1EAH1

Pv2l complexed with antiviral agent sch48973
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
272
Chain Sequence
ANNLPDTQSSGPAHSKETPALTAVETGATNPLVPSDTVQTRHVIQKRTRSESTVESFFARGACVAIIEVDNDSKLFSVWKITYKDTVQLRRKLEFFTYSRFDMEFTFVVTSNYTDANNGHALNQVYQIMYIPPGAPIPGKWNDYTWQTSSNPSVFYTYGAPPARISVPYVGIANAYSHFYDGFAKVPLAGQASTEGDSLYGAASLNDFGSLAVRVVNDHNPTKLTSKIRVYMKPKHVRVWCPRPPRAVPYYGPGVDYKDGLAPLPGKGLTTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLIOVIRUS TYPE 2 COAT PROTEINS VP1 TO VP4
publication title Structure of poliovirus type 2 Lansing complexed with antiviral agent SCH48973: comparison of the structural and biological properties of three poliovirus serotypes.
pubmed doi rcsb
source organism Human poliovirus 2
molecule tags Virus
total genus 43
structure length 272
sequence length 278
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1eah100
1E57A 1BEV2 3FBMA 5A32A 1RUH2 5BNPA 3ZFGA 1K5MA 4YVWA 3VDDB 4CDQB 5A33A 1TMF2 1PO21 4FTBA 4Q4V3 2HWE2 3NAPA 2R041 2WS91 4WM8C 1RHI2 4GH4A 4GMP1 4RS5C 1PGW2 1PO12 3VBFB 1ZBA2 4RHV3 1OOPB 2HWF2 1QJU2 1DDLA 1FPN1 1AR93 5C4WA 1OOPC 1QQP3 1RUF1 1MQTA 1C8M2 3DPRB 1RUJ3 3JB4C 1AYN1 1AYM3 3DPRC 2BFUL 1RVF2 1POV3 1NY71 1F8VA 1NCQB 1Z7S3 4JGZA 1NCQC 1EV13 4Q4V1 1B35B 2X5IA 2RS33 1VRH2 1NA1A 3TN93 5J96B 1RUD2 1HRI2 1NCRB 1X33A 1TME3 4IV3B 4Q4V2 1HRV3 1RUI2 1VBE3 1NCRC 5L7OB 4RHV1 4AEDB 4GMP0 1ZBE2 5L7OC 2GSYA 1QQP1 4N53A 4JGYC 2PLV2 3J8F3 4RQPC 2HWD2 2ZTNA 1R081 5DDJ3 5CFDA 1AYM1 5BNNC 2WZR1 2MEV2 1FMD3 1R082 1POV1 1HQNA 2RS11 5BNOB 2WZR2 5BNOC 1Z7S1 3VBSA 2RS12 4WM7A 3VBHC 2RS31 4SBVA 5CFCA 4Q4W3 1RMU3 1Z7S2 4CDWB 1ASJ1 2RS52 1TME1 5D8AA 4CDWC 1AR63 1HRV1 1VBE1 1RUC1 1RB8G 1ASJ2 3M8LA 3VBOB 4CEWA 4Q4Y2 1TME2 1R1A2 1QJX1 4CDXA 1VBE2 3VBOC 1RUC2 1AR82 4CEYB 2R062 5ACA3 3JBG2 4N43B 1QJX2 4CEYC 5JZGC 5DDJ1 2BPA2 5C9AB 4N43C 3ZFFB 2WFF3 1VB4A 4RR3A 3ZFFC 4IV1C 1FMD1 3S6PA 3CJIC 5AC93 2XBO2 3VBUA 1ND3B 1POV0 1ND2B 3JD73 1NG0A 1ND3C 3VBRC 1PIV1 5LK7B 5K0UB 4Q4W1 1RMU1 5BNPB 1PIV2 3ZFGB 1K5MB 4YVWB 5ABJB 5BNPC 1X36A 5A33B 3VDDC 4CDQC 1K5MC 4YVWC 5ABJC 4PDWA 3NAPB 3NAPC 1PO22 1RUG3 5ACA1 4GH4B 1CD3G 5C8CA 2R042 1FOD3 2WS92 1VAKA 2WFF1 3VBFC 5AC91 5C4WB 1PGL1 1MQTB 4Y4YA 4QPGB 5C4WC 1FPN2 4QPGC 4RFT0 4WM8A 1D4M3 1RUF2 2HWB3 4RS5A 1VBB3 3JD71 1R093 1QJZA 2RM21 1AYN2 1OOPA 1COV3 2IZWA 2RM22 2R073 4JGZB 1NY72 2BFUS 1CJDA 1QJY3 2X5IB 1EAH3 1B35C 1NA1B 1PVC3 1RUG1 2X5IC 2HWC3 5GKAC 3ZFEA 4IV3C 4Q4X3 1HXS3 1RUE3 1AR91 1H8TB 4AEDC 4N53B 1H8TC 4RHV2 4N53C 1AR92 1D4M1 1QQP2 1RUJ1 2WWSA 2HWB1 4YVSA 1VBB1 5CFDB 1AR73 4QPIA 4Y5Z0 1R091 1BBT3 1RUJ2 1AYM2 1COV1 2ZZQA 4JGYA 5FOJB 4FSJA 1EV11 2R071 4RQPA 1VBD3 1OPOA 1VB2A 5BNNA 4WM7B 1QJY1 5J98B 1EAH1 3TN91 5CFCB 1PVC1 1EV12 1AL23 2HWC1 5D8AB 2RS32 1MEC3 3TN92 1VBC3 4Q4X1 1V9U3 1W39A 1RUE1 4FTSA 1HRV2 4CDXB 4NWWA 2GH8A 3VBHA 4CDXC 3J8F1 1BEV3 1AR71 3J8F2 5C9AC 1TMF3 1OHFA 4RR3B 1BBT1 2HWE3 5DDJ2 3VBOA 1RHI3 1FMD2 1PO13 3VBUB 2BBVA 5JZGA 1ZBA3 2VQ0A 1ND2C 1QJU3 2HWF3 4N43A 5K0UC 1AL21 4IV1A 3CJIA 1AR61 5A32B 1C8M3 4Q4W2 1RMU2 1VBC1 4EJRA 3ZFGC 1V9U1 2RMU3 4CDUA 1AR62 1RVF3 4GB33 1VBC2 3VBRA 1ND3A 1BEV1 1M06G 5C8CB 4GH4C 3HAGA 5C8CC 5ACA2 1TMF1 4NWVA 1AUYA 3VDDA 2HWE1 4CDQA 1VRH3 5ABJA 1RUD3 2WFF2 1RHI1 1MQTC 1HRI3 4Z92B 1PGW1 1PO11 1VBA3 1RUI3 4WM8B 2DF7A 5AC92 1PGL2 4RS5B 1ZBA1 2HWF1 1QJU1 2Y26A 1ZBE3 1HX6A 2RR13 3VBFA 4BCUA 3JD72 1C8M1 2PLV3 2HWD3 3LOBA 2RMU1 4QPGA 2WLPA 1BMV1 1RVF1 4JGZC 3DPRA 4GB31 2MEV3 1GFF2 1R083 2RMU2 2ZAHA 1NA1C 1BMV2 2WZR3 1FOD1 4GB32 4FTEA 3ZFEB 1RUG2 3ZFEC 2RS13 1NCQA 1FOD2 1VRH1 1RUD1 1HRI1 1B35A 2RS53 1WCDJ 1VBA1 1RUI1 4YVSB 1NOVA 4QPIB 3IDEA 1ASJ3 1NCRA 5CFDC 4IV3A 4YVSC 4Q4Y3 1ZBE1 4QPIC 1D4M2 1R1A3 2RR11 1VBA2 2XPJA 2HWB2 1VBB2 1RUC3 5L7OA 4AEDA 1R092 1AR83 2PLV1 2R063 2HWD1 1H8TA 3JBG3 1QJX3 2RR12 4JGYB 4RQPB 3VBSB 1COV2 2MEV1 3VBSC 5BNNB 2R072 4WM7C 5CFCC 2QQPA 2XBO3 1F2NA 1QJY2 1EAH2 1PVC2 5D8AC 1HXS1 5BNOA 2HWC2 4CEWB 5FMOL 2BUKA 4CEWC 1IHMA 4Q4X2 4LLFA 1HXS2 1SMVA 1RUE2 3VBHB 1RUH3 2RS51 1PIV3 4CDWA 1C8NA 4Q4Y1 1R1A1 5FMOS 1AR72 4RR3C 1AR81 1PO23 2R061 2TBVA 3JBG1 1BBT2 3JB8A 1VBD1 2R043 2WS93 4CEYA 3VBUC 2FZ1A 2FZ2A 5JZGB 4GMP3 5C9AA 1VBD2 1A6CA 3ZFFA 3ZXAC 2XBO1 4IV1B 3CJIB 1FPN3 1MEC1 1RUF3 1AL22 1AL0G 4CDUB 1MEC2 4PDWB 4CDUC 1V9U2 1AYN3 3VBRB 1ND2A 4PDWC 1RUH1 5K0UA 2RM23
chains in the Genus database with same CATH superfamily
