2OQ6A

Crystal structure of jmjd2a complexed with histone h3 peptide trimethylated at lys9
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
348
structure length
348
Chain Sequence
LNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLVTGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNIGRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKGFFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYGKQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 3A
publication title Crystal structures of histone demethylase JMJD2A reveal basis for substrate specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 112
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2007-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF02375 JmjN jmjN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 2oq6A01
4XDPA 3UYJA 5FZMA 3OPWA 5FZ6A 2OQ6A 4IGOA 2YU2A 4TN7A 5A7PA 4EYUA 4LIVA 5FPVA 3K3OA 4EZHA 2Q8EA 4D6QA 4GJYA 5FY1A 4BU2A 5A1LA 5F3EA 4IGPA 5E6HA 5FZ1A 2GP3A 5FYCA 5FXXA 4CCLA 4LXLA 4Y4RA 5FWEA 5IVVA 5FP9A 4LIUA 5F32A 4CCNA 2OT7A 5FZGA 2W2IA 4CUGA 5FWJA 3AVRA 5KR7A 4ASKA 3AVSA 3N9QA 5FPBA 3ZPOA 5FYUA 2OQ7A 4D6SA 5FXWA 3K2OA 5FZ7A 3PUAA 4NUBA 5IW0A 3OPTA 4DIQA 4BXFA 5FZOA 5A3TA 5FUPA 4CSWA 5F3IA 5A3NA 2XUEA 3AL6A 5F5IA 5FV3A 5FP3A 2Q8CA 3PU8A 3N9NA 5LY1A 5F5AA 3N9PA 5FZLA 5FZIA 4CCKA 2XDVA 2XXZA 5FXVA 3N9OA 5FY7A 4DO0A 3U4SA 4XDOA 5FY9A 5FZ0A 3AL5A 2P5BA 5FY5A 5FZFA 5F39A 5IVFA 4QXBA 5FJKA 3RVHA 5A3PA 5FZOB 3KV9A 3N9LA 5F5CA 5ISLA 5F3GA 4HONA 3PTRB 5A7SA 5A80A 5FZCA 5A7QA 5F3CA 4UF0B 5IVBA 4IGQA 4V2WA 5FJHA 4Y3OA 5IVEA 5FYHA 5FZ4A 3U78A 4E4HA 5FY0A 4QU1A 5ANQA 5FYIA 5FYBA 5FP8A 5FPAA 3PUSA 5F2WA 5FYYA 5IVCA 4UF0A 5FPLA 5K4LA 4C8DA 5FXZA 3KV5A 2GP5A 1VRBA 3NJYA 5FYTA 5FYMA 5FUNA 5LWBA 5F2SA 4CCMA 4HOOA 4CCOA 3DXTA 5FZEA 5FYZA 5FZKA 5FZHA 4BISA 2YBKA 5IVYA 5A7OA 3KVAA 5FZAA 4QWNA 4V2VA 4QXCA 3PDQA 4GAZA 5FZBA 2VD7A 3KVBA 5LY2A 2Q8DA 2XMLA 3KV4A 4GD4A 3LDBA 5FP4A 5IWFA 5FPUA 5IVJA 4AAPA 2YBPA 2WWJA 5FZDA 2YBSA 5FY4A 3PURA 4GJZA 5FZ3A 3KV6A 4D6RA 4AI9A 2WWUA 2YU1A 2YPDA 4QX7A 5F37A 5FYVA 5FYSA 5A7WB 2OS2A 5A1FA 3LD8A 5FZ9A 4EZ4A 5LW9A 3ZLIA 5FP7A 5A3WA 4URAA 5A7NA 3K3NA 4LITA 4QX8A 5FBJA 5FZ8A 2PXJA 5FY8A 2OX0A 3PUQA 5CEHA 3DXUA 3PU3A 4QXHA 4CCJA 3N9MA 4Y33A 5A7WA
chains in the Genus database with same CATH superfamily
1QJY3 4Y26A 3VV1A 4MXWA 1PMJX 1NZIA 2KR2A 1XE0A 1CZTA 1JUHA 1ODMA 3O1MA 1IG0A 3WQBA 5DAVA 1GSLA 1JW6A 4I3GA 3VBOC 4BLIA 1K45A 1OQDA 5AC91 1CN1A 1BEV2 3J26N 2OPWA 5FY1A 2QQNA 1ND3B 3AMPA 5IYYA 4OUMA 3RMXA 3ZXKA 4HN0A 1WW7A 3OD0A 1AR92 2HWE3 3CDZB 4BH9A 4DEQA 1RXFA 2B8MA 2RR11 1G7YA 2ES3A 3AVRA 4IXLA 2VMFA 1J3PA 1DQ6A 4HANA 4WVVA 3ZFGC 4Q1PA 1CAXB 2JIGA 2YYOA 3AXEA 5FYUA 1N1SA 2C4XA 1GMMA 1MS5A 2AGSA 5B4XA 5L36A 2ZGOA 5JIAA 5GZDA 4BLJA 5BXXA 3T09A 5A3NA 2EIDA 2QUOA 4DY5A 2BW8A 2E33A 5AC92 4AVTA 3SISA 1PM4A 2PELA 2RJLA 2V72A 1JN2P 2BTVC 3BB6A 4QX1A 5FPZA 1G9CA 3O1TA 1EV11 1TNFA 2NZ9A 4DO0A 1GP4A 1W39A 5KHHA 2VMIA 5J98B 2RR12 2VUAA 5JWPA 2VTFA 5HCBA 1AL23 1TQ5A 3CJXA 2YDEA 5T54A 3TEZA 2ZGPA 4L97A 5A3PA 3OYWB 4N90A 4XQ4A 4W6XA 1ULOA 2Z69A 2RE9A 5F6KA 2WS93 3USUA 1CWPA 3S6PA 1OUXA 2UYBA 4L2NA 5KC6A 1WUVA 1PX3A 1UOBA 1YQ6A 2X10A 3LZZA 3WDUA 5FLHA 4B7EA 3PIJA 3HNMA 1EV12 4Q4X1 3CL1A 4W50A 4YW4A 5EYYA 5BNOC 2VVDA 4Y22B 1WCKA 5FYYA 1Z7S3 1PO21 3MIGA 4OZXA 3WSOA 1D0HA 3BCWA 1HRI3 1F35A 1WZXA 3BN6A 4WVMB 4OI0A 3UL2A 5LWBA 3HBKA 1RUNA 1W6OA 5FO7B 2XWJB 5EZWA 4BDVB 5FYZA 3ZKUA 3V0BA 2BJSA 2P1BA 5A7OA 4N43B 4A3XA 5FMCA 1DGWX 3BPZA 1LHVA 4COYA 1KEXA 2WN2A 4DRRA 2QDRA 2PAMA 5KHJA 1YCIA 5C4WA 3UESA 1U5ZA 1DYPA 2HEVF 2JKBA 1BEV3 2WQ4A 1H9PA 1MZ6A 1H9WA 2ZEYA 4Q4X2 1E5HA 2P3KA 4ZU7A 2VD7A 5J36A 3OCPA 3WF0A 1PO22 2A70A 1PVC3 3CJIA 3HIFA 1AR93 4COWA 5KC5A 2A3XA 1CAWA 1RINA 1TVGA 2JG9A 4MADA 5GLVA 2FDJA 2O14A 1JOPA 5FKCA 4Z07A 2YU1A 2JDZA 4ARYA 1VBA1 4KL1A 2D3PA 1ND2A 4OHWA 2HEYF 2YFZA 2GC2A 4L92A 1UQXA 4FT8A 2E7AA 1J83A 5AC93 3BTAA 1IS5A 3PUQA 5LBBA 2BOJA 4IW3A 5A32B 3VBUB 2TBVA 3LEMA 4ZPIA 4IE5A 4WM8B 4CVUA 2ARCA 2VNVA 4D3WA 2C0ZA 1YRZA 1UPSA 4TN7A 4FSJA 1UO9A 1LGBA 1UY4A 1JYIA 4LKDA 2UURA 3Q8CA 2ETEA 1FMD1 2PLV1 2RR13 4M00A 4K21A 2GC3A 2WZ8A 4OCTA 3VZJA 4COZA 3ORJA 4XTMA 5L9RA 3WINE 2KM2A 5DZGA 3KHBA 3KF5A 1OF3A 3W58A 2FZ1A 2W3JA 5A1LA 4XJ8A 1VBA2 2JDMA 3IAQA 5FXXA 5IVVA 2QE3A 2AUYA 3ATGA 3KSCA 4YWAA 2YZ4A 1MVQA 2X5IC 2BGPA 5HPOA 1JU3A 1UU4A 1ZZCA 5FUIA 4YSFA 4GXLA 3AKQA 3WEZA 1ULEA 1MS0A 3GF6A 4LJHA 1XRUA 4NOTA 1T6GC 1EV13 4A4AA 4YW7A 1OF4A 3V56A 3WF3A 3B01A 4HBNA 3UK9A 1GOFA 4H7LA 3WT3A 1FMD2 2PLV2 1NKGA 1GV9A 1K5JA 4AE2A 4BMBA 5C8WA 3OY8B 