4XZPA

Crystal structure of the n-terminal domain of human galectin-4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
148
structure length
148
Chain Sequence
PAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-4
publication title Full-length model of the human galectin-4 and insights into dynamics of inter-domain communication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 29
structure length 148
sequence length 148
ec nomenclature
pdb deposition date 2015-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4xzpA00
1ULGA 1UZYA 4P9XA 4DFSA 5H9QA 2P3IA 2E53A 5GZGA 4UW3A 3WZ1A 3SH4A 2E6VA 1IS3A 4NO4A 1N1YA 1V6MA 1YRZA 2A3XA 4NOTA 2NM1A 2CWSA 4GALA 4Q26A 1ENRA 1ONAA 4R9DA 1AJOA 2VY0A 2GMPA 1LHUA 3V0BB 4Q1RA 2CY6A 2E7TA 4UW4A 1R1ZA 1WUVA 5IK7A 3LSEA 2A3YA 1W6MA 1S0JA 5L73A 1KJRA 1W0PA 1AX2A 2OVUA 2ZHLA 1AXYA 1WW7A 3NV4A 4YZ2A 1LESA 3WCRA 3ZXKA 2EXIA 1HLCA 2R0HA 4FOVA 4YGEA 4PBPA 2P37A 2R16A 3USUA 4C1WA 5SV8A 3UJQA 4K21A 1DQ1A 4YW2A 2JD4A 5H9RA 4XBLA 1YI7A 3R05A 1LULA 2ZBJA 3AP6A 4BMBA 3M3QA 2JKBA 4YGBA 1MS1A 4ISQA 2XB6C 2JJ6A 4HANA 3MW4A 1HDKA 1NLSA 2D3RA 3WG2A 3IPVB 5EYYA 1QKQA 2V5YA 4LBLA 1LCLA 1Q8QA 2A6VA 3PMEA 4AGVA 1GV9A 1J1TA 1OKQA 1WW4A 3PVOA 5CB7A 2LTNA 4F83A 1G7YA 2GDFA 4BMEA 1FAYA 4XJWA 5HCFA 1AX0A 2OUHA 3FLTA 2PELA 1RINA 3WG3A 4BM8A 2R1DA 3UL2A 1WLDA 4FP2A 3N7LA 5IK4A 1V6IA 4YG0A 1UL9A 1DBNA 2ZGOA 3BTAA 5DZEA 2CTVA 1BYHA 3USUB 3WDWA 3NV2A 3B69A 1SACA 3MEPA 2A7AA 3N35A 4FOQA 3O0WA 4FOYA 1W6PA 4XBNA 1C4RA 1W6QA 4LBJA 1DHKB 1S0DA 1AX1A 2NMOA 3NV3A 3CNAA 3WDUA 2ZGLA 1UZZA 4WV8A 3O5SA 4BLJA 1LOAA 3BODA 3N7MA 3U4XA 3RQ0A 1SLBA 1DIWA 2ZGTA 3VUOA 1VALA 1N3QA 1ZM1A 2D7FA 3ENRA 3R4UA 1LOGA 1JHNA 1CESA 3AYAA 2VW1A 5KXEA 3ZSJA 1SCSA 4Q2FA 4M00A 3WNXA 3M3CA 5GLZA 3UK9A 3V0BA 2DVFA 5FREA 1FX5A 1IS5A 2EALA 1MVEA 1GZCA 3I4IA 3JUUA 4GWMA 3LCPA 2VH9A 1LGBA 1UKGA 2WT0A 4YW4A 4CTEA 2UWAA 1S0GA 1UN1A 2AR6A 2D6PA 1Z78A 1QMJA 1ENSA 3KM5A 4R9AA 3SNMA 3AP7A 2VU9A 1F9KA 2D3PA 3D5OA 2A6ZA 2D3SA 1LTEA 2R49A 1LOFC 1DQ4A 1LOBA 1GBGA 1Q8OA 1LHNA 2CWMA 1S1AA 3IPVA 3QCWA 5CAZA 4AGGA 4TYSA 2A6YA 1V6OA 2WQZC 5GLVA 3AP5A 4P9WA 3RMYA 4AGRA 2OW4A 2A6XA 1MS3A 2DWRA 2OUJA 2C9AA 5FRAA 2R0FA 1DYPA 1MS4A 1I1EA 5DUUA 3APBA 5JOXA 3RRDA 5H9PA 1G9CA 3NWKA 2UURA 2A75A 1ULFA 1G9DA 3D6EA 2WLQA 4Y24A 2DV9A 3AXEA 4H55A 3B00A 1DQ0A 1WW6A 3AYEA 3HR9A 2ZAAA 1PZ7A 1GYKA 2GNMA 1D2SA 1FYUA 1MZ6A 5GLUA 1YYNA 1LENA 2D6LX 4Y20B 1S0IA 2EF6A 3ZSLA 1SCRA 1ULDA 1GZ9A 2AUYA 1A3KA 4YFZA 4YM2A 1SBEA 1BQPA 2B7YA 3ZYPA 2WSVA 3RSJA 3POWA 3PJQA 4CRQA 3VV1A 1G9AA 2NP0A 1W6QB 1S0EA 4YG6A 1IS4A 2V73A 1W6OB 4M3CB 1S0FA 1N47A 2GNTA 3AZYA 5E89A 1AJKA 2A70A 1IKPA 1GLHA 1SLLA 1PZ9A 1WBLA 4XIOA 4YFWA 1KITA 3AJYA 3AXDA 2NMNA 2PHWA 3B01A 4YW3A 2GN7A 5DUVA 4XXPA 2AH2A 4XZPA 4YGCA 1U0AA 4YLZA 1KJLA 2UU8A 2ZGMA 4LBQB 3N7JA 1Q8SA 5DUWA 4LBKA 4Y1XA 5EXOA 1AVBA 2DVAA 3N36A 4IQPA 3IMNA 3VKOA 2SBAA 3VKLA 4XE9A 3RS6A 1KRIA 2DYCA 4KBBA 3SITA 2GALA 4M01A 1I3HA 4XHBA 4U2AA 3V64A 2GNBA 1FV2A 3AJZA 2YMZA 5JOWA 4GA9A 2ZABA 1DZQA 3AX4A 5E88A 3VKNA 2GMMA 1A78A 2DUPA 5GLWA 3LSDA 4XOGA 3ZXEA 4FPCA 1CPNA 1LODA 3Q9OA 3ZVXA 4ATFA 3AP9A 4D69A 4FOWA 2ZHKA 3AP4A 5DG1A 1D0HA 4AWDA 4TZDA 2EXKA 3IKWA 3PVNA 4ZXKA 4OZXA 3OGGA 1SLTA 3I8TA 4Y20A 5JDBA 2A5ZA 1UPSA 2JDZA 5JMCA 1GZWB 2DURA 2I2SA 3OBRA 4PBOA 1QGLA 2GMEA 4BPZA 1JW6A 1LOCA 1JBCA 1HKDA 2CL2A 1QNYA 2DTWA 4YZ4A 3M3OA 3ATGA 3B3QE 1QOOA 2DVBA 4ITCA 3W58A 1MS5A 1W6OA 4XJAA 3ZXJA 4M3CA 5DG2A 4JCKA 1BJQA 3AFKA 1N3OA 1DQ2A 2D6NA 2FHRA 1B09A 3O0XA 4DS0A 1JN2P 1GNHA 2CYFA 2YXSA 5GLTA 3ZXFA 1BZWA 1LGCA 5GZEA 2NZ9A 4L8QA 4K1YA 5BYNA 5HCAA 2DUQA 1CIWA 4LBQD 4FPYA 2LALA 5E8AA 3OYWB 1VAMA 5F9TA 3POYA 4LBQA 4FPLA 4BLIA 2YV8A 4LBOA 5JOZA 4JC1A 1C1FA 2WT2A 2PHFA 1CQ9A 2DUOA 1H30A 3IN9A 4K1ZA 2DTYA 1CVNA 1CONA 2YY1A 1YXWA 3INAA 4LBNA 3MW2A 3FUOA 1MS0A 2JE9A 2P3KA 3OY8B 3SLIA 2ZMKA 3OBTA 2WT1A 1FNYA 1QOSA 2WSUA 3KQRA 1IOAA 1DGLA 4GWNA 1UAIA 2RHPA 1W0OA 1N3PA 5T5OA 3A0NA 4M3CF 5CA6A 1OQ1A 1APNA 3T1LA 2ZGKA 1GICA 2ZGQA 1BKZA 3IM0A 4I30A 3WVJA 3N3HA 5CBLA 1EPWA 3M1HA 5IUQA 3B9CA 1H9PA 4DPNA 1JYIA 1VLNA 1SLAA 4R9BA 2PHXA 3POSA 1F31A 2CNAA 2PHTA 1GSLA 1MR5A 1X50A 3WG4A 2ENRA 3OJBA 1C57A 4XIKA 5EWSA 3AK0A 1DLLA 3AYDA 1JXNA 4XJ8A 5IK8A 1DQ6A 1IKQA 4XTMA 1LHWA 1WLCA 2ZGPA 2W39A 2ZGUA 1GZWA 3OPZA 1N1SA 5DUXA 1V00A 1MVQA 5F5QA 4XJZA 1LOFA 3DGTA 5DZFA 5GM0A 1TEIA 1WD4A 1MACA 3QLQA 3TB0A 1G86A 3WG1A 1Q56A 4HL0A 4Y22B 4R9CA 1UX6A 3C2UA 1CPMA 1S0CA 1AXKA 3WLUA 4YZ3A 2NN8A 1HQWA 4FQZA 4FPHA 4XYXA 1A8DA 2E7QA 4AVSA 2AENA 3FBYA 3OYWA 1V6KA 3BIWE 4Y26A 3FFZA 2E51A 3V0AB 4XMIA 2DVDA 3WUDA 1SLIA 4YG3A 3ZSKA 1Q8VA 4K20A 3WDTA 4XXAA 4FPEA 4SLIA 1LOEA 2D43A 2WJSA 3ASIA 4GKXA 5JVVA 5AVAA 4C1XA 1AZDA 4Y1VA 3AZVA 1Q8PA 3WHTA 1AXZA 1N1TA 2W52A 1O4ZA 5GZCA 3OY8A 3VKMA 1O4YA 2Z42A 2UWCA 4CZSA 3FLRA 1FNZA 4WVWA 4PQ9A 3FLPA 3NV1A 1LGNA 3PVEA 1UMZA 1IS6A 2DVGA 3GALA 3O12A 5H9SA 3HN1A 4W65A 1G8WA 2DU1A 4Y1ZA 1F5FA 5KXDA 3H0OA 4FP3A 3AZZA 3SH3A 1WBFA 2ZGRA 2EXHA 4U36A 1CR7A 2NYYA 4DRRA 4FVVA 4Z8BA 2D6KA 2XG3A 3AZXA 4Y1UA 