4HXCA

Crystal structure of a putative glycosyl hydrolase (bacuni_00951) from bacteroides uniformis atcc 8492 at 2.15 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
255
structure length
255
Chain Sequence
b'TTTAVSYSKSLKAPETDSLNLPIDADGYITIFDGKSLDGWRGYGKDKVPSRWIIEDGCLKFCGTGTGEGQTGEGGDLIFAHKFKNFELELEWKISKGGNSGIFYLAQEVTSKDKDGNEVLEPIYISAPEFQVLDNANHPDAKLGKDNNRQAASLYDMIPAVPQNAKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWTEMLQASKFSEEKWPLAFELLNNCGGENHEGFIGVQDHGDDVWYRNIRVKVLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative glycosyl hydrolase
publication title Crystal structure of a putative glycosyl hydrolase (BACUNI_00951) from Bacteroides uniformis ATCC 8492 at 2.15 A resolution
rcsb
source organism Bacteroides uniformis
molecule tags Hydrolase
total genus 74
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06439 DUF1080 Domain of Unknown Function (DUF1080)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4hxcA00
4UFHA 1Y9MA 3LDKA 3LIGA 5ANNA 3LF7A 4B1LA 3H3LA 3PIJA 3PIGA 3U1XA 3HBKA 4UFIA 4FFHA 1Y9GA 1W2TA 5FK8A 5FMDA 3UGFA 5FK7A 2XQRA 4UFKA 4CCCA 4UFMA 3LIHA 3IMMA 3U14A 3UGHA 4UFJA 2AEYA 4JQTA 3RWKX 3LFIA 5FIXA 3LEMA 3LDRA 1ST8A 4FFGA 4QHZA 5FMCA 3U75A 4CCEA 4HXCA 5FMBA 3NMBA 1Y4WA 3UGGA 4UFLA 4AZZA 3SC7X 4CCDA 5FKCA 5FKBA 2ADDA 1UYPA 3ZR6A 4FFFA 3OSDA 2AC1A 2QQWA 4FFIA 3ZR5A 4B1MA 3KF3A 3S5QA 2OXBA 4EQVA 2QQUA 2ADEA 2QQVA 3KF5A 2AEZA
chains in the Genus database with same CATH superfamily
2FZ1A 5LA9A 4E4SA 3SCHA 4KQ7A 1WMDA 1F2NA 2D3RA 1VBB3 5L9BA 4AEDA 2XPJA 1CR7A 4O9GA 1G9BA 4UFKA 3C2UA 3JXSA 4PBPA 2HWF2 5ERLA 3ZN6A 4CCKA 2VCAA 5SV5A 2DVBA 1UY2A 1W9TA 2RR13 1W0NA 1VRH3 1XNTA 2SLIA 4CU9A 4GB32 3T2PA 2D6MA 3MHZA 1E5SA 1AR91 1QDCA 3POGA 5ABJC 5IVBA 2XJUA 5J7MA 1DZQA 4CDXA 2QNKA 3M1HA 5A3PA 2BZDA 1JYCA 1YIPA 2G19A 4MO3M 2PA7A 4EZ4A 5BNNB 4Q5OA 4CCLA 1K12A 2XVKA 4A41A 1ND2C 4LR4A 3VD7A 1F4HA 1V6NA 4AFBA 1YXWA 4MSVA 4CCMA 4IEQA 4DIQA 1CIWA 2QQJA 3GBWA 3ZKUA 4PI2A 3AJYA 1KFXL 1FX5A 3HBKA 5FR3A 1ULGA 2JX9A 4IEPA 1Q56A 3TBDA 2VZUA 3OBZA 2W39A 4AG4A 4I0AA 3RWKX 3ZXDA 4B7KA 4I0BA 2P3IA 2ARBA 4BYYA 3AB0A 2JD4A 4XCBA 2XJRA 1S0DA 2W1WA 1WCDJ 1WWYA 3SC7X 3RGBA 1NA1C 4YGBA 1BBT2 1NXD1 5T5PA 5CFDC 2BUKA 3RZHA 2FQPA 4QDSA 4UW3A 3H50A 3UT0A 5JPNB 4TZDA 2XQXA 4QGNA 5LK7B 2D93A 1V6LA 1CPNA 3ZVXA 1NAEA 2RS31 4WM7A 5F39A 4GZ9A 4PI0A 4COYA 3LZZA 3NV3A 2WDBA 3T2TA 2VZPA 3AFGA 2BOIA 2FDFA 2GN7A 2NPIA 2X5IC 3IKWA 4AEKA 3O1TA 1TG7A 3AKRA 4QKNA 2YHJA 3KD4A 1VMFA 2PHUA 3V65A 2ES3A 1YI9A 3FL7A 5J96B 4ONUA 4QPIB 1ND3C 2J22A 3I2FA 1HRV1 1O8SA 4K8RB 1IZ3A 3POWA 3BYWA 4QDQA 1W9FA 4U2AA 4R9AA 5EWSA 5LZ6A 2HBTA 3VDBA 4JAAA 1VBE1 3ZFEA 4ZY9A 4LLFA 3LE0A 5FZEA 2ZX1A 2VBPA 2WNVB 2R073 3LSEA 2CYFA 4XFCA 4WM8B 1W6NB 3NQHA 1SLCA 3UNPA 5FZ7A 1ZBE2 1W9WA 4K1ZA 2DFBA 3JUUA 3WDXA 4IE6A 1ODMA 3TN93 1H8TC 1DGLA 3K4DA 1AYM3 4W6YA 4Y1YA 4PDWB 4CP0A 5A6ZA 3N4MA 3SH5A 3UGHA 1YQ5A 4RQPB 1OT5A 4UW5A 2NMOA 4DY3A 4YZ1A 5I0DA 5JCTA 4XQ4A 5EFUA 5FXVA 4OI0A 5JXGA 2JE8A 4YW1A 1PK6B 2P6CA 4P9JA 4A7KA 3KCYA 4LKSA 2R072 1AR63 2XHNA 2Y64A 1OA3A 5FP7A 2F17A 4XBQA 2F6BA 4QX0A 3KV9A 5FXWA 3CJXA 3KGZA 2FDKA 3MIFA 4ARXA 3ZFGB 4WBBA 1G6NA 1HJFA 2ZGUA 4GD4A 2W68A 3TN92 3D5OA 3ZIWA 1OOPC 4XAEA 1KS4A 3T0AA 3ZYBA 3MPBA 5FZCA 5FPVA 1XU2A 5FUIA 4KBBA 1DZRA 2ORZA 4KMQA 5FZBA 3O7OA 2ZGRA 3PDQA 4JZRA 1VB2A 1RUE3 3OUIA 3VBHB 1W8HA 1UZZA 2WT1A 5HCBA 3LKJA 1NCRB 3RPQA 3AP9A 3MDPA 2P1BA 3GHNA 5D8AA 5J36A 4NIHA 4M3CB 5KC6A 3P1IA 1IOAA 3B5LB 1FV2A 3R6SA 1F15A 3QOPA 4RN5A 4URAA 1NQJA 5A32B 4CZSA 5T3NA 1UU6A 5A6YA 4EQVA 1COV3 1LGNA 5JMOA 2VNGA 1JHNA 5HV0A 4MYEA 4W6XA 4OI2A 3S57A 1JOJA 3M3EA 5I8TA 2RDSA 3SEPA 5T52A 3DYOA 1X50A 3FHAA 2EF6A 1RUC3 3SITA 4V2WA 3SCGA 2MEV1 1CJPA 4Z2AA 1J58A 4YM2A 1RIRA 2JE7A 3A22A 2X8KA 1QH7A 2VUDA 3H7YA 3B00A 3JZVA 4ZXKA 3LPFA 1JZ2A 1IPKA 1YJLA 2R063 3T1LA 4JGZC 1COV2 5ACA1 5JZGB 4K3UA 5HBAA 2JDHA 4F8AA 4K40A 3BGAA 3W20A 1VP6A 3HNYM 4FTEA 2ZS6B 4JTNA 1IG0A 3KQ4B 3RJ2X 5FZLA 2XH6A 2X10A 3F95A 5CU1A 2QQPA 3NNFA 4AK3A 1DQ2A 4KNCA 5GZFA 3T4HB 4GH4B 1VAVA 1MZEA 2ZGOA 4XIOA 3ZSEA 5F5IA 2ZGTA 2XLAA 2IXKA 4IGOA 3WHUA 1FMD1 1GMMA 3VB9A 4MGIE 1G9AA 3SEEA 4B29A 3I2GA 1W04A 2YDEA 3J8F1 2Z2SB 1Q3EA 4XXPA 4AVVA 3T0DA 2CNAA 3U0ZA 2WO1A 3FMGA 3ZXJA 2GNDA 3I3EA 4UW4A 3GGLA 4LBMA 4KWUA 2VZVA 1YIFA 1PIV3 4R9BA 4AQ2A 2DWRA 5FYVA 2R0HA 4BLJA 2JG9A 4KI5M 1UX6A 4S2DA 1O5UA 1ULEA 1WCSA 2CGNA 2D43A 5AVPA 3KV5A 2A71A 4HFSA 1RMU3 2JG8B 1ZRIA 3WNMA 2BFUS 1SG3A 3B93A 2AH2A 5LA2A 4DEVA 5L7OB 5FOBB 1V6JA 1CAXB 1POV1 3BPZA 3MUZ1 2W52A 3VDDC 5BNOB 4ET7A 1WD3A 2YBKA 1PIV2 3V64A 5JVVA 4AEMA 1LU2A 2MEV2 3IAPA 2OIIA 1IHMA 1Y9QA 4Y22A 5FYMA 5KXCA 2VOKA 1PVC3 3TNQA 4NVPA 3N7MA 4XAAA 2EVXA 1WLWA 2VE1A 2G9ZA 2LALA 1RMU2 5F7UA 5ACA2 1AYN1 4BE3A 5F37A 3AK0A 4GKYA 4QT6A 2KM2A 1JODA 2BU9A 3K4AA 3JD71 5FJHA 3W9AA 3USSA 1UD1A 1H2LA 5D1IA 5E1RA 4B1LA 4CEYB 3HR9A 3U1XA 5GZCA 3HQUA 3DV8A 2K2SA 1S0FA 1ULOA 4LEJA 5GLTA 4YRDA 2EIDA 4BQYA 2ZHLA 2ZGKA 4CDUA 2HEWF 2C6SA 2AEYA 1MS9A 4KL1A 1V9U1 3R05A 3ZFEC 5FPLA 4D6SA 1QQP3 1OURA 2EA7A 1SHWB 3WEZA 1XRUA 1UOFA 3N7LA 2RDQA 5FZ8A 5H9RA 4HZFA 3VL9A 4D6QA 1NZIA 1LOCA 1DZTA 1HJGA 1YFUA 3BU0A 3WVJA 2VOXA 2GSYA 4IL7A 3NJXA 5FY8A 2ZEXA 2HWB1 2UURA 1LKNA 2GU9A 3QH6A 2O8QA 5LEKA 3LA3A 3MIHA 4YFWA 3RMXA 1LEMA 5FYUA 1W6PA 5F8PA 3DPRB 5LRRA 1FATA 4LA2A 5B2GB 1QQP2 2Y60A 2XUEA 5JOXA 2VCBA 3LA7A 2LS6A 3EB7A 2QQIA 2ZAHA 2A1XA 4CUCA 1PNFA 1SMVA 2R49A 1WCKA 5E16A 4IV1A 2BGCA 2P2KA 1D0GA 5A33A 1GV9A 1YO8A 1XSQA 1SEFA 2JE9A 2XBO1 2VW0A 2Y8KA 4LORA 5T54A 4BH9A 3DXUA 3OGSA 1K5JA 2WNOA 2E26A 3HWJA 1SDWA 4BU2A 5IYYA 1SLBA 1CONA 1JTZX 2W95A 3K75B 5F3IA 4CE8A 5JPMB 4AQSA 2P6HA 4QM8A 2WZPP 4EN7B 2DVFA 2WNUA 4LHNA 1ASJ1 1AYN2 1HW5A 2AYHA 3CDZB 3WDUA 4DEQA 5FK8A 3U4XA 2O0OA 2VU9A 3JD72 2JKXA 4FPEA 1BJQA 1H0BA 1S0IA 4UFMA 4XE9A 3SMHA 4AGGA 1OF4A 3PMSA 1YQCA 3ZYIB 3ACHA 1C28A 2A3XA 2E9QA 2I2SA 4NHMA 4NPMA 5FO9B 5LEJA 5FWJA 4Q4Y1 2OZJA 3Q8BA 1MZ5A 4OVEA 3I54A 2RHPA 1JYXA 1XNCA 2I74A 2VVEA 1V9U2 2A5ZA 1UAIA 2ZOEB 3WF3A 1RHI1 2Q8DA 5DUWA 4YVSB 4CCJA 3N3HA 4GMP1 2AUYA 1N1TA 4XQDA 3ALQA 4PJYA 4A2UA 4QXHA 1ULPA 1N1YA 4MHRA 1GANA 2CAUA 3KV6A 1C4RA 2XLFA 5FLJA 1LOGA 1RUJ2 3POBA 4M01A 2HWE1 4AW7A 4UF0B 2VMCA 4MGTA 4L8QA 4MGQA 5F32A 4UT5A 3GBGA 1VB4A 4HK9A 5FZOA 3ZFFB 2D98A 5DAPA 1UKGA 3RQ0A 2VCCA 4MADA 2WSVA 1WD4A 1PGSA 2QQLA 2EALA 2Y26A 3MO4A 1GNYA 4QX3A 4XJAA 5GLUA 1ZREA 1I5ZA 4BQ5A 3BOPA 3IN9A 1R64A 5JI7A 3AKSA 3GZUC 4ISRA 1JBCA 1VBD1 1AX2A 3WV6A 3PVBB 1TMF1 2FCVA 2RV9A 1UXXX 4NE9A 3CJIC 5GLVA 5HI0A 3OGVA 2XVLA 3FHQA 4M4PA 5E89A 2VXRA 2VULA 2CDOA 1W3XA 4QD2A 3KSCA 1GOFA 1C8M3 1ZRCA 5LK5A 5BUVA 3B9CA 5EHDA 1JYNA 1Q8PA 1VR3A 5FK7A 1QJU3 3RSJA 2GZWA 2Q1MA 2ZX2A 4HBNA 4YVWB 2Q8OA 1ASJ2 4A6OA 1D4M1 4PLNA 1QJY1 1HLCA 1O7FA 2HWC3 4L0PA 4OI4A 4AI2A 1PZ9A 3AYAA 4YSFA 5BNPC 1LODA 3D8CA 4MLOA 4OUMA 1CAWA 4DMIA 2DUPA 2C9AA 2WSUA 2YMZA 1UCXA 3ENRA 3LOIA 1VPHA 4DZGA 1C8M2 2WYSA 4Q4Y2 5A3NA 1CIYA 1WCUA 2D6OX 3GJBA 5C33A 5JOWA 3AXDA 2FMDA 2OQ6A 2F4LA 3ORJA 2ADEA 1QJU2 3IBMA 4RS5C 3PTRB 3TNPB 2B42B 1SBDA 1H1AA 2Y0OA 1W8TA 5BXXA 1SCSA 4B4QA 5HCFA 1OPMA 1RHI2 3E5UA 3H3LA 4LUKA 1G9DA 3J7NA 3I7DA 1HRI1 2C0ZA 4IE7A 5FUPA 1YUDA 3VDCA 4Q29A 4KBZA 1BEV3 3IZOA 5A7QA 3UV9A 3OYWA 2O1QA 3POFA 4JQTA 2AREA 2J42A 2JDPA 2Y6GA 5F3CA 5CAZA 2HWE2 3P6BA 3WP6A 4I01A 3L2YA 3D0JA 1JS9A 2MPFA 5JWPA 2QDNA 3MIBA 4P9IA 5FP8A 3DKWA 4PLMA 1FPN3 1XC6A 4DY5A 1CX4A 1YC61 4EN9B 4QPGA 1FOD1 2WN3A 2R32A 4BLIA 1Q8VA 4W50A 1SZBA 1BEV2 2QQVA 2WZR3 2B46X 4QMAA 3U11A 1SDDB 5LWBA 2BP6A 1YQ8A 4XW3A 4XCAA 1ZRRA 1TMF2 1UMHA 1KD7A 1V6MA 2XL7A 5DDJ3 5CG8A 2YC0A 4IQPA 5DG1A 1LESA 4IV3A 1QOSA 1URXA 4GKXA 4JHTA 4TLGA 1FPN2 1DFQA 1U5IA 4YG6A 3UKTA 1OLME 1GLHA 3WG1A 4DRRA 2A75A 3WF2A 2ZGLA 3WUDA 2EXHA 2UU8A 2G4IA 2ZZQA 3UETA 1NCQC 5AC93 2GALA 1H2MA 2ARAA 3WW2A 1VBC1 4XFAA 5FZMA 3IPVA 2VMFA 4YW5A 4AVCA 5E6HA 3S6PA 2P5BA 2Y6LA 1QJY2 4EN8B 2WIIB 1RUOA 2VPVA 4NMIA 1C3HA 3MLJA 1PMJX 5LBFA 3IDEA 3RZKA 3VBFC 1E5HA 1QXPA 2GMPA 2ZKLA 1R081 3JQXA 5L73A 3WQ7A 2WYFA 2VL4A 4CCOA 4TWTA 3SXWA 2ERFA 2ZTNA 3RJRA 1LEDA 4ATEA 4C1XA 4RFRB 3OGRA 4R9DA 5GM0A 4CCCA 4IDZA 2HH9A 2DTYA 3LA2A 3ZSLA 4XIKA 1LHNA 1UZ0A 4XUNA 3USUB 4QX8A 3OD4A 5FY1A 3EXUA 1OUSA 4JDOA 3DYPA 4OHVA 3VKNA 2JWPA 2P3JA 1XSRA 3ZR6A 1GP5A 5FXZA 3WQ0A 3ME2A 5F6LB 3H8XA 4ZONA 2W94A 3M3IA 3ZXGA 2WQ8A 3HQRA 1NLRA 4N53C 1FOD2 5FZ0A 5I0UA 5ABJA 4Q0PA 2D44A 1HB3A 4EN0A 1XNKA 4CDWB 5LASA 3O1RA 5C3RA 1CESA 1QKQA 1X8MA 3KZ4C 3ILRA 4Y1XA 1KS5A 1WMFA 1XXNA 1AVBA 1X33A 1GQGA 4JC1A 4Q27A 1K5MB 2WFF1 2VQ0A 4IEZA 5DQ0A 4FPLA 1G86A 1IKQA 