1EAH1

Pv2l complexed with antiviral agent sch48973
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
272
Chain Sequence
ANNLPDTQSSGPAHSKETPALTAVETGATNPLVPSDTVQTRHVIQKRTRSESTVESFFARGACVAIIEVDNDSKLFSVWKITYKDTVQLRRKLEFFTYSRFDMEFTFVVTSNYTDANNGHALNQVYQIMYIPPGAPIPGKWNDYTWQTSSNPSVFYTYGAPPARISVPYVGIANAYSHFYDGFAKVPLAGQASTEGDSLYGAASLNDFGSLAVRVVNDHNPTKLTSKIRVYMKPKHVRVWCPRPPRAVPYYGPGVDYKDGLAPLPGKGLTTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 2 COAT PROTEINS VP1 TO VP4
publication title Structure of poliovirus type 2 Lansing complexed with antiviral agent SCH48973: comparison of the structural and biological properties of three poliovirus serotypes.
pubmed doi rcsb
source organism Human poliovirus 2
molecule tags Virus
total genus 43
structure length 272
sequence length 278
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1eah100
1NCQC 4CDXC 4N53C 3JBG1 1VAKA 1VBD1 1R1A1 1V9U1 2BPA2 2QQPA 2MEV3 1K5MC 1BEV3 1CD3G 2X5IA 4RHV1 1HRI2 5CFDA 2HWB2 2WZR1 4GB33 3DPRC 2HWF3 1RVF3 1RUD3 5BNOC 1B35B 1QQP1 1F8VA 2RR11 1RUF3 5ACA3 1TME2 1VBC3 2HWE2 4AEDA 1MQTB 1Z7S3 2X5IC 1VRH2 2WS91 4Q4Y1 5CFDC 5L7OB 2HWD2 1HQNA 5CFCB 1MEC3 2R062 1QJU3 1FPN3 1AL23 1VBA1 4JGYC 1PVC1 4CDQB 3VBUA 5D8AB 4IV3C 4JGZB 1EAH3 5C4WC 2XBO3 3TN91 4EJRA 3CJIB 2PLV2 1FMD2 1FOD3 1PGW2 1PIV3 1RHI2 4CDUC 4YVWB 1PO12 1RUJ2 4PDWA 4RR3A 4FTBA 5BNNC 2MEV1 1BMV1 1BEV1 3VDDC 1QJX2 2BFUS 3VBOA 2RS13 4GB31 2HWF1 1RVF1 1RUD1 4YVSB 5JZGA 3VBSB 1ZBE2 1RUF1 5K0UA 5ACA1 5BNPA 2RM22 4Q4W2 1VBC1 4IV1A 1TMF3 4RR3C 1OOPC 1AR72 1Z7S1 1AYM2 1ND3B 1NA1C 3VBOC 4CEYA 1MEC1 2RS53 4N43A 3VBUB 2WWSA 1NCRC 1EV12 1QJU1 4Q4V2 1CJDA 1FPN1 3S6PA 1AL21 1RUI2 2R043 1AR63 1R092 1R083 1VB4A 1AR82 4NWVA 1EAH1 5AC93 2XBO1 4WM8C 1BBT3 1H8TC 4PDWB 4FTSA 1HRV3 4WM7A 1FOD1 1PIV1 5JZGB 2XPJA 1AUYA 5K0UB 1RUE2 1VBD2 5BNPB 3JD72 2RS11 2DF7A 1RUG3 1VBB3 5CFCA 1B35C 3ZFGA 1QQP2 1D4M3 1RMU3 1TMF1 1MQTC 1PO22 3JB8A 3TN93 5GKAC 4CDQA 3NAPC 5D8AA 1VBE2 4RQPA 1DDLA 4JGZA 2RS51 5L7OC 2WS92 5CFCC 4LLFA 1HRI3 4CDWB 2HWB3 3CJIA 2R041 1AR61 1C8M3 1R081 1HXS2 4CDQC 3ZFEA 1TME3 1VBA2 2HWE3 2BFUL 4YVWA 3ZFFB 5AC91 4WM7B 1POV3 1BBT1 3CJIC 1HRV1 4YVSA 1COV2 2HWD3 1ND2A 2R063 3VBSA 5FOJB 5J98B 5C9AA 3ZFGB 1ND3A 1RUG1 4QPGA 5LK7B 4AEDC 4YVSC 1VBB1 3VBSC 4RQPB 2HWF2 1QJY3 2ZAHA 1D4M1 1FMD3 1RMU1 1NCQB 1VBC2 1RHI3 2IZWA 2RS32 1ND3C 1PO13 1RUJ3 2BUKA 3VBUC 1NY71 1QJX3 1HRI1 3ZFEB 2RMU2 2HWB1 1C8M1 4Q4X3 1PGL1 2HWC2 4GMP3 1FPN2 2RM23 1TME1 3FBMA 4Q4W3 2HWE1 1ND2B 1POV1 5C9AB 1AYM3 1SMVA 5C8CB 2WFF2 4PDWC 2HWD1 2R061 4QPGB 1VB2A 4Q4V3 4GMP0 5JZGC 1RUC2 3VBRB 1RUI3 1AR93 1FOD2 5DDJ2 5K0UC 1R093 5BNPC 1AR83 2GH8A 4QPIB 2Y26A 4IV1C 1WCDJ 1F2NA 3J8F2 1QJY1 4GH4A 4CDWA 1ZBA2 4CEYC 1FMD1 4N43C 1AYN2 1PGW1 1RHI1 2R072 2FZ1A 1PO11 1RUJ1 3ZFFA 1RUE3 1QJX1 3JD73 1ASJ3 5BNNB 3JBG2 4CDWC 3VDDB 1RUH3 2ZZQA 4CEWB 4Q4X1 1R1A2 1V9U2 4GMP1 3VBHA 2RM21 4Q4W1 4RHV2 2WZR2 4WM7C 1PO23 1AYM1 2GSYA 1IHMA 5AC92 1OOPB 1VBE3 2RR12 1BBT2 4FSJA 3VBFA 4RS5B 4Q4V1 2FZ2A 1NCRB 1RUI1 1AR91 4Q4Y2 4GH4B 1R091 1NCQA 3ZXAC 1AR81 1HXS3 4N53A 3ZFGC 4Z92B 1QJZA 3LOBA 2WLPA 1X36A 5D8AC 4RQPC 1PVC2 4JGZC 4WM8B 1C8NA 1COV3 4Y5Z0 1VRH3 3DPRA 1D4M2 1RMU2 5BNOA 3TN92 1RUE1 3VBHB 3JD71 1ASJ1 3ZFEC 1RUH1 5ABJB 4YVWC 5C8CA 1OPOA 1NY72 4FTEA 1NG0A 1POV0 2MEV2 1BMV2 1BEV2 1C8M2 1PGL2 1ND2C 3VBFB 3VBRA 1PO21 4GB32 1RVF2 1RUD2 5C9AC 2RS33 2PLV3 1VBE1 4JGYA 5A32B 5A33A 1RUF2 5ACA2 4QPIA 3NAPB 4SBVA 5C8CC 4IV3A 4CDXB 4N53B 1W39A 2ZTNA 2RMU3 4QPGC 5C4WA 1Z7S2 3VBRC 2HWC3 1HXS1 1K5MB 1MEC2 4QPIC 1ZBE3 1QJU2 1RB8G 3DPRB 5FMOS 4CDUA 5BNOB 1AL22 5BNNA 2WFF3 3HAGA 3VDDA 1COV1 4CEWA 1AR73 1QJY2 1VRH1 1OHFA 1EAH2 2X5IB 1RUC3 2XBO2 5CFDB 1M06G 1NOVA 5DDJ3 1EV13 1OOPA 2TBVA 1E57A 1PIV2 4CEWC 1NA1A 4AEDB 4JGYB 3J8F3 4RS5A 5A33B 1ZBA3 4Q4X2 4IV3B 1NCRA 2RS12 3JB4C 1AYN3 5C4WB 2RS31 2PLV1 2R073 2RMU1 1TMF2 4RS5C 3JBG3 4CDUB 4WM8A 4Y4YA 1VBD3 1X33A 1R1A3 4NWWA 3M8LA 1V9U3 1H8TA 2HWC1 4GH4C 2RS52 3IDEA 1AR92 4RHV3 1A6CA 1GFF2 1ZBE1 2WZR3 2R042 1AR62 2WFF1 1QQP3 5ABJA 2RR13 3ZFFC 1R082 1AR71 1AL0G 4RR3B 4BCUA 1RUC1 1NA1B 1B35A 3VBOB 2WS93 4Q4Y3 5DDJ1 3VBHC 1EV11 1HRV2 1MQTA 5A32A 5ABJC 3NAPA 1ASJ2 5J96B 4CDXA 4IV1B 1RUH2 3J8F1 5L7OA 1HX6A 1VBA3 1ZBA1 1PVC3 4RFT0 4CEYB 3VBFC 1RUG2 1AYN1 2R071 4N43B 1VBB2 5FMOL 1K5MA 2BBVA 2VQ0A 1H8TB
chains in the Genus database with same CATH superfamily
