1EAH1

Pv2l complexed with antiviral agent sch48973
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
272
Chain Sequence
b'ANNLPDTQSSGPAHSKETPALTAVETGATNPLVPSDTVQTRHVIQKRTRSESTVESFFARGACVAIIEVDNDSKLFSVWKITYKDTVQLRRKLEFFTYSRFDMEFTFVVTSNYTDANNGHALNQVYQIMYIPPGAPIPGKWNDYTWQTSSNPSVFYTYGAPPARISVPYVGIANAYSHFYDGFAKVPLAGQASTEGDSLYGAASLNDFGSLAVRVVNDHNPTKLTSKIRVYMKPKHVRVWCPRPPRAVPYYGPGVDYKDGLAPLPGKGLTTY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 2 COAT PROTEINS VP1 TO VP4
publication title Structure of poliovirus type 2 Lansing complexed with antiviral agent SCH48973: comparison of the structural and biological properties of three poliovirus serotypes.
pubmed doi rcsb
source organism Human poliovirus 2
molecule tags Virus
total genus 43
structure length 272
sequence length 278
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1eah100
4WM7C 5L7OC 1Z7S3 1PGW1 1AR61 1NCQA 2XBO1 2FZ1A 2QQPA 1NA1B 1PO22 4JGYC 4GMP3 1IHMA 4IV3B 5BNNA 4Q4X2 5D8AB 5CFDB 5A32A 4CDQC 1H8TB 4FSJA 1BBT1 5ABJB 1QJY1 1NCRB 5C8CA 1QQP2 5C4WA 1CD3G 2RS11 4WM7A 5L7OA 3ZFEB 1OOPB 2WLPA 1FMD3 1NY71 5A33A 1VBA2 1VBC1 4JGYA 3VBSB 4YVWC 1POV1 3VDDB 5K0UC 1EV11 1AR73 4CDQA 1PIV2 1GFF2 1PVC3 1RUE2 1RUF1 1DDLA 5BNOB 4CEYC 1RUC3 1RMU3 4Q4Y1 2WFF3 4PDWB 1V9U1 4FTEA 5C8CB 4GB31 4Q4W1 1NG0A 4FTSA 1HX6A 1PGW2 1ZBA1 1AR62 2XBO2 4RFT0 3S6PA 4WM7B 5L7OB 2IZWA 1D4M1 1PO13 3JBG3 4CEWC 1K5MC 1BBT2 2BFUS 1RUI3 1QJX3 1QJY2 4CDQB 2WS93 1VBE3 2RS12 2BPA2 5FMOL 1F8VA 3TN91 1NY72 2WS91 1VBC2 1AYN3 1QJZA 1M06G 1ND3A 1FOD3 1EV12 5JZGA 4CEWA 1PO23 5ACA3 1AYN1 1K5MA 1RUF2 4YVWB 1NA1C 4GMP0 4Q4X3 5K0UB 1F2NA 4Q4Y2 1V9U2 4GB32 4CEYB 1TME1 1ASJ3 2RM21 1RUC2 1QQP3 1ZBA2 1VB4A 1CJDA 2RR11 1D4M2 4RHV1 1HRI1 1MQTB 1VBA3 4JGZC 3VBFC 4YVSC 1NA1A 4IV3A 3ZXAC 4CEWB 5D8AA 3JBG2 1K5MB 2RS31 1PIV3 1H8TA 4N53C 1AYM3 2ZAHA 2ZZQA 3TN92 2WS92 4CDWC 1RVF1 1AR81 4PDWC 1AYM1 2HWF1 1AR63 1C8NA 1OOPA 3ZFEA 2XBO3 4JGZA 3VBFA 1AYN2 1QJU3 1SMVA 3VBSA 1FOD2 3VDDA 1BBT3 5ACA2 1QJU1 4N53A 1QJY3 1TME2 2RM22 5BNOA 1PGL1 4CDWA 1VRH1 2RS13 2RR12 4PDWA 4RHV2 1RUD1 1ASJ2 1HRI2 3VBOC 1VBC3 3VBUC 5CFCC 1POV3 3VBFB 4JGZB 1EV13 1RHI1 4WM8C 4YVSB 2RS32 1RUF3 4GH4C 1HXS1 2WZR1 4Q4Y3 1WCDJ 2R073 5DDJ1 1RVF2 3VBRC 1V9U3 4N53B 2RS51 4GB33 4Q4W3 1AYM2 3ZFGC 4CDWB 4QPIC 1ZBA3 2R071 2ZTNA 3VBUA 1D4M3 4RR3C 2PLV1 2R061 1R081 3JB4C 4WM8A 1MQTC 4GH4A 1QJU2 4YVWA 5C9AC 5K0UA 1PGL2 3VBRA 1RUD2 3TN93 2MEV1 3ZFGA 4CEYA 1C8M1 1A6CA 4Q4V1 1MEC3 1AL0G 3VBOB 1AL21 1RHI2 3VBUB 2HWD1 1MQTA 5CFCB 1HXS2 3CJIC 1ZBE1 1MEC1 4WM8B 5C9AA 4AEDC 5DDJ2 1FPN1 4GH4B 2RS52 1TME3 2RM23 3VBRB 1OPOA 1TMF1 2R072 1VBB3 2RR13 2PLV2 4RHV3 3ZFGB 4Q4W2 4QPIB 2R062 1R082 1HRI3 4NWVA 5FOJB 2RMU1 1VBB1 4RR3B 4QPGC 1POV0 3JD71 2DF7A 2HWC1 3VBHC 4AEDA 4EJRA 2RS33 2HWE1 3J8F1 4RS5C 5AC93 1EAH1 5C9AB 2MEV2 1C8M2 1X36A 1RVF3 3HAGA 1AR83 5AC91 2HWF3 1AL22 2HWD2 1AUYA 1RUJ1 1ZBE2 1MEC2 2HWB1 5BNPC 3VBHA 3LOBA 1ND2C 4YVSA 1COV1 3CJIB 4AEDB 1NCQC 2R043 1TMF2 1VRH3 1R1A1 3IDEA 2TBVA 3NAPC 5BNNC 1RB8G 1RUD3 4N43C 4SBVA 2R041 2RMU2 1VBB2 2BFUL 1HRV1 3JD72 1RHI3 2HWC2 5C4WC 1BMV1 5BNPA 2HWE2 1B35C 4QPGB 1ND2A 3J8F2 1HXS3 1OHFA 1HQNA 2WZR3 1EAH2 3VBHB 1BEV1 5DDJ3 4RS5B 2RS53 3NAPA 1RUG1 5AC92 1Z7S1 4N43A 1AR82 2PLV3 4GMP1 1RUJ2 1RUH3 2R063 1R083 2HWF2 2HWB2 2X5IC 3VBOA 1VBD3 1B35A 1COV2 4BCUA 2FZ2A 4Z92B 1R093 5CFCA 1RUH1 5BNPB 1ND2B 1R1A2 2GSYA 1VBD1 1NCQB 1FMD1 1R091 2MEV3 1C8M3 2R042 3NAPB 1VRH2 4Q4V3 5BNNB 5A32B 4N43B 4Y4YA 2Y26A 1HRV2 1AL23 2X5IA 1AR71 4QPIA 1BMV2 2HWD3 1PVC1 4RR3A 1ZBE3 5C4WB 1RUC1 1BEV2 1RMU1 2WFF1 1B35B 1FPN3 4CDXC 1ND3C 1RUG2 3M8LA 4IV1C 4CDUC 2BUKA 5A33B 4LLFA 1AR93 2WZR2 4RQPC 2GH8A 1Z7S2 2WWSA 1TMF3 5JZGC 1E57A 1VB2A 4JGYB 1X33A 1AR91 1PO11 3ZFFC 3JBG1 2RMU3 3DPRC 1W39A 1RUI1 1QJX1 2XPJA 2X5IB 1RUH2 3JD73 2HWC3 3FBMA 5LK7B 2HWE3 1VBE1 4CDXA 1VBD2 3J8F3 1EAH3 4IV1A 4CDUA 3CJIA 4RQPA 1FMD2 1R092 3JB8A 4FTBA 4Y5Z0 5GKAC 1FOD1 4IV3C 5D8AC 3ZFFA 1AR72 5CFDC 1H8TC 4Q4V2 1PO21 1NOVA 5ACA1 3DPRA 1PVC2 1RUJ3 5ABJC 4Q4X1 2HWB3 1NCRC 1RMU2 2WFF2 1COV3 4NWWA 4QPGA 2VQ0A 1ASJ1 3ZFEC 1OOPC 5J96B 1QQP1 4CDXB 1ND3B 1R1A3 1FPN2 4IV1B 4CDUB 4RQPB 4RS5A 3VBSC 1AR92 1PO12 5JZGB 3VDDC 1VBA1 5CFDA 5J98B 1RUE3 5FMOS 1RUI2 5ABJA 1QJX2 5BNOC 3ZFFB 1HRV3 1VAKA 1NCRA 1VBE2 3DPRB 1PIV1 1RUE1 5C8CC 1BEV3 2BBVA 1RUG3
chains in the Genus database with same CATH superfamily
