4HXCA

Crystal structure of a putative glycosyl hydrolase (bacuni_00951) from bacteroides uniformis atcc 8492 at 2.15 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
255
structure length
255
Chain Sequence
TTTAVSYSKSLKAPETDSLNLPIDADGYITIFDGKSLDGWRGYGKDKVPSRWIIEDGCLKFCGTGTGEGQTGEGGDLIFAHKFKNFELELEWKISKGGNSGIFYLAQEVTSKDKDGNEVLEPIYISAPEFQVLDNANHPDAKLGKDNNRQAASLYDMIPAVPQNAKPFGEWNKAKIMVYKGTVVHGQNDENVLEYHLWTKQWTEMLQASKFSEEKWPLAFELLNNCGGENHEGFIGVQDHGDDVWYRNIRVKVLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords putative glycosyl hydrolase
publication title Crystal structure of a putative glycosyl hydrolase (BACUNI_00951) from Bacteroides uniformis ATCC 8492 at 2.15 A resolution
rcsb
source organism Bacteroides uniformis
total genus 74
structure length 255
sequence length 255
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06439 DUF1080 Domain of Unknown Function (DUF1080)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.560 Mainly Beta Sandwich Jelly Rolls Exo-inulinase; domain 1 4hxcA00
3ZR6A 4B1MA 3LEMA 5FIXA 3IMMA 3LDKA 3NMBA 3KF3A 3RWKX 5FK8A 3UGGA 4FFHA 2ADEA 3S5QA 5FMDA 5FKBA 3LFIA 4JQTA 5FKCA 4B1LA 3H3LA 2QQVA 4CCEA 3KF5A 1W2TA 4FFIA 4UFIA 3ZR5A 5FMCA 4CCDA 2ADDA 2XQRA 3PIJA 1UYPA 5FMBA 3U75A 2QQWA 3SC7X 4UFHA 3UGFA 4AZZA 2OXBA 4UFKA 1Y4WA 3UGHA 4CCCA 3LIGA 2QQUA 4UFJA 5ANNA 4UFLA 3U14A 1Y9GA 1Y9MA 3LIHA 4UFMA 2AC1A 3HBKA 3LDRA 3PIGA 1ST8A 4HXCA 3U1XA 4EQVA 4QHZA 2AEYA 4FFFA 2AEZA 3OSDA 4FFGA 3LF7A 5FK7A
chains in the Genus database with same CATH superfamily
3NJVA 5DDJ2 2VZPA 3FLPA 4NAMA 3FUQA 2VUDA 3FL7A 1XJAA 4AFBA 2VGDA 4H7LA 1QF3A 1O7FA 1ZBE2 2D5FA 4JQTA 1NT0A 3UV9A 4M01A 4K21A 3RI8A 1VAKA 5CVRA 3VBUB 2NZ9A 1LJ7A 3JUUA 3WINE 1F4AA 5IVCA 3I59A 4IEYA 3BTXA 2YV8A 5FZ6A 1KXGA 1ULGA 2OPWA 3PL0A 4Q4V1 3DF0A 4B7EA 3V0AA 3D5OA 3VDBA 3BIEA 4UI9L 1POV3 3JXSA 2VH9A 3VHRA 4ASKA 4XJWA 4OQ9A 4DUWA 3AKRA 2CYFA 1GV9A 2PXJA 1RHI2 4P9LA 5BXXA 1MQTB 2AEZA 3WEZA 2ZZQA 1GP4A 4OUMA 2PLV2 3L2YA 2VECA 5FIXA 3WP5A 3E6BA 3U10A 3K4ZA 5DPNA 3IIIA 1BXHA 2XWJB 2ZMLA 4TN7A 4FOWA 3WW1A 3GGLA 1LCLA 4MGZE 4K6BA 4GWNA 4MUVA 1KS4A 1W3XA 1YI7A 2BYVE 3MV01 2ZXQA 3QH7A 2XVGA 4MO3M 3VDAA 3V0BB 1EPWA 4X8NA 4RYDA 5EFUA 1FOD3 1S2BA 5KHGA 3FHQA 2YC4A 5C70A 3WG1A 3OYWB 5I8TA 1GWMA 1D7PM 2FDFA 2ZGSA 1JYCA 3HQXA 5AVAA 2C1FA 2CAUA 3VHOA 1FV2A 4P08A 4B3NA 3AP5A 2WN2A 3PMSA 2ORXA 2XVLA 1POQA 3NNMA 4DUXA 3ZX7A 5F39A 3WW4A 1WW5A 2CGNA 1DYKA 3NVCA 4D69A 5C9AA 4I0BA 4NRMA 1S0JA 4QWNA 4JKKA 5GLUA 1W90A 5EWSA 1A3KA 1CX1A 3EMRA 5I0UA 4K8RB 3ZYIB 1WLCA 1GOHA 2PA7A 5GZGA 2OQ7A 3HIFA 2P5BA 2WABA 3IDEA 4QPGC 5A3WA 5BNPA 5C4WB 2QTWB 2VNVA 5DG2A 2XHNA 2YBSA 1LRHA 2UY8A 4UF0A 2R061 1Y7BA 1YFXA 2VXJA 5D8AC 2R32A 3VKNA 5EJZB 3VZKA 4OHZA 5BNOA 1O3RA 3QD6A 3SCFA 2OA2A 4JGZC 4LLFA 5J7MA 3A23A 4BCUA 3Q8CA 4IERA 2J22A 2EF6A 4META 4G4FA 1AR91 4C90A 4AHYA 4PI2A 4FXGB 1HQNA 5F5CA 5DN2A 4CXWA 4K7JA 2XBO2 1QQP2 4Q4Y3 1WWYA 1OA3A 3T4HB 1ZBA3 3JCIA 3PVNA 1D2QA 3RRDA 1W6PA 5KR7A 4CUAA 1TME1 2G4IA 1ULFA 2C6SA 2D6LX 4FPCA 2JDUA 3PU8A 5DZEA 2RS51 1EV11 1M4WA 2I2SA 4N53B 3LPFA 3POSA 5IVVA 1QHDA 2CAVA 4JRLA 4XJAA 3TAYA 3VKOA 2DFBA 3M1HA 4IEPA 2GALA 2QKDA 2VZRA 5ISLA 4GAZA 1XE7A 5LATA 1DZTA 4AW7A 1YQ5A 1K5MB 4A3ZA 1J1LA 2GP5A 5KXDA 2R6QA 3USUA 2J7MA 1NCQC 3GZAA 5KC6A 2Q1ZB 4RGAA 4Q4W3 2QQVA 4EN6B 3LOIA 4OI4A 2VU9A 1E5RA 5HCFA 3T0AA 5CB7A 1LB2A 1U5ZA 1XYNA 1RUI3 5JR7B 2C0ZA 4LBQD 4YVSB 1OLRA 1T6BX 1FX5A 3ACHA 3GZEA 1UL9A 1YLLA 5FXVA 1NYWA 4ZS2A 1XNTA 2GNMA 2VG9A 2ZGRA 4BMEA 2VL4A 2WO2A 3VBOC 1RUH1 3OSDA 2G9ZA 1X36A 3T08A 1HRI1 1W8NA 2Z42A 1OF4A 3KD4A 3LAGA 1AX0A 3LDKA 4QM9A 1L7QA 5CFCB 2DTWA 2I07B 4AEDB 1KJRA 1UIKA 2A3XA 2FMYA 1Q8QA 1LESA 4HMZA 1LOAA 2WYSA 1WA6X 4YRDA 2AH2A 1SLBA 1XOYA 4XC9A 3WDTA 2XR4A 3W5MA 3DL3A 1V00A 4LEJA 2OIIA 5JR2A 3J9SA 1PO12 3C3VA 4Z1VA 2D6PA 2Y33A 2FDJA 1LENA 1NA1B 4DB5A 2BVVA 3M3OA 3N9MA 1XE0A 4LTAA 3J7MA 5LBBA 4E4ZA 3W5NA 1UZ0A 1W6OA 1W9YA 1W8WA 4L92A 4ZPIA 2Q8CA 4IGQA 4AVSA 4A44A 3M3CA 4DMIA 4BXFA 1UXZA 4LXLA 3NSTA 4S2GA 4WVWA 2MEV1 4XUOA 3ZFFA 1IS3A 2GN7A 2IXKA 2XJQA 5CA6A 1PNFA 4AVBA 4XQWA 1H6XA 2X5IB 2BFUS 3DUIA 1AJKA 5F6LB 3OTFA 3KV4A 3VZNA 5B2GB 4UFHA 2RR11 1UY0A 4CU6A 1LULA 2BERA 3NAPA 4GB33 1HN0A 4IEOA 4RHV2 5GLWA 5L9RA 1MVEA 1GR3A 1R081 3WDYA 2W94A 1U5IA 4LBNA 2NPIA 1LU1A 2CSGA 3OBAA 4WBBA 3IN9A 3WG3A 4E4SA 2BOIA 3LB9A 5JAXA 4URTA 3TN91 4PF5A 5FZMA 4AI2A 4HK8A 5B4XA 1S2EA 4Y20B 4RQPA 3IM0A 3K75B 3N36A 5C3QA 2FCUA 5FTTC 2ZEXA 2VZ1A 3FUOA 2A75A 4NWVA 4KWJA 2BBAA 3G6JB 4CDQC 3THDA 1QJY1 2DVDA 2JECA 4CP9A 3AKQA 4LA2A 1CAWA 1YIPA 2XJUA 1OLQA 3OPZA 4JDMA 3MF6A 5JMOA 2ZACA 1Q8PA 3N9PA 1IQDC 4FAHA 1K42A 4O9EA 3NNJA 3R4UA 1YFWA 4PBOA 3RGBA 5LA1A 4P9YA 4IV3C 1H9WA 4I09A 5DAQA 4OQ8A 1H30A 2Y60A 1W6MB 3MLJA 4E2SA 4Q0PA 1AR72 4N43A 3BALA 4X6RB 4FP2A 4FPLA 4F8AA 5A6YA 1BKZA 2XG3A 2WZR1 1C8M2 3WF1A 5EZWA 4HL0A 2YGLA 1OMIA 1UCXA 2A71A 2DVBA 1LOCA 3AFGA 3L9JT 4QDSA 1OLME 2WSUA 1ZRDA 1C1FA 1QXPA 2VOTA 5F5AA 5APAA 1YCIA 1DQ2A 1QY4A 3MYXA 1AVBA 1DQ5A 1IQAA 4IEQA 3WHTA 1O3QA 1EUUA 3U14A 3OGGA 4E27A 4R4ZA 1UY4A 1PNGA 4E9KA 1RUNA 3LKJA 1BHGA 5ACA1 3O1UA 4KGGA 5I0DA 2UU8A 4A7KA 4LHLA 1RUD3 3GF6A 4Y26A 3WD5A 5SV5A 5CG9A 2ERFA 2P6HA 1PO23 2WNVB 4HETA 3LFIA 4LHSA 1BVP1 3OEAA 5IFTA 4I02A 4KWUA 1OH4A 1S0GA 3RJRA 2PTMA 2RMU1 3NW4A 4XBNA 4S2FA 3GBGA 1G9CA 3P1IA 4CCDA 4DNYA 2V4VA 3THTA 2Q8OA 1OOPB 1WMFA 3N7KA 4P9WA 1YQ6A 2WSVA 2ZGOA 2J1SA 5EYXA 5D8AB 1W0NA 4EJRA 3S0MA 2PHWA 2PAEA 4Y22B 1W9SA 3CF6E 4H3WA 4P00B 4JGZB 4QPGA 1H8TC 1UIJA 3BGAA 5FY1A 2HWC3 3AYAA 3GJAA 2DCTA 4MV2A 2BWAA 2ZX3A 2BPA2 2IXJA 1V6IA 2XQXA 1J3RA 4C0HA 4CDWA 1JU4A 4QT6A 4LO8A 1KDMA 2VOXA 4Y5Z0 2VULA 3PVEA 3C7HA 4Q4X3 4H14A 2WS92 2OVUA 1W6QA 1PZ8A 4AHWA 3BVCA 3UK9A 4P9XA 5LEKA 4NHMA 3O5SA 1D4M1 4W6XA 3BOPA 1H0BA 5CFDB 3I3EA 4HSJA 3HNBM 3R4SA 4QXBA 4QXKA 5FLJA 5A33A 3RYPA 3VKMA 3BOWA 4CCCA 1DGWA 3DPRC 2DVAA 2WUHA 1FAYA 3POBA 3N9QA 1BVVA 3GYDA 5JIAA 1RUJ2 5FUPA 5AFEA 1QGLA 5A7WA 2ZGUA 1SFPA 1GNYA 3RFRA 3T2TA 1VBE1 5FRAA 3ZMNA 5FZDA 1NCQB 4XQDA 1W2UA 1SG3A 3N9NA 4QU2A 1DBNA 3QOPA 4AFCA 3B94A 2ZX4A 1VJ2A 1J3QA 2BTVC 1PMJX 4Q26A 3D4KA 4BK4A 1GFF2 1O91A 2RS32 4MYEA 5FMCA 3S5AA 4PBPA 2Q30A 5FMOL 2E6VA 4RS5C 4TZDA 2K0GA 1ENQA 4QHBA 2W08A 3UESA 1VBB3 1YNAA 2DCKA 1CESA 3T1MA 4YW7A 3VBOB 1PVC1 5C33A 2J42A 4I3GA 4B7KA 5JI7A 2ZMKA 3LEKA 2QNKA 5FZCA 2BJSA 1E57A 3OPTA 1OHFA 2DUQA 3E1F1 1VR3A 3SHRA 1VPHA 3ZXAC 2IUWA 2CL2A 4IDZA 4LMFA 4O9GA 3MGUA 1F35A 4Q4V2 3THPA 4EWDA 4CP1A 1M06G 3NKGA 4N9IA 3VDDB 2OZ6A 1MEC3 5FYYA 2W39A 4MADA 4I0AA 3VBHB 1X33A 4D3WA 4IE4A 1ZZBA 5JMCA 3CNAA 3HR9A 1D0GA 4R52A 1P8JA 1VB2A 2AZ5A 3P6BA 4AHZA 1UQXA 1H9PA 4SLIA 4BK5A 1UY3A 3VHNA 1SBFA 2JE7A 4OHYA 2HBUA 2B9VA 4I0WB 1MS1A 4LE3A 1QEXA 1UYXA 4IUGA 4CCOA 4JHZA 2ETEA 1NCRC 1ZM1A 1GQPA 2RS13 3UJQA 1N3QA 3M70A 3O0WA 2BWCA 3HN1A 2JJ6A 3OJBA 2Q4SA 2BDRA 4PLMA 3RNSA 4YSFA 5M0TA 2PQQA 1HB1A 1O6UA 5CYYA 3EO6A 4QPWA 5FPBA 2HWB3 2DVFA 4TLFA 2XJPA 4CCKA 1W2AX 2WZPP 1PK6C 1RVF3 3FC0A 2VJXA 2ID4A 2PHXA 5F2SA 2WFPA 3TWIA 3RZMA 3DECA 1RUOA 5IVJA 3C8XA 2DUOA 1DZQA 3CJIA 2VVEA 3AYEA 4AYUA 2EXKA 2Y0OA 1DU3D 2D6OX 1RJ7A 2GH2A 4DXTA 5BV6A 4IE7A 4MOAA 2XL7A 3JD73 1JXNA 4X8PA 1HXS3 2DF7A 3MO4A 1BK1A 1L7RA 5K4LA 2N7GA 5FPUA 1UNBA 2XHKA 4XHBA 2ZKNA 1TNRA 5ABJA 3RZLA 5DAWA 3U37A 2VZSA 4I3PA 1GYKA 4I30A 3WP3A 1HRV3 2VW2A 1FYUA 1UZWA 3GALA 4XF4A 1WMDA 5GKAC 1LHUA 4GZ9A 2EA7A 2QZ2A 5G04L 5HBAA 2Q8EA 1RITA 4BB3A 1COV1 2LALA 2VUJA 4GA9A 4ZONA 5FY9A 4PLOA 2VCMA 1NOVA 2Y26A 3EJKA 3ZDVA 3WSOA 2ADEA 3NJYA 5JXJA 5DUUA 3LFMA 1ASJ1 1BYHA 1W9FA 2Y0IA 1Z78A 2X29A 4XFAA 1QU0A 1MVQA 5ERLA 2DV9A 2RDNA 3HT2A 5FV3A 4B1LA 1TME2 4YG6A 4Z2WA 3NNGA 1D2SA 1U12A 4YYOA 1S0FA 3BTAA 1A78A 1Q8OA 1POV1 1CONA 1EV12 2RS52 2WNOA 3ROUA 2FDGA 2Y34A 1J3PA 2A6ZA 1MS0A 2XJSA 3K2OA 4OULA 4HSLA 2FZ1A 3T1LA 3LOBA 2I45A 3W58A 3CO2A 1Y9MA 3O1VA 4ZS3A 1FI2A 2CDOA 1RUF3 1KRIA 2LROA 1S4CA 2MPFA 3P3PA 1YRZA 4M3CB 4R9CA 1ZA7A 2VMIA 3DYMA 4JX0A 4NIHA 3I2HA 4HKWA 4FCAA 3AKSA 2NP0A 5C9AC 3AZXA 4XW3A 2Y6GA 2YPJA 3BTYA 4CRQA 3WNXA 1KD7A 2AYHA 3RPQA 3AKTA 5DDJ3 4PI0A 2EXIA 1DFQA 1W05A 2J1UA 4QXHA 5DAXA 3ZR5A 5FYCA 1GNZA 5BNPC 5A7OA 5FCCA 4YGEA 3U75A 1ZBE3 4Q8KA 5FDBA 4DPNA 5SV8A 5JCTA 1H8TB 1GSLA 3GHNA 3VD9A 3BU0A 1RUH2 4A4AA 2CWMA 4OZXA 5A6XA 3I54A 5BNOC 3HQUA 4CA9A 2J1TA 3BCWA 3MDPA 1T2XA 2D44A 3OPWA 4NPLA 4RA0A 4GH4A 1JOBA 5C7GA 4JCKA 3I2DA 5FZOB 3AM2A 1OT5A 1HKDA 5FPVA 3RWNA 1AYN2 5FZ9A 3VN4A 3AZWA 1RHI3 5A1LA 3IZOA 5A6ZA 3VD4A 5JXIA 3I3MA 2PLV3 3S7IA 5A1AA 1XYOA 3SH5A 1JODA 2XMLA 2R0HA 2VBDA 1UZVA 2ZX2A 1F4HA 3DPRB 3KGZA 1DQ6A 1SMVA 