2IXHA 2WDBA 2ZHMA 1IS6A 3K48A 1NCQC 1UZZA 3JZVA 2D3SA 5FZ7A 2VTXJ 1VAKA 3JBG1 4CXXA 1UPIA 1VMFA 3O1VA 1VBD1 2OT7A 3KCYA 4XJAA 1XU2A 5DMYA 1KQRA 2OS2A 4PI0A 3JQWA 4UW5A 1UY1A 3LSDA 2P37A 2VXJA 4PLOA 2PELA 2VE1A 2VOXA 3AB0A 4IEQA 5FMCA 4GJZA 1U5XA 2HWB2 2WZR1 3EO6A 1HB2A 4C8DA 3DPRC 3PNAA 1XYOA 1AXZA 1B35B 3RWKX 2CWMA 4I0BA 4W65A 1OXCA 2RR11 1YO8A 3VZNA 5JI9A 2YFUA 2ORXA 1W9YA 1PZ8A 4JC1A 4AEDA 3UGHA 2C24A 2W3JA 5EYXA 2IVIB 3EHKA 1VJ2A 3AKSA 5GALA 3LEIA 3ZXKA 5CFDC 2IFWA 4Y3OA 3A23A 3ME2A 2CSGA 3WF1A 4BOWA 1YQ2A 4PIXA 4OZOA 2IXLA 4DXRA 2XR4A 2VH9A 2C5DA 3VHRA 1QJU3 4XFBA 4QKFA 1FPN3 1GLHA 5C3RA 1VBA1 2VUAA 2IXIA 5LA1A 1K45A 2ZX0A 1PVC1 2X29A 4CDQB 3WF0A 1OVSA 3LDKA 4IL7A 1R64A 4JRAA 1LR5A 5C4WC 1SLTA 1Y3TA 4OMDA 4UF0B 2XBO3 4BJ0A 2DTWA 2VZRA 4EJRA 1NE6A 3Q8BA 5FLJA 2PLV2 5AFBA 5A3WA 4Q1RA 5FBZA 4QM8A 1V6IA 2UWBA 5L73A 5H9PA 3FLTA 2XKOA 1EPZA 4JKMA 1RUOA 1L7QA 3OTFA 1G9AA 4PDWA 1W8TA 4ZHNA 5IK4A 4FTBA 3ITQA 3ZYJB 4B4RA 2XQXA 1NYWA 4FO9A 3O1UA 1ST8A 2WNVB 5KC6A 2Y0OA 4YVSB 5LZ6A 3X29B 2Y0IA 1EY2A 1ZX5A 3I59B 2OX0A 1S2KA 5FZ6A 1W2AX 4TYSA 4MHRA 2J1UA 4UFKA 3HNMA 5F6KA 1TMF3 4RR3C 1AR72 3R0RA 3O1PA 4NIHA 3NMBA 4AEMA 4C91A 2JDYA 3RI8A 3POJA 4N9HA 3AYEA 4HETA 2XHNA 1LOCA 3POYA 2RS53 4NUBA 3WUCA 4TTGA 1ZVFA 2YU2A 1A34A 4LLOA 1NQJA 1NCRC 2GALA 4RSUA 1QJU1 3AJZA 4ATEA 4EYUA 5EFUA 4Q4V2 2ZX4A 1FPN1 3QLQA 4YSFA 5A3PA 2BP6A 1GOHA 1JBCA 2FQPA 1R083 1QDCA 2WO7A 4AEJA 1SBFA 1IS3A 3VD7A 5AC93 2AEZA 3ACGA 4NRPA 5EZWA 3ZM8A 1NLRA 2XBO1 4OQ9A 3UK9A 3U0ZA 3BU0A 1OF3A 2E63A 4RGKA 3AXEA 2Y64A 2Y6JA 4Z8BA 4META 4XJZA 2CGNA 4NE9A 3OOXA 1HB1A 1GNHA 1KFXL 2VQTA 3J7HA 1YCIA 4COZA 1UX7A 4SLIA 1GNZA 1O4ZA 1WMFA 1AUYA 5KXEA 2D3PA 2RDRA 4NHMA 3N36A 1N3PA 5FDBA 5KC5A 1YFYA 5BNPB 1KD7A 1OA2A 1ULGA 1DLLA 4J1XA 3FC0A 4FAGA 4K8RB 3KSCA 3G7DA 3CEWA 1DBNA 1CAVA 5A7WA 3KB5A 4HXCA 4I0AA 4DOUA 4XFHA 2XMLA 5CFCA 1B35C 3JUUA 1WLCA 2WABA 5GZGA 3ZFGA 4NHKA 2YPDA 1QQP2 1D4M3 1TMF1 1Q43A 2WYSA 3FN9A 1DGLA 1MZFA 3JB8A 3A0KA 3TN93 4KWLA 4N7UA 1VBE2 3B5LB 3NNMA 1WW6A 1WW4A 4XTPA 4J6GA 4JGZA 2RS51 3U07A 4L0PA 3P3NA 3F95A 4LLFA 5FP9A 3KD4A 1JOBA 2HWB3 3CJIA 3KM5A 5EWSA 3ZIXA 2GH2A 3BTXA 1HV1A 1G9BA 2CV6A 2YDEA 2C9KA 4QHBA 3ZXLA 1R081 1HXS2 4CDQC 5CAZA 5JOZA 3TEYA 3ZFEA 4NROA 4YZ3A 5AC91 4WM7B 4K7JA 4NHXA 4LA3A 1POV3 3DUIA 4UFLA 4QB2A 1NLSA 1QH7A 4KBBA 4WVMB 1LAJA 4KWUA 2Y6KA 3INAA 5A6ZA 1QXJA 4LIVA 5F5AA 2HLEA 2W1UA 1W99A 3VBSA 4XIOA 3H3ZA 3IT8A 3RSJA 1CAUA 1U12A 2BV4A 3WNMA 4CCJA 1QDOA 1X50A 2Q1MA 3WP4A 3WF2A 2YBSA 2E7QA 3HBKA 3QACA 4ZS3A 5FKCA 2WNVC 1PNFA 4OUSA 3A21A 4YVSC 2BVBA 4I0WB 3C7FA 2YC0A 4RQPB 1YHFA 1YC61 1D4M1 1IQAA 4OUEA 4XDPA 5DZGA 1W0NA 4L92A 3JU9A 5LRRA 1JHJA 4KWJA 3AL6A 2B46X 4AXOA 4ET7A 2GC0A 2ZCWA 1HB4A 3WUDA 2UY8A 2RS32 3T4VA 4AHYA 3FHQA 2PFWA 5FP8A 1OA4A 1QWRA 2VZOA 2WWJA 3FHAA 3E6CC 4BXFA 1CESA 4B29A 3TEWA 1CIYA 5FJHA 1QU0A 5KBFA 2HWB1 1QOSA 4AQ2A 1RJ8A 3KGZA 3U4SA 2BOIA 1LU1A 1MACA 5HI0A 3IDCB 3H9AA 2Z42A 5ERLA 3K77A 4FFFA 3ZR6A 2HWC2 3ES4A 4F3JA 1AJKA 2HEVF 1UCXA 4AI1A 3ZLIA 5C3OA 2D93A 3DGTA 1CX1A 3D3AA 1ND2B 2G9FA 2XJQA 3PTYA 3P3PA 4QDSA 1POV1 4PLMA 3SCFA 5LRSA 3ROUA 2NZ9A 1SMVA 1US3A 1OQEA 4LHSA 1H2NA 3KWVA 1NX9A 1YWKA 5E1RA 5I8YA 1OLME 5IYYA 4Q4V3 1DQ6A 3FJSA 5E88A 3T0DA 3APBA 5JXIA 2ARCA 3I2JA 5DDJ2 5JCTA 5KXBA 2HEYF 1Y9QA 1UOJA 4XFFA 5BNPC 5HV0A 3VD4A 1W2UA 4QPIB 2Y26A 4IE6A 3HD8B 1WCDJ 1F2NA 2E51A 2XDVA 3EBRA 4K9SA 2J1TA 4AQTA 2ZGTA 3E5QA 2OA2A 4KGQA 1DIWA 2P1BA 4MGIE 4UFMA 1P8JA 4XUPA 4MX3A 2JEMA 4WV8A 3I3QA 3T0AA 3THPA 1AZDA 1L3JA 4S2FA 2BGOA 2FZ1A 1APNA 2EXJA 1I9RA 1PZ9A 2BTVC 1ASJ3 2VM9A 1X8MA 2A5ZA 1QNWA 5DUUA 5BNNB 3VDDB 4CP1A 2ZX1A 5ANNA 4DRRA 4PBOA 4YW6A 3VLBB 1OVPA 1ZZ7A 1UAIA 4TXWA 4X6QB 3V56A 3HPNA 5J09A 1KXGA 1LGCA 2GP3A 4MZUA 5CKNA 2XL9A 2HYKA 4AQ6A 2C9AA 4OYUA 1A8MA 4WM7C 4EN8B 1UXZA 4AFBA 3S0MA 1VBE3 2NMNA 4CXWA 4Y5TA 4I3PA 5CIRA 2E9QA 4FSJA 3MFCA 4DXTA 4QB6A 4XE9A 3WP6A 1HIXA 2OQ7A 1N47A 4Q4V1 4DIQA 1UKRA 4ZONA 5IJRA 4QB1A 2YG0A 1JOJA 3GDBA 2ENRA 4IQPA 4LK7A 4AZZA 3WW2A 3TYJA 4GH4B 3GNEA 4M0NA 3WX5A 3WDTA 4YG0A 3ZXAC 1HXS3 4N53A 4NO4A 4UYBA 4GWIA 3SEEA 1JHNA 5FUPA 4IERA 4EN9B 3L2YA 3AKRA 3LOBA 1LHVA 2PHLA 2VMDA 4COWA 4HK9A 5LA0A 3Q8EA 3L2HA 2I07B 5FZ8A 2D43A 4RQPC 1LU2A 4AI2A 2VCCA 4B1MA 3V64A 1N3OA 1IGOA 1GP4A 2KD7A 4TLGA 1AVBA 5FAXA 5C71A 5JPMB 4Y5Z0 2JDNA 4XF4A 4BQWA 3LPGA 2RVAA 2GC3A 2VZTA 3M3CA 3K4AA 3LFMA 4DINB 5BNNC 2NP0A 3VBHB 3CL1A 1UOFA 1R1ZA 4QDRA 1KJRA 5FZIA 1ASJ1 1LOEA 2A73B 2CWSA 2VNVA 1QJFA 3A0NA 4NN0A 4Y1UA 2ORZA 2ZGLA 4YVWC 5C8CA 3SKJE 1OPOA 1NZIA 3GZEA 3J7NA 1DZQA 4KU7A 5BNQA 1OQ1A 1QOOA 1POV0 1DYOA 4YW2A 1S0EA 1W8WA 2PQSA 3AZZA 1BMV2 4AWDA 1ENRA 1ND2C 2GN7A 1TQ5A 2B42B 2QQKA 4GB32 4AVCA 2J7MA 5FK8A 1RVF2 3QCWA 1GOFA 2RS33 3O1MA 1VBE1 4P14A 1LECA 4HFSA 1W8FA 4HZFA 2VCAA 4YZ2A 1AX2A 1RUF2 3GYDA 2WJSA 3NAPB 3H3UA 4UBGA 2QDRA 2YV8A 2ZTNA 3UGGA 4ZZ8A 4J25A 3BGAA 3R6SA 4BK5A 5IAVA 1UZYA 4A45A 2D97A 1JZ2A 4KL1A 2HWC3 1IS4A 1A3KA 1HXS1 3ALQA 3TOJA 1K5MB 1MEC2 3I3BA 5BUVA 1U0AA 4M3CA 4AI0A 4YM0A 5F6LB 5KWRA 4QPIC 4TZDA 1ZBE3 1RB8G 4P9JA 1BK0A 1W8NA 2BGPA 5FZ0A 2VOVA 5BNOB 1LHNA 2XLGA 1RITA 4OHYA 4IGPA 1BKZA 4XC9A 4NIIA 2QQIA 2O8OA 3HAGA 3RQ0A 2Y38A 3SKVA 3BI3A 4XEZA 1RXFA 2QQLA 4IEOA 4NAMA 4BQ2A 4CP0A 3DL3A 4OUMA 1EAH2 1UU6A 2J42A 1YQ6A 2VJXA 1ZZCA 4KWKA 2LM3A 4I02A 2XVLA 1CR7A 5IT6A 5KHGA 4NPRA 2QQNA 1NOVA 5DDJ3 3AMHA 4G4FA 3HNYM 1EV13 3MBWA 4NJ4A 3U10A 3B01A 2BBAA 1OOPA 2NN8A 5AVPA 2BERA 1E57A 1SDDB 2JDPA 1UF2C 1NA1A 2WQ8A 4AEDB 5HCHA 1V70A 1YYNA 1EPWA 4HT1T 4BZ4A 3M4FA 2NMOA 3LFIA 4IV3B 1UX6A 2VVEA 5KHHA 2P4EA 3JB4C 4XF0A 1DQ0A 4QQLA 2O14A 2RS31 4XVHA 5GZFA 3V0AA 4HN1A 4DPNA 5GZCA 5IK8A 4R52A 1WGPA 1H8VA 4GULA 2DVBA 2EIDA 4LEJA 5ANQA 3A7QA 1IKQA 4ITCA 1I5PA 2CHHA 4Y4YA 2BYVE 4E4ZA 1H8TA 2HWC1 2P5BA 4GH4C 1CZSA 3PDQA 4QQOA 