2D6PA

Crystal structure of mouse galectin-9 n-terminal crd in complex with t-antigen
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
148
structure length
144
Chain Sequence
ALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords lectin, galactose binding, soluble 9
publication title Crystal Structure of the Galectin-9 N-terminal Carbohydrate Recognition Domain from Mus musculus Reveals the Basic Mechanism of Carbohydrate Recognition
pubmed doi rcsb
source organism Mus musculus
total genus 32
structure length 144
sequence length 148
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2d6pA00
2EXKA 3QLQA 5H9QA 1LTEA 2PHTA 3DUIA 2LALA 2NP0A 5LK5A 5T5PA 2W68A 4FPOB 4RA0A 5JOWA 2ZMLA 1AX2A 4FOWA 4FPJA 1AX0A 1HQWA 5GLVA 1A78A 3NV2A 1G86A 1G9FA 1S0BA 4XJAA 2A71A 2WJSA 1D0HA 4XBNA 1W6PB 5BYNA 1C57A 3GNEA 2UU8A 3AJYA 4JCKA 4PBPA 1UKGA 1W6QA 3ZSKA 3OBTA 1LOEA 1S0DA 4FP3A 4YM2A 4Q26A 1WD3A 3WUDA 1VIWB 1VAVA 2RHPA 4XJ9A 3PMEA 4FPCA 1ENSA 1PZ7A 1YRZA 4AGRA 4BMEA 2ZA9A 3AP7A 4XIKA 1W6OA 2A6ZA 1WW5A 2GMPA 1G9AA 3VV1A 5DZGA 1W0PA 1SCSA 1F5FA 2D43A 4UW6A 5GZGA 1YO8A 2A6XA 1Z78A 4AVVA 5DG1A 2A7AA 3Q9OA 2AUYA 1LOCA 2ENRA 3N7JA 3VUOA 2R49A 3O12A 1GNZA 3R4UA 3O5SA 1LOFC 1MR5A 2V73A 3AP5A 1GSLA 1LHVA 5GM0A 5L73A 4BPZA 2W39A 1SLIA 5IUQA 3RMXA 2VH9A 3WNXA 3MW4A 4DRVA 3C2UA 3AYDA 1CIWA 3V65A 2JE7A 1KITA 1Y7BA 4XXAA 4Q1RA 3M1HA 4U2AA 2R0HA 2GDFA 4XYXA 1LGBA 2CNAA 1WLCA 2UWBA 2ZHKA 4GWNA 3UJOA 4TZDA 5GJ6A 3RMYA 1W6MB 1S0GA 1D2SA 2CTVA 4PCRA 4FPGA 1N1TA 3AJZA 1H30A 1MS4A 1GICA 3ZXJA 3PVEA 4YG6A 2ZABA 4KBBA 1A3KA 1AXYA 4AGVA 4YLZA 2DVFA 2ZHMA 1DZQA 1R1ZA 2JJ6A 5JOXA 3AP9A 1IKPA 4LBMA 3WG4A 1JHNA 3BTAA 2A5ZA 1JYCA 4R9BA 4BQ1A 4Y22B 2D6NA 4F83A 1LHOA 3WG1A 3L2YA 3AK0A 3UK9A 3V64A 1N1YA 1AZDA 2AH2A 4XXPA 4DFSA 3T1LA 1X50A 2TEPA 3SNMA 1JN2P 5JVVA 1QDOA 2NN8A 4RL7A 1IKQA 3WDVA 2OW4A 3AX4A 4K21A 2DVAA 3O0WA 1CJPA 2A3YA 2D3SA 1BJQA 2D6KA 2GN7A 4ITCA 4YW2A 1URXA 1ENQA 2P2KA 1LULA 3B69A 4JC1A 4AYUA 1DQ5A 1DQ6A 4M00A 3VKLA 3SITA 1CONA 3V0BB 4WZFA 1IS3A 3WG3A 4Y22A 1B09A 3PVOA 1H9WA 4LBJA 1VAMA 4D69A 1I3HA 1F31A 4FPLA 2LTNA 2ZGKA 1QMJA 2EF6A 2WKKA 4BLIA 2Q5TA 4FQZA 1KQRA 1U0AA 1ONAA 4Y1VA 5DXDA 3AP6A 2DU0A 2GNMA 4XJWA 4K20A 2PHFA 5JMCA 4XJUA 3GALA 3ZYPA 3V0AB 1SLAA 4LBNA 5CA6A 3FUOA 4K1ZA 1AF9A 1CPMA 2D3RA 3ZSMA 1HDKA 2YXSA 4OZXA 4YFWA 1JXNA 3HMYA 1WBFA 2VU9A 1OQ1A 3FLPA 3MW2A 3PVNA 4Y1ZA 3M3QA 1OKQA 3OYWA 5E8AA 4YZ5A 1EPWA 3B01A 5KXEA 5HCAA 1ULCA 1SBEA 1ZM1A 1PZ9A 3ZPYA 1CPNA 3AXEA 1V00A 1ZA4A 5CBLA 5GZFA 2CWMA 2PHRA 3KQRA 2SBAA 5IK4A 1W6QB 2AENA 2ZHLA 1JUIA 2VW0A 3H0OA 5DUUA 1GZ9A 3OY8A 1LODA 4U36A 1UZZA 2A6YA 2ZACA 1YYNA 2GNBA 1JYIA 3HR9A 1DIWA 1GYKA 5T5OA 1LECA 2P34A 2AYHA 2WT2A 1W6OB 4MYEA 1QKQA 2WSUA 3RSJA 2ZBJA 1SLBA 4WVVA 3U4XA 4YG3A 1G9BA 3TAYA 2UWAA 3ASIA 4BLJA 2EXHA 1MZ6A 5EXOA 4HL0A 2A75A 3O0VA 4R9AA 3N7KA 1N1SA 3AP4A 4Y24A 1KRIA 4P9XA 2DTYA 1LOBA 1LGCA 3D5OA 5GZCA 1G9CA 4YW3A 1QOSA 1LOFA 4XIOA 5F9TA 3NV1A 2ERFA 1KDMA 2AGSA 3M3OA 4DRRA 1FATA 2W52A 4Q8KA 3WDWA 4XOGA 2C5DA 2DURA 4WV8A 5T54A 4XTMA 5CB7A 1G9DA 2DUOA 4UW3A 1DFQA 1DYKA 2R1DA 3FLTA 1TEIA 1N3OA 1LEDA 4P9WA 1V6KA 4GA9A 4CZSA 5T55A 4NO4A 3AZVA 4LBLA 4ZXKA 5F5QA 3VKMA 4YG0A 5GLZA 2D6OX 5AVAA 1IS4A 3NV4A 2NYYA 5DUVA 3MEPA 1C1LA 3NV3A 1GV9A 3RQ0A 1MS9A 1V6JA 5T50A 2H0BA 1LHNA 3WZ1A 1LCLA 2ZMNA 3ILRA 4R9DA 1YIFA 4LBQA 2R0FA 4Q27A 1BZWA 3T2TA 1Q8PA 2G4IA 4HANA 3AYEA 4FPFA 2ZGQA 5JOZA 2DTWA 1MVQA 4M3CB 5IT6A 1RIRA 5T52A 3HN1A 4FOYA 2NM1A 3ZVXA 1WLWA 3WDYA 3WUCA 5IK7A 1O4ZA 2P37A 1GZWB 4YM1A 4GALA 1S0IA 1SLLA 2DUPA 1ULEA 1BYHA 4XZPA 2D6MA 4M3CF 2CY6A 3WLUA 5JLVA 2D6LX 4ATEA 4GKXA 3AZZA 5E89A 4Y1YA 1DLLA 1UL9A 3WV6A 3N35A 4K1YA 1IS5A 1WW7A 1BKZA 2ZHNA 1V6OA 2ZGUA 4FVVA 1DQ0A 1SFYA 2YROA 3A0NA 1WW4A 3AYAA 3IN9A 2C9AA 4M3CA 4GXLA 2E51A 1DQ2A 1FV2A 2AREA 4FPHA 4M3CE 3R4SA 5H9RA 3AZWA 1LOGA 4JRAA 2GN3A 1GZWA 1QU0A 2B7YA 2OUHA 4YGBA 1LOAA 1QNYA 3IMNA 3SISA 3IM0A 3WDUA 1Z0HA 3AZYA 1MS3A 2XG3A 5T5LA 3UJQA 2FHRA 1AJOA 2EALA 5CAZA 2ZKNA 3R05A 4L8QA 5HCFA 1ULDA 2GALA 4DQAA 3IPVA 1FV3A 4YM0A 2A6VA 3OYWB 3OBRA 3IKWA 3PJQA 1KDKA 4NOTA 2JD4A 3USUB 2WT0A 4Y20B 2GMMA 3VKOA 1PZ8A 5DZFA 2ZGOA 5IK8A 1CVNA 3I8TA 3ZXEA 1C1FA 3N7LA 1W6NB 1QDCA 1N3QA 3OY8B 5KXCA 4UW5A 3KM5A 3M3EA 1YI7A 2A6WA 2VW2A 2R1BA 1KJLA 2D7FA 5FREA 1NLSA 1N47A 3ENRA 2ES3A 3JU9A 1DGLA 2EAKA 2WQZC 4CTEA 5JOYA 1S0EA 1XQNA 1SCRA 3USUA 2SLIA 1Q8OA 4Y20A 2P3KA 2DUQA 5T5JA 4UW4A 4XDQA 1DBNA 2YZ4A 5HCBA 2ZGRA 1MS5A 1G8WA 2EIGA 1W6NA 3SH5A 2CL2A 3B9CA 2NMOA 3VKNA 4ZKTB 4I30A 4Q1PA 4YFZA 3JUUA 4DS0A 2DVGA 2PHWA 1J1TA 4YW4A 1BQPA 3POWA 4FOQA 3B3QE 1LENA 4XHXA 1S1AA 5GZDA 1DQ4A 2V5YA 2DWRA 5SV8A 2E6VA 1HLCA 4Z8BA 2CYFA 2FMDA 1UX6A 4PQ9A 5KXDA 1S0JA 2ZAAA 3FBYA 4SLIA 2ZGLA 2VUAA 3MW3A 1GLHA 1WBLA 4GWMA 3NWKA 5H9SA 3WHTA 4AVTA 3N36A 1GBGA 1IOAA 1V6IA 1C4RA 3VKFC 1APNA 4XILA 1HKDA 2GNTA 2A70A 1LJ7A 2W08A 3WCSA 1GZCA 1LESA 3AXDA 1LHUA 2YV8A 4LBQB 2JKBA 1N1VA 2VY0A 1AVBA 4XMIA 1S0CA 1S0FA 1WD4A 4Y1UA 4PBOA 2ZGTA 3ZSJA 1UN1A 4H55A 2BQPA 4BM8A 4FPKA 1SLTA 2ARXA 1NXD1 3FUQA 1MACA 