2GC0 A;  3IKW A;  3VBR B;  2BER A;  3VKL A;  1GWK A;  3OBA A;  4ATE A;  4QHO A;  4NO4 A;  1HV0 A;  1H0B A;  3MW3 A;  4XFC A;  4IND A;  1U5I A;  5KWR A;  5FPZ A;  2WAO A;  2RS5 2;  2XLA A;  2GP3 A;  2Q1Z B;  4L9B A;  1ULE A;  4RGA A;  2EF6 A;  1YUD A;  4BQX A;  4C1W A;  3JB4 C;  1SPP A;  2WAA A;  1S0J A;  2E26 A;  2UYA A;  1FMD 1;  3GBG A;  3VBF B;  4LBQ D;  5CFC A;  1IKQ A;  5A33 B;  3BTX A;  5I91 A;  1QOO A;  1GMM A;  1S55 A;  2LS6 A;  4PBP A;  2JG9 A;  3TEY A;  3S7I A;  4K8F A;  4Z92 B;  1AYN 1;  4J6G A;  3AP4 A;  3WDX A;  4ISR A;  3VBS A;  1PIV 3;  2WZP P;  5ISL A;  3CJI C;  2E51 A;  3N7M A;  4OHV A;  4GUL A;  4DO0 A;  4COW A;  2WS9 3;  2D5H A;  1Q8S A;  2GC2 A;  2P3I A;  3FJS A;  3T2O A;  4IE7 A;  2PXJ A;  3ZSJ A;  2XJS A;  4Y1Z A;  3ITQ A;  5DDJ 1;  1GP4 A;  1D2S A;  1OQE A;  3J7H A;  3NL1 A;  4BPZ A;  5JOY A;  5HCH A;  3T0B A;  5FYT A;  1RUH 2;  1BCX A;  2GC3 A;  3BU0 A;  5C8C C;  4HZF A;  1DU3 D;  5J96 B;  4CSW A;  3HQR A;  3VKO A;  2HYK A;  1X82 A;  4NHM A;  1CZT A;  5GZF A;  3X29 B;  4YZ2 A;  2YU2 A;  1ZZ7 A;  1ODM A;  3TBD A;  2Q0A A;  2JE8 A;  3PUR A;  1PO1 2;  2TUN A;  4WVM B;  1NOV A;  1QNY A;  4PI2 A;  4J25 A;  5BY5 A;  3K77 A;  1H8T B;  3AZV A;  1POV 3;  1K45 A;  5CU1 A;  4D94 A;  5JXJ A;  4Q4X 2;  3R05 A;  4QDS A;  4XZU G;  2QQN A;  2EIG A;  4KU8 A;  5KXB A;  3QAC A;  3T0A A;  4DXZ A;  1NG0 A;  1O3S A;  1W39 A;  1GOH A;  1NLR A;  5FUN A;  4Z82 A;  3VZL A;  4QWN A;  2QQP A;  2Q8D A;  1U0A A;  4ZXE A;  1AR9 2;  1V9U 1;  4F83 A;  1SZB A;  1GQP A;  2HEW F;  3TEX A;  3WW3 A;  1XOY A;  1XRU A;  3JZV A;  1HRV 1;  3NNJ A;  4LXL A;  2DFC A;  5FMO S;  1SG3 A;  1VLN A;  2LRO A;  4GAL A;  5GLW A;  4DOU A;  3O14 A;  4JV4 A;  4MLO A;  2YZ4 A;  2W1Q A;  3ECQ A;  2W2I A;  2FZ1 A;  1YFY A;  4X8P A;  5EYY A;  3I3B A;  4JDM A;  4HKW A;  4AQT A;  2XKO A;  1BVV A;  3T09 A;  2VOK A;  5T5P A;  1F35 A;  1MS8 A;  1UMI A;  4IEX A;  4YW4 A;  2VZR A;  4N9I A;  3CJI A;  1M4W A;  3T30 A;  1AJO A;  1HRI 2;  2RM2 3;  4QDQ A;  2VZV A;  2Z69 A;  2C9A A;  2K0G A;  5I0U A;  1AXZ A;  3NW4 A;  2CGN A;  1ENS A;  1R08 3;  1FNY A;  1FXZ A;  4MZU A;  4Q29 A;  1UY0 A;  1Z7S 3;  3AFK A;  1R1A 1;  4BIF A;  5C8C A;  5IVV A;  1NUK A;  2E32 A;  1AR8 2;  5CBL A;  2ZAB A;  4FXK B;  1O6U A;  4XE9 A;  4QKN A;  5DG2 A;  4AEM A;  5FUP A;  5J48 A;  1C8M 2;  4G9S B;  1EYB A;  1LED A;  2YFU A;  2DVD A;  1CJD A;  4Q0U A;  4TLG A;  4IDZ A;  2VTF A;  1CES A;  3E5X A;  4KGG A;  4LBJ A;  5BNO C;  4K6B A;  1X8E A;  1XXN A;  5DDJ 2;  1WBL A;  3BIW E;  1WCS A;  2GAL A;  2EIE A;  3ENR A;  4YZ5 A;  1N1T A;  5JCT A;  4W8J A;  1W8U A;  3KS7 A;  2HEY F;  3FLP A;  4DFS A;  3RS6 A;  5J7M A;  2FDG A;  5EP9 A;  3QD6 A;  4IE4 A;  4J1X A;  1LOD A;  2ZHN A;  3WNN A;  2GH2 A;  2J1U A;  2E7Q A;  1DYP A;  2KD7 A;  4I09 A;  4I2O A;  2WRA A;  4O65 A;  1DQ0 A;  2R1B A;  4R4Z A;  5L73 A;  2UUR A;  2XHK A;  3B7M A;  4A41 A;  1DQ5 A;  2G9F A;  1NZI A;  4YGD A;  2YYO A;  4LA3 A;  1B09 A;  1W9Y A;  1C1L A;  3BOP A;  4YZ3 A;  2DCK A;  4AVS A;  2P6H A;  2ZX4 A;  4I0A A;  4LUL A;  4XFF A;  5T55 A;  1OMI A;  3VKF C;  1FYU A;  4UI9 L;  2G9G A;  3OB8 A;  2NMO A;  2XHN A;  3SNM A;  3VDB A;  2XOM A;  3WF1 A;  2W47 A;  3FN9 A;  3VGI A;  3PU8 A;  1OF3 A;  3NV4 A;  1MS3 A;  1R09 3;  5KHG A;  1EPZ A;  1UOF A;  1LNS A;  1HDK A;  2Q1F A;  1SLC A;  1Y3T A;  1E5R