1E57A 1LODA 1US2A 2Q5TA 1HIXA 4XXAA 1K5MA 1NLQA 2GC0A 4CDQB 4FFGA 5A6QA 3RVHA 2DUOA 3I3BA 5DAPA 4B1MA 2C4XA 2CU5A 5DZEA 1AZDA 1QOSA 5DUWA 2ARXA 1CAXA 1DQ1A 3EHKA 4NN0A 4H2AA 2OYZA 2PQQA 1PM7A 2PN5A 4XUPA 4WM8C 5FY7A 3ZN4A 5KR7A 1OFSA 1PO12 2E33A 5KHJA 4DZGA 1E5RA 5FQ0A 4XBNA 4UT5A 3PUAA 1BK1A 1OOPB 2VGDA 1QJU2 3FC0A 1UY2A 1YQ2A 3GALA 4JKKA 3V64A 1DDLA 4NROA 5IVFA 1OOPC 2BVVA 1QQP3 2BNMA 2QQOA 4AL9A 3UESA 2WA4A 1F35A 4HLTA 3ZM8A 3ABZA 3CIHA 5LA2A 1OLME 2V4VA 1WMEA 4LO6B 4OUSA 3MPPG 3WDVA 2J7MA 4ZU5A 1LEMA 2BFUL 1SCRA 4D69A 1YJKA 2OQ6A 1JOBA 4XJAA 3ETQA 3KV6A 4OI2A 2BGPA 5FO9B 1S0GA 1AXKA 3Q8AA 1WD3A 5LY2A 3RZKA 3WG2A 3H8XA 5A3UA 1W0NA 3ITQA 2Z42A 1VAMA 1DYKA 4JGZA 1EV13 3K48A 5DABA 2VMFA 3WW4A 4QX0A 4QHOA 1AVBA 3RZJA 1B35B 5IVYA 4LBQB 1YC61 2RS33 3B69A 3N9QA 1SLCA 3ZYRA 2JG9A 2JE9A 1RUD2 4ES9A 5IVJA 3MI8A 3S57A 4QM8A 3BGAA 1K12A 1XNCA 1ACCA 1NCRB 2LRPA 1TME3 2AH2A 2D97A 1RUI2 2C26A 3MDPA 1NCRC 4Q8LA 1UD1A 2NYYA 5FPXA 3AKTA 4NPRA 4O65A 4ATEA 3IMNA 1C57A 5H9QA 2WN3A 5F5QA 3VD7A 5KHHA 2XXZA 3KT1A 5FY0A 4BQ1A 1LGNA 1R081 4BH9A 1XE8A 5CFDA 1V6LA 4NVPA 2BOIA 5APAA 2VZTA 3VHRA 3WV6A 2ZX1A 5FO7B 2ZEXA 3OF1A 4JKMA 4Q1RA 2TNFA 3AKSA 1OVPA 4AE2A 1FMD3 1R082 3JZVA 2GDFA 2JDHA 1ST8A 1HQNA 4PF5A 2IXIA 4P08A 2DFCA 3WF1A 1CX1A 4COUA 4EZHA 3QACA 2EAKA 2JENA 3VBSA 4BXFA 1UPSA 4ARYA 3LFMA 4LA2A 4WM7A 4HZFA 3NNGA 2GP3A 4CCNA 3CO2A 4MHUA 3BPZA 1VR3A 5F2SA 3I8TA 4QB6A 4X8PA 4ITCA 3DN7A 1IG3A 4PQQA 5D8AA 5FRAA 3ZYGA 1AR63 2OKXA 3NNFA 1GWMA 4K9SA 4LKDA 4BU2A 1RUC1 3V0AB 1OVSA 4XEZA 5A6YA 4PCRA 2Y0IA 4RYDA 3VZMA 5A3MA 3ZIWA 3ME2A 3HQXA 2YBKA 3T09A 1RUC2 5JR2A 1YQCA 3HN3A 5F7UA 4K8FA 1WCQA 5CISA 2J1VA 2IXJA 1IS5A 2A5ZA 1UNBA 3EJKA 3WDXA 2QZ3A 1DQ6A 5JZGC 4LHNA 4K3UA 2WFF3 4YZ1A 2XL9A 5A3WA 4LOTA 1UAIA 3RMXA 1LCLA 4KWLA 3CJIC 4XW3A 1RGSA 3H42B 3O0XA 5HV0A 1BHGA 5F39A 3VUOA 4TWTA 1LOCA 1W8FA 2FDJA 5B2GB 2XMLA 3JQWA 4XMIA 5FP3A 5IFTA 3NWKA 3VBUA 4XOGA 2Y6HA 4IE7A 2W1SA 4QQLA 1G9BA 4BZ4A 3RI9A 1PGSA 1NG0A 4LT5A 1Q8SA 1RMU1 1S0DA 4OHVA 3CQOA 3KQRA 3ZSKA 1WD4A 3WCSA 4YZ3A 4GWIA 3ZFGB 3PMSA 2HKXA 5L73A 1XNAA 5ABJB 3N9OA 3ST7A 4BJ0A 2UYBA 3WP6A 4XUTA 5ABJC 3P1IA 5CKNA 4AG4A 1QJFA 1D2SA 2D3RA 1N1YA 1PZ8A 1O6UA 1YCIA 2R1DA 3NAPB 3OGSA 4LO5B 5FYYA 3BN6A 3RJRA 1DQ4A 2WYFA 3NAPC 1PO22 2ZGSA 3IMMA 4UAPA 1IPSA 1LHUA 2JICA 3OY8B 4GH4B 4QB2A 4YYOA 2YHJA 4XFFA 4MGYE 1FOD3 4R9CA 4Y24A 1PNFA 2WS92 1UYXA 4CSWA 4CUAA 1XYOA 4Z07A 3IN9A 4YW5A 3VBFC 5A1AA 5I8YA 3FHIB 3ALQA 5FZGA 1A3KA 3B9IA 3AJYA 3POSA 3WXPA 3OD4A 3ZSMA 4TLFA 3SCHA 1PGL1 4AXOA 1MQTB 4Y4YA 4HT1T 3MLKA 1PK6B 5JPMB 3GZAA 4JC1A 3GM8A 4LOSA 4RFT0 2BRTA 3J7MA 1UOFA 2ORZA 3I2DA 4M4RA 5CKMA 2W92A 3T08A 2H0VA 3U14A 1R093 3CBNA 4I09A 1QJZA 4M3CA 5FY8A 1EUTA 3TBDA 1DLCA 5TSWA 2IC1A 1O59A 1XB9A 1ALYA 3BTAA 3CKHA 3QLQA 4S2FA 3Q8CA 1JZ2A 1GQGA 2R49A 2WAOA 3TB0A 1NX9A 3H8RA 2RDQA 3I2FA 4MXVA 2R073 2W39A 2D3PA 2P6CA 3FLRA 3GBFA 3GZUC 1AHSA 3JU9A 4FQZA 4LE3A 4UOJA 4YW6A 1VLNA 1QJY3 3ECQA 2VM9A 4FT8A 2R0HA 1W6NB 2PQSA 1I5PA 3WW1A 2HWC3 5IK7A 1W04A 4CPBA 3N4MA 1HB4A 4N7IA 1N1VA 4EZ4A 2IXLA 1TG7A 1N47A 4XDQA 1SLAA 2MPFA 1JOJA 2P34A 3WT3A 2XWBB 4E9KA 4Z2WA 2ZMLA 2WNUB 2Q30A 4M00A 2VTXJ 2WWSA 4O9EA 1V6MA 2HWB1 5SV5A 3LSEA 2WNUC 1AR73 4HETA 4MUVA 5H9RA 5IW0A 4DXZA 3GHMA 4NPMA 5FXZA 2A6XA 4FPJA 1XU2A 2PAEA 2RJKA 3PDQA 1VRBA 5FZMA 1BBT3 2YFZA 3AZWA 1AYM2 4BE3A 1JH5A 2QDNA 1WLDA 3GCWA 1COV1 4LUMA 4JGYA 4Q0QA 1UOGA 4BB3A 5F32A 4UYBA 2ZEZA 3APBA 3AL5A 4Y20A 1DCSA 1Q8OA 4LK7A 2WNVC 3U1XA 5A3TA 4ARXA 1EAH1 3AP6A 4WV8A 1GV9A 2FCTA 3TN91 1MS3A 2UWAA 3W20A 4BA6A 5LASA 2W68A 5LB6A 3THPA 4DXRA 2VG9A 3VL9A 1MEC3 3I2JA 3TN92 1CONA 3LEIA 3ILRA 4XBLA 1ULDA 3IDAA 1RUE1 1YFXA 4GULA 2EIDA 4HL0A 4KGQA 2D6PA 1HRV2 5FZBA 2BOJA 2VZQA 3AYDA 3PU3A 4YM3A 4YZ5A 3RZGA 4QT6A 3DV8A 4ZHNA 4XDOA 3I59B 1REDA 2DWRA 1S0EA 2H6CA 3SITA 2JG8A 4LKEA 1Z78A 1ZRFA 4V1PA 3C3VA 3N9MA 5FYMA 4FXGB 5DDJ2 1SLBA 1UW8A 3BOWA 3VL8A 3WP5A 1K5JA 2B9UA 3BODA 3VBOA 2BERA 4CCOA 2XB6C 3DUIA 1PO13 2D6OX 2ZHNA 5FY9A 1ZA7A 3HQRA 5FPVA 3NQHA 4CCEA 4AEMA 1JYTA 3OBAA 1E5IA 4XTMA 2VQ0A 5J36A 3O14A 4D3WA 2JIGA 1QJU3 3H3LA 1DYPA 5AFEA 3H3UA 1MR5A 5BPXA 1OFNA 3THDA 4GXLA 2ATFA 2ZHLA 5HCHA 4PBPA 5C33A 4Q4W2 1F4HA 4AGVA 1UKGA 4EJRA 1V9U1 2RMU3 4MGZE 4LE4A 3HEIA 3H50A 1Y43B 3FE5A 2XWJB 5E6HA 1ND3A 1ENSA 1N3OA 1TZOA 1BEV1 1M06G 1LOEA 2ZMNA 1DU3D 1VMHA 3OB8A 4GQ7A 4E4HA 5A70A 1QHDA 4MADA 1N3QA 3HAGA 2QKDA 1TQ5A 4I0AA 5L36A 5CIRA 1AJOA 3EYPA 4MGQA 1QJEA 1MS9A 2ZGTA 1XBFA 4NWVA 2RE9A 5FYSA 1NZIA 1CIYA 4JV4A 2Y6LA 2XJQA 2WKKA 4Q29A 1UQXA 1RUD3 1XNBA 4C1XA 3S7EA 1KGYA 3A4UA 3JXSA 4L8QA 3ASIA 4Q1PA 3GCXA 1PGW1 4E4DX 5AC92 3WP3A 1RUI3 4HN1A 5FK8A 3BKZA 2H0BA 2JDPA 1W6MB 3N9LA 1O3QA 1WA4A 5FREA 4CVUA 1HX6A 5KWRA 1LB2A 2JDZA 2XQXA 3AMPA 2P5BA 2BJSA 1U5XA 2QJVA 2VXJA 3NO8A 2JKXA 4J1XA 4FP2A 3HVDA 1ONAA 1OD3A 2ETEA 2VBPA 2YDEA 4QPGA 4YFWA 1IGOA 2GH2A 3WR0A 5J1XA 1DGLA 1RVF1 3DPRA 1YRZA 4V2WA 3T2PA 5FK7A 1IQDC 4NAOA 3V0BB 2JWPA 1R083 3E5UA 3B5LB 4ZKTB 3O0WA 3DKWA 3PL0A 4EV0A 1CIWA 3WDTA 1OQ1A 2W1QA 3ZKYA 2Z79A 2CTVA 2YFUA 2C0ZA 4GJYA 1OPMA 3OEAA 1RUG2 3S30A 1OD5A 4LIVA 3AYAA 4CUBA 2VUCA 1LHNA 3USSA 1NCQA 2Q8EA 5FYUA 2V4AA 3KQ4B 1VRH1 4YARA 4F83A 4WVMA 4OZOA 1ULOA 5T5PA 5IWFA 4UWDA 3LWCA 5GALA 4BQWA 4E8CA 4PLMA 5FUIA 3VD4A 1VBA1 1SFNA 2BP6A 1XQNA 3KMHA 3IPVA 4QPIB 3ILFA 3ZSLA 3IDEA 3SNMA 3UKNA 2PHUA 3F95A 4IV3A 1X8MA 2ZBJA 3E6DA 1ZBE1 4QPIC 4XETA 1VBA2 2GMEA 1MS0A 1RUC3 1UF2C 4C90A 5L7OA 4AEDA 5F2WA 4CZSA 2PLV1 2Q0AA 4GWJA 1HN1A 1OA4A 3SXWA 5JXJA 4P9GA 3BTYA 4RQPB 1KFUL 3U0ZA 3SHRA 5D1IA 3MUY1 4JDOA 4IUGA 4HK8A 3J7NA 4AW7A 2OX0A 4RN5A 3HNMA 4H3WA 1UZ0A 2GNDA 2GN7A 3L2HA 4A7YA 4P5YA 3TEZA 5FZ8A 4YNIA 2DTWA 5CFCC 2QQPA 3L9JT 1QEXA 4V2VA 1F2NA 4Q5OA 3UETA 2F6BA 4OHYA 3M2MA 1PVC2 2WWUA 3IKWA 4LO4B 4Y1UA 4BOWA 