4WM7C 2OUJA 2VE1A 3H8OA 2Y64A 1Z7S3 3A4UA 4UW6A 1U5YA 1O5LA 4KMQA 2ZGRA 2JDAA 3ZYBA 4P5HA 3VDAA 3WNKA 4D6SA 1CN1A 5FY4A 4YGCA 4YRDA 5J09A 1UY4A 3OEBA 5FPBA 3ZXJA 5FYHA 1SLTA 2CGOA 2Z69A 2VULA 5ABJB 1H1IA 2OQ7A 1QJY1 3V0AA 5LEKA 3GYDA 5JR7B 2HBTA 1S1AA 1NLSA 1XYOA 3AYEA 5FPUA 1YFWA 4OHYA 2PTMA 3MV01 4WM7A 2NPIA 1S0FA 2VMCA 3VKOA 1A8MA 3RS6A 2VTFA 5IATA 1REDA 2EIBA 1SBDA 1W6OB 2A6VA 3A7QA 3BI3A 2W1WA 2BYVE 2XQRA 1DQ0A 3T4HB 3VBSB 5C71A 5KBFA 3H7JA 3MPBA 2D3PA 3Q8AA 4ONUA 1AR73 2W0XA 4ZY9A 1W6NB 3AZXA 5DMYA 1IS3A 1PIV2 1RUF1 4BIOA 3IKWA 1W04A 5E88A 4WVZA 2WFF3 2Y6GA 1OA4A 1DBNA 1A78A 1YCIA 2G19A 1DZQA 2LM3A 3NMBA 4LO4B 4N7UA 3VLBB 1UXZA 1AJOA 3ZXLA 4FTEA 5EJ3A 3HN1A 2CV6A 4GB31 5K4LA 1GNHA 1N1TA 1W9FA 1ALYA 1ULGA 1US2A 2H0BA 2Q1ZB 4GWIA 1CAWB 5FK8A 4A41A 5C33A 1AR62 4V2WA 3VKLA 1J1TA 2JDKA 1PX4A 2VVFA 3WHUA 3IM0A 5F6KA 4A7YA 3ZIWA 2OA2A 4XCAA 2Q0AA 5T55A 3LEGA 3OTFA 3OD4A 3WQ0A 1H6XA 3O0WA 1UU4A 1GQPA 1XU1A 3W5MA 1PZ9A 5C3QA 4GWNA 1QJX3 2VVDA 3EQEA 4HN0A 4QQHA 5FRAA 3H1MA 1VBE3 5GLWA 1S2EA 3OY8B 1Q3EA 1F8VA 1QNYA 2ET1A 5H9QA 1NY72 3QBQA 1G8WA 4LR4A 1FV3A 3AMMA 1LHUA 1VBC2 1QJZA 2G9GA 2G4IA 2BGPA 1S0GA 2UYAA 4HETA 4QKBA 3KQ4B 3WW1A 1M06G 4NRQA 1SEFA 2JJ6A 3DXTA 2KD7A 4GZ9A 5A7OA 3J9SA 5FP8A 4NIDA 1PO23 1AYN1 1WLCA 1WMEA 3U14A 4MH0E 3AL5A 4YVWB 5SV5A 2JE9A 2VOWA 3I59A 4Q4X3 3WG1A 3CNAA 4Q4Y2 5FXXA 1W8OA 1TG7A 1BZWA 1SZBA 1QOTA 2HH9A 3O14A 5DUVA 1N3QA 1TME1 4LBJA 1ASJ3 1X50A 4NROA 2RM21 3CZUA 4PT6A 4QX3A 2Q8EA 4HXCA 1QQP3 4OI4A 1OPMA 1CJDA 5DUXA 1V6OA 1IKPA 2XHKA 2RR11 3KVBA 3WG4A 4AYUA 3U4XA 4K8RB 4LBNA 2N7GA 4LMFA 1HRI1 1VBA3 3VBFC 4JGZC 1Q43A 3EB7A 1NYWA 3RI8A 1W3VA 4E9KA 2CAVA 4GIQA 3TAYA 4IV3A 3ZXAC 3ZKUA 1K5MB 1JS9A 3MLJA 4XFIA 1H8TA 4B4QA 5JWPA 4FPFA 3LQCA 4BM8A 3ACIA 3FLRA 4OUMA 4AFDA 1Y9MA 2Y6HA 3KT4A 3POFA 4I02A 4XJUA 1H2LA 3BUCA 4QXHA 3RFRA 1AYM1 1AF9A 4QU2A 3OUJA 3ZR6A 3GZAA 3ZFEA 5IVJA 2KXLA 1ULPA 3N36A 4JGZA 4GWJA 3VBFA 1C28A 1HW5A 3I2FA 4CXYA 4BQ5A 3AC0A 4X8PA 2XHNA 4HN1A 2E26A 1UNBA 2VCCA 3BALA 3RZLA 2VNGA 1O3RA 3M3OA 3T2OA 4XFGA 3PUSA 2Y6FA 2R32A 4HSLA 3ON7A 1XJAA 4FFFA 1NZCA 1BBT3 1MS8A 4PIYA 5A1AA 1MZ6A 1QJU1 2K9ZA 5FMDA 3AFKA 4PI0A 4JRAA 3OD0A 1QIQA 1PGL1 4A3XA 2ETEA 2JX9A 4MGYE 4NHXA 4P9XA 4AK3A 2KR2A 3INAA 4Q0UA 4RHV2 5A3OA 3VL8A 2IFWA 1ASJ2 4ZXEA 3KD4A 5CB7A 3N7JA 4OHWA 3CEWA 1YIPA 3Q9OA 4D94A 4XFFA 3MW4A 3T0AA 4E4SA 4TXWA 5GZCA 2JIJA 2D6NA 4Z1VA 3JUUA 2RS32 4AW7A 4CA9A 3E6CC 2XJRA 4QXBA 1QHDA 2WZR1 2OPKA 4QM8A 3I3MA 1HJGA 2WWUA 5T54A 1VIWB 2PMWB 1V9U3 2Y6LA 3WSOA 3I54A 2VUJA 4N53B 3U10A 5IAXA 2XVKA 4ZS2A 3CMGA 4KU8A 1JUHA 1WW6A 4R9AA 1ZVFA 2WABA 4ZXKA 5A3TA 3BIWE 3W21A 1D4M3 1LRHA 4XHXA 2BNNA 4LBMA 2LTNA 5LA1A 3HNBM 4L92A 3U37A 4HKWA 2JG8C 1GZTA 1MQTC 1VAVA 5DAPA 4IEXA 2K0GA 4I2OA 5FXZA 1WZXA 3NV3A 1GMMA 3C8XA 3VDBA 1XYPA 1RIRA 3PMSA 2R49A 4ZS3A 1JYWA 1ACCA 4GJZA 5K0UA 3O1MA 5FY5A 5DG1A 1YQCA 1JXNA 2CGPA 4META 1RUD2 5HV0A 3TN93 1DYKA 3FMGA 5D2AA 5JSPA 3MIEA 1C8M1 4MADA 3J7HA 3TEZA 3KV4A 1HQWA 1XB9A 3J4UH 4A42A 1UZYA 4DINB 2CDPA 1AL0G 1AL21 4DRRA 2ZHLA 3VHRA 2HWD1 1MQTA 3GALA 3IIIA 2PA7A 4CU7A 5CFCB 1EUUA 4QD2A 4AI2A 3DYMA 1E5IA 3VV1A 5JCTA 1ZBE1 3AFGA 3C7HA 4H7MA 3JQWA 3SHRA 5DDJ2 2TEPA 1YQ6A 4GH4B 1UW8A 4YM1A 4OHVA 2JDZA 1W6MA 5JI9A 3ZO0B 2VQAA 1POQA 3B9IA 4QX2A 4BLIA 1Y9QA 3RRDA 4QMAA 3OCPA 3KCXA 4LO5B 2ARXA 1W0NA 1R082 2OVUA 3IB3A 4ZHNA 2Z79A 3SKVA 4NWVA 1WMDA 1OH3A 4AVBA 2WQ4A 1UWWA 4WZFA 3NQHA 5A3WA 2H0VA 4AHWA 3OBAA 1J1LA 2HWC1 4NIHA 4EZHA 1UD1A 4EJRA 5DPNA 3IDCB 2C9AA 2QDNA 5A3MA 1ZZCA 3MUY1 4Q26A 4RS5C 1SDDB 2HYKA 1UKGA 2OPWA 3MO4A 1W8NA 1Z0HA 4TLFA 3P1IA 2MEV2 2OXBA 1RVF3 2GP3A 2EXHA 1VJ2A 2TNFA 3HAGA 5F3CA 1W90A 4NOTA 5AC91 2HWF3 3WF3A 5KC6A 1W6PA 2X8KA 3HEIA 4P9WA 1GZCA 4URAA 1K45A 1S0DA 3IPVA 3LAGA 4OQ9A 3RSJA 1AUYA 4LBOA 4JTNA 2GU9A 4XHBA 3PJYA 2C26A 5FY9A 5F8PA 3LOBA 2XJPA 1ND2C 2PN5A 3QH7A 3ST7A 1VE0A 4Q0PA 1QU0A 5T5OA 2XJVA 3B00A 3J7MA 1ENRA 4LBQD 2AEZA 1F15A 4BQWA 2JDMA 2WN3A 2LUWA 2TBVA 3NAPC 4UT5A 3I2IA 1GZ9A 1RGSA 2PHDA 3S57A 5CYYA 3WF0A 3QCWA 4N43C 2VZ1A 3N9MA 2R1DA 2WO2A 1XBFA 2ZXQA 5L9BA 3T0DA 1WBFA 2RDRA 2WZEA 2RMU2 4Y22B 4PLOA 1WWYA 3KZ4C 3NV1A 2YB7A 3WP5A 1RHI3 4RGAA 2RJLA 2WSUA 1BMV1 1Y7BA 3HR9A 1NUKA 2NYYA 1H9WA 2JDPA 4QPGB 3TEYA 1ND2A 1HXS3 1OHFA 2FMDA 1HQNA 3R05A 3SCGA 3RYPA 1LOGA 4AQ2A 1RUNA 2UYBA 1GP4A 4I0AA 3ZSMA 1H2KA 4R4XA 5FBZA 5C8WA 4OQ8A 4JKLA 2NLRA 2VO5A 4XQWA 2WNUB 2RS53 3NAPA 3WG2A 4O61A 1URXA 1ENSA 2ZS6B 2GC2A 3AMQA 4G4FA 3O1OA 3N9NA 1TE1B 4N43A 1UMHA 4EWEA 4W6XA 3EMRA 1W9WA 3FWEA 4JDMA 4LITA 4IGOA 4K1ZA 4W4ZA 4NAMA 2HWF2 2QVSB 2HWB2 2EF6A 3DL3A 3SH4A 4R9CA 1COV2 4Y1YA 4COZA 2FZ2A 3A22A 4TYSA 4D6RA 2XONA 2VW0A 1JN2P 4XW3A 4C90A 4S2FA 2D3SA 2HEVF 5BNPB 5JXJA 2B42B 2ZGKA 2ENRA 1VBD1 1ZX5A 4P9YA 4FP3A 1ZZ8A 3E5XA 4NPRA 4XOGA 5J3UA 2ZACA 3KMHA 5A7PA 3MLKA 5A6YA 1EY2A 4CPBA 4MGTA 1W06A 5LW9A 3ETPA 1XNKA 4E4DX 4BH9A 2E63A 3LWCA 1HRV2 1J83A 2VPVA 4QPIA 3DXUA 3PVBB 3IAQA 2JG9A 2AENA 5I0UA 1PVC1 3NKTA 3V0AB 3E97A 2DTWA 2D43A 4JRLA 3M1HA 1HQLA 4HBNA 1BEV2 4XUOA 4EN0A 4JQTA 2DFBA 3VHPA 4CDXC 1ND3C 2E7TA 1DZRA 1X9PA 3LA7A 4IV1C 1PK6C 3VD5A 1UL9A 4LLOA 1H4GA 1IS5A 2GH8A 2EALA 3H1YA 4KWJA 1WW7A 2PFWA 4Q0QA 4UFLA 4XFHA 2JKBA 4Z82A 1JHJA 5FYTA 1VB2A 1WLDA 1VMJA 1LU2A 1W8FA 4ARYA 3I2JA 3O1RA 1ZRDA 1X33A 4DEVA 1NE6A 1K3IA 4P9LA 1PO11 4DEQA 3KT7A 3JBG1 1PM4A 2EVXA 4QQ2A 5JR2A 1MS5A 5L19A 2D3RA 5FQ0A 5JLVA 1YWKA 5LCWL 4TZDA 5LZ6A 3JD73 1GICA 4O65A 3FBMA 1GP5A 4AEKA 1O5UA 2HWE3 2D98A 2VW2A 4PIXA 3WP6A 4CDXA 5DABA 1LESA 3VZLA 4IV1A 3TNPB 2QDRA 4FXKB 3CJIA 3LGRA 4ISRA 5F32A 5C6CA 1CJPA 3HQXA 4I3GA 2J1EA 4XTPA 2FDHA 1CIWA 2BW8A 5J7MA 2J42A 4QPWA 1FOD1 3TWIA 1HLCA 5D8AC 1Y3TA 5EV7A 4MXVA 4KBZA 4UF0A 5BNQA 2H6BA 4XQDA 3M7AA 2ZCWA 4BQ2A 1DQ1A 1YO8A 1RMU2 2D93A 3AZYA 3K4AA 3UKTA 1XQNA 4XF3A 