2OQ6A

Crystal structure of jmjd2a complexed with histone h3 peptide trimethylated at lys9
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
348
structure length
348
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2oq6A01
4DO0A 5FXZA 3PU3A 5FYVA 2PXJA 4CCKA 5FY1A 4URAA 3U4SA 4CCNA 4XDPA 5F3EA 2W2IA 3K3OA 2YU1A 4Y3OA 2YBPA 2YU2A 5F5AA 2OQ6A 5FY7A 2WWJA 4C8DA 3U78A 5FV3A 3PU8A 3K3NA 4D6RA 2GP3A 2WWUA 5F2SA 5FY4A 4LITA 3PUQA 5A7PA 5FZEA 5LW9A 4E4HA 5K4LA 4BU2A 4Y33A 4QX7A 4IGOA 5FP4A 5FZKA 5FZHA 4AI9A 5IVVA 3AL6A 4UF0A 4DIQA 5A3TA 5FZGA 5FZOB 5FWJA 2YBSA 5LWBA 5F5CA 5FBJA 5F39A 5FZ4A 5CEHA 5IVFA 5FYMA 5FYYA 3KV6A 5FPAA 3AL5A 4HONA 5FXVA 5IWFA 3ZPOA 5IVEA 5F3GA 5A1LA 3RVHA 3NJYA 5A7NA 4CCMA 5FJHA 5A7OA 5A1FA 5FZ1A 2OT7A 5F37A 5A3PA 4AAPA 4IGPA 4NUBA 4UF0B 5A7SA 3LD8A 5A80A 4QXCA 4Y4RA 4CUGA 5FYTA 5FY5A 3PURA 5FYCA 5F2WA 5ISLA 2Q8EA 5FPVA 5FUPA 5FZDA 3KVAA 3PDQA 5F32A 5FP3A 5FZ6A 5IW0A 2OX0A 2XXZA 4GD4A 5FZ0A 5FZIA 3N9QA 4D6SA 5FYHA 1VRBA 5FZCA 5F3CA 5FY8A 5IVJA 4QU1A 3N9LA 5FZ9A 5FYZA 5FXXA 4IGQA 5FZAA 2OS2A 3N9OA 3N9MA 5FY9A 4V2WA 5ANQA 5FPLA 4CSWA 4CCOA 2OQ7A 5FZ8A 3KV4A 5A3WA 3PUSA 4GJYA 5FZBA 2YPDA 3PUAA 5FP9A 5IVBA 5FZOA 2XDVA 5FZFA 5F3IA 3OPTA 4ASKA 3LDBA 2XMLA 2P5BA 2Q8DA 5FZMA 5A7WA 4CCLA 3DXTA 5LY1A 4EYUA 5FZLA 4QXBA 3N9PA 3DXUA 5F5IA 4CCJA 3K2OA 4QWNA 5FP8A 3KVBA 5FZ3A 4GJZA 3OPWA 5IVCA 3KV9A 3PTRB 4LXLA 4EZ4A 2GP5A 4TN7A 5FYIA 5FJKA 4HOOA 5FY0A 4D6QA 4QX8A 4XDOA 4BISA 3UYJA 4GAZA 5A7WB 5FP7A 5LY2A 2YBKA 5E6HA 4BXFA 5FZ7A 5FYSA 2VD7A 4V2VA 5FUNA 3AVSA 2XUEA 3AVRA 5IVYA 5FYBA 3N9NA 2Q8CA 5KR7A 5FPBA 4LIVA 3KV5A 5FWEA 3ZLIA 5A3NA 4LIUA 5FYUA 4EZHA 5FPUA 5FXWA 5A7QA 4QXHA
chains in the Genus database with same CATH superfamily
3JCIA 4E4DX 2PLV2 1X50A 1OQEA 1NCQA 4MXWA 3RJRA 5GLTA 1XPWA 5KHHA 3U0ZA 5EYYA 4Y3OA 4Y4YA 3ZFEC 1C8M2 5KXDA 3E5UA 1BYHA 1I5ZA 2YV8A 1V0AA 2X09A 5FO8B 1WCSA 2A6YA 5HXMA 5KXBA 3FHAA 1TVGA 1SFPA 3V65A 3CF6E 4QDSA 4Y33A 4IGOA 2EIBA 3HIFA 4M00A 3AL6A 4U2AA 3VBSC 5KC5A 2Z2SB 2VVDA 5A3TA 3S6PA 1ND3C 2YBSA 4UOJA 4WM8A 5GZFA 3RYPA 1PVC2 3KV6A 3J7LA 1DIWA 2WIIB 1ZBA2 4KWJA 3HMYA 3S7IA 1V9U2 3JBG1 1D0HA 1IS5A 3SH5A 2XBO3 2P6HA 4IEXA 1CVNA 4CP9A 1OF3A 1U5IA 4XC9A 1X33A 3AB0A 4FSJA 1UO9A 5A3PA 5FDBA 4BPZA 1YFWA 4JAAA 3I2DA 2WO2A 4FQZA 2I45A 4UXAA 3N4MA 3JUUA 1B35C 2EIDA 4CDXA 1QJU1 1A8MA 4ZZ8A 3RZJA 2VUAA 2D93A 2FD8A 4LLOA 4I09A 2SBAA 3LA7A 4QPIA 4GXLA 4CEYA 1PIV2 2ARBA 1AR93 2JB8A 3N35A 4AQTA 1GMMA 2F4PA 3PNAA 4NRPA 2VH9A 5I8YA 1RXFA 1RUD2 1JZ2A 2WQ4A 2HWC3 1HQLA 2YFZA 1O59A 1VRH2 1W2NA 5E89A 1W04A 1MEC3 4AI2A 3WDXA 2AH2A 3CU7A 1Z7S2 5HCBA 2Y8KA 4YW1A 3WSOA 4QQPA 3NL1A 1PX4A 1RL3A 3R6SA 4UFMA 1ZRDA 3PVEA 1DGWA 1I3HA 2V09A 4M0HA 2WDBA 1J84A 4LO5B 3SISA 2LROA 4LBOA 4RN5A 2CGPA 3MZHA 1CESA 5K9YA 5AVAA 4OCTA 4YVWB 1W6NA 1HN0A 1FMD2 1NXMA 2P5BA 5A7WA 3VBHB 1X8MA 4Y5Z0 1UZVA 2CAVA 1AYM2 4CXXA 2YZ4A 1ZM1A 1HKDA 2J22A 1HN1A 2UU8A 3KV9A 4XMAA 2ZGKA 2ZX1A 4GMP3 4YZ1A 4AFDA 2VZ3A 3HT1A 3J8F2 4XBNA 2GP5A 2EICA 4LHNA 3WOGA 4DNYA 3IPVB 2WT0A 1UCXA 3ZFEB 1FXZA 1GBGA 2PQQA 1YRZA 2RJKA 1S0IA 3J4UH 3URFA 3WNOA 4KG8A 4FPKA 1FI2A 2B5HA 4CU9A 4IXLA 1POV3 1UW8A 4YW2A 1WBFA 3FN9A 3C7FA 3OSDA 2ZGSA 4DOUA 2JDKA 2IZWA 1PMHX 4PBOA 3C7GA 5L19A 2ZA9A 5C8CB 2HKXA 5T5LA 2CU5A 2Y6HA 4P9IA 1ND3B 4J1XA 2YFUA 3U07A 3LIGA 4MADA 1DYPA 5FPBA 4KU8A 1J59A 2V4AA 2FMDA 4LIUA 5EIYB 3ZYIB 4HK8A 2EVXA 1AR91 4OLLA 5B4NA 4TLGA 2ZAAA 1AYN3 2HWC1 2D3SA 5FY1A 4DRRA 5F5QA 2WQ8A 3ENRA 3G6JB 2ZJCA 1RB8G 3PVNA 3ZXKA 1MEC1 3CZJA 4QX2A 2WWJA 2RS33 4BH9A 2BNOA 2Y34A 4UAPA 1LJ7A 2BRTA 4BMEA 1OH4A 1Q8QA 4URTA 1OFSA 4CCCA 1I6XA 2XJTA 1UMZA 5FZGA 4Z8BA 4TSVA 5KHJA 3N7KA 5BNPA 4J25A 1NXD1 5JI7A 4QPGC 3H3UA 2J1EA 2PYTA 5F1RA 3K48A 5G05L 4YG6A 5FK8A 1ASJ1 5JSRA 2VZ1A 1MZ6A 2O0OA 2HEVF 4QXKA 1REEA 3ACIA 4LBNA 3LQCA 2DVDA 1VBB3 2WO7A 4UWDA 1X9PA 2AEYA 1CX1A 1ZRFA 4AI3A 2D6PA 1GP5A 4JGZC 2ZTNA 3NNFA 4EWDA 2VBBA 2JIJA 5DXDA 2BFUL 1QOOA 2VQ0A 3ZYBA 4AVCA 2RS53 2JKXA 3AZYA 3U14A 3I59B 4XFIA 4PLNA 3PURA 2VCMA 1U12A 3ZR6A 3Q8CA 4ZKTB 3TYJA 4B4QA 3T0BA 3H7JA 4BQYA 4CZSA 2DCJA 5T52A 1POV1 4E2GA 5LA0A 3O1SA 4JTOA 1QNYA 5JXJA 5T54A 4KU7A 3I2JA 1QJY3 4IEVA 5I8TA 2FDJA 5K0UB 5JOYA 3VDBA 3BOWA 1UYZA 4PIYA 4Z82A 3VDCA 1TZOA 2WFF1 3ZSKA 2WSUA 3MUY1 4RHV3 3PJYA 3VBOA 3KT7A 3VN4A 2DUQA 2XL9A 2B42B 1NZIA 3N7LA 1GP4A 4ES8A 2VJXA 3JD73 1VBC2 3FJSA 2ARCA 3ZYHA 1DGLA 3O1VA 1RITA 1NCRA 4BB3A 1AYN1 5A6YA 4BM8A 4LKSA 1SLAA 5FIXA 1AVBA 2YPDA 5JZGC 3SQOA 2XJSA 2XKOA 1H8TA 2C6SA 3OGJA 5BNNC 3ILRA 2ARXA 2HWB1 2RS31 2HYKA 2LW8A 2A6XA 1YI9A 4HPKB 2XVGA 4PCRA 3VZNA 2PHDA 4FTSA 4EWAA 2KXLA 3LA2A 4PI2A 3HJRA 4JHZA 4R4XA 2UYBA 1CJPA 1RUC3 1TME2 4L99A 3DKQA 4L92A 4QWNA 4XJZA 4DUWA 2Y38A 3VD9A 4XJWA 5CBLA 4IEQA 3C3VA 3QACA 5SV8A 3SHRA 4IV3A 4TN7A 4KG0A 1D4M3 4KWUA 3MF6A 5GKAC 1G9FA 1ONAA 4UBGA 4E8CA 5DAVA 1UPIA 3N7JA 2VW1A 4WZCA 4Q4X2 3UYJA 1ZZ8A 2C1FA 4Y1VA 3E1F1 2VQUA 5JLVA 3PJQA 1FV2A 2RR13 2X5IB 2K46A 3S7EA 5ACA3 2G9ZA 2ZX0A 4FPEA 1GZWB 1PHMA 4XYXA 1WLWA 3VBRA 1QH6A 4CEWA 3VBUB 3T0DA 3RJ2X 3BTYA 2RHPA 4YFZA 2DU0A 5FYBA 1OD5A 4YM3A 1AHSA 4P9YA 4QPGB 5FWEA 5IAVA 1REDA 4Y1ZA 4BYYA 5FUIA 5FPUA 4L2NA 3D0SA 4X8PA 3VV1A 4F8AA 1X36A 5E8AA 1I5PA 1QJY1 3HWJA 2WS92 1NZCA 2ERFA 3QD6A 2FCUA 1Q3EA 4M4PA 3MW2A 4KNCA 1N47A 3BTZA 3K3OA 2A3YA 1W9FA 2D44A 1SDDB 2GC1A 3J7NA 4JKLA 3ZYFA 4JGZB 3RPQA 1MQTA 2YPJA 4OMCA 3U78A 3BUCA 4DPNA 2Y0IA 4CDUA 1WMFA 4F3JA 3JD71 1F5FA 1H0BA 1OVSA 2JX9A 2VOVA 5K4LA 1XQNA 5IVVA 1DYKA 5FP4A 4ATEA 4Y20A 3RG0A 1EAH3 4LO8A 4OFGA 2EAKA 5FWJA 4S2FA 4HSJA 2VBDA 1YWKA 1ENQA 1KS4A 1VBE1 4XTMA 4XJ8A 5FYMA 3S57A 4KWLA 5JSOA 1PGL1 4XEZA 1Y43B 3PVOA 1W39A 4GZ9A 2UURA 4M3CF 4LO4B 4MZUA 4XILA 4ATFA 3G7DA 2NMOA 1O7FA 4I3PA 2Y6FA 1RUC1 3R0RA 4MYEA 4RA0A 3UNPA 5FZ1A 1ZX5A 2VZQA 2PHWA 1V6NA 2RJ2A 2UWAA 5F37A 1O6UA 1YYNA 3WY6A 3ZSLA 2YC2A 3DEMA 4AEKA 5FPZA 4JKMA 2BP6A 2VCCA 1D4M1 2O8QA 4CUGA 1PK6A 4IEWA 5JZGB 3D6EA 4BE3A 4LBQD 5FPVA 4Q4W1 5FZDA 1PMIA 1SBDA 2RDQA 5GZGA 4AHWA 2RR11 3KS7A 5FZ0A 1Q8OA 2AACA 1PVXA 3C7EA 2R063 1C3HA 2HWF2 4XZUG 3OY8A 2VQAA 1W2OA 4PLOA 3MGUA 3KQ4B 1EYBA 5EZWA 4QD2A 3RMXA 4ZHNA 1WA4A 4Z2AA 3E6CC 1CZSA 3WP6A 4GH4C 3JZVA 5KXCA 4OZOA 2WINB 1SBEA 3EB7A 3ACHA 3KGLA 5F6LB 1NG0A 4PF1A 2OQ7A 1HJFA 1W2TA 1M06G 1R083 4ZU4A 4XZPA 4R8HA 3THTA 3OBRA 3WCRA 2VOXA 1ZZBA 4RGKA 2WZR3 3RFRA 2VOTA 4BIOA 4CVUA 2FDIA 4LT5A 3KSCA 1DLLA 2GMMA 4ZZ5A 1YEWA 1QQP2 3JB4C 2WRAA 1EAH1 2B9VA 4N53B 3M7AA 2XGXA 1W90A 2ORZA 2DURA 4PQ9A 1LNSA 4JVAA 4ZXKA 3WG3A 4AQSA 4YZ4A 3QCWA 3MV01 4HT1T 1OSGA 1AZDA 4OI1A 5HCHA 4TXWA 4YVSA 2OYZA 4LBLA 2MHFA 2HLEA 5FJKA 4G3YC 4JGYB 3K46A 3LAGA 1QF3A 4LBQA 5D21A 5EV7A 5I0RA 1X8EA 4FVVA 5GM0A 1MZ5A 4AK3A 3HVDA 1XE7A 2WA4A 3NKGA 2LTNA 2P4EA 1YXWA 3RDIA 2JEMA 5LY2A 3VZJA 5KHIA 2B9UA 2VXJA 2GC3A 5B4XA 1W3XA 2E9QA 1XU2A 3Q8BA 1NKGA 3RWKX 3BODA 1UD1A 1W6OA 4Q5OA 2JICA 2YHJA 2UWCA 1LEDA 3SCHA 2MEV3 1HB4A 4XUNA 2Q8CA 5JCTA 3C7HA 4RFT0 4B7EA 3R4UA 1F35A 3S0MA 4QPWA 2ZGOA 1QXRA 4UT5A 4HN0A 2R061 4N43C 4QXHA 2DUOA 4XCBA 1GNZA 1R092 2RMU3 5C4WC 3KGZA 5FYVA 4RQPB 1UN1A 2PXJA 1PO13 4MVTA 5J98B 2A5ZA 2FQPA 2N7GA 1KQRA 1NX9A 4LE4A 1AR82 2YU1A 3ZFGA 1QXJA 3IDBB 5FY7A 3WF3A 3ES4A 4GWIA 1FNYA 5F2SA 4LITA 2WZ8A 3KZ4C 3ZDVA 1S0JA 5LW9A 3AC0A 2XHKA 3USUA 3ZYRA 1QEXA 3AM2A 3MI8A 3L2YA 4EN8B 5A3OA 2HJIA 1BBT1 1R081 1LEMA 2ZEZA 4P02B 5D8AA 4IEYA 5IVFA 2IXCA 3O1TA 1AXZA 1LHUA 1JMUB 4MSVA 5BNOB 3UV9A 4FP3A 2BBAA 4NR1A 5FKCA 3OJBA 4XHBA 4DXTA 1JU3A 1RHI3 2JG8C 5FPXA 5GLWA 1W6PA 3T4VA 5HXVA 1ZZCA 1KDKA 5A7OA 1E5IA 4GH4B 2ETEA 1G9CA 5D2AA 4OZXA 1GYKA 3OF1A 4UF0B 2WNVB 2J1AA 3ZSJA 2AUYA 1PGW1 1XNAA 1U0AA 2F4LA 2VCBA 5DAWA 4AGGA 3H50A 4NHLA 4QKDA 3K51A 1W8FA 4WVMB 3TNQA 1W6QB 5IK5A 5C9AA 2A3WA 4YM0A 5F32A 1WW4A 3ROUA 4O7XA 1QDOA 2I74A 3AP4A 2V73A 5CFCA 4BCUA 3BOPA 3DECA 4NHKA 1G9DA 1A3KA 5A1AA 3VD3A 4AVBA 1ULDA 3KWVA 4M3CA 3H3LA 2MEV1 3ZYJB 4H7LA 4L0PA 5FY9A 4V2WA 3AYEA 3SMHA 2NLRA 4Z1VA 1RUE3 4YYOA 3A23A 4GWNA 4JRLA 1OKOA 3CHXA 4ASMB 1G9BA 1PO11 2W9XA 1RVF3 1W0PA 5JWPA 5IVBA 4FT8A 2QZ2A 4OHZA 5LZ6A 2XDVA 1YJKA 5J48A 2B7YA 4XFGA 4EWEA 2Q8DA 3PMEA 4DY5A 2ZEYA 1C28A 3RYKA 4OI2A 4Q4Y1 1MS8A 5A32B 3ZKYA 1O5LA 4N90A 2FMYA 2CHHA 4ZPIA 5T3NA 1UKRA 1UY2A 2ZACA 4CUBA 5JSPA 4NIIA 1LOFA 3B9IA 3HBZA 4N43B 4Q4V2 4YW3A 1GOFA 5DUUA 4XF3A 1F31A 4HOOA 5GLZA 1ZA7A 1RHI1 4CDWA 3BB6A 2ZHKA 2C9AA 4GAZA 3CJIA 1COV2 1EPZA 3PIGA 4K40A 2BWCA 4IE7A 4AGVA 1K5MA 3W21A 1US2A 2X8KA 3LPGA 1NY71 4LO6B 5FZ7A 5FYSA 2Y6LA 1PO23 2RM22 5IAXA 5IVYA 3R4SA 4ONUA 1HJGA 4P9WA 4ZU5A 4QM8A 2DF7A 3AKQA 1ENSA 2VBPA 2RG4A 5LA2A 1SG3A 5BNQA 5FYUA 1ZYBA 4XQDA 3ZFFA 2WSVA 2UWBA 1NT0A 2ARAA 3POGA 5J1XA 5FZOA 4AL9A 5FMBA 2JG8B 3AXEA 3DV8A 3P6BA 4JDMA 4UW4A 4YW5A 4YFWA 1AXKA 1N1SA 3ZIXA 4D0QA 1DF0A 1DU3D 1O4YA 2P3JA 3VBFC 5FY4A 4FXKB 4L8QA 1RUE1 3H1WA 2ZOEB 1ACCA 3E6BA 1OOPA 1RVF1 4Q27A 3KM5A 2P3KA 1YI7A 2WNUA 5FMDA 4PDWA 2ZGMA 1RYYA 5GLUA 2Q8OA 1OH3A 2XVKA 1ND2C 3ALQA 4LQRA 5IK4A 3KHCA 4FTBA 3ZPOA 5FQ0A 4HG6B 1D4VB 1JYWA 5A1LA 3DKWA 2DTWA 1DP0A 4I0AA 4KH9A 4NHMA 1RUI3 1YUDA 4OMDA 2HWD2 2XLAA 4IUGA 2UY9A 2ZGNA 3RI9A 3ZR5A 2BW8A 1CAXB 2JDPA 1DQ5A 4MGKE 5E16A 1T6GC 