3VBUA

Crystal structure of empty human enterovirus 71 particle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
225
structure length
218
Chain Sequence
HSTAETTLDSFFSRAGLVGEIDLPLKGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTKDLEYGAMPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome Polyprotein, capsid protein VP1
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
molecule tags Virus
total genus 34
structure length 218
sequence length 225
ec nomenclature
pdb deposition date 2012-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vbuA00
5AC93 4CEWA 2GH8A 1COV1 1VB2A 4QPGB 1QJU1 4WM8C 1Z7S3 1AL21 1AR93 1PVC1 5L7OC 1EAH1 2RS52 2RR13 1BBT1 3VDDA 1ZBE1 1RUG3 4RS5B 4RQPA 2BBVA 1FOD1 5BNOC 5BNNA 2WZR3 4Y5Z0 1RUF3 2MEV1 3JBG3 4N53C 3ZFFC 4CEYC 4Q4W3 3CJIC 1NCRB 4CDUA 1ZBA2 2XBO3 1PO21 3DPRA 1GFF2 1B35B 1QQP1 5CFCC 1RUJ3 1R093 1VBE2 4QPIB 1OOPA 4RHV1 5CFDC 3J8F1 2HWC2 1RVF2 1RUH2 3VBUB 4FTSA 1VBD1 1HRV3 4Q4Y1 2RMU1 4NWVA 2DF7A 1MQTC 5GKAC 5L7OB 1RUD1 1AYM2 3JD73 3ZFEA 2WFF3 2HWE3 5BNOB 1PIV3 2PLV1 2R041 1AR82 1PGW1 4N53B 1D4M1 3ZFFB 4CEYB 1W39A 1VBA1 3CJIB 1TMF2 2HWF3 1X33A 5FMOL 3VBHC 1C8M1 4JGYC 3LOBA 2TBVA 2RS33 5CFCB 4QPGA 2HWB1 2RM21 2BUKA 4GB32 3VBFA 5CFDB 3JB8A 2ZZQA 4RS5A 1HRI1 1MQTB 4NWWA 5AC92 1NCRA 3VDDB 5K0UC 1Z7S2 1AR92 1MEC3 5FMOS 1B35A 1R081 5A33B 2RR12 3VBHB 1QJX3 1K5MC 1RUG1 4Q4X3 4QPIA 4JGYB 3VBOC 2WZR2 5BNPC 1RUF2 3JBG2 1AYM3 4AEDC 3VBUA 4Q4W2 2XBO2 5L7OA 1AR73 1AYN2 1RUJ2 4FTBA 1AR83 1NOVA 1R092 4CDWC 5ACA1 5BNOA 4RFT0 5C4WC 1BMV2 4RR3C 1RHI3 2FZ1A 3S6PA 4N53A 3ZFFA 1RUC3 4CEYA 1HX6A 1A6CA 3CJIA 2ZTNA 1HRV1 1VRH1 1PGL2 3ZXAC 4GB33 1OHFA 1EV11 5CFCA 1V9U1 3JD72 1K5MB 1RUI3 4N43C 2HWE2 3TN91 3VBOB 5CFDA 5BNPB 1PIV1 1RUE3 4CDXC 2HWF2 1VBB3 1MQTA 4YVWC 2VQ0A 3VBFB 2IZWA 2RS32 1H8TC 2RS51 5C4WB 2HWD3 1CD3G 1R1A2 4RR3B 1FMD2 5A33A 3VBHA 1X36A 5LK7B 4JGYA 1PO13 1ZBA1 1AYN3 1ASJ2 1TME2 1ND3C 1VBE1 1MEC2 1NG0A 1HXS2 1QJY3 2RS13 2HWC1 1RVF1 4YVSC 1QJX2 4CDXB 1RUH1 4Q4X2 3VBSC 1RMU2 4GMP1 4WM8B 4YVWB 4JGZC 1F2NA 1BEV2 2BFUL 4CDQC 1AYM1 1H8TB 2X5IC 2Y26A 5C9AC 5JZGC 5C8CC 1AR72 3FBMA 2QQPA 5DDJ3 1AR81 1K5MA 3VBOA 1NCQC 1TMF1 3VBRC 3ZFGC 5BNPA 1IHMA 1RHI2 1NY72 1RUC2 1ND3B 1POV1 2R063 4GB31 1R1A3 1F8VA 1FMD3 4GH4C 4YVSB 4Q4V2 1DDLA 2BFUS 1RUI2 3VBSB 4JGZB 5C4WA 4RR3A 2WWSA 1COV3 4CDQB 1VBC2 1C8M2 1QJU3 1RUE2 5AC91 3NAPC 1ASJ3 1TME3 1AL23 1FPN2 1PVC3 1VBB2 5C9AB 5JZGB 1EAH3 1Z7S1 1AR91 1BBT3 2ZAHA 1HXS3 1ZBE3 2RR11 1NCQB 3VBRB 3ZFGB 2HWD2 1RMU3 1M06G 1BEV3 2WZR1 4CDXA 1RUF1 5ABJC 1PO23 3JBG1 4Q4W1 4WM8A 4YVWA 1PO12 1QQP3 2R072 2XBO1 4GH4B 1AYN1 1H8TA 4RHV3 1RUJ1 3J8F3 1R091 4PDWC 1QJY2 2RS12 1VBD3 1BMV1 3NAPB 2RMU3 4IV1C 4Q4Y3 4IV3C 5K0UB 1RUD3 5J96B 4WM7C 1PGL1 2GSYA 1HQNA 1OPOA 1ND3A 3JD71 4Q4V3 2PLV3 2WFF1 2R043 1POV0 2HWE1 1VBA3 5DDJ2 5ACA2 4LLFA 2WS92 1VBC3 1C8M3 4YVSA 4AEDB 5ABJB 1ND2C 1AR62 3VBSA 4JGZA 1FPN3 2HWF1 4CDQA 2HWB3 2RM23 2RS31 5C9AA 5JZGA 4CDWB 1V9U2 2R062 4PDWB 1R1A1 4IV1B 1HRI3 4IV3B 1NCQA 3VBRA 3ZFGA 4WM7B 1COV2 1E57A 2R073 1QJU2 3VBUC 1CJDA 3IDEA 1AL22 1PVC2 4Z92B 1ASJ1 1TME1 4N43B 1EAH2 1R083 1BBT2 1MEC1 1ZBE2 4GH4A 1HXS1 1ND2B 4FTEA 1FOD2 2FZ2A 1QJX1 1NA1C 4Q4X1 2MEV2 1RMU1 1BEV1 3NAPA 1PO22 5A32B 5K0UA 1AL0G 1QQP2 1AR71 5ACA3 4RHV2 2WS93 3J8F2 1AR63 1C8NA 5D8AC 1VBD2 4CEWC 4Q4Y2 1RHI1 2RMU2 4AEDA 5ABJA 1NY71 1VRH3 1RUC1 2BPA2 1RUD2 1EV13 1V9U3 1QJZA 3TN93 3VDDC 2PLV2 4Q4V1 4CDWA 4RQPC 1NA1B 1RUI1 1VB4A 2R042 5BNNC 1PGW2 4PDWA 1D4M2 1RB8G 1VBA2 4BCUA 4IV1A 4IV3A 1VBC1 1RUE1 2X5IB 4CDUC 4WM7A 5C8CB 1FPN1 1VBB1 3DPRC 4Y4YA 2RS53 2HWB2 2RM22 5FOJB 4N43A 1FOD3 2WLPA 5D8AB 1OOPC 3JB4C 2HWD1 2MEV3 4CEWB 1HRI2 1ND2A 1ZBA3 4GMP0 1PO11 2R071 3ZFEC 5A32A 1VBE3 4RQPB 5J98B 1R082 5BNNB 2HWC3 1RVF3 1RUH3 1RUG2 1QJY1 2RS11 4GMP3 4CDUB 3DPRB 2XPJA 4QPGC 1OOPB 3VBFC 1SMVA 1D4M3 1VAKA 5DDJ1 1TMF3 4RS5C 2WS91 1NA1A 1AR61 4FSJA 1WCDJ 3ZFEB 1HRV2 1VRH2 1POV3 1NCRC 2X5IA 1EV12 5C8CA 3HAGA 2WFF2 1B35C 2R061 1AUYA 3M8LA 3TN92 1FMD1 4EJRA 1PIV2 4QPIC 4SBVA 5D8AA
chains in the Genus database with same CATH superfamily
1A78A 4XUNA 4JTOA 2IVIB 4LJHA 5FZOB 1ZRCA 1BXHA 2WNUC 2R30A 4HLTA 5F6LB 5HPOA 1W8WA 4WM8C 5DAVA 5A3PA 1AL21 5L7OC 3QH7A 2RS52 4H55A 2RR13 4U2AA 5CU1A 3ZSJA 3ZPYA 4C0BA 4RQPA 3AMMA 1DQ1A 4IEZA 1JI6A 2F17A 4AZZA 3LE0A 3DL3A 2ZMLA 1UQXA 2N7GA 5A80A 4CEYC 4CDUA 4Z82A 1ZBA2 2XBO3 3MIGA 4FQZA 4C90A 4QX5A 1UXZA 3ILFA 2VMFA 4EZ4A 2XQXA 1YI9A 5F6KA 3UETA 4M3CA 3WW1A 1YHFA 1Y9QA 1BYHA 1R093 1VBE2 3MIFA 1GZCA 2ZGQA 4QPIB 5FPLA 1OOPA 4YGBA 3B94A 1IS6A 2LROA 3AKPA 1JU4A 3N9QA 1RUH2 4AI2A 2CY6A 3M3IA 4TYSA 4FPOB 2VZVA 3DUIA 4Q4Y1 5FMDA 4NWVA 1VJ2A 2ZHKA 1RJ7A 3CQOA 1WA4A 3CKHA 4AFAA 4MG2A 3NV1A 1AYM2 5FWEA 4ET7A 3KV9A 2XUMA 4CCEA 2YROA 2YBPA 3F2ZA 1YFUA 2O14A 3VDAA 4HONA 4OZOA 4PIXA 4SLIA 1W99A 3WEZA 3BCWA 2VUCA 4UYBA 2JIJA 2R041 1H2LA 1WW4A 4IEUA 4N53B 2R1BA 4AL9A 2OVUA 4FOWA 4EN6B 4OVEA 4LORA 5C5TA 2A6VA 1F4HA 2ENRA 4I30A 4CU7A 4LKSA 1ZZ8A 2YY1A 4XC9A 4E4HA 1UMIA 1QH7A 2FDFA 2TUNA 3POGA 4LIVA 4OCTA 1SBDA 3I54A 5JOZA 3AFKA 