4JRAA 2MNGA 2XWBB 4XFFA 5BNOB 2VPVA 3LGRA 1N3PA 3ACGA 3NRUA 5F5AA 1U12A 2GZWA 2Y6KA 2ZTNA 3GZAA 4CEWB 3SCFA 3AKTA 1YQCA 4UYBA 1QJFA 4GWNA 4QQ2A 2XJVA 3IM0A 5LEKA 3ZYGA 4CPBA 2IXHA 2YY1A 1FATA 1PMIA 1MZEA 2X05A 3BVCA 1VE0A 1JOBA 3SH4A 5FZOB 3ZFFA 2XVGA 2VU9A 5JVVA 4Q4X3 5J7MA 5HCHA 2R30A 1Y7BA 4UT5A 3DYOA 2FBEA 4A6SA 1PO23 3I49A 3L2YA 5A7QA 2VW0A 3BYWA 2GU9A 3SXWA 3BIWE 3NSTA 3ZXLA 1RUE1 2QDNA 4RGKA 1OT5A 1IS3A 1Q43A 4V2WA 4X6QB 5IK8A 1F5JA 5FZ4A 1QOTA 4QU1A 4Q4Y1 4MZUA 5FPAA 3TB0A 3PVOA 1NZCA 1DQ0A 2ZEXA 5FO9B 3HQXA 1J59A 2ZCWA 5EPAA 3MFAA 4XDQA 1AVBA 5FYTA 1W9TA 3WDXA 4CCOA 3OEBA 2GN7A 1NG0A 4QHZA 2JB8A 1LOEA 3MYXA 4P00B 3T4VA 4XF9A 5GZEA 1X50A 1UY0A 2J1EA 1K5MC 3GZUC 4CUBA 1RUE2 3ZN4A 2QTWB 5IT6A 3OUHA 4NIDA 2GH8A 4AHWA 2VNRA 1ZX5A 4QM8A 2VZ3A 3POWA 4YGDA 5I93A 3O0WA 4Q4Y2 4WV8A 2ZHLA 2XMLA 4GQ7A 4SBVA 5C9AA 4P02B 2AREA 4BZ4A 3BU7A 5E8AA 3TN91 3VBFA 3M3EA 3PMEA 1O7FA 1TMF1 3VKFC 1F15A 3C8XA 1QNYA 3KZ4C 4J6GA 3V64A 2P3YA 4AG4A 1F8VA 4MGIE 2UWCA 3BOWA 3ILFA 4FFFA 5FMDA 2X5IB 4FAHA 5BNPA 5F37A 3QOPA 2W0XA 3NL1A 3B02A 1FMD3 2PLV3 2WQZC 2NQYA 2VBBA 3PVBB 1U5YA 4GWIA 1FV2A 2FCUA 1OA3A 1IQDC 1POQA 4YW6A 1SPPB 3ZN5A 4EN9B 4RN5A 1YI7A 3LF7A 2JJ6A 2Y34A 1W90A 5GLWA 1H8TC 2N7GA 4MSVA 5FZ6A 1O8SA 4LA2A 4K8RB 3TN92 4UW4A 1TMF2 1XNBA 4KWJA 1WKYA 4CA9A 1V6KA 5E1RA 5J3UA 1RC6A 2VMCA 4AVBA 4XUTA 2RDNA 4LHSA 4YPJA 1HQLA 4NPRA 5FQ0B 1I5PA 3CHXA 5BYNA 4R9AA 5JIUA 1SLIA 2IXJA 4YG3A 5F32A 3OBRA 5FZGA 3T1MA 4CU8A 1MS9A 3POEA 5K9YA 1NCQA 3WNLA 5B4NA 2B39A 1IPJA 1UW8A 2OQ7A 2ZACA 4W6WA 5K0UA 4D6SA 2A6ZA 3CEWA 1UAIA 2PHFA 2X29A 5ANNA 4HLTA 5CKMA 2NYYA 2Y26A 2AYHA 1NCRA 3AMHA 4ORFA 2WABA 3D8CA 4CP9A 1UOFA 2DU1A 2VULA 4EWDA 3KCXA 5C3SA 1H1IA 5FK8A 2QQVA 3HQRA 1D2SA 1WLTA 3J7NA 3H3UA 2WA4A 2WNVB 4LTAA 3PJYA 5J37A 3MDPA 1ZZ7A 3MI8A 4AHXA 3IDEA 3HQUA 3GBWA 2CYFA 3WP4A 2IVIB 1S4CA 1OUSA 3HJRA 3PTRB 4Q4Y3 4C1XA 1GNYA 1ZZ8A 3IN9A 2VVFA 3IWZA 3ROUA 4DFSA 3RZMA 4AGGA 1UX7A 2BFUS 3FLPA 4YM0A 4BMEA 5B2GB 4A3ZA 2CL2A 1EAH1 2Q0AA 3AZYA 4HK9A 5FYHA 3U78A 3WW4A 1ZRCA 1DQ2A 3ES1A 5BV6A 4HKOA 2WNOA 3NV1A 4DUVA 2Q1MA 2ADEA 3WHUA 3VD4A 3VBSA 2Q1FA 3LKJA 2DF7A 1WMDA 2WAAA 4K9SA 5LA9A 1MZFA 5DAXA 1SFPA 4M3CB 5FBZA 2R1DA 3THPA 4AFCA 1CZVA 4C91A 2H6CA 2JDUA 3OUJA 1TMF3 1QOSA 2XLGA 2R16A 2YGMA 3WF1A 5FOBB 3VDBA 4Q1RA 2BPA2 2VZOA 3EMRA 4XACA 1EAH2 3RJRA 4P9JA 2ZHKA 5DZEA 1ZYBA 1V6OA 2VMDA 3LWCA 1LR5A 2PAKA 5FP4A 3ACHA 5IWFA 4PCRA 1C3HA 1REDA 1XSQA 2J42A 2OW4A 2XBO1 3H50A 2WIIB 4BQ3A 1QJX1 4K3UA 3GGLA 5I0SA 3K4ZA 4GMP1 2VJXA 3S5AA 4XMIA 4RGAA 2PA7A 5FYSA 4MGYE 3O1UA 2ADDA 2ET7A 3HN1A 3MBWA 1ULPA 1S1AA 2VECA 2Y0OA 3ETQA 3DYMA 5IFPA 1W9WA 4NIIA 3M7AA 4CDXC 1ASJ1 3RSJA 1ODNA 5T5PA 1X9TA 1KFXL 3DCQA 4P08A 4TWTA 4TSVA 4XDPA 2G9GA 2YU2A 2VCBA 1ZRIA 4XF3A 4AOCA 5JSPA 2XBO2 3ZFEB 2FD8A 1MVEA 2NMOA 4XW3A 1C5HA 2VZPA 4CU7A 1BVP1 4YNIA 1QJX2 3U4XA 5CA6A 1SBFA 2B5HA 2QQWA 3EXUA 3HT1A 3FHIB 4JRLA 2QCSB 3LIGA 2HWB1 3TNQA 4ET7A 5C5UA 4TTGA 5FYCA 1W6NB 1OOPB 4E2GA 1AYN1 5CFCC 1ASJ2 2W47A 1RUG3 3MLLA 2D6KA 1KS5A 2IXCA 4PF5A 1KDMA 3GCXA 4Q29A 3DF0A 1RUD3 4YFZA 2ZZJA 1FAYA 1PK6A 2RJKA 3TEWA 5A70A 4QKNA 4R52A 1OHFA 2R061 1H2MA 3MW3A 3M2MA 3B93A 4XZUG 3NAPC 1QF3A 1XNCA 2HWB2 5L7OA 1W8ZA 3ZXGA 1JYTA 4YZ5A 1S0JA 1J3RA 2LS6A 1RUC3 2B46X 2ZX1A 3BPSA 1AYN2 2DVFA 5FZFA 2OUJA 5FMOS 1GBGA 2BU9A 2RM21 3R4DB 4BOWA 5M0TA 1CJDA 1EAH3 4EE2A 2EAKA 4QDQA 2ZGRA 2BV4A 2DU0A 2HH9A 2JICA 2R7EB 3FBMA 2D93A 3DPRB 3DECA 3MIEA 4IE4A 3PL0A 1HQWA 3NW4A 1OQEA 3AZVA 3H9AA 4NRPA 4O7XA 2R062 5JAXA 4E8CA 2A6XA 4HK8A 4AFAA 2WSUA 5EHDA 4OMDA 1NA1A 4H2AA 1QY4A 1VAVA 4QKDA 2OYZA 2FCTA 5ANQA 2FDHA 4UWDA 4YFWA 3PUSA 4ES9A 3VDDC 4D69A 3SLIA 3NKGA 3BTZA 3CIHA 1CIYA 1U5IA 1VRBA 1XJAA 2IC1A 2RM22 2Y6JA 4ZHNA 3MGUA 4HOOA 5GJ6A 3MEPA 5DUWA 5GZGA 3MIFA 2K9ZA 3HR9A 3N35A 4FPFA 1SBEA 1D0GA 3OBAA 3KVAA 4Y20A 2ZAHA 4A45A 1MPXA 2ARBA 2XBO3 4LBQB 3WD5A 1LU2A 2X8KA 2ORZA 4Q4W1 3ZN6A 1QJX3 1DLLA 4AEDC 3BI3A 4GMP3 5F6LB 1SLAA 3NVCA 3E97A 4GAZA 2IUWA 3GXUA 3DKQA 4MOAA 1NE6A 1NLQA 4WZCA 4XETA 1C8M1 1PHMA 3GZEA 3OBTA 5JOXA 1OPOA 3MO4A 4JGZC 2HYKA 4HMZA 1XBFA 4I0AA 3ZIXA 4AI3A 5ERLA 1WA6X 5FY4A 3WHTA 2E26A 2OUHA 1VBC3 5CKNA 4D6RA 2RS33 4DXZA 2HJIA 1W6PB 5A1AA 3GALA 1H6XA 3ENRA 2E32A 2XH6A 3DKWA 4CRQA 2D40A 3GBFA 3S7IA 3EJKA 1YXWA 3WOGA 1YFYA 4Q4W2 2JD9A 1APNA 2VZQA 3PU3A 4QDRA 2BFUL 4RS5B 4HL0A 1X36A 2HWB3 1C8M2 5AVPA 1LEDA 3X29B 4UXAA 1CD3G 1UOGA 4MGKE 3NJZA 2ZGNA 5D8AA 2V5YA 4BCUA 1RITA 2E9QA 2V5DA 2VTXJ 1COV1 3N7LA 1IKPA 1GANA 2VZTA 3AZZA 4D6QA 1XYOA 4E2SA 4JKMA 1PGSA 1HJFA 1OD5A 1SEFA 1VAMA 3AYAA 1GWKA 5EJ1B 3WVJA 5FP9A 5ABJA 2R063 5IAXA 1ULGA 1GZWA 3BALA 