3HQRA 4YPJA 4XF0A 2NN8A 5ISLA 1C1FA 2DBIA 4XFCA 1LCLA 3LEIA 4FPFA 3F95A 4Q0SA 3ZO0B 5FO9B 1AL23 4W6YA 1SCSA 4AYUA 3H1MA 4B1LA 2HWE3 4AQ2A 4BLIA 2ZHLA 1JYVA 3P5BA 1PO21 3PUIA 4I0BA 4GULA 5KBFA 1BK0A 1OPMA 2PFWA 3O0XA 4W6XA 1DQ4A 4AOCA 3JXSA 4O65A 1TG7A 2BYVE 3J7HA 2LUWA 2YUEA 2P37A 3AK0A 1LHVA 2D97A 4CUAA 3CDZB 3NNJA 1GQGA 3WD5A 2BOIA 2VOWA 3I2IA 4S2GA 1GZTA 5BPXA 2J42A 3JBG2 2FZ2A 1DG6A 2YXSA 1XSQA 3OB8A 1JHNA 1XE8A 3TN93 4GALA 1F5JA 3T0AA 4L9BA 1QIQA 1CZVA 5FZMA 2BBVA 3POBA 4LE3A 5JIUA 5GZEA 3QBQA 1LU1A 1QJU2 1VBA2 1EY2A 1RUH3 4FOYA 4D3WA 4QGNA 1QHDA 5HPOA 3ZXLA 4M0NA 2LRPA 1FYUA 1DZQA 4H7MA 4EZ4A 1JS9A 3WV6A 3BCWA 1UYPA 2GC0A 2MPFA 1KEXA 1OMIA 3ZN6A 2AYHA 2C4XA 2IVIB 4YW4A 3FWEA 1AR73 4RL7A 5CFDA 3WNNA 2BGCA 2BVVA 4Q29A 1RUI1 1Y3TA 4RR3A 5DUXA 1WW5A 4CDQC 2YBKA 1W05A 3B94A 4UFHA 1R1ZA 1CGPA 2VW0A 1MVEA 1ENXA 1QGLA 3M3IA 3MIFA 1UOJA 2VR4A 4CP1A 1W0NA 4B7KA 1DYOA 1DZRA 3KT4A 1KJLA 2XWBB 1YLLA 5JPNB 5KR7A 4Y22B 1YC61 2ZBJA 1ND2B 1S0BA 4IEOA 1EUUA 1RXGA 1AL21 4XXAA 2NYYA 4TWTA 3AZZA 2HWE1 3PHMA 4NVPA 3NAPC 3W20A 4ZXEA 2VW2A 3ACFA 2TUNA 3MDPA 1DQ6A 1UXZA 3DYPA 2JDZA 3Q8EA 2A1XA 2C26A 3NV2A 4X8NA 3I2GA 1GP6A 3HEIA 4AFBA 5AFBA 4E4HA 3O1MA 2C9KA 1PGSA 4BU2A 4QX3A 1LESA 2ET7A 1C8NA 1WZXA 2WO1A 1CR7A 5C6CA 1XSRA 2XBO2 2JG9C 1IKPA 2B45X 1X9TA 4LPLA 3Q8AA 5FZ4A 2W1SA 1ZVFA 1L7RA 5FRAA 3TN91 4P08A 3IDAA 3NV1A 3UK9A 3WDVA 5FPAA 4Z07A 5FXVA 5GJ6A 3MYXA 1OLRA 1PZ8A 2H0VA 1H2NA 3ELNA 1XRUA 1CQ9A 4P00B 4RS5A 4UW6A 2BEOA 3ST7A 5JMCA 2E7TA 4BQ2A 1E5HA 1RUH1 2VGDA 2XUMA 4YG3A 1QOTA 3CIHA 3MLJA 4A7ZA 4ZY9A 1O8PA 2PHLA 4IGPA 3PIJA 1CAWB 3GJAA 4H3WA 5A7SA 3OPZA 2DVBA 1AR92 3LDKA 1YJLA 1XU1A 2DVFA 4MGYE 2V5DA 2YY1A 5FYTA 3WDUA 5FYCA 3F2ZA 5F2WA 2HWC2 2BGOA 3VZMA 3V0AB 2NPIA 2VM9A 4JQTA 1AR71 5FZ6A 2ZABA 4HK9A 1MEC2 2R043 5C8CC 4IL7A 4HVQA 2I07B 1VRBA 4D94A 2CSGA 3IZOA 3TB0A 2VXRA 3VBSA 4CXWA 1ND3A 1LHNA 2QQNA 2DCYA 2BZDA 3VZOA 1BZWA 4AFCA 1PMJX 4XQWA 2W3JA 4CE8A 4K1ZA 1D7PM 3J9SA 4WVWA 4NIDA 4YARA 3T2QA 3LZZA 5IHRA 4NWWA 3LB9A 1O3RA 5ABJB 1YO8A 4WVZA 4CDQB 1DCSA 1RINA 2D98A 4A4AA 4ASKA 3EJKA 1IOAA 1HRV3 3AJYA 3VLBB 2XVLA 1DLCA 2ILMA 3DN7A 5FZLA 1B35A 4GWMA 2JIGA 1F8VA 3OYWB 5DAQA 5FP8A 5FLJA 3OPWA 2R073 5A3MA 4AEDB 2CAUA 2PA7A 3OEBA 3NAPB 3THDA 3GBGA 3PMSA 1V70A 4LULA 1K42A 5T5JA 3O0WA 2P3IA 3LCPA 2PMWB 4XXPA 3RZZA 1CIWA 1Q8SA 3BN6A 3ZVXA 3H7YA 4QX5A 3WUCA 3ZXJA 4M3CE 2HYXA 5JOZA 1C1LA 3KHBA 4MGZE 5CIRA 3ZXDA 1QJZA 2DCKA 1YQCA 3OUJA 4RYDA 4YZ3A 2JG9B 2OA2A 1UU6A 1ASJ3 1AYN2 3NNGA 2JECA 3GZAA 4GMP0 3VDDC 2ZX4A 5K0UC 3AKRA 1JUHA 3EMRA 3O0VA 1IKQA 2R041 4ISQA 5DUWA 4KBZA 1OD3A 3NMBA 4LHKA 2RS32 5FXZA 2R7EB 3WEZA 1JZ8A 3AKSA 1S0GA 3HN1A 3FFQA 4DEVA 2YYOA 1EV13 1VALA 4LHSA 1PM7A 3I3DA 5FMCA 1POV0 4OI0A 5C7GA 2ENRA 3IBMA 4WM7A 2WQZC 3OUHA 3DCQA 1VB2A 2JKBA 3BPSA 3PUQA 4IERA 4HN1A 5BV6A 2JENA 2YB7A 1LODA 3LDRA 2E6VA 4QX7A 5LCWL 4AFAA 3S5AA 3LFMA 2VTXA 4XFAA 1WKYA 1S0EA 4TTGA 1UOFA 2OZ6A 1UY4A 1HXS3 1VBB2 3RWNA 3NKTA 5FBJA 2WFF3 5L7OC 1NCQB 2RVAA 5I8SA 5A6QA 3JB8A 2BWAA 3VDAA 1A78A 1HRV1 3O12A 4NPLA 1SBFA 4QT6A 1S0FA 5DG1A 3WP3A 1ZBE3 3KT1A 4FOWA 2VTXJ 1RUG1 4HPKA 3KMHA 4F7ZA 3U37A 2RS52 1PIV3 4FO9A 5FJHA 4Y26A 4LBMA 1OBNA 2JDNA 4B3NA 2R071 3KCYA 3I4IA 3D0JA 5FAXA 2Z79A 3GJBA 4AR2A 3RI8A 4WM8B 4BMBA 4KBBA 2HWB3 1QJY2 4LBJA 4JKKA 1U5YA 2X5IC 4XE9A 3VKOA 2BGPA 1LENA 1OC1A 5FMOS 1UY1A 3GHNA 4NHXA 4RHV2 3VBUC 4GD4A 4CP9B 4DY3A 5A6ZA 2L9LA 1UY3A 4P9GA 1ULOA 4D7SA 1GZWA 1YQ5A 5CZKA 2ZHMA 4LORA 4PIZA 5I0TA 3VL9A 4HANA 2QQMA 3JD72 4IV1A 4QHOA 3TEYA 1H9WA 1W8ZA 2A6VA 3QOPA 5FFOC 4EE2A 1W9SA 4HFSA 4PI0A 5DQ0A 2X10A 5LA1A 1TNRA 4TYSA 1S55A 4BQWA 1PGL2 1JOBA 2QDNA 4K8RB 4OQ9A 2W08A 1G6NA 3PUSA 1EV11 4CEYB 1IPSA 2YG0A 2W39A 2ZHNA 4QDRA 3OGSA 2AEZA 3KQRA 1XC6A 1RUC2 2WLPA 4JGZA 3BIEA 1W03A 3U1XA 1KJRA 5EJ3A 3BGAA 4EN6B 3RYRA 1D4M2 3VDDB 4HSLA 3U11A 5JOWA 3RZMA 1LRHA 4UW5A 1ODNA 4CRQA 3W58A 1HXS1 1WMEA 5H9RA 1H1IA 1HW5A 2RR12 4LXLA 1ZRCA 2BQPA 5ACA2 4LKFA 1ZBE1 4UFLA 1W6NB 2W1UA 2W94A 1PIV1 4IE5A 5HBAA 4YG0A 5LATA 3UJQA 4YW7A 5A7WB 1ULEA 4AHZA 5C3RA 1MACA 5H9PA 2WNOA 1FPN3 2EXHA 3SLIA 3WF4A 1CN1A 1JHJA 4FPHA 1VBE3 2XUEA 3R05A 1UX7A 2IXHA 3NWKA 3LOBA 5JZGA 2IFWA 2P34A 5L7OB 1N3QA 5BNNA 3AMQA 1KFUL 5AFEA 5JOXA 3ZN5A 1X82A 2V72A 2IXLA 3AP6A 3N3HA 4Y1YA 3H8OA 4DUXA 2EXKA 2QQWA 2QQPA 2GALA 2Q1FA 4XBLA 3H9AA 2OW4A 5J09A 5F3EA 1XOYA 3GALA 2ET1A 3GYDA 4YZ2A 3K3NA 4B4PA 3CMGA 4K21A 1H4HA 3ACGA 4Q4W3 1W2AX 1QJX3 4M4RA 2CGNA 4AI9A 1WW6A 3N7MA 4GKYA 5FZHA 1HX6A 4COUA 1W99A 3VHOA 1UU4A 2D6NA 1JYIA 1U5ZA 5F39A 4J6GA 3B00A 2D3RA 4MHRA 4N53C 2ZGPA 4HKWA 4LMFA 2J1TA 2R6QA 2JE8A 2W91A 2PHFA 5LEKA 1W6MA 4OULA 5A7NA 2ZPXA 1QJFA 1BCXA 3Q9OA 1JOJA 2P3YA 3DGTA 3V0BA 2O1QA 4JGYC 2V4VA 4A41A 1UQXA 2LALA 3MBWA 2R062 1JODA 1XBFA 1OPOA 4GB33 3I2OA 1AF9A 5APAA 4KGGA 3LEGA 2V5YA 3CL1A 4MXVA 1AL0G 1HRI3 3VZLA 3MUZ1 2WT1A 2QQIA 5JXIA 1FPN1 1OLMA 1Q8VA 4RD7A 1MS1A 5F3CA 2YMZA 4XBQA 2RV9A 4YWAA 4AHYA 3NJXA 2JXAA 1FNZA 4IGQA 4FAGA 1R082 5ANQA 1RMU3 3KF3A 4RQPC 1UYYA 4BQ4A 2E33A 2WZR2 4OUSA 2OUHA 4S2DA 5FZ8A 4AF9A 3KV4A 1K45A 4DINB 1W8TA 3CLPA 3OGGA 4YNIA 3FE5A 3E5QA 5EJZB 4Q26A 3WF0A 1W28A 5LASA 2D6OX 1ENRA 1QJX1 5FLIA 3MF9A 1PGW2 3N9PA 2X05A 3WW1A 1ZRIA 2XJQA 1O3TA 2QQUA 3WDTA 4CCJA 2QE3A 5IYYA 5BNOC 4XABA 3K4ZA 4LUKA 1GICA 4HKOA 1J58A 1NCRB 4X6QB 1CPMA 4C90A 4LA3A 4DXZA 2ORXA 1PK6C 5JR7B 1HIXA 4QQOA 1H8TB 1DGWX 2VL4A 4LNVA 5JXGA 3VUOA 1VE0A 4KMQA 2WNVC 3H8UA 1IS3A 2WABA 1FV3A 3J7MA 1GQPA 2MEV2 5L9BA 4GH4A 4Z92B 1R1A3 2A6ZA 1BBT3 2OXBA 4PBPA 3WW4A 1PZ9A 1SPPA 3EQEA 4IW3A 2RJLA 4FFHA 4IDZA 2RMU2 5IK8A 1UMIA 4GB31 1AJKA 1PO12 1TEIA 4NIHA 4IV3B 4BXSV 4QX0A 1HRI1 3EBRA 5EHDA 3GCWA 2FHRA 5FXWA 5CNAA 4R52A 1AXYA 2VZPA 3NRUA 4XACA 1KD7A 4HMZA 2GH8A 4EROA 4AEJA 4HZFA 4CCNA 3U4XA 2GNDA 3ZXGA 3RMYA 1EUTA 3D4KA 4MUVA 4QKBA 2QNKA 4CEWB 3MFAA 4M01A 2RDRA 2HBUA 1RMU1 3IDEA 1V00A 2VO5A 3LIHA 2VNOA 3LPFA 4DFSA 1RGSA 4QHZA 5DABA 4Q8LA 5FZKA 4J1WA 1O5UA 4XMIA 4R9BA 3AFGA 3KD4A 2VNGA 3APBA 1RHI2 3E97A 3JQXA 4MHUA 3QH6A 2ZX3A 4JRAA 2W92A 4RSUA 2SLIA 3SEPA 3UETA 1K5JA 4Q4X1 2VZOA 3AL5A 1NY72 2BNNA 2W52A 1DGRN 3DPRC 2XL7A 1MQTB 2GU9A 1A6CA 2ZGQA 4FPJA 4Y5SA 2CWMA 4CDUB 3OTFA 2P1BA 5JVVA 4Y20B 4BLJA 4KWKA 4N43A 3FUOA 4Y5TA 2QQVA 3LD8A 1Q8PA 3P3PA 5C4WA 1HV1A 3W59A 5C33A 4I02A 4F83A 2UYAA 5CISA 3EHKA 4FPLA 2ADDA 1BMV1 4FOVA 3WQ1A 2VQTA 4A6SA 3GNEA 4Q4Y3 2WS91 3WHTA 1Q5OA 1UY0A 1GANA 5CVRA 1R1A1 5LRSA 3N9QA 1NA1C 2PAEA 4XFFA 5FZCA 1YQ8A 3ZFGC 5IT6A 1L7LA 2OPWA 3UGHA 1P8JA 3ECQA 5G04L 3POSA 3MIDA 1HV0A 2WC2A 3I3BA 1OHFA 3N9OA 4E9KA 5C3OA 2QQKA 1PK6B 2BUKA 1OA3A 4WBBA 3T2OA 3K75B 1VMFA 5CB7A 4NPMA 2GC2A 1Y7BA 1BEV3 3A4UA 3CJXA 4AQ6A 3D8CA 5FZBA 3M70A 5D8AC 2F6BA 3SH4A 5FP9A 4CA9A 3GCXA 5F3IA 2JD4A 3KF5A 4XTPA 3GDBA 1BK1A 1Y9QA 3KCXA 4E2QA 5L36A 1JTZX 1JZ3A 1XB9A 3WG4A 3PTYA 3IMMA 2K0GA 2XQXA 4QXBA 3TBDA 3BIWE 4HBNA 1XYPA 5FO7B 1QOSA 4C1WA 4I3GA 3M1HA 4XJUA 5IVCA 1WCKA 3OOXA 4IESA 3ZYGA 4OI4A 3NQHA 5CAZA 1HB1A 4CUCA 2WN2A 5T55A 3V56A 1QXPA 2WJSA 3M8LA 5FY0A 4A45A 2Z4FA 1PO22 1STMA 3DUIA 3TNPB 3RS6A 1IG0A 1NLQA 1YIPA 1XYOA 4NRMA 4ET7A 2YDEA 3MW3A 2HH9A 1V6KA 3OD4A 1SQ4A 3GZUC 1UX6A 2WLQA 1CAXA 1VP6A 2VD7A 5CA6A 4B1MA 1SHWB 3AFKA 3WCSA 3BALA 2BOJA 4SLIA 4YSFA 3AZXA 2HEYF 1VBD3 4XJAA 4YVSB 2D6KA 2WZEA 3NV4A 4YW6A 5GZCA 4QGMA 3MEPA 4UFIA 3WZ1A 1L7QA 3BYWA 3DPRB 1FOD3 3HNBM 4BIFA 5CU1A 5LEJA 4LO7A 1BVVA 2GNMA 3U4SA 2CDOA 1H4GA 1XNCA 3ABZA 3T2TA 1VMHA 2G4IA 3VKLA 3O1PA 4DEQA 5FV3A 1NOVA 5M0TA 2WWUA 1W6OB 2AREA 2J1RA 2VMGA 3P1IA 2PQSA 4PLMA 4QB2A 4CCEA 1JI6A 2E7AA 2VZVA 4AW7A 1BEV1 3CNAA 4XOGA 5F5CA 2UY8A 2X53S 4BQ3A 1NA1B 5AC93 4YGDA 3JQWA 1RUI2 5FCCA 3ZFGB 3D82A 3BVCA 3CO2A 3THPA 4K9SA 4LHLA 2WT2A 4O61A 4U36A 4LJHA 4TZDA 1LGNA 4HVRA 3K77A 4WV8A 3TWIA 5A1FA 3USUB 3E6DA 1O4ZA 3A22A 4JTNA 1KRIA 5DDJ3 3ME2A 3Q8FA 1K3IA 4JCKA 1AL22 4K8FA 2VMHA 4B29A 2DTYA 2HWE2 4S2HA 4Y4RA 2FDHA 1J83A 4DB5A 5D8AB 2BDRA 2GN7A 5IFPA 2ZZQA 2E53A 2RS13 1TMF3 3MIEA 1G86A 3AMNA 5D1IA 3VBFA 1LAJA 1OLQA 3GGLA 4QGLA 1PM4A 3S30A 3NVCA 3ZX7A 3T08A 3TEZA 1NAEA 4ZONA 2R1BA 3I2FA 4L11A 4LK7A 4FTEA 1LULA 4Q0VA 1VBD1 4PHZA 3THCA 3N9MA 1UWWA 2NM1A 2DWRA 1OOPC 3TN92 1FOD1 3AYDA 4H55A 4NOTA 3DYOA 4Q8KA 3TEWA 3WDWA 4NO4A 5SV5A 5CFCB 4KGQA 4B8EA 2GH2A 5IK7A 1RUH2 1S0CA 3FLPA 1QY4A 1LHOA 1GQHA 2EAAA 2IC1A 5LBBA 4M3CB 3UJOA 1X7NA 1XNBA 4AWDA 2GN3A 5LY1A 3B7MA 1UAIA 4A3XA 5K7PA 3H3ZA 2CY6A 5DZGA 3SEEA 3LEKA 4PT6A 4JC1A 1W9YA 3K2OA 1LHWA 2A7AA 1DFQA 4K7JA 3HQUA 1DBNA 3WF1A 4Q0PA 5I0UA 5AC91 1AR72 3I2HA 1SLTA 4COWA 4UFKA 2QCSB 2QKDA 2ZKLA 3ON7A 1A8DA 1YFUA 2B4KA 2FCTA 4XETA 1RUF3 4XUOA 4MGTA 3HPNA 4YGEA 1QJEA 1JOPA 4NN0A 2CTVA 1OLME 1SLBA 3RZGA 1CAVB 4TLFA 2K2SA 5C3PA 5I93A 5L9RA 2H6CA 1H30A 1S2KA 5DDJ1 1CAWA 3FL7A 1US3A 5LA9A 1HQWA 4G4FA 5F9TA 3POFA 4AVTA 2Y6GA 3PLQA 5K8SA 2Z69A 4N7UA 2LS6A 3I3QA 4BJ0A 2MNGA 2RS11 4EZHA 2RE9A 1TMF1 2D7FA 2ZX2A 1F4HA 3KB5A 4R9CA 5CG8A 5A7QA 4CDWB 1GKBA 4W6WA 3CJIB 5ERLA 1JZ5A 3ZMNA 5ANNA 1QKQA 3I54A 4C0HA 1RUNA 1S2BA 1VAMA 1WWYA 2YU2A 2OQ6A 5F5AA 2BU9A 5E88A 5BXXA 2JDUA 3WHUA 4C8DA 5A33B 2GP3A 1UPSA 2Y6JA 2ZS6B 1IG3A 3IKWA 5DZEA 3I2KA 5ABJC 