2BTVC 2DYCA 2O1QA 1F4HA 4LIUA 5CEHA 2A3YA 2W94A 1SLBA 1W3XA 4BQ1A 5CA6A 3VHNA 2UY9A 5J96B 2ZX2A 4RGKA 1UIJA 1WD3A 4WVMB 1G9BA 1CAXA 1R1A3 4X6RB 2P3YA 4NIGA 1GSLA 4CDUB 5FZEA 3T3YA 3VKNA 5JOZA 4AFCA 5IK4A 3VDDC 1O3SA 3OG2A 1SACA 4DXSA 3I3EA 1RUE3 3MIGA 1ULFA 4XUPA 4ES8A 1ZRFA 1AZDA 1RUI2 5BNOC 2H6CA 2GN3A 4H3WA 3U11A 3AYDA 2WN2A 2K2SA 2IVJA 3DPRB 3POSA 2R6QA 4BLJA 3B5LB 5C5UA 1W8UA 4I0WB 4UFMA 4DZGA 5C8CC 2B4KA 1GWMA 2VZRA 3VL9A 5FO9B 4LJHA 3HN3A 2R1BA 3ILNA 1QF3A 2A73B 3TOJA 4MZUA 4A6SA 1LOFC 1XYNA 5D21A 5C70A 4R8HA 2XBO1 2ADDA 2QQPA 1KQRA 3HMYA 1S0BA 3RYKA 3WQ1A 4GMP3 3ZYRA 4ATFA 3HNMA 4IV3B 3THTA 5G05L 1DYOA 4Y1UA 4BQ4A 5BNNA 2EIGA 1GWLA 4YFZA 1AXZA 1UQXA 3WCRA 1C1LA 1H8TB 4CE8A 3RYRA 3DCQA 4RN5A 4QKNA 3ES1A 1NCRB 2DVAA 4D7TA 5C8CA 4C8DA 4CXWA 1DG6A 5C4WA 2VMEA 3V65A 2RS11 1ZRCA 2CWSA 3ZFEB 4INDA 1LOFA 1FMD3 4QU1A 1GWKA 4DRVA 2GNBA 2AZ5A 5LBBA 5SV8A 4GA9A 5IVVA 5LA0A 5A6XA 4LHNA 4UFJA 4JTOA 3P5BA 1POV1 3AXEA 1FV2A 5HPOA 2XJTA 2EIEA 2OT7A 1EV11 2C9KA 3POEA 2Y34A 5FLIA 1RJ7A 4IUGA 3AMHA 4LBQA 2PHWA 3V0BA 1UPIA 1RUE2 1JZ4A 1DDLA 2X09A 3PUQA 3OPTA 4CEYC 4XPVA 1A34A 1GV9A 2DCYA 2V09A 1JI6A 1DFQA 4PBPA 3H7YA 4MSVA 4D7SA 4Q27A 1RINA 4JAAA 3OGVA 1KITA 3VD3A 4BISA 1IKQA 1NLRA 3RVHA 4CP2A 1ZBA1 2D44A 1N1SA 1KFUL 4AI3A 5L7OB 1GQGA 1PZ7A 3WNXA 4AQTA 4ASLA 2B8MA 2ZGNA 4X8NA 5J37A 3K51A 3KV5A 4R52A 1YYNA 4MXWA 4TSVA 4H14A 5LA9A 2BFUS 1PVXA 4XXAA 3W58A 2GN7A 3I2GA 1SQ4A 4S2GA 4NHYA 1BK1A 1QJY2 4A44A 4XBNA 3D6EA 5EJ1B 4CDQB 1W6QB 2Y33A 2A6YA 4HMZA 1WBLA 2IXHA 2BPA2 4CRQA 3ZOIA 4KWLA 3RDIA 1ULOA 1AVBA 1D4VB 4DUWA 2DFCA 1LHOA 1GU3A 2NMOA 2UWBA 4QGNA 3ZN6B 5F5AA 2VL4A 5FYVA 2P34A 3C3VA 4K7JA 1UN1A 4YZ5A 4YFWA 1AYN3 1VR3A 5FY8A 1SLLA 2ZGUA 4XZPA 4AFAA 4HVRA 4IEQA 4IEZA 2RDNA 5FZFA 5HV4A 5DN2A 1SFPA 1VRBA 4NIIA 1UX6A 1UOJA 5JZGA 3NNMA 5KXEA 4EWAA 2SLIA 3ZPOA 5ACA3 1RUF2 2JDYA 3JQXA 3UGGA 1X8EA 3H42B 1OLRA 5K0UB 2FDKA 3DGTA 4YG0A 3N9PA 5C3SA 2XL7A 3CHXA 4KI5M 2HEWF 2P4EA 2A6ZA 4LO6B 2VXRA 4BU2A 2CWMA 4GB32 1UOBA 4XZUG 5JSOA 1RUOA 2IXLA 1SLAA 3ORJA 1YQ2A 1OLME 5IJRA 2OS2A 5FZ6A 5F1RA 4MLOA 1VALA 4K21A 2Y0IA 1KGYA 1UY1A 2ZEWA 1YJLA 2Q4SA 1MQTB 1Q8PA 3AK0A 2ORXA 5FIXA 4YVSC 3LIHA 5FR3A 3CZJA 3LKJA 1NXD1 2P1BA 3N35A 1PM7A 2YYOA 1QDOA 4CEWB 1R1ZA 3PJQA 4LO7A 5FAXA 3LPFA 1PIV3 4W65A 1ULEA 2QUOA 5G04L 4CTEA 3POGA 1W6MB 5BYNA 3GBWA 5JXIA 1D0GA 1AYM3 2A6WA 1IQAA 1SPPB 3MF6A 4PLMA 3IMNA 1OMIA 4IW3A 5EFUA 3VD7A 3ZXDA 3H8XA 4CDWC 5JMCA 2WNVA 4AR2A 1O8PA 2ZHKA 3VZOA 1NLQA 4PDWC 4I3PA 1P8JA 4W50A 1OUXA 3ROUA 5EHDA 3GDBA 3PUIA 3LFIA 2WO7A 1ODNA 3BOPA 1AR63 1UYZA 1OOPA 1D0HA 3F2ZA 2GNTA 3F95A 1N1YA 1Q56A 2XQXA 3L2HA 4QGMA 2W1UA 2EICA 1EUTA 2ZX3A 1AYN2 1QJU3 2YHJA 3T2PA 3D4KA 3OEAA 5LBCA 1OFNA 2V4AA 2RG4A 4NMIA 1WCQA 5FZOA 3J26N 3OUIA 3UETA 3AZZA 3VD9A 3WT3A 5ACA2 2W39A 2PAMA 3NJXA 3NW4A 4WZCA 1TME2 4AVSA 3B3QE 2IXIA 2RM22 5B4XA 3BOWA 4CDWA 1CVNA 4ZZ8A 3M3QA 2XOMA 2RR12 2WYSA 4PDWA 5EP9A 4NVPA 1W6PB 3MYXA 4H2AA 1HRI2 1Q8QA 1DGWA 4L8QA 4FOVA 3VBOC 4EZ4A 1VBC3 4FI9A 3NL1A 5FZIA 1CAUA 3VBUC 1JU3A 3O7OA 1V6KA 2LRPA 1LEMA 2W1SA 4QWNA 3N7MA 5EPAA 1YC61 4XUQA 4BZ4A 4WM8C 2XH6A 3ALQA 1MPXA 3RJRA 3OUHA 3RG0A 3NNFA 2ZEYA 1CPNA 3CF6E 2OIIA 3A0KA 2DU1A 2Q1MA 4Q4Y3 1WCDJ 1BCXA 1IPSA 3D5OA 2D5HA 3KM5A 4OVEA 2Q8CA 4BMBA 1YIFA 4LUKA 4Q4W3 1H2NA 1AYM2 3JU9A 3VZNA 1WGPA 2PHXA 1OXCA 2VZUA 3MPPG 4JCKA 1L7LA 1DU3D 4IEOA 5J48A 2YFZA 3VBUA 4RR3C 3EHKA 2PLV1 3TB0A 1G9DA 2YC4A 2D40A 4LXLA 5F37A 1UZVA 3MUZ1 1Q8VA 1ZZBA 2QQMA 2R061 4XF9A 5B2GB 1IQDC 3NNJA 1Y9GA 2W08A 1V6IA 3FL7A 4WM8A 5FP9A 3WEZA 5F7UA 5GLUA 4M01A 1V6JA 3PUHA 3EXUA 3QOPA 1QJU2 3WY6A 1SLIA 4A6OA 5HCFA 1UKRA 2W95A 1PGL2 1SG3A 2JWPA 1GUIA 4PLNA 2LROA 1T2XA 2WYFA 4YGBA 4YW4A 1VAMA 3MZHA 4KG8A 1A6CA 5CADA 2QZ3A 2ATFA 2ZGQA 3PVOA 1RC6A 2VQTA 4Y24A 5FV3A 1Q8SA 3AP6A 4CCKA 1S0JA 1HJFA 3LDRA 3U07A 2A75A 4UFIA 1IPJA 2PHFA 3OYWB 1OBNA 4BMEA 2QQWA 4GKYA 1W9SA 4W8JA 3MI8A 3NJZA 4YZ4A 1GOFA 5A70A 5I0RA 3CJXA 3U75A 1FPN1 5I8SA 1LEDA 2BNMA 2D5FA 5FP4A 3SNMA 4XEZA 3AP4A 3BPZA 4HANA 4AGRA 3VZMA 3VBRB 5EYYA 1TMF1 2YFUA 2ZA9A 1I1EA 2AC1A 5K9YA 3H3UA 4LKSA 2VMIA 1C57A 5C9AB 4RHV3 1CZTA 3D3AA 2YU1A 4Q4W2 4QPIB 3ZFGB 3X29B 4XJ9A 2JG9B 2FDJA 5BY5A 5A80A 3TRSB 4EQVA 3H1WA 4LUMA 5KXBA 1POV0 5FYUA 1W0OA 4D8MA 4YZ1A 5FYSA 1XXNA 2RS33 4NUBA 2ZMLA 3J8F1 3THCA 5AC93 2AREA 2ZGPA 1EAH1 1FAYA 1QJFA 1C8M2 1UCXA 1X36A 3MGUA 1H9PA 3O0VA 4AAXA 3AYAA 1JZ6A 2DCKA 3PHMA 3M3IA 1AR83 3BTAA 4ET7A 2OYZA 1O3TA 4A7ZA 2PHLA 1PNFA 2XJUA 4MGSA 2ARAA 4UOJA 5LEJA 3QH6A 2VGDA 1AL22 3HT2A 1NQJA 4GD4A 1CAVB 2HWD2 5JMOA 2E9QA 1JMUB 2QFEA 1O6UA 5FQ0B 3NVCA 4YARA 2Q8DA 1RUJ1 2ADEA 1ZBE2 2JB8A 3TNQA 2QE3A 3SCHA 1BVP1 3AMPA 4N90A 1YI7A 3IT8A 2E51A 1W2OA 2B7YA 3RPQA 1GYKA 3CJIB 2P3IA 4S2DA 4XUNA 3R4DB 1PGSA 2VZTA 4NE9A 2B9UA 5HXMA 1VP6A 4AEDB 1NCQC 3VZKA 3MW3A 1VRH3 4OI0A 3I2HA 3A0NA 3CLPA 1RB8G 1RUD3 3U1XA 4IE5A 1FATA 2VXJA 4JQRA 5GLTA 4MX3A 4E27A 4FXGB 3ZM8A 2XKPA 2UWCA 2K46A 2EA7A 2WZ8A 3NSTA 4OLLA 4TWTA 1V00A 4FQ4A 2JD9A 2FDGA 1WD4A 2BFUL 4FOYA 3S30A 1LB2A 2HWC2 4Y20A 5FZMA 5LRRA 2VBDA 1PX3A 4PF5A 1B35C 2CDOA 1OI6A 3ZYGA 3WNOA 