5L73A 1DQ4A 2B4KA 5KR7A 3M3IA 4G3YC 3AP5A 1LOFC 4PDWA 3CZJA 4QPGB 4XUOA 4IDZA 4CDQA 4ASLA 2XLAA 2JDYA 1LENA 2D98A 3FE5A 4YVWA 4AQ6A 5A3TA 5FUPA 3WXPA 2HKXA 5BNNA 2ORXA 4RR3B 3I3MA 1COV2 3ZR5A 1W0OA 4L11A 1LB2A 3UNPA 1P8JA 4QPYA 3N9PA 4E4SA 2YUEA 4LBNA 5F8PA 2TNFA 1YFWA 4JC1A 4QQLA 3UKVA 1Q5OA 3B94A 2LW8A 4JGYC 4XFBA 4CDWA 4UW6A 4QQOA 1QJY1 3MLJA 2YXSA 4YW3A 1CAVB 4L99A 4ZS3A 4OQ8A 4CEWA 1O3TA 1RIRA 2OPKA 1LOGA 4AL9A 1OA4A 3C3VA 1MR5A 1QJZA 3IIIA 3PVEA 3H7YA 5KHKA 1A78A 4Y5TA 2VBDA 3A4UA 4Y1YA 2IXIA 2UY9A 4LULA 4GMP0 4UFHA 4G4FA 2LROA 1OURA 2RDQA 4QHOA 3RZZA 2VMHA 3IPVA 5C70A 4XZPA 3VBHC 3R05A 4LORA 2CGNA 4Q5OA 2DDUA 4HSJA 5FY0A 3FN9A 3GCWA 2VTXA 1QJY2 1VRH1 2VOWA 4LUMA 4UF0A 2D7FA 4Q4W3 4C8DA 1X9PA 3I2IA 5FYMA 4RQPB 1UYXA 1ND3C 1AR61 2OA2A 1LEMA 1O4ZA 1W8HA 3E5UA 1C8M3 3NWKA 2Y38A 4YZ4A 4JV4A 2A3YA 3WF4A 3OSDA 3K48A 2XVLA 1B09A 3MF9A 1DGWA 5A33A 3ZXFA 3B7MA 1UZ0A 3TWIA 1JI6A 1GFF2 3VD7A 1O4TA 3LA2A 4IEPA 3N36A 2W94A 1ONAA 2RDSA 4HSLA 1KFUL 2JDHA 1TEIA 3MW4A 4PT6A 5LY2A 3D82A 1Q8OA 1VRH2 3G7DA 4XF1A 1DYKA 5FPUA 2VCMA 4R9DA 1Z78A 2CAUA 4Y1XA 1AR62 2BVBA 4LBQD 3VDCA 1JOJA 4Z2AA 4JKKA 1WCUA 3LEIA 2J22A 4OHVA 3BTYA 4MXWB 2VNGA 1LJ7A 4S2GA 3FL7A 1OI6A 2YROA 3K4AA 4OZOA 4Z8BA 4HVQA 4L9BA 3RDIA 1PGL1 2DYCA 1COV3 5L9BA 5LK5A 4HZFA 5G05L 4CCJA 3I59A 2RDRA 5A7WA 1SLBA 4XJ9A 2UWBA 4XJUA 4IGOA 3D6EA 2FMDA 4AI2A 3R6SA 3VN4A 1AXKA 2YG0A 3B9IA 2R1BA 5K7PA 1XYPA 5DZFA 1JZ4A 1F4HA 1DGRN 4FPJA 4S2DA 2EXJA 2QZ2A 4A7YA 1ND2C 1UWWA 1S0GA 3O14A 4ZXEA 2CU5A 4GJYA 1R091 4AHZA 4IGPA 3AKSA 3ZKYA 1H6YA 1HIXA 1KITA 1QH7A 4G9SB 4JTOA 1VB4A 5DXDA 3ZO0B 2G19A 1PGL2 2WNEA 4IEZA 4KU7A 4XABA 3V0AB 4PQQA 4QPIA 4AI8A 1PVC1 3POFA 1LULA 4M4RA 4DY3A 1WMFA 1DIWA 3WX5A 2W68A 2WNUA 4AWDA 2MHFA 2P6CA 2ZABA 2OXBA 4FPHA 2WAOA 3ZR6A 3VBHB 1FNZA 1M4WA 3NV2A 4Q26A 5E89A 1ZRRA 1GWLA 2WSVA 1LAJA 2JWPA 5HCFA 2ZGTA 1R092 2QVSB 4L0PA 1HV0A 4ATFA 4FPOB 1DGRA 1Y9QA 2ET1A 4CU9A 3USUB 1PVXA 1R081 3KD4A 4PLMA 4BQ2A 2HBTA 2C9AA 3HEIA 3FJSA 4HETA 1GQGA 1LHWA 4IE7A 4B4PA 4EJRA 1YIFA 2G1MA 1N47A 1PVC2 4WM7A 3VUOA 4PIXA 2O0OA 2A1XA 3LPFA 1S0DA 2I74A 3GNEA 5F3GA 1D4VB 4YVSA 1W9FA 4CTEA 5L9VA 5KXDA 1XOYA 5CFDA 3B69A 5FZCA 1VRH3 4DUWA 5LBCA 3W9AA 3N7JA 4D7SA 1FX5A 3VBUC 1CONA 4RGGA 1AR63 4WM8C 2J1AA 4LLOA 3WQ1A 5I0TA 1XPWA 1W2AX 4FQZA 4LQRA 1W6OB 1D7PM 3AP6A 1VBD1 4S2FA 5IAVA 3V0BB 2Y6FA 1R082 1Y9MA 4F3JA 5HCAA 4KGQA 4FVVA 3SC7X 4A2UA 1HB3A 4YG0A 3KV5A 4YGBA 3LA3A 2A7AA 1MS4A 3U75A 1JYNA 1O3QA 2DUOA 2PAEA 4CU6A 5FCCA 1T6BX 2QQJA 4EN8B 3U10A 1OH3A 1NY71 1DZQA 2YBKA 3O7OA 3I2FA 4NN0A 4HT1T 4Q2FA 3KGLA 4Z92B 1KJLA 1ZZBA 1W2NA 4O65A 3CJIB 3ZXJA 3KCYA 5FZAA 2ZGUA 1CAWB 2GMPA 3T2QA 3WDYA 3WQ0A 1WWYA 4XBQA 5JOZA 1HKDA 3DV8A 1F31A 3PVNA 2NMNA 3ALQA 1DU3D 1VBD2 3KCCA 3WP3A 1D2QA 3KV4A 1AXZA 3O1SA 1ND2B 1UX6A 1IHMA 1VMHA 3VLBB 4BQ5A 1SCRA 2WWJA 2ZX0A 3RFRA 3JXSA 1MQTC 4M4PA 2DVDA 4GIQA 2MEV1 4UW5A 3FFZA 2EF6A 1RB8G 1UY2A 2W1SA 3LAGA 1NY72 1PNGA 1T2XA 3MUZ1 5FZ9A 3M3OA 1RUOA 4URAA 3TEXA 5CKQA 3O1PA 4AW7A 4X6RB 3NKTA 4B7KA 1QJU1 1HDKA 1R093 1TG7A 3QD6A 4PJYA 5FZEA 3ZYBA 4CEYC 1GNHA 1HN1A 2W1UA 1NAEA 2EICA 4LO6B 1YJLA 4CDUC 4EYUA 1JODA 3T0BA 2QQLA 5HBAA 4IETA 3HVDA 1CR7A 2MEV2 4Y24A 2G4IA 3PTYA 1VIWB 3I2DA 3THDA 4C90A 2D6PA 4K20A 4Y1VA 4XCBA 4PIYA 5I8TA 5GZFA 1PGW1 3DYPA 3IDAA 1FPN1 1OVSA 3EBRA 2JG8A 3DN7A 1QJU2 2AH2A 2EALA 2ZGKA 4BPZA 4W65A 1PO11 3ZYIB 4OI1A 3GDBA 1AX1A 1CQ9A 2VO5A 3HAGA 1R083 4J25A 3OPTA 5JR7B 1LHOA 5HXVA 1PIV1 1FOD1 2XUEA 4YW1A 3H1YA 4AHYA 4MGZE 2VUCA 4RL7A 3ZFFB 1QQP3 3G6JB 5FZIA 3VGIA 5T55A 1SDWA 5LA0A 4AGRA 4BQYA 3C7OA 5FY9A 1PGW2 1NCQC 1RVF3 2P5BA 3O0XA 5GLUA 2KXLA 1QXJA 3O5SA 3RWNA 1XU2A 1XNKA 4JQRA 4MXVA 4XQWA 5FJKA 2WO7A 4MGSA 2YMZA 4ONUA 1PO12 1C1LA 1NCRC 3LDRA 4ZXKA 1VBD3 2WJSA 2ZZQA 1BQPA 2I07B 1GR3A 1PIV2 1DCSA 2JECA 1FOD2 3WQ7A 3E1F1 5DUVA 3WNKA 1O3SA 2YGLA 1LODA 4O9EA 2WZR3 4N43A 4MLOA 4D0QA 1IG3A 3KT7A 4JHZA 4FPCA 1MQTB 4YZ3A 3AYCA 3OUIA 5FREA 2GP5A 1KGYA 4LOSA 1L7RA 4HVOA 3VBOA 4AQSA 2ATFA 1NE4A 1ZBE1 1TE1B 3T0DA 4BQ1A 3AP9A 5FZKA 2OKXA 1IOAA 4UFJA 2XHKA 4OQ9A 4HPKA 3OGRA 2C5DA 4QMAA 3AMNA 2E53A 4LBOA 1DFQA 5C9AB 3VBFB 2R6QA 1YO8A 3QBQA 4LK6A 4CEYB 1BZWA 2MEV3 2O8QA 4IV3C 4QXCA 4CDUB 2YC0A 3ZFGA 4A7KA 2GC1A 4NVPA 1YI9A 3ETPA 5BNPB 2RVAA 4R4ZA 2KD7A 5A32A 5C3QA 5JDBA 4FTSA 3VD9A 1GP6A 5EJZB 3FLRA 4DXRA 1D4M3 5JCTA 4XHXA 3RZKA 1TME1 2VXJA 1QJU3 3NO8A 1QKQA 1ZBE2 1OVPA 1W0PA 5JLVA 4XUQA 5AVAA 2Q1ZB 5J96B 3KMHA 2BQPA 1U5XA 4AF9A 2WNVC 2W87A 4FFHA 4K8FA 2ZGMA 3L9JT 3SHRA 3VKOA 4XAEA 4QX8A 5H9QA 2ARAA 1ACCA 2W9XA 3A23A 2W46A 3JZVA 4J1WA 4EWAA 2OZJA 5JXHA 4QXHA 3WCRA 4LHLA 3INAA 1GKBA 