4HXCA

Crystal structure of a putative glycosyl hydrolase (bacuni_00951) from bacteroides uniformis atcc 8492 at 2.15 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
255
structure length
255
Chain Sequence
TTTAVSYSKSLKAPETDSLNLPIDADGYITIFDGKSLDGWRGYGKDKVPSRWIIEDGCLKFCGTGTGEGQTGEGGDLIFAHKFKNFELELEWKISKGGNSGIFYLAQEVTSKDKDGNEVLEPIYISAPEFQVLDNANHPDAKLGKDNNRQAASLYDMIPAVPQNAKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWTEMLQASKFSEEKWPLAFELLNNCGGENHEGFIGVQDHGDDVWYRNIRVKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative glycosyl hydrolase
publication title Crystal structure of a putative glycosyl hydrolase (BACUNI_00951) from Bacteroides uniformis ATCC 8492 at 2.15 A resolution
rcsb
source organism Bacteroides uniformis
molecule tags Hydrolase
total genus 74
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06439 DUF1080 Domain of Unknown Function (DUF1080)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4hxcA00
3OSDA 4CCCA 1W2TA 3KF5A 3UGHA 4B1LA 5FIXA 2AC1A 5ANNA 3UGFA 2XQRA 3H3LA 2QQWA 4JQTA 2QQVA 3S5QA 1Y4WA 3LIGA 3UGGA 3LF7A 3PIJA 2QQUA 4UFIA 5FMCA 3LDKA 5FMBA 3LFIA 3KF3A 3PIGA 3U75A 3ZR5A 4B1MA 1ST8A 4FFHA 3LEMA 5FKCA 3RWKX 4UFHA 1Y9MA 5FKBA 3SC7X 4CCDA 4FFGA 5FK7A 4QHZA 2AEZA 3NMBA 4UFLA 5FMDA 3HBKA 2OXBA 4CCEA 3IMMA 3LDRA 4FFIA 2ADDA 3LIHA 5FK8A 1UYPA 4HXCA 4UFJA 3ZR6A 3U14A 4FFFA 4EQVA 4UFKA 3U1XA 2AEYA 4AZZA 4UFMA 2ADEA 1Y9GA
chains in the Genus database with same CATH superfamily
1DQ4A 3BN6A 2O8QA 3H7JA 1O8SA 2NMNA 3H3LA 1QJU1 5IUQA 4IGOA 1G9AA 4MGZE 3A0NA 1YLLA 5CAZA 4AEMA 2OT7A 5JAXA 5IWFA 4EWAA 4YGEA 1DGRA 4H14A 4MGSA 1POV0 1JYCA 1LESA 5DAPA 3DXUA 1B09A 1YC61 5F2SA 1BMV2 1WCSA 4RYDA 3OBZA 1R1A3 1F4AA 1NLRA 1RITA 4XIKA 4A44A 1FI2A 3HNMA 2JDYA 3HPNA 2YYOA 2BUKA 2IWGB 3JUUA 3RMYA 1D4M1 3ATGA 2VUDA 4JDNA 1FV2A 3U78A 4MHUA 5BNPC 4LHKA 2DUPA 1C8M1 3WW2A 1UY3A 2D3RA 3D5OA 4YVSB 4Q4V1 3ZFFC 1MS4A 1UXZA 1ZRFA 5IVFA 5IJRA 1AL23 5A3NA 1J84A 1GWMA 3FFQA 4Y1UA 1KRIA 4HVQA 1G9BA 3WG3A 2D6PA 3VV1A 1OA4A 2EICA 1EY2A 5DABA 3R05A 1R082 5T5OA 4MGTA 1NXMA 5EJ1B 2FDKA 2XL9A 3C7FA 4HFSA 1T6GC 3VKLA 4NHYA 5FYBA 1HXS2 2CGOA 2GSYA 1R64A 2WNUA 3AKSA 3BU7A 1OOPB 2WRAA 3ACFA 1ZVFA 3GCWA 4E4HA 3N9OA 1F4HA 2XJUA 3FHAA 2VXJA 4E2GA 2ZGUA 5J98B 3VDCA 3FWEA 4YZ1A 1EPWA 4IV3B 1ZX5A 3MIGA 2XKPA 3PTYA 4YVWC 3VBRB 1YI9A 5CYYA 1I3HA 3BTZA 1IPSA 3MIFA 1QJU2 4NUBA 4Q26A 5FIXA 3VBSB 5HI0A 1QOSA 3N9NA 3KV4A 5I8YA 4IEOA 2W3JA 2WLPA 4UXAA 3RNSA 2OKXA 2R043 4AFCA 1PO23 2VECA 5HPOA 4P9WA 3VDAA 3CJIC 1LHWA 4LQRA 1PK6C 1JUIA 3WCSA 1SLBA 1S0FA 1YUDA 5CISA 3MV01 2DDUA 4NE9A 1COV1 3IM0A 4MHRA 1F5JA 1VBC3 2QQMA 2D3SA 3ZDSA 1D4M2 1W8TA 3AK0A 1W6PB 4KU7A 3SKJE 3OPZA 3K46A 1VIWB 3RYRA 1C8M2 4YZ2A 3ZN4A 4A6OA 3ZFGB 3B9IA 4Q4V2 2G1MA 4FPHA 3T2TA 2PLV3 3CL1A 5IAXA 4P08A 4DY5A 4EYUA 5FP8A 4XDQA 3I2IA 1A78A 5A1LA 4YG6A 2EXHA 3AKPA 4JQTA 2VMGA 5A32B 4URAA 4RHV2 5HCFA 4LHLA 4WVVA 3WW3A 1UOJA 5C8CC 4TWTA 1SPPA 3AXEA 4KMQA 2UYAA 1V9U3 1SDDB 2ZGMA 1PVC1 4LBJA 1IPKA 4LKDA 4W6WA 4KBBA 4GAZA 2YU2A 1MS5A 4QB6A 4XFHA 2PAKA 3LEGA 3IMMA 1J3RA 5LCWL 1GYKA 2ZACA 2E53A 5EJZB 2PHRA 3NWKA 1EAH1 3LSEA 1OLME 3I3DA 4E2QA 4R8HA 1B35A 1J58A 3THCA 1OXCA 1VPHA 2VTXA 1S0EA 2QQIA 2QQJA 4CCCA 1FATA 4QXBA 3N7LA 3WEZA 2DWRA 4XW3A 4FTBA 3VDDC 5LZ6A 1PX3A 3A4UA 5A7WA 3N7MA 3TRSB 1O5UA 4RFT0 3I59B 1COV2 1X33A 4PDWB 2P6HA 4OHWA 4AEJA 2BW8A 3SCHA 2ZCWA 2XH6A 3WQ7A 3AJZA 3NKTA 2YB7A 1V6IA 1WLTA 1TMF1 4LBLA 3ZYFA 3FC0A 1Q8VA 2A75A 2ORZA 1JOJA 3DPRC 4XVHA 5FOJB 1S2BA 4KWUA 4PLNA 1D7PM 3FUQA 5FZFA 3RG0A 1AR73 4GJZA 1YQ5A 4XFFA 4QPWA 1POQA 5FPVA 4DZGA 1RUH1 2RS33 3AVSA 4GKYA 1N3QA 4K1ZA 3W20A 3BUCA 3VLBB 4M01A 1GWKA 5A3MA 1PVC2 1O3TA 5C3PA 4CU9A 5GZGA 5K8SA 1YIFA 1GZCA 1RUJ1 2FCTA 5J96B 1MEC1 1DG6A 1ULOA 2XLGA 1JYXA 1VAKA 2RR13 2SBAA 2QTWB 3LDRA 1EAH2 1XPWA 5LEJA 1E5HA 1W0NA 3WCRA 2FDIA 2BQPA 4M4RA 3S30A 1CWPA 4Y22A 1UD1A 1WW7A 1S4CA 5FLHA 3VBOC 1QQP3 2BNMA 3SXWA 3GNEA 1OD5A 3SH5A 1N1YA 5L7OC 3KCXA 5FPXA 2VUAA 2XXZA 5F37A 2XJTA 3B00A 1NCQC 1K5MC 2C4XA 3P3PA 2E31A 4FXKB 4DRRA 1GLHA 2R071 1S0CA 3KZ4C 4PF1A 5T54A 2OYZA 4F83A 5A6YA 3INAA 2BDRA 4LKEA 4O61A 1TMF2 4JGYC 2ETEA 5IVCA 4YYOA 3RVHA 3AL6A 4QPYA 1OQEA 2Q8DA 4ASKA 1EPZA 3GM8A 2ZS6B 4FP2A 3AFKA 4LK6A 2E6VA 5FMOL 2W0XA 1SBDA 1LB2A 1AR91 2QZ2A 1N1TA 1Q8PA 1QWRA 4XABA 5C3QA 4MO3M 5E16A 3FUOA 3N9PA 3R0RA 3U07A 1S2KA 1UX7A 4XFGA 1IS5A 1RUH2 3UGHA 3ZFEA 1VBE3 4CEWC 4RGKA 5IATA 2JG8C 4QQPA 3VKFC 4JKKA 1ASJ1 3LFMA 3VL9A 5C7GA 2HWB3 3BTYA 3FMGA 5D8AA 3KSCA 4XC9A 1RUJ2 4XJUA 1MEC2 1W9WA 2ZXQA 2XWBB 3MF6A 4UFHA 2R0FA 3KCYA 4ZXEA 3AKRA 4KNCA 3ZXKA 3D4KA 2PELA 3AC0A 4XIOA 1WCUA 2VZRA 2ZEWA 3LA3A 4AI2A 1N3PA 1CN1A 1YEWA 1AJOA 3O14A 2EXKA 3AZWA 3U14A 4N53B 4GMP3 3CHXA 4ZPIA 2AEYA 4S2GA 4CDQA 1ULEA 4FOVA 4PJYA 1Q3EA 4DXZA 5HV0A 2PHUA 2DCKA 1GNHA 3WHUA 2R072 5CU1A 4LXLA 1RXGA 5FLIA 5KHHA 5F2WA 4DUWA 4AW7A 2WO2A 5F1RA 4CA9A 5KR7A 4MLOA 4OI4A 1Y9QA 3B01A 4Y1XA 3AVRA 3U37A 2OIIA 3HQXA 4IDZA 3SCFA 2XVKA 4DXTA 1BHGA 3IPVB 3WF4A 4JRLA 3K75B 1US2A 4FPCA 1AR92 3GXUA 3AFGA 4AFBA 4QKFA 3LA2A 5CFDA 4AVTA 4LE4A 4EN8B 5FPBA 2VZ3A 3RJRA 2EIGA 2J1AA 5I91A 4XBLA 2VOWA 4LLFA 2WT2A 3EHKA 3JQXA 4CEYB 1ASJ2 2CV6A 4TLGA 5SV8A 1NA1A 4LO6B 5FZ3A 5C8WA 4PT6A 3LOIA 5LRSA 3MUZ1 3DKWA 5J37A 5K4LA 2FDJA 4D3WA 3OGVA 1GZ9A 2J1UA 4QXHA 3K51A 4QX2A 3R4UA 1NQDA 4QKBA 3KV9A 1NZIA 5FPUA 1BYHA 3PJYA 4WVMB 4P5HA 4BB3A 1CAVA 1UOFA 4Q1RA 2VC9A 2DUQA 2W91A 1UU6A 1WD4A 3K4ZA 5JWPA 2ZHNA 3OJBA 4P9IA 5D8AB 4QWNA 3ZYIB 1IQDC 1U5YA 2Y64A 3RQ0A 4GKXA 3T2PA 4XBNA 5FZ0A 3M3OA 1RUD3 2UYBA 1SBEA 1JYWA 1BXHA 1X82A 2VQ0A 4HOOA 3WINE 2ZX4A 1SLCA 1XYNA 1PX4A 5I8TA 1WBFA 2SLIA 1SLIA 3O1MA 4QQHA 5JSRA 1UYZA 3WXPA 4YGCA 2WO7A 4FAHA 1RMU1 5EWSA 4HPKB 5FYVA 2OPWA 5A3LA 2RS51 4XJ9A 3B7MA 2FBEA 2R49A 1JUHA 1QIQA 3A7QA 3JB4C 3BU0A 2IXJA 1SCSA 4Y24A 5BNOB 5D1IA 2JX9A 4WM8A 4YVSC 5D21A 5FZIA 2JDKA 3OSDA 4M3CB 1J1TA 3BCWA 4JHTA 1LHUA 3Q8AA 1MQTB 4BE3A 1VBB3 2ZGPA 4NR1A 4JC1A 3NSTA 1HQLA 4ZS3A 4CZSA 2P1BA 4KL1A 4QPGA 3GZEA 1BBT3 1DP0A 1KJLA 3LEIA 2VR4A 4XCBA 3P6BA 1HN1A 4LPLA 5BXXA 4FFGA 3NJVA 3D82A 1PNFA 3HMYA 3NJXA 4P9XA 3PUIA 4YW6A 1OOPC 2PA7A 3JB8A 5JOXA 3H8XA 1CD3G 1UZYA 4M3CF 3W58A 5IAVA 1VMHA 4CP2A 3ITQA 5A33B 2X5IA 3ACGA 4IV3C 1S1AA 1LOEA 1NA1B 4MZUA 4AVVA 2R16A 3VBRC 4HMZA 1CESA 1GUIA 3ETPA 3VBSC 1LAJA 1GQHA 4J6GA 3IDEA 2AC1A 2VZUA 3AX4A 5FP9A 3MLJA 4DUXA 2VW0A 3P1IA 2Z2SB 4LBKA 4MUVA 4RQPA 3PUSA 5FZ4A 3MDPA 3FN9A 4ZZ8A 1P8JA 3PTRB 1HDKA 5L19A 3ZSEA 3BIWE 3OGGA 3W59A 2WS91 1YWKA 3LQCA 1ZBE3 2PXJA 5FTTC 2RDRA 3OUJA 4AE2A 1ONAA 2WZR1 4EZ4A 1H2NA 1N47A 1RMU2 3ZMOA 2FCUA 2RS52 3HD8B 4OZXA 2OQ6A 4DO0A 2LS6A 4BLIA 1RXFA 4CP1A 1OPOA 4X8NA 2FZ2A 1RUG1 1DZQA 1VRBA 5FO7B 1OFNA 5FZLA 2JG9B 3ZFGC 1X8EA 1VRH3 2V5YA 2R1DA 4BPZA 3A23A 4C1WA 2ZGRA 5J1XA 1RUI1 2HEWF 3CIHA 4OVEA 4AFDA 4INDA 1MS9A 3EBRA 4LR4A 4YVWB 5FYHA 4XAEA 4SLIA 4DY3A 2JD4A 5LW9A 1UZZA 5DUWA 1RUOA 1IGOA 1UW8A 3I2KA 2XPJA 4GXLA 1VB4A 3AYEA 3ABZA 4BJ0A 5CA6A 3NO8A 5CG8A 5C4WB 1KEXA 1H4GA 2DCTA 2ZZJA 1WW5A 3NNLA 4W6YA 3J8F1 4M00A 2Z4FA 1JZ6A 1CGPA 4CPBD 3K4AA 3C7OA 1GZTA 1VBD3 3THPA 3ZDVA 3USUB 1AJKA 4QQOA 4NWVA 5IK7A 3WF3A 3KT7A 1O4ZA 1GNYA 5BY5A 2BP6A 1HB2A 4NRPA 2ZMLA 5LA2A 4ARXA 3VD7A 4I30A 2XJRA 3QACA 2F4LA 5A7QA 2C6SA 5F39A 1UO9A 4GB31 1ZBA2 4M0HA 2HJIA 1VALA 2WS92 1H2MA 3VGIA 1PO11 1N1SA 4XFAA 2EAKA 2XLAA 1CZVA 1US3A 2CAUA 4PDWC 2EIEA 5KXCA 2WZR2 4DMIA 5FZ9A 3VKNA 1AZDA 3GJAA 3NKGA 2CNAA 2XGXA 4P9LA 4K20A 4QXCA 5FR3A 3CJXA 1RUG2 2GNMA 1W05A 2UWAA 4LBQA 1DQ5A 4BLJA 1BEV1 4BISA 5IK5A 3TEWA 5C70A 2LUWA 1AYM1 2OW4A 2WN2A 4IEUA 4XJZA 1RUI2 3KGZA 3PU3A 4K21A 4HSJA 1RUC3 1JZ5A 1G8WA 5FZCA 4YARA 1DQ6A 1BJQA 1OLRA 4MGQA 1O3QA 2YC4A 1IKQA 4RR3A 5LY2A 1W8NA 5FQ0B 3VKOA 1ZRRA 5FBJA 2WJSA 2P2KA 2JIGA 1GU3A 1KDKA 4LBNA 2WQ4A 4JGZA 4QAWA 1WW4A 4TSVA 1SFNA 1REEA 2GC3A 2W47A 1UPSA 4EE2A 2PHXA 4QX3A 1FOD3 3VDDB 4OCTA 1GICA 1XNKA 3ZR5A 4AF9A 2GN7A 5FY7A 3D8CA 3NNGA 2F4PA 3J8F2 1G7YA 5DDJ3 2PFWA 4M4PA 2Z5WA 1X9TA 4QDSA 3ENRA 3OEAA 3M8LA 5CZKA 3RYKA 2MNGA 5ABJA 3H42B 4P00B 5IK4A 2A3WA 1I1EA 2DBIA 1RUE2 3ZR6A 4K7JA 5A3OA 3T1MA 1A8DA 1R1A1 4HKOA 2Y6FA 2EXJA 1O7FA 2XBO1 3DF0A 3OGSA 3VBUA 3WNMA 3ZN6B 1URXA 2A70A 2Q8CA 2ZA9A 3PUHA 4GB32 1JZ3A 2BGOA 1JOBA 2JDZA 1KGYA 3PUAA 3Q8CA 4MXWB 3J7LA 1PO12 3T08A 3QH6A 1G9DA 3V0AB 2XR4A 4OI0A 1NY71 2ZGSA 3QLQA 4NIHA 1AL21 2BGCA 4YSFA 5J48A 4NPLA 3UT0A 5CKQA 4YFZA 2WKKA 1LHVA 2W9XA 2VQAA 1B35C 2OZ6A 2VMEA 3LZZA 3U11A 4RGGA 1Q43A 5GLVA 2ZGOA 4R4XA 2GP5A 3DYPA 1BEV2 1C1FA 1MVQA 2DVDA 3HN3A 3Q9OA 3SITA 4A3ZA 1AR63 4E8CA 4XETA 4COYA 1XRUA 1V6NA 