2OQ6A

Crystal structure of jmjd2a complexed with histone h3 peptide trimethylated at lys9
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
348
structure length
348
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords JmjC domain-containing histone demethylation protein 3A
total genus 112
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2oq6A01
5FXWA 4GJYA 3N9QA 4IGOA 5FZEA 2WWUA 5FZDA 2Q8EA 2YPDA 5FY8A 4ASKA 3KV5A 4QX7A 4HOOA 3KVBA 4IGPA 4GAZA 4QU1A 5A7PA 5FP3A 4CCNA 5F37A 5KR7A 3U78A 5FJHA 5A1LA 4V2WA 5IVVA 2OQ7A 4D6RA 5A7NA 4URAA 3KVAA 5FYSA 5FY7A 5FZAA 3OPWA 3ZPOA 5FZ4A 4Y3OA 2GP3A 5FZCA 5FY0A 5FBJA 5A7OA 4LIVA 5FZOA 3K2OA 5A3TA 5LW9A 2P5BA 5FP7A 2W2IA 4EYUA 4BISA 5A7SA 5FYMA 2YBPA 3K3NA 5FYTA 5FPAA 4Y4RA 2XDVA 3KV9A 5FZMA 5FZIA 5F3IA 5LY2A 5CEHA 2XUEA 2YBKA 5IVFA 5FXXA 2GP5A 5FYCA 1VRBA 5FZOB 4LITA 5F3CA 5FZ6A 5FZ1A 5IWFA 4QX8A 4CCMA 3DXUA 4CCLA 5FP8A 4BXFA 5K4LA 5FUNA 5FUPA 5FXZA 2Q8DA 5FJKA 5LY1A 5F5AA 5FYBA 4DIQA 4DO0A 4XDPA 5IVEA 2OT7A 5FXVA 5FY5A 3LDBA 5F3GA 3PUSA 4E4HA 2YU1A 5F5IA 5FY4A 4CCOA 4D6SA 3PDQA 5A3PA 5A7WB 4IGQA 5ANQA 5FP4A 5FYYA 5FV3A 5FZ9A 4UF0A 5FZGA 5FZ0A 4XDOA 5F2WA 2VD7A 5FYZA 3N9PA 4CSWA 4V2VA 3LD8A 3PU8A 5F39A 5FZLA 5FZ8A 5A7QA 3PUQA 4AAPA 4TN7A 5A80A 3DXTA 5FWJA 5FZBA 4BU2A 2OX0A 5FYHA 5FPVA 5IVYA 3N9OA 3ZLIA 3N9NA 5FPLA 3KV4A 4QXCA 5FPBA 4CCJA 5IVJA 5FYIA 4QXHA 2XMLA 3PURA 2YBSA 5A1FA 5FZHA 3N9LA 5A7WA 3AVRA 5FY9A 4EZHA 5A3NA 4UF0B 4D6QA 4CUGA 2OS2A 4AI9A 5FPUA 3NJYA 4LXLA 2WWJA 3PTRB 3KV6A 4NUBA 3U4SA 4CCKA 5F3EA 3AL5A 5F5CA 5ISLA 5LWBA 3RVHA 3PUAA 4Y33A 5FZ7A 5FWEA 4EZ4A 5FP9A 5A3WA 4GJZA 2YU2A 3UYJA 5IW0A 3N9MA 5FYVA 5FYUA 2PXJA 5FZKA 4QWNA 2XXZA 3OPTA 5FZFA 4QXBA 3PU3A 5IVCA 2OQ6A 3AVSA 5FY1A 4LIUA 4HONA 5E6HA 5F32A 5IVBA 5F2SA 5FZ3A 4C8DA 2Q8CA 3K3OA 4GD4A 3AL6A
chains in the Genus database with same CATH superfamily
1BKZA 3N9QA 4UW3A 4CSWA 2PA7A 2PQSA 4Y22A 2A6WA 1I5PA 1LU2A 3KV5A 1JW6A 3P3NA 4NRMA 4ONUA 1X8EA 4DB5A 5JIUA 1W6NB 4GAZA 4AI1A 1Q56A 1W03A 3UJQA 5JR2A 4ZXEA 2JDKA 5IVVA 3H9AA 3NNLA 1TNRA 1O8PA 1CAXB 2JE7A 3OYWB 5CIRA 5K8SA 2VU9A 1D0HA 3JCIA 3OPWA 3KHCA 2VW2A 3FUOA 1LHNA 2GP3A 2D5HA 2X5IA 1PNFA 2OUHA 4CEWB 4DXRA 4LO7A 5FZOA 1K5MC 1VMJA 2CU5A 5C8WA 4HT1T 5LW9A 1JOPA 1QQP1 2VAUA 4HZFA 5JSRA 1C1FA 2D44A 2D40A 3IPVA 3MIGA 3OBZA 4W50A 5EJZB 1W6PB 1WBFA 1YHFA 3X29B 4Q4W3 4YW6A 3SMHA 5H9QA 3DKQA 3ETQA 1JU3A 1RUF3 4YG3A 3TEWA 4CDXC 3PVNA 3IDAA 1LAJA 3E5XA 4LORA 4E8DA 2DYCA 2QVSB 3SH4A 3UT0A 3IM0A 1J1TA 4ZS3A 4B8EA 5KXBA 5F5AA 3VD4A 3O1OA 1QJFA 1Y4WA 5SV8A 4YGBA 3PUSA 3MLLA 3HT1A 4XEZA 5IT6A 1SCSA 3ZXDA 4BQYA 1W6MB 4FPCA 1UZYA 5A3PA 4K1ZA 3MW3A 2GU9A 2Z5WA 4MYEA 3SXWA 5FZGA 5HCAA 4KG0A 3O1MA 4CEYA 3UGFA 4E4ZA 3OGGA 4OFGA 2WFF1 4UI9L 1SACA 3L2YA 4XF3A 1X7NA 1S2BA 2RR12 1WBLA 1N1YA 2PQQA 3SH3A 2Z4FA 3IIAA 3ZXKA 4BK4A 1UYXA 1IGOA 4LA3A 1WGPA 3GCWA 4YG0A 2WAAA 5E8AA 4BM8A 1TEIA 1N1SA 5FPBA 1SBEA 1VBA1 3JB8A 2ZTNA 3M4FA 4KWLA 4YG6A 1UIJA 4NWWA 1G86A 4F83A 2KR2A 1YC61 2ARAA 4GWNA 1W9WA 2GALA 1S55A 4MGYE 1GZWA 4ORFA 4AHWA 2DU0A 3WG2A 4LEJA 3S0MA 2NYYA 3FMGA 1LULA 3BPSA 4LTAA 3BTZA 4OVEA 2RS13 2P37A 2X10A 4LBQB 4J1XA 4AK3A 3AXEA 3VN4A 3BTYA 1JZ2A 3B69A 1C5IA 1US2A 2Y0IA 1FV3A 4EZ4A 4YZ2A 4W6XA 4WM7B 4KH9A 3T4VA 1N3QA 1W8NA 2CWSA 2PHDA 2YFUA 5FYVA 1G9DA 2RDSA 2V73A 2FDJA 1COV3 1Q8QA 3NJVA 2Y8KA 4Q0VA 5KHGA 1KJRA 3V0AA 1BMV1 5DG2A 1S0GA 4DUVA 4A44A 3AVSA 4ES8A 1PVC3 4Q1RA 1GP4A 3G6JB 2W46A 3J9SA 5EFUA 2YV8A 3WLUA 1I5ZA 1GQHA 1R093 3J8F2 2VZQA 3AP6A 2AH2A 4LE3A 3ACLA 2MHFA 4P9IA 5GLVA 3SCHA 4AI0A 1UPIA 3S57A 1OLMA 1TME3 3QLQA 5JMCA 4DY3A 2DFBA 2JDMA 3FBMA 2XPJA 2XUMA 2RS12 1XNCA 4QM9A 4FTSA 4J25A 1BMV2 1OOPA 2P4EA 2RS51 4HVOA 4ZPIA 1RUG3 1VE0A 2J1EA 4XJAA 2GC2A 5FQ0B 3QH6A 3VDDC 1SBDA 2XL7A 1PMIA 4AEMA 3VZMA 2IWGB 1VP6A 3ZXGA 2WNUA 1X8MA 2W91A 3NSTA 5IAXA 3NNFA 3ZPOA 4MGTA 4EROA 4IEOA 2LRPA 4YLZA 4FOQA 1IQDC 1GP5A 1RUH2 1H6YA 1PGW2 3I2KA 1J3RA 4Q29A 4AVBA 2W0XA 5A3TA 4QPIB 2CSGA 2E51A 2WYSA 4RYDA 2V5YA 1ST8A 4EYUA 3N7KA 3IDCB 5FYTA 2DVBA 2WSUA 2XLAA 3H3UA 4YYOA 2ADEA 4NHYA 2VQAA 1RUG1 3ZN5A 3RZZA 3GZUC 2W5FA 5F9TA 1QJY2 4QPGA 5LA2A 1W2OA 4D7TA 5I93A 3N35A 1JI6A 3BTAA 3POWA 1B35B 1QJX1 3GYDA 2YZ4A 1UO9A 2C26A 4N9HA 4MADA 3ZIXA 1JZ8A 1I1EA 1AR63 4NHMA 2VMFA 3LE0A 2JG9C 4JGZA 3M8LA 5HV0A 3ECQA 1AR91 2VNVA 3WNMA 1UMIA 3WCSA 5GKAC 1RJ7A 2R7EB 2YROA 5IVEA 2OT7A 3ZYPA 5LEKA 1QOTA 4W4ZA 2E63A 3PHMA 1DBNA 5CKMA 2X29A 4QQ2A 3C8XA 3ZOIA 2VVEA 4QMAA 4YM0A 5FZ9A 3S7EA 1GMMA 1Y43B 2HWC2 3BB6A 3U75A 4XVHA 5HCFA 5GLTA 5CKNA 2A3XA 4KNCA 4RHV1 2Q0AA 1ND3C 4AVCA 4CA9A 4BQ2A 4G4FA 4CDQB 2HEYF 4ISRA 5FZLA 4IQPA 3H8UA 3APBA 4UFMA 3P6BA 4UOJA 2VZUA 4MO3M 2CDOA 4PI0A 1EV12 5FWJA 2WIIB 3AKSA 2W39A 1D4M2 3N9OA 2G9GA 1W6OA 1F5JA 1PZ9A 3GJBA 3FFZA 4YFWA 4ZONA 3KLSA 1OQDA 5DABA 4OMDA 2YFZA 5CG8A 2WO2A 1NY72 5FLIA 3I3EA 2EALA 3E6DA 3LFIA 3NJYA 1PO12 3EMRA 4BMEA 4HK8A 1TVGA 4I2OA 2HWB3 1YQ8A 2P3KA 5H9PA 3SISA 2A3WA 4QQLA 2ET1A 3THDA 4Y33A 2I45A 5JOWA 2WLQA 1WA4A 3ZYFA 3VBFC 1D2QA 4UFKA 3I4IA 3Q8FA 5CADA 2TEPA 1VBC3 4A6SA 1H1MA 2WO7A 2Y6GA 4M4RA 3PLQA 3WDTA 1ZNPA 4N43C 4QXBA 4S2FA 2VR4A 3ST7A 4HONA 1BBT3 2BVBA 2J42A 3JXSA 4LMFA 3FLTA 5DUXA 4C8DA 5KXDA 1W2UA 2VUCA 3Q9OA 1CGPA 3A0KA 4A3XA 4PI2A 4COWA 2CV6A 3MV01 1OHFA 5BNNC 3OTFA 3ACGA 4TWTA 4Q4X3 4N8MA 3V0BA 1AHSA 1EY2A 2D43A 2GNDA 2LS6A 3A0NA 1YFYA 3LWCA 5IK4A 1DZTA 1VBB3 1LOAA 2OUJA 1VBD1 2BPA2 3PJQA 4FFIA 4N9IA 1NLSA 1W90A 4KBBA 1YFUA 5T5OA 4EQVA 1ULDA 3LIGA 4I0WB 1XE0A 3IIIA 5C3PA 5FO9B 2WJSA 1Y9QA 3HBZA 3M3EA 4RD7A 2QCSB 4JTOA 1GNHA 1PIV2 3M70A 4PQQA 5K9YA 1S2EA 4XHXA 3FZ3A 1JODA 5A3UA 3ZYRA 2VJXA 1QJU3 4IEXA 1H4HA 4UFJA 1AYN2 3VKLA 2YHJA 2LUWA 3ACHA 3KMHA 3J7MA 2JX9A 5EYYA 1RMU3 1HRI1 1CR7A 2A75A 5FZIA 3WNOA 1T2XA 3MUY1 3RGBA 4WVWA 3D82A 3A4UA 3HN1A 1ZZ8A 1TE1B 3ZMOA 1DGWA 1POQA 2HKXA 3ZR6A 1VBA3 3AMMA 3IAQA 2EXKA 4L11A 4XQDA 1W28A 1JYVA 5K0UB 4GWMA 2Y64A 2W08A 4A4AA 2HWD1 3OBAA 5ACA3 1AR93 5FYBA 4LHNA 3AB0A 3LDRA 1TQ5A 4NWVA 1AR61 1O4ZA 4L97A 2Q8OA 5F5IA 2VULA 3PNAA 2V4AA 4QGMA 4CCOA 2PFWA 2WWSA 3PDQA 3ZMNA 1O3RA 2VZPA 3MHZA 2WO3A 4WVMA 5FP4A 2W9XA 2B9VA 3HNYM 5C6CA 5CFDA 1AL23 2A73B 1VJ2A 1LGNA 2B45X 1YI9A 2R043 3GDBA 5FUIA 1RYYA 2J1VA 1US3A 5JOYA 3AMPA 4WM7C 1YIFA 1DCSA 4PIYA 2BVVA 3LD8A 3NV1A 3W20A 1DQ4A 1GOGA 5IUQA 2R32A 1XB9A 3KS7A 5T52A 4CCJA 3AMNA 3PMEA 2G9ZA 3T30A 3RJ2X 2IUWA 3VBOC 4XCAA 2XMLA 4OQ8A 3CU7A 4X8NA 3UJOA 4ZXKA 3WF2A 3TEYA 3KCCA 2AEZA 3OBRA 3CO2A 1Z7S2 2WNEA 3H1WA 4JZRA 4LXLA 5A6XA 2QDNA 5C5UA 4NUBA 1U5ZA 4O9GA 1W0NA 2R0FA 1GNZA 2R062 5ISLA 4LHKA 3NQHA 1ULPA 5IFPA 1QQP3 1X36A 3LGRA 3LSEA 4H7MA 2Y33A 3B01A 5JXJA 2VVDA 4FCAA 5A33A 4OYUA 4Y22B 5JSPA 4IV1C 4PHZA 3PU3A 4O65A 4BJ0A 1JOBA 5J37A 2D6NA 5E6HA 2FMYA 2QQWA 2RR13 4MGQA 4WZCA 1AR83 1SLBA 5L7OB 2E7QA 4NIDA 2XJRA 4BQ1A 4NIHA 5EV7A 1QGLA 2PHTA 2RS11 2VZTA 3HOBA 4W6YA 3VBUA 1MS5A 1B35C 1JTZX 1ASJ1 2YC4A 3KVBA 4Q27A 2AENA 4YFZA 2VZSA 1YQ6A 4OMCA 1ZRCA 1LHWA 1OXCA 3FJSA 3J8F1 4XZUG 2OQ7A 1GV9A 4XMIA 3MFAA 5FZAA 4C1WA 5D2AA 4R9DA 3I59A 1R081 5FZ4A 4Y3OA 4M3CA 5GLZA 5K0UA 5F7UA 2FHRA 4ITCA 3VKOA 4DRVA 1RUC3 1DLLA 2RR11 2Y38A 1QH7A 4BCUA 2CAVA 2XONA 3USSA 4CXYA 1QWRA 3ORJA 3HIFA 5FYMA 4F7ZA 1DQ1A 1C5HA 2BFUS 3ZXEA 4JGYA 3O7OA 5DAPA 1HB1A 3ZYHA 2FDIA 1RC6A 2Y60A 5GLWA 3OY8B 1MR5A 1RUE3 1JYWA 4NPMA 3OGRA 2P1BA 1RUH1 1YQ5A 2QFEA 3AZVA 3MGUA 4JV4A 5A1AA 4GWIA 1RL3A 3K4ZA 1JZ7A 1JUIA 2WNUB 1LTEA 4F3JA 4CCEA 5T3NA 4CEWC 4XZPA 1WWYA 3EO6A 4NIGA 2VTXA 5FXZA 3FUQA 3ZFFA 5CISA 4TSVA 3HN3A 2O8OA 1STMA 1ZBA2 4E8CA 4Y1YA 5C5TA 4UWDA 4P9YA 1A8MA 1AYN3 3IB3A 5A7WB 4D3WA 4Q4V3 3T2PA 1AYM1 4NVPA 1DGWX 3HR9A 3I3BA 4CDXB 1V6KA 1SG3A 1V6JA 3VBFB 3KT1A 3LZZA 2W92A 1BEV2 3Q8AA 1BHGA 1AX1A 4N53A 2JKBA 4R9CA 4HVQA 1G9CA 3T1LA 2R041 2ZGRA 4N43B 1BLZA 2ADDA 1F8VA 4UFLA 5H9SA 4FXKB 3T2TA 3NMBA 1A78A 3OUJA 4FAHA 5CA6A 3KZ4C 4UYBA 1HLCA 1LOFC 1WLWA 2ZHMA 4YW4A 4JX0A 4KQ7A 4D7SA 2HWF2 3VB9A 2DBNA 1QMJA 5FFOC 3GF6A 2D6MA 3TN92 3ALQA 1L3JA 4LKDA 5FZHA 1W8WA 3NWKA 3H7YA 2DUQA 4WVZA 2HWC3 1PO22 2BERA 3WW4A 1MACA 2YGLA 1O5LA 1VMFA 2R042 1W0PA 1EV13 3KCXA 4CRQA 1W8TA 3AL5A 3RVHA 2WYFA 1H0BA 4MOAA 4H7LA 4IV1A 5BNOC 2B4KA 2D3SA 4CP2A 3O1SA 2H0BA 1YLLA 3A7QA 2PMWB 1OA2A 1PX3A 2CGOA 2WZR1 2ZMNA 4Q4V2 4FOWA 2QE3A 2XXZA 3P3PA 1VBD2 1HXS1 3I59B 4IEYA 4MXVA 1FMD3 2ZOEB 1RUI1 5FDBA 4CCCA 3RPQA 1H30A 5FK8A 3FHIB 3I2JA 1Z7S3 1ZA4A 1HV1A 4XUNA 2J1AA 1FPN3 3I3QA 5T54A 4XF9A 4QKNA 5KHHA 1NT0A 3T2QA 4BYYA 4BQ3A 2WWUA 3ZPYA 3JUUA 2WABA 4M3CE 3MPBA 3MPPG 4G9SB 3MDPA 1ZM1A 4XAEA 4Q4W2 1QJEA 3WW3A 2V72A 4UT5A 1VAVA 5EIYB 5FP3A 1VBB1 4E4DX 4WVVA 1RIRA 1UL9A 2CY6A 2ZMLA 3FX3A 4HANA 4LR4A 4EN6B 1UAIA 5CB7A 4UFIA 3ZSEA 1YFWA 4JKKA 2PAKA 2G19A 4NAMA 2ID4A 1GQPA 3DL3A 3EXUA 4XBQA 5DZEA 2FDFA 4XFAA 4XJ9A 2IXLA 1PGL1 3AXDA 3MLKA 3MW4A 1S0FA 4NO4A 4Y1XA 5GZEA 4BH9A 1KS5A 1J3QA 2Q1FA 1HJGA 3ZYJB 2VH9A 4GMP3 3WUCA 4L99A 4FFFA 1NCQB 1YNAA 2WZEA 4META 4Y24A 1LB2A 2FDGA 1QKQA 1DYPA 5DZFA 1WA6X 3VDDB 2GH2A 4HSJA 2HYXA 4LITA 4XC9A 5IWFA 4I01A 4QDSA 1W2NA 3J7NA 3ZSMA 1JZ5A 3RZKA 1JU4A 4UAPA 2Y34A 1R083 3KB5A 3O1RA 4DY5A 4YNIA 3WG3A 1RUC2 3GM8A 4QPIC 1HRV1 1PX4A 4E27A 4XDPA 2HWF1 