4XZPA

Crystal structure of the n-terminal domain of human galectin-4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
148
structure length
148
Chain Sequence
b'PAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-4
molecule tags Sugar binding protein
source organism Homo sapiens
publication title Full-length model of the human galectin-4 and insights into dynamics of inter-domain communication.
pubmed doi rcsb
total genus 29
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2015-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xzpA00
2P2KA 1I1EA 4UW5A 4PBOA 4HANA 1KDMA 3OBTA 1LU2A 1C1LA 3MEPA 5DZGA 3WUCA 1LODA 1JYCA 2GALA 4ZKTB 5JVVA 5E89A 3FFZA 3WUDA 4PQ9A 4XHXA 1IS5A 1O4YA 1V6NA 2VUAA 5JDBA 1BZWA 1ONAA 4TYSA 2AYHA 3AXEA 4K20A 5HCBA 5KXDA 3SITA 2ZGKA 2ZMLA 1VLNA 5H9SA 4BMEA 1QOSA 2SBAA 1GNZA 1VAMA 4UW4A 1KJLA 2ARBA 2DTWA 2LALA 4FPGA 3WG4A 2A75A 4P9WA 1SBEA 4XBLA 3Q9OA 3HR9A 3WDVA 4AGRA 1JN2P 4NO4A 2ZGSA 3NV1A 4FOWA 3PMEA 2VY0A 2PHRA 1QKQA 3QCWA 1S1AA 4C1WA 4XJ9A 1WD4A 1W6MB 3M3QA 1FYUA 1S0CA 2I2SA 3WDYA 1SACA 4CTEA 4BQ1A 4YM3A 1JHNA 1DGLA 1SLTA 2ZBJA 3AP6A 3FUQA 5GJ6A 1ZM1A 5IT6A 1H9PA 1S0JA 1AZDA 1LEDA 3PVEA 1Q8QA 3SNMA 1G9DA 1GZ9A 4XE9A 3OY8B 3H0OA 1RINA 4XJUA 3U4XA 1G8WA 1AXZA 2UWCA 4YGBA 2EXKA 3VV1A 5JOXA 2R1BA 4XZPA 1OFSA 1UMZA 2DURA 4ISQA 1AXYA 1U0AA 4L8QA 1S0DA 4FQZA 1IKQA 1V6KA 1W6NA 1IKPA 4WV8A 4XJZA 3N35A 1DQ1A 2R49A 1HQWA 1JOJA 4ISRA 3RSJA 3WDTA 4AVTA 3V0AB 1W6OB 4M00A 1RIRA 3N7JA 3D5OA 1XQNA 4Y1VA 3GALA 3R4SA 3W58A 4FOQA 5T5OA 4Y1YA 4GALA 4YGEA 1GYKA 4YZ2A 2Q5TA 1LHVA 3KQRA 4FPLA 4K1YA 3IPVB 1DQ6A 1W6PA 5CBLA 1WD3A 1AX2A 1X50A 4R9DA 1SLIA 2JECA 1FAYA 2P3KA 4JCKA 4P9XA 2D6OX 5DUUA 4JC1A 2VXRA 4BM8A 3M3OA 4WVVA 4AVSA 1MR5A 4U2AA 2YZ4A 1SFYA 3TAYA 1DFQA 2OVUA 1N1VA 1WCSA 2PHFA 4LBQB 5JOZA 4DQAA 2A7AA 4Y1UA 1QDOA 2ZGLA 2VW1A 1UZZA 2VH9A 4K1ZA 1LHNA 1MS4A 3WCSA 1D0HA 2GMEA 1QGLA 1LHWA 1JUIA 2WKKA 3INAA 4XBNA 5EYYA 5DUXA 1APNA 5AVAA 4XJAA 3A0NA 3NV2A 1MS3A 2HYKA 3O12A 1S0EA 5T55A 2A6ZA 1LOBA 1MS0A 1PZ8A 5GZFA 1R1ZA 3IKWA 4FPYA 1DYKA 3N36A 3ILFA 1MS8A 1ULGA 2YXSA 4XTPA 5BYNA 2WSUA 5EXOA 3WG1A 2CNAA 5GZGA 3KM5A 5SV8A 3RS6A 3B3QE 1AJKA 2D6NA 1A3KA 1SCRA 1FV3A 4YW3A 1LOFA 1NLSA 3N7LA 2E7TA 4K21A 2FHRA 3OPZA 1URXA 2H0BA 1GSLA 1RITA 1CQ9A 2OW4A 3OYWB 2WSVA 1D2SA 2ZGNA 2LTNA 3WVJA 4DRRA 1GV9A 3L2YA 1JXNA 1DHKB 2CWSA 1CR7A 1DQ5A 4FQ4A 3ILNA 1JBCA 1LOFC 3ILRA 3USUA 4MYEA 3DUIA 1C57A 4FPOB 3WG3A 2A6VA 2VU9A 2R0FA 3M3CA 4GA9A 2DUQA 3O5SA 5DUVA 2AUYA 2CYFA 1WW5A 3WV6A 1LOCA 2D43A 2R16A 5F9TA 1J1TA 2EXIA 2V5YA 4YW4A 2DUOA 2GNTA 2ES3A 3MW2A 2JE7A 3WDXA 1WLCA 2DYCA 1G9BA 4YFWA 5GLWA 5GLZA 1F9KA 4ITCA 2W39A 3V0AA 3BTAA 1LENA 1FX5A 2AH2A 1KQRA 3WDUA 1CPNA 1DBNA 5DUWA 2ZHLA 2D44A 2E6VA 3BOPA 3I4IA 3BIWE 1LECA 2ZKNA 4LBJA 3N7KA 4XDQA 4BOWA 4WVWA 4FPKA 4Q1RA 4UW6A 1LOAA 4D69A 1S0BA 1ENSA 4FPFA 2C5DA 3HMYA 3I8TA 5HCFA 3IN9A 4P9YA 3WHTA 1MS5A 3AP5A 3M3EA 4H55A 1NXD1 4YFZA 1GLHA 5IK8A 3WG2A 3V0BB 4YW5A 3T1MA 3AYEA 3FLPA 4XILA 4Y24A 1TEIA 4DRVA 1H30A 1IS6A 2AENA 2EALA 3A0KA 3UJOA 4DPNA 1N1TA 1GZCA 4GWMA 3WHUA 3ZSMA 1YRZA 5L73A 1WLWA 5FREA 1LOEA 2ZGTA 4BMBA 2D3PA 1UZYA 3ENRA 1FV2A 1VIWB 2NMOA 3POSA 4Y20B 2WT1A 1HKDA 3GNEA 2B7YA 3SLIA 2D3SA 1FATA 2OUJA 3DGTA 3FLTA 3WNXA 3WZ1A 3AZZA 3TB0A 2UWAA 1LOGA 3APBA 3ZXLA 3A4UA 4LBQD 4LBMA 4PF5A 2EXHA 4U36A 5DXDA 1GANA 2PELA 5JMCA 4F83A 2JE9A 3ZPYA 5GZDA 3VKFC 3ZXJA 4CRQA 3FBYA 4HL0A 3SH4A 3HN1A 3AJYA 2D6PA 3MPPG 4XMIA 4ZXKA 4BLIA 1KRIA 1KDKA 1VALA 5T5PA 2EXJA 1N1SA 1F31A 1N47A 3C2UA 1Z0HA 1DQ0A 3AP9A 4ATFA 1MACA 1V6OA 1WW4A 3AZXA 2WT0A 3B9CA 1SLLA 2BQPA 4YW2A 1OQ1A 2D7FA 3FLRA 3SH3A 1WW6A 1CIWA 3ZSJA 3O0VA 1S0GA 2ZHKA 5DG2A 1YI7A 4OZXA 4XOGA 3M1HA 2E7QA 4XXAA 3BODA 2JDZA 4Q27A 2WJSA 3PJQA 3ZXFA 3PVOA 2A70A 2A6XA 1N3QA 5CA6A 2G4IA 4P14A 3R05A 2UWBA 1AJOA 2A71A 2XB6C 4KBBA 1I3HA 2R1DA 3AX4A 1MZ5A 2NM1A 2PHUA 1JW6A 4Y26A 2TEPA 3RQ0A 1HDKA 3V64A 2NP0A 2GMMA 1A8DA 1QF3A 2CWMA 3IPVA 4R9CA 4SLIA 4Q8KA 4R9AA 1LULA 1MZ6A 5H9RA 2ZHMA 4IQPA 1HLCA 1G86A 3WCRA 4RA0A 5F5QA 2E51A 1CVNA 2R0HA 4JRAA 5H9QA 1GBGA 3NV3A 4NOTA 2GNDA 1H9WA 4YW1A 2YY1A 1AXKA 1V6JA 1W6QB 2E53A 4YM2A 5KXEA 3OY8A 1UPSA 2ZAAA 3MW3A 1FNZA 3AK0A 2NYYA 4FOVA 1KJRA 4WZFA 3N3HA 5LK5A 5T54A 3RG0A 5GALA 4ASMB 4BLJA 1SLBA 1BJQA 1BYHA 4YZ4A 1DZQA 2RHPA 2V73A 4YGCA 1LGCA 2ZGQA 3W59A 4Y22A 5IK5A 4YGDA 5KXBA 1UX6A 1QOTA 4Q1PA 3RMYA 1Z78A 1DYPA 3AZWA 2ZZJA 3V0BA 2VW2A 5FRAA 4YZ3A 5KXCA 1SBFA 1CN1A 2GMPA 1KITA 1V6LA 4PBPA 1V6IA 1ULCA 2KM2A 5GM0A 1G9AA 2AREA 3RMXA 1V6MA 1S0FA 2WLQA 2JD4A 4Y1XA 2A3XA 3ZYRA 3ZXEA 4FP3A 4R9BA 4Z8BA 1FNYA 4TZDA 2GDFA 2D6LX 1W6NB 1EPWA 2W52A 5E8AA 5T52A 3ZVXA 1BXHA 3AFKA 4Y1ZA 1LJ7A 4YG0A 3B69A 1ENRA 4FPEA 2CY6A 1BQPA 3JU9A 1JYIA 1WUVA 2WNEA 5DG1A 1VAVA 2DVBA 4I30A 2EAKA 4YM1A 1GICA 2YROA 2DVGA 2W68A 4XYXA 2DTYA 3IMNA 5CNAA 5IK4A 1OKQA 1Q8OA 3NWKA 2ZMKA 4XJ8A 3AYCA 4XBQA 1W6PB 2VW0A 1N3OA 4BPZA 1SLCA 4ATEA 1UKGA 2YMZA 4M3CB 4XTMA 1S0IA 2ZACA 5EWSA 2EF6A 1IS3A 1ULEA 4Y22B 3VKMA 5IUQA 4FOYA 1W6QA 4PCRA 1LESA 2DVDA 2PHXA 5EYXA 5T5JA 