4XTPA 5DZGA 5IT6A 2D6MA 1GKBA 2FMDA 4FPGA 3A4UA 5DXDA 2EAKA 4UW5A 1CN1A 1SFYA 2AYHA 4Q8KA 1RITA 3WV6A 3AYCA 1AF9A 4YM1A 1QOTA 3A0KA 4GXLA 2BQPA 5T55A 2UWBA 2D44A 1FV3A 2A6WA 2ZA9A 3ILNA 4YM0A 1ZA4A 1N1VA 1BXHA 3WDVA 2VXRA 4FQ4A 3ILRA 2R1BA 3JU9A 4Y22A 1NXD1 4XILA 3TAYA 5JLVA 4XBQA 1KDMA 2Q5TA 1ULEA 5CNAA 2VW2A 3ZPYA 1JUIA 1WLWA 2YROA 2EXJA 4XDQA 2GN3A 3WUCA 5JOYA 1V6NA 2PHRA 3V65A 2WNEA 4DQAA 4AYUA 3V0AA 1QU0A 1G9FA 4YGDA 1G9BA 1RIRA 1S0BA 1WCSA 4XJ9A 2ZHNA 3WDYA 2HYKA 1KDKA 3SH5A 3WDXA 1LHVA 4DRVA 4YZ1A 3DUIA 1QNWA 4Q1PA 5T50A 1LU2A 4PCRA 4XHXA 4YW1A 5GALA 4YZ5A 2KM2A 1LU1A 3WHUA 3W59A 2A3WA 2ZMLA 2VW0A 1WD3A 5GJ6A 1GNZA 2VUAA 2P2KA 4RA0A 4WVVA 1OFSA 2ZACA 1SBFA 1QDOA 1W6NB 2ZGSA 2ZMNA 3N7KA 1ULCA 3ZXLA 4AVTA 4BOWA 4ISRA 1LJ7A 2H0BA 3L2YA 4Y1YA 1C1LA 1URXA 3T1MA 3M2MA 4MYEA 2W68A 2D6OX 3UJOA 1DYKA 2DU0A 3AZWA 4BQ1A 2JE7A 1CJPA 1ENQA 4P9YA 1HQLA 3WOGA 4WZFA 2ERFA 3FUQA 2ES3A 2ZHMA 1SLCA 3BOPA 3GNEA 3ZSMA 1GANA 4RL7A 1XQNA 4GKYA 3R4SA 1W6MB 1MS9A 4JRAA 4YM3A 1LEMA 3M3EA 3O0VA 3MW3A 1QF3A 5EYXA 1VAVA 4AVVA 2ZZJA 2ARBA 1SBDA 1LEDA 3ILFA 2TEPA 4LBMA 4PF5A 4FPOB 4YW5A 1QDCA 2WKKA 5LK5A 5T52A 5KXBA 1YO8A 5GZFA 1JYCA 2C5DA 2EIGA 3T2TA 4Q8LA 1MS8A 4ASMB 1MZ5A 4XJUA 2AREA 1V6JA 2AGSA 1JOJA 3WCSA 1DFQA 3D4KA 3ZYRA 2A71A 2ZGNA 3SISA 4P14A 2ZKNA 5KXCA 2PHUA 5T5JA 1WW5A 5HCBA 5T5LA 4FPFA 1LECA 2JECA 4FPKA 1DQ5A 1VIWB 2P3JA 1YIFA 2SLIA 4M3CE 3VKFC 2ARXA 4ATEA 5T54A 1H9WA 1Y7BA 1FATA 3MPPG 3HMYA 5GZDA 4ZKTB 2P34A 4XMAA 1V6LA 1KQRA 4Q27A 5T5PA 3RMXA 1Z0HA 2GNDA 2YZ4A 2G4IA 5IK5A 1LHOA 2W08A 4FPJA 4UW6A 3RG0A 1PZ8A 1W6PB 1W6NA
chains in the Genus database with same CATH superfamily
1CD3G 1UZYA 4MGZE 4XFAA 2XL9A 3POJA 5H9QA 1W2AX 3O1OA 2R063 4UW3A 3WZ1A 2B46X 4QB6A 1OXCA 5FZ7A 1IS3A 2BWAA 4NROA 1RHI3 1E5SA 1V6MA 1YQCA 4NOTA 3ZFEC 1UXZA 4X8PA 5ANNA 2PTMA 2CWSA 1ENRA 3FWEA 4AL9A 4R9DA 2GMPA 4RQPA 2KD7A 1IQDC 3DKQA 5IW0A 3AM2A 3B93A 1WUVA 3KF5A 3MV01 4YVSA 2A3YA 3BKZA 3VD3A 1W6MA 3MIBA 4XUTA 2RJ2A 1MPXA 3CDZB 3UGGA 1ND3A 4B29A 1AX2A 3MICA 4EQVA 1OLMA 3FX3A 5FJKA 3NV4A 4YZ2A 1LESA 1UYZA 3KWVA 5I8YA 1UXXX 4G3YC 4RGGA 1F8VA 1FXZA 1JMUB 4D7TA 1OLQA 2FDJA 3GZAA 3CU7A 2RR12 5FY7A 3UESA 4LEJA 2JD4A 1XE8A 1CZVA 5H9RA 3KT1A 4XBLA 5A3MA 2RM22 4JKLA 1RVF2 3K77A 3M3QA 1HRI2 4AQ6A 4ISQA 1NCRA 1AR73 2JXAA 4HANA 3ST7A 3IPVB 1QJU2 3M3IA 3VBUA 5LWBA 1D4M3 1U5ZA 2VNVA 2Y33A 4BDVB 1LR5A 1Q8QA 4V2WA 1GV9A 2DFBA 4F83A 5JIUA 2LTNA 1G7YA 3C3VA 4QT6A 2GDFA 2K2SA 1L7LA 2WS91 3CEWA 1AX0A 4YW6A 4N53B 4OCTA 4URTA 2W87A 1RINA 1PGL2 3UL2A 5HI0A 4CU6A 1WLDA 3UKVA 4TLFA 2AZ5A 1UL9A 1DBNA 1AYN1 5DPNA 3DN7A 3NAPC 3N35A 2A7AA 3O0WA 4O65A 2HWC2 4YYOA 1DHKB 4OYUA 4WBBA 4QX1A 3T0BA 3NV3A 4E4HA 4WV8A 5I0DA 3ORJA 4ZZ8A 4CEYA 1SLBA 1DIWA 2AACA 3MBWA 1CZTA 3VUOA 1VALA 5J37A 1ZM1A 2MEV1 3HBZA 3AYAA 3WNLA 5C3QA 2R6QA 3ZSJA 2WO7A 4QXBA 4M00A 1V0AA 4GMP1 5GLZA 3AKPA 1JYXA 3H1WA 2HKXA 5CFCB 4M4RA 3CMGA 2GH2A 4MX3A 2VM9A 1IS5A 2EIEA 1MVEA 1QJX2 4QXCA 4L92A 5C8CA 3JUUA 4GWMA 5JSOA 1UCXA 1W99A 2VH9A 4YARA 1EAH1 5IVVA 5FYSA 4YW4A 4CTEA 2AC1A 2X09A 2UWAA 1S0GA 1UN1A 5IVCA 2D98A 1PX3A 5J1XA 2WS93 4X8NA 1KS5A 2D3PA 4WM8B 3D5OA 1JU4A 4AEJA 3MFAA 1SMVA 4WM7A 1LOBA 1Q8OA 2Y8KA 4IESA 3MIDA 2QFEA 5K4LA 4AF9A 4AGGA 5IYYA 1AYN3 3I7DA 3OSDA 2O1QA 2WQZC 5GLVA 3ZFEB 4IEQA 1YQ5A 4MGSA 1VPHA 3LZZA 4ZU4A 4AGRA 2OS2A 4AI9A 4AVCA 2A6XA 1MS3A 2OUJA 2RE9A 3RYKA 4FAGA 2R0FA 3GF6A 3GBWA 4ZY9A 4QX7A 2RDRA 3H50A 1GP4A 3ECQA 3J9SA 4QQ2A 4QX5A 3KB5A 2A75A 2BZDA 4HMZA 2WWJA 3LDKA 5I8SA 4H3WA 2BW8A 4IGPA 4Y24A 5C9AC 2MEV3 3O1TA 3RZGA 2QQNA 2X10A 3B00A 2C24A 1O3TA 1AL22 5ISLA 4GJZA 4GMP3 3T4VA 1FYUA 3A22A 3HN3A 1LENA 2D6LX 4Y20B 5LRSA 4N9IA 1GZ9A 2AUYA 4DUXA 4DINB 5JUVA 2B7YA 4D94A 4WVZA 3POWA 3RSJA 2WC2A 1EAH3 2ET7A 5FQ0B 4YG6A 3CJIC 2XONA 5IFTA 1W6OB 4HKOA 1V9U2 3N9MA 4RN5A 1N47A 1D0GA 2GNTA 3AZYA 5E89A 4JDOA 1AJKA 5FZBA 4NIAA 5HBAA 1JZ3A 2A70A 5FLJA 4IDZA 3RVHA 3VD5A 5K0UC 1OD3A 4QX3A 1KFXL 4P02B 1PZ9A 3FJSA 4YFWA 1HJGA 4YW3A 5LBBA 1W8WA 4XFGA 4CUCA 1C8M1 2GN7A 2Q0AA 5DUVA 3ACLA 3IDBB 4XXPA 1PMHX 2OT7A 4YGCA 1NY71 3B94A 4YLZA 5IVFA 5A33B 5DUWA 2FCVA 2VUDA 1NQDA 4B3NA 3DKWA 4NR1A 3VKOA 3EYPA 4MV2A 3OGRA 3E5XA 3RS6A 4NIGA 5F39A 4OI1A 1KRIA 5F1RA 2Z79A 4LIUA 3SITA 1QJY1 1PO12 2V4AA 5FXZA 2D40A 4U2AA 3SEPA 5DN2A 3AJZA 2CSGA 3D8CA 4NPLA 3VKNA 5JWPA 1B35C 4E4ZA 4JHZA 2RVAA 2BVBA 3VBSC 2Q1MA 3FHIB 3NW4A 4FFGA 3ZVXA 3QACA 5I0SA 1RUJ1 4ATFA 4MSVA 3AP9A 4D69A 4NWWA 1SDWA 2ZHKA 4C0HA 1O3SA 4CP2A 1I9RA 5FZIA 4PIYA 1QIQA 4LUKA 4TZDA 4BU2A 3PVNA 2NLRA 2XKPA 5FLIA 3KT7A 5D1IA 2GH8A 5A7NA 1GQHA 1NKGA 5JMCA 2XVKA 1PNFA 1JODA 1NE4A 3TBDA 1Z7S1 3OBRA 4YNIA 1OA3A 3VBFC 2ZX3A 1C8M3 1CGPA 2VR4A 2DTWA 4YZ4A 3M3OA 5IHRA 3ATGA 3B3QE 4NAMA 3L9JT 2VMGA 4I2OA 1MS5A 4BE3A 3I3MA 1ZA7A 1PK6A 5DMYA 2D6NA 3O0XA 4HK8A 1HV1A 1OPOA 1WMXA 2E26A 1ODNA 2YXSA 4XF3A 1FOD2 4XEZA 2XLGA 5GZEA 5C6CA 4H2AA 2YGMA 4K1YA 1QJY3 2YC0A 4Q4Y2 4LBQD 3ALQA 4FPYA 1WLTA 1HRV1 4JTNA 5A80A 4QB2A 2VL4A 4JC1A 5C9AB 4JGYA 2HLEA 2PHFA 2VG9A 2Y34A 2IFRA 3H8UA 5SV5A 3IN9A 2FMYA 2DTYA 1CVNA 1VE0A 