2EIDA 5IWFA 1TVGA 2OW4A 5HI0A 5GALA 1YO8A 3THCA 2IXLA 3MI8A 4BQ5A 1NKGA 4CDXB 5A7PA 4GMP0 5J96B 3H8OA 4XDQA 4HANA 1PZ9A 2ZPXA 1AR83 2BNMA 2VMHA 1AF9A 2ZA9A 5E6HA 4QX0A 1XNCA 3K3OA 2W0XA 3IMMA 2MEV2 1QOTA 4COUA 2OQ6A 4CPBA 3T4VA 5FO7B 2GNTA 1RUG2 2CTVA 4HK9A 1RINA 1CZTA 4QAWA 2HWE1 4WVMA 4XIOA 2WL1A 5DAVA 3UL2A 1ACCA 1EY2A 2O1QA 3ILFA 4Q4Y1 2HKXA 1CJDA 4KWKA 4XFFA 1ULEA 5I8YA 2AENA 3BIWE 5IK5A 4J6GA 2RR12 5D1IA 1PVXA 5L7OA 5LCWL 3ZO0B 4CP0A 5F32A 4IEWA 4K1YA 2B8MA 4RFT0 4KGQA 2QQWA 3VZLA 3O1MA 2VMFA 2ARCA 4GXLA 2WWJA 1NLSA 1JMUB 1BCXA 2QQUA 4XETA 1RUE1 4RS5A 3VGIA 4XHXA 3ZFGA 4RSUA 2HH9A 3DYOA 3ITQA 5A7NA 3TN92 1AZDA 4ZZ8A 1OQDA 5E89A 3H3UA 2W3JA 3AX4A 4AOCA 1DDLA 4NVPA 4E8CA 5C8CA 4XE9A 2GC3A 4IEXA 4MXWA 1CVNA 5KXCA 4RR3A 4WVZA 3I2OA 4WZFA 5CU1A 3EXUA 1HDKA 5DABA 3ATGA 2WRAA 2HEVF 3PIJA 3B9CA 1HV1A 3PURA 2VMGA 4UFKA 4UT5A 1FPN2 1CAXA 4CZSA 1DYPA 5BNNA 2XBO3 3F2ZA 1GP5A 1OUXA 4NHLA 3D6EA 4JTOA 3ZYPA 2YDEA 4XUNA 4QXCA 3LQCA 3WHUA 1W6NB 4YZ3A 2V4AA 3RZZA 2WA4A 3H0OA 3QLQA 4OHXA 5T5JA 3TEZA 4F7ZA 2P2KA 3B69A 4IE5A 5LASA 1NCRB 2WZR2 1CAVA 1HQWA 3AMNA 2FDIA 1CAUA 1IPSA 2PHDA 3ZFFC 1APNA 3GHMA 4ORFA 4XTPA 2UY9A 5C6CA 1US2A 4E4HA 3HBZA 3J7HA 4UFIA 3FZ3A 3WNNA 4XIKA 4Z8BA 1H4GA 2VZOA 2XLFA 3UJOA 1EYBA 4BU2A 5CG8A 1BZWA 4FAGA 5ACA2 1QXRA 3NAPC 3OD4A 4LIVA 4PIXA 2IFRA 1KDKA 4LBOA 2WC2A 4L9BA 1X8EA 3V0BA 2WAOA 3AMMA 1SDDB 2JD4A 4PLNA 4XABA 4URAA 4XACA 1W3VA 2SBAA 2DU1A 5FYVA 1MPXA 1LEMA 1UZYA 2OT7A 4IW3A 4XFCA 3T09A 2RMU2 3NNFA 3OGRA 4FPKA 4RQPC 3ZPOA 3T30A 5KHHA 1SPPA 4B4PA 1RMU2 1JHJA 3JQWA 1XSQA 1CPNA 5D2AA 1WCQA 5FY4A 4AK3A 3I3BA 2YZ4A 1QJX2 1Z7S3 4YLZA 2GH8A 3D8CA 3MW3A 1PGL1 2Y8KA 1YIFA 1ZZ6A 4UFMA 4C0BA 4Y24A 1XE8A 3AYCA 1PO13 1AL22 1PGW1 3ZXGA 1W8FA 3ZYJB 5AFBA 1I5PA 3H7YA 1FXZA 1FMD2 5E1RA 5FZBA 4AVVA 5GM0A 2Z4FA 2VVDA 2NYYA 4N43C 2FQPA 4G3YC 2YPDA 4YFWA 2ZEZA 1SCRA 1W0OA 3PTRB 5FKBA 4AQ2A 4SBVA 4HOOA 4BOWA 1YYNA 4MXVA 4DFSA 3MF9A 2ZKLA 4JRAA 3A7QA 4KU8A 3POJA 3WW3A 1OI6A 5GZDA 3K4AA 5A3PA 3SH4A 2RHPA 4QQ2A 2D43A 3ZXDA 4YFZA 2WT0A 3PUAA 5FZIA 2NM1A 1AYM1 1DHKB 1HX6A 1VBE2 2K46A 2KM2A 3Q8BA 3WQ0A 4CTEA 3UETA 1GQGA 4IV1A 4U2AA 3A0KA 4XVHA 1V6OA 1US3A 3IAPA 4OUEA 5C9AB 4AHXA 1B35B 1OVPA 2JDYA 3KF3A 4JQRA 3B7MA 1VALA 3LA2A 4RHV3 5IVYA 3LWCA 3ZFEC 4XXPA 5FQ0A 2YC0A 1BJQA 1R1A3 4COZA 1TQ5A 4AL9A 3I2FA 5LBEA 1I3HA 1NX9A 2ZGLA 5FXWA 1LOEA 2QBXA 4XMAA 4CCEA 3NL1A 1V6NA 5A3LA 2ZCWA 4CU9A 4UF0B 5JOXA 1WW4A 2W52A 4ZKTB 1QJZA 3AJYA 1CIWA 1PVC2 3NWKA 4ZXKA 5BNOB 1VRBA 1YHFA 2DCZA 4GJYA 3KVBA 4J1WA 1GQHA 4XPVA 4BQ1A 4QD2A 1JH5A 2GMEA 3A22A 1KQRA 1UU6A 2BGPA 5JSOA 5D21A 3M8LA 1RUD1 2Y6LA 5FZ4A 4MG2A 3OYWA 4MZUA 4HPKA 4CDWC 1O4TA 4EV0A 1VAMA 4RGGA 1OVSA 5FBJA 4YW3A 1L7LA 5GLVA 1VMHA 3ILNA 3M7AA 3O12A 1W03A 4COWA 1GKBA 4LBMA 1AHSA 1GZ9A 3MIEA 4C91A 3LGRA 3RJ2X 3S5QA 5K9YA 5FMDA 1IZ3A 1V0AA 3H42B 3J26N 3RS6A 1W6PB 4P14A 2Z69A 3H9AA 2A70A 5FLIA 1I5ZA 4HVQA 1VMJA 3JU9A 3I2KA 1AR73 5E88A 4F3JA 1X7NA 4Y1ZA 1NLRA 4QQOA 1UAIA 1OPMA 1C8M3 1BBT3 1ND3C 3LIGA 2J1RA 2HWC1 1FT9A 4OFGA 5F3GA 4KWLA 2VE1A 2BZDA 3LDRA 4DO0A 3TRSB 3Q8EA 1A6CA 1VLNA 2R49A 4Y4YA 4YW4A 3USUB 2AREA 4LUKA 1UX7A 2RDRA 5EJ1B 2J1AA 5C3RA 1LGNA 3AKPA 1IOAA 5C3PA 1AXYA 4Q4X1 4XBLA 2ZAAA 3DKWA 3MIFA 3VD3A 2XH6A 4CDUA 3GJBA 2R072 4CXYA 1OKQA 1D0HA 1WUVA 1VBC2 3WQ7A 1NQJA 2PAMA 4WM8A 1VRH1 1ZNPA 2BQPA 5F1RA 1Q8VA 1V6JA 2BW8A 3J8F1 3PMEA 3PUHA 2BGOA 4KG0A 4BQYA 1XNKA 4CUCA 1N1TA 4LBJA 2EVXA 3NJXA 1OQ1A 4FPFA 2ZHMA 4KBBA 2R1BA 2ZHKA 3NV2A 2YBPA 3H7JA 4GIQA 3H8UA 3OUIA 5BNQA 3M3EA 3IMNA 4N8MA 4XFGA 5A3UA 4N53A 2E7TA 2PN5A 1BEV2 4LORA 1CPMA 4Q2FA 3UGGA 4M4RA 2VZTA 5H9QA 1CJPA 1HB2A 1G9AA 1K12A 1ZYBA 3P3NA 2RM22 1VBD1 3IWZA 4JTNA 3AK0A 5LEJA 1CZVA 4JVAA 2A6VA 2B4KA 1QOOA 1W39A 2GC0A 4XOGA 5FY8A 2BUKA 3MHZA 4LKSA 3LZZA 5LK5A 3RVHA 1F15A 3VBRA 3OCPA 2YY1A 1W9TA 2WS93 5K0UB 3RZGA 1WLDA 1DZRA 1F2NA 1LECA 1V70A 4RN5A 3AB0A 5AVPA 3S6PA 1COV2 5JXGA 5GLTA 3ZXEA 3OGVA 1REDA 2Q1FA 2VM9A 5EV7A 2VD7A 2V72A 3FFQA 4ES9A 1V6KA 4A6SA 4D0QA 1A34A 1ASJ2 4AI9A 4DXRA 2G9FA 3ZFFB 5L73A 3ASIA 3Q8AA 5IAXA 1AXKA 3N9LA 3ZN6A 2HYKA 4BYYA 1RUJ3 1MS4A 4S2HA 3FJSA 5CFCA 3R6SA 3ALQA 3QH6A 4DRRA 2E53A 4DXZA 2QCSB 3O0XA 2BNNA 3WVJA 2VC9A 2FMDA 2VZUA 3DCQA 3NAPB 3SKVA 1IKPA 1MACA 1UYYA 1S0DA 3OUHA 2WIIB 3PTYA 4B29A 4B8EA 2JDZA 2NMNA 1GICA 1H8VA 4O65A 2NQYA 2EXHA 3I3QA 2NLRA 3CZJA 2W68A 4HVRA 2RS33 3IDBB 1GP6A 5H9SA 2A1XA 2C9AA 4IGOA 3OBTA 3AP7A 3HWJA 3M4FA 4ZU4A 2HWD1 1TE1B 4TSVA 4NHYA 1PX3A 2AR6A 3M3IA 5TSWA 5F7UA 1LHNA 1WLTA 3CJIC 2C24A 4YGBA 1HB4A 1ODMA 2VXRA 5F8PA 5CIRA 5A80A 3J4UH 3VBSA 3FLRA 1MS8A 4YNIA 1JOJA 2PFWA 4EWAA 4CP9B 3EHKA 2P3JA 2PELA 3DKQA 2X53S 4COVA 1UYZA 2LUWA 5ABJC 2B5HA 2KR2A 2HWB1 2PMWB 3BB6A 1SLTA 2ZBJA 1ZZ9A 2C26A 5LK7B 4MH0E 4FTEA 1F8VA 4AG4A 2OXBA 4Q4V3 1HIXA 1N1SA 4JKMA 4M3CE 5I93A 3HNYM 3LE0A 4PIZA 3NV4A 5FOJB 2GAUA 4AAXA 2RV9A 1WCSA 1KJLA 1SHWB 1UKGA 2WFF1 1QMJA 2YROA 4N43B 4I01A 2J1EA 4IQPA 4N90A 3PUIA 3V65A 2E31A 3T3YA 4K1ZA 3JD71 3B01A 3VD5A 5C3OA 5FO8B 4AVTA 1EAH1 3OD0A 1N3OA 3WDUA 1GLHA 3NNLA 2ATFA 4ISRA 5GZCA 2Z5WA 4Y20A 4AF9A 3AP9A 3AZZA 5AC91 1GZCA 1DF0A 3MBWA 4OMDA 4NN0A 4PHZA 4QM8A 5EJ3A 4UFJA 3USSA 2P6CA 4ONUA 3SH3A 5HPOA 1E5SA 1Y9GA 2QZ3A 2GN3A 3GNEA 2R1DA 4MHRA 1WD3A 2QFEA 3MW4A 5EP9A 4DIQA 2XWBB 5FZ7A 5I0TA 3WCRA 2HWE2 3H1WA 2YC2A 4Q4Y2 2BGCA 1QJU2 3MICA 4K3UA 2EAAA 1Q56A 4O7XA 2HYXA 2TBVA 4YVWA 1PM7A 2UWCA 1JYXA 3DGTA 4Z07A 3ZFEA 1W6MA 2KA3A 1JZ8A 2Q1MA 2VOWA 4V1PA 4LR4A 2R042 5FMOS 2BP6A 4QX2A 2XQRA 1LEDA 1RUE2 4QPGB 3ME2A 3MLKA 3UNPA 5T54A 4FVVA 5IK8A 3D0SA 3GXUA 1VBA1 1VB4A 1JS9A 4LKEA 4DY3A 4CDWB 4AGVA 3ENRA 2WO3A 2QE3A 4GH4C 3OUJA 4GKYA 5CNAA 3WR0A 3B93A 3PHMA 2PHTA 3FE5A 2FD8A 1ZREA 1Y43B 4Q27A 5HCBA 3TYJA 1U5XA 4P9JA 1W6QB 2EALA 1GU3A 1RL3A 2ZS6B 2WWUA 3CLPA 3ZPYA 2V5DA 4UW6A 4XCBA 2ZTNA 5FZKA 2A73B 1IPKA 1FNYA 1DQ0A 1OF3A 2YU2A 2WA3A 3RI9A 5A33B 5F3CA 5JZGA 4I2OA 2WNVA 1VP6A 1UN1A 1ZBE1 1RUC2 3UT0A 2XVKA 3IDAA 5FZLA 1UYPA 5K7PA 1Z0HA 5IVEA 2QDNA 5A7WB 4TTGA 4QB6A 2Y6JA 3FMGA 4HLTA 4MLOA 1CX4A 3FX3A 3I49A 1KS5A 3HEIA 4BA6A 3BI3A 3O1TA 2WINB 4QPIC 1ND3A 1DLCA 3TNQA 3KMHA 1A8DA 4KBZA 3ZSLA 1I1EA 5A3MA 3VZMA 3TOJA 3I2JA 1WZXA 3NMBA 2K9ZA 2VPVA 3ECQA 2CV6A 3OB8A 5KHJA 4LKDA 4A41A 2PLV1 3RMYA 3KV9A 5L7OC 2XL9A 4WM7A 5A3NA 1GOGA 1F5FA 4NO4A 4GALA 4QKBA 5IUQA 3ZXLA 3HMYA 5FPXA 2WT2A 5FWEA 4IE6A 4MVTA 1XYPA 4Y5SA 1X82A 1JBCA 1UPIA 4RFRB 4A7YA 4P02B 2V5YA 2ZX1A 3WNMA 4AEMA 3ZFGC 5CFDA 1JZ4A 4YW5A 5F2WA 2IVJA 1AR81 1Q5OA 3LIHA 3WW2A 2E7AA 5FP3A 1KFUL 2VQTA 4KMQA 3U11A 2VOKA 1XBFA 2VMDA 3P5BA 5J98B 1RUH3 3OGSA 4IE0A 5C8CC 3O1PA 2LRPA 3E6DA 4PT6A 4RR3C 2Y6HA 2YFZA 4E2GA 3WF0A 1JZ7A 2JG8A 4FO9A 3JBG1 4QKFA 4XYXA 2WLPA 4TYSA 2YB7A 1W2TA 2DUPA 2PYTA 5CBLA 1AYN3 1PGL2 1EPZA 1OKOA 5BY5A 1UKRA 5BNNC 1H2NA 1Y4WA 5FZ3A 5LB6A 3WLUA 1WBLA 1AR61 4HN0A 3KZ4C 3WXPA 3ZM8A 1SCSA 1FNZA 2OPKA 3LA7A 1W2OA 5E16A 3OEBA 5FZ1A 1ULDA 2CY6A 3WNPA 1PMHX 4LBKA 5FO9B 5KXBA 1GOFA 2VQ0A 4ZU5A 1TMF1 4Q8LA 3ZXKA 1J84A 3H8RA 2WWSA 2WZ8A 4XJZA 4BDVB 2QQIA 4IESA 2HWF1 2MEV3 4P5YA 4DS0A 1G6NA 1R091 2YFUA 1RUG3 1AYM2 3JQXA 4Q0VA 2B7YA 2PHRA 2TEPA 2JWPA 2XBO1 4C8DA 4D7TA 5BYNA 5LA0A 3AC0A 3VDDA 3WNKA 2RR13 1PIV3 2VZQA 2WQ4A 3BODA 1C57A 5FYSA 3CJIB 3VBHA 4OZOA 2VCAA 2GDFA 1TNFA 4Z92B 2JEMA 1J83A 2RDSA 5FK8A 5T52A 3LD8A 4QHOA 3TN93 1W8UA 1L3JA 1AJOA 3OOXA 3S30A 4R9AA 1AX1A 2XOMA 3WG4A 4BQWA 2JG9A 1V9U3 4M0NA 4AR2A 4CDQB 1YXWA 1CD3G 2ILMA 2OS2A 4NRPA 2WQ8A 4LBQA 4ATFA 4DY5A 2H0VA 4BM8A 1UMIA 3AFKA 2R062 4LBLA 3IPVA 2W1SA 3PUQA 3RZHA 4GKXA 1YEWA 3W59A 2ZX0A 4BIFA 3IDCB 1UOGA 4HVOA 5EHDA 3KQ4B 3F95A 3ZXFA 3AMPA 3CDZB 4XTMA 1K3IA 4IV3B 5F37A 3CZUA 1WD4A 1GUIA 1FPN3 2ZGKA 3JZVA 4GULA 1AR92 1POV0 2MNGA 3KT4A 2VTFA 4UWDA 4FTBA 1OA4A 2ZMNA 4CCNA 2VBPA 2W9XA 3AZYA 4FT8A 4V2WA 4XQ4A 1XC6A 3FWEA 4XAEA 4BMBA 5C5TA 2QQJA 1URXA 1QDCA 3MW2A 2VMCA 3OBZA 4O61A 4Y4RA 3MPBA 4GQ7A 1G86A 4NAOA 4XF1A 5FKCA 4N9HA 2YHJA 2RE9A 2QQMA 2WZR3 1Z7S1 2HWC2 3ACFA 1TEIA 4NMIA 2FCVA 2F17A 2QDRA 1QOSA 3GM8A 4QGMA 4R8HA 2VTXJ 4AWDA 4LUMA 1LODA 4A3XA 4AQ6A 2ZGTA 4IV1C 5HXMA 4BQ3A 2PHLA 3UKTA 3NO8A 4Q4X2 1H1AA 4HN1A 5JDBA 1W06A 5ACA3 2HEYF 1JN2P 5JWPA 4XEZA 1GZWA 3ILRA 5FPLA 3K3NA 3ZMOA 4CEWA 1VRH2 1VMFA 2GNBA 3J8F2 1F31A 4FPJA 1TG7A 1ZVFA 2OUHA 2UWBA 4G9SB 2R30A 3CU7A 2G9GA 2JDMA 1S0IA 2RMU3 4ASLA 2A5ZA 2E7QA 1FOD1 1DYOA 5FMBA 4XF0A 2IXCA 1SLLA 1AUYA 2VTXA 2K2SA 5FPAA 1F9KA 1RMU3 4MGQA 2A6XA 3SNMA 2H6BA 2BRTA 2BBVA 1UPSA 4GH4B 2VNRA 2HJIA 4AI8A 1JTZX 1QWRA 3UKNA 3U1XA 1HRI2 2F6BA 1LOFC 1QJX3 5FYIA 3H1YA 3QBQA 2W1WA 2DYCA 4Q1PA 4CVUA 4XJUA 5I0RA 4HFSA 4NHKA 1VBD2 1X50A 5A3TA 