A;  5F3E A;  5CYY A;  4ZS3 A;  5A32 B;  2F17 A;  5JDB A;  3T1M A;  1O8P A;  4FPG A;  1CAX B;  1NT0 A;  4WVZ A;  2W1S A;  4E4S A;  1JYI A;  1UYP A;  3M70 A;  1R1Z A;  2CTV A;  3LFM A;  2R04 2;  1ULP A;  2EAL A;  5A3T A;  5CKM A;  1TNF A;  5IVE A;  2HWD 1;  2WKK A;  4FFF A;  4QGL A;  2W5F A;  3ZX7 A;  2Y34 A;  4XFG A;  1LAJ A;  3N36 A;  3N9Q A;  1DLL A;  5FZ7 A;  1X9P A;  2DU1 A;  5FOJ B;  1GNH A;  1JYN A;  1FPN 2;  2D3P A;  4HOO A;  1E57 A;  4Q0P A;  3U10 A;  2E53 A;  1SPP B;  1A3K A;  2YBK A;  4XFA A;  5ABJ B;  4MV2 A;  3MHZ A;  2JG9 B;  2ZGL A;  1CR7 A;  3LDB A;  3OD4 A;  2YUE A;  4CCD A;  3NNG A;  1QH7 A;  2BP6 A;  4N53 C;  2VXJ A;  4BXS V;  2VMF A;  2R06 1;  3VBS B;  3GZT B;  2WBK A;  4PHZ A;  3OG2 A;  5CG9 A;  3ZPY A;  1YCI A;  5KC5 A;  4OUS A;  1NE4 A;  5TSW A;  2JIG A;  4XDQ A;  4F7Z A;  2WNO A;  4IV3 A;  2ZBJ A;  3BKZ A;  1PX4 A;  3PME A;  5FOB B;  5CFD B;  4BHP A;  4XHB A;  1RMU 2;  3WR0 A;  4UFI A;  1TME 2;  3AZX A;  1U5X A;  2A70 A;  1XPW A;  4RHV 3;  2CNA A;  4LR4 A;  5EJ1 B;  5I8S A;  1D4M 1;  2W87 A;  4TN7 A;  4UW4 A;  1RUH 3;  2HJI A;  1NCR C;  1RVF 2;  2ZZQ A;  2CYF A;  1ALY A;  1XQN A;  4Y33 A;  4DEQ A;  4TXW A;  2KR2 A;  3WF2 A;  1AYM 3;  4E8D A;  1RUC 3;  1X33 A;  2X8K A;  1PO1 3;  3ETP A;  2HWF 3;  5JLV A;  2JWP A;  4YM3 A;  1RHI 2;  2NYY A;  3VBH C;  3ES4 A;  4PDW C;  3FUQ A;  3WIN E;  2FBE A;  5F5I A;  3PUH A;  4Q4X 3;  3DL3 A;  3AYC A;  1QF3 A;  3AFG A;  4XF3 A;  5FZD A;  5HPO A;  3D0S A;  3TNP B;  2JD4 A;  2WA4 A;  3LEI A;  5CIR A;  1SLT A;  3H8R A;  5DQ0 A;  1K3I A;  1L7R A;  4CCJ A;  4LE4 A;  4FAG A;  1JYV A;  2VOX A;  4COZ A;  3J7N A;  4MSV A;  2PN5 A;  1JOP A;  2DVA A;  3GZE A;  5JSO A;  4JTO A;  3MEP A;  3HVD A;  5LRR A;  1RIT A;  1C57 A;  4AYU A;  4QDR A;  4MX3 A;  3DPR C;  3CJI B;  2P5B A;  1AXY A;  2ADD A;  4FPL A;  4SBV A;  2A3W A;  4KH9 A;  3AVS A;  4YLZ A;  1ULO A;  2D43 A;  1ZNP A;  4QKF A;  1KJL A;  1RJ7 A;  2P2K A;  3Q8F A;  4MAD A;  4HON A;  5FPL A;  1VBB 2;  4M01 A;  2FZ2 A;  1N1Y A;  4XJA A;  5C8C B;  1FV2 A;  2KA3 A;  3W20 A;  4JAA A;  4CPB D;  1GYK A;  2VQU A;  2X05 A;  4XAC A;  2IXL A;  5FY8 A;  2WZR 1;  1MEC 2;  5GZD A;  3U07 A;  3I4I A;  1JOB A;  4TSV A;  5A7N A;  2FCU A;  1C8N A;  4NHL A;  5FP4 A;  5L9R A;  1AR8 3;  3ROU A;  4AAP A;  2YDE A;  3VBU B;  4P9L A;  1W9T A;  4QB6 A;  1DGW X;  4PIX A;  3ACL A;  4QPI A;  1UF2 C;  2OQ6 A;  4Q0V A;  1AR7 3;  2JEM A;  2RS1 1;  4XBN A;  5DAB A;  4URA A;  5EJZ B;  1W8Z A;  2GDF A;  5F2S A;  1JMU B;  2JDK A;  3VBH A;  3MIH A;  3ZYB A;  4PDW A;  3ALQ A;  3SQO A;  2P3Y A;  4DXS A;  1PMJ X;  1DQ4 A;  1W06 A;  4K1Z A;  2BBA A;  3LA3 A;  1JZ5 A;  4QQP A;  1H2L A;  1KGY A;  3CQO A;  4Q4V 1;  3JXS A;  4P9W A;  3S30 A;  1S0D A;  4M4R A;  2ZTN A;  1IPK A;  3TYJ A;  4UWD A;  3WW4 A;  3UKV A;  3VDD B;  4N9H A;  4LO7 A;  5DAW A;  2QDN A;  2GMP A;  3MF9 A;  5FMD A;  4KWK A;  3MYX A;  3WSO A;  2Y6F A;  5FQ0 A;  2VW0 A;  2ENR A;  2FHR A;  4RD7 A;  1NYW A;  4YVW A;  3ZXF A;  3EMR A;  2HH9 A;  3CBN A;  1Q8O A;  4KL1 A;  3DPR A;  4XOG A;  2ARC A;  4NPR A;  2ZGT A;  3WX5 A;  3MLL A;  5GLT A;  4AZZ A;  4CEW C;  3R4D B;  3HAG A;  4FOV A;  2E31 A;  2VH9 A;  2CY6 A;  1UXX X;  3E1F 1;  1LCL A;  5CA6 A;  5M0T A;  1RJ8 A;  1QQP 2;  2RMU 1;  3MW2 A;  1JYW A;  1GOF A;  3KF3 A;  1QKQ A;  2Y60 A;  3I97 A;  3ZMO A;  3ZSL A;  1QJY 