4XZPA

Crystal structure of the n-terminal domain of human galectin-4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
148
structure length
148
Chain Sequence
PAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galectin-4
publication title Full-length model of the human galectin-4 and insights into dynamics of inter-domain communication.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2015-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xzpA00
1ONAA 1V6JA 4GKXA 1MZ5A 2VU9A 1I3HA 2LTNA 1NXD1 5AVAA 2A7AA 5GZDA 4M3CF 1QGLA 2JECA 2V73A 2ZGPA 4Q26A 4XIKA 4AWDA 3ZPYA 4FVVA 4Q2FA 4BM8A 2A6YA 4PF5A 3AP6A 4XOGA 1JXNA 1KITA 2H0BA 1C57A 4OZXA 3WUDA 3V0BA 3W58A 1UMZA 1MS9A 2DV9A 1X50A 3D4KA 4GWNA 4XJAA 1MS0A 1SCSA 2CTVA 1R1ZA 5T5LA 1KRIA 5JMCA 1F5FA 2OVUA 3WDUA 2UURA 4ISQA 2GMPA 3TAYA 4UW5A 2WJSA 1W0OA 4XJZA 2ZMKA 4YM2A 5GLZA 3WCRA 2VH9A 3H0OA 4SLIA 5IK5A 1QNYA 2UWAA 3B9CA 5H9RA 1V6NA 3ILRA 5EWSA 1LHWA 1H9WA 3U4XA 4ITCA 1W6QB 3ATGA 2TEPA 1GYKA 2ZHNA 2D7FA 1QOTA 1KJRA 4ZKTB 3M1HA 1S0BA 4YZ1A 4XYXA 2NM1A 1Q56A 2ZHMA 4YW2A 2CYFA 4JRAA 1FX5A 1ZA4A 2Z42A 4YW3A 4LBQB 3ZXEA 3R4UA 1W6QA 1URXA 2ZGMA 3AXEA 3WDWA 2OUHA 1N3PA 1LOBA 1LODA 2WQZC 2E51A 4M00A 4M3CE 4Y1ZA 4YM3A 3WNXA 1V6LA 3SH4A 3AZWA 1LOEA 3C2UA 3ZSLA 5E8AA 1SLAA 2CNAA 3N36A 4FOVA 4K1ZA 3ZXFA 4LBQA 5E88A 1UN1A 3AK0A 2EXJA 2WT2A 1ULDA 1LOAA 2ZGUA 4GKYA 2YROA 2D43A 3SH5A 1UL9A 3D6EA 2DTWA 5GJ6A 4AGRA 1S0GA 1JYIA 3FFZA 1FV3A 3IKWA 3APBA 3A0NA 2OW4A 5T5PA 1LOFA 4R9CA 4XTPA 4YGBA 5KXBA 4HANA 2DVAA 1CPNA 1ULFA 3B3QE 3RG0A 1FYUA 1AXYA 2DUQA 3AJZA 4Q1RA 2R0FA 2ZZJA 1SLTA 4BMBA 4CRQA 2C9AA 3UJOA 1JHNA 2D3RA 3KM5A 3SITA 5JLVA 3W59A 4Y26A 1ENRA 3V65A 4WVWA 5HCFA 1LHOA 1QMJA 3AJYA 3BTAA 3N7MA 2ZKNA 2D6MA 4Y1YA 5F5QA 1LECA 1YIFA 1JUIA 5GZCA 1SLIA 2DVDA 2CWSA 2GMMA 4PBPA 2CL2A 1AJKA 2A6WA 1S0CA 1KDKA 4H55A 5EYXA 1W6OB 4FOYA 5IK7A 2XB6C 1QU0A 4FOQA 4KBBA 5DG2A 1HQLA 4XJUA 1PZ7A 1LESA 3FUQA 4WVVA 1C1LA 4XBQA 4Y22B 5JOZA 5DZGA 4XJ9A 2EAKA 5IK8A 2GNBA 3RMXA 1CJPA 5DZFA 1W6OA 4R9DA 1IS3A 1AXZA 2D3SA 3LSEA 4FPGA 1LU1A 4XHXA 4XE9A 1VAVA 1IS6A 4LBOA 3WV6A 1AZDA 3A0KA 1PZ8A 1ZM1A 4GXLA 1GBGA 2RHPA 4YM0A 4MYEA 4U36A 1XQNA 4LBMA 3M3EA 3AZVA 2GNDA 2R0HA 5SV8A 1AX2A 1KDMA 1TEIA 2GNTA 1V6KA 1FNZA 4FPLA 2PHFA 4Y1UA 4Q1PA 3FUOA 1LHNA 1A8DA 4GALA 1VLNA 3WDYA 4TYSA 2P3KA 2UWBA 3AFKA 3M3CA 1F9KA 1N1YA 1O4ZA 1MS5A 1B09A 3WG3A 2ZGKA 3NWKA 2OUJA 5H9QA 4DRVA 2W08A 5HCAA 2A6XA 4HL0A 3ILNA 4LBNA 3PJQA 5KXDA 1MVQA 4XJ8A 1YI7A 1BZWA 2WNEA 3BOPA 3O0VA 2SLIA 2G4IA 1LU2A 2EXIA 4YLZA 3HMYA 3RS6A 4W65A 1OKQA 3BIWE 1RITA 4XIOA 1GZ9A 4Q8KA 2P3IA 1WLWA 1DQ1A 3ZSKA 4YM1A 5F9TA 1G8WA 1V6MA 3O12A 1KQRA 1CR7A 4GWMA 5GLTA 2NZ9A 1MS3A 1WUVA 2VXRA 4GA9A 2PHUA 1GZWA 2BQPA 5BYNA 1IKQA 4XXAA 1S0DA 4JCKA 3UJQA 4DRRA 1GLHA 2ZGQA 1DYPA 5CB7A 3N35A 2ZMNA 4PBOA 1WLCA 4XTMA 3I8TA 1WD4A 1WCSA 1GNZA 1GZCA 3B00A 4AGGA 4F83A 1AJOA 2ZBJA 1G9CA 1V6IA 2P34A 1FAYA 2ENRA 1VAMA 1S1AA 2YMZA 2D6NA 1GNHA 1Z0HA 2R1DA 3AYEA 4YG6A 4FQZA 1LCLA 3T2TA 4D69A 4XMIA 2WT1A 2ERFA 4AVVA 2ZGLA 3PMEA 1UAIA 1Z78A 5LK5A 2AYHA 5KXCA 1LGNA 3M2MA 2EALA 3OYWA 1BXHA 1Y7BA 3POSA 1MZ6A 2EXHA 4YZ3A 4FP2A 1DLLA 3N7JA 4UW4A 3WOGA 5JOWA 1QNWA 5FREA 1LOFC 1WW7A 4FPEA 1LEDA 1AX0A 2A71A 3UK9A 4UW3A 1V00A 1C1FA 3ILFA 2UU8A 3O0XA 4YGDA 5DXDA 3AYCA 2CY6A 2P37A 4XZPA 1CONA 1S0EA 3UL2A 1QKQA 2D44A 1LGBA 1SFYA 4FPOB 3NV1A 1CQ9A 3GNEA 5T55A 1MVEA 4P9XA 2WSVA 3NV2A 2YZ4A 3OJBA 1QDCA 1ULCA 3LSDA 3M3QA 1MS4A 2JD4A 2PHTA 2KM2A 4IQPA 1IOAA 2D6OX 2I2SA 4XILA 1IKPA 1QF3A 1WLDA 4LBQD 1G86A 1DQ4A 1W6NB 2D3PA 5JOXA 4DFSA 1UKGA 1AF9A 1LHVA 3WUCA 1DGLA 1GANA 3WDTA 3DUIA 1I1EA 2VW2A 5GZGA 1LOCA 4XDQA 1MS8A 4YGCA 2ARXA 2DU0A 5FRAA 1IS4A 1N3OA 1O4YA 2AR6A 2A70A 1G9AA 1BYHA 3ZXJA 2A6VA 1JBCA 5IT6A 1W6NA 1VIWB 3INAA 3WG4A 4ATEA 2GDFA 1N1SA 4BQ1A 2EXKA 1QOSA 1WW6A 1A3KA 1U0AA 1H30A 2FHRA 2A3YA 2JJ6A 3LCPA 5IUQA 4LBLA 4YG3A 3AX4A 3A4UA 3JU9A 1LOGA 1DQ2A 3VKNA 1S0JA 2VW1A 3CNAA 1DBNA 1DQ6A 4ASMB 4FPHA 2DUOA 4YZ2A 3ASIA 2UWCA 2R1BA 4Y20B 3AYAA 4L8QA 1MR5A 1LULA 3NV4A 4YZ4A 3WZ1A 3MEPA 5DUXA 1MS1A 1N1VA 3RQ0A 3ZXLA 1EPWA 5H9SA 5JOYA 4TZDA 3JUUA 2P2KA 1G9FA 1SLLA 3OY8A 1HQWA 4DQAA 3QLQA 3ZSJA 4BOWA 3NV3A 3MW3A 1G7YA 1F31A 1CPMA 1LHUA 2LALA 2VUAA 1BJQA 1WW4A 4Z8BA 4BPZA 4Y20A 2AGSA 3N3HA 4Y1VA 2ARBA 1W6MA 1A78A 3O0WA 4AVSA 1QDOA 4Y1XA 1N3QA 2NYYA 5KXEA 2DUPA 2NMNA 1KJLA 1DFQA 3B69A 4LBKA 4YW5A 5DUWA 1WD3A 2ZAAA 4FPJA 4PQ9A 1SBEA 1YRZA 3FLPA 5T5JA 2W39A 1SBFA 1W6PB 3PVNA 2DTYA 3ZYRA 2ZGTA 3WCSA 4BMEA 4CTEA 4P14A 3OBTA 1GZWB 2E7TA 3AXDA 3OGGA 1C4RA 1Q8OA 1GKBA 4RL7A 2V5YA 3R05A 3T1MA 4YFWA 1AX1A 3HR9A 1CIWA 3QCWA 5DUUA 2EIGA 1UX6A 2AREA 3PVEA 4M3CB 4FPYA 1W6PA 1Q8VA 2GN3A 2JDZA 3WHTA 1FV2A 2ZABA 1J1TA 1JYCA 3FBYA 2A6ZA 4C1XA 2XG3A 2DVGA 3WVJA 2AENA 1GICA 1ULEA 2GNMA 4XBNA 4K1YA 4K20A 1G9BA 4YW4A 3WG1A 1NLSA 1VALA 2PHWA 1LENA 3POYA 4M3CA 3OYWB 1S0FA 2VW0A 4LBJA 1HLCA 3AZYA 5GLVA 5GM0A 1SLBA 2YXSA 1DHKB 5GZFA 1GV9A 4PCRA 2W68A 5GZEA 5L73A 1UZYA 3HN1A 3I4IA 4K21A 2GN7A 2JE7A 1SCRA 1LEMA 3TB0A 2EF6A 2E6VA 4YW1A 