1ZNPA 1CONA 4LBNA 4NIIA 3CO2A 4LKDA 4M0HA 1RUJ3 5FYCA 4AAPA 1MS0A 2JDKA 2Z69A 4Q0SA 2JE9A 5FZOB 4BIFA 3NNJA 1W8NA 4H7LA 3OF1A 2WSUA 4KU8A 1EV11 2ZCWA 3KQRA 4LK6A 4Q4W2 4KGGA 1PO22 2RHPA 1W8UA 3CJIB 4CDXC 3RZHA 4I02A 2WBKA 1EPZA 4GWJA 1JS9A 4M3CF 1Z7S3 4IEYA 1APNA 2VQTA 4AFBA 4ES9A 4I30A 1OA2A 5FPZA 3JXSA 2VBBA 4OZOA 1H9PA 2WQ8A 1JYIA 3HQXA 1KFUL 1SLAA 5A3WA 2W1SA 1GSLA 1MR5A 5FYBA 4PJYA 3BUCA 2ENRA 1XNDA 3OJBA 5A1FA 1C57A 2IXHA 4L11A 1BBT2 1CZSA 1DLLA 5IK8A 1RUI2 1WLCA 2WR9A 3ZFFC 1RUG1 3OEBA 2W39A 4MUVA 4YVWA 4BQWA 1IPSA 1GZWA 4CU7A 3GZEA 4LA3A 5F3EA 3IWZA 1HRV3 1TNFA 1H4HA 1W39A 3HT2A 3PIGA 4XJZA 1H1MA 4NPMA 5DDJ1 4CCNA 4E8DA 5GM0A 1TEIA 4IE6A 5I0TA 5FPBA 3TB0A 2FCTA 3WG1A 1J3QA 1W9WA 2WL1A 3RNSA 5A7SA 3PJYA 5DAWA 3LQCA 4GB31 1SHWB 2KXLA 4QPIA 4R9CA 4Y22B 3C2UA 5FK7A 5C5TA 1B35B 4IEPA 4DZGA 1OVSA 1MZFA 1HQWA 3MO4A 3VBSB 1UZWA 1A8DA 2E7QA 3NSTA 2PLV1 4XAEA 1IPJA 1POQA 1EV13 3M70A 3VHRA 1OVPA 4P9IA 5F3CA 3FFZA 4LR4A 2OYZA 2DVDA 1SLIA 4YG3A 1VMJA 1Q8VA 3ZSKA 2QVSB 2ZXQA 5K9YA 3ASIA 1UYYA 4RYDA 3I49A 1L7QA 2PHDA 3FHQA 3T09A 4E4SA 1QQP1 4UWDA 2YU1A 5EIYB 3K48A 2BUKA 3WHTA 1DDLA 1UYPA 3OG2A 4N43A 1JZ2A 2VQUA 4UBHA 1O4YA 2Z42A 5FAXA 3HT1A 2GC1A 2B4KA 1FNZA 4KBZA 4PQ9A 3PVEA 3NV1A 4BQ2A 4DMIA 2BRTA 1UMZA 5BNPC 1RUG3 3GALA 2ORZA 2VZ1A 3O12A 3RI9A 2CGPA 2H6BA 1K45A 4PI2A 5A3PA 2QZ3A 2XL7A 1WCQA 2FDIA 3VDBA 2VMCA 1VMHA 5FDBA 4PLOA 4U36A 4L97A 2W91A 5DDJ3 1YFWA 3ZFGC 5CU1A 3BPZA 2D6KA 2XG3A 1NA1B 4IV1A 1PM7A 3PDQA 1L3JA 4GB33 2R042 1RUF2 4ONUA 3GYDA 3A4UA 4FXKB 5DXDA 1A8MA 2R7EB 1FPN2 4Q8KA 1AR92 2VMFA 1AF9A 1E57A 2RR11 2ZX1A 2PLV3 4YM1A 5ABJC 4GH4C 4GQ7A 3WF3A 3RWNA 1QY4A 1MEC2 2RM21 4P9JA 5T55A 4AAXA 1RVF1 4YVWB 3TYJA 3WW3A 5LY1A 1HRI1 5A3OA 4QD2A 2F17A 1UKRA 4YM0A 1N1VA 1BXHA 5HXMA 1QJU1 3Q8FA 2PA7A 5FYHA 3ILRA 1QQP3 4CDXB 4Y33A 2VNOA 3GZUC 1XC6A 3AKQA 4Y4YA 2VQ0A 1FMD2 3THTA 1V6NA 2IVIB 5A70A 1CJDA 1NLRA 4J6GA 1G9FA 3AKTA 5C4WA 1PGL1 3OGSA 2JD9A 2J1VA 5EQUA 4XJ9A 4IEWA 2HYKA 4RS5C 1EUTA 2W1WA 3WDXA 1LHVA 4DRVA 3DUIA 1OF3A 4KNCA 1CAVB 1OQDA 2HWC1 1LU2A 5FP8A 4PCRA 4DO0A 1HB3A 5GALA 2DBNA 4WZCA 5JZGA 1LU1A 1XSQA 4F8AA 1WMFA 3EMRA 2G9GA 1ASJ2 3I3EA 3DYOA 2VW0A 1WD3A 4ZS2A 4QQHA 2VUAA 2P2KA 4RA0A 1GQGA 4OHYA 1TQ5A 2ZACA 1QDOA 1W6NB 5FXVA 1SZBA 4LULA 2RR13 3QBQA 1W05A 3DYMA 4DNYA 1RTVA 4KG8A 4AI1A 2QQMA 2RM23 1QH7A 4UBGA 1RVF3 2W1UA 3OOXA 1URXA 4MGYE 1HRI3 2ZAHA 4MYEA 1QJX1 4S2GA 1Q43A 4OUEA 5I0UA 3AMMA 4L9BA 1QJU3 2VBDA 4TSVA 4BQ1A 1CJPA 1NYWA 4OHVA 2B5HA 2PFWA 4QHBA 3WOGA 1HJFA 2CHHA 2ERFA 4P5HA 4FFIA 2VMEA 3ZSMA 1SLCA 4MGTA 5FYVA 1GOGA 2BEOA 1JI6A 5G04L 3R4SA 4NHMA 4IEVA 5L7OC 4P9LA 3QOPA 5HV4A 3M3EA 3MW3A 3LB9A 4IE4A 4BK4A 2Q30A 4CDUC 2ZZJA 3DF0A 1OQEA 1LEDA 4LBMA 2VMIA 4YW5A 2WKKA 2XH6A 4HKLA 4ZZ5A 2WWSA 3FL7A 4CPBD 5BNPB 4XFHA 2C5DA 2OXBA 3T2TA 2HWC3 2WLPA 3VBHC 4LK7A 4COVA 2XBO2 5A1LA 4LUMA 4UFHA 3LKJA 4EJRA 1RJ7A 2ZGNA 3CF6E 3H7YA 4BHPA 2W46A 3ZFGB 5FYTA 5T5LA 4FPFA 5FJHA 2MNGA 1DQ5A 2QE3A 4KG0A 1AL21 2SLIA 4M3CE 1H9WA 3I59A 4Z82A 3H42B 4ZKTB 2JIJA 5F37A 1SFNA 1QJX3 4GH4B 2VZTA 5B4XA 1ZZ7A 1Y9QA 5T5PA 3T3YA 4HVQA 1RUOA 3RMXA 1UMHA 2W08A 4DXZA 3GGLA 4JGZA 3AL5A 2UURA 4D3WA 4UF0A 5DQ0A 1ULGA 3LA7A 1V9U1 3BGAA 2P3IA 2E53A 4TWTA 5GZGA 4OQ9A 1U5YA 4Q0PA 3SH4A 4BWOA 4CDWC 3D0SA 2VZ3A 5D8AC 3OB8A 4Q0VA 3E97A 2TNFA 1DYOA 4K6BA 3LPFA 4QPGC 1ONAA 1D4VB 1JH5A 1W8HA 1A34A 2VY0A 3V0BB 1Q3EA 4Q1RA 4L99A 4UW4A 2BYVE 1R1ZA 3U78A 1VBD2 3DEMA 1F2NA 4RS5B 5L73A 1NCQB 4CU9A 1W0PA 2JDNA 3ZXAC 3GCWA 2OVUA 2Q8DA 1RJ8A 1AXYA 5LEKA 4S2DA 2JDMA 1D2QA 1HLCA 1PO11 2VZOA 4FOVA 4XQ4A 3WQ0A 2P37A 5CG8A 5SV8A 3UJQA 4MO3M 5FR3A 1POV1 1AL23 4BQXA 4D7SA 2FCUA 1YI7A 3ZMNA 3R05A 1UOGA 5JI7A 4Q4V2 5FZDA 2JKBA 1DF0A 3WW4A 1YUDA 4CP9B 2JJ6A 3S30A 2D3RA 2EA7A 1VBB2 3HNBM 1J83A 4XFCA 2V5YA 4LBLA 4QB1A 3PMEA 5FUPA 3PVOA 1WW4A 1PVXA 2RMU2 4LLOA 2YBPA 5CKQA 1BEV2 1V9U3 2Z2SB 3E6DA 4BMEA 4E2QA 4FBFA 5HCFA 1OMIA 2OUHA 5AVPA 2VQAA 3EXUA 3LE0A 4YRDA 2O14A 5CFDA 1BMV2 4BXFA 2PELA 3DV8A 3WG3A 4BM8A 3ZKUA 4KWUA 4FP2A 5L7OB 4YG0A 3BTAA 4JZRA 3WDWA 2ZX2A 2VVDA 1VP6A 4DEVA 1RB8G 2CV6A 1YQ8A 4PHZA 1W6QA 1R092 2ORXA 2JDHA 4LBJA 5AC92 2VZPA 3OTFA 1UOBA 3MIGA 3CNAA 2V4VA 2ZGLA 1UZZA 2Q1ZB 3O5SA 4BLJA 4D0QA 2FD8A 1F4HA 4YSFA 1K12A 1NUKA 2ZOEB 1FOD1 2ZGTA 3CKHA 3OBAA 1W8FA 4Q4Y1 1N3QA 5HXVA 4NAOA 1PO13 3VBHB 3IT8A 1JOPA 2D7FA 3NNFA 5C33A 3LF7A 3R4UA 1ZX5A 1JHNA 1CESA 5B2GB 1POV3 5FKBA 1UIKA 1BCXA 4Q2FA 1YFYA 3WNXA 4BA6A 3VBRC 2QUOA 3DXTA 2ZJCA 1PIV2 1W9FA 2QQJA 2X5IA 5FREA 1YJKA 1GR3A 2VGDA 5IWFA 2J42A 4IUGA 1MQTB 3I4IA 3AFGA 2BV4A 3LCPA 2W94A 4I01A 2ZEWA 1W8ZA 1REEA 1VJ2A 4OMCA 3VZMA 4LO7A 1LGBA 4XZUG 3W20A 3MI8A 5C5UA 3HJRA 3EBRA 2D6PA 2G19A 4KMQA 1QMJA 3SNMA 4GWIA 4LKEA 4Q4W1 1F9KA 1K5MC 1PO21 3A21A 1JYWA 5LBFA 3VZKA 1HXS2 3IBMA 5A7OA 1LHNA 1S1AA 2CU5A 3IPVA 5CAZA 4KI5M 4LKFA 2JENA 3VZJA 1ZRDA 5D8AB 1ZRRA 4QPWA 3N9NA 5FZHA 3ZPOA 4CXWA 4HKWA 2RS32 1OUSA 1ZZ6A 3O14A 4AEDB 5FCCA 3KHCA 1MS4A 3F95A 4DY5A 3APBA 1BBT1 5JOXA 1UU4A 1JZ6A 1GUIA 1RUH2 1G9CA 1RUI1 1ULOA 1NAEA 3NWKA 4N53A 1S55A 3EJKA 1FOD3 