3VBUA

Crystal structure of empty human enterovirus 71 particle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
225
structure length
218
Chain Sequence
HSTAETTLDSFFSRAGLVGEIDLPLKGTTNPNGYANWDIDITGYAQMRRKVELFTYMRFDAEFTFVACTPTGEVVPQLLQYMFVPPGAPKPDSRESLAWQTATNPSVFVKLSDPPAQVSVPFMSPASAYQWFYDGYPTKDLEYGAMPNNMMGTFSVRTVGTSKSKYPLVVRIYMRMKHVRAWIPRPMRNQNYLFKANPNYAGNSIKPTGASRTAITTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Genome Polyprotein, capsid protein VP1
publication title A sensor-adaptor mechanism for enterovirus uncoating from structures of EV71.
pubmed doi rcsb
total genus 34
structure length 218
sequence length 225
ec nomenclature
pdb deposition date 2012-01-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vbuA00
2FZ1A 3VBHA 4JGYB 1VBA3 1D4M1 4Q4Y3 1BEV3 4JGZA 1QJX2 1OOPB 1TMF3 5LK7B 3M8LA 5CFCC 1AR83 1WCDJ 1QJX1 4RFT0 1QJU3 1PIV3 5BNPA 4QPIC 1VBB3 5K0UB 1QJZA 4RHV2 2FZ2A 3VBUB 5BNNA 3NAPB 1HX6A 1QJY3 1VBC2 2WS93 1ASJ2 3JD71 4WM8A 4FTBA 1FPN1 1VRH2 4Q4X2 1VBC1 1RUD2 2GH8A 1RHI3 4QPGB 5ACA3 1ASJ1 3NAPA 1VRH1 2DF7A 1RUI2 4GB33 4Q4X1 1PO13 1POV3 1RUD1 1RUH3 2ZTNA 2MEV1 1E57A 4EJRA 5C9AC 1HQNA 2RMU2 1RUI1 1NY72 4CEWA 4BCUA 4GH4C 4AEDC 3ZFGA 1NCRA 1VBA2 4Q4V1 1H8TC 2RMU1 1Z7S3 4N43A 4Q4Y2 1MQTB 1VBD3 1ND2C 2RS53 3S6PA 1VBA1 1VB4A 4IV3C 4RS5A 3ZFFB 1TMF2 4Q4Y1 4YVSC 1BEV1 1AR82 2WFF3 4CDWA 1NCQB 1ND3B 5ABJC 1QJU2 1NOVA 1TMF1 1M06G 1PGW1 4CDQC 1AR81 2GSYA 1NA1A 4NWVA 5GKAC 1VBB2 1V9U3 1R092 3VBFA 1PIV1 1MEC3 2BPA2 4Y5Z0 1VBB1 4N53A 5J96B 1QJY2 1RUC3 1HXS3 1QJY1 4IV1B 1AYM1 2WS91 5ACA2 1AR63 1PVC3 3VBRA 1QQP3 4RR3B 1BMV2 1RHI1 5D8AA 2ZAHA 2X5IC 4GB31 1PO11 1POV1 4JGYC 1POV0 2HWF3 1RUH1 3TN93 4CEYB 3VDDB 4NWWA 1Z7S2 1ZBA2 2RS52 1OOPC 2R043 1Z7S1 4YVWB 1VBD1 1B35C 2RS51 2WFF2 3VDDA 2R073 5FMOL 3VBHB 1SMVA 1VB2A 1AL0G 1HRI3 2WFF1 4IV3A 5K0UC 5BNOA 5J98B 1V9U2 1MEC2 3HAGA 2XPJA 1RUC2 1AR73 1V9U1 1MEC1 5C4WC 1HXS2 2HWB3 5BNPB 1RUC1 3J8F3 1VAKA 1AR62 1PVC2 2WZR3 1HXS1 1VBE3 5BNNB 1QQP2 4CDXA 2HWD3 3CJIA 1AYN3 1AR61 3ZFEC 1PVC1 5C8CB 1QQP1 2HWF2 4WM8B 3TN92 1MQTC 2WLPA 2HWF1 3JD72 3TN91 1FPN2 3ZFFC 2R042 3VBOA 2RM23 5C8CA 1AL23 1AYM3 1ND3C 4CEWB 5JZGA 2R041 3ZFGB 1NCRB 2MEV2 2R072 3VBSC 2HWC3 5CFDC 1COV3 1HRI2 1R1A3 4N43B 2R071 1RUJ1 4Q4V2 4RS5B 3DPRA 3FBMA 1HRI1 1B35A 5L7OA 2HWE3 1A6CA 4CDWB 1AR72 2RS13 4FTSA 1BEV2 4RQPA 4PDWC 2HWB2 1AR71 1NA1B 1RUF3 1RUG3 1PGW2 4RR3C 2WZR2 1VBE2 2HWB1 3VBFB 3IDEA 3J8F1 2HWD2 4N53B 5FMOS 1AYN2 2WZR1 5C4WA 1VBE1 1PIV2 4CEYC 1ZBE3 2BBVA 2HWD1 1AYN1 1TME3 1RMU3 1X36A 5CFCA 4CDUC 1PO23 4WM7C 3ZXAC 4FSJA 3VBRB 2RM22 3ZFEA 1AL22 1AYM2 2WS92 5D8AB 1AR93 4QPIA 1K5MC 3VBHC 2RM21 1AL21 1RHI2 1R083 4GB32 1HRV3 1PO12 1COV2 1R1A2 4Y4YA 1RUH2 4JGZC 2HWC1 1COV1 1R1A1 5FOJB 2HWE2 5CFDA 3VBSA 2RS12 1EV13 1VBD2 5BNPC 2HWE1 4IV3B 5C9AA 5BNOB 2PLV3 2RS11 1RUG2 4GH4A 4AEDA 4YVSB 5A33A 1H8TA 2QQPA 1X33A 1RUF1 1FOD3 1RUJ3 1RUG1 1RUE3 1ND2A 4WM8C 4PDWA 1ZBE2 3VBUC 4YVSA 1TME2 1RMU2 2BFUS 1NG0A 1PO22 3NAPC 1ZBE1 4GMP1 4GMP0 5ABJA 3JB8A 1TME1 4CDQA 1RMU1 1RVF3 1PO21 4CDXB 3CJIB 4CEWC 1F2NA 1NCRC 1W39A 4QPGC 5DDJ3 4CDUA 4WM7A 1AR91 4N43C 1HRV2 4RS5C 4Z92B 1R081 3VBOB 1HRV1 2RS33 4CDWC 2XBO3 5JZGB 1EV12 1CD3G 1NA1C 2ZZQA 2X5IA 2PLV2 1FMD3 4JGYA 1EV11 3VBFC 1NCQC 4Q4W3 3DPRB 1B35B 4N53C 5L7OB 2PLV1 1FOD2 1RUJ2 1DDLA 1RUE2 2BUKA 1OOPA 1FOD1 4RQPB 2BFUL 1CJDA 1R093 4FTEA 1RUE1 3VBRC 4RHV1 1F8VA 1C8M3 5D8AC 1RVF2 5K0UA 4IV1C 5AC93 5C4WB 3VBUA 3J8F2 1RVF1 3JB4C 5DDJ2 2R063 5CFCB 5DDJ1 3ZFEB 2RS32 4GMP3 4QPGA 4QPIB 3VDDC 1PGL2 2XBO2 1NY71 1ZBA3 1BBT3 2RS31 1PGL1 2XBO1 5BNOC 4YVWC 1EAH3 1FMD2 2RR13 4Q4W2 1RB8G 1MQTA 1FMD1 5A32B 3JBG3 4Q4W1 2HWC2 1OHFA 3VBSB 3ZFFA 5CFDB 2Y26A 1QJU1 1D4M3 5C9AB 1OPOA 1NCQA 1ND3A 4GH4B 4AEDB 5A32A 5A33B 4CDXC 1R091 3CJIC 1C8M2 1H8TB 5AC92 1ND2B 1QJX3 4PDWB 1C8M1 4LLFA 1RUF2 2IZWA 4SBVA 2R062 5BNNC 5AC91 1AUYA 3VBOC 5ACA1 2R061 5C8CC 5ABJB 4CDQB 4IV1A 2WWSA 1BMV1 5JZGC 4RHV3 3LOBA 4RR3A 1BBT2 3JD73 4CDUB 4WM7B 1FPN3 2VQ0A 1VBC3 1GFF2 1ZBA1 2TBVA 1BBT1 1EAH2 1IHMA 1ASJ3 4CEYA 1AR92 1VRH3 2RR12 3DPRC 4Q4X3 1K5MB 3ZFGC 1RUD3 5L7OC 2MEV3 1EAH1 1R082 2RR11 1RUI3 3JBG2 4RQPC 4YVWA 4Q4V3 2RMU3 4JGZB 1D4M2 1C8NA 3JBG1 1K5MA 2X5IB
chains in the Genus database with same CATH superfamily
2ARBA 4DINB 1KJRA 3L2HA 2OIIA 2ZKNA 5GZGA 1NZCA 1BJQA 2DUQA 2K46A 2Y6FA 3ATGA 3NV4A 3MV11 2Y60A 4IEWA 5FJHA 3BTAA 4YRDA 3VGIA 3WF2A 1OQ1A 3CO2A 1ZREA 1BEV3 4UFJA 4LO4B 3HNMA 3RYPA 1QJX2 2CHHA 1OOPB 4PHZA 3RI9A 1C1FA 1LHNA 3LSEA 4GWMA 4YFWA 1WMEA 5FXZA 2QQLA 1YO8A 2UWBA 4AR2A 3D0SA 5T52A 1UZYA 5LK7B 5J37A 1LCLA 3BGAA 3VKMA 1QJX1 4D7YA 4RFT0 2XUEA 1LOFC 1X9PA 3KHCA 2UYAA 3GYDA 4HANA 1OF3A 2VMCA 3MLKA 2DBIA 1W8FA 2ZGNA 2P17A 1W2AX 3CZJA 1VBB3 5K0UB 1QJZA 1K3IA 1W99A 4KU7A 2D43A 1HIXA 3H3ZA 4UT5A 4UOJA 5DN2A 5LEJA 3ME2A 2FCTA 2ZMNA 4XABA 4Y26A 3T08A 4O7XA 2VZVA 2JXAA 2WAAA 1E5HA 1VR3A 3CU7A 3JD71 4WM8A 5T5OA 4Q4X2 5LRSA 2VMGA 2BOIA 5FZLA 4ITCA 5F3CA 3NAPA 2YC0A 3LSDA 1RUI2 4Q4X1 3RMYA 5FZAA 3I2GA 1RUH3 3ZN6A 3HQUA 1QWRA 4D3WA 2RMU2 3I3MA 1RUI1 1NY72 1SBDA 3ITQA 1MR5A 