2OQ6A

Crystal structure of jmjd2a complexed with histone h3 peptide trimethylated at lys9
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
348
structure length
348
Chain Sequence
b'LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 112
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2oq6A01
5FP8A 3N9PA 4QWNA 2XDVA 5FXWA 4DO0A 5FZ3A 5A7QA 3RVHA 3OPTA 5A7WB 4CCNA 3N9OA 1VRBA 5FYTA 3K3NA 5FXZA 4AI9A 3PUQA 5E6HA 5IVCA 5A7PA 5FYBA 5A3WA 4EZ4A 5A3TA 2Q8CA 5LW9A 5FZ6A 5F3EA 3KVAA 5FPLA 5IVVA 2OS2A 3N9MA 3PUSA 4HOOA 5FWEA 2YBSA 4QXCA 5FXXA 3ZLIA 4CCMA 5FZFA 2XUEA 5F5AA 5FUNA 2Q8EA 4IGPA 4V2VA 4QXHA 4UF0A 5A1LA 4BU2A 5FPAA 5FZHA 4CCKA 5A3PA 3N9NA 3KV9A 3PURA 5FYIA 4LIVA 4BXFA 4D6SA 5FZGA 5FYHA 4GJZA 4D6QA 2XXZA 4Y3OA 2W2IA 3PTRB 3K2OA 5A7SA 5FYYA 2YU1A 5IVYA 4E4HA 5F3CA 4LITA 4QXBA 5F2SA 4AAPA 4EZHA 4HONA 5KR7A 5A7NA 2P5BA 3PU3A 3KVBA 5FPVA 5FV3A 5FZ1A 4D6RA 4UF0B 3N9QA 5FPUA 4QX8A 5LY1A 2GP3A 5FZLA 5FZOB 3AL5A 5FZMA 5FPBA 5IWFA 5LY2A 4CCOA 5FYMA 5FY8A 5FYZA 3UYJA 2OT7A 5FP9A 4C8DA 5FY5A 2PXJA 5FUPA 5LWBA 5FYVA 4CUGA 3KV5A 5F5CA 5IW0A 2YPDA 5FZ8A 3N9LA 5FZAA 5A7OA 3ZPOA 3NJYA 3AVRA 5FZCA 4CCLA 5CEHA 4CCJA 5FYUA 5FZIA 4TN7A 3DXUA 5FP3A 5IVFA 2OQ6A 4XDPA 5F39A 5A3NA 5FXVA 5F37A 4NUBA 5A7WA 5FYSA 5FP4A 5FY4A 3LD8A 3LDBA 5A1FA 4QX7A 3K3OA 5FYCA 5K4LA 4EYUA 2Q8DA 3DXTA 5F2WA 5FZ9A 4URAA 3KV6A 3AL6A 4ASKA 3OPWA 5FY1A 5F32A 4GAZA 3PUAA 4Y4RA 5F3IA 4BISA 5IVBA 4LIUA 4GJYA 2XMLA 5FP7A 5A80A 2WWJA 5ISLA 5F5IA 4V2WA 4CSWA 2YU2A 4LXLA 2YBPA 5IVEA 5FWJA 5FJKA 5FZBA 5FZKA 5FZEA 5FZ0A 3KV4A 4Y33A 5FY0A 3U78A 2YBKA 5F3GA 5IVJA 5FZ7A 2OQ7A 4QU1A 5FZ4A 3U4SA 2GP5A 5FJHA 5FY7A 5FBJA 4GD4A 3AVSA 4DIQA 5FZOA 2WWUA 2VD7A 3PDQA 5FZDA 4XDOA 4IGOA 4IGQA 5FY9A 2OX0A 3PU8A 5ANQA
chains in the Genus database with same CATH superfamily
3DKQA 5FP8A 1J3PA 2YC4A 2PAKA 3U10A 4QHZA 4NOTA 5T5LA 5A7QA 1DYOA 3DPRB 3ZXDA 2KA3A 3AC0A 5HCFA 4AQ6A 5JI9A 2VULA 1CN1A 3IBMA 5EWSA 2RS12 4CCDA 5E6HA 1YXWA 2OZ6A 1HQNA 1BKZA 4UFLA 4ASLA 4P14A 4E8CA 2GN3A 1F35A 3OEBA 4QHBA 5F5AA 2WZEA 1AYN1 1LCLA 4L11A 3V56A 4UF0A 3UETA 3RI9A 5A1LA 2XJUA 3BI3A 3I2IA 4S2DA 3VZJA 3N9NA 1W2AX 2X5IA 1W2NA 3WF1A 4KGGA 4Q0QA 5FQ0A 1XU1A 2WZPP 3N7JA 5LA9A 3PTRB 1C28A 1V9U1 1E5RA 2HWC3 4EN9B 1G9AA 1HRI2 4BQYA 1FAYA 2JE9A 2P6CA 2OYZA 3E97A 3W20A 1D0HA 4FFFA 1RUE2 2DVDA 2IZWA 3PVOA 4ONUA 3FWEA 4UXAA 4XIOA 4IE4A 1RTVA 1WW5A 1JZ4A 2ARCA 3CU7A 3CJIB 3H42B 4CU8A 1LKNA 1YJLA 4LKEA 3SEEA 1VRH3 3AL5A 3RZHA 4QGNA 3AK0A 2RS32 2WYFA 2XLGA 3D0JA 4K8FA 4QB6A 5FYZA 2Y6LA 3UKNA 4OMDA 1MS9A 1PO13 3OBZA 4Q26A 5FP9A 2VO5A 2KD7A 3U11A 2PXJA 2VZVA 2W9XA 3D8CA 4QGLA 3ACGA 3QH6A 2VGDA 5IW0A 2YPDA 1JZ7A 4FT8A 1X9PA 4B7KA 3BOWA 2RR13 1SHWB 2G4IA 2BVVA 1QJY2 5A7WA 4CEWB 1DCSA 1K5MA 4GH4B 2JX9A 2XWBB 5IAXA 3T4VA 3AFGA 4BDVB 3GYDA 1X50A 1N3OA 4C90A 1C1LA 1CR7A 2HJIA 3KSCA 4M3CE 4QKBA 4YFWA 5F32A 4L92A 4GAZA 4UOJA 4N43B 2GH8A 2R7EB 1PK6A 2WJSA 5KHGA 4P00B 1CAXA 5FP7A 4HXCA 1RUJ1 4HN1A 4CDWB 2WS91 2HWD2 3LWCA 4PF5A 1VAKA 3WV6A 2CWMA 4PT6A 3POFA 4OCTA 4Y1VA 5IT6A 1UMZA 1QWRA 5L73A 3ZN6B 1GFF2 2WA3A 4RGAA 2D7FA 3TWIA 1JI6A 4JV4A 3TEYA 2XJSA 4MGTA 1TME3 3I2KA 4DY3A 1FPN3 2R49A 1COV3 1WMEA 2FDJA 3GALA 2R061 4L8QA 3U4XA 1QF3A 4LO4B 3WINE 3WF2A 5IK5A 3ZDVA 1WCUA 5GZFA 4OHVA 3GGLA 5DG1A 1GP6A 3KT1A 3ST7A 4GD4A 1RL3A 3OD0A 4XURA 3WNXA 2Y60A 1WZXA 2PHXA 3KGZA 4D7TA 1PZ7A 4XJ8A 1GICA 1C5IA 3OGVA 4LHKA 3LE0A 4GB32 4FP2A 2UY8A 2ZS6B 3AZXA 5G05L 2ZACA 1KQRA 3RVHA 4A6OA 4BMBA 2WT0A 3DPRC 3W58A 1PNGA 4LUKA 2H6CA 4AI9A 4YM1A 3VBHB 5JSOA 2AENA 3WNOA 1FXZA 5FZ6A 3SHRA 1YFYA 1F5FA 5T54A 4ISRA 2NYYA 1BK1A 3NNGA 2Q4SA 3H8XA 2VCAA 5F6LB 1UIKA 1ULEA 4JGZB 4Q0UA 4V2VA 4YNIA 4FAHA 1RITA 4CCKA 4IUGA 5CADA 3F2ZA 3T30A 3MIFA 3I2FA 1DHKB 3N7KA 4LIVA 4BQXA 3NWKA 1F4HA 3I49A 2W91A 3O14A 5IATA 2HWB2 2RJKA 4GIQA 1WUVA 5A70A 3K2OA 4BH9A 4YW5A 5FYYA 3FL7A 1IG3A 2YU1A 4AVCA 2E9QA 4NE9A 1VBA3 1XE7A 4HL0A 2ERFA 3JZVA 2VZUA 5JXGA 2W3JA 5IHRA 4UW3A 2W5FA 2ZXQA 4LKDA 4AHWA 1JYCA 4CVUA 3LEIA 1I9RA 1QU0A 2CDOA 3CJIC 3MV01 5FZ1A 1MS1A 1W6MA 4JX0A 5I8YA 4B1LA 2XBO2 5KXCA 1DQ6A 2AC1A 5IVBA 3R0RA 1S0IA 2YY1A 4P9LA 3WW2A 3POSA 3VUOA 2XHNA 4W6XA 1WW4A 2WNVB 3CIHA 3BGAA 1QJFA 3AKQA 1HW5A 2B9VA 4Y20B 3RMYA 3B9IA 3LIHA 4C8DA 1E5HA 1E5IA 1SLLA 2XVLA 4FPLA 5BNPB 2FD8A 3AMHA 3MIGA 5IYYA 1BVP1 4I0WB 1PGSA 4Q4W3 3VHPA 4IE5A 3QBQA 3POIA 4FPHA 2R0FA 4O61A 4ZHNA 5C4WB 3LOBA 1YWKA 2DVAA 4CDQB 4CEWC 1H6XA 1Z78A 2D6KA 2JG8A 2VMHA 2WWSA 3C7GA 2WQZC 3N7MA 2WFPA 2ZABA 2DUPA 4GH4C 4NUBA 5GJ6A 1VBD1 2IWGB 1C8M1 3MW2A 4Q4X3 3WXPA 3ZR5A 2Z5WA 3OBAA 3AFKA 3BIWE 2VW0A 1OKOA 3H7YA 5KBFA 3RRDA 3BYWA 5L7OB 2LW8A 1O4TA 1H2LA 3BN6A 3I59B 5KHJA 1OOPA 4N43C 2BWAA 1RC6A 5E8AA 4YVWB 1SFNA 1FNYA 2DCJA 4CDWC 1W9SA 2AZ5A 5HXVA 2Y6FA 1B09A 1RUD2 2R071 2ETEA 3RWKX 3VDAA 3EHKA 4QPWA 5JCTA 4IEUA 4A2UA 1GWMA 2P3YA 2DBNA 3WF4A 1ALYA 1NXMA 2OUHA 1ZZ9A 5FY0A 1R64A 2JG9A 2ZGPA 4P9GA 1RUI2 1ULFA 3L2HA 1MEC1 4CEYA 1EP0A 4Q0VA 4JAAA 1AXYA 1ULCA 3UT0A 4J1XA 2BOJA 1D4M3 1XRUA 5FY7A 2RS53 1LOAA 2DFBA 1OUSA 1N1YA 3FLTA 1UZYA 2TUNA 3EB7A 5IJRA 4AI1A 5GLZA 4IEYA 5LASA 1L7LA 5C7GA 2VCCA 4RGGA 2ZCWA 5J48A 4U36A 4W50A 1W9FA 2IUWA 2X29A 1SBDA 4OI1A 2YMZA 1IPKA 2HKXA 3CO2A 4X6QB 3BTYA 1ULOA 1IQAA 1O59A 4Q4Y3 4LUMA 3EJKA 3LPGA 4DXTA 5K8SA 2JDPA 1GOHA 3ZSLA 1LOEA 2DURA 1W99A 2VOKA 2YYOA 2ZHNA 2ZKLA 3BB6A 3MFCA 5A7PA 3VBHC 4YGDA 3BKZA 4XIKA 3KQ4B 2ENRA 4HPKB 2V4VA 4D94A 4LK6A 1DQ1A 2DBIA 2IFRA 1G9CA 2B42B 2ZX2A 1F15A 4PLOA 5FZFA 1NX9A 1CAWB 2DU0A 1ZZCA 1KRIA 3LDKA 1UMIA 3MF6A 4JGZC 4XF3A 1XC6A 1POQA 2B7YA 4COZA 5DAWA 1Q5OA 1UN1A 4PLNA 1F9KA 5JXIA 4FXGB 1IKQA 3JBG1 3ZYRA 2XXZA 4D6QA 1O3TA 4IE0A 1IOAA 1BQPA 3FFZA 4K7JA 1WCSA 4JGYB 4P9XA 3FLRA 3ZKUA 1RUF3 2VC9A 1YNAA 1ZYBA 3AM2A 1UIJA 5F2SA 5A32B 1XYOA 2JDZA 3Q9OA 3NV4A 1BEV3 1YCIA 1OVPA 3ZN4A 4XCAA 1VBE2 1H2MA 1FOD1 1Z7S1 4IV3A 3Q8BA 2DCYA 1W0OA 4CCOA 1QQP1 2E6VA 4OHXA 4OUSA 3NO8A 5FDBA 1OLRA 1N3QA 2OT7A 2WNVC 2E31A 1DQ0A 4K20A 1RIRA 4IDZA 1IPSA 1G8WA 3AXEA 5F6KA 4QKDA 5BNPC 4JC1A 1JTZX 3SH4A 4F8AA 3ACIA 4FFIA 1ASJ2 3AJZA 4TN7A 4BQ2A 1VALA 5C4WC 3AZYA 4QM8A 2QFEA 1FMD2 2VBDA 1JOBA 2VUJA 4CDQC 3AB0A 1SLBA 1SEFA 1QJZA 4OYUA 5EP9A 4YYOA 1ND2A 3CNAA 4KWLA 4BIFA 2BZDA 1W06A 2QQNA 1WWYA 1DIWA 5JDBA 3GDBA 3B9CA 1EYBA 1NLQA 2Q8DA 4V1PA 1GZWB 5FZ9A 4GWMA 3ZXJA 2EALA 1ND3B 3VLBB 1GOGA 1JH5A 3BALA 5L7OC 2E26A 1UY3A 1GZTA 1IS3A 1S4CA 3NJXA 4GJYA 5AFEA 3VD5A 2W39A 5L19A 4AWDA 3GF6A 4YVWC 2WRAA 5FMDA 4YVSB 5FMCA 1JS9A 3T1MA 3I3QA 4GZ9A 3WD5A 2WIIB 4Q29A 3NL1A 4MHRA 5FWJA 4OMCA 4BQWA 1O3SA 2RVAA 3WDWA 1UMHA 1QY4A 2R1BA 3LA7A 2G9ZA 4XC9A 5GALA 2UYBA 1SLCA 3U78A 1C1FA 3PVBB 1JYXA 3RZJA 4MO3M 1XQNA 4MGYE 5EFUA 3WP4A 3THPA 2Y64A 3APBA 4YLZA 5EYXA 1OH3A 3ITQA 1T2XA 2F4LA 2OQ7A 2RDRA 4PCRA 4QU1A 2EXIA 1LOCA 2WINB 2C1FA 3CZJA 3OEAA 5A6ZA 3LIGA 4B29A 4LOTA 4UFJA 5JMCA 2TNFA 1SCSA 3FLPA 4KU8A 2QQUA 4B4RA 3ZYFA 1J83A 2C26A 3K77A 3QOPA 4XDOA 5FZDA 3ZFEA 4MGSA 1REEA 4QKFA 4CCNA 5ANQA 1O3QA 2FDIA 2H6BA 2JICA 2AGSA 1PVC1 1V0AA 3IMNA 5C9AC 1X8EA 3WR0A 3VKOA 1UU5A 3WG1A 4B3NA 1DGRA 4XUQA 2BNOA 2RS11 1GU3A 3QD6A 3U0ZA 1C3HA 1W3XA 4XF4A 4CDUB 1W0PA 4MUVA 3JQXA 4UW4A 3W59A 4WM7A 4XJAA 4BQ4A 4MG2A 1WBFA 5A3WA 3R6SA 2Q8CA 5LB6A 1L7QA 2ZGRA 3VBFA 5IVVA 5D21A 1XNAA 4XPVA 4HK9A 3MIHA 2Y6KA 2XQRA 3ELNA 3RWNA 4P02B 1ZVFA 2ZGSA 3THDA 1FATA 1MACA 1O8PA 1O5UA 4AAXA 3GZAA 1REFA 1VRH2 4O65A 1UX6A 5JXJA 1AXZA 5DAXA 3VHNA 3I54A 1WA6X 1QGLA 1GYKA 1UKRA 1YUDA 2BW8A 2D6OX 3AYAA 1STMA 4LLFA 5GZGA 2WLPA 1HRI1 3H1WA 2R16A 2JIJA 1EAH3 3SKJE 1RUE1 4Y1UA 4JGYC 4K6BA 2FCVA 2PQQA 1QH6A 3MUZ1 4R4ZA 3I3EA 4XBLA 5GZCA 5BY5A 1YIFA 5FO8B 4EZHA 4Q5OA 4LO8A 1ZBE3 2RR12 4NWWA 2XL9A 4EV0A 4OLLA 3G7DA 2VY0A 1XNKA 4YW4A 5J7MA 1QMJA 4MH0E 4QX8A 3HR9A 2RS31 1ZZ7A 3MFAA 4UFMA 4XE9A 1O4YA 4LBQD 4XZUG 1W8WA 5EQUA 2D3SA 2VPVA 5D2AA 1S0GA 1YQ2A 1B35A 1HN1A 1WW7A 2BNMA 5I0UA 1S0JA 5JR2A 2UWCA 1X8MA 4J25A 1MQTB 1XYNA 1ZBA3 5C5TA 2FHRA 4WVWA 3ON7A 3TEWA 1N1TA 1W9TA 5JOYA 2ZX1A 4AVVA 1AR62 5A7OA 1CIWA 2Y33A 1W8NA 1NCRA 3DGTA 1QJY1 1NOVA 2D44A 1J3RA 1US2A 3H9AA 3I2GA 4GA9A 3ZN5A 5IVFA 4XZPA 4HVOA 1FI2A 5LBCA 2P2KA 1GWLA 1W05A 5F37A 2LRPA 4DINB 1LOBA 5E88A 3HD8B 5HCHA 1WBLA 4A4AA 4YM3A 3O1PA 4Z92B 4PHZA 3HNMA 3DXTA 3DKWA 4FPOB 1RHI3 1W0NA 1COV2 4PI2A 3OJBA 3ZXLA 4MGIE 2NP0A 1ND3C 2RE9A 2V72A 3M3EA 5CFCB 2WL1A 3AKTA 3RZKA 2HWD1 4FP3A 3OGJA 5HI0A 3I97A 3MLKA 4DUWA 4KBBA 4O9EA 4YVSC 1WCQA 5LBBA 1CPMA 3PL0A 1H8TA 3K48A 4BQ5A 2QDNA 5IVEA 3IDAA 1J1TA 1NCQB 5FREA 1IZ3A 1XNBA 2UU8A 2JE8A 3MHZA 4R9BA 3IPVB 4UFKA 3SQOA 3VL8A 5KXBA 3FZ3A 5F3GA 3ZPYA 2ZTNA 4NRQA 4Y24A 1CAUB 3B5LB 2WFF3 3LGRA 2EA7A 4L0PA 2XB6C 3BPSA 5JOXA 4RHV2 5FRAA 3URFA 4WVZA 4CP1A 4GB31 1VB4A 2VH9A 2FCUA 3T2PA 2XG3A 1UZZA 2NPIA 2QNKA 3K4ZA 2DCZA 3Q8AA 3T2TA 3VZNA 3WOGA 2CL2A 3WW1A 4PLMA 1SPPA 2JB4A 4KBZA 3SH5A 4C1XA 1UOFA 2P17A 2EIDA 5FUIA 2DTWA 3U14A 1DGWX 1PVXA 4CDUC 5IVCA 3WG2A 1OI6A 4R52A 4BWOA 3POJA 2Y6JA 1H8VA 2EXJA 2VUAA 1W8ZA 4C91A 4Q8KA 1YFUA 2DYCA 5FUNA 1A6CA 1QEXA 3MIDA 2VOXA 1MR5A 3K4AA 2F6BA 1JW6A 1Q56A 1OUXA 4TSVA 1W9YA 1AR73 1BJQA 5AC93 5GLWA 5L36A 1LNSA 2HWB1 4ZY9A 1I5PA 5APAA 4BIOA 1A34A 