2;  2XR4 A;  4LOS A;  5FWE A;  1HB4 A;  1BEV 1;  3NVC A;  4PLN A;  2P1B A;  1AR6 3;  2IZW A;  1IZ3 A;  3APB A;  4G3Y C;  5CKQ A;  2V4V A;  2D7F A;  5J98 B;  2UU8 A;  4IEO A;  3VZJ A;  2QQI A;  4NN0 A;  3RZL A;  3LA2 A;  2ARE A;  2ET7 A;  1JN2 P;  1KRI A;  3JB8 A;  4YWA A;  2VU9 A;  4ES8 A;  5FYB A;  4W6W A;  1RUE 2;  4E4D X;  3CDZ B;  4BCU A;  2WZ8 A;  1GIC A;  2EXH A;  2FCV A;  5I0R A;  5GJ6 A;  2VEC A;  2ET1 A;  1JUI A;  4HLT A;  2ZHL A;  4LLO A;  4ASL A;  3LE0 A;  5LBB A;  3RRD A;  1HJF A;  2OPW A;  1FPN 3;  1RUG 2;  1W6O A;  3JBG 1;  3UGG A;  4NAM A;  1CIW A;  4YW1 A;  4K40 A;  3RVH A;  5C3O A;  2OII A;  2QQV A;  4NPM A;  1OFS A;  4AFA A;  2VNG A;  3WVJ A;  2VJX A;  5KHI A;  1JHN A;  3J8F 2;  4BQ3 A;  4BME A;  3RNS A;  1K12 A;  2UY9 A;  3LAG A;  2QJV A;  2RHP A;  4IV3 B;  3SEP A;  3I2H A;  3OOX A;  4JCK A;  2Y0O A;  5IAT A;  1UKG A;  3MIC A;  1V6N A;  4BH9 A;  1HQL A;  3QLQ A;  1YJK A;  4A7Z A;  3PUI A;  4DIN B;  1W0O A;  1VBE 2;  4BLI A;  5FUI A;  4C0B A;  3O1T A;  1Q5O A;  3HD8 B;  3OBZ A;  5K0U A;  3BTY A;  1CAV A;  1YIP A;  4ASM B;  4Q4W 2;  5A6Y A;  1ZYB A;  5FZ1 A;  1W6P A;  2FCT A;  2OKX A;  3IMN A;  1NA1 A;  1PO2 2;  1JOD A;  1RMU 3;  4FI9 A;  1JTZ X;  3RDI A;  2UWC A;  3MIE A;  3K51 A;  3OY8 A;  5FFO C;  3HNB M;  3VBR C;  2A6Y A;  5C4W C;  2RS3 2;  2A5Z A;  4ERO A;  1TG7 A;  1ZZB A;  2O1Q A;  2VAU A;  4JDO A;  2VMI A;  1W9W A;  4XXA A;  1YYN A;  3VL8 A;  5LA0 A;  1MQT C;  2XKP A;  4CUB A;  2B7Y A;  2PAK A;  3HMY A;  4QGN A;  4XJU A;  1F2N A;  5EWS A;  3ZXD A;  1CX1 A;  1BYH A;  4K9S A;  1Q56 A;  3A4U A;  3H1W A;  1ULC A;  4ARY A;  5C6C A;  3KD4 A;  3VBF C;  2MEV 2;  3KGZ A;  4XW3 A;  2A73 B;  3HQX A;  3HT2 A;  5FY4 A;  4I3P A;  1WGP A;  2ZEY A;  3LB9 A;  3OGJ A;  1JBC A;  1W2T A;  5FRE A;  1POV 1;  4A42 A;  3D0J A;  4M00 A;  3HIF A;  2WLQ A;  2XJQ A;  4XAB A;  2XBO 3;  4IES A;  4CA9 A;  1QXR A;  1ZZ9 A;  4CDQ B;  1LR5 A;  4YW5 A;  3KQ4 B;  1U5Y A;  4Q4Y 2;  5EJ3 A;  4QX5 A;  5JZG B;  3M3Q A;  1MS1 A;  3V0B A;  1OUR A;  4GB3 3;  4LHK A;  3THD A;  1YNA A;  3VKN A;  4LKE A;  1RTV A;  4OVE A;  1UW8 A;  5FDB A;  5A7O A;  1MPX A;  2OVU A;  4W6Y A;  3RYP A;  4P9Y A;  2VNO A;  4AVT A;  1WKY A;  5C3S A;  1UPI A;  1V6M A;  3N7L A;  4EE2 A;  1VBB 3;  2WWJ A;  3FL7 A;  3E5U A;  3LOI A;  1ST8 A;  4BU2 A;  3W21 A;  4E2S A;  5JXI A;  1QDO A;  1TVG A;  4GWI A;  1S4C A;  2WT1 A;  4RA0 A;  1HX6 A;  4QPI B;  1MEC 3;  3VD9 A;  5C4W A;  1AL0 G;  1TEI A;  3C7E A;  1H6X A;  4NRP A;  2YPD A;  3WOG A;  2R7E B;  3MUY 1;  1R08 1;  3KV4 A;  2P3J A;  1JXN A;  1O7F A;  2OS2 A;  3ZYJ B;  1F5F A;  4A7Y A;  1MQT A;  3O1P A;  5AC9 1;  4IGO A;  3ST7 A;  4XET A;  4AEK A;  1W03 A;  2FMD A;  1ASJ 1;  3AVR A;  3POB A;  1UZ0 A;  2JXA A;  5LBE A;  4KWL A;  3P1I A;  3PTY A;  3WHU A;  2N7G A;  5IFP A;  3PVO A;  3TEW A;  1KDM A;  4XMI A;  5A33 A;  1PIV 2;  1HB1 A;  3N9N A;  3TWI A;  1PGL 2;  3WF3 A;  5T5O A;  4ARX A;  4UW5 A;  1JU3 A;  2A3Y A;  2DUR A;  5FQ0 B;  3I3M A;  2WS9 2;  4XPV A;  4YVW B;  2E33 A;  4M3C F;  4UAP A;  2MNG A;  2JJ6 A;  4OYU A;  4B4R A;  4FQZ A;  4BMB A;  1Q8P A;  1S2E A;  1AL2 3;  4ZU4 A;  1V6I A;  3U11 A;  1YQC A;  1Y4W A;  2XQR A;  3III A;  4CP0 A;  1QJU 3;  1XSR A;  2PMW B;  2ES3 A;  1E5H A;  4NIG A;  2GNT A;  4OHX A;  4AI2 A;  4D7Y A;  1J3R A;  1O4Y A;  1HB2 A;  1OVP A;  4MYE A;  