4XUQA 1JS9A 5B4NA 5FDBA 2JIJA 3E5QA 1YXWA 2WZ8A 4OLLA 1PGSA 4BMEA 1YCIA 5T3NA 4CE8A 3KF3A 3BPZA 1LOFC 1OVSA 4E4DX 1WA6X 2R041 5A3WA 2B8MA 1PO21 1W6OA 3ZXDA 5FCCA 3S7IA 3VD5A 2UY9A 1VP6A 4XFBA 1JTZX 3IKWA 1R1A2 3MLKA 4N53C 1Z7S3 5FZOA 3FHIB 3ZLIA 1VBC1 3D0JA 3J26N 3LCPA 3NVCA 3PMSA 5DUUA 3VUOA 2ORXA 2JDUA 1HN0A 3MHZA 5HXVA 1O6UA 1XJAA 3KLSA 2WYSA 4QPIB 4AEDB 2WNVB 3KHCA 1H2KA 2BFUS 4KI5M 4TTGA 2PLV1 4MOAA 4R52A 4Y20A 3OD0A 2BVVA 1W6NA 2JG8B 3OGJA 4YRDA 2EIBA 2UWBA 4NO4A 1XNAA 3CMGA 3KD4A 1SZBA 5H9RA 3V64A 3O1SA 3BIEA 1W6MA 2WWSA 4YG3A 1FNZA 4P02B 1JODA 1YO8A 1V9U1 3KGLA 3KM5A 3K3OA 5EP9A 1UZWA 4UF0A 1GOGA 4V2WA 2VNOA 4YW1A 1DHKB 3I2OA 1R093 4MGYE 3UK9A 3H1YA 1A3KA 4XDPA 5F5IA 1JBCA 2G9FA 2YBKA 3PVBB 1F9KA 4FPKA 2JECA 2PHLA 1HLCA 1SQ4A 3AMMA 4U36A 4CEYC 2P34A 3T0AA 2J1EA 3N7KA 5EV7A 1TME3 4ASMB 2E63A 3POFA 2EALA 5GZFA 3RZKA 1WUVA 4RFRB 3ZM8A 5FXWA 3N36A 3PNAA 3I2HA 4NIGA 4GWMA 1KDMA 1HV0A 2YHJA 4YM0A 4B4QA 4CUGA 2R042 5A7NA 1PO22 5A3TA 2YC2A 5GZDA 2JB4A 4LLOA 4UFLA 2KD7A 3WNXA 4OQ9A 3WQ0A 5FZ6A 2VQTA 2YV8A 4YM3A 1PM7A 3S5AA 1VBC2 3ZXEA 3MLLA 4QD2A 3AYDA 2O8OA 4Y1VA 5D8AC 4CP9A 2PHTA 2A6WA 2JE7A 5DPNA 2WFF3 2A73B 2XG3A 1QNWA 3FX3A 2VCAA 3NJZA 1OKOA 2PLV2 2B5HA 1QXJA 2TEPA 1POV3 1AXZA 2OQ7A 3AP7A 1AR71 1MZEA 4C91A 2Y0IA 5LBFA 2AYHA 2BEOA 2A6VA 2PMWB 1RYYA 5C71A 5FPLA 2WA4A 4AGRA 3EB7A 3RZJA 3WNKA 2RS31 1WCKA 1ODNA 2JJ6A 4LO5B 1V9U2 4L99A 1CAUB 4G9SB 2VW2A 1QGLA 4ZU5A 3OYWA 3TBDA 5KXDA 1WCQA 3ILRA 1DIWA 1NCRA 1ZM1A 1Z78A 4BZ4A 2RR11 5BNOC 5FZDA 2W52A 2DVFA 4LO4B 2W95A 5ACA3 3I49A 4D6SA 1SHWB 3R4SA 2CDPA 4A42A 4S2FA 1HQWA 5KWRA 1QJFA 1EV13 1MQTC 1QQP1 1QH6A 2HH9A 2P6CA 2WL1A 1ND3A 5LATA 3S7EA 5FY0A 4FCAA 2FZ1A 2W92A 4YW7A 1UN1A 4HLTA 3O1RA 4GH4A 2ZEYA 1IS3A 4YWAA 3WP3A 3RZMA 2WWJA 4XUPA 1HB4A 3CO2A 5CIRA 1UOGA 3WW4A 3VD4A 2QVSB 3SC7X 3DL3A 1JN2P 4EV0A 4FBFA 3GCXA 2VZ1A 3C8XA 4IEZA 1D4VB 3IAPA 3SEPA 4CRQA 4TN7A 2DU1A 2EF6A 2XUEA 3N7JA 3T2OA 3H1WA 2Q5TA 3ZYRA 1NA1C 5FYZA 1OQ1A 1OF3A 4HZFA 4UT5A 4AZZA 3DYMA 4IV1A 5T52A 5G05L 1ZA7A 3ZX7A 1MZFA 3RYPA 3I3QA 1AR72 4OMDA 4BXFA 5KXBA 2BBVA 2W1WA 4LKFA 5JSPA 3I8TA 2ZEZA 3WDWA 1XQNA 4LA3A 1YI7A 2IVJA 2VTXJ 2JE8A 2RS32 3LWCA 3RS6A 4LO7A 2GC2A 4RHV1 5G04L 4LOTA 2ZGNA 3FLPA 3GF6A 5LB6A 4YW2A 2HWB1 5JMOA 4QGNA 1LCLA 1IHMA 3MUY1 4AI0A 3H3ZA 2N7GA 1PM4A 3HQUA 4IEPA 5A1FA 4IE0A 2RR12 2RM23 2YC0A 2JG9C 1AX2A 1GP5A 3HVDA 4CXWA 3SH3A 2RHPA 4A7ZA 2XDVA 2P4EA 5CKNA 4OUMA 3AP9A 3B69A 4FO9A 4Z2AA 1XOYA 1WBLA 3WLUA 2BU9A 1QQP2 2X05A 4GMP1 4AR2A 1MS1A 1JYTA 5DAQA 1HJFA 4AHXA 2EXIA 4OUEA 3O1OA 3VHPA 3CU7A 3KHBA 4XQ4A 2R7EB 3T4VA 2E26A 5C4WC 1QKQA 4OHVA 4XF4A 4CDWA 3TNPB 3IIAA 5DG1A 3WF1A 4D0QA 4UW6A 1FAYA 3ETQA 1ZZ6A 3PUQA 3NAPA 2VQUA 4J1WA 1T2XA 2WFPA 3KV5A 1XSQA 4WM8C 4XAAA 2L9LA 3M3EA 3OTFA 5APAA 4ZS2A 4ATFA 2ET7A 4RS5A 1JXNA 5FYIA 1AX0A 4DIQA 3ACIA 4CU7A 1VAVA 2NQYA 5IYYA 4QPGC 2TBVA 2JDNA 3WY6A 5FZMA 4W6XA 3Q8FA 4AVSA 1H6XA 4YG0A 2PHDA 4GULA 4I01A 1Y3TA 4QX5A 3THDA 2WT1A 5L9BA 1VBE2 4A2UA 3RGBA 4NIAA 1PMJX 1Q8SA 1GR3A 3D6EA 3TB0A 3WX5A 2HWB2 3PL0A 5EJ3A 1ZRDA 3RI9A 2D6LX 2X5IC 4IEQA 1QEXA 4AK3A 2QQLA 1XXNA 3CEWA 4UOJA 2VZSA 4XZUG 4IV1B 5DAVA 4PIZA 4NHKA 5C9AA 1TZOA 3APBA 4TXWA 5FK8A 1EUUA 3J7MA 1ZRIA 2B9UA 3M3CA 4RQPC 1JU3A 4DEVA 4Z82A 1QJY3 4K9SA 4OULA 1KFUL 1M4WA 2D98A 1YNAA 3MPBA 4CYDA 2D5HA 1V70A 3ZSMA 1OH4A 1MVEA 2VVDA 1ULPA 1UNBA 2BFUL 3EJKA 2VNVA 4UW3A 2Y6HA 3AJYA 1LU1A 4MG2A 1Y4WA 3ES4A 3GYDA 2XJSA 1DQ2A 4MV2A 5JXJA 1RUD1 3ZSJA 2WNUB 5CFCB 2RG4A 1KXGA 3UETA 4BXSV 3ZSKA 2XJPA 2DTWA 3T0DA 2IXLA 4LUKA 1U5ZA 2Y38A 3VBFA 1OQDA 3QD6A 5JPNB 4R9AA 3GALA 5JVVA 3CLPA 1J3QA 5JLVA 4NRMA 1DBNA 5F6LB 1STMA 4FFFA 5KXEA 1WGPA 2H6CA 1K45A 1OT5A 1S0JA 3VN4A 3ZPYA 2QNKA 3F2ZA 3ZYHA 4XQDA 1FPN3 4QM9A 5A3UA 1ZZ8A 4JCKA 1TVGA 2YZ4A 2FHRA 5FMCA 2LRPA 4B3NA 1VBB1 1L7RA 1NG0A 2GMEA 2VE1A 5FKCA 3BPSA 5K0UA 4JZRA 3TEYA 2OVUA 1SLAA 3GZUC 4L97A 2VOKA 1AYN3 3ELNA 5SV5A 4AXOA 4BQXA 5LBCA 1BBT1 2PAMA 3UYJA 3AP6A 1U5XA 2ZKNA 4Q4X3 1H1AA 4N7IA 3S0MA 1EYBA 5FV3A 1YFWA 3VD3A 4AGVA 3M3IA 4QT6A 1AL0G 4IXLA 2UU8A 2Y60A 3KMHA 3OF1A 5DZEA 4BWOA 2C9AA 2JXAA 1SPPB 2GH2A 4XCAA 1UKRA 2GZWA 3Q8EA 1CPNA 4PBPA 2VTFA 2R0HA 2QQVA 3LPGA 3BB6A 4LE3A 1J83A 3QOPA 4X6RB 4LIVA 4Y1YA 5D2AA 1SEFA 1RUD2 5KC6A 4LULA 4IUGA 4CDXA 3TNQA 2W1UA 2ZMKA 4ZHNA 3I97A 3GBGA 3LOBA 2O0OA 3J7HA 3NMBA 4Z8BA 4NPRA 1PIV3 3NQHA 1ZBE1 5EPAA 1B35B 4UWDA 4JAAA 5IFTA 5JPMB 5KHJA 1X8MA 2WBKA 1QOOA 2BPA2 4MGKE 4UFMA 2ZX1A 3GJBA 3J7NA 3ZXLA 2HWE3 1LGNA 2QQNA 3FLRA 4QPIC 5A7WB 4AEDC 3AZXA 2WNVC 1VRH1 3IWZA 5GLWA 2RJKA 4FI9A 4XJ8A 1UMHA 2Q1ZB 4LA2A 3LKJA 3JD73 3W9AA 2WA3A 1L7QA 4XUNA 2VCBA 1PVXA 4K3UA 3I7DA 1QJEA 1LEMA 1VBB2 2QQPA 4N43A 4W4ZA 4C8DA 3KCCA 1W0OA 1ST8A 3P5BA 1BBT2 3AP4A 3GHNA 2ARAA 1NXD1 1U5IA 3KV6A 3UESA 5FOBB 3VBUC 2KA3A 4W8JA 3PLQA 1F2NA 4LEJA 2P17A 4OUSA 3HEIA 3T0BA 4LIUA 3NRUA 4YLZA 5ISLA 3MICA 1YFYA 5EFUA 3VKMA 1VBD1 4CDUA 2VG9A 2VUCA 3WQBA 5JI9A 2DFBA 3WDXA 2R063 5T5PA 1VMJA 2XVLA 3HNYM 3M1HA 1W90A 3N9QA 4ET7A 5JZGA 4ORFA 1J59A 2HWC3 1IPJA 4CSWA 5GZEA 1GFF2 3MIEA 4KU8A 3VZKA 4NAMA 2GP3A 3ZO0B 3AMNA 4D7SA 4E2SA 1UMIA 4HANA 4R9DA 2WUHA 1ZBE2 3M4FA 4ZU7A 4XEZA 4Y22B 5HCHA 3CZJA 4PLMA 3BI3A 4XMIA 2VVFA 2Y6KA 1IOAA 3BODA 1SFPA 1BCXA 1TE1B 4IEXA 2W2IA 3D0SA 4KG0A 1RUNA 1VRH2 5M0TA 4B8EA 2OUJA 4Q4W3 4E9KA 1UY4A 4R9BA 5F32A 1RUC1 3T4HB 3BALA 1YQ2A 4FPLA 5BNNA 2J42A 5EYXA 3ES1A 3KWVA 2ZMNA 3SEEA 1SLTA 4WBBA 1WD3A 2RDQA 2JENA 2K2SA 3N9LA 2B42B 1UX6A 5JUVA 2BZDA 3DECA 2GH8A 1XNTA 1CPMA 2AZ5A 1WA4A 2ZHLA 1FYUA 5DDJ1 2PN5A 3ZFEB 1OUSA 1DQ0A 2ZKLA 5AVPA 1VBD2 1CAXA 1N1VA 2VZVA 3U1XA 4EQVA 2VMFA 2D6KA 4YFWA 4LO8A 3HAGA 1LRHA 4KG8A 5L73A 3WG4A 3E1F1 1W2NA 2A1XA 4AAXA 1VR3A 4H2AA 4QX8A 4CXXA 2BNNA 3GGLA 1IQAA 1CAWA 2YU1A 1C5HA 1NQJA 3AP5A 4CTEA 3WSOA 3FE5A 3K77A 4HT1T 1SG3A 3V56A 2XMLA 1QHDA 2BRTA 2UURA 4ITCA 4O65A 3ZFFA 2Z79A 3WR0A 1W2UA 1QH7A 4HL0A 1I9RA 4CDQB 5GKAC 5FUNA 3A22A 3LD8A 3OY8A 4CXYA 3AB0A 3O1PA 1T6BX 2H0VA 5CFCC 4YW5A 4ES9A 4IW3A 4LKSA 4HVOA 2HWF3 2WNOA 1AR61 2PHFA 4Y5Z0 1RUC2 3OBAA 3O0XA 1L3JA 3ZXJA 1GV9A 3WNLA 5FZKA 2CTVA 2CYFA 2QQWA 2B4KA 5H9SA 2JDPA 4N8MA 1DU3D 2B46X 5LASA 4L92A 5I93A 4DPNA 2JWPA 2YUEA 4FAGA 3MPPG 1FOD2 2YXSA 4CVUA 5FLJA 4R4ZA 1S55A 5CFDB 5JCTA 5DDJ2 4BHPA 2BBAA 3FBMA 3HR9A 3CJIA 1PK6A 4QU2A 4GD4A 1BZWA 2YGMA 2WQZC 5CG9A 1S0IA 1Z7S1 1WMXA 5FBZA 5FZ7A 3VZNA 2DVGA 2HYKA 5IVYA 1CR7A 3T2QA 4AFMA 4CCJA 3E6CC 3VHOA 4XHBA 1OFSA 4G3YC 3MW4A 1YQ8A 2E32A 4CCKA 2WIIB 3PURA 5FUPA 1QJZA 2C9KA 1NCRC 2VD7A 3OEBA 3QCWA 3URFA 1PZ7A 1ZBA1 4FPYA 1CX1A 1JZ7A 5T5JA 4C1XA 1CAVB 1MPXA 2HEYF 1OLQA 2WLQA 4TZDA 1QJX3 2VL4A 1ODMA 3L9JT 2OUHA 5C8CA 3C2UA 2IZWA 3RPQA 3WQ1A 4BYYA 2A3YA 3V0BA 3N35A 3WDYA 1ND3C 1CVNA 1DYKA 4XACA 1R091 1AR62 5DAWA 1NZCA 3OPWA 1XSRA 3W5MA 4CUAA 3O7OA 3S57A 5FO8B 2AACA 3PMEA 3I54A 4EN9B 4JHZA 1S0DA 4XF0A 1FMD3 3RWNA 2C24A 1PGW1 3JBG3 3CDZB 4FVVA 5GLUA 3B3QE 3WHTA 1TME1 2Q1MA 1UY1A 4JKLA 3I4IA 4BU2A 1ENRA 4HETA 2VUJA 4IV1C 1BVP1 3POGA 2ZHKA 4DXSA 4CP0A 5KHKA 2EIDA 2VXRA 1XU2A 3SKVA 4GALA 3BVCA 4WM8B 1YJLA 1XC6A 1E5IA 4A4AA 4FQZA 1H2LA 1LHNA 2MEV3 1Z7S2 3IZOA 3D3AA 4K6BA 1RUE1 4BIFA 2ET1A 3IBMA 1UU4A 1W9FA 4Q1PA 2Q4SA 5FY1A 5FZBA 3DPRA 4QPGB 5ANNA 2WFF1 4XUOA 4HVRA 2NP0A 4IGPA 4OFGA 3HQRA 4WVWA 1FNYA 1RB8G 2RS13 1VE0A 1POV1 2VU9A 2WNUC 1X36A 2Y0OA 3FL7A 4UFIA 1LULA 3VBHA 4LK7A 4LMFA 4COZA 2YFZA 3UL2A 2DU0A 1RC6A 2ZX3A 1XNBA 3FLTA 1AX1A 2X5IB 4QHZA 5FY9A 3ZSLA 4NJ4A 5BUVA 4PI2A 1UPIA 4CCNA 2BERA 3CZUA 1Y43B 2XVGA 3OBRA 1R092 4AYUA 2DURA 1HJGA 2WABA 2FD8A 4OYUA 2O1QA 1H8TA 4NVPA 4RQPB 2QQOA 4XFIA 1SDWA 4CU8A 2E7QA 5FYMA 3IIIA 4JDMA 1PGW2 3A21A 1W6QA 3NAPC 1GQGA 5ACA1 5I0DA 1HV1A 1DLCA 1TME2 2VOTA 2YFUA 3MF9A 4IQPA 5GLTA 5A7OA 1V6OA 1RUF3 3VBOA 4HK9A 3SISA 1CIWA 1EV11 1OURA 5L7OA 2A71A 4Q4Y3 2DCZA 5L9VA 2R32A 2WWUA 2Y26A 1PNGA 4QGLA 1NCQA 1K5MA 5FP7A 3RRDA 2D6NA 3T30A 2ZX0A 3BKZA 5LK5A 4ARYA 2MHFA 1QF3A 2YBSA 3LA7A 5FJHA 1W3VA 1H9WA 2ZGQA 3NNFA 1LU2A 5DZFA 1VBA3 3B02A 2WO3A 3H8UA 4UFKA 3SQOA 4A45A 1D2QA 4JGYA 4XQWA 2QDRA 2ADEA 5J36A 3ON7A 1NX9A 2WFF2 3NV3A 4D69A 4LHSA 1XNCA 2RMU3 1AXKA 5GM0A 4QQLA 4Q0SA 3SHRA 1PMIA 2W1QA 4A7KA 1UF2C 2XJVA 1YRZA 5FP4A 5FWJA 4CEWA 1JYNA 4XBQA 4LT5A 4E4SA 2GNBA 3WF0A 4AHWA 3AMQA 3WNOA 2JKXA 3CNAA 4FTSA 4QKDA 1RJ7A 2ARCA 3MV11 4J1XA 1JHJA 3UV9A 5F9TA 2VZOA 1GBGA 4XYXA 1LTEA 3VZMA 1G9FA 2PTMA 3EMRA 5DUVA 2RM21 2Q30A 1G6NA 4XOGA 4S2DA 5A3PA 1LOAA 1TQ5A 3LEKA 3VBHB 5ACA2 2VAUA 1D0HA 3ZPOA 1A6CA 4XJWA 3AYCA 1EV12 3VBFC 4YZ5A 3T3YA 2HEVF 5EXOA 4OI2A 1GWLA 2Y6GA 4BQWA 5FFOC 1LECA 3N4MA 3QBQA 3DYOA 2I45A 3JXSA 4FPOB 4LBQB 3OD4A 