4XHXA 2E7AA 2VBPA 5FPZA 4BCUA 4EE2A 4GH4C 5EZWA 3ZFGA 1NCRA 1H8TC 1UCXA 1V6NA 2RMU1 3LPGA 5KXEA 1Z7S3 5EFUA 5FZOB 4Q4Y2 4CCNA 5LY2A 1HB3A 1OKOA 1ND2C 1POQA 2Q0AA 1RXGA 2YMZA 2VNGA 3Q9OA 5LBCA 1SZBA 1VB4A 1UX7A 2DTWA 2YFZA 3EQEA 4RS5A 2WZEA 2Q8OA 4QPYA 3ZFFB 1HJGA 3OGVA 1TMF2 4Q4Y1 4TTGA 5IAVA 4CXXA 3AMPA 3OOXA 3H0OA 4CDWA 1ND3B 1UNBA 1TMF1 4N9IA 5APAA 1ZYBA 4HL0A 5LK5A 3IDBB 1ZA7A 4CDQC 5FYYA 1JHJA 1MZEA 2GSYA 1GKBA 4BMEA 1CAXA 1DP0A 2UWAA 2IXJA 1PMHX 3SH5A 1LHVA 1NA1A 1ST8A 5GKAC 3V65A 1CIWA 2B7YA 3ILFA 4BU2A 1PIV1 2ZZJA 2DUPA 3LA2A 4GJZA 5CBLA 1W6OA 4A2UA 1MS1A 3BU7A 1RUC3 2DVDA 2J1EA 2L9LA 4LBNA 1VMFA 1U0AA 3N9MA 4A6SA 4UXAA 2W46A 3WQ0A 1HXS3 3ECQA 1XYOA 5FPLA 2ZX3A 4FOYA 4MYEA 5EJ1B 4YG6A 1DFQA 4XMAA 1W6QB 3U4SA 1AR63 1PVC3 3HMYA 5BXXA 1W05A 4Q0SA 4CPBA 2QQNA 1W2NA 2LM3A 1D0HA 3GCWA 4ISQA 2ENRA 3LEIA 2BEOA 1JTZX 2D97A 2ZAHA 4H7MA 1GOGA 4GB31 4YNIA 4LHKA 4JGYC 4W6WA 2LUWA 4KG0A 4MGKE 5J1XA 3I2JA 3LFMA 2JKXA 4TYSA 1DHKB 2XKPA 3SISA 4XC9A 2W87A 1U12A 2RHPA 5FXXA 3ORJA 4CUCA 5JXIA 2BWCA 2EIGA 5FLIA 3RG0A 2RS52 2MHFA 2WO2A 2X29A 3VHOA 4YVWB 3RWKX 3S30A 2FDGA 3VDDA 2RS51 4AHZA 2XL7A 4HBNA 1PGSA 4I3PA 4ZS3A 5FWEA 4BOWA 4EWEA 5F2WA 2PHWA 2P1BA 3VBHB 4QKDA 3LF7A 5FMBA 2QQJA 4DUWA 2QQWA 4HVQA 2VJXA 5FP3A 1V00A 3AK0A 2CGNA 3R4DB 4FT8A 1S0FA 4I2OA 1IG3A 2Y6KA 3OBTA 5CYYA 2GC3A 1DGWA 2Y6HA 2VUCA 1V9U2 2NPIA 3WP6A 1QJFA 5EHDA 3MPPG 3HAGA 3ZDVA 2JG9A 1O59A 1O3TA 3BTYA 5SV8A 1AR73 1V9U1 2W1UA 1PZ9A 5F6KA 2HWB3 3ZMNA 1JHNA 4CE8A 2VULA 4FQ4A 5BNPB 1CPNA 3Q8BA 5A3NA 1VAKA 1PK6A 3RVHA 5J7MA 3U1XA 2JIGA 3AZXA 2VZSA 5BNNB 1QQP2 1JH5A 3VN4A 4A7ZA 4IQPA 2HWD3 4JQTA 2BNMA 2ZMKA 3LEKA 5H9RA 1GOHA 3AKPA 2ZGTA 5GZEA 5C8CB 4XETA 1O4ZA 1QQP1 4ET7A 3WNLA 3TEYA 4OCTA 3IWZA 4IEYA 3E6BA 1CZTA 1DIWA 3TN92 4DEVA 2DCZA 2VCMA 1KS5A 3AYAA 3HN1A 2R6QA 3KMHA 4Q1RA 3QH6A 3SC7X 2WLPA 2ZACA 3TN91 1XYPA 2BGCA 2B4KA 4LUMA 3DXTA 3VBOA 2GP3A 4YG0A 3AVSA 1AYM3 3VKNA 3OSDA 2JWPA 1JN2P 5FYZA 2E7TA 2VMHA 4CU6A 2PXJA 2NZ9A 4PIXA 5I8SA 3UGHA 3UJQA 1JZ2A 1XQNA 2MEV2 4JQRA 5JOXA 1J3QA 2J1VA 4UAPA 5L9RA 3CBNA 1W6MA 3ZX7A 1QOTA 1XXNA 1HRI2 4XTMA 2A73B 1R1A3 1W2UA 4F7ZA 1YIFA 3O1RA 1LEMA 3RPQA 3N4MA 2WNUB 1HRI1 1GBGA 3NW4A 3NV2A 1L7RA 4P08A 3HWJA 1GZCA 1I9RA 3W21A 3ZYJB 2LTNA 2Q4SA 4CA9A 4YZ2A 1H1MA 4AVCA 2YC2A 1QF3A 3HPNA 5A3PA 5GM0A 4AGRA 1UO9A 3WP5A 1HB1A 3WHUA 5GZFA 4XDOA 5LW9A 4DB5A 1BEV2 4W6XA 2W5FA 4KNCA 2D3RA 2RJKA 4L11A 2YBPA 4Q0PA 3V0AB 2TEPA 5LA9A 1IGOA 1LHWA 1G9FA 1N47A 2LW8A 3D4KA 1I5PA 1SEFA 1VBE2 3ILNA 4LPLA 4ZU4A 5FZ0A 3VBFB 3J8F1 3W5NA 5C3SA 2OKXA 4DPNA 2UY8A 4BHPA 4B1MA 1VBE1 2VNVA 1V6LA 1W06A 4NHMA 2WNVC 1NLSA 2RV9A 2GNTA 2C1FA 4E4SA 1RMU3 3MIHA 1IKPA 1J3RA 5J48A 1XBFA 2EAAA 4XTPA 3T4VA 1JU4A 3HN3A 1A3KA 3L2YA 2DYCA 4J25A 3ZFEA 1AL22 1QIQA 3BOWA 1OLMA 4IEXA 1O7FA 4HMZA 5FCCA 3KVBA 3Q8FA 1AL21 4CCDA 4Y1ZA 4XF4A 4EZ4A 4OI2A 2JDUA 3M7AA 1S0DA 4FFGA 4TN7A 5FK7A 1COV2 5C5TA 2R0HA 3LEMA 1RUH2 2O14A 5C3OA 1W8TA 2W47A 2GC1A 1MS4A 2JX9A 4TWTA 1JZ5A 1SACA 1SCSA 3VDCA 2AH2A 2DFCA 1COV1 4NO4A 4E27A 5FOJB 4UW6A 4J1WA 1IKQA 2OYZA 5E89A 2IWGB 4P00B 5K7PA 3I2DA 3K4DA 2QBXA 5AVPA 2P4EA 5CFDA 3VBSA 1QGLA 1YRZA 1R64A 2WSUA 2BYVE 4NJ4A 2PMWB 2DCYA 4IV3B 2Y6JA 2YG0A 3T0AA 4NOTA 3MYXA 3H50A 3SH4A 1CJPA 4J6GA 1WD4A 2W1WA 5ERLA 5ISLA 1UY1A 2VZ1A 4HSJA 4EN9B 2QQPA 5I93A 3AZVA 3PMSA 4QX1A 1F35A 1JI6A 1KEXA 1RUJ3 2JIJA 3DV8A 4TZDA 4WM8C 4UBGA 1XC6A 3JU9A 5FZ4A 1GP5A 5A1FA 3K75B 4GULA 2YGMA 4YW2A 5A7OA 4YVSA 1TME2 1TZOA 4IEPA 2DTYA 4XBNA 3BPSA 3DUIA 3NAPC 1W9WA 3I3BA 4M3CB 5LY1A 2WYSA 4XQWA 5KHHA 4MGZE 1TME1 1U5XA 1Y9QA 4Q1PA 5JR7B 4EWDA 4OI1A 1OLQA 4YLZA 1DQ5A 3N7MA 2XL9A 2JE7A 3HOBA 3PNAA 1NCRC 2R1BA 1UQXA 4LMFA 1FYUA 4OUSA 3VHRA 3PTRB 4B29A 1MS5A 5DDJ3 4HT1T 1AR91 4OFGA 2ZKLA 4I0AA 5J3UA 4GWNA 4AWDA 1HRV2 2CV6A 5IK7A 3GM8A 5A3UA 2DU1A 4Y5TA 1UW8A 3O0XA 4COYA 2XWJB 1NE4A 4RS5C 1R081 5KXBA 3FHQA 2A7AA 1F31A 1HRV1 2QJVA 1NZIA 4DY3A 3GJBA 2DU0A 1WLWA 4LK6A 5A3LA 4CDWC 2FDFA 2XBO3 2RJ2A 1UY3A 1BVVA 2LROA 5EYXA 2AR6A 1LODA 3MW3A 2QZ2A 3QOPA 4PF1A 2ZA9A 1DG6A 1UYXA 1FI2A 1EV12 4ZXEA 4M4PA 3M3EA 4YW6A 1NA1C 2IC1A 3THTA 3USUB 2K9ZA 1W6PB 4FPLA 4E2QA 1FMD3 3BI3A 1EV11 5T50A 2J1SA 3MICA 3DPRB 1B35B 1VJ2A 3EXUA 3FE5A 1N1TA 4C1XA 2PTMA 3MI8A 4H7LA 3KV5A 1LRHA 3LQCA 4OZOA 2OVUA 1DDLA 1RUE2 5DABA 5BUVA 3T2TA 1OOPA 3J7HA 4LO8A 4B4RA 2PQSA 2R1DA 3FN9A 1CJDA 1KFUL 1RUE1 2VQUA 2WWUA 2ZEZA 3IMMA 4UFLA 4BB3A 4CZSA 5FRAA 5IJRA 2QVSB 4RHV1 2ZX2A 4HN1A 3AKRA 1WMDA 2W68A 4BMBA 1H30A 5K0UA 4GD4A 3WQ7A 5BY5A 3A0KA 4HKLA 3ZXLA 3URFA 3MHZA 5C4WB 4B3NA 3ILRA 3ZIXA 4QB1A 2VBBA 2R063 1NYWA 4AEJA 4INDA 1KDMA 5JOYA 5CFCB 4NHLA 5HCBA 2VMFA 1ZRFA 4CXWA 2R16A 4OUMA 1EPWA 5A7PA 2QFEA 3WX5A 2B42B 3ZDSA 1ZZ7A 3ZXGA 1UYYA 3OD4A 4GMP3 3PUHA 4QPIB 1US2A 1SLTA 2OZ6A 4JTOA 4CUGA 2YROA 1KRIA 1BBT3 1XSRA 1AX2A 5FZCA 3TNPB 4MGSA 4YW4A 4NPLA 4EROA 1MS3A 4C91A 3FZ3A 1DZRA 4NPMA 1Y43B 2ARCA 5FKBA 4BQ3A 1JOBA 2PFWA 4NRPA 4GZ9A 4QQ2A 2RR13 2CAUA 4FOVA 3JQXA 5CZKA 4Q4W2 3NJZA 2YGLA 3RZHA 2JG9C 1RB8G 3KV9A 5FZOA 1KD7A 1LOBA 5BPXA 5FZ7A 5L19A 4XF9A 1WCKA 3JBG3 1LHUA 1VMJA 2I74A 