2JE9A 1MS0A 4XJ8A 2EXJA 2ZMKA 4YW5A 3TB0A 2DVDA 1ULGA 2PELA 1FYUA 2E7TA 1RITA 3WDTA 1DQ1A 3AYCA 4BMBA 4LBKA 1BXHA 1AXKA 1LEMA 3I4IA 4BOWA 3POSA 4ASMB 1F9KA 5GLWA 4YGDA 4YW1A 3INAA 2VXRA 1VLNA 1AXZA 1CESA 1MZ5A 2D3PA 3OJBA 2EXIA 4FPYA 1YXWA 4Y1XA 1FNZA 1W6PA 1DYPA 1IS6A 1SLCA 3M2MA 4ISRA 1G7YA 1OFSA 1UAIA 4Y26A 4Q8LA 5GLTA 4YZ1A 4PF5A 5DUXA 5E88A 1LU2A 1N3PA 1GKBA 3CNAA 4FP2A 5H9PA 4AGGA 1MS8A 1QOTA 3ILNA 3ZSLA 4XE9A 1FNYA 3IPVB 1MS1A 1AX1A 1FAYA 1Q8SA 1ULFA 2ZGMA 2WT1A 3AFKA 2A3XA 3LCPA 3OGGA 2P3JA 1CQ9A 5KXBA 2GNDA 2ZGNA 3WDXA 4AWDA 1UMZA 5EWSA 2GMEA 2VW1A 3UL2A 1Q8QA 2YY1A 3OPZA 1O4YA 1SBFA 3A0KA 4YGEA 3ZXKA 2R16A 5DG2A 2OVUA 2NMNA 4WVWA 1WUVA 1V6MA 4P9YA 3ZYRA 1GNHA 1AJKA 4FOVA 1A8DA 1MVEA 2P3IA 3BOPA 1ENRA 2XB6C 2Z42A 2YMZA 4GKYA 3QCWA 4P14A 2D44A 4YZ3A 4XBLA 1WCSA 2AR6A 2DU1A 3BIWE 4XJZA 5GZEA 1W6MA 2UURA 3N7MA 3RG0A 3DGTA 1JBCA 4IQPA 3WG2A 1I1EA 2DV9A 1RINA 3SH3A 1CR7A 2D6PA 1GANA 2E7QA 2WNEA 1LGNA 4R9CA 2CWSA 3ZXLA 1QOOA 2E53A 4W65A 5DUWA 2NZ9A 3AZXA 3WVJA 3WOGA 4XHBA 1WLDA 4TYSA 2HYKA 2PHUA 1W0OA 1VALA 2WLQA 4FQ4A 3SH4A 3W59A 4YM3A 3WCRA 4YZ4A 3ATGA 3FFZA 1SACA 3W58A 1LHWA 2PHXA 2UWCA 4XBQA 2ARBA 3ZXFA 4DPNA 2ZGSA 1SBDA 1QF3A 4XTPA 3BODA 1KJRA 5CNAA 1V6NA 5FRAA 3LSEA 1LU1A 3D6EA 3MPPG 1QGLA 4M01A 4Q2FA 4AVSA 2DYCA 1CN1A 3FLRA 3SLIA 3V0BA 3B00A 5DZEA 4ATFA 1H9PA 2OUJA 1FX5A 3WHUA 3ILFA 4YGCA 1V6LA 5IK5A 2KM2A 2A3WA 3LSDA 1DHKB 4FPEA 5EYYA 4XMAA 5GALA 5GLUA 4LBQD 3T1MA 1WW6A 1Q8VA 3M3CA 3O0XA 2ZZJA 3D4KA 3POYA 4CRQA 1QNWA 5EYXA 3A4UA 3RS6A 4C1WA 2DVBA 1JW6A 4LBOA 2WSVA 1Q56A 2JDZA 1UPSA 3APBA 4C1XA 5JDBA 3V0AA 2I2SA 3N3HA 3RRDA 1HQLA 2ZGPA 4ISQA 2JECA 1UZYA 4YZ2A 1JOJA
chains in the Genus database with same CATH superfamily
1XU1A 3SQOA 5KHJA 4WVZA 2F6BA 2EIDA 2JG9A 4JTOA 5JOWA 1AX2A 5A1FA 5FPAA 1AX0A 5GLVA 2XWBB 3NV2A 1G86A 1G9FA 4XJAA 3K4DA 2A71A 3O1RA 1KEXA 4HK8A 1W6PB 3AC0A 2ARCA 5LA9A 1LNSA 3DXUA 1C57A 3MIDA 2WS93 3AJYA 4ZS2A 5LW9A 4PBPA 1O3QA 1LOEA 5I8YA 1UZVA 4YM2A 3WUDA 1VAVA 2ZPXA 1POV0 3ZXGA 1PMJX 4FPCA 4P08A 3LDKA 1UU6A 4TLGA 5ACA1 1RUF1 3AP7A 2A6ZA 2GMPA 3OUIA 4LHSA 4XIKA 4OYUA 4CCLA 1COV1 1OA2A 3VV1A 4S2DA 3T08A 4A6OA 1YQCA 1F5FA 3C8XA 4DUXA 3A23A 5GZGA 4DEVA 5JXIA 4HPKB 1PK6B 1SQ4A 1US3A 2W2IA 2A7AA 5DG1A 4ZZ5A 1QY4A 2JEMA 4AFMA 4RR3B 2ENRA 2R071 5FP4A 3KV5A 4BK5A 3MI8A 3O12A 3NO8A 3NNGA 1UYXA 3SCHA 5EZWA 1LOFC 3KHCA 4KG8A 4FFIA 3UT0A 3SEEA 3RMXA 2J1EA 2VH9A 2GH8A 4KGQA 3AYDA 1CIWA 1FXZA 3CIHA 1W0NA 4Q1RA 3THCA 4FFHA 1VPHA 3E5UA 1W03A 3OB8A 3ZR5A 5J7MA 2Q8EA 2Q4SA 2GDFA 1W8UA 3I2KA 4P9LA 4BQ3A 1WLCA 1IGOA 4TZDA 4IE0A 2AEZA 3ALQA 2RS12 4PQQA 3TWIA 3ZSEA 2PN5A 1MS4A 1GICA 2HEYF 4UFJA 1AXYA 1UY3A 2Y6FA 1H1AA 1U5ZA 5FPLA 3ZIXA 1DZQA 1R1ZA 2JJ6A 1XU2A 3JD71 1PGSA 4IV1C 3ZYFA 4OMCA 1JHNA 1RUJ1 5DDJ3 5J48A 1NCRA 3BVCA 4I2OA 3NKGA 3DYOA 4Y22B 3GCXA 3AKSA 3L2YA 3AK0A 1D4M2 2G9GA 1BEV1 2AH2A 2PQSA 4DFSA 2ORXA 1QDOA 5EFUA 1MZEA 1UU5A 1RC6A 3LAGA 4JGYA 2ZAHA 3WDVA 1XBFA 4K21A 2WZR3 1XNBA 4F3JA 4OCTA 5EIYB 4Y4YA 4XABA 1BBT2 3ZR6A 4DNYA 5L7OC 1ENQA 4QQ2A 1LULA 2WAOA 5IVVA 1VMJA 1AR73 1DQ5A 4OLLA 1OF4A 3SITA 1CONA 1RUD3 3ZMNA 2RS53 4QQLA 1CGPA 1SFNA 3PVOA 1H9WA 1HX6A 5FBJA 4ZU4A 4RGAA 1XE8A 4WM8B 4AOCA 2ZGKA 4MHRA 2Q0AA 5FZCA 1IG3A 5LBEA 2QUOA 5LA2A 5HI0A 3JBG1 3GCWA 4Y1VA 1H8TC 2JDPA 3KMHA 2B42B 1ACCA 2FDHA 2PHFA 5JMCA 4JQTA 1OOPB 4OHZA 3ROUA 4AEJA 4QPIC 4W4ZA 1CPMA 1AR62 2OZJA 2QFEA 4YFWA 4GJYA 1T6GC 4A4AA 3MW2A 1SHWB 1OQ1A 4OFGA 2XHKA 1OKQA 2Z79A 4FT8A 1C8M2 1FMD3 1EPWA 5FZOB 4YZ5A 3ZFEB 4HLTA 5KXEA 1PGL2 3C7FA 1KS4A 3D82A 1CPNA 2VNRA 4XQWA 4I0AA 4CEWA 5GZFA 4D94A 3NRUA 3LA2A 5AC92 2C1FA 1QJX2 2AENA 2WNVC 1TVGA 2J1AA 2VVDA 1S2BA 1DZRA 2IXHA 4NN0A 1O3RA 2VOKA 4GZ9A 5FY8A 3I3BA 2RS33 4NROA 1ND3C 3J7NA 1JYIA 4AHXA 4IE6A 4IE4A 1DIWA 4BQWA 4NIHA 1OF3A 4PJYA 2P34A 2E32A 1QKQA 2WO1A 2WSUA 3I3DA 2VMHA 4S2FA 2E9QA 4M4RA 4ZZ8A 4TTGA 4IV3A 4Y3OA 4WVVA 3CU7A 1G9BA 2X09A 3MYXA 4B8EA 4BLJA 4AI9A 3TN93 3R6SA 3UGGA 3P3NA 4HL0A 3MV11 3N7KA 1N1SA 5B4NA 4AQ6A 3BPZA 3W21A 3IDCB 3J4UH 4UF0B 3FBMA 5F9TA 1JZ3A 1F4AA 4IEYA 2GC1A 4NE9A 4Q8KA 5DPNA 4PI2A 5CB7A 3NJVA 5IVCA 2VPVA 1DFQA 1HRV3 4QX0A 1X9TA 1TEIA 2VZPA 3POJA 4CP0A 1V6KA 4GA9A 4CZSA 2VNOA 1O5UA 5A7WB 2WYSA 2D6OX 1US2A 1IS4A 1H6XA 3NV4A 5DUVA 3NV3A 5AVAA 4EN8B 2ATFA 5KHIA 2RR11 3PU3A 1VBE2 4QB2A 2ZEYA 4MGZE 1C28A 3WZ1A 3MIHA 3OBZA 2ZMNA 5FYTA 3ILRA 1YIFA 4LBQA 5FZKA 2R0FA 3UKVA 2ZGQA 3JXSA 4KWLA 3KVBA 4M3CB 5IT6A 3ZVXA 1QXPA 3HN1A 2NM1A 4MADA 1R092 4OI4A 1H1MA 1O4ZA 4QQPA 1GZWB 2VOXA 2XBO3 3C7GA 4FO9A 3FJSA 4KWJA 4L9BA 4HG6B 4AEMA 2DUPA 4XUOA 3WD5A 1ALYA 4M3CF 5JLVA 2D6LX 1S55A 2BBAA 5D8AC 5FP7A 3AZZA 5E89A 3URFA 3I49A 2Q1ZB 2XQXA 2DCZA 1PO21 4K6BA 5IHRA 4NMIA 1TG7A 3LQCA 3W20A 4LUMA 4RQPC 1FPN2 5L36A 4FVVA 5FZ8A 1J84A 1CAVA 4W6WA 1KD7A 4AI2A 2YROA 4FAGA 2P4EA 3VDBA 3J8F2 3AYAA 2C9AA 3LA7A 1DQ2A 2AREA 1W2OA 4Q0SA 5FPXA 4OHXA 2YC2A 1R093 2VZUA 5C8CC 4XFCA 4YGBA 4LO6B 1XE7A 4PLOA 2K2SA 2B9UA 4H7MA 4IGOA 5CISA 3WDUA 4EJRA 5C4WA 1STMA 2R6QA 1MS3A 4E8DA 4COZA 2RDQA 3NW4A 1LAJA 5CAZA 2ZKNA 4L8QA 1EPZA 2YYOA 