3VBUA

Crystal structure of empty human enterovirus 71 particle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
225
structure length
218
Chain Sequence
b'HSTAETTLDSFFSRAGLVGEIDLPLKGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTKDLEYGAMPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome Polyprotein, capsid protein VP1
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
molecule tags Virus
total genus 34
structure length 218
sequence length 225
ec nomenclature
pdb deposition date 2012-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vbuA00
2HWE2 5J98B 1X33A 5D8AB 1FOD1 2RS52 2RM21 1B35A 1TME1 1VBC3 4GH4B 5GKAC 5JZGA 5L7OB 1POV0 1TMF1 1QQP1 2XBO2 3TN92 1MEC3 2X5IA 1V9U1 2R043 4RS5C 1HRI1 4JGYB 1AL0G 1VBE3 4QPGA 4CDQB 1BBT2 4IV1B 2BPA2 1AR91 4YVSC 1VRH3 1R091 4CEYA 1AYN3 1VBD2 1ND3C 1R082 1OOPC 4FTEA 5AC91 4N43B 4Q4W3 2RMU3 3S6PA 1Z7S3 1EAH1 1ASJ1 5ABJC 1C8M2 4CEWB 3JD72 4AEDA 1NG0A 1DDLA 1RHI2 5BNPC 1PO22 1ND2C 1HXS1 2R073 2RR12 4FSJA 3VBRA 2WZR3 1ZBE1 4YVWA 2RS51 5C4WC 1EV11 4IV3A 1VBC2 5CFDA 1NCQB 1CD3G 1K5MC 1FPN3 2WS91 1ND3B 1OOPB 3VBOC 1QJU1 2WWSA 2BFUL 1QJX3 2R042 1FMD3 1SMVA 4N53A 4NWWA 3JB4C 1AYM1 3VBHB 1VBE2 3J8F3 2PLV3 1RUH3 1NA1A 1VRH2 1BEV2 5BNPB 1AYN2 5D8AA 3ZFGC 1NY72 4Q4W2 3VBSC 1RUC1 1D4M3 2RMU2 1Z7S2 3VDDB 2WFF1 1HRV1 5BNNA 1OHFA 4Q4V1 5C4WB 1MQTA 5DDJ1 1PGL1 4PDWA 1VAKA 1F2NA 4WM8C 1CJDA 4GMP0 1RUD3 4Q4X1 1RUE3 2R072 1QJY3 5L7OC 1PO11 4RR3C 4IV1A 4BCUA 2FZ2A 1ZBA3 3VBFB 1PIV1 4RHV1 2RS13 2R063 1PVC1 4FTBA 1POV1 2HWD3 4JGYC 1FPN2 1AR83 1AL23 4GB31 4CDWC 2HWC3 3ZFGB 1C8NA 1FMD2 2HWF1 5C9AB 4Q4Y3 4N43C 5ACA3 1VBB3 5CFCC 2GH8A 3J8F2 4WM8B 1PGW1 1AR73 2PLV2 1OPOA 4RS5A 1BEV1 3ZFFA 3CJIB 4CEWC 1RUF1 1RUG3 2RS33 4RQPB 1H8TB 1D4M2 1RUI1 4RR3B 4YVSA 1ND3A 5BNOC 4CDUB 1RMU1 1RVF1 1BMV2 1RUD2 4CDXA 5ABJA 1RUE2 4CDWB 1NCQC 1QJY2 1AR63 3JBG3 2HWB3 5A32B 1ZBA2 1RUJ1 2RS12 5A33B 5CFCB 3VBUA 1ND2A 2R062 1R1A1 3DPRA 2HWD2 3VBHC 1AR82 1B35C 1NCRA 5FMOL 1AL22 5JZGC 2HWC2 1COV3 2TBVA 1VBA1 3ZXAC 2DF7A 2MEV1 1K5MA 2HWE1 1FOD3 4Q4Y2 2RM23 1TME3 1VBB2 5BNOB 3VDDC 4Z92B 3JB8A 3VBOA 3NAPB 5K0UA 1TMF3 1AR72 1QQP3 4WM7A 4QPGC 2Y26A 1RUG2 1M06G 2RS32 1V9U3 2XBO1 3TN91 1HRI3 1IHMA 2ZZQA 5C8CA 3ZFEC 1MEC2 1VB4A 3VBSA 1AR93 4GMP1 2VQ0A 1R093 1B35B 4JGZA 4SBVA 3VBFC 1BBT1 5JZGB 5AC93 1VB2A 1W39A 1EAH3 1VBD1 1AR62 1R081 3JBG2 2HWB2 1ASJ3 2X5IB 3VBRC 5FOJB 4GH4A 1C8M1 5L7OA 1X36A 5C9AC 4QPGB 3JD71 5CFDC 1HQNA 1HXS3 1COV2 1RHI1 3IDEA 3CJIC 1PO21 1ZBE3 3ZFEB 2RR11 4JGYA 2RS53 4RQPC 1EV13 1H8TC 1TME2 2RM22 4CDQA 2WZR2 4N53C 1TMF2 1QQP2 2WS93 1VBC1 4RFT0 4AEDB 4N43A 4CDUC 1A6CA 1QJU3 1V9U2 2BFUS 1NA1C 1HRI2 1MEC1 4QPIC 1AYM3 4CEWA 3VBRB 2R041 1QJX2 4YVWB 1VBE1 5BNNC 1AR92 1WCDJ 1R092 1MQTC 5CFDB 4PDWC 5AC92 1VRH1 1RUC3 5BNOA 1RUH2 1EAH2 1AYN1 2WFF3 4LLFA 1ASJ2 1HRV3 1NY71 4Q4W1 2RMU1 1Z7S1 4Q4V3 2BBVA 5DDJ3 1NCQA 4N53B 4Q4X3 1OOPA 2QQPA 1HXS2 3M8LA 1PO13 3NAPC 1NA1B 1ZBE2 2R071 4QPIB 3VBHA 1HX6A 1PIV3 4RHV3 2WZR1 1EV12 1PVC3 1POV3 5BNNB 2WS92 1MQTB 5BNPA 4PDWB 4GB33 1FPN1 1QJU2 3VDDA 3ZFFC 1QJZA 2HWF3 1AYM2 5C4WA 1QJX1 1FMD1 2FZ1A 2X5IC 1BEV3 1RUF3 5ACA2 3ZFEA 3J8F1 2PLV1 3FBMA 1RUH1 1RUC2 1RUI3 2WFF2 4CDXC 1HRV2 2IZWA 1D4M1 3VBFA 4Q4V2 5DDJ2 1PGL2 4CEYC 1RMU3 1RVF3 4Q4X2 3VBUC 1F8VA 3DPRC 3ZFGA 4FTSA 1PO12 4RS5B 1RUD1 4Y5Z0 3ZFFB 1BMV1 1NCRC 1RUE1 4AEDC 5C9AA 1QJY1 1RUJ3 1PIV2 4RHV2 2ZTNA 4WM8A 1R1A3 1ZBA1 4YVSB 1PVC2 2GSYA 2RS11 3CJIA 2R061 5FMOS 4GB32 4RQPA 2HWD1 4YVWC 1VBA3 5K0UC 4WM7C 1H8TA 1AR81 2ZAHA 4RR3A 4CDXB 1AL21 4IV3C 2MEV3 5ABJB 2HWC1 2HWE3 2HWF2 1RB8G 4CEYB 4CDUA 5C8CC 1PGW2 4Y4YA 4Q4Y1 1FOD2 5ACA1 1VBB1 3VBUB 1RUF2 1ND2B 4NWVA 4CDWA 3HAGA 3DPRB 4QPIA 1AR71 2XBO3 3TN93 1RUI2 1NCRB 1RUG1 4JGZC 2RS31 5A32A 5A33A 5CFCA 1K5MB 1RMU2 5D8AC 1RVF2 4GMP3 4GH4C 1BBT3 3VBOB 1NOVA 2WLPA 5J96B 5K0UB 4WM7B 5LK7B 2XPJA 1VBD3 4IV3B 1R083 1AUYA 1RUJ2 1AR61 2BUKA 3JBG1 2HWB1 1C8M3 1R1A2 5C8CB 3NAPA 1E57A 3JD73 4EJRA 4CDQC 4IV1C 3VBSB 1GFF2 1VBA2 1RHI3 3LOBA 4JGZB 1PO23 2MEV2 2RR13 1COV1
chains in the Genus database with same CATH superfamily
2XVKA 2J1RA 5T3NA 1W04A 4AGGA 1Q43A 4FPGA 4XACA 1XNCA 3AJYA 4CCDA 5IYYA 3ASIA 3QH6A 4JDOA 2Z42A 4YZ1A 5FZFA 3CQOA 4L2NA 3BN6A 2DV9A 1XOYA 5GKAC 4UW6A 5FBZA 4FPKA 2AC1A 4HVRA 5A3WA 4CCCA 2A6YA 3URFA 1AX2A 1XSQA 2G1MA 2XBO2 4B4PA 3HBZA 3TN92 3FLPA 5DUUA 4XDQA 3LA3A 1WCQA 3LSDA 1UZWA 3P1IA 4JC1A 4L9BA 1HRI1 4W65A 1B09A 3ILFA 3HOBA 4JGYB 3H8XA 1YCIA 1G9DA 1AL0G 1ZA7A 2WNOA 3TB0A 4XUNA 4AI9A 2P3JA 3ZXLA 1W90A 4YM2A 1CR7A 4IV1B 1LB2A 2BPA2 1S0BA 2KM2A 3C3VA 1H0BA 5I0RA 4LITA 4CEYA 3MICA 1OOPC 5JDBA 2J1TA 3PUIA 4OYUA 3WQ1A 4QB2A 3NJVA 4LKSA 1Z7S3 2VY0A 2XWJB 3S6PA 4J6GA 3WHUA 1DGWA 4X6RB 1X82A 2PHFA 4YW1A 2EIGA 1XPWA 5IVCA 1Q8PA 4CEWB 5A3MA 3JD72 2VJXA 1NG0A 4LR4A 1NQDA 3ZXEA 2A1XA 1U5IA 5FY5A 3O1UA 1OD5A 1RHI2 3FC0A 1PO22 1KJLA 1QU0A 1ONAA 1ND2C 3NNGA 1GZWB 3ECQA 2A3XA 4FSJA 1UY4A 2VAUA 3VBRA 3WEZA 1NLQA 2W94A 5FYZA 4A45A 4CP1A 4QXBA 4Y33A 1CIWA 1PNGA 2DTYA 5DAXA 1LOCA 5C3QA 4LA2A 1RUOA 2WNVA 4AVCA 2BVVA 4YG0A 5CFDA 