2VZSA 2Y6LA 4L0PA 4Q4Y3 4QDRA 1G9DA 2OIIA 5FY0A 4NMIA 2DV9A 3NO8A 5FMOL 2ZAAA 1PZ7A 1MZ6A 3U1XA 4UYBA 4GULA 1S0IA 4E8CA 3ZSLA 5DAQA 1SCRA 2YBKA 1ULDA 2FDKA 1J1LA 1YNAA 2VTFA 3NKGA 4TLGA 4IETA 4YM2A 4O7XA 4HT1T 3ZYPA 3TEZA 3BI3A 1X36A 1QXJA 4YPJA 4CRQA 3VV1A 4CP0A 2NP0A 4XF0A 4OHXA 1CX4A 1W6QB 3P3PA 4QM8A 5LZ6A 1IS4A 4ZONA 1DZTA 5K7PA 3WP6A 5FWEA 1GOHA 1S0FA 4Q4W3 5IVYA 1ZVFA 3OGVA 1CAWB 5KC6A 1PO23 2P17A 4C8DA 2XLAA 1GLHA 5CFCA 2VCMA 3U10A 2CGOA 2E63A 4ORFA 4RQPC 3UT0A 1KITA 4XACA 1GNYA 4XZPA 2GC2A 4JX0A 3S7IA 5KHGA 1KJLA 5FLHA 5FYYA 3MF6A 1Q8SA 2X5IB 3OUHA 4LBKA 1AVBA 4IGQA 3N36A 2ZTNA 4HPKB 2SBAA 3BOWA 1BBT3 3J26N 2WQ4A 4WM8A 2L9LA 1RUI3 3IAQA 4CDQB 2V09A 5FFOC 3MIFA 2YG0A 2PXJA 1I3HA 4XHBA 3VD9A 1XU2A 3V64A 5JPMB 4OHZA 1W0NA 3LGRA 1GOFA 4GA9A 2ZABA 1YC61 5CADA 3ZFEA 2JG9B 3VBUC 2GMMA 2DUPA 4GJYA 4LOSA 3LSDA 2WRAA 2Y0IA 3H9AA 3H1YA 3CHXA 4XOGA 2ZKLA 2WWUA 1CX1A 2V5DA 2BGCA 3ZXGA 3VBRB 1CPNA 1LODA 2R041 1IGOA 1RUF1 4LHSA 1STMA 1GZTA 1Y4WA 1FPN1 1AR91 1IPKA 3AP4A 4R4ZA 4LO8A 2VCBA 2EXKA 3AKSA 4ZXKA 1MEC1 1VAKA 4OZXA 3OGGA 1SLTA 4IGOA 3ZN6B 3I8TA 4Y20A 3T0DA 1UPSA 3P1IA 2BERA 2DURA 2I2SA 4CUGA 1QGLA 5LA9A 1JW6A 1UOFA 1K5MB 1CAUB 1S4CA 2CL2A 1QNYA 2GSYA 5EHDA 5LW9A 3BPSA 3KGLA 5TSWA 3W58A 5FQ0A 3RWKX 4CEYC 4EV0A 1W6OA 2WNUC 3E6BA 5ERLA 4K8RB 3ZXJA 1P8JA 4ARYA 3TEYA 1FMD1 1O6UA 1N3OA 1T6GC 1XBFA 2QQIA 1B09A 4IE0A 2Q8EA 1XYPA 3SCGA 1JN2P 1GNHA 1BZWA 2RJLA 4L8QA 2VECA 4QHZA 1UZ0A 5FP4A 2DCJA 3OYWB 2NPIA 1VAMA 1W28A 2FZ1A 2BNNA 4NWVA 3AMQA 5A33A 4QKNA 3SXWA 3KCCA 1H8TB 3HQUA 5C8CC 1JZ5A 2R30A 3ZYFA 5LEJA 1CQ9A 3PVBB 1AYM2 3NJZA 3ZXDA 1ASJ1 1PM4A 2CDPA 3NAPA 1YQ2A 2R043 1RUF3 3DL3A 3FUOA 4W6XA 3VBOB 1GFF2 2HEWF 2JICA 3GZTB 4OFGA 1FPN3 3WF2A 1AR93 3OY8B 3SLIA 2ZMKA 4LE4A 5C70A 4HBNA 1QOSA 1OFNA 1LNSA 4XQWA 4PT6A 1IOAA 1MEC3 2BOJA 4GWNA 4NPRA 4EWAA 4QDQA 3ZR5A 1Q5OA 3Q8CA 1OLME 4BIOA 5A6YA 2FDHA 5CA6A 2R072 2ZGKA 1ZBA1 2ZGQA 5CBLA 3WVJA 3M1HA 5IUQA 4LHLA 3B9CA 1GP6A 4JTOA 4FTEA 3J4UH 4QMAA 2PHXA 3ZO0B 4ZU5A 1F31A 2E31A 4K40A 3WX5A 2X05A 4LNVA 3WG4A 4LOTA 1VB2A 1FMD3 4XIKA 4LMFA 5A6ZA 1O8PA 3AYDA 3T2QA 1IKQA 4CUAA 3LDRA 2VOTA 4XTMA 2NQYA 2QCSB 2ZGPA 1UYXA 2ZGUA 3LA3A 1H0BA 2GP3A 3VZOA 3IIAA 3VHNA 4CCKA 3MHZA 4Y5Z0 1OD5A 3IDAA 3N4MA 1IZ3A 1VB4A 3AVSA 5L9BA 1S2EA 1WD4A 3QLQA 3RI8A 2Y6KA 2XBO1 4HL0A 1WKYA 2CDOA 2E9QA 2WYSA 3C7EA 3K4ZA 5C7GA 1ASJ3 4QWNA 3RYRA 3KHBA 4A7ZA 1UX6A 5LB6A 3F2ZA 2ZX4A 3WLUA 4HN0A 2XVGA 5ACA2 4FPHA 2IFWA 3RDIA 2D5FA 3RYPA 4A7KA 1JYVA 3SHRA 5CG9A 2P4EA 4KU7A 5FZLA 4AFCA 1E5HA 5EV7A 3WD5A 1ZYBA 4PDWC 3V0AB 5C9AA 2ZEXA 3O7OA 3T2OA 2XJPA 4FPEA 1ZBA3 1LOEA 3LIHA 3MLKA 5JVVA 4TTGA 2W47A 2WO2A 3UNPA 1AZDA 2PAMA 5FZOA 4C0BA 1YI9A 1N1TA 2W52A 4V2VA 1SPPB 4N7IA 4XF4A 3VKMA 3W5NA 2XOMA 2UWCA 3E5UA 3NAPB 4CZSA 4FI9A 4YW7A 4WVWA 4AXOA 4CSWA 2YC4A 3WNOA 3CJIA 2JG8C 4HXCA 5F6LB 3T2PA 1AHSA 3ME2A 1QJFA 2DVGA 2WNUB 5CYYA 5FTTC 3HN1A 4W65A 2B39A 4Y1ZA 3N9LA 3K4AA 4RFRB 1OSGA 4AHZA 2IXJA 5KXDA 3NQHA 3AZZA 2IXCA 1WBFA 5DABA 4DOUA 1CR7A 3CZUA 5KC5A 1VBD1 3AZXA 4Y1UA 5DZGA 2XBO3 4LHKA 3TRSB 3GXUA 2FMDA 2VZRA 1UIJA 4FPGA 5JIAA 4A7YA 1UY3A 2F4PA 2I07B 1KD7A 4ARXA 1SFYA 4Y5TA 2HBTA 3WV6A 4E2GA 5FZGA 4KWJA 3R4DB 1GWLA 1YCIA 2PAKA 3K3OA 4QGMA 2DF7A 4JKKA 2ADEA 4Q4V1 1FV3A 2A6WA 1H2MA 3ILNA 2HWB2 5JXGA 1ZA4A 4W6WA 5D21A 2BBAA 4DY3A 4XUNA 1VBB1 2R32A 3FHAA 4Y22A 5BNQA 1NXD1 1KEXA 3TAYA 4XETA 3GBGA 1B35A 1KDMA 2UYBA 1ULEA 5LBEA 4NIHA 3U07A 3AL6A 2ATFA 4QKFA 2RMU1 3VBSA 1AR62 3O1RA 1BEV1 1JUIA 1WLWA 2EXJA 1W2UA 2VJXA 3S0MA 4XDQA 3WUCA 3ZDVA 1H8VA 2PHRA 1BMV1 4K8FA 1ZRIA 4AYUA 3HEIA 3PUQA 4W4ZA 3THPA 1RIRA 1S0BA 1WCSA 2BTVC 3KCYA 3U11A 3ZR6A 4JGYC 2YC2A 1U5XA 5IVBA 2RS52 3CQOA 4M0NA 2FBEA 4R52A 3LAGA 5T50A 1R091 4D6RA 5AC91 1VBD3 5EPAA 3BVCA 3Q8BA 4UFJA 2C1FA 4HN1A 4GAZA 4IXLA 4HSLA 1F35A 2EAAA 5GKAC 4BQ4A 1L7RA 1SBFA 2QDRA 2BU9A 2DCKA 5EJ1B 1T2XA 3ZXLA 1XNBA 1HN0A 5FP9A 4XDOA 3IMMA 1LJ7A 3LEIA 3PHMA 5EJ3A 2Q8OA 2LW8A 1VBC2 4AHXA 2YUEA 1PIV1 3MZHA 4PLNA 4Y1YA 4CCCA 4Q4V3 2WAOA 2W68A 1NA1A 2D6OX 4QGNA 1PGW2 1YFXA 1VBB3 1WWYA 2XMLA 5K0UB 1UY1A 3WT3A 1DGWX 1ENQA 1W2OA 2PHLA 4P9YA 2J1EA 4WZFA 3PUSA 3FUQA 3I2GA 4PI0A 1VBE2 4QX0A 3BOPA 5FXWA 2RMU3 1GANA 4Q0UA 1BEV3 1JTZX 4C90A 4FTSA 2J1RA 4Z1VA 3LOIA 4CUBA 1OH3A 3OGJA 3CLPA 5EYXA 1WCDJ 1HXS1 4CEWC 1SBDA 3USUB 4PF5A 5T52A 5E1RA 5KXBA 1X7NA 3FE5A 1LB2A 4ZPIA 1ODMA 4CP1A 2JG8B 5GZFA 4CDXA 4CCDA 5IVJA 4XPVA 4HG6B 3H1MA 3WF1A 4KWKA 4QPIC 1MS8A 3BIEA 1MZ5A 1R093 2HBUA 3I3DA 4XJUA 5FO7B 5AC93 1TME2 5F5IA 1JOJA 3WCSA 2XJQA 3I2KA 2CGNA 4D6QA 1RUH1 2HJIA 1TG7A 1NX9A 3SISA 4CVUA 5A7WB 1XXNA 4IL7A 3LDBA 5KXCA 2PHUA 4O9EA 1LECA 2JECA 1ST8A 4UXAA 2JEMA 3B02A 2ARXA 4ATEA 3GJBA 5T54A 1PIV3 4S2HA 1US3A 1CAVA 2W3JA 5GZDA 1ENXA 2Y6FA 1R1A2 1LKNA 1QWRA 2F4LA 4AI0A 4N43C 1KQRA 3PURA 4URAA 1Z0HA 2JX9A 2YZ4A 2BGPA 2WNVC 2YPDA 4FPJA 4UW6A 1O7FA 1W6PB 5FZ0A 2IUWA 1W6NA 3H3ZA 3VBFB 4DFSA 1ZREA 3T30A 2QTWB 4Q29A 2VTXJ 2E6VA 3OBZA 5JR2A 3J8F2 1J3RA 4LPLA 2PQQA 2A3XA 1HXS3 2JB4A 2NM1A 3WF0A 4CA9A 3I2JA 3KZ4C 4PLMA 2EICA 2VO5A 5FZ8A 5A3LA 