2JE9A 4Q4W1 4TSVA 3AKSA 4ZONA 5F2SA 2AENA 1ODMA 2OXBA 1QJU1 1WW7A 3ZFFA 3ZSJA 1YQ5A 1WBFA 5IK8A 5C9AB 2ET1A 1ND3A 2XMLA 3HQRA 3NJVA 4EN7B 3ALQA 3M1HA 5FZ1A 4AEDB 1IS4A 2XJRA 4AK3A 5A33B 5J09A 2D6OX 1QKQA 3UK9A 4FCAA 4BWOA 2YB7A 5FZGA 4XBLA 1US3A 5JWPA 5AC92 3SXWA 1W8OA 1QJX3 2XJPA 2YXSA 4PDWB 3T0BA 1KFXL 2EXKA 3J7LA 2IZWA 3DYOA 3LDKA 1N1SA 1CPMA 4Q29A 4HN0A 4AFBA 5AC91 4AQ6A 5KR7A 5IYYA 4CSWA 1Y7BA 2OQ6A 3WNOA 4LBJA 3LKJA 3ZYBA 2ZX1A 3VBOC 3WOGA 5ACA1 5ABJB 1KQRA 2JDYA 4OVEA 1SCRA 1SDWA 4R52A 3TB0A 1SG3A 2J1UA 3R05A 4XJ8A 5GZDA 1W6QA 2Y8KA 3PLQA 4LLOA 3EHKA 2VVFA 3THCA 3JD73 2E9QA 4WM7B 4V2WA 1GANA 2BVBA 3DGTA 4JVAA 5I0TA 5F5QA 1DGRA 1ZBA1 1X8MA 3MZHA 1YJLA 3A22A 1IHMA 3LAGA 1XE0A 5IK5A 4Q4X3 4XCAA 1ALYA 1S4CA 4B7KA 4C0BA 3E5QA 5IVBA 1SFNA 3GGLA 4BPZA 5F9TA 5HCFA 4R8HA 1RUI3 1PHMA 2UWCA 1UD1A 4Q5OA 2YU1A 4QPWA 3ACHA 4QKNA 4YVWA 5FZMA 1UKGA 2V4AA 1WWYA 4YYOA 2RMU3 1A34A 3K48A 4XFBA 3NV1A 4OHYA 1K5MA 4FFHA 2JEMA 4CCCA 2FZ1A 3VBHA 1C4RA 3KT7A 2ZX4A 4QXBA 1HLCA 1N1YA 3O5SA 4E4HA 4AHYA 1F15A 1UY0A 2QTWB 1MS8A 4Q4Y3 1RC6A 1ULFA 1UU6A 4AGGA 2PHLA 4XURA 4PT6A 5LCWL 1JYIA 3BIWE 4JGZA 1SHWB 4MSVA 4B7EA 4DY5A 1TMF3 3QACA 3WP3A 4CU7A 2XDVA 2G19A 1DGRN 3SEPA 4AFDA 4IGQA 1GNYA 3VZLA 3A21A 4D69A 4BXSV 2Q30A 1YC61 5EQUA 5A6YA 1PIV3 4UFMA 5DZFA 5BNPA 1YEWA 3WDXA 1FATA 2J22A 3NQHA 4QQOA 3MPBA 3VBUB 2C9AA 3VB9A 5BNNA 3PVOA 3MO4A 2QNKA 3ES4A 3T4HB 4BJ0A 3WW3A 2XQRA 1HX6A 2GDFA 5LA2A 1OMIA 5FZKA 5EXOA 4A3XA 4ZPIA 3UV9A 1GP6A 2Q8DA 1FPN1 2CWSA 4Y1YA 4LT5A 1AF9A 3LD8A 1J59A 1SFYA 4MUVA 3AXDA 4A44A 5C70A 4QPGB 5HBAA 3SCGA 4HOOA 3AYDA 4GB33 4OHZA 5KHJA 1O4TA 3RWNA 2QQKA 1V6JA 2ZTNA 4JZRA 4E9KA 4COZA 2ZBJA 1C3HA 1QNWA 4UWDA 4QX3A 2VOTA 1C57A 1ONAA 3FLRA 2ZJCA 5H9SA 2VQTA 1QDCA 1AZDA 3VV1A 2X10A 4MADA 4OMCA 4ASKA 1BLZA 1DYKA 1VBA2 2XLGA 4LBQB 4Q4V1 2V5DA 1D0GA 3V0BB 3U37A 4A41A 3RNSA 2R7EB 1MQTB 1XOYA 2RS53 1HV1A 3S6PA 3WVJA 1VBA1 2WNUA 3Q8AA 5FZ6A 1HN1A 3BPZA 3HEIA 4YVSC 5FXWA 4EWAA 2AUYA 4BQ4A 1LEDA 4BXFA 3A23A 3Q8CA 3I3DA 4XJZA 4O9EA 1ZZ9A 5A7NA 2LRPA 3J4UH 1AVBA 3I3EA 1PGW1 5FBJA 1VMHA 2ZOEB 3O1OA 5AFEA 4LHSA 5LA0A 5IT6A 1WA6X 2WT0A 4E2SA 3RZJA 4HKOA 2Z5WA 1V9U3 3MUY1 5E16A 4Z07A 3VBFA 3VKLA 4CCOA 4Y5Z0 1UKRA 5JSRA 5J96B 3N7LA 3RJRA 4AHWA 5HI0A 5DZGA 1GQGA 4XFHA 4EYUA 4YZ5A 3ZSMA 2ET7A 3C7HA 4QX5A 1ZZBA 5A6ZA 2E7QA 1W8WA 4IV1B 5IHRA 3TEWA 3ZLIA 4D0QA 5FR3A 3K2OA 3WW4A 4Y24A 2ZX0A 4I30A 1QQP3 2XJVA 2G9ZA 4F3JA 1MVEA 4RGKA 1XYNA 1RHI1 3N9QA 5FTTC 4QT6A 5FO9B 3UL2A 1S2EA 1S55A 4LITA 1POV1 4MX3A 4QX0A 2ZXQA 4A3ZA 5I0DA 1POV0 3KVAA 3TN93 1DQ0A 4LO5B 2WKKA 3GHMA 3GXUA 4FI9A 4AHXA 3VDDB 4UF0B 2Z69A 3I49A 4MOAA 3K3NA 4IE7A 5FY4A 2ETEA 2ILMA 2Y64A 3KF3A 1JZ3A 2K2SA 1BYHA 1OOPC 1Q8OA 1I6XA 3VZOA 2XVLA 3THPA 2X8KA 1AJOA 3T30A 1PX4A 5IVVA 3I2HA 3KCXA 2ADDA 2HEWF 2H0BA 2X53S 5IVEA 4ZU5A 4ZZ8A 4D7SA 2WFF2 2P5BA 2XJUA 5DQ0A 5FUPA 2PA7A 5CAZA 3CJXA 2JDKA 3N3HA 1LOEA 2Q8CA 4ZY9A 2DBNA 2A3YA 1HRI3 2YU2A 3O14A 1OI6A 2WFF1 4K1YA 3MV01 4IV3A 5K0UC 2DCJA 1HV0A 1O6UA 3OPTA 4PIYA 1LTEA 3M3CA 3O1VA 5FJKA 1W3XA 1MEC2 2BNNA 4NPRA 1TE1B 4LEJA 3WUCA 2K0GA 3FWEA 4WVWA 3HT2A 3LZZA 3M2MA 2GU9A 4AFCA 1MEC1 3JXSA 2VU9A 4E8CA 1KXGA 2Q5TA 1CAVA 1Q8VA 4DS0A 2Z4FA 2BU9A 2BZDA 3C7EA 4M0HA 4MXWB 4CP0A 1SLLA 3JCIA 4FXKB 4OZXA 4XFAA 3J8F3 3CQOA 5LBBA 4E8DA 4LORA 4M3CA 4HKWA 1QDOA 1N3OA 1T6BX 3I8TA 1VBE3 2NQYA 3T09A 1LGBA 3S7EA 1GOFA 3RZGA 4KH9A 3PUAA 1UMHA 4E4DX 5C7GA 1H2NA 5JXHA 4A4AA 4GWIA 4HK9A 4NHKA 3SLIA 3NKTA 2Y0IA 2HWF2 3VD5A 3IIAA 3UGFA 4PI2A 4IGOA 5FZEA 1V6IA 3IDCB 4JV4A 3MFCA 4XBQA 2J1AA 2HWF1 3JD72 4LA3A 4Y22B 1F5FA 3ZFFC 2W94A 2R042 3DYMA 3NL1A 2JECA 3INAA 4HVOA 1AL23 3FFQA 4P9YA 3WEZA 4NHXA 4QXKA 4EN0A 5JR2A 1E5SA 1CESA 1UY4A 1NLRA 2WA4A 3CKHA 3LPFA 1ND3C 5IVYA 3OUJA 2JD4A 3U75A 2R041 3VDBA 4HFSA 2EIBA 5C33A 4RGAA 4JDNA 1J83A 1COV3 4MGYE 3USUA 4FAHA 4META 5FMDA 1W6PA 4K20A 1O3QA 3CZUA 1QOSA 2W91A 1X7NA 1B35A 3DPRA 5IUQA 4UW5A 4K40A 1L7LA 4AVTA 1IS3A 2ZPXA 2G9GA 3O0VA 3PUIA 1YI9A 3DN7A 4W6YA 4CU9A 4YPJA 1FT9A 3VD9A 2IXIA 3AP6A 5I91A 3AMHA 3TAYA 1OH4A 1H1IA 3DKQA 3OBZA 3OB8A 4PQ9A 3B69A 1O5LA 3UKNA 4BDVB 3D6EA 1Y9GA 1TNRA 5KWRA 3N35A 5D2AA 4NIAA 5FY5A 4K1ZA 1K42A 1DQ4A 4XVHA 5T54A 2GALA 4IEQA 4COVA 3RGBA 5A70A 1C1LA 3IDEA 5L9VA 2DVAA 4XW3A 3ZYGA 4N53B 3ZYPA 1XJAA 3EMRA 2Y6GA 4XHBA 1XE7A 5C4WA 1PIV2 1SLAA 4XZPA 2FDHA 4N8MA 1GYKA 1LESA 3POSA 5FYMA 2EXIA 1C5IA 4ASLA 2VZ3A 3PDQA 1TME3 3BYWA 4RL7A 1X36A 3MEPA 3WT3A 4CDUC 3AKTA 4CUBA 3ZXJA 5JIAA 1Z0HA 5CFCA 1XE8A 1PVXA 1RTVA 5DG2A 2BBAA 3VBRB 3WF3A 2RM22 3NJXA 1BHGA 1CQ9A 1S0BA 3CIHA 3PIGA 4CVUA 3OGRA 1AR93 1O4YA 2CTVA 4QPIA 5D8AB 1K5MC 3WG4A 3WY6A 4AVVA 4CCMA 2VMDA 2VW2A 3VBHC 4CCKA 1W8HA 2RM21 2VCAA 3OYWB 1R083 3OEBA 4H14A 2ADEA 2V09A 4GB32 1HRV3 2A6WA 3ASIA 4Y4YA 2JENA 2GNMA 4IW3A 4AOCA 4JGZC 2OPKA 4LIUA 4HETA 4BK5A 4BIOA 3UGGA 1BK1A 3H7JA 2HWC1 2KXLA 3A4UA 1SDDB 4M00A 4R4ZA 5IWFA 1W6NB 5FXVA 1W9TA 1LECA 1G8WA 1ULEA 1EV13 2A75A 2RS12 4LKEA 5BNPC 3R6SA 5LBFA 4QWNA 2ZGUA 4M0NA 2W0XA 1F5JA 1YFXA 4JDMA 5BNOB 5C9AA 4LHNA 2RS11 4AEDA 3WNNA 4UYBA 5A33A 4NVPA 2XVGA 1WCQA 4V1PA 1X33A 