3S7EA 1SG3A 5CBLA 5F7UA 1W2UA 2VMDA 4Y1XA 4N53A 3U07A 4AVBA 1H6YA 2OIIA 5LCWL 4LBMA 1LRHA 1V70A 5BNOA 2ZGOA 4YZ2A 1UKGA 4AAPA 1CIYA 5F9TA 4I0BA 3S5AA 1LHUA 2XBO1 4LBQB 1Y7BA 5C8CB 2BGPA 2BGOA 4Y22A 4BXSV 2MEV2 1V00A 4Y26A 2C5DA 3VBOA 3PLQA 4Q4X2 1YC61 3VBSA 1XXNA 3VBUB 1D0GA 2VMFA 2WNUA 2ZX3A 3AYCA 4MV2A 4OULA 1RMU3 1AYM3 3NV1A 3UJQA 3WCSA 3ABZA 4DQAA 1MQTC 2ADEA 2DU1A 5FUPA 4XTPA 2E7TA 3ZPOA 2WC2A 3GNEA 4YWAA 4ARXA 4QQOA 3RNSA 3RFRA 5GLVA 3U75A 3IIAA 1CJDA 1Q3EA 3HVDA 1J84A 3OBTA 3MIBA 4KNCA 1SLIA 4XFBA 4QX0A 2LUWA 3B3QE 1HB4A 2XR4A 1KFUL 1CAVA 2QQJA 4QX7A 1IS6A 4LJHA 1DGRN 5I0DA 2VZ3A 2WSVA 1BYHA 1L3JA 1WKYA 2TEPA 1XPWA 2CSGA 3M3CA 4YGEA 4W65A 1LENA 4QPIA 1TEIA 2WNOA 5CFCC 4P9JA 5SV5A 1RUD1 1D4M2 2RS52 2Y6GA 5FLHA 5C3SA 3LFIA 5A3OA 4D0QA 3LCPA 2A3XA 4V2WA 3QLQA 1HRV2 1LEMA 3EMRA 1U5YA 4FFHA 4WVMB 3ZOIA 3WW4A 1W8OA 4IV1A 5FZBA 2D6LX 1NCQC 1RUI1 2VM9A 1UY4A 2HWE3 1BVVA 4Q4Y2 2VG9A 3HBKA 1DP0A 3J26N 3ALQA 1UU4A 2JEMA 3H0OA 2VVDA 2QQMA 4CP9A 2GMEA 2LM3A 4PDWA 4XXPA 5FZ7A 3S30A 4RFT0 4LMFA 2GP5A 4A45A 4DEQA 5A6XA 3ZFGB 2W1WA 3AVSA 4XQDA 4B4PA 2VD7A 3OGGA 4AW7A 2ZZQA 4FTBA 1H2NA 1LHVA 1SDWA 1VAVA 2DDUA 2K2SA 2LS6A 2VBPA 2V5DA 3JU9A 4XF0A 4WM8B 1AR83 3I3BA 2VZ1A 3NNMA 3WF0A 2XONA 1O7FA 1XSQA 5I0SA 3OYWA 1OLMA 3NNLA 2E63A 1VRBA 1I5ZA 2GC1A 3H50A 3LF7A 3MV11 1OSGA 4MGKE 3AX4A 5EJZB 3WHUA 2Z42A 1RUF2 2BUKA 4EN8B 2DCKA 1JZ3A 1AYN3 1YRZA 2BQPA 2VW1A 3B00A 3R4DB 3OY8B 4KWKA 5JUVA 3E1F1 1BCXA 1PZ8A 4LPLA 4LOSA 3ZYHA 5FYIA 1YEWA 1KDKA 2RM23 1A8MA 1XBFA 3JUUA 4HKOA 5DZGA 1V9U3 4GQ7A 4GMP1 3GJAA 3B94A 4FPCA 4AVAA 4I09A 1H1MA 2GALA 1H2KA 2CU5A 2E32A 2SLIA 2QCSB 1S2EA 4QXBA 1YYNA 4QX3A 1PVC2 1Q8VA 2H0BA 4YFZA 2JDYA 3EBRA 4EROA 1LU1A 1KFXL 5KR7A 1H30A 1VBE1 3AYDA 3KVBA 1BBT3 3BOPA 4UF0B 3ZFFB 3NJVA 5LY1A 2ZMKA 2ZPXA 2CNAA 1GMMA 5C8CC 2YROA 3FC0A 2B8MA 2IXCA 3O0XA 4W8JA 1JHNA 1PMHX 5FPBA 3K75B 2ZHKA 2P4EA 4Z82A 2FBEA 2ZHLA 5FQ0B 3VBUC 4G3YC 3SXWA 5ANNA 1CONA 3ZYGA 2HWF2 2NN8A 5CZKA 1CX4A 2RDSA 5DMYA 3ES4A 5HV4A 5BPXA 1JOJA 4CUGA 1HB3A 1ASJ1 3INAA 3KF5A 1K12A 3FJSA 1HQWA 5DAQA 4CPBA 2D40A 3E5UA 1JZ5A 1WMFA 3ZXKA 4Y1ZA 1FMD1 2YDEA 2WBKA 2OW4A 2PQSA 4LBNA 1NA1A 2ZAAA 2WZR3 1YLLA 3KF3A 4DY5A 1C5HA 2WQ8A 2PHWA 1EPWA 4LBJA 4XAAA 2V4AA 5M0TA 5FY4A 1ENSA 3E5QA 5AFBA 4LE3A 2QQWA 3K46A 3LOIA 5JIUA 4NN0A 3ASIA 3A22A 3JXSA 1N47A 2PHDA 3QH7A 4BISA 4UYBA 1LGBA 3Q8CA 2XMLA 1UOBA 3OCPA 2JB8A 3CL1A 4XAEA 1CZTA 1LJ7A 4HG6B 3V0AA 3AMNA 4YZ5A 4KG0A 2X8KA 4NRMA 3BUCA 1EY2A 5FFOC 1K45A 4Y33A 5EHDA 4DNYA 2E33A 3H3LA 2ZOEB 2D6MA 1PK6B 3ZXFA 1OHFA 1W90A 2D93A 5C33A 5AVAA 3CJIA 4AE2A 2Y0IA 1DZTA 3ZFGC 4QQLA 3TNQA 2VZRA 3T2QA 5E1RA 5HPOA 1Q8QA 3MICA 4LBKA 4ZU4A 1PX4A 4QWNA 1U5ZA 4WM8C 2OZJA 2W46A 4LHNA 4URTA 4GWIA 3FUOA 3MW4A 2YPJA 3J8F2 4XQ4A 4BK4A 2HYKA 4XILA 4OUMA 5FYBA 2B9UA 4FQ4A 2WDBA 4LE4A 1QOTA 3OUJA 4EQVA 4CEWA 3I2OA 4NIHA 2Y38A 3ZO0B 4GH4A 4N7IA 5ERLA 1SFPA 1YQ5A 3M3OA 1ZBE2 1ONAA 1US3A 4NHMA 1XU2A 1SDDB 1VRH1 5JPNB 5CU1A 4OQ9A 3JCIA 5FPZA 3CZUA 2O1QA 2GU9A 2XJVA 2CDPA 4FO9A 2ARXA 2BRTA 4FVVA 2LROA 4XTMA 1PO11 2R043 2UWBA 3KB5A 4N43A 5CNAA 3VDCA 1IKPA 5GM0A 4BB3A 4YG6A 4Y3OA 1ZA4A 1ZBA2 1DBNA 2JD4A 1Y9MA 4CDWA 5B4NA 5F1RA 5IAVA 2VZSA 4AF9A 1OT5A 4KL1A 4FPEA 4YW3A 3TN92 2RR11 1YQCA 3FX3A 1D2QA 3J7HA 4H55A 3RPQA 2X53S 3E5XA 1AXKA 4EE2A 4AVTA 1MZFA 3BIEA 1QJX3 3N9QA 3NKTA 3ZKYA 3ZFFC 4D3WA 4QX2A 4CUAA 1N1VA 1ENQA 1IS5A 4E4ZA 4EN0A 1W6NA 2BPA2 2YXSA 3N35A 2A6XA 5BNNA 3BCWA 2Q1ZB 3J7LA 5HCBA 1TNRA 5EZWA 1AR61 1RUH3 2FCTA 3POWA 4XBQA 4AQSA 3ZDSA 2EVXA 3TYJA 5LRSA 4FOVA 3C7OA 1MPXA 5F5CA 2ES3A 2G9GA 5FLIA 3WX5A 2VR4A 5CEHA 5FZIA 1UNBA 4Q0PA 4M0HA 1BXHA 3G6JB 4XJ9A 5FXVA 1C8M3 1GUIA 2VAUA 1N3PA 2IFWA 3IT8A 4K1YA 3V0BB 3ZXGA 3O1SA 5KHKA 2R30A 1GKBA 2JECA 4WZCA 1RUC2 1COV1 4I3PA 3VBHA 2XLAA 3KZ4C 4AEMA 3LEMA 1VBC3 4CP0A 3WVJA 5C70A 1AF9A 1OURA 1UYPA 4EWEA 3GJBA 4OHWA 1HN0A 5DAVA 3ZYJB 2R073 4JGZA 4N7UA 2P37A 2R32A 4XBNA 1F4AA 3WW3A 2X10A 1W8UA 5CG8A 4MX3A 1DZRA 4EJRA 3WSOA 2WT2A 2JG8B 5CFDA 1V6IA 3RS6A 1XNCA 1Q8OA 1RINA 4AK3A 1CESA 1KS5A 1X33A 5EIYB 1JOPA 5FJKA 4GXLA 2GAUA 5ACA2 4DEVA 4PBOA 1LHWA 3DV8A 3KV4A 3EXUA 4K8RB 2XH6A 4BK5A 2DF7A 4NPMA 4O7XA 3FBYA 3D0SA 1RXGA 1OOPB 1DQ2A 2UYAA 1PK6C 2GMMA 4RHV1 2GC3A 1DLCA 1JU4A 1VMFA 5D8AB 1BMV2 3PHMA 1RVF3 4NAMA 5DDJ2 3M3IA 4CXWA 3ZXEA 2BFUS 1GQGA 3ES1A 5C3QA 4JRAA 3WDUA 5E16A 1MS4A 4AG4A 3JD73 4AEDA 3D82A 1AR72 2PLV3 4Q2FA 3DYOA 2CYFA 3O0WA 4DO0A 4XHXA 3E6BA 1WMXA 3IDEA 2QUOA 2X09A 3HBZA 4TLFA 5BNPA 3GHMA 4ZKTB 4CEYB 3B93A 1D2SA 3A0KA 4RL7A 4H3WA 5F3EA 5C71A 3Q8EA 4CDQA 1ODMA 2OS2A 3N9MA 2ET1A 3ZLIA 1ZREA 1VBB3 3HQUA 2EICA 5H9PA 2HBTA 3WDXA 4HT1T 4IGPA 5ABJA 2BJSA 3KT7A 4INDA 2ORZA 4XUNA 4BU2A 1W04A 3VDDA 1ZA7A 4LHSA 5LBFA 1UCXA 5L7OA 3I59A 4I3GA 3ZIXA 4RS5B 3BU0A 3ROUA 1AYM2 2DFCA 5FMOL 3UGHA 1HIXA 1QJU3 5GLTA 2JWPA 4EWAA 2VVFA 3ZSMA 4H7MA 1NY72 2BVBA 4LITA 2G19A 2XJRA 4GMP0 5JMOA 2VU9A 2J1AA 4AR2A 1UD1A 3PJQA 2ET7A 5A7NA 1FOD3 4NIDA 2MEV1 4M0NA 1VP6A 3AP7A 4FFGA 3C2UA 4Q4X1 3GZTB 4R9AA 5DZEA 3POBA 2PTMA 2Q8OA 1O5LA 2JDHA 4L99A 4Q1RA 1IHMA 4XXAA 2N7GA 3B02A 3RYRA 5FO9B 1LGCA 4TZDA 5AVPA 1SLTA 1HDKA 3O7OA 3DUIA 4IL7A 1ZZBA 5SV8A 2HYXA 3NQHA 4QPGA 4AGRA 4LO5B 2W1SA 1CD3G 4CE8A 1F8VA 3UKVA 3M4FA 4XUTA 5CVRA 3NJYA 4CCJA 2GMPA 4BHPA 1KDMA 2K0GA 2OQ6A 5C9AA 2OPWA 4IV3B 4LBOA 1OD3A 2VUDA 4AGVA 2ID4A 4OUEA 4COWA 2D6NA 2QQOA 2WN2A 1R1A3 4L97A 1R082 2UWAA 2HWE2 3C7HA 4ATEA 4Q0SA 5K0UB 1OA2A 2ZGUA 2Q1MA 2W08A 4M3CA 3KD4A 1FX5A 3NV2A 4LNVA 4Y4RA 1D4M1 2JD9A 1HXS2 2RS51 1QHDA 3LKJA 4XJWA 1JN2P 1CQ9A 2MHFA 3N36A 5CKNA 1HQLA 1NXD1 2UY9A 2XGXA 3M7AA 2C9KA 4HZFA 1HRV1 3IB3A 4PJYA 3E6CC 2FQPA 2VQUA 1XNDA 3DYMA 1UZWA 1GANA 3MLLA 4HK8A 2JG8C 2D3PA 1JUHA 1M06G 4LK7A 1W6QB 1AR82 4Q4Y1 5GZEA 3UESA 4HKLA 2QE3A 4JGYA 2Q0AA 1UU6A 3JQWA 4EN7B 4FOQA 2Z2SB 1RUG3 1W6PB 1ENXA 3A7QA 5FBZA 1YJKA 2R1DA 1URXA 2W1UA 1OOPC 3AP5A 1SCRA 4OQ8A 4R9CA 3VBRB 3HWJA 4NROA 5D8AC 4CU6A 2D5HA 3H1MA 4FPFA 1K42A 4FPJA 2JIGA 4YG3A 1O6UA 3H7JA 4KG8A 4AEJA 4JQTA 4NPLA 1F31A 2PYTA 2RS13 5FXWA 1AR93 4N90A 1UXZA 2XVKA 4IEXA 2RM22 4FTSA 3ZSEA 5FZ3A 3S7IA 2SBAA 1W6OA 4XETA 4N9HA 1LOFC 5GZDA 5LZ6A 5C6CA 3MDPA 4CEYC 2IXKA 1Y3TA 1RUF1 4FXKB 3T2OA 1S0DA 2ZBJA 3KVAA 3O0VA 5FPLA 4HOOA 3AZWA 1H0BA 4NMIA 3OF1A 4ZONA 5F5QA 3ZFEB 1V6OA 4AHZA 1G9BA 1BBT2 4DZGA 4Z8BA 4NHYA 2WR9A 1A3KA 2J1EA 4R8HA 5FK7A 1JZ2A 3VD4A 1GZWA 1ZRRA 3OB8A 1QH7A 3IMMA 1QXPA 1ND3A 2DTYA 4BXFA 1HRI3 4GKYA 1V6KA 2K46A 5DABA 3TRSB 4RS5C 2ILMA 3UJOA 1UOGA 4TYSA 4K9SA 4YVSA 4YW1A 5F3CA 3VBFB 4CXYA 1KXGA 3MEPA 1POV1 1J59A 2JENA 1Y4WA 4HONA 2HWC2 1BK0A 2RS33 3I7DA 4UFHA 5FPVA 2QJVA 5JZGB 2I2SA 2WZR2 3EYPA 2JDUA 4A44A 5CKQA 1UF2C 2DCTA 2HWF1 1BLZA 3VZLA 4XFFA 2F4PA 2EIGA 3CDZB 3CLPA 3ZSKA 3KT4A 5DN2A 5H9SA 5FKBA 2ZGTA 5FYVA 1QJY3 1I1EA 5LA0A 3KCCA 1Y9QA 3N9LA 2XKOA 1PO12 1UW8A 3AVRA 5FZCA 3RI8A 3GZUC 2R6QA 4PQ9A 1YQ6A 4E2SA 5T52A 1ZZ8A 3E6DA 3R05A 2WKKA 4RGKA 4XDPA 1NYWA 5IK4A 2ADDA 1LECA 2JDNA 4IV3C 2WZ8A 1UZ0A 4RA0A 3T09A 4E8DA 5IK8A 1Y43B 5K0UC 2HBUA 1Y9GA 2HWD3 3USUB 4FCAA 3VV1A 4ORFA 2XVGA 2CAUA 4YZ4A 2I07B 4BMEA 3AP9A 5A33B 3OBRA 2AR6A 3MGUA 2K9ZA 5KWRA 3U37A 3H8RA 2VZPA 5GKAC 1ZNPA 2J1SA 3MI8A 2G9FA 3POGA 3T0BA 4HKWA 3I3MA 5CG9A 2A6ZA 1UYZA 3CBNA 3VKNA 4ISQA 2B45X 2XKPA 1IPJA 3A0NA 4OI0A 2B5HA 3DF0A 4MGZE 3B7MA 4MVTA 3I3DA 1TME2 5FJHA 1FPN2 3VBRC 4JKLA 2BBAA 2DVFA 4GB33 4P08A 2BEOA 1QNWA 2PN5A 2VMIA 3NAPA 3RMXA 2W68A 2HLEA 4IGOA 1H8TB 5F8PA 3IM0A 3PU8A 1QXJA 3X29B 2XDVA 3KHBA 5JOWA 3O1MA 2R042 3J8F1 2O14A 4TWTA 4BLJA 1JZ6A 3FHAA 4BLIA 3SCHA 2J1TA 4ATFA 2GNBA 1WA4A 3IAPA 1Q8PA 3SMHA 2GNDA 4MLOA 2CV6A 1ZBE1 2QQVA 1U0AA 1UL9A 3BTXA 2IC1A 1PO23 4JDOA 3ZMNA 4XFGA 1UPIA 4CCMA 1EV13 2VNGA 1PMJX 3OPZA 2P34A 3ZFEC 1QJX2 3TEXA 5FK8A 4CUCA 3WG3A 2ZGMA 4XMAA 1RUNA 3H3UA 1G9FA 1ZBA1 5FYHA 5CFCA 2VBBA 4HVQA 1RUH2 4JZRA 3OGRA 3T4HB 1X9TA 2B4KA 2PA7A 3TN91 2WNEA 5A6QA 1IQDC 2CAVA 3VHOA 4BYYA 3VBFC 1QIQA 4DRRA 2YG0A 2F17A 1GNYA 2P1BA 1VBA2 4HLTA 5C3RA 3NMBA 5JZGC 2VCMA 3LSDA 5JLVA 2Y0OA 3LAGA 5IK7A 4BE3A 1OLQA 1RJ8A 1JODA 3IPVA 5FZOB 5LY2A 4EWDA 4P9YA 3M8LA 2PAEA 2XJQA 4ZZ8A 5FYMA 5HXMA 1XNTA 5EV7A 1C4RA 1OPOA 4Q1PA 1JMUB 5DG2A 1CAUA 3NJZA 1K3IA 5BV6A 5KC5A 1VBC2 4MHUA 4QDRA 2A3WA 4W6WA 1I6XA 1TMF3 2XUMA 1J3QA 2OVUA 1R093 3H3ZA 3NV3A 4A42A 3H8OA 1JXNA 4RR3A 5FMOS 4CDXA 1VIWB 4MXWB 5FYUA 1YFWA 3GCWA 3ECQA 2ARAA 2JKBA 5F39A 5A3NA 5K7PA 4IE6A 4Q4W2 4Y22B 5DXDA 1GQPA 3VBOB 1UPSA 2WQ4A 1RUC1 1CGPA 3LD8A 3LDBA 3LDRA 4IXLA 2WNUB 4XACA 1L7RA 4QDQA 4BA6A 2WAAA 1RUD3 2ZMLA 3PUAA 4L2NA 4CCEA 1LODA 3P6BA 2W94A 4LIUA 4MOAA 2OKXA 5JSRA 2GSYA 5A80A 5T5JA 4FPKA 3TNPB 4DUVA 1RVF2 1EUTA 4CPBD 5J98B 2YB7A 4YSFA 3KS7A 1AL23 3OUHA 3BODA 5EJ3A 3SH3A 5ACA1 1RUI3 3JD72 5DUUA 2E7AA 2DVGA 2PLV2 4QGMA 3AMMA 3ZIWA 4QU2A 1U12A 1VB2A 3QACA 4IEZA 5FOBB 1OMIA 2YBKA 4PQQA 2PFWA 1UWWA 2A7AA 4AI2A 3DYPA 1BMV1 5EYYA 4QPIB 4UW6A 3T1LA 4AHYA 4FAGA 2XLFA 4LBQA 1AJKA 4Q4V3 5DDJ1 4JKMA 4D7SA 3DL3A 5FBJA 4DFSA 5C8CA 1ZRIA 2WWUA 1VBB2 2VNVA 2ZEWA 4QPYA 3OUIA 2RMU3 1E5SA 1AR71 4IGQA 3HNBM 1H8TC 4UBHA 4LKSA 3GBFA 4IV1B 4MYEA 4E9KA 3SNMA 3KHCA 3OPTA 1PIV3 3P3NA 4MADA 2W95A 5TSWA 2WO1A 