2JIGA

Crystal structure of chlamydomonas reinhardtii prolyl-4 hydroxylase type i complexed with zinc and pyridine-2,4-dicarboxylate
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
216
structure length
216
Chain Sequence
EEWRGEVVHLSWSPRAFLLKNFLSDEECDYIVEKARPKMVKSSVVDNESGKSVDSEIRTSTGTWFAKGEDSVISKIEKRVAQVTMIPLENHEGLQVLHYHDGQKYEPHYDYFHDPVNAGPEHGGQRVVTMLMYLTTVEEGGETVLPNAEQKVTGDGWSECAKRGLAVKPIKGDALMFYSLKPDGSNDPASLHGSCPTLKGDKWSATKWIHVAPIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROLYL-4 HYDROXYLASE
publication title The Active Site of an Algal Prolyl 4-Hydroxylase Has a Large Structural Plasticity.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Hydrolase
total genus 56
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.620 Mainly Beta Sandwich Jelly Rolls q2cbj1_9rhob like domain 2jigA01
2HBTA 5IAXA 4J25A 3HQUA 5IAVA 3MGUA 2RDSA 2FCVA 3GZEA 5ERLA 4NMIA 3W20A 4UWDA 2JIGA 2HBUA 5LASA 5LA9A 5DAVA 2Y34A 5HV0A 3OUIA 4NHYA 4XACA 3NNLA 2FCTA 4NAOA 4BQXA 5A3UA 3PL0A 2A1XA 2OPWA 4NHKA 2V4AA 4BQWA 5LBBA 4Y5SA 5HV4A 3KT4A 2FCUA 5DAWA 3EMRA 4MHRA 5LBFA 3HQRA 5EP9A 4IW3A 4NHLA 5LB6A 4XCAA 5C5UA 5DAQA 4XABA 5L9BA 2G1MA 5IATA 3OUJA 3NNJA 5EQUA 4BQYA 4KBZA 2G19A 3GJBA 4ZONA 4NHMA 4MHUA 4NHXA 4XC9A 3W21A 5DAPA 5LATA 2JIJA 4ZPIA 5L9RA 5M0TA 3OUHA 3GJAA 3ITQA 3KT1A 3OBZA 3BVCA 3KT7A 5LBEA 5DAXA 5L9VA 2RG4A 4XAAA 2RDQA 3NNMA 2Y33A 3DKQA 4Q5OA 5EPAA 3NNFA 2RDNA 4Y5TA 2RDRA 4XCBA 5C5TA 4JZRA 5LBCA
chains in the Genus database with same CATH superfamily
2QQOA 4DXRA 4YNIA 5HCAA 2ZAAA 1ND2A 4IQPA 3HJRA 1D4M1 4HETA 4AVCA 1VBD1 3NSTA 4CCJA 2JENA 1DU3D 1YJLA 5C9AA 1S0CA 3D5OA 3KV5A 4PLOA 2B8MA 1VAVA 1VBC3 3H3UA 5IVVA 1GNZA 4FXKB 1H1MA 1H2MA 2RS52 3LSDA 2PHRA 1NZCA 3VBFB 1KXGA 2WNVB 1DYKA 4R9BA 4RHV1 5ABJB 4GKYA 1E5SA 3IDEA 4CDWB 1F15A 1W8UA 2A75A 2VU9A 2WS91 3AZXA 4AEKA 5ANNA 1OUSA 4QDSA 1OPMA 1W6OB 1QJY2 4XFHA 2GU9A 4XZUG 1QU0A 5CFCC 2IXHA 4KU8A 3IIIA 3MO4A 1NX9A 1ZYBA 2XL9A 3IDCB 4HZFA 5FAXA 2QQPA 1PNGA 1AJOA 1GQPA 1O6UA 2ZGKA 2JG8B 3RVHA 2J1EA 3E6DA 3HR9A 4YVSA 2PLV3 5H9RA 1VBB3 1QH7A 3HOBA 1DZTA 2JD9A 3I7DA 1SBDA 4Q0QA 4B1LA 1ZZ6A 1YUDA 5JXGA 3ST7A 5IK4A 3WG4A 5CFDB 1EYBA 3BI3A 4TSVA 2QE3A 1W0PA 2D6LX 2J1RA 4JGYA 5LBFA 5IUQA 4LBQD 3ZO0B 3CZJA 1BK0A 4HK9A 4D6RA 1FPN2 4QM8A 5JZGA 2VCCA 4RA0A 3TEZA 4XABA 4URAA 4BQ4A 1BBT3 5C8CB 2VJXA 4N90A 1Y3TA 1WD4A 3OTFA 1PX3A 4RS5A 4YW2A 3VLBB 4YFWA 1RUJ2 3MBWA 2UURA 4IE4A 1FMD3 3P3PA 3ZIWA 4BQ3A 2ZS6B 1A8MA 3KSCA 4FXGB 4WVMB 4ASLA 3CBNA 1EUUA 4B7EA 2Y6GA 4A42A 3H9AA 2HWE2 1EAH2 4RR3A 1XYPA 3RZHA 2XLAA 4ZKTB 1W6QB 1L7RA 1UF2C 1NXMA 1AVBA 1DGRA 5T5LA 2C9KA 4CDQB 4MHUA 1VR3A 5FPLA 3ZSKA 5G05L 5CAZA 2MEV2 3U10A 3C7OA 4ATFA 3O0VA 2ZHKA 3DN7A 1MS9A 4UW6A 4IDZA 2B39A 1WLDA 5DDJ2 1QY4A 1QOTA 1QXPA 1UW8A 1AR81 3WF2A 3NW4A 2UY9A 1RUOA 4JCKA 3UV9A 1VBE2 2GN7A 4OZXA 5A6XA 2YYOA 2QQIA 1GKBA 2Y60A 4UFKA 1BCXA 5L9VA 3IWZA 4IE7A 2RG4A 4ZY9A 4AFMA 4PBOA 5JPNB 1URXA 1VAMA 3ZYRA 3ABZA 1HRI2 2D93A 1Q8PA 3CJXA 2YG0A 1Z7S3 2RDNA 1B35C 2BEOA 2YFZA 4LO4B 1H2NA 2RDRA 5LRSA 2FZ1A 2BV4A 1FOD2 2XJVA 2YBPA 1IG3A 1OF3A 1IS5A 3WOGA 4DO0A 2VW1A 5FXVA 1W9FA 4HXCA 4K3UA 5FKCA 1MS3A 2VD7A 3D82A 2HWC1 1XJAA 3LEIA 4JQTA 3VBSA 1RUE2 1YCIA 1PGSA 3JBG1 5FJKA 3I3MA 5FO7B 5J3UA 5LWBA 3K3OA 4YVWA 3IDBB 2CGNA 2FCVA 3GZEA 4XXPA 4CUGA 5FLHA 4C0BA 1XC6A 4A7YA 1LAJA 3TN93 3CLPA 1H1AA 5A1FA 3AM2A 2YMZA 2GDFA 5C4WB 2XLFA 5AFBA 1HX6A 1G8WA 1GSLA 2GMPA 1QH6A 1HIXA 1MZEA 5LW9A 1ZA7A 2ZEZA 1IS3A 3AP6A 5A6QA 1QXRA 3OYWB 1TNFA 1F8VA 3OUIA 4NHYA 3SCGA 2J1VA 4XACA 2OIIA 4AVTA 4NJ4A 4BU2A 4UW4A 1GNHA 3T30A 3LKJA 2BTVC 4BK4A 4DXSA 3VZMA 4S2GA 1D4M2 3FUQA 1VBD2 4HN0A 4FPKA 3OPWA 1PO13 4HPKA 1LODA 4O61A 4XE9A 3LA3A 1ZNPA 1W9TA 1ZZ8A 3LEMA 4QB2A 3U07A 4FFFA 1KDKA 1ULPA 2V09A 4QDQA 1CESA 3K3NA 2ZX4A 4FO9A 5A33B 1NUKA 3KT4A 4OULA 2JE8A 2DU1A 2Y6FA 4RHV2 3POJA 1J59A 2EXKA 1X36A 5DAWA 3EMRA 3VDAA 2DFCA 3WCRA 2VE1A 2WS92 2VQ0A 4XFIA 3TB0A 1IS6A 1IPSA 1S0IA 1Q8SA 2XJPA 3VD3A 4PDWC 1E57A 1CPMA 1ZZ9A 3LE0A 1AR61 3AXEA 2MNGA 3BODA 3GHNA 4XF9A 3J8F3 4H7LA 3L2YA 2GNMA 3HWJA 3VBOA 2KD7A 1APNA 3SQOA 1Q43A 3AJYA 5FUNA 3HNYM 3T2OA 3TYJA 1NA1B 3C3VA 2RMU1 1B09A 5FYVA 2FDHA 1MS5A 1NCQC 3BIWE 4AEDA 5BNOA 2HEYF 3T1MA 5BNPB 2EIDA 3AVRA 5FREA 1ZZBA 5G04L 3E5UA 3FBMA 3MIHA 4EWAA 2VY0A 3N9MA 3O0XA 4MGZE 5FMOS 1IQAA 1ZBE1 5A7OA 2R0FA 2WUHA 3O12A 1XOYA 1G9CA 4BIFA 2Q1MA 3IB3A 2CDPA 4A45A 3ZN6A 2DCTA 2NZ9A 1POV3 4BQ2A 4D7SA 5DN2A 4YZ5A 2YPJA 1HQLA 3BVCA 4A4AA 3FHAA 1OLME 4AGGA 1KQRA 1HJFA 1A34A 4QKBA 3W9AA 4LK7A 1YC61 3S7EA 1XRUA 2XUMA 1RHI1 3AP5A 2AYHA 2E7QA 4YGBA 2Y33A 3VBRA 1XE7A 4QPGA 1UZVA 5FUPA 1OA2A 3PU8A 3I2KA 2C1FA 1PM7A 3QD6A 5LCWL 2XBO3 3PTYA 4M0HA 2EVXA 1RUC1 2VVFA 2R32A 4YZ4A 4BYYA 4W6YA 4CSWA 4QX7A 3VDDA 1PZ7A 4R52A 4WM8B 5EYYA 5C7GA 1R081 5L19A 1GWMA 3OG2A 2ZA9A 2ET7A 1LOGA 3I8TA 3E6CC 1GBGA 1K5JA 1AR83 1W6PA 3B00A 3H7YA 3NJZA 2C4XA 5CYYA 1C8M3 1K12A 2AC1A 1WZXA 1OOPA 2DCYA 2IZWA 2R071 3RMXA 4AI2A 3J9SA 3ZIXA 4DFSA 1OMIA 2Q8CA 1GANA 1AR73 1UYXA 3W20A 4AQ6A 2VMFA 2CYFA 2O0OA 5APAA 1FV2A 2D6MA 1PHMA 4DZGA 2E32A 5DAVA 3DPRA 3OGGA 4DEQA 5A80A 4KGQA 4Y20A 5KR7A 3PUAA 2BYVE 3VZJA 2WN3A 1DZQA 4LOSA 2VMCA 2Y64A 4LK6A 4XTPA 5EWSA 2HWC2 3S5QA 3BTZA 3EYPA 3CJIA 4N53A 2ZX2A 3JBG2 2RVAA 2R041 3CL1A 1H30A 4YG6A 5DG2A 4EE2A 3H1MA 5C3RA 2JEMA 4GH4A 2HWB2 4QHZA 3ATGA 5ACA1 3SH5A 3UGFA 5FY5A 2P4EA 5J09A 1V9U3 3JB4C 3UKVA 5FWEA 2J1SA 1GOFA 1RXFA 1F5JA 5EP9A 1H1IA 1AR91 4M00A 1QEXA 5BNNB 3RQ0A 3WW4A 5AFEA 4LNVA 4MVTA 4B3NA 2G1MA 3KWVA 3CKHA 3N7MA 3ZKUA 3RZJA 1BHGA 3BOPA 4QGMA 2CGOA 3OEAA 1L7QA 4XFCA 3N4MA 1UQXA 3LIGA 1SCSA 1LOEA 5E88A 3PDQA 4FPCA 3WDXA 5JR7B 5FPUA 3FFQA 3GCXA 5JWPA 1E5HA 1NZIA 2RS13 2XGXA 3QLQA 4KBZA 4AFBA 1PZ8A 2GC2A 4HANA 1AXZA 3WP4A 4M3CA 2UWBA 4UBHA 3RS6A 4CE8A 1US3A 2DBIA 1J3PA 1OKOA 1OH3A 1SBFA 1UXXX 3HNMA 4FQ4A 3I97A 1UMHA 4M4PA 4OFGA 5GM0A 4A3ZA 4EZHA 1G9BA 1SPPB 3B69A 3BYWA 2BJSA 4NHXA 2HYKA 1NKGA 4GQ7A 3UL2A 4LORA 3LEGA 4XHXA 4XBQA 3RFRA 1AR62 4B8EA 3OY8A 2QVSB 5KHKA 2VMEA 4X6RB 1NLRA 5FLJA 3VBUC 4ITCA 5J48A 1G9AA 3MF6A 1OD3A 5FZ9A 1US2A 3WQ0A 3FUOA 3BKZA 3ZVXA 1RXGA 3ITQA 4NE9A 5JZGB 4E9KA 3T3YA 2G4IA 3J7MA 4J6GA 2RMU2 4BXSV 1SG3A 2OKXA 2W0XA 1W2OA 4FP2A 2GC0A 3D4KA 3TNPB 4KWUA 3S30A 4TTGA 2WYSA 2PELA 2X5IB 3M3IA 5FZKA 4RQPA 3IMMA 2AEZA 2Y6HA 3N9QA 1JYWA 1K5MA 1NCRB 4K20A 2JG9C 2PYTA 5J96B 4CDXB 3APBA 2WINB 3LB9A 5FYTA 4OI2A 4AI9A 4DMIA 1H0BA 5BY5A 4YGEA 3RWKX 5HXMA 1ZBE2 2QDNA 1RTVA 3HN3A 4IETA 1C1LA 2ZOEB 3R4UA 1S4CA 2WKKA 2ZEYA 4LLFA 5CIRA 5C5TA 3V64A 2Q30A 4LO5B 3LAGA 3AZYA 4KNCA 1UPSA 2IXJA 2ZZQA 2RR11 2Q5TA 4IGPA 2X10A 2GN3A 3C7FA 3G7DA 2HBTA 3KGZA 5GKAC 3VHRA 5JUVA 5DABA 2FDFA 1AX2A 2WNVA 5ABJA 1YRZA 1HXS1 2V5YA 4QKNA 3ROUA 1RVF1 2QQNA 1RHI2 4COVA 4O9EA 2JKBA 3UJQA 5SV5A 1YQ5A 2PQQA 3IBMA 3AJZA 1T6GC 4IEYA 4QPIA 1UX7A 2PQSA 2P5BA 5TSWA 1W6OA 5FZ6A 5J98B 3UT0A 1JYIA 5FY4A 1UZ0A 3SEEA 4A44A 4OMDA 3JU9A 1RUC2 3KQRA 2IXCA 2VZVA 4LBMA 2E9QA 5DUWA 2W39A 3WQ1A 3RI9A 1R082 2UWAA 4OUMA 4DS0A 1LGCA 5F3EA 1I3HA 5A3OA 1HJGA 4XDOA 1OD5A 2Q8EA 3THDA 1K3IA 3BGAA 2FMYA 3OGSA 4YM3A 1BQPA 4LBNA 2R072 3N36A 4R4XA 1YNAA 2OPWA 1XSRA 1COV1 4GMP0 1HB1A 2LS6A 2PHTA 2Q0AA 3VHNA 4WVVA 5A7NA 5A7WA 3VKLA 1HRV1 4CEYB 3WW2A 3QBQA 3A4UA 4N7UA 1S2KA 3VKOA 4XYXA 1GWLA 5C8CA 2WZR3 3HQRA 4GB31 5DQ0A 1W3XA 3CQOA 3EHKA 2WQZC 1Q5OA 4QT6A 4HBNA 2ZXQA 2DVBA 1H6YA 1VBA3 1W0OA 1O7FA 4WVMA 5IATA 3MDPA 2WA3A 1CX1A 2A3WA 3NNJA 3MUZ1 4K21A 1JZ5A 3RZZA 3WLUA 2PHWA 1OFNA 1RUI3 2R042 4XPVA 1WKYA 5JIAA 4M0NA 4YM0A 5FXXA 5ACA2 2WT0A 4JRLA 1W6QA 1ULDA 2A3XA 4K8FA 4L92A 4XMAA 3ZFFC 4Z2AA 5F9TA 1W39A 3QH7A 1UX6A 4D7YA 5L36A 4Q4W3 2J7MA 3KGLA 5FQ0B 4OHYA 3VKMA 2DUPA 4GD4A 4W8JA 1JH5A 4FPEA 5DPNA 1IG0A 3T09A 1MS0A 1LEDA 5FZBA 2JE9A 1IZ3A 1TZOA 1ULFA 4FFIA 1AR92 5A7PA 4ZXKA 5FCCA 1WLWA 4NOTA 4HL0A 5LATA 1WA6X 3RNSA 1PVC1 3HIFA 3WP6A 2JDPA 1IKQA 3HBZA 3HMYA 3NKGA 3WSOA 3L2HA 2W47A 3LDKA 1ND2C 4GWJA 5IVYA 4ES9A 4FOVA 2Z42A 1Y43B 1YFUA 2VZTA 5C9AC 1H4GA 4PIXA 2WFPA 4CP9B 3GDBA 1LOAA 2RJLA 5JCTA 2DU0A 2ZKNA 3POBA 4BJ0A 2DYCA 2GNDA 2WFF1 2VL4A 5F37A 1ODNA 3WG2A 3RI8A 4YZ3A 4AGVA 2EAKA 1BMV1 1IOAA 2IXLA 5BNOB 2VZQA 3LEKA 3PTRB 5BUVA 3FLRA 1REDA 3PVBB 4XCBA 1DQ4A 4E2QA 1U5YA 2VZUA 4CU8A 1QOSA 1MZ6A 1JTZX 4L9BA 5T3NA 3MW3A 4F3JA 2ZGSA 3M3CA 5C4WA 3WHUA 1F4AA 4MG2A 1G9FA 3HQUA 4Q1PA 2ES3A 4Y5Z0 3D6EA 2QQLA 3H1YA 4YVSC 3OYWA 2EALA 4HKOA 3FHIB 1VRH3 4V2WA 3BU0A 3AKTA 1N3QA 2J1AA 2D6PA 2YC2A 5LASA 3B3QE 5A1AA 1VLNA 4CTEA 4JGYC 4BOWA 1MS1A 1ENQA 3BTAA 4AXOA 5D8AB 2RHPA 4OI1A 1FAYA 5F32A 4BDVB 1XQNA 2RR12 4LITA 1KDMA 4XDPA 4XQWA 5LY1A 1H8TB 3IMNA 5A33A 4BH9A 3EQEA 4RS5C 1HXS2 4W50A 3VDDB 1F2NA 2D3SA 1RVF2 1TME3 