4UT5A 1LHUA 1O8SA 2E33A 5KHHA 1ND2C 2CY6A 2E7TA 1H4GA 5FMOS 2JDPA 3JBG2 1S0JA 4HZFA 1KJRA 3BU7A 1RUH3 5DAXA 1WW7A 3ZXKA 2EXIA 4MGKE 2R0HA 4YGEA 2BNOA 3WNMA 5JR7B 1CWPA 3UV9A 4RSUA 3IDCB 4K21A 4QQPA 4YW2A 4QM9A 3PTRB 1HB4A 2GU9A 4HVOA 5L9RA 5BNPA 3KV6A 2D97A 4BMBA 1LULA 2ZBJA 3AP6A 4H14A 4XUOA 5FZEA 3WSOA 5JPNB 3PMSA 1I5PA 1MS1A 2ADDA 3VZLA 3ROUA 1OLRA 1HDKA 1NLSA 4AI8A 5EYYA 1QKQA 5J7MA 2VVFA 3ZFGA 2Z5WA 1UD1A 1AL0G 4OI2A 3OD4A 3U37A 1FAYA 4JAAA 4XJWA 3G7DA 2WS92 4NIDA 1O4TA 4GH4A 3N7LA 5IK4A 3DPRC 2E7AA 5CVRA 4LKSA 1CAXB 2ZGOA 3THCA 3UKNA 2CTVA 1E5IA 4IV3C 3ZFFB 3R0RA 4A6OA 1SACA 4R4XA 3MEPA 4FOQA 4CEWB 4FOYA 4XBNA 1RMU2 3WQBA 2RJKA 5BNNC 4I3GA 2XUEA 4R8HA 2NMOA 5C3RA 1E5RA 1S2KA 3N7MA 3BODA 3LPGA 3JB8A 1ALYA 3U14A 4AFDA 3T0AA 2G9FA 1R082 2I74A 3A23A 4LO5B 1K3IA 1LOGA 4COWA 2VW1A 4NUBA 5KXEA 4L2NA 2UY9A 3UK9A 3V0BA 1NT0A 3IAPA 2WIIB 1HQNA 4MH0E 4NE9A 4COZA 4I0WB 4RS5A 5EFUA 2VOVA 4ZU7A 1NCQA 2XHNA 3UETA 4COUA 1UKGA 5APAA 5LATA 4LT5A 4LJHA 1UO9A 3MLJA 1ENSA 1RC6A 1TMF2 4HSJA 2FDFA 2OKXA 3RPQA 2VU9A 1GMMA 2WNVB 1X9TA 2QQOA 2A6ZA 5F3GA 2D3SA 2LUWA 3I3QA 1LOFC 1AUYA 1H1IA 2YFZA 2R071 5BNOC 5FY9A 4CP9A 5FV3A 5K8SA 4EN7B 5JXJA 5A7QA 1S2BA 2A6YA 4XDPA 2XXZA 1V6OA 4OHWA 3AC0A 4AVBA 1GWMA 1XNKA 4OULA 3S6PA 2JB8A 1PVC2 2BFUL 3DECA 3HOBA 3WINE 3H7JA 1ND2B 4Y5SA 1H6YA 1ULFA 1RXFA 1OT5A 3HNMA 2WLQA 5L7OA 4MG2A 5FZKA 3FZ3A 2YU2A 3AXEA 4H55A 1DQ0A 5C3PA 3HR9A 1GYKA 3A7QA 5GLUA 1YYNA 4CDUA 1YJLA 2EF6A 4DUWA 4RR3C 5ABJB 4AOCA 4JGZC 1A3KA 4N8MA 3NVCA 2GC0A 2WSVA 2ZPXA 3PJQA 1G9AA 3VBHA 1S0EA 4N90A 4UI9L 1YFUA 5A3NA 1DGWA 4M3CB 3KCXA 3MIHA 3N9OA 4D8MA 3ZYJB 3ACIA 4XAAA 3U75A 1REDA 5FP7A 1XSRA 4UAPA 5KBFA 2R073 1MQTA 3OPTA 2NMNA 2Y6HA 3B01A 3BU0A 1F5JA 3IB3A 3ZKYA 4WVMB 1U0AA 3ZDSA 4LBQB 4ZHNA 2ETEA 2WN2A 2W92A 2TBVA 2WINB 5B4NA 2QKDA 5FY8A 3DPRB 3TOJA 4AEMA 1COV2 2YDEA 2XQRA 4IV3B 3MF9A 3V56A 3KVAA 3KF3A 4FO9A 3T4HB 3LA2A 4KBBA 5BNNB 1W9TA 4I3PA 4M01A 3WY6A 1EY2A 3GM8A 5A32A 1Y3TA 4S2FA 4FFFA 5D8AA 2YMZA 3TNPB 5FY1A 3ACHA 1DZQA 4GZ9A 4N9HA 5E88A 3PNAA 1A78A 4EROA 3ACFA 3L2HA 1YWKA 4Z2WA 3EB7A 3J7HA 2E32A 3VDDC 4FPCA 3TN92 3ZXEA 3UGHA 4AEDA 3H8OA 1YEWA 4KQ7A 5BPXA 2D93A 1I5ZA 2HYXA 2XKOA 3URFA 4A2UA 2VNGA 3JD72 5CFDC 3NJVA 4QU1A 2J1SA 1XYOA 2AEZA 1OBNA 2Y26A 2WAAA 4B4PA 4JVAA 5JDBA 2A5ZA 2HWB1 2JDZA 4J1WA 1UY0A 1NZIA 3N9PA 4JV4A 1W2NA 2GMEA 2EIDA 1LOCA 3JB4C 1HKDA 4LLFA 4CDUB 1O5LA 5BNOB 2BNMA 3LFMA 1YQ6A 4KGQA 1GU3A 1AR61 1U5IA 5CKMA 4FXGB 3IIIA 3O1PA 3OCPA 3ZM8A 3AFKA 3I97A 3W5MA 1DQ2A 2FHRA 1CAWA 1NZCA 1PNGA 2HWE2 3PUIA 2NZ9A 2J1UA 2VZQA 3K4DA 5HCAA 1JZ8A 2DUQA 3UGFA 1UU5A 1CIWA 4RHV2 5E8AA 2LALA 3VD7A 4BQYA 3DXUA 1HV0A 4BYYA 2RS51 5FZ6A 3VHPA 3E1F1 5C8WA 2YV8A 1H2KA 1C1FA 4W50A 5FP3A 1BVVA 1WA4A 4GMP0 4FSJA 1JZ4A 1XPWA 4HPKA 1KXGA 1OOPC 4CXXA 4EWEA 1YXWA 3INAA 4QXHA 3ZIWA 3MW2A 4UFLA 1UMIA 4RR3B 4CDQA 5KHJA 2F6BA 3Q8AA 2KA3A 4COYA 3OBTA 2JDAA 1FNYA 1M4WA 2WFF2 5A3UA 1LAJA 2QNKA 4EN6B 3GJAA 2OPKA 1VBC1 5EP9A 1OKOA 3VGIA 1W0OA 1N3PA 2JG9A 3A0NA 1VR3A 2HWB3 3TWIA 2BGOA 4QXKA 5J96B 1PGW1 5A32B 3ZN5A 3ES1A 2Q1FA 4CDWB 3VBRA 3CBNA 4DPNA 2W5FA 4AHYA 3RZZA 1VLNA 3ZYGA 1VBE1 4MGQA 5C3SA 1WMEA 4QPGB 1AR63 1OUXA 3POSA 5JMOA 3KV5A 4IEOA 2PHTA 1ZZ8A 2WABA 3JQXA 1HIXA 3PTYA 3HBKA 2GZWA 1W2TA 3GDBA 2VXJA 1JXNA 1H2NA 1SFPA 3ZN6A 5F2SA 5IATA 1W9YA 4A42A 3EO6A 3OPZA 3ZSEA 5FPXA 5DUXA 1V00A 3POGA 2W0XA 1MVQA 2C9KA 3I3BA 3HPNA 3PIJA 3RFRA 1K5MA 1CAUA 3U4SA 2RS53 4BQ3A 4CU8A 3POBA 4E4DX 3DGTA 3KV9A 5DZFA 3AVRA 1UW8A 3SMHA 1TME1 1G86A 1GQPA 1Q56A 4AQTA 3HIFA 3OPWA 4MXWA 1G6NA 5EZWA 1AXKA 4O61A 1GWKA 2UYAA 2NN8A 4YZ3A 5F3IA 3VDDB 1U12A 4XYXA 2AENA 5FOBB 3OYWA 3KV4A 1UU6A 1VBC3 1XOYA 1H8TA 2E51A 2AEYA 2P6HA 1XB9A 3H3UA 3WDTA 1R1A1 1XRUA 4K20A 4Y4RA 3CL1A 2I45A 3D3AA 2W2IA 4SLIA 1VBA2 3S5QA 4YVSC 3LOBA 3C7GA 5AVAA 4C1XA 4Y1VA 3VL9A 3AZVA 3VBOA 1UZVA 1ND3C 1VBE3 1O4ZA 3OY8A 2XLFA 2EIBA 4XUPA 2IWGB 2XUMA 1O59A 3AKRA 3B5LB 5BXXA 3HD8B 2DCYA 4Y3OA 2HEVF 2PYTA 2RS12 1ZZ9A 1LGNA 1QXPA 2ARAA 3J8F1 5LCWL 1IS6A 4CCOA 3KGZA 4OUSA 1F5FA 1Y9MA 1CIYA 1NCRC 3H0OA 4XC9A 1UPIA 3RGBA 1H6XA 4UFIA 4DRRA 2ZGRA 1DG6A 4Z8BA 1ULPA 3DCQA 1TME3 2IVJA 3NJXA 3JBG1 2D6MA 3LEMA 1JHJA 4NRQA 4CE8A 5I8TA 3MV11 4BZ4A 4CCJA 1PX4A 2EAKA 5IFPA 1CN1A 3WXPA 2AYHA 1OOPB 2VE1A 1RITA 4J1XA 3AYCA 4RGKA 3UYJA 3VB9A 4GIQA 2IZWA 3A0KA 4AFAA 1H2LA 1DU3D 3W21A 2D44A 4OQ8A 4OUMA 1R1A3 2MHFA 2V72A 2ID4A 2VXRA 1J84A 2R1BA 3JU9A 5JLVA 4XILA 4MGIE 4XBQA 5J48A 2Q5TA 5CNAA 4X6RB 3S7EA 2P5BA 4LITA 1C5IA 1K42A 2YROA 4XF9A 3ITQA 4MXWB 2RG4A 2LS6A 2N7GA 1RUE2 3RZMA 5KWRA 3AMPA 3I2IA 2WNEA 1UNBA 3J8F3 4XFBA 4A4AA 4DQAA 1QU0A 1XJAA 1W8OA 4YGDA 1VRH2 4B4QA 5A6QA 4EYUA 3V0AA 3NJYA 1YHFA 3C7FA 4D6SA 4LIVA 1OHFA 3SH5A 2X53S 2ET1A 2O0OA 1QNWA 1RMU1 1SPPA 4CYDA 3RZLA 2Y0OA 2KM2A 3WHUA 3JBG3 3Q8EA 3TEWA 2A3WA 1W8TA 2QJVA 2ZMLA 1FI2A 2HEYF 1R081 1HX6A 1ZZCA 3P3NA 5IVEA 2WNUA 1OFSA 3CJXA 4PIXA 1VMFA 2YFUA 4WM7C 1AR82 4LORA 4IERA 5I91A 1ULCA 4QKDA 3M8LA 2QQPA 4ISRA 1HW5A 5FIXA 4DEQA 3L2YA 2B9UA 4IE7A 3T1MA 3M2MA 2P3YA 1DYKA 2DU0A 3AZWA 2DFCA 