2JD9A 2R1DA 4IE0A 1V6JA 1RUJ3 5EQUA 2PAKA 5FZOB 3AZWA 4A3ZA 5LWBA 1ZREA 1UXXX 4LBKA 5C5UA 4CDQA 2VNVA 1UU5A 5FYYA 4DXRA 2CV6A 4QHBA 1LOCA 2AR6A 5IWFA 1WCDJ 2ES3A 3BTAA 4FP2A 4E4ZA 4QMAA 2DFBA 3VHNA 4E27A 3NJYA 4AEDC 3WG1A 4ISRA 1TQ5A 3OYWA 1M4WA 1OOPB 1OQDA 2R042 2WNUB 3NAPA 2QUOA 1ZRRA 4XAEA 5FY5A 2JDHA 1RUF1 5GLVA 3ATGA 3EO6A 1DQ2A 3ASIA 2IXIA 4MOAA 1FX5A 1WD3A 3AYCA 3AZVA 1MS0A 5FQ0B 2XJRA 2XKPA 1OFNA 3P3NA 4D6SA 2J7MA 3O14A 5H9QA 1IQDC 1GU3A 3OGVA 3WNMA 2FBEA 3PVBB 3WT3A 4YVWA 5FY8A 5IVJA 4XVHA 4W50A 3N9LA 2JG9A 1D2SA 1QU0A 1UNBA 3VBHA 3O1OA 3AXDA 3OCPA 4LLFA 3B3QE 1B09A 1D2QA 4HVOA 3SITA 1LOGA 2J1UA 1HRV2 4Q0QA 2TEPA 1WUVA 4ORFA 1CD3G 1IGOA 1FAYA 1RJ8A 2OPKA 3UGGA 4A42A 3NO8A 4P9LA 3NW4A 3IPVA 2VZRA 5C3QA 2ZMLA 3T3YA 3ILNA 3ZFEA 2XOMA 1IHMA 2DDUA 2R072 1JYNA 1AJOA 2A71A 4IEUA 1F2NA 5J37A 3VD5A 2HWD1 3FHQA 1NCQC 2LM3A 3O7OA 1RUJ1 4HKLA 2NZ9A 1O4TA 3GBWA 5CKMA 1OUSA 4GJZA 1N1TA 2XLGA 3SCGA 4CP2A 2VVEA 5C8CA 5JAXA 3AP5A 1E5RA 1JU4A 4QB1A 2XJVA 2VZUA 1CAUB 1UZWA 5HCAA 1WLDA 2WAOA 2R0FA 3NJVA 1GWLA 2DUPA 4XDOA 4LOSA 4DS0A 1W2UA 3WNXA 1ASJ2 4QKFA 4RGGA 4WM8C 3I3EA 3WNKA 3EYPA 4XPVA 1GNYA 3POIA 4HLTA 4XIKA 2ZGLA 4O9GA 1MPXA 5FUNA 1UL9A 2JDAA 3BU7A 2E63A 5C3SA 1VJ2A 1WW7A 2XH6A 2FDKA 4R9DA 1V6LA 1RUG3 3LSDA 1EV12 3OD0A 3OGRA 2EXJA 4ZS2A 4JX0A 5HV4A 3LEMA 2WA3A 3B5LB 3M3QA 1WGPA 2R0HA 3ZN6B 4LUMA 4DO0A 5CFDB 4XF9A 2B46X 5KHGA 2XQRA 4C91A 1S4CA 4URAA 4RR3B 4H2AA 5JI9A 3IIAA 4CDXC 2W1QA 1AR63 4XJ9A 3LFIA 1WMDA 4EV0A 4QPIC 4BQ1A 3OG2A 1VR3A 1HXS2 2EIGA 2PLV3 3WW3A 1VBA1 2WFF2 4AZZA 4CEYC 1IS4A 2XJPA 2AZ5A 3OBZA 4D8MA 2B8MA 3HR9A 1C8M3 1GWMA 1ZBE2 3AP9A 4JZRA 3WQBA 4DZGA 5DMYA 1LOEA 4IETA 2PHTA 3HBKA 3H8RA 3I59A 2XHNA 1UZ0A 2D6MA 1F9KA 2W1WA 1QNWA 2IXJA 4YM2A 4CU6A 3A7QA 1UIKA 4L97A 3RVHA 3WG2A 1D0GA 3D3AA 4DRVA 1UIJA 2HWB2 3HQXA 3MLLA 2JB4A 4IEZA 3VDDA 5K0UA 3WP4A 1PVC3 1DGRA 2CYFA 3IT8A 2OT7A 4MV2A 1ZBA3 4AAPA 4NE9A 5HV0A 3RZLA 1V9U3 5JIAA 1KITA 3LGRA 3ETPA 4R4ZA 4NAOA 1RC6A 4LA2A 4QQHA 4XHXA 2W46A 2W68A 2Y0OA 5FUPA 3U75A 4COVA 4CXYA 5T5PA 3WVJA 5IW0A 4RS5B 4A6OA 4AI8A 3TOJA 1HB3A 3FMGA 5FYHA 4MXWB 1ULGA 1POQA 2KA3A 4WM7C 3H8XA 1E57A 5L7OA 3ORJA 2WFPA 2BERA 4MGQA 4I30A 4DQAA 3VKNA 2XR4A 1RUD3 2XBO1 2GNBA 3OEAA 2PHUA 1UKGA 1QDCA 2BVBA 4UFJA 1VRH3 2IUWA 3S5QA 4BWOA 3RZKA 1C4RA 1LOAA 1Z7S3 2O14A 3I8TA 2OUJA 1AR61 5FMOL 2QFEA 3DYMA 1RUOA 2A70A 1WBLA 3VBSB 4SBVA 2PLV1 2ZEWA 4UI9L 2IVJA 1YNAA 1AX0A 4EYUA 1QWRA 5GZDA 3SNMA 3ZN4A 2X5IA 4QX1A 1C8M1 1VAKA 4FBFA 2GMPA 2VG9A 3VZKA 3WNLA 3ZSEA 3KVBA 4AVAA 3VBUA 1FMD3 1N3OA 4EN0A 2JDYA 3CBNA 4BHPA 4FI9A 4QPGA 3T1LA 2Q4SA 1AYM3 1FPN2 4CDXB 4D6QA 1VBE2 2FCVA 4QPIB 4OVEA 1PVC1 1B35B 5EFUA 1W8WA 1J1TA 3J8F3 5BNPC 1ZBA1 4Y24A 4IV1C 1KXGA 1TNFA 1V9U1 5J3UA 4BXFA 4D7YA 1GOHA 3WUDA 1AUYA 2QTWB 2VMEA 2NMNA 4Q2FA 1EP0A 4KQ7A 2W5FA 3ES1A 1U5XA 1JH5A 1G7YA 3I49A 1IPKA 5C5TA 5FKBA 4COZA 4MGIE 5J36A 4Q4W2 1QJX2 1MZFA 1OURA 1MS5A 1O3QA 3UKTA 4XDPA 2W2IA 3O5SA 4K6BA 4GMP1 2DYCA 5B2GB 4P5HA 3GHMA 5F8PA 1K12A 4BOWA 1WMXA 4WVVA 4CYDA 1CZTA 3RGBA 5I0SA 2E51A 1RUD1 3ZSMA 5EYXA 2BFUS 4XW3A 3LA3A 2ZGTA 3UT0A 1VRH1 3EXUA 3RZHA 2VMCA 4EN9B 2R32A 1V6IA 1Z7S1 2E32A 3MLKA 3GF6A 3VBOC 3POJA 4LK6A 3OBTA 3WXPA 2VCAA 3I7DA 1SZBA 2XG3A 2J1VA 1S2EA 1IS6A 5JMOA 3LKJA 3IAQA 1JW6A 4WM7B 4BQXA 4AFMA 4FFIA 1JUIA 1UF2C 1ZNPA 1NCRC 4AVVA 2CGOA 2Q0AA 4GB32 5FOJB 5DZFA 1JBCA 1WCQA 2ZZJA 4FFGA 3WINE 1FMD1 1H8TC 3HT2A 3ZKUA 1HRI2 1AX2A 2TNFA 1EAH2 2W47A 2WUHA 3KLSA 4XDQA 2FDFA 1J3RA 1IQAA 1AYM1 1GNHA 1OI6A 3D5OA 3MIHA 2ZAHA 3HD8B 4KL1A 2QBXA 2VMFA 2GAUA 3KVAA 3QH7A 3J8F1 1RMU2 2AENA 2YROA 5CADA 2ID4A 1C5IA 2C0ZA 3H0OA 4IV3C 1G8WA 3MW4A 2XLFA 4V1PA 4QU1A 1IPJA 3M4FA 5FZ9A 4N7IA 4LKEA 4BDVB 2OS2A 2D43A 4JDOA 1NQDA 4AVSA 3NNMA 1DHKB 1WLTA 3MICA 4N53A 3VGIA 2ZMNA 3SC7X 4CCOA 1VBB1 3INAA 4NRQA 1ST8A 1V6MA 3VBRC 3ZXEA 4CEWC 1S1AA 1MZEA 3WQ7A 2P6CA 4MH0E 2FDGA 5A3LA 1F15A 3HAGA 5BNPB 3ZIWA 5IATA 1UOBA 2VZTA 4JGYA 2RS51 1WA6X 4IV1B 3A21A 4QM9A 1VBC3 3LDBA 2Q30A 3GBFA 3LWCA 4K20A 4MO3M 2WN3A 1GSLA 4KI5M 4PIXA 2XB6C 5AVPA 4LTAA 3SKJE 4C0BA 4XF1A 2C24A 2WBKA 4OYUA 1H2LA 1BMV2 5JR2A 4XF4A 5FZ3A 1DQ1A 2NQYA 1MQTC 5KHKA 4JHTA 1R1A2 1BBT2 1CX4A 4H14A 3ZM8A 1OA4A 4XQ4A 4CDUC 4W8JA 3AX4A 3RRDA 3LF7A 4RHV1 3O1UA 1TME3 1VAVA 1PZ7A 1J3QA 2KD7A 3AMPA 4CTEA 4QB6A 1J1LA 4A7YA 4RQPA 5FP7A 3HN3A 2ZXQA 3POEA 3I3MA 2XONA 5E6HA 2WZPP 1N1VA 3FX3A 1DQ0A 2H6BA 4NROA 1SLIA 2VNRA 3M3OA 4MLOA 4UYBA 3PUHA 5T50A 3AVRA 4Q4X3 2WYFA 2PAMA 3FFZA 2QQOA 2D5FA 3ZMOA 3VBOB 4Y1UA 4DMIA 1W06A 1OQ1A 2YGMA 3B69A 3M3CA 4ARXA 5JUVA 4B4RA 2JJ6A 2WNEA 5FBZA 5FREA 2VUJA 3PL0A 1CWPA 2VOKA 5FOBB 3IMNA 2CNAA 3MHZA 1FT9A 3PU3A 4CPBD 4AGRA 2RDNA 4N8MA 4CCKA 4OHVA 2YBPA 2G9GA 5BNOA 4IQPA 1EPWA 3GZTB 4D6RA 3B01A 3PU8A 2ZKNA 1OF4A 4P9JA 3UESA 2PN5A 1KDMA 2WS93 4GQ7A 2WR9A 4LR4A 4PQQA 1MVQA 5DG2A 4FCAA 4NHYA 5BNNB 1VPHA 1O3SA 4O9EA 2WNVA 4UF0A 2VVFA 1BJQA 1URXA 4ZS3A 5ACA1 4AE2A 1Y4WA 5IUQA 1LGCA 2OKXA 1OT5A 4XFBA 4RGAA 5A3UA 3POWA 1DDLA 1JZ6A 4WVMA 1VBC1 2I2SA 1W6QA 3W5NA 2XJUA 3NNLA 4HONA 1GZ9A 4QU2A 3CQOA 2EA7A 2VE1A 4XUTA 4AAXA 1ZZ7A 2TBVA 1FATA 2GMEA 4OHWA 1YQ6A 4CCMA 1LR5A 2BTVC 1ULCA 3HNYM 2IXKA 3E5XA 3LOIA 1LTEA 3T1MA 1Z78A 2G19A 4Q4Y2 4NUBA 2ZCWA 3BTXA 4FOQA 1UMHA 4YGCA 3VD4A 1MS3A 2VPVA 5DN2A 3VBRB 3W9AA 1GV9A 4P5YA 5A80A 3WNPA 2F17A 1TME1 2BJSA 4W65A 5FK7A 3PDQA 5FP3A 3RQ0A 3B02A 1OA2A 2OX0A 1H2KA 2BNMA 4NAMA 4PF5A 1T2XA 1W6MB 1XE0A 2Y26A 3H42B 4OUEA 4YVSC 4CPBA 1I1EA 2Q1MA 1LOBA 3AKTA 3DF0A 5LBCA 3V0BB 2EF6A 1LU2A 1RJ7A 2QQLA 4XUPA 5EWSA 4YZ5A 4XUQA 1BEV2 1NLRA 1NYWA 3C8XA 5FZAA 3FC0A 4FPOB 1PNGA 4YM1A 1CONA 1PNFA 5A32A 3AKPA 3BPZA 5DAXA 2HWF3 2IWGB 3VD7A 1R64A 2HEWF 3DPRA 1NLSA 3GZEA 2Y33A 1S0DA 5CKNA 4GJYA 1VB4A 2A6WA 2R16A 2YC4A 3IDCB 3N36A 2YC0A 4JQRA 4XIOA 5DUVA 3SH3A 2GNTA 1ZZ9A 2ADEA 3M3EA 4FFFA 3T09A 1V6OA 3W5MA 1SDWA 4ITCA 4IE6A 3K4AA 5EP9A 1BVP1 4NIAA 4GKXA 3CEWA 3FBMA 2QQJA 2VY0A 1RUE2 2AGSA 2WAAA 2DV9A 1MS9A 3C7OA 2XPJA 2DCZA 2AC1A 1NA1A 2EXIA 2VZSA 1RVF2 5EXOA 5C8WA 5TSWA 4W4ZA 2D40A 4AHXA 4XURA 1QQP3 3TAYA 3WDYA 4C1XA 3BU0A 4Q1RA 3TEXA 2CL2A 4IE4A 4QQLA 4QX8A 4CU8A 5DPNA 2JG8A 2K9ZA 1L3JA 1VBD2 3DL3A 2G9FA 3V64A 3WQ0A 2VTFA 3VKMA 1A34A 5BUVA 1SACA 2C5DA 3ETQA 3OY8B 4Q1PA 5LRRA 1FOD2 1RTVA 4R9AA 1G9AA 1HLCA 2ZGUA 2WZR1 3NJZA 4EN7B 4CCDA 5JXHA 4LIVA 4NMIA 5L73A 1YQ2A 3ZYPA 5A3NA 1W8HA 4XFHA 1H1MA 1GLHA 3VB9A 1OKQA 2RDSA 2WYSA 1Q43A 5EJ1B 5LK7B 2VC9A 2EIEA 2KR2A 5JDBA 1H2MA 2A73B 2H0BA 3AYAA 4MG2A 1BHGA 3L2HA 3O1RA 2P17A 1SPPB 5A70A 5C9AC 4EQVA 3AMMA 4NIGA 1CJDA 1R093 5AC92 2HWF1 5FZEA 5CFCC 3ZDSA 1SLLA 1LKNA 5BY5A 4D69A 3IN9A 1SCRA 1AR83 2GSYA 3CZUA 5IJRA 4DIQA 1XNDA 1UYXA 4AI1A 1WD4A 1W9WA 5CG9A 4XCAA 2DVGA 3GXUA 3HOBA 5CEHA 3A0NA 4E8DA 4A44A 4XAAA 4YLZA 3ACLA 5DDJ2 1E5SA 1YIFA 5IVEA 3IIIA 4LBQB 1XYNA 2P2KA 2VUDA 4A7KA 4X6RB 3ZXFA 1C5HA 4P9XA 2RMU1 2RS12 1TMF2 1WCUA 4CU7A 3ZOIA 4LEJA 3OBAA 4YGBA 1QQP1 3T30A 3MPPG 1ULPA 5LBFA 4K3UA 4AXOA 4P14A 3WW2A 1J3PA 1H8VA 5DAPA 4GWJA 1LB2A 2PHXA 4OQ8A 1CAVA 3M2MA 3BI3A 2Z5WA 1LOFC 2ZMKA 3FUQA 4LOTA 4WZFA 1BXHA 1W8OA 1ZZ6A 3NV3A 2A75A 4BK5A 5BYNA 4FXGB 3SXWA 1TE1B 2Y60A 2A3XA 4CDWC 1JYXA 5C4WB 3MPBA 3VHPA 3CJIC 4GA9A 4G9SB 2DU1A 2Y64A 3MFCA 1K5MC 5FPLA 4CSWA 4DUVA 4JDNA 2CDPA 1XNTA 5A3WA 2JE9A 1W8NA 1JZ7A 1JXNA 4AI0A 4ASLA 4N9IA 2B39A 2R49A 3USSA 3VHRA 3H1YA 3OUIA 4IEPA 5C71A 2WL1A 1H6XA 1Q56A 4BZ4A 3X29B 3FZ3A 2YGLA 3OPTA 3ZFFC 1CIYA 3CKHA 4NPRA 1R091 5A33A 5F7UA 1APNA 5JPMB 4CCLA 1HB2A 1VIWB 3R4DB 1AR81 3FLRA 2FZ1A 1W6PB 3WR0A 3DXUA 4HXCA 5A6XA 5IFTA 1RUF2 4HL0A 5LB6A 2VUCA 1MR5A 1VMJA 2O8OA 4QQ2A 3WX5A 4BK4A 3K4DA 4Y22A 4DXSA 3POYA 1ND2A 2DVAA 3FBYA 4Y1XA 3WLUA 4N9HA 5C9AB 4BISA 3AMHA 2W95A 2WNUC 4Q4V3 4PDWC 2E31A 3JU9A 1QMJA 2OZJA 4FQ4A 4COYA 2QDRA 2X29A 2Y6KA 1JYTA 2DBNA 1GUIA 4V2VA 1UZZA 1XNKA 2QZ3A 3AVSA 5HCFA 1H9PA 2Z42A 4MGSA 4FAHA 5J7MA 1COV3 1O91A 4PJYA 2JWPA 4FPGA 3KV5A 4BA6A 4E4SA 2RM23 1REFA 3SKVA 4AEMA 1BKZA 3MV11 1YFXA 2VU9A 1F4AA 3J26N 2QJVA 3KCCA 4Z2WA 3HNMA 1I9RA 1Y9MA 3IAPA 4QPYA 4OUMA 1RUJ2 4ZU7A 3RNSA 2E26A 2VAUA 3FHIB 3UGFA 4OHYA 1VLNA 1YFYA 4FPYA 1NUKA 5A7PA 3GM8A 1ALYA 1SFYA 2VMIA 2W87A 3T2PA 5E1RA 1GOGA 5KXEA 2VULA 2DCTA 4QKNA 5GALA 2XWJB 3AP7A 2E7QA 3IWZA 4ES9A 3V0AA 3B93A 4I01A 4HETA 3UL2A 1LGBA 5F3GA 4OHXA 1H1AA 4NWVA 1JN2P 3I97A 1OUXA 1K5MB 4I2OA 5LBEA 1W3VA 5L9VA 1JZ4A 2CWSA 1CPNA 2ZEXA 3B9CA 1HQNA 1CAUA 4QXCA 3A0KA 1GZCA 1OVPA 4UBHA 2WWSA 1GR3A 2Q8EA 1JYCA 2HWD3 1N1YA 3ZFFB 3ZXAC 4Q4V1 5T5OA 2XXZA 1YCIA 4LKDA 1LECA 5FZIA 4Q0UA 3U10A 5F6KA 1BQPA 4RFRB 4A2UA 1GWKA 2PHRA 5H9SA 5ABJA 2VECA 4YRDA 2BPA2 1NE4A 3WP5A 3WF2A 1HDKA 1YHFA 4AG4A 2R30A 2JE7A 1COV1 3L9JT 2W0XA 2D3PA 4GIQA 1SMVA 2KM2A 5FYZA 5FXXA 4D7TA 3SCFA 5CFDC 5FR3A 2JDMA 4QAWA 1KGYA 5FTTC 4RR3C 2EALA 2RM21 2D5HA 3UKVA 2ATFA 1OXCA 2WKKA 2ZGRA 3NSTA 1Y9GA 2NP0A 1WLCA 1H6YA 3VBFB 4AEDA 2QVSB 1RIRA 1W0OA 1Z0HA 1IZ3A 1W8UA 3PUAA 4PDWB 2OIIA 4MX3A 1UZYA 2VMDA 1NE6A 3IM0A 5FZFA 2OVUA 2HBTA 4E2SA 1BLZA 2IFRA 2XMLA 3BKZA 1KS5A 2WO3A 4INDA 3DXTA 3JBG3 1C57A 3ITQA 4CP0A 1DZTA 2D6LX 3MO4A 4EJRA 2J1SA 3FLTA 4BQ5A 1XXNA 3UKNA 5F5IA 2GDFA 5KC6A 5LK5A 3ZPYA 1ZA4A 1AX1A 1N3PA 1KFXL 4JV4A 3PTRB 3TRSB 1XJAA 1NQJA 5FYIA 5C70A 1SFNA 3VKFC 5I0DA 4K1YA 1QJU3 1VBA3 3ILFA 3MIBA 4QDQA 1QH7A 1ODMA 1W9TA 5CKQA 2PELA 1RUG2 2Q5TA 5FLHA 3RSJA 5KWRA 4ARYA 4YVWC 3IB3A 3T4HB 2Q1ZB 2GZWA 4I0WB 2PTMA 1SEFA 1GFF2 3MIGA 1O8SA 3QLQA 1T6BX 5CYYA 1PX3A 4NJ4A 3VBHC 5HI0A 5I91A 3LE0A 4META 5J96B 2G1MA 4RS5C 3N9NA 2DFCA 1SLCA 2BV4A 3LSEA 3VL8A 1UOGA 3C2UA 3AJZA 3ZLIA 1AR62 1MS4A 4FPCA 4UW3A 1ULFA 5EPAA