2HWD3 3ME2A 4JHTA 4XFAA 5F5QA 5T50A 4UT5A 2O8QA 3W59A 4MHRA 2FDIA 1UY2A 4RR3C 1LR5A 3NMBA 2OUHA 4LXLA 5FPAA 1CIWA 1W8FA 1XNKA 4IW3A 3ZOIA 1RUH3 5L7OC 3FHQA 4GA9A 4MXWA 3WDYA 2H6CA 2GNTA 2ZGMA 3KV6A 4MGKE 3PU3A 3ZMNA 5FY0A 4AYUA 4CUCA 1OQEA 4X8NA 1Q56A 4QX2A 4FBFA 3DPRB 2D44A 3AMHA 5DUXA 3B01A 1BEV1 4Y20B 3ZKYA 4DY3A 5BNPA 4QGLA 1COV2 1W2AX 1RUJ1 4Y26A 2ZBJA 1MACA 4NPRA 3E5QA 4CCCA 3ZFGA 1HRV2 5FLIA 2IVIB 3CJIB 3MFCA 3T2QA 4UYBA 4X6QB 2A3YA 1M4WA 4OYUA 2A71A 5H9PA 4XAEA 4CVUA 4GB32 3ZN4A 5L73A 4FT8A 4DINB 2W3JA 4L11A 3LFMA 2D43A 5EJZB 1RUNA 1LCLA 1GZCA 4M4RA 5FMDA 4S2DA 4XQ4A 1JOPA 1YJKA 4Y4RA 5C71A 1JUIA 4JGZB 3WW3A 1ULGA 1ZRCA 2VH9A 2VULA 2X53S 5FYSA 3O1UA 4CCKA 1RUG1 3BALA 5F2WA 3VBSC 1XNAA 3T4VA 4LKFA 5LBEA 5DAXA 3IN9A 2GMEA 3O7OA 4YVWC 5FUIA 3RPQA 4HOOA 2XMLA 2BGPA 4O9GA 4W65A 5FZ1A 3I2FA 3H8XA 1X8EA 1N1SA 1QJU1 4Q5OA 2ENRA 4QQ2A 3EO6A 3GBGA 5HI0A 4CRQA 1MEC3 2CL2A 5A6ZA 3NNFA 2BFUS 3B9IA 5F3CA 1O4YA 4Q27A 1PVC2 1STMA 2G9ZA 4M3CB 3KV9A 5I91A 3AMMA 5EYXA 4CP2A 1QQP1 2E6VA 2JICA 2PMWB 1OQDA 1GMMA 2GZWA 3FJSA 1RITA 2FDKA 4FTBA 2ZGPA 3WP5A 4N7IA 3OY8B 1AL23 1ULCA 3C2UA 1V00A 2GMMA 4XBLA 4MO3M 5LK5A 1EUTA 2A73B 1UZWA 4ARXA 3FX3A 4CCEA 1PX4A 1JYCA 1PMIA 1V6JA 2PAMA 3BOWA 2WFF2 1D2QA 2R063 1HV1A 1TMF1 5LA1A 4IEPA 1AYN3 4P9GA 1BMV2 2QQMA 4B29A 2W5FA 4K40A 3WDTA 4XF1A 2JX9A 1CAXB 3PUHA 3VDBA 4ZS2A 4RQPB 4YM2A 4LR4A 4K1ZA 4G4FA 2VOTA 4MGIE 3OF1A 1MQTA 5F5AA 5DZGA 3TOJA 3W58A 4A7KA 1HB2A 3K51A 4KL1A 5F8PA 4IEUA 3IDAA 3OB8A 3DEMA 4ZU5A 4AHZA 1BJQA 3VBOC 1CZVA 1RUD1 2LRPA 4H2AA 4P9YA 5FZMA 1DQ2A 5I8TA 2QDRA 1N47A 1O8SA 3ZYGA 3G6JB 4UW5A 4AG4A 2ARCA 5BNNA 4YW6A 3WNLA 4AEDC 4MADA 4BHPA 3O1SA 4MH0E 1V70A 3NJYA 4SLIA 1Z0HA 2RS53 3ACIA 5HCFA 2ZMKA 4E8DA 2EA7A 3ACLA 1DYPA 4OUSA 2VVDA 1NY71 1D0HA 2RS31 1BVP1 1JODA 4YFZA 2RJ2A 2VBDA 5C5UA 5GZFA 1OLRA 1UU6A 4OCTA 2DF7A 2QKDA 4QPIB 3WR0A 3ZYBA 5A70A 2HEVF 4QX8A 4CCNA 1W28A 4N9IA 3UKTA 2IFWA 1ASJ1 1QJY3 2OVUA 1HN0A 4W4ZA 3IM0A 4QHBA 5C33A 4CUAA 1GU3A 4NIDA 1GFF2 4LT5A 2IUWA 4MGSA 1JHJA 3LFIA 2PHUA 4H14A 1SPPA 5FBZA 2YHJA 4LHSA 5H9SA 1R091 2I2SA 2G19A 3GJBA 2ZPXA 2PAEA 4OMCA 2WNUB 2ZX0A 1WW4A 4RD7A 3WDVA 5I0UA 5FFOC 1C4RA 3VBRC 4QPGC 3ACFA 1K42A 4MGQA 1PO21 2ZHLA 2XR4A 5DAPA 4LA2A 2GSYA 5A7WB 2ZHNA 2ZGTA 3AB0A 2ZGLA 3OJBA 4EWEA 4CEWA 4P02B 1FPN3 3MIFA 4LULA 1O3TA 2BRTA 2XB6C 4UAPA 1BEV2 2X5IA 5FP4A 1W9SA 4YYOA 1YFYA 1DP0A 4QX0A 5FPBA 4AHYA 1NCRA 3WINE 1HN1A 5ANQA 5KC5A 4CDXA 1RUJ3 2CU5A 4NWWA 2VBPA 3WUDA 3FLTA 1XNDA 4XUTA 4F83A 5CG8A 1OXCA 3R05A 4Y1VA 1ENXA 2JWPA 3KHCA 1Y7BA 1SZBA 2RJKA 3DF0A 4I3GA 4PI2A 1PGW1 4W6WA 1CQ9A 4IE0A 1UZZA 2HWE3 1EAH3 4QXCA 2YGMA 2I07B 1W05A 3MI8A 3P5BA 4ZXEA 4AF9A 3GCWA 4AI8A 1UYZA 4FFHA 2JDUA 1LESA 4TLFA 4NRPA 3UJOA 1ND3A 1UOJA 4U36A 4AEMA 5C70A 4FTSA 4P5HA 5LBCA 4QXKA 2MEV3 2ZACA 4QPYA 5ISLA 2AGSA 1U0AA 4W6XA 3SKVA 1DGLA 2DVFA 1LHOA 3O1TA 4GKXA 5A3TA 3N9OA 1RUG2 1H2LA 4XURA 5DDJ3 3QOPA 3ZYHA 1CAVB 3WCSA 2RDSA 3LDBA 4UW3A 3DKWA 4N43B 4YWAA 1WMDA 3VKNA 1VBE3 2A6ZA 2XQRA 2WLPA 1DYOA 4HLTA 2WAOA 5FTTC 1POV0 2ZJCA 1QJU2 3ZSJA 3HNBM 2HBUA 1PVXA 3PUQA 3NV3A 5FZDA 1UCXA 4AI3A 2Y34A 1HRI3 4DY5A 1OT5A 4EN9B 3PIJA 1QHDA 4F8AA 2Y6JA 4PLNA 3N7JA 1U12A 2BNOA 2K2SA 1VRBA 4Y22B 1QQP2 3HN1A 3PNAA 1LHNA 4IERA 4LJHA 4BQ5A 5J37A 2J42A 3ZFEC 4Z92B 4B1MA 1FOD3 1IS4A 4P08A 3BIEA 2FD8A 2A6WA 5I8SA 3PL0A 4CEYA 2P3IA 4GULA 4JTOA 4OVEA 4WM7A 2PHXA 4E27A 3J7HA 1RUE3 4DRVA 1Y4WA 3Q8AA 1AXKA 3J7LA 4P9IA 2V4AA 4QGNA 3O1MA 1J1LA 1W3VA 2HWB1 4IV3C 1TMF2 4JHZA 2E53A 1N1YA 4XUNA 4EN0A 3RYPA 1UU5A 4UXAA 1QJZA 3T2PA 4QX3A 4IE6A 2WYFA 4DOUA 3BU7A 4OHZA 2D5HA 1UIJA 1W8ZA 2XKOA 1XXNA 4XILA 1MZ5A 4EYUA 3VGIA 3SEPA 1X8MA 5FZAA 3PURA 4KMQA 5FQ0A 5FR3A 1D4M3 1VBD3 2GH2A 1RUD2 2W1WA 2W95A 4GWNA 3AP7A 1WCSA 4QKDA 1N1TA 2EICA 2WNOA 2LALA 2H0BA 3GZUC 4YLZA 2XWJB 1O4TA 3TEWA 4C90A 5IWFA 5KHGA 1DCSA 1K5MC 1NY72 2VQUA 2RS32 3FLPA 1I9RA 4RHV3 2DWRA 2VNOA 3K4DA 1CAWA 3KCYA 4RSUA 2WS93 5FY9A 4ZPIA 4L0PA 3N7LA 1OBNA 3M3OA 1ASJ2 4HVQA 4CP9A 3UGHA 5FO9B 4RN5A 2A7AA 2UWCA 1DBNA 1DLLA 2VCMA 2WC2A 1CPNA 3FBYA 1I5ZA 3KF3A 3KVAA 2V4VA 4MXWB 2HKXA 4URTA 3P1IA 5GLTA 2QQVA 3AC0A 3VBFC 4KWKA 4RGKA 3WUCA 2GALA 4K8RB 1R092 4WZCA 1FT9A 1ZZCA 1LOFC 3MZHA 4CDWC 5I0RA 4M3CF 5C3PA 3VBHB 3MW2A 4NROA 4G9SB 2GP3A 3IT8A 1UOBA 3N7KA 4NRMA 3U4SA 1MPXA 2YZ4A 3TNQA 1ZRIA 1PO22 2JG9B 2WO1A 2YUEA 4IXLA 4LHKA 4V2VA 3WDWA 3ZFGB 4IV1C 2P3YA 4NUBA 3ZXJA 1S0EA 3DYOA 4A3XA 4AE2A 3ZXGA 2JG8C 3HD8B 3ZDSA 3WVJA 2ZGUA 1BYHA 3WNMA 1F31A 3MLLA 4P00B 1ZZ7A 3JD71 5CZKA 4AL9A 1GYKA 1C3HA 5CFDC 5FRAA 4CDUB 1WWYA 3ZXAC 4FOYA 2VUJA 5D8AA 1PGW2 4PBPA 5C6CA 5I0SA 4GJYA 4O65A 1AX0A 3K48A 3QACA 5K0UB 1JS9A 2VMHA 4FI9A 2VGDA 4Q4Y2 4FAGA 1JHNA 1H8TA 5LEJA 2QCSB 4OHWA 2ZGOA 1RC6A 1WW7A 4XJUA 1SLTA 5FJHA 1HQNA 2Z5WA 2JJ6A 3AL6A 2JB4A 3LQCA 4IEWA 2CWSA 2XVLA 5IFPA 5KWRA 4BA6A 1NQDA 3UNPA 1YQ2A 3LOIA 4I30A 4JVAA 4UFJA 4XMIA 4YGDA 2EXIA 2OXBA 1AF9A 3NJVA 4XF0A 3BTYA 3RWNA 4CDQC 4LO6B 1V6NA 4HONA 2XQXA 1NLQA 1XU1A 2FDGA 1RGSA 1O3RA 1YIFA 3UYJA 2VZPA 2V72A 3N9PA 5CISA 1ZVFA 2ZGRA 5F6LB 1OVSA 1XPWA 2YGLA 2FHRA 1Y9GA 1V6OA 1LB2A 2IWGB 1DGRN 2O14A 3KM5A 1RMU1 1REFA 2W9XA 5A3MA 1DF0A 1IPKA 4KBBA 4AQ2A 3O1RA 2HWC3 4KH9A 1HKDA 1OQ1A 2IFRA 4CCOA 3JBG3 1CX4A 1WMXA 2E51A 1MQTB 2B9VA 2VBBA 5D1IA 1C5HA 2RM22 2EAAA 2UYAA 4PIZA 2BQPA 2HWB3 3ZFFB 1JZ3A 4JDOA 5A3NA 3OBTA 1E5IA 2QTWB 1BKZA 1YQ8A 5JMOA 4ZONA 2ET1A 3KD4A 5FK7A 1PM4A 2VZOA 1WCUA 2P34A 3PUSA 2VNGA 3MYXA 3X29B 3C8XA 2BPA2 4LQRA 4JGZA 1OKQA 2LTNA 3ZSLA 3P3NA 3OBAA 2JDNA 3W21A 2WR9A 5D21A 2VUAA 5FO8B 1DQ5A 2AZ5A 4XIKA 3ACGA 3T1LA 4HN1A 4AVVA 1KEXA 3SLIA 5FZ0A 3HVDA 3TBDA 1RINA 2Q1ZB 3H0OA 1LU1A 1UPIA 5FYMA 3I3DA 5C4WC 3FN9A 4LIVA 1QXJA 4L97A 3F2ZA 4UF0B 4Q0PA 4AVAA 1O4ZA 1PNFA 1B35A 3NNMA 2CSGA 2BNNA 1C5IA 1WMEA 2VW0A 3DKQA 3K46A 4Q4V1 2MPFA 2WNEA 1L3JA 1OF4A 5D2AA 4XQDA 2WJSA 2WQ4A 3FZ3A 2HLEA 1CD3G 4JC1A 4P9XA 4AWDA 3B93A 1JZ6A 3AMQA 4BLJA 2JDHA 1AR63 2R16A 5LA0A 1ZBA1 3AZZA 5JIUA 2XONA 4ATEA 3MLKA 2YROA 4C91A 5A3LA 3H8OA 5T5JA 3ZXDA 5CADA 1IQDC 1DFQA 2C5DA 1NE6A 3MGUA 4HSJA 5JI7A 4CEWB 1TNRA 4FP3A 5FMCA 3KLSA 2RMU3 1QDOA 1CAXA 2MHFA 5FK8A 2JB8A 5DG1A 2GC3A 3U11A 2JIGA 4X8PA 2WWSA 1JZ4A 3I59B 5LA9A 1BZWA 1D2SA 3WDUA 1ULEA 2AACA 3U4XA 1IGOA 1KRIA 5FZHA 2LW8A 5E16A 1ZBE3 3ILFA 2P6HA 4YG3A 1PIV1 1ENSA 2FCTA 4NAOA 5CNAA 1LOCA 3R6SA 3SMHA 5C3QA 1UD1A 3JD72 5HCBA 1NA1C 2C26A 5FXZA 1Q8OA 3O1OA 1ND3B 2BVVA 4NIIA 2SLIA 3WQ7A 2EF6A 4HKLA 1QJX1 3I49A 1E5RA 5LBBA 1H4HA 4XHBA 1CN1A 1NE4A 2VTXA 1LNSA 3SITA 2FCUA 1RHI3 1W2UA 2XL7A 2ZEXA 2C6SA 3OGVA 4PDWA 1S55A 3ZLIA 4ET7A 1O8PA 3ETQA 4NPLA 3U1XA 2YDEA 4XJZA 5LB6A 4ZU7A 3POYA 3KF5A 4ISRA 1CAUB 1UOFA 4PF5A 3FL7A 1RUC3 4YW5A 1R1A1 2XKPA 1UYYA 2DFBA 3NAPB 4LBOA 2C24A 4S2HA 3TAYA 4ASMB 1R083 1OUXA 1SLBA 1F5FA 4NWVA 4Y24A 4ZU4A 5FYUA 1OA4A 2KXLA 5KHHA 3I3BA 4KWJA 3PJYA 3S57A 2PN5A 2WNUA 3S0MA 4KI5M 2R073 1S2EA 4LHNA 4RGAA 1ALYA 3AMNA 4WV8A 1WCKA 1WMFA 2XUEA 3CZUA 4OHXA 3M8LA 5IVJA 3GNEA 1MS4A 5A32A 1D4VB 4WM7B 2LUWA 3A0KA 3SNMA 3ENRA 1KFXL 4L2NA 4IL7A 4NHMA 2P3JA 4WM8C 2G9GA 5FZLA 5FOJB 5T55A 1AYM1 4I3PA 2F4LA 1RMU2 1W8NA 5FZCA 1ULOA 2Q4SA 1FYUA 3MIGA 1CVNA 3GHMA 3ORJA 2ZABA 2QQJA 3K4ZA 1YI7A 1UYPA 3VV1A 5FKBA 2R043 1RUF1 1JI6A 1ZA4A 5ACA3 3FC0A 1HB3A 4Q4X1 3OPZA 1WGPA 5JPMB 2B7YA 5KXDA 1X9PA 1PK6B 2ZGNA 2OUJA 3BTXA 3CU7A 4D3WA 2I74A 4OHVA 1AR93 5GLVA 1U5IA 1GNYA 2Z2SB 1IPJA 1HW5A 1LHUA 1CAVA 2WWUA 5AC91 4N43A 2ID4A 2B45X 2WT2A 5JDBA 4QQPA 5IK7A 2GNBA 4HT1T 1CAWB 3ETPA 3ILNA 3WY6A 4YG0A 1UAIA 3L9JT 3NV2A 5FP3A 1JZ7A 5IK8A 4FPGA 4INDA 4Y33A 2VPVA 5FYIA 1SFNA 3RZLA 1JUHA 3ZXLA 4AR2A 4PJYA 3ZYPA 1UWWA 4Q4V2 1W90A 3ASIA 1H6XA 4DEVA 4Y22A 5BNNC 2SBAA 5CG9A 3KCCA 3PHMA 5HV0A 1GZWB 2LM3A 4FQZA 4NO4A 2P3KA 5I0DA 4FFGA 1LENA 5A7SA 4XUPA 3RJRA 1ZBA2 2XOMA 1NAEA 2NMNA 2EIBA 2W68A 2VO5A 1XE8A 2XJQA 4AOCA 4Q8KA 4IUGA 5A3UA 2JE7A 5A6YA 4C8DA 1SQ4A 1O5LA 1SACA 4FPFA 4FPHA 4B7KA 1YYNA 1L7LA 2DTYA 2OW4A 2VMDA 2YBSA 2J22A 3B7MA 4NHKA 1JZ2A 1EV11 2VNRA 3CO2A 2VTFA 5KXBA 2UYBA 2XXZA 5KHJA 3DXUA 5E1RA 5HV4A 4XDQA 3PVEA 4Z2WA 1CZTA 1QIQA 2A6YA 2VMIA 1O3QA 1OI6A 2YB7A 1WD3A 4TXWA 4COZA 3OD4A 1VB4A 1YIPA 4D94A 5CBLA 3AYAA 1WCDJ 4H7MA 3DYMA 4M01A 5IFTA 5JOZA 2WWJA 1PIV2 2WQ8A 3C7HA 1MR5A 3OPTA 5EJ1B 4GAZA 4L8QA 3WT3A 4DXZA 5KBFA 3O1VA 2BERA 5JZGC 4QXHA 1RIRA 5CA6A 3AL5A 3DV8A 2RR13 2Q8OA 4NIAA 1WBLA 1XB9A 2OX0A 2PHDA 2ZX1A 5CFCB 3HT2A 4Y1UA 2X5IC 5IK5A 1VBC1 1QJX2 2BGOA 1SLIA 4BQYA 5FY1A 3PIGA 4LHLA 1ZRDA 1EPWA 2VOVA 4UOJA 1HXS3 3DL3A 3JQXA 1N3OA 5DUUA 2TEPA 5EFUA 5EHDA 1RVF3 2KM2A 4BCUA 4D6QA 3ES4A 5LA2A 3FFZA 5GZDA 1OH4A 2NM1A 2AEYA 1GQHA 4KG8A 4D69A 5E89A 2HWF2 3S7IA 3AFKA 1VJ2A 4Q0SA 4QQHA 4I2OA 4XC9A 3VBUA 