1S0IA 2DVBA 4YFZA 1G9DA 3KQRA 4BLIA 1BQPA 1DIWA 1CESA 2ZGNA 1FNYA 2GMEA 4R9AA 4XMAA 1HDKA 2Q5TA 3IMNA 1V6OA 4Q8LA 3VUOA 1W0PA 1UZZA 4DS0A 1ENQA 1DZQA 1N1TA 3O5SA 1YXWA 2E53A 3BODA 4RA0A 5EXOA 1APNA 2B7YA 4WV8A 2AUYA 3VKFC 2ZMLA 4YG0A 1Q8PA 4ATFA 3MW2A 4Y24A 1CN1A 3SLIA 1HKDA 1WBFA 3IN9A 2YY1A 3OBRA 1H9PA 4U2AA 5DZEA 3ZXKA 1QOOA 2A3XA 2D6KA 2ZGOA 5IK4A 5JVVA 5JDBA 1N47A 1AVBA 2PHXA 1SLCA 1ULGA 1DYKA 2HYKA 4R9BA 1AXKA 2E7QA 1IS5A 2C5DA 3R4SA 3AZXA 3MW4A 4C1WA 5CBLA 5T52A 1UPSA 2DWRA 5HCBA 1DQ5A 1D2SA 5T54A 3WG2A 3ENRA 2A5ZA 1YYNA 3AZZA 2DYCA 4AVTA 2WSUA 3Q9OA 2WLQA 5E89A 1CVNA 2JE9A 5GALA 1LGCA 4UW6A 3RMYA 3B01A 4P9WA 4Q27A 2NP0A 1JW6A 3IM0A 1Q8QA 2DU1A 4FPFA 4XHBA 2PELA 5T50A 1RIRA 2D6LX 4M01A 3V0AB 3ZSMA 1RINA 3PVOA 3WHUA 3MPPG 3AP9A 2ZACA 1JOJA 5EYYA 3AP4A 1LJ7A 2AH2A 3GALA 4WZFA 4CZSA 3USUB 3OY8B 3T1LA 2ZGSA 4AYUA 5GLUA 2A3WA 1SACA 5GLWA 4ZXKA 3V0AA 4P9YA 3AP5A 3IPVB 2WKKA 1OFSA 3DGTA 2NN8A 1W6MB 3ZYPA 2ZA9A 3D5OA 1PZ9A 3USUA 2YV8A 2FMDA 5H9PA 4AGVA 4FPKA 2CWMA 4BLJA 4ISRA 2R16A 3N7LA 4NOTA 2WT0A 3SISA 1DQ0A 1SBDA 3WDXA 3IPVA 2D6PA 2P3JA 2ZGRA 4FPCA 3RRDA 3V64A 1BKZA 1OQ1A 2ES3A 2W52A 1YO8A 1WW5A 3VKLA 2PHRA 3SH3A 4I30A 5CA6A 3WLUA 3POWA 3RSJA 3OPZA 4YZ5A 2JKBA 3SNMA 3FLTA 1JN2P 4FQ4A 4JC1A 1D0HA 4XXPA 5CNAA 3M3OA 3VKOA 2ZHLA 2SBAA 2GALA 4FOWA 4XBLA 2DURA 3FLRA 4Y22A 3WDVA 2NMOA 5T5OA 1MACA 4YGEA 3VV1A 3AP7A 4DPNA 2DVFA 4XJWA 4NO4A 3VKMA 5CAZA 2A75A 4FP3A 1ENSA 1GSLA 1WBLA 5DUVA 3L2YA 2ZHKA 3ZVXA 3N7KA 2VY0A 5DG1A 3V0BB 3AYDA 1Q8SA 1LTEA 1FATA 2R49A
chains in the Genus database with same CATH superfamily
3RWKX 4NRPA 5BY5A 4H7LA 3NJYA 5GZDA 5FUNA 4XIKA 1RXFA 1OH3A 3C7EA 4FVVA 4Q2FA 4BM8A 4A44A 4XOGA 4LXLA 1GOFA 1JXNA 4QU1A 5J7MA 1QJX3 1C57A 3ACFA 1WZXA 3ZN6A 4JDMA 3KT4A 2DV9A 4GB33 4NHXA 5I91A 3BTZA 4Q4Y3 3B93A 1MS0A 5JZGA 1MEC3 5T5LA 4CP9B 2LRPA 3B94A 4JKMA 4QWNA 3TAYA 4Z2AA 1W0OA 1GUIA 2C4XA 4KMQA 3WCRA 4CCDA 4XEZA 1W39A 3MHZA 4XUTA 2UWAA 5A6YA 3ZXDA 4MX3A 3GJAA 2IVJA 4MXVA 4UFIA 5BNPC 1ZBA2 3U4XA 4Y3OA 1AR91 5ISLA 2VAUA 2BGCA 2D7FA 1REEA 3EHKA 1UOJA 5E16A 4MGTA 2BPA2 2Y6LA 4CDQA 4YZ1A 4DIQA 1Q56A 4AEJA 3BU7A 2WS93 1EPZA 3KVAA 3LPGA 3AFGA 4CPBD 4YW3A 4LBQB 4AEKA 1CD3G 5LEKA 3R4UA 1URXA 4NWVA 3HD8B 1VP6A 4S2HA 3AXEA 1PMJX 1S4CA 2HWF1 1HRV3 3OEAA 3RYRA 2HWE3 1LOBA 5L9VA 2WQZC 2ZEWA 3NJZA 4M00A 4O7XA 5IWFA 4TLGA 2YG0A 4XC9A 4S2FA 2XBO3 4AL9A 2VBPA 1C8M3 3ZXFA 1RTVA 1CX1A 5E88A 2BNNA 3D0JA 1UN1A 5GKAC 2RJ2A 2BRTA 2WT2A 4PIXA 1NY71 5FJHA 1LOAA 5LCWL 3GZUC 4N43B 1UZ0A 3AVSA 3NVCA 3U78A 4EROA 2Q30A 4GH4C 4E4ZA 5FP7A 1VMFA 1NCRB 1O3RA 3O1UA 3MLLA 1W2OA 4AGRA 1ZBE3 1OMIA 1S0GA 1OC1A 1JYIA 1FV3A 3IKWA 3APBA 4FO9A 2P1BA 3C7OA 1F4HA 4UWDA 3EMRA 2KD7A 2BU9A 3B3QE 1ND3C 1AXYA 1SZBA 1K5MB 3AJZA 3HAGA 4QGLA 2ZS6B 3VBOC 1RVF2 3H3LA 4LE3A 1JYWA 3I3QA 4KGQA 4WM7B 5I8SA 3RZJA 4CEYC 1G6NA 2BWAA 4CRQA 2WFPA 4K3UA 4JHTA 3CHXA 4PQQA 1FXZA 2G19A 5HCFA 4ZS3A 5HCHA 1BBT1 1VRH3 3BTAA 3EYPA 2ZKNA 2D97A 1UYPA 2BFUS 4RS5C 3I7DA 3OBAA 4E9KA 4PLMA 3U07A 3FWEA 4PDWC 5F5QA 4E27A 2QDNA 5CKQA 1YIFA 4BQ4A 1JUIA 5GZCA 1WGPA 1ZYBA 4LO5B 5LA1A 2ZXQA 5LBCA 2W1UA 5FZ7A 1KDKA 1W6OB 1TMF2 2GZWA 1QU0A 2WNUA 2VBDA 3HQXA 4HN0A 3Q8BA 2OZ6A 3K46A 3OUJA 4QQHA 5FKCA 3UT0A 3WQBA 5A6XA 1C1LA 1UZVA 5FY7A 2CAVA 4XJ9A 5IK8A 3H9AA 5FXWA 1QXPA 2ZPXA 2VM9A 4BHPA 4WZCA 3CU7A 3SCGA 1JI6A 4XE9A 4Q4X2 5L9RA 1IS6A 1AZDA 3A0KA 4GXLA 4I0AA 2RJLA 5DABA 2HWD1 4CU7A 4LBMA 3N9LA 1WA4A 4UFJA 3WXPA 2R0HA 4LHKA 4OI1A 2WFF2 5BNOC 3TRSB 2DDUA 4W6XA 2R061 4FPLA 1V0AA 2C26A 3VZOA 3ZXGA 4Q1PA 3PJYA 1LHNA 1A8DA 3E6CC 3ZN6B 1FPN3 2X05A 3DYPA 1Q43A 2P3KA 3BCWA 3WDYA 4AI9A 1PIV1 3VZKA 1W2UA 5K9YA 2VCBA 1UIJA 5LRSA 4ASKA 3ZO0B 4HL0A 3ILNA 1MVQA 1RUJ3 1M4WA 1YI7A 1BZWA 5CU1A 5DN2A 2PHDA 3IIIA 5FPLA 2QJVA 1RJ7A 2SLIA 3SCFA 1UKRA 4XF9A 3UNPA 1SEFA 2VTFA 1FMD1 1QJFA 3DV8A 2C0ZA 3I54A 4UOJA 4NIGA 4Q8KA 2ZEXA 4CCCA 1DQ1A 3LFMA 3ZSKA 1B35A 2R042 1NE4A 1X82A 1V6MA 2Y0OA 4A41A 2FCUA 4GIQA 3RPQA 1DLCA 1RUE3 1IQAA 1VBB1 4XF0A 1UXXX 2AACA 5DDJ3 5DPNA 1RMU3 1S0DA 1W2TA 4MVTA 1IG3A 3UJQA 4URTA 5FZAA 5CB7A 5C3OA 2OYZA 3N35A 2ZMNA 3AC0A 4PBOA 2QQIA 1W8OA 3FZ3A 2BWCA 4Q0QA 5IVYA 5C8WA 3POJA 4NR1A 3VBSA 2ZBJA 2XOMA 1SHWB 2BYVE 5BXXA 2YMZA 1UOGA 4PJYA 2R1DA 1LCLA 3OF1A 2W92A 1WMXA 3ZLIA 2VL4A 3FC0A 3I3DA 3MPBA 2ZGLA 3ES1A 3ZYIB 1VAKA 4CDUA 2BW8A 1W0NA 3KF3A 5KXCA 3M2MA 2EALA 2RS51 3NSTA 2RM23 4UYBA 5JR7B 2EXHA 4O65A 3ZN4A 2VMHA 5JOWA 3FL7A 3N7JA 2W1SA 1CZVA 2BOIA 3H3ZA 5BV6A 4FPEA 4CSWA 1GOGA 2A71A 1RUD2 3VL9A 4EN8B 5BUVA 1GU3A 4UW3A 1AR62 3OB8A 1O4TA 3FHIB 4LO8A 1CZSA 3ZFEC 1RUH1 1R64A 2ZTNA 3AYCA 1H4GA 4BE3A 3ZFFA 4QKDA 1GFF2 1O5UA 2VZPA 4KWJA 2D44A 4LE4A 1LGBA 1HXS3 4AXOA 1MVEA 1OVPA 5LBBA 2WSVA 3BYWA 3NV2A 2BGOA 1OLME 3LSDA 5HPOA 1DGWA 4RGGA 2PHTA 1P8JA 2OKXA 4NWWA 4AVBA 1D4M3 1W06A 3G6JB 1IKPA 1YFWA 2XVLA 4RQPC 1PGL2 1G86A 5JOXA 1CZTA 1XYPA 4GULA 4IL7A 3GCXA 3S57A 5AFBA 4XFAA 5CFDA 2E32A 1W9WA 3THCA 5FRAA 4OHVA 5KHIA 2DU0A 3KQ4B 5K8SA 3MUY1 4QT6A 3FJSA 2HWC1 2A70A 4LQRA 5LA2A 1JBCA 4AR2A 2IC1A 1VBA2 1W6NA 4LKFA 3VDDA 2O8QA 