1LOGA 3T1LA 1RUF1 5F3EA 2EA7A 5B4XA 4D6QA 4W50A 1RUE3 2FMYA 2WAOA 4LE3A 2I07B 3OG2A 1Q43A 3O7OA 4PDWA 3OJBA 1RIRA 1QH6A 3FHIB 5F1RA 3V64A 1UPIA 1FNZA 2BFUS 1NG0A 2YPJA 2GZWA 1IPSA 5JAXA 3X29B 5JSPA 4J1XA 3FLTA 5CG8A 4P9GA 3WDWA 5ABJA 1YFYA 3U14A 2G4IA 2WT1A 3WSOA 4ZXKA 4CDXB 2IVJA 3CJIB 5F5CA 5A6QA 4DXTA 3FLPA 1SQ4A 3H7YA 1GNZA 2XH6A 2YDEA 1OLRA 5FO8B 2XQXA 4ATEA 3IBMA 2WDBA 2GMMA 5T3NA 3N36A 3OGSA 4P9IA 2O0OA 4WM7A 5I0RA 5JI9A 4GIQA 4XQDA 2QQVA 4ISRA 4LTAA 4IESA 2GMEA 3VZKA 2VECA 2WNUC 2QE3A 2EALA 1DZQA 1MZ5A 3ZYIB 1I1EA 4A7KA 1CZSA 1YQCA 2DUOA 3Q8EA 3E97A 3WDVA 4XYXA 2XLAA 4NROA 5EP9A 1WLTA 5JZGB 3VL9A 2SBAA 3R4UA 2ZHNA 1ZRRA 3NNMA 5FZFA 4NIDA 3OD0A 5FQ0B 3GZUC 4S2DA 1CN1A 1HW5A 2B46X 2WBKA 2D5HA 3PVBB 4XQ4A 4AEMA 3BKZA 3BOPA 3VBFC 1NCQC 4Q4W3 3E6DA 3M3OA 2YZ4A 3KGZA 2E33A 2J1TA 5GZCA 3AJYA 4ORFA 3POWA 4RN5A 3UJOA 2RE9A 2XJQA 1JW6A 2ZHKA 4FTEA 1YQ2A 3VD3A 3IZOA 2PHTA 2N7GA 1YXWA 1N1VA 1S1AA 2DV9A 2GC2A 1URXA 2BTVC 2VMEA 3W59A 4H2AA 2EXJA 4LBOA 3SITA 5AC93 3I97A 3OEAA 3VBUA 4OYUA 3J8F2 2PYTA 4PIZA 1IPKA 3JB4C 5C3PA 4IEUA 3ZVXA 4XAAA 4EV0A 4JHZA 3H3LA 4CP9B 1H8VA 2F17A 3TOJA 3JQWA 4WZCA 4XILA 5GLZA 2A1XA 2GH2A 1QXPA 2PAMA 2Q1FA 2W9XA 2A6XA 4BQ1A 1JZ7A 3EO6A 1E5IA 4QQLA 1WCSA 2RS32 4R4XA 5EJZB 1WMXA 1XRUA 4QPGA 1SFPA 4FBFA 5IVCA 1PGL2 4TXWA 3SQOA 3VZMA 4GWJA 1ZBA3 1AXKA 2XUMA 2RS31 3IDAA 2B8MA 1PGL1 5LZ6A 1OUSA 5FLHA 2RDQA 3LA7A 2QQIA 4RD7A 2YUEA 3CF6E 1W8NA 4K8RB 4FOQA 5FYCA 5AVAA 4AI8A 4LBQA 1GNHA 3GZAA 4AL9A 3K4AA 4ZZ5A 2B9UA 1MQTA 5A32B 3AZZA 3FUOA 3S5QA 1RITA 4NRQA 4QU1A 2VZTA 5FPBA 4YM3A 3AXEA 3OY8B 2B5HA 1QJEA 2Y26A 5KBFA 4BQWA 4R9BA 5IFPA 1ULDA 1AXYA 2HYKA 1EPZA 2KM2A 3GBWA 3NWKA 4ARXA 4RGGA 3OPWA 4P5HA 1R091 3S57A 1C8M2 3MIEA 3ZR6A 5JSOA 1MS9A 1C8M1 1BQPA 2IVIB 5FV3A 4SBVA 1BZWA 4Q2FA 4C1WA 3AP4A 5A3MA 4BQ2A 1LENA 1EP0A 5SV5A 4A45A 1H2LA 1AUYA 1J84A 1MZ6A 1Q5OA 4OHWA 2D6PA 4B8EA 4QX2A 4IV1A 2H6BA 2ZMLA 1S0GA 2ERFA 2GNBA 4KGGA 4KL1A 4CCJA 4CRQA 4NRMA 4Q0UA 2AACA 2C5DA 3S0MA 1BMV1 2IXKA 4G3YC 3WNXA 2JDAA 4U36A 3B93A 1FPN3 2D93A 4DUXA 1QH7A 4A42A 1GFF2 2R49A 1EAH2 1GWMA 3H1MA 1AR92 3DPRC 5HCHA 3CHXA 4P14A 4QAWA 5JXGA 3MW4A 3ZFGC 2ARAA 3ZO0B 3O1PA 2C4XA 4DOUA 1EAH1 4QQHA 1ODNA 2JD9A 1R082 4MHUA 1LOAA 1GLHA 4OMDA 1MS0A 3WF0A 4MHRA 1UAIA 4Q4V3 3H1YA 4IETA 2XG3A 1D4M2 5GLWA 3N9PA 1DLLA 2IXCA 2X5IB 3MIFA 4FVVA 5LRRA 3PMEA 3KF5A 1VBA3 1VLNA 3A0NA 3EJKA 1D4M1 1XNAA 2VY0A 5DAQA 4BISA 2RDSA 2VZQA 3RSJA 4XE9A 3RFRA 5CG9A 3SEEA 3MIDA 2F4LA 3KM5A 1W2OA 3AYCA 3DCQA 4Z82A 4OQ9A 5CFCC 3HJRA 1HDKA 2EVXA 3BTXA 4Q0QA 1TEIA 3AP5A 4L92A 1IS5A 1V6OA 4AEKA 4MV2A 5EV7A 1ACCA 3BODA 4MXWA 4QPIC 3PVNA 3ZMOA 4MG2A 3LA3A 3MUZ1 4RHV2 3O1MA 2FZ2A 2CDPA 4AI0A 1UU5A 1LAJA 2WN3A 4LR4A 1H4GA 3NAPB 1WW4A 1LR5A 5CVRA 3ZN6B 4DXRA 5T55A 4WV8A 4W65A 1ASJ2 3UESA 4DRVA 3ZXDA 4FTBA 1H1AA 4XF3A 1J1TA 4FPCA 3JZVA 2O1QA 1YIPA 1T6GC 2HEYF 1AX0A 2GH8A 1L3JA 4YW5A 1LGCA 1RHI3 3NVCA 2P3IA 1ASJ1 1MVQA 4Y22A 4U2AA 2DF7A 3S5AA 1POV3 4PQQA 2BGOA 3TWIA 1KJLA 4AVBA 3NMBA 3J7MA 3BUCA 5A80A 3U4XA 1NE6A 2BW8A 4EJRA 5C9AC 5LASA 1HQNA 3NJYA 4IGPA 4AEDC 5K9YA 5KHGA 4IEOA 4OI0A 3KQRA 1D2SA 2C6SA 2OUHA 1Q56A 4COWA 1LU1A 1W9FA 3IB3A 2WQZC 2Z2SB 4JHTA 2UURA 4DXZA 1EY2A 2A71A 4YW3A 3ZKUA 5AFBA 3O1SA 1JXNA 1OD5A 3WD5A 3PIJA 3HVDA 4DZGA 1AR82 2WFF3 4B1LA 3MGUA 1N3PA 1QJU2 1LJ7A 1S2KA 2XKOA 2RDNA 5ABJC 3JUUA 4XJ9A 1AR81 5FZBA 4NWVA 3ZR5A 3PTYA 5CKQA 1V0AA 3CEWA 1LGNA 5GALA 3T2OA 4B4QA 1MEC3 1PK6C 5T5PA 2BPA2 2D6NA 4NIHA 4PLNA 1RL3A 2BP6A 4N53A 1O5UA 1LOFA 1QJY2 2YHJA 3CMGA 2G1MA 3H8XA 1JBCA 5F32A 4GQ7A 2F4PA 4AVAA 1ZM1A 2Y33A 3B9CA 1OF4A 1GZ9A 1QJY1 1HKDA 3LDBA 1DQ2A 3KD4A 1AYM1 2WS91 4WVVA 3D8CA 2DVFA 3QCWA 4G9SB 5ACA2 3VBRA 4BA6A 3RZKA 3WQ1A 1B09A 1Q8PA 3TYJA 1BCXA 5LA1A 5D8AA 2TNFA 3PJQA 4NAOA 1PO11 4NHYA 5A3OA 5L36A 1QXRA 2HWF3 3OYWA 4CEYB 2YFUA 1UL9A 4LK7A 4H55A 3SMHA 2CL2A 2WN2A 3WG1A 4K21A 4NWWA 1ZBA2 1YQ6A 3LIHA 5C71A 2HBTA 2R30A 1LOCA 2JJ6A 2O8QA 2A70A 2R043 4Y3OA 1H9PA 2EIDA 2ES3A 4QHZA 1WA4A 1UYZA 5FYVA 1CWPA 1CX1A 5GLVA 4DIQA 1VBD1 5JVVA 2HH9A 2OT7A 5FZ8A 5CKNA 1SLIA 1W6NA 4FFIA 1IZ3A 4PBOA 5FP7A 1FV3A 1S0JA 3SCFA 3USSA 5C6CA 3WP4A 1VB2A 3KHBA 1AL0G 2FQPA 3KT1A 3HBKA 2JB8A 5BNOA 5IAXA 1GWKA 3AFGA 3OCPA 2PHXA 5JUVA 2UYBA 4FPFA 2OA2A 2XPJA 5DAVA 4C90A 2J42A 3BALA 5T5LA 2BDRA 5H9PA 2CGPA 1OVSA 1WZXA 2VC9A 1G6NA 3GDBA 1W9SA 1FXZA 5F3GA 1UIKA 2XXZA 3C3VA 1S2BA 2WABA 3C7GA 3QH7A 2QQOA 1UWWA 3T2QA 5CISA 3RZZA 4CDXA 3CJIA 2WRAA 4HG6B 3PVEA 3ZFEC 1OXCA 2LALA 2OPWA 2YYOA 2BV4A 3C2UA 5FY0A 3P3PA 2VZOA 1X50A 1UXZA 3FL7A 3LWCA 2PAKA 3NNFA 1VRBA 4JCKA 2VL4A 4W4ZA 4YWAA 3T2PA 1PNGA 1MQTC 3MF9A 4JAAA 1FPN2 1W6MB 4C8DA 2ZCWA 4N9HA 3W5MA 5CA6A 2RM23 1VALA 4QDRA 4PBPA 5C8CA 3LB9A 1BVP1 1O8SA 3W20A 3ZN4A 4S2HA 2RDRA 2VXJA 4CEWB 4QHOA 5FFOC 5JZGA 4L97A 2CDOA 3SKJE 2P3KA 4PI0A 1REEA 2WQ4A 3POEA 2R072 2AGSA 2QUOA 5HV4A 4IE0A 5FQ0A 2F6BA 2HWC3 3VBSC 5CFDC 2D3PA 3D82A 3HNBM 4N43B 1KITA 1DYPA 2B45X 3AX4A 2R071 1WMFA 3ST7A 1WD3A 1H0BA 1RUJ1 2WZ8A 4Q4V2 4UFIA 3MIGA 5K4LA 1GSLA 3C7FA 3FBMA 3KCYA 4R9AA 3O1UA 3ZSLA 1PM4A 3AFKA 5A1LA 2ZGOA 1QXJA 