1AX0A 4GD4A 4CUAA 1ZBE1 5JXJA 4K40A 1F5FA 5APAA 1GNYA 1AR62 5FZOA 2VBPA 1EUUA 4FPYA 2ZHKA 3W58A 3WW4A 3ZR5A 4P9LA 4YGDA 4EN7B 2QCSB 1S2EA 5FPVA 4BCUA 4B7EA 4ZU5A 5A7SA 4LBOA 2WS93 3PVNA 5EP9A 5DDJ1 3VBHC 1EV11 2D6LX 3NKGA 4NPLA 1HRV2 1G86A 2BGCA 3K51A 5A7PA 4XHBA 1MQTA 5T5JA 4CU8A 2ES3A 3H7JA 4V1PA 1Q8PA 1PK6C 4U2AA 3HIFA 4QHOA 3ZN5A 5L7OA 1HX6A 3POEA 4YPJA 1PMJX 4WVWA 3UYJA 1C4RA 4A7ZA 5A6QA 1W9SA 2EXHA 3MEPA 1RUG2 1ULEA 4IXLA 4UFIA 2WQZC 1W2TA 4OHXA 3OUJA 5FMOL 4LE4A 2R49A 1UY3A 3BODA 4L11A 3WNOA 2PXJA 3EXUA 4AGRA 4BLJA 4CU7A 2WAAA 5IATA 4CSWA 1O91A 2IC1A 4MVTA 2Z5WA 4ZZ5A 3VKNA 5C8WA 2W92A 1YQCA 1XSRA 1YJLA 1BZWA 1VRBA 3MW2A 1XQNA 3S5AA 2BPA2 1J58A 1W6QA 3S5QA 2QQPA 1GP6A 1K5MC 2X5IA 3ETQA 5I8TA 3B9CA 4GB33 2HWF3 1RVF3 3AVRA 3TNPB 2VTFA 5BNOC 4W6XA 1S0IA 2GP5A 2BWCA 2R7EB 1RUF3 2Z79A 2JG8B 4QXKA 4DEVA 1O3RA 5F3GA 3LSEA 4HPKB 3HMYA 3OYWA 1SHWB 3KVAA 4N7IA 3ASIA 2VBBA 3PMSA 3GCXA 5FXWA 1VRH2 2WS91 1OLRA 2P3KA 1JH5A 1S0FA 4MGQA 4MADA 5G05L 2HWD2 4Y20A 5GZEA 5CFCB 1MEC3 5GLWA 1LOGA 2R062 4KGGA 2UYBA 4FBFA 4MXWA 2PHUA 5DUVA 2PTMA 2VUDA 2OQ6A 3NL1A 1JODA 2D44A 4MSVA 4Q2FA 4YM1A 5A6XA 2X10A 4CP9A 5FYCA 4Y1XA 4JDOA 1JYTA 4MH0E 3B9IA 3CO2A 3VBUA 4IV3C 3AK0A 1V6JA 1QXRA 4JGZB 5LASA 1EAH3 4JKKA 3VD5A 4UXAA 5IWFA 4LO5B 1C1FA 1YUDA 2V09A 4CRQA 2SBAA 3CJIB 4NIDA 4GQ7A 2BEOA 4GWMA 4IEVA 2XB6C 3NV1A 4P9GA 1H1AA 3ZSEA 4C1XA 4LULA 1PGW2 1RHI2 2ZEXA 4K20A 2H6CA 5JAXA 1US2A 1GBGA 1HB3A 4QQ2A 1RJ7A 4XETA 1N3QA 2WAOA 4RD7A 2KXLA 1BMV1 5T55A 5C5UA 4D3WA 2BFUS 1O4YA 2Q4SA 4Q5OA 2JG9B 2XL7A 3MLKA 1UY2A 1SLIA 1VR3A 2OXBA 2HWF1 1RVF1 3MF9A 4GB31 5FZKA 5JZGA 3LQCA 3DKQA 3HT1A 3VBSB 1RUF1 5K0UA 2BU9A 3RNSA 4Q4W2 5HCBA 5IFPA 3H8XA 2JIJA 3MIDA 4IV1A 5FY5A 1GQHA 3PU8A 1JZ6A 3POIA 2Q8CA 4MUVA 1XYPA 2ZGQA 4CEYA 3NNFA 2DV9A 3AJYA 1MEC1 4HKOA 1XRUA 4N43A 3M3IA 2CNAA 3CZUA 4LKDA 2K0GA 4COYA 2W1SA 2O8QA 1HDKA 5FZ4A 4XAAA 1CJDA 2YB7A 4XBNA 5LA9A 4A4AA 3C7HA 1PX4A 2QQVA 2XUMA 1AR63 1CPNA 5DQ0A 4AOCA 2C4XA 2WA4A 4ARYA 2W95A 2DFCA 2H0VA 4Y22A 3RMXA 4NVPA 2DYCA 3OY8A 1KDKA 4Q0VA 1EAH1 4CU6A 5HPOA 5FZCA 2TNFA 2W1WA 3LEMA 5LW9A 4HVOA 4WM8C 1BBT3 1DQ5A 4XOGA 2DVAA 2P3YA 3KT4A 3GGLA 1HRV3 4FQ4A 5LBBA 2DVGA 2A6XA 2VZ3A 1DYPA 3KVBA 4U36A 3H0OA 5SV5A 3NJVA 3SH4A 1W9TA 2ZGUA 3IDBB 3RPQA 2XOMA 2WNEA 3SLIA 2XPJA 1YI9A 4A6SA 1DHKB 1H30A 5A3MA 1XNTA 1DQ2A 5IUQA 3I3EA 2RJLA 3JD72 3OBTA 2G1MA 5FZ1A 5GZDA 4AFCA 1GICA 1RUG3 2JD9A 2ZEZA 2DURA 5B4NA 1LOAA 3ACHA 5LBCA 4CCDA 5A3TA 5J1XA 2EAAA 2VXRA 2RDNA 4D7YA 2JG8C 5JPNB 1RMU3 2YBKA 4G3YC 5DABA 2QBXA 3PHMA 4AHWA 3S57A 3MIEA 4JHTA 2WC2A 5D8AA 1UKGA 5D21A 4MLOA 5D1IA 3KF5A 3WDXA 2BW8A 1QXPA 3MDPA 5CFCC 4FPCA 4D7TA 1SCSA 3AMPA 2GNMA 5FQ0A 3WNNA 3UKVA 3MI8A 4UW4A 1QKQA 3ZDSA 5FBJA 4YW1A 5HXVA 1G9DA 1AR61 3DYPA 4QX7A 1QIQA 3MW4A 4XXAA 3H1WA 4W8JA 1ZRIA 4D0QA 2CGPA 2JE7A 3ZKUA 4BQ5A 4AAXA 2P6HA 2WN2A 1O5LA 1HJFA 2YGMA 3FLRA 4CZSA 4BE3A 1REFA 2ZGSA 1BBT1 2WNUA 1O3QA 1YEWA 3CNAA 3N9QA 2JKXA 4KG0A 4O65A 2E7AA 5FPBA 3KHCA 3CJIC 3BN6A 1HRV1 1COV2 4BU2A 2HWD3 4P5HA 3MYXA 2R063 5HXMA 4LKSA 2DCKA 3WT3A 4OI1A 4A42A 1W6OB 3KCCA 3MV11 2FDFA 1AF9A 3H1YA 3U37A 2FMDA 4AFAA 2RHPA 2VUJA 2VOTA 4JZRA 1YFWA 3D4KA 1ND3A 1GANA 4L99A 1RUG1 4NHYA 2JG9C 3NV3A 4QPGA 4UFHA 4XILA 4C90A 5LK7B 3MHZA 4N90A 3WQ7A 4XFCA 2A6VA 3ETPA 3C3VA 1OFSA 3VBSC 4AVAA 3I3MA 3J7MA 3M1HA 4LBQD 1ZNPA 2ZAHA 4CVUA 1RMU1 1C57A 2KM2A 1LOFC 4G9SB 4XABA 4E2SA 3N9NA 4MHUA 4ES9A 2VQUA 1VBC2 3O5SA 2VZQA 2WWUA 1RHI3 1UY0A 3M7AA 3PURA 3UKTA 4A3ZA 4QD2A 3LIHA 5T5PA 3AMNA 2P6CA 3OSDA 4YLZA 1K12A 1FNZA 2F4PA 1IPSA 3IN9A 2RMU2 3K2OA 1ZYBA 5FY4A 1HQWA 3PVBB 4QQPA 4QPWA 2G9GA 4Q4X3 1PGL1 2VMGA 1LTEA 4PIZA 1MZ6A 1CAXB 4I30A 2VULA 2W0XA 3AKQA 4GA9A 2DVDA 4Q4W3 1U5ZA 1W6MA 1LKNA 3VUOA 1DCSA 2JDHA 5C9AB 1F15A 2YYOA 4P9IA 4AGVA 1OT5A 2AR6A 3LGRA 5F32A 4BA6A 5EJ3A 4EV0A 1GQGA 5C8CB 2HWD1 4LO7A 3KF3A 2R061 2HEWF 1F35A 4FFHA 1WBFA 5F39A 5FXZA 3FBYA 2JE9A 2UYAA 1VB2A 3KV4A 4QAWA 3M3EA 4BWOA 4XQWA 1FOD2 1I5ZA 1O8PA 3B02A 3H7YA 2AREA 4QGMA 3RVHA 5K9YA 1KITA 5FYTA 2FDIA 4MYEA 2VW1A 3JCIA 1XU1A 4IE4A 2MPFA 3N9OA 4LA2A 1FATA 5EYYA 1D2QA 3OCPA 2WSUA 1OA3A 2XWJB 2A6YA 1ZBA2 2VD7A 4CUBA 3MIGA 3VD9A 1D7PM 3K46A 1GOGA 1AYN2 1PGW1 1RHI1 5FREA 3ZN4A 1Q3EA 2VMIA 4H2AA 3LZZA 4M3CB 2B8MA 4XQDA 2OPWA 2PHXA 1FT9A 3ZFFA 2VCMA 1H0BA 5C3PA 2JB8A 4HG6B 4AI9A 1WCUA 3JD73 2Q1ZB 3IMNA 1IS5A 2RDQA 3E5UA 1RUH3 1MS0A 4KU8A 1CIWA 1UPSA 4Q4X1 1Y9GA 2D98A 3P6BA 1V9U2 1OBNA 4Q8LA 1W3VA 3WG4A 3WINE 4DEQA 2J1RA 2DDUA 3H8UA 3ILFA 4OULA 4Q4W1 1OH3A 3NSTA 2YC4A 4P5YA 4RHV2 4ASLA 3WEZA 1ZZ9A 5FOBB 3EJKA 3MFAA 4OLLA 2C6SA 2GMMA 1WMEA 2ZZJA 1UMIA 1OOPB 1JUIA 4QHZA 3OGRA 2WZPP 3VZOA 1I1EA 1TNRA 3K3NA 2W5FA 3N9LA 4XAEA 5KXDA 2WN3A 3CDZB 2GNBA 1A8DA 3VBFA 2BZDA 2Y33A 2ET1A 5D2AA 2FZ2A 4ZXKA 1V6LA 3DYMA 4EWDA 4Q4Y2 3WG1A 1ULFA 1NCQA 2A71A 1UIKA 3N4MA 5F3CA 1QHDA 5DAVA 4DRVA 4FOVA 2W52A 3J26N 1QJZA 3V0AB 3POBA 3HWJA 3NWKA 1W8HA 1TEIA 2GNTA 2GNDA 2ZS6B 4JRLA 2BOJA 3ZXGA 2K46A 4EROA 2OPKA 1G6NA 1TG7A 1COV3 3OB8A 2HH9A 2D6OX 4XPVA 1J59A 3QOPA 4LK6A 4P9WA 1DG6A 3DPRA 4ZU7A 5JXGA 2LROA 4OFGA 5T50A 5CISA 