2DV9A

Crystal structure of peanut lectin gal-beta-1,3-gal complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
232
structure length
232
Chain Sequence
AETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galactose-binding lectin
publication title Structural studies on peanut lectin complexed with disaccharides involving different linkages: further insights into the structure and interactions of the lectin
pubmed doi rcsb
total genus 54
structure length 232
sequence length 232
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2dv9A00
1WW4A 4YZ1A 2GNBA 4R9CA 5GLWA 5DZGA 3MEPA 3DUIA 2V73A 3RRDA 5JMCA 2D44A 5IUQA 2WKKA 2E7TA 1WBLA 4ZKTB 1JN2P 2R1BA 1W6NA 2ZACA 1ULFA 4XJWA 2EXKA 1KQRA 3GALA 3N7MA 5LK5A 1C4RA 3AP9A 2ZGLA 3SH4A 3ASIA 1YRZA 1WLDA 4KBBA 1V00A 1WD3A 3AJYA 4D69A 1GSLA 2WT1A 3ZXFA 5T52A 3B00A 4C1WA 1Q8SA 5JOXA 3FLTA 1WBFA 4K1YA 3H0OA 4XTPA 1MZ5A 2ZMKA 1C1FA 2A3WA 4IQPA 2PELA 4Q27A 5JOYA 3Q9OA 1ULGA 3WG2A 3WCSA 1JXNA 1BJQA 1ULDA 3AX4A 1OFSA 3PMEA 4ISQA 1G9BA 5KXBA 2ZHKA 2NZ9A 3MW2A 4BOWA 2E6VA 1GNHA 5HCFA 3ILNA 1AX1A 4YZ4A 1AXKA 4M00A 4YW2A 2CWMA 2DYCA 1MS1A 1V6OA 2YZ4A 1RITA 3LSEA 3PJQA 1FYUA 4LBJA 5GZEA 5CAZA 2CY6A 1LHUA 5GLUA 2OUJA 4XJZA 1G7YA 2VUAA 2VW1A 1LTEA 5L73A 1V6NA 2A6ZA 4C1XA 5KXCA 4YG3A 1G9AA 3L2YA 3V64A 1SCRA 4P9YA 1DQ5A 2P3IA 2AH2A 1N1TA 4FPYA 4YZ2A 3U4XA 1SLCA 4ISRA 5T5JA 1V6MA 2ZGOA 3AP4A 5JDBA 2P34A 3OGGA 2RHPA 2PHRA 3WDTA 4XBNA 4FPHA 4PCRA 3UK9A 1NLSA 3UJQA 1A78A 1OQ1A 1AXYA 4CZSA 5CA6A 5KXDA 5IK7A 1UMZA 1JYCA 1I3HA 1DQ2A 1SCSA 2EF6A 4XYXA 1DIWA 3QCWA 1UN1A 2P3KA 2PHFA 4LBQD 2GN3A 4PBPA 1SLIA 2A5ZA 3OBRA 2JE9A 4JRAA 1FV2A 1BKZA 1LODA 2D6KA 3B01A 2ZGKA 3ZXLA 3FBYA 1Z78A 1AJKA 1GZWB 4UW5A 1JOJA 2SBAA 2WNEA 5KXEA 3INAA 2ARBA 1QMJA 1Q8OA 4Y22B 5T54A 4FP2A 4Q26A 1D0HA 2VH9A 3FFZA 4AYUA 2DVAA 3AFKA 3PVOA 2AR6A 4R9DA 3RSJA 1LULA 2W52A 3OY8B 1GKBA 4GWMA 1KJRA 3N7KA 1ZM1A 2VY0A 4RL7A 4XHXA 4YM3A 4GKYA 3V0BB 3M2MA 3POYA 4FPGA 5IK5A 2UURA 1IKQA 1N3PA 3RMYA 2W08A 1LEMA 4Y20B 3OY8A 3D6EA 4BLIA 3WZ1A 1AX0A 1F5FA 3IMNA 3M3OA 4FOQA 4YW3A 1DYPA 5IK8A 5CNAA 4NOTA 3V0BA 1MVQA 5H9SA 1CR7A 3AP7A 4BMBA 1UZZA 3NV2A 1IKPA 2CYFA 2AGSA 4BQ1A 2NMOA 1LOBA 5DG1A 2ZKNA 3VUOA 3FUQA 4Q1RA 1CQ9A 2ZGRA 4U36A 2CTVA 1N3QA 1LESA 4XIOA 1FX5A 1B09A 2ARXA 1G9FA 3B69A 1F9KA 3ZYPA 2D43A 3O0WA 1SBEA 2A71A 2KM2A 1S0IA 4L8QA 3ZYRA 1DQ6A 1LGBA 2PHWA 2DURA 5CB7A 1UKGA 1BYHA 1W0PA 1H9PA 2P37A 2UWAA 4YW5A 1CVNA 2NMNA 1O4YA 3WDXA 4LBOA 2D3PA 2DU1A 5GJ6A 3TAYA 1JBCA 1G8WA 1LU2A 4XXAA 1ONAA 1FV3A 4I30A 1FATA 4PBOA 3NV4A 4GALA 1GYKA 3AP6A 1IS5A 2ZBJA 1NXD1 1KITA 2ZGUA 4YFWA 1W6MB 3SISA 2EXJA 2R1DA 5DUUA 1BQPA 1FNYA 5CBLA 4FPJA 3OYWB 4JCKA 4XBLA 2D6MA 1PZ7A 4R9AA 1S1AA 2VU9A 4XDQA 3VKNA 2ZGTA 1S0CA 3MW3A 3WDYA 3WLUA 1MS4A 1N1SA 2E53A 1IOAA 1W6MA 4GKXA 5GLZA 5T5LA 3D5OA 4XTMA 3VKOA 2PHUA 3KQRA 3OYWA 4WV8A 2A75A 2CNAA 4WVWA 3ZXKA 2D3RA 2GDFA 2HYKA 4DRVA 1LOGA 3AZVA 3PVEA 4JC1A 4YGBA 1QU0A 2ERFA 4LBNA 1G86A 2GN7A 5IK4A 3POSA 1CJPA 3AYAA 3AK0A 3T1MA 2ENRA 4DRRA 2YROA 2W39A 1WW6A 3WDVA 4AGVA 4LBMA 1RIRA 4M3CE 3ILFA 3AYEA 1DBNA 1DHKB 1LENA 2W68A 3ZSKA 2ZGQA 2Z42A 3JU9A 4YG0A 1MR5A 3HR9A 4BMEA 1LOCA 1LU1A 2XG3A 2DV9A 4PF5A 5E88A 1LHVA 2WSUA 1ENSA 3W59A 2ZGNA 1HQLA 5JOWA 3AZXA 3O5SA 4XJ8A 2ZA9A 3N36A 3POWA 4R9BA 2ZGPA 1AZDA 3R4SA 2E51A 4XILA 2GALA 4Q1PA 3WHUA 2B7YA 1WW5A 4FOYA 3I4IA 2LTNA 4GWNA 5DZFA 1A3KA 1VALA 2DTYA 2D7FA 2VXRA 2EXHA 3WUCA 1QDOA 1MS9A 2TEPA 1HDKA 3BOPA 1H9WA 1YYNA 1R1ZA 3JUUA 4FQ4A 1APNA 1HKDA 5T55A 3RS6A 2A6WA 4FQZA 2Q5TA 4UW4A 3FUOA 1V6LA 4BPZA 2R49A 5DUVA 1S0JA 1JUIA 5BYNA 1LOFA 2DUPA 4Q8KA 4YGDA 1Y7BA 1UZYA 3V65A 2E7QA 2WT2A 1LOAA 3NV1A 5GZCA 1GICA 2GMMA 4NO4A 2NN8A 1CPMA 1C57A 2EIGA 5T5OA 4XHBA 1URXA 3O12A 2NP0A 1DGLA 4ITCA 1Q8QA 1QDCA 1GZWA 3FLRA 4FPLA 3OBTA 1BZWA 2R0HA 4Y22A 2WT0A 3R4UA 1N1VA 1Q8PA 3ILRA 5FREA 3ZSJA 1UL9A 4ATEA 2ZGSA 5GM0A 1QF3A 4YZ3A 2NYYA 5GZDA 1MS3A 1QGLA 4DS0A 5E8AA 3APBA 4CRQA 2YY1A 2WLQA 3SH5A 1HQWA 4XZPA 1UAIA 2P3JA 1YO8A 2DVGA 1GZCA 2A6YA 5EXOA 1S0BA 3USUB 1W0OA 4W65A 2D3SA 3O0XA 3A0NA 1CPNA 4Y1ZA 1G9DA 2FMDA 2I2SA 1DQ0A 1GANA 4K20A 4Y20A 5EYXA 2ZHMA 1LOFC 2A6XA 3AZWA 3LCPA 4M3CF 1QOOA 4Q2FA 5T50A 3WG1A 1SBFA 2UU8A 2ZZJA 5AVAA 1FAYA 4K21A 1PZ9A 4FPOB 3USUA 5IT6A 2BQPA 3WG4A 1MS8A 2H0BA 5GZGA 3WHTA 1V6IA 3N3HA 1VAMA 1Q56A 3RQ0A 2V5YA 1WD4A 1LGNA 2DUQA 5GZFA 1DLLA 4YGEA 2A6VA 1V6JA 3W58A 1MZ6A 2ZHLA 3O0VA 3KM5A 3WOGA 1S0EA 2AYHA 3AXEA 2A70A 3V0AB 3N7JA 1DZQA 2A3XA 1QOSA 1A8DA 3C2UA 3OJBA 4GA9A 4M3CB 4WVVA 3SITA 1LJ7A 2GNDA 3M3CA 1CESA 2GNTA 1RINA 2R0FA 1LCLA 2DTWA 3AZZA 5EYYA 4WZFA 4XJUA 3IPVB 2P2KA 4MYEA 5DUWA 1W6OB 2DVDA 2PHXA 3VKFC 1TEIA 1YIFA 2DUOA 3WDWA 3N35A 1VLNA 3V0AA 1FNZA 4BM8A 4M3CA 4FPKA 1YI7A 1QOTA 2JJ6A 3CNAA 4YM1A 3WDUA 3D4KA 2DVBA 1ULEA 3HMYA 1S0FA 2GMEA 3AZYA 1C1LA 4XIKA 1GLHA 3IPVA 1GV9A 1WCSA 4P9XA 1MVEA 1W6OA 4XE9A 3PVNA 4Y24A 2CL2A 1KDMA 2OVUA 5DUXA 5EWSA 3BIWE 4AGGA 1N3OA 4FOVA 3NWKA 4XJAA 1LHOA 1MACA 1O4ZA 2FHRA 1VIWB 2R16A 5SV8A 3FLPA 4H55A 2A3YA 4Y1UA 4BLJA 2YV8A 4AVVA 5FRAA 4XMIA 1QKQA 3ZVXA 