5FZ0A 3BGAA 3M3CA 5IK8A 1SBEA 1F35A 4ZKTB 1STMA 3U4SA 3VBHB 1OF4A 1UYXA 5DDJ3 4LK7A 5FP3A 3ACLA 3OGJA 3ILRA 3WNPA 1RUG1 3WD5A 5AC92 3GZEA 5KHJA 1Z7S1 3GBGA 1FXZA 3KS7A 3FN9A 4CCOA 4UYBA 5I8TA 1ZZ9A 2QBXA 2GH2A 1DZTA 1I5PA 1AR82 2DWRA 5FZGA 1NE4A 3ELNA 3LOIA 3Q8EA 3S7EA 5CNAA 4CP9A 1R083 3ABZA 2CYFA 5K7PA 1C5HA 2X5IC 4M3CF 3SC7X 4K9SA 4JDNA 4OI2A 1VBD3 1RXGA 5KHIA 1B35A 1N1VA 3B93A 3POIA 3POBA 5LB6A 1D2SA 5IVBA 1KFXL 3FHIB 1UYPA 3NJVA 1AX1A 2VMFA 1DGWX 1S55A 2GC3A 4UI9L 1UIKA 4CXXA 5FFOC 2FBEA 4QPYA 1GP6A 2QQNA 2R30A 4QXKA 2MEV3 2XVGA 3BTZA 1QNWA 4IE6A 2DCJA 1GZWB 1VRH2 2JIGA 4Q4V3 3OF1A 5BNNB 3WVJA 2MPFA 5FPZA 1OT5A 2QQVA 2ZX1A 4HL0A 4M3CB 3UV9A 2X5IA 1AR71 2ZEZA 5FZBA 5JOYA 1BMV2 3FBYA 1SFNA 5IYYA 3K4ZA 4BQXA 3C2UA 1NQDA 1GBGA 2WAAA 4P9GA 5C4WB 2WFF1 1H1AA 1VPHA 2JG8A 4P5YA 2D97A 5F3IA 1WA6X 2ZABA 5IK5A 3ATGA 2BGOA 2VY0A 1TVGA 2JDNA 3ACGA 5T52A 2BUKA 2X10A 4YW1A 5FZ7A 4RQPC 2ZOEB 2I45A 4LULA 5DXDA 2WWSA 2Y60A 3BPSA 3FFQA 5DUUA 4XIKA 4Y1ZA 1PNGA 1E57A 4KWKA 1G9AA 2AEYA 1L7QA 3POYA 3WCSA 1LHNA 2PQQA 3IDAA 3HBZA 5FKBA 1AR91 4AVCA 4KGGA 3S0MA 1OSGA 4XJZA 3V0BB 1CZVA 1LHVA 2RMU3 4FOWA 4A7KA 1UAIA 3AKPA 4LA2A 4A45A 4DO0A 1JBCA 1TNRA 1ZZ6A 2DUQA 1QJX1 4EROA 5JPMB 3B02A 2F17A 4FOQA 3AZWA 3ZDSA 1JUIA 1VBE1 1KD7A 2B9VA 4B7EA 1HIXA 1VBD2 3VKMA 3WOGA 4KH9A 1DHKB 3B01A 5FJHA 2JD4A 4QX7A 1JYNA 5FOJB 3KVAA 4RQPA 1LTEA 2PYTA 3OPWA 2PHTA 1X82A 5APAA 3KT1A 1YLLA 2AYHA 4R9DA 2GDFA 3SXWA 5FK7A 4BIFA 1VMHA 4QQPA 5GKAC 3N7KA 4Z8BA 3LIGA 2IVIB 3QD6A 4MXWB 4QX5A 2W92A 1NAEA 5JSRA 3ZSJA 1OVSA 4FAHA 4Q4V2 1PO21 1NXMA 1PVC2 5FXWA 5ABJC 4RD7A 4Q4X1 2HWB3 3L9JT 2FHRA 4M3CE 1KRIA 1SLCA 2EAAA 4OCTA 1COV3 2OX0A 2BOIA 2QJVA 3GCXA 5H9RA 1BHGA 4HG6B 4Y26A 5LWBA 1ASJ1 4PI2A 2PELA 1QQP1 2FCUA 5CAZA 2OW4A 1IOAA 5EJZB 1U5XA 4N8MA 1CIYA 4RGGA 4BB3A 1U5IA 3M3EA 4RS5A 2X05A 4OMDA 3VBSC 4JKMA 1GQHA 1PO12 5JZGB 1VBA1 2V5YA 5F9TA 3KHCA 3LEKA 3HIFA 2WNEA 4LQRA 4B4PA 5FTTC 5ABJA 1W8WA 3ZFFB 1HRV3 2IXKA 3I7DA 2QNKA 1QWRA 2ZGMA 2VZOA 2VCAA 5FPLA 1IZ3A 1JYTA 1GOHA 3AJZA 3HNYM 1BVVA 1L3JA 5A1FA 4O7XA 5ANNA 1BEV3 1MVEA 3ACHA 4YW5A 4HK9A 4LBKA 4F8AA 4Q5OA 4FPLA 1W6OA 4AEJA 4IGPA 5IVCA 5KWRA 2E33A 3QACA 1O91A 3CDZB 1PGW1 1F5FA 3C7GA 3KSCA 4XURA 3V64A 1GANA 1ZREA 1IHMA 2F4LA 2QQKA 4KWUA 2NZ9A 4YPJA 3G6JB 4AL9A 2WBKA 1MACA 2ZGSA 3MFCA 5A32A 2VUAA 5CFDB 1DGRN 1U0AA 4AHYA 1F31A 2NQYA 1BBT1 1MZ5A 4FSJA 2W3JA 1XNDA 4W6WA 2VNRA 1UZZA 4PBOA 4M00A 4B1LA 2B45X 4WVVA 2WINB 2J1SA 2WNVB 4G9SB 3WDYA 2GMMA 1ZZ7A 2ZJCA 4I09A 3FLTA 3UGHA 1CD3G 1IGOA 3BVCA 1W28A 5BUVA 5JAXA 1OOPB 1XE8A 2JDHA 5AVAA 5FY7A 2XG3A 5JI7A 1PHMA 1OFSA 4MGZE 4YG3A 2BGCA 2WKKA 1YFYA 2WL1A 4YVWC 5FZOB 5A7QA 2VBPA 5J36A 1MZFA 3I2OA 4A3ZA 3GGLA 1DYPA 1HV1A 4PQ9A 3ZYFA 4QGLA 2BQPA 1GFF2 1OVPA 1RXFA 1XE0A 1V6MA 1DIWA 2E31A 3N3HA 5F2WA 1RUC3 4YNIA 5DUWA 1E5SA 1RMU3 2J1RA 2VUDA 4Z2WA 4PDWB 3UJOA 1V9U1 2O8OA 5EZWA 4PQQA 1JZ8A 3OJBA 4J25A 2FMYA 3MLLA 1U5ZA 2VTXA 3KF5A 4FFHA 1XC6A 1NG0A 4OFGA 4X6QB 1HX6A 4Y3OA 1KJLA 4YLZA 5GZFA 4GQ7A 2RHPA 4FTSA 2XBO2 4RFT0 3S6PA 4WM7B 2Y38A 3SCFA 4OMCA 1D4M1 2EXIA 4C1XA 4DS0A 2P2KA 1ULDA 3WX5A 3P3PA 3LDKA 4NPLA 4B4RA 2C4XA 1K5MC 5FOBB 2JXAA 4K6BA 2A3XA 1RUI3 4GALA 5T5LA 3C7OA 4NN0A 5C5TA 3O1UA 2VNOA 1JODA 2J22A 3OBRA 2ZX4A 4AGVA 1DGRA 3B94A 1C1FA 2RS12 3ENRA 3ZSEA 3ME2A 1W2NA 4CUBA 3R4SA 3PNAA 3TN91 5F3EA 2WS91 2XWJB 1W9YA 1ODMA 2XUEA 3ITQA 1RTVA 3LSEA 4BYYA 1ND3A 1T6GC 1YHFA 4YW6A 2CU5A 3WW3A 1PK6A 5KXDA 2B46X 1EV12 3UKVA 2DUPA 2XXZA 3T30A 5CBLA 5IVFA 4GKXA 3I49A 3T1MA 4MOAA 1K5MA 1RJ8A 1NA1C 4V2VA 3AP9A 2AGSA 1W8ZA 1ZA4A 1ENQA 4CSWA 3ZMOA 1XSQA 2C0ZA 2VCBA 1LU1A 1HB1A 2G1MA 4CU6A 4CU9A 1FYUA 4QX8A 1RUC2 1ZBA2 4XDOA 1VB4A 2YY1A 2UY8A 2W87A 4GAZA 5A3PA 1RITA 4K3UA 1JHNA 2DUOA 2Q5TA 4XTMA 2VM9A 4AHZA 3TYJA 1OUSA 1CQ9A 1SBFA 2JECA 4UW3A 4M0HA 4AE2A 5GZGA 1PMHX 3CO2A 1LENA 4IE4A 4JDOA 1MS1A 2G9FA 1L7RA 3THDA 5E8AA 1JW6A 2VOXA 1NA1A 1O4YA 3HVDA 4CVUA 2HLEA 1O8SA 1RYYA 1NZIA 5D8AA 3ZKYA 1OD3A 4P08A 4AHXA 5T5PA 3I59B 4N53C 5JOXA 2JEMA 5FYIA 1WKYA 2ZZQA 1LOEA 2YBKA 3UYJA 4XAAA 4H55A 1YRZA 3WW2A 1RVF1 5EWSA 2WQ8A 1UZ0A 4XBLA 2J1TA 5GJ6A 2DCZA 1YEWA 3AKRA 4P9JA 4HKOA 3WINE 1ENXA 3AVRA 5AFBA 2HWF1 3WF2A 2XB6C 3UJQA 1C8NA 2GC0A 4KGQA 4BWOA 3WNLA 1WCKA 4HONA 4RSUA 2RE9A 5FZ3A 3EO6A 3KGLA 3K46A 1QH7A 3MIFA 4IEUA 2ZPXA 3CIHA 3C7EA 1US3A 2GZWA 2XWBB 3VDDA 4B29A 4NO4A 1UMZA 3ZXGA 4BJ0A 4EN6B 2YGLA 2YU2A 4PF1A 3FUOA 4N53A 2VU9A 1QJY3 5F2SA 1OD5A 3NV4A 4JHTA 5FYMA 3S5AA 1G7YA 3B7MA 2PQSA 5BNOA 1YQ8A 2R0HA 4DUXA 3VD4A 3UT0A 3W59A 2CAUA 1E5RA 3SQOA 1MS9A 2J1AA 4AF9A 5IAVA 3BKZA 5AFEA 1O7FA 5CFCC 1LKNA 3GHMA 3VBFB 4JGZB 4B8EA 2GNMA 1RHI1 2YZ4A 4NIAA 1Q5OA 4RL7A 2YBSA 1RUF3 3O12A 1OH4A 3K4DA 4GH4C 1HXS1 4AWDA 4ES9A 1HB4A 2NM1A 1K42A 5H9SA 1SCRA 2ERFA 2JB4A 3ZYHA 3ILFA 1HB2A 3E1F1 2EAKA 3M2MA 1G9CA 2RS51 4GJYA 2D6PA 1UOGA 2ZX0A 4GB33 3A21A 4XMIA 3FFZA 2WLQA 4AAPA 4IL7A 5GM0A 3E5UA 1OKQA 3AP5A 2WA4A 2R071 4PJYA 4B3NA 4N9IA 2ZTNA 4BK5A 3NNLA 3PIGA 2V73A 5F39A 3LF7A 4L0PA 4AFBA 3JB4C 3Q8BA 1YI9A 5FY1A 3V56A 3ZYJB 4ARXA 4OHZA 4AEMA 3P3NA 4CCDA 4GH4A 1H1MA 1JYIA 5GLZA 