1W2NA 1ALYA 3JD71 2R30A 3ZN6A 4CCKA 1RUH1 3VZLA 3VV1A 1CN1A 1NY72 1RUNA 3RFRA 1LHOA 3UV9A 4W50A 2Y6GA 3CHXA 1C8M2 1RGSA 2AC1A 2VMHA 1OD5A 1SLLA 3IAQA 4ATFA 1KGYA 1RUD2 2OKXA 3RRDA 4XUTA 5C9AC 1QOTA 1WCQA 2PLV3 3Q9OA 4HKLA 5CG8A 2AEYA 4E2GA 5HV4A 1OUSA 5A33A 2IVJA 4NIGA 5C8CC 4LR4A 3S30A 4SBVA 5CKQA 3NV2A 4YW7A 2G19A 4A2UA 1PNGA 4S2GA 1W39A 5F3EA 4AVSA 2RMU3 3D5OA 5C4WA 1K5JA 1RTVA 3BCWA 4BQ3A 2TEPA 4UBHA 4HOOA 3T09A 3I8TA 4ONUA 3MV01 5B2GB 1XC6A 1CJPA 2VY0A 5IFTA 5DAWA 5AFEA 5FP7A 1URXA 3MGUA 5T5LA 5FK7A 4PCRA 5FP4A 2J1SA 5EJ1B 1UO9A 3B3QE 3T2PA 4YZ4A 4ARXA 3BIWE 1NQDA 2DUOA 4D6QA 1XYNA 2H0BA 2JDAA 1BYHA 2XVKA 5DPNA 4CUCA 5E16A 1NT0A 5ISLA 1COV1 2AUYA 4OHZA 4H14A 3ZYPA 4LKFA 1AR73 4QU1A 1QJY2 2KA3A 4YNIA 4D6RA 4MGSA 4XTMA 3SH3A 3TRSB 4EZHA 1JOPA 1QY4A 2X5IB 3ZXDA 2GMEA 3V65A 1C5HA 1H6XA 1KEXA 4CPBD 3CF6E 1JZ5A 3IDAA 4JV4A 4MV2A 4UOJA 4XIKA 3ZX7A 1PIV2 1U5YA 2Z4FA 3I54A 1ULPA 5FJKA 3VKFC 1GP5A 3BOWA 3WXPA 4XBLA 4EQVA 5LCWL 2JKBA 1NZCA 3NNGA 4JGYB 3R4DB 4RS5A 5FZDA 1ZBA3 5CYYA 1GWMA 2AH2A 2HKXA 1NCRA 1OPMA 2X53S 4XACA 1OI6A 2RS12 2FBEA 3WLUA 3N7MA 4AQSA 2Z69A 1AYN3 1W8UA 4OCTA 4XZPA 2Q8EA 2PLV1 3ZDVA 2R0HA 1Q8OA 3O1SA 4MXWB 2QQJA 1ZRRA 4XMIA 1LEMA 2HBUA 5LWBA 5FZHA 2RMU1 1FYUA 5JIUA 2FCTA 3WP5A 3ACFA 2BJSA 5J48A 2JDUA 5EXOA 4CDUB 3GXUA 4QX1A 3AFGA 4XMAA 3M8LA 4B4PA 1V9U3 5FY7A 1XSQA 3NQHA 5EHDA 4Q8KA 1W6NA 5L19A 1AR92 4FT8A 2WT0A 4WVZA 4RHV3 1A6CA 1GFF2 3HJRA 4BQYA 4E4DX 5BXXA 5KR7A 1HW5A 2PQQA 4BPZA 1FNYA 1W05A 2N7GA 2R042 4OHVA 2GU9A 4Q0UA 4XDQA 2VCBA 1C3HA 1QQP3 5ABJA 4M3CF 3KQ4B 2DBIA 1AR71 2JENA 3ACIA 2JDZA 4C0BA 5A1AA 1AL0G 5LEKA 1N1YA 1YFXA 2RDSA 4QDQA 1VMHA 2ZXQA 3FUOA 3K3OA 4CTEA 1B35A 4FPJA 4QPYA 3WD5A 2B39A 1W28A 2NYYA 4Q4Y3 4XUNA 2R1DA 5FXVA 3SCHA 4P02B 4XQ4A 1H1MA 2W87A 3P5BA 5A3UA 1H6YA 5FY1A 1G8WA 4WBBA 2PMWB 3FFZA 4CDXA 3LF7A 4IV1B 1UZVA 2Q8DA 4BK4A 4OI2A 1ZBA1 3AP5A 1E5RA 3CZJA 1XJAA 4V2WA 3CLPA 3ORJA 4LNVA 4C0HA 4CEYB 3MICA 1AYN1 4N43B 5A7NA 2BBVA 4D94A 5FCCA 5F2SA 4D69A 4O9GA 2Y8KA 1LGBA 4GKYA 4XURA 1G9CA 3J9SA 2ZMKA 3SCGA 2Q8OA 3BYWA 4Y22B 1MS4A 1V9U1 4LOSA 2ZGOA 2PAEA 4UF0A 3NW4A 3I2OA 5T54A 3K4ZA 3R4UA 4XF1A 3M70A 2WZEA 4CCLA 2C1FA 4H3WA 4RHV1 2YGLA 1HRI2 4IUGA 1VE0A 3ENRA 4Y26A 1GKBA 2D6MA 3ON7A 1D4VB 1RUD3 3LAGA 5K7PA 1QQP1 4QX8A 2ZMLA 1PHMA 4XFGA 3QH6A 3W20A 4JTOA 2WNVA 1BK1A 1UNBA 3TNQA 4FFIA 3OUHA 1OLMA 2VVFA 3SITA 2X5IC 3ILRA 4LO8A 3I59A 4CCOA 4EWAA 4Q4Y1 2Q5TA 3O1OA 1ZZ6A 4AVTA 2JDMA 1HN1A 1QNYA 1PMHX 5JUVA 2J1AA 1IZ3A 2ZGRA 5FIXA 4YM3A 5H9RA 2B7YA 2VR4A 2ET7A 4JGYC 3U14A 5IVCA 3U11A 1MR5A 3FZ3A 1D0HA 2IUWA 1XBFA 3DN7A 5D8AB 4FFGA 3C7OA 1ULOA 2R1BA 5KXCA 2PAMA 1YQ8A 3I2FA 5B4XA 4DY5A 5FQ0B 3O0VA 1LJ7A 2UY9A 3NRUA 4FP2A 2DU1A 1TE1B 1NXMA 3WNXA 1OC1A 1PIV3 2WT1A 3RGBA 4CDUC 2FD8A 5CVRA 2SLIA 3OGSA 3D0SA 5EV7A 1PO12 2ADDA 2XJTA 3FWEA 1PZ7A 2B4KA 3LE0A 3WNLA 2YC2A 1Z0HA 1F31A 2JD4A 1GZWA 2CDOA 2WNUB 3NV4A 3VDDC 1QJX2 1L7LA 1W3XA 5CNAA 5FZEA 3VBOA 1Q8SA 5CEHA 1DF0A 2RS13 3HQXA 5FFOC 5GLVA 1RUD1 4HSJA 3VDCA 5CADA 1V6MA 3AXDA 3VKOA 2HBTA 3W5NA 4FI9A 4LORA 5A70A 2HJIA 5JOWA 3CKHA 1UU5A 2ZACA 5BNPA 2CTVA 3TWIA 4B4QA 4FPKA 5E89A 2AZ5A 1JZ3A 4QGLA 3I49A 1AYM2 1ND3B 3BTYA 1ULDA 1WA4A 2WIIB 5LEJA 1N1SA 2XJVA 2XH6A 2ZEYA 4QKNA 5F2WA 1YI7A 3WHUA 3KT7A 1W03A 2O1QA 2WWSA 3AZVA 4YW4A 3TBDA 1JYCA 4XXPA 4DO0A 3CIHA 3RDIA 3LDBA 4IGOA 2R043 1RUI2 3B69A 1QJEA 3N7KA 3VKLA 2VPVA 2F17A 3MIBA 3OBZA 1VB4A 3GBWA 4QXCA 4NWVA 1TNFA 4R9AA 5FZBA 5GLZA 4E27A 5FUIA 5FYSA 3VZMA 1JS9A 4CA9A 3RS6A 1JI6A 4K1YA 4PDWB 3UGFA 4HLTA 2WKKA 4Z07A 1ZREA 3H50A 4QQHA 2Z2SB 2WO2A 3LCPA 2FCUA 4WM7A 1PIV1 4HSLA 4L8QA 4Z82A 3HQUA 4YGCA 5LK5A 2TUNA 4QX5A 2O0OA 3S7IA 4WVMA 4URTA 5A7QA 2OYZA 3SISA 1RUE2 1VBD2 2JE8A 2QUOA 2ZGKA 3B7MA 4GZ9A 4NRQA 5EPAA 3THTA 2W68A 3WZ1A 2RS11 5M0TA 1Y4WA 2DF7A 2QTWB 2CAUA 1XNAA 5F5QA 3RI9A 4OZXA 1S0DA 4QXHA 2WO3A 4MXVA 1B09A 1I3HA 1VIWB 3E6BA 3KCXA 2NQYA 3MLLA 4PJYA 3RZZA 5T5OA 2VNGA 1N1TA 2W91A 4UW3A 1ZA4A 3NAPC 5CKMA 1NUKA 1SCRA 4RQPA 4COUA 4KI5M 2UURA 4DUWA 3AP4A 4IETA 1O6UA 4FOYA 2ERFA 2WSVA 4PF1A 4A44A 1HRI3 2Y6FA 1SG3A 2CY6A 2WO1A 2E6VA 2GAUA 2R041 2OVUA 2FDKA 2E26A 2Y34A 3FX3A 2DBNA 4F8AA 2VBDA 1DGWA 5EJZB 1VBA2 1OKOA 2BFUL 3GM8A 4YVWA 2QKDA 3RJRA 3ZFFB 4BQ4A 2LUWA 1WWYA 5IVFA 3B94A 1JZ4A 3N7JA 1I6XA 3AMQA 4KG8A 2JIGA 1UOBA 2W1QA 5IVBA 4EWEA 1REDA 2VW2A 5FPLA 4YW5A 4E4SA 1ND2A 3LB9A 1LGNA 1CWPA 5J98B 2V4AA 2EXIA 5A7WB 1CAVB 4QWNA 5T52A 4CCMA 3HVDA 2GC2A 4XJ9A 1LRHA 2VUCA 1X9TA 1RXGA 3BPZA 2V5DA 3ZFGB 1UD1A 2WNUC 1ENQA 4AE2A 3BOPA 3IKWA 1D0GA 3MLJA 1GV9A 3LOIA 4HONA 5FPAA 3WF4A 4AEDC 4CUGA 5KHJA 3BPSA 3PUIA 3GBFA 5I0SA 5A6YA 4OI0A 4LO6B 2DU0A 1FI2A 2R0FA 5A1FA 1ZZBA 1Y9MA 2QQOA 4HK8A 2LRPA 4Y1ZA 2OIIA 4Z2WA 2VECA 2PYTA 1CAWA 2Y6HA 3DKWA 1NCQB 4X8PA 3VB9A 2OZ6A 2WYFA 2IZWA 1ND3C 4MG2A 1JU3A 3KGLA 3NKTA 1PO13 3CBNA 3MZHA 5DN2A 2BUKA 5A1LA 5BYNA 3UETA 1WCKA 1QJX3 1HRI1 1UU4A 2R16A 3MF6A 2XWBB 4HBNA 2A70A 5IW0A 3T30A 4YG3A 2E33A 4BQXA 1JZ8A 4LQRA 5FXXA 4OI4A 1X9PA 4CCCA 1W06A 1ZRDA 1UYXA 4LMFA 2D6PA 3D6EA 2PAKA 2WLQA 5EQUA 5F5IA 1MZ5A 1FPN2 1H9WA 3FBMA 3RG0A 4QX0A 