4COZA 3POWA 4PT6A 5BNOA 5FZEA 2BUKA 3A23A 5FYCA 1I3HA 5L9BA 1SMVA 4PLNA 2RHPA 3VBHB 4CCLA 3I49A 3BIEA 2XJVA 1FV3A 3FX3A 1D0HA 3H9AA 4CDWA 4BQ4A 4ISQA 1KFXL 4IGPA 2YB7A 2YU1A 5EYXA 2W2IA 4L2NA 2VNGA 1C8NA 1ULGA 4PHZA 1G8WA 5I0TA 1O3RA 2XVLA 3UKVA 4RR3C 2CDPA 1PO23 1DBNA 2R061 4B29A 2IXHA 3JBG1 2LALA 4B7KA 3ZSEA 4A2UA 2WS93 4WVVA 2N7GA 3DL3A 4P9YA 3BVCA 3ZN6A 1CAWB 4XAAA 4AHXA 3WCRA 4OZXA 5FKBA 5C9AA 2E31A 5JVVA 3GNEA 3UT0A 1ZVFA 1JZ7A 4ZZ5A 1PZ9A 2ZGOA 4XABA 3ZLIA 4JQTA 3ZXAC 4ORFA 1WZXA 4IV1B 4XQWA 4OUEA 2V5DA 2UY8A 4AHZA 4KH9A 1RC6A 1DFQA 1X50A 2RDNA 3ZVXA 2YC4A 1AL0G 1U5IA 1UY0A 4OUMA 4AVAA 4CDUB 2DBNA 1ZZ6A 1H0BA 4S2DA 3NJYA 4CDUC 3FLTA 3MEPA 4A7ZA 4DINB 1GZWA 4YWAA 1SCSA 3WDWA 5LZ6A 5K0UA 4F3JA 4FPHA 2E7QA 4GZ9A 4FAGA 3POIA 2G1MA 3KHCA 4NIGA 4B4QA 1GZCA 1ZNPA 5T3NA 4CP1A 1K45A 1J1TA 4QHZA 5T52A 1UO9A 5K8SA 4YSFA 1RUOA 3VDDB 4FP3A 4I01A 4IEOA 1DQ5A 2X09A 1TMF2 3LAGA 3N9PA 3AVRA 1O5UA 3TYJA 1W2OA 3I3DA 3WF0A 4A45A 5FBZA 5JXIA 4LBNA 2HWE2 4Q4V3 2YG0A 1UOBA 1YLLA 2VL4A 4BPZA 4BLIA 4JX0A 1NE6A 1S4CA 2WT0A 3ACIA 4MX3A 1RHI2 5JCTA 1WCKA 2ADDA 5FZ7A 4RS5C 2HEVF 3OBTA 2NPIA 2ZX3A 5DG2A 1J3QA 2CSGA 2WQZC 2WQ4A 1JHNA 2QQWA 5FMDA 2HWF2 5GLWA 1QNWA 1FPN1 2VD7A 2XVKA 2BGCA 5AVPA 1OC1A 1O3SA 4DRRA 5JIAA 2LROA 1F5JA 1I5ZA 4IETA 5GZEA 4NUBA 1CAUA 4HANA 3JCIA 1JYVA 3R4DB 4BIFA 5DZFA 4AFMA 3AL6A 1OMIA 1SACA 3DEMA 1AYN1 4IDZA 1AYM3 3POEA 4DUWA 1JYXA 2OQ7A 2GZWA 2DVAA 3KLSA 4KU7A 4P5HA 3VHOA 3B93A 4D6QA 4QQ2A 1RJ7A 1POV3 3TEYA 4XFCA 2W94A 1NY71 2I45A 1DQ2A 4NHMA 3UGHA 1TVGA 4UBHA 2HYKA 3NV4A 1W90A 3U11A 4R9DA 5FYTA 1PMHX 1SFYA 5A1LA 2X5IA 1NA1A 2ERFA 3TN93 2PFWA 4AEJA 4OI4A 2OIIA 4A3XA 2BVBA 2E7AA 1LENA 1IZ3A 1WLTA 1X33A 5JR7B 3VD9A 1HRV3 1VBE3 3LFIA 2CHHA 4BM8A 4XJ8A 4RHV1 2KA3A 4UFHA 4DFSA 4GMP0 3VZJA 3GZEA 4N53A 5JUVA 4XE9A 3WOGA 4Q2FA 2MHFA 4QGNA 2P17A 2XJRA 4MLOA 4W8JA 5FPBA 2JB8A 2HWD2 2VAUA 5T50A 2RJ2A 2A3XA 3WG1A 4DEVA 3N7LA 1QU0A 2YXSA 4IE5A 4QGMA 5DDJ3 1C5HA 4F7ZA 5BNNC 5IK5A 2WWJA 2A71A 2NP0A 1UZVA 2WZR1 2YBSA 2ZX4A 4QKBA 5A3LA 2B45X 2FDHA 1JXNA 4ZS2A 2ZEYA 3SH3A 3WHTA 4ASLA 1W8OA 2RS11 4FVVA 1FXZA 2E51A 2WZR2 2JIJA 2W9XA 4MGTA 4LPLA 1Z7S1 1W06A 1GANA 2QQJA 2ZACA 4KI5M 2RS12 3C7GA 3IB3A 3WNKA 2JKBA 3ORJA 2VZOA 2A3YA 4Q4W3 3WD5A 1Z7S2 2VBDA 2ZXQA 2O0OA 1ASJ1 4CUCA 3ILNA 1O3TA 2XHNA 4DXTA 5DAVA 2VCCA 5FZIA 5CG9A 1RTVA 3AB0A 3N3HA 4C1WA 1NUKA 3MW3A 5DG1A 5FLIA 4CU7A 3BCWA 3CHXA 1ASJ2 4P9IA 3LIGA 4URTA 1VMJA 3MV11 4J1WA 4Q4Y2 3X29B 1N1TA 2D44A 2Y6KA 3O12A 2ZX0A 2YZ4A 4HPKA 4AK3A 2VW1A 3NKTA 5CADA 3ZXGA 1AR82 1ZZ7A 3ZYBA 2O14A 4CEYB 1PZ7A 1V6KA 4N43B 4CCDA 2Q8DA 1RL3A 4CEYC 3GBWA 1UIKA 2WO2A 2BPA2 5GLZA 1XC6A 3M3CA 4N43C 4X6RB 1UXXX 1W9FA 2B4KA 4HVQA 2VZ3A 1UY3A 1VB4A 1RJ8A 1UU6A 2A1XA 3HWJA 4ONUA 3VD5A 5AC93 4L9BA 2H6BA 2XBO2 2HYXA 5DAQA 3WG4A 3F2ZA 1E5SA 5A7OA 3ZPYA 4AI1A 1GMMA 3AZZA 1ND2B 2CNAA 4LEJA 5T54A 3I97A 3VBRC 1WBLA 2IUWA 3O1VA 2QVSB 3IT8A 5KXBA 2XR4A 4EN7B 4UF0B 5FZ9A 4EWDA 2PMWB 4A42A 3Q8EA 1JZ8A 2Y8KA 2VNOA 2BWAA 1K5MB 4MO3M 2QDRA 1X36A 4CDQC 4LHKA 1K5MC 3SC7X 2ET1A 4EYUA 1JTZX 2IFRA 2XKOA 4PDWA 1H6YA 1MPXA 1V6IA 3FFZA 2HJIA 1W6OA 5GZDA 2ID4A 5GZGA 3KWVA 1RUG3 2AYHA 2EF6A 4O61A 1OT5A 5C8CA 1HJFA 1YFUA 1W0OA 1W9WA 4KWKA 4R9AA 2ORXA 1VAKA 2ZGNA 5FQ0B 2D40A 1OA2A 4W6YA 4XCAA 4B1LA 3ATGA 2QBXA 3LKJA 1H2NA 1UU4A 1UX6A 2VMEA 1GNZA 3MIGA 5F37A 4LR4A 4HN0A 1Y9GA 5JWPA 1T6BX 1O5LA 4HBNA 4WM8A 2YC2A 2ET7A 1DLLA 2ARBA 3NMBA 4Y1ZA 1SLIA 4COWA 3JD71 3KGLA 4FFFA 1S1AA 1BVP1 1O4YA 2E26A 2RM21 3N7KA 4QGLA 1D2QA 2VJXA 2C9AA 2DV9A 3MF9A 4XYXA 3LPFA 2VECA 2ZGPA 2K9ZA 2WT2A 1OSGA 1XU1A 4XVHA 2DVDA 1OOPA 2FMYA 4DB5A 1UYZA 2RM22 3MIEA 5FBJA 4FOVA 2NN8A 3DXTA 3KF5A 3AK0A 4YW1A 3SH4A 1JYIA 1C1FA 1YUDA 2AGSA 4JGZB 4Q0UA 2BFUS 2P3KA 1CJDA 2VULA 4CP2A 2P4EA 5I93A 5I0DA 4DPNA 2ENRA 1KJLA 1B35C 1PVC3 5H9SA 2JG9B 4AZZA 3FJSA 5A1FA 1GU3A 2CAUA 4NE9A 3WLUA 3OJBA 3O0VA 2WNOA 4AEKA 1Y3TA 5FZOB 1AR91 3ZXEA 4YLZA 2GN3A 3V65A 1V00A 4N90A 2YGMA 4CXXA 1XNDA 1AR92 1LKNA 1D4M1 2FDGA 4YVSA 1VBB1 5CFDB 1JZ6A 3NJVA 4SLIA 4Z8BA 5CU1A 5JXGA 5CBLA 5EV7A 1FYUA 3L2YA 2OZJA 3FL7A 5FZFA 4XDPA 3NVCA 2VMGA 1P8JA 2WFPA 4QHBA 2JD9A 2Y6FA 5LA9A 1LAJA 2A7AA 2W5FA 3NKGA 1DP0A 1SEFA 4DQAA 5JXHA 5FOJB 5JPNB 5BNQA 1VE0A 2CYFA 3ACHA 4W6XA 1KDMA 4YGCA 1XSQA 1VB2A 2D7FA 1EY2A 3BALA 4LTAA 4PF1A 3WNXA 3DYPA 4WM7B 2PELA 3HQUA 4RSUA 2F4LA 3SMHA 3AP4A 3OGGA 1V6OA 5JOXA 3WQ7A 3GF6A 5D8AB 1ZRDA 1LJ7A 2LM3A 5FLHA 2VY0A 3GJAA 3MW2A 4Q4X1 4C8DA 1IG0A 1PM4A 2BEOA 3AKPA 3D82A 4R8HA 3TAYA 3W5MA 2ADEA 5L9VA 1XOYA 3WY6A 2OA2A 4FPCA 4PI0A 5A6XA 4GKYA 4W6WA 4EWAA 2I2SA 3DCQA 1DIWA 4QAWA 3POGA 3IDCB 1M4WA 4META 3PHMA 3K4AA 4OHZA 2OVUA 5GLTA 1TMF3 5IFPA 5LA0A 1IPJA 4Y22A 2WINB 2DUQA 2HWE3 3VKMA 2QQUA 5G05L 2BGOA 2OPKA 4O7XA 1CPMA 4QDSA 1RHI3 5E89A 4ET7A 3RZMA 3SISA 1VALA 4XJWA 1W9SA 1CPNA 2VTXA 3B3QE 3ZIXA 3ZYIB 4E2QA 3VBUB 4XJUA 5HI0A 1LULA 2PAKA 4AQ6A 5JZGA 2X8KA 3LEMA 2HWF3 4D7TA 5LY1A 5JOYA 5CG8A 2IVJA 1ZX5A 2NMNA 3MYXA 3SEPA 1AL21 2JDMA 4LORA 4RD7A 2UU8A 3CJIA 5A32B 2B5HA 4FPKA 4P9JA 1RMU2 1VBC1 1NKGA 1WW6A 1BXHA 3ZFGC 1AX1A 4PI2A 1H4GA 1OLMA 5HXVA 