chains in the Genus database with same CATH topology
4DO0A 5FXZA 3PU3A 5FYVA 2PXJA 4CCKA 5FY1A 4URAA 3U4SA 4CCNA 4XDPA 5F3EA 2W2IA 3K3OA 2YU1A 4Y3OA 2YBPA 2YU2A 5F5AA 2OQ6A 5FY7A 2WWJA 4C8DA 3U78A 5FV3A 3PU8A 3K3NA 4D6RA 2GP3A 2WWUA 5F2SA 5FY4A 4LITA 3PUQA 5A7PA 5FZEA 5LW9A 4E4HA 5K4LA 4BU2A 4Y33A 4QX7A 4IGOA 5FP4A 5FZKA 5FZHA 4AI9A 5IVVA 3AL6A 4UF0A 4DIQA 5A3TA 5FZGA 5FZOB 5FWJA 2YBSA 5LWBA 5F5CA 5FBJA 5F39A 5FZ4A 5CEHA 5IVFA 5FYMA 5FYYA 3KV6A 5FPAA 3AL5A 4HONA 5FXVA 5IWFA 3ZPOA 5IVEA 5F3GA 5A1LA 3RVHA 3NJYA 5A7NA 4CCMA 5FJHA 5A7OA 5A1FA 5FZ1A 2OT7A 5F37A 5A3PA 4AAPA 4IGPA 4NUBA 4UF0B 5A7SA 3LD8A 5A80A 4QXCA 4Y4RA 4CUGA 5FYTA 5FY5A 3PURA 5FYCA 5F2WA 5ISLA 2Q8EA 5FPVA 5FUPA 5FZDA 3KVAA 3PDQA 5F32A 5FP3A 5FZ6A 5IW0A 2OX0A 2XXZA 4GD4A 5FZ0A 5FZIA 3N9QA 4D6SA 5FYHA 1VRBA 5FZCA 5F3CA 5FY8A 5IVJA 4QU1A 3N9LA 5FZ9A 5FYZA 5FXXA 4IGQA 5FZAA 2OS2A 3N9OA 3N9MA 5FY9A 4V2WA 5ANQA 5FPLA 4CSWA 4CCOA 2OQ7A 5FZ8A 3KV4A 5A3WA 3PUSA 4GJYA 5FZBA 2YPDA 3PUAA 5FP9A 5IVBA 5FZOA 2XDVA 5FZFA 5F3IA 3OPTA 4ASKA 3LDBA 2XMLA 2P5BA 2Q8DA 5FZMA 5A7WA 4CCLA 3DXTA 5LY1A 4EYUA 5FZLA 4QXBA 3N9PA 3DXUA 5F5IA 4CCJA 3K2OA 4QWNA 5FP8A 3KVBA 5FZ3A 4GJZA 3OPWA 5IVCA 3KV9A 3PTRB 4LXLA 4EZ4A 2GP5A 4TN7A 5FYIA 5FJKA 4HOOA 5FY0A 4D6QA 4QX8A 4XDOA 4BISA 3UYJA 4GAZA 5A7WB 5FP7A 5LY2A 2YBKA 5E6HA 4BXFA 5FZ7A 5FYSA 2VD7A 4V2VA 5FUNA 3AVSA 2XUEA 3AVRA 5IVYA 5FYBA 3N9NA 2Q8CA 5KR7A 5FPBA 4LIVA 3KV5A 5FWEA 3ZLIA 5A3NA 4LIUA 5FYUA 4EZHA 5FPUA 5FXWA 5A7QA 4QXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DO0 A;  5FXZ A;  3PU3 A;  5FYV A;  2PXJ A;  4CCK A;  5FY1 A;  4URA A;  3U4S A;  4CCN A;  4XDP A;  5F3E A;  2W2I A;  3K3O A;  2YU1 A;  4Y3O A;  2YBP A;  2YU2 A;  5F5A A;  2OQ6 A;  5FY7 A;  2WWJ A;  4C8D A;  3U78 A;  5FV3 A;  3PU8 A;  3K3N A;  4D6R A;  2GP3 A;  2WWU A;  5F2S A;  5FY4 A;  4LIT A;  3PUQ A;  5A7P A;  5FZE A;  5LW9 A;  4E4H A;  5K4L A;  4BU2 A;  4Y33 A;  4QX7 A;  4IGO A;  5FP4 A;  5FZK A;  5FZH A;  4AI9 A;  5IVV A;  3AL6 A;  4UF0 A;  4DIQ A;  5A3T A;  5FZG A;  5FZO B;  5FWJ A;  2YBS A;  5LWB A;  5F5C A;  5FBJ A;  5F39 A;  5FZ4 A;  5CEH A;  5IVF A;  5FYM A;  5FYY A;  3KV6 A;  5FPA A;  3AL5 A;  4HON A;  5FXV A;  5IWF A;  3ZPO A;  5IVE A;  5F3G A;  5A1L A;  3RVH A;  3NJY A;  5A7N A;  4CCM A;  5FJH A;  5A7O A;  5A1F A;  5FZ1 A;  2OT7 A;  5F37 A;  5A3P A;  4AAP A;  4IGP A;  4NUB A;  4UF0 B;  5A7S A;  3LD8 A;  5A80 A;  4QXC A;  4Y4R A;  4CUG A;  5FYT A;  5FY5 A;  3PUR A;  5FYC A;  5F2W A;  5ISL A;  2Q8E A;  5FPV A;  5FUP A;  5FZD A;  3KVA A;  3PDQ A;  5F32 A;  5FP3 A;  5FZ6 A;  5IW0 A;  2OX0 A;  2XXZ A;  4GD4 A;  5FZ0 A;  5FZI A;  3N9Q A;  4D6S A;  5FYH A;  1VRB A;  5FZC A;  5F3C A;  5FY8 A;  5IVJ A;  4QU1 A;  3N9L A;  5FZ9 A;  5FYZ A;  5FXX A;  4IGQ A;  5FZA A;  2OS2 A;  3N9O A;  3N9M A;  5FY9 A;  4V2W A;  5ANQ A;  5FPL A;  4CSW A;  4CCO A;  2OQ7 A;  5FZ8 A;  3KV4 A;  5A3W A;  3PUS A;  4GJY A;  5FZB A;  2YPD A;  3PUA A;  5FP9 A;  5IVB A;  5FZO A;  2XDV A;  5FZF A;  5F3I A;  3OPT A;  4ASK A;  3LDB A;  2XML A;  2P5B A;  2Q8D A;  5FZM A;  5A7W A;  4CCL A;  3DXT A;  5LY1 A;  4EYU A;  5FZL A;  4QXB A;  3N9P A;  3DXU A;  5F5I A;  4CCJ A;  3K2O A;  4QWN A;  5FP8 A;  3KVB A;  5FZ3 A;  4GJZ A;  3OPW A;  5IVC A;  3KV9 A;  3PTR B;  4LXL A;  4EZ4 A;  2GP5 A;  4TN7 A;  5FYI A;  5FJK A;  4HOO A;  5FY0 A;  4D6Q A;  4QX8 A;  4XDO A;  4BIS A;  3UYJ A;  4GAZ A;  5A7W B;  5FP7 A;  5LY2 A;  2YBK A;  5E6H A;  4BXF A;  5FZ7 A;  5FYS A;  2VD7 A;  4V2V A;  5FUN A;  3AVS A;  2XUE A;  3AVR A;  5IVY A;  5FYB A;  3N9N A;  2Q8C A;  5KR7 A;  5FPB A;  4LIV A;  3KV5 A;  5FWE A;  3ZLI A;  5A3N A;  4LIU A;  5FYU A;  4EZH A;  5FPU A;  5FXW A;  5A7Q A;  4QXH A; 
#chains in the Genus database with same CATH topology
 3JCI A;  4E4D X;  2PLV 2;  1X50 A;  1OQE A;  1NCQ A;  4MXW A;  3RJR A;  5GLT A;  1XPW A;  5KHH A;  3U0Z A;  5EYY A;  4Y3O A;  4Y4Y A;  3ZFE C;  1C8M 2;  5KXD A;  3E5U A;  1BYH A;  1I5Z A;  2YV8 A;  1V0A A;  2X09 A;  5FO8 B;  1WCS A;  2A6Y A;  5HXM A;  5KXB A;  3FHA A;  1TVG A;  1SFP A;  3V65 A;  3CF6 E;  4QDS A;  4Y33 A;  4IGO A;  2EIB A;  3HIF A;  4M00 A;  3AL6 A;  4U2A A;  3VBS C;  5KC5 A;  2Z2S B;  2VVD A;  5A3T A;  3S6P A;  1ND3 C;  2YBS A;  4UOJ A;  4WM8 A;  5GZF A;  3RYP A;  1PVC 2;  3KV6 A;  3J7L A;  1DIW A;  2WII B;  1ZBA 2;  4KWJ A;  3HMY A;  3S7I A;  1V9U 2;  3JBG 1;  1D0H A;  1IS5 A;  3SH5 A;  2XBO 3;  2P6H A;  4IEX A;  1CVN A;  4CP9 A;  1OF3 A;  1U5I A;  4XC9 A;  1X33 A;  3AB0 A;  4FSJ A;  1UO9 A;  5A3P A;  5FDB A;  4BPZ A;  1YFW A;  4JAA A;  3I2D A;  2WO2 A;  4FQZ A;  2I45 A;  4UXA A;  3N4M A;  3JUU A;  1B35 C;  2EID A;  4CDX A;  1QJU 1;  1A8M A;  4ZZ8 A;  3RZJ A;  2VUA A;  2D93 A;  2FD8 A;  4LLO A;  4I09 A;  2SBA A;  3LA7 A;  4QPI A;  4GXL A;  4CEY A;  1PIV 2;  2ARB A;  1AR9 3;  2JB8 A;  3N35 A;  4AQT A;  1GMM A;  2F4P A;  3PNA A;  4NRP A;  2VH9 A;  5I8Y A;  1RXF A;  1RUD 2;  1JZ2 A;  2WQ4 A;  2HWC 3;  1HQL A;  2YFZ A;  1O59 A;  1VRH 2;  1W2N A;  5E89 A;  1W04 A;  1MEC 3;  4AI2 A;  3WDX A;  2AH2 A;  3CU7 A;  1Z7S 2;  5HCB A;  2Y8K A;  4YW1 A;  3WSO A;  4QQP A;  3NL1 A;  1PX4 A;  1RL3 A;  3R6S A;  4UFM A;  1ZRD A;  3PVE A;  1DGW A;  1I3H A;  2V09 A;  4M0H A;  2WDB A;  1J84 A;  4LO5 B;  3SIS A;  2LRO A;  4LBO A;  4RN5 A;  2CGP A;  3MZH A;  1CES A;  5K9Y A;  5AVA A;  4OCT A;  4YVW B;  1W6N A;  1HN0 A;  1FMD 2;  1NXM A;  2P5B A;  5A7W A;  3VBH B;  1X8M A;  4Y5Z 0;  1UZV A;  2CAV A;  1AYM 2;  4CXX A;  2YZ4 A;  1ZM1 A;  1HKD A;  2J22 A;  1HN1 A;  2UU8 A;  3KV9 A;  4XMA A;  2ZGK A;  2ZX1 A;  4GMP 3;  4YZ1 A;  4AFD A;  2VZ3 A;  3HT1 A;  3J8F 2;  4XBN A;  2GP5 A;  2EIC A;  4LHN A;  3WOG A;  4DNY A;  3IPV B;  2WT0 A;  1UCX A;  3ZFE B;  1FXZ A;  1GBG A;  2PQQ A;  1YRZ A;  2RJK A;  1S0I A;  3J4U H;  3URF A;  3WNO A;  4KG8 A;  4FPK A;  1FI2 A;  2B5H A;  4CU9 A;  4IXL A;  1POV 3;  1UW8 A;  4YW2 A;  1WBF A;  3FN9 A;  3C7F A;  3OSD A;  2ZGS A;  4DOU A;  2JDK A;  2IZW A;  1PMH X;  4PBO A;  3C7G A;  5L19 A;  2ZA9 A;  5C8C B;  2HKX A;  5T5L A;  2CU5 A;  2Y6H A;  4P9I A;  1ND3 B;  4J1X A;  2YFU A;  3U07 A;  3LIG A;  4MAD A;  1DYP A;  5FPB A;  4KU8 A;  1J59 A;  2V4A A;  2FMD A;  4LIU A;  5EIY B;  3ZYI B;  4HK8 A;  2EVX A;  1AR9 1;  4OLL A;  5B4N A;  4TLG A;  2ZAA A;  1AYN 3;  2HWC 1;  2D3S A;  5FY1 A;  4DRR A;  5F5Q A;  2WQ8 A;  3ENR A;  3G6J B;  2ZJC A;  1RB8 G;  3PVN A;  3ZXK A;  1MEC 1;  3CZJ A;  4QX2 A;  2WWJ A;  2RS3 3;  4BH9 A;  2BNO A;  2Y34 A;  4UAP A;  1LJ7 A;  2BRT A;  4BME A;  1OH4 A;  1Q8Q A;  4URT A;  1OFS A;  4CCC A;  1I6X A;  2XJT A;  1UMZ A;  5FZG A;  4Z8B A;  4TSV A;  5KHJ A;  3N7K A;  5BNP A;  4J25 A;  1NXD 1;  5JI7 A;  4QPG C;  3H3U A;  2J1E A;  2PYT A;  5F1R A;  3K48 A;  5G05 L;  4YG6 A;  5FK8 A;  1ASJ 1;  5JSR A;  2VZ1 A;  1MZ6 A;  2O0O A;  2HEV F;  4QXK A;  1REE A;  3ACI A;  4LBN A;  3LQC A;  2DVD A;  1VBB 3;  2WO7 A;  4UWD A;  1X9P A;  2AEY A;  1CX1 A;  1ZRF A;  4AI3 A;  2D6P A;  1GP5 A;  4JGZ C;  2ZTN A;  3NNF A;  4EWD A;  2VBB A;  2JIJ A;  5DXD A;  2BFU L;  1QOO A;  2VQ0 A;  3ZYB A;  4AVC A;  2RS5 3;  2JKX A;  3AZY A;  3U14 A;  3I59 B;  4XFI A;  4PLN A;  3PUR A;  2VCM A;  1U12 A;  3ZR6 A;  3Q8C A;  4ZKT B;  3TYJ A;  4B4Q A;  3T0B A;  3H7J A;  4BQY A;  4CZS A;  2DCJ A;  5T52 A;  1POV 1;  4E2G A;  5LA0 A;  3O1S A;  4JTO A;  1QNY A;  5JXJ A;  5T54 A;  4KU7 A;  3I2J A;  1QJY 3;  4IEV A;  5I8T A;  2FDJ A;  5K0U B;  5JOY A;  3VDB A;  3BOW A;  1UYZ A;  4PIY A;  4Z82 A;  3VDC A;  1TZO A;  2WFF 1;  3ZSK A;  2WSU A;  3MUY 1;  4RHV 3;  3PJY A;  3VBO A;  3KT7 A;  3VN4 A;  2DUQ A;  2XL9 A;  2B42 B;  1NZI A;  3N7L A;  1GP4 A;  4ES8 A;  2VJX A;  3JD7 3;  1VBC 2;  3FJS A;  2ARC A;  3ZYH A;  1DGL A;  3O1V A;  1RIT A;  1NCR A;  4BB3 A;  1AYN 1;  5A6Y A;  4BM8 A;  4LKS A;  1SLA A;  5FIX A;  1AVB A;  2YPD A;  5JZG C;  3SQO A;  2XJS A;  2XKO A;  1H8T A;  2C6S A;  3OGJ A;  5BNN C;  3ILR A;  2ARX A;  2HWB 1;  2RS3 1;  2HYK A;  2LW8 A;  2A6X A;  1YI9 A;  4HPK B;  2XVG A;  4PCR A;  3VZN A;  2PHD A;  4FTS A;  4EWA A;  2KXL A;  3LA2 A;  4PI2 A;  3HJR A;  4JHZ A;  4R4X A;  2UYB A;  1CJP A;  1RUC 3;  1TME 2;  4L99 A;  3DKQ A;  4L92 A;  4QWN A;  4XJZ A;  4DUW A;  2Y38 A;  3VD9 A;  4XJW A;  5CBL A;  4IEQ A;  3C3V A;  3QAC A;  5SV8 A;  3SHR A;  4IV3 A;  4TN7 A;  4KG0 A;  1D4M 3;  4KWU A;  3MF6 A;  5GKA C;  1G9F A;  1ONA A;  4UBG A;  4E8C A;  5DAV A;  1UPI A;  3N7J A;  2VW1 A;  4WZC A;  4Q4X 2;  3UYJ A;  1ZZ8 A;  2C1F A;  4Y1V A;  3E1F 1;  2VQU A;  5JLV A;  3PJQ A;  1FV2 A;  2RR1 3;  2X5I B;  2K46 A;  3S7E A;  5ACA 3;  2G9Z A;  2ZX0 A;  4FPE A;  1GZW B;  1PHM A;  4XYX A;  1WLW A;  