3RWKX 4NIDA 5IW0A 1C28A 4I0WB 4XUTA 1O3RA 1JI6A 1GZWA 5C3OA 3ACLA 4DXRA 1DGWA 4C0BA 4CCMA 3WP5A 4BQ2A 4RR3B 1EUTA 4O9EA 2ERFA 3DGTA 4P9JA 4CUBA 4ZZ5A 2FDHA 2TUNA 4JGZB 3VZJA 4HK8A 3PJQA 5T5LA 2PYTA 4B1LA 4UBGA 1NE6A 5FXZA 5I0TA 1AVBA 3S5QA 2RE9A 5FREA 3ZKUA 4AFAA 2DVBA 1UY0A 3POEA 4Y4YA 3LB9A 5ABJB 2GN3A 3HJRA 1PZ9A 2BWCA 2QQKA 3VHRA 4B29A 2CWSA 1UWWA 2E9QA 2YY1A 4PBOA 5FXXA 4XMAA 3E5UA 5L36A 4A41A 2W87A 3K48A 2DUOA 5JIAA 4BK5A 3BTAA 4KQ7A 3WUDA 2HYXA 3H7YA 5CB7A 1GOHA 3DXTA 4XXPA 2IXKA 1ZRCA 2C0ZA 3VBUB 2BV4A 2DVAA 1ND2A 2ES3A 2YPJA 3LDBA 3I2FA 1ULFA 2RM22 4COWA 4YM2A 5F5AA 3HN1A 1WMFA 1UXXX 2QFEA 5F3EA 2QKDA 2ZEXA 1NT0A 1QJY1 1TG7A 2RJ2A 3SNMA 4JKMA 3T09A 1SBFA 1RVF3 3QH7A 3AZVA 4WM7A 2VBBA 2WSVA 4ZY9A 1JZ8A 4QKNA 4GQ7A 4AQSA 3DCQA 3RJ2X 5LWBA 5LRRA 2A5ZA 1OF4A 4H7LA 4K8RB 2XJQA 4N90A 4EROA 3H8RA 2CAVA 4AG4A 4C90A 1NOVA 3IN9A 3LE0A 4UW4A 4PCRA 1YQCA 3ZFEC 1XYPA 4HKLA 1O3SA 1W8FA 5EHDA 2AENA 3ZXGA 2GC0A 2WYFA 4EJRA 1UMZA 1JYIA 2ILMA 4IEWA 4YNIA 1OC1A 2VBDA 3I2GA 1UIJA 3M2MA 4N43C 1WMEA 1DYOA 4EN0A 1OI6A 1DGRN 2ZGTA 1LGBA 2QE3A 2VULA 4BIOA 4E27A 4KGGA 1W6OB 3H8OA 4YVSA 3USSA 1MACA 1RHI3 2J1TA 5HXMA 2Z42A 4ISQA 5FWEA 1FPN1 4CP9B 2ZTNA 1ZREA 1H9PA 4CDQC 5FZOB 2OXBA 1UCXA 4I02A 4TYSA 5FZHA 2YDEA 4AI1A 1E57A 1FT9A 1AYN1 1DYPA 3AL5A 3R6SA 1AF9A 2OX0A 3POWA 1C4RA 2AH2A 4Q4X1 5LY1A 1UY2A 1W39A 4DUVA 4Y20B 1QJY2 1OOPA 1JZ2A 4NRQA 1W6NB 2B9VA 3ZIWA 1RTVA 2LROA 4LBOA 5AFEA 3ME2A 4KWKA 4NN0A 4E8DA 1LOGA 1W6MB 3DV8A 2NN8A 3NNJA 2K46A 2Z69A 3POJA 4FPGA 4IV3A 5AFBA 1LR5A 4IEYA 3VBRA 1ZNPA 1KQRA 2WN3A 1U12A 4UF0B 2EVXA 4QHBA 3VBSA 5GZCA 5J3UA 1BQPA 4IE5A 2Q1FA 5CFDC 3J4UH 1REFA 1AYM3 2WAOA 3CF6E 3KS7A 3IAQA 2IXHA 2EAAA 1DLLA 2YBPA 4QGMA 3MIBA 4UFJA 4AHZA 3C7HA 1PIV1 1ZA4A 2W1SA 1AR83 5BNNC 5LA1A 2BTVC 2Q8OA 4LHNA 2A3XA 3Q8BA 4FSJA 2JEMA 2NMOA 2UY8A 3H3UA 4PF5A 5F3CA 1W6PA 1DQ1A 2D44A 3CBNA 3LGRA 2HWE1 3H50A 4GZ9A 3ZFGA 2JB8A 4PI0A 1O59A 4EWDA 1FPN2 2XKOA 4YM1A 4I2OA 3H1MA 4MVTA 1BVVA 3ZMNA 4DNYA 3OGRA 1VBE1 3JD71 3ZYJB 4I0AA 5A32A 5CBLA 1ENSA 2Y8KA 1F31A 4OHYA 2ZZQA 1BLZA 2Y33A 3BYWA 1AYN2 1DZRA 1X50A 2XB6C 3HBKA 5T50A 4JX0A 4QXKA 5JSOA 1LKNA 4XHXA 2XBO3 2CDOA 2P3YA 1FV3A 2NZ9A 4Q4X2 5BV6A 1OH3A 5EZWA 1UZVA 2ID4A 4DB5A 4YW4A 1ULGA 3LPFA 3FZ3A 4XZPA 2ARBA 1CZTA 3KF5A 2VZQA 1XYOA 3MBWA 1H30A 3HT1A 3TN93 2R061 4HKWA 2J7MA 4GIQA 4JV4A 2F6BA 4A7YA 1TNRA 3LDKA 3U10A 2V4AA 3OYWB 4X6QB 3VDBA 4CCOA 2HWC1 4FFHA 1NCRB 1XE8A 2W68A 3TWIA 5LBEA 4PIXA 4AI9A 5CFCA 5KHGA 5HV4A 2I07B 2E7TA 4XF3A 1W2OA 1LOCA 3I59A 1O4TA 1PIV2 4N9IA 5L9RA 3KB5A 1H4HA 4PDWA 4QHOA 2I74A 1V6JA 2B7YA 3LSDA 4IESA 2YGLA 2RDSA 5AC93 2A7AA 5BNQA 2IVIB 2R1BA 1C5IA 2W94A 4META 4AAPA 1GMMA 5A7SA 1ND3B 1VJ2A 5IVBA 1O91A 4BQYA 5F7UA 5JI7A 4QX0A 2QJVA 3ILFA 1OBNA 4GH4B 2BWAA 1TNFA 2HWE2 3AMHA 3R4DB 3KVAA 3NW4A 1NAEA 1K5JA 3AM2A 1W9TA 4Q0VA 4Q4W1 2WO1A 3JD72 2DF7A 2IFRA 3WD5A 2D3PA 2QBXA 2X8KA 2GNTA 1M06G 1ENQA 1E5SA 1WMDA 1QMJA 2X10A 5LBBA 3RFRA 4F8AA 2HWD3 2P3JA 2IC1A 2BNOA 1GOFA 2XONA 3KQRA 4B7KA 2G19A 3MGUA 5IVJA 1OHFA 3JCIA 3MFAA 3MIDA 3WNPA 4PLOA 1WLWA 4MADA 3OG2A 4PQQA 1HRV3 4YW3A 4IETA 4BMBA 3ZYPA 3ROUA 2D6MA 2X29A 4AQTA 4Z2WA 3KQ4B 1S0BA 4YZ3A 2R062 4QU1A 2WNEA 1PGL1 5T55A 2VOVA 5AVAA 3AXDA 4A6SA 5FY4A 4YZ4A 3N9MA 2HWC2 3VD9A 1PMHX 4KWLA 4LORA 4QB2A 4JVAA 3U75A 4B1MA 4D8MA 3E5XA 2D40A 2DCJA 2HKXA 3AKQA 5FPAA 3VZOA 4DS0A 5JIUA 1UYXA 4G4FA 2G9GA 1Q56A 2YROA 3MFCA 3PU8A 4BQ4A 1HRI3 5I0SA 1XU1A 5HCAA 2QDNA 5IFPA 2JKBA 2WQ8A 4LNVA 1CQ9A 3WP4A 4DQAA 2C26A 2K0GA 4CDWB 3AKTA 4EWEA 2V5DA 4Q4W2 5A6ZA 5BYNA 5HBAA 1LHOA 4K8FA 4XTMA 1H0BA 2HWF1 2GC1A 2PHWA 2ZGKA 3B93A 3NAPB 3UKNA 5B2GB 1RL3A 5EYYA 4KH9A 2G4IA 4DRVA 4NOTA 2CY6A 4QQ2A 2WINB 4FXGB 4I0BA 2E33A 4RS5B 1UQXA 5FY5A 4UAPA 1MS0A 4Z1VA 2VZTA 3WDTA 1OUXA 3F95A 4I09A 1CIYA 3UKVA 1LOFA 3HWJA 3OCPA 4H7MA 2V72A 2VVEA 3ZVXA 3MZHA 4FPFA 1K42A 1IG0A 4YGDA 2WR9A 4B7EA 1MZ5A 3VBHC 4P9YA 4ZKTB 2P5BA 4HBNA 2JICA 1UKGA 1W3XA 1RIRA 2VPVA 2PAEA 1PGL2 3PVEA 5JMCA 3PDQA 4N53A 2F17A 2JDHA 2ZPXA 5LA0A 4N7UA 3BTXA 3FHQA 1O5LA 3LIGA 2B39A 1R083 4XDOA 2Q8EA 1DF0A 1WZXA 4AQ6A 1ZYBA 5FZ1A 2YMZA 4WVZA 3ZXFA 4COUA 5C9AB 4CCDA 1H8TC 3M3QA 1HXS3 2FQPA 3EQEA 3POSA 3I3EA 3WOGA 3FJSA 4MYEA 4SBVA 5F3GA 5FZAA 4FTEA 2YG0A 4YGBA 1D2SA 1ACCA 1QJX1 4RR3C 3V65A 2VMCA 5CNAA 2HBUA 3IPVA 5A6QA 4JGZC 1NYWA 2BYVE 1QJU3 2GDFA 1XE0A 5LK7B 4GWNA 1GSLA 3UJQA 3IDCB 2HWF2 4LUMA 5FUIA 3WG2A 1CZSA 3TAYA 2P37A 1WLDA 1QOTA 2LTNA 4ZU4A 5FXVA 3WW1A 4K40A 3PIJA 2WZEA 5ABJC 2RJLA 1FMD1 3RMXA 4J25A 4CEYA 3VBFB 1JHNA 1BK0A 4P5YA 3JBG1 4QX1A 3WV6A 3T1LA 2EA7A 4OZOA 2RDNA 3KT1A 4UBHA 1ULCA 5ANQA 5FPZA 1D4M3 3VB9A 3HT2A 1W03A 5C6CA 3KT4A 3TEZA 5E1RA 1YJKA 1C8M3 1XB9A 3L2HA 4GA9A 4Q4V3 1JU4A 1ZZBA 2ATFA 4WVMA 4F7ZA 4BOWA 1XE7A 2MEV1 4RHV3 3ILNA 2ENRA 3O5SA 2FDGA 2XWJB 1QNYA 4NHMA 4FOYA 5K0UB 2LW8A 1UU5A 2XOMA 3C3VA 2D6OX 3X29B 4B4PA 4BCUA 4OMCA 4KBZA 4D7TA 1LGCA 2RS11 2Y6LA 4BH9A 5JDBA 1QJX2 3DKQA 4NIIA 2J1VA 4U2AA 5I8SA 1S0GA 2ZJCA 5E8AA 2W5FA 3IDBB 3K3NA 4NWWA 5DG2A 4HN0A 4IL7A 3NJYA 4QM8A 3RSJA 5CADA 2ZAAA 5BPXA 2DYCA 3TOJA 4FT8A 1Y9GA 4HPKA 1SMVA 4O9GA 5E88A 3MIHA 4D6QA 3A0KA 4ISRA 4NROA 1GKBA 1WCDJ 3BOWA 2VMHA 4Q0QA 3ZXAC 4HONA 4CDXB 3UGFA 3M7AA 5BNOA 1DDLA 1RGSA 3GDBA 1FMD2 1W8ZA 3BGAA 3OB8A 4M3CA 4OI1A 3JBG2 5IT6A 5LEKA 1COV3 4YPJA 2XLFA 3WDUA 1W8UA 4QB1A 2C5DA 1RUF1 2CSGA 5DXDA 1MQTA 2ZBJA 5FYTA 4L2NA 5JXIA 1QXRA 4K1YA 4AVBA 3M70A 4Q4Y1 1FOD1 1LNSA 5FRAA 1KS4A 2FMYA 4BQ1A 4A3XA 5FYCA 1GANA 4BA6A 2VH9A 4P14A 4QDQA 4Q8LA 1O8PA 2MEV2 1VBA1 3ZYBA 5C3SA 2RVAA 2CHHA 1S2EA 4L11A 5IVEA 2TNFA 3ACHA 4N43B 5A33A 4AVAA 4GMP0 1APNA 1WW6A 1PVC3 2NLRA 4TLFA 3OUHA 1CJPA 2RMU1 5BNPA 1R1ZA 3JQWA 4FQ4A 4E4ZA 1ND2C 3I3BA 4IE7A 3O1UA 1J3PA 1H8VA 2RS12 2GU9A 3ZYGA 1JH5A 1QDOA 2UWCA 1Y9MA 4D7YA 3MO4A 1W0PA 2AGSA 4NMIA 1J1LA 5E89A 2AR6A 3LAGA 5A1AA 2LM3A 1EAH3 1DFQA 3MYXA 4IERA 4AWDA 4FFIA 5DN2A 1NLSA 4CDUB 4COVA 3GBWA 3ALQA 4WM7C 1LOBA 1Y7BA 2P3KA 3WZ1A 3ZOIA 1E5RA 2J1SA 3FBYA 5F5CA 5JZGB 2ZHMA 4GWJA 3NV2A 2ZGLA 5DAXA 2W46A 4LTAA 4FP3A 1PHMA 5DUXA 2JG9A 3POIA 3RZHA 4HN1A 4Q27A 4QX7A 4XF1A 2D7FA 1V0AA 2WT0A 1RUF2 3NV1A 4WV8A 1OA3A 4YVWA 1DCSA 4DOUA 5LA9A 4PIYA 1TMF3 1HKDA 5CKMA 4NAOA 2OZJA 4Q4Y2 1H1MA 1YFUA 2DV9A 2OPKA 2CGNA 2LALA 2OS2A 5ERLA 1AHSA 2VCCA 3AZZA 5CEHA 5H9QA 5C4WA 2BOIA 5FY8A 1SLLA 5A80A 4KGQA 3U0ZA 3JU9A 2WDBA 2XL7A 3HNBM 4D94A 2JDAA 2NPIA 1VBA2 1KITA 1NUKA 4BDVB 5BNNB 1OVPA 2VMIA 4Q29A 1RUH3 4RA0A 2HBTA 1KJRA 4Y26A 1X9PA 1SFYA 2BOJA 2VGDA 2NYYA 4XXAA 3USUA 4W50A 3DUIA 2B45X 2CWMA 2JE9A 5FZGA 1V6LA 2RMU2 2ZOEB 3O1VA 1ALYA 3UGGA 2D97A 4MSVA 1RUJ3 3PHMA 1MEC3 2X53S 3NV4A 3RZLA 3W21A 5FP3A 1H1IA 1QXPA 4URTA 3WT3A 2VJXA 3DN7A 2D93A 5DQ0A 1MR5A 4EN6B 1JW6A 4UW5A 2AEZA 1GP4A 1CAXB 1JMUB 2YPDA 4AGGA 2ADDA 3WF2A 1XNDA 3WUCA 4CPBA 3OOXA 1H6YA 4RSUA 4Z07A 5K9YA 1CAWB 3IT8A 4OQ8A 4ATEA 3AYAA 4Y1ZA 1W8HA 5C33A 2G9ZA 4GH4C 3B9CA 5JR7B 5BNPB 1CX4A 5JXHA 2E7AA 2R073 1LENA 1L7LA 2CL2A 3PVOA 3O0WA 3VL8A 3ZFFB 4ONUA 2H0BA 1OD3A 1F35A 4CUCA 4ES8A 2R30A 4LJHA 4XFCA 2V4VA 1RVF1 3PIGA 1TEIA 4AVCA 5FYUA 3JZVA 5FQ0A 4H3WA 3LEMA 3OY8B 5JOWA 5JXGA 1I6XA 4Q5OA 5FKBA 1GP6A 3ECQA 4RGAA 3POBA 5HCBA 5JOZA 5FMDA 4OHZA 4CCEA 3VDDA 2VNRA 1OKQA 5EIYB 2GALA 1AR93 1BKZA 1OSGA 1V6KA 3L2YA 1W9SA 5KHIA 2FDFA 2A6YA 1GQPA 3O12A 2JD9A 1MS3A 4ZONA 1V6MA 3EXUA 1HIXA 4JDOA 1HB3A 1I5ZA 2GMMA 1ASJ3 4V2VA 2O14A 1F5FA 2R6QA 3HIFA 4OHXA 3S6PA 3UKTA 4DINB 4Z92B 5E6HA 2GNDA 4PQ9A 5A7PA 2CGPA 1C1LA 5CVRA 3ZN6A 2QQUA 4C0HA 1UYYA 3J9SA 2V73A 4MXVA 4MXWA 2FMDA 3H0OA 3G6JB 3V0AA 3AZYA 2WSUA 1YIPA 3CJIB 4Q0UA 1PK6B 1RHI1 1A34A 1ZZ7A 1Q8OA 1OLMA 5C3RA 1UZ0A 1Q8QA 3RI8A 2WZPP 2W08A 5DZGA 3C7EA 3K4DA 1LEDA 5FO9B 5A6XA 4AHYA 2H6BA 2QCSB 4NPMA 5I0RA 3O1TA 3CQOA 1C8NA 2P3IA 4IGQA 5FAXA 3MW2A 1W06A 5K7PA 4CDWC 1D0GA 3N3HA 1ZZCA 3WDVA 3HBZA 3ZN5A 4L9BA 4ASLA 2FCVA 2GMPA 1AXYA 2DCYA 1RVF2 4WZFA 3THTA 2BVBA 4Y5TA 2JDMA 5GJ6A 5C8CB 4H55A 3KVBA 4KWJA 4XF9A 4RS5C 3V0BB 4LBMA 2VY0A 1RINA 1UAIA 1W2AX 1WKYA 1JOPA 2KM2A 2A6XA 3I2JA 1LJ7A 3NL1A 3MW3A 1UL9A 3DEMA 1MS8A 1QU0A 3ST7A 3G7DA 4JTOA 4CU6A 2GAUA 4XE9A 5TSWA 2VMDA 3GBFA 1G86A 1RJ8A 2VCMA 1AR81 4Y3OA 1REDA 5GALA 2PQQA 1QDCA 2XQRA 4V1PA 1F8VA 1W8WA 1F15A 1YYNA 3GHMA 1IZ3A 4FPJA 3AMPA 2ZAHA 1UOBA 1WWYA 5C9AC 4QPIA 4AEDA 5J09A 1IS4A 2WNVA 1RHI2 1NLQA 4B4RA 5FK7A 4DFSA 2JG8A 3I3MA 1ZZ9A 4I3PA 2A6ZA 3RZZA 3ASIA 4XURA 3RDIA 3B5LB 4AI8A 2KR2A 4Y5SA 4LBQD 3POYA 4BM8A 5C5TA 5GLZA 5C5UA 2VO5A 3DPRB 3H9AA 4XPVA 3I2DA 2IFWA 3U4SA 3MEPA 3UJOA 1YQ6A 1W28A 4AL9A 5F5QA 1VAMA 2DTYA 4CCLA 2VBPA 3SMHA 2D5FA 1X7NA 4UI9L 1Z0HA 1KD7A 3E97A 