3PUSA 5HBAA 1ND2A 3LOBA 3P3PA 5CFDC 2XKOA 5CKMA 4P00B 3IPVA 3H8RA 3SHRA 1OC1A 3IKWA 3S30A 5FZLA 2PLV1 3USUB 2Y6HA 2C9KA 1RHI2 4Q4W1 2GMMA 3VLBB 1RGSA 3VBUC 5IK8A 1CVNA 4P5YA 2RJLA 4LR4A 4NAOA 2E7AA 4ZPIA 4ARXA 5ERLA 5FO9B 3IIAA 5A1AA 1QDCA 2ZX4A 4NUBA 1X9PA 4UW5A 1LR5A 3U0ZA 1CZVA 1RL3A 1VBB2 3M3EA 4JVAA 1ZBA1 2WYFA 1NLSA 1N47A 1UO9A 2JDAA 4AEDA 4BIFA 4H7LA 4N9IA 1AYN1 5JOYA 3ZPOA 3QD6A 1S0EA 2IXLA 4NJ4A 3RZGA 4FTBA 4YARA 4N53C 2OXBA 3L2HA 2SLIA 3ME2A 4MO3M 2VOTA 5BNOA 3HBKA 3PNAA 1RUF2 3O14A 5T5JA 4UW4A 5F7UA 2YZ4A 2VCMA 2ZGRA 1G8WA 1QJU1 1VJ2A 3DPRB 5JZGA 1RUH3 3M70A 2CL2A 3THDA 2QDNA 3VKNA 5FQ0B 5G04L 1SMVA 1PNFA 2R041 3LD8A 3PMSA 1BQPA 2QVSB 4Y4RA 4HVRA 4LT5A 4XHXA 3B3QE 3WNPA 1J58A 1FOD1 4FFFA 5BNPA 1PO11 3ETPA 4LXLA 4META 5GZDA 2DWRA 5SV8A 5C9AA 5JIUA 1CAUA 2CYFA 2I07B 3GHMA 4QQOA 3ZM8A 4W6YA 3NJXA 1JYWA 2ZX3A 2FMYA 3H8XA 3A7QA 1K12A 1IHMA 5H9SA 1HXS2 2VQ0A 3VL9A 1V6IA 2HWD3 4A7YA 2BOJA 4TXWA 4Q4V3 2EICA 4XVHA 1HKDA 3BYWA 1Y9GA 4RFT0 4S2HA 5C33A 3KT7A 5BNPC 1W8NA 3WP4A 3KCYA 5B4XA 5FR3A 1WZXA 1N1VA 2XHNA 1YFWA 4IV1B 1PIV3 2D97A 3JD72 1UY4A 3RNSA 3T09A 1UN1A 1VBD2 4BM8A 4QPYA 2C0ZA 5FDBA 2CDOA 3WW3A 2VZ1A 4F8AA 1BEV2 1XNAA 4LITA 4GWIA 2JE9A 2VULA 2Y6KA 3RYKA 3HQRA 2J1UA 5F3IA 4Z92B 4YW5A 3TB0A 1I6XA 2DVDA 2PELA 1FYUA 4HSLA 4E4ZA 1QJEA 3C3VA 1RITA 1AL21 1F4HA 3PTRB 4KL1A 4BMBA 1NCQA 1LEMA 4RS5C 2CHHA 2R7EB 5GLWA 1IPJA 2WS91 3HT1A 3OSDA 1CESA 2YDEA 3ETQA 2V72A 3OJBA 4QGLA 4ASKA 1W6PA 1DYPA 1IS6A 3K4AA 2BPA2 2HJIA 2BBVA 2JENA 4ISRA 1G7YA 1OFSA 5FZHA 4Q8LA 1NLRA 3POBA 5DUXA 4CEYB 5JSOA 4NR1A 1N3PA 1GKBA 1H8TB 1NZIA 1REEA 4FP2A 5CIRA 1JTZX 1MS8A 1JH5A 2MEV3 3DXTA 3JBG2 4R4XA 5DMYA 3ZSLA 3AMHA 3B02A 4OI1A 4FAHA 4XACA 3SC7X 2ZGMA 4RYDA 3AFKA 4SLIA 3DL3A 3WW2A 1HB3A 3B94A 4HPKA 5C7GA 3WDXA 4GIQA 4QMAA 4RR3A 5EWSA 2GMEA 2VW1A 5C3RA 1CAWB 2VZQA 1Q8QA 3OPZA 4EZHA 3A0KA 3H3UA 2WNVB 2R16A 3JCIA 4OI2A 3ZFGB 4I02A 4PIYA 5FJHA 3TBDA 3D8CA 1RUG2 4P9IA 3LFIA 1GWLA 1ND3B 4P9YA 2EIEA 3H42B 2WZPP 1PK6C 1A8DA 2G1MA 4QX1A 2Z42A 3Q8FA 4GKYA 3EMRA 5F3EA 3ZXAC 5LRSA 1QH7A 2XXZA 3BIWE 3MIEA 4XBLA 3I2JA 4XJZA 5GZEA 2WAAA 1WWYA 3OGVA 3E5QA 4QD2A 5DDJ1 2JDHA 2PAMA 2QDRA 3DGTA 1E5IA 1ENXA 1U5XA 3SH3A 3BTXA 3AKRA 2WDBA 5A3WA 2WNEA 3FWEA 2RMU3 2BRTA 2YUEA 1DZTA 4XUQA 4W65A 2VCBA 4HN0A 1Z7S2 3AZXA 1ZRIA 4IE7A 5K4LA 1RUG3 4LHNA 4X8NA 4XHBA 4TYSA 2YBPA 1W8WA 5KHKA 2RS11 2WZR1 5FXVA 1CZSA 1L7LA 2HWF2 2VZTA 3S5QA 2HKXA 3W58A 2UWCA 3RJRA 1PX4A 4P9GA 4EQVA 4EROA 4JGZB 2ARBA 3ZXFA 5AFBA 5FMBA 1AR82 2ZGSA 5F2WA 4DPNA 1RXGA 3FC0A 3MFCA 1KJRA 4XTPA 1V6NA 2X5IA 3HWJA 3LSEA 3WQBA 1D4M1 2W1QA 4DOUA 1QGLA 2CU5A 4MGYE 4AVSA 2DYCA 3TYJA 4AK3A 5DZEA 2VZ3A 4JQRA 4QT6A 3I3QA 1ZRCA 5IK5A 4WM8A 1DHKB 5EYYA 2Y0OA 5GALA 5GLUA 1WW6A 1Q8VA 3O0XA 3D4KA 2JIJA 2Y0IA 2WABA 3VD4A 2OA2A 2QZ2A 4LBOA 1H1IA 3GF6A 4LPLA 4DINB 5HV4A 5FIXA 1UW8A 1Y43B 2VUDA 5JDBA 1YQ5A 3NSTA 1VBA3 2AZ5A 4ISQA 1K45A 1FMD1 4UW3A 5FMOL 1HJGA 5D8AB 5H9QA 4J6GA 5JXJA 1ZZ7A 1VAKA 5FWJA 4CCDA 3DUIA 2LALA 4JRLA 4LA2A 1OA3A 4QM8A 4IGPA 3WF1A 3F2ZA 4FOWA 3UYJA 2WIIB 4RQPB 3S5AA 3WQ7A 5I93A 5FZOA 4EE2A 2HWE2 1W2AX 2BEOA 4MZUA 3UGHA 3VBFB 2YPDA 3CMGA 3ZFEA 1D0HA 2RS31 5DAQA 1OOPC 1XC6A 1AR61 5A3TA 3LDBA 1OVSA 5FY5A 4UBGA 1YEWA 1VRBA 3OBTA 4Q29A 4QGNA 2VNGA 1RXFA 2BP6A 1VIWB 3LWCA 4Q4Y2 4RN5A 4EN0A 2VBDA 2RVAA 3U10A 1C8M1 2VUCA 1ENSA 4BMEA 4F7ZA 1PGL1 1W05A 5IWFA 2QQIA 2ZA9A 3ZFEC 3WINE 2XL7A 3VBOC 1ULPA 3E5XA 5AC91 5CFDB 1TME3 1QJX1 2D43A 4BJ0A 1YO8A 2A6XA 1Z78A 2I45A 4QKDA 5DAVA 1DF0A 3Q9OA 1SDWA 1W8ZA 3VZMA 5CYYA 3VBUB 4UFMA 4Q4W2 5K7PA 5A1LA 1WKYA 5GM0A 1MR5A 3AP5A 2Q8OA 4CCKA 4BU2A 2W39A 2YFUA 4O7XA 1RUE3 5IUQA 3VBSC 3BKZA 4QKFA 2H0VA 1VBC2 4O9EA 4IEQA 5F5AA 4UF0A 2FZ2A 4ZY9A 3GGLA 4XXAA 1HRV1 3OGRA 3M1HA 3ZFFB 5K0UC 4IESA 4XETA 1J3PA 2B45X 1LGBA 3KF3A 2CNAA 5GJ6A 1AYN2 2CGPA 4UFLA 4N53B 2NLRA 1W6MB 3GZUC 3RMYA 1JHJA 1V9U2 1UKRA 1VR3A 3FN9A 4NHXA 3AJZA 4NPMA 4DIQA 4K40A 5IW0A 3ZXJA 4Q5OA 4YG6A 3LFMA 5A7WA 4A2UA 1A3KA 4AGVA 2DVFA 2Y64A 3CO2A 3FHQA 3RJ2X 4CCNA 5JOXA 4WM7C 3WG4A 3BTAA 1HB4A 4QXBA 3LEMA 1NOVA 2OS2A 2BZDA 4LO8A 3WG1A 2B46X 3UK9A 4XF3A 1DG6A 1YQ6A 2EIBA 1AZDA 2VMIA 4XXPA 2FDJA 1X50A 1AR92 1FOD2 5JVVA 1ASJ3 2D98A 3K2OA 4CPBD 2NN8A 3ST7A 4AI0A 4HKWA 4WVMA 3AKPA 4LIVA 2JDKA 2VM9A 1M06G 2VCCA 1VBE1 3AX4A 3O0WA 1CJPA 1O7FA 2JIGA 2D3SA 4LKFA 1XSQA 3MHZA 1BJQA 1WCQA 2D6KA 3VHNA 1URXA 2ZCWA 4XUNA 4NHYA 3B69A 4AYUA 5F2SA 2QQWA 1GZTA 3F95A 1W28A 4IL7A 3LEKA 1XNKA 3V0BB 4AE2A 3WG3A 5FZ1A 3WNNA 1HB2A 1R091 4IEOA 3ES1A 4Q0PA 1S4CA 1VAMA 2P17A 4LBJA 4FPLA 2V09A 5HPOA 1JZ5A 2LTNA 2J7MA 2XUEA 4YWAA 3WEZA 5FYYA 3H3ZA 4WZCA 3OEAA 4AFBA 5KBFA 2WR9A 5DQ0A 4C0HA 4FQZA 4LQRA 3I2HA 1U0AA 1QEXA 1XPWA 3H8UA 3JZVA 5FY0A 1OUXA 2WWSA 1GMMA 4V2WA 4XJUA 1FPN1 3GALA 3ZYPA 5C3QA 5AFEA 2BFUL 3V0AB 2EAAA 1UQXA 2HWB2 5FZFA 3D3AA 1YNAA 2WA4A 2VCAA 4K1ZA 2KD7A 3ZSMA 3J8F1 4Z2AA 5BNNA 4NIAA 5LEKA 4MGKE 4COWA 4Y1ZA 3ECQA 1GWKA 3KLSA 4B4QA 5E8AA 1W8TA 4LHKA 4AQ2A 4RS5B 3ZPYA 5JPMB 2QQLA 1DGRN 5HXMA 4UAPA 5CBLA 2OYZA 2WS92 3MGUA 5FPBA 1OHFA 2BGOA 3KQRA 1LKNA 