1GQGA 2Y0OA 4WVMB 1NCQB 3J7LA 1QXJA 1VMFA 1W9WA 1UY0A 4XUQA 2OQ6A 1UU4A 3MIDA 3NWKA 5FLHA 1OOPB 4TSVA 3P3NA 5AFEA 3VBOC 1I1EA 2X09A 1QJU1 1QOOA 4EQVA 3KQ4B 4HN0A 4XJ9A 4W50A 5FY8A 3C8XA 4BIOA 4CP9B 1VIWB 4O7XA 2C24A 4OZXA 2YC2A 1EP0A 3B94A 3JB4C 3X29B 5FPXA 1VBE2 2BZDA 2WO2A 4LPLA 1UU6A 2EA7A 1NUKA 5JXHA 1PNFA 3W5NA 3MF9A 5HXMA 5B4NA 2XWBB 2D40A 1JUHA 1VRH2 3O12A 2G9FA 1VMHA 3LDKA 1AYN2 4FXGB 1N1SA 2P17A 4IEWA 4QKNA 1NY72 2PAEA 4M4RA 2Q0AA 2ZMNA 2UURA 4KMQA 4Q4W2 3ZFGC 3ZSLA 3VDDB 2WFF1 4HKWA 5A1LA 3BIEA 1LOAA 1HRV1 2ZHMA 3H3LA 2Q4SA 4B1LA 5BNNA 1PMIA 2WABA 2ETEA 4QGMA 5LA9A 5HCAA 1VAKA 3IAQA 2E32A 3RDIA 4WM8C 2ZEYA 3KB5A 3N9OA 4JHZA 4TXWA 2VOVA 1RUD3 2G4IA 1XU1A 2HJIA 3VZLA 2F4LA 3WD5A 1WLWA 3ZYHA 2WZPP 2WYSA 3DXUA 2X53S 1PO11 5F5IA 1K42A 3ZPYA 5FYYA 2Y0IA 2IVIB 1S55A 2PHWA 2DVAA 2ZGTA 2GC3A 3AL6A 3AZVA 4MXWB 3OPZA 2WWJA 4XOGA 3CJXA 2OX0A 2VZ1A 2WDBA 4B4RA 3IPVA 5FIXA 4RN5A 3O1SA 1R1ZA 2UWCA 3RZGA 3NKTA 2D98A 1SLIA 1DQ4A 4I02A 4AFAA 3ACIA 2ZGUA 3NV4A 5A1FA 1FPN2 3OGJA 4HETA 3ZYRA 1AL23 4CCKA 1YWKA 1TG7A 1W03A 3ZFGB 1BZWA 2BERA 4YW6A 4CZSA 4HL0A 1JODA 3BOPA 3OY8B 4FQ4A 1UYPA 1FMD2 2R1BA 1LOFC 5JLVA 2HWF1 3H1YA 5C9AB 4N9HA 1RC6A 4P00B 4LBQB 5CFCC 4LO5B 5LZ6A 2GH8A 2GNDA 3KV9A 1BJQA 4WM8B 3RJ2X 4XFGA 4JZRA 1AXZA 2OPWA 4M3CF 1OPOA 4RS5A 1BEV1 3ZN6B 4B29A 4XYXA 1RUF1 5A3TA 1RJ7A 3HEIA 5ANNA 1PK6A 1W3VA 3OD4A 3VDBA 3UGHA 4AFBA 1OBNA 4DB5A 1D4M2 2JG9B 5CB7A 5J48A 4MV2A 2VUDA 5F5AA 1NE6A 3KGZA 1CWPA 3ZM8A 2P34A 2VECA 2PHRA 4CDUB 1F15A 4B4QA 4LBLA 4GXLA 1KRIA 3SLIA 1I5PA 3UJOA 1UYXA 3NSTA 4IEXA 4BK5A 4EZ4A 1ZA4A 1SFPA 5B4XA 1DQ5A 4CSWA 1JZ7A 3POBA 5E88A 4DXRA 3WW4A 4DO0A 4ZHNA 3SEPA 4AQ6A 5LEJA 4FXKB 5FZ6A 1W6MB 1W8TA 4XF9A 1RUJ1 4ZXKA 1Y43B 4BZ4A 5CFCB 3VBUA 1WBFA 2R062 3W58A 3ZYGA 3RZKA 2F4PA 3NO8A 3SHRA 3SISA 2BWAA 4B7KA 3VBHC 3E97A 4GULA 1NCRA 3JQXA 2FBEA 3KVBA 3H8UA 4QHBA 3DYMA 1F4AA 1GQHA 2HWC2 2H0BA 2D5HA 2TBVA 3OEBA 3OGSA 3Q8BA 4NJ4A 3DECA 5EV7A 3GF6A 5A7OA 1XQNA 2DF7A 2YBPA 3CZJA 3POGA 3PNAA 3ZXAC 4XUPA 4OQ8A 4QX8A 1XYPA 1KXGA 5ANQA 1IQAA 1UOFA 1PMJX 2G19A 5F5QA 4AQ2A 3JB8A 4NIHA 1CAWB 5K0UA 2WAOA 1AR72 3ZXDA 5FZ9A 2D44A 2DUOA 4CCMA 2OKXA 1RUG2 4QU1A 4UFMA 1V9U3 2XBO1 2ORXA 4E2QA 4A4AA 4OHZA 3TN91 3RZLA 1IHMA 2P3KA 2ZZQA 3RS6A 1MEC2 1JZ5A 2JEMA 5FZAA 2QJVA 2BWCA 2FCUA 3CDZB 3FJSA 3MIGA 3OBZA 2HEVF 5T55A 2HEYF 4HG6B 3IDCB 4S2GA 3VBFC 3MGUA 5I0UA 1GBGA 5CEHA 2ZABA 1VB2A 2CGOA 3C2UA 1L7RA 2IXHA 3HNMA 3PURA 4Y1YA 2HWB2 3V64A 3U37A 1W9FA 1ZREA 2O8QA 5FDBA 3SQOA 3VBRC 5FOJB 4LHLA 1XE7A 2BP6A 2WT0A 2EXKA 2SBAA 1VP6A 1ZZ7A 2XJQA 2ZGLA 1LGNA 4OULA 5L7OA 1U5ZA 4D0QA 3GZEA 3UK9A 3JD71 1JH5A 1VJ2A 2GMEA 1SLTA 3I54A 1IGOA 5CFDC 2HBUA 1TNFA 2IFWA 3OGVA 1EUTA 4UFJA 1RHI1 1TE1B 2VZOA 2WO3A 3IDEA 3KT1A 3IWZA 5FYVA 3BIWE 5HXVA 1PO21 4A41A 4JTNA 2ZX3A 2KD7A 3AP4A 1IPSA 4BQ3A 2EXHA 2ERFA 4BMBA 4WZCA 2BGPA 2VR4A 3PVNA 2WZR2 1N1TA 5JIUA 3I2HA 5BPXA 1Y4WA 2PHXA 4C90A 2B46X 2DU1A 4K6BA 2YG0A 1LENA 2XJTA 1BLZA 4KBBA 4P9LA 4P9YA 2VMEA 4E2SA 1DHKB 1YFXA 2BFUS 1JMUB 4UBHA 1E5RA 2YZ4A 2RV9A 4XFBA 3T09A 2JG8C 4ZU4A 2W46A 2FDFA 2VMGA 3M3OA 1MZFA 3AM2A 3VBRB 3WOGA 3INAA 4XPVA 3P6BA 4BMEA 1QOTA 2WLQA 4X8PA 2QTWB 4FOQA 1VBE1 5BNNC 2WNVB 3KHBA 1R092 2AGSA 5CFDB 4LE3A 2HLEA 1OLME 1RYYA 4LBMA 2XQRA 1MR5A 1WMXA 5AC92 3H3ZA 4MX3A 1VRH1 5KBFA 2FQPA 3DYOA 4FT8A 4LK7A 1EAH2 1AYN1 1POQA 4JRLA 1YLLA 1ASJ2 1NY71 4Q4W1 3LA7A 1ZZ6A 2QZ3A 2GDFA 1YQ8A 4KGGA 4NVPA 3A7QA 1S2BA 3LEGA 4OFGA 3VB9A 4TWTA 1I3HA 2OQ7A 1DLLA 5EFUA 2W91A 2CTVA 4D6QA 4IEUA 2QQPA 2W68A 1UMHA 4Q1RA 3M8LA 5FZ8A 3LA2A 4XJZA 5C33A 1K3IA 2VNOA 2VVFA 3GZTB 1DZRA 4OMCA 4RD7A 1RL3A 1F4HA 1PIV3 1UF2C 4RHV3 1HV1A 1SFYA 1EV12 2DCJA 4JTOA 1GANA 4MH0E 3ZVXA 2ZGMA 3N7JA 4M3CA 4XF0A 1POV3 5BNNB 5KXCA 3K3NA 3MIFA 1REDA 4R4ZA 5BNPA 2Y6FA 2KR2A 3U11A 4GB33 4NPRA 1SBEA 4JX0A 3K75B 1I6XA 2ZMKA 5FZHA 1FPN1 1OXCA 2MNGA 3GYDA 4PQ9A 4QU2A 1QJZA 1LNSA 2VH9A 4AAPA 5HCFA 4AHXA 1QOSA 1PK6C 2BVBA 3A0KA 4Y24A 5I0SA 1AYM2 1YUDA 4Z82A 4E4HA 1CX4A 1F31A 1FMD1 4E4DX 4NHLA 2DU0A 3TAYA 2FZ1A 4BPZA 4Q0QA 3ZR6A 5I8YA 1OA2A 1OUXA 3IPVB 2UYBA 2VW2A 1QNYA 4IGQA 3ZFEA 2BOIA 5ACA2 2WZEA 4QDRA 3ME2A 5JR7B 3ACGA 4AVAA 4RYDA 4YGBA 3W9AA 2GC0A 5FTTC 1RUC2 1XSRA 2GZWA 4XCBA 4OHWA 2XVLA 4MYEA 3ZIWA 4Y5TA 1OQDA 1D4M1 1OPMA 3PUSA 4Q4V2 5H9SA 4AFDA 1OUSA 2WQ4A 1FNYA 1PGL2 2YC4A 3B9CA 1RVF3 5E8AA 4C1WA 3MLLA 4TN7A 3T1LA 3S7EA 2A3YA 3VBUC 3ZSJA 1PMHX 3I97A 4INDA 1GU3A 3RMYA 1Z0HA 3ZMNA 4XTPA 1W2OA 2DVGA 5DZFA 4RS5B 4CUAA 1UY1A 1NCRC 4EV0A 1PK6B 4R52A 1V00A 3BALA 4X8NA 3ZO0B 2Y64A 4ATEA 4OHXA 4XF1A 5LASA 1R1A3 1OC1A 4MVTA 1DZTA 2DCZA 2Y33A 3NNMA 2ZHKA 2GSYA 4KBZA 1OSGA 2FCVA 2R061 4L92A 5FMOS 1JZ8A 3MDPA 4YWAA 5FWEA 2Z2SB 1OLQA 2AENA 2C9KA 4KI5M 5CYYA 1VBA3 2YXSA 3HQUA 3IIIA 4YVWC 4AI1A 5K0UC 2PFWA 4RR3A 3M3EA 2YGMA 1IPJA 2MEV3 1D2QA 4TTGA 2W52A 2HWC1 4MZUA 3O1RA 4IEVA 3VHNA 4P9WA 1D7PM 3UT0A 3FHIB 4R9AA 3R4DB 5AVAA 5FPVA 1MS0A 1LJ7A 3UJQA 5JOXA 4ISQA 4URTA 3NNLA 1LOBA 5JXGA 4ATFA 1HB4A 3NNJA 3VBUB 4EWAA 2QUOA 3WW1A 2F17A 4TLGA 1OF4A 3N3HA 1AR71 4Q8LA 2PHTA 1NCRB 1RUG1 