1VLNA 4ZY9A 1W2TA 4Z1VA 4KBBA 3IT8A 3MW2A 4GB32 3VBFA 4DXSA 5CFDB 3O1TA 1UMHA 5LA2A 5HCAA 4W65A 3ZDSA 2WRAA 3BKZA 1OURA 2ZZQA 2CWSA 2A7AA 4GXLA 1W2UA 1MQTB 1W8HA 4I02A 5CB7A 5AC92 4BISA 5A3OA 2VQUA 1X50A 3AFGA 1W9WA 2O8OA 1NCRA 3VDDB 2ZGSA 3QH6A 4AI8A 5A6QA 4W6WA 1W0PA 4HVOA 4XJWA 3ZYIB 5FMOS 1R081 2Z42A 3EBRA 3MICA 2A71A 2DTWA 3MPPG 4GKXA 5IK7A 2BWAA 4HOOA 3VBOC 1V6IA 1CAVB 2A6YA 3I2DA 4WVZA 2VCCA 4LBOA 1RUF2 1PZ7A 1GANA 3W9AA 1J1LA 3JBG2 1CAUA 3VBUA 4ONUA 2A70A 1M4WA 1KQRA 2ES3A 4TZDA 3J4UH 4GWIA 3UGFA 4R9AA 5JSRA 1Z0HA 3FLTA 4QX3A 4FPHA 2Z2SB 5C3SA 5GZFA 3WNXA 2E6VA 2VNOA 2W08A 3WW4A 4Q2FA 3GCXA 1NOVA 2JE9A 2V72A 5GALA 3OUIA 4FTBA 5FK7A 1LR5A 3E5XA 4KG0A 3UJOA 3HJRA 5BNOA 3LFIA 4XQ4A 2PXJA 4XQWA 4DNYA 1BMV2 4CCLA 2FZ1A 2XJQA 3PMSA 5C5UA 3H8XA 3ZFFA 4AQ6A 4DPNA 1A6CA 1YQ2A 2UWAA 4CXWA 3WG1A 4D6SA 3SH3A 3VHRA 5CFCA 1OFSA 1V9U1 1PK6C 2OUJA 2XGXA 3JD72 2ZPXA 5IVFA 3VB9A 1LOAA 1RUI3 3MUZ1 5FLHA 1XE8A 3RYKA 2VPVA 3TN91 4LHNA 5FREA 5FY0A 3WF1A 3FUOA 1EUTA 1LGBA 2JWPA 3N9MA 4DUWA 1ENQA 5J37A 2VZOA 4KMQA 5JPMB 1RUE3 2HYKA 1G7YA 4NRMA 2HWF2 3H42B 1GZ9A 4LBNA 3RZKA 4MX3A 3V64A 2BNOA 2X29A 4IDZA 5A7SA 4AFCA 4A41A 2IZWA 2XWBB 5JMOA 3KF5A 3O1OA 4NAMA 1OD5A 1XOYA 1W2AX 1GZWB 3JCIA 3CIHA 2TEPA 2C26A 1FYUA 1BVVA 1PMJX 2HWD3 1OD3A 3GZTB 5IJRA 3T0AA 1HN0A 3W21A 4E4DX 2D44A 1GOFA 4EWEA 4M01A 3OUHA 4A2UA 4R8HA 3EB7A 4AQSA 3H0OA 3DEMA 4JGYA 3U1XA 1PO13 4O7XA 3MIEA 1YO8A 2A73B 1Q8OA 1V6MA 5KBFA 1PNFA 3ZLIA 3FLRA 4LOTA 3ON7A 4XJZA 4YZ5A 3LQCA 4LUKA 1UW8A 2RS13 1UO9A 3C7OA 3NVCA 1N3OA 4YVSC 1QJX2 2VOXA 4S2HA 1WLDA 1JYTA 3ZN6B 1YFYA 4WM8B 5GZCA 2PHTA 3Q8EA 4XURA 2NYYA 3UGGA 3IMMA 1PNGA 4CDQC 3PVEA 3K46A 3DXUA 2W47A 3WR0A 4I0BA 5JZGC 3OG2A 5FP8A 3VHPA 3WDVA 3BVCA 4IEVA 1AR72 2ZEWA 5FPZA 3WP3A 2QQPA 4BLJA 2B8MA 4A3XA 3H3UA 3WY6A 3SQOA 3WDTA 1CGPA 1IPSA 5GJ6A 1LOBA 2VMCA 1W06A 4D6RA 5EV7A 2JG9C 2B39A 5BNPA 2BNNA 1YYNA 4FXGB 3I59A 1RHI2 2Y6LA 4LR4A 4AAXA 3PL0A 4UFHA 5IVCA 1XNCA 3KVBA 4GA9A 3RSJA 3WNLA 2YPJA 4BQXA 1GZTA 1UOBA 1W6PB 4QX1A 5K8SA 2E51A 4ITCA 4QB2A 2R063 4B4QA 3SMHA 1RC6A 4HFSA 1R1A3 3E6DA 2YDEA 5F3IA 1LU1A 2DFBA 2JDZA 3ITQA 3ZN4A 1DDLA 4BQ2A 4K1ZA 1HKDA 5C4WA 1GOGA 2OYZA 2BERA 5AVAA 2VNVA 1MZFA 2F4LA 3BPZA 2VW1A 2H6BA 3CL1A 3NAPC 5FY8A 3UESA 4AGGA 1ASJ3 4QXBA 2D6OX 1YFWA 4RGAA 2D40A 2YUEA 1HB3A 5FZAA 1Z7S1 2LS6A 3P5BA 1NE4A 1AR91 1BBT3 1PM7A 1WW5A 2ZAHA 1NKGA 1HXS3 1ZBE3 2BZDA 4I0WB 4P9GA 1O3QA 1H4HA 1SDDB 4HANA 4QPYA 2G9GA 3AL5A 4P00B 4QHZA 1NCQB 3VBRB 5DUUA 3ZFGB 1YRZA 4C1XA 1RMU3 1YJKA 5C6CA 4EZHA 4EN8B 2Z79A 2PHWA 2QE3A 4AEJA 4CDXA 5IFPA 5FJKA 4Q4W1 5IFTA 2QDRA 2R072 1W6NA 1GYKA 4CCKA 2P3KA 1SFPA 1CR7A 5FZLA 1MZEA 1QJEA 4MGYE 1H8TA 4NMIA 4QHOA 4XF9A 3IAQA 4RHV3 1ULCA 2JDKA 1F4AA 2P6CA 3H1YA 1IQAA 2CYFA 3AKQA 3R4DB 3IIIA 4OI2A 2VL4A 2EAKA 2W1UA 5CG9A 2Q8CA 3IM0A 2JJ6A 5D1IA 1QOSA 3ENRA 1TNFA 5JI9A 5DUVA 4NVPA 3MIDA 2ZXQA 1YIPA 4LK7A 1UN1A 4XYXA 3ZSKA 5ERLA 4XCBA 1H1AA 1JOJA 1RITA 1LGCA 4WZCA 4DRRA 3BU0A 1ND3A 3MBWA 3NJXA 3D0JA 4AI0A 1OBNA 5JAXA 1OQDA 4UBHA 2DU1A 3ES1A 2J42A 4NHYA 5T5JA 5DDJ2 4UWDA 5ACA2 3WV6A 3LDKA 1DHKB 3PU8A 1H6XA 2A5ZA 3KCCA 4NROA 2JECA 2WSUA 3DKQA 3O1PA 3ELNA 1FPN3 2KM2A 4JGZA 3GGLA 5DMYA 2Q30A 2ZKLA 1S0IA 2DUPA 3U37A 2H0VA 3J26N 4X8NA 1V70A 2RS31 2D3PA 1UYYA 3IIAA 3FL7A 3TOJA 2QJVA 3BB6A 1CAWA 1LODA 1H6YA 1IZ3A 1N1YA 3TRSB 1R1A1 1SPPB 4IV1B 4QM8A 1W8UA 4IV3B 4A7YA 1JYIA 1NYWA 5F1RA 1OFNA 1W6MB 5T50A 5TSWA 4JCKA 3KCXA 1UF2C 2YHJA 2ZABA 2HH9A 5FY1A 4HSJA 1EP0A 3ACHA 3VKOA 3IDEA 1AL22 4BDVB 1ASJ1 4JRAA 2VZRA 1KGYA 4PBOA 2OPWA 3H8UA 4OFGA 1JH5A 4HN0A 4Q5OA 5CVRA 1MEC1 5F5AA 3IDBB 3NNMA 4GH4A 4XF4A 4ASLA 3V0BA 1HXS1 2EXHA 4IQPA 4GJYA 4HKLA 4DZGA 3AZXA 1F15A 4Q4X1 4BWOA 2ARAA 2UU8A 1RMU1 1LHOA 2VECA 2Y6FA 1KXGA 2GU9A 2PA7A 2CL2A 3BIEA 3IBMA 3VDBA 3AM2A 3ZYRA 1DFQA 5IYYA 1AL0G 1Y4WA 5A70A 1DGLA 1GV9A 1AXZA 3T09A 2EICA 1T2XA 3DF0A 2VXJA 3I3EA 4LMFA 1UY4A 2WABA 2VUDA 2W52A 1ONAA 5AFEA 4K6BA 3Q8BA 2YC2A 4XILA 3KF3A 1DZTA 3M4FA 2XLAA 2VCMA 2UY8A 4CEWC 4CXXA 5F3CA 4Q4Y2 2JB8A 4QX2A 1NY71 1U5YA 5FOBB 2EXJA 4M4RA 4I09A 5A1AA 4ES9A 1U5ZA 3GHMA 2DTYA 4V1PA 5KC6A 1KS4A 1QJZA 4A42A 4AGVA 1S4CA 3RFRA 2R042 3WD5A 5FMBA 1LEMA 3ME2A 2FQPA 1UYZA 5A7WA 4HKWA 4META 2VVDA 1L7RA 1QOOA 3LDBA 4OLLA 4CP9B 1FPN1 1VBB1 2JD4A 1ZM1A 4BB3A 3POIA 2Q8DA 3NW4A 4Y4YA 2ZHNA 1S0JA 3NKGA 4AOCA 1V6JA 4HPKB 3WQ1A 4MGKE 2R7EB 2X53S 2ZS6B 5EPAA 2HEYF 2Q8OA 5LA0A 3WQ0A 1AJOA 2MEV3 3SH5A 4B7EA 4B4RA 4I2OA 1LGNA 2YU2A 3GZUC 4AFDA 3KZ4C 1ND2A 4OHVA 5CADA 1JN2P 1WWYA 4JDOA 4YW3A 2OW4A 1VAMA 4UF0B 3T08A 4GWNA 5KWRA 1OSGA 2YBSA 1PMIA 1ZX5A 3RGBA 2JKBA 5GZEA 4QPWA 3MF9A 3ZDVA 2P3YA 1F5FA 1ZA4A 3HD8B 4N8MA 1MVQA 1R082 5BNNB 1F5JA 2D98A 4XDQA 5IVVA 2HWC3 1RVF3 4RN5A 2ZX0A 3FMGA 3M3EA 5BNQA 2E53A 2X05A 3SCGA 2DURA 3DPRB 4OI0A 4RL7A 3M7AA 4D7YA 3BYWA 4MZUA 3AZWA 2AC1A 4OI4A 5DUXA 2IVJA 1XE7A 2ADEA 2HBTA 3TNPB 1YJLA 5FUNA 2WN2A 5FQ0B 5JOWA 3DKWA 4DXZA 1D4M3 3WUDA 4BIOA 2V5YA 5F9TA 3ROUA 1XYNA 2BU9A 5GZDA 1TMF3 5JR2A 5FYYA 2W3JA 1AJKA 1JTZX 1NA1A 2DUOA 4Q8LA 4QXHA 3ZKYA 2WYSA 1HLCA 2B9UA 3C7GA 