1EAH1

Pv2l complexed with antiviral agent sch48973
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
272
Chain Sequence
ANNLPDTQSSGPAHSKETPALTAVETGATNPLVPSDTVQTRHVIQKRTRSESTVESFFARGACVAIIEVDNDSKLFSVWKITYKDTVQLRRKLEFFTYSRFDMEFTFVVTSNYTDANNGHALNQVYQIMYIPPGAPIPGKWNDYTWQTSSNPSVFYTYGAPPARISVPYVGIANAYSHFYDGFAKVPLAGQASTEGDSLYGAASLNDFGSLAVRVVNDHNPTKLTSKIRVYMKPKHVRVWCPRPPRAVPYYGPGVDYKDGLAPLPGKGLTTY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords POLIOVIRUS TYPE 2 COAT PROTEINS VP1 TO VP4
publication title Structure of poliovirus type 2 Lansing complexed with antiviral agent SCH48973: comparison of the structural and biological properties of three poliovirus serotypes.
pubmed doi rcsb
source organism Human poliovirus 2
total genus 43
structure length 272
sequence length 278
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1eah100
1RVF1 1Z7S1 4CDWB 4N53B 5CFCC 3VBFB 1OHFA 3LOBA 1QJY1 4QPGB 1OOPB 1MQTA 1AR83 1V9U3 1FOD2 3VBHB 1BBT1 1C8M2 4IV1C 4RS5C 3TN91 5C9AA 2XBO3 1FMD3 1HX6A 2IZWA 1MQTB 1RMU1 1PGW1 1ND2C 1RHI1 2HWC1 1BBT3 2RMU2 3VBOC 3TN93 1AR61 4Q4V1 3CJIA 4QPIA 4IV3C 1HXS1 1QQP2 1FPN2 4CEYC 1RHI3 1RUD1 1VBB2 1RB8G 2HWC3 1B35A 3CJIB 1R081 1QJU2 4QPIB 5C8CA 4Q4V3 5BNNA 2RS11 2RM22 1OOPC 1DDLA 1VBC1 1TMF1 3VBHC 1ND3C 1RUG2 1B35B 1RUD3 5D8AC 4Z92B 5C8CB 5BNNB 1W39A 2BUKA 2RS13 1BEV3 5CFDA 1TMF3 1K5MC 3ZFEA 1FOD1 5L7OC 1PVC2 1C8M1 2WZR2 2MEV2 4AEDA 5CFDB 3JBG3 1F8VA 2HWF2 3ZFEB 4NWWA 5CFCA 2R062 2ZTNA 3FBMA 2GH8A 3NAPB 1C8M3 4GMP1 1RUJ2 4QPIC 2RMU1 1VBD3 2R072 1RUI2 4AEDB 4IV1A 4RS5A 1WCDJ 1QQP1 5CFCB 1QJX3 2FZ1A 4N43C 5ABJC 1VBB1 1R092 4GMP3 3DPRC 1QJU1 1ND2A 5K0UC 4RS5B 2RM21 4FTSA 2HWD2 3VBOA 4Q4W2 1RUG1 1VBB3 3VBUC 4IV3A 3S6PA 5LK7B 5BNOC 1ND2B 4RR3A 4CDQC 1NOVA 4CEYA 1QJU3 1RUC2 3VBOB 2RM23 4Y5Z0 1ZBA2 3ZFEC 1HRV2 1POV0 4IV3B 3NAPC 1OOPA 4RR3B 1PVC1 3VBRC 4CEYB 4AEDC 2ZAHA 3VBHA 1ND3A 1VRH2 1AR92 5D8AA 2MEV1 1RUF2 2HWE2 1AUYA 2HWF1 2BFUL 3JD72 1NG0A 2R061 5FMOL 1ND3B 1RUJ1 5D8AB 1K5MA 2R071 4YVWC 2TBVA 1RVF3 2MEV3 1Z7S3 5L7OA 4CEWC 1QJY3 1AYM2 1NY72 1NCRA 1K5MB 1R091 1RUJ3 2R073 5L7OB 5AC92 4GH4C 5C4WC 1HRI2 4RHV2 3ZFGC 2HWD1 1NCQC 1NCRB 4Q4W1 4RR3C 1RMU3 1RUE1 2RS52 1R093 1MEC2 5FOJB 4N43A 1RUC1 1ZBE2 1TME1 4BCUA 5ABJA 5A32A 1EAH1 1D4M2 1AR63 1ZBA1 5J98B 1AL22 3DPRA 2Y26A 1HRV1 1HXS3 5K0UA 2WWSA 1RUE3 2RR11 4GB32 4N43B 5ABJB 5A32B 1VRH1 1AR91 1TME3 4NWVA 3VBUA 1RUF1 2HWE1 1EAH3 1R083 1RUH2 3DPRB 5BNOA 5K0UB 1ZBA3 1COV2 4CDQA 3JD71 1QJZA 1VBC3 1PGL2 4JGYC 3JB8A 2RR13 1EV12 1AR72 3VBUB 2R042 1VRH3 1AR93 5A33A 5BNOB 4FSJA 3NAPA 4CDQB 1RUF3 2HWE3 2FZ2A 3VBRA 3JD73 1NCRC 4WM8C 1AYM1 1NY71 5FMOS 2GSYA 1FOD3 1PIV2 4Y4YA 5A33B 3VBRB 1X36A 5AC91 1HRI1 4RHV1 2X5IC 4YVWA 1FPN1 1POV1 1VBE2 2RS51 5GKAC 4CEWA 1IHMA 2XBO2 1ZBE1 1FMD2 2RMU3 4EJRA 5AC93 4YVWB 1HRI3 4RHV3 1AL21 1M06G 1PO22 1QQP3 2QQPA 4CEWB 1NA1C 4GH4A 1FPN3 5C4WA 1POV3 4GB31 2RS53 3ZFGA 1VB4A 1NCQA 1ZBE3 1RUH1 1COV1 4LLFA 1AL23 1AYN2 4SBVA 4CDXA 1A6CA 4GH4B 5C4WB 3ZFGB 1PGL1 1SMVA 1NCQB 1RUG3 4GB33 1EV11 1AR71 2R041 2VQ0A 2WLPA 2WZR1 2PLV2 4Q4Y2 1RUH3 4CDXB 1COV3 4GMP0 3ZFFC 3HAGA 1PIV1 1EV13 1PVC3 3IDEA 2R043 1BEV2 4FTBA 4JGYA 2WZR3 1RUI1 1CJDA 2BBVA 2HWF3 3VBSA 2R063 1VBE1 4WM7C 1PIV3 1F2NA 2XBO1 4JGYB 4WM8A 1FMD1 3JBG2 1ASJ2 1RUI3 1R1A2 2HWB2 3J8F2 1PO21 3VBSB 4PDWC 1VBE3 2X5IA 1VBD2 1X33A 4WM8B 1OPOA 4YVSC 5DDJ2 5BNPC 1GFF2 4CDXC 1QJX2 4RQPC 1AYN1 1H8TA 2XPJA 1PO23 2RS32 2HWD3 2X5IB 5C9AB 3M8LA 4Q4W3 3JB4C 2WS92 1NA1A 1PO12 5JZGC 2PLV1 3VDDC 4CDUC 4Q4Y1 1RUC3 1H8TB 1AYN3 2WFF2 4JGZC 1BMV2 1E57A 5J96B 1HRV3 1VBA2 1AL0G 4CDWC 4N53C 3VBFC 1NA1B 4FTEA 1BEV1 4QPGC 2PLV3 4Q4Y3 3VBSC 1HQNA 5ACA2 4Q4X2 1VB2A 2BFUS 3ZFFA 3JBG1 1MQTC 1ASJ1 1R1A1 2HWB1 3J8F1 5C9AC 1AR82 1V9U2 2BPA2 3ZFFB 1VBD1 1AYM3 1VAKA 1RVF2 1MEC1 1Z7S2 2DF7A 5DDJ1 1QJX1 1H8TC 1ASJ3 4WM7A 1QJY2 1D4M1 1R1A3 2HWB3 3J8F3 2RS31 3CJIC 1BBT2 2WS91 3TN92 1MEC3 1PO11 4PDWA 4WM7B 5DDJ3 1D4M3 1B35C 2WFF1 1RMU2 4YVSA 1PGW2 2RS33 5C8CC 1BMV1 5BNPA 5BNNC 1RHI2 1VBA1 2HWC2 4RQPA 4PDWB 2WS93 4IV1B 1AR62 4Q4V2 1PO13 1C8NA 1HXS2 4YVSB 3ZXAC 5ACA1 2ZZQA 5BNPB 2WFF3 1RUE2 5JZGA 3VDDA 4CDUA 4RQPB 4Q4X1 1RUD2 1VBA3 1TME2 4JGZA 5CFDC 1EAH2 1R082 1AR73 2RS12 4CDWA 4N53A 3VBFA 1VBC2 5JZGB 3VDDB 4CDUB 1TMF2 5ACA3 4QPGA 1AR81 1V9U1 2RR12 4Q4X3 4RFT0 1CD3G 4JGZB
chains in the Genus database with same CATH superfamily