2D5FA 3AP7A 1MPXA 2YU1A 1QIQA 3FLRA 1W0OA 4LPLA 1LHUA 2XJQA 3LA7A 3F95A 5ANQA 4QT6A 1CQ9A 5A70A 3DKWA 1RUE2 3ZM8A 1RUF2 1C4RA 4HFSA 2XVGA 1QJY3 3POSA 3IT8A 5F2WA 5CFCC 3WQ1A 4E2QA 2V4VA 2JG9B 3AKQA 2O14A 3R4DB 2WFPA 3GJAA 5A80A 5A3LA 4OUEA 3VZNA 2XJSA 5F8PA 3O0VA 1F15A 4HG6B 1JMUB 3T4HB 1ASJ3 1LOEA 4XFFA 3VBRC 1QJY1 4IE6A 2XR4A 4U36A 2ZGMA 1X9TA 4XXAA 5HI0A 3GALA 2YBSA 3USUA 2GNMA 2O8QA 1UN1A 4P9JA 5JXGA 4PF1A 1Q8SA 1XU2A 4MUVA 2JB8A 1L7LA 2EXIA 3I2DA 1RHI3 2UU8A 3PUHA 2NMOA 1KDMA 5ACA2 4D94A 1K45A 2DUPA 4K40A 4P9WA 5FZ7A 3VLBB 2CGPA 2R072 1ZYBA 2DTWA 1NE6A 3B7MA 3WP4A 4WM8A 2BWAA 3ITQA 2IFWA 4CZSA 4XYXA 4OHZA 3TNQA 5G04L 3JBG1 5FZFA 3ZDSA 1FT9A 1URXA 1W8FA 3H50A 1PMJX 3PVEA 2SBAA 4HETA 2YGMA 1CX1A 2GDFA 2HWB2 4ATEA 3DPRC 4BOWA 5IVBA 2ZHLA 1IS3A 5I0RA 3ZFEA 4EN7B 1GFF2 1OOPC 2ARCA 4LLFA 4WM7A 2P6CA 4MH0E 1GQGA 2Q1MA 1Y3TA 2A1XA 1O4YA 1V6NA 4I02A 2ZMKA 2WFF2 5FZEA 4DUWA 2ZKNA 3WV6A 1Q8PA 1UCXA 1WMXA 4XFCA 4EN0A 1ASJ2 5CZKA 1N1VA 3WNKA 2YC0A 4QU1A 4YRDA 2ZHKA 1ND2B 5EZWA 2R0HA 5LK5A 4AEDA 2XKPA 5GM0A 2UY8A 2AZ5A 5L9RA 1T6BX 1VAKA 4KWJA 3OGVA 1NQJA 1ZZBA 3VKMA 3WQBA 4X8PA 3EYPA 5LATA 1JYXA 2CNAA 4FSJA 5FY0A 1SLAA 4Z07A 2PELA 2J1TA 2VPVA 2VUDA 4QX3A 4DFSA 4B4PA 2JG8B 3FC0A 1NCRB 5FQ0A 2EVXA 1O7FA 2I07B 4Q5OA 1PO21 1RMU1 1S0EA 4IE0A 4OLLA 1N47A 5LRRA 2ZHNA 3VBUB 1OQ1A 5FZMA 5FPXA 3RZLA 3RZMA 5AFBA 3GZEA 1WD3A 4Q1PA 3BU0A 3HWJA 4PBOA 1U5XA 2WS91 4R52A 5EJ3A 2ZGNA 3WZ1A 3KF3A 1HB2A 5L9BA 5GJ6A 1OQEA 1VRBA 4B3NA 4C0HA 5LBFA 1DGRA 2Y6HA 1SHWB 2NZ9A 1YRZA 1OF3A 2XJVA 2DVAA 4BHPA 4FPGA 4NIIA 3ACIA 1C57A 3IKWA 4RFRB 5FUNA 2JEMA 5IK5A 1UXXX 4WZFA 2B42B 2VUJA 2VOTA 3ZYIB 2VNRA 3VZJA 1NQDA 3DGTA 3SNMA 3LPGA 4AEJA 3KGLA 4IGQA 5FYYA 5IK7A 3RJRA 1W2TA 1V0AA 1VRH3 4FPLA 4AAXA 2IZWA 2Y6LA 3LF7A 4NHXA 4LLOA 5IK8A 4URTA 2XVLA 5BNOB 3NO8A 2LW8A 2FCVA 3KF5A 1UY3A 4QDRA 2BYVE 2ZA9A 4XMAA 1JS9A 4B1MA 4QQHA 5K0UC 3M1HA 1XNTA 3K4DA 4GALA 2OXBA 2DWRA 4BU2A 2WAOA 2VMHA 2JIJA 4YARA 4JQTA 2JDPA 3JBG2 2EF6A 4JKMA 5FTTC 4RA0A 4AGGA 2B46X 2PHXA 5A1FA 2EXHA 3N9LA 1CESA 3PIGA 4K21A 4QAWA 4XJUA 3WG1A 4YM3A 1MQTA 4OHVA 1RUE1 5JDBA 5A6ZA 1S1AA 3ILFA 2E53A 3ROUA 3PJYA 2VNGA 5L36A 2Y6KA 4FPJA 5F5CA 2W47A 1LECA 3AZWA 1D0GA 2D93A 3PMSA 1WW6A 1J1LA 4YZ3A 1Z78A 3AK0A 1ND2A 2W1SA 5A3WA 2YU2A 3OUIA 1GP6A 2PAMA 3MIHA 4FVVA 2CDPA 1VALA 3LAGA 4P5YA 5C70A 3VBOB 1ENRA 1XJAA 4C1XA 4KGQA 3LOIA 4KL1A 3JD73 2JJ6A 2YPJA 5EHDA 3DF0A 2QBXA 3KCYA 4KU8A 4CPBA 1NCQC 5AFEA 3BIEA 1OVPA 3ZSLA 5A3OA 4OUMA 4Z92B 1X9PA 1XNKA 5KHKA 1C8NA 4BQ5A 1W9SA 1SFYA 2G1MA 1OPMA 2RV9A 1YXWA 4NE9A 3VHOA 2K2SA 1H8TC 3AP4A 4IEVA 2BW8A 1R64A 2AYHA 4XTMA 4R8HA 4AQSA 1OF4A 3SCGA 1XYPA 2ES3A 2QDRA 1AYM2 1KGYA 1QDCA 4D6RA 2UWAA 5JOXA 4KGGA 1H8VA 4BPZA 3IMNA 1FPN2 1QU0A 4LOTA 1S0DA 4CE8A 5FZCA 5DUVA 4BZ4A 1QJX3 3K2OA 1UD1A 1A3KA 2V09A 4AI2A 4HN1A 3H8RA 4BA6A 5KXEA 4NHLA 1D4VB 3JU9A 4LQRA 3SLIA 5CFCB 5FMOS 1AF9A 5DZGA 4PQ9A 4AXOA 3DYMA 2R1DA 4RL7A 5CEHA 5GZFA 3AFKA 4LKFA 4LBMA 1OA3A 5FXXA 4AQ6A 5JPNB 1MZ5A 1UYYA 4ZU4A 3EBRA 4XOGA 2AGSA 2LALA 5ABJA 1RUJ3 4C90A 2GN3A 1DLCA 3FLPA 4CEYB 3UETA 1O6UA 2A6XA 2BZDA 4AVAA 2FCUA 4CDUC 1UKGA 3AJYA 2VC9A 2WQ4A 3WQ7A 3WEZA 4A3ZA 5I0SA 1GOHA 5A6QA 4LJHA 4LBOA 4CU7A 3BPZA 1VBE2 1AVBA 1I9RA 4UF0A 3VGIA 1G9AA 3OOXA 3T0AA 5JXHA 2EIEA 3EB7A 2IVJA 4QDQA 3CJIB 3BI3A 3TEXA 4AE2A 2WNUC 2EIDA 2UY9A 4TLFA 3WP5A 4AQ2A 1LESA 1Q3EA 4H14A 1PVC1 3N7LA 2BGOA 3PU8A 1ZZ7A 4OI4A 4YVSC 3RFRA 4FQ4A 1FI2A 1GZCA 3RWKX 1J3PA 2PLV2 3TB0A 3DPRB 4GB33 2D6LX 2Z2SB 4QXCA 5FPLA 1NYWA 5JCTA 1ZVFA 3O14A 1WCQA 2BQPA 2GC0A 1PHMA 3GGLA 4XIKA 2ZX2A 1C8M2 3P1IA 1CPMA 3NJXA 1YIPA 1I6XA 4AFMA 3VBSB 1W04A 3LKJA 2VNOA 3C7EA 4CUAA 3UKVA 5A3NA 1AR82 1PM7A 2OS2A 4O7XA 2WZ8A 1UY0A 4YSFA 3KV6A 4FO9A 1UYPA 2RDQA 5DAQA 4Y1VA 3W5NA 3WNNA 2X8KA 4C0BA 4AFAA 4I0AA 5EJ1B 2NQYA 3O0WA 4BIFA 2BOJA 5F5QA 5JAXA 4MLOA 4CDQA 2ZGUA 4W8JA 2RJKA 1WKYA 1F31A 2PTMA 5CG9A 1RUI2 3GCXA 3V56A 2P3YA 1BZWA 2GSYA 1OUXA 2ZEWA 2ZZQA 2ZGKA 3CHXA 2RMU3 3KQ4B 4XFGA 1MVQA 4AEKA 1O3TA 4H55A 4N7UA 4IESA 1NCRC 4XURA 1ZZ9A 1J59A 3CNAA 3PUIA 2DVFA 1AXZA 1NUKA 2LROA 3G7DA 4OCTA 5F32A 5C3OA 1ZBE1 1W39A 2A70A 2BDRA 1WZXA 2ETEA 3BOWA 5FIXA 3TYJA 3VBUC 3W9AA 5JXIA 2FD8A 1H2KA 1UW8A 2CAUA 1SPPA 1ULOA 2RVAA 1KXGA 4LBKA 2VG9A 2QUOA 3CZJA 3LEKA 3RI8A 2WQ8A 1JH5A 2VQ0A 3TN91 4CCNA 3JZVA 4MGSA 4QKDA 2AUYA 1MEC2 1UOFA 1DQ0A 2VL4A 2ZAAA 1VBD3 4JDMA 5D1IA 1DFQA 1X33A 2IXJA 4A45A 3FFQA 4JGYC 2KA3A 4QHOA 4Y5SA 2W2IA 2HYKA 2ZJCA 4BISA 4KG8A 3U14A 3WNPA 3NAPB 4BQWA 2XVKA 3B9CA 4QM8A 1DQ2A 1ZZ6A 1UY2A 1MS0A 1GANA 2P3JA 3RYKA 1YQ2A 1PGL2 2VE1A 2RMU2 2KD7A 3FL7A 4QB2A 3NVCA 4HVRA 4YZ1A 1SQ4A 1CVNA 3CJIA 2GP5A 5FYCA 5I0DA 3VUOA 1APNA 1MS4A 5FZOB 2DURA 2VZ1A 4FT8A 5A6YA 1A6CA 1R1A3 5JPMB 2QQJA 4RS5C 4XUPA 4AFDA 4R4ZA 1G9BA 1IHMA 1SLCA 1W6PA 2BUKA 1GSLA 3LSDA 1TMF1 2D3PA 4DO0A 1H1IA 4DXZA 4FBFA 3H7JA 4JDOA 3MV11 1CAVB 2ZGQA 2VCMA 5FY5A 3WNXA 1CIWA 1ALYA 1OURA 2QQVA 1JHJA 4D6SA 1EAH1 3OGSA 3S7IA 1RUJ1 3ES1A 2QQLA 3I2IA 4L0PA 3BUCA 1UWWA 4RR3A 3D6EA 5HXVA 1OI6A 2QQKA 2R1BA 1NX9A 3B00A 4Y5TA 2VVFA 5C3QA 2VZ3A 3OEAA 4R9BA 1XPWA 5E1RA 4FFGA 1YJKA 4SLIA 3BGAA 3BKZA 4Z8BA 3JQXA 2JKXA 2NP0A 3EQEA 1QOSA 3POGA 1S4CA 1MS1A 4I3GA 4IEZA 1LOFA 4C91A 2E33A 1UMZA 2E32A 4BDVB 2IC1A 2OX0A 4M3CF 5EP9A 4RGKA 5FPVA 1XBFA 1MZFA 3N9NA 5C8CC 4UW6A 1GKBA 5DN2A 5IYYA 4OHWA 3MUZ1 3JD71 4P9GA 5DAVA 1Y7BA 4YZ5A 1HB4A 2P2KA 4WM8B 4YWAA 1CD3G 4D6QA 5J09A 1YQCA 1UOBA 2E7TA 1K5MA 4XUTA 1NAEA 1POV0 2JICA 1SPPB 4EWDA 2VZRA 5DMYA 1TMF3 2XHNA 1FNZA 5I91A 4QPWA 2IFRA 4Z82A 4FPEA 1KD7A 4DUXA 2D7FA 2EA7A 2E9QA 2GMPA 1RTVA 2XBO3 5C4WA 3ZSJA 3SKVA 1DZQA 3OYWA 3VBRB 3F2ZA 1BJQA 1LEDA 2HWF3 3ACFA 5FPZA 2W3JA 4AHYA 3LDKA 2Z79A 3Q8EA 2CGNA 4P9XA 1BCXA 4LBQA 3SHRA 4CEWA 4AEDB 1QJX2 4PLMA 5DAXA 2BNNA 3IWZA 1MQTB 4P08A 5EPAA 3NAPA 5FO7B 3U0ZA 3AL6A 1UX6A 4GJYA 4IGOA 1X82A 4NPLA 3V0AB 4EN8B 1BXHA 1LU1A 2Y6FA 3N3HA 2XG3A 1RVF2 2C1FA 2YB7A 2EICA 4IGPA 4XDQA 1QY4A 1MS8A 4IV3B 5FKCA 3POYA 3UKNA 4ZZ8A 4L2NA 2XBO2 4NN0A 2RG4A 1W9TA 4XUQA 1VRH1 1OLRA 3KVAA 5FYSA 5FY7A 3RYPA 1COV1 4LK6A 5BY5A 2ZACA 5J3UA 1FPN1 4IE4A 5T50A 3VKFC 1CAWB 1DU3D 3PTYA 2NN8A 1OOPB 1HW5A 2P5BA 2G4IA 3O1VA 1CAVA 1IG0A 4X6RB 4N7IA 1PMHX 4AYUA 3CJIC 1WW7A 1TG7A 3KV9A 2WZR3 3CLPA 2A7AA 1REDA 1ND2C 2XUEA 3WP6A 5BV6A 4RS5A 3FHQA 4BQXA 3KQRA 3WUDA 2WA4A 2PAEA 4HPKA 3J7LA 3BIWE 5D8AA 3WT3A 4TXWA 2H6BA 1UU6A 2DCJA 3LEMA 1HB3A 4RSUA 1KRIA 4R4XA 4XAAA 2Q8DA 1QNYA 5KWRA 4WV8A 3S5AA 2JG8C 3VL8A 3AKPA 4HSLA 3MEPA 2HH9A 1L7QA 1NLQA 2L9LA 3LDBA 3OBTA 1NXMA 4G3YC 4DQAA 1ZREA 2WC2A 3RS6A 5LZ6A 1D7PM 4PDWB 5FV3A 2YMZA 4JTNA 1F9KA 1QXRA 3C3VA 2J1RA 4LOSA 5IAVA 4K8FA 3OSDA 4YM2A 1PO13 3MIBA 4NRPA 3QD6A 1FMD2 1AZDA 1HQLA 3CL1A 4ISQA 4XTPA 5JIAA 2RS52 4BLIA 3LFMA 2JDNA 1ENQA 3O12A 1O3QA 3OUHA 3DCQA 5FMBA 3AP9A 5BNQA 2MPFA 1QHDA 4AZZA 3DXTA 3T08A 1DF0A 1LRHA 4JAAA 5LCWL 1H9WA 3TNPB 2JDAA 3MLJA 2R061 2AC1A 1W06A 2V5DA 1RUG2 4GIQA 5BNPA 2JDYA 1LGBA 2GC3A 5E16A 5C7GA 5IVJA 4JHTA 3ZKUA 2WS92 2ARBA 3FBYA 4PJYA 2HJIA 4ZKTB 2WNOA 3M2MA 5I0UA 2BFUL 4PLNA 4MHRA 1CJPA 2J1SA 3D0JA 3K4AA 1K12A 4TZDA 4UF0B 1O3SA 1HIXA 2ZEXA 3LIHA 5APAA 4ZZ5A 4CDXA 1DQ6A 4U2AA 1QF3A 2WDBA 5F3EA 1W6OB 2FBEA 4CVUA 1XE7A 1MS9A 1RVF1 3JBG3 4E9KA 1WMFA 3UNPA 1DDLA 1OH3A 5IFTA 3EJKA 4CDUA 1MZEA 2E7AA 3T1MA 3USUB 4HLTA 1AYN1 4KU7A 5AC93 4GB32 1RITA 2EAAA 3VL9A 3H0OA 5E88A 2FZ2A 1U5IA 4H3WA 5LA0A 1V9U2 2FCTA 3UESA 3RWNA 1G7YA 3NAPC 4DNYA 2F4LA 1RHI1 1VB2A 4LIUA 4BMBA 3DYOA 5F2SA 3CMGA 1CAXA 5F6KA 5F1RA 1VBE1 3ZKYA 1IKPA 5FXWA 4N53C 2F6BA 5EXOA 4XJ8A 2JIGA 3CJXA 2HWD2 2YPDA 3DYPA 4K6BA 2Y6JA 3LEIA 4LKEA 4M01A 1NG0A 4CU9A 1IKQA 1RXFA 1WW5A 5B4NA 5C9AC 2NLRA 4FTEA 5J36A 4RS5B 3THPA 5J7MA 3SKJE 4TLGA 4Q0QA 4YGDA 3U78A 2HWE2 4OHYA 2Q1ZB 1WLTA 4AHXA 3B9IA 2KM2A 1Q8OA 2X53S 1SBFA 3V64A 5CBLA 4PLOA 4Q26A 3NV2A 4M0HA 2IVIB 1NA1A 4XUOA 1HRV2 3K48A 4PIZA 3BODA 4COVA 1XNDA 4ASMB 4ET7A 4BWOA 4QKFA 3U1XA 5ABJB 3UV9A 4CU8A 4JVAA 2YBPA 4AG4A 3QOPA 2RDRA 4Y4RA 1S2KA 2YDEA 2BBAA 3RQ0A 4Z2AA 1H8TB 3ZN4A 4OI2A 1OVSA 4GZ9A 4NR1A 2CL2A 2VCCA 5IVFA 1XU1A 4RN5A 1HRV3 5LEJA 1DHKB 5LBEA 1D2SA 3MFCA 4H2AA 5DUUA 1W6MA 4MVTA 3H3ZA 1Q5OA 1NCRA 4FP3A 4LK7A 1REEA 4CCMA 1AR81 4CCLA 5C8CB 3ZO0B 1UU5A 1JYTA 4LO8A 3VBFA 1BQPA 1V6MA 2NMNA 3HNMA 4PCRA 4IL7A 4YW2A 4LA2A 4OZOA 4D8MA 4N43A 1POV1 2PYTA 1DGLA 1DQ5A 2VOVA 4Y1ZA 4GULA 1YYNA 5J48A 1YUDA 1E5HA 1WCKA 2Y26A 4CP0A 4K8RB 4MSVA 4Y20B 3TOJA 1N3PA 4JRLA 5FAXA 2D6PA 3THTA 1JYNA 5LBCA 4GXLA 3S5QA 4NMIA 2D6OX 2VOKA 5FKBA 4OHXA 4CEYC 1RGSA 3I2HA 5F39A 4AHZA 1BK1A 4JC1A 5JVVA 5JOZA 1PZ8A 3HAGA 2HBTA 1HJFA 1LKNA 4UFHA 4CDUB 3W59A 3VHRA 3H3LA 1HN0A 3PL0A 4CU6A 4AEDC 3NV4A 4I30A 1DP0A 1XRUA 2RM21 2ZZJA 4DZGA 1UZVA 1RUI3 1KDKA 3O0XA 2YY1A 3FWEA 3HQRA 1CZVA 4QPGC 1OMIA 4RR3B 5KC5A 4O61A 4CUGA 2WT2A 1FOD3 3LB9A 4Q0UA 1SDDB 3RNSA 3ILRA 4CDWB 2XGXA 1R082 1S0BA 4TTGA 2VQUA 4IV3C 3E5UA 4YVSB 2OZJA 3CBNA 3O5SA 4P00B 3WVJA 1AL21 1LOBA 3K46A 3TBDA 4CUCA 5FREA 5KC6A 3RZHA 2DCKA 2PHFA 1C8M3 2WQZC 4XFHA 4MG2A 1MVEA 2XH6A 3HT2A 3N9MA 5T55A 4CPBD 3W58A 1ULEA 3NKGA 4NPRA 1QJU1 4LNVA 3VBSC 1J58A 1AJKA 4PBPA 2DDUA 2FDKA 5KXCA 3ENRA 3U37A 2Q8CA 3M3OA 