2JIGA

Crystal structure of chlamydomonas reinhardtii prolyl-4 hydroxylase type i complexed with zinc and pyridine-2,4-dicarboxylate
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
216
structure length
216
Chain Sequence
EEWRGEVVHLSWSPRAFLLKNFLSDEECDYIVEKARPKMVKSSVVDNESGKSVDSEIRTSTGTWFAKGEDSVISKIEKRVAQVTMIPLENHEGLQVLHYHDGQKYEPHYDYFHDPVNAGPEHGGQRVVTMLMYLTTVEEGGETVLPNAEQKVTGDGWSECAKRGLAVKPIKGDALMFYSLKPDGSNDPASLHGSCPTLKGDKWSATKWIHVAPIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROLYL-4 HYDROXYLASE
publication title The Active Site of an Algal Prolyl 4-Hydroxylase Has a Large Structural Plasticity.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
total genus 56
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2jigA01
4XC9A 5ERLA 5EQUA 2OPWA 5A3UA 3EMRA 4NHMA 5HV4A 5LBBA 3DKQA 4XABA 2RDQA 4J25A 2G1MA 3W21A 5LBCA 4BQWA 4ZPIA 5DAPA 3MGUA 3GJBA 3KT4A 5C5TA 2RDNA 4NHKA 4MHUA 2RG4A 4MHRA 5LBEA 4KBZA 2JIGA 3KT1A 3BVCA 5LB6A 5LATA 3HQRA 5LBFA 3OUIA 2HBTA 3NNMA 3W20A 4Y5TA 3NNFA 4XCBA 5DAVA 2FCTA 4Y5SA 4Q5OA 4NHYA 3NNJA 4BQYA 4JZRA 5L9RA 3GZEA 3OUHA 2FCUA 2V4AA 2FCVA 2HBUA 4XACA 5EPAA 4XCAA 5LA9A 2G19A 5L9VA 4IW3A 3PL0A 5LASA 2RDRA 5DAQA 4BQXA 3KT7A 5M0TA 2Y34A 4UWDA 2RDSA 2JIJA 3GJAA 5L9BA 3HQUA 4NHXA 3OBZA 5DAWA 5IAXA 5HV0A 5EP9A 2A1XA 3ITQA 5IAVA 5C5UA 4NAOA 5IATA 3NNLA 4NMIA 4NHLA 2Y33A 4XAAA 4ZONA 3OUJA 5DAXA
chains in the Genus database with same CATH superfamily
4COZA 4XC9A 1LHOA 2UYBA 4GB33 1UF2C 3A0NA 4BQ4A 4DEQA 3QH6A 4RGKA 1UZWA 4YZ2A 1H1MA 1LJ7A 2HH9A 2Q8EA 4Y20A 2W2IA 1DZTA 1QNYA 4QPGC 5IT6A 4QHBA 1YEWA 2QQLA 1SCRA 2RS13 1BCXA 2ARBA 2ZKLA 3WV6A 3ZSEA 5FYMA 1O3TA 4IEOA 1CAUA 2WO7A 5FWJA 1QOTA 3LFMA 4AGVA 3S57A 4XBNA 1UZ0A 3AVSA 4E8CA 4IV1A 2A3YA 4HL0A 4AEMA 1CZSA 1WCUA 1KS5A 1OVSA 1URXA 1WKYA 3T0BA 1RB8G 2A75A 1ZRRA 1RJ8A 1RUJ3 1UX7A 2Y6KA 3JZVA 4M3CE 4Y1VA 3CL1A 4S2DA 2NM1A 4A2UA 3H50A 4DXZA 5FYIA 2QFEA 1FV2A 3AZXA 4DEVA 1PGL1 4YGBA 1UX6A 2EICA 4DY5A 1W8OA 4RQPC 3H0OA 3GJBA 5EJZB 4LOTA 3LA3A 4FP2A 2ZEYA 4M0NA 2RS51 2XUMA 1XYPA 1JYCA 4IEXA 3D4KA 2RDNA 3OOXA 3ZDVA 3K51A 1WD3A 4A4AA 1CR7A 5LBEA 1QQP1 1UY4A 1VBC3 2V5YA 3LFIA 5FMOS 5FPAA 4AHYA 1CIYA 4NIDA 1CAXA 4B4PA 5DDJ2 3BALA 1ONAA 2DDUA 1EUUA 1POQA 3ORJA 2C26A 5FZFA 2TBVA 5LB6A 4BCUA 1HQLA 3GBFA 2JD9A 4BMBA 1XBFA 4E4HA 1O4TA 4PDWA 1VRH1 4RR3B 3HPNA 3JQXA 4UBGA 1JH5A 1OA4A 1VBB1 2C9AA 2TNFA 1V00A 2W87A 4BLIA 4D7SA 4RS5B 4XCBA 4AI3A 4ISRA 4YFZA 4XILA 1XNCA 3M1HA 1RVF3 1KD7A 1S0CA 2E6VA 2ZGKA 3SQOA 4DRRA 2ORXA 2QQNA 1FT9A 2JX9A 4AL9A 5KHKA 4I3GA 4HZFA 4P9GA 1X9PA 3OUHA 5H9SA 1QOOA 5F39A 3P5BA 3MF9A 4M4RA 1GZCA 3NV3A 1RHI2 2ZEWA 4YVSA 4Q0UA 2OYZA 2QQIA 3WX5A 4CDWA 3P1IA 5JIUA 1I5ZA 3U4SA 5HCHA 3NAPC 4Q8LA 4OMCA 4QD2A 5KXDA 2RDSA 4QPGB 3AFKA 3C7EA 4NRQA 2VNRA 2OZJA 5APAA 4MGZE 1WGPA 1JYTA 1R1A1 4GIQA 4XZUG 5JXGA 1XRUA 5E88A 5KWRA 3PLQA 4YVWB 3APBA 1YO8A 2Y6HA 3GZAA 2D3RA 1W2OA 3RMYA 4FPLA 4LEJA 2BWAA 1DQ6A 1IG0A 1D0GA 4PF1A 4A6OA 2PYTA 3P3PA 1RUNA 5F6KA 4HMZA 4EN7B 2E32A 5H9QA 4RQPB 3LIGA 4FT8A 4UFMA 2QQKA 4ZONA 3IDAA 1AR82 1SLAA 1PVC3 4GH4A 1JU3A 4KG8A 4KU8A 4YW6A 5EYXA 2P1BA 3UKNA 3ZXDA 2VZRA 5FXWA 1MQTA 2VBBA 3B3QE 3PIJA 4CCNA 3OGJA 4DIQA 1AX0A 2MEV2 5FKCA 3VKOA 1NX9A 4EZHA 4FOVA 5I0DA 1Q3EA 2AGSA 1DQ4A 2YBPA 4UF0B 4CCMA 4M01A 4XF1A 2GU9A 1I6XA 3IAPA 5FXZA 5FXXA 3AYCA 1RHI3 4EWDA 2PHTA 3MDPA 4XFHA 2QDNA 4RFRB 5FZDA 5JOYA 3FBMA 1OOPA 1YLLA 4XFGA 1HV1A 4YW4A 5A7OA 4D8MA 2BDRA 3E5QA 3WF3A 4ES8A 5EHDA 2IXIA 5FZ7A 1HV0A 2YC4A 1OHFA 4MXWA 4FPEA 4NJ4A 5FZBA 4QPWA 4LA2A 4YZ5A 4JGZC 3LOIA 3VD3A 1PIV2 3POEA 3SEEA 2X10A 3H3ZA 5FP8A 4WM8A 2JECA 1D4VB 1MEC1 1FV3A 4NOTA 5K0UC 2ZX0A 1HN0A 3JBG3 4R9DA 4SLIA 4AK3A 4P14A 2OXBA 2WS91 3I54A 3K4ZA 2ORZA 2ERFA 3POJA 1V9U1 2P2KA 2JIGA 1WA4A 3KT1A 5FPLA 3T09A 1RUH2 3WVJA 4A3ZA 4CCOA 2WZEA 5F5QA 4OUMA 4RSUA 3ZO0B 1CPNA 1W05A 1RUE2 4W6WA 3UL2A 1DQ5A 2WQ4A 1QGLA 2FMYA 4KMQA 2AACA 2XB6C 2ZGTA 3OGSA 4V1PA 1N1VA 2WWSA 1R081 2ZOEB 4U2AA 5D8AC 3W20A 1NLQA 3ZFEA 4Q4V1 2A3XA 2EXIA 2JE7A 2A71A 2VOKA 1S2KA 4Y5SA 5JPMB 2VPVA 1HXS3 1JYVA 4UW6A 3NNJA 2D7FA 3EB7A 3V65A 1GZTA 1GU3A 3O1RA 3OBAA 2XJVA 1SLCA 1F4AA 3O5SA 3N9QA 3LDRA 1QXRA 2R071 1GOFA 3K48A 4XDOA 1J59A 1NT0A 2I45A 4KWKA 3S5AA 1AUYA 4QHZA 3VD5A 3S6PA 4CRQA 2WYFA 2ZAAA 4AVSA 4ZXKA 5FZOB 1X36A 3LEIA 1RUC2 4EN6B 2VMDA 4QX8A 2VG9A 4CXWA 2C1FA 1YIPA 2WC2A 4LUMA 1VBD1 2VJXA 5F3GA 4AHZA 1ND2C 1OC1A 1G9DA 2IC1A 3DGTA 1TMF1 1H8TC 2DU1A 2W1QA 2WNEA 4FOWA 2Z5WA 4CP9A 4ZU4A 1MS9A 4LJHA 1Q43A 2IVJA 1Z7S3 2WAAA 2XG3A 4HT1T 1DHKB 5FY5A 4ATEA 2XLFA 1RUH3 1HJFA 5T52A 2A1XA 3E97A 1F5FA 2E7AA 4NWWA 1RUE3 3UYJA 4AHXA 1NOVA 4NAOA 4GAZA 4CUBA 2DVFA 4XYXA 1OQ1A 5KC5A 2Y33A 3ZN5A 1KEXA 4E2QA 1TME3 4LNVA 1ENRA 3UGHA 5I8TA 2W1SA 1TG7A 3I2FA 5FY8A 3LSEA 3M3IA 2RMU3 5ERLA 1EV11 1BK1A 4HONA 4Q4W1 3POFA 2B9VA 5I93A 1PMHX 5ABJC 3ZX7A 2OPWA 4XEZA 5A3UA 1VBE1 5KHGA 1TEIA 2HWC1 5FZGA 5A7WB 3S7EA 3POWA 4FXKB 2VOTA 1NCRB 4LBQD 2D6PA 1G86A 3SH4A 5D8AB 1DLLA 2WNVC 3PUIA 5LBCA 4CP0A 1O3RA 2AUYA 1DIWA 2FBEA 4LXLA 1DGWX 2XJTA 3WNNA 1S4CA 2RM21 1L7LA 4JAAA 1PNFA 1YHFA 4QQHA 3OEBA 4LBQB 4PJYA 4Q4X3 1JN2P 3PMSA 1US2A 4LE3A 3ZYHA 4CEWC 4C91A 4LULA 5IFTA 4MH0E 1NYWA 3EYPA 4WZCA 4Q8KA 5F37A 5DZEA 1W3XA 2A6ZA 1ZZCA 3VZOA 3I2KA 3RS6A 1A78A 4NHKA 4ZU7A 2FDHA 2Y60A 1PO22 1PM7A 4XFAA 3I2JA 2VUAA 5IVYA 1AR62 4IGQA 3HBZA 2OS2A 4UBHA 4KBZA 4LHLA 3VBFA 3VBSA 5DMYA 4DUXA 4XJ9A 2RS31 4YARA 2FZ2A 2BUKA 5JDBA 4LHNA 4UFIA 3T3YA 5T50A 5JPNB 3V0BA 3LZZA 1JZ6A 2DVBA 4QX7A 3TEXA 2J7MA 3N9MA 5FMDA 3RGBA 2E51A 2P3IA 3GNEA 1DGLA 3JD72 2ET7A 4NAMA 5FYSA 3U75A 4BQ5A 2VZTA 2DVAA 4R9AA 3DECA 4H55A 1POV0 1D4M2 4IXLA 3RZGA 2ATFA 2K46A 3VUOA 4IE7A 2D5HA 4WVMA 5CVRA 2ZX4A 2IVIB 4OUEA 2VNGA 1I5PA 2PFWA 3B93A 2WT1A 2QUOA 2WFF2 3IIAA 3PVNA 5EPAA 3VKMA 2Q1MA 3ZN6B 3TB0A 2GP3A 4WZFA 2AH2A 2VMCA 3LQCA 1BMV1 1W06A 2LW8A 3I4IA 2HWB2 1ENQA 4MVTA 5K0UA 4IL7A 4UFLA 3LB9A 3VZJA 2ZGPA 4OYUA 5ABJB 2ZEXA 5B4XA 1D2QA 1UOGA 4XETA 3VD9A 2YDEA 1OT5A 3GJAA 5FBZA 2CWMA 1K12A 4AEDA 1PO23 3K3NA 3WDTA 5LCWL 1AR63 2VW1A 1N3OA 3OJBA 3PHMA 1LNSA 2XQXA 3KQRA 5DUUA 2BWCA 5HV0A 3IWZA 4RA0A 5FZHA 3QBQA 2PLV1 2VBDA 3J8F1 5ANNA 5F9TA 1HQNA 2R1BA 4CP1A 3ITQA 3UJOA 4Y5Z0 2ILMA 4N8MA 2AREA 3CNAA 3BU7A 4L9BA 4LA3A 3JD73 1OQEA 1IS6A 2Y0OA 3LEKA 3MI8A 4CEWB 3ZOIA 3WR0A 1ULOA 2DFBA 4IEUA 4NPMA 4GQ7A 5FJHA 2RR13 5J96B 1D4M3 3MZHA 4XQDA 2ZGQA 1W39A 4QPIC 1W6NB 2EA7A 3GCXA 2J42A 5B4NA 1MVQA 2NPIA 3D3AA 3WHUA 5HCAA 2DTWA 1ST8A 1ULPA 4HK8A 4QU1A 1YIFA 2EALA 5B2GB 1S0GA 4LHKA 2J1TA 3BTZA 2G9FA 5HV4A 4CU9A 2TUNA 2WFF3 3THPA 3VHNA 3BOWA 1E57A 1XQNA 5EXOA 1XNBA 3R4SA 3C7GA 4JTNA 1R091 2JG8A 4OCTA 1RJ7A 2RE9A 1DF0A 3MLLA 2HWB3 3AC0A 5L7OA 4XE9A 1W9YA 4OHYA 3H8XA 4RYDA 5JXJA 1VMHA 3VBUB 1ZNPA 3T4HB 4XQ4A 4FOQA 4FXGB 4JQRA 3CIHA 2AC1A 3X29B 3GDBA 3T0AA 4BK5A 2RS52 4AG4A 2GNBA 4YM1A 1MS1A 1LKNA 4GMP0 3L2HA 3ZLIA 3M8LA 4CDUC 4YZ4A 2MEV1 3PTRB 2H0BA 1JXNA 1QQP2 1ZZ8A 2B8MA 1AX2A 1CAWB 4JVAA 1H2NA 4UXAA 2LUWA 2A3WA 1RTVA 3OGGA 4YGDA 4CTEA 3O0VA 4QGNA 1F4HA 1VRH2 5JZGA 1DU3D 4J1WA 1VBB2 4WM7C 2WNUB 3T2OA 1AR71 2GP5A 4H2AA 3I3BA 4JRLA 4ASMB 3THDA 4AZZA 3ZFGC 3OPZA 1GNYA 4YW3A 1CX4A 4OI1A 1WUVA 1U5IA 1REDA 1L7QA 4Q1PA 1RC6A 1KQRA 4BQYA 2HJIA 4ITCA 3S0MA 1DQ1A 1O5LA 1O4YA 2E7QA 2EAKA 3GZEA 5FDBA 2XJSA 2CGOA 5LW9A 4L97A 5DPNA 3H3UA 3B69A 3NJVA 1SQ4A 1Q5OA 1XC6A 1RGSA 1W0PA 3KZ4C 2AEYA 1GFF2 1OLRA 1IPJA 3WT3A 1W9FA 4NIHA 2D43A 1BK0A 1LENA 1SCSA 2VD7A 4WV8A 4P9YA 5FP9A 4B8EA 2CAUA 2FD8A 2VULA 1O8PA 1XXNA 1LHNA 5SV5A 1Q8VA 4I3PA 4CCDA 1E5IA 3WUCA 1R1A2 1W6OB 2KD7A 3D6EA 2PHXA 1CIWA 5FYVA 3WDXA 4BK4A 4E4ZA 1CAVB 1VBA3 2I74A 4EWAA 4URTA 3HIFA 1HW5A 5IAXA 4QX3A 5DABA 2GZWA 2DUQA 5GKAC 2ZXQA 2PAMA 3WINE 3O1VA 1QMJA 1VRH3 1VB4A 1F2NA 4R4XA 4RFT0 1GBGA 2R32A 4XBQA 5IVBA 3KMHA 1VBB3 3K2OA 3NWKA 3SKJE 5G04L 2A6YA 4JGYC 3UKTA 4YM3A 2A6WA 4O9GA 1NCQA 4PI2A 3U4XA 5FQ0B 4Y1XA 4KWLA 4EYUA 2WLPA 4AVTA 5FUIA 3E5XA 3SLIA 5DAXA 1LGCA 5FZ1A 1T6GC 1COV2 2YMZA 3T08A 1VAVA 4XFIA 4CDUB 3CHXA 5AC93 3ZM8A 3VD4A 2PHUA 4Y22B 5F2SA 2VZ1A 3MW4A 5A33B 3LSDA 4DINB 4E2GA 3POBA 4XAEA 4XJWA 2UY9A 4IEPA 3E5UA 1WMFA 4WVZA 1K5MA 3KB5A 2QZ3A 2YFZA 2YGMA 1UY1A 3ZSKA 5C8CB 1SPPB 3ZFFA 2CU5A 5JVVA 3HQXA 3N7MA 1O7FA 4QM9A 3N36A 2BNMA 4X8PA 2ZAHA 3FFZA 1C5HA 3ZFGB 2PHWA 3PU8A 1QKQA 5DAPA 3NQHA 2VGDA 4D7TA 1O3SA 1W6MA 2GMPA 2ES3A 2VVDA 3GHNA 1SBDA 1WW4A 1WMDA 1AF9A 4I30A 5H9RA 3WDWA 2YPJA 5DG2A 4COYA 1MEC2 1A8MA 4K21A 3HNYM 4OHZA 5DZFA 2WS92 5KBFA 3ZYBA 2Y6LA 4MHUA 1V9U2 1AXKA 2W1WA 3EQEA 3GCWA 5FAXA 2VQ0A 4IQPA 4JDMA 3CJIB 4M3CB 2XJRA 1AL21 2OA2A 2WWJA 4IE4A 3WNLA 3WP5A 5FOJB 1NG0A 1OF3A 1YNAA 1R082 3CDZB 5IK4A 5EJ3A 3D8CA 2OIIA 3GGLA 4Z82A 