1UIKA 4PHZA 3NNMA 2QZ3A 3EO6A 4FOWA 4QMAA 3TN91 1O4YA 2ARXA 1CONA 2V09A 3RZGA 5EQUA 1RMU3 3IDAA 4S2HA 2RS53 4L8QA 1YHFA 5F8PA 2WC2A 1H8TB 2IUWA 1U0AA 2Y34A 1HX6A 2XHNA 3LIHA 1AYM2 2PQSA 3ORJA 4I3GA 4XILA 5F6KA 1G9CA 5JR2A 3OPTA 1W6QB 3ZIXA 3SH4A 2RV9A 1W8OA 2Q0AA 4BQ3A 5IVVA 1C3HA 3ZKYA 1AR82 4W65A 1CJDA 2E51A 4HG6B 3VBOB 4Q8KA 5AC91 1KS5A 4NHXA 1W04A 3OBTA 5L7OB 4JRAA 5K0UC 4FPEA 4N9HA 2K9ZA 3SCGA 1NCQB 1K5MB 2VM9A 3C7GA 1ENXA 4F3JA 3O0VA 3WG1A 1W9YA 1FX5A 4UYBA 4Q2FA 3TYJA 4IEVA 4Q0PA 2KXLA 1GNZA 2XQXA 4X8PA 3CKHA 3OUIA 2CU5A 4JGYB 2XUMA 3TEXA 4ZXKA 1OA2A 1Q5OA 1WLCA 3W5NA 2HWD1 2VZPA 4HXCA 1CAUA 1FXZA 4MH0E 2J1RA 2XBO2 4Y33A 5KC5A 4MGIE 4GWIA 3VZLA 4HSLA 1K12A 4NHLA 2VOXA 5H9PA 1NE4A 1V00A 4XJAA 2DFCA 4CDXC 1W2TA 1NY72 1HRV1 2MPFA 1ZBA3 5A70A 2WS93 1AL22 4CEWB 4GJYA 1IKPA 4EN7B 4Y4RA 4JQRA 3TN92 4LOSA 1SACA 3U4XA 5FMBA 2WZR3 2ZX2A 2IXCA 1BK1A 1PZ8A 3IMNA 1DZTA 1HB1A 2AUYA 4BQ5A 4JTNA 1RUG3 4AOCA 4LITA 4MX3A 3K2OA 4AQ2A 2X09A 2AREA 1UYPA 2BGPA 5IK8A 1AUYA 1N3OA 2I2SA 4DEQA 1RUI3 2OA2A 5FYSA 4AI3A 1BMV1 1HRI1 1HQNA 4RN5A 5AC92 3E6DA 4BK4A 4AEKA 5B4XA 2J22A 2BJSA 1C57A 2IXIA 3BOPA 4EZHA 1VLNA 3FFZA 3LF7A 4IE4A 2HLEA 3IB3A 5JOYA 3GZTB 2WAAA 1LODA 1SCRA 3WP6A 2VW1A 3J8F3 3E6BA 5F3IA 1GZWB 1ULDA 1JZ4A 4M3CE 1DGWX 1EP0A 5I0UA 4CDUC 5FYYA 3WVJA 2HWD2 1XBFA 1RUE3 3UNPA 1NKGA 5JZGC 1I5PA 4RD7A 2ZABA 1KFXL 4D6RA 1IS6A 1DGLA 1HRV2 4GB33 5FZ8A 1MZ6A 4RL7A 5IHRA 2VNGA 1OPMA 1PO13 3WNNA 1IG3A 3SLIA 5FZEA 2DBNA 3HOBA 4R9CA 3P3NA 1YFXA 3EYPA 4L0PA 2QUOA 4FOQA 1JYVA 4IE6A 3LFIA 5J7MA 1OMIA 4WZCA 1ND2B 1R081 2D43A 5DMYA 2C1FA 4QDRA 2W39A 1VB2A 1BEV3 5FJKA 1K3IA 4M0NA 1HW5A 1QY4A 2XHKA 1HXS1 3MI8A 1HRI2 2Y6JA 4P9GA 1W99A 4XTPA 5FMOS 1VMFA 1A8MA 3PVNA 5KBFA 3VHNA 4WM7B 4O7XA 3B94A 3GZAA 2NM1A
chains in the Genus database with same CATH topology
3OSDA 4CCCA 1W2TA 3KF5A 3UGHA 4B1LA 5FIXA 2AC1A 5ANNA 3UGFA 2XQRA 3H3LA 2QQWA 4JQTA 2QQVA 3S5QA 1Y4WA 3LIGA 3UGGA 3LF7A 3PIJA 2QQUA 4UFIA 5FMCA 3LDKA 5FMBA 3LFIA 3KF3A 3PIGA 3U75A 3ZR5A 4B1MA 1ST8A 4FFHA 3LEMA 5FKCA 3RWKX 4UFHA 1Y9MA 5FKBA 3SC7X 4CCDA 4FFGA 5FK7A 4QHZA 2AEZA 3NMBA 4UFLA 5FMDA 3HBKA 2OXBA 4CCEA 3IMMA 3LDRA 4FFIA 2ADDA 3LIHA 5FK8A 1UYPA 4HXCA 4UFJA 3ZR6A 3U14A 4FFFA 4EQVA 4UFKA 3U1XA 2AEYA 4AZZA 4UFMA 2ADEA 1Y9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OSD A;  4CCC A;  1W2T A;  3KF5 A;  3UGH A;  4B1L A;  5FIX A;  2AC1 A;  5ANN A;  3UGF A;  2XQR A;  3H3L A;  2QQW A;  4JQT A;  2QQV A;  3S5Q A;  1Y4W A;  3LIG A;  3UGG A;  3LF7 A;  3PIJ A;  2QQU A;  4UFI A;  5FMC A;  3LDK A;  5FMB A;  3LFI A;  3KF3 A;  3PIG A;  3U75 A;  3ZR5 A;  4B1M A;  1ST8 A;  4FFH A;  3LEM A;  5FKC A;  3RWK X;  4UFH A;  1Y9M A;  5FKB A;  3SC7 X;  4CCD A;  4FFG A;  5FK7 A;  4QHZ A;  2AEZ A;  3NMB A;  4UFL A;  5FMD A;  3HBK A;  2OXB A;  4CCE A;  3IMM A;  3LDR A;  4FFI A;  2ADD A;  3LIH A;  5FK8 A;  1UYP A;  4HXC A;  4UFJ A;  3ZR6 A;  3U14 A;  4FFF A;  4EQV A;  4UFK A;  3U1X A;  2AEY A;  4AZZ A;  4UFM A;  2ADE A;  1Y9G A; 
#chains in the Genus database with same CATH topology
 1DQ4 A;  3BN6 A;  2O8Q A;  3H7J A;  1O8S A;  2NMN A;  3H3L A;  1QJU 1;  5IUQ A;  4IGO A;  1G9A A;  4MGZ E;  3A0N A;  1YLL A;  5CAZ A;  4AEM A;  2OT7 A;  5JAX A;  5IWF A;  4EWA A;  4YGE A;  1DGR A;  4H14 A;  4MGS A;  1POV 0;  1JYC A;  1LES A;  5DAP A;  3DXU A;  1B09 A;  1YC6 1;  5F2S A;  1BMV 2;  1WCS A;  4RYD A;  3OBZ A;  1R1A 3;  1F4A A;  1NLR A;  1RIT A;  4XIK A;  4A44 A;  1FI2 A;  3HNM A;  2JDY A;  3HPN A;  2YYO A;  2BUK A;  2IWG B;  3JUU A;  3RMY A;  1D4M 1;  3ATG A;  2VUD A;  4JDN A;  1FV2 A;  3U78 A;  4MHU A;  5BNP C;  4LHK A;  2DUP A;  1C8M 1;  3WW2 A;  1UY3 A;  2D3R A;  3D5O A;  4YVS B;  4Q4V 1;  3ZFF C;  1MS4 A;  1UXZ A;  1ZRF A;  5IVF A;  5IJR A;  1AL2 3;  5A3N A;  1J84 A;  1GWM A;  3FFQ A;  4Y1U A;  1KRI A;  4HVQ A;  1G9B A;  3WG3 A;  2D6P A;  3VV1 A;  1OA4 A;  2EIC A;  1EY2 A;  5DAB A;  3R05 A;  1R08 2;  5T5O A;  4MGT A;  1NXM A;  5EJ1 B;  2FDK A;  2XL9 A;  3C7F A;  4HFS A;  1T6G C;  3VKL A;  4NHY A;  5FYB A;  1HXS 2;  2CGO A;  2GSY A;  1R64 A;  2WNU A;  3AKS A;  3BU7 A;  1OOP B;  2WRA A;  3ACF A;  1ZVF A;  3GCW A;  4E4H A;  3N9O A;  1F4H A;  2XJU A;  3FHA A;  2VXJ A;  4E2G A;  2ZGU A;  5J98 B;  3VDC A;  3FWE A;  4YZ1 A;  1EPW A;  4IV3 B;  1ZX5 A;  3MIG A;  2XKP A;  3PTY A;  4YVW C;  3VBR B;  1YI9 A;  5CYY A;  1I3H A;  3BTZ A;  1IPS A;  3MIF A;  1QJU 2;  4NUB A;  4Q26 A;  5FIX A;  3VBS B;  5HI0 A;  1QOS A;  3N9N A;  3KV4 A;  5I8Y A;  4IEO A;  2W3J A;  2WLP A;  4UXA A;  3RNS A;  2OKX A;  2R04 3;  4AFC A;  1PO2 3;  2VEC A;  5HPO A;  4P9W A;  3VDA A;  3CJI C;  1LHW A;  4LQR A;  1PK6 C;  1JUI A;  3WCS A;  1SLB A;  1S0F A;  1YUD A;  5CIS A;  3MV0 1;  2DDU A;  4NE9 A;  1COV 1;  3IM0 A;  4MHR A;  1F5J A;  1VBC 3;  2QQM A;  2D3S A;  3ZDS A;  1D4M 2;  1W8T A;  3AK0 A;  1W6P B;  4KU7 A;  3SKJ E;  3OPZ A;  3K46 A;  1VIW B;  3RYR A;  1C8M 2;  4YZ2 A;  3ZN4 A;  4A6O A;  3ZFG B;  3B9I A;  4Q4V 2;  2G1M A;  4FPH A;  3T2T A;  2PLV 3;  3CL1 A;  5IAX A;  4P08 A;  4DY5 A;  4EYU A;  5FP8 A;  4XDQ A;  3I2I A;  1A78 A;  5A1L A;  4YG6 A;  2EXH A;  3AKP A;  4JQT A;  2VMG A;  5A32 B;  4URA A;  4RHV 2;  5HCF A;  4LHL A;  4WVV A;  3WW3 A;  1UOJ A;  5C8C C;  4TWT A;  1SPP A;  3AXE A;  4KMQ A;  2UYA A;  1V9U 3;  1SDD B;  2ZGM A;  1PVC 1;  4LBJ A;  1IPK A;  4LKD A;  4W6W A;  4KBB A;  4GAZ A;  2YU2 A;  1MS5 A;  4QB6 A;  4XFH A;  2PAK A;  3LEG A;  3IMM A;  1J3R A;  5LCW L;  1GYK A;  2ZAC A;  2E53 A;  5EJZ B;  2PHR A;  3NWK A;  1EAH 1;  3LSE A;  1OLM E;  3I3D A;  4E2Q A;  4R8H A;  1B35 A;  1J58 A;  3THC A;  1OXC A;  1VPH A;  2VTX A;  1S0E A;  2QQI A;  2QQJ A;  4CCC A;  1FAT A;  4QXB A;  3N7L A;  3WEZ A;  2DWR A;  4XW3 A;  4FTB A;  3VDD C;  5LZ6 A;  1PX3 A;  3A4U A;  5A7W A;  3N7M A;  3TRS B;  1O5U A;  4RFT 0;  3I59 B;  1COV 2;  1X33 A;  4PDW B;  2P6H A;  4OHW A;  4AEJ A;  2BW8 A;  3SCH A;  2ZCW A;  2XH6 A;  3WQ7 A;  3AJZ A;  3NKT A;  2YB7 A;  1V6I A;  1WLT A;  1TMF 1;  4LBL A;  3ZYF A;  3FC0 A;  1Q8V A;  2A75 A;  2ORZ A;  1JOJ A;  3DPR C;  4XVH A;  5FOJ B;  1S2B A;  4KWU A;  4PLN A;  1D7P M;  3FUQ A;  5FZF A;  3RG0 A;  1AR7 3;  4GJZ A;  1YQ5 A;  4XFF A;  4QPW A;  1POQ A;  5FPV A;  4DZG A;  1RUH 1;  2RS3 3;  3AVS A;  4GKY A;  1N3Q A;  4K1Z A;  3W20 A;  3BUC A;  3VLB B;  4M01 A;  1GWK A;  5A3M A;  1PVC 2;  1O3T A;  5C3P A;  4CU9 A;  5GZG A;  5K8S A;  1YIF A;  1GZC A;  1RUJ 1;  2FCT A;  5J96 B;  1MEC 1;  1DG6 A;  1ULO A;  2XLG A;  1JYX A;  1VAK A;  2RR1 3;  2SBA A;  2QTW B;  3LDR A;  1EAH 2;  1XPW A;  5LEJ A;  1E5H A;  1W0N A;  3WCR A;  2FDI A;  2BQP A;  4M4R A;  3S30 A;  1CWP A;  4Y22 A;  1UD1 A;  1WW7 A;  1S4C A;  5FLH A;  3VBO C;  1QQP 3;  2BNM A;  3SXW A;  3GNE A;  1OD5 A;  3SH5 A;  1N1Y A;  5L7O C;  3KCX A;  5FPX A;  2VUA A;  2XXZ A;  5F37 A;  2XJT A;  3B00 A;  1NCQ C;  1K5M C;  2C4X A;  3P3P A;  2E31 A;  4FXK B;  4DRR A;  1GLH A;  2R07 1;  1S0C A;  3KZ4 C;  4PF1 A;  5T54 A;  2OYZ A;  4F83 A;  5A6Y A;  3INA A;  2BDR A;  4LKE A;  4O61 A;  1TMF 2;  4JGY C;  2ETE A;  5IVC A;  4YYO A;  3RVH A;  3AL6 A;  4QPY A;  1OQE A;  2Q8D A;  4ASK A;  1EPZ A;  3GM8 A;  2ZS6 B;  4FP2 A;  3AFK A;  4LK6 A;  2E6V A;  5FMO L;  2W0X A;  1SBD A;  1LB2 A;  1AR9 1;  2QZ2 A;  1N1T A;  1Q8P A;  1QWR A;  4XAB A;  5C3Q A;  4MO3 M;  5E16 A;  3FUO A;  3N9P A;  3R0R A;  3U07 A;  1S2K A;  1UX7 A;  4XFG A;  1IS5 A;  1RUH 2;  3UGH A;  3ZFE A;  1VBE 3;  4CEW C;  4RGK A;  5IAT A;  2JG8 C;  4QQP A;  3VKF C;  4JKK A;  1ASJ 1;  3LFM A;  3VL9 A;  5C7G A;  2HWB 3;  3BTY A;  3FMG A;  5D8A A;  3KSC A;  4XC9 A;  1RUJ 2;  4XJU A;  1MEC 2;  1W9W A;  2ZXQ A;  2XWB B;  3MF6 A;  4UFH A;  2R0F A;  3KCY A;  4ZXE A;  3AKR A;  4KNC A;  3ZXK A;  3D4K A;  2PEL A;  3AC0 A;  4XIO A;  1WCU A;  2VZR A;  2ZEW A;  3LA3 A;  4AI2 A;  1N3P A;  1CN1 A;  1YEW A;  1AJO A;  3O14 A;  2EXK A;  3AZW A;  3U14 A;  4N53 B;  4GMP 3;  3CHX A;  4ZPI A;  2AEY A;  4S2G A;  4CDQ A;  1ULE A;  4FOV A;  4PJY A;  1Q3E A;  4DXZ A;  5HV0 A;  2PHU A;  2DCK A;  1GNH A;  3WHU A;  2R07 2;  5CU1 A;  4LXL A;  1RXG A;  5FLI A;  5KHH A;  5F2W A;  4DUW A;  4AW7 A;  2WO2 A;  5F1R A;  4CA9 A;  5KR7 A;  4MLO A;  4OI4 A;  1Y9Q A;  3B01 A;  4Y1X A;  3AVR A;  3U37 A;  2OII A;  3HQX A;  4IDZ A;  3SCF A;  2XVK A;  4DXT A;  1BHG A;  3IPV B;  3WF4 A;  4JRL A;  3K75 B;  1US2 A;  4FPC A;  1AR9 2;  3GXU A;  3AFG A;  4AFB A;  4QKF A;  3LA2 A;  5CFD A;  4AVT A;  4LE4 A;  4EN8 B;  5FPB A;  2VZ3 A;  3RJR A;  2EIG A;  2J1A A;  5I91 A;  4XBL A;  2VOW A;  4LLF A;  2WT2 A;  3EHK