1YIFA 3VKNA 3WDWA 4LBQA 3UL2A 1IOAA 5GZEA 1WBLA 1QDCA 2DU0A 2W08A 1YO8A 1DIWA 4XJWA 3VKOA 3VKLA 4GWNA 1AF9A 3AYAA 3D4KA 2NN8A 3ASIA 1LEMA 3OBRA 1V00A 4YZ5A 3AZVA 2AGSA 1LGNA 3ZSLA 4C1XA 5HCAA 2A3YA 3ATGA 1ULFA 4XMAA 3AZYA 1QNWA 5CB7A 1B09A 4AYUA 3T1LA 3VUOA 1W6MA 3ZSKA 2PHTA 2P34A 1SBDA 2NMNA 4XIKA 4DFSA 1LHOA 2Z42A 1MS9A 3AJZA 3WLUA 3NV4A 3LCPA 1LCLA 4M3CE 1GZWA 4RL7A 1WW7A 2ZGPA 5T5LA 3USUB 4GXLA 2OUHA 3AXDA 5H9PA 2D6MA 1MS1A 3UK9A 3ZXKA 1LU1A 4FP2A 4M01A 4Q8LA 1Q8SA 2ZGRA 1W0PA 3LSEA 2YV8A 1O4ZA 2ZMNA 3IM0A 2ZGMA 4XXPA 1DQ4A 1G9CA 1G9FA 2UURA 4LBOA 1YYNA 2ZA9A 3POWA 1MVEA 2DWRA 1SCSA 3B01A 3V65A 2NZ9A 2A3WA 3N7MA 3O0XA 2XG3A 2A6YA 3B00A 1GZWB 3OGGA 5GLTA 4GKYA 1N1YA 4Q2FA 1UN1A 3UJQA 4W65A 3LSDA 1C1FA 1DQ2A 1CJPA 1UL9A 2A6WA 4FVVA 3WOGA 2ZGOA 3D6EA 1CONA 5E88A 2GNBA 2ZHNA 2EIGA 2CTVA 1QU0A 4FPHA 5JLVA 1LTEA 1CPMA 1WBFA 3CNAA 3SH5A 1GKBA 2ARXA 1MVQA 2DVAA 3T2TA 1BKZA 3AP4A 4LBNA 4CZSA 1N3PA 1ENQA 2GNMA 2PHWA 3M2MA 5DZFA 3JUUA 3SISA 5IK7A 3RRDA 4UW3A 2D6KA 3AYDA 4YM0A 1PZ7A 2D3RA 4XHBA 2FMDA 2JJ6A 1W6OA 2P37A 1Q8PA 2P3IA 1QOOA 1ZA4A 2DUPA 3OYWA 3R4UA 4FPCA 5JOWA 4YLZA 1UAIA 2AR6A 3O0WA 2WT2A 4AGVA 1CESA 3QLQA 1C4RA 1A78A 1W0OA 4GKXA 1AX1A 1YXWA 2CL2A 4LBKA 2GN3A 1Y7BA 4DS0A 2ERFA 4XIOA 4LBLA 1QNYA 1AX0A 3AP7A 1IS4A 1LGBA 1PZ9A 3FUOA 3PVNA 2A5ZA 4Y20A 2ZABA 5JOYA 4AGGA 1G7YA 1Q56A 4YG3A 4AWDA 1WLDA 2ZGUA 1HQLA 5CAZA 4AVVA 1DLLA 2C9AA 4Q26A 2DV9A 2P3JA 1F5FA 5GLVA 1SLAA 2DVFA 2ENRA 1GNHA 5GZCA 3MW4A 1LHUA 5DZEA 2UU8A 5GLUA 4M3CF 4YG6A 5T50A 4FPJA 3OJBA 1AVBA 3ZYPA 2DU1A 4YZ1A 2WQZC 1Q8VA 1QMJA 1ULDA 4M3CA 2SLIA 2GN7A 2JKBA 3POYA
chains in the Genus database with same CATH superfamily
1RUJ2 2P2KA 2RVAA 4BA6A 1W8HA 1VBD1 3OBTA 2O8OA 3VN4A 1HIXA 2OPKA 2GALA 2YB7A 4KH9A 5JVVA 1SPPA 1KS5A 2VUAA 5JDBA 1BZWA 1U5XA 3OGVA 5ACA3 4TYSA 2D5FA 3KGLA 4NHKA 4NAMA 4LO4B 3VZKA 3M8LA 1WGPA 4HLTA 2YGLA 3QOPA 4E4ZA 4J1WA 5D8AB 1UMHA 3BYWA 3IAPA 4M0NA 3H8XA 3SC7X 1J84A 2XKPA 2VOVA 2X53S 4BQ2A 2LALA 4EWDA 1NCQB 1OH3A 4XC9A 3DYOA 2A75A 3OCPA 4NHXA 3ZOIA 2FBEA 5FZLA 1TNRA 1KFUL 5AVPA 2AACA 1CAXB 4QU1A 3PTYA 1DP0A 2DFCA 4FOWA 1SDDB 3PMEA 1W9FA 2XBO3 3LIGA 1WZXA 2IXHA 1SG3A 4XJ9A 2R30A 2BNMA 1POQA 4NUBA 2I74A 5FMBA 1YIPA 2CSGA 3D0JA 4K8FA 4CUBA 3LEGA 3H8RA 1SLTA 2WBKA 4RD7A 3FUQA 5GJ6A 3UV9A 1H9PA 3SNMA 1L7QA 1DCSA 4G4FA 4EV0A 1F8VA 1JTZX 1NG0A 4XJUA 2WO1A 2EXKA 3ITQA 3LKJA 3B02A 4N8MA 3AMMA 1OFSA 5JZGA 5FOJB 1QY4A 1XXNA 1AXYA 4FQZA 4WV8A 1UY3A 1PO22 4YYOA 4N9IA 4BQWA 1DQ1A 2XJRA 1JOJA 1W8FA 4P9LA 5A7SA 1W6OB 5FYSA 5FOBB 4YVWB 3D5OA 3W58A 5LY2A 4QPWA 2C26A 5FY7A 5JXGA 4HMZA 1QHDA 4YGEA 4HVQA 3MIGA 3J7HA 4FPLA 4H7LA 5I8SA 1OQDA 1AX2A 2GC1A 4QB2A 2D6OX 2P1BA 2VZOA 4JC1A 3VZMA 5HI0A 1H1IA 3B5LB 2VXRA 3VD5A 1VMJA 4U2AA 2CGPA 3OF1A 4XFIA 2OVUA 1GWKA 1BVP1 1Y9GA 3VBUA 2B39A 4DQAA 2RMU2 2XGXA 1GWMA 4PQQA 4Q4W2 4P5YA 2WZR2 1AR91 4Y1UA 1ZZ6A 2ZGLA 2J1RA 1H6XA 1OD5A 3LOIA 4N43B 3ZKYA 2XVLA 2GMEA 4XBNA 3K75B 1XU1A 2IZWA 3K3OA 5AVAA 3I2OA 4QX5A 2D5HA 1W9SA 3O12A 5L7OC 3B94A 4NHLA 5T55A 2XQXA 1FPN1 4GMP3 2BNNA 2XL7A 1MS0A 1OF4A 1RHI1 5FZIA 3O1OA 4P00B 3N36A 3MIDA 4BWOA 5EPAA 4EJRA 1XNCA 4XTPA 4DUWA 4JKLA 4AI9A 3C7GA 4GH4B 4XQWA 5EXOA 4OHYA 5FTTC 4AXOA 1AJKA 4AEJA 5A6YA 3HT1A 1GOHA 1F5JA 1RMU2 2WO7A 4B4PA 3LEIA 5FP7A 5A3TA 2BYVE 1T6GC 1QJEA 1YQCA 3I49A 3CDZB 2CU5A 3ST7A 4NJ4A 3PL0A 1KD7A 2VNOA 2WSVA 1D2SA 4CEYB 2ZGNA 4D6SA 4WVZA 2GC3A 4XCAA 3L2YA 4DRRA 4NMIA 1DHKB 4LUMA 3AMQA 5G05L 1B35C 1DQ5A 2ADEA 1JBCA 1BCXA 5L7OB 4FPOB 4TSVA 4Y3OA 2R0FA 4GA9A 2Q8EA 4CDXB 2VL4A 1JZ7A 2WABA 2YDEA 3BU7A 5D8AA 4CEWC 1AL21 1PGL1 4OHXA 4N43C 3J8F2 4NHMA 3WDXA 3MW2A 3C7HA 2DYCA 5C3SA 2C1FA 1G9BA 3O1VA 2Q8DA 1F9KA 1B35A 1RUC1 3R6SA 2JG9C 3WF1A 3KCYA 1HRV3 4KWJA 3EMRA 1KQRA 2J1AA 3WDUA 2CAUA 5I0UA 2K0GA 3FJSA 5DUWA 3I4IA 2D44A 4MGZE 2RJ2A 2FZ2A 4XDQA 1BLZA 3MGUA 3OUIA 3KZ4C 3FZ3A 3GZEA 4QMAA 1ENSA 3MLLA 4XFCA 3ZXDA 1JU4A 3WHTA 3AP5A 1W05A 1OXCA 4YFZA 1W2OA 4LORA 5F3IA 1GLHA 1QJFA 3AFGA 5FR3A 1XPWA 3T1MA 4HKLA 1NCQC 2CGOA 1H30A 1NAEA 3A0KA 1REDA 2DCTA 1OOPB 4GWMA 3K4DA 4IGPA 4IETA 4BXFA 2E7AA 5F7UA 5FREA 3U07A 3CEWA 4BMBA 1UD1A 3GDBA 5L7OA 4A41A 2NMOA 3BTZA 1W8ZA 4Y20B 4CEWB 2UY8A 3ES1A 5BV6A 4QT6A 1AUYA 3IDAA 4AI1A 3HNYM 4MXVA 3FLTA 3I54A 2OA2A 3ABZA 2UWAA 4CCJA 1IG0A 5FY5A 4CDWC 4CPBD 3H3LA 2XJTA 1UZ0A 4LBMA 3DPRA 1Y9QA 5DXDA 2VD7A 4XW3A 4LK7A 2JG9A 2JE9A 3K4ZA 3KCXA 3ZPYA 5GZDA 3ZXJA 3PDQA 5BNOC 3FBYA 4DOUA 4EYUA 3POBA 1AR93 2VO5A 3AJYA 2YYOA 2WYFA 5F32A 4ZXKA 2WS92 3WEZA 4L99A 4D0QA 2Q4SA 4JHTA 4NRPA 4XFFA 2BOIA 3W5MA 3AP9A 4ATFA 1V6OA 5T3NA 2BGOA 3B9CA 5BNOA 3QH7A 4MXWA 4XUOA 4XACA 4QHBA 1VB2A 1WW6A 4CDQA 3GYDA 3OOXA 3O0VA 1HJGA 3TN91 3LEMA 4CP9A 3FBMA 4QB1A 3TWIA 3HBZA 4UI9L 3BB6A 2A6XA 1N3QA 4PF1A 1CIYA 3ZDVA 1I6XA 1OQEA 4N9HA 4P14A 2RS51 1GU3A 2A71A 4HETA 2HWF3 2WZR1 4BK5A 1QXPA 1MZ5A 2PHUA 4XETA 1RC6A 3B93A 4IEXA 3F95A 2XJUA 4AI8A 3LDRA 5F3GA 2XBO1 1AR82 5K0UA 3CJIA 4DMIA 3CO2A 1VBB3 1PK6C 2E32A 1H8TC 1MZ6A 3LFMA 4YVSC 5I8TA 2HWB1 2XUMA 4MG2A 3MPBA 4FAHA 2W94A 1G86A 3D0SA 5FYVA 3MO4A 4FXKB 