4BQWA 1ZZ9A 5GALA 3C7FA 3H8OA 5C33A 3UGFA 1W8FA 1FPN3 1YIPA 2V4VA 5J09A 1BK0A 3WUCA 5FPVA 3LSDA 4NWVA 1NCQB 1PO13 1SG3A 3E5XA 3LDKA 2J1VA 5F3EA 5TSWA 4ZZ8A 1IGOA 5K0UB 5FZ1A 4CXYA 1W9SA 3K75B 1H1AA 5BNOA 2Q5TA 1PIV3 1ZBA1 4BA6A 1Q8PA 1FOD3 1NCRB 2ZXQA 4XBNA 2W2IA 1SFYA 2ZGSA 2RG4A 3TOJA 4CP9B 2J7MA 1AYM1 1MACA 3PHMA 1O8PA 2WQ8A 2JDAA 2EXHA 1DP0A 1ZNPA 5DAQA 2PFWA 3Q8EA 5FZOA 3SMHA 3THTA 4GH4A 1CVNA 1NX9A 1GP5A 1AR71 1QOOA 1PMHX 2HYXA 4IEUA 2BBAA 3CMGA 5FV3A 2JENA 3IKWA 4CP2A 5HXMA 3WNXA 2ZA9A 4Y4YA 4KG8A 3VZNA 1ZBA2 1UY1A 2K46A 4GULA 4Q0PA 2F4LA 4YW5A 1OKQA 2R49A 1AYM2 2W52A 2ERFA 2WFF1 1GU3A 4CPBD 2P3IA 1QMJA 1OH4A 5JXIA 4XIKA 4DEVA 4AI0A 3BOPA 4IV3B 3N3HA 3RGBA 3T30A 2BNMA 3DEMA 4H3WA 4IV1C 4F8AA 1AR72 5G04L 5L7OC 1AUYA 1OC1A 1HJGA 2VGDA 5IUQA 4Y3OA 2DFBA 1ZBE3 3M3CA 3VBSB 5IVEA 1ULDA 4X8NA 4E4HA 3A7QA 1RUG1 1GICA 1ZM1A 4BK5A 4K40A 2VM9A 3F2ZA 2VXRA 3ZFEC 1YFUA 5ACA1 5LATA 1UZWA 1BJQA 1GZCA 3RNSA 1RUD1 3ASIA 3H7JA 3I2KA 1WCDJ 3E6DA 1V6NA 2WFF2 3FHQA 5F2SA 1WD4A 2DTYA 4F83A 4FPKA 1RUI3 4BISA 2LUWA 1OOPC 2Y6GA 1NA1C 4Q0SA 4DXSA 2YHJA 2ZHMA 3D4KA 3WY6A 1ZZ6A 2HBUA 4N7UA 1AJOA 4W4ZA 1RUC1 2L9LA 1TME3 4RFT0 2BERA 4XURA 2WT0A 1RUJ1 2I2SA 1CZSA 1RUG2 1I9RA 4TZDA 3RZLA 2RS11 1H4HA 1UY3A 4GD4A 1UMHA 1YQ2A 3JCIA 5ACA2 1SPPA 4IE6A 1RUD2 2TEPA 5E88A 2C1FA 2OIIA 1BYHA 2VUDA 2YBSA 5JR2A 1R1A1 4QX2A 5KHGA 1GUIA 4NIAA 3T08A 5LB6A 1SQ4A 3K77A 5EQUA 4LR4A 3AB0A 2OS2A 4NAOA 2RV9A 5CB7A 1Y9GA 4KH9A 5C7GA 2GNMA 1JYWA 1NOVA 1RUC2 3AKRA 1L7LA 1JYVA 1QNWA 3CZUA 3DXUA 4LKSA 1RUJ2 1ZVFA 2BOIA 2Z4FA 1C57A 1OFNA 3DPRC 2RS12 3P3PA 3VZMA 1CX1A 3SEPA 4N9IA 4YRDA 1A3KA 2JEMA 3AYEA 4FI9A 1ZBA3 1BKZA 4BYYA 4XJWA 1O4YA 3NJXA 1URXA 1R1A2 5D21A 3U07A 1AYM3 3DUIA 4JQTA 3IDCB 3UJOA 4D7TA 3H8RA 3PUIA 1UKGA 4QB1A 1HXS1 2DBIA 3ELNA 1NXD1 3I3BA 4N53C 2XB6C 4UOJA 4Y4RA 3W20A 4BIOA 2VY0A 1BXHA 1AR73 2VMGA 1W3VA 5FWJA 2ZKNA 5BNQA 2PHWA 2VZSA 4CUCA 1AHSA 2IFRA 1LTEA 4IV1B 4NHYA 5L7OB 1JTZX 3OPZA 3PUAA 4LLFA 4P9LA 3OD4A 1VBC1 2XJTA 2RS31 3OOXA 4NRMA 5JPMB 2AENA 3OB8A 1XXNA 1W6QA 3LFIA 2C26A 1K5MA 3QLQA 4OUSA 1ULCA 2DVAA 1WLWA 4AR2A 3B9CA 1CESA 2H0BA 2WFF3 4NHMA 5CVRA 5FKBA 4FFGA 1HXS2 5T52A 4K1YA 4ITCA 4MYEA 5H9SA 1HB2A 4QQHA 5FY5A 5F39A 3MPPG 5IK5A 3NJVA 4ZS2A 3RPQA 4QXBA 4DUXA 2J1RA 5FR3A 4LHNA 1NA1B 2SLIA 5FPXA 1LOAA 2CTVA 5FMBA 4P9XA 1UPIA 4BIFA 5BNNC 5I0DA 4RYDA 5C8CA 4W8JA 1RXGA 4TXWA 1VBC2 2W92A 3S7EA 4JDMA 2RS32 5ACA3 1KQRA 3R0RA 5IK7A 4JX0A 3MHZA 3MIDA 1N1YA 3RZGA 4IQPA 2ZX2A 3GHMA 4RS5C 1V6LA 4I01A 5FJHA 4B3NA 1J3QA 2Z42A 1ZRDA 3H0OA 2ZS6B 1W2OA 3C7HA 3ZDSA 4UBGA 1TZOA 1H8TA 2ZPXA 4CEWC 3JD73 2WO1A 2OVUA 1G9DA 2ENRA 3U11A 3ZYPA 3ZSLA 2BUKA 3ZN6B 2WZPP 1RUJ3 2YC4A 3LB9A 2A73B 4PBPA 4CCMA 2A6VA 5DDJ1 1UYPA 2HWD3 2RS13 5FK7A 4OUEA 1B35A 5BPXA 4ES8A 5KHIA 1OA2A 4QPGC 2Y6LA 4AQ2A 1R1A3 4XJAA 3HN3A 3WG2A 3BKZA 1EYBA 2R0FA 5JMOA 5DMYA 2J1UA 1RMU1 2ZMLA 3O0VA 3WW1A 3LOIA 2WO3A 3FHAA 4RR3C 2PQSA 1CGPA 4XILA 4P14A 4NHXA 4PHZA 5A3UA 3DL3A 4URTA 3HOBA 4ZZ5A 1YUDA 4N53B 4N7IA 1DF0A 1UU6A 4YZ2A 4NO4A 5DDJ2 2WWUA 5JXGA 5DAPA 1LOCA 2D3SA 2F17A 1RYYA 1H2NA 3IMMA 4ARXA 3GZTB 3ZPYA 5FO8B 3LD8A 4JDNA 3FLTA 5A3WA 3SCGA 1VBB1 2C24A 2JE7A 4LITA 3ZOIA 1YJKA 5FZ8A 5D8AB 1A8DA 4XUPA 1VMFA 4NPMA 5CEHA 5JZGA 1W6NA 2A5ZA 3W5MA 2CHHA 4IEXA 1HXS3 1RMU2 3NNGA 1YFXA 1BK1A 3AM2A 1IQAA 2XVKA 4C1WA 4GZ9A 1WLCA 5FBJA 1PZ9A 4E9KA 4HG6B 1XSRA 5ABJB 1GZWB 3FUOA 1SLLA 4YG6A 4Q0QA 4B1LA 4NJ4A 3I3DA 5CISA 2VG9A 2A3WA 4AYUA 2BDRA 4CCLA 1UF2C 1KXGA 1VBB2 2DBNA 3SH3A 4OI4A 4RQPC 5BNNB 4CUGA 3ACLA 3W5NA 2ZOEB 1E5IA 2H6BA 2A75A 4A7ZA 4I0BA 4ZKTB 1W0NA 4YLZA 4GALA 2DVBA 3KS7A 3B3QE 4OI2A 5DUXA 5DABA 3ZXEA 4EN0A 5F1RA 1JXNA 1W8TA 4QX5A 4CDWB 5HV0A 1M06G 1O3RA 1DLCA 3FFQA 4B8EA 5IFTA 2PHLA 2GNTA 1UYZA 1IZ3A 4FPLA 1R64A 3D0SA 5FP3A 5FZLA 2Q8CA 2DCZA 4YW2A 4CCKA 2VOVA 4BXSV 4PQ9A 4Q0UA 1JHJA 4MGQA 1C4RA 4QPIC 2AC1A 3AL5A 2R041 4RSUA 4OMCA 4XE9A 5HV4A 1W3XA 1XB9A 2D43A 4IERA 5L19A 1O59A 1IS6A 4LK7A 5F5CA 3BIEA 2B9UA 1F4AA 3IPVB 3MLKA 4I02A 4HONA 4BQ4A 1F9KA 1UL9A 4XUNA 3BTXA 2WUHA 1Q8QA 1ENXA 1GOGA 3MIHA 3PNAA 4UF0B 5GLTA 4CDXA 1BBT1 3JQXA 4JZRA 2XG3A 5BUVA 1US3A 4X8PA 4FOQA 5DDJ3 4DRVA 5DAWA 5APAA 5FLIA 3V65A 1IKQA 2R042 3FC0A 2D6MA 2XKOA 4EN7B 4I30A 5DQ0A 3I3QA 3RYPA 3EYPA 5A33B 4OHXA 5FUNA 1UMIA 2W1QA 1OXCA 3A21A 2JE9A 3OJBA 4LBJA 5CFDC 2CSGA 2AEYA 3JB8A 3HBZA 2A6WA 1GYKA 2GSYA 1Q3EA 2D6LX 2DV9A 4Q0VA 1RMU3 1S0EA 4CXWA 4FTEA 4LT5A 5I0RA 3TYJA 3BODA 2LTNA 4I3PA 2PHXA 1CJPA 1DHKB 2EIGA 3GJBA 1CAUA 1W6MB 4K1ZA 3BUCA 5CFCA 1BBT2 2CWSA 1HB4A 4XTPA 1CIWA 4NIHA 4XPVA 1E5SA 4XF0A 5FDBA 2R32A 1QDOA 4QAWA 1K42A 2DFCA 1YWKA 4KI5M 