2VMEA 2BOIA 3BOPA 1GWKA 3POFA 4I3PA 4WBBA 2O1QA 4MXWA 5FY8A 4ARXA 1EYBA 1HRI3 2XLGA 4HN0A 4GKXA 4LHLA 5CFDC 1FOD1 2AACA 1NA1C 1UIKA 4I0BA 5SV5A 2KXLA 3SH5A 3VKNA 2UWCA 3CEWA 5C4WB 2X5IC 1LCLA 3IZOA 4Q4X1 1VRH2 4SBVA 3RMXA 3GNEA 1V9U3 4EE2A 3VDDA 1SLIA 3CQOA 2XQRA 1S0JA 4YGEA 1BBT2 3S6PA 3ZYBA 4DPNA 3AKRA 2A6YA 3MW2A 1I3HA 1TMF2 2RJLA 2GNTA 1VBB2 1TME2 3VD3A 2R073 3KHBA 4LBJA 3GHMA 2K9ZA 1CX4A 2YYOA 1SFNA 3NNMA 4IDZA 1IS5A 4Q4Y2 4Q4X2 1HQWA 2ORXA 2GH8A 4QGNA 1M4WA 1RJ8A 2DBIA 3E6BA 2B8MA 1S0IA 5LY2A 3ME2A 4IXLA 1OLME 3M3CA 2PHWA 2X09A 3T2OA 2PN5A 4NJ4A 1GZTA 1V6LA 1XNBA 1NY71 1NKGA 4AFBA 1FATA 4GA9A 3VDCA 4YPJA 4Q4Y1 1WUVA 1WW4A 1ULGA 3B5LB 5CKQA 1CN1A 2C9KA 4JGYB 5FP8A 3I3MA 1CAWA 2VUAA 3FN9A 4QQPA 1RUH3 2UURA 5T5LA 3ZFEC 5LY1A 3OY8A 2D98A 5A32B 3WQ0A 2DVGA 1DGRN 2E31A 1W2AX 2DFCA 2GN7A 2JG9A 4JGZC 4Y4YA 5FY4A 4B4RA 4CP9B 3V65A 1Q43A 2BP6A 4PF5A 3WF0A 5AVPA 2AREA 2EAKA 4CDWA 1O91A 1LENA 1W9FA 4XW3A 1RUC1 2H0VA 2XL9A 1YFXA 3T0DA 1CIYA 4LT5A 3AX4A 3UL2A 4INDA 2FMDA 4K3UA 4MGIE 4B4QA 1RUNA 4XPVA 1REFA 4FOVA 2WT0A 4S2HA 3HQUA 3WD5A 3WHUA 3THCA 5L19A 2P34A 5FYHA 5IVYA 5I8TA 1HV0A 1PZ7A 2RMU1 3EHKA 1G8WA 5C33A 1W99A 4KBZA 4HMZA 4GH4B 3POJA 3QCWA 4D7YA 4N53B 4IE5A 3AVRA 1CPNA 1YI7A 3KT4A 4FPOB 4J1WA 4XIOA 3RSJA 5C9AB 4LULA 1LHOA 3WY6A 1JZ3A 1RXGA 4F8AA 3J7HA 3U11A 4CCKA 3BN6A 2CTVA 4B7KA 1GYKA 2ZAHA 1QXPA 4GMP0 5T5PA 2DCYA 4D0QA 2LTNA 4R9AA 1IPSA 1GNYA 2WSVA 3WR0A 3ILNA 3VBSA 2A6VA 2K0GA 3PVOA 2WBKA 4GB31 2P3IA 1YO8A 2GZWA 4FOYA 2PXJA 4FI9A 3DECA 4P5HA 5FZKA 1UF2C 5FO8B 4L9BA 3AMHA 2VZOA 3ON7A 4WM8C 2HEWF 1XSRA 1ODNA 3U4XA 1LHVA 1ZBE2 2VM9A 3MIFA 2RJ2A 3NL1A 3DEMA 1KQRA 1UY1A 5JMOA 4OI0A 2Q8EA 1XNAA 3GXUA 1ZBA3 3MICA 4HOOA 1H2LA 3IDBB 3BYWA 4ZS2A 1R1ZA 1U5YA 5DDJ2 5LRSA 1PIV1 3JD72 5KR7A 1SEFA 4QHBA 3ZFGA 4BQ4A 2VMCA 5A1LA 5CYYA 3MF6A 4K9SA 5J96B 1MEC1 4KMQA 5GLUA 2QZ2A 2OKXA 3VBOA 4NROA 3MBWA 1HXS2 3OD0A 4K20A 1W8ZA 1MQTC 3QACA 2RDNA 4LIVA 5A7OA 4HPKB 1CZTA 2R063 2UYBA 2I2SA 5A32A 5D8AB 4CP9A 5DDJ3 1Z7S1 5FCCA 1AUYA 2EIGA 3VV1A 2TUNA 5KHJA 1ZRDA 1AX2A 2GMEA 2ARXA 5F3IA 4QB6A 1W05A 5AVAA 3WF1A 4JCKA 1GLHA 5HV4A 3AMQA 2VMIA 1EAH2 3I2FA 1PVC2 2YUEA 4MGKE 3KM5A 1SDWA 2RS31 4WVMB 3VZLA 3ZN6A 5BUVA 3AYAA 3PIJA 1U12A 1L7RA 3ES4A 4BXFA 1HX6A 1S0CA 4MHUA 1NCQA 3O1TA 3WXPA 3CIHA 4UBGA 5BNOA 4ZHNA 1W3XA 3O1UA 5FLHA 4QKBA 1M06G 3OEBA 4RR3C 4AF9A 2JB4A 4QPGB 3JQWA 4ARYA 4CDWC 4E4HA 1KEXA 2LM3A 1UNBA 4BIOA 4QX5A 2H6CA 2XLFA 1PK6A 4I09A 2MEV2 2WT1A 5BYNA 4XJZA 1UY4A 4XBLA 4HBNA 4IE7A 5HXMA 4Y1UA 4AFCA 1RHI2 2VD7A 3LCPA 1V70A 3FE5A 1EAH3 1QXJA 4RQPA 2HBUA 2J1UA 3U07A 3WF4A 1ZRRA 1PVXA 3H1MA 5C8CA 2VXJA 1OSGA 4GKYA 5FZBA 4XCBA 1H4GA 4AW7A 5FOJB 2ZBJA 2K46A 1XQNA 3ZLIA 1BYHA 1R1A1 1UZ0A 4O9EA 3SITA 1TZOA 2DF7A 1BBT1 1JUHA 2IXCA 4PDWC 5JUVA 1AYM3 5A7WA 3RRDA 1YCIA 5A33B 2ERFA 2OW4A 2OYZA 2QQOA 2SLIA 1JYCA 1BVVA 1ZZCA 2JD9A 2OPKA 2WFF3 2WNVA 3E6CC 3Q8BA 5CVRA 3VDAA 5C4WC 4QXKA 4ATFA 3H8XA 1AR73 2PHRA 1AR71 3VHPA 4YVWB 3W21A 2VBPA 4A2UA 5LA1A 3N4MA 1KJLA 2BU9A 2XKOA 1J84A 3OGJA 4IEPA 4ZY9A 3ETPA 4FXGB 2QTWB 5A3MA 2R071 3LPFA 1JZ4A 1UX7A 1W6NA 3TN93 1QJZA 2PHUA 5GALA 3ZVXA 1RUJ2 2XBO1 3UKTA 3M7AA 1LR5A 2ZGPA 2DU1A 5AC92 4FPFA 1PM4A 4M3CB 2JDHA 1WLCA 4YVSA 4UW4A 1IG3A 1OFNA 2HWB1 2VECA 2VGDA 2D3RA 4Q4W1 1AXYA 2R30A 2AEYA 3BVCA 3WDYA 1OPOA 3FHAA 3MIDA 3IDEA 1CAUA 2A5ZA 3O1PA 4V2WA 1ACCA 4IEUA 5A7NA 1R092 3J8F3 4HKLA 4KWUA 3ZFEB 4URAA 4NRQA 1VPHA 2BWCA 3ZR5A 5M0TA 3E5QA 4JGZB 3Q8CA 2OA2A 4RHV3 3J26N 3GBWA 3AFGA 4XFBA 5FP7A 4KWKA 4IV3A 3E1F1 3ZIWA 3R4SA 5JWPA 5DUWA 1YJLA 3MI8A 1FX5A 2DUOA 4IEQA 4MXWB 2J22A 2VZVA 2TNFA 2BGCA 4DOUA 4XETA 3I2GA 5DDJ1 1K42A 2BV4A 1F5FA 1FYUA 2Y0OA 3I54A 1WD4A 2ZGOA 1LOCA 2ZKLA 4K1YA 4QX8A 3I7DA 1C28A 2RS33 3OD4A 2C4XA 4GH4C 2JXAA 1QJU2 3LEGA 5DG1A 5K4LA 4EN9B 4OUSA 5FJKA 5ABJC 4COZA 5JZGC 4AVTA 4RFT0 3INAA 4DIQA 3C7HA 3VDBA 3AKTA 1OD5A 3ZFFC 1FV2A 1KFUL 3HNBM 4E2GA 1D4M3 1JHNA 1SFPA 3CDZB 3AZXA 4HXCA 1E57A 4JDNA 1EUTA 3BU7A 5EQUA 4AVVA 5CAZA 2WN2A 1UOGA 2Q5TA 3HQXA 4GWJA 2GC1A 2YXSA 4B7EA 3NV3A 4S2GA 3N9PA 4KI5M 5BNNA 3A23A 5HCBA 3VHNA 5B2GB 4NIAA 4BB3A 3AZYA 4YVWA 1BK0A 3ELNA 4RGAA 1AR62 1F4HA 2W68A 1W3VA 2UYAA 3I3DA 4E2SA 2VOXA 2W1QA 1GICA 1WCSA 5HCHA 1VMHA 4XILA 5HBAA 4B29A 2F4PA 1ZBA1 2VTFA 2W87A 1HKDA 4LE4A 4QQOA 1PGW1 2R49A 3AM2A 3PURA 2JDUA 1UPSA 3WOGA 1OA4A 1OH4A 2BNMA 3WG4A 4Q8KA 1YWKA 2XHKA 3PVBB 5IHRA 3MYXA 5FPUA 4FPHA 3ZXJA 2QQPA 3DV8A 1V6IA 3VD9A 1G9FA 1BEV3 3LOBA 1JBCA 1W8OA 3A21A 2ZPXA 2A71A 3POIA 3QH7A 3WINE 3WNLA 1A34A 4D69A 2HWD3 3AYCA 5ACA1 1IPJA 1CONA 2ZX4A 1Q8VA 3WF3A 2HLEA 3OB8A 4YW5A 3AC0A 5FP9A 3KSCA 3D4KA 3QBQA 4FPYA 4GJZA 2F17A 1R091 3R05A 5IW0A 2JECA 1H1AA 3M3QA 2NM1A 5DPNA 4XBNA 1OBNA 3SCFA 3OPTA 3K77A 5FMOL 4P02B 3NKTA 1SLLA 1LODA 3TWIA 1NZIA 5I8SA 4HKOA 4QX2A 2ZEYA 3OPZA 2JG8A 5C9AA 1FOD2 1K5MB 1H2NA 4GD4A 3T0BA 1FNYA 1ND3A 2XJPA 5FZDA 4ASKA 5JSOA 5DAWA 1K3IA 1ONAA 3BCWA 3OCPA 1AR72 3VBHC 3OG2A 5IATA 3R6SA 1P8JA 4XE9A 4AI8A 1ODMA 4HKWA 1OD3A 2IXHA 2VTXJ 1W6QA 2Q30A 3CZUA 1W8UA 4QPYA 4QX1A 4ZU7A 5C3RA 1U0AA 5EYXA 3NRUA 1XOYA 1W9YA 4W6WA 5FBJA 1NOVA 4UXAA 1R1A2 2R16A 3URFA 3WP3A 4S2DA 1VLNA 4X6QB 2PHLA 1F35A 2VY0A 1XYNA 1AL0G 3ZXAC 5FPAA 1ULFA 1AJOA 4DINB 1MZ6A 5D21A 1H6XA 4E4SA 3HPNA 2OPWA 1VR3A 3WDWA 5CFDB 2BBVA 1NA1B 2YBKA 4AQTA 1AXKA 2CWMA 1GWLA 1QH6A 2X5IB 4J6GA 4Q0PA 1N3OA 2ZEZA 5F3CA 3ZFGB 3WX5A 1EP0A 1VBC1 3MF9A 1E5SA 2WN3A 3R4UA 3B02A 3IPVB 1V9U1 2B7YA 4RHV2 5FUPA 1RUOA 3MZHA 1WLDA 2TBVA 1RUF1 5E89A 5I0TA 4IERA 3AP5A 1JYIA 1MS3A 5FXVA 5H9RA 1YEWA 1K5JA 1OT5A 1O8SA 1UXZA 1LOGA 2HEVF 2QNKA 1SCRA 2WL1A 3HBKA 1HDKA 1V00A 4FQZA 4HL0A 4XF1A 4YW1A 5FMCA 5JR7B 2C9AA 1XYOA 3MIEA 1IQAA 4FPKA 1ENSA 4LUKA 4MV2A 3SEEA 1UU4A 1WMEA 3DUIA 4M0NA 3AYEA 4MGZE 4XACA 4XDOA 4YVWC 3WW1A 4YZ4A 5EWSA 1Y9GA 4NAOA 1ZRFA 1NE4A 4IEWA 2JWPA 4V2VA 4LBQD 3ZN6B 3A22A 2DVDA 3OJBA 2G9FA 3ZXFA 4AAPA 1NZCA 2DV9A 4CYDA 4YW3A 1RINA 2CHHA 2MNGA 3IAPA 5IJRA 1JXNA 2WINB 4CXWA 3HJRA 1CJDA 2EXJA 4UBHA 1C3HA 2NPIA 5FYIA 4QXHA 1H2MA 4TYSA 2ZXQA 3OF1A 2A6ZA 3VBRA 2J7MA 1CZSA 1EV11 1VBA2 2W52A 4L92A 5CU1A 2ZGTA 3NW4A 4AI9A 1Y9MA 5LA9A 1VB4A 3B3QE 1FAYA 4QU2A 4RQPB 3AZZA 2FQPA 4YW7A 1RUD1 4OQ9A 2QQIA 4AI3A 1FXZA 4MX3A 4LO4B 2HWE1 1OUSA 2ORZA 3RI9A 2VBBA 1A8DA 1GZWB 3GBFA 4Q2FA 3RZJA 1LGCA 3LA2A 1DIWA 4QWNA 2D97A 2ZGSA 5BNPB 1MEC3 1BVP1 4Q8LA 1UZZA 4LUMA 1PK6C 4BXSV 3D5OA 4EWEA 1E5IA 2WUHA 1W8HA 5FY1A 1RUD2 1PIV3 4PIXA 3BALA 5L73A 2C24A 4FTBA 3N7JA 3E97A 4YM1A 3UGGA 3K3OA 3RG0A 3VBHA 4COYA 2QKDA 3LQCA 5LASA 3GZAA 4DEVA 2WNVB 2WZR2 4Q4V1 2RM23 2X05A 3I2OA 1F2NA 3POEA 2ZX0A 1NLRA 2OIIA 2WKKA 2B9UA 5F37A 2BEOA 1VBC2 2JE9A 2QQNA 4GMP1 1OLQA 1JOJA 2XQXA 4GQ7A 2MEV1 4ES9A 4A6OA 3T09A 2C0ZA 2B39A 4M4PA 1XC6A 5KHIA 2C6SA 4A7ZA 4IW3A 1SMVA 3ZSKA 1EPWA 3ZFFB 2WLPA 2RS53 2E26A 2ILMA 3D3AA 4K7JA 4P9LA 1XSQA 2VCBA 3HD8B 3KWVA 4LO6B 5B4XA 3RDIA 2VXRA 3W5MA 1QQP2 5GZDA 1TME1 5A7SA 3K3NA 3D0SA 3RMYA 1DZRA 2XDVA 4DMIA 1AX0A 1DG6A 3WDUA 2ZCWA 3ZYGA 1LEMA 1AL22 2ZABA 4AOCA 4AVSA 4LBNA 5JI7A 3U10A 4CXXA 2WO1A 2VO5A 2A3YA 3SEPA 1RUD3 5FZ6A 5FZ1A 4A7KA 4QPIA 4Z2WA 1CWPA 5GZGA 1IZ3A 2B5HA 2IXKA 3DXUA 3H42B 2OVUA 2RHPA 3TAYA 2BJSA 3ZDVA 4CDQC 1OKQA 1FMD1 5J98B 5T5JA 2PLV3 4A42A 5FOBB 5D8AC 3IN9A 5LB6A 5K7PA 3HEIA 3I49A 3D8CA 4Q0SA 2XB6C 1WCUA 2RM22 3AYDA 3H8OA 1ULCA 1HN1A 1GOFA 5F3GA 2XJUA 5LBBA 5FR3A 4AGVA 1B35A 5DXDA 4EJRA 2HWE3 4XQ4A 4AL9A 2VBDA 3WSOA 1H8TA 1QEXA 4COUA 1HQNA 3I97A 5J1XA 5FZ0A 2WS93 1X50A 1IOAA 1UYZA 5GZCA 3H1YA 2N7GA 1N1TA 2W94A 4XFIA 3N36A 1PO23 3UGHA 2VMGA 5A7QA 3VD5A 2HWC1 3PUQA 1ZRIA 4LKSA 1EPZA 2W1WA 4M00A 2BRTA 2YG0A 4LO5B 3JB4C 4OI1A 1H9PA 3K75B 2Q4SA 4HK9A 5FLJA 3T3YA 3L2HA 2VW1A 4ZU5A 3WDXA 1JZ6A 3C7GA 2AR6A 3CF6E 2O0OA 4CCDA 4A7YA 4XF4A 4L8QA 4UW5A 2BTVC 4QHZA 4XF0A 4EZHA 1VBE3 4Y26A 1OKOA 4AWDA 3VBHB 4XQWA 4Y20A 2VQTA 4BLJA 5AC91 4LBLA 2VMDA 3UK9A 2WZPP 5BNNB 5DQ0A 3PUAA 4GH4A 2VOWA 4OZXA 5FWEA 1OFSA 1RVF3 4A41A 5L7OA 1GBGA 4Q4Y3 5JZGA 1PGSA 2QQUA 3UYJA 3GHNA 2JD4A 3DPRA 4FAGA 2CYFA 1QNWA 5IVCA 1QOOA 2GMMA 3TEZA 3WW2A 1Z0HA 4YGCA 5L9VA 1UZWA 4NOTA 1CAUB 3K51A 5ANNA 1IS6A 4IETA 2Z69A 5FRAA 1PO11 2OQ6A 1XE8A 3S30A 3WDVA 3NNJA 3AJZA 3KD4A 1B09A 2ZX1A 1GWMA 3VZOA 2YC2A 4QX7A 3ZFGC 5TSWA 1O5UA 2QJVA 4NHKA 2R6QA 3KT7A 1SLTA 5A7PA 4RGGA 4PT6A 2VW0A 4XHBA 5FJHA 3C7OA 2WA3A 3WCRA 4CTEA 5CFCA 1RMU2 5LK7B 1KITA 4ASLA 3BTXA 1F4AA 2E6VA 2P17A 1LJ7A 3I8TA 2BNOA 1C8M1 1ZBE3 2Z42A 5ERLA 1SZBA 2JENA 4XJWA 1LNSA 3ASIA 4JKLA 5BPXA 2RS32 2FDHA 3KGZA 4DRRA 2C5DA 3GZTB 3IMMA 3WHTA 4BE3A 4AGRA 1O59A 2PLV1 3HMYA 2XJTA 5C71A 1C1LA 1GUIA 2XOMA 1GR3A 1GZ9A 4AR2A 2D6KA 3GBGA 2DTYA 1KFXL 4JHZA 1OC1A 1PNGA 4W65A 3MO4A 3CKHA 1EUUA 1RB8G 2WRAA 2UWBA 3POBA 2DCTA 5BXXA 3NNGA 3RZGA 3J4UH 5FK7A 2OZ6A 2FZ1A 4EWAA 1DYKA 5HPOA 1VIWB 1ZX5A 1KS4A 5I8YA 1O4TA 3B93A 4FP2A 2W1UA 4RQPC 5JI9A 3IBMA 4XABA 2ZX3A 4FFHA 1UOJA 1J83A 4B1LA 1UKRA 2WR9A 4P14A 4JQRA 5G05L 1POV3 1BEV1 1WCDJ 5FMDA 4QGLA 5FYZA 4DXSA 2GNBA 1AR92 1DYOA 3ATGA 4LHSA 4XXPA 4BK5A 5FZ8A 2ZS6B 3NJZA 3VZKA 3ABZA 4TN7A 5BNPC 5JZGB 3R0RA 2I74A 4DS0A 1JN2P 3N7MA 1PK6B 2P6HA 4JRAA 4QB1A 4PDWA 1D4M1 3SC7X 1COV2 1HRI2 3KV4A 2DCZA 1V6OA 1NXD1 5CNAA 4QD2A 1E5RA 3RYRA 3ZX7A 4IV1B 5F6LB 3ZXLA 1UMHA 1G6NA 1TNFA 2MEV3 1IS4A 2ENRA 2WNVC 4MZUA 3DN7A 4OULA 2EIBA 2RE9A 5FY9A 3TRSB 1IPKA 3LA3A 5KBFA 3VD7A 4Y5Z0 2ATFA 2WWJA 3PTRB 4DEQA 5L7OC 2QZ3A 3U4SA 3HVDA 3P5BA 4CUBA 2ZGLA 3V0BB 2JE8A 5LWBA 4DXTA 3M3IA 1GU3A 1VAMA 4Z1VA 4N90A 2W95A 4IUGA 3B94A 5FBZA 1ND3B 3C2UA 3L9JT 5FYUA 3SQOA 1XXNA 1QDOA 5C3SA 1T6GC 2XWJB 1HXS3 2VCAA 4V1PA 4QX0A 1ZA7A 2IXIA 5JLVA 4EV0A 2BGPA 1W6QB 5FZ3A 2ET7A 3C7FA 1UQXA 2GAUA 2JDZA 1ENXA 4CP1A 2XWBB 1WMDA 2QQMA