3WG4A 5C3PA 4IE0A 4ATEA 2GDFA 5AFEA 2O1QA 2F17A 1QOSA 1V9U3 1A3KA 1U0AA 1WW6A 1H30A 2VVDA 2Y6HA 2VZUA 2EICA 3LCPA 4TTGA 3LAGA 2VCAA 4IE4A 1DQ2A 1OURA 4BU2A 2C24A 3Q8AA 1POV3 1XE0A 2IXHA 3KV6A 4LITA 5IVBA 3WZ1A 3NV4A 1E5RA 3MEPA 3RQ0A 3ZXLA 4A7YA 5JOYA 3JUUA 4OHWA 1HQWA 3JD72 4LLOA 4BOWA 3NV3A 3E5XA 1ZBA1 2VUAA 5FCCA 3ROUA 1WW4A 1R1A2 3S0MA 3KMHA 1W28A 1HN0A 3H3UA 2ARBA 4AVSA 3HOBA 2B8MA 1ACCA 3SC7X 2ZEZA 1GZTA 3ME2A 1PNFA 1N3QA 1NCQA 3VDAA 2RV9A 2DUPA 1RL3A 2VC9A 4YW5A 3BTXA 2FZ1A 2QBXA 4OCTA 3WP5A 3I2GA 4OQ8A 4H7MA 1SBEA 4ET7A 5FWJA 4RR3C 2KXLA 4AZZA 1U5YA 3DPRC 5LZ6A 2ORZA 1SBFA 1HV1A 4AHXA 4EZHA 4CTEA 4P14A 5KHGA 1PX3A 1EP0A 2QTWB 2E7TA 4IE6A 2DF7A 1F4AA 4AEDA 5K0UA 4LT5A 2BBVA 1C4RA 1QJU2 4CDWA 3BU0A 4GMP3 3T1MA 4L2NA 1AL0G 2VQ0A 3HR9A 3IMMA 1RXGA 4ARXA 2AREA 3IWZA 3PIJA 4HSJA 1W6PA 3VBSB 1Q8VA 2GN3A 1JYXA 2EVXA 2ZABA 1J1TA 1AYN2 3EBRA 1JYCA 4AI2A 3BOWA 3WVJA 2HJIA 3AMPA 4K20A 2FCVA 3B02A 3WG1A 4ZZ8A 1NLSA 2VULA 2CAUA 4L9BA 2PHWA 1ASJ2 2E31A 4HSLA 4LK6A 2ZEYA 5ACA1 1C5HA 1HJGA 2VW0A 3VBRC 5JXHA 2EAAA 1RVF1 4DEVA 3TEYA 3EJKA 2BEOA 2ILMA 2QFEA 4KWLA 2QQVA 2W94A 2ZX2A 3FHQA 2CSGA 5IFPA 1EUUA 2FQPA 1RUC2 1UZYA 3VHOA 3HN1A 1QQP2 3I4IA 4K21A 2GN7A 3BGAA 3IAQA 4UFLA 4Q4V1 2OA2A 3LF7A 2VQTA 4XFFA 4QQOA 1FOD2 1YJKA 1XE7A 2E6VA 3UESA 4DUVA 3ZFFB 4AG4A 4YFZA 1G9DA 3KQRA 1BQPA 1CESA 2Q5TA 1V6OA 4Q8LA 4R52A 1W0PA 1TMF1 2QVSB 2ORXA 3OSDA 5FPZA 1M06G 3QACA 4L97A 4AVAA 1YXWA 4I01A 1OLRA 4RHV1 2AUYA 1SFNA 1R093 4QPGA 5FXXA 2VTXJ 1VJ2A 3SLIA 3VBFB 3HJRA 3IN9A 4AEMA 2YY1A 3DXUA 1C5IA 1EV13 1H9PA 3E6BA 1QOOA 5FLJA 2ZGOA 3ZXKA 4AK3A 3TEWA 1X36A 4QPIC 3POEA 4Q4X1 1W2AX 1DYKA 1RGSA 2BDRA 3MW4A 4DINB 1IPSA 3ZPOA 4BQ3A 5HI0A 5EP9A 3C8XA 2QQJA 5JSRA 2WFF1 1W8NA 1YYNA 3AZZA 1S55A 1CAUB 4E2SA 4E2GA 3QD6A 2WLQA 5E89A 2JE9A 2R043 2YBPA 5GALA 3RMYA 2GH2A 4Q27A 5LA0A 5FPUA 4B4PA 4IE5A 4TSVA 2NP0A 1GWLA 2ZX4A 2DU1A 1ZRFA 1KEXA 2PELA 5KHHA 4W8JA 1RIRA 3TN91 3V0AB 3ZSMA 3ZX7A 1TME3 3USSA 2P6HA 1Y9QA 3PVOA 3MPPG 1K5JA 5IAXA 5FYTA 1JOJA 1LJ7A 2AH2A 4WZFA 4PLNA 1YQ8A 2YFUA 3AMHA 2RR13 5F5AA 2X8KA 3I2HA 4QKBA 4B29A 1CAVA 4JZRA 3OG2A 2ZCWA 4DOUA 4JDNA 1MZEA 2WKKA 3DGTA 1RUOA 1QH6A 1DU3D 2VOXA 3D5OA 4V2VA 5EHDA 1ZX5A 5A7QA 3V56A 1PZ9A 3ZKUA 3K48A 4JGZC 5H9PA 4ISRA 1NY72 2JIGA 4I3GA 2R16A 3WDXA 1DQ0A 1X7NA 4N7IA 4JTOA 2D6PA 4AF9A 1DGRN 4XQWA 5F7UA 1BKZA 4BH9A 2EIDA 2W52A 4CEWC 1K3IA 4DEQA 3VKLA 5FMCA 1JZ5A 1OI6A 1D7PM 4IGOA 1UNBA 3POWA 3U4SA 3RSJA 4YZ5A 4KGGA 2E63A 4YYOA 1JN2P 1OVSA 1RUG3 4MGIE 3EQEA 1OPMA 3AKQA 4NRMA 2DFCA 2GALA 4XBLA 1HB2A 1Z7S1 5FBJA 3H8RA 2DURA 3RZGA 2VZQA 3AKSA 1KXGA 4IV3B 5F3IA 3HPNA 5T5OA 2YPJA 3VV1A 5ABJA 1F2NA 5CAZA 5KR7A 2IWGB 1CAWB 5SV5A 4QX7A 1ENSA 1X33A 1YHFA 5FY5A 5M0TA 1WBLA 2ET1A 4B1LA 1NYWA 1RUD1 2VMIA 1WA6X 2DCTA 2XR4A 1GP4A 4CA9A 1RUI2 1W9YA 4LBKA 1BMV2 1Y43B 2W87A 3ZFGC 1OOPA 1EUTA 1V6JA 3I2KA 2B9UA 1I3HA 1HQNA 4GKXA 2Y64A 3LA2A 2VZVA 4B4QA 2JECA 2GC0A 4Q26A 5KWRA 3GXUA 1O5LA 2Y38A 4ZU5A 3AP6A 1V70A 1KITA 4M0HA 3A7QA 2WO1A 4ZHNA 4R8HA 3MZHA 1UMZA 1PVXA 4XJAA 5BNNA 4JGYB 4A45A 1UMIA 1SCSA 1O3TA 1PGL1 2JIJA 2Y26A 3B9IA 1KRIA 5D8AC 2XHKA 3GM8A 2UURA 1XJAA 2Z4FA 4Y5TA 4QQPA 1XC6A 2GMPA 2QCSB 1EY2A 3IZOA 4UW5A 4YM2A 2ZMKA 4RSUA 2CHHA 5FZ1A 5GLZA 1F5JA 3MICA 3H0OA 5IK5A 3VD5A 5F32A 2HWD2 5CFCC 5H9RA 3S7EA 5FZIA 1YUDA 1YCIA 4AHZA 1W6QB 1VBA1 2WZEA 3ATGA 1E5IA 1GYKA 2DCZA 3UV9A 3VD3A 4AI3A 4EE2A 5A3UA 2R062 4MGSA 5IVJA 4ZKTB 3M1HA 1S0BA 3I2JA 5F5IA 2NM1A 4XFGA 1OLMA 3PUSA 5DAQA 5BNQA 2CYFA 4HZFA 1DYOA 1PK6C 4MADA 5LASA 3LIHA 4DUWA 3PUIA 2BZDA 5AC93 3LGRA 5JI7A 4YSFA 2VTXA 2I45A 4EWDA 2RS33 4ORFA 5JAXA 3RZMA 1LAJA 2VXJA 1W3VA 3Q8FA 2WABA 2E33A 3T2PA 4FI9A 4YM3A 4RGAA 3WNXA 3SH4A 3CMGA 3LOIA 3C2UA 2OT7A 2J1AA 4HPKB 4O9GA 2JDMA 2CNAA 2XKPA 2W47A 1BK0A 3A22A 4K1ZA 3ZSLA 4JAAA 4A3XA 5J48A 4LBQA 3JD71 1AL23 4TLFA 2B45X 2EXJA 5HV4A 2F4PA 5C5TA 1GWKA 4OUSA 1R1A1 4D6QA 3ZYBA 3WW4A 2D43A 2XJVA 3IIAA 1UL9A 3D6EA 1REDA 2ZX1A 5HV0A 3H1YA 3VHRA 2GU9A 5T5PA 1WMEA 2OW4A 3A0NA 3AM2A 4XF3A 2VQAA 1AYN3 1ULFA 3KV4A 3RG0A 1FYUA 3IDCB 4N43A 2D5FA 4YVSB 1NCRA 1YFXA 2OX0A 2R0FA 2ZZJA 2X29A 3RDIA 2PAMA 1SLTA 4CUAA 3GJBA 1U12A 3ON7A 4Y4RA 2G1MA 3ZN5A 4YVWC 2YGLA 3W59A 4BWOA 1QJU1 3AJYA 4RFT0 5TSWA 4L99A 2D6MA 4Y1YA 1H0BA 3LWCA 3FFQA 3J7HA 3VB9A 2GAUA 4HOOA 5FMBA 4Z1VA 4WM7A 2HKXA 1SLIA 5E1RA 3KGZA 4P9JA 5FZBA 4N53C 4PBPA 4A2UA 3JB4C 5EYXA 2XB6C 4FOQA 5DG2A 5FO9B 1HQLA 4QQ2A 1RUH2 3FUQA 4WVVA 1ASJ1 2K0GA 4QB2A 3ZSEA 2GC1A 1NA1C 4F8AA 3N4MA 1QXJA 4XBQA 5JOZA 1VBC3 2DCJA 5DZGA 1AR73 2GNBA 5ABJB 4YARA 2XJUA 4WM8B 3IDBB 5A6ZA 1J3RA 1W6OA 4R9DA 4X6RB 2D3SA 4MXWB 4LO6B 1RUC1 1VAVA 2BV4A 1QQP1 3T4VA 1PZ8A 5E6HA 1GBGA 5FYCA 2WNVA 1IG0A 4QM8A 1PVC2 5CG9A 1FOD1 4IEUA 2GNDA 2BERA 2ZJCA 5SV8A 1JYNA 5FAXA 1FNZA 5KC6A 5EJ1B 4CXXA 3Q8EA 3FUOA 1O8SA 1YJLA 2W2IA 4TYSA 4Q29A 1ENXA 5CVRA 1N1YA 1VMHA 3M8LA 3K75B 5JZGC 3NWKA 2OUJA 3Q8CA 5H9QA 3WSOA 4XUNA 3TNPB 5HCAA 4LBNA 5KXDA 4OZOA 1AR93 2A73B 4KU8A 3H1WA 3T2QA 4AFMA 2XUEA 4WVZA 5C9AC 2WL1A 3BOPA 3JZVA 4TN7A 5J96B 2JEMA 2E26A 