3VBR A;  1QH6 A;  4CEW A;  3VBU B;  3T0D A;  3RJ2 X;  3BTY A;  2RHP A;  4YFZ A;  2DU0 A;  5FYB A;  1OD5 A;  4YM3 A;  1AHS A;  4P9Y A;  4QPG B;  5FWE A;  5IAV A;  1RED A;  4Y1Z A;  4BYY A;  5FUI A;  5FPU A;  4L2N A;  3D0S A;  4X8P A;  3VV1 A;  4F8A A;  1X36 A;  5E8A A;  1I5P A;  1QJY 1;  3HWJ A;  2WS9 2;  1NZC A;  2ERF A;  3QD6 A;  2FCU A;  1Q3E A;  4M4P A;  3MW2 A;  4KNC A;  1N47 A;  3BTZ A;  3K3O A;  2A3Y A;  1W9F A;  2D44 A;  1SDD B;  2GC1 A;  3J7N A;  4JKL A;  3ZYF A;  4JGZ B;  3RPQ A;  1MQT A;  2YPJ A;  4OMC A;  3U78 A;  3BUC A;  4DPN A;  2Y0I A;  4CDU A;  1WMF A;  4F3J A;  3JD7 1;  1F5F A;  1H0B A;  1OVS A;  2JX9 A;  2VOV A;  5K4L A;  1XQN A;  5IVV A;  1DYK A;  5FP4 A;  4ATE A;  4Y20 A;  3RG0 A;  1EAH 3;  4LO8 A;  4OFG A;  2EAK A;  5FWJ A;  4S2F A;  4HSJ A;  2VBD A;  1YWK A;  1ENQ A;  1KS4 A;  1VBE 1;  4XTM A;  4XJ8 A;  5FYM A;  3S57 A;  4KWL A;  5JSO A;  1PGL 1;  4XEZ A;  1Y43 B;  3PVO A;  1W39 A;  4GZ9 A;  2UUR A;  4M3C F;  4LO4 B;  4MZU A;  4XIL A;  4ATF A;  3G7D A;  2NMO A;  1O7F A;  4I3P A;  2Y6F A;  1RUC 1;  3R0R A;  4MYE A;  4RA0 A;  3UNP A;  5FZ1 A;  1ZX5 A;  2VZQ A;  2PHW A;  1V6N A;  2RJ2 A;  2UWA A;  5F37 A;  1O6U A;  1YYN A;  3WY6 A;  3ZSL A;  2YC2 A;  3DEM A;  4AEK A;  5FPZ A;  4JKM A;  2BP6 A;  2VCC A;  1D4M 1;  2O8Q A;  4CUG A;  1PK6 A;  4IEW A;  5JZG B;  3D6E A;  4BE3 A;  4LBQ D;  5FPV A;  4Q4W 1;  5FZD A;  1PMI A;  1SBD A;  2RDQ A;  5GZG A;  4AHW A;  2RR1 1;  3KS7 A;  5FZ0 A;  1Q8O A;  2AAC A;  1PVX A;  3C7E A;  2R06 3;  1C3H A;  2HWF 2;  4XZU G;  3OY8 A;  2VQA A;  1W2O A;  4PLO A;  3MGU A;  3KQ4 B;  1EYB A;  5EZW A;  4QD2 A;  3RMX A;  4ZHN A;  1WA4 A;  4Z2A A;  3E6C C;  1CZS A;  3WP6 A;  4GH4 C;  3JZV A;  5KXC A;  4OZO A;  2WIN B;  1SBE A;  3EB7 A;  3ACH A;  3KGL A;  5F6L B;  1NG0 A;  4PF1 A;  2OQ7 A;  1HJF A;  1W2T A;  1M06 G;  1R08 3;  4ZU4 A;  4XZP A;  4R8H A;  3THT A;  3OBR A;  3WCR A;  2VOX A;  1ZZB A;  4RGK A;  2WZR 3;  3RFR A;  2VOT A;  4BIO A;  4CVU A;  2FDI A;  4LT5 A;  3KSC A;  1DLL A;  2GMM A;  4ZZ5 A;  1YEW A;  1QQP 2;  3JB4 C;  2WRA A;  1EAH 1;  2B9V A;  4N53 B;  3M7A A;  2XGX A;  1W90 A;  2ORZ A;  2DUR A;  4PQ9 A;  1LNS A;  4JVA A;  4ZXK A;  3WG3 A;  4AQS A;  4YZ4 A;  3QCW A;  3MV0 1;  4HT1 T;  1OSG A;  1AZD A;  4OI1 A;  5HCH A;  4TXW A;  4YVS A;  2OYZ A;  4LBL A;  2MHF A;  2HLE A;  5FJK A;  4G3Y C;  4JGY B;  3K46 A;  3LAG A;  1QF3 A;  4LBQ A;  5D21 A;  5EV7 A;  5I0R A;  1X8E A;  4FVV A;  5GM0 A;  1MZ5 A;  4AK3 A;  3HVD A;  1XE7 A;  2WA4 A;  3NKG A;  2LTN A;  2P4E A;  1YXW A;  3RDI A;  2JEM A;  5LY2 A;  3VZJ A;  5KHI A;  2B9U A;  2VXJ A;  2GC3 A;  5B4X A;  1W3X A;  2E9Q A;  1XU2 A;  3Q8B A;  1NKG A;  3RWK X;  3BOD A;  1UD1 A;  1W6O A;  4Q5O A;  2JIC A;  2YHJ A;  2UWC A;  1LED A;  3SCH A;  2MEV 3;  1HB4 A;  4XUN A;  2Q8C A;  5JCT A;  3C7H A;  4RFT 0;  4B7E A;  3R4U A;  1F35 A;  3S0M A;  4QPW A;  2ZGO A;  1QXR A;  4UT5 A;  4HN0 A;  2R06 1;  4N43 C;  4QXH A;  2DUO A;  4XCB A;  1GNZ A;  1R09 2;  2RMU 3;  5C4W C;  3KGZ A;  5FYV A;  4RQP B;  1UN1 A;  2PXJ A;  1PO1 3;  4MVT A;  5J98 B;  2A5Z A;  2FQP A;  2N7G A;  1KQR A;  1NX9 A;  4LE4 A;  1AR8 2;  2YU1 A;  3ZFG A;  1QXJ A;  3IDB B;  5FY7 A;  3WF3 A;  3ES4 A;  4GWI A;  1FNY A;  5F2S A;  4LIT A;  2WZ8 A;  3KZ4 C;  3ZDV A;  1S0J A;  5LW9 A;  3AC0 A;  2XHK A;  3USU A;  3ZYR A;  1QEX A;  3AM2 A;  3MI8 A;  3L2Y A;  4EN8 B;  5A3O A;  2HJI A;  1BBT 1;  1R08 1;  1LEM A;  2ZEZ A;  4P02 B;  5D8A A;  4IEY A;  5IVF A;  2IXC A;  3O1T A;  1AXZ A;  1LHU A;  1JMU B;  4MSV A;  5BNO B;  3UV9 A;  4FP3 A;  2BBA A;  4NR1 A;  5FKC A;  3OJB A;  4XHB A;  4DXT A;  1JU3 A;  1RHI 3;  2JG8 C;  5FPX A;  5GLW A;  1W6P A;  3T4V A;  5HXV A;  1ZZC A;  1KDK A;  5A7O A;  1E5I A;  4GH4 B;  2ETE A;  1G9C A;  5D2A A;  4OZX A;  1GYK A;  3OF1 A;  4UF0 B;  2WNV B;  2J1A A;  3ZSJ A;  2AUY A;  1PGW 1;  1XNA A;  1U0A A;  2F4L A;  2VCB A;  5DAW A;  4AGG A;  3H50 A;  4NHL A;  4QKD A;  3K51 A;  1W8F A;  4WVM B;  3TNQ A;  1W6Q B;  5IK5 A;  5C9A A;  2A3W A;  4YM0 A;  5F32 A;  1WW4 A;  3ROU A;  4O7X A;  1QDO A;  2I74 A;  3AP4 A;  2V73 A;  5CFC A;  4BCU A;  3BOP A;  3DEC A;  4NHK A;  1G9D A;  1A3K A;  5A1A A;  3VD3 A;  4AVB A;  1ULD A;  3KWV A;  4M3C A;  3H3L A;  2MEV 1;  3ZYJ B;  4H7L A;  4L0P A;  5FY9 A;  4V2W A;  3AYE A;  3SMH A;  2NLR A;  4Z1V A;  1RUE 3;  4YYO A;  3A23 A;  4GWN A;  4JRL A;  1OKO A;  3CHX A;  4ASM B;  1G9B A;  1PO1 1;  2W9X A;  1RVF 3;  1W0P A;  5JWP A;  5IVB A;  4FT8 A;  2QZ2 A;  4OHZ A;  5LZ6 A;  2XDV A;  1YJK A;  5J48 A;  2B7Y A;  4XFG A;  4EWE A;  2Q8D A;  3PME A;  4DY5 A;  2ZEY A;  1C28 A;  3RYK A;  4OI2 A;  4Q4Y 1;  1MS8 A;  5A32 B;  3ZKY A;  1O5L A;  4N90 A;  2FMY A;  2CHH A;  4ZPI A;  5T3N A;  1UKR A;  1UY2 A;  2ZAC A;  4CUB A;  5JSP A;  4NII A;  1LOF A;  3B9I A;  3HBZ A;  4N43 B;  4Q4V 2;  4YW3 A;  1GOF A;  5DUU A;  4XF3 A;  1F31 A;  4HOO A;  5GLZ A;  1ZA7 A;  1RHI 1;  4CDW A;  3BB6 A;  2ZHK A;  2C9A A;  4GAZ A;  3CJI A;  1COV 2;  1EPZ A;  3PIG A;  4K40 A;  2BWC A;  4IE7 A;  4AGV A;  1K5M A;  3W21 A;  1US2 A;  2X8K A;  3LPG A;  1NY7 1;  4LO6 B;  5FZ7 A;  5FYS A;  2Y6L A;  1PO2 3;  2RM2 2;  5IAX A;  5IVY A;  3R4S A;  4ONU A;  1HJG A;  4P9W A;  4ZU5 A;  4QM8 A;  2DF7 A;  3AKQ A;  1ENS A;  2VBP A;  2RG4 A;  5LA2 A;  1SG3 A;  5BNQ A;  5FYU A;  1ZYB A;  4XQD A;  3ZFF A;  2WSV A;  2UWB A;  1NT0 A;  2ARA A;  3POG A;  5J1X A;  5FZO A;  4AL9 A;  5FMB A;  2JG8 B;  3AXE A;  3DV8 A;  3P6B A;  4JDM A;  4UW4 A;  4YW5 A;  4YFW A;  1AXK A;  1N1S A;  3ZIX A;  4D0Q A;  1DF0 A;  1DU3 D;  1O4Y A;  2P3J A;  3VBF C;  5FY4 A;  4FXK B;  4L8Q A;  1RUE 1;  3H1W A;  2ZOE B;  1ACC A;  3E6B A;  1OOP A;  1RVF 1;  4Q27 A;  3KM5 A;  2P3K A;  1YI7 A;  2WNU A;  5FMD A;  4PDW A;  2ZGM A;  1RYY A;  5GLU A;  2Q8O A;  1OH3 A;  2XVK A;  1ND2 C;  3ALQ A;  4LQR A;  5IK4 A;  3KHC A;  4FTB A;  3ZPO A;  5FQ0 A;  4HG6 B;  1D4V B;  1JYW A;  5A1L A;  3DKW A;  2DTW A;  1DP0 A;  4I0A A;  4KH9 A;  4NHM A;  1RUI 3;  1YUD A;  4OMD A;  2HWD 2;  2XLA A;  4IUG A;  2UY9 A;  2ZGN A;  3RI9 A;  3ZR5 A;  2BW8 A;  1CAX B;  2JDP A;  1DQ5 A;  4MGK E;  5E16 A;  1T6G C;  3HQR A;  4YPJ A;  4XF0 A;  2NN8 A;  5ISL A;  1C1F A;  2DBI A;  4XFC A;  1LCL A;  3LEI A;  4FPF A;  3F95 A;  4Q0S A;  3ZO0 B;  5FO9 B;  1AL2 3;  4W6Y A;  1SCS A;  4AYU A;  3H1M A;  4B1L A;  2HWE 3;  4AQ2 A;  4BLI A;  2ZHL A;  1JYV A;  3P5B A;  1PO2 1;  3PUI A;  4I0B A;  4GUL A;  5KBF A;  1BK0 A;  1OPM A;  2PFW A;  3O0X A;  4W6X A;  1DQ4 A;  4AOC A;  3JXS A;  4O65 A;  1TG7 A;  2BYV E;  3J7H A;  2LUW A;  2YUE A;  2P37 A;  3AK0 A;  1LHV A;  2D97 A;  4CUA A;  3CDZ B;  3NNJ A;  1GQG A;  3WD5 A;  2BOI A;  2VOW A;  3I2I A;  4S2G A;  1GZT A;  5BPX A;  2J42 A;  3JBG 2;  2FZ2 A;  1DG6 A;  2YXS A;  1XSQ A;  3OB8 A;  1JHN A;  1XE8 A;  3TN9 3;  4GAL A;  1F5J A;  3T0A A;  4L9B A;  1QIQ A;  1CZV A;  5FZM A;  2BBV A;  3POB A;  4LE3 A;  5JIU A;  5GZE A;  3QBQ A;  1LU1 A;  1QJU 2;  1VBA 2;  1EY2 A;  1RUH 3;  4FOY A;  4D3W A;  4QGN A;  1QHD A;  5HPO A;  3ZXL A;  4M0N A;  2LRP A;  1FYU A;  1DZQ A;  4H7M A;  4EZ4 A;  1JS9 A;  3WV6 A;  3BCW A;  1UYP A;  2GC0 A;  2MPF A;  1KEX A;  1OMI A;  3ZN6 A;  2AYH A;  2C4X A;  2IVI B;  4YW4 A;  3FWE A;  1AR7 3;  4RL7 A;  5CFD A;  3WNN A;  2BGC A;  2BVV A;  4Q29 A;  1RUI 1;  1Y3T A;  4RR3 A;  5DUX A;  1WW5 A;  4CDQ C;  2YBK A;  1W05 A;  3B94 A;  4UFH A;  1R1Z A;  1CGP A;  2VW0 A;  1MVE A;  1ENX A;  1QGL A;  3M3I A;  3MIF A;  1UOJ A;  2VR4 A;  4CP1 A;  1W0N A;  4B7K A;  1DYO A;  1DZR A;  3KT4 A;  1KJL A;  2XWB B;  1YLL A;  5JPN B;  5KR7 A;  4Y22 B;  1YC6 1;  2ZBJ A;  1ND2 B;  1S0B A;  4IEO A;  1EUU A;  1RXG A;  1AL2 1;  4XXA A;  2NYY A;  4TWT A;  3AZZ A;  2HWE 1;  3PHM A;  4NVP A;  3NAP C;  3W20 A;  4ZXE A;  2VW2 A;  3ACF A;  2TUN A;  3MDP A;  1DQ6 A;  1UXZ A;  3DYP A;  2JDZ A;  3Q8E A;  2A1X A;  2C26 A;  3NV2 A;  4X8N A;  3I2G A;  1GP6 A;  3HEI A;  4AFB A;  5AFB A;  4E4H A;  3O1M A;  2C9K A;  1PGS A;  4BU2 A;  4QX3 A;  1LES A;  2ET7 A;  1C8N A;  1WZX A;  2WO1 A;  1CR7 A;  5C6C A;  1XSR A;  2XBO 2;  2JG9 C;  1IKP A;  2B45 X;  1X9T A;  4LPL A;  3Q8A A;  5FZ4 A;  2W1S A;  1ZVF A;  1L7R A;  5FRA A;  3TN9 1;  4P08 A;  3IDA A;  3NV1 A;  3UK9 A;  3WDV A;  5FPA A;  4Z07 A;  5FXV A;  5GJ6 A;  3MYX A;  1OLR A;  1PZ8 A;  2H0V A;  1H2N A;  3ELN A;  1XRU A;  1CQ9 A;  4P00 B;  4RS5 A;  4UW6 A;  2BEO A;  3ST7 A;  5JMC A;  2E7T A;  4BQ2 A;  1E5H A;  1RUH 1;  2VGD A;  2XUM A;  4YG3 A;  1QOT A;  3CIH A;  3MLJ A;  4A7Z A;  4ZY9 A;  1O8P A;  2PHL A;  4IGP A;  3PIJ A;  1CAW B;  3GJA A;  4H3W A;  5A7S A;  3OPZ A;  2DVB A;  1AR9 2;  3LDK A;  1YJL A;  1XU1 A;  2DVF A;  4MGY E;  2V5D A;  2YY1 A;  5FYT A;  3WDU A;  5FYC A;  3F2Z A;  5F2W A;  2HWC 2;  2BGO A;  3VZM A;  3V0A B;  2NPI A;  2VM9 A;  4JQT A;  1AR7 1;  5FZ6 A;  2ZAB A;  4HK9 A;  1MEC 2;  2R04 3;  5C8C C;  4IL7 A;  4HVQ A;  2I07 B;  1VRB A;  4D94 A;  2CSG A;  3IZO A;  3TB0 A;  2VXR A;  3VBS A;  4CXW A;  1ND3 A;  1LHN A;  2QQN A;  2DCY A;  2BZD A;  3VZO A;  1BZW A;  4AFC A;  1PMJ X;  4XQW A;  2W3J A;  4CE8 A;  