2YBSA 2ZHLA 3CZJA 3H0OA 2VW0A 3USSA 5A7SA 3E1F1 3GDBA 2BERA 1LODA 2R063 1UZZA 2A6YA 2GNBA 4RHV3 4H3WA 3MFAA 5D21A 1Q5OA 4UFHA 1RHI1 2VGDA 1SDDB 2AYHA 2VBBA 3WQ0A 2W94A 4GD4A 3TEXA 4OHYA 1EYBA 2N7GA 3HN3A 2XLAA 3U1XA 5FLIA 3U4XA 3MF6A 2V4VA 5HV0A 2GH2A 2UWAA 3BALA 3BN6A 1B35C 1H0BA 4LLOA 2JB8A 2EXHA 1VBB1 5F5IA 5EXOA 4JKKA 3PU8A 4W6XA 3I2OA 1GQPA 3PVBB 4IEWA 1ZZBA 4AHYA 3WQ1A 3NNFA 5F32A 2Z69A 2LW8A 2XGXA 5A7NA 1LOBA 3D5OA 3ITQA 4DMIA 2V5DA 1LOFA 5A3NA 4HK9A 2VZVA 1TNRA 1JMUB 2JB4A 5FCCA 3KHBA 1JYXA 3M3OA 5C3OA 1Y9QA 3DPRC 5T54A 5ABJC 4Q4X3 2DUOA 1POV3 4AVCA 2R1DA 1N3OA 1LEDA 2OQ7A 3H50A 2GU9A 4NO4A 3THTA 5I91A 4KMQA 1JS9A 1W2NA 4ZXKA 3VKMA 4XUPA 1W39A 1C1LA 5JSPA 1MS9A 5JI7A 3RI8A 2RM23 5DDJ2 2K0GA 2ARAA 3OPWA 4UFKA 5B2GB 1XB9A 4E4SA 1SZBA 1H2LA 2XPJA 3NNMA 3PURA 4IV1A 1F5JA 1HXS1 2BVBA 1Q8PA 3T2TA 5IATA 4HANA 5LB6A 3B93A 2DTWA 1MVQA 3MPBA 4FOYA 1GOFA 1WLWA 3H9AA 1JZ6A 2WZR2 4YM1A 4GALA 3K46A 3WXPA 4UBHA 5DABA 4QXKA 2CY6A 3FFQA 5SV5A 4FTEA 5JPNB 4ES8A 4LOSA 4GJZA 4QXCA 1QJFA 3U4SA 1AR72 3BTZA 4G9SB 4Y1YA 2FCVA 3WV6A 3KV4A 4MUVA 1IS5A 1WW7A 1BKZA 1RUD2 4HFSA 2RS52 2ZHNA 5L7OA 1VBD1 1LB2A 2ZGUA 1SFYA 2YBKA 5C5UA 3J7HA 1NG0A 3OGJA 1RJ8A 3N9LA 2ZS6B 5BPXA 3VHRA 3BU0A 4MG2A 4GXLA 4URAA 4FPHA 1FV2A 4IGQA 4CUGA 1O91A 4QPGB 3VGIA 2GN3A 3HPNA 3HNYM 1QU0A 2B7YA 1SPPA 4D6QA 1LOAA 1QNYA 3M8LA 1UMIA 3NQHA 4AF9A 3IMNA 2JKXA 4MXVA 1O8PA 4OULA 1R083 2XG3A 5FK8A 3UJQA 4CEYA 1OPOA 1H8TA 2KR2A 1AJOA 4XPVA 5I8SA 2HWC3 2FDGA 5LCWL 1OMIA 1JZ4A 4DQAA 2HYXA 4YM0A 1C5HA 2A6VA 1YCIA 3OYWB 4QPIA 1FMD2 2DBNA 2JD4A 3OD0A 1W9YA 2P5BA 2FCUA 5DZFA 3OF1A 2FD8A 1W9WA 3K4ZA 4K7JA 3ZXEA 3N7LA 1W6NB 4CEYC 1H8VA 4DZGA 3U75A 5EV7A 1RVF3 1E5SA 4XF0A 2JE8A 5LRRA 4L92A 4V2VA 1TNFA 2RS32 2ZX1A 4ONUA 1YI7A 2VW2A 4PLMA 2WNVA 2QQJA 3ZFGA 5FREA 3ENRA 3K48A 2ES3A 5FMOS 4OZOA 2WQZC 1XXNA 4B29A 3BIEA 4B7KA 1ND3A 2I74A 3R4DB 1SCRA 2P6CA 4D0QA 4Y20A 2VZOA 3TN92 3VBOB 2DUQA 2YB7A 4XDQA 1DBNA 1MS5A 4N43B 1UOFA 4LJHA 1O59A 5FZBA 1ST8A 4Z1VA 1EAH3 1RUC3 3P5BA 1PVXA 2NMOA 3B9CA 4B1MA 3ZFGC 1RUG1 2LRPA 3PUIA 3LPGA 3JUUA 4INDA 3U37A 1O3SA 2DVGA 1MEC3 3TNPB 4YW4A 1NT0A 1PM7A 3NNJA 4FOQA 3H1MA 3DEMA 3PTYA 3I54A 1NQJA 3UETA 3VBSB 4XURA 5FBZA 1S2KA 1X33A 3EQEA 2G19A 3IDBB 4I3GA 1H2NA 3OOXA 4PQ9A 1ZRDA 1S0JA 2YU2A 2ZAAA 1JOBA 3EB7A 3FBYA 2VUAA 2ZTNA 3HIFA 3K77A 1HRV2 3P6BA 1GLHA 4GWMA 4OUEA 4Q0UA 3VL8A 3WHTA 5K0UB 3BI3A 5A32B 2BJSA 3AB0A 4JGZA 1APNA 5FUNA 1EV12 2R32A 1Z7S1 4MVTA 2W08A 1LJ7A 2L9LA 2ZEXA 3WCSA 1LESA 2ZZQA 5J1XA 2XR4A 4N7UA 1OT5A 3I59B 4QKBA 2ET1A 3ZYBA 3N9PA 3RZZA 1I5PA 3AKQA 2HWF1 4XDPA 1TZOA 4QDQA 4CDUC 2W95A 2W92A 4BB3A 3I3MA 4L97A 4WM7B 1W99A 3RDIA 3ZDSA 4FTSA 4Y1UA 5JUVA 3IWZA 1AR81 4LA3A 4LO5B 4MV2A 4PBOA 5GKAC 4JGZC 5LASA 2BQPA 2ARXA 4YNIA 2XBO2 2WL1A 5J36A 2VC9A 4XAEA 2QQUA 1ZNPA 2VMFA 3BCWA 1MACA 4XJ8A 5LEJA 2EXJA 1MQTC 1EV13 2LS6A 2ZMKA 5A6ZA 5E6HA 2E7TA 3B9IA 4AFDA 3LPFA 3GZEA 1RB8G 3AYCA 3CZUA 5D8AA 5FO7B 4AAPA 5FYSA 1AXKA 3I4IA 2A73B 3DV8A 4AI3A 1ZBE3 2CAUA 5FUPA 3DKWA 4YGDA 4YW1A 3INAA 3WP5A 3WF3A 4RQPA 2WFF3 1AXZA 3BPSA 5KR7A 2EXIA 4FPYA 5FY4A 3JQXA 2X10A 1EP0A 1FNZA 5IVJA 1KGYA 1QXJA 1SLCA 1VRH3 1XYNA 3ACFA 2GZWA 4XFFA 4Y26A 3GYDA 2VOVA 5DN2A 5C8CA 2BWAA 1W2TA 3CNAA 4HN1A 4QB1A 5BY5A 2PAEA 1TME1 2D40A 1UIKA 2HWE1 5F3GA 3CKHA 4KWKA 1OURA 3VBFC 1FAYA 2W1UA 4QKNA 4JDOA 4Y5Z0 5EJ1B 5CFDA 2Z4FA 2P3JA 1CQ9A 2KXLA 4Q4Y1 4M0NA 3PUAA 1O4TA 4GB33 3VBUA 3O1VA 1NLQA 4QX2A 2YY1A 4COVA 5HCHA 1YJLA 2BFUS 2OVUA 3GJBA 3GXUA 3PUQA 4KI5M 4CCOA 1WUVA 5KC6A 1CAXB 5I0DA 3KGZA 1V6MA 2XDVA 2XUMA 1GNHA 3I7DA 5JWPA 2DCYA 1J1LA 1PGW1 3ZFFA 2TBVA 3TEYA 3BOPA 1ENRA 2XB6C 1LRHA 3VHPA 1W8HA 2PHLA 2YMZA 3KCXA 5C3PA 1K5MC 4IEUA 2D44A 1QQP3 3TEWA 4KG0A 1AUYA 4N53A 1W6MA 3NL1A 4MXWB 4Y5SA 1RUH2 5CKNA 2VE1A 2VG9A 1B35B 2HBTA 3UV9A 1VBC1 2UY8A 3POFA 2D6PA 2QZ3A 2WNUB 2E7QA 5L9RA 3ZYIB 5FZMA 5LBCA 2Y38A 1LGNA 4GH4C 2CWSA 3GZAA 3PIGA 2DCTA 4R9CA 1QOOA 3T2QA 3ZFFC 4BCUA 1H2MA 5A7OA 4CA9A 3BB6A 3O1PA 1E5HA 3WVJA 2RJ2A 2OIIA 2HYKA 3KB5A 1V9U1 2IXKA 1VALA 4FQ4A 2PXJA 4YM3A 2DCJA 4CU8A 3WCRA 2X8KA 3OEBA 1BHGA 1DCSA 3POIA 2VNVA 4J25A 4YZ4A 3U07A 3T0DA 1SACA 4CDWC 1W04A 4XCBA 4O65A 2PMWB 2HWD2 2J22A 4FXGB 4B1LA 2JG8C 1YJKA 4E2QA 3TEZA 5ABJB 4Q4V2 1SBDA 2ADDA 3ZN5A 5FRAA 2VR4A 2BNMA 2UYAA 3DECA 3MO4A 4LTAA 5A7QA 1CN1A 2OQ6A 3CQOA 3ACIA 1AR91 1WA4A 4QDRA 4BQXA 4ATFA 1PIV2 1X7NA 1H9PA 3S7IA 3V0BA 2WNOA 2IVJA 2OUJA 4ES9A 5J09A 2FZ1A 4P5HA 3T2PA 3LSDA 1NZCA 3EHKA 1WCKA 4LBQD 5IAVA 1PNGA 1YC61 4JHZA 1JYTA 1E5RA 3ELNA 3POYA 3VZOA 4BQYA 4CUBA 2DFCA 4NRQA 3RS6A 3ZN6B 4C1WA 2DVBA 1JW6A 5JCTA 1JZ2A 1Q56A 3O1UA 1XRUA 1UPSA 3PDQA 2VJXA 3A21A 3V0AA 2I2SA 2FBEA 1HQLA 5I0UA 3POEA 2EXKA 4E9KA 3Q8EA 1LTEA 1QXRA 2PHTA 1ODMA 3VDDC 4E2GA 3VZLA 2NP0A 5LK5A 3Q8CA 4RA0A 3I2GA 5CFCC 1HQWA 3DKQA 4IETA 4CVUA 1S0BA 4PDWC 4RS5A 2R061 2WJSA 4Z82A 3E97A 4XBNA 3RYPA 4XW3A 1DP0A 1CX4A 4NVPA 4D7TA 2HWB1 5ACA3 5FOJB 1COV3 3ZSKA 3NJYA 4LMFA 4RD7A 1WD3A 3NVCA 4BHPA 2MEV2 2YC0A 1UXXX 4XJ9A 3PMEA 3JQWA 2R073 1PZ7A 1YIPA 4XFBA 3T2OA 4J1XA 2XL9A 5FZ6A 3D0SA 