5H9RA 4CDWB 1XNAA 4N53B 1OHFA 2BDRA 1ULFA 1NLRA 1JI6A 5FJHA 4NAMA 1JU4A 4UWDA 3SHRA 3KCYA 3O1TA 2IXIA 1MQTA 2VZOA 3E6CC 2DBNA 4AWDA 3S5AA 3VV1A 1O5UA 4QDQA 3D0SA 2DCZA 2DU0A 3ITQA 5C9AA 2VTXJ 4F83A 2GP3A 2R1BA 4EN6B 5B4XA 2IZWA 4KGQA 4MX3A 2OQ6A 3O1SA 5B4NA 2Q4SA 2ZGTA 5JOYA 1RHI1 3WQ0A 4PCRA 2HWC1 1Z78A 3OYWA 3ELNA 4YLZA 1WMFA 3B9CA 4L2NA 5A1LA 2CGPA 3TYJA 3M3CA 1UY2A 2NMNA 3VZLA 3HQRA 2YBKA 1GQHA 1QNYA 4IV3C 3LA7A 4EYUA 1QQP2 5CG9A 3ZYFA 1E5RA 4XFFA 4BQ3A 4DXSA 3OBRA 2TEPA 3GCWA 1TG7A 1VBB2 4BISA 1RB8G 2XMLA 1IS5A 3KHCA 4KH9A 5FZ8A 1B35A 3CJIB 3MFCA 3JQWA 5FOBB 1GV9A 4QPIB 2R6QA 1W9SA 1J3RA 4PLOA 4Q4V3 5CIRA 2RS11 3D8CA 4IGOA 1OOPC 3HT1A 4AVVA 5IVCA 1MR5A 3OB8A 4TXWA 1G9CA 2VZVA 1TMF1 4B8EA 1Q8SA 3VBHC 1ND3C 1U0AA 3U78A 1RUG2 1RUD3 1ST8A 1GMMA 4LA2A 2XH6A 3VD4A 2E63A 4XW3A 1W8HA 5FCCA 5CA6A 2DVAA 4Q26A 2PN5A 3WZ1A 4IEYA 4WBBA 4CP0A 4DY3A 1W0OA 2ET1A 5EWSA 5EIYB 1WLTA 2QDNA 1ZREA 3GBWA 1UYZA 1ZRIA 1TZOA 1V6IA 1K5JA 1VMJA 3K48A 3ALQA 4AGGA 4IUGA 4XZPA 1FOD1 1GNYA 5A80A 5A70A 2WNUC 1C8M1 3POFA 2PHDA 5L7OC 1BKZA 5CISA 2GMMA 4P9WA 2WZR2 3TRSB 1JMUB 2ARAA 4QT6A 3CNAA 4E4SA 2WNVA 5BYNA 4Y33A 5A3WA 2WSUA 3W59A 1CWPA 2AZ5A 1J1TA 4LO5B 3USUB 4AOCA 1ZRFA 1OF3A 4ISRA 1GWKA 2R062 4F8AA 5CFCA 2RE9A 2ZTNA 2QTWB 2EAAA 2Z5WA 3I97A 4GMP1 3ZYPA 1VALA 2WZ8A 4COZA 2Q30A 1GZTA 3WNOA 3HJRA 3CDZB 1VBD3 4QX8A 1CVNA 1RUI2 4P9JA 4F7ZA 3L2HA 5FZ9A 3CKHA 1W99A 2C5DA 3LDBA 5IUQA 4DS0A 4JZRA 4OI2A 4G3YC 4Q0UA 4RYDA 4AQTA 4AEKA 5GZCA 3VD7A 1CX1A 2LALA 3SXWA 1NKGA 2FQPA 3KD4A 2WWJA 5IVEA 3DPRC 1S0JA 2D3PA 2AEYA 4NMIA 3WNMA 1WMEA 3KF5A 5K0UC 5DUVA 2W39A 1I6XA 1LHUA 3WF0A 3AP5A 4UAPA 3VBOA 2VOVA 1QIQA 2OA2A 5IK4A 3UGGA 4Q4W2 2D6NA 4OI4A 2XB6C 1Q5OA 3I2JA 2GC1A 2YUEA 4CP9B 2LUWA 5BNOC 1W9TA 4CDQC 2JENA 3K4AA 2QQKA 3BYWA 1QJU3 1RUC2 4LK7A 4Y5SA 3VD9A 1XOYA 5M0TA 3MBWA 1O3TA 3ZN5A 4XCBA 4Y5Z0 3O1RA 3LE0A 4XFHA 5IWFA 2XOMA 1HRV2 4I0WB 1POV0 3LDKA 4IV3B 2VAUA 3N9NA 1PGSA 2GN3A 2KD7A 4GA9A 3QH7A 4PIYA 4AGVA 4CCMA 3H3LA 1SACA 2ZGOA 4AEDC 4AXOA 3ILRA 1AR92 3T08A 4AG4A 3WDUA 2XQXA 1OI6A 1AUYA 4R9CA 4CXXA 2BFUL 2JDNA 3LGRA 1W6MB 2X29A 3JUUA 5CB7A 3VLBB 5JSOA 2QQLA 1DLCA 2W1QA 1KXGA 2ATFA 1IQDC 4MV2A 3HEIA 1ND3B 3ZXLA 4QWNA 3N9OA 3ACFA 2FD8A 1K5MA 2R071 2D6OX 1YCIA 4WVMA 1BLZA 1F5FA 2XKPA 4YVWC 3WF2A 5FWEA 1RC6A 2QQIA 2XUEA 3SCGA 5FREA 3ZN4A 4A41A 2Y6GA 1K42A 1XNDA 3CO2A 2Z42A 3AJYA 1HB3A 3HR9A 4R9DA 1DZRA 2LS6A 4HG6B 4CUCA 4D7YA 2QQWA 4CPBA 2O8OA 3TBDA 3N9LA 1AYM2 3I49A 1NCRA 3MV11 3A4UA 2WNEA 1ZNPA 2JEMA 2ZJCA 4XJZA 5L7OB 1YHFA 2WNUB 5FYHA 3KCXA 3ZKYA 2Y6LA 4L9BA 4X8NA 1HRI2 1OLME 3D3AA 3ABZA 1L7LA 4DRVA 4QQOA 5JXJA 4CU6A 5KXCA 1JYNA 4E4HA 2YFZA 4LQRA 1WW4A 1M4WA 3AKSA 5FOJB 4N43A 4RGGA 1HB4A 1W6OA 3FUQA 1D4M2 2DUQA 4L99A 3C2UA 4O9EA 1ZBA1 4LT5A 3GM8A 1SPPB 4D7SA 3N9QA 1U5XA 5IFTA 1XQNA 3AKPA 4JTNA 1NE4A 2A5ZA 2VZ3A 3CBNA 4D0QA 1WMDA 2OUJA 3QH6A 1RUE3 4TLGA 3O1MA 5FY1A 2RR11 3NO8A 4I2OA 5A32B 3RZKA 1F35A 2OPWA 3R6SA 1VRH1 1LKNA 1TME3 2FCTA 4NWVA 4BMEA 1R64A 1RUF1 2HWE1 1R083 3AMNA 3I2DA 4M01A 3DPRB 4Q8LA 4A2UA 3LEKA 4AVAA 5K0UB 1COV2 3WV6A 1UZYA 3IMNA 3IN9A 4GQ7A 1LU1A 5JI9A 1EYBA 3NJYA 2R0HA 1SCSA 3AMMA 3OEAA 3FLPA 1US2A 3H50A 1EV12 3U0ZA 3DCQA 1AZDA 1HQWA 1B09A 4IGPA 3S5QA 3T4HB 2Z2SB 5JOXA 4KG0A 4FSJA 5BNOB 4DPNA 3NAPA 4CDQB 3BPZA 5FFOC 3KV5A 2FZ2A 1WD3A 5I0DA 2VMEA 3T3YA 5HCHA 2HJIA 2VU9A 3A21A 3ILNA 1GNHA 3JD73 4XHXA 5J09A 3LEGA 2EXKA 5LZ6A 2BNNA 4XILA 2E53A 5IYYA 2YV8A 4MOAA 3OGRA 3PU8A 4KG8A 5FMOS 3TEWA 2OIIA 2W91A 4KQ7A 2PELA 1SDDB 2SBAA 1UMIA 3DXUA 3MIGA 1JOPA 4XXAA 4AK3A 2P2KA 5IK5A 1VPHA 5C71A 1QKQA 3A22A 1WBLA 2XJPA 4FAHA 1W6PA 2JIGA 4LNVA 3CLPA 5GZDA 5FK7A 4XACA 3AYDA 3W5MA 1FPN1 4ZPIA 3WX5A 1POV1 3HVDA 4E2SA 4URAA 4LBJA 2VZ1A 1S0GA 1ZBE1 3PTRB 4YPJA 3UYJA 3K3OA 3ZMOA 2D44A 2DVBA 2BNOA 2HH9A 4NOTA 5FPVA 2VMDA 2WLQA 2DTWA 3K46A 5GALA 3S7EA 4BWOA 2DVDA 4YVWB 5AC93 2JXAA 2XDVA 3I3DA 3LCPA 1AL21 3I3QA 3IDAA 2YGLA 1PO22 4M0NA 4EN8B 1NA1C 2Z79A 3OBZA 5C4WA 5G04L 3ZFGA 2WC2A 1VB4A 3IDBB 3OEBA 1NCQA 1MVEA 1ZVFA 3EJKA 3NV2A 2YGMA 1H1MA 3J7LA 4PQ9A 5A7WB 3UJOA 1RUH1 4CE8A 4AVSA 1VP6A 5FYBA 3KHBA 4WZFA 1JYIA 1AYN2 4SBVA 4QDSA 4CDXA 4E8DA 4YZ5A 1J3QA 4CU8A 3K75B 1PGL1 4AHYA 2UURA 4H7MA 4MHRA 1GOFA 2J1EA 2I2SA 3RYKA 2VMCA 3GF6A 4GB33 3VHPA 5AFBA 5JMOA 3PNAA 1AR71 5A7SA 3FZ3A 2R041 2LM3A 4XC9A 2ZGPA 2WLPA 1C3HA 3P5BA 4QB6A 4E2GA 1BHGA 3WD5A 5FMCA 3ZDVA 4A4AA 4D6RA 1S0BA 4JVAA 1YC61 4LBQB 1ULCA 1WUVA 1TNFA 1PVC3 2A6ZA 2PQSA 1XU1A 4Q1PA 1V6MA 4UFMA 1X8EA 1TQ5A 1MS9A 1LAJA 1CJDA 3O0XA 4KBBA 3VDBA 3WW4A 1BK1A 1STMA 4DRRA 5FZFA 4V2VA 1S1AA 4L97A 1VBE1 3GCXA 3HQXA 5H9QA 2ZEYA 3RG0A 3K2OA 3NW4A 1PIV3 3PJQA 3AL5A 4XUOA 2EIEA 4WM8A 3E5QA 3M3OA 3POWA 4INDA 4UFLA 1O4TA 3ZX7A 4AFMA 2Y60A 2VXJA 2BW8A 2RJ2A 4ZZ8A 3MIFA 1SFPA 2OS2A 5BUVA 3LA3A 3BU0A 4JHZA 4YM1A 4YW5A 1CR7A 5EJ3A 5FYMA 3V0BA 1UF2C 1ULDA 4AVBA 2VUJA 4TZDA 2X5IA 1VBD2 3VDCA 2NMOA 2WA4A 4M4RA 5FP9A 5E16A 4BK4A 2JE7A 3VUOA 5LK5A 2XVKA 4RQPC 2RDSA 2XL9A 2VZTA 1DF0A 3DECA 5DQ0A 4BQ1A 1H8TA 3GJBA 5FXXA 2KM2A 5F5CA 4CYDA 3D5OA 4M00A 5C8WA 5C9AB 5A3LA 2B46X 3KT4A 2C26A 3D82A 3KQRA 4XJ9A 1JHNA 2JG9C 1JZ6A 2V72A 5JR7B 1HW5A 4XF4A 3EHKA 1G8WA 2F17A 1G6NA 2YC2A 2AH2A 3TEXA 4JGZC 1CZTA 4XFBA 1CPNA 4M0HA 1NUKA 1E57A 2AYHA 4CP2A 2WQ8A 2G4IA 5H9SA 1NA1B 3ME2A 1ULPA 2V4AA 1HB2A 4O65A 4HFSA 1O91A 2BGOA 3OF1A 4Q4Y3 3ZXKA 3OUHA 3WR0A 3DV8A 1E5HA 4QX7A 3VBSC 2JG8A 4Z1VA 3SKVA 5FLIA 4Q4X2 4IETA 1UCXA 5FAXA 2IXKA 4LHSA 1F31A 3BIWE 4K6BA 4AHZA 3WG2A 4R8HA 3MEPA 3JBG1 2VNGA 1DZTA 2J1AA 1OBNA 4S2FA 1DQ6A 1BCXA 5FZIA 1W05A 1SLCA 4UF0A 1K45A 2N7GA 2XLGA 2XGXA 2A6YA 1JXNA 3HBZA 3POEA 1AR82 3HPNA 4NE9A 4X6RB 3CEWA 2FDHA 5FLJA 3A0NA 1G86A 3F2ZA 5C7GA 1A3KA 1LJ7A 2VZRA 5FMDA 3AZVA 2W1UA 3LAGA 1GQPA 2GN7A 1RL3A 4FOQA 4WM7A 4OYUA 4FPOB 5IVBA 3OBAA 3N7JA 