2JE7A 4KH9A 1I6XA 4BXSV 3I2FA 4RQPB 3JZVA 3ES4A 2ZHMA 4RL7A 1XQNA 4YVSB 4GKYA 5JSPA 1TMF1 1BK0A 1W6MB 4D7YA 5LA0A 1Y9GA 4YM3A 1ND3B 2HWD2 3O0VA 2WYFA 1TZOA 5FPUA 2ARBA 4Q5OA 4P9GA 1IHMA 4JHTA 4FPOB 1QDCA 3KD4A 4K7JA 1LRHA 3KQ4B 4I0AA 3SKJE 3WP4A 2OZ6A 3JCIA 1YO8A 4AW7A 2VCCA 4I0BA 4QQOA 4ZXEA 2GC3A 2B45X 4LQRA 3ZOIA 1JYCA 3VLBB 1RMU3 2DCTA 4ASMB 2AREA 1V6JA 4OMDA 1NCRB 2VMHA 3D4KA 2W1QA 5FPVA 1PVC1 4HK9A 1OC1A 2A71A 3VBUB 3EHKA 1R083 3C8XA 5T5JA 3WEZA 5HCBA 2RDQA 5L19A 2FZ2A 1HN1A 2YGLA 5CIRA 2Y6JA 4DB5A 2O8QA 4JRLA 2HH9A 2WZR2 3KVBA 4IEXA 1WA6X 3VKFC 4AK3A 4LTAA 2VCAA 1XYNA 2XWJB 1OI6A 4MXVA 4NN0A 3ZLIA 4A6SA 4AI3A 1W03A 2HWF2 4GD4A 4XMAA 4E9KA 3O1UA 1ZRCA 3ACGA 4DIQA 5IK5A 2G4IA 1IG3A 1LHOA 4AFMA 4K9SA 2PQSA 4P9XA 1VRBA 5IJRA 3BB6A 3MGUA 1TMF3 2CAVA 1C8NA 2J7MA 1RXGA 4Q4X2 5LRRA 3ZYHA 4CEYB 4B4RA 3VDCA 4NO4A 4MHRA 4AEKA 5J09A 4Z07A 1N1YA 1JYNA 3R6SA 1YRZA 3SEEA 1RUD2 4E27A 2BFUS 4GALA 4Q26A 1V70A 5K0UA 3KSCA 1AJOA 2XDVA 2J1AA 4PDWA 2XPJA 5CKNA 3MDPA 3WP3A 3PUHA 3HVDA 4EN0A 4ET7A 1A6CA 4H7MA 4NHYA 5IK7A 3LSEA 1COV1 4Q0QA 5C8CB 1PVC3 1YIPA 5HV0A 3BYWA 2ZHLA 3ON7A 4JQRA 3WCRA 3WQ7A 4P00B 1HB1A 1SQ4A 3NNGA 2R16A 4PBPA 3USUA 4C1WA 1NXMA 1DGRN 1DQ1A 1XE0A 2JDUA 4DXRA 2JG8A 4XABA 3OD0A 1IQAA 4W8JA 4WM7B 4YGBA 2IXKA 2YB7A 4EE2A 1O5UA 1FT9A 2XB6C 3TN91 3MW4A 4F7ZA 3WG2A 3PU3A 5A7WA 1PK6C 1LCLA 2YYOA 4NRPA 4HONA 2QDNA 2A6VA 4AGVA 4Z92B 4XUQA 4EN8B 1J1TA 1OKQA 3JD71 5CB7A 2G9ZA 2WZ8A 3VN4A 3TNQA 1X33A 2OPWA 3K51A 5FZAA 3AMNA 5F32A 1YLLA 3FLTA 4MVTA 4FAHA 2R1DA 4HFSA 2K9ZA 1UWWA 1NLQA 2WDBA 2RDSA 2WZEA 3OUJA 3C7HA 4JDMA 2PMWB 1V6IA 5DZEA 5KHKA 2QQVA 1BYHA 3GCXA 3NV2A 3B69A 1KGYA 4A44A 4EZ4A 3VBFA 1ACCA 1W6PA 1C4RA 4LO6B 4Z2AA 1ZBE2 1S0DA 1AX1A 1COV3 3WDUA 4ASKA 1LOAA 2OQ6A 2BWCA 2VMDA 4XFFA 3U4XA 2K0GA 3PU8A 5F8PA 3RQ0A 3H8XA 2HWE1 1F15A 1RUC2 5F5CA 3NRUA 2XJRA 3ENRA 4RHV1 1JZ7A 3FC0A 3I2OA 1SCSA 1NA1C 3M3CA 4EWDA 2DVFA 3D82A 2VZVA 1FX5A 5AFBA 1QEXA 2EALA 1GZCA 3TN93 1DZRA 2FQPA 4PDWB 2DCZA 4MOAA 5FWJA 2WT0A 2VOWA 3JD73 2AR6A 2WFF1 5FBZA 4YVWC 5L36A 1Z78A 4TXWA 2CAUA 3KM5A 2R062 4R9AA 4I09A 3AP7A 4JQTA 5FUIA 1HB2A 4PQQA 5FZ3A 1W3VA 1LTEA 2R49A 1DGRA 2QQWA 1DQ4A 1RHI2 1GBGA 4LO4B 4HLTA 2PAEA 4MHUA 4QQLA 1C5HA 2CWMA 1WGPA 1UY2A 4NHXA 1DCSA 4XVHA 3QCWA 3WQ1A 4TYSA 3LFIA 1C28A 5JAXA 4QHOA 2XGXA 2RDNA 3RZJA 2RS31 3AP5A 5EJZB 3POFA 3WW1A 2BDRA 4P9WA 3RMYA 2OW4A 4DXTA 1I1EA 2DWRA 5FRAA 2C9AA 5IAVA 3O1MA 1DYPA 5DUUA 4QGLA 4OI0A 1ZZBA 3WNNA 3RRDA 2OZJA 4QX2A 5H9PA 3SCHA 3ETQA 1QH6A 2HWE3 5C3OA 4A3ZA 4PIZA 3D6EA 4RHV3 3ZYBA 4META 2G1MA 1WW6A 3AYEA 3ZFFA 1CAXA 4TN7A 2GNMA 1D2SA 1OURA 2WA4A 3QH6A 3IDEA 4CEWA 4EZHA 2XJSA 2QQUA 1DLCA 3FN9A 4F3JA 2B42B 4YFZA 2IC1A 1BHGA 1AR72 1SBEA 1BQPA 5I93A 1SDDB 2FDGA 3P5BA 3WW2A 1D4M2 5FZ9A 4AR2A 4LA2A 2VD7A 4EN9B 2JWPA 3QD6A 3K46A 2V73A 2WFF3 2XWBB 2WFPA 1J59A 1NG0A 3MIEA 3LEKA 1PK6B 2OX0A 4AZZA 2WN3A 1SEFA 4OI4A 3RJ2X 3RZKA 1IKPA 2LROA 5BY5A 1SLLA 4XIOA 1WBLA 4NHLA 1RL3A 1VBA1 3AJYA 3AXDA 2PHWA 5JSRA 4IV1C 2AH2A 4AG4A 2C26A 3CZJA 3E6CC 2ZGMA 2UU8A 3N7JA 3VZNA 2RS33 5E6HA 1KS4A 5EXOA 2OQ7A 3BALA 2OA2A 4JGYB 2DVAA 2YPJA 4Y1XA 4IQPA 5FMBA 3IMNA 5LY2A 1OPMA 2GAUA 3VKLA 4XE9A 2WNVA 2RS11 4IE5A 1PHMA 1J58A 2DYCA 1W90A 2H0VA 1M06G 5F2WA 1XNAA 4IEUA 2GALA 4SBVA 3MUZ1 4QDSA 3ZMOA 5AFEA 3B7MA 3O1SA 2QBXA 2GNBA 2Z4FA 1FV2A 2ARCA 5A3TA 3H8RA 5JOWA 4RGAA 3BN6A 5LK7B 3AX4A 1POV0 4OLLA 4HOOA 1XNCA 3IZOA 5GLWA 4N7UA 3PUAA 2A73B 4PF1A 2ILMA 2VOKA 4G4FA 3O1VA 3Q9OA 1ND2A 5FZCA 3LD8A 3BTZA 1Y43B 4FOWA 3BTYA 1QHDA 1UOJA 5FZ1A 5DG1A 1D0HA 3WR0A 5C4WC 3NMBA 4AWDA 3HQRA 4ASLA 2Q8CA 4AQ2A 3IKWA 4DUVA 4MZUA 3SQOA 2IXLA 3NNLA 5DAPA 4CCMA 1NOVA 5HPOA 4P08A 1GZWB 5ABJA 2QQLA 2X29A 4PBOA 1EP0A 1TVGA 1VBA3 5JZGC 2JDYA 2LM3A 4BPZA 2H6CA 1JBCA 2XR4A 5I0RA 1J3PA 3D0JA 4QX8A 5IAXA 1AYN2 5JI9A 3EQEA 3FMGA 5FMDA 3BCWA 1QOOA 2DVBA 3LWCA 4HETA 4ITCA 3VDAA 4BK5A 1TNRA 2VVEA 4AHWA 4XJAA 2XJUA 4M3CA 5DG2A 4JCKA 1BJQA 4KL1A 4FTBA 1RUE1 4QPIB 2RS13 4DS0A 4B8EA 3B9IA 2CYFA 5GLTA 1VRH1 1LGCA 2Y38A 3UKTA 3ZXFA 4AVAA 5BYNA 4B1MA 2MEV2 2ZEZA 1UF2C 5F9TA 4WVMA 3POYA 4FFHA 4FPLA 1EYBA 1WCUA 4LBQA 1NCQC 4LBOA 4BLIA 5JOZA 3BTXA 1AYM1 2WT2A 3DPRA 4BB3A 2DUOA 1H30A 4K1ZA 5FBJA 2LRPA 4IV3A 4INDA 2YY1A 2XJTA 5A6XA 4IW3A 3P6BA 1EAH2 2BP6A 1XE7A 2QQKA 3ZN4A 5BNNA 3J7LA 1K5JA 3GBFA 2P3KA 4IEZA 4N43B 5LA2A 1AR81 2Y6GA 5BV6A 4BCUA 2WT1A 5BUVA 1TE1B 2VULA 3I54A 4XCAA 5C71A 2BOIA 1DGLA 4RD7A 1UAIA 2VNRA 5T5OA 2XQXA 4XFIA 1OQ1A 3QH7A 3T1LA 1GICA 3LIGA 4QPYA 1BKZA 3IM0A 4BISA 5FYMA 3N3HA 1JYTA 1EPWA 1ZBA2 2WO1A 2Q4SA 1PGSA 2BVVA 2WA3A 2UY8A 2WNOA 1REFA 4R9BA 1T6BX 2CNAA 2Y64A 1X50A 1ZRFA 2P6CA 4IV1B 4ES8A 1RUE3 2W9XA 3AK0A 5EWSA 4B7EA 4XJ8A 2HWD1 1DQ6A 1LHWA 2TUNA 1O3QA 1VRH3 4ZS3A 2YBSA 4UOJA 1OH4A 1N1SA 2B8MA 5FUNA 3HWJA 5FZFA 3VL8A 5F5QA 1W9SA 2VOXA 5J3UA 1QXRA 3KMHA 5FY4A 1LOFA 5BNOA 1AYM3 1MACA 4FCAA 2C0ZA 2WUHA 1NQJA 4V1PA 5ANQA 5LASA 3K3NA 3AB0A 1US2A 1X8MA 5T3NA 3POEA 5ACA1 3K75B 1CPMA 1S0CA 1DP0A 5KHIA 5FYUA 4FQZA 3NNMA 3ABZA 1AR83 2C4XA 3KT4A 4AVSA 3FBYA 2WZR1 1V6KA 5F6KA 