1OA2A 5J36A 1A6CA 5FYBA 1XU2A 2ZGKA 3NV3A 4FPJA 3WW2A 4HZFA 4NR1A 2RS13 1UZWA 1JYTA 4FTSA 3ZN5A 2P34A 4CTEA 5FMCA 2AEYA 4MGQA 5FYUA 1CR7A 1RUF3 2Q8EA 1PGW2 3ZPYA 2WZR2 4MO3M 2PHFA 4Q0VA 1IQDC 3KT4A 3D5OA 3DYPA 3PL0A 1AYN2 1BXHA 1WKYA 3VZJA 4D7TA 2WZR1 1T2XA 2WFPA 4UI9L 3WHTA 4XEZA 3WQBA 3V0AA 5FY8A 1AYN1 4CP9A 5I8YA 2C24A 4N7UA 1JYVA 4QKBA 1PX3A 3LFIA 3T3YA 2VQAA 2WC2A 5FO7B 3L9JT 3WINE 1RJ8A 1RXFA 5HXVA 3IN9A 4Q8LA 4HXCA 4FSJA 4MXVA 2JB4A 4IE4A 5T5JA 5DUVA 5LB6A 3WG3A 2JICA 2IFRA 2YPDA 1XNTA 1SLBA 2VBDA 1IG0A 3WUDA 1RHI2 2XJSA 4FPKA 4JC1A 5FYSA 4EN6B 3E5UA 3LEGA 3ENRA 1TQ5A 1J3PA 3PU8A 2C26A 3J9SA 3U11A 4FXGB 3IM0A 2FBEA 1UF2C 2FMDA 1GQHA 2XLFA 4B4PA 5B4NA 2QQUA 4P9LA 4XPVA 2A3WA 1UMIA 3OBAA 1WLCA 4AQ2A 2HWE2 1NLQA 4BQ5A 3OY8A 1OA4A 5F39A 2JG8B 3BTZA 5FZHA 2YV8A 5FY1A 4YFZA 3AL6A 5FZIA 3WZ1A 1UU4A 2HWE1 2XGXA 1GQPA 4DEQA 4YARA 2P6CA 4LBQD 1NKGA 4LBKA 5FPXA 2DCTA 5E8AA 3OUHA 2XVKA 5I8TA 1RUG2 4YVSB 4NE9A 3KV6A 1W8ZA 2FHRA 1UPSA 1RUG1 3WCRA 5JLVA 3AB0A 3AMMA 4DO0A 3PUQA 1ZBE2 1LB2A 2W52A 2QQMA 3DEMA 3NNJA 1CZVA 2ATFA 3M70A 5FUNA 1JS9A 1PO22 1ZBE1 4Y20B 4GMP1 2BOJA 2VTXJ 1GP4A 4GMP0 4Z2AA 3I59B 2G9FA 3AZYA 2ZHLA 4NIGA 1YWKA 1PO21 4QM9A 1H6XA 3K46A 4LULA 1F2NA 3TEZA 5FREA 2MPFA 5EJ3A 4FFFA 1W39A 2VCCA 1OA3A 3WLUA 1UIJA 3ETPA 3OUIA 2CU5A 2ZS6B 4L8QA 4MGIE 3H1WA 4AAXA 2W95A 3ZPOA 2XB6C 4I09A 3WDYA 4ASMB 4OHXA 3KCCA 2VE1A 4D6RA 4Z92B 2V73A 3QLQA 3KLSA 1GU3A 4HPKB 3P6BA 4UBHA 1GMMA 2RS33 4CP2A 4YSFA 4X6RB 4JKKA 3M3QA 3V56A 3T0DA 3POBA 1GZWB 1REDA 3ES1A 4XF1A 2VVDA 1IQAA 2CY6A 2X05A 1L7QA 2EICA 2X5IA 1JU3A 2PLV2 1Q8SA 1AJKA 3B94A 1JMUB 3ZXKA 4N53C 2NP0A 3HT1A 3D0JA 1DLCA 4YM0A 5L7OB 2PLV1 1FOD2 1NUKA 1ZRIA 4YM2A 3N9OA 2JDMA 3CNAA 1OLME 2BUKA 2GP5A 2RG4A 3IAPA 4KBBA 4QD2A 5G04L 4AFAA 2ORXA 1IS6A 1UXXX 2WINB 4LXLA 4RA0A 1FOD1 1XNBA 2D40A 1P8JA 2BFUL 3BN6A 3FJSA 1R093 4RQPB 5DUUA 5DUWA 1X9TA 3WNKA 4AYUA 3N7JA 1GUIA 4QX7A 4KQ7A 2D6MA 3VBRC 5H9QA 3IIIA 4LO7A 1VP6A 3CL1A 1C8M3 2AYHA 2Y38A 2WO3A 3APBA 1H6YA 2RJLA 1RVF2 3KV4A 4FPGA 5D8AC 3TRSB 3WR0A 5A3TA 3HR9A 1CX4A 4FPHA 3H8UA 4O9GA 4P9JA 4EQVA 1CAUB 1RVF1 4N90A 5FBZA 4PLOA 2E26A 1OC1A 1ENSA 4X6QB 5BYNA 5DZEA 3SCHA 5EYYA 3RQ0A 5EIYB 2E53A 3VD7A 2P6HA 2BRTA 1UOJA 5IVJA 5C3RA 1ENRA 5JMCA 1WBLA 1NY71 4XIOA 2YBSA 3E6CC 2IFWA 2QZ3A 2VGDA 2WL1A 3W9AA 2VTFA 1VPHA 5HCAA 1JODA 4KWJA 4ONUA 5C8WA 4CP1A 5BNOC 3HBZA 1FNYA 4W8JA 3RZLA 5F37A 4YVWC 5GJ6A 2OUJA 3ACFA 1EAH3 2VOKA 5FYHA 4AI2A 1NQDA 1WGPA 3T1MA 1RGSA 3KZ4C 2W2IA 2H6CA 1JYWA 1F4AA 1SBFA 3QBQA 4WVMB 3MIBA 1UX6A 4MZUA 4AG4A 1O8PA 2HWC2 4XUNA 3ZXFA 5JPNB 3WNMA 3WG2A 1X8EA 3ON7A 4M3CF 4OUEA 4Y4RA 1D4M3 4BM8A 1G9CA 4XIKA 2HLEA 2EAKA 3HIFA 4YGCA 2UY9A 2ZEWA 4GH4B 2OX0A 4QXCA 5FYIA 2J1RA 2ZGLA 4CDXC 3CJIC 1H8TB 1XNKA 1YFWA 1DGLA 2BGPA 3GZEA 4LQRA 4NN0A 5F5IA 3O12A 3AYEA 2VD7A 4BLJA 1QY4A 3AC0A 1ND2B 3ETQA 4XJWA 4DUVA 1J58A 4XAEA 2WO1A 4LE4A 2W08A 1RUF2 4OI4A 1ZZCA 5FY9A 1J1LA 4PJYA 4ATFA 5BNNC 4IE6A 4P9XA 3K77A 4BIFA 1RUNA 3IKWA 4QDSA 2PN5A 1U5ZA 1QNYA 1A8DA 1CVNA 1EUUA 3OGGA 4Y1XA 5A7WB 3U07A 5C8CC 2XHKA 4I3GA 4CDQB 3V0BA 3PU3A 2ZGSA 2WWSA 3GALA 3S7IA 1FAYA 5FOBB 2H0VA 3R4SA 4LKDA 1MACA 1TNFA 4NUBA 4RHV3 2IUWA 2WNOA 3P5BA 3K51A 4KI5M 5JMOA 4BE3A 4D8MA 2E31A 3UNPA 3LOBA 4Y33A 4ES8A 5FY7A 1STMA 4CDUB 5JXJA 2DFBA 4GA9A 1ZNPA 2VQ0A 2JDZA 2DCKA 4XOGA 1QEXA 3GCXA 5FLJA 3ZYFA 5JOZA 1ASJ3 4CEYA 1OKQA 2W39A 2ZHMA 3LCPA 5D1IA 1K5MB 3IAQA 3KGLA 2PHRA 4LBLA 1KS4A 4BQXA 1E5RA 2NYYA 3RRDA 4JX0A 5D21A 3VLBB 4WZFA 3KB5A 3PJYA 1O91A 2NLRA 5CU1A 1XNDA 4P5YA 3POIA 4H3WA 4JGZB 4P9WA 3UKVA 4AI1A 2Q1ZB 1F9KA 4LNVA 5FWJA 5ANQA 2EIEA 1K5JA 4JGYB 3U10A 4CXYA 5KHIA 2WWJA 4DXSA 4UW3A 4E4ZA 1XNCA 1YI7A 4DQAA 5CADA 1U5IA 1K12A 1DF0A 5DPNA 2D44A 3ZM8A 1IPJA 5FPAA 1W8UA 4MH0E 1NXD1 2WSVA 2VW0A 2A6YA 3M8LA 2E63A 4XFCA 4Z1VA 5DMYA 4QB2A 1AR83 1WCDJ 2VR4A 3ZIWA 3GNEA 3KQ4B 1QJU3 1ZRCA 3J26N 1D7PM 1C28A 4LBMA 4GXLA 4XZUG 1Y9MA 1PM7A 5C3QA 4Y1VA 1W04A 4RSUA 4XXPA 5DAPA 3OPZA 3ZYHA 1BKZA 3NNLA 3LIGA 1NQJA 2WNEA 4SLIA 3RS6A 3UT0A 4QGNA 4CYDA 4XUTA 1QJY3 2AEZA 4OLLA 4WVZA 1LHOA 2NMOA 1VBC2 3DKWA 5F5AA 2WS93 2AC1A 4CCLA 4FPYA 1VRH2 4HK8A 4XCBA 2FDKA 1I5ZA 2E6VA 2JDPA 1VBC1 5L73A 2NM1A 4YGBA 1RUD2 1SPPB 2GAUA 2HKXA 1UZ0A 5ACA3 4UFHA 3DF0A 3KWVA 1VRH1 5CB7A 4KMQA 1PO13 4S2GA 2JDNA 5BNQA 2ZGMA 1OVPA 1RUD1 1EYBA 4KGQA 2MEV1 3N7KA 5A7QA 5IK4A 3BIEA 1E57A 1HB4A 3B7MA 4EZHA 4CEWA 3QD6A 4XFIA 2D6KA 3D3AA 1OQDA 5FK8A 2P2KA 5DG1A 5LATA 4L9BA 1YHFA 4HLTA 5DAXA 3IPVB 1UZZA 4FP2A 1ZVFA 4YM1A 3SKVA 4AAPA 1JYNA 1DQ6A 1WW6A 3O0WA 2OW4A 5I0SA 1M4WA 4N43A 4XFGA 5FPVA 1VBD3 2EXHA 4IV3C 1V6KA 4K9SA 4K3UA 3SHRA 4YW7A 1BEV1 1ZZ8A 5FPUA 2BJSA 1NCQB 3G7DA 4R9CA 1O3SA 2J7MA 3RMXA 1TVGA 3I2FA 1NOVA 3MW2A 2A5ZA 1ENQA 3AZWA 1VE0A 2WYFA 1M06G 2BVVA 2XONA 3J7NA 1OBNA 3MDPA 4GALA 2VOWA 5B2GB 1W28A 1VBB2 1OT5A 1CAWB 2V72A 3MLLA 5KHKA 5M0TA 1MPXA 3FBYA 1R092 3FX3A 4FPEA 2VOVA 3DXUA 1PMJX 1VBB1 3UETA 3U78A 5FP8A 5DAWA 1H2MA 2I45A 2HEVF 3ZOIA 4DRRA 5CIRA 2KA3A 1XPWA 3P3NA 4LJHA 4JKLA 4XUOA 1JUIA 3AKQA 3OF1A 2ZABA 2HBUA 3K3OA 2WT2A 4RR3B 1DCSA 4FQZA 1BMV2 1OFNA 