2EXKA 1JZ8A 3KM5A 3WW2A 1F5FA 1KS4A 1VBB3 3CU7A 2TUNA 1V6IA 5FZDA 4NMIA 3PURA 1LNSA 4GKXA 1HW5A 3KV6A 4BQXA 2DURA 1VAKA 2BWCA 2DWRA 1BLZA 1RJ8A 1K3IA 3I59B 3NAPA 1U0AA 4P9WA 5A7WB 3WG4A 5KXBA 1UNBA 5LW9A 2VVEA 4FBFA 2JD4A 4NROA 3KQRA 3J8F1 2A6YA 4OULA 1C28A 2J1TA 1XQNA 3RZJA 2MPFA 1JUIA 4A41A 3AJZA 1UIKA 1WBFA 1YNAA 1AL0G 5DUUA 2Z2SB 5HI0A 4I0WB 4V1PA 4O9GA 2FZ2A 3OBZA 3VBRA 3NV3A 1UMZA 4QPIB 1KDKA 3ES4A 2Q8EA 4FTBA 2VAUA 3AFGA 1ENQA 4I2OA 1GOHA 3SKVA 2GP3A 2WNUB 4NHLA 2NPIA 3B00A 4GKYA 5JOWA 3H1MA 5C4WC 3VDDA 2VOTA 4Q8LA 3J8F2 4AEMA 2ILMA 5F7UA 5GLZA 1QIQA 3NV4A 4Y5SA 4UFKA 3EB7A 3T4HB 4ZU4A 3HT2A 1YC61 1SZBA 2R043 3CJIC 4DIQA 2UY8A 2VCCA 4P9YA 3OG2A 4FPYA 4JHTA 3S57A 1W8WA 2JG9C 3ME2A 4KBBA 1RHI1 3WNPA 1PM7A 4QKFA 5F5IA 4FCAA 1TNRA 4WM7B 5LRRA 1N3OA 4AEDA 3BU0A 3N9NA 4E2QA 2QZ3A 1S55A 1V70A 2W5FA 5FXVA 1UXZA 2E31A 4YVSB 1VB2A 1K12A 1X8MA 3A0NA 4PLOA 2WC2A 5CFDB 2XONA 4JGZA 1HRV3 2GAUA 4FXKB 1MEC1 3IB3A 1BBT3 4PI2A 2Q30A 1STMA 2Q8OA 5JXJA 3VZKA 4CCCA 5ISLA 4TLFA 4GWMA 2JX9A 5A7SA 1VBE1 2CNAA 1ZA4A 1S0IA 1MS8A 4GWJA 3KF3A 1HLCA 1RHI2 2VW2A 3M1HA 3U37A 4DZGA 4Q27A 3ZSKA 5I0UA 3THCA 4A42A 4BWOA 3AP4A 4HKWA 3PIGA 1I6XA 3ZDVA 5T50A 2K0GA 2P3JA 3CQOA 1UYYA 3CF6E 2IZWA 2P2KA 1MEC2 5FPLA 4Y1ZA 1QDCA 4LBMA 3NJYA 4ZY9A 5LCWL 3ZSMA 1GZ9A 2JXAA 2AR6A 2I45A 1QWRA 1LU1A 1W2TA 1VLNA 3A22A 2VOXA 5FZHA 1VBE2 4Y5Z0 1L3JA 1HV1A 4MV2A 1QQP1 4CZSA 4QDSA 3OGVA 3ZYRA 2E7TA 1UU5A 3O1VA 3I2HA 4WVWA 1RVF1 1RUF3 1BHGA 4XQDA 1LOFA 4CP1A 1H4GA 2FMYA 3SEEA 2HWF3 3QH6A 1OD3A 3ZMOA 1QJEA 5I8SA 3J8F3 2PTMA 4O61A 2Y33A 1DYOA 3ZFFC 2WYSA 2VR4A 2RJ2A 2VH9A 4LO8A 4RFRB 4FO9A 3HNYM 3MW2A 3WDVA 2P4EA 2W95A 3TBDA 5C4WB 2CWMA 1V9U1 2WZR1 2DTWA 5SV5A 5T5JA 4BE3A 4R9CA 1QQP2 2ZEWA 4EZ4A 1Q8SA 3ZLIA 4JGYA 1OLMA 1NUKA 1OLRA 3W59A 2WO2A 3K3NA 5C3RA 3ZYHA 5FY8A 1RVF2 5E16A 2OX0A 4INDA 3POIA 1KD7A 3MUY1 3N9MA 3ZYFA 3MPBA 2JG9B 1POV1 3UYJA 3ZXAC 3OPWA 3V0AA 1AX0A 2OQ6A 2PHDA 3ACFA 2P17A 2JG8B 1Q8VA 5J48A 1C1FA 1H2LA 1JU4A 1W2UA 2Y64A 1Z0HA 4KQ7A 1QEXA 3JBG1 4XFHA 3WDTA 2WZR2 1V9U2 3VBHA 5E6HA 2VCAA 4UFMA 3VDAA 3N7KA 1PZ8A 1RHI3 2CY6A 2DUQA 1PX4A 1OQ1A 4XYXA 3UT0A 2V4AA 2NLRA 2R0HA 3AVSA 1ND3A 2JIJA 1LRHA 1OLME 4Q8KA 1S2KA 1LCLA 3F95A 1D4M1 3UETA 4E4ZA 5C9AC 2BGCA 1J58A 3P6BA 1JZ6A 3IMNA 3VBFC 4KMQA 1MEC3 4CSWA 3N4MA 3M70A 2QQUA 2WZEA 1CAXA 2GMMA 4AVSA 4KBZA 3JBG2 5BNPC 2XXZA 1VJ2A 3AKPA 3MIBA 4AXOA 1VBE3 4LO7A 3AMQA 3FBYA 4FPGA 3VKMA 4WVZA 5CU1A 3URFA 5SV8A 2EIBA 4U2AA 1IS4A 2K2SA 1AXYA 4AFMA 3PMSA 1EUUA 5DG1A 2NN8A 4GH4C 5C3OA 3ILNA 5AFEA 3UV9A 1D4M2 1DZTA 1MZ5A 2LM3A 3POGA 2ZBJA 2UWAA 4H14A 5EIYB 4XIOA 4BHPA 1Y3TA 2E7QA 2PHTA 1AZDA 4IEOA 3VBOB 1OLQA 1OPMA 3OGGA 4DNYA 3OEAA 4EWEA 2GC0A 3OYWA 2D6OX 3VZLA 2D5HA 4LUKA 1UOJA 1YLLA 4PIZA 2WFPA 2ZGQA 4ISRA 1BVVA 2QQMA 1ST8A 4HPKB 4Z2WA 4QGLA 3TEYA 4HXCA 4RD7A 3PUHA 2XL7A 5FXZA 4DPNA 1V6JA 5JPNB 4JVAA 1FPN2 4PBOA 5IHRA 4QX3A 4EROA 5K0UC 1E5RA 3ZFGB 5A6QA 4ZU5A 3WV6A 2EA7A 4Y22A 4C0HA 2XJUA 5FTTC 4M3CF 1DQ5A 5JSRA 1QHDA 1SCSA 4IUGA 4LE3A 4WVMA 4YYOA 3RYKA 3IZOA 4COVA 1EP0A 1W05A 4QWNA 1JMUB 4V2VA 3PDQA 3IAPA 3ZM8A 1ALYA 1V0AA 4KU8A 1JYCA 3JUUA 1V9U3 2YB7A 3O1OA 1W28A 1WA4A 3LDBA 5KXCA 4AFBA 4B4QA 2XJPA 2BEOA 1Q56A 3K4DA 2FDKA 2DCKA 2XOMA 1POV3 4META 4QQPA 4QX7A 2EAAA 4WZFA 4EV0A 3GYDA 2PYTA 4AGVA 3WUDA 4QB6A 4EN6B 5FP7A 5C3PA 1LGNA 3LE0A 2PHRA 2EVXA 1LECA 4CE8A 2JE8A 4QHBA 2GH2A 5DPNA 1SMVA 3JBG3 4DOUA 5A6XA 5LY1A 4LO5B 2CDOA 1Y4WA 1WMEA 4FQ4A 1FV3A 2R071 5A7PA 5JI7A 5KXEA 5EXOA 1RUI1 5FLJA 2BNNA 2WL1A 3ZIWA 1XYNA 3U1XA 4Q4V1 4HVRA 4LIVA 4COUA 2AEZA 3VBUA 2C6SA 3DGTA 3MV01 3VBSC 4EZHA 1OSGA 4WM8A 5KBFA 4BU2A 1J1LA 2XJQA 4KG0A 3B5LB 1OFSA 4LKEA 2JDKA 1Y43B 2ZAAA 3WNMA 3ZX7A 4LIUA 4OLLA 3RRDA 4GH4B 2V09A 4NRQA 5CNAA 5CADA 4QT6A 2BWAA 3QACA 4XFCA 5D2AA 1G9BA 4P9IA 4BB3A 4LBKA 5A3LA 2VNOA 4XMAA 2R072 3RZHA 4NUBA 3D0JA 5IW0A 1RUI2 3LEGA 3LQCA 5C6CA 2ZEZA 4GB31 4Q4V2 5F3IA 5FOJB 1DG6A 3KHCA 3WG1A 3AL6A 2BBVA 5KWRA 4DXTA 3WR0A 4K7JA 3PU8A 4H55A 2VBPA 2XDVA 5K8SA 1TME2 4XOGA 2EIEA 5LBEA 5T3NA 3NNJA 3RWKX 3SKJE 3U4SA 1LHUA 4XF4A 1HQNA 1FI2A 4D8MA 5IVFA 3OY8A 5LA1A 1NLSA 2O1QA 3ST7A 1DGLA 1RTVA 1MQTA 2X09A 2XJSA 3ITQA 3N9LA 4Y1UA 3R4UA 1QGLA 3U14A 4IL7A 3AXDA 4XXAA 5A80A 4GB32 4NPLA 3AYDA 5LASA 5IVBA 4IGQA 1A8MA 1VBA3 5T5LA 3RI8A 1BMV1 5CZKA 1S0BA 4LOTA 2Y60A 2A71A 1XE8A 3FX3A 1SHWB 2BVVA 5H9PA 4CEYA 4IE0A 2ID4A 3LCPA 4M0HA 5F2WA 3WW3A 1C8NA 4CDUA 5LK7B 5K4LA 5GM0A 3RYRA 5C8CC 5A3OA 1WW5A 2X53S 5CG8A 3WDWA 1POV0 4DS0A 4YZ1A 4E27A 5IATA 2W1WA 3D5OA 3ACIA 3U0ZA 1PK6C 2YV8A 2Y8KA 2W39A 4M0NA 2KA3A 3POYA 4P5YA 3S30A 4YM3A 3HWJA 3T2OA 1WCQA 2XR4A 2WT2A 