5BUVA 1QJU2 1JYVA 4PDWB 2WLQA 1NE4A 5LW9A 1AZDA 1OD5A 3THTA 1OPMA 3KLSA 5LA2A 4COYA 5FXXA 1DG6A 3WNKA 4A7KA 1JYWA 1AUYA 1YQ8A 4FPGA 4ZZ5A 4XMIA 1AVBA 3HMYA 3NNJA 2GZWA 4YGBA 2O0OA 5FPAA 1HV0A 3IN9A 3WNMA 4GMP3 3P3PA 1AYM1 1OA4A 1UY0A 2GN7A 3ZYIB 3OYWB 1GNZA 4TLGA 1S1AA 4NHKA 3AKRA 3UNPA 1NY71 4QKNA 2G1MA 4GWNA 1O8SA 2EF6A 3F95A 3T0DA 3TEZA 2QQLA 3HT1A 3WT3A 4M01A 1VBE3 2MPFA 4ASMB 4ES8A 4JDMA 2VNRA 3ILFA 4WVMA 5DZFA 2V73A 1OVSA 1KS4A 4SLIA 1POV0 1T6BX 4RQPB 4DPNA 4JQRA 4K1ZA 4I2OA 1GR3A 1BEV2 1CZVA 1R1A2 1Q43A 1VE0A 2VMEA 3KWVA 5DPNA 3WNLA 4A3ZA 3UYJA 1CJPA 1G86A 4A3XA 1CPNA 2AACA 3L9JT 2H0VA 3S5QA 1OF3A 5D1IA 3ZFGA 4YPJA 2EXHA 4LEJA 2A71A 4OVEA 1OKQA 1TQ5A 1G9DA 1J1LA 1UXXX 4UAPA 3VL9A 4ARYA 2XJPA 4A41A 4U2AA 4UBGA 1H1AA 3CJXA 2J1VA 2ZKNA 3DCQA 2XJTA 4KWJA 4XOGA 3TOJA 3IZOA 1HX6A 4I0AA 2ZMNA 3PJYA 4LKFA 2B46X 4LQRA 4AFDA 3LEKA 4KMQA 4OFGA 2A1XA 4K3UA 4JTNA 5I0RA 4B4QA 1NQDA 3ACHA 4N8MA 3VBOC 1R081 2HWE1 1TZOA 5B2GB 4YGCA 3MF9A 5CA6A 3IDBB 2WNUC 5FO7B 2GDFA 1QKQA 1ZRFA 2CY6A 4GALA 2ZAHA 1RUG2 3RYPA 3WZ1A 2X5IB 1HXS1 3AMQA 1WD4A 5CAZA 3HQRA 1OA3A 2WN3A 2JJ6A 3OY8A 1H4GA 2ARBA 1F2NA 1VLNA 3PMSA 3I2DA 4CXXA 4DUXA 3WP6A 3WG4A 2P3JA 1NA1B 4QHOA 2ZGQA 1A78A 2WO3A 3ZM8A 1S2BA 1AR81 3MPBA 3PTYA 5IUQA 3AXDA 4LTAA 1AR92 4M4PA 4RFRB 5A3MA 5FZEA 5KHHA 1O4ZA 1WLDA 2J22A 1DGWA 2A6VA 4AFAA 1ODNA 2IVJA 3DPRA 5EJ1B 1QJEA 3MUY1 4Y4YA 3WQ1A 3MZHA 4O9GA 4QPIC 3M70A 3U4SA 4COVA 1IGOA 2KR2A 5IFPA 3ZFFA 5JPMB 1RB8G 2Y26A 4ZS2A 3OG2A 4C0HA 2YV8A 1RUJ3 4SBVA 3V0AB 2WS93 2VECA 1PGL2 2A75A 3AMPA 3PDQA 2OXBA 5J36A 1NAEA 4F7ZA 2AREA 4QQ2A 2RM21 4H7LA 4IV1C 2CGOA 3ZX7A 3LEGA 1K5MB 3I2HA 2FZ2A 2GH2A 2LALA 5JAXA 3RZMA 3T08A 1LULA 5B4XA 4ZPIA 3HEIA 1EPZA 4K21A 5FYTA 4DXZA 3BVCA 3VN4A 4YW7A 4PDWC 1Z0HA 2DVBA 2R063 3PIJA 3RYKA 3CMGA 5J1XA 3PUSA 3K4DA 5FWEA 2DWRA 4Z2AA 1GQHA 1AJOA 1LAJA 4UT5A 3QCWA 1BBT1 2OA2A 1CAXB 3I4IA 2Q8EA 4Y5Z0 4AYUA 2FDFA 3M1HA 1KEXA 1CVNA 2A6WA 1UAIA 3AJYA 3LB9A 2PHRA 4IW3A 4QDSA 1DF0A 1PHMA 1RGSA 3WLUA 2IXLA 2W2IA 4Q27A 4Z1VA 4ZXEA 3O1UA 3ACLA 2J42A 1OC1A 1VPHA 2HWC1 4ZXKA 2BGCA 3U1XA 3NRUA 3FE5A 1HLCA 1WGPA 2WZR1 2EAKA 1EAH2 4XCBA 2WAOA 2W47A 5FPUA 2WUHA 2RDQA 2KM2A 5FPXA 5IWFA 4RQPC 4XJUA 3SISA 2CTVA 2XPJA 2A73B 3W5NA 1AR63 1NT0A 4WBBA 3HAGA 1MZEA 5L9BA 5J09A 1OFNA 2QQIA 4L9BA 3O1VA 4H2AA 2RG4A 2UURA 5HBAA 1GZCA 2W1QA 2PHFA 4JKKA 3R4UA 3NVCA 5FZ8A 3WQ7A 1NLRA 3ACFA 3WY6A 5FP3A 3DXUA 1DDLA 3RJ2X 3SITA 1SFYA 5J3UA 4P5HA 1W6NB 3D5OA 4NJ4A 1SLAA 4PIZA 1S0CA 5T3NA 1T6GC 3HNYM 3VKLA 3ZN6A 5BNNB 1LB2A 5K4LA 3EQEA 3LA2A 4LORA 4NIAA 4EYUA 4A7YA 3KV6A 4YM0A 1YIPA 3ETPA 1OXCA 3KCXA 1JHJA 4IERA 4MSVA 3PMEA 2X5IC 5A3UA 1R1ZA 2EIEA 2HEVF 2Y34A 3MIEA 4KQ7A 4XYXA 3A23A 4D69A 1RHI2 4QX1A 5H9RA 2IXJA 1W3VA 4FI9A 1PGW2 1SACA 2BU9A 1J58A 1NA1C 3W5MA 2VZQA 1HB1A 5JR7B 4YM2A 5I8TA 5FLJA 1W6MB 3LA3A 5FZ0A 1VBD3 2TBVA 5A6YA 1MS5A 4W6YA 1S55A 2X05A 2JXAA 3RSJA 4RHV3 3A21A 2QZ2A 5DUXA 5FIXA 1TME1 3A4UA 1FPN1 2VQ0A 1U5XA 1RUOA 3OD4A 5BXXA 4QMAA 3P5BA 4DIQA 1AX0A 1PO22 4E4SA 3AP6A 4X8NA 1EV12 2HEYF 1UYXA 5CFDB 3R4SA 5FR3A 5LBEA 1SBEA 2WFF2 3ZYBA 1NZIA 1KJRA 1KD7A 2YFZA 2E53A 5LATA 5A3LA 2R041 3HOBA 3C7EA 4BM8A 1WW6A 2P3IA 2ZGLA 3AYEA 3I8TA 4C1WA 2CWSA 3ZMOA 3IKWA 3I2JA 3FBMA 1K5MC 4OHYA 2W0XA 4QQHA 5A7WB 3UL2A 1LGNA 1WD3A 1XE0A 2D5FA 2J1UA 3PUQA 4LR4A 3ATGA 1OF4A 1MEC3 2VJXA 4IEOA 3M2MA 4AI0A 3T0AA 4XQWA 2C24A 4LBLA 2D3RA 4KWUA 1QJX1 5DUWA 1WLWA 2W87A 2C4XA 2VZOA 2YZ4A 3AP4A 3JB8A 3P1IA 3B01A 3PIGA 5C5UA 3V0BA 3LPFA 3WP5A 3DN7A 2B39A 3OGSA 4AEDB 5E89A 5FZHA 3GZEA 4Q8LA 2VXJA 1UO9A 4IEQA 4P9IA 4XFIA 3KQRA 2C9AA 5KXEA 1RUH1 3N4MA 2D97A 1X82A 4BOWA 3WP3A 3NSTA 3LFMA 1OQDA 2WNVA 4HETA 5AC92 1HJFA 3OOXA 4Y20A 5JVVA 1TMF2 2Z79A 2JG9B 1R092 1CX1A 4Z2WA 1X36A 1VBA1 1ZM1A 2MEV3 3OTFA 4XFHA 3UV9A 3WHTA 5C3OA 2JDAA 2P5BA 5C4WA 5A1AA 5FV3A 1AX2A 5ABJB 1S0EA 4BPZA 1NKGA 1WCDJ 2GP3A 3VDDB 4JDNA 1W2TA 2NZ9A 4LLOA 4D8MA 1IS4A 2VTXA 3H1YA 3ILRA 4GULA 4WVVA 1MVQA 5EPAA 5FY8A 3WQBA 1VBC1 3V64A 2ZGKA 3VD7A 1NQJA 5D8AA 4GKXA 5JIAA 3SLIA 1JYTA 3JBG3 4XVHA 5LWBA 4E2QA 2VQTA 4ET7A 4C0BA 4WZFA 4J1WA 4CCLA 3AZVA 2FDKA 1RMU2 2VOTA 1AHSA 3VDBA 4YVWA 2HH9A 4XFCA 1KITA 4Q4W1 1JZ8A 3WEZA 5EXOA 2QZ3A 1Q8SA 1WMDA 2WT1A 5LK5A 1O91A 3WF3A 1I3HA 2QDRA 1AL22 1LOFA 2E7QA 4X6RB 3J4UH 5T50A 5J96B 1MS8A 5JOZA 1Z7S3 1QNYA 2XHKA 1XE8A 3Q8FA 4M4RA 3SCFA 1QQP3 4P9WA 5BNNC 5C8WA 1C57A 5F2WA 4ITCA 3EO6A 3FHQA 3AZZA 3M3QA 2P3KA 3N7LA 4FPYA 5FY1A 4ASKA 1IG0A 4QPGB 4NAOA 2ZJCA 2QBXA 3C7FA 4JHZA 4XUOA 1RVF1 5F3IA 2ZGNA 3SEPA 2ZA9A 1HRV3 4Q4V2 2PAMA 1E57A 3MLJA 4H14A 5I8SA 4F3JA 2VQAA 2ATFA 2YFUA 2Z69A 5C9AB 4LHLA 3N3HA 3WDYA 1W2OA 2RMU2 3JD71 3WUDA 2PLV1 2V09A 4RN5A 4MGQA 4RS5A 4QX5A 4UW5A 1LEDA 2GNTA 3PUIA 4I30A 4IESA 1SBFA 3B69A 4AVSA 3POYA 1PIV2 4AI8A 3GM8A 4M3CB 3THCA 3LZZA 3RDIA 4BCUA 5I0TA 3FN9A 3VZKA 1H4HA 2A6YA 4DS0A 5FZ4A 1OBNA 1VBB1 3VD9A 1V6MA 1DU3D 4HPKA 3ORJA 2EXKA 1SZBA 1VAMA 5CFDC 1CAWA 3CEWA 1N1SA 1YI7A 5FY9A 4JTOA 2Q1FA 4LULA 3ENRA 3LSEA 3GBGA 3TAYA 3KMHA 3ZVXA 5DQ0A 1QJU1 4OI2A 1ND2B 2CGNA 3L2YA 4QT6A 2A5ZA 5LEKA 3S57A 3T3YA 2MNGA 4S2FA 2BBVA 2W92A 2ZX0A 2FMYA 5A3TA 2Q5TA 1GNHA 3GXUA 4ES9A 2RV9A 4MZUA 5A32A 4YZ1A 5HV0A 1C8NA 4Y5SA 2YHJA 3HJRA 5KXDA 5LRRA 2XUEA 2Q30A 3TBDA 1PM7A 1TVGA 4CZSA 1HKDA 3ZSJA 1XSRA 5CISA 4Y5TA 5JI7A 3K51A 4AEDC 4UWDA 1AYN2 1OQEA 5K0UA 1XYPA 4G4FA 1W6OB 4R9DA 4AFCA 3RQ0A 3KGLA 3MO4A 1PVC3 5KHIA 1MS3A 1MZ5A 5C3PA 1DGLA 3GBWA 4IE7A 3RG0A 3VB9A 1POV3 4UI9L 1V9U2 4NR1A 1GP4A 2JG9C 2PHLA 1NZCA 2FDGA 4PI0A 5T5PA 1W8TA 4M00A 2AEZA 2VUCA 1YFXA 4ZS3A 1W6QA 5ABJC 3RJRA 1S2KA 1AX1A 3WDTA 1BEV1 1R1A1 4HSLA 2HWF3 3VDDC 3O1OA 1W6PA 4E2GA 3J7NA 2YUEA 5H9QA 4DXRA 1UOJA 3VBRA 4YW2A 1QOOA 3IIIA 1GV9A 1H9WA 1PX3A 1WCKA 3PUHA 2EIBA 4I02A 3KV5A 2CGPA 1DYPA 3SCGA 1FNZA 1RUE3 2DV9A 2PHTA 2J1RA 3IDCB 4FOYA 4IETA 1HJGA 4WM7B 4EN6B 1O3RA 4B7EA 5I93A 3MYXA 3NKGA 4LA3A 4OZOA 4TXWA 1DFQA 1XOYA 4OI4A 2FMDA 3LQCA 1WLTA 1LHNA 4FBFA 5A1FA 3UGGA 1GBGA 3K3OA 1TE1B 1RUG1 2VMGA 4JRLA 4X8PA 4HANA 3SC7X 1BHGA 1YHFA 4CU7A 2VTXJ 4PIXA 4QPGC 3J9SA 5G04L 3RZZA 1FT9A 1DZQA 1DYKA 2ORXA 4OHZA 1APNA 2Y8KA 4CUBA 5BNQA 1F5JA 3W9AA 4B1MA 1GZ9A 4Y1YA 1RUJ2 1D7PM 2WS92 4ZU5A 2BTVC 1V6NA 1AR91 2VTFA 2YU2A 4K40A 2QTWB 2YBPA 3PNAA 1RJ7A 1ULDA 2YGMA 3O1TA 3MW3A 4NHLA 3TB0A 2YC0A 4LT5A 1JU3A 3FMGA 2VMCA 3CQOA 4CDUA 4KGQA 1NUKA 1B35B 4PIYA 4LO7A 1UY2A 2R062 2R0HA 1QDCA 3FFQA 5CB7A 4HN0A 1LU2A 5JZGA 4IEVA 3SKVA 1PGL1 3J7MA 2EAAA 1PM4A 5J37A 1SMVA 4NVPA 1V6JA 2O8QA 1NCRB 4KH9A 2AUYA 2BNNA 2OX0A 3N9PA 3H8UA 3J8F3 2C6SA 3VZOA 1FV3A 1M4WA 1W39A 3GHNA 4HBNA 3UGFA 4YZ3A 3BPZA 3HN3A 1OLME 2VVEA 3BTAA 1GWKA 3N9OA 4W4ZA 5FMBA 4HMZA 5L9RA 2NMNA 3NNFA 1ND2C 5FXZA 3K3NA 1DQ5A 1MVEA 1JBCA 1ULPA 4WV8A 5FTTC 4EZ4A 4YG0A 4LO6B 5HCAA 1UYYA 5CYYA 1V6LA 4QXCA 1CWPA 3NAPB 2KXLA 1RYYA 5I91A 5LA1A 4S2GA 1VMHA 4XF9A 2NQYA 5A3PA 3GCXA 3KV9A 1ST8A 3PURA 2JDMA 4RSUA 2DUOA 2QKDA 5FAXA 4LA2A 5FZGA 3USUA 2XQXA 2RHPA 3FUQA 1CZSA 4NPRA 2VXRA 1W8FA 4GJZA 3TN93 4A6SA 3O1RA 1MZ6A 1MQTA 5A33A 4YARA 3POEA 3WNPA 4E4HA 2ZEZA 1W8HA 3S0MA 1W28A 1EAH1 2XL7A 1PNFA 3WNNA 5BYNA 4R4XA 1LTEA 4BQ1A 3VKFC 4NHXA 4AFMA 5FZLA 3HIFA 5FZMA 4NIGA 4DRVA 2VOWA 1LESA 2C0ZA 2PMWB 3IWZA 5ISLA 1LHOA 2BDRA 3IAQA 4I01A 5IFTA 1UZVA 2HWB3 4IEPA 5FCCA 1RXFA 4M3CF 1SPPB 5L9VA 5FY5A 4QAWA 4AI3A 4S2HA 4DOUA 3S6PA 4CCCA 3RZGA 5GLUA 1ZRCA 2QQPA 2L9LA 4G9SB 5DAPA 3O12A 2QQKA 4WM7C 3VZMA 2P6HA 4P5YA 2BP6A 4DB5A 5JWPA 2O8OA 1RUC3 3USSA 2BV4A 2HEWF 3ETQA 1HB2A 3VKMA 2XBO3 3JB4C 4CRQA 5CIRA 5FYSA 2I45A 4XEZA 2WO2A 4E27A 1LOGA 1A8DA 4PBPA 1NCQA 4XHBA 5FYCA 1VBD2 1C8M2 1FYUA 4AQ2A 2DUQA 3AL6A 3ZR6A 4E4DX 2D98A 1RHI1 3AKPA 4NRPA 4AEKA 4AOCA 1GOFA 4RR3B 2J7MA 1VR3A 4CDXB 1PGW1 2WWJA 4RD7A 4QD2A 3C3VA 4N53B 1DLLA 3HPNA 5F5IA 2BERA 3VHRA 4AGGA 2RJ2A 1OFSA 4BJ0A 5ACA3 5BNOB 2YC2A 1QOSA 3HT2A 3O5SA 1SQ4A 5T55A 4FSJA 2R072 2Y6HA 4LXLA 2BOIA 2RDNA 1QDOA 4NO4A 3NW4A 2V5YA 2XWJB 2AEYA 1JUIA 4TTGA 5K9YA 1QXRA 4MXVA 1P8JA 3VBSB 4D7YA 5DDJ3 1GSLA 3WQ0A 2VE1A 1B35C 2GNMA 2RJLA 1VMJA 1MEC2 2E51A 1PO21 2WABA 2ZZJA 2ZX4A 4QB2A 2FZ1A 1EV11 2OPKA 4HSJA 4N9IA 4JHTA 5JXHA 1W9WA 5FZOA 2WFF1 4NIIA 1UQXA 4OZXA 4AHXA 1NCRC 2Z4FA 1NG0A 4AQTA 4FTEA 1WLCA 1U5IA 4META 3ILNA 1KGYA 2A70A 4HVRA 2A3YA 2AYHA 1TNFA 4UFIA 3RGBA 4XJZA 3V65A 1CAVB 1DQ4A 4DXSA 1YI9A 1UY1A 3WDVA 1NLSA 4MXWA 1KJLA 1ULGA 2VL4A 3ZYPA 1S0FA 3MPPG 2YBSA 1BZWA 1ZX5A 3NAPC 3VGIA 1GP5A 3OSDA 4F83A 3BU7A 4QXHA 1JYIA 2D6PA 5DUVA 4KU7A 3ZXAC 4AFBA 5LEJA 4XW3A 3HQXA 4D6SA 1LR5A 3VBUA 5AC91 1TMF1 5A7SA 4J6GA 1R091 2NLRA 3JBG2 5IVYA 3DECA 4ZU7A 1ZZ6A 2I74A 1OH4A 2W52A 1TG7A 2ZEXA 1EUUA 2JE7A 3WCRA 4CP9B 1ZRDA 4D6RA 3PU3A 2WSUA 2IVIB 4XUPA 2VNOA 4QM9A 1D4VB 1FOD2 1Z7S2 3DEMA 4KI5M 2BFUL 3CF6E 1QQP2 4JVAA 2BWCA 4QQPA 4YRDA 5T5OA 3PVEA 4NWVA 2AH2A 3MBWA 2VZTA 1RMU1 4AL9A 1G7YA 4A7ZA 4QB1A 5FZAA 5FOJB 1YO8A 2IXHA 2PHUA 2WO7A 4CYDA 1AL0G 1K5JA 3FHIB 4IEWA 4B8EA 3KCYA 2YGLA 2CHHA 1AL21 4CTEA 4CP2A 1UX7A 1G6NA 1R083 1ENRA 3D6EA 1X7NA 3AKSA 4HFSA 4XDQA 3C8XA 4YW6A 2WA4A 5FP4A 1MS0A 4QXKA 4BQ3A 1HXS3 1PMIA 3PVNA 3W21A 3WUCA 4AZZA 4IQPA 4BZ4A 4URAA 5KC6A 2FDHA 5LK7B 3OPWA 4CA9A 1XJAA 4Q4V1 2VCBA 2JKXA 2WYSA 1HV1A 4RR3C 5JSPA 2XOMA 4CDXC 1S0BA 2D43A 2GC0A 1ASJ3 2RMU1 2QVSB 1OQ1A 4N53C 1W03A 1H1IA 2NM1A 4CU9A 3D4KA 5CKMA 1FMD3 2BYVE 4AXOA 5BNOC 1H9PA 4CSWA 1VJ2A 4FQZA 2LTNA 4Z07A 3KM5A 2PELA 3D3AA 4JCKA 1PIV1 4WM8A 5FZKA 1JYNA 4XF1A 3VD3A 4RYDA 1NE6A 4XFAA 1ACCA 2NMOA 3ME2A 3HN1A 3RZLA 4COUA 5IVJA 1GLHA 2VOVA 4GWJA 3VBSC 3UK9A 1PZ9A 2VW2A 1REDA 2ZEYA 5FKCA 1XB9A 2OUJA 1FV2A 3CHXA 4XABA 4PF1A 4RQPA 3CKHA 2ZHMA 3BTZA 2IXIA 4FOWA 2JDKA 2GC2A 3UKTA 4DMIA