4LBQB 2D6LX 1CIWA 1GNZA 3OPZA 3AYDA 2D6OX 3ENRA 4DPNA 4YW1A 3M1HA 4PQ9A 3UL2A 3TB0A 1ZA4A 4YGCA 2VW0A 4YM0A 4ATFA 1AJOA 4XXPA 3WV6A 2OUHA 3ZXEA 1ULCA 3I8TA 4OZXA 4YM2A 4AVSA 1H30A 1OKQA 4XMAA 4LBQA 4DFSA 2AENA 1AX2A 1U0AA 2YMZA 1XQNA 3BODA 3ZXJA 4DQAA 1CONA 4FPCA 2JD4A 5HCBA 2NM1A 1BXHA 3IM0A 1ENQA 1V6KA 2JE7A 1JHNA 2C9AA 3GNEA 4LBLA 4M01A 5DXDA 3RMXA 2C5DA 5GALA 3SLIA 4AWDA 4YFZA 2JDZA 3AJZA 1Z0HA 5JLVA 1I1EA 2WSVA 3NV3A 4TYSA 4ASMB 2A7AA 1AF9A 3MW4A 3A0KA 3WVJA 1GZ9A 2ES3A 4YG6A 3DGTA 2UWCA 1UPSA 1UX6A 2DVFA 4FVVA 1DQ1A 5F9TA 4XJ9A 2ZGMA 4K1ZA 1SLTA 1JYIA 4P14A 1IS4A 1AXZA 1DFQA 2EXIA 4FPEA 1DQ4A 5E89A 3WCRA 3ATGA 4SLIA 1WLCA 2CWSA 2EALA 2D6NA 4Y1YA 4Q8LA 4F83A 3UJOA 1S0GA 3BTAA 3AYCA 4Y1XA 3RG0A 3VKLA 1ENRA 1F31A 1W6QB 2JECA 3LSDA 1QNYA 3WNXA 4Z8BA 1SLLA 3ZPYA 3ZSMA 1W6PB 2G4IA 5DG2A 1GBGA 5HCAA 1LEDA 3IN9A 4YZ5A 1MS5A 1N47A 3SH3A 1YXWA 5H9PA 1W6QA 2SLIA 3QLQA 3B3QE 3T2TA 4AGRA 5H9RA 2GNMA 1DYKA 4UW3A 5H9QA 2EAKA 1SFYA 2ZABA 3SNMA 3MPPG 1AVBA 1SLBA 1LHWA 1W6PA 2DU0A 3N7LA 3A4UA 4FP3A 4GXLA 4TZDA 4CTEA 1IS3A 2OW4A 4FPFA 4U2AA 1HLCA 1WLWA 1EPWA 1MS0A 1KDKA 4HL0A 2XB6C 3WUDA 3AXDA 1LGCA 4XOGA 4YW4A 1N1YA 1D2SA 2ZMNA 1LHNA 2LALA 3HN1A 2ZMLA 1Q8VA 2DWRA 5JVVA 4RA0A 1LOEA 2YXSA 4FOWA 5DZEA 1KRIA 1KJLA 1SLAA 1S0DA 5GLTA 3WG3A 3VKMA 1JW6A 3T1LA 1SBDA 2WQZC 2PHTA 4UW6A 5JOZA 4HANA 4XBQA 3R05A 5GLVA 4AVTA 4LBKA 4P9WA 5T5PA 2VW2A 4ZXKA 2UWBA 3M3QA 1WW7A 1QNWA 3IKWA 5F5QA 4Y1VA 1PZ8A 2ZAAA 3AP5A 2GMPA 1CN1A 4YLZA 2WJSA 3B9CA 1J1TA 1G9CA 3VV1A 1LECA 1X50A 2JKBA 1SACA 1IS6A 1VAVA 3M3EA 2AUYA 2AREA 2D6PA 2ZHNA 4Y26A 3ZSLA 1W6NB 1WUVA
chains in the Genus database with same CATH superfamily
1HXS1 4R9CA 5FYSA 4DUVA 3VHPA 2B46X 1R093 1OPMA 3OGVA 4GB32 4IEZA 2V73A 4AL9A 5JMCA 3BALA 3RWNA 3HPNA 4RFT0 2MNGA 5IUQA 4AFBA 2Z5WA 4LHLA 1JN2P 2WQ8A 3JZVA 1W6NA 1POV3 1VBE2 2WAAA 1C4RA 3G6JB 1HQNA 2ZGLA 3ASIA 3U11A 1YRZA 2VZSA 4X8PA 4A3XA 1WLTA 4WVMA 3ZXFA 3M3IA 5LZ6A 4C1WA 5IATA 1Q8SA 4KGGA 3FLTA 1COV3 3I3QA 1MZ5A 2A3WA 3Q9OA 3WG2A 1ULDA 3AX4A 1H8TA 2WNVA 3K2OA 3PMEA 4CP9A 1JUHA 4COVA 5KXBA 5DDJ2 2QZ3A 2E6VA 1ASJ1 4O7XA 3VBSA 5FK8A 1SPPB 2CWMA 2DYCA 4LNVA 4PHZA 4Q4V1 1V6OA 5IVVA 2JKXA 1RITA 3MFCA 5A7PA 2QZ2A 1JYNA 1XYNA 1D0GA 2OUJA 2VW1A 1LTEA 3MICA 3L2YA 4IEPA 2BVVA 3HQUA 1TVGA 1JZ8A 1GQPA 1YQ6A 4MGYE 3ZSEA 3NQHA 1SLCA 4Q0VA 1KD7A 2ZGOA 4XFAA 5JDBA 4CXWA 4KG0A 3OGGA 4WM7C 3WDTA 3IIAA 1RUH1 4EV0A 1NLSA 4CZSA 1OQ1A 2DFCA 5CA6A 1H2MA 4FO9A 2VXJA 5D21A 5L9VA 3VZMA 1SCSA 2EF6A 1XSRA 2E33A 3MIEA 3C7GA 3QCWA 4MXWA 2NPIA 3AMQA 3JB4C 2HWF1 2GN3A 1HIXA 4XCBA 4QX3A 4CP2A 1CAWA 3OBRA 3VDDC 3LE0A 5FZ0A 1I6XA 1X7NA 3MDPA 5C3QA 5A80A 1LODA 3B01A 3PMSA 3HNBM 2XWJB 5FPZA 2WDBA 1AJKA 4YARA 1OUSA 2BDRA 5KXEA 3INAA 2ARBA 4IV1C 2O8QA 5T54A 5C4WB 4AYUA 3FFZA 2B4KA 1WMXA 3AFKA 4O9EA 4AFMA 2RV9A 5CG9A 5C9AC 1RJ8A 2W52A 3OY8B 1OOPA 4CUCA 4B8EA 1KJRA 3IT8A 1ZM1A 2VMGA 3N7KA 4RL7A 5LY2A 4PJYA 2VBDA 3WT3A 4GKYA 4RD7A 5LA9A 5FMDA 5FQ0A 5J48A 2W91A 3RMYA 3J4UH 2Y6HA 3K51A 3OTFA 3LA7A 1RUJ2 5F2WA 1IG3A 3B5LB 3NAPA 1F5FA 3GDBA 4FOQA 4LE4A 2VBBA 4YVWB 1PNFA 5IK8A 1NE6A 4E8DA 3NKTA 1RGSA 5I0TA 1BMV2 1YQ5A 3ITQA 4CU6A 3GCXA 1UW8A 4AZZA 2CSGA 2RS32 5LEKA 2OS2A 4NRMA 3E6CC 2PQSA 1BEV3 1UF2C 1UO9A 2HWB1 2YDEA 2ZGRA 1TNRA 4U36A 4RFRB 3IDAA 2RJKA 4IE4A 3WP5A 3FHQA 4CEYB 2Q8OA 4D6RA 4IV3C 1G9FA 2CDPA 3UETA 1IZ3A 3RGBA 4L8QA 4CPBA 2WN2A 4LA2A 1LGBA 2QJVA 4FSJA 1VP6A 1PIV2 1W0PA 2FBEA 4LOTA 3VHNA 2NMNA 5FP7A 2PAMA 2VR4A 1BBT3 4HK8A 1OFNA 2D3PA 2DU1A 3RYPA 3WDXA 3TAYA 3EBRA 3OBZA 5IFTA 5JXIA 5DAXA 5D8AC 5A1AA 1WCKA 5FBJA 1FATA 3NV4A 4GALA 4DMIA 1SHWB 1WMFA 3EQEA 1BEV1 1RYYA 1Y9GA 2K2SA 3VDAA 1Y9MA 2ZBJA 1H1IA 1S2EA 1KITA 1UYPA 4L99A 3SC7X 2ZGUA 3WF1A 5JSRA 1LNSA 1AR82 4HKLA 3OEBA 5A1LA 2DFBA 1FNYA 2BEOA 4N7UA 2WNUB 1GP5A 3OYWB 5HXVA 3RDIA 4N7IA 2WAOA 5L36A 1ZZ9A 1POV0 1PZ7A 4PDWA 2GAUA 3KB5A 3N9OA 4K40A 3WDYA 3NJXA 4MGQA 2WYFA 5LK7B 4FTSA 1NCRB 4MVTA 4CDXA 4KGQA 3HJRA 4AFDA 3DN7A 1PVC2 3TN93 3KHBA 4QKFA 1O3SA 4WV8A 3E5UA 2A75A 3PIJA 3ZXKA 5KHGA 2HYKA 1QJX2 2WYSA 1LOGA 3AZVA 3HEIA 4P5HA 5FYUA 3KGLA 3ZFFB 5IK4A 2TUNA 1DG6A 1CJPA 3HQRA 3QOPA 4UT5A 3VZOA 3VD9A 2JD9A 3PURA 4AGVA 4BK5A 4G9SB 1RVF3 4B4QA 2QCSB 2Q8EA 4CDWB 2VGDA 4HBNA 4Z07A 1DHKB 4QMAA 4GD4A 3JU9A 4BMEA 3HR9A 1LOCA 4PF5A 3B9IA 4A42A 2ZAHA 4UFJA 4WBBA 5HV4A 4GQ7A 1W9WA 1ZBE1 4FXKB 2WSUA 4XFBA 1ENSA 5CFDC 2VNGA 3O5SA 3POBA 2ZKLA 4I3GA 1AZDA 4R9BA 3IB3A 4O9GA 1X9TA 4Q1PA 1Y9QA 2JWPA 2QQLA 4FOYA 2PLV2 3T4VA 5DZFA 2C1FA 5FY7A 1VALA 2D7FA 2VXRA 2PTMA 1VRH3 2EXHA 1R092 1O3RA 4W50A 3LWCA 1HB4A 1IGOA 4QPIB 2F4LA 1YYNA 1W8FA 3CDZB 5A3WA 1HKDA 2J42A 3U75A 3I49A 2I07B 5T55A 3RS6A 4H14A 4AEDA 2Q5TA 4UW4A 1V6LA 1D4VB 4M4PA 1LOFA 2WNOA 4MHUA 3K4AA 3WSOA 4YGDA 3FMGA 1Y7BA 3I59A 1ZX5A 4NHLA 3VBRA 3OUHA 3ZLIA 5JCTA 2XL7A 1ULOA 4LTAA 1W8HA 1COV2 2HWE2 2IWGB 4NO4A 5FPBA 1CPMA 2D5FA 1GWLA 3VLBB 5A33B 1URXA 1DGRN 4DO0A 1QDCA 2R063 4LKSA 5KHHA 5FWJA 2BP6A 4XQWA 1N1VA 2C4XA 3ILRA 4KL1A 3D3AA 2GH8A 4W6XA 3POFA 4C90A 1XBFA 4IDZA 3VD7A 4YZ3A 1OUXA 4CRQA 2R043 5BUVA 1PK6B 3RZMA 