3K4DA 1V6OA 2TUNA 5JAXA 1UIKA 4XDPA 2YBKA 3LIHA 5FP9A 4BB3A 1GNZA 2A6ZA 1JN2P 2BGOA 2R6QA 4XW3A 1JOBA 1AXKA 1SZBA 1O4TA 4OHYA 4LBQD 2Y6LA 2B5HA 5D8AC 4MGTA 2R1DA 3POIA 1IOAA 5L9BA 1HW5A 2LS6A 4MGIE 3T4HB 2MPFA 1O3RA 4GH4C 1UY2A 4D7TA 2E6VA 5K0UB 1LHWA 3PU3A 4EROA 4QXCA 4TYSA 1CPMA 1ACCA 1VBD3 3CL1A 1N3QA 1R083 1WA4A 2W1SA 4XFHA 5BY5A 4NIGA 4UW5A 2W1QA 4FQZA 5KHJA 2W47A 1LOEA 2XJVA 3B69A 2BUKA 3T1MA 2HWB1 3I3EA 3QD6A 4XUOA 1C8M3 3MW2A 3LEIA 1W2NA 3EQEA 3NAPA 3K3OA 2CWSA 4Q0VA 5FP3A 3H9AA 2BDRA 2JD4A 4U2AA 4EJRA 2YPDA 3O1TA 4FFHA 3OB8A 2QFEA 5F8PA 2PMWB 1UOBA 2YMZA 3LEMA 3K48A 5LB6A 1CN1A 1GLHA 3WF2A 4AGRA 3R05A 4ZPIA 2A5ZA 3ILNA 2HWE2 4JVAA 2VTFA 4Y22A 1NE4A 3BCWA 5D8AB 1T2XA 5K7PA 1FOD1 1J59A 5CBLA 3HT1A 2ZAAA 1REFA 1VBC3 4J25A 1KS5A 5CKQA 1W8NA 1UQXA 4G9SB 4GH4B 4K1ZA 4COUA 4CXWA 4URAA 4XF4A 1GR3A 2NMNA 3BGAA 5L7OB 2EALA 2QDRA 2WO1A 4GJZA 1MS8A 2J7MA 4PHZA 3RQ0A 1OVSA 5KHGA 4QKDA 1MEC3 3IN9A 5F2SA 4DFSA 3M4FA 4LKEA 1P8JA 3E5XA 2Y38A 3OTFA 5A7WB 3I7DA 4FOWA 4JQRA 1GNYA 1SG3A 2JB4A 4TLFA 3C7GA 1XYNA 3NNFA 5I0DA 3M7AA 3IZOA 4PF5A 1I5ZA 5H9QA 3GM8A 1ZYBA 5E1RA 4QHZA 5A6YA 2RDRA 5JMOA 3OBTA 4YVSC 1R091 5FXXA 5CKNA 3DKWA 3HQRA 4ITCA 3VL9A 3V56A 4FTEA 5AC91 5FBJA 1SLLA 1Y9MA 1QDOA 3VZJA 1G9CA 1CGPA 1UYZA 1EAH1 4QGNA 3VKLA 3WINE 4BK4A 2VO5A 5L9VA 1G9AA 3WVJA 1ASJ1 3RNSA 3ACHA 1VRBA 3E1F1 1OKOA 3AP5A 4AEDA 4YRDA 2P3YA 5DAQA 4K7JA 4UXAA 1WMDA 1EPZA 3S5QA 3FUQA 5FPLA 3BTXA 2PELA 2VZUA 4QXHA 5BNPC 1C5IA 4OVEA 2TNFA 4XAAA 2R073 2RR12 5E6HA 2ARBA 1LGBA 1OURA 5CISA 1F5JA 2WZR3 3QCWA 1CX1A 3U78A 1JYTA 1CAUA 3NKGA 1VLNA 2JXAA 4A6SA 1WD3A 1WW7A 1EV11 4FPOB 3CF6E 4KWKA 3V0AA 1LRHA 5DUVA 2BBAA 2JDYA 2D6OX 1W06A 1ULFA 4QB6A 4OHVA 1JU3A 1ZZ9A 3WDUA 2JDNA 1H6YA 1N47A 3WT3A 1G6NA 4BQ1A 4JDMA 4BHPA 2R042 4O9EA 2QQVA 3D0JA 1DGLA 2LUWA 3E5QA 4PBOA 4PLMA 2J1EA 1W9YA 1HB2A 3PU8A 4ZKTB 3MFCA 2AR6A 4XBLA 2VOWA 1AYM1 4XE9A 2ZKNA 1WUVA 4XIOA 1BCXA 3J8F3 4M3CB 5H9RA 2PLV3 4AWDA 2VBPA 1NA1A 1QH6A 1HIXA 2XG3A 1BEV2 4YGDA 2QQWA 5BNPB 5CNAA 1LAJA 3WV6A 3UKNA 3VN4A 1V6JA 2JJ6A 5FKBA 3VBSC 1RUC1 2Q1MA 2RMU2 2UU8A 4QQHA 4R8HA 1OFNA 3MO4A 4UWDA 3HT2A 4Y20A 3OGRA 2ADDA 4LIVA 5LBFA 3RZHA 4OI2A 3AXEA 4Q4V1 4NO4A 3KT4A 4RGKA 1PGL1 3GALA 2O8OA 1H4HA 1NLSA 1F2NA 2AUYA 4AE2A 1CJDA 4PLOA 3DYPA 3ZYIB 3HBKA 4GMP0 3QLQA 1MZ6A 3T08A 5HPOA 4YM0A 3U14A 2G9ZA 3PJYA 3LFIA 4DNYA 1WW6A 5A7PA 4RR3C 4XHBA 4LTAA 2DUQA 4M00A 2AEZA 3GNEA 4BISA 1S0CA 3I2FA 3HJRA 2AZ5A 2E53A 3KSCA 4PCRA 5F3GA 2RS13 3O1OA 2XR4A 1NQJA 4CPBA 1DYKA 5G05L 4ORFA 2O14A 4JGYC 3VD7A 4D7YA 3N7KA 3DF0A 1XYOA 1AR83 4IGOA 3ZYPA 5M0TA 1BVVA 1NYWA 2ZX2A 4K8RB 3LE0A 1C8NA 4X6QB 3AX4A 2BEOA 2A6WA 5FZOA 4Q4Y3 3ZSKA 1W3XA 1YQ5A 3G7DA 3LPFA 3MV01 1SFNA 1VBB3 5I0TA 3ZSMA 4IW3A 4FPJA 5E16A 3SKJE 3VKMA 3T0BA 5DUWA 4AOCA 1MPXA 4CEWC 4P9IA 2RS33 3PVBB 4GWMA 3I49A 2DBIA 1K45A 1Y3TA 2VNVA 4RR3B 5JCTA 1J3QA 4HSLA 3RGBA 4DEQA 2W39A 1DCSA 1CPNA 3ES1A 2GP3A 2ID4A 5F32A 1ND3A 4NRPA 1AHSA 2QKDA 3BU7A 3ETQA 4HSJA 1BK1A 1LOGA 2J42A 2P6HA 2P6CA 5LRRA 2QQOA 2ATFA 2V5DA 5F9TA 4D8MA 1R64A 3W20A 4JCKA 4M0NA 4RL7A 4Y5SA 5T5LA 2WWUA 4CDXA 5ABJA 2Y6KA 3K77A 1RUE2 4Q8KA 1NCQC 3WG2A 1J1TA 2XVGA 1QJY2 4PI2A 4GKYA 3T4VA 2VPVA 4KH9A 3O0VA 1AR63 4IEPA 4R4XA 2EVXA 2XJUA 2QCSB 3MEPA 1ZBA2 4N90A 3KCCA 4YM1A 5IW0A 5FYUA 2VM9A 3WHTA 1OI6A 3OEAA 4P9GA 5CAZA 3H1MA 2HWD2 3KHCA 3LEKA 2XJRA 4OLLA 2A70A 4K8FA 2VE1A 2LM3A 1COV3 1PZ8A 2OVUA 1PHMA 2P3IA 1L3JA 5T5JA 5JI7A 2XJSA 2WSUA 2B4KA 3KV4A 5IAVA 3U0ZA 5J09A 1K5MA 4P02B 1H2MA 5JIAA 2HWE1 4C0HA 4D6SA 4DINB 4UFKA 4LQRA 5IFPA 4FPFA 5BNOB 3VDDC 2YC0A 4Z92B 4WZFA 4AHYA 3LQCA 1LODA 3NAPB 4WM7A 4QMAA 3WXPA 1V6IA 2VUAA 3LKJA 3U75A 1C3HA 3ZIXA 2JIJA 2QE3A 3VKFC 1AX0A 1S0IA 3AVRA 3RPQA 1YIPA 4ASMB 2V5YA 2Y6HA 4NRMA 3PDQA 3HN1A 2NZ9A 1HRI3 2WT1A 2BW8A 3D5OA 3BTZA 2LALA 1NZCA 1VB4A 2P4EA 5FXZA 5LWBA 5JUVA 1S0GA 1KEXA 4COVA 5JOZA 2SLIA 3WP3A 4SBVA 3SH3A 4ES8A 1Y9QA 5JSRA 5FQ0A 1D4VB 5A1AA 2YV8A 1W39A 5L36A 4V2VA 3JBG2 3WF3A 5JXIA 3OBAA 3HNYM 4QAWA 1YC61 3M2MA 4AVSA 4AEMA 4LUMA 4NE9A 1MACA 2EF6A 2VCBA 1CQ9A 1H9WA 1CAVB 1CZVA 1HV0A 1MVQA 1X36A 5C9AC 3GBGA 1HN1A 1H6XA 4XFCA 5F3EA 2X10A 4A3ZA 2YGLA 3AKTA 4HOOA 2J1AA 3LAGA 3LZZA 4DY5A 3WNKA 5EYYA 3T0DA 4YW5A 3POEA 5FZ0A 4EN7B 3RVHA 2CYFA 2X8KA 3GDBA 1OH3A 1S0EA 2I45A 2DFBA 1DQ2A 3CZUA 4QGLA 4LMFA 2RR11 2WR9A 3BPZA 3PIGA 4DUXA 3GHMA 2ES3A 2A75A 4GKXA 2RM22 1BQPA 1TME2 4QM9A 4MHUA 4CDQA 2JG9C 4JDNA 3N9MA 4Y3OA 1IS4A 1ZRDA 1TMF2 5FZKA 1QQP2 4GWJA 1HLCA 1IKPA 3MW3A 4B7EA 4AEDB 4JV4A 2ZX0A 4M0HA 4N43A 5EXOA 1QJU3 3VL8A 4CDUC 3AMMA 5LCWL 2J22A 2PHDA 2IWGB 1NA1C 3AKSA 3WUDA 5HV4A 1ZNPA 1FNZA 4ET7A 1C1LA 5FZ1A 1UXXX 1WCSA 2R041 5BXXA 2FDGA 5FMDA 1CAUB 1DG6A 1YYNA 4AFMA 1MS1A 1AR92 4H55A 4UF0A 4Y1ZA 3H8RA 4LO6B 4M01A 2CHHA 2W95A 2Y60A 3KF5A 3V0AB 4FPHA 2CAVA 4B8EA 2P37A 3ZLIA 3RYRA 2WFF3 3ZYFA 4K3UA 3POWA 4LLFA 4W6YA 1C28A 1HRV3 4Q0UA 1ENRA 4Z8BA 1JU4A 2RMU1 3MPBA 4L8QA 4UOJA 3AZXA 3OYWA 2BBVA 3JUUA 2V4AA 5C7GA 2VBDA 4WVVA 4XETA 4ZY9A 4ZS3A 4N7IA 2VZSA 4FPLA 2WT2A 3B7MA 3E5UA 4LJHA 4BDVB 2D6PA 4O9GA 1HXS2 1PGSA 