2DVDA 4Q4V2 1HLCA 1OSGA 3WG4A 2L9LA 4QB6A 2Y26A 4JQTA 4HLTA 2OW4A 2WN2A 3WDUA 4HG6B 4GULA 2B39A 1H9WA 3A7QA 4XFCA 2O1QA 5DZGA 2VZQA 2IFRA 2YYOA 4JZRA 2R072 5CFDC 1ZZ7A 1OVPA 1AR91 1ULCA 2WO1A 1WLDA 2QVSB 3FUOA 1F15A 1U12A 3HJRA 1PZ8A 2HWF1 4BIFA 2YB7A 3ZXEA 1Q56A 3KF3A 1ACCA 4JHTA 3AYAA 1JW6A 4YYOA 3AZZA 4CDQA 3BTXA 1X8MA 4A44A 1HRV3 2P5BA 3BI3A 4HXCA 3MBWA 2VOWA 3MV11 3UNPA 2AENA 2D6MA 5LZ6A 4OQ9A 5A32A 1VBD2 2ARXA 1KDMA 1YQ2A 3AYEA 3NNGA 3MUZ1 1TMF2 3DPRA 3AL5A 3VHRA 2VH9A 2XPJA 4Y1YA 4XUNA 2WS93 2ZPXA 3G6JB 3LEGA 5CU1A 1OD3A 1V9U3 4F83A 4XW3A 2BVBA 2E63A 4AI2A 3NL1A 5D1IA 3LWCA 5JXIA 3LKJA 1RITA 5T55A 4AOCA 3RZJA 1KFUL 2ZACA 3KWVA 4JDNA 1R083 4Q29A 2WRAA 3PVOA 2RJ2A 4FPCA 4LKDA 4QQPA 1M4WA 2HWE1 2IXJA 2G9ZA 4XTMA 1LGNA 4OFGA 1DYOA 1LOCA 1H30A 3VDBA 1NQJA 3MIFA 4P08A 5FYCA 4EE2A 2R073 4Q4W2 1BBT3 1UYPA 4RR3C 2VECA 2JB8A 3KV4A 3Q8FA 4FBFA 1VBE2 3IN9A 2XBO1 4Q0VA 2XL7A 4RS5C 4XMIA 4Q0QA 2J1RA 1CGPA 1XYOA 2E26A 2HWC2 3ZMOA 4DNYA 4BLJA 2QQJA 3LA2A 2Z69A 4I09A 1G9FA 4W65A 2B7YA 4E9KA 2DYCA 3MIBA 3ME2A 3O0XA 2Q1FA 4B1LA 4HBNA 1K3IA 4LTAA 1OKOA 2ZGNA 4OZXA 2VC9A 1V6MA 3VDAA 2VMEA 1XYNA 4ES9A 2C6SA 5CFCA 2RM22 1ULGA 3VB9A 3RDIA 3SH5A 2B46X 2BGCA 1GZWA 1SBEA 3BYWA 3ZYPA 2HLEA 4P02B 2W92A 4RHV1 4P9WA 2ZBJA 4YPJA 1QJX1 3AP9A 4BQ2A 2Q4SA 2VTXA 5CFDB 2VQAA 1BVVA 1C57A 2Y6GA 2DV9A 2GMEA 2VXRA 2FDJA 3FHQA 4C1XA 1G6NA 2RHPA 3BODA 1BKZA 2PN5A 1U5YA 4Q1RA 1UY3A 1QY4A 2ZHLA 4CDXC 3CEWA 3ES1A 4TSVA 1BZWA 5JMCA 4FFIA 5FK8A 2RS32 1O4ZA 1UXXX 1S2BA 1UWWA 4YVWC 2IXCA 3UGFA 4G9SB 4ORFA 5BNNA 4A3XA 5EV7A 2BGOA 4YVSB 5HCBA 3QOPA 1EV13 4OHVA 1IKQA 4Q4W3 1MS8A 3VBHA 1CONA 1PK6B 1DFQA 3VHPA 4RL7A 4ZS3A 1ZA7A 2D40A 2FCTA 1HB1A 2R49A 4FO9A 2PQQA 5E6HA 2JG9A 1RYYA 3U07A 4DOUA 4KU7A 1FOD1 4XFFA 3I3MA 2P6CA 2VZPA 3HN1A 3ZYFA 5FWEA 3VBOA 1VE0A 1S0BA 2XJPA 3PJQA 2JDMA 1S0JA 3H8RA 1DGWA 2JDPA 1JUHA 3B5LB 2PXJA 1CESA 1XNDA 2KR2A 4N53A 3RSJA 2NZ9A 1LHWA 5JMOA 2QQOA 1CN1A 4MZUA 3KCYA 1BMV2 1DLCA 3I59A 3PVBB 1AVBA 4GWMA 4YG0A 5F5AA 5A70A 5LK7B 2NN8A 5LASA 3FL7A 1X82A 3POSA 4P9JA 2UURA 3S7IA 1NE6A 3Q8AA 4M4PA 4V2VA 5FUNA 1GSLA 2VCCA 4GH4B 3AMHA 4UW4A 5FOBB 2ADEA 2W46A 2VZSA 2Y34A 1W8ZA 3KCCA 5FY7A 5L36A 4MV2A 1NA1C 3ATGA 5BY5A 2XDVA 5GZCA 2W47A 1LOGA 3TNPB 3VDDA 2PLV2 3J8F2 2A70A 3KVAA 3LAGA 4Y1UA 3KGZA 4ZZ8A 1AL0G 4GJYA 1PMJX 2Y6FA 1HB4A 5KXEA 3KHCA 3M4FA 4JC1A 4GWJA 5C5UA 1OOPB 2FDKA 4FPOB 4K1YA 4XPVA 1JYNA 4LBOA 4FSJA 1QJU1 1QOSA 1H8VA 2B42B 2Y6JA 1E5HA 5IUQA 1B35C 3P3NA 4AR2A 2BERA 2PMWB 5F3IA 4MXWB 3C7FA 5C3PA 1CQ9A 1Y3TA 2VUCA 3U0ZA 1ZBA1 2WNOA 2X53S 4UW5A 4XUOA 4CDXB 1C1LA 5C33A 1WCSA 4XHXA 1XNAA 4XVHA 3WP3A 3K77A 3LOBA 3MLJA 5CADA 1TE1B 2ZTNA 3CMGA 3HT2A 2FHRA 2W94A 1BQPA 1R092 4TN7A 5DDJ3 3GBGA 1C3HA 2RDQA 2NMNA 5FUPA 1U5ZA 2XGXA 3POGA 1ZA4A 2Z42A 4XJZA 4EN8B 4AI1A 3BUCA 1Y4WA 4HETA 1T2XA 4D0QA 2YV8A 4X8NA 2VBPA 2GC2A 4SBVA 2XR4A 1ULFA 2V4VA 3MW3A 2XLGA 2WDBA 3OBRA 3WD5A 5T5PA 5C6CA 5JI9A 4BPZA 3ZYRA 4QX2A 1L3JA 4CA9A 1COV1 2WSUA 2V73A 3GXUA 4OZOA 3UETA 1AHSA 2PLV3 3J8F3 3BN6A 4D6RA 4CVUA 1NQDA 1LRHA 2Y38A 4IDZA 4QDQA 4G4FA 4BDVB 2RG4A 2YGLA 3WF4A 2RVAA 1ALYA 2WJSA 2VMHA 1RUF1 3BVCA 2WZR1 2UY8A 2VOXA 1YC61 4MX3A 3E6DA 1UMHA 3M3QA 4FTSA 2YC2A 3PDQA 4QB2A 2VOVA 3B7MA 1LOBA 4X6QB 5JR2A 2VMIA 1ND3A 3ACHA 1AR72 3N7LA 1NA1B 1OPOA 1QF3A 2R041 3H1YA 3H7YA 5CAZA 5A3WA 4QQOA 1LAJA 1CWPA 3IM0A 1IS3A 1XSRA 4HANA 4ZU5A 1UO9A 4FI9A 4GWNA 4CP9B 5AFBA 1CZTA 1AZDA 3VZMA 1R093 5A1LA 1ZBE2 2X8KA 3CLPA 4Y4YA 3SMHA 5FZAA 2VTXJ 1AYM1 1GV9A 4HK9A 5I8YA 4HOOA 1OA2A 3H9AA 5CG8A 3WNPA 4CCCA 4CU6A 3B00A 1H1IA 4DQAA 1B35B 4Y3OA 1B09A 3U14A 4AI8A 3LIHA 4AQSA 4BMEA 4TZDA 1AR83 3RPQA 3JUUA 5AVAA 5FO7B 4BISA 1NCRC 1JS9A 3IDCB 3I49A 2EIEA 1VP6A 3MYXA 4FPHA 4QPGA 4KWUA 2MEV3 4YFWA 3WQ1A 5DUVA 5L19A 2D6KA 3RI8A 2DF7A 1AX1A 3WSOA 1YFYA 2PHLA 2GN3A 4Z1VA 4A7KA 4URAA 5FY1A 4BA6A 3VGIA 1HIXA 3WW3A 1OURA 5FZLA 4CCLA 4LO8A 3FLTA 1LHUA 4MGSA 1W2TA 1I9RA 3A21A 3RQ0A 3V0AA 4QDRA 2ZX3A 4DS0A 1J1LA 4RQPA 2ARCA 3OD4A 3RFRA 3W58A 5FZ3A 4ZHNA 1DDLA 1J84A 3NJZA 5CIRA 1U0AA 1C8M2 4BHPA 1WBFA 1PIV3 3DL3A 1F5JA 1HB3A 3NSTA 5FZ4A 1YJLA 3PTYA 3HVDA 3KF5A 5LRSA 3A0KA 5KC6A 1RUD1 1NAEA 1S0DA 3OYWB 5EQUA 3USUB 2ZGRA 3KGLA 5IVVA 1C1FA 1H2LA 3ZXFA 4NIGA 1W2AX 5DUXA 5A6ZA 2OUJA 3OB8A 3VBFB 3QLQA 4JHZA 2VCMA 4JKKA 1UPSA 4XOGA 4MO3M 4DUVA 1FATA 4BQWA 1PGSA 2JDZA 2D97A 4RN5A 1MS4A 4B7EA 3BIEA 2D6NA 1UU4A 4COVA 4MSVA 3I3EA 2XLAA 4OUSA 1EYBA 1F31A 1AXZA 4CZSA 3AP4A 1OXCA 4CEYB 3KT4A 3AKPA 2LS6A 4AEJA 4LE4A 1MS0A 2JDKA 5C4WC 3T30A 4AEKA 3BTYA 5FK7A 5JSOA 2Q8OA 3RJRA 3ZSLA 2C4XA 2XONA 3HT1A 4K9SA 2LRPA 3NAPA 4MGQA 2RS11 1AL22 1H9PA 3VZLA 3ECQA 5CNAA 2VM9A 1RUC3 3OUIA 4IE6A 3WLUA 3SKVA 1RUG1 3IKWA 3OGVA 2C0ZA 2G9GA 2IUWA 3LDKA 5I0TA 4J1XA 4DMIA 3AMQA 3HN3A 2D3SA 4YW2A 3IDEA 3LEMA 3WZ1A 1OLQA 3C2UA 4EN9B 1N1TA 3LPFA 3RJ2X 3ACLA 1VMJA 3TN91 1H6YA 1RUJ1 5HXMA 3MUY1 4R8HA 3JCIA 3I3DA 4J6GA 2BYVE 3ZYGA 2NP0A 5FZMA 4XUQA 4HPKB 2YY1A 3A22A 1UIKA 5CYYA 1OH3A 1AR92 3KM5A 1AXYA 1VRBA 2IXHA 4QHOA 2QQWA 3DYMA 3TEZA 2HWF2 3DKWA 2FDIA 1ASJ1 5JAXA 1JI6A 1O8SA 3KLSA 3EBRA 1QJY1 4Z2WA 4L92A 3RZMA 2ETEA 1IQDC 5E1RA 4N9HA 4LBMA 4PT6A 1LR5A 3AMMA 5FYZA 3SCHA 4IE0A 4AFAA 2QCSB 1N1SA 2OPKA 1YUDA 2A6VA 3GM8A 4AFCA 4HKLA 1GWKA 3T1LA 1VMFA 3MFCA 4O61A 4Z07A 2XWJB 4XJAA 3VBRB 3VL9A 3WF2A 2KA3A 5IFPA 1IKPA 2EAAA 1ZRCA 5AFEA 2VNVA 3K46A 2JIJA 1GP5A 1BJQA 1NXD1 3ETQA 5T5JA 3VBUC 1VR3A 3IAQA 3WNMA 4NHXA 4ARXA 1RVF1 2QE3A 4INDA 2X5IC 1ODMA 5FZ8A 1OQDA 4XMAA 1XSQA 1W0NA 2EXKA 2NQYA 5FP7A 2HWE2 5BNOC 4P5YA 4JGZA 1H4GA 1F35A 2W68A 4XF0A 4I0WB 3ACIA 3DXTA 3ZSJA 1IQAA 3WQBA 2B45X 1RUOA 3PJYA 2BBAA 3J7HA 3LDBA 4I01A 5C71A 1XNTA 5A3PA 1HN1A 4ISQA 3IMNA 3EO6A 1YJKA 5C4WB 1AR93 2J1EA 4AFDA 5EYYA 5FLHA 3FE5A 1W8HA 1YFXA 2HWF3 2XBO2 3UV9A 1W28A 1TNFA 2WNUC 1DG6A 3AFGA 3O14A 5HXVA 5C9AC 1WCDJ 1QHDA 3OSDA 5LEJA 3PUHA 4Q4Y1 2BEOA 2ZABA 5A3MA 5A7WA 3WY6A 2Z4FA 1NCRA 3DCQA 2YBSA 4O9EA 5LBBA 2BTVC 2P3JA 5IWFA 5D8AA 5IVCA 2GALA 2OZ6A 1L7RA 4QX1A 3UT0A 1NUKA 1SBFA 3DYPA 3TNQA 2UWBA 2WKKA 5J98B 3HBKA 4BXFA 1KITA 2F17A 2CHHA 4RHV2 1QJX2 2BV4A 5FRAA 4AAPA 2DFCA 4R52A 5JOZA 2ZZQA 3IPVA 1DYKA 5DUWA 4BJ0A 2HYKA 1G9CA 1UYXA 2JDUA 4CPBA 1PVC1 4YW7A 4R9BA 2FQPA 4MGYE 5DXDA 4MHRA 3H7JA 3BTAA 3WUDA 1WW5A 4FCAA 1KRIA 1OFSA 1OBNA 3JXSA 1ND2A 1S0FA 1SEFA 2V5DA 3T2PA 4F3JA 2Q5TA 1H8TA 3T0DA 1STMA 2WO3A 1YYNA 1DQ0A 1RXGA 2W9XA 3PURA 2XBO3 2OQ6A 3MIEA 2JDNA 3E6CC 5A6YA 2VU9A 3ILRA 3C7OA 4OHXA 2X5IB 2Q0AA 2CNAA 5FZIA 5T5LA 4AFMA 1FOD2 5EZWA 2Q30A 3FHAA 4JCKA 5FMBA 1LB2A 5DG1A 2BU9A 5IVEA 4AFBA 5BNOB 2PHDA 4NIAA 2YFUA 2FCUA 2FCVA 3PIGA 2E53A 3DUIA 3JBG1 3U11A 2O8OA 4E8DA 4KQ7A 1TVGA 2Z2SB 1OKQA 4XCAA 5A3NA 4LKEA 2SLIA 5LA9A 5ANQA 3R05A 5C8CC 1NCQB 3MIDA 1E5SA 4CCEA 3I3QA 1POV1 5ABJA 1DZQA 3J7LA 3I97A 4BQXA 1O3QA 2GC3A 4CU7A 5C9AB 1WLCA 1XPWA 3DF0A 3K75B 1W04A 3NVCA 4UWDA 4ZXEA 4UW3A 1BEV1 2W5FA 4FOYA 3ZYJB 3OGRA 3N35A 5BNPC 1SDDB 3O1TA 2BBVA 3I2HA 3ZR5A 5A3OA 1J3QA 1HXS1 4ASLA 2WNVA 4HKOA 4Z8BA 5EP9A 1ZBE1 4IGPA 4FPKA 1A6CA 2CDOA 5FPXA 3PU3A 4HN1A 2HEVF 2CDPA 4F7ZA 5IAVA 3WG3A 3KSCA 3ZFFB 3AK0A 5F7UA 1JMUB 1QJU2 2DCKA 2HWD1 2PQSA 4IV3C 4CEWA 4BQ3A 2GMMA 4BU2A 5IHRA 4COUA 4JV4A 2WLQA 3PUAA 2DWRA 4LO5B 1ZYBA 2ID4A 3AYDA 3CJIC 2RS53 2BGPA 3AMPA 2D6OX 1W6NA 3ES4A 2ADDA 1W2UA 2JE8A 1W6MB 3WOGA 1ZBA2 2HEYF 2R30A 4EQVA 1X33A 1LOEA 3D0JA 5FP3A 2BVVA 1JOBA 1QQP3 2C5DA 2PAEA 3AB0A 3L2YA 4LBJA 4PBPA 5A7SA 1GLHA 4NHMA 4AQTA 4D7YA 5C70A 4K8RB 4A41A 1S2EA 5GLTA 3AKSA 3I2DA 1Z7S1 1ZZBA 1FX5A 1W6PA 4XABA 2J1UA 3AP5A 3OPWA 2BOJA 5BYNA 2XJUA 4YGEA 1UPIA 5TSWA 2VZOA 2XUEA 2A7AA 3KQ4B 3MW2A 3NV2A 4RGGA 3TOJA 4ZPIA 3VBUA 1AJKA 1DP0A 4YZ1A 3HOBA 1Y9MA 1D7PM 1K45A 1LOFC 4A7ZA 1C8M1 2P6HA 1TNRA 1LEMA 1BHGA 2FMDA 3SEPA 2XHKA 2ZGUA 3OY8B 2RMU1 1KS4A 3CQOA 4MGIE 5C5TA 1JHJA 3LPGA 4OHWA 5FCCA 1CAWA 1FPN1 3VL8A 2UWCA 1H2KA 1RUF2 4PIYA 1QJU3 2WZR2 1UNBA 4KBBA 5CKQA 3O1MA 1PX3A 2VZUA 4AWDA 1RIRA 1Z0HA 2R061 3FX3A 1J1TA 2VZ3A 3IBMA 3TEWA 1HKDA 4M3CF 4EWEA 5FREA 4YSFA 5I0SA 5A1FA 1ZBA3 2R042 5A32B 4GMP1 1RUI2 5BNPB 4PIZA 1R1A3 4IV1C 4FFGA 4AVCA 1EUTA 1ZREA 4Q5OA 4IEWA 1J83A 4HSLA 2D5FA 1W8UA 2PTMA 2X05A 1VLNA 3ZN4A 1PNGA 2DCJA 1AYM2 4AQ6A 2YPDA 3T2TA 2EIBA 2W91A 4IV3B 4YW1A 3Q9OA 2P34A 2OQ7A 4N43B 1F9KA 4JDOA 1AYN2 4QM8A 4XACA 3R4UA 1SFYA 1FAYA 5SV8A 1GP6A 2O0OA 2H6CA 3H8UA 4F8AA 2WQ8A 3AJZA 4FTBA 1G8WA 4QPIA 3ZPYA 2ZGLA 4AVAA 1COV3 3N9LA 3V64A 5A7NA 1BYHA 1C28A 3IIIA 5LY2A 1X50A 2CY6A 2QQPA 1E5RA 1W6OA 1WW7A 2ZGOA 4O65A 1HDKA 4PQ9A 3RYKA 4PDWC 1ZZ9A 4W50A 2UU8A 5FMOL 4AXOA 5L9BA 5LWBA 4BXSV 2K9ZA 1UW8A 4Q0PA 4DXRA 3DYOA 2DU0A 4YZ3A 3HAGA 2WZR3 2VCBA 1IG3A 4QDSA 3CBNA 1GQGA 3POIA 1XE0A 5ACA2 2GNDA 2YBKA 