1EYBA 3AYCA 2ORXA 1UYXA 4HKWA 2DTWA 3CLPA 1MS4A 4CYDA 3WCSA 1UZWA 4DNYA 3ACIA 1VBC2 2ZEZA 2RS51 4JGYB 1Z7S1 1KEXA 2ZEWA 4ITCA 2W92A 4Q1PA 3A21A 5IWFA 3EHKA 2IXIA 1UOBA 1NA1A 3JBG3 1OQ1A 2ZX3A 5T5LA 1PO13 1HV0A 2Q5TA 3OBAA 5CFDA 1XYNA 3HEIA 1W6MA 3ZXKA 1R1A3 3AXEA 4J1XA 3GF6A 4YM3A 3JCIA 1US2A 4DXRA 1QOTA 1M06G 3DXTA 1CJDA 1RVF1 3O0VA 2WA4A 1JZ3A 2PHLA 1E5RA 3A0KA 1V70A 3L9JT 3OY8B 1HQNA 4LBKA 1F31A 1WW4A 2VQUA 3GXUA 1KFUL 3IDAA 2BBAA 5FZFA 4K20A 2NLRA 5FFOC 5FY7A 4BXFA 5C4WB 1AX1A 4MGSA 2X5IA 3CKHA 3JBG2 2ZACA 4RR3C 3WCRA 2FZ2A 4Q4W3 3BI3A 2HBUA 5JOYA 2FDGA 1S0BA 3C8XA 3PUHA 1XOYA 1R1A2 4OFGA 3CBNA 3LFMA 4P5YA 1ONAA 5T5JA 1HQLA 4CRQA 4D7YA 1XQNA 1Y9MA 4B7EA 2UWAA 4BISA 4NR1A 4DXTA 4CU8A 3K2OA 2GH2A 1ZNPA 4LHKA 5FZ3A 5FQ0B 1IS4A 4OYUA 2PLV1 2DV9A 3SNMA 3KHCA 1DYOA 1I6XA 4HSJA 1HB2A 1EAH1 3D6EA 4META 3RG0A 3VBRB 3VDDB 3TB0A 4C8DA 1GKBA 1RUF3 4V2VA 4BJ0A 1J3PA 5F5AA 4AGRA 4FSJA 2GNBA 3M2MA 2FD8A 4Y5SA 3AFKA 5KHGA 3Q8FA 1VJ2A 1Q8OA 1DGRN 2WFF2 3U4SA 1H8TA 2V72A 1IS5A 4MVTA 1GSLA 1RUH1 4A7YA 3H1WA 1N1VA 4XEZA 1AHSA 1RTVA 3O1OA 1JH5A 3FE5A 1DF0A 3GZEA 3HQXA 3THCA 4LTAA 3UJQA 3GCXA 4OZXA 1WLTA 3PMEA 5JLVA 2CGPA 2NYYA 5EQUA 4QPGC 2RVAA 2JD9A 3TOJA 2ATFA 2VH9A 1LULA 4XJWA 1Q8SA 1GZCA 2DBIA 1CAVA 3I2OA 1B09A 1LNSA 4FPJA 3TEYA 1LRHA 1RVF2 2DDUA 2RJKA 4FPOB 4TXWA 4IV3C 3C7GA 3J4UH 3VBOB 5C3QA 2J1RA 3N36A 2AENA 3AC0A 1OA2A 3T09A 3HT2A 1U5XA 1BK1A 3LDKA 2RS13 4JCKA 2KXLA 1MZFA 1UF2C 4C1WA 4LO6B 3V0AB 1AJKA 4N43C 3A0NA 4A3ZA 4RHV3 5LA1A 4Y33A 4CXWA 2A3WA 5IW0A 4X8NA 4EV0A 2YPJA 1QGLA 2JDKA 3KHBA 2PLV2 4UBHA 1Q43A 1OHFA 3AZXA 4WZFA 1GU3A 1RJ8A 2W9XA 4Q26A 1EAH2 1QNYA 5DXDA 5JSOA 4BQWA 3AMNA 4AYUA 1KRIA 4LO7A 1XB9A 2HWF3 2Y6FA 5BNNA 2HJIA 4QKDA 1OI6A 4NHYA 2DVGA 1J3RA 1K5MC 2PTMA 3CU7A 4GB33 3LIHA 1LU1A 4BK5A 1ULFA 3MIDA 5F5QA 4EYUA 3B69A 2V4AA 4JGZA 3J9SA 1RUH2 5BPXA 4KWKA 2JXAA 1RC6A 1JYIA 4C0BA 5DPNA 3QH7A 2E6VA 2B9VA 2J1AA 3CF6E 3WOGA 3IMMA 3BB6A 4JGYC 3N7JA 3SKVA 3ZSMA 3RZJA 2BQPA 2C1FA 3PVNA 1X36A 4L9BA 5FMBA 3LEIA 3T4VA 1PM7A 4QX1A 4QGLA 1JI6A 5C8CB 2PHDA 1DP0A 1WGPA 4CDQC 2ET1A 4RSUA 3WXPA 1YLLA 1UMZA 4MXWA 3FHIB 4N7UA 1MACA 4NPRA 3THPA 4JKLA 1S0GA 1YQ6A 1RUNA 5CKNA 1UMIA 1SACA 3KWVA 1BBT3 1D2SA 1X82A 2ZABA 4COWA 5CISA 1LOBA 2KA3A 2Y6JA 3KT4A 3WNOA 2GNMA 4Z2WA 3CHXA 3MFCA 2E7QA 4ATFA 3NJVA 1RUI3 2VOWA 3SHRA 1MS8A 3LEMA 1SCRA 4QPIA 1Q8QA 4Y4YA 2NM1A 1GYKA 1A8MA 4MXVA 4XPVA 3BTXA 3VBUC 1VMHA 5FZ4A 3N7KA 3SCFA 5KXEA 1PGL1 2VTXA 3RZMA 4OQ9A 1ULCA 3MW4A 4PLOA 1DG6A 4CP9B 4HVRA 1LHVA 4UXAA 4HN0A 2ZX4A 2ARXA 5A3OA 2FDJA 2YYOA 4XABA 1JU3A 1RUI2 1D0HA 2BJSA 2ZZJA 1LHWA 2MNGA 5F6KA 1W2TA 3I59B 3X29B 3KS7A 5EZWA 1AR93 2QQKA 4AEDB 1W6QA 2XJQA 4AFCA 1WW5A 2XJTA 4HSLA 3H1MA 3E5XA 2W0XA 3ZN6B 3CO2A 1UQXA 2IVJA 2RG4A 2Z79A 2RMU1 3H1YA 1OPOA 1PK6A 1WZXA 4FQ4A 3W5NA 2IC1A 2OZ6A 2AZ5A 2BNOA 1OQDA 4XUOA 1ZBE3 5JSRA 5L19A 5EPAA 1ZRDA 1AXYA 1GNZA 1UY3A 3HD8B 1RXFA 1V6IA 3MEPA 4P00B 3SISA 4RGKA 1AR92 4XUPA 3ZYGA 1DCSA 4HPKA 4HG6B 1PZ8A 1Y43B 2WS91 2QFEA 4L97A 1UXZA 4CCNA 4L11A 1UY1A 4XUQA 4NAMA 4OCTA 4UFIA 4Q0VA 2VZ1A 3A23A 3LD8A 4IW3A 3WW4A 2A3YA 1YQ2A 4KU8A 4BIFA 1W0OA 2JECA 2VVDA 1GWKA 3VBSB 4BQ1A 2EIBA 4YGDA 4KWLA 4CXYA 4R52A 4ZU5A 5FZ1A 4PF5A 2DCZA 3H3ZA 5K4LA 3V56A 4UFLA 4AZZA 4YM1A 1HIXA 4M3CE 2C26A 3ROUA 5AFBA 2RS33 4WVWA 5K8SA 3AKPA 2DYCA 4FFFA 5AVAA 2AC1A 5A3UA 3M8LA 4BQ2A 1PGL2 2DVAA 3ZYPA 3I2KA 1S55A 4IEWA 1GWLA 4X6QB 3RI9A 2JDNA 1DU3D 1JYWA 4HKOA 4WV8A 4FPCA 2ZPXA 4HANA 4FOVA 4HVQA 1V6KA 2G1MA 1HRV3 2IUWA 2GNTA 2RS32 3ZPOA 2D7FA 3QLQA 4CA9A 4F3JA 2VZ3A 1NZCA 1RGSA 1TZOA 1VBE3 2HYXA 2W5FA 2Y38A 5A3TA 5JZGA 2RMU2 2ADDA 1J1LA 4QQOA 3PUQA 4E2SA 3ZYJB 4NIAA 2R061 3OG2A 3MICA 2V09A 1XE8A 2JB4A 4H7LA 4XF9A 1JUIA 1HRV2 1RJ7A 1ZA7A 3NAPB 2PYTA 4FPFA 4GJZA 4LPLA 1JZ5A 5LCWL 4JHZA 4GH4A 2WFPA 5ANNA 2YU2A 1VBE2 5FMOL 4CP2A 2BWCA 2WS92 3BUCA 3Q8AA 4XF0A 2DBNA 1YHFA 2R0FA 3P5BA 4BQ3A 2A6ZA 4XURA 5BNNC 5CG9A 2QKDA 1MEC1 1Z0HA 5FIXA 4Y1ZA 2PAEA 3W5MA 1SLLA 3BU7A 1DQ0A 1PO21 1PGW1 1HDKA 4ARYA 5FY0A 4YW6A 1ACCA 2PXJA 3PL0A 5CB7A 1HN1A 2WAAA 3DKQA 4FAGA 1T2XA 1QDOA 5H9PA 1UZYA 3S5AA 4E9KA 4W6WA 3BIWE 1AR81 4CEWB 1IS3A 3FZ3A 5G04L 3THDA 3H8RA 2JG8A 3TAYA 4GA9A 3Q8EA 2YGMA 1OMIA 2JKBA 1AF9A 2EIEA 3K51A 2LTNA 3QBQA 5FYYA 4D3WA 1S2KA 3LAGA 4QXBA 5KR7A 1CAXA 5FYZA 1ENXA 3CJIA 3UKNA 3N9MA 3E5QA 4M3CF 5D8AB 3B94A 4HXCA 5GZDA 2EAKA 4IE4A 2VMGA 1CZTA 1OFSA 2QJVA 1BKZA 1NY71 4D94A 2DU1A 3HN1A 5GJ6A 1D2QA 1UU5A 4Q4X1 1AR71 5FCCA 1S1AA 1RL3A 4EZHA 2K9ZA 2MEV3 3MF9A 4JRAA 2LM3A 4Q4V1 5CVRA 5A7WB 1ENQA 4KG0A 5BNPA 3ES4A 5IK5A 4QPIC 1A6CA 2VR4A 2ZAAA 3PU8A 4XDQA 5IUQA 4C91A 3VZJA 4IUGA 1WKYA 2J1EA 2W2IA 2YFZA 3ACLA 2X29A 4K8FA 5ACA3 5IAXA 4M0NA 5A1LA 2CDPA 3VZMA 1DGWA 3R4SA 3RYPA 2OUHA 1XYPA 1W6OB 4RS5A 1GZ9A 5FPBA 5H9SA 5KHHA 2WNVC 4ZZ5A 4NIGA 2D3PA 4NWVA 1O3TA 4XILA 4AI9A 4FXKB 4WM8C 4CP1A 3VKLA 2F4PA 1MEC2 1WUVA 2YU1A 3V0BB 4GXLA 1QU0A 4ORFA 5CFCC 1XE0A 1TNFA 2KR2A 4JDNA 4QQPA 4PDWC 5LW9A 2GH8A 1AUYA 1ZVFA 5L9VA 4RQPC 5FDBA 4I2OA 4XHBA 4A42A 2B39A 2WZ8A 4YFZA 3KF5A 4D8MA 1NLQA 3DPRA 3AKQA 1PK6C 1FMD3 1JMUB 3E6CC 4IGQA 1H1MA 4CTEA 5JAXA 4YW3A 4XTPA 3ZFGC 5F9TA 3ZYFA 4UI9L 5A3WA 1ZYBA 1GICA 2B9UA 2JIGA 4GWNA 2VBDA 2BOJA 1FYUA 5IVJA 5D2AA 2Q1ZB 4LA3A 5FZ6A 4YG3A 4AVAA 2I45A 3KT1A 1HXS1 4H55A 3ABZA 4OUSA 1FMD2 5B4XA 1ZBA1 5FYHA 1UY4A 2BNNA 3KCCA 1GFF2 1I3HA 3VDAA 1B35B 1XBFA 3VBHC 2WNEA 3WF0A 4DRVA 1CVNA 4DXZA 2IXLA 3J8F2 4XC9A 5LBEA 5K9YA 2BBVA 1NCRC 1NY72 3WDVA 2JG9B 4PIXA 4YNIA 1PX4A 4YZ5A 4YW7A 3Q9OA 5J3UA 1UX7A 1POV3 3ZX7A 1NCQA 3SLIA 3FUOA 1RINA 1STMA 2JICA 5DAQA 5FRAA 2X53S 3WP5A 4S2HA 4XJZA 4E2GA 1H8VA 5LATA 5T55A 1UU4A 1XNAA 1PMHX 5JSPA 3LFIA 4H7MA 3VBFA 5EYYA 3WINE 4DFSA 2CAVA 3CNAA 1AYN3 4Y22B 1JOBA 3WG3A 3J7HA 4URTA 2OA2A 2RM21 2D6KA 2JIJA 4UWDA 3JD73 3TEZA 5CNAA 5A6XA 2D5HA 4ASMB 2R041 4LBQB 2ZX0A 2OXBA 4LHLA 1N3QA 5B4NA 2YC4A 4L2NA 4CSWA 2VJXA 1LTEA 2OT7A 1DYKA 4ZXEA 3B7MA 1AL21 5EJ3A 1W05A 2IWGB 2WQ4A 5LB6A 3R4DB 3IMNA 3PTYA 1QWRA 3EYPA 1V9U3 5JZGC 4NROA 1L3JA 1X9TA 4NRPA 1ENSA 5H9QA 2RDRA 2VCMA 5FPZA 3AL5A 1KQRA 1O4YA 2HKXA 2C9KA 1MPXA 4FCAA 2YB7A 3M3OA 3ZFFA 2SBAA 5LA0A 3O1VA 1O3QA 4YW4A 2HWB3 4HVOA 4N53A 1PVXA 2ETEA 1Y4WA 1T6GC 4XBNA 4I3PA 1RUJ3 4GH4C 1SLIA 3N9NA 3WQ1A 4BCUA 4NIDA 5E8AA 1WBLA 4JTOA 5FPUA 4FQZA 1H4HA 1EUUA 2EAAA 3VD5A 1HXS2 2X09A 5A1AA 3KVBA 5GALA 2B8MA 5LBBA 4AAXA 3WHTA 3AKTA 2GC0A 3W58A 4XUTA 3FLTA 3L2HA 1Q5OA 1OH4A 2HWB2 3MUY1 4BQXA 2XBO3 1ZA4A 2GC3A 3FN9A 1VMJA 3K77A 4P9WA 1F9KA 4H3WA 3LWCA 4YVWA 4QQLA 2YY1A 2K46A 1UIJA 4IV1B 1VLNA 2D97A 4AI3A 5A33B 1WMEA 4CCEA 1WBFA 4XXAA 5FTTC 4EROA 2XB6C 3DL3A 1SBFA 2JG8C 4MGYE 3P3NA 3IIAA 5ANQA 3RZZA 1AX0A 5I0RA 1CAUB 5L7OC 2LW8A 4HL0A 1ASJ3 1OUXA 2XBO2 5A1FA 4FI9A 3B01A 3MLLA 5BNOC 2RM22 4Y4RA 4NPLA 1GR3A 3U10A 1H4GA 1F5JA 1LOFC 3VZLA 5HCHA 2IXCA 5FXXA 2P17A 4HETA 4YYOA 2R042 2WNUB 3NRUA 4P9YA 4TN7A 1SPPB 1PX3A 1C1FA 2DF7A 1CWPA 4Q4Y3 2ZCWA 4QU2A 1AL22 4LKDA 3MYXA 3OEAA 5IVYA 2WN2A 4RR3A 1EV11 2XDVA 4J1WA 3ETQA 3OD0A 4FOYA 1RHI3 4AHXA 3DEMA 1TNRA 2G9GA 2YGLA 2FCTA 4IETA 4XFIA 4CEYC 3GYDA 3AMMA 4PT6A 4GMP3 4ZS3A 4XMIA 1NX9A 3GZTB 2OVUA 4Y3OA 4DO0A 4QB6A 4MOAA 1YEWA 2HWD1 2RE9A 4LOSA 3I3MA 4PIZA 4GJYA 2VVFA 2WA3A 2HWE3 1SBEA 5DUXA 1I5PA 3APBA 1N47A 1UPSA 2PQSA 4LE4A 2Q8EA 2JDYA 2HLEA 2QBXA 4HONA 2DURA 2H6BA 4QU1A 4AEJA 1SFPA 2GC1A 3CL1A 3BKZA 4U36A 1JZ7A 3I3BA 1MS1A 3HNBM 4Q1RA 1O6UA 3MPPG 1L7RA 5CYYA 1W9SA 5DDJ1 5I0TA 3WDYA 1BXHA 1VBD3 1RUG1 3DPRC 1TMF3 2E53A 5APAA 2XVGA 4W4ZA 4OQ8A 2ZXQA 3WDTA 1LOAA 1L7QA 1NUKA 1R091 2XONA 4I02A 3NV1A 5IVVA 5EYXA 3FBMA 4QQ2A 2ET7A 3D4KA 4BQ4A 2ZBJA 1D4M3 3QACA 1UL9A 1W8OA 1QJEA 1VBD2 1QJY3 4YLZA 3UGFA 5FMOS 4FO9A 1OLMA 2VC9A 4XFFA 1C1LA 5FUNA 1PZ7A 1QXRA 2VZRA 4GWJA 2WR9A 2E31A 1TME1 3EQEA 4NHLA 2Y6KA 4OZOA 2Q30A 2OQ7A 4DUXA 4GIQA 1EV12 1NXMA 2P4EA 4CCDA 3J26N 3PHMA 1DQ6A 1D4M2 3HAGA 2DCTA 4N43A 3AP5A 5EJ1B 5C3OA 5K0UB 2GMMA 5JI9A 3PLQA 4RA0A 3I2IA 2BEOA 3JB4C 3ILFA 2Y34A 3MI8A 1NT0A 1QJX1 3N9PA 3LQCA 2HWD2 1RYYA 3POIA 1W99A 4LBOA 2OYZA 3UJOA 2VMDA 5KHKA 5EV7A 3I2DA 3ZXFA 3ZMOA 1G8WA 4Y24A 1CD3G 5FPAA 3BODA 3THTA 1RUD1 2WO3A 2XKOA 1AXZA 3CZJA 4YVSC 4IERA 1K5MA 1W8ZA 2B4KA 3AMPA 3C7HA 4LITA 1FOD3 1HRI2 3NMBA 3AZVA 5EXOA 1W2NA 1DQ1A 1BK0A 4P08A 2B45X 2FDIA 2BGPA 2QZ3A 2WINB 1U5ZA 1RUG2 2PAMA 4AQ6A 3K3OA 4JGYA 2E33A 3HPNA 3OCPA 1BQPA 1EUTA 2VD7A 4G9SB 3ZFFC 3C3VA 4ZPIA 5FYCA 2A73B 3IIIA 1R092 2W1QA 4KH9A 3AVSA 4CDQA 2WWUA 3OPZA 4AF9A 3ZIXA 1VBC3 3WF4A 3WSOA 4BIOA 5C3SA 4KWJA 3DGTA 3OY8A 4DPNA 3ES1A 4LKFA 2E32A 2RJ2A 3OB8A 5JMCA 2J1VA 1V6OA 5C4WA 3MV11 3IT8A 4AFDA 1TME2 