1JODA 2JDAA 1UAIA 3WNPA 1J84A 5C8CB 1AHSA 1LAJA 5BNNA 1UOBA 1NQJA 1OQDA 2D3SA 4HN0A 1OPOA 3IIIA 3LQCA 3A0NA 3O0XA 4OHXA 4DINB 4F3JA 2IVIB 4QKDA 1GANA 1W2UA 4JV4A 4ORFA 5EYXA 4LE3A 2Q30A 4M3CF 4A45A 2BBAA 3VBUC 4RGKA 4AF9A 1ND3B 1QJU3 2UU8A 2K46A 2ZZJA 1FAYA 1VPHA 4K21A 3I54A 2LW8A 3I2HA 5DAQA 4FPOB 3WQ1A 1R1A3 2W87A 2XPJA 4JHTA 1DZRA 5GZGA 4A41A 3J26N 1WD4A 2WFF1 2R041 1ZVFA 2DUQA 2G1MA 5EV7A 3GJBA 2ADDA 2GC1A 1V6JA 3IWZA 4XFFA 3O1TA 1MZ6A 1PGL2 1S0EA 2W1WA 3CIHA 4CEYA 5K0UB 2AYHA 4MGTA 3N7JA 1DZQA 2A3XA 4PI0A 1J3QA 3C2UA 4GA9A 4QPGC 4QX2A 2YUEA 3SITA 1A8MA 2P4EA 4EN7B 1UU6A 1UYYA 3DV8A 2PFWA 2TBVA 5A3OA 3NJVA 4UFKA 2R0FA 3DXUA 5EYYA 1NCQC 1JYTA 1CAXA 3K4ZA 5IJRA 3IPVB 5FMBA 2GZWA 3VHOA 2VZOA 1TEIA 3V0AA 2VNVA 4L2NA 3T3YA 4EWAA 5F3IA 4MLOA 1YI7A 2RE9A 3ZXGA 3CNAA 2WL1A 4HPKA 3H3UA 5A3LA 2GMEA 3ZDVA 4UI9L 5FXVA 1WCQA 4FBFA 1GFF2 3FFQA 1WCSA 4XE9A 1MVEA 1W6OA 3A23A 5CVRA 3BOWA 4GAZA 4LPLA 5DUXA 3UNPA 1RUI3 4I01A 3NWKA 4HT1T 4XJAA 2R16A 4AI2A 4Y1UA 1SDDB 2A3YA 4BLJA 2EIEA 5E16A 1K5JA 4Q0PA 3CZJA 3MIBA 4AVVA 4AVAA 4XMIA 5FJHA 2Y26A 4LBQB 1CIWA 2Y64A 1WMEA 3AYDA 4QX1A 2D6OX 3N4MA 4OYUA 3BTYA 4PQ9A 3HOBA 1RC6A 4LLOA 4Q4W2 1AJOA 5JIUA 4YM2A 4CEWB 5GKAC 2ORZA 5CKNA 1XRUA 4NUBA 4IGOA 1O91A 1NY71 3CMGA 1BBT2 1R64A 1U0AA 2VCCA 3ZXJA 4DQAA 1CONA 3WF3A 5C3RA 1EP0A 5HCBA 1NAEA 4AGRA 1JHNA 5J98B 1K5MA 1BK0A 1CJDA 1SG3A 1US2A 5FIXA 3SMHA 1UXXX 4MADA 1UY4A 2WSVA 2A7AA 1AF9A 3MW4A 3A0KA 3SCGA 2WR9A 2YG0A 3LDBA 2UWCA 1UZWA 3B7MA 4FVVA 1ZBA3 2O1QA 1DQ1A 3MIGA 2XQRA 2D93A 5FDBA 5FZ3A 4LT5A 2GP3A 2VAUA 2FCVA 3NL1A 1AYM3 4QPIA 1PO13 4ZS2A 1NKGA 1IS4A 1AXZA 3DF0A 1XJAA 5DQ0A 5E89A 2DBIA 3TN92 4SLIA 5F1RA 4I0AA 2CWSA 4OI4A 1IHMA 1VBC1 5EJ1B 2VOVA 3UJOA 1JTZX 1XXNA 2VZ1A 3VKLA 5CFCB 3VBSC 3VBHB 5C3SA 1AYN3 1SLLA 1AL0G 4JQTA 3ZPYA 2G4IA 2I45A 4H2AA 5B4XA 3I97A 5HCAA 4HFSA 2HBUA 4N43B 1RVF2 3CJXA 1R081 3OPWA 3QACA 5J37A 2VZRA 3FZ3A 1W6QA 3QLQA 5FZ1A 4COZA 5FR3A 1H1MA 5ABJA 2GNMA 4UW3A 3LEMA 4K8RB 2HJIA 1SFYA 3FE5A 4LUMA 5H9QA 3TEXA 4B7EA 2G9GA 3RYKA 2X53S 1W6PA 4QHBA 4G3YC 4YVSB 4D7SA 4TZDA 4AQ6A 2QQOA 1IS3A 5AC91 3DPRC 1EPWA 3BPZA 1LGCA 4NROA 2VZ3A 5FOJB 2O0OA 2LALA 3MGUA 1E5RA 1HN0A 2W5FA 2ZMLA 5IVYA 1VB2A 2VZPA 4Q4Y1 5IW0A 5B2GB 4RA0A 2OZ6A 5JR2A 4K6BA 1VRH2 2O14A 4FOWA 3FC0A 4INDA 2RG4A 1QQP3 5FMOS 3OEAA 3KV6A 1C28A 1EV13 4OQ9A 1QXPA 2XJRA 5JXHA 4W6YA 1DDLA 1NZCA 1SBDA 2JG9B 2WQZC 1YJKA 1RUD3 1Q43A 1ULPA 2ETEA 2W1UA 5JOZA 5FK7A 4XBQA 3R05A 1MEC3 2YC2A 4LBKA 4QQLA 2VZUA 2OXBA 1JZ7A 4AAXA 4J6GA 1VJ2A 5K8SA 4Y1VA 4KWUA 2ZAAA 3AP5A 1CN1A 1ZYBA 4OUMA 1OHFA 1SFNA 5K9YA 2R062 3WD5A 1HB2A 3PIGA 4KH9A 1XE0A 2LUWA 1IS6A 3M3EA 5I8SA 1W6NB 1WW4A 1HX6A 2PAKA 3ZDSA 3ZYGA 4I02A 4D7TA 5GLWA 1NLQA 3OSDA 4LHNA 3MEPA 4WVMB 2ZS6B 4ZZ5A 3DUIA 3WF2A 4PLNA 3LAGA 3H8RA 1MEC1 3ACIA 4NHMA 4XVHA 5FYBA 2WKKA 2E7TA 1UZ0A 2IXJA 2VE1A 3AKRA 3RJRA 1WBLA 2Q1FA 1L7RA 5LW9A 2ZACA 1T6BX 4CP9B 3GALA 1H8TB 2WNVB 3N7MA 4V2WA 3SH4A 5C6CA 1JOPA 1NLRA 1QJU2 4KWJA 1WLDA 3OB8A 4KBBA 4PI2A 1WD3A 4XQDA 2WS93 4D69A 4M0HA 1VMHA 5T52A 1VBD1 4NWWA 2BGPA 1R1A2 2JG8A 5F39A 1WMDA 3H0OA 2ZMKA 5JOYA 2BFUL 2PELA 1ULGA 3UT0A 3HIFA 4OLLA 4JGZC 1G9BA 1SQ4A 2YGLA 1ZZCA 1NG0A 5F32A 4QX7A 2R073 1OXCA 1PMJX 1AX1A 1OD5A 3CJIC 5IVJA 4Z2AA 4AFAA 1DF0A 2J1SA 3WNNA 2P17A 4XDPA 4AG4A 3S6PA 2Y0IA 3LSEA 1OI6A 2D5HA 3PJQA 5F6LB 4I2OA 4N8MA 5FXXA 3U78A 4A7KA 3DKQA 2QKDA 5C8WA 3DYPA 2G19A 3H7YA 1HN1A 4LITA 4OUEA 5JIAA 3W9AA 5L7OB 1NA1B 1SCRA 3WNLA 4DNYA 5FY9A 1CIYA 4FPYA 3WF0A 4MXWB 4P9JA 4CCEA 2IC1A 2VMFA 4XFGA 4JAAA 4PT6A 5HXMA 1CAWB 3CF6E 1YIPA 5E6HA 4TLGA 2C0ZA 2WZ8A 1QWRA 1JYCA 1ND2A 1DQ2A 1JZ3A 1HRI1 2XJUA 1OLMA 4WM8B 2RDNA 1V9U3 5IYYA 1EUUA 1RUI2 2A5ZA 4DXZA 1CZVA 3PVBB 1XYOA 1OOPB 1EAH3 2JE9A 4ZU5A 4ZHNA 2VZVA 1YJLA 3UESA 2J1AA 2ZEYA 2ZGKA 3ZXLA 4MOAA 2WFPA 4HZFA 4PF1A 4COWA 2WNEA 5FQ0B 1QMJA 5B4NA 3S0MA 2BWAA 5C5UA 1AR72 1OLQA 1D0HA 1U5IA 2VH9A 2DVAA 3PVOA 3GHMA 3ABZA 3RSJA 1LULA 4JDOA 1GKBA 4GWMA 1ALYA 2VOXA 3DKWA 3NAPB 4XHXA 1FMD3 4IE6A 3KCCA 4TLFA 1GOFA 4A7ZA 2HWC3 2XUEA 3M2MA 1OH3A 3UKNA 4E4ZA 1RUC3 2MEV1 4FPGA 5IK5A 1V9U1 2RDSA 3MPBA 5FZBA 4A7YA 1IKQA 4LHKA 4BQ2A 1REFA 3LDKA 3OUIA 4G4FA 3AKPA 1QHDA 3D6EA 4BLIA 1JMUB 1MQTA 2P6CA 3JCIA 1AX0A 5FY1A 4XFCA 5BY5A 1RUF3 2XVLA 1EPZA 3EO6A 1X9PA 2XXZA 5H9SA 4O61A 1RJ7A 5C33A 1UZZA 2CYFA 2AGSA 3VD5A 4BQ1A 2W46A 1LOBA 5I0UA 3I2GA 3VUOA 2BU9A 1OMIA 1ZBA2 1HXS3 4Q1RA 1CQ9A 1IQDC 2Y33A 2Z2SB 4AQSA 4HMZA 3E6BA 1PO21 2ATFA 3ELNA 5JXJA 1AYM2 3P5BA 1PO12 3B69A 3E5QA 5KC6A 4TTGA 3WP4A 1F9KA 3FBMA 3ZYPA 2D43A 4RN5A 3O0WA 1SBEA 2KM2A 4FTBA 4QGMA 1UIKA 4NIHA 5C4WC 2D40A 1OF3A 2P37A 4Y5Z0 1J3PA 1FPN1 5LA2A 3O1SA 1E5HA 4BHPA 2WO7A 1C8M1 1G8WA 4NAMA 3T2PA 3FL7A 5FKCA 1W28A 1AYN2 1FV3A 1UY3A 4I30A 4BIFA 4QXHA 4KNCA 5FP8A 5FMOL 4PDWB 3BCWA 1GYKA 3AL6A 1W06A 1IS5A 2EIBA 4C8DA 1S4CA 4OMDA 4CDXB 1ASJ3 1FT9A 2CU5A 4YFWA 1YLLA 1IPSA 2EXJA 2R1DA 4Q5OA 4JCKA 4Q4V3 3A22A 1WCUA 3AL5A 4IGPA 4YVWC 4PLOA 1J83A 2D6MA 4XBLA 3VBOA 4E4DX 3S57A 4R9AA 1S1AA 3FWEA 5ANNA 2VU9A 4I0BA 5EJZB 2J1UA 3VKNA 1S0CA 2UYBA 1JHJA 