4EE2A 5C9AC 1QOOA 2R16A 4XFBA 1J3QA 2Z4FA 3WP4A 1ZM1A 5BPXA 5T5JA 1DLLA 4QKFA 5FDBA 2QZ2A 1DQ5A 1TZOA 3APBA 1RL3A 3D8CA 2CL2A 3LFMA 1IS6A 3QLQA 4HVOA 4XAEA 4CEYA 5A6QA 2ZMNA 5A3LA 1UF2C 5FMCA 2P5BA 2P6CA 1H30A 3LE0A 1CR7A 5FXVA 5FZ4A 4KBBA 2ILMA 4CP9B 1WLWA 2VOTA 1S2KA 4BK4A 4LKFA 4CCJA 3R4UA 5J1XA 4EYUA 4FPKA 3K3NA 4BOWA 3NV2A 5EXOA 3GNEA 4RA0A 5KC5A 1S0IA 5IW0A 4TTGA 1LHWA 2LW8A 1ZRIA 2FDFA 1MEC1 4FO9A 5I91A 5C9AA 1MS0A 5FWEA 4BPZA 1KS4A 3AXDA 1XNAA 5JUVA 1X9TA 1YJKA 4QAWA 4COUA 5JIUA 4PCRA 3IDBB 4YZ2A 1TME3 1JH5A 2RM23 1X7NA 4MGKE 2CNAA 1REFA 4A4AA 2Q30A 3EYPA 2RR13 5FUNA 2PLV2 2GC1A 4QDSA 5FZDA 4XC9A 4IE0A 2R062 1HRI3 4QM9A 4LNVA 2XL9A 5HCHA 4G3YC 1LECA 1VBB1 1CX4A 4QPGC 4OUEA 2P6HA 3MDPA 4UXAA 5KHHA 2JG8B 3L2YA 3WG3A 3JD71 1YQ5A 2DF7A 4IEYA 4QHOA 4DB5A 3ZMNA 5D1IA 4IGQA 2HWE1 1LODA 1C3HA 1F4AA 1LGBA 2WNUC 1V6NA 2E53A 3FUQA 2JKXA 4Q1PA 1F9KA 3WLUA 4DY5A 3O1PA 1MS3A 2WR9A 1H6YA 1DLCA 1GR3A 4ITCA 4L97A 3I97A 4EN7B 1JOJA 3GCWA 3I3QA 1S4CA 2GMPA 3BN6A 1LULA 1M4WA 2BWAA 3AKQA 3HJRA 4FPOB 1KXGA 1W05A 3OSDA 2DU0A 4IDZA 2YGMA 4XJWA 4CCNA 5BNPC 4F83A 1W03A 2GP5A 1W9TA 4YVSA 4LHLA 3FLPA 1WCSA 2GAUA 2WNUA 3AM2A 3R0RA 3ZXEA 3D0JA 2RDQA 4QX0A 1Z78A 1TMF2 1HDKA 4OZXA 1R1A1 2DVDA 1W2TA 4LKDA 3OGSA 4HT1T 4XACA 2VNVA 3O5SA 1KDMA 4FPCA 4OUSA 3RWNA 3GZUC 3AJYA 4Y1VA 4QDRA 4NJ4A 4SBVA 2R041 5FYBA 2OZ6A 2RJKA 3AL6A 2EIDA 2IUWA 5E16A 3S7IA 5LATA 2VH9A 3FJSA 2VAUA 5F3GA 4DXZA 4HOOA 5KHKA 4Z2AA 4AI8A 3IPVB 5FZKA 5A1LA 2V4VA 5BNPA 2XKOA 2XGXA 3LSDA 4LHSA 3J8F2 3AKTA 4MHUA 2G9ZA 3IMMA 1IPKA 1QY4A 1EAH2 2WZR3 3WQ7A 2AR6A 2Y8KA 3BB6A 4J1XA 1MS4A 2BRTA 4RS5B 1DGLA 5CKQA 3T1LA 3RMYA 1JU4A 4LEJA 1WCUA 5FLHA 4OI1A 4FT8A 3AVSA 4EWDA 3FHAA 2BJSA 3H9AA 3WDTA 2W5FA 2W91A 4QB1A 1S0EA 2VC9A 5EIYB 5L73A 4GMP1 1RUJ2 3OBTA 5FLJA 2VCMA 1UY0A 2MHFA 3VBOA 2W2IA 4AVVA 2DCTA 4ZPIA 5FUIA 4Z92B 3SISA 1RUH1 4W6YA 2YROA 4K1YA 4KNCA 5CU1A 4AI9A 1ND2B 1W0PA 3I2KA 4JVAA 1F5JA 5E1RA 1D7PM 4J6GA 4F7ZA 3BU0A 1OKOA 5HXVA 1FMD1 1R091 1C8M3 2DVBA 1ZYBA 2QQJA 1AXYA 1V6LA 3KF3A 4U36A 3NAPB 2ZGLA 4UBGA 3THPA 2WT1A 2XLAA 5F5IA 5A32B 4N43B 2Y26A 4UAPA 2FCTA 2Y0OA 1AL23 5A7WA 3M70A 4CP1A 5EYXA 4PIZA 2HWD3 4B1MA 4ZZ5A 4RR3A 1ZBE3 4ORFA 3SKJE 5L36A 3RZZA 1H8VA 4GXLA 2VR4A 3E6DA 4BE3A 1ST8A 1EPWA 1AHSA 1RUG2 4GWMA 3SEPA 1SHWB 1ZNPA 4CDUC 1AR93 2WNOA 2WZR2 1Z7S2 4XF1A 5FP7A 5GZEA 5F6LB 3WF4A 1UY3A 2HJIA 2ID4A 3POJA 3TBDA 2Q1FA 4QHZA 1GOGA 3LD8A 4XYXA 1BQPA 1TQ5A 4LKEA 1X8MA 5FY0A 4Q29A 2O0OA 4MHRA 2E7AA 5JIAA 3BU7A 1W39A 3CL1A 3DPRC 4HKLA 5LASA 5IVEA 1PZ8A 4Q0SA 2JE7A 1FNYA 4KQ7A 2HWC3 5JOWA 5LK7B 3VKFC 4XQ4A 4WVMA 1UMIA 2XLFA 4COYA 1MZEA 2QQOA 3DN7A 4CDUA 1YNAA 4LE4A 1UXXX 2ES3A 1I6XA 4KG0A 5FJKA 3ZR5A 4LHKA 4JKKA 3R6SA 4AFMA 1IS4A 3HOBA 4Y5Z0 4QQLA 2ZEXA 2BNOA 2VZPA 4AI1A 1SFYA 4CU8A 4IV3C 4F3JA 2VZQA 5F5QA 4FBFA 1AR72 4DY3A 4HVQA 2VUCA 1H8TC 1TEIA 1NOVA 5ACA1 1HN0A 3DPRA 1ONAA 3NRUA 4UBHA 3WR0A 2E6VA 2XLGA 3WZ1A 4CZSA 4E2GA 1IG3A 1NCRC 1QGLA 2JENA 5CKNA 2BU9A 2WFF2 2WSVA 1EPZA 3RQ0A 5KXCA 5JPNB 4NWWA 4MGIE 5F5CA 4BXFA 2VQ0A 3PU3A 3WNMA 3ZFEC 1YUDA 3NKGA 2VD7A 4DQAA 5LBEA 4CDXB 1ZA7A 1ND3B 1UYYA 3RNSA 4C1WA 3JCIA 4DOUA 4IV1B 1PK6B 5BXXA 3ZN4A 4IEVA 1AR92 2YC0A 1DQ2A 4FPGA 5CIRA 4E8DA 2VMGA 5J98B 4P14A 3O1TA 1QH6A 1MR5A 1XNBA 4DIQA 2XMLA 3ZIXA 4QQOA 1QJX2 3I3DA 1D2QA 1LCLA 1NCRA 5FPVA 5CG9A 4UFHA 1VBE2 4UF0B 3AZVA 1PIV1 4OHXA 3OGRA 4JV4A 1KEXA 4XXPA 3PTYA 4XF0A 1E5HA 3UESA 4I30A 4C0BA 3OOXA 2WIIB 2DURA 2BBVA 2YXSA 1OC1A 2DBIA 4XIOA 2UU8A 1FT9A 2RV9A 3HBKA 1JYCA 4QKDA 4I0BA 4XDQA 1XU2A 3ETQA 2YC2A 3MIBA 5L7OC 5ISLA 1K5JA 5DG2A 3I3BA 4CPBD 3WP3A 1DQ6A 2QQUA 1AR61 1A3KA 1CAXB 1HN1A 1J84A 1NCQA 2I74A 2VBBA 4MGQA 2FZ1A 5FPAA 4CUAA 2ZKNA 1NA1B 1PO22 3LCPA 3MF9A 4JGYC 4OYUA 4HK8A 4Q4X2 2A6XA 5D8AB 3FHQA 2LS6A 4CDQC 1C5IA 1OLMA 4Q8KA 4NHLA 4LIVA 4D7YA 3DKQA 2Y6KA 4E2QA 5A3NA 1H2MA 3CQOA 3FZ3A 5FMBA 5FZHA 1QQP2 1QXPA 1XSRA 1YFUA 1G6NA 3LEMA 1N47A 2ZZJA 4Y4RA 5L7OA 1OQ1A 1EYBA 4Z07A 2WLPA 2WO3A 1NY71 3WF1A 4MUVA 5A33A 1VBA2 2EXJA 4BA6A 1VBC1 4CCMA 4EV0A 4JGYA 3GJAA 4DPNA 1LOAA 2BDRA 3VDDB 3VN4A 2WFPA 5CG8A 5K0UC 4FAGA 3B9CA 4CDQA 1W6QA 5ANQA 2FDIA 4NR1A 1PVC3 4XJ8A 3A23A 3USUA 2CY6A 3GXUA 1CPMA 2OQ6A 3VDCA 2A5ZA 5BNOB 5FPXA 5LRSA 4Q4Y1 3ZN6A 3AKSA 4R9BA 2WDBA 2WO1A 2O14A 4UFKA 4XE9A 5DZFA 4QB6A 3U78A 2P37A 3ZX7A 5C3RA 5C8CB 4Q4W1 3H8RA 3H8UA 1PGW2 2VW1A 2Q8OA 1DF0A 1W99A 5HCAA 2IZWA 4NRPA 3H0OA 3Q8CA 1GNYA 1PO13 1WW4A 4HPKA 3JBG3 2P3KA 4CEWC 1H0BA 4QDQA 4P9IA 1BBT2 4NAOA 2VG9A 4YW7A 3TEXA 4BHPA 2KA3A 2Z2SB 3E6BA 4COWA 3LPGA 2AH2A 2JE8A 3GHNA 2WS93 4QT6A 1BJQA 3LA3A 5CKMA 5I0DA 4LBQB 4QXCA 4KL1A 1PMJX 4MYEA 5FMOL 2WQZC 4NRMA 4FPYA 3GZTB 4DXRA 3D82A 3ECQA 5AVPA 5I93A 4XF4A 4WBBA 2PHRA 1LOCA 1XE7A 2XJQA 3N9QA 4ZU4A 4JC1A 3TEWA 5B4NA 1FOD3 1VMFA 5ERLA 4YWAA 2UURA 3G7DA 2BVVA 4IXLA 4CEWA 5FZ8A 2E7QA 3ES4A 5E89A 3RZMA 4GMP0 2JDUA 1KDKA 4E2SA 1F2NA 1SPPA 3WV6A 1QXRA 2WWJA 5I0SA 3RWKX 1AX2A 1V9U2 2CHHA 3NO8A 3RJ2X 3O0XA 4Q0VA 4XJAA 3ZDVA 3SH3A 4CEYB 4M4RA 1HB3A 1DP0A 1J3RA 1EP0A 1XRUA 2PAEA 2HBUA 3N7LA 2LALA 1XNCA 2QKDA 2V5DA 1D4M2 4FP2A 1A8DA 3VZJA 1ZRRA 