3O12A 4MADA 1QDOA 5HCFA 1MS5A 2EIDA 4YLZA 3LD8A 4FAHA 2VVFA 1GOGA 1XB9A 4Q26A 2R043 3FUQA 3UJQA 3QH7A 1Z78A 4NMIA 1UYZA 4NHLA 2D93A 2V09A 5A80A 4AI0A 2PAKA 2ZCWA 1LU2A 3B01A 5GALA 3HNBM 5KXBA 1R64A 1QH6A 1GZWB 4CDUA 4UYBA 5A33A 5JSPA 2DBIA 4YVSC 2BRTA 5C7GA 1LHVA 1MEC3 2ZHNA 2JICA 1RUD2 3WNOA 1FNYA 1JHNA 1PO11 1PK6C 1OD5A 3ASIA 2QNKA 4XF9A 3S5QA 3EMRA 4BZ4A 4Y20B 3TWIA 4FP3A 4S2GA 1RMU1 3AP6A 2VMFA 4A7YA 2FZ1A 1W8NA 2W0XA 4K20A 3T2QA 1SPPA 2VUJA 3AZYA 3R0RA 1H4HA 1GKBA 4WM7A 4J25A 4KG0A 1YXWA 1LOAA 3ELNA 1CAUB 5JUVA 2ZMLA 2YUEA 2WBKA 3LCPA 3I2GA 2EIGA 3ZFGA 5BNNB 4Q4V3 4IV1B 4M0HA 1FNZA 5JR7B 2WYSA 1SFNA 1WMEA 5FBJA 2VMGA 4D69A 5A7QA 4WVWA 3QCWA 4CUGA 4OLLA 2RR11 3MHZA 4GB32 1JZ3A 2VQTA 4GH4C 5IYYA 4UFHA 3BPZA 2EXJA 1YWKA 4K3UA 4FPGA 1MQTC 3U1XA 2JE9A 1LULA 1C4RA 2ZJCA 3IZOA 2PELA 2RS12 5FYHA 4M3CA 5A7PA 4OI2A 1PVXA 5FYUA 1OA3A 1CAXB 1SMVA 2Y8KA 4PIXA 4AQ2A 4GALA 3WCSA 1RUG2 1IZ3A 1VBD3 2HBTA 4DO0A 3O0WA 4TYSA 1G9BA 1YQ8A 1R1ZA 1Q8PA 2X29A 1UCXA 1TMF3 2H0VA 5G05L 4PDWB 4Y5TA 1RUD3 1OOPC 3TN92 1RUJ2 3FC0A 4YG3A 1JODA 4E4DX 3AKRA 1W6QA 1N47A 4BWOA 3OPTA 5J09A 3MO4A 5FLJA 1IS5A 5A3TA 4NN0A 3IDBB 4XFBA 5GLZA 1EPWA 5LRRA 5T5OA 3AKQA 1ASJ2 2GNTA 2A5ZA 4JGYA 1G7YA 2GH2A 2JDAA 3OD0A 1QJY2 3VDDB 3CF6E 1OMIA 2VO5A 2K0GA 2QKDA 3CZUA 3RVHA 4QU2A 4EZ4A 4XBLA 2DCYA 3OG2A 4AAXA 4AF9A 1X9TA 3LA7A 1Y9QA 3AL6A 1VALA 5GLVA 4IW3A 1UU5A 1UU6A 4CP2A 3R4DB 2E33A 5DAQA 4CDWB 3A23A 1WLTA 3G7DA 1EAH1 1RINA 4LLFA 4QGLA 1GMMA 3ZIXA 4C0HA 1MR5A 2NYYA 5T54A 1UOBA 1VBE3 5C3QA 3NMBA 2WAOA 2IWGB 2MPFA 2OT7A 1EP0A 4NR1A 2HWC3 4LO7A 4QGMA 1ENXA 3ZFEC 1RVF2 5DAWA 4MXVA 3F95A 3GZTB 3RZHA 3KD4A 1RUG3 4FPYA 5CKNA 2WR9A 3WP4A 1QXPA 4KL1A 3OCPA 1ZX5A 3KVBA 2RM23 3ZDSA 3T1MA 3N7KA 3TN93 5HBAA 1I3HA 5A1AA 1IPSA 3N7JA 1QNWA 1UL9A 3DEMA 1LEDA 4QKFA 3AXEA 2IXKA 3H1WA 1VAKA 3ZKUA 1ASJ3 1WZXA 3MICA 2CV6A 4LQRA 1EPZA 5FP4A 1MQTB 1QJY3 5F8PA 4DFSA 2BJSA 3K3OA 4Q4Y2 4LOSA 3SH3A 1PGW1 1XE7A 4Y33A 3SCGA 1X7NA 3MV01 4OI4A 2RS33 3AVRA 5FZEA 1VBA1 5CA6A 5EFUA 1DGRA 1LODA 3HEIA 2C24A 1YRZA 1FMD1 2JKXA 2WIIB 4Z92B 3Q8EA 1WA6X 3HR9A 3WEZA 4S2HA 3VKNA 1ZRDA 3D82A 3EHKA 3LF7A 4HKWA 2I07B 2RJLA 4IGOA 3WF1A 4QT6A 3NV1A 4LMFA 1DGRN 1ND3B 5CFDA 1G9AA 2BNNA 3CKHA 1J58A 1U5XA 3FFQA 5FZCA 4LK7A 5E16A 1PVC2 1WD4A 3MPBA 5FPZA 3UGGA 1HRI1 2VZVA 2UWAA 3DN7A 3ETPA 1V6OA 2XKPA 3I8TA 4Y1ZA 3RZKA 5AC91 4WM8B 1M06G 3LGRA 4IERA 5KHHA 4PCRA 3KV9A 2J1VA 3K4DA 4L11A 4XZPA 3ZKYA 1GANA 1S1AA 1UY2A 4K6BA 5FIXA 5K7PA 2ZMNA 4LBLA 1H6XA 5LATA 3ZIWA 2E7TA 2YC0A 4XQWA 3KS7A 4E27A 2CAVA 5K9YA 3N9NA 4I2OA 3VHOA 4B3NA 4NROA 1PK6A 4UI9L 5J36A 4LIUA 1AJOA 1S0IA 2DURA 3OTFA 2R16A 3ZFEB 1OF4A 2VE1A 3J26N 4HN0A 4Q4Y3 4BIOA 3AP7A 1YI7A 4NHYA 2BOIA 5KXCA 4MGTA 1W8FA 2D6LX 1NY71 5IJRA 3TYJA 3CO2A 2WN3A 3MPPG 3HNMA 5FMCA 3UESA 5LA2A 4GKXA 3JBG2 4XUTA 1YFWA 3C8XA 2CWSA 4QXBA 5JI7A 2NMOA 4AYUA 3MEPA 3V0AB 5I0RA 3KCXA 1Y43B 2G19A 2JJ6A 4KWJA 4FQZA 1GQPA 4RR3A 4PF5A 4D6SA 1SG3A 3VBSC 4Y26A 3VBFC 2DBNA 3QD6A 1LGBA 1MPXA 3VZKA 3K4AA 4RS5A 1IHMA 3OBTA 3SXWA 1Y7BA 1BEV2 4MYEA 1RUI1 3JU9A 3ZSMA 1XU2A 4BE3A 4XDQA 1JU4A 3NJXA 3Q8BA 5FY0A 1HXS2 4N7IA 3PUQA 4R4ZA 1CJPA 5F5CA 4BQ1A 2ZX2A 2KM2A 5ISLA 2EF6A 4CEYC 4E4SA 4K7JA 1NXMA 3WNXA 5GZDA 2ZMKA 4XIOA 3ZR6A 4W4ZA 2ARAA 2HWD2 1DQ2A 1AYN1 3J7NA 4L0PA 1DCSA 4MUVA 4IETA 1WMXA 4XDPA 4UOJA 1VIWB 4I02A 4A42A 1QDCA 3MLKA 2WUHA 3THCA 1HRV1 3J7MA 4W8JA 5F5IA 2Y0IA 5DQ0A 2E31A 4YGCA 1KDKA 1NE4A 2W08A 5CBLA 1LESA 2JEMA 3FHIB 4PI0A 1ZZ6A 4NRPA 3H42B 4CDXA 1OUXA 4CCKA 1JYWA 2BZDA 5KR7A 1O59A 4HFSA 1SLTA 4YVWA 4XXAA 1T6BX 1XOYA 4P9IA 1Z7S2 4AGGA 1GYKA 1JZ2A 2YROA 4AEDC 5I0UA 3ZPOA 1SZBA 3DKQA 4EJRA 3FLPA 4P9XA 2XQRA 5ACA1 1HJGA 1POV3 2EVXA 1V0AA 1WBLA 2NLRA 3AZWA 3NAPB 1O91A 4V2WA 3W21A 3AZVA 3KV6A 3SC7X 3VZNA 4B1MA 3O7OA 5CG9A 4QX5A 1AR73 1OH4A 4BYYA 2VY0A 3H8OA 1BEV3 1VPHA 2R0FA 1W2NA 4FFFA 4JRAA 1DYPA 2CSGA 3M3OA 4B4RA 4NIIA 4BOWA 1JUIA 1OLMA 1TME2 5IVJA 2JB4A 4AE2A 4RGAA 5IK7A 3FLRA 4K1ZA 3ZXKA 1SLLA 5JSRA 4DRVA 1MZFA 1ZBE3 2RMU2 3IB3A 4NPRA 3VBRC 2ENRA 1CPMA 4CE8A 4UF0A 2A73B 5FO9B 1BBT1 1FPN2 4LO6B 4P5HA 4NVPA 5GLWA 5FJKA 3T4VA 5J3UA 1S55A 1I1EA 4KNCA 3TRSB 4C8DA 2YU2A 3VN4A 2GC0A 2HWD3 4IESA 5LA1A 2XKOA 1D2SA 2QQMA 1NLSA 2R062 2J1SA 3VBSB 2BW8A 4QQ2A 1CD3G 1QJEA 2TEPA 2D3PA 2PHFA 3LE0A 5CB7A 3WW4A 2HEWF 3MIHA 4ZS2A 1KXGA 1NKGA 1NA1A 2GN7A 3V0BB 2JG8C 3N3HA 1W9SA 3QACA 1J3PA 2OUHA 2WT0A 5DAVA 4GJZA 5IVFA 2ZKNA 2BP6A 1MACA 1UMIA 3AXDA 4HVQA 5L7OC 4Q4X2 4OI0A 3NRUA 2H6BA 2QJVA 5FYTA 1WCQA 2XVLA 3GZUC 1H1AA 4QPYA 3TBDA 1REEA 1J3RA 4GB31 1A3KA 4QX0A 2DUPA 2CGNA 2E9QA 1XJAA 2EXHA 4EN0A 3J9SA 4WVMB 5LA0A 4AVBA 3DV8A 1B35A 3E1F1 2ZGMA 5LY1A 5CKMA 4LK6A 4GKYA 4PLNA 3N9OA 4JGZB 3R6SA 4YRDA 1C8M3 2DCZA 1UN1A 2LALA 1QU0A 3TEYA 1A34A 2YHJA 3PUSA 3TAYA 2JXAA 2MNGA 3PNAA 4H3WA 3SISA 5K0UB 2D44A 2B9UA 5J1XA 5F3EA 5JZGC 4AVVA 1FPN3 5A3LA 2N7GA 1OLME 1W3VA 1W90A 2P37A 2KXLA 4AW7A 4AEDB 4KGGA 2FDGA 2BNOA 3FMGA 5FPVA 2R063 4IE5A 2JENA 5FZ9A 3VKFC 4L8QA 1UMZA 4NRMA 3GF6A 3SHRA 5C3RA 4GMP3 1V70A 2AZ5A 3ZXGA 5FZOA 3WQ7A 1VBC1 4C90A 3M2MA 3WXPA 4CPBD 4XJUA 3O1UA 3U10A 1C8NA 5I91A 1QEXA 4HVOA 1KFXL 1UQXA 1CJDA 2JD4A 1GWMA 2JDYA 3S30A 3IPVB 4CU8A 4DZGA 3OYWA 4CUCA 5LK5A 1PO12 5FZ0A 3USUA 3RWKX 3MFAA 4D94A 2JDHA 3I7DA 1BLZA 3GBWA 5E8AA 4HVRA 3URFA 2ZHMA 1RMU2 4YNIA 3HD8B 2P17A 1PX4A 4L2NA 5K8SA 5LEKA 2Z79A 1AL23 4H7LA 4AI9A 4LR4A 4XHBA 1QJZA 4G3YC 2WZPP 4COWA 3FN9A 2IXLA 4FPJA 1UOJA 1GNHA 2JG8B 3SCFA 1JOJA 1ND2B 2BFUL 1LECA 3BCWA 1LTEA 2ZHKA 1H8TB 5L7OB 4MG2A 2XMLA 1W0OA 3V56A 3CJXA 1IPKA 4ARYA 2B5HA 4JX0A 4FFHA 4B7KA 2XHNA 3CU7A 4Q27A 4XIKA 2AEZA 4Q2FA 4CEYA 1NCQC 1ZM1A 5FPBA 5GJ6A 4GA9A 2RR12 1CZVA 4TLFA 1GR3A 3RI9A 5HPOA 4CYDA 5D21A 3WQ0A 3INAA 3I2OA 2GC1A 4P9LA 3IMMA 1W9TA 3ROUA 3WP6A 4DY3A 5EJ1B 2IZWA 2Q8CA 2WWUA 5H9PA 3ENRA 4QXHA 4QXCA 3J4UH 4ZY9A 4XJ8A 4EROA 1UD1A 1VAMA 2DCTA 4DUWA 2ZS6B 5FZ6A 5JOXA 5DDJ1 4FPFA 3O1SA 2CYFA 5F2WA 1K5MC 2JKBA 1ZRIA 4PBOA 1WCKA 3NJYA 5A6QA 2GAUA 2W3JA 4NE9A 5DN2A 5JZGB 3F2ZA 1D0HA 3ZFFC 5FR3A 3M3EA 5J7MA 4LBQA 5J37A 1PO13 4XF4A 2OX0A 3RNSA 5F3CA 4HPKA 4FVVA 1RMU3 1XE8A 2VCAA 4XUPA 1UIJA 3ZXLA 4ZKTB 1JYXA 4UFKA 3NO8A 3RZZA 5L73A 4D6QA 1TQ5A 3L9JT 4DB5A 2F4LA 1OPMA 2O8QA 3I2IA 1HQWA 4NUBA 3BGAA 2WINB 3Q8CA 2WNVB 4TXWA 1YQ5A 2HWE3 2C9KA 4NO4A 2Q8DA 2WZ8A 1RHI1 1H2MA 4ET7A 4JTOA 5FZKA 4MOAA 5GM0A 2OVUA 1KJRA 2XVGA 1UKRA 3PL0A 5F32A 1SHWB 3VBRA 3WHTA 1SFPA 5C8WA 1EAH2 2OKXA 5IW0A 3OEAA 5GZGA 3HWJA 1DZRA 2FDFA 3BU0A 2X09A 4GD4A 3SNMA 4O7XA 2WFPA 4K40A 4WVVA 4LBKA 1GQHA 2WT2A 1W8WA 4N9IA 3HQUA 3PVEA 3O1OA 1K42A 3OBZA 4LKFA 3VD7A 4W6XA 3BKZA 4GWIA 1MZEA 1PM4A 4M00A 4PLOA 1VB2A 5JOWA 4R9CA 2VNOA 1BVP1 1W6PB 1TZOA 1LU1A 3GHMA 3ZN6A 3B9CA 1MZ6A 1OI6A 3NNLA 4TLGA 4N90A 4RHV3 4XXPA 1QJX3 3RMXA 4Y24A 2VAUA 4Z2AA 1PGL2 3VDCA 4LPLA 3MIGA 5C4WA 4LUKA 1QIQA 4QAWA 4CDQC 4D3WA 5F1RA 2V72A 2DVGA 1AR81 1V6LA 2LROA 2XWBB 2LM3A 3KV5A 1MZ5A 2QDRA 2HKXA 1Q8SA 1PGW2 4PLMA 4B29A 4I0BA 4BM8A 4A45A 3DPRC 2VR4A 3NW4A 4DXSA 1VBA2 1SACA 2QQUA 4FAGA 1K5MB 3WW2A 2W39A 1FMD2 1PZ9A 3ON7A 4P00B 3ZMNA 1UZVA 2G1MA 4A6SA 4IUGA 1EAH3 5C3SA 3EJKA 1GICA 1JTZX 1WW6A 2Q1ZB 4N43C 5T3NA 1CX1A 3KHBA 5BV6A 3RYRA 4HSJA 4QKDA 4MLOA 3EXUA 1QH7A 4QB1A 1FOD3 1HRI2 2R0HA 2WABA 2YG0A 2AYHA 2WL1A 3BOPA 3JQWA 1PIV1 3AJYA 3ILNA 1DBNA 4LLOA 4ONUA 5AC92 5E89A 3ZXAC 2I2SA 1GNZA 3CZJA 3WG1A 1SLBA 3AM2A 1QWRA 5KHJA 1BXHA 5I8SA 1ODNA 1QXJA 2K2SA 2R1DA 3NV4A 4AGRA 3THTA 2WQZC 3JB4C 5BNQA 5GZFA 1RUH1 3HQRA 1GWLA 3NKTA 3GYDA 2ZEZA 5FY9A 4OVEA 1RUE1 2VVEA 4QPIB 1F8VA 4TWTA 2QQVA 1A8DA 4OULA 2XXZA 3NNFA 1N1YA 3RZLA 3AX4A 4DPNA 4CXXA 2BFUS 1W9WA 4GXLA 1UOFA 2X5IA 1K5JA 5CFCC 1TME1 1H0BA 1NY72 3ACGA 3W9AA 4PHZA 2VXJA 3H1MA 1IS4A 1JBCA 4X6RB 3W5NA 1UY0A 1US3A 1FMD3 3AKTA 5BNOA 1GP4A 5JIAA 1O6UA 1WWYA 2GDFA 5FV3A 3RWNA 5KHIA 1C5IA 4K8FA 5FPUA 2P3KA 1RXFA 3FBYA 1MVEA 4LHSA 4OQ8A 4QXKA 3ILFA 4CDQB 4LORA 4Q0SA 5GZEA 5L9VA 4TTGA 5FFOC 1XU1A 2G4IA 3NKGA 2YZ4A 4PQQA 3USSA 1RUC1 1HRI3 2WNUA 5C9AA 1N3PA 3GALA 5FXVA 3ALQA 3AMNA 1JOPA 3D5OA 1P8JA 1W99A 3KT7A 5FYBA 5BNNC 5M0TA 3H3LA 3DPRB 1VJ2A 2P3YA 1PHMA 2VUDA 3VBHC 4Q4X1 4YM0A 1UXZA 2ZZJA 4S2FA 1O5UA 1UYYA 5JWPA 1N3QA 4ASKA 4XURA 4META 4LITA 2PHRA 3WNKA 4UFJA 3DXUA 3HMYA 2F4PA 5J48A 2XH6A 5JLVA 2JG9C 4WM7B 5IATA 2IFWA 3N9PA 4ATFA 2P4EA 4QKBA 5C3OA 3VBOC 3BIWE 4ZZ5A 1HRV2 2HYXA 2J1AA 1LCLA 1V6KA 2W52A 2CTVA 3M3CA 2VW2A 3BPSA 4N53C 2DUOA 3P6BA 5CZKA 3E6BA 4LBNA 4XTPA 4OMDA 5JXHA 1CAVA 1NZCA 4FQ4A 5FY4A 4IEYA 1NZIA 2D98A 1HB2A 1RUF3 1NLRA 3FJSA 1JZ8A 2WA3A 3WDYA 3UK9A 1YCIA 1JYIA 3ABZA 5BXXA 2ZGSA 1ZVFA 1YQCA 3U78A 5BUVA 5JCTA 5GLUA 4H7MA 1FI2A 3C7HA 5FTTC 3VDDC 2F6BA 4BH9A 2VQUA 3BB6A 4NWVA 5FQ0A 