3WQBA 2WL1A 1GR3A 2UWAA 4GAZA 4BIFA 1AYM3 1CAUB 1DP0A 1H9PA 2G4IA 3E5XA 5FYIA 1W0PA 3VKMA 4RGGA 2QDNA 2XJSA 3C7EA 4PDWC 3HN3A 1LESA 2A75A 2H6BA 1J83A 1F5JA 4XDOA 3T2TA 2BVVA 4LTAA 1MVQA 4WZFA 4GMP0 1RUC2 3JXSA 1LEDA 1RUI3 4QXBA 1RIRA 3URFA 5GJ6A 1W04A 2GH8A 1YLLA 3SMHA 2ZGMA 1YFUA 3DCQA 4RGAA 4B8EA 5IHRA 3MIHA 4Y4RA 2GC1A 2ZHNA 2QVSB 3J8F2 4GH4A 4LUKA 3LA3A 4RL7A 5FZAA 4CDWA 3DXUA 4LE3A 5DG2A 5HCAA 1QGLA 1EYBA 4LBKA 4R8HA 4XHXA 1YNAA 4BISA 2PHWA 5LY2A 1IOAA 1ACCA 3C2UA 2R072 1HJGA 1OH4A 3GALA 1PO11 3VDAA 4FAHA 3FUQA 1YXWA 3ES1A 4S2DA 4B7KA 4AG4A 1RUE3 1QJX1 4XBQA 4M01A 3A22A 1JTZX 2VNOA 2XHKA 2XG3A 2ZZQA 4BLIA 1R1A2 2OW4A 1CX4A 4K3UA 3AC0A 3VBHA 4XCAA 1O4TA 3POFA 2XXZA 1OF4A 1W0OA 3O0WA 4JCKA 4LOTA 3W9AA 2P3JA 2QE3A 3FHIB 4R9CA 3MUZ1 4AHZA 4DXSA 2DTYA 1IPJA 4QMAA 4TSVA 1AYM1 3VHNA 1PK6A 1U5IA 3VZJA 4DQAA 4MGKE 4D6SA 5AC92 3WDUA 4MOAA 5CB7A 2ILMA 2I74A 3AZXA 4RS5B 4AFMA 3O1TA 3BVCA 3CQOA 1NCRB 1RUI1 3THDA 1E5IA 5I0TA 4NIAA 3UNPA 4IE5A 3ZFGC 5I8SA 4Z92B 5IK5A 3AVSA 4LPLA 3OD4A 1UQXA 2WLPA 3MPBA 2LS6A 1BLZA 2W39A 3I2GA 5GLUA 1KJLA 2P2KA 4X6RB 5L9RA 4AR2A 2MNGA 4JGZC 2FDHA 1C8NA 4FPFA 1BJQA 2GZWA 1J1TA 2WINB 3BU7A 4TWTA 4RYDA 1PM4A 1VRH3 1W6NB 5FYYA 4FQZA 1D4M2 4YRDA 5BNOA 5HCFA 1CGPA 1OMIA 3TN92 4Q0SA 1RUE1 2J1VA 1GZCA 2FDGA 2E53A 2V73A 4KBZA 3KHBA 4QX2A 3ZFEC 2ZA9A 1C5IA 5ABJB 4BIOA 4UWDA 5JMCA 1WMDA 1H4GA 4HVQA 2YHJA 1DLCA 3KLSA 1C1LA 2A1XA 2MEV2 1BEV2 1OD3A 3VBRA 1FX5A 1SACA 1LOBA 2BNOA 1WUVA 2PHDA 3V0BA 1K3IA 4CYDA 3CU7A 3WDYA 1WLWA 1NKGA 2J1EA 4XFAA 4XW3A 1ZRFA 5JMOA 5ACA2 2JWPA 1UL9A 5FY9A 5LY1A 3KMHA 4IV3A 5E6HA 4CDXB 4N53B 3ZVXA 2ZMNA 2RJKA 2JB4A 4AVVA 2VZVA 3UJQA 4QKDA 3ZXFA 3PJYA 1N1VA 1Z7S2 5FTTC 1WD4A 1OQDA 1VP6A 4OVEA 3VL9A 3OGJA 3QH7A 1RINA 1PM7A 5FUNA 4INDA 1Q5OA 3HR9A 5FY8A 3USUA 5FPXA 5BY5A 3B93A 4GJYA 1GYKA 5CG9A 3IPVA 2X09A 1GU3A 4FPLA 1AL22 1Q56A 1V6KA 2DCTA 3M2MA 1S0CA 2VZUA 3UKNA 3T08A 1HV0A 4CEWA 4D8MA 4JDNA 1VRH1 2D40A 5I91A 1OHFA 2E32A 4Y33A 1DYKA 3T2OA 4FOWA 3VGIA 1RUC3 3H1MA 4LHNA 3DXTA 4GWNA 1JYVA 3ABZA 5JVVA 5IAXA 3IZOA 3I2DA 4LBQA 2YU1A 3T3YA 1VAVA 4E4HA 2Q0AA 4YG6A 2EICA 3WQ1A 5JLVA 5DAQA 2W9XA 3H3LA 3GHNA 3ST7A 2RJ2A 4IEXA 3J8F3 3OGGA 5A3OA 4FCAA 3RZJA 1J1LA 3WV6A 1W90A 1SLCA 3PUSA 4BB3A 4FXKB 2E7TA 3OG2A 3KV5A 2R073 3PUQA 4OHWA 1X7NA 1PVXA 4AF9A 2EIGA 5FZ9A 4DS0A 4XJ8A 5J36A 5C6CA 3SXWA 4YARA 4E8DA 3BB6A 5FYZA 3ZYBA 4RS5C 2PHTA 3AP9A 5C3SA 2ID4A 4YFWA 4WM8A 3THCA 3SNMA 4I09A 4W4ZA 1PMIA 1R1A3 2ZOEB 4NWWA 2D7FA 4Y5SA 2RE9A 5LBFA 4CP2A 2YPJA 3EQEA 2XVGA 2WBKA 4COVA 1Y43B 1POQA 2WUHA 4QU2A 2CL2A 4BYYA 3RZHA 1ZRCA 1TVGA 1REEA 1OUXA 3VHPA 2QQMA 1D2SA 2A3YA 2Y60A 1O7FA 1J84A 4IW3A 3H8OA 5DUWA 2A3XA 5A3LA 1VPHA 2E31A 2D5FA 2IXKA 3PIGA 5JOYA 1SQ4A 3N7LA 1GZWB 3FFQA 4YFZA 1RUC1 1WD3A 1NA1B 1W9FA 2G9ZA 3VBOB 4YGBA 3H8RA 5EIYB 2VZPA 2JG8A 2XJRA 3PUAA 3QD6A 4HL0A 4HPKA 3CMGA 4WVVA 1DZTA 1ZM1A 2P17A 4AYUA 5C33A 5A32A 5ABJC 3MIFA 2WT2A 3LEGA 2IFRA 1ASJ2 3UL2A 4NHLA 1JW6A 5J96B 3J8F1 3ZYGA 5I93A 1IG0A 2YMZA 3O0XA 5IVVA 3IIIA 3BIEA 3BKZA 3ZPYA 3ECQA 3C8XA 1K42A 2EVXA 3VN4A 2R071 4L97A 2JICA 1VBB2 4P00B 3AZWA 3AZYA 5L9VA 2ZHLA 1S55A 1H8TB 2LALA 1XE8A 3UT0A 3AP6A 3RWNA 3FL7A 4CDXC 2ZGNA 2FMYA 2QZ2A 2XKPA 3GZUC 3I2IA 4H55A 4N53C 3T2QA 2OUHA 3HN1A 1CZVA 4AW7A 1UXXX 1R1A1 5GLTA 5TSWA 3IBMA 1F4AA 2X05A 3WVJA 2BNMA 3EMRA 1KS5A 5FZOB 3GZAA 4RFRB 5JIAA 1H2KA 2MEV3 4A7YA 1JZ7A 1BEV3 1CD3G 1Z78A 3LDRA 1CQ9A 1ENSA 4MO3M 5CFDA 3LPFA 3MUY1 4KQ7A 2WRAA 2XUEA 3S7EA 1F8VA 1WLTA 2QFEA 4GALA 3SQOA 5ACA3 3RZGA 3KS7A 3PIJA 3IWZA 3NO8A 1TME2 1VBC3 2HWE2 2JG9A 2W94A 3U4XA 4XJUA 3GJBA 2JECA 4IEZA 1MQTB 3DECA 3PVEA 4JTNA 4JVAA 4TN7A 4DUXA 2YUEA 5JSRA 1UYZA 4GIQA 1Z7S3 5FYBA 2IXCA 5H9SA 3T4HB 2ATFA 3O7OA 4PIYA 3W59A 2YY1A 5JSOA 1UZWA 2BWAA 5FZLA 5L7OB 1MS5A 3ILNA 1HQNA 1LOFA 2GMPA 1GWKA 1HKDA 3WG2A 5JDBA 4LHKA 3NVCA 3E1F1 2GDFA 4Z1VA 5IVJA 1ODMA 5JWPA 2EIBA 1IQDC 4Q1PA 1AL23 2QQWA 3G6JB 3ZIWA 4BQ1A 4E2QA 3MO4A 2ETEA 1QH6A 2F6BA 3SC7X 3T1LA 1UZ0A 2BNNA 2QQUA 1WZXA 3FLPA 3J4UH 3R05A 3OPTA 3AM2A 3KV6A 3TN91 3H42B 5FWEA 1DFQA 2VOWA 4FP3A 4FXGB 1W6QB 3WOGA 1FMD2 3ZMOA 2XLAA 3N3HA 4PQ9A 3WQ0A 2DUPA 3U78A 1SLAA 5BV6A 1F9KA 1FOD3 4XCBA 5FMDA 4FPEA 3GCWA 3KT1A 2VVDA 3WG3A 4A7KA 4YVWB 1BHGA 1MS1A 1RUJ2 1LULA 4RR3A 1BXHA 2L9LA 2MEV1 3WCRA 3AYDA 1BEV1 2IXJA 3ZSKA 5F7UA 3OYWB 1V00A 3VL8A 1AXYA 4PHZA 1ZBE2 4ZPIA 2LW8A 4C1WA 2V72A 5ACA1 4FPHA 2YZ4A 2CAVA 3RMYA 3O1RA 2RM22 1VBC1 3FE5A 2B9UA 4GXLA 2ADEA 1X82A 4QM9A 4S2HA 1SEFA 4Y20B 3VZKA 2JJ6A 3I2KA 3ZPOA 2JX9A 3OF1A 4YW3A 1OOPC 5JI7A 4AHXA 5L36A 1Z7S1 2RG4A 3PU3A 1NA1C 1W6PA 2BQPA 3VBOC 4CP9B 2YFZA 2LTNA 1SPPA 3K4DA 4XUOA 2P34A 4F83A 1T6GC 3GJAA 4ISRA 4PLNA 4UT5A 3AL5A 4WZCA 3VBUB 5C3QA 3AYCA 5FPUA 1S2BA 4I3GA 3MW3A 4YM2A 1EV12 2VAUA 3AKTA 3Q8CA 4MGYE 1XNKA 1GQPA 3S6PA 1CAWB 1AL21 2JDKA 4LBLA 5J3UA 4M4PA 3WDWA 1LNSA 4IGQA 2EAKA 3VHOA 1BQPA 5F1RA 1R092 3I2HA 2VG9A 4IEPA 2WR9A 3I4IA 1DZRA 1AR82 1XXNA 1KFUL 4A6OA 4M3CE 3WY6A 4CPBA 2VOKA 3T1MA 2QJVA 3IIAA 3RYRA 2PHRA 3PVOA 2ARAA 5L9BA 3AMMA 4XZUG 4PI2A 3LA7A 1H8TC 1KRIA 4FTSA 3WW1A 4B3NA 1WCSA 1JXNA 1MZEA 