1K45A 3WCRA 4DEVA 1SZBA 1NX9A 4JRAA 1UZVA 5FP4A 3PUHA 3T0DA 2JWPA 1OH4A 4P9IA 4KGGA 3WF4A 3EBRA 1V6JA 2E53A 4M4RA 4BDVB 3KQ4B 3FHIB 4FXGB 4NIHA 3MW3A 3AK0A 4RHV3 5CKQA 3N3HA 5LK5A 1OVPA 1ZNPA 4BZ4A 2RM21 3AM2A 4DINB 4DXSA 5CFCB 1CD3G 1SLBA 1HXS3 1VAKA 3BI3A 1DZQA 5FQ0A 2XLAA 4YGCA 1RMU1 4Y22A 2JDHA 4LR4A 2VCMA 3RMYA 4K7JA 1Z78A 1PHMA 4LKSA 1UMIA 5KBFA 4QWNA 2D98A 2WN2A 1NQDA 1R092 3IBMA 5K8SA 1CN1A 3LD8A 3NQHA 2VMEA 3H9AA 3U1XA 3E5UA 1D4M1 2JD4A 3ZYRA 4AFAA 4BIFA 1VBC3 2RDSA 4Y5TA 5DN2A 3SCGA 4CXXA 1C8M2 3HT2A 1OD3A 1W2NA 4KG0A 4OQ9A 1W8OA 1QJU1 4L0PA 3ZO0B 1UNBA 2CHHA 3B69A 1GQHA 5A6ZA 4LHSA 2CY6A 1JYIA 2WNEA 1RUH1 5DG1A 1VAVA 2DVBA 4TLFA 1O5UA 5DAVA 2HWD1 3WP4A 2YROA 1FPN3 3HOBA 3AMPA 3PIGA 4GMP1 1V70A 1XC6A 2Z79A 5F6LB 2DTYA 1NY72 1OKQA 3MUY1 2ZMKA 5C3OA 4LHKA 3AYCA 3I3BA 1RUI3 3KV9A 2ZKLA 1W03A 1W6PB 4XBQA 3VL9A 3DN7A 1BBT3 2O14A 4OCTA 4PIXA 4RS5A 5A3UA 3RI8A 2V72A 1C8NA 5I0RA 2W87A 3E6BA 1GFF2 2VTXJ 3ZMNA 2ZACA 1PIV1 1POV3 4Y22B 1IS3A 1EUUA 4NROA 2YPDA 5IUQA 2WNUA 3WY6A 1GOGA 2VXJA 3A23A 3VBHC 3ETQA 3VKNA 1MQTA 3WDWA 2UYBA 5IVEA 3LPGA 2DF7A 3NMBA 5GZEA 1TME1 2C6SA 1M4WA 1QDCA 2PQQA 2W08A 4XJWA 1MQTB 5KC5A 2W1QA 1VR3A 4GWNA 1IQDC 3GBWA 4IUGA 4QHOA 3D4KA 3I2FA 2Y33A 5ERLA 3SCHA 3ZIWA 4A45A 1HRI2 2NN8A 3ASIA 1XBFA 4AG4A 4C8DA 5CKNA 1W9WA 1Y3TA 2VMGA 5BNNA 1LGNA 4LKFA 4JQRA 2W3JA 3ACIA 2A3YA 5C9AA 1EV13 3VUOA 4AYUA 1TMF1 3X29B 3PURA 2J1EA 2O8QA 5BXXA 3S0MA 1ZBA3 5ANQA 3T0BA 1W0NA 1PVC3 2RS11 3AJZA 3WLUA 2ADDA 1QJX1 3NV4A 3M7AA 2J1UA 3USUB 2EIDA 2ZGPA 3ZYHA 2E33A 2OUHA 1QH6A 2W92A 3I7DA 5H9PA 1UYZA 3ZXKA 3RZLA 3KT4A 1LU1A 2HEYF 4TXWA 2WNVA 2QJVA 2VUDA 2YV8A 2ZMNA 1TNFA 2VMIA 4W50A 1G9CA 2IXKA 4LBOA 1RUE3 4AVBA 1OLME 4RS5C 4OHZA 2HKXA 1NUKA 2NZ9A 3ZYGA 4I3GA 3ZMOA 1LRHA 1PVXA 3KV6A 1JHJA 4DY3A 2BWCA 4RR3B 4BIOA 4QX8A 5A32A 1L3JA 1RUOA 1DU3D 4LA2A 3PIJA 5ISLA 5CG8A 1QJY3 2VUCA 5FWEA 4AQSA 1UY4A 1DQ2A 4FVVA 1CX1A 2VTXA 2YUEA 4E2GA 1CONA 1JU3A 2ZHNA 5C5TA 5A6XA 2K9ZA 5JLVA 1LTEA 3FHAA 4I02A 1VBD2 3LFIA 4LIUA 2ZZQA 1YQ6A 1BKZA 3D3AA 5DZFA 2ZEZA 1XE8A 1W2UA 1EAH2 4QGLA 5C5UA 2D6KA 5FP8A 5LA9A 4PDWA 5FZ6A 2FMDA 3WP5A 4BJ0A 2BRTA 1NA1C 5FMCA 3LB9A 2DUPA 4YPJA 1RYYA 4QPGA 2V4AA 2WC2A 3U0ZA 1BEV1 1UAIA 2WT2A 4E4DX 3QLQA 4HKOA 1W0OA 1OOPA 4GKXA 4A4AA 1CAWA 1BHGA 4AEDC 1AX1A 5KHKA 2ZS6B 1ST8A 4LBKA 2OZ6A 1QJY1 1QNYA 1AX0A 2PAEA 3AP7A 1IS4A 4NIIA 2FDKA 5FY4A 4Q5OA 5FMOS 5JOYA 1HXS2 2VR4A 4KBZA 4AGGA 1PO21 1Q56A 5EP9A 4NWWA 4INDA 1F15A 3VDDB 4N53B 4A6SA 2ZGUA 3AKSA 3DPRC 4AVVA 2HEVF 1BBT2 3OD0A 1GQPA 2YC4A 3Q8AA 1QIQA 1XNDA 2E31A 2P3JA 5DAPA 1F5FA 3ZPOA 4MGIE 4OVEA 1GNHA 4QQPA 5A1AA 3ZR5A 2UU8A 4M3CF 1UKRA 2B8MA 4YG6A 5KHHA 5T50A 4FPJA 3UETA 3LWCA 2WQZC 1UY2A 1UU5A 2SLIA 2GN7A 3O1UA 2JKBA 1I1EA 4UW5A 3WNLA 2X05A 3CJIC 3I3DA 4IEQA 5FY8A 1LODA 4FFGA 4CDWB 1W3VA 2PHDA 4QM8A 2QQNA 1OBNA 4NVPA 1A8MA 4XHXA 1IS5A 3ZXGA 3H1YA 4E8CA 2AYHA 5HCBA 5J48A 2XDVA 3LA2A 3SXWA 5JXHA 1OA4A 1MZEA 3SITA 5DPNA 3VBFB 5I8YA 2ZMLA 3AKTA 1U5YA 4GQ7A 2R063 5J7MA 4OUMA 3RZZA 1VMHA 2PA7A 3K48A 2QCSB 3FN9A 4A7KA 1AR61 1TVGA 2HWE2 4C91A 1KJLA 3KT7A 3VBSA 1YQ8A 1OOPC 2ARBA 3GZAA 4Q29A 1X7NA 4X6QB 5A7OA 3RYKA 2LM3A 5JR7B 5I0SA 1PNFA 1NOVA 3PLQA 1PGW2 1EYBA 1XNBA 4HXCA 2MEV3 3POIA 5C8CB 3HR9A 4ZHNA 5D2AA 4CEWA 2ZGSA 1H2KA 4CP9B 1D7PM 2QQJA 1OKOA 1J3QA 1X8EA 2VY0A 5CVRA 2WYSA 5FZDA 3RDIA 4QQOA 3ZYBA 2E9QA 2Q1FA 5FYYA 4BISA 4C1WA 4CP2A 1SFPA 3ZFEB 2PLV2 4Q4Y3 1W6MB 4LA3A 1W8UA 3H3UA 2EICA 4OQ8A 1IPKA 4TN7A 2WLPA 1SACA 3FHQA 2VNVA 4CTEA 5FUNA 2BVVA 1DGLA 3AP6A 4LT5A 1ZM1A 2VQTA 2QDRA 5LBEA 3WW2A 1AZDA 1LEDA 4AFMA 1Q8QA 4LMFA 3JD73 2JXAA 1HRI1 5FZOB 1GZ9A 4AHWA 3KV4A 5FBJA 3H0OA 1RINA 1RL3A 2VOWA 5F39A 4XZUG 3BPZA 1QQP3 2B9UA 4YGBA 1JZ6A 1FPN2 3ZN4A 4JKMA 2DURA 4CDXC 1D2QA 3MI8A 1S0DA 1V6KA 4MGQA 4OZOA 4E9KA 2VCAA 3SHRA 3CIHA 3WQ0A 4FCAA 2RS12 2BBAA 3WDTA 5JXIA 4AQ6A 2XKOA 4AVTA 3D8CA 2XUEA 1RIRA 3N7JA 1PK6A 2W2IA 3BCWA 4Y1VA 4DO0A 3I2JA 2R072 2Z5WA 4HFSA 4COUA 4Y1YA 4GALA 1TE1B 2JDPA 2XMLA 1Y43B 1H4GA 4YZ2A 3HWJA 1R1A3 3K77A 4BQ4A 4AL9A 1IQAA 2F17A 3I59B 3C7EA 3IPVB 3S7IA 4EN8B 1W6PA 1SLIA 3AC0A 4JCKA 2RS13 2DBIA 1UY1A 4GD4A 5DUUA 3P6BA 4Y33A 4HSLA 3I2GA 1ZRCA 3EXUA 1RUJ3 4GIQA 2VZRA 1SFYA 1NT0A 2C0ZA 4QB6A 1SFNA 4Q0PA 3S6PA 3TAYA 4H14A 4LBQB 5HXVA 1RTVA 1QQP2 4AFCA 4BCUA 3TEWA 1C3HA 1P8JA 4XVHA 5FZ3A 1QDOA 2IUWA 3DF0A 4D7TA 1ND2B 1PMIA 2FDJA 1Y4WA 2JG8A 2ZJCA 3M4FA 2AZ5A 3NKGA 3OG2A 4J25A 2JDMA 1OLRA 2QQKA 4NPMA 4QQLA 4XF3A 3URFA 4QPIB 2WKKA 5EYYA 5A6QA 2YFUA 5F5AA 1BK1A 1APNA 4OI4A 1KFXL 4XJAA 4MHUA 2XJPA 2XL9A 3NV2A 1MS3A 3ZSEA 5FO8B 2YPJA 4NIGA 4Z82A 2A6ZA 3JZVA 1VBC1 3TEXA 3VBSB 1NE4A 2N7GA 3WF2A 4RSUA 5LW9A 2GC2A 4A7ZA 1O5LA 2QQUA 4CCEA 1ODMA 5GZFA 5HCHA 2V4VA 3IKWA 4LKDA 5FFOC 3BIEA 4W6XA 4FTBA 3AL5A 5E1RA 3ILFA 1NXMA 2C9KA 2BGPA 2YXSA 5CZKA 5BYNA 2WSUA 2ORZA 3J7NA 3WG1A 2HBUA 3KM5A 3N9QA 5SV8A 1C8M3 1WA6X 5FPBA 1YI9A 2D6NA 3PHMA 2HWD3 1W9TA 2HWE3 1FV3A 2I45A 3BOWA 5GKAC 1NLSA 5ACA2 2JX9A 2RM23 3ALQA 3H7YA 4LE4A 4CP1A 3O1SA 2IXCA 2FHRA 4K21A 4MVTA 4URAA 3PVBB 2WQ4A 3KHBA 2BEOA 2LUWA 