4FTEA 1PMIA 1RUI3 4YW5A 2QTWB 4QQLA 5A6XA 4BB3A 1ENSA 2YXSA 5CFCB 1IOAA 2B4KA 2XVKA 3ZYIB 2VW0A 2ZX1A 4E2SA 2LTNA 1ZRFA 2ET1A 5F6LB 3MGUA 4XF3A 3WF0A 3FZ3A 4Y4RA 2O14A 4Y22A 3RG0A 2XL9A 1W6QB 2Y64A 3OY8A 4IEVA 4QKNA 4CDWC 1BBT2 2QBXA 1AYM3 2CL2A 1GOHA 2XOMA 4L99A 4N7UA 2QZ2A 3ST7A 1EY2A 4JKMA 1JZ7A 1YFUA 4JGYB 4U36A 1AYN3 4KGQA 5C8CA 2GSYA 1PO21 3M70A 4QMAA 5CISA 1AR61 1X8EA 3A4UA 1QJFA 3WW1A 3VV1A 1IGOA 1XNKA 3FWEA 3OF1A 5LBFA 4RD7A 1MS3A 2RJKA 4C1WA 4CSWA 3NNMA 3U37A 5CEHA 4AHWA 4CUAA 2R7EB 3SITA 5BNPA 2WA4A 4I0AA 3RRDA 3WDVA 2VL4A 3ZXJA 4CCJA 4LIVA 3B02A 3VBHB 1FXZA 3JD71 4LO4B 3MF6A 1KGYA 4C0BA 5FO8B 3ZVXA 1V6JA 4IEZA 1UZYA 3WCRA 1HX6A 5L9RA 4QWNA 1V6IA 1YI9A 3O1PA 1D4M1 1Q8QA 3WG2A 3W5MA 2BPA2 1FYUA 2AR6A 2JG9B 4IEQA 4WBBA 5ACA3 5HI0A 4IV3A 4MGKE 5BPXA 4N43A 1SDWA 1APNA 3ACFA 2XJQA 3M7AA 5IK5A 2V4AA 2GNMA 1JZ4A 5IK8A 2JWPA 2WSVA 2HBUA 2DTYA 3B9IA 4JKLA 2J22A 4KI5M 3VBOB 1W03A 1W8TA 3CJIA 1JZ5A 3B94A 1V6NA 4UAPA 2WFF1 4N53B 2PA7A 1PZ7A 3POYA 5FLIA 3I59B 3PMEA 2RDRA 2RV9A 1WLWA 2WO2A 1EV12 2HWB1 1GZ9A 2BQPA 4YWAA 5AVPA 4GZ9A 3N4MA 2A6XA 4EV0A 2MHFA 5FKBA 1GUIA 3C3VA 4YG6A 1OFNA 4DXTA 2W1UA 4NPLA 4LKSA 2CGPA 2UYAA 1S0EA 4B4QA 1ND3C 1UZZA 1UAIA 1KJLA 1YQ6A 1ULEA 4UT5A 4LT5A 5K4LA 1Q8OA 1OUSA 5EIYB 3RYPA 5EWSA 1ULDA 2W95A 3UKVA 2SBAA 1SLIA 2VTFA 3IT8A 3VLBB 4YM2A 1REFA 4WM8C 3JB8A 3VKLA 3D0SA 1VBC2 3W59A 2GH8A 1LOFA 2R6QA 1RL3A 5D2AA 1Y9GA 2YU1A 4W6YA 4XAAA 5FYYA 2ZA9A 4H14A 4KH9A 4CXYA 1CVNA 3OUJA 1UKGA
chains in the Genus database with same CATH topology
4XC9A 5ERLA 5EQUA 2OPWA 5A3UA 3EMRA 4NHMA 5HV4A 5LBBA 3DKQA 4XABA 2RDQA 4J25A 2G1MA 3W21A 5LBCA 4BQWA 4ZPIA 5DAPA 3MGUA 3GJBA 3KT4A 5C5TA 2RDNA 4NHKA 4MHUA 2RG4A 4MHRA 5LBEA 4KBZA 2JIGA 3KT1A 3BVCA 5LB6A 5LATA 3HQRA 5LBFA 3OUIA 2HBTA 3NNMA 3W20A 4Y5TA 3NNFA 4XCBA 5DAVA 2FCTA 4Y5SA 4Q5OA 4NHYA 3NNJA 4BQYA 4JZRA 5L9RA 3GZEA 3OUHA 2FCUA 2V4AA 2FCVA 2HBUA 4XACA 5EPAA 4XCAA 5LA9A 2G19A 5L9VA 4IW3A 3PL0A 5LASA 2RDRA 5DAQA 4BQXA 3KT7A 5M0TA 2Y34A 4UWDA 2RDSA 2JIJA 3GJAA 5L9BA 3HQUA 4NHXA 3OBZA 5DAWA 5IAXA 5HV0A 5EP9A 2A1XA 3ITQA 5IAVA 5C5UA 4NAOA 5IATA 3NNLA 4NMIA 4NHLA 2Y33A 4XAAA 4ZONA 3OUJA 5DAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XC9 A;  5ERL A;  5EQU A;  2OPW A;  5A3U A;  3EMR A;  4NHM A;  5HV4 A;  5LBB A;  3DKQ A;  4XAB A;  2RDQ A;  4J25 A;  2G1M A;  3W21 A;  5LBC A;  4BQW A;  4ZPI A;  5DAP A;  3MGU A;  3GJB A;  3KT4 A;  5C5T A;  2RDN A;  4NHK A;  4MHU A;  2RG4 A;  4MHR A;  5LBE A;  4KBZ A;  2JIG A;  3KT1 A;  3BVC A;  5LB6 A;  5LAT A;  3HQR A;  5LBF A;  3OUI A;  2HBT A;  3NNM A;  3W20 A;  4Y5T A;  3NNF A;  4XCB A;  5DAV A;  2FCT A;  4Y5S A;  4Q5O A;  4NHY A;  3NNJ A;  4BQY A;  4JZR A;  5L9R A;  3GZE A;  3OUH A;  2FCU A;  2V4A A;  2FCV A;  2HBU A;  4XAC A;  5EPA A;  4XCA A;  5LA9 A;  2G19 A;  5L9V A;  4IW3 A;  3PL0 A;  5LAS A;  2RDR A;  5DAQ A;  4BQX A;  3KT7 A;  5M0T A;  2Y34 A;  4UWD A;  2RDS A;  2JIJ A;  3GJA A;  5L9B A;  3HQU A;  4NHX A;  3OBZ A;  5DAW A;  5IAX A;  5HV0 A;  5EP9 A;  2A1X A;  3ITQ A;  5IAV A;  5C5U A;  4NAO A;  5IAT A;  3NNL A;  4NMI A;  4NHL A;  2Y33 A;  4XAA A;  4ZON A;  3OUJ A;  5DAX A; 
#chains in the Genus database with same CATH topology
 4COZ A;  4XC9 A;  1LHO A;  2UYB A;  4GB3 3;  1UF2 C;  3A0N A;  4BQ4 A;  4DEQ A;  3QH6 A;  4RGK A;  1UZW A;  4YZ2 A;  1H1M A;  1LJ7 A;  2HH9 A;  2Q8E A;  4Y20 A;  2W2I A;  1DZT A;  1QNY A;  4QPG C;  5IT6 A;  4QHB A;  1YEW A;  2QQL A;  1SCR A;  2RS1 3;  1BCX A;  2ARB A;  2ZKL A;  3WV6 A;  3ZSE A;  5FYM A;  1O3T A;  4IEO A;  1CAU A;  2WO7 A;  5FWJ A;  1QOT A;  3LFM A;  4AGV A;  3S57 A;  4XBN A;  1UZ0 A;  3AVS A;  4E8C A;  4IV1 A;  2A3Y A;  4HL0 A;  4AEM A;  1CZS A;  1WCU A;  1KS5 A;  1OVS A;  1URX A;  1WKY A;  3T0B A;  1RB8 G;  2A75 A;  1ZRR A;  1RJ8 A;  1RUJ 3;  1UX7 A;  2Y6K A;  3JZV A;  4M3C E;  4Y1V A;  3CL1 A;  4S2D A;  2NM1 A;  4A2U A;  3H50 A;  4DXZ A;  5FYI A;  2QFE A;  1FV2 A;  3AZX A;  4DEV A;  1PGL 1;  4YGB A;  1UX6 A;  2EIC A;  4DY5 A;  1W8O A;  4RQP C;  3H0O A;  3GJB A;  5EJZ B;  4LOT A;  3LA3 A;  4FP2 A;  2ZEY A;  4M0N A;  2RS5 1;  2XUM A;  1XYP A;  1JYC A;  4IEX A;  3D4K A;  2RDN A;  3OOX A;  3ZDV A;  3K51 A;  1WD3 A;  4A4A A;  1CR7 A;  5LBE A;  1QQP 1;  1UY4 A;  1VBC 3;  2V5Y A;  3LFI A;  5FMO S;  5FPA A;  4AHY A;  1CIY A;  4NID A;  1CAX A;  4B4P A;  5DDJ 2;  3BAL A;  1ONA A;  2DDU A;  1EUU A;  1POQ A;  3ORJ A;  2C26 A;  5FZF A;  2TBV A;  5LB6 A;  4BCU A;  1HQL A;  3GBF A;  2JD9 A;  4BMB A;  1XBF A;  4E4H A;  1O4T A;  4PDW A;  1VRH 1;  4RR3 B;  3HPN A;  3JQX A;  4UBG A;  1JH5 A;  1OA4 A;  1VBB 1;  2C9A A;  2TNF A;  1V00 A;  2W87 A;  4BLI A;  4D7S A;  4RS5 B;  4XCB A;  4AI3 A;  4ISR A;  4YFZ A;  4XIL A;  1XNC A;  3M1H A;  1RVF 3;  1KD7 A;  1S0C A;  2E6V A;  2ZGK A;  3SQO A;  4DRR A;  2ORX A;  2QQN A;  1FT9 A;  2JX9 A;  4AL9 A;  5KHK A;  4I3G A;  4HZF A;  4P9G A;  1X9P A;  3OUH A;  5H9S A;  1QOO A;  5F39 A;  3P5B A;  3MF9 A;  4M4R A;  1GZC A;  3NV3 A;  1RHI 2;  2ZEW A;  4YVS A;  4Q0U A;  2OYZ A;  2QQI A;  3WX5 A;  4CDW A;  3P1I A;  5JIU A;  1I5Z A;  3U4S A;  5HCH A;  3NAP C;  4Q8L A;  4OMC A;  4QD2 A;  5KXD A;  2RDS A;  4QPG B;  3AFK A;  3C7E A;  4NRQ A;  2VNR A;  2OZJ A;  5APA A;  4MGZ E;  1WGP A;  1JYT A;  1R1A 1;  4GIQ A;  4XZU G;  5JXG A;  1XRU A;  5E88 A;  5KWR A;  3PLQ A;  4YVW B;  3APB A;  1YO8 A;  2Y6H A;  3GZA A;  2D3R A;  1W2O A;  3RMY A;  4FPL A;  4LEJ A;  2BWA A;  1DQ6 A;  1IG0 A;  1D0G A;  4PF1 A;  4A6O A;  2PYT A;  3P3P A;  1RUN A;  5F6K A;  4HMZ A;  4EN7 B;  2E32 A;  5H9Q A;  4RQP B;  3LIG A;  4FT8 A;  4UFM A;  2QQK A;  4ZON A;  3IDA A;  1AR8 2;  1SLA A;  1PVC 3;  4GH4 A;  1JU3 A;  4KG8 A;  4KU8 A;  4YW6 A;  5EYX A;  2P1B A;  3UKN A;  3ZXD A;  2VZR A;  5FXW A;  1MQT A;  2VBB A;  3B3Q E;  3PIJ A;  4CCN A;  3OGJ A;  4DIQ A;  1AX0 A;  2MEV 2;  5FKC A;  3VKO A;  1NX9 A;  4EZH A;  4FOV A;  5I0D A;  1Q3E A;  2AGS A;  1DQ4 A;  2YBP A;  4UF0 B;  4CCM A;  4M01 A;  4XF1 A;  2GU9 A;  1I6X A;  3IAP A;  5FXZ A;  5FXX A;  3AYC A;  1RHI 3;  4EWD A;  2PHT A;  3MDP A;  4XFH A;  2QDN A;  4RFR B;  5FZD A;  5JOY A;  3FBM A;  1OOP A;  1YLL A;  4XFG A;  1HV1 A;  4YW4 A;  5A7O A;  4D8M A;  2BDR A;  3E5Q A;  3WF3 A;  4ES8 A;  5EHD A;  2IXI A;  5FZ7 A;  1HV0 A;  2YC4 A;  1OHF A;  4MXW A;  4FPE A;  4NJ4 A;  5FZB A;  4QPW A;  4LA2 A;  4YZ5 A;  4JGZ C;  3LOI A;  3VD3 A;  1PIV 2;  3POE A;  3SEE A;  2X10 A;  3H3Z A;  5FP8 A;  4WM8 A;  2JEC A;  1D4V B;  1MEC 1;  1FV3 A;  4NOT A;  5K0U C;  2ZX0 A;  1HN0 A;  3JBG 3;  4R9D A;  4SLI A;  4AK3 A;  4P14 A;  2OXB A;  2WS9 1;  3I54 A;  3K4Z A;  2ORZ A;  2ERF A;  3POJ A;  1V9U 1;  2P2K A;  2JIG A;  1WA4 A;  3KT1 A;  5FPL A;  3T09 A;  1RUH 2;  3WVJ A;  4A3Z A;  4CCO A;  2WZE A;  5F5Q A;  4OUM A;  4RSU A;  3ZO0 B;  1CPN A;  1W05 A;  1RUE 2;  4W6W A;  3UL2 A;  1DQ5 A;  2WQ4 A;  1QGL A;  2FMY A;  4KMQ A;  2AAC A;  2XB6 C;  2ZGT A;  3OGS A;  4V1P A;  1N1V A;  2WWS A;  1R08 1;  2ZOE B;  4U2A A;  5D8A C;  3W20 A;  1NLQ A;  3ZFE A;  4Q4V 1;  2A3X A;  2EXI A;  2JE7 A;  2A71 A;  2VOK A;  1S2K A;  4Y5S A;  5JPM B;  2VPV A;  1HXS 3;  1JYV A;  4UW6 A;  3NNJ A;  2D7F A;  3EB7 A;  3V65 A;  1GZT A;  1GU3 A;  3O1R A;  3OBA A;  2XJV A;  1SLC A;  1F4A A;  3O5S A;  3N9Q A;  3LDR A;  1QXR A;  2R07 1;  1GOF A;  3K48 A;  4XDO A;  1J59 A;  1NT0 A;  2I45 A;  4KWK A;  3S5A A;  1AUY A;  4QHZ A;  3VD5 A;  3S6P A;  4CRQ A;  2WYF A;  2ZAA A;  4AVS A;  4ZXK A;  5FZO B;  1X36 A;  3LEI A;  1RUC 2;  4EN6 B;  2VMD A;  4QX8 A;  2VG9 A;  4CXW A;  2C1F A;  1YIP A;  2WC2 A;  4LUM A;  1VBD 1;  2VJX A;  5F3G A;  4AHZ A;  1ND2 C;  1OC1 A;  1G9D A;  2IC1 A;  3DGT A;  1TMF 1;  1H8T C;  2DU1 A;  2W1Q A;  2WNE A;  4FOW A;  2Z5W A;  4CP9 A;  4ZU4 A;  1MS9 A;  4LJH A;  1Q43 A;  2IVJ A;  1Z7S 3;  2WAA A;  2XG3 A;  4HT1 T;  1DHK B;  5FY5 A;  4ATE A;  2XLF A;  1RUH 3;  1HJF A;  5T52 A;  2A1X A;  3E97 A;  1F5F A;  2E7A A;  4NWW A;  1RUE 3;  3UYJ A;  4AHX A;  1NOV A;  4NAO A;  4GAZ A;  4CUB A;  2DVF A;  4XYX A;  1OQ1 A;  5KC5 A;  2Y33 A;  3ZN5 A;  1KEX A;  4E2Q A;  1TME 3;  4LNV A;  1ENR A;  3UGH A;  5I8T A;  2W1S A;  1TG7 A;  3I2F A;  5FY8 A;  3LSE A;  3M3I A;  2RMU 3;  5ERL A;  1EV1 1;  1BK1 A;  4HON A;  4Q4W 1;  3POF A;  2B9V A;  5I93 A;  1PMH X;  5ABJ C;  3ZX7 A;  2OPW A;  4XEZ A;  5A3U A;  1VBE 1;  5KHG A;  1TEI A;  2HWC 1;  5FZG A;  5A7W B;  3S7E A;  3POW A;  4FXK B;  2VOT A;  1NCR B;  4LBQ D;  2D6P A;  1G86 A;  3SH4 A;  5D8A B;  1DLL A;  2WNV C;  3PUI A;  5LBC A;  4CP0 A;  1O3R A;  2AUY A;  1DIW A;  2FBE A;  4LXL A;  1DGW X;  2XJT A;  3WNN A;  1S4C A;  2RM2 1;  1L7L A;  4JAA A;  1PNF A;  