4LT5A 3NJXA 2DCZA 1FOD1 1WW5A 5JZGB 1VLNA 4Q0PA 1GWLA 3TAYA 1FV2A 1FV3A 4GWJA 3W21A 5K0UB 2HYXA 4YWAA 3ZO0B 4AAPA 2VQAA 1H4HA 1MS9A 4EN6B 3ZYRA 5F8PA 1E5HA 2K2SA 4NPMA 3OEAA 1W6OA 1A78A 1J3PA 1VBB3 4NRMA 4ASMB 4JQTA 2EALA 4ZS2A 4QX3A 3RZLA 1KDMA 4Q29A 1DGRA 4X8NA 3LIGA 1MQTC 1PO22 3T0BA 3D82A 5GKAC 4CDQA 5LB6A 2D3RA 2EF6A 2RV9A 4H7MA 5L7OC 3TEZA 1DDLA 1C28A 4YZ5A 2WS92 1MVEA 3J7LA 4AEKA 4NOTA 4YYOA 3OY8B 5FP3A 1YIPA 5FV3A 5LBEA 3RYPA 5A80A 4CDWB 3K75B 1O3TA 5LA2A 4K6BA 1DGWX 3Q8FA 5FLHA 5C70A 1C8M3 1UOGA 3OJBA 4H7LA 4M4RA 5KHIA 3NNJA 3SHRA 5LATA 4CU9A 3NJYA 3RZMA 4PQQA 1WMXA 4DXZA 3IB3A 3A4UA 4IEUA 1HLCA 1TME3 2HWE3 1VMJA 1HN0A 1XNDA 2VW0A 2ZAAA 2VC9A 3ZXJA 1XOYA 1L7RA 1LHWA 1ZA7A 1YRZA 4HVRA 2DCJA 1S1AA 4MGZE 1S4CA 2A3WA 5CBLA 3GBGA 3W5MA 1CAXA 4ASKA 1W9WA 1G7YA 3ELNA 2XGXA 4PT6A 1O59A 4YVSA 5T3NA 4DZGA 4R9BA 1T2XA 3PLQA 5FOJB 4QGNA 5C9AA 1ENXA 4QKBA 5J37A 4JX0A 5FPZA 3ZSLA 3IM0A 5CA6A 5FR3A 4HN0A 1KS4A 3GZTB 1W8ZA 2BDRA 3ATGA 4PF5A 1PK6B 2WZ8A 1X8EA 3HBZA 4LIUA 4R4ZA 2W2IA 4BH9A 1WA6X 1QF3A 2F4LA 4HANA 3F2ZA 5FYUA 2ZEWA 1VBB1 2K9ZA 3KV9A 3OBRA 4O7XA 1JYWA 1IG3A 1UWWA 3ZKYA 2EA7A 4P9YA 5E8AA 5SV8A 2HWF2 1UN1A 1QJY3 5JR7B 1H2LA 4W6WA 1FMD3 4IE7A 2VMCA 3ZXEA 1BVVA 3ZYFA 4MGTA 4QT6A 5CU1A 1Q8QA 1EP0A 1OLQA 4NR1A 1Y7BA 1RUJ3 5DXDA 2DFBA 3VBUC 1NY71 1RC6A 1AHSA 3U1XA 5KHKA 5FYVA 2OZJA 4J1WA 2A6WA 4M0HA 3WP3A 5IK7A 2CU5A 1C8M1 1Q8VA 3ACLA 3WCSA 2Q1FA 2VGDA 4GMP3 4NAOA 3KQRA 2NM1A 2R6QA 1J3QA 3NJZA 2Y6LA 3Q8AA 4JKLA 2RM23 1TME1 4XF9A 5DAPA 2HWE1 3WF3A 2CGOA 2VNRA 3POSA 2YROA 3HNBM 4KNCA 5H9QA 5I0RA 3UESA 2WFF2 4EZ4A 4JQRA 5FYHA 2X8KA 1O5UA 2I45A 3HOBA 5G04L 1RL3A 1V6NA 1WBLA 1JN2P 4Y1YA 4QPGB 5FZGA 4YZ1A 5JR2A 1W8OA 2KR2A 4K8FA 3HQRA 1OFNA 4DB5A 5JZGC 4GKXA 1OURA 3VBRB 2ARXA 3CJXA 1AR93 4Z2AA 3V0BB 2VTXA 2WQ4A 5K0UC 1T6BX 1GMMA 1R093 2D5HA 5DUXA 3GHMA 1AR83 1IKPA 4IV1C 1MS8A 2PN5A 4IDZA 3LD8A 3GF6A 2B5HA 1QJY1 2QZ3A 4CEYC 1TZOA 1FMD1 2BRTA 3O14A 4R4XA 3UJOA 4DUVA 4FPOB 1LODA 4N43C 3LEKA 1XE7A 4E9KA 2ZX3A 1BCXA 2WFPA 3OPWA 4TLFA 5DZFA 3ZOIA 1DQ4A 4IEWA 1UMZA 4FPGA 5FZ3A 2VZ1A 1S0JA 3TEXA 2ZJCA 3USUB 4BDVB 1NLQA 1RUJ1 2V5YA 3PUHA 4UFJA 5C5TA 1H2MA 1XPWA 2DCYA 3IPVB 3RZKA 2Q30A 5K4LA 2UU8A 4K21A 4NMIA 1CVNA 1W6MB 4OMCA 3N9PA 2CDPA 3JBG2 4CDWC 3ZYIB 1MS3A 5FO7B 4CEWB 3DYOA 1DGRN 2VL4A 4GMP1 3RYKA 1UMHA 3QBQA 2RM21 3KZ4C 4LBNA 5BPXA 2VQ0A 1J3RA 1NE4A 2D6NA 2A6ZA 2WZR2 4XJWA 1PO23 4ZKTB 4LBQB 2GSYA 1IHMA 2FDJA 2W47A 4AVBA 2VMEA 4BM8A 4CCNA 5FO9B 2RR12 1SBDA 1SFYA 3PJQA 1BBT2 5DG1A 5CZKA 1VAMA 4UW6A 3ZSJA 2WA3A 4Y24A 5DAXA 2DUQA 4P9XA 1UYPA 1EUTA 1AR91 4RA0A 3B00A 2AENA 3BUCA 1JYXA 3AP7A 1ODNA 4LKEA 1R091 2J22A 2JXAA 3E6DA 3OUIA 4LBMA 4EN0A 1AR81 3IMMA 4A3XA 3I97A 1SFNA 5JOXA 1V6OA 2FHRA 4UI9L 2B45X 5FKBA 1X36A 2EXKA 2YBPA 5D8AC 4PBPA 5FZMA 5FWJA 1LENA 4XFIA 1PVC2 4WM8B 1CZTA 4XF3A 3BTAA 5IVEA 3OD0A 4K1ZA 1DQ1A 1O8SA 2GN3A 3D0JA 1F4HA 4R9DA 1SLBA 1RMU2 2AACA 5F37A 3TB0A 1PGSA 3AFKA 5FRAA 1JYNA 3LKJA 3LA2A 1GZ9A 1CONA 4Q27A 3OPZA 2PA7A 1JYIA 2C0ZA 1S0BA 4CE8A 4ISQA 4E8CA 4N8MA 2AYHA 4CCEA 4JDMA 4AI3A 4FTEA 5FO8B 1NG0A 1RYYA 4I01A 4XYXA 3AYAA 5GM0A 1PX3A 1PGL2 3USSA 3VBFB 2XQRA 3E97A 1PO21 1UW8A 3ZFEB 1OKQA 1STMA 4O9EA 2ZX2A 2W46A 1LCLA 4JGYA 5A32B 4QPIA 1WW7A 4LO4B 3WNPA 2A7AA 2ZKNA 5DZEA 4AI8A 4CXYA 3N9MA 4RN5A 3I7DA 4QPGC 3ZYHA 4ZXEA 1QMJA 2ARBA 4AK3A 5HBAA 2W08A 4L2NA 3VBRC 2CYFA 1FAYA 3BALA 4DMIA 1V0AA 3AX4A 2VO5A 4ZY9A 1GZTA 3R4SA 3DEMA 3L9JT 4LITA 5J7MA 1ZZ8A 1XNCA 1QJU2 4EE2A 3DPRB 5FMOS 4CDUA 5F9TA 4F7ZA 3VD3A 1DU3D 5FLIA 4BXSV 1AXKA 5BNNA 4V2VA 5I0DA 2WFF3 3VDDA 3O12A 4LBJA 3OGVA 1S0GA 3JQXA 3M3QA 3ZN6B 4B1LA 1YQ5A 5F3IA 1HQLA 4JHZA 1LB2A 1O3SA 3M3OA 3P1IA 2DVFA 2XBO2 5FY0A 4IE0A 5CFDB 5AVAA 4KMQA 1M06G 3FMGA 3EYPA 3OBAA 2FCVA 4IEYA 4LUMA 1NAEA 3PMEA 3POWA 2NPIA 1AX1A 1BVP1 2TBVA 2V4VA 2VU9A 1SDWA 3POGA 3HEIA 4FOQA 4CEWC 1LHUA 2AGSA 1ULCA 3BTZA 1YIFA 5C7GA 4ORFA 1UY4A 2QNKA 1UIJA 2ZPXA 5A33B 3MPPG 4Q4X2 2VMFA 2C26A 2XJUA 4AL9A 2I2SA 3D8CA 1H1IA 2UWCA 1M4WA 5C4WB 4DNYA 3SEPA 2VZSA 3C7GA 1QEXA 4IESA 1SFPA 1YJKA 5JSPA 1OSGA 1JMUB 4LXLA 2XONA 2OUJA 1TMF2 3DF0A 2XJPA 2IWGB 4P08A 3JBG3 3WNKA 3WDVA 3EB7A 1VBD3 1JUHA 1X33A 2ZKLA 4UAPA 3DV8A 1AJOA 2XLFA 1E5SA 2D6KA 1IPKA 5IVYA 2RS52 1NXD1 4HMZA 5FZFA 4I2OA 3IDEA 1G9FA 4O61A 5FMBA 5F5CA 3ZSMA 4HKWA 4Q0QA 2WZR3 2EIEA 4DY3A 1GUIA 1WKYA 3HT2A 3LWCA 3N35A 4Q26A 4YGEA 1XB9A 1VALA 2NLRA 4BMBA 1W2OA 2WFF1 4LHLA 4URAA 2ZGPA 2RR13 3ZFFC 1MPXA 1R082 1XE0A 3U75A 4ES8A 3WSOA 4RR3B 3RJ2X 3PTRB 2ZABA 1FXZA 5K8SA 1CPMA 4N9IA 4A41A 2PHFA 4M00A 5JXHA 2R32A 4DFSA 3NNLA 3ZMNA 4FVVA 4XUQA 3I3DA 3WW3A 1UYYA 4L9BA 3WR0A 2ZBJA 4BHPA 3WHTA 3NAPA 1ONAA 2YXSA 4Y1VA 2DWRA 5A3NA 1SZBA 1RUH2 4W6YA 3OEBA 4BMEA 2MHFA 1VBA3 3AKPA 4JAAA 2B9VA 1PVC3 3PL0A 4RFT0 4OQ8A 1XNBA 1W6PB 3IAPA 1WLDA 3SH5A 4AFDA 1GSLA 1SPPB 2WNOA 4LJHA 5I0UA 3VBFC 4AGGA 1JU4A 4ZU4A 4KH9A 5FYMA 1K5MA 3VDBA 1SBEA 4D7SA 2P3IA 5A7OA
chains in the Genus database with same CATH topology