4QXKA 1AR81 4DMIA 3S0MA 5EJ3A 4XJZA 4IESA 4P9GA 1BMV2 4XVHA 3PJQA 3I2OA 3KVBA 1WBLA 2XGXA 4R4XA 4AVCA 1X82A 5FFOC 3EQEA 5C71A 3LIHA 4OVEA 4AAPA 2E51A 1FXZA 1JHNA 4JAAA 1EPWA 3S5QA 2WT1A 4KWLA 5CAZA 1S2BA 1B35C 4UAPA 3WZ1A 3NNFA 2R073 4BM8A 2NM1A 2W08A 4Q4V3 1AR82 2P37A 2VZ1A 1OKOA 2ZHNA 2PXJA 3I7DA 3L2HA 2DVGA 4FOYA 3MF6A 2XHNA 2GDFA 3JD71 4S2HA 1JYXA 2X5IA 1G9AA 1W06A 3NMBA 2H0VA 3Q8FA 3PLQA 3R4SA 4FPEA 4PLNA 1C5IA 2HWD1 2ZGLA 3J4UH 4RA0A 3BGAA 4OYUA 4B29A 1CPNA 4QB2A 1ENSA 1DDLA 3OF1A 4FOVA 1X7NA 4KNCA 1NT0A 1RUE3 2QNKA 5JZGC 3O12A 1XE7A 2WLPA 3SNMA 4GB33 3C2UA 2OT7A 3E6BA 4W6YA 1W6QB 1X33A 4XHBA 1K5MB 3JD72 5DN2A 4YGCA 3RJ2X 4WBBA 3VHOA 3WCSA 2JDPA 3ZXDA 4ASKA 1W04A 5LRSA 2FCVA 2VW1A 4E4DX 1KRIA 5FQ0A 3SQOA 2FQPA 5FZ7A 4IEQA 2Q4SA 1UCXA 1SLCA 5F5QA 4BXFA 1N1VA 2DCYA 3D3AA 2HWD2 4YGEA 1A34A 1O5UA 1WLDA 2B45X 1H1MA 3CO2A 3J7LA 2B42B 3POBA 3I3EA 1XNDA 4ISQA 1EUTA 1RUH1 3IBMA 1X8EA 3P5BA 1S2EA 5EFUA 3VZOA 4IV3A 3WNNA 4BJ0A 3LOBA 2VQ0A 3KT1A 2LRPA 4QM9A 5C8CB 2Y0IA 1DQ1A 1GQHA 5FZ0A 2OZ6A 3QH7A 4FP3A 3WLUA 1XU1A 1LKNA 3LSEA 2ARXA 1H30A 1SACA 4DINB 4LO4B 3RVHA 1PK6B 3TAYA 4OFGA 1H8VA 3T3YA 1JBCA 5LBFA 3CNAA 3TN93 4MX3A 2QQIA 5EV7A 3ECQA 1VMJA 1H8TB 3POSA 4YARA 5I8YA 2VZRA 2WNVA 3M4FA 2XKPA 5D8AC 4MG2A 1UKRA 2ZX4A 1RUH2 4FXGB 4MH0E 4PI0A 4AEJA 3MICA 3ON7A 1LESA 4U36A 3P1IA 2W91A 3AX4A 1SFNA 4GA9A 5FYBA 1PZ7A 2VL4A 2XUMA 1QXRA 4P5HA 5ABJC 2BRTA 2IXKA 1B35B 5F9TA 3HNBM 1AR83 4UFIA 2HLEA 4PDWC 4KWUA 1ULFA 4KWKA 4XFIA 4CDQC 2AZ5A 2QKDA 5FIXA 2QFEA 5C5TA 5AFBA 1W8OA 2XQRA 4XAAA 2B7YA 4YVWC 1FYUA 5IVYA 4H7MA 2WINB 3M8LA 4IEVA 4LE4A 4XCAA 5A6ZA 4SLIA 5JI9A 2BP6A 3E6CC 4YM1A 2ZMKA 2ZMNA 2F4PA 1YQ5A 5A6YA 5GZCA 1W8UA 2UU8A 4CUAA 5JUVA 2YC2A 5FZBA 2Q8DA 2XPJA 2D44A 1I1EA 4M3CA 4CDWC 5IVJA 1V6MA 4N8MA 1UZZA 2YBPA 5CIRA 1PNFA 3CLPA 2GNBA 2XL9A 2BGOA 2ZX3A 4GJZA 4QGMA 5FZ3A 2FHRA 4Y20B 5JZGB 4UW3A 3I97A 3C7EA 2UYAA 4AI9A 4L8QA 2VE1A 1MS1A 3C7GA 5FYVA 1O6UA 4CCEA 4CP0A 1XNAA 2BZDA 4NIGA 3VD5A 4QD2A 3KWVA 5T5OA 2CGOA 5FRAA 2F6BA 1VPHA 2FDFA 2EXIA 3ILRA 1LGCA 1QU0A 4N9HA 1US2A 1YEWA 2VZVA 2JB4A 3OTFA 4QKBA 3EO6A 2GN3A 5FZMA 1HX6A 2WDBA 3IT8A 1ENRA 1DZRA 4E8DA 4RHV1 3N7MA 4LMFA 1UIJA 4IV1A 1ZREA 4JTNA 2GNDA 2VQUA 4XBLA 4ZONA 2C9KA 3I2GA 4M3CE 4AI1A 2JKXA 3JB4C 3WF2A 2G9FA 4C0BA 4LPLA 4JCKA 4A44A 1NYWA 3CKHA 1W03A 3NQHA 4OHYA 4LXLA 1L7QA 4XEZA 5FWEA 3ZFEA 1AJKA 1WW4A 2P34A 4K6BA 1SLTA 3RG0A 3RMYA 3UGGA 4CCNA 4MGTA 1REFA 3I2JA 5DG2A 1GQPA 3VHRA 1REEA 1RUH3 3M3QA 1UD1A 3I8TA 5FPBA 3ZPOA 3VD3A 4UFLA 1GWMA 5FXWA 3K2OA 3T0AA 3VBRC 1OOPA 5FAXA 3KQ4B 4RHV2 1H0BA 2PHUA 4YM2A 1OBNA 1G8WA 3SCHA 4F7ZA 3AP7A 3APBA 3QCWA 3AZXA 4IEYA 3N9OA 4AQTA 4PDWB 1QH6A 3H8XA 3H1WA 4CDQB 3UKTA 3GBGA 3WG3A 1WW6A 4B4RA 4QGNA 4CDXB 4YVWB 3VHPA 3TNPB 3VL8A 2PN5A 2QQKA 3AJYA 1A6CA 1LOBA 2VQAA 3OGJA 4NR1A 3T1LA 1WD3A 1GNZA 4XXPA 3T2PA 5F3CA 2Y6HA 5LEJA 1XNTA 1VR3A 4LKFA 4XC9A 1NXMA 3VHNA 2D5FA 3VL9A 1EPZA 3HPNA 2WR9A 3DPRA 1R1ZA 5FYIA 1ASJ3 1VP6A 5FP8A 2ZJCA 2J1SA 2AACA 5LZ6A 4FP2A 2LALA 1CAUB 1JS9A 1RJ7A 4NE9A 4JDOA 5H9RA 5CFCB 3GM8A 1NQDA 2IVJA 3DXTA 1HB1A 2PMWB 2VOKA 2WNUC 3A0KA 1CX4A 3AK0A 4XFGA 3W21A 3K51A 4N53A 4AFDA 2QJVA 1N3QA 4NWWA 2WKKA 1KJRA 1W8NA 1HRV1 4ATEA 1AYN3 2HWC1 4A6OA 1JH5A 3NAPB 4NHKA 3UJQA 1JZ3A 3Q8BA 4LBQA 1F2NA 2QQOA 2P6HA 3H42B 4CXXA 4LBLA 4WM7C 1FT9A 1SDDB 2VC9A 1G9FA 3FZ3A 4Z1VA 3ZSJA 2RMU1 1XC6A 2SBAA 1GLHA 3FUQA 3JU9A 4QPWA 5D1IA 1RGSA 1FNYA 1CPMA 4M01A 4YVSC 4XFAA 5CG9A 3KB5A 4R9BA 5LA2A 1NQJA 1W99A 2BNOA 3NNMA 4RHV3 1O91A 4I09A 4QU2A 3ZYJB 1OMIA 4FAGA 1UN1A 5A7NA 5J1XA 2VMEA 5JSOA 1V00A 3T2TA 4MO3M 4EQVA 5BY5A 1HRV2 3VBRB 4UBHA 3WNOA 3J7HA 1N1TA 1I3HA 1W6PA 2HWC2 2RS51 3MFCA 4J1XA 4Y33A 2GALA 5EWSA 3WP5A 4D7YA 1JZ5A 4TYSA 2VUJA 4MVTA 3AFKA 2RM23 2XQXA 4MUVA 3UKNA 3SITA 3ZMNA 1UZVA 3EHKA 3ABZA 3J9SA 2NP0A 3VDDB 3RI9A 3K3OA 2RMU2 5IJRA 1J1TA 1E57A 3P3NA 4RS5A 3ZVXA 4PF1A 3VKLA 3TRSB 3O1RA 5CBLA 1JZ7A 1UZYA 1RUF1 3NNLA 3E5QA 1S0CA 4AVAA 3LEKA 2DCTA 2YFUA 3MZHA 2HWF1 2QBXA 2E6VA 1GZTA 2PQQA 1AF9A 2IWGB 2RS52 3H3LA 1RL3A 3AC0A 3N9QA 4AAXA 4AEDB 1O5LA 4ASMB 3Q8AA 2E63A 4HKLA 1S0FA 4AVVA 5JOYA 2WA3A 2DCJA 2HWE1 4JGZB 1J84A 4DB5A 1VALA 1HN0A 3CBNA 3FWEA 3IDBB 4QPGA 4MHUA 3AZWA 4CYDA 1EY2A 1AX2A 2XJRA 5IK4A 1G6NA 2CV6A 5FY7A 4BK4A 1RUF2 2HEWF 3I54A 4XDOA 2Z5WA 2IXLA 1YQ8A 4DQAA 2V73A 2HWF2 4RR3A 2CGPA 2WWSA 3HD8B 3RQ0A 4HN1A 1JZ2A 2QQPA 3KV9A 4UI9L 2GMEA 1ZRFA 2WN3A 3IIAA 3GHNA 5I91A 2HWE2 1CAVA 3KLSA 3LFMA 5EP9A 4D94A 1AL21 2IFWA 5JMCA 4KGGA 3LPGA 1W6MA 4LEJA 2CDPA 2O8OA 2G9ZA 4JKLA 2CAVA 3Q9OA 3POJA 3VB9A 5CYYA 2WS91 2FDGA 1NLRA 1LHNA 2JG8C 5IVCA 3AMMA 2WRAA 5FMOL 4R8HA 2Z79A 3GJAA 2XLFA 1I5ZA 3JQWA 2D97A 3K46A 4LHKA 2HWC3 4NAMA 4AEKA 4LNVA 4TLGA 4LA3A 2VQTA 2VZUA 4FOWA 1WCSA 2JDNA 3UGHA 3USSA 1Z7S1 4FFIA 2WBKA 1IPSA 5GKAC 1AL22 3KT4A 4RQPA 4AK3A 1HRI1 2RMU3 4MHRA 4OHZA 1WMXA 4Z82A 1UXXX 1SBDA 2D6NA 3I4IA 2WYFA 4HFSA 4IEWA 2WS92 1YHFA 1MS3A 1IPKA 1G86A 1W9YA 3FMGA 3WP6A 4JGYB 1H2KA 3H3ZA 2DUPA 2RHPA 2D3RA 3OGSA 3LA7A 2YPJA 4QX0A 2RS53 1BEV1 1BCXA 1YYNA 3MV11 3HMYA 2YPDA 5EYXA 3ZSEA 2ZKLA 2BYVE 4AZZA 1QXPA 5A1FA 3RS6A 4B1MA 1Z7S2 4CCDA 2WLQA 1DBNA 1AR91 3KGZA 1HRI2 3H8UA 1ZA7A 3VKNA 4N43C 5A3MA 3SH5A 2B9VA 1WGPA 2FDIA 3J7MA