3BIWE 4A45A 1MQTC 2XHKA 3GHMA 5FMCA 3DYPA 4Y26A 4MLOA 4X6QB 3WNKA 1RGSA 3I2DA 5JXHA 4XMIA 3WUDA 2HWF1 5C4WB 2JE8A 2J22A 3NKTA 2VC9A 4K3UA 5FPAA 4NJ4A 2VUJA 4XXAA 5A7PA 3VD4A 2D43A 2WJSA 4P5YA 4GKXA 5E16A 1C8M2 1PMJX 2JIGA 1NY72 5A1AA 1Q8PA 3ZX7A 2B9VA 1AXZA 4MADA 4RR3A 5J36A 2KR2A 5GZCA 4CCLA 1EUUA 5HCHA 5JZGB 3S57A 2VTXA 2P1BA 1UY4A 1BVP1 3FLRA 4Q4X1 5CEHA 2HWD3 3FLPA 1W06A 5H9SA 1JU3A 1RUD1 5JCTA 1QJY2 3S5AA 4C91A 1G8WA 2DU1A 2X8KA 4B1LA 3MFCA 3LEGA 2D5HA 3THDA 3K2OA 4LHNA 5CZKA 4CDWA 4FP3A 3W9AA 3KS7A 4AEDC 3SH3A 3HNYM 2EXHA 2MPFA 2NYYA 2WO3A 2K46A 1WZXA 4FVVA 4QPGA 1W3XA 2RV9A 4XTPA 5IT6A 4XF1A 2VZUA 1GKBA 2J1TA 5ACA3 1QJEA 1RUJ2 3ETPA 2ZS6B 4UW5A 2XJVA 5FYIA 1MZEA 1QOTA 2WZR3 4GXLA 2BQPA 5DAVA 3POIA 2BBVA 2UWBA 3M7AA 4A3XA 2HWF3 2ZA9A 1Z7S2 2BJSA 2Y60A 4G9SB 4NVPA 4RFT0 5J98B 3WDVA 2W95A 4M4PA 4UFMA 4FQ4A 4B7KA 5FO8B 2ZEYA 3ZPYA 2VW2A 3VDDA 1X8EA 2XVLA 3E5QA 4LXLA 1BLZA 2WZPP 4Q4X3 2GN3A 5F5AA 2A1XA 1RUNA 5JOYA 3V65A 2PN5A 4NHKA 5FKCA 4CXYA 3NL1A 1IG0A 1G9BA 1RUD3 3MYXA 2X5IC 5D2AA 4XURA 2ZHNA 5FPLA 2C6SA 3WDYA 1HRV2 5L9VA 2ZZQA 3I2HA 5LA1A 1D7PM 1KDKA 3T08A 2EVXA 4YZ1A 3I59B 2VPVA 3USSA 4O9GA 4Q1PA 4HVRA 5FK8A 3SC7X 4XHXA 1ZBE1 4YW1A 4YZ5A 3C7OA 4CDQC 4XCBA 4OVEA 3W59A 3WF4A 1RYYA 5GJ6A 3RJRA 1GNZA 2BPA2 1RUC1 4WVVA 4JGZB 3J7MA 4J25A 5LBCA 1O91A 1X9PA 4AQSA 4QAWA 4UF0B 2ZGSA 2ZMNA 2IXIA 2JG9C 3N7KA 4KWLA 5FY5A 3FFQA 4AVTA 1JOBA 3G6JB 4BOWA 1EV12 5JXIA 3AMHA 2VBPA 3SKVA 4A41A 5M0TA 2H0BA 2VAUA 1C1LA 4BQ5A 1XU1A 3UJOA 1SG3A 2DDUA 1HQLA 2ZX0A 1BK1A 4DXSA 4QKBA 2ES3A 4N53C 3GHNA 4JDNA 1WCKA 3GNEA 4XW3A 1OOPA 5FZ4A 5F7UA 4AE2A 3HAGA 5FOJB 2R061 3U0ZA 5FZMA 1OF4A 4CCEA 1MS9A 4JRAA 3KLSA 1LEMA 5FO9B 1UX7A 1UQXA 4W6YA 1QF3A 1O3RA 1VAVA 4AVVA 1RHI1 1RUG2 2JKXA 3JQWA 2YHJA 3ILFA 2TEPA 4YWAA 3J7NA 5LK5A 1QJZA 3OUIA 1JUHA 1WMDA 4E2SA 1C3HA 5G05L 4QU2A 3CIHA 3WP5A 2EIGA 3H3LA 1XNTA 4Q8LA 5DDJ2 4XQDA 3VHOA 3SCFA 1PMIA 4AI2A 4CPBA 2AGSA 1ZBE3 1DFQA 1NE6A 2DBIA 4BJ0A 1X82A 3TEXA 4FT8A 4JKMA 3ZYRA 5FYZA 4GB32 3WNPA 4P14A 2ZKNA 1RUC3 2O8OA 4NRMA 1WW5A 4BH9A 4UFKA 5KR7A 1H8TC 3MPBA 5CFCC 5CISA 4FPKA 1VIWB 1R64A 2P3JA 1YIFA 2PLV2 3MUY1 3MLLA 1Y7BA 3MPPG 1FATA 3X29B 3ZIXA 5CFDB 1F4AA 3HMYA 3PLQA 3PL0A 3VBOC 5FXXA 1AR71 2P34A 2VUCA 3M4FA 1V6LA 4Q27A 4LE3A 1D4M1 3FBMA 2GNDA 3N9QA 3OEAA 2GP5A 1QQP2 1OA4A 1H1AA 3ELNA 4WM8C 1W04A 3RG0A 1GP5A 1PZ8A 2QZ2A 3ZYIB
chains in the Genus database with same CATH topology
1CD3G 1UZYA 4MGZE 4XFAA 2XL9A 5H9QA 2R063 4UW3A 3WZ1A 2B46X 1IS3A 2BWAA 1RHI3 3ZFEC 1V6MA 4NOTA 4X8PA 2PTMA 2CWSA 1ENRA 3FWEA 4R9DA 2GMPA 4RQPA 3AM2A 3B93A 1WUVA 4YVSA 2A3YA 1W6MA 3MIBA 4B29A 1ND3A 1AX2A 3MICA 3FX3A 3NV4A 4YZ2A 1LESA 5I8YA 1F8VA 4G3YC 4RGGA 1FXZA 4D7TA 1OLQA 3GZAA 3CU7A 2RR12 4LEJA 2JD4A 1XE8A 5H9RA 3KT1A 4XBLA 5A3MA 2RM22 1RVF2 3M3QA 1HRI2 4AQ6A 4ISQA 1NCRA 1AR73 2JXAA 4HANA 3ST7A 3IPVB 1QJU2 3M3IA 3VBUA 1D4M3 1U5ZA 1LR5A 1Q8QA 1GV9A 2DFBA 4F83A 5JIUA 2LTNA 1G7YA 3C3VA 4QT6A 2GDFA 2K2SA 2WS91 3CEWA 1AX0A 4N53B 4URTA 1RINA 1PGL2 3UL2A 5HI0A 1WLDA 3UKVA 4TLFA 2AZ5A 1UL9A 1DBNA 1AYN1 3DN7A 3NAPC 3N35A 2A7AA 3O0WA 2HWC2 4YYOA 1DHKB 4WBBA 3NV3A 4WV8A 4CEYA 1SLBA 1DIWA 3VUOA 1VALA 5J37A 1ZM1A 2MEV1 3HBZA 3AYAA 2R6QA 3ZSJA 4M00A 4GMP1 5GLZA 3AKPA 3H1WA 2HKXA 5CFCB 4MX3A 2GH2A 1IS5A 1MVEA 1QJX2 4L92A 5C8CA 3JUUA 4GWMA 5JSOA 1UCXA 2VH9A 4YARA 1EAH1 4YW4A 4CTEA 2UWAA 1S0GA 1UN1A 2D98A 2WS93 4X8NA 1KS5A 2D3PA 4WM8B 3D5OA 4AEJA 3MFAA 1SMVA 4WM7A 1LOBA 1Q8OA 4IESA 3MIDA 2QFEA 4AF9A 4AGGA 1AYN3 3I7DA 2O1QA 2WQZC 5GLVA 3ZFEB 4IEQA 4AVCA 3LZZA 4ZU4A 4AGRA 2A6XA 1MS3A 2OUJA 2RE9A 3RYKA 4FAGA 2R0FA 3GF6A 3GBWA 3H50A 3ECQA 3J9SA 4QQ2A 4QX5A 3KB5A 2A75A 4HMZA 5I8SA 4H3WA 2BW8A 4Y24A 5C9AC 2MEV3 3B00A 1O3TA 1AL22 4GMP3 1FYUA 1LENA 2D6LX 4Y20B 5LRSA 4N9IA 1GZ9A 2AUYA 4DINB 2B7YA 4D94A 4WVZA 3POWA 3RSJA 2WC2A 1EAH3 2ET7A 5FQ0B 4YG6A 3CJIC 1W6OB 4HKOA 1V9U2 1N47A 1D0GA 2GNTA 3AZYA 5E89A 4JDOA 1AJKA 5HBAA 2A70A 5FLJA 5K0UC 1KFXL 1PZ9A 3FJSA 4YFWA 4YW3A 4XFGA 1C8M1 2GN7A 2Q0AA 5DUVA 3ACLA 3IDBB 4XXPA 4YGCA 1NY71 3B94A 4YLZA 5A33B 5DUWA 1NQDA 4B3NA 3DKWA 4NR1A 3VKOA 4MV2A 3E5XA 3RS6A 4OI1A 1KRIA 5F1RA 2Z79A 3SITA 1QJY1 1PO12 2D40A 4U2AA 3AJZA 3D8CA 3VKNA 5JWPA 1B35C 4E4ZA 2BVBA 3VBSC 2Q1MA 3FHIB 3NW4A 3ZVXA 3QACA 5I0SA 1RUJ1 4ATFA 4MSVA 3AP9A 4D69A 4NWWA 1SDWA 2ZHKA 4C0HA 1O3SA 4CP2A 1I9RA 4PIYA 4LUKA 4TZDA 3PVNA 2NLRA 2XKPA 5FLIA 3KT7A 5D1IA 2GH8A 1GQHA 5JMCA 2XVKA 1PNFA 1NE4A 3TBDA 1Z7S1 3OBRA 4YNIA 1OA3A 3VBFC 2ZX3A 1C8M3 1CGPA 2DTWA 4YZ4A 3M3OA 3ATGA 3B3QE 3L9JT 2VMGA 4I2OA 1MS5A 4BE3A 1PK6A 2D6NA 3O0XA 4HK8A 1HV1A 1OPOA 2YXSA 5C6CA 4XF3A 4XEZA 1FOD2 2XLGA 5GZEA 4Q4Y2 2YGMA 4K1YA 1QJY3 2YC0A 4LBQD 3ALQA 4FPYA 1WLTA 1HRV1 4JTNA 4JC1A 5C9AB 4JGYA 2PHFA 2VG9A 2IFRA 3H8UA 5SV5A 3IN9A 2FMYA 2DTYA 1CVNA 1ZNPA 1CONA 4LBNA 3CO2A 4M0HA 1RUJ3 1MS0A 2Z69A 4Q0SA 2JE9A 4BIFA 4H7LA 3OF1A 2WSUA 4KU8A 1EV11 2ZCWA 3KQRA 4Q4W2 4KGGA 1PO22 2RHPA 3CJIB 4CDXC 4I02A 4AFBA 1EPZA 4M3CF 1Z7S3 4IEYA 1APNA 4ES9A 4I30A 1OA2A 5FPZA 1H9PA 1JYIA 3HQXA 1KFUL 1SLAA 1GSLA 1MR5A 4PJYA 2ENRA 