chains in the Genus database with same CATH topology
5FP8A 3N9PA 4QWNA 2XDVA 5FXWA 4DO0A 5FZ3A 5A7QA 3RVHA 3OPTA 5A7WB 4CCNA 3N9OA 1VRBA 5FYTA 3K3NA 5FXZA 4AI9A 3PUQA 5E6HA 5IVCA 5A7PA 5FYBA 5A3WA 4EZ4A 5A3TA 2Q8CA 5LW9A 5FZ6A 5F3EA 3KVAA 5FPLA 5IVVA 2OS2A 3N9MA 3PUSA 4HOOA 5FWEA 2YBSA 4QXCA 5FXXA 3ZLIA 4CCMA 5FZFA 2XUEA 5F5AA 5FUNA 2Q8EA 4IGPA 4V2VA 4QXHA 4UF0A 5A1LA 4BU2A 5FPAA 5FZHA 4CCKA 5A3PA 3N9NA 3KV9A 3PURA 5FYIA 4LIVA 4BXFA 4D6SA 5FZGA 5FYHA 4GJZA 4D6QA 2XXZA 4Y3OA 2W2IA 3PTRB 3K2OA 5A7SA 5FYYA 2YU1A 5IVYA 4E4HA 5F3CA 4LITA 4QXBA 5F2SA 4AAPA 4EZHA 4HONA 5KR7A 5A7NA 2P5BA 3PU3A 3KVBA 5FPVA 5FV3A 5FZ1A 4D6RA 4UF0B 3N9QA 5FPUA 4QX8A 5LY1A 2GP3A 5FZLA 5FZOB 3AL5A 5FZMA 5FPBA 5IWFA 5LY2A 4CCOA 5FYMA 5FY8A 5FYZA 3UYJA 2OT7A 5FP9A 4C8DA 5FY5A 2PXJA 5FUPA 5LWBA 5FYVA 4CUGA 3KV5A 5F5CA 5IW0A 2YPDA 5FZ8A 3N9LA 5FZAA 5A7OA 3ZPOA 3NJYA 3AVRA 5FZCA 4CCLA 5CEHA 4CCJA 5FYUA 5FZIA 4TN7A 3DXUA 5FP3A 5IVFA 2OQ6A 4XDPA 5F39A 5A3NA 5FXVA 5F37A 4NUBA 5A7WA 5FYSA 5FP4A 5FY4A 3LD8A 3LDBA 5A1FA 4QX7A 3K3OA 5FYCA 5K4LA 4EYUA 2Q8DA 3DXTA 5F2WA 5FZ9A 4URAA 3KV6A 3AL6A 4ASKA 3OPWA 5FY1A 5F32A 4GAZA 3PUAA 4Y4RA 5F3IA 4BISA 5IVBA 4LIUA 4GJYA 2XMLA 5FP7A 5A80A 2WWJA 5ISLA 5F5IA 4V2WA 4CSWA 2YU2A 4LXLA 2YBPA 5IVEA 5FWJA 5FJKA 5FZBA 5FZKA 5FZEA 5FZ0A 3KV4A 4Y33A 5FY0A 3U78A 2YBKA 5F3GA 5IVJA 5FZ7A 2OQ7A 4QU1A 5FZ4A 3U4SA 2GP5A 5FJHA 5FY7A 5FBJA 4GD4A 3AVSA 4DIQA 5FZOA 2WWUA 2VD7A 3PDQA 5FZDA 4XDOA 4IGOA 4IGQA 5FY9A 2OX0A 3PU8A 5ANQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FP8 A;  3N9P A;  4QWN A;  2XDV A;  5FXW A;  4DO0 A;  5FZ3 A;  5A7Q A;  3RVH A;  3OPT A;  5A7W B;  4CCN A;  3N9O A;  1VRB A;  5FYT A;  3K3N A;  5FXZ A;  4AI9 A;  3PUQ A;  5E6H A;  5IVC A;  5A7P A;  5FYB A;  5A3W A;  4EZ4 A;  5A3T A;  2Q8C A;  5LW9 A;  5FZ6 A;  5F3E A;  3KVA A;  5FPL A;  5IVV A;  2OS2 A;  3N9M A;  3PUS A;  4HOO A;  5FWE A;  2YBS A;  4QXC A;  5FXX A;  3ZLI A;  4CCM A;  5FZF A;  2XUE A;  5F5A A;  5FUN A;  2Q8E A;  4IGP A;  4V2V A;  4QXH A;  4UF0 A;  5A1L A;  4BU2 A;  5FPA A;  5FZH A;  4CCK A;  5A3P A;  3N9N A;  3KV9 A;  3PUR A;  5FYI A;  4LIV A;  4BXF A;  4D6S A;  5FZG A;  5FYH A;  4GJZ A;  4D6Q A;  2XXZ A;  4Y3O A;  2W2I A;  3PTR B;  3K2O A;  5A7S A;  5FYY A;  2YU1 A;  5IVY A;  4E4H A;  5F3C A;  4LIT A;  4QXB A;  5F2S A;  4AAP A;  4EZH A;  4HON A;  5KR7 A;  5A7N A;  2P5B A;  3PU3 A;  3KVB A;  5FPV A;  5FV3 A;  5FZ1 A;  4D6R A;  4UF0 B;  3N9Q A;  5FPU A;  4QX8 A;  5LY1 A;  2GP3 A;  5FZL A;  5FZO B;  3AL5 A;  5FZM A;  5FPB A;  5IWF A;  5LY2 A;  4CCO A;  5FYM A;  5FY8 A;  5FYZ A;  3UYJ A;  2OT7 A;  5FP9 A;  4C8D A;  5FY5 A;  2PXJ A;  5FUP A;  5LWB A;  5FYV A;  4CUG A;  3KV5 A;  5F5C A;  5IW0 A;  2YPD A;  5FZ8 A;  3N9L A;  5FZA A;  5A7O A;  3ZPO A;  3NJY A;  3AVR A;  5FZC A;  4CCL A;  5CEH A;  4CCJ A;  5FYU A;  5FZI A;  4TN7 A;  3DXU A;  5FP3 A;  5IVF A;  2OQ6 A;  4XDP A;  5F39 A;  5A3N A;  5FXV A;  5F37 A;  4NUB A;  5A7W A;  5FYS A;  5FP4 A;  5FY4 A;  3LD8 A;  3LDB A;  5A1F A;  4QX7 A;  3K3O A;  5FYC A;  5K4L A;  4EYU A;  2Q8D A;  3DXT A;  5F2W A;  5FZ9 A;  4URA A;  3KV6 A;  3AL6 A;  4ASK A;  3OPW A;  5FY1 A;  5F32 A;  4GAZ A;  3PUA A;  4Y4R A;  5F3I A;  4BIS A;  5IVB A;  4LIU A;  4GJY A;  2XML A;  5FP7 A;  5A80 A;  2WWJ A;  5ISL A;  5F5I A;  4V2W A;  4CSW A;  2YU2 A;  4LXL A;  2YBP A;  5IVE A;  5FWJ A;  5FJK A;  5FZB A;  5FZK A;  5FZE A;  5FZ0 A;  3KV4 A;  4Y33 A;  5FY0 A;  3U78 A;  2YBK A;  5F3G A;  5IVJ A;  5FZ7 A;  2OQ7 A;  4QU1 A;  5FZ4 A;  3U4S A;  2GP5 A;  5FJH A;  5FY7 A;  5FBJ A;  4GD4 A;  3AVS A;  4DIQ A;  5FZO A;  2WWU A;  2VD7 A;  3PDQ A;  5FZD A;  4XDO A;  4IGO A;  4IGQ A;  5FY9 A;  2OX0 A;  3PU8 A;  5ANQ A; 
#chains in the Genus database with same CATH topology
 3DKQ A;  5FP8 A;  1J3P A;  2YC4 A;  2PAK A;  3U10 A;  4QHZ A;  4NOT A;  5T5L A;  5A7Q A;  1DYO A;  3DPR B;  3ZXD A;  2KA3 A;  3AC0 A;  5HCF A;  4AQ6 A;  5JI9 A;  2VUL A;  1CN1 A;  3IBM A;  5EWS A;  2RS1 2;  4CCD A;  5E6H A;  1YXW A;  2OZ6 A;  1HQN A;  1BKZ A;  4UFL A;  4ASL A;  4P14 A;  4E8C A;  2GN3 A;  1F35 A;  3OEB A;  4QHB A;  5F5A A;  2WZE A;  1AYN 1;  1LCL A;  4L11 A;  3V56 A;  4UF0 A;  3UET A;  3RI9 A;  5A1L A;  2XJU A;  3BI3 A;  3I2I A;  4S2D A;  3VZJ A;  3N9N A;  1W2A X;  2X5I A;  1W2N A;  3WF1 A;  4KGG A;  4Q0Q A;  5FQ0 A;  1XU1 A;  2WZP P;  3N7J A;  5LA9 A;  3PTR B;  1C28 A;  1V9U 1;  1E5R A;  2HWC 3;  4EN9 B;  1G9A A;  1HRI 2;  4BQY A;  1FAY A;  2JE9 A;  2P6C A;  2OYZ A;  3E97 A;  3W20 A;  1D0H A;  4FFF A;  1RUE 2;  2DVD A;  2IZW A;  3PVO A;  4ONU A;  3FWE A;  4UXA A;  4XIO A;  4IE4 A;  1RTV A;  1WW5 A;  1JZ4 A;  2ARC A;  3CU7 A;  3CJI B;  3H42 B;  4CU8 A;  1LKN A;  1YJL A;  4LKE A;  3SEE A;  1VRH 3;  3AL5 A;  3RZH A;  4QGN A;  3AK0 A;  2RS3 2;  2WYF A;  2XLG A;  3D0J A;  4K8F A;  4QB6 A;  5FYZ A;  2Y6L A;  3UKN A;  4OMD A;  1MS9 A;  1PO1 3;  3OBZ A;  4Q26 A;  5FP9 A;  2VO5 A;  2KD7 A;  3U11 A;  2PXJ A;  2VZV A;  2W9X A;  3D8C A;  4QGL A;  3ACG A;  3QH6 A;  2VGD A;  5IW0 A;  2YPD A;  1JZ7 A;  4FT8 A;  1X9P A;  4B7K A;  3BOW A;  2RR1 3;  1SHW B;  2G4I A;  2BVV A;  1QJY 2;  5A7W A;  4CEW B;  1DCS A;  1K5M A;  4GH4 B;  2JX9 A;  2XWB B;  5IAX A;  3T4V A;  3AFG A;  4BDV B;  3GYD A;  1X50 A;  1N3O A;  4C90 A;  1C1L A;  1CR7 A;  2HJI A;  3KSC A;  4M3C E;  4QKB A;  4YFW A;  5F32 A;  4L92 A;  4GAZ A;  4UOJ A;  4N43 B;  2GH8 A;  2R7E B;  1PK6 A;  2WJS A;  5KHG A;  4P00 B;  1CAX A;  5FP7 A;  4HXC A;  1RUJ 1;  4HN1 A;  4CDW B;  2WS9 1;  2HWD 2;  3LWC A;  4PF5 A;  1VAK A;  3WV6 A;  2CWM A;  4PT6 A;  3POF A;  4OCT A;  4Y1V A;  5IT6 A;  1UMZ A;  1QWR A;  5L73 A;  3ZN6 B;  1GFF 2;  2WA3 A;  4RGA A;  2D7F A;  3TWI A;  1JI6 A;  4JV4 A;  3TEY A;  2XJS A;  4MGT A;  1TME 3;  3I2K A;  4DY3 A;  1FPN 3;  2R49 A;  1COV 3;  1WME A;  2FDJ A;  3GAL A;  2R06 1;  4L8Q A;  3U4X A;  1QF3 A;  4LO4 B;  3WIN E;  3WF2 A;  5IK5 A;  3ZDV A;  1WCU A;  5GZF A;  4OHV A;  3GGL A;  5DG1 A;  1GP6 A;  3KT1 A;  3ST7 A;  4GD4 A;  1RL3 A;  3OD0 A;  4XUR A;  3WNX A;  2Y60 A;  1WZX A;  2PHX A;  3KGZ A;  4D7T A;  1PZ7 A;  4XJ8 A;  1GIC A;  1C5I A;  3OGV A;  4LHK A;  3LE0 A;  4GB3 2;  4FP2 A;  2UY8 A;  2ZS6 B;  3AZX A;  5G05 L;  2ZAC A;  1KQR A;  3RVH A;  4A6O A;  4BMB A;  2WT0 A;  3DPR C;  3W58 A;  1PNG A;  4LUK A;  2H6C A;  4AI9 A;  4YM1 A;  3VBH B;  5JSO A;  2AEN A;  3WNO A;  1FXZ A;  5FZ6 A;  3SHR A;  1YFY A;  1F5F A;  5T54 A;  4ISR A;  2NYY A;  1BK1 A;  3NNG A;  2Q4S A;  3H8X A;  2VCA A;  5F6L B;  1UIK A;  1ULE A;  4JGZ B;  4Q0U A;  4V2V A;  4YNI A;  4FAH A;  1RIT A;  4CCK A;  4IUG A;  5CAD A;  3F2Z A;  3T30 A;  3MIF A;  3I2F A;  1DHK B;  3N7K A;  4LIV A;  4BQX A;  3NWK A;  1F4H A;  3I49 A;  2W91 A;  3O14 A;  5IAT A;  2HWB 2;  2RJK A;  4GIQ A;  1WUV A;  5A70 A;  3K2O A;  4BH9 A;  4YW5 A;  5FYY A;  3FL7 A;  1IG3 A;  2YU1 A;  4AVC A;  2E9Q A;  4NE9 A;  1VBA 3;  1XE7 A;  4HL0 A;  2ERF A;  3JZV A;  2VZU A;  5JXG A;  2W3J A;  5IHR A;  4UW3 A;  2W5F A;  2ZXQ A;  4LKD A;  4AHW A;  1JYC A;  4CVU A;  3LEI A;  1I9R A;  1QU0 A;  2CDO A;  3CJI C;  3MV0 1;  5FZ1 A;  1MS1 A;  1W6M A;  4JX0 A;  5I8Y A;  4B1L A;  2XBO 2;  5KXC A;  1DQ6 A;  2AC1 A;  5IVB A;  3R0R A;  1S0I A;  2YY1 A;  4P9L A;  3WW2 A;  3POS A;  3VUO A;  2XHN A;  4W6X A;  1WW4 A;  2WNV B;  3CIH A;  3BGA A;  1QJF A;  3AKQ A;  1HW5 A;  2B9V A;  4Y20 B;  3RMY A;  3B9I A;  3LIH A;  4C8D A;  1E5H A;  1E5I A;  1SLL A;  2XVL A;  4FPL A;  5BNP B;  2FD8 A;  3AMH A;  3MIG A;  5IYY A;  1BVP 1;  4I0W B;  1PGS A;  4Q4W 3;  3VHP A;  4IE5 A;  3QBQ A;  3POI A;  4FPH A;  2R0F A;  4O61 A;  4ZHN A;  5C4W B;  3LOB A;  1YWK A;  2DVA A;  4CDQ B;  4CEW C;  1H6X A;  1Z78 A;  2D6K A;  2JG8 A;  2VMH A;  2WWS A;  3C7G A;  2WQZ C;  3N7M A;  2WFP A;  2ZAB A;  2DUP A;  4GH4 C;  4NUB A;  5GJ6 A;  1VBD 1;  2IWG B;  1C8M 1;  3MW2 A;  4Q4X 3;  3WXP A;  3ZR5 A;  2Z5W A;  3OBA A;  3AFK A;  3BIW E;  2VW0 A;  1OKO A;  3H7Y A;  5KBF A;  3RRD A;  3BYW A;  5L7O B;  2LW8 A;  1O4T A;  1H2L A;  3BN6 A;  3I59 B;  5KHJ A;  1OOP A;  4N43 C;  2BWA A;  1RC6 A;  5E8A A;  4YVW B;  1SFN A;  1FNY A;  2DCJ A;  4CDW C;  1W9S A;  2AZ5 A;  5HXV A;  2Y6F A;  1B09 A;  1RUD 2;  2R07 1;  2ETE A;  3RWK X;  3VDA A;  3EHK A;  4QPW A;  5JCT A;  4IEU A;  4A2U A;  1GWM A;  2P3Y A;  2DBN A;  3WF4 A;  1ALY A;  1NXM A;  2OUH A;  1ZZ9 A;  5FY0 A;  1R64 A;  2JG9 A;  2ZGP A;  4P9G A;  1RUI 2;  1ULF A;  3L2H A;  1MEC 1;  4CEY A;  1EP0 A;  4Q0V A;  4JAA A;  1AXY A;  1ULC A;  3UT0 A;  4J1X A;  2BOJ A;  1D4M 3;  1XRU A;  5FY7 A;  2RS5 3;  1LOA A;  2DFB A;  1OUS A;  1N1Y A;  3FLT A;  1UZY