4BJ0A 3O5SA 3KS7A 2LROA 1R1A3 1GU3A 2BQPA 2RG4A 1H2MA 2RS31 1UX6A 3BCWA 1WKYA 5T3NA 1UZVA 2ZPXA 4CXWA 2WS91 2EIGA 3D6EA 5IVJA 3TN92 1UX7A 2ZBJA 1JZ4A 4FQZA 4G4FA 3I3MA 3RZLA 3I2FA 4PDWA 4YG0A 4MVTA 3MV01 1V6OA 4A7YA 2GC2A 1BJQA 1CESA 5FKBA 1W0PA 1TEIA 4Y5TA 3CHXA 5FR3A 1SLIA 3LKJA 4YVSA 1PGW2 1WLWA 5C8CC 4LO4B 5BNPA 5BNNC 1VBA1 2V4VA 1C1LA 2J1UA 3Q8BA 4K1YA 4ORFA 4ZS3A 2K46A 3T1LA 2PTMA 3JCIA 1LEMA 1AVBA 1UO9A 4YRDA 3SISA 4K3UA 5FZOA 1H6XA 3VZJA 3H8XA 1UOBA 3THCA 5ACA1 4LA3A 1UU5A 1RUE2 4FPJA 5JZGA 5CVRA 4RQPB 4UXAA 3I3EA 3PIJA 4Y26A 4ZXKA 2BGCA 1JBCA 3KT1A 3ZOIA 1JS9A 5C3SA 4RFRB 1TME2 3ACGA 5FBJA 3EO6A 2ORXA 5CFDC 4W65A 3H1YA 1R082 1U12A 2Y34A 1PK6A 3ZXGA 4D3WA 1J59A 1D2SA 3UNPA 5I8SA 4I0AA 1JOBA 3VBFA 2E33A 5GLUA 4DEVA 2JG9B 4J1WA 3WNNA 2BNMA 1OT5A 2ZKNA 1PX3A 4LHKA 4QPGA 4DY5A 1V9U1 4EN9B 4E4DX 1JZ8A 3U4XA 4BPZA 1CD3G 4JGZB 2QQJA 5FY9A 3SITA 5KHIA 4AQSA 2FMYA 2FMDA 1S0CA 1F9KA 2X10A 4EE2A 2J1RA 1OMIA 2YXSA 5FZ3A 3LOBA 4CCKA 1SBEA 1QJY1 1OD3A 2EICA 4ITCA 5DPNA 5DUXA 2EXJA 1O5LA 1ZZ7A 5FYYA 3ASIA 2VNOA 2E9QA 3BTXA 5KC5A 5K4LA 1BBT1 4W6XA 1QXPA 2YPJA 4MXWA 1A8DA 4FPEA 4M3CF 3MFAA 2XBO3 1WA6X 1YIPA 2ZKLA 2NLRA 1N3OA 1RINA 2JIJA 2WJSA 3E5XA 3QACA 4HKWA 4XJWA 5C70A 4PQQA 4I3GA 1RMU1 1UYPA 4OHXA 5LBEA 3SMHA 4ZU4A 4AI8A 4HVQA 4N7IA 1KFUL 4AAPA 2Z4FA 1AX1A 4Q5OA 5FIXA 1AR61 1L7RA 5HBAA 3ZR5A 1WCKA 2YPDA 3ZXFA 2YZ4A 1L3JA 3FWEA 2YMZA 4Q2FA 3OUIA 3V0AA 3ORJA 2XJRA 1ODNA 2WZEA 5C5UA 1MS8A 1CJPA 2BVBA 4JDMA 1RHI3 2HWC3 2XWBB 3AZWA 4JRLA 2VM9A 4V2WA 4NHXA 1IKPA 4AI2A 4COVA 2GU9A 2YFUA 3VKNA 2YBSA 1BYHA 2RM22 3TOJA 1PZ9A 3R4SA 4LBMA 5DAXA 4IESA 2VCMA 4IEPA 4EWDA 1UMHA 1AX0A 1HIXA 1W2NA 1W6OB 1IGOA 4OFGA 5C8CB 1DHKB 2VVEA 2ZHLA 4Z92B 5BNNB 4XQDA 1W39A 2BUKA 3IZOA 3MYXA 2BWAA 2AREA 3WF4A 1KJLA 3DXTA 2RS13 1BEV3 1IS6A 1Y7BA 1GICA 2JX9A 4FPGA 4PF5A 2ZCWA 1TMF3 2ZMNA 1LHNA 4J25A 2CWMA 4GJYA 1DCSA 1PVC2 4TSVA 3RJ2X 2PAKA 2I07B 5K7PA 1DLLA 5A6XA 3MLJA 4LBNA 2ZMLA 3POGA 2MEV2 4AEDA 1W04A 1HN0A 5CFDB 1KQRA 1F8VA 1REFA 3B00A 5C3QA 1PZ7A 3ZFEB 3AFKA 1CX4A 3J7HA 3POBA 4COUA 5F9TA 4IL7A 1WZXA 3VL9A 1O6UA 2GH8A 1LNSA 2VZUA 2ENRA 3NAPB 1C8M3 1RUJ2 2P5BA 4QPIC 4YM3A 1POQA 1XE0A 4GKYA 1YQCA 2AEZA 4XFCA 2OQ7A 2C6SA 4IV1A 4P14A 4RS5A 2VMHA 1QQP1 1QJX3 2FZ1A 3VZNA 4R9BA 2BOJA 2PXJA 5DG2A 1J58A 4AQ2A 1VBB1 1EP0A 2WAAA 1QOOA 3OUJA 3FMGA 2OPKA 2FBEA 4H14A 5JR2A 1R092 1WLCA 4GMP3 1PHMA 1Q56A 1JTZX 1ND2A 4ONUA 5FY7A 5FO7B 1W6PB 5A7PA 1UN1A 3WG4A 2OT7A 4FP2A 5FBZA 2J1VA 3MICA 3M70A 3KCCA 2BBAA 2A6VA 1RUG1 4NPLA 3NV1A 2E7AA 1C57A 5AVAA 1NXMA 4K21A 4A6SA 4YZ2A 2ADEA 3LFMA 4LPLA 3NNLA 2E51A 2VOWA 3AFGA 4B4PA 4HL0A 4CEYA 4PIZA 4AAXA 1SZBA 5F5QA 3SEEA 1JUIA 4XE9A 2VOKA 2P34A 2IXHA 3TAYA 1CGPA 4RN5A 4MADA 1MS4A 1MZFA 4RR3B 4DNYA 3KMHA 3VBRC 2CU5A 4CCJA 5T5LA 5CKMA 3BIEA 2PHLA 4I02A 3WDYA 3ACHA 5D8AA 4Q0VA 2R1DA 5HI0A 1QGLA 2Q1ZB 1Q43A 3I2HA 1NG0A 2R061 5F7UA 4COYA 1JZ2A 3ECQA 5JXGA 3VD3A 3FC0A 2XR4A 3H1MA 4JTOA 1AJKA 1GP4A 1RGSA 1UYYA 2ERFA 5ISLA 3I59A 5LEJA 4XJ8A 1CAUA 3DUIA 4ASKA 4P02B 2F4LA 2VOTA 4HK9A 2C9AA 2VQTA 1RVF3 4KNCA 1Z7S3 4MH0E 3AMQA 4YW3A 1SFYA 4BA6A 4CEWC 5JXHA 1Y4WA 5CZKA 4C1XA 4QKNA 4UW6A 2VECA 1ULOA 1W8UA 2WO7A 4FPFA 4Y20B 4NROA 1BQPA 1OKQA 3OTFA 4LLOA 5BPXA 2FDIA 5FV3A 4H3WA 4LITA 4BZ4A 4FPHA 3LPFA 1GZWB 2R073 2JB4A 3KVBA 1XC6A 1KD7A 3OGVA 4MGQA 3UL2A 2I74A 1DIWA 2WDBA 4RHV2 2NQYA 2B4KA 4Q4W1 4XPVA 1W90A 3QLQA 4TWTA 4GWNA 2RS52 5EYXA 1YUDA 2VTXA 1IPJA 1H2LA 4Q0PA 4HKLA 3SEPA 3ZSMA 4A7KA 1RUC1 3VL8A 3ZYBA 5ABJA 5B2GB 5DUUA 4YWAA 2W94A 2PHTA 3CU7A 1O4ZA 2YG0A 3O0WA 3RSJA 5J98B 3LEMA 2Y26A 1HRV1 1HXS3 2BVVA 1JZ7A 2VVDA 3KQ4B 2IFRA 1UIJA 2PYTA 3LQCA 2WWSA 2RVAA 3WLUA 1X9PA 3WF3A 2BJSA 4UOJA 1AR91 5FYTA 1AXKA 4YZ3A 2BTVC 1YLLA 3MIHA 3VBUA 2B42B 4AI3A 5DMYA 1ZBA3 3KLSA 2IVJA 2PHXA 3IBMA 4OZOA 2GALA 1VBC3 1WCUA 1XE8A 2RV9A 4W4ZA 2R0FA 3HWJA 3RI9A 1G7YA 5T54A 4JGYC 2UWCA 5C3OA 2RR13 5T5PA 2B9UA 4LOSA 3W9AA 1SEFA 4SLIA 1VRH3 5A33A 4BXFA 5KWRA 2VMGA 1RUF3 2HWE3 5E89A 4C0HA 1FXZA 2VPVA 1QOTA 2GC0A 4XABA 4JRAA 4XMAA 2GNTA 4D69A 1AYM1 1DQ0A 3NNJA 2WNOA 4AFBA 1H4HA 2VQUA 4MGSA 4AW7A 4P9XA 5J48A 3O12A 5J1XA 4QKFA 4Y4YA 3IM0A 1CAVB 3OCPA 3VBRB 4YGCA 4BM8A 1GLHA 3P1IA 1HRI1 5I0SA 1XNCA 2OKXA 1YJKA 1XYOA 1ALYA 4UFHA 1H9PA 3RWNA 3ZXDA 1JH5A 4NIDA 5IATA 5GKAC 2NM1A 4HLTA 4I0BA 4I09A 1FV2A 4LORA 2AACA 1OLQA 2XBO2 4Y22A 3WXPA 5JCTA 3AZZA 3T2TA 2RMU3 2A75A 1LOFA 4B3NA 4LEJA 4O9GA 3ZN6B 3RQ0A 1M06G 3C7OA 5A1FA 2VR4A 3GGLA 1RTVA 5LA2A 3LDRA 4CEWB 4CPBD 2QQPA 4OI1A 3LB9A 3NNFA 4GH4A 1FPN3 4XF0A 1IS3A 1POV3 5FQ0B 4CCNA 1QHDA 3KWVA 3N9MA 3WW1A 3G6JB 4HMZA 3OY8B 1XNTA 1ZBE3 1O3QA 3H7YA 4PLMA 3BU7A 1C5IA 4JX0A 4IE4A 5BNQA 5FPBA 3LIGA 1N3QA 5HXVA 3J7MA 1COV1 5T5OA 2D5HA 4LXLA 1AL23 2OVUA 1YEWA 4IDZA 4NPMA 4DFSA 3THPA 2QVSB 2YU1A 4PI2A 1TVGA 4IXLA 1EV11 2YC0A 4LTAA 1CAWA 5FPAA 5H9PA 2JDYA 1QY4A 4B4QA 4B29A 2PLV2 4EZ4A 1RUH3 1CAXB 2H0BA 1KFXL 1XYNA 1VLNA 3DYOA 3U37A 3ZFFC 2AUYA 2ZABA 5F5AA 3HAGA 4C1WA 2VH9A 1DG6A 1Q8QA 3NJVA 2DCYA 1DQ1A 1N1VA 1CN1A 4P9IA 3QOPA 5KC6A 2WT2A 2R043 1BEV2 3DYMA 1XPWA 2YHJA 3IDEA 2GNBA 2KA3A 2JB8A 