A;  3JQX A;  4CEY B;  1ASJ 2;  2CV6 A;  4TLG A;  5SV8 A;  1NA1 A;  4LO6 B;  5FZ3 A;  5C8W A;  4PT6 A;  3LOI A;  5LRS A;  3MUZ 1;  3DKW A;  5J37 A;  5K4L A;  2FDJ A;  4D3W A;  3OGV A;  1GZ9 A;  2J1U A;  4QXH A;  3K51 A;  4QX2 A;  3R4U A;  1NQD A;  4QKB A;  3KV9 A;  1NZI A;  5FPU A;  1BYH A;  3PJY A;  4WVM B;  4P5H A;  4BB3 A;  1CAV A;  1UOF A;  4Q1R A;  2VC9 A;  2DUQ A;  2W91 A;  1UU6 A;  1WD4 A;  3K4Z A;  5JWP A;  2ZHN A;  3OJB A;  4P9I A;  5D8A B;  4QWN A;  3ZYI B;  1IQD C;  1U5Y A;  2Y64 A;  3RQ0 A;  4GKX A;  3T2P A;  4XBN A;  5FZ0 A;  3M3O A;  1RUD 3;  2UYB A;  1SBE A;  1JYW A;  1BXH A;  1X82 A;  2VQ0 A;  4HOO A;  3WIN E;  2ZX4 A;  1SLC A;  1XYN A;  1PX4 A;  5I8T A;  1WBF A;  2SLI A;  1SLI A;  3O1M A;  4QQH A;  5JSR A;  1UYZ A;  3WXP A;  4YGC A;  2WO7 A;  4FAH A;  1RMU 1;  5EWS A;  4HPK B;  5FYV A;  2OPW A;  5A3L A;  2RS5 1;  4XJ9 A;  3B7M A;  2FBE A;  2R49 A;  1JUH A;  1QIQ A;  3A7Q A;  3JB4 C;  3BU0 A;  2IXJ A;  1SCS A;  4Y24 A;  5BNO B;  5D1I A;  2JX9 A;  4WM8 A;  4YVS C;  5D21 A;  5FZI A;  2JDK A;  3OSD A;  4M3C B;  1J1T A;  3BCW A;  4JHT A;  1LHU A;  3Q8A A;  1MQT B;  4BE3 A;  1VBB 3;  2ZGP A;  4NR1 A;  4JC1 A;  3NST A;  1HQL A;  4ZS3 A;  4CZS A;  2P1B A;  4KL1 A;  4QPG A;  3GZE A;  1BBT 3;  1DP0 A;  1KJL A;  3LEI A;  2VR4 A;  4XCB A;  3P6B A;  1HN1 A;  4LPL A;  5BXX A;  4FFG A;  3NJV A;  3D82 A;  1PNF A;  3HMY A;  3NJX A;  4P9X A;  3PUI A;  4YW6 A;  1OOP C;  2PA7 A;  3JB8 A;  5JOX A;  3H8X A;  1CD3 G;  1UZY A;  4M3C F;  3W58 A;  5IAV A;  1VMH A;  4CP2 A;  3ITQ A;  5A33 B;  2X5I A;  3ACG A;  4IV3 C;  1S1A A;  1LOE A;  1NA1 B;  4MZU A;  4AVV A;  2R16 A;  3VBR C;  4HMZ A;  1CES A;  1GUI A;  3ETP A;  3VBS C;  1LAJ A;  1GQH A;  4J6G A;  3IDE A;  2AC1 A;  2VZU A;  3AX4 A;  5FP9 A;  3MLJ A;  4DUX A;  2VW0 A;  3P1I A;  2Z2S B;  4LBK A;  4MUV A;  4RQP A;  3PUS A;  5FZ4 A;  3MDP A;  3FN9 A;  4ZZ8 A;  1P8J A;  3PTR B;  1HDK A;  5L19 A;  3ZSE A;  3BIW E;  3OGG A;  3W59 A;  2WS9 1;  1YWK A;  3LQC A;  1ZBE 3;  2PXJ A;  5FTT C;  2RDR A;  3OUJ A;  4AE2 A;  1ONA A;  2WZR 1;  4EZ4 A;  1H2N A;  1N47 A;  1RMU 2;  3ZMO A;  2FCU A;  2RS5 2;  3HD8 B;  4OZX A;  2OQ6 A;  4DO0 A;  2LS6 A;  4BLI A;  1RXF A;  4CP1 A;  1OPO A;  4X8N A;  2FZ2 A;  1RUG 1;  1DZQ A;  1VRB A;  5FO7 B;  1OFN A;  5FZL A;  2JG9 B;  3ZFG C;  1X8E A;  1VRH 3;  2V5Y A;  2R1D A;  4BPZ A;  3A23 A;  4C1W A;  2ZGR A;  5J1X A;  1RUI 1;  2HEW F;  3CIH A;  4OVE A;  4AFD A;  4IND A;  1MS9 A;  3EBR A;  4LR4 A;  4YVW B;  5FYH A;  4XAE A;  4SLI A;  4DY3 A;  2JD4 A;  5LW9 A;  1UZZ A;  5DUW A;  1RUO A;  1IGO A;  1UW8 A;  3I2K A;  2XPJ A;  4GXL A;  1VB4 A;  3AYE A;  3ABZ A;  4BJ0 A;  5CA6 A;  3NO8 A;  5CG8 A;  5C4W B;  1KEX A;  1H4G A;  2DCT A;  2ZZJ A;  1WW5 A;  3NNL A;  4W6Y A;  3J8F 1;  4M00 A;  2Z4F A;  1JZ6 A;  1CGP A;  4CPB D;  3K4A A;  3C7O A;  1GZT A;  1VBD 3;  3THP A;  3ZDV A;  3USU B;  1AJK A;  4QQO A;  4NWV A;  5IK7 A;  3WF3 A;  3KT7 A;  1O4Z A;  1GNY A;  5BY5 A;  2BP6 A;  1HB2 A;  4NRP A;  2ZML A;  5LA2 A;  4ARX A;  3VD7 A;  4I30 A;  2XJR A;  3QAC A;  2F4L A;  5A7Q A;  2C6S A;  5F39 A;  1UO9 A;  4GB3 1;  1ZBA 2;  4M0H A;  2HJI A;  1VAL A;  2WS9 2;  1H2M A;  3VGI A;  1PO1 1;  1N1S A;  4XFA A;  2EAK A;  2XLA A;  1CZV A;  1US3 A;  2CAU A;  4PDW C;  2EIE A;  5KXC A;  2WZR 2;  4DMI A;  5FZ9 A;  3VKN A;  1AZD A;  3GJA A;  3NKG A;  2CNA A;  2XGX A;  4P9L A;  4K20 A;  4QXC A;  5FR3 A;  3CJX A;  1RUG 2;  2GNM A;  1W05 A;  2UWA A;  4LBQ A;  1DQ5 A;  4BLJ A;  1BEV 1;  4BIS A;  5IK5 A;  3TEW A;  5C70 A;  2LUW A;  1AYM 1;  2OW4 A;  2WN2 A;  4IEU A;  4XJZ A;  1RUI 2;  3KGZ A;  3PU3 A;  4K21 A;  4HSJ A;  1RUC 3;  1JZ5 A;  1G8W A;  5FZC A;  4YAR A;  1DQ6 A;  1BJQ A;  1OLR A;  4MGQ A;  1O3Q A;  2YC4 A;  1IKQ A;  4RR3 A;  5LY2 A;  1W8N A;  5FQ0 B;  3VKO A;  1ZRR A;  5FBJ A;  2WJS A;  2P2K A;  2JIG A;  1GU3 A;  1KDK A;  4LBN A;  2WQ4 A;  4JGZ A;  4QAW A;  1WW4 A;  4TSV A;  1SFN A;  1REE A;  2GC3 A;  2W47 A;  1UPS A;  4EE2 A;  2PHX A;  4QX3 A;  1FOD 3;  3VDD B;  4OCT A;  1GIC A;  1XNK A;  3ZR5 A;  4AF9 A;  2GN7 A;  5FY7 A;  3D8C A;  3NNG A;  2F4P A;  3J8F 2;  1G7Y A;  5DDJ 3;  2PFW A;  4M4P A;  2Z5W A;  1X9T A;  4QDS A;  3ENR A;  3OEA A;  3M8L A;  5CZK A;  3RYK A;  2MNG A;  5ABJ A;  3H42 B;  4P00 B;  5IK4 A;  2A3W A;  1I1E A;  2DBI A;  1RUE 2;  3ZR6 A;  4K7J A;  5A3O A;  3T1M A;  1A8D A;  1R1A 1;  4HKO A;  2Y6F A;  2EXJ A;  1O7F A;  2XBO 1;  3DF0 A;  3OGS A;  3VBU A;  3WNM A;  3ZN6 B;  1URX A;  2A70 A;  2Q8C A;  2ZA9 A;  3PUH A;  4GB3 2;  1JZ3 A;  2BGO A;  1JOB A;  2JDZ A;  1KGY A;  3PUA A;  3Q8C A;  4MXW B;  3J7L A;  1PO1 2;  3T08 A;  3QH6 A;  1G9D A;  3V0A B;  2XR4 A;  4OI0 A;  1NY7 1;  2ZGS A;  3QLQ A;  4NIH A;  1AL2 1;  2BGC A;  4YSF A;  5J48 A;  4NPL A;  3UT0 A;  5CKQ A;  4YFZ A;  2WKK A;  1LHV A;  2W9X A;  2VQA A;  1B35 C;  2OZ6 A;  2VME A;  3LZZ A;  3U11 A;  4RGG A;  1Q43 A;  5GLV A;  2ZGO A;  4R4X A;  2GP5 A;  3DYP A;  1BEV 2;  1C1F A;  1MVQ A;  2DVD A;  3HN3 A;  3Q9O A;  3SIT A;  4A3Z A;  1AR6 3;  4E8C A;  4XET A;  4COY A;  1XRU A;  1V6N A;  4XUQ A;  1JS9 A;  5B4N A;  5FDB A;  2JIJ A;  3E5Q A;  1YXW A;  2WZ8 A;  4OLL A;  1PGS A;  4BME A;  1YCI A;  5T3N A;  4CE8 A;  3KF3 A;  3BPZ A;  1LOF C;  1OVS A;  4E4D X;  1WA6 X;  2R04 1;  5A3W A;  2B8M A;  1PO2 1;  1W6O A;  3ZXD A;  5FCC A;  3S7I A;  3VD5 A;  2UY9 A;  1VP6 A;  4XFB A;  1JTZ X;  3IKW A;  1R1A 2;  3MLK A;  4N53 C;  1Z7S 3;  5FZO A;  3FHI B;  3ZLI A;  1VBC 1;  3D0J A;  3J26 N;  3LCP A;  3NVC A;  3PMS A;  5DUU A;  3VUO A;  2ORX A;  2JDU A;  1HN0 A;  3MHZ A;  5HXV A;  1O6U A;  1XJA A;  3KLS A;  2WYS A;  4QPI B;  4AED B;  2WNV B;  3KHC A;  1H2K A;  2BFU S;  4KI5 M;  4TTG A;  2PLV 1;  4MOA A;  4R52 A;  4Y20 A;  3OD0 A;  2BVV A;  1W6N A;  2JG8 B;  3OGJ A;  4YRD A;  2EIB A;  2UWB A;  4NO4 A;  1XNA A;  3CMG A;  3KD4 A;  1SZB A;  5H9R A;  3V64 A;  3O1S A;  3BIE A;  1W6M A;  2WWS A;  4YG3 A;  1FNZ A;  4P02 B;  1JOD A;  1YO8 A;  1V9U 1;  3KGL A;  3KM5 A;  3K3O A;  5EP9 A;  1UZW A;  4UF0 A;  1GOG A;  4V2W A;  2VNO A;  4YW1 A;  1DHK B;  3I2O A;  1R09 3;  4MGY E;  3UK9 A;  3H1Y A;  1A3K A;  4XDP A;  5F5I A;  1JBC A;  2G9F A;  2YBK A;  3PVB B;  1F9K A;  4FPK A;  2JEC A;  2PHL A;  1HLC A;  1SQ4 A;  3AMM A;  4U36 A;  4CEY C;  2P34 A;  3T0A A;  2J1E A;  3N7K A;  5EV7 A;  1TME 3;  4ASM B;  2E63 A;  3POF A;  2EAL A;  5GZF A;  3RZK A;  1WUV A;  4RFR B;  3ZM8 A;  5FXW A;  3N36 A;  3PNA A;  3I2H A;  4NIG A;  4GWM A;  1KDM A;  1HV0 A;  2YHJ A;  4YM0 A;  4B4Q A;  4CUG A;  2R04 2;  5A7N A;  1PO2 2;  5A3T A;  2YC2 A;  5GZD A;  2JB4 A;  4LLO A;  4UFL A;  2KD7 A;  3WNX A;  4OQ9 A;  3WQ0 A;  5FZ6 A;  2VQT A;  2YV8 A;  4YM3 A;  1PM7 A;  3S5A A;  1VBC 2;  3ZXE A;  3MLL A;  4QD2 A;  3AYD A;  2O8O A;  4Y1V A;  5D8A C;  4CP9 A;  2PHT A;  2A6W A;  2JE7 A;  5DPN A;  2WFF 3;  2A73 B;  2XG3 A;  1QNW A;  3FX3 A;  2VCA A;  3NJZ A;  1OKO A;  2PLV 2;  2B5H A;  1QXJ A;  2TEP A;  1POV 3;  1AXZ A;  2OQ7 A;  3AP7 A;  1AR7 1;  1MZE A;  4C91 A;  2Y0I A;  5LBF A;  2AYH A;  2BEO A;  2A6V A;  2PMW B;  1RYY A;  5C71 A;  5FPL A;  2WA4 A;  4AGR A;  3EB7 A;  3RZJ A;  3WNK A;  2RS3 1;  1WCK A;  1ODN A;  2JJ6 A;  4LO5 B;  1V9U 2;  4L99 A;  1CAU B;  4G9S B;  2VW2 A;  1QGL A;  4ZU5 A;  3OYW A;  3TBD A;  5KXD A;  1WCQ A;  3ILR A;  1DIW A;  1NCR A;  1ZM1 A;  1Z78 A;  4BZ4 A;  2RR1 1;  5BNO C;  5FZD A;  2W52 A;  2DVF A;  4LO4 B;  2W95 A;  5ACA 3;  3I49 A;  4D6S A;  1SHW B;  3R4S A;  2CDP A;  4A42 A;  4S2F A;  1HQW A;  5KWR A;  1QJF A;  1EV1 3;  1MQT C;  1QQP 1;  1QH6 A;  2HH9 A;  2P6C A;  2WL1 A;  1ND3 A;  5LAT A;  3S7E A;  5FY0 A;  4FCA A;  2FZ1 A;  2W92 A;  4YW7 A;  1UN1 A;  4HLT A;  3O1R A;  4GH4 A;  2ZEY A;  1IS3 A;  4YWA A;  3WP3 A;  3RZM A;  2WWJ A;  4XUP A;  1HB4 A;  3CO2 A;  5CIR A;  1UOG A;  3WW4 A;  3VD4 A;  2QVS B;  3SC7 X;  3DL3 A;  1JN2 P;  4EV0 A;  4FBF A;  3GCX A;  2VZ1 A;  3C8X A;  4IEZ A;  1D4V B;  3IAP A;  3SEP A;  4CRQ A;  4TN7 A;  2DU1 A;  2EF6 A;  2XUE A;  3N7J A;  3T2O A;  3H1W A;  2Q5T A;  3ZYR A;  1NA1 C;  5FYZ A;  1OQ1 A;  1OF3 A;  4HZF A;  4UT5 A;  4AZZ A;  3DYM A;  4IV1 A;  5T52 A;  5G05 L;  1ZA7 A;  3ZX7 A;  1MZF A;  3RYP A;  3I3Q A;  1AR7 2;  4OMD A;  4BXF A;  5KXB A;  2BBV A;  2W1W A;  4LKF A;  5JSP A;  3I8T A;  2ZEZ A;  3WDW A;  1XQN A;  4LA3 A;  1YI7 A;  2IVJ A;  2VTX J;  2JE8 A;  2RS3 2;  3LWC A;  3RS6 A;  4LO7 A;  2GC2 A;  4RHV 1;  5G04 L;  4LOT A;  2ZGN A;  3FLP A;  3GF6 A;  5LB6 A;  4YW2 A;  2HWB 1;  5JMO A;  4QGN A;  1LCL A;  1IHM A;  3MUY 1;  4AI0 A;  3H3Z