2P17A 2PAKA 4IERA 4JZRA 4RHV1 4LT5A 2Z5WA 2YV8A 5A3UA 5A7NA 3GJBA 3PL0A 1W2AX 3AMNA 4C0HA 2D7FA 3DECA 4O9EA 4D0QA 2A7AA 3VUOA 1WUVA 4D3WA 5C3PA 3KCYA 2FQPA 5DAXA 1S0CA 2BEOA 2YUEA 4MO3M 4YGEA 3ZPYA 4IQPA 3JBG2 1I5ZA 2RS31 4FCAA 4LO8A 2ZAHA 2PXJA 4DNYA 2VZVA 1FX5A 3TN92 4ZONA 2WS92 4Y5TA 2DBNA 2FD8A 2ZGOA 1Q8OA 3ASIA 1OURA 1AR81 4AVAA 5CZKA 3UKNA 1W8TA 1CX1A 4UWDA 3RZHA 2XBO3 4Q8LA 1O4TA 3H3ZA 2ZHMA 4L2NA 1SMVA 4FFGA 2ZKLA 1V70A 4KU7A 4D6QA 1S2BA 1FOD2 3VBSA 1OA2A 3PVNA 2OKXA 3K2OA 3MIDA 1BLZA 4HLTA 1W6NA 3M4FA 2ZMKA 4RYDA 4LBLA 3MEPA 3PMEA 4CYDA 2RJ2A 4YYOA 4DXTA 3UNPA 4C91A 4QHBA 3NWKA 4LK6A 1VRH1 4XVHA 3K75B 3RMXA 2RS13 3ZN5A 2WAOA 4ATEA 3PUAA 5M0TA 2ET7A 4FPEA 1RUD1 3OBZA 3KV9A 4JHZA 5BV6A 3WQBA 3VGIA 3DEMA 4V1PA 5L9VA 4O9GA 1CAWA 4OZOA 1QOSA 3LA2A 1POV3 5IK7A 1EV13 2DVGA 4CP0A 4YVSB 1UU6A 5K8SA 5IHRA 1BXHA 4FFIA 4WVWA 2YG0A 3U0ZA 1LNSA 5GALA 1SDWA 5T50A 2R073 2IFRA 3OB8A 1RVF2 5DDJ1 3MV11 3VBRC 4XETA 1MVQA 3J7LA 5C7GA 3S5QA 5FREA 4BXSV 2VZ3A 3N4MA 4WV8A 1W8HA 3T2QA 1JYXA 4AGGA 3OY8A 3WUCA 1OQDA 2J1VA 3ZFGC 4CDWB 4QPIC 1ZBA3 4CUGA 1AJKA 1DQ4A 4LOSA 2JG9C 5I0TA 3OYWA 4PHZA 3IAPA 4J1WA 5A7SA 2L9LA 4XABA 5FBJA 1R081 2Y6JA 1BK0A 3T0BA 1CAUB 2HYXA 5EQUA 2GALA 5GZDA 5FZLA 2W47A 3BYWA 5JXHA 2XVLA 4ASMB 4DUVA 1LGNA 1AX0A 3NNGA 4YVWA 2E32A 4NPMA 1Y43B 4AQSA 2HKXA 3VBRA 3PTRB 3MHZA 2BV4A 1XOYA 2KM2A 5FYZA 3HT1A 1JZ5A 4ZU7A 2W9XA 3JZVA 3KLSA 3KQRA 2MEV1 3ZFGA 4ASKA 2VOKA 2QQLA 2WT2A 3ZXKA 1ULCA 4Q4V1 1CZSA 1QJEA 4QB2A 3O1SA 2GMEA 3W5NA 4L99A 5IUQA 1MEC3 3ACFA 3DYPA 3VBOB 3FC0A 4AXOA 1QDCA 4YSFA 1RHI2 3VBUB 2R0FA 5FUPA 3IZOA 4RFRB 4L11A 3FX3A 1N3OA 4YG6A 4YM0A 5LA2A 1HXS2 5DZEA 3W20A 3CJIC 3RZKA 1NT0A 1BYHA 4WM8B 4EN8B 4Y5SA 4AEDC 2C5DA 1UOFA 2IXCA 5I8YA 2RS52 1NKGA 2WRAA 3ZXFA 2WUHA 3PLQA 5L9RA 4BQ3A 3IWZA 1G86A 1LR5A 2AUYA 2OUHA 2DV9A 2W52A 3MIHA 4YW2A 3SITA 3GBFA 1OPOA 2R072 1O59A 3MBWA 1VBB3 3T2TA 3UGFA 1CONA 5JDBA 4AQ6A 1CAVA 4FQZA 3K48A 2UWAA 5A7WB 1O3QA 1WMFA 3KCCA 3DYOA 5FCCA 4A2UA 2YDEA 3AB0A 1LOBA 1QKQA 1YFXA 2PHUA 2RMU1 2SBAA 2XDVA 3IN9A 1T6BX 3KV6A 4RR3B 3WDXA 1WMXA 5C3OA 3URFA 5FO8B 3O1VA 2J1UA 3C7FA 4S2HA 4JX0A 1GLHA 5FZ9A 2WZPP 3ZVXA 3E5QA 4XMAA 3VBHC 4AEDA 1QXJA 3AP7A 2TUNA 5FZAA 1Y4WA 3HWJA 1XPWA 2VJXA 4DMIA 3ZYIB 4GULA 3KHBA 5DAVA 2OZJA 1PMIA 3WDVA 3JXSA 4UW5A 3MW2A 3HQUA 3RI9A 3N9LA 5JXGA 4UW4A 2F4PA 3NJYA 4M0NA 4P00B 2WT0A 2WJSA 3BTXA 3SH5A 4IESA 2A70A 1OA3A 1O4ZA 1BKZA 3RGBA 5FKCA 4DFSA 4XFAA 3WUDA 1MEC2 4ISQA 2VMDA 2HWB1 4FPJA 3B69A 3J7NA 3HQRA 3Q8FA 5IFPA 3T09A 1HV0A 3VBHA 5HI0A 5CISA 1UY2A 3EJKA 3BODA 1COV1 3CKHA 2BBAA 1V0AA 3FE5A 2ARCA 4Y33A 4BDVB 4LOTA 3ZSLA 4NHKA 5LY2A 4U2AA 3KGZA 5FWJA 2R043 2A1XA 5IWFA 3RZJA 3IBMA 4EN9B 1FNZA 3IDEA 1OF3A 5BNNC 2VVEA 3IIAA 4CCCA 2ZGTA 3LB9A 4P02B 2XJSA 1APNA 4XILA 4URTA 1VLNA 2HEYF 5FYCA 1CWPA 3LZZA 1K12A 4XUTA 3T4VA 4COVA 1VBB2 1NX9A 3K77A 2BZDA 4N7IA 2VECA 3UL2A 2B39A 3AX4A 1HRV1 3JD72 4K40A 5C4WC 2W68A 4LPLA 2YBPA 2HWE2 4K8FA 3PDQA 5TSWA 3UK9A 4YM2A 4K20A 5A6ZA 1UU5A 2D6OX 3K3OA 1REEA 1BEV1 1JZ7A 4MV2A 2CSGA 1I3HA 1GZWA 4ZU5A 4FVVA 3SLIA 2Z42A 3PVEA 1QMJA 2FCVA 1W2UA 2DTYA 4E8CA 1SCSA 1LJ7A 4M3CA 1KJRA 2BOJA 2PLV3 4MVTA 3ZSKA 3H3LA 3POWA 1RUH3 2R063 1CESA 3GM8A 3MFAA 5IT6A 2R7EB 1GNZA 1UPSA 4L9BA 3USSA 2YPDA 2NMNA 2XUMA 2CTVA 2VQUA 4TLGA 1IG0A 3CBNA 1WLTA 4BCUA 1R093 4Y20B 5CFCA 2C6SA 5DQ0A 3VHOA 2A3WA 1R1A2 2GSYA 2F6BA 5DAWA 4YZ3A 3BIEA 5KR7A 4LA3A 2WC2A 1UX7A 1NCQB 1N3PA 1J59A 4N9HA 4CCEA 3AYCA 3CU7A 2R042 2IWGB 4LORA 1JOPA 3HD8B 3HPNA 1TNFA 3P6BA 3I8TA 5E6HA 1OQEA 4E4ZA 1DCSA 2BP6A 2IC1A 5CVRA 2QQIA 4Y4YA 1LGCA 2VMHA 2ZAAA 4XFCA 5GLVA 3RZGA 4SLIA 2X29A 2VZSA 2P3JA 3PU8A 5FZ1A 1WA4A 1U12A 3WDUA 4YGDA 5DAQA 2I07B 5HCBA 2YMZA 4M4PA 3DKWA 1RUC1 1RMU1 1B35B 4D69A 1FPN3 4H7LA 3OGGA 1JZ2A 4IEPA 3M8LA 3EBRA 5IFTA 2BERA 5A33B 1HKDA 4LLFA 3VB9A 3W9AA 1TMF3 2O8QA 4IE7A 5JZGC 1FI2A 4JGYB 2JICA 3OPZA 3T08A 4AVTA 4MG2A 3I2DA 5T3NA 3ZFFC 4CCLA 4OULA 3MICA 5H9PA 1R64A 4Y1XA 5JVVA 4QX1A 3USUB 4E4HA 3BTYA 1GKBA 1RUI1 2X53S 2XPJA 2X5IB 1RUH2 1JOBA 2J7MA 2W1QA 3WXPA 1CGPA 1J3PA 5IVYA 3WDWA 3J8F3 1KS5A 4IEWA 1EAH3 2RVAA 2DDUA 2VOVA 3N9OA 4LE3A 4XBQA 1FMD2 1R092 2AACA 2BVBA 2W46A 1J58A 3JB8A 3WNNA 4FTBA 1XNTA 4AOCA 2ARBA 3LDBA 4AI0A 2GNDA 1JTZX 4HPKB 4Q2FA 4AZZA 3ZFFA 5CFDC 3WHTA 2EXKA 2BWCA 3DF0A 4YW3A 4YM3A 1RUJ3 1UZWA 4Y22A 4R4ZA 5LBFA 2RDSA 2D6LX 4XDPA 3ZLIA 3ZYPA 3D0SA 1LAJA 2WNVC 2QCSB 4XCBA 1G9FA 1WW5A 3WW4A 1YXWA 3PIJA 2CGNA 2MNGA 4LTAA 3PURA 4HSJA 4QPGA 4NHMA 1AXKA 1OOPC 2B5HA 4HZFA 1JZ3A 2NN8A 2C1FA 1H4HA 1OLQA 2ZBJA 2WA3A 3DUIA 5DZGA 5LK5A 1FPN2 4HFSA 3I4IA 3KB5A 4RQPB 2A71A 2C24A 2ZHNA 5HBAA 3SMHA 4AG4A 5LY1A 4I01A 5FZCA 4B7KA 2I2SA 4TN7A 5FO7B 5CFDA 2YPJA 3KWVA 2ORZA 3SEEA 3DV8A 5FMOS 3LEIA 2XR4A 2IXJA 1VAKA 1C4RA 4FPHA 1B09A 1UO9A 2V72A 4BQYA 1RUE1 4Q1RA 4IETA 1QEXA 2VTXJ 2DVFA 3BCWA 5FYYA 2NP0A 1I9RA 2D6KA 2QTWB 3GF6A 5KHGA 1JYVA 4CUCA 3H50A 2D6MA 1RUG3
chains in the Genus database with same CATH topology