4W65A 1R1A1 2LM3A 3N7JA 3A4UA 4M3CA 5DUVA 1AL23 4L99A 1FMD3 5FZHA 3SEEA 4Q5OA 4FPGA 1OFNA 4V2VA 2O0OA 4Q29A 1MS3A 4L8QA 1XU2A 4FPOB 4BH9A 2P34A 5FYUA 3LEGA 5FYBA 1W04A 1OPOA 5ANNA 3E6CC 3WG2A 1ND2A 2BEOA 2JDHA 2Z79A 5F3IA 3VLBB 1W2NA 5FUIA 3K51A 4K9SA 4OCTA 3TB0A 5A3OA 3ZYGA 4WVMB 3TNPB 4LK7A 1OLMA 2P1BA 4QPIA 3ZR6A 3N4MA 3MIGA 1B09A 1JZ5A 5DUXA 2JICA 2E32A 4HG6B 4CDUC 4PIYA 5DZGA 5LA2A 4ARXA 2EICA 5CKNA 3NRUA 4XDPA 4WM8C 4XZPA 5EYYA 1O4YA 1W8ZA 1LKNA 1ZBA1 3AMHA 4Q0UA 4Y3OA 3OY8A 4RS5B 3NKTA 4CU7A 3ZFGB 1BBT1 5T3NA 5CADA 3SC7X 1ZRFA 4JGYA 4D8MA 2HWD2 2Y6FA 4FPEA 4HZFA 4LO5B 3VUOA 1FATA 5LRRA 1R082 2X10A 1NZCA 3WDWA 4EQVA 4UW4A 2W46A 3CMGA 4N53C 5C8CB 3POWA 2ORZA 1UOBA 2VO5A 1HV0A 1PVC3 1X8MA 4LOTA 2VQUA 1QXJA 4MXWB 1AL0G 3MEPA 3H1MA 3AVRA 4M4PA 4RR3B 4CXXA 4QB2A 5IHRA 3PVOA 2XONA 4C1WA 5F5QA 1XNDA 2JIGA 1R64A 3JB4C 4QB1A 4YM0A 1UU5A 4L0PA 3M2MA 1BK0A 4Q4W1 5J09A 5FZ8A 4GD4A 1IS4A 3HPNA 3VKFC 1YQ2A 2JB4A 3ELNA 4UAPA 1QJY2 3WT3A 1RUI1 5BNNB 5FR3A 3VBRC 5EPAA 4TLGA 3ON7A 4KG8A 2A3YA 3K4DA 1YQCA 1XSRA 2WFF2 3WP6A 5J36A 1LOGA 3RG0A 3ZOIA 2P3YA 1QQP3 4CCJA 1W8OA 4LHKA 4NOTA 1W9WA 1CAVB 1JI6A 4FBFA 1CAUB 3MUZ1 4W6WA 4Q1RA 3C7EA 1EAH2 1JZ6A 4MGTA 1I9RA 2P37A 1SBDA 5E8AA 1PMIA 2VUCA 4CUGA 3ES4A 5FP9A 5J37A 2XLGA 5CFCC 4GWMA 4Z2AA 4YGCA 4CEYA 5AC92 2NN8A 5ANQA 2DCJA 3I2IA 5FYZA 4KNCA 1IS6A 3UYJA 1Y3TA 3AMQA 1ZX5A 3K46A 5FJHA 1RXGA 5JOZA 3O1RA 2R073 2AUYA 3PU3A 2JDKA 5A32A 2PQSA 1VBC3 1LTEA 2OX0A 3N9OA 1PK6B 5FZGA 4XUPA 2D3SA 1WCKA 4NPMA 1E5HA 3ZN4A 3SMHA 4DOUA 4PDWA 2BNOA 2D7FA 2WNUA 5FY5A 1QNYA 2WN3A 3VBSC 5CKMA 4XUTA 5C8WA 3T0DA 5K8SA 3OG2A 3MIBA 1SZBA 3I59B 4BQ4A 3KHBA 3DXUA 4KI5M 3T0BA 2F4PA 1XNAA 1DQ1A 1BEV3 2ZGPA 4MGSA 3V0AB 3POEA 1VBA2 2VZVA 4U36A 3WV6A 1JW6A 2O8OA 2W5FA 3EQEA 3VBFA 4LULA 3MLLA 4AVCA 4LA3A 2RM23 3K77A 2RS31 3O1SA 4GB31 1H1MA 3CHXA 2PHUA 1IS5A 2D5HA 3SXWA 2WYFA 2DWRA 4BE3A 2YG0A 4FSJA 4BISA 2VAUA 1NE6A 2VW1A 3BYWA 1ZRRA 5FYTA 4BZ4A 4EN0A 2E63A 2KD7A 1VE0A 3WF4A 5IYYA 1GMMA 1COV3 2ES3A 4QX7A 3VDCA 3WCSA 4DUVA 3RSJA 5LBFA 3RZJA 5GZFA 2D6KA 3D82A 5F9TA 2SLIA 3OGJA 1KFXL 3FBMA 4C1XA 1D4M2 3ZLIA 1ASJ3 2Y38A 4XFIA 1SLCA 2P3IA 1PX4A 3IB3A 1NE4A 1OURA 2C5DA 2VW0A 2ADDA 1XB9A 1AXZA 2FCTA 3U4XA 4ISQA 4IV1B 1HB3A 2ARBA 3VBUA 1OSGA 1ZZ7A 3QCWA 3KQRA 4Y1VA 4BJ0A 1GWLA 3HBKA 2GSYA 4OYUA 3J7NA 1WMEA 4IXLA 5L9BA 1Q43A 1W0PA 4FPYA 5FQ0B 4FFFA 5FFOC 5T55A 4QQHA 1DGLA 3PVBB 1PGSA 3RZKA 3LEMA 2HLEA 4YVWC 1LHOA 3N3HA 5DMYA 2JX9A 1YJKA 2DCYA 2VVFA 4EN7B 1MQTA 5JUVA 3UKVA 5L9VA 1IKQA 4LOSA 4MHUA 2HBTA 4QQPA 2OYZA 5JSRA 5BNPB 4XILA 1QJFA 4XDOA 4GWJA 3IAQA 4KQ7A 3DYPA 3ZVXA 3A21A 1W28A 3MZHA 5FP4A 1AR82 4A42A 2DFCA 2IZWA 3TEWA 1H2LA 3EYPA 4HPKB 3SISA 4AGGA 2VY0A 4AQSA 1I6XA 4CU8A 1XNBA 1K5JA 2WO1A 3JB8A 2YGMA 3R05A 1OQEA 3INAA 3KB5A 1NQDA 3B00A 2RVAA 4FXKB 4W4ZA 3KSCA 1LOFA 3VL9A 1UMHA 3JBG2 4AFAA 1PO21 1XXNA 3KT7A 4OVEA 3SLIA 3GZUC 4AVAA 3MFAA 2XDVA 1BMV1 1DLLA 3WZ1A 3BPSA 5JZGC 1B35A 5CAZA 3PNAA 2WNVC 2EIEA 3WY6A 1YI9A 2ZAHA 1JYTA 2F4LA 1Y9QA 3GCWA 1AR62 4MGKE 3FBYA 1NUKA 2WDBA 1JYVA 2LTNA 1OOPC 2GC2A 4ITCA 5HV4A 3U0ZA 2ZZJA 3AL6A 2W1QA 2ET1A 3ETPA 5FUNA 1SLIA 2WNEA 2OUJA 2D97A 2XB6C 3APBA 2W87A 3ZYHA 2X09A 2XJTA 1WA4A 4QHZA 2ZEYA 4PJYA 5FP7A 5C4WA 2QQPA 4DXSA 3LF7A 1SFNA 4CDUB 2RG4A 4EZHA 1TMF2 3E5QA 1QNWA 5I8SA 4WM8B 5HXVA 2HWF2 3B02A 4NE9A 4EE2A 4WM7C 1R092 5C71A 3H8XA 4MGIE 3O0VA 2ZGQA 2D3RA 2HWE3 1MR5A 2GMMA 4B4RA 1QJU3 3G7DA 4XF9A 2CDPA 4FOVA 4D7SA 4OI1A 4GMP3 5LRSA 1AX2A 3RYRA 1J1TA 2WLQA 4AXOA 2ZOEB 4YM2A 1O4ZA 1MS9A 5CFDC 2I74A 2BVBA 4OI2A 3DXTA 4MSVA 1KITA 4LT5A 4LE4A 4YPJA 1V6LA 2R043 1BQPA 4FPHA 4HONA 1C5IA 3ABZA 4R4XA 1RUE3 5LBCA 3WX5A 4MGYE 3KM5A 2A6YA 2AEYA 4JZRA 2RJ2A 3W21A 3WDXA 4DINB 2JDNA 2X05A 1OXCA 4JDNA 2D98A 2DDUA 2BU9A 1PZ7A 1ODNA 1X9PA 3ETQA 2JG8C 4LPLA 5F5IA 4CCLA 3B3QE 3T2OA 1JYIA 3FN9A 1N1YA 3VBRB 3FHIB 1MZFA 4NIGA 4UXAA 1O5UA 3KF5A 3KV6A 1K5MA 5FXZA 2FZ2A 2WBKA 1C1LA 2J1VA 3KCYA 3POFA 4NROA 3ZSMA 1JZ2A 5FLHA 1VBB1 1UWWA 4HKLA 3J7LA 4ES8A 5JXHA 4IETA 2R0FA 1RUC3 2R16A 1W6OB 1MZ6A 3ZN6B 4JDOA 1ZA4A 2JE8A 1O5LA 4YVSA 3HVDA 4CSWA 4ZZ5A 1OBNA 1JYNA 1Q8SA 4QQLA 3GZTB 2CHHA 1RXFA 1U0AA 3HQRA 4B4QA 1O8SA 4DRVA 2B39A 3MFCA 1Z7S2 3SCHA 5JPMB 3GDBA 4FI9A 3RDIA 3I97A 1AYN1 4BPZA 4PQQA 4DEQA 5A1FA 1MEC1 2Y64A 4AEDA 2W2IA 2Y6KA 4QPYA 3O14A 4DZGA 4JV4A 2YUEA 3AYDA 3VDDC 3WDVA 1G8WA 1H4HA 3AXEA 4AZZA 2ZGMA 4QGNA 4BLIA 1XU1A 1WBFA 3VBHC 4A2UA 1NAEA 1U5YA 2VR4A 3KT1A 1C8NA 1ZRIA 5K0UA 1VIWB 5IVBA 4UBHA 2DBNA 2TNFA 4QX5A 3VBSB 4A6OA 1YUDA 1NA1A 5A6QA 2IFWA 4RQPB 5GZEA 3VZJA 2NMOA 4FP3A 2ET7A 2IXIA 2RS11 4CP2A 3SCGA 1H6YA 3CEWA 1S0CA 1LHVA 1FOD2 2JG9C 1RUG1 1G9BA 3LPGA 5FBZA 5A7QA 1CAWB 3TEYA 3R0RA 1ENSA 4AAPA 5C3SA 5JIUA 2MHFA 1PIV1 1LHWA 1STMA 2QQOA 4IEUA 5CKQA 5CEHA 2UYAA 1T6GC 3UGHA 2X5IA 4E4DX 4XMIA 1NY71 1RVF1 2L9LA 4YGDA 3RQ0A 1ULCA 1PM4A 1R1A2 1LGBA 3PLQA 4L2NA 5L19A 3BPZA 1RTVA 4BIOA 4FFGA 2ARAA 3O7OA 4FQZA 4BQ2A 1REFA 2CWSA 4CUBA 2WR9A 2UURA 4LLOA 3Q8FA 2WZEA 4OLLA 5F3EA 3WQ1A 4AFMA 5JOWA 3VZOA 5KBFA 1HXS1 5H9PA 5I0SA 3KS7A 4ARYA 1V9U1 2WKKA 3CBNA 4DQAA 5EIYB 2RDQA 4YM1A 3ZDSA 1QDOA 4QGLA 5FPZA 1G9FA 3IT8A 3I2GA 3GCXA 2E26A 2P17A 1MS5A 3LSDA 4NIAA 3VB9A 1XRUA 1UOFA 1WCUA 3ZYBA 1SACA 1HRV1 4LO6B 3I8TA 2QQLA 4K40A 2WAAA 4AI0A 3KVAA 3AVSA 3NV1A 1AYM3 2PHFA 1FPN1 4YW2A 4NPRA 3ZN5A 4YVWB 1JYWA 2LS6A 1CWPA 1LU2A 4BXSV 3RYKA 4QDRA 2FDKA 2Q0AA 4LITA 3ZFEB 4CEWC 5FYHA 1JOPA 3WUDA 4CPBD 4FFHA 1ZBA2 1H1IA 4QX3A 1YQ8A 1WGPA 3LSEA 4Q0QA 5DG1A 1JUHA 4M3CF 5C5UA 1BBT2 5FY0A 4AEJA 1UOJA 3OBRA 3H3ZA 4R9BA 1RC6A 3NJZA 3U07A 3I7DA 1XQNA 3PJYA 2DTYA 3MIHA 4FOYA 4JAAA 3S57A 2BFUL 5J1XA 1XPWA 3AZVA 3GBWA 5LW9A 4BHPA 4YG0A 2A6WA 2W95A 4UFLA 5FAXA 1RUF1 4J25A 5FOBB 1WKYA 3FFZA 4NIDA 1ST8A 1ZZ8A 2W91A 4LO7A 2EXJA 3CKHA 3URFA 3ZKUA 2R063 1OD5A 3PJQA 4J1XA 1HW5A 2TUNA 5JI9A 4Q4W2 5EXOA 3C2UA 4GWIA 2G19A 2JDAA 3I4IA 5JZGB 3KV5A 5KWRA 2Q5TA 3ZKYA 1RUI2 2QJVA 1UZZA 2XKOA 2B42B 1QH7A 5DDJ1 1S2KA 1KGYA 1LNSA 1YWKA 1RB8G 3VD7A 1S0BA 1AR93 4XFBA 5JLVA 1GBGA 3V56A 1LGCA 3SITA 5T5LA 5BPXA 1BLZA 1GANA 1RMU1 1CR7A 1NG0A 3H50A 4HT1T 1ND3B 4Y1YA 1ND2C 1WLWA 5FWJA 2A3WA 1TME3 4N7IA 1QJX1 3LA3A 1OOPA 2B46X 1SQ4A 2VBBA 5CZKA 2VCCA 3DV8A 3DN7A 2ZGNA 4K20A 3KLSA 2RS53 1EV13 2CNAA 5D8AA 2GMPA 4Y22A 3BUCA 1AL21 4WM7B 4IL7A 4JGZA 5LY2A 1RHI1 1FMD1 4AQTA 4NR1A 4IEVA 1ENRA 2ARXA 2Z2SB 4IGPA 2GC1A 2QUOA 1PHMA 1SFYA 5CISA 3W9AA 1VRH3 4QDQA 3TBDA 1YFUA 1DGWX 3J8F3 4JGYC 3ZYFA 1KEXA 1UY2A 4M0HA 1DGRN 4UYBA 5EQUA 5GLZA 2XUEA 2D6MA 1C4RA 1IG3A 1VAVA 1WW7A 3CIHA 3QACA 3X29B 3ST7A 1CGPA 1N3PA 4OHVA 3IIAA 4X6QB 1HJFA 3KCCA 3VKLA 5DZFA 3AL5A 4YWAA 4HXCA 4P9GA 4CDXC 5FJKA 4JHTA 4BQXA 5LZ6A 3POIA 4LHNA 4D6QA 2YYOA 3BU7A 1CQ9A 3AP4A 1LOBA 2JG8B 5FY7A 5HCAA 3WUCA 2C9KA 2HEWF 5IFPA 2R7EB 4R9DA 1G9DA 1GZTA 2JIJA 5IW0A 1HRI3 3ACGA 1O3TA 4AEKA 2ZEWA 3ORJA 4P5HA 1JU3A 1NCQA 2Q8DA 2V73A 4YZ1A 4KL1A 1VBD3 1S1AA 2LW8A 4GB32 4JKLA 5JSPA 2JKBA 4UBGA 5FYMA 4RGKA 4Q0SA 4YM3A 2ENRA 4WVVA 4P9IA 5IATA 2JE9A 5FZFA 1PGW2 5KXEA 3NQHA 5B4NA 3WQBA 1X9TA 1C28A 3HNMA 3L2HA 1N47A 4AI3A 4Y1XA 4BLJA 3VBOA 1HLCA 2OZJA 4LO4B 1UY1A 2RJLA 1SBEA 3SKJE 1UX6A 1UXXX 4CEYC 5IVFA 1OC1A 1S0EA 4ASMB 5L36A 1JUIA 1H2MA 4E2QA 1D4VB 4GJZA 3B5LB 3KWVA 2UWAA 4AI1A 4ZHNA 1J59A 1QQP1 2EIBA 1SEFA 2XGXA 4RD7A 1A8MA 4YZ2A 3T2PA 1F5JA 1MZEA 4FTSA 3FLTA 4PDWC 1C5HA 5T5OA 2BV4A 5T5PA 3N7MA 2WNUC 2HWD3 2O8QA 3PDQA 5DQ0A 4LIUA 1R083 1UO9A 2AGSA 3LEIA 2DVGA 4HKOA 4HBNA 4UOJA 3VHPA 2IXHA 3VV1A 4ATEA 2JG9B 5IAVA 1OA2A 4KU7A 3HD8B 5JOYA 1SLAA 4LBQB 1C3HA 5ABJB 4AE2A 1TZOA 3IPVB 3D3AA 5BUVA 2E33A 2X8KA 4LNVA 3ZSEA 3VBFC 2R071 1W8HA 4YG3A 4QKDA 2OKXA 4AGRA 4OI0A 1VBC1 1JHNA 1NXMA 3D0JA 1CN1A 5IK4A 2IWGB 4K8FA 5FZEA 5FZ0A 2XJRA 1ENXA 1S55A 4DEVA 1RUD2 2WT1A 1QJY3 2D93A 2WJSA 5DUWA 2AACA 3PIGA 3N35A 1ULPA 2XLAA 1PO22 4QX1A 2B45X 2WFF3 1BMV2 3ACIA 3POYA 4BWOA 2ZABA 4ZY9A 1O59A 2FDHA 4YZ5A 2XJVA 1EUTA 1BEV1 2VZ3A 3W20A 1LR5A 3AXDA 1ULOA 1EAH3 2ZHNA 4XXAA 4FFIA 1QKQA 4H55A 4LQRA 1DCSA 1ZZCA 2VUAA 2JB8A 2RM21 4L11A 4YZ4A 3VBUC 1HN1A 3E5UA 3N7LA 2B9UA 2GZWA 4FQ4A 5AC93 3HJRA 4S2DA 4PQ9A 4CDQA 2GP3A 1PO11 2AC1A 1GZWB 4UW5A 1DGRA 4CEWB 4JC1A 1UF2C 4CE8A 4W8JA 2E51A 1H2KA 1REEA 2YMZA 1MQTC 4IV3A 1CIYA 2CGOA 3DEMA 3WNLA 1DG6A 5A7SA 4TWTA 2FHRA 1ONAA 1V6MA 2BOJA 4NUBA 3U78A 2JDPA 3IKWA 3WF3A 2ZJCA 4CCMA 2CGPA 2WO7A 2VOVA 1VBA3 2D3PA 1IG0A 2GNDA 3TEXA 1RIRA 4NHXA 5J48A 1NLQA 5DAPA 3NV3A 4RL7A 1J58A 4XAAA 4XURA 4Z82A 4RHV1 2IC1A 5JPNB 3KGLA 4L97A 4XJ8A 1UMZA 1B35C 2EAKA 3K48A 3E97A 3EB7A 4XF3A 3WP4A 1OD3A 1E5IA 5HV0A 5I91A 1QJEA 4QU1A 5LA9A 1CZSA 5JVVA 3WNOA 