A;  2TUN A;  3EB7 A;  5IJR A;  4AI1 A;  5GLZ A;  4IEY A;  5LAS A;  1L7L A;  5C7G A;  2VCC A;  4RGG A;  2ZCW A;  5J48 A;  4U36 A;  4W50 A;  1W9F A;  2IUW A;  2X29 A;  1SBD A;  4OI1 A;  2YMZ A;  1IPK A;  2HKX A;  3CO2 A;  4X6Q B;  3BTY A;  1ULO A;  1IQA A;  1O59 A;  4Q4Y 3;  4LUM A;  3EJK A;  3LPG A;  4DXT A;  5K8S A;  2JDP A;  1GOH A;  3ZSL A;  1LOE A;  2DUR A;  1W99 A;  2VOK A;  2YYO A;  2ZHN A;  2ZKL A;  3BB6 A;  3MFC A;  5A7P A;  3VBH C;  4YGD A;  3BKZ A;  4XIK A;  3KQ4 B;  2ENR A;  4HPK B;  2V4V A;  4D94 A;  4LK6 A;  1DQ1 A;  2DBI A;  2IFR A;  1G9C A;  2B42 B;  2ZX2 A;  1F15 A;  4PLO A;  5FZF A;  1NX9 A;  1CAW B;  2DU0 A;  1ZZC A;  1KRI A;  3LDK A;  1UMI A;  3MF6 A;  4JGZ C;  4XF3 A;  1XC6 A;  1POQ A;  2B7Y A;  4COZ A;  5DAW A;  1Q5O A;  1UN1 A;  4PLN A;  1F9K A;  5JXI A;  4FXG B;  1IKQ A;  3JBG 1;  3ZYR A;  2XXZ A;  4D6Q A;  1O3T A;  4IE0 A;  1IOA A;  1BQP A;  3FFZ A;  4K7J A;  1WCS A;  4JGY B;  4P9X A;  3FLR A;  3ZKU A;  1RUF 3;  2VC9 A;  1YNA A;  1ZYB A;  3AM2 A;  1UIJ A;  5F2S A;  5A32 B;  1XYO A;  2JDZ A;  3Q9O A;  3NV4 A;  1BEV 3;  1YCI A;  1OVP A;  3ZN4 A;  4XCA A;  1VBE 2;  1H2M A;  1FOD 1;  1Z7S 1;  4IV3 A;  3Q8B A;  2DCY A;  1W0O A;  4CCO A;  1QQP 1;  2E6V A;  4OHX A;  4OUS A;  3NO8 A;  5FDB A;  1OLR A;  1N3Q A;  2OT7 A;  2WNV C;  2E31 A;  1DQ0 A;  4K20 A;  1RIR A;  4IDZ A;  1IPS A;  1G8W A;  3AXE A;  5F6K A;  4QKD A;  5BNP C;  4JC1 A;  1JTZ X;  3SH4 A;  4F8A A;  3ACI A;  4FFI A;  1ASJ 2;  3AJZ A;  4TN7 A;  4BQ2 A;  1VAL A;  5C4W C;  3AZY A;  4QM8 A;  2QFE A;  1FMD 2;  2VBD A;  1JOB A;  2VUJ A;  4CDQ C;  3AB0 A;  1SLB A;  1SEF A;  1QJZ A;  4OYU A;  5EP9 A;  4YYO A;  1ND2 A;  3CNA A;  4KWL A;  4BIF A;  2BZD A;  1W06 A;  2QQN A;  1WWY A;  1DIW A;  5JDB A;  3GDB A;  3B9C A;  1EYB A;  1NLQ A;  2Q8D A;  4V1P A;  1GZW B;  5FZ9 A;  4GWM A;  3ZXJ A;  2EAL A;  1ND3 B;  3VLB B;  1GOG A;  1JH5 A;  3BAL A;  5L7O C;  2E26 A;  1UY3 A;  1GZT A;  1IS3 A;  1S4C A;  3NJX A;  4GJY A;  5AFE A;  3VD5 A;  2W39 A;  5L19 A;  4AWD A;  3GF6 A;  4YVW C;  2WRA A;  5FMD A;  4YVS B;  5FMC A;  1JS9 A;  3T1M A;  3I3Q A;  4GZ9 A;  3WD5 A;  2WII B;  4Q29 A;  3NL1 A;  4MHR A;  5FWJ A;  4OMC A;  4BQW A;  1O3S A;  2RVA A;  3WDW A;  1UMH A;  1QY4 A;  2R1B A;  3LA7 A;  2G9Z A;  4XC9 A;  5GAL A;  2UYB A;  1SLC A;  3U78 A;  1C1F A;  3PVB B;  1JYX A;  3RZJ A;  4MO3 M;  1XQN A;  4MGY E;  5EFU A;  3WP4 A;  3THP A;  2Y64 A;  3APB A;  4YLZ A;  5EYX A;  1OH3 A;  3ITQ A;  1T2X A;  2F4L A;  2OQ7 A;  2RDR A;  4PCR A;  4QU1 A;  2EXI A;  1LOC A;  2WIN B;  2C1F A;  3CZJ A;  3OEA A;  5A6Z A;  3LIG A;  4B29 A;  4LOT A;  4UFJ A;  5JMC A;  2TNF A;  1SCS A;  3FLP A;  4KU8 A;  2QQU A;  4B4R A;  3ZYF A;  1J83 A;  2C26 A;  3K77 A;  3QOP A;  4XDO A;  5FZD A;  3ZFE A;  4MGS A;  1REE A;  4QKF A;  4CCN A;  5ANQ A;  1O3Q A;  2FDI A;  2H6B A;  2JIC A;  2AGS A;  1PVC 1;  1V0A A;  3IMN A;  5C9A C;  1X8E A;  3WR0 A;  3VKO A;  1UU5 A;  3WG1 A;  4B3N A;  1DGR A;  4XUQ A;  2BNO A;  2RS1 1;  1GU3 A;  3QD6 A;  3U0Z A;  1C3H A;  1W3X A;  4XF4 A;  4CDU B;  1W0P A;  4MUV A;  3JQX A;  4UW4 A;  3W59 A;  4WM7 A;  4XJA A;  4BQ4 A;  4MG2 A;  1WBF A;  5A3W A;  3R6S A;  2Q8C A;  5LB6 A;  1L7Q A;  2ZGR A;  3VBF A;  5IVV A;  5D21 A;  1XNA A;  4XPV A;  4HK9 A;  3MIH A;  2Y6K A;  2XQR A;  3ELN A;  3RWN A;  4P02 B;  1ZVF A;  2ZGS A;  3THD A;  1FAT A;  1MAC A;  1O8P A;  1O5U A;  4AAX A;  3GZA A;  1REF A;  1VRH 2;  4O65 A;  1UX6 A;  5JXJ A;  1AXZ A;  5DAX A;  3VHN A;  3I54 A;  1WA6 X;  1QGL A;  1GYK A;  1UKR A;  1YUD A;  2BW8 A;  2D6O X;  3AYA A;  1STM A;  4LLF A;  5GZG A;  2WLP A;  1HRI 1;  3H1W A;  2R16 A;  2JIJ A;  1EAH 3;  3SKJ E;  1RUE 1;  4Y1U A;  4JGY C;  4K6B A;  2FCV A;  2PQQ A;  1QH6 A;  3MUZ 1;  4R4Z A;  3I3E A;  4XBL A;  5GZC A;  5BY5 A;  1YIF A;  5FO8 B;  4EZH A;  4Q5O A;  4LO8 A;  1ZBE 3;  2RR1 2;  4NWW A;  2XL9 A;  4EV0 A;  4OLL A;  3G7D A;  2VY0 A;  1XNK A;  4YW4 A;  5J7M A;  1QMJ A;  4MH0 E;  4QX8 A;  3HR9 A;  2RS3 1;  1ZZ7 A;  3MFA A;  4UFM A;  4XE9 A;  1O4Y A;  4LBQ D;  4XZU G;  1W8W A;  5EQU A;  2D3S A;  2VPV A;  5D2A A;  1S0G A;  1YQ2 A;  1B35 A;  1HN1 A;  1WW7 A;  2BNM A;  5I0U A;  1S0J A;  5JR2 A;  2UWC A;  1X8M A;  4J25 A;  1MQT B;  1XYN A;  1ZBA 3;  5C5T A;  2FHR A;  4WVW A;  3ON7 A;  3TEW A;  1N1T A;  1W9T A;  5JOY A;  2ZX1 A;  4AVV A;  1AR6 2;  5A7O A;  1CIW A;  2Y33 A;  1W8N A;  1NCR A;  3DGT A;  1QJY 1;  1NOV A;  2D44 A;  1J3R A;  1US2 A;  3H9A A;  3I2G A;  4GA9 A;  3ZN5 A;  5IVF A;  4XZP A;  4HVO A;  1FI2 A;  5LBC A;  2P2K A;  1GWL A;  1W05 A;  5F37 A;  2LRP A;  4DIN B;  1LOB A;  5E88 A;  3HD8 B;  5HCH A;  1WBL A;  4A4A A;  4YM3 A;  3O1P A;  4Z92 B;  4PHZ A;  3HNM A;  3DXT A;  3DKW A;  4FPO B;  1RHI 3;  1W0N A;  1COV 2;  4PI2 A;  3OJB A;  3ZXL A;  4MGI E;  2NP0 A;  1ND3 C;  2RE9 A;  2V72 A;  3M3E A;  5CFC B;  2WL1 A;  3AKT A;  3RZK A;  2HWD 1;  4FP3 A;  3OGJ A;  5HI0 A;  3I97 A;  3MLK A;  4DUW A;  4KBB A;  4O9E A;  4YVS C;  1WCQ A;  5LBB A;  1CPM A;  3PL0 A;  1H8T A;  3K48 A;  4BQ5 A;  2QDN A;  5IVE A;  3IDA A;  1J1T A;  1NCQ B;  5FRE A;  1IZ3 A;  1XNB A;  2UU8 A;  2JE8 A;  3MHZ A;  4R9B A;  3IPV B;  4UFK A;  3SQO A;  3VL8 A;  5KXB A;  3FZ3 A;  5F3G A;  3ZPY A;  2ZTN A;  4NRQ A;  4Y24 A;  1CAU B;  3B5L B;  2WFF 3;  3LGR A;  2EA7 A;  4L0P A;  2XB6 C;  3BPS A;  5JOX A;  4RHV 2;  5FRA A;  3URF A;  4WVZ A;  4CP1 A;  4GB3 1;  1VB4 A;  2VH9 A;  2FCU A;  3T2P A;  2XG3 A;  1UZZ A;  2NPI A;  2QNK A;  3K4Z A;  2DCZ A;  3Q8A A;  3T2T A;  3VZN A;  3WOG A;  2CL2 A;  3WW1 A;  4PLM A;  1SPP A;  2JB4 A;  4KBZ A;  3SH5 A;  4C1X A;  1UOF A;  2P17 A;  2EID A;  5FUI A;  2DTW A;  3U14 A;  1DGW X;  1PVX A;  4CDU C;  5IVC A;  3WG2 A;  1OI6 A;  4R52 A;  4BWO A;  3POJ A;  2Y6J A;  1H8V A;  2EXJ A;  2VUA A;  1W8Z A;  4C91 A;  4Q8K A;  1YFU A;  2DYC A;  5FUN A;  1A6C A;  1QEX A;  3MID A;  2VOX A;  1MR5 A;  3K4A A;  2F6B A;  1JW6 A;  1Q56 A;  1OUX A;  4TSV A;  1W9Y A;  1AR7 3;  1BJQ A;  5AC9 3;  5GLW A;  5L36 A;  1LNS A;  2HWB 1;  4ZY9 A;  1I5P A;  5APA A;  4BIO A;  1A34 A;  3S7E A;  1SG3 A;  5CBL A;  5F7U A;  1W2U A;  2VMD A;  4Y1X A;  4N53 A;  3U07 A;  4AVB A;  1H6Y A;  2OII A;  5LCW L;  4LBM A;  1LRH A;  1V70 A;  5BNO A;  2ZGO A;  4YZ2 A;  1UKG A;  4AAP A;  1CIY A;  5F9T A;  4I0B A;  3S5A A;  1LHU A;  2XBO 1;  4LBQ B;  1Y7B A;  5C8C B;  2BGP A;  2BGO A;  4Y22 A;  4BXS V;  2MEV 2;  1V00 A;  4Y26 A;  2C5D A;  3VBO A;  3PLQ A;  4Q4X 2;  1YC6 1;  3VBS A;  1XXN A;  3VBU B;  1D0G A;  2VMF A;  2WNU A;  2ZX3 A;  3AYC A;  4MV2 A;  4OUL A;  1RMU 3;  1AYM 3;  3NV1 A;  3UJQ A;  3WCS A;  3ABZ A;  4DQA A;  1MQT C;  2ADE A;  2DU1 A;  5FUP A;  4XTP A;  2E7T A;  3ZPO A;  2WC2 A;  3GNE A;  4YWA A;  4ARX A;  4QQO A;  3RNS A;  3RFR A;  5GLV A;  3U75 A;  3IIA A;  1CJD A;  1Q3E A;  3HVD A;  1J84 A;  3OBT A;  3MIB A;  4KNC A;  1SLI A;  4XFB A;  4QX0 A;  2LUW A;  3B3Q E;  1HB4 A;  2XR4 A;  1KFU L;  1CAV A;  2QQJ A;  4QX7 A;  1IS6 A;  4LJH A;  1DGR N;  5I0D A;  2VZ3 A;  2WSV A;  1BYH A;  1L3J A;  1WKY A;  2TEP A;  1XPW A;  2CSG A;  3M3C A;  4YGE A;  4W65 A;  1LEN A;  4QPI A;  1TEI A;  2WNO A;  5CFC C;  4P9J A;  5SV5 A;  1RUD 1;  1D4M 2;  2RS5 2;  2Y6G A;  5FLH A;  5C3S A;  3LFI A;  5A3O A;  4D0Q A;  3LCP A;  2A3X A;  4V2W A;  3QLQ A;  1HRV 2;  1LEM A;  3EMR A;  1U5Y A;  4FFH A;  4WVM B;  3ZOI A;  3WW4 A;  1W8O A;  4IV1 A;  5FZB A;  2D6L X;  1NCQ C;  1RUI 1;  2VM9 A;  1UY4 A;  2HWE 3;  1BVV A;  4Q4Y 2;  2VG9 A;  3HBK A;  1DP0 A;  3J26 N;  3ALQ A;  1UU4 A;  2JEM A;  3H0O A;  2VVD A;  2QQM A;  4CP9 A;  2GME A;  2LM3 A;  4PDW A;  4XXP A;  5FZ7 A;  3S30 A;  4RFT 0;  4LMF A;  2GP5 A;  4A45 A;  4DEQ A;  5A6X A;  3ZFG B;  2W1W A;  3AVS A;  4XQD A;  4B4P A;  2VD7 A;  3OGG A;  4AW7 A;  2ZZQ A;  4FTB A;  1H2N A;  1LHV A;  1SDW A;  1VAV A;  2DDU A;  2K2S A;  2LS6 A;  2VBP A;  2V5D A;  3JU9 A;  4XF0 A;  4WM8 B;  1AR8 3;  3I3B A;  2VZ1 A;  3NNM A;  3WF0 A;  2XON A;  1O7F A;  1XSQ A;  5I0S A;  3OYW A;  1OLM A;  3NNL A;  2E63 A;  1VRB A;  1I5Z A;  2GC1 A;  3H50 A;  3LF7 A;  3MV1 1;  1OSG A;  4MGK E;  3AX4 A;  5EJZ B;  3WHU A;  2Z42 A;  1RUF 2;  2BUK A;  4EN8 B;  2DCK A;  1JZ3 A;  1AYN 3;  1YRZ A;  2BQP A;  2VW1 A;  3B00 A;  3R4D B;  3OY8 B;  4KWK A;  5JUV A;  3E1F 1;  1BCX A;  1PZ8 A;  4LPL A;  4LOS A;  3ZYH A;  5FYI A;  1YEW A;  1KDK A;  2RM2 3;  1A8M A;  1XBF A;  3JUU A;  4HKO A;  5DZG A;  1V9U 3;  4GQ7 A;  4GMP 1;  3GJA A;  3B94 A;  4FPC A;  4AVA A;  4I09 A;  1H1M A;  2GAL A;  1H2K A;  2CU5 A;  2E32 A;  2SLI A;  2QCS B;  1S2E A;  4QXB A;  1YYN A;  4QX3 A;  1PVC 2;  1Q8V A;  2H0B A;  4YFZ A;  2JDY A;  3EBR A;  4ERO A;  1LU1 A;  1KFX L;  5KR7 A;  1H30 A;  1VBE 1;  3AYD A;  3KVB A;  1BBT 3;  3BOP A;  4UF0 B;  3ZFF B;  3NJV A;  5LY1 A;  2ZMK A;  2ZPX A;  2CNA A;  1GMM A;  5C8C C;  2YRO A;  3FC0 A;  2B8M A;  2IXC A;  3O0X A;  4W8J A;  1JHN A;  1PMH X;  5FPB A;  3K75 B;  2ZHK A;  2P4E A;  4Z82 A;  2FBE A;  2ZHL A;  5FQ0 B;  3VBU C;  4G3Y C;  3SXW A;  5ANN A;  1CON A;  3ZYG A;  2HWF 2;  2NN8 A;  5CZK A;  1CX4 A;  2RDS A;  5DMY A;  3ES4 A;  5HV4 