2OQ6A

Crystal structure of jmjd2a complexed with histone h3 peptide trimethylated at lys9
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
348
structure length
348
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords JmjC domain-containing histone demethylation protein 3A
total genus 112
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2oq6A01
2GP3A 4QXHA 5FZMA 2PXJA 5FYTA 5A7WB 5FZAA 3N9OA 4XDPA 5LY2A 3KVAA 3OPWA 4QX8A 3U78A 4GJZA 5F32A 5E6HA 5A7SA 5FYVA 5FYBA 5FYMA 2XMLA 5A3WA 2WWUA 3ZLIA 2XXZA 5FY8A 2YU2A 3PU3A 5FXWA 3LDBA 5FZIA 4DIQA 2Q8EA 4HOOA 4XDOA 5A1FA 5F39A 5IVEA 5A80A 5FZ8A 5FYUA 5FZKA 2WWJA 5F3IA 3AVRA 3KV5A 5LW9A 3DXTA 4IGQA 2OQ6A 4QXBA 5FZCA 4QX7A 5FXZA 4CCKA 3RVHA 3N9LA 5FYIA 3KV6A 2YPDA 5FPBA 4LIUA 2XUEA 4BXFA 3PURA 5F37A 4Y3OA 4TN7A 5IVVA 5FZ7A 5FBJA 3DXUA 4QWNA 4Y33A 5FWEA 5A3PA 3AL5A 5FUPA 3PDQA 2OT7A 5FPLA 4V2WA 2YU1A 5F5AA 5FZFA 5K4LA 4IGOA 4NUBA 3K3NA 5F2WA 2YBKA 5FYSA 5IVYA 5FY7A 2OQ7A 3N9MA 4EZ4A 5ISLA 5FYHA 4AI9A 4CCOA 5FZ0A 4CCJA 3KVBA 5F2SA 5FP3A 5FZHA 5FXXA 5LWBA 4V2VA 4DO0A 5A3NA 5IVFA 4C8DA 5FYCA 5A7WA 5FZBA 5FZOA 2P5BA 4AAPA 5IVBA 3PUQA 5FV3A 5FP8A 3N9NA 4LXLA 5FPAA 5FXVA 5FZDA 4BU2A 2W2IA 2YBPA 3K3OA 3OPTA 4QU1A 4GJYA 5FZ4A 5F3EA 4LITA 4IGPA 5FZOB 5FPVA 3LD8A 5F5CA 5FP4A 5A7PA 4CSWA 2Q8DA 3K2OA 3N9QA 4GAZA 5FZLA 4ASKA 5IVCA 5FY9A 3PU8A 5FY1A 4CCNA 4URAA 5FP9A 5FZ6A 4EZHA 4CCMA 5IWFA 5ANQA 5FY0A 5F5IA 5A7QA 5A7OA 5FZ3A 4QXCA 3ZPOA 4D6QA 2OS2A 4D6SA 5FZEA 3N9PA 5IW0A 1VRBA 3AVSA 5LY1A 5FY4A 2YBSA 3KV4A 4GD4A 4HONA 5FZ9A 5FY5A 3U4SA 2GP5A 5FYYA 5CEHA 5A3TA 3KV9A 4Y4RA 5F3GA 5FJHA 2VD7A 3PTRB 4CCLA 5FPUA 4UF0A 5FJKA 4BISA 4EYUA 4LIVA 5IVJA 5F3CA 2XDVA 3NJYA 5FZ1A 5A7NA 5KR7A 4E4HA 3PUSA 5FUNA 3UYJA 4CUGA 5A1LA 5FZGA 3AL6A 4D6RA 5FYZA 3PUAA 5FWJA 5FP7A 2Q8CA 2OX0A 4UF0B
chains in the Genus database with same CATH superfamily
1LEDA 3NJVA 3P3PA 1GANA 4FPFA 2E9QA 3LA2A 3VZKA 4L8QA 3WT3A 4EJRA 2PELA 5HV4A 4E2QA 3A0NA 1AR82 2E7TA 4I3PA 5IATA 2WO3A 3D0JA 1BVP1 1Q8QA 1LGCA 1NE6A 2H0VA 5IAXA 2XH6A 1DCSA 1LOGA 1HN1A 4RGGA 2HWD1 2JG8C 2QJVA 1VB4A 4Y5TA 5FUIA 2YU2A 2FDGA 2BBAA 4CEYB 4FPOB 1ZX5A 3LOIA 4L0PA 4IEUA 4Y1UA 5JIUA 2FCTA 4XCAA 4LORA 1RHI1 2YV8A 2HEYF 3IT8A 1ULFA 3CJIC 3MLJA 2JDYA 3R6SA 4M0HA 4IEZA 4WVZA 4CDXA 1B35C 4FFGA 2D3SA 1JHJA 3CDZB 3HNYM 1RUH1 2RDRA 4NRPA 3LEIA 4UW5A 1UN1A 5FYIA 2O8QA 3SCHA 3ZYPA 1C8M1 4EN6B 4KU8A 3VBUA 2VNGA 1AR83 3ZFFC 4YARA 2VL4A 4UFHA 5EIYB 2J22A 4CUCA 2WQZC 1W9TA 4YGDA 5L7OA 1YFUA 3ZIXA 2NN8A 2Y6FA 2B8MA 1GWMA 2B9UA 3IIAA 5E89A 4A3XA 1LNSA 1RJ7A 1V6JA 1UU5A 1RYYA 4QM8A 3QOPA 3NL1A 1C5IA 2WFF3 1IS5A 2YU1A 3M70A 5FQ0A 1PZ9A 2W52A 5F5AA 3VDDA 2D44A 2YFUA 3AX4A 5K4LA 2W94A 4QDSA 4ISRA 5JMOA 1ULDA 2RR13 3UV9A 4ARXA 5K8SA 4URTA 2W1SA 2Y6JA 4MXWB 2K46A 1YI9A 3PVBB 2IXIA 3ZXLA 2WN2A 5F2SA 5FP3A 3W59A 3B5LB 5LWBA 1PVC1 1UOBA 5CAZA 3ZVXA 2XJQA 4NIGA 2P5BA 1PNGA 5IVEA 1W6PB 2VMIA 3MIHA 3C7OA 1Q5OA 1B35B 4QKFA 3VV1A 2Y6GA 1GP6A 2W2IA 3CJIB 3K3OA 3OPTA 4Z8BA 4ZONA 4WM7B 3I2OA 2JECA 4TLFA 4F8AA 1XXNA 3UETA 5GZDA 5FMOL 1ND3B 1A8MA 3H3UA 1VBE3 2J7MA 5FZ6A 4Y26A 1X82A 5JPMB 2VMFA 2JG8B 4LBJA 2YYOA 1VBB2 3WF2A 3L9JT 1SCSA 4ISQA 4XF1A 3CKHA 1V70A 2X5IA 2VNOA 4ES8A 1GUIA 2E7AA 3LZZA 5CNAA 1H9PA 1H6YA 2CNAA 2VQUA 1PNFA 2WNOA 4UFJA 1N3QA 5DAPA 1S0JA 1W8FA 3HJRA 4Q1RA 3M3OA 1MZ6A 1SLLA 3OD0A 1LOEA 1UMIA 3ZN5A 4CA9A 1JU4A 3RSJA 5KXBA 4DXSA 1HRV1 5JOXA 4QX1A 2QZ3A 2Y6LA 3DECA 2VZUA 4DUVA 5L9RA 4WM7A 2RMU2 2HLEA 3HR9A 3IM0A 4YGEA 3M3CA 3NAPA 5EV7A 1V9U2 4BA6A 4LKSA 1F4AA 4N43B 2WS92 3SQOA 1X9PA 1KJRA 3POGA 1SMVA 3FLPA 5FZMA 3GDBA 1YRZA 3FHIB 4NHYA 2E53A 2WAOA 4LO6B 3MW3A 4O7XA 2JG9A 3U10A 3VHRA 1KRIA 3BYWA 4QKNA 2XVLA 4RN5A 1VB2A 4XUNA 3B69A 2DUOA 2R062 5C33A 2WWUA 2XXZA 4A7KA 1G86A 4OI1A 1REFA 4M3CE 3CEWA 3VN4A 1N1SA 1DZQA 2VMHA 3OCPA 1ZNPA 3G7DA 5T50A 1U12A 2V73A 3NWKA 3S30A 3LCPA 1E5SA 1LHUA 3GCWA 4Q29A 3GBWA 3WF1A 2PAEA 3TYJA 3ZXGA 1CIYA 3GM8A 4XACA 2IXKA 1W90A 5HBAA 5DDJ3 1OPOA 1OURA 3MBWA 2R0HA 4CP2A 3LOBA 2DF7A 4BXFA 1QJX2 5JOYA 2Y6HA 2XUMA 4RHV1 4CU8A 2B4KA 3AZVA 4HKWA 4Q4V1 4JHZA 4MV2A 1VRH2 4BPZA 3RGBA 1TNRA 4Z92B 2WKKA 5FLJA 4DNYA 5LBEA 4TSVA 4A2UA 2ARXA 2OUJA 3MW4A 1KS4A 5JVVA 3WNLA 2EAKA 4QM9A 4AAXA 3POYA 3Q8CA 4M00A 1XQNA 3OYWA 3RYPA 1UY1A 5F2WA 1HRI2 2RDSA 1TG7A 1AX1A 1WLDA 4K21A 4YW3A 3VKOA 3TN91 1ZZ8A 1OVSA 3MIGA 3VD4A 1AYM2 5CFCB 2JB4A 1BEV3 1IPJA 3WQ7A 1LU2A 3CQOA 3PL0A 2X05A 3KSCA 4DY5A 3MPPG 1ASJ3 2WNVB 4ES9A 5A3MA 4XURA 1AJKA 1WBLA 3NJXA 4EV0A 3WQ1A 3NNJA 4ASMB 1QOOA 4JZRA 1UZVA 2DU1A 1W9WA 3GBGA 4RFRB 5E8AA 3TOJA 3WHUA 2WT2A 3BPZA 4H7LA 2QDNA 2QTWB 2Z5WA 4QQLA 2W5FA 3K46A 4P5YA 2XLAA 4EZHA 2J1SA 1UY2A 2BP6A 3UKTA 1OOPA 2A75A 3W20A 1YJLA 4AFCA 3VBSA 1WA4A 3HAGA 2RS32 1RITA 1C5HA 1ZBE3 2G9FA 2VPVA 4XUQA 2IVIB 4B4RA 1RVF1 5FY5A 2VBDA 2DVAA 3GCXA 1LGNA 1HW5A 2RS51 1NXMA 1OD3A 3WP3A 3T1LA 1BYHA 3LEKA 1TEIA 2CAUA 3N7KA 5CVRA 4AQ2A 4CDUC 3HT1A 1LR5A 1QNWA 2ZMKA 2FQPA 1ZA4A 2F6BA 2JDHA 3POFA 5JR2A 2A5ZA 3JUUA 4LULA 4QX3A 2K0GA 4Y5SA 4LEJA 5HV0A 3PMSA 1QQP2 3J7MA 5EQUA 2F4LA 3VKLA 1K5MC 3NSTA 4Z82A 2RR12 2Y60A 4LE3A 5BNPA 1OH4A 1QJU3 4UF0B 3TEXA 1OVPA 1RUD2 4PQQA 4AEDC 3VZNA 2GDFA 4XTPA 5EPAA 1ACCA 5IT6A 2EXJA 4AHZA 2JWPA 4HVRA 1APNA 4UW4A 2C9AA 2TEPA 2ZACA 5LEJA 4KBBA 1NE4A 1X8MA 5LA9A 5A6YA 3ZMOA 4UWDA 3ZSLA 4QD2A 4RFT0 4BQWA 2R30A 5CKQA 1UD1A 4INDA 5A3WA 1CN1A 4SLIA 2OXBA 1N3OA 3H9AA 4QPGB 3Q8EA 3WV6A 3C7GA 4BE3A 3HOBA 1JOPA 3BPSA 2BYVE 1EPWA 5EFUA 1NLSA 1VBD3 1VMJA 1WKYA 1GQPA 2VZ1A 5BPXA 2GMEA 2WA3A 2DWRA 4QGMA 4XW3A 4WBBA 1VBC3 4KQ7A 5C7GA 3ZYIB 1O5UA 3TWIA 1QJX1 1WD4A 3IPVB 4QB6A 4XBLA 4AGRA 3PIJA 2Y0IA 3NW4A 4AOCA 4QPGC 2VXJA 4NR1A 1XE0A 2RM22 2XBO3 5CKMA 2OPWA 2PAKA 5F37A 2D7FA 5JDBA 4UW3A 4Q8LA 1AZDA 4G4FA 1CESA 1HB4A 2JD4A 3AJYA 3B02A 3KZ4C 1BBT3 5DAXA 1RUOA 2WNUA 1NKGA 2VUAA 1AR73 1WGPA 3AMPA 4YGBA 2B46X 3ZYRA 2PAMA 3S6PA 5FUPA 4ZU4A 4KGQA 4HK9A 1ZYBA 3K4DA 3KS7A 2C5DA 2ILMA 3EB7A 4K9SA 2HWB1 2ZHMA 3IDCB 5FZFA 2Y26A 3ITQA 1VBD2 1D0GA 1NCQB 4N9IA 2W39A 3ZR6A 1W03A 3ELNA 1CPNA 1A3KA 1XNDA 3AXDA 4PBOA 3IPVA 3RMYA 1V0AA 1TMF2 2E6VA 3RZGA 5FRAA 1W6OA 1PM7A 3OJBA 5JUVA 2GNTA 5D2AA 1D4M2 4KNCA 1WLWA 2PHDA 3B7MA 1O3QA 2WLPA 3B94A 4HXCA 4AVVA 3DF0A 5CIRA 1UZYA 4LUMA 5JSOA 4Q4W3 2HWB3 3IIIA 1W3VA 3SMHA 4JGYA 4R9DA 1KEXA 1ALYA 4XJZA 1SLCA 1CPMA 2QQNA 5C3PA 5ANQA 3SITA 1OKOA 1FOD2 2R073 2W1QA 4I3GA 1BBT1 3GBFA 1RGSA 1FPN2 4PQ9A 4XC9A 5DDJ2 5FZ3A 5KHHA 4CRQA 1M4WA 1NG0A 4Y20B 3AVSA 3WW2A 1H6XA 2JDUA 2ERFA 3AZWA 1V6LA 2DCTA 2VE1A 1R093 2WABA 1TMF3 4NWVA 4OLLA 1ZZ6A 1WMFA 4Q0UA 1QJX3 1C1LA 2BBVA 1S0DA 4FPLA 3DPRC 3T1MA 3Q9OA 1H0BA 1W9FA 4CU7A 4BQ3A 1ULCA 2XDVA 2WNVC 4RQPA 3AYCA 3PUHA 2NLRA 4ZS2A 5FZGA 4R52A 4D6RA 3O12A 1C57A 5BUVA 4HPKB 4XJAA 2OX0A 4MXVA 2WO7A 2A6WA 1YI7A 3C2UA 1IZ3A 2N7GA 1PO21 3AKPA 2PXJA 3H1YA 4XHBA 3O5SA 3ZXKA 3WLUA 4A7ZA 4YSFA 5CB7A 1F4HA 4AEMA 4AK3A 2VY0A 1AXZA 3N7LA 5EJ1B 1DLLA 3OUIA 1N3PA 1DBNA 2RMU3 4YG0A 4M0NA 2DVDA 1H8VA 2ZOEB 4PI0A 4IQPA 4AW7A 2WS93 3APBA 5FY8A 4R4ZA 4XZPA 1OA2A 1PMIA 1ZZCA 4ZXEA 3ZXDA 2CU5A 3OBAA 4RA0A 1SBEA 4JHTA 3WG3A 1YUDA 1AR63 3HWJA 2O0OA 1VBB1 5LW9A 3DXTA 3HPNA 3ZXFA 1MVQA 2Q30A 2XG3A 4YZ2A 2NZ9A 2ZGMA 1TQ5A 5FBZA 4GIQA 5SV5A 2QKDA 1I5PA 2RS53 3GNEA 5E88A 3I54A 1CJPA 5LA2A 5J98B 2AUYA 5JSPA 5KC5A 1KFXL 1CD3G 4LO8A 4YVWC 2WFPA 2RE9A 2UY8A 3B00A 3H3LA 3BTXA 1Q8PA 2CY6A 4CPBD 3POJA 4DFSA 3WR0A 2JDPA 1V6KA 3DYPA 2BGOA 4LKDA 1X8EA 4LT5A 1DU3D 2XJSA 3ZFEC 5KHGA 2VC9A 2D3RA 2NQYA 1F5JA 2JKXA 4BQ2A 1Q8OA 2AEYA 2JG8A 4WVMB 4AZZA 2C9KA 4XQWA 1GBGA 5IVYA 4DRVA 3HD8B 4W65A 3I8TA 1V6IA 4N43C 4QDRA 3WQBA 4LBNA 1DLCA 3VBOC 2VW0A 1Z7S1 4DO0A 5FZBA 3NKTA 2ZABA 4YW4A 4I30A 1W2AX 3WG2A 4Q0VA 1FMD1 2QFEA 4CU6A 3P1IA 4BU2A 1RUE1 2IC1A 4QPYA 2D3PA 2PA7A 3OYWB 5FZ4A 5IFPA 1QWRA 2EVXA 3LE0A 3WOGA 1WCSA 3SNMA 2Y34A 5BY5A 3C7FA 1OUXA 4U36A 4CYDA 3AKTA 3CO2A 2YY1A 2DBNA 2VGDA 2WRAA 1SZBA 2SBAA 2JDZA 2UWBA 1LODA 2VR4A 3A22A 1VBA3 5FK7A 4L2NA 4CVUA 3CZJA 3C7HA 3UK9A 3U75A 1WLCA 3GJBA 3I3EA 4XIOA 3RZJA 2J1AA 1N1VA 2XL7A 1ND3C 1DIWA 1QJFA 1GQHA 2ZGLA 3NV1A 4KWKA 1VRBA 4RHV2 4AGGA 2YC2A 4BQ1A 4WM7C 2QZ2A 5FZ9A 3HT2A 1TNFA 2DVFA 2GP5A 2KD7A 2Q8OA 1W8HA 2FMYA 2JE9A 3RPQA 3O1OA 2E31A 1IQAA 5F6LB 2WR9A 4JTNA 3RDIA 2W91A 1GSLA 4XILA 3IN9A 1KFUL 5FQ0B 1RHI2 1W2TA 2NM1A 3C8XA 1JODA 3VBHA 4Q4X3 5FFOC 1LB2A 4AFMA 3VDAA 5FP7A 1FMD3 1PO22 3HN1A 4Q26A 3TB0A 4BHPA 1QHDA 3S57A 3J4UH 2HBTA 4P02B 4N9HA 1MQTC 2VXRA 3KCYA 5FZAA 1MZFA 3LDRA 4MVTA 1SDWA 1LRHA 1EUUA 4CE8A 4FFFA 3U78A 5JLVA 4WM8B 1YQ2A 4D8MA 3A4UA 4JGZC 5FYBA 3GHNA 1VJ2A 3R0RA 3VZLA 1HB3A 1Y9GA 3PU3A 5FXWA 3THCA 3HQRA 3ZFFB 1WZXA 4HK8A 1OLQA 2ORXA 3B9IA 5D1IA 3J8F3 4IUGA 4XJWA 1W6NB 1MZ5A 1TVGA 4YZ1A 5BYNA 5F9TA 1EYBA 2PMWB 3NNLA 4QT6A 5GALA 4I0BA 3ZYGA 2B45X 4OUEA 3U37A 4CDXB 1NLRA 1SBDA 4P9LA 2RS31 1GKBA 1FI2A 4JGYB 5FZCA 5FXZA 1PVC2 2XQRA 3N9LA 4F83A 1UZ0A 2VUCA 3NNGA 1BK1A 3I59B 2JB8A 3MYXA 1WUVA 3I3DA 3HMYA 5D21A 4CEYC 1DFQA 1OFNA 4TN7A 2JE8A 4Y20A 3WNPA 1PGSA 1LGBA 5JMCA 4ATEA 4ZKTB 3NNMA 5K7PA 4Y22A 3IDAA 3S5AA 3MZHA 2AGSA 3M7AA 2JEMA 4Y33A 4GQ7A 1AYN2 2I07B 4AVAA 2C1FA 2CV6A 2XJTA 4LKFA 2VOKA 4EN8B 2EA7A 2Z4FA 