3DKWA 5F2WA 4XCAA 5FO9B 2ZX1A 4BQ2A 4MGKE 1Y9QA 4OZXA 5HCFA 2HWF3 3OD0A 1BZWA 2BWCA 2NP0A 4LJHA 2EA7A 3VBSA 1PK6B 1XB9A 4MGTA 1QEXA 2TUNA 2D3RA 4Y1VA 4HPKA 5IHRA 3ON7A 4JGYB 5BY5A 3GXUA 3I2OA 1ASJ2 2DTYA 4BIFA 3N3HA 5CG8A 1W3XA 4B7KA 1ZYBA 2HWB2 3J8F2 1ULEA 1PO21 3PURA 5I91A 2Z69A 2PFWA 5TSWA 3SNMA 4XTMA 5FY5A 3WUDA 1T2XA 3ZYGA 1VBE3 4LKEA 5SV8A 4DEQA 1MS0A 4O61A 3OGSA 4ES8A 3LIHA 2XQRA 1GNZA 2ZGSA 5FO8B 3LZZA 5DDJ2 2AR6A 1QJX2 3ILFA 2MHFA 3RYPA 1AYN1 4MGIE 2HWD3 2JDHA 4MXWB 1W6NA 4QB2A 2GNMA 3L9JT 1PO12 2Q8DA 1NYWA 4CDUC 1I5ZA 3HD8B 4XIKA 3ES4A 4ASLA 2WFF2 5LATA 1N1SA 2WQ4A 5J96B 1AL0G 4BMBA 3DL3A 3ZYIB 2WZPP 2Q5TA 2JE9A 3CL1A 1W8FA 4BQXA 4QX5A 3V0AB 4FTEA 2WN2A 3LFIA 2J7MA 2J1TA 4HK8A 1MZ6A 1SCRA 1HQNA 1V70A 2Q8OA 3ZR6A 3THTA 4XYXA 5J37A 3N7MA 4NO4A 5G05L 4NVPA 5HCAA 4OVEA 3RRDA 3CJXA 3IIIA 4QU2A 5A3OA 1MQTC 1S4CA 5L19A 2XLAA 4P5HA 3GHNA 4QB1A 2ZGMA 5D21A 5T55A 1BXHA 1PNFA 4UFKA 5C9AC 1UU6A 2VVFA 1W6QB 4FBFA 1MZ5A 3V56A 3ZFFB 2JD9A 1VBD1 2F6BA 3D0JA 3UETA 5LY1A 2YU2A 4IQPA 1OVSA 5A3TA 1VAKA 2C24A 2WA3A 3ENRA 1RVF2 1MEC1 1Z7S2 2VCCA 2YROA 2DF7A 3O1OA 3RGBA 4L0PA 2IVIB 1EPWA 2ZX2A 3PMSA 4HKOA 1OQEA 4FAGA 4B1MA 1W2TA 1UWWA 1OC1A 3POYA 1N3PA 4GZ9A 4BK5A 3RZHA 1LODA 2Q0AA 4HSJA 5JSRA 4NRQA 4GWMA 5FY4A 2BP6A 3RNSA 5A7NA 3B02A 3AB0A 2ORZA 4OMDA 3MPPG 1ZA7A 4WVWA 1B35C 1V6NA 2P17A 3AP7A 2RS33 4LULA 4BLIA 4NHMA 4R4ZA 4RA0A 4A6OA 5FKCA 1DQ4A 3ES1A 1ENSA 2WS93 4IV1B 3WDVA 2XUMA 3B5LB 4Q4V2 2B5HA 2QZ2A 3ETPA 3LF7A 2ZA9A 3EXUA 3H8UA 4AYUA 1WMXA 4OUEA 1HXS2 4LOTA 3SH3A 5F6KA 3WHUA 1LB2A 1WWYA 1JN2P 1Y43B 5FZMA 5A3MA 5LRSA 3VDDA 4CCEA 4KU8A 4Q4X1 1RUD2 1VBA3 3S0MA 2VBBA 2X53S 3VD5A 4QX1A 2ES3A 1S0IA 5GLWA 3AP4A 4QGMA 4AI1A 3H8RA 2XVGA 5KHJA 1UOGA 2BV4A 1NZCA 3IPVB 5KXDA 5GLZA 4CDWA 2GMEA 4FPLA 4N53A 1RUNA 3U07A 1YJLA 1VBC2 4CDUB 1RJ8A 2WABA 5ACA3 2NZ9A 4OHYA 1AR81 4JDOA 2WNVC 2RR12 1W9FA 4P08A 4K7JA 3SC7X 3KGLA 3TNPB 3EBRA 4LBOA 1PZ8A 1UOJA 2CGNA 5A7QA 3ZXEA 1GWLA 5CFCC 1S2KA 1VE0A 4JKMA 3PHMA 2JKXA 1FI2A 4NIAA 2V5DA 2BYVE 3MW4A 3LD8A 1D0GA 3SKJE 4YARA 2W46A 3VDAA 1PVXA 5T52A 1QDCA 1URXA 3M1HA 2CWSA 1ONAA 2RDRA 4PT6A 1V9U3 4UBGA 4J6GA 4CCOA 4LO7A 4DQAA 1S2EA 3OJBA 3TN91 2ILMA 5T50A 3POSA 3R4UA 5KXEA 1U5ZA 2G9ZA 1FMD3 2PHRA 1MQTB 3WINE 4JC1A 3VZKA 2ETEA 1PGW1 4GULA 1CAUB 2W47A 3PVNA 3VKLA 3PDQA 3FLRA 4Q0QA 4QMAA 4A45A 1BBT3 2WINB 3H42B 3PUHA 1OFNA 3VHOA 2RMU2 3VBOC 4XAAA 1NT0A 1UXZA 5T5JA 3CJIA 1S0DA 4EWAA 4S2GA 5K8SA 3DKQA 4QPIA 2A73B 2ZEWA 5FPUA 3VZOA 2D6LX 5FWJA 4HZFA 3AKQA 5I8YA 2VD7A 1FPN2 4QHZA 4HVOA 3OYWB 3FE5A 2WT1A 2VXRA 4YW2A 1XRUA 2Q8EA 3V65A 2LRPA 2VTFA 3IDCB 5C33A 4GJZA 4XQWA 1R081 1QJU2 2FCVA 1NLSA 3C7GA 3C8XA 3ST7A 2EIDA 1LULA 4PBOA 3IIAA 3HT2A 4CUGA 3HNBM 3DYPA 4I30A 1DU3D 1IKQA 4N8MA 5FXWA 4NHYA 2BERA 2HBUA 2HYXA 2DUOA 4YNIA 5DXDA 1B35B 2P3IA 3M7AA 5CKNA 3I54A 2D7FA 3MPBA 4JHTA 1NZIA 1H6YA 5JVVA 3HBKA 3EB7A 3U11A 1YWKA 1ACCA 5DUWA 1FNZA 1OD5A 1VR3A 3MI8A 4HXCA 1LHOA 2DDUA 4IEVA 2DVGA 4ZS2A 5CYYA 5C6CA 1H8VA 1YQ5A 3QBQA 4IE0A 1K5MC 4IEOA 5DAQA 2VUCA 2VUAA 2K0GA 1DFQA 1DQ5A 2E7TA 1ZRCA 2GAUA 4BIOA 1IG3A 4OHZA 2E26A 1LHVA 4XDQA 4FO9A 1OQ1A 3MF9A 2ZAAA 1QH7A 4XUNA 4B1LA 3L2YA 1G9FA 2HWF2 2R30A 5GM0A 2G19A 4KWKA 5AFEA 3C7FA 4IERA 3VKMA 4BQWA 2DCTA 3ROUA 4FI9A 2R32A 1QJFA 4Q0SA 2CGOA 3SLIA 3ZIWA 5A3PA 4YW4A 5LBCA 3W58A 2WNVB 2VJXA 4K9SA 5LY2A 1XE7A 3M4FA 4XXPA 4V1PA 2ZGRA 3JXSA 4QXHA 5CFCB 1GZCA 1XNKA 3KV9A 3U75A 4NIHA 3MUY1 3NV4A 4N43C 4OHWA 4Q27A 3S57A 2CSGA 4OCTA 4XMIA 2IC1A 1W0NA 3RZZA 4BQ4A 4COWA 5FTTC 3CZUA 5DAPA 5FP3A 4CP9A 5FP8A 5FPXA 2P3YA 4C91A 2RM21 4FOWA 4FTSA 2PA7A 1YO8A 1V00A 3CZJA 4OI0A 2HWD2 3WQBA 3RZMA 4J1XA 5E8AA 1HB1A 3I7DA 1VBB3 2WFPA 4IV3A 1WD4A 2Y0IA 3BGAA 3E5UA 1W03A 5LK7B 3RYRA 5D1IA 3ZKUA 3ZSKA 5LEKA 1ZM1A 3Q8AA 2ARCA 5F2SA 3VBOB 2E7QA 1AJOA 3ZFEC 1H2KA 1U5YA 3FJSA 2CAUA 3IWZA 4HONA 3TWIA 4QXBA 5FZ7A 4TLFA 3HQUA 3MW3A 1W6MA 1KDKA 1UPIA 3O14A 3NAPC 1OOPA 2A1XA 5FZEA 1J83A 1PVC1 3UT0A 3AJZA 1HQLA 1JZ3A 5JI7A 2ZAHA 3VBHA 1ND3A 2G9FA 5L73A 1DYOA 2MEV1 2AENA 2E31A 4YGEA 5FZHA 4CZSA 1QWRA 3PJYA 1IG0A 5FYVA 5GZEA 5AVPA 3JD72 4OQ8A 2D97A 3KGZA 1J3PA 5FMOL 4ARYA 3I2KA 4AGRA 1A78A 3ZYHA 1I9RA 4CU9A 2A70A 4FPKA 1RUJ1 5L9RA 1LOCA 4Y1XA 1WCSA 4HN1A 5LASA 5HV4A 2VL4A 1A8MA 5A3UA 1LU2A 2TBVA 3NSTA 3GDBA 5A6ZA 2XWJB 2WNUA 2VBDA 3KF3A 5F3GA 3TNQA 1X82A 1SHWB 2JDAA 3R4DB 4JKLA 4QDRA 1G9BA 1YQ2A 2ZGKA 1LEDA 3WP3A 1NY72 1RUOA 1K5MB 1R091 4WVMB 1SG3A 1W2AX 2A6WA 2A6XA 4LKDA 1LOGA 2JE8A 2PMWB 2IFWA 4CUBA 2DUPA 5AC92 5C4WC 2Y0OA 3ZFGC 3PUSA 2JDKA 5IVFA 1NCQC 1SPPA 1DGLA 1NCRB 3IT8A 3Q8FA 4FXKB 4IW3A 2NPIA 4QKBA 4RR3C 4U36A 3CQOA 1LENA 1XNBA 2ZHMA 5EV7A 1OA2A 2B7YA 4BHPA 1JYTA 1YFWA 4FFGA 4WZCA 2VNRA 4BCUA 1NE6A 4XEZA 5A32A 3T4VA 4IE5A 1EAH1 3MLKA 2W95A 3C7EA 1O8SA 3EYPA 1EY2A 1SLTA 3DPRA 1GUIA 5K0UA 1QXRA 2E32A 2QZ3A 3NNMA 4YW1A 5CADA 5FPZA 5ANNA 3AKRA 5F5IA 3MO4A 2W1WA 4NUBA 4GB32 4N43B 4AF9A 1H30A 3WNKA 4QGLA 4Y24A 4L11A 2D43A 2JDMA 4QHBA 3B3QE 1OQDA 5F8PA 1N1YA 2VNVA 5BNOA 4XFAA 3RDIA 5FYCA 4CDQA 3J9SA 1UZ0A 5FZBA 1H2NA 2B8MA 2Q1FA 1QH6A 2VZQA 1HDKA 2Y38A 2RJLA 3PTYA 