3OSDA 4M4RA 4CU6A 1HB1A 2VZTA 4WZCA 4YVWC 3LB9A 5C70A 1X7NA 2BVBA 1CZSA 4QKFA 3LIGA 3G7DA 1POV0 5KBFA 1JYTA 1DLCA 3VBUA 3GJAA 5FQ0A 1KJRA 4QB1A 3T2OA 2XUMA 1JHJA 1S2BA 2XJSA 4DINB 2QZ2A 4ES9A 1R082 3POSA 5F3EA 3VBRA 3AM2A 2DCKA 5FZKA 3CZUA 4QB2A 4DS0A 4I30A 3S7EA 1W2AX 4CU7A 5IAVA 4FAHA 1H6YA 5CEHA 2FDHA 3MBWA 4Q0UA 1KITA 3GCWA 5I8YA 1Y3TA 2J1TA 1MR5A 3WT3A 5A3MA 1OVSA 1VRBA 1MS5A 2VG9A 4MX3A 3UL2A 2PHRA 1H9PA 3DYMA 5FO7B 4AFAA 5F1RA 1APNA 5IATA 4P02B 1GQPA 2X05A 4JX0A 2DCYA 4Y20A 2DCJA 5HPOA 3QD6A 1DBNA 4JVAA 5ABJB 4P9GA 4LXLA 2WFF3 5T50A 4XF4A 2AGSA 3N35A 4Q0SA 4ZZ8A 4KGGA 1O3RA 3VLBB 3S7IA 4EN6B 3VHOA 1JZ6A 4N7IA 4MGZE 1NG0A 1ST8A 1ND2B 4X6RB 3FUQA 3NL1A 3UK9A 5FYBA 4AXOA 2XGXA 3LEGA 2LROA 2RS53 1LECA 1Z7S3 4PHZA 1RITA 2J1SA 5E88A 1UYPA 4BPZA 5A70A 2BW8A 1DQ5A 3G6JB 3ZO0B 1TVGA 4AE2A 1J84A 4MHUA 1H9WA 2YXSA 3D82A 3ILNA 4LLOA 3NNGA 3LSDA 1RVF3 1IPSA 1UO9A 1VAKA 2CSGA 4N9IA 3V0AA 1NA1B 1W2UA 4LIUA 4AVSA 5K0UC 1PMIA 2RS52 1Z7S2 1M4WA 2VGDA 4G4FA 2JDUA 3WD5A 4Z92B 3N9OA 1Y7BA 1RXGA 4GWIA 2PQQA 1VBA1 5F3GA 5FP9A 3UKVA 2FBEA 2VNOA 3UGGA 1QHDA 2NN8A 1NKGA 2VTFA 5FZDA 4RHV1 4CPBD 4E4HA 1DHKB 3B3QE 4DOUA 4ASLA 3HT1A 1OLRA 1JN2P 3BALA 3GDBA 4LMFA 2X5IB 3RFRA 2YUEA 4F7ZA 4QX2A 3TYJA 2QQUA 2ZGQA 3UYJA 2ZGMA 4BWOA 2VOVA 2PLV3 5BNQA 1W06A 2YFUA 3K46A 1ND3B 3LF7A 1EAH3 3EO6A 3FFQA 3R4UA 1WW7A 2VZQA 1GZWB 4D0QA 1Y9GA 1LB2A 1UOJA 2QQNA 3ON7A 2VXJA 4TSVA 3U37A 2WUHA 3ZSJA 5CBLA 3VKFC 5JXHA 2ZGSA 2KD7A 5DABA 1VBB1 4QXKA 3TWIA 1RUH3 2ID4A 4LULA 3ZMNA 5FLHA 4CDWC 4GMP0 2G9FA 5FKBA 1UYYA 1MZ6A 3E1F1 2RR11 1H8TB 1H30A 1OD5A 1QOOA 1VRH1 4NJ4A 2H0BA 3VN4A 5FP4A 3S5QA 3I97A 4LE3A 4ISQA 4PBOA 4R4XA 2EIGA 4IEUA 1WCQA 4XETA 4YWAA 2AEZA 3RDIA 4LK6A 2Q0AA 2VOTA 2QDRA 2WC2A 2UYAA 4A45A 3AJZA 4INDA 1FNZA 5EIYB 4E27A 5FY5A 3RYRA 3O1PA 3M7AA 3ZKYA 4ES8A 1XJAA 4L99A 1OOPB 1XPWA 1LHUA 2W46A 3LDRA 2DUOA 1FXZA 2WLPA 4M00A 1HN0A 3DECA 4IESA 1LENA 4QDRA 5A7NA 2ENRA 2BYVE 5DAVA 3BPSA 1GBGA 4P14A 5A7PA 3ETPA 1VBA2 2ZJCA 4XHXA 3WNXA 4CP9A 2D5FA 3URFA 5C9AB 4WVMB 3H9AA 1OC1A 2VM9A 3NVCA 4PQ9A 3AX4A 1X8EA 2VQAA 5FZ9A 1IPJA 5DG2A 3T08A 2B5HA 4CPBA 1HB4A 2E51A 3I59A 3OPWA 1OFNA 1OA4A 2AR6A 2WAOA 4HOOA 4SBVA 3OGGA 2XR4A 5C4WC 3HVDA 3WNLA 2YBPA 3I3DA 2EICA 4LUMA 2WWSA 1IG3A 4A44A 2VUJA 1MQTB 2PN5A 2P3YA 4FT8A 5GZGA 2OPWA 5IJRA 3KGLA 1DQ4A 3VGIA 3MZHA 5LBCA 5A7SA 1OBNA 1TE1B 2AACA 4IEOA 1VBB2 1JZ8A 4Q8KA 2QQMA 1GP4A 4LNVA 1ZBE1 4QM9A 1YFYA 3VBRC 3A7QA 1US3A 1ENRA 1SQ4A 2R7EB 3CQOA 2DVDA 1JOPA 2WNVA 3FC0A 3PIGA 1I1EA 2RR12 1VRH2 2XL9A 3K4ZA 3KCXA 2JENA 4JGZB 1W6NA 4WM8A 3WUCA 3HIFA 4YGEA 3WW3A 1BVVA 5CFCA 3LOBA 1BVP1 4Y5TA 1FT9A 4PDWA 3VBSA 3VZNA 1W39A 2R071 4RQPA 4XYXA 4RFT0 5J37A 1XE7A 2VNRA 3FLRA 4E4DX 4E4ZA 5C5UA 1O4ZA 3MFAA 3TN91 2H0VA 1VIWB 1AYM1 1FAYA 4PQQA 3LGRA 4NHXA 4OMCA 4CDXB 1GQHA 4MXWB 1UOGA 3ZFGA 1POQA 3NO8A 2EXJA 2ZMNA 1W8FA 4K1YA 3WLUA 1AR61 2UY9A 5FPXA 2E7TA 2Y33A 2BVVA 3WG2A 4BZ4A 3O14A 5FOJB 1LR5A 3OF1A 1S0EA 2WWJA 2ZGPA 3VBHA 3U14A 4YG0A 3VBOC 1NCRA 1UKRA 2CU5A 5CIRA 5LRSA 4IE5A 4XACA 2VAUA 3E6BA 1FNYA 1U5YA 4QHBA 4M3CA 2A70A 2JJ6A 3ACGA 3OGJA 1RUE1 1W8WA 3NV2A 4P9XA 4K7JA 1H6XA 2OUJA 5A32A 1F4AA 2OPKA 5DZEA 1YFWA 3NAPA 1PNGA 4OLLA 4BMEA 1XYOA 1UN1A 4B4RA 3VD4A 2Z5WA 4NRMA 1NLSA 1JU4A 3GBFA 4OULA 1AJOA 4S2GA 4WM7B 2RMU3 1UW8A 3BCWA 5HXMA 1H2KA 2W47A 3N9QA 4NHKA 2GP5A 2CHHA 1COV1 4FVVA 1W6QB 3Q8CA 3RS6A 4XFGA 4ZKTB 1LOEA 2IFWA 4QX7A 3NW4A 5F2SA 4MUVA 1K45A 5DZGA 1RUC1 2W91A 3RWNA 2Q8CA 1JZ4A 3KB5A 4BXSV 2WS93 3ZOIA 2PAKA 4O61A 4AAPA 1GUIA 1IGOA 4MV2A 2EXIA 4AHYA 1AYM2 3WF1A 4CVUA 3AMQA 4FPGA 2QUOA 4HPKB 4CEWA 3ZFEB 3E6DA 1N3OA 4Z8BA 2VW2A 4A4AA 2V5YA 5KHJA 4AVTA 4MH0E 1CQ9A 5KC5A 5C8CC 5FJKA 4LKEA 2XXZA 4PIYA 1UIKA 4QQHA 4Y5Z0 1AR62 4XFHA 2I07B 5IT6A 3C7OA 1DLLA 3PUSA 5C9AC 2XHKA 4NO4A 5T5OA 4BHPA 2C24A 3O0WA 1PHMA 4PF1A 4Z1VA 4QXCA 1W8UA 4H14A 2UYBA 3GALA 2UWBA 4LBLA 3RNSA 4B3NA 1BYHA 1A34A 2NQYA 2WRAA 1GZTA 2JEMA 4NWWA 1KDKA 5JUVA 3SH3A 4XJ8A 3OPTA 5CKMA 2TEPA 4MZUA 1MQTC 1RUE2 5A7WA 1GWMA 4EWAA 3NKGA 2IXHA 3MW3A 2WO2A 3VV1A 2C5DA 5IVFA 4FTBA 4N8MA 3FWEA 3MIEA 4Y26A 2DU0A 4P5HA 1PIV1 5EP9A 5FZHA 5FMDA 5L7OA 2FMYA 3NV4A 4LBQD 3I8TA 1W6OA 3MW2A 2R1BA 2RDNA 4O7XA 4XBLA 4XDOA 4DXSA 4TYSA 3WQBA 1KGYA 2BV4A 5BNOA 3RVHA 1RMU1 3ACFA 3K48A 3U75A 1LJ7A 1LOFA 1N3PA 4AHZA 1FI2A 4N9HA 4MG2A 4LQRA 2XLGA 2VUCA 3WNNA 3V0BA 3ZYRA 1LGBA 5FO8B 1NYWA 4QPWA 3PVOA 4AEDC 3AVRA 1ZM1A 1OH3A 4AGVA 4DQAA 5J48A 1RUC2 1IQAA 3KF3A 3LDBA 3M4FA 3C7FA 1PVC1 3OBTA 1HQWA 3MGUA 2JDZA 3TRSB 2PFWA 2B7YA 2TUNA 2W3JA 1MEC3 1OLQA 4GWMA 3P3PA 4KGQA 4CEYA 2R062 3D3AA 4UBGA 3VL8A 2BGOA 2VUAA 4CDXC 5KXDA 5C6CA 1PO23 3DCQA 1JUHA 4QPYA 1QH6A 4D7TA 2WKKA 3OTFA 4YZ3A 1REDA 2P34A 5JXIA 4XQWA 3H7JA 5FAXA 1YWKA 4M0HA 1KJLA 3VKOA 3RI8A 1YRZA 1UWWA 5JDBA 2A6YA 1REFA 2BWAA 1IS6A 2GMEA 4RYDA 1AR83 5IFPA 1B35A 5CA6A 4JKKA 1XU1A 1FV3A 1CX1A 4GAZA 4B1MA 1QQP1 3IAQA 4DB5A 2WT0A 4EWEA 3VBSC 2O14A 1H2NA 1PO22 1PGW2 4XZPA 2GAUA 3LEKA 3KM5A 1LAJA 2YBSA 4CUAA 4AQTA 4OHZA 3U78A 3J8F3 1AR82 3AMHA 3W21A 5IK8A 2V5DA 3CJIB 4COVA 1GNHA 2CV6A 4Q4X3 4WM7C 1AR73 2IXJA 4Q2FA 4E2QA 1QIQA 2WZEA 4Q4V3 1IQDC 1WA6X 4FPHA 4RL7A 3PUIA 2VECA 5FKCA 1D4VB 2QE3A 4HK8A 4IE0A 2VQTA 4LBQA 2IZWA 3FLPA 3WP4A 3ZR5A 2VY0A 1AXKA 1S4CA 3BTYA 3I49A 3BN6A 4EWDA 4FOWA 3NNMA 2CWMA 3PNAA 5BNPB 4Z07A 1HV1A 1ZZ8A 2A6XA 3PIJA 4JKMA 2BERA 1E57A 1N1SA 1U12A 1DIWA 1AR72 2D3SA 1ZX5A 3J7LA 1PVC2 3PURA 4Q4X2 3ZPYA 3ZXEA 4AOCA 1BZWA 4JV4A 4Q4V2 4I09A 1P8JA 3ECQA 5K7PA 4OMDA 2Z42A 3NAPC 4R8HA 4RS5B 5JXJA 3O0XA 2Q1FA 2PMWB 1EPZA 5LY2A 2OW4A 5I0SA 1TEIA 1H1IA 1SLTA 2YZ4A 3NJZA 3KMHA 1CPMA 4BB3A 1DYPA 2WABA 2VTXJ 5FBJA 4FFIA 4XF3A 2FHRA 4YVSA 1RUJ1 3VKMA 2VMEA 3UESA 4YARA 5CADA 4D7SA 5DMYA 3VZOA 3I2HA 5CZKA 3H0OA 3RRDA 1C5IA 2DFCA 2WJSA 2V73A 3KT7A 4NAOA 3HOBA 2R30A 4UF0A 4B4PA 5G05L 4BK4A 4NN0A 4BMBA 1HXS3 4CDUB 1ZBA3 5C7GA 3O1SA 1XNDA 3HN3A 4CUGA 4CEWC 3KQRA 2L9LA 3AL6A 2WBKA 3AYDA 5F2WA 2P37A 4YM0A 3M70A 4ZHNA 1S0CA 1CAUA 4GULA 3KLSA 5DN2A 1ZZ7A 3AP4A 3NJYA 3U07A 2D40A 3NWKA 4AWDA 3MF6A 4BA6A 4LJHA 5DUUA 1KDMA 2E7AA 2N7GA 4COUA 4XMAA 1MVEA 1OF3A 4N90A 4YPJA 1O3SA 1K3IA 3EBRA 4RD7A 1ZBA2 5D8AC 1JYVA 2Z4FA 5DAXA 1NCQB 1S2EA 1SPPA 1W6PB 3OUJA 2E63A 5FYSA 4AHWA 1A78A 1AZDA 5I91A 1OD3A 4I3GA 2XQRA 2PHFA 2RM23 5FZIA 3NKTA 4UFJA 2LRPA 4YZ2A 2VNVA 1OXCA 5IK7A 1C8M1 1OKQA 3BTZA 3VBFB 1CN1A 2R043 2Y6HA 3PUAA 3AZZA 4UW6A 1QJU1 2W1SA 1AL23 1CZVA 1UPIA 3VZKA 3IB3A 5FYIA 2HWC1 5CKQA 3WNPA 2NZ9A 5I93A 2ZEYA 5C8WA 3I3QA 5KHIA 3C7EA 4AL9A 1WLCA 5KXBA 1W0PA 1O59A 4W65A 5TSWA 3M3CA 5FBZA 4R9CA 4B8EA 4COZA 5ISLA 5J1XA 4XVHA 4YZ4A 3T2QA 4E8DA 1O91A 2BTVC 5A7OA 3W59A 4FFGA 5AFEA 4LO8A 4QHZA 3O1UA 2D6NA 4UYBA 1G7YA 3NSTA 4N53B 2PHTA 5J09A 1BEV1 1W90A 3DF0A 3BVCA 3T30A 3ZLIA 3DUIA 2OX0A 2YPDA 5C3PA 5JIAA 2R16A 4QGMA 5GLZA 1IKPA 3POEA 4TLFA 4GALA 3SH4A 3WY6A 1PM4A 2JB8A 3POYA 1FPN1 3ZYHA 4BDVB 1JXNA 3T0BA 4DUVA 1V00A 3FJSA 4NUBA 4O9EA 1QNWA 1B35C 2WZR1 1DGWX 4QKBA 4FTSA 5EJZB 2MHFA 3ZSKA 2JG9C 1G9FA 3DN7A 1GP6A 2YC2A 4ZU4A 1BHGA 5FZOB 1I9RA 3IWZA 1F35A 4FPYA 4IEVA 1CGPA 3VHNA 1KXGA 1T6BX 2BRTA 4OI1A 5K0UA 3AZWA 2R1DA 1YI7A 4KG8A 5LY1A 3OBRA 5AC91 3T1MA 1DDLA 2VZSA 3H8UA 4P9LA 1EV13 1ODNA 1NOVA 2ZMLA 2HWC2 4Y1UA 5FZAA 5C71A 5FP3A 3VUOA 2V4VA 5FZGA 2ZGNA 4K21A 4LBNA 5GLWA 5IFTA 3VHRA 2VW1A 5FY4A 1OKOA 4RR3B 2XWBB 2ZKNA 3RMYA 2GDFA 3IDBB 3USUA 4BM8A 2HWD3 4OHWA 1QXJA 4A3XA 4AI0A 4NRQA 1O4TA 3GM8A 3ZN5A 5C5TA 3ST7A 3IM0A 4UOJA 4ZS2A 5HV4A 3ZDVA 1CAWB 1SFNA 4J6GA 4UAPA 1GOHA 2BDRA 3AYEA 4HMZA 2QQWA 4CDUC 4OHYA 1A8DA 3WZ1A 3VD3A 1G9CA 1HRI3 2GC2A 5FV3A 2IFRA 5DAWA 2BNMA 1J3QA 3S30A 2J1UA 4LO4B 5IK4A 3EJKA 2YV8A 4XJUA 3PU3A 4Q8LA 4CDWA 1EPWA 1W03A 2HEYF 4Q0QA 4OHXA 1RUG3 3M3QA 3N9LA 2VMIA 4RGGA 4X8PA 1ZZ6A 1YFXA 4FPKA 3NNJA 3K3NA 3OYWB 1X9PA 4HN1A 5FMCA 1R093 1J59A 3SKJE 1ZZCA 2QQOA 2WZR2 4LOTA 5HXVA 1OSGA 4XF1A 4SLIA 4FBFA 5FY9A 1AL0G 1WW6A 3ZM8A 2XKPA 2CGOA 5DDJ2 4EE2A 1W8NA 4ASKA 4QPGB 3RZLA 3RYKA 3O12A 4FXGB 3HNMA 3CMGA 4IV1C 2ZHKA 4LO5B 2HYKA 2CY6A 4I0WB 1W9YA 2H6CA 3OOXA 3PJQA 3T3YA 2C4XA 4FOQA 4V1PA 1UNBA 1BCXA 5AC92 1TME3 1EP0A 1YCIA 3I4IA 1O5LA 1QY4A 2JDMA 4IV3B 5JR7B 3JB8A 1XNBA 1O8PA 4LK7A 3FX3A 2VZOA 3TEWA 1L7LA 3JBG1 3OEBA 1YJKA 1PO11 1R1ZA 2WNUC 3KVAA 1J83A 1R1A1 2XJPA 4L92A 3BOWA 1QJX3 4QWNA 2TNFA 4LT5A 2WQZC 3F2ZA 3IPVB 1R083 3D0SA 2QVSB 3FBYA 4XJ9A 4N43B 4W8JA 5DZFA 5F5CA 3WW1A 1LGCA 4AI1A 5IVEA 1LCLA 2A6VA 3ZN4A 4D6RA 3PVEA 4IEXA 3ZXAC 1RUD3 3BIEA 4FP3A 5JOZA 3HMYA 3LCPA 1V0AA 1K42A 3INAA 2K0GA 1ALYA 1MS3A 3H42B 4Q4W1 2QCSB 2CTVA 1NE6A 1QJX2 2WL1A 3WP3A 1BMV1 4JQRA 3E97A 4E8CA 