A;  5BPX A;  1JOJ A;  4CUG A;  1HB3 A;  1ASJ 1;  3INA A;  3KF5 A;  1K12 A;  3FJS A;  1HQW A;  5DAQ A;  4CPB A;  2D40 A;  3E5U A;  1JZ5 A;  1WMF A;  3ZXK A;  4Y1Z A;  1FMD 1;  2YDE A;  2WBK A;  2OW4 A;  2PQS A;  4LBN A;  1NA1 A;  2ZAA A;  2WZR 3;  1YLL A;  3KF3 A;  4DY5 A;  1C5H A;  2WQ8 A;  2PHW A;  1EPW A;  4LBJ A;  4XAA A;  2V4A A;  5M0T A;  5FY4 A;  1ENS A;  3E5Q A;  5AFB A;  4LE3 A;  2QQW A;  3K46 A;  3LOI A;  5JIU A;  4NN0 A;  3ASI A;  3A22 A;  3JXS A;  1N47 A;  2PHD A;  3QH7 A;  4BIS A;  4UYB A;  1LGB A;  3Q8C A;  2XML A;  1UOB A;  3OCP A;  2JB8 A;  3CL1 A;  4XAE A;  1CZT A;  1LJ7 A;  4HG6 B;  3V0A A;  3AMN A;  4YZ5 A;  4KG0 A;  2X8K A;  4NRM A;  3BUC A;  1EY2 A;  5FFO C;  1K45 A;  4Y33 A;  5EHD A;  4DNY A;  2E33 A;  3H3L A;  2ZOE B;  2D6M A;  1PK6 B;  3ZXF A;  1OHF A;  1W90 A;  2D93 A;  5C33 A;  5AVA A;  3CJI A;  4AE2 A;  2Y0I A;  1DZT A;  3ZFG C;  4QQL A;  3TNQ A;  2VZR A;  3T2Q A;  5E1R A;  5HPO A;  1Q8Q A;  3MIC A;  4LBK A;  4ZU4 A;  1PX4 A;  4QWN A;  1U5Z A;  4WM8 C;  2OZJ A;  2W46 A;  4LHN A;  4URT A;  4GWI A;  3FUO A;  3MW4 A;  2YPJ A;  3J8F 2;  4XQ4 A;  4BK4 A;  2HYK A;  4XIL A;  4OUM A;  5FYB A;  2B9U A;  4FQ4 A;  2WDB A;  4LE4 A;  1QOT A;  3OUJ A;  4EQV A;  4CEW A;  3I2O A;  4NIH A;  2Y38 A;  3ZO0 B;  4GH4 A;  4N7I A;  5ERL A;  1SFP A;  1YQ5 A;  3M3O A;  1ZBE 2;  1ONA A;  1US3 A;  4NHM A;  1XU2 A;  1SDD B;  1VRH 1;  5JPN B;  5CU1 A;  4OQ9 A;  3JCI A;  5FPZ A;  3CZU A;  2O1Q A;  2GU9 A;  2XJV A;  2CDP A;  4FO9 A;  2ARX A;  2BRT A;  4FVV A;  2LRO A;  4XTM A;  1PO1 1;  2R04 3;  2UWB A;  3KB5 A;  4N43 A;  5CNA A;  3VDC A;  1IKP A;  5GM0 A;  4BB3 A;  4YG6 A;  4Y3O A;  1ZA4 A;  1ZBA 2;  1DBN A;  2JD4 A;  1Y9M A;  4CDW A;  5B4N A;  5F1R A;  5IAV A;  2VZS A;  4AF9 A;  1OT5 A;  4KL1 A;  4FPE A;  4YW3 A;  3TN9 2;  2RR1 1;  1YQC A;  3FX3 A;  1D2Q A;  3J7H A;  4H55 A;  3RPQ A;  2X53 S;  3E5X A;  1AXK A;  4EE2 A;  4AVT A;  1MZF A;  3BIE A;  1QJX 3;  3N9Q A;  3NKT A;  3ZKY A;  3ZFF C;  4D3W A;  4QX2 A;  4CUA A;  1N1V A;  1ENQ A;  1IS5 A;  4E4Z A;  4EN0 A;  1W6N A;  2BPA 2;  2YXS A;  3N35 A;  2A6X A;  5BNN A;  3BCW A;  2Q1Z B;  3J7L A;  5HCB A;  1TNR A;  5EZW A;  1AR6 1;  1RUH 3;  2FCT A;  3POW A;  4XBQ A;  4AQS A;  3ZDS A;  2EVX A;  3TYJ A;  5LRS A;  4FOV A;  3C7O A;  1MPX A;  5F5C A;  2ES3 A;  2G9G A;  5FLI A;  3WX5 A;  2VR4 A;  5CEH A;  5FZI A;  1UNB A;  4Q0P A;  4M0H A;  1BXH A;  3G6J B;  4XJ9 A;  5FXV A;  1C8M 3;  1GUI A;  2VAU A;  1N3P A;  2IFW A;  3IT8 A;  4K1Y A;  3V0B B;  3ZXG A;  3O1S A;  5KHK A;  2R30 A;  1GKB A;  2JEC A;  4WZC A;  1RUC 2;  1COV 1;  4I3P A;  3VBH A;  2XLA A;  3KZ4 C;  4AEM A;  3LEM A;  1VBC 3;  4CP0 A;  3WVJ A;  5C70 A;  1AF9 A;  1OUR A;  1UYP A;  4EWE A;  3GJB A;  4OHW A;  1HN0 A;  5DAV A;  3ZYJ B;  2R07 3;  4JGZ A;  4N7U A;  2P37 A;  2R32 A;  4XBN A;  1F4A A;  3WW3 A;  2X10 A;  1W8U A;  5CG8 A;  4MX3 A;  1DZR A;  4EJR A;  3WSO A;  2WT2 A;  2JG8 B;  5CFD A;  1V6I A;  3RS6 A;  1XNC A;  1Q8O A;  1RIN A;  4AK3 A;  1CES A;  1KS5 A;  1X33 A;  5EIY B;  1JOP A;  5FJK A;  4GXL A;  2GAU A;  5ACA 2;  4DEV A;  4PBO A;  1LHW A;  3DV8 A;  3KV4 A;  3EXU A;  4K8R B;  2XH6 A;  4BK5 A;  2DF7 A;  4NPM A;  4O7X A;  3FBY A;  3D0S A;  1RXG A;  1OOP B;  1DQ2 A;  2UYA A;  1PK6 C;  2GMM A;  4RHV 1;  2GC3 A;  1DLC A;  1JU4 A;  1VMF A;  5D8A B;  1BMV 2;  3PHM A;  1RVF 3;  4NAM A;  5DDJ 2;  3M3I A;  4CXW A;  3ZXE A;  2BFU S;  1GQG A;  3ES1 A;  5C3Q A;  4JRA A;  3WDU A;  5E16 A;  1MS4 A;  4AG4 A;  3JD7 3;  4AED A;  3D82 A;  1AR7 2;  2PLV 3;  4Q2F A;  3DYO A;  2CYF A;  3O0W A;  4DO0 A;  4XHX A;  3E6B A;  1WMX A;  3IDE A;  2QUO A;  2X09 A;  3HBZ A;  4TLF A;  5BNP A;  3GHM A;  4ZKT B;  4CEY B;  3B93 A;  1D2S A;  3A0K A;  4RL7 A;  4H3W A;  5F3E A;  5C71 A;  3Q8E A;  4CDQ A;  1ODM A;  2OS2 A;  3N9M A;  2ET1 A;  3ZLI A;  1ZRE A;  1VBB 3;  3HQU A;  2EIC A;  5H9P A;  2HBT A;  3WDX A;  4HT1 T;  4IGP A;  5ABJ A;  2BJS A;  3KT7 A;  4IND A;  2ORZ A;  4XUN A;  4BU2 A;  1W04 A;  3VDD A;  1ZA7 A;  4LHS A;  5LBF A;  1UCX A;  5L7O A;  3I59 A;  4I3G A;  3ZIX A;  4RS5 B;  3BU0 A;  3ROU A;  1AYM 2;  2DFC A;  5FMO L;  3UGH A;  1HIX A;  1QJU 3;  5GLT A;  2JWP A;  4EWA A;  2VVF A;  3ZSM A;  4H7M A;  1NY7 2;  2BVB A;  4LIT A;  2G19 A;  2XJR A;  4GMP 0;  5JMO A;  2VU9 A;  2J1A A;  4AR2 A;  1UD1 A;  3PJQ A;  2ET7 A;  5A7N A;  1FOD 3;  4NID A;  2MEV 1;  4M0N A;  1VP6 A;  3AP7 A;  4FFG A;  3C2U A;  4Q4X 1;  3GZT B;  4R9A A;  5DZE A;  3POB A;  2PTM A;  2Q8O A;  1O5L A;  2JDH A;  4L99 A;  4Q1R A;  1IHM A;  4XXA A;  2N7G A;  3B02 A;  3RYR A;  5FO9 B;  1LGC A;  4TZD A;  5AVP A;  1SLT A;  1HDK A;  3O7O A;  3DUI A;  4IL7 A;  1ZZB A;  5SV8 A;  2HYX A;  3NQH A;  4QPG A;  4AGR A;  4LO5 B;  2W1S A;  1CD3 G;  4CE8 A;  1F8V A;  3UKV A;  3M4F A;  4XUT A;  5CVR A;  3NJY A;  4CCJ A;  2GMP A;  4BHP A;  1KDM A;  2K0G A;  2OQ6 A;  5C9A A;  2OPW A;  4IV3 B;  4LBO A;  1OD3 A;  2VUD A;  4AGV A;  2ID4 A;  4OUE A;  4COW A;  2D6N A;  2QQO A;  2WN2 A;  1R1A 3;  4L97 A;  1R08 2;  2UWA A;  2HWE 2;  3C7H A;  4ATE A;  4Q0S A;  5K0U B;  1OA2 A;  2ZGU A;  2Q1M A;  2W08 A;  4M3C A;  3KD4 A;  1FX5 A;  3NV2 A;  4LNV A;  4Y4R A;  1D4M 1;  2JD9 A;  1HXS 2;  2RS5 1;  1QHD A;  3LKJ A;  4XJW A;  1JN2 P;  1CQ9 A;  2MHF A;  3N36 A;  5CKN A;  1HQL A;  1NXD 1;  2UY9 A;  2XGX A;  3M7A A;  2C9K A;  4HZF A;  1HRV 1;  3IB3 A;  4PJY A;  3E6C C;  2FQP A;  2VQU A;  1XND A;  3DYM A;  1UZW A;  1GAN A;  3MLL A;  4HK8 A;  2JG8 C;  2D3P A;  1JUH A;  1M06 G;  4LK7 A;  1W6Q B;  1AR8 2;  4Q4Y 1;  5GZE A;  3UES A;  4HKL A;  2QE3 A;  4JGY A;  2Q0A A;  1UU6 A;  3JQW A;  4EN7 B;  4FOQ A;  2Z2S B;  1RUG 3;  1W6P B;  1ENX A;  3A7Q A;  5FBZ A;  1YJK A;  2R1D A;  1URX A;  2W1U A;  1OOP C;  3AP5 A;  1SCR A;  4OQ8 A;  4R9C A;  3VBR B;  3HWJ A;  4NRO A;  5D8A C;  4CU6 A;  2D5H A;  3H1M A;  4FPF A;  1K42 A;  4FPJ A;  2JIG A;  4YG3 A;  1O6U A;  3H7J A;  4KG8 A;  4AEJ A;  4JQT A;  4NPL A;  1F31 A;  2PYT A;  2RS1 3;  5FXW A;  1AR9 3;  4N90 A;  1UXZ A;  2XVK A;  4IEX A;  2RM2 2;  4FTS A;  3ZSE A;  5FZ3 A;  3S7I A;  2SBA A;  1W6O A;  4XET A;  4N9H A;  1LOF C;  5GZD A;  5LZ6 A;  5C6C A;  3MDP A;  4CEY C;  2IXK A;  1Y3T A;  1RUF 1;  4FXK B;  3T2O A;  1S0D A;  2ZBJ A;  3KVA A;  3O0V A;  5FPL A;  4HOO A;  3AZW A;  1H0B A;  4NMI A;  3OF1 A;  4ZON A;  5F5Q A;  3ZFE B;  1V6O A;  4AHZ A;  1G9B A;  1BBT 2;  4DZG A;  4Z8B A;  4NHY A;  2WR9 A;  1A3K A;  2J1E A;  4R8H A;  5FK7 A;  1JZ2 A;  3VD4 A;  1GZW A;  1ZRR A;  3OB8 A;  1QH7 A;  3IMM A;  1QXP A;  1ND3 A;  2DTY A;  4BXF A;  1HRI 3;  4GKY A;  1V6K A;  2K46 A;  5DAB A;  3TRS B;  4RS5 C;  2ILM A;  3UJO A;  1UOG A;  4TYS A;  4K9S A;  4YVS A;  4YW1 A;  5F3C A;  3VBF B;  4CXY A;  1KXG A;  3MEP A;  1POV 1;  1J59 A;  2JEN A;  1Y4W A;  4HON A;  2HWC 2;  1BK0 A;  2RS3 3;  3I7D A;  4UFH A;  5FPV A;  2QJV A;  5JZG B;  2I2S A;  2WZR 2;  3EYP A;  2JDU A;  4A44 A;  5CKQ A;  1UF2 C;  2DCT A;  2HWF 1;  1BLZ A;  3VZL A;  4XFF A;  2F4P A;  2EIG A;  3CDZ B;  3CLP A;  3ZSK A;  3KT4 A;  5DN2 A;  5H9S A;  5FKB A;  2ZGT A;  5FYV A;  1QJY 3;  1I1E A;  5LA0 A;  3KCC A;  1Y9Q A;  3N9L A;  2XKO A;  1PO1 2;  1UW8 A;  3AVR A;  5FZC A;  3RI8 A;  3GZU C;  2R6Q A;  4PQ9 A;  1YQ6 A;  4E2S A;  5T52 A;  1ZZ8 A;  3E6D A;  3R05 A;  2WKK A;  4RGK A;  4XDP A;  1NYW A;  5IK4 A;  2ADD A;  1LEC A;  2JDN A;  4IV3 C;  2WZ8 A;  1UZ0 A;  4RA0 A;  3T09 A;  4E8D A;  5IK8 A;  1Y43 B;  5K0U C;  2HBU A;  1Y9G A;  2HWD 3;  3USU B;  4FCA A;  3VV1 A;  4ORF A;  2XVG A;  2CAU A;  4YZ4 A;  2I07 B;  4BME A;  3AP9 A;  5A33 B;  3OBR A;  2AR6 A;  3MGU A;  2K9Z A;  5KWR A;  3U37 A;  3H8R A;  2VZP A;  5GKA C;  1ZNP A;  2J1S A;  3MI8 A;  2G9F A;  3POG A;  3T0B A;  4HKW A;  3I3M A;  5CG9 A;  2A6Z A;  1UYZ A;  3CBN A;  3VKN A;  4ISQ A;  2B45 X;  2XKP A;  1IPJ A;  3A0N A;  4OI0 A;  2B5H A;  3DF0 A;  4MGZ E;  3B7M A;  4MVT A;  3I3D A;  1TME 2;  5FJH A;  1FPN 2;  3VBR C;  4JKL A;  2BBA A;  2DVF A;  4GB3 3;  4P08 A;  2BEO A;  1QNW A;  2PN5 A;  2VMI A;  3NAP A;  3RMX A;  2W68 A;  2HLE A;  4IGO A;  1H8T B;  5F8P A;  3IM0 A;  3PU8 A;  1QXJ A;  3X29 B;  2XDV A;  3KHB A;  5JOW A;  3O1M A;  2R04 2;  3J8F 1;  2O14 A;  4TWT A;  4BLJ A;  1JZ6 A;  3FHA A;  4BLI A;  3SCH A;  2J1T A;  4ATF A;  2GNB A;  1WA4 A;  3IAP A;  1Q8P A;  3SMH A;  2GND A;  4MLO A;  2CV6 A;  1ZBE 1;  2QQV A;  1U0A A;  1UL9 A;  3BTX A;  2IC1 A;  1PO2 3;  4JDO A;  3ZMN A;  4XFG A;  1UPI A;  4CCM A;  1EV1 3;  2VNG A;  1PMJ X;  3OPZ A;  2P34 A;  3ZFE C;  1QJX 2;  3TEX A;  5FK8 A;  4CUC A;  3WG3 A;  2ZGM A;  4XMA A;  1RUN A;  3H3U A;  1G9F A;  1ZBA 1;  5FYH A;  5CFC A;  2VBB A;  4HVQ A;  1RUH 2;  4JZR A;  3OGR A;  3T4H B;  1X9T A;  2B4K A;  2PA7 A;  3TN9 1;  2WNE A;  5A6Q A;  1IQD C;  2CAV A;  3VHO A;  4BYY A;  3VBF C;  1QIQ A;  4DRR A;  2YG0 A;  2F17 A;  1GNY A;  2P1B A;  1VBA 2;  4HLT A;  5C3R A;  3NMB A;  5JZG C;  2VCM A;  3LSD A;  5JLV A;  2Y0O A;  3LAG A;  5IK7 A;  4BE3 A;  1OLQ A;  1RJ8 A;  1JOD A;  3IPV A;  5FZO B;  5LY2 A;  4EWD A;  4P9Y A;  3M8L A;  2PAE A;  2XJQ A;  4ZZ8 A;  5FYM A;  5HXM