3FMGA 3HNMA 1WW5A 5DZGA 2WN2A 5FWEA 1W0PA 4IXLA 3KV9A 2JD9A 1OI6A 4ZHNA 4UXAA 3MUZ1 4AVVA 4R8HA 3KQ4B 3HQXA 1H2KA 4JTNA 4QU1A 5KC5A 2O8OA 3VUOA 5FPZA 2ORZA 3EJKA 4NWWA 4X8PA 5FFOC 3B7MA 3R4UA 1MZFA 1WMDA 2OKXA 2BNOA 3HJRA 4BPZA 1ZVFA 4OQ9A 1SLIA 3C7HA 5L9BA 3WNXA 3MW4A 3V56A 3ZN4A 3C2UA 4DRVA 3V65A 5A70A 2JE7A 4A7ZA 1Y7BA 2YFZA 5FZ3A 1UX7A 4YSFA 1XOYA 4YVSC 4U2AA 5FO8B 1CX1A 3GZTB 4EZ4A 1ZRRA 2R0HA 4I09A 5F3CA 4CDXC 1RUJ3 5CEHA 2B8MA 2UWBA 2W3JA 4GWNA 3VZJA 1PK6A 1RYYA 4LEJA 1RUI3 1ZZ9A 2RM21 4MH0E 1F35A 1D2SA 4JGYB 1OH4A 4PCRA 4XQDA 3WY6A 1H30A 1UF2C 4CU6A 4FXKB 5FYIA 3IAQA 4E4DX 3HNBM 3S7EA 3BUCA 2ZHMA 5ANQA 2RMU2 4PT6A 4CCMA 4LBMA 4KU7A 2GC0A 4AHWA 3J7MA 2QNKA 3DYMA 1JYCA 5A3MA 3VB9A 1YWKA 3NJZA 4F83A 2VUJA 4M4PA 4NPRA 4N9HA 4NHMA 3W5NA 5FZDA 1UY1A 1QJZA 1W3VA 2J1SA 2OPKA 3FHIB 4CYDA 3RWNA 3SNMA 2VMGA 2WO2A 1JN2P 3CJIC 4QAWA 3KGLA 5JIAA 3LEGA 1IKQA 1K42A 4AQTA 1IQAA 1IZ3A 3SMHA 2A3YA 1UYZA 4AI1A 2BTVC 2GN7A 3KD4A 2P2KA 2EVXA 2WLPA 3OD4A 4JC1A 1NKGA 2F4LA 2WRAA 3KT1A 4NIGA 1DQ6A 3O1SA 4JZRA 3HAGA 4CCJA 1IS3A 4A41A 3KVAA 4Y22A 1B09A 1GWMA 3ZX7A 3QH7A 4E4HA 2F4PA 1I3HA 1L3JA 4R4ZA 5FAXA 3KCCA 1OH3A 4CDUB 5A7PA 1W9FA 4H2AA 3LDRA 1QMJA 2EF6A 2CAVA 2VMEA 4K8FA 4OUMA 2Q5TA 1AR71 4NIIA 1J3RA 2HWC1 2VBPA 2VTFA 1ONAA 4QPGA 4YZ2A 4ZXEA 1RUD1 4K20A 3LGRA 4H14A 2RS51 2IZWA 1UWWA 1HJFA 1SLAA 1VBA2 3EXUA 3M4FA 3ZKUA 4NHLA 3SCFA 3FUOA 1MQTB 1AF9A 1SG3A 2D3RA 5I0SA 1HDKA 2YXSA 4OZXA 4BISA 1JXNA 3FLPA 3OYWA 4EWAA 4XF9A 5FV3A 3B01A 4QPGC 5HCAA 3O1OA 4HXCA 1ZM1A 1PZ9A 1JODA 5LATA 5LY1A 1OBNA 4LNVA 1NQDA 2SBAA 4ZONA 5ANNA 4KU8A 2W1WA 1W6QB 3T30A 2GP3A 2XLFA 3HT2A 1GZ9A 5DUUA 5FP3A 1OOPA 1L7QA 4U36A 2ZACA 3GJAA 4QX5A 1GYKA 1TE1B 5T5OA 1LECA 2AC1A 2NQYA 1W6OB 3T3YA 3O1TA 3RSJA 1EAH1 1HIXA 1SLBA 1TME2 1U5IA 4DB5A 2E63A 5FYHA 4DY5A 3VBOA 1MZ6A 2VQAA 3BU7A 4IE5A 5KHHA 2FDKA 2GSYA 4R9AA 4NRMA 4Y5TA 4KBZA 4GQ7A 1P8JA 1REFA 4L11A 4P9XA 4AR2A 1RUE2 2B9VA 1HRI2 2P1BA 4Z07A 1LGCA 1R1A3 1A34A 5GZCA 1YHFA 1PVC3 2WO3A 3RI9A 5A3PA 4URTA 4YW3A 1QOSA 4XIOA 3VD7A 5IVYA 3BGAA 3NV1A 3MIGA 1YQ2A 2ERFA 2VTXJ 2AGSA 3TN91 1H4HA 3VBSA 4A3XA 2RR13 2Q8DA 1PMIA 2W52A 3H7JA 4XOGA 2DURA 3M7AA 3PLQA 4N43C 4WV8A 5F5CA 4K3UA 5EP9A 5K0UA 1GNYA 2QE3A 2K46A 1GP5A 1PGW2 4N7IA 5T55A 3GBFA 4AAXA 1K5MB 4HZFA 3K75B 5LBFA 3VDCA 1BK0A 2BOIA 4O9GA 5F39A 2JICA 3MLJA 3R0RA 3MEPA 5GLZA 3RQ0A 1GV9A 1ZA7A 1V6JA 5T50A 2H0BA 4QQHA 2XVGA 4IERA 4BIOA 1HRI3 2FDFA 3I59A 5I8TA 1LHNA 3MV01 4HKOA 5A6XA 1LCLA 1HQNA 2IUWA 2Y34A 5M0TA 1CAVB 4GH4B 4G4FA 3MLKA 4WM7A 2G4IA 4G3YC 3AYEA 2YGMA 5JOZA 1PO23 5FY1A 4BQ5A 1OSGA 1ASJ2 1EV11 5T52A 2VD7A 3HEIA 2W0XA 5IK7A 2P37A 4LORA 3VBRC 3KSCA 1UY2A 4QHBA 4CDWB 1SLLA 3VN4A 3J7LA 1ULEA 1BYHA 4XZPA 2D6MA 3K3OA 5EJZB 2JG8B 2VAUA 4LUKA 5FMDA 2JXAA 4GKXA 4COUA 5J96B 4D6RA 2ZEWA 4BE3A 4AW7A 3IB3A 4K1YA 2WFF1 1ND2B 1DGWX 1GQHA 1KXGA 3VDAA 5EJ3A 1DQ0A 2XBO1 3H8OA 1VB2A 3CLPA 5C8WA 1S2EA 2WQ4A 1WW4A 3LKJA 3J26N 1W8FA 4IEZA 2E51A 4M3CA 4M3CE 3TNQA 1T6BX 3R4SA 3AZWA 5H9RA 2LROA 5L19A 1GZWA 3CDZB 4QX8A 3H1WA 2PLV3 2ET7A 2X29A 2VMCA 4JHTA 4JDNA 1YUDA 3AZYA 4ET7A 3ZO0B 3I3EA 2OX0A 4JKMA 5T5LA 2FHRA 1AYM3 5BNQA 2Y8KA 3MIBA 3RZKA 4AEDB 4PI0A 5HCFA 5EPAA 2GALA 1DGRA 3OGSA 1FV3A 4MGIE 5FXZA 3K51A 3OBRA 3PJQA 1ZX5A 1ZBA3 3FL7A 3OPTA 3VDDB 1O6UA 4NOTA 4B4PA 2WT0A 5CG9A 1RMU3 3X29B 4A45A 3VKOA 5BNOB 5CFCB 2ZX2A 2E33A 2QJVA 3I8TA 1VP6A 1C1FA 4QM9A 5JZGB 1MPXA 4PDWB 4B3NA 2XLGA 5IYYA 2H6BA 3OY8B 2R062 1V0AA 2DDUA 1F15A 3DCQA 5KXCA 1R64A 3AL5A 2C6SA 4QDSA 4RHV2 3WX5A 1QJY3 3M3IA 2A6WA 1G6NA 4C0BA 4UYBA 4CUAA 1KJLA 1IQDC 1QJU3 2WINB 4TLFA 1AHSA 4LULA 3JU9A 1CAXA 3AMNA 3J9SA 4CTEA 3LIGA 2R043 1XQNA 5JI9A 4BQ4A 3CHXA 3USUA 5LBBA 4KGGA 4GMP3 4W8JA 3I2DA 3T0AA 4XZUG 3ORJA 1PO13 1NYWA 3RZHA 4MXWA 4HOOA 4ZKTB 4GAZA 1B35A 3QOPA 4Q1PA 4JX0A 4XFGA 4DS0A 3FE5A 1ZZ8A 4Q0QA 3NAPC 1ZZCA 1F8VA 3POWA 1LENA 1S1AA 2QBXA 4EWEA 5DAPA 3KV6A 5C6CA 1UPIA 1YFUA 1HLCA 1V70A 2PQQA 3KZ4C 1RUH1 5FXXA 4YVSB 4Q4X2 2ZGLA 4CXYA 4HBNA 3NWKA 1D4VB 3S0MA 4C91A 2XJVA 4CDXB 1IOAA 3CEWA 1C3HA 2WNUC 4NPLA 3DPRA 5FYCA 3PJYA 2B39A 1GP6A 5ABJA 3E6CC 1OFNA 5FQ0A 4XDOA 4FFGA 2GNTA 1BVVA 2A70A 2IXIA 1GR3A 2RM22 1FT9A 5FP9A 5IFTA 3AXDA 4DO0A 1TMF3 1BMV2 1LHUA 1O3TA 2YV8A 2VVFA 1NCQB 1AVBA 3VBHC 4FSJA 4XMIA 2HWD1 4CU9A 1S0FA 1WD4A 5A33B 4IUGA 2CV6A 4Q4V1 4MSVA 1AL23 2JX9A 5FZ0A 1NXD1 3LB9A 1XNCA 1WCDJ 1UOJA 3FUQA 5DAWA 1UNBA 1NX9A 3CJIB 3ZN6A 5APAA 4XQ4A 2FCTA 1PIV1 4X6RB 1BLZA 1ULGA 1W2UA 2JG9C 5JXGA 4CP9B 3ZIWA 1DLCA 2PHDA 4P02B 4ZU7A 1H6YA 3ON7A 1HV1A 4LO7A 2FDIA 1F9KA 4UI9L 4EN9B 3HOBA 2VXRA 1UYYA 3WNOA 2Q30A 2VMDA 3G7DA 5J37A 4XFHA 1M4WA 1RUOA 4RFRB 4Y1XA 1JZ8A 3M2MA 1NY72 3IMMA 3WNKA 1UAIA 5GLTA 1HN1A 4IDZA 4OHVA 1R082 4XFIA 5E88A 1ZYBA 1LU2A 3AVRA 3GHNA 2HWC2 3OG2A 1QOTA 4XE9A 4LLFA 2BNNA 4QXHA 3PIJA 1MS1A 1IPSA 1Q8SA 3N9OA 2O1QA 3UESA 2IWGB 3SKVA 2WT1A 1JZ7A 4LOTA 2GC3A 1J83A 3LCPA 3OGGA 4C8DA 4CE8A 5CG8A 1OUSA 3I2IA 3EO6A 2MEV1 2TNFA 2GNDA 4UWDA 1RVF2 1UMZA 2ETEA 1Y3TA 2FQPA 4AFCA 2OPWA 1O4YA 3ZOIA 1REDA 1W9SA 1I9RA 2QQNA 2ZXQA 5KHGA 2NMNA 2DBIA 