1GOGA 1ND2A 2W08A 4J25A 5FYTA 3CIHA 3VDDA 5JR2A 2A7AA 1C8NA 3WR0A 5KWRA 2VMHA 3WX5A 1UY0A 1RUD2 1VALA 5HCAA 3NNLA 1UZVA 2OKXA 2XG3A 3GZAA 1RUF1 2GP3A 5FWEA 3ASIA 3JU9A 3WDWA 3ZXLA 5L36A 5GZEA 4JDMA 1D7PM 2PHXA 3I2JA 3LPGA 2P3KA 4AI8A 3PJYA 2DUQA 3POJA 5D21A 2Y0IA 2XJVA 5J98B 3VD9A 2RJLA 3TEXA 4CDQB 3HJRA 3MIGA 1QMJA 1ZRFA 4Z82A 3MLKA 1VE0A 2R6QA 2OS2A 1JW6A 4K6BA 3OJBA 5I8SA 2ILMA 3ZDSA 3OUHA 3R0RA 1LHOA 1WLDA 2WLQA 2PHWA 1HX6A 3ELNA 3GHMA 2GN3A 4K9SA 3VHPA 4NIIA 5A3LA 3H3UA 3EMRA 4LHSA 3WG4A 4C0HA 3O1MA 1RB8G 1PO12 4G3YC 2CL2A 1YYNA 4XFBA 2XMLA 3IDCB 2A6WA 3VBOA 2ZMKA 1SFYA 3AP7A 2UY8A 4JRLA 5GKAC 1ND3A 3S0MA 3AZYA 1NE4A 1GZWA 2XOMA 2VO5A 5M0TA 4MGKE 2UWCA 4HT1T 1A3KA 4QX5A 3VBUB 1OVPA 2O8OA 1MS0A 2Q4SA 1SLAA 5CFDB 4CXXA 1W6MB 2RS11 3ITQA 4Q4W2 2D6LX 2W1UA 1ZZ9A 2EXKA 1VAMA 2WT2A 2PELA 3AP6A 2ZA9A 4IGPA 2JDAA 4QAWA 4AR2A 5IHRA 1BLZA 2VBBA 4YW2A 1BMV2 3J7MA 2XWJB 2ARCA 3BTAA 4IXLA 1NQDA 3HBZA 4GQ7A 4LBJA 1WA4A 2ZHMA 4CUBA 1F8VA 1Z78A 3FFZA 1HKDA 4XDPA 4O65A 4EJRA 5L9RA 5A80A 4FP2A 4A7ZA 4ZU7A 3A4UA 3JQWA 4UFHA 1C5HA 4Y20B 1W2OA 1RUF2 2HWF1 3ATGA 2W87A 2BFUL 5BYNA 2NMNA 1QEXA 1W28A 3GNEA 4HLTA 4XZUG 4GB31 5CFCB 4C90A 2IVIB 2BPA2 1OQEA 4S2FA 2NP0A 1OOPA 1J1TA 5FLIA 4PCRA 1TQ5A 4DUWA 3H8OA 4WVZA 4LIVA 2J7MA 4HKLA 4AFMA 5IVCA 2WO7A 2YROA 1DGRA 1QJFA 5C8CA 1UYZA 4F83A 1F5FA 3KV4A 5C9AA 3CEWA 4WVMA 2FCUA 3O5SA 3B9IA 2QTWB 2TBVA 1S0JA 2LUWA 4XOGA 1YNAA 1WMXA 4BOWA 4R4ZA 5DUVA 1U0AA 3WNKA 1VBA3 2CWSA 1EY2A 4FFHA 4H2AA 4NOTA 2YG0A 2Z69A 3B02A 5SV8A 5FREA 5BY5A 4D69A 1C57A 1QF3A 4A6SA 1MQTA 3MV01 4QHOA 1W3VA 1BBT1 5BV6A 4RGAA 1MVQA 1E5IA 1ZZBA 2ZHNA 4WVVA 1CAVB 3RZGA 1ULDA 4YGCA 2RS12 2HEVF 4OUEA 4Y1VA 4XTMA 4IEYA 1RUI1 3SQOA 5JIUA 3QCWA 1QJZA 4AVBA 4RHV2 5A6QA 2D6PA 4KU7A 4TTGA 1REEA
chains in the Genus database with same CATH topology
4UFHA 1Y9MA 3LDKA 3LIGA 5ANNA 3LF7A 4B1LA 3H3LA 3PIJA 3PIGA 3U1XA 3HBKA 4UFIA 4FFHA 1Y9GA 1W2TA 5FK8A 5FMDA 3UGFA 5FK7A 2XQRA 4UFKA 4CCCA 4UFMA 3LIHA 3IMMA 3U14A 3UGHA 4UFJA 2AEYA 4JQTA 3RWKX 3LFIA 5FIXA 3LEMA 3LDRA 1ST8A 4FFGA 4QHZA 5FMCA 3U75A 4CCEA 4HXCA 5FMBA 3NMBA 1Y4WA 3UGGA 4UFLA 4AZZA 3SC7X 4CCDA 5FKCA 5FKBA 2ADDA 1UYPA 3ZR6A 4FFFA 3OSDA 2AC1A 2QQWA 4FFIA 3ZR5A 4B1MA 3KF3A 3S5QA 2OXBA 4EQVA 2QQUA 2ADEA 2QQVA 3KF5A 2AEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFH A;  1Y9M A;  3LDK A;  3LIG A;  5ANN A;  3LF7 A;  4B1L A;  3H3L A;  3PIJ A;  3PIG A;  3U1X A;  3HBK A;  4UFI A;  4FFH A;  1Y9G A;  1W2T A;  5FK8 A;  5FMD A;  3UGF A;  5FK7 A;  2XQR A;  4UFK A;  4CCC A;  4UFM A;  3LIH A;  3IMM A;  3U14 A;  3UGH A;  4UFJ A;  2AEY A;  4JQT A;  3RWK X;  3LFI A;  5FIX A;  3LEM A;  3LDR A;  1ST8 A;  4FFG A;  4QHZ A;  5FMC A;  3U75 A;  4CCE A;  4HXC A;  5FMB A;  3NMB A;  1Y4W A;  3UGG A;  4UFL A;  4AZZ A;  3SC7 X;  4CCD A;  5FKC A;  5FKB A;  2ADD A;  1UYP A;  3ZR6 A;  4FFF A;  3OSD A;  2AC1 A;  2QQW A;  4FFI A;  3ZR5 A;  4B1M A;  3KF3 A;  3S5Q A;  2OXB A;  4EQV A;  2QQU A;  2ADE A;  2QQV A;  3KF5 A;  2AEZ A; 
#chains in the Genus database with same CATH topology
 2FZ1 A;  5LA9 A;  4E4S A;  3SCH A;  4KQ7 A;  1WMD A;  1F2N A;  2D3R A;  1VBB 3;  5L9B A;  4AED A;  2XPJ A;  1CR7 A;  4O9G A;  1G9B A;  4UFK A;  3C2U A;  3JXS A;  4PBP A;  2HWF 2;  5ERL A;  3ZN6 A;  4CCK A;  2VCA A;  5SV5 A;  2DVB A;  1UY2 A;  1W9T A;  2RR1 3;  1W0N A;  1VRH 3;  1XNT A;  2SLI A;  4CU9 A;  4GB3 2;  3T2P A;  2D6M A;  3MHZ A;  1E5S A;  1AR9 1;  1QDC A;  3POG A;  5ABJ C;  5IVB A;  2XJU A;  5J7M A;  1DZQ A;  4CDX A;  2QNK A;  3M1H A;  5A3P A;  2BZD A;  1JYC A;  1YIP A;  2G19 A;  4MO3 M;  2PA7 A;  4EZ4 A;  5BNN B;  4Q5O A;  4CCL A;  1K12 A;  2XVK A;  4A41 A;  1ND2 C;  4LR4 A;  3VD7 A;  1F4H A;  1V6N A;  4AFB A;  1YXW A;  4MSV A;  4CCM A;  4IEQ A;  4DIQ A;  1CIW A;  2QQJ A;  3GBW A;  3ZKU A;  4PI2 A;  3AJY A;  1KFX L;  1FX5 A;  3HBK A;  5FR3 A;  1ULG A;  2JX9 A;  4IEP A;  1Q56 A;  3TBD A;  2VZU A;  3OBZ A;  2W39 A;  4AG4 A;  4I0A A;  3RWK X;  3ZXD A;  4B7K A;  4I0B A;  2P3I A;  2ARB A;  4BYY A;  3AB0 A;  2JD4 A;  4XCB A;  2XJR A;  1S0D A;  2W1W A;  1WCD J;  1WWY A;  3SC7 X;  3RGB A;  1NA1 C;  4YGB A;  1BBT 2;  1NXD 1;  5T5P A;  5CFD C;  2BUK A;  3RZH A;  2FQP A;  4QDS A;  4UW3 A;  3H50 A;  3UT0 A;  5JPN B;  4TZD A;  2XQX A;  4QGN A;  5LK7 B;  2D93 A;  1V6L A;  1CPN A;  3ZVX A;  1NAE A;  2RS3 1;  4WM7 A;  5F39 A;  4GZ9 A;  4PI0 A;  4COY A;  3LZZ A;  3NV3 A;  2WDB A;  3T2T A;  2VZP A;  3AFG A;  2BOI A;  2FDF A;  2GN7 A;  2NPI A;  2X5I C;  3IKW A;  4AEK A;  3O1T A;  1TG7 A;  3AKR A;  4QKN A;  2YHJ A;  3KD4 A;  1VMF A;  2PHU A;  3V65 A;  2ES3 A;  1YI9 A;  3FL7 A;  5J96 B;  4ONU A;  4QPI B;  1ND3 C;  2J22 A;  3I2F A;  1HRV 1;  1O8S A;  4K8R B;  1IZ3 A;  3POW A;  3BYW A;  4QDQ A;  1W9F A;  4U2A A;  4R9A A;  5EWS A;  5LZ6 A;  2HBT A;  3VDB A;  4JAA A;  1VBE 1;  3ZFE A;  4ZY9 A;  4LLF A;  3LE0 A;  5FZE A;  2ZX1 A;  2VBP A;  2WNV B;  2R07 3;  3LSE A;  2CYF A;  4XFC A;  4WM8 B;  1W6N B;  3NQH A;  1SLC A;  3UNP A;  5FZ7 A;  1ZBE 2;  1W9W A;  4K1Z A;  2DFB A;  3JUU A;  3WDX A;  4IE6 A;  1ODM A;  3TN9 3;  1H8T C;  1DGL A;  3K4D A;  1AYM 3;  4W6Y A;  4Y1Y A;  4PDW B;  4CP0 A;  5A6Z A;  3N4M A;  3SH5 A;  3UGH A;  1YQ5 A;  4RQP B;  1OT5 A;  4UW5 A;  2NMO A;  4DY3 A;  4YZ1 A;  5I0D A;  5JCT A;  4XQ4 A;  5EFU A;  5FXV A;  4OI0 A;  5JXG A;  2JE8 A;  4YW1 A;  1PK6 B;  2P6C A;  4P9J A;  4A7K A;  3KCY A;  4LKS A;  2R07 2;  1AR6 3;  2XHN A;  2Y64 A;  1OA3 A;  5FP7 A;  2F17 A;  4XBQ A;  2F6B A;  4QX0 A;  3KV9 A;  5FXW A;  3CJX A;  3KGZ A;  2FDK A;  3MIF A;  4ARX A;  3ZFG B;  4WBB A;  1G6N A;  1HJF A;  2ZGU A;  4GD4 A;  2W68 A;  3TN9 2;  3D5O A;  3ZIW A;  1OOP C;  4XAE A;  1KS4 A;  3T0A A;  3ZYB A;  3MPB A;  5FZC A;  5FPV A;  1XU2 A;  5FUI A;  4KBB A;  1DZR A;  2ORZ A;  4KMQ A;  5FZB A;  3O7O A;  2ZGR A;  3PDQ A;  4JZR A;  1VB2 A;  1RUE 3;  3OUI A;  3VBH B;  1W8H A;  1UZZ A;  2WT1 A;  5HCB A;  3LKJ A;  1NCR B;  3RPQ A;  3AP9 A;  3MDP A;  2P1B A;  3GHN A;  5D8A A;  5J36 A;  4NIH A;  4M3C B;  5KC6 A;  3P1I A;  1IOA A;  3B5L B;  1FV2 A;  3R6S A;  1F15 A;  3QOP A;  4RN5 A;  4URA A;  1NQJ A;  5A32 B;  4CZS A;  5T3N A;  1UU6 A;  5A6Y A;  4EQV A;  1COV 3;  1LGN A;  5JMO A;  2VNG A;  1JHN A;  5HV0 A;  4MYE A;  4W6X A;  4OI2 A;  3S57 A;  1JOJ A;  3M3E A;  5I8T A;  2RDS A;  3SEP A;  5T52 A;  3DYO A;  1X50 A;  3FHA A;  2EF6 A;  1RUC 3;  3SIT A;  4V2W A;  3SCG A;  2MEV 1;  1CJP A;  4Z2A A;  1J58 A;  4YM2 A;  1RIR A;  2JE7 A;  3A22 A;  2X8K A;  1QH7 A;  2VUD A;  3H7Y A;  3B00 A;  3JZV A;  4ZXK A;  3LPF A;  1JZ2 A;  1IPK A;  1YJL A;  2R06 3;  3T1L A;  4JGZ C;  1COV 2;  5ACA 1;  5JZG B;  4K3U A;  5HBA A;  2JDH A;  4F8A A;  4K40 A;  3BGA A;  3W20 A;  1VP6 A;  3HNY M;  4FTE A;  2ZS6 B;  4JTN A;  1IG0 A;  3KQ4 B;  3RJ2 X;  5FZL A;  2XH6 A;  2X10 A;  3F95 A;  5CU1 A;  2QQP A;  3NNF A;  4AK3 A;  1DQ2 A;  4KNC A;  5GZF A;  3T4H B;  4GH4 B;  1VAV A;  1MZE A;  2ZGO A;  4XIO A;  3ZSE A;  5F5I A;  2ZGT A;  2XLA A;  2IXK A;  4IGO A;  3WHU A;  1FMD 1;  1GMM A;  3VB9 A;  4MGI E;  1G9A A;  3SEE A;  4B29 A;  3I2G A;  1W04 A;  2YDE A;  3J8F 1;  2Z2S B;  1Q3E A;  4XXP A;  4AVV A;  3T0D A;  2CNA A;  3U0Z A;  2WO1 A;  3FMG A;  3ZXJ A;  2GND A;  3I3E A;  4UW4 A;  3GGL A;  4LBM A;  4KWU A;  2VZV A;  1YIF A;  1PIV 3;  4R9B A;  4AQ2 A;  2DWR A;  5FYV A;  2R0H A;  4BLJ A;  2JG9 A;  4KI5 M;  1UX6 A;  4S2D A;  1O5U A;  1ULE A;  1WCS A;  2CGN A;  2D43 A;  5AVP A;  3KV5 A;  2A71 A;  4HFS A;  1RMU 3;  2JG8 B;  1ZRI A;  3WNM A;  2BFU S;  1SG3 A;  3B93 A;  2AH2 A;  5LA2 A;  4DEV A;  5L7O B;  5FOB B;  1V6J A;  1CAX B;  1POV 1;  3BPZ A;  3MUZ 1;  2W52 A;  3VDD C;  5BNO B;  4ET7 A;  1WD3 A;  2YBK A;  1PIV 2;  3V64 A;  5JVV A;  4AEM A;  1LU2 A;  2MEV 2;  3IAP A;  2OII A;  1IHM A;  1Y9Q A;  4Y22 A;  5FYM A;  5KXC A;  2VOK A;  1PVC 3;  3TNQ A;  4NVP A;  3N7M A;  4XAA A;  2EVX A;  1WLW A;  2VE1 A;  2G9Z A;  2LAL A;  1RMU 2;  5F7U A;  5ACA 2;  1AYN 1;  4BE3 A;  5F37 A;  3AK0 A;  4GKY A;  4QT6 A;  2KM2 A;  1JOD A;  2BU9 A;  3K4A A;  3JD7 1;  5FJH A;  3W9A A;  3USS A;  1UD1 A;  1H2L A;  5D1I A;  5E1R A;  4B1L A;  4CEY B;  3HR9 A;  3U1X A;  5GZC A;  3HQU A;  3DV8 A;  2K2S A;  1S0F A;  1ULO A;  4LEJ A;  5GLT A;  4YRD A;  2EID A;  4BQY A;  2ZHL A;  2ZGK A;  4CDU A;  2HEW F;  2C6S A;  2AEY A;  1MS9 A;  4KL1 A;  1V9U 1;  3R05 A;  3ZFE C;  5FPL A;  4D6S A;  1QQP 3;  1OUR A;  2EA7 A;  1SHW B;  3WEZ A;  1XRU A;  1UOF A;  3N7L A;  2RDQ A;  5FZ8 A;  5H9R A;  4HZF A;  3VL9 A;  4D6Q A;  1NZI A;  1LOC A;  1DZT A;  1HJG A;  1YFU