4W8JA 3J9SA 1PO13 1NA1B 3MLKA 3ALQA 2O0OA 3CBNA 1SDWA 3PJQA 4GZ9A 4GH4A 1YRZA 2VZTA 1ZBE2 3SXWA 5FYHA 5I91A 5GJ6A 2GAUA 1W6NA 3RZMA 4Y20B 4BLIA 3D6EA 4AK3A 2GH2A 2DURA 4JKMA 3ACLA 1VR3A 3K2OA 2WS92 1W6QB 2WA3A 3H1WA 4CCEA 4QPYA 4XQ4A 1LGCA 2J1UA 3M70A 2K0GA 4LO8A 3N9LA 4Z1VA 3VD9A 1H8VA 4UFIA 4QX5A 5L19A 5DZEA 3BU0A 1D0HA 2CNAA 2VC9A 3O0WA 3KZ4C 2HWF3 4AEKA 1W05A 2XJPA 4JKKA 5C4WA 1QJX1 2JDMA 4BQYA 1ENQA 2ARXA 3LFMA 5DAVA 5APAA 1K12A 3WNPA 4YSFA 1WA6X 1BEV3 4LBNA 5A70A 1RUF3 2BNOA 3S0MA 3RI8A 1DQ1A 3AFGA 5IVYA 1RUH1 1XE8A 3MHZA 2OT7A 1O3QA 5FP7A 1CJPA 3Q8AA 3WP6A 4CDXC 3AFKA 1FV3A 5DG2A 3S30A 3DCQA 1E5HA 4IEQA 1LU2A 1OMIA 5A6XA 5DDJ2 1J1LA 1ULDA 2DYCA 4CEYC 5FO8B 5GLWA 4CUBA 2XMLA 4KG0A 4CU7A 4QD2A 4XMAA 5FZOB 4AFCA 4K9SA 1U0AA 4Q4X2 4LO4B 4KU8A 2VOTA 1WLTA 4D6RA 3TWIA 5GLUA 4XZPA 4Y5Z0 4BQXA 5IHRA 1RUE1 5FPBA 2XQXA 3AMHA 3PVEA 2A6XA 3PVOA 2QQJA 4G3YC 1QJY1 1RUJ3 1HB3A 3IMMA 2WYFA 2Q30A 4GA9A 4KU7A 1AF9A 3WR0A 5IATA 1ODNA 1ZBA1 5EHDA 1PVC2 1GYKA 3T2OA 1IG0A 4FPCA 5LA1A 3CJIA 4DXSA 1SLAA 4F3JA 1US3A 2D97A 4WV8A 5IWFA 2R32A 2DCTA 5B2GB 4RQPA 2HWD1 3A22A 4WM7C 1H8TA 1W28A 2WNVC 2B7YA 4S2DA 4CDXB 4ZZ5A 3MUY1 1YHFA 3RWNA 4A44A 5ABJB 4HLTA 1REEA 1FAYA 4DRVA 5KXEA 1AJOA 4UW4A 3DN7A 2P2KA 1NAEA 1UKGA 4AZZA 1ZVFA 4CEYB 3T30A 1GP5A 5IK7A 2Y34A 4N9IA 1FOD2 1ULGA 4EZHA 3AZWA 5CVRA 5GM0A 4A7KA 2XGXA 3WF1A 4CDWA 4QPIA 1IS6A 3MIBA 5FY4A 3T2PA 2YFZA 1RITA 2XBO3 3CKHA 4PF1A 4HKLA 3TN93 1LR5A 1RUI2 2JECA 4HANA 5FP4A 4DXTA 2Y8KA 1F5FA 5A32A 2P5BA 3OOXA 3KT7A 2R30A 3PIJA 3KS7A 1HDKA 2OPKA 2V73A 3WW2A 1D2SA 3WG3A 2JX9A 4Y1UA 1K5MB 2PHLA 5EPAA 5TSWA 1RMU2 3E6DA 4IE7A 4PIYA 2Q8EA 2CDPA 2BJSA 1SDDB 1SBFA 1JYXA 2E7AA 3IT8A 1V6KA 2NMOA 4LORA 2GALA 3J7MA 5FUIA 4G4FA 5EIYB 1LULA 2HYKA 4WM7B 2VZPA 1ULOA 3GBWA 1RGSA 2IFRA 2E26A 4Q27A 4RGGA 1MS9A 4AVBA 2PYTA 4DUWA 2ZHLA 4YARA 3KCXA 2P1BA 1H1AA 1XXNA 4BIFA 4MHRA 4H2AA 5FY0A 2JE9A 1SHWB 3JBG1 3A4UA 4AVTA 5C70A 5HV0A 2VOXA 2CU5A 1UZZA 5FZCA 3WF0A 3IAPA 1E57A 3OPTA 4BU2A 3JD73 2OUHA 4CDQC 4CVUA 2DVBA 2CAUA 4MGKE 3SCHA 4I2OA 1VAMA 1U5YA 3PL0A 1QKQA 1CVNA 1RHI3 1UZVA 5CZKA 3VD5A 1S0JA 5LBBA 4Q0PA 1AVBA 4YW7A 1PO23 2EICA 3H7JA 3VHPA 1XE0A 4FFGA 2CGNA 5FQ0B 2Q8OA 2FMDA 3L2YA 1GZ9A 3NV3A 2OW4A 1NXMA 5J98B 4E2GA 1X33A 4AI3A 3UETA 5IVVA 1E5IA 5BNQA 3D0SA 2EXIA 4AW7A 2B45X 1TME1 2RM21 3RRDA 3ZDSA 3RZZA 4LLOA 4P5YA 2GNMA 3KVAA 4P14A 3BODA 4BE3A 4BWOA 4QQPA 4DXZA 2R16A 4GQ7A 4CUCA 4XJ8A 5J37A 1POV0 1TMF1 1QQP1 4GD4A 4YG6A 4H7MA 1VMJA 4JHTA 1AJKA 1O4YA 3I2KA 4AL9A 1W99A 4A3XA 2X5IA 2PAKA 2W87A 3THCA 4ZZ8A 3PMEA 3FUOA 2ZGOA 1H4GA 4RS5C 4MADA 5ISLA 3IMNA 3Q9OA 1JZ3A 3B02A 4EN9B 3GZAA 1VBE3 4QPGA 5F1RA 4E27A 4CDQB 3SH4A 1BBT2 4FCAA 2C6SA 2LW8A 1AR91 1H2NA 5FK8A 1KQRA 1VRH3 3W21A 2NLRA 1AYN3 2VNGA 1XC6A 1JHJA 3LCPA 4N43B 4Q4W3 1W8WA 2NP0A 2B8MA 4OI0A 1HB1A 4CP0A 2ZS6B 4E4ZA 1O5LA 2XL9A 1YI9A 3LOIA 1DGRA 1IG3A 2D3PA 4NHMA 2HEWF 3VHRA 5FK7A 4XCAA 1RXGA 2ZEWA 1LKNA 1GOHA 3MIEA 1DF0A 1J83A 3K51A 2IUWA 4F7ZA 5I8TA 1GKBA 2XB6C 1HXS1 5FZIA 4LULA 3WP4A 4E8DA 4ASLA 5IAXA 1FI2A 3ZXJA 3UGFA 1RJ8A 3S57A 1ZBE1 3N36A 2RS51 4LOTA 3EJKA 4FO9A 2AACA 4HZFA 2QVSB 3ZMOA 3MIHA 4W6XA 1YQ6A 3OYWB 4IV3A 1UX7A 5C4WC 2J1VA 5IFTA 3R6SA 4CU8A 3V0BA 1JOPA 1CD3G 4XQDA 1FPN3 2WS91 4WVWA 1O3SA 1LHNA 4AG4A 4XJWA 5LA2A 4FPYA 1H1IA 2D3RA 4YW2A 1ZZBA 2WWSA 4OI1A 2BFUL 5LY2A 1FMD3 4AI0A 3S7IA 4NWWA 4WVZA 1OKQA 2A3WA 2Z4FA 3GCWA 4LUKA 1Q5OA 1W6NB 1CESA 3FN9A 2YPJA 3FX3A 4LHNA 3KQRA 5ERLA 1G9FA 1O59A 3HQXA 1UL9A 3KLSA 3I4IA 5FYIA 3NQHA 1D4M3 3O14A 1Z7S2 3RWKX 2OZ6A 4YZ2A 4KWLA 2C26A 1UZYA 3FHQA 1V6MA 2LRPA 2JE7A 2I2SA 5C4WB 2GNBA 2ZEZA 5DDJ1 2WQ8A 4OUMA 2ZGSA 3THPA 4FAHA 2VGDA 1ZZ8A 3Q8EA 5A3NA 3D4KA 4Q4X1 1HQLA 4NIIA 3O5SA 2VZRA 2B42B 3TBDA 3WNOA 1G8WA 3VHOA 1WMFA 2UYAA 1KGYA 4QQLA 5L7OC 1DZQA 5ACA3 2VMHA 4IV1A 4JKLA 1UAIA 1IPKA 2YU2A 4BCUA 1JYWA 3PHMA 1UXZA 5C5UA 5FKCA 2R063 4YNIA 2VVEA 2D6MA 1APNA 5JR2A 1PVC1 1WZXA 2KXLA 5FO9B 1GZCA 4FTBA 4NAOA 1UMZA 1DYPA 1ZRRA 2DFCA 3USUA 4CE8A 3R4SA 3T2TA 4CDWC 5FOBB 2HWC3 1VALA 2L9LA 3MZHA 4A7YA 2IXIA 1JYCA 2Q5TA 3LF7A 1OLMA 4JRAA 5FPAA 4QT6A 5FUPA 3UV9A 5A3PA 4I0WB 5IK5A 1UOGA 3UGGA 4I01A 1GOFA 5A80A 4L0PA 3B9IA 4ZXEA 1AR73 1KFXL 1QF3A 2PQQA 4Y26A 3CJIB 3AP9A 5D21A 1RUG3 5IJRA 2FMYA 4NIAA 3NMBA 4IE4A 4PIXA 4V1PA 1V6NA 4RQPB 4DY3A 5E89A 1WW5A 1VAVA 1H8TB 1RUI1 4H14A 2EIBA 1JYVA 4ARXA 1JXNA 5C3OA 4NN0A 4P08A 4DMIA 5T50A 1RMU1 3F2ZA 5JMCA 2RJKA 4D69A 5FO7B 3CLPA 4BXFA 3D3AA 4CPBD 4LEJA 1RUD2 4I0BA 4CDWB 1DLCA 5DABA 1QHDA 1RIRA 3U1XA 3CU7A 4Q26A 2YB7A 4GAZA 5FXVA 5GLTA 1ALYA 2HWB3 5A32B 3P5BA 1JOJA 2VD7A 3MUZ1 4H3WA 5FMBA 4CP2A 4EE2A 3FLTA 1W2TA 5CG9A 4EYUA 2JDKA 1ND2A 1PX3A 4OZOA 5GALA 2OA2A 5DQ0A 3TNQA 2FDKA 1WLCA 2VUCA 4LK6A 1AL22 5FMOL 5FLJA 1A8DA 1O3TA 2VCMA 2YDEA 5FMCA 2B9UA 3PUAA 5F3IA 2EIDA 1OH4A 3D8CA 2JB8A 1FOD3 3I3BA 2VU9A 2R0HA 1O6UA 4NHKA 2D7FA 4YPJA 3VBOA 5IVFA 1FATA 3BB6A 1QGLA 1XRUA 3WNNA 3HMYA 3AMNA 4QPGC 2RDNA 1WCUA 5A7NA 1GP6A 4OI4A 3U4SA 3VZMA 4BJ0A 3OUHA 1JHNA 1ULCA 4KL1A 3ZPOA 2VTXA 5I8SA 1RXFA 5A6ZA 5JPNB 3TYJA 4Q1PA 1HJGA 