2WIIB 3HQUA 1W9YA 1WCDJ 2ATFA 2DVDA 3AP5A 1LEDA 3D3AA 3NV2A 3WDWA 4JKLA 4LBLA 3W5MA 1O59A 3KGZA 2YB7A 1CAXB 4E2SA 4DY3A 2XL7A 3TN92 5GM0A 1ENXA 4EJRA 5JCTA 1KEXA 4QPIC 4SBVA 2FD8A 3HNBM 3L2YA 4PHZA 3BTXA 1AZDA 1WBFA 1UYPA 1X7NA 2WZ8A 4BQ4A 1COV1 1VB2A 2VR4A 1JZ7A 5HBAA 2VTXJ 3OCPA 2BVVA 4J1WA 3DYMA 5EYYA 3RZLA 1O8SA 2P34A 3OBRA 3ZXGA 1WLWA 3VDDA 3LSDA 3P3NA 1RUG3 3WCSA 2OQ7A 1HW5A 5L73A 4B1LA 3O1RA 5H9SA 4CU9A 2WZR3 4E8CA 3T3YA 1OA3A 4AHZA 1JHJA 4FPJA 4L92A 2MEV1 4AF9A 4N53C 2O8QA 4YW6A 2VVEA 5BUVA 1FAYA 4AVCA 3O1UA 2XWJB 2VC9A 1PO21 3KSCA 3P3PA 3GJAA 4CUCA 5T5OA 1QQP1 2XB6C 4NUBA 1RUJ3 2JE8A 1ZREA 3EXUA 4GWJA 3H8RA 2W46A 2GALA 3UYJA 5EWSA 3BI3A 5D21A 1RXFA 3J8F1 5CFDC 3V0AB 3USUA 4AHXA 2GMEA 2VM9A 4Y22B 1R1ZA 5LASA 4FOVA 3A0KA 3T1MA 4D69A 1VBD1 5K7PA 1HRV3 1MS4A 1OUSA 2RMU1 2DF7A 4MLOA 4LBQA 1MQTC 4PI0A 1VRBA 2I45A 1TZOA 1RUD1 1UU4A 2K0GA 4L99A 1W6OB 4XE9A 3WXPA 1UNBA 1DQ6A 1WCKA 3ZFEA 3ZYGA 3NJYA 4Z2WA 3VKMA 4ES8A 1BK0A 1CESA 1ULDA 2EVXA 4KL1A 5I0DA 2HWE3 1GNZA 3SEEA 1XSRA 5FPXA 5JXJA 1PIV3 5A3UA 2BOJA 1O5LA 2P3IA 1JUIA 4FFHA 1NT0A 1PGW1 4XABA 1D4M1 1DLLA 3WF0A 4AI1A 3CJIB 4NPRA 4CPBA 3THCA 3WNOA 1WMDA 5E16A 2GN3A 4PCRA 2WA4A 4O61A 1CIWA 4OUSA 3P6BA 4KBZA 2TBVA 3OYWA 2PAKA 1UZZA 3AJZA 4Q8KA 4QPGA 1MS3A 4M3CF 1I1EA 2HWB1 2RM21 4MHUA 1UZ0A 3WG3A 3WP4A 3I2KA 1AF9A 1QJFA 1N47A 2JG8A 1JOPA 3HPNA 2R49A 3JB8A 1MS1A 3KCYA 4RSUA 1MS9A 1NLRA 2CAVA 2G9ZA 3Q8CA 3T0BA 3MUY1 3I3QA 4RS5A 1W3XA 2WL1A 4XOGA 1AX2A 5K4LA 4R4XA 4NN0A 2VCAA 4URTA 2NQYA 4HN1A 4F83A 4C1WA 1C4RA 4KWUA 2GC1A 3SCHA 1C5IA 2WFPA 2DUQA 3ATGA 4LE3A 1LESA 2NP0A 3ZM8A 1Z7S2 1AR92 4QD2A 4IW3A 2XUEA 1B35A 1XBFA 1YQ5A 4YM0A 4N7IA 5A33B 1VMJA 4YG3A 3VBHB 1LECA 2ERFA 2VO5A 2VY0A 2ZJCA 4JAAA 2E31A 4MV2A 1RUG1 3UKTA 4E4SA 4MUVA 1UX7A 2A6ZA 1XB9A 2WAAA 2EA7A 3RZMA 3M2MA 3R4UA 5A1LA 3WNMA 2NZ9A 2WAOA 3INAA 3DV8A 2WNUA 2P17A 2DVGA 4JV4A 4Q4W2 4UFJA 2YGMA 4FP3A 3ST7A 2VAUA 5L7OA 1NE6A 3L9JT 4BE3A 5FYCA 3CU7A 3GCWA 4Y1VA 5FZIA 1OLRA 4BK5A 1AR83 1NXMA 2R1DA 3E6CC 1WKYA 4LBQD 1R64A 3HNMA 3LGRA 4QQPA 5H9PA 5IVYA 5ACA1 5SV5A 2KA3A 4RFT0 1ENSA 3A23A 4P9IA 1LKNA 4QKNA 4ZXKA 2GMMA 4XHBA 4X6RB 5IW0A 4CUAA 2RDRA 1RUC3 4CEYA 2BJSA 2ZTNA 1GKBA 1HRV1 2DVBA 2XVLA 1O3RA 3I2OA 1IQDC 4GWMA 4IEOA 1F31A 4S2FA 5KC5A 2E7QA 4Y24A 1AX0A 4UI9L 1SBFA 3MLJA 2VZTA 1K5MB 2PFWA 1KJRA 3CO2A 2GMPA 4N43C 3ZXEA 5DXDA 4OQ9A 5FRAA 2QQKA 3W5NA 1PIV1 5EQUA 3L2HA 4LO4B 2WINB 3EQEA 1SLTA 3PJQA 4YFWA 3UL2A 2GN7A 5FY7A 4AVAA 1LCLA 2BYVE 3ILNA 4RA0A 2VBPA 2VU9A 4XFFA 1YC61 2RS32 3HWJA 3ZXFA 4AQ2A 2LM3A 1SHWB 4M4PA 5DZEA 2VNRA 1UD1A 4J6GA 4XACA 3RPQA 5FY9A 5ANNA 5H9RA 5T54A 4A4AA 1R1A2 3I3BA 4RR3B 5FXWA 1N3QA 1FX5A 3ECQA 4R52A 5IUQA 1Y7BA 4Y1YA 3WF4A 2W94A 5FO8B 4FI9A 4FFIA 4YFZA 5FZHA 1O4YA 4XF3A 5B4NA 2Y33A 3B9IA 4UOJA 1D4VB 4NHKA 2DVFA 1KFUL 2DU0A 1ENRA 1AYN3 1ASJ2 4PT6A 4XFHA 4XF0A 3I7DA 3OGVA 5AVPA 4A3ZA 3OBZA 2Y6GA 4HBNA 3LOIA 1Q8PA 1AX1A 4B1MA 1MEC2 2ZGUA 1HXS2 4BMEA 3AP9A 1DLCA 1QJY3 4DS0A 1ZRDA 5T5PA 3OPWA 3ZPOA 4XFGA 1V6KA 3HBZA 4M0HA 3S7IA 4Q4X2 3K3NA 1RMU2 3WHUA 4YVWB 4IEPA 4KWLA 1S0DA 2FDGA 4BH9A 1UY1A 3H7JA 2EF6A 2ZGOA 3K3OA 3MEPA 4YLZA 4UFMA 1XNTA 2C9KA 1LTEA 2D6PA 3AYDA 3I4IA 2ZBJA 4OHXA 4ZU5A 1ZRFA 2X5IC 2RDSA 2Y26A 5JXIA 4EV0A 1KD7A 1HB2A 1TE1B 4LO7A 4IL7A 4LITA 4QAWA 5C8CC 1H1IA 4KU7A 3T30A 3AKSA 4QX8A 1UOGA 5C7GA 3KHBA 5IT6A 5FXZA 2PHLA 1OXCA 3O5SA 1AR81 4HG6B 4YZ1A 4QQLA 1NCQC 3VBOA 3O0WA 1ST8A 2C6SA 3VBRC 3ZFGC 4AG4A 4NIHA 2E7TA 2Q1MA 3KV5A 5DZFA 1NY72 4YZ2A 2Z69A 2PAEA 2HEWF 1RGSA 4AVBA 2QDNA 1H2KA 1WW6A 2QNKA 3ZO0B 5F39A 3S7EA 1POV1 4NIDA 2CWMA 3IDAA 4CRQA 5A3TA 5BPXA 3WF2A 1UKRA 4NIAA 5T55A 1BZWA 1F9KA 5GLZA 1SLBA 2BFUS 1LHVA 3RRDA 3NNLA 1C1LA 3VBSB 5J1XA 1APNA 2NM1A 4XJAA 4ARXA 5LZ6A 4IEXA 4S2DA 3HVDA 2ARXA 1SPPA 4OQ8A 5A3WA 1GNHA 1QJU3 3HMYA 4A45A 3ZVXA 4LUMA 2JDAA 5BYNA 1QWRA 1PVC3 1FPN2 1VBB2 2Y38A 3QD6A 4ORFA 5C3RA 5C9AB 1EAH3 2D3RA 2BDRA 3IPVA 1U0AA 1W05A 5A6YA 2X09A 5HXMA 3URFA 2CV6A 5C33A 1PK6A 4BU2A 3UKVA 2VVFA 2HLEA 3NJVA 1Q56A 2RR11 2W1WA 5FP9A 1ODMA 1MZ6A 1SDWA 2KXLA 2WO2A 3GBGA 3GYDA 3O1MA 1K12A 1CIYA 1KS5A 2AR6A 3K4DA 4F7ZA 4Y33A 2JDMA 3K77A 1LAJA 1LULA 1JUHA 5FR3A 3GF6A 5DAQA 3RMXA 4O9GA 3OTFA 4B7KA 2XBO1 2QZ3A 2BNMA 4A7ZA 2QQWA 1A8DA 2WO7A 1UY2A 4LEJA 3VUOA 1AYN1 1W90A 2D6MA 3B93A 2ZMKA 4IUGA 1GUIA 2DCTA 2ZGTA 1B09A 1R091 5LBBA 3A4UA 1QY4A 1US2A 1Y9GA 1W6QB 4A6SA 4CP1A 4DUXA 3BUCA 2WWUA 5C71A 1RTVA 4IV1C 3PVNA 4IV3C 2ZX1A 4E4ZA 4K3UA 2ZGPA 5I0SA 2AACA 2CNAA 3VV1A 3ZIWA 5CKQA 2WUHA 1JZ8A 3GZEA 1PZ9A 3N7KA 4D0QA 3R0RA 4P9JA 1Z78A 3LEMA 4HK9A 2RV9A 1OPOA 5L36A 2QZ2A 4Q4V3 2PLV3 3KVAA 3BIWE 1IKQA 2MNGA 2VUJA 4Q27A 2NPIA 2HJIA 4AYUA 1VBA3 3LA3A 3CDZB 3OOXA 4Q1PA 4YVSA 1VBC3 1C8M3 5ABJB 2JD9A 2EXKA 3BGAA 1G9BA 2Y0IA 4Y1XA 3RWNA 3WW3A 5FLIA 3B3QE 4CDQA 2V4AA 5HCBA 5G04L 4AFMA 3NWKA 3QBQA 1J3QA 4YGCA 3BTZA 2ZAAA 3O1SA 3G7DA 4L0PA 3J7LA 4XHXA 5JZGA 4JVAA 1WLTA 4HSLA 2Y60A 3GBFA 1REEA 2VZPA 4A44A 2WWJA 2E63A 4FT8A 4PDWB 1ULOA 4W6XA 4B29A 4E2QA 5JPNB 4QM9A 5CG8A 1GU3A 3D5OA 3ZYHA 1HRI3 4NIGA 4D3WA 2UWBA 4MGTA 5LB6A 