A;  3BU0 A;  3WVJ A;  2VOX A;  2GSY A;  4IL7 A;  3NJX A;  5FY8 A;  2ZEX A;  2HWB 1;  2UUR A;  1LKN A;  2GU9 A;  3QH6 A;  2O8Q A;  5LEK A;  3LA3 A;  3MIH A;  4YFW A;  3RMX A;  1LEM A;  5FYU A;  1W6P A;  5F8P A;  3DPR B;  5LRR A;  1FAT A;  4LA2 A;  5B2G B;  1QQP 2;  2Y60 A;  2XUE A;  5JOX A;  2VCB A;  3LA7 A;  2LS6 A;  3EB7 A;  2QQI A;  2ZAH A;  2A1X A;  4CUC A;  1PNF A;  1SMV A;  2R49 A;  1WCK A;  5E16 A;  4IV1 A;  2BGC A;  2P2K A;  1D0G A;  5A33 A;  1GV9 A;  1YO8 A;  1XSQ A;  1SEF A;  2JE9 A;  2XBO 1;  2VW0 A;  2Y8K A;  4LOR A;  5T54 A;  4BH9 A;  3DXU A;  3OGS A;  1K5J A;  2WNO A;  2E26 A;  3HWJ A;  1SDW A;  4BU2 A;  5IYY A;  1SLB A;  1CON A;  1JTZ X;  2W95 A;  3K75 B;  5F3I A;  4CE8 A;  5JPM B;  4AQS A;  2P6H A;  4QM8 A;  2WZP P;  4EN7 B;  2DVF A;  2WNU A;  4LHN A;  1ASJ 1;  1AYN 2;  1HW5 A;  2AYH A;  3CDZ B;  3WDU A;  4DEQ A;  5FK8 A;  3U4X A;  2O0O A;  2VU9 A;  3JD7 2;  2JKX A;  4FPE A;  1BJQ A;  1H0B A;  1S0I A;  4UFM A;  4XE9 A;  3SMH A;  4AGG A;  1OF4 A;  3PMS A;  1YQC A;  3ZYI B;  3ACH A;  1C28 A;  2A3X A;  2E9Q A;  2I2S A;  4NHM A;  4NPM A;  5FO9 B;  5LEJ A;  5FWJ A;  4Q4Y 1;  2OZJ A;  3Q8B A;  1MZ5 A;  4OVE A;  3I54 A;  2RHP A;  1JYX A;  1XNC A;  2I74 A;  2VVE A;  1V9U 2;  2A5Z A;  1UAI A;  2ZOE B;  3WF3 A;  1RHI 1;  2Q8D A;  5DUW A;  4YVS B;  4CCJ A;  3N3H A;  4GMP 1;  2AUY A;  1N1T A;  4XQD A;  3ALQ A;  4PJY A;  4A2U A;  4QXH A;  1ULP A;  1N1Y A;  4MHR A;  1GAN A;  2CAU A;  3KV6 A;  1C4R A;  2XLF A;  5FLJ A;  1LOG A;  1RUJ 2;  3POB A;  4M01 A;  2HWE 1;  4AW7 A;  4UF0 B;  2VMC A;  4MGT A;  4L8Q A;  4MGQ A;  5F32 A;  4UT5 A;  3GBG A;  1VB4 A;  4HK9 A;  5FZO A;  3ZFF B;  2D98 A;  5DAP A;  1UKG A;  3RQ0 A;  2VCC A;  4MAD A;  2WSV A;  1WD4 A;  1PGS A;  2QQL A;  2EAL A;  2Y26 A;  3MO4 A;  1GNY A;  4QX3 A;  4XJA A;  5GLU A;  1ZRE A;  1I5Z A;  4BQ5 A;  3BOP A;  3IN9 A;  1R64 A;  5JI7 A;  3AKS A;  3GZU C;  4ISR A;  1JBC A;  1VBD 1;  1AX2 A;  3WV6 A;  3PVB B;  1TMF 1;  2FCV A;  2RV9 A;  1UXX X;  4NE9 A;  3CJI C;  5GLV A;  5HI0 A;  3OGV A;  2XVL A;  3FHQ A;  4M4P A;  5E89 A;  2VXR A;  2VUL A;  2CDO A;  1W3X A;  4QD2 A;  3KSC A;  1GOF A;  1C8M 3;  1ZRC A;  5LK5 A;  5BUV A;  3B9C A;  5EHD A;  1JYN A;  1Q8P A;  1VR3 A;  5FK7 A;  1QJU 3;  3RSJ A;  2GZW A;  2Q1M A;  2ZX2 A;  4HBN A;  4YVW B;  2Q8O A;  1ASJ 2;  4A6O A;  1D4M 1;  4PLN A;  1QJY 1;  1HLC A;  1O7F A;  2HWC 3;  4L0P A;  4OI4 A;  4AI2 A;  1PZ9 A;  3AYA A;  4YSF A;  5BNP C;  1LOD A;  3D8C A;  4MLO A;  4OUM A;  1CAW A;  4DMI A;  2DUP A;  2C9A A;  2WSU A;  2YMZ A;  1UCX A;  3ENR A;  3LOI A;  1VPH A;  4DZG A;  1C8M 2;  2WYS A;  4Q4Y 2;  5A3N A;  1CIY A;  1WCU A;  2D6O X;  3GJB A;  5C33 A;  5JOW A;  3AXD A;  2FMD A;  2OQ6 A;  2F4L A;  3ORJ A;  2ADE A;  1QJU 2;  3IBM A;  4RS5 C;  3PTR B;  3TNP B;  2B42 B;  1SBD A;  1H1A A;  2Y0O A;  1W8T A;  5BXX A;  1SCS A;  4B4Q A;  5HCF A;  1OPM A;  1RHI 2;  3E5U A;  3H3L A;  4LUK A;  1G9D A;  3J7N A;  3I7D A;  1HRI 1;  2C0Z A;  4IE7 A;  5FUP A;  1YUD A;  3VDC A;  4Q29 A;  4KBZ A;  1BEV 3;  3IZO A;  5A7Q A;  3UV9 A;  3OYW A;  2O1Q A;  3POF A;  4JQT A;  2ARE A;  2J42 A;  2JDP A;  2Y6G A;  5F3C A;  5CAZ A;  2HWE 2;  3P6B A;  3WP6 A;  4I01 A;  3L2Y A;  3D0J A;  1JS9 A;  2MPF A;  5JWP A;  2QDN A;  3MIB A;  4P9I A;  5FP8 A;  3DKW A;  4PLM A;  1FPN 3;  1XC6 A;  4DY5 A;  1CX4 A;  1YC6 1;  4EN9 B;  4QPG A;  1FOD 1;  2WN3 A;  2R32 A;  4BLI A;  1Q8V A;  4W50 A;  1SZB A;  1BEV 2;  2QQV A;  2WZR 3;  2B46 X;  4QMA A;  3U11 A;  1SDD B;  5LWB A;  2BP6 A;  1YQ8 A;  4XW3 A;  4XCA A;  1ZRR A;  1TMF 2;  1UMH A;  1KD7 A;  1V6M A;  2XL7 A;  5DDJ 3;  5CG8 A;  2YC0 A;  4IQP A;  5DG1 A;  1LES A;  4IV3 A;  1QOS A;  1URX A;  4GKX A;  4JHT A;  4TLG A;  1FPN 2;  1DFQ A;  1U5I A;  4YG6 A;  3UKT A;  1OLM E;  1GLH A;  3WG1 A;  4DRR A;  2A75 A;  3WF2 A;  2ZGL A;  3WUD A;  2EXH A;  2UU8 A;  2G4I A;  2ZZQ A;  3UET A;  1NCQ C;  5AC9 3;  2GAL A;  1H2M A;  2ARA A;  3WW2 A;  1VBC 1;  4XFA A;  5FZM A;  3IPV A;  2VMF A;  4YW5 A;  4AVC A;  5E6H A;  3S6P A;  2P5B A;  2Y6L A;  1QJY 2;  4EN8 B;  2WII B;  1RUO A;  2VPV A;  4NMI A;  1C3H A;  3MLJ A;  1PMJ X;  5LBF A;  3IDE A;  3RZK A;  3VBF C;  1E5H A;  1QXP A;  2GMP A;  2ZKL A;  1R08 1;  3JQX A;  5L73 A;  3WQ7 A;  2WYF A;  2VL4 A;  4CCO A;  4TWT A;  3SXW A;  2ERF A;  2ZTN A;  3RJR A;  1LED A;  4ATE A;  4C1X A;  4RFR B;  3OGR A;  4R9D A;  5GM0 A;  4CCC A;  4IDZ A;  2HH9 A;  2DTY A;  3LA2 A;  3ZSL A;  4XIK A;  1LHN A;  1UZ0 A;  4XUN A;  3USU B;  4QX8 A;  3OD4 A;  5FY1 A;  3EXU A;  1OUS A;  4JDO A;  3DYP A;  4OHV A;  3VKN A;  2JWP A;  2P3J A;  1XSR A;  3ZR6 A;  1GP5 A;  5FXZ A;  3WQ0 A;  3ME2 A;  5F6L B;  3H8X A;  4ZON A;  2W94 A;  3M3I A;  3ZXG A;  2WQ8 A;  3HQR A;  1NLR A;  4N53 C;  1FOD 2;  5FZ0 A;  5I0U A;  5ABJ A;  4Q0P A;  2D44 A;  1HB3 A;  4EN0 A;  1XNK A;  4CDW B;  5LAS A;  3O1R A;  5C3R A;  1CES A;  1QKQ A;  1X8M A;  3KZ4 C;  3ILR A;  4Y1X A;  1KS5 A;  1WMF A;  1XXN A;  1AVB A;  1X33 A;  1GQG A;  4JC1 A;  4Q27 A;  1K5M B;  2WFF 1;  2VQ0 A;  4IEZ A;  5DQ0 A;  4FPL A;  1G86 A;  1IKQ A;  1EYB A;  3AYC A;  2ORX A;  1UYX A;  4HKW A;  2DTW A;  3CLP A;  1MS4 A;  4CYD A;  3WCS A;  1UZW A;  4DNY A;  3ACI A;  1VBC 2;  2ZEZ A;  2RS5 1;  4JGY B;  1Z7S 1;  1KEX A;  2ZEW A;  4ITC A;  2W92 A;  4Q1P A;  3A21 A;  5IWF A;  3EHK A;  2IXI A;  1UOB A;  1NA1 A;  3JBG 3;  1OQ1 A;  2ZX3 A;  5T5L A;  1PO1 3;  1HV0 A;  2Q5T A;  3OBA A;  5CFD A;  1XYN A;  3HEI A;  1W6M A;  3ZXK A;  1R1A 3;  3AXE A;  4J1X A;  3GF6 A;  4YM3 A;  3JCI A;  1US2 A;  4DXR A;  1QOT A;  1M06 G;  3DXT A;  1CJD A;  1RVF 1;  3O0V A;  2WA4 A;  1JZ3 A;  2PHL A;  1E5R A;  3A0K A;  1V70 A;  3L9J T;  3OY8 B;  1HQN A;  4LBK A;  1F31 A;  1WW4 A;  2VQU A;  3GXU A;  1KFU L;  3IDA A;  2BBA A;  5FZF A;  4K20 A;  2NLR A;  5FFO C;  5FY7 A;  4BXF A;  5C4W B;  1AX1 A;  4MGS A;  2X5I A;  3CKH A;  3JBG 2;  2ZAC A;  4RR3 C;  3WCR A;  2FZ2 A;  4Q4W 3;  3BI3 A;  2HBU A;  5JOY A;  2FDG A;  1S0B A;  3C8X A;  3PUH A;  1XOY A;  1R1A 2;  4OFG A;  3CBN A;  3LFM A;  4P5Y A;  1ONA A;  5T5J A;  1HQL A;  4CRQ A;  4D7Y A;  1XQN A;  1Y9M A;  4B7E A;  2UWA A;  4BIS A;  4NR1 A;  4DXT A;  4CU8 A;  3K2O A;  2GH2 A;  1ZNP A;  4LHK A;  5FZ3 A;  5FQ0 B;  1IS4 A;  4OYU A;  2PLV 1;  2DV9 A;  3SNM A;  3KHC A;  1DYO A;  1I6X A;  4HSJ A;  1HB2 A;  1EAH 1;  3D6E A;  4MET A;  3RG0 A;  3VBR B;  3VDD B;  3TB0 A;  4C8D A;  1GKB A;  1RUF 3;  4V2V A;  4BJ0 A;  1J3P A;  5F5A A;  4AGR A;  4FSJ A;  2GNB A;  3M2M A;  2FD8 A;  4Y5S A;  3AFK A;  5KHG A;  3Q8F A;  1VJ2 A;  1Q8O A;  1DGR N;  2WFF 2;  3U4S A;  1H8T A;  2V72 A;  1IS5 A;  4MVT A;  1GSL A;  1RUH 1;  4A7Y A;  3H1W A;  1N1V A;  4XEZ A;  1AHS A;  1RTV A;  3O1O A;  1JH5 A;  3FE5 A;  1DF0 A;  3GZE A;  3HQX A;  3THC A;  4LTA A;  3UJQ A;  3GCX A;  4OZX A;  1WLT A;  3PME A;  5JLV A;  2CGP A;  2NYY A;  5EQU A;  4QPG C;  2RVA A;  2JD9 A;  3TOJ A;  2ATF A;  2VH9 A;  1LUL A;  4XJW A;  1Q8S A;  1GZC A;  2DBI A;  1CAV A;  3I2O A;  1B09 A;  1LNS A;  4FPJ A;  3TEY A;  1LRH A;  1RVF 2;  2DDU A;  2RJK A;  4FPO B;  4TXW A;  4IV3 C;  3C7G A;  3J4U H;  3VBO B;  5C3Q A;  2J1R A;  3N36 A;  2AEN A;  3AC0 A;  1OA2 A;  3T09 A;  3HT2 A;  1U5X A;  1BK1 A;  3LDK A;  2RS1 3;  4JCK A;  2KXL A;  1MZF A;  1UF2 C;  4C1W A;  4LO6 B;  3V0A B;  1AJK A;  4N43 C;  3A0N A;  4A3Z A;  4RHV 3;  5LA1 A;  4Y33 A;  4CXW A;  2A3W A;  5IW0 A;  4X8N A;  4EV0 A;  2YPJ A;  1QGL A;  2JDK A;  3KHB A;  2PLV 2;  4UBH A;  1Q43 A;  1OHF A;  3AZX A;  4WZF A;  1GU3 A;  1RJ8 A;  2W9X A;  4Q26 A;  1EAH 2;  1QNY A;  5DXD A;  5JSO A;  4BQW A;  3AMN A;  4AYU A;  1KRI A;  4LO7 A;  1XB9 A;  2HWF 3;  2Y6F A;  5BNN A;  2HJI A;  4QKD A;  1OI6 A;  4NHY A;  2DVG A;  1J3R A;  1K5M C;  2PTM A;  3CU7 A;  4GB3 3;  3LIH A;  1LU1 A;  4BK5 A;  1ULF A;  3MID A;  5F5Q A;  4EYU A;  3B69 A;  2V4A A;  4JGZ A;  3J9S A;  1RUH 2;  5BPX A;  4KWK A;  2JXA A;  1RC6 A;  1JYI A;  4C0B A;  5DPN A;  3QH7 A;  2E6V A;  2B9V A;  2J1A A;  3CF6 E;  3WOG A;  3IMM A;  3BB6 A;  4JGY C;  3N7J A;  3SKV A;  3ZSM A;  3RZJ A;  2BQP A;  2C1F A;  3PVN A;  1X36 A;  4L9B A;  5FMB A;  3LEI A;  3T4V A;  1PM7 A;  4QX1 A;  4QGL A;  1JI6 A;  5C8C B;  2PHD A;  1DP0 A;  1WGP A;  4CDQ C;  2ET1 A;  4RSU A;  3WXP A;  1YLL A;  1UMZ A;  4MXW A;  3FHI B;  4N7U A;  1MAC A;  4NPR A;  3THP A;  4JKL A;  1S0G A;  1YQ6 A;  1RUN A;  5CKN A;  1UMI A;  1SAC A;  3KWV A;  1BBT 3;  1D2S A;  1X82 A;  2ZAB A;  4COW A;  5CIS A;  1LOB A;  2KA3 A;  2Y6J A;  3KT4 A;  3WNO A;  2GNM A;  4Z2W A;  3CHX A;  3MFC A;  2E7Q