chains in the Genus database with same CATH topology
5FXWA 4GJYA 3N9QA 4IGOA 5FZEA 2WWUA 5FZDA 2Q8EA 2YPDA 5FY8A 4ASKA 3KV5A 4QX7A 4HOOA 3KVBA 4IGPA 4GAZA 4QU1A 5A7PA 5FP3A 4CCNA 5F37A 5KR7A 3U78A 5FJHA 5A1LA 4V2WA 5IVVA 2OQ7A 4D6RA 5A7NA 4URAA 3KVAA 5FYSA 5FY7A 5FZAA 3OPWA 3ZPOA 5FZ4A 4Y3OA 2GP3A 5FZCA 5FY0A 5FBJA 5A7OA 4LIVA 5FZOA 3K2OA 5A3TA 5LW9A 2P5BA 5FP7A 2W2IA 4EYUA 4BISA 5A7SA 5FYMA 2YBPA 3K3NA 5FYTA 5FPAA 4Y4RA 2XDVA 3KV9A 5FZMA 5FZIA 5F3IA 5LY2A 5CEHA 2XUEA 2YBKA 5IVFA 5FXXA 2GP5A 5FYCA 1VRBA 5FZOB 4LITA 5F3CA 5FZ6A 5FZ1A 5IWFA 4QX8A 4CCMA 3DXUA 4CCLA 5FP8A 4BXFA 5K4LA 5FUNA 5FUPA 5FXZA 2Q8DA 5FJKA 5LY1A 5F5AA 5FYBA 4DIQA 4DO0A 4XDPA 5IVEA 2OT7A 5FXVA 5FY5A 3LDBA 5F3GA 3PUSA 4E4HA 2YU1A 5F5IA 5FY4A 4CCOA 4D6SA 3PDQA 5A3PA 5A7WB 4IGQA 5ANQA 5FP4A 5FYYA 5FV3A 5FZ9A 4UF0A 5FZGA 5FZ0A 4XDOA 5F2WA 2VD7A 5FYZA 3N9PA 4CSWA 4V2VA 3LD8A 3PU8A 5F39A 5FZLA 5FZ8A 5A7QA 3PUQA 4AAPA 4TN7A 5A80A 3DXTA 5FWJA 5FZBA 4BU2A 2OX0A 5FYHA 5FPVA 5IVYA 3N9OA 3ZLIA 3N9NA 5FPLA 3KV4A 4QXCA 5FPBA 4CCJA 5IVJA 5FYIA 4QXHA 2XMLA 3PURA 2YBSA 5A1FA 5FZHA 3N9LA 5A7WA 3AVRA 5FY9A 4EZHA 5A3NA 4UF0B 4D6QA 4CUGA 2OS2A 4AI9A 5FPUA 3NJYA 4LXLA 2WWJA 3PTRB 3KV6A 4NUBA 3U4SA 4CCKA 5F3EA 3AL5A 5F5CA 5ISLA 5LWBA 3RVHA 3PUAA 4Y33A 5FZ7A 5FWEA 4EZ4A 5FP9A 5A3WA 4GJZA 2YU2A 3UYJA 5IW0A 3N9MA 5FYVA 5FYUA 2PXJA 5FZKA 4QWNA 2XXZA 3OPTA 5FZFA 4QXBA 3PU3A 5IVCA 2OQ6A 3AVSA 5FY1A 4LIUA 4HONA 5E6HA 5F32A 5IVBA 5F2SA 5FZ3A 4C8DA 2Q8CA 3K3OA 4GD4A 3AL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FXW A;  4GJY A;  3N9Q A;  4IGO A;  5FZE A;  2WWU A;  5FZD A;  2Q8E A;  2YPD A;  5FY8 A;  4ASK A;  3KV5 A;  4QX7 A;  4HOO A;  3KVB A;  4IGP A;  4GAZ A;  4QU1 A;  5A7P A;  5FP3 A;  4CCN A;  5F37 A;  5KR7 A;  3U78 A;  5FJH A;  5A1L A;  4V2W A;  5IVV A;  2OQ7 A;  4D6R A;  5A7N A;  4URA A;  3KVA A;  5FYS A;  5FY7 A;  5FZA A;  3OPW A;  3ZPO A;  5FZ4 A;  4Y3O A;  2GP3 A;  5FZC A;  5FY0 A;  5FBJ A;  5A7O A;  4LIV A;  5FZO A;  3K2O A;  5A3T A;  5LW9 A;  2P5B A;  5FP7 A;  2W2I A;  4EYU A;  4BIS A;  5A7S A;  5FYM A;  2YBP A;  3K3N A;  5FYT A;  5FPA A;  4Y4R A;  2XDV A;  3KV9 A;  5FZM A;  5FZI A;  5F3I A;  5LY2 A;  5CEH A;  2XUE A;  2YBK A;  5IVF A;  5FXX A;  2GP5 A;  5FYC A;  1VRB A;  5FZO B;  4LIT A;  5F3C A;  5FZ6 A;  5FZ1 A;  5IWF A;  4QX8 A;  4CCM A;  3DXU A;  4CCL A;  5FP8 A;  4BXF A;  5K4L A;  5FUN A;  5FUP A;  5FXZ A;  2Q8D A;  5FJK A;  5LY1 A;  5F5A A;  5FYB A;  4DIQ A;  4DO0 A;  4XDP A;  5IVE A;  2OT7 A;  5FXV A;  5FY5 A;  3LDB A;  5F3G A;  3PUS A;  4E4H A;  2YU1 A;  5F5I A;  5FY4 A;  4CCO A;  4D6S A;  3PDQ A;  5A3P A;  5A7W B;  4IGQ A;  5ANQ A;  5FP4 A;  5FYY A;  5FV3 A;  5FZ9 A;  4UF0 A;  5FZG A;  5FZ0 A;  4XDO A;  5F2W A;  2VD7 A;  5FYZ A;  3N9P A;  4CSW A;  4V2V A;  3LD8 A;  3PU8 A;  5F39 A;  5FZL A;  5FZ8 A;  5A7Q A;  3PUQ A;  4AAP A;  4TN7 A;  5A80 A;  3DXT A;  5FWJ A;  5FZB A;  4BU2 A;  2OX0 A;  5FYH A;  5FPV A;  5IVY A;  3N9O A;  3ZLI A;  3N9N A;  5FPL A;  3KV4 A;  4QXC A;  5FPB A;  4CCJ A;  5IVJ A;  5FYI A;  4QXH A;  2XML A;  3PUR A;  2YBS A;  5A1F A;  5FZH A;  3N9L A;  5A7W A;  3AVR A;  5FY9 A;  4EZH A;  5A3N A;  4UF0 B;  4D6Q A;  4CUG A;  2OS2 A;  4AI9 A;  5FPU A;  3NJY A;  4LXL A;  2WWJ A;  3PTR B;  3KV6 A;  4NUB A;  3U4S A;  4CCK A;  5F3E A;  3AL5 A;  5F5C A;  5ISL A;  5LWB A;  3RVH A;  3PUA A;  4Y33 A;  5FZ7 A;  5FWE A;  4EZ4 A;  5FP9 A;  5A3W A;  4GJZ A;  2YU2 A;  3UYJ A;  5IW0 A;  3N9M A;  5FYV A;  5FYU A;  2PXJ A;  5FZK A;  4QWN A;  2XXZ A;  3OPT A;  5FZF A;  4QXB A;  3PU3 A;  5IVC A;  2OQ6 A;  3AVS A;  5FY1 A;  4LIU A;  4HON A;  5E6H A;  5F32 A;  5IVB A;  5F2S A;  5FZ3 A;  4C8D A;  2Q8C A;  3K3O A;  4GD4 A;  3AL6 A; 
#chains in the Genus database with same CATH topology
 1BKZ A;  3N9Q A;  4UW3 A;  4CSW A;  2PA7 A;  2PQS A;  4Y22 A;  2A6W A;  1I5P A;  1LU2 A;  3KV5 A;  1JW6 A;  3P3N A;  4NRM A;  4ONU A;  1X8E A;  4DB5 A;  5JIU A;  1W6N B;  4GAZ A;  4AI1 A;  1Q56 A;  1W03 A;  3UJQ A;  5JR2 A;  4ZXE A;  2JDK A;  5IVV A;  3H9A A;  3NNL A;  1TNR A;  1O8P A;  1CAX B;  2JE7 A;  3OYW B;  5CIR A;  5K8S A;  2VU9 A;  1D0H A;  3JCI A;  3OPW A;  3KHC A;  2VW2 A;  3FUO A;  1LHN A;  2GP3 A;  2D5H A;  2X5I A;  1PNF A;  2OUH A;  4CEW B;  4DXR A;  4LO7 A;  5FZO A;  1K5M C;  1VMJ A;  2CU5 A;  5C8W A;  4HT1 T;  5LW9 A;  1JOP A;  1QQP 1;  2VAU A;  4HZF A;  5JSR A;  1C1F A;  2D44 A;  2D40 A;  3IPV A;  3MIG A;  3OBZ A;  4W50 A;  5EJZ B;  1W6P B;  1WBF A;  1YHF A;  3X29 B;  4Q4W 3;  4YW6 A;  3SMH A;  5H9Q A;  3DKQ A;  3ETQ A;  1JU3 A;  1RUF 3;  4YG3 A;  3TEW A;  4CDX C;  3PVN A;  3IDA A;  1LAJ A;  3E5X A;  4LOR A;  4E8D A;  2DYC A;  2QVS B;  3SH4 A;  3UT0 A;  3IM0 A;  1J1T A;  4ZS3 A;  4B8E A;  5KXB A;  5F5A A;  3VD4 A;  3O1O A;  1QJF A;  1Y4W A;  5SV8 A;  4YGB A;  3PUS A;  3MLL A;  3HT1 A;  4XEZ A;  5IT6 A;  1SCS A;  3ZXD A;  4BQY A;  1W6M B;  4FPC A;  1UZY A;  5A3P A;  4K1Z A;  3MW3 A;  2GU9 A;  2Z5W A;  4MYE A;  3SXW A;  5FZG A;  5HCA A;  4KG0 A;  3O1M A;  4CEY A;  3UGF A;  4E4Z A;  3OGG A;  4OFG A;  2WFF 1;  4UI9 L;  1SAC A;  3L2Y A;  4XF3 A;  1X7N A;  1S2B A;  2RR1 2;  1WBL A;  1N1Y A;  2PQQ A;  3SH3 A;  2Z4F A;  3IIA A;  3ZXK A;  4BK4 A;  1UYX A;  1IGO A;  4LA3 A;  1WGP A;  3GCW A;  4YG0 A;  2WAA A;  5E8A A;  4BM8 A;  1TEI A;  1N1S A;  5FPB A;  1SBE A;  1VBA 1;  3JB8 A;  2ZTN A;  3M4F A;  4KWL A;  4YG6 A;  1UIJ A;  4NWW A;  1G86 A;  4F83 A;  2KR2 A;  1YC6 1;  2ARA A;  4GWN A;  1W9W A;  2GAL A;  1S55 A;  4MGY E;  1GZW A;  4ORF A;  4AHW A;  2DU0 A;  3WG2 A;  4LEJ A;  3S0M A;  2NYY A;  3FMG A;  1LUL A;  3BPS A;  4LTA A;  3BTZ A;  4OVE A;  2RS1 3;  2P37 A;  2X10 A;  4LBQ B;  4J1X A;  4AK3 A;  3AXE A;  3VN4 A;  3BTY A;  1JZ2 A;  3B69 A;  1C5I A;  1US2 A;  2Y0I A;  1FV3 A;  4EZ4 A;  4YZ2 A;  4W6X A;  4WM7 B;  4KH9 A;  3T4V A;  1N3Q A;  1W8N A;  2CWS A;  2PHD A;  2YFU A;  5FYV A;  1G9D A;  2RDS A;  2V73 A;  2FDJ A;  1COV 3;  1Q8Q A;  3NJV A;  2Y8K A;  4Q0V A;  5KHG A;  1KJR A;  3V0A A;  1BMV 1;  5DG2 A;  1S0G A;  4DUV A;  4A44 A;  3AVS A;  4ES8 A;  1PVC 3;  4Q1R A;  1GP4 A;  3G6J B;  2W46 A;  3J9S A;  5EFU A;  2YV8 A;  3WLU A;  1I5Z A;  1GQH A;  1R09 3;  3J8F 2;  2VZQ A;  3AP6 A;  2AH2 A;  4LE3 A;  3ACL A;  2MHF A;  4P9I A;  5GLV A;  3SCH A;  4AI0 A;  1UPI A;  3S57 A;  1OLM A;  1TME 3;  3QLQ A;  5JMC A;  4DY3 A;  2DFB A;  2JDM A;  3FBM A;  2XPJ A;  2XUM A;  2RS1 2;  1XNC A;  4QM9 A;  4FTS A;  4J25 A;  1BMV 2;  1OOP A;  2P4E A;  2RS5 1;  4HVO A;  4ZPI A;  1RUG 3;  1VE0 A;  2J1E A;  4XJA A;  2GC2 A;  5FQ0 B;  3QH6 A;  3VDD C;  1SBD A;  2XL7 A;  1PMI A;  4AEM A;  3VZM A;  2IWG B;  1VP6 A;  3ZXG A;  2WNU A;  1X8M A;  2W91 A;  3NST A;  5IAX A;  3NNF A;  3ZPO A;  4MGT A;  4ERO A;  4IEO A;  2LRP A;  4YLZ A;  4FOQ A;  1IQD C;  1GP5 A;  1RUH 2;  1H6Y A;  1PGW 2;  3I2K A;  1J3R A;  4Q29 A;  4AVB A;  2W0X A;  5A3T A;  4QPI B;  2CSG A;  2E51 A;  2WYS A;  4RYD A;  2V5Y A;  1ST8 A;  4EYU A;  3N7K A;  3IDC B;  5FYT A;  2DVB A;  2WSU A;  2XLA A;  3H3U A;  4YYO A;  2ADE A;  4NHY A;  2VQA A;  1RUG 1;  3ZN5 A;  3RZZ A;  3GZU C;  2W5F A;  5F9T A;  1QJY 2;  4QPG A;  5LA2 A;  1W2O A;  4D7T A;  5I93 A;  3N35 A;  1JI6 A;  3BTA A;  3POW A;  1B35 B;  1QJX 1;  3GYD A;  2YZ4 A;  1UO9 A;  2C26 A;  4N9H A;  4MAD A;  3ZIX A;  1JZ8 A;  1I1E A;  1AR6 3;  4NHM A;  2VMF A;  3LE0 A;  2JG9 C;  4JGZ A;  3M8L A;  5HV0 A;  3ECQ A;  1AR9 1;  2VNV A;  3WNM A;  1UMI A;  3WCS A;  5GKA C;  1RJ7 A;  2R7E B;  2YRO A;  5IVE A;  2OT7 A;  3ZYP A;  5LEK A;  1QOT A;  4W4Z A;  2E63 A;  3PHM A;  1DBN A;  5CKM A;  2X29 A;  4QQ2 A;  3C8X A;  3ZOI A;  2VVE A;  4QMA A;  4YM0 A;  5FZ9 A;  3S7E A;  1GMM A;  1Y43 B;  2HWC 2;  3BB6 A;  3U75 A;  4XVH A;  5HCF A;  5GLT A;  5CKN A;  2A3X A;  4KNC A;  4RHV 1;  2Q0A A;  1ND3 C;  4AVC A;  4CA9 A;  4BQ2 A;  4G4F A;  4CDQ B;  2HEY F;  4ISR A;  5FZL A;  4IQP A;  3H8U A;  3APB A;  4UFM A;  3P6B A;  4UOJ A;  2VZU A;  4MO3 M;  2CDO A;  4PI0 A;  1EV1 2;  5FWJ A;  2WII B;  3AKS A;  2W39 A;  1D4M 2;  3N9O A;  2G9G A;  1W6O A;  1F5J A;  1PZ9 A;  3GJB A;  3FFZ A;  4YFW A;  4ZON A;  3KLS A;  1OQD A;  5DAB A;  4OMD A;  2YFZ A;  5CG8 A;  2WO2 A;  1NY7 2;  5FLI A;  3I3E A;  2EAL A;  3E6D A;  3LFI A;  3NJY A;  1PO1 2;  3EMR A;  4BME A;  4HK8 A;  1TVG A;  4I2O A;  2HWB 3;  1YQ8 A;  2P3K A;  5H9P A;  3SIS A;  2A3W A;  4QQL A;  2ET1 A;  3THD A;  4Y33 A;  2I45 A;  5JOW A;  2WLQ A;  1WA4 A;  3ZYF A;  3VBF C;  1D2Q A;  4UFK A;  3I4I A;  3Q8F A;  5CAD A;  2TEP A;  1VBC 3;  4A6S A;  1H1M A;  2WO7 A;  2Y6G A;  4M4R A;  3PLQ A;  3WDT