2JG9A 1QNWA 4FPCA 4WM7B 1LHUA 5CKMA 1COV2 2VQTA 2WZPP 3WF3A 5CA6A 4XUTA 3VBUC 5LBFA 1C1FA 5FZCA 4XQDA 5E89A 4N43B 1CJPA 4P02B 5FZFA 3CLPA 3POYA 2C24A 1SCSA 2X10A 3LEGA 4LKDA 3KWVA 5F2SA 1QXRA 1GQPA 2W9XA 3ZXKA 1SLCA 1CPNA 2QQVA 2MEV2 5JWPA 3RI9A 1BJQA 3KV6A 2WR9A 2VOTA 3NAPA 4MVTA 4JKKA 1UU6A 3OBAA 5FLJA 1PO22 3ES4A 3RS6A 5JLVA 2HYXA 5K0UA 1C57A 3FHIB 1KITA 1LOGA 1QQP2 1V0AA 3U4SA 2HEVF 3Q9OA 4XTMA 1LB2A 3UK9A 4YYOA 3J8F2 1AHSA 1AR63 3FHAA 1C8NA 3N7JA 2DCYA 3AMQA 3HOBA 4AGRA 2JDUA 4MXWA 3UJQA 1VBD2 1SBEA 4YARA 5ANQA 3WHTA 2VCBA 2QCSB 2RMU2 4AEDA 4P5YA 5DAWA 1VRH3 2EXIA 3SCFA 2G9FA 4JDMA 2YFUA 1RUD2 4PI2A 2WC2A 1EV13 2XJTA 4FFFA 2EALA 4NRPA 1IKPA 4KGGA 1LENA 3KS7A 2HKXA 2QQNA 2DDUA 4FXKB 4JDNA 2C5DA 5G05L 4Q4V1 4CDWA 1RUI1 1VB4A 4FPYA 4J25A 1HV1A 5BNNC 5I0RA 1PGW2 3AMPA 1D4M2 4WVMA 5BXXA 1RB8G 2W5FA 5B2GB 3N7LA 4XCAA 5LA1A 1VBC1 1RUE1 2DFCA 4KWKA 4GJZA 1G6NA 2X5IB 1RUOA 4QGLA 5C8CB 3LWCA 2CGNA 3DPRC 2EIEA 1VR3A 2XONA 1OKQA 2RS53 3HN1A 4UW5A 2J22A 1A8MA 2HWB2 2RM22 3ZR6A 2R0FA 1QXPA 1K42A 1S2KA 3BU7A 4DXRA 3NO8A 3ILRA 1FOD3 1W8NA 1ZYBA 2E7AA 1UIKA 2WLPA 1UZWA 1JBCA 1EY2A 2WNVB 4P5HA 1NX9A 1CZSA 1XNDA 5D8AB 4B4PA 2HWD1 2UURA 4XBLA 3R6SA 1W0NA 3MF6A 3OY8A 4UFIA 5FXXA 4CA9A 5BV6A 4CUGA 2GC2A 1ZBA3 3LD8A 1E5RA 3BOWA 5GZGA 5EHDA 1BK1A 1PO11 5LRSA 1XJAA 1HB4A 1YXWA 3LSEA 5A32A 1VBE3 2Q4SA 4RQPB 2D5HA 1H30A 1XQNA 2ARCA 1GICA 4XETA 2IXKA 5FPVA 4MOAA 1RUH3 1RUG2 1T6GC 4Y20A 5FZ8A 2RS11 4GMP3 1W9FA 4CDUB 3WW2A 2X8KA 4ARYA 4COUA 3PJYA 2I07B 2QQUA 1N1VA 3N35A 5HV4A 3PIJA 4FPKA 4M3CB 2CDOA 1VMHA 3DN7A 2Q1ZB 4HZFA 2D43A 2H6CA 4RD7A 2P3JA 4FBFA 1TG7A 1OOPB 1DIWA 3ALQA 3J7NA 5LEJA 1SMVA 2ORZA 1ZZ6A 1UY0A 1OH3A 4L97A 1ZA7A 1WCSA 4FAGA 5LA9A 2JENA 2AEYA 2XJUA 4XFIA 3SLIA 2VZUA 2JICA 2G4IA 4FPLA 1OMIA 3AZVA 3LIHA 1AR61 3AP4A 3J7HA 4LHLA 4W50A 4Y5TA 3VKFC 1DU3D 4INDA 1D2QA 2B7YA 2D6NA 1HRV2 5CISA 3CZUA 3BTAA 4PLMA 2EIDA 4TN7A 3GJBA 3MZHA 1O4TA 1OQEA 3VZJA 2VG9A 4LOSA 1SEFA 2YPDA 1NAEA 3HAGA 2ZEYA 1JS9A 3H3ZA 1HB1A 2R061 1PHMA 3KB5A 1AUYA 2FHRA 1JXNA 3M8LA 1Q8QA 4LHSA 4XEZA 2OUHA 1PIV2 2FDJA 5EYXA 4L2NA 2G19A 5F32A 4ZKTB 2WO1A 4G3YC 5AC93 1AXYA 4CEWA 3OB8A 3EYPA 2GH8A 4NHXA 5B4XA 3N36A 3GALA 2JE7A 5JI7A 4TSVA 2DBIA 4JHTA 4K9SA 4ZXEA 3VL9A 4Q1RA 4N90A 1H2MA 3MHZA 1WA6X 4DEQA 2CAUA 2VNGA 5CEHA 3SKVA 2A3XA 4PJYA 2JX9A 5KHJA 5KR7A 1BBT1 1Y3TA 3PNAA 1ZBE1 3OD4A 3W58A 1W3VA 1I5PA 4W8JA 1FOD1 1EPWA 4Y5Z0 1OA2A 4Q29A 1GR3A 1RUF3 3KT1A 3WDUA 3JBG3 3ZIXA 2O0OA 1BLZA 4ZHNA 1Y9MA 4RFRB 5J7MA 3CJIC 1NCRB 3KT4A 2JDYA 2PTMA 2XKPA 5CYYA 2YZ4A 4NOTA 4TLGA 2NN8A 1ZRRA 1CONA 4BPZA 1GFF2 1NZIA 5FKCA 4EYUA 4AVVA 2ZHLA 4R4ZA 3RJRA 4YSFA 3VGIA 2MPFA 3ZR5A 2V4VA 4WBBA 4I3GA 1JZ5A 3ZSMA 4RHV1 1XE0A 3GM8A 5JSPA 1J83A 5C3PA 1WD3A 1V6OA 3SXWA 3WNNA 1CAUB 4MGIE 3VBUB 3P1IA 2WN3A 3IN9A 5F5CA 1G9DA 1XSQA 5CKNA 1RINA 3ACLA 2QQOA 5GKAC 2GZWA 2Y6JA 4PIZA 4XMIA 3WP5A 4AW7A 3JD73 1H4GA 2B45X 2WFF3 2ZZJA 3KGLA 4LPLA 3T1LA 2AYHA 2ZHMA 4LBJA 3ZN5A 2VUAA 3POEA 4YM3A 4QDSA 4EWDA 1QIQA 2XJVA 5BNOB 4P9WA 2J1VA 4G9SB 5FAXA 5J09A 5EJZB 1WCUA 1AR82 3ZFFB 2D6LX 4P9LA 3VBHC 4XJUA 2HWF3 1X33A 1YWKA 5FMOL 1UMZA 2EIBA 3WLUA 1JYNA 1S0GA 1H8VA 1E5HA 1MS8A 3C7HA 2L9LA 3POWA 4I0AA 5DAXA 5LBEA 4URAA 1J59A 2W0XA 1URXA 3FC0A 4EQVA 1OUXA 5CFCB 5FZOA 3QLQA 1EYBA 2XJRA 1W28A 4UW4A 4OHYA 3GDBA 3NNJA 5A7QA 2YFZA 2VW2A 2ZGNA 4LE4A 3ZYJB 2OT7A 3O1VA 2WSVA 4CCJA 5FZDA 3D82A 5EFUA 2DBNA 3DYPA 4ZONA 2XXZA 4Y26A 3AJYA 5GLUA 1LRHA 3BPSA 4LO6B 3D6EA 1J3RA 5LEKA 1S2BA 2XG3A 5FJHA 2VZSA 5GLTA 1UU5A 2W2IA 4N7UA 1G86A 2B9VA 4QGNA 1DCSA 3BN6A 2YYOA 2D3SA 4QB1A 4KNCA 1GSLA 3OUJA 2EAAA 5FXVA 5EXOA 3AC0A 2RR12 3VZKA 1QJX3 4R9BA 3THPA 5JDBA 1K5MC 2A1XA 4QPIA 4JGYB 4Y1ZA 2JXAA 2OZ6A 4PF5A 2GNDA 4PLNA 3VZMA 1QOTA 1OQ1A 2Y34A 1YIFA 4PIYA 3OGSA 1BCXA 3U07A 2XBO2 1UYXA 5JVVA 2WT0A 5EIYB 1AR73 1AYN2 4HKOA 3NRUA 3ZXLA 1F35A 4XUQA 1R092 1MVEA 3LFMA 2JKXA 3M3QA 3FX3A 3SHRA 4RR3C 1RHI3 4P9XA 3VKNA 4D94A 3OEBA 4N53A 3UNPA 1SLLA 1ODNA 1OLQA 5J48A 5F2WA 1L3JA 1OLME 4BIFA 3VD4A 1V6NA 2GC3A 3A21A 3A7QA 4XJ9A 1ALYA 4C91A 3PVOA 3PTYA 1H2NA 5A7NA 2OPKA 3HN3A 3AMNA 2Y0OA 4QKFA 2ZGMA 4X8PA 2RE9A 5CFDA 2OS2A 3U14A 2H0BA 2XQRA 5BNPB 1JU3A 3I59B 3K75B 2WQ8A 5L9RA 2RJKA 3FN9A 4H7LA 4K21A 4TXWA 4UT5A 2ZKNA 4QMAA 1YUDA 2ILMA 1N1TA 4Q26A 1MQTA 4ATFA 3T0DA 4YVWC 1HV0A 5FZ3A 4FPEA 2D7FA 2Y8KA 2FCVA 3MW3A 1QHDA 3B02A 3E5UA 4D8MA 3VD9A 2FDKA 1OPMA 5KXEA 2I74A 3T4VA 3AX4A 5F3EA 2RVAA 4FFGA 4FOYA 3T4HB 5C4WB 3NNGA 1FATA 1CWPA 3C8XA 3EJKA 5HXVA 2RDNA 2JIGA 1ULPA 3B7MA 2FCTA 4IE4A 1IS4A 2VOWA 3ZXDA 1CAVA 2RHPA 1SCRA 3N9OA 4DFSA 1XNBA 4AVTA 1ZZ9A 4EROA 3RVHA 1OF4A 4ATEA 3SISA 3AKTA 4YZ3A 4XXPA 4YGEA 3RZJA 1WZXA 1JMUB 2HWC1 1RVF1 2PQSA 4YW1A 4CDXB 4QXKA 2XKOA 1RYYA 3VHOA 1JYXA 3VBSC 3QCWA 2ZEXA 2VOKA 3MYXA 4O9EA 1W8TA 2E32A 4NE9A 1W6NB 4R9CA 3SNMA 4KQ7A 2VGDA 1HDKA 1H8TB 3ZKUA 4AHWA 5C9AC 4E27A 5IVJA 3OGJA 5DABA 2XH6A 2CGOA 1QDCA 4OMCA 3FBMA 1GMMA 3IMNA 4GD4A 5DDJ3 3KM5A 4ASMB 1YI7A 2OZJA 2CHHA 1TMF1 3V56A 1YCIA 1IHMA 3RYRA 1MZ5A 1REFA 4FPGA 2VE1A 1K45A 3LZZA 2ARBA 3I2FA 4LNVA 