4CA9A 2E63A 4UFLA 2ZHMA 1R1A2 2D6NA 4QX1A 4Z8BA 4AK3A 2J1UA 5DXDA 1J84A 2VAUA 2XVKA 3MICA 2GC1A 1C57A 3TWIA 5A3WA 4Q26A 4FOQA 2VZ1A 1RJ7A 2PLV1 1VBB1 1LGBA 3VBHA 1VP6A 4HMZA 4QD2A 2QUOA 2V5DA 1VALA 1REEA 2JG9A 1COV3 2EIEA 3V0BB 3PMEA 2TBVA 1FI2A 3N9NA 1HRV3 4ORFA 4YW4A 2VW2A 5J1XA 5HXVA 3VD9A 4PHZA 2WZEA 3BPSA 5F5IA 3K77A 1AYM2 1SLAA 1HDKA 2ZEWA 3AZVA 4GB33 5GJ6A 4H3WA 4PT6A 5GALA 2GAUA 2ATFA 3EB7A 1BBT1 5LRRA 1UY0A 4EN6B 4P9WA 2R7EB 2QQUA 4CU6A 4HVOA 3NQHA 5JSOA 2PAKA 4FAHA 4CDUA 5FZIA 4CYDA 2XH6A 2JDAA 1FMD1 4J25A 2YXSA 1RUF2 4CU9A 1WCQA 2WRAA 4NIGA 1JU3A 1NQJA 1TG7A 3AVSA 5T5OA 4Q4X2 1HLCA 2TNFA 2W52A 5K0UA 1BLZA 1XBFA 5JSPA 4PIYA 5JAXA 4MZUA 2P1BA 3T2TA 2O1QA 1QGLA 3KZ4C 2X09A 2Z69A 2RE9A 3WW1A 3K2OA 5FZ8A 4OQ9A 3WG1A 1SCRA 2YC0A 3HEIA 3I2GA 1LGNA 4P5YA 3KVBA 4NN0A 4BM8A 4Z07A 1DG6A 1B35B 4XJAA 5AC92 1PVC3 1V6KA 2W2IA 2K9ZA 3ILRA 5C3SA 4Z1VA 2HYXA 1GICA 4Y1YA 4MOAA 2BDRA 3SH4A 2B46X 3KB5A 1JYTA 4QU1A 2W46A 3WNNA 1VPHA 1JYXA 4LEJA 1HB4A 1Y9MA 4LOTA 3Q8CA 1GZTA 4LKDA 4QB1A 4R9AA 1RL3A 2A6VA 3NWKA 2WO2A 1LJ7A 1C28A 1UKRA 1Z7S1 2WFF3 1NLSA 3QCWA 1J3QA 2AH2A 3H3LA 4XCAA 1OLMA 3MFAA 3M1HA 3OGJA 4O7XA 1KGYA 5F3IA 2AENA 4BMBA 1OHFA 1OVPA 1GOGA 1GOHA 2D3RA 5L9BA 3GBFA 2EXHA 1K45A 2XJRA 5KXEA 2YC4A 3ZFFA 4YRDA 1BXHA 4Q1RA 2B5HA 5C3OA 1EV12 1UMZA 3RZGA 3WD5A 1DGWX 2WT1A 3I2HA 1UY4A 2Y26A 4G3YC 3MW4A 3ZR5A 2RV9A 4DIQA 2D97A 3IPVB 2DBNA 4XJ8A 2VVEA 3U14A 2QZ3A 1Z78A 4EZ4A 5BNOC 1TVGA 2XWBB 1ODMA 2JDYA 2YBKA 2R49A 4XF3A 1LULA 2BU9A 4YM1A 3KMHA 5T54A 3N35A 3LIHA 4CP1A 3O1PA 3KHBA 1W6MB 3THTA 3WNXA 2F17A 1YI9A 1AX1A 4GJZA 1YWKA 5L9RA 5DUVA 4SBVA 3CNAA 4PDWB 1G7YA 1JXNA 3UETA 2VMGA 4UF0A 1PO11 2OQ6A 1KITA 2BWAA 3OOXA 4OI4A 4I09A 1VBC2 1DLCA 3ACHA 4LO8A 3KT7A 4RYDA 2EIGA 3HT1A 5IYYA 3ELNA 3W5NA 3D3AA 3RJ2X 1KJLA 1T2XA 3AXDA 2YU1A 3VHOA 2ZAHA 2RDQA 2VZ3A 4PI0A 4JX0A 1NCQB 1WW5A 2D6KA 2PXJA 4HG6B 5D8AC 5JR2A 3AYEA 1OA3A 5IVBA 1W9WA 3AFGA 3RSJA 3USUB 2ARXA 4XJ9A 5FP9A 4IGQA 3J8F1 1UOGA 5CKQA 1A78A 1H8TC 2V73A 4JZRA 2BGCA 4IV1B 1JYVA 4Z82A 5A32B 2XJSA 4CCDA 5J7MA 4Y1ZA 2ZMLA 2C9AA 4ZHNA 3J4UH 1H8VA 1YQ6A 2JKXA 2JDZA 3VDDC 4LBJA 2PLV2 2OQ7A 1JBCA 1VBB2 2YFUA 3CIHA 3VB9A 1UZYA 5FYCA 3CHXA 1ZX5A 1BEV3 4CCMA 4K9SA 4J1XA 1Y9QA 4I01A 3I59A 2VG9A 5SV8A 3UKNA 1UMIA 4LBQB 4AQTA 1W2TA 4B4RA 5CU1A 1EP0A 1OOPC 3ALQA 1VB2A 2X29A 3INAA 1X50A 1SMVA 2PHLA 2JECA 4OLLA 1VMHA 1O3SA 4EROA 1W99A 2D7FA 4LPLA 1CWPA 3Q9OA 3NNLA 1BBT2 5A1LA 3DPRC 1OURA 2Y0OA 4FOWA 4Q4Y1 3C7GA 2ZMNA 2FQPA 4HFSA 5JXJA 4RGGA 4F7ZA 3QH6A 1AHSA 3HPNA 2WBKA 1POV1 1FMD2 4LKEA 1G86A 2CDOA 4IEOA 4WBBA 3VN4A 4AEJA 1H9PA 1XE0A 2BUKA 3LPFA 4QU2A 4PCRA 1DIWA 5FXWA 3WX5A 4C1WA 4IEXA 3CJIC 1GP6A 4N53C 4HK8A 2CY6A 1RUG3 3POWA 2WZ8A 4WVWA 3V56A 2B42B 2WABA 3DXTA 3KV4A 4MV2A 3TRSB 1DZRA 4GH4C 1CAUA 4XVHA 4PQQA 2H6BA 5L7OA 3NAPA 1QJU3 2XBO1 2XHKA 3R4SA 1UO9A 4Q8LA 2VCBA 2D3PA 3U75A 5FDBA 4IESA 4JGZC 1M06G 1SFPA 2VZSA 3DCQA 1Q8QA 3VZLA 2FZ2A 5K9YA 3CEWA 1V6MA 4YW7A 5DMYA 1QQP3 2D98A 4NRQA 2XG3A 1U5XA 2QJVA 3F95A 1C8M1 2NMOA 1R64A 4FCAA 2DVGA 3BUCA 2ORXA 4KG0A 5FBJA 1QOOA 5FZ3A 1AR71 1ENRA 1QJFA 1SDWA 4L99A 3SH3A 3LWCA 1YFWA 3LD8A 1W9YA 1UY3A 2RM21 3T0BA 1Z7S2 4D0QA 1G6NA 1XYNA 1TMF3 5T5PA 4GIQA 4LKSA 1F35A 1RB8G 4JRAA 4GXLA 1H9WA 2PHFA 1MZFA 2ARBA 1GP5A 5M0TA 3AK0A 1UIKA 2Z4FA 3OUHA 2CAVA 1UY1A 2IXIA 3NL1A 3OBZA 1O91A 4U2AA 4BMEA 3MHZA 1KS4A 3SCHA 3TN92 2BZDA 2WSVA 1PK6A 1RUD3 4XW3A 4XOGA 3LDRA 3M7AA 1DGWA 1MVEA 1V9U1 1YHFA 2K46A 1ZRRA 5FZGA 2IXKA 3SCFA 3OGRA 4IEVA 5EPAA 2X8KA 1OPOA 1QJEA 2O8OA 4RQPC 3AP9A 1I5PA 5A7QA 4HVRA 5FY7A 2RS33 4EQVA 2F6BA 4ZS3A 4A2UA 1TEIA 1DDLA 1GP4A 1DHKB 1GV9A 4Q0UA 4JV4A 4R9CA 5BPXA 4QB6A 1PO12 3I3QA 5HBAA 2ILMA 4Y3OA 3ZXFA 1ASJ3 1JZ8A 3VD4A 3THPA 3VBUB 2UY8A 2G9FA 3WNOA 2DVAA 1V6LA 4NMIA 2RS11 5K7PA 4D7TA 1GZWA 2WNVC 3I2JA 4S2FA 2DTWA 1V6IA 2ZZJA 5EXOA 5ABJC 1VMJA 2GH8A 4OQ8A 3LOBA 1R093 2JD4A 5F5CA 1DQ6A 1YFXA 4PQ9A 1WLCA 4QPIC 1ACCA 1S0GA 4A6OA 3ZPOA 1CR7A 3GBWA 3AX4A 4QKFA 4K6BA 3J8F2 1PO23 3VUOA 1SBEA 4B4PA 3NVCA 1S0BA 1TE1B 4MXVA 1IHMA 4XXAA 3I4IA 1AUYA 2FBEA 2DCZA 3SISA 4LBLA 2OA2A 4OI0A 4ISQA 2ORZA 5CB7A 3AKSA 2OYZA 3LSEA 4LLOA 3A23A 3POIA 2CV6A 1C8NA 3J7NA 1O5UA 2WNUC 4R9DA 4ARYA 5FPVA 4LUKA 4UI9L 5JMCA 3LA2A 4B4QA 1JN2P 5HPOA 5EIYB 4I0WB 1RJ8A 1W6NB 4JAAA 4LTAA 2C0ZA 2B4KA 4XUQA 2DVDA 3IIAA 4NR1A 2GP5A 5FMOL 3NV1A 2J1TA 2KR2A 4KQ7A 5C8CC 1KFUL 5CFCA 3N9LA 4Q4Y3 1XNTA 3RDIA 1OLQA 2VC9A 3MEPA 3GYDA 5J36A 2E7TA 2XVGA 3JQWA 4JKKA 4MGTA 3RYKA 3CF6E 3Q8FA 3I2DA 1LRHA 3I3EA 4AZZA 1KS5A 2QQWA 1GUIA 2CTVA 2ZGQA 5KC6A 1I6XA 3A7QA 1UU4A 3JB8A 1W03A 2XPJA 1HQWA 3POFA 2CAUA 3ZDVA 3D0JA 4MUVA 4EN7B 2VUCA 2JXAA 3SKJE 3OEBA 2XBO2 4DNYA 4E2SA 3THCA 1S0JA 2BP6A 1FXZA 3ZYIB 4BE3A 5JXIA 4CPBA 3PUIA 5B4NA 1QKQA 3V0AB 4COYA 3GF6A 2ETEA 3LZZA 2PA7A 1AR82 2AREA 3WHTA 1QNYA 3MIDA 1C8M2 3OSDA 4R8HA 2Q8DA 2YY1A 3S6PA 4N43C 3SXWA 3V0BA 1QF3A 1PMJX 2XHNA 2WL1A 1WW6A 1AR72 2DDUA 3UGGA 3WF0A 3DECA 3USSA 4AVBA 2QZ2A 4FTEA 3E97A 2CGPA 2RM23 4AAXA 5FZOA 5IVEA 2PTMA 1A8DA 2WZR1 3E1F1 3C7EA 3VZOA 1GQGA 4AQSA 1C1FA 4XBNA 3VDCA 3O5SA 2H0VA 5GZCA 2WIIB 1UN1A 5LK7B 1ST8A 2I45A 1VBA1 4BLIA 2VOWA 2ERFA 2WAAA 5KHIA 3MV11 1CONA 1RUI1 3D0SA 5FIXA 4YZ2A 1QNWA 1OC1A 2BWCA 4QHOA 3ZX7A 2VQTA 3EXUA 1KD7A 4LA3A 5AVAA 1FV3A 3PVOA 4Q4W1 1V9U2 1ND2B 4TYSA 1GZ9A 3ECQA 3ZXEA 5LEKA 5JOYA 3UK9A 3BB6A 3JCIA 5C9AB 4BB3A 4Q2FA 3UESA 4AHWA 4D6SA 3JZVA 2OPKA 3CMGA 4BPZA 1P8JA 2VQAA 3H7JA 2VM9A 3ZSEA 1R1ZA 2W1UA 1NG0A 4GWIA 4BWOA 1X9TA 4P9JA 4Q29A 3OCPA 5JSRA 4A7ZA 2FMDA 4AFDA 5EJ3A 2BOJA 3LF7A 3POSA 3ZFEA 4Y4YA 4DQAA 5FZEA 4MSVA 4DPNA 3SHRA 5CEHA 1UXZA 2L9LA 3WNKA 1YO8A 3WF4A 4AI0A 4MGYE 4Q0VA 1JU4A 2W1SA 5EZWA 3WNPA 2DCKA 4JKLA 2BBAA 3HQXA 4C0HA 3I2OA 2A1XA 3JXSA 4OUEA 3T0AA 4AFAA 1VE0A 3MPPG 5FOBB 2RS12 3AMPA 3FWEA 4IV3A 3B5LB 4E8CA 4BQWA 3A21A 4K7JA 1O59A 2P2KA 2D6OX 4YVSB 5B4XA 1W8WA 1OFSA 2QQKA 4UFIA 3RRDA 2FDJA 5FP7A 3T08A 5F39A 2P37A 4EWDA 5DAQA 4JGYB 1SDDB 2Y8KA 4FPJA 1LOBA 1PMHX 3MIBA 1FATA 3MV01 4QXBA 4IEZA 2ZTNA 4I0AA 5F6KA 5FPZA 4YGCA 3IZOA 3IPVA 2ARAA 4OZOA 4DUXA 2K0GA 3NRUA 3JD73 4ONUA 4XIOA 3Q8BA 1W8TA 1Q8VA 3VBHC 1VRH1 5BNPC 3H42B 2XLGA 4RS5B 3ZPYA 3OBRA 5JLVA 4IE5A 1MVQA 1W6MA 3AYDA 3B94A 3ZMOA 4AAPA 3TEYA 2JDMA 3ZFGC 2W92A 3H8UA 4AI1A 4JQRA 2XJTA 2BBVA 2VECA 2HWF1 3WF1A 4CZSA 3TEXA 2JIJA 4DXTA 4RR3B 3PVNA 5JXHA 4XETA 2QNKA 1WA4A 4HSLA 4JDNA 4BIOA 4GMP1 4YZ1A 1PGL1 3POEA 5L7OB 4WZFA 5FZFA 1W0NA 4LUMA 1EY2A 4QQLA 3VBFA 4CDUC 1S1AA 2VXJA 2WSUA 1TME1 2HWD1 1OSGA 5GLUA 1LOFA 1NCQA 3VZNA 4CDWA 4NAMA 1LHVA 1RYYA 3VD7A 2DV9A 4E4SA 3U0ZA 1YQCA 2Y38A 5FPXA 2E7AA 1QDCA 3GGLA 5K8SA 1F4HA 3N3HA 4XFGA 5GZEA 3USUA 5K0UC 4QX5A 1W8OA 3A22A 3K75B 3M3EA 4YW3A 1D0GA 4IV1A 3VKFC 4XTMA 2P17A 5FZ7A 1HV0A 2NLRA 1GLHA 1RUH1 4QQOA 2TUNA 3P6BA 4Y5TA 5F7UA 1VMFA 2ZCWA 1H2KA 2JG8A 4LIUA 1XU2A 3KQ4B 5FZ4A 4N8MA 3WEZA 1W06A 5IT6A 4RL7A 4XEZA 2XDVA 4LBQA 4Y1XA 4CXWA 1TQ5A 2NQYA 1RMU3 4LE3A 1JOJA 4MLOA 2Y6LA 5CFDA 5I8YA 2R1BA 2VOKA 1JMUB 4QM9A 1VAKA 1WUVA 4CUBA 5IAXA 5JOWA 4FSJA 1NOVA 2AUYA 1BVVA 2BOIA 3LCPA 3NV4A 5IAVA 3RGBA 1FNYA 4DB5A 4E2GA 5ERLA 5HCHA 1F9KA 4FPOB 2YU2A 1YXWA 1ONAA 3VBSB 2WLQA 3DUIA 3T0DA 1GWKA 2WZR2 4HKWA 4J1WA 4YVWB 3AKRA 5IVCA 1SFYA 1NYWA 4XF4A 2VCAA 2NN8A 3U37A 1VBA2 2AR6A 2CWMA 3NNGA 2IVJA 3NJXA 5IJRA 2W91A 2ADDA 2W94A 4YSFA 1QWRA 1RUI2 3AP4A 3NO8A 1SHWB 4RFRB 4UFMA 3AKQA 3MIEA 3VD5A 5C8WA 1MQTC 3ES1A 1T6BX 2Y6KA 1SLCA 3MF9A 3CDZB 1VIWB 3WP3A 4LE4A 1X82A 5BV6A 3EBRA 1A6CA 4Q4W2 3V65A 4CDQA 3KCXA 3M2MA 2QFEA 4META 4Y5SA 3FMGA 4HPKB 2KA3A 4I0BA 2W08A 4TLGA 5DZEA 1MEC1 2A70A 3MLJA 4Q4V3 1A3KA 2UU8A 4JDMA 3W5MA 4NHLA 3DGTA 3B02A 5FYHA 2W87A 2VR4A 5AVPA 4ASKA 3RZKA 2WN2A 2VTXJ 2CHHA 2JDKA 2VNVA 1ZBA3 3OUJA 2OZJA 4JKMA 4UFHA 2BW8A 3WF3A 3GALA 5A3PA 1X7NA 1UKGA 4BQ1A 1AL21 1QMJA 3RG0A 1YLLA 2DUOA 5EQUA 1POQA 2YV8A 5I0TA 3ZM8A 4BZ4A 2X05A 1Q3EA 3H8RA 2R061 3Q8EA 4P14A 1LECA 3A0NA 5E8AA 2Q1FA 3VBOB 1AYN1 4COUA 4LO7A 4P9LA 5FYZA 5BYNA 4IGOA 3RZMA 4NPMA 2EXJA 4TN7A 1FX5A 2BNMA 3VZKA 5EV7A 1XNBA 4AEDB 4QAWA 3H3ZA 3WV6A 4AFCA 4LMFA 1S0DA 1PZ9A 5LZ6A 2OS2A 1ZM1A 1CJDA 1S2BA 2VZRA 5FYYA 3U78A 4XFFA 1SEFA 1PIV3 5JVVA 2DUQA 4YARA 3ZN5A 2N7GA 4BK5A 4CEWC 5FYBA 3GJAA 3VL9A 5F1RA 4PF1A 3VL8A 4QMAA 4CP0A 2WO7A 2W1QA 1J3RA 1KJRA 1VRH2 3O0WA 5GLZA 2ADEA 4H55A 3E5XA 4ZZ5A 4A6SA 1XNCA 3GZAA 1NCRC 2LROA 5K4LA 2E33A 2VXRA 4XAAA 1QJX3 1W04A 3ZN6B 4AGRA 5E6HA 4CDXC 1IKPA 5FWJA 1AJKA 4TWTA 2RS51 2R6QA 1DQ0A 1W2NA 2B9UA 4FPLA 5KXCA 2YPDA 3NKTA 5GLWA 3ZYJB 1CZSA 1SLLA 2HWF3 3GM8A 2Y0IA 1PGL2 4IEQA 1N3PA 2WO3A 3I2IA 4ZZ8A 3ON7A 3VBRB 1LU2A 4QPGB 2R30A 3AZWA 4GMP3 4V1PA 1QJY1 1R1A3 5FMBA 1J58A 1ND3C 1U5ZA 3BN6A 3ZR6A 3R4DB 2A5ZA 3R0RA 