3WLUA 1N1SA 5HV0A 5LRSA 1W6MA 5GLZA 5T5LA 4TN7A 2ZOEB 3KQRA 4LO8A 2CNAA 4XAEA 2D3RA 1QJZA 2GDFA 2VG9A 3ACGA 4QM8A 2HWD1 1O5UA 2Z4FA 4CEYC 5BNPA 1RTVA 1NOVA 1QU0A 4W4ZA 5LBFA 1QQP2 5A6XA 1RUH3 4LBNA 1ZRCA 1EV12 3AYAA 2XMLA 5APAA 3FJSA 3N9NA 3T1MA 4DRRA 4DUXA 2AZ5A 4BE3A 1OVPA 2W39A 4PIXA 1F2NA 2GH2A 4XW3A 1RUD2 4LBMA 3I2KA 2ET1A 1P8JA 2HWF3 5FY5A 2ZJCA 3UGFA 1DBNA 4AI8A 2IXIA 1RUNA 1W2NA 3TNPB 1OSGA 3ZXAC 2DV9A 5E88A 1D4M1 3VDCA 3D8CA 4EJRA 1LHVA 3IDEA 3W59A 2BUKA 2Q4SA 2RMU1 3N9MA 1VBA1 4HONA 1AL21 3AZXA 2O8OA 1QJEA 1SEFA 4M4RA 2E51A 5FP9A 1YQ8A 5FY4A 4TXWA 2QQJA 4AHYA 4AEDB 2WNUC 4JKKA 3WHUA 5L7OA 1WW5A 1NA1A 2P6HA 4GWNA 5FUPA 4IUGA 5IVBA 5HCHA 2GU9A 3NJZA 1K42A 3I59B 1MS9A 5FYHA 1HDKA 3VBRB 1NCRC 3D0JA 4NWVA 2IFRA 1CAVB 2X5IA 3JUUA 1APNA 1GUIA 3D82A 2YHJA 3ST7A 4TSVA 5C71A 2A6WA 2Y6FA 1PGW2 2DCTA 5FYYA 3FN9A 5FPVA 2VOTA 1YQ2A 5DUVA 3RVHA 1JUIA 5BYNA 3K3OA 2E9QA 4MX3A 2DUPA 4WM8A 4UXAA 1UZYA 2W2IA 2WS92 2E7QA 3CQOA 3ZFFC 1O3QA 4IEWA 2OA2A 2EICA 5LBBA 3K46A 2Z69A 2NN8A 4XF3A 3ZM8A 2XUMA 3PU8A 3ZMNA 1C57A 4Q4X1 2R32A 2EIGA 2HWB3 3RZGA 4HG6B 2BZDA 3F95A 3KMHA 3O12A 5EFUA 4B4PA 4CDWC 1Q8QA 4LJHA 1Z7S1 5I93A 5HPOA 2HEVF 3FLRA 2VTXA 2W47A 3OBTA 3KGZA 5F8PA 2R0HA 5BNNB 3R4UA 1RMU2 4EWEA 1Q8PA 1VAKA 2BJSA 2R072 2WZEA 1QIQA 2ZX1A 2ZGSA 2QNKA 4DS0A 5BXXA 3ZR5A 2A73B 3AMPA 3APBA 4BQWA 2YY1A 2ZPXA 4IESA 3SH5A 1HQWA 1H4GA 4CU7A 1REDA 2P3JA 2BGCA 4NAOA 5DAWA 4DIQA 2A6YA 2VMEA 2WZR1 4GMP1 1S0BA 5FAXA 1W0OA 5A32A 3MUZ1 1G9DA 2VCAA 4QM9A 4HOOA 3WQ7A 3I7DA 2ZHMA 3LCPA 3AZWA 1XSQA 3MIHA 4QDSA 3ZIWA 1XC6A 4QPIC 1AUYA 4ONUA 1OA4A 1PZ9A 4XFIA 3USUA 3WG4A 3QH7A 5FFOC 4Z92B 2R7EB 1JZ2A 2H0BA 2HBTA 3WHTA 3CU7A 1BVVA 1Q56A 1XNBA 3NJYA 3EYPA 4XQ4A 5GZFA 3N9QA 4A3ZA 4BQ5A 1DLLA 1NUKA 2QDNA 5EP9A 2A6VA 4NHKA 2ZHLA 1B35A 1CAXB 2QVSB 3KM5A 3O0VA 4HETA 1EAH2 3T4HB 4AEJA 3AXEA 3V0AB 1J59A 1A8DA 4AEMA 1PM7A 4WVVA 3NSTA 5DAVA 2GNDA 1TMF1 3M3CA 4HPKB 4AVBA 4RR3A 1H8VA 2GNTA 3AC0A 4J1WA 1PX4A 1LCLA 3JBG1 4ZONA 1WKYA 2DTWA 4BDVB 5DUWA 1W6OB 5IVCA 1FMD2 4EN8B 3WW3A 1PK6C 1RUG1 4KMQA 1VLNA 3RI8A 2HWC2 4BM8A 4LIVA 3SQOA 4HSJA 1RUC2 5C8CC 3GBWA 2VMDA 3K48A 1ULEA 3HMYA 4GJYA 4RQPB 2D98A 3P6BA 5FLJA 5G05L 5LY1A 4XIKA 2J1RA 2Q1ZB 3GXUA 4JHZA 4L97A 4OUSA 4CP0A 1ZBE3 1GLHA 5FYVA 1ND3C 1CZTA 1RUF2 4Y24A 4Y5SA 1KDMA 4GWIA 3WINE 3IDBB 5EWSA 3BIWE 2WO1A 4FOVA 2RR11 3KWVA 2FD8A 1VIWB 1W9TA 2Y6JA 1ZRDA 4XUQA 4KU7A 3AM2A 4QU1A 1ZA7A 1W2TA 3J7MA 1HXS2 4ET7A 2D6LX 5FZIA 4OZOA 3LOBA 3OPZA 5FZOA 1C3HA 4COYA 5FZGA 2ZEXA 3ENRA 4DPNA 4YW1A 5JI9A 1H2NA 1O8PA 2WINB 1O6UA 5K0UC 2DCZA 3CLPA 3M1HA 4A4AA 4NPRA 2NLRA 2KXLA 2VW0A 4IE7A 4XZUG 5CKMA 1HJGA 4YM0A 4YGCA 1K5MB 2OUHA 3ZXEA 3I8TA 4ATFA 5FPUA 3RZJA 4GH4A 4LA3A 4AXOA 2YBKA 3U14A 3F2ZA 2UY9A 1AX2A 4XDOA 3BODA 2VVEA 5FZKA 1K45A 4FPCA 4BIOA 2PHDA 2NP0A 3O1OA 1CX4A 2NM1A 3HBKA 5IWFA 1BXHA 3GF6A 4LBLA 1V6KA 3TNQA 1X33A 3ECQA 5DXDA 3IMMA 4QX8A 4MUVA 4AWDA 3AJZA 1ENXA 4XUTA 1BLZA 3GBFA 4W8JA 1GMMA 3VL8A 4ASMB 5C70A 1ASJ2 5F5AA 4R4ZA 4N9IA 1LR5A 3WVJA 1GZ9A 1Q5OA 2ES3A 2CGNA 5JAXA 4Q4V2 2RDQA 2A1XA 5F9TA 3DXTA 5FO8B 1D7PM 3T2QA 1U12A 4JDMA 4K1ZA 4AK3A 1SLTA 1XU2A 3PNAA 1PHMA 4B7KA 4HSLA 1AR91 1CAVA 4P14A 4FPEA 2EXIA 4QD2A 2L9LA 1H2KA 3WCRA 3ATGA 3KS7A 3UYJA 2EALA 4Y1YA 2X10A 1YEWA 2D6NA 2Q8CA 4E4HA 3WW2A 3H3LA 4LMFA 1S0GA 4P9IA 2JDUA 2RS51 3WQBA 5FBZA 3RG0A 1W6QB 1F31A 4ARYA 3KHCA 5ABJB 1RUH2 1QNYA 4N53A 3WNXA 2H0VA 2VVFA 3UGGA 4B1LA 4DY3A 4Z8BA 3U0ZA 1W6PB 4BQXA 5DG2A 2OPKA 4CEWC 1GBGA 1LEDA 5C7GA 4NIGA 2WFF3 3IN9A 4YZ5A 1MS5A 2HWF2 1RUE1 2XJVA 1HB3A 1YXWA 2SLIA 3HNYM 2W3JA 3KF3A 2EAKA 2ZABA 1DP0A 4MGSA 5JZGA 3POIA 4FP3A 4WZCA 3A4UA 2OW4A 3K3NA 1HLCA 1V0AA 3AFGA 4U2AA 1KDKA 1W3XA 2XBO1 1UCXA 1EUTA 4JX0A 2X29A 5AFEA 5C3PA 3WUDA 4CVUA 4YW7A 4XOGA 4YW4A 2QBXA 3AKSA 3RPQA 1D2SA 2E26A 1LHNA 2ADEA 4BXFA 5I0RA 2JX9A 4MSVA 1Q8VA 2DWRA 2OT7A 5JVVA 3ROUA 3S5QA 4AR2A 2YXSA 3TWIA 2P5BA 2RS11 4I09A 3ZN6A 3E1F1 5TSWA 5HBAA 5DZEA 5FXZA 1I5ZA 2BGOA 4META 5KHKA 2UYAA 3MFAA 1DGRA 3VKMA 1JW6A 4YWAA 4UW6A 4N90A 3BB6A 4HANA 5CFCC 3JD71 4QGNA 4NPMA 2JIJA 2ZX0A 3VBHC 1RHI1 2E63A 1W03A 2XONA 4LXLA 2UWBA 3B94A 1QNWA 3MO4A 4RGGA 5F5QA 5KBFA 2HWB2 2IVJA 2V4AA 1IPKA 4QPYA 4N43C 1KGYA 1UIJA 2GMPA 3H8UA 3RI9A 3LEGA 2WWSA 4LORA 1G9CA 3VV1A 3J8F1 1SACA 1VAVA 2AREA 4EQVA 1W2OA 1PNGA 2DCYA 2ZX4A 4Y26A 4DB5A 5CG8A 4YVSC 1W8ZA 4YZ1A 1W90A 3KCYA 1JZ4A 3POEA 3LDRA 3ZKUA 4Z2WA 4FCAA 1U5YA 4MXVA 3PUHA 4ES9A 4EYUA 5BV6A 2D44A 2JG8B 1CAUA 1HRV1 2PYTA 1KFUL 4RQPA 4FFIA 2LM3A 2FZ2A 5ERLA 4A44A 4UYBA 2EXKA 2MPFA 4XURA 5FYZA 1BEV2 3AP9A 4FT8A 5IAVA 3ZFEC 2YPJA 1UNBA 3AJYA 5KR7A 3ACLA 5LWBA 2WT1A 5LA1A 5CU1A 3M4FA 3ZPOA 5JOXA 2IXHA 2WN3A 2VMHA 1QJY1 1WBFA 4P00B 3ZMOA 5I0DA 3SKVA 3ZFGB 1C1FA 2JG9C 1F15A 5FZ4A 2RVAA 2VUDA 1HV1A 1T6GC 4F8AA 1X8MA 4ISQA 2FQPA 4QPWA 5A7WA 4BCUA 4P9GA 3BI3A 4BOWA 2PN5A 4CP1A 4B29A 5HCFA 3ILNA 5EIYB 4CDUB 5FZFA 5F7UA 1F35A 3BPSA 1UXZA 1AXKA 4M00A 3VDDA 2IXKA 1VBC3 3I2IA 4OFGA 5GZEA 5CAZA 1FYUA 4LBJA 2IZWA 2YFZA 4K3UA 1ZRRA 2CY6A 5FKBA 1WCDJ 4XJZA 2VUAA 4UOJA 1F8VA 5KXCA 5L73A 