1YHF A;  4QQH A;  3OEB A;  4LBQ B;  4PJY A;  4Q4X 3;  1JN2 P;  3PMS A;  1US2 A;  4LE3 A;  3ZYH A;  4CEW C;  4C91 A;  4LUL A;  5IFT A;  4MH0 E;  1NYW A;  3EYP A;  4WZC A;  4Q8K A;  5F37 A;  5DZE A;  1W3X A;  2A6Z A;  1ZZC A;  3VZO A;  3I2K A;  3RS6 A;  1A78 A;  4NHK A;  4ZU7 A;  2FDH A;  2Y60 A;  1PO2 2;  1PM7 A;  4XFA A;  3I2J A;  2VUA A;  5IVY A;  1AR6 2;  4IGQ A;  3HBZ A;  2OS2 A;  4UBH A;  4KBZ A;  4LHL A;  3VBF A;  3VBS A;  5DMY A;  4DUX A;  4XJ9 A;  2RS3 1;  4YAR A;  2FZ2 A;  2BUK A;  5JDB A;  4LHN A;  4UFI A;  3T3Y A;  5T50 A;  5JPN B;  3V0B A;  3LZZ A;  1JZ6 A;  2DVB A;  4QX7 A;  3TEX A;  2J7M A;  3N9M A;  5FMD A;  3RGB A;  2E51 A;  2P3I A;  3GNE A;  1DGL A;  3JD7 2;  2ET7 A;  4NAM A;  5FYS A;  3U75 A;  4BQ5 A;  2VZT A;  2DVA A;  4R9A A;  3DEC A;  4H55 A;  1POV 0;  1D4M 2;  4IXL A;  3RZG A;  2ATF A;  2K46 A;  3VUO A;  4IE7 A;  2D5H A;  4WVM A;  5CVR A;  2ZX4 A;  2IVI B;  4OUE A;  2VNG A;  1I5P A;  2PFW A;  3B93 A;  2WT1 A;  2QUO A;  2WFF 2;  3IIA A;  3PVN A;  5EPA A;  3VKM A;  2Q1M A;  3ZN6 B;  3TB0 A;  2GP3 A;  4WZF A;  2AH2 A;  2VMC A;  3LQC A;  1BMV 1;  1W06 A;  2LW8 A;  3I4I A;  2HWB 2;  1ENQ A;  4MVT A;  5K0U A;  4IL7 A;  4UFL A;  3LB9 A;  3VZJ A;  2ZGP A;  4OYU A;  5ABJ B;  2ZEX A;  5B4X A;  1D2Q A;  1UOG A;  4XET A;  3VD9 A;  2YDE A;  1OT5 A;  3GJA A;  5FBZ A;  2CWM A;  1K12 A;  4AED A;  1PO2 3;  3K3N A;  3WDT A;  5LCW L;  1AR6 3;  2VW1 A;  1N3O A;  3OJB A;  3PHM A;  1LNS A;  2XQX A;  3KQR A;  5DUU A;  2BWC A;  5HV0 A;  3IWZ A;  4RA0 A;  5FZH A;  3QBQ A;  2PLV 1;  2VBD A;  3J8F 1;  5ANN A;  5F9T A;  1HQN A;  2R1B A;  4CP1 A;  3ITQ A;  3UJO A;  4Y5Z 0;  2ILM A;  4N8M A;  2ARE A;  3CNA A;  3BU7 A;  4L9B A;  4LA3 A;  3JD7 3;  1OQE A;  1IS6 A;  2Y0O A;  3LEK A;  3MI8 A;  4CEW B;  3ZOI A;  3WR0 A;  1ULO A;  2DFB A;  4IEU A;  4NPM A;  4GQ7 A;  5FJH A;  2RR1 3;  5J96 B;  1D4M 3;  3MZH A;  4XQD A;  2ZGQ A;  1W39 A;  4QPI C;  1W6N B;  2EA7 A;  3GCX A;  2J42 A;  5B4N A;  1MVQ A;  2NPI A;  3D3A A;  3WHU A;  5HCA A;  2DTW A;  1ST8 A;  1ULP A;  4HK8 A;  4QU1 A;  1YIF A;  2EAL A;  5B2G B;  1S0G A;  4LHK A;  2J1T A;  3BTZ A;  2G9F A;  5HV4 A;  4CU9 A;  2TUN A;  2WFF 3;  3THP A;  3VHN A;  3BOW A;  1E57 A;  1XQN A;  5EXO A;  1XNB A;  3R4S A;  3C7G A;  4JTN A;  1R09 1;  2JG8 A;  4OCT A;  1RJ7 A;  2RE9 A;  1DF0 A;  3MLL A;  2HWB 3;  3AC0 A;  5L7O A;  4XE9 A;  1W9Y A;  4OHY A;  3H8X A;  4RYD A;  5JXJ A;  1VMH A;  3VBU B;  1ZNP A;  3T4H B;  4XQ4 A;  4FOQ A;  4FXG B;  4JQR A;  3CIH A;  2AC1 A;  3X29 B;  3GDB A;  3T0A A;  4BK5 A;  2RS5 2;  4AG4 A;  2GNB A;  4YM1 A;  1MS1 A;  1LKN A;  4GMP 0;  3L2H A;  3ZLI A;  3M8L A;  4CDU C;  4YZ4 A;  2MEV 1;  3PTR B;  2H0B A;  1JXN A;  1QQP 2;  1ZZ8 A;  2B8M A;  1AX2 A;  1CAW B;  4JVA A;  1H2N A;  4UXA A;  2LUW A;  2A3W A;  1RTV A;  3OGG A;  4YGD A;  4CTE A;  3O0V A;  4QGN A;  1F4H A;  1VRH 2;  5JZG A;  1DU3 D;  4J1W A;  1VBB 2;  4WM7 C;  2WNU B;  3T2O A;  1AR7 1;  2GP5 A;  4H2A A;  3I3B A;  4JRL A;  4ASM B;  3THD A;  4AZZ A;  3ZFG C;  3OPZ A;  1GNY A;  4YW3 A;  1CX4 A;  4OI1 A;  1WUV A;  1U5I A;  1RED A;  1L7Q A;  4Q1P A;  1RC6 A;  1KQR A;  4BQY A;  2HJI A;  4ITC A;  3S0M A;  1DQ1 A;  1O5L A;  1O4Y A;  2E7Q A;  2EAK A;  3GZE A;  5FDB A;  2XJS A;  2CGO A;  5LW9 A;  4L97 A;  5DPN A;  3H3U A;  3B69 A;  3NJV A;  1SQ4 A;  1Q5O A;  1XC6 A;  1RGS A;  1W0P A;  3KZ4 C;  2AEY A;  1GFF 2;  1OLR A;  1IPJ A;  3WT3 A;  1W9F A;  4NIH A;  2D43 A;  1BK0 A;  1LEN A;  1SCS A;  2VD7 A;  4WV8 A;  4P9Y A;  5FP9 A;  4B8E A;  2CAU A;  2FD8 A;  2VUL A;  1O8P A;  1XXN A;  1LHN A;  5SV5 A;  1Q8V A;  4I3P A;  4CCD A;  1E5I A;  3WUC A;  1R1A 2;  1W6O B;  2KD7 A;  3D6E A;  2PHX A;  1CIW A;  5FYV A;  3WDX A;  4BK4 A;  4E4Z A;  1CAV B;  1VBA 3;  2I74 A;  4EWA A;  4URT A;  3HIF A;  1HW5 A;  5IAX A;  4QX3 A;  5DAB A;  2GZW A;  2DUQ A;  5GKA C;  2ZXQ A;  2PAM A;  3WIN E;  3O1V A;  1QMJ A;  1VRH 3;  1VB4 A;  1F2N A;  4R4X A;  4RFT 0;  1GBG A;  2R32 A;  4XBQ A;  5IVB A;  3KMH A;  1VBB 3;  3K2O A;  3NWK A;  3SKJ E;  5G04 L;  2A6Y A;  4JGY C;  3UKT A;  4YM3 A;  2A6W A;  4O9G A;  1NCQ A;  4PI2 A;  3U4X A;  5FQ0 B;  4Y1X A;  4KWL A;  4EYU A;  2WLP A;  4AVT A;  5FUI A;  3E5X A;  3SLI A;  5DAX A;  1LGC A;  5FZ1 A;  1T6G C;  1COV 2;  2YMZ A;  3T08 A;  1VAV A;  4XFI A;  4CDU B;  3CHX A;  5AC9 3;  3ZM8 A;  3VD4 A;  2PHU A;  4Y22 B;  5F2S A;  2VZ1 A;  3MW4 A;  5A33 B;  3LSD A;  4DIN B;  4E2G A;  3POB A;  4XAE A;  4XJW A;  2UY9 A;  4IEP A;  3E5U A;  1WMF A;  4WVZ A;  1K5M A;  3KB5 A;  2QZ3 A;  2YFZ A;  2YGM A;  1UY1 A;  3ZSK A;  5C8C B;  1SPP B;  3ZFF A;  2CU5 A;  5JVV A;  3HQX A;  3N7M A;  1O7F A;  4QM9 A;  3N36 A;  2BNM A;  4X8P A;  2ZAH A;  3FFZ A;  1C5H A;  3ZFG B;  2PHW A;  3PU8 A;  1QKQ A;  5DAP A;  3NQH A;  2VGD A;  4D7T A;  1O3S A;  1W6M A;  2GMP A;  2ES3 A;  2VVD A;  3GHN A;  1SBD A;  1WW4 A;  1WMD A;  1AF9 A;  4I30 A;  5H9R A;  3WDW A;  2YPJ A;  5DG2 A;  4COY A;  1MEC 2;  1A8M A;  4K21 A;  3HNY M;  4OHZ A;  5DZF A;  2WS9 2;  5KBF A;  3ZYB A;  2Y6L A;  4MHU A;  1V9U 2;  1AXK A;  2W1W A;  3EQE A;  3GCW A;  5FAX A;  2VQ0 A;  4IQP A;  4JDM A;  3CJI B;  4M3C B;  2XJR A;  1AL2 1;  2OA2 A;  2WWJ A;  4IE4 A;  3WNL A;  3WP5 A;  5FOJ B;  1NG0 A;  1OF3 A;  1YNA A;  1R08 2;  3CDZ B;  5IK4 A;  5EJ3 A;  3D8C A;  2OII A;  3GGL A;  4Z82 A;  2DVD A;  4Q4V 2;  1HLC A;  1OSG A;  3WG4 A;  2L9L A;  4QB6 A;  2Y26 A;  4JQT A;  4HLT A;  2OW4 A;  2WN2 A;  3WDU A;  4HG6 B;  4GUL A;  2B39 A;  1H9W A;  3A7Q A;  4XFC A;  2O1Q A;  5DZG A;  2VZQ A;  2IFR A;  2YYO A;  4JZR A;  2R07 2;  5CFD C;  1ZZ7 A;  1OVP A;  1AR9 1;  1ULC A;  2WO1 A;  1WLD A;  2QVS B;  3FUO A;  1F15 A;  1U12 A;  3HJR A;  1PZ8 A;  2HWF 1;  4BIF A;  2YB7 A;  3ZXE A;  1Q56 A;  3KF3 A;  1ACC A;  4JHT A;  3AYA A;  1JW6 A;  4YYO A;  3AZZ A;  4CDQ A;  3BTX A;  1X8M A;  4A44 A;  1HRV 3;  2P5B A;  3BI3 A;  4HXC A;  3MBW A;  2VOW A;  3MV1 1;  3UNP A;  2AEN A;  2D6M A;  5LZ6 A;  4OQ9 A;  5A32 A;  1VBD 2;  2ARX A;  1KDM A;  1YQ2 A;  3AYE A;  3NNG A;  3MUZ 1;  1TMF 2;  3DPR A;  3AL5 A;  3VHR A;  2VH9 A;  2XPJ A;  4Y1Y A;  4XUN A;  2WS9 3;  2ZPX A;  3G6J B;  3LEG A;  5CU1 A;  1OD3 A;  1V9U 3;  4F83 A;  4XW3 A;  2BVB A;  2E63 A;  4AI2 A;  3NL1 A;  5D1I A;  3LWC A;  5JXI A;  3LKJ A;  1RIT A;  5T55 A;  4AOC A;  3RZJ A;  1KFU L;  2ZAC A;  3KWV A;  4JDN A;  1R08 3;  4Q29 A;  2WRA A;  3PVO A;  2RJ2 A;  4FPC A;  4LKD A;  4QQP A;  1M4W A;  2HWE 1;  2IXJ A;  2G9Z A;  4XTM A;  1LGN A;  4OFG A;  1DYO A;  1LOC A;  1H30 A;  3VDB A;  1NQJ A;  3MIF A;  4P08 A;  5FYC A;  4EE2 A;  2R07 3;  4Q4W 2;  1BBT 3;  1UYP A;  4RR3 C;  2VEC A;  2JB8 A;  3KV4 A;  3Q8F A;  4FBF A;  1VBE 2;  3IN9 A;  2XBO 1;  4Q0V A;  2XL7 A;  4RS5 C;  4XMI A;  4Q0Q A;  2J1R A;  1CGP A;  1XYO A;  2E26 A;  2HWC 2;  3ZMO A;  4DNY A;  4BLJ A;  2QQJ A;  3LA2 A;  2Z69 A;  4I09 A;  1G9F A;  4W65 A;  2B7Y A;  4E9K A;  2DYC A;  3MIB A;  3ME2 A;  3O0X A;  2Q1F A;  4B1L A;  4HBN A;  1K3I A;  4LTA A;  1OKO A;  2ZGN A;  4OZX A;  2VC9 A;  1V6M A;  3VDA A;  2VME A;  1XYN A;  4ES9 A;  2C6S A;  5CFC A;  2RM2 2;  1ULG A;  3VB9 A;  3RDI A;  3SH5 A;  2B46 X;  2BGC A;  1GZW A;  1SBE A;  3BYW A;  3ZYP A;  2HLE A;  4P02 B;  2W92 A;  4RHV 1;  4P9W A;  2ZBJ A;  4YPJ A;  1QJX 1;  3AP9 A;  4BQ2 A;  2Q4S A;  2VTX A;  5CFD B;  2VQA A;  1BVV A;  1C57 A;  2Y6G A;  2DV9 A;  2GME A;  2VXR A;  2FDJ A;  3FHQ A;  4C1X A;  1G6N A;  2RHP A;  3BOD A;  1BKZ A;  2PN5 A;  1U5Y A;  4Q1R A;  1UY3 A;  1QY4 A;  2ZHL A;  4CDX C;  3CEW A;  3ES1 A;  4TSV A;  1BZW A;  5JMC A;  4FFI A;  5FK8 A;  2RS3 2;  1O4Z A;  1UXX X;  1S2B A;  1UWW A;  4YVW C;  2IXC A;  3UGF A;  4G9S B;  4ORF A;  5BNN A;  4A3X A;  5EV7 A;  2BGO A;  4YVS B;  5HCB A;  3QOP A;  1EV1 3;  4OHV A;  1IKQ A;  4Q4W 3;  1MS8 A;  3VBH A;  1CON A;  1PK6 B;  1DFQ A;  3VHP A;  4RL7 A;  4ZS3 A;  1ZA7 A;  2D40 A;  2FCT A;  1HB1 A;  2R49 A;  4FO9 A;  2PQQ A;  5E6H A;  2JG9 A;  1RYY A;  3U07 A;  4DOU A;  4KU7 A;  1FOD 1;  4XFF A;  3I3M A;  2P6C A;  2VZP A;  3HN1 A;  3ZYF A;  5FWE A;  3VBO A;  1VE0 A;  1S0B A;  2XJP A;  3PJQ A;  2JDM A;  1S0J A;  3H8R A;  1DGW A;  2JDP A;  1JUH A;  3B5L B;  2PXJ A;  1CES A;  1XND A;  2KR2 A;  4N53 A;  3RSJ A;  2NZ9 A;  1LHW A;  5JMO A;  2QQO A;  1CN1 A;  4MZU A;  3KCY A;  1BMV 2;  1DLC A;  3I59 A;  3PVB B;  1AVB A;  4GWM A;  4YG0 A;  5F5A A;  5A70 A;  5LK7 B;  2NN8 A;  5LAS A;  3FL7 A;  1X82 A;  3POS A;  4P9J A;  2UUR A;  3S7I A;  1NE6 A;  3Q8A A;  4M4P A;  4V2V A;  5FUN A;  1GSL A;  2VCC A;  4GH4 B;  3AMH A;  4UW4 A;  5FOB B;  2ADE A;  2W46 A;  2VZS A;  2Y34 A;  1W8Z A;  3KCC A;  5FY7 A;  5L36 A;  