5LW9A 4COYA 3RS6A 4W65A 1UYYA 3BIWE 1GNYA 5FZ9A 5A7OA 4XUQA 2BTVC 1XB9A 3ACHA 5F9TA 1GQPA 5I0DA 5A1FA 4CDQC 2HWF3 1KQRA 5GLTA 2AZ5A 2NZ9A 1MS3A 1WUVA 2W91A 3MV11 4PI0A 3OGSA 4X6QB 5FYVA 4B7EA 1WCKA 3CBNA 3I97A 4JCKA 4Q0SA 3MF6A 2W5FA 1GLHA 4INDA 4XF1A 1MPXA 1ZZ6A 2ZGQA 2RE9A 3C7HA 3VBUC 1E57A 2VECA 4FFFA 4IEQA 4XTMA 3OEBA 3K4ZA 1WCSA 1GNZA 3T4HB 1JU3A 1G9CA 2P34A 1QJEA 1HRI2 2D6NA 1QJY2 4YG6A 3AYEA 3RZZA 4FQZA 4LUMA 3MBWA 4D69A 4XMIA 2WT1A 2ERFA 2MEV2 3OD0A 5IJRA 3WNLA 5A3MA 4F3JA 3AB0A 4P9GA 4C0HA 4CU6A 2OPKA 2LM3A 5C8CB 4CDXB 3BIEA 1Z78A 3JQWA 1SG3A 2AYHA 4E4SA 3POSA 4YZ3A 3NNJA 5C4WC 1QNWA 3J7NA 4LMFA 1L7LA 3JQXA 2QQNA 1LEDA 4BDVB 1IZ3A 1U5XA 2PAKA 2J7MA 4D7YA 2X5IA 1C1FA 1BBT3 1A6CA 3ILFA 3NJXA 2P37A 4XZPA 3MGUA 1CONA 3OPWA 1QXRA 4FFHA 1OPOA 4KU7A 3GNEA 5A3OA 2Y6FA 3OBZA 5FZGA 2YDEA 3AKRA 3U14A 2C1FA 2JD4A 2P3YA 4P9LA 5J36A 2KM2A 1UCXA 5ACA2 1S2KA 3K3NA 3IAPA 2D6OX 2WIIB 1QF3A 3LEGA 5DMYA 1WLDA 4CU9A 5FXVA 4LBQD 2D3PA 3RWNA 3SQOA 3DCQA 1MQTB 1AUYA 2OIIA 2VNGA 4TXWA 3WUCA 1DGLA 2ZOEB 4X8PA 2J1EA 2WR9A 2WNUC 4EWEA 5GZGA 1LOCA 2ARXA 1EYBA 4Q4V2 3O1MA 1NZCA 4QU2A 1O4YA 3CJIB 1RUI1 2VCMA 5EJZB 4LO7A 1BYHA 1G9AA 1BMV1 4NAOA 5F1RA 2VUDA 2XKOA 4UT5A 4QXHA 1W9SA 2Z5WA 4GH4A 4OMDA 4FSJA 2XBO1 4BQ1A 2EXKA 3TYJA 3LPFA 2A3YA 2R063 3ETQA 3KS7A 1ZRIA 2WNVB 4RHV2 3A4UA 1AHSA 4K9SA 4B4RA 1JS9A 3CNAA 1PIV3 1ND3A 2IFRA 1YWKA 3NL1A 5L7OB 2R1BA 3IDEA 5KBFA 4Y20B 2XXZA 3AYAA 1NX9A 1RUF2 1LULA 2Z79A 4L8QA 4YZ4A 4NVPA 3S7IA 4CEYA 1CGPA 1UU4A 2BNMA 5H9SA 4DQAA 4QX1A 4QM9A 3D82A 1G7YA 4QX5A 3POBA 1LHUA 4AI1A 1FMD3 5JSPA 4RS5A 4CUBA 4Z8BA 5FY4A 2YB7A 3T0BA 4I3PA 4JV4A 2WYSA 2Z69A 4CYDA 1ULPA 4IV1B 2AGSA 2RMU2 1W6MA 2JDUA 5FPBA 2JG8C 2Y8KA 4LNVA 1QDOA 1NQJA 1XNBA 2QZ3A 1VBB3 2Q1ZB 2PQSA 2NMNA 3C7GA 1OD5A 4OUMA 4QB1A 4XW3A 2VNOA 2JKXA 5DUWA 3TN92 3VBHB 5KHKA 4BIOA 1B35C 1EAH2 1YRZA 2WN3A 3FLPA 5T5JA 2JG9C 3ZDSA 3NNGA 2DTYA 3ZYRA 2ZGTA 1L3JA 3OD4A 1HN1A 4XUPA 1R081 3HBZA 2H6CA 2B39A 1Q8OA 2V5YA 2VMGA 3R05A 1NE6A 4YFWA 1AX1A 4F7ZA 1CIWA 3QCWA 4LLFA 4CCJA 5BPXA 1UX6A 1GOHA 4UBHA 3R6SA 4B8EA 1H8TB 1VB2A 4M3CB 1XNCA 3VBSC 3WT3A 1ZA7A 3PUAA 1PO12 4FFGA 2RS53 4FT8A 5BNOA 2XJTA 3FBYA 2YFZA 2C6SA 2DVGA 2PMWB 2AENA 2GNMA 2VMFA 2XG3A 4N8MA 4XBNA 5A7WB 4E8CA 2ADDA 3WP3A 4CDUC 3OTFA 4EQVA 4ARYA 3POYA 4UI9L 2WWSA 2BGPA 4CU8A 4MGQA 1RUH3 4KG8A 3G7DA 3CF6E 3U11A 5LWBA 3AZYA 1W8UA 2WA3A 4I09A 2CGOA 2IFWA 1SLBA 2UY8A 3ZYHA 2O0OA 4PCRA 4RD7A 3BI3A 3GBWA 4K8FA 5IW0A 5L73A 4MO3M 4J1WA 3VD4A 1GQHA 4CUCA 1Z7S2 2X5IB 4NJ4A 2JE7A 1SCRA 1LEMA 4YW1A 5BNPB 3KF5A 4JQRA 2I07B 3LKJA 3LEKA 4XMAA 1HDKA 5J98B 1QHDA 3VUOA 2EA7A 3SKVA 4B1MA 5C3SA 5CKNA 2XJQA 4DS0A 1N1TA 1DZQA 5FMOS 1DZRA 2E53A 2WC2A 3BODA 3N9PA 4RA0A 3VLBB 5IVVA 3VKFC 4WV8A 4YW7A 3T2OA 2ZMLA 1J59A 2HWC3 2PLV2 4ATFA 4C90A 3DYOA 4Y24A 1CN1A 4AFDA 2ETEA 4KBZA 2XDVA 5DZEA 5JDBA 1GMMA 1ZZ8A 5A70A 5CFDC 5JVVA 4ZS2A 1VPHA 2VNVA 3WP4A 2PHXA 1AVBA 4C0BA 3E1F1 3ACLA 2FDKA 2HYKA 4R9BA 1OD3A 1AXKA 2E7QA 4HG6B 4XFBA 3O1OA 1BEV2 3R4SA 3PDQA 4COVA 1PVC1 3CKHA 3PMSA 4CVUA 1DQ5A 4QXCA 3WG2A 2R072 3VDDC 3VBFA 3ZOIA 2A5ZA 3RZLA 1WCQA 3ST7A 4GH4B 4HN1A 4Z92B 4DY3A 5F37A 3VHPA 2WRAA 1LGCA 2GP5A 2JICA 3E5QA 4UW6A 4P9WA 3GDBA 4UXAA 4NHYA 4LHSA 2RS12 1Q8QA 5HBAA 2JDPA 1IHMA 4FPFA 4XHBA 4Y5SA 1D4VB 1LR5A 1XYOA 3K4DA 4JX0A 1ND3B 2D6LX 5IFTA 3WX5A 1X9TA 2RM21 3E5UA 4AHYA 3WHUA 1CAUA 1ZBA3 1QH7A 4ZY9A 1H1MA 3AP9A 3VBOB 3LD8A 5EYYA 2XL9A 4CEYB 2AEYA 3IB3A 5FPAA 1BK1A 4BJ0A 4Q5OA 2VJXA 5ERLA 2ZGSA 3H50A 4CUGA 5GLUA 2W95A 3THTA 2HWB2 2P17A 2C9KA 2YHJA 4RS5B 3V0AA 4HONA 3MIEA 5A80A 5JMOA 3IPVB 3O1PA 4O9EA 1UYXA 4UF0B 1XU2A 2VMCA 4PDWB 4PIZA 3WNOA 3S5AA 1W6MB 2Y6JA 4S2DA 3MIDA 1GWMA 4QD2A 3KGLA 3ES4A 1NCQC 3F95A 3MLKA 3CIHA 4FPKA 4V2WA 4B7KA 2VOTA 1OA4A 3N7LA 3UYJA 2WT0A 1SBDA 2VD7A 4QXBA 4OI4A 4BYYA 1YI9A 5FMDA 1W05A 1U5IA 4LJHA 1WW5A 3TBDA 3SH3A 4ZU4A 3B7MA 4I30A 2GSYA 1HRI1 3GBGA 1QJY1 5CA6A 1PO22 2GC2A 4AEDC 5K0UC 3FLTA 5FDBA 4FQ4A 4JC1A 2MEV1 3PTRB 4NE9A 3WF4A 4CDWC 3CQOA 3OPTA 2WDBA 4FOWA 2VPVA 1J58A 3FN9A 4Y22A 1WKYA 2NMOA 3BKZA 3U1XA 4HKWA 4YGEA 5ACA3 4IGPA 5BNOB 2DVFA 4XJWA 1RVF3 4CCNA 1AR82 1OBNA 1UWWA 2A75A 2JXAA 5KHJA 1TZOA 1SQ4A 1GSLA 3L2HA 3L2YA 2Y60A 2YC0A 3LEIA 4GZ9A 3ZVXA 2CU5A 3O1VA 3ETPA 3V0BB 1XXNA 2ADEA 3NMBA 4IW3A 2R49A 4IV3A 5LB6A 1ONAA 4Q4V3 1MZ5A 2VU9A 5AVAA 1NXD1 1T2XA 2A7AA 1DP0A 1QGLA 2V73A 2VUCA 2ZGPA 4IEPA 4KH9A 1CAWA 4M3CF 4NPMA 3WINE 3ZPYA 2IXJA 1S2EA 2A6YA 2HLEA 4PF5A 2B4KA 2Y33A 3WUDA 4OZXA 1W9FA 1BCXA 1TMF3 2GP3A 3U75A 2XL7A 1YC61 2BOJA 1X50A 2IVIB 1JZ7A 2CTVA 5F6LB 1R1ZA 5F2WA 3KHCA 4RHV3 4EV0A 5JMCA 1F5FA 4LA2A 5DAPA 2WO2A 4RR3A 2HBTA 3DPRA 4LIVA 4HKLA 4XJZA 1RHI2 2VH9A 3ZMNA 5L19A 3MYXA 5I8TA 4SLIA 1QNYA 3K51A 2RVAA 2WWUA 2MNGA 5DAWA 1V6NA 4Q4X3 5C71A 4JGYA 3FE5A 1YQCA 1LHWA 4MGYE 4ITCA 2Y34A 4QPGC 2TEPA 2ZHNA 3JXSA 1O6UA 2XHNA 1QOTA 1KJRA 3GHNA 3KWVA 1D0GA 1VBD2 5I0SA 2WFF3 2ZHMA 4N9HA 2WA4A 3O1RA 2F4LA 2Y6GA 3MLJA 4DXZA 1FX5A 5EFUA 1IQDC 4GMP1 5FY0A 1ZA4A 2Z42A 4A3ZA 5FMOL 1XE8A 1NOVA 1W6QA 3S6PA 3W5MA 2ZGMA 4XURA 