1URXA 1WA4A 4CU7A 1GSLA 1RITA 1YQ2A 4Q0UA 5FYZA 5JPNB 2OW4A 1JYXA 3T30A 1DZTA 1JXNA 2CWSA 2IXJA 5LBBA 3MIFA 4OMDA 2BNOA 2BFUL 4FQ4A 3ILNA 3USUA 3ZX7A 4AFDA 1JZ4A 2TNFA 1WMFA 2VZ1A 4GJYA 3WG3A 3M3CA 2VU9A 1H6YA 1OA2A 5DUVA 2QBXA 3O5SA 4DXZA 4YARA 2MPFA 2CYFA 1RUF3 1CAUB 4QXKA 1ASJ1 2V5YA 2O0OA 2GNTA 2XONA 4AVAA 1WLCA 2FD8A 3R0RA 2W39A 3OGJA 4XF0A 2WIIB 1RUE1 4XCBA 2BW8A 3VZOA 3HIFA 1PGL2 3P5BA 4IL7A 4F3JA 1CPNA 2ZHLA 2E6VA 2WS91 2YBKA 2QQIA 1LECA 5EJ3A 4ZONA 3N7KA 3U4SA 1PVC1 4Q1RA 5K4LA 1AR81 1LOAA 4QDSA 1WCUA 4D69A 4FPFA 3BTYA 1H8VA 3JD71 3IN9A 1SEFA 4WVMA 1IG3A 3LIHA 1NXD1 3UGGA 2WWSA 1OPMA 2D97A 3V0BB 2VMFA 4YW5A 3TN92 1UOJA 4EE2A 4XF1A 5FZ9A 1QXRA 1TEIA 4AQ2A 1VBE1 2EALA 3O1PA 1AYN1 3WHUA 3AVRA 1YRZA 5LWBA 5L73A 3WW4A 2VZTA 3KSCA 2ZGTA 3FE5A 4ARXA 3ENRA 3MZHA 5LBCA 3RZKA 1FV2A 1NCRB 3SQOA 1NZIA 2WT1A 3NJYA 1H4HA 1A6CA 2B7YA 4IV1A 2OUJA 1BMV1 3AZZA 3TB0A 1GMMA 1LOGA 3APBA 3AKRA 5FZ4A 4LBQD 5FY9A 3WQBA 2XOMA 4CCMA 4ZU7A 1R091 2EXHA 3FC0A 5LA1A 4U36A 1GANA 3OPTA 4META 5EJZB 5C4WA 5A80A 5JMCA 2GH8A 4PLNA 3EYPA 1D4M2 1DGWA 2PFWA 4XPVA 2VMDA 4IE0A 3SH4A 1M06G 2P3YA 1ZREA 3VD4A 3NSTA 3MPPG 1MEC2 1SDWA 2YBPA 4XMIA 1KRIA 1F35A 1KDKA 1VALA 1C8M1 4NAOA 4HN1A 4AI2A 1N47A 2QKDA 3C3VA 3C7OA 5F3EA 1QJU2 1SMVA 2MEV1 5M0TA 1X82A 3AZXA 2BQPA 3EO6A 2FDIA 2Y6HA 4AAXA 1QJU3 4S2FA 2ZTNA 3CQOA 3WP6A 2D7FA 4DB5A 4OI0A 4UF0B 3CZJA 4OZXA 4YVSA 5KC6A 3PJQA 4NPRA 4WM8C 1NLQA 3PVOA 2X29A 3ACLA 3J9SA 1OA3A 3OBAA 4FBFA 2G4IA 4BK4A 4H7MA 1AJOA 1X9TA 4PLMA 1EP0A 2Y6KA 4OLLA 2I07B 5FP9A 3NVCA 4RYDA 4DIQA 4EWAA 1FXZA 2GP3A 4CEYC 1C28A 2CWMA 4ES9A 3IPVA 5JSOA 3KF5A 5FCCA 4IV1C 4Q8KA 5FZ1A 3TRSB 1PMJX 3V56A 1LULA 3NNGA 4IE5A 1CGPA 3KB5A 2KXLA 5H9RA 4W8JA 2ZHMA 1VRBA 2P5BA 2WA3A 4RA0A 4AE2A 1W04A 1R1A1 2ZEXA 5FZHA 5H9QA 4CDUA 2HWB3 1UPIA 3TN93 4JQTA 2P17A 4R8HA 3PUQA 4XF4A 4Y5Z0 1W6QB 3MV11 3OY8A 2VNRA 1OFNA 4QD2A 3M3IA 2V5DA 2JIGA 1FNZA 3ROUA 2NYYA 1QJX2 1KJRA 4UFHA 3RG0A 3UGFA 1WWYA 5T54A 4BLJA 3OPWA 1PIV2 4UFJA 5IAXA 3VBUC 5A1FA 1MPXA 3E6CC 4YZ4A 3HBKA 1K5JA 2RE9A 2HWF1 1HRV1 2WZR3 1NLRA 3MLKA 1LGCA 4Q4W3 5IK5A 1FMD2 4YGDA 4TWTA 5IFTA 1QOTA 2WZPP 4LUKA 4PLOA 1S55A 2FZ1A 2HYXA 2Y6LA 5FRAA 4E4SA 4CSWA 1PMHX 3IT8A 3QACA 4HN0A 1NA1B 2DCKA 2QUOA 2VQAA 1BEV3 1KITA 5LCWL 3NNFA 4QPGC 1ULCA 4HZFA 4RQPC 5AC91 1G9AA 2FDHA 3RMXA 2H6CA 1V6MA 3Q8FA 1S0FA 3N9PA 1YFWA 1ZZ8A 5CYYA 5CFDB 4IE7A 1RXGA 1CAVB 3ZR6A 2W5FA 4TZDA 2GDFA 2LW8A 4MUVA 3JBG3 1W6NB 4F7ZA 1UYXA 5J36A 1WCKA 2JB4A 4G3YC 1BQPA 3G6JB 1WUVA 5FAXA 3SKVA 2MNGA 4KG8A 3NJVA 2E63A 4OULA 5LK7B 2WQ8A 1QJZA 4RHV2 5CNAA 4CUCA 2EVXA 3NWKA 4NRMA 1PX4A 1UYYA 3N9LA 4XJ8A 4IV3C 2VW0A 1IPSA 2Y6GA 3KLSA 3D82A 2GH2A 1W2AX 5C3RA 3AKPA 1BEV2 2YMZA 4MGSA 4XTMA 3DXTA 4Q0QA 2EF6A 3CHXA 1MZFA 3I2DA 3VBFC 2ARAA 4FOYA 4IV3B 2QE3A 1LESA 2DVDA 3H8OA 3KD4A 2QNKA 4XQ4A 4IV3A 2RG4A 3QD6A 2DU0A 3T09A 1AR83 2YG0A 1DIWA 1DDLA 4N43A 4HBNA 4XABA 1QJX3 5I0DA 3AYAA 3GGLA 4YWAA 1UU4A 1LEMA 3ACHA 3OBRA 3AZVA 3ZSLA 2BOJA 5HCAA 4EZ4A 2JDUA 3H50A 5CB7A 1CAUA 2R043 5D1IA 3T1LA 1W6MA 5FZMA 4GZ9A 2PHTA 3C8XA 1GOFA 2NMNA 2P6CA 2IFRA 4DFSA 2OX0A 1MS9A 3THDA 5FXWA 5T5LA 3S5AA 1GZWA 1WW7A 1OMIA 1WMXA 1HQNA 2RR12 4Q4V1 1SPPB 4D6QA 1HN1A 4BB3A 1U12A 1MS1A 1PM7A 3MIHA 4FP2A 1MEC1 4GULA 1YFYA 3LSEA 5IATA 1O4ZA 5JZGB 3IM0A 2ZGMA 4MV2A 2PTMA 2UURA 1COV1 1XYPA 3POWA 2DWRA 4B4RA 5CU1A 1BBT1 3V65A 2HBTA 4B1LA 2A3WA 3O0XA 3RPQA 2XG3A 4LO6B 2BDRA 3VBRA 3ZLIA 5J37A 2X8KA 3OGGA 5GLTA 2KR2A 4D94A 2HWE1 4GKYA 5FUPA 1HX6A 1W90A 3DECA 4X8PA 1UN1A 4XFBA 3UJQA 3WF0A 5LRRA 1LB2A 5FYCA 4G9SB 1UWWA 2A6WA 2ZX0A 4CDWA 3D6EA 4IGOA 2GNBA 4B1MA 4YRDA 1QU0A 2LRPA 3SH5A 3CNAA 1RJ7A 3BKZA 2DVAA 3T2TA 4CUAA 3AP4A 5FYHA 4CZSA 3MF9A 5FZAA 1N3PA 2GNMA 1K3IA 2PHWA 3M2MA 1YQ5A 3JUUA 1FI2A 5EV7A 3R4DB 5IK7A 1QXJA 1MEC3 4UOJA 2PLV1 4KWLA 5F2WA 5KHGA 1CZVA 1JMUB 3UKVA 1ND2A 4YW6A 4YSFA 5J3UA 3EHKA 4FPCA 3ZYFA 2AR6A 3O0WA 4RR3C 5FZGA 5A3OA 4AGVA 5C71A 1CESA 1ZRIA 3JB8A 1C4RA 1RHI3 4O61A 5F5CA 4CCNA 3W5NA 2HWC1 3WW1A 4WM8B 4QPYA 4Z07A 4XIOA 4BH9A 2VNGA 4CDXA 2WA4A 1LGBA 1ZRFA 4FTEA 2ZABA 4PHZA 4JGZB 1G7YA 4HG6B 1OF3A 4XQDA 3UGHA 3S7EA 4AWDA 1VBA2 1Z7S1 1UU6A 1WLDA 4N90A 3H8UA 1R64A 1REFA 1HQLA 3SEPA 4JV4A 5FY0A 4UYBA 1DLLA 1RUJ1 3POGA 2DV9A 4AR2A 5IVBA 4I0WB 1FMD1 2ZPXA 3VBRC 5A33B 3OJBA 4YZ1A 1UOGA 1VRH2 4Q4X2 4OI2A 1YJKA 4M3CA 1ULDA 3AZYA 5BNOB 1H8TA 1QH7A 1VBB1 3IDBB 1OPOA 1LNSA 3POYA 4HPKB 4PBOA 1J58A 2EIEA 4HANA 3GJAA 3W20A 1JYNA 1C1LA 1ZZ7A 5JWPA 3WUCA 1JYCA 4B7KA 3TNPB 1MQTC 3LEKA 1RB8G 5I91A 3WUDA 2W46A 3VBOC 1V6NA 1O4YA 4QHZA 1ONAA 2BU9A 4MOAA 3VDBA 4K20A 2W9XA 5APAA 1YHFA 3VD7A 1VRH3 2AEZA 1VLNA 5FIXA 3W21A 2VVFA 3ZFFB 4J1XA 1JYTA 5A3WA 3DYMA 1QOSA 2YFZA 2SBAA 3RWNA 1GNZA 1VAMA 4UW4A 4ARYA 5C9AB 3GCWA 3WD5A 3VBOA 2YHJA 4JTNA 2DTWA 3MICA 1JS9A 1NKGA 3WG4A 2OPWA 2BUKA 3IWZA 1CAVA 4MX3A 3E5QA 2WNVB 3EB7A 3ZYJB 1SBEA 2VG9A 2OIIA 1NCQA 3ZIXA 4AGRA 4NO4A 1CX4A 4OUEA 4CU8A 5FY1A 3BTXA 2ZCWA 3VBFA 2PHRA 3QCWA 5FZCA 1QQP1 4P5HA 5F37A 2VVDA 2WR9A 1FOD1 4A2UA 3PTRB 3HEIA 2X10A 3M3QA 3KS7A 5ACA1 3WDYA 3VHNA 