1XNBA 1DYOA 4NUBA 4CP9B 4OZXA 1QDCA 1UYPA 1V9U1 3ZXEA 3N9MA 4HZFA 4KL1A 4IV1A 3P6BA 5LK5A 2EF6A 2ZX1A 4FCAA 2JG9B 3KVBA 4LBKA 3KT4A 1JZ7A 1YFYA 1PK6B 4RL7A 4H2AA 1DGWX 2XL9A 2C0ZA 4FPYA 1RUE2 3AP6A 4QPIB 3F95A 4S2GA 4X6QB 4Y4YA 3FC0A 3RWNA 4DZGA 1Q3EA 1W2OA 2HWC1 4B1LA 1YFWA 4FTBA 1GLHA 3K51A 3VDCA 2ET1A 2FDIA 3M3EA 4Q2FA 3OG2A 4C0BA 1XSRA 1QJEA 1H8TC 1NQDA 3KHBA 4CCCA 1SACA 1LHWA 4BMEA 1ODMA 1VAVA 2Q1FA 5A7QA 2AYHA 4R9CA 4XF0A 4MGZE 1R091 3WEZA 5C8CA 3MLLA 4L99A 3N9PA 2XVGA 2VZQA 2WA4A 2D6MA 1ND2B 2ZGRA 5FO9B 3OGJA 3NQHA 4QX2A 5FYYA 4KU7A 1RUC1 1S0GA 1OC1A 1YC61 4IEYA 2BNMA 5DABA 3BGAA 1SCRA 5KXCA 1NX9A 4AI2A 5FUNA 1OMIA 1AXYA 3LSDA 2DTYA 2WBKA 2XPJA 5FKCA 5FYZA 2MPFA 4XF9A 3WDUA 2VG9A 2GP3A 2GMPA 2HYXA 2ZJCA 2ZX3A 1W0PA 3ZKYA 1DGLA 1UPSA 2JICA 1JHNA 1S0FA 2TUNA 4QKBA 4XDPA 1BQPA 3DCQA 3ZFEA 2A1XA 3OB8A 4P9YA 1YJKA 5ACA1 5JOZA 1OBNA 3VBRB 4YM0A 3H0OA 4AYUA 4KWJA 1LULA 2Q5TA 2HWC3 2L9LA 5I0SA 5FYMA 5T3NA 3HVDA 4A3ZA 5T5OA 4HVQA 4PT6A 4QU2A 1KQRA 5DAWA 1ZRIA 1ZBA3 2O8OA 4Q1PA 4BLJA 4PF1A 1UXZA 4O9GA 4QGNA 2E7QA 3V64A 3VBUC 3ZN6A 1S2BA 4AGVA 1MEC3 4N53B 2G9GA 3VD9A 3TN92 1BBT2 4ATFA 1NCQA 3D6EA 1RJ8A 4CDWC 3AXEA 1UZWA 2YUEA 1JOBA 1ZZBA 1W28A 2NMOA 2IXLA 2WSVA 4LO4B 1G7YA 4NIIA 1OA3A 3PTYA 4FBFA 4TZDA 4LIUA 4BZ4A 4PLNA 2HWE2 4SBVA 5L9BA 1WA6X 3H8XA 1H9WA 4Y1VA 2YFZA 4LLOA 2D40A 1JW6A 2ZXQA 4YG6A 1KDKA 5KXDA 3ETPA 3O1SA 2ZGQA 4XABA 2J1RA 5FBJA 5J09A 1O8PA 3G6JB 2CL2A 1AYN1 3EHKA 3POEA 4FT8A 2ZX0A 2X5IB 4GA9A 2DTWA 2K9ZA 3FFZA 5GLVA 3ZIWA 3ZYBA 4BQ4A 4IE4A 5CFCA 1SQ4A 2E32A 3T0AA 3N35A 5L7OB 1K42A 4OI4A 2Z69A 2LROA 4WVVA 3RQ0A 4A44A 4IGOA 1W8OA 5FYSA 2BTVC 4UBHA 3WXPA 1W0OA 2DBIA 3BOWA 3GF6A 4OMDA 5A70A 1IS3A 3BN6A 5FZ0A 4WM8A 4V1PA 5C9AB 1RVF2 3C7EA 1CGPA 1CZVA 4FPJA 2D93A 5DQ0A 1Y43B 4I0WB 3H7YA 4FPCA 4IE7A 5FZOA 1VAKA 2XHNA 5JXJA 3E5QA 4FPGA 3OY8A 2XGXA 3DPRA 3VLBB 1E5RA 1RUG2 2RDQA 4GB31 1U5XA 4MHRA 4OYUA 4QU1A 2R043 4COZA 4BM8A 4XPVA 2UYBA 3I2GA 4LJHA 1JYTA 4YGCA 3ROUA 2XOMA 4MGQA 1VIWB 4UFIA 4NIDA 3ACLA 1VE0A 1L7LA 3MIDA 3J7NA 2XLFA 1J83A 1UU4A 4YM1A 5I8YA 2P3KA 3ZPOA 5CFDC 1AR72 1JZ6A 1B35A 1RVF3 3KF5A 4HL0A 2PHXA 2G19A 3JB8A 2P3YA 5APAA 1Z78A 4M4PA 2G9ZA 2KM2A 4LTAA 1LOBA 2WNUB 4PJYA 5IHRA 5JR7B 1PVXA 2V5DA 4CCLA 5IK7A 4QXKA 3KGLA 3RZKA 4UF0A 5FJKA 5H9PA 4DINB 1URXA 4GWMA 3E5XA 1F35A 1VBB3 3M3IA 4QAWA 4UYBA 1IG3A 1L7RA 5TSWA 1GICA 2YHJA 5L19A 2GAUA 4H7MA 5C3QA 3ES4A 3I2HA 1MS4A 1C28A 3ILNA 2WT1A 2WWSA 2GNMA 4JCKA 3B01A 5FMBA 3WNKA 1NYWA 1GWKA 2JE7A 5LBCA 1UOFA 1V6OA 2WS91 2A6YA 2CGOA 3VB9A 1F5FA 3OOXA 3QH7A 1HQWA 1LHNA 3ETQA 4HG6B 1O6UA 3WSOA 4W6YA 4UFMA 2XJPA 3EO6A 2XKOA 4Q4X2 1MS9A 1LJ7A 3AM2A 3B9CA 4NHLA 4OULA 3ZN4A 4CXXA 4PDWC 3H3ZA 4I01A 4B4QA 1DP0A 2J42A 4J1XA 3BU0A 3HEIA 4DOUA 3VD7A 4ZHNA 1QU0A 3O14A 2BUKA 2ZGSA 3I3MA 3O7OA 4GKXA 2VMGA 2ETEA 4OUSA 2D6KA 3ENRA 5FLIA 5T54A 1RMU2 5C8CB 1HJGA 4QQ2A 4D7TA 2FD8A 3RG0A 1XOYA 2DUPA 3GHMA 5KWRA 1K5JA 1P8JA 2DCJA 3AB0A 4K8RB 4QXBA 1W8TA 3ABZA 3OGRA 3THDA 3KWVA 2VJXA 3OF1A 2D5FA 2VTFA 1JXNA 1IHMA 2WYFA 5BXXA 1TMF1 1MS3A 1Y9MA 2XUEA 4NOTA 1POV1 1NCRC 3HQXA 4ZXKA 3ACFA 1GZWA 5GLUA 1MZEA 1REDA 3U14A 4TTGA 3DGTA 5L9VA 4MGSA 2R16A 4JC1A 1G9BA 4AI0A 3VDDB 1E57A 3GZTB 4QQHA 3E1F1 4JKLA 3N36A 4IEQA 3FUOA 2CSGA 4MOAA 1AXKA 3I3QA 3PDQA 1DQ5A 1KXGA 5C4WC 4XXAA 3UL2A 2ES3A 5C5UA 2WYSA 1RUNA 1NA1B 2PTMA 3PJYA 4K7JA 5FLHA 2MNGA 5LATA 1LENA 4EN7B 4XFCA 5K0UC 4K3UA 5FXXA 2ZGTA 4LBMA 4FTEA 3IAPA 2R041 5SV8A 5IVFA 1VBE2 4ONUA 3ZMNA 1C8NA 1QQP3 4XIKA 2ZGOA 4RS5B 1VRH1 3UGFA 4GB32 2FBEA 1DQ6A 1YLLA 2A3XA 3OTFA 4CDUA 5JXIA 2V09A 2D97A 2J1TA 2OUHA 5GLWA 3TRSB 3ZYHA 3OGSA 4N53A 4OHXA 5C8WA 2ZKNA 4ZS3A 4PHZA 2YMZA 3ORJA 4NIAA 3N9QA 2QQVA 1HRV3 1LOFA 1QH7A 4UW6A 4W8JA 1JZ5A 4PBPA 4CCNA 1ZRRA 4PDWA 1OOPC 1PO23 1WMEA 1AR71 3PHMA 1HQLA 2RG4A 2VMEA 1LTEA 4Y1XA 5GLTA 1O3RA 5AVPA 5KHJA 3O1RA 1AHSA 1UPIA 1WCKA 2CAVA 2HEVF 4XFFA 2KA3A 2R49A 4EROA 3SH5A 2RJLA 5D8AC 1OF3A 1RUI3 4JKKA 5C5TA 1IOAA 3FBMA 2YXSA 1MQTA 4E4SA 4A6OA 2VOTA 1W6NA 3AFKA 1UO9A 4IE0A 2IVJA 1JYXA 5GZFA 3HNBM 1SPPA 3WQ0A 2VNRA 1UYZA 3IWZA 4HN0A 2ZAAA 3ASIA 3C3VA 2WAAA 4HBNA 1CAWB 1W6QB 5GM0A 4YRDA 3T2TA 3BTYA 1PVC3 3BIEA 4IEVA 3J8F2 4JDMA 3D4KA 3AK0A 1OH3A 4BXSV 5FOJB 1JZ3A 3GZEA 1IS6A 1LCLA 4JX0A 4N7UA 4XJUA 4Q4W1 4TLGA 5IUQA 1L3JA 5E6HA 1OT5A 3T2OA 4EWAA 4RR3B 2ZMLA 5FYVA 2EXIA 4Q4Y2 4XF3A 3RNSA 5GJ6A 4EWEA 1UOGA 5ACA3 3W5MA 2D6LX 5BNPB 3O1VA 1GZTA 1PX4A 3UJQA 1AVBA 1W2NA 4YW1A 1O4YA 1QQP1 1RL3A 2QQIA 4ET7A 1HB2A 4D94A 1W8UA 2ZPXA 3DYOA 3H7JA 4GXLA 5DZFA 3WNMA 4WZFA 3NJZA 1M06G 2OQ6A 2RS12 4D7YA 3MEPA 4ARYA 1GOHA 3IZOA 1DZRA 2QDRA 3EYPA 1H1MA 3SH4A 3DEMA 1Y7BA 1BVVA 2PQQA 5HCFA 4CU9A 1RUH3 3BALA 1KITA 4CTEA 3AMHA 3LIHA 3MLKA 1YEWA 1DZTA 5FZ7A 3VL8A 4KBZA 3POSA 2ET7A 3PJQA 5EHDA 4QWNA 1G8WA 3E5UA 2EALA 3ES1A 2XBO1 4AR2A 2VM9A 2QQMA 4LR4A 3PVEA 3T08A 2BZDA 2GZWA 2J1VA 4YVSB 1KDMA 1XU2A 3WP5A 4BWOA 1VBD1 4CCOA 2VW1A 3I49A 4CCJA 3PMEA 2WN3A 3HBZA 4META 1RXGA 4D69A 5A7WA 5IYYA 3A23A 2B7YA 4LO5B 4YVWA 2WIIB 2JX9A 3PUQA 5FV3A 4LXLA 1ENQA 4LHNA 4PLOA 1CZSA 3FLRA 1FV3A 4GH4B 1D0HA 1EV12 4KH9A 4MGTA 2VNVA 4GJYA 4YM2A 3S7EA 2CYFA 3JXSA 3LD8A 4Y5Z0 5A7PA 3WW3A 5IVCA 4GAZA 2SLIA 2OA2A 4URAA 2VZOA 3CJIA 3H50A 2R32A 2QCSB 3OEBA 3R4SA 1Y9QA 1O91A 5FY0A 4QX5A 4ZY9A 1QJU1 1S4CA 1JOJA 1QNYA 2ORZA 3RZLA 2A3WA 1W6OB 4L97A 4D6SA 3K75B 5IW0A 3NO8A 3QD6A 3AMMA 3ZFGC 5JWPA 3JZVA 1JYIA 3WY6A 5L73A 1S1AA 2CWSA 1QXPA 4C91A 1HX6A 1SBFA 4JAAA 1XE8A 2A71A 5DAVA 4AI1A 1GZWB 1WW6A 4LIVA 2XR4A 3NJYA 2W87A 4P00B 1RTVA 1S55A 3V0BB 2FDJA 1UY4A 4PI2A 1W05A 2FDKA 3KCCA 3VBHB 1W0NA 1ZBE1 5J1XA 1OI6A 1RUE3 3R4DB 4YZ3A 4IV1B 3ZSJA 1CAXB 1DDLA 1Y4WA 1UF2C 1NZCA 3RZZA 2D6NA 3ATGA 3BOPA 4RR3A 3J8F1 4XAEA 1POV0 4ZZ8A 2GN3A 4RQPC 4QHOA 3NAPB 4LBOA 4KG8A 1Z7S3 4FO9A 1UOJA 4WV8A 3VZJA 1MPXA 4WVWA 1YWKA 4FP2A 3MO4A 2P6HA 4IE5A 4RGAA 1AL0G 4FP3A 1ODNA 4MHUA 2VTXJ 3I3BA 5E16A 4AHWA 2OZ6A 2Q1MA 3HN3A 3LSEA 2DUQA 4GB33 2UURA 2ENRA 4HANA 3ZLIA 5I8TA 1REEA 2F17A 3B93A 1CR7A 2Q8EA 5I91A 4NRQA 5FMDA 3ZFFA 1IQDC 3AZZA 5FZ8A 3FHAA 3LKJA 3LPFA 5HCHA 3ACHA 2GNDA 2B9VA 2LW8A 2VZ3A 2YC0A 2ZCWA 2XONA 4NIHA 4BK4A 1ULPA 2IUWA 1X33A 4IL7A 4AQTA 1QJZA 3KV6A 4E8CA 1XNAA 5FPXA 5DZEA 1SFNA 4AFBA 2BEOA 5HXVA 3FL7A 2ZEZA 2A6ZA 5AFBA 3RZMA 4AQSA 5LRSA 3BTZA 1A34A 2E33A 2LS6A 1TZOA 2VZTA 4MGYE 2A73B 3ZYFA 3IDEA 4G9SB 1N1YA 3CZUA 4B4PA 4RHV3 1UXXX 2EAAA 1UY3A 4R9BA 4TYSA 5BNQA 1YXWA 5DPNA 2P1BA 3WDWA 4HKOA 4HSJA 1DQ4A 4CDQC 5AFEA 1XRUA 1VBA1 1LEMA 1QEXA 3K3NA 2YBKA 4AVBA 3WUCA 1ZRFA 4NVPA 2OQ7A 4X8NA 3NV2A 4C1XA 1GZCA 4EZ4A 4AI9A 4AEKA 1RC6A 4CEWA 3VBRA 1KD7A 3WZ1A 5A3NA 1N1TA 5F7UA 3IMNA 5EYYA 3WHTA 3JB4C 1AL21 2GC0A 1XYPA 4CZSA 5ACA2 5FPAA 5FXVA 1NUKA 3MICA 3ZSMA 4BB3A 1Q43A 1AR93 2Z42A 1PIV3 2VCBA 5DXDA 1PMHX 1PO12 4YW6A 5ABJA 2GMMA 4MH0E 1O59A 2OZJA 4GULA 4NHMA 2WFF1 2ZS6B 2HWF1 5B4NA 4OUMA 5FCCA 1D2SA 1O5LA 1Y3TA 3K4AA 2WJSA 3MHZA 4GMP3 1JZ4A 1BK0A 2XJUA 3ECQA 4ASLA 5BNOC 4D6QA 1ENSA 2C26A 2WZPP 5FZEA 1UQXA 4YW5A 1MS8A 1K45A 4BLIA 2RM23 4R4XA 3RFRA 5FOBB 2DV9A 2VMCA 1R082 2P4EA 2W68A 4P5HA 4RQPB 3H8RA 1O3SA 3EXUA 1S0IA 3RI9A 2PYTA 1GMMA 2R071 3N3HA 4XAAA 3B3QE 3PTRB 2VZRA 4OQ9A 1K3IA 3EMRA 4NHXA 4IV1C 2YGMA 2OKXA 4HMZA 4BISA 1D4M1 1WBFA 4BQ5A 3CU7A 5F3CA 5IK4A 1QXJA 2EXKA 1V6MA 3VBHC 3ZPYA 3V0BA 4J1WA 4B1MA 3AL6A 1ZRCA 4MZUA 3THTA 3WD5A 1S0CA 2VCAA 1GYKA 3LQCA 4QB2A 2OPKA 1EAH2 1NCRA 4UAPA 5C71A 3A0KA 1CAXA 3D8CA 4G3YC 2RJKA 2PLV3 2UU8A 1QJY2 4FXKB 2A70A 3ZOIA 1GOGA 1WCDJ 5CISA 1AF9A 2R042 4JTOA 2WZ8A 1VBE1 1RUI2 2JDNA 1BMV2 3ZFGB 4COUA 4P08A 2O14A 3KD4A 4XJ8A 5H9RA 4NROA 1C1FA 1MS1A 3LEMA 1AX0A 4JQTA 3ZO0B 4CP9A 2LM3A 3O0VA 3S0MA 3IDBB 5IJRA 3HQUA 5A33B 3VBSC 4HOOA 3VL9A 5F39A 1PK6A 1FAYA 2AH2A 1CAWA 1R64A 1TME2 4LQRA 3JQXA 5FYUA 2BU9A 5EWSA 5A80A 4BQYA 3WNOA 1NA1A 5BNNB 5F3IA 3WF3A 4DPNA 2A7AA 3QCWA 3RVHA 1IPSA 2X29A 5CG8A 3O0XA 5K0UA 1DYKA 2BWAA 4MX3A 5GKAC 3TEZA 2CTVA 2JKBA 4OHZA 5JZGA 1IPKA 1RUJ1 3UGGA 4LHKA 2GU9A 4LE4A 2MHFA 2WO2A 3D82A 2PQSA 2AZ5A 3T3YA 5C4WA 2BV4A 1YQCA 4OHVA 3SLIA 2YDEA 1Z0HA 4RD7A 1UKRA 1PX3A 2PHLA 4L92A 1OUSA 1UL9A 3INAA 4UI9L 2W3JA 1JI6A 4JDNA 4OCTA 1ULOA 5FYHA 3OY8B 2UYAA 3J9SA 5JCTA 1LHOA 2X10A 5ABJB 3LFIA 5CG9A 4NHKA 4YYOA 4XUTA 1W06A 2A3YA 2VOWA 3GALA 3O1TA 4PIZA 1H2NA 2VTXA 2OVUA 2Z79A 1UNBA 1VRH3 3EBRA 4O65A 4F7ZA 2BOIA 2GNBA 2IXCA 3RJ2X 1XNCA 4LITA 1ZVFA 4AXOA 3OBTA 5G04L 1GNHA 3GXUA 3MUZ1 3AFGA 3BIWE 2IFWA 3UKNA 2VQ0A 2FHRA 4LK6A 4OQ8A 4LA2A 4O9EA 3MI8A 2IXHA 1PGW1 1XBFA 4R9AA 3LB9A 4RR3C 1YNAA 4LNVA 4QXCA 1UAIA 5DZGA 1EV13 1R081 2CGNA 3I7DA 3VBFC 2CDOA 4Q4X1 2MEV1 3KV4A 4NPRA 4EN0A 5J96B 1S2EA 3AMNA 3MDPA 4IW3A 4BYYA 2BGPA 4CDQA 4IXLA 3SH3A 1J3PA 3LDKA 2P37A 1VR3A 3GZUC 1POV3 1RUC2 4N43A 1CQ9A 1E5HA 4XJ9A 1G6NA 4QQPA 2Y64A 4GWNA 4EYUA 1CX1A 5LZ6A 1LOCA 4E4HA 1W8WA 1HIXA 4IV3B 1UX6A 4MGIE 4BDVB 3ZFGA 5CBLA 3AYEA 1ONAA 2Q4SA 3DKWA 4CEWB 1G9FA 1JZ2A 3ZSEA 5C3SA 1UIKA 3VZOA 1GU3A 3POWA 5EP9A 4NAMA 1BMV1 1OFSA 1ENRA 3V56A 4IE6A 4TWTA 2W46A 5LY2A 4DQAA 3X29B 4E2SA 4A42A 4LUKA 4XZUG 2O1QA 4IEPA 5F32A 4XF4A 4JVAA 5I93A 5FPZA 5A7SA 3WCSA 2ZZQA 5DUXA 3CJXA 2G1MA 1OOPB 4GKYA 4A7YA 2XWBB 1ENXA 