5FOBB 1N3PA 4Y1ZA 4M3CE 3TN93 3DEMA 1RUF1 3AVRA 1V6LA 2VG9A 3AZWA 1SLAA 4FOVA 5FYYA 2DBIA 5JIUA 2K46A 2QQOA 4A7ZA 1NT0A 3GHMA 4PIYA 1H2LA 3LIGA 2QQPA 4AFBA 3ZFEB 2PYTA 2YROA 5FY9A 5LBFA 3RJ2X 4R4ZA 2RMU1 4P5HA 3FFZA 4HPKA 3PVBB 2IXCA 3ECQA 1UY1A 2VQUA 1LOFA 3SHRA 2WINB 5FLIA 4R9CA 5LY2A 1QIQA 2DBNA 3UKVA 2DVAA 1KFXL 4W6WA 4XDOA 4BQ2A 2F6BA 1K42A 4P9IA 1F8VA 4ONUA 1EAH1 5EQUA 3I2OA 4N90A 2D93A 5FUIA 4RQPB 5AVPA 4BMBA 2EIEA 2NLRA 2C9AA 4I0BA 3UJOA 5I0RA 1JHNA 5JLVA 3I2IA 1VBE2 4XABA 5F2SA 1I5ZA 1W8HA 2B5HA 4WVWA 3I3EA 1QMJA 5ANQA 1XNKA 2DFBA 2UYBA 1XU1A 1W04A 4YVSA 2IXLA 2VCCA 1LECA 1ND2C 1PHMA 1Z7S3 1PO11 2CWSA 2GMMA 1OFNA 5F3EA 2A6WA 1S0CA 4LIUA 1XOYA 4OULA 1KS4A 1QJX2 4Y4YA 2FDIA 3MIFA 4FOYA 1OKOA 4LO4B 1JHJA 5JR2A 3TEZA 3WF3A 1K45A 4GB32 4NHKA 5JUVA 1PZ7A 5I0UA 4Q4Y2 4I2OA 4A7KA 5J3UA 2QDRA 1MEC2 1RUD3 2FDFA 2VO5A 3O14A 4Y22B 5F8PA 1AR63 1S2BA 1UD1A 2O8OA 3NAPC 4Y33A 3PTYA 3RMXA 1PMHX 4KG0A 4AFCA 2PA7A 4EWAA 1XNDA 4J1XA 1IS3A 1PGW2 2G9ZA 3BUCA 4XHXA 1SDWA 3WV6A 3GGLA 2ARCA 4YM0A 2WZR1 1YQ6A 2D5HA 3LQCA 4U36A 1XQNA 4DNYA 4D94A 1OOPC 3LB9A 3N9MA 1AX2A 1AYM1 1KDMA 1OUSA 1V6KA 2D40A 2EIBA 2GNTA 2ZAHA 3NO8A 4WM8A 2WS92 2J1VA 3KT1A 4Y1UA 4AQ6A 4MXWA 1OSGA 5FOJB 5IHRA 4GALA 1UMHA 1K12A 1VLNA 3MIBA 4PI2A 2UWBA 2W1QA 3D8CA 4G9SB 4DO0A 1F9KA 3AL6A 3NJVA 5FZKA 5FZCA 5DAXA 4XUOA 2HWE2 5BNNC 2VZSA 3J8F1 1B09A 5D21A 2PLV1 2ZGKA 1BVP1 1J84A 2QNKA 4RR3B 2XBO2 5JIAA 2VOKA 3DPRB 1UY2A 1VBA3 3PJQA 3H1MA 1C8M2 5JSOA 2P5BA 3O0VA 4R4XA 3SCHA 2G4IA 1COV1 3QBQA 4NIIA 1UU6A 4QHZA 1CIYA 1H2NA 1BEV1 2WAOA 5CKMA 4A4AA 4CXYA 4XIOA 1GZ9A 2P3IA 4I02A 2R071 1J3PA 1ZBE2 3H8UA 4HVRA 1G8WA 2CDOA 1D2QA 4FTEA 2BP6A 4GWMA 1JYTA 2VXRA 4QAWA 5FYHA 2XJSA 2PHUA 1GZWA 1PNGA 2BQPA 1IKQA 5BYNA 5I93A 4Q0UA 1ZRDA 2RS11 5FO7B 3N9NA 4DRRA 4PF1A 2VZRA 1ULOA 3JD73 1SDDB 2YPDA 1WLCA 4X8NA 3ZM8A 1OUXA 5FZ3A 1WD4A 2HH9A 1GZCA 3VBRB 1R1A3 3ZMOA 4IERA 1PGSA 1FAYA 2ENRA 2FDGA 1GNHA 1Z0HA 1REFA 1VRH2 1UOFA 4MHRA 3I49A 1JYVA 1UF2C 3UKTA 2HWB1 5FKBA 4GJYA 1H1AA 1OF4A 4RFRB 5LK5A 1CAXB 1HIXA 1LGNA 2JDAA 3S5QA 3OYWA 1BXHA 1NLRA 1Y7BA 5IVEA 4IEVA 4BK5A 1MZ6A 2JX9A 3CZUA 2XJPA 4UW4A 2OZJA 3WOGA 1R082 1WMDA 4ZPIA 2V4VA 3RI9A 5EPAA 3MFAA 5G05L 5IATA 2MHFA 3WR0A 4CDXA 5C8CA 4DMIA 2XONA 4N43C 1QJU3 2W1WA 4Q4W1 5K7PA 1V00A 3O0XA 2UU8A 4YGDA 5DXDA 5FZ8A 1NCRC 2CY6A 4NMIA 2XVKA 3VZMA 1S0EA 4QDQA 5A3WA 1SFYA 3NNLA 3NV1A 2K9ZA 5T55A 4YW6A 5FQ0A 1PO21 3OOXA 2YZ4A 3OJBA 4QPIB 2XMLA 1MS4A 1PK6A 1YQ2A 3RNSA 2I74A 2NQYA 3JBG1 4IQPA 1K5MC 1IOAA 3PURA 2I2SA 1RUNA 5EJ3A 4XILA 1ZVFA 1ASJ3 4MSVA 4WM7C 1DQ4A 4DFSA 1H4HA 1UKGA 5A7SA 5FYUA 1AR81 1FPN2 2JE8A 3IT8A 3UETA 3R0RA 4IXLA 2VW2A 4XDQA 4NHLA 4CCEA 2CDPA 1N3OA 1RUC3 2AR6A 3I59B 4JVAA 1QQP3 1CJDA 2A6VA 3KHBA 5A7NA 3ZYFA 2H0VA 4L0PA 3ZR5A 5A3TA 3RI8A 3KCCA 4ES9A 1RUJ2 1FOD3 3ELNA 1GQGA 1MQTA 1N1SA 4GAZA 4XZUG 4D3WA 4UAPA 2WZ8A 4GWIA 2JJ6A 1JTZX 5CISA 5IUQA 3WQ0A 2PQQA 3AX4A 3CJIA 3J26N 4RN5A 3JU9A 1LOGA 5JXGA 4P02B 4XQDA 4JDOA 2DUOA 4YZ2A 1RUE2 4HMZA 5LBEA 5DDJ2 3J9SA 1MR5A 4K8RB 1RMU2 3LDRA 1MS1A 1RHI1 1N1VA 2PN5A 3POFA 4C8DA 1EPWA 4TZDA 2P2KA 4JGZB 1H8VA 5IVCA 3QLQA 1QY4A 1NKGA 2LALA 4AI8A 1BJQA 5L7OA 2A1XA 4EN6B 1DF0A 5J37A 3ACGA 3KD4A 4XPVA 4Y20A 2OQ7A 4BPZA 4CEWB 2AEZA 1UXZA 1VBD1 2VMEA 3N3HA 4Y1VA 2B9VA 4E2QA 3M70A 3O0WA 5FPVA 4OHZA 1VR3A 2GC3A 5C5UA 5ANNA 3B69A 1KJLA 1DFQA 1ST8A 4NIDA 2Z2SB 2RM22 1ODMA 2JD9A 4PQ9A 3GZAA 5FZHA 4IDZA 4IV1A 4Y5Z0 2XGXA 3PVNA 4OI2A 4BMEA 3WNMA 3WCSA 3BPSA 4QX8A 4IE7A 1GZWB 1QEXA 1ODNA 2ZX3A 3AXDA 1XNAA 2XPJA 1GKBA 4RL7A 3SMHA 3MO4A 5JI9A 3VBHA 1DDLA 1H6YA 3KCXA 4FBFA 3HEIA 2EIGA 1ZZBA 3OUIA 5B2GB 2FZ2A 1HXS2 2WN2A 3PVEA 2VVEA 4FPYA 3UGGA 4BIFA 3ZFGB 5D1IA 2JDZA 3WQ1A 4E8DA 4MG2A 2R32A 1O8PA 3RJRA 4LHLA 2YUEA 2A6ZA 4C1XA 1O7FA 3C7FA 4XFIA 1GICA 1ULEA 4K1YA 4UBGA 1G9BA 1UY0A 4YW4A 1D4M2 4LR4A 4C91A 5B4NA 2TNFA 5FO8B 3PHMA 2XWBB 4MH0E 1H8TA 3GBFA 3OYWB 1Q5OA 4H3WA 4M3CA 3WNPA 4OFGA 2VBBA 3BN6A 4LBJA 4LOTA 5FZFA 3SEEA 3KT7A 3URFA 4NUBA 5D8AB 5FUPA 2YXSA 1GR3A 1NUKA 1VBE1 2Q1MA 1GV9A 5A7WA 4BQXA 4XETA 5C9AA 2W68A 1I9RA 1J83A 2VZTA 4QKNA 1VB4A 1A8MA 5FZ4A 1NAEA 3MIHA 4MGKE 5FWEA 2X5IC 1HX6A 4DXRA 5CFCB 5LK7B 2EF6A 1L7QA 1OXCA 5FR3A 3KV5A 3M7AA 1TNRA 4MGZE 3NKTA 1V9U2 3THPA 3RZHA 4QXKA 5FQ0B 3IMNA 1UW8A 1QJX1 1VRBA 4GWJA 2VMDA 3EXUA 4WVMA 3TWIA 4IEOA 4AVCA 1PK6B 4GB31 4D7TA 4Q4Y1 1MEC1 4YPJA 5EXOA 4LKSA 1APNA 5BNPA 2IZWA 1MZFA 1Q8PA 1RUI3 3NNMA 3MW2A 4YG0A 3BTYA 4XQ4A 3NQHA 1HKDA 1WBFA 3OBRA 4DXSA 1PM7A 2D6KA 2A3XA 2QQUA 5IK4A 5A33B 5A1AA 1PGW1 4KL1A 1N47A 4LHNA 5C33A 1ULGA 5FP9A 3P3NA 1IS5A 2RG4A 4A6OA 4AAPA 5T52A 4HVOA 2DWRA 5T54A 4RYDA 1D2SA 5F3CA 1BVVA 1HJFA 4QHBA 2DYCA 1NZIA 4AQTA 4AVTA 2WS91 2YC2A 3MIGA 4OLLA 1CVNA 2Q8OA 5A1LA 4IUGA 5C4WA 2XWJB 1WLTA 2ZX0A 4XCBA 1HRV1 4CE8A 2HWE1 5T50A 5FZMA 2HWD3 5K4LA 1Q3EA 1O3QA 1YLLA 1RINA 2FDJA 2X10A 4JRLA 2ZACA 1C8M1 4J25A 2XLAA 4JKKA 3I2FA 3MUZ1 2WZPP 4FTSA 3T30A 1J1LA 4YVWB 4NPLA 3USUB 4Q0PA 4AYUA 3W20A 5B4XA 5GLWA 2B46X 1SPPB 2XJRA 3AP5A 2DCYA 4JQTA 4K7JA 1JZ2A 1ZBE1 3VBOA 2V4AA 