3RGBA 3T4VA 3B00A 1ENQA 3TRSB 4OMCA 3A22A 4E2SA 1VBC2 2WO3A 2EALA 4CU9A 1S0FA 2VVEA 3KM5A 3OYWA 4Y20B 5CFCB 1KDKA 4JCKA 4GH4C 1KXGA 2EIGA 3LA7A 3NNMA 5IYYA 4LK6A 1IKPA 3ZYPA 3LDRA 5ACA2 2O8QA 1MS8A 4WVWA 1JI6A 1UIJA 2YMZA 4OVEA 5JAXA 1OH4A 5ABJA 1A34A 2Z69A 1E5HA 1YI9A 3ON7A 3UL2A 1MQTC 3OUHA 2Q8OA 2W47A 4WZFA 1PGL2 1PK6C 2DF7A 1WWYA 5FZ4A 2QQLA 4EQVA 1ZBA1 4X8NA 1OI6A 3OY8A 3A21A 4JKLA 4UXAA 3AVSA 4MOAA 1GOHA 2RR13 4TLGA 3IBMA 2ZHMA 4IE0A 5L9RA 2EVXA 3MGUA 3MLLA 3VBFA 1S0IA 1UPIA 2ES3A 1PX3A 4FOYA 1C8M1 4WZCA 5LRRA 1OA3A 2XUEA 4HSLA 2HWD3 3P3NA 4JDNA 4XURA 2GC1A 5F3EA 1OF4A 3AYCA 4JTNA 1MZFA 1ZZ9A 4OI1A 1BMV1 4BIOA 2RVAA 5E1RA 5J3UA 3RWKX 2DUPA 4GB31 5SV8A 2K0GA 1NAEA 2W87A 3O1PA 4XILA 4AYUA 5C3RA 3PJQA 4XUQA 1VP6A 3WVJA 1JYNA 4LNVA 1A8DA 1BMV2 3U07A 2WZR3 3LEKA 1A78A 4GB32 4KL1A 4QX8A 3A0KA 4FTEA 4ZONA 4RL7A 1C1LA 1GOFA 3Q9OA 5KHGA 3TEWA 5JOZA 3VZLA 3VN4A 2RS13 4IEUA 1OBNA 3SKJE 4FXKB 1OXCA 1LHWA 4ES8A 1HKDA 3W5NA 5F6LB 1N1SA 2G19A 1GQHA 2XL7A 1MACA 3QD6A 1QOOA 4LBJA 1HRI1 4LJHA 3USUA 2G4IA 1CESA 2BTVC 1YEWA 3K46A 2VVDA 3MUZ1 4CU6A 1EP0A 3GGLA 5FLJA 4IGQA 3ZSJA 1HV0A 1ASJ3 1FATA 1MS4A 5ANNA 5FUPA 2W0XA 3PU8A 4Q4Y3 4KWJA 4Y5SA 1L7RA 2HWB2 2VQAA 4AQSA 1DYOA 1AR83 4D7SA 1QH7A 5E88A 4LBMA 2ZGRA 4JGYB 4QU1A 3LA3A 4NIDA 3E6BA 2WSUA 4CXYA 1IKQA 2WAAA 1COV2 2WQ8A 2JJ6A 3LGRA 4M3CF 2WNUA 4YG6A 1NXMA 2MEV1 3MZHA 3H1WA 3MF6A 1W3XA 2ZGKA 1UZYA 3PUIA 2VW0A 1JZ3A 1PMIA 1HQLA 2XBO3 2PHFA 4N8MA 4YGEA 4BK5A 2J1EA 5BY5A 1EAH2 5F6KA 1XNTA 3H8UA 5FYBA 2B7YA 5K9YA 4K20A 4XQDA 1STMA 1ULFA 5A7WB 2CDOA 4AFDA 2VVFA 4XCBA 4CEWB 5JMCA 5DAXA 1OQEA 4K6BA 4CEWC 1IHMA 1LHVA 2WNVA 1RUE2 5FZDA 2RS51 1LOBA 2WJSA 4HKLA 4AWDA 1H1AA 2JG8B 3I3QA 4UI9L 4DEQA 1G9DA 1R1A1 5FZ0A 2PTMA 1UCXA 3C7FA 4XPVA 2C1FA 3VKOA 3RPQA 4TN7A 2EIEA 1C5IA 2TBVA 4YZ4A 2IXCA 3JB8A 1SLLA 4FAHA 4CP0A 5DPNA 3MFCA 2SLIA 2FZ1A 1ENRA 2PA7A 5T5LA 4H7LA 3KVBA 3HT2A 1LTEA 1A6CA 3CEWA 2O1QA 3ZFFA 2TEPA 1L3JA 1W2UA 5IK4A 3MLJA 4UFKA 4F8AA 3LZZA 5FPLA 5FTTC 5C5TA 2JDNA 4XFHA 2YBPA 4QXCA 1NYWA 1CQ9A 2CWSA 4I02A 3WINE 2E6VA 2WC2A 4DIQA 3SCFA 4IEYA 1FT9A 4LIUA 4WVZA 2CAVA 1V9U2 4KMQA 1WCSA 4UFLA 2XVGA 4A3ZA 4MXWA 3W58A 3M3EA 1RUH1 4NHLA 3SQOA 3AM2A 2RM23 3N7MA 4NHKA 2XQRA 3AFGA 4FI9A 5EFUA 3HN1A 1K42A 4L0PA 1BEV2 2R30A 3FBMA 1ZZBA 4W50A 4QXHA 1RUH2 5BNPA 1SBEA 1KD7A 2NMOA 1UY4A 4YVWA 3LDKA 3OGRA 2CV6A 5A33A 4R4ZA 3PVNA 1Y9QA 1QDOA 3KCYA 5DXDA 3U75A 1AXYA 3CMGA 5FP8A 5JI7A 4MG2A 2R041 3UGFA 4H7MA 4UFIA 3R05A 1NQDA 5EHDA 5K4LA 1Q8VA 4GMP1 2QCSB 1UN1A 1PGW2 2Y33A 4Q0SA 2BWCA 1CGPA 5LEKA 1F15A 2P1BA 4Y5TA 1O8PA 2DDUA 3OCPA 1WUVA 1AR93 5C4WA 3M1HA 1RUF1 4A41A 2R1BA 4XIOA 5C8WA 4LLOA 3DPRB 3AKRA 1JMUB 3HD8B 3JB4C 5F3IA 3DPRC 3C7HA 1R1ZA 1RVF2 3VZOA 1J1LA 1BZWA 1OLRA 3I7DA 1SZBA 3ZN5A 3OOXA 5LK5A 4CCMA 1F8VA 4UW4A 3FWEA 3K77A 4XTPA 4G9SB 1NCQB 3CLPA 1G6NA 4CCKA 4XC9A 3W21A 1NCQC 2Y34A 4WVMB 3WNMA 2WZPP 5KC5A 3LPGA 2P3YA 1H30A 4Z1VA 5HPOA 4AI8A 1VRH2 3N35A 2R7EB 3QOPA 3FZ3A 1Q3EA 1HQWA 2NZ9A 3JQXA 4IE6A 4IV3B 4CCJA 4AI0A 4D6SA 1LOFC 1Y4WA 2WSVA 1AF9A 4FCAA 2JXAA 3KT7A 2V73A 5L7OB 4AEDB 4QQOA 3RQ0A 1ZBE2 4DUVA 5L7OC 2GSYA 2ZGQA 1QWRA 1CZSA 1QQP1 2D3SA 4PBOA 4XAEA 2VNVA 1ULCA 3MIBA 2YC0A 4MGSA 4AHWA 2PLV2 4RQPC 1W9TA 3VDCA 3WUDA 4E2GA 2PYTA 1J59A 3PIGA 2Z5WA 1YI7A 3NSTA 4Y33A 2KD7A 4ZU4A 5B4NA 1CJPA 4OI0A 2B46X 3OBZA 3OEBA 5C70A 2KR2A 2VZ1A 4Y4RA 1HB3A 4LO8A 3DF0A 1ZZ8A 5BNOB 3RZLA 1W3VA 1WW4A 2BQPA 3J9SA 5IT6A 5LWBA 3UK9A 3CJXA 5BNOC 5FYHA 2G9GA 2C9KA 2V09A 2AUYA 4IQPA 3OBRA 5HXMA 2HBUA 2WBKA 2ZX2A 2RS31 2YV8A 4SBVA 3THCA 3VBHC 5CFCA 4GA9A 1RMU3 5HBAA 4CDWB 4RA0A 2QQMA 3D3AA 5BYNA 1EYBA 2UY9A 3UJOA 4CCCA 4P9XA 1TME1 2ZOEB 4CDWC 2Y60A 3ZXJA 4NO4A 2JD4A 2QQVA 2VR4A 1XNKA 2P6HA 3M8LA 1AX0A 1FX5A 1QKQA 1I9RA 2PXJA 4K8RB 1TME2 4BQ5A 1QJX1 4CDXA 4YRDA 4B8EA 1NXD1 2Q1MA 4YM0A 3MBWA 3GXUA 2R062 1SPPB 4B3NA 5ACA3 5LCWL 3JBG2 5A7PA 2XLAA 1QJX2 1YQ8A 3ZN6B 2FDFA 4RGAA 4K7JA 4PIXA 5C9AB 1QOTA 5F1RA 3ETPA 5FV3A 4OHWA 3ZXDA 2WDBA 4RR3A 4GD4A 4EROA 4IV1C 1FMD1 1LR5A 3S6PA 2E32A 2FD8A 1CN1A 4FPEA 4JDMA 2CGNA 4OYUA 3AC0A 1HLCA 5D2AA 3SEEA 1JW6A 4YW3A 4B7EA 1C4RA 1SDWA 4E27A 3DYOA 1H8VA 4XFGA 1J83A 5FYIA 1GQPA 2BYVE 2D6NA 1DGWA 1US3A 1POV0 2BDRA 4JVAA 3MO4A 4AGGA 4EWEA 2PHRA 3AYEA 1GZWB 1PIV1 5LK7B 3BTXA 4CA9A 5K0UB 1H4HA 2A70A 4AVSA 1Y7BA 3FUOA 2GNMA 1LOGA 1BYHA 4Q0PA 1GICA 3IDBB 3WW2A 3SKVA 1PIV2 4QX7A 5GZFA 4E4SA 4LULA 3C7EA 2XOMA 2JB4A 2VOVA 5ERLA 3VDDC 4IEZA 2ZZJA 3UKTA 3I3EA 4Z2AA 5LRSA 5FPAA 3MW4A 2L9LA 2DCYA 4K40A 1W0PA 3PTRB 1GNHA 4GWMA 4RGKA 4QMAA 3FMGA 4M0HA 4FOQA 2W1UA 1JYWA 3ROUA 2ZEWA 1LHOA 4KQ7A 3KGZA 2A6YA 2GNBA 3LD8A 1JODA 1Q43A 3I2GA 5CVRA 4DO0A 2VBBA 3O1TA 3KS7A 3PVEA 2E63A 2EXIA 5FMCA 2WFF1 3PVBB 1QXJA 1QH6A 4H14A 4CP9A 4YFZA 1KQRA 4IE4A 5DMYA 1DZRA 3E5XA 4FFHA 1T2XA 3WZ1A 2K46A 3ZXKA 4CPBD 3HBKA 1W03A 4FQ4A 4CE8A 4XF0A 1CAUB 2UURA 3ZDSA 5LA1A 4QQPA 5A6ZA 1FPN2 2Y0OA 1L7LA 5FKCA 1J84A 4QXKA 2VZUA 4XUOA 5GJ6A 2HWB3 2DVGA 3J7LA 1PVXA 4LKFA 4QWNA 4RS5A 1FAYA 2BU9A 4FPOB 1EUUA 3ZXLA 1AYN2 2J1SA 3G6JB 4AF9A 4BWOA 2YU2A 1COV3 3CL1A 4U2AA 1NE4A 1SDDB 1YHFA 