3I3MA 3H42B 3M3QA 3ZFEC 4N7UA 1TEIA 1KFUL 2NM1A 4IE5A 3EXUA 3KCYA 2DVFA 3OY8A 4IDZA 4GMP1 2VQ0A 3LD8A 1R093 4HK9A 1DQ6A 2RDQA 4JGZA 4LIUA 4COYA 1BBT1 2PTMA 3U10A 5JWPA 4Z2AA 1JZ4A 5FYCA 5AC93 4PI0A 2CSGA 4DIQA 2NN8A 2XOMA 4LKDA 1EAH3 1I9RA 2AREA 5FFOC 1ASJ3 2X5IB 2A7AA 3UESA 3GCXA 4XAEA 2GN3A 4MXVA 1QIQA 5EJ3A 3MFAA 5FZLA 4I0AA 4QPGB 1XNBA 2E31A 2WC2A 3ITQA 1CAXA 3QACA 4EWEA 4YYOA 1MVEA 1GP4A 4OMDA 3RYPA 4L11A 1NT0A 1X8EA 3ZFEB 5HI0A 1YFYA 3J7NA 4AVVA 2GU9A 1SLBA 1EV13 4YGEA 5CA6A 1UO9A 3J4UH 5EP9A 3N9PA 3THTA 2VL4A 4FPEA 1BKZA 4L97A 1Q56A 2W0XA 3AYDA 3GJBA 3T3YA 4YZ5A 1LOFA 3MLJA 1QXPA 2Y6JA 4S2FA 5D2AA 2QQNA 3RFRA 2R0FA 2VQTA 4LHKA 4XHXA 5DXDA 1V9U2 1ZRFA 2QQLA 1OT5A 2DBNA 1PZ7A 3PTRB 3KV6A 1AYM3 3VD3A 4Q2FA 3JXSA 2FDJA 1QJX2 3KMHA 2CL2A 3LDBA 1Q8VA 3WCSA 1H1MA 2K2SA 3UNPA 4COWA 1OA3A 2R49A 1WCDJ 1TZOA 5DZGA 3WSOA 2JDAA 4H7LA 1Y7BA 2WNUA 4ZU5A 4UW3A 2Z69A 5IT6A 1RUC3 3R0RA 4RSUA 1S0FA 3QBQA 1RUH2 3FZ3A 4UBGA 3RZJA 2ZX1A 1XU2A 4MGSA 3ZXFA 1Z7S1 4Q4V3 4PIZA 4IQPA 4MG2A 4A42A 1S2KA 5JSOA 1A3KA 4CCNA 4E9KA 1SBDA 4QX3A 1W0NA 2ARAA 3JQWA 3NAPC 3RG0A 5JOYA 3FMGA 1IZ3A 1N1YA 2VG9A 2W08A 4NOTA 4W4ZA 4LOSA 5FZDA 3I2JA 1W0PA 5A7QA 1V70A 3VBHA 1DIWA 3O7OA 1HX6A 3MPPG 1N3PA 1X50A 2VW0A 2D3SA 1HN0A 5IVEA 1US2A 2DDUA 3AYEA 3BUCA 4C1XA 5CKMA 3GXUA 2QQKA 3EB7A 2F6BA 3L2HA 5FYMA 1LCLA 4LBKA 3HD8B 2VMIA 4GALA 3VGIA 5A7SA 2VCCA 4W6WA 3B5LB 1LU1A 1TQ5A 4LBJA 1GSLA 3FLRA 3EHKA 3VDAA 4BLJA 5FZBA 2GNTA 1W6OA 3VZNA 2ET7A 3ZDVA 3IBMA 3WDWA 2QQUA 2ZXQA 5IK4A 4J1WA 2ZOEB 3TEZA 4BH9A 3SITA 1LECA 5T5PA 3C7EA 3S5AA 2ARCA 4R9CA 5LA0A 2E7TA 3FBMA 1W2AX 2BQPA 3USUB 3JCIA 1ULEA 3N35A 4RGAA 4CCOA 3W5MA 4XTMA 5LEKA 3VBFA 4NMIA 1QMJA 2EAKA 2C9AA 2JKBA 3HPNA 5FWJA 3TEXA 4A6OA 2NQYA 4KG8A 2IXJA 2W5FA 5HBAA 3B01A 1GZTA 2VMFA 4QWNA 3PMSA 1F8VA 4XUTA 4AQTA 4Y22B 5GZDA 4YZ4A 4EN0A 2ZA9A 4FTSA 1RUD1 2N7GA 4PQQA 5GZCA 4M4PA 4AEDC 3N7MA 3V65A 5J1XA 4MGQA 3T0AA 2X29A 5FZ4A 5EJZB 1U5XA 3WDVA 5AFBA 1PIV2 4RHV2 3ST7A 2YHJA 3WDXA 1CONA 3MYXA 4XEZA 3AC0A 4N8MA 3KF3A 1S4CA 1UU5A 3OG2A 1UKRA 1KDMA 4GB32 2Y6GA 4DZGA 4BXSV 4LE4A 2JENA 3RYKA 2VTXJ 4DS0A 4IL7A 2XKPA 3OJBA 2I74A 2Q1ZB 1X7NA 4UI9L 1AL21 2X05A 1ST8A 2XL7A 3HIFA 2VOKA 1J3RA 2HWE3 4Q5OA 3VZKA 4YLZA 3M1HA 5FPZA 1C1FA 2BU9A 3ZXKA 5F6LB 3KV5A 4NROA 1PGW2 3OUIA 2ZPXA 5DAPA 4HBNA 3H8OA 1UYYA 2XONA 5T5OA 2JG8A 1ND2B 4NWVA 3HAGA 4HMZA 1FYUA 4AXOA 3I2GA 1SQ4A 2E33A 1W9TA 2ILMA 1FX5A 3FFZA 4B1MA 2OUJA 3OGGA 4JGZC 4QX1A 1IKQA 1GOGA 1MS4A 1K5JA 2VZVA 2WIIB 1M4WA 4XMIA 1DFQA 4A2UA 5C8WA 5A33A 1LTEA 2V09A 4C8DA 3O1PA 2YYOA 1FXZA 1QJEA 4DPNA 1S2EA 3NJZA 1RVF2 2OS2A 2XKOA 3A21A 2RVAA 5FY9A 3UL2A 3QOPA 4ASKA 2FDHA 2ZGQA 5FZMA 3VBOB 3I2IA 5EWSA 4LA3A 3LSEA 4YM3A 4J1XA 3ZYBA 5J96B 5LK7B 1YNAA 2XPJA 1XB9A 2V4VA 5L9RA 3FWEA 4NAMA 4LKFA 2C0ZA 2DCYA 2VMDA 4QQOA 3B3QE 2ZZJA 4FOYA 3GHNA 3WNLA 1R1A2 2B39A 3IKWA 3NW4A 4QX7A 4XURA 2FD8A 2JDZA 1ZZCA 3POFA 5KHKA 1GUIA 5BUVA 3MV11 2H0VA 2JD9A 2QDNA 3AKQA 4UT5A 5IK8A 1WGPA 1GFF2 1VBA2 3I59A 3LOBA 4JGZB 4AF9A 4QB1A 1O4ZA 3N9QA 2MEV2 5FZ7A 3KGLA 3WDTA 1XNAA 2RR13 5FP8A 3WNMA 5KXBA 2DUPA 1SPPA 1S0DA 2CY6A 3POSA 5K8SA 3KM5A 3CHXA 3GZUC 1SACA 2RS52 3B93A 1T6GC 4LBOA 1B35A 2BYVE 4XFAA 4K21A 1Z78A 5JZGA 4NIDA 2VNRA 1XNKA 3EMRA 4OUEA 2YBSA 5T54A 1XNTA 3DGTA 1YFUA 3TOJA 4DRRA 4M3CE 1CAXB 4PT6A 3ZR5A 5KR7A 3E6CC 2WNUC 1QJFA 3ILRA 1W2UA 4HXCA 1LHOA 1V9U1 2JE8A 1XBFA 4HPKA 1UIJA 1XNDA 2R043 1H2KA 2BTVC 1H30A 4YFWA 2IXKA 3ETPA 4IE6A 4AR2A 2PAMA 2FCTA 2YY1A 1UX6A 2Q1FA 4JAAA 4IEYA 5F5CA 4IEOA 5FR3A 4NHYA 1WLDA 4QDQA 2DCKA 1DQ0A 1UNBA 1HKDA 2UWBA 2XLAA 1BK0A 1PM7A 4P9XA 1KDKA 1ULPA 5J7MA 4QXKA 3HWJA 3DV8A 2WSVA 3APBA 5EJ1B 4XC9A 1VBD2 1ND3C 5F3CA 1R082 1IS5A 3I2DA 4GWIA 3ZYJB 5FPUA 1YJKA 4D7SA 4DEVA 1JYNA 1EPWA 2RMU3 5FAXA 4QKFA 1V6LA 1OD3A 1JZ6A 5ABJC 1C8M2 3DUIA 4ZS2A 1BXHA 2ZMLA 3GBFA 1L7QA 2W1UA 2OXBA 2K46A 4XFIA 1DDLA 4QX2A 1YQ2A 2CDOA 4PJYA 1JUIA 4I3GA 4IGPA 4UFLA 5SV8A 4HT1T 3Q8CA 2PHUA 3CNAA 3ZN5A 3DXTA 1ENSA 2WNUB 3FHAA 2VXRA 4AQSA 3NV1A 1UWWA 2TEPA 1EY2A 2XHKA 2DTWA 5C3RA 1MS3A 3WF4A 1WD4A 5F6KA 2I07B 4XJUA 4XJAA 4PBPA 4YVWA 2FDIA 2WNEA 1NZIA 3WG4A 4IUGA 1VBC2 3THDA 4Y1VA 3P3PA 4I3PA 1K5MC 1W0OA 1ZX5A 3VKOA 4E4SA 2WBKA 2WN2A 1E5SA 3RI9A 5HCHA 4XVHA 1ND3B 2J1SA 4DQAA 1KS4A 3LDRA 4CYDA 2RJLA 4QX0A 2C5DA 5C6CA 3WZ1A 4IEZA 2Q8DA 4CXYA 1QJX3 1YXWA 2PA7A 1SEFA 1URXA 1UZ0A 1SMVA 2IC1A 3AJZA 1MS5A 4N53A 5GZEA 1KJRA 2UY8A 3VBHB 4A7ZA 5FY1A 2NPIA 4KQ7A 3LWCA 3NJYA 5JOWA 5DUXA 4YFZA 1RUH3 2CV6A 4S2HA 3VLBB 2RG4A 1EUUA 1RUNA 4XF3A 5D8AA 1G7YA 3CMGA 4O65A 5LW9A 1A34A 1BMV1 4UYBA 1CIYA 2W3JA 2HBTA 2WN3A 4XXAA 4KGQA 5JI9A 2JKXA 2EXJA 3PUHA 5JPMB 4ISRA 5A6QA 1Q8SA 2UWAA 2D6LX 2ORZA 3VV1A 1DYOA 1OHFA 2QNKA 4FP3A 1MQTA 3SEEA 2JDUA 2XHNA 4PDWA 4XFFA 1W6OB 4BQ2A 3O1MA 1O8PA 4ONUA 2JIGA 5A7WA 2GN7A 4P5HA 4V2WA 5LBEA 4FI9A 5A3UA 1PVXA 1RUE3 4JQTA 3E6BA 1HQWA 3SC7X 2R072 1QJY3 1YFWA 2E9QA 2ZGRA 2ZX4A 1NXD1 1RTVA 3PLQA 1J3PA 1DP0A 2XLFA 2ZHNA 4XDOA 4XQWA 4ES9A 2FZ2A 1ZBA3 5LY1A 5F39A 3O1VA 3WQ0A 3VBFB 1PIV1 4RHV1 2D6NA 2DWRA 1JZ2A 4HVOA 1DGWX 1JS9A 