2Y6JA 4UT5A 4WVWA 2LUWA 4JDMA 5J3UA 3VZNA 4L2NA 4YW6A 3RWKX 2O14A 3VD9A 5FYVA 1RUI1 1VMFA 1E57A 1U12A 5FZAA 4AVAA 3ZYRA 2CSGA 1AJKA 4A3ZA 5C71A 2P3IA 4ASLA 4IEPA 4HMZA 4P14A 3MICA 3ZDVA 2DU1A 2XJRA 4AI8A 1RTVA 5FZ9A 3ZXDA 5KWRA 1EAH2 1RUC2 2KA3A 2WQ8A 3N7MA 2RS13 3RG0A 3WG2A 1NXMA 1RINA 1CAWA 1JU3A 1NCRC 2X5IB 1EY2A 3E6BA 3FX3A 3O7OA 1MEC2 4NRPA 2RG4A 2HEVF 4QPWA 1UD1A 2TUNA 2W1SA 3ZXLA 4PHZA 5FY7A 4NIDA 5IFPA 2NZ9A 4MX3A 2HLEA 1ZZ6A 3KF5A 1NE4A 2QQVA 3WF2A 1DYOA 2PHUA 1J59A 1GQGA 1W0OA 1WGPA 1UZ0A 1D4M3 2BGCA 2QQOA 2QQKA 2WLQA 3SH4A 1A6CA 4JGYC 4DEQA 3ATGA 3FFZA 1F2NA 1QHDA 1WA6X 3AKTA 2PHXA 3OBAA 1PMHX 4XBQA 2XH6A 1OPMA 2RMU1 4K8RB 3WNMA 4I3PA 2QTWB 5JR2A 2WFPA 3Q8BA 3BODA 5FPVA 2WA3A 1HN0A 1BBT3 4BXSV 5LA1A 1BVP1 4P9JA 1LU1A 3D6EA 3LEIA 4M01A 4PIZA 4Q2FA 1GFF2 4QB6A 3ZYHA 2XJQA 3FLRA 3SLIA 3P1IA 1L7RA 1OVPA 4AXOA 1T2XA 4CSWA 3GBGA 2LM3A 4XF4A 1FX5A 2ZKLA 4YVWB 3IIIA 3RGBA 2ZX0A 3MIFA 3WHUA 5FZGA 3LZZA 4CDUA 1GOHA 2XJSA 3U78A 4XMAA 3T1MA 3M3CA 5IVBA 4I01A 5FKCA 2ZZJA 3W9AA 1VE0A 2F17A 3O1MA 1RUNA 2XVLA 4CRQA 5FY9A 3A4UA 5LA0A 1OD3A 4PIXA 2WSVA 3VD3A 3JB8A 3VBRB 4C1XA 3LF7A 4LHLA 1X82A 2JECA 3WP6A 3TRSB 1CZTA 1JOJA 3CL1A 3QLQA 1AR63 1MQTA 1NA1B 2C24A 1OXCA 2R30A 5T5PA 1ZBE2 2W68A 4FPOB 4XEZA 2IXCA 5BV6A 2ZMLA 4FPJA 4CEWC 1U5YA 2WFF2 1HV0A 1A78A 3HD8B 2O8QA 4TSVA 5JSRA 1C8M3 3UNPA 1VBA1 1VRH2 1WLTA 1VB4A 4EN6B 5BYNA 4COYA 3GNEA 2UU8A 4JCKA 1WMEA 1UKGA 3PUHA 5AC93 1W6QA 2XWJB 1QJX3 1S0DA 4FP3A 5TSWA 2VO5A 1JOPA 4Q26A 1OD5A 2PFWA 3T4VA 1VMHA 1XYPA 3QACA 2VOWA 3W5MA 1Y9MA 2RHPA 4JV4A 4AGRA 4IV3C 1YRZA 1HW5A 1O5LA 1W6OA 1G9AA 1CJDA 1X8EA 1OLRA 3OCPA 2X05A 1SCSA 2BGPA 4UW6A 3VBFA 4LK6A 2PA7A 1WMFA 4LKSA 1R1A1 2BW8A 2AUYA 1LOCA 1PVC1 2W47A 3VHOA 3N7JA 4GB32 2R49A 1GNZA 4W50A 1W06A 4DXTA 5IVFA 3O5SA 2V73A 5DAXA 1GSLA 1LHVA 2OT7A 5L73A 5LZ6A 2CGOA 1SFPA 1W8OA 1KFXL 1RJ7A 5CZKA 2EA7A 2ZJCA 5FOBB 1KITA 4IW3A 2Y6LA 5J98B 2AEYA 3WF4A 2VZSA 3UKNA 4XYXA 3DN7A 4L99A 3UJOA 4BYYA 1QQP2 2ZHKA 1QIQA 4HSJA 4D8MA 3T0BA 2G9ZA 4WVMB 1RUE1 4CP2A 1HRI1 1OQEA 1S0GA 2CTVA 1UU4A 3FHAA 1N1TA 3NMBA 4FPGA 4MGSA 1ZREA 3H1YA 4E27A 1K5MA 3PVEA 2ZABA 4KBBA 5FYZA 4E2SA 4YLZA 1UY0A 4O61A 2WZEA 4HVOA 3AP9A 1IKPA 4TN7A 3UKTA 4QX7A 1VBE3 3ACHA 2A5ZA 2YC4A 4R9BA 4BQ1A 1YLLA 2D6NA 3NAPB 2QKDA 1LHOA 4IEXA 4GH4A 3LOIA 1K3IA 3V64A 1N1YA 2PTMA 1O8SA 3MLLA 3T1LA 2TEPA 2VVEA 4Q0VA 3WNLA 3H7YA 1D7PM 2J1TA 3ACLA 4DY3A 1CWPA 4RL7A 4N8MA 1BK1A 2OW4A 1YQ8A 2DVAA 4CP1A 1IPKA 4D3WA 2XQRA 4CDWA 4EN7B 2IXJA 4S2GA 4GWJA 4ITCA 4YW2A 4CU7A 2JG8A 3WW1A 5E16A 4ARYA 2XOMA 4B4RA 1XNTA 3VKLA 4M00A 5BNNB 3C7OA 4Y33A 4BXFA 3BOWA 1ASJ1 4WZFA 2PAKA 1OKOA 4CDQB 1SEFA 1FPN3 3S6PA 4D69A 1F31A 4BDVB 4XCAA 2Q1MA 4IEVA 5BXXA 3VBHB 3J8F3 4CXXA 5IAXA 5A6QA 2WN3A 2BYVE 2WKKA 1AYM1 4BLIA 4QX3A 5C4WC 1KQRA 3E6DA 3WSOA 5DXDA 3AP6A 2DU0A 2GNMA 4XJWA 2IC1A 3IZOA 4HONA 5FZ7A 1ND2C 1UMHA 5CVRA 3ZLIA 4CUCA 4LBNA 4AG4A 2P6HA 5CA6A 2XJTA 4MOAA 1RMU1 4NAMA 2K9ZA 4MLOA 2JG9B 2WC2A 3JB4C 1JU4A 3HMYA 1QWRA 1WBFA 2VU9A 3PVNA 4KWUA 3ZMOA 3KS7A 3M3QA 1Q43A 2Y60A 1EUTA 1PHMA 1ULOA 3VDDA 2X53S 3BTYA 1ULCA 1SBEA 4DUVA 5F37A 4HKLA 1RHI3 5CFCA 3AXEA 5ACA2 1V00A 5D1IA 1QJY1 1XNDA 1ZA4A 5EQUA 1ZRFA 2CWMA 1COV2 3VZKA 2PHRA 4PDWA 5IK4A 3HBZA 4PF1A 4HVQA 1GUIA 1KFUL 1JUIA 4EV0A 5FZIA 3NKTA 3OY8A 4AEDC 4XFAA 5I0RA 3IDEA 1VBB3 5FTTC 4AZZA 1YYNA 4BQ2A 1FI2A 2R072 3HR9A 4CCEA 1UOBA 4GMP1 3L9JT 3RFRA 3WT3A 2WT2A 4D7SA 2PYTA 4MYEA 5BUVA 5BNOC 4AQSA 4DXSA 1AL0G 2GAUA 2ZBJA 4YG3A 5JZGC 3IDAA 3ASIA 5C5TA 2D5HA 1RUF3 4RHV1 2A75A 3O0VA 4NWVA 3AP4A 4Y24A 1KRIA 1KS5A 2DTYA 5C9AC 2JDYA 1G9CA 2DFBA 3U11A 2A1XA 3EYPA 2J42A 5FJKA 3OTFA 5A80A 3LIHA 1KDMA 2RDNA 2RV9A 4DRRA 2BUKA 3AM2A 1J3QA 1FATA 1RUJ2 2JDUA 2C5DA 3WDWA 1W9TA 4XTMA 4YVSA 5IVEA 1G9DA 5E1RA 1RUI2 3QH6A 2JDMA 1DYKA 3FLTA 4P9WA 1X8MA 4ZS3A 4A7KA 4CDXA 1HXS3 1Q3EA 3RYRA 1EUUA 3AVSA 1GOGA 1TMF1 2DCKA 2HEWF 3AZVA 4LBLA 4YG0A 2ZOEB 4KQ7A 5F5QA 2NYYA 2BV4A 1H4GA 2YU1A 5F8PA 1NCRB 1W90A 4LE3A 4EYUA 5L7OB 4Q4X1 4XUTA 4R9DA 1POV1 2JWPA 1XJAA 4Q27A 4AEKA 3C7EA 1BZWA 3IT8A 4FPFA 1A8MA 1Y4WA 2ILMA 3JD73 1CD3G 5A33A 4MGTA 4DUWA 4JAAA 1RIRA 2UY9A 2WO7A 1VBD3 3WDYA 3WUCA 4DXZA 5HXVA 3MBWA 4BA6A 1SPPB 1S0IA 2Z5WA 1BEV3 1OQDA 2CGNA 2VXJA 2D93A 1BMV1 1UIJA 3CJIA 3MDPA 3SKJE 3WLUA 2VL4A 4ATEA 1NCQC 1XYOA 1DLLA 1UL9A 5A3OA 3DYPA 3N35A 5JXHA 4CP9A 3A22A 3HQUA 1V6OA 5L9VA 2BVVA 2C26A 2E31A 4QPIB 5FLJA 2C4XA 1BCXA 3A0NA 1XE0A 4D6SA 5FPUA 3IN9A 4TWTA 4FBFA 4JRAA 1LOGA 2Z2SB 4A6SA 2O0OA 2IFWA 2OUHA 1X36A 2QQPA 3SISA 3N9MA 3IM0A 1Z0HA 2EALA 2QQMA 2Y26A 3PL0A 3JBG3 3R05A 4XF1A 5AVPA 2GP5A 1ULDA 3MF9A 2RDSA 4V1PA 3KT4A 1C8NA 1KDKA 1WCUA 3G6JB 1NY71 5FYMA 5CADA 4Y20B 4RR3C 1YFXA 4AL9A 1PZ8A 2WBKA 1R081 2ZGOA 2Y6GA 3FZ3A 4CEWB 3K3NA 5FYBA 4DXRA 4UFIA 5K9YA 5FYUA 4YRDA 1N3QA 1JI6A 2BU9A 3ZKYA 3KM5A 1NUKA 2R1BA 2D7FA 2QCSB 4WBBA 1WMXA 2NPIA 3ZYGA 1W3XA 1DGLA 2EAKA 3POGA 5FKBA 3T4HB 5LWBA 5FP8A 4IV3B 2VECA 2W91A 1RVF1 4RSUA 1Q8OA 5T3NA 2P3KA 3Q8AA 5HCBA 2EIGA 2BWCA 1W6NA 3SH5A 4EWDA 4KNCA 2V4AA 4I0BA 2YPJA 5A3UA 4I30A 2VQUA 4QGMA 