4WM7C 2OUJA 1Z7S3 3A4UA 4UW6A 1U5YA 1O5LA 2ZGRA 4P5HA 1CN1A 4YGCA 4YRDA 5J09A 3ZXJA 1SLTA 2CGOA 2Z69A 2VULA 5ABJB 1H1IA 1QJY1 3V0AA 5LEKA 3GYDA 5JR7B 1S1AA 1NLSA 1XYOA 3AYEA 1YFWA 4OHYA 2PTMA 4WM7A 2NPIA 1S0FA 3VKOA 1A8MA 3RS6A 1REDA 1SBDA 1W6OB 2A6VA 2BYVE 1DQ0A 3VBSB 5KBFA 3H7JA 3MPBA 2D3PA 4ONUA 1AR73 2W0XA 1W6NB 3AZXA 1IS3A 1PIV2 1RUF1 4BIOA 3IKWA 5E88A 4WVZA 2WFF3 1OA4A 1DBNA 1A78A 1YCIA 2LM3A 1DZQA 4N7UA 4LO4B 5FAXA 3VLBB 1AJOA 3ZXLA 4FTEA 5EJ3A 3HN1A 2CV6A 4GB31 1GNHA 1N1TA 1ALYA 1ULGA 2Q1ZB 2H0BA 5C33A 1AR62 1CAWB 3VKLA 1J1TA 2VVFA 3WHUA 3IM0A 5F6KA 4A7YA 3ZIWA 2OA2A 2Q0AA 5T55A 3OTFA 3OD4A 3WQ0A 3O0WA 1UU4A 1XU1A 1PZ9A 4GWNA 1QJX3 2VVDA 3EQEA 4HN0A 4QQHA 5FRAA 3H1MA 1VBE3 5GLWA 3OY8B 1Q3EA 1F8VA 1QNYA 2ET1A 5H9QA 1NY72 3QBQA 1G8WA 4LR4A 1FV3A 3AMMA 1LHUA 1VBC2 1QJZA 2G4IA 2UYAA 2G9GA 1S0GA 4HETA 1M06G 3WW1A 1SEFA 2JJ6A 3J9SA 1PO23 1AYN1 1WLCA 1WMEA 4MH0E 4YVWB 5SV5A 2JE9A 2VOWA 3I59A 4Q4X3 3WG1A 3CNAA 4Q4Y2 1BZWA 1QOTA 3O14A 5DUVA 1N3QA 1TME1 4LBJA 1ASJ3 1X50A 2RM21 1QQP3 4OI4A 1OPMA 1CJDA 5DUXA 1V6OA 1IKPA 2XHKA 2RR11 3WG4A 4AYUA 4LBNA 2N7GA 1HRI1 1VBA3 3VBFC 4JGZC 1Q43A 1NYWA 3RI8A 4E9KA 2CAVA 4GIQA 3TAYA 4IV3A 3ZXAC 1K5MB 3MLJA 4XFIA 1H8TA 4B4QA 5JWPA 4FPFA 4BM8A 3FLRA 4OUMA 4AFDA 3KT4A 4I02A 4XJUA 1H2LA 1AYM1 1AF9A 4QU2A 3GZAA 3ZFEA 2KXLA 3N36A 4JGZA 3VBFA 1C28A 1HW5A 4X8PA 4HN1A 3BALA 2VNGA 1O3RA 3M3OA 4XFGA 2R32A 4HSLA 1NZCA 1BBT3 1MS8A 4PIYA 1MZ6A 1QJU1 2K9ZA 3AFKA 4JRAA 3OD0A 1PGL1 4A3XA 2ETEA 2JX9A 4MGYE 4P9XA 4AK3A 3INAA 4Q0UA 4RHV2 3VL8A 2IFWA 1ASJ2 3KD4A 5CB7A 3N7JA 4OHWA 3CEWA 1YIPA 3Q9OA 4D94A 4XFFA 3MW4A 4E4SA 5GZCA 2D6NA 4Z1VA 3JUUA 2RS32 4AW7A 3E6CC 2XJRA 1QHDA 2WZR1 2OPKA 4QM8A 5T54A 1VIWB 1V9U3 3I54A 2VUJA 4N53B 3U10A 2XVKA 4KU8A 1JUHA 1WW6A 4R9AA 1ZVFA 4ZXKA 3BIWE 1D4M3 1LRHA 4XHXA 2BNNA 4LBMA 2LTNA 4L92A 4HKWA 2JG8C 1MQTC 1VAVA 4IEXA 2K0GA 4I2OA 3NV3A 1XYPA 1RIRA 3PMSA 2R49A 5K0UA 5DG1A 1JXNA 2CGPA 4META 1RUD2 3TN93 1DYKA 3FMGA 5JSPA 3MIEA 1C8M1 1HQWA 3J4UH 1UZYA 4DINB 1AL0G 1AL21 4DRRA 2ZHLA 3VHRA 2HWD1 1MQTA 3GALA 2PA7A 5CFCB 4QD2A 4AI2A 3VV1A 5JCTA 1ZBE1 3AFGA 4H7MA 3JQWA 3SHRA 5DDJ2 2TEPA 4GH4B 1UW8A 4YM1A 4OHVA 2JDZA 1W6MA 5JI9A 3ZO0B 2VQAA 3B9IA 4BLIA 1Y9QA 3RRDA 4QMAA 3OCPA 3KCXA 4LO5B 2ARXA 1R082 2OVUA 2Z79A 4NWVA 1WMDA 4AVBA 2WQ4A 4WZFA 2H0VA 4AHWA 1J1LA 2HWC1 1UD1A 4EJRA 3IDCB 2C9AA 2QDNA 5A3MA 1ZZCA 4Q26A 4RS5C 2HYKA 1UKGA 4TLFA 5C9AB 1Z0HA 2MEV2 1RVF3 2EXHA 1VJ2A 2TNFA 3HAGA 4NOTA 5AC91 2HWF3 5KC6A 1W6PA 2X8KA 4P9WA 1GZCA 1S0DA 3IPVA 3LAGA 3RSJA 1AUYA 4LBOA 4JTNA 2GU9A 4XHBA 3PJYA 3LOBA 2XJPA 1ND2C 2PN5A 3QH7A 3ST7A 4Q0PA 1QU0A 5T5OA 2XJVA 3B00A 1ENRA 4LBQD 2LUWA 2TBVA 3NAPC 1GZ9A 1RGSA 2PHDA 3QCWA 4N43C 2R1DA 1WBFA 4Y22B 2RMU2 4PLOA 3KZ4C 3WP5A 3NV1A 1RHI3 4RGAA 2RJLA 2WSUA 1BMV1 1Y7BA 3HR9A 2NYYA 1H9WA 4QPGB 1ND2A 1HXS3 1OHFA 2FMDA 1HQNA 3R05A 3SCGA 3RYPA 1LOGA 4AQ2A 1RUNA 2UYBA 4I0AA 3ZSMA 1H2KA 4R4XA 5FBZA 5C8WA 2NLRA 4XQWA 2WNUB 2RS53 3NAPA 3WG2A 1URXA 1ENSA 2ZS6B 2GC2A 3AMQA 4G4FA 1TE1B 4N43A 4EWEA 4W6XA 3FWEA 4JDMA 4K1ZA 2HWF2 2QVSB 2HWB2 2EF6A 3DL3A 3SH4A 4R9CA 1COV2 4Y1YA 4COZA 2FZ2A 4TYSA 2VW0A 1JN2P 4XW3A 4C90A 4S2FA 2D3SA 2HEVF 5BNPB 2B42B 2ZGKA 2ENRA 1VBD1 1ZX5A 4P9YA 4FP3A 1ZZ8A 3E5XA 4NPRA 4XOGA 5J3UA 2ZACA 3KMHA 3MLKA 1EY2A 1XNKA 4E4DX 4BH9A 2E63A 3LWCA 1HRV2 2VPVA 4QPIA 3PVBB 2JG9A 2AENA 5I0UA 1PVC1 3NKTA 3V0AB 3E97A 2DTWA 2D43A 4JRLA 3M1HA 1HQLA 4HBNA 1BEV2 2DFBA 4CDXC 1ND3C 2E7TA 1DZRA 3LA7A 4IV1C 1PK6C 1UL9A 4LLOA 1H4GA 1IS5A 2GH8A 2EALA 3H1YA 4KWJA 1WW7A 2PFWA 4Q0QA 4XFHA 4Z82A 2JKBA 5JIUA 1VB2A 1WLDA 1LU2A 1ZRDA 1X33A 1NE6A 4P9LA 1PO11 3KT7A 3JBG1 2EVXA 4QQ2A 5L19A 1MS5A 2D3RA 5FQ0A 5JLVA 1YWKA 4TZDA 3JD73 1GICA 3FBMA 4AEKA 1O5UA 2HWE3 2D98A 2VW2A 4PIXA 3WP6A 4CDXA 1LESA 3VZLA 4IV1A 2QDRA 4FXKB 3CJIA 3LGRA 4ISRA 5C6CA 1CJPA 3HQXA 4I3GA 4XTPA 1CIWA 2BW8A 5J7MA 1FOD1 3TWIA 1HLCA 5D8AC 1Y3TA 5EV7A 4MXVA 5BNQA 2H6BA 4XQDA 3M7AA 2ZCWA 1DQ1A 1YO8A 1RMU2 2D93A 3AZYA 3UKTA 1XQNA 4XF3A 2BTVC 2DYCA 2O1QA 2A3YA 1SLBA 4BQ1A 5CA6A 3VHNA 2UY9A 5J96B 2ZX2A 1UIJA 1WD3A 4WVMB 1G9BA 1CAXA 1R1A3 4X6RB 1GSLA 4CDUB 3VKNA 5JOZA 4AFCA 5IK4A 3VDDC 1O3SA 1SACA 3MIGA 1RUE3 4ES8A 1ULFA 1ZRFA 1AZDA 1RUI2 5BNOC 2H6CA 2GN3A 4H3WA 3U11A 3AYDA 2K2SA 3DPRB 3POSA 2R6QA 4BLJA 3B5LB 4I0WB 4DZGA 5C8CC 3VL9A 5FO9B 2R1BA 3ILNA 1QF3A 2A73B 3TOJA 4MZUA 1LOFC 1XYNA 4R8HA 2XBO1 2QQPA 1KQRA 3HMYA 1S0BA 3RYKA 3WQ1A 4GMP3 3ZYRA 4ATFA 4IV3B 3THTA 5BNNA 4Y1UA 2EIGA 4YFZA 1AXZA 3WCRA 1C1LA 1H8TB 3RYRA 3ES1A 1NCRB 2DVAA 4D7TA 5C8CA 1DG6A 5C4WA 3V65A 2RS11 1ZRCA 2CWSA 3ZFEB 4INDA 1LOFA 1FMD3 4DRVA 2GNBA 2AZ5A 5SV8A 4GA9A 4LHNA 4JTOA 1POV1 3AXEA 1FV2A 2XJTA 1EV11 5FLIA 1RJ7A 3AMHA 4LBQA 2PHWA 3V0BA 1UPIA 1RUE2 1DDLA 4CEYC 4XPVA 1GV9A 2DCYA 2V09A 1DFQA 4PBPA 3H7YA 4MSVA 4D7SA 4Q27A 1RINA 4JAAA 1KITA 1IKQA 1NLRA 4CP2A 1ZBA1 2D44A 1N1SA 1KFUL 5L7OB 1GQGA 1PZ7A 3WNXA 4AQTA 4ASLA 2B8MA 2ZGNA 4X8NA 5J37A 3K51A 4R52A 1YYNA 4MXWA 4TSVA 4H14A 2BFUS 1PVXA 4XXAA 3W58A 2GN7A 1SQ4A 4S2GA 1BK1A 1QJY2 4XBNA 3D6EA 4CDQB 1W6QB 2A6YA 4HMZA 1WBLA 2IXHA 2BPA2 4CRQA 3U4XA 4KWLA 3RDIA 1AVBA 1D4VB 2DFCA 1LHOA 2NMOA 2UWBA 4QGNA 3ZN6B 2P34A 3C3VA 4K7JA 1UN1A 4YZ5A 4YFWA 1AYN3 1VR3A 1SLLA 2ZGUA 