1XNDA 3OJBA 1C57A 2IXHA 4L11A 1BBT2 1DLLA 5IK8A 1RUI2 1WLCA 3ZFFC 1RUG1 4MUVA 2W39A 4YVWA 1GZWA 4LA3A 3IWZA 1HRV3 1TNFA 1H4HA 1W39A 3HT2A 4XJZA 1H1MA 5DDJ1 5GM0A 1TEIA 5I0TA 3TB0A 3WG1A 1J3QA 2WL1A 3RNSA 3PJYA 4GB31 4QPIA 2KXLA 4R9CA 4Y22B 3C2UA 1B35B 4IEPA 4DZGA 1MZFA 1HQWA 3VBSB 1A8DA 2E7QA 3NSTA 2PLV1 1IPJA 3M70A 1EV13 3VHRA 4P9IA 3FFZA 4LR4A 2OYZA 2DVDA 1SLIA 4YG3A 3ZSKA 1Q8VA 5K9YA 2QVSB 3ASIA 2PHDA 4E4SA 1QQP1 3K48A 2BUKA 3WHTA 1DDLA 4N43A 4UBHA 1O4YA 2Z42A 5FAXA 3HT1A 2GC1A 1FNZA 4DMIA 4PQ9A 3PVEA 3NV1A 1UMZA 5BNPC 1RUG3 3GALA 3RI9A 2CGPA 3O12A 2H6BA 2QZ3A 2XL7A 5FDBA 4PLOA 4U36A 4L97A 5DDJ3 1YFWA 3ZFGC 5CU1A 3BPZA 2D6KA 2XG3A 1NA1B 4IV1A 1PM7A 1L3JA 4GB33 2R042 1RUF2 4ONUA 3GYDA 3A4UA 4FXKB 5DXDA 1A8MA 1FPN2 4Q8KA 1AR92 1AF9A 1E57A 2RR11 2ZX1A 2PLV3 4YM1A 5ABJC 4GH4C 4GQ7A 3RWNA 1QY4A 1MEC2 2RM21 4P9JA 5T55A 1RVF1 4YVWB 3TYJA 3WW3A 1HRI1 4QD2A 1UKRA 4YM0A 1N1VA 1BXHA 1QJU1 2PA7A 3ILRA 1QQP3 4CDXB 2VNOA 3GZUC 3AKQA 4Y4YA 2VQ0A 1FMD2 3THTA 1V6NA 1CJDA 1NLRA 4J6GA 1G9FA 3AKTA 5C4WA 1PGL1 4XJ9A 4IEWA 2HYKA 4RS5C 3WDXA 1LHVA 4DRVA 3DUIA 4KNCA 1CAVB 1OQDA 2HWC1 1LU2A 4PCRA 5JZGA 5GALA 4WZCA 1LU1A 4F8AA 1WMFA 2G9GA 1ASJ2 2VW0A 1WD3A 4QQHA 2VUAA 2P2KA 4RA0A 1GQGA 4OHYA 1TQ5A 2ZACA 1QDOA 1W6NB 4LULA 2RR13 3QBQA 4DNYA 1RTVA 4KG8A 4AI1A 2RM23 1QH7A 4UBGA 1RVF3 1URXA 4MGYE 1HRI3 2ZAHA 4MYEA 1QJX1 4S2GA 1Q43A 5I0UA 3AMMA 4L9BA 1QJU3 4TSVA 4BQ1A 4E2SA 1CJPA 1NYWA 4OHVA 2B5HA 2PFWA 4QHBA 3WOGA 2ERFA 4P5HA 3ZSMA 1SLCA 2BEOA 3R4SA 4NHMA 4IEVA 5L7OC 4P9LA 3QOPA 3M3EA 3MW3A 3LB9A 2Q30A 4CDUC 2ZZJA 3DF0A 1OQEA 1LEDA 4LBMA 2VMIA 4YW5A 2WKKA 2XH6A 4HKLA 2WWSA 5BNPB 4XFHA 2C5DA 3T2TA 2HWC3 2WLPA 3VBHC 4COVA 2XBO2 4LUMA 3LKJA 4EJRA 1RJ7A 2ZGNA 3CF6E 3H7YA 4BHPA 3ZFGB 5T5LA 4FPFA 2MNGA 1DQ5A 2QE3A 4KG0A 1AL21 2SLIA 4M3CE 1H9WA 3I59A 4Z82A 4ZKTB 1SFNA 1QJX3 4GH4B 1ZZ7A 1Y9QA 5T5PA 4HVQA 1RUOA 3RMXA 4DXZA 2W08A 4JGZA 2UURA 4D3WA 1ULGA 3LA7A 1V9U1 2P3IA 2E53A 4TWTA 5GZGA 1U5YA 4Q0PA 3SH4A 4BWOA 4CDWC 3D0SA 5D8AC 4Q0VA 3E97A 2TNFA 4K6BA 4QPGC 1ONAA 1D4VB 1JH5A 2VY0A 3V0BB 1Q3EA 4Q1RA 4L99A 4UW4A 2BYVE 1R1ZA 1VBD2 1F2NA 4RS5B 5L73A 1NCQB 1W0PA 3ZXAC 2OVUA 1RJ8A 1AXYA 5LEKA 4S2DA 1D2QA 1HLCA 1PO11 4FOVA 4XQ4A 3WQ0A 5CG8A 2P37A 5SV8A 3UJQA 1POV1 1AL23 4D7SA 1YI7A 3ZMNA 3R05A 5JI7A 4Q4V2 3WW4A 2JKBA 1DF0A 1YUDA 2JJ6A 3S30A 2D3RA 2EA7A 1VBB2 4XFCA 2V5YA 4LBLA 3PMEA 3PVOA 1WW4A 1PVXA 2RMU2 4LLOA 4E2QA 1BEV2 1V9U3 2Z2SB 3E6DA 4BMEA 4FBFA 5HCFA 1OMIA 2OUHA 5AVPA 2VQAA 3EXUA 4YRDA 5CFDA 1BMV2 2PELA 3DV8A 3WG3A 4BM8A 4FP2A 5L7OB 4YG0A 3BTAA 3WDWA 1RB8G 2ZX2A 2VVDA 1VP6A 2CV6A 1W6QA 1R092 4LBJA 5AC92 3OTFA 4BLJA 3MIGA 3CNAA 2ZGLA 1UZZA 2Q1ZB 3O5SA 4YSFA 2ZOEB 1FOD1 2ZGTA 5HXVA 4Q4Y1 1N3QA 3VBHB 1PO13 3IT8A 5C33A 2D7FA 3R4UA 1ZX5A 1JHNA 1CESA 5B2GB 1POV3 1UIKA 1BCXA 4Q2FA 1YFYA 3WNXA 4BA6A 3VBRC 2QUOA 2ZJCA 1PIV2 2X5IA 5FREA 1YJKA 1GR3A 2VGDA 1MQTB 3I4IA 3AFGA 3LCPA 4I01A 1REEA 1VJ2A 3VZMA 4LO7A 1LGBA 3MI8A 3EBRA 2D6PA 1QMJA 3SNMA 4Q4W1 1F9KA 1K5MC 1PO21 3VZKA 1HXS2 3IBMA 1LHNA 1S1AA 3IPVA 5CAZA 3VZJA 2JENA 1ZRDA 5D8AB 1ZRRA 4HKWA 2RS32 1ZZ6A 3O14A 4AEDB 5FCCA 1MS4A 4DY5A 3APBA 1BBT1 5JOXA 1UU4A 1RUH2 1G9CA 1RUI1 3NWKA 4N53A 1S55A 3EJKA 1FOD3 4Q4Y3 1G9DA 2OIIA 2DV9A 3NO8A 5FMOL 2ZAAA 1PZ7A 1MZ6A 4GULA 1S0IA 3ZSLA 1SCRA 1ULDA 1J1LA 1YNAA 3NKGA 4YM2A 4IETA 3ZYPA 4HT1T 1X36A 1QXJA 4CRQA 3VV1A 4CP0A 2NP0A 4XF0A 4OHXA 1CX4A 1W6QB 3P3PA 4QM8A 1IS4A 1DZTA 5K7PA 3WP6A 1S0FA 4Q4W3 1ZVFA 5KC6A 1CAWB 1PO23 2P17A 2XLAA 1GLHA 5CFCA 3U10A 2CGOA 2E63A 4ORFA 4RQPC 1KITA 4XZPA 2GC2A 3S7IA 5KHGA 1KJLA 5FLHA 3MF6A 1Q8SA 2X5IB 4LBKA 1AVBA 3N36A 2ZTNA 4HPKB 2SBAA 3BOWA 1BBT3 3J26N 2WQ4A 4WM8A 1RUI3 4CDQB 2V09A 5FFOC 3MIFA 1I3HA 4XHBA 1XU2A 3V64A 5JPMB 4OHZA 3LGRA 4GA9A 2ZABA 5CADA 3ZFEA 2JG9B 3VBUC 2GMMA 2DUPA 3LSDA 2Y0IA 3H9AA 4XOGA 3H1YA 2ZKLA 2BGCA 3ZXGA 3VBRB 1CPNA 1LODA 2R041 1IGOA 1RUF1 1FPN1 1AR91 1IPKA 3AP4A 4R4ZA 4LO8A 2EXKA 3AKSA 4ZXKA 1MEC1 1VAKA 4OZXA 3OGGA 1SLTA 3ZN6B 3I8TA 4Y20A 1UPSA 2DURA 2I2SA 1QGLA 1JW6A 1K5MB 1CAUB 2CL2A 1QNYA 2GSYA 3KGLA 5TSWA 3W58A 5FQ0A 4CEYC 4EV0A 1W6OA 2WNUC 3E6BA 3ZXJA 1FMD1 1T6GC 1N3OA 1B09A 3SCGA 1XYPA 1JN2P 1GNHA 1BZWA 2RJLA 4L8QA 2VECA 2DCJA 3OYWB 2NPIA 1VAMA 2FZ1A 2BNNA 4NWVA 3AMQA 5A33A 3SXWA 5C8CC 3KCCA 1H8TB 2R30A 5LEJA 1CQ9A 3PVBB 1AYM2 3NJZA 3ZXDA 1ASJ1 3NAPA 2R043 1RUF3 3DL3A 3FUOA 4W6XA 3VBOB 1GFF2 2HEWF 2JICA 3GZTB 4OFGA 1FPN3 1AR93 3OY8B 3SLIA 2ZMKA 4LE4A 4HBNA 1QOSA 1OFNA 4XQWA 1IOAA 1MEC3 4GWNA 4NPRA 4EWAA 1Q5OA 4BIOA 5CA6A 2R072 2ZGKA 1ZBA1 2ZGQA 5CBLA 3WVJA 3M1HA 5IUQA 4LHLA 3B9CA 4JTOA 4FTEA 3J4UH 4QMAA 2PHXA 3ZO0B 4ZU5A 1F31A 4K40A 3WX5A 4LNVA 3WG4A 1VB2A 1FMD3 4XIKA 3AYDA 1IKQA 4XTMA 2NQYA 2QCSB 2ZGPA 2ZGUA 3LA3A 1H0BA 3VZOA 3IIAA 3VHNA 4Y5Z0 1OD5A 3N4MA 1IZ3A 1VB4A 3RI8A 1WD4A 3QLQA 2XBO1 4HL0A 2E9QA 1ASJ3 3RYRA 4A7ZA 1UX6A 2ZX4A 3WLUA 4HN0A 2XVGA 5ACA2 4FPHA 2IFWA 3RDIA 2D5FA 3RYPA 4A7KA 5CG9A 3SHRA 4KU7A 4AFCA 5EV7A 3WD5A 1ZYBA 4PDWC 3V0AB 5C9AA 3O7OA 2XJPA 4FPEA 1ZBA3 1LOEA 3MLKA 5JVVA 1AZDA 2PAMA 4C0BA 1YI9A 1N1TA 2W52A