3JD71 4IEOA 4OVEA 4DIQA 1AR92 2VO5A 5IK5A 1BLZA 5J37A 1YQ6A 2QQWA 4Y1ZA 4FPHA 3NV4A 2WZR1 1ZM1A 2EIEA 2HYKA 1I5ZA 2WWJA 1NY72 3AVRA 1QJU2 1XB9A 1GV9A 5JZGC 3U11A 5LBFA 2QE3A 5JZGB 1IKPA 4RS5C 3TAYA 1ULGA 1NAEA 4Y1YA 5LB6A 1VP6A 3N4MA 4NO4A 1A78A 1HXS3 3ILRA 5K0UB 4YWAA 1HB1A 3CIHA 4XFHA 4AFDA 5LEKA 4B7EA 4EN9B 1XU1A 2HWE1 3VKMA 3NRUA 5GZCA 1NA1C 1BKZA 1LAJA 4AE2A 1OXCA 1QGLA 3LWCA 2J1UA 2BNOA 3BUCA 1QH6A 3MGUA 4L9BA 1AX2A 1XJAA 1W6MB 2OT7A 2ZKLA 4JV4A 3R05A 1PGL1 1OA4A 4Q27A 1A8DA 4CPBA 3WDYA 4YFZA 2RJ2A 3VDDC 3QACA 2Y6KA 2VOXA 1EAH3 2ID4A 3CLPA 1US2A 3OSDA 4FOQA 5DG2A 4CP0A 2VBPA 1FPN3 1QF3A 4CEWC 4DUXA 2ZX4A 5G05L 4IV3C 2DURA 1ST8A 4XFIA 4H55A 2VW2A 1QY4A 3WDVA 2R0FA 1L7QA 1RUF3 3IB3A 1JYCA 3JQWA 4P9JA 4EQVA 1COV1 2EIBA 3N9NA 4HVOA 5GLZA 5DAQA 2VMDA 3AP9A 3WINE 1UX7A 3CHXA 4LMFA 1RUG1 3BODA 1PZ7A 2RMU1 3FHQA 3RI8A 2LTNA 5CKNA 1TME3 5T5PA 2V4AA 2ZMNA 3VBFB 1DQ2A 4CUAA 2AACA 3M8LA 1UW8A 1WW5A 4RYDA 2ZGUA 5C9AA 5A33A 2VZPA 2D6PA 4BH9A 1UZZA 1JUIA 4M4RA 1U5YA 1DQ0A 3MUY1 1LOAA 5A3LA 5A7OA 1WCUA 2I2SA 3I2KA 4S2FA 2PHTA 2WQ8A 1GP4A 2MEV2 1FYUA 5EXOA 5CADA 1XNTA 1POQA 2ZTNA 3A7QA 4QHBA 2J1EA 1AYN3 5LY1A 1PO13 2H6CA 1HXS1 3O0WA 4UT5A 4OHYA 4IETA 1RUF2 4I2OA 4R8HA 2AREA 1WD3A 1WMDA 3D3AA 4Q4V3 5F3GA 5FJHA 3ZYJB 4AEDA 3UNPA 1Q8VA 4FI9A 1J58A 2ADEA 4AVTA 1BCXA 5J3UA 1QXRA 2JDMA 4FTSA 4D7SA 1DG6A 2DCZA 5ABJC 4B29A 1R1ZA 2VQTA 2ZHNA 4K40A 5JPNB 3AYDA 1CIWA 2D43A 2QQUA 2TNFA 3DN7A 4XEZA 3VDBA 1TE1B 3PUAA 3E97A 3TNPB 3JD73 1RMU1 1U5IA 4YPJA 3H8OA 1VMFA 4QXHA 2WNUC 2BPA2 2FCUA 1NT0A 3HNMA 3VD3A 1YYNA 1SFYA 5HI0A 3BKZA 3IKWA 5J7MA 1W39A 2X09A 4UFKA 4FQ4A 1ZBA1 5CU1A 3W9AA 2VCCA 3J7HA 4E4DX 3MF6A 4I09A 1LESA 1CAVA 3GGLA 5CFDB 4MG2A 4HETA 1ASJ2 2QNKA 3FLTA 3PVNA 2VECA 4Q5OA 4EE2A 2G4IA 2DCYA 4YW7A 1DGRA 3H8UA 1HDKA 5FZIA 2UY9A 4GWJA 4XDOA 4HSLA 1HQNA 2QQKA 2YROA 3TBDA 1XYNA 3FZ3A 3WNXA 1R1A3 4HN1A 2NP0A 1X50A 4AFAA 3KV5A 2F4PA 4JRLA 4IGQA 4BCUA 1XC6A 2XJRA 1JZ8A 3WG1A 3F2ZA 1DQ1A 5BNNC 4CCKA 4H14A 3PIGA 1AR81 3FMGA 1GP5A 1C8M3 1W8ZA 2Q0AA 3KCXA 3ST7A 5FPBA 3U4XA 1GNZA 4LHLA 5HCBA 3VBSB 3PURA 3RRDA 4P9GA 5C9AC 1O3TA 3KB5A 4Y3OA 3MF9A 1CWPA 1EV11 1RUC3 1GZ9A 4YM3A 3BTAA 3WVJA 3DXUA 5ANNA 5F8PA 5FIXA 3T0DA 4DUWA 2VAUA 1KJLA 2YG0A 3MIBA 1PIV2 2E51A 2V72A 5A3PA 4LLFA 4B8EA 1JYNA 2I74A 5AC91 1ZZ7A 3V65A 2P3IA 1W6MA 5FR3A 2ZHKA 4V2WA 5M0TA 2CGPA 2W9XA 2Y38A 2XVKA 3KM5A 2FDFA 4CXWA 1XYOA 4OMCA 3UESA 1I9RA 5FMOS 2HWD3 4XHXA 2NMNA 1GQGA 3T30A 1SLTA 1ND3A 2VOVA 5H9SA 3ZM8A 4C1WA 1SEFA 3LEGA 2B42B 1G9DA 1VAMA 2RS52 3K4ZA 4HT1T 4CCDA 3P3NA 5FZDA 5FP8A 2ZEXA 1PMJX 3CF6E 4CDWB 5FAXA 4XBNA 4FPKA 4N53C 4NAOA 3LIGA 4QX0A 4IGPA 2JXAA 4K1ZA 4QPWA 5HCAA 4MADA 3QLQA 5EJZB 5FPVA 3EQEA 3ZDSA 3WCRA 2Q8DA 3K2OA 3VBFA 1OD5A 2RR11 2GN7A 1MACA 4Q0QA 1XNKA 5FY9A 4AI3A 1H4HA 1V9U3 4AL9A 3AP7A 3WUDA 4Q0PA 1CAUA 5IWFA 4CCMA 5BNOB 1JS9A 1IKQA 2QQLA 2VU9A 2VZSA 1MS5A 4RS5A 1WCQA 1O4ZA 3IBMA 3L2YA 4E27A 1HXS2 4XXPA 1RB8G 5IK8A 1W9YA 3U4SA 5F1RA 1OF4A 4COVA 5KXEA 1HN0A 2VH9A 1T6BX 3VUOA 5FPUA 3HBKA 4Z1VA 4M3CF 3OGGA 1O8SA 5FZ1A 3KQRA 5KR7A 3PUSA 5CYYA 1T6GC 3I59A 2GC2A 2RS33 4K8FA 2D5HA 3VD5A 1UYXA 3DV8A 1FX5A 4XYXA 4NMIA 1UKGA 2Q8CA 2ZHLA 3PNAA 4BOWA 1UMZA 1JYWA 1OHFA 3QBQA 5A3OA 1V6NA 3W21A 3WF0A 5FTTC 4AG4A 5K9YA 4CDQB 2RS11 5FYTA 5KHKA 3M4FA 2DCKA 2W95A 1ND2C 4HFSA 1FNZA 1VMHA 4Y24A 4QX8A 4KI5M 1YIPA 1YHFA 2R061 3JBG1 5C3RA 4LO7A 2ZX2A 3JCIA 1SLIA 3OBZA 1RINA 1I1EA 1H8TB 5DUUA 3KQ4B 3AKQA 5AC93 4LBLA 2V5YA 2HJIA 5CZKA 5A1FA 1SHWB 1DHKB 1EUTA 5FDBA 1BEV1 1JU3A 1OPMA 5FZKA 3VHNA 3CL1A 1PGW2 1W99A 2ADDA 4J6GA 3MIEA 1FXZA 1D4M3 5FO7B 5DN2A 2CHHA 4N7IA 5L36A 3ZN6B 1EP0A 5JOWA 2EIGA 4PIXA 5EYXA 3POBA 4B3NA 3BU7A 1OSGA 1RXFA 4Q4W2 1PK6C 3VBOA 4OZOA 3I2DA 2DVGA 2QVSB 4Q4V2 2JG9C 1QMJA 2DU0A 5B2GB 3MPBA 3GJAA 5IVVA 5HPOA 4Q4Y3 2VUDA 3LA7A 4RSUA 1D2QA 1FOD3 2R072 3BI3A 3T09A 1MR5A 4MUVA 1R1A1 2QUOA 3TEYA 4I0AA 3UKVA 5AC92 1JMUB 3UJOA 2PN5A 1LECA 4GMP1 1SG3A 2LRPA 2HBUA 3LFMA 2HWF3 3LAGA 3NAPC 5DUWA 5E1RA 3I2IA 3UGHA 3V0AA 5DDJ1 1D7PM 2ZZJA 3WDTA 4OFGA 2ARAA 2DFCA 4BIOA 5ISLA 1OKQA 4KWUA 3BB6A 2BJSA 4W50A 5FZHA 2BRTA 1RUH2 3QH6A 1OQEA 5F5QA 4AAPA 3U0ZA 2W47A 1RMU3 3AP4A 4JGYC 4CDXC 3JD72 2P34A 4AVSA 1CVNA 1CAVB 2IWGB 3M1HA 1T2XA 4LBQB 1X7NA 3KLSA 2EIDA 4E8DA 5FZOB 1SFPA 4XOGA 3H1MA 1J84A 5JI7A 3USUA 1BZWA 4O61A 4AWDA 2FZ2A 1SDDB 1YQ8A 3AC0A 3ZXJA 3T4HB 3OBRA 4QQOA 4Y22B 2ZA9A 5F5IA 2IZWA 2VZVA 4JGZB 1W04A 1C8M2 4B7KA 1STMA 4OI0A 4WM8C 4CCEA 5JAXA 2FMDA 2FDHA 2WLQA 2W0XA 4GD4A 1NXD1 2XQXA 3I97A 4GALA 1MQTB 4U2AA 2ZEYA 1S2KA 4AI8A 1ULEA 2BWCA 2PHUA 3KV9A 4I02A 3ILFA 4GH4C 4QB1A 5LRRA 1J1LA 4CXYA 4YNIA 2ZEWA 1GWLA 3VHPA 1H2MA 4NRMA 4XFBA 5A7NA 5I0UA 3MW2A 3SCGA 1TME1 5ERLA 2Y0OA 4XQDA 3HIFA 4FOWA 2QQOA 1FNYA 3LF7A 1NOVA 1S0BA 2H6BA 1RUD1 1YQ5A 3CNAA 1GOFA 1COV3 4YVSC 2Y8KA 4QPIA 1AR61 3RWKX 2VVFA 2EXHA 3D0SA 4WVMA 2PFWA 2BVBA 1PHMA 3N9OA 1N47A 3FX3A 1I6XA 4XDQA 2WQ4A 2X53S 4LPLA 4GJZA 4A4AA 2JJ6A 4CP1A 3DL3A 3J26N 3SEPA 4YZ5A 1OQDA 1J3QA 4FFHA 4LHSA 4UOJA 4W6WA 4C90A 3O1PA 1YO8A 1HRV2 1ZBE2 2PHWA 3KF3A 4TXWA 1WWYA 3SEEA 3EJKA 4AHXA 4FXGB 4IEWA 4LK7A 4A41A 5AVAA 4IDZA 2W92A 2WT0A 4MGKE 4PLMA 1G9CA 3AP5A 3TNQA 2RVAA 4BQXA 2ARCA 1VBA2 5C3OA 1XE7A 1W9SA 5CFDA 1KS5A 3MFAA 4EWDA 3OEAA 4ITCA 2AENA 4K20A 1J3RA 4QHZA 2OW4A 5FO8B 2Y33A 3AMQA 4QDQA 3VBOB 3SKVA 1K5MA 1JUHA 5FK8A 5BNPC 1R1A2 4F3JA 1F15A 2FCVA 1MS0A 3AZYA 1JN2P 1A6CA 1AL22 1GR3A 3OUJA 3T4VA 1H2KA 1NZIA 2DYCA 2TBVA 4OI2A 4Q4Y1 2LUWA 3RZHA 2WL1A 3RS6A 2AEZA 1SPPB 2EICA 5I0DA 4NJ4A 2HWB2 4HKLA 3ZFEB 1J1TA 4K1YA 1WW7A 1MEC2 1F8VA 1UCXA 1D4VB 3ALQA 4AHYA 1K12A 2ZGKA 1V00A 4XQ4A 4YZ4A 5FY7A 4YVWB 4KGGA 2BFUL 4LBQD 1US3A 1RHI3 2YZ4A 4YG3A 1Q56A 4D3WA 5T5JA 5LA1A 4XFGA 2GH2A 4AQ6A 1OLMA 5IVBA 1H8TA 3WX5A 1GNYA 3PVOA 2GALA 5D8AB 3WG4A 1JBCA 4HLTA 3AYAA 4ZPIA 2PLV2 1QOTA 2YBPA 2HWD2 3WDXA 2XJVA 4Q8KA 2DVBA 3FWEA 3LPGA 3JBG3 2OYZA 4XCBA 5F5CA 5FP4A 5I0TA 5FZLA 4ORFA 4MYEA 2XBO2 1ZRDA 3PU8A 1MVEA 1PM4A 3FJSA 1H30A 2RS13 4JDOA 1E5IA 2D6OX 4FAGA 3NV3A 3RMXA 5A32A 4XFAA 3AKRA 2NYYA 5H9QA 2VVEA 2NPIA 3SISA 2P2KA 5FY4A 1HV0A 2YGLA 2BVVA 3USSA 5CEHA 1U0AA 2W1UA 4XMAA 3N7JA 4W4ZA 4W6XA 3VZMA 3ON7A 1O4TA 4DRRA 2Q1ZB 5IFTA 5KBFA 2OIIA 4KMQA 3V0AB 2HWF2 2B5HA 1LKNA 3ACIA 2WZR2 4CUGA 1VBC1 5A1LA 4GWIA 5B4XA 3BVCA 3OD4A 3S7IA 4IV3A 2ZBJA 4E4ZA 2R6QA 5JXHA 2B39A 3R4UA 4X6RB 2P3JA 3KGZA 3E6BA 4YVSA 5FWJA 1AR62 4Q0SA 1DF0A 2R1DA 3DPRB 4LKEA 2C4XA 2W08A 2IFRA 2RDNA 2WINB 5J48A 2PHFA 5A7WB 2CDPA 1QJY1 3KT1A 4M3CB 5C4WB 3OPWA 4BIFA 1LOFC 5EJ3A 5DMYA 1NQJA 4GH4A 5JIAA 3RYKA 5GZGA 4KG0A 2A6VA 1W6QA 4WZCA 2BNNA 2KR2A 3PUIA 2XMLA 3FFQA 1UMHA 4C0HA 5C6CA 3K77A 3U07A 2JDAA 4FVVA 2R7EB 3ZR5A 3E6CC 1RUJ2 1UU6A 1NCRB 2VVDA 4XE9A 3ZKUA 1QJY3 1HJFA 4QMAA 4XUOA 1QOSA 4NE9A 2BERA 1FT9A 3SXWA 5LK7B 1SLAA 4LBQA 2I45A 1DYPA 4JGZA 4UXAA 4YLZA 3ZX7A 4DEVA 3ACGA 5FREA 4OHWA 2XB6C 1RUI1 1AUYA 1BJQA 1QKQA 4QX7A 3USUB 5C8CC 4AEJA 1CZTA 1HKDA 3WP6A 2K2SA 1BHGA 4LA3A 3E6DA 3A21A 4MXWA 3JU9A 4JRAA 1NCQC 4ZU5A 4DY3A 1H1IA 3URFA 4PDWB 2HKXA 2UWAA 3I2JA 3CBNA 1HV1A 2VULA 3WF4A 1KGYA 1W6PA 1CONA 1GFF2 5FWEA 3IMMA 5DG1A 1EPZA 4P14A 4IEXA 3LGRA 1CX4A 3Q8FA 3NVCA 3MFCA 4YW2A 3WW1A 1F31A 5JI9A 4A45A 2ZGNA 1OLRA 3ZSKA 1F2NA 3NKGA 1DGWA 1Z7S2 1ZZ9A 4CUBA 2QQPA 1WLTA 1XPWA 4JKMA 5KC6A 1RUF1 2E63A 5A6QA 3MV01 4DXZA 2XHKA 4DXRA 1W3XA 2AC1A 1W2UA 1S0EA 2PLV1 2YC4A 3WW4A 2JD9A 5KHIA 4XTMA 1OLME 5D8AA 3K48A 3PLQA 4E2GA 1LHVA 5LASA 1ASJ1 3NNFA 1LU1A 5F3EA 4RGKA 5A6XA 1G9AA 5EZWA 3AKSA 1IS4A 2IXJA 2Z2SB 4QKDA 1B09A 2P17A 2WO1A 1AYM3 4A6SA 4CSWA 4D0QA 4ASKA 3TN93 3AJZA 4CEYA 2QQJA 1VPHA 1Q8SA 3VKFC 5FP9A 3I2FA 2WC2A 1HRI3 3KMHA 3Q8BA 1H4GA 4UBGA 2RV9A 1JH5A 3FBYA 1WMXA 2VBBA 1ZBA2 3O1UA 2OS2A 1IGOA 4YFWA 3THPA 5T55A 2HWE3 2A6XA 2RM21 3ZXAC 4COWA 3M3QA 1EY2A 2WSUA 4K6BA 3U1XA 2YBSA 4E9KA 1FMD2 2GC3A 3FUQA 5T52A 4FSJA 2YPJA 4AEDB 2LALA 2KXLA 3DKQA 4IESA 4DXTA 2ZGPA 1K5MB 3TEWA 3GYDA 1VBC2 1JYVA 1IG0A 1ND2A 5FKBA 3J7LA 4J25A 4P9IA 3T2PA 5LCWL 1FV2A 4FOVA 4S2DA 2JIGA 3UYJA 5FMCA 1PIV1 1PO11 3ME2A 4Z2WA 4JQRA 1AR91 2VQAA 1JTZX 5IAVA 4BK5A 2WFF2 3MIFA 3WNNA 1UWWA 2WUHA 5J36A 4CDUB 4IERA 3OGVA 4DEQA 1AL23 3IAQA 2VCMA 4NPMA 5F6KA 5CA6A 5T5LA 4DB5A 1HRI1 1X36A 2BGCA 3SHRA 3OUHA 4BMBA 4COYA 5L7OC 3KVAA 4NPLA 3SKJE 1AJOA 4M3CA 2X5IC 3WP4A 1AYM1 2YB7A 4X8PA 4AVCA 4UFLA 1ZREA 1RUG3 1XSQA 3POIA 5I0RA 3VHOA 2UWCA 3W5NA 3SC7X 1YFXA 1VALA 5BNNA 2ATFA 4LOSA 4N90A 2HH9A 3LDBA 3DYMA 2E26A 3LA3A 1C4RA 3FN9A 4M01A 2GH8A 5A32B 2HEWF 3FE5A 1FOD1 5DUVA 3H1WA 1FPN1 3M2MA 2PHRA 4XVHA 1RUD3 2ARBA 3I4IA 5I8SA 1UYYA 5HXMA 1EAH1 2WDBA 4ZZ5A 1YIFA 2XKPA 2BFUS 4FOYA 1SLBA 2X8KA 4DS0A 3VGIA 3T0BA 4MLOA 5LBBA 3VBUB 2YPDA 4PIYA 3RJRA 2W1WA 3W58A 3ZDVA 2GC1A 2JENA 2XLGA 4XBQA 5GZEA 5CFCC 1R083 2C24A 2AR6A 4PF5A 1WW4A 4XMIA 3KHCA 2WNVA 1VLNA 4FPEA 4LOTA 3L2HA 4QGLA 3VBRC 3AL5A 4FFIA 1CJDA 4GMP0 5FPLA 4QPGA 1NY71 4NN0A 3UT0A 1QIQA 4ZU7A 5BV6A 3N7MA 2BOJA 1UY0A 4N8MA 2R1BA 3OPZA 2FZ1A 2R063 3H42B 4CDWA 1BXHA 4HPKA 4P9WA 2CWMA 5JXGA 1NLQA 4MSVA 2BW8A 2WZR3 4V2VA 3CMGA 1F9KA 4XUPA 4H3WA 4C8DA 5FYCA 2JIJA 5A3UA 3Q8AA 1OQ1A 4L11A 1J59A 4FAHA 3MV11 1H2LA 4Z2AA 4FQZA 1PZ8A 2GSYA 1I3HA 2DFBA 3NMBA 1YCIA 3O1MA 5JSRA 5A6ZA 3VKNA 5FY1A 3D5OA 1W8NA 1CAUB 2V4VA 4PCRA 5BNOA 3AZXA 1C3HA 2P6CA 1RUJ3 4S2HA 4NWWA 3GZAA 3RYRA 1UIJA 5A1AA 2RHPA 1U5ZA 1O7FA 1ZA7A 4KWLA 3JBG2 2H0BA 3T2QA 4HONA 2VUJA 4XETA 1H1AA 1COV2 1FATA 1QDOA 1X9TA 5A3TA 5C70A 4Y4RA 1DGRN 2VD7A 2HWC2 4QPIC 2BQPA 3DUIA 4DMIA 4GZ9A 3BCWA 2XWJB 4P9XA 1RIRA 2BDRA 3S5QA 5IVJA 5LA0A 2QBXA 2JDKA 3SCFA 2C6SA 4MO3M 1BEV2 1MEC1 2WNEA 4AF9A 2MEV3 4Z07A 3KT7A 1PGL2 4BJ0A 1HLCA 2D98A 2WZEA 1R092 3P5BA 2ZAHA 2DDUA