4XZPA 4AFAA 4HVRA 4IEQA 4IEZA 1UX6A 5JZGA 5KXEA 4EWAA 2SLIA 5ACA3 1RUF2 3JQXA 1X8EA 1OLRA 5K0UB 3DGTA 4YG0A 2XL7A 2HEWF 2A6ZA 4LO6B 2VXRA 2CWMA 4GB32 5JSOA 1RUOA 2IXLA 1SLAA 5F1RA 4MLOA 1VALA 4K21A 2Y0IA 1YJLA 2Q4SA 1MQTB 1Q8PA 3AK0A 4YVSC 3LKJA 1NXD1 3N35A 1PM7A 2YYOA 1QDOA 4CEWB 1R1ZA 3PJQA 4LO7A 4W65A 1PIV3 1ULEA 2QUOA 4CTEA 5BYNA 1W6MB 3GBWA 1D0GA 1AYM3 2A6WA 1IQAA 3MF6A 4PLMA 3IMNA 1OMIA 5EFUA 3ZXDA 4CDWC 5JMCA 2WNVA 2ZHKA 3VZOA 4PDWC 4I3PA 3ROUA 3BOPA 1AR63 1OOPA 1D0HA 4QGMA 2GNTA 1N1YA 1Q56A 3L2HA 2ZX3A 1AYN2 1QJU3 2YHJA 3D4KA 1OFNA 3J26N 3AZZA 3WT3A 5ACA2 2W39A 2PAMA 3NW4A 4WZCA 1TME2 4AVSA 3B3QE 2IXIA 2RM22 3BOWA 4CDWA 1CVNA 3M3QA 2RR12 4PDWA 4NVPA 1W6PB 3MYXA 1HRI2 1Q8QA 1DGWA 4L8QA 4FOVA 3VBOC 1VBC3 3NL1A 1CAUA 3VBUC 3O7OA 1V6KA 1LEMA 3N7MA 4BZ4A 4WM8C 2XH6A 3ALQA 3RJRA 3RG0A 1CPNA 3CF6E 2OIIA 3A0KA 2DU1A 2Q1MA 4Q4Y3 1WCDJ 1BCXA 3D5OA 2D5HA 3KM5A 4OVEA 4BMBA 1YIFA 4LUKA 4Q4W3 1H2NA 1AYM2 3JU9A 3VZNA 1WGPA 2PHXA 3MPPG 4JCKA 1DU3D 4IEOA 5J48A 3VBUA 4RR3C 3EHKA 2PLV1 3TB0A 1G9DA 2D40A 1Q8VA 1ZZBA 2R061 5B2GB 4XF9A 4WM8A 2W08A 1V6IA 5GLUA 4M01A 1V6JA 3QOPA 3EXUA 1QJU2 3WY6A 1SLIA 5HCFA 1UKRA 1PGL2 4PLNA 4YGBA 4YW4A 1VAMA 3MZHA 4KG8A 1A6CA 5CADA 2QZ3A 2ATFA 2ZGQA 3PVOA 1RC6A 4Y24A 1Q8SA 3AP6A 1S0JA 3U07A 2A75A 1IPJA 2PHFA 3OYWB 4BMEA 4GKYA 3MI8A 3NJZA 4YZ4A 5I0RA 3CJXA 1FPN1 5I8SA 1LEDA 2BNMA 2D5FA 3SNMA 4XEZA 3AP4A 3BPZA 4HANA 4AGRA 3VZMA 3VBRB 5EYYA 1TMF1 2ZA9A 1I1EA 5K9YA 3H3UA 2VMIA 1C57A 4RHV3 3ZFGB 4Q4W2 4QPIB 3X29B 4XJ9A 2JG9B 5BY5A 3TRSB 3H1WA 4LUMA 5KXBA 1POV0 1W0OA 4YZ1A 1XXNA 2RS33 2ZMLA 3J8F1 5AC93 2AREA 2ZGPA 1EAH1 1FAYA 1C8M2 1UCXA 1X36A 3MGUA 1H9PA 3O0VA 3AYAA 2DCKA 3PHMA 3M3IA 1AR83 3BTAA 2OYZA 1O3TA 4A7ZA 2PHLA 1PNFA 2XJUA 5LEJA 3QH6A 2VGDA 1AL22 3HT2A 1NQJA 1CAVB 2HWD2 2E9QA 2QFEA 5FQ0B 3NVCA 4YARA 1RUJ1 1ZBE2 3TNQA 2QE3A 3SCHA 1BVP1 3AMPA 4N90A 1YI7A 3IT8A 2B7YA 2E51A 3RPQA 3VHPA 1GYKA 3CJIB 2P3IA 4S2DA 3R4DB 1PGSA 2B9UA 1VP6A 4AEDB 1NCQC 3VZKA 3MW3A 1VRH3 4OI0A 3A0NA 3CLPA 1RB8G 1RUD3 1FATA 4JQRA 5GLTA 4MX3A 4E27A 4FXGB 2XKPA 2UWCA 2EA7A 3NSTA 4OLLA 4TWTA 1V00A 4FQ4A 1WD4A 2BFUL 4FOYA 3S30A 1LB2A 2HWC2 4Y20A 5LRRA 4PF5A 1B35C 1OI6A 3ZYGA 3M3CA 5IK8A 1SBEA 4ZKTB 3VBHB 5DDJ3 3ACLA 3OGJA 3ILRA 1RUG1 3WD5A 5AC92 5KHJA 1Z7S1 3GBGA 1FXZA 3KS7A 5I8TA 1ZZ9A 2GH2A 1DZTA 1AR82 2DWRA 1NE4A 3ELNA 3LOIA 3S7EA 5CNAA 5K7PA 1R083 2CYFA 1C5HA 2X5IC 4M3CF 4K9SA 4JDNA 4OI2A 1VBD3 5KHIA 1B35A 1N1VA 3B93A 1D2SA 1KFXL 3FHIB 1AX1A 1DGWX 1S55A 2GC3A 1UIKA 5FFOC 2FBEA 4QPYA 2R30A 4QXKA 2MEV3 2XVGA 1QNWA 2DCJA 1GZWB 1VRH2 4Q4V3 3OF1A 5BNNB 3WVJA 2MPFA 5FPZA 2ZX1A 4M3CB 4HL0A 3UV9A 2X5IA 1AR71 5JOYA 1BMV2 3FBYA 1SFNA 3C2UA 1NQDA 1GBGA 4P9GA 5C4WB 2WFF1 1H1AA 2JG8A 2D97A 5IK5A 2ZABA 3ATGA 2VY0A 5T52A 2BUKA 4YW1A 4RQPC 2ZOEB 2I45A 4LULA 5DXDA 2WWSA 3FFQA 5DUUA 4XIKA 4Y1ZA 1PNGA 1E57A 4KWKA 1G9AA 3POYA 3WCSA 1LHNA 2PQQA 3HBZA 1AR91 4AVCA 4KGGA 3S0MA 1OSGA 4XJZA 3V0BB 1LHVA 2RMU3 4FOWA 4A7KA 1UAIA 3AKPA 4LA2A 1JBCA 1TNRA 1ZZ6A 2DUQA 1QJX1 4EROA 5JPMB 3B02A 4FOQA 3ZDSA 3AZWA 1JUIA 1VBE1 1KD7A 4B7EA 1HIXA 1VBD2 3VKMA 3WOGA 4KH9A 1DHKB 3B01A 2JD4A 4RQPA 1LTEA 2PYTA 2PHTA 1X82A 3KT1A 1YLLA 2AYHA 4R9DA 2GDFA 3SXWA 4BIFA 4QQPA 5GKAC 3N7KA 4Z8BA 3QD6A 4MXWB 4QX5A 5JSRA 3ZSJA 4FAHA 4Q4V2 1PO21 1NXMA 1PVC2 5ABJC 4RD7A 4Q4X1 2HWB3 3L9JT 2FHRA 4M3CE 1KRIA 1SLCA 2EAAA 1COV3 2QJVA 5H9RA 4Y26A 1ASJ1 2PELA 1QQP1 5CAZA 2OW4A 1IOAA 1U5XA 4RGGA 1U5IA 3M3EA 4RS5A 3VBSC 1GQHA 1PO12 5JZGB 1VBA1 2V5YA 5F9TA 3HIFA 2WNEA 4B4PA 5FTTC 5ABJA 3ZFFB 1HRV3 2IXKA 3I7DA 2QNKA 1QWRA 2ZGMA 1IZ3A 3AJZA 1BVVA 1L3JA 1BEV3 1MVEA 4YW5A 4HK9A 4LBKA 4F8AA 4FPLA 1W6OA 4AEJA 5KWRA 3QACA 1O91A 1PGW1 1F5FA 3KSCA 3V64A 1GANA 1ZREA 1IHMA 2NZ9A 3G6JB 1MACA 2ZGSA 3MFCA 5A32A 2VUAA 5CFDB 1DGRN 1U0AA 4AHYA 1F31A 2NQYA 1BBT1 1MZ5A 4FSJA 1XNDA 4W6WA 2VNRA 1UZZA 4PBOA 4M00A 2B45X 4WVVA 2WINB 2WNVB 4G9SB 3WDYA 2GMMA 1ZZ7A 2ZJCA 4I09A 3FLTA 1CD3G 1IGOA 5JAXA 1OOPB 1XE8A 5AVAA 2XG3A 5JI7A 1PHMA 1OFSA 4MGZE 4YG3A 2BGCA 2WKKA 1YFYA 2WL1A 4YVWC 5J36A 1MZFA 4PQ9A 1DYPA 1HV1A 4QGLA 2BQPA 1GFF2 1V6MA 1DIWA 3N3HA 1RUC3 4YNIA 5DUWA 1RMU3 4Z2WA 4PDWB 3UJOA 1V9U1 2O8OA 5EZWA 3OJBA 2FMYA 3MLLA 1U5ZA 1NG0A 4OFGA 4X6QB 1HX6A 4YLZA 1KJLA 5GZFA 4FTSA 4GQ7A 2RHPA 2XBO2 4RFT0 3S6PA 4WM7B 2Y38A 3SCFA 1D4M1 2EXIA 4C1XA 4DS0A 2P2KA 1ULDA 3WX5A 3P3PA 4B4RA 1K5MC 5FOBB 2JXAA 4K6BA 2A3XA 1RUI3 4GALA 5T5LA 4NN0A 2VNOA 3OBRA 4AGVA 2ZX4A 1DGRA 3B94A 1C1FA 2RS12 3ENRA 3ZSEA 3ME2A 3R4SA 3PNAA 3TN91 2WS91 2XWJB 4BYYA 3LSEA 1RTVA 1ND3A 1T6GC 1YHFA 3WW3A 1PK6A 5KXDA 2B46X 1EV12 3UKVA 2DUPA 5CBLA 4GKXA 3T1MA 1K5MA 1RJ8A 1NA1C 3AP9A 2AGSA 1ZA4A 1ENQA 3ZMOA 2C0ZA 1LU1A 1FYUA 1RUC2 1ZBA2 1VB4A 2YY1A 2UY8A 1RITA 4K3UA 1JHNA 2DUOA 2Q5TA 4XTMA 4AHZA 3TYJA 5GZGA 1CQ9A 1SBFA 2JECA 4UW3A 4M0HA 4AE2A 3CO2A 1LENA 4JDOA 1MS1A 2G9FA 5E8AA 1JW6A 2VOXA 1NA1A 1O4YA 5D8AA 4AHXA 5T5PA 3I59B 4N53C 5JOXA 2JEMA 2ZZQA 1LOEA 4H55A 1YRZA 3WW2A 1RVF1 5EWSA 5GJ6A 4XBLA 2DCZA 3AKRA 4P9JA 4HKOA 3WINE 1ENXA 5AFBA 2HWF1 2XB6C 3UJQA 1C8NA 2GC0A 4KGQA 4BWOA 1WCKA 4RSUA 2RE9A 3EO6A 3KGLA 1QH7A 3MIFA