A;  4ATF A;  3NJV A;  1RUI 3;  2VOW A;  3SHR A;  1MS8 A;  3LEM A;  1SCR A;  4QPI A;  1Q8Q A;  4Y4Y A;  2NM1 A;  1GYK A;  1A8M A;  4MXV A;  4XPV A;  3BTX A;  3VBU C;  1VMH A;  5FZ4 A;  3N7K A;  3SCF A;  5KXE A;  1PGL 1;  2VTX A;  3RZM A;  4OQ9 A;  1ULC A;  3MW4 A;  4PLO A;  1DG6 A;  4CP9 B;  4HVR A;  1LHV A;  4UXA A;  4HN0 A;  2ZX4 A;  2ARX A;  5A3O A;  2FDJ A;  2YYO A;  4XAB A;  1JU3 A;  1RUI 2;  1D0H A;  2BJS A;  2ZZJ A;  1LHW A;  2MNG A;  5F6K A;  1W2T A;  3I59 B;  3X29 B;  3KS7 A;  5EZW A;  1AR9 3;  2QQK A;  4AED B;  1W6Q A;  2XJQ A;  4AFC A;  1WW5 A;  2XJT A;  4HSL A;  3H1M A;  3E5X A;  2W0X A;  3ZN6 B;  3CO2 A;  1UQX A;  2IVJ A;  2RG4 A;  2Z79 A;  2RMU 1;  3H1Y A;  1OPO A;  1PK6 A;  1WZX A;  4FQ4 A;  3W5N A;  2IC1 A;  2OZ6 A;  2AZ5 A;  2BNO A;  1OQD A;  4XUO A;  1ZBE 3;  5JSR A;  5L19 A;  5EPA A;  1ZRD A;  1AXY A;  1GNZ A;  1UY3 A;  3HD8 B;  1RXF A;  1V6I A;  3MEP A;  4P00 B;  3SIS A;  4RGK A;  1AR9 2;  4XUP A;  3ZYG A;  1DCS A;  4HPK A;  4HG6 B;  1PZ8 A;  1Y43 B;  2WS9 1;  2QFE A;  4L97 A;  1UXZ A;  4CCN A;  4L11 A;  1UY1 A;  4XUQ A;  4NAM A;  4OCT A;  4UFI A;  4Q0V A;  2VZ1 A;  3A23 A;  3LD8 A;  4IW3 A;  3WW4 A;  2A3Y A;  1YQ2 A;  4KU8 A;  4BIF A;  1W0O A;  2JEC A;  2VVD A;  1GWK A;  3VBS B;  4BQ1 A;  2EIB A;  4YGD A;  4KWL A;  4CXY A;  4R52 A;  4ZU5 A;  5FZ1 A;  4PF5 A;  2DCZ A;  3H3Z A;  5K4L A;  3V56 A;  4UFL A;  4AZZ A;  4YM1 A;  1HIX A;  4M3C E;  2C26 A;  3ROU A;  5AFB A;  2RS3 3;  4WVW A;  5K8S A;  3AKP A;  2DYC A;  4FFF A;  5AVA A;  2AC1 A;  5A3U A;  3M8L A;  4BQ2 A;  1PGL 2;  2DVA A;  3ZYP A;  3I2K A;  1S55 A;  4IEW A;  1GWL A;  4X6Q B;  3RI9 A;  2JDN A;  1DU3 D;  1JYW A;  4HKO A;  4WV8 A;  4FPC A;  2ZPX A;  4HAN A;  4FOV A;  4HVQ A;  1V6K A;  2G1M A;  1HRV 3;  2IUW A;  2GNT A;  2RS3 2;  3ZPO A;  2D7F A;  3QLQ A;  4CA9 A;  4F3J A;  2VZ3 A;  1NZC A;  1RGS A;  1TZO A;  1VBE 3;  2HYX A;  2W5F A;  2Y38 A;  5A3T A;  5JZG A;  2RMU 2;  2ADD A;  1J1L A;  4QQO A;  3PUQ A;  4E2S A;  3ZYJ B;  4NIA A;  2R06 1;  3OG2 A;  3MIC A;  2V09 A;  1XE8 A;  2JB4 A;  4H7L A;  4XF9 A;  1JUI A;  1HRV 2;  1RJ7 A;  1ZA7 A;  3NAP B;  2PYT A;  4FPF A;  4GJZ A;  4LPL A;  1JZ5 A;  5LCW L;  4JHZ A;  4GH4 A;  2WFP A;  5ANN A;  2YU2 A;  1VBE 2;  5FMO L;  4CP2 A;  2BWC A;  2WS9 2;  3BUC A;  3Q8A A;  4XF0 A;  2DBN A;  1YHF A;  2R0F A;  3P5B A;  4BQ3 A;  2A6Z A;  4XUR A;  5BNN C;  5CG9 A;  2QKD A;  1MEC 1;  1Z0H A;  5FIX A;  4Y1Z A;  2PAE A;  3W5M A;  1SLL A;  3BU7 A;  1DQ0 A;  1PO2 1;  1PGW 1;  1HDK A;  4ARY A;  5FY0 A;  4YW6 A;  1ACC A;  2PXJ A;  3PL0 A;  5CB7 A;  1HN1 A;  2WAA A;  3DKQ A;  4FAG A;  1T2X A;  1QDO A;  5H9P A;  1UZY A;  3S5A A;  4E9K A;  4W6W A;  3BIW E;  1AR8 1;  4CEW B;  1IS3 A;  3FZ3 A;  5G04 L;  3THD A;  3H8R A;  2JG8 A;  3TAY A;  4GA9 A;  3Q8E A;  2YGM A;  1OMI A;  2JKB A;  1AF9 A;  2EIE A;  3K51 A;  2LTN A;  3QBQ A;  5FYY A;  4D3W A;  1S2K A;  3LAG A;  4QXB A;  5KR7 A;  1CAX A;  5FYZ A;  1ENX A;  3CJI A;  3UKN A;  3N9M A;  3E5Q A;  4M3C F;  5D8A B;  3B94 A;  4HXC A;  5GZD A;  2EAK A;  4IE4 A;  2VMG A;  1CZT A;  1OFS A;  2QJV A;  1BKZ A;  1NY7 1;  4D94 A;  2DU1 A;  3HN1 A;  5GJ6 A;  1D2Q A;  1UU5 A;  4Q4X 1;  1AR7 1;  5FCC A;  1S1A A;  1RL3 A;  4EZH A;  2K9Z A;  2MEV 3;  3MF9 A;  4JRA A;  2LM3 A;  4Q4V 1;  5CVR A;  5A7W B;  1ENQ A;  4KG0 A;  5BNP A;  3ES4 A;  5IK5 A;  4QPI C;  1A6C A;  2VR4 A;  2ZAA A;  3PU8 A;  4XDQ A;  5IUQ A;  4C91 A;  3VZJ A;  4IUG A;  1WKY A;  2J1E A;  2W2I A;  2YFZ A;  3ACL A;  2X29 A;  4K8F A;  5ACA 3;  5IAX A;  4M0N A;  5A1L A;  2CDP A;  3VZM A;  1DGW A;  3R4S A;  3RYP A;  2OUH A;  1XYP A;  1W6O B;  4RS5 A;  1GZ9 A;  5FPB A;  5H9S A;  5KHH A;  2WNV C;  4ZZ5 A;  4NIG A;  2D3P A;  4NWV A;  1O3T A;  4XIL A;  4AI9 A;  4FXK B;  4WM8 C;  4CP1 A;  3VKL A;  2F4P A;  1MEC 2;  1WUV A;  2YU1 A;  3V0B B;  4GXL A;  1QU0 A;  4ORF A;  5CFC C;  1XE0 A;  1TNF A;  2KR2 A;  4JDN A;  4QQP A;  4PDW C;  5LW9 A;  2GH8 A;  1AUY A;  1ZVF A;  5L9V A;  4RQP C;  5FDB A;  4I2O A;  4XHB A;  4A42 A;  2B39 A;  2WZ8 A;  4YFZ A;  3KF5 A;  4D8M A;  1NLQ A;  3DPR A;  3AKQ A;  1PK6 C;  1FMD 3;  1JMU B;  3E6C C;  4IGQ A;  1H1M A;  4CTE A;  5JAX A;  4YW3 A;  4XTP A;  3ZFG C;  5F9T A;  3ZYF A;  4UI9 L;  5A3W A;  1ZYB A;  1GIC A;  2B9U A;  2JIG A;  4GWN A;  2VBD A;  2BOJ A;  1FYU A;  5IVJ A;  5D2A A;  2Q1Z B;  4LA3 A;  5FZ6 A;  4YG3 A;  4AVA A;  2I45 A;  3KT1 A;  1HXS 1;  4H55 A;  3ABZ A;  4OUS A;  1FMD 2;  5B4X A;  1ZBA 1;  5FYH A;  1UY4 A;  2BNN A;  3KCC A;  1GFF 2;  1I3H A;  3VDA A;  1B35 B;  1XBF A;  3VBH C;  2WNE A;  3WF0 A;  4DRV A;  1CVN A;  4DXZ A;  2IXL A;  3J8F 2;  4XC9 A;  5LBE A;  5K9Y A;  2BBV A;  1NCR C;  1NY7 2;  3WDV A;  2JG9 B;  4PIX A;  4YNI A;  1PX4 A;  4YZ5 A;  4YW7 A;  3Q9O A;  5J3U A;  1UX7 A;  1POV 3;  3ZX7 A;  1NCQ A;  3SLI A;  3FUO A;  1RIN A;  1STM A;  2JIC A;  5DAQ A;  5FRA A;  2X53 S;  3WP5 A;  4S2H A;  4XJZ A;  4E2G A;  1H8V A;  5LAT A;  5T55 A;  1UU4 A;  1XNA A;  1PMH X;  5JSP A;  3LFI A;  4H7M A;  3VBF A;  5EYY A;  3WIN E;  4DFS A;  2CAV A;  3CNA A;  1AYN 3;  4Y22 B;  1JOB A;  3WG3 A;  3J7H A;  4URT A;  2OA2 A;  2RM2 1;  2D6K A;  2JIJ A;  4UWD A;  3JD7 3;  3TEZ A;  5CNA A;  5A6X A;  2D5H A;  4ASM B;  2R04 1;  4LBQ B;  2ZX0 A;  2OXB A;  4LHL A;  1N3Q A;  5B4N A;  2YC4 A;  4L2N A;  4CSW A;  2VJX A;  1LTE A;  2OT7 A;  1DYK A;  4ZXE A;  3B7M A;  1AL2 1;  5EJ3 A;  1W05 A;  2IWG B;  2WQ4 A;  5LB6 A;  3R4D B;  3IMN A;  3PTY A;  1QWR A;  3EYP A;  1V9U 3;  5JZG C;  4NRO A;  1L3J A;  1X9T A;  4NRP A;  1ENS A;  5H9Q A;  2RDR A;  2VCM A;  5FPZ A;  3AL5 A;  1KQR A;  1O4Y A;  2HKX A;  2C9K A;  1MPX A;  4FCA A;  2YB7 A;  3M3O A;  3ZFF A;  2SBA A;  5LA0 A;  3O1V A;  1O3Q A;  4YW4 A;  2HWB 3;  4HVO A;  4N53 A;  1PVX A;  2ETE A;  1Y4W A;  1T6G C;  4XBN A;  4I3P A;  1RUJ 3;  4GH4 C;  1SLI A;  3N9N A;  3WQ1 A;  4BCU A;  4NID A;  5E8A A;  1WBL A;  4JTO A;  5FPU A;  4FQZ A;  1H4H A;  1EUU A;  2EAA A;  3VD5 A;  1HXS 2;  2X09 A;  5A1A A;  3KVB A;  5GAL A;  2B8M A;  5LBB A;  4AAX A;  3WHT A;  3AKT A;  2GC0 A;  3W58 A;  4XUT A;  3FLT A;  3L2H A;  1Q5O A;  1OH4 A;  2HWB 2;  3MUY 1;  4BQX A;  2XBO 3;  1ZA4 A;  2GC3 A;  3FN9 A;  1VMJ A;  3K77 A;  4P9W A;  1F9K A;  4H3W A;  3LWC A;  4YVW A;  4QQL A;  2YY1 A;  2K46 A;  1UIJ A;  4IV1 B;  1VLN A;  2D97 A;  4AI3 A;  5A33 B;  1WME A;  4CCE A;  1WBF A;  4XXA A;  5FTT C;  4ERO A;  2XB6 C;  3DL3 A;  1SBF A;  2JG8 C;  4MGY E;  3P3N A;  3IIA A;  5ANQ A;  3RZZ A;  1AX0 A;  5I0R A;  1CAU B;  5L7O C;  2LW8 A;  4HL0 A;  1ASJ 3;  1OUX A;  2XBO 2;  5A1F A;  4FI9 A;  3B01 A;  3MLL A;  5BNO C;  2RM2 2;  4Y4R A;  4NPL A;  1GR3 A;  3U10 A;  1H4G A;  1F5J A;  1LOF C;  3VZL A;  5HCH A;  2IXC A;  5FXX A;  2P17 A;  4HET A;  4YYO A;  2R04 2;  2WNU B;  3NRU A;  4P9Y A;  4TN7 A;  1SPP B;  1PX3 A;  1C1F A;  2DF7 A;  1CWP A;  4Q4Y 3;  2ZCW A;  4QU2 A;  1AL2 2;  4LKD A;  3MYX A;  3OEA A;  5IVY A;  2WN2 A;  4RR3 A;  1EV1 1;  2XDV A;  4J1W A;  3ETQ A;  3OD0 A;  4FOY A;  1RHI 3;  4AHX A;  3DEM A;  1TNR A;  2G9G A;  2YGL A;  2FCT A;  4IET A;  4XFI A;  4CEY C;  3GYD A;  3AMM A;  4PT6 A;  4GMP 3;  4ZS3 A;  4XMI A;  1NX9 A;  3GZT B;  2OVU A;  4Y3O A;  4DO0 A;  4QB6 A;  4MOA A;  1YEW A;  2HWD 1;  2RE9 A;  4LOS A;  3I3M A;  4PIZ A;  4GJY A;  2VVF A;  2WA3 A;  2HWE 3;  1SBE A;  5DUX A;  1I5P A;  3APB A;  1N47 A;  1UPS A;  2PQS A;  4LE4 A;  2Q8E A;  2JDY A;  2HLE A;  2QBX A;  4HON A;  2DUR A;  2H6B A;  4QU1 A;  4AEJ A;  1SFP A;  2GC1 A;  3CL1 A;  3BKZ A;  4U36 A;  1JZ7 A;  3I3B A;  1MS1 A;  3HNB M;  4Q1R A;  1O6U A;  3MPP G;  1L7R A;  5CYY A;  1W9S A;  5DDJ 1;  5I0T A;  3WDY A;  1BXH A;  1VBD 3;  1RUG 1;  3DPR C;  1TMF 3;  2E53 A;  5APA A;  2XVG A;  4W4Z A;  4OQ8 A;  2ZXQ A;  3WDT A;  1LOA A;  1L7Q A;  1NUK A;  1R09 1;  2XON A;  4I02 A;  3NV1 A;  5IVV A;  5EYX A;  3FBM A;  4QQ2 A;  2ET7 A;  3D4K A;  4BQ4 A;  2ZBJ A;  1D4M 3;  3QAC A;  1UL9 A;  1W8O A;  1QJE A;  1VBD 2;  1QJY 3;  4YLZ A;  3UGF A;  5FMO S;  4FO9 A;  1OLM A;  2VC9 A;  4XFF A;  1C1L A;  5FUN A;  1PZ7 A;  1QXR A;  2VZR A;  4GWJ A;  2WR9 A;  2E31 A;  1TME 1;  3EQE A;  4NHL A;  2Y6K A;  4OZO A;  2Q30 A;  2OQ7 A;  4DUX A;  4GIQ A;  1EV1 2;  1NXM A;  2P4E A;  4CCD A;  3J26 N;  3PHM A;  1DQ6 A;  1D4M 2;  3HAG A;  2DCT A;  4N43 A;  3AP5 A;  5EJ1 B;  5C3O A;  5K0U B;  2GMM A;  5JI9 A;  3PLQ A;  4RA0 A;  3I2I A;  2BEO A;  3JB4 C;  3ILF A;  2Y34 A;  3MI8 A;  1NT0 A;  1QJX 1;  3N9P A;  3LQC A;  2HWD 2;  1RYY A;  3POI A;  1W99 A;  4LBO A;  2OYZ A;  3UJO A;  2VMD A;  5KHK A;  5EV7 