4YFZA 2XONA 4HETA 1R1A2 3RZMA 1TQ5A 1PVC2 2PHWA 1J1TA 1PX3A 1ODNA 4CXWA 3PHMA 2RJKA 3QBQA 4BK4A 3RVHA 4C90A 2UYBA 1Z7S3 2RR12 1DQ4A 2WZ8A 2V5YA 4CPBA 4X6QB 2E6VA 2RDRA 4Z8BA 2FMDA 1RUC1 1UX6A 2J1VA 5KXDA 2AACA 3S57A 2HWF3 2IVIB 2MPFA 1WBLA 2W5FA 1BBT1 3MW3A 4ORFA 3RPQA 4AVTA 1MEC1 3N36A 2X5IC 1GBGA 1C4RA 2HBUA 2XKPA 3CF6E 4LE4A 4N43A 4OHWA 3VKFC 4A42A 2Q8CA 4XILA 4LO4B 4LKDA 1AR83 1JYNA 2WWJA 3ABZA 3WP3A 1GZCA 3RZLA 2J1RA 5FUIA 1HB1A 4AFAA 3MZHA 1DDLA 2VQTA 4QWNA 4LBQB 2JKBA 4WM8C 2VY0A 4RGGA 1S0CA 3WR0A 1PO22 2HH9A 4R52A 4YVWA 4D7YA 5CKQA 2ZGTA 3ZSJA 3U14A 4H55A 1NAEA 1SLTA 3AMPA 4FPKA 2ZEZA 4RGKA 1XSRA 2XJPA 4SBVA 1UOGA 5A32A 3NNLA 1MS0A 5C70A 1IG0A 5ISLA 3N9QA 5C8CB 3VBRA 4QHZA 2YGLA 2MNGA 3WDTA 4I0WB 4YVWC 2E26A 1DQ1A 3EBRA 4YYOA 5JR7B 3UGFA 1NA1A 3ZYJB 4LBKA 1BXHA 2IFRA 3H3LA 4AHZA 4BOWA 3POSA 3SXWA 4ASMB 3AFGA 4FCAA 1POQA 1VLNA 3IAPA 1MZ5A 2D3PA 3CBNA 2HWE3 1YXWA 2XJUA 2B5HA 2PLV2 2JDNA 4K9SA 4YZ1A 5JAXA 5C4WB 3RZJA 4PF5A 1ZBE1 1D0GA 1AYM2 1NA1C 5H9PA 5FLHA 4AGGA 4Q4Y3 4BZ4A 4LKEA 3ILNA 1DU3D 1C5IA 4BH9A 4CCCA 4AVBA 1FNYA 3IPVB 3AMMA 2GC2A 1VRH1 1AX1A 1ULFA 1ZBA2 2YHJA 1RMU2 3HVDA 4LIUA 4M0HA 2ADEA 2A3XA 2VZRA 5F6KA 1YFYA 3LA3A 3MUY1 3SEPA 3WF0A 5KXBA 1UYPA 1PM4A 2ZGNA 5JMOA 3OUHA 4AWDA 3UL2A 2P3YA 3AMQA 4Q4W3 1UXZA 5A3LA 1QJY2 3CJXA 1SBFA 4YGEA 1QJU2 3GBWA 3ZXKA 5DG2A 2D5FA 5F6LB 4OUSA 5LY2A 1VBC3 4NHKA 1YI9A 5K8SA 2R042 4XAAA 4FOVA 2Y33A 1MVEA 3GM8A 4GB31 2W9XA 4HT1T 5FMCA 3QCWA 4MGQA 1PO12 4YZ3A 1WCSA 2AR6A 3AL6A 4UOJA 1AYN3 2H6CA 2UURA 4JKLA 1V9U3 2ID4A 4B7EA 1JBCA 4IQPA 1UZWA 1I1EA 2G9FA 2DV9A 3OUJA 5A6YA 1CR7A 5G05L 4XC9A 3KWVA 1GANA 1JUHA 5C3SA 1K5JA 3DF0A 5LK7B 4GULA 2B4KA 2E53A 2VTXA 3ACGA 5DUWA 1GP4A 1OLQA 5FK7A 5BNPB 1QQP1 1D2QA 5C9AB 1JYVA 3NAPA 3WOGA 1NE6A 1WLDA 1CAUB 4FI9A 3W59A 4OQ8A 5D2AA 3N4MA 3I2FA 2XMLA 2W46A 1AR93 1LHWA 3IBMA 4YW7A 1FOD3 2MHFA 4OI0A 5IJRA 2DF7A 3THPA 4L0PA 1CIYA 4LK7A 1QF3A 4YPJA 5CNAA 2WWUA 2W87A 2WNUA 5I0TA 1DGWA 1OLMA 1OLME 3D0JA 4GMP0 5FXWA 4Z2WA 3MPPG 1TMF2 3SCGA 2BDRA 4QU2A 1I5ZA 3B00A 1UCXA 4N90A 3VD5A 4CDQA 2XVKA 1QH6A 3ILFA 4J1WA 4KH9A 5CU1A 1V6LA 4YGCA 2KM2A 3B5LB 5FZ4A 2A3WA 2CDPA 3TOJA 4BWOA 1AL22 3LE0A 4FPEA 4ZU5A 3TAYA 3VBHA 2OZ6A 4OVEA 5EHDA 4E8CA 4QHOA 5F1RA 5FZEA 2YG0A 1QNWA 3ES4A 5EYXA 4A44A 3N9NA 1OA4A 2RE9A 2JDZA 4OMDA 5BNNC 2WUHA 3APBA 4MHUA 4PLNA 3N3HA 3I97A 2Q1FA 2ZGPA 3RRDA 4CDQC 1UZYA 3WW4A 2HWB3 1GU3A
chains in the Genus database with same CATH topology
1XU1A 5KHJA 4WVZA 2F6BA 2JG9A 4JTOA 5JOWA 1AX2A 1AX0A 5GLVA 2XWBB 3NV2A 1G86A 1G9FA 4XJAA 2A71A 4HK8A 1W6PB 3MIDA 1C57A 2WS93 3AJYA 4PBPA 1O3QA 1LOEA 5I8YA 4YM2A 3WUDA 1VAVA 2ZPXA 1POV0 3ZXGA 4FPCA 1UU6A 5ACA1 1RUF1 3AP7A 2A6ZA 2GMPA 4XIKA 1COV1 1OA2A 3VV1A 4S2DA 1F5FA 5GZGA 4HPKB 1PK6B 1SQ4A 5DG1A 2A7AA 1QY4A 2JEMA 4AFMA 4RR3B 2ENRA 2R071 3MI8A 3O12A 3NO8A 3SCHA 5EZWA 1LOFC 4KG8A 3RMXA 2VH9A 2GH8A 4KGQA 3AYDA 1CIWA 1FXZA 4Q1RA 3E5UA 5J7MA 2Q4SA 2GDFA 4P9LA 1WLCA 1IGOA 4TZDA 3ALQA 2RS12 3TWIA 3ZSEA 2PN5A 1MS4A 1GICA 2HEYF 1AXYA 1H1AA 1U5ZA 3ZIXA 1DZQA 1R1ZA 2JJ6A 1XU2A 3JD71 1PGSA 4IV1C 1JHNA 1RUJ1 5DDJ3 5J48A 1NCRA 4I2OA 3NKGA 4Y22B 3AKSA 3L2YA 3AK0A 1D4M2 2G9GA 1BEV1 2AH2A 4DFSA 1QDOA 5EFUA 1MZEA 1UU5A 1RC6A 3LAGA 4JGYA 2ZAHA 3WDVA 4K21A 2WZR3 1XNBA 4F3JA 4Y4YA 1BBT2 4DNYA 5L7OC 1ENQA 4QQ2A 1LULA 4OLLA 1AR73 1DQ5A 3SITA 1CONA 1RUD3 3ZMNA 2RS53 4QQLA 1CGPA 1SFNA 3PVOA 1H9WA 1HX6A 4ZU4A 4RGAA 1XE8A 4WM8B 2ZGKA 2Q0AA 2QUOA 5HI0A 3JBG1 4Y1VA 1H8TC 3KMHA 2B42B 2PHFA 5JMCA 1OOPB 4OHZA 3ROUA 4AEJA 4QPIC 1AR62 1CPMA 2OZJA 2QFEA 4YFWA 1T6GC 3MW2A 4OFGA 1OQ1A 2XHKA 1OKQA 2Z79A 4FT8A 1C8M2 1FMD3 1EPWA 4YZ5A 5KXEA 3ZFEB 4HLTA 1PGL2 1KS4A 3D82A 1CPNA 2VNRA 4XQWA 4I0AA 4CEWA 5GZFA 4D94A 3LA2A 5AC92 2C1FA 1QJX2 2AENA 2WNVC 2VVDA 1S2BA 1DZRA 2IXHA 4NN0A 1O3RA 2VOKA 2RS33 1ND3C 1JYIA 4AHXA 1DIWA 4PJYA 2P34A 1QKQA 2WSUA 4S2FA 2VMHA 2E9QA 4IV3A 4WVVA 3CU7A 1G9BA 3MYXA 4B8EA 4BLJA 3TN93 3R6SA 3P3NA 4HL0A 3N7KA 1N1SA 4AQ6A 3BPZA 3IDCB 3J4UH 3FBMA 5F9TA 4IEYA 2GC1A 4Q8KA 5CB7A 2VPVA 1DFQA 1HRV3 4CP0A 1TEIA 4CZSA 1V6KA 4GA9A 2VNOA 1O5UA 2D6OX 5AVAA 1IS4A 3NV4A 5DUVA 3NV3A 4EN8B 2ATFA 5KHIA 2RR11 1VBE2 4MGZE 1C28A 3WZ1A 3MIHA 2ZMNA 3ILRA 1YIFA 4LBQA 2R0FA 3UKVA 2ZGQA 4KWLA 4M3CB 5IT6A 3ZVXA 1QXPA 3HN1A 2NM1A 1R092 4OI4A 1H1MA 1O4ZA 4QQPA 1GZWB 2VOXA 2XBO3 4FO9A 4KWJA 3FJSA 4L9BA 4AEMA 2DUPA 3WD5A 1ALYA 4M3CF 5JLVA 2D6LX 1S55A 5D8AC 3AZZA 5E89A 3URFA 2Q1ZB 2DCZA 1PO21 4K6BA 4LUMA 4RQPC 1FPN2 5L36A 4FVVA 4W6WA 1CAVA 1KD7A 4AI2A 2YROA 4FAGA 3J8F2 3AYAA 2C9AA 3LA7A 1DQ2A 2AREA 4Q0SA 5FPXA 4OHXA 1R093 5C8CC 4XFCA 4YGBA 4LO6B 1XE7A 4PLOA 2K2SA 2B9UA 4H7MA 3WDUA 4EJRA 5C4WA 2R6QA 1MS3A 4COZA 3NW4A 5CAZA 2ZKNA 4L8QA 1EPZA 2YYOA 3LOBA 5HBAA 1ND2A 3P3PA 5CFDC 2XKOA 3IPVA 3SHRA 3IKWA 3S30A 2PLV1 3USUB 3VLBB 1RHI2 4Q4W1 2GMMA 1RGSA 3VBUC 5IK8A 1CVNA 2RJLA 4LR4A 2E7AA 5FO9B 3IIAA 1QDCA 2ZX4A 4UW5A 1LR5A 3U0ZA 4JVAA 1RL3A 1VBB2 3M3EA 1ZBA1 1NLSA 1N47A 4AEDA 4BIFA 4H7LA 4N9IA 1AYN1 5JOYA 3QD6A 1S0EA 2IXLA 4FTBA 4YARA 4N53C 3L2HA 2SLIA 3ME2A 5BNOA 3PNAA 1RUF2 