1ULPA 2D43A 2IZWA 1ODNA 2C24A 3FLPA 1CZVA 3ZYFA 3MHZA 1OQDA 5I0UA 1NY72 1X9TA 1GSLA 4YZ2A 1H2LA 2ZAAA 5HCAA 1OUXA 2QQKA 1FNYA 1W6QA 1EAH3 2X5IB 1H9PA 3LA2A 1NA1B 1DGRN 1GYKA 5AVAA 3O5SA 5IK8A 2B39A 2X5IC 2WL1A 1NT0A 1A8MA 3OGJA 5GKAC 1JU4A 1YO8A 4A44A 3ZFEA 3DYMA 4UBGA 1G9FA 1RUE3 3H8OA 4TXWA 1DHKB 4KNCA 1H8TB 3VDBA 3S7IA 2OT7A 4N53B 1H8TC 4YG3A 3D6EA 4RHV2 2VOTA 1LU1A 1HJGA 2GC2A 2VQTA 4N53C 3O1SA 1RUJ1 5CA6A 4YGDA 2A3WA 2ZA9A 2NM1A 4Y5Z0 1R091 2DURA 3PVOA 4AFAA 5BXXA 2VH9A 2QUOA 3CZJA 1GNYA 4ISRA 4YM1A 3OUIA 1RUJ2 5FZCA 2RDSA 3AKQA 4KWUA 4HONA 5LEJA 3MPBA 1H2KA 1RIRA 2ZZQA 4BISA 2X29A 3ZOIA 2JDYA 1V0AA 4COVA 3IIIA 2R071 4RGGA 1WMDA 3D8CA 1H9WA 2JDAA 1SQ4A 1W8UA 1G7YA 2DVBA 2EICA 2JECA 3B7MA 1XSRA 3ACFA 3T2TA 1QJY1 5J98B 5BNNA 2BV4A 3MIHA 1YIFA 3VZKA 5IVCA 4OFGA 4AI3A 2HWC1 1BK0A 2WIIB 2QTWB 4AHYA 5A7NA 3PIJA 1EPZA 4PIZA 3WG3A 1V9U3 3M4FA 4HK9A 4DY3A 4FPGA 1CAVB 4D0QA 1IPKA 4FPLA 4HFSA 3SLIA 4HPKB 2XHKA 5KXCA 2GH8A 5JOWA 1RUNA 2ZGLA 1O8SA 3KV5A 3J8F1 1BEV3 4U36A 5I91A 3EO6A 3OPWA 2WA3A 4TSVA 2W91A 4DUXA 1AR71 4AI9A 2BNOA 1WGPA 3J8F2 2HEYF 1OHFA 2P3IA 1W05A 3KB5A 1BBT1 5KBFA 5FYZA 3RJ2X 1NLRA 1DZTA 5FXVA 1UOJA 3GYDA 4A4AA 3RWNA 1YQ6A 1J3PA 2ARCA 1W6PA 5LBEA 5DZGA 2BBVA 2I74A 2Q4SA 2Y6GA 3VHPA 2WABA 1LESA 5A80A 5M0TA 1ND2C 4N43A 4HMZA 3NW4A 4KBBA 1YNAA 3OUJA 1JUHA 3S5AA 3FUQA 2VUAA 4NRPA 1ZREA 3OG2A 1CVNA 3J26N 4S2GA 4NHXA 1PX4A 1RINA 3D4KA 1FNZA 1YXWA 3PTYA 3ES4A 4N9IA 3WNOA 5D21A 3NNLA 1RVF3 4IEWA 4YW2A 1CAXB 2J1TA 5J09A 3WW3A 4TZDA 3VBRA 1W6OB 5EP9A 5LW9A 3HNYM 3QCWA 5F5IA 1AXZA 2ZHKA 1IS3A 4AVBA 3LF7A 5C8CB 3A0NA 3NRUA 4QQHA 1SBFA 5C8CC 1J58A 3JUUA 3KV9A 4EE2A 3OPZA 3GHNA 1AUYA 4CDQA 4BDVB 3DGTA 1VRH3 5DUUA 5E8AA 4Z82A 5F5AA 1JBCA 4IEPA 4R52A 5KHIA 4IESA 2WYSA 4DNYA 4NIHA 1WLCA 4O9GA 2VOWA 3KF3A 1PO11 1VBA3 4JQRA 4WM8B 2GC3A 1H1MA 1S2EA 2VZRA 2NLRA 2YY1A 4QX2A 3U4XA 3ZX7A 2YUEA 2Y26A 1QJU1 4AVTA 5I0RA 2WUHA 2W95A 1ZBE3 4H55A 2VXRA 5HV4A 1IS6A 3JD72 2DVFA 1DGRA 2PLV3 3AJZA 3K75B 1OUSA 5KHKA 5FY1A 3LOBA 1BQPA 2RMU1 3BUCA 3HBZA 3K3OA 4AOCA 2W1WA 2DFBA 1G9CA 4JGZC 1YWKA 4XHXA 2VNRA 5A3NA 4CXWA 2RMU2 3BU7A 4LXLA 5CZKA 2JG9C 1W8TA 4XHBA 1W8HA 2WZ8A 1ZM1A 2ZJCA 3EMRA 4XIKA 3T1LA 3Q8FA 3ZYJB 3NV3A 3NJZA 2A6ZA 3N9NA 4EN8B 3TNQA 2IFWA 4TYSA 5HCFA 1RUD1 1QY4A 3NL1A 1JHJA 4LMFA 1B35A 4LBQA 1OLQA 1WCDJ 1GR3A 3HIFA 3P5BA 1RUI1 4NJ4A 4XZPA 4JHZA 4P00B 4YVSB 2Y64A 1NCRA 1UX7A 2OUJA 4XJZA 5CFDC 4YVSC 2AR6A 2BBAA 1D4M2 1HW5A 4M3CE 5GM0A 1VBB2 2XH6A 2EA7A 2RDRA 3O7OA 5A7SA 2GU9A 4MGIE 5FZOA 2R063 1MS1A 3JBG3 1QJX3 3IWZA 3IAQA 5ISLA 2VMDA 1LECA 3FBYA 2YYOA 4QU2A 1V6JA 3BYWA 3VBSB 5DQ0A 3VBSC 3BTZA 2Z4FA 2D6LX 3N36A 3NV2A 4IEQA 1R64A 3AP5A 4LQRA 4OCTA 1PNGA 2SBAA 4WM7C 5JSOA 4XFBA 1UXZA 3LEGA 3M3QA 1MVQA 3ELNA 2LW8A 2B9VA 3WF4A 1Q5OA 5D8AC 1VJ2A 1HXS1 3O1MA 3GJBA 4A6OA 4UFJA 5FMOL 5FP9A 3K4DA 4FBFA 1QXRA 4Q4X2 4XFIA 5FWEA 3EQEA 1HXS2 3KCXA 2CY6A 4QB1A 1SLTA 4AVCA 1PIV3 1WCUA 4Q26A 3AFKA 1KRIA 3MFAA 3WNLA 3URFA 1NQJA 4J6GA 3WNPA 2VMCA 5EJZB 2LTNA 3H7YA 4GKXA 4AR2A 1D0GA 1MZ5A 5J48A 4Y22B 2MNGA 5FMOS 3V0AA 3I4IA 4C0BA 3E1F1 5CYYA 4DY5A 3B9CA 4LHSA 4XFAA 4EN9B 4NRMA 2J22A 4Q0VA 4B4PA 3POBA 3T0BA 1WMFA 2YROA 1YFYA 1ZZCA 5F9TA 4AI2A 1VBD1 5LBBA 4A6SA 3VBUC 1UMHA 5A3OA 3LE0A 4MVTA 1U12A 4HVOA 5JZGB 4IEXA 1W2AX 2J1UA 3J4UH 4OMDA 1VBD2 2C5DA 3E5QA 1I6XA 4ZXKA 2HH9A 1HB1A 4D94A 2QQIA 1YQ5A 3CJIB 5E16A 1FPN3 5JLVA 1AL22 3WNNA 4IXLA 4XF4A 3UV9A 3UYJA 3WF3A 4INDA 3WUCA 2UYAA 4XF1A 2VTFA 3NNJA 5B4XA 2HBTA 3ZO0B 4K1YA 4M0NA 3T3YA 2DCZA 5FUNA 1AYN3 3PUSA 3W9AA 3OYWB 3BPSA 4XACA 1BJQA 5FXWA 3VB9A 3H0OA 2FBEA 2G9ZA 1X82A 5A32A 5AFBA 1GLHA 3DECA 2WNEA 2WLQA 5FZAA 4QKDA 3MICA 4LBLA 2DCKA 1TEIA 3ZFGA 1UZWA 2ZPXA 4KG8A 2ZKNA 3U4SA 1RXGA 3WEZA 4ZZ8A 1U0AA 1OKQA 2EXJA 1PO21 4LBOA 4PJYA 5LBCA 4FTBA 2DYCA 5IJRA 3NAPA 5FZHA 2YGLA 2ZMKA 1X7NA 2VMHA 3B01A 2Q1ZB 4PIYA 2WS91 2XJTA 3AP7A 3BIWE 4GH4A 4M3CB 2WZEA 3OD0A 3K2OA 4LHLA 4XZUG 5A3PA 4BHPA 1LRHA 4B4RA 2R6QA 3VBFB 4BQ3A 1ZBA2 4RHV3 1D4VB 2ZGMA 1WLWA 5CEHA 2GAUA 3I2OA 3U37A 2JEMA 1S0BA 3HNBM 3Q8BA 1MQTA 4CRQA 1S55A 4XQ4A 1JOPA 4C0HA 2A73B 4BXSV 4EN6B 1C8M2 1PK6A 2J42A 3RZHA 2WR9A 4LA3A 5FO8B 1RUJ3 2J1AA 4ZXEA 5C71A 2D5FA 3OSDA 4D6RA 3SH5A 2FQPA 1TNRA 5LBFA 1ENXA 2VCMA 2WO1A 2WO7A 3AMMA 2VUDA 3M3OA 1SFPA 4ATFA 3ZPOA 3T0AA 4JZRA 3U78A 5FDBA 1RITA 2CGPA 1BVVA 4QKFA 1UWWA 4UFMA 1PHMA 1Z7S3 2CGOA 4QX3A 2P37A 1KS4A 4P9LA 4PQ9A 4QX5A 5FPZA 4NIIA 1W2NA 3USUB 4Q4V1 3T2QA 3POYA 2BZDA 1W2TA 1YJLA 1W6NA 3ZXFA 1LU2A 2IVIB 5J96B 1ZRCA 4L99A 5T5OA 3EB7A 1HRI2 3LB9A 3I2HA 4YW4A 4Q4V2 5FZKA 4I3GA 1REEA 1S0CA 1KITA 2F17A 2OXBA 4R4XA 5C6CA 4ZS3A 2E53A 4XBQA 3T30A 3TOJA 4QX1A 1NZCA 3PUHA 3ENRA 3PURA 5EYYA 1FV2A 5FFOC 2XLFA 3THTA 3TWIA 3U10A 3ACGA 4JGYC 3OGVA 4GALA 1OF3A 2XJUA 4NHYA 3E97A 3J8F3 1RXFA 4ZY9A 1XE7A 2ZTNA 3S0MA 4N9HA 2F4PA 1AYM1 3H1MA 3EBRA 4HG6B 1U5ZA 2X05A 2HEWF 2ZS6B 1MVEA 5KXEA 2MEV2 2JDKA 1X9PA 1KEXA 1XYPA 3BU0A 1AJKA 1POV1 4QDRA 3PJYA 3C8XA 1U5YA 3KHBA 4D7YA 3T2OA 1APNA 3NV1A 4CYDA 1JZ5A 4TTGA 2WNVB 1HN0A 1GP6A 4M4PA 4IEVA 2GMPA 2I07B 3KSCA 2RS52 1K3IA 4LKSA 5JSPA 2X10A 