A;  1XNT A;  5EV7 A;  1C4R A;  1OPO A;  4Q1P A;  1JMU B;  5DG2 A;  1CAU A;  3NJZ A;  1K3I A;  5BV6 A;  5KC5 A;  1VBC 2;  4MHU A;  4QDR A;  2A3W A;  4W6W A;  1I6X A;  1TMF 3;  2XUM A;  1J3Q A;  2OVU A;  1R09 3;  3H3Z A;  3NV3 A;  4A42 A;  3H8O A;  1JXN A;  4RR3 A;  5FMO S;  4CDX A;  1VIW B;  4MXW B;  5FYU A;  1YFW A;  3GCW A;  3ECQ A;  2ARA A;  2JKB A;  5F39 A;  5A3N A;  5K7P A;  4IE6 A;  4Q4W 2;  4Y22 B;  5DXD A;  1GQP A;  3VBO B;  1UPS A;  2WQ4 A;  1RUC 1;  1CGP A;  3LD8 A;  3LDB A;  3LDR A;  4IXL A;  2WNU B;  4XAC A;  1L7R A;  4QDQ A;  4BA6 A;  2WAA A;  1RUD 3;  2ZML A;  3PUA A;  4L2N A;  4CCE A;  1LOD A;  3P6B A;  2W94 A;  4LIU A;  4MOA A;  2OKX A;  5JSR A;  2GSY A;  5A80 A;  5T5J A;  4FPK A;  3TNP B;  4DUV A;  1RVF 2;  1EUT A;  4CPB D;  5J98 B;  2YB7 A;  4YSF A;  3KS7 A;  1AL2 3;  3OUH A;  3BOD A;  5EJ3 A;  3SH3 A;  5ACA 1;  1RUI 3;  3JD7 2;  5DUU A;  2E7A A;  2DVG A;  2PLV 2;  4QGM A;  3AMM A;  3ZIW A;  4QU2 A;  1U12 A;  1VB2 A;  3QAC A;  4IEZ A;  5FOB B;  1OMI A;  2YBK A;  4PQQ A;  2PFW A;  1UWW A;  2A7A A;  4AI2 A;  3DYP A;  1BMV 1;  5EYY A;  4QPI B;  4UW6 A;  3T1L A;  4AHY A;  4FAG A;  2XLF A;  4LBQ A;  1AJK A;  4Q4V 3;  5DDJ 1;  4JKM A;  4D7S A;  3DL3 A;  5FBJ A;  4DFS A;  5C8C A;  1ZRI A;  2WWU A;  1VBB 2;  2VNV A;  2ZEW A;  4QPY A;  3OUI A;  2RMU 3;  1E5S A;  1AR7 1;  4IGQ A;  3HNB M;  1H8T C;  4UBH A;  4LKS A;  3GBF A;  4IV1 B;  4MYE A;  4E9K A;  3SNM A;  3KHC A;  3OPT A;  1PIV 3;  3P3N A;  4MAD A;  2W95 A;  5TSW A;  2WO1 A;  5BUV A;  1QJU 2;  1JYV A;  4PDW B;  2WLQ A;  1NE4 A;  5LW9 A;  1AZD A;  1OD5 A;  3THT A;  1OPM A;  3KLS A;  5LA2 A;  4COY A;  5FXX A;  1DG6 A;  3WNK A;  4A7K A;  1JYW A;  1AUY A;  1YQ8 A;  4FPG A;  4ZZ5 A;  4XMI A;  1AVB A;  3HMY A;  3NNJ A;  2GZW A;  4YGB A;  2O0O A;  5FPA A;  1HV0 A;  3IN9 A;  3WNM A;  4GMP 3;  3P3P A;  1AYM 1;  1OA4 A;  1UY0 A;  2GN7 A;  3ZYI B;  3OYW B;  1GNZ A;  4TLG A;  1S1A A;  4NHK A;  3AKR A;  3UNP A;  1NY7 1;  4QKN A;  2G1M A;  4GWN A;  1O8S A;  2EF6 A;  3F95 A;  3T0D A;  3TEZ A;  2QQL A;  3HT1 A;  3WT3 A;  4M01 A;  1VBE 3;  2MPF A;  4ASM B;  4ES8 A;  4JDM A;  2VNR A;  3ILF A;  4WVM A;  5DZF A;  2V73 A;  1OVS A;  1KS4 A;  4SLI A;  1POV 0;  1T6B X;  4RQP B;  4DPN A;  4JQR A;  4K1Z A;  4I2O A;  1GR3 A;  1BEV 2;  1CZV A;  1R1A 2;  1Q43 A;  1VE0 A;  2VME A;  3KWV A;  5DPN A;  3WNL A;  4A3Z A;  3UYJ A;  1CJP A;  1G86 A;  4A3X A;  1CPN A;  2AAC A;  3L9J T;  2H0V A;  3S5Q A;  1OF3 A;  5D1I A;  3ZFG A;  4YPJ A;  2EXH A;  4LEJ A;  2A71 A;  4OVE A;  1OKQ A;  1TQ5 A;  1G9D A;  1J1L A;  1UXX X;  4UAP A;  3VL9 A;  4ARY A;  2XJP A;  4A41 A;  4U2A A;  4UBG A;  1H1A A;  3CJX A;  2J1V A;  2ZKN A;  3DCQ A;  2XJT A;  4KWJ A;  4XOG A;  3TOJ A;  3IZO A;  1HX6 A;  4I0A A;  2ZMN A;  3PJY A;  4LKF A;  2B46 X;  4LQR A;  4AFD A;  3LEK A;  4KMQ A;  4OFG A;  2A1X A;  4K3U A;  4JTN A;  5I0R A;  4B4Q A;  1NQD A;  3ACH A;  4N8M A;  3VBO C;  1R08 1;  2HWE 1;  1TZO A;  5B2G B;  4YGC A;  3MF9 A;  5CA6 A;  3IDB B;  2WNU C;  5FO7 B;  2GDF A;  1QKQ A;  1ZRF A;  2CY6 A;  4GAL A;  2ZAH A;  1RUG 2;  3RYP A;  3WZ1 A;  2X5I B;  1HXS 1;  3AMQ A;  1WD4 A;  5CAZ A;  3HQR A;  1OA3 A;  2WN3 A;  2JJ6 A;  3OY8 A;  1H4G A;  2ARB A;  1F2N A;  1VLN A;  3PMS A;  3I2D A;  4CXX A;  4DUX A;  3WP6 A;  3WG4 A;  2P3J A;  1NA1 B;  4QHO A;  2ZGQ A;  1A78 A;  2WO3 A;  3ZM8 A;  1S2B A;  1AR8 1;  3MPB A;  3PTY A;  5IUQ A;  3AXD A;  4LTA A;  1AR9 2;  4M4P A;  4RFR B;  5A3M A;  5FZE A;  5KHH A;  1O4Z A;  1WLD A;  2J22 A;  1DGW A;  2A6V A;  4AFA A;  1ODN A;  2IVJ A;  3DPR A;  5EJ1 B;  1QJE A;  3MUY 1;  4Y4Y A;  3WQ1 A;  3MZH A;  4O9G A;  4QPI C;  3M70 A;  3U4S A;  4COV A;  1IGO A;  2KR2 A;  5IFP A;  3ZFF A;  5JPM B;  1RB8 G;  2Y26 A;  4ZS2 A;  3OG2 A;  4C0H A;  2YV8 A;  1RUJ 3;  4SBV A;  3V0A B;  2WS9 3;  2VEC A;  1PGL 2;  2A75 A;  3AMP A;  3PDQ A;  2OXB A;  5J36 A;  1NAE A;  4F7Z A;  2ARE A;  4QQ2 A;  2RM2 1;  4H7L A;  4IV1 C;  2CGO A;  3ZX7 A;  3LEG A;  1K5M B;  3I2H A;  2FZ2 A;  2GH2 A;  2LAL A;  5JAX A;  3RZM A;  3T08 A;  1LUL A;  5B4X A;  4ZPI A;  3HEI A;  1EPZ A;  4K21 A;  5FYT A;  4DXZ A;  3BVC A;  3VN4 A;  4YW7 A;  4PDW C;  1Z0H A;  2DVB A;  2R06 3;  3PIJ A;  3RYK A;  3CMG A;  5J1X A;  3PUS A;  3K4D A;  5FWE A;  2DWR A;  4Z2A A;  1GQH A;  1AJO A;  1LAJ A;  4UT5 A;  3QCW A;  1BBT 1;  2OA2 A;  1CAX B;  3I4I A;  2Q8E A;  4Y5Z 0;  4AYU A;  2FDF A;  3M1H A;  1KEX A;  1CVN A;  2A6W A;  1UAI A;  3AJY A;  3LB9 A;  2PHR A;  4IW3 A;  4QDS A;  1DF0 A;  1PHM A;  1RGS A;  3WLU A;  2IXL A;  2W2I A;  4Q27 A;  4Z1V A;  4ZXE A;  3O1U A;  3ACL A;  2J42 A;  1OC1 A;  1VPH A;  2HWC 1;  4ZXK A;  2BGC A;  3U1X A;  3NRU A;  3FE5 A;  1HLC A;  1WGP A;  2WZR 1;  2EAK A;  1EAH 2;  4XCB A;  2WAO A;  2W47 A;  5FPU A;  2WUH A;  2RDQ A;  2KM2 A;  5FPX A;  5IWF A;  4RQP C;  4XJU A;  3SIS A;  2CTV A;  2XPJ A;  2A73 B;  3W5N A;  1AR6 3;  1NT0 A;  4WBB A;  3HAG A;  1MZE A;  5L9B A;  5J09 A;  1OFN A;  2QQI A;  4L9B A;  3O1V A;  4H2A A;  2RG4 A;  2UUR A;  5HBA A;  1GZC A;  2W1Q A;  2PHF A;  4JKK A;  3R4U A;  3NVC A;  5FZ8 A;  3WQ7 A;  1NLR A;  3ACF A;  3WY6 A;  5FP3 A;  3DXU A;  1DDL A;  3RJ2 X;  3SIT A;  1SFY A;  5J3U A;  4P5H A;  1W6N B;  3D5O A;  4NJ4 A;  1SLA A;  4PIZ A;  1S0C A;  5T3N A;  1T6G C;  3HNY M;  3VKL A;  3ZN6 A;  5BNN B;  1LB2 A;  5K4L A;  3EQE A;  3LA2 A;  4LOR A;  4NIA A;  4EYU A;  4A7Y A;  3KV6 A;  4YM0 A;  1YIP A;  3ETP A;  1OXC A;  3KCX A;  1JHJ A;  4IER A;  4MSV A;  3PME A;  2X5I C;  5A3U A;  1R1Z A;  2EIE A;  2HEV F;  2Y34 A;  3MIE A;  4KQ7 A;  4XYX A;  3A23 A;  4D69 A;  1RHI 2;  4QX1 A;  5H9R A;  2IXJ A;  1W3V A;  4FI9 A;  1PGW 2;  1SAC A;  2BU9 A;  1J58 A;  1NA1 C;  3W5M A;  2VZQ A;  1HB1 A;  5JR7 B;  4YM2 A;  5I8T A;  5FLJ A;  1W6M B;  3LA3 A;  5FZ0 A;  1VBD 3;  2TBV A;  5A6Y A;  1MS5 A;  4W6Y A;  1S55 A;  2X05 A;  2JXA A;  3RSJ A;  4RHV 3;  3A21 A;  2QZ2 A;  5DUX A;  5FIX A;  1TME 1;  3A4U A;  1FPN 1;  2VQ0 A;  1U5X A;  1RUO A;  3OD4 A;  5BXX A;  4QMA A;  3P5B A;  4DIQ A;  1AX0 A;  1PO2 2;  4E4S A;  3AP6 A;  4X8N A;  1EV1 2;  2HEY F;  1UYX A;  5CFD B;  3R4S A;  5FR3 A;  5LBE A;  1SBE A;  2WFF 2;  3ZYB A;  1NZI A;  1KJR A;  1KD7 A;  2YFZ A;  2E53 A;  5LAT A;  5A3L A;  2R04 1;  3HOB A;  3C7E A;  4BM8 A;  1WW6 A;  2P3I A;  2ZGL A;  3AYE A;  3I8T A;  4C1W A;  2CWS A;  3ZMO A;  3IKW A;  3I2J A;  3FBM A;  1K5M C;  4OHY A;  2W0X A;  4QQH A;  5A7W B;  3UL2 A;  1LGN A;  1WD3 A;  1XE0 A;  2D5F A;  2J1U A;  3PUQ A;  4LR4 A;  3ATG A;  1OF4 A;  1MEC 3;  2VJX A;  4IEO A;  3M2M A;  4AI0 A;  3T0A A;  4XQW A;  2C24 A;  4LBL A;  2D3R A;  4KWU A;  1QJX 1;  5DUW A;  1WLW A;  2W87 A;  2C4X A;  2VZO A;  2YZ4 A;  3AP4 A;  3JB8 A;  3P1I A;  3B01 A;  3PIG A;  5C5U A;  3V0B A;  3LPF A;  3WP5 A;  3DN7 A;  2B39 A;  3OGS A;  4AED B;  5E89 A;  5FZH A;  3GZE A;  4Q8L A;  2VXJ A;  1UO9 A;  4IEQ A;  4P9I A;  4XFI A;  3KQR A;  2C9A A;  5KXE A;  1RUH 1;  3N4M A;  2D97 A;  1X82 A;  4BOW A;  3WP3 A;  3NST A;  3LFM A;  1OQD A;  2WNV A;  4HET A;  5AC9 2;  1HJF A;  3OOX A;  4Y20 A;  5JVV A;  1TMF 2;  2Z79 A;  2JG9 B;  1R09 2;  1CX1 A;  4Z2W A;  1X36 A;  1VBA 1;  1ZM1 A;  2MEV 3;  3OTF A;  4XFH A;  3UV9 A;  3WHT A;  5C3O A;  2JDA A;  2P5B A;  5C4W A;  5A1A A;  5FV3 A;  1AX2 A;  5ABJ B;  1S0E A;  4BPZ A;  1NKG A;  1WCD J;  2GP3 A;  3VDD B;  4JDN A;  1W2T A;  2NZ9 A;  4LLO A;  4D8M A;  1IS4 A;  2VTX A;  3H1Y A;  3ILR A;  4GUL A;  4WVV A;  1MVQ A;  5EPA A;  5FY8 A;  3WQB A;  1VBC 1;  3V64 A;  2ZGK A;  3VD7 A;  1NQJ A;  5D8A A;  4GKX A;  5JIA A;  3SLI A;  1JYT A;  3JBG 3;  4XVH A;  5LWB A;  4E2Q A;  2VQT A;  4ET7 A;  4C0B A;  4WZF A;  4J1W A;  4CCL A;  3AZV A;  2FDK A;  1RMU 2;  2VOT A;  1AHS A;  3VDB A;  4YVW A;  2HH9 A;  4XFC A;  1KIT A;  4Q4W 1;  1JZ8 A;  3WEZ A;  5EXO A;  2QZ3 A;  1Q8S A;  1WMD A;  2WT1 A;  5LK5 A;  1O91 A;  3WF3 A;  1I3H A;  2QDR A;  1AL2 2;  1LOF A;  2E7Q A;  4X6R B;  3J4U H;  5T50 A;  5J96 B;  1MS8 A;  5JOZ A;  1Z7S 3;  1QNY A;  2XHK A;  1XE8 A;  3Q8F A;  4M4R A;  3SCF A;  1QQP 3;  4P9W A;  5BNN C;  5C8W A;  1C57 A;  5F2W A;  4ITC A;  3EO6 A;  3FHQ A;  3AZZ A;  3M3Q A;  2P3K A;  3N7L A;  4FPY A;  5FY1 A;  4ASK A;  1IG0 A;  4QPG B;  4NAO A;  2ZJC A;  2QBX A;  3C7F A;  4JHZ A;  4XUO A;  1RVF 1;  5F3I A;  2ZGN A;  3SEP A;  2ZA9 A;  1HRV 3;  4Q4V 2;  2PAM A;  1E57 A;  3MLJ A;  4H14 A;  5I8S A;  4F3J A;  2VQA A;  2ATF A;  2YFU A;  2Z69 A;  5C9A B;  4LHL A;  3N3H A;  3WDY A;  1W2O A;  2RMU 2;  3JD7 1;  3WUD A;  2PLV 1;  2V09 A;  4RN5 A;  4MGQ A;  4RS5 A;  4QX5 A;  4UW5 A;  1LED A;  2GNT A;  3PUI A;  4I30 A;  4IES A;  1SBF A;  3B69 A;  4AVS A;  3POY A;  1PIV 2;  4AI8 A;  3GM8 A;  4M3C B;  3THC A;  3LZZ A;  3RDI A;  4BCU A;  5I0T A;  3FN9 A;  3VZK A;  1H4H A;  2A6Y A;  4DS0 A;  5FZ4 A;  1OBN A;  1VBB 1;  3VD9 A;  1V6M A;  1DU3 D;  4HPK A;  3ORJ A;  2EXK A;  1SZB A;  1VAM A;  5CFD C;  1CAW A;  3CEW A;  1N1S A;  1YI7 A;  5FY9 A;  4JTO A;  2Q1F A;  4LUL A;  3ENR A;  3LSE A;  3GBG A;  3TAY A;  3KMH A;  3ZVX A;  5DQ0 A;  1QJU 1;  4OI2 A;  1ND2 B;  2CGN A;  3L2Y A;  4QT6 