5LA0A 5A3MA 4YM3A 1JHNA 4XUTA 3ZFGA 3NL1A 5IVVA 3PVEA 3SMHA 1H0BA 5IYYA 3GJBA 1G9DA 4XE9A 3OY8B 1E5SA 1VBD3 5G04L 3U4XA 1UYPA 3GCXA 1CZSA 2UWCA 4UWDA 4ZZ8A 4XZPA 4Z92B 5FUIA 3EJKA 5IVYA 2G9FA 5A3PA 1XYOA 5FZBA 3OEAA 4L8QA 3WT3A 1IKQA 1W6NA 5C8WA 3N35A 2JKXA 2XJSA 4ISRA 1HQWA 3MBWA 3ZYIB 1NZCA 4CDUB 2OKXA 4AEKA 3WQ1A 1HN0A 4M00A 3RZGA 3WNMA 2C24A 3R4SA 1ZYBA 3ZDSA 1YFXA 5T5OA 4R4ZA 2HLEA 1CZTA 2B5HA 3LZZA 2GU9A 3N9NA 4QXBA 1RUE2 3H1WA 4Q4W1 4X8NA 3VBHA 4K1YA 4MADA 4RFT0 1DQ6A 1QEXA 2QQMA 5CBLA 1WD3A 1X50A 3L2HA 5IAVA 4AFBA 4IDZA 2F6BA 1EY2A 1COV2 3B9IA 3F2ZA 3KVAA 3M3OA 2ZX2A 4WVVA 5ABJB 3KGZA 4JGYB 2A73B 3UNPA 1WCQA 1US2A 5HXMA 1PK6B 1N1VA 1WCSA 2PHFA 3MV01 1D0GA 2A7AA 2QQVA 2QDNA 2WAOA 1T6BX 4WM7C 1K5MB 4COZA 2X5IB 2VZPA 1UZZA 1RHI2 2NPIA 2WFF1 4K1ZA 4ZU4A 2FQPA 2ZX1A 1MS4A 1VBE2 4L9BA 2X09A 1D0HA 3VHPA 3WCSA 1LHWA 1JUIA 3INAA 4UFKA 5FBZA 4PI0A 3B7MA 1O4TA 3ZN6A 4COVA 2VGDA 2W0XA 3A0NA 1ZBE2 3AMNA 4PT6A 1HRI3 1UO9A 4W4ZA 5LASA 3NNMA 4HK8A 1S2BA 1B35B 2VZVA 4ZS2A 1O8SA 3JB4C 3P1IA 1XRUA 2XVGA 4CDQC 4CCLA 4FSJA 1PZ8A 5FP3A 1R1ZA 5A7WA 1ND2C 1RUD3 3VDDA 4FPYA 1K5MC 2FCVA 4WM7B 1MS8A 2Z2SB 2JG8C 1ULGA 2WNOA 3JD72 2ILMA 5FMOL 2CNAA 3VGIA 4JGYC 2W91A 3RS6A 5L36A 2RV9A 3PJYA 5DABA 2IFWA 1PNGA 4NR1A 3I3MA 5BUVA 1SCRA 1WLTA 5LRSA 4YW3A 5CG9A 1V9U1 1VPHA 4Q4Y2 4MGKE 4UXAA 1JODA 3AKQA 4YVSB 5FYIA 3N7LA 2E7TA 3RFRA 2Z69A 4IESA 2WAAA 2ATFA 3OEBA 2CDPA 2H0BA 3PUAA 2ET1A 4OFGA 3OYWB 3J8F1 5AFEA 4KI5M 2MEV2 2Q1MA 4QGMA 4CDQB 2LTNA 1GV9A 2BP6A 1RUC2 1CR7A 2Y38A 4MSVA 1WMEA 4DZGA 3ILRA 3THPA 5LZ6A 5JI9A 3DUIA 1C57A 4JVAA 2A6VA 3FX3A 1BMV2 2AUYA 3ZFFA 5AC93 4Q4X1 1JZ2A 2R16A 4WVMB 5CADA 2EXIA 4AEMA 1OLQA 3NNJA 3NAPA 2DUOA 1RUNA 2ES3A 1ZZBA 4FO9A 4YFWA 2R042 5GLZA 4NPLA 1ZX5A 4ITCA 2VZUA 3BTAA 4QKBA 1Q5OA 1FX5A 4UBHA 4IEUA 2FCTA 2AH2A 4FFFA 1V9U3 2WUHA 1DBNA 2TUNA 3E5XA 3W9AA 2ZKNA 5HBAA 2WINB 4BOWA 4WVWA 5C8CA 4KQ7A 2W1UA 1AL22 5E6HA 1S0BA 1GUIA 2H0VA 3I8TA 3HMYA 4RFRB 4E2SA 3VZNA 1DYOA 1NCRA 3OGSA 1MS5A 2RS33 4JX0A 5E16A 5FPXA 1X9PA 1LR5A 3IAQA 2XHNA 5FO9B 3OGRA 5IK8A 3FLPA 4XILA 4LLFA 1NA1A 2IXIA 1IS6A 3UJOA 4ET7A 1H1MA 3FL7A 5FZ0A 1HB3A 4RN5A 3AVSA 3ZSMA 4COYA 1EV11 2VOTA 1WLWA 4I0AA 2AC1A 3VHRA 2D3PA 4JRLA 2FDFA 3UKTA 1EUTA 1RUF2 3POSA 1HKDA 3GNEA 3PUSA 3POJA 5FKCA 1OUXA 1UCXA 2D3SA 1FATA 3DGTA 3WNXA 2WFPA 1K12A 2YBSA 3ZXLA 3T2OA 1UX7A 3A4UA 1SHWB 1JZ3A 2YU2A 4QX3A 1ASJ3 2VUJA 3GBFA 1UQXA 4LQRA 2PELA 4LK6A 2PN5A 3H3ZA 2CDOA 3NO8A 1UIKA 4CRQA 4GH4A 3FWEA 4Z2AA 2Q0AA 4HL0A 1R1A2 3HN1A 4L92A 4BE3A 3S5QA 2D6PA 4D7YA 1OT5A 5T5PA 5L9VA 1F31A 4KMQA 3VBRB 1PO13 1DQ0A 4JDMA 5FXVA 4LTAA 1MACA 2E26A 2VMCA 4BQXA 2D93A 4GH4C 2KA3A 3BN6A 5LEKA 3HPNA 1OQ1A 3I2HA 4URTA 5DAQA 4CEYA 2WRAA 3ZSJA 5D8AC 1AYM2 5JCTA 2ZHKA 1OVSA 1VB4A 4LIVA 3KVBA 4GB31 3TBDA 4J6GA 4E8DA 2QQLA 3M1HA 1X33A 1XE0A 2JDZA 3BODA 3RVHA 3CZUA 2WJSA 3ZXFA 4LJHA 4A3ZA 4QX7A 4BQ3A 1ND3C 1HV0A 4GWIA 4AW7A 2A70A 4LOTA 2HWB2 2Y6FA 1ULPA 3R05A 2XB6C 1HB1A 3RWKX 1I3HA 3AX4A 2O1QA 1UXXX 1JW6A 4Y26A 2TEPA 3IB3A 2L9LA 1HDKA 3J26N 5FJHA 2GMMA 3T0AA 2WFF2 2B9VA 3V64A 5C33A 5CISA 2NP0A 3ZFGB 1R081 1QF3A 3ON7A 2VQ0A 4SLIA 5B2GB 3J7LA 3JQWA 3P3NA 2DCYA 1TQ5A 1PGSA 1XSRA 1RUG3 4BHPA 2RDRA 2RM22 2OT7A 2VAUA 4IQPA 3L9JT 1HLCA 1NQJA 3OUJA 4EN0A 3AL6A 1H2MA 2E51A 1GP4A 2VCCA 4GJZA 3IDEA 4PIYA 4L11A 3NV3A 2GP5A 2Y8KA 3CJXA 4HSJA 1T2XA 4RHV1 5FPVA 4FTSA 1OI6A 3BALA 1AXKA 1JI6A 3PUIA 4YM2A 5KXEA 2ZX3A 4I2OA 4LEJA 1O6UA 4JGZC 3RYPA 1UOBA 4WZFA 2J42A 1E5HA 5IHRA 3T2PA 1BJQA 1BYHA 1O91A 2LS6A 2V73A 5CIRA 3W59A 4Q0SA 5KHJA 4Q4Y1 1W28A 5KXBA 1UX6A 5FZEA 5JPMB 3I97A 4Q1PA 5FLIA 3ZFEA 4BU2A 3NAPB 1DYPA 3AZWA 5IVFA 5JI7A 2CAVA 3MFCA 2VW2A 3DL3A 4UT5A 3V0BA 2RDQA 5KXCA 1I5PA 1V6LA 4PBPA 4XUPA 4LO7A 4UFIA 5GM0A 2XVKA 1DGRN 3KF3A 2WLQA 4Y1XA 2A3XA 4UBGA 3WSOA 1FOD3 2TBVA 2W1WA 3EQEA 5IFPA 5F3CA 4UFLA 1YJLA 3OTFA 4R9BA 1FNYA 1AR63 2ZXQA 5E8AA 2VBPA 3GHMA 5FJKA 5T52A 3SEEA 3TNQA 3K51A 4OHVA 3WINE 5JAXA 1OLMA 4YG0A 4FPEA 4Q4V2 5D21A 3JU9A 5FK7A 4IW3A 1IPJA 3JBG1 1RUI1 4CXWA 2EAKA 4L97A 3KWVA 1U5IA 4JGYA 3WNPA 2DVGA 3AB0A 4XYXA 3IMNA 5IK4A 4QM9A 1RUD1 4CUGA 1Q8OA 4QKFA 3CKHA 5I0TA 2CGNA 2NQYA 3WW3A 2R062 1UKGA 4ATEA 5LB6A 3BU0A 4I0BA 4M3CB 3KCCA 2ZEYA 5EHDA 1S0IA 3KT1A 1ULEA 3LOBA 1OURA 2HWD2 4EN9B 5JMOA 5EIYB 2VCBA 4I09A 1W6QA 4PCRA 5DDJ3 2QZ3A 3PU8A 5EYXA 5T5JA 2YU1A 1YIFA 4H3WA 5F6KA 1IOAA 3UL2A 4CPBA 1WBLA 5FPUA 2QVSB 2JD9A 1YLLA 1JZ5A 5J98B 4QAWA 1XU2A 3CMGA 4F8AA 3VKLA 3LDBA 2Q1ZB 5FZ7A 4IEOA 1PM4A 4C0BA 3G7DA 1KS4A 2VVEA 4A6OA 1WKYA 2ZEWA 4YZ5A 2AGSA 4A3XA 4Q0VA 5F2SA 2PLV3 2BV4A 3RYRA 2VBBA 1ULFA 1B09A 3BGAA 1XNAA 3CL1A 3OB8A 1SBDA 4RGAA 3VD3A 2QQOA 2Z4FA 2Z42A 2RMU3 2XHKA 3CF6E 4NHYA 4AHYA 5FYTA 3LCPA 1LCLA 3LGRA 1J83A 1VBB2 2ARCA 4JGZA 4GXLA 3VBHB 1CAXA 2VC9A 3GBGA 5L19A 3H7JA 3LA3A 1F4AA 5C9AC 2D6MA 2IXLA 5C4WB 2JDNA 2Y64A 1XYNA 4XXPA 1W8NA 5A7NA 3VLBB 4ZS3A 1G9FA 3TYJA 1ULOA 4FAGA 2Y0IA 1MVEA 3B01A 4YW7A 2GAUA 1RGSA 3B00A 3JQXA 1GZWB 2BGCA 2BJSA 4OYUA 4CCDA 1TG7A 2PYTA 4Q2FA 1AYM1 3CJIB 4W65A 3VBSC 3LSDA 2WDBA 1UL9A 3WOGA 2ZGOA 