chains in the Genus database with same CATH topology
2GP3A 4QXHA 5FZMA 2PXJA 5FYTA 5A7WB 5FZAA 3N9OA 4XDPA 5LY2A 3KVAA 3OPWA 4QX8A 3U78A 4GJZA 5F32A 5E6HA 5A7SA 5FYVA 5FYBA 5FYMA 2XMLA 5A3WA 2WWUA 3ZLIA 2XXZA 5FY8A 2YU2A 3PU3A 5FXWA 3LDBA 5FZIA 4DIQA 2Q8EA 4HOOA 4XDOA 5A1FA 5F39A 5IVEA 5A80A 5FZ8A 5FYUA 5FZKA 2WWJA 5F3IA 3AVRA 3KV5A 5LW9A 3DXTA 4IGQA 2OQ6A 4QXBA 5FZCA 4QX7A 5FXZA 4CCKA 3RVHA 3N9LA 5FYIA 3KV6A 2YPDA 5FPBA 4LIUA 2XUEA 4BXFA 3PURA 5F37A 4Y3OA 4TN7A 5IVVA 5FZ7A 5FBJA 3DXUA 4QWNA 4Y33A 5FWEA 5A3PA 3AL5A 5FUPA 3PDQA 2OT7A 5FPLA 4V2WA 2YU1A 5F5AA 5FZFA 5K4LA 4IGOA 4NUBA 3K3NA 5F2WA 2YBKA 5FYSA 5IVYA 5FY7A 2OQ7A 3N9MA 4EZ4A 5ISLA 5FYHA 4AI9A 4CCOA 5FZ0A 4CCJA 3KVBA 5F2SA 5FP3A 5FZHA 5FXXA 5LWBA 4V2VA 4DO0A 5A3NA 5IVFA 4C8DA 5FYCA 5A7WA 5FZBA 5FZOA 2P5BA 4AAPA 5IVBA 3PUQA 5FV3A 5FP8A 3N9NA 4LXLA 5FPAA 5FXVA 5FZDA 4BU2A 2W2IA 2YBPA 3K3OA 3OPTA 4QU1A 4GJYA 5FZ4A 5F3EA 4LITA 4IGPA 5FZOB 5FPVA 3LD8A 5F5CA 5FP4A 5A7PA 4CSWA 2Q8DA 3K2OA 3N9QA 4GAZA 5FZLA 4ASKA 5IVCA 5FY9A 3PU8A 5FY1A 4CCNA 4URAA 5FP9A 5FZ6A 4EZHA 4CCMA 5IWFA 5ANQA 5FY0A 5F5IA 5A7QA 5A7OA 5FZ3A 4QXCA 3ZPOA 4D6QA 2OS2A 4D6SA 5FZEA 3N9PA 5IW0A 1VRBA 3AVSA 5LY1A 5FY4A 2YBSA 3KV4A 4GD4A 4HONA 5FZ9A 5FY5A 3U4SA 2GP5A 5FYYA 5CEHA 5A3TA 3KV9A 4Y4RA 5F3GA 5FJHA 2VD7A 3PTRB 4CCLA 5FPUA 4UF0A 5FJKA 4BISA 4EYUA 4LIVA 5IVJA 5F3CA 2XDVA 3NJYA 5FZ1A 5A7NA 5KR7A 4E4HA 3PUSA 5FUNA 3UYJA 4CUGA 5A1LA 5FZGA 3AL6A 4D6RA 5FYZA 3PUAA 5FWJA 5FP7A 2Q8CA 2OX0A 4UF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GP3 A;  4QXH A;  5FZM A;  2PXJ A;  5FYT A;  5A7W B;  5FZA A;  3N9O A;  4XDP A;  5LY2 A;  3KVA A;  3OPW A;  4QX8 A;  3U78 A;  4GJZ A;  5F32 A;  5E6H A;  5A7S A;  5FYV A;  5FYB A;  5FYM A;  2XML A;  5A3W A;  2WWU A;  3ZLI A;  2XXZ A;  5FY8 A;  2YU2 A;  3PU3 A;  5FXW A;  3LDB A;  5FZI A;  4DIQ A;  2Q8E A;  4HOO A;  4XDO A;  5A1F A;  5F39 A;  5IVE A;  5A80 A;  5FZ8 A;  5FYU A;  5FZK A;  2WWJ A;  5F3I A;  3AVR A;  3KV5 A;  5LW9 A;  3DXT A;  4IGQ A;  2OQ6 A;  4QXB A;  5FZC A;  4QX7 A;  5FXZ A;  4CCK A;  3RVH A;  3N9L A;  5FYI A;  3KV6 A;  2YPD A;  5FPB A;  4LIU A;  2XUE A;  4BXF A;  3PUR A;  5F37 A;  4Y3O A;  4TN7 A;  5IVV A;  5FZ7 A;  5FBJ A;  3DXU A;  4QWN A;  4Y33 A;  5FWE A;  5A3P A;  3AL5 A;  5FUP A;  3PDQ A;  2OT7 A;  5FPL A;  4V2W A;  2YU1 A;  5F5A A;  5FZF A;  5K4L A;  4IGO A;  4NUB A;  3K3N A;  5F2W A;  2YBK A;  5FYS A;  5IVY A;  5FY7 A;  2OQ7 A;  3N9M A;  4EZ4 A;  5ISL A;  5FYH A;  4AI9 A;  4CCO A;  5FZ0 A;  4CCJ A;  3KVB A;  5F2S A;  5FP3 A;  5FZH A;  5FXX A;  5LWB A;  4V2V A;  4DO0 A;  5A3N A;  5IVF A;  4C8D A;  5FYC A;  5A7W A;  5FZB A;  5FZO A;  2P5B A;  4AAP A;  5IVB A;  3PUQ A;  5FV3 A;  5FP8 A;  3N9N A;  4LXL A;  5FPA A;  5FXV A;  5FZD A;  4BU2 A;  2W2I A;  2YBP A;  3K3O A;  3OPT A;  4QU1 A;  4GJY A;  5FZ4 A;  5F3E A;  4LIT A;  4IGP A;  5FZO B;  5FPV A;  3LD8 A;  5F5C A;  5FP4 A;  5A7P A;  4CSW A;  2Q8D A;  3K2O A;  3N9Q A;  4GAZ A;  5FZL A;  4ASK A;  5IVC A;  5FY9 A;  3PU8 A;  5FY1 A;  4CCN A;  4URA A;  5FP9 A;  5FZ6 A;  4EZH A;  4CCM A;  5IWF A;  5ANQ A;  5FY0 A;  5F5I A;  5A7Q A;  5A7O A;  5FZ3 A;  4QXC A;  3ZPO A;  4D6Q A;  2OS2 A;  4D6S A;  5FZE A;  3N9P A;  5IW0 A;  1VRB A;  3AVS A;  5LY1 A;  5FY4 A;  2YBS A;  3KV4 A;  4GD4 A;  4HON A;  5FZ9 A;  5FY5 A;  3U4S A;  2GP5 A;  5FYY A;  5CEH A;  5A3T A;  3KV9 A;  4Y4R A;  5F3G A;  5FJH A;  2VD7 A;  3PTR B;  4CCL A;  5FPU A;  4UF0 A;  5FJK A;  4BIS A;  4EYU A;  4LIV A;  5IVJ A;  5F3C A;  2XDV A;  3NJY A;  5FZ1 A;  5A7N A;  5KR7 A;  4E4H A;  3PUS A;  5FUN A;  3UYJ A;  4CUG A;  5A1L A;  5FZG A;  3AL6 A;  4D6R A;  5FYZ A;  3PUA A;  5FWJ A;  5FP7 A;  2Q8C A;  2OX0 A;  4UF0 B; 
#chains in the Genus database with same CATH topology
 1LED A;  3NJV A;  3P3P A;  1GAN A;  4FPF A;  2E9Q A;  3LA2 A;  3VZK A;  4L8Q A;  3WT3 A;  4EJR A;  2PEL A;  5HV4 A;  4E2Q A;  3A0N A;  1AR8 2;  2E7T A;  4I3P A;  5IAT A;  2WO3 A;  3D0J A;  1BVP 1;  1Q8Q A;  1LGC A;  1NE6 A;  2H0V A;  5IAX A;  2XH6 A;  1DCS A;  1LOG A;  1HN1 A;  4RGG A;  2HWD 1;  2JG8 C;  2QJV A;  1VB4 A;  4Y5T A;  5FUI A;  2YU2 A;  2FDG A;  2BBA A;  4CEY B;  4FPO B;  1ZX5 A;  3LOI A;  4L0P A;  4IEU A;  4Y1U A;  5JIU A;  2FCT A;  4XCA A;  4LOR A;  1RHI 1;  2YV8 A;  2HEY F;  3IT8 A;  1ULF A;  3CJI C;  3MLJ A;  2JDY A;  3R6S A;  4M0H A;  4IEZ A;  4WVZ A;  4CDX A;  1B35 C;  4FFG A;  2D3S A;  1JHJ A;  3CDZ B;  3HNY M;  1RUH 1;  2RDR A;  4NRP A;  3LEI A;  4UW5 A;  1UN1 A;  5FYI A;  2O8Q A;  3SCH A;  3ZYP A;  1C8M 1;  4EN6 B;  4KU8 A;  3VBU A;  2VNG A;  1AR8 3;  3ZFF C;  4YAR A;  2VL4 A;  4UFH A;  5EIY B;  2J22 A;  4CUC A;  2WQZ C;  1W9T A;  4YGD A;  5L7O A;  1YFU A;  3ZIX A;  2NN8 A;  2Y6F A;  2B8M A;  1GWM A;  2B9U A;  3IIA A;  5E89 A;  4A3X A;  1LNS A;  1RJ7 A;  1V6J A;  1UU5 A;  1RYY A;  4QM8 A;  3QOP A;  3NL1 A;  1C5I A;  2WFF 3;  1IS5 A;  2YU1 A;  3M70 A;  5FQ0 A;  1PZ9 A;  2W52 A;  5F5A A;  3VDD A;  2D44 A;  2YFU A;  3AX4 A;  5K4L A;  2W94 A;  4QDS A;  4ISR A;  5JMO A;  1ULD A;  2RR1 3;  3UV9 A;  4ARX A;  5K8S A;  4URT A;  2W1S A;  2Y6J A;  4MXW B;  2K46 A;  1YI9 A;  3PVB B;  2IXI A;  3ZXL A;  2WN2 A;  5F2S A;  5FP3 A;  3W59 A;  3B5L B;  5LWB A;  1PVC 1;  1UOB A;  5CAZ A;  3ZVX A;  2XJQ A;  4NIG A;  2P5B A;  1PNG A;  5IVE A;  1W6P B;  2VMI A;  3MIH A;  3C7O A;  1Q5O A;  1B35 B;  4QKF A;  3VV1 A;  2Y6G A;  1GP6 A;  2W2I A;  3CJI B;  3K3O A;  3OPT A;  4Z8B A;  4ZON A;  4WM7 B;  3I2O A;  2JEC A;  4TLF A;  4F8A A;  1XXN A;  3UET A;  5GZD A;  5FMO L;  1ND3 B;  1A8M A;  3H3U A;  1VBE 3;  2J7M A;  5FZ6 A;  4Y26 A;  1X82 A;  5JPM B;  2VMF A;  2JG8 B;  4LBJ A;  2YYO A;  1VBB 2;  3WF2 A;  3L9J T;  1SCS A;  4ISQ A;  4XF1 A;  3CKH A;  1V70 A;  2X5I A;  2VNO A;  4ES8 A;  1GUI A;  2E7A A;  3LZZ A;  5CNA A;  1H9P A;  1H6Y A;  2CNA A;  2VQU A;  1PNF A;  2WNO A;  4UFJ A;  1N3Q A;  5DAP A;  1S0J A;  1W8F A;  3HJR A;  4Q1R A;  3M3O A;  1MZ6 A;  1SLL A;  3OD0 A;  1LOE A;  1UMI A;  3ZN5 A;  4CA9 A;  1JU4 A;  3RSJ A;  5KXB A;  4DXS A;  1HRV 1;  5JOX A;  4QX1 A;  2QZ3 A;  2Y6L A;  3DEC A;  2VZU A;  4DUV A;  5L9R A;  4WM7 A;  2RMU 2;  2HLE A;  3HR9 A;  3IM0 A;  4YGE A;  3M3C A;  3NAP A;  5EV7 A;  1V9U 2;  4BA6 A;  4LKS A;  1F4A A;  4N43 B;  2WS9 2;  3SQO A;  1X9P A;  1KJR A;  3POG A;  1SMV A;  3FLP A;  5FZM A;  3GDB A;  1YRZ A;  3FHI B;  4NHY A;  2E53 A;  2WAO A;  4LO6 B;  3MW3 A;  4O7X A;  2JG9 A;  3U10 A;  3VHR A;  1KRI A;  3BYW A;  4QKN A;  2XVL A;  4RN5 A;  1VB2 A;  4XUN A;  3B69 A;  2DUO A;  2R06 2;  5C33 A;  2WWU A;  2XXZ A;  4A7K A;  1G86 A;  4OI1 A;  1REF A;  4M3C E;  3CEW A;  3VN4 A;  1N1S A;  1DZQ A;  2VMH A;  3OCP A;  1ZNP A;  3G7D A;  5T50 A;  1U12 A;  2V73 A;  3NWK A;  3S30 A;  3LCP A;  1E5S A;  1LHU A;  3GCW A;  4Q29 A;  3GBW A;  3WF1 A;  2PAE A;  3TYJ A;  3ZXG A;  1CIY A;  3GM8 A;  4XAC A;  2IXK A;  1W90 A;  5HBA A;  5DDJ 3;  1OPO A;  1OUR A;  3MBW A;  2R0H A;  4CP2 A;  3LOB A;  2DF7 A;  4BXF A;  1QJX 2;  5JOY A;  2Y6H A;  2XUM A;  4RHV 1;  4CU8 A;  2B4K A;  3AZV A;  4HKW A;  4Q4V 1;  4JHZ A;  4MV2 A;  1VRH 2;  4BPZ A;  3RGB A;  1TNR A;  4Z92 B;  2WKK A;  5FLJ A;  4DNY A;  5LBE A;  4TSV A;  4A2U A;  2ARX A;  2OUJ A;  3MW4 A;  1KS4 A;  5JVV A;  3WNL A;  2EAK A;  4QM9 A;  4AAX A;  3POY A;  3Q8C A;  4M00 A;  1XQN A;  3OYW A;  3RYP A;  1UY1 A;  5F2W A;  1HRI 2;  2RDS A;  1TG7 A;  1AX1 A;  1WLD A;  4K21 A;  4YW3 A;  3VKO A;  3TN9 1;  1ZZ8 A;  1OVS A;  3MIG A;  3VD4 A;  1AYM 2;  5CFC B;  2JB4 A;  1BEV 3;  1IPJ A;  3WQ7 A;  1LU2 A;  3CQO A;  3PL0 A;  2X05 A;  3KSC A;  4DY5 A;  3MPP G;  1ASJ 3;  2WNV B;  4ES9 A;  5A3M A;  4XUR A;  1AJK A;  1WBL A;  3NJX A;  4EV0 A;  3WQ1 A;  3NNJ A;  4ASM B;  1QOO A;  4JZR A;  1UZV A;  2DU1 A;  1W9W A;  3GBG A;  4RFR B;  5E8A A;  3TOJ A;  3WHU A;  2WT2 A;  3BPZ A;  4H7L A;  2QDN A;  2QTW B;  2Z5W A;  4QQL A;  2W5F A;  3K46 A;  4P5Y A;  2XLA A;  4EZH A;  2J1S A;  1UY2 A;  2BP6 A;  3UKT A;  1OOP A;  2A75 A;  3W20 A;  1YJL A;  4AFC A;  3VBS A;  1WA4 A;  3HAG A;  2RS3 2;  1RIT A;  1C5H A;  1ZBE 3;  2G9F A;  2VPV A;  4XUQ A;  2IVI B;  4B4R A;  1RVF 1;  5FY5 A;  2VBD A;  2DVA A;  3GCX A;  1LGN A;  1HW5 A;  2RS5 1;  1NXM A;  1OD3 A;  3WP3 A;  3T1L A;  1BYH A;  3LEK A;  1TEI A;  2CAU A;  3N7K A;  5CVR A;  4AQ2 A;  4CDU C;  3HT1 A;  1LR5 A;  1QNW A;  2ZMK A;  2FQP A;  1ZA4 A;  2F6B A;  2JDH A;  3POF A;  5JR2 A;  2A5Z A;  3JUU A;  4LUL A;  4QX3 A;  2K0G A;  4Y5S A;  4LEJ A;  5HV0 A;  3PMS A;  1QQP 2;  3J7M A;  5EQU A;  2F4L A;  3VKL A;  1K5M C;  3NST A;  4Z82 A;  2RR1 2;  2Y60 