4MV2 A;  1NA1 C;  3ATG A;  5BY5 A;  2XDV A;  5GZC A;  2W47 A;  1LOG A;  3TNP B;  3VDD A;  2PLV 2;  3J8F 2;  2A70 A;  3KVA A;  3LAG A;  4Y1U A;  3KGZ A;  4ZZ8 A;  1AL0 G;  4GJY A;  1PMJ X;  2Y6F A;  1HB4 A;  5KXE A;  3KHC A;  3M4F A;  4JC1 A;  4GWJ A;  5C5U A;  1OOP B;  2FDK A;  4FPO B;  4K1Y A;  4XPV A;  1JYN A;  4LBO A;  4FSJ A;  1QJU 1;  1QOS A;  1H8V A;  2B42 B;  2Y6J A;  1E5H A;  5IUQ A;  1B35 C;  3P3N A;  4AR2 A;  2BER A;  2PMW B;  5F3I A;  4MXW B;  3C7F A;  5C3P A;  1CQ9 A;  1Y3T A;  2VUC A;  3U0Z A;  1ZBA 1;  2WNO A;  2X53 S;  4UW5 A;  4XUO A;  4CDX B;  1C1L A;  5C33 A;  1WCS A;  4XHX A;  1XNA A;  4XVH A;  3WP3 A;  3K77 A;  3LOB A;  3MLJ A;  5CAD A;  1TE1 B;  2ZTN A;  3CMG A;  3HT2 A;  2FHR A;  2W94 A;  1BQP A;  1R09 2;  4TN7 A;  5DDJ 3;  3GBG A;  1C3H A;  2RDQ A;  2NMN A;  5FUP A;  1U5Z A;  2XGX A;  3POG A;  1ZA4 A;  2Z42 A;  4XJZ A;  4EN8 B;  4AI1 A;  3BUC A;  1Y4W A;  4HET A;  1T2X A;  4D0Q A;  2YV8 A;  4X8N A;  2VBP A;  2GC2 A;  4SBV A;  2XR4 A;  1ULF A;  2V4V A;  3MW3 A;  2XLG A;  2WDB A;  3OBR A;  3WD5 A;  5T5P A;  5C6C A;  5JI9 A;  4BPZ A;  3ZYR A;  4QX2 A;  1L3J A;  4CA9 A;  1COV 1;  2WSU A;  2V73 A;  3GXU A;  4OZO A;  3UET A;  1AHS A;  2PLV 3;  3J8F 3;  3BN6 A;  4D6R A;  4CVU A;  1NQD A;  1LRH A;  2Y38 A;  4IDZ A;  4QDQ A;  4G4F A;  4BDV B;  2RG4 A;  2YGL A;  3WF4 A;  2RVA A;  1ALY A;  2WJS A;  2VMH A;  1RUF 1;  3BVC A;  2WZR 1;  2UY8 A;  2VOX A;  1YC6 1;  4MX3 A;  3E6D A;  1UMH A;  3M3Q A;  4FTS A;  2YC2 A;  3PDQ A;  4QB2 A;  2VOV A;  3B7M A;  1LOB A;  4X6Q B;  5JR2 A;  2VMI A;  1ND3 A;  3ACH A;  1AR7 2;  3N7L A;  1NA1 B;  1OPO A;  1QF3 A;  2R04 1;  3H1Y A;  3H7Y A;  5CAZ A;  5A3W A;  4QQO A;  1LAJ A;  1CWP A;  3IM0 A;  1IS3 A;  1XSR A;  4HAN A;  4ZU5 A;  1UO9 A;  4FI9 A;  4GWN A;  4CP9 B;  5AFB A;  1CZT A;  1AZD A;  3VZM A;  1R09 3;  5A1L A;  1ZBE 2;  2X8K A;  3CLP A;  4Y4Y A;  3SMH A;  5FZA A;  2VTX J;  1AYM 1;  1GV9 A;  4HK9 A;  5I8Y A;  4HOO A;  1OA2 A;  3H9A A;  5CG8 A;  3WNP A;  4CCC A;  4CU6 A;  3B00 A;  1H1I A;  4DQA A;  1B35 B;  4Y3O A;  1B09 A;  3U14 A;  4AI8 A;  3LIH A;  4AQS A;  4BME A;  4TZD A;  1AR8 3;  3RPQ A;  3JUU A;  5AVA A;  5FO7 B;  4BIS A;  1NCR C;  1JS9 A;  3IDC B;  3I49 A;  2EIE A;  1VP6 A;  3MYX A;  4FPH A;  4QPG A;  4KWU A;  2MEV 3;  4YFW A;  3WQ1 A;  5DUV A;  5L19 A;  2D6K A;  3RI8 A;  2DF7 A;  1AX1 A;  3WSO A;  1YFY A;  2PHL A;  2GN3 A;  4Z1V A;  4A7K A;  4URA A;  5FY1 A;  4BA6 A;  3VGI A;  1HIX A;  3WW3 A;  1OUR A;  5FZL A;  4CCL A;  4LO8 A;  3FLT A;  1LHU A;  4MGS A;  1W2T A;  1I9R A;  3A21 A;  3RQ0 A;  3V0A A;  4QDR A;  2ZX3 A;  4DS0 A;  1J1L A;  4RQP A;  2ARC A;  3OD4 A;  3RFR A;  3W58 A;  5FZ3 A;  4ZHN A;  1DDL A;  1J84 A;  3NJZ A;  5CIR A;  1U0A A;  1C8M 2;  4BHP A;  1WBF A;  1PIV 3;  3DL3 A;  1F5J A;  1HB3 A;  3NST A;  5FZ4 A;  1YJL A;  3PTY A;  3HVD A;  3KF5 A;  5LRS A;  3A0K A;  5KC6 A;  1RUD 1;  1NAE A;  1S0D A;  3OYW B;  5EQU A;  3USU B;  2ZGR A;  3KGL A;  5IVV A;  1C1F A;  1H2L A;  3ZXF A;  4NIG A;  1W2A X;  5DUX A;  5A6Z A;  2OUJ A;  3OB8 A;  3VBF B;  3QLQ A;  4JHZ A;  2VCM A;  4JKK A;  1UPS A;  4XOG A;  4MO3 M;  4DUV A;  1FAT A;  4BQW A;  1PGS A;  2JDZ A;  2D97 A;  4RN5 A;  1MS4 A;  4B7E A;  3BIE A;  2D6N A;  1UU4 A;  4COV A;  4MSV A;  3I3E A;  2XLA A;  4OUS A;  1EYB A;  1F31 A;  1AXZ A;  4CZS A;  3AP4 A;  1OXC A;  4CEY B;  3KT4 A;  3AKP A;  2LS6 A;  4AEJ A;  4LE4 A;  1MS0 A;  2JDK A;  5C4W C;  3T30 A;  4AEK A;  3BTY A;  5FK7 A;  5JSO A;  2Q8O A;  3RJR A;  3ZSL A;  2C4X A;  2XON A;  3HT1 A;  4K9S A;  2LRP A;  3NAP A;  4MGQ A;  2RS1 1;  1AL2 2;  1H9P A;  3VZL A;  3ECQ A;  5CNA A;  2VM9 A;  1RUC 3;  3OUI A;  4IE6 A;  3WLU A;  3SKV A;  1RUG 1;  3IKW A;  3OGV A;  2C0Z A;  2G9G A;  2IUW A;  3LDK A;  5I0T A;  4J1X A;  4DMI A;  3AMQ A;  3HN3 A;  2D3S A;  4YW2 A;  3IDE A;  3LEM A;  3WZ1 A;  1OLQ A;  3C2U A;  4EN9 B;  1N1T A;  3LPF A;  3RJ2 X;  3ACL A;  1VMJ A;  3TN9 1;  1H6Y A;  1RUJ 1;  5HXM A;  3MUY 1;  4R8H A;  3JCI A;  3I3D A;  4J6G A;  2BYV E;  3ZYG A;  2NP0 A;  5FZM A;  4XUQ A;  4HPK B;  2YY1 A;  3A22 A;  1UIK A;  5CYY A;  1OH3 A;  1AR9 2;  3KM5 A;  1AXY A;  1VRB A;  2IXH A;  4QHO A;  2QQW A;  3DYM A;  3TEZ A;  2HWF 2;  3DKW A;  2FDI A;  1ASJ 1;  5JAX A;  1JI6 A;  1O8S A;  3KLS A;  3EBR A;  1QJY 1;  4Z2W A;  4L92 A;  3RZM A;  2ETE A;  1IQD C;  5E1R A;  4N9H A;  4LBM A;  4PT6 A;  1LR5 A;  3AMM A;  5FYZ A;  3SCH A;  4IE0 A;  4AFA A;  2QCS B;  1N1S A;  2OPK A;  1YUD A;  2A6V A;  3GM8 A;  4AFC A;  4HKL A;  1GWK A;  3T1L A;  1VMF A;  3MFC A;  4O61 A;  4Z07 A;  2XWJ B;  4XJA A;  3VBR B;  3VL9 A;  3WF2 A;  2KA3 A;  5IFP A;  1IKP A;  2EAA A;  1ZRC A;  5AFE A;  2VNV A;  3K46 A;  2JIJ A;  1GP5 A;  1BJQ A;  1NXD 1;  3ETQ A;  5T5J A;  3VBU C;  1VR3 A;  3IAQ A;  3WNM A;  4NHX A;  4ARX A;  1RVF 1;  2QE3 A;  4IND A;  2X5I C;  1ODM A;  5FZ8 A;  1OQD A;  4XMA A;  1XSQ A;  1W0N A;  2EXK A;  2NQY A;  5FP7 A;  2HWE 2;  5BNO C;  4P5Y A;  4JGZ A;  1H4G A;  1F35 A;  2W68 A;  4XF0 A;  4I0W B;  3ACI A;  3DXT A;  3ZSJ A;  1IQA A;  3WQB A;  2B45 X;  1RUO A;  3PJY A;  2BBA A;  3J7H A;  3LDB A;  4I01 A;  5C71 A;  1XNT A;  5A3P A;  1HN1 A;  4ISQ A;  3IMN A;  3EO6 A;  1YJK A;  5C4W B;  1AR9 3;  2J1E A;  4AFD A;  5EYY A;  5FLH A;  3FE5 A;  1W8H A;  1YFX A;  2HWF 3;  2XBO 2;  3UV9 A;  1W28 A;  1TNF A;  2WNU C;  1DG6 A;  3AFG A;  3O14 A;  5HXV A;  5C9A C;  1WCD J;  1QHD A;  3OSD A;  5LEJ A;  3PUH A;  4Q4Y 1;  2BEO A;  2ZAB A;  5A3M A;  5A7W A;  3WY6 A;  2Z4F A;  1NCR A;  3DCQ A;  2YBS A;  4O9E A;  5LBB A;  2BTV C;  2P3J A;  5IWF A;  5D8A A;  5IVC A;  2GAL A;  2OZ6 A;  1L7R A;  4QX1 A;  3UT0 A;  1NUK A;  1SBF A;  3DYP A;  3TNQ A;  2UWB A;  2WKK A;  5J98 B;  3HBK A;  4BXF A;  1KIT A;  2F17 A;  2CHH A;  4RHV 2;  1QJX 2;  2BV4 A;  5FRA A;  4AAP A;  2DFC A;  4R52 A;  5JOZ A;  2ZZQ A;  3IPV A;  1DYK A;  5DUW A;  4BJ0 A;  2HYK A;  1G9C A;  1UYX A;  2JDU A;  4CPB A;  1PVC 1;  4YW7 A;  4R9B A;  2FQP A;  4MGY E;  5DXD A;  4MHR A;  3H7J A;  3BTA A;  3WUD A;  1WW5 A;  4FCA A;  1KRI A;  1OFS A;  1OBN A;  3JXS A;  1ND2 A;  1S0F A;  1SEF A;  2V5D A;  3T2P A;  4F3J A;  2Q5T A;  1H8T A;  3T0D A;  1STM A;  2WO3 A;  1YYN A;  1DQ0 A;  1RXG A;  2W9X A;  3PUR A;  2XBO 3;  2OQ6 A;  3MIE A;  2JDN A;  3E6C C;  5A6Y A;  2VU9 A;  3ILR A;  3C7O A;  4OHX A;  2X5I B;  2Q0A A;  2CNA A;  5FZI A;  5T5L A;  4AFM A;  1FOD 2;  5EZW A;  2Q30 A;  3FHA A;  4JCK A;  5FMB A;  1LB2 A;  5DG1 A;  2BU9 A;  5IVE A;  4AFB A;  5BNO B;  2PHD A;  4NIA A;  2YFU A;  2FCU A;  2FCV A;  3PIG A;  2E53 A;  3DUI A;  3JBG 1;  3U11 A;  2O8O A;  4E8D A;  4KQ7 A;  1TVG A;  2Z2S B;  1OKQ A;  4XCA A;  5A3N A;  4LKE A;  2SLI A;  5LA9 A;  5ANQ A;  3R05 A;  5C8C C;  1NCQ B;  3MID A;  1E5S A;  4CCE A;  3I3Q A;  1POV 1;  5ABJ A;  1DZQ A;  3J7L A;  3I97 A;  4BQX A;  1O3Q A;  2GC3 A;  4CU7 A;  5C9A B;  1WLC A;  1XPW A;  3DF0 A;  3K75 B;  1W04 A;  3NVC A;  4UWD A;  4ZXE A;  4UW3 A;  1BEV 1;  2W5F A;  4FOY A;  3ZYJ B;  3OGR A;  3N35 A;  5BNP C;  1SDD B;  3O1T A;  2BBV A;  3I2H A;  3ZR5 A;  5A3O A;  1J3Q A;  1HXS 1;  4ASL A;  2WNV A;  4HKO A;  4Z8B A;  5EP9 A;  1ZBE 1;  4IGP A;  4FPK A;  1A6C A;  2CDO A;  5FPX A;  3PU3 A;  4HN1 A;  2HEV F;  2CDP A;  4F7Z A;  5IAV A;  3WG3 A;  3KSC A;  3ZFF B;  3AK0 A;  5F7U A;  1JMU B;  1QJU 2;  2DCK A;  2HWD 1;  2PQS A;  4IV3 C;  4CEW A;  4BQ3 A;  2GMM A;  4BU2 A;  5IHR A;  4COU A;  4JV4 A;  2WLQ A;  3PUA A;  2DWR A;  4LO5 B;  1ZYB A;  2ID4 A;  3AYD A;  3CJI C;  2RS5 3;  2BGP A;  3AMP A;  2D6O X;  1W6N A;  3ES4 A;  2ADD A;  1W2U A;  2JE8 A;  1W6M B;  3WOG A;  1ZBA 2;  2HEY F;  2R30 A;  4EQV A;  1X33 A;  1LOE A;  3D0J A;  5FP3 A;  2BVV A;  1JOB A;  1QQP 3;  2C5D A;  2PAE A;  3AB0 A;  3L2Y A;  4LBJ A;  4PBP A;  5A7S A;  1GLH A;  4NHM A;  4AQT A;  4D7Y A;  5C70 A;  4K8R B;  4A41 A;  1S2E A;  5GLT A;  3AKS A;  3I2D A;  1Z7S 1;  1ZZB A;  1FX5 A;  1W6P A;  4XAB A;  2J1U A;  3AP5 A;  3OPW A;  2BOJ A;  5BYN A;  2XJU A;  4YGE A;  1UPI A;  5TSW A;  2VZO A;  2XUE A;  2A7A A;  3KQ4 B;  3MW2 A;  3NV2 A;  4RGG A;  3TOJ A;  4ZPI A;  3VBU A;  1AJK A;  1DP0 A;  4YZ1 A;  3HOB A;  1Y9M A;  1D7P M;  1K45 A;  1LOF C;  4A7Z A;  1C8M 1;  2P6H A;  1TNR A;  1LEM A;  1BHG A;  2FMD A;  3SEP A;  2XHK A;  2ZGU A;  3OY8 B;  2RMU 1;  1KS4 A;  3CQO A;  4MGI E;  5C5T A;  1JHJ A;  3LPG A;  4OHW A;  5FCC A;  1CAW A;  1FPN 1;  3VL8 A;  2UWC A;  1H2K A;  1RUF 2;  4PIY A;  1QJU 3;  2WZR 2;  1UNB A;  4KBB A;  5CKQ A;  3O1M A;  1PX3 A;  2VZU A;  4AWD A;  1RIR A;  1Z0H A;  2R06 1;  3FX3 A;  1J1T A;  2VZ3 A;  3IBM A;  3TEW A;  1HKD A;  4M3C F;  4EWE A;  5FRE A;  