1VBB2 3ACLA 1ND2B 5HCHA 1YC61 2W47A 1O3SA 1D4M3 4MX3A 2P4EA 2XKPA 3KCXA 2V09A 4QPIB 3SEPA 1YJLA 5T50A 3ZIWA 3I3DA 2XXZA 3CL1A 3Q9OA 2JKXA 1RJ8A 3CJXA 3PUSA 5C4WC 1H8TA 1JZ3A 1WMXA 2JD9A 2W1UA 4M00A 3UGFA 4D6SA 5LWBA 3RWKX 3FHAA 2ZHLA 5A70A 1VBE3 5L7OB 1MEC2 1FV3A 3OY8B 2DU0A 3LDBA 5FREA 2W92A 4KH9A 2P3KA 2QQNA 2H0BA 4XJ9A 4JGYB 5FZOA 2VNGA 3H3LA 5G05L 3S7EA 3POGA 1AR71 4AFDA 4COYA 2JXAA 2VMEA 3C7FA 3LCPA 1QH6A 3M3QA 4W50A 4Y33A 4QKNA 4N7UA 1C8M1 4EN9B 1DIWA 3R4DB 2YXSA 3C7OA 4WZCA 3VL8A 3WF2A 2RJKA 4OUSA 1ZRCA 1LAJA 3WOGA 3DPRA 4YW1A 3A0NA 4NIIA 1NXD1 5KHIA 2JENA 3MUY1 4EROA 4ZU7A 2A7AA 2QVSB 5KHKA 2RS12 3ES1A 4CDXA 4B1MA 2FBEA 4H2AA 1DQ4A 1G7YA 5FP8A 5LY1A 4PF1A 2DBIA 1IPJA 1QJU1 4OMCA 4GMP1 1HQLA 1K5MC 4PCRA 5FXXA 1PIV2 1MZ5A 2HWB2 3AJZA 3HT1A 3GBFA 3OF1A 3JBG3 2EIGA 4OHWA 3BTZA 1Q3EA 1CAXB 2D6NA 3AP6A 1NY72 1RVF2 4Y1UA 1O8PA 3E5XA 4EN8B 4TXWA 2R041 4EZ4A 4CYDA 1HJGA 3MPPG 1WCDJ 4F83A 1UW8A 3IBMA 4WV8A 2YU1A 1QIQA 1IHMA 4LJHA 1AR63 4YVSC 3ZSJA 1WW6A 3JD72 4XBQA 5GJ6A 1W8TA 1HXS2 4E8DA 1GWKA 5DXDA 1V9U2 1R1ZA 4CEYB 5J3UA 2CU5A 3HN3A 4EYUA 2QQKA 3HAGA 4NWWA 2H6CA 4XFHA 4YW6A 3T2QA 1OH3A 4LKFA 4AEDC 2G1MA 2VQAA 1HRV2 1TMF3 3MV11 1OFSA 5A32B 3HOBA 4LK6A 2HWF3 2WS91 1R093 2PAKA 5FZAA 2E9QA 1RUC1 4ET7A 3CQOA 4INDA 1EP0A 4PDWB 2KXLA 4XZUG 3U4SA 3ZXJA 4D94A 5K0UC 1RYYA 4EWEA 2UYBA 2WNUB 3EBRA 4YARA 1NA1C 1ALYA 5F6KA 3ZIXA 2O14A 1UU4A 5FK7A 4H7MA 1DP0A 1SPPB 2VNOA 2VCBA 4QX8A 1NZIA 1RUJ1 1K45A 1SDWA 2GU9A 4ZXEA 3SQOA 3V64A 2IVIB 1W6NA 3MIDA 2YBKA 3RMXA 4FOQA 3VBFB 5IT6A 2WQZC 3ZYRA 1NCRA 1W99A 1UD1A 1OUSA 2C4XA 4NJ4A 5H9RA 4QMAA 2XUMA 1YFYA 4D7YA 4XCAA 1RUF2 3BKZA 2DURA 4XUQA 4W6YA 2X5IC 3O1OA 4A7ZA 4IEZA 4A45A 5IK7A 5KC5A 2D40A 3B9IA 1GNHA 4UW3A 3ZSKA 4D6RA 2XPJA 4Y5TA 1N1VA 4NRQA 3BN6A 5IJRA 1RGSA 3C7GA 1IGOA 3KHCA 1PK6A
chains in the Genus database with same CATH topology
3ZR6A 4B1MA 3LEMA 5FIXA 3IMMA 3LDKA 3NMBA 3KF3A 3RWKX 5FK8A 3UGGA 4FFHA 2ADEA 3S5QA 5FMDA 5FKBA 3LFIA 4JQTA 5FKCA 4B1LA 3H3LA 2QQVA 4CCEA 3KF5A 1W2TA 4FFIA 4UFIA 3ZR5A 5FMCA 4CCDA 2ADDA 2XQRA 3PIJA 1UYPA 5FMBA 3U75A 2QQWA 3SC7X 4UFHA 3UGFA 4AZZA 2OXBA 4UFKA 1Y4WA 3UGHA 4CCCA 3LIGA 2QQUA 4UFJA 5ANNA 4UFLA 3U14A 1Y9GA 1Y9MA 3LIHA 4UFMA 2AC1A 3HBKA 3LDRA 3PIGA 1ST8A 4HXCA 3U1XA 4EQVA 4QHZA 2AEYA 4FFFA 2AEZA 3OSDA 4FFGA 3LF7A 5FK7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZR6 A;  4B1M A;  3LEM A;  5FIX A;  3IMM A;  3LDK A;  3NMB A;  3KF3 A;  3RWK X;  5FK8 A;  3UGG A;  4FFH A;  2ADE A;  3S5Q A;  5FMD A;  5FKB A;  3LFI A;  4JQT A;  5FKC A;  4B1L A;  3H3L A;  2QQV A;  4CCE A;  3KF5 A;  1W2T A;  4FFI A;  4UFI A;  3ZR5 A;  5FMC A;  4CCD A;  2ADD A;  2XQR A;  3PIJ A;  1UYP A;  5FMB A;  3U75 A;  2QQW A;  3SC7 X;  4UFH A;  3UGF A;  4AZZ A;  2OXB A;  4UFK A;  1Y4W A;  3UGH A;  4CCC A;  3LIG A;  2QQU A;  4UFJ A;  5ANN A;  4UFL A;  3U14 A;  1Y9G A;  1Y9M A;  3LIH A;  4UFM A;  2AC1 A;  3HBK A;  3LDR A;  3PIG A;  1ST8 A;  4HXC A;  3U1X A;  4EQV A;  4QHZ A;  2AEY A;  4FFF A;  2AEZ A;  3OSD A;  4FFG A;  3LF7 A;  5FK7 A; 
#chains in the Genus database with same CATH topology
 3NJV A;  5DDJ 2;  2VZP A;  3FLP A;  4NAM A;  3FUQ A;  2VUD A;  3FL7 A;  1XJA A;  4AFB A;  2VGD A;  4H7L A;  1QF3 A;  1O7F A;  1ZBE 2;  2D5F A;  4JQT A;  1NT0 A;  3UV9 A;  4M01 A;  4K21 A;  3RI8 A;  1VAK A;  5CVR A;  3VBU B;  2NZ9 A;  1LJ7 A;  3JUU A;  3WIN E;  1F4A A;  5IVC A;  3I59 A;  4IEY A;  3BTX A;  2YV8 A;  5FZ6 A;  1KXG A;  1ULG A;  2OPW A;  3PL0 A;  4Q4V 1;  3DF0 A;  4B7E A;  3V0A A;  3D5O A;  3VDB A;  3BIE A;  4UI9 L;  1POV 3;  3JXS A;  2VH9 A;  3VHR A;  4ASK A;  4XJW A;  4OQ9 A;  4DUW A;  3AKR A;  2CYF A;  1GV9 A;  2PXJ A;  1RHI 2;  4P9L A;  5BXX A;  1MQT B;  2AEZ A;  3WEZ A;  2ZZQ A;  1GP4 A;  4OUM A;  2PLV 2;  3L2Y A;  2VEC A;  5FIX A;  3WP5 A;  3E6B A;  3U10 A;  3K4Z A;  5DPN A;  3III A;  1BXH A;  2XWJ B;  2ZML A;  4TN7 A;  4FOW A;  3WW1 A;  3GGL A;  1LCL A;  4MGZ E;  4K6B A;  4GWN A;  4MUV A;  1KS4 A;  1W3X A;  1YI7 A;  2BYV E;  3MV0 1;  2ZXQ A;  3QH7 A;  2XVG A;  4MO3 M;  3VDA A;  3V0B B;  1EPW A;  4X8N A;  4RYD A;  5EFU A;  1FOD 3;  1S2B A;  5KHG A;  3FHQ A;  2YC4 A;  5C70 A;  3WG1 A;  3OYW B;  5I8T A;  1GWM A;  1D7P M;  2FDF A;  2ZGS A;  1JYC A;  3HQX A;  5AVA A;  2C1F A;  2CAU A;  3VHO A;  1FV2 A;  4P08 A;  4B3N A;  3AP5 A;  2WN2 A;  3PMS A;  2ORX A;  2XVL A;  1POQ A;  3NNM A;  4DUX A;  3ZX7 A;  5F39 A;  3WW4 A;  1WW5 A;  2CGN A;  1DYK A;  3NVC A;  4D69 A;  5C9A A;  4I0B A;  4NRM A;  1S0J A;  4QWN A;  4JKK A;  5GLU A;  1W90 A;  5EWS A;  1A3K A;  1CX1 A;  3EMR A;  5I0U A;  4K8R B;  3ZYI B;  1WLC A;  1GOH A;  2PA7 A;  5GZG A;  2OQ7 A;  3HIF A;  2P5B A;  2WAB A;  3IDE A;  4QPG C;  5A3W A;  5BNP A;  5C4W B;  2QTW B;  2VNV A;  5DG2 A;  2XHN A;  2YBS A;  1LRH A;  2UY8 A;  4UF0 A;  2R06 1;  1Y7B A;  1YFX A;  2VXJ A;  5D8A C;  2R32 A;  3VKN A;  5EJZ B;  3VZK A;  4OHZ A;  5BNO A;  1O3R A;  3QD6 A;  3SCF A;  2OA2 A;  4JGZ C;  4LLF A;  5J7M A;  3A23 A;  4BCU A;  3Q8C A;  4IER A;  2J22 A;  2EF6 A;  4MET A;  4G4F A;  1AR9 1;  4C90 A;  4AHY A;  4PI2 A;  4FXG B;  1HQN A;  5F5C A;  5DN2 A;  4CXW A;  4K7J A;  2XBO 2;  1QQP 2;  4Q4Y 3;  1WWY A;  1OA3 A;  3T4H B;  1ZBA 3;  3JCI A;  3PVN A;  1D2Q A;  3RRD A;  1W6P A;  5KR7 A;  4CUA A;  1TME 1;  2G4I A;  1ULF A;  2C6S A;  2D6L X;  4FPC A;  2JDU A;  3PU8 A;  5DZE A;  2RS5 1;  1EV1 1;  1M4W A;  2I2S A;  4N53 B;  3LPF A;  3POS A;  5IVV A;  1QHD A;  2CAV A;  4JRL A;  4XJA A;  3TAY A;  3VKO A;  2DFB A;  3M1H A;  4IEP A;  2GAL A;  2QKD A;  2VZR A;  5ISL A;  4GAZ A;  1XE7 A;  5LAT A;  1DZT A;  4AW7 A;  1YQ5 A;  1K5M B;  4A3Z A;  1J1L A;  2GP5 A;  5KXD A;  2R6Q A;  3USU A;  2J7M A;  1NCQ C;  3GZA A;  5KC6 A;  2Q1Z B;  4RGA A;  4Q4W 3;  2QQV A;  4EN6 B;  3LOI A;  4OI4 A;  2VU9 A;  1E5R A;  5HCF A;  3T0A A;  5CB7 A;  1LB2 A;  1U5Z A;  1XYN A;  1RUI 3;  5JR7 B;  2C0Z A;  4LBQ D;  4YVS B;  1OLR A;  1T6B X;  1FX5 A;  3ACH A;  3GZE A;  1UL9 A;  1YLL A;  5FXV A;  1NYW A;  4ZS2 A;  1XNT A;  2GNM A;  2VG9 A;  2ZGR A;  4BME A;  2VL4 A;  2WO2 A;  3VBO C;  1RUH 1;  3OSD A;  2G9Z A;  1X36 A;  3T08 A;  1HRI 1;  1W8N A;  2Z42 A;  1OF4 A;  3KD4 A;  3LAG A;  1AX0 A;  3LDK A;  4QM9 A;  1L7Q A;  5CFC B;  2DTW A;  2I07 B;  4AED B;  1KJR A;  1UIK A;  2A3X A;  2FMY A;  1Q8Q A;  1LES A;  4HMZ A;  1LOA A;  2WYS A;  1WA6 X;  4YRD A;  2AH2 A;  1SLB A;  1XOY A;  4XC9 A;  3WDT A;  2XR4 A;  3W5M A;  3DL3 A;  1V00 A;  4LEJ A;  2OII A;  5JR2 A;  3J9S A;  1PO1 2;  3C3V A;  4Z1V A;  2D6P A;  2Y33 A;  2FDJ A;  1LEN A;  1NA1 B;  4DB5 A;  2BVV A;  3M3O A;  3N9M A;  1XE0 A;  4LTA A;  3J7M A;  5LBB A;  4E4Z A;  3W5N A;  1UZ0 A;  1W6O A;  1W9Y A;  1W8W A;  4L92 A;  4ZPI A;  2Q8C A;  4IGQ A;  4AVS A;  4A44 A;  3M3C A;  4DMI A;  4BXF A;  1UXZ A;  4LXL A;  3NST A;  4S2G A;  4WVW A;  2MEV 1;  4XUO A;  3ZFF A;  1IS3 A;  2GN7 A;  2IXK A;  2XJQ A;  5CA6 A;  1PNF A;  4AVB A;  4XQW A;  1H6X A;  2X5I B;  2BFU S;  3DUI A;  1AJK A;  5F6L B;  3OTF A;  3KV4 A;  3VZN A;  5B2G B;  4UFH A;  2RR1 1;  1UY0 A;  4CU6 A;  1LUL A;  2BER A;  3NAP A;  4GB3 3;  1HN0 A;  4IEO A;  4RHV 2;  5GLW A;  5L9R A;  1MVE A;  1GR3 A;  1R08 1;  3WDY A;  2W94 A;  1U5I A;  4LBN A;  2NPI A;  1LU1 A;  2CSG A;  3OBA A;  4WBB A;  3IN9 A;  3WG3 A;  4E4S A;  2BOI A;  3LB9 A;  5JAX A;  4URT A;  3TN9 1;  4PF5 A;  5FZM A;  4AI2 A;  4HK8 A;  5B4X A;  1S2E A;  4Y20 B;  4RQP A;  3IM0 A;  3K75 B;  3N36 A;  5C3Q A;  2FCU A;  5FTT C;  2ZEX A;  2VZ1 A;  3FUO A;  2A75 A;  4NWV A;  4KWJ A;  2BBA A;  3G6J B;  4CDQ C;  3THD A;  1QJY 1;  2DVD A;  2JEC A;  4CP9 A;  3AKQ A;  4LA2 A;  1CAW A;  1YIP A;  2XJU A;  1OLQ A;  3OPZ A;  4JDM A;  3MF6 A;  5JMO A;  2ZAC A;  1Q8P A;  3N9P A;  1IQD C;  4FAH A;  1K42 A;  4O9E A;  3NNJ A;  3R4U A;  1YFW A;  4PBO A;  3RGB A;  5LA1 A;  4P9Y A;  4IV3 C;  1H9W A;  4I09 A;  5DAQ A;  4OQ8 A;  1H30 A;  2Y60 A;  1W6M B;  3MLJ A;  4E2S A;  4Q0P A;  1AR7 2;  4N43 A;  3BAL A;  4X6R B;  4FP2 A;  4FPL A;  4F8A A;  5A6Y A;  1BKZ A;  2XG3 A;  2WZR 1;  1C8M 2;  3WF1 A;  5EZW A;  4HL0 A;  2YGL A;  1OMI A;  1UCX A;  2A71 A;  2DVB A;  1LOC A;  3AFG A;  3L9J T;  4QDS A;  1OLM E;  2WSU A;  1ZRD A;  1C1F A;  1QXP A;  2VOT A;  5F5A A;  5APA A;  1YCI A;  1DQ2 A;  1QY4 A;  3MYX A;  1AVB A;  1DQ5 A;  1IQA A;  4IEQ A;  3WHT A;  1O3Q A;  1EUU A;  3U14 A;  3OGG A;  4E27 A;  4R4Z A;  1UY4 A;  1PNG A;  4E9K A;  1RUN A;  3LKJ A;  1BHG A;  5ACA 1;  3O1U A;  4KGG A;  5I0D A;  2UU8 A;  4A7K A;  4LHL A;  1RUD 3;  3GF6 A;  4Y26 A;  3WD5 A;  5SV5 A;  5CG9 A;  2ERF A;  2P6H