A;  4LE3 A;  5BNP A;  1OH4 A;  1QJU 3;  4UF0 B;  3TEX A;  1OVP A;  1RUD 2;  4PQQ A;  4AED C;  3VZN A;  2GDF A;  4XTP A;  5EPA A;  1ACC A;  5IT6 A;  2EXJ A;  4AHZ A;  2JWP A;  4HVR A;  1APN A;  4UW4 A;  2C9A A;  2TEP A;  2ZAC A;  5LEJ A;  4KBB A;  1NE4 A;  1X8M A;  5LA9 A;  5A6Y A;  3ZMO A;  4UWD A;  3ZSL A;  4QD2 A;  4RFT 0;  4BQW A;  2R30 A;  5CKQ A;  1UD1 A;  4IND A;  5A3W A;  1CN1 A;  4SLI A;  2OXB A;  1N3O A;  3H9A A;  4QPG B;  3Q8E A;  3WV6 A;  3C7G A;  4BE3 A;  3HOB A;  1JOP A;  3BPS A;  2BYV E;  1EPW A;  5EFU A;  1NLS A;  1VBD 3;  1VMJ A;  1WKY A;  1GQP A;  2VZ1 A;  5BPX A;  2GME A;  2WA3 A;  2DWR A;  4QGM A;  4XW3 A;  4WBB A;  1VBC 3;  4KQ7 A;  5C7G A;  3ZYI B;  1O5U A;  3TWI A;  1QJX 1;  1WD4 A;  3IPV B;  4QB6 A;  4XBL A;  4AGR A;  3PIJ A;  2Y0I A;  3NW4 A;  4AOC A;  4QPG C;  2VXJ A;  4NR1 A;  1XE0 A;  2RM2 2;  2XBO 3;  5CKM A;  2OPW A;  2PAK A;  5F37 A;  2D7F A;  5JDB A;  4UW3 A;  4Q8L A;  1AZD A;  4G4F A;  1CES A;  1HB4 A;  2JD4 A;  3AJY A;  3B02 A;  3KZ4 C;  1BBT 3;  5DAX A;  1RUO A;  2WNU A;  1NKG A;  2VUA A;  1AR7 3;  1WGP A;  3AMP A;  4YGB A;  2B46 X;  3ZYR A;  2PAM A;  3S6P A;  5FUP A;  4ZU4 A;  4KGQ A;  4HK9 A;  1ZYB A;  3K4D A;  3KS7 A;  2C5D A;  2ILM A;  3EB7 A;  4K9S A;  2HWB 1;  2ZHM A;  3IDC B;  5FZF A;  2Y26 A;  3ITQ A;  1VBD 2;  1D0G A;  1NCQ B;  4N9I A;  2W39 A;  3ZR6 A;  1W03 A;  3ELN A;  1CPN A;  1A3K A;  1XND A;  3AXD A;  4PBO A;  3IPV A;  3RMY A;  1V0A A;  1TMF 2;  2E6V A;  3RZG A;  5FRA A;  1W6O A;  1PM7 A;  3OJB A;  5JUV A;  2GNT A;  5D2A A;  1D4M 2;  4KNC A;  1WLW A;  2PHD A;  3B7M A;  1O3Q A;  2WLP A;  3B94 A;  4HXC A;  4AVV A;  3DF0 A;  5CIR A;  1UZY A;  4LUM A;  5JSO A;  4Q4W 3;  2HWB 3;  3III A;  1W3V A;  3SMH A;  4JGY A;  4R9D A;  1KEX A;  1ALY A;  4XJZ A;  1SLC A;  1CPM A;  2QQN A;  5C3P A;  5ANQ A;  3SIT A;  1OKO A;  1FOD 2;  2R07 3;  2W1Q A;  4I3G A;  1BBT 1;  3GBF A;  1RGS A;  1FPN 2;  4PQ9 A;  4XC9 A;  5DDJ 2;  5FZ3 A;  5KHH A;  4CRQ A;  1M4W A;  1NG0 A;  4Y20 B;  3AVS A;  3WW2 A;  1H6X A;  2JDU A;  2ERF A;  3AZW A;  1V6L A;  2DCT A;  2VE1 A;  1R09 3;  2WAB A;  1TMF 3;  4NWV A;  4OLL A;  1ZZ6 A;  1WMF A;  4Q0U A;  1QJX 3;  1C1L A;  2BBV A;  1S0D A;  4FPL A;  3DPR C;  3T1M A;  3Q9O A;  1H0B A;  1W9F A;  4CU7 A;  4BQ3 A;  1ULC A;  2XDV A;  2WNV C;  4RQP A;  3AYC A;  3PUH A;  2NLR A;  4ZS2 A;  5FZG A;  4R52 A;  4D6R A;  3O12 A;  1C57 A;  5BUV A;  4HPK B;  4XJA A;  2OX0 A;  4MXV A;  2WO7 A;  2A6W A;  1YI7 A;  3C2U A;  1IZ3 A;  2N7G A;  1PO2 1;  3AKP A;  2PXJ A;  3H1Y A;  4XHB A;  3O5S A;  3ZXK A;  3WLU A;  4A7Z A;  4YSF A;  5CB7 A;  1F4H A;  4AEM A;  4AK3 A;  2VY0 A;  1AXZ A;  3N7L A;  5EJ1 B;  1DLL A;  3OUI A;  1N3P A;  1DBN A;  2RMU 3;  4YG0 A;  4M0N A;  2DVD A;  1H8V A;  2ZOE B;  4PI0 A;  4IQP A;  4AW7 A;  2WS9 3;  3APB A;  5FY8 A;  4R4Z A;  4XZP A;  1OA2 A;  1PMI A;  1ZZC A;  4ZXE A;  3ZXD A;  2CU5 A;  3OBA A;  4RA0 A;  1SBE A;  4JHT A;  3WG3 A;  1YUD A;  1AR6 3;  3HWJ A;  2O0O A;  1VBB 1;  5LW9 A;  3DXT A;  3HPN A;  3ZXF A;  1MVQ A;  2Q30 A;  2XG3 A;  4YZ2 A;  2NZ9 A;  2ZGM A;  1TQ5 A;  5FBZ A;  4GIQ A;  5SV5 A;  2QKD A;  1I5P A;  2RS5 3;  3GNE A;  5E88 A;  3I54 A;  1CJP A;  5LA2 A;  5J98 B;  2AUY A;  5JSP A;  5KC5 A;  1KFX L;  1CD3 G;  4LO8 A;  4YVW C;  2WFP A;  2RE9 A;  2UY8 A;  3B00 A;  3H3L A;  3BTX A;  1Q8P A;  2CY6 A;  4CPB D;  3POJ A;  4DFS A;  3WR0 A;  2JDP A;  1V6K A;  3DYP A;  2BGO A;  4LKD A;  1X8E A;  4LT5 A;  1DU3 D;  2XJS A;  3ZFE C;  5KHG A;  2VC9 A;  2D3R A;  2NQY A;  1F5J A;  2JKX A;  4BQ2 A;  1Q8O A;  2AEY A;  2JG8 A;  4WVM B;  4AZZ A;  2C9K A;  4XQW A;  1GBG A;  5IVY A;  4DRV A;  3HD8 B;  4W65 A;  3I8T A;  1V6I A;  4N43 C;  4QDR A;  3WQB A;  4LBN A;  1DLC A;  3VBO C;  2VW0 A;  1Z7S 1;  4DO0 A;  5FZB A;  3NKT A;  2ZAB A;  4YW4 A;  4I30 A;  1W2A X;  3WG2 A;  4Q0V A;  1FMD 1;  2QFE A;  4CU6 A;  3P1I A;  4BU2 A;  1RUE 1;  2IC1 A;  4QPY A;  2D3P A;  2PA7 A;  3OYW B;  5FZ4 A;  5IFP A;  1QWR A;  2EVX A;  3LE0 A;  3WOG A;  1WCS A;  3SNM A;  2Y34 A;  5BY5 A;  3C7F A;  1OUX A;  4U36 A;  4CYD A;  3AKT A;  3CO2 A;  2YY1 A;  2DBN A;  2VGD A;  2WRA A;  1SZB A;  2SBA A;  2JDZ A;  2UWB A;  1LOD A;  2VR4 A;  3A22 A;  1VBA 3;  5FK7 A;  4L2N A;  4CVU A;  3CZJ A;  3C7H A;  3UK9 A;  3U75 A;  1WLC A;  3GJB A;  3I3E A;  4XIO A;  3RZJ A;  2J1A A;  1N1V A;  2XL7 A;  1ND3 C;  1DIW A;  1QJF A;  1GQH A;  2ZGL A;  3NV1 A;  4KWK A;  1VRB A;  4RHV 2;  4AGG A;  2YC2 A;  4BQ1 A;  4WM7 C;  2QZ2 A;  5FZ9 A;  3HT2 A;  1TNF A;  2DVF A;  2GP5 A;  2KD7 A;  2Q8O A;  1W8H A;  2FMY A;  2JE9 A;  3RPQ A;  3O1O A;  2E31 A;  1IQA A;  5F6L B;  2WR9 A;  4JTN A;  3RDI A;  2W91 A;  1GSL A;  4XIL A;  3IN9 A;  1KFU L;  5FQ0 B;  1RHI 2;  1W2T A;  2NM1 A;  3C8X A;  1JOD A;  3VBH A;  4Q4X 3;  5FFO C;  1LB2 A;  4AFM A;  3VDA A;  5FP7 A;  1FMD 3;  1PO2 2;  3HN1 A;  4Q26 A;  3TB0 A;  4BHP A;  1QHD A;  3S57 A;  3J4U H;  2HBT A;  4P02 B;  4N9H A;  1MQT C;  2VXR A;  3KCY A;  5FZA A;  1MZF A;  3LDR A;  4MVT A;  1SDW A;  1LRH A;  1EUU A;  4CE8 A;  4FFF A;  3U78 A;  5JLV A;  4WM8 B;  1YQ2 A;  4D8M A;  3A4U A;  4JGZ C;  5FYB A;  3GHN A;  1VJ2 A;  3R0R A;  3VZL A;  1HB3 A;  1Y9G A;  3PU3 A;  5FXW A;  3THC A;  3HQR A;  3ZFF B;  1WZX A;  4HK8 A;  1OLQ A;  2ORX A;  3B9I A;  5D1I A;  3J8F 3;  4IUG A;  4XJW A;  1W6N B;  1MZ5 A;  1TVG A;  4YZ1 A;  5BYN A;  5F9T A;  1EYB A;  2PMW B;  3NNL A;  4QT6 A;  5GAL A;  4I0B A;  3ZYG A;  2B45 X;  4OUE A;  3U37 A;  4CDX B;  1NLR A;  1SBD A;  4P9L A;  2RS3 1;  1GKB A;  1FI2 A;  4JGY B;  5FZC A;  5FXZ A;  1PVC 2;  2XQR A;  3N9L A;  4F83 A;  1UZ0 A;  2VUC A;  3NNG A;  1BK1 A;  3I59 B;  2JB8 A;  3MYX A;  1WUV A;  3I3D A;  3HMY A;  5D21 A;  4CEY C;  1DFQ A;  1OFN A;  4TN7 A;  2JE8 A;  4Y20 A;  3WNP A;  1PGS A;  1LGB A;  5JMC A;  4ATE A;  4ZKT B;  3NNM A;  5K7P A;  4Y22 A;  3IDA A;  3S5A A;  3MZH A;  2AGS A;  3M7A A;  2JEM A;  4Y33 A;  4GQ7 A;  1AYN 2;  2I07 B;  4AVA A;  2C1F A;  2CV6 A;  2XJT A;  4LKF A;  2VOK A;  4EN8 B;  2EA7 A;  2Z4F A;  1XNB A;  1DYO A;  4NUB A;  4CP9 B;  4OZX A;  1QDC A;  1UYP A;  1V9U 1;  3ZXE A;  3N9M A;  4HZF A;  4KL1 A;  4IV1 A;  3P6B A;  5LK5 A;  2EF6 A;  2ZX1 A;  4FCA A;  2JG9 B;  3KVB A;  4LBK A;  3KT4 A;  1JZ7 A;  1YFY A;  1PK6 B;  4RL7 A;  4H2A A;  1DGW X;  2XL9 A;  2C0Z A;  4FPY A;  1RUE 2;  3AP6 A;  4QPI B;  3F95 A;  4S2G A;  4X6Q B;  4Y4Y A;  3FC0 A;  3RWN A;  4DZG A;  1Q3E A;  1W2O A;  2HWC 1;  4B1L A;  1YFW A;  4FTB A;  1GLH A;  3K51 A;  3VDC A;  2ET1 A;  2FDI A;  3M3E A;  4Q2F A;  3OG2 A;  4C0B A;  1XSR A;  1QJE A;  1H8T C;  1NQD A;  3KHB A;  4CCC A;  1SAC A;  1LHW A;  4BME A;  1ODM A;  1VAV A;  2Q1F A;  5A7Q A;  2AYH A;  4R9C A;  4XF0 A;  4MGZ E;  1R09 1;  3WEZ A;  5C8C A;  3MLL A;  4L99 A;  3N9P A;  2XVG A;  2VZQ A;  2WA4 A;  2D6M A;  1ND2 B;  2ZGR A;  5FO9 B;  3OGJ A;  3NQH A;  4QX2 A;  5FYY A;  4KU7 A;  1RUC 1;  1S0G A;  1OC1 A;  1YC6 1;  4IEY A;  2BNM A;  5DAB A;  3BGA A;  1SCR A;  5KXC A;  1NX9 A;  4AI2 A;  5FUN A;  1OMI A;  1AXY A;  3LSD A;  2DTY A;  2WBK A;  2XPJ A;  5FKC A;  5FYZ A;  2MPF A;  4XF9 A;  3WDU A;  2VG9 A;  2GP3 A;  2GMP A;  2HYX A;  2ZJC A;  2ZX3 A;  1W0P A;  3ZKY A;  1DGL A;  1UPS A;  2JIC A;  1JHN A;  1S0F A;  2TUN A;  4QKB A;  4XDP A;  1BQP A;  3DCQ A;  3ZFE A;  2A1X A;  3OB8 A;  4P9Y A;  1YJK A;  5ACA 1;  5JOZ A;  1OBN A;  3VBR B;  4YM0 A;  3H0O A;  4AYU A;  4KWJ A;  1LUL A;  2Q5T A;  2HWC 3;  2L9L A;  5I0S A;  5FYM A;  5T3N A;  3HVD A;  4A3Z A;  5T5O A;  4HVQ A;  4PT6 A;  4QU2 A;  1KQR A;  5DAW A;  1ZRI A;  1ZBA 3;  2O8O A;  4Q1P A;  4BLJ A;  4PF1 A;  1UXZ A;  4O9G A;  4QGN A;  2E7Q A;  3V64 A;  3VBU C;  3ZN6 A;  1S2B A;  4AGV A;  1MEC 3;  4N53 B;  2G9G A;  3VD9 A;  3TN9 2;  1BBT 2;  4ATF A;  1NCQ A;  3D6E A;  1RJ8 A;  4CDW C;  3AXE A;  1UZW A;  2YUE A;  1JOB A;  1ZZB A;  1W28 A;  2NMO A;  2IXL A;  2WSV A;  4LO4 B;  1G7Y A;  4NII A;  1OA3 A;  3PTY A;  4FBF A;  4TZD A;  4LIU A;  4BZ4 A;  4PLN A;  2HWE 2;  4SBV A;  5L9B A;  1WA6 X;  3H8X A;  1H9W A;  4Y1V A;  2YFZ A;  4LLO A;  2D40 A;  1JW6 A;  2ZXQ A;  4YG6 A;  1KDK A;  5KXD A;  3ETP A;  3O1S A;  2ZGQ A;  4XAB A;  2J1R A;  5FBJ A;  5J09 A;  1O8P A;  3G6J B;  2CL2 A;  1AYN 1;  3EHK A;  3POE A;  4FT8 A;  2ZX0 A;  2X5I B;  4GA9 A;  2DTW A;  2K9Z A;  3FFZ A;  5GLV A;  3ZIW A;  3ZYB A;  4BQ4 A;  4IE4 A;  5CFC A;  1SQ4 A;  2E32 A;  3T0A A;  3N35 A;  5L7O B;  1K42 A;  4OI4 A;  2Z69 A;  2LRO A;  4WVV A;  3RQ0 A;  4A44 A;  4IGO A;  1W8O A;  5FYS A;  2BTV C;  4UBH A;  3WXP A;  1W0O A;  2DBI A;  3BOW A;  3GF6 A;  4OMD A;  5A70 A;  1IS3 A;  3BN6 A;  5FZ0 A;  4WM8 A;  4V1P A;  5C9A B;  1RVF 2;  3C7E A;  1CGP A;  1CZV A;  4FPJ A;  2D93 A;  5DQ0 A;  1Y43 B;  4I0W B;  3H7Y A;  4FPC A;  4IE7 A;  5FZO A;  1VAK A;  2XHN A;  5JXJ A;  3E5Q A;  4FPG A;  3OY8 A;  2XGX A;  3DPR A;  3VLB B;  1E5R A;  1RUG 2;  2RDQ A;  4GB3 1;  1U5X A;  4MHR A;  4OYU A;  4QU1 A;  2R04 3;  4COZ A;  4BM8 A;  4XPV A;  2UYB A;  3I2G A;  4LJH A;  1JYT A;  4YGC A;  3ROU A;  2XOM A;  4MGQ A;  1VIW B;  4UFI A;  4NID A;  3ACL A;  1VE0 A;  1L7L A;  3MID