4YSF A;  5I0S A;  5A1F A;  1ZBA 3;  2R04 2;  5A32 B;  4GMP 1;  1RUI 2;  5BNP B;  4PIZ A;  1R1A 3;  4IV1 C;  4FFG A;  4AVC A;  1EUT A;  1ZRE A;  4Q5O A;  4IEW A;  1J83 A;  4HSL A;  2D5F A;  1W8U A;  2PTM A;  2X05 A;  1VLN A;  3ZN4 A;  1PNG A;  2DCJ A;  1AYM 2;  4AQ6 A;  2YPD A;  3T2T A;  2EIB A;  2W91 A;  4IV3 B;  4YW1 A;  3Q9O A;  2P34 A;  2OQ7 A;  4N43 B;  1F9K A;  4JDO A;  1AYN 2;  4QM8 A;  4XAC A;  3R4U A;  1SFY A;  1FAY A;  5SV8 A;  1GP6 A;  2O0O A;  2H6C A;  3H8U A;  4F8A A;  2WQ8 A;  3AJZ A;  4FTB A;  1G8W A;  4QPI A;  3ZPY A;  2ZGL A;  4AVA A;  1COV 3;  3N9L A;  3V64 A;  5A7N A;  1BYH A;  1C28 A;  3III A;  5LY2 A;  1X50 A;  2CY6 A;  2QQP A;  1E5R A;  1W6O A;  1WW7 A;  2ZGO A;  4O65 A;  1HDK A;  4PQ9 A;  3RYK A;  4PDW C;  1ZZ9 A;  4W50 A;  2UU8 A;  5FMO L;  4AXO A;  5L9B A;  5LWB A;  4BXS V;  2K9Z A;  1UW8 A;  4Q0P A;  4DXR A;  3DYO A;  2DU0 A;  4YZ3 A;  3HAG A;  2WZR 3;  2VCB A;  1IG3 A;  4QDS A;  3CBN A;  1GQG A;  3POI A;  1XE0 A;  5ACA 2;  2GND A;  2YBK A;  3O12 A;  4MAD A;  1QDO A;  5HCF A;  1MS5 A;  2EID A;  4YLZ A;  3LD8 A;  4FAH A;  2VVF A;  1GOG A;  1XB9 A;  4Q26 A;  2R04 3;  3FUQ A;  3UJQ A;  3QH7 A;  1Z78 A;  4NMI A;  1UYZ A;  4NHL A;  2D93 A;  2V09 A;  5A80 A;  4AI0 A;  2PAK A;  2ZCW A;  1LU2 A;  3B01 A;  5GAL A;  3HNB M;  5KXB A;  1R64 A;  1QH6 A;  1GZW B;  4CDU A;  4UYB A;  5A33 A;  5JSP A;  2DBI A;  4YVS C;  2BRT A;  5C7G A;  1LHV A;  1MEC 3;  2ZHN A;  2JIC A;  1RUD 2;  3WNO A;  1FNY A;  1JHN A;  1PO1 1;  1PK6 C;  1OD5 A;  3ASI A;  2QNK A;  4XF9 A;  3S5Q A;  3EMR A;  4BZ4 A;  4Y20 B;  3TWI A;  4FP3 A;  4S2G A;  1RMU 1;  3AP6 A;  2VMF A;  4A7Y A;  2FZ1 A;  1W8N A;  2W0X A;  4K20 A;  3T2Q A;  1SPP A;  2VUJ A;  3AZY A;  3R0R A;  1H4H A;  1GKB A;  4WM7 A;  4J25 A;  4KG0 A;  1YXW A;  1LOA A;  3ELN A;  1CAU B;  5JUV A;  2ZML A;  2YUE A;  2WBK A;  3LCP A;  3I2G A;  2EIG A;  3ZFG A;  5BNN B;  4Q4V 3;  4IV1 B;  4M0H A;  1FNZ A;  5JR7 B;  2WYS A;  1SFN A;  1WME A;  5FBJ A;  2VMG A;  4D69 A;  5A7Q A;  4WVW A;  3QCW A;  4CUG A;  4OLL A;  2RR1 1;  3MHZ A;  4GB3 2;  1JZ3 A;  2VQT A;  4GH4 C;  5IYY A;  4UFH A;  3BPZ A;  2EXJ A;  1YWK A;  4K3U A;  4FPG A;  1MQT C;  3U1X A;  2JE9 A;  1LUL A;  1C4R A;  2ZJC A;  3IZO A;  2PEL A;  2RS1 2;  5FYH A;  4M3C A;  5A7P A;  4OI2 A;  1PVX A;  5FYU A;  1OA3 A;  1CAX B;  1SMV A;  2Y8K A;  4PIX A;  4AQ2 A;  4GAL A;  3WCS A;  1RUG 2;  1IZ3 A;  1VBD 3;  2HBT A;  4DO0 A;  3O0W A;  4TYS A;  1G9B A;  1YQ8 A;  1R1Z A;  1Q8P A;  2X29 A;  1UCX A;  1TMF 3;  2H0V A;  5G05 L;  4PDW B;  4Y5T A;  1RUD 3;  1OOP C;  3TN9 2;  1RUJ 2;  3FC0 A;  4YG3 A;  1JOD A;  4E4D X;  3AKR A;  1W6Q A;  1N47 A;  4BWO A;  3OPT A;  5J09 A;  3MO4 A;  5FLJ A;  1IS5 A;  5A3T A;  4NN0 A;  3IDB B;  4XFB A;  5GLZ A;  1EPW A;  5LRR A;  5T5O A;  3AKQ A;  1ASJ 2;  2GNT A;  2A5Z A;  4JGY A;  1G7Y A;  2GH2 A;  2JDA A;  3OD0 A;  1QJY 2;  3VDD B;  3CF6 E;  1OMI A;  2VO5 A;  2K0G A;  2QKD A;  3CZU A;  3RVH A;  4QU2 A;  4EZ4 A;  4XBL A;  2DCY A;  3OG2 A;  4AAX A;  4AF9 A;  1X9T A;  3LA7 A;  1Y9Q A;  3AL6 A;  1VAL A;  5GLV A;  4IW3 A;  1UU5 A;  1UU6 A;  4CP2 A;  3R4D B;  2E33 A;  5DAQ A;  4CDW B;  3A23 A;  1WLT A;  3G7D A;  1EAH 1;  1RIN A;  4LLF A;  4QGL A;  1GMM A;  3ZIX A;  4C0H A;  1MR5 A;  2NYY A;  5T54 A;  1UOB A;  1VBE 3;  5C3Q A;  3NMB A;  2WAO A;  2IWG B;  2MPF A;  2OT7 A;  1EP0 A;  4NR1 A;  2HWC 3;  4LO7 A;  4QGM A;  1ENX A;  3ZFE C;  1RVF 2;  5DAW A;  4MXV A;  3F95 A;  3GZT B;  3RZH A;  3KD4 A;  1RUG 3;  4FPY A;  5CKN A;  2WR9 A;  3WP4 A;  1QXP A;  4KL1 A;  3OCP A;  1ZX5 A;  3KVB A;  2RM2 3;  3ZDS A;  3T1M A;  3N7K A;  3TN9 3;  5HBA A;  1I3H A;  5A1A A;  1IPS A;  3N7J A;  1QNW A;  1UL9 A;  3DEM A;  1LED A;  4QKF A;  3AXE A;  2IXK A;  3H1W A;  1VAK A;  3ZKU A;  1ASJ 3;  1WZX A;  3MIC A;  2CV6 A;  4LQR A;  1EPZ A;  5FP4 A;  1MQT B;  1QJY 3;  5F8P A;  4DFS A;  2BJS A;  3K3O A;  4Q4Y 2;  4LOS A;  3SH3 A;  1PGW 1;  1XE7 A;  4Y33 A;  3SCG A;  1X7N A;  3MV0 1;  4OI4 A;  2RS3 3;  3AVR A;  5FZE A;  1VBA 1;  5CA6 A;  5EFU A;  1DGR A;  1LOD A;  3HEI A;  2C24 A;  1YRZ A;  1FMD 1;  2JKX A;  2WII B;  4Z92 B;  3Q8E A;  1WA6 X;  3HR9 A;  3WEZ A;  4S2H A;  3VKN A;  1ZRD A;  3D82 A;  3EHK A;  3LF7 A;  4HKW A;  2I07 B;  2RJL A;  4IGO A;  3WF1 A;  4QT6 A;  3NV1 A;  4LMF A;  1DGR N;  1ND3 B;  5CFD A;  1G9A A;  2BNN A;  3CKH A;  1J58 A;  1U5X A;  3FFQ A;  5FZC A;  4LK7 A;  5E16 A;  1PVC 2;  1WD4 A;  3MPB A;  5FPZ A;  3UGG A;  1HRI 1;  2VZV A;  2UWA A;  3DN7 A;  3ETP A;  1V6O A;  2XKP A;  3I8T A;  4Y1Z A;  3RZK A;  5AC9 1;  4WM8 B;  1M06 G;  3LGR A;  4IER A;  5KHH A;  4PCR A;  3KV9 A;  2J1V A;  3K4D A;  4L11 A;  4XZP A;  3ZKY A;  1GAN A;  1S1A A;  1UY2 A;  4K6B A;  5FIX A;  5K7P A;  2ZMN A;  4LBL A;  1H6X A;  5LAT A;  3ZIW A;  2E7T A;  2YC0 A;  4XQW A;  3KS7 A;  4E27 A;  2CAV A;  5K9Y A;  3N9N A;  4I2O A;  3VHO A;  4B3N A;  4NRO A;  1PK6 A;  4UI9 L;  5J36 A;  4LIU A;  1AJO A;  1S0I A;  2DUR A;  3OTF A;  2R16 A;  3ZFE B;  1OF4 A;  2VE1 A;  3J26 N;  4HN0 A;  4Q4Y 3;  4BIO A;  3AP7 A;  1YI7 A;  4NHY A;  2BOI A;  5KXC A;  4MGT A;  1W8F A;  2D6L X;  1NY7 1;  5IJR A;  3TYJ A;  3CO2 A;  2WN3 A;  3MPP G;  3HNM A;  5FMC A;  3UES A;  5LA2 A;  4GKX A;  3JBG 2;  4XUT A;  1YFW A;  3C8X A;  2CWS A;  4QXB A;  5JI7 A;  2NMO A;  4AYU A;  3MEP A;  3V0A B;  5I0R A;  3KCX A;  1Y43 B;  2G19 A;  2JJ6 A;  4KWJ A;  4FQZ A;  1GQP A;  4RR3 A;  4PF5 A;  4D6S A;  1SG3 A;  3VBS C;  4Y26 A;  3VBF C;  2DBN A;  3QD6 A;  1LGB A;  1MPX A;  3VZK A;  3K4A A;  4RS5 A;  1IHM A;  3OBT A;  3SXW A;  1Y7B A;  1BEV 2;  4MYE A;  1RUI 1;  3JU9 A;  3ZSM A;  1XU2 A;  4BE3 A;  4XDQ A;  1JU4 A;  3NJX A;  3Q8B A;  5FY0 A;  1HXS 2;  4N7I A;  3PUQ A;  4R4Z A;  1CJP A;  5F5C A;  4BQ1 A;  2ZX2 A;  2KM2 A;  5ISL A;  2EF6 A;  4CEY C;  4E4S A;  4K7J A;  1NXM A;  3WNX A;  5GZD A;  2ZMK A;  4XIO A;  3ZR6 A;  4W4Z A;  2ARA A;  2HWD 2;  1DQ2 A;  1AYN 1;  3J7N A;  4L0P A;  1DCS A;  4MUV A;  4IET A;  1WMX A;  4XDP A;  4UOJ A;  1VIW B;  4I02 A;  4A42 A;  1QDC A;  3MLK A;  2WUH A;  3THC A;  1HRV 1;  3J7M A;  4W8J A;  5F5I A;  2Y0I A;  5DQ0 A;  2E31 A;  4YGC A;  1KDK A;  1NE4 A;  2W08 A;  5CBL A;  1LES A;  2JEM A;  3FHI B;  4PI0 A;  1ZZ6 A;  4NRP A;  3H42 B;  4CDX A;  1OUX A;  4CCK A;  1JYW A;  2BZD A;  5KR7 A;  1O59 A;  4HFS A;  1SLT A;  4YVW A;  4XXA A;  1T6B X;  1XOY A;  4P9I A;  1Z7S 2;  4AGG A;  1GYK A;  1JZ2 A;  2YRO A;  4AED C;  5I0U A;  3ZPO A;  1SZB A;  3DKQ A;  4EJR A;  3FLP A;  4P9X A;  2XQR A;  5ACA 1;  1HJG A;  1POV 3;  2EVX A;  1V0A A;  1WBL A;  2NLR A;  3AZW A;  3NAP B;  1O91 A;  4V2W A;  3W21 A;  3AZV A;  3KV6 A;  3SC7 X;  3VZN A;  4B1M A;  3O7O A;  5CG9 A;  4QX5 A;  1AR7 3;  1OH4 A;  4BYY A;  2VY0 A;  3H8O A;  1BEV 3;  1VPH A;  2R0F A;  1W2N A;  4FFF A;  4JRA A;  1DYP A;  2CSG A;  3M3O A;  4B4R A;  4NII A;  4BOW A;  1JUI A;  1OLM A;  1TME 2;  5IVJ A;  2JB4 A;  4AE2 A;  4RGA A;  5IK7 A;  3FLR A;  4K1Z A;  3ZXK A;  1SLL A;  5JSR A;  4DRV A;  1MZF A;  1ZBE 3;  2RMU 2;  3IB3 A;  4NPR A;  3VBR C;  2ENR A;  1CPM A;  4CE8 A;  4UF0 A;  2A73 B;  5FO9 B;  1BBT 1;  1FPN 2;  4LO6 B;  4P5H A;  4NVP A;  5GLW A;  5FJK A;  3T4V A;  5J3U A;  1S55 A;  1I1E A;  4KNC A;  3TRS B;  4C8D A;  2YU2 A;  3VN4 A;  2GC0 A;  2HWD 3;  4IES A;  5LA1 A;  2XKO A;  1D2S A;  2QQM A;  1NLS A;  2R06 2;  2J1S A;  3VBS B;  2BW8 A;  4QQ2 A;  1CD3 G;  1QJE A;  2TEP A;  2D3P A;  2PHF A;  3LE0 A;  5CB7 A;  3WW4 A;  2HEW F;  3MIH A;  4ZS2 A;  1KXG A;  1NKG A;  1NA1 A;  2GN7 A;  3V0B B;  2JG8 C;  3N3H A;  1W9S A;  3QAC A;  1J3P A;  2OUH A;  2WT0 A;  5DAV A;  4GJZ A;  5IVF A;  2ZKN A;  2BP6 A;  1MAC A;  1UMI A;  3AXD A;  4HVQ A;  5L7O C;  4Q4X 2;  4OI0 A;  3NRU A;  2H6B A;  2QJV A;  5FYT A;  1WCQ A;  2XVL A;  3GZU C;  1H1A A;  4QPY A;  3TBD A;  1REE A;  1J3R A;  4GB3 1;  1A3K A;  4QX0 A;  2DUP A;  2CGN A;  2E9Q A;  1XJA A;  2EXH A;  4EN0 A;  3J9S A;  4WVM B;  5LA0 A;  4AVB A;  3DV8 A;  1B35 A;  3E1F 1;  2ZGM A;  5LY1 A;  5CKM A;  4LK6 A;  4GKY A;  4PLN A;  3N9O A;  4JGZ B;  3R6S A;  4YRD A;  1C8M 3;  2DCZ A;  1UN1 A;  2LAL A;  1QU0 A;  3TEY A;  1A34 A;  2YHJ A;  3PUS A;  3TAY A;  2JXA A;  2MNG A;  3PNA A;  4H3W A;  3SIS A;  5K0U B;  2D44 A;  2B9U A;  5J1X A;  5F3E A;  5JZG C;  4AVV A;  1FPN 3;  5A3L A;  2N7G A;  1OLM E;  1W3V A;  1W90 A;  2P37 A;  2KXL A;  4AW7 A;  4AED B;  4KGG A;  2FDG A;  2BNO A;  3FMG A;  5FPV A;  2R06 3;  4IE5 A;  2JEN A;  5FZ9 A;  3VKF C;  4L8Q A;  1UMZ A;  4NRM A;  3GF6 A;  3SHR A;  5C3R A;  4GMP 3;  1V70 A;  2AZ5 A;  3ZXG A;  5FZO A;  3WQ7 A;  1VBC 1;  4C90 A;  3M2M A;  3WXP A;  4CPB D;  4XJU