1HRV1 2JG8C 3KD4A 1VBE1 4HVRA 3AMNA 4QKNA 3UNPA 1CWPA 3T1MA 3IZOA 4NRQA 1RB8G 1GKBA 1TNFA 5A7WA 4OQ8A 1V6NA 3BB6A 3VBOB 4CEWA 5I8SA 3RYPA 4XJ9A 1R1A2 1UZZA 1VBE2 3VBOC 3WQ0A 1W8WA 3RSJA 4BMEA 5C7GA 1F9KA 1HDKA 1VMFA 1S2KA 5F3GA 4D8MA 4KU8A 3I59A 1VPHA 3LDBA 4XF9A 5IVEA 1BCXA 4WBBA 4AFCA 5DDJ1 3W59A 5FXXA 4DOUA 5GLUA 3ZFFB 3WQBA 3INAA 1UMIA 1UYPA 1HV1A 2PHWA 3ZFFC 5HCBA 2EXKA 5LATA 2K2SA 1Q8QA 3PNAA 3VKFC 3VHNA 4IW3A 5CKQA 3AXEA 2JE7A 4LO7A 5F3CA 1WW7A 2CWMA 2VMIA 1ND3B 2D5HA 4FOWA 2Y38A 3HMYA 4QPWA 3JD73 3KVAA 1ND3C 4MXWB 4K1ZA 2BW8A 4XMAA 5JMOA 5FY5A 2AACA 4Q4W1 2QQNA 2VZSA 1LGBA 5DAWA 4I2OA 1L7QA 4ASMB 1ZYBA 3K3NA 5BNPB 5I8TA 3TEXA 3C7OA 4YVWB 5BNPC 5A33B 2NQYA 3KV4A 3WQ1A 4YVWC 1SHWB 4URAA 5EJ3A 3D0SA 5DUVA 4BYYA 4I30A 1DGWX 1KS5A 4MZUA 1F5FA 1LEDA 4MH0E 1ULEA 3VKLA 3OPTA 3DKQA 2W08A 1XPWA 1CD3G 4DMIA 2JX9A 2R042 2XLGA 3H1YA 2VZVA 3R6SA 5IVBA 2J1RA 1IS4A 2FCVA 2GP5A 2XDVA 4K21A 2KXLA 1T6GC 5AC91 5C4WB 4XXPA 3VGIA 2GMMA 3MIFA 5FZ3A 5C3QA 2AENA 4QPGB 2BNNA 2OPWA 2PAMA 5C4WC 2AC1A 4W4ZA 4QPGC 1DZQA 1D4M3 1RUF2 4AQ2A 1X8EA 3VLBB 1VBB3 2TUNA 1W6MA 2YPJA 2XJSA 4AFBA 2VQUA 1NLSA 5G04L 5EPAA 5ACA1 3RI8A 5KC6A 3VV1A 1W99A 4LBQD 3R4UA 2FHRA 3VZNA 4AAPA 4I3PA 5FP7A 1WW5A 2X53S 4AAXA 5FMBA 1G86A 1UKRA 2QNKA 4G4FA 1OH3A 5IUQA 3FFQA 4BQYA 1KJRA 3SCGA 3S5QA 1IOAA 3RFRA 5FPUA 1QDCA 3LQCA 4JRLA 4A7KA 4CTEA 3V0BA 1VAVA 5FYVA 3WDUA 2HLEA 2B8MA 4KG0A 3IPVB 1RUG1 3PUQA 3ZDVA 1YFWA 2ZABA 1WA6X 1W8NA 2XJPA 4IV3C 4Q4X3 2AREA 4P14A 5CNAA 5FJHA 1HXS3 4CU8A 3PMEA 3D5OA 4AEDC 2KM2A 4LITA 5DUXA 4YW7A 4JRAA 3D0JA 3E6CC 3ES1A 1QQP2 2PHXA 3O1RA 3ZKUA 4QPIA 1ODMA 1JZ4A 1UYYA 2B42B 2QE3A 2WN2A 5FZ6A 1LOFA 4OHXA 1YYNA 2FMDA 4E8DA 5JSRA 1PMJX 5FR3A 2VW2A 2ZKLA 4L97A 4FPYA 5T5JA 3ZMNA 4N7UA 1GUIA 4IL7A 1Y9MA 1W28A 4FSJA 1EV11 3WSOA 4RQPA 1EPWA 1VBD3 4HKWA 1OPOA 1LOAA 1C3HA 5FZ1A 3WX5A 2EXHA 2QZ2A 5FIXA 3KT4A 4FFIA 1CX4A 4OLLA 2IWGB 1PVC1 2Q8CA 1EV12 1LGCA 2VOXA 3FHQA 1OKOA 3FN9A 1AL23 5DN2A 4YPJA 2DCJA 5FZLA 2EIBA 3KCCA 5I0SA 1D7PM 3B94A 1MZEA 2ZCWA 2RS32 3RYKA 4BMBA 5FWJA 5K7PA 3TNPB 1VBC3 4DXSA 1GP5A 4HOOA 4AVVA 1W39A 4PLOA 4QM9A 2JE8A 1QXPA 5FP4A 5CB7A 4FTSA 4I0BA 3POJA 1UL9A 1F4AA 4CDXB 2XGXA 4NWWA 1J3RA 1B09A 1GWLA 4GWNA 3VBHA 3ZYHA 4CDXC 1CR7A 2VU9A 4S2HA 3MV01 2VO5A 5BUVA 2Q1FA 3HT1A 1H2MA 1C28A 1XXNA 4X6QB 4Y1XA 1JN2P 4NMIA 5C9AC 4KBZA 4NR1A 2A75A 4RR3B 3RDIA 1O7FA 1XYNA 4JHTA 2IXKA 3J7HA 2VE1A 5C3PA 3QH7A 2AEZA 1AX2A 5BV6A 2VCAA 4QPYA 1FMD2 1ZA4A 3KZ4C 4MGKE 3WDYA 1WBFA 1CAWA 1SPPA 1V70A 1XE0A 1ZBA3 2DU0A 2VC9A 3WF2A 1O4ZA 1O4TA 2R32A 5K0UC 1QNYA 2XONA 3LSDA 2R0FA 1DF0A 4I0WB 2EAAA 4IV1A 5JIUA 1AR61 2E7TA 1C8M3 3NJXA 4J25A 3AMQA 3IIAA 4CDUA 1QF3A 1AR62 4LUKA 4GB33 4M01A 5C3OA 1GBGA 3UJQA 2XKPA 5L19A 2PHDA 1GZTA 5IHRA 3AZVA 2P3JA 3K4ZA 3LCPA 3T4HB 4DS0A 5C5UA 5EIYB 1VIWB 3I2KA 3I3MA 1TMF1 3CDZB 4AGRA 4CP9B 4IERA 1POQA 4HXCA 4NPLA 5FJKA 3VDDA 2HWE1 4GIQA 5H9PA 1O91A 3IAPA 2WFF2 1XJAA 1RHI1 3O1OA 3DXUA 3QBQA 4G3YC 1GWKA 1HRI3 3GDBA 3M7AA 3VD3A 4Z92B 1GZ9A 2VOKA 3HOBA 4XF3A 4RS5B 5FY4A 4FPFA 1S0JA 1DQ0A 1MZ6A 1N3PA 2ZGUA 3AXDA 4CUGA 2HWF1 4NIAA 4YGBA 1MS5A 1REFA 4QXBA 2VZPA 1BLZA 4FO9A 4BCUA 2G9FA 2RV9A 3CZUA 4Q8KA 5JI9A 3QH6A 5GZCA 2O8OA 3OTFA 2W46A 5IAXA 2VCBA 3M3IA 2RG4A 2WLPA 4P02B 1JUIA 3H3ZA 3RZZA 2MEV3 2A6VA 1GFF2 1W6QB 3WP4A 1JU3A 3ACLA 2DBIA 4Y1VA 4EN0A 3O1UA 2ZAHA 1BKZA 3RMYA 1NA1C 1ZRRA 3M70A 2AZ5A 4UW5A 1DG6A 1FOD1 3MIDA 3R4SA 3AMHA 4GJZA 3ZFEB 5J37A 3GBGA 2WT1A 5EWSA 5FAXA 2FDKA 2LUWA 1Q56A 3WHUA 3ZFEC 3P6BA 5GLVA 4W65A 3LIHA 3ZR6A 3P3PA 1FOD2 1SBDA 4QDQA 4JAAA 5EXOA 2GALA 4XUNA 4BLJA 2RS53 4MYEA 1H6XA 2WRAA 3CU7A 2YPDA 4Y3OA 3ZMOA 3EXUA 4R9BA 2XUMA 1NOVA 2VPVA 2UWBA 2OW4A 2QFEA 3AZXA 3POFA 2PHLA 3AZYA 1R1A3 4NOTA 2RR11 2XPJA 4E4ZA 4OULA 1R092 5F5CA 4BK4A 4AQTA 2OUHA 1Z0HA 1H8TA 2HWD1 2LS6A 2UWCA 1JS9A 1JYCA 2RR12 2V72A 3HPNA 3PLQA 4NAMA 3RS6A 3T0DA 1H1IA 4UW6A 3H7JA 1OURA 1CZTA 2OZ6A 4HKOA 1GP4A 1HB2A 3A7QA 1WMXA 4MV2A 4ASKA 4DRVA 5BNNB 1I1EA 2ILMA 4QD2A 2R072 2DCTA 4Y26A 4OQ9A 2W52A 4BQ2A 1S2BA 4L92A 1QJY2 2VUJA 3IM0A 3LOIA 1QIQA 3N7JA 1QMJA 4UW3A 5F8PA 2FDIA 3RG0A 4YG0A 3B02A 3RNSA 2HWC2 2V5YA 2D98A 5IAVA 3HR9A 3AP9A 4L11A 1UMZA 2PHTA 1QGLA 4RFRB 1TE1B 1FI2A 1W9YA 1YIPA 4LLFA 4P9WA 3V56A 5C3SA 1LNSA 1RUH3 2C6SA 3G7DA 2AEYA 1RYYA 1UU5A 1XRUA 2CL2A 2D6MA 3R0RA 2Z2SB 3C2UA 2RJLA 1SG3A 3K51A 1IQAA 2D93A 4LBKA 4Q4Y1 3RRDA 5KXDA 4Q27A 5IATA 4COYA 1AR72 5EQUA 3UGGA 4HSJA 4MHRA 5FCCA 1AR81 5EJ1B 3ZR5A 2DTYA 2ARAA 4Y1YA 1CAVA 5A7QA 1BBT2 4YM2A 4C91A 2DU1A 2R043 1W6PB 2E9QA 3CNAA 1G9AA 4CEYA 4ZU7A 4KGGA 2FCUA 2FZ2A 5IVVA 4GMP3 2P2KA 4JTOA 3AX4A 2XG3A 3I2IA 4GAZA 2D6KA 3I54A 3VKNA 3BOPA 1WKYA 1W8ZA 2XBO1 3GZTB 3BI3A 5EZWA 3VDAA 1MEC1 5FOBB 1Q8PA 2W3JA 3RYRA 2OS2A 1RUF3 3CF6E 4MSVA 2A6WA 1GOGA 1ZRIA 5CAZA 1MEC2 2JDUA 4PDWB 5J7MA 5JDBA 2Y6JA 1F31A 1URXA 3VBRB 1ND2A 4PDWC 5ANQA 2GNTA 4BQXA 3HJRA 3FHAA 4ZPIA 4IGOA 5T55A 1UY1A 4UF0A 2R16A
chains in the Genus database with same CATH topology