4K1Z A;  1D7P M;  3J9S A;  4WVW A;  4NID A;  4YAR A;  3T2Q A;  3LZZ A;  5IHR A;  4NWW A;  3LB9 A;  1O3R A;  5ABJ B;  1YO8 A;  4WVZ A;  4CDQ B;  1DCS A;  1RIN A;  2D98 A;  4A4A A;  4ASK A;  3EJK A;  1IOA A;  1HRV 3;  3AJY A;  3VLB B;  2XVL A;  1DLC A;  2ILM A;  3DN7 A;  5FZL A;  1B35 A;  4GWM A;  2JIG A;  1F8V A;  3OYW B;  5DAQ A;  5FP8 A;  5FLJ A;  3OPW A;  2R07 3;  5A3M A;  4AED B;  2CAU A;  2PA7 A;  3OEB A;  3NAP B;  3THD A;  3GBG A;  3PMS A;  1V70 A;  4LUL A;  1K42 A;  5T5J A;  3O0W A;  2P3I A;  3LCP A;  2PMW B;  4XXP A;  3RZZ A;  1CIW A;  1Q8S A;  3BN6 A;  3ZVX A;  3H7Y A;  4QX5 A;  3WUC A;  3ZXJ A;  4M3C E;  2HYX A;  5JOZ A;  1C1L A;  3KHB A;  4MGZ E;  5CIR A;  3ZXD A;  1QJZ A;  2DCK A;  1YQC A;  3OUJ A;  4RYD A;  4YZ3 A;  2JG9 B;  2OA2 A;  1UU6 A;  1ASJ 3;  1AYN 2;  3NNG A;  2JEC A;  3GZA A;  4GMP 0;  3VDD C;  2ZX4 A;  5K0U C;  3AKR A;  1JUH A;  3EMR A;  3O0V A;  1IKQ A;  2R04 1;  4ISQ A;  5DUW A;  4KBZ A;  1OD3 A;  3NMB A;  4LHK A;  2RS3 2;  5FXZ A;  2R7E B;  3WEZ A;  1JZ8 A;  3AKS A;  1S0G A;  3HN1 A;  3FFQ A;  4DEV A;  2YYO A;  1EV1 3;  1VAL A;  4LHS A;  1PM7 A;  3I3D A;  5FMC A;  1POV 0;  4OI0 A;  5C7G A;  2ENR A;  3IBM A;  4WM7 A;  2WQZ C;  3OUH A;  3DCQ A;  1VB2 A;  2JKB A;  3BPS A;  3PUQ A;  4IER A;  4HN1 A;  5BV6 A;  2JEN A;  2YB7 A;  1LOD A;  3LDR A;  2E6V A;  4QX7 A;  5LCW L;  4AFA A;  3S5A A;  3LFM A;  2VTX A;  4XFA A;  1WKY A;  1S0E A;  4TTG A;  1UOF A;  2OZ6 A;  1UY4 A;  1HXS 3;  1VBB 2;  3RWN A;  3NKT A;  5FBJ A;  2WFF 3;  5L7O C;  1NCQ B;  2RVA A;  5I8S A;  5A6Q A;  3JB8 A;  2BWA A;  3VDA A;  1A78 A;  1HRV 1;  3O12 A;  4NPL A;  1SBF A;  4QT6 A;  1S0F A;  5DG1 A;  3WP3 A;  1ZBE 3;  3KT1 A;  4FOW A;  2VTX J;  1RUG 1;  4HPK A;  3KMH A;  4F7Z A;  3U37 A;  2RS5 2;  1PIV 3;  4FO9 A;  5FJH A;  4Y26 A;  4LBM A;  1OBN A;  2JDN A;  4B3N A;  2R07 1;  3KCY A;  3I4I A;  3D0J A;  5FAX A;  2Z79 A;  3GJB A;  4AR2 A;  3RI8 A;  4WM8 B;  4BMB A;  4KBB A;  2HWB 3;  1QJY 2;  4LBJ A;  4JKK A;  1U5Y A;  2X5I C;  4XE9 A;  3VKO A;  2BGP A;  1LEN A;  1OC1 A;  5FMO S;  1UY1 A;  3GHN A;  4NHX A;  4RHV 2;  3VBU C;  4GD4 A;  4CP9 B;  4DY3 A;  5A6Z A;  2L9L A;  1UY3 A;  4P9G A;  1ULO A;  4D7S A;  1GZW A;  1YQ5 A;  5CZK A;  2ZHM A;  4LOR A;  4PIZ A;  5I0T A;  3VL9 A;  4HAN A;  2QQM A;  3JD7 2;  4IV1 A;  4QHO A;  3TEY A;  1H9W A;  1W8Z A;  2A6V A;  3QOP A;  5FFO C;  4EE2 A;  1W9S A;  4HFS A;  4PI0 A;  5DQ0 A;  2X10 A;  5LA1 A;  1TNR A;  4TYS A;  1S55 A;  4BQW A;  1PGL 2;  1JOB A;  2QDN A;  4K8R B;  4OQ9 A;  2W08 A;  1G6N A;  3PUS A;  1EV1 1;  4CEY B;  1IPS A;  2YG0 A;  2W39 A;  2ZHN A;  4QDR A;  3OGS A;  2AEZ A;  3KQR A;  1XC6 A;  1RUC 2;  2WLP A;  4JGZ A;  3BIE A;  1W03 A;  3U1X A;  1KJR A;  5EJ3 A;  3BGA A;  4EN6 B;  3RYR A;  1D4M 2;  3VDD B;  4HSL A;  3U11 A;  5JOW A;  3RZM A;  1LRH A;  4UW5 A;  1ODN A;  4CRQ A;  3W58 A;  1HXS 1;  1WME A;  5H9R A;  1H1I A;  1HW5 A;  2RR1 2;  4LXL A;  1ZRC A;  2BQP A;  5ACA 2;  4LKF A;  1ZBE 1;  4UFL A;  1W6N B;  2W1U A;  2W94 A;  1PIV 1;  4IE5 A;  5HBA A;  4YG0 A;  5LAT A;  3UJQ A;  4YW7 A;  5A7W B;  1ULE A;  4AHZ A;  5C3R A;  1MAC A;  5H9P A;  2WNO A;  1FPN 3;  2EXH A;  3SLI A;  3WF4 A;  1CN1 A;  1JHJ A;  4FPH A;  1VBE 3;  2XUE A;  3R05 A;  1UX7 A;  2IXH A;  3NWK A;  3LOB A;  5JZG A;  2IFW A;  2P34 A;  5L7O B;  1N3Q A;  5BNN A;  3AMQ A;  1KFU L;  5AFE A;  5JOX A;  3ZN5 A;  1X82 A;  2V72 A;  2IXL A;  3AP6 A;  3N3H A;  4Y1Y A;  3H8O A;  4DUX A;  2EXK A;  2QQW A;  2QQP A;  2GAL A;  2Q1F A;  4XBL A;  3H9A A;  2OW4 A;  5J09 A;  5F3E A;  1XOY A;  3GAL A;  2ET1 A;  3GYD A;  4YZ2 A;  3K3N A;  4B4P A;  3CMG A;  4K21 A;  1H4H A;  3ACG A;  4Q4W 3;  1W2A X;  1QJX 3;  4M4R A;  2CGN A;  4AI9 A;  1WW6 A;  3N7M A;  4GKY A;  5FZH A;  1HX6 A;  4COU A;  1W99 A;  3VHO A;  1UU4 A;  2D6N A;  1JYI A;  1U5Z A;  5F39 A;  4J6G A;  3B00 A;  2D3R A;  4MHR A;  4N53 C;  2ZGP A;  4HKW A;  4LMF A;  2J1T A;  2R6Q A;  2JE8 A;  2W91 A;  2PHF A;  5LEK A;  1W6M A;  4OUL A;  5A7N A;  2ZPX A;  1QJF A;  1BCX A;  3Q9O A;  1JOJ A;  2P3Y A;  3DGT A;  3V0B A;  2O1Q A;  4JGY C;  2V4V A;  4A41 A;  1UQX A;  2LAL A;  3MBW A;  2R06 2;  1JOD A;  1XBF A;  1OPO A;  4GB3 3;  3I2O A;  1AF9 A;  5APA A;  4KGG A;  3LEG A;  2V5Y A;  3CL1 A;  4MXV A;  1AL0 G;  1HRI 3;  3VZL A;  3MUZ 1;  2WT1 A;  2QQI A;  5JXI A;  1FPN 1;  1OLM A;  1Q8V A;  4RD7 A;  1MS1 A;  5F3C A;  2YMZ A;  4XBQ A;  2RV9 A;  4YWA A;  4AHY A;  3NJX A;  2JXA A;  1FNZ A;  4IGQ A;  4FAG A;  1R08 2;  5ANQ A;  1RMU 3;  3KF3 A;  4RQP C;  1UYY A;  4BQ4 A;  2E33 A;  2WZR 2;  4OUS A;  2OUH A;  4S2D A;  5FZ8 A;  4AF9 A;  3KV4 A;  1K45 A;  4DIN B;  1W8T A;  3CLP A;  3OGG A;  4YNI A;  3FE5 A;  3E5Q A;  5EJZ B;  4Q26 A;  3WF0 A;  1W28 A;  5LAS A;  2D6O X;  1ENR A;  1QJX 1;  5FLI A;  3MF9 A;  1PGW 2;  3N9P A;  2X05 A;  3WW1 A;  1ZRI A;  2XJQ A;  1O3T A;  2QQU A;  3WDT A;  4CCJ A;  2QE3 A;  5IYY A;  5BNO C;  4XAB A;  3K4Z A;  4LUK A;  1GIC A;  4HKO A;  1J58 A;  1NCR B;  4X6Q B;  1CPM A;  4C90 A;  4LA3 A;  4DXZ A;  2ORX A;  1PK6 C;  5JR7 B;  1HIX A;  4QQO A;  1H8T B;  1DGW X;  2VL4 A;  4LNV A;  5JXG A;  3VUO A;  1VE0 A;  4KMQ A;  2WNV C;  3H8U A;  1IS3 A;  2WAB A;  1FV3 A;  3J7M A;  1GQP A;  2MEV 2;  5L9B A;  4GH4 A;  4Z92 B;  1R1A 3;  2A6Z A;  1BBT 3;  2OXB A;  4PBP A;  3WW4 A;  1PZ9 A;  1SPP A;  3EQE A;  4IW3 A;  2RJL A;  4FFH A;  4IDZ A;  2RMU 2;  5IK8 A;  1UMI A;  4GB3 1;  1AJK A;  1PO1 2;  1TEI A;  4NIH A;  4IV3 B;  4BXS V;  4QX0 A;  1HRI 1;  3EBR A;  5EHD A;  3GCW A;  2FHR A;  5FXW A;  5CNA A;  4R52 A;  1AXY A;  2VZP A;  3NRU A;  4XAC A;  1KD7 A;  4HMZ A;  2GH8 A;  4ERO A;  4AEJ A;  4HZF A;  4CCN A;  3U4X A;  2GND A;  3ZXG A;  3RMY A;  1EUT A;  3D4K A;  4MUV A;  4QKB A;  2QNK A;  4CEW B;  3MFA A;  4M01 A;  2RDR A;  2HBU A;  1RMU 1;  3IDE A;  1V00 A;  2VO5 A;  3LIH A;  2VNO A;  3LPF A;  4DFS A;  1RGS A;  4QHZ A;  5DAB A;  4Q8L A;  5FZK A;  4J1W A;  1O5U A;  4XMI A;  4R9B A;  3AFG A;  3KD4 A;  2VNG A;  3APB A;  1RHI 2;  3E97 A;  3JQX A;  4MHU A;  3QH6 A;  2ZX3 A;  4JRA A;  2W92 A;  4RSU A;  2SLI A;  3SEP A;  3UET A;  1K5J A;  4Q4X 1;  2VZO A;  3AL5 A;  1NY7 2;  2BNN A;  2W52 A;  1DGR N;  3DPR C;  2XL7 A;  1MQT B;  2GU9 A;  1A6C A;  2ZGQ A;  4FPJ A;  4Y5S A;  2CWM A;  4CDU B;  3OTF A;  2P1B A;  5JVV A;  4Y20 B;  4BLJ A;  4KWK A;  4N43 A;  3FUO A;  4Y5T A;  2QQV A;  3LD8 A;  1Q8P A;  3P3P A;  5C4W A;  1HV1 A;  3W59 A;  5C33 A;  4I02 A;  4F83 A;  2UYA A;  5CIS A;  3EHK A;  4FPL A;  2ADD A;  1BMV 1;  4FOV A;  3WQ1 A;  2VQT A;  4A6S A;  3GNE A;  4Q4Y 3;  2WS9 1;  3WHT A;  1Q5O A;  1UY0 A;  1GAN A;  5CVR A;  1R1A 1;  5LRS A;  3N9Q A;  1NA1 C;  2PAE A;  4XFF A;  5FZC A;  1YQ8 A;  3ZFG C;  5IT6 A;  1L7L A;  2OPW A;  3UGH A;  1P8J A;  3ECQ A;  5G04 L;  3POS A;  3MID A;  1HV0 A;  2WC2 A;  3I3B A;  1OHF A;  3N9O A;  4E9K A;  5C3O A;  2QQK A;  1PK6 B;  2BUK A;  1OA3 A;  4WBB A;  3T2O A;  3K75 B;  1VMF A;  5CB7 A;  4NPM A;  2GC2 A;  1Y7B A;  1BEV 3;  3A4U A;  3CJX A;  4AQ6 A;  3D8C A;  5FZB A;  3M70 A;  5D8A C;  2F6B A;  3SH4 A;  5FP9 A;  4CA9 A;  3GCX A;  5F3I A;  2JD4 A;  3KF5 A;  4XTP A;  3GDB A;  1BK1 A;  1Y9Q A;  3KCX A;  4E2Q A;  5L36 A;  1JTZ X;  1JZ3 A;  1XB9 A;  3WG4 A;  3PTY A;  3IMM A;  2K0G A;  2XQX A;  4QXB A;  3TBD A;  3BIW E;  4HBN A;  1XYP A;  5FO7 B;  1QOS A;  4C1W A;  4I3G A;  3M1H A;  4XJU A;  5IVC A;  1WCK A;  3OOX A;  4IES A;  3ZYG A;  4OI4 A;  3NQH A;  5CAZ A;  1HB1 A;  4CUC A;  2WN2 A;  5T55 A;  3V56 A;  1QXP A;  2WJS A;  3M8L A;  5FY0 A;  4A45 A;  2Z4F A;  1PO2 2;  1STM A;  3DUI A;  3TNP B;  3RS6 A;  1IG0 A;  1NLQ A;  1YIP A;  1XYO A;  4NRM A;  4ET7 A;  2YDE A;  3MW3 A;  2HH9 A;  1V6K A;  3OD4 A;  1SQ4 A;  3GZU C;  1UX6 A;  2WLQ A;  1CAX A;  1VP6 A;  2VD7 A;  5CA6 A;  4B1M A;  1SHW B;  3AFK A;  3WCS A;  3BAL A;  2BOJ A;  4SLI A;  4YSF A;  3AZX A;  2HEY F;  1VBD 3;  4XJA A;  4YVS B;  2D6K A;  2WZE A;  3NV4 A;  4YW6 A;  5GZC A;  4QGM A;  3MEP A;  4UFI A;  3WZ1 A;  1L7Q A;  3BYW A;  3DPR B;  1FOD 3;  3HNB M;  4BIF A;  5CU1 A;  5LEJ A;  4LO7 A;  1BVV A;  2GNM A;  3U4S A;  2CDO A;  1H4G A;  1XNC A;  3ABZ A;  3T2T A;  1VMH A;  2G4I A;  3VKL A;  3O1P A;  4DEQ A;  5FV3 A;  1NOV A;  5M0T A;  2WWU A;  1W6O B;  2ARE A;  2J1R A;  2VMG A;  3P1I A;  2PQS A;  4PLM A;  4QB2 A;  4CCE A;  1JI6 A;  2E7A A;  2VZV A;  4AW7 A;  1BEV 1;  3CNA A;  4XOG A;  5F5C A;  2UY8 A;  2X53 S;  4BQ3 A;  1NA1 B;  5AC9 3;  4YGD A;  3JQW A;  1RUI 2;  5FCC A;  3ZFG B;  3D82 A;  3BVC A;  3CO2 A;  3THP A;  4K9S A;  4LHL A;  2WT2 A;  4O61 A;  4U36 A;  4LJH A;  4TZD A;  1LGN A;  4HVR A;  3K77 A;  4WV8 A;  3TWI A;  5A1F A;  3USU B;  3E6D A;  1O4Z A;  3A22 A;  4JTN A;  1KRI A;  5DDJ 3;  3ME2 A;  3Q8F A;  1K3I A;  4JCK A;  1AL2 2;  4K8F A;  2VMH A;  4B29 A;  2DTY A;  2HWE 2;  4S2H A;  4Y4R A;  2FDH A;  1J83 A;  4DB5 A;  5D8A B;  2BDR A;  2GN7 A;  5IFP A;  2ZZQ A;  2E53 A;  2RS1 3;  1TMF 3;  3MIE A;  1G86 A;  3AMN A;  5D1I A;  3VBF A;  1LAJ A;  1OLQ A;  3GGL A;  4QGL A;  1PM4 A;  3S30 A;  3NVC A;  3ZX7 A;  3T08 A;  3TEZ A;  1NAE A;  