A;  3O1U A;  3U10 A;  1C8N A;  5I91 A;  1QEX A;  4HVO A;  1KFX L;  1UQX A;  1CJD A;  2JD4 A;  1GWM A;  2JDY A;  3S30 A;  3IPV B;  4CU8 A;  4DZG A;  3OYW A;  4CUC A;  5LK5 A;  1PO1 2;  5FZ0 A;  3USU A;  3RWK X;  3MFA A;  4D94 A;  2JDH A;  3I7D A;  1BLZ A;  3GBW A;  5E8A A;  4HVR A;  3URF A;  2ZHM A;  1RMU 2;  4YNI A;  3HD8 B;  2P17 A;  1PX4 A;  4L2N A;  5K8S A;  5LEK A;  2Z79 A;  1AL2 3;  4H7L A;  4AI9 A;  4LR4 A;  4XHB A;  1QJZ A;  4G3Y C;  2WZP P;  4COW A;  3FN9 A;  2IXL A;  4FPJ A;  1UOJ A;  1GNH A;  2JG8 B;  3SCF A;  1JOJ A;  1ND2 B;  2BFU L;  1LEC A;  3BCW A;  1LTE A;  2ZHK A;  1H8T B;  5L7O B;  4MG2 A;  2XML A;  1W0O A;  3V56 A;  3CJX A;  1IPK A;  4ARY A;  2B5H A;  4JX0 A;  4FFH A;  4B7K A;  2XHN A;  3CU7 A;  4Q27 A;  4XIK A;  2AEZ A;  4Q2F A;  4CEY A;  1NCQ C;  1ZM1 A;  5FPB A;  5GJ6 A;  4GA9 A;  2RR1 2;  1CZV A;  4TLF A;  1GR3 A;  3RI9 A;  5HPO A;  4CYD A;  5D21 A;  3WQ0 A;  3INA A;  3I2O A;  2GC1 A;  4P9L A;  3IMM A;  1W9T A;  3ROU A;  3WP6 A;  4DY3 A;  5EJ1 B;  2IZW A;  2Q8C A;  2WWU A;  5H9P A;  3ENR A;  4QXH A;  4QXC A;  3J4U H;  4ZY9 A;  4XJ8 A;  4ERO A;  1UD1 A;  1VAM A;  2DCT A;  4DUW A;  2ZS6 B;  5FZ6 A;  5JOX A;  5DDJ 1;  4FPF A;  3O1S A;  2CYF A;  5F2W A;  1K5M C;  2JKB A;  1ZRI A;  4PBO A;  1WCK A;  3NJY A;  5A6Q A;  2GAU A;  2W3J A;  4NE9 A;  5DN2 A;  5JZG B;  3F2Z A;  1D0H A;  3ZFF C;  5FR3 A;  3M3E A;  5J7M A;  4LBQ A;  5J37 A;  1PO1 3;  4XF4 A;  2OX0 A;  3RNS A;  5F3C A;  4HPK A;  4FVV A;  1RMU 3;  1XE8 A;  2VCA A;  4XUP A;  1UIJ A;  3ZXL A;  4ZKT B;  1JYX A;  4UFK A;  3NO8 A;  3RZZ A;  5L73 A;  4D6Q A;  1TQ5 A;  3L9J T;  4DB5 A;  2F4L A;  1OPM A;  2O8Q A;  3I2I A;  1HQW A;  4NUB A;  3BGA A;  2WIN B;  3Q8C A;  2WNV B;  4TXW A;  1YQ5 A;  2HWE 3;  2C9K A;  4NO4 A;  2Q8D A;  2WZ8 A;  1RHI 1;  1H2M A;  4ET7 A;  4JTO A;  5FZK A;  4MOA A;  5GM0 A;  2OVU A;  1KJR A;  2XVG A;  1UKR A;  3PL0 A;  5F32 A;  1SHW B;  3VBR A;  3WHT A;  1SFP A;  5C8W A;  1EAH 2;  2OKX A;  5IW0 A;  3OEA A;  5GZG A;  3HWJ A;  1DZR A;  2FDF A;  3BU0 A;  2X09 A;  4GD4 A;  3SNM A;  4O7X A;  2WFP A;  4K40 A;  4WVV A;  4LBK A;  1GQH A;  2WT2 A;  1W8W A;  4N9I A;  3HQU A;  3PVE A;  3O1O A;  1K42 A;  3OBZ A;  4LKF A;  3VD7 A;  4W6X A;  3BKZ A;  4GWI A;  1MZE A;  1PM4 A;  4M00 A;  4PLO A;  1VB2 A;  5JOW A;  4R9C A;  2VNO A;  1BVP 1;  1W6P B;  1TZO A;  1LU1 A;  3GHM A;  3ZN6 A;  3B9C A;  1MZ6 A;  1OI6 A;  3NNL A;  4TLG A;  4N90 A;  4RHV 3;  4XXP A;  1QJX 3;  3RMX A;  4Y24 A;  2VAU A;  4Z2A A;  1PGL 2;  3VDC A;  4LPL A;  3MIG A;  5C4W A;  4LUK A;  1QIQ A;  4QAW A;  4CDQ C;  4D3W A;  5F1R A;  2V72 A;  2DVG A;  1AR8 1;  1V6L A;  2LRO A;  2XWB B;  2LM3 A;  3KV5 A;  1MZ5 A;  2QDR A;  2HKX A;  1Q8S A;  1PGW 2;  4PLM A;  4B29 A;  4I0B A;  4BM8 A;  4A45 A;  3DPR C;  2VR4 A;  3NW4 A;  4DXS A;  1VBA 2;  1SAC A;  2QQU A;  4FAG A;  1K5M B;  3WW2 A;  2W39 A;  1FMD 2;  1PZ9 A;  3ON7 A;  4P00 B;  3ZMN A;  1UZV A;  2G1M A;  4A6S A;  4IUG A;  1EAH 3;  5C3S A;  3EJK A;  1GIC A;  1JTZ X;  1WW6 A;  2Q1Z B;  4N43 C;  5T3N A;  1CX1 A;  3KHB A;  5BV6 A;  3RYR A;  4HSJ A;  4QKD A;  4MLO A;  3EXU A;  1QH7 A;  4QB1 A;  1FOD 3;  1HRI 2;  2R0H A;  2WAB A;  2YG0 A;  2AYH A;  2WL1 A;  3BOP A;  3JQW A;  1PIV 1;  3AJY A;  3ILN A;  1DBN A;  4LLO A;  4ONU A;  5AC9 2;  5E89 A;  3ZXA C;  2I2S A;  1GNZ A;  3CZJ A;  3WG1 A;  1SLB A;  3AM2 A;  1QWR A;  5KHJ A;  1BXH A;  5I8S A;  1ODN A;  1QXJ A;  2K2S A;  2R1D A;  3NV4 A;  4AGR A;  3THT A;  2WQZ C;  3JB4 C;  5BNQ A;  5GZF A;  1RUH 1;  3HQR A;  1GWL A;  3NKT A;  3GYD A;  2ZEZ A;  5FY9 A;  4OVE A;  1RUE 1;  2VVE A;  4QPI B;  1F8V A;  4TWT A;  2QQV A;  1A8D A;  4OUL A;  2XXZ A;  3NNF A;  1N1Y A;  3RZL A;  3AX4 A;  4DPN A;  4CXX A;  2BFU S;  1W9W A;  4GXL A;  1UOF A;  2X5I A;  1K5J A;  5CFC C;  1TME 1;  1H0B A;  1NY7 2;  3ACG A;  3W9A A;  4PHZ A;  2VXJ A;  3H1M A;  1IS4 A;  1JBC A;  4X6R B;  3W5N A;  1UY0 A;  1US3 A;  1FMD 3;  3AKT A;  5BNO A;  1GP4 A;  5JIA A;  1O6U A;  1WWY A;  2GDF A;  5FV3 A;  3RWN A;  5KHI A;  1C5I A;  4K8F A;  5FPU A;  2P3K A;  1RXF A;  3FBY A;  1MVE A;  4LHS A;  4OQ8 A;  4QXK A;  3ILF A;  4CDQ B;  4LOR A;  4Q0S A;  5GZE A;  5L9V A;  4TTG A;  5FFO C;  1XU1 A;  2G4I A;  3NKG A;  2YZ4 A;  4PQQ A;  3USS A;  1RUC 1;  1HRI 3;  2WNU A;  5C9A A;  1N3P A;  3GAL A;  5FXV A;  3ALQ A;  3AMN A;  1JOP A;  3D5O A;  1P8J A;  1W99 A;  3KT7 A;  5FYB A;  5BNN C;  5M0T A;  3H3L A;  3DPR B;  1VJ2 A;  2P3Y A;  1PHM A;  2VUD A;  3VBH C;  4Q4X 1;  4YM0 A;  1UXZ A;  2ZZJ A;  4S2F A;  1O5U A;  1UYY A;  5JWP A;  1N3Q A;  4ASK A;  4XUR A;  4MET A;  4LIT A;  2PHR A;  3WNK A;  4UFJ A;  3DXU A;  3HMY A;  2F4P A;  5J48 A;  2XH6 A;  5JLV A;  2JG9 C;  4WM7 B;  5IAT A;  2IFW A;  3N9P A;  4ATF A;  2P4E A;  4QKB A;  5C3O A;  3VBO C;  3BIW E;  4ZZ5 A;  1HRV 2;  2HYX A;  2J1A A;  1LCL A;  1V6K A;  2W52 A;  2CTV A;  3M3C A;  2VW2 A;  3BPS A;  4N53 C;  2DUO A;  3P6B A;  5CZK A;  3E6B A;  4LBN A;  4XTP A;  4OMD A;  5JXH A;  1CAV A;  1NZC A;  4FQ4 A;  5FY4 A;  4IEY A;  1NZI A;  2D98 A;  1HB2 A;  1RUF 3;  1NLR A;  3FJS A;  1JZ8 A;  2WA3 A;  3WDY A;  3UK9 A;  1YCI A;  1JYI A;  3ABZ A;  5BXX A;  2ZGS A;  1ZVF A;  1YQC A;  3U78 A;  5BUV A;  5JCT A;  5GLU A;  4H7M A;  1FI2 A;  3C7H A;  5FTT C;  3VDD C;  2F6B A;  4BH9 A;  2VQU A;  3BB6 A;  4NWV A;  5FQ0 A;  4FTE A;  1PMI A;  1RUI 3;  4YW5 A;  2QTW B;  4QQL A;  5A6X A;  4BB3 A;  1ENS A;  2YXS A;  5CFC B;  1IOA A;  2B4K A;  2XVK A;  3ZYI B;  2VW0 A;  2ZX1 A;  4E2S A;  2LTN A;  1ZRF A;  2ET1 A;  5F6L B;  3MGU A;  4XF3 A;  3WF0 A;  3FZ3 A;  4Y4R A;  2O14 A;  4Y22 A;  3RG0 A;  2XL9 A;  1W6Q B;  2Y64 A;  3OY8 A;  4IEV A;  4QKN A;  4CDW C;  1BBT 2;  2QBX A;  1AYM 3;  2CL2 A;  1GOH A;  2XOM A;  4L99 A;  4N7U A;  2QZ2 A;  3ST7 A;  1EY2 A;  4JKM A;  1JZ7 A;  1YFU A;  4JGY B;  4U36 A;  1AYN 3;  4KGQ A;  5C8C A;  2GSY A;  1PO2 1;  3M70 A;  4QMA A;  5CIS A;  1AR6 1;  1X8E A;  3A4U A;  1QJF A;  3WW1 A;  3VV1 A;  1IGO A;  1XNK A;  3FWE A;  3OF1 A;  5LBF A;  4RD7 A;  1MS3 A;  2RJK A;  4C1W A;  4CSW A;  3NNM A;  3U37 A;  5CEH A;  4AHW A;  4CUA A;  2R7E B;  3SIT A;  5BNP A;  2WA4 A;  4I0A A;  3RRD A;  3WDV A;  2VL4 A;  3ZXJ A;  4CCJ A;  4LIV A;  3B02 A;  3VBH B;  1FXZ A;  3JD7 1;  4LO4 B;  3MF6 A;  1KGY A;  4C0B A;  5FO8 B;  3ZVX A;  1V6J A;  4IEZ A;  1UZY A;  3WCR A;  1HX6 A;  5L9R A;  4QWN A;  1V6I A;  1YI9 A;  3O1P A;  1D4M 1;  1Q8Q A;  3WG2 A;  3W5M A;  2BPA 2;  1FYU A;  2AR6 A;  2JG9 B;  4IEQ A;  4WBB A;  5ACA 3;  5HI0 A;  4IV3 A;  4MGK E;  5BPX A;  4N43 A;  1SDW A;  1APN A;  3ACF A;  2XJQ A;  3M7A A;  5IK5 A;  2V4A A;  2GNM A;  1JZ4 A;  5IK8 A;  2JWP A;  2WSV A;  2HBU A;  2DTY A;  3B9I A;  4JKL A;  2J22 A;  4KI5 M;  3VBO B;  1W03 A;  1W8T A;  3CJI A;  1JZ5 A;  3B94 A;  1V6N A;  4UAP A;  2WFF 1;  4N53 B;  2PA7 A;  1PZ7 A;  3POY A;  5FLI A;  3I59 B;  3PME A;  2RDR A;  2RV9 A;  1WLW A;  2WO2 A;  1EV1 2;  2HWB 1;  1GZ9 A;  2BQP A;  4YWA A;  5AVP A;  4GZ9 A;  3N4M A;  2A6X A;  4EV0 A;  2MHF A;  5FKB A;  1GUI A;  3C3V A;  4YG6 A;  1OFN A;  4DXT A;  2W1U A;  4NPL A;  4LKS A;  2CGP A;  2UYA A;  1S0E A;  4B4Q A;  1ND3 C;  1UZZ A;  1UAI A;  1KJL A;  1YQ6 A;  1ULE A;  4UT5 A;  4LT5 A;  5K4L A;  1Q8O A;  1OUS A;  5EIY B;  3RYP A;  5EWS A;  1ULD A;  2W95 A;  3UKV A;  2SBA A;  1SLI A;  2VTF A;  3IT8 A;  3VLB B;  4YM2 A;  1REF A;  4WM8 C;  3JB8 A;  3VKL A;  3D0S A;  1VBC 2;  3W59 A;  2GH8 A;  1LOF A;  2R6Q A;  1RL3 A;  5D2A A;  1Y9G A;  2YU1 A;  4W6Y A;  4XAA A;  5FYY A;  2ZA9 A;  4H14 A;  4KH9 A;  4CXY A;  1CVN A;  3OUJ A;  1UKG A; 
#chains in the Genus database with same CATH homology
 4XC9 A;  5ERL A;  5EQU A;  2OPW A;  5A3U A;  3EMR A;  4NHM A;  5HV4 A;  5LBB A;  3DKQ A;  4XAB A;  2RDQ A;  4J25 A;  2G1M A;  3W21 A;  5LBC A;  4BQW A;  4ZPI A;  5DAP A;  3MGU A;  3GJB A;  3KT4 A;  5C5T A;  2RDN A;  4NHK A;  4MHU A;  2RG4 A;  4MHR A;  5LBE A;  4KBZ A;  2JIG A;  3KT1 A;  3BVC A;  5LB6 A;  5LAT A;  3HQR A;  5LBF A;  3OUI A;  2HBT A;  3NNM A;  3W20 A;  4Y5T A;  3NNF A;  4XCB A;  5DAV A;  2FCT A;  4Y5S A;  4Q5O A;  4NHY A;  3NNJ A;  4BQY A;  4JZR A;  5L9R A;  3GZE A;  3OUH A;  2FCU A;  2V4A A;  2FCV A;  2HBU A;  4XAC A;  5EPA A;  4XCA A;  5LA9 A;  2G19 A;  5L9V A;  4IW3 A;  3PL0 A;  5LAS A;  2RDR A;  5DAQ A;  4BQX A;  3KT7 A;  5M0T A;  2Y34 A;  4UWD A;  2RDS A;  2JIJ A;  3GJA A;  5L9B A;  3HQU A;  4NHX A;  3OBZ A;  5DAW A;  5IAX A;  5HV0 A;  5EP9 A;  2A1X A;  3ITQ A;  5IAV A;  5C5U A;  4NAO A;  5IAT A;  3NNL A;  4NMI A;  4NHL A;  2Y33 A;  4XAA A;  4ZON A;  3OUJ A;  5DAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...