2A6ZA 3RWKX 4IV1A 4YG3A 5D1IA 1G9AA 1W04A 4BB3A 2JB4A 3Q8CA 2P3IA 1ND2B 5C9AA 4ASKA 2AH2A 1N1TA 4YZ2A 2VTXJ 3U4XA 3MZHA 3MI8A 3AP4A 1R083 2P34A 5JMOA 4DOUA 1ODMA 3HQXA 4CDQB 3W20A 2C9KA 4XBNA 4PCRA 1KFXL 1Y3TA 4XUNA 4OHZA 3UJQA 3UK9A 4EZ4A 5KXDA 5IK7A 1ZBE2 1UMZA 1H8TC 1QH6A 2WNVC 1I3HA 1WWYA 5AC93 5AFBA 1O8SA 1DIWA 3MHZA 4XYXA 4ZS3A 3BKZA 1E5SA 2JDMA 2PHFA 2BNMA 4LBQD 4PBPA 3KD4A 4QB1A 4RHV1 1TME1 4XFHA 3SEPA 1NXMA 4BISA 3OBAA 4J1XA 4HXCA 1RXFA 4AW7A 4Q4Y3 4AI0A 3I3EA 1Z78A 1XNKA 5FY0A 1GZWB 5A6ZA 1NYWA 4UW5A 2G9ZA 2SBAA 3W21A 4Y22B 1W05A 2GC2A 1FOD1 3EHKA 4Q26A 3TYJA 4IW3A 2OX0A 4P08A 1GWMA 4KI5M 1MQTB 3C7OA 4E8CA 4NJ4A 5FYIA 3C7HA 2ZXQA 3PDQA 4IE5A 4YM3A 1W8OA 3POYA 3E97A 3EXUA 4ARXA 5DPNA 2UURA 2HEYF 5J7MA 1VE0A 1N3PA 4JVAA 4RS5B 3NNJA 4DXSA 5L7OC 3BTZA 3R6SA 5J3UA 1NA1C 1DLCA 1LEMA 2RM21 4MGZE 2K9ZA 5ACA3 4OULA 3WZ1A 1Y4WA 5D8AA 3V56A 3IMNA 4YW3A 2LS6A 3TOJA 3O1UA 2JXAA 5CNAA 5L9RA 4NOTA 3V0BA 5KHJA 5DAPA 3UGHA 4BMBA 5KHIA 3NV2A 4D6QA 2ZKNA 3NNLA 4NMIA 1C5HA 3RYRA 3ACHA 3RNSA 4WM8C 3C7EA 3PUIA 2VO5A 3EJKA 1UYXA 1VBB1 2CTVA 1L7QA 2EA7A 3KV9A 1GOGA 1OOPC 2ZCWA 1FX5A 1B09A 1X82A 2ARXA 2QDRA 3CKHA 3M8LA 3LPFA 1AR61 4LK7A 5FZMA 5ACA1 2XJSA 1S0IA 5BPXA 3VL9A 3ZYRA 5F3CA 3BUCA 5CB7A 2DURA 1UKGA 1BYHA 1YNAA 1H9PA 3L2HA 4YW5A 1CVNA 2GP5A 4FAGA 3R0RA 1NX9A 2B9UA 4LBOA 1VBD3 5GJ6A 3GZUC 1LU2A 1PX3A 4XXAA 2BNOA 1H1AA 4XETA 3WEZA 3NAPC 2CV6A 1OF4A 4UFHA 3LIGA 4JDNA 4PBOA 3JQXA 3H1YA 4FI9A 3VBOB 5IAXA 1VBE1 1JYVA 1A6CA 2WFF2 2R042 3ORJA 5T3NA 4BH9A 2DBNA 5IFPA 3FHIB 3VHRA 2W92A 3T0BA 1W6MB 2WABA 3AKTA 3B02A 5CBLA 3Q8EA 4FPJA 3PL0A 2PHLA 2XOMA 3CO2A 2RJ2A 4OI2A 4AE2A 4EE2A 4UF0A 4XDQA 5CFDA 1O7FA 5BNPB 2ZGTA 5DDJ1 3MBWA 2Y38A 3N9LA 1MS4A 4K7JA 5C5TA 3IAPA 4GKXA 2YYOA 2XKPA 1NZIA 2P1BA 2PA7A 3D5OA 4XTMA 5E1RA 2YU2A 3OGSA 4WVWA 1OC1A 4DRVA 4KWLA 2YB7A 4LO7A 4JC1A 4YGBA 2ERFA 3Q8FA 1UWWA 3LB9A 4P5YA 2F6BA 2GN7A 3POSA 3DL3A 2BTVC 2ENRA 5ANQA 1W9SA 1HRI3 2YROA 3ZFGA 1PMHX 1WW6A 3DEMA 3OG2A 3WDVA 1RIRA 2XJPA 4M3CE 3AYEA 1UYZA 4UBHA 3ZSKA 2W68A 2ZGQA 2Z42A 2QFEA 4YG0A 1MR5A 1YI9A 1LU1A 3WW1A 1VMFA 2Y60A 2ZX3A 4CDUA 2AEYA 4PDWC 2ZGNA 1HQLA 5JOWA 1YHFA 3OCPA 2Y8KA 2VL4A 2ZA9A 3POWA 4FFHA 4XAAA 2X5IB 2ZGPA 4ZXEA 3THCA 4CDXC 3R4SA 2QQNA 4BK4A 2YC4A 3T08A 1NT0A 5FZEA 4XILA 4CXYA 2GALA 3HT2A 2J7MA 2QQWA 2B39A 4F7ZA 5JPMB 3RZHA 2XL9A 2VC9A 4B1MA 3BTXA 2VUJA 3O14A 1VMJA 5LATA 2DTYA 4E27A 5FYCA 2MEV3 2XH6A 1QDOA 4LQRA 1NY72 2PXJA 4UAPA 1R1ZA 2FCUA 2VOWA 4CDQA 2VULA 2ORXA 4HVOA 2BW8A 1QY4A 1F4AA 4QDQA 4FQZA 2TNFA 3MIDA 3FUOA 4BPZA 2R49A 1S0JA 4S2GA 4XCAA 3VBFB 3VBUA 1Y43B 2VCBA 3DCQA 2J22A 5GZCA 4FTEA 2GMMA 4C0BA 4KBZA 1RUJ1 2V5DA 5T5OA 4D6SA 1DGLA 1UY1A 5FY8A 1GZWA 1PO23 3A21A 4NIAA 3IZOA 3MIFA 1BMV1 4Y22A 2WT0A 3ZSJA 4OI0A 3G7DA 5A32B 5I0SA 2YFUA 3T2OA 1IPJA 1UL9A 4ATEA 2RS31 1QJFA 1QF3A 2NYYA 3GCWA 4QX0A 1QGLA 5GZDA 5JSPA 1VBC2 1GZTA 3KT1A 3ES4A 1PM4A 1JOBA 3OOXA 4LO4B 4QPGA 1FPN3 3NNFA 4XZPA 2ZZQA 2CAUA 1YO8A 3WP3A 1C8M3 1GZCA 5EXOA 1IQAA 3C3VA 3USUB 2CDOA 4W65A 4AEDC 4RS5A 5A3UA 2FMDA 2I2SA 1NCQA 1O4TA 1SZBA 2BWCA 2PMWB 1QXJA 1LOFC 2A6XA 2Q8DA 1XOYA 2B9VA 4Q2FA 1PIV1 4YW6A 3VBRC 2VBPA 1R082 4QHOA 1JS9A 3WG1A 1B35B 3KT4A 5LBCA 4C0HA 1O3TA 4DXTA 2BQPA 3I3MA 2VVDA 3ON7A 4H7LA 3BN6A 3KT7A 3ZR6A 4HLTA 1V6IA 5CADA 3RQ0A 2VMIA 5AC92 5FOBB 4RR3B 2OQ6A 2WRAA 4DEQA 2VZTA 3MF9A 3W58A 5JSOA 1ZREA 2VQUA 1AR81 5F3EA 1LRHA 2E31A 4MZUA 1XNTA 3PTYA 2A70A 3SCHA 4Q4Y2 5F5CA 4KWKA 1UKRA 1LJ7A 3WNKA 2VQ0A 5BNNC 2HWD3 1RINA 5BNQA 4HVQA 3AZZA 2C6SA 1PVC1 4QB6A 4WZFA 1YFUA 3QH6A 4XJUA 3GZTB 1UD1A 3O1RA 4MYEA 4R52A 3EMRA 1YIFA 2DUOA 3WDWA 3N35A 4KU8A 1FNZA 3PU3A 3AMNA 4M3CA 4FPKA 5JXGA 3I2JA 1H0BA 1QJX1 1QOTA 4XPVA 1H2LA 2XWBB 3D4KA 2DVBA 2WQ4A 3H3ZA 3PUQA 3SCFA 4EROA 5BNOB 4NR1A 1C1LA 2XDVA 5KWRA 1D4M3 3OD0A 4CPBD 1GV9A 2RMU3 1VBA3 1KXGA 2XLFA 1AL23 2CL2A 2QE3A 5FZOB 3T30A 4XC9A 3VZNA 4AGGA 1XPWA 1LHOA 1MACA 1O4ZA 2J1TA 4JQRA 2FHRA 3VZKA 1E57A 1ZZ8A 3GGLA 5SV8A 5JUVA 3FLPA 3H1WA 1RXGA 2Y0OA 2YV8A 2VNOA 1K3IA 3O1VA 2X05A 4L11A 4GH4B 5FRAA 3K77A 3E6DA 1QKQA 5IVEA 1JU4A 1GNZA 4XABA 1W2AX 4EWDA 4XEZA 5FZ8A 1MEC2 2HWE3 5FZDA 5FJKA 3LGRA 4OI1A 1ZA4A 5FO9B 4JKLA 1X36A 5LA0A 4CU9A 3WV6A 1W39A 2PLV1 2QUOA 1BVP1 4LK6A 3BU7A 4OZXA 3PJYA 4AVSA 4CE8A 2CHHA 5FYTA 2AACA 1OKQA 1R091 1XNDA 4KQ7A 4DFSA 2AENA 1CGPA 4CA9A 2FDHA 1VBD2 4L0PA 2X8KA 3KSCA 4J25A 2VECA 1RUOA 4Q4X3 5A7NA 2C9AA 1POV1 1G6NA 3JB8A 2C5DA 4JRLA 5GALA 1GOHA 1Z7S3 3ACFA 2JDZA 4S2HA 3MV11 5JLVA 4RQPC 2ILMA 4PLMA 4TYSA 3I2FA 3DYOA 5CZKA 5F5IA 3VB9A 2ZTNA 1COV1 2HWE1 4Y3OA 4YG6A 3AKQA 2B45X 4QXCA 5ISLA 1UX6A 2DVFA 5FZCA 3H8XA 1L7LA 2J1EA 3NKGA 4XJ9A 4QHZA 2ZGMA 4BA6A 3MV01 3U07A 1ZRIA 2WZR3 3DPRA 4GMP3 1OT5A 4JGYB 3MLJA 1JYIA 2VPVA 2XQXA 3I2DA 4N53B 1DQ4A 3NMBA 1YC61 5F2SA 5LB6A 4NN0A 1C8NA 4V1PA 4NIIA 1W99A 4CUGA 2W9XA 3J9SA 4GZ9A 4Y33A 4E9KA 5CISA 3BTAA 1M06G 1UOGA 3GJAA 3GZEA 3GM8A 1ENRA 2JECA 3VBFA 1S2KA 4FXGB 2BOIA 4UFIA 4X6QB 4E2QA 3VZLA 2E32A 4MGKE 1UU5A 5JZGB 1K5MC 4FAHA 1HRI2 2ZEZA 5FZ7A 2FDIA 3DYMA 3SKJE 5FP3A 3SH3A 1N47A 2C24A 