A;  3J7N A;  2XLF A;  1J83 A;  1UU4 A;  4YM1 A;  5I8Y A;  2P3K A;  3ZPO A;  5CFD C;  1AR7 2;  1JZ6 A;  1B35 A;  1RVF 3;  3KF5 A;  4HL0 A;  2PHX A;  2G19 A;  3JB8 A;  2P3Y A;  5APA A;  1Z78 A;  4M4P A;  2G9Z A;  2KM2 A;  4LTA A;  1LOB A;  2WNU B;  4PJY A;  5IHR A;  5JR7 B;  1PVX A;  2V5D A;  4CCL A;  5IK7 A;  4QXK A;  3KGL A;  3RZK A;  4UF0 A;  5FJK A;  5H9P A;  4DIN B;  1URX A;  4GWM A;  3E5X A;  1F35 A;  1VBB 3;  3M3I A;  4QAW A;  4UYB A;  1IG3 A;  1L7R A;  5TSW A;  1GIC A;  2YHJ A;  5L19 A;  2GAU A;  4H7M A;  5C3Q A;  3ES4 A;  3I2H A;  1MS4 A;  1C28 A;  3ILN A;  2WT1 A;  2WWS A;  2GNM A;  4JCK A;  3B01 A;  5FMB A;  3WNK A;  1NYW A;  1GWK A;  2JE7 A;  5LBC A;  1UOF A;  1V6O A;  2WS9 1;  2A6Y A;  2CGO A;  3VB9 A;  1F5F A;  3OOX A;  3QH7 A;  1HQW A;  1LHN A;  3ETQ A;  4HG6 B;  1O6U A;  3WSO A;  4W6Y A;  4UFM A;  2XJP A;  3EO6 A;  2XKO A;  4Q4X 2;  1MS9 A;  1LJ7 A;  3AM2 A;  3B9C A;  4NHL A;  4OUL A;  3ZN4 A;  4CXX A;  4PDW C;  3H3Z A;  4I01 A;  4B4Q A;  1DP0 A;  2J42 A;  4J1X A;  3BU0 A;  3HEI A;  4DOU A;  3VD7 A;  4ZHN A;  1QU0 A;  3O14 A;  2BUK A;  2ZGS A;  3I3M A;  3O7O A;  4GKX A;  2VMG A;  2ETE A;  4OUS A;  2D6K A;  3ENR A;  5FLI A;  5T54 A;  1RMU 2;  5C8C B;  1HJG A;  4QQ2 A;  4D7T A;  2FD8 A;  3RG0 A;  1XOY A;  2DUP A;  3GHM A;  5KWR A;  1K5J A;  1P8J A;  2DCJ A;  3AB0 A;  4K8R B;  4QXB A;  1W8T A;  3ABZ A;  3OGR A;  3THD A;  3KWV A;  2VJX A;  3OF1 A;  2D5F A;  2VTF A;  1JXN A;  1IHM A;  2WYF A;  5BXX A;  1TMF 1;  1MS3 A;  1Y9M A;  2XUE A;  4NOT A;  1POV 1;  1NCR C;  3HQX A;  4ZXK A;  3ACF A;  1GZW A;  5GLU A;  1MZE A;  1RED A;  3U14 A;  4TTG A;  3DGT A;  5L9V A;  4MGS A;  2R16 A;  4JC1 A;  1G9B A;  4AI0 A;  3VDD B;  1E57 A;  3GZT B;  4QQH A;  3E1F 1;  4JKL A;  3N36 A;  4IEQ A;  3FUO A;  2CSG A;  4MOA A;  1AXK A;  3I3Q A;  3PDQ A;  1DQ5 A;  1KXG A;  5C4W C;  4XXA A;  3UL2 A;  2ES3 A;  5C5U A;  2WYS A;  1RUN A;  1NA1 B;  2PTM A;  3PJY A;  4K7J A;  5FLH A;  2MNG A;  5LAT A;  1LEN A;  4EN7 B;  4XFC A;  5K0U C;  4K3U A;  5FXX A;  2ZGT A;  4LBM A;  4FTE A;  3IAP A;  2R04 1;  5SV8 A;  5IVF A;  1VBE 2;  4ONU A;  3ZMN A;  1C8N A;  1QQP 3;  4XIK A;  2ZGO A;  4RS5 B;  1VRH 1;  3UGF A;  4GB3 2;  2FBE A;  1DQ6 A;  1YLL A;  2A3X A;  3OTF A;  4CDU A;  5JXI A;  2V09 A;  2D97 A;  2J1T A;  2OUH A;  5GLW A;  3TRS B;  3ZYH A;  3OGS A;  4N53 A;  4OHX A;  5C8W A;  2ZKN A;  4ZS3 A;  4PHZ A;  2YMZ A;  3ORJ A;  4NIA A;  3N9Q A;  2QQV A;  1HRV 3;  1LOF A;  1QH7 A;  4UW6 A;  4W8J A;  1JZ5 A;  4PBP A;  4CCN A;  1ZRR A;  4PDW A;  1OOP C;  1PO2 3;  1WME A;  1AR7 1;  3PHM A;  1HQL A;  2RG4 A;  2VME A;  1LTE A;  4Y1X A;  5GLT A;  1O3R A;  5AVP A;  5KHJ A;  3O1R A;  1AHS A;  1UPI A;  1WCK A;  2CAV A;  2HEV F;  4XFF A;  2KA3 A;  2R49 A;  4ERO A;  3SH5 A;  2RJL A;  5D8A C;  1OF3 A;  1RUI 3;  4JKK A;  5C5T A;  1IOA A;  3FBM A;  2YXS A;  1MQT A;  4E4S A;  4A6O A;  2VOT A;  1W6N A;  3AFK A;  1UO9 A;  4IE0 A;  2IVJ A;  1JYX A;  5GZF A;  3HNB M;  1SPP A;  3WQ0 A;  2VNR A;  1UYZ A;  3IWZ A;  4HN0 A;  2ZAA A;  3ASI A;  3C3V A;  2WAA A;  4HBN A;  1CAW B;  1W6Q B;  5GM0 A;  4YRD A;  3T2T A;  3BTY A;  1PVC 3;  3BIE A;  4IEV A;  3J8F 2;  4JDM A;  3D4K A;  3AK0 A;  1OH3 A;  4BXS V;  5FOJ B;  1JZ3 A;  3GZE A;  1IS6 A;  1LCL A;  4JX0 A;  4N7U A;  4XJU A;  4Q4W 1;  4TLG A;  5IUQ A;  1L3J A;  5E6H A;  1OT5 A;  3T2O A;  4EWA A;  4RR3 B;  2ZML A;  5FYV A;  2EXI A;  4Q4Y 2;  4XF3 A;  3RNS A;  5GJ6 A;  4EWE A;  1UOG A;  5ACA 3;  3W5M A;  2D6L X;  5BNP B;  3O1V A;  1GZT A;  1PX4 A;  3UJQ A;  1AVB A;  1W2N A;  4YW1 A;  1O4Y A;  1QQP 1;  1RL3 A;  2QQI A;  4ET7 A;  1HB2 A;  4D94 A;  1W8U A;  2ZPX A;  3DYO A;  3H7J A;  4GXL A;  5DZF A;  3WNM A;  4WZF A;  3NJZ A;  1M06 G;  2OQ6 A;  2RS1 2;  4D7Y A;  3MEP A;  4ARY A;  1GOH A;  3IZO A;  1DZR A;  2QDR A;  3EYP A;  1H1M A;  3SH4 A;  3DEM A;  1Y7B A;  1BVV A;  2PQQ A;  5HCF A;  4CU9 A;  1RUH 3;  3BAL A;  1KIT A;  4CTE A;  3AMH A;  3LIH A;  3MLK A;  1YEW A;  1DZT A;  5FZ7 A;  3VL8 A;  4KBZ A;  3POS A;  2ET7 A;  3PJQ A;  5EHD A;  4QWN A;  1G8W A;  3E5U A;  2EAL A;  3ES1 A;  2XBO 1;  4AR2 A;  2VM9 A;  2QQM A;  4LR4 A;  3PVE A;  3T08 A;  2BZD A;  2GZW A;  2J1V A;  4YVS B;  1KDM A;  1XU2 A;  3WP5 A;  4BWO A;  1VBD 1;  4CCO A;  2VW1 A;  3I49 A;  4CCJ A;  3PME A;  2WN3 A;  3HBZ A;  4MET A;  1RXG A;  4D69 A;  5A7W A;  5IYY A;  3A23 A;  2B7Y A;  4LO5 B;  4YVW A;  2WII B;  2JX9 A;  3PUQ A;  5FV3 A;  4LXL A;  1ENQ A;  4LHN A;  4PLO A;  1CZS A;  3FLR A;  1FV3 A;  4GH4 B;  1D0H A;  1EV1 2;  4KH9 A;  4MGT A;  2VNV A;  4GJY A;  4YM2 A;  3S7E A;  2CYF A;  3JXS A;  3LD8 A;  4Y5Z 0;  5A7P A;  3WW3 A;  5IVC A;  4GAZ A;  2SLI A;  2OA2 A;  4URA A;  2VZO A;  3CJI A;  3H50 A;  2R32 A;  2QCS B;  3OEB A;  3R4S A;  1Y9Q A;  1O91 A;  5FY0 A;  4QX5 A;  4ZY9 A;  1QJU 1;  1S4C A;  1JOJ A;  1QNY A;  2ORZ A;  3RZL A;  2A3W A;  1W6O B;  4L97 A;  4D6S A;  3K75 B;  5IW0 A;  3NO8 A;  3QD6 A;  3AMM A;  3ZFG C;  5JWP A;  3JZV A;  1JYI A;  3WY6 A;  5L73 A;  1S1A A;  2CWS A;  1QXP A;  4C91 A;  1HX6 A;  1SBF A;  4JAA A;  1XE8 A;  2A71 A;  5DAV A;  4AI1 A;  1GZW B;  1WW6 A;  4LIV A;  2XR4 A;  3NJY A;  2W87 A;  4P00 B;  1RTV A;  1S55 A;  3V0B B;  2FDJ A;  1UY4 A;  4PI2 A;  1W05 A;  2FDK A;  3KCC A;  3VBH B;  1W0N A;  1ZBE 1;  5J1X A;  1OI6 A;  1RUE 3;  3R4D B;  4YZ3 A;  4IV1 B;  3ZSJ A;  1CAX B;  1DDL A;  1Y4W A;  1UF2 C;  1NZC A;  3RZZ A;  2D6N A;  3ATG A;  3BOP A;  4RR3 A;  3J8F 1;  4XAE A;  1POV 0;  4ZZ8 A;  2GN3 A;  4RQP C;  4QHO A;  3NAP B;  4LBO A;  4KG8 A;  1Z7S 3;  4FO9 A;  1UOJ A;  4WV8 A;  3VZJ A;  1MPX A;  4WVW A;  1YWK A;  4FP2 A;  3MO4 A;  2P6H A;  4IE5 A;  4RGA A;  1AL0 G;  4FP3 A;  1ODN A;  4MHU A;  2VTX J;  3I3B A;  5E16 A;  4AHW A;  2OZ6 A;  2Q1M A;  3HN3 A;  3LSE A;  2DUQ A;  4GB3 3;  2UUR A;  2ENR A;  4HAN A;  3ZLI A;  5I8T A;  1REE A;  2F17 A;  3B93 A;  1CR7 A;  2Q8E A;  5I91 A;  4NRQ A;  5FMD A;  3ZFF A;  1IQD C;  3AZZ A;  5FZ8 A;  3FHA A;  3LKJ A;  3LPF A;  5HCH A;  3ACH A;  2GND A;  2B9V A;  2LW8 A;  2VZ3 A;  2YC0 A;  2ZCW A;  2XON A;  4NIH A;  4BK4 A;  1ULP A;  2IUW A;  1X33 A;  4IL7 A;  4AQT A;  1QJZ A;  3KV6 A;  4E8C A;  1XNA A;  5FPX A;  5DZE A;  1SFN A;  4AFB A;  2BEO A;  5HXV A;  3FL7 A;  2ZEZ A;  2A6Z A;  5AFB A;  3RZM A;  4AQS A;  5LRS A;  3BTZ A;  1A34 A;  2E33 A;  2LS6 A;  1TZO A;  2VZT A;  4MGY E;  2A73 B;  3ZYF A;  3IDE A;  4G9S B;  1N1Y A;  3CZU A;  4B4P A;  4RHV 3;  1UXX X;  2EAA A;  1UY3 A;  4R9B A;  4TYS A;  5BNQ A;  1YXW A;  5DPN A;  2P1B A;  3WDW A;  4HKO A;  4HSJ A;  1DQ4 A;  4CDQ C;  5AFE A;  1XRU A;  1VBA 1;  1LEM A;  1QEX A;  3K3N A;  2YBK A;  4AVB A;  3WUC A;  1ZRF A;  4NVP A;  2OQ7 A;  4X8N A;  3NV2 A;  4C1X A;  1GZC A;  4EZ4 A;  4AI9 A;  4AEK A;  1RC6 A;  4CEW A;  3VBR A;  1KD7 A;  3WZ1 A;  5A3N A;  1N1T A;  5F7U A;  3IMN A;  5EYY A;  3WHT A;  3JB4 C;  1AL2 1;  2GC0 A;  1XYP A;  4CZS A;  5ACA 2;  5FPA A;  5FXV A;  1NUK A;  3MIC A;  3ZSM A;  4BB3 A;  1Q43 A;  1AR9 3;  2Z42 A;  1PIV 3;  2VCB A;  5DXD A;  1PMH X;  1PO1 2;  4YW6 A;  5ABJ A;  2GMM A;  4MH0 E;  1O59 A;  2OZJ A;  4GUL A;  4NHM A;  2WFF 1;  2ZS6 B;  2HWF 1;  5B4N A;  4OUM A;  5FCC A;  1D2S A;  1O5L A;  1Y3T A;  3K4A A;  2WJS A;  3MHZ A;  4GMP 3;  1JZ4 A;  1BK0 A;  2XJU A;  3ECQ A;  4ASL A;  5BNO C;  4D6Q A;  1ENS A;  2C26 A;  2WZP P;  5FZE A;  1UQX A;  4YW5 A;  1MS8 A;  1K45 A;  4BLI A;  2RM2 3;  4R4X A;  3RFR A;  5FOB B;  2DV9 A;  2VMC A;  1R08 2;  2P4E A;  2W68 A;  4P5H A;  4RQP B;  3H8R A;  1O3S A;  3EXU A;  1S0I A;  3RI9 A;  2PYT A;  1GMM A;  2R07 1;  3N3H A;  4XAA A;  3B3Q E;  3PTR B;  2VZR A;  4OQ9 A;  1K3I A;  3EMR A;  4NHX A;  4IV1 C;  2YGM A;  2OKX A;  4HMZ A;  4BIS A;  1D4M 1;  1WBF A;  4BQ5 A;  3CU7 A;  5F3C A;  5IK4 A;  1QXJ A;  2EXK A;  1V6M A;  3VBH C;  3ZPY A;  3V0B A;  4J1W A;  4B1M A;  3AL6 A;  1ZRC A;  4MZU A;  3THT A;  3WD5 A;  1S0C A;  2VCA A;  1GYK A;  3LQC A;  4QB2 A;  2OPK A;  1EAH 2;  1NCR A;  4UAP A;  5C71 A;  3A0K A;  1CAX A;  3D8C A;  4G3Y C;  2RJK A;  2PLV 3;  2UU8 A;  1QJY 2;  4FXK B;  2A70 A;  3ZOI A;  1GOG A;  1WCD J;  5CIS A;  1AF9 A;  2R04 2;  4JTO A;  2WZ8 A;  1VBE 1;  1RUI 2;  2JDN A;  1BMV 2;  3ZFG B;  4COU A;  4P08 A;  2O14 A;  3KD4 A;  4XJ8 A;  5H9R A;  4NRO A;  1C1F A;  1MS1 A;  3LEM A;  1AX0 A;  4JQT A;  3ZO0 B;  4CP9 A;  2LM3 A;  3O0V A;  3S0M A;  3IDB B;  5IJR A;  3HQU A;  5A33 B;  3VBS C;  4HOO A;  3VL9 A;  5F39 A;  1PK6 A;  1FAY A;  2AH2 A;  1CAW A;  1R64 A;  1TME 2;  4LQR A;  3JQX A;  5FYU A;  2BU9 A;  5EWS A;  5A80 A;  4BQY A;  3WNO A;  1NA1 A;  5BNN B;  5F3I A;  3WF3 A;  4DPN A;  2A7A A;  3QCW A;  3RVH A;  1IPS A;  2X29 A;  5CG8 A;  3O0X A;  5K0U A;  1DYK A;  2BWA A;  4MX3 A;  5GKA C;  3TEZ A;  2CTV A;  2JKB A;  4OHZ A;  5JZG A;  1IPK A;  1RUJ 1;  3UGG A;  4LHK A;  2GU9 A;  4LE4 A;  2MHF A;  2WO2 A;  3D82 A;  2PQS A;  2AZ5 A;  3T3Y A;  5C4W A;  2BV4 A;  1YQC A;  4OHV A;  3SLI A;  2YDE A;  1Z0H A;  4RD7 A;  1UKR A;  1PX3 A;  2PHL A;  4L92 A;  1OUS A;  1UL9 A;  3INA A;  4UI9 L;  2W3J A;  1JI6 A;  4JDN A;  4OCT A;  1ULO A;  5FYH A;  