A;  2N7G A;  1PM4 A;  3HQU A;  4IEP A;  5A1F A;  4IE0 A;  2RR1 2;  2RM2 3;  2YC0 A;  2JG9 C;  1AX2 A;  1GP5 A;  3HVD A;  4CXW A;  3SH3 A;  2RHP A;  4A7Z A;  2XDV A;  2P4E A;  5CKN A;  4OUM A;  3AP9 A;  3B69 A;  4FO9 A;  4Z2A A;  1XOY A;  1WBL A;  3WLU A;  2BU9 A;  1QQP 2;  2X05 A;  4GMP 1;  4AR2 A;  1MS1 A;  1JYT A;  5DAQ A;  1HJF A;  4AHX A;  2EXI A;  4OUE A;  3O1O A;  3VHP A;  3CU7 A;  3KHB A;  4XQ4 A;  2R7E B;  3T4V A;  2E26 A;  5C4W C;  1QKQ A;  4OHV A;  4XF4 A;  4CDW A;  3TNP B;  3IIA A;  5DG1 A;  3WF1 A;  4D0Q A;  4UW6 A;  1FAY A;  3ETQ A;  1ZZ6 A;  3PUQ A;  3NAP A;  2VQU A;  4J1W A;  1T2X A;  2WFP A;  3KV5 A;  1XSQ A;  4WM8 C;  4XAA A;  2L9L A;  3M3E A;  3OTF A;  5APA A;  4ZS2 A;  4ATF A;  2ET7 A;  4RS5 A;  1JXN A;  5FYI A;  1AX0 A;  4DIQ A;  3ACI A;  4CU7 A;  1VAV A;  2NQY A;  5IYY A;  4QPG C;  2TBV A;  2JDN A;  3WY6 A;  5FZM A;  4W6X A;  3Q8F A;  4AVS A;  1H6X A;  4YG0 A;  2PHD A;  4GUL A;  4I01 A;  1Y3T A;  4QX5 A;  3THD A;  2WT1 A;  5L9B A;  1VBE 2;  4A2U A;  3RGB A;  4NIA A;  1PMJ X;  1Q8S A;  1GR3 A;  3D6E A;  3TB0 A;  3WX5 A;  2HWB 2;  3PL0 A;  5EJ3 A;  1ZRD A;  3RI9 A;  2D6L X;  2X5I C;  4IEQ A;  1QEX A;  4AK3 A;  2QQL A;  1XXN A;  3CEW A;  4UOJ A;  2VZS A;  4XZU G;  4IV1 B;  5DAV A;  4PIZ A;  4NHK A;  5C9A A;  1TZO A;  3APB A;  4TXW A;  5FK8 A;  1EUU A;  3J7M A;  1ZRI A;  2B9U A;  3M3C A;  4RQP C;  1JU3 A;  4DEV A;  4Z82 A;  1QJY 3;  4K9S A;  4OUL A;  1KFU L;  1M4W A;  2D98 A;  1YNA A;  3MPB A;  4CYD A;  2D5H A;  1V70 A;  3ZSM A;  1OH4 A;  1MVE A;  2VVD A;  1ULP A;  1UNB A;  2BFU L;  3EJK A;  2VNV A;  4UW3 A;  2Y6H A;  3AJY A;  1LU1 A;  4MG2 A;  1Y4W A;  3ES4 A;  3GYD A;  2XJS A;  1DQ2 A;  4MV2 A;  5JXJ A;  1RUD 1;  3ZSJ A;  2WNU B;  5CFC B;  2RG4 A;  1KXG A;  3UET A;  4BXS V;  3ZSK A;  2XJP A;  2DTW A;  3T0D A;  2IXL A;  4LUK A;  1U5Z A;  2Y38 A;  3VBF A;  1OQD A;  3QD6 A;  5JPN B;  4R9A A;  3GAL A;  5JVV A;  3CLP A;  1J3Q A;  5JLV A;  4NRM A;  1DBN A;  5F6L B;  1STM A;  4FFF A;  5KXE A;  1WGP A;  2H6C A;  1K45 A;  1OT5 A;  1S0J A;  3VN4 A;  3ZPY A;  2QNK A;  3F2Z A;  3ZYH A;  4XQD A;  1FPN 3;  4QM9 A;  5A3U A;  1ZZ8 A;  4JCK A;  1TVG A;  2YZ4 A;  2FHR A;  5FMC A;  2LRP A;  4B3N A;  1VBB 1;  1L7R A;  1NG0 A;  2GME A;  2VE1 A;  5FKC A;  3BPS A;  5K0U A;  4JZR A;  3TEY A;  2OVU A;  1SLA A;  3GZU C;  4L97 A;  2VOK A;  1AYN 3;  3ELN A;  5SV5 A;  4AXO A;  4BQX A;  5LBC A;  1BBT 1;  2PAM A;  3UYJ A;  3AP6 A;  1U5X A;  2ZKN A;  4Q4X 3;  1H1A A;  4N7I A;  3S0M A;  1EYB A;  5FV3 A;  1YFW A;  3VD3 A;  4AGV A;  3M3I A;  4QT6 A;  1AL0 G;  4IXL A;  2UU8 A;  2Y60 A;  3KMH A;  3OF1 A;  5DZE A;  4BWO A;  2C9A A;  2JXA A;  1SPP B;  2GH2 A;  4XCA A;  1UKR A;  2GZW A;  3Q8E A;  1CPN A;  4PBP A;  2VTF A;  2R0H A;  2QQV A;  3LPG A;  3BB6 A;  4LE3 A;  1J83 A;  3QOP A;  4X6R B;  4LIV A;  4Y1Y A;  5D2A A;  1SEF A;  1RUD 2;  5KC6 A;  4LUL A;  4IUG A;  4CDX A;  3TNQ A;  2W1U A;  2ZMK A;  4ZHN A;  3I97 A;  3GBG A;  3LOB A;  2O0O A;  3J7H A;  3NMB A;  4Z8B A;  4NPR A;  1PIV 3;  3NQH A;  1ZBE 1;  5EPA A;  1B35 B;  4UWD A;  4JAA A;  5IFT A;  5JPM B;  5KHJ A;  1X8M A;  2WBK A;  1QOO A;  2BPA 2;  4MGK E;  4UFM A;  2ZX1 A;  3GJB A;  3J7N A;  3ZXL A;  2HWE 3;  1LGN A;  2QQN A;  3FLR A;  4QPI C;  5A7W B;  4AED C;  3AZX A;  2WNV C;  1VRH 1;  3IWZ A;  5GLW A;  2RJK A;  4FI9 A;  4XJ8 A;  1UMH A;  2Q1Z B;  4LA2 A;  3LKJ A;  3JD7 3;  3W9A A;  2WA3 A;  1L7Q A;  4XUN A;  2VCB A;  1PVX A;  4K3U A;  3I7D A;  1QJE A;  1LEM A;  1VBB 2;  2QQP A;  4N43 A;  4W4Z A;  4C8D A;  3KCC A;  1W0O A;  1ST8 A;  3P5B A;  1BBT 2;  3AP4 A;  3GHN A;  2ARA A;  1NXD 1;  1U5I A;  3KV6 A;  3UES A;  5FOB B;  3VBU C;  2KA3 A;  4W8J A;  3PLQ A;  1F2N A;  4LEJ A;  2P17 A;  4OUS A;  3HEI A;  3T0B A;  4LIU A;  3NRU A;  4YLZ A;  5ISL A;  3MIC A;  1YFY A;  5EFU A;  3VKM A;  1VBD 1;  4CDU A;  2VG9 A;  2VUC A;  3WQB A;  5JI9 A;  2DFB A;  3WDX A;  2R06 3;  5T5P A;  1VMJ A;  2XVL A;  3HNY M;  3M1H A;  1W90 A;  3N9Q A;  4ET7 A;  5JZG A;  4ORF A;  1J59 A;  2HWC 3;  1IPJ A;  4CSW A;  5GZE A;  1GFF 2;  3MIE A;  4KU8 A;  3VZK A;  4NAM A;  2GP3 A;  3ZO0 B;  3AMN A;  4D7S A;  4E2S A;  1UMI A;  4HAN A;  4R9D A;  2WUH A;  1ZBE 2;  3M4F A;  4ZU7 A;  4XEZ A;  4Y22 B;  5HCH A;  3CZJ A;  4PLM A;  3BI3 A;  4XMI A;  2VVF A;  2Y6K A;  1IOA A;  3BOD A;  1SFP A;  1BCX A;  1TE1 B;  4IEX A;  2W2I A;  3D0S A;  4KG0 A;  1RUN A;  1VRH 2;  5M0T A;  4B8E A;  2OUJ A;  4Q4W 3;  4E9K A;  1UY4 A;  4R9B A;  5F32 A;  1RUC 1;  3T4H B;  3BAL A;  1YQ2 A;  4FPL A;  5BNN A;  2J42 A;  5EYX A;  3ES1 A;  3KWV A;  2ZMN A;  3SEE A;  1SLT A;  4WBB A;  1WD3 A;  2RDQ A;  2JEN A;  2K2S A;  3N9L A;  2B42 B;  1UX6 A;  5JUV A;  2BZD A;  3DEC A;  2GH8 A;  1XNT A;  1CPM A;  2AZ5 A;  1WA4 A;  2ZHL A;  1FYU A;  5DDJ 1;  2PN5 A;  3ZFE B;  1OUS A;  1DQ0 A;  2ZKL A;  5AVP A;  1VBD 2;  1CAX A;  1N1V A;  2VZV A;  3U1X A;  4EQV A;  2VMF A;  2D6K A;  4YFW A;  4LO8 A;  3HAG A;  1LRH A;  4KG8 A;  5L73 A;  3WG4 A;  3E1F 1;  1W2N A;  2A1X A;  4AAX A;  1VR3 A;  4H2A A;  4QX8 A;  4CXX A;  2BNN A;  3GGL A;  1IQA A;  1CAW A;  2YU1 A;  1C5H A;  1NQJ A;  3AP5 A;  4CTE A;  3WSO A;  3FE5 A;  3K77 A;  4HT1 T;  1SG3 A;  3V56 A;  2XML A;  1QHD A;  2BRT A;  2UUR A;  4ITC A;  4O65 A;  3ZFF A;  2Z79 A;  3WR0 A;  1W2U A;  1QH7 A;  4HL0 A;  1I9R A;  4CDQ B;  5GKA C;  5FUN A;  3A22 A;  3LD8 A;  3OY8 A;  4CXY A;  3AB0 A;  3O1P A;  1T6B X;  2H0V A;  5CFC C;  4YW5 A;  4ES9 A;  4IW3 A;  4LKS A;  4HVO A;  2HWF 3;  2WNO A;  1AR6 1;  2PHF A;  4Y5Z 0;  1RUC 2;  3OBA A;  3O0X A;  1L3J A;  3ZXJ A;  1GV9 A;  3WNL A;  5FZK A;  2CTV A;  2CYF A;  2QQW A;  2B4K A;  5H9S A;  2JDP A;  4N8M A;  1DU3 D;  2B46 X;  5LAS A;  4L92 A;  5I93 A;  4DPN A;  2JWP A;  2YUE A;  4FAG A;  3MPP G;  1FOD 2;  2YXS A;  4CVU A;  5FLJ A;  4R4Z A;  1S55 A;  5CFD B;  5JCT A;  5DDJ 2;  4BHP A;  2BBA A;  3FBM A;  3HR9 A;  3CJI A;  1PK6 A;  4QU2 A;  4GD4 A;  1BZW A;  2YGM A;  2WQZ C;  5CG9 A;  1S0I A;  1Z7S 1;  1WMX A;  5FBZ A;  5FZ7 A;  3VZN A;  2DVG A;  2HYK A;  5IVY A;  1CR7 A;  3T2Q A;  4AFM A;  4CCJ A;  3E6C C;  3VHO A;  4XHB A;  1OFS A;  4G3Y C;  3MW4 A;  1YQ8 A;  2E32 A;  4CCK A;  2WII B;  3PUR A;  5FUP A;  1QJZ A;  2C9K A;  1NCR C;  2VD7 A;  3OEB A;  3QCW A;  3URF A;  1PZ7 A;  1ZBA 1;  4FPY A;  1CX1 A;  1JZ7 A;  5T5J A;  4C1X A;  1CAV B;  1MPX A;  2HEY F;  1OLQ A;  2WLQ A;  4TZD A;  1QJX 3;  2VL4 A;  1ODM A;  3L9J T;  2OUH A;  5C8C A;  3C2U A;  2IZW A;  3RPQ A;  3WQ1 A;  4BYY A;  2A3Y A;  3V0B A;  3N35 A;  3WDY A;  1ND3 C;  1CVN A;  1DYK A;  4XAC A;  1R09 1;  1AR6 2;  5DAW A;  1NZC A;  3OPW A;  1XSR A;  3W5M A;  4CUA A;  3O7O A;  3S57 A;  5FO8 B;  2AAC A;  3PME A;  3I54 A;  4EN9 B;  4JHZ A;  1S0D A;  4XF0 A;  1FMD 3;  3RWN A;  2C24 A;  1PGW 1;  3JBG 3;  3CDZ B;  4FVV A;  5GLU A;  3B3Q E;  3WHT A;  1TME 1;  2Q1M A;  1UY1 A;  4JKL A;  3I4I A;  4BU2 A;  1ENR A;  4HET A;  2VUJ A;  4IV1 C;  1BVP 1;  3POG A;  2ZHK A;  4DXS A;  4CP0 A;  5KHK A;  2EID A;  2VXR A;  1XU2 A;  3SKV A;  4GAL A;  3BVC A;  4WM8 B;  1YJL A;  1XC6 A;  1E5I A;  4A4A A;  4FQZ A;  1H2L A;  1LHN A;  2MEV 3;  1Z7S 2;  3IZO A;  3D3A A;  4K6B A;  1RUE 1;  4BIF A;  2ET1 A;  3IBM A;  1UU4 A;  1W9F A;  4Q1P A;  2Q4S A;  5FY1 A;  5FZB A;  3DPR A;  4QPG B;  5ANN A;  2WFF 1;  4XUO A;  4HVR A;  2NP0 A;  4IGP A;  4OFG A;  3HQR A;  4WVW A;  1FNY A;  1RB8 G;  2RS1 3;  1VE0 A;  1POV 1;  2VU9 A;  2WNU C;  1X36 A;  2Y0O A;  3FL7 A;  4UFI A;  1LUL A;  3VBH A;  4LK7 A;  4LMF A;  4COZ A;  2YFZ A;  3UL2 A;  2DU0 A;  1RC6 A;  2ZX3 A;  1XNB A;  3FLT A;  1AX1 A;  2X5I B;  4QHZ A;  5FY9 A;  3ZSL A;  4NJ4 A;  5BUV A;  4PI2 A;  1UPI A;  4CCN A;  2BER A;  3CZU A;  1Y43 B;  2XVG A;  3OBR A;  1R09 2;  4AYU A;  2DUR A;  1HJG A;  2WAB A;  2FD8 A;  4OYU A;  2O1Q A;  1H8T A;  4NVP A;  4RQP B;  2QQO A;  4XFI A;  1SDW A;  4CU8 A;  2E7Q A;  5FYM A;  3III A;  4JDM A;  1PGW 2;  3A21 A;  1W6Q A;  3NAP C;  1GQG A;  5ACA 1;  5I0D A;  1HV1 A;  1DLC A;  1TME 2;  2VOT A;  2YFU A;  3MF9 A;  4IQP A;  5GLT A;  5A7O A;  1V6O A;  1RUF 3;  3VBO A;  4HK9 A;  3SIS A;  1CIW A;  1EV1 1;  1OUR A;  5L7O A;  2A71 A;  4Q4Y 3;  2DCZ A;  5L9V A;  2R32 A;  2WWU A;  2Y26 A;  1PNG A;  4QGL A;  1NCQ A;  1K5M A;  5FP7 A;  3RRD A;  2D6N A;  3T30 A;  2ZX0 A;  3BKZ A;  5LK5 A;  4ARY A;  2MHF A;  1QF3 A;  2YBS A;  3LA7 A;  5FJH A;  1W3V A;  1H9W A;  2ZGQ A;  3NNF A;  1LU2 A;  5DZF A;  1VBA 3;  3B02 A;  2WO3 A;  3H8U A;  4UFK A;  3SQO A;  4A45 A;  1D2Q A;  4JGY A;  4XQW A;  2QDR A;  2ADE A;  5J36 A;  3ON7 