A;  1ZNP A;  4N43 C;  4QXB A;  4S2F A;  2VR4 A;  3ST7 A;  4HON A;  1BBT 3;  2BVB A;  2J42 A;  3JXS A;  4LMF A;  3FLT A;  5DUX A;  4C8D A;  5KXD A;  1W2U A;  2VUC A;  3Q9O A;  1CGP A;  3A0K A;  4A3X A;  4PI2 A;  4COW A;  2CV6 A;  3MV0 1;  1OHF A;  5BNN C;  3OTF A;  3ACG A;  4TWT A;  4Q4X 3;  4N8M A;  3V0B A;  1AHS A;  1EY2 A;  2D43 A;  2GND A;  2LS6 A;  3A0N A;  1YFY A;  3LWC A;  5IK4 A;  1DZT A;  1VBB 3;  1LOA A;  2OUJ A;  1VBD 1;  2BPA 2;  3PJQ A;  4FFI A;  4N9I A;  1NLS A;  1W90 A;  4KBB A;  1YFU A;  5T5O A;  4EQV A;  1ULD A;  3LIG A;  4I0W B;  1XE0 A;  3III A;  5C3P A;  5FO9 B;  2WJS A;  1Y9Q A;  3HBZ A;  3M3E A;  4RD7 A;  2QCS B;  4JTO A;  1GNH A;  1PIV 2;  3M70 A;  4PQQ A;  5K9Y A;  1S2E A;  4XHX A;  3FZ3 A;  1JOD A;  5A3U A;  3ZYR A;  2VJX A;  1QJU 3;  4IEX A;  1H4H A;  4UFJ A;  1AYN 2;  3VKL A;  2YHJ A;  2LUW A;  3ACH A;  3KMH A;  3J7M A;  2JX9 A;  5EYY A;  1RMU 3;  1HRI 1;  1CR7 A;  2A75 A;  5FZI A;  3WNO A;  1T2X A;  3MUY 1;  3RGB A;  4WVW A;  3D82 A;  3A4U A;  3HN1 A;  1ZZ8 A;  1TE1 B;  3ZMO A;  1DGW A;  1POQ A;  2HKX A;  3ZR6 A;  1VBA 3;  3AMM A;  3IAQ A;  2EXK A;  4L11 A;  4XQD A;  1W28 A;  1JYV A;  5K0U B;  4GWM A;  2Y64 A;  2W08 A;  4A4A A;  2HWD 1;  3OBA A;  5ACA 3;  1AR9 3;  5FYB A;  4LHN A;  3AB0 A;  3LDR A;  1TQ5 A;  4NWV A;  1AR6 1;  1O4Z A;  4L97 A;  2Q8O A;  5F5I A;  2VUL A;  3PNA A;  2V4A A;  4QGM A;  4CCO A;  2PFW A;  2WWS A;  3PDQ A;  3ZMN A;  1O3R A;  2VZP A;  3MHZ A;  2WO3 A;  4WVM A;  5FP4 A;  2W9X A;  2B9V A;  3HNY M;  5C6C A;  5CFD A;  1AL2 3;  2A73 B;  1VJ2 A;  1LGN A;  2B45 X;  1YI9 A;  2R04 3;  3GDB A;  5FUI A;  1RYY A;  2J1V A;  1US3 A;  5JOY A;  3AMP A;  4WM7 C;  1YIF A;  1DCS A;  4PIY A;  2BVV A;  3LD8 A;  3NV1 A;  3W20 A;  1DQ4 A;  1GOG A;  5IUQ A;  2R32 A;  1XB9 A;  3KS7 A;  5T52 A;  4CCJ A;  3AMN A;  3PME A;  2G9Z A;  3T30 A;  3RJ2 X;  2IUW A;  3VBO C;  4XCA A;  2XML A;  4OQ8 A;  3CU7 A;  4X8N A;  3UJO A;  4ZXK A;  3WF2 A;  3TEY A;  3KCC A;  2AEZ A;  3OBR A;  3CO2 A;  1Z7S 2;  2WNE A;  3H1W A;  4JZR A;  4LXL A;  5A6X A;  2QDN A;  5C5U A;  4NUB A;  1U5Z A;  4O9G A;  1W0N A;  2R0F A;  1GNZ A;  2R06 2;  5ISL A;  4LHK A;  3NQH A;  1ULP A;  5IFP A;  1QQP 3;  1X36 A;  3LGR A;  3LSE A;  4H7M A;  2Y33 A;  3B01 A;  5JXJ A;  2VVD A;  4FCA A;  5A33 A;  4OYU A;  4Y22 B;  5JSP A;  4IV1 C;  4PHZ A;  3PU3 A;  4O65 A;  4BJ0 A;  1JOB A;  5J37 A;  2D6N A;  5E6H A;  2FMY A;  2QQW A;  2RR1 3;  4MGQ A;  4WZC A;  1AR8 3;  1SLB A;  5L7O B;  2E7Q A;  4NID A;  2XJR A;  4BQ1 A;  4NIH A;  5EV7 A;  1QGL A;  2PHT A;  2RS1 1;  2VZT A;  3HOB A;  4W6Y A;  3VBU A;  1MS5 A;  1B35 C;  1JTZ X;  1ASJ 1;  2YC4 A;  3KVB A;  4Q27 A;  2AEN A;  4YFZ A;  2VZS A;  1YQ6 A;  4OMC A;  1ZRC A;  1LHW A;  1OXC A;  3FJS A;  3J8F 1;  4XZU G;  2OQ7 A;  1GV9 A;  4XMI A;  3MFA A;  5FZA A;  4C1W A;  5D2A A;  4R9D A;  3I59 A;  1R08 1;  5FZ4 A;  4Y3O A;  4M3C A;  5GLZ A;  5K0U A;  5F7U A;  2FHR A;  4ITC A;  3VKO A;  4DRV A;  1RUC 3;  1DLL A;  2RR1 1;  2Y38 A;  1QH7 A;  4BCU A;  2CAV A;  2XON A;  3USS A;  4CXY A;  1QWR A;  3ORJ A;  3HIF A;  5FYM A;  4F7Z A;  1DQ1 A;  1C5H A;  2BFU S;  3ZXE A;  4JGY A;  3O7O A;  5DAP A;  1HB1 A;  3ZYH A;  2FDI A;  1RC6 A;  2Y60 A;  5GLW A;  3OY8 B;  1MR5 A;  1RUE 3;  1JYW A;  4NPM A;  3OGR A;  2P1B A;  1RUH 1;  1YQ5 A;  2QFE A;  3AZV A;  3MGU A;  4JV4 A;  5A1A A;  4GWI A;  1RL3 A;  3K4Z A;  1JZ7 A;  1JUI A;  2WNU B;  1LTE A;  4F3J A;  4CCE A;  5T3N A;  4CEW C;  4XZP A;  1WWY A;  3EO6 A;  4NIG A;  2VTX A;  5FXZ A;  3FUQ A;  3ZFF A;  5CIS A;  4TSV A;  3HN3 A;  2O8O A;  1STM A;  1ZBA 2;  4E8C A;  4Y1Y A;  5C5T A;  4UWD A;  4P9Y A;  1A8M A;  1AYN 3;  3IB3 A;  5A7W B;  4D3W A;  4Q4V 3;  3T2P A;  1AYM 1;  4NVP A;  1DGW X;  3HR9 A;  3I3B A;  4CDX B;  1V6K A;  1SG3 A;  1V6J A;  3VBF B;  3KT1 A;  3LZZ A;  2W92 A;  1BEV 2;  3Q8A A;  1BHG A;  1AX1 A;  4N53 A;  2JKB A;  4R9C A;  4HVQ A;  1G9C A;  3T1L A;  2R04 1;  2ZGR A;  4N43 B;  1BLZ A;  2ADD A;  1F8V A;  4UFL A;  5H9S A;  4FXK B;  3T2T A;  3NMB A;  1A78 A;  3OUJ A;  4FAH A;  5CA6 A;  3KZ4 C;  4UYB A;  1HLC A;  1LOF C;  1WLW A;  2ZHM A;  4YW4 A;  4JX0 A;  4KQ7 A;  4D7S A;  2HWF 2;  3VB9 A;  2DBN A;  1QMJ A;  5FFO C;  3GF6 A;  2D6M A;  3TN9 2;  3ALQ A;  1L3J A;  4LKD A;  5FZH A;  1W8W A;  3NWK A;  3H7Y A;  2DUQ A;  4WVZ A;  2HWC 3;  1PO2 2;  2BER A;  3WW4 A;  1MAC A;  2YGL A;  1O5L A;  1VMF A;  2R04 2;  1W0P A;  1EV1 3;  3KCX A;  4CRQ A;  1W8T A;  3AL5 A;  3RVH A;  2WYF A;  1H0B A;  4MOA A;  4H7L A;  4IV1 A;  5BNO C;  2B4K A;  2D3S A;  4CP2 A;  3O1S A;  2H0B A;  1YLL A;  3A7Q A;  2PMW B;  1OA2 A;  1PX3 A;  2CGO A;  2WZR 1;  2ZMN A;  4Q4V 2;  4FOW A;  2QE3 A;  2XXZ A;  3P3P A;  1VBD 2;  1HXS 1;  3I59 B;  4IEY A;  4MXV A;  1FMD 3;  2ZOE B;  1RUI 1;  5FDB A;  4CCC A;  3RPQ A;  1H30 A;  5FK8 A;  3FHI B;  3I2J A;  1Z7S 3;  1ZA4 A;  1HV1 A;  4XUN A;  2J1A A;  1FPN 3;  3I3Q A;  5T54 A;  4XF9 A;  4QKN A;  5KHH A;  1NT0 A;  3T2Q A;  4BYY A;  4BQ3 A;  2WWU A;  3ZPY A;  3JUU A;  2WAB A;  4M3C E;  3MPB A;  3MPP G;  4G9S B;  3MDP A;  1ZM1 A;  4XAE A;  4Q4W 2;  1QJE A;  3WW3 A;  2V72 A;  4UT5 A;  1VAV A;  5EIY B;  5FP3 A;  1VBB 1;  4E4D X;  4WVV A;  1RIR A;  1UL9 A;  2CY6 A;  2ZML A;  3FX3 A;  4HAN A;  4LR4 A;  4EN6 B;  1UAI A;  5CB7 A;  4UFI A;  3ZSE A;  1YFW A;  4JKK A;  2PAK A;  2G19 A;  4NAM A;  2ID4 A;  1GQP A;  3DL3 A;  3EXU A;  4XBQ A;  5DZE A;  2FDF A;  4XFA A;  4XJ9 A;  2IXL A;  1PGL 1;  3AXD A;  3MLK A;  3MW4 A;  1S0F A;  4NO4 A;  4Y1X A;  5GZE A;  4BH9 A;  1KS5 A;  1J3Q A;  2Q1F A;  1HJG A;  3ZYJ B;  2VH9 A;  4GMP 3;  3WUC A;  4L99 A;  4FFF A;  1NCQ B;  1YNA A;  2WZE A;  4MET A;  4Y24 A;  1LB2 A;  2FDG A;  1QKQ A;  1DYP A;  5DZF A;  1WA6 X;  3VDD B;  2GH2 A;  4HSJ A;  2HYX A;  4LIT A;  4XC9 A;  5IWF A;  4I01 A;  4QDS A;  1W2N A;  3J7N A;  3ZSM A;  1JZ5 A;  3RZK A;  1JU4 A;  4UAP A;  2Y34 A;  1R08 3;  3KB5 A;  3O1R A;  4DY5 A;  4YNI A;  3WG3 A;  1RUC 2;  3GM8 A;  4QPI C;  1HRV 1;  1PX4 A;  4E27 A;  4XDP A;  2HWF 1;  2D5F A;  3AP7 A;  1MPX A;  2YU1 A;  1QIQ A;  3FLR A;  1W0O A;  4LPL A;  1LHU A;  2XJQ A;  3LA7 A;  3F95 A;  5ANQ A;  4QT6 A;  1CQ9 A;  5A70 A;  3DKW A;  1RUE 2;  3ZM8 A;  1RUF 2;  1C4R A;  4HFS A;  2XVG A;  1QJY 3;  3POS A;  3IT8 A;  5F2W A;  5CFC C;  3WQ1 A;  4E2Q A;  2V4V A;  2JG9 B;  3AKQ A;  2O14 A;  3R4D B;  2WFP A;  3GJA A;  5A80 A;  5A3L A;  4OUE A;  3VZN A;  2XJS A;  5F8P A;  3O0V A;  1F15 A;  4HG6 B;  1JMU B;  3T4H B;  1ASJ 3;  1LOE A;  4XFF A;  3VBR C;  1QJY 1;  4IE6 A;  2XR4 A;  4U36 A;  2ZGM A;  1X9T A;  4XXA A;  5HI0 A;  3GAL A;  2YBS A;  3USU A;  2GNM A;  2O8Q A;  1UN1 A;  4P9J A;  5JXG A;  4PF1 A;  1Q8S A;  1XU2 A;  4MUV A;  2JB8 A;  1L7L A;  2EXI A;  3I2D A;  1RHI 3;  2UU8 A;  3PUH A;  2NMO A;  1KDM A;  5ACA 2;  4D94 A;  1K45 A;  2DUP A;  4K40 A;  4P9W A;  5FZ7 A;  3VLB B;  2CGP A;  2R07 2;  1ZYB A;  2DTW A;  1NE6 A;  3B7M A;  3WP4 A;  4WM8 A;  2BWA A;  3ITQ A;  2IFW A;  4CZS A;  4XYX A;  4OHZ A;  3TNQ A;  5G04 L;  3JBG 1;  5FZF A;  3ZDS A;  1FT9 A;  1URX A;  1W8F A;  3H50 A;  1PMJ X;  3PVE A;  2SBA A;  4HET A;  2YGM A;  1CX1 A;  2GDF A;  2HWB 2;  4ATE A;  3DPR C;  4BOW A;  5IVB A;  2ZHL A;  1IS3 A;  5I0R A;  3ZFE A;  4EN7 B;  1GFF 2;  1OOP C;  2ARC A;  4LLF A;  4WM7 A;  2P6C A;  4MH0 E;  1GQG A;  2Q1M A;  1Y3T A;  2A1X A;  1O4Y A;  1V6N A;  4I02 A;  2ZMK A;  2WFF 2;  5FZE A;  4DUW A;  2ZKN A;  3WV6 A;  1Q8P A;  1UCX A;  1WMX A;  4XFC A;  4EN0 A;  1ASJ 2;  5CZK A;  1N1V A;  3WNK A;  2YC0 A;  4QU1 A;  4YRD A;  2ZHK A;  1ND2 B;  5EZW A;  2R0H A;  5LK5 A;  4AED A;  2XKP A;  5GM0 A;  2UY8 A;  2AZ5 A;  5L9R A;  1T6B X;  1VAK A;  4KWJ A;  3OGV A;  1NQJ A;  1ZZB A;  3VKM A;  3WQB A;  4X8P A;  3EYP A;  5LAT A;  1JYX A;  2CNA A;  4FSJ A;  5FY0 A;  1SLA A;  4Z07 A;  2PEL A;  2J1T A;  2VPV A;  2VUD A;  4QX3 A;  4DFS A;  4B4P A;  2JG8 B;  3FC0 A;  1NCR B;  5FQ0 A;  2EVX A;  1O7F A;  2I07 B;  4Q5O A;  1PO2 1;  1RMU 1;  1S0E A;  4IE0 A;  4OLL A;  1N47 A;  5LRR A;  2ZHN A;  3VBU B;  1OQ1 A;  5FZM A;  5FPX A;  3RZL A;  3RZM A;  5AFB A;  3GZE A;  1WD3 A;  4Q1P A;  3BU0 A;  3HWJ A;  4PBO A;  1U5X A;  2WS9 1;  4R52 A;  5EJ3 A;  2ZGN A;  3WZ1 A;  3KF3 A;  1HB2 A;  5L9B A;  5GJ6 A;  1OQE A;  1VRB A;  4B3N A;  4C0H A;  5LBF A;  1DGR A;  2Y6H A;  1SHW B;  2NZ9 A;  1YRZ A;  1OF3 A;  2XJV A;  2DVA A;  4BHP A;  4FPG A;  4NII A;  3ACI A;  1C57 A;  3IKW A;  4RFR B;  5FUN A;  2JEM A;  5IK5 A;  1UXX X;  4WZF A;  2B42 B;  2VUJ A;  2VOT A;  3ZYI B;  2VNR A;  3VZJ A;  1NQD A;  3DGT A;  3SNM A;  3LPG A;  4AEJ A;  3KGL A;  4IGQ A;  5FYY A;  5IK7 A;  3RJR A;  1W2T A;  1V0A A;  1VRH 3;  4FPL A;  4AAX A;  2IZW A;  2Y6L A;  3LF7 A;  4NHX A;  4LLO A;  5IK8 A;  4URT A;  2XVL A;  5BNO B;  3NO8 A;  2LW8 A;  2FCV A;  3KF5 A;  1UY3 A;  4QDR A;  2BYV E;  2ZA9 A;  4XMA A;  1JS9 A;  4B1M A;  4QQH A;  5K0U C;  3M1H A;  1XNT A;  3K4D A;  4GAL A;  2OXB A;  2DWR A;  4BU2 A;  2WAO A;  2VMH A;  2JIJ A;  4YAR A;  4JQT A;  2JDP A;  3JBG 2;  2EF6 A;  4JKM A;  5FTT C;  4RA0 A;  4AGG A;  2B46 X;  2PHX A;  5A1F A;  2EXH