4A44A 3T4VA 2EIGA 2CTVA 4S2HA 3RZHA 1BK0A 1CPMA 1WBFA 2VZSA 3LAGA 3MYXA 2HH9A 4GMP0 2ARXA 2PAMA 5EZWA 3THTA 5BNNC 1QWRA 1POV0 1W8WA 2XQRA 4AEDA 3SISA 2EAAA 4Y5SA 4NWVA 4AHXA 1E57A 5JR2A 1FOD2 1QJY2 1VJ2A 2IVIB 1W9YA 3AYDA 1PZ7A 4NRQA 2D3RA 4QPGB 4XHBA 3S30A 4ASKA 5K0UC 1HXS1 2P37A 1W6OA 2VZQA 4N53C 2P3IA 4QGNA 1ZA4A 3QBQA 2QTWB 3R4UA 4OMCA 5BNPB 1GWLA 4YLZA 1XOYA 3DYPA 3U78A 4K9SA 1A78A 5B4NA 2Y34A 1AR71 3KHCA 2CL2A 2PHLA 1Y7BA 1ZZCA 4ASLA 2ERFA 4V2VA 1EAH1 1AYM3 5DDJ2 3DV8A 5CFCC 2A5ZA 4Y20A 2OXBA 2J7MA 5J1XA 3LA7A 1AYN3 4LULA 1L7LA 4AK3A 2PAKA 4UAPA 2Q8OA 3GZTB 3ACGA 5CAZA 2J1VA 1J3PA 3HNMA 4EWEA 1OUSA 1YNAA 2VMHA 5FMDA 2WN3A 4RGKA 1SLAA 2ENRA 3J4UH 4O65A 1ZZ9A 2BZDA 4E2QA 1EAH3 3MW4A 4XAAA 4Z1VA 5F5IA 2Y0OA 5BNNB 3HAGA 5FXZA 1XB9A 5JIAA 5GLUA 2R073 3DXUA 4JKKA 5FO7B 1S2KA 4N7UA 4FT8A 1HB4A 1PX3A 2NLRA 1QMJA 3WZ1A 1AL0G 3SCFA 3HD8B 3Q8BA 4N7IA 1YEWA 3T4HB 3VHOA 1KDMA 1LU2A 3MEPA 5IWFA 5DZGA 4RQPA 1AR62 4GWJA 4ZKTB 2YGMA 3WR0A 3ZN5A 4LPLA 5E89A 3FFZA 4CE8A 4HONA 4PQ9A 2XWJB 2J1SA 3PMSA 4WBBA 1W06A 4RS5B 4O7XA 3AXEA 5KXDA 3RZJA 3HQRA 4AZZA 3JCIA 4KU7A 1YWKA 1PGW1 2ZGKA 5H9SA 4BMEA 1ND3A 3J8F3 4KU8A 3E1F1 1ZBE1 4O9EA 5FZKA 1RUI2 2DBNA 1JOPA 4BXSV 1E5RA 2GC0A 2G9ZA 4FPGA 1SQ4A 1RUD2 2BERA 4GAZA 5HV4A 4P9WA 1K5MA 4XBLA 2QQPA 2DFBA 4C0HA 3Q9OA 3IDCB 5JIUA 4OUSA 3WDVA 1JN2P 2BTVC 4QXCA 3NV1A 1ZBE3 2KD7A 4NE9A 3MDPA 3OUHA 1QKQA 1S1AA 1RVF2 4HOOA 4BYYA 4EZHA 3KMHA 5LA2A 1JUHA 2VBDA 1WD4A 4XFGA 2BBVA 1V9U2 1FYUA 1S0CA 2I2SA 4DUXA 4PDWC 3NJZA 3U75A 4BQ1A 1C5IA 4IERA 2ZBJA 5IT6A 2C4XA 1S0JA 1PO11 4RQPB 3O1RA 2WO3A 1I9RA 1HJFA 1AXZA 1G8WA 5A7PA 3VV1A 1KXGA 5JOXA 2R1BA 4IE6A 1COV3 1UMZA 4ISQA 1U0AA 3O1TA 3RZMA 4XJZA 4Q4V3 4EROA 1IKPA 3HN3A 1Q3EA 1DLCA 2R49A 3VD9A 3RSJA 4CCCA 3T08A 3BVCA 4ZXEA 5ABJA 3V0AB 2ZAHA 4K8RB 5EJ1B 4A42A 1XQNA 1YFUA 3GALA 2WZEA 1G6NA 2R041 4FOQA 1ACCA 3BPSA 3K4AA 3CLPA 4P08A 1GYKA 2Q5TA 4AHZA 1LHVA 3KQRA 2WNUC 4MH0E 2LROA 3LF7A 4R9DA 3BUCA 2JECA 1FAYA 1ZVFA 2P3KA 4P9XA 5SV5A 4P02B 2BWAA 4XUNA 4BM8A 1UZWA 4R4XA 4AVSA 2Y6JA 3N9OA 4QU2A 1STMA 1MR5A 2AEYA 2JEMA 2R071 2YZ4A 3DKQA 4IGQA 1DFQA 4JZRA 5JOZA 2OYZA 4Q4X3 2DDUA 1NYWA 2JG9B 3WP3A 1VBC2 2OQ6A 1O59A 4HKWA 2VW1A 3VZJA 4QPIA 4CP0A 2VH9A 4PIZA 5BY5A 2RS31 3I3EA 1LHNA 3WNKA 3MLJA 3PU3A 2XPJA 1ZBA2 5FLHA 1QGLA 5FZOA 4HT1T 1OSGA 1R093 5DUXA 3UYJA 3NAPC 4FFHA 1EV12 1DG6A 2HYKA 1ND3B 1VBE3 1S0EA 3ORJA 1RVF3 1VBA3 3HQUA 1YC61 1FT9A 5FWJA 5IVCA 1O3TA 3VBUB 1LOBA 4PI2A 4NIAA 2JENA 3VZLA 2D40A 4UFMA 1DYKA 3N4MA 3U10A 1JYVA 2VPVA 2VOXA 3LE0A 4XAEA 4XURA 5CKMA 3J7MA 5I93A 3DEMA 5GZGA 3UT0A 5FDBA 1OC1A 1CJDA 3B3QE 1X8MA 1A3KA 3O14A 5A3NA 1LOFA 3ACFA 2GSYA 1XSQA 5A33A 2JDYA 2WWJA 2RJLA 4KWUA 2F4PA 3OPZA 1ZRDA 3UKNA 4EN7B 2FMYA 1CQ9A 1WMDA 4E27A 5A1LA 3RGBA 5FYMA 4AAPA 3WVJA 4CXYA 4NIDA 2B4KA 1RUF1 4M4PA 3AMHA 3ECQA 1LOFC 1UF2C 2RMU1 4CDUC 4MYEA 4JDNA 2WO2A 2DUQA 4MZUA 4EQVA 3P3PA 4DXTA 1WW5A 4KWKA 1LOCA 3WV6A 2D43A 5LY1A 3LDKA 5F9TA 1PVC2 1J1TA 2VZ3A 4YW4A 5KWRA 2W95A 4V2WA 2JE7A 3UESA 5JSPA 5JUVA 5GLWA 3IMMA 5FLJA 3V0AA 2YC0A 4B29A 1LENA 4OI1A 1RMU3 1VMFA 1XNTA 3Q8CA 3BOPA 1KEXA 3BIWE 5K0UB 4LBJA 2BVBA 2PXJA 4KL1A 4FPKA 2CV6A 3ZFEC 1ASJ2 1AYN2 1XNKA 2PQSA 4I01A 4UW6A 2FCUA 1F2NA 4D3WA 3ZXAC 5CFCA 2C5DA 4BQ5A 1DGWX 5HCFA 5EFUA 5C7GA 4P9YA 2WFF3 3M3EA 4H55A 1H1AA 2K46A 5K7PA 2G1MA 1AR92 2WNVC 2QZ2A 3GHNA 1RUG1 3WG2A 3GXUA 4GB32 3AYEA 4YVWC 3A7QA 1D4VB 4Y24A 3WF3A 2AENA 4N53A 5EQUA 4DRVA 4DPNA 3O1MA 1N1TA 4IEYA 1GZCA 2B45X 1US3A 4ZU5A 1LOEA 2JIJA 1KGYA 2HEWF 1UZYA 4KGQA 1VIWB 1NCRC 4QXHA 2G19A 1W2TA 3TEZA 1HB2A 4B7EA 3SLIA 1CAWB 3WNNA 3NNLA 2DCJA 5JSRA 3T2QA 3IIIA 1R082 2R32A 5FPZA 3IZOA 2X5IA 2G9GA 2Q8CA 2FDGA 1PO12 1AL23 4PF5A 4QQHA 2GZWA 4O9GA 3GZUC 3K46A 5HPOA 3MFAA 4DY5A 3JXSA 1GNYA 2OQ7A 4XFAA 2F4LA 1OHFA 1W3XA 2VM9A 4XDOA 4F83A 4NN0A 3VKFC 5A70A 5LBFA 1VE0A 2JB8A 3U11A 1A34A 3SKJE 5HV0A 3C7FA 3WNOA 4BLIA 1RXFA 3HVDA 4FFIA 4RGGA 3K2OA 4P9JA 1DGRA 2EXJA 1N1SA 2WZ8A 5DAWA 2BPA2 3PNAA 3C2UA 4D7SA 1Z0HA 2OS2A 3E6DA 5DAXA 5A32B 4BQYA 1XE7A 1WW4A 2WT0A 2MHFA 1SLLA 4YW2A 1S4CA 4AI0A 3JBG2 2JG8B 4KNCA 2QFEA 2HJIA 3FLRA 4LE3A 3SH3A 2WL1A 1CIWA 5FYBA 5JXJA 1S0GA 5FV3A 3WQ7A 1JYWA 1O8PA 5DG2A 1YI7A 3ZFFC 4XOGA 1ZRRA 4B8EA 4XXAA 2E7QA 3VB9A 4QQ2A 1X36A 4Q27A 3H1MA 3VDAA 5FKBA 1HW5A 1W99A 1J3RA 4K40A 4YNIA 3VBOB 5IJRA 5C6CA 5CA6A 2R6QA 2UWBA 2BFUS 4EN6B 2IC1A 3GM8A 2R1DA 4KBBA 4MXWB 5CEHA 2NM1A 1UW8A 4E4HA 3RQ0A 1WCDJ 5C3PA 4CCOA 3S57A 2RS32 2X5IC 3N9MA 1A8DA 1ZBA1 4R9CA 3FMGA 4Z2WA 1O3SA 1JOBA 4R9AA 1LAJA 1RJ8A 4XDPA 5ABJC 4LO5B 1IGOA 1GR3A 2YC2A 2ZX4A 1Z7S3 4K6BA 3RNSA 3CBNA 5F5QA 2HWF2 1H2LA 2VE1A 1CVNA 1F4HA 2R0HA 4IEZA 5F1RA 2P4EA 1GBGA 2XJVA 4NOTA 2GNDA 1H9WA 4GB33 1BVVA 4YW1A 3DPRB 4AVCA 2YY1A 4YVWA 4CYDA 5FZFA 3A22A 4ZZ5A 2HWC3 4HPKA 1UPSA 2ZAAA 2R061 4FOVA 4ASMB 5GALA 1GP6A 5AC92 3MIBA 4JDOA 5L9RA 2RHPA 1CWPA 1UY0A 4R52A 4OHWA 1U5ZA 5FK8A 2ZGQA 3NKTA 4AOCA 4COWA 3RJRA 4C90A 4QKNA 5JZGC 1RUC3 4JTOA 1AR73 3O7OA 2ZZJA 5BNPC 4QPIC 4YZ3A 5LATA 1SBFA 4QX1A 2Q30A 2GMPA 4MO3M 4XUQA 1ALYA 3WX5A 1V6IA 