1PX4A 4ZZ5A 1ND3B 5HCFA 1D0GA 3LPGA 4U36A 2XLFA 3UT0A 1ZZBA 3VD7A 2AGSA 4ZS2A 3H7YA 1SZBA 1FMD3 4PQQA 4BXFA 1W9SA 4Q4V2 1P8JA 3J7MA 3FHQA 1RUI2 1GZWA 1C5HA 1CZVA 4JGZB 1NUKA 4Q0PA 4AWDA 3POFA 2WWSA 2ZCWA 3O0XA 1VBC2 1C8M2 4IERA 1RUE2 3N7MA 4Y3OA 4RGKA 4BMBA 4CU8A 5A1FA 1TNRA 4QGMA 1TME3 1AL23 2PN5A 4DUVA 2BW8A 3NL1A 1CAWB 4FCAA 2BBAA 1PMHX 1YQ8A 2ETEA 2IXJA 2ORXA 2WA3A 1QNYA 5FPAA 3FBYA 3VHNA 3B01A 3ZXJA 2Q0AA 1DGRN 2LTNA 2HWD2 4AI3A 2MHFA 4LBMA 4UW6A 4XIOA 3S30A 1BEV3 1BVP1 2WZR1 3FJSA 4CVUA 1ACCA 3AKRA 4XJ8A 2XL9A 5ABJC 3KT7A 3ZN6A 4WM8A 1UZVA 3SKJE 4QU1A 1PO12 1AVBA 1O8PA 2GDFA 3MV01 4UBGA 5DZGA 5FMCA 3PUAA 1OI6A 4GH4B 5T5LA 3U10A 5FTTC 3V0BB 1KRIA 1CQ9A 2OQ6A 1PZ8A 1RUJ1 2W68A 4TWTA 3RMYA 4Q0VA 1W2OA 3OGGA 2DV9A 5A6ZA 1LHNA 3LA2A 4PDWC 3SC7X 2DCZA 2RS12 2ZGLA 5FZGA 3WCRA 4Q4Y3 5KXDA 3MDPA 1DG6A 4O65A 1DYOA 4WM7C 3FFZA 2DCKA 4XAEA 1PGL1 2WQZC 1HQWA 2GSYA 3UKNA 2QVSB 4XFBA 4CPBD 1VAVA 1D7PM 5FP7A 5JXGA 4QHBA 4LKFA 3W20A 2IFWA 4BQ1A 4HT1T 1W6PA 5LW9A 4QU2A 3PTRB 2R043 2HWE1 4CTEA 4JTNA 1OC1A 1QXJA 4HVQA 3PUHA 3RJ2X 3KMHA 3B00A 1AR62 2WJSA 1CX4A 4YNIA 1J1TA 5FZMA 5J36A 2BQPA 4OHWA 4E9KA 2NLRA 5I91A 3GBWA 1JZ2A 2IUWA 5FO9B 3ABZA 1VALA 4XXAA 1RUNA 2J1TA 5HCHA 4DIQA 2R062 3ZOIA 2YGLA 2W39A 3PDQA 3PURA 3WG4A 4IGPA 5A7WB 5I8TA 2Y6KA 1XYPA 4MH0E 4V2VA 1FXZA 1NCQA 3VBRA 4LKEA 2IXIA 3ZFGA 3KHCA 1LOFC 3LEIA 3QACA 1E57A 1D2SA 2YMZA 1G9FA 4Q0QA 1CJDA 4MXVA 1W04A 3HR9A 1TME1 1KDKA 3MIBA 4WVVA 4X6QB 1KDMA 3WX5A 1R083 1BBT2 1SQ4A 1ZBE2 1IPKA 1ND2B 3TYJA 1FOD2 1JOBA 3EHKA 1AXKA 5JSOA 5KHIA 1DQ2A 1JODA 5JR7B 3RDIA 3ZYPA 3I8TA 3A0NA 3MO4A 1O5UA 4XBQA 3WG2A 3JQXA 1PM4A 1BEV1 1LJ7A 2RG4A 3WNPA 5C3QA 4P14A 2FDHA 5FDBA 3VL8A 1Q5OA 3H9AA 5IK4A 3PHMA 1IS3A 2VD7A 2QUOA 5C8WA 3BALA 3APBA 4IGOA 3MFCA 4QB6A 1SFYA 3RYPA 3N4MA 3GHNA 1X8EA 2WS93 4RHV2 1DGWA 1XYOA 2WNVC 5LRRA 1WCQA 5D8AC 4W4ZA 3N9PA 2BVBA 1MPXA 2B4KA 5IATA 4M0NA 5FP4A 4DOUA 3LF7A 4S2GA 2YXSA 3TB0A 1W8FA 1RUC1 4D7TA 3M3OA 4NO4A 2WYFA 3KQRA 3TEYA 1V9U3 2B46X 1RJ8A 4K40A 1J3PA 1O3TA 2AREA 3S5QA 1SLIA 3HBKA 3TN93 1K3IA 1S0CA 4L9BA 1NXD1 4RQPC 1NA1B 2W95A 3H1WA 3MI8A 4QDRA 2PAMA 5FV3A 5F5QA 4AEKA 3LKJA 4W6YA 1STMA 4K8RB 4MGZE 2J1SA 1J58A 3TEZA 4IV1A 3GZAA 4F3JA 2YBKA 4BHPA 4IV3A 4NPLA 4ZU4A 5F37A 1W6MA 4CDUC 5IWFA 1MACA 2W91A 1QEXA 3BOPA 4GIQA 1UX6A 2AZ5A 1Q8VA 2VOVA 1JW6A 4F8AA 2VW0A 3BTYA 3FE5A 1IG3A 1OOPC 4MSVA 1IOAA 4ZZ8A 2YC0A 2WT2A 1EUUA 3JZVA 5GLWA 4EN7B 5EP9A 3T2TA 4CE8A 2TNFA 1A3KA 4JX0A 4GMP0 4HETA 4R9DA 1CN1A 2OIIA 4D7SA 3B69A 3U0ZA 1HJGA 2Z4FA 4CCMA 1JYWA 1H9PA 1N1SA 2AEZA 4B8EA 1BKZA 1GWMA 3LDRA 4NJ4A 3A22A 2PHRA 4QT6A 3AVSA 2BWCA 4PLOA 1QJY1 2FMYA 1FV3A 4UFLA 1HJFA 1UXXX 1QF3A 2XPJA 4D6QA 5FIXA 4E2GA 3AZZA 1UPSA 2XR4A 3T2PA 1REDA 5DUWA 4TTGA 4J1XA 2WQ4A 3OD0A 1RXGA 4XZPA 5IK8A 5F8PA 4YG0A 3VBFC 2XLGA 4AVSA 3USUB 1NQJA 2WO3A 5I8SA 2A3YA 1NLSA 1TEIA 2SBAA 3S5AA 1KFXL 1VAKA 1SACA 1UWWA 2VTXA 4MO3M 5A3LA 2P1BA 2WS91 3THTA 2Q8EA 4LBQB 4NHMA 1OVSA 5FBJA 2ET1A 4CCOA 4FSJA 4COYA 3WP6A 3WZ1A 3TEWA 3ZFEB 3VZLA 1GNYA 5E8AA 1NCRC 2PQQA 4BOWA 3RG0A 2NMOA 3FZ3A 1FNYA 5FY5A 1PX3A 4CP9A 3I49A 3S57A 4BLIA 1FNZA 1IPJA 2WFF2 2A6XA 3E5QA 4HPKA 2K9ZA 3QOPA 5FYUA 1IS5A 2BGCA 4K20A 3WT3A 4AK3A 4N9HA 2D6KA 3WUCA 1UAIA 2Y64A 2ZEZA 3H50A 3OYWB 4IESA 4FOQA 1DZQA 4KG8A 4P08A 5FZ6A 3POSA 1HN1A 2XDVA 5GLVA 1OVPA 2W87A 4QPGB 3TAYA 1QJU1 4OUEA 5IAVA 2I2SA 2VMHA 3C7EA 3VD5A 1Z7S3 2WLQA 3RWKX 1PVC1 1AR93 4GULA 4JKMA 2JG8B 1UKGA 1U5XA 1EAH1 2CU5A 2Z5WA 4KU8A 4UF0A 5FYSA 3RZHA 5DQ0A 1TQ5A 1Q3EA 2R6QA 4COWA 4RS5B 4LHKA 1CPMA 4CYDA 3DGTA 4BYYA 2BBVA 5BNOC 5BNNA 5I0TA 5KHGA 1GBGA 3PVBB 2VTFA 4DRVA 2VJXA 2VH9A 3ZFFC 3ZMOA 2F6BA 4KGQA 4Q4W3 1W8OA 4NPMA 4AI9A 3MLKA 3O7OA 1GWLA 1MR5A 2PMWB 3DPRA 1O6UA 2RJLA 2QBXA 4JRLA 5LY1A 4XFAA 2P2KA 2ZA9A 1B35B 2QKDA 5CFCC 1WMEA 3PMEA 1GP4A 5KHKA 2WT1A 4OZXA 2PHFA 4CCDA 5IHRA 3WINE 2HWC2 1RVF2 2XHNA 1QDOA 2B42B 3ORJA 4QKBA 2Q5TA 5FYIA 4LK6A 3ZMNA 1VPHA 3VDCA 2WNUB 4BA6A 5EJ3A 4FTSA 1QKQA 2AENA 2VMIA 2VZ1A 5FZ9A 3HT2A 2AH2A 5FYZA 4BZ4A 2VQAA 3B9CA 5L7OB 3CNAA 3MPBA 3WDXA 3I3DA 2ZACA 2OXBA 3WVJA 3IDCB 4UW3A 5FWJA 2UYAA 5DAPA 2JEMA 5FPUA 2LW8A 4DEVA 1LHWA 4MYEA 1XNAA 3E1F1 2PLV1 3K4AA 4YM1A 1IG0A 2OA2A 4UXAA 3KD4A 5LWBA 1CAXA 4QX7A 1BQPA 5HV0A 4CEYB 1PVXA 1W39A 1VBA1 2LUWA 1TMF2 2J7MA 3J9SA 5FZKA 3N9NA 1C8M1 3CMGA 1OF3A 3I2HA 3HNYM 4JGYC 4FP2A 1WW7A 3I97A 3VLBB 3LOBA 4E8DA 1HIXA 1QU0A 4YPJA 2RS33 1POQA 1OLMA 3D0SA 1L7LA 1V00A 2YV8A 1XXNA 2BUKA 2FMDA 3M3CA 2BEOA 4GQ7A 3AZYA 3JXSA 4BM8A 1W0OA 4YGDA 4BQYA 2BTVC 4Z2AA 5LBCA 5E1RA 3PUSA 1HRI1 4LQRA 4NWWA 4BXSV 2GNMA 1X9PA 5A7OA 3N9LA 1Y43B 2LRPA 4FPFA 4AAPA 3AYEA 2HBUA 3RQ0A 2FBEA 3TBDA 5K0UC 1O3SA 3IAPA 4QQHA 4I01A 4LULA 4M3CE 1MEC3 4K1YA 3AK0A 1JHNA 3OSDA 3WSOA 4XW3A 5EJ1B 4Q4X3 3DECA 5JUVA 2WZR2 2CDPA 1S0BA 3V0AA 1PGSA 1ULGA 1WMXA 2Q1FA 5BNPC 1BHGA 1ULFA 4Y22A 3ZSLA 3DYOA 1OA4A 1AYM3 3FUQA 4AEDC 4ASKA 4DB5A 3H8OA 2ZGRA 2GAUA 4WZFA 2ZOEB 4HMZA 4MGSA 4XIKA 1W6OA 2BGPA 4IGQA 3ZYFA 1RUJ2 4EN9B 1EPZA 3IKWA 4YM2A 3ZSEA 1CX1A 4YG6A 1JYCA 1LOEA 2GP3A 3S0MA 4CDWC 3M70A 