2ZX3A 3AL6A 3LPGA 1OPMA 4IEZA 5EFUA 1OLMA 3TB0A 4E27A 5EPAA 4UFJA 1AR93 1C5HA 2ZGLA 3B01A 4AEMA 5IT6A 4A3ZA 2CNAA 5A1AA 3JZVA 3NWKA 5HCBA 2W5FA 2P4EA 3FHIB 4EV0A 3O1PA 3O1VA 3LEIA 4N9HA 4WM8C 4QGNA 4ATEA 4ZKTB 5F3CA 1I5PA 1QNWA 2GSYA 1FOD3 3OD4A 1PIV2 5BXXA 1XSRA 3ZSJA 3WDTA 4MXVA 1X36A 4H7LA 2EAKA 4W6WA 4RHV1 5JIAA 2X5IC 2FDJA 2ADDA 3FBYA 4Q1RA 4YVWA 1VIWB 3I4IA 1NQDA 2GMPA 3E97A 4EN7B 2J22A 3ZYJB 1DP0A 2EVXA 1SLAA 2VW2A 2RS51 4Z82A 1IHMA 4XFIA 3BALA 3N35A 2V73A 3WEZA 4KU7A 4OUSA 1FMD2 4H55A 4GIQA 2C4XA 5FZDA 1REDA 1P8JA 3N36A 5FLHA 4CSWA 1HRI3 5A7WA 1OXCA 3UGHA 1YFUA 3NQHA 4ZHNA 3GZUC 4JQTA 4ARXA 4GWJA 3RMYA 2CDPA 2E6VA 2Y64A 3R05A 2WO3A 3U14A 1NLQA 3ZM8A 2XJVA 5CEHA 3RS6A 3UV9A 3VN4A 5J7MA 4IGQA 3SH4A 1LGCA 3M2MA 4QXKA 4DO0A 5FZ6A 2PAMA 4UFIA 4S2DA 3K3NA 4LLFA 4IEUA 3AP6A 4OLLA 3WCSA 2GZWA 1A6CA 3POJA 5C4WB 3ZFGB 5HPOA 4LE4A 2PAEA 1Y9GA 4ZU7A 1NCQB 1WGPA 4AVCA 4ZU5A 5L9BA 3H8OA 1S0FA 5F32A 2JECA 3EMRA 5JSPA 4LBQA 4XBLA 5DZEA 1H4GA 2JG8C 3H7JA 1Q3EA 2WRAA 2WZR1 4N7UA 5IAVA 4Q4Y2 4NIIA 4CVUA 1OLRA 2P1BA 4CDXB 1COV3 2MNGA 1OH4A 4GMP0 5LA1A 4LO6B 4DIQA 3N4MA 1Y3TA 1UOFA 1YYNA 4ZZ5A 5A6YA 2W08A 3FHAA 2IXCA 1ULGA 1GZ9A 3FLTA 4N90A 4FQ4A 4LMFA 1EV13 5A3NA 3KV4A 4KWJA 1GP6A 2CL2A 1RUI1 5JXIA 4O7XA 2IUWA 2XJSA 4FFFA 2GDFA 3AC0A 2HKXA 1LGNA 4UI9L 3T2QA 4CCLA 2VW1A 2CAVA 4KWLA 4WM7C 4WVVA 4YM0A 3WW3A 1O3SA 2QJVA 2XBO1 1Q8PA 4D8MA 4BH9A 2ID4A 5JDBA 2ZHKA 4ISQA 1W8NA 3NKGA 3FUOA 3ACIA 1R1A2 2MPFA 1FYUA 4B7EA 4PDWC 5A6QA 5JOZA 4WM8B 1XXNA 3HMYA 4R9AA 5L7OA 4D6SA 3MZHA 3WQ1A 1OPOA 1MACA 5FUIA 3V64A 4YVSC 4UW3A 2RHPA 3WQ7A 5BNPC 2J42A 1PX4A 5FK8A 1MS3A 3ZSEA 5GLVA 1VAMA 2WN3A 4YGBA 2CTVA 4LO8A 3W5NA 3V0BB 1DGRN 2XPJA 1PO23 4Y1ZA 3WP5A 2P3KA 2X5IB 3M8LA 3X29B 4LIVA 5IK8A 1AHSA 2VY0A 4PF1A 2O8QA 1OA3A 5C3PA 1NA1A 5JZGC 2PLV1 3W20A 4YSFA 4NRMA 4GD4A 2P6CA 4RD7A 4F3JA 1FV3A 3E6BA 1H8TB 1H0BA 3ETQA 1C4RA 3UK9A 1EPZA 1AYN3 1GQGA 1NX9A 1OUXA 2B9VA 2VOXA 3I2IA 1PM7A 4FCAA 4QQLA 1BMV2 3PVOA 1PK6C 4IEQA 2VG9A 5FZGA 1PM4A 3VBFC 3H1WA 5L9VA 2DCKA 1IQAA 4D6QA 2EF6A 4WV8A 1BEV1 4A7ZA 4QPGC 3AMPA 4P9YA 3K4DA 4P00B 3NV3A 4FXGB 2QFEA 3PLQA 1BK0A 3BOWA 4X6QB 3SCHA 4MUVA 3UKVA 2D3SA 2D5FA 3UKTA 2VZPA 5I93A 4E2QA 1SFNA 1QXJA 2OW4A 3DF0A 4FT8A 1UD1A 4XDPA 5APAA 1VB2A 2JWPA 2Y6FA 4CU7A 1UYXA 4JAAA 4K8FA 3MGUA 5F3IA 4ATFA 1FATA 1LOAA 2EXIA 3T0AA 2CDOA 3VZMA 1ASJ1 2W1SA 4JKKA 3MF6A 4DZGA 4RL7A 2JG8B 5FUNA 2H6CA 3H0OA 3AX4A 2HWB1 3GZEA 3J8F1 3KM5A 2X05A 4Q29A 2BPA2 2FHRA 1OURA 1TNRA 3G7DA 4NRPA 2C9KA 3VKFC 3NJXA 5IJRA 2Y8KA 1HLCA 4YW6A 5JAXA 1S0EA 5J36A 5EYYA 3URFA 5DDJ1 3A0KA 3K51A 4N9IA 4UF0B 1QJX1 4ES9A 1VJ2A 3SH5A 1RITA 2R49A 1HJFA 3GBFA 4BQYA 1SLLA 1D4M1 2D93A 2UYAA 2Y6KA 3FN9A 3R0RA 3AXDA 4BQ5A 5FDBA 1APNA 3AYCA 5IW0A 4C8DA 2WT0A 4I01A 3AYEA 5EJ1B 2OXBA 5DZFA 2DVFA 3ZLIA 2OUHA 3U1XA 4K20A 1AF9A 1QF3A 2X09A 4LKFA 1HJGA 1MEC3 1PO11 2IXJA 4WM7B 4Y1UA 4MHUA 2C0ZA 4XETA 1LRHA 5IK7A 1QU0A 2WFF1 1UXXX 1ZZCA 2W92A 1RHI2 2HWC2 1ZZ9A 4RQPA 4LBKA 4YFWA 4XBNA 4PDWB 4QPYA 2HLEA 1REEA 2HBTA 2VCAA 1E5IA 5FMBA 4CRQA 1C8NA 4HVRA 4R4XA 2D6PA 2WL1A 3AP9A 4HANA 5HXMA 4YVSB 3F95A 3RMXA 3ZXAC 4DXZA 2ZZQA 5BNPB 1I3HA 2JG9A 3P3NA 2OYZA 1NXD1 4D7TA 1W3VA 2UWAA 1KJRA 4QM9A 1DGRA 5KXBA 3KZ4C 3T2OA 4JGZA 3J7NA 5C3RA 4A42A 5FZOB 1AR73 1UZWA 2RS12 3O0VA 2CHHA 2WYFA 3N7KA 3WNLA 5E88A 4EZHA 2DU1A 4MGZE 1CZVA 5F37A 5JZGB 3RJRA 1TMF2 3FFZA 1DGWX 3FX3A 1OKOA 3WDXA 1UY3A 2HYKA 4AFDA 1D4VB 1W9YA 5CNAA 4Q4X3 4RFT0 1ODMA 2A3YA 3GZTB 3HOBA 4NAOA 3NKTA 1RVF1 1Z7S1 4YYOA 3VBFB 4CUAA 2AC1A 1R1ZA 3U4SA 1HKDA 1G9AA 4QPGB 1OOPB 2ZGUA 5FYZA 3BTAA 1V0AA 4FOYA 4QX3A 2CYFA 2DURA 4KGGA 1AR83 3VBHB 1FOD2 4XBQA 3K77A 4BE3A 2PQQA 1F15A 1C8M2 3AZYA 3Q9OA 4IV1C 1D7PM 4RS5C 3MIDA 3U10A 4AL9A 3NL1A 3POIA 3AVSA 1E5SA 1K12A 1S2BA 3OG2A 4A3XA 3TEYA 3HN3A 4Q8KA 2O0OA 2W0XA 5DAWA 2J1SA 1HX6A 4LBLA 1O3RA 1OH3A 3MLLA 4XF1A 3ZDSA 1V6JA 1UNBA 2EALA 2NN8A 3PL0A 5FZ4A 1OFSA 1ND2C 2ZX0A 3KB5A 4LUMA 4EQVA 2QNKA 1C28A 4EN0A 1DYPA 1DGWA 3TN93 1UL9A 4Q4V1 3KSCA 1RIRA 4KL1A 1OUSA 5FYIA 2QUOA 1MS5A 1HXS1 3OOXA 4AZZA 3P3PA 4TTGA 3ACLA 4QU1A 1Q8VA 3GALA 5GZFA 1YQ8A 4AQ6A 4CEYC 1RUD1 4YW7A 1X9TA 2WO1A 3JU9A 1UKGA 4K1ZA 1F5JA 2XLFA 4UT5A 4XUTA 2DV9A 3LA2A 1S55A 1PMJX 5I0UA 3ATGA 1O7FA 5C8CA 5BNNA 2WSVA 2GNDA 1SLBA 1N1TA 2K9ZA 4XUPA 1DDLA 4XF9A 1VBC1 3J26N 4NPRA 1KDMA 1DBNA 1LR5A 1LHWA 4XIOA 1F4HA 2OZ6A 1JOJA 2GP5A 5EQUA 5D8AC 2WUHA 3IAQA 1UAIA 3PU3A 4HSLA 2DYCA 1YQ6A 3T0DA 1FAYA 3BTZA 3VGIA 5JIUA 1D2QA 1DQ2A 3UKNA 5CFDA 1WW7A 3ZFEA 1UQXA 3LSDA 4M3CA 1GOGA 2D40A 2Y33A 4NHLA 1UIKA 4IE6A 1BVVA 4NHKA 1YNAA 2X8KA 1AX2A 4XDOA 5I8TA 4LHLA 3B94A 3GZAA 2D98A 3JBG3 4MSVA 1JU3A 2WR9A 3B9IA 1MPXA 4PI0A 2W9XA 5LBBA 4NWWA 2JICA 4AI9A 5FXZA 3FBMA 2IXLA 2WIIB 3CMGA 4H2AA 4UYBA 3INAA 5IVYA 3VKOA 1XU2A 5EP9A 5FYSA 2ZMKA 4CCCA 2H0VA 2RMU1 4XOGA 2ZEZA 3OPWA 4M4PA 2R072 2XHKA 3WG3A 3WF1A 4AEDB 2P6HA 1Q8OA 2OX0A 4QX2A 3JQXA 5JWPA 3OPZA 4RGKA 3ZO0B 3BVCA 5LCWL 3MUZ1 4W50A 1WCDJ 2Q1MA 1JYWA 2HEVF 1V6LA 3B93A 4KI5M 4XTPA 1VMFA 3N7LA 3WW2A 5ABJC 1UY0A 2QCSB 4WVZA 2O14A 4ET7A 4E8CA 1SBFA 2XL7A 1IPKA 2DFCA 1QDOA 