chains in the Genus database with same CATH topology
4XDPA 3UYJA 5FZMA 3OPWA 5FZ6A 2OQ6A 4IGOA 2YU2A 4TN7A 5A7PA 4EYUA 4LIVA 5FPVA 3K3OA 4EZHA 2Q8EA 4D6QA 4GJYA 5FY1A 4BU2A 5A1LA 5F3EA 4IGPA 5E6HA 5FZ1A 2GP3A 5FYCA 5FXXA 4CCLA 4LXLA 4Y4RA 5FWEA 5IVVA 5FP9A 4LIUA 5F32A 4CCNA 2OT7A 5FZGA 2W2IA 4CUGA 5FWJA 3AVRA 5KR7A 4ASKA 3AVSA 3N9QA 5FPBA 3ZPOA 5FYUA 2OQ7A 4D6SA 5FXWA 3K2OA 5FZ7A 3PUAA 4NUBA 5IW0A 3OPTA 4DIQA 4BXFA 5FZOA 5A3TA 5FUPA 4CSWA 5F3IA 5A3NA 2XUEA 3AL6A 5F5IA 5FV3A 5FP3A 2Q8CA 3PU8A 3N9NA 5LY1A 5F5AA 3N9PA 5FZLA 5FZIA 4CCKA 2XDVA 2XXZA 5FXVA 3N9OA 5FY7A 4DO0A 3U4SA 4XDOA 5FY9A 5FZ0A 3AL5A 2P5BA 5FY5A 5FZFA 5F39A 5IVFA 4QXBA 5FJKA 3RVHA 5A3PA 5FZOB 3KV9A 3N9LA 5F5CA 5ISLA 5F3GA 4HONA 3PTRB 5A7SA 5A80A 5FZCA 5A7QA 5F3CA 4UF0B 5IVBA 4IGQA 4V2WA 5FJHA 4Y3OA 5IVEA 5FYHA 5FZ4A 3U78A 4E4HA 5FY0A 4QU1A 5ANQA 5FYIA 5FYBA 5FP8A 5FPAA 3PUSA 5F2WA 5FYYA 5IVCA 4UF0A 5FPLA 5K4LA 4C8DA 5FXZA 3KV5A 2GP5A 1VRBA 3NJYA 5FYTA 5FYMA 5FUNA 5LWBA 5F2SA 4CCMA 4HOOA 4CCOA 3DXTA 5FZEA 5FYZA 5FZKA 5FZHA 4BISA 2YBKA 5IVYA 5A7OA 3KVAA 5FZAA 4QWNA 4V2VA 4QXCA 3PDQA 4GAZA 5FZBA 2VD7A 3KVBA 5LY2A 2Q8DA 2XMLA 3KV4A 4GD4A 3LDBA 5FP4A 5IWFA 5FPUA 5IVJA 4AAPA 2YBPA 2WWJA 5FZDA 2YBSA 5FY4A 3PURA 4GJZA 5FZ3A 3KV6A 4D6RA 4AI9A 2WWUA 2YU1A 2YPDA 4QX7A 5F37A 5FYVA 5FYSA 5A7WB 2OS2A 5A1FA 3LD8A 5FZ9A 4EZ4A 5LW9A 3ZLIA 5FP7A 5A3WA 4URAA 5A7NA 3K3NA 4LITA 4QX8A 5FBJA 5FZ8A 2PXJA 5FY8A 2OX0A 3PUQA 5CEHA 3DXUA 3PU3A 4QXHA 4CCJA 3N9MA 4Y33A 5A7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XDP A;  3UYJ A;  5FZM A;  3OPW A;  5FZ6 A;  2OQ6 A;  4IGO A;  2YU2 A;  4TN7 A;  5A7P A;  4EYU A;  4LIV A;  5FPV A;  3K3O A;  4EZH A;  2Q8E A;  4D6Q A;  4GJY A;  5FY1 A;  4BU2 A;  5A1L A;  5F3E A;  4IGP A;  5E6H A;  5FZ1 A;  2GP3 A;  5FYC A;  5FXX A;  4CCL A;  4LXL A;  4Y4R A;  5FWE A;  5IVV A;  5FP9 A;  4LIU A;  5F32 A;  4CCN A;  2OT7 A;  5FZG A;  2W2I A;  4CUG A;  5FWJ A;  3AVR A;  5KR7 A;  4ASK A;  3AVS A;  3N9Q A;  5FPB A;  3ZPO A;  5FYU A;  2OQ7 A;  4D6S A;  5FXW A;  3K2O A;  5FZ7 A;  3PUA A;  4NUB A;  5IW0 A;  3OPT A;  4DIQ A;  4BXF A;  5FZO A;  5A3T A;  5FUP A;  4CSW A;  5F3I A;  5A3N A;  2XUE A;  3AL6 A;  5F5I A;  5FV3 A;  5FP3 A;  2Q8C A;  3PU8 A;  3N9N A;  5LY1 A;  5F5A A;  3N9P A;  5FZL A;  5FZI A;  4CCK A;  2XDV A;  2XXZ A;  5FXV A;  3N9O A;  5FY7 A;  4DO0 A;  3U4S A;  4XDO A;  5FY9 A;  5FZ0 A;  3AL5 A;  2P5B A;  5FY5 A;  5FZF A;  5F39 A;  5IVF A;  4QXB A;  5FJK A;  3RVH A;  5A3P A;  5FZO B;  3KV9 A;  3N9L A;  5F5C A;  5ISL A;  5F3G A;  4HON A;  3PTR B;  5A7S A;  5A80 A;  5FZC A;  5A7Q A;  5F3C A;  4UF0 B;  5IVB A;  4IGQ A;  4V2W A;  5FJH A;  4Y3O A;  5IVE A;  5FYH A;  5FZ4 A;  3U78 A;  4E4H A;  5FY0 A;  4QU1 A;  5ANQ A;  5FYI A;  5FYB A;  5FP8 A;  5FPA A;  3PUS A;  5F2W A;  5FYY A;  5IVC A;  4UF0 A;  5FPL A;  5K4L A;  4C8D A;  5FXZ A;  3KV5 A;  2GP5 A;  1VRB A;  3NJY A;  5FYT A;  5FYM A;  5FUN A;  5LWB A;  5F2S A;  4CCM A;  4HOO A;  4CCO A;  3DXT A;  5FZE A;  5FYZ A;  5FZK A;  5FZH A;  4BIS A;  2YBK A;  5IVY A;  5A7O A;  3KVA A;  5FZA A;  4QWN A;  4V2V A;  4QXC A;  3PDQ A;  4GAZ A;  5FZB A;  2VD7 A;  3KVB A;  5LY2 A;  2Q8D A;  2XML A;  3KV4 A;  4GD4 A;  3LDB A;  5FP4 A;  5IWF A;  5FPU A;  5IVJ A;  4AAP A;  2YBP A;  2WWJ A;  5FZD A;  2YBS A;  5FY4 A;  3PUR A;  4GJZ A;  5FZ3 A;  3KV6 A;  4D6R A;  4AI9 A;  2WWU A;  2YU1 A;  2YPD A;  4QX7 A;  5F37 A;  5FYV A;  5FYS A;  5A7W B;  2OS2 A;  5A1F A;  3LD8 A;  5FZ9 A;  4EZ4 A;  5LW9 A;  3ZLI A;  5FP7 A;  5A3W A;  4URA A;  5A7N A;  3K3N A;  4LIT A;  4QX8 A;  5FBJ A;  5FZ8 A;  2PXJ A;  5FY8 A;  2OX0 A;  3PUQ A;  5CEH A;  3DXU A;  3PU3 A;  4QXH A;  4CCJ A;  3N9M A;  4Y33 A;  5A7W A; 
#chains in the Genus database with same CATH topology