4ZON A;  2R1B A;  3I2F A;  4L11 A;  4LK7 A;  4FTE A;  1LUL A;  4Q0V A;  1VBD 1;  4PHZ A;  3THC A;  3N9M A;  1UWW A;  2NM1 A;  2DWR A;  1OOP C;  3TN9 2;  1FOD 1;  3AYD A;  4H55 A;  4NOT A;  3DYO A;  4Q8K A;  3TEW A;  3WDW A;  4NO4 A;  5SV5 A;  5CFC B;  4KGQ A;  4B8E A;  2GH2 A;  5IK7 A;  1RUH 2;  1S0C A;  3FLP A;  1QY4 A;  1LHO A;  1GQH A;  2EAA A;  2IC1 A;  5LBB A;  4M3C B;  3UJO A;  1X7N A;  1XNB A;  4AWD A;  2GN3 A;  5LY1 A;  3B7M A;  1UAI A;  4A3X A;  5K7P A;  3H3Z A;  2CY6 A;  5DZG A;  3SEE A;  3LEK A;  4PT6 A;  4JC1 A;  1W9Y A;  3K2O A;  1LHW A;  2A7A A;  1DFQ A;  4K7J A;  3HQU A;  1DBN A;  3WF1 A;  4Q0P A;  5I0U A;  5AC9 1;  1AR7 2;  3I2H A;  1SLT A;  4COW A;  4UFK A;  2QCS B;  2QKD A;  2ZKL A;  3ON7 A;  1A8D A;  1YFU A;  2B4K A;  2FCT A;  4XET A;  1RUF 3;  4XUO A;  4MGT A;  3HPN A;  4YGE A;  1QJE A;  1JOP A;  4NN0 A;  2CTV A;  1OLM E;  1SLB A;  3RZG A;  1CAV B;  4TLF A;  2K2S A;  5C3P A;  5I93 A;  5L9R A;  2H6C A;  1H30 A;  1S2K A;  5DDJ 1;  1CAW A;  3FL7 A;  1US3 A;  5LA9 A;  1HQW A;  4G4F A;  5F9T A;  3POF A;  4AVT A;  2Y6G A;  3PLQ A;  5K8S A;  2Z69 A;  4N7U A;  2LS6 A;  3I3Q A;  4BJ0 A;  2MNG A;  2RS1 1;  4EZH A;  2RE9 A;  1TMF 1;  2D7F A;  2ZX2 A;  1F4H A;  3KB5 A;  4R9C A;  5CG8 A;  5A7Q A;  4CDW B;  1GKB A;  4W6W A;  3CJI B;  5ERL A;  1JZ5 A;  3ZMN A;  5ANN A;  1QKQ A;  3I54 A;  4C0H A;  1RUN A;  1S2B A;  1VAM A;  1WWY A;  2YU2 A;  2OQ6 A;  5F5A A;  2BU9 A;  5E88 A;  5BXX A;  2JDU A;  3WHU A;  4C8D A;  5A33 B;  2GP3 A;  1UPS A;  2Y6J A;  2ZS6 B;  1IG3 A;  3IKW A;  5DZE A;  3I2K A;  5ABJ C;  2JD9 A;  2R1D A;  4IE0 A;  1V6J A;  1RUJ 3;  5EQU A;  2PAK A;  5FZO B;  3AZW A;  4A3Z A;  5LWB A;  1ZRE A;  1UXX X;  4LBK A;  5C5U A;  4CDQ A;  2VNV A;  1UU5 A;  5FYY A;  4DXR A;  2CV6 A;  4QHB A;  1LOC A;  2AR6 A;  5IWF A;  1WCD J;  2ES3 A;  3BTA A;  4FP2 A;  4E4Z A;  4QMA A;  2DFB A;  3VHN A;  4E27 A;  3NJY A;  4AED C;  3WG1 A;  4ISR A;  1TQ5 A;  3OYW A;  1M4W A;  1OOP B;  1OQD A;  2R04 2;  2WNU B;  3NAP A;  2QUO A;  1ZRR A;  4XAE A;  5FY5 A;  2JDH A;  1RUF 1;  5GLV A;  3ATG A;  3EO6 A;  1DQ2 A;  3ASI A;  2IXI A;  4MOA A;  1FX5 A;  1WD3 A;  3AYC A;  3AZV A;  1MS0 A;  5FQ0 B;  2XJR A;  2XKP A;  1OFN A;  3P3N A;  4D6S A;  2J7M A;  3O14 A;  5H9Q A;  1IQD C;  1GU3 A;  3OGV A;  3WNM A;  2FBE A;  3PVB B;  3WT3 A;  4YVW A;  5FY8 A;  5IVJ A;  4XVH A;  4W50 A;  3N9L A;  2JG9 A;  1D2S A;  1QU0 A;  1UNB A;  3VBH A;  3O1O A;  3AXD A;  3OCP A;  4LLF A;  3B3Q E;  1B09 A;  1D2Q A;  4HVO A;  3SIT A;  1LOG A;  2J1U A;  1HRV 2;  4Q0Q A;  2TEP A;  1WUV A;  4ORF A;  1CD3 G;  1IGO A;  1FAY A;  1RJ8 A;  2OPK A;  3UGG A;  4A42 A;  3NO8 A;  4P9L A;  3NW4 A;  3IPV A;  2VZR A;  5C3Q A;  2ZML A;  3T3Y A;  3ILN A;  3ZFE A;  2XOM A;  1IHM A;  2DDU A;  2R07 2;  1JYN A;  1AJO A;  2A71 A;  4IEU A;  1F2N A;  5J37 A;  3VD5 A;  2HWD 1;  3FHQ A;  1NCQ C;  2LM3 A;  3O7O A;  1RUJ 1;  4HKL A;  2NZ9 A;  1O4T A;  3GBW A;  5CKM A;  1OUS A;  4GJZ A;  1N1T A;  2XLG A;  3SCG A;  4CP2 A;  2VVE A;  5C8C A;  5JAX A;  3AP5 A;  1E5R A;  1JU4 A;  4QB1 A;  2XJV A;  2VZU A;  1CAU B;  1UZW A;  5HCA A;  1WLD A;  2WAO A;  2R0F A;  3NJV A;  1GWL A;  2DUP A;  4XDO A;  4LOS A;  4DS0 A;  1W2U A;  3WNX A;  1ASJ 2;  4QKF A;  4RGG A;  4WM8 C;  3I3E A;  3WNK A;  3EYP A;  4XPV A;  1GNY A;  3POI A;  4HLT A;  4XIK A;  2ZGL A;  4O9G A;  1MPX A;  5FUN A;  1UL9 A;  2JDA A;  3BU7 A;  2E63 A;  5C3S A;  1VJ2 A;  1WW7 A;  2XH6 A;  2FDK A;  4R9D A;  1V6L A;  1RUG 3;  3LSD A;  1EV1 2;  3OD0 A;  3OGR A;  2EXJ A;  4ZS2 A;  4JX0 A;  5HV4 A;  3LEM A;  2WA3 A;  3B5L B;  3M3Q A;  1WGP A;  2R0H A;  3ZN6 B;  4LUM A;  4DO0 A;  5CFD B;  4XF9 A;  2B46 X;  5KHG A;  2XQR A;  4C91 A;  1S4C A;  4URA A;  4RR3 B;  4H2A A;  5JI9 A;  3IIA A;  4CDX C;  2W1Q A;  1AR6 3;  4XJ9 A;  3LFI A;  1WMD A;  4EV0 A;  4QPI C;  4BQ1 A;  3OG2 A;  1VR3 A;  1HXS 2;  2EIG A;  2PLV 3;  3WW3 A;  1VBA 1;  2WFF 2;  4AZZ A;  4CEY C;  1IS4 A;  2XJP A;  2AZ5 A;  3OBZ A;  4D8M A;  2B8M A;  3HR9 A;  1C8M 3;  1GWM A;  1ZBE 2;  3AP9 A;  4JZR A;  3WQB A;  4DZG A;  5DMY A;  1LOE A;  4IET A;  2PHT A;  3HBK A;  3H8R A;  3I59 A;  2XHN A;  1UZ0 A;  2D6M A;  1F9K A;  2W1W A;  1QNW A;  2IXJ A;  4YM2 A;  4CU6 A;  3A7Q A;  1UIK A;  4L97 A;  3RVH A;  3WG2 A;  1D0G A;  3D3A A;  4DRV A;  1UIJ A;  2HWB 2;  3HQX A;  3MLL A;  2JB4 A;  4IEZ A;  3VDD A;  5K0U A;  3WP4 A;  1PVC 3;  1DGR A;  2CYF A;  3IT8 A;  2OT7 A;  4MV2 A;  1ZBA 3;  4AAP A;  4NE9 A;  5HV0 A;  3RZL A;  1V9U 3;  5JIA A;  1KIT A;  3LGR A;  3ETP A;  4R4Z A;  4NAO A;  1RC6 A;  4LA2 A;  4QQH A;  4XHX A;  2W46 A;  2W68 A;  2Y0O A;  5FUP A;  3U75 A;  4COV A;  4CXY A;  5T5P A;  3WVJ A;  5IW0 A;  4RS5 B;  4A6O A;  4AI8 A;  3TOJ A;  1HB3 A;  3FMG A;  5FYH A;  4MXW B;  1ULG A;  1POQ A;  2KA3 A;  4WM7 C;  3H8X A;  1E57 A;  5L7O A;  3ORJ A;  2WFP A;  2BER A;  4MGQ A;  4I30 A;  4DQA A;  3VKN A;  2XR4 A;  1RUD 3;  2XBO 1;  2GNB A;  3OEA A;  2PHU A;  1UKG A;  1QDC A;  2BVB A;  4UFJ A;  1VRH 3;  2IUW A;  3S5Q A;  4BWO A;  3RZK A;  1C4R A;  1LOA A;  1Z7S 3;  2O14 A;  3I8T A;  2OUJ A;  1AR6 1;  5FMO L;  2QFE A;  3DYM A;  1RUO A;  2A70 A;  1WBL A;  3VBS B;  4SBV A;  2PLV 1;  2ZEW A;  4UI9 L;  2IVJ A;  1YNA A;  1AX0 A;  4EYU A;  1QWR A;  5GZD A;  3SNM A;  3ZN4 A;  2X5I A;  4QX1 A;  1C8M 1;  1VAK A;  4FBF A;  2GMP A;  2VG9 A;  3VZK A;  3WNL A;  3ZSE A;  3KVB A;  4AVA A;  3VBU A;  1FMD 3;  1N3O A;  4EN0 A;  2JDY A;  3CBN A;  4BHP A;  4FI9 A;  4QPG A;  3T1L A;  2Q4S A;  1AYM 3;  1FPN 2;  4CDX B;  4D6Q A;  1VBE 2;  2FCV A;  4QPI B;  4OVE A;  1PVC 1;  1B35 B;  5EFU A;  1W8W A;  1J1T A;  3J8F 3;  5BNP C;  1ZBA 1;  4Y24 A;  4IV1 C;  1KXG A;  1TNF A;  1V9U 1;  5J3U A;  4BXF A;  4D7Y A;  1GOH A;  3WUD A;  1AUY A;  2QTW B;  2VME A;  2NMN A;  4Q2F A;  1EP0 A;  4KQ7 A;  2W5F A;  3ES1 A;  1U5X A;  1JH5 A;  1G7Y A;  3I49 A;  1IPK A;  5C5T A;  5FKB A;  4COZ A;  4MGI E;  5J36 A;  4Q4W 2;  1QJX 2;  1MZF A;  1OUR A;  1MS5 A;  1O3Q A;  3UKT A;  4XDP A;  2W2I A;  3O5S A;  4K6B A;  4GMP 1;  2DYC A;  5B2G B;  4P5H A;  3GHM A;  5F8P A;  1K12 A;  4BOW A;  1WMX A;  4WVV A;  4CYD A;  1CZT A;  3RGB A;  5I0S A;  2E51 A;  1RUD 1;  3ZSM A;  5EYX A;  2BFU S;  4XW3 A;  3LA3 A;  2ZGT A;  3UT0 A;  1VRH 1;  3EXU A;  3RZH A;  2VMC A;  4EN9 B;  2R32 A;  1V6I A;  1Z7S 1;  2E32 A;  3MLK A;  3GF6 A;  3VBO C;  3POJ A;  4LK6 A;  3OBT A;  3WXP A;  2VCA A;  3I7D A;  1SZB A;  2XG3 A;  2J1V A;  1S2E A;  1IS6 A;  5JMO A;  3LKJ A;  3IAQ A;  1JW6 A;  4WM7 B;  4BQX A;  4AFM A;  4FFI A;  1JUI A;  1UF2 C;  1ZNP A;  1NCR C;  4AVV A;  2CGO A;  2Q0A A;  4GB3 2;  5FOJ B;  5DZF A;  1JBC A;  1WCQ A;  2ZZJ A;  4FFG A;  3WIN E;  1FMD 1;  1H8T C;  3HT2 A;  3ZKU A;  1HRI 2;  1AX2 A;  2TNF A;  1EAH 2;  2W47 A;  2WUH A;  3KLS A;  4XDQ A;  2FDF A;  1J3R A;  1IQA A;  1AYM 1;  1GNH A;  1OI6 A;  3D5O A;  3MIH A;  2ZAH A;  3HD8 B;  4KL1 A;  2QBX A;  2VMF A;  2GAU A;  3KVA A;  3QH7 A;  3J8F 1;  1RMU 2;  2AEN A;  2YRO A;  5CAD A;  2ID4 A;  1C5I A;  2C0Z A;  3H0O A;  4IV3 C;  1G8W A;  3MW4 A;  2XLF A;  4V1P A;  4QU1 A;  1IPJ A;  3M4F A;  5FZ9 A;  4N7I A;  4LKE A;  4BDV B;  2OS2 A;  2D43 A;  4JDO A;  1NQD A;  4AVS A;  3NNM A;  1DHK B;  1WLT A;  3MIC A;  4N53 A;  3VGI A;  2ZMN A;  3SC7 X;  4CCO A;  1VBB 1;  3INA A;  4NRQ A;  1ST8 A;  1V6M A;  3VBR C;  3ZXE A;  4CEW C;  1S1A A;  1MZE A;  3WQ7 A;  2P6C A;  4MH0 E;  2FDG A;  5A3L A;  1F15 A;  3HAG A;  5BNP B;  3ZIW A;  5IAT A;  1UOB A;  2VZT A;  4JGY A;  2RS5 1;  1WA6 X;  4IV1 B;  3A21 A;  4QM9 A;  1VBC 3;  3LDB A;  2Q30 A;  3GBF A;  3LWC A;  4K20 A;  4MO3 M;  2WN3 A;  1GSL A;  4KI5 M;  4PIX A;  2XB6 C;  5AVP A;  4LTA A;  3SKJ E;  4C0B A;  4XF1 A;  2C24 A;  2WBK A;  4OYU A;  1H2L A;  1BMV 2;  5JR2 A;  4XF4 A;  5FZ3 A;  1DQ1 A;  2NQY A;  1MQT C;  5KHK A;  4JHT A;  1R1A 2;  1BBT 2;  1CX4 A;  4H14 A;  3ZM8 A;  1OA4 A;  4XQ4 A;  4CDU C;  4W8J A;  3AX4 A;  3RRD A;  3LF7 A;  4RHV 1;  3O1U A;  1TME 3;  1VAV A;  1PZ7 A;  1J3Q A;  2KD7 A;  3AMP A;  4CTE A;  4QB6 A;  1J1L A;  4A7Y A;  4RQP A;  5FP7 A;  3HN3 A;  2ZXQ A;  3POE A;  3I3M A;  2XON A;  5E6H A;  2WZP P;  1N1V A;  3FX3 A;  1DQ0 A;  2H6B A;  4NRO A;  1SLI A;  2VNR A;  3M3O A;  4MLO A;  4UYB A;  3PUH A;  5T50 A;  3AVR A;  4Q4X 3;  2WYF A;  2PAM A;  3FFZ A;  2QQO A;  2D5F A;  3ZMO A;  3VBO B;  4Y1U A;  4DMI A;  1W06 A;  1OQ1 A;  2YGM A;  3B69 A;  3M3C A;  4ARX A;  5JUV A;  4B4R A;  2JJ6 A;  2WNE A;  5FBZ A;  5FRE A;  2VUJ A;  3PL0 A;  1CWP A;  2VOK A;  5FOB B;  3IMN A;  2CNA A;  3MHZ A;  1FT9 A;  3PU3 A;  4CPB D;  4AGR A;  2RDN A;  4N8M A;  4CCK A;  4OHV A;  2YBP A;  2G9G A;  5BNO A;  4IQP A;  1EPW A;  3GZT B;  4D6R A;  3B01 A;  3PU8 A;  2ZKN A;  1OF4 A;  4P9J A;  3UES A;  2PN5 A;  1KDM A;  2WS9 3;  4GQ7 A;  2WR9 A;  4LR4 A;  4PQQ A;  1MVQ A;  5DG2 A;  4FCA A;  4NHY A;  5BNN B;  1VPH A;  1O3S A;  4O9E A;  2WNV A;  4UF0 A;  2VVF A;  1BJQ A;  1URX A;  4ZS3 A;  5ACA 1;  4AE2 A;  1Y4W A;  5IUQ A;  1LGC A;  2OKX A;  1OT5 A;  4XFB A;  4RGA A;  5A3U A;  3POW A;  1DDL A;  1JZ6 A;  4WVM A;  1VBC 