3OY8 B;  2UYA A;  3J9S A;  5JCT A;  1LHO A;  2X10 A;  5ABJ B;  3LFI A;  5CG9 A;  4NHK A;  4YYO A;  4XUT A;  1W06 A;  2A3Y A;  2VOW A;  3GAL A;  3O1T A;  4PIZ A;  1H2N A;  2VTX A;  2OVU A;  2Z79 A;  1UNB A;  1VRH 3;  3EBR A;  4O65 A;  4F7Z A;  2BOI A;  2GNB A;  2IXC A;  3RJ2 X;  1XNC A;  4LIT A;  1ZVF A;  4AXO A;  3OBT A;  5G04 L;  1GNH A;  3GXU A;  3MUZ 1;  3AFG A;  3BIW E;  2IFW A;  3UKN A;  2VQ0 A;  2FHR A;  4LK6 A;  4OQ8 A;  4LA2 A;  4O9E A;  3MI8 A;  2IXH A;  1PGW 1;  1XBF A;  4R9A A;  3LB9 A;  4RR3 C;  1YNA A;  4LNV A;  4QXC A;  1UAI A;  5DZG A;  1EV1 3;  1R08 1;  2CGN A;  3I7D A;  3VBF C;  2CDO A;  4Q4X 1;  2MEV 1;  3KV4 A;  4NPR A;  4EN0 A;  5J96 B;  1S2E A;  3AMN A;  3MDP A;  4IW3 A;  4BYY A;  2BGP A;  4CDQ A;  4IXL A;  3SH3 A;  1J3P A;  3LDK A;  2P37 A;  1VR3 A;  3GZU C;  1POV 3;  1RUC 2;  4N43 A;  1CQ9 A;  1E5H A;  4XJ9 A;  1G6N A;  4QQP A;  2Y64 A;  4GWN A;  4EYU A;  1CX1 A;  5LZ6 A;  1LOC A;  4E4H A;  1W8W A;  1HIX A;  4IV3 B;  1UX6 A;  4MGI E;  4BDV B;  3ZFG A;  5CBL A;  3AYE A;  1ONA A;  2Q4S A;  3DKW A;  4CEW B;  1G9F A;  1JZ2 A;  3ZSE A;  5C3S A;  1UIK A;  3VZO A;  1GU3 A;  3POW A;  5EP9 A;  4NAM A;  1BMV 1;  1OFS A;  1ENR A;  3V56 A;  4IE6 A;  4TWT A;  2W46 A;  5LY2 A;  4DQA A;  3X29 B;  4E2S A;  4A42 A;  4LUK A;  4XZU G;  2O1Q A;  4IEP A;  5F32 A;  4XF4 A;  4JVA A;  5I93 A;  5FPZ A;  5A7S A;  3WCS A;  2ZZQ A;  5DUX A;  3CJX A;  2G1M A;  1OOP B;  4GKY A;  4A7Y A;  2XWB B;  1ENX A;  3JD7 1;  4IEO A;  4OVE A;  4DIQ A;  1AR9 2;  2VO5 A;  5IK5 A;  1BLZ A;  5J37 A;  1YQ6 A;  2QQW A;  4Y1Z A;  4FPH A;  3NV4 A;  2WZR 1;  1ZM1 A;  2EIE A;  2HYK A;  1I5Z A;  2WWJ A;  1NY7 2;  3AVR A;  1QJU 2;  1XB9 A;  1GV9 A;  5JZG C;  3U11 A;  5LBF A;  2QE3 A;  5JZG B;  1IKP A;  4RS5 C;  3TAY A;  1ULG A;  1NAE A;  4Y1Y A;  5LB6 A;  1VP6 A;  3N4M A;  4NO4 A;  1A78 A;  1HXS 3;  3ILR A;  5K0U B;  4YWA A;  1HB1 A;  3CIH A;  4XFH A;  4AFD A;  5LEK A;  4B7E A;  4EN9 B;  1XU1 A;  2HWE 1;  3VKM A;  3NRU A;  5GZC A;  1NA1 C;  1BKZ A;  1LAJ A;  4AE2 A;  1OXC A;  1QGL A;  3LWC A;  2J1U A;  2BNO A;  3BUC A;  1QH6 A;  3MGU A;  4L9B A;  1AX2 A;  1XJA A;  1W6M B;  2OT7 A;  2ZKL A;  4JV4 A;  3R05 A;  1PGL 1;  1OA4 A;  4Q27 A;  1A8D A;  4CPB A;  3WDY A;  4YFZ A;  2RJ2 A;  3VDD C;  3QAC A;  2Y6K A;  2VOX A;  1EAH 3;  2ID4 A;  3CLP A;  1US2 A;  3OSD A;  4FOQ A;  5DG2 A;  4CP0 A;  2VBP A;  1FPN 3;  1QF3 A;  4CEW C;  4DUX A;  2ZX4 A;  5G05 L;  4IV3 C;  2DUR A;  1ST8 A;  4XFI A;  4H55 A;  2VW2 A;  1QY4 A;  3WDV A;  2R0F A;  1L7Q A;  1RUF 3;  3IB3 A;  1JYC A;  3JQW A;  4P9J A;  4EQV A;  1COV 1;  2EIB A;  3N9N A;  4HVO A;  5GLZ A;  5DAQ A;  2VMD A;  3AP9 A;  3WIN E;  1UX7 A;  3CHX A;  4LMF A;  1RUG 1;  3BOD A;  1PZ7 A;  2RMU 1;  3FHQ A;  3RI8 A;  2LTN A;  5CKN A;  1TME 3;  5T5P A;  2V4A A;  2ZMN A;  3VBF B;  1DQ2 A;  4CUA A;  2AAC A;  3M8L A;  1UW8 A;  1WW5 A;  4RYD A;  2ZGU A;  5C9A A;  5A33 A;  2VZP A;  2D6P A;  4BH9 A;  1UZZ A;  1JUI A;  4M4R A;  1U5Y A;  1DQ0 A;  3MUY 1;  1LOA A;  5A3L A;  5A7O A;  1WCU A;  2I2S A;  3I2K A;  4S2F A;  2PHT A;  2WQ8 A;  1GP4 A;  2MEV 2;  1FYU A;  5EXO A;  5CAD A;  1XNT A;  1POQ A;  2ZTN A;  3A7Q A;  4QHB A;  2J1E A;  1AYN 3;  5LY1 A;  1PO1 3;  2H6C A;  1HXS 1;  3O0W A;  4UT5 A;  4OHY A;  4IET A;  1RUF 2;  4I2O A;  4R8H A;  2ARE A;  1WD3 A;  1WMD A;  3D3A A;  4Q4V 3;  5F3G A;  5FJH A;  3ZYJ B;  4AED A;  3UNP A;  1Q8V A;  4FI9 A;  1J58 A;  2ADE A;  4AVT A;  1BCX A;  5J3U A;  1QXR A;  2JDM A;  4FTS A;  4D7S A;  1DG6 A;  2DCZ A;  5ABJ C;  4B29 A;  1R1Z A;  2VQT A;  2ZHN A;  4K40 A;  5JPN B;  3AYD A;  1CIW A;  2D43 A;  2QQU A;  2TNF A;  3DN7 A;  4XEZ A;  3VDB A;  1TE1 B;  3PUA A;  3E97 A;  3TNP B;  3JD7 3;  1RMU 1;  1U5I A;  4YPJ A;  3H8O A;  1VMF A;  4QXH A;  2WNU C;  2BPA 2;  2FCU A;  1NT0 A;  3HNM A;  3VD3 A;  1YYN A;  1SFY A;  5HI0 A;  3BKZ A;  3IKW A;  5J7M A;  1W39 A;  2X09 A;  4UFK A;  4FQ4 A;  1ZBA 1;  5CU1 A;  3W9A A;  2VCC A;  3J7H A;  4E4D X;  3MF6 A;  4I09 A;  1LES A;  1CAV A;  3GGL A;  5CFD B;  4MG2 A;  4HET A;  1ASJ 2;  2QNK A;  3FLT A;  3PVN A;  2VEC A;  4Q5O A;  4EE2 A;  2G4I A;  2DCY A;  4YW7 A;  1DGR A;  3H8U A;  1HDK A;  5FZI A;  2UY9 A;  4GWJ A;  4XDO A;  4HSL A;  1HQN A;  2QQK A;  2YRO A;  3TBD A;  1XYN A;  3FZ3 A;  3WNX A;  1R1A 3;  4HN1 A;  2NP0 A;  1X50 A;  4AFA A;  3KV5 A;  2F4P A;  4JRL A;  4IGQ A;  4BCU A;  1XC6 A;  2XJR A;  1JZ8 A;  3WG1 A;  3F2Z A;  1DQ1 A;  5BNN C;  4CCK A;  4H14 A;  3PIG A;  1AR8 1;  3FMG A;  1GP5 A;  1C8M 3;  1W8Z A;  2Q0A A;  3KCX A;  3ST7 A;  5FPB A;  3U4X A;  1GNZ A;  4LHL A;  5HCB A;  3VBS B;  3PUR A;  3RRD A;  4P9G A;  5C9A C;  1O3T A;  3KB5 A;  4Y3O A;  3MF9 A;  1CWP A;  1EV1 1;  1RUC 3;  1GZ9 A;  4YM3 A;  3BTA A;  3WVJ A;  3DXU A;  5ANN A;  5F8P A;  5FIX A;  3T0D A;  4DUW A;  2VAU A;  1KJL A;  2YG0 A;  3MIB A;  1PIV 2;  2E51 A;  2V72 A;  5A3P A;  4LLF A;  4B8E A;  1JYN A;  2I74 A;  5AC9 1;  1ZZ7 A;  3V65 A;  2P3I A;  1W6M A;  5FR3 A;  2ZHK A;  4V2W A;  5M0T A;  2CGP A;  2W9X A;  2Y38 A;  2XVK A;  3KM5 A;  2FDF A;  4CXW A;  1XYO A;  4OMC A;  3UES A;  1I9R A;  5FMO S;  2HWD 3;  4XHX A;  2NMN A;  1GQG A;  3T30 A;  1SLT A;  1ND3 A;  2VOV A;  5H9S A;  3ZM8 A;  4C1W A;  1SEF A;  3LEG A;  2B42 B;  1G9D A;  1VAM A;  2RS5 2;  3K4Z A;  4HT1 T;  4CCD A;  3P3N A;  5FZD A;  5FP8 A;  2ZEX A;  1PMJ X;  3CF6 E;  4CDW B;  5FAX A;  4XBN A;  4FPK A;  4N53 C;  4NAO A;  3LIG A;  4QX0 A;  4IGP A;  2JXA A;  4K1Z A;  4QPW A;  5HCA A;  4MAD A;  3QLQ A;  5EJZ B;  5FPV A;  3EQE A;  3ZDS A;  3WCR A;  2Q8D A;  3K2O A;  3VBF A;  1OD5 A;  2RR1 1;  2GN7 A;  1MAC A;  4Q0Q A;  1XNK A;  5FY9 A;  4AI3 A;  1H4H A;  1V9U 3;  4AL9 A;  3AP7 A;  3WUD A;  4Q0P A;  1CAU A;  5IWF A;  4CCM A;  5BNO B;  1JS9 A;  1IKQ A;  2QQL A;  2VU9 A;  2VZS A;  1MS5 A;  4RS5 A;  1WCQ A;  1O4Z A;  3IBM A;  3L2Y A;  4E27 A;  1HXS 2;  4XXP A;  1RB8 G;  5IK8 A;  1W9Y A;  3U4S A;  5F1R A;  1OF4 A;  4COV A;  5KXE A;  1HN0 A;  2VH9 A;  1T6B X;  3VUO A;  5FPU A;  3HBK A;  4Z1V A;  4M3C F;  3OGG A;  1O8S A;  5FZ1 A;  3KQR A;  5KR7 A;  3PUS A;  5CYY A;  1T6G C;  3I59 A;  2GC2 A;  2RS3 3;  4K8F A;  2D5H A;  3VD5 A;  1UYX A;  3DV8 A;  1FX5 A;  4XYX A;  4NMI A;  1UKG A;  2Q8C A;  2ZHL A;  3PNA A;  4BOW A;  1UMZ A;  1JYW A;  1OHF A;  3QBQ A;  5A3O A;  1V6N A;  3W21 A;  3WF0 A;  5FTT C;  4AG4 A;  5K9Y A;  4CDQ B;  2RS1 1;  5FYT A;  5KHK A;  3M4F A;  2DCK A;  2W95 A;  1ND2 C;  4HFS A;  1FNZ A;  1VMH A;  4Y24 A;  4QX8 A;  4KI5 M;  1YIP A;  1YHF A;  2R06 1;  3JBG 1;  5C3R A;  4LO7 A;  2ZX2 A;  3JCI A;  1SLI A;  3OBZ A;  1RIN A;  1I1E A;  1H8T B;  5DUU A;  3KQ4 B;  3AKQ A;  5AC9 3;  4LBL A;  2V5Y A;  2HJI A;  5CZK A;  5A1F A;  1SHW B;  1DHK B;  1EUT A;  5FDB A;  1BEV 1;  1JU3 A;  1OPM A;  5FZK A;  3VHN A;  3CL1 A;  1PGW 2;  1W99 A;  2ADD A;  4J6G A;  3MIE A;  1FXZ A;  1D4M 3;  5FO7 B;  5DN2 A;  2CHH A;  4N7I A;  5L36 A;  3ZN6 B;  1EP0 A;  5JOW A;  2EIG A;  4PIX A;  5EYX A;  3POB A;  4B3N A;  3BU7 A;  1OSG A;  1RXF A;  4Q4W 2;  1PK6 C;  3VBO A;  4OZO A;  3I2D A;  2DVG A;  2QVS B;  4Q4V 2;  2JG9 C;  1QMJ A;  2DU0 A;  5B2G B;  3MPB A;  3GJA A;  5IVV A;  5HPO A;  4Q4Y 3;  2VUD A;  3LA7 A;  4RSU A;  1D2Q A;  1FOD 3;  2R07 2;  3BI3 A;  3T09 A;  1MR5 A;  4MUV A;  1R1A 1;  2QUO A;  3TEY A;  4I0A A;  3UKV A;  5AC9 2;  1JMU B;  3UJO A;  2PN5 A;  1LEC A;  4GMP 1;  1SG3 A;  2LRP A;  2HBU A;  3LFM A;  2HWF 3;  3LAG A;  3NAP C;  5DUW A;  5E1R A;  3I2I A;  3UGH A;  3V0A A;  5DDJ 1;  1D7P M;  2ZZJ A;  3WDT A;  4OFG A;  2ARA A;  2DFC A;  4BIO A;  5ISL A;  1OKQ A;  4KWU A;  3BB6 A;  2BJS A;  4W50 A;  5FZH A;  2BRT A;  1RUH 2;  3QH6 A;  1OQE A;  5F5Q A;  4AAP A;  3U0Z A;  2W47 A;  1RMU 3;  3AP4 A;  4JGY C;  4CDX C;  3JD7 2;  2P34 A;  4AVS A;  1CVN A;  1CAV B;  2IWG B;  3M1H A;  1T2X A;  4LBQ B;  1X7N A;  3KLS A;  2EID A;  4E8D A;  5FZO B;  1SFP A;  4XOG A;  3H1M A;  1J84 A;  5JI7 A;  3USU A;  1BZW A;  4O61 A;  4AWD A;  2FZ2 A;  1SDD B;  1YQ8 A;  3AC0 A;  3ZXJ A;  3T4H B;  3OBR A;  4QQO A;  4Y22 B;  2ZA9 A;  5F5I A;  2IZW A;  2VZV A;  4JGZ B;  1W04 A;  1C8M 2;  4B7K A;  1STM A;  4OI0 A;  4WM8 C;  4CCE A;  5JAX A;  2FMD A;  2FDH A;  2WLQ A;  2W0X A;  4GD4 A;  1NXD 1;  2XQX A;  3I97 A;  4GAL A;  1MQT B;  4U2A A;  2ZEY A;  1S2K A;  4AI8 A;  1ULE A;  2BWC A;  2PHU A;  3KV9 A;  4I02 A;  3ILF A;  4GH4 C;  4QB1 A;  5LRR A;  1J1L A;  4CXY A;  4YNI A;  2ZEW A;  1GWL A;  3VHP A;  1H2M A;  4NRM A;  4XFB A;  5A7N A;  5I0U A;  3MW2 A;  3SCG A;  1TME 1;  5ERL A;  2Y0O A;  4XQD A;  3HIF A;  4FOW A;  2QQO A;  1FNY A;  3LF7 A;  1NOV A;  1S0B A;  2H6B A;  1RUD 1;  1YQ5 A;  3CNA A;  1GOF A;  1COV 3;  4YVS C;  2Y8K A;  4QPI A;  1AR6 1;  3RWK X;  2VVF A;  2EXH A;  3D0S A;  4WVM A;  2PFW A;  2BVB A;  1PHM A;  3N9O A;  1N47 A;  3FX3 A;  1I6X A;  4XDQ A;  2WQ4 A;  2X53 S;  4LPL A;  4GJZ A;  4A4A A;  2JJ6 A;  4CP1 A;  3DL3 A;  3J26 N;  3SEP A;  4YZ5 A;  1OQD A;  1J3Q A;  4FFH A;  4LHS A;  4UOJ A;  4W6W A;  4C90 A;  3O1P A;  1YO8 A;  1HRV 2;  1ZBE 2;  2PHW A;  3KF3 A;  4TXW A;  1WWY A;  3SEE A;  3EJK A;  