4XFCA 4K8FA 1LNSA 3SITA 3MIHA 5C4WC 5IVEA 1NQDA 2QQLA 5IVBA 3OEAA 4FQ4A 3S6PA 4JZRA 5DN2A 1HX6A 1ZRIA 3CJIA 5KXCA 5FO7B 2J1RA 3AP7A 4JQRA 1VRH1 4OMDA 3VZOA 3ZXAC 1PGL2 4GB33 1LOCA 1OHFA 1C3HA 5BY5A 1EV11 2R16A 2A75A 3NMBA 2ZX3A 3U75A 2GNBA 3LAGA 3THDA 3OPTA 4Y1UA 5FZ1A 1VP6A 2JDPA 2HWE2 3VBOB 2VMDA 1VMFA 5A3MA 5FP3A 5CAZA 2XHKA 2PHDA 3D8CA 3MW4A 2DWRA 4LIUA 5FPBA 4CDXC 1ZZ7A 3JU9A 3V65A 5A3NA 1VBB3 2B5HA 4MHRA 4QWNA 2VQ0A 4L8QA 3VBFB 5L9VA 3G6JB 1UIJA 1XPWA 3H1MA 1DGRA 1O4ZA 4Q0SA 3I2GA 1H8TC 2CSGA 1OH4A 2RS51 4LO5B 3OGRA 4MGQA 5HI0A 2YU1A 1E5IA 2CTVA 2QQMA 2ZMNA 3IWZA 1CD3G 2R32A 3ETPA 3RZZA 1FMD2 3ACIA 5A33A 5SV8A 3VBHA 1CZTA 4FVVA 4GZ9A 4IE0A 1X36A 5LK7B 2WKKA 4CP2A 4DINB 2D93A 3IPVB 5J3UA 3O12A 2Y6HA 4DQAA 2VZ3A 1YEWA 1ZBA1 1FI2A 2XMLA 1LU2A 3MV11 3R4SA 4OHZA 1PK6B 3N3HA 4A7KA 2E9QA 3TNQA 1QGLA 1TME2 2IXCA 2GH2A 2R0HA 3POBA 3KLSA 1ND3C 2P5BA 4OYUA 4PBPA 4QX0A 3VN4A 2QFEA 1J84A 1VBE1 1NG0A 3O14A 3PU3A 5FY4A 1V6LA 1ZVFA 2P4EA 1DF0A 5DG1A 5JIUA 1SLAA 4FO9A 5FYMA 2VULA 3FLPA 1RUH1 2W1SA 3SH4A 2CGPA 4GMP1 4NIIA 4JGZC 3K48A 1F2NA 1BEV2 5DPNA 4QXCA 2BFUL 2J1AA 2YG0A 3I2IA 5JOYA 3C3VA 4KWJA 1AYM1 2XVGA 4N9IA 1SFNA 4KH9A 4QKDA 4RYDA 1S0FA 4AR2A 5K9YA 2V5DA 4XMAA 2UWCA 4NR1A 2PELA 1KJLA 4IXLA 5H9QA 3HEIA 4H7MA 4XF1A 2C9AA 3B5LB 1K5MA 1RL3A 1VE0A 4IE5A 4QQOA 1XU1A 3HT1A 5APAA 3W59A 4AFBA 4MADA 4Z8BA 1A34A 4P9YA 1WLCA 2D97A 1T6BX 4LT5A 2WBKA 4KI5M 1GWKA 1RUC2 2SLIA 1DZRA 2EIGA 4JC1A 5LK5A 3Q8FA 4UFKA 4YZ4A 3OBTA 4GB31 1FV2A 5JIAA 4A6OA 1F8VA 5A7PA 3USSA 4GH4C 3LIGA 4JHZA 4YVSB 5M0TA 1G9CA 4CUBA 4CZSA 3HQRA 4NHLA 2WZEA 4H14A 2WNEA 4YRDA 3E97A 4I3PA 3OPZA 4RR3A 1COV3 3AYCA 4CDQB 2C1FA 4COVA 2D5FA 2WDBA 1GQGA 4XTPA 5AC91 1YNAA 2PHUA 2LALA 4OI1A 3UV9A 3IZOA 5JZGB 3C7FA 4GALA 3GNEA 3K51A 1SG3A 1UCXA 3AYAA 4IETA 5FZEA 4QQ2A 1YFXA 5F7UA 4L11A 4XDOA 1W8ZA 3PUIA 5CNAA 4BJ0A 1FT9A 1XRUA 4HXCA 2G1MA 5F3GA 5FZ4A 2GNTA 2JG9B 3DCQA 4EWAA 1M06G 3PIGA 3U78A 3AMHA 1NLQA 3U11A 2VZQA 4TLFA 1RUF1 3TEXA 3HQXA 1I3HA 1PO23 3JBG1 1XC6A 4UAPA 1D0HA 4PQ9A 5FZBA 4YVWA 2P37A 4XUOA 4YW5A 1QQP3 1Q8SA 1X82A 3X29B 5FZ0A 3POJA 4H3WA 2OX0A 3J8F3 3OJBA 4PF1A 3K4ZA 1DGWX 1QMJA 4ISQA 1QJY2 1GP6A 4DXTA 1VBD3 1BMV1 1I6XA 2P6HA 3NAPB 2RMU3 3CZJA 3SEPA 4Y5SA 3CBNA 1QH6A 1X8MA 1DQ0A 3ETQA 5K0UB 1RUD3 1DQ5A 5J96B 1C28A 3IB3A 3AVRA 2ID4A 1K5JA 2YC4A 1HQNA 3FWEA 1H1MA 4FAHA 3JD71 2WFF1 1O91A 4XUPA 3NJZA 4BQWA 1N3PA 4JQTA 1W03A 2DCJA 1POV0 3WDYA 4MXWB 2ET7A 3KQ4B 4LLFA 2WS92 1L7QA 2ZGKA 3AXEA 2GP5A 4AEDB 5JXHA 1ND2C 3ZX7A 3VBSA 2A6WA 4LO8A 2HWF1 1G8WA 3PLQA 1TVGA 3U4XA 1GP5A 1WD4A 5I8YA 5L9BA 2J1EA 4ISRA 5FQ0A 2HWB3 2RM23 4XVHA 3DXTA 5C9AA 2V09A 3HIFA 3AXDA 4CDWB 5E6HA 1V9U2 4IEQA 1OT5A 4CCCA 3AL6A 2IC1A 2C4XA 4WVMB 5C3OA 1YQ6A 1JZ6A 4C8DA 5F5IA 5KHHA 4AE2A 5IAXA 4BQ5A 4XZUG 5I0UA 4EN0A 3LCPA 3LB9A 4YW2A 5CZKA 1JZ4A 1RIRA 1WBLA 2R073 1QJU2 3CEWA 3Q8AA 1WGPA 4LA3A 5JMCA 3RNSA 3RI8A 4Z92B 1PVC2 1W9TA 2K2SA 2K46A 4M00A 1HQLA 1EAH2 3MGUA 2PHXA 5LCWL 5E88A 1UY3A 3EO6A 5C70A 2ZX4A 1UPIA 1X9TA 3OY8B 5FZ7A 1S0EA 3I2JA 4Z07A 4ZS3A 4FTEA 1G9AA 5DG2A 4CSWA 2FZ2A 1QJX1 4HVRA 3WQBA 1GLHA 1NA1C 2XJSA 4XAAA 3VZNA 1W6QA 1H0BA 1MS5A 4V2WA 3VD3A 1CVNA 4BQ3A 4GAZA 5FYHA 5KXBA 5A32B 3C2UA 1I9RA 3MFAA 3CJXA 5I93A 4LBKA 2DYCA 4LA2A 5FK8A 4AEMA 1JYVA 3GXUA 5LY2A 5FCCA 1AR71 3KV4A 1Q43A 4LXLA 1IGOA 4Y20B 4IE7A 2BP6A 4K7JA 5ACA3 3VKLA 1S55A 2XJPA 4G4FA 2VBDA 2XVKA 4CP0A 1ZZCA 4HL0A 3ACGA 3O0VA 2JDHA 3MLLA 3NNFA 4NRQA 1RHI1 5ABJA 1WUVA 4GKYA 3T2QA 4EE2A 2BPA2 4DY5A 2IFRA 4OULA 3EMRA 4IEWA 3F95A 4LTAA 4ZU7A 4CU6A 2QQJA 3T2OA 2QQIA 2UYBA 1YLLA 3VDDC 2IXLA 2ZX2A 2PLV2 1W2NA 2VBBA 5T52A 1US3A 5D2AA 3WOGA 4PDWA 1WMFA 3H3LA 2FCUA 1VBA2 4BCUA 1DP0A 1MS0A 3M1HA 1UL9A 1YQCA 2QTWB 2J1UA 3TWIA 5ISLA 4WM7A 2VXRA 3NSTA 3PUQA 1ULEA 5FUIA 4BK4A 2O1QA 3LPFA 1U12A 1DBNA 2V73A 5JOXA 1DYPA 5FOJB 4N43A 2JB4A 4YWAA 3ZYBA 2UY9A 5FKBA 3JB4C 4ZPIA 2WNOA 4CEWB 1UZYA 3RZGA 3UGHA 1HRI2 1JZ3A 1O7FA 1ZNPA 4CCNA 2RJ2A 1GOHA 3AB0A 3CF6E 3WNKA 4COZA 2GC0A 5AFBA 2R071 2IWGB 3BODA 1DQ4A 2F4PA 3R05A 4XDPA 4NAOA 5LATA 3JUUA 3ZFEC 4AHYA 1XU2A 2BGOA 4Q0UA 4QDQA 1GQHA 1NZCA 5J98B 3I3MA 4WVWA 4HK8A 4LLOA 3NQHA 4DO0A 2E26A 2W92A 3FFQA 2C0ZA 1E5SA 1VIWB 4DMIA 3E6BA 5FYBA 3ACFA 3WQ7A 4AXOA 3NV4A 4IEYA 1LOFA 3LA7A 2FDIA 4RGGA 1XNKA 2BOIA 2BRTA 4AQTA 4CXYA 5CIRA 2E33A 4B3NA 1H9WA 4QPGC 3NKTA 5EZWA 4YW4A 2JDNA 1UOFA 2NMNA 2ADDA 2A3WA 2JG8C 1UOJA 2RDQA 5DDJ1 5FBZA 4RS5C 2PYTA 3NV3A 4Y4RA 3LEKA 5FYVA 1OKOA 4XPVA 4OUMA 1S1AA 1U5IA 5A6XA 1S2EA 4WV8A 5IK5A 2W1QA 2VMEA 4H2AA 2KD7A 3OF1A 1VRH2 2KR2A 5FFOC 2OKXA 4IE6A 5FUPA 1POV3 2X5IA 4XBNA 2VMGA 3CHXA 3D4KA 3K2OA 1EV12 5C8CA 5L19A 3JQWA 2XOMA 5FYTA 5T3NA 1B35C 2AUYA 3ASIA 4YW7A 2DVAA 5CBLA 1DYKA 3AP6A 1FMD1 2BV4A 4C0HA 1I5ZA 2IXHA 2WNVA 5D8AA
chains in the Genus database with same CATH topology