5F39A 1U5IA 5I0TA 4BOWA 1QJU1 2B39A 4FFIA 4RS5B 5DN2A 4YG3A 2VW0A 2F4PA 1L7QA 2WKKA 5L36A 3E6DA 1KITA 5KR7A 3C3VA 1GP5A 3A23A 1ENQA 4NJ4A 3VBUC 3S6PA 4D94A 4XHBA 3H3ZA 4DMIA 1ND2B 2YY1A 4RR3A 5LB6A 3S30A 1NOVA 3CIHA 2BRTA 4XUQA 1ENRA 3GBGA 3OSDA 1SDWA 3NVCA 3E1F1 1W06A 3WSOA 2RM23 1YRZA 1OSGA 1DYKA 1ZBA2 5CAZA 2ZEXA 5LW9A 1JZ5A 5GLTA 2CY6A 3I3BA 2UU8A 4XQ4A 1N47A 3BN6A 3RI8A 1RXGA 1T6BX 1X8MA 1ZZBA 2VO5A 2FDKA 4CEYB 2WBKA 2XXZA 3P6BA 2BU9A 1VRH2 4MYEA 3T0BA 1RUF2 2HWE2 3USSA 4L92A 4QQPA 5EZWA 1OA4A 2HWF1 5ANQA 5JLVA 2QDRA 3WHTA 2WO2A 3WY6A 3B69A 1WCQA 4Z8BA 5JPMB 4Y3OA 2RJKA 4YZ1A 4Y20A 2XVLA 2YYOA 2D6KA 4UW5A 3APBA 1GBGA 5D8AB 3I8TA 3WP4A 4AVTA 1YI7A 2QE3A 1FT9A 1GZWA 5FZCA 3ZMNA 2MEV3 5FYUA 4E9KA 3WT3A 4Y4RA 1JUHA 4I3PA 1LECA 2QQUA 4MLOA 5C5TA 1QJY3 2RDNA 5A7OA 5KHGA 2BEOA 1EUUA 2ET7A 3I59B 4P5YA 2WQZC 4YZ4A 4B4RA 1LOFC 2G1MA 1RUJ3 2Y6HA 4HN0A 4XJUA 2XJTA 3RPQA 2BGPA 4NIGA 4XURA 2KXLA 5FP7A 5IAXA 1UY1A 2WYSA 4GH4C 3OGJA 4RSUA 1GSLA 5CKQA 4LUKA 4Z07A 5SV5A 2HWD1 3UGFA 2JD4A 2GC3A 1RMU3 2W2IA 4OMCA 2CV6A 1RUE1 1V6KA 1LCLA 5FZLA 1WW5A 5FP4A 5DZGA 1R093 4FP3A 1MEC2 3RZGA 3DEMA 5F6LB 1ZBE2 3W21A 1TME1 4DUVA 2VZSA 1YIFA 5KHHA 3VHRA 4ZONA 1AR63 1YXWA 3TEZA 3H9AA 1JW6A 2LW8A 4HT1T 1AL22 3MIBA 1XJAA 3M3EA 1WLDA 4DUXA 5IVVA 4TN7A 2W87A 4AR2A 3HNMA 1ZZ6A 5ABJB 5FZAA 5LWBA 4JV4A 3WP6A 5I0RA 1IS4A 4PJYA 3ZXJA 2WWUA 2DBIA 1NQJA 1W9WA 1EAH3 1RUH2 3AM2A 2SLIA 1UKRA 4DUWA 3GHMA 3JD71 1QJZA 2L9LA 3PUIA 4K8RB 1PGL2 1SQ4A 3USUA 3JB8A 4Z2AA 4MO3M 3KVAA 4DINB 2JKBA 3RVHA 2VGDA 1OF4A 1ZRRA 1AR72 4YFZA 3VBUB 5K9YA 2R042 2VULA 4YG6A 2XJUA 5LA0A 1CAVA 1F4AA 2XKOA 2ZACA 4FVVA 5CU1A 3VBRA 1RYYA 3VB9A 1G9DA 3S7IA 1NCRC 2VCBA 1K3IA 4W6YA 5D2AA 4OQ9A 1NY71 2LTNA 4FPCA 3THDA 3D4KA 4AHWA 2FDFA 2YC4A 3IAPA 1IZ3A 2NYYA 3AK0A 4P9LA 3A7QA 5A33B 1H1IA 1CIWA 1JHJA 3T1MA 2DCJA 3GNEA 1LOEA 3MDPA 5AC91 3NNGA 1US3A 2TNFA 1WA4A 5FXVA 5FPLA 2HEYF 1W8OA 3ZN6A 4GAZA 5F1RA 2PHUA 2BOIA 3LSEA 5DABA 5E6HA 1QJEA 3OPTA 1VBE2 2P3JA 2R16A 1W2OA 2ZHNA 4CEWA 1HV0A 1ZA4A 2W3JA 1AXZA 2ZOEB 5FQ0A 3NMBA 3OY8A 2JDPA 1JYVA 2V09A 3FL7A 1GANA 4EJRA 4TYSA 4P9GA 3MW2A 1T6GC 4RHV3 3WDWA 4NN0A 4CP1A 1TE1B 2Y6JA 2QQVA 1QQP3 5FZ1A 3ZYRA 4XJAA 3BUCA 1GKBA 5FZ0A 3AKTA 4META 5EHDA 1KGYA 1VAVA 2JDZA 4GB31 2RS53 4QHOA 4Y22B 1DZQA 2DFBA 4DXTA 3IB3A 1X7NA 4HOOA 3WUCA 3C7HA 5KBFA 2XJQA 4PHZA 2H6BA 3ZIXA 1CAXA 3HIFA 4GH4B 4BYYA 4CXYA 3SCFA 4KMQA 1SMVA 4DXRA 1RJ7A 4AI0A 1RUG3 3NRUA 3KV6A 3SQOA 5LRRA 2XG3A 2VQ0A 1KRIA 1UU4A 2FDGA 1KS4A 1WW6A 5LA9A 5FZKA 1LOBA 2DWRA 2YDEA 5JOWA 1QMJA 1RXFA 2W68A 1YFXA 3BOPA 4BDVB 3Q8CA 5F3EA 2VE1A 4HETA 1UZZA 1CAWB 2I45A 3ZVXA 4KBZA 1Y9MA 1PIV1 2KR2A 5LBFA 4W8JA 1JYCA 4FTBA 1XBFA 4XF3A 4JGYA 2WZR3 4BB3A 1HN1A 4X8PA 3AYAA 4BXSV 5DAVA 1GYKA 2BBVA 1W8ZA 4K40A 3UJQA 3H3UA 2VQAA 3QD6A 2R063 3ZPYA 1CZSA 1CQ9A 4URTA 1MVQA 2D6MA 1F2NA 2A3WA 3M3QA 3BODA 1FMD1 3JBG2 3K4ZA 5J3UA 2QKDA 1BVP1 4DB5A 1GOHA 1RUI3 4MG2A 3GYDA 4L8QA 1W28A 4PLNA 2R7EB 3QCWA 3PMEA 1QOSA 1J84A 2C1FA 3KT7A 3PVEA 4IEWA 4QKDA 3VBSB 3FFQA 1O8PA 3CF6E 4OULA 5BV6A 4OHVA 1GWMA 1YI9A 5FJKA 2QQOA 4HPKB 3PUAA 4PBPA 1X33A 2YBPA 3WNPA 1JYXA 3NJZA 4XVHA 1OVPA 1UMZA 1UPSA 1GFF2 4CDXC 3T2PA 2A7AA 2XONA 1PMIA 4BU2A 3B7MA 3AVRA 4DOUA 4Y1YA 3WVJA 4AEJA 2RS32 1D0HA 2A3XA 3HN1A 4A44A 2IWGB 1KS5A 4ZY9A 1H1AA 4JDNA 4EWEA 4Q4W3 3JB4C 1ZRDA 3WNXA 3ZSLA 2WS92 4M3CE 1MZEA 4AFAA 1XSQA 4CCDA 1I1EA 3VDDC 5JUVA 4Q4Y1 3FHQA 1RUC3 5JMCA 3DN7A 2VBPA 3LOIA 4HBNA 3IMMA 1W6NB 4LR4A 4AE2A 2P37A 1ZZ8A 1ENXA 1HRV3 1VBA2 3OGGA 1XYPA 2EXHA 4CDWC 4N53C 1W8TA 2WAOA 3IKWA 1W8WA 3UESA 3BB6A 3T30A 1LGBA 1SBDA 2VC9A 4QXCA 4CA9A 1H9WA 2PLV3 4LIUA 2FCUA 2O1QA 2QBXA 1W2UA 1KEXA 2V5YA 4GKXA 4XAEA 5ACA2 3RFRA 1MS1A 5FRAA 3I2GA 1UY4A 1EUTA 1CONA 1W6QA 2BFUS 4RGAA 2RDQA 5E1RA 1A34A 2VMIA 4FPYA 3ZFFA 4LBQD 2XHNA 4QQ2A 4AFCA 2UY8A 2GH2A 2EIBA 4QPWA 1VRBA 1CIYA 1ZX5A 2A71A 4U2AA 3BI3A 1R1A1 3BTYA 1UW8A 3AMHA 2ZZJA 3BPSA 1V9U2 2HEWF 2QQNA 5GZGA 1LESA 1JODA 2OZJA 5FY8A 4OUMA 4FFHA 1AYM3 1O4YA 5EXOA 5CBLA 3N9PA 4GALA 2UWBA 3O1UA 3HNYM 3WG1A 3ZPOA 1H8TC 1ASJ3 1NAEA 1O59A 3J4UH 4LHNA 1QJY2 4M3CB 4Z2WA 1CPMA 2ARBA 2Q8CA 2HWB3 3J8F3 5ERLA 2UY9A 1IPSA 4IEXA 5DG1A 3BKZA 2W52A 3CJIC 4JCKA 4UBHA 3MIEA 3PUQA 4CTEA 4QM8A 1PNGA 2ZGNA 1BBT2 4LK6A 2ZXQA 5KHKA 3LWCA 1C1FA 4S2HA 4MZUA 1VMHA 5DDJ3 4EROA 2ARXA 2B45X 3WCRA 4R52A 3T09A 4AHXA 1AXYA 1D4M3 3AZXA 3GJAA 2BZDA 4GXLA 4ZXEA 1RMU2 3PVBB 4GWIA 1BMV1 4LE3A 4QX0A 4QAWA 3EQEA 3PIGA 4YGDA 3MHZA 3WOGA 4C0BA 4G9SB 1AR62 3O7OA 4NR1A 1PO13 4XFGA 3Q8EA 2UYBA 1GR3A 4FOVA 5IFPA 5FY0A 1FX5A 1HV1A 2PHFA 2VMFA 3IPVA 4KWUA 1J1LA 4YM2A 2ZS6B 5EJZB 2WFF3 1FNYA 1PMHX 2VUDA 4CDUA 4QQHA 2G9GA 2JJ6A 3DGTA 1LTEA 1X50A 4IE7A 2AGSA 2JDUA 4ASMB 4UW4A 4PIXA 4BLJA 5HV0A 1EAH2 2ZX4A 4LKSA 4QD2A 2YB7A 5GJ6A 2QQMA 3RZJA 4JQRA 2K2SA 3AXEA 1WBFA 1Z0HA 3VDDB 4E4ZA 5JPNB 4C90A 4MGYE 5FUPA 2PHWA 3M3IA 3VHNA 2ZGQA 3OBTA 1YFYA 4XZUG 3RWKX 1IOAA
chains in the Genus database with same CATH topology