3MPBA 5JI9A 4QDRA 1TME2 2HWD2 4KGGA 1ZRFA 3E6BA 1S0FA 2P6CA 3J26N 1XSQA 2HJIA 2ZX3A 2A6XA 4DUVA 4EV0A 2E31A 3M70A 3B9CA 3GXUA 4GWMA 4CPBD 1LEMA 1MS8A 2OZ6A 4UWDA 2XJUA 1W6PB 5T52A 5FP8A 4CXYA 1YEWA 4GALA 4CXXA 4YW1A 1OOPB 1LHWA 3HAGA 4FVVA 1RUH2 3WZ1A 5GZGA 4C1XA 3S5AA 3BCWA 1AZDA 1UL9A 3MUY1 3NAPC 4DRRA 3EJKA 4RFT0 2HEWF 4KWLA 3T4HB 1FPN1 1UNBA 1J83A 1NA1A 1AYM3 4N9HA 5FZOB 4FPYA 5FV3A 5H9QA 4BQXA 4BXFA 2DURA 2NYYA 3FE5A 4GZ9A 4AW7A 4M3CE 4COWA 2CNAA 2NPIA 3VHPA 4BISA 1LTEA 4CCLA 1W6NA 4MYEA 4CEYC 1RUF3 3BPZA 1X33A 2WA4A 4N53B 1AL0G 3LA7A 4WM7C 2VUDA 4KU7A 3ZXKA 3K4AA 4Q4X3 4R4ZA 1J1TA 5DZFA 5IHRA 3IKWA 5FY8A 2HWE1 1EAH1 4GH4B 4AHXA 4MX3A 4EJRA 3OD0A 4EN8B 5BNQA 2BVBA 4AVSA 1GR3A 4CU7A 3SC7X 1JOBA 2R1DA 1JW6A 3I54A 2MEV1 3PMSA 5CKMA 4I02A 5F2SA 4JTNA 3ZSMA 4XZPA 2R0HA 4XFBA 3JUUA 1D7PM 3KS7A 5AC93 5B2GB 1JYNA 3PLQA 5DDJ1 1NXD1 4UBGA 3ZFEB 1G9DA 2DCJA 5JOXA 2WDBA 4D8MA 1VBE1 3IAQA 4ES8A 5IW0A 1XYOA 1PK6C 3H1WA 3D8CA 5CKNA 1AXYA 1W8HA 5I93A 1MEC2 3DYPA 4WM8A 2HH9A 3V0AA 2F4PA 3AKPA 3GZTB 1HRI1 4LBKA 4IV3B 2BFUL 4K1YA 1WLTA 4QWNA 4E4DX 4QPWA 3WG3A 4XJWA 1DQ1A 1WBFA 5CVRA 2Z79A 3LPGA 3ZYFA 1FOD1 1CIYA 1NT0A 1LKNA 2WZPP 3H50A 2ZKLA 2E26A 3RMYA 3RYRA 1AL22 2IC1A 4WVZA 3KT1A 4NVPA 4XUOA 3LGRA 1N1VA 1RUE1 3O14A 4A41A 5LY2A 1V0AA 4NIHA 1I1EA 2R062 3URFA 1EV13 3TN91 4E4HA 5IVFA 3IAPA 3HBKA 1AYN2 2D40A 4TZDA 3WQBA 1BK1A 1ZREA 4DUWA 3M3QA 5BXXA 4E4ZA 2VOXA 2OT7A 4PLMA 3AYCA 1CJPA 4YPJA 3M4FA 1FNZA 3POGA 2NP0A 2QBXA 5F3GA 2PFWA 1EPZA 1K5MB 3WXPA 1CGPA 3PJQA 2D5FA
chains in the Genus database with same CATH topology
2HBTA 5IAXA 4J25A 3HQUA 5IAVA 3MGUA 2RDSA 2FCVA 3GZEA 5ERLA 4NMIA 3W20A 4UWDA 2JIGA 2HBUA 5LASA 5LA9A 5DAVA 2Y34A 5HV0A 3OUIA 4NHYA 4XACA 3NNLA 2FCTA 4NAOA 4BQXA 5A3UA 3PL0A 2A1XA 2OPWA 4NHKA 2V4AA 4BQWA 5LBBA 4Y5SA 5HV4A 3KT4A 2FCUA 5DAWA 3EMRA 4MHRA 5LBFA 3HQRA 5EP9A 4IW3A 4NHLA 5LB6A 4XCAA 5C5UA 5DAQA 4XABA 5L9BA 2G1MA 5IATA 3OUJA 3NNJA 5EQUA 4BQYA 4KBZA 2G19A 3GJBA 4ZONA 4NHMA 4MHUA 4NHXA 4XC9A 3W21A 5DAPA 5LATA 2JIJA 4ZPIA 5L9RA 5M0TA 3OUHA 3GJAA 3ITQA 3KT1A 3OBZA 3BVCA 3KT7A 5LBEA 5DAXA 5L9VA 2RG4A 4XAAA 2RDQA 3NNMA 2Y33A 3DKQA 4Q5OA 5EPAA 3NNFA 2RDNA 4Y5TA 2RDRA 4XCBA 5C5TA 4JZRA 5LBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBT A;  5IAX A;  4J25 A;  3HQU A;  5IAV A;  3MGU A;  2RDS A;  2FCV A;  3GZE A;  5ERL A;  4NMI A;  3W20 A;  4UWD A;  2JIG A;  2HBU A;  5LAS A;  5LA9 A;  5DAV A;  2Y34 A;  5HV0 A;  3OUI A;  4NHY A;  4XAC A;  3NNL A;  2FCT A;  4NAO A;  4BQX A;  5A3U A;  3PL0 A;  2A1X A;  2OPW A;  4NHK A;  2V4A A;  4BQW A;  5LBB A;  4Y5S A;  5HV4 A;  3KT4 A;  2FCU A;  5DAW A;  3EMR A;  4MHR A;  5LBF A;  3HQR A;  5EP9 A;  4IW3 A;  4NHL A;  5LB6 A;  4XCA A;  5C5U A;  5DAQ A;  4XAB A;  5L9B A;  2G1M A;  5IAT A;  3OUJ A;  3NNJ A;  5EQU A;  4BQY A;  4KBZ A;  2G19 A;  3GJB A;  4ZON A;  4NHM A;  4MHU A;  4NHX A;  4XC9 A;  3W21 A;  5DAP A;  5LAT A;  2JIJ A;  4ZPI A;  5L9R A;  5M0T A;  3OUH A;  3GJA A;  3ITQ A;  3KT1 A;  3OBZ A;  3BVC A;  3KT7 A;  5LBE A;  5DAX A;  5L9V A;  2RG4 A;  4XAA A;  2RDQ A;  3NNM A;  2Y33 A;  3DKQ A;  4Q5O A;  5EPA A;  3NNF A;  2RDN A;  4Y5T A;  2RDR A;  4XCB A;  5C5T A;  4JZR A;  5LBC A; 
#chains in the Genus database with same CATH topology
 2QQO A;  4DXR A;  4YNI A;  5HCA A;  2ZAA A;  1ND2 A;  4IQP A;  3HJR A;  1D4M 1;  4HET A;  4AVC A;  1VBD 1;  3NST A;  4CCJ A;  2JEN A;  1DU3 D;  1YJL A;  5C9A A;  1S0C A;  3D5O A;  3KV5 A;  4PLO A;  2B8M A;  1VAV A;  1VBC 3;  3H3U A;  5IVV A;  1GNZ A;  4FXK B;  1H1M A;  1H2M A;  2RS5 2;  3LSD A;  2PHR A;  1NZC A;  3VBF B;  1KXG A;  2WNV B;  1DYK A;  4R9B A;  4RHV 1;  5ABJ B;  4GKY A;  1E5S A;  3IDE A;  4CDW B;  1F15 A;  1W8U A;  2A75 A;  2VU9 A;  2WS9 1;  3AZX A;  4AEK A;  5ANN A;  1OUS A;  4QDS A;  1OPM A;  1W6O B;  1QJY 2;  4XFH A;  2GU9 A;  4XZU G;  1QU0 A;  5CFC C;  2IXH A;  4KU8 A;  3III A;  3MO4 A;  1NX9 A;  1ZYB A;  2XL9 A;  3IDC B;  4HZF A;  5FAX A;  2QQP A;  1PNG A;  1AJO A;  1GQP A;  1O6U A;  2ZGK A;  2JG8 B;  3RVH A;  2J1E A;  3E6D A;  3HR9 A;  4YVS A;  2PLV 3;  5H9R A;  1VBB 3;  1QH7 A;  3HOB A;  1DZT A;  2JD9 A;  3I7D A;  1SBD A;  4Q0Q A;  4B1L A;  1ZZ6 A;  1YUD A;  5JXG A;  3ST7 A;  5IK4 A;  3WG4 A;  5CFD B;  1EYB A;  3BI3 A;  4TSV A;  2QE3 A;  1W0P A;  2D6L X;  2J1R A;  4JGY A;  5LBF A;  5IUQ A;  4LBQ D;  3ZO0 B;  3CZJ A;  1BK0 A;  4HK9 A;  4D6R A;  1FPN 2;  4QM8 A;  5JZG A;  2VCC A;  4RA0 A;  3TEZ A;  4XAB A;  4URA A;  4BQ4 A;  1BBT 3;  5C8C B;  2VJX A;  4N90 A;  1Y3T A;  1WD4 A;  3OTF A;  1PX3 A;  4RS5 A;  4YW2 A;  3VLB B;  4YFW A;  1RUJ 2;  3MBW A;  2UUR A;  4IE4 A;  1FMD 3;  3P3P A;  3ZIW A;  4BQ3 A;  2ZS6 B;  1A8M A;  3KSC A;  4FXG B;  4WVM B;  4ASL A;  3CBN A;  1EUU A;  4B7E A;  2Y6G A;  4A42 A;  3H9A A;  2HWE 2;  1EAH 2;  4RR3 A;  1XYP A;  3RZH A;  2XLA A;  4ZKT B;  1W6Q B;  1L7R A;  1UF2 C;  1NXM A;  1AVB A;  1DGR A;  5T5L A;  2C9K A;  4CDQ B;  4MHU A;  1VR3 A;  5FPL A;  3ZSK A;  5G05 L;  5CAZ A;  2MEV 2;  3U10 A;  3C7O A;  4ATF A;  3O0V A;  2ZHK A;  3DN7 A;  1MS9 A;  4UW6 A;  4IDZ A;  2B39 A;  1WLD A;  5DDJ 2;  1QY4 A;  1QOT A;  1QXP A;  1UW8 A;  1AR8 1;  3WF2 A;  3NW4 A;  2UY9 A;  1RUO A;  4JCK A;  3UV9 A;  1VBE 2;  2GN7 A;  4OZX A;  5A6X A;  2YYO A;  2QQI A;  1GKB A;  2Y60 A;  4UFK A;  1BCX A;  5L9V A;  3IWZ A;  4IE7 A;  2RG4 A;  4ZY9 A;  4AFM A;  4PBO A;  5JPN B;  1URX A;  1VAM A;  3ZYR A;  3ABZ A;  1HRI 2;  2D93 A;  1Q8P A;  3CJX A;  2YG0 A;  1Z7S 3;  2RDN A;  1B35 C;  2BEO A;  2YFZ A;  4LO4 B;  1H2N A;  2RDR A;  5LRS A;  2FZ1 A;  2BV4 A;  1FOD 2;  2XJV A;  2YBP A;  1IG3 A;  1OF3 A;  1IS5 A;  3WOG A;  4DO0 A;  2VW1 A;  5FXV A;  1W9F A;  4HXC A;  4K3U A;  5FKC A;  1MS3 A;  2VD7 A;  3D82 A;  2HWC 1;  1XJA A;  3LEI A;  4JQT A;  3VBS A;  1RUE 2;  1YCI A;  1PGS A;  3JBG 1;  5FJK A;  3I3M A;  5FO7 B;  5J3U A;  5LWB A;  3K3O A;  4YVW A;  3IDB B;  2CGN A;  2FCV A;  3GZE A;  4XXP A;  4CUG A;  5FLH A;  4C0B A;  1XC6 A;  4A7Y A;  1LAJ A;  3TN9 3;  3CLP A;  1H1A A;  5A1F A;  3AM2 A;  2YMZ A;  2GDF A;  5C4W B;  2XLF A;  5AFB A;  1HX6 A;  1G8W A;  1GSL A;  2GMP A;  1QH6 A;  1HIX A;  1MZE A;  5LW9 A;  1ZA7 A;  2ZEZ A;  1IS3 A;  3AP6 A;  5A6Q A;  1QXR A;  3OYW B;  1TNF A;  1F8V A;  3OUI A;  4NHY A;  3SCG A;  2J1V A;  4XAC A;  2OII A;  4AVT A;  4NJ4 A;  4BU2 A;  4UW4 A;  1GNH A;  3T30 A;  3LKJ A;  2BTV C;  4BK4 A;  4DXS A;  3VZM A;  4S2G A;  1D4M 2;  3FUQ A;  1VBD 2;  4HN0 A;  4FPK A;  3OPW A;  1PO1 3;  4HPK A;  1LOD A;  4O61 A;  4XE9 A;  3LA3 A;  1ZNP A;  1W9T A;  1ZZ8 A;  3LEM A;  4QB2 A;  3U07 A;  4FFF A;  1KDK A;  1ULP A;  2V09 A;  4QDQ A;  1CES A;  3K3N A;  2ZX4 A;  4FO9 A;  5A33 B;  1NUK A;  3KT4 A;  4OUL A;  2JE8 A;  2DU1 A;  2Y6F A;  4RHV 2;  3POJ A;  1J59 A;  2EXK A;  1X36 A;  5DAW A;  3EMR A;  3VDA A;  2DFC A;  3WCR A;  2VE1 A;  2WS9 2;  2VQ0 A;  4XFI A;  3TB0 A;  1IS6 A;  1IPS A;  1S0I A;  1Q8S A;  2XJP A;  3VD3 A;  4PDW C;  1E57 A;  1CPM A;  1ZZ9 A;  3LE0 A;  1AR6 1;  3AXE A;  2MNG A;  3BOD A;  3GHN A;  4XF9 A;  3J8F 3;  4H7L A;  3L2Y A;  2GNM A;  3HWJ A;  3VBO A;  2KD7 A;  1APN A;  3SQO A;  1Q43 A;  3AJY A;  5FUN A;  3HNY M;  3T2O A;  3TYJ A;  1NA1 B;  3C3V A;  2RMU 1;  1B09 A;  5FYV A;  2FDH A;  1MS5 A;  1NCQ C;  3BIW E;  4AED A;  5BNO A;  2HEY F;  3T1M A;  5BNP B;  2EID A;  3AVR A;  5FRE A;  1ZZB A;  5G04 L;  3E5U A;  3FBM A;  3MIH A;  4EWA A;  2VY0 A;  3N9M A;  3O0X A;  4MGZ E;  5FMO S;  1IQA A;  1ZBE 1;  5A7O A;  2R0F A;  2WUH A;  3O12 A;  1XOY A;  1G9C A;  4BIF A;  2Q1M A;  3IB3 A;  2CDP A;  4A45 A;  3ZN6 A;  2DCT A;  2NZ9 A;  1POV 3;  4BQ2 A;  4D7S A;  5DN2 A;  4YZ5 A;  2YPJ A;  1HQL A;  3BVC A;  4A4A A;  3FHA A;  1OLM E;  4AGG A;  1KQR A;  1HJF A;  1A34 A;  4QKB A;  3W9A A;  4LK7 A;  1YC6 1;  3S7E A;  1XRU A;  2XUM A;  1RHI 1;  3AP5 A;  2AYH A;  2E7Q A;  4YGB A;  2Y33 A;  3VBR A;  1XE7 A;  4QPG A;  1UZV A;  5FUP A;  1OA2 A;  3PU8 A;  3I2K A;  2C1F A;  1PM7 A;  3QD6 A;  5LCW L;  2XBO 3;  3PTY A;  4M0H A;  2EVX A;  1RUC 1;  2VVF A;  2R32 A;  4YZ4 A;  4BYY A;  4W6Y A;  4CSW A;  4QX7 A;  3VDD A;  1PZ7 A;  4R52 A;  4WM8 B;  5EYY A;  5C7G A;  1R08 1;  5L19 A;  1GWM A;  3OG2 A;  2ZA9 A;  2ET7 A;  1LOG A;  3I8T A;  3E6C C;  1GBG A;  1K5J A;  1AR8 3;  1W6P A;  3B00 A;  3H7Y A;  3NJZ A;  2C4X A;  5CYY A;  1C8M 3;  1K12 A;  2AC1 A;  1WZX A;  1OOP A;  2DCY A;  2IZW A;  2R07 1;  3RMX A;  4AI2 A;  3J9S A;  3ZIX A;  4DFS A;  1OMI A;  2Q8C A;  1GAN A;  1AR7 3;  1UYX A;  3W20 A;  4AQ6 A;  2VMF A;  2CYF A;  2O0O A;  5APA A;  1FV2 A;  2D6M A;  1PHM A;  4DZG A;  2E32 A;  5DAV A;  3DPR A;  3OGG A;  4DEQ A;  5A80 A;  4KGQ A;  4Y20 A;  