5BNQA 3A21A 1O3QA 3TOJA 2WS93 2KM2A 5AFBA 2AREA 1DF0A 3ZM8A 2VECA 2XXZA 1HRV2 5FPAA 2RS52 4ES8A 3POEA 3H42B 3ZXEA 4FP3A 4XEZA 3T3YA 2Y26A 4MLOA 3ZN6B 4Z8BA 5CFDA 2EA7A 5FXXA 5BNPA 4WZCA 2XBO2 2D6LX 1EPWA 2W52A 3FFQA 2UY9A 3IIAA 2W47A 3ZVXA 1BXHA 3AFKA 3WXPA 1IZ3A 1LJ7A 2WNUB 1W8TA 4Y1ZA 1K42A 1H2NA 1ENRA 2XWBB 4JAAA 4FI9A 4QKDA 4QX2A 4TLGA 4I30A 3MHZA 4YM1A 1GICA 3U37A 5DMYA 2W68A 3LQCA 1I5ZA 2QQWA 3DKWA 4Y4YA 3I2IA 3USSA 4M0HA 3HQXA 1N3OA 4BPZA 1SLCA 3I59A 1Y9MA 2VOKA 3NJXA 4WM8A 3I3QA 3KV5A 1LKNA 4K3UA 2ET7A 4ORFA 4PJYA 5FPLA 1PO23 5EWSA 2R7EB 1J59A 4TTGA 1AR72 3NW4A 3VKMA 4LLOA 1O3RA 1O7FA 4DNYA 3OD4A 4IEWA 1RUG2 5FYUA 4CU6A 2PHXA 4LBQA 2ID4A 2RR13 5B4XA 1EPZA 1YO8A 3HJRA 4LHNA 3VKOA 4PDWB 5J09A 1AF9A 4ZPIA 5C70A 4IE4A 4IEVA 4Y4RA 2IVJA 2RR11 3ETPA 4DXRA 1V00A 3RI9A 1UIJA 1ODNA 3ZKUA 2VULA 3U14A 2W1SA 5BPXA 4C1XA 4A7YA 2A1XA 3ATGA 4XMAA 1QNWA 2B42B 2VJXA 4AI3A 3DCQA 1S2EA 3ZSKA 3ME2A 4D6RA 5C8CC 2P34A 4XIKA 4HK9A 3HNBM 1LHOA 1JH5A 5CFDC 1Q43A 2JICA 3QH6A 5A3LA 4M3CE 4RL7A 2V09A 3MF6A 4RR3A 4CVUA 1J1LA 3AXDA 1HV1A 4S2DA 4UF0A 4MGTA 1YCIA 4X6RB 3UK9A 4CCKA 5DDJ1 2JDAA 4M01A 4Q8LA 1Q8SA 1TZOA 1W0PA 2ZGRA 4LO8A 4HVOA 1DQ4A 5ANNA 1ENXA 2RS53 4MGYE 3POFA 1DZRA 3RJ2X 1YYNA 2ZA9A 1SCSA 1VP6A 2DCZA 2EIBA 4LOSA 4AEDB 5C3QA 3N7MA 2IWGB 4XFHA 2P6HA 2ZOEB 2A6YA 2XH6A 2XJQA 4IXLA 4H2AA 3VL8A 5IW0A 2WWUA 2JE8A 1N1YA 4CA9A 4LNVA 1REEA 2OZJA 4JHZA 1IHMA 4WM7A 5KHIA 2RJKA 1C1FA 1CJPA 3NRUA 3MIEA 4ONUA 2VQUA 4AQTA 5E88A 4DEQA 1RUH3 3OBZA 5A7QA 3TEYA 3VDCA 3M70A 4LHLA 4FPHA 4IEPA 3OSDA 4HVRA 4LXLA 1XJAA 1JZ8A 1GKBA 1MVQA 4QDQA 1NE6A 1RUH2 4LBNA 4SBVA 3GF6A 1ENQA 2HWC2 1UOFA 4L2NA 4IV1B 4D8MA 1GP5A 3RRDA 1L7RA 4UW3A 1NY71 4YM0A 4I3PA 2H6BA 1TMF2 2JJ6A 2J22A 2VTFA 4DUVA 1POV1 1Q8PA 1QOOA 2JDKA 3OYWA 4S2GA 3VDDC 1VBA1 1Z7S2 5JOWA 4MHRA 1AHSA 3K3NA 4V1PA 5LEJA 1GZTA 4QX0A 5IVJA 5FZ8A 1TME3 1V0AA 3THCA 1YXWA 1R083 2GN3A 3ES4A 4DS0A 3Q8EA 4ZY9A 1FMD3 4LBLA 4B3NA 3E97A 1PZ9A 3FUOA 3PVNA 4W6WA 5KR7A 1TME2 2UYAA 4P9GA 4XF9A 1PIV3 5L9BA 4YG3A 2Y60A 5C4WC 1GQGA 1VRH1 1C5HA 2ORXA 5A7WB 3CU7A 4LKEA 2C9AA 3ELNA 4LITA 2B46X 4Q26A 1TMF3 1ZA7A 2K2SA 3I2KA 3LPFA 4W6YA 2J1TA 5GLVA 2DVFA 1W39A 1RVF1 1YUDA 2XLFA 5TSWA 4CU9A 5GZCA 5F8PA 1LHUA 5DZEA 5FQ0B 5K9YA 5DQ0A 2PMWB 1H8TB 1UXZA 5J96B 1D4M3 2ETEA 1AVBA 3ZYPA 1E5IA 2DU1A 1Q8VA 2XR4A 2RDNA 3MUZ1 4AF9A 2XLGA 4B4QA 3ZFGC 4QDRA
chains in the Genus database with same CATH topology
1RUJ2 2P2KA 4BA6A 1VBD1 3OBTA 2O8OA 3VN4A 1HIXA 2OPKA 2GALA 4KH9A 5JVVA 1KS5A 2VUAA 5JDBA 1BZWA 1U5XA 5ACA3 4TYSA 2D5FA 3KGLA 4NHKA 4LO4B 3VZKA 3M8LA 1WGPA 4HLTA 2YGLA 3QOPA 4E4ZA 4J1WA 5D8AB 4M0NA 2XKPA 2VOVA 2X53S 2LALA 4EWDA 1NCQB 2A75A 3OCPA 2FBEA 1TNRA 1KFUL 5AVPA 1CAXB 3PTYA 4FOWA 2DFCA 3PMEA 2XBO3 2IXHA 4XJ9A 2R30A 2BNMA 2I74A 1YIPA 3D0JA 4K8FA 1SLTA 3UV9A 4RD7A 3FUQA 5GJ6A 1H9PA 3SNMA 4G4FA 4EV0A 1F8VA 1JTZX 1NG0A 4XJUA 5JZGA 2EXKA 3LKJA 3B02A 3AMMA 1OFSA 5FOJB 1QY4A 1XXNA 1AXYA 4FQZA 4WV8A 4YYOA 1PO22 4N9IA 1DQ1A 2XJRA 1JOJA 4P9LA 1W6OB 5FOBB 4YVWB 3D5OA 3W58A 4HMZA 1QHDA 4YGEA 4HVQA 3MIGA 4FPLA 4H7LA 5I8SA 1OQDA 1AX2A 2GC1A 2D6OX 3VZMA 4JC1A 5HI0A 1H1IA 3B5LB 2VXRA 4U2AA 2CGPA 3OF1A 4XFIA 2OVUA 3VBUA 1BVP1 2B39A 4DQAA 2RMU2 2XGXA 4Q4W2 2WZR2 1AR91 4Y1UA 1ZZ6A 2ZGLA 1OD5A 3LOIA 4N43B 2XVLA 2GMEA 4XBNA 1XU1A 2IZWA 5AVAA 4QX5A 2D5HA 3O12A 5L7OC 3B94A 4NHLA 5T55A 1FPN1 4GMP3 2BNNA 2XL7A 1MS0A 1RHI1 3N36A 3MIDA 4BWOA 4EJRA 1XNCA 4XTPA 4GH4B 5EXOA 4XQWA 4OHYA 5FTTC 4AXOA 1AJKA 4AEJA 3HT1A 1F5JA 1RMU2 4B4PA 2BYVE 1T6GC 3ST7A 1KD7A 2VNOA 2WSVA 1D2SA 4CEYB 2ZGNA 4WVZA 2GC3A 4DRRA 3L2YA 1DHKB 4LUMA 3AMQA 1B35C 1DQ5A 1JBCA 1BCXA 5L7OB 4FPOB 4TSVA 2R0FA 4GA9A 4CDXB 2YDEA 3BU7A 5D8AA 4CEWC 1AL21 1PGL1 4OHXA 4N43C 3J8F2 4NHMA 3WDXA 3MW2A 2DYCA 1G9BA 2C1FA 1F9KA 1B35A 1RUC1 3R6SA 2JG9C 3KCYA 1HRV3 4KWJA 1KQRA 3WDUA 2CAUA 5I0UA 2K0GA 3FJSA 5DUWA 3I4IA 2D44A 4MGZE 2FZ2A 4XDQA 3MGUA 3KZ4C 3FZ3A 4QMAA 1ENSA 3MLLA 4XFCA 3ZXDA 3WHTA 3AP5A 4YFZA 1GLHA 3AFGA 3T1MA 4HKLA 1NCQC 2CGOA 3A0KA 1H30A 1REDA 2DCTA 1OOPB 4GWMA 4IETA 2E7AA 5FREA 3U07A 3CEWA 4BMBA 1UD1A 5L7OA 2NMOA 4Y20B 5BV6A 4CEWB 2UY8A 3ES1A 4QT6A 1AUYA 4AI1A 4MXVA 3FLTA 3I54A 2OA2A 2UWAA 4CDWC 2XJTA 4LBMA 3DPRA 1Y9QA 5DXDA 4XW3A 2JG9A 2JE9A 3KCXA 3ZPYA 5GZDA 3ZXJA 5BNOC 3FBYA 4DOUA 1AR93 3AJYA 2YYOA 4ZXKA 2WS92 4L99A 2Q4SA 4XFFA 3AP9A 4ATFA 1V6OA 5T3NA 3B9CA 5BNOA 3QH7A 4MXWA 4QHBA 1VB2A 1WW6A 4CDQA 3GYDA 3O0VA 3TN91 3FBMA 3TWIA 3HBZA 3BB6A 2A6XA 1N3QA 1I6XA 1OQEA 4N9HA 4P14A 2RS51 2A71A 4HETA 2HWF3 2WZR1 1QXPA 1MZ5A 2PHUA 4XETA 1RC6A 3B93A 4IEXA 2XJUA 4AI8A 2XBO1 1AR82 5K0UA 3CJIA 4DMIA 3CO2A 1VBB3 1PK6C 1H8TC 1MZ6A 4YVSC 5I8TA 2HWB1 2XUMA 3MPBA 4FAHA 1G86A 3D0SA 3WCRA 4FXKB 4JRAA 4P9IA 4KGGA 3EBRA 1V6JA 2E53A 3FHIB 4FXGB 3MW3A 3AK0A 4RHV3 5LK5A 3N3HA 4BZ4A 1ZNPA 4DINB 5CFCB 2RM21 3AM2A 1CD3G 1SLBA 1HXS3 1VAKA 1DZQA 5FQ0A 2XLAA 4YGCA 1RMU1 4Y22A 4LR4A 3RMYA 4K7JA 1Z78A 1PHMA 5KBFA 2D98A 1NQDA 1R092 3IBMA 5K8SA 1CN1A 3H9AA 3E5UA 1D4M1 2JD4A 3ZYRA 4AFAA 4BIFA 1VBC3 3SCGA 1C8M2 3HT2A 4KG0A 1QJU1 3ZO0B 