4G4FA 3RDIA 2X09A 2O8OA 1W2TA 2VNRA 1OH3A 2GMPA 2VPVA 2X5IC 4Y1UA 3VD4A 2YBKA 4D6SA 4P02B 3NKGA 1RUH1 3RYKA 1S0EA 1R1ZA 5L9BA 3RI8A 5JIUA 2WNVB 4RR3C 5FP9A 1I3HA 1Z7S2 5FUIA 4AQSA 3WDUA 2VUJA 1DBNA 2NMNA 4QHBA 1NX9A 3B3QE 4K6BA 4JDOA 3U0ZA 1Z7S1 3FUQA 3SH3A 4NMIA 2WJSA 4BH9A 5JPMB 2WQ8A 3ZYRA 1B35C 2W92A 1DZTA 4A6OA 4GJYA 2AREA 2CWMA 2D3SA 1OUXA 2EF6A 2ID4A 2WLQA 3IT8A 2R073 1YUDA 2VZPA 2JG8A 5FMOL 3HD8B 3VKOA 1OURA 1SMVA 4YZ3A 2D98A 3I2IA 1DU3D 4KWLA 2A6ZA 1CAVB 5J98B 1UMZA 2VOXA 1G9AA 3WDTA 2DVGA 3EB7A 3TNQA 2ZEXA 1NT0A 1JYXA 5TSWA 4QDQA 4LKFA 4COUA 1RUC2 4LOSA 1HB2A 5FZ9A 1RUOA 1YJKA 4GKYA 4LIVA 4FO9A 2DWRA 4DFSA 3AP7A 5C4WC 2A6VA 1HXS2 1XB9A 1YNAA 3TBDA 3VL8A 3ACGA 1RUC1 5K8SA 4RFRB 4Y20A 1VAVA 1U5YA 1AR62 1PVC2 2WZR3 1HXS1 1AHSA 3I59A 1QOOA 5LBEA 1XSQA 1JZ8A 2PELA 1AYN3 1AR61 2PAEA 1PVC1 2YC4A 2SLIA 1W03A 5F6LB 5E6HA 1EUTA 4I0BA 4AZZA 5A1AA 1JZ6A 2Q1MA 1FV2A 3E5XA 4WM8B 3FHAA 2JE8A 4LUKA 2XHNA 1ZA4A 1WW5A 4YG3A 1WUVA 1DGWX 1YLLA 2FDIA 5CNAA 4Z2WA 1AX1A 2QDNA 4O61A 1KGYA 1YCIA 4XJAA 1JOJA 2VG9A 4JRLA 1OPMA 2E32A 4GAZA 3VHNA 3W58A 2VZUA 5EPAA 1MZFA 4URAA 4Q8KA 4MVTA 1YFUA 4HPKA 5IATA 3P1IA 4KG8A 4JRAA 2HYXA 4F8AA 4XDQA 4BK4A 2VW1A 3K4ZA 1A8MA 3HQXA 1VAMA 3R0RA 4JKMA 4UF0A 4K8FA 2P3YA 3ZFGB 1NCRB 1PNFA 3ZXEA 1GZWA 3IMNA 1Y4WA 2Y6LA 3WW1A 3MBWA 4BYYA 2WO7A 4XMIA 1ENXA 3BB6A 1LNSA 2QDRA 4RS5B 2OQ7A 5I0UA 5IW0A 2BWAA 1H9WA 1D4VB 5L7OA 4XFFA 2R32A 4L2NA 2HWE3 4XXAA 4CDWB 1DYOA 1AR72 4A7YA 2CAVA 3POFA 3DL3A 1LKNA 4RQPA 2XJTA 4PDWC 2HWB2 4F83A 3G6JB 1CAXB 2FDJA 1AR71 2WR9A 1Z78A 2VVEA 1NA1B 3E1F1 1H4HA 5FZDA 2W1SA 3NRUA 1RUG3 4D94A 5E1RA 2HWB1 3FMGA 5EWSA 5KXDA 4ZU7A 2VUDA 1BK0A 1W6OB 2GN7A 2HWD2 1UOFA 5FMOS 1RJ7A 3H8OA 5G05L 1WLDA 4CU8A 1CAUA 4CEYC 1ZBE3 3C7OA 2BBVA 4AFMA 2HWD1 1C5HA 1APNA 1W0OA 2TUNA 2ZGPA 3N9NA 3GHNA 4BLIA 4DNYA 1PO23 3HNYM 4L99A 4WM7C 5ANNA 3ZXAC 4AE2A 3GF6A 5C5UA 5KC5A 5E88A 4AGVA 1UYPA 2YY1A 1G86A 3VZNA 4AW7A 1AYM2 2WS92 3WF4A 5JZGC 3B01A 4DMIA 3MFAA 5LWBA 1FX5A 4KWUA 5F7UA 2E51A 2CNAA 1GV9A 2V5YA 1PO12 4XF0A 1R1A2 3EBRA 1D2QA 2PQQA 3OBRA 1LU2A 5CKMA 1V70A 4M3CE 1ULPA 3WXPA 1GZTA 3O1TA 5KC6A 1R1A1 1ZZ6A 3LE0A 2BQPA 2B39A 2MNGA 3GBFA 1H2KA 4M01A 4WVMA 1IOAA 2D6LX 5FAXA 4IERA 4XJUA 3C8XA 3AM2A 4JTNA 3WF1A 1VBD2 4PLMA 4X8NA 4IEZA 4YGEA 1QMJA 2PLV3 3WV6A 3ZSEA 2WA3A 3EYPA 4GH4A 1SBEA 3OTFA 2WZPP 1F4HA 1H8TA 2JG9B 1FOD3 2W1QA 2Y34A 2ZAAA 4ARYA 4AVSA 4V2VA 1ZRDA 1ND2A 1X82A 1PMIA 5FYTA 1G7YA 3VHPA 5IFTA 2VCBA 3VDAA 3VUOA 3VBUC 2C0ZA 1UOBA 3THDA 1RMU2 1ZX5A 2PHUA 1PK6B 5F8PA 5A7WA 3AVRA 3ACLA 4BQYA 4IEVA 3H3UA 3M3IA 1UZVA 3JB8A 3UYJA 1XU1A 1RMU1 3POYA 3CDZB 1RVF3 3I7DA 4N7IA 4CDQA 5CEHA 4LKSA 4CEWC 4S2FA 3AMQA 3WNPA 2JDHA 3ACIA 1Y3TA 2AZ5A 2Z79A 2KD7A 4QPGC 1PZ8A 4CPBD 2W3JA 1PZ7A 2LS6A 3AL5A 4CDUA 5A6XA 4I01A 3LDRA 4IE5A 4N43C 2P37A 4BZ4A 4MGTA 2VUAA 2XOMA 4IDZA 3PURA 1SLCA 3I3QA 4MLOA 1OD3A 3B9IA 2ORZA 2VTXA 2VZRA 4HVRA 3VBOB 1UN1A 3I54A 4XUQA 2BNOA 2OS2A 4M4RA 1UY2A 3CLPA 1W3VA 1W0PA 1N3QA 4HSLA 4PF5A 3I4IA 3RJ2X 1K45A 4TLFA 1VIWB 1REFA 3MF6A 2ARXA 4CCEA 4E2GA 3RYRA 1CD3G 2D5FA 3AMNA 2ZZQA 3H8RA 4RYDA 5GLUA 5A7SA 3BU0A 5LEKA 4QB6A 4JGYA 5HV0A 1TG7A 2VO5A 4LHLA 4K7JA 4ZS2A 2JKBA 3I2OA 2WUHA 4LOTA 4FAGA 4YW1A 2HJIA 4URTA 4Q26A 1RUJ2 4R9DA 3ZKYA 1G9DA 4IL7A 2NN8A 1Q3EA 2A3XA 4LO6B 3ABZA 3F2ZA 1UOGA 1ULCA 3POJA 2VXRA 4CUAA 2IXHA 3UKTA 4QGLA 1YQ8A 3FFZA 4O65A 1F8VA 5JI7A 4QM8A 1CGPA 5JCTA 4I0WB 2VH9A 2GC0A 4NIIA 3M4FA 2CYFA 1GWLA 4IV1C 4AQTA 4QU2A 4WBBA 5FKCA 4AI9A 4AF9A 1JUHA 1AXZA 4ES9A 1G9BA 5DDJ2 1DQ1A 1S0IA 5DUXA 2C9KA 2KR2A 4I02A 3AJZA 2PHDA 3B5LB 1HJFA 1ULOA 4YZ4A 5DDJ1 2Y0OA 5FP4A 2VM9A 4EN8B 3NNGA 5A3WA 3ZFEB 3WCSA 1S0CA 4Q27A 1SPPA 3AP9A 2ZGQA 3NSTA 2P3JA 4PCRA 3VDDC 5HXMA 4IXLA 2XBO2 1LULA 3B00A 2FD8A 2JG8C 2VNOA 3DECA 3PHMA 1Q8QA 4QKFA 3SNMA 1HQLA 1HN0A 4Y5SA 5KXCA 2V4VA 4OULA 2XBO1 1A78A 3I2KA 1V6MA 2GN3A 3A7QA 3POGA 4XACA 2VAUA 5FIXA 3ZSKA 1FMD2 3N9LA 2DURA 3IPVA 1CONA 2DVBA 4FP3A 3B02A 1GR3A 1QHDA 4QQPA 1FMD1 5BV6A 4QMAA 1OQEA 3LGRA 1OHFA 4LA2A 3VBSB 4AI3A 5CFDB 4FOWA 4GKXA 4OHVA 2BERA 2UU8A 3ROUA 3RZMA 2WIIB 1O3RA 3GBGA 1RINA 1OPOA 1NCQA 1YYNA 1OFSA 2XWBB 2I2SA 1KDKA 4KU8A 4QXHA 5A32A 2QKDA 3NO8A 2B9VA 2QCSB 5FDBA 2FCUA 1W90A 2IXLA 3GZTB 3MLJA 1CAWA 5IVFA 3VKFC 3BVCA 1ULGA 2FCVA 4LLFA 4KBZA 4YZ1A 2R062 2ZEYA 3F95A 5DXDA 1GICA 1OSGA 3KSCA 5F3IA 1JOPA 4QX8A 1W0NA 2OZJA 3BCWA 4TLGA 5JDBA 4X8PA 2R061 3LOIA 4HONA 1WCUA 4UFKA 1NXMA 4QGMA 1HQWA 3PUSA 4KWKA 2RVAA 4RR3A 1BBT2 4C0HA 2CGOA 4IUGA 4Z8BA 5FZ3A 4NAMA 4FPOB 4L0PA 1W9YA 1NAEA 1VBC3 4YGDA 4ZKTB 1RYYA 2TBVA 1BBT1 4XUPA 3TEXA 5HPOA 1QU0A 1VRH3 2RR12 2VMIA 5GLTA 4ZHNA 3GJAA 2ZGRA 2GNDA 1RUD3 2WNVA 3H9AA 2MEV3 5L7OC 3ELNA 3FC0A 5JOWA 4UW4A 2XR4A 3KS7A 3H42B 2RR11 2Z42A 3JBG2 4XDPA 4AXOA 2R0FA 2CSGA 4RQPC 1CIYA 1JZ4A 3OGJA 4OQ8A 2DDUA 2D7FA 1JYCA 1C8NA 3JBG1
chains in the Genus database with same CATH topology