5A3NA 5FXZA 1XRUA 1O91A 3ZYPA 5FZOB 4N53B 4Z07A 2YV8A 2FMDA 4K40A 4BLJA 2CV6A 5C7GA 1R083 4FXGB 1XBFA 5DAVA 3SISA 4NOTA 3WEZA 4QPWA 3IPVA 1DZTA 2P3JA 2ZGRA 4FPCA 4MV2A 4UF0A 3V64A 1NA1B 1E5SA 2ES3A 4PDWA 4BQ5A 3J7LA 1YO8A 2PHRA 2IXKA 1WCDJ 2ARAA 2FCTA 3ALQA 3WF0A 4BZ4A 3WLUA 1C28A 1JOBA 1VRH1 2JKBA 3OPZA 4PLOA 3IDAA 4XF4A 4YRDA 1D0HA 4XXPA 5CNAA 1I6XA 3M3OA 2X09A 3U10A 5IVFA 2SBAA 2L9LA 2D98A 4QX3A 1F15A 5FTTC 1OQEA 3FLRA 3WDVA 4P00B 4COWA 1MACA 2X53S 1ZNPA 4PHZA 1XYNA 4Z2WA 4DPNA 3AP7A 1JUHA 4G3YC 5A3PA 1W8WA 4HXCA 2JWPA 3MF9A 4G4FA 2CGPA 3B5LB 3CEWA 4CCMA 1R092 3AYDA 1LTEA 1FATA 3DKWA 3OUHA 1XPWA 3AMQA 1EV12 1SFPA 3OGVA 2LTNA 3GF6A 4GD4A 5JZGB 4EJRA 1LRHA 2JDYA 2W46A 3DECA 2QKDA 4AWDA 4OI0A 5C9AB 5FFOC 1LB2A 1DCSA 3JCIA 1E5HA 2JG8A 3BB6A 3ZXAC 2H0BA 4A42A 2VZ1A 3DXTA 4XVHA 3W58A 1H2KA 3V0BA 1KD7A 3KV9A 1MS9A 4AFAA 3D4KA 4GWNA 4LEJA 4Q0VA 2HEWF 5CZKA 4XDPA 2OVUA 3WDUA 4ISQA 2OS2A 2JG9A 4CDQB 1FPN1 2WJSA 1OF3A 3MDPA 3T3YA 4LKEA 3NRUA 4WVMB 3WD5A 2WZR2 4GJZA 3B9CA 3F2ZA 3ILRA 5EWSA 1Y9GA 1TME2 1I5PA 2B42B 1H9WA 4W4ZA 3HQUA 3P3PA 1AYM2 4J6GA 4QKFA 1WMFA 3VBUB 3ZFFC 3GCWA 1RUJ1 1PVC3 1US3A 3LOBA 5A7PA 4XYXA 3LEMA 5F39A 1Y3TA 4YW2A 2RR12 2RDRA 4MLOA 4JRAA 1ZRRA 4EN0A 1IPKA 3ZXEA 4QDRA 3J8F2 3J7MA 3ABZA 4QQLA 2KR2A 3VBFC 3PL0A 1YQ5A 2OUHA 3WDWA 1RUE1 1LODA 2E51A 5DDJ1 3J4UH 3UKNA 4UFMA 1UIKA 1RMU1 2JENA 1LOEA 2WO3A 1COV2 4IEZA 4AE2A 3M4FA 5E8AA 4D6SA 3N36A 5C4WB 2J1TA 2RJKA 3AK0A 1US2A 1ULDA 4ZXEA 3H7JA 4ZU7A 5C70A 3LA7A 1HV0A 2RDSA 2ZGUA 3QH7A 4GKYA 4BXFA 5FPXA 3SH5A 4FXKB 2LW8A 5FYSA 5APAA 3ZKYA 2DTWA 4H2AA 5GJ6A 3WF2A 1RUG2 4E4HA 3PNAA 4OYUA 3VHNA 1W03A 1NXMA 1YNAA 5FP8A 4XTPA 1H6XA 3L9JT 4YGBA 4AW7A 4HANA 5A6QA 5KXBA 1A34A 3EO6A 1CPNA 1IGOA 4MOAA 2FD8A 4RGKA 3ZFEA 2WWJA 1OHFA 2DUQA 2J22A 3RVHA 1UZWA 3IBMA 3O7OA 1UY3A 3KZ4C 4Q1RA 5A32A 3CDZB 3PLQA 4CCLA 4HT1T 5FYMA 3A23A 1ZRCA 2G9FA 3WW1A 2D3RA 3KM5A 3SITA 2ZKLA 4AAXA 5CG8A 4OHYA 5CYYA 4Y26A 1ENRA 2G9GA 3V65A 1HRI3 1LHOA 1QJY3 5FZ6A 2PAEA 2WNUB 1OH4A 3BVCA 4M4PA 3N7MA 2W9XA 2ATFA 2BBAA 3FX3A 5EZWA 2MEV3 4CP2A 5C6CA 2AC1A 3LZZA 4NROA 3N9OA 1HXS1 1YFUA 2BFUL 3N9QA 4RQPA 5IAVA 2WNOA 3VZJA 5FZDA 2DVDA 3PUQA 2CL2A 4EZ4A 1AJKA 3E97A 3WNNA 1C3HA 3D0SA 4H55A 5IK7A 4NIAA 1RJ8A 2WBKA 3NKGA 4KBBA 3P6BA 1W2NA 4XJUA 1D4M1 1LESA 4Q4W2 4DUXA 4FAHA 4XFCA 2H6BA 3KVBA 5IYYA 2HBUA 3VZNA 2EAKA 2ID4A 3MFCA 4BQWA 4D8MA 3O1SA 4HKOA 1ZREA 1CJPA 3BALA 5DZFA 4XAAA 1H1IA 2J1RA 1AXZA 3LSEA 4LPLA 4FPGA 1LU1A 4HK9A 3JBG2 4LBOA 1ZM1A 1XNTA 2RHPA 3H8XA 4MYEA 2O14A 2VZ3A 1W9TA 2PXJA 3AZVA 3M3EA 4IV3C 2QZ2A 5EV7A 3H8OA 3T0DA 4P08A 3WY6A 3U37A 1TEIA 4LORA 1V9U1 3AL5A 3SXWA 2YGMA 1X8MA 2PHFA 3H7YA 1X9PA 1UQXA 5AC92 2QQWA 2JG8B 1CWPA 2PHLA 2RS32 3VL8A 5F6KA 3T0AA 1W8FA 3AFKA 3M3CA 2VR4A 2IXIA 1W3XA 1NQDA 3PU3A 4BCUA 1HW5A 1O4ZA 1MS5A 5FYBA 1POV1 3K3OA 3WG3A 5FY1A 2LS6A 1GP5A 3P5BA 4DRVA 1PMIA 2W08A 1B35B 1VE0A 2A6XA 4QGNA 2JG9B 5C3RA 3ITQA 4XJ8A 2WNEA 1UOBA 1AL22 2NPIA 4O61A 1LU2A 2EXIA 4YLZA 4KI5M 4H14A 3HMYA 4JGYC 1OKQA 1T6GC 3TOJA 1RITA 3DL3A 1NG0A 4JHZA 2Q8DA 4QGMA 1WLWA 2VZOA 4YM1A 5HXVA 4ZZ5A 5EIYB 2BJSA 4LA3A 4NRQA 3O12A 1CR7A 3ZDVA 3CL1A 4GA9A 5LRRA 4XCAA 4OUEA 1ZZ9A 4XXAA 1RUF3 4COZA 2BVVA 1Y4WA 3CZJA 4CDUB 1DYPA 3AMNA 1W8TA 1Y9MA 2JDHA 3I8TA 1DGWX 3B00A 4AGGA 5L36A 4F83A 1UPIA 1AJOA 4HK8A 1V6IA 1XSQA 1VAMA 1S1AA 1HB4A 4YWAA 2RMU3 3T2TA 1NLQA 3WP6A 4PT6A 3ZYGA 5FJKA 3CJXA 2XH6A 4AVVA 1KFUL 5FYZA 3PMEA 1UAIA 3OCPA 4FTBA 4V1PA 2TUNA 2YU1A 4UFHA 1JZ3A 1YIPA 4OMCA 3VBRA 4FFIA 3T09A 1HB1A 5CADA 1EAH3 4FP2A 1DLLA 4GQ7A 4NN0A 4LKDA 5FZEA 2E9QA 5FREA 1IPJA 1LOFC 2N7GA 1WW7A 4QDSA 4BA6A 5JXJA 2WAAA 1AX0A 1H2MA 2V5DA 4DXTA 3UK9A 4LTAA 3E6DA 1VBC2 1AR72 1CAXA 3OGJA 1JOPA 3GYDA 5JPMB 1JZ8A 5A32B 1CX4A 4A6SA 3ACIA 2QUOA 1UU5A 3ZIWA 3UL2A 3WW3A 4QHOA 1QKQA 3A21A 4FPOB 1CQ9A 1ZZCA 3GZTB 4P9XA 1PO13 1J3QA 2J1UA 5CFDB 4MHUA 1POQA 1QDCA 1LKNA 1ULCA 2HEYF 2XQRA 3M3QA 2XLGA 2QQLA 3LDBA 2PFWA 4NAMA 4NPRA 4YVSC 2WQ4A 4IEXA 1W6NB 5F5CA 2JDNA 3VDDB 3SEPA 2QQKA 2YU2A 3VDCA 2J42A 1AF9A 1LHVA 5FLHA 3ZIXA 1GANA 3WDTA 3DUIA 4QPIA 2RDQA 3KB5A 2W0XA 4JKLA 5J1XA 4YGCA 1MS8A 2VE1A 5F3GA 1I1EA 1IS4A 1U5ZA 1JU4A 3PU8A 3I2DA 3RYPA 1R091 3HBKA 3ZXJA 4SBVA 2WZR3 4AQSA 5C3QA 5IT6A 1L7RA 4OQ9A 1EV11 1AR92 1VIWB 3CLPA 3INAA 1POV0 3ZYJB 2LROA 4DB5A 1PM4A 1PX4A 3HWJA 2VUJA 1AYM3 4E4DX 2Q0AA 2FHRA 2ZZQA 3QOPA 3RYKA 4XAEA 3I3BA 4LBLA 1KGYA 3DF0A 3I59A 4YG3A 1FI2A 3WQ7A 3AKPA 3VKNA 1S0JA 2VW1A 3LFIA 1DBNA 1DQ6A 4ASMB 1TE1B 4FPHA 2HWF2 5ABJC 1UYZA 3K2OA 3PUHA 3ASIA 4AI0A 4EYUA 2UWCA 3S30A 1YFYA 2R041 1UX7A 3HNBM 3J8F3 3R4DB 2HEVF 2PLV3 4WM8C 3WNKA 4KWUA 2OQ6A 5FZ0A 1OT5A 3QH6A 3RGBA 5DUXA 3W21A 3LA3A 4QX2A 4CCKA 2JB8A 5FIXA 1TNFA 1SMVA 3OY8A 1G9FA 1LNSA 1NCQB 1SLLA 1F35A 4HFSA 4ASLA 3ZSJA 5J09A 3MW3A 1COV3 1TME1 3FBMA 1F31A 1CPMA 3TNQA 2P6CA 3HT2A 4I0WB 1BEV3 3VDBA 5T3NA 5FBZA 3LE0A 5I0TA 1ND2A 2R073 1WCUA 3VZLA 5JWPA 1ZZ7A 1A78A 3NW4A 5D2AA 5DQ0A 2RR11 2OXBA 3HT1A 4Y1XA 2Q4SA 2XLFA 2DCKA 2NYYA 2Y6KA 3GZEA 2R6QA 4JGZA 4GMP0 2KA3A 1HRV2 2YC4A 2Y0IA 