5KR7 A;  3PUA A;  2BYV E;  3VZJ A;  2WN3 A;  1DZQ A;  4LOS A;  2VMC A;  2Y64 A;  4LK6 A;  4XTP A;  5EWS A;  2HWC 2;  3S5Q A;  3BTZ A;  3EYP A;  3CJI A;  4N53 A;  2ZX2 A;  3JBG 2;  2RVA A;  2R04 1;  3CL1 A;  1H30 A;  4YG6 A;  5DG2 A;  4EE2 A;  3H1M A;  5C3R A;  2JEM A;  4GH4 A;  2HWB 2;  4QHZ A;  3ATG A;  5ACA 1;  3SH5 A;  3UGF A;  5FY5 A;  2P4E A;  5J09 A;  1V9U 3;  3JB4 C;  3UKV A;  5FWE A;  2J1S A;  1GOF A;  1RXF A;  1F5J A;  5EP9 A;  1H1I A;  1AR9 1;  4M00 A;  1QEX A;  5BNN B;  3RQ0 A;  3WW4 A;  5AFE A;  4LNV A;  4MVT A;  4B3N A;  2G1M A;  3KWV A;  3CKH A;  3N7M A;  3ZKU A;  3RZJ A;  1BHG A;  3BOP A;  4QGM A;  2CGO A;  3OEA A;  1L7Q A;  4XFC A;  3N4M A;  1UQX A;  3LIG A;  1SCS A;  1LOE A;  5E88 A;  3PDQ A;  4FPC A;  3WDX A;  5JR7 B;  5FPU A;  3FFQ A;  3GCX A;  5JWP A;  1E5H A;  1NZI A;  2RS1 3;  2XGX A;  3QLQ A;  4KBZ A;  4AFB A;  1PZ8 A;  2GC2 A;  4HAN A;  1AXZ A;  3WP4 A;  4M3C A;  2UWB A;  4UBH A;  3RS6 A;  4CE8 A;  1US3 A;  2DBI A;  1J3P A;  1OKO A;  1OH3 A;  1SBF A;  1UXX X;  3HNM A;  4FQ4 A;  3I97 A;  1UMH A;  4M4P A;  4OFG A;  5GM0 A;  4A3Z A;  4EZH A;  1G9B A;  1SPP B;  3B69 A;  3BYW A;  2BJS A;  4NHX A;  2HYK A;  1NKG A;  4GQ7 A;  3UL2 A;  4LOR A;  3LEG A;  4XHX A;  4XBQ A;  3RFR A;  1AR6 2;  4B8E A;  3OY8 A;  2QVS B;  5KHK A;  2VME A;  4X6R B;  1NLR A;  5FLJ A;  3VBU C;  4ITC A;  5J48 A;  1G9A A;  3MF6 A;  1OD3 A;  5FZ9 A;  1US2 A;  3WQ0 A;  3FUO A;  3BKZ A;  3ZVX A;  1RXG A;  3ITQ A;  4NE9 A;  5JZG B;  4E9K A;  3T3Y A;  2G4I A;  3J7M A;  4J6G A;  2RMU 2;  4BXS V;  1SG3 A;  2OKX A;  2W0X A;  1W2O A;  4FP2 A;  2GC0 A;  3D4K A;  3TNP B;  4KWU A;  3S30 A;  4TTG A;  2WYS A;  2PEL A;  2X5I B;  3M3I A;  5FZK A;  4RQP A;  3IMM A;  2AEZ A;  2Y6H A;  3N9Q A;  1JYW A;  1K5M A;  1NCR B;  4K20 A;  2JG9 C;  2PYT A;  5J96 B;  4CDX B;  3APB A;  2WIN B;  3LB9 A;  5FYT A;  4OI2 A;  4AI9 A;  4DMI A;  1H0B A;  5BY5 A;  4YGE A;  3RWK X;  5HXM A;  1ZBE 2;  2QDN A;  1RTV A;  3HN3 A;  4IET A;  1C1L A;  2ZOE B;  3R4U A;  1S4C A;  2WKK A;  2ZEY A;  4LLF A;  5CIR A;  5C5T A;  3V64 A;  2Q30 A;  4LO5 B;  3LAG A;  3AZY A;  4KNC A;  1UPS A;  2IXJ A;  2ZZQ A;  2RR1 1;  2Q5T A;  4IGP A;  2X10 A;  2GN3 A;  3C7F A;  3G7D A;  2HBT A;  3KGZ A;  5GKA C;  3VHR A;  5JUV A;  5DAB A;  2FDF A;  1AX2 A;  2WNV A;  5ABJ A;  1YRZ A;  1HXS 1;  2V5Y A;  4QKN A;  3ROU A;  1RVF 1;  2QQN A;  1RHI 2;  4COV A;  4O9E A;  2JKB A;  3UJQ A;  5SV5 A;  1YQ5 A;  2PQQ A;  3IBM A;  3AJZ A;  1T6G C;  4IEY A;  4QPI A;  1UX7 A;  2PQS A;  2P5B A;  5TSW A;  1W6O A;  5FZ6 A;  5J98 B;  3UT0 A;  1JYI A;  5FY4 A;  1UZ0 A;  3SEE A;  4A44 A;  4OMD A;  3JU9 A;  1RUC 2;  3KQR A;  2IXC A;  2VZV A;  4LBM A;  2E9Q A;  5DUW A;  2W39 A;  3WQ1 A;  3RI9 A;  1R08 2;  2UWA A;  4OUM A;  4DS0 A;  1LGC A;  5F3E A;  1I3H A;  5A3O A;  1HJG A;  4XDO A;  1OD5 A;  2Q8E A;  3THD A;  1K3I A;  3BGA A;  2FMY A;  3OGS A;  4YM3 A;  1BQP A;  4LBN A;  2R07 2;  3N36 A;  4R4X A;  1YNA A;  2OPW A;  1XSR A;  1COV 1;  4GMP 0;  1HB1 A;  2LS6 A;  2PHT A;  2Q0A A;  3VHN A;  4WVV A;  5A7N A;  5A7W A;  3VKL A;  1HRV 1;  4CEY B;  3WW2 A;  3QBQ A;  3A4U A;  4N7U A;  1S2K A;  3VKO A;  4XYX A;  1GWL A;  5C8C A;  2WZR 3;  3HQR A;  4GB3 1;  5DQ0 A;  1W3X A;  3CQO A;  3EHK A;  2WQZ C;  1Q5O A;  4QT6 A;  4HBN A;  2ZXQ A;  2DVB A;  1H6Y A;  1VBA 3;  1W0O A;  1O7F A;  4WVM A;  5IAT A;  3MDP A;  2WA3 A;  1CX1 A;  2A3W A;  3NNJ A;  3MUZ 1;  4K21 A;  1JZ5 A;  3RZZ A;  3WLU A;  2PHW A;  1OFN A;  1RUI 3;  2R04 2;  4XPV A;  1WKY A;  5JIA A;  4M0N A;  4YM0 A;  5FXX A;  5ACA 2;  2WT0 A;  4JRL A;  1W6Q A;  1ULD A;  2A3X A;  4K8F A;  4L92 A;  4XMA A;  3ZFF C;  4Z2A A;  5F9T A;  1W39 A;  3QH7 A;  1UX6 A;  4D7Y A;  5L36 A;  4Q4W 3;  2J7M A;  3KGL A;  5FQ0 B;  4OHY A;  3VKM A;  2DUP A;  4GD4 A;  4W8J A;  1JH5 A;  4FPE A;  5DPN A;  1IG0 A;  3T09 A;  1MS0 A;  1LED A;  5FZB A;  2JE9 A;  1IZ3 A;  1TZO A;  1ULF A;  4FFI A;  1AR9 2;  5A7P A;  4ZXK A;  5FCC A;  1WLW A;  4NOT A;  4HL0 A;  5LAT A;  1WA6 X;  3RNS A;  1PVC 1;  3HIF A;  3WP6 A;  2JDP A;  1IKQ A;  3HBZ A;  3HMY A;  3NKG A;  3WSO A;  3L2H A;  2W47 A;  3LDK A;  1ND2 C;  4GWJ A;  5IVY A;  4ES9 A;  4FOV A;  2Z42 A;  1Y43 B;  1YFU A;  2VZT A;  5C9A C;  1H4G A;  4PIX A;  2WFP A;  4CP9 B;  3GDB A;  1LOA A;  2RJL A;  5JCT A;  2DU0 A;  2ZKN A;  3POB A;  4BJ0 A;  2DYC A;  2GND A;  2WFF 1;  2VL4 A;  5F37 A;  1ODN A;  3WG2 A;  3RI8 A;  4YZ3 A;  4AGV A;  2EAK A;  1BMV 1;  1IOA A;  2IXL A;  5BNO B;  2VZQ A;  3LEK A;  3PTR B;  5BUV A;  3FLR A;  1RED A;  3PVB B;  4XCB A;  1DQ4 A;  4E2Q A;  1U5Y A;  2VZU A;  4CU8 A;  1QOS A;  1MZ6 A;  1JTZ X;  4L9B A;  5T3N A;  3MW3 A;  4F3J A;  2ZGS A;  3M3C A;  5C4W A;  3WHU A;  1F4A A;  4MG2 A;  1G9F A;  3HQU A;  4Q1P A;  2ES3 A;  4Y5Z 0;  3D6E A;  2QQL A;  3H1Y A;  4YVS C;  3OYW A;  2EAL A;  4HKO A;  3FHI B;  1VRH 3;  4V2W A;  3BU0 A;  3AKT A;  1N3Q A;  2J1A A;  2D6P A;  2YC2 A;  5LAS A;  3B3Q E;  5A1A A;  1VLN A;  4CTE A;  4JGY C;  4BOW A;  1MS1 A;  1ENQ A;  3BTA A;  4AXO A;  5D8A B;  2RHP A;  4OI1 A;  1FAY A;  5F32 A;  4BDV B;  1XQN A;  2RR1 2;  4LIT A;  1KDM A;  4XDP A;  4XQW A;  5LY1 A;  1H8T B;  3IMN A;  5A33 A;  4BH9 A;  3EQE A;  4RS5 C;  1HXS 2;  4W50 A;  3VDD B;  1F2N A;  2D3S A;  1RVF 2;  1TME 3;  2HWD 3;  3ME2 A;  4JHT A;  4XFA A;  5F5Q A;  5T50 A;  4UT5 A;  2O8Q A;  3W59 A;  4MHR A;  2FDI A;  1UY2 A;  4RR3 C;  1LR5 A;  3NMB A;  2OUH A;  4LXL A;  5FPA A;  1CIW A;  1W8F A;  1XNK A;  4IW3 A;  3ZOI A;  1RUH 3;  5L7O C;  3FHQ A;  4GA9 A;  4MXW A;  3WDY A;  2H6C A;  2GNT A;  2ZGM A;  3KV6 A;  4MGK E;  3PU3 A;  3ZMN A;  5FY0 A;  4AYU A;  4CUC A;  1OQE A;  4X8N A;  1Q56 A;  4QX2 A;  4FBF A;  3DPR B;  2D44 A;  3AMH A;  5DUX A;  3B01 A;  1BEV 1;  4Y20 B;  3ZKY A;  4DY3 A;  5BNP A;  4QGL A;  1COV 2;  1W2A X;  1RUJ 1;  4Y26 A;  2ZBJ A;  1MAC A;  4NPR A;  3E5Q A;  4CCC A;  3ZFG A;  1HRV 2;  5FLI A;  2IVI B;  3CJI B;  3MFC A;  3T2Q A;  4UYB A;  4X6Q B;  2A3Y A;  1M4W A;  4OYU A;  2A71 A;  5H9P A;  4XAE A;  4CVU A;  4GB3 2;  3ZN4 A;  5L73 A;  4FT8 A;  4DIN B;  2W3J A;  4L11 A;  3LFM A;  2D43 A;  5EJZ B;  1RUN A;  1LCL A;  1GZC A;  4M4R A;  5FMD A;  4S2D A;  4XQ4 A;  1JOP A;  1YJK A;  4Y4R A;  5C71 A;  1JUI A;  4JGZ B;  3WW3 A;  1ULG A;  1ZRC A;  2VH9 A;  2VUL A;  2X53 S;  5FYS A;  3O1U A;  4CCK A;  1RUG 1;  3BAL A;  5F2W A;  3VBS C;  1XNA A;  3T4V A;  4LKF A;  5LBE A;  5DAX A;  3IN9 A;  2GME A;  3O7O A;  4YVW C;  5FUI A;  3RPQ A;  4HOO A;  2XML A;  2BGP A;  4O9G A;  4W65 A;  5FZ1 A;  3I2F A;  3H8X A;  1X8E A;  1N1S A;  1QJU 1;  4Q5O A;  2ENR A;  4QQ2 A;  3EO6 A;  3GBG A;  5HI0 A;  4CRQ A;  1MEC 3;  2CL2 A;  5A6Z A;  3NNF A;  2BFU S;  3B9I A;  5F3C A;  1O4Y A;  4Q27 A;  1PVC 2;  1STM A;  2G9Z A;  4M3C B;  3KV9 A;  5I91 A;  3AMM A;  5EYX A;  4CP2 A;  1QQP 1;  2E6V A;  2JIC A;  2PMW B;  1OQD A;  1GMM A;  2GZW A;  3FJS A;  1RIT A;  2FDK A;  4FTB A;  2ZGP A;  3WP5 A;  4N7I A;  3OY8 B;  1AL2 3;  1ULC A;  3C2U A;  1V00 A;  2GMM A;  4XBL A;  4MO3 M;  5LK5 A;  1EUT A;  2A73 B;  1UZW A;  4ARX A;  3FX3 A;  4CCE A;  1PX4 A;  1JYC A;  1PMI A;  1V6J A;  2PAM A;  3BOW A;  2WFF 2;  1D2Q A;  2R06 3;  1HV1 A;  1TMF 1;  5LA1 A;  4IEP A;  1AYN 3;  4P9G A;  1BMV 2;  2QQM A;  4B29 A;  2W5F A;  4K40 A;  3WDT A;  4XF1 A;  2JX9 A;  1CAX B;  3PUH A;  3VDB A;  4ZS2 A;  4RQP B;  4YM2 A;  4LR4 A;  4K1Z A;  4G4F A;  2VOT A;  4MGI E;  3OF1 A;  1MQT A;  5F5A A;  5DZG A;  3TOJ A;  3W58 A;  4A7K A;  1HB2 A;  3K51 A;  4KL1 A;  5F8P A;  4IEU A;  3IDA A;  3OB8 A;  3DEM A;  4ZU5 A;  4AHZ A;  1BJQ A;  3VBO C;  1CZV A;  1RUD 1;  2LRP A;  4H2A A;  4P9Y A;  5FZM A;  1DQ2 A;  5I8T A;  2QDR A;  1N47 A;  1O8S A;  3ZYG A;  3G6J B;  4UW5 A;  4AG4 A;  2ARC A;  5BNN A;  4YW6 A;  3WNL A;  4AED C;  4MAD A;  4BHP A;  3O1S A;  4MH0 E;  1V70 A;  3NJY A;  4SLI A;  1Z0H A;  2RS5 3;  3ACI A;  5HCF A;  2ZMK A;  4E8D A;  2EA7 A;  3ACL A;  1DYP A;  4OUS A;  2VVD A;  1NY7 1;  1D0H A;  2RS3 1;  1BVP 1;  1JOD A;  4YFZ A;  2RJ2 A;  2VBD A;  5C5U A;  5GZF A;  1OLR A;  1UU6 A;  4OCT A;  2DF7 A;  2QKD A;  4QPI B;  3WR0 A;  3ZYB A;  5A70 A;  2HEV F;  4QX8 A;  4CCN A;  1W28 A;  4N9I A;  3UKT A;  2IFW A;  1ASJ 1;  1QJY 3;  2OVU A;  1HN0 A;  4W4Z A;  3IM0 A;  4QHB A;  5C33 A;  4CUA A;  1GU3 A;  4NID A;  1GFF 2;  4LT5 A;  2IUW A;  4MGS A;  1JHJ A;  3LFI A;  2PHU A;  4H14 A;  1SPP A;  5FBZ A;  2YHJ A;  4LHS A;  5H9S A;  1R09 1;  2I2S A;  2G19 A;  3GJB A;  2ZPX A;  2PAE A;  4OMC A;  2WNU B;  2ZX0 A;  1WW4 A;  4RD7 A;  3WDV A;  5I0U A;  5FFO C;  1C4R A;  3VBR C;  4QPG C;  3ACF A;  1K42 A;  4MGQ A;  1PO2 1;  2ZHL A;  2XR4 A;  5DAP A;  