5G04L 1ZRCA 4HK8A 1POV1 2HWD3 3M3IA 2HH9A 4AI8A 4UFHA 1OFSA 4GB31 2Z5WA 3USSA 3WP5A 3ZKUA 1G86A 2BOJA 5C3SA 4OUSA 1GV9A 1AXYA 4EN6B 3VUOA 3I2OA 1J84A 4I30A 5EZWA 1W6PA 3J7HA 5LATA 4N43C 5T52A 1ZRIA 3IM0A 1D0GA 1UCXA 2C4XA 3VDCA 3OBRA 1HJFA 3J8F2 1PGW1 3GJAA 3LGRA 3R4UA 4IESA 2PLV2 2ET1A 1H2LA 1OQ1A 3ZFFA 1F9KA 2JDPA 3BOWA 5FYTA 4WBBA 2QQMA 3IIAA 3U07A 4BQ4A 4NPLA 5J3UA 3F95A 1CZSA 5CG8A 4E8CA 1OLRA 1W9SA 1YIFA 3EO6A 2DVDA 4YVSA 1OA4A 2ZJCA 3U4XA 4FBFA 4XBNA 5FV3A 1O7FA 3H0OA 1RVF1 3G6JB 3ROUA 1VPHA 2E7QA 1BMV2 3SCGA 2JG8B 1TVGA 3VZOA 2JDHA 2XXZA 5CU1A 1UPSA 1X9TA 2B9VA 2AYHA 5DAWA 2GMPA 1QDCA 5FYSA 1DBNA 3JBG3 5KC6A 2WJSA 4Z07A 3CIHA 4ZU7A 2WAAA 1GWMA 3DL3A 2RS12 5A33B 1Q8QA 3A0NA 3ZKYA 3ZOIA 1R1A1 3DPRA 4PLNA 5F2WA 5JSPA 1W8HA 2W1WA 1DU3D 3AP7A 4RA0A 5GZFA 1AR82 5LRSA 1B35C 4UAPA 2OYZA 4HN1A 3I3DA 3TRSB 4COZA 4SLIA 5F37A 5JZGC 2WINB 2AEYA 5FREA 1VBA1 4BYYA 4BOWA 5I93A 1QEXA 3AZZA 4HONA 4UF0B 3AP6A 2MEV1 2R7EB 3N4MA 4QKBA 3TNPB 2GP5A 3UKTA 5F7UA 3K46A 3FBYA 4Q4Y2 2RM23 1TME3 1SLCA 2WZ8A 1VBB2 3AKRA 2NYYA 3AZYA 2CGPA 3WQBA 1TMF3 3O0XA 1QQP3 5AVPA 1O8SA 2IVJA 1H9PA 2Y26A 4Q29A 4C0BA 4NPMA 1BHGA 1UPIA 2RS32 3J26N 5DPNA 1M06G 4AHZA 2G9GA 1UY3A 3I59B 1STMA 3WG1A 3JU9A 5A3OA 1PX4A 3OSDA 5KWRA 1UD1A 4F8AA 1A78A 5C8CA 1KD7A 3VKNA 5GLZA 3AKPA 3AL5A 4LO7A 1SPPB 2XH6A 2YFUA 3VD4A 3T2QA 3DEMA 5L73A 1FT9A 4EWDA 3VBSA 4CXXA 1AR93 4FFFA 5FY7A 1B35B 3NJXA 4MSVA 1AZDA 5C3PA 4LT5A 5JZGB 3ZN4A 2IXCA 4QM8A 4CA9A 1C57A 1U12A 5CADA 2D43A 1VBD1 3C7HA 1AR62 1R081 3A23A 3WCRA 2BRTA 1UN1A 2VVDA 5CIRA 3SMHA 3ZXGA 2HKXA 4HPKB 1N3OA 5JVVA 1Q3EA 2VULA 2XUEA 2LROA 3AXDA 1C8M1 1IQDC 2E51A 1ENXA 3LB9A 2OIIA 1HQNA 2IXLA 4DOUA 5DN2A 5FYBA 2RHPA 1C5HA 1HXS3 1COV2 2W2IA 1VE0A 3ZX7A 5BV6A 1EYBA 3CJIC 4NR1A 4YZ3A 1ZBE3 4K20A 4JGYA 1QWRA 2RS53 4RQPC 3FFQA 5H9PA 3BI3A 2ZBJA 1H8TC 4NRQA 4GJYA 2JWPA 4N53C 2GMMA 2VW1A 2WS93 3IB3A 1VBC1 4RFT0 5BYNA 4MGYE 4AHWA 4AAXA 5A3LA 2ZGKA 3OD0A 2D6KA 3DKQA 1A6CA 2GC1A 3POYA 4F83A 2H6BA 1O5UA 3AYCA 1HRI2 1MEC1 3AMQA 5FLIA 2WQZC 4QPIC 4Z2WA 4CEWA 1QNWA 1SCSA 4XBQA 4AI2A 3BTYA 5FCCA 3UKVA 2WRAA 3OUJA 4YVWB 4QHOA 4XABA 5LBCA 2AH2A 1MQTC 2BGCA 4OQ9A 4PDWC 1G9BA 1GZWA 3MW4A 5FJHA 3SCFA 2WUHA 5FZ3A 3WNXA 5BNOA 3TEYA 4R9BA 4MOAA 2WO7A 3HNBM 2WFPA 3NVCA 4IXLA 3ELNA 3NV2A 1JW6A 4NHXA 2YUEA 2C1FA 3PTYA 3WQ7A 2EIEA 2RDSA 5DDJ3 4WVMA 5FZEA 1X9PA 1NCQA 2QQIA 2Z79A 4MLOA 3AMPA 4N53B 2K9ZA 5FUNA 3RMXA 2A73B 3N9NA 2XUMA 2ZEXA 3BYWA 1J58A 1NKGA 2UY9A 4Q4X3 2VCAA 1OOPA 5D1IA 5SV5A 2HYXA 3SKVA 1RINA 4CCJA 4RFRB 5K4LA 2EAAA 1W8OA 3D82A 3TEWA 4CP9A 4BQ5A 1SCRA 1Y9GA 4BA6A 4FVVA 1V0AA 2R071 1T6BX 4QPIB 4CUGA 2RJ2A 5DG1A 4TZDA 1OQEA 4I09A 3WX5A 5KC5A 2WZR1 2VMCA 4GWNA 5LK5A 4OCTA 1PVC3 3KWVA 3AB0A 4KWUA 2ENRA 2MHFA 1MQTB 3MF6A 2BNNA 4FOVA 4PDWB 2ZKLA 1KITA 3QH7A 5IVJA 2V72A 3AYAA 4FAGA 1QJU2 3AVSA 3VDDA 3ZFFC 2H6CA 2ADEA 2W9XA 1WW4A 1CAVA 5EYXA 1JI6A 2FHRA 1O91A 3IDAA 1GQPA 3OCPA 4D94A 4QQ2A 4YGCA 3ON7A 5BNOC 3H50A 4B3NA 2PXJA 4R9DA 4BM8A 1UMIA 2GC2A 1WCKA 2XDVA 2X5IC 3K4ZA 1WWYA 2D93A 1YO8A 4P9JA 3RJRA 1UOJA 1W8FA 2D5FA 2VBBA 3J8F1 4CCLA 1MZEA 2PLV1 3WY6A 3SNMA 4MXWA 5IVBA 1RUI3 1YI7A 1WBLA 2WFF2 3LIGA 3HR9A 1HRV2 2OZJA 2ZACA 3GGLA 4XIKA 4Y1XA 5GZGA 2IZWA 3ORJA 3H7YA 3WUCA 3OF1A 2VZQA 4CTEA 1NX9A 1WKYA 2ZGNA 3MI8A 5K9YA 1NLRA 1RMU3 1XJAA 1W6PB 5GLVA 1MZ5A 5EQUA 3OPWA 1DGRN 1GMMA 1S1AA 1JYIA 2VZ3A 3DPRC 3ZFGA 4YG3A 4C91A 3RSJA 3IDBB 1PO12 3M3CA 3ZFFB 3ABZA 4IETA 3K4AA 3MBWA 4AEJA 4BQWA 2VQUA 5JXJA 5FJKA 1N1VA 1OVPA 5C9AA 2QBXA 1IS3A 4L99A 2A6VA 4META 3BKZA 4MGZE 4NUBA 4XZUG 1GWLA 4LBQA 3UYJA 5KXDA 1A8MA 4K40A 3H3UA 1AX1A 2ZTNA 1QH7A 1W8ZA 2ZCWA 3N7LA 4Q0SA 1LESA 3KD4A 4WM8A 4YVSB 3ZN6A 4QPWA 4O61A 2RS11 3CEWA 3WW3A 2CWMA 3WLUA 2LTNA 3EYPA 1GWKA 1LHUA 5FRAA 2E63A 3B00A 5J36A 4FP2A 1YEWA 1LHVA 1AR81 2ZAHA 2JG9A 4AGVA 4IV3C 3WDYA 4EN8B 3L9JT 4IERA 1LEMA 2HWF2 3JZVA 1RB8G 3AK0A 5C71A 1TNRA 3LPGA 3SH5A 1QXRA 2O1QA 1JBCA 4MUVA 4ARYA 4CDUA 5C8CC 1L7LA 2XLGA 4Y4YA 4Q4Y1 3NRUA 5ACA1 1PZ9A 5DMYA 1VBB1 1RUF2 1FV2A 2ZGPA 3DPRB 1YJLA 3HVDA 4ZONA 5KHHA 2KA3A 1C4RA 2YU1A 4QDSA 2RS31 4KNCA 2YROA 4LXLA 5FZGA 2JICA 1W6MA 1UW8A 4MO3M 2PN5A 5HCBA 1BVP1 1W6QA 2VUJA 4U36A 2RE9A 3ES4A 4KWJA 3BTAA 3W59A 4CU9A 5CFCA 4CU6A 4XILA 4CRQA 1PM4A 2BNMA 2WL1A 4YW4A 1YQCA 4GMP3 5C5TA 1LEDA 4D3WA 3PUQA 1GNHA 3C7FA 1BBT3 1X8MA 4K1YA 1NOVA 1WMEA 1ZM1A 3I3QA 2WLPA 4HVQA 1F35A 3FE5A 2VQAA 3BPSA 4YW3A 3CO2A 3ENRA 3ATGA 4LHSA 2PQSA 4FFIA 5IUQA 4IV3B 5KHIA 2Q8CA 4HFSA 1AUYA 3C7OA 3V0BB 1QY4A 3ACFA 1RUJ2 1JTZX 4GIQA 1AR61 1CAWA 3BVCA 2QZ2A 3POJA 1ODMA 3ZSEA 5C8CB 4LNVA 3EBRA 3NL1A 3I8TA 4HKOA 4DUVA 4Y4RA 1CZTA 3FL7A 2BV4A 1OF3A 1GICA 2A71A 2W92A 4IV1C 1W8UA 1Q8OA 4XXPA 3VBSB 4AYUA 1BYHA 2VXJA 4IE0A 2WKKA 5FXWA 3Q8FA 3HN3A 2WA4A 1COV1
chains in the Genus database with same CATH topology