A;  3N9L A;  1CES A;  3PIG A;  4K21 A;  4QAW A;  4XJU A;  3WG1 A;  4YM3 A;  1MQT A;  4OHV A;  1RUE 1;  5JDB A;  5A6Z A;  1S1A A;  3ILF A;  2E53 A;  3ROU A;  3PJY A;  2VNG A;  5L36 A;  2Y6K A;  4FPJ A;  5F5C A;  2W47 A;  1LEC A;  3AZW A;  1D0G A;  2D93 A;  3PMS A;  1WW6 A;  1J1L A;  4YZ3 A;  1Z78 A;  3AK0 A;  1ND2 A;  2W1S A;  5A3W A;  2YU2 A;  3OUI A;  1GP6 A;  2PAM A;  3MIH A;  4FVV A;  2CDP A;  1VAL A;  3LAG A;  4P5Y A;  5C70 A;  3VBO B;  1ENR A;  1XJA A;  4C1X A;  4KGQ A;  3LOI A;  4KL1 A;  3JD7 3;  2JJ6 A;  2YPJ A;  5EHD A;  3DF0 A;  2QBX A;  3KCY A;  4KU8 A;  4CPB A;  1NCQ C;  5AFE A;  3BIE A;  1OVP A;  3ZSL A;  5A3O A;  4OUM A;  4Z92 B;  1X9P A;  1XNK A;  5KHK A;  1C8N A;  4BQ5 A;  1W9S A;  1SFY A;  2G1M A;  1OPM A;  2RV9 A;  1YXW A;  4NE9 A;  3VHO A;  2K2S A;  1H8T C;  3AP4 A;  4IEV A;  2BW8 A;  1R64 A;  2AYH A;  4XTM A;  4R8H A;  4AQS A;  1OF4 A;  3SCG A;  1XYP A;  2ES3 A;  2QDR A;  1AYM 2;  1KGY A;  1QDC A;  4D6R A;  2UWA A;  5JOX A;  4KGG A;  1H8V A;  4BPZ A;  3IMN A;  1FPN 2;  1QU0 A;  4LOT A;  1S0D A;  4CE8 A;  5FZC A;  5DUV A;  4BZ4 A;  1QJX 3;  3K2O A;  1UD1 A;  1A3K A;  2V09 A;  4AI2 A;  4HN1 A;  3H8R A;  4BA6 A;  5KXE A;  4NHL A;  1D4V B;  3JU9 A;  4LQR A;  3SLI A;  5CFC B;  5FMO S;  1AF9 A;  5DZG A;  4PQ9 A;  4AXO A;  3DYM A;  2R1D A;  4RL7 A;  5CEH A;  5GZF A;  3AFK A;  4LKF A;  4LBM A;  1OA3 A;  5FXX A;  4AQ6 A;  5JPN B;  1MZ5 A;  1UYY A;  4ZU4 A;  3EBR A;  4XOG A;  2AGS A;  2LAL A;  5ABJ A;  1RUJ 3;  4C90 A;  2GN3 A;  1DLC A;  3FLP A;  4CEY B;  3UET A;  1O6U A;  2A6X A;  2BZD A;  4AVA A;  2FCU A;  4CDU C;  1UKG A;  3AJY A;  2VC9 A;  2WQ4 A;  3WQ7 A;  3WEZ A;  4A3Z A;  5I0S A;  1GOH A;  5A6Q A;  4LJH A;  4LBO A;  4CU7 A;  3BPZ A;  1VBE 2;  1AVB A;  1I9R A;  4UF0 A;  3VGI A;  1G9A A;  3OOX A;  3T0A A;  5JXH A;  2EIE A;  3EB7 A;  2IVJ A;  4QDQ A;  3CJI B;  3BI3 A;  3TEX A;  4AE2 A;  2WNU C;  2EID A;  2UY9 A;  4TLF A;  3WP5 A;  4AQ2 A;  1LES A;  1Q3E A;  4H14 A;  1PVC 1;  3N7L A;  2BGO A;  3PU8 A;  1ZZ7 A;  4OI4 A;  4YVS C;  3RFR A;  4FQ4 A;  1FI2 A;  1GZC A;  3RWK X;  1J3P A;  2PLV 2;  3TB0 A;  3DPR B;  4GB3 3;  2D6L X;  2Z2S B;  4QXC A;  5FPL A;  1NYW A;  5JCT A;  1ZVF A;  3O14 A;  1WCQ A;  2BQP A;  2GC0 A;  1PHM A;  3GGL A;  4XIK A;  2ZX2 A;  1C8M 2;  3P1I A;  1CPM A;  3NJX A;  1YIP A;  1I6X A;  4AFM A;  3VBS B;  1W04 A;  3LKJ A;  2VNO A;  3C7E A;  4CUA A;  3UKV A;  5A3N A;  1AR8 2;  1PM7 A;  2OS2 A;  4O7X A;  2WZ8 A;  1UY0 A;  4YSF A;  3KV6 A;  4FO9 A;  1UYP A;  2RDQ A;  5DAQ A;  4Y1V A;  3W5N A;  3WNN A;  2X8K A;  4C0B A;  4AFA A;  4I0A A;  5EJ1 B;  2NQY A;  3O0W A;  4BIF A;  2BOJ A;  5F5Q A;  5JAX A;  4MLO A;  4CDQ A;  2ZGU A;  4W8J A;  2RJK A;  1WKY A;  1F31 A;  2PTM A;  5CG9 A;  1RUI 2;  3GCX A;  3V56 A;  2P3Y A;  1BZW A;  2GSY A;  1OUX A;  2ZEW A;  2ZZQ A;  2ZGK A;  3CHX A;  2RMU 3;  3KQ4 B;  4XFG A;  1MVQ A;  4AEK A;  1O3T A;  4H55 A;  4N7U A;  4IES A;  1NCR C;  4XUR A;  1ZZ9 A;  1J59 A;  3CNA A;  3PUI A;  2DVF A;  1AXZ A;  1NUK A;  2LRO A;  3G7D A;  4OCT A;  5F32 A;  5C3O A;  1ZBE 1;  1W39 A;  2A70 A;  2BDR A;  1WZX A;  2ETE A;  3BOW A;  5FIX A;  3TYJ A;  3VBU C;  3W9A A;  5JXI A;  2FD8 A;  1H2K A;  1UW8 A;  2CAU A;  1SPP A;  1ULO A;  2RVA A;  1KXG A;  4LBK A;  2VG9 A;  2QUO A;  3CZJ A;  3LEK A;  3RI8 A;  2WQ8 A;  1JH5 A;  2VQ0 A;  3TN9 1;  4CCN A;  3JZV A;  4MGS A;  4QKD A;  2AUY A;  1MEC 2;  1UOF A;  1DQ0 A;  2VL4 A;  2ZAA A;  1VBD 3;  4JDM A;  5D1I A;  1DFQ A;  1X33 A;  2IXJ A;  4A45 A;  3FFQ A;  4JGY C;  2KA3 A;  4QHO A;  4Y5S A;  2W2I A;  2HYK A;  2ZJC A;  4BIS A;  4KG8 A;  3U14 A;  3WNP A;  3NAP B;  4BQW A;  2XVK A;  3B9C A;  4QM8 A;  1DQ2 A;  1ZZ6 A;  1UY2 A;  1MS0 A;  1GAN A;  2P3J A;  3RYK A;  1YQ2 A;  1PGL 2;  2VE1 A;  2RMU 2;  2KD7 A;  3FL7 A;  4QB2 A;  3NVC A;  4HVR A;  4YZ1 A;  1SQ4 A;  1CVN A;  3CJI A;  2GP5 A;  5FYC A;  5I0D A;  3VUO A;  1APN A;  1MS4 A;  5FZO B;  2DUR A;  2VZ1 A;  4FT8 A;  5A6Y A;  1A6C A;  1R1A 3;  5JPM B;  2QQJ A;  4RS5 C;  4XUP A;  4AFD A;  4R4Z A;  1G9B A;  1IHM A;  1SLC A;  1W6P A;  2BUK A;  1GSL A;  3LSD A;  1TMF 1;  2D3P A;  4DO0 A;  1H1I A;  4DXZ A;  4FBF A;  3H7J A;  4JDO A;  3MV1 1;  1CAV B;  2ZGQ A;  2VCM A;  5FY5 A;  3WNX A;  1CIW A;  1ALY A;  1OUR A;  2QQV A;  1JHJ A;  4D6S A;  1EAH 1;  3OGS A;  3S7I A;  1RUJ 1;  3ES1 A;  2QQL A;  3I2I A;  4L0P A;  3BUC A;  1UWW A;  4RR3 A;  3D6E A;  5HXV A;  1OI6 A;  2QQK A;  2R1B A;  1NX9 A;  3B00 A;  4Y5T A;  2VVF A;  5C3Q A;  2VZ3 A;  3OEA A;  4R9B A;  1XPW A;  5E1R A;  4FFG A;  1YJK A;  4SLI A;  3BGA A;  3BKZ A;  4Z8B A;  3JQX A;  2JKX A;  2NP0 A;  3EQE A;  1QOS A;  3POG A;  1S4C A;  1MS1 A;  4I3G A;  4IEZ A;  1LOF A;  4C91 A;  2E33 A;  1UMZ A;  2E32 A;  4BDV B;  2IC1 A;  2OX0 A;  4M3C F;  5EP9 A;  4RGK A;  5FPV A;  1XBF A;  1MZF A;  3N9N A;  5C8C C;  4UW6 A;  1GKB A;  5DN2 A;  5IYY A;  4OHW A;  3MUZ 1;  3JD7 1;  4P9G A;  5DAV A;  1Y7B A;  4YZ5 A;  1HB4 A;  2P2K A;  4WM8 B;  4YWA A;  1CD3 G;  4D6Q A;  5J09 A;  1YQC A;  1UOB A;  2E7T A;  1K5M A;  4XUT A;  1NAE A;  1POV 0;  2JIC A;  1SPP B;  4EWD A;  2VZR A;  5DMY A;  1TMF 3;  2XHN A;  1FNZ A;  5I91 A;  4QPW A;  2IFR A;  4Z82 A;  4FPE A;  1KD7 A;  4DUX A;  2D7F A;  2EA7 A;  2E9Q A;  2GMP A;  1RTV A;  2XBO 3;  5C4W A;  3ZSJ A;  3SKV A;  1DZQ A;  3OYW A;  3VBR B;  3F2Z A;  1BJQ A;  1LED A;  2HWF 3;  3ACF A;  5FPZ A;  2W3J A;  4AHY A;  3LDK A;  2Z79 A;  3Q8E A;  2CGN A;  4P9X A;  1BCX A;  4LBQ A;  3SHR A;  4CEW A;  4AED B;  1QJX 2;  4PLM A;  5DAX A;  2BNN A;  3IWZ A;  1MQT B;  4P08 A;  5EPA A;  3NAP A;  5FO7 B;  3U0Z A;  3AL6 A;  1UX6 A;  4GJY A;  4IGO A;  1X82 A;  4NPL A;  3V0A B;  4EN8 B;  1BXH A;  1LU1 A;  2Y6F A;  3N3H A;  2XG3 A;  1RVF 2;  2C1F A;  2YB7 A;  2EIC A;  4IGP A;  4XDQ A;  1QY4 A;  1MS8 A;  4IV3 B;  5FKC A;  3POY A;  3UKN A;  4ZZ8 A;  4L2N A;  2XBO 2;  4NN0 A;  2RG4 A;  1W9T A;  4XUQ A;  1VRH 1;  1OLR A;  3KVA A;  5FYS A;  5FY7 A;  3RYP A;  1COV 1;  4LK6 A;  5BY5 A;  2ZAC A;  5J3U A;  1FPN 1;  4IE4 A;  5T50 A;  3VKF C;  1CAW B;  1DU3 D;  3PTY A;  2NN8 A;  1OOP B;  1HW5 A;  2P5B A;  2G4I A;  3O1V A;  1CAV A;  1IG0 A;  4X6R B;  4N7I A;  1PMH X;  4AYU A;  3CJI C;  1WW7 A;  1TG7 A;  3KV9 A;  2WZR 3;  3CLP A;  2A7A A;  1RED A;  1ND2 C;  2XUE A;  3WP6 A;  5BV6 A;  4RS5 A;  3FHQ A;  4BQX A;  3KQR A;  3WUD A;  2WA4 A;  2PAE A;  4HPK A;  3J7L A;  3BIW E;  5D8A A;  3WT3 A;  4TXW A;  2H6B A;  1UU6 A;  2DCJ A;  3LEM A;  1HB3 A;  4RSU A;  1KRI A;  4R4X A;  4XAA A;  2Q8D A;  1QNY A;  5KWR A;  4WV8 A;  3S5A A;  2JG8 C;  3VL8 A;  3AKP A;  4HSL A;  3MEP A;  2HH9 A;  1L7Q A;  1NLQ A;  2L9L A;  3LDB A;  3OBT A;  1NXM A;  4G3Y C;  4DQA A;  1ZRE A;  2WC2 A;  3RS6 A;  5LZ6 A;  1D7P M;  4PDW B;  5FV3 A;  2YMZ A;  4JTN A;  1F9K A;  1QXR A;  3C3V A;  2J1R A;  4LOS A;  5IAV A;  4K8F A;  3OSD A;  4YM2 A;  1PO1 3;  3MIB A;  4NRP A;  3QD6 A;  1FMD 2;  1AZD A;  1HQL A;  3CL1 A;  4ISQ A;  4XTP A;  5JIA A;  2RS5 2;  4BLI A;  3LFM A;  2JDN A;  1ENQ A;  3O12 A;  1O3Q A;  3OUH A;  3DCQ A;  5FMB A;  3AP9 A;  5BNQ A;  2MPF A;  1QHD A;  4AZZ A;  3DXT A;  3T08 A;  1DF0 A;  1LRH A;  4JAA A;  5LCW L;  1H9W A;  3TNP B;  2JDA A;  3MLJ A;  2R06 1;  2AC1 A;  1W06 A;  2V5D A;  1RUG 2;  4GIQ A;  5BNP A;  2JDY A;  1LGB A;  2GC3 A;  5E16 A;  5C7G A;  5IVJ A;  4JHT A;  3ZKU A;  2WS9 2;  2ARB A;  3FBY A;  4PJY A;  2HJI A;  4ZKT B;  2WNO A;  3M2M A;  5I0U A;  2BFU L;  4PLN A;  4MHR A;  1CJP A;  2J1S A;  3D0J A;  3K4A A;  1K12 A;  4TZD A;  4UF0 B;  1O3S A;  1HIX A;  2ZEX A;  3LIH A;  5APA A;  4ZZ5 A;  4CDX A;  1DQ6 A;  4U2A A;  1QF3 A;  2WDB A;  5F3E A;  1W6O B;  2FBE A;  4CVU A;  1XE7 A;  1MS9 A;  1RVF 1;  3JBG 3;  4E9K A;  1WMF A;  3UNP A;  1DDL A;  1OH3 A;  5IFT A;  3EJK A;  4CDU A;  1MZE A;  2E7A A;  3T1M A;  3USU B;  4HLT A;  1AYN 1;  4KU7 A;  5AC9 3;  4GB3 2;  1RIT A;  2EAA A;  3VL9 A;  3H0O A;  5E88 A;  2FZ2 A;  1U5I A;  4H3W A;  5LA0 A;  1V9U 2;  2FCT A;  3UES A;  3RWN A;  1G7Y A;  3NAP C;  4DNY A;  2F4L A;  1RHI 1;  1VB2 A;  4LIU A;  4BMB A;  3DYO A;  5F2S A;  3CMG A;  1CAX A;  5F6K A;  5F1R A;  1VBE 1;  3ZKY A;  1IKP A;  5FXW A;  4N53 C;  2F6B A;  5EXO A;  4XJ8 A;  2JIG A;  3CJX A;  2HWD 2;  2YPD A;  3DYP A;  4K6B A;  2Y6J A;  3LEI A;  4LKE A;  4M01 A;  1NG0 A;  4CU9 A;  1IKQ A;  1RXF A;  1WW5 A;  5B4N A;  5C9A C;  2NLR A;  4FTE A;  5J36 A;  4RS5 B;  3THP A;  5J7M A;  3SKJ E;  4TLG A;  4Q0Q A;  4YGD A;  3U78 A;  2HWE 2;  4OHY A;  2Q1Z B;  1WLT A;  4AHX A;  3B9I A;  2KM2 A;  1Q8O A;  2X53 S;  1SBF A;  3V64 A;  5CBL A;  4PLO A;  4Q26 A;  3NV2 A;  4M0H A;  2IVI B;  1NA1 A;  4XUO A;  1HRV 2;  3K48 A;  4PIZ A;  3BOD A;  4COV A;  1XND A;  4ASM B;  4ET7 A;  4BWO A;  4QKF A;  3U1X A;  5ABJ B;  3UV9 A;  4CU8 A;  4JVA A;  2YBP A;  4AG4 A;  3QOP A;  2RDR A;  4Y4R A;  1S2K A;  2YDE A;  2BBA A;  3RQ0 A;  4Z2A A;  1H8T B;  3ZN4 A;  4OI2 A;  1OVS A;  4GZ9 A;  4NR1 A;  2CL2 A;  2VCC A;  5IVF A;  1XU1 A;  4RN5 A;  1HRV 3;  5LEJ A;  1DHK B;  5LBE A;  1D2S A;  3MFC A;  4H2A A;  5DUU A;  1W6M A;  4MVT A;  3H3Z A;  1Q5O A;  