4PQQ A;  5FAX A;  4NMI A;  4MUV A;  5L9B A;  4ZU7 A;  2B8M A;  4HVQ A;  2ZGR A;  3RZK A;  1PVC 2;  1SCS A;  1T6G C;  1DZR A;  4AHZ A;  4XZP A;  2VMD A;  4MHR A;  3JUU A;  1W9F A;  3NV1 A;  3WDU A;  1AX0 A;  2DVB A;  2ZGK A;  4FPE A;  1DFQ A;  1YC6 1;  4LKS A;  2HWC 3;  3T1L A;  2IXH A;  4FBF A;  2ZKN A;  3J4U H;  5DAX A;  1XYP A;  1R64 A;  2VUD A;  1RUD 3;  3LGR A;  4XIL A;  4C8D A;  4LPL A;  4FSJ A;  3LIH A;  2HKX A;  3V56 A;  2BOI A;  4Y5T A;  5EIY B;  4HVR A;  4WBB A;  3S5Q A;  2VTX A;  4C1X A;  3OUH A;  2PLV 1;  1RUE 3;  5H9S A;  3DEC A;  1AHS A;  3IAP A;  1FV3 A;  2JDU A;  5FK8 A;  4A6O A;  5EYX A;  3UV9 A;  2ZXQ A;  1H9W A;  3MPB A;  1W6O B;  4KU7 A;  4NID A;  1GZC A;  3WUC A;  3BN6 A;  1UIK A;  3HJR A;  3DF0 A;  2LTN A;  2RM2 2;  2XLF A;  3SC7 X;  5FO8 B;  3I54 A;  1ZBE 3;  1FOD 1;  1JOJ A;  1RUG 3;  1SHW B;  2G19 A;  5DMY A;  2DUO A;  3PIG A;  5C3R A;  4RQP C;  3M1H A;  5FZM A;  3GM8 A;  2P6C A;  4XQW A;  1C5H A;  1SAC A;  2W95 A;  3ETQ A;  3VD5 A;  2AEZ A;  4R9A A;  4FPO B;  4S2G A;  1Z7S 2;  1FAT A;  2LRP A;  3J8F 3;  4YG6 A;  1LHO A;  3J7L A;  5IUQ A;  1WW5 A;  1G9D A;  4C0H A;  4CVU A;  1UYX A;  3EQE A;  2B4K A;  4MOA A;  1S0E A;  4FOQ A;  3FHA A;  1UL9 A;  3A0K A;  4HFS A;  4KQ7 A;  1OA2 A;  5K4L A;  3F2Z A;  4XIK A;  1CAV B;  3RMX A;  3VZO A;  1UZW A;  5K0U B;  2VVF A;  1NA1 B;  1I3H A;  2XB6 C;  3KV9 A;  2BNO A;  4EN6 B;  1B35 A;  1C1F A;  3CJX A;  2D97 A;  4OMD A;  1NLQ A;  2ETE A;  2VZ3 A;  4QB1 A;  4Q4W 3;  4YAR A;  1GKB A;  2BWA A;  3JU9 A;  3OY8 B;  3POG A;  3PVB B;  3J26 N;  1RIN A;  5FPB A;  2C26 A;  4HKL A;  1CZV A;  2XGX A;  1MS0 A;  2WAB A;  2WNE A;  1ZX5 A;  2VZO A;  4LUM A;  1WLW A;  3CF6 E;  1YRZ A;  4Y22 A;  5I8T A;  3ZKU A;  5CIS A;  4XDO A;  2RS3 3;  4IGP A;  4ZKT B;  2UWA A;  3WQ0 A;  1S0G A;  1UWW A;  4P00 B;  3E97 A;  3CU7 A;  2SLI A;  1HN1 A;  3H9A A;  5ABJ C;  2BPA 2;  1DHK B;  4RYD A;  1RUH 1;  3PNA A;  3KCY A;  3IDA A;  3S57 A;  3AJY A;  2MEV 3;  4QX7 A;  2YRO A;  5AFB A;  1BXH A;  3VBS C;  1LEN A;  4GWM A;  4XJ8 A;  1PO1 1;  4R9B A;  2PHD A;  1TMF 3;  4XC9 A;  4QPG A;  1C3H A;  3O7O A;  1HN0 A;  3OD0 A;  2YPJ A;  1X36 A;  4Q4X 1;  4RQP A;  3ZMN A;  4NIA A;  4X8N A;  4TYS A;  4DUV A;  4COV A;  2AR6 A;  4D69 A;  1R09 2;  2J1V A;  4KG0 A;  4LKF A;  3V0B B;  5CFD C;  1U12 A;  2VMC A;  2WT0 A;  1V0A A;  3GBF A;  4QXB A;  4UFL A;  3FHQ A;  4LIV A;  5LZ6 A;  1VBA 3;  3O12 A;  2WII B;  1S0C A;  3AC0 A;  4IE5 A;  4LOT A;  4AAX A;  4Z8B A;  4WVW A;  2QZ2 A;  5FZB A;  2DCZ A;  5F8P A;  1L7L A;  5SV8 A;  1GV9 A;  2JDP A;  5E89 A;  4K1Y A;  3AMM A;  5FTT C;  5LK5 A;  5E88 A;  3VL9 A;  2AH2 A;  1QJE A;  4ZZ8 A;  5C4W B;  2CGO A;  3AP5 A;  2J1E A;  3LPG A;  4XFB A;  3WW2 A;  2ZX0 A;  4D6S A;  5DUW A;  1GP5 A;  1HRI 1;  1MQT B;  2QUO A;  2Y6G A;  4TLF A;  4BWO A;  3K4A A;  5IJR A;  2TBV A;  1UU6 A;  5FYS A;  4BQ1 A;  2XG3 A;  3HN3 A;  1I5P A;  1VE0 A;  4Y20 A;  2R6Q A;  3EHK A;  4EYU A;  1GZT A;  2CU5 A;  3L2H A;  1O4Z A;  5ABJ A;  1OOP A;  1D0H A;  2VNR A;  1AR8 1;  3OBT A;  4EN8 B;  1NXD 1;  5C8W A;  5FYI A;  1J1T A;  3H1Y A;  1DCS A;  1H2N A;  5F3G A;  3RZJ A;  1C8M 1;  1AJK A;  1COV 3;  4WM7 B;  1VBC 3;  5JWP A;  1JYC A;  2HWB 3;  4CXW A;  4Y1U A;  1WA6 X;  2JG8 A;  1OXC A;  2JB4 A;  3IMM A;  3NNM A;  5FZ6 A;  2P34 A;  2QE3 A;  2W68 A;  4AQ2 A;  4GMP 1;  