1E57A 1LODA 2Q5TA 1HIXA 4XXAA 1K5MA 2GC0A 4CDQB 2DUOA 5DZEA 1AZDA 1QOSA 5DUWA 2ARXA 1CAXA 1DQ1A 3EHKA 4NN0A 2OYZA 2PQQA 1PM7A 2PN5A 4WM8C 3ZN4A 1OFSA 1PO12 5KHJA 4DZGA 5FQ0A 4XBNA 1BK1A 1OOPB 2VGDA 1QJU2 3FC0A 3GALA 1DDLA 3V64A 1OOPC 2BVVA 1QQP3 2BNMA 2WA4A 4HLTA 1WMEA 4LO6B 4OUSA 3MPPG 3WDVA 4ZU5A 1LEMA 2BFUL 1SCRA 4D69A 1YJKA 4XJAA 3ETQA 4OI2A 5FO9B 1S0GA 1AXKA 1WD3A 3WG2A 2Z42A 1VAMA 1DYKA 4JGZA 1EV13 3K48A 3WW4A 1AVBA 1B35B 4LBQB 2RS33 3B69A 3ZYRA 1SLCA 4ES9A 2JG9A 2JE9A 1RUD2 3MI8A 4QM8A 1XNCA 1NCRB 1TME3 2AH2A 2D97A 1RUI2 3MDPA 4Q8LA 1NCRC 1UD1A 2NYYA 5FPXA 3AKTA 4NPRA 4ATEA 3IMNA 1C57A 5H9QA 5F5QA 5KHHA 3KT1A 4BQ1A 1LGNA 1R081 4BH9A 1XE8A 5CFDA 1V6LA 4NVPA 3VHRA 3WV6A 2ZX1A 5FO7B 3OF1A 4Q1RA 2TNFA 3AKSA 4AE2A 1FMD3 1R082 3JZVA 2GDFA 1HQNA 4PF5A 2IXIA 2DFCA 4COUA 3QACA 2EAKA 2JENA 3VBSA 1UPSA 4LA2A 4WM7A 4HZFA 3CO2A 3BPZA 1VR3A 3I8TA 4X8PA 4ITCA 3DN7A 5D8AA 5FRAA 3ZYGA 1AR63 4K9SA 1RUC1 3V0AB 4XEZA 4PCRA 2Y0IA 3VZMA 5A3MA 3ZIWA 3ME2A 3HQXA 1RUC2 4K8FA 2IXJA 1IS5A 2A5ZA 3EJKA 3WDXA 5JZGC 2QZ3A 1DQ6A 4LHNA 4K3UA 2WFF3 4YZ1A 2XL9A 1UAIA 3RMXA 1LCLA 4KWLA 3CJIC 4XW3A 1RGSA 3O0XA 3VUOA 4TWTA 1LOCA 5B2GB 3JQWA 4XMIA 3NWKA 3VBUA 4XOGA 4QQLA 1G9BA 4BZ4A 3RI9A 1PGSA 1NG0A 4LT5A 1Q8SA 1RMU1 1S0DA 4OHVA 3KQRA 3ZSKA 1WD4A 3WCSA 4YZ3A 3ZFGB 3PMSA 2HKXA 5L73A 5ABJB 3ST7A 2UYBA 3WP6A 5ABJC 4AG4A 1D2SA 1N1YA 1PZ8A 1YCIA 2D3RA 2R1DA 3NAPB 4LO5B 3RJRA 1DQ4A 3NAPC 1PO22 2ZGSA 4Y20A 4YYOA 2JICA 1LHUA 3OY8B 4GH4B 5ACA1 2YHJA 4XFFA 4MGYE 1FOD3 4R9CA 4Y24A 1PNFA 2WS92 1XYOA 4Z07A 3IN9A 4YW5A 3VBFC 5I8YA 3FHIB 3ALQA 1A3KA 3B9IA 3AJYA 3POSA 3WXPA 3OD4A 3ZSMA 4TLFA 3SCHA 1PGL1 4AXOA 1MQTB 4Y4YA 4HT1T 3MLKA 1PK6B 5JPMB 3GZAA 4JC1A 4RFT0 3I2DA 2H0VA 1R093 4M3CA 4I09A 1QJZA 3TBDA 5TSWA 2IC1A 4S2FA 1ALYA 3BTAA 3QLQA 1GQGA 2R49A 3TB0A 4MXVA 2R073 2W39A 2D3PA 3FLRA 3GBFA 3GZUC 3JU9A 1AHSA 4FQZA 4LE3A 1VLNA 1QJY3 3ECQA 4FT8A 2R0HA 1W6NB 3WW1A 2HWC3 5IK7A 3N4MA 4N7IA 1N1VA 2IXLA 1N47A 4XDQA 1SLAA 2MPFA 1JOJA 2P34A 3WT3A 2XWBB 4E9KA 4Z2WA 2ZMLA 2WNUB 2Q30A 4M00A 2WWSA 4O9EA 1V6MA 2HWB1 5SV5A 3LSEA 2WNUC 1AR73 4HETA 4MUVA 5H9RA 4DXZA 3GHMA 2A6XA 4FPJA 1XU2A 2PAEA 2RJKA 1BBT3 3AZWA 1AYM2 4BE3A 1JH5A 2QDNA 1WLDA 1COV1 4LUMA 4JGYA 4Q0QA 3APBA 1Q8OA 2WNVC 1EAH1 3AP6A 4WV8A 1GV9A 3TN91 1MS3A 2UWAA 4BA6A 2W68A 3THPA 2VG9A 3VL9A 1MEC3 3TN92 1CONA 3ILRA 4XBLA 1ULDA 4GULA 1RUE1 1YFXA 4HL0A 4KGQA 2D6PA 1HRV2 3AYDA 4YM3A 4YZ5A 4QT6A 3DV8A 3I59B 1REDA 2DWRA 1S0EA 2H6CA 3SITA 2JG8A 1Z78A 1ZRFA 4V1PA 3C3VA 4FXGB 5DDJ2 1SLBA 1UW8A 3BOWA 3VL8A 3WP5A 2B9UA 3BODA 3VBOA 2XB6C 3DUIA 1PO13 2D6OX 2ZHNA 4AEMA 4XTMA 5J36A 2VQ0A 3O14A 4D3WA 1QJU3 1DYPA 5AFEA 3H3UA 1MR5A 5BPXA 1OFNA 4GXLA 2ATFA 2ZHLA 4PBPA 5C33A 4Q4W2 4AGVA 1UKGA 4EJRA 1V9U1 2RMU3 4MGZE 4LE4A 3H50A 1Y43B 3FE5A 2XWJB 1ND3A 1ENSA 1N3OA 1BEV1 1M06G 1LOEA 2ZMNA 1DU3D 4GQ7A 1QHDA 1N3QA 3HAGA 2QKDA 1TQ5A 4I0AA 5L36A 5CIRA 1AJOA 1MS9A 2ZGTA 4NWVA 2RE9A 4JV4A 2XJQA 2WKKA 4Q29A 1RUD3 1XNBA 4C1XA 3S7EA 3A4UA 4L8QA 3ASIA 4Q1PA 1PGW1 4E4DX 5AC92 3WP3A 1RUI3 4HN1A 2H0BA 1W6MB 1O3QA 1WA4A 5FREA 1HX6A 5KWRA 1LB2A 2JDZA 3AMPA 1U5XA 2QJVA 3NO8A 4J1XA 4FP2A 1ONAA 2ETEA 2YDEA 4QPGA 4YFWA 1IGOA 2GH2A 3WR0A 1DGLA 1RVF1 3DPRA 1YRZA 3V0BB 1R083 3E5UA 3B5LB 4ZKTB 3O0WA 3DKWA 4EV0A 1CIWA 3WDTA 1OQ1A 2Z79A 2CTVA 2C0ZA 1OPMA 1RUG2 3S30A 1OD5A 3AYAA 1LHNA 3USSA 1NCQA 1VRH1 4YARA 4F83A 4WVMA 5T5PA 3LWCA 5GALA 4PLMA 1VBA1 1SFNA 1XQNA 3KMHA 3IPVA 4QPIB 3ILFA 3ZSLA 3IDEA 3SNMA 3UKNA 2PHUA 4IV3A 1X8MA 2ZBJA 3E6DA 1ZBE1 4QPIC 4XETA 1VBA2 2GMEA 1MS0A 1RUC3 1UF2C 4C90A 5L7OA 4AEDA 4CZSA 2PLV1 2Q0AA 1OA4A 3SXWA 4P9GA 4RQPB 1KFUL 3U0ZA 3SHRA 5D1IA 4JDOA 4HK8A 4AW7A 4H3WA 2GNDA 2GN7A 3L2HA 4A7YA 4YNIA 2DTWA 5CFCC 2QQPA 3L9JT 1F2NA 2F6BA 4OHYA 3M2MA 1PVC2 3IKWA 4LO4B 4Y1UA 4BOWA 4COZA 3POWA 5BNOA 2BUKA 1I3HA 1SMVA 4PLNA 2RHPA 3VBHB 2XJVA 1FV3A 3FX3A 1D0HA 3H9AA 4CDWA 4ISQA 1KFXL 5EYXA 4L2NA 2VNGA 1C8NA 1ULGA 5I0TA 1G8WA 1O3RA 2XVLA 3UKVA 4RR3C 1PO23 1DBNA 2R061 4B29A 2IXHA 3JBG1 2LALA 4B7KA 3ZSEA 4A2UA 2WS93 4WVVA 2N7GA 3DL3A 4P9YA 3ZN6A 1CAWB 4AHXA 3WCRA 4OZXA 5C9AA 5JVVA 3GNEA 1ZVFA 1PZ9A 2ZGOA 3ZXAC 4ORFA 4IV1B 4XQWA 2UY8A 4AHZA 4KH9A 1RC6A 1DFQA 1X50A 3ZVXA 1AL0G 1U5IA 4OUMA 4AVAA 4CDUB 1ZZ6A 1H0BA 4S2DA 4CDUC 3FLTA 3MEPA 4A7ZA 4DINB 1GZWA 3WDWA 1SCSA 5K0UA 4F3JA 4FPHA 2E7QA 4FAGA 4B4QA 1GZCA 1ZNPA 5T3NA 4CP1A 1J1TA 5T52A 5K8SA 4YSFA 1RUOA 3VDDB 4FP3A 4I01A 4IEOA 1DQ5A 1TMF2 3LAGA 3TYJA 1O5UA 5FBZA 4LBNA 2HWE2 4Q4V3 4BPZA 1YLLA 4BLIA 1NE6A 4MX3A 2WT0A 1RHI2 5JCTA 1WCKA 4RS5C 2HEVF 3OBTA 2NPIA 2ZX3A 5DG2A 1J3QA 2WQZC 2WQ4A 1JHNA 2HWF2 5GLWA 1QNWA 1FPN1 5AVPA 2XVKA 2BGCA 1O3SA 4DRRA 5JIAA 1F5JA 1I5ZA 4IETA 5GZEA 1CAUA 4HANA 3JCIA 3R4DB 4BIFA 5DZFA 4AFMA 1OMIA 1SACA 1AYN1 1AYM3 2GZWA 2DVAA 3KLSA 4KU7A 4P5HA 3VHOA 3B93A 4QQ2A 1RJ7A 1POV3 4XFCA 1NY71 2I45A 1DQ2A 4NHMA 4UBHA 2HYKA 3NV4A 3U11A 4R9DA 1SFYA 2X5IA 1NA1A 2ERFA 3TN93 2PFWA 4AEJA 4OI4A 2OIIA 4A3XA 2BVBA 2E7AA 1LENA 1IZ3A 1WLTA 1X33A 5JR7B 1HRV3 1VBE3 4BM8A 4XJ8A 4RHV1 2KA3A 4DFSA 4GMP0 3VZJA 4N53A 4XE9A 3WOGA 4Q2FA 2MHFA 4QGNA 2P17A 2XJRA 4MLOA 2HWD2 5T50A 3WG1A 2A3XA 3N7LA 1QU0A 2YXSA 4QGMA 5DDJ3 1C5HA 4F7ZA 5BNNC 5IK5A 2NP0A 2A71A 2WZR1 2ZX4A 5A3LA 