A;  1NX9 A;  2WFF 2;  3NV3 A;  4D69 A;  4LHS A;  1XNC A;  2RMU 3;  1AXK A;  5GM0 A;  4QQL A;  4Q0S A;  3SHR A;  1PMI A;  2W1Q A;  4A7K A;  1UF2 C;  2XJV A;  1YRZ A;  5FP4 A;  5FWJ A;  4CEW A;  1JYN A;  4XBQ A;  4LT5 A;  4E4S A;  2GNB A;  3WF0 A;  4AHW A;  3AMQ A;  3WNO A;  2JKX A;  3CNA A;  4FTS A;  4QKD A;  1RJ7 A;  2ARC A;  3MV1 1;  4J1X A;  1JHJ A;  3UV9 A;  5F9T A;  2VZO A;  1GBG A;  4XYX A;  1LTE A;  3VZM A;  1G9F A;  2PTM A;  3EMR A;  5DUV A;  2RM2 1;  2Q30 A;  1G6N A;  4XOG A;  4S2D A;  5A3P A;  1LOA A;  1TQ5 A;  3LEK A;  3VBH B;  5ACA 2;  2VAU A;  1D0H A;  3ZPO A;  1A6C A;  4XJW A;  3AYC A;  1EV1 2;  3VBF C;  4YZ5 A;  3T3Y A;  2HEV F;  5EXO A;  4OI2 A;  1GWL A;  2Y6G A;  4BQW A;  5FFO C;  1LEC A;  3N4M A;  3QBQ A;  3DYO A;  2I45 A;  3JXS A;  4FPO B;  4LBQ B;  3OD4 A;  3RWK X;  4NID A;  5IW0 A;  1C28 A;  4I0W B;  4XUT A;  1O3R A;  1JI6 A;  1GZW A;  5C3O A;  3ACL A;  4DXR A;  1DGW A;  4C0B A;  4CCM A;  3WP5 A;  4BQ2 A;  4RR3 B;  1EUT A;  4O9E A;  2ERF A;  3DGT A;  4P9J A;  4CUB A;  4ZZ5 A;  2FDH A;  2TUN A;  4JGZ B;  3VZJ A;  4HK8 A;  3PJQ A;  5T5L A;  2PYT A;  4B1L A;  4UBG A;  1NE6 A;  5FXZ A;  5I0T A;  1AVB A;  3S5Q A;  2RE9 A;  5FRE A;  3ZKU A;  4AFA A;  2DVB A;  1UY0 A;  3POE A;  4Y4Y A;  3LB9 A;  5ABJ B;  2GN3 A;  3HJR A;  1PZ9 A;  2BWC A;  2QQK A;  3VHR A;  4B29 A;  2CWS A;  1UWW A;  2E9Q A;  2YY1 A;  4PBO A;  5FXX A;  4XMA A;  3E5U A;  5L36 A;  4A41 A;  2W87 A;  3K48 A;  2DUO A;  5JIA A;  4BK5 A;  3BTA A;  4KQ7 A;  3WUD A;  2HYX A;  3H7Y A;  5CB7 A;  1GOH A;  3DXT A;  4XXP A;  2IXK A;  1ZRC A;  2C0Z A;  3VBU B;  2BV4 A;  2DVA A;  1ND2 A;  2ES3 A;  2YPJ A;  3LDB A;  3I2F A;  1ULF A;  2RM2 2;  4COW A;  4YM2 A;  5F5A A;  3HN1 A;  1WMF A;  1UXX X;  2QFE A;  5F3E A;  2QKD A;  2ZEX A;  1NT0 A;  1QJY 1;  1TG7 A;  2RJ2 A;  3SNM A;  4JKM A;  3T09 A;  1SBF A;  1RVF 3;  3QH7 A;  3AZV A;  4WM7 A;  2VBB A;  2WSV A;  4ZY9 A;  1JZ8 A;  4QKN A;  4GQ7 A;  4AQS A;  3DCQ A;  3RJ2 X;  5LWB A;  5LRR A;  2A5Z A;  1OF4 A;  4H7L A;  4K8R B;  2XJQ A;  4N90 A;  4ERO A;  3H8R A;  2CAV A;  4AG4 A;  4C90 A;  1NOV A;  3IN9 A;  3LE0 A;  4UW4 A;  4PCR A;  1YQC A;  3ZFE C;  1XYP A;  4HKL A;  1O3S A;  1W8F A;  5EHD A;  2AEN A;  3ZXG A;  2GC0 A;  2WYF A;  4EJR A;  1UMZ A;  1JYI A;  2ILM A;  4IEW A;  4YNI A;  1OC1 A;  2VBD A;  3I2G A;  1UIJ A;  3M2M A;  4N43 C;  1WME A;  1DYO A;  4EN0 A;  1OI6 A;  1DGR N;  2ZGT A;  1LGB A;  2QE3 A;  2VUL A;  4BIO A;  4E27 A;  4KGG A;  1W6O B;  3H8O A;  4YVS A;  3USS A;  1MAC A;  1RHI 3;  2J1T A;  5HXM A;  2Z42 A;  4ISQ A;  5FWE A;  1FPN 1;  4CP9 B;  2ZTN A;  1ZRE A;  1H9P A;  4CDQ C;  5FZO B;  2OXB A;  1UCX A;  4I02 A;  4TYS A;  5FZH A;  2YDE A;  4AI1 A;  1E57 A;  1FT9 A;  1AYN 1;  1DYP A;  3AL5 A;  3R6S A;  1AF9 A;  2OX0 A;  3POW A;  1C4R A;  2AH2 A;  4Q4X 1;  5LY1 A;  1UY2 A;  1W39 A;  4DUV A;  4Y20 B;  1QJY 2;  1OOP A;  1JZ2 A;  4NRQ A;  1W6N B;  2B9V A;  3ZIW A;  1RTV A;  2LRO A;  4LBO A;  5AFE A;  3ME2 A;  4KWK A;  4NN0 A;  4E8D A;  1LOG A;  1W6M B;  3DV8 A;  2NN8 A;  3NNJ A;  2K46 A;  2Z69 A;  3POJ A;  4FPG A;  4IV3 A;  5AFB A;  1LR5 A;  4IEY A;  3VBR A;  1ZNP A;  1KQR A;  2WN3 A;  1U12 A;  4UF0 B;  2EVX A;  4QHB A;  3VBS A;  5GZC A;  5J3U A;  1BQP A;  4IE5 A;  2Q1F A;  5CFD C;  3J4U H;  1REF A;  1AYM 3;  2WAO A;  3CF6 E;  3KS7 A;  3IAQ A;  2IXH A;  2EAA A;  1DLL A;  2YBP A;  4QGM A;  3MIB A;  4UFJ A;  4AHZ A;  3C7H A;  1PIV 1;  1ZA4 A;  2W1S A;  1AR8 3;  5BNN C;  5LA1 A;  2BTV C;  2Q8O A;  4LHN A;  2A3X A;  3Q8B A;  4FSJ A;  2JEM A;  2NMO A;  2UY8 A;  3H3U A;  4PF5 A;  5F3C A;  1W6P A;  1DQ1 A;  2D44 A;  3CBN A;  3LGR A;  2HWE 1;  3H50 A;  4GZ9 A;  3ZFG A;  2JB8 A;  4PI0 A;  1O59 A;  4EWD A;  1FPN 2;  2XKO A;  4YM1 A;  4I2O A;  3H1M A;  4MVT A;  1BVV A;  3ZMN A;  4DNY A;  3OGR A;  1VBE 1;  3JD7 1;  3ZYJ B;  4I0A A;  5A32 A;  5CBL A;  1ENS A;  2Y8K A;  1F31 A;  4OHY A;  2ZZQ A;  1BLZ A;  2Y33 A;  3BYW A;  1AYN 2;  1DZR A;  1X50 A;  2XB6 C;  3HBK A;  5T50 A;  4JX0 A;  4QXK A;  5JSO A;  1LKN A;  4XHX A;  2XBO 3;  2CDO A;  2P3Y A;  1FV3 A;  2NZ9 A;  4Q4X 2;  5BV6 A;  1OH3 A;  5EZW A;  1UZV A;  2ID4 A;  4DB5 A;  4YW4 A;  1ULG A;  3LPF A;  3FZ3 A;  4XZP A;  2ARB A;  1CZT A;  3KF5 A;  2VZQ A;  1XYO A;  3MBW A;  1H30 A;  3HT1 A;  3TN9 3;  2R06 1;  4HKW A;  2J7M A;  4GIQ A;  4JV4 A;  2F6B A;  4A7Y A;  1TNR A;  3LDK A;  3U10 A;  2V4A A;  3OYW B;  4X6Q B;  3VDB A;  4CCO A;  2HWC 1;  4FFH A;  1NCR B;  1XE8 A;  2W68 A;  3TWI A;  5LBE A;  4PIX A;  4AI9 A;  5CFC A;  5KHG A;  5HV4 A;  2I07 B;  2E7T A;  4XF3 A;  1W2O A;  1LOC A;  3I59 A;  1O4T A;  1PIV 2;  4N9I A;  5L9R A;  3KB5 A;  1H4H A;  4PDW A;  4QHO A;  2I74 A;  1V6J A;  2B7Y A;  3LSD A;  4IES A;  2YGL A;  2RDS A;  5AC9 3;  2A7A A;  5BNQ A;  2IVI B;  2R1B A;  1C5I A;  2W94 A;  4MET A;  4AAP A;  1GMM A;  5A7S A;  1ND3 B;  1VJ2 A;  5IVB A;  1O91 A;  4BQY A;  5F7U A;  5JI7 A;  4QX0 A;  2QJV A;  3ILF A;  1OBN A;  4GH4 B;  2BWA A;  1TNF A;  2HWE 2;  3AMH A;  3R4D B;  3KVA A;  3NW4 A;  1NAE A;  1K5J A;  3AM2 A;  1W9T A;  4Q0V A;  4Q4W 1;  2WO1 A;  3JD7 2;  2DF7 A;  2IFR A;  3WD5 A;  2D3P A;  2QBX A;  2X8K A;  2GNT A;  1M06 G;  1ENQ A;  1E5S A;  1WMD A;  1QMJ A;  2X10 A;  5LBB A;  3RFR A;  4F8A A;  2HWD 3;  2P3J A;  2IC1 A;  2BNO A;  1GOF A;  2XON A;  3KQR A;  4B7K A;  2G19 A;  3MGU A;  5IVJ A;  1OHF A;  3JCI A;  3MFA A;  3MID A;  3WNP A;  4PLO A;  1WLW A;  4MAD A;  3OG2 A;  4PQQ A;  1HRV 3;  4YW3 A;  4IET A;  4BMB A;  3ZYP A;  3ROU A;  2D6M A;  2X29 A;  4AQT A;  4Z2W A;  3KQ4 B;  1S0B A;  4YZ3 A;  2R06 2;  4QU1 A;  2WNE A;  1PGL 1;  5T55 A;  2VOV A;  5AVA A;  3AXD A;  4A6S A;  5FY4 A;  4YZ4 A;  3N9M A;  2HWC 2;  3VD9 A;  1PMH X;  4KWL A;  4LOR A;  4QB2 A;  4JVA A;  3U75 A;  4B1M A;  4D8M A;  3E5X A;  2D40 A;  2DCJ A;  2HKX A;  3AKQ A;  5FPA A;  3VZO A;  4DS0 A;  5JIU A;  1UYX A;  4G4F A;  2G9G A;  1Q56 A;  2YRO A;  3MFC A;  3PU8 A;  4BQ4 A;  1HRI 3;  5I0S A;  1XU1 A;  5HCA A;  2QDN A;  5IFP A;  2JKB A;  2WQ8 A;  4LNV A;  1CQ9 A;  3WP4 A;  4DQA A;  2C26 A;  2K0G A;  4CDW B;  3AKT A;  4EWE A;  2V5D A;  4Q4W 2;  5A6Z A;  5BYN A;  5HBA A;  1LHO A;  4K8F A;  4XTM A;  1H0B A;  2HWF 1;  2GC1 A;  2PHW A;  2ZGK A;  3B93 A;  3NAP B;  3UKN A;  5B2G B;  1RL3 A;  5EYY A;  4KH9 A;  2G4I A;  4DRV A;  4NOT A;  2CY6 A;  4QQ2 A;  2WIN B;  4FXG B;  4I0B A;  2E33 A;  4RS5 B;  1UQX A;  5FY5 A;  4UAP A;  1MS0 A;  4Z1V A;  2VZT A;  3WDT A;  1OUX A;  3F95 A;  4I09 A;  1CIY A;  3UKV A;  1LOF A;  3HWJ A;  3OCP A;  4H7M A;  2V72 A;  2VVE A;  3ZVX A;  3MZH A;  4FPF A;  1K42 A;  1IG0 A;  4YGD A;  2WR9 A;  4B7E A;  1MZ5 A;  3VBH C;  4P9Y A;  4ZKT B;  2P5B A;  4HBN A;  2JIC A;  1UKG A;  1W3X A;  1RIR A;  2VPV A;  2PAE A;  1PGL 2;  3PVE A;  5JMC A;  3PDQ A;  4N53 A;  2F17 A;  2JDH A;  2ZPX A;  5LA0 A;  4N7U A;  3BTX A;  3FHQ A;  1O5L A;  3LIG A;  2B39 A;  1R08 3;  4XDO A;  2Q8E A;  1DF0 A;  1WZX A;  4AQ6 A;  1ZYB A;  5FZ1 A;  2YMZ A;  4WVZ A;  3ZXF A;  4COU A;  5C9A B;  4CCD A;  1H8T C;  3M3Q A;  1HXS 3;  2FQP A;  3EQE A;  3POS A;  3I3E A;  3WOG A;  3FJS A;  4MYE A;  4SBV A;  5F3G A;  5FZA A;  4FTE A;  2YG0 A;  4YGB A;  1D2S A;  1ACC A;  1QJX 1;  4RR3 C;  3V65 A;  2VMC A;  5CNA A;  2HBU A;  3IPV A;  5A6Q A;  4JGZ C;  1NYW A;  2BYV E;  1QJU 3;  2GDF A;  1XE0 A;  5LK7 B;  4GWN A;  1GSL A;  3UJQ A;  3IDC B;  2HWF 2;  4LUM A;  5FUI A;  3WG2 A;  1CZS A;  3TAY A;  2P37 A;  1WLD A;  1QOT A;  2LTN A;  4ZU4 A;  5FXV A;  3WW1 A;  4K40 A;  3PIJ A;  2WZE A;  5ABJ C;  2RJL A;  1FMD 1;  3RMX A;  4J25 A;  4CEY A;  3VBF B;  1JHN A;  1BK0 A;  4P5Y A;  3JBG 1;  4QX1 A;  3WV6 A;  3T1L A;  2EA7 A;  4OZO A;  2RDN A;  3KT1 A;  4UBH A;  1ULC A;  5ANQ A;  5FPZ A;  1D4M 3;  3VB9 A;  3HT2 A;  1W03 A;  5C6C A;  3KT4 A;  3TEZ A;  5E1R A;  1YJK A;  1C8M 3;  1XB9 A;  3L2H A;  4GA9 A;  4Q4V 3;  1JU4 A;  1ZZB A;  2ATF A;  4WVM A;  4F7Z A;  4BOW A;  1XE7 A;  2MEV 1;  4RHV 3;  3ILN A;  2ENR A;  3O5S A;  2FDG A;  2XWJ B;  1QNY A;  4NHM A;  4FOY A;  5K0U B;  2LW8 A;  1UU5 A;  2XOM A;  3C3V A;  2D6O X;  3X29 B;  4B4P A;  4BCU A;  4OMC A;  4KBZ A;  4D7T A;  1LGC A;  2RS1 1;  2Y6L A;  4BH9 A;  5JDB A;  1QJX 2;  3DKQ A;  4NII A;  2J1V A;  4U2A A;  5I8S A;  1S0G A;  2ZJC A;  5E8A A;  2W5F A;  3IDB B;  3K3N A;  4NWW A;  5DG2 A;  4HN0 A;  4IL7 A;  3NJY A;  4QM8 A;  3RSJ A;  5CAD A;  2ZAA A;  5BPX A;  2DYC A;  3TOJ A;  4FT8 A;  1Y9G A;  4HPK A;  1SMV A;  4O9G A;  5E88 A;  3MIH A;  4D6Q A;  3A0K A;  4ISR A;  4NRO A;  1GKB A;  1WCD J;  3BOW A;  2VMH