4CP9 B;  4AED A;  3R0R A;  2BFU S;  3D6E A;  3GF6 A;  3MV0 1;  4L0P A;  4RHV 2;  3N4M A;  2OUH A;  4HSJ A;  1OLM E;  2V73 A;  5CFD A;  2IXK A;  2WC2 A;  5FK7 A;  1XU2 A;  1CIY A;  4Q0Q A;  2DTW A;  1W8O A;  3ES1 A;  3T4H B;  2Q5T A;  5C71 A;  4MG2 A;  1AYM 2;  1RUC 2;  1F15 A;  3GNE A;  4H7M A;  4BK5 A;  2HWF 2;  1PM4 A;  1YI9 A;  2XJV A;  2XL9 A;  2ZA9 A;  1W6M A;  3AL5 A;  4L97 A;  5FV3 A;  3IWZ A;  3VBU C;  3LIG A;  1PVC 3;  5F2W A;  1JYT A;  3V64 A;  2RR1 3;  1ZZC A;  4S2F A;  5DXD A;  2DF7 A;  4ZHN A;  2VW2 A;  3AX4 A;  1VIW B;  1VBD 3;  5F5Q A;  4YPJ A;  3FZ3 A;  3VZN A;  4A2U A;  1XND A;  4DPN A;  5DUV A;  3KCC A;  2J1R A;  3V65 A;  2HBT A;  5FIX A;  4AGG A;  3VDD C;  4D7T A;  4XAE A;  5F39 A;  1JZ3 A;  2X10 A;  2TEP A;  2XPJ A;  3T2T A;  1W2O A;  3W5M A;  3ZXL A;  3LD8 A;  1OA3 A;  4XF4 A;  1WWY A;  3KQR A;  2JE7 A;  1EAH 3;  1QNW A;  2PQS A;  3AB0 A;  2XVK A;  1OD5 A;  1LOA A;  2DWR A;  2R04 1;  4P9I A;  4PJY A;  2VCC A;  1US3 A;  4XHX A;  2H6B A;  3U1X A;  1OQD A;  4G4F A;  2JE9 A;  3ACI A;  5C70 A;  2AC1 A;  1JH5 A;  3RI9 A;  2PHL A;  2OA2 A;  3MPP G;  4AL9 A;  5A7S A;  2PHX A;  4LUK A;  3HPN A;  1GR3 A;  2ILM A;  4KWU A;  3INA A;  1FPN 1;  1BVP 1;  1QJF A;  2WO1 A;  5FZ3 A;  4YSF A;  4FPF A;  1I5Z A;  4PIZ A;  4UF0 A;  5L9V A;  3KT1 A;  2V5D A;  1LHN A;  3UGF A;  3OJB A;  2OQ7 A;  1UXZ A;  1B35 B;  1W3V A;  1K5J A;  2AYH A;  3RI8 A;  3WNL A;  1AR7 2;  2XUE A;  2JIJ A;  2V72 A;  3IIA A;  4IET A;  5IVY A;  1ZZ8 A;  3O1S A;  2ERF A;  4YGE A;  3OCP A;  3VBU A;  1CGP A;  3CIH A;  2W94 A;  4JKM A;  1JZ2 A;  1QY4 A;  2YY1 A;  1UYZ A;  2IVJ A;  2WA3 A;  4Y22 B;  1DGR N;  2B9V A;  4YW3 A;  5L19 A;  5JSR A;  2A6V A;  2ZCW A;  4W65 A;  2FDF A;  2Q8O A;  5KHK A;  4UT5 A;  3KVB A;  3NNF A;  1UY4 A;  4QMA A;  3AMN A;  1MZE A;  4CDW C;  3RSJ A;  1RMU 1;  1TME 1;  2EXJ A;  2X5I B;  2CGP A;  2Y6J A;  1AXK A;  3J9S A;  4KWJ A;  3KCX A;  3VDD A;  4OI1 A;  2ZGN A;  3WUD A;  4CU7 A;  2NM1 A;  2BDR A;  2QDR A;  3M3I A;  3C7G A;  2A6W A;  1FNZ A;  1LHW A;  5F9T A;  1RVF 1;  3W58 A;  2IC1 A;  4FPH A;  5IYY A;  4QPG B;  2ZHM A;  2Y0I A;  5KHH A;  1J58 A;  1LHU A;  4EQV A;  4HK8 A;  3WG2 A;  3PMS A;  1H8V A;  1NX9 A;  2WJS A;  4RQP B;  4IV3 C;  3USS A;  4JC1 A;  2WO7 A;  2WFF 2;  3B9I A;  2HWE 3;  4Y3O A;  1RHI 1;  4X6Q B;  3MID A;  2PHF A;  2VD7 A;  2JIC A;  2BWC A;  2GN3 A;  3WDV A;  5H9P A;  1AR6 2;  4UFM A;  3ZM8 A;  1MAC A;  2HEV F;  1LHV A;  1OC1 A;  3PTR B;  3WT3 A;  5A6Q A;  3U75 A;  2I07 B;  3T2Q A;  1RGS A;  5A3U A;  1S2B A;  4J1W A;  1N1V A;  1EPW A;  3DUI A;  3OGG A;  1RXF A;  4ZS2 A;  3W59 A;  4AFB A;  2W1U A;  4QB2 A;  2WL1 A;  4JKL A;  1W8F A;  3O0W A;  1CZS A;  2R49 A;  4P08 A;  5DN2 A;  5C3Q A;  1HB3 A;  4LT5 A;  4KMQ A;  1X9T A;  3O0V A;  3ZXA C;  3D8C A;  5FLJ A;  3ZDS A;  1NXM A;  3NJZ A;  3AKT A;  5IFT A;  2CHH A;  1IHM A;  2ORX A;  2CWS A;  1UCX A;  3PU3 A;  4Y20 B;  4AOC A;  1UOB A;  4N7U A;  2DVF A;  4NII A;  3AXD A;  1TNR A;  2BNN A;  4XF9 A;  1K42 A;  1C5I A;  3GJA A;  1OOP B;  1VBB 1;  1D7P M;  4CDW A;  2AEN A;  2B42 B;  2IXI A;  3LOB A;  5A3P A;  2VUA A;  3OYW A;  3BOD A;  1S0I A;  3U14 A;  3UT0 A;  1MEC 1;  1UU5 A;  1N3O A;  4JQT A;  2TNF A;  3RYK A;  4NIH A;  4XUT A;  5FZC A;  2JG8 B;  1DYK A;  4IE6 A;  4R9C A;  4XQ4 A;  5A7P A;  5T5L A;  4CDQ C;  2J1T A;  2E7T