5H9RA 4CDWB 4N53B 1OHFA 1ULFA 1NLRA 3SHRA 3KCYA 2IXIA 1MQTA 3E6CC 4AWDA 3VV1A 1O5UA 3D0SA 2DCZA 2DU0A 5C9AA 4F83A 2R1BA 4EN6B 2IZWA 4KGQA 4MX3A 2Q4SA 2ZGTA 5JOYA 1RHI1 3WQ0A 4PCRA 2HWC1 1Z78A 3OYWA 3ELNA 4YLZA 1WMFA 3B9CA 4L2NA 2CGPA 3TYJA 3M3CA 2NMNA 3VZLA 1GQHA 1QNYA 4IV3C 3LA7A 1QQP2 5CG9A 4XFFA 3OBRA 2TEPA 1VBB2 1RB8G 1IS5A 4KH9A 1B35A 3CJIB 3MFCA 3JQWA 5FOBB 1GV9A 4QPIB 2R6QA 4Q4V3 1J3RA 4PLOA 5CIRA 2RS11 3D8CA 1OOPC 3HT1A 4AVVA 1MR5A 1G9CA 1TMF1 4B8EA 1Q8SA 3VBHC 1ND3C 1U0AA 1RUG2 1RUD3 4LA2A 2XH6A 2E63A 4XW3A 5FCCA 5CA6A 2DVAA 4Q26A 2PN5A 3WZ1A 4IEYA 4WBBA 4CP0A 4DY3A 1W0OA 2ET1A 5EWSA 1ZREA 1WLTA 2QDNA 3GBWA 1V6IA 3K48A 3ALQA 4AGGA 4XZPA 1FOD1 5L7OC 2WNUC 1C8M1 2PHDA 1BKZA 2GMMA 4P9WA 2WZR2 3TRSB 4E4SA 4QT6A 3CNAA 5BYNA 2WNVA 2WSUA 3W59A 2AZ5A 1J1TA 4LO5B 3USUB 1ZRFA 4ISRA 2R062 5CFCA 4F8AA 2RE9A 2ZTNA 2EAAA 2Z5WA 4GMP1 3ZYPA 1VALA 4COZA 2Q30A 1VBD3 1CVNA 1RUI2 4P9JA 4F7ZA 3L2HA 2C5DA 5IUQA 4DS0A 4OI2A 4G3YC 4Q0UA 4AQTA 4AEKA 5GZCA 2LALA 3SXWA 2FQPA 3KD4A 3DPRC 1S0JA 2D3PA 5K0UC 1WMEA 5DUVA 2W39A 1I6XA 1LHUA 3AP5A 3VBOA 2VOVA 2OA2A 5IK4A 4Q4W2 2D6NA 4OI4A 2XB6C 1Q5OA 2GC1A 2YUEA 2LUWA 5BNOC 4CDQC 2JENA 1QJU3 1RUC2 3ZN5A 4Y5Z0 4XFHA 1HRV2 4I0WB 1POV0 4IV3B 1PGSA 2GN3A 4GA9A 3QH7A 4PIYA 4AGVA 1SACA 2ZGOA 4AEDC 4AXOA 3ILRA 1AR92 4AG4A 3WDUA 1OI6A 1AUYA 4R9CA 2BFUL 3LGRA 1W6MB 2X29A 3JUUA 5CB7A 3VLBB 5JSOA 1KXGA 2ATFA 4MV2A 1ND3B 3ZXLA 1K5MA 2R071 2D6OX 1YCIA 4WVMA 4YVWC 1F5FA 2XKPA 1RC6A 3SCGA 5FREA 3ZN4A 1XNDA 3CO2A 2Z42A 3AJYA 3HR9A 4R9DA 1DZRA 4D7YA 2O8OA 3TBDA 1AYM2 1NCRA 3A4UA 2WNEA 1ZNPA 2JEMA 2ZJCA 4XJZA 5L7OB 1YHFA 2WNUB 3KCXA 4L9BA 4X8NA 1HRI2 4DRVA 4QQOA 5KXCA 1WW4A 1M4WA 3AKSA 5FOJB 4N43A 4RGGA 1W6OA 3FUQA 1D4M2 2DUQA 4L99A 3C2UA 4O9EA 1ZBA1 4D7SA 1U5XA 1XQNA 3AKPA 4JTNA 1NE4A 2A5ZA 1WMDA 2OUJA 3QH6A 1RUE3 2RR11 3NO8A 4I2OA 5A32B 3R6SA 4BMEA 1VRH1 1LKNA 1TME3 4NWVA 1RUF1 2HWE1 3I2DA 1R083 3AMNA 4M01A 4Q8LA 3DPRB 4A2UA 5K0UB 4AVAA 1COV2 3WV6A 1UZYA 3IMNA 3IN9A 4GQ7A 1LU1A 5JI9A 1EYBA 2R0HA 1SCSA 3AMMA 3FLPA 3H50A 3U0ZA 1EV12 1AZDA 1HQWA 1B09A 5JOXA 2Z2SB 4KG0A 4FSJA 5BNOB 4DPNA 3NAPA 4CDQB 3BPZA 5FFOC 2FZ2A 1WD3A 2HJIA 2VU9A 3ILNA 3JD73 1GNHA 4XHXA 5J09A 2EXKA 2BNNA 4XILA 2E53A 2YV8A 4KG8A 5FMOS 2OIIA 4KQ7A 2PELA 2SBAA 3MIGA 4XXAA 4AK3A 2P2KA 5IK5A 1QKQA 1WBLA 2XJPA 4FAHA 1W6PA 4LNVA 3CLPA 5GZDA 3AYDA 1FPN1 3WX5A 1POV1 4E2SA 4LBJA 1S0GA 1ZBE1 1O3TA 3ZMOA 2D44A 2DVBA 2BNOA 4NOTA 5GALA 2WLQA 2DTWA 4BWOA 3S7EA 5AC93 2DVDA 4YVWB 2JXAA 3LCPA 1AL21 2YGLA 1PO22 4M0NA 4EN8B 1NA1C 2Z79A 5C4WA 3ZFGA 2WC2A 1VB4A 3IDBB 1NCQA 1MVEA 1ZVFA 3EJKA 3NV2A 2YGMA 1H1MA 4PQ9A 3UJOA 1RUH1 4AVSA 1VP6A 4WZFA 1JYIA 1AYN2 4SBVA 4CDXA 4YZ5A 1J3QA 1PGL1 4AHYA 2UURA 4H7MA 5AFBA 2I2SA 3RYKA 3GF6A 4GB33 3VHPA 3PNAA 1AR71 3FZ3A 2R041 2LM3A 2ZGPA 2WLPA 1C3HA 4E2GA 3WD5A 1S0BA 4JVAA 4LBQB 1ULCA 1WUVA 1TNFA 1PVC3 2A6ZA 1XU1A 4Q1PA 1V6MA 1X8EA 1TQ5A 1MS9A 1CJDA 3O0XA 4KBBA 3WW4A 1BK1A 4DRRA 1S1AA 4L97A 1VBE1 3HQXA 5H9QA 3RG0A 3NW4A 1PIV3 3PJQA 4WM8A 3E5QA 3M3OA 3POWA 4INDA 3ZX7A 1O4TA 4AFMA 2BW8A 3MIFA 5BUVA 3LA3A 4YM1A 4YW5A 1CR7A 5EJ3A 3V0BA 1UF2C 1ULDA 4AVBA 2VUJA 4TZDA 2X5IA 1VBD2 2NMOA 2WA4A 5E16A 2JE7A 3VUOA 5LK5A 2XVKA 4RQPC 2XL9A 1DF0A 4BQ1A 1H8TA 2KM2A 4CYDA 3D5OA 4M00A 5C8WA 5C9AB 5A3LA 2B46X 3KT4A 3D82A 3KQRA 4XJ9A 1JHNA 2JG9C 5JR7B 1HW5A 4XF4A 3EHKA 1G8WA 1G6NA 2AH2A 4JGZC 4XFBA 1CPNA 4M0HA 1E57A 2AYHA 4CP2A 2G4IA 5H9SA 1NA1B 3ME2A 4HFSA 1O91A 3OF1A 4Q4Y3 3ZXKA 3WR0A 3DV8A 3VBSC 2JG8A 4Z1VA 5FLIA 4Q4X2 4IETA 1UCXA 5FAXA 2IXKA 1F31A 3BIWE 4K6BA 4AHZA 3WG2A 4R8HA 3MEPA 3JBG1 2VNGA 1DZTA 4S2FA 1DQ6A 1BCXA 1SLCA 2N7GA 2XLGA 2XGXA 2A6YA 1JXNA 3HBZA 1AR82 4X6RB 3CEWA 5FLJA 3A0NA 1G86A 1A3KA 1LJ7A 3AZVA 3LAGA 2GN7A 1RL3A 4FOQA 4WM7A 4FPOB 3N7JA 3O5SA 3KS7A 1R1A3 2BQPA 2RS31 1H2MA 1UX6A 3BCWA 5T3NA 2ZPXA 2WS91 2EIGA 3D6EA 3TN92 2ZBJA 4FQZA 4G4FA 4PDWA 4YG0A 4MVTA 1V6OA 4A7YA 2GC2A 1BJQA 1CESA 1W0PA 1TEIA 1SLIA 3LKJA 4YVSA 1PGW2 1WLWA 5C8CC 4LO4B 5BNPA 5BNNC 1VBA1 1C1LA 4K1YA 4ORFA 3T1LA 2PTMA 3JCIA 1LEMA 1AVBA 4YRDA 3SISA 4K3UA 3VZJA 5ACA1 4LA3A 1UU5A 1RUE2 4FPJA 5JZGA 5CVRA 4RQPB 4UXAA 4Y26A 4ZXKA 2BGCA 1JBCA 3KT1A 1TME2 3EO6A 5CFDC 4W65A 3H1YA 1R082 1U12A 3ZXGA 1PK6A 4D3WA 1J59A 1D2SA 5I8SA 4I0AA 3VBFA 5GLUA 2JG9B 4J1WA 2BNMA 2ZKNA 4QPGA 4LHKA 4DY5A 4EN9B 3U4XA 1V9U1 4E4DX 4BPZA 1CD3G 4JGZB 3SITA 5KHIA 4AQSA 2FMYA 2FMDA 1S0CA 1F9KA 1OMIA 2YXSA 3LOBA 1SBEA 1QJY1 4ITCA 5DUXA 2EXJA 1O5LA 1ZZ7A 3ASIA 2VNOA 2E9QA 5KC5A 1BBT1 4W6XA 1QXPA 2YPJA 4MXWA 1A8DA 4FPEA 4M3CF 3MFAA 2XBO3 1YIPA 2ZKLA 2NLRA 1N3OA 1RINA 2WJSA 3E5XA 3QACA 4HKWA 4XJWA 4I3GA 1RMU1 4OHXA 3SMHA 4ZU4A 4AI8A 4HVQA 4N7IA 1KFUL 1AX1A 5HBAA 1AR61 1WCKA 3ZXFA 2YZ4A 1L3JA 3FWEA 2YMZA 4Q2FA 3V0AA 2XJRA 1MS8A 1CJPA 2BVBA 4JDMA 1RHI3 2HWC3 2XWBB 3AZWA 4JRLA 1IKPA 4AI2A 4COVA 2GU9A 3VKNA 1BYHA 2RM22 3TOJA 1PZ9A 3R4SA 4LBMA 4IESA 4IEPA 4EWDA 1AX0A 1HIXA 4OFGA 1W6OB 1IGOA 4Z92B 5C8CB 1DHKB 2VVEA 2ZHLA 5BNNB 4XQDA 1W39A 2BUKA 3MYXA 2BWAA 2AREA 1KJLA 2RS13 1BEV3 1IS6A 1Y7BA 1GICA 2JX9A 4FPGA 4PF5A 2ZCWA 1TMF3 2ZMNA 1LHNA 2CWMA 1PVC2 4TSVA 3RJ2X 2PAKA 2I07B 1DLLA 3MLJA 4LBNA 2ZMLA 2MEV2 4AEDA 5CFDB 1KQRA 1F8VA 1REFA 3B00A 1PZ7A 3ZFEB 3AFKA 1CX4A 4COUA 5F9TA 