3O14A 5T5JA 4UW4A 2YZ4A 2ZGRA 3DPRB 1G8WA 1QJU1 1VJ2A 5JZGA 1RUH3 3M70A 2CL2A 2QDNA 3VKNA 5FQ0B 1SMVA 1PNFA 2R041 3PMSA 1BQPA 2QVSB 4HVRA 4LT5A 4XHXA 3B3QE 1J58A 1FOD1 5BNPA 1PO11 4META 5GZDA 5C9AA 2DWRA 5SV8A 5JIUA 1CAUA 2CYFA 2I07B 3GHMA 4QQOA 4W6YA 2ZX3A 2FMYA 5H9SA 1IHMA 1HXS2 2VQ0A 3VL9A 1V6IA 2HWD3 4A7YA 4Q4V3 1HKDA 4RFT0 4S2HA 5C33A 3KT7A 5BNPC 3WP4A 3KCYA 1N1VA 1YFWA 4IV1B 1PIV3 2D97A 3JD72 3RNSA 1UN1A 1VBD2 4BM8A 4QPYA 2C0ZA 5FDBA 3WW3A 4F8AA 1BEV2 2JE9A 2VULA 3RYKA 4Z92B 4YW5A 3TB0A 1I6XA 2DVDA 2PELA 1FYUA 4HSLA 4E4ZA 3C3VA 1RITA 1AL21 4KL1A 4BMBA 1NCQA 1LEMA 4RS5C 5GLWA 1IPJA 2WS91 3HT1A 1CESA 2YDEA 3ETQA 3OJBA 4QGLA 1W6PA 1DYPA 1IS6A 2BPA2 2BBVA 2HJIA 2JENA 4ISRA 1G7YA 1OFSA 4Q8LA 1NLRA 5DUXA 4CEYB 5JSOA 4NR1A 1N3PA 1GKBA 1H8TB 1REEA 4FP2A 5CIRA 4FSJA 1JTZX 1MS8A 1JH5A 2MEV3 3JBG2 4R4XA 3ZSLA 3AMHA 3B02A 4OI1A 4FAHA 2ZGMA 3AFKA 3DL3A 3WW2A 3B94A 4HPKA 3WDXA 4GIQA 4QMAA 4RR3A 5EWSA 2GMEA 2VW1A 1CAWB 1Q8QA 3OPZA 3A0KA 3H3UA 2WNVB 2R16A 3JCIA 4OI2A 3ZFGB 4I02A 4PIYA 3TBDA 3D8CA 1RUG2 4P9IA 1ND3B 4P9YA 2WZPP 1PK6C 1A8DA 2Z42A 4GKYA 5LRSA 3ZXAC 1QH7A 3BIWE 4XBLA 3MIEA 4XJZA 5GZEA 3E5QA 4QD2A 5DDJ1 3DGTA 2PAMA 2QDRA 1ENXA 1U5XA 3SH3A 3AKRA 2WNEA 3FWEA 2RMU3 2YUEA 1DZTA 4W65A 4HN0A 1Z7S2 3AZXA 1RUG3 4LHNA 4X8NA 4XHBA 4TYSA 5KHKA 2WZR1 2RS11 2HWF2 2HKXA 3W58A 2UWCA 3RJRA 4P9GA 4EROA 4JGZB 2ARBA 3ZXFA 5AFBA 4DPNA 1AR82 2ZGSA 3MFCA 3FC0A 4XTPA 1KJRA 1V6NA 2X5IA 3HWJA 3LSEA 1D4M1 4DOUA 1QGLA 4MGYE 4AVSA 2DYCA 3TYJA 4AK3A 5DZEA 4JQRA 4QT6A 1ZRCA 5IK5A 4WM8A 1DHKB 5EYYA 2Y0OA 5GALA 5GLUA 1WW6A 1Q8VA 3O0XA 3D4KA 2Y0IA 2OA2A 2QZ2A 4LBOA 1H1IA 3GF6A 4DINB 1UW8A 1Y43B 5JDBA 3NSTA 1VBA3 2AZ5A 4ISQA 1FMD1 4UW3A 5FMOL 5D8AB 5H9QA 4J6GA 1ZZ7A 1VAKA 3DUIA 2LALA 4JRLA 4LA2A 1OA3A 4QM8A 4FOWA 2WIIB 4RQPB 3WQ7A 5I93A 2HWE2 4MZUA 2BEOA 3VBFB 3ZFEA 1D0HA 2RS31 1OOPC 1AR61 4UBGA 3OBTA 4Q29A 4QGNA 2VNGA 4Q4Y2 1VIWB 3LWCA 4EN0A 1C8M1 1PGL1 1ENSA 4BMEA 4F7ZA 2ZA9A 3ZFEC 3WINE 2XL7A 3VBOC 3E5XA 5AC91 5CFDB 1TME3 1QJX1 2D43A 1YO8A 2A6XA 1Z78A 2I45A 1DF0A 3Q9OA 1SDWA 3VZMA 3VBUB 4Q4W2 5K7PA 5GM0A 1MR5A 3AP5A 2Q8OA 2W39A 3VBSC 1RUE3 5IUQA 2H0VA 1VBC2 4O9EA 4IEQA 2FZ2A 4XXAA 1HRV1 3M1HA 3ZFFB 5K0UC 4IESA 4XETA 1J3PA 2B45X 1LGBA 2CNAA 5GJ6A 1AYN2 2CGPA 4N53B 2NLRA 1W6MB 3GZUC 3RMYA 1V9U2 1UKRA 1VR3A 3AJZA 4K40A 3ZXJA 4YG6A 4A2UA 1A3KA 4AGVA 2DVFA 3CO2A 3RJ2X 5JOXA 4WM7C 3WG4A 3BTAA 1NOVA 4LO8A 3WG1A 2B46X 3UK9A 4XF3A 1DG6A 1AZDA 2VMIA 4XXPA 1X50A 1AR92 1FOD2 5JVVA 1ASJ3 2D98A 2NN8A 3ST7A 4AI0A 4HKWA 4WVMA 3AKPA 1M06G 1VBE1 3AX4A 3O0WA 1CJPA 1O7FA 2D3SA 3VHNA 1BJQA 2D6KA 1URXA 2ZCWA 3B69A 4AYUA 4IL7A 1XNKA 3V0BB 4AE2A 3WG3A 1R091 4IEOA 3ES1A 4Q0PA 4LBJA 1VAMA 2P17A 4FPLA 2V09A 2LTNA 4AFBA 3H3ZA 4WZCA 5KBFA 4C0HA 4FQZA 1U0AA 3H8UA 3JZVA 2WWSA 4XJUA 1FPN1 3GALA 3ZYPA 3V0AB 5AFEA 2BFUL 2EAAA 2HWB2 1YNAA 2WA4A 4K1ZA 3ZSMA 5BNNA 3J8F1 5LEKA 4MGKE 4COWA 4Y1ZA 3ECQA 3KLSA 4B4QA 5E8AA 4LHKA 4AQ2A 4RS5B 3ZPYA 5JPMB 1DGRN 5CBLA 2OYZA 2WS92 3MGUA 1OHFA 3KQRA 1LKNA 2ZHLA 3H0OA 2VW0A 3USSA 1LODA 2R063 1UZZA 2A6YA 2GNBA 4RHV3 4H3WA 3MFAA 1Q5OA 1RHI1 2VGDA 2AYHA 3WQ0A 4OHYA 1EYBA 2N7GA 2XLAA 5FLIA 3U4XA 3MF6A 2GH2A 2UWAA 3BALA 4LLOA 1B35C 1H0BA 2EXHA 1VBB1 5EXOA 4W6XA 3PVBB 4IEWA 1ZZBA 4AHYA 3WQ1A 2Z69A 2XGXA 1LOBA 3D5OA 4DMIA 1LOFA 4HK9A 1TNRA 5FCCA 3M3OA 1Y9QA 3DPRC 5T54A 5ABJC 4Q4X3 2DUOA 1POV3 4AVCA 2R1DA 1N3OA 1LEDA 3H50A 2GU9A 4NO4A 3THTA 5I91A 4ZXKA 3VKMA 1W39A 1C1LA 5JSPA 1MS9A 5JI7A 3RI8A 2RM23 5DDJ2 2K0GA 5B2GB 4E4SA 1H2LA 2XPJA 4IV1A 1F5JA 1HXS1 2BVBA 1Q8PA 3T2TA 4HANA 3B93A 2DTWA 1MVQA 3MPBA 4FOYA 1WLWA 3H9AA 2WZR2 4YM1A 4GALA 3WXPA 4UBHA 4QXKA 2CY6A 3FFQA 5SV5A 4FTEA 5JPNB 4ES8A 1AR72 4G9SB 4Y1YA 3WV6A 4MUVA 1IS5A 1WW7A 1BKZA 1RUD2 4HFSA 2RS52 2ZHNA 5L7OA 1VBD1 1LB2A 2ZGUA 1SFYA 1NG0A 3OGJA 1RJ8A 5BPXA 2ZS6B 3VHRA 4GXLA 4FPHA 1FV2A 1O91A 4QPGB 3VGIA 2GN3A 1QU0A 2B7YA 1LOAA 1QNYA 3M8LA 4AF9A 3IMNA 4MXVA 4OULA 1R083 2XG3A 3UJQA 4CEYA 1OPOA 1H8TA 4XPVA 1AJOA 5I8SA 2HWC3 1OMIA 4DQAA 4YM0A 1C5HA 2A6VA 1YCIA 3OYWB 4QPIA 1FMD2 2JD4A 3OD0A 5DZFA 3OF1A 4K7JA 3ZXEA 3N7LA 1W6NB 4CEYC 1H8VA 4DZGA 5EV7A 1RVF3 4XF0A 5LRRA 4L92A 1TNFA 2RS32 2ZX1A 4ONUA 1YI7A 2VW2A 4PLMA 2WNVA 3ZFGA 5FREA 3ENRA 3K48A 2ES3A 5FMOS 2WQZC 1XXNA 4B29A 4B7KA 1ND3A 2I74A 3R4DB 1SCRA 4Y20A 3TN92 3VBOB 2DUQA 4XDQA 1DBNA 1MS5A 4N43B 4Z1VA 1EAH3 1RUC3 1PVXA 2NMOA 3B9CA 3ZFGC 1RUG1 4INDA 3JUUA 1O3SA 2DVGA 1MEC3 3TNPB 4YW4A 1PM7A 4FOQA 3H1MA 3PTYA 3I54A 1NQJA 3VBSB 5FBZA 1S2KA 1X33A 3EQEA 3IDBB 4I3GA 1H2NA 4PQ9A 1ZRDA 1S0JA 2ZAAA 3FBYA 4SLIA 3U10A 3HIFA 2VUAA 2ZTNA 1HRV2 3VL8A 1GLHA 4GWMA 4Q0UA 3WHTA 5K0UB 5A32B 3AB0A 4JGZA 1APNA 1EV12 2R32A 1Z7S1 4MVTA 2W08A 1LJ7A 3WCSA 1LESA 2ZZQA 4N7UA 3I59B 2ET1A 3RZZA 3AKQA 2HWF1 4CDUC 4L97A 4WM7B 3RDIA 3ZDSA 4FTSA 4Y1UA 3IWZA 1AR81 4LA3A 4LO5B 4MV2A 4PBOA 5GKAC 4JGZC 2BQPA 2ARXA 4YNIA 2XBO2 2WL1A 5J36A 1ZNPA 3BCWA 1MACA 4XJ8A 5LEJA 2EXJA 1MQTC 1EV13 2ZMKA 2E7TA 3B9IA 4AFDA 1RB8G 3AYCA 5D8AA 5FO7B 1AXKA 3I4IA 2A73B 3DV8A 4AI3A 1ZBE3 2CAUA 3DKWA 4YGDA 4YW1A 3INAA 3WP5A 4RQPA 2WFF3