A;  1PO2 3;  2WNV B;  4HET A;  3LFI A;  4LHS A;  1BVP 1;  3OEA A;  5IFT A;  4I02 A;  4KWU A;  1OH4 A;  1S0G A;  3RJR A;  2PTM A;  2RMU 1;  3NW4 A;  4XBN A;  4S2F A;  3GBG A;  1G9C A;  3P1I A;  4CCD A;  4DNY A;  2V4V A;  3THT A;  2Q8O A;  1OOP B;  1WMF A;  3N7K A;  4P9W A;  1YQ6 A;  2WSV A;  2ZGO A;  2J1S A;  5EYX A;  5D8A B;  1W0N A;  4EJR A;  3S0M A;  2PHW A;  2PAE A;  4Y22 B;  1W9S A;  3CF6 E;  4H3W A;  4P00 B;  4JGZ B;  4QPG A;  1H8T C;  1UIJ A;  3BGA A;  5FY1 A;  2HWC 3;  3AYA A;  3GJA A;  2DCT A;  4MV2 A;  2BWA A;  2ZX3 A;  2BPA 2;  2IXJ A;  1V6I A;  2XQX A;  1J3R A;  4C0H A;  4CDW A;  1JU4 A;  4QT6 A;  4LO8 A;  1KDM A;  2VOX A;  4Y5Z 0;  2VUL A;  3PVE A;  3C7H A;  4Q4X 3;  4H14 A;  2WS9 2;  2OVU A;  1W6Q A;  1PZ8 A;  4AHW A;  3BVC A;  3UK9 A;  4P9X A;  5LEK A;  4NHM A;  3O5S A;  1D4M 1;  4W6X A;  3BOP A;  1H0B A;  5CFD B;  3I3E A;  4HSJ A;  3HNB M;  3R4S A;  4QXB A;  4QXK A;  5FLJ A;  5A33 A;  3RYP A;  3VKM A;  3BOW A;  4CCC A;  1DGW A;  3DPR C;  2DVA A;  2WUH A;  1FAY A;  3POB A;  3N9Q A;  1BVV A;  3GYD A;  5JIA A;  1RUJ 2;  5FUP A;  5AFE A;  1QGL A;  5A7W A;  2ZGU A;  1SFP A;  1GNY A;  3RFR A;  3T2T A;  1VBE 1;  5FRA A;  3ZMN A;  5FZD A;  1NCQ B;  4XQD A;  1W2U A;  1SG3 A;  3N9N A;  4QU2 A;  1DBN A;  3QOP A;  4AFC A;  3B94 A;  2ZX4 A;  1VJ2 A;  1J3Q A;  2BTV C;  1PMJ X;  4Q26 A;  3D4K A;  4BK4 A;  1GFF 2;  1O91 A;  2RS3 2;  4MYE A;  5FMC A;  3S5A A;  4PBP A;  2Q30 A;  5FMO L;  2E6V A;  4RS5 C;  4TZD A;  2K0G A;  1ENQ A;  4QHB A;  2W08 A;  3UES A;  1VBB 3;  1YNA A;  2DCK A;  1CES A;  3T1M A;  4YW7 A;  3VBO B;  1PVC 1;  5C33 A;  2J42 A;  4I3G A;  4B7K A;  5JI7 A;  2ZMK A;  3LEK A;  2QNK A;  5FZC A;  2BJS A;  1E57 A;  3OPT A;  1OHF A;  2DUQ A;  3E1F 1;  1VR3 A;  3SHR A;  1VPH A;  3ZXA C;  2IUW A;  2CL2 A;  4IDZ A;  4LMF A;  4O9G A;  3MGU A;  1F35 A;  4Q4V 2;  3THP A;  4EWD A;  4CP1 A;  1M06 G;  3NKG A;  4N9I A;  3VDD B;  2OZ6 A;  1MEC 3;  5FYY A;  2W39 A;  4MAD A;  4I0A A;  3VBH B;  1X33 A;  4D3W A;  4IE4 A;  1ZZB A;  5JMC A;  3CNA A;  3HR9 A;  1D0G A;  4R52 A;  1P8J A;  1VB2 A;  2AZ5 A;  3P6B A;  4AHZ A;  1UQX A;  1H9P A;  4SLI A;  4BK5 A;  1UY3 A;  3VHN A;  1SBF A;  2JE7 A;  4OHY A;  2HBU A;  2B9V A;  4I0W B;  1MS1 A;  4LE3 A;  1QEX A;  1UYX A;  4IUG A;  4CCO A;  4JHZ A;  2ETE A;  1NCR C;  1ZM1 A;  1GQP A;  2RS1 3;  3UJQ A;  1N3Q A;  3M70 A;  3O0W A;  2BWC A;  3HN1 A;  2JJ6 A;  3OJB A;  2Q4S A;  2BDR A;  4PLM A;  3RNS A;  4YSF A;  5M0T A;  2PQQ A;  1HB1 A;  1O6U A;  5CYY A;  3EO6 A;  4QPW A;  5FPB A;  2HWB 3;  2DVF A;  4TLF A;  2XJP A;  4CCK A;  1W2A X;  2WZP P;  1PK6 C;  1RVF 3;  3FC0 A;  2VJX A;  2ID4 A;  2PHX A;  5F2S A;  2WFP A;  3TWI A;  3RZM A;  3DEC A;  1RUO A;  5IVJ A;  3C8X A;  2DUO A;  1DZQ A;  3CJI A;  2VVE A;  3AYE A;  4AYU A;  2EXK A;  2Y0O A;  1DU3 D;  2D6O X;  1RJ7 A;  2GH2 A;  4DXT A;  5BV6 A;  4IE7 A;  4MOA A;  2XL7 A;  3JD7 3;  1JXN A;  4X8P A;  1HXS 3;  2DF7 A;  3MO4 A;  1BK1 A;  1L7R A;  5K4L A;  2N7G A;  5FPU A;  1UNB A;  2XHK A;  4XHB A;  2ZKN A;  1TNR A;  5ABJ A;  3RZL A;  5DAW A;  3U37 A;  2VZS A;  4I3P A;  1GYK A;  4I30 A;  3WP3 A;  1HRV 3;  2VW2 A;  1FYU A;  1UZW A;  3GAL A;  4XF4 A;  1WMD A;  5GKA C;  1LHU A;  4GZ9 A;  2EA7 A;  2QZ2 A;  5G04 L;  5HBA A;  2Q8E A;  1RIT A;  4BB3 A;  1COV 1;  2LAL A;  2VUJ A;  4GA9 A;  4ZON A;  5FY9 A;  4PLO A;  2VCM A;  1NOV A;  2Y26 A;  3EJK A;  3ZDV A;  3WSO A;  2ADE A;  3NJY A;  5JXJ A;  5DUU A;  3LFM A;  1ASJ 1;  1BYH A;  1W9F A;  2Y0I A;  1Z78 A;  2X29 A;  4XFA A;  1QU0 A;  1MVQ A;  5ERL A;  2DV9 A;  2RDN A;  3HT2 A;  5FV3 A;  4B1L A;  1TME 2;  4YG6 A;  4Z2W A;  3NNG A;  1D2S A;  1U12 A;  4YYO A;  1S0F A;  3BTA A;  1A78 A;  1Q8O A;  1POV 1;  1CON A;  1EV1 2;  2RS5 2;  2WNO A;  3ROU A;  2FDG A;  2Y34 A;  1J3P A;  2A6Z A;  1MS0 A;  2XJS A;  3K2O A;  4OUL A;  4HSL A;  2FZ1 A;  3T1L A;  3LOB A;  2I45 A;  3W58 A;  3CO2 A;  1Y9M A;  3O1V A;  4ZS3 A;  1FI2 A;  2CDO A;  1RUF 3;  1KRI A;  2LRO A;  1S4C A;  2MPF A;  3P3P A;  1YRZ A;  4M3C B;  4R9C A;  1ZA7 A;  2VMI A;  3DYM A;  4JX0 A;  4NIH A;  3I2H A;  4HKW A;  4FCA A;  3AKS A;  2NP0 A;  5C9A C;  3AZX A;  4XW3 A;  2Y6G A;  2YPJ A;  3BTY A;  4CRQ A;  3WNX A;  1KD7 A;  2AYH A;  3RPQ A;  3AKT A;  5DDJ 3;  4PI0 A;  2EXI A;  1DFQ A;  1W05 A;  2J1U A;  4QXH A;  5DAX A;  3ZR5 A;  5FYC A;  1GNZ A;  5BNP C;  5A7O A;  5FCC A;  4YGE A;  3U75 A;  1ZBE 3;  4Q8K A;  5FDB A;  4DPN A;  5SV8 A;  5JCT A;  1H8T B;  1GSL A;  3GHN A;  3VD9 A;  3BU0 A;  1RUH 2;  4A4A A;  2CWM A;  4OZX A;  5A6X A;  3I54 A;  5BNO C;  3HQU A;  4CA9 A;  2J1T A;  3BCW A;  3MDP A;  1T2X A;  2D44 A;  3OPW A;  4NPL A;  4RA0 A;  4GH4 A;  1JOB A;  5C7G A;  4JCK A;  3I2D A;  5FZO B;  3AM2 A;  1OT5 A;  1HKD A;  5FPV A;  3RWN A;  1AYN 2;  5FZ9 A;  3VN4 A;  3AZW A;  1RHI 3;  5A1L A;  3IZO A;  5A6Z A;  3VD4 A;  5JXI A;  3I3M A;  2PLV 3;  3S7I A;  5A1A A;  1XYO A;  3SH5 A;  1JOD A;  2XML A;  2R0H A;  2VBD A;  1UZV A;  2ZX2 A;  1F4H A;  3DPR B;  3KGZ A;  1DQ6 A;  1SMV A;  2EID A;  5IWF A;  1TVG A;  2OW4 A;  5HI0 A;  5GAL A;  1YO8 A;  3THC A;  2IXL A;  3MI8 A;  4BQ5 A;  1NKG A;  4CDX B;  5A7P A;  4GMP 0;  5J96 B;  3H8O A;  4XDQ A;  4HAN A;  1PZ9 A;  2ZPX A;  1AR8 3;  2BNM A;  2VMH A;  1AF9 A;  2ZA9 A;  5E6H A;  4QX0 A;  1XNC A;  3K3O A;  2W0X A;  3IMM A;  2MEV 2;  1QOT A;  4COU A;  2OQ6 A;  4CPB A;  3T4V A;  5FO7 B;  2GNT A;  1RUG 2;  2CTV A;  4HK9 A;  1RIN A;  1CZT A;  4QAW A;  2HWE 1;  4WVM A;  4XIO A;  2WL1 A;  5DAV A;  3UL2 A;  1ACC A;  1EY2 A;  2O1Q A;  3ILF A;  4Q4Y 1;  2HKX A;  1CJD A;  4KWK A;  4XFF A;  1ULE A;  5I8Y A;  2AEN A;  3BIW E;  5IK5 A;  4J6G A;  2RR1 2;  5D1I A;  1PVX A;  5L7O A;  5LCW L;  3ZO0 B;  4CP0 A;  5F32 A;  4IEW A;  4K1Y A;  2B8M A;  4RFT 0;  4KGQ A;  2QQW A;  3VZL A;  3O1M A;  2VMF A;  2ARC A;  4GXL A;  2WWJ A;  1NLS A;  1JMU B;  1BCX A;  2QQU A;  4XET A;  1RUE 1;  4RS5 A;  3VGI A;  4XHX A;  3ZFG A;  4RSU A;  2HH9 A;  3DYO A;  3ITQ A;  5A7N A;  3TN9 2;  1AZD A;  4ZZ8 A;  1OQD A;  5E89 A;  3H3U A;  2W3J A;  3AX4 A;  4AOC A;  1DDL A;  4NVP A;  4E8C A;  5C8C A;  4XE9 A;  2GC3 A;  4IEX A;  4MXW A;  1CVN A;  5KXC A;  4RR3 A;  4WVZ A;  3I2O A;  4WZF A;  5CU1 A;  3EXU A;  1HDK A;  5DAB A;  3ATG A;  2WRA A;  2HEV F;  3PIJ A;  3B9C A;  1HV1 A;  3PUR A;  2VMG A;  4UFK A;  4UT5 A;  1FPN 2;  1CAX A;  4CZS A;  1DYP A;  5BNN A;  2XBO 3;  3F2Z A;  1GP5 A;  1OUX A;  4NHL A;  3D6E A;  4JTO A;  3ZYP A;  2YDE A;  4XUN A;  4QXC A;  3LQC A;  3WHU A;  1W6N B;  4YZ3 A;  2V4A A;  3RZZ A;  2WA4 A;  3H0O A;  3QLQ A;  4OHX A;  5T5J A;  3TEZ A;  4F7Z A;  2P2K A;  3B69 A;  4IE5 A;  5LAS A;  1NCR B;  2WZR 2;  1CAV A;  1HQW A;  3AMN A;  2FDI A;  1CAU A;  1IPS A;  2PHD A;  3ZFF C;  1APN A;  3GHM A;  4ORF A;  4XTP A;  2UY9 A;  5C6C A;  1US2 A;  4E4H A;  3HBZ A;  3J7H A;  4UFI A;  3FZ3 A;  3WNN A;  4XIK A;  4Z8B A;  1H4G A;  2VZO A;  2XLF A;  3UJO A;  1EYB A;  4BU2 A;  5CG8 A;  1BZW A;  4FAG A;  5ACA 2;  1QXR A;  3NAP C;  3OD4 A;  4LIV A;  4PIX A;  2IFR A;  1KDK A;  4LBO A;  2WC2 A;  4L9B A;  1X8E A;  3V0B A;  2WAO A;  3AMM A;  1SDD B;  2JD4 A;  4PLN A;  4XAB A;  4URA A;  4XAC A;  1W3V A;  2SBA A;  2DU1 A;  5FYV A;  1MPX A;  1LEM A;  1UZY A;  2OT7 A;  4IW3 A;  4XFC A;  3T09 A;  2RMU 2;  3NNF A;  3OGR A;  4FPK A;  4RQP C;  3ZPO A;  3T30 A;  5KHH A;  1SPP A;  4B4P A;  1RMU 2;  1JHJ A;  3JQW A;  1XSQ A;  1CPN A;  5D2A A;  1WCQ A;  5FY4 A;  4AK3 A;  3I3B A;  2YZ4 A;  1QJX 2;  1Z7S 3;  4YLZ A;  2GH8 A;  3D8C A;  3MW3 A;  1PGL 1;  2Y8K A;  1YIF A;  1ZZ6 A;  4UFM A;  4C0B A;  4Y24 A;  1XE8 A;  3AYC A;  1PO1 3;  1AL2 2;  1PGW 1;  3ZXG A;  1W8F A;  3ZYJ B;  5AFB A;  1I5P A;  3H7Y A;  1FXZ A;  1FMD 2;  5E1R A;  5FZB A;  4AVV A;  5GM0 A;  2Z4F A;  2VVD A;  2NYY A;  4N43 C;  2FQP A;  4G3Y C;  2YPD A;  4YFW A;  2ZEZ A;  1SCR A;  1W0O A;  3PTR B;  5FKB A;  4AQ2 A;  4SBV A;  4HOO A;  4BOW A;  1YYN A;  4MXV A;  4DFS A;  3MF9 A;  2ZKL A;  4JRA A;  3A7Q A;  4KU8 A;  3POJ A;  3WW3 A;  1OI6 A;  5GZD A;  3K4A A;  5A3P A;  3SH4 A;  2RHP A;  4QQ2 A;  2D43 A;  3ZXD A;  4YFZ A;  2WT0 A;  3PUA A;  5FZI A;  2NM1 A;  1AYM 1;  1DHK B;  1HX6 A;  1VBE 2;  2K46 A;  2KM2 A;  3Q8B A;  3WQ0 A;  4CTE A;  3UET A;  1GQG A;  4IV1 A;  4U2A A;  3A0K A;  4XVH A;  1V6O A;  1US3 A;  3IAP A;  4OUE A;  5C9A B;  4AHX A;  1B35 B;  1OVP A;  2JDY A;  3KF3 A;  4JQR A;  3B7M A;  1VAL A;  3LA2 A;  4RHV 3;  5IVY A;  3LWC A;  3ZFE C;  4XXP A;  5FQ0 A;  2YC0 A;  1BJQ A;  1R1A 3;  4COZ A;  1TQ5 A;  4AL9 A;  3I2F A;  5LBE A;  1I3H A;  1NX9 