A;  3I2D A;  3ZXF A;  3ZMO A;  1G8W A;  4Y24 A;  1CD3 G;  5FPA A;  3BOD A;  3THT A;  1RUD 1;  2WO3 A;  2XKO A;  1AXZ A;  3CZJ A;  4YVS C;  4IER A;  1K5M A;  1W8Z A;  2B4K A;  3AMP A;  3C7H A;  4LIT A;  1FOD 3;  1HRI 2;  3NMB A;  3AZV A;  5EXO A;  1W2N A;  1DQ1 A;  1BK0 A;  4P08 A;  2B45 X;  2FDI A;  2BGP A;  2QZ3 A;  2WIN B;  1U5Z A;  1RUG 2;  2PAM A;  4AQ6 A;  3K3O A;  4JGY A;  2E33 A;  3HPN A;  3OCP A;  1BQP A;  1EUT A;  2VD7 A;  4G9S B;  3ZFF C;  3C3V A;  4ZPI A;  5FYC A;  2A73 B;  3III A;  1R09 2;  2W1Q A;  4KH9 A;  3AVS A;  4CDQ A;  2WWU A;  3OPZ A;  4AF9 A;  3ZIX A;  1VBC 3;  3WF4 A;  3WSO A;  4BIO A;  5C3S A;  4KWJ A;  3DGT A;  3OY8 A;  4DPN A;  3ES1 A;  4LKF A;  2E32 A;  2RJ2 A;  3OB8 A;  5JMC A;  2J1V A;  1V6O A;  5C4W A;  3MV1 1;  3IT8 A;  4AFD A;  1TME 2;  3OSD A;  4M4R A;  4CU6 A;  1HB1 A;  2VZT A;  4WZC A;  4YVW C;  3LB9 A;  5C70 A;  1X7N A;  2BVB A;  1CZS A;  4QKF A;  3LIG A;  3G7D A;  1POV 0;  5KBF A;  1JYT A;  1DLC A;  3VBU A;  3GJA A;  5FQ0 A;  1KJR A;  4QB1 A;  3T2O A;  2XUM A;  1JHJ A;  1S2B A;  2XJS A;  4DIN B;  2QZ2 A;  4ES9 A;  1R08 2;  3POS A;  5F3E A;  3VBR A;  3AM2 A;  2DCK A;  5FZK A;  3CZU A;  4QB2 A;  4DS0 A;  4I30 A;  3S7E A;  1W2A X;  4CU7 A;  5IAV A;  4FAH A;  1H6Y A;  5CEH A;  2FDH A;  3MBW A;  4Q0U A;  1KIT A;  3GCW A;  5I8Y A;  1Y3T A;  2J1T A;  1MR5 A;  3WT3 A;  5A3M A;  1OVS A;  1VRB A;  1MS5 A;  2VG9 A;  4MX3 A;  3UL2 A;  2PHR A;  1H9P A;  3DYM A;  5FO7 B;  4AFA A;  5F1R A;  1APN A;  5IAT A;  4P02 B;  1GQP A;  2X05 A;  4JX0 A;  2DCY A;  4Y20 A;  2DCJ A;  5HPO A;  3QD6 A;  1DBN A;  4JVA A;  5ABJ B;  4P9G A;  4LXL A;  2WFF 3;  5T50 A;  4XF4 A;  2AGS A;  3N35 A;  4Q0S A;  4ZZ8 A;  4KGG A;  1O3R A;  3VLB B;  3S7I A;  4EN6 B;  3VHO A;  1JZ6 A;  4N7I A;  4MGZ E;  1NG0 A;  1ST8 A;  1ND2 B;  4X6R B;  3FUQ A;  3NL1 A;  3UK9 A;  5FYB A;  4AXO A;  2XGX A;  3LEG A;  2LRO A;  2RS5 3;  1LEC A;  1Z7S 3;  4PHZ A;  1RIT A;  2J1S A;  5E88 A;  1UYP A;  4BPZ A;  5A70 A;  2BW8 A;  1DQ5 A;  3G6J B;  3ZO0 B;  1TVG A;  4AE2 A;  1J84 A;  4MHU A;  1H9W A;  2YXS A;  3D82 A;  3ILN A;  4LLO A;  3NNG A;  3LSD A;  1RVF 3;  1IPS A;  1UO9 A;  1VAK A;  2CSG A;  4N9I A;  3V0A A;  1NA1 B;  1W2U A;  4LIU A;  4AVS A;  5K0U C;  1PMI A;  2RS5 2;  1Z7S 2;  1M4W A;  2VGD A;  4G4F A;  2JDU A;  3WD5 A;  4Z92 B;  3N9O A;  1Y7B A;  1RXG A;  4GWI A;  2PQQ A;  1VBA 1;  5F3G A;  5FP9 A;  3UKV A;  2FBE A;  2VNO A;  3UGG A;  1QHD A;  2NN8 A;  1NKG A;  2VTF A;  5FZD A;  4RHV 1;  4CPB D;  4E4H A;  1DHK B;  3B3Q E;  4DOU A;  4ASL A;  3HT1 A;  1OLR A;  1JN2 P;  3BAL A;  3GDB A;  4LMF A;  2X5I B;  3RFR A;  2YUE A;  4F7Z A;  4QX2 A;  3TYJ A;  2QQU A;  2ZGQ A;  3UYJ A;  2ZGM A;  4BWO A;  2VOV A;  2PLV 3;  5BNQ A;  1W06 A;  2YFU A;  3K46 A;  1ND3 B;  3LF7 A;  1EAH 3;  3EO6 A;  3FFQ A;  3R4U A;  1WW7 A;  2VZQ A;  1GZW B;  4D0Q A;  1Y9G A;  1LB2 A;  1UOJ A;  2QQN A;  3ON7 A;  2VXJ A;  4TSV A;  3U37 A;  2WUH A;  3ZSJ A;  5CBL A;  3VKF C;  5JXH A;  2ZGS A;  2KD7 A;  5DAB A;  1VBB 1;  4QXK A;  3TWI A;  1RUH 3;  2ID4 A;  4LUL A;  3ZMN A;  5FLH A;  4CDW C;  4GMP 0;  2G9F A;  5FKB A;  1UYY A;  1MZ6 A;  3E1F 1;  2RR1 1;  1H8T B;  1H30 A;  1OD5 A;  1QOO A;  1VRH 1;  4NJ4 A;  2H0B A;  3VN4 A;  5FP4 A;  3S5Q A;  3I97 A;  4LE3 A;  4ISQ A;  4PBO A;  4R4X A;  2EIG A;  4IEU A;  1WCQ A;  4XET A;  4YWA A;  2AEZ A;  3RDI A;  4LK6 A;  2Q0A A;  2VOT A;  2QDR A;  2WC2 A;  2UYA A;  4A45 A;  3AJZ A;  4IND A;  1FNZ A;  5EIY B;  4E27 A;  5FY5 A;  3RYR A;  3O1P A;  3M7A A;  3ZKY A;  4ES8 A;  1XJA A;  4L99 A;  1OOP B;  1XPW A;  1LHU A;  2W46 A;  3LDR A;  2DUO A;  1FXZ A;  2WLP A;  4M00 A;  1HN0 A;  3DEC A;  4IES A;  1LEN A;  4QDR A;  5A7N A;  2ENR A;  2BYV E;  5DAV A;  3BPS A;  1GBG A;  4P14 A;  5A7P A;  3ETP A;  1VBA 2;  2ZJC A;  4XHX A;  3WNX A;  4CP9 A;  2D5F A;  3URF A;  5C9A B;  4WVM B;  3H9A A;  1OC1 A;  2VM9 A;  3NVC A;  4PQ9 A;  3AX4 A;  1X8E A;  2VQA A;  5FZ9 A;  1IPJ A;  5DG2 A;  3T08 A;  2B5H A;  4CPB A;  1HB4 A;  2E51 A;  3I59 A;  3OPW A;  1OFN A;  1OA4 A;  2AR6 A;  2WAO A;  4HOO A;  4SBV A;  3OGG A;  2XR4 A;  5C4W C;  3HVD A;  3WNL A;  2YBP A;  3I3D A;  2EIC A;  4LUM A;  2WWS A;  1IG3 A;  4A44 A;  2VUJ A;  1MQT B;  2PN5 A;  2P3Y A;  4FT8 A;  5GZG A;  2OPW A;  5IJR A;  3KGL A;  1DQ4 A;  3VGI A;  3MZH A;  5LBC A;  5A7S A;  1OBN A;  1TE1 B;  2AAC A;  4IEO A;  1VBB 2;  1JZ8 A;  4Q8K A;  2QQM A;  1GP4 A;  4LNV A;  1ZBE 1;  4QM9 A;  1YFY A;  3VBR C;  3A7Q A;  1US3 A;  1ENR A;  1SQ4 A;  2R7E B;  3CQO A;  2DVD A;  1JOP A;  2WNV A;  3FC0 A;  3PIG A;  1I1E A;  2RR1 2;  1VRH 2;  2XL9 A;  3K4Z A;  3KCX A;  2JEN A;  4JGZ B;  1W6N A;  4WM8 A;  3WUC A;  3HIF A;  4YGE A;  3WW3 A;  1BVV A;  5CFC A;  3LOB A;  1BVP 1;  4Y5T A;  1FT9 A;  4PDW A;  3VBS A;  3VZN A;  1W39 A;  2R07 1;  4RQP A;  4XYX A;  4RFT 0;  5J37 A;  1XE7 A;  2VNR A;  3FLR A;  4E4D X;  4E4Z A;  5C5U A;  1O4Z A;  3MFA A;  3TN9 1;  2H0V A;  1VIW B;  1AYM 1;  1FAY A;  4PQQ A;  3LGR A;  4NHX A;  4OMC A;  4CDX B;  1GQH A;  4MXW B;  1UOG A;  3ZFG A;  1POQ A;  3NO8 A;  2EXJ A;  2ZMN A;  1W8F A;  4K1Y A;  3WLU A;  1AR6 1;  2UY9 A;  5FPX A;  2E7T A;  2Y33 A;  2BVV A;  3WG2 A;  4BZ4 A;  3O14 A;  5FOJ B;  1LR5 A;  3OF1 A;  1S0E A;  2WWJ A;  2ZGP A;  3VBH A;  3U14 A;  4YG0 A;  3VBO C;  1NCR A;  1UKR A;  2CU5 A;  5CIR A;  5LRS A;  4IE5 A;  4XAC A;  2VAU A;  3E6B A;  1FNY A;  1U5Y A;  4QHB A;  4M3C A;  2A70 A;  2JJ6 A;  3ACG A;  3OGJ A;  1RUE 1;  1W8W A;  3NV2 A;  4P9X A;  4K7J A;  1H6X A;  2OUJ A;  5A32 A;  1F4A A;  2OPK A;  5DZE A;  1YFW A;  3NAP A;  1PNG A;  4OLL A;  4BME A;  1XYO A;  1UN1 A;  4B4R A;  3VD4 A;  2Z5W A;  4NRM A;  1NLS A;  1JU4 A;  3GBF A;  4OUL A;  1AJO A;  4S2G A;  4WM7 B;  2RMU 3;  1UW8 A;  3BCW A;  5HXM A;  1H2K A;  2W47 A;  3N9Q A;  4NHK A;  2GP5 A;  2CHH A;  1COV 1;  4FVV A;  1W6Q B;  3Q8C A;  3RS6 A;  4XFG A;  4ZKT B;  1LOE A;  2IFW A;  4QX7 A;  3NW4 A;  5F2S A;  4MUV A;  1K45 A;  5DZG A;  1RUC 1;  2W91 A;  3RWN A;  2Q8C A;  1JZ4 A;  3KB5 A;  4BXS V;  2WS9 3;  3ZOI A;  2PAK A;  4O61 A;  4AAP A;  1GUI A;  1IGO A;  4MV2 A;  2EXI A;  4AHY A;  1AYM 2;  3WF1 A;  4CVU A;  3AMQ A;  4FPG A;  2QUO A;  4HPK B;  4CEW A;  3ZFE B;  3E6D A;  1N3O A;  4Z8B A;  2VW2 A;  4A4A A;  2V5Y A;  5KHJ A;  4AVT A;  4MH0 E;  1CQ9 A;  5KC5 A;  5C8C C;  5FJK A;  4LKE A;  2XXZ A;  4PIY A;  1UIK A;  4QQH A;  4Y5Z 0;  1AR6 2;  4XFH A;  2I07 B;  5IT6 A;  3C7O A;  1DLL A;  3PUS A;  5C9A C;  2XHK A;  4NO4 A;  5T5O A;  4BHP A;  2C24 A;  3O0W A;  1PHM A;  4PF1 A;  4Z1V A;  4QXC A;  1W8U A;  4H14 A;  2UYB A;  3GAL A;  2UWB A;  4LBL A;  3RNS A;  4B3N A;  1BYH A;  1A34 A;  2NQY A;  2WRA A;  1GZT A;  2JEM A;  4NWW A;  1KDK A;  5JUV A;  3SH3 A;  4XJ8 A;  3OPT A;  5CKM A;  2TEP A;  4MZU A;  1MQT C;  1RUE 2;  5A7W A;  1GWM A;  4EWA A;  3NKG A;  2IXH A;  3MW3 A;  2WO2 A;  3VV1 A;  2C5D A;  5IVF A;  4FTB A;  4N8M A;  3FWE A;  3MIE A;  4Y26 A;  2DU0 A;  4P5H A;  1PIV 1;  5EP9 A;  5FZH A;  5FMD A;  5L7O A;  2FMY A;  3NV4 A;  4LBQ D;  3I8T A;  1W6O A;  3MW2 A;  2R1B A;  2RDN A;  4O7X A;  4XBL A;  4XDO A;  4DXS A;  4TYS A;  3WQB A;  1KGY A;  2BV4 A;  5BNO A;  3RVH A;  1RMU 1;  3ACF A;  3K48 A;  3U75 A;  1LJ7 A;  1LOF A;  1N3P A;  4AHZ A;  1FI2 A;  4N9H A;  4MG2 A;  4LQR A;  2XLG A;  2VUC A;  3WNN A;  3V0B A;  3ZYR A;  1LGB A;  5FO8 B;  1NYW A;  4QPW A;  3PVO A;  4AED C;  3AVR A;  1ZM1 A;  1OH3 A;  4AGV A;  4DQA A;  5J48 A;  1RUC 2;  1IQA A;  3KF3 A;  3LDB A;  3M4F A;  3C7F A;  1PVC 1;  3OBT A;  1HQW A;  3MGU A;  2JDZ A;  3TRS B;  2PFW A;  2B7Y A;  2TUN A;  2W3J A;  1MEC 3;  1OLQ A;  4GWM A;  3P3P A;  4KGQ A;  4CEY A;  2R06 2;  3D3A A;  4UBG A;  3VL8 A;  2BGO A;  2VUA A;  4CDX C;  5KXD A;  5C6C A;  1PO2 3;  3DCQ A;  1JUH A;  4QPY A;  1QH6 A;  4D7T A;  2WKK A;  3OTF A;  4YZ3 A;  1RED A;  2P34 A;  5JXI A;  4XQW A;  3H7J A;  5FAX A;  1YWK A;  4M0H A;  1KJL A;  3VKO A;  3RI8 A;  1YRZ A;  1UWW A;  5JDB A;  2A6Y A;  1REF A;  2BWA A;  1IS6 A;  2GME A;  4RYD A;  1AR8 3;  5IFP A;  1B35 A;  5CA6 A;  4JKK A;  1XU1 A;  1FV3 A;  1CX1 A;  4GAZ A;  4B1M A;  1QQP 1;  3IAQ A;  4DB5 A;  2WT0 A;  4EWE A;  3VBS C;  2O14 A;  1H2N A;  1PO2 2;  1PGW 2;  4XZP A;  2GAU A;  3LEK A;  3KM5 A;  1LAJ A;  2YBS A;  4CUA A;  4AQT A;  4OHZ A;  3U78 A;  3J8F 3;  1AR8 2;  3AMH A;  3W21 A;  5IK8 A;  2V5D A;  3CJI B;  4COV A;  1GNH A;  2CV6 A;  4Q4X 3;  4WM7 C;  1AR7 3;  2IXJ A;  4Q2F A;  4E2Q A;  1QIQ A;  2WZE A;  4Q4V 3;  1IQD C;  1WA6 X;  4FPH A;  4RL7 A;  3PUI A;  2VEC A;  5FKC A;  1D4V