4IL7A 3VL9A 2GH8A 2ENRA 3NAPB 1C8M3 1RUJ2 4QPIC 4YM3A 4GKYA 4XFCA 4P14A 4IV1A 4RS5A 2VMHA 1QQP1 1QJX3 2FZ1A 3VZNA 4R9BA 5DG2A 1J58A 4AQ2A 1VBB1 1EP0A 1QOOA 3FMGA 2OPKA 2FBEA 4H14A 1R092 1WLCA 4GMP3 1PHMA 1Q56A 1JTZX 1ND2A 4ONUA 5FO7B 1W6PB 1UN1A 3WG4A 4FP2A 5FBZA 3MICA 3M70A 3KCCA 2A6VA 1RUG1 3NV1A 2E7AA 1C57A 5AVAA 1NXMA 4K21A 4YZ2A 2E51A 2VOWA 3AFGA 4B4PA 4HL0A 4CEYA 4PIZA 5F5QA 1JUIA 4XE9A 2VOKA 2P34A 2IXHA 3TAYA 1CGPA 1MS4A 1MZFA 4RR3B 4DNYA 3KMHA 3VBRC 5T5LA 2PHLA 4I02A 3WDYA 5D8AA 4Q0VA 2R1DA 5HI0A 1QGLA 2Q1ZB 1Q43A 1NG0A 2R061 4COYA 3ECQA 3FC0A 3H1MA 4JTOA 1AJKA 2ERFA 1RGSA 5LEJA 3I59A 4XJ8A 1CAUA 3DUIA 4HK9A 2C9AA 4LT5A 1RVF3 4KNCA 1Z7S3 4MH0E 3AMQA 4YW3A 1SFYA 4BA6A 4CEWC 4C1XA 4UW6A 2VECA 4Y20B 4FPFA 1BQPA 1OKQA 3OTFA 4LLOA 5BPXA 4H3WA 4BZ4A 4FPHA 1GZWB 2R073 1KD7A 3UL2A 2I74A 1DIWA 4RHV2 2NQYA 4Q4W1 4XPVA 3QLQA 4TWTA 4GWNA 2RS52 5EYXA 1YUDA 1IPJA 1H2LA 4Q0PA 4HKLA 3ZSMA 4A7KA 5ABJA 1RUC1 3VL8A 5B2GB 5DUUA 2PHTA 3CU7A 1O4ZA 3O0WA 3RSJA 5J98B 2Y26A 1HRV1 1HXS3 2BVVA 2VVDA 2IFRA 1UIJA 2PYTA 2WWSA 3WLUA 1AR91 1AXKA 4YZ3A 2BTVC 1YLLA 3MIHA 3VBUA 2B42B 4AI3A 1ZBA3 3KLSA 2PHXA 3IBMA 3X29B 2GALA 1VBC3 1XE8A 3RI9A 2R0FA 3HWJA 1G7YA 5T54A 4JGYC 2UWCA 2RR13 5T5PA 2B9UA 3W9AA 1SEFA 4SLIA 1VRH3 5A33A 5KWRA 2VMGA 1RUF3 2HWE3 5E89A 4C0HA 1FXZA 2VPVA 1QOTA 2GC0A 4JRAA 4XMAA 2GNTA 4D69A 1AYM1 1DQ0A 4AFBA 1H4HA 4AW7A 4P9XA 5J48A 3O12A 4Y4YA 3IM0A 1CAVB 3OCPA 3VBRB 4YGCA 4BM8A 1GLHA 1HRI1 5I0SA 1XNCA 1YJKA 1XYOA 1ALYA 1H9PA 3RWNA 3ZXDA 1JH5A 5GKAC 2NM1A 4HLTA 4I0BA 4I09A 1FV2A 2XBO2 1OLQA 5JCTA 4Y22A 3WXPA 3AZZA 3T2TA 2RMU3 2A75A 1LOFA 4B3NA 4LEJA 4O9GA 3ZN6B 3RQ0A 1M06G 1RTVA 2QQPA 4CEWB 4OI1A 3LB9A 4GH4A 1FPN3 4XF0A 1IS3A 1POV3 5FQ0B 1QHDA 3WW1A 3G6JB 4HMZA 3OY8B 1O3QA 1ZBE3 3H7YA 4PLMA 3BU7A 1C5IA 5BNQA 1N3QA 5HXVA 1COV1 5T5OA 2D5HA 1AL23 2OVUA 4DFSA 3THPA 2QVSB 4IXLA 1EV11 2YC0A 4LTAA 1CAWA 5H9PA 1QY4A 4B4QA 4B29A 2PLV2 1RUH3 1CAXB 2H0BA 1KFXL 1XYNA 1VLNA 3ZFFC 2AUYA 2ZABA 3HAGA 4C1WA 2VH9A 1DG6A 1Q8QA 2DCYA 1DQ1A 1N1VA 1CN1A 4P9IA 3QOPA 5KC6A 2WT2A 2R043 1BEV2 3IDEA 2YHJA 2GNBA 2KA3A 3DKWA 5FO9B 2ZX1A 4MGKE 1Y9QA 4OZXA 5HCFA 2HWF3 3OD0A 1BZWA 2BWCA 2NP0A 2EA7A 3VBSA 1PK6B 2TUNA 2D3RA 4Y1VA 4HPKA 4JGYB 5BY5A 1ASJ2 2DTYA 4BIFA 3N3HA 5CG8A 4B7KA 1ZYBA 2HWB2 3J8F2 1ULEA 1PO21 5I91A 2Z69A 2PFWA 5TSWA 3SNMA 4XTMA 3WUDA 3ZYGA 1VBE3 5SV8A 1MS0A 4ES8A 2ZGSA 1GNZA 5FO8B 3LZZA 5DDJ2 2AR6A 1QJX2 3ILFA 2MHFA 3RYPA 1AYN1 4MGIE 2HWD3 4MXWB 1W6NA 2GNMA 3L9JT 1PO12 1NYWA 4CDUC 1I5ZA 3HD8B 4XIKA 3ES4A 4ASLA 2WFF2 1N1SA 2WQ4A 5J96B 1AL0G 4BMBA 3DL3A 3ZYIB 2WZPP 2Q5TA 2JE9A 3CL1A 3V0AB 4QX5A 4FTEA 4HK8A 1MZ6A 1SCRA 1HQNA 1V70A 2Q8OA 3THTA 4XYXA 5J37A 3N7MA 4NO4A 4NVPA 5HCAA 4OVEA 3RRDA 3CJXA 4QU2A 1MQTC 5L19A 2XLAA 4P5HA 3GHNA 2ZGMA 5T55A 1BXHA 1PNFA 5C9AC 1UU6A 2VVFA 1W6QB 4FBFA 1MZ5A 3V56A 3ZFFB 1VBD1 2F6BA 3D0JA 4IQPA 1VAKA 2WA3A 3ENRA 1RVF2 1MEC1 1Z7S2 2YROA 2DF7A 1EPWA 2ZX2A 3PMSA 4HKOA 1OQEA 4FAGA 3POYA 1N3PA 1LODA 2Q0AA 4HSJA 5JSRA 4GWMA 3RNSA 3B02A 3AB0A 3MPPG 4WVWA 1B35C 1V6NA 2P17A 3AP7A 2RS33 4LULA 4BLIA 4NHMA 4R4ZA 4RA0A 1DQ4A 3ES1A 1ENSA 2WS93 4IV1B 3WDVA 2XUMA 3B5LB 4Q4V2 2B5HA 2QZ2A 2ZA9A 3EXUA 3H8UA 4AYUA 1HXS2 3SH3A 5F6KA 3WHUA 1LB2A 1JN2P 1Y43B 5A3MA 5LRSA 3VDDA 4KU8A 4Q4X1 1RUD2 1VBA3 3S0MA 2X53S 2ES3A 1S0IA 5GLWA 3AP4A 4QGMA 4AI1A 2XVGA 5KHJA 1NZCA 3IPVB 5KXDA 5GLZA 4CDWA 2GMEA 4FPLA 4N53A 1RUNA 3U07A 1YJLA 1VBC2 4CDUB 1RJ8A 5ACA3 2NZ9A 4OHYA 1AR81 4JDOA 2WNVC 2RR12 4K7JA 3KGLA 3TNPB 3EBRA 4LBOA 1PZ8A 2CGNA 3ZXEA 5CFCC 1S2KA 3PHMA 1FI2A 2BYVE 3MW4A 1D0GA 4YARA 1PVXA 5T52A 1QDCA 1URXA 3M1HA 2CWSA 1ONAA 4UBGA 5K7PA 1V9U3 4J6GA 4LO7A 4DQAA 3OJBA 3TN91 2ILMA 5T50A 3POSA 3R4UA 5KXEA 1U5ZA 1FMD3 2PHRA 1MQTB 3WINE 3VZKA 2ETEA 1PGW1 4GULA 1CAUB 3PVNA 3VKLA 3FLRA 4Q0QA 4QMAA 1BBT3 2WINB 3VHOA 1OFNA 2RMU2 3VBOC 5T5JA 3CJIA 1S0DA 4EWAA 4S2GA 5K8SA 4QPIA 2A73B 3VZOA 2D6LX 5I8YA 4HZFA 3AKQA 1FPN2 4HVOA 3OYWB 3FE5A 2WT1A 2VXRA 4YW2A 1XRUA 3V65A 3IDCB 5C33A 4XQWA 1R081 1QJU2 1NLSA 3ST7A 1LULA 4PBOA 3IIAA 3HT2A 4I30A 1DU3D 1IKQA 2DUOA 4YNIA 5DXDA 1B35B 2P3IA 3M7AA 3I54A 2D7FA 3MPBA 5JVVA 3U11A 1YWKA 5DUWA 1FNZA 1OD5A 1VR3A 3MI8A 1LHOA 4IEVA 2DVGA 5C6CA 1H8VA 3QBQA 1K5MC 4IEOA 2VUAA 2K0GA 1DFQA 1DQ5A 2E7TA 1ZRCA 2GAUA 4BIOA 4OHZA 1LHVA 4XDQA 4FO9A 1OQ1A 3MF9A 2ZAAA 1QH7A 3L2YA 1G9FA 2HWF2 2R30A 5GM0A 4KWKA 5AFEA 4IERA 3VKMA 2DCTA 2R32A 3ZIWA 4Q0SA 2CGOA 3SLIA 4YW4A 3W58A 2WNVB 4K9SA 1XE7A 3M4FA 4XXPA 4V1PA 2ZGRA 5CFCB 1GZCA 1XNKA 3NV4A 4N43C 4OHWA 4Q27A 4XMIA 2IC1A 3RZZA 4COWA 5FTTC 5FPXA 4C91A 2RM21 4FOWA 4FTSA 2PA7A 1YO8A 1V00A 4OI0A 2HWD2 4J1XA 5E8AA 3I7DA 1VBB3 2WFPA 4IV3A 1WD4A 2Y0IA 3E5UA 5LK7B 3RYRA 5D1IA 3ZSKA 5LEKA 1ZM1A 3VBOB 2E7QA 1AJOA 3ZFEC 1H2KA 1U5YA 3FJSA 2CAUA 3IWZA 3TWIA 4TLFA 3MW3A 1W6MA 1KDKA 1UPIA 3O14A 3NAPC 1OOPA 1PVC1 3AJZA 1HQLA 5JI7A 2ZAHA 3VBHA 1ND3A 2G9FA 5L73A 2MEV1 2AENA 4YGEA 4CZSA 1QWRA 3PJYA 5GZEA 5AVPA 3JD72 2D97A 3KGZA 1J3PA 5FMOL 4AGRA 1A78A 1I9RA 2A70A 4FPKA 1RUJ1 1LOCA 4Y1XA 1WCSA 4HN1A 1A8MA 1LU2A 2TBVA 3NSTA 2XWJB 2WNUA 3TNQA 5L7OA 1X82A 3R4DB 1G9BA <