A;  2ZGL A;  5FXW A;  1LOE A;  2QBX A;  4XMA A;  4CCE A;  3NL1 A;  1V6N A;  5A3L A;  2ZCW A;  4CU9 A;  4UF0 B;  5JOX A;  1WW4 A;  2W52 A;  4ZKT B;  1QJZ A;  3AJY A;  1CIW A;  1PVC 2;  3NWK A;  4ZXK A;  5BNO B;  1VRB A;  1YHF A;  2DCZ A;  4GJY A;  3KVB A;  4J1W A;  1GQH A;  4XPV A;  4BQ1 A;  4QD2 A;  1JH5 A;  2GME A;  3A22 A;  1KQR A;  1UU6 A;  2BGP A;  5JSO A;  5D21 A;  3M8L A;  1RUD 1;  2Y6L A;  5FZ4 A;  4MG2 A;  3OYW A;  4MZU A;  4HPK A;  4CDW C;  1O4T A;  4EV0 A;  1VAM A;  4RGG A;  1OVS A;  5FBJ A;  4YW3 A;  1L7L A;  5GLV A;  1VMH A;  3ILN A;  3M7A A;  3O12 A;  1W03 A;  4COW A;  1GKB A;  4LBM A;  1AHS A;  1GZ9 A;  3MIE A;  4C91 A;  3LGR A;  3RJ2 X;  3S5Q A;  5K9Y A;  5FMD A;  1IZ3 A;  1V0A A;  3H42 B;  3J26 N;  3RS6 A;  1W6P B;  4P14 A;  2Z69 A;  3H9A A;  2A70 A;  5FLI A;  1I5Z A;  4HVQ A;  1VMJ A;  3JU9 A;  3I2K A;  1AR7 3;  5E88 A;  4F3J A;  1X7N A;  4Y1Z A;  1NLR A;  4QQO A;  1UAI A;  1OPM A;  1C8M 3;  1BBT 3;  1ND3 C;  3LIG A;  2J1R A;  2HWC 1;  1FT9 A;  4OFG A;  5F3G A;  4KWL A;  2VE1 A;  2BZD A;  3LDR A;  4DO0 A;  3TRS B;  3Q8E A;  1A6C A;  1VLN A;  2R49 A;  4Y4Y A;  4YW4 A;  3USU B;  2ARE A;  4LUK A;  1UX7 A;  2RDR A;  5EJ1 B;  2J1A A;  5C3R A;  1LGN A;  3AKP A;  1IOA A;  5C3P A;  1AXY A;  4Q4X 1;  4XBL A;  2ZAA A;  3DKW A;  3MIF A;  3VD3 A;  2XH6 A;  4CDU A;  3GJB A;  2R07 2;  4CXY A;  1OKQ A;  1D0H A;  1WUV A;  1VBC 2;  3WQ7 A;  1NQJ A;  2PAM A;  4WM8 A;  1VRH 1;  1ZNP A;  2BQP A;  5F1R A;  1Q8V A;  1V6J A;  2BW8 A;  3J8F 1;  3PME A;  3PUH A;  2BGO A;  4KG0 A;  4BQY A;  1XNK A;  4CUC A;  1N1T A;  4LBJ A;  2EVX A;  3NJX A;  1OQ1 A;  4FPF A;  2ZHM A;  4KBB A;  2R1B A;  2ZHK A;  3NV2 A;  2YBP A;  3H7J A;  4GIQ A;  3H8U A;  3OUI A;  5BNQ A;  3M3E A;  3IMN A;  4N8M A;  4XFG A;  5A3U A;  4N53 A;  2E7T A;  2PN5 A;  1BEV 2;  4LOR A;  1CPM A;  4Q2F A;  3UGG A;  4M4R A;  2VZT A;  5H9Q A;  1CJP A;  1HB2 A;  1G9A A;  1K12 A;  1ZYB A;  3P3N A;  2RM2 2;  1VBD 1;  3IWZ A;  4JTN A;  3AK0 A;  5LEJ A;  1CZV A;  4JVA A;  2A6V A;  2B4K A;  1QOO A;  1W39 A;  2GC0 A;  4XOG A;  5FY8 A;  2BUK A;  3MHZ A;  4LKS A;  3LZZ A;  5LK5 A;  3RVH A;  1F15 A;  3VBR A;  3OCP A;  2YY1 A;  1W9T A;  2WS9 3;  5K0U B;  3RZG A;  1WLD A;  1DZR A;  1F2N A;  1LEC A;  1V70 A;  4RN5 A;  3AB0 A;  5AVP A;  3S6P A;  1COV 2;  5JXG A;  5GLT A;  3ZXE A;  3OGV A;  1RED A;  2Q1F A;  2VM9 A;  5EV7 A;  2VD7 A;  2V72 A;  3FFQ A;  4ES9 A;  1V6K A;  4A6S A;  4D0Q A;  1A34 A;  1ASJ 2;  4AI9 A;  4DXR A;  2G9F A;  3ZFF B;  5L73 A;  3ASI A;  3Q8A A;  5IAX A;  1AXK A;  3N9L A;  3ZN6 A;  2HYK A;  4BYY A;  1RUJ 3;  1MS4 A;  4S2H A;  3FJS A;  5CFC A;  3R6S A;  3ALQ A;  3QH6 A;  4DRR A;  2E53 A;  4DXZ A;  2QCS B;  3O0X A;  2BNN A;  3WVJ A;  2VC9 A;  2FMD A;  2VZU A;  3DCQ A;  3NAP B;  3SKV A;  1IKP A;  1MAC A;  1UYY A;  1S0D A;  3OUH A;  2WII B;  3PTY A;  4B29 A;  4B8E A;  2JDZ A;  2NMN A;  1GIC A;  1H8V A;  4O65 A;  2NQY A;  2EXH A;  3I3Q A;  2NLR A;  3CZJ A;  2W68 A;  4HVR A;  2RS3 3;  3IDB B;  1GP6 A;  5H9S A;  2A1X A;  2C9A A;  4IGO A;  3OBT A;  3AP7 A;  3HWJ A;  3M4F A;  4ZU4 A;  2HWD 1;  1TE1 B;  4TSV A;  4NHY A;  1PX3 A;  2AR6 A;  3M3I A;  5TSW A;  5F7U A;  1LHN A;  1WLT A;  3CJI C;  2C24 A;  4YGB A;  1HB4 A;  1ODM A;  2VXR A;  5F8P A;  5CIR A;  5A80 A;  3J4U H;  3VBS A;  3FLR A;  1MS8 A;  4YNI A;  1JOJ A;  2PFW A;  4EWA A;  4CP9 B;  3EHK A;  2P3J A;  2PEL A;  3DKQ A;  2X53 S;  4COV A;  1UYZ A;  2LUW A;  5ABJ C;  2B5H A;  2KR2 A;  2HWB 1;  2PMW B;  3BB6 A;  1SLT A;  2ZBJ A;  1ZZ9 A;  2C26 A;  5LK7 B;  4MH0 E;  4FTE A;  1F8V A;  4AG4 A;  2OXB A;  4Q4V 3;  1HIX A;  1N1S A;  4JKM A;  4M3C E;  5I93 A;  3HNY M;  3LE0 A;  4PIZ A;  3NV4 A;  5FOJ B;  2GAU A;  4AAX A;  2RV9 A;  1WCS A;  1KJL A;  1SHW B;  1UKG A;  2WFF 1;  1QMJ A;  2YRO A;  4N43 B;  4I01 A;  2J1E A;  4IQP A;  4N90 A;  3PUI A;  3V65 A;  2E31 A;  3T3Y A;  4K1Z A;  3JD7 1;  3B01 A;  3VD5 A;  5C3O A;  5FO8 B;  4AVT A;  1EAH 1;  3OD0 A;  1N3O A;  3WDU A;  1GLH A;  3NNL A;  2ATF A;  4ISR A;  5GZC A;  2Z5W A;  4Y20 A;  4AF9 A;  3AP9 A;  3AZZ A;  5AC9 1;  1GZC A;  1DF0 A;  3MBW A;  4OMD A;  4NN0 A;  4PHZ A;  4QM8 A;  5EJ3 A;  4UFJ A;  3USS A;  2P6C A;  4ONU A;  3SH3 A;  5HPO A;  1E5S A;  1Y9G A;  2QZ3 A;  2GN3 A;  3GNE A;  2R1D A;  4MHR A;  1WD3 A;  2QFE A;  3MW4 A;  5EP9 A;  4DIQ A;  2XWB B;  5FZ7 A;  5I0T A;  3WCR A;  2HWE 2;  3H1W A;  2YC2 A;  4Q4Y 2;  2BGC A;  1QJU 2;  3MIC A;  4K3U A;  2EAA A;  1Q56 A;  4O7X A;  2HYX A;  2TBV A;  4YVW A;  1PM7 A;  2UWC A;  1JYX A;  3DGT A;  4Z07 A;  3ZFE A;  1W6M A;  2KA3 A;  1JZ8 A;  2Q1M A;  2VOW A;  4V1P A;  4LR4 A;  2R04 2;  5FMO S;  2BP6 A;  4QX2 A;  2XQR A;  1LED A;  1RUE 2;  4QPG B;  3ME2 A;  3MLK A;  3UNP A;  5T54 A;  4FVV A;  5IK8 A;  3D0S A;  3GXU A;  1VBA 1;  1VB4 A;  1JS9 A;  4LKE A;  4DY3 A;  4CDW B;  4AGV A;  3ENR A;  2WO3 A;  2QE3 A;  4GH4 C;  3OUJ A;  4GKY A;  5CNA A;  3WR0 A;  3B93 A;  3PHM A;  2PHT A;  3FE5 A;  2FD8 A;  1ZRE A;  1Y43 B;  4Q27 A;  5HCB A;  3TYJ A;  1U5X A;  4P9J A;  1W6Q B;  2EAL A;  1GU3 A;  1RL3 A;  2ZS6 B;  2WWU A;  3CLP A;  3ZPY A;  2V5D A;  4UW6 A;  4XCB A;  2ZTN A;  5FZK A;  2A73 B;  1IPK A;  1FNY A;  1DQ0 A;  1OF3 A;  2YU2 A;  2WA3 A;  3RI9 A;  5A33 B;  5F3C A;  5JZG A;  4I2O A;  2WNV A;  1VP6 A;  1UN1 A;  1ZBE 1;  1RUC 2;  3UT0 A;  2XVK A;  3IDA A;  5FZL A;  1UYP A;  5K7P A;  1Z0H A;  5IVE A;  2QDN A;  5A7W B;  4TTG A;  4QB6 A;  2Y6J A;  3FMG A;  4HLT A;  4MLO A;  1CX4 A;  3FX3 A;  3I49 A;  1KS5 A;  3HEI A;  4BA6 A;  3BI3 A;  3O1T A;  2WIN B;  4QPI C;  1ND3 A;  1DLC A;  3TNQ A;  3KMH A;  1A8D A;  4KBZ A;  3ZSL A;  1I1E A;  5A3M A;  3VZM A;  3TOJ A;  3I2J A;  1WZX A;  3NMB A;  2K9Z A;  2VPV A;  3ECQ A;  2CV6 A;  3OB8 A;  5KHJ A;  4LKD A;  4A41 A;  2PLV 1;  3RMY A;  3KV9 A;  5L7O C;  2XL9 A;  4WM7 A;  5A3N A;  1GOG A;  1F5F A;  4NO4 A;  4GAL A;  4QKB A;  5IUQ A;  3ZXL A;  3HMY A;  5FPX A;  2WT2 A;  5FWE A;  4IE6 A;  4MVT A;  1XYP A;  4Y5S A;  1X82 A;  1JBC A;  1UPI A;  4RFR B;  4A7Y A;  4P02 B;  2V5Y A;  2ZX1 A;  3WNM A;  4AEM A;  3ZFG C;  5CFD A;  1JZ4 A;  4YW5 A;  5F2W A;  2IVJ A;  1AR8 1;  1Q5O A;  3LIH A;  3WW2 A;  2E7A A;  5FP3 A;  1KFU L;  2VQT A;  4KMQ A;  3U11 A;  2VOK A;  1XBF A;  2VMD A;  3P5B A;  5J98 B;  1RUH 3;  3OGS A;  4IE0 A;  5C8C C;  3O1P A;  2LRP A;  3E6D A;  4PT6 A;  4RR3 C;  2Y6H A;  2YFZ A;  4E2G A;  3WF0 A;  1JZ7 A;  2JG8 A;  4FO9 A;  3JBG 1;  4QKF A;  4XYX A;  2WLP A;  4TYS A;  2YB7 A;  1W2T A;  2DUP A;  2PYT A;  5CBL A;  1AYN 3;  1PGL 2;  1EPZ A;  1OKO A;  5BY5 A;  1UKR A;  5BNN C;  1H2N A;  1Y4W A;  5FZ3 A;  5LB6 A;  3WLU A;  1WBL A;  1AR6 1;  4HN0 A;  3KZ4 C;  3WXP A;  3ZM8 A;  1SCS A;  1FNZ A;  2OPK A;  3LA7 A;  1W2O A;  5E16 A;  3OEB A;  5FZ1 A;  1ULD A;  2CY6 A;  3WNP A;  1PMH X;  4LBK A;  5FO9 B;  5KXB A;  1GOF A;  2VQ0 A;  4ZU5 A;  1TMF 1;  4Q8L A;  3ZXK A;  1J84 A;  3H8R A;  2WWS A;  2WZ8 A;  4XJZ A;  4BDV B;  2QQI A;  4IES A;  2HWF 1;  2MEV 3;  4P5Y A;  4DS0 A;  1G6N A;  1R09 1;  2YFU A;  1RUG 3;  1AYM 2;  3JQX A;  4Q0V A;  2B7Y A;  2PHR A;  2TEP A;  2JWP A;  2XBO 1;  4C8D A;  4D7T A;  5BYN A;  5LA0 A;  3AC0 A;  3VDD A;  3WNK A;  2RR1 3;  1PIV 3;  2VZQ A;  2WQ4 A;  3BOD A;  1C57 A;  5FYS A;  3CJI B;  3VBH A;  4OZO A;  2VCA A;  2GDF A;  1TNF A;  4Z92 B;  2JEM A;  1J83 A;  2RDS A;  5FK8 A;  5T52 A;  3LD8 A;  4QHO A;  3TN9 3;  1W8U A;  1L3J A;  1AJO A;  3OOX A;  3S30 A;  4R9A A;  1AX1 A;  2XOM A;  3WG4 A;  4BQW A;  2JG9 A;  1V9U 3;  4M0N A;  4AR2 A;  4CDQ B;  1YXW A;  1CD3 G;  2ILM A;  2OS2 A;  4NRP A;  2WQ8 A;  4LBQ A;  4ATF A;  4DY5 A;  2H0V A;  4BM8 A;  1UMI A;  3AFK A;  2R06 2;  4LBL A;  3IPV A;  2W1S A;  3PUQ A;  3RZH A;  4GKX A;  1YEW A;  3W59 A;  2ZX0 A;  4BIF A;  3IDC B;  1UOG A;  4HVO A;  5EHD A;  3KQ4 B;  3F95 A;  3ZXF A;  3AMP A;  3CDZ B;  4XTM A;  1K3I A;  4IV3 B;  5F37 A;  3CZU A;  1WD4 A;  1GUI A;  1FPN 3;  2ZGK A;  3JZV A;  4GUL A;  1AR9 2;  1POV 0;  2MNG A;  3KT4 A;  2VTF A;  4UWD A;  4FTB A;  1OA4 A;  2ZMN A;  4CCN A;  2VBP A;  2W9X A;  3AZY A;  4FT8 A;  4V2W A;  4XQ4 A;  1XC6 A;  3FWE A;  4XAE A;  4BMB A;  5C5T A;  2QQJ A;  1URX A;  1QDC A;  3MW2 A;  2VMC A;  3OBZ A;  4O61 A;  4Y4R A;  3MPB A;  4GQ7 A;  1G86 A;  4NAO A;  4XF1 A;  5FKC A;  4N9H A;  2YHJ A;  2RE9 A;  2QQM A;  2WZR 3;  1Z7S 1;  2HWC 2;  3ACF A;  1TEI A;  4NMI A;  2FCV A;  2F17 A;  2QDR A;  1QOS A;  3GM8 A;  4QGM A;  4R8H A;  2VTX J;  4AWD A;  4LUM A;  1LOD A;  4A3X A;  4AQ6 A;  2ZGT A;  4IV1 C;  5HXM A;  4BQ3 A;  2PHL A;  3UKT A;  3NO8 A;  4Q4X 