4LA2 A;  2GSY A;  5A7W B;  2ZHN A;  2ZGT A;  3AB0 A;  2ZGL A;  3OJB A;  4EWE A;  4CEW A;  4P02 B;  1FPN 3;  3MIF A;  4LUL A;  1O3T A;  2BRT A;  2XB6 C;  4UAP A;  1BEV 2;  2X5I A;  5FP4 A;  1W9S A;  4YYO A;  1YFY A;  1DP0 A;  4QX0 A;  5FPB A;  4AHY A;  1NCR A;  3WIN E;  1HN1 A;  5ANQ A;  5KC5 A;  4CDX A;  1RUJ 3;  2CU5 A;  4NWW A;  2VBP A;  3WUD A;  3FLT A;  1XND A;  4XUT A;  4F83 A;  5CG8 A;  1OXC A;  3R05 A;  4Y1V A;  1ENX A;  2JWP A;  3KHC A;  1Y7B A;  1SZB A;  2RJK A;  3DF0 A;  4I3G A;  4PI2 A;  1PGW 1;  4W6W A;  1CQ9 A;  4IE0 A;  1UZZ A;  2HWE 3;  1EAH 3;  4QXC A;  2YGM A;  2I07 B;  1W05 A;  3MI8 A;  3P5B A;  4ZXE A;  4AF9 A;  3GCW A;  4AI8 A;  1UYZ A;  4FFH A;  2JDU A;  1LES A;  4TLF A;  4NRP A;  3UJO A;  1ND3 A;  1UOJ A;  4U36 A;  4AEM A;  5C70 A;  4FTS A;  4P5H A;  5LBC A;  4QXK A;  2MEV 3;  2ZAC A;  4QPY A;  5ISL A;  2AGS A;  1U0A A;  4W6X A;  3SKV A;  1DGL A;  2DVF A;  1LHO A;  3O1T A;  4GKX A;  5A3T A;  3N9O A;  1RUG 2;  1H2L A;  4XUR A;  5DDJ 3;  3QOP A;  3ZYH A;  1CAV B;  3WCS A;  2RDS A;  3LDB A;  4UW3 A;  3DKW A;  4N43 B;  4YWA A;  1WMD A;  3VKN A;  1VBE 3;  2A6Z A;  2XQR A;  2WLP A;  1DYO A;  4HLT A;  2WAO A;  5FTT C;  1POV 0;  2ZJC A;  1QJU 2;  3ZSJ A;  3HNB M;  2HBU A;  1PVX A;  3PUQ A;  3NV3 A;  5FZD A;  1UCX A;  4AI3 A;  2Y34 A;  1HRI 3;  4DY5 A;  1OT5 A;  4EN9 B;  3PIJ A;  1QHD A;  4F8A A;  2Y6J A;  4PLN A;  3N7J A;  1U12 A;  2BNO A;  2K2S A;  1VRB A;  4Y22 B;  1QQP 2;  3HN1 A;  3PNA A;  1LHN A;  4IER A;  4LJH A;  4BQ5 A;  5J37 A;  2J42 A;  3ZFE C;  4Z92 B;  4B1M A;  1FOD 3;  1IS4 A;  4P08 A;  3BIE A;  2FD8 A;  2A6W A;  5I8S A;  3PL0 A;  4CEY A;  2P3I A;  4GUL A;  4JTO A;  4OVE A;  4WM7 A;  2PHX A;  4E27 A;  3J7H A;  1RUE 3;  4DRV A;  1Y4W A;  3Q8A A;  1AXK A;  3J7L A;  4P9I A;  2V4A A;  4QGN A;  3O1M A;  1J1L A;  1W3V A;  2HWB 1;  4IV3 C;  1TMF 2;  4JHZ A;  2E53 A;  1N1Y A;  4XUN A;  4EN0 A;  3RYP A;  1UU5 A;  4UXA A;  1QJZ A;  3T2P A;  4QX3 A;  4IE6 A;  2WYF A;  4DOU A;  3BU7 A;  4OHZ A;  2D5H A;  1UIJ A;  1W8Z A;  2XKO A;  1XXN A;  4XIL A;  1MZ5 A;  4EYU A;  3VGI A;  3SEP A;  1X8M A;  5FZA A;  3PUR A;  4KMQ A;  5FQ0 A;  5FR3 A;  1D4M 3;  1VBD 3;  2GH2 A;  1RUD 2;  2W1W A;  2W95 A;  4GWN A;  3AP7 A;  1WCS A;  4QKD A;  1N1T A;  2EIC A;  2WNO A;  2LAL A;  2H0B A;  3GZU C;  4YLZ A;  2XWJ B;  1O4T A;  3TEW A;  4C90 A;  5IWF A;  5KHG A;  1DCS A;  1K5M C;  1NY7 2;  2VQU A;  2RS3 2;  3FLP A;  1I9R A;  4RHV 3;  2DWR A;  2VNO A;  3K4D A;  1CAW A;  3KCY A;  4RSU A;  2WS9 3;  5FY9 A;  4ZPI A;  4L0P A;  3N7L A;  1OBN A;  3M3O A;  1ASJ 2;  4HVQ A;  4CP9 A;  3UGH A;  5FO9 B;  4RN5 A;  2A7A A;  2UWC A;  1DBN A;  1DLL A;  2VCM A;  2WC2 A;  1CPN A;  3FBY A;  1I5Z A;  3KF3 A;  3KVA A;  2V4V A;  4MXW B;  2HKX A;  4URT A;  3P1I A;  5GLT A;  2QQV A;  3AC0 A;  3VBF C;  4KWK A;  4RGK A;  3WUC A;  2GAL A;  4K8R B;  1R09 2;  4WZC A;  1FT9 A;  1ZZC A;  1LOF C;  3MZH A;  4CDW C;  5I0R A;  4M3C F;  5C3P A;  3VBH B;  3MW2 A;  4NRO A;  4G9S B;  2GP3 A;  3IT8 A;  1UOB A;  3N7K A;  4NRM A;  3U4S A;  1MPX A;  2YZ4 A;  3TNQ A;  1ZRI A;  1PO2 2;  2JG9 B;  2WO1 A;  2YUE A;  4IXL A;  4LHK A;  4V2V A;  3WDW A;  3ZFG B;  4IV1 C;  2P3Y A;  4NUB A;  3ZXJ A;  1S0E A;  3DYO A;  4A3X A;  4AE2 A;  3ZXG A;  2JG8 C;  3HD8 B;  3ZDS A;  3WVJ A;  2ZGU A;  1BYH A;  3WNM A;  1F31 A;  3MLL A;  4P00 B;  1ZZ7 A;  3JD7 1;  5CZK A;  4AL9 A;  1GYK A;  1C3H A;  5CFD C;  5FRA A;  4CDU B;  1WWY A;  3ZXA C;  4FOY A;  2VUJ A;  5D8A A;  1PGW 2;  4PBP A;  5C6C A;  5I0S A;  4GJY A;  4O65 A;  1AX0 A;  3K48 A;  3QAC A;  5K0U B;  1JS9 A;  2VMH A;  4FI9 A;  2VGD A;  4Q4Y 2;  4FAG A;  1JHN A;  1H8T A;  5LEJ A;  2QCS B;  4OHW A;  2ZGO A;  1RC6 A;  1WW7 A;  4XJU A;  1SLT A;  5FJH A;  1HQN A;  2Z5W A;  2JJ6 A;  3AL6 A;  2JB4 A;  3LQC A;  4IEW A;  2CWS A;  2XVL A;  5IFP A;  5KWR A;  4BA6 A;  1NQD A;  3UNP A;  1YQ2 A;  3LOI A;  4I30 A;  4JVA A;  4UFJ A;  4XMI A;  4YGD A;  2EXI A;  2OXB A;  1AF9 A;  3NJV A;  4XF0 A;  3BTY A;  3RWN A;  4CDQ C;  4LO6 B;  1V6N A;  4HON A;  2XQX A;  1NLQ A;  1XU1 A;  2FDG A;  1RGS A;  1O3R A;  1YIF A;  3UYJ A;  2VZP A;  2V72 A;  3N9P A;  5CIS A;  1ZVF A;  2ZGR A;  5F6L B;  1OVS A;  1XPW A;  2YGL A;  2FHR A;  1Y9G A;  1V6O A;  1LB2 A;  2IWG B;  1DGR N;  2O14 A;  3KM5 A;  1RMU 1;  1REF A;  2W9X A;  5A3M A;  1DF0 A;  1IPK A;  4KBB A;  4AQ2 A;  3O1R A;  2HWC 3;  4KH9 A;  1HKD A;  1OQ1 A;  2IFR A;  4CCO A;  3JBG 3;  1CX4 A;  1WMX A;  2E51 A;  1MQT B;  2B9V A;  2VBB A;  5D1I A;  1C5H A;  2RM2 2;  2EAA A;  2UYA A;  4PIZ A;  2BQP A;  2HWB 3;  3ZFF B;  1JZ3 A;  4JDO A;  5A3N A;  3OBT A;  1E5I A;  2QTW B;  1BKZ A;  1YQ8 A;  5JMO A;  4ZON A;  2ET1 A;  3KD4 A;  5FK7 A;  1PM4 A;  2VZO A;  1WCU A;  2P34 A;  3PUS A;  2VNG A;  3MYX A;  3X29 B;  3C8X A;  2BPA 2;  4LQR A;  4JGZ A;  1OKQ A;  2LTN A;  3ZSL A;  3P3N A;  3OBA A;  2JDN A;  3W21 A;  2WR9 A;  5D21 A;  2VUA A;  5FO8 B;  1DQ5 A;  2AZ5 A;  4XIK A;  3ACG A;  3T1L A;  4HN1 A;  4AVV A;  1KEX A;  3SLI A;  5FZ0 A;  3HVD A;  3TBD A;  1RIN A;  2Q1Z B;  3H0O A;  1LU1 A;  1UPI A;  5FYM A;  3I3D A;  5C4W C;  3FN9 A;  4LIV A;  1QXJ A;  4L97 A;  3F2Z A;  4UF0 B;  4Q0P A;  4AVA A;  1O4Z A;  1PNF A;  1B35 A;  3NNM A;  2CSG A;  2BNN A;  1C5I A;  1WME A;  2VW0 A;  3DKQ A;  3K46 A;  4Q4V 1;  2MPF A;  2WNE A;  1L3J A;  1OF4 A;  5D2A A;  4XQD A;  2WJS A;  2WQ4 A;  3FZ3 A;  2HLE A;  1CD3 G;  4JC1 A;  4P9X A;  4AWD A;  3B93 A;  1JZ6 A;  3AMQ A;  4BLJ A;  2JDH A;  1AR6 3;  2R16 A;  5LA0 A;  1ZBA 1;  3AZZ A;  5JIU A;  2XON A;  4ATE A;  3MLK A;  2YRO A;  4C91 A;  5A3L A;  3H8O A;  5T5J A;  3ZXD A;  5CAD A;  1IQD C;  1DFQ A;  2C5D A;  1NE6 A;  3MGU A;  4HSJ A;  5JI7 A;  4CEW B;  1TNR A;  4FP3 A;  5FMC A;  3KLS A;  2RMU 3;  1QDO A;  1CAX A;  2MHF A;  5FK8 A;  2JB8 A;  5DG1 A;  2GC3 A;  3U11 A;  2JIG A;  4X8P A;  2WWS A;  1JZ4 A;  3I59 B;  5LA9 A;  1BZW A;  1D2S A;  3WDU A;  1ULE A;  2AAC A;  3U4X A;  1IGO A;  1KRI A;  5FZH A;  2LW8 A;  5E16 A;  1ZBE 3;  3ILF A;  2P6H A;  4YG3 A;  1PIV 1;  1ENS A;  2FCT A;  4NAO A;  5CNA A;  1LOC A;  3R6S A;  3SMH A;  5C3Q A;  1UD1 A;  3JD7 2;  5HCB A;  1NA1 C;  2C26 A;  5FXZ A;  1Q8O A;  3O1O A;  1ND3 B;  2BVV A;  4NII A;  2SLI A;  3WQ7 A;  2EF6 A;  4HKL A;  1QJX 1;  3I49 A;  1E5R A;  5LBB A;  1H4H A;  4XHB A;  1CN1 A;  1NE4 A;  2VTX A;  1LNS A;  3SIT A;  2FCU A;  1RHI 3;  1W2U A;  2XL7 A;  2ZEX A;  2C6S A;  3OGV A;  4PDW A;  1S55 A;  3ZLI A;  4ET7 A;  1O8P A;  3ETQ A;  4NPL A;  3U1X A;  2YDE A;  4XJZ A;  5LB6 A;  4ZU7 A;  3POY A;  3KF5 A;  4ISR A;  1CAU B;  1UOF A;  4PF5 A;  3FL7 A;  1RUC 3;  4YW5 A;  1R1A 1;  2XKP A;  1UYY A;  2DFB A;  3NAP B;  4LBO A;  2C24 A;  4S2H A;  3TAY A;  4ASM B;  1R08 3;  1OUX A;  1SLB A;  1F5F A;  4NWV A;  4Y24 A;  4ZU4 A;  5FYU A;  1OA4 A;  2KXL A;  5KHH A;  3I3B A;  4KWJ A;  3PJY A;  3S57 A;  2PN5 A;  2WNU A;  3S0M A;  4KI5 M;  2R07 3;  1S2E A;  4LHN A;  4RGA A;  1ALY A;  3AMN A;  4WV8 A;  1WCK A;  1WMF A;  2XUE A;  3CZU A;  4OHX A;  3M8L A;  5IVJ A;  3GNE A;  1MS4 A;  5A32 A;  1D4V B;  4WM7 B;  2LUW A;  3A0K A;  3SNM A;  3ENR A;  1KFX L;  4L2N A;  4IL7 A;  4NHM A;  2P3J A;  4WM8 C;  2G9G A;  5FZL A;  5FOJ B;  5T55 A;  1AYM 1;  4I3P A;  2F4L A;  1RMU 2;  1W8N A;  5FZC A;  1ULO A;  2Q4S A;  1FYU A;  3MIG A;  1CVN A;  3GHM A;  3ORJ A;  2ZAB A;  2QQJ A;  3K4Z A;  1YI7 A;  1UYP A;  3VV1 A;  5FKB A;  2R04 3;  1RUF 1;  1JI6 A;  1ZA4 A;  5ACA 3;  3FC0 A;  1HB3 A;  4Q4X 1;  3OPZ A;  1WGP A;  5JPM B;  2B7Y A;  5KXD A;  1X9P A;  1PK6 B;  2ZGN A;  2OUJ A;  3BTX A;  3CU7 A;  4D3W A;  2I74 A;  4OHV A;  1AR9 3;  5GLV A;  1U5I A;  1GNY A;  2Z2S B;  1IPJ A;  1HW5 A;  1LHU A;  1CAV A;  2WWU A;  5AC9 1;  4N43 A;  2ID4 A;  2B45 X;  2WT2 A;  5JDB A;  4QQP A;  5IK7 A;  2GNB A;  4HT1 T;  1CAW B;  3ETP A;  3ILN A;  3WY6 A;  4YG0 A;  1UAI A;  3L9J T;  3NV2 A;  5FP3 A;  1JZ7 A;  5IK8 A;  4FPG A;  4IND A;  4Y33 A;  2VPV A;  5FYI A;  1SFN A;  3RZL A;  1JUH A;  3ZXL A;  4AR2 A;  4PJY A;  3ZYP A;  1UWW A;  4Q4V 2;  1W90 A;  3ASI A;  1H6X A;  4DEV A;  4Y22 A;  5BNN C;  2SBA A;  5CG9 A;  3KCC A;  3PHM A;  5HV0 A;  1GZW B;  2LM3 A;  4FQZ A;  4NO4 A;  2P3K A;  5I0D A;  4FFG A;  1LEN A;  5A7S A;  4XUP A;  3RJR A;  1ZBA 2;  2XOM A;  1NAE A;  2NMN A;  2EIB A;  2W68 A;  2VO5 A;  1XE8 A;  2XJQ A;  4AOC A;  4Q8K A;  4IUG A;  5A3U A;  2JE7 A;  5A6Y A;  4C8D A;  1SQ4 A;  1O5L A;  1SAC A;  4FPF A;  4FPH A;  4B7K A;  1YYN A;  1L7L A;  2DTY A;  2OW4 A;  2VMD A;  2YBS A;  2J22 A;  3B7M A;  4NHK A;  1JZ2 A;  1EV1 1;  2VNR A;  3CO2 A;  2VTF A;  5KXB A;  2UYB A;  2XXZ A;  5KHJ A;  3DXU A;  5E1R A;  5HV4 A;  