2IXHA 2ZHMA 1IS6A 3K48A 1NCQC 1UZZA 3JZVA 2D3SA 3JBG1 1VAKA 1UPIA 1VBD1 3KCYA 4XJAA 1XU2A 1KQRA 3JQWA 4UW5A 3LSDA 2P37A 4PLOA 2PELA 2VOXA 3AB0A 4IEQA 1U5XA 2HWB2 2WZR1 3EO6A 3DPRC 3PNAA 1XYOA 1AXZA 1B35B 2CWMA 4I0BA 4W65A 5JI9A 2RR11 1YO8A 3VZNA 1PZ8A 4JC1A 4AEDA 5EYXA 3EHKA 1VJ2A 3AKSA 5GALA 3ZXKA 5CFDC 2IFWA 3ME2A 4BOWA 4PIXA 2IXLA 2VH9A 2C5DA 3VHRA 1QJU3 4XFBA 1FPN3 1GLHA 1VBA1 2VUAA 2IXIA 2ZX0A 1PVC1 2X29A 4CDQB 4JRAA 4IL7A 1LR5A 5C4WC 1SLTA 1Y3TA 2XBO3 4EJRA 2DTWA 1NE6A 5AFBA 5FLJA 2PLV2 4Q1RA 5FBZA 4QM8A 1V6IA 2UWBA 5L73A 5H9PA 3FLTA 2XKOA 1EPZA 1RUOA 3OTFA 1G9AA 4PDWA 5IK4A 4FTBA 3ZYJB 4B4RA 1NYWA 4FO9A 2WNVB 5KC6A 2Y0OA 4YVSB 3X29B 2Y0IA 1EY2A 1ZX5A 3I59B 1S2KA 4TYSA 5F6KA 1TMF3 4RR3C 1AR72 3R0RA 4AEMA 4C91A 3RI8A 4N9HA 3AYEA 4HETA 3POYA 1LOCA 2RS53 3WUCA 1ZVFA 4LLOA 1NQJA 1NCRC 2GALA 4RSUA 1QJU1 3AJZA 4ATEA 5EFUA 4Q4V2 2ZX4A 1FPN1 3QLQA 4YSFA 1JBCA 2FQPA 1R083 1QDCA 4AEJA 1SBFA 1IS3A 5AC93 5EZWA 1NLRA 2XBO1 3UK9A 3U0ZA 2E63A 3AXEA 4Z8BA 4META 4XJZA 2CGNA 1GNHA 1KFXL 1YCIA 4COZA 4SLIA 1GNZA 1O4ZA 1WMFA 1AUYA 5KXEA 2D3PA 4NHMA 3N36A 1N3PA 5FDBA 5KC5A 1YFYA 5BNPB 1KD7A 1OA2A 1ULGA 1DLLA 4J1XA 3FC0A 4FAGA 3KSCA 3G7DA 3CEWA 1DBNA 1CAVA 3KB5A 4I0AA 4DOUA 4XFHA 5CFCA 1B35C 3JUUA 1WLCA 5GZGA 3ZFGA 4NHKA 1QQP2 1D4M3 1TMF1 1Q43A 1DGLA 1MZFA 3JB8A 3A0KA 3TN93 4KWLA 4N7UA 1VBE2 3B5LB 4XTPA 1WW6A 1WW4A 4J6GA 4JGZA 2RS51 3U07A 3P3NA 4LLFA 3KD4A 2HWB3 3CJIA 5EWSA 3KM5A 3ZIXA 2GH2A 1HV1A 1G9BA 2CV6A 2YDEA 4QHBA 3ZXLA 1R081 1HXS2 4CDQC 5CAZA 5JOZA 3ZFEA 4YZ3A 5AC91 4WM7B 4K7JA 4LA3A 1POV3 3DUIA 1NLSA 1QH7A 4KBBA 4WVMB 3INAA 1QXJA 3VBSA 4XIOA 3H3ZA 3IT8A 3RSJA 1CAUA 1U12A 1QDOA 1X50A 2Q1MA 3WP4A 2E7QA 3QACA 2WNVC 1PNFA 4OUSA 4YVSC 2BVBA 4I0WB 2YC0A 4RQPB 1YHFA 1D4M1 1IQAA 5DZGA 4L92A 3JU9A 5LRRA 4AXOA 4KWJA 2B46X 2GC0A 2ZCWA 3WUDA 2UY8A 2RS32 4AHYA 2PFWA 1OA4A 1QWRA 3E6CC 1CESA 4B29A 1QU0A 5KBFA 2HWB1 1QOSA 4AQ2A 1RJ8A 3KGZA 1LU1A 1MACA 5HI0A 3IDCB 3H9AA 2Z42A 2HWC2 3ES4A 4F3JA 1AJKA 2HEVF 1UCXA 4AI1A 2D93A 3DGTA 1ND2B 2G9FA 2XJQA 3PTYA 3P3PA 1POV1 4PLMA 3SCFA 5LRSA 3ROUA 2NZ9A 1SMVA 1OQEA 1H2NA 1YWKA 5E1RA 5I8YA 4Q4V3 1DQ6A 3FJSA 5E88A 3APBA 5DDJ2 5JCTA 5KXBA 2HEYF 1Y9QA 4XFFA 5BNPC 1W2UA 4QPIB 2Y26A 3HD8B 1WCDJ 1F2NA 2E51A 3EBRA 4K9SA 4AQTA 2ZGTA 3E5QA 2OA2A 4KGQA 1DIWA 4MGIE 4MX3A 2JEMA 4WV8A 3THPA 1AZDA 1L3JA 4S2FA 2FZ1A 1APNA 2EXJA 1I9RA 1PZ9A 2BTVC 1ASJ3 1X8MA 2A5ZA 1QNWA 5DUUA 5BNNB 3VDDB 4CP1A 2ZX1A 4DRRA 4PBOA 3ZXJA 3VLBB 1ZZ7A 1UAIA 4X6QB 5J09A 3V56A 1KXGA 1LGCA 4MZUA 2XL9A 2HYKA 4AQ6A 2C9AA 4EN8B 1A8MA 4WM7C 4AFBA 3S0MA 1VBE3 2NMNA 4I3PA 5CIRA 2E9QA 4FSJA 3MFCA 4XE9A 3WP6A 1HIXA 1N47A 4Q4V1 1UKRA 1JOJA 2ENRA 4IQPA 3WW2A 3TYJA 4GH4B 3GNEA 4M0NA 3WX5A 3WDTA 4YG0A 3ZXAC 1HXS3 4N53A 4NO4A 1JHNA 4EN9B 4IERA 3LOBA 3L2YA 3AKRA 1LHVA 2PHLA 4COWA 4HK9A 3L2HA 2I07B 2D43A 4RQPC 1LU2A 4AI2A 3V64A 1N3OA 1IGOA 5JPMB 1AVBA 5FAXA 4Y5Z0 4XF4A 2GC3A 3M3CA 4DINB 2NP0A 3VBHB 3CL1A 1R1ZA 1KJRA 1ASJ1 1LOEA 2A73B 2CWSA 3A0NA 4NN0A 4Y1UA 2ZGLA 4YVWC 5C8CA 1OPOA 4KU7A 1DZQA 5BNQA 1OQ1A 1QOOA 1POV0 4YW2A 1S0EA 1BMV2 3AZZA 4AWDA 1ENRA 1ND2C 2GN7A 1TQ5A 2B42B 4AVCA 4GB32 1RVF2 3QCWA 2RS33 1VBE1 4P14A 1LECA 4HFSA 4HZFA 4YZ2A 1AX2A 1RUF2 3GYDA 2WJSA 3NAPB 3H3UA 4UBGA 2QDRA 2YV8A 2ZTNA 3R6SA 1UZYA 2D97A 4KL1A 1IS4A 2HWC3 1A3KA 1HXS1 3ALQA 3TOJA 1K5MB 1MEC2 5BUVA 1U0AA 4M3CA 4AI0A 4YM0A 5F6LB 5KWRA 4QPIC 4TZDA 1ZBE3 1RB8G 4P9JA 2VOVA 5BNOB 1LHNA 2XLGA 1RITA 4OHYA 1BKZA 2O8OA 3HAGA 3RQ0A 2Y38A 4XEZA 4IEOA 4CP0A 3DL3A 4OUMA 1EAH2 1UU6A 1ZZCA 4KWKA 2LM3A 4I02A 2XVLA 1CR7A 5IT6A 5KHGA 4NPRA 1NOVA 5DDJ3 3AMHA 4G4FA 3U10A 1EV13 3B01A 1OOPA 2NN8A 5AVPA 1E57A 1UF2C 1NA1A 4AEDB 1V70A 1YYNA 1EPWA 4HT1T 4BZ4A 3M4FA 2NMOA 4IV3B 1UX6A 2VVEA 5KHHA 3JB4C 4XF0A 1DQ0A 4QQLA 2RS31 5GZFA 3V0AA 4HN1A 4DPNA 5GZCA 5IK8A 4R52A 1WGPA 1H8VA 4GULA 2DVBA 4LEJA 1IKQA 4ITCA 4Y4YA 2BYVE 4E4ZA 1H8TA 2HWC1 4GH4C 4QQOA 1AX0A 1ZBE1 4K40A 1F5FA 1AR62 4FPYA 2ZHKA 3W58A 3WW4A 4P9LA 4YGDA 4EN7B 2QCSB 4BCUA 4B7EA 4ZU5A 4LBOA 2WS93 3PVNA 5DDJ1 3VBHC 1EV11 2D6LX 3NKGA 1HRV2 1G86A 2BGCA 3K51A 4XHBA 1MQTA 5T5JA 2ES3A 3H7JA 4V1PA 1Q8PA 1PK6C 4U2AA 3HIFA 3ZN5A 5L7OA 1HX6A 4WVWA 1C4RA 4A7ZA 2EXHA 3MEPA 1RUG2 1ULEA 4IXLA 2WQZC 4OHXA 5FMOL 4LE4A 2R49A 3BODA 4L11A 3EXUA 4BLJA 4AGRA 1O91A 2IC1A 4MVTA 2Z5WA 3VKNA 5C8WA 1YJLA 1BZWA 3MW2A 1XQNA 2BPA2 1J58A 1W6QA 2QQPA 1K5MC 2X5IA 3ETQA 5I8TA 3B9CA 4GB33 2HWF3 1RVF3 3TNPB 5BNOC 4W6XA 1S0IA 2BWCA 2Z79A 1RUF3 1O3RA 2JG8B 4QXKA 3LSEA 4HPKB 3HMYA 3OYWA 4N7IA 3ASIA 3PMSA 1VRH2 2WS91 1OLRA 2P3KA 1JH5A 1S0FA 2HWD2 4Y20A 5GZEA 5CFCB 1MEC3 5GLWA 1LOGA 2R062 4KGGA 2UYBA 4FBFA 4MXWA 2PHUA 5DUVA 2PTMA 3NL1A 4MSVA 2D44A 4Q2FA 4YM1A 4Y1XA 4JDOA 4MH0E 3B9IA 3CO2A 1SBEA 3VBUA 4IV3C 3AK0A 1V6JA 1QXRA 4JGZB 1EAH3 4UXAA 4LO5B 1C1FA 1YUDA 2V09A 4CRQA 2SBAA 3CJIB 4GQ7A 2BEOA 4GWMA 4IEVA 2XB6C 3NV1A 4P9GA 1H1AA 3ZSEA 4C1XA 4LULA 1PGW2 1RHI2 4K20A 2H6CA 5JAXA 4XETA 1GBGA 4QQ2A 1RJ7A 1N3QA 4RD7A 2KXLA 1BMV1 5T55A 4D3WA 2BFUS 1O4YA 2Q4SA 2JG9B 2XL7A 3MLKA 1VR3A 1SLIA 3MF9A 4GB31 2HWF1 1RVF1 5JZGA 3HT1A 3VBSB 1RUF1 5K0UA 3RNSA 4Q4W2 5HCBA 3MIDA 4IV1A 1GQHA 4MUVA 1XYPA 2ZGQA 4CEYA 2DV9A 3AJYA 1MEC1 4HKOA 1XRUA 4N43A 3M3IA 2CNAA 4COYA 2K0GA 2O8QA 