1A78A 4JTOA 1ZRCA 1BXHA 2WNUC 2R30A 4HLTA 5F6LB 4WM8C 1AL21 5L7OC 3QH7A 2RS52 4H55A 2RR13 4U2AA 5CU1A 3ZSJA 3ZPYA 4C0BA 4RQPA 3AMMA 1DQ1A 4IEZA 3DL3A 2ZMLA 2N7GA 4CEYC 4CDUA 4Z82A 1ZBA2 2XBO3 3MIGA 4FQZA 4C90A 4QX5A 3ILFA 1YI9A 5F6KA 3WW1A 4M3CA 1YHFA 1Y9QA 1BYHA 1R093 1VBE2 3MIFA 1GZCA 2ZGQA 4QPIB 1OOPA 4YGBA 3B94A 1IS6A 3AKPA 1RUH2 4AI2A 2CY6A 3M3IA 4TYSA 4FPOB 3DUIA 4Q4Y1 4NWVA 1VJ2A 2ZHKA 1RJ7A 4AFAA 1WA4A 3NV1A 1AYM2 2XUMA 2YROA 1YFUA 4PIXA 4SLIA 3BCWA 2R041 1H2LA 1WW4A 4IEUA 4N53B 2R1BA 2OVUA 4FOWA 4EN6B 4OVEA 2A6VA 2ENRA 4I30A 1ZZ8A 2YY1A 1QH7A 2TUNA 5JOZA 1SBDA 3I54A 3AFKA 1VLNA 4Z1VA 4KBBA 3IT8A 3MW2A 4GB32 3VBFA 5CFDB 5HCAA 4W65A 3ZDSA 2ZZQA 2CWSA 2A7AA 4GXLA 1W2UA 1MQTB 4I02A 5CB7A 5AC92 1X50A 3AFGA 2O8OA 1NCRA 3VDDB 2ZGSA 3QH6A 4AI8A 4W6WA 1W0PA 4HVOA 4XJWA 3ZYIB 5FMOS 1R081 2Z42A 3EBRA 3MICA 2A71A 2DTWA 3MPPG 4GKXA 5IK7A 2BWAA 3VBOC 1V6IA 1CAVB 2A6YA 3I2DA 4WVZA 4LBOA 1RUF2 1PZ7A 1GANA 3W9AA 1J1LA 3JBG2 1CAUA 3VBUA 4ONUA 2A70A 1M4WA 1KQRA 2ES3A 4TZDA 3J4UH 4R9AA 5JSRA 1Z0HA 3FLTA 4FPHA 2Z2SB 5GZFA 3WNXA 2E6VA 2VNOA 2W08A 3WW4A 4Q2FA 4FTBA 1NOVA 2JE9A 5GALA 1LR5A 3E5XA 4KG0A 3UJOA 5BNOA 4XQ4A 1BMV2 4XQWA 4DNYA 2FZ1A 2XJQA 3PMSA 3ZFFA 4AQ6A 4DPNA 1A6CA 2UWAA 3WG1A 3SH3A 3VHRA 5CFCA 1OFSA 1V9U1 1PK6C 2OUJA 2XGXA 3JD72 2ZPXA 1LOAA 1RUI3 5FLHA 1XE8A 3RYKA 2VPVA 3TN91 4LHNA 5FREA 3FUOA 1LGBA 5J37A 1ENQA 5JPMB 1RUE3 2HYKA 1G7YA 2HWF2 1GZ9A 4LBNA 4MX3A 3V64A 2BNOA 2X29A 4AFCA 2IZWA 2XWBB 1OD5A 1GZWB 3JCIA 2TEPA 1BVVA 1FYUA 3GZTB 2HWD3 4E4DX 2D44A 4EWEA 4M01A 4A2UA 4R8HA 4AQSA 3H0OA 4JGYA 1PO13 3MIEA 1YO8A 2A73B 1Q8OA 1V6MA 5KBFA 1PNFA 3FLRA 4XJZA 4YZ5A 4LUKA 1UW8A 2RS13 3NVCA 1N3OA 4YVSC 1QJX2 2VOXA 4S2HA 1WLDA 3ZN6B 1YFYA 4WM8B 5GZCA 2PHTA 2NYYA 1PNGA 4CDQC 3PVEA 3WR0A 4I0BA 5JZGC 3VHPA 3WDVA 4IEVA 1AR72 5FPZA 3WP3A 2QQPA 2B8MA 4A3XA 3H3UA 3WY6A 3WDTA 1CGPA 5GJ6A 1LOBA 5EV7A 2JG9C 2B39A 5BNPA 2BNNA 1YYNA 4FXGB 3I59A 1RHI2 4LR4A 1XNCA 4GA9A 3RSJA 2YPJA 1W6PB 5K8SA 2E51A 4ITCA 2R063 4B4QA 3SMHA 1RC6A 4HFSA 1R1A3 3E6DA 2YDEA 3ZN4A 1LU1A 2DFBA 2JDZA 1DDLA 4K1ZA 1HKDA 5C4WA 2OYZA 5AVAA 1MZFA 3BPZA 3CL1A 2VW1A 2H6BA 3NAPC 1ASJ3 1YFWA 2D6OX 4RGAA 2D40A 2YUEA 1Z7S1 4AGGA 1NE4A 1AR91 1BBT3 1PM7A 1WW5A 2ZAHA 4P9GA 1HXS3 1ZBE3 4I0WB 1O3QA 1H4HA 4HANA 4QPYA 2G9GA 1NCQB 3VBRB 5DUUA 3ZFGB 1YRZA 4C1XA 1RMU3 1YJKA 5C6CA 4EN8B 2Z79A 2PHWA 2QE3A 4AEJA 4CDXA 4Q4W1 2QDRA 2R072 1W6NA 1GYKA 2P3KA 1CR7A 1MZEA 4MGYE 4XF9A 1H8TA 4RHV3 1ULCA 3H1YA 1IQAA 2CYFA 3AKQA 3R4DB 4OI2A 2EAKA 5CG9A 3IM0A 2JJ6A 5D1IA 1QOSA 3ENRA 1TNFA 5JI9A 5DUVA 4NVPA 3MIDA 1YIPA 1UN1A 4XYXA 3ZSKA 1H1AA 1JOJA 1RITA 1LGCA 4WZCA 4DRRA 1ND3A 3D0JA 4AI0A 5JAXA 1OQDA 4UBHA 2DU1A 3ES1A 5T5JA 5DDJ2 5ACA2 3WV6A 1DHKB 2A5ZA 3KCCA 2JECA 2WSUA 3ELNA 1FPN3 2KM2A 4JGZA 2Q30A 2ZKLA 1S0IA 2DUPA 2H0VA 3J26N 4X8NA 1V70A 2RS31 2D3PA 3IIAA 3TOJA 2QJVA 3BB6A 1CAWA 1LODA 1IZ3A 1N1YA 3TRSB 1R1A1 4IV1B 4QM8A 4IV3B 4A7YA 1JYIA 1NYWA 5F1RA 1OFNA 1W6MB 5T50A 5TSWA 4JCKA 3KCXA 1UF2C 2YHJA 2ZABA 4HSJA 1EP0A 3VKOA 3IDEA 1AL22 1ASJ1 4JRAA 4PBOA 3H8UA 4OFGA 1JH5A 4HN0A 5CVRA 1MEC1 4ASLA 3IDBB 4GH4A 4XF4A 3V0BA 1HXS1 2EXHA 4IQPA 4HKLA 4DZGA 3AZXA 4Q4X1 4BWOA 2UU8A 1RMU1 1LHOA 2VECA 1KXGA 2GU9A 2PA7A 2CL2A 3IBMA 3AM2A 3ZYRA 1DFQA 1AL0G 1DGLA 1GV9A 1AXZA 3DF0A 2W52A 1ONAA 5AFEA 4K6BA 4XILA 1DZTA 3M4FA 2XLAA 2UY8A 4CEWC 4Q4Y2 1NY71 1U5YA 5FOBB 2EXJA 4I09A 4ES9A 1U5ZA 3GHMA 2DTYA 4V1PA 5KC6A 1KS4A 1QJZA 4AGVA 2R042 3WD5A 1LEMA 3ME2A 2FQPA 4HKWA 4META 2VVDA 4OLLA 1QOOA 1FPN1 1VBB1 2JD4A 1ZM1A 3NW4A 4Y4YA 2ZHNA 1S0JA 3NKGA 1V6JA 4HPKB 3WQ1A 4MGKE 2X53S 2ZS6B 2HEYF 2Q8OA 3WQ0A 1AJOA 2MEV3 3SH5A 4B7EA 4B4RA 4I2OA 1LGNA 4AFDA 3GZUC 3KZ4C 1ND2A 4OHVA 5CADA 1JN2P 4JDOA 4YW3A 2OW4A 1VAMA 4GWNA 5KWRA 1OSGA 1PMIA 1ZX5A 2JKBA 5GZEA 3MF9A 1F5FA 1ZA4A 3HD8B 1MVQA 1R082 5BNNB 1F5JA 2D98A 4XDQA 2HWC3 1RVF3 2ZX0A 3FMGA 3M3EA 5BNQA 2E53A 3SCGA 2DURA 3DPRB 4OI0A 4RL7A 3M7AA 4D7YA 4MZUA 3AZWA 4OI4A 5DUXA 1XE7A 3TNPB 1YJLA 5FQ0B 5JOWA 3DKWA 1D4M3 3WUDA 4BIOA 2V5YA 5F9TA 3ROUA 1XYNA 5GZDA 1TMF3 1AJKA 1JTZX 1NA1A 2DUOA 4Q8LA 1HLCA 2B9UA 2WIIB 1WCDJ 2ATFA 2DVDA 3AP5A 1LEDA 3NV2A 3WDWA 4LBLA 3KGZA 1CAXB 4E2SA 4DY3A 2XL7A 3TN92 5GM0A 1ENXA 4EJRA 5JCTA 4QPIC 4SBVA 3L2YA 1AZDA 1WBFA 1X7NA 1COV1 1VB2A 5HBAA 3OCPA 2BVVA 4J1WA 5EYYA 2P34A 3OBRA 3ZXGA 1WLWA 3VDDA 3LSDA 3P3NA 1RUG3 3WCSA 1HW5A 5L73A 5H9SA 2WZR3 1OA3A 4AHZA 4FPJA 4L92A 2MEV1 4AF9A 4N53C 2O8QA 2VVEA 5BUVA 1FAYA 4AVCA 2XWJB 1PO21 3KSCA 3P3PA 5T5OA 1QQP1 2XB6C 1RUJ3 3EXUA 2GALA 5EWSA 5CFDC 3J8F1 3V0AB 3USUA 4AHXA 2GMEA 4Y22B 1R1ZA 4FOVA 3A0KA 3T1MA 4D69A 1VBD1 5K7PA 1HRV3 1MS4A 2RMU1 2DF7A 4MLOA 4LBQA 1MQTC 2I45A 1RUD1 1UU4A 2K0GA 4L99A 1W6OB 4XE9A 3WXPA 1DQ6A 1WCKA 3ZFEA 3ZYGA 4Z2WA 3VKMA 4ES8A 1CESA 1ULDA 2EVXA 4KL1A 2HWE3 1GNZA 5FPXA 1PIV3 1O5LA 2P3IA 1JUIA 1PGW1 4AI1A 1D4M1 1DLLA 3CJIB 4NPRA 1WMDA 5E16A 2GN3A 4PCRA 2WA4A 1CIWA 4OUSA 2TBVA 3OYWA 2PAKA 1UZZA 3AJZA 4Q8KA 4QPGA 1MS3A 4M3CF 1I1EA 2HWB1 2RM21 3WG3A 3WP4A 1AF9A 1N47A 2JG8A 3KCYA 3JB8A 2R49A 1MS1A 4RSUA 1MS9A 1NLRA 2CAVA 4RS5A 2WL1A 4XOGA 1AX2A 4R4XA 4NN0A 4URTA 2NQYA 4HN1A 4F83A 4C1WA 1C4RA 2GC1A 3SCHA 1C5IA 2WFPA 2DUQA 3ATGA 4LE3A 1LESA 2NP0A 1Z7S2 1AR92 4QD2A 1B35A 4YM0A 4N7IA 5A33B 4YG3A 3VBHB 1LECA 2ERFA 4JAAA 2VY0A 2ZJCA 4MV2A 3UKTA 1RUG1 4E4SA 4MUVA 2A6ZA 