1;  2I2S A;  1W6Q A;  3W5N A;  2XJU A;  3NNL A;  4HON A;  1GZ9 A;  4QU2 A;  3CQO A;  2EA7 A;  2VE1 A;  4XUT A;  4AAX A;  1ZZ7 A;  2TBV A;  1FAT A;  2GME A;  4OHW A;  1YQ6 A;  4CCM A;  1LR5 A;  2BTV C;  1ULC A;  3HNY M;  2IXK A;  3E5X A;  3LOI A;  1LTE A;  3T1M A;  1Z78 A;  2G19 A;  4Q4Y 2;  4NUB A;  2ZCW A;  3BTX A;  4FOQ A;  1UMH A;  4YGC A;  3VD4 A;  1MS3 A;  2VPV A;  5DN2 A;  3VBR B;  3W9A A;  1GV9 A;  4P5Y A;  5A80 A;  3WNP A;  2F17 A;  1TME 1;  2BJS A;  4W65 A;  5FK7 A;  3PDQ A;  5FP3 A;  3RQ0 A;  3B02 A;  1OA2 A;  2OX0 A;  1H2K A;  2BNM A;  4NAM A;  4PF5 A;  1T2X A;  1W6M B;  1XE0 A;  2Y26 A;  3H42 B;  4OUE A;  4YVS C;  4CPB A;  1I1E A;  2Q1M A;  1LOB A;  3AKT A;  3DF0 A;  5LBC A;  3V0B B;  2EF6 A;  1LU2 A;  1RJ7 A;  2QQL A;  4XUP A;  5EWS A;  4YZ5 A;  4XUQ A;  1BEV 2;  1NLR A;  1NYW A;  3C8X A;  5FZA A;  3FC0 A;  4FPO B;  1PNG A;  4YM1 A;  1CON A;  1PNF A;  5A32 A;  3AKP A;  3BPZ A;  5DAX A;  2HWF 3;  2IWG B;  3VD7 A;  1R64 A;  2HEW F;  3DPR A;  1NLS A;  3GZE A;  2Y33 A;  1S0D A;  5CKN A;  4GJY A;  1VB4 A;  2A6W A;  2R16 A;  2YC4 A;  3IDC B;  3N36 A;  2YC0 A;  4JQR A;  4XIO A;  5DUV A;  3SH3 A;  2GNT A;  1ZZ9 A;  2ADE A;  3M3E A;  4FFF A;  3T09 A;  1V6O A;  3W5M A;  1SDW A;  4ITC A;  4IE6 A;  3K4A A;  5EP9 A;  1BVP 1;  4NIA A;  4GKX A;  3CEW A;  3FBM A;  2QQJ A;  2VY0 A;  1RUE 2;  2AGS A;  2WAA A;  2DV9 A;  1MS9 A;  3C7O A;  2XPJ A;  2DCZ A;  2AC1 A;  1NA1 A;  2EXI A;  2VZS A;  1RVF 2;  5EXO A;  5C8W A;  5TSW A;  4W4Z A;  2D40 A;  4AHX A;  4XUR A;  1QQP 3;  3TAY A;  3WDY A;  4C1X A;  3BU0 A;  4Q1R A;  3TEX A;  2CL2 A;  4IE4 A;  4QQL A;  4QX8 A;  4CU8 A;  5DPN A;  2JG8 A;  2K9Z A;  1L3J A;  1VBD 2;  3DL3 A;  2G9F A;  3V64 A;  3WQ0 A;  2VTF A;  3VKM A;  1A34 A;  5BUV A;  1SAC A;  2C5D A;  3ETQ A;  3OY8 B;  4Q1P A;  5LRR A;  1FOD 2;  1RTV A;  4R9A A;  1G9A A;  1HLC A;  2ZGU A;  2WZR 1;  3NJZ A;  4EN7 B;  4CCD A;  5JXH A;  4LIV A;  4NMI A;  5L73 A;  1YQ2 A;  3ZYP A;  5A3N A;  1W8H A;  4XFH A;  1H1M A;  1GLH A;  3VB9 A;  1OKQ A;  2RDS A;  2WYS A;  1Q43 A;  5EJ1 B;  5LK7 B;  2VC9 A;  2EIE A;  2KR2 A;  5JDB A;  1H2M A;  2A73 B;  2H0B A;  3AYA A;  4MG2 A;  1BHG A;  3L2H A;  3O1R A;  2P17 A;  1SPP B;  5A70 A;  5C9A C;  4EQV A;  3AMM A;  4NIG A;  1CJD A;  1R09 3;  5AC9 2;  2HWF 1;  5FZE A;  5CFC C;  3ZDS A;  1SLL A;  1LKN A;  5BY5 A;  4D69 A;  3IN9 A;  1SCR A;  1AR8 3;  2GSY A;  3CZU A;  5IJR A;  4DIQ A;  1XND A;  1UYX A;  4AI1 A;  1WD4 A;  1W9W A;  5CG9 A;  4XCA A;  2DVG A;  3GXU A;  3HOB A;  5CEH A;  3A0N A;  4E8D A;  4A44 A;  4XAA A;  4YLZ A;  3ACL A;  5DDJ 2;  1E5S A;  1YIF A;  5IVE A;  3III A;  4LBQ B;  1XYN A;  2P2K A;  2VUD A;  4A7K A;  4X6R B;  3ZXF A;  1C5H A;  4P9X A;  2RMU 1;  2RS1 2;  1TMF 2;  1WCU A;  4CU7 A;  3ZOI A;  4LEJ A;  3OBA A;  4YGB A;  1QQP 1;  3T30 A;  3MPP G;  1ULP A;  5LBF A;  4K3U A;  4AXO A;  4P14 A;  3WW2 A;  1J3P A;  1H8V A;  5DAP A;  4GWJ A;  1LB2 A;  2PHX A;  4OQ8 A;  1CAV A;  3M2M A;  3BI3 A;  2Z5W A;  1LOF C;  2ZMK A;  3FUQ A;  4LOT A;  4WZF A;  1BXH A;  1W8O A;  1ZZ6 A;  3NV3 A;  2A75 A;  4BK5 A;  5BYN A;  4FXG B;  3SXW A;  1TE1 B;  2Y60 A;  2A3X A;  4CDW C;  1JYX A;  5C4W B;  3MPB A;  3VHP A;  3CJI C;  4GA9 A;  4G9S B;  2DU1 A;  2Y64 A;  3MFC A;  1K5M C;  5FPL A;  4CSW A;  4DUV A;  4JDN A;  2CDP A;  1XNT A;  5A3W A;  2JE9 A;  1W8N A;  1JZ7 A;  1JXN A;  4AI0 A;  4ASL A;  4N9I A;  2B39 A;  2R49 A;  3USS A;  3VHR A;  3H1Y A;  3OUI A;  4IEP A;  5C71 A;  2WL1 A;  1H6X A;  1Q56 A;  4BZ4 A;  3X29 B;  3FZ3 A;  2YGL A;  3OPT A;  3ZFF C;  1CIY A;  3CKH A;  4NPR A;  1R09 1;  5A33 A;  5F7U A;  1APN A;  5JPM B;  4CCL A;  1HB2 A;  1VIW B;  3R4D B;  1AR8 1;  3FLR A;  2FZ1 A;  1W6P B;  3WR0 A;  3DXU A;  4HXC A;  5A6X A;  5IFT A;  1RUF 2;  4HL0 A;  5LB6 A;  2VUC A;  1MR5 A;  1VMJ A;  2O8O A;  4QQ2 A;  3WX5 A;  4BK4 A;  3K4D A;  4Y22 A;  4DXS A;  3POY A;  1ND2 A;  2DVA A;  3FBY A;  4Y1X A;  3WLU A;  4N9H A;  5C9A B;  4BIS A;  3AMH A;  2W95 A;  2WNU C;  4Q4V 3;  4PDW C;  2E31 A;  3JU9 A;  1QMJ A;  2OZJ A;  4FQ4 A;  4COY A;  2QDR A;  2X29 A;  2Y6K A;  1JYT A;  2DBN A;  1GUI A;  4V2V A;  1UZZ A;  1XNK A;  2QZ3 A;  3AVS A;  5HCF A;  1H9P A;  2Z42 A;  4MGS A;  4FAH A;  5J7M A;  1COV 3;  1O91 A;  4PJY A;  2JWP A;  4FPG A;  3KV5 A;  4BA6 A;  4E4S A;  2RM2 3;  1REF A;  3SKV A;  4AEM A;  1BKZ A;  3MV1 1;  1YFX A;  2VU9 A;  1F4A A;  3J26 N;  2QJV A;  3KCC A;  4Z2W A;  3HNM A;  1I9R A;  1Y9M A;  3IAP A;  4QPY A;  4OUM A;  1RUJ 2;  4ZU7 A;  3RNS A;  2E26 A;  2VAU A;  3FHI B;  3UGF A;  4OHY A;  1VLN A;  1YFY A;  4FPY A;  1NUK A;  5A7P A;  3GM8 A;  1ALY A;  1SFY A;  2VMI A;  2W87 A;  3T2P A;  5E1R A;  1GOG A;  5KXE A;  2VUL A;  2DCT A;  4QKN A;  5GAL A;  2XWJ B;  3AP7 A;  2E7Q A;  3IWZ A;  4ES9 A;  3V0A A;  3B93 A;  4I01 A;  4HET A;  3UL2 A;  1LGB A;  5F3G A;  4OHX A;  1H1A A;  4NWV A;  1JN2 P;  3I97 A;  1OUX A;  1K5M B;  4I2O A;  5LBE A;  1W3V A;  5L9V A;  1JZ4 A;  2CWS A;  1CPN A;  2ZEX A;  3B9C A;  1HQN A;  1CAU A;  4QXC A;  3A0K A;  1GZC A;  1OVP A;  4UBH A;  2WWS A;  1GR3 A;  2Q8E A;  1JYC A;  2HWD 3;  1N1Y A;  3ZFF B;  3ZXA C;  4Q4V 1;  5T5O A;  2XXZ A;  1YCI A;  4LKD A;  1LEC A;  5FZI A;  4Q0U A;  3U10 A;  5F6K A;  1BQP A;  4RFR B;  4A2U A;  1GWK A;  2PHR A;  5H9S A;  5ABJ A;  2VEC A;  4YRD A;  2BPA 2;  1NE4 A;  3WP5 A;  3WF2 A;  1HDK A;  1YHF A;  4AG4 A;  2R30 A;  2JE7 A;  1COV 1;  3L9J T;  2W0X A;  2D3P A;  4GIQ A;  1SMV A;  2KM2 A;  5FYZ A;  5FXX A;  4D7T A;  3SCF A;  5CFD C;  5FR3 A;  2JDM A;  4QAW A;  1KGY A;  5FTT C;  4RR3 C;  2EAL A;  2RM2 1;  2D5H A;  3UKV A;  2ATF A;  1OXC A;  2WKK A;  2ZGR A;  3NST A;  1Y9G A;  2NP0 A;  1WLC A;  1H6Y A;  3VBF B;  4AED A;  2QVS B;  1RIR A;  1W0O A;  1Z0H A;  1IZ3 A;  1W8U A;  3PUA A;  4PDW B;  2OII A;  4MX3 A;  1UZY A;  2VMD A;  1NE6 A;  3IM0 A;  5FZF A;  2OVU A;  2HBT A;  4E2S A;  1BLZ A;  2IFR A;  2XML A;  3BKZ A;  1KS5 A;  2WO3 A;  4IND A;  3DXT A;  3JBG 3;  1C57 A;  3ITQ A;  4CP0 A;  1DZT A;  2D6L X;  3MO4 A;  4EJR A;  2J1S A;  3FLT A;  4BQ5 A;  1XXN A;  3UKN A;  5F5I A;  2GDF A;  5KC6 A;  5LK5 A;  3ZPY A;  1ZA4 A;  1AX1 A;  1N3P A;  1KFX L;  4JV4 A;  3PTR B;  3TRS B;  1XJA A;  1NQJ A;  5FYI A;  5C70 A;  1SFN A;  3VKF C;  5I0D A;  4K1Y A;  1QJU 3;  1VBA 3;  3ILF A;  3MIB A;  4QDQ A;  1QH7 A;  1ODM A;  1W9T A;  5CKQ A;  2PEL A;  1RUG 2;  2Q5T A;  5FLH A;  3RSJ A;  5KWR A;  4ARY A;  4YVW C;  3IB3 A;  3T4H B;  2Q1Z B;  2GZW A;  4I0W B;  2PTM A;  1SEF A;  1GFF 2;  3MIG A;  1O8S A;  3QLQ A;  1T6B X;  5CYY A;  1PX3 A;  4NJ4 A;  3VBH C;  5HI0 A;  5I91 A;  3LE0 A;  4MET A;  5J96 B;  2G1M A;  4RS5 C;  3N9N A;  2DFC A;  1SLC A;  2BV4 A;  3LSE A;  3VL8 A;  1UOG A;  3C2U A;  3AJZ A;  3ZLI A;  1AR6 2;  1MS4 A;  4FPC A;  4UW3 A;  1ULF A;  5EPA A; 
#chains in the Genus database with same CATH homology
 4DO0 A;  5FXZ A;  3PU3 A;  5FYV A;  2PXJ A;  4CCK A;  5FY1 A;  4URA A;  3U4S A;  4CCN A;  4XDP A;  5F3E A;  2W2I A;  3K3O A;  2YU1 A;  4Y3O A;  2YBP A;  2YU2 A;  5F5A A;  2OQ6 A;  5FY7 A;  2WWJ A;  4C8D A;  3U78 A;  5FV3 A;  3PU8 A;  3K3N A;  4D6R A;  2GP3 A;  2WWU A;  5F2S A;  5FY4 A;  4LIT A;  3PUQ A;  5A7P A;  5FZE A;  5LW9 A;  4E4H A;  5K4L A;  4BU2 A;  4Y33 A;  4QX7 A;  4IGO A;  5FP4 A;  5FZK A;  5FZH A;  4AI9 A;  5IVV A;  3AL6 A;  4UF0 A;  4DIQ A;  5A3T A;  5FZG A;  5FZO B;  5FWJ A;  2YBS A;  5LWB A;  5F5C A;  5FBJ A;  5F39 A;  5FZ4 A;  5CEH A;  5IVF A;  5FYM A;  5FYY A;  3KV6 A;  5FPA A;  3AL5 A;  4HON A;  5FXV A;  5IWF A;  3ZPO A;  5IVE A;  5F3G A;  5A1L A;  3RVH A;  3NJY A;  5A7N A;  4CCM A;  5FJH A;  5A7O A;  5A1F A;  5FZ1 A;  2OT7 A;  5F37 A;  5A3P A;  4AAP A;  4IGP A;  4NUB A;  4UF0 B;  5A7S A;  3LD8 A;  5A80 A;  4QXC A;  4Y4R A;  4CUG A;  5FYT A;  5FY5 A;  3PUR A;  5FYC A;  5F2W A;  5ISL A;  2Q8E A;  5FPV A;  5FUP A;  5FZD A;  3KVA A;  3PDQ A;  5F32 A;  5FP3 A;  5FZ6 A;  5IW0 A;  2OX0 A;  2XXZ A;  4GD4 A;  5FZ0 A;  5FZI A;  3N9Q A;  4D6S A;  5FYH A;  1VRB A;  5FZC A;  5F3C A;  5FY8 A;  5IVJ A;  4QU1 A;  3N9L A;  5FZ9 A;  5FYZ A;  5FXX A;  4IGQ A;  5FZA A;  2OS2 A;  3N9O A;  3N9M A;  5FY9 A;  4V2W A;  5ANQ A;  5FPL A;  4CSW A;  4CCO A;  2OQ7 A;  5FZ8 A;  3KV4 A;  5A3W A;  3PUS A;  4GJY A;  5FZB A;  2YPD A;  3PUA A;  5FP9 A;  5IVB A;  5FZO A;  2XDV A;  5FZF A;  5F3I A;  3OPT A;  4ASK A;  3LDB A;  2XML A;  2P5B A;  2Q8D A;  5FZM A;  5A7W A;  4CCL A;  3DXT A;  5LY1 A;  4EYU A;  5FZL A;  4QXB A;  3N9P A;  3DXU A;  5F5I A;  4CCJ A;  3K2O A;  4QWN A;  5FP8 A;  3KVB A;  5FZ3 A;  4GJZ A;  3OPW A;  5IVC A;  3KV9 A;  3PTR B;  4LXL A;  4EZ4 A;  2GP5 A;  4TN7 A;  5FYI A;  5FJK A;  4HOO A;  5FY0 A;  4D6Q A;  4QX8 A;  4XDO A;  4BIS A;  3UYJ A;  4GAZ A;  5A7W B;  5FP7 A;  5LY2 A;  2YBK A;  5E6H A;  4BXF A;  5FZ7 A;  5FYS A;  2VD7 A;  4V2V A;  5FUN A;  3AVS A;  2XUE A;  3AVR A;  5IVY A;  5FYB A;  3N9N A;  2Q8C A;  5KR7 A;  5FPB A;  4LIV A;  3KV5 A;  5FWE A;  3ZLI A;  5A3N A;  4LIU A;  5FYU A;  4EZH A;  5FPU A;  5FXW A;  5A7Q A;  4QXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...