A;  1KJR A;  3FMG A;  3LCP A;  3PVE A;  4RR3 A;  3UK9 A;  1W2N A;  4AED B;  4BZ4 A;  1T6B X;  5K7P A;  3S5A A;  1YWK A;  1AUY A;  1CX4 A;  1O91 A;  5JR7 B;  1POQ A;  4QXK A;  4YYO A;  5JZG C;  1KIT A;  1RIR A;  4K3U A;  5ANN A;  2DDU A;  2GU9 A;  3TEZ A;  1CAU B;  1WD4 A;  2RDQ A;  3WDY A;  3GHM A;  5BYN A;  1UNB A;  3Q8A A;  3NJY A;  1G9F A;  4DUW A;  5ERL A;  1YFX A;  1BK1 A;  1HKD A;  3KT7 A;  3LKJ A;  5IK4 A;  3A21 A;  3VD3 A;  4F8A A;  2GNB A;  3RYR A;  2ZEZ A;  5AVP A;  2A71 A;  3WG4 A;  4YVS B;  3MIB A;  1W6M B;  2Z2S B;  2XL7 A;  1OH3 A;  3FHI B;  1DGW A;  1UO9 A;  4QPI C;  3P3P A;  2YGM A;  4JGZ C;  2WIN B;  5LY1 A;  1DLC A;  3U4S A;  3E6D A;  3LEK A;  1BZW A;  4XJ9 A;  5LW9 A;  2ARA A;  2CAU A;  4ZXK A;  2D6L X;  4URT A;  1PMH X;  4N43 C;  3UYJ A;  1WW6 A;  3GZA A;  1O4T A;  1UY1 A;  2FMY A;  2KXL A;  1QQP 1;  1I6X A;  4DIQ A;  4OFG A;  5SV5 A;  4Y5Z 0;  5FMB A;  2XBO 2;  2LUW A;  3O1O A;  1UOJ A;  5FZI A;  4YNI A;  3WLU A;  2C9K A;  1QJY 1;  3ILR A;  4YVW C;  5LB6 A;  3ZYH A;  4B29 A;  2ID4 A;  5C7G A;  3BB6 A;  4DXT A;  2VOV A;  4CDQ A;  3SH4 A;  4RN5 A;  5DAP A;  1NLS A;  4XUN A;  4GB3 2;  4QX8 A;  1QJZ A;  3ZIX A;  4LNV A;  5FZK A;  3AL6 A;  4Z07 A;  5JPN B;  4DXR A;  1RUE 1;  5F1R A;  1H6Y A;  5JZG A;  4CP2 A;  3CL1 A;  1S0F A;  1YQ8 A;  5GLV A;  4W50 A;  3CZU A;  2D6P A;  4I02 A;  2C1F A;  1C28 A;  4FQ4 A;  1RUJ 3;  1O59 A;  1GU3 A;  4UF0 B;  1F31 A;  3I2D A;  4LBN A;  3D4K A;  4UFK A;  4NHX A;  3Q8E A;  1DBN A;  1G9C A;  1RUG 1;  4DZG A;  2VZ1 A;  3POE A;  3ZFG A;  1NCQ A;  5LBF A;  3ZFF C;  1SLI A;  4IEY A;  4IEV A;  3WQ1 A;  1F4A A;  2GNM A;  4JGZ A;  3J8F 1;  2X53 S;  3AZW A;  1WCD J;  4AR2 A;  2J1S A;  4ZU5 A;  2DTY A;  2YU1 A;  4LJH A;  1Y9M A;  2BRT A;  2QQW A;  1OKQ A;  1CPN A;  4B3N A;  4N43 A;  1VRH 2;  3WNM A;  3DKW A;  1VBE 1;  4LO5 B;  5GLZ A;  2L9L A;  4Q4W 1;  4Y1Y A;  5BNP A;  5A70 A;  4ZPI A;  3WNO A;  1AYN 3;  1LOB A;  1PO2 1;  1BK0 A;  1PVX A;  2RJ2 A;  2QCS B;  3EXU A;  1AL2 2;  3K3N A;  4LA2 A;  3K4D A;  4BQY A;  4BQ4 A;  1ND2 B;  1QJU 2;  3KV6 A;  5FZ0 A;  4JRA A;  3T2P A;  1W8H A;  3SIS A;  3ZSM A;  4HN1 A;  2RS3 1;  3HWJ A;  3ZSK A;  4QT6 A;  1UMZ A;  1DGL A;  3IBM A;  3TB0 A;  2DBN A;  3VLB B;  4EZ4 A;  1RYY A;  3ZLI A;  1GQG A;  3TN9 2;  5FYC A;  1H2K A;  3NJX A;  1QIQ A;  1UYY A;  2WFF 3;  5K0U C;  1VAM A;  1UZZ A;  5JI9 A;  1G8W A;  2HBU A;  3H42 B;  3SIT A;  1NA1 C;  2MEV 1;  2HWC 2;  4AW7 A;  2GME A;  4PF5 A;  2W0X A;  2XJP A;  3N9O A;  4LBQ A;  4QX3 A;  4RGK A;  1H1M A;  3QOP A;  2VM9 A;  4XCB A;  4XTM A;  3POY A;  5B2G B;  2VBB A;  4GD4 A;  1RUD 2;  2I2S A;  4COU A;  3VV1 A;  3ZFF A;  2Z5W A;  1F9K A;  2EIC A;  5FCC A;  3ZN6 A;  4M0H A;  4CDU A;  3RZH A;  1ZBA 2;  3IDB B;  5DZF A;  4AI1 A;  1ONA A;  3IDC B;  4XBQ A;  2Z79 A;  1RUI 3;  2B9U A;  4Q4Y 1;  1KEX A;  2OX0 A;  3V0A B;  2VUC A;  2GND A;  4XF1 A;  5JSP A;  1V9U 3;  5DZE A;  3MFC A;  4XVH A;  1S1A A;  1OF4 A;  5LAS A;  1O8S A;  1TE1 B;  3W5N A;  4CDW B;  1ZBE 2;  2DCJ A;  4ZON A;  5K9Y A;  1NZC A;  3ZDV A;  3OYW B;  4CCM A;  2LAL A;  1RB8 G;  1IG3 A;  2R30 A;  3TAY A;  1ZA4 A;  2ZHK A;  3EB7 A;  3HR9 A;  4GWJ A;  4IGQ A;  5F32 A;  4B7E A;  1ACC A;  5ANQ A;  1GOG A;  5HV4 A;  4MVT A;  1W8T A;  4HXC A;  1KFX L;  4QHB A;  4RR3 B;  2GC1 A;  3SH3 A;  3NKT A;  1ZRC A;  2W39 A;  