4AEDB 4CDWB 5K0UB 5KXEA 1BHGA 2RS13 2CGNA 1STMA 1WD3A 4S2GA 2ZAAA 4FPJA 2FDHA 2R30A 5FY8A 2W39A 4CEWA 1XSRA 1W6PB 2WQ8A 5LA9A 3NAPA 2FBEA 3I3MA 2VOWA 3OBTA 3HIFA 2QE3A 2BNOA 2E7AA 4P5YA 1JODA 3OGGA 4META 4BK4A 1W8ZA 1BBT2 3EB7A 1O59A 4K6BA 4XACA 1QJZA 1O3SA 5DUUA 3MV01 2Q8EA 1AR61 3CO2A 2HWB3 3WHTA 1FV2A 4IESA 5A3LA 1RUG1 4HLTA 4KWKA 4LOSA 1WWYA 4XFHA 4YNIA 4M4RA 1VALA 2VNRA 2TBVA 2VGDA 1LENA 1UO9A 1S0FA 2VVFA 3ZFGA 4BISA 4Q4W3 4CP1A 1FT9A 2Q8CA 2R7EB 4M0NA 1HLCA 3HNYM 4CPBA 5GLVA 5FYIA 3K4AA 4LUKA 5GM0A 1DHKB 5GZFA 1OA3A 3ZR6A 4OHXA 5GZEA 3U0ZA 1OA2A 4W6YA 1PO23 4D7SA 5C8CC 4CDXC 4IETA 4AOCA 3POIA 4QB6A 3W5NA 3TB0A 2FMYA 2LUWA 1S0IA 2K2SA 3JBG3 4LK7A 2DVBA 5L9BA 4CXWA 4QPGB 2XVGA 5D8AA 4BLIA 4CP9A 1DIWA 2YBSA 2ZGNA 1FNYA 2GMEA 4R9AA 5FP3A 4W50A 1HB3A 4LULA 1JH5A 5HXMA 4QX0A 2YBKA 1UZZA 3RZKA 1AR83 4BXSV 1ENQA 1RC6A 3O5SA 4L92A 3VBUA 3H42B 2GH8A 1PIV2 4URAA 5CFCA 4NIHA 2JB4A 2B7YA 5FK7A 5FP4A 1KS5A 4U2AA 4KQ7A 3ORJA 2W3JA 3KSCA 2MPFA 1SLCA 3HVDA 3VN4A 3AKTA 4KNCA 1FMD2 1GP6A 3DYMA 2C5DA 3POGA 4BB3A 3AZXA 3FMGA 4N7UA 3TEXA 4C1WA 4EN9B 5CBLA 1UPSA 3FHAA 5HCBA 3X29B 4DZGA 3WF1A 3ENRA 3DKQA 3VD9A 1BLZA 1MQTC 2YYOA 4IEWA 4CCOA 4TWTA 2WSUA 1ALYA 3Q9OA 4OVEA 2ET7A 1RYYA 3KCYA 1VBB2 5A33A 3DN7A 4AQ2A 5AC91 3B01A 4IGQA 4NHMA 2RS31 1JW6A 3IM0A 5JPNB 5G04L 3CJIC 3K77A 1RHI3 3HN3A 4AHWA 4HVQA 3D3AA 4BQYA 1CAVB 1TG7A 2IUWA 3MI8A 4M01A 5LEJA 5JCTA 3WW2A 2WUHA 4UFKA 4QMAA 2WO7A 2VOVA 3AP4A 4MZUA 5LY1A 2PTMA 4FAGA 3GALA 4MUVA 4CZSA 1AL21 1VBD3 5I8YA 3OY8B 4HETA 5FK8A 2WNVC 3T1LA 5JXIA 3VGIA 2A3WA 1SACA 2UYAA 4ZXKA 4P9YA 4D0QA 5L7OC 5FZLA 1VMJA 2RS52 1K5MA 1OFSA 5KC5A 4D6RA 4COUA 4HBNA 1W99A 1ND2B 2NN8A 2RDNA 3KLSA 3THDA 2ZA9A 1X8EA 1QWRA 1JZ6A 4YVWA 4N9IA 2P4EA 3USUA 1AYN1 4B3NA 5LATA 4AGVA 2CWMA 4ZONA 3M3IA 4FCAA 4CP0A 3AMMA 1SPPA 5CIRA 3RRDA 1T6BX 3W9AA 1OQ1A 1DG6A 4IV1C 5CEHA 3UGHA 3NAPB 4IEYA 5FZOA 2BUKA 3NNFA 4N53A 3RFRA 4DY5A 3C3VA 3O1TA 3SKJE 4QPYA 3SNMA 1OQDA 3VKOA 2UY9A 5FV3A 2ZHLA 3VBHC 2V09A 4L11A 2J1SA 1DGRA 1TQ5A 1NA1A 2OPWA 2XQXA 3HNMA 2WYFA 1YEWA 3JB8A 3LDKA 1JMUB 1OOPB 1OLQA 2JDKA 3HQRA 3UGFA 1JZ4A 4EN7B 1W90A 3PIGA 4NO4A 3VKMA 3VD7A 4FP3A 2HYXA 1C8NA 2Q1FA 2WLPA 4JTNA 5DUVA 2ZHKA 3T08A 3OGRA 4ES8A 1VBE3 1UY4A 2QQMA 2XUMA 3N7KA 2V72A 1VBC1 2BVBA 2VY0A 5DG1A 2HWC2 1TVGA 1AR71 3BPZA 1Q8SA 3P1IA 4Z82A 1RB8G 1H8TC 5BNNB 4WBBA
chains in the Genus database with same CATH topology
5BY5A 4H7LA 5GZDA 4XIKA 4FVVA 4Q2FA 4BM8A 4XOGA 1JXNA 5J7MA 1QJX3 1C57A 3ZN6A 4JDMA 3KT4A 2DV9A 4GB33 5I91A 4Q4Y3 3B93A 1MS0A 5JZGA 1MEC3 5T5LA 3B94A 3TAYA 1W0OA 3WCRA 4XEZA 1W39A 2UWAA 3ZXDA 4MX3A 4MXVA 3U4XA 5BNPC 1ZBA2 1AR91 2BGCA 2D7FA 1REEA 3EHKA 5E16A 2BPA2 4CDQA 4YZ1A 1Q56A 4AEJA 3BU7A 2WS93 1EPZA 3AFGA 4YW3A 4LBQB 4AEKA 1CD3G 5LEKA 3R4UA 1URXA 4NWVA 3HD8B 1VP6A 4S2HA 3AXEA 3RYRA 2HWF1 3VBUA 1HRV3 2HWE3 1LOBA 2WQZC 4M00A 3NJZA 4S2FA 2XBO3 1C8M3 3ZXFA 1RTVA 5E88A 2BNNA 3D0JA 1UN1A 5GKAC 2WT2A 4PIXA 1NY71 1LOAA 3GZUC 4N43B 3NVCA 4EROA 2Q30A 4GH4C 4E4ZA 1NCRB 1O3RA 3MLLA 4AGRA 1ZBE3 1OMIA 1S0GA 1JYIA 1FV3A 3IKWA 3APBA 4FO9A 3B3QE 1ND3C 1AXYA 1K5MB 3AJZA 3HAGA 4QGLA 2ZS6B 3VBOC 1RVF2 4LE3A 4KGQA 4WM7B 5I8SA 4CEYC 1G6NA 2BWAA 4CRQA 2WFPA 4K3UA 1FXZA 5HCFA 1BBT1 1VRH3 3BTAA 2ZKNA 2D97A 4RS5C 2BFUS 4E9KA 3I7DA 4PLMA 3U07A 3FWEA 4PDWC 5F5QA 4E27A 2QDNA 1YIFA 1JUIA 5GZCA 1WGPA 1ZYBA 4LO5B 1KDKA 1W6OB 1TMF2 2GZWA 1QU0A 2WNUA 3HQXA 4HN0A 2OZ6A 4QQHA 1C1LA 2CAVA 4XJ9A 5IK8A 3H9AA 1QXPA 2ZPXA 4BHPA 4WZCA 3CU7A 3SCGA 4XE9A 4Q4X2 1IS6A 1AZDA 3A0KA 4GXLA 4I0AA 2RJLA 2HWD1 4LBMA 1WA4A 3WXPA 2R0HA 4LHKA 4OI1A 2WFF2 5BNOC 3TRSB 4W6XA 2R061 4FPLA 3ZXGA 3VZOA 4Q1PA 3PJYA 1LHNA 1A8DA 3E6CC 3ZN6B 1FPN3 3WDYA 1Q43A 2P3KA 3BCWA 1PIV1 3VZKA 1W2UA 5K9YA 1UIJA 5LRSA 3ZO0B 4HL0A 3ILNA 1MVQA 1RUJ3 1M4WA 1YI7A 1BZWA 5CU1A 2PHDA 2QJVA 1RJ7A 2SLIA 3SCFA 1UKRA 4XF9A 1SEFA 1FMD1 3DV8A 2C0ZA 3I54A 4Q8KA 1DQ1A 3ZSKA 1B35A 2R042 1NE4A 1X82A 1V6MA 2Y0OA 4GIQA 3RPQA 1RUE3 1IQAA 1VBB1 4XF0A 5DDJ3 1RMU3 1S0DA 4MVTA 3UJQA 4URTA 5CB7A 2OYZA 3N35A 2ZMNA 4PBOA 3FZ3A 2BWCA 4Q0QA 4NR1A 3VBSA 2ZBJA 2BYVE 5BXXA 2YMZA 4PJYA 2R1DA 1LCLA 3OF1A 3FC0A 3MPBA 3ZYIB 2ZGLA 3ES1A 4CDUA 1VAKA 2BW8A 5KXCA 3M2MA 2EALA 2RS51 3NSTA 2RM23 5JR7B 2EXHA 3ZN4A 2VMHA 5JOWA 3N7JA 5BV6A 3H3ZA 4FPEA 2A71A 1RUD2 3VL9A 4EN8B 5BUVA 4UW3A 1AR62 1O4TA 3FHIB 4LO8A 3ZFEC 1RUH1 2ZTNA 3AYCA 1H4GA 4BE3A 3ZFFA 1GFF2 1O5UA 4LE4A 4KWJA 2D44A 4AXOA 1LGBA 1HXS3 1MVEA 2WSVA 3NV2A 3LSDA 1DGWA 4RGGA 2PHTA 4NWWA 4AVBA 1D4M3 3G6JB 1IKPA 1YFWA 2XVLA 4RQPC 1PGL2 1G86A 5JOXA 1XYPA 4GULA 4IL7A 5AFBA 4XFAA 5CFDA 5FRAA 4OHVA 5KHIA 2DU0A 5K8SA 4QT6A 3FJSA 2HWC1 2A70A 1JBCA 2IC1A 1VBA2 1W6NA 3VDDA 2O8QA 3WG4A 4ATEA 2GDFA 5AFEA 2O1QA 1QOSA 1V9U3 1A3KA 1U0AA 1WW6A 1H30A 2VVDA 3LCPA 3LAGA 1DQ2A 1POV3 2IXHA 3WZ1A 3NV4A 3MEPA 3RQ0A 3ZXLA 4A7YA 5JOYA 3JUUA 4OHWA 1HQWA 3JD72 4LLOA 4BOWA 3NV3A 3E5XA 1ZBA1 2VUAA 5FCCA 3ROUA 1WW4A 1R1A2 3S0MA 3KMHA 3H3UA 2ARBA 4AVSA 2B8MA 3ME2A 1PNFA 1N3QA 1NCQA 2DUPA 1RL3A 4YW5A 2FZ1A 3WP5A 4H7MA 1SBEA 4RR3C 2KXLA 1U5YA 3DPRC 