2B45X 1JXNA 3SH3A 3WHTA 4ASLA 2RS11 4FVVA 1FXZA 2E51A 2WZR2 1Z7S1 1GANA 2ZACA 2RS12 2JKBA 2A3YA 4Q4W3 3WD5A 1Z7S2 2O0OA 1ASJ1 1O3TA 3ILNA 5CG9A 1RTVA 3AB0A 3N3HA 4C1WA 3MW3A 5DG1A 5FLIA 3BCWA 1ASJ2 4P9IA 4URTA 4J1WA 4Q4Y2 3X29B 1N1TA 2D44A 3O12A 2ZX0A 2YZ4A 4HPKA 4AK3A 2VW1A 3NKTA 5CADA 3ZXGA 1AR82 1ZZ7A 4CEYB 1PZ7A 1V6KA 4N43B 1RL3A 4CEYC 3GBWA 1UIKA 2BPA2 5GLZA 4N43C 3M3CA 4X6RB 4HVQA 1VB4A 1RJ8A 1UU6A 3HWJA 4ONUA 5AC93 4L9BA 2H6BA 2XBO2 3WG4A 3ZPYA 4AI1A 3AZZA 1ND2B 2CNAA 4LEJA 5T54A 3VBRC 1WBLA 2QVSB 3IT8A 5KXBA 4EN7B 4EWDA 2VNOA 2BWAA 1K5MB 2QDRA 1X36A 4CDQC 4LHKA 1K5MC 2ET1A 1JTZX 2IFRA 2XKOA 4PDWA 1V6IA 3FFZA 2HJIA 1W6OA 5GZDA 5GZGA 1RUG3 2AYHA 2EF6A 5C8CA 1YFUA 1W0OA 4KWKA 4R9AA 1VAKA 2ZGNA 5FQ0B 2D40A 1OA2A 4W6YA 3ATGA 3LKJA 1H2NA 1UU4A 1UX6A 1GNZA 3MIGA 4LR4A 4HN0A 5JWPA 1O5LA 4HBNA 4WM8A 2ET7A 1DLLA 2ARBA 4Y1ZA 1SLIA 4COWA 3JD71 3KGLA 1S1AA 1BVP1 1O4YA 3N7KA 2RM21 4QGLA 1D2QA 2C9AA 2DV9A 3MF9A 4XYXA 2VECA 2ZGPA 2K9ZA 2WT2A 1OSGA 1XU1A 2DVDA 1OOPA 2FMYA 4DB5A 2RM22 3MIEA 3WX5A 4FOVA 2NN8A 4YW1A 3SH4A 3AK0A 1JYIA 1C1FA 1YUDA 2AGSA 4JGZB 4Q0UA 2BFUS 2P3KA 1CJDA 2VULA 4CP2A 5I93A 4DPNA 2ENRA 1KJLA 1B35C 1PVC3 5H9SA 2JG9B 3FJSA 2CAUA 3WLUA 3OJBA 3O0VA 4AEKA 1Y3TA 1AR91 3ZXEA 4YLZA 2GN3A 3V65A 1V00A 4N90A 2YGMA 1XNDA 1AR92 1LKNA 1D4M1 4YVSA 1VBB1 5CFDB 4SLIA 4Z8BA 5CU1A 5CBLA 5EV7A 1FYUA 3L2YA 2OZJA 3NVCA 2VMGA 2WFPA 4QHBA 2A7AA 3NKGA 1SEFA 4DQAA 5JPNB 5FOJB 5BNQA 2CYFA 4W6XA 1KDMA 4YGCA 1VB2A 2D7FA 1EY2A 3BALA 4LTAA 3WNXA 4WM7B 2PELA 4RSUA 3SMHA 3AP4A 3OGGA 1V6OA 5JOXA 3WQ7A 3GF6A 5D8AB 1ZRDA 1LJ7A 2LM3A 5FLHA 2VY0A 3MW2A 4Q4X1 2BEOA 3AKPA 3D82A 4R8HA 3TAYA 3WY6A 2OA2A 4FPCA 4GKYA 4W6WA 4EWAA 2I2SA 1DIWA 3IDCB 1M4WA 4META 3PHMA 4OHZA 2OVUA 5GLTA 1TMF3 1IPJA 4Y22A 2WINB 2DUQA 2HWE3 3VKMA 2OPKA 1CPMA 1RHI3 5E89A 3SISA 1VALA 4XJWA 3B3QE 1CPNA 3ZIXA 3ZYIB 4E2QA 5HI0A 3VBUB 4XJUA 1LULA 2PAKA 4AQ6A 5JZGA 2X8KA 2HWF3 4D7TA 5JOYA 5CG8A 2NMNA 1ZX5A 3MYXA 1AL21 4RD7A 2UU8A 3CJIA 5A32B 2B5HA 4FPKA 4P9JA 1RMU2 1VBC1 3ZFGC 1WW6A 1BXHA 1AX1A 1H4GA 5HXVA 3B00A 1ENQA 3TRSB 4E2SA 1VBC2 2EALA 1S0FA 2VVEA 3KM5A 3OYWA 4Y20B 1KDKA 4JCKA 4GH4C 1KXGA 2EIGA 3LA7A 1IKPA 3ZYPA 5ACA2 2O8QA 1MS8A 4WVWA 1UIJA 2YMZA 4OVEA 5JAXA 5ABJA 2Z69A 1YI9A 3UL2A 1MQTC 2Q8OA 4WZFA 1PGL2 1PK6C 2DF7A 1ZBA1 4X8NA 1OI6A 3OY8A 4UXAA 2RR13 3IBMA 2ZHMA 2EVXA 3MGUA 3MLLA 3VBFA 1S0IA 1UPIA 2ES3A 4WZCA 4FOYA 1C8M1 5LRRA 1OA3A 4HSLA 2HWD3 3P3NA 4JDNA 2GC1A 3AYCA 4JTNA 1MZFA 1ZZ9A 4OI1A 1BMV1 4BIOA 5E1RA 5J3UA 2DUPA 4GB31 5SV8A 2K0GA 4XILA 4AYUA 3PJQA 1VP6A 3WVJA 4LNVA 1A8DA 1BMV2 3U07A 2WZR3 4GB32 1A78A 4KL1A 4FTEA 3A0KA 4RL7A 1C1LA 3Q9OA 5KHGA 5JOZA 3VZLA 3VN4A 2RS13 4IEUA 4FXKB 1LHWA 1HKDA 5F6LB 1N1SA 3USUA 1GQHA 2XL7A 1MACA 3QD6A 1QOOA 4LBJA 1HRI1 2G4IA 1CESA 2BTVC 2VVDA 1EP0A 5FLJA 3ZSJA 1HV0A 1ASJ3 1FATA 1MS4A 2W0XA 4Q4Y3 4KWJA 2HWB2 2VQAA 4AQSA 1AR83 4D7SA 1QH7A 5E88A 4LBMA 2ZGRA 4JGYB 3LA3A 3E6BA 2WSUA 1IKQA 1COV2 2JJ6A 3LGRA 4M3CF 2WNUA 4YG6A 1NXMA 2MEV1 3MZHA 3H1WA 3MF6A 2ZGKA 1UZYA 2VW0A 1PMIA 1HQLA 2XBO3 2PHFA 4YGEA 5BY5A 1EAH2 5F6KA 3H8UA 5K9YA 2B7YA 4K20A 4XQDA 1ULFA 4AFDA 4CEWB 2VVFA 5JMCA 1OQEA 4K6BA 4CEWC 1IHMA 1LHVA 2WNVA 1RUE2 2RS51 1LOBA 2WJSA 4HKLA 4AWDA 1H1AA 2JG8B 1G9DA 1R1A1 2PTMA 1UCXA 4XPVA 2C1FA 3VKOA 3RPQA 1C5IA 2TBVA 4YZ4A 2IXCA 3JB8A 1SLLA 4FAHA 4CP0A 3MFCA 2SLIA 2FZ1A 1ENRA 2PA7A 5T5LA 4H7LA 3HT2A 1LTEA 1A6CA 3CEWA 2O1QA 3ZFFA 2TEPA 1L3JA 1W2UA 5IK4A 3MLJA 4F8AA 3LZZA 5FTTC 4XFHA 1NYWA 1CQ9A 2CWSA 4I02A 3WINE 2E6VA 2WC2A 3SCFA 4IEYA 1FT9A 4WVZA 2CAVA 1V9U2 1WCSA 2XVGA 4MXWA 3W58A 3M3EA 1RUH1 4NHLA 3AM2A 2RM23 3N7MA 4NHKA 3AFGA 3HN1A 1BEV2 2R30A 3FBMA 1ZZBA 5BNPA 1RUH2 1SBEA 1KD7A 2NMOA 4YVWA 2CV6A 5A33A 4R4ZA 3PVNA 1Y9QA 1QDOA 3KCYA 5DXDA 1AXYA 5JI7A 2R041 4H7MA 3R05A 1NQDA 1Q8VA 4GMP1 2QCSB 1UN1A 1PGW2 4Q0SA 2BWCA 1CGPA 5LEKA 3OCPA 1WUVA 1AR93 5C4WA 3M1HA 1RUF1 2R1BA 4XIOA 4LLOA 3DPRB 3AKRA 3HD8B 3JB4C 3DPRC 1R1ZA 1RVF2 3VZOA 1J1LA 1BZWA 1OLRA 3I7DA 3ZN5A 5LK5A 1F8VA 4UW4A 3FWEA 4XTPA 4G9SB 1NCQB 3CLPA 1G6NA 1NCQC 4WVMB 5KC5A 2WZPP 1H30A 4Z1VA 4AI8A 1VRH2 3N35A 3QOPA 3FZ3A 1Q3EA 1HQWA 2NZ9A 3JQXA 4IV3B 4AI0A 1LOFC 2WSVA 1AF9A 4FCAA 2JXAA 3KT7A 2V73A 5L7OB 4AEDB 4QQOA 3RQ0A 1ZBE2 5L7OC 2GSYA 2ZGQA 1QWRA 1QQP1 2D3SA 4PBOA 1ULCA 3MIBA 2YC0A 4AHWA 2PLV2 4RQPC 3WUDA 4E2GA 2PYTA 1J59A 2Z5WA 1YI7A 3NSTA 4ZU4A 1CJPA 4OI0A 2B46X 4LO8A 3DF0A 1ZZ8A 5BNOB 1WW4A 2BQPA 3J9SA 5IT6A 3UK9A 3CJXA 5BNOC 2G9GA 2V09A 2AUYA 4IQPA 3OBRA 3VBHC 2ZX2A 2RS31 2YV8A 4SBVA 5CFCA 4GA9A 1RMU3 5HBAA 4CDWB 4RA0A 5BYNA 1EYBA 2UY9A 3UJOA 4P9XA 1TME1 2ZOEB 4CDWC 3ZXJA 4NO4A 2JD4A 1XNKA 3M8LA 5EFUA 1AX0A 1FX5A 1QKQA 1I9RA 5EYYA 1TME2 1QJX1 4CDXA 4YRDA 4B8EA 1NXD1 2Q1MA 4YM0A 4B3NA 2R062 5ACA3 3JBG2 3ZN6B 2XLAA 1QJX2 4RGAA 4K7JA 4PIXA 5C9AB 1QOTA 5F1RA 4OHWA 3ZXDA 4RR3A 4EROA 4IV1C 1FMD1 1LR5A 3S6PA 1CN1A 4FPEA 4JDMA 2CGNA 1HLCA 1JW6A 4YW3A 4B7EA 1C4RA 1SDWA 4E27A 1H8VA 4XFGA 2BYVE 2D6NA 1DGWA 4JVAA 1POV0 4AGGA 2PHRA 3AYEA 1GZWB 1PIV1 5LK7B 5K0UB 1H4HA 2A70A 4AVSA 1Y7BA 3FUOA 2GNMA 1LOGA 1BYHA 4Q0PA 1GICA 3IDBB 3WW2A 1PIV2 5GZFA