2XVKA 5T3NA 4AGGA 1Q43A 4FPGA 1XNCA 3AJYA 3ASIA 3QH6A 4JDOA 2Z42A 4YZ1A 4L2NA 2DV9A 5GKAC 4UW6A 5FBZA 4FPKA 4HVRA 2A6YA 3URFA 1AX2A 2XBO2 4B4PA 3HBZA 3TN92 3FLPA 5DUUA 4XDQA 3LA3A 3LSDA 4JC1A 4L9BA 1HRI1 4W65A 1B09A 3ILFA 4JGYB 1YCIA 1G9DA 1AL0G 3TB0A 2P3JA 3ZXLA 4YM2A 1CR7A 4IV1B 1LB2A 2BPA2 1S0BA 2KM2A 3C3VA 1H0BA 5I0RA 4CEYA 3MICA 1OOPC 5JDBA 3WQ1A 3S6PA 1Z7S3 2VY0A 2XWJB 3WHUA 4J6GA 1DGWA 4X6RB 1X82A 2PHFA 4YW1A 2EIGA 1Q8PA 4CEWB 5A3MA 3JD72 1NG0A 4LR4A 1NQDA 3ZXEA 1U5IA 1OD5A 1RHI2 3FC0A 1PO22 1KJLA 1QU0A 1ONAA 1ND2C 1GZWB 3ECQA 2A3XA 4FSJA 3VBRA 4CP1A 1CIWA 1PNGA 2DTYA 1LOCA 4LA2A 1RUOA 2WNVA 4AVCA 2BVVA 4YG0A 5CFDA 1GQGA 2Y0OA 4WVMB 1NCQB 1QXJA 3MIDA 1UU4A 3NWKA 5FLHA 1OOPB 4TSVA 3P3NA 5AFEA 3VBOC 1I1EA 1QJU1 1QOOA 4HN0A 4XJ9A 4BIOA 1VIWB 4OZXA 1EP0A 3B94A 3JB4C 3X29B 5FPXA 1VBE2 1UU6A 2EA7A 1PNFA 3MF9A 2XWBB 2D40A 1JUHA 1VRH2 3O12A 2G9FA 1AYN2 4FXGB 1N1SA 2P17A 4IEWA 3ZFGC 1NY72 2PAEA 4Q4W2 2Q0AA 2ZMNA 2UURA 3ZSLA 3VDDB 2WFF1 4HKWA 1LOAA 1HRV1 2ZHMA 2Q4SA 5BNNA 1PMIA 2ETEA 4QGMA 5HCAA 1VAKA 3RDIA 4WM8C 3KB5A 1RUD3 2G4IA 1XU1A 2HJIA 3VZLA 3WD5A 1WLWA 2WZPP 2X53S 1PO11 3ZPYA 2Y0IA 4MXWB 1S55A 2PHWA 2DVAA 2ZGTA 2GC3A 3AZVA 3OPZA 4XOGA 3CJXA 4B4RA 3IPVA 1R1ZA 2UWCA 3NKTA 2D98A 1SLIA 1DQ4A 4I02A 4AFAA 3NV4A 2ZGUA 1FPN2 3OGJA 4HETA 3ZYRA 1AL23 1YWKA 3ZFGB 1BZWA 4CZSA 4HL0A 3BOPA 3OY8B 4FQ4A 1FMD2 2R1BA 1LOFC 5JLVA 2HWF1 3H1YA 5C9AB 4N9HA 1RC6A 4LBQB 5CFCC 4LO5B 2GH8A 2GNDA 1BJQA 4WM8B 3RJ2X 4XFGA 1AXZA 4M3CF 1OPOA 4RS5A 1BEV1 3ZN6B 4B29A 4XYXA 1RUF1 1RJ7A 1PK6A 3OD4A 4AFBA 4DB5A 1D4M2 2JG9B 5CB7A 5J48A 4MV2A 1NE6A 3KGZA 2P34A 2VECA 2PHRA 4CDUB 4B4QA 4LBLA 4GXLA 1KRIA 3SLIA 3UJOA 3NSTA 4IEXA 1ZA4A 1DQ5A 5E88A 3WW4A 4AQ6A 5LEJA 4FXKB 4ZXKA 1W6MB 4XF9A 1RUJ1 1Y43B 4BZ4A 5CFCB 3VBUA 1WBFA 2R062 3W58A 3ZYGA 2F4PA 3NO8A 3SHRA 3SISA 2BWAA 4B7KA 3VBHC 3E97A 4GULA 1NCRA 3JQXA 2FBEA 4QHBA 3H8UA 1GQHA 2H0BA 2HWC2 2D5HA 2TBVA 5EV7A 3WG3A 3ZXAC 3GF6A 1XQNA 2DF7A 3PNAA 1XYPA 1KXGA 1IQAA 5F5QA 4AQ2A 3JB8A 1CAWB 5K0UA 3ZXDA 1AR72 2D44A 2DUOA 1RUG2 1V9U3 2XBO1 4E2QA 4OHZA 3TN91 1IHMA 2P3KA 2ZZQA 3RS6A 1MEC2 2JEMA 2QJVA 2BWCA 3FJSA 3MIGA 2HEVF 5T55A 2HEYF 3IDCB 4S2GA 3VBFC 3MGUA 5I0UA 1GBGA 2ZABA 1VB2A 2CGOA 3C2UA 2IXHA 4Y1YA 2HWB2 3V64A 1ZREA 2O8QA 5FDBA 3VBRC 5FOJB 4LHLA 1XE7A 2WT0A 2XJQA 2EXKA 2SBAA 1VP6A 1ZZ7A 2ZGLA 4GH4A 1LGNA 4OULA 5L7OA 1U5ZA 3UK9A 3JD71 1JH5A 1VJ2A 2GMEA 1SLTA 3I54A 1IGOA 5CFDC 1TNFA 2IFWA 1RHI1 1TE1B 3KT1A 3IDEA 5HXVA 3IWZA 3BIWE 1PO21 4JTNA 2ZX3A 3AP4A 2EXHA 2ERFA 4BMBA 4WZCA 3PVNA 2WZR2 1N1TA 5JIUA 5BPXA 2PHXA 4C90A 2B46X 2DU1A 4K6BA 1LENA 2XJTA 4KBBA 4P9LA 4P9YA 4E2SA 1DHKB 1YFXA 2BFUS 4UBHA 2YZ4A 4XFBA 2JG8C 4ZU4A 2VMGA 3M3OA 1MZFA 3AM2A 3VBRB 3WOGA 3INAA 4XPVA 4BMEA 1QOTA 2WLQA 4X8PA 4FOQA 1VBE1 5BNNC 2WNVB 1R092 2AGSA 5CFDB 4LE3A 4LBMA 1MR5A 5AC92 3H3ZA 4MX3A 1VRH1 5KBFA 2FQPA 4FT8A 1EAH2 1AYN1 4JRLA 1YLLA 1ASJ2 1NY71 4Q4W1 3LA7A 1ZZ6A 2QZ3A 2GDFA 4KGGA 4NVPA 1S2BA 4OFGA 4TWTA 1I3HA 1DLLA 5EFUA 2CTVA 4IEUA 2QQPA 2W68A 4Q1RA 3M8LA 3LA2A 4XJZA 5C33A 2VNOA 2VVFA 3GZTB 1DZRA 4RD7A 1RL3A 1PIV3 1UF2C 4RHV3 1HV1A 1SFYA 1EV12 2DCJA 4JTOA 1GANA 4MH0E 3ZVXA 2ZGMA 3N7JA 4M3CA 4XF0A 1POV3 5BNNB 5KXCA 4R4ZA 3MIFA 1REDA 5BNPA 3U11A 4GB33 4NPRA 1SBEA 1I6XA 2ZMKA 1FPN1 3GYDA 2MNGA 4PQ9A 4QU2A 1QJZA 2VH9A 5HCFA 4AHXA 1QOSA 1PK6C 2BVBA 3A0KA 4Y24A 1AYM2 1YUDA 4Z82A 1F31A 1CX4A 1FMD1 4E4DX 4NHLA 2DU0A 3TAYA 2FZ1A 4BPZA 4Q0QA 5I8YA 1OA2A 3IPVB 2UYBA 2VW2A 1QNYA 3ZFEA 5ACA2 5JR7B 3ME2A 4AVAA 4YGBA 3W9AA 2GC0A 5FTTC 1RUC2 2GZWA 4OHWA 2XVLA 4MYEA 3ZIWA 1OQDA 1D4M1 1OPMA 4Q4V2 5H9SA 4AFDA 2WQ4A 1FNYA 1PGL2 3B9CA 1RVF3 5E8AA 4C1WA 3MLLA 3T1LA 3S7EA 2A3YA 3VBUC 3ZSJA 4INDA 3RMYA 3ZMNA 1Z0HA 4XTPA 2DVGA 5DZFA 4RS5B 1NCRC 4EV0A 1PK6B 4R52A 1V00A 3BALA 4X8NA 3ZO0B 4ATEA 4OHXA 4XF1A 1R1A3 4MVTA 1DZTA 2DCZA 2ZHKA 2GSYA 1OSGA 2R061 4L92A 5FMOS 3MDPA 2Z2SB 1OLQA 2AENA 4YVWC 4AI1A 1VBA3 2YXSA 5K0UC 2PFWA 4RR3A 3M3EA 2YGMA 1IPJA 2MEV3 1D2QA 2W52A 2HWC1 4MZUA 4IEVA 3VHNA 4P9WA 3FHIB 4R9AA 3R4DB 5AVAA 1MS0A 1LJ7A 3UJQA 5JOXA 4ISQA 4URTA 1LOBA 4ATFA 3VBUB 4EWAA 2QUOA 3WW1A 3N3HA 1AR71 4Q8LA 2PHTA 1NCRB 1RUG1 1V6OA 2TUNA 5JAXA 1UIKA 1GNZA 2A6ZA 1JN2P 2R6QA 4XW3A 4OHYA 1AXKA 1O4TA 4LBQD 2B5HA 5D8AC 2R1DA 1IOAA 1HW5A 4MGIE 2MPFA 1O3RA 4GH4C 4D7TA 2E6VA 5K0UB 1LHWA 4EROA 4TYSA 1CPMA 1VBD3 3CL1A 1N3QA 1R083 1WA4A 4XFHA 5BY5A 4UW5A 4FQZA 5KHJA 1LOEA 2XJVA 3B69A 2BUKA 3T1MA 2HWB1 3QD6A 1C8M3 3MW2A 3EQEA 3NAPA 2CWSA 4Q0VA 3H9AA 4U2AA 2JD4A 4EJRA 2QFEA 2YMZA 3K48A 1CN1A 1GLHA 4AGRA 3R05A 2A5ZA 3ILNA 2HWE2 4JVAA 4Y22A 1NE4A 3BCWA 5D8AB 5K7PA 1FOD1 1J59A 5CBLA 3HT1A 2ZAAA 1REFA 1VBC3 1KS5A 4G9SB 4GH4B 4K1ZA 4COUA 4XF4A 1GR3A 2NMNA 5L7OB 2EALA 2QDRA 1MS8A 3RQ0A 5KHGA 1MEC3 3IN9A 4DFSA 3M4FA 3E5XA 2Y38A 3OTFA 3I7DA 4FOWA 4JQRA 4TLFA 1XYNA 3M7AA 4PF5A 1I5ZA 5H9QA 1ZYBA 5E1RA 3OBTA 4YVSC 1R091 3DKWA 4ITCA 3VL9A 3V56A 4FTEA 5AC91 1SLLA 1QDOA 3VZJA 1G9CA 1CGPA 1EAH1 4QGNA 3VKLA 3WINE 1G9AA 3WVJA 1ASJ1 3RNSA 3AP5A 4AEDA 4YRDA 4K7JA 4UXAA 1WMDA 1EPZA 3FUQA 2PELA 5BNPC 1C5IA 4OVEA 2TNFA 2R073 2RR12 2ARBA 1LGBA 1F5JA 2WZR3 3QCWA 1CAUA 3NKGA 1VLNA 2JXAA 1WD3A 1WW7A 1EV11 4FPOB 3CF6E 4KWKA 3V0AA 1LRHA 5DUVA 2D6OX 1ULFA 4OHVA 1ZZ9A 3WDUA 1N47A 3WT3A 1G6NA 4BQ1A 4JDMA 4BHPA 2R042 4O9EA 3D0JA 1DGLA 2LUWA 3E5QA 4PBOA 4PLMA 