A;  4Q0Q A;  3ZXA C;  4HON A;  4CDX B;  3UGF A;  3M7A A;  5BNO A;  1DDL A;  1RGS A;  3GDB A;  1FMD 2;  1W8Z A;  3BGA A;  3OB8 A;  4M3C A;  4OI1 A;  3JBG 2;  5IT6 A;  5LEK A;  1COV 3;  4YPJ A;  2XLF A;  3WDU A;  1W8U A;  4QB1 A;  2C5D A;  1RUF 1;  2CSG A;  5DXD A;  1MQT A;  2ZBJ A;  5FYT A;  4L2N A;  5JXI A;  1QXR A;  4K1Y A;  4AVB A;  3M70 A;  4Q4Y 1;  1FOD 1;  1LNS A;  5FRA A;  1KS4 A;  2FMY A;  4BQ1 A;  4A3X A;  5FYC A;  1GAN A;  4BA6 A;  2VH9 A;  4P14 A;  4QDQ A;  4Q8L A;  1O8P A;  2MEV 2;  1VBA 1;  3ZYB A;  5C3S A;  2RVA A;  2CHH A;  1S2E A;  4L11 A;  5IVE A;  2TNF A;  3ACH A;  4N43 B;  5A33 A;  4AVA A;  4GMP 0;  1APN A;  1WW6 A;  1PVC 3;  2NLR A;  4TLF A;  3OUH A;  1CJP A;  2RMU 1;  5BNP A;  1R1Z A;  3JQW A;  4FQ4 A;  4E4Z A;  1ND2 C;  3I3B A;  4IE7 A;  3O1U A;  1J3P A;  1H8V A;  2RS1 2;  2GU9 A;  3ZYG A;  1JH5 A;  1QDO A;  2UWC A;  1Y9M A;  4D7Y A;  3MO4 A;  1W0P A;  2AGS A;  4NMI A;  1J1L A;  5E89 A;  2AR6 A;  3LAG A;  5A1A A;  2LM3 A;  1EAH 3;  1DFQ A;  3MYX A;  4IER A;  4AWD A;  4FFI A;  5DN2 A;  1NLS A;  4CDU B;  4COV A;  3GBW A;  3ALQ A;  4WM7 C;  1LOB A;  1Y7B A;  2P3K A;  3WZ1 A;  3ZOI A;  1E5R A;  2J1S A;  3FBY A;  5F5C A;  5JZG B;  2ZHM A;  4GWJ A;  3NV2 A;  2ZGL A;  5DAX A;  2W46 A;  4LTA A;  4FP3 A;  1PHM A;  5DUX A;  2JG9 A;  3POI A;  3RZH A;  4HN1 A;  4Q27 A;  4QX7 A;  4XF1 A;  2D7F A;  1V0A A;  2WT0 A;  1RUF 2;  3NV1 A;  4WV8 A;  1OA3 A;  4YVW A;  1DCS A;  4DOU A;  5LA9 A;  4PIY A;  1TMF 3;  1HKD A;  5CKM A;  4NAO A;  2OZJ A;  4Q4Y 2;  1H1M A;  1YFU A;  2DV9 A;  2OPK A;  2CGN A;  2LAL A;  2OS2 A;  5ERL A;  1AHS A;  2VCC A;  3AZZ A;  5CEH A;  5H9Q A;  5C4W A;  2BOI A;  5FY8 A;  1SLL A;  5A80 A;  4KGQ A;  3U0Z A;  3JU9 A;  2WDB A;  2XL7 A;  3HNB M;  4D94 A;  2JDA A;  2NPI A;  1VBA 2;  1KIT A;  1NUK A;  4BDV B;  5BNN B;  1OVP A;  2VMI A;  4Q29 A;  1RUH 3;  4RA0 A;  2HBT A;  1KJR A;  4Y26 A;  1X9P A;  1SFY A;  2BOJ A;  2VGD A;  2NYY A;  4XXA A;  3USU A;  4W50 A;  3DUI A;  2B45 X;  2CWM A;  2JE9 A;  5FZG A;  1V6L A;  2RMU 2;  2ZOE B;  3O1V A;  1ALY A;  3UGG A;  2D97 A;  4MSV A;  1RUJ 3;  3PHM A;  1MEC 3;  2X53 S;  3NV4 A;  3RZL A;  3W21 A;  5FP3 A;  1H1I A;  1QXP A;  4URT A;  3WT3 A;  2VJX A;  3DN7 A;  2D93 A;  5DQ0 A;  1MR5 A;  4EN6 B;  1JW6 A;  4UW5 A;  2AEZ A;  1GP4 A;  1CAX B;  1JMU B;  2YPD A;  4AGG A;  2ADD A;  3WF2 A;  1XND A;  3WUC A;  4CPB A;  3OOX A;  1H6Y A;  4RSU A;  4Z07 A;  5K9Y A;  1CAW B;  3IT8 A;  4OQ8 A;  4ATE A;  3AYA A;  4Y1Z A;  1W8H A;  5C33 A;  2G9Z A;  4GH4 C;  3B9C A;  5JR7 B;  5BNP B;  1CX4 A;  5JXH A;  2E7A A;  2R07 3;  1LEN A;  1L7L A;  2CL2 A;  3PVO A;  3O0W A;  3VL8 A;  3ZFF B;  4ONU A;  2H0B A;  1OD3 A;  1F35 A;  4CUC A;  4ES8 A;  2R30 A;  4LJH A;  4XFC A;  2V4V A;  1RVF 1;  3PIG A;  1TEI A;  4AVC A;  5FYU A;  3JZV A;  5FQ0 A;  4H3W A;  3LEM A;  3OY8 B;  5JOW A;  5JXG A;  1I6X A;  4Q5O A;  5FKB A;  1GP6 A;  3ECQ A;  4RGA A;  3POB A;  5HCB A;  5JOZ A;  5FMD A;  4OHZ A;  4CCE A;  3VDD A;  2VNR A;  1OKQ A;  5EIY B;  2GAL A;  1AR9 3;  1BKZ A;  1OSG A;  1V6K A;  3L2Y A;  1W9S A;  5KHI A;  2FDF A;  2A6Y A;  1GQP A;  3O12 A;  2JD9 A;  1MS3 A;  4ZON A;  1V6M A;  3EXU A;  1HIX A;  4JDO A;  1HB3 A;  1I5Z A;  2GMM A;  1ASJ 3;  4V2V A;  2O14 A;  1F5F A;  2R6Q A;  3HIF A;  4OHX A;  3S6P A;  3UKT A;  4DIN B;  4Z92 B;  5E6H A;  2GND A;  4PQ9 A;  5A7P A;  2CGP A;  1C1L A;  5CVR A;  3ZN6 A;  2QQU A;  4C0H A;  1UYY A;  3J9S A;  2V73 A;  4MXV A;  4MXW A;  2FMD A;  3H0O A;  3G6J B;  3V0A A;  3AZY A;  2WSU A;  1YIP A;  3CJI B;  4Q0U A;  1PK6 B;  1RHI 1;  1A34 A;  1ZZ7 A;  1Q8O A;  1OLM A;  5C3R A;  1UZ0 A;  1Q8Q A;  3RI8 A;  2WZP P;  2W08 A;  5DZG A;  3C7E A;  3K4D A;  1LED A;  5FO9 B;  5A6X A;  4AHY A;  2H6B A;  2QCS B;  4NPM A;  5I0R A;  3O1T A;  3CQO A;  1C8N A;  2P3I A;  4IGQ A;  5FAX A;  3MW2 A;  1W06 A;  5K7P A;  4CDW C;  1D0G A;  3N3H A;  1ZZC A;  3WDV A;  3HBZ A;  3ZN5 A;  4L9B A;  4ASL A;  2FCV A;  2GMP A;  1AXY A;  2DCY A;  1RVF 2;  4WZF A;  3THT A;  2BVB A;  4Y5T A;  2JDM A;  5GJ6 A;  5C8C B;  4H55 A;  3KVB A;  4KWJ A;  4XF9 A;  4RS5 C;  3V0B B;  4LBM A;  2VY0 A;  1RIN A;  1UAI A;  1W2A X;  1WKY A;  1JOP A;  2KM2 A;  2A6X A;  3I2J A;  1LJ7 A;  3NL1 A;  3MW3 A;  1UL9 A;  3DEM A;  1MS8 A;  1QU0 A;  3ST7 A;  3G7D A;  4JTO A;  4CU6 A;  2GAU A;  4XE9 A;  5TSW A;  2VMD A;  3GBF A;  1G86 A;  1RJ8 A;  2VCM A;  1AR8 1;  4Y3O A;  1RED A;  5GAL A;  2PQQ A;  1QDC A;  2XQR A;  4V1P A;  1F8V A;  1W8W A;  1F15 A;  1YYN A;  3GHM A;  1IZ3 A;  4FPJ A;  3AMP A;  2ZAH A;  1UOB A;  1WWY A;  5C9A C;  4QPI A;  4AED A;  5J09 A;  1IS4 A;  2WNV A;  1RHI 2;  1NLQ A;  4B4R A;  5FK7 A;  4DFS A;  2JG8 A;  3I3M A;  1ZZ9 A;  4I3P A;  2A6Z A;  3RZZ A;  3ASI A;  4XUR A;  3RDI A;  3B5L B;  4AI8 A;  2KR2 A;  4Y5S A;  4LBQ D;  3POY A;  4BM8 A;  5C5T A;  5GLZ A;  5C5U A;  2VO5 A;  3DPR B;  3H9A A;  4XPV A;  3I2D A;  2IFW A;  3U4S A;  3MEP A;  3UJO A;  1YQ6 A;  1W28 A;  4AL9 A;  5F5Q A;  1VAM A;  2DTY A;  4CCL A;  2VBP A;  3SMH A;  2D5F A;  1X7N A;  4UI9 L;  1Z0H A;  1KD7 A;  3E97 A;  1UIK A;  4PHZ A;  3NNM A;  2QZ3 A;  3EO6 A;  4FOW A;  4QMA A;  3TN9 1;  1O4Y A;  2ARX A;  1CON A;  2V09 A;  3RZG A;  5EQU A;  1RMU 3;  3IDA A;  4S2H A;  2RS5 3;  4L8Q A;  1YHF A;  5F8P A;  2WC2 A;  1H8T B;  2IUW A;  1U0A A;  2Y34 A;  1HX6 A;  2XHN A;  3LIH A;  1AYM 2;  2PQS A;  3ORJ A;  4I3G A;  4XIL A;  5F6K A;  1G9C A;  5JR2 A;  3OPT A;  1W6Q B;  3ZIX A;  3SH4 A;  2RV9 A;  1W8O A;  2Q0A A;  4BQ3 A;  5IVV A;  1C3H A;  3ZKY A;  1AR8 2;  4W65 A;  1CJD A;  2E51 A;  4HG6 B;  3VBO B;  4Q8K A;  5AC9 1;  1KS5 A;  4NHX A;  1W04 A;  3OBT A;  5L7O B;  4JRA A;  5K0U C;  4FPE A;  4N9H A;  2K9Z A;  3SCG A;  1NCQ B;  1K5M B;  2VM9 A;  3C7G A;  1ENX A;  4F3J A;  3O0V A;  3WG1 A;  1W9Y A;  1FX5 A;  4UYB A;  4Q2F A;  3TYJ A;  4IEV A;  4Q0P A;  2KXL A;  1GNZ A;  2XQX A;  4X8P A;  3CKH A;  3OUI A;  2CU5 A;  4JGY B;  2XUM A;  3TEX A;  4ZXK A;  1OA2 A;  1Q5O A;  1WLC A;  3W5N A;  2HWD 1;  2VZP A;  4HXC A;  1CAU A;  1FXZ A;  4MH0 E;  2J1R A;  2XBO 2;  4Y33 A;  5KC5 A;  4MGI E;  4GWI A;  3VZL A;  4HSL A;  1K12 A;  4NHL A;  2VOX A;  5H9P A;  1NE4 A;  1V00 A;  4XJA A;  2DFC A;  4CDX C;  1W2T A;  1NY7 2;  1HRV 1;  2MPF A;  1ZBA 3;  5A70 A;  2WS9 3;  1AL2 2;  4CEW B;  4GJY A;  1IKP A;  4EN7 B;  4Y4R A;  4JQR A;  3TN9 2;  4LOS A;  1SAC A;  3U4X A;  5FMB A;  2WZR 3;  2ZX2 A;  2IXC A;  1BK1 A;  1PZ8 A;  3IMN A;  1DZT A;  1HB1 A;  2AUY A;  4BQ5 A;  4JTN A;  1RUG 3;  4AOC A;  4LIT A;  4MX3 A;  3K2O A;  4AQ2 A;  2X09 A;  2ARE A;  1UYP A;  2BGP A;  5IK8 A;  1AUY A;  1N3O A;  2I2S A;  4DEQ A;  1RUI 3;  2OA2 A;  5FYS A;  4AI3 A;  1BMV 1;  1HRI 1;  1HQN A;  4RN5 A;  5AC9 2;  3E6D A;  4BK4 A;  4AEK A;  5B4X A;  2J22 A;  2BJS A;  1C57 A;  2IXI A;  3BOP A;  4EZH A;  1VLN A;  3FFZ A;  3LF7 A;  4IE4 A;  2HLE A;  3IB3 A;  5JOY A;  3GZT B;  2WAA A;  1LOD A;  1SCR A;  3WP6 A;  2VW1 A;  3J8F 3;  3E6B A;  5F3I A;  1GZW B;  1ULD A;  1JZ4 A;  4M3C E;  1DGW X;  1EP0 A;  5I0U A;  4CDU C;  5FYY A;  3WVJ A;  2HWD 2;  1XBF A;  1RUE 3;  3UNP A;  1NKG A;  5JZG C;  1I5P A;  4RD7 A;  2ZAB A;  1KFX L;  4D6R A;  1IS6 A;  1DGL A;  1HRV 2;  4GB3 3;  5FZ8 A;  1MZ6 A;  4RL7 A;  5IHR A;  2VNG A;  1OPM A;  1PO1 3;  3WNN A;  1IG3 A;  3SLI A;  5FZE A;  2DBN A;  3HOB A;  4R9C A;  3P3N A;  1YFX A;  3EYP A;  4L0P A;  2QUO A;  4FOQ A;  1JYV A;  4IE6 A;  3LFI A;  5J7M A;  1OMI A;  4WZC A;  1ND2 B;  1R08 1;  2D43 A;  5DMY A;  2C1F A;  4QDR A;  2W39 A;  1VB2 A;  1BEV 3;  5FJK A;  1K3I A;  4M0N A;  1HW5 A;  1QY4 A;  2XHK A;  1HXS 1;  3MI8 A;  1HRI 2;  2Y6J A;  4P9G A;  1W99 A;  4XTP A;  5FMO S;  1VMF A;  1A8M A;  3PVN A;  5KBF A;  3VHN A;  4WM7 B;  4O7X A;  3B94 A;  3GZA A;  2NM1 A; 
#chains in the Genus database with same CATH homology
 3OSD A;  4CCC A;  1W2T A;  3KF5 A;  3UGH A;  4B1L A;  5FIX A;  2AC1 A;  5ANN A;  3UGF A;  2XQR A;  3H3L A;  2QQW A;  4JQT A;  2QQV A;  3S5Q A;  1Y4W A;  3LIG A;  3UGG A;  3LF7 A;  3PIJ A;  2QQU A;  4UFI A;  5FMC A;  3LDK A;  5FMB A;  3LFI A;  3KF3 A;  3PIG A;  3U75 A;  3ZR5 A;  4B1M A;  1ST8 A;  4FFH A;  3LEM A;  5FKC A;  3RWK X;  4UFH A;  1Y9M A;  5FKB A;  3SC7 X;  4CCD A;  4FFG A;  5FK7 A;  4QHZ A;  2AEZ A;  3NMB A;  4UFL A;  5FMD A;  3HBK A;  2OXB A;  4CCE A;  3IMM A;  3LDR A;  4FFI A;  2ADD A;  3LIH A;  5FK8 A;  1UYP A;  4HXC A;  4UFJ A;  3ZR6 A;  3U14 A;  4FFF A;  4EQV A;  4UFK A;  3U1X A;  2AEY A;  4AZZ A;  4UFM A;  2ADE A;  1Y9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...