1NCR A;  4FP3 A;  4LK7 A;  1REE A;  4CCM A;  1AR8 1;  4CCL A;  5C8C B;  3ZO0 B;  1UU5 A;  1JYT A;  4LO8 A;  3VBF A;  1BQP A;  1V6M A;  2NMN A;  3HNM A;  4PCR A;  4IL7 A;  4YW2 A;  4LA2 A;  4OZO A;  4D8M A;  4N43 A;  1POV 1;  2PYT A;  1DGL A;  1DQ5 A;  2VOV A;  4Y1Z A;  4GUL A;  1YYN A;  5J48 A;  1YUD A;  1E5H A;  1WCK A;  2Y26 A;  4CP0 A;  4K8R B;  4MSV A;  4Y20 B;  3TOJ A;  1N3P A;  4JRL A;  5FAX A;  2D6P A;  3THT A;  1JYN A;  5LBC A;  4GXL A;  3S5Q A;  4NMI A;  2D6O X;  2VOK A;  5FKB A;  4OHX A;  4CEY C;  1RGS A;  3I2H A;  5F39 A;  4AHZ A;  1BK1 A;  4JC1 A;  5JVV A;  5JOZ A;  1PZ8 A;  3HAG A;  2HBT A;  1HJF A;  1LKN A;  4UFH A;  4CDU B;  3W59 A;  3VHR A;  3H3L A;  1HN0 A;  3PL0 A;  4CU6 A;  4AED C;  3NV4 A;  4I30 A;  1DP0 A;  1XRU A;  2RM2 1;  2ZZJ A;  4DZG A;  1UZV A;  1RUI 3;  1KDK A;  3O0X A;  2YY1 A;  3FWE A;  3HQR A;  1CZV A;  4QPG C;  1OMI A;  4RR3 B;  5KC5 A;  4O61 A;  4CUG A;  2WT2 A;  1FOD 3;  3LB9 A;  4Q0U A;  1SDD B;  3RNS A;  3ILR A;  4CDW B;  2XGX A;  1R08 2;  1S0B A;  4TTG A;  2VQU A;  4IV3 C;  3E5U A;  4YVS B;  2OZJ A;  3CBN A;  3O5S A;  4P00 B;  3WVJ A;  1AL2 1;  1LOB A;  3K46 A;  3TBD A;  4CUC A;  5FRE A;  5KC6 A;  3RZH A;  2DCK A;  2PHF A;  1C8M 3;  2WQZ C;  4XFH A;  4MG2 A;  1MVE A;  2XH6 A;  3HT2 A;  3N9M A;  5T55 A;  4CPB D;  3W58 A;  1ULE A;  3NKG A;  4NPR A;  1QJU 1;  4LNV A;  3VBS C;  1J58 A;  1AJK A;  4PBP A;  2DDU A;  2FDK A;  5KXC A;  3ENR A;  3U37 A;  2Q8C A;  3M3O A;  2VME A;  2BOI A;  3BOP A;  1GWK A;  3POF A;  4I3P A;  4WBB A;  2O1Q A;  4MXW A;  5FY8 A;  4ARX A;  1EYB A;  1HRI 3;  2XLG A;  4HN0 A;  4GKX A;  4LHL A;  5CFD C;  1FOD 1;  2AAC A;  1NA1 C;  1UIK A;  4I0B A;  5SV5 A;  2KXL A;  3SH5 A;  3VKN A;  2UWC A;  3CEW A;  5C4W B;  2X5I C;  1LCL A;  3IZO A;  4Q4X 1;  1VRH 2;  4SBV A;  3RMX A;  3GNE A;  1V9U 3;  4EE2 A;  3VDD A;  1SLI A;  3CQO A;  2XQR A;  1S0J A;  4YGE A;  1BBT 2;  3S6P A;  3ZYB A;  4DPN A;  3AKR A;  2A6Y A;  3MW2 A;  1I3H A;  1TMF 2;  2RJL A;  2GNT A;  1VBB 2;  1TME 2;  3VD3 A;  2R07 3;  3KHB A;  4LBJ A;  3GHM A;  2K9Z A;  1CX4 A;  2YYO A;  1SFN A;  3NNM A;  4IDZ A;  1IS5 A;  4Q4Y 2;  4Q4X 2;  1HQW A;  2ORX A;  2GH8 A;  4QGN A;  1M4W A;  1RJ8 A;  2DBI A;  3E6B A;  2B8M A;  1S0I A;  5LY2 A;  3ME2 A;  4IXL A;  1OLM E;  3M3C A;  2PHW A;  2X09 A;  3T2O A;  2PN5 A;  4NJ4 A;  1GZT A;  1V6L A;  1XNB A;  1NY7 1;  1NKG A;  4AFB A;  1FAT A;  4GA9 A;  3VDC A;  4YPJ A;  4Q4Y 1;  1WUV A;  1WW4 A;  1ULG A;  3B5L B;  5CKQ A;  1CN1 A;  2C9K A;  4JGY B;  5FP8 A;  3I3M A;  1CAW A;  2VUA A;  3FN9 A;  4QQP A;  1RUH 3;  2UUR A;  5T5L A;  3ZFE C;  5LY1 A;  3OY8 A;  2D98 A;  5A32 B;  3WQ0 A;  2DVG A;  1DGR N;  2E31 A;  1W2A X;  2DFC A;  2GN7 A;  2JG9 A;  4JGZ C;  4Y4Y A;  5FY4 A;  4B4R A;  4CP9 B;  3V65 A;  1Q43 A;  2BP6 A;  4PF5 A;  3WF0 A;  5AVP A;  2ARE A;  2EAK A;  4CDW A;  1O91 A;  1LEN A;  1W9F A;  4XW3 A;  1RUC 1;  2H0V A;  2XL9 A;  1YFX A;  3T0D A;  1CIY A;  4LT5 A;  3AX4 A;  3UL2 A;  4IND A;  2FMD A;  4K3U A;  4MGI E;  4B4Q A;  1RUN A;  4XPV A;  1REF A;  4FOV A;  2WT0 A;  4S2H A;  3HQU A;  3WD5 A;  3WHU A;  3THC A;  5L19 A;  2P34 A;  5FYH A;  5IVY A;  5I8T A;  1HV0 A;  1PZ7 A;  2RMU 1;  3EHK A;  1G8W A;  5C33 A;  1W99 A;  4KBZ A;  4HMZ A;  4GH4 B;  3POJ A;  3QCW A;  4D7Y A;  4N53 B;  4IE5 A;  3AVR A;  1CPN A;  1YI7 A;  3KT4 A;  4FPO B;  4J1W A;  4XIO A;  3RSJ A;  5C9A B;  4LUL A;  1LHO A;  3WY6 A;  1JZ3 A;  1RXG A;  4F8A A;  3J7H A;  3U11 A;  4CCK A;  3BN6 A;  2CTV A;  4B7K A;  1GYK A;  2ZAH A;  1QXP A;  4GMP 0;  5T5P A;  2DCY A;  4D0Q A;  2LTN A;  4R9A A;  1IPS A;  1GNY A;  2WSV A;  3WR0 A;  3ILN A;  3VBS A;  2A6V A;  2K0G A;  3PVO A;  2WBK A;  4GB3 1;  2P3I A;  1YO8 A;  2GZW A;  4FOY A;  2PXJ A;  4FI9 A;  3DEC A;  4P5H A;  5FZK A;  1UF2 C;  5FO8 B;  4L9B A;  3AMH A;  2VZO A;  3ON7 A;  4WM8 C;  2HEW F;  1XSR A;  1ODN A;  3U4X A;  1LHV A;  1ZBE 2;  2VM9 A;  3MIF A;  2RJ2 A;  3NL1 A;  3DEM A;  1KQR A;  1UY1 A;  5JMO A;  4OI0 A;  2Q8E A;  1XNA A;  3GXU A;  1ZBA 3;  3MIC A;  4HOO A;  1H2L A;  3IDB B;  3BYW A;  4ZS2 A;  1R1Z A;  1U5Y A;  5DDJ 2;  5LRS A;  1PIV 1;  3JD7 2;  5KR7 A;  1SEF A;  4QHB A;  3ZFG A;  4BQ4 A;  2VMC A;  5A1L A;  5CYY A;  3MF6 A;  4K9S A;  5J96 B;  1MEC 1;  4KMQ A;  5GLU A;  2QZ2 A;  2OKX A;  3VBO A;  4NRO A;  3MBW A;  1HXS 2;  3OD0 A;  4K20 A;  1W8Z A;  1MQT C;  3QAC A;  2RDN A;  4LIV A;  5A7O A;  4HPK B;  1CZT A;  2R06 3;  2UYB A;  2I2S A;  5A32 A;  5D8A B;  4CP9 A;  5DDJ 3;  1Z7S 1;  5FCC A;  1AUY A;  2EIG A;  3VV1 A;  2TUN A;  5KHJ A;  1ZRD A;  1AX2 A;  2GME A;  2ARX A;  5F3I A;  4QB6 A;  1W05 A;  5AVA A;  3WF1 A;  4JCK A;  1GLH A;  5HV4 A;  3AMQ A;  2VMI A;  1EAH 2;  3I2F A;  1PVC 2;  2YUE A;  4MGK E;  3KM5 A;  1SDW A;  2RS3 1;  4WVM B;  3VZL A;  3ZN6 A;  5BUV A;  3AYA A;  3PIJ A;  1U12 A;  1L7R A;  3ES4 A;  4BXF A;  1HX6 A;  1S0C A;  4MHU A;  1NCQ A;  3O1T A;  3WXP A;  3CIH A;  4UBG A;  5BNO A;  4ZHN A;  1W3X A;  3O1U A;  5FLH A;  4QKB A;  1M06 G;  3OEB A;  4RR3 C;  4AF9 A;  2JB4 A;  4QPG B;  3JQW A;  4ARY A;  4CDW C;  4E4H A;  1KEX A;  2LM3 A;  1UNB A;  4BIO A;  4QX5 A;  2H6C A;  2XLF A;  1PK6 A;  4I09 A;  2MEV 2;  2WT1 A;  5BYN A;  4XJZ A;  1UY4 A;  4XBL A;  4HBN A;  4IE7 A;  5HXM A;  4Y1U A;  4AFC A;  1RHI 2;  2VD7 A;  3LCP A;  1V70 A;  3FE5 A;  1EAH 3;  1QXJ A;  4RQP A;  2HBU A;  2J1U A;  3U07 A;  3WF4 A;  1ZRR A;  1PVX A;  3H1M A;  5C8C A;  2VXJ A;  1OSG A;  4GKY A;  5FZB A;  4XCB A;  1H4G A;  4AW7 A;  5FOJ B;  2ZBJ A;  2K46 A;  1XQN A;  3ZLI A;  1BYH A;  1R1A 1;  1UZ0 A;  4O9E A;  3SIT A;  1TZO A;  2DF7 A;  1BBT 1;  1JUH A;  2IXC A;  4PDW C;  5JUV A;  1AYM 3;  5A7W A;  3RRD A;  1YCI A;  5A33 B;  2ERF A;  2OW4 A;  2OYZ A;  2QQO A;  2SLI A;  1JYC A;  1BVV A;  1ZZC A;  2JD9 A;  2OPK A;  2WFF 3;  2WNV A;  3E6C C;  3Q8B A;  5CVR A;  3VDA A;  5C4W C;  4QXK A;  4ATF A;  3H8X A;  1AR7 3;  2PHR A;  1AR7 1;  3VHP A;  4YVW B;  3W21 A;  2VBP A;  4A2U A;  5LA1 A;  3N4M A;  1KJL A;  2BU9 A;  2XKO A;  1J84 A;  3OGJ A;  4IEP A;  4ZY9 A;  3ETP A;  4FXG B;  2QTW B;  5A3M A;  2R07 1;  3LPF A;  1JZ4 A;  1UX7 A;  1W6N A;  3TN9 3;  1QJZ A;  2PHU A;  5GAL A;  3ZVX A;  1RUJ 2;  2XBO 1;  3UKT A;  3M7A A;  1LR5 A;  2ZGP A;  2DU1 A;  5AC9 2;  4FPF A;  1PM4 A;  4M3C B;  2JDH A;  1WLC A;  4YVS A;  4UW4 A;  1IG3 A;  1OFN A;  2HWB 1;  2VEC A;  2VGD A;  2D3R A;  4Q4W 1;  1AXY A;  2R30 A;  2AEY A;  3BVC A;  3WDY A;  1OPO A;  3FHA A;  3MID A;  3IDE A;  1CAU A;  2A5Z A;  3O1P A;  4V2W A;  1ACC A;  4IEU A;  5A7N A;  1R09 2;  3J8F 3;  4HKL A;  4KWU A;  3ZFE B;  4URA A;  4NRQ A;  1VPH A;  2BWC A;  3ZR5 A;  5M0T A;  3E5Q A;  4JGZ B;  3Q8C A;  2OA2 A;  4RHV 3;  3J26 N;  3GBW A;  3AFG A;  4XFB A;  5FP7 A;  4KWK A;  4IV3 A;  3E1F 1;  3ZIW A;  3R4S A;  5JWP A;  5DUW A;  1YJL A;  3MI8 A;  1FX5 A;  2DUO A;  4IEQ A;  4MXW B;  2J22 A;  2VZV A;  2TNF A;  2BGC A;  4DOU A;  4XET A;  3I2G A;  5DDJ 1;  1K42 A;  2BV4 A;  1F5F A;  1FYU A;  2Y0O A;  3I54 A;  1WD4 A;  2ZGO A;  1LOC A;  2ZKL A;  4K1Y A;  4QX8 A;  3I7D A;  1C28 A;  2RS3 3;  3OD4 A;  2C4X A;  4GH4 C;  2JXA A;  1QJU 2;  3LEG A;  5DG1 A;  5K4L A;  4EN9 B;  4OUS A;  5FJK A;  5ABJ C;  4COZ A;  5JZG C;  4AVT A;  4RFT 0;  3INA A;  4DIQ A;  3C7H A;  3VDB A;  3AKT A;  1OD5 A;  3ZFF C;  1FV2 A;  1KFU L;  3HNB M;  4E2G A;  1D4M 3;  1JHN A;  1SFP A;  3CDZ B;  3AZX A;  4HXC A;  1E57 A;  4JDN A;  1EUT A;  3BU7 A;  5EQU A;  4AVV A;  5CAZ A;  2WN2 A;  1UOG A;  2Q5T A;  3HQX A;  4GWJ A;  2GC1 A;  2YXS A;  4B7E A;  3NV3 A;  4S2G A;  3N9P A;  4KI5 M;  5BNN A;  3A23 A;  5HCB A;  3VHN A;  5B2G B;  4NIA A;  4BB3 A;  3AZY A;  4YVW A;  1BK0 A;  3ELN A;  4RGA A;  1AR6 2;  1F4H A;  2W68 A;  1W3V A;  2UYA A;  3I3D A;  4E2S A;  2VOX A;  2W1Q A;  1GIC A;  1WCS A;  5HCH A;  1VMH A;  4XIL A;  5HBA A;  4B29 A;  2F4P A;  1ZBA 1;  2VTF A;  2W87 A;  1HKD A;  4LE4 A;  4QQO A;  1PGW 1;  2R49 A;  3AM2 A;  3PUR A;  2JDU A;  1UPS A;  3WOG A;  1OA4 A;  1OH4 A;  2BNM A;  3WG4 A;  4Q8K A;  1YWK A;  2XHK A;  3PVB B;  5IHR A;  3MYX A;  5FPU A;  4FPH A;  3ZXJ A;  2QQP A;  3DV8 A;  1V6I A;  3VD9 A;  1G9F A;  1BEV 3;  3LOB A;  1JBC A;  1W8O A;  3A21 A;  2ZPX A;  2A71 A;  3POI A;  3QH7 A;  3WIN E;  3WNL A;  1A34 A;  4D69 A;  2HWD 3;  3AYC A;  5ACA 1;  1IPJ A;  1CON A;  2ZX4 A;  1Q8V A;  3WF3 A;  2HLE A;  3OB8 A;  4YW5 A;  3AC0 A;  5FP9 A;  3KSC A;  3D4K A;  3QBQ A;  4FPY A;  4GJZ A;  2F17 A;  1R09 1;  3R05 A;  5IW0 A;  2JEC A;  1H1A A;  3M3Q A;  2NM1 A;  5DPN A;  4XBN A;  1OBN A;  3SCF A;  3OPT A;  3K77 A;  5FMO L;  4P02 B;  3NKT A;  1SLL A;  1LOD A;  3TWI A;  1NZI A;  5I8S A;  4HKO A;  4QX2 A;  2ZEY A;  3OPZ A;  2JG8 A;  5C9A A;  1FOD 2;  1K5M B;  1H2N A;  4GD4 A;  3T0B A;  1FNY A;  1ND3 A;  2XJP A;  5FZD A;  4ASK A;  5JSO A;  5DAW A;  1K3I A;  1ONA A;  3BCW A;  3OCP A;  1AR7 2;  3VBH C;  3OG2 A;  5IAT A;  3R6S A;  1P8J A;  4XE9 A;  4AI8 A;  1ODM A;  4HKW A;  1OD3 A;  2IXH A;  2VTX J;  1W6Q A;  2Q30 A;  3CZU A;  1W8U A;  4QPY A;  4QX1 A;  4ZU7 A;  5C3R A;  1U0A A;  5EYX A;  3NRU A;  1XOY A;  1W9Y A;  4W6W A;  