2ARBA 4DINB 1KJRA 3L2HA 2OIIA 2ZKNA 5GZGA 1NZCA 1BJQA 2DUQA 3ATGA 4IEWA 3NV4A 3BTAA 4YRDA 3VGIA 1ZREA 1OQ1A 3CO2A 1BEV3 4LO4B 3RYPA 1QJX2 4AYUA 1OOPB 3RI9A 1C1FA 1LHNA 3LSEA 4GWMA 4YFWA 1WMEA 1YO8A 2UWBA 5LK7B 3D0SA 5T52A 1UZYA 5J37A 1LCLA 3VKMA 1QJX1 4D7YA 4RFT0 1LOFC 2UYAA 3GYDA 4HANA 3MLKA 2ZGNA 2P17A 1VBB3 5K0UB 1QJZA 4KU7A 2D43A 1HIXA 3H3ZA 5LEJA 3ME2A 2ZMNA 4Y26A 2JXAA 1VR3A 3CU7A 3JD71 4WM8A 5T5OA 4Q4X2 5LRSA 2VMGA 4ITCA 3NAPA 2YC0A 3LSDA 1RUI2 4Q4X1 3RMYA 3ZN6A 1RUH3 1QWRA 4D3WA 2RMU2 1RUI1 1NY72 1SBDA 4XHXA 1MR5A 5FPZA 2E7AA 4BCUA 5F9TA 4GH4C 5EZWA 3ZFGA 1NCRA 1H8TC 1UCXA 1V6NA 2RMU1 5KXEA 1Z7S3 5EFUA 4Q4Y2 3Q9OA 1ND2C 2YMZA 2Q0AA 2VNGA 1VB4A 2DTWA 3EQEA 4RS5A 2Q8OA 3ZFFB 4QPYA 1TMF2 4Q4Y1 3AMPA 3H0OA 4CDWA 1ND3B 4N9IA 1TMF1 5LK5A 1ZYBA 4HL0A 3IDBB 4CDQC 1MZEA 2GSYA 1GKBA 4BMEA 1CAXA 2UWAA 3SH5A 2IXJA 1LHVA 1NA1A 5GKAC 3V65A 1CIWA 2B7YA 3ILFA 1PIV1 2ZZJA 2DUPA 3LA2A 5CBLA 1W6OA 4A2UA 1MS1A 3BU7A 1RUC3 2DVDA 4LBNA 1U0AA 4UXAA 3WQ0A 1HXS3 3ECQA 1XYOA 2ZX3A 4FOYA 4MYEA 4YG6A 1DFQA 4XMAA 1W6QB 1AR63 1PVC3 3HMYA 5BXXA 4Q0SA 2LM3A 1D0HA 4ISQA 2ENRA 2BEOA 1JTZX 2D97A 2ZAHA 4H7MA 4GB31 4YNIA 4LHKA 4JGYC 4W6WA 2LUWA 4KG0A 4MGKE 4TYSA 1DHKB 2XKPA 3SISA 1U12A 2RHPA 2BWCA 2EIGA 5FLIA 3RG0A 2RS52 2MHFA 2X29A 3VHOA 4YVWB 3S30A 2RS51 4AHZA 2XL7A 4HBNA 1PGSA 4I3PA 4EWEA 2PHWA 3VBHB 4HVQA 1V00A 3AK0A 2CGNA 3R4DB 4FT8A 1S0FA 4I2OA 3OBTA 2GC3A 1DGWA 1V9U2 2NPIA 3WP6A 3MPPG 3HAGA 2JG9A 1O3TA 5SV8A 1AR73 1V9U1 5F6KA 1PZ9A 2HWB3 3ZMNA 1JHNA 5BNPB 2VULA 4FQ4A 1CPNA 1VAKA 1PK6A 5J7MA 3AZXA 5BNNB 1QQP2 1JH5A 3VN4A 4A7ZA 4IQPA 2HWD3 2BNMA 2ZMKA 5H9RA 3AKPA 2ZGTA 5GZEA 5C8CB 4XETA 1O4ZA 1QQP1 3IWZA 4IEYA 3E6BA 3TN92 1DIWA 2DCZA 3AYAA 1KS5A 3HN1A 2R6QA 3KMHA 4Q1RA 3QH6A 2WLPA 2ZACA 3TN91 1XYPA 2BGCA 4LUMA 3VBOA 4YG0A 1AYM3 3VKNA 1JN2P 2E7TA 2VMHA 2NZ9A 4PIXA 5I8SA 3UJQA 1XQNA 2MEV2 4JQRA 5JOXA 1J3QA 1W6MA 3ZX7A 1QOTA 1XXNA 1HRI2 4XTMA 2A73B 1R1A3 1W2UA 4F7ZA 1YIFA 1LEMA 3RPQA 3N4MA 2WNUB 1HRI1 1GBGA 3NW4A 3NV2A 3ZYJB 3HWJA 1GZCA 1I9RA 2LTNA 2Q4SA 4YZ2A 1H1MA 4AVCA 1QF3A 5GM0A 4AGRA 3WP5A 3WHUA 5GZFA 4DB5A 1BEV2 4W6XA 4KNCA 2D3RA 2RJKA 4L11A 4Q0PA 3V0AB 2TEPA 1IGOA 1LHWA 1G9FA 1N47A 3D4KA 3ILNA 1SEFA 1VBE2 4RR3C 3VBFB 4ZU4A 3J8F1 4DPNA 2UY8A 4BHPA 1VBE1 1V6LA 4NHMA 2WNVC 1NLSA 4E4SA 2GNTA 2C1FA 1RMU3 3MIHA 1IKPA 1J3RA 5J48A 2EAAA 4XTPA 1A3KA 3L2YA 2DYCA 3ZFEA 1AL22 3BOWA 4IEXA 1O7FA 4HMZA 5FCCA 1AL21 4Y1ZA 4XF4A 4OI2A 3M7AA 1S0DA 1COV2 2R0HA 1RUH2 2GC1A 2JX9A 1MS4A 4TWTA 1SACA 1SCSA 2AH2A 2DFCA 1COV1 4NO4A 4E27A 5FOJB 4UW6A 4J1WA 1IKQA 2OYZA 5E89A 2IWGB 5K7PA 3I2DA 5AVPA 5CFDA 3VBSA 1QGLA 1YRZA 2WSUA 2BYVE 2DCYA 4IV3B 4NOTA 3MYXA 3H50A 3SH4A 1CJPA 4J6GA 1WD4A 4HSJA 4EN9B 2QQPA 3AZVA 3PMSA 1RUJ3 3DV8A 4TZDA 4WM8C 4UBGA 3JU9A 4GULA 4YW2A 2YGMA 4YVSA 1TME2 4IEPA 2DTYA 4XBNA 3DUIA 3NAPC 4M3CB 4XQWA 5KHHA 4MGZE 1TME1 1U5XA 1Y9QA 4Q1PA 5JR7B 4EWDA 4OI1A 1OLQA 4YLZA 1DQ5A 3N7MA 2XL9A 2JE7A 3PNAA 1NCRC 2R1BA 3VHRA 4B29A 1FYUA 4OUSA 1MS5A 5DDJ3 4HT1T 1AR91 4OFGA 2ZKLA 4I0AA 5J3UA 4GWNA 4AWDA 1HRV2 2CV6A 5IK7A 2DU1A 1UW8A 3O0XA 4COYA 2XWJB 1NE4A 4RS5C 1R081 5KXBA 2A7AA 1F31A 1HRV1 2QJVA 4DY3A 2DU0A 1WLWA 5A3LA 4CDWC 2XBO3 1BVVA 5EYXA 2AR6A 1LODA 3MW3A 2QZ2A 3QOPA 2ZA9A 1DG6A 1FI2A 1EV12 3M3EA 1NA1C 2IC1A 3THTA 3USUB 2K9ZA 1W6PB 4FPLA 4E2QA 1FMD3 1EV11 5T50A 3MICA 3DPRB 1B35B 1VJ2A 3EXUA 3FE5A 1N1TA 4C1XA 2PTMA 3MI8A 4H7LA 1DDLA 1LRHA 2OVUA 1RUE2 5BUVA 3T2TA 1OOPA 4LO8A 4B4RA 2R1DA 1CJDA 1KFUL 1RUE1 4CZSA 5FRAA 2QVSB 4RHV1 2ZX2A 4HN1A 3AKRA 1WMDA 2W68A 4BMBA 1H30A 5K0UA 3WQ7A 5BY5A 3A0KA 4HKLA 3ZXLA 3URFA 5C4WB 4B3NA 3ILRA 3ZIXA 2R063 1NYWA 4AEJA 4INDA 1KDMA 5JOYA 5CFCB 4NHLA 5HCBA 1ZRFA 2R16A 4OUMA 1EPWA 2QFEA 3WX5A 2B42B 3ZDSA 1ZZ7A 3ZXGA 3OD4A 4GMP3 4QPIB 4JTOA 1SLTA 2OZ6A 1KRIA 2YROA 1BBT3 1AX2A 3TNPB 4YW4A 4EROA 1MS3A 4C91A 3FZ3A 1DZRA 1Y43B 2PFWA 4QQ2A 2RR13 2CAUA 4FOVA 3JQXA 4Q4W2 3NJZA 2YGLA 1RB8G 2JG9C 1KD7A 1LOBA 5BPXA 5L19A 4XF9A 1WCKA 3JBG3 1LHUA 2I74A 2JE9A 4Q4W1 4TSVA 5H9PA 3AKSA 3ZFFA 2AENA 3ZSJA 1QJU1 1WW7A 1WBFA 5IK8A 5C9AB 2ET1A 1ND3A 4EN7B 3ALQA 3M1HA 4AEDB 4AK3A 1IS4A 2XJRA 5A33B 5J09A 2D6OX 1QKQA 3UK9A 4FCAA 4BWOA 4XBLA 5JWPA 5AC92 3SXWA 1QJX3 2XJPA 2YXSA 4PDWB 1KFXL 2EXKA 2IZWA 1N1SA 1CPMA 4Q29A 4HN0A 4AFBA 5AC91 4AQ6A 1Y7BA 4LBJA 3LKJA 2ZX1A 3VBOC 3WOGA 5ACA1 5ABJB 1KQRA 4OVEA 1SCRA 1SDWA 4R52A 3TB0A 3R05A 4XJ8A 5GZDA 1W6QA 3PLQA 4LLOA 3EHKA 2VVFA 3JD73 2E9QA 4WM7B 1GANA 2BVBA 3DGTA 4JVAA 5I0TA 5F5QA 1DGRA 1X8MA 1ZBA1 3MZHA 1YJLA 1IHMA 3LAGA 5IK5A 4Q4X3 1ALYA 4B7KA 4C0BA 3E5QA 1SFNA 4BPZA 5HCFA 4R8HA 1RUI3 1PHMA 2UWCA 1UD1A 4YVWA 1UKGA 4YYOA 2RMU3 3K48A 4XFBA 3NV1A 4OHYA 1K5MA 2JEMA 2FZ1A 3VBHA 1C4RA 3KT7A 2ZX4A 1HLCA 1N1YA 3O5SA 4AHYA 1MS8A 4Q4Y3 1RC6A 1ULFA 1UU6A 4AGGA 2PHLA 1JYIA 3BIWE 4JGZA 4MSVA 4B7EA 4DY5A 1TMF3 3QACA 3WP3A 1DGRN 4D69A 4AFDA 3VZLA 2Q30A 1PIV3 5DZFA 5BNPA 3WDXA 1FATA 4QQOA 3MPBA 3VBUB 2C9AA 5BNNA 3PVOA 2QNKA 3ES4A 3WW3A 1HX6A 2GDFA 1OMIA 5EXOA 4A3XA 3UV9A 1FPN1 2CWSA 4Y1YA 4LT5A 1AF9A 1J59A 1SFYA 4MUVA 3AXDA 4QPGB 5HBAA 3SCGA 3AYDA 4GB33 4OHZA 5KHJA 1O4TA 3RWNA 4E9KA 1V6JA 2ZTNA 4COZA 2ZBJA 1C3HA 1QNWA 1C57A 1ONAA 3FLRA 2ZJCA 5H9SA 1QDCA 1AZDA 3VV1A 1VBA2 1DYKA 2XLGA 4Q4V1 4LBQB 1D0GA 3V0BB 3RNSA 1MQTB 2RS53 1HV1A 3S6PA 3WVJA 1VBA1 2WNUA 