A;  2A5Z A;  5LEK A;  3S57 A;  3T3Y A;  2MNG A;  4S2F A;  2BBV A;  2W92 A;  2ZX0 A;  2FMY A;  5A3T A;  2Q5T A;  1GNH A;  3GXU A;  4ES9 A;  2RV9 A;  4MZU A;  5A32 A;  4YZ1 A;  5HV0 A;  1C8N A;  4Y5S A;  2YHJ A;  3HJR A;  5KXD A;  5LRR A;  2XUE A;  2Q30 A;  3TBD A;  1PM7 A;  1TVG A;  4CZS A;  1HKD A;  3ZSJ A;  1XSR A;  5CIS A;  4Y5T A;  5JI7 A;  3K51 A;  4AED C;  4UWD A;  1AYN 2;  1OQE A;  5K0U A;  1XYP A;  4G4F A;  1W6O B;  4R9D A;  4AFC A;  3RQ0 A;  3KGL A;  3MO4 A;  1PVC 3;  5KHI A;  1MS3 A;  1MZ5 A;  5C3P A;  1DGL A;  3GBW A;  4IE7 A;  3RG0 A;  3VB9 A;  1POV 3;  4UI9 L;  1V9U 2;  4NR1 A;  1GP4 A;  2JG9 C;  2PHL A;  1NZC A;  2FDG A;  4PI0 A;  5T5P A;  1W8T A;  4M00 A;  2AEZ A;  2VUC A;  1YFX A;  4ZS3 A;  1W6Q A;  5ABJ C;  3RJR A;  1S2K A;  1AX1 A;  3WDT A;  1BEV 1;  1R1A 1;  4HSL A;  2HWF 3;  3VDD C;  3O1O A;  1W6P A;  4E2G A;  3J7N A;  2YUE A;  5H9Q A;  4DXR A;  1UOJ A;  3VBR A;  4YW2 A;  1QOO A;  3III A;  1GV9 A;  1H9W A;  1PX3 A;  1WCK A;  3PUH A;  2EIB A;  4I02 A;  3KV5 A;  2CGP A;  1DYP A;  3SCG A;  1FNZ A;  1RUE 3;  2DV9 A;  2PHT A;  2J1R A;  3IDC B;  4FOY A;  4IET A;  1HJG A;  4WM7 B;  4EN6 B;  1O3R A;  4B7E A;  5I93 A;  3MYX A;  3NKG A;  4LA3 A;  4OZO A;  4TXW A;  1DFQ A;  1XOY A;  4OI4 A;  2FMD A;  3LQC A;  1WLT A;  1LHN A;  4FBF A;  5A1F A;  3UGG A;  1GBG A;  3K3O A;  1TE1 B;  1RUG 1;  2VMG A;  4JRL A;  4X8P A;  4HAN A;  3SC7 X;  1BHG A;  1YHF A;  4CU7 A;  2VTX J;  4PIX A;  4QPG C;  3J9S A;  5G04 L;  3RZZ A;  1FT9 A;  1DZQ A;  1DYK A;  2ORX A;  4OHZ A;  1APN A;  2Y8K A;  4CUB A;  5BNQ A;  1F5J A;  3W9A A;  4B1M A;  1GZ9 A;  4Y1Y A;  1RUJ 2;  1D7P M;  2WS9 2;  4ZU5 A;  2BTV C;  1V6N A;  1AR9 1;  2VTF A;  2YU2 A;  4K40 A;  2QTW B;  2YBP A;  3PNA A;  1RJ7 A;  1ULD A;  2YGM A;  3O1T A;  3MW3 A;  4NHL A;  3TB0 A;  2YC0 A;  4LT5 A;  1JU3 A;  3FMG A;  2VMC A;  3CQO A;  4CDU A;  4KGQ A;  1NUK A;  1B35 B;  4PIY A;  4LO7 A;  1UY2 A;  2R06 2;  2R0H A;  1QDC A;  3FFQ A;  5CB7 A;  4HN0 A;  1LU2 A;  5JZG A;  4IEV A;  3SKV A;  1PGL 1;  3J7M A;  2EAA A;  1PM4 A;  5J37 A;  1SMV A;  4NVP A;  1V6J A;  2O8Q A;  1NCR B;  4KH9 A;  2AUY A;  2BNN A;  2OX0 A;  3N9P A;  3H8U A;  3J8F 3;  2C6S A;  3VZO A;  1FV3 A;  1M4W A;  1W39 A;  3GHN A;  4HBN A;  3UGF A;  4YZ3 A;  3BPZ A;  3HN3 A;  1OLM E;  2VVE A;  3BTA A;  1GWK A;  3N9O A;  4W4Z A;  5FMB A;  4HMZ A;  5L9R A;  2NMN A;  3NNF A;  1ND2 C;  5FXZ A;  3K3N A;  1DQ5 A;  1MVE A;  1JBC A;  1ULP A;  4WV8 A;  5FTT C;  4EZ4 A;  4YG0 A;  4LO6 B;  5HCA A;  1UYY A;  5CYY A;  1V6L A;  4QXC A;  1CWP A;  3NAP B;  2KXL A;  1RYY A;  5I91 A;  5LA1 A;  4S2G A;  1VMH A;  4XF9 A;  2NQY A;  5A3P A;  3GCX A;  3KV9 A;  1ST8 A;  3PUR A;  2JDM A;  4RSU A;  2DUO A;  2QKD A;  5FAX A;  4LA2 A;  5FZG A;  3USU A;  2XQX A;  2RHP A;  3FUQ A;  1CZS A;  4NPR A;  2VXR A;  1W8F A;  4GJZ A;  3TN9 3;  4A6S A;  3O1R A;  1MZ6 A;  1MQT A;  5A33 A;  4YAR A;  3POE A;  3WNP A;  4E4H A;  2ZEZ A;  1W8H A;  3S0M A;  1W28 A;  1EAH 1;  2XL7 A;  1PNF A;  3WNN A;  5BYN A;  4R4X A;  1LTE A;  4BQ1 A;  3VKF C;  4NHX A;  4AFM A;  5FZL A;  3HIF A;  5FZM A;  4NIG A;  4DRV A;  2VOW A;  1LES A;  2C0Z A;  2PMW B;  3IWZ A;  5ISL A;  1LHO A;  2BDR A;  3IAQ A;  4I01 A;  5IFT A;  1UZV A;  2HWB 3;  4IEP A;  5FCC A;  1RXF A;  4M3C F;  1SPP B;  5L9V A;  5FY5 A;  4QAW A;  4AI3 A;  4S2H A;  4DOU A;  3S6P A;  4CCC A;  3RZG A;  5GLU A;  1ZRC A;  2QQP A;  2L9L A;  4G9S B;  5DAP A;  3O12 A;  2QQK A;  4WM7 C;  3VZM A;  2P6H A;  4P5Y A;  2BP6 A;  4DB5 A;  5JWP A;  2O8O A;  1RUC 3;  3USS A;  2BV4 A;  2HEW F;  3ETQ A;  1HB2 A;  3VKM A;  2XBO 3;  3JB4 C;  4CRQ A;  5CIR A;  5FYS A;  2I45 A;  4XEZ A;  2WO2 A;  4E27 A;  1LOG A;  1A8D A;  4PBP A;  1NCQ A;  4XHB A;  5FYC A;  1VBD 2;  1C8M 2;  1FYU A;  4AQ2 A;  2DUQ A;  3AL6 A;  3ZR6 A;  4E4D X;  2D98 A;  1RHI 1;  3AKP A;  4NRP A;  4AEK A;  4AOC A;  1GOF A;  4RR3 B;  2J7M A;  1VR3 A;  4CDX B;  1PGW 1;  2WWJ A;  4RD7 A;  4QD2 A;  3C3V A;  4N53 B;  1DLL A;  3HPN A;  5F5I A;  2BER A;  3VHR A;  4AGG A;  2RJ2 A;  1OFS A;  4BJ0 A;  5ACA 3;  5BNO B;  2YC2 A;  1QOS A;  3HT2 A;  3O5S A;  1SQ4 A;  5T55 A;  4FSJ A;  2R07 2;  2Y6H A;  4LXL A;  2BOI A;  2RDN A;  1QDO A;  4NO4 A;  3NW4 A;  2V5Y A;  2XWJ B;  2AEY A;  1JUI A;  4TTG A;  5K9Y A;  1QXR A;  4MXV A;  1P8J A;  3VBS B;  4D7Y A;  5DDJ 3;  1GSL A;  3WQ0 A;  2VE1 A;  1B35 C;  2GNM A;  2RJL A;  1VMJ A;  1MEC 2;  2E51 A;  1PO2 1;  2WAB A;  2ZZJ A;  2ZX4 A;  4QB2 A;  2FZ1 A;  1EV1 1;  2OPK A;  4HSJ A;  4N9I A;  4JHT A;  5JXH A;  1W9W A;  5FZO A;  2WFF 1;  4NII A;  1UQX A;  4OZX A;  4AHX A;  1NCR C;  2Z4F A;  1NG0 A;  4AQT A;  4FTE A;  1WLC A;  1U5I A;  4MET A;  3ILN A;  1KGY A;  2A70 A;  4HVR A;  2A3Y A;  2AYH A;  1TNF A;  4UFI A;  3RGB A;  4XJZ A;  3V65 A;  1CAV B;  1DQ4 A;  4DXS A;  1YI9 A;  1UY1 A;  3WDV A;  1NLS A;  4MXW A;  1KJL A;  1ULG A;  2VL4 A;  3ZYP A;  1S0F A;  3MPP G;  2YBS A;  1BZW A;  1ZX5 A;  3NAP C;  3VGI A;  1GP5 A;  3OSD A;  4F83 A;  3BU7 A;  4QXH A;  1JYI A;  2D6P A;  5DUV A;  4KU7 A;  3ZXA C;  4AFB A;  5LEJ A;  4XW3 A;  3HQX A;  4D6S A;  1LR5 A;  3VBU A;  5AC9 1;  1TMF 1;  5A7S A;  4J6G A;  1R09 1;  2NLR A;  3JBG 2;  5IVY A;  3DEC A;  4ZU7 A;  1ZZ6 A;  2I74 A;  1OH4 A;  2W52 A;  1TG7 A;  2ZEX A;  1EUU A;  2JE7 A;  3WCR A;  4CP9 B;  1ZRD A;  4D6R A;  3PU3 A;  2WSU A;  2IVI B;  4XUP A;  2VNO A;  4QM9 A;  1D4V B;  1FOD 2;  1Z7S 2;  3DEM A;  4KI5 M;  2BFU L;  3CF6 E;  1QQP 2;  4JVA A;  2BWC A;  4QQP A;  4YRD A;  5T5O A;  3PVE A;  4NWV A;  2AH2 A;  3MBW A;  2VZT A;  1RMU 1;  4AL9 A;  1G7Y A;  4A7Z A;  4QB1 A;  5FZA A;  5FOJ B;  1YO8 A;  2IXH A;  2PHU A;  2WO7 A;  4CYD A;  1AL0 G;  1K5J A;  3FHI B;  4IEW A;  4B8E A;  3KCY A;  2YGL A;  2CHH A;  1AL2 1;  4CTE A;  4CP2 A;  1UX7 A;  1G6N A;  1R08 3;  1ENR A;  3D6E A;  1X7N A;  3AKS A;  4HFS A;  4XDQ A;  3C8X A;  4YW6 A;  2WA4 A;  5FP4 A;  1MS0 A;  4QXK A;  4BQ3 A;  1HXS 3;  1PMI A;  3PVN A;  3W21 A;  3WUC A;  4AZZ A;  4IQP A;  4BZ4 A;  4URA A;  5KC6 A;  2FDH A;  5LK7 B;  3OPW A;  4CA9 A;  1XJA A;  4Q4V 1;  2VCB A;  2JKX A;  2WYS A;  1HV1 A;  4RR3 C;  5JSP A;  2XOM A;  4CDX C;  1S0B A;  2D43 A;  2GC0 A;  1ASJ 3;  2RMU 1;  2QVS B;  1OQ1 A;  4N53 C;  1W03 A;  1H1I A;  2NM1 A;  4CU9 A;  3D4K A;  5CKM A;  1FMD 3;  2BYV E;  4AXO A;  5BNO C;  1H9P A;  4CSW A;  1VJ2 A;  4FQZ A;  2LTN A;  4Z07 A;  3KM5 A;  2PEL A;  3D3A A;  4JCK A;  1PIV 1;  4WM8 A;  5FZK A;  1JYN A;  4XF1 A;  3VD3 A;  4RYD A;  1NE6 A;  4XFA A;  1ACC A;  2NMO A;  3ME2 A;  3HN1 A;  3RZL A;  4COU A;  5IVJ A;  1GLH A;  2VOV A;  4GWJ A;  3VBS C;  3UK9 A;  1PZ9 A;  2VW2 A;  1RED A;  2ZEY A;  5FKC A;  1XB9 A;  2OUJ A;  1FV2 A;  3CHX A;  4XAB A;  4PF1 A;  4RQP A;  3CKH A;  2ZHM A;  3BTZ A;  2IXI A;  4FOW A;  2JDK A;  2GC2 A;  3UKT A;  4DMI A; 
#chains in the Genus database with same CATH homology
 5FP8 A;  3N9P A;  4QWN A;  2XDV A;  5FXW A;  4DO0 A;  5FZ3 A;  5A7Q A;  3RVH A;  3OPT A;  5A7W B;  4CCN A;  3N9O A;  1VRB A;  5FYT A;  3K3N A;  5FXZ A;  4AI9 A;  3PUQ A;  5E6H A;  5IVC A;  5A7P A;  5FYB A;  5A3W A;  4EZ4 A;  5A3T A;  2Q8C A;  5LW9 A;  5FZ6 A;  5F3E A;  3KVA A;  5FPL A;  5IVV A;  2OS2 A;  3N9M A;  3PUS A;  4HOO A;  5FWE A;  2YBS A;  4QXC A;  5FXX A;  3ZLI A;  4CCM A;  5FZF A;  2XUE A;  5F5A A;  5FUN A;  2Q8E A;  4IGP A;  4V2V A;  4QXH A;  4UF0 A;  5A1L A;  4BU2 A;  5FPA A;  5FZH A;  4CCK A;  5A3P A;  3N9N A;  3KV9 A;  3PUR A;  5FYI A;  4LIV A;  4BXF A;  4D6S A;  5FZG A;  5FYH A;  4GJZ A;  4D6Q A;  2XXZ A;  4Y3O A;  2W2I A;  3PTR B;  3K2O A;  5A7S A;  5FYY A;  2YU1 A;  5IVY A;  4E4H A;  5F3C A;  4LIT A;  4QXB A;  5F2S A;  4AAP A;  4EZH A;  4HON A;  5KR7 A;  5A7N A;  2P5B A;  3PU3 A;  3KVB A;  5FPV A;  5FV3 A;  5FZ1 A;  4D6R A;  4UF0 B;  3N9Q A;  5FPU A;  4QX8 A;  5LY1 A;  2GP3 A;  5FZL A;  5FZO B;  3AL5 A;  5FZM A;  5FPB A;  5IWF A;  5LY2 A;  4CCO A;  5FYM A;  5FY8 A;  5FYZ A;  3UYJ A;  2OT7 A;  5FP9 A;  4C8D A;  5FY5 A;  2PXJ A;  5FUP A;  5LWB A;  5FYV A;  4CUG A;  3KV5 A;  5F5C A;  5IW0 A;  2YPD A;  5FZ8 A;  3N9L A;  5FZA A;  5A7O A;  3ZPO A;  3NJY A;  3AVR A;  5FZC A;  4CCL A;  5CEH A;  4CCJ A;  5FYU A;  5FZI A;  4TN7 A;  3DXU A;  5FP3 A;  5IVF A;  2OQ6 A;  4XDP A;  5F39 A;  5A3N A;  5FXV A;  5F37 A;  4NUB A;  5A7W A;  5FYS A;  5FP4 A;  5FY4 A;  3LD8 A;  3LDB A;  5A1F A;  4QX7 A;  3K3O A;  5FYC A;  5K4L A;  4EYU A;  2Q8D A;  3DXT A;  5F2W A;  5FZ9 A;  4URA A;  3KV6 A;  3AL6 A;  4ASK A;  3OPW A;  5FY1 A;  5F32 A;  4GAZ A;  3PUA A;  4Y4R A;  5F3I A;  4BIS A;  5IVB A;  4LIU A;  4GJY A;  2XML A;  5FP7 A;  5A80 A;  2WWJ A;  5ISL A;  5F5I A;  4V2W A;  4CSW A;  2YU2 A;  4LXL A;  2YBP A;  5IVE A;  5FWJ A;  5FJK A;  5FZB A;  5FZK A;  5FZE A;  5FZ0 A;  3KV4 A;  4Y33 A;  5FY0 A;  3U78 A;  2YBK A;  5F3G A;  5IVJ A;  5FZ7 A;  2OQ7 A;  4QU1 A;  5FZ4 A;  3U4S A;  2GP5 A;  5FJH A;  5FY7 A;  5FBJ A;  4GD4 A;  3AVS A;  4DIQ A;  5FZO A;  2WWU A;  2VD7 A;  3PDQ A;  5FZD A;  4XDO A;  4IGO A;  4IGQ A;  5FY9 A;  2OX0 A;  3PU8 A;  5ANQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...