2KD7A 1QH7A 3B3QE 3MLKA 3PUSA 3NVCA 1DYKA 4ZZ8A 2XGXA 5A1FA 1AVBA 4MO3M 1SLBA 2IXCA 3ZN5A 1LHWA 3N7LA 5K7PA 5FUIA 1VB4A 4CTEA 4FPFA 3SEEA 2IXLA 3HT1A 3ZN6B 1TMF3 3ETPA 3NNGA 4HL0A 2PQQA 2XB6C 2AC1A 3JBG3 2VD7A 5L9BA 3S5AA 1PGL1 1N1YA 3HN1A 2GC0A 3P3PA 1JU3A 4QKBA 4X6RB 1ST8A 1NQDA 1D2QA 1CZSA 5FZLA 3T0DA 1RUG3 3KZ4C 1ZRFA 4BQYA 4LULA 3LZZA 2MEV2 1J3RA 1V9U2 3LIHA 4MV2A 3U4SA 1SFPA 4HKOA 1KJLA 2AEZA 3WG3A 4AOCA 4EN6B 1SDWA 1J58A 1DGWA 1OBNA 1W9FA 2BBVA 4XUPA 1YFWA 5GLVA 5ABJC 5C3OA 5J1XA 2RR13 5T5PA 2VW2A 3LKJA 3RFRA 3CBNA 4Q0UA 4LHSA 4Q4W3 1OH4A 1WW7A 1OA3A 2B42B 3IKWA 3PHMA 1XU1A 3RZZA 4AQTA 4CXXA 3GBGA 4YLZA 2WJSA 5D2AA 1J1TA 1I5PA 1PO22 3CL1A 5FZHA 1X50A 1UY0A 4JGZA 1RL3A 2JKBA 1CAUB 3IBMA 3M7AA 1HB1A 1MPXA 2DDUA 4I0WB 2D6PA 4IEUA 4B4RA 2ZHKA 4QB2A 1WUVA 3CJIA 3OUJA 4BU2A 5LBEA 2BVBA 2GNBA 5DZGA 1FPN2 4JZRA 1POQA 2YC0A 3RRDA 1C8M2 2V4VA 3S30A 4WM7B 4BQ4A 2I74A 2VM9A 3I3BA 3LEKA 3OGRA 4HK9A 4JTOA 5BNOA 2B8MA 2HEWF 4ZKTB 2R1BA 2EVXA 4Q4W1 1ULFA 4XJWA 1KQRA 2R30A 4IL7A 5LK5A 3GYDA 2JE8A 3ALQA 4LEJA 5A7WB 1V00A 3ME2A 1JYWA 1BBT1 1GSLA 5G04L 4P9LA 3B00A 3POGA 2LROA 2V09A 3VDDB 1VRBA 1V70A 4K1YA 4UFMA 4XTPA 3L9JT 5I8YA 4IQPA 4Q27A 4BXSV 1OURA 4CCMA 3KCXA 1TE1B 3WCSA 1JXNA 1BJQA 1MZEA 4QX5A 1OFSA 1W3VA 4FFGA 4YYOA 4W6WA 1W8WA 5EPAA 3WX5A 1ZZ7A 4IV1B 2K0GA 1M4WA 2NZ9A 3MW2A 4LIUA 4OVEA 1AR93 1GNHA 4YZ4A 3WY6A 2OIIA 5C9AB 1LB2A 4YW2A 3OGJA 5J96B 1MS1A 2YZ4A 1GR3A 4NHYA 3ZYJB 4UFLA 1X8EA 2RS53 3OPTA 1LHUA 5GLUA 2HWD2 1OKOA 1G7YA 2JDNA 2VQTA 3KVAA 5FXWA 1V6NA 4AI9A 4C1XA 5FZAA 4DZGA 5FPAA 2RJLA 5F3GA 1S2BA 1UX7A 2Q0AA 3V64A 5JPNB 4P9YA 1DQ5A 1CX1A 3TN91 1SPPA 5DMYA 4LO6B 4ISRA 5T5JA 1V6MA 3KV5A 1TG7A 3H1MA 1RUE3 4QKNA 2JDPA 2RHPA 3ES1A 2JG8C 4D3WA 3S7EA 2PAEA 2PHRA 3ZO0B 3LA2A 4GMP0 1GWKA 4FPHA 5A6YA 1OQEA 4BYYA 1A78A 1D4M2 1AXYA 4Z82A 5A6QA 4S2DA 3CZUA 2Z79A 2RMU2 3PUAA 1W8TA 1VBA2 2CGPA 1H6YA 3CEWA 1AL22 1UN1A 1RVF1 2P3KA 2XBO3 4IETA 2BOJA 1XE8A 1SLIA 2EAAA 4JKMA 4LLFA 5A7QA 2E7AA 4JGYA 5FTTC 4OHWA 3HVDA 3ZFGC 3ZYBA 4IV3B 4JRAA 4CCKA 4CUAA 1FV2A 3RZKA 1BKZA 5IHRA 2D6KA 3VZJA 3FBYA 5FLIA 1Q3EA 4OHYA 4NE9A 1JOJA 2RS13 5A3PA 1Q8OA 3ZXDA 4FP2A 1HW5A 4IEVA 4CDUC 4R9DA 2AR6A 5FMCA 4OHVA 3UV9A 2BRTA 2LRPA 2EIDA 2WA4A 3GZAA 3NNMA 5D8AB 2VY0A 2HLEA 3OF1A 5EJ3A 3AVSA 4IXLA 3V0BB 4D8MA 3JD73 4YNIA 1VRH1 5LCWL 5C4WA 1RHI3 3OD4A 4PIZA 2FMYA 1TNFA 2W08A 5FO7B 1MZFA 2NQYA 1CD3G 3ZYHA 4FFFA 4Y20B 1ND2C 4HKWA 3OY8A 2FDKA 4QQOA 3S7IA 4Q4X2 2DCJA 1ODNA 2G9FA 2R6QA 3M3OA 2W94A 1DYPA 1K12A 1Z7S2 3LEIA 1MVQA 4CDQC 1YFYA 5L19A 5LASA 3U1XA 1CR7A 1DU3D 1GNYA 1O5LA 3AP7A 1DZTA 3J8F3 4D0QA 1IKPA 3URFA 2NMOA 4XF4A 5F6KA 3W5MA 2YGMA 2QQKA 5DG1A 3FUQA 3U37A 3B93A 4QXBA 4NRPA 1UU4A 3FHAA 4SBVA 3TEWA 4CSWA 4YVWA 4A2UA 5JI7A 4V2VA 2R061 1N3QA 1LESA 1I9RA 2WZR2 4EN0A 2KR2A 2QQVA 1HRV3 3H9AA 4XIOA 1ZZ6A 2XKOA 5FYMA 2ZX2A 5A7SA 5A3TA 4CU8A 5DN2A 2WIIB 2W1SA 2WA3A 4NHXA 2A71A 4QU2A 4MHRA 1XYPA 2WC2A 4NPLA 4CYDA 1DQ6A 2N7GA 2PHWA 2DF7A 1UQXA 2UWAA 3ZN4A 1O4YA 3TEZA 3AMMA 2BYVE 1JBCA 1JZ6A 5A3MA 1QJY3 1ONAA 1MQTC 1DCSA 3LF7A 4GWJA 1GQHA 4BWOA 3USSA 3BIEA 1UOFA 1W8UA 4PIYA 3RJ2X 3ZKYA 5JWPA 4HN1A 4RYDA 3AP6A 4UF0B 5CFDB 1QJU1 3MUY1 1C5IA 1JH5A 1NXD1 4RS5C 1WA6X 4QWNA 3HN3A 3SISA 1QXRA 4Q29A 1R1A1 3QBQA 5DUUA 3BYWA 1BQPA 2VTFA 2XJQA 2BPA2 4IE0A 2HH9A 4AHXA 4CCJA 2VOKA 4H7MA 1S55A 3ETQA 1TMF2 2BFUS 3MF6A 3MW3A 2Y6KA 4QQ2A 2E53A 3JBG2 4WM7A 4OCTA 3J7NA 1IOAA 2VJXA 3HNMA 2KA3A 3VKOA 2PHUA 1RUG2 2WNUA 3OYWA 4C91A 4DY5A 3H42B 2GC3A 2W1QA 4IEXA 3PVEA 4Z1VA 1UPIA 3MYXA 1GQGA 2XLGA 4BQ3A 1G86A 1NCRA 4LOSA 1U5XA 5EHDA 1OVSA 3AK0A 2VUCA 4N9HA 3HAGA 4XF9A 4XF0A 5SV5A 2MHFA 3H50A 5FUNA 4M0NA 1EY2A 4Q0SA 4B3NA 4CCLA 4LR4A 4X8NA 3ILFA 1AR73 3LPGA 1XB9A 4Y5TA 4DXRA 1LENA 1TME3 2RR12 4RHV3 4RSUA 5CKQA 3HD8B 4XUOA 2XHKA 3ZFFA 2XG3A 3TEYA 1OD3A 3VBOC 3H7JA 3WP6A 5EZWA 4QT6A 3LD8A 4KG8A 2VNRA 2FDFA 3JQWA 1PVXA 3N36A 4XJ8A 1QEXA 2OYZA 4CCDA 4YSFA 1FOD3 4CDWA 1RUI1 4LKDA 3SHRA 1HV0A 2VCMA 3RZLA 1UMHA 3I2OA 4NIDA 3C7FA 5J36A 1BHGA 2IUWA 2B7YA 1H4HA 1W0NA 2YPDA 3I4IA 2LTNA 4E2SA 1PGSA 1A3KA 3J7LA 4URTA 2ET7A 3VD3A 4WVZA 3VBUB 5BNPC 3WUCA 2JEMA 3BOPA 2TEPA 1TZOA 1H9WA 1ACCA 1AR71 3EB7A 3IAQA 1YWKA 3VGIA 5IVFA 1FXZA 2XLAA 4FQ4A 5J09A 4K8FA 2RM23 4URAA 2WWUA 4YPJA 1BCXA 2Y6LA 3WR0A 4AQ2A 4IEOA 1T2XA 2WO3A 3D0SA 2FDGA 4DEVA 3K4DA 4Q8KA 5KC5A 5A7OA 3V65A 4A6SA 3PTRB 1O59A 1LOAA 2WO2A 2WT2A 2WZPP 3NV1A 3ZIXA 4TWTA 1GICA 2W95A 2XJTA 4IV3A 3P1IA 2XR4A 3O1PA 4XHBA 5FZ6A 2QQPA 4QPGB 4ITCA 1VBB3 2XVKA 5A70A 1YUDA 1FI2A 5AVPA 4FPLA 4Y4RA 1BZWA 2YBPA 5FREA 3E5XA 3BGAA 1AR92 5DABA 1DGWX 4IEYA 2B5HA 1NCQB 4OMCA 1AR63 3LFMA 5GM0A 2BERA 3W5NA 1MS3A 1ZBA1 5E8AA 4D94A 3THDA 4QQHA 2WLQA 5A33A 4H3WA 2X5IC 2RS52 4GB33 2DVGA 1AYM1 4AI1A 2JB8A 1PO11 4UWDA 4GIQA 4CCOA 1CPNA 4Y1ZA 3PLQA 4Y20A 1DQ0A 4K20A 1VBE3 3X29B 1YFXA 4R8HA 1QOOA 1OLME 5T50A 1PK6A 1SBFA 5JR7B 1RUE2 5AVAA 3N9PA 1REEA 3WNMA 1STMA 5C8CA 5IT6A 4AHZA 1MS8A 1AYN1 3ZYFA 4QQPA 3DECA 3Q8BA 3N3HA 5FCCA 1VAMA 4LO5B 1CWPA 3NW4A 2V5YA 5FZ9A 3VBFC 3ZFEB 1IG0A 1LGNA 1ND3A 2X09A 