4XDQ A;  3PVE A;  4Z2W A;  1CZT A;  1QIQ A;  2A6Y A;  2VMI A;  1O3Q A;  1OI6 A;  2YB7 A;  1WD3 A;  4TXW A;  4COZ A;  3OD4 A;  1VB4 A;  1YIP A;  4D94 A;  5CBL A;  3AYA A;  1WCD J;  4H7M A;  3DYM A;  4M01 A;  5IFT A;  5JOZ A;  2WWJ A;  1PIV 2;  2WQ8 A;  3C7H A;  1MR5 A;  3OPT A;  5EJ1 B;  4GAZ A;  4L8Q A;  3WT3 A;  4DXZ A;  5KBF A;  3O1V A;  2BER A;  5JZG C;  4QXH A;  1RIR A;  5CA6 A;  3AL5 A;  3DV8 A;  2RR1 3;  2Q8O A;  4NIA A;  1WBL A;  1XB9 A;  2OX0 A;  2PHD A;  2ZX1 A;  5CFC B;  3HT2 A;  4Y1U A;  2X5I C;  5IK5 A;  1VBC 1;  1QJX 2;  2BGO A;  1SLI A;  4BQY A;  5FY1 A;  3PIG A;  4LHL A;  1ZRD A;  1EPW A;  2VOV A;  4UOJ A;  1HXS 3;  3DL3 A;  3JQX A;  1N3O A;  5DUU A;  2TEP A;  5EFU A;  5EHD A;  1RVF 3;  2KM2 A;  4BCU A;  4D6Q A;  3ES4 A;  5LA2 A;  3FFZ A;  5GZD A;  1OH4 A;  2NM1 A;  2AEY A;  1GQH A;  4KG8 A;  4D69 A;  5E89 A;  2HWF 2;  3S7I A;  3AFK A;  1VJ2 A;  4Q0S A;  4QQH A;  4I2O A;  4XC9 A;  3VBU A;  4CA9 A;  2E63 A;  4UFL A;  2ZHM A;  1R1A 2;  2D6N A;  4QX1 A;  4Z8B A;  4AK3 A;  2J1U A;  5DXD A;  1J84 A;  2VAU A;  2XVK A;  3MIC A;  2GC1 A;  1C57 A;  3TWI A;  5A3W A;  4Q26 A;  4FOQ A;  2VZ1 A;  1RJ7 A;  2PLV 1;  1VBB 1;  1LGB A;  3VBH A;  1VP6 A;  4HMZ A;  4QD2 A;  2QUO A;  2V5D A;  1VAL A;  1REE A;  2JG9 A;  1COV 3;  2EIE A;  3V0B B;  3PME A;  2TBV A;  1FI2 A;  3N9N A;  1HRV 3;  4ORF A;  4YW4 A;  2VW2 A;  5J1X A;  5HXV A;  3VD9 A;  4PHZ A;  2WZE A;  3BPS A;  5F5I A;  3K77 A;  1AYM 2;  1SLA A;  1HDK A;  2ZEW A;  3AZV A;  4GB3 3;  5GJ6 A;  4H3W A;  4PT6 A;  5GAL A;  2GAU A;  2ATF A;  3EB7 A;  1BBT 1;  5LRR A;  1UY0 A;  4EN6 B;  4P9W A;  2R7E B;  2QQU A;  4CU6 A;  4HVO A;  3NQH A;  5JSO A;  2PAK A;  4FAH A;  4CDU A;  5FZI A;  4CYD A;  2XH6 A;  2JDA A;  1FMD 1;  4J25 A;  2YXS A;  1RUF 2;  4CU9 A;  1WCQ A;  2WRA A;  4NIG A;  1JU3 A;  1NQJ A;  1TG7 A;  3AVS A;  5T5O A;  4Q4X 2;  1HLC A;  2TNF A;  2W52 A;  5K0U A;  1BLZ A;  1XBF A;  5JSP A;  4PIY A;  5JAX A;  4MZU A;  2P1B A;  3T2T A;  2O1Q A;  1QGL A;  3KZ4 C;  2X09 A;  2Z69 A;  2RE9 A;  3WW1 A;  3K2O A;  5FZ8 A;  4OQ9 A;  3WG1 A;  1SCR A;  2YC0 A;  3HEI A;  3I2G A;  1LGN A;  4P5Y A;  3KVB A;  4NN0 A;  4BM8 A;  4Z07 A;  1DG6 A;  1B35 B;  4XJA A;  5AC9 2;  1PVC 3;  1V6K A;  2W2I A;  2K9Z A;  3ILR A;  5C3S A;  4Z1V A;  2HYX A;  1GIC A;  4Y1Y A;  4MOA A;  2BDR A;  3SH4 A;  2B46 X;  3KB5 A;  1JYT A;  4QU1 A;  2W46 A;  3WNN A;  1VPH A;  1JYX A;  4LEJ A;  1HB4 A;  1Y9M A;  4LOT A;  3Q8C A;  1GZT A;  4LKD A;  4QB1 A;  4R9A A;  1RL3 A;  2A6V A;  3NWK A;  2WO2 A;  1LJ7 A;  1C28 A;  1UKR A;  1Z7S 1;  2WFF 3;  1NLS A;  3QCW A;  1J3Q A;  2AH2 A;  3H3L A;  4XCA A;  1OLM A;  3MFA A;  3M1H A;  3OGJ A;  4O7X A;  1KGY A;  5F3I A;  2AEN A;  4BMB A;  1OHF A;  1OVP A;  1GOG A;  1GOH A;  2D3R A;  5L9B A;  3GBF A;  2EXH A;  1K45 A;  2XJR A;  5KXE A;  2YC4 A;  3ZFF A;  4YRD A;  1BXH A;  4Q1R A;  2B5H A;  5C3O A;  1EV1 2;  1UMZ A;  3RZG A;  3WD5 A;  1DGW X;  2WT1 A;  3I2H A;  1UY4 A;  2Y26 A;  4G3Y C;  3MW4 A;  3ZR5 A;  2RV9 A;  4DIQ A;  2D97 A;  3IPV B;  2DBN A;  4XJ8 A;  2VVE A;  3U14 A;  2QZ3 A;  1Z78 A;  4EZ4 A;  5BNO C;  1TVG A;  2XWB B;  1ODM A;  2JDY A;  2YBK A;  2R49 A;  4XF3 A;  1LUL A;  2BU9 A;  4YM1 A;  3KMH A;  5T54 A;  3N35 A;  3LIH A;  4CP1 A;  3O1P A;  3KHB A;  1W6M B;  3THT A;  3WNX A;  2F17 A;  1YI9 A;  1AX1 A;  4GJZ A;  1YWK A;  5L9R A;  5DUV A;  4SBV A;  3CNA A;  4PDW B;  1G7Y A;  1JXN A;  3UET A;  2VMG A;  4UF0 A;  1PO1 1;  2OQ6 A;  1KIT A;  2BWA A;  3OOX A;  4OI4 A;  4I09 A;  1VBC 2;  1DLC A;  3ACH A;  4LO8 A;  3KT7 A;  4RYD A;  2EIG A;  3HT1 A;  5IYY A;  3ELN A;  3W5N A;  3D3A A;  3RJ2 X;  1KJL A;  1T2X A;  3AXD A;  2YU1 A;  3VHO A;  2ZAH A;  2RDQ A;  2VZ3 A;  4PI0 A;  4JX0 A;  1NCQ B;  1WW5 A;  2D6K A;  2PXJ A;  4HG6 B;  5D8A C;  5JR2 A;  3AYE A;  1OA3 A;  5IVB A;  1W9W A;  3AFG A;  3RSJ A;  3USU B;  2ARX A;  4XJ9 A;  5FP9 A;  4IGQ A;  3J8F 1;  1UOG A;  5CKQ A;  1A78 A;  1H8T C;  2V73 A;  4JZR A;  2BGC A;  4IV1 B;  1JYV A;  4Z82 A;  5A32 B;  2XJS A;  4CCD A;  5J7M A;  4Y1Z A;  2ZML A;  2C9A A;  4ZHN A;  3J4U H;  1H8V A;  1YQ6 A;  2JKX A;  2JDZ A;  3VDD C;  4LBJ A;  2PLV 2;  2OQ7 A;  1JBC A;  1VBB 2;  2YFU A;  3CIH A;  3VB9 A;  1UZY A;  5FYC A;  3CHX A;  1ZX5 A;  1BEV 3;  4CCM A;  4K9S A;  4J1X A;  1Y9Q A;  4I01 A;  3I59 A;  2VG9 A;  5SV8 A;  3UKN A;  1UMI A;  4LBQ B;  4AQT A;  1W2T A;  4B4R A;  5CU1 A;  1EP0 A;  1OOP C;  3ALQ A;  1VB2 A;  2X29 A;  3INA A;  1X50 A;  1SMV A;  2PHL A;  2JEC A;  4OLL A;  1VMH A;  1O3S A;  4ERO A;  1W99 A;  2D7F A;  4LPL A;  1CWP A;  3Q9O A;  3NNL A;  1BBT 2;  5A1L A;  3DPR C;  1OUR A;  2Y0O A;  4FOW A;  4Q4Y 1;  3C7G A;  2ZMN A;  2FQP A;  4HFS A;  5JXJ A;  4RGG A;  4F7Z A;  3QH6 A;  1AHS A;  3HPN A;  2WBK A;  1POV 1;  1FMD 2;  4LKE A;  1G86 A;  2CDO A;  4IEO A;  4WBB A;  3VN4 A;  4AEJ A;  1H9P A;  1XE0 A;  2BUK A;  3LPF A;  4QU2 A;  4PCR A;  1DIW A;  5FXW A;  3WX5 A;  4C1W A;  4IEX A;  3CJI C;  1GP6 A;  4N53 C;  4HK8 A;  2CY6 A;  1RUG 3;  3POW A;  2WZ8 A;  4WVW A;  3V56 A;  2B42 B;  2WAB A;  3DXT A;  3KV4 A;  4MV2 A;  3TRS B;  1DZR A;  4GH4 C;  1CAU A;  4XVH A;  4PQQ A;  2H6B A;  5L7O A;  3NAP A;  1QJU 3;  2XBO 1;  2XHK A;  3R4S A;  1UO9 A;  4Q8L A;  2VCB A;  2D3P A;  3U75 A;  5FDB A;  4IES A;  4JGZ C;  1M06 G;  1SFP A;  2VZS A;  3DCQ A;  1Q8Q A;  3VZL A;  2FZ2 A;  5K9Y A;  3CEW A;  1V6M A;  4YW7 A;  5DMY A;  1QQP 3;  2D98 A;  4NRQ A;  2XG3 A;  1U5X A;  2QJV A;  3F95 A;  1C8M 1;  2NMO A;  1R64 A;  4FCA A;  2DVG A;  3BUC A;  2ORX A;  4KG0 A;  5FBJ A;  1QOO A;  5FZ3 A;  1AR7 1;  1ENR A;  1QJF A;  1SDW A;  4L99 A;  3SH3 A;  3LWC A;  1YFW A;  3LD8 A;  1W9Y A;  1UY3 A;  2RM2 1;  3T0B A;  1Z7S 2;  4D0Q A;  1G6N A;  1XYN A;  1TMF 3;  5T5P A;  4GIQ A;  4LKS A;  1F35 A;  1RB8 G;  4JRA A;  4GXL A;  1H9W A;  2PHF A;  1MZF A;  2ARB A;  1GP5 A;  5M0T A;  3AK0 A;  1UIK A;  2Z4F A;  3OUH A;  2CAV A;  1UY1 A;  2IXI A;  3NL1 A;  3OBZ A;  1O91 A;  4U2A A;  4BME A;  3MHZ A;  1KS4 A;  3SCH A;  3TN9 2;  2BZD A;  2WSV A;  1PK6 A;  1RUD 3;  4XW3 A;  4XOG A;  3LDR A;  3M7A A;  1DGW A;  1MVE A;  1V9U 1;  1YHF A;  2K46 A;  1ZRR A;  5FZG A;  2IXK A;  3SCF A;  3OGR A;  4IEV A;  5EPA A;  2X8K A;  1OPO A;  1QJE A;  2O8O A;  4RQP C;  3AP9 A;  1I5P A;  5A7Q A;  4HVR A;  5FY7 A;  2RS3 3;  4EQV A;  2F6B A;  4ZS3 A;  4A2U A;  1TEI A;  1DDL A;  1GP4 A;  1DHK B;  1GV9 A;  4Q0U A;  4JV4 A;  4R9C A;  5BPX A;  4QB6 A;  1PO1 2;  3I3Q A;  5HBA A;  2ILM A;  4Y3O A;  3ZXF A;  1ASJ 3;  1JZ8 A;  3VD4 A;  3THP A;  3VBU B;  2UY8 A;  2G9F A;  3WNO A;  2DVA A;  1V6L A;  4NMI A;  2RS1 1;  5K7P A;  4D7T A;  1GZW A;  2WNV C;  3I2J A;  4S2F A;  2DTW A;  1V6I A;  2ZZJ A;  5EXO A;  5ABJ C;  1VMJ A;  2GH8 A;  4OQ8 A;  3LOB A;  1R09 3;  2JD4 A;  5F5C A;  1DQ6 A;  1YFX A;  4PQ9 A;  1WLC A;  4QPI C;  1ACC A;  1S0G A;  4A6O A;  3ZPO A;  1CR7 A;  3GBW A;  3AX4 A;  4QKF A;  4K6B A;  3J8F 2;  1PO2 3;  3VUO A;  1SBE A;  4B4P A;  3NVC A;  1S0B A;  1TE1 B;  4MXV A;  1IHM A;  4XXA A;  3I4I A;  1AUY A;  2FBE A;  2DCZ A;  3SIS A;  4LBL A;  2OA2 A;  4OI0 A;  4ISQ A;  2ORZ A;  5CB7 A;  3AKS A;  2OYZ A;  3LSE A;  4LLO A;  3A23 A;  3POI A;  2CV6 A;  1C8N A;  3J7N A;  1O5U A;  2WNU C;  4R9D A;  4ARY A;  5FPV A;  4LUK A;  4UI9 L;  5JMC A;  3LA2 A;  4B4Q A;  1JN2 P;  5HPO A;  5EIY B;  4I0W B;  1RJ8 A;  1W6N B;  4JAA A;  4LTA A;  2C0Z A;  2B4K A;  4XUQ A;  2DVD A;  3IIA A;  4NR1 A;  2GP5 A;  5FMO L;  3NV1 A;  2J1T A;  2KR2 A;  4KQ7 A;  5C8C C;  1KFU L;  5CFC A;  3N9L A;  4Q4Y 3;  1XNT A;  3RDI A;  1OLQ A;  2VC9 A;  3MEP A;  3GYD A;  5J36 A;  2E7T A;  2XVG A;  3JQW A;  4JKK A;  4MGT A;  3RYK A;  3CF6 E;  3Q8F A;  3I2D A;  1LRH A;  3I3E A;  4AZZ A;  1KS5 A;  2QQW A;  1GUI A;  2CTV A;  2ZGQ A;  5KC6 A;  1I6X A;  3A7Q A;  1UU4 A;  3JB8 A;  1W03 A;  2XPJ A;  1HQW A;  3POF A;  2CAU A;  3ZDV A;  3D0J A;  4MUV A;  4EN7 B;  2VUC A;  2JXA A;  3SKJ E;  3OEB A;  2XBO 2;  4DNY A;  4E2S A;  3THC A;  1S0J A;  2BP6 A;  1FXZ A;  3ZYI B;  4BE3 A;  5JXI A;  4CPB A;  3PUI A;  5B4N A;  1QKQ A;  3V0A B;  4COY A;  3GF6 A;  2ETE A;  3LZZ A;  2PA7 A;  1AR8 2;  2ARE A;  3WHT A;  1QNY A;  3MID A;  1C8M 2;  3OSD A;  4R8H A;  2Q8D A;  2YY1 A;  3S6P A;  4N43 C;  3SXW A;  3V0B A;  1QF3 A;  1PMJ X;  2XHN A;  2WL1 A;  1WW6 A;  1AR7 2;  2DDU A;  3UGG A;  3WF0 A;  3DEC A;  3USS A;  4AVB A;  2QZ2 A;  4FTE A;  3E97 A;  2CGP A;  2RM2 3;  4AAX A;  5FZO A;  5IVE A;  2PTM A;  1A8D A;  2WZR 1;  3E1F 1;  3C7E A;  3VZO A;  1GQG A;  4AQS A;  1C1F A;  4XBN A;  3VDC A;  3O5S A;  2H0V A;  5GZC A;  2WII B;  1UN1 A;  5LK7 B;  1ST8 A;  2I45 A;  1VBA 1;  4BLI A;  