B;  2QE3 A;  4HK8 A;  4IE0 A;  2VQT A;  4LBQ A;  2IZW A;  3FLP A;  3WP4 A;  3ZR5 A;  2VY0 A;  1AXK A;  1S4C A;  3BTY A;  3I49 A;  3BN6 A;  4EWD A;  4FOW A;  3NNM A;  2CWM A;  3PNA A;  5BNP B;  4Z07 A;  1HV1 A;  1ZZ8 A;  2A6X A;  3PIJ A;  4JKM A;  2BER A;  1E57 A;  1N1S A;  1U12 A;  1DIW A;  1AR7 2;  2D3S A;  1ZX5 A;  3J7L A;  1PVC 2;  3PUR A;  4Q4X 2;  3ZPY A;  3ZXE A;  4AOC A;  1BZW A;  4JV4 A;  4Q4V 2;  4I09 A;  1P8J A;  3ECQ A;  5K7P A;  4OMD A;  2Z42 A;  3NAP C;  4R8H A;  4RS5 B;  5JXJ A;  3O0X A;  2Q1F A;  2PMW B;  1EPZ A;  5LY2 A;  2OW4 A;  5I0S A;  1TEI A;  1H1I A;  1SLT A;  2YZ4 A;  3NJZ A;  3KMH A;  1CPM A;  4BB3 A;  1DYP A;  2WAB A;  2VTX J;  5FBJ A;  4FFI A;  4XF3 A;  2FHR A;  4YVS A;  1RUJ 1;  3VKM A;  2VME A;  3UES A;  4YAR A;  5CAD A;  4D7S A;  5DMY A;  3VZO A;  3I2H A;  5CZK A;  3H0O A;  3RRD A;  1C5I A;  2DFC A;  2WJS A;  2V73 A;  3KT7 A;  4NAO A;  3HOB A;  2R30 A;  4UF0 A;  4B4P A;  5G05 L;  4BK4 A;  4NN0 A;  4BMB A;  1HXS 3;  4CDU B;  1ZBA 3;  5C7G A;  3O1S A;  1XND A;  3HN3 A;  4CUG A;  4CEW C;  3KQR A;  2L9L A;  3AL6 A;  2WBK A;  3AYD A;  5F2W A;  2P37 A;  4YM0 A;  3M70 A;  4ZHN A;  1S0C A;  1CAU A;  4GUL A;  3KLS A;  5DN2 A;  1ZZ7 A;  3AP4 A;  3NJY A;  3U07 A;  2D40 A;  3NWK A;  4AWD A;  3MF6 A;  4BA6 A;  4LJH A;  5DUU A;  1KDM A;  2E7A A;  2N7G A;  4COU A;  4XMA A;  1MVE A;  1OF3 A;  4N90 A;  4YPJ A;  1O3S A;  1K3I A;  3EBR A;  4RD7 A;  1ZBA 2;  5D8A C;  1JYV A;  2Z4F A;  5DAX A;  1NCQ B;  1S2E A;  1SPP A;  1W6P B;  3OUJ A;  2E63 A;  5FYS A;  4AHW A;  1A78 A;  1AZD A;  5I91 A;  1OD3 A;  4I3G A;  2XQR A;  2PHF A;  2RM2 3;  5FZI A;  3NKT A;  4UFJ A;  2LRP A;  4YZ2 A;  2VNV A;  1OXC A;  5IK7 A;  1C8M 1;  1OKQ A;  3BTZ A;  3VBF B;  1CN1 A;  2R04 3;  2Y6H A;  3PUA A;  3AZZ A;  4UW6 A;  1QJU 1;  2W1S A;  1AL2 3;  1CZV A;  1UPI A;  3VZK A;  3IB3 A;  5FYI A;  2HWC 1;  5CKQ A;  3WNP A;  2NZ9 A;  5I93 A;  2ZEY A;  5C8W A;  3I3Q A;  5KHI A;  3C7E A;  4AL9 A;  1WLC A;  5KXB A;  1W0P A;  1O59 A;  4W65 A;  5TSW A;  3M3C A;  5FBZ A;  4R9C A;  4B8E A;  4COZ A;  5ISL A;  5J1X A;  4XVH A;  4YZ4 A;  3T2Q A;  4E8D A;  1O91 A;  2BTV C;  5A7O A;  3W59 A;  4FFG A;  5AFE A;  4LO8 A;  4QHZ A;  3O1U A;  2D6N A;  4UYB A;  1G7Y A;  3NST A;  4N53 B;  2PHT A;  5J09 A;  1BEV 1;  1W90 A;  3DF0 A;  3BVC A;  3T30 A;  3ZLI A;  3DUI A;  2OX0 A;  2YPD A;  5C3P A;  5JIA A;  2R16 A;  4QGM A;  5GLZ A;  1IKP A;  3POE A;  4TLF A;  4GAL A;  3SH4 A;  3WY6 A;  1PM4 A;  2JB8 A;  3POY A;  1FPN 1;  3ZYH A;  4BDV B;  1JXN A;  3T0B A;  4DUV A;  1V00 A;  3FJS A;  4NUB A;  4O9E A;  1QNW A;  1B35 C;  2WZR 1;  1DGW X;  4QKB A;  4FTS A;  5EJZ B;  2MHF A;  3ZSK A;  2JG9 C;  1G9F A;  3DN7 A;  1GP6 A;  2YC2 A;  4ZU4 A;  1BHG A;  5FZO B;  1I9R A;  3IWZ A;  1F35 A;  4FPY A;  4IEV A;  1CGP A;  3VHN A;  1KXG A;  1T6B X;  2BRT A;  4OI1 A;  5K0U A;  3AZW A;  2R1D A;  1YI7 A;  4KG8 A;  5LY1 A;  3OBR A;  5AC9 1;  3T1M A;  1DDL A;  2VZS A;  3H8U A;  4P9L A;  1EV1 3;  1ODN A;  1NOV A;  2ZML A;  2HWC 2;  4Y1U A;  5FZA A;  5C71 A;  5FP3 A;  3VUO A;  2V4V A;  5FZG A;  2ZGN A;  4K21 A;  4LBN A;  5GLW A;  5IFT A;  3VHR A;  2VW1 A;  5FY4 A;  1OKO A;  4RR3 B;  2XWB B;  2ZKN A;  3RMY A;  2GDF A;  3IDB B;  3USU A;  4BM8 A;  2HWD 3;  4OHW A;  1QXJ A;  4A3X A;  4AI0 A;  4NRQ A;  1O4T A;  3GM8 A;  3ZN5 A;  5C5T A;  3ST7 A;  3IM0 A;  4UOJ A;  4ZS2 A;  5HV4 A;  3ZDV A;  1CAW B;  1SFN A;  4J6G A;  4UAP A;  1GOH A;  2BDR A;  3AYE A;  4HMZ A;  2QQW A;  4CDU C;  4OHY A;  1A8D A;  3WZ1 A;  3VD3 A;  1G9C A;  1HRI 3;  2GC2 A;  5FV3 A;  2IFR A;  5DAW A;  2BNM A;  1J3Q A;  3S30 A;  2J1U A;  4LO4 B;  5IK4 A;  3EJK A;  2YV8 A;  4XJU A;  3PU3 A;  4Q8L A;  4CDW A;  1EPW A;  1W03 A;  2HEY F;  4Q0Q A;  4OHX A;  1RUG 3;  3M3Q A;  3N9L A;  2VMI A;  4RGG A;  4X8P A;  1ZZ6 A;  1YFX A;  4FPK A;  3NNJ A;  3K3N A;  3OYW B;  1X9P A;  4HN1 A;  5FMC A;  1R09 3;  1J59 A;  3SKJ E;  1ZZC A;  2QQO A;  2WZR 2;  4LOT A;  5HXV A;  1OSG A;  4XF1 A;  4SLI A;  4FBF A;  5FY9 A;  1AL0 G;  1WW6 A;  3ZM8 A;  2XKP A;  2CGO A;  5DDJ 2;  4EE2 A;  1W8N A;  4ASK A;  4QPG B;  3RZL A;  3RYK A;  3O12 A;  4FXG B;  3HNM A;  3CMG A;  4IV1 C;  2ZHK A;  4LO5 B;  2HYK A;  2CY6 A;  4I0W B;  1W9Y A;  2H6C A;  3OOX A;  3PJQ A;  3T3Y A;  2C4X A;  4FOQ A;  4V1P A;  1UNB A;  1BCX A;  5AC9 2;  1TME 3;  1EP0 A;  1YCI A;  3I4I A;  1O5L A;  1QY4 A;  2JDM A;  4IV3 B;  5JR7 B;  3JB8 A;  1XNB A;  1O8P A;  4LK7 A;  3FX3 A;  2VZO A;  3TEW A;  1L7L A;  3JBG 1;  3OEB A;  1YJK A;  1PO1 1;  1R1Z A;  2WNU C;  3KVA A;  1J83 A;  1R1A 1;  2XJP A;  4L92 A;  3BOW A;  1QJX 3;  4QWN A;  2TNF A;  4LT5 A;  2WQZ C;  3F2Z A;  3IPV B;  1R08 3;  3D0S A;  2QVS B;  3FBY A;  4XJ9 A;  4N43 B;  4W8J A;  5DZF A;  5F5C A;  3WW1 A;  1LGC A;  4AI1 A;  5IVE A;  1LCL A;  2A6V A;  3ZN4 A;  4D6R A;  3PVE A;  4IEX A;  3ZXA C;  1RUD 3;  3BIE A;  4FP3 A;  5JOZ A;  3HMY A;  3LCP A;  1V0A A;  1K42 A;  3INA A;  2K0G A;  1ALY A;  1MS3 A;  3H42 B;  4Q4W 1;  2QCS B;  2CTV A;  1NE6 A;  1QJX 2;  2WL1 A;  3WP3 A;  1BMV 1;  4JQR A;  3E97 A;  4E8C A;  1GOG A;  1ND2 A;  2W08 A;  4J25 A;  5FYT A;  3CIH A;  3VDD A;  5JR2 A;  2A7A A;  1C8N A;  3WR0 A;  5KWR A;  2VMH A;  3WX5 A;  1UY0 A;  1RUD 2;  1VAL A;  5HCA A;  3NNL A;  1UZV A;  2OKX A;  2XG3 A;  3GZA A;  1RUF 1;  2GP3 A;  5FWE A;  3ASI A;  3JU9 A;  3WDW A;  3ZXL A;  5L36 A;  5GZE A;  4JDM A;  1D7P M;  2PHX A;  3I2J A;  3LPG A;  2P3K A;  4AI8 A;  3PJY A;  2DUQ A;  3POJ A;  5D21 A;  2Y0I A;  2XJV A;  5J98 B;  3VD9 A;  2RJL A;  3TEX A;  4CDQ B;  3HJR A;  3MIG A;  1QMJ A;  1ZRF A;  4Z82 A;  3MLK A;  1VE0 A;  2R6Q A;  2OS2 A;  1JW6 A;  4K6B A;  3OJB A;  5I8S A;  2ILM A;  3ZDS A;  3OUH A;  3R0R A;  1LHO A;  1WLD A;  2WLQ A;  2PHW A;  1HX6 A;  3ELN A;  3GHM A;  2GN3 A;  4K9S A;  3VHP A;  4NII A;  5A3L A;  3H3U A;  3EMR A;  4LHS A;  3WG4 A;  4C0H A;  3O1M A;  1RB8 G;  1PO1 2;  4G3Y C;  2CL2 A;  1YYN A;  4XFB A;  2XML A;  3IDC B;  2A6W A;  3VBO A;  2ZMK A;  1SFY A;  3AP7 A;  2UY8 A;  4JRL A;  5GKA C;  1ND3 A;  3S0M A;  3AZY A;  1NE4 A;  1GZW A;  2XOM A;  2VO5 A;  5M0T A;  4MGK E;  2UWC A;  4HT1 T;  1A3K A;  4QX5 A;  3VBU B;  1OVP A;  2O8O A;  1MS0 A;  2Q4S A;  1SLA A;  5CFD B;  4CXX A;  1W6M B;  2RS1 1;  3ITQ A;  4Q4W 2;  2D6L X;  2W1U A;  1ZZ9 A;  2EXK A;  1VAM A;  2WT2 A;  2PEL A;  3AP6 A;  2ZA9 A;  4IGP A;  2JDA A;  4QAW A;  4AR2 A;  5IHR A;  1BLZ A;  2VBB A;  4YW2 A;  1BMV 2;  3J7M A;  2XWJ B;  2ARC A;  3BTA A;  4IXL A;  1NQD A;  3HBZ A;  4GQ7 A;  4LBJ A;  1WA4 A;  2ZHM A;  4CUB A;  1F8V A;  1Z78 A;  3FFZ A;  1HKD A;  4XDP A;  4O65 A;  4EJR A;  5L9R A;  5A80 A;  4FP2 A;  4A7Z A;  4ZU7 A;  3A4U A;  3JQW A;  4UFH A;  1C5H A;  4Y20 B;  1W2O A;  1RUF 2;  2HWF 1;  3ATG A;  2W87 A;  2BFU L;  5BYN A;  2NMN A;  1QEX A;  1W28 A;  3GNE A;  4HLT A;  4XZU G;  4GB3 1;  5CFC B;  4C90 A;  2IVI B;  2BPA 2;  1OQE A;  4S2F A;  2NP0 A;  1OOP A;  1J1T A;  5FLI A;  4PCR A;  1TQ5 A;  4DUW A;  3H8O A;  4WVZ A;  4LIV A;  2J7M A;  4HKL A;  4AFM A;  5IVC A;  2WO7 A;  2YRO A;  1DGR A;  1QJF A;  5C8C A;  1UYZ A;  4F83 A;  1F5F A;  3KV4 A;  5C9A A;  3CEW A;  4WVM A;  2FCU A;  3O5S A;  3B9I A;  2QTW B;  2TBV A;  1S0J A;  2LUW A;  4XOG A;  1YNA A;  1WMX A;  4BOW A;  4R4Z A;  5DUV A;  1U0A A;  3WNK A;  1VBA 3;  2CWS A;  1EY2 A;  4FFH A;  4H2A A;  4NOT A;  2YG0 A;  2Z69 A;  3B02 A;  5SV8 A;  5FRE A;  5BY5 A;  4D69 A;  1C57 A;  1QF3 A;  4A6S A;  1MQT A;  3MV0 1;  4QHO A;  1W3V A;  1BBT 1;  5BV6 A;  4RGA A;  1MVQ A;  1E5I A;  1ZZB A;  2ZHN A;  4WVV A;  1CAV B;  3RZG A;  1ULD A;  4YGC A;  2RS1 2;  2HEV F;  4OUE A;  4Y1V A;  4XTM A;  4IEY A;  1RUI 1;  3SQO A;  5JIU A;  3QCW A;  1QJZ A;  4AVB A;  4RHV 2;  5A6Q A;  2D6P A;  4KU7 A;  4TTG A;  1REE A; 
#chains in the Genus database with same CATH homology
 4UFH A;  1Y9M A;  3LDK A;  3LIG A;  5ANN A;  3LF7 A;  4B1L A;  3H3L A;  3PIJ A;  3PIG A;  3U1X A;  3HBK A;  4UFI A;  4FFH A;  1Y9G A;  1W2T A;  5FK8 A;  5FMD A;  3UGF A;  5FK7 A;  2XQR A;  4UFK A;  4CCC A;  4UFM A;  3LIH A;  3IMM A;  3U14 A;  3UGH A;  4UFJ A;  2AEY A;  4JQT A;  3RWK X;  3LFI A;  5FIX A;  3LEM A;  3LDR A;  1ST8 A;  4FFG A;  4QHZ A;  5FMC A;  3U75 A;  4CCE A;  4HXC A;  5FMB A;  3NMB A;  1Y4W A;  3UGG A;  4UFL A;  4AZZ A;  3SC7 X;  4CCD A;  5FKC A;  5FKB A;  2ADD A;  1UYP A;  3ZR6 A;  4FFF A;  3OSD A;  2AC1 A;  2QQW A;  4FFI A;  3ZR5 A;  4B1M A;  3KF3 A;  3S5Q A;  2OXB A;  4EQV A;  2QQU A;  2ADE A;  2QQV A;  3KF5 A;  2AEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...