5I0SA 4ZKTB 3MFCA 2AR6A 4XBLA 2VOWA 1AYM1 4XE9A 2ZKNA 1WUVA 4XIOA 1BCXA 3J8F3 4M3CB 5H9RA 2PLV3 4AWDA 1NA1A 1QH6A 1HIXA 2XG3A 1BEV2 4YGDA 5BNPB 5CNAA 3WV6A 3UKNA 3VN4A 1V6JA 2JJ6A 3VBSC 1RUC1 2Q1MA 2RMU2 2UU8A 4QQHA 4R8HA 1OFNA 4Y20A 3HT2A 4OI2A 3AXEA 4Q4V1 4NO4A 3KT4A 1PGL1 3GALA 2O8OA 1H4HA 1NLSA 1F2NA 2AUYA 4AE2A 1CJDA 4PLOA 3ZYIB 4GMP0 3QLQA 1MZ6A 4YM0A 3PJYA 4DNYA 1WW6A 4RR3C 4XHBA 4LTAA 2DUQA 4M00A 3GNEA 1S0CA 3KSCA 2AZ5A 2E53A 4PCRA 2RS13 1NQJA 1DYKA 4ORFA 4JGYC 4D7YA 3N7KA 3DF0A 1XYOA 1AR83 3ZYPA 1BVVA 1NYWA 2ZX2A 1C8NA 4X6QB 3AX4A 2BEOA 2A6WA 3ZSKA 4Q4Y3 3ZSMA 3G7DA 5ACA3 1SFNA 1VBB3 5I0TA 4FPJA 5E16A 3VKMA 5DUWA 4CEWC 4P9IA 2RS33 3PVBB 4GWMA 1Y3TA 4RR3B 5JCTA 1J3QA 4HSLA 2W39A 1CPNA 3ES1A 1ND3A 1AHSA 2QKDA 3BU7A 3ETQA 4HSJA 1BK1A 1LOGA 5LRRA 5BNOC 5F9TA 2ATFA 4JCKA 4M0NA 4RL7A 5T5LA 4CDXA 5ABJA 1RUE2 4Q8KA 1NCQC 3WG2A 1J1TA 2XVGA 1QJY2 4GKYA 2VPVA 4KH9A 3O0VA 1AR63 4IEPA 4R4XA 2EVXA 2XJUA 2QCSB 3MEPA 1ZBA2 4N90A 3KCCA 4YM1A 3WHTA 1OI6A 4P9GA 5CAZA 3H1MA 2HWD2 2XJRA 4OLLA 2A70A 4K8FA 2LM3A 1COV3 1PZ8A 2OVUA 1PHMA 2P3IA 1L3JA 5T5JA 5JI7A 2XJSA 2WSUA 3U0ZA 5J09A 1K5MA 1H2MA 5JIAA 2HWE1 4C0HA 4DINB 4FPFA 5BNOB 3VDDC 2YC0A 4Z92B 4WZFA 4AHYA 1LODA 3NAPB 4WM7A 4QMAA 3WXPA 1V6IA 2VUAA 3LKJA 3ZIXA 1C3HA 3VKFC 2QE3A 1AX0A 1S0IA 3RPQA 1YIPA 4ASMB 2V5YA 3HN1A 2NZ9A 1HRI3 2WT1A 2BW8A 3D5OA 2LALA 1NZCA 1VB4A 1S0GA 4COVA 5JOZA 2SLIA 3WP3A 4SBVA 3SH3A 4ES8A 1Y9QA 5JSRA 5FQ0A 1D4VB 2YV8A 1W39A 5L36A 3JBG2 3M2MA 4AVSA 4AEMA 4LUMA 1MACA 2EF6A 1CQ9A 1CAVB 1H9WA 1MVQA 1HV0A 1X36A 5C9AC 3GBGA 4XFCA 2YGLA 3AKTA 4DY5A 3LAGA 3LZZA 5EYYA 4YW5A 4EN7B 2CYFA 2X8KA 1S0EA 2I45A 2DFBA 1DQ2A 4QGLA 2RR11 3BPZA 3GHMA 2ES3A 2A75A 4GKXA 2RM22 1BQPA 1TME2 4QM9A 4CDQA 2JG9C 4JDNA 1IS4A 1ZRDA 1TMF2 1QQP2 1HLCA 1IKPA 3MW3A 4B7EA 4AEDB 4JV4A 2ZX0A 4M0HA 4N43A 5EXOA 1QJU3 3VL8A 4CDUC 3AMMA 2PHDA 2IWGB 1NA1C 3AKSA 3WUDA 1ZNPA 1FNZA 1C1LA 1WCSA 2R041 5BXXA 1CAUB 1DG6A 1YYNA 4AFMA 1MS1A 1AR92 4H55A 4Y1ZA 4LO6B 4M01A 3V0AB 4FPHA 2CAVA 4B8EA 2P37A 3RYRA 2WFF3 4K3UA 3POWA 4LLFA 4W6YA 1C28A 1HRV3 4Q0UA 1ENRA 4Z8BA 2RMU1 3MPBA 4L8QA 3AZXA 3OYWA 2BBVA 3JUUA 4WVVA 4XETA 4N7IA 4FPLA 2WT2A 3B7MA 3E5UA 2D6PA 4O9GA 1HXS2 1PGSA 3J9SA 1PO13 1NA1B 3MLKA 3ALQA 2O0OA 3PJQA 1SDWA 3SXWA 1YRZA 1ZBE2 5I91A 5GJ6A 2GAUA 1W6NA 4Y20B 4BLIA 3D6EA 4AK3A 2GH2A 2DURA 3ACLA 1VR3A 2WS92 1W6QB 2WA3A 3H1WA 4QPYA 4XQ4A 1LGCA 3M70A 2K0GA 4LO8A 4Z1VA 1H8VA 4QX5A 5L19A 5DZEA 1D0HA 2CNAA 3O0WA 3KZ4C 2HWF3 4AEKA 5C4WA 2XJPA 1QJX1 1ENQA 2ARXA 4YSFA 4LBNA 1BEV3 1RUF3 2BNOA 3S0MA 3RI8A 1DQ1A 3AFGA 1O3QA 1RUH1 1XE8A 1CJPA 3WP6A 4CDXC 3AFKA 1FV3A 5DG2A 3S30A 4IEQA 1LU2A 1OMIA 5DDJ2 1J1LA 1ULDA 2DYCA 4CEYC 5FO8B 5GLWA 4KG0A 4QD2A 4XMAA 4AFCA 4K9SA 1U0AA 4Q4X2 4LO4B 4KU8A 1WLTA 3TWIA 5GLUA 4XZPA 4Y5Z0 1RUE1 3AMHA 3PVEA 2A6XA 3PVOA 4G3YC 1QJY1 1RUJ3 2Q30A 4GA9A 4KU7A 1AF9A 3WR0A 1ZBA1 1PVC2 1GYKA 4FPCA 3CJIA 1SLAA 4F3JA 2D97A 4WV8A 2R32A 2DCTA 5B2GB 4RQPA 2HWD1 4WM7C 1H8TA 2WNVC 2B7YA 4S2DA 4CDXB 1YHFA 3RWNA 5ABJB 4HLTA 1REEA 1FAYA 4DRVA 5KXEA 1AJOA 4UW4A 3DN7A 2P2KA 1UKGA 1ZVFA 4CEYB 5IK7A 4N9IA 1FOD2 1ULGA 3AZWA 5CVRA 5GM0A 4A7KA 2XGXA 4CDWA 4QPIA 1IS6A 3MIBA 1RITA 2XBO3 4HKLA 3TN93 1LR5A 1RUI2 2JECA 4HANA 5A32A 1F5FA 3KT7A 2R30A 3KS7A 1HDKA 2OPKA 2V73A 3WW2A 1D2SA 2JX9A 4Y1UA 1K5MB 2PHLA 5TSWA 1RMU2 3E6DA 4PIYA 1SBFA 2E7AA 3IT8A 1V6KA 2NMOA 2GALA 4G4FA 1LULA 2HYKA 4WM7B 3GBWA 1RGSA 2IFRA 4Q27A 4RGGA 1MS9A 4AVBA 2PYTA 2ZHLA 4YARA 3KCXA 1H1AA 1XXNA 4BIFA 2JE9A 3JBG1 3A4UA 4AVTA 2VOXA 1UZZA 1E57A 3JD73 2OUHA 4CDQC 2DVBA 2CAUA 4MGKE 3SCHA 4I2OA 1VAMA 1U5YA 1QKQA 1CVNA 1RHI3 1S0JA 4Q0PA 1AVBA 1PO23 3H7JA 3VHPA 5FQ0B 2CGNA 2Q8OA 2FMDA 3L2YA 1GZ9A 3NV3A 2OW4A 1NXMA 5J98B 4E2GA 1X33A 4AI3A 5BNQA 3D0SA 2EXIA 4AW7A 2B45X 1TME1 2RM21 3RRDA 3ZDSA 3RZZA 4LLOA 4BE3A 2GNMA 4P14A 3BODA 4BWOA 4DXZA 4QQPA 2R16A 4GQ7A 4XJ8A 5J37A 1POV0 1TMF1 1QQP1 4YG6A 4H7MA 1AJKA 1O4YA 4A3XA 2X5IA 2PAKA 3PMEA 3FUOA 2ZGOA 1H4GA 4RS5C 3IMNA 3Q9OA 3B02A 4EN9B 3GZAA 1VBE3 4QPGA 5F1RA 4E27A 4CDQB 3SH4A 1BBT2 4FCAA 1AR91 1H2NA 1KQRA 1VRH3 2NLRA 1AYN3 2VNGA 3LCPA 4N43B 4Q4W3 2NP0A 2B8MA 4OI0A 4CP0A 2ZS6B 4E4ZA 1O5LA 2XL9A 1YI9A 3LOIA 1DGRA 2D3PA 4NHMA 2HEWF 3VHRA 1LKNA 3MIEA 1DF0A 3K51A 4F7ZA 5I8TA 1GKBA 2XB6C 1HXS1 4LULA 3WP4A 4ASLA 1FI2A 3ZXJA 1RJ8A 1ZBE1 3N36A 2RS51 3EJKA 4FO9A 4HZFA 3ZMOA 2QVSB 5C4WC 3MIHA 4W6XA 3OYWB 4IV3A 3R6SA 3V0BA 4XQDA 1CD3G 1FPN3 2WS91 4WVWA 1O3SA 1LHNA 4AG4A 4XJWA 4FPYA 1H1IA 2D3RA 4YW2A 1ZZBA 2WWSA 4OI1A 2BFUL 1FMD3 4AI0A 3S7IA 4NWWA 4WVZA 1OKQA 2A3WA 4LUKA 1Q5OA 1W6NB 1CESA 2YPJA 3FX3A 4LHNA 3KQRA 1G9FA 3HQXA 1UL9A 3KLSA 3I4IA 1D4M3 3O14A 1Z7S2 2OZ6A 4YZ2A 4KWLA 1UZYA 1V6MA 2JE7A 2I2SA 5C4WB 2GNBA 5DDJ1 4OUMA 2ZGSA 3THPA 4FAHA 2VGDA 1ZZ8A 3D4KA 4Q4X1 1HQLA 3O5SA 2B42B 3TBDA 1G8WA 3VHOA 1WMFA 2UYAA 4QQLA 5L7OC 1DZQA 2VMHA 4IV1A 4BCUA 1UAIA 1IPKA 3PHMA 2R063 4YNIA 2VVEA 2D6MA 1APNA 1PVC1 2KXLA 4FTBA 5FO9B 1GZCA 1UMZA 1DYPA 1ZRRA 2DFCA 3USUA 3R4SA 3T2TA 4CDWC 5FOBB 2HWC3 1VALA 3MZHA 4A7YA 2IXIA 1JYCA 2Q5TA 4JRAA 4QT6A 3UV9A 4I0WB 5IK5