2EA7A 3M2MA 3R4UA 2NZ9A 3INAA 3DV8A 2WNUA 2P17A 2DVGA 4JV4A 4Q4W2 2YGMA 4FP3A 3ST7A 5L7OA 1NE6A 3L9JT 4BE3A 3CU7A 4Y1VA 1OLRA 1AR83 1NXMA 2R1DA 3E6CC 4LBQD 3LGRA 4QQPA 5H9PA 5ACA1 5SV5A 2KA3A 4RFT0 1ENSA 4P9IA 1LKNA 4ZXKA 2GMMA 4XHBA 4X6RB 1RUC3 4CEYA 2ZTNA 1GKBA 1HRV1 2DVBA 2XVLA 1O3RA 4GWMA 4IEOA 1F31A 4S2FA 5KC5A 2E7QA 4Y24A 1AX0A 1SBFA 3MLJA 1K5MB 2PFWA 1KJRA 3CO2A 2GMPA 4N43C 3ZXEA 5DXDA 5FRAA 1PIV1 3L2HA 4LO4B 2WINB 3EQEA 1SLTA 3PJQA 4YFWA 3UL2A 2GN7A 4AVAA 1LCLA 2BYVE 3ILNA 4RA0A 2VU9A 4XFFA 2RS32 3HWJA 3ZXFA 4AQ2A 2LM3A 5DZEA 2VNRA 1UD1A 4J6GA 3RPQA 5H9RA 5T54A 1R1A2 4RR3B 1N3QA 1FX5A 3ECQA 4R52A 5IUQA 1Y7BA 4Y1YA 5FO8B 4YFZA 1O4YA 4XF3A 3B9IA 1D4VB 4NHKA 2DVFA 1KFUL 2DU0A 1ENRA 1AYN3 1ASJ2 4XFHA 4XF0A 3I7DA 5AVPA 4HBNA 3LOIA 1Q8PA 1AX1A 1MEC2 2ZGUA 1HXS2 4BMEA 3AP9A 1ZRDA 1QJY3 4DS0A 5T5PA 4XFGA 1V6KA 3HBZA 4M0HA 3S7IA 4Q4X2 1RMU2 3WHUA 4YVWB 4IEPA 4KWLA 1S0DA 4BH9A 3H7JA 2EF6A 2ZGOA 3MEPA 4YLZA 3I4IA 1LTEA 2D6PA 3AYDA 4OHXA 2ZBJA 4ZU5A 1ZRFA 2X5IC 2Y26A 4EV0A 1KD7A 4LO7A 1TE1B 5C8CC 4IL7A 1H1IA 4KU7A 3AKSA 5IT6A 2PHLA 3O5SA 1AR81 4YZ1A 4QQLA 1NCQC 3VBOA 3O0WA 3VBRC 3ZFGC 4AG4A 2E7TA 2Q1MA 5DZFA 1NY72 4YZ2A 2Z69A 2PAEA 2HEWF 1RGSA 4AVBA 2QDNA 1H2KA 1WW6A 2QNKA 3ZO0B 3S7EA 1POV1 2CWMA 4CRQA 5BPXA 1UKRA 5T55A 1BZWA 1F9KA 5GLZA 1SLBA 2BFUS 1LHVA 3RRDA 3VBSB 1C1LA 1APNA 2NM1A 4XJAA 4IEXA 4S2DA 2ARXA 1GNHA 1QJU3 3HMYA 3ZVXA 4LUMA 5BYNA 1QWRA 1PVC3 1FPN2 1VBB2 2Y38A 3QD6A 4ORFA 5C9AB 1EAH3 2D3RA 3IPVA 1U0AA 3URFA 2CV6A 5C33A 1PK6A 3UKVA 2VVFA 1Q56A 2RR11 1SDWA 1MZ6A 3GBGA 2KXLA 3GYDA 1KS5A 2AR6A 4F7ZA 1LULA 1JUHA 3GF6A 3RMXA 4O9GA 3OTFA 4B7KA 2XBO1 2QZ3A 2BNMA 4A7ZA 1A8DA 4LEJA 3VUOA 1AYN1 2D6MA 3B93A 2ZMKA 2DCTA 2ZGTA 1B09A 1R091 3A4UA 1QY4A 1W6QB 4CP1A 1RTVA 4IV1C 3PVNA 4IV3C 2ZX1A 4E4ZA 4K3UA 2ZGPA 5I0SA 2CNAA 3VV1A 3ZIWA 1PZ9A 3N7KA 3R0RA 4P9JA 1Z78A 4HK9A 5L36A 1OPOA 2QZ2A 4Q4V3 2PLV3 3BIWE 1IKQA 2MNGA 2VUJA 4Q27A 2NPIA 2HJIA 4AYUA 1VBA3 3LA3A 4Q1PA 4YVSA 1VBC3 1C8M3 5ABJB 2EXKA 1G9BA 2Y0IA 4Y1XA 3RWNA 3WW3A 5FLIA 3B3QE 4CDQA 5HCBA 4AFMA 3NWKA 3QBQA 1J3QA 4YGCA 2ZAAA 3G7DA 4XHXA 5JZGA 4JVAA 1WLTA 4HSLA 3GBFA 1REEA 4FT8A 2E63A 4W6XA 4PDWB 4B29A 4E2QA 5JPNB 4QM9A 5CG8A 3D5OA 1HRI3 4D3WA 2UWBA 2JG9A 1QNWA 4FPCA 4WM7B 1LHUA 1COV2 2WZPP 5CA6A 3VBUC 1C1FA 4XQDA 5E89A 4N43B 1CJPA 3CLPA 3POYA 1SCSA 1QXRA 3ZXKA 1SLCA 1CPNA 2MEV2 5JWPA 3RI9A 1BJQA 3NAPA 4MVTA 5FLJA 1UU6A 1PO22 3ES4A 3RS6A 5JLVA 5K0UA 1C57A 3FHIB 1KITA 1LOGA 1QQP2 2HEVF 3Q9OA 4XTMA 1LB2A 3UK9A 4YYOA 3J8F2 1AHSA 1AR63 1C8NA 3N7JA 2DCYA 3AMQA 4AGRA 4MXWA 3UJQA 1VBD2 1SBEA 4YARA 5A3LA 3WHTA 1ZREA 2QCSB 2RMU2 4AEDA 1VRH3 2EXIA 3SCFA 2G9FA 4JDMA 1RUD2 2WC2A 1EV13 2XJTA 2EALA 1IKPA 4KGGA 1LENA 3KS7A 2HKXA 4FXKB 4JDNA 2C5DA 4Q4V1 4CDWA 1RUI1 1VB4A 4FPYA 5I0RA 1HV1A 5BNNC 1PGW2 3AMPA 1D4M2 4WVMA 5BXXA 1RB8G 5B2GB 3N7LA 1VBC1 1RUE1 2DFCA 4KWKA 1G6NA 2X5IB 1RUOA 4QGLA 5C8CB 3LWCA 2CGNA 3DPRC 1VR3A 1OKQA 2RS53 3HN1A 4UW5A 1A8MA 2HWB2 2RM22 2R0FA 1QXPA 1S2KA 3BU7A 3NO8A 3ILRA 1FOD3 2E7AA 1ZYBA 2WNVB 1UIKA 2WLPA 5D8AB 1JBCA 1EY2A 4P5HA 4BLJA 1XNDA 4DXZA 4B4PA 2HWD1 2UURA 4XBLA 3R6SA 3MF6A 3OY8A 5BV6A 2GC2A 1ZBA3 3BOWA 5GZGA 5LRSA 1BK1A 1PO11 1YXWA 3LSEA 5A32A 1VBE3 2Q4SA 4RQPB 2D5HA 1H30A 1XQNA 1GICA 4XETA 2IXKA 1RUH3 1RUG2 1T6GC 4Y20A 2RS11 4GMP3 4CDUB 3WW2A 2X8KA 4COUA 3PJYA 2I07B 1N1VA 3N35A 4FPKA 4M3CB 3DN7A 4HZFA 2Q1ZB 2D43A 2H6CA 4RD7A 2P3JA 4FBFA 1OOPB 1DIWA 3ALQA 5LEJA 1SMVA 1ZZ6A 4L97A 1WCSA 4FAGA 2JENA 2XJUA 3SLIA 4XFIA 2JICA 2G4IA 4FPLA 1OMIA 3AZVA 1AR61 3AP4A 4LHLA 3VKFC 1DU3D 4INDA 1D2QA 2B7YA 2D6NA 1HRV2 4PLMA 3BTAA 3MZHA 1O4TA 1OQEA 3VZJA 2VG9A 1SEFA 3HAGA 3H3ZA 2R061 1PHMA 3KB5A 1AUYA 2FHRA 1JXNA 3M8LA 1Q8QA 4XEZA 2OUHA 1PIV2 5EYXA 4L2NA 4ZKTB 4G3YC 5AC93 1AXYA 4CEWA 2GH8A 3N36A 3GALA 2JE7A 5JI7A 4TSVA 4K9SA 3VL9A 4Q1RA 4N90A 1H2MA 2CAUA 2VNGA 2A3XA 4PJYA 2JX9A 5KHJA 1BBT1 1Y3TA 3PNAA 1ZBE1 3OD4A 3W58A 1FOD1 1EPWA 4Y5Z0 1OA2A 4Q29A 1GR3A 1RUF3 3KT1A 3WDUA 3JBG3 3ZIXA 2O0OA 5J7MA 3CJIC 1NCRB 3KT4A 2PTMA 2XKPA 2YZ4A 4NOTA 2NN8A 1ZRRA 1CONA 4BPZA 1GFF2 4AVVA 2ZHLA 4R4ZA 3RJRA 4YSFA 3VGIA 2MPFA 4WBBA 4I3GA 3ZSMA 4RHV1 5JSPA 1WD3A 1V6OA 3SXWA 1CAUB 4MGIE 3VBUB 3IN9A 1G9DA 1RINA 3ACLA 5GKAC 2GZWA 4PIZA 4XMIA 3WP5A 4AW7A 3JD73 1H4GA 2B45X 2WFF3 2ZZJA 3KGLA 3T1LA 3ZN5A 2AYHA 2ZHMA 4LBJA 4YM3A 2VUAA 4EWDA 2XJVA 5BNOB 4P9WA 4G9SB 5FAXA 5J09A 1AR82 3ZFFB 2D6LX 4P9LA 3VBHC 4XJUA 2HWF3 1X33A 1YWKA 5FMOL 1UMZA 3WLUA 1S0GA 1H8VA 1MS8A 3POWA 4I0AA 1J59A 2W0XA 1URXA 3FC0A 5CFCB 3QLQA 1EYBA 2XJRA 4OHYA 4UW4A 2VW2A 2ZGNA 4LE4A 3ZYJB 2WSVA 3D82A 5EFUA 4Y26A 3AJYA 5GLUA 1LRHA 4LO6B 3D6EA 1J3RA 5LEKA 1S2BA 2XG3A 5GLTA 1UU5A 4N7UA 1G86A 4QGNA 2YYOA 2D3SA 4KNCA 1GSLA 2EAAA 5EXOA 2RR12 3VZKA 1QJX3 4R9BA 3THPA 5JDBA 1K5MC 4QPIA 4JGYB 4Y1ZA 2JXAA 2OZ6A 4PF5A 2GNDA 4PLNA 3VZMA 1QOTA 1OQ1A 1YIFA 4PIYA 1BCXA 3U07A 2XBO2 5JVVA 2WT0A 1AR73 1AYN2 4HKOA 3ZXLA 1R092 1MVEA 3M3QA 3FX3A 3SHRA 4RR3C 1RHI3 4P9XA 3VKNA 4D94A 4N53A 1SLLA 1OLQA 5J48A 1L3JA 4BIFA 1V6NA 2GC3A 4XJ9A 1ALYA 4C91A 3PVOA 3PTYA 1H2NA 2OPKA 3AMNA