2W0XA 2XBO2 5DDJ3 4AI3A 4YGEA 5HI0A 4GB31 1A34A 3WOGA 3LA3A 4CCNA 4CCCA 1RB8G 4Y4YA 4R4XA 1QOSA 2C26A 3OJBA 4M3CB 1JYXA 2QQMA 2ID4A 2RS12 4E2GA 1CESA 3KQ4B 1XNCA 4DUWA 2HKXA 5K0UA 2BNNA 2P2KA 3VKFC 2DVDA 2F4PA 2PHXA 1KS5A 1US3A 2IFWA 4AHWA 2OZJA 3JD72 3HBZA 3KV4A 4YM1A 2JJ6A 3WDUA 4ZY9A 3ZX7A 4IGQA 4A6OA 1RHI2 1J1LA 1QQP1 1S0FA 3AZYA 1GP6A 2ZEWA 1EV11 3IPVA 3IDCB 4P9XA 4L92A 2Y6GA 3PVNA 1RUD1 1YCIA 4XACA 2FCTA 2OVUA 4COUA 1B35C 1F4HA 1N3OA 3U10A 3ZOIA 4QXKA 3J8F2 4O65A 4H55A 3J7HA 4JTNA 4NVPA 2CAVA 1WA4A 1E5IA 1GP4A 2Q1MA 3GHNA 4RR3C 5FP4A 3ZVXA 3R4DB 4IEQA 4IERA 2UY8A 2YU1A 3C8XA 3UKTA 4AEKA 4ZU4A 4L9BA 3VBSB 1EYBA 1HRV2 2VZQA 3UL2A 4RGAA 3TB0A 2QQUA 3WF4A 3UKVA 2GSYA 4XXPA 4EZHA 1BK1A 1ULCA 2D97A 4MGIE 2FZ1A 1H30A 4XMAA 4LBQA 1NE4A 1RMU3 1VR3A 2YMZA 1XQNA 1UOJA 2Y34A 2WBKA 1QJY2 3POJA 1ZNPA 2H6CA 2OQ7A 2JD4A 1RUJ3 4LUKA 3FX3A 1PMIA 2JIGA 3IM0A 1ENQA 1PGW1 2JE7A 2VQAA 3GNEA 3KF5A 2F17A 1WGPA 3MLLA 4GULA 3AVRA 3RMXA 3SLIA 1XNAA 4YFZA 4CEWA 3ZYIB 1F5JA 4I3PA 1Z0HA 3DPRB 4YRDA 3VD4A 3M70A 1I1EA 2WWJA 5BNOC 2WS91 3NV3A 3THPA 4QAWA 5LRRA 5EQUA 4GJZA 2RS33 1LKNA 3WNOA 2JDHA 3DGTA 4MH0E 2XVGA 1UPSA 2XHNA 4LKEA 1W8NA 1TQ5A 3KVBA 3H8OA 1UMIA 1KS4A 5CIRA 1RMU1 2H6BA 4AAPA 2R071 3AMHA 2V72A 1SMVA 3WQ0A 1DFQA 3TRSB 4E4SA 3NO8A 1OLRA 4GH4C 1WLCA 4F83A 4QDRA 3A7QA 4Q8LA 3WXPA 2HYXA 2YBSA 1PIV3 3AYCA 1YQCA 4Y1XA 4D7YA 3LSDA 3T0AA 4M01A 2JDYA 3O1MA 3T09A 3VN4A 2P3YA 5FV3A 3ZSMA 4ES8A 3WW4A 5I8TA 3AB0A 4MG2A 1KEXA 2OPWA 4S2FA 1UZVA 4Q0QA 4UBGA 3BVCA 3KLSA 3NRUA 5F37A 4EN9B 5H9PA 2WLPA 2ARAA 1TME2 4RHV2 5A3NA 4QGLA 5CFCA 4LKFA 1AR83 3T2TA 5H9RA 3VBHA 1H6XA 3CHXA 1U5ZA 2CGOA 3O7OA 3BU0A 3I3DA 3MPPG 3SNMA 3TBDA 2JDKA 2DU0A 2QTWB 1JI6A 2RDRA 3LOIA 4GXLA 1KRIA 1W9YA 2WUHA 1WLWA 5FLHA 4BZ4A 1MS0A 4N43A 1FOD2 5FPXA 2BV4A 1GU3A 3AXDA 2JENA 1PVC3 2ZMNA 5I91A 1EAH1 2DCKA 2ARCA 2OKXA 3QD6A 2QQIA 4YVSA 1LOEA 4ZU7A 5M0TA 5LEJA 1QJX3 4JGYC 4AFCA 4ASLA 4N53C 2J1VA 2RM22 3P3NA 4CUBA 5FWEA 4AVCA 4K9SA 1SLAA 1S0DA 1ZZBA 5FPLA 5GLTA 1HJFA 4XF1A 1FMD1 4ZPIA 4HVRA 3T1LA 1WZXA 2VMCA 2PHTA 3HWJA 5K4LA 2HWC1 5CEHA 4JGZB 3SXWA 1RUC1 3ZFEA 3K75B 3VDBA 4P02B 2JICA 4AVTA 4OQ8A 4P9WA 5JZGC 1DYOA 3THTA 4ZXKA 3CJIB 4NRQA 3M3QA 5CYYA 1XE7A 2FDJA 1PZ8A 1RUF1 2JG9A 3LFIA 3B9CA 1VBB2 4BJ0A 1LECA 3JXSA 1OA2A 3Q8AA 1L3JA 4PQQA 1JZ5A 2AUYA 2ZHNA 1UY2A 3ZSLA 1AR62 5ACA2 2PLV3
chains in the Genus database with same CATH topology
1HXS1 4R9CA 3VHPA 2B46X 1R093 1OPMA 4GB32 4IEZA 2V73A 5JMCA 3BALA 3RWNA 4RFT0 2MNGA 5IUQA 4AFBA 2Z5WA 4LHLA 1JN2P 3JZVA 1W6NA 1POV3 1VBE2 1C4RA 3G6JB 1HQNA 2ZGLA 3ASIA 3U11A 1YRZA 4X8PA 4A3XA 1WLTA 4WVMA 3ZXFA 3M3IA 4C1WA 1Q8SA 4KGGA 3FLTA 1COV3 1MZ5A 2A3WA 3Q9OA 3WG2A 1ULDA 3AX4A 1H8TA 2WNVA 3PMEA 4COVA 1JUHA 5KXBA 5DDJ2 2QZ3A 2E6VA 1ASJ1 3VBSA 2CWMA 2DYCA 4LNVA 4Q4V1 1V6OA 1RITA 3MFCA 2QZ2A 1XYNA 1D0GA 2OUJA 2VW1A 1LTEA 3MICA 3L2YA 4IEPA 2BVVA 4MGYE 3ZSEA 1SLCA 4Q0VA 1KD7A 2ZGOA 4XFAA 5JDBA 4KG0A 3OGGA 4WM7C 3WDTA 3IIAA 1RUH1 4EV0A 1NLSA 4CZSA 1OQ1A 2DFCA 5CA6A 1H2MA 4FO9A 3VZMA 1SCSA 2EF6A 3MIEA 4MXWA 3QCWA 2NPIA 3AMQA 3JB4C 2HWF1 2GN3A 1HIXA 4CP2A 1CAWA 3OBRA 3VDDC 1I6XA 1X7NA 3MDPA 1LODA 3B01A 3PMSA 5FPZA 2XWJB 1AJKA 4YARA 5KXEA 3INAA 2ARBA 4IV1C 2O8QA 5T54A 5C4WB 4AYUA 3FFZA 4AFMA 3AFKA 4O9EA 5CG9A 5C9AC 1RJ8A 2W52A 3OY8B 1OOPA 4B8EA 1KJRA 3IT8A 1ZM1A 2VMGA 3N7KA 4RL7A 4PJYA 3WT3A 4GKYA 4RD7A 5FQ0A 5J48A 3RMYA 3J4UH 3K51A 3OTFA 3LA7A 1RUJ2 3B5LB 3NAPA 1F5FA 4LE4A 4FOQA 4YVWB 1PNFA 5IK8A 1NE6A 3NKTA 1RGSA 5I0TA 1BMV2 1UW8A 2RS32 5LEKA 3E6CC 1BEV3 1UF2C 2HWB1 2YDEA 2ZGRA 1TNRA 4U36A 3WP5A 2RJKA 4CEYB 2Q8OA 4IV3C 1G9FA 1IZ3A 4L8QA 4LA2A 1LGBA 2QJVA 4FSJA 1VP6A 1PIV2 1W0PA 2FBEA 3VHNA 2NMNA 3RYPA 2PAMA 1BBT3 4HK8A 1OFNA 2D3PA 2DU1A 3WDXA 3TAYA 3EBRA 5D8AC 1WCKA 1FATA 3NV4A 4GALA 4DMIA 1WMFA 3EQEA 1BEV1 2K2SA 2ZBJA 1H1IA 4L99A 1KITA 2ZGUA 5JSRA 1AR82 4HKLA 2DFBA 1FNYA 2BEOA 4N7UA 2WNUB 3OYWB 5HXVA 3RDIA 4N7IA 5L36A 1ZZ9A 1POV0 1PZ7A 4PDWA 2GAUA 3KB5A 4K40A 3WDYA 5LK7B 4FTSA 1NCRB 4MVTA 4CDXA 4KGQA 4AFDA 3DN7A 1PVC2 3TN93 1O3SA 4WV8A 3E5UA 2A75A 5KHGA 3ZXKA 2HYKA 1QJX2 1LOGA 3AZVA 4P5HA 3KGLA 3ZFFB 5IK4A 2TUNA 1DG6A 1CJPA 3QOPA 3VZOA 4AGVA 4G9SB 1RVF3 4B4QA 2QCSB 4CDWB 2VGDA 4HBNA 4Z07A 1DHKB 4QMAA 3JU9A 4BMEA 3HR9A 1LOCA 4PF5A 3B9IA 2ZAHA 4WBBA 4GQ7A 1ZBE1 4FXKB 2WSUA 4XFBA 1ENSA 5CFDC 2VNGA 3O5SA 4I3GA 2ZKLA 4R9BA 1AZDA 4O9GA 4Q1PA 1Y9QA 4FOYA 2PLV2 5DZFA 2C1FA 1VALA 2D7FA 2VXRA 2PTMA 1VRH3 2EXHA 1R092 1O3RA 3LWCA 4QPIB 1IGOA 1YYNA 1HKDA 2I07B 5T55A 3RS6A 4H14A 4AEDA 2Q5TA 4UW4A 1V6LA 1D4VB 1LOFA 4YGDA 3FMGA 1Y7BA 3I59A 1ZX5A 4NHLA 3VBRA 5JCTA 2XL7A 4LTAA 1COV2 2HWE2 2IWGB 4NO4A 1CPMA 2D5FA 3VLBB 5A33B 1URXA 1DGRN 1QDCA 2R063 5KHHA 4XQWA 1N1VA 3ILRA 4KL1A 2GH8A 4W6XA 4C90A 4YZ3A 4CRQA 2R043 5BUVA 1PK6B 1UAIA 5C8CB 1AHSA 5BNNA 1NQJA 1OQDA 2D3SA 4HN0A 1OPOA 3O0XA 4OHXA 3A0NA 4DINB 4F3JA 1GANA 1W2UA 4JV4A 4ORFA 5EYXA 4LE3A 2Q30A 4M3CF 3VBUC 4AF9A 1ND3B 1QJU3 2UU8A 2ZZJA 1FAYA 4K21A 3I54A 3WQ1A 4FPOB 1R1A3 2XPJA 1DZRA 5GZGA 3J26N 1WD4A 2WFF1 2R041 1ZVFA 2DUQA 5EV7A 2GC1A 