4AHX A;  4FXG B;  4IEW A;  4LK7 A;  4A41 A;  5AVA A;  4IDZ A;  2W92 A;  2WT0 A;  4MGK E;  4PLM A;  1G9C A;  3AP5 A;  3TNQ A;  2RVA A;  4BQX A;  2ARC A;  1VBA 2;  5C3O A;  1XE7 A;  1W9S A;  5CFD A;  1KS5 A;  3MFA A;  4EWD A;  3OEA A;  4ITC A;  2AEN A;  4K20 A;  1J3R A;  4QHZ A;  2OW4 A;  5FO8 B;  2Y33 A;  3AMQ A;  4QDQ A;  3VBO B;  3SKV A;  1K5M A;  1JUH A;  5FK8 A;  5BNP C;  1R1A 2;  4F3J A;  1F15 A;  2FCV A;  1MS0 A;  3AZY A;  1JN2 P;  1A6C A;  1AL2 2;  1GR3 A;  3OUJ A;  3T4V A;  1H2K A;  1NZI A;  2DYC A;  2TBV A;  4OI2 A;  4Q4Y 1;  2LUW A;  3RZH A;  2WL1 A;  3RS6 A;  2AEZ A;  1SPP B;  2EIC A;  5I0D A;  4NJ4 A;  2HWB 2;  4HKL A;  3ZFE B;  1J1T A;  4K1Y A;  1WW7 A;  1MEC 2;  1F8V A;  1UCX A;  1D4V B;  3ALQ A;  4AHY A;  1K12 A;  2ZGK A;  1V00 A;  4XQ4 A;  4YZ4 A;  5FY7 A;  4YVW B;  4KGG A;  2BFU L;  4LBQ D;  1US3 A;  1RHI 3;  2YZ4 A;  4YG3 A;  1Q56 A;  4D3W A;  5T5J A;  5LA1 A;  4XFG A;  2GH2 A;  4AQ6 A;  1OLM A;  5IVB A;  1H8T A;  3WX5 A;  1GNY A;  3PVO A;  2GAL A;  5D8A B;  3WG4 A;  1JBC A;  4HLT A;  3AYA A;  4ZPI A;  2PLV 2;  1QOT A;  2YBP A;  2HWD 2;  3WDX A;  2XJV A;  4Q8K A;  2DVB A;  3FWE A;  3LPG A;  3JBG 3;  2OYZ A;  4XCB A;  5F5C A;  5FP4 A;  5I0T A;  5FZL A;  4ORF A;  4MYE A;  2XBO 2;  1ZRD A;  3PU8 A;  1MVE A;  1PM4 A;  3FJS A;  1H30 A;  2RS1 3;  4JDO A;  1E5I A;  2D6O X;  4FAG A;  3NV3 A;  3RMX A;  5A32 A;  4XFA A;  3AKR A;  2NYY A;  5H9Q A;  2VVE A;  2NPI A;  3SIS A;  2P2K A;  5FY4 A;  1HV0 A;  2YGL A;  2BVV A;  3USS A;  5CEH A;  1U0A A;  2W1U A;  4XMA A;  3N7J A;  4W4Z A;  4W6X A;  3VZM A;  3ON7 A;  1O4T A;  4DRR A;  2Q1Z B;  5IFT A;  5KBF A;  2OII A;  4KMQ A;  3V0A B;  2HWF 2;  2B5H A;  1LKN A;  3ACI A;  2WZR 2;  4CUG A;  1VBC 1;  5A1L A;  4GWI A;  5B4X A;  3BVC A;  3OD4 A;  3S7I A;  4IV3 A;  2ZBJ A;  4E4Z A;  2R6Q A;  5JXH A;  2B39 A;  3R4U A;  4X6R B;  2P3J A;  3KGZ A;  3E6B A;  4YVS A;  5FWJ A;  1AR6 2;  4Q0S A;  1DF0 A;  2R1D A;  3DPR B;  4LKE A;  2C4X A;  2W08 A;  2IFR A;  2RDN A;  2WIN B;  5J48 A;  2PHF A;  5A7W B;  2CDP A;  1QJY 1;  3KT1 A;  4M3C B;  5C4W B;  3OPW A;  4BIF A;  1LOF C;  5EJ3 A;  5DMY A;  1NQJ A;  4GH4 A;  5JIA A;  3RYK A;  5GZG A;  4KG0 A;  2A6V A;  1W6Q A;  4WZC A;  2BNN A;  2KR2 A;  3PUI A;  2XML A;  3FFQ A;  1UMH A;  4C0H A;  5C6C A;  3K77 A;  3U07 A;  2JDA A;  4FVV A;  2R7E B;  3ZR5 A;  3E6C C;  1RUJ 2;  1UU6 A;  1NCR B;  2VVD A;  4XE9 A;  3ZKU A;  1QJY 3;  1HJF A;  4QMA A;  4XUO A;  1QOS A;  4NE9 A;  2BER A;  1FT9 A;  3SXW A;  5LK7 B;  1SLA A;  4LBQ A;  2I45 A;  1DYP A;  4JGZ A;  4UXA A;  4YLZ A;  3ZX7 A;  4DEV A;  3ACG A;  5FRE A;  4OHW A;  2XB6 C;  1RUI 1;  1AUY A;  1BJQ A;  1QKQ A;  4QX7 A;  3USU B;  5C8C C;  4AEJ A;  1CZT A;  1HKD A;  3WP6 A;  2K2S A;  1BHG A;  4LA3 A;  3E6D A;  3A21 A;  4MXW A;  3JU9 A;  4JRA A;  1NCQ C;  4ZU5 A;  4DY3 A;  1H1I A;  3URF A;  4PDW B;  2HKX A;  2UWA A;  3I2J A;  3CBN A;  1HV1 A;  2VUL A;  3WF4 A;  1KGY A;  1W6P A;  1CON A;  1GFF 2;  5FWE A;  3IMM A;  5DG1 A;  1EPZ A;  4P14 A;  4IEX A;  3LGR A;  1CX4 A;  3Q8F A;  3NVC A;  3MFC A;  4YW2 A;  3WW1 A;  1F31 A;  5JI9 A;  4A45 A;  2ZGN A;  1OLR A;  3ZSK A;  1F2N A;  3NKG A;  1DGW A;  1Z7S 2;  1ZZ9 A;  4CUB A;  2QQP A;  1WLT A;  1XPW A;  4JKM A;  5KC6 A;  1RUF 1;  2E63 A;  5A6Q A;  3MV0 1;  4DXZ A;  2XHK A;  4DXR A;  1W3X A;  2AC1 A;  1W2U A;  1S0E A;  2PLV 1;  2YC4 A;  3WW4 A;  2JD9 A;  5KHI A;  4XTM A;  1OLM E;  5D8A A;  3K48 A;  3PLQ A;  4E2G A;  1LHV A;  5LAS A;  1ASJ 1;  3NNF A;  1LU1 A;  5F3E A;  4RGK A;  5A6X A;  1G9A A;  5EZW A;  3AKS A;  1IS4 A;  2IXJ A;  2Z2S B;  4QKD A;  1B09 A;  2P17 A;  2WO1 A;  1AYM 3;  4A6S A;  4CSW A;  4D0Q A;  4ASK A;  3TN9 3;  3AJZ A;  4CEY A;  2QQJ A;  1VPH A;  1Q8S A;  3VKF C;  5FP9 A;  3I2F A;  2WC2 A;  1HRI 3;  3KMH A;  3Q8B A;  1H4G A;  4UBG A;  2RV9 A;  1JH5 A;  3FBY A;  1WMX A;  2VBB A;  1ZBA 2;  3O1U A;  2OS2 A;  1IGO A;  4YFW A;  3THP A;  5T55 A;  2HWE 3;  2A6X A;  2RM2 1;  3ZXA C;  4COW A;  3M3Q A;  1EY2 A;  2WSU A;  4K6B A;  3U1X A;  2YBS A;  4E9K A;  1FMD 2;  2GC3 A;  3FUQ A;  5T52 A;  4FSJ A;  2YPJ A;  4AED B;  2LAL A;  2KXL A;  3DKQ A;  4IES A;  4DXT A;  2ZGP A;  1K5M B;  3TEW A;  3GYD A;  1VBC 2;  1JYV A;  1IG0 A;  1ND2 A;  5FKB A;  3J7L A;  4J25 A;  4P9I A;  3T2P A;  5LCW L;  1FV2 A;  4FOV A;  4S2D A;  2JIG A;  3UYJ A;  5FMC A;  1PIV 1;  1PO1 1;  3ME2 A;  4Z2W A;  4JQR A;  1AR9 1;  2VQA A;  1JTZ X;  5IAV A;  4BK5 A;  2WFF 2;  3MIF A;  3WNN A;  1UWW A;  2WUH A;  5J36 A;  4CDU B;  4IER A;  3OGV A;  4DEQ A;  1AL2 3;  3IAQ A;  2VCM A;  4NPM A;  5F6K A;  5CA6 A;  5T5L A;  4DB5 A;  1HRI 1;  1X36 A;  2BGC A;  3SHR A;  3OUH A;  4BMB A;  4COY A;  5L7O C;  3KVA A;  4NPL A;  3SKJ E;  1AJO A;  4M3C A;  2X5I C;  3WP4 A;  1AYM 1;  2YB7 A;  4X8P A;  4AVC A;  4UFL A;  1ZRE A;  1RUG 3;  1XSQ A;  3POI A;  5I0R A;  3VHO A;  2UWC A;  3W5N A;  3SC7 X;  1YFX A;  1VAL A;  5BNN A;  2ATF A;  4LOS A;  4N90 A;  2HH9 A;  3LDB A;  3DYM A;  2E26 A;  3LA3 A;  1C4R A;  3FN9 A;  4M01 A;  2GH8 A;  5A32 B;  2HEW F;  3FE5 A;  1FOD 1;  5DUV A;  3H1W A;  1FPN 1;  3M2M A;  2PHR A;  4XVH A;  1RUD 3;  2ARB A;  3I4I A;  5I8S A;  1UYY A;  5HXM A;  1EAH 1;  2WDB A;  4ZZ5 A;  1YIF A;  2XKP A;  2BFU S;  4FOY A;  1SLB A;  2X8K A;  4DS0 A;  3VGI A;  3T0B A;  4MLO A;  5LBB A;  3VBU B;  2YPD A;  4PIY A;  3RJR A;  2W1W A;  3W58 A;  3ZDV A;  2GC1 A;  2JEN A;  2XLG A;  4XBQ A;  5GZE A;  5CFC C;  1R08 3;  2C24 A;  2AR6 A;  4PF5 A;  1WW4 A;  4XMI A;  3KHC A;  2WNV A;  1VLN A;  4FPE A;  4LOT A;  3L2H A;  4QGL A;  3VBR C;  3AL5 A;  4FFI A;  1CJD A;  4GMP 0;  5FPL A;  4QPG A;  1NY7 1;  4NN0 A;  3UT0 A;  1QIQ A;  4ZU7 A;  5BV6 A;  3N7M A;  2BOJ A;  1UY0 A;  4N8M A;  2R1B A;  3OPZ A;  2FZ1 A;  2R06 3;  3H42 B;  4CDW A;  1BXH A;  4HPK A;  4P9W A;  2CWM A;  5JXG A;  1NLQ A;  4MSV A;  2BW8 A;  2WZR 3;  4V2V A;  3CMG A;  1F9K A;  4XUP A;  4H3W A;  4C8D A;  5FYC A;  2JIJ A;  5A3U A;  3Q8A A;  1OQ1 A;  4L11 A;  1J59 A;  4FAH A;  3MV1 1;  1H2L A;  4Z2A A;  4FQZ A;  1PZ8 A;  2GSY A;  1I3H A;  2DFB A;  3NMB A;  1YCI A;  3O1M A;  5JSR A;  5A6Z A;  3VKN A;  5FY1 A;  3D5O A;  1W8N A;  1CAU B;  2V4V A;  4PCR A;  5BNO A;  3AZX A;  1C3H A;  2P6C A;  1RUJ 3;  4S2H A;  4NWW A;  3GZA A;  3RYR A;  1UIJ A;  5A1A A;  2RHP A;  1U5Z A;  1O7F A;  1ZA7 A;  4KWL A;  3JBG 2;  2H0B A;  3T2Q A;  4HON A;  2VUJ A;  4XET A;  1H1A A;  1COV 2;  1FAT A;  1QDO A;  1X9T A;  5A3T A;  5C70 A;  4Y4R A;  1DGR N;  2VD7 A;  2HWC 2;  4QPI C;  2BQP A;  3DUI A;  4DMI A;  4GZ9 A;  3BCW A;  2XWJ B;  4P9X A;  1RIR A;  2BDR A;  3S5Q A;  5IVJ A;  5LA0 A;  2QBX A;  2JDK A;  3SCF A;  2C6S A;  4MO3 M;  1BEV 2;  1MEC 1;  2WNE A;  4AF9 A;  2MEV 3;  4Z07 A;  3KT7 A;  1PGL 2;  4BJ0 A;  1HLC A;  2D98 A;  2WZE A;  1R09 2;  3P5B A;  2ZAH A;  2DDU A; 
#chains in the Genus database with same CATH homology
 2GP3 A;  4QXH A;  5FZM A;  2PXJ A;  5FYT A;  5A7W B;  5FZA A;  3N9O A;  4XDP A;  5LY2 A;  3KVA A;  3OPW A;  4QX8 A;  3U78 A;  4GJZ A;  5F32 A;  5E6H A;  5A7S A;  5FYV A;  5FYB A;  5FYM A;  2XML A;  5A3W A;  2WWU A;  3ZLI A;  2XXZ A;  5FY8 A;  2YU2 A;  3PU3 A;  5FXW A;  3LDB A;  5FZI A;  4DIQ A;  2Q8E A;  4HOO A;  4XDO A;  5A1F A;  5F39 A;  5IVE A;  5A80 A;  5FZ8 A;  5FYU A;  5FZK A;  2WWJ A;  5F3I A;  3AVR A;  3KV5 A;  5LW9 A;  3DXT A;  4IGQ A;  2OQ6 A;  4QXB A;  5FZC A;  4QX7 A;  5FXZ A;  4CCK A;  3RVH A;  3N9L A;  5FYI A;  3KV6 A;  2YPD A;  5FPB A;  4LIU A;  2XUE A;  4BXF A;  3PUR A;  5F37 A;  4Y3O A;  4TN7 A;  5IVV A;  5FZ7 A;  5FBJ A;  3DXU A;  4QWN A;  4Y33 A;  5FWE A;  5A3P A;  3AL5 A;  5FUP A;  3PDQ A;  2OT7 A;  5FPL A;  4V2W A;  2YU1 A;  5F5A A;  5FZF A;  5K4L A;  4IGO A;  4NUB A;  3K3N A;  5F2W A;  2YBK A;  5FYS A;  5IVY A;  5FY7 A;  2OQ7 A;  3N9M A;  4EZ4 A;  5ISL A;  5FYH A;  4AI9 A;  4CCO A;  5FZ0 A;  4CCJ A;  3KVB A;  5F2S A;  5FP3 A;  5FZH A;  5FXX A;  5LWB A;  4V2V A;  4DO0 A;  5A3N A;  5IVF A;  4C8D A;  5FYC A;  5A7W A;  5FZB A;  5FZO A;  2P5B A;  4AAP A;  5IVB A;  3PUQ A;  5FV3 A;  5FP8 A;  3N9N A;  4LXL A;  5FPA A;  5FXV A;  5FZD A;  4BU2 A;  2W2I A;  2YBP A;  3K3O A;  3OPT A;  4QU1 A;  4GJY A;  5FZ4 A;  5F3E A;  4LIT A;  4IGP A;  5FZO B;  5FPV A;  3LD8 A;  5F5C A;  5FP4 A;  5A7P A;  4CSW A;  2Q8D A;  3K2O A;  3N9Q A;  4GAZ A;  5FZL A;  4ASK A;  5IVC A;  5FY9 A;  3PU8 A;  5FY1 A;  4CCN A;  4URA A;  5FP9 A;  5FZ6 A;  4EZH A;  4CCM A;  5IWF A;  5ANQ A;  5FY0 A;  5F5I A;  5A7Q A;  5A7O A;  5FZ3 A;  4QXC A;  3ZPO A;  4D6Q A;  2OS2 A;  4D6S A;  5FZE A;  3N9P A;  5IW0 A;  1VRB A;  3AVS A;  5LY1 A;  5FY4 A;  2YBS A;  3KV4 A;  4GD4 A;  4HON A;  5FZ9 A;  5FY5 A;  3U4S A;  2GP5 A;  5FYY A;  5CEH A;  5A3T A;  3KV9 A;  4Y4R A;  5F3G A;  5FJH A;  2VD7 A;  3PTR B;  4CCL A;  5FPU A;  4UF0 A;  5FJK A;  4BIS A;  4EYU A;  4LIV A;  5IVJ A;  5F3C A;  2XDV A;  3NJY A;  5FZ1 A;  5A7N A;  5KR7 A;  4E4H A;  3PUS A;  5FUN A;  3UYJ A;  4CUG A;  5A1L A;  5FZG A;  3AL6 A;  4D6R A;  5FYZ A;  3PUA A;  5FWJ A;  5FP7 A;  2Q8C A;  2OX0 A;  4UF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...