3B69A 1GQHA 2CY6A 1JYIA 2WNEA 1RUH1 5DG1A 1VAVA 2DVBA 4TLFA 1O5UA 3WP4A 2HWD1 2YROA 1FPN3 4GMP1 3AMPA 1V70A 2Z79A 5F6LB 2DTYA 1NY72 1OKQA 2ZMKA 4LHKA 3AYCA 1RUI3 2ZKLA 4XBQA 1W6PB 3VL9A 3DN7A 1BBT3 4PIXA 4RS5A 3RI8A 5I0RA 1C8NA 3E6BA 1GFF2 3ZMNA 2ZACA 1PIV1 1POV3 4Y22B 1IS3A 5IUQA 2WNUA 3WY6A 3VBHC 3ETQA 3VKNA 1MQTA 3WDWA 2UYBA 2DF7A 5GZEA 1TME1 1M4WA 1QDCA 2PQQA 2W08A 4XJWA 1MQTB 5KC5A 1VR3A 4GWNA 3GBWA 3SCHA 3D4KA 3ZIWA 4AG4A 1HRI2 2NN8A 3ASIA 1Y3TA 2VMGA 5BNNA 1LGNA 4JQRA 2A3YA 5C9AA 1EV13 3VUOA 4AYUA 1TMF1 3X29B 2O8QA 5BXXA 3S0MA 1ZBA3 1PVC3 2RS11 3AJZA 3WLUA 3NV4A 1QJX1 3M7AA 3USUB 2ZGPA 2OUHA 1QH6A 3I7DA 5H9PA 3ZXKA 3KT4A 1LU1A 2HEYF 2WNVA 2QJVA 2YV8A 2ZMNA 1TNFA 2VMIA 1G9CA 2IXKA 4LBOA 1RUE3 4AVBA 4RS5C 4OHZA 2HKXA 2NZ9A 3ZYGA 4I3GA 3ZMOA 1LRHA 1PVXA 4DY3A 2BWCA 4RR3B 4BIOA 5A32A 1L3JA 1RUOA 1DU3D 4LA2A 1QJY3 4AQSA 4FVVA 1DQ2A 2YUEA 4E2GA 1CONA 2ZHNA 2K9ZA 5JLVA 1LTEA 4I02A 1VBD2 2ZZQA 1BKZA 5DZFA 1XE8A 1W2UA 1EAH2 4QGLA 2D6KA 4PDWA 3WP5A 2FMDA 1NA1C 3LB9A 2DUPA 4QPGA 3U0ZA 2WC2A 1BEV1 1UAIA 2WT2A 4E4DX 3QLQA 4HKOA 1W0OA 1OOPA 4GKXA 1CAWA 4AEDC 1AX1A 5KHKA 2ZS6B 4LBKA 2OZ6A 1QJY1 1QNYA 1AX0A 2PAEA 3AP7A 1IS4A 5FMOS 5JOYA 1HXS2 4AGGA 1PO21 1Q56A 4NWWA 4INDA 3VDDB 4N53B 2ZGUA 3AKSA 3DPRC 4AVVA 2HEVF 1BBT2 3OD0A 1XNDA 2P3JA 1F5FA 4MGIE 4OVEA 1GNHA 4QQPA 2UU8A 4M3CF 1UKRA 2B8MA 4YG6A 5KHHA 5T50A 4FPJA 3LWCA 2WQZC 1UU5A 2SLIA 2GN7A 2JKBA 1I1EA 4UW5A 3CJIC 4IEQA 1LODA 4CDWB 2PHDA 4QM8A 4NVPA 1A8MA 4XHXA 1IS5A 3ZXGA 3H1YA 2AYHA 5HCBA 5J48A 3LA2A 3SXWA 1OA4A 1MZEA 3SITA 3VBFB 5I8YA 2ZMLA 3AKTA 1U5YA 4GQ7A 2R063 5J7MA 4OUMA 3RZZA 2PA7A 3K48A 2QCSB 4A7KA 1AR61 2HWE2 4C91A 1KJLA 3KT7A 3VBSA 1OOPC 2ARBA 3GZAA 4Q29A 1X7NA 4X6QB 3RYKA 2LM3A 5JR7B 5I0SA 1PNFA 1NOVA 3PLQA 1PGW2 1EYBA 1XNBA 5C8CB 2MEV3 3HR9A 4CEWA 2ZGSA 1H2KA 1J3QA 1X8EA 2VY0A 5CVRA 3RDIA 4QQOA 2E9QA 4C1WA 4CP2A 3ZFEB 2PLV2 4Q4Y3 1W6MB 4LA3A 3H3UA 1IPKA 2WLPA 1SACA 4CTEA 2BVVA 1DGLA 3AP6A 4LT5A 1ZM1A 2QDRA 3WW2A 1AZDA 1LEDA 4AFMA 1Q8QA 3JD73 2JXAA 1HRI1 1GZ9A 4AHWA 3H0OA 1RINA 1RL3A 2VOWA 3BPZA 1QQP3 2B9UA 4YGBA 1FPN2 3ZN4A 2DURA 4CDXC 1D2QA 3MI8A 1S0DA 1V6KA 4E9KA 3SHRA 3WQ0A 4FCAA 2RS12 3WDTA 4AQ6A 2XKOA 4AVTA 3D8CA 1RIRA 3N7JA 1PK6A 3BCWA 4Y1VA 2R072 2Z5WA 4HFSA 4COUA 4Y1YA 4GALA 1TE1B 4YZ2A 1Y43B 1H4GA 3HWJA 1R1A3 1IQAA 3I59B 3IPVB 4EN8B 3S7IA 1W6PA 1SLIA 4JCKA 2RS13 5DUUA 1ZRCA 4HSLA 3EXUA 1RUJ3 4GIQA 1SFYA 2C0ZA 3S6PA 3TAYA 1SFNA 4Q0PA 4H14A 4LBQB 5HXVA 1RTVA 1QQP2 4AFCA 4BCUA 1C3HA 1QDOA 3DF0A 4D7TA 1ND2B 1PMIA 3NKGA 2ZJCA 2JG8A 3M4FA 2AZ5A 4QQLA 4XF3A 1OLRA 1RB8G 3URFA 4QPIB 2WKKA 5EYYA 1BK1A 1APNA 4OI4A 1KFXL 4XJAA 2XJPA 2XL9A 3NV2A 1MS3A 3ZSEA 5FO8B 2YPJA 4Z82A 2A6ZA 3JZVA 1VBC1 1NE4A 2N7GA 4RSUA 2GC2A 4A7ZA 1O5LA 5GZFA 3IKWA 5FFOC 4FTBA 4W6XA 5E1RA 3ILFA 1NXMA 2YXSA 5BYNA 2WSUA 3WG1A 3KM5A 5SV8A 1C8M3 1YI9A 2D6NA 3PHMA 2HWD3 2HWE3 1FV3A 2I45A 3BOWA 5GKAC 1NLSA 5ACA2 2JX9A 2RM23 3ALQA 3H7YA 4LE4A 4CP1A 2IXCA 2FHRA 4K21A 4MVTA 3PVBB 2WQ4A 2BEOA 2LUWA 1URXA 1WA4A 1GSLA 1RITA 4Q0UA 5JPNB 2OW4A 1DZTA 1JXNA 2CWSA 2IXJA 3MIFA 2BNOA 2BFUL 4FQ4A 3ILNA 3USUA 3ZX7A 4AFDA 2TNFA 1WMFA 3WG3A 3M3CA 2VU9A 1OA2A 5DUVA 4DXZA 4YARA 3O5SA 2MPFA 2CYFA 1RUF3 1CAUB 4QXKA 1ASJ1 2V5YA 2O0OA 2GNTA 4AVAA 1WLCA 3R0RA 2W39A 3OGJA 4XF0A 2WIIB 1RUE1 2BW8A 3VZOA 3HIFA 1PGL2 4IL7A 4F3JA 1CPNA 2ZHLA 2E6VA 2WS91 5EJ3A 1LECA 3N7KA 1PVC1 4Q1RA 1AR81 1LOAA 4D69A 4FPFA 1H8VA 3JD71 3IN9A 1SEFA 4WVMA 1NXD1 2WWSA 1OPMA 2D97A 3V0BB 4YW5A 3TN92 4XF1A 1QXRA 1TEIA 4AQ2A 1VBE1 2EALA 1AYN1 3WHUA 1YRZA 5L73A 3WW4A 3KSCA 2ZGTA 3FE5A 3MZHA 3ENRA 1FV2A 1NCRB 2WT1A 1H4HA 1A6CA 2B7YA 4IV1A 2OUJA 1BMV1 3AZZA 3TB0A 1LOGA 3APBA 3AKRA 4LBQD 4ZU7A 1R091 2EXHA 3FC0A 4U36A 1GANA 4META 5C4WA 5JMCA 2GH8A 4PLNA 1D4M2 1DGWA 2PFWA 4XPVA 3SH4A 1M06G 1ZREA 3NSTA 3MPPG 1MEC2 1SDWA 4XMIA 1KRIA 1KDKA 1VALA 1C8M1 4HN1A 4AI2A 1N47A 2QKDA 3C3VA 1QJU2 1SMVA 2MEV1 1X82A 3AZXA 2BQPA 3EO6A 1QJU3 4S2FA 2ZTNA 3WP6A 2D7FA 4DB5A 4OI0A 4OZXA 4YVSA 5KC6A 3PJQA 4NPRA 4WM8C 3PVOA 2X29A 3ACLA 3J9SA 1OA3A 4FBFA 2G4IA 4H7MA 1AJOA 4PLMA 1EP0A 4OLLA 2I07B 3NVCA 4EWAA 1FXZA 4CEYC 1C28A 2CWMA 4ES9A 3IPVA 5JSOA 4Q8KA 5FCCA 4IV1C 3TRSB 3V56A 1LULA 1CGPA 3KB5A 2KXLA 5H9RA 2ZHMA 2WA3A 4RA0A 4AE2A 1R1A1 4CDUA 5H9QA 2HWB3 1UPIA 3TN93 2P17A 4R8HA 4XF4A 4Y5Z0 1W6QB 3OY8A 2VNRA 1OFNA 4QD2A 3M3IA 1FNZA 3ROUA 2NYYA 1QJX2 1KJRA 3RG0A 5T54A 4BLJA 1PIV2 3VBUC 3E6CC 4YZ4A 2RE9A 2HWF1 1HRV1 2WZR3 1NLRA 3MLKA 1LGCA 4Q4W3 5IK5A 1FMD2 4YGDA 4TWTA 1QOTA 2WZPP 4LUKA 4PLOA 1S55A 2FZ1A 4E4SA 5FRAA 3IT8A 3QACA 4HN0A 1NA1B 2DCKA 2VQAA 2QUOA 1BEV3 1KITA 4QPGC 1ULCA 4HZFA 4RQPC 5AC91 1G9AA 3RMXA 2H6CA 1V6MA 1S0FA 1YFWA 1ZZ8A 5CFDB 1CAVB 4TZDA 2GDFA 4MUVA 3JBG3 1W6NB 4F7ZA 5J36A 1WCKA 4G3YC 1BQPA 3G6JB 1WUVA 5FAXA 2MNGA 4KG8A 2E63A 4OULA 5LK7B 1QJZA 4RHV2 5CNAA 2EVXA 3NWKA 4XJ8A 4IV3C 2VW0A 3KLSA 3D82A 2GH2A 3AKPA 1BEV2 2YMZA 4XTMA 4Q0QA 2EF6A 1MZFA 3I2DA 3VBFC 4FOYA 4IV3B 2QE3A 1LESA 2DVDA 3KD4A 2QNKA 4XQ4A 4IV3A 3QD6A 2DU0A 1AR83 1DDLA 1DIWA 4N43A 4HBNA 1QJX3 3AYAA 1UU4A 1LEMA 3OBRA 3AZVA