1V6JA 3IWZA 4XFFA 1MZ6A 1PGL2 1S0EA 4CEYA 5K0UB 2AYHA 3N7JA 1DZQA 2A3XA 4QPGC 1J3QA 3C2UA 4GA9A 3SITA 1RUNA 2YUEA 1A8MA 4EN7B 1UU6A 3DV8A 2PFWA 2TBVA 2R0FA 5EYYA 1NCQC 1CAXA 3IPVB 2GZWA 3VHOA 1TEIA 3V0AA 4L2NA 4EWAA 4MLOA 1YI7A 2RE9A 3ZXGA 3CNAA 2WL1A 4HPKA 3H3UA 5A3LA 2GMEA 4FBFA 1GFF2 3FFQA 1WCSA 4XE9A 1MVEA 1W6OA 5CVRA 3BOWA 5DUXA 1RUI3 4I01A 3NWKA 4HT1T 4XJAA 2R16A 4AI2A 4Y1UA 2A3YA 4BLJA 5E16A 4Q0PA 3MIBA 4AVVA 4AVAA 4XMIA 2Y26A 4LBQB 1CIWA 1WMEA 3AYDA 2D6OX 3N4MA 4PQ9A 1RC6A 4LLOA 4Q4W2 1AJOA 5JIUA 4YM2A 4CEWB 5GKAC 1XRUA 1O91A 1NY71 1BBT2 1U0AA 3ZXJA 4DQAA 1CONA 1EP0A 5HCBA 4AGRA 1JHNA 5J98B 1K5MA 1CJDA 3SMHA 2WSVA 2A7AA 1AF9A 3MW4A 3A0KA 3SCGA 2UWCA 3B7MA 4FVVA 1ZBA3 2O1QA 1DQ1A 3MIGA 2D93A 5FDBA 4LT5A 3NL1A 1AYM3 4QPIA 1PO13 1IS4A 1AXZA 3DF0A 5E89A 3TN92 5F1RA 4SLIA 4I0AA 2CWSA 4OI4A 1IHMA 1VBC1 2VOVA 3UJOA 1JTZX 1XXNA 3VKLA 5CFCB 3VBSC 3VBHB 1AYN3 1SLLA 1AL0G 3ZPYA 2G4IA 2I45A 5HCAA 4HFSA 4N43B 1RVF2 3CJXA 1R081 3QACA 5J37A 3FZ3A 1W6QA 3QLQA 4COZA 1H1MA 5ABJA 2GNMA 4UW3A 5H9QA 4LUMA 2HJIA 1SFYA 3FE5A 4B7EA 2G9GA 3RYKA 2X53S 1W6PA 4QHBA 4G3YC 4YVSB 4D7SA 4TZDA 4AQ6A 1IS3A 5AC91 3DPRC 1EPWA 3BPZA 1LGCA 5FOJB 2O0OA 2LALA 3MGUA 5B2GB 2ZMLA 1VB2A 4Q4Y1 4RA0A 2OZ6A 4K6BA 1VRH2 4FOWA 3FC0A 4INDA 1QQP3 5FMOS 1C28A 1EV13 1QXPA 2XJRA 4W6YA 1DDLA 1NZCA 1SBDA 2JG9B 2WQZC 1YJKA 1RUD3 1Q43A 2ETEA 5JOZA 4XBQA 3R05A 1MEC3 4LBKA 4QQLA 4J6GA 1VJ2A 5K8SA 4Y1VA 2ZAAA 3AP5A 1CN1A 1ZYBA 4OUMA 1OHFA 1SFNA 5K9YA 2R062 3WD5A 4KH9A 2LUWA 1IS6A 3M3EA 5I8SA 1W6NB 1WW4A 1HX6A 2PAKA 3ZDSA 3ZYGA 4I02A 4D7TA 5GLWA 4LHNA 3MEPA 4WVMB 2ZS6B 3DUIA 4PLNA 3LAGA 1MEC1 4NHMA 2WKKA 2E7TA 2IXJA 3AKRA 3RJRA 1WBLA 2ZACA 3GALA 1H8TB 2WNVB 3N7MA 3SH4A 5C6CA 1NLRA 1QJU2 4KWJA 1WLDA 4KBBA 1WD3A 4XQDA 2WS93 4D69A 4M0HA 5T52A 1VBD1 4NWWA 1R1A2 2JG8A 1WMDA 3H0OA 2ZMKA 5JOYA 2BFUL 2PELA 1ULGA 3HIFA 4OLLA 4JGZC 1G9BA 1SQ4A 2YGLA 1ZZCA 1NG0A 2R073 1AX1A 1OD5A 3CJIC 4AFAA 1DF0A 2P17A 4AG4A 3S6PA 2Y0IA 3LSEA 1OI6A 2D5HA 3PJQA 5F6LB 4I2OA 4A7KA 2QKDA 5C8WA 3H7YA 3W9AA 5L7OB 5JIAA 1NA1B 1SCRA 4DNYA 4FPYA 4MXWB 4P9JA 2IC1A 4XFGA 4JAAA 1CAWB 3CF6E 1YIPA 2C0ZA 1QWRA 1JYCA 1ND2A 1DQ2A 1HRI1 2XJUA 4WM8B 1V9U3 1RUI2 2A5ZA 4DXZA 3PVBB 1XYOA 1OOPB 1EAH3 2JE9A 4ZU5A 1YJLA 3ZXLA 2ZGKA 2WFPA 4HZFA 4COWA 2WNEA 5FQ0B 1QMJA 3S0MA 2BWAA 1AR72 1OLQA 1D0HA 1U5IA 2VH9A 2DVAA 3PVOA 3GHMA 3RSJA 1LULA 4JDOA 1GKBA 4GWMA 1ALYA 2VOXA 3DKWA 3NAPB 4XHXA 1FMD3 3KCCA 4TLFA 4A7ZA 2HWC3 3M2MA 3UKNA 4E4ZA 1RUC3 2MEV1 4FPGA 5IK5A 1V9U1 3MPBA 4A7YA 1IKQA 4LHKA 1REFA 4G4FA 3AKPA 1QHDA 3D6EA 4BLIA 1MQTA 3JCIA 1AX0A 4XFCA 5BY5A 1RUF3 2XVLA 1EPZA 3EO6A 5H9SA 1RJ7A 5C33A 1UZZA 2CYFA 2AGSA 4BQ1A 1LOBA 5I0UA 3VUOA 1OMIA 1ZBA2 1HXS3 4Q1RA 1CQ9A 2Z2SB 4AQSA 4HMZA 3E6BA 1PO21 2ATFA 3ELNA 1AYM2 1PO12 3B69A 3E5QA 5KC6A 3WP4A 1F9KA 3FBMA 3ZYPA 2D43A 3O0WA 1SBEA 2KM2A 4FTBA 4QGMA 1UIKA 5C4WC 2D40A 2P37A 4Y5Z0 1J3PA 1FPN1 4BHPA 1C8M1 1G8WA 1AYN2 1FV3A 4I30A 4BIFA 4KNCA 5FMOL 4PDWB 3BCWA 1GYKA 1IS5A 4CDXB 1ASJ3 1FT9A 4YFWA 1YLLA 2EXJA 2R1DA 4JCKA 4Q4V3 4YVWC 4PLOA 4XBLA 2D6MA 3VBOA 4E4DX 4R9AA 1S1AA 3FWEA 2VU9A 4I0BA 3VKNA 1S0CA 2UYBA 3WLUA 1N1SA 5LRSA 1W6MA 5GLZA 5T5LA 2ZOEB 3KQRA 4LO8A 2CNAA 2D3RA 1QJZA 2GDFA 2VG9A 4QM8A 2HWD1 1O5UA 4CEYC 5BNPA 1RTVA 1NOVA 1QU0A 1QQP2 1RUH3 4LBNA 1ZRCA 1EV12 3AYAA 3FJSA 3T1MA 4DRRA 2AZ5A 4BE3A 4PIXA 2W39A 1F2NA 2GH2A 4XW3A 1RUD2 4LBMA 2ET1A 2HWF3 2ZJCA 1DBNA 4AI8A 2IXIA 3TNPB 1OSGA 3ZXAC 2DV9A 5E88A 1D4M1 3D8CA 4EJRA 1LHVA 3IDEA 3W59A 2BUKA 2Q4SA 2RMU1 1VBA1 1AL21 3AZXA 2O8OA 1SEFA 2E51A 4AHYA 4AEDB 2WNUC 3WHUA 5L7OA 1WW5A 1NA1A 4GWNA 2GU9A 3NJZA 3I59B 1MS9A 3VBRB 1HDKA 1NCRC 3D0JA 4NWVA 2IFRA 1CAVB 2X5IA 3JUUA 1APNA 3D82A 2YHJA 3ST7A 4TSVA 2A6WA 1PGW2 2DCTA 5DUVA 1JUIA 5BYNA 2E9QA 4MX3A 2DUPA 4WM8A 4UXAA 1UZYA 2WS92 3ZFFC 2E7QA 1O3QA 4IEWA 2OA2A 2Z69A 2NN8A 4XF3A 2XUMA 3ZMNA 1C57A 4Q4X1 2R32A 2EIGA 2HWB3 4B4PA 3KMHA 3O12A 5EFUA 2NP0A 4CDWC 1Q8QA 5I93A 1Z7S1 2HEVF 3FLRA 3OBTA 3KGZA 5BNNB 2R0HA 3R4UA 1RMU2 4EWEA 1Q8PA 1VAKA 2R072 2ZX1A 2ZGSA 2QNKA 4DS0A 5BXXA 2A73B 3AMPA 3APBA 2YY1A 2ZPXA 4IESA 3SH5A 1HQWA 1H4GA 1REDA 2P3JA 2BGCA 2A6YA 2WZR1 4GMP1 1S0BA 5FAXA 1W0OA 5A32A 1G9DA 4QM9A 3WQ7A 3I7DA 2ZHMA 3LCPA 3AZWA 3MIHA 3ZIWA 4QPIC 1AUYA 4ONUA 1OA4A 1PZ9A 4XFIA 3USUA 3WG4A 3QH7A 5FFOC 4Z92B 2H0BA 3WHTA 3CU7A 1BVVA 1Q56A 1XNBA 4XQ4A 5GZFA 1DLLA 2QDNA 2A6VA 4NHKA 2ZHLA 1B35A 1CAXB 2QVSB 3KM5A 3O0VA 4HETA 1EAH2 4AEJA 3AXEA 3V0AB 1J59A 1A8DA 4AEMA 1PM7A 4WVVA 3NSTA 2GNDA 1TMF1 3M3CA 4HPKB 4AVBA 4RR3A 1H8VA 2GNTA 4J1WA 1LCLA 3JBG1 2DTWA 5DUWA 1W6OB 1FMD2 4EN8B 3WW3A 1PK6C 1RUG1 1VLNA 3RI8A 2HWC2 4BM8A 4HSJA 1RUC2 5C8CC 3GBWA 4RQPB 3K48A 1ULEA 3HMYA 5FLJA 2D98A 4XIKA 2Q1ZB 4OUSA 4L97A 4CP0A 1ZBE3 1GLHA 1ND3C 1RUF2 4Y24A 1KDMA 3WINE 3IDBB 5EWSA 3BIWE 4FOVA 2RR11 1VIWB 1ZRDA 4KU7A 3AM2A 1HXS2 2D6LX 3OPZA 1C3HA 4COYA 5JI9A 3ENRA 4DPNA 4YW1A 1H2NA 2WINB 5K0UC 2DCZA 3CLPA 3M1HA 4NPRA 2NLRA 2KXLA 2VW0A 4YM0A 4YGCA 4ATFA 1K5MB 2OUHA 3ZXEA 3I8TA 4GH4A 4LA3A 4AXOA 2UY9A 1AX2A 3BODA 2VVEA 4FPCA 2PHDA 1CX4A 2NM1A 1BXHA <