2VOW A;  2ERF A;  2WAA A;  5KHI A;  3MV1 1;  1CON A;  1RUI 1;  3D0S A;  5FIX A;  4YZ2 A;  1QNW A;  1OC1 A;  2BWC A;  4QHO A;  3ZX7 A;  2VQT A;  3EXU A;  1KD7 A;  4LA3 A;  5AVA A;  1FV3 A;  3PVO A;  4Q4W 1;  1V9U 2;  1ND2 B;  4TYS A;  1GZ9 A;  3ECQ A;  3ZXE A;  5LEK A;  5JOY A;  3UK9 A;  3BB6 A;  3JCI A;  5C9A B;  4BB3 A;  4Q2F A;  3UES A;  4AHW A;  4D6S A;  3JZV A;  2OPK A;  3CMG A;  4BPZ A;  1P8J A;  2VQA A;  3H7J A;  2VM9 A;  3ZSE A;  1R1Z A;  2W1U A;  1NG0 A;  4GWI A;  4BWO A;  1X9T A;  4P9J A;  4Q29 A;  3OCP A;  5JSR A;  4A7Z A;  2FMD A;  4AFD A;  5EJ3 A;  2BOJ A;  3LF7 A;  3POS A;  3ZFE A;  4Y4Y A;  4DQA A;  5FZE A;  4MSV A;  4DPN A;  3SHR A;  5CEH A;  1UXZ A;  2L9L A;  3WNK A;  1YO8 A;  3WF4 A;  4AI0 A;  4MGY E;  4Q0V A;  1JU4 A;  2W1S A;  5EZW A;  3WNP A;  2DCK A;  4JKL A;  2BBA A;  3HQX A;  4C0H A;  3I2O A;  2A1X A;  3JXS A;  4OUE A;  3T0A A;  4AFA A;  1VE0 A;  3MPP G;  5FOB B;  2RS1 2;  3AMP A;  3FWE A;  4IV3 A;  3B5L B;  4E8C A;  4BQW A;  3A21 A;  4K7J A;  1O59 A;  2P2K A;  2D6O X;  4YVS B;  5B4X A;  1W8W A;  1OFS A;  2QQK A;  4UFI A;  3RRD A;  2FDJ A;  5FP7 A;  3T08 A;  5F39 A;  2P37 A;  4EWD A;  5DAQ A;  4JGY B;  1SDD B;  2Y8K A;  4FPJ A;  1LOB A;  1PMH X;  3MIB A;  1FAT A;  3MV0 1;  4QXB A;  4IEZ A;  2ZTN A;  4I0A A;  5F6K A;  5FPZ A;  4YGC A;  3IZO A;  3IPV A;  2ARA A;  4OZO A;  4DUX A;  2K0G A;  3NRU A;  3JD7 3;  4ONU A;  4XIO A;  3Q8B A;  1W8T A;  1Q8V A;  3VBH C;  1VRH 1;  5BNP C;  3H42 B;  2XLG A;  4RS5 B;  3ZPY A;  3OBR A;  5JLV A;  4IE5 A;  1MVQ A;  1W6M A;  3AYD A;  3B94 A;  3ZMO A;  4AAP A;  3TEY A;  2JDM A;  3ZFG C;  2W92 A;  3H8U A;  4AI1 A;  4JQR A;  2XJT A;  2BBV A;  2VEC A;  2HWF 1;  3WF1 A;  4CZS A;  3TEX A;  2JIJ A;  4DXT A;  4RR3 B;  3PVN A;  5JXH A;  4XET A;  2QNK A;  1WA4 A;  4HSL A;  4JDN A;  4BIO A;  4GMP 1;  4YZ1 A;  1PGL 1;  3POE A;  5L7O B;  4WZF A;  5FZF A;  1W0N A;  4LUM A;  1EY2 A;  4QQL A;  3VBF A;  4CDU C;  1S1A A;  2VXJ A;  2WSU A;  1TME 1;  2HWD 1;  1OSG A;  5GLU A;  1LOF A;  1NCQ A;  3VZN A;  4CDW A;  4NAM A;  1LHV A;  1RYY A;  3VD7 A;  2DV9 A;  4E4S A;  3U0Z A;  1YQC A;  2Y38 A;  5FPX A;  2E7A A;  1QDC A;  3GGL A;  5K8S A;  1F4H A;  3N3H A;  4XFG A;  5GZE A;  3USU A;  5K0U C;  4QX5 A;  1W8O A;  3A22 A;  3K75 B;  3M3E A;  4YW3 A;  1D0G A;  4IV1 A;  3VKF C;  4XTM A;  2P17 A;  5FZ7 A;  1HV0 A;  2NLR A;  1GLH A;  1RUH 1;  4QQO A;  2TUN A;  3P6B A;  4Y5T A;  5F7U A;  1VMF A;  2ZCW A;  1H2K A;  2JG8 A;  4LIU A;  1XU2 A;  3KQ4 B;  5FZ4 A;  4N8M A;  3WEZ A;  1W06 A;  5IT6 A;  4RL7 A;  4XEZ A;  2XDV A;  4LBQ A;  4Y1X A;  4CXW A;  1TQ5 A;  2NQY A;  1RMU 3;  4LE3 A;  1JOJ A;  4MLO A;  2Y6L A;  5CFD A;  5I8Y A;  2R1B A;  2VOK A;  1JMU B;  4QM9 A;  1VAK A;  1WUV A;  4CUB A;  5IAX A;  5JOW A;  4FSJ A;  1NOV A;  2AUY A;  1BVV A;  2BOI A;  3LCP A;  3NV4 A;  5IAV A;  3RGB A;  1FNY A;  4DB5 A;  4E2G A;  5ERL A;  5HCH A;  1F9K A;  4FPO B;  2YU2 A;  1YXW A;  1ONA A;  3VBS B;  2WLQ A;  3DUI A;  3T0D A;  1GWK A;  2WZR 2;  4HKW A;  4J1W A;  4YVW B;  3AKR A;  5IVC A;  1SFY A;  1NYW A;  4XF4 A;  2VCA A;  2NN8 A;  3U37 A;  1VBA 2;  2AR6 A;  2CWM A;  3NNG A;  2IVJ A;  3NJX A;  5IJR A;  2W91 A;  2ADD A;  2W94 A;  4YSF A;  1QWR A;  1RUI 2;  3AP4 A;  3NO8 A;  1SHW B;  4RFR B;  4UFM A;  3AKQ A;  3MIE A;  3VD5 A;  5C8W A;  1MQT C;  3ES1 A;  1T6B X;  2Y6K A;  1SLC A;  3MF9 A;  3CDZ B;  1VIW B;  3WP3 A;  4LE4 A;  1X82 A;  5BV6 A;  3EBR A;  1A6C A;  4Q4W 2;  3V65 A;  4CDQ A;  3KCX A;  3M2M A;  2QFE A;  4MET A;  4Y5S A;  3FMG A;  4HPK B;  2KA3 A;  4I0B A;  2W08 A;  4TLG A;  5DZE A;  1MEC 1;  2A70 A;  3MLJ A;  4Q4V 3;  1A3K A;  2UU8 A;  4JDM A;  3W5M A;  4NHL A;  3DGT A;  3B02 A;  5FYH A;  2W87 A;  2VR4 A;  5AVP A;  4ASK A;  3RZK A;  2WN2 A;  2VTX J;  2CHH A;  2JDK A;  2VNV A;  1ZBA 3;  3OUJ A;  2OZJ A;  4JKM A;  4UFH A;  2BW8 A;  3WF3 A;  3GAL A;  5A3P A;  1X7N A;  1UKG A;  4BQ1 A;  1AL2 1;  1QMJ A;  3RG0 A;  1YLL A;  2DUO A;  5EQU A;  1POQ A;  2YV8 A;  5I0T A;  3ZM8 A;  4BZ4 A;  2X05 A;  1Q3E A;  3H8R A;  2R06 1;  3Q8E A;  4P14 A;  1LEC A;  3A0N A;  5E8A A;  2Q1F A;  3VBO B;  1AYN 1;  4COU A;  4LO7 A;  4P9L A;  5FYZ A;  5BYN A;  4IGO A;  3RZM A;  4NPM A;  2EXJ A;  4TN7 A;  1FX5 A;  2BNM A;  3VZK A;  5EV7 A;  1XNB A;  4AED B;  4QAW A;  3H3Z A;  3WV6 A;  4AFC A;  4LMF A;  1S0D A;  1PZ9 A;  5LZ6 A;  2OS2 A;  1ZM1 A;  1CJD A;  1S2B A;  2VZR A;  5FYY A;  3U78 A;  4XFF A;  1SEF A;  1PIV 3;  5JVV A;  2DUQ A;  4YAR A;  3ZN5 A;  2N7G A;  4BK5 A;  4CEW C;  5FYB A;  3GJA A;  3VL9 A;  5F1R A;  4PF1 A;  3VL8 A;  4QMA A;  4CP0 A;  2WO7 A;  2W1Q A;  1J3R A;  1KJR A;  1VRH 2;  3O0W A;  5GLZ A;  2ADE A;  4H55 A;  3E5X A;  4ZZ5 A;  4A6S A;  1XNC A;  3GZA A;  1NCR C;  2LRO A;  5K4L A;  2E33 A;  2VXR A;  4XAA A;  1QJX 3;  1W04 A;  3ZN6 B;  4AGR A;  5E6H A;  4CDX C;  1IKP A;  5FWJ A;  1AJK A;  4TWT A;  2RS5 1;  2R6Q A;  1DQ0 A;  1W2N A;  2B9U A;  4FPL A;  5KXC A;  2YPD A;  3NKT A;  5GLW A;  3ZYJ B;  1CZS A;  1SLL A;  2HWF 3;  3GM8 A;  2Y0I A;  1PGL 2;  4IEQ A;  1N3P A;  2WO3 A;  3I2I A;  4ZZ8 A;  3ON7 A;  3VBR B;  1LU2 A;  4QPG B;  2R30 A;  3AZW A;  4GMP 3;  4V1P A;  1QJY 1;  1R1A 3;  5FMB A;  1J58 A;  1ND3 C;  1U5Z A;  3BN6 A;  3ZR6 A;  3R4D B;  2A5Z A;  3R0R A;  3MPB A;  5JI9 A;  4QDR A;  1TME 2;  2HWD 2;  4KGG A;  1ZRF A;  3E6B A;  1S0F A;  2P6C A;  3J26 N;  1XSQ A;  2HJI A;  2ZX3 A;  2A6X A;  4DUV A;  4EV0 A;  2E31 A;  3M70 A;  3B9C A;  3GXU A;  4GWM A;  4CPB D;  1LEM A;  1MS8 A;  2OZ6 A;  4UWD A;  2XJU A;  1W6P B;  5T52 A;  5FP8 A;  4CXY A;  1YEW A;  4GAL A;  4CXX A;  4YW1 A;  1OOP B;  1LHW A;  3HAG A;  4FVV A;  1RUH 2;  3WZ1 A;  5GZG A;  4C1X A;  3S5A A;  3BCW A;  1AZD A;  1UL9 A;  3MUY 1;  3NAP C;  4DRR A;  3EJK A;  4RFT 0;  2HEW F;  4KWL A;  3T4H B;  1FPN 1;  1UNB A;  1J83 A;  1NA1 A;  1AYM 3;  4N9H A;  5FZO B;  4FPY A;  5FV3 A;  5H9Q A;  4BQX A;  4BXF A;  2DUR A;  2NYY A;  3FE5 A;  4GZ9 A;  4AW7 A;  4M3C E;  4COW A;  2CNA A;  2NPI A;  3VHP A;  4BIS A;  1LTE A;  4CCL A;  1W6N A;  4MYE A;  4CEY C;  1RUF 3;  3BPZ A;  1X33 A;  2WA4 A;  4N53 B;  1AL0 G;  3LA7 A;  4WM7 C;  2VUD A;  4KU7 A;  3ZXK A;  3K4A A;  4Q4X 3;  4R4Z A;  1J1T A;  5DZF A;  5IHR A;  3IKW A;  5FY8 A;  2HWE 1;  1EAH 1;  4GH4 B;  4AHX A;  4MX3 A;  4EJR A;  3OD0 A;  4EN8 B;  5BNQ A;  2BVB A;  4AVS A;  1GR3 A;  4CU7 A;  3SC7 X;  1JOB A;  2R1D A;  1JW6 A;  3I54 A;  2MEV 1;  3PMS A;  5CKM A;  4I02 A;  5F2S A;  4JTN A;  3ZSM A;  4XZP A;  2R0H A;  4XFB A;  3JUU A;  1D7P M;  3KS7 A;  5AC9 3;  5B2G B;  1JYN A;  3PLQ A;  5DDJ 1;  1NXD 1;  4UBG A;  3ZFE B;  1G9D A;  2DCJ A;  5JOX A;  2WDB A;  4D8M A;  1VBE 1;  3IAQ A;  4ES8 A;  5IW0 A;  1XYO A;  1PK6 C;  3H1W A;  3D8C A;  5CKN A;  1AXY A;  1W8H A;  5I93 A;  1MEC 2;  3DYP A;  4WM8 A;  2HH9 A;  3V0A A;  2F4P A;  3AKP A;  3GZT B;  1HRI 1;  4LBK A;  4IV3 B;  2BFU L;  4K1Y A;  1WLT A;  4QWN A;  4E4D X;  4QPW A;  3WG3 A;  4XJW A;  1DQ1 A;  1WBF A;  5CVR A;  2Z79 A;  3LPG A;  3ZYF A;  1FOD 1;  1CIY A;  1NT0 A;  1LKN A;  2WZP P;  3H50 A;  2ZKL A;  2E26 A;  3RMY A;  3RYR A;  1AL2 2;  2IC1 A;  4WVZ A;  3KT1 A;  4NVP A;  4XUO A;  3LGR A;  1N1V A;  1RUE 1;  3O14 A;  4A41 A;  5LY2 A;  1V0A A;  4NIH A;  1I1E A;  2R06 2;  3URF A;  1EV1 3;  3TN9 1;  4E4H A;  5IVF A;  3IAP A;  3HBK A;  1AYN 2;  2D40 A;  4TZD A;  3WQB A;  1BK1 A;  1ZRE A;  4DUW A;  3M3Q A;  5BXX A;  4E4Z A;  2VOX A;  2OT7 A;  4PLM A;  3AYC A;  1CJP A;  4YPJ A;  3M4F A;  1FNZ A;  3POG A;  2NP0 A;  2QBX A;  5F3G A;  2PFW A;  1EPZ A;  1K5M B;  3WXP A;  1CGP A;  3PJQ A;  2D5F A; 
#chains in the Genus database with same CATH homology
 2HBT A;  5IAX A;  4J25 A;  3HQU A;  5IAV A;  3MGU A;  2RDS A;  2FCV A;  3GZE A;  5ERL A;  4NMI A;  3W20 A;  4UWD A;  2JIG A;  2HBU A;  5LAS A;  5LA9 A;  5DAV A;  2Y34 A;  5HV0 A;  3OUI A;  4NHY A;  4XAC A;  3NNL A;  2FCT A;  4NAO A;  4BQX A;  5A3U A;  3PL0 A;  2A1X A;  2OPW A;  4NHK A;  2V4A A;  4BQW A;  5LBB A;  4Y5S A;  5HV4 A;  3KT4 A;  2FCU A;  5DAW A;  3EMR A;  4MHR A;  5LBF A;  3HQR A;  5EP9 A;  4IW3 A;  4NHL A;  5LB6 A;  4XCA A;  5C5U A;  5DAQ A;  4XAB A;  5L9B A;  2G1M A;  5IAT A;  3OUJ A;  3NNJ A;  5EQU A;  4BQY A;  4KBZ A;  2G19 A;  3GJB A;  4ZON A;  4NHM A;  4MHU A;  4NHX A;  4XC9 A;  3W21 A;  5DAP A;  5LAT A;  2JIJ A;  4ZPI A;  5L9R A;  5M0T A;  3OUH A;  3GJA A;  3ITQ A;  3KT1 A;  3OBZ A;  3BVC A;  3KT7 A;  5LBE A;  5DAX A;  5L9V A;  2RG4 A;  4XAA A;  2RDQ A;  3NNM A;  2Y33 A;  3DKQ A;  4Q5O A;  5EPA A;  3NNF A;  2RDN A;  4Y5T A;  2RDR A;  4XCB A;  5C5T A;  4JZR A;  5LBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...