1HDKA 1CJDA 4XBNA 2XUMA 1AR63 1CPNA 2WA4A 2DFCA 2H0VA 4Y22A 3RMXA 4NVPA 2DYCA 3OY8A 1KDKA 4Q0VA 1EAH1 2TNFA 4HVOA 4WM8C 1BBT3 1DQ5A 4XOGA 2DVAA 3KT4A 1HRV3 4FQ4A 2DVGA 2A6XA 1DYPA 3SH4A 4U36A 3H0OA 5SV5A 2ZGUA 3IDBB 3RPQA 2WNEA 3SLIA 2XPJA 1YI9A 1DHKB 1H30A 5A3MA 1DQ2A 5IUQA 2RJLA 3JD72 3OBTA 5GZDA 4AFCA 1GICA 1RUG3 2DURA 1LOAA 2EAAA 2VXRA 4D7YA 2JG8C 5JPNB 1RMU3 4G3YC 4AHWA 3PHMA 3MIEA 2WC2A 5D8AA 1UKGA 4MLOA 5D1IA 3WDXA 2BW8A 1QXPA 3MDPA 5CFCC 4FPCA 4D7TA 1SCSA 3AMPA 2GNMA 5FQ0A 3UKVA 3MI8A 4UW4A 1QKQA 3ZDSA 4YW1A 5HXVA 1G9DA 1AR61 4XXAA 3MW4A 2CGPA 3H1WA 2JE7A 1O5LA 2YGMA 3FLRA 4CZSA 4BE3A 1REFA 2ZGSA 1BBT1 2WNUA 1O3QA 3CNAA 4KG0A 2E7AA 3CJIC 1HRV1 1COV2 2HWD3 4P5HA 3MYXA 2R063 2DCKA 3WT3A 4OI1A 1W6OB 3KCCA 1AF9A 3H1YA 2FMDA 4AFAA 2RHPA 2VUJA 1YFWA 3D4KA 1ND3A 1GANA 4L99A 1RUG1 4QPGA 2JG9C 3NV3A 4XILA 4C90A 5LK7B 4N90A 3WQ7A 4XFCA 2A6VA 3C3VA 1OFSA 3VBSC 4AVAA 3M1HA 4LBQD 1ZNPA 2ZAHA 1RMU1 1C57A 2KM2A 1LOFC 4G9SB 4E2SA 4ES9A 1VBC2 3O5SA 1RHI3 3M7AA 3UKTA 4QD2A 5T5PA 3AMNA 4YLZA 1FNZA 2F4PA 3IN9A 2RMU2 1ZYBA 1HQWA 3PVBB 4QQPA 2G9GA 4Q4X3 1PGL1 2VMGA 1LTEA 4PIZA 1MZ6A 1CAXB 4I30A 2VULA 2W0XA 3AKQA 4GA9A 2DVDA 4Q4W3 1U5ZA 1W6MA 1LKNA 3VUOA 5C9AB 4P9IA 2YYOA 4AGVA 2AR6A 3LGRA 4BA6A 5C8CB 5EJ3A 4EV0A 1GQGA 2HWD1 4LO7A 2R061 2HEWF 1WBFA 3FBYA 2JE9A 2UYAA 1VB2A 3M3EA 4BWOA 4XQWA 1FOD2 1I5ZA 3B02A 3H7YA 2AREA 4QGMA 5K9YA 1KITA 4MYEA 2VW1A 3JCIA 1XU1A 4LA2A 2MPFA 1FATA 5EYYA 1D2QA 3OCPA 2WSUA 1OA3A 2XWJB 2A6YA 1ZBA2 3MIGA 1AYN2 1PGW1 1RHI1 5FREA 3ZN4A 1Q3EA 2VMIA 3LZZA 4M3CB 2B8MA 4XQDA 2PHXA 1FT9A 3ZFFA 1H0BA 3JD73 2Q1ZB 3IMNA 1IS5A 3E5UA 1RUH3 1MS0A 4KU8A 1CIWA 1UPSA 4Q4X1 2D98A 1V9U2 4Q8LA 3WG4A 3WINE 3H8UA 3ILFA 4OULA 4Q4W1 3NSTA 4RHV2 4ASLA 1ZZ9A 5FOBB 3EJKA 3MFAA 4OLLA 2GMMA 1WMEA 2ZZJA 2WZPP 1OOPB 1JUIA 3VZOA 1I1EA 1TNRA 5KXDA 2GNBA 1A8DA 3VBFA 2ET1A 2FZ2A 4ZXKA 1V6LA 4EWDA 4Q4Y2 3WG1A 1ULFA 1NCQA 2A71A 1UIKA 3N4MA 1QHDA 4DRVA 4FOVA 2W52A 3J26N 1QJZA 3V0AB 3HWJA 3NWKA 1TEIA 2GNTA 2GNDA 2ZS6B 4JRLA 3ZXGA 4EROA 2OPKA 1G6NA 1COV3 4XPVA 2D6OX 1J59A 3QOPA 4P9WA 1DG6A 3DPRA 4ZU7A 4OFGA 5T50A 1ALYA 3JD71 2R30A 3ZN6A 1RUH1 3VZLA 3VV1A 1CN1A 1NY72 1RUNA 1LHOA 3UV9A 1C8M2 1RGSA 2VMHA 1OD5A 1SLLA 4ATFA 1RUD2 3RRDA 5C9AC 1QOTA 2PLV3 3Q9OA 4HKLA 5CG8A 4E2GA 5A33A 5C8CC 4LR4A 3S30A 4SBVA 3NV2A 4A2UA 1PNGA 4S2GA 1W39A 4AVSA 2RMU3 3D5OA 5C4WA 3BCWA 1RTVA 2TEPA 4UBHA 3I8TA 4ONUA 5B2GB 1CJPA 2VY0A 5AFEA 1URXA 3MGUA 5T5LA 4PCRA 3B3QE 4YZ4A 3BIWE 1NQDA 2DUOA 1XYNA 2H0BA 1BYHA 2XVKA 5E16A 1COV1 2AUYA 4OHZA 4H14A 3ZYPA 1AR73 1QJY2 2KA3A 4YNIA 4XTMA 3SH3A 3TRSB 1QY4A 2X5IB 3ZXDA 2GMEA 3V65A 1C5HA 3CF6E 4JV4A 4MV2A 4XIKA 3ZX7A 1PIV2 1U5YA 3I54A 3VKFC 3WXPA 3BOWA 4XBLA 2JKBA 1NZCA 4JGYB 3R4DB 4RS5A 1ZBA3 2AH2A 2HKXA 1NCRA 1OPMA 2X53S 1OI6A 2RS12 2FBEA 3WLUA 3N7MA 4AQSA 2Z69A 1AYN3 4XZPA 2PLV1 2R0HA 1Q8OA 4MXWB 1ZRRA 4XMIA 1LEMA 2RMU1 1FYUA 5JIUA 3WP5A 5J48A 5EXOA 4CDUB 3AFGA 4XMAA 3M8LA 4B4PA 1V9U3 4Q8KA 1W6NA 5L19A 1AR92 4FT8A 2WT0A 4WVZA 4RHV3 1A6CA 1GFF2 4E4DX 5BXXA 1HW5A 2PQQA 4BPZA 1FNYA 2R042 2N7GA 4OHVA 4XDQA 2GU9A 4Q0UA 1C3HA 1QQP3 5ABJA 4M3CF 1AR71 2JENA 4C0BA 2JDZA 1AL0G 5LEKA 1N1YA 1YFXA 3FUOA 4CTEA 1B35A 4FPJA 4QPYA 3WD5A 2B39A 2NYYA 4Q4Y3 3SCHA 2R1DA 4XQ4A 1H1MA 1G8WA 4WBBA 3FFZA 4CDXA 4IV1B 4OI2A 1ZBA1 3AP5A 3CLPA 4LNVA 4C0HA 4CEYB 3MICA 1AYN1 4N43B 2BBVA 4D94A 5FCCA 4D69A 4O9GA 4GKYA 1LGBA 1G9CA 3J9SA 2ZMKA 3SCGA 2Q8OA 4Y22B 1MS4A 1V9U1 2ZGOA 2PAEA 3NW4A 5T54A 3R4UA 4XF1A 3M70A 2C1FA 4H3WA 4RHV1 2YGLA 1HRI2 3ENRA 4Y26A 1GKBA 2D6MA 1D4VB 1RUD3 3LAGA 5K7PA 1QQP1 2ZMLA 1PHMA 4XFGA 3QH6A 4JTOA 2WNVA 1BK1A 3TNQA 2VVFA 3SITA 2X5IC 3ILRA 4LO8A 3I59A 4EWAA 4Q4Y1 2Q5TA 1ZZ6A 4AVTA 1QNYA 1IZ3A 2ZGRA 4YM3A 5H9RA 2B7YA 2ET7A 4JGYC 3U11A 1MR5A 3FZ3A 1D0HA 5D8AB 3DN7A 2R1BA 5KXCA 2PAMA 4DY5A 5FQ0B 3O0VA 1LJ7A 2UY9A 4FP2A 2DU1A 1TE1B 1NXMA 3WNXA 1PIV3 2WT1A 4CDUC 5CVRA 2SLIA 5EV7A 3D0SA 1PO12 2XJTA 3FWEA 1PZ7A 5BNNC 1Z0HA 1F31A 2JD4A 1GZWA 3NV4A 2WNUB 3VDDC 1QJX2 5CNAA 3VBOA 1Q8SA 1DF0A 2RS13 3HQXA 5FFOC 5GLVA 1RUD1 4HSJA 5CADA 1V6MA 3AXDA 3VKOA 2HJIA 5JOWA 1UU5A 2ZACA 5BNPA 2CTVA 3TWIA 4B4QA 4FPKA 5E89A 2AZ5A 4QGLA 1AYM2 1ND3B 1ULDA 1WA4A 2WIIB 5LEJA 1N1SA 2XJVA 2XH6A 1YI7A 3WHUA 3KT7A 2O1QA 2WWSA 3AZVA 4YW4A 3TBDA 1JYCA 4XXPA 3RDIA 2R043 1RUI2 3B69A 3VKLA 3N7KA 2VPVA 3MIBA 1VB4A 3GBWA 4R9AA 4NWVA 1TNFA 5GLZA 4E27A 3VZMA 3RS6A 4K1YA 4PDWB 4HLTA 2WKKA 4Z07A 1ZREA 3H50A 4QQHA 2Z2SB 4WM7A 3LCPA 4Z82A 4YGCA 1PIV1 4HSLA 4L8QA 5LK5A 2TUNA 4QX5A 2O0OA 3S7IA 4WVMA 4URTA 2OYZA 3SISA 1RUE2 1VBD2 2QUOA 2ZGKA 3B7MA 3WZ1A 3THTA 2W68A 2RS11 2DF7A 2CAUA 5F5QA 3RI9A 4OZXA 1S0DA 4MXVA 1B09A 1I3HA 1VIWB 3E6BA 3KCXA 2NQYA 3MLLA 4PJYA 3RZZA 5T5OA 2VNGA 1N1TA 4UW3A 1ZA4A 3NAPC 1SCRA 4RQPA 4COUA 2UURA 3AP4A 4IETA 4FOYA 2ERFA 2WSVA 1HRI3 2CY6A 2E6VA 2GAUA 2R041 2OVUA 3FX3A 4F8AA 1DGWA 1VBA2 2BFUL 4YVWA 3ZFFB 2QKDA 3RJRA 2LUWA 3B94A 3N7JA 1I6XA 3AMQA 4KG8A 4EWEA 1REDA 2VW2A 4YW5A 4E4SA 1ND2A 3LB9A 1LGNA 5J98B 2EXIA 1CAVB 5T52A 2GC2A 4XJ9A 1LRHA 3BPZA 3ZFGB 1UD1A 2WNUC 1ENQA 4AE2A 3BOPA 3IKWA 1D0GA 3MLJA 1GV9A 3LOIA