3BPZA 4YVSC 4EWAA 2AUYA 1LEDA 4XJZA 4O9EA 1ZZ9A 3J4UH 1AVBA 1PGW1 2ZOEB 5AFEA 2WT0A 4E2SA 4HKOA 2Z5WA 1V9U3 4Z07A 5E16A 3VBFA 3VKLA 4Y5Z0 1UKRA 5JSRA 5J96B 3N7LA 3RJRA 4AHWA 5HI0A 5DZGA 1GQGA 4XFHA 4YZ5A 3ZSMA 2ET7A 4QX5A 1ZZBA 2E7QA 4IV1B 3WW4A 4Y24A 2ZX0A 4I30A 1QQP3 2XJVA 4F3JA 1MVEA 1XYNA 1RHI1 5FTTC 4QT6A 5FO9B 3UL2A 1S55A 1POV1 4MX3A 1POV0 3TN93 1DQ0A 4LO5B 2WKKA 3GHMA 4AHXA 3VDDB 2Z69A 2ETEA 2ILMA 2K2SA 1BYHA 1OOPC 1Q8OA 1I6XA 3VZOA 2XVLA 3THPA 2X8KA 1AJOA 3KCXA 2HEWF 2H0BA 2X53S 4ZU5A 4D7SA 2WFF2 2XJUA 5CAZA 2PA7A 3CJXA 3N3HA 1LOEA 2A3YA 1HRI3 3O14A 4K1YA 1OI6A 2WFF1 4IV3A 5K0UC 2DCJA 1HV0A 4PIYA 1LTEA 3M3CA 1MEC2 2BNNA 4NPRA 1TE1B 4LEJA 3WUCA 2K0GA 3FWEA 4WVWA 3HT2A 3LZZA 3M2MA 2GU9A 4AFCA 1MEC1 2VU9A 1KXGA 2Q5TA 1CAVA 1Q8VA 4DS0A 4E2GA 4M0HA 4MXWB 4CP0A 1SLLA 3JCIA 4FXKB 4OZXA 4XFAA 3J8F3 4M3CA 4HKWA 1QDOA 1N3OA 3I8TA 1VBE3 2NQYA 1LGBA 3S7EA 4KH9A 4E4DX 1H2NA 4HK9A 4NHKA 3SLIA 3NKTA 2Y0IA 2HWF2 3IIAA 1V6IA 3IDCB 4JV4A 3MFCA 4XBQA 2HWF1 3JD72 4LA3A 4Y22B 1F5FA 3ZFFC 2R042 4HVOA 3NL1A 2JECA 3INAA 4P9YA 1AL23 3FFQA 4EN0A 5CG9A 4QXKA 1CESA 1NLRA 2WA4A 1ND3C 2JD4A 2R041 4HFSA 5C33A 4RGAA 4JDNA 1COV3 4MGYE 3USUA 4FAHA 4META 1W6PA 4K20A 1O3QA 1QOSA 3DPRA 1X7NA 1B35A 5IUQA 4UW5A 4K40A 4AVTA 1IS3A 2ZPXA 2G9GA 3O0VA 1YI9A 3DN7A 4W6YA 1FT9A 2IXIA 3AP6A 5I91A 3AMHA 3TAYA 3UKNA 1H1IA 4PQ9A 3B69A 1O5LA 3D6EA 1TNRA 5KWRA 3N35A 4K1ZA 1DQ4A 5T54A 2GALA 4IEQA 4COVA 1C1LA 3IDEA 2DVAA 4XW3A 3ZYGA 4N53B 3ZYPA 4XHBA 1XE7A 5C4WA 1PIV2 1SLAA 4XZPA 1GYKA 1LESA 3POSA 2EXIA 1C5IA 4ASLA 5IT6A 4RL7A 1TME3 3WT3A 1X36A 3MEPA 5CFCA 4CDUC 3AKTA 3ZXJA 5JIAA 1Z0HA 1XE8A 1PVXA 1RTVA 5DG2A 3VBRB 2RM22 1S0BA 1CQ9A 5D8AB 1AR93 1O4YA 2CTVA 4QPIA 3WG4A 1K5MC 3WY6A 4AVVA 2VW2A 3VBHC 2RM21 3OYWB 1R083 4H14A 2V09A 4GB32 1HRV3 2A6WA 3ASIA 4Y4YA 2JENA 2GNMA 4JGZC 2OPKA 4HETA 4BIOA 1BK1A 3H7JA 2HWC1 2KXLA 3A4UA 4M00A 4R4ZA 1W6NB 1LECA 1G8WA 1ULEA 1EV13 2A75A 2RS12 5BNPC 3R6SA 2ZGUA 4M0NA 2W0XA 1F5JA 1YFXA 4JDMA 5BNOB 5C9AA 4LHNA 2RS11 4AEDA 5A33A 4NVPA 2XVGA 4V1PA 1X33A 1LOGA 3T1LA 1RUF1 2EA7A 1RUE3 2FMYA 4LE3A 2I07B 1Q43A 3O7OA 4PDWA 3OJBA 1RIRA 1QH6A 3FHIB 5F1RA 3V64A 1UPIA 1FNZA 2BFUS 1NG0A 2YPJA 2GZWA 5JAXA 3X29B 5JSPA 4J1XA 3FLTA 5CG8A 4P9GA 3WDWA 5ABJA 1YFYA 2G4IA 2WT1A 4ZXKA 4CDXB 3CJIB 3FLPA 1SQ4A 3H7YA 1GNZA 2XH6A 2YDEA 1OLRA 5FO8B 4ATEA 3IBMA 5T3NA 2GMMA 3N36A 4P9IA 2O0OA 4WM7A 5I0RA 5JI9A 4GIQA 4XQDA 4ISRA 4LTAA 4IESA 2GMEA 3VZKA 2VECA 2WNUC 2QE3A 2EALA 1DZQA 1MZ5A 3ZYIB 1I1EA 4A7KA 2DUOA 3E97A 3WDVA 4XYXA 2XLAA 1WLTA 5JZGB 3VL9A 2SBAA 3R4UA 2ZHNA 1ZRRA 3OD0A 5FQ0B 3GZUC 4S2DA 1CN1A 1HW5A 2B46X 3PVBB 2D5HA 4XQ4A 4AEMA 3BOPA 3VBFC 1NCQC 4Q4W3 3E6DA 3M3OA 2YZ4A 3KGZA 5GZCA 3AJYA 4ORFA 3POWA 3UJOA 2RE9A 2XJQA 1JW6A 2ZHKA 4FTEA 2PHTA 2N7GA 1YXWA 1N1VA 1S1AA 2DV9A 2GC2A 1URXA 2BTVC 3W59A 2EXJA 4LBOA 3SITA 5AC93 3VBUA 3J8F2 2PYTA 4PIZA 1IPKA 3JB4C 4IEUA 3ZVXA 4EV0A 1H8VA 3TOJA 3JQWA 4WZCA 4XILA 5GLZA 2GH2A 1QXPA 2PAMA 2A6XA 4BQ1A 3EO6A 4QQLA 1WCSA 2RS32 4R4XA 1XRUA 4QPGA 4FBFA 1PGL2 3VZMA 1ZBA3 1AXKA 2XUMA 2RS31 2B8MA 1PGL1 5FLHA 3LA7A 4RD7A 2YUEA 3CF6E 4FOQA 5AVAA 4AI8A 4LBQA 1GNHA 3GZAA 2B9UA 1MQTA 5A32B 3AZZA 3FUOA 1RITA 4YM3A 3AXEA 3OY8B 2B5HA 2Y26A 5KBFA 4R9BA 1ULDA 1AXYA 2HYKA 1EPZA 2KM2A 3GBWA 3NWKA 4RGGA 4P5HA 1R091 1C8M2 3MIEA 5JSOA 1MS9A 1C8M1 1BQPA 4SBVA 1BZWA 4Q2FA 4C1WA 3AP4A 5A3MA 1LENA 1EP0A 5SV5A 1H2LA 1AUYA 4OHWA 1MZ6A 1Q5OA 2D6PA 4B8EA 4IV1A 2H6BA 2ZMLA 1S0GA 2ERFA 2GNBA 4KGGA 4KL1A 3S0MA 4CRQA 4Q0UA 1BMV1 2C5DA 2IXKA 4G3YC 3WNXA 4U36A 3B93A 1FPN3 2D93A 1QH7A 1GFF2 2R49A 1EAH2 3H1MA 1AR92 3DPRC 4P14A 3MW4A 3ZFGC 3ZO0B 4DOUA 1EAH1 4QQHA 1R082 1LOAA 1GLHA 1MS0A 1UAIA 4Q4V3 3H1YA 4IETA 2XG3A 1D4M2 5GLWA 2X5IB 2IXCA 1DLLA 3MIFA 4FVVA 5LRRA 3PMEA 1VBA3 1VLNA 3A0NA 3EJKA 1D4M1 2VY0A 3RSJA 4XE9A 3MIDA 3KM5A 3AYCA 4Z82A 5CFCC 1HDKA 2EVXA 4Q0QA 1TEIA 3AP5A 4L92A 1IS5A 1V6OA 4AEKA 4MV2A 5EV7A 4MXWA 3BODA 4QPIC 3PVNA 3ZMOA 3LA3A 4RHV2 2FZ2A 4AI0A 1UU5A 4LR4A 1H4GA 3NAPB 1WW4A 1LR5A 5CVRA 3ZN6B 5T55A 4WV8A 4W65A 1ASJ2 4DRVA 3ZXDA 4FTBA 1H1AA 4XF3A 1J1TA 4FPCA 3JZVA 2O1QA 1YIPA 1T6GC 2HEYF 1AX0A 2GH8A 1L3JA 4YW5A 1LGCA 1RHI3 3NVCA 2P3IA 1ASJ1 1MVQA 4Y22A 4U2AA 2DF7A 1POV3 4AVBA 3TWIA 1KJLA 3U4XA 1NE6A 2BW8A 4EJRA 5C9AC 1HQNA 5K9YA 4AEDC 5KHGA 4IEOA 4OI0A 3KQRA 1D2SA 2OUHA 1Q56A 4COWA 1LU1A 2WQZC 2Z2SB 2UURA 4DXZA 1EY2A 2A71A 4YW3A 5AFBA 1JXNA 1OD5A 3WD5A 4DZGA 1AR82 2WFF3 3MGUA 1N3PA 2XKOA 1LJ7A 1QJU2 1S2KA 5ABJC 3JUUA 4XJ9A 1AR81 4NWVA 3PTYA 3CEWA 1LGNA 5GALA 4B4QA 1MEC3 1PK6C 5T5PA 2BPA2 2D6NA 4PLNA 1RL3A 4N53A 1O5UA 1LOFA 1QJY2 2YHJA 1JBCA 4GQ7A 2F4PA 4AVAA 1ZM1A 3B9CA 1GZ9A 1QJY1 1HKDA 1DQ2A 3KD4A 1AYM1 2WS91 4WVVA 3D8CA 2DVFA 3QCWA 4G9SB 5ACA2 3VBRA 4BA6A 3WQ1A 1B09A 1Q8PA 3TYJA 1BCXA 5D8AA 2TNFA 3PJQA 1PO11 5L36A 1QXRA 2HWF3 3OYWA 4CEYB 1UL9A 3SMHA 4H55A 2CL2A 3WG1A 4K21A 4NWWA 1ZBA2 2R30A 1LOCA 2JJ6A 2O8QA 2A70A 2R043 1H9PA 2ES3A 1WA4A 5GLVA 1VBD1 5JVVA 1SLIA 1W6NA 4PBOA 1IZ3A 3SCFA 1FV3A 1S0JA 3USSA 5C6CA 3WP4A 1VB2A 1AL0G 2FQPA 3KT1A 5BNOA 3AFGA 3OCPA 2PHXA 2UYBA 4FPFA 2OA2A 2XPJA 4C