5FBJ A;  1NOV A;  4UXA A;  1R1A 2;  2R16 A;  3URF A;  3WP3 A;  4S2D A;  1VLN A;  4X6Q B;  2PHL A;  1F35 A;  2VY0 A;  1XYN A;  1AL0 G;  3ZXA C;  5FPA A;  1ULF A;  1AJO A;  4DIN B;  1MZ6 A;  5D21 A;  1H6X A;  4E4S A;  3HPN A;  2OPW A;  1VR3 A;  3WDW A;  5CFD B;  2BBV A;  1NA1 B;  2YBK A;  4AQT A;  1AXK A;  2CWM A;  1GWL A;  1QH6 A;  2X5I B;  4J6G A;  4Q0P A;  1N3O A;  2ZEZ A;  5F3C A;  3ZFG B;  3WX5 A;  1EP0 A;  1VBC 1;  3MF9 A;  1E5S A;  2WN3 A;  3R4U A;  3B02 A;  3IPV B;  1V9U 1;  2B7Y A;  4RHV 2;  5FUP A;  1RUO A;  3MZH A;  1WLD A;  2TBV A;  1RUF 1;  5E89 A;  5I0T A;  4IER A;  3AP5 A;  1JYI A;  1MS3 A;  5FXV A;  5H9R A;  1YEW A;  1K5J A;  1OT5 A;  1O8S A;  1UXZ A;  1LOG A;  2HEV F;  2QNK A;  1SCR A;  2WL1 A;  3HBK A;  1HDK A;  1V00 A;  4FQZ A;  4HL0 A;  4XF1 A;  4YW1 A;  5FMC A;  5JR7 B;  2C9A A;  1XYO A;  3MIE A;  1IQA A;  4FPK A;  1ENS A;  4LUK A;  4MV2 A;  3SEE A;  1UU4 A;  1WME A;  3DUI A;  4M0N A;  3AYE A;  4MGZ E;  4XAC A;  4XDO A;  4YVW C;  3WW1 A;  4YZ4 A;  5EWS A;  1Y9G A;  4NAO A;  1ZRF A;  1NE4 A;  4IEW A;  2JWP A;  4V2V A;  4LBQ D;  3ZN6 B;  3A22 A;  2DVD A;  3OJB A;  2G9F A;  3ZXF A;  4AAP A;  1NZC A;  2DV9 A;  4CYD A;  4YW3 A;  1RIN A;  2CHH A;  2MNG A;  3IAP A;  5IJR A;  1JXN A;  2WIN B;  4CXW A;  3HJR A;  1CJD A;  2EXJ A;  4UBH A;  1C3H A;  2NPI A;  5FYI A;  4QXH A;  1H2M A;  4TYS A;  2ZXQ A;  3OF1 A;  2A6Z A;  3VBR A;  2J7M A;  1CZS A;  1EV1 1;  1VBA 2;  2W52 A;  4L92 A;  5CU1 A;  2ZGT A;  3NW4 A;  4AI9 A;  1Y9M A;  5LA9 A;  1VB4 A;  3B3Q E;  1FAY A;  4QU2 A;  4RQP B;  3AZZ A;  2FQP A;  4YW7 A;  1RUD 1;  4OQ9 A;  2QQI A;  4AI3 A;  1FXZ A;  4MX3 A;  4LO4 B;  2HWE 1;  1OUS A;  2ORZ A;  3RI9 A;  2VBB A;  1A8D A;  1GZW B;  3GBF A;  4Q2F A;  3RZJ A;  1LGC A;  3LA2 A;  1DIW A;  4QWN A;  2D97 A;  2ZGS A;  5BNP B;  1MEC 3;  1BVP 1;  4Q8L A;  1UZZ A;  4LUM A;  1PK6 C;  4BXS V;  3D5O A;  4EWE A;  1E5I A;  2WUH A;  1W8H A;  5FY1 A;  1RUD 2;  1PIV 3;  4PIX A;  3BAL A;  5L73 A;  2C24 A;  4FTB A;  3N7J A;  3E97 A;  4YM1 A;  3UGG A;  3K3O A;  3RG0 A;  3VBH A;  4COY A;  2QKD A;  3LQC A;  5LAS A;  3GZA A;  4DEV A;  2WNV B;  2WZR 2;  4Q4V 1;  2RM2 3;  2X05 A;  3I2O A;  1F2N A;  3POE A;  2ZX0 A;  1NLR A;  2OII A;  2WKK A;  2B9U A;  5F37 A;  2BEO A;  1VBC 2;  2JE9 A;  2QQN A;  4GMP 1;  1OLQ A;  1JOJ A;  2XQX A;  4GQ7 A;  2MEV 1;  4ES9 A;  4A6O A;  3T09 A;  2C0Z A;  2B39 A;  4M4P A;  1XC6 A;  5KHI A;  2C6S A;  4A7Z A;  4IW3 A;  1SMV A;  3ZSK A;  1EPW A;  3ZFF B;  2WLP A;  2RS5 3;  2E26 A;  2ILM A;  3D3A A;  4K7J A;  4P9L A;  1XSQ A;  2VCB A;  3HD8 B;  3KWV A;  4LO6 B;  5B4X A;  3RDI A;  2VXR A;  3W5M A;  1QQP 2;  5GZD A;  1TME 1;  5A7S A;  3K3N A;  3D0S A;  3RMY A;  1DZR A;  2XDV A;  4DMI A;  1AX0 A;  1DG6 A;  3WDU A;  2ZCW A;  3ZYG A;  1LEM A;  1AL2 2;  2ZAB A;  4AOC A;  4AVS A;  4LBN A;  5JI7 A;  3U10 A;  4CXX A;  2WO1 A;  2VO5 A;  2A3Y A;  3SEP A;  1RUD 3;  5FZ6 A;  5FZ1 A;  4A7K A;  4QPI A;  4Z2W A;  1CWP A;  5GZG A;  1IZ3 A;  2B5H A;  2IXK A;  3DXU A;  3H42 B;  2OVU A;  2RHP A;  3TAY A;  2BJS A;  3ZDV A;  4CDQ C;  1OKQ A;  1FMD 1;  5J98 B;  5T5J A;  2PLV 3;  4A42 A;  5FOB B;  5D8A C;  3IN9 A;  5LB6 A;  5K7P A;  3HEI A;  3I49 A;  3D8C A;  4Q0S A;  2XB6 C;  1WCU A;  2RM2 2;  3AYD A;  3H8O A;  1ULC A;  1HN1 A;  1GOF A;  5F3G A;  2XJU A;  5LBB A;  5FR3 A;  4AGV A;  1B35 A;  5DXD A;  4EJR A;  2HWE 3;  4XQ4 A;  4AL9 A;  2VBD A;  3WSO A;  1H8T A;  1QEX A;  4COU A;  1HQN A;  3I97 A;  5J1X A;  5FZ0 A;  2WS9 3;  1X50 A;  1IOA A;  1UYZ A;  5GZC A;  3H1Y A;  2N7G A;  1N1T A;  2W94 A;  4XFI A;  3N36 A;  1PO2 3;  3UGH A;  2VMG A;  5A7Q A;  3VD5 A;  2HWC 1;  3PUQ A;  1ZRI A;  4LKS A;  1EPZ A;  2W1W A;  4M00 A;  2BRT A;  2YG0 A;  4LO5 B;  3JB4 C;  4OI1 A;  1H9P A;  3K75 B;  2Q4S A;  4HK9 A;  5FLJ A;  3T3Y A;  3L2H A;  2VW1 A;  4ZU5 A;  3WDX A;  1JZ6 A;  3C7G A;  2AR6 A;  3CF6 E;  2O0O A;  4CCD A;  4A7Y A;  4XF4 A;  4L8Q A;  4UW5 A;  2BTV C;  4QHZ A;  4XF0 A;  4EZH A;  1VBE 3;  4Y26 A;  1OKO A;  4AWD A;  3VBH B;  4XQW A;  4Y20 A;  2VQT A;  4BLJ A;  5AC9 1;  4LBL A;  2VMD A;  3UK9 A;  2WZP P;  5BNN B;  5DQ0 A;  3PUA A;  4GH4 A;  2VOW A;  4OZX A;  5FWE A;  1OFS A;  1RVF 3;  4A41 A;  5L7O A;  1GBG A;  4Q4Y 3;  5JZG A;  1PGS A;  2QQU A;  3UYJ A;  3GHN A;  2JD4 A;  3DPR A;  4FAG A;  2CYF A;  1QNW A;  5IVC A;  1QOO A;  2GMM A;  3TEZ A;  3WW2 A;  1Z0H A;  4YGC A;  5L9V A;  1UZW A;  4NOT A;  1CAU B;  3K51 A;  5ANN A;  1IS6 A;  4IET A;  2Z69 A;  5FRA A;  1PO1 1;  2OQ6 A;  1XE8 A;  3S30 A;  3WDV A;  3NNJ A;  3AJZ A;  3KD4 A;  1B09 A;  2ZX1 A;  1GWM A;  3VZO A;  2YC2 A;  4QX7 A;  3ZFG C;  5TSW A;  1O5U A;  2QJV A;  4NHK A;  2R6Q A;  3KT7 A;  1SLT A;  5A7P A;  4RGG A;  4PT6 A;  2VW0 A;  4XHB A;  5FJH A;  3C7O A;  2WA3 A;  3WCR A;  4CTE A;  5CFC A;  1RMU 2;  5LK7 B;  1KIT A;  4ASL A;  3BTX A;  1F4A A;  2E6V A;  2P17 A;  1LJ7 A;  3I8T A;  2BNO A;  1C8M 1;  1ZBE 3;  2Z42 A;  5ERL A;  1SZB A;  2JEN A;  4XJW A;  1LNS A;  3ASI A;  4JKL A;  5BPX A;  2RS3 2;  2FDH A;  3KGZ A;  4DRR A;  2C5D A;  3GZT B;  3IMM A;  3WHT A;  4BE3 A;  4AGR A;  1O59 A;  2PLV 1;  3HMY A;  2XJT A;  5C71 A;  1C1L A;  1GUI A;  2XOM A;  1GR3 A;  1GZ9 A;  4AR2 A;  2D6K A;  3GBG A;  2DTY A;  1KFX L;  4JHZ A;  1OC1 A;  1PNG A;  4W65 A;  3MO4 A;  3CKH A;  1EUU A;  1RB8 G;  2WRA A;  2UWB A;  3POB A;  2DCT A;  5BXX A;  3NNG A;  3RZG A;  3J4U H;  5FK7 A;  2OZ6 A;  2FZ1 A;  4EWA A;  1DYK A;  5HPO A;  1VIW B;  1ZX5 A;  1KS4 A;  5I8Y A;  1O4T A;  3B93 A;  4FP2 A;  2W1U A;  4RQP C;  5JI9 A;  3IBM A;  4XAB A;  2ZX3 A;  4FFH A;  1UOJ A;  1J83 A;  4B1L A;  1UKR A;  2WR9 A;  4P14 A;  4JQR A;  5G05 L;  1POV 3;  1BEV 1;  1WCD J;  5FMD A;  4QGL A;  5FYZ A;  4DXS A;  2GNB A;  1AR9 2;  1DYO A;  3ATG A;  4LHS A;  4XXP A;  4BK5 A;  5FZ8 A;  2ZS6 B;  3NJZ A;  3VZK A;  3ABZ A;  4TN7 A;  5BNP C;  5JZG B;  3R0R A;  2I74 A;  4DS0 A;  1JN2 P;  3N7M A;  1PK6 B;  2P6H A;  4JRA A;  4QB1 A;  4PDW A;  1D4M 1;  3SC7 X;  1COV 2;  1HRI 2;  3KV4 A;  2DCZ A;  1V6O A;  1NXD 1;  5CNA A;  4QD2 A;  1E5R A;  3RYR A;  3ZX7 A;  4IV1 B;  5F6L B;  3ZXL A;  1UMH A;  1G6N A;  1TNF A;  2MEV 3;  1IS4 A;  2ENR A;  2WNV C;  4MZU A;  3DN7 A;  4OUL A;  2EIB A;  2RE9 A;  5FY9 A;  3TRS B;  1IPK A;  3LA3 A;  5KBF A;  3VD7 A;  4Y5Z 0;  2ATF A;  2WWJ A;  3PTR B;  4DEQ A;  5L7O C;  2QZ3 A;  3U4S A;  3HVD A;  3P5B A;  4CUB A;  2ZGL A;  3V0B B;  2JE8 A;  5LWB A;  4DXT A;  3M3I A;  1GU3 A;  1VAM A;  4Z1V A;  4N90 A;  2W95 A;  4IUG A;  3B94 A;  5FBZ A;  1ND3 B;  3C2U A;  3L9J T;  5FYU A;  3SQO A;  1XXN A;  1QDO A;  5C3S A;  1T6G C;  2XWJ B;  1HXS 3;  2VCA A;  4V1P A;  4QX0 A;  1ZA7 A;  2IXI A;  5JLV A;  4EV0 A;  2BGP A;  1W6Q B;  5FZ3 A;  2ET7 A;  3C7F A;  1UQX A;  2GAU A;  2JDZ A;  1ENX A;  4CP1 A;  2XWB B;  1WMD A;  2QQM A; 
#chains in the Genus database with same CATH homology
 5FXW A;  4GJY A;  3N9Q A;  4IGO A;  5FZE A;  2WWU A;  5FZD A;  2Q8E A;  2YPD A;  5FY8 A;  4ASK A;  3KV5 A;  4QX7 A;  4HOO A;  3KVB A;  4IGP A;  4GAZ A;  4QU1 A;  5A7P A;  5FP3 A;  4CCN A;  5F37 A;  5KR7 A;  3U78 A;  5FJH A;  5A1L A;  4V2W A;  5IVV A;  2OQ7 A;  4D6R A;  5A7N A;  4URA A;  3KVA A;  5FYS A;  5FY7 A;  5FZA A;  3OPW A;  3ZPO A;  5FZ4 A;  4Y3O A;  2GP3 A;  5FZC A;  5FY0 A;  5FBJ A;  5A7O A;  4LIV A;  5FZO A;  3K2O A;  5A3T A;  5LW9 A;  2P5B A;  5FP7 A;  2W2I A;  4EYU A;  4BIS A;  5A7S A;  5FYM A;  2YBP A;  3K3N A;  5FYT A;  5FPA A;  4Y4R A;  2XDV A;  3KV9 A;  5FZM A;  5FZI A;  5F3I A;  5LY2 A;  5CEH A;  2XUE A;  2YBK A;  5IVF A;  5FXX A;  2GP5 A;  5FYC A;  1VRB A;  5FZO B;  4LIT A;  5F3C A;  5FZ6 A;  5FZ1 A;  5IWF A;  4QX8 A;  4CCM A;  3DXU A;  4CCL A;  5FP8 A;  4BXF A;  5K4L A;  5FUN A;  5FUP A;  5FXZ A;  2Q8D A;  5FJK A;  5LY1 A;  5F5A A;  5FYB A;  4DIQ A;  4DO0 A;  4XDP A;  5IVE A;  2OT7 A;  5FXV A;  5FY5 A;  3LDB A;  5F3G A;  3PUS A;  4E4H A;  2YU1 A;  5F5I A;  5FY4 A;  4CCO A;  4D6S A;  3PDQ A;  5A3P A;  5A7W B;  4IGQ A;  5ANQ A;  5FP4 A;  5FYY A;  5FV3 A;  5FZ9 A;  4UF0 A;  5FZG A;  5FZ0 A;  4XDO A;  5F2W A;  2VD7 A;  5FYZ A;  3N9P A;  4CSW A;  4V2V A;  3LD8 A;  3PU8 A;  5F39 A;  5FZL A;  5FZ8 A;  5A7Q A;  3PUQ A;  4AAP A;  4TN7 A;  5A80 A;  3DXT A;  5FWJ A;  5FZB A;  4BU2 A;  2OX0 A;  5FYH A;  5FPV A;  5IVY A;  3N9O A;  3ZLI A;  3N9N A;  5FPL A;  3KV4 A;  4QXC A;  5FPB A;  4CCJ A;  5IVJ A;  5FYI A;  4QXH A;  2XML A;  3PUR A;  2YBS A;  5A1F A;  5FZH A;  3N9L A;  5A7W A;  3AVR A;  5FY9 A;  4EZH A;  5A3N A;  4UF0 B;  4D6Q A;  4CUG A;  2OS2 A;  4AI9 A;  5FPU A;  3NJY A;  4LXL A;  2WWJ A;  3PTR B;  3KV6 A;  4NUB A;  3U4S A;  4CCK A;  5F3E A;  3AL5 A;  5F5C A;  5ISL A;  5LWB A;  3RVH A;  3PUA A;  4Y33 A;  5FZ7 A;  5FWE A;  4EZ4 A;  5FP9 A;  5A3W A;  4GJZ A;  2YU2 A;  3UYJ A;  5IW0 A;  3N9M A;  5FYV A;  5FYU A;  2PXJ A;  5FZK A;  4QWN A;  2XXZ A;  3OPT A;  5FZF A;  4QXB A;  3PU3 A;  5IVC A;  2OQ6 A;  3AVS A;  5FY1 A;  4LIU A;  4HON A;  5E6H A;  5F32 A;  5IVB A;  5F2S A;  5FZ3 A;  4C8D A;  2Q8C A;  3K3O A;  4GD4 A;  3AL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...