4XUQ A;  1G86 A;  4M0N A;  1WLT A;  3I49 A;  4FT8 A;  1FT9 A;  1HQN A;  3IB3 A;  4YZ1 A;  1UAI A;  3ILN A;  2XJR A;  3H1M A;  1LES A;  1APN A;  3TOJ A;  1COV 1;  1PIV 1;  1O5U A;  4YGB A;  2K46 A;  3G6J B;  1W8N A;  1BLZ A;  1PGL 1;  4GKX A;  3Q8C A;  3MF6 A;  4DY5 A;  5LA1 A;  5A7W B;  2WS9 1;  4HG6 B;  4MO3 M;  1QH6 A;  3AMH A;  3MDP A;  5KR7 A;  2D6K A;  2CL2 A;  3JCI A;  3Q9O A;  4AVC A;  2EXK A;  1E5S A;  3VKM A;  3POJ A;  1DGR A;  4NAO A;  5AVA A;  3WDT A;  5FPU A;  4BJ0 A;  5A1L A;  2W9X A;  1BKZ A;  4AWD A;  2C24 A;  4AGR A;  2W91 A;  2VE1 A;  1W6N A;  3BVC A;  4I30 A;  1RUN A;  2VQT A;  2JEN A;  3EJK A;  1TZO A;  4MXV A;  2PHW A;  3UKT A;  3B01 A;  3OGV A;  4GJY A;  1TMF 2;  1AX1 A;  4B4Q A;  4A4A A;  1XE0 A;  1OLM A;  1OQ1 A;  1PVC 1;  1XB9 A;  1IS5 A;  5EZW A;  1Q3E A;  3H3Z A;  4WM7 C;  4CDX C;  5KXE A;  2P3K A;  2ARX A;  5FZH A;  1MS9 A;  4FPK A;  1JU4 A;  3R4S A;  1LKN A;  4NE9 A;  5FJK A;  5T3N A;  1CPM A;  5CKN A;  4QU2 A;  3HBZ A;  1DQ1 A;  3H3U A;  1VBA 2;  1LU1 A;  2WN3 A;  3N9M A;  2VMG A;  4XAA A;  4ZZ5 A;  3SH5 A;  3BGA A;  4EWE A;  3T4V A;  1MZ6 A;  3U78 A;  4KNC A;  1LUL A;  5FBJ A;  3WP5 A;  4UW3 A;  3ZKY A;  4FOW A;  1J83 A;  5LK7 B;  2QZ3 A;  1LGB A;  1SQ4 A;  3I2I A;  3KZ4 C;  4CZS A;  4D7S A;  2VTX J;  5DAV A;  4YM2 A;  1X7N A;  1GUI A;  5L36 A;  1Y9Q A;  3M3E A;  3PLQ A;  5IWF A;  4AHW A;  1XNT A;  1MZ5 A;  1H1I A;  2H0V A;  1HXS 3;  3I2G A;  3ZFG B;  3AKP A;  3MW4 A;  2RM2 1;  1NCQ B;  1SLL A;  3U0Z A;  3KT4 A;  1DIW A;  4CXX A;  2HWD 3;  4B1L A;  1LOF A;  2W1W A;  3C8X A;  1MS5 A;  2Y64 A;  4JGZ B;  1UPS A;  1WZX A;  4OI2 A;  3ACG A;  4PF1 A;  5T52 A;  3S6P A;  1OLR A;  4YW6 A;  1NY7 2;  5FZO B;  5HXV A;  1VAK A;  2BQP A;  5AFE A;  1O3T A;  4BIO A;  1Z7S 1;  1LOG A;  5GLU A;  3FUO A;  4LK6 A;  4N43 B;  3PL0 A;  1WW7 A;  1YHF A;  2JEC A;  3LF7 A;  3QBQ A;  1W04 A;  1S0B A;  4Y1X A;  1LOE A;  1HJG A;  3LFI A;  4O9G A;  1COV 2;  1SBF A;  3NRU A;  1VBC 2;  4R8H A;  2BW8 A;  2HWB 2;  2XWB B;  2ZML A;  4Y5S A;  5BNP B;  4H14 A;  1VRH 3;  3HQU A;  2XDV A;  1T2X A;  5CAD A;  2QKD A;  2BVB A;  5JI7 A;  2R06 3;  4PCR A;  4QQL A;  4WM7 A;  2O8O A;  2OZJ A;  2SBA A;  4R9D A;  5CB7 A;  4CDX A;  1QJX 2;  3K2O A;  2WLP A;  2RDS A;  1C4R A;  1RL3 A;  1BBT 2;  4CYD A;  4QPW A;  2XQX A;  4CP9 A;  1LGC A;  3CO2 A;  2Q4S A;  2YFZ A;  2XVL A;  4LKD A;  3ELN A;  4Q1R A;  1DG6 A;  1ENQ A;  2VMH A;  3KB5 A;  3ZXG A;  4AGV A;  2VOT A;  5JUV A;  5L7O C;  4KG8 A;  3E6C C;  1W2U A;  1W99 A;  3O0X A;  3ZVX A;  1PNF A;  2ZS6 B;  1KDK A;  1VPH A;  3M7A A;  4NWW A;  3RGB A;  1D4M 3;  1EUU A;  3TN9 3;  1B35 C;  1IQD C;  3A23 A;  2E7A A;  4LBQ B;  4LQR A;  2RR1 2;  3U37 A;  1GFF 2;  5LEJ A;  2BEO A;  2UYB A;  3WEZ A;  1VBD 2;  5JVV A;  3ZFF B;  5FYU A;  1QHD A;  3ZN6 B;  4CDU B;  2R1D A;  3I2K A;  3T08 A;  1YJL A;  1KS5 A;  1OH4 A;  4QPY A;  5E8A A;  1PZ7 A;  2Y33 A;  1IS4 A;  4AFD A;  3FWE A;  1IS6 A;  2F4L A;  3MIG A;  4KBZ A;  3I3D A;  4UXA A;  1BMV 2;  4P9J A;  1ZBA 3;  1R09 1;  1PX3 A;  2ZGP A;  1YO8 A;  3QH7 A;  4P9X A;  2X5I C;  4PT6 A;  4MH0 E;  1EAH 2;  1OLQ A;  4QX2 A;  4BDV B;  3R4U A;  1D4V B;  3WF0 A;  3AYA A;  3IM0 A;  1Q8Q A;  1ND3 A;  3MGU A;  3RJR A;  3EO6 A;  3BPZ A;  4BQ5 A;  2NP0 A;  2Z4F A;  4QPG C;  4UYB A;  2JDM A;  3WQ7 A;  1JUH A;  1UD1 A;  3AK0 A;  3B00 A;  