2;  1H1A A;  4HN1 A;  5JDB A;  1W06 A;  5ACA 3;  2HEY F;  1JN2 P;  5JWP A;  4XEZ A;  1GZW A;  3ILR A;  5FPL A;  3K3N A;  3ZMO A;  4CEW A;  1VRH 2;  1VMF A;  2GNB A;  3J8F 2;  1F31 A;  4FPJ A;  1TG7 A;  1ZVF A;  2OUH A;  2UWB A;  4G9S B;  2R30 A;  3CU7 A;  2G9G A;  2JDM A;  1S0I A;  2RMU 3;  4ASL A;  2A5Z A;  2E7Q A;  1FOD 1;  1DYO A;  5FMB A;  4XF0 A;  2IXC A;  1SLL A;  1AUY A;  2VTX A;  2K2S A;  5FPA A;  1F9K A;  1RMU 3;  4MGQ A;  2A6X A;  3SNM A;  2H6B A;  2BRT A;  2BBV A;  1UPS A;  4GH4 B;  2VNR A;  2HJI A;  4AI8 A;  1JTZ X;  1QWR A;  3UKN A;  3U1X A;  1HRI 2;  2F6B A;  1LOF C;  1QJX 3;  5FYI A;  3H1Y A;  3QBQ A;  2W1W A;  2DYC A;  4Q1P A;  4CVU A;  4XJU A;  5I0R A;  4HFS A;  4NHK A;  1VBD 2;  1X50 A;  5A3T A;  4W65 A;  1R1A 1;  2LM3 A;  3N7J A;  3A4U A;  4M3C A;  5DUV A;  1AL2 3;  4L99 A;  1FMD 3;  5FZH A;  3SEE A;  4Q5O A;  4FPG A;  1OFN A;  4V2V A;  2O0O A;  4Q29 A;  1MS3 A;  4L8Q A;  1XU2 A;  4FPO B;  4BH9 A;  2P34 A;  5FYU A;  3LEG A;  5FYB A;  1W04 A;  1OPO A;  5ANN A;  3E6C C;  3WG2 A;  1ND2 A;  2BEO A;  2JDH A;  2Z79 A;  5F3I A;  3VLB B;  1W2N A;  5FUI A;  3K51 A;  4K9S A;  4OCT A;  3TB0 A;  5A3O A;  3ZYG A;  4WVM B;  3TNP B;  4LK7 A;  1OLM A;  2P1B A;  4QPI A;  3ZR6 A;  3N4M A;  3MIG A;  1B09 A;  1JZ5 A;  5DUX A;  2JIC A;  2E32 A;  4HG6 B;  4CDU C;  4PIY A;  5DZG A;  5LA2 A;  4ARX A;  2EIC A;  5CKN A;  3NRU A;  4XDP A;  4WM8 C;  4XZP A;  5EYY A;  1O4Y A;  1W8Z A;  1LKN A;  1ZBA 1;  3AMH A;  4Q0U A;  4Y3O A;  3OY8 A;  4RS5 B;  3NKT A;  4CU7 A;  3ZFG B;  1BBT 1;  5T3N A;  5CAD A;  3SC7 X;  1ZRF A;  4JGY A;  4D8M A;  2HWD 2;  2Y6F A;  4FPE A;  4HZF A;  4LO5 B;  3VUO A;  1FAT A;  5LRR A;  1R08 2;  2X10 A;  1NZC A;  3WDW A;  4EQV A;  4UW4 A;  2W46 A;  3CMG A;  4N53 C;  5C8C B;  3POW A;  2ORZ A;  1UOB A;  2VO5 A;  1HV0 A;  1PVC 3;  1X8M A;  4LOT A;  2VQU A;  1QXJ A;  4MXW B;  1AL0 G;  3MEP A;  3H1M A;  3AVR A;  4M4P A;  4RR3 B;  4CXX A;  4QB2 A;  5IHR A;  3PVO A;  2XON A;  4C1W A;  5F5Q A;  1XND A;  2JIG A;  1R64 A;  3JB4 C;  4QB1 A;  4YM0 A;  1UU5 A;  4L0P A;  3M2M A;  1BK0 A;  4Q4W 1;  5J09 A;  5FZ8 A;  4GD4 A;  1IS4 A;  3HPN A;  3VKF C;  1YQ2 A;  2JB4 A;  3ELN A;  4UAP A;  1QJY 2;  3WT3 A;  1RUI 1;  5BNN B;  5FR3 A;  3VBR C;  5EPA A;  4TLG A;  3ON7 A;  4KG8 A;  2A3Y A;  3K4D A;  1YQC A;  1XSR A;  2WFF 2;  3WP6 A;  5J36 A;  1LOG A;  3RG0 A;  3ZOI A;  2P3Y A;  1QQP 3;  4CCJ A;  1W8O A;  4LHK A;  4NOT A;  1W9W A;  1CAV B;  1JI6 A;  4FBF A;  1CAU B;  3MUZ 1;  4W6W A;  4Q1R A;  3C7E A;  1EAH 2;  1JZ6 A;  4MGT A;  1I9R A;  2P37 A;  1SBD A;  5E8A A;  1PMI A;  2VUC A;  4CUG A;  3ES4 A;  5FP9 A;  5J37 A;  2XLG A;  5CFC C;  4GWM A;  4Z2A A;  4YGC A;  4CEY A;  5AC9 2;  2NN8 A;  5ANQ A;  2DCJ A;  3I2I A;  5FYZ A;  4KNC A;  1IS6 A;  3UYJ A;  1Y3T A;  3AMQ A;  1ZX5 A;  3K46 A;  5FJH A;  1RXG A;  5JOZ A;  3O1R A;  2R07 3;  2AUY A;  3PU3 A;  2JDK A;  5A32 A;  2PQS A;  1VBC 3;  1LTE A;  2OX0 A;  3N9O A;  1PK6 B;  5FZG A;  4XUP A;  2D3S A;  1WCK A;  4NPM A;  1E5H A;  3ZN4 A;  3SMH A;  4DOU A;  4PDW A;  2BNO A;  2D7F A;  2WNU A;  5FY5 A;  1QNY A;  2WN3 A;  3VBS C;  5CKM A;  4XUT A;  5C8W A;  3T0D A;  5K8S A;  3OG2 A;  3MIB A;  1SZB A;  3I59 B;  4BQ4 A;  3KHB A;  3DXU A;  4KI5 M;  3T0B A;  2F4P A;  1XNA A;  1DQ1 A;  1BEV 3;  2ZGP A;  4MGS A;  3V0A B;  3POE A;  1VBA 2;  2VZV A;  4U36 A;  3WV6 A;  1JW6 A;  2O8O A;  2W5F A;  3EQE A;  3VBF A;  4LUL A;  3MLL A;  4AVC A;  4LA3 A;  2RM2 3;  3K77 A;  2RS3 1;  3O1S A;  4GB3 1;  1H1M A;  3CHX A;  2PHU A;  1IS5 A;  2D5H A;  3SXW A;  2WYF A;  2DWR A;  4BE3 A;  2YG0 A;  4FSJ A;  4BIS A;  2VAU A;  1NE6 A;  2VW1 A;  3BYW A;  1ZRR A;  5FYT A;  4BZ4 A;  4EN0 A;  2E63 A;  2KD7 A;  1VE0 A;  3WF4 A;  5IYY A;  1GMM A;  1COV 3;  2ES3 A;  4QX7 A;  3VDC A;  3WCS A;  4DUV A;  3RSJ A;  5LBF A;  3RZJ A;  5GZF A;  2D6K A;  3D82 A;  5F9T A;  2SLI A;  3OGJ A;  1KFX L;  3FBM A;  4C1X A;  1D4M 2;  3ZLI A;  1ASJ 3;  2Y38 A;  4XFI A;  1SLC A;  2P3I A;  1PX4 A;  3IB3 A;  1NE4 A;  1OUR A;  2C5D A;  2VW0 A;  2ADD A;  1XB9 A;  1AXZ A;  2FCT A;  3U4X A;  4ISQ A;  4IV1 B;  1HB3 A;  2ARB A;  3VBU A;  1OSG A;  1ZZ7 A;  3QCW A;  3KQR A;  4Y1V A;  4BJ0 A;  1GWL A;  3HBK A;  2GSY A;  4OYU A;  3J7N A;  1WME A;  4IXL A;  5L9B A;  1Q43 A;  1W0P A;  4FPY A;  5FQ0 B;  4FFF A;  5FFO C;  5T55 A;  4QQH A;  1DGL A;  3PVB B;  1PGS A;  3RZK A;  3LEM A;  2HLE A;  4YVW C;  1LHO A;  3N3H A;  5DMY A;  2JX9 A;  1YJK A;  2DCY A;  2VVF A;  4EN7 B;  1MQT A;  5JUV A;  3UKV A;  5L9V A;  1IKQ A;  4LOS A;  4MHU A;  2HBT A;  4QQP A;  2OYZ A;  5JSR A;  5BNP B;  4XIL A;  1QJF A;  4XDO A;  4GWJ A;  3IAQ A;  4KQ7 A;  3DYP A;  3ZVX A;  3A21 A;  1W28 A;  3MZH A;  5FP4 A;  1AR8 2;  4A42 A;  2DFC A;  2IZW A;  3TEW A;  1H2L A;  3EYP A;  4HPK B;  3SIS A;  4AGG A;  2VY0 A;  4AQS A;  1I6X A;  4CU8 A;  1XNB A;  1K5J A;  2WO1 A;  3JB8 A;  2YGM A;  3R05 A;  1OQE A;  3INA A;  3KB5 A;  1NQD A;  3B00 A;  2RVA A;  4FXK B;  4W4Z A;  3KSC A;  1LOF A;  3VL9 A;  1UMH A;  3JBG 2;  4AFA A;  1PO2 1;  1XXN A;  3KT7 A;  4OVE A;  3SLI A;  3GZU C;  4AVA A;  3MFA A;  2XDV A;  1BMV 1;  1DLL A;  3WZ1 A;  3BPS A;  5JZG C;  1B35 A;  5CAZ A;  3PNA A;  2WNV C;  2EIE A;  3WY6 A;  1YI9 A;  2ZAH A;  1JYT A;  2F4L A;  1Y9Q A;  3GCW A;  1AR6 2;  4MGK E;  3FBY A;  1NUK A;  2WDB A;  1JYV A;  2LTN A;  1OOP C;  2GC2 A;  4ITC A;  5HV4 A;  3U0Z A;  2ZZJ A;  3AL6 A;  2W1Q A;  2ET1 A;  3ETP A;  5FUN A;  1SLI A;  2WNE A;  2OUJ A;  2D97 A;  2XB6 C;  3APB A;  2W87 A;  3ZYH A;  2X09 A;  2XJT A;  1WA4 A;  4QHZ A;  2ZEY A;  4PJY A;  5FP7 A;  5C4W A;  2QQP A;  4DXS A;  3LF7 A;  1SFN A;  4CDU B;  2RG4 A;  4EZH A;  1TMF 2;  3E5Q A;  1QNW A;  5I8S A;  4WM8 B;  5HXV A;  2HWF 2;  3B02 A;  4NE9 A;  4EE2 A;  4WM7 C;  1R09 2;  5C71 A;  3H8X A;  4MGI E;  3O0V A;  2ZGQ A;  2D3R A;  2HWE 3;  1MR5 A;  2GMM A;  4B4R A;  1QJU 3;  3G7D A;  4XF9 A;  2CDP A;  4FOV A;  4D7S A;  4OI1 A;  4GMP 3;  5LRS A;  1AX2 A;  3RYR A;  1J1T A;  2WLQ A;  4AXO A;  2ZOE B;  4YM2 A;  1O4Z A;  1MS9 A;  5CFD C;  2I74 A;  2BVB A;  4OI2 A;  3DXT A;  4MSV A;  1KIT A;  4LT5 A;  4LE4 A;  4YPJ A;  1V6L A;  2R04 3;  1BQP A;  4FPH A;  4HON A;  1C5I A;  3ABZ A;  4R4X A;  1RUE 3;  5LBC A;  3WX5 A;  4MGY E;  3KM5 A;  2A6Y A;  2AEY A;  4JZR A;  2RJ2 A;  3W21 A;  3WDX A;  4DIN B;  2JDN A;  2X05 A;  1OXC A;  4JDN A;  2D98 A;  2DDU A;  2BU9 A;  1PZ7 A;  1ODN A;  1X9P A;  3ETQ A;  2JG8 C;  4LPL A;  5F5I A;  4CCL A;  3B3Q E;  3T2O A;  1JYI A;  3FN9 A;  1N1Y A;  3VBR B;  3FHI B;  1MZF A;  4NIG A;  4UXA A;  1O5U A;  3KF5 A;  3KV6 A;  1K5M A;  5FXZ A;  2FZ2 A;  2WBK A;  1C1L A;  2J1V A;  3KCY A;  3POF A;  4NRO A;  3ZSM A;  1JZ2 A;  5FLH A;  1VBB 1;  1UWW A;  4HKL A;  3J7L A;  4ES8 A;  5JXH A;  4IET A;  2R0F A;  1RUC 3;  2R16 A;  1W6O B;  1MZ6 A;  3ZN6 B;  4JDO A;  1ZA4 A;  2JE8 A;  1O5L A;  4YVS A;  3HVD A;  4CSW A;  4ZZ5 A;  1OBN A;  1JYN A;  1Q8S A;  4QQL A;  3GZT B;  2CHH A;  1RXF A;  1U0A A;  3HQR A;  4B4Q A;  1O8S A;  4DRV A;  2B39 A;  3MFC A;  1Z7S 2;  3SCH A;  5JPM B;  3GDB A;  4FI9 A;  3RDI A;  3I97 A;  1AYN 1;  4BPZ A;  4PQQ A;  4DEQ A;  5A1F A;  1MEC 1;  2Y64 A;  4AED A;  2W2I A;  2Y6K A;  4QPY A;  3O14 A;  4DZG A;  4JV4 A;  2YUE A;  3AYD A;  3VDD C;  3WDV A;  1G8W A;  1H4H A;  3AXE A;  4AZZ A;  2ZGM A;  4QGN A;  4BLI A;  1XU1 A;  1WBF A;  3VBH C;  4A2U A;  1NAE A;  1U5Y A;  2VR4 A;  3KT1 A;  1C8N A;  1ZRI A;  5K0U A;  1VIW B;  5IVB A;  4UBH A;  2DBN A;  2TNF A;  4QX5 A;  3VBS B;  4A6O A;  1YUD A;  1NA1 A;  5A6Q A;  2IFW A;  4RQP B;  5GZE A;  3VZJ A;  2NMO A;  4FP3 A;  2ET7 A;  2IXI A;  2RS1 1;  4CP2 A;  3SCG A;  1H6Y A;  3CEW A;  1S0C A;  1LHV A;  1FOD 2;  2JG9 C;  1RUG 1;  1G9B A;  3LPG A;  5FBZ A;  5A7Q A;  1CAW B;  3TEY A;  3R0R A;  1ENS A;  4AAP A;  5C3S A;  5JIU A;  2MHF A;  1PIV 1;  1LHW A;  1STM A;  2QQO A;  4IEU A;  5CKQ A;  5CEH A;  2UYA A;  1T6G C;  3UGH A;  2X5I A;  4E4D X;  4XMI A;  1NY7 1;  1RVF 1;  2L9L A;  4YGD A;  3RQ0 A;  1ULC A;  1PM4 A;  1R1A 2;  1LGB A;  3PLQ A;  4L2N A;  5L19 A;  3BPZ A;  1RTV A;  4BIO A;  4FFG A;  2ARA A;  3O7O A;  4FQZ A;  4BQ2 A;  1REF A;  2CWS A;  4CUB A;  2WR9 A;  2UUR A;  4LLO A;  3Q8F A;  2WZE A;  4OLL A;  5F3E A;  3WQ1 A;  4AFM A;  5JOW A;  3VZO A;  5KBF A;  1HXS 1;  5H9P A;  5I0S A;  3KS7 A;  4ARY A;  1V9U 1;  2WKK A;  3CBN A;  4DQA A;  5EIY B;  2RDQ A;  4YM1 A;  3ZDS A;  1QDO A;  4QGL A;  5FPZ A;  1G9F A;  3IT8 A;  3I2G A;  3GCX A;  2E26 A;  2P17 A;  1MS5 A;  3LSD A;  4NIA A;  3VB9 A;  1XRU A;  1UOF A;  1WCU A;  3ZYB