1SBFA 1HV1A 4AHXA 4CTEA 4P14A 5KHGA 1EP0A 4LT5A 2E7TA 2DF7A 4AEDA 5K0UA 2BBVA 1C4RA 1QJU2 4CDWA 4GMP3 3T1MA 4L2NA 1AL0G 2VQ0A 3HR9A 2AREA 3IWZA 4HSJA 1W6PA 3VBSB 1Q8VA 2GN3A 2EVXA 2ZABA 1J1TA 1AYN2 3EBRA 1JYCA 4AI2A 3BOWA 3WVJA 2HJIA 3AMPA 4K20A 3B02A 3WG1A 1NLSA 2VULA 2CAUA 4L9BA 2PHWA 1ASJ2 4HSLA 5ACA1 1C5HA 2VW0A 3VBRC 2EAAA 1RVF1 3EJKA 2BEOA 2ILMA 2QFEA 4KWLA 2ZX2A 1RUC2 1UZYA 2FQPA 3VHOA 3HN1A 1QQP2 3I4IA 4K21A 2GN7A 4Q4V1 2OA2A 4XFFA 4QQOA 1FOD2 1YJKA 1XE7A 2E6VA 3ZFFB 4AG4A 4YFZA 1G9DA 3KQRA 1BQPA 1CESA 2Q5TA 1V6OA 4Q8LA 4R52A 1W0PA 1TMF1 2QVSB 5FPZA 1M06G 3QACA 4L97A 4AVAA 1YXWA 4I01A 1OLRA 4RHV1 2AUYA 1SFNA 1R093 4QPGA 1VJ2A 3SLIA 3VBFB 4AEMA 3IN9A 2YY1A 1C5IA 1EV13 1H9PA 3E6BA 1QOOA 5FLJA 2ZGOA 3ZXKA 4AK3A 1X36A 4QPIC 4Q4X1 1DYKA 1RGSA 3MW4A 4DINB 5HI0A 5JSRA 2WFF1 1YYNA 3AZZA 1S55A 1CAUB 4E2SA 4E2GA 3QD6A 2WLQA 5E89A 2JE9A 2R043 5GALA 3RMYA 2GH2A 4Q27A 4B4PA 2NP0A 4TSVA 2ZX4A 2DU1A 1ZRFA 2PELA 5KHHA 1RIRA 3TN91 3V0AB 3ZSMA 3ZX7A 1TME3 3USSA 1Y9QA 3PVOA 3MPPG 1JOJA 1LJ7A 2AH2A 4WZFA 4PLNA 3AMHA 2RR13 2X8KA 4B29A 1CAVA 2ZCWA 4DOUA 4JDNA 1MZEA 2WKKA 3DGTA 1RUOA 1QH6A 1DU3D 2VOXA 3D5OA 3V56A 1ZX5A 1PZ9A 3K48A 4JGZC 5H9PA 4ISRA 1NY72 4I3GA 2R16A 3WDXA 1DQ0A 1X7NA 4N7IA 4JTOA 2D6PA 4AF9A 1DGRN 4XQWA 1BKZA 4BH9A 2W52A 4CEWC 3VKLA 1OI6A 3POWA 3RSJA 4YZ5A 4KGGA 2E63A 4YYOA 1JN2P 1RUG3 4MGIE 3EQEA 1OPMA 3AKQA 2DFCA 2GALA 4XBLA 1Z7S1 2DURA 3AKSA 1KXGA 4IV3B 5T5OA 2YPJA 3VV1A 5ABJA 1F2NA 5CAZA 2IWGB 1CAWB 5SV5A 1ENSA 1X33A 1YHFA 1WBLA 2ET1A 1NYWA 1RUD1 2VMIA 2DCTA 1RUI2 4LBKA 1BMV2 1Y43B 3ZFGC 1OOPA 1V6JA 4GKXA 2B9UA 1I3HA 1HQNA 4B4QA 3LA2A 2JECA 2GC0A 4Q26A 5KWRA 1O5LA 2Y38A 4ZU5A 3AP6A 1V70A 1KITA 4M0HA 4R8HA 3MZHA 1UMZA 1PVXA 4XJAA 5BNNA 4JGYB 1O3TA 1SCSA 1PGL1 3B9IA 2Y26A 1KRIA 5D8AC 2XHKA 2UURA 4QQPA 2GMPA 2QCSB 1EY2A 4UW5A 4YM2A 5GLZA 2ZMKA 4RSUA 1F5JA 3MICA 3H0OA 5IK5A 2HWD2 5CFCC 5H9RA 3S7EA 1YUDA 1YCIA 4AHZA 1W6QB 1VBA1 3ATGA 5C8WA 3UV9A 1GYKA 2DCZA 4AI3A 2R062 4ZKTB 3M1HA 1S0BA 2NM1A 4XFGA 5BNQA 2CYFA 4HZFA 1PK6C 5AC93 3LGRA 5JI7A 4YSFA 2I45A 4EWDA 2RS33 4ORFA 5JAXA 4YM3A 4RGAA 3WNXA 3SH4A 4O9GA 3LOIA 3C2UA 4HPKB 3ZSLA 2CNAA 2XKPA 4K1ZA 4A3XA 4JAAA 5J48A 4LBQA 3JD71 1AL23 4TLFA 2B45X 2EXJA 2F4PA 4OUSA 1R1A1 3WW4A 2D43A 2XJVA 3IIAA 1UL9A 3D6EA 1REDA 2ZX1A 3H1YA 3VHRA 2GU9A 5T5PA 1WMEA 2OW4A 3A0NA 3AM2A 4XF3A 2VQAA 1AYN3 1ULFA 3RG0A 1FYUA 3IDCB 4N43A 2D5FA 4YVSB 1NCRA 1YFXA 2R0FA 2ZZJA 2X29A 3RDIA 2PAMA 1SLTA 1U12A 3ZN5A 4YVWC 2YGLA 3W59A 4BWOA 1QJU1 3AJYA 4RFT0 5TSWA 4L99A 2D6MA 4Y1YA 1H0BA 3LWCA 3FFQA 2GAUA 4Z1VA 4WM7A 2HKXA 1SLIA 5E1RA 3KGZA 4P9JA 4N53C 4PBPA 4A2UA 3JB4C 5EYXA 2XB6C 4FOQA 5DG2A 5FO9B 1HQLA 4QQ2A 1RUH2 3FUQA 4WVVA 1ASJ1 2K0GA 3ZSEA 4F8AA 2GC1A 1NA1C 3N4MA 1QXJA 4XBQA 5JOZA 1VBC3 2DCJA 5DZGA 1AR73 2GNBA 5ABJB 4YARA 2XJUA 4WM8B 3IDBB 1J3RA 1W6OA 4R9DA 4X6RB 2D3SA 4MXWB 4LO6B 1RUC1 1VAVA 1QQP1 1PZ8A 1GBGA 2WNVA 4QM8A 1PVC2 5CG9A 1FOD1 4IEUA 2GNDA 2ZJCA 5SV8A 5FAXA 1FNZA 5KC6A 3FUOA 1YJLA 4TYSA 4Q29A 1ENXA 5CVRA 1N1YA 3M8LA 5JZGC 3NWKA 2OUJA 5H9QA 5HCAA 3TNPB 4LBNA 5KXDA 1AR93 2A73B 4KU8A 3H1WA 4AFMA 5C9AC 4WVZA 2WL1A 3BOPA 3JZVA 5J96B 2JEMA 4COYA 3RS6A 4W65A 3BIWE 2BTVC 5F9TA 4CDQC 2HWF3 1KQRA 5GLTA 2AZ5A 2NZ9A 1MS3A 1WUVA 4B7EA 4X6QB 1WCKA 4JCKA 4Q0SA 3MF6A 4XF1A 1GLHA 4INDA 1ZZ6A 2ZGQA 2RE9A 3VBUC 1E57A 2VECA 4IEQA 4XTMA 1WCSA 1GNZA 1G9CA 2P34A 1HRI2 2D6NA 1QJY2 4YG6A 3AYEA 3RZZA 4FQZA 4LUMA 4D69A 4XMIA 2WT1A 2ERFA 2MEV2 3OD0A 5A3MA 4F3JA 3AB0A 4P9GA 4C0HA 2OPKA 2LM3A 5C8CB 4CDXB 1Z78A 3JQWA 4E4SA 2AYHA 3POSA 4YZ3A 5C4WC 1QNWA 3JQXA 1LEDA 1IZ3A 1U5XA 2PAKA 4D7YA 2X5IA 1C1FA 1BBT3 1A6CA 3ILFA 2P37A 4XZPA 3MGUA 1CONA 1QXRA 1OPOA 4KU7A 3GNEA 2YDEA 3AKRA 2C1FA 2JD4A 4P9LA 5J36A 2KM2A 1UCXA 5ACA2 1S2KA 2D6OX 2WIIB 1QF3A 1WLDA 4LBQD 2D3PA 3RWNA 1MQTB 1AUYA 2OIIA 2VNGA 3WUCA 1DGLA 2ZOEB 4X8PA 2WNUC 4EWEA 5GZGA 1LOCA 2ARXA 1EYBA 4Q4V2 1NZCA 4QU2A 1O4YA 3CJIB 1RUI1 1G9AA 4LO7A 1BYHA 1BMV1 5F1RA 2XKOA 4GH4A 2Z5WA 4FSJA 2XBO1 4BQ1A 2EXKA 3TYJA 2A3YA 2R063 3ETQA 3KS7A 2WNVB 4RHV2 3A4UA 1AHSA 4K9SA 4B4RA 3CNAA 1PIV3 1ND3A 2IFRA 1YWKA 3NL1A 5L7OB 2R1BA 3IDEA 5KBFA 4Y20B 3AYAA 4L8QA 1RUF2 1LULA 2Z79A 4YZ4A 3S7IA 4NVPA 4CEYA 1CGPA 1UU4A 2BNMA 5H9SA 4DQAA 4QM9A 3D82A 1G7YA 4QX5A 1LHUA 4AI1A 1FMD3 5JSPA 4RS5A 4Z8BA 4I3PA 4JV4A 4CYDA 2Z69A 4IV1B 2AGSA 2RMU2 1W6MA 2JG8C 4LNVA 1QDOA 1NQJA 1XNBA 2QZ3A 1VBB3 2Q1ZB 2NMNA 4OUMA 1OD5A 4XW3A 2VNOA 5DUWA 3TN92 3VBHB 5KHKA 4BIOA 1B35C 1EAH2 1YRZA 3FLPA 5T5JA 2JG9C 3ZDSA 2DTYA 3ZYRA 2ZGTA 1L3JA 3OD4A 1R081 3HBZA 2H6CA 2B39A 1Q8OA 2V5YA 2VMGA 3R05A 1NE6A 4YFWA 1AX1A 4F7ZA 1CIWA 3QCWA 4LLFA 5BPXA 1UX6A 4UBHA 3R6SA 4B8EA 1H8TB 1VB2A 4M3CB 1XNCA 3VBSC 3WT3A 1PO12 2RS53 4FT8A 5BNOA 2XJTA 3FBYA 2XG3A 2DVGA 2AENA 2GNMA 4XBNA 3WP3A 4CDUC 3OTFA 3POYA 2WWSA 1RUH3 4KG8A 3G7DA 3CF6E 3U11A 3AZYA 2WA3A 4I09A 2CGOA 2IFWA 1SLBA 2UY8A 2O0OA 4PCRA 4RD7A 3GBWA 4K8FA 5L73A 4J1WA 1GQHA 1Z7S2 2X5IB 2JE7A 1SCRA 1LEMA 4YW1A 5BNPB 4JQRA 2I07B 3LKJA 4XMAA 1HDKA 5J98B 1QHDA 3VUOA 2EA7A 2XJQA 4DS0A 1N1TA 1DZQA