1J3Q A;  2XWJ B;  1Y9G A;  1WBF A;  5C9A C;  3OPZ A;  4WVV A;  2YV8 A;  3JD7 2;  4R4X A;  5A3M A;  2YC2 A;  4Q1P A;  3BTA A;  5EPA A;  4IEW A;  2D93 A;  3POI A;  2PHR A;  3I8T A;  3ZIW A;  3H0O A;  3K46 A;  3AXE A;  1QMJ A;  3ZR5 A;  1L3J A;  2GSY A;  2J7M A;  2IWG B;  2WQ4 A;  5L7O A;  2J22 A;  3POW A;  3N7J A;  4FTB A;  3ZYP A;  2PHT A;  1WMX A;  2WYS A;  3G7D A;  4LLF A;  4WM8 B;  5EHD A;  3SLI A;  2ZOE B;  2AUY A;  5DAQ A;  3K3O A;  4IEZ A;  2DU0 A;  3HOB A;  4HK9 A;  1H1A A;  1PGW 2;  1WUV A;  2VO5 A;  3O5S A;  1V6K A;  3AMQ A;  1PK6 A;  5KXD A;  2D5F A;  2VBD A;  3USU A;  2EAA A;  4Y24 A;  3UKN A;  2ORZ A;  5A6Z A;  2RS1 3;  3C2U A;  5FYZ A;  4EJR A;  1VRB A;  3LEG A;  3H8U A;  3ATG A;  4XBL A;  1ULD A;  1UX6 A;  3SCF A;  4LE3 A;  5A1F A;  4OZO A;  4OZX A;  2RJK A;  2B5H A;  5KXC A;  1REE A;  5E6H A;  3MFA A;  4RHV 1;  1JZ6 A;  2ZGU A;  3WY6 A;  2VUL A;  4BYY A;  1W6N B;  2EAK A;  1BHG A;  2VXR A;  4LK7 A;  1OOP C;  4Q4V 3;  5DZG A;  3WZ1 A;  2X5I A;  3MO4 A;  1WCQ A;  1DP0 A;  4OCT A;  1RXG A;  3DYO A;  3UL2 A;  3P6B A;  5BXX A;  4PQ9 A;  1FAY A;  3ILF A;  4NRO A;  5LAT A;  2OT7 A;  1AYM 1;  4X6R B;  1RUC 1;  1CN1 A;  4B7K A;  1MVQ A;  5IVF A;  2VCA A;  2HWF 1;  2HWE 2;  1AZD A;  2JG8 C;  4Q8L A;  5T54 A;  1VAL A;  5EXO A;  4BOW A;  4IUG A;  3OUI A;  4DRV A;  4E27 A;  2G1M A;  5FRA A;  4AED C;  4LHN A;  3VHO A;  3CNA A;  2XUM A;  5C9A A;  4ES9 A;  1IPJ A;  2BNM A;  4DRR A;  2BYV E;  1W3X A;  3WNK A;  2BOJ A;  4AQS A;  4CEY C;  3SEE A;  1AVB A;  2WNV B;  4E4Z A;  2WO3 A;  4WV8 A;  2RMU 3;  4RGG A;  4EN0 A;  3UJO A;  5FR3 A;  5FY1 A;  1SEF A;  4OUE A;  4LTA A;  1QOT A;  4FOY A;  4YVS C;  1W90 A;  3Q8B A;  2V09 A;  4MHU A;  5FYY A;  4UOJ A;  4FFH A;  3I3Q A;  3KHC A;  5G05 L;  2FQP A;  2VZU A;  3WD5 A;  4AI8 A;  4XUO A;  1XNC A;  1XYO A;  3SKV A;  5HCA A;  2RDR A;  2YC4 A;  3ME2 A;  1G6N A;  2AEY A;  4RS5 A;  3RWK X;  5FYV A;  1GZW A;  2O14 A;  4HPK B;  3GXU A;  1SLA A;  1XU1 A;  4AEJ A;  4ISQ A;  4O61 A;  5DUU A;  4IV1 A;  1K5M C;  2VME A;  3B93 A;  1QEX A;  4QM8 A;  2VOW A;  4H3W A;  1SFP A;  3VHN A;  4CCC A;  4CU8 A;  5IAV A;  4LBL A;  3JBG 3;  3ZYR A;  2I45 A;  3RMY A;  5DPN A;  5FXV A;  5CNA A;  5FP8 A;  2EID A;  1GZ9 A;  4HBN A;  2A75 A;  2Z42 A;  5BNN C;  1Y7B A;  2IFW A;  1AR7 1;  2OUJ A;  3GCW A;  4CDX B;  3IPV A;  4IXL A;  4YFW A;  4Z2A A;  3BUC A;  3M2M A;  2YMZ A;  2QBX A;  4CXY A;  3AMP A;  3UET A;  4GWN A;  1WMF A;  2WNU A;  5FKC A;  2JKB A;  1VR3 A;  3VHR A;  1QJX 3;  1DZT A;  4LBK A;  1A6C A;  5JR2 A;  3FFZ A;  3H8O A; 
#chains in the Genus database with same CATH homology
 1Y4W A;  2XQR A;  2OXB A;  3U75 A;  4CCD A;  5FK7 A;  3S5Q A;  4B1M A;  4UFL A;  3KF5 A;  5FIX A;  2QQU A;  3NMB A;  3UGF A;  4HXC A;  3U14 A;  3OSD A;  3LDK A;  1UYP A;  3PIJ A;  5FKB A;  4QHZ A;  4CCC A;  2ADD A;  4JQT A;  5FK8 A;  3ZR6 A;  3ZR5 A;  4AZZ A;  2ADE A;  5FMC A;  3LEM A;  4FFF A;  4FFI A;  4EQV A;  3LF7 A;  3H3L A;  3LIG A;  1Y9M A;  3LFI A;  2QQW A;  4FFH A;  3SC7 X;  5ANN A;  3IMM A;  3U1X A;  3HBK A;  1W2T A;  3LDR A;  4FFG A;  3KF3 A;  4UFI A;  1ST8 A;  3UGG A;  2AC1 A;  3UGH A;  4B1L A;  3PIG A;  4UFH A;  2QQV A;  4CCE A;  5FKC A;  2AEY A;  4UFK A;  4UFJ A;  5FMD A;  3RWK X;  1Y9G A;  5FMB A;  4UFM A;  2AEZ A;  3LIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...