A;  1SAC A;  1HRV 1;  4LO6 B;  3I8T A;  2QQL A;  4K40 A;  2WAA A;  4AI0 A;  3KVA A;  3AVS A;  3NV1 A;  1AYM 3;  2PHF A;  1FPN 1;  4YW2 A;  4NPR A;  3ZN5 A;  4YVW B;  1JYW A;  2LS6 A;  1CWP A;  1LU2 A;  4BXS V;  3RYK A;  4QDR A;  2FDK A;  2Q0A A;  4LIT A;  3ZFE B;  4CEW C;  5FYH A;  1JOP A;  3WUD A;  4CPB D;  4FFH A;  1ZBA 2;  1H1I A;  4QX3 A;  1YQ8 A;  1WGP A;  3LSE A;  4Q0Q A;  5DG1 A;  1JUH A;  4M3C F;  5C5U A;  1BBT 2;  5FY0 A;  4AEJ A;  1UOJ A;  3OBR A;  3H3Z A;  4R9B A;  1RC6 A;  3NJZ A;  3U07 A;  3I7D A;  1XQN A;  3PJY A;  2DTY A;  3MIH A;  4FOY A;  4JAA A;  3S57 A;  2BFU L;  5J1X A;  1XPW A;  3AZV A;  3GBW A;  5LW9 A;  4BHP A;  4YG0 A;  2A6W A;  2W95 A;  4UFL A;  5FAX A;  1RUF 1;  4J25 A;  5FOB B;  1WKY A;  3FFZ A;  4NID A;  1ST8 A;  1ZZ8 A;  2W91 A;  4LO7 A;  2EXJ A;  3CKH A;  3URF A;  3ZKU A;  2R06 3;  1OD5 A;  3PJQ A;  4J1X A;  1HW5 A;  2TUN A;  5JI9 A;  4Q4W 2;  5EXO A;  3C2U A;  4GWI A;  2G19 A;  2JDA A;  3I4I A;  5JZG B;  3KV5 A;  5KWR A;  2Q5T A;  3ZKY A;  1RUI 2;  2QJV A;  1UZZ A;  2XKO A;  2B42 B;  1QH7 A;  5DDJ 1;  1S2K A;  1KGY A;  1LNS A;  1YWK A;  1RB8 G;  3VD7 A;  1S0B A;  1AR9 3;  4XFB A;  5JLV A;  1GBG A;  3V56 A;  1LGC A;  3SIT A;  5T5L A;  5BPX A;  1BLZ A;  1GAN A;  1RMU 1;  1CR7 A;  1NG0 A;  3H50 A;  4HT1 T;  1ND3 B;  4Y1Y A;  1ND2 C;  1WLW A;  5FWJ A;  2A3W A;  1TME 3;  4N7I A;  1QJX 1;  3LA3 A;  1OOP A;  2B46 X;  1SQ4 A;  2VBB A;  5CZK A;  2VCC A;  3DV8 A;  3DN7 A;  2ZGN A;  4K20 A;  3KLS A;  2RS5 3;  1EV1 3;  2CNA A;  5D8A A;  2GMP A;  4Y22 A;  3BUC A;  1AL2 1;  4WM7 B;  4IL7 A;  4JGZ A;  5LY2 A;  1RHI 1;  1FMD 1;  4AQT A;  4NR1 A;  4IEV A;  1ENR A;  2ARX A;  2Z2S B;  4IGP A;  2GC1 A;  2QUO A;  1PHM A;  1SFY A;  5CIS A;  3W9A A;  1VRH 3;  4QDQ A;  3TBD A;  1YFU A;  1DGW X;  3J8F 3;  4JGY C;  3ZYF A;  1KEX A;  1UY2 A;  4M0H A;  1DGR N;  4UYB A;  5EQU A;  5GLZ A;  2XUE A;  2D6M A;  1C4R A;  1IG3 A;  1VAV A;  1WW7 A;  3CIH A;  3QAC A;  3X29 B;  3ST7 A;  1CGP A;  1N3P A;  4OHV A;  3IIA A;  4X6Q B;  1HJF A;  3KCC A;  3VKL A;  5DZF A;  3AL5 A;  4YWA A;  4HXC A;  4P9G A;  4CDX C;  5FJK A;  4JHT A;  4BQX A;  5LZ6 A;  3POI A;  4LHN A;  4D6Q A;  2YYO A;  3BU7 A;  1CQ9 A;  3AP4 A;  1LOB A;  2JG8 B;  5FY7 A;  5HCA A;  3WUC A;  2C9K A;  2HEW F;  5IFP A;  2R7E B;  4R9D A;  1G9D A;  1GZT A;  2JIJ A;  5IW0 A;  1HRI 3;  3ACG A;  1O3T A;  4AEK A;  2ZEW A;  3ORJ A;  4P5H A;  1JU3 A;  1NCQ A;  2Q8D A;  2V73 A;  4YZ1 A;  4KL1 A;  1VBD 3;  1S1A A;  2LW8 A;  4GB3 2;  4JKL A;  5JSP A;  2JKB A;  4UBG A;  5FYM A;  4RGK A;  4Q0S A;  4YM3 A;  2ENR A;  4WVV A;  4P9I A;  5IAT A;  2JE9 A;  5FZF A;  1PGW 2;  5KXE A;  3NQH A;  5B4N A;  3WQB A;  1X9T A;  1C28 A;  3HNM A;  3L2H A;  1N47 A;  4AI3 A;  4Y1X A;  4BLJ A;  3VBO A;  1HLC A;  2OZJ A;  4LO4 B;  1UY1 A;  2RJL A;  1SBE A;  3SKJ E;  1UX6 A;  1UXX X;  4CEY C;  5IVF A;  1OC1 A;  1S0E A;  4ASM B;  5L36 A;  1JUI A;  1H2M A;  4E2Q A;  1D4V B;  4GJZ A;  3B5L B;  3KWV A;  2UWA A;  4AI1 A;  4ZHN A;  1J59 A;  1QQP 1;  2EIB A;  1SEF A;  2XGX A;  4RD7 A;  1A8M A;  4YZ2 A;  3T2P A;  1F5J A;  1MZE A;  4FTS A;  3FLT A;  4PDW C;  1C5H A;  5T5O A;  2BV4 A;  5T5P A;  3N7M A;  2WNU C;  2HWD 3;  2O8Q A;  3PDQ A;  5DQ0 A;  4LIU A;  1R08 3;  1UO9 A;  2AGS A;  3LEI A;  2DVG A;  4HKO A;  4HBN A;  4UOJ A;  3VHP A;  2IXH A;  3VV1 A;  4ATE A;  2JG9 B;  5IAV A;  1OA2 A;  4KU7 A;  3HD8 B;  5JOY A;  1SLA A;  4LBQ B;  1C3H A;  5ABJ B;  4AE2 A;  1TZO A;  3IPV B;  3D3A A;  5BUV A;  2E33 A;  2X8K A;  4LNV A;  3ZSE A;  3VBF C;  2R07 1;  1W8H A;  4YG3 A;  4QKD A;  2OKX A;  4AGR A;  4OI0 A;  1VBC 1;  1JHN A;  1NXM A;  3D0J A;  1CN1 A;  5IK4 A;  2IWG B;  4K8F A;  5FZE A;  5FZ0 A;  2XJR A;  1ENX A;  1S55 A;  4DEV A;  1RUD 2;  2WT1 A;  1QJY 3;  2D93 A;  2WJS A;  5DUW A;  2AAC A;  3PIG A;  3N35 A;  1ULP A;  2XLA A;  1PO2 2;  4QX1 A;  2B45 X;  2WFF 3;  1BMV 2;  3ACI A;  3POY A;  4BWO A;  2ZAB A;  4ZY9 A;  1O59 A;  2FDH A;  4YZ5 A;  2XJV A;  1EUT A;  1BEV 1;  2VZ3 A;  3W20 A;  1LR5 A;  3AXD A;  1ULO A;  1EAH 3;  2ZHN A;  4XXA A;  4FFI A;  1QKQ A;  4H55 A;  4LQR A;  1DCS A;  1ZZC A;  2VUA A;  2JB8 A;  2RM2 1;  4L11 A;  4YZ4 A;  3VBU C;  1HN1 A;  3E5U A;  3N7L A;  2B9U A;  2GZW A;  4FQ4 A;  5AC9 3;  3HJR A;  4S2D A;  4PQ9 A;  4CDQ A;  2GP3 A;  1PO1 1;  2AC1 A;  1GZW B;  4UW5 A;  1DGR A;  4CEW B;  4JC1 A;  1UF2 C;  4CE8 A;  4W8J A;  2E51 A;  1H2K A;  1REE A;  2YMZ A;  1MQT C;  4IV3 A;  1CIY A;  2CGO A;  3DEM A;  3WNL A;  1DG6 A;  5A7S A;  4TWT A;  2FHR A;  1ONA A;  1V6M A;  2BOJ A;  4NUB A;  3U78 A;  2JDP A;  3IKW A;  3WF3 A;  2ZJC A;  4CCM A;  2CGP A;  2WO7 A;  2VOV A;  1VBA 3;  2D3P A;  1IG0 A;  2GND A;  3TEX A;  1RIR A;  4NHX A;  5J48 A;  1NLQ A;  5DAP A;  3NV3 A;  4RL7 A;  1J58 A;  4XAA A;  4XUR A;  4Z82 A;  4RHV 1;  2IC1 A;  5JPN B;  3KGL A;  4L97 A;  4XJ8 A;  1UMZ A;  1B35 C;  2EAK A;  3K48 A;  3E97 A;  3EB7 A;  4XF3 A;  3WP4 A;  1OD3 A;  1E5I A;  5HV0 A;  5I91 A;  1QJE A;  4QU1 A;  5LA9 A;  1CZS A;  5JVV A;  3WNO A;  1VBB 2;  3ACL A;  1ND2 B;  5HCH A;  1YC6 1;  2W47 A;  1O3S A;  1D4M 3;  4MX3 A;  2P4E A;  2XKP A;  3KCX A;  2V09 A;  4QPI B;  3SEP A;  1YJL A;  5T50 A;  3ZIW A;  3I3D A;  2XXZ A;  3CL1 A;  3Q9O A;  2JKX A;  1RJ8 A;  3CJX A;  3PUS A;  5C4W C;  1H8T A;  1JZ3 A;  1WMX A;  2JD9 A;  2W1U A;  4M00 A;  3UGF A;  4D6S A;  5LWB A;  3RWK X;  3FHA A;  2ZHL A;  5A70 A;  1VBE 3;  5L7O B;  1MEC 2;  1FV3 A;  3OY8 B;  2DU0 A;  3LDB A;  5FRE A;  2W92 A;  4KH9 A;  2P3K A;  2QQN A;  2H0B A;  4XJ9 A;  4JGY B;  5FZO A;  2VNG A;  3H3L A;  5G05 L;  3S7E A;  3POG A;  1AR7 1;  4AFD A;  4COY A;  2JXA A;  2VME A;  3C7F A;  3LCP A;  1QH6 A;  3M3Q A;  4W50 A;  4Y33 A;  4QKN A;  4N7U A;  1C8M 1;  4EN9 B;  1DIW A;  3R4D B;  2YXS A;  3C7O A;  4WZC A;  3VL8 A;  3WF2 A;  2RJK A;  4OUS A;  1ZRC A;  1LAJ A;  3WOG A;  3DPR A;  4YW1 A;  3A0N A;  4NII A;  1NXD 1;  5KHI A;  2JEN A;  3MUY 1;  4ERO A;  4ZU7 A;  2A7A A;  2QVS B;  5KHK A;  2RS1 2;  3ES1 A;  4CDX A;  4B1M A;  2FBE A;  4H2A A;  1DQ4 A;  1G7Y A;  5FP8 A;  5LY1 A;  4PF1 A;  2DBI A;  1IPJ A;  1QJU 1;  4OMC A;  4GMP 1;  1HQL A;  1K5M C;  4PCR A;  5FXX A;  1PIV 2;  1MZ5 A;  2HWB 2;  3AJZ A;  3HT1 A;  3GBF A;  3OF1 A;  3JBG 3;  2EIG A;  4OHW A;  3BTZ A;  1Q3E A;  1CAX B;  2D6N A;  3AP6 A;  1NY7 2;  1RVF 2;  4Y1U A;  1O8P A;  3E5X A;  4EN8 B;  4TXW A;  2R04 1;  4EZ4 A;  4CYD A;  1HJG A;  3MPP G;  1WCD J;  4F83 A;  1UW8 A;  3IBM A;  4WV8 A;  2YU1 A;  1QIQ A;  1IHM A;  4LJH A;  1AR6 3;  4YVS C;  3ZSJ A;  1WW6 A;  3JD7 2;  4XBQ A;  5GJ6 A;  1W8T A;  1HXS 2;  4E8D A;  1GWK A;  5DXD A;  1V9U 2;  1R1Z A;  4CEY B;  5J3U A;  2CU5 A;  3HN3 A;  4EYU A;  2QQK A;  3HAG A;  4NWW A;  2H6C A;  4XFH A;  4YW6 A;  3T2Q A;  1OH3 A;  4LKF A;  4AED C;  2G1M A;  2VQA A;  1HRV 2;  1TMF 3;  3MV1 1;  1OFS A;  5A32 B;  3HOB A;  4LK6 A;  2HWF 3;  2WS9 1;  1R09 3;  2PAK A;  5FZA A;  2E9Q A;  1RUC 1;  4ET7 A;  3CQO A;  4IND A;  1EP0 A;  4PDW B;  2KXL A;  4XZU G;  3U4S A;  3ZXJ A;  4D94 A;  5K0U C;  1RYY A;  4EWE A;  2UYB A;  2WNU B;  3EBR A;  4YAR A;  1NA1 C;  1ALY A;  5F6K A;  3ZIX A;  2O14 A;  1UU4 A;  5FK7 A;  4H7M A;  1DP0 A;  1SPP B;  2VNO A;  2VCB A;  4QX8 A;  1NZI A;  1RUJ 1;  1K45 A;  1SDW A;  2GU9 A;  4ZXE A;  3SQO A;  3V64 A;  2IVI B;  1W6N A;  3MID A;  2YBK A;  3RMX A;  4FOQ A;  3VBF B;  5IT6 A;  2WQZ C;  3ZYR A;  1NCR A;  1W99 A;  1UD1 A;  1OUS A;  2C4X A;  4NJ4 A;  5H9R A;  4QMA A;  2XUM A;  1YFY A;  4D7Y A;  4XCA A;  1RUF 2;  3BKZ A;  2DUR A;  4XUQ A;  4W6Y A;  2X5I C;  3O1O A;  4A7Z A;  4IEZ A;  4A45 A;  5IK7 A;  5KC5 A;  2D40 A;  3B9I A;  1GNH A;  4UW3 A;  3ZSK A;  4D6R A;  2XPJ A;  4Y5T A;  1N1V A;  4NRQ A;  3BN6 A;  5IJR A;  1RGS A;  3C7G A;  1IGO A;  3KHC A;  1PK6 A; 
#chains in the Genus database with same CATH homology
 3ZR6 A;  4B1M A;  3LEM A;  5FIX A;  3IMM A;  3LDK A;  3NMB A;  3KF3 A;  3RWK X;  5FK8 A;  3UGG A;  4FFH A;  2ADE A;  3S5Q A;  5FMD A;  5FKB A;  3LFI A;  4JQT A;  5FKC A;  4B1L A;  3H3L A;  2QQV A;  4CCE A;  3KF5 A;  1W2T A;  4FFI A;  4UFI A;  3ZR5 A;  5FMC A;  4CCD A;  2ADD A;  2XQR A;  3PIJ A;  1UYP A;  5FMB A;  3U75 A;  2QQW A;  3SC7 X;  4UFH A;  3UGF A;  4AZZ A;  2OXB A;  4UFK A;  1Y4W A;  3UGH A;  4CCC A;  3LIG A;  2QQU A;  4UFJ A;  5ANN A;  4UFL A;  3U14 A;  1Y9G A;  1Y9M A;  3LIH A;  4UFM A;  2AC1 A;  3HBK A;  3LDR A;  3PIG A;  1ST8 A;  4HXC A;  3U1X A;  4EQV A;  4QHZ A;  2AEY A;  4FFF A;  2AEZ A;  3OSD A;  4FFG A;  3LF7 A;  5FK7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...