 1QJY 3;  4Y26 A;  3VV1 A;  4MXW A;  1PMJ X;  1NZI A;  2KR2 A;  1XE0 A;  1CZT A;  1JUH A;  1ODM A;  3O1M A;  1IG0 A;  3WQB A;  5DAV A;  1GSL A;  1JW6 A;  4I3G A;  3VBO C;  4BLI A;  1K45 A;  1OQD A;  5AC9 1;  1CN1 A;  1BEV 2;  3J26 N;  2OPW A;  5FY1 A;  2QQN A;  1ND3 B;  3AMP A;  5IYY A;  4OUM A;  3RMX A;  3ZXK A;  4HN0 A;  1WW7 A;  3OD0 A;  1AR9 2;  2HWE 3;  3CDZ B;  4BH9 A;  4DEQ A;  1RXF A;  2B8M A;  2RR1 1;  1G7Y A;  2ES3 A;  3AVR A;  4IXL A;  2VMF A;  1J3P A;  1DQ6 A;  4HAN A;  4WVV A;  3ZFG C;  4Q1P A;  1CAX B;  2JIG A;  2YYO A;  3AXE A;  5FYU A;  1N1S A;  2C4X A;  1GMM A;  1MS5 A;  2AGS A;  5B4X A;  5L36 A;  2ZGO A;  5JIA A;  5GZD A;  4BLJ A;  5BXX A;  3T09 A;  5A3N A;  2EID A;  2QUO A;  4DY5 A;  2BW8 A;  2E33 A;  5AC9 2;  4AVT A;  3SIS A;  1PM4 A;  2PEL A;  2RJL A;  2V72 A;  1JN2 P;  2BTV C;  3BB6 A;  4QX1 A;  5FPZ A;  1G9C A;  3O1T A;  1EV1 1;  1TNF A;  2NZ9 A;  4DO0 A;  1GP4 A;  1W39 A;  5KHH A;  2VMI A;  5J98 B;  2RR1 2;  2VUA A;  5JWP A;  2VTF A;  5HCB A;  1AL2 3;  1TQ5 A;  3CJX A;  2YDE A;  5T54 A;  3TEZ A;  2ZGP A;  4L97 A;  5A3P A;  3OYW B;  4N90 A;  4XQ4 A;  4W6X A;  1ULO A;  2Z69 A;  2RE9 A;  5F6K A;  2WS9 3;  3USU A;  1CWP A;  3S6P A;  1OUX A;  2UYB A;  4L2N A;  5KC6 A;  1WUV A;  1PX3 A;  1UOB A;  1YQ6 A;  2X10 A;  3LZZ A;  3WDU A;  5FLH A;  4B7E A;  3PIJ A;  3HNM A;  1EV1 2;  4Q4X 1;  3CL1 A;  4W50 A;  4YW4 A;  5EYY A;  5BNO C;  2VVD A;  4Y22 B;  1WCK A;  5FYY A;  1Z7S 3;  1PO2 1;  3MIG A;  4OZX A;  3WSO A;  1D0H A;  3BCW A;  1HRI 3;  1F35 A;  1WZX A;  3BN6 A;  4WVM B;  4OI0 A;  3UL2 A;  5LWB A;  3HBK A;  1RUN A;  1W6O A;  5FO7 B;  2XWJ B;  5EZW A;  4BDV B;  5FYZ A;  3ZKU A;  3V0B A;  2BJS A;  2P1B A;  5A7O A;  4N43 B;  4A3X A;  5FMC A;  1DGW X;  3BPZ A;  1LHV A;  4COY A;  1KEX A;  2WN2 A;  4DRR A;  2QDR A;  2PAM A;  5KHJ A;  1YCI A;  5C4W A;  3UES A;  1U5Z A;  1DYP A;  2HEV F;  2JKB A;  1BEV 3;  2WQ4 A;  1H9P A;  1MZ6 A;  1H9W A;  2ZEY A;  4Q4X 2;  1E5H A;  2P3K A;  4ZU7 A;  2VD7 A;  5J36 A;  3OCP A;  3WF0 A;  1PO2 2;  2A70 A;  1PVC 3;  3CJI A;  3HIF A;  1AR9 3;  4COW A;  5KC5 A;  2A3X A;  1CAW A;  1RIN A;  1TVG A;  2JG9 A;  4MAD A;  5GLV A;  2FDJ A;  2O14 A;  1JOP A;  5FKC A;  4Z07 A;  2YU1 A;  2JDZ A;  4ARY A;  1VBA 1;  4KL1 A;  2D3P A;  1ND2 A;  4OHW A;  2HEY F;  2YFZ A;  2GC2 A;  4L92 A;  1UQX A;  4FT8 A;  2E7A A;  1J83 A;  5AC9 3;  3BTA A;  1IS5 A;  3PUQ A;  5LBB A;  2BOJ A;  4IW3 A;  5A32 B;  3VBU B;  2TBV A;  3LEM A;  4ZPI A;  4IE5 A;  4WM8 B;  4CVU A;  2ARC A;  2VNV A;  4D3W A;  2C0Z A;  1YRZ A;  1UPS A;  4TN7 A;  4FSJ A;  1UO9 A;  1LGB A;  1UY4 A;  1JYI A;  4LKD A;  2UUR A;  3Q8C A;  2ETE A;  1FMD 1;  2PLV 1;  2RR1 3;  4M00 A;  4K21 A;  2GC3 A;  2WZ8 A;  4OCT A;  3VZJ A;  4COZ A;  3ORJ A;  4XTM A;  5L9R A;  3WIN E;  2KM2 A;  5DZG A;  3KHB A;  3KF5 A;  1OF3 A;  3W58 A;  2FZ1 A;  2W3J A;  5A1L A;  4XJ8 A;  1VBA 2;  2JDM A;  3IAQ A;  5FXX A;  5IVV A;  2QE3 A;  2AUY A;  3ATG A;  3KSC A;  4YWA A;  2YZ4 A;  1MVQ A;  2X5I C;  2BGP A;  5HPO A;  1JU3 A;  1UU4 A;  1ZZC A;  5FUI A;  4YSF A;  4GXL A;  3AKQ A;  3WEZ A;  1ULE A;  1MS0 A;  3GF6 A;  4LJH A;  1XRU A;  4NOT A;  1T6G C;  1EV1 3;  4A4A A;  4YW7 A;  1OF4 A;  3V56 A;  3WF3 A;  3B01 A;  4HBN A;  3UK9 A;  1GOF A;  4H7L A;  3WT3 A;  1FMD 2;  2PLV 2;  1NKG A;  1GV9 A;  1K5J A;  4AE2 A;  4BMB A;  5C8W A;  3OY8 B;  4JRA A;  2MNG A;  2XWB B;  4XFF A;  5BNO B;  2VPV A;  3LGR A;  1N3P A;  3ACG A;  3NRU A;  5F5A A;  1U12 A;  2GZW A;  2Y6K A;  2ZTN A;  3GZA A;  4CEW B;  3SCF A;  3AKT A;  1YQC A;  4UYB A;  1QJF A;  4GWN A;  4QQ2 A;  2XJV A;  3IM0 A;  5LEK A;  3ZYG A;  4CPB A;  2IXH A;  2YY1 A;  1FAT A;  1PMI A;  1MZE A;  2X05 A;  3BVC A;  1VE0 A;  1JOB A;  3SH4 A;  5FZO B;  3ZFF A;  2XVG A;  2VU9 A;  5JVV A;  4Q4X 3;  5J7M A;  5HCH A;  2R30 A;  1Y7B A;  4UT5 A;  3DYO A;  2FBE A;  4A6S A;  1PO2 3;  3I49 A;  3L2Y A;  5A7Q A;  2VW0 A;  3BYW A;  2GU9 A;  3SXW A;  3BIW E;  3NST A;  3ZXL A;  1RUE 1;  2QDN A;  4RGK A;  1OT5 A;  1IS3 A;  1Q43 A;  4V2W A;  4X6Q B;  5IK8 A;  1F5J A;  5FZ4 A;  1QOT A;  4QU1 A;  4Q4Y 1;  4MZU A;  5FPA A;  3TB0 A;  3PVO A;  1NZC A;  1DQ0 A;  2ZEX A;  5FO9 B;  3HQX A;  1J59 A;  2ZCW A;  5EPA A;  3MFA A;  4XDQ A;  1AVB A;  5FYT A;  1W9T A;  3WDX A;  4CCO A;  3OEB A;  2GN7 A;  1NG0 A;  4QHZ A;  2JB8 A;  1LOE A;  3MYX A;  4P00 B;  3T4V A;  4XF9 A;  5GZE A;  1X50 A;  1UY0 A;  2J1E A;  1K5M C;  3GZU C;  4CUB A;  1RUE 2;  3ZN4 A;  2QTW B;  5IT6 A;  3OUH A;  4NID A;  2GH8 A;  4AHW A;  2VNR A;  1ZX5 A;  4QM8 A;  2VZ3 A;  3POW A;  4YGD A;  5I93 A;  3O0W A;  4Q4Y 2;  4WV8 A;  2ZHL A;  2XML A;  4GQ7 A;  4SBV A;  5C9A A;  4P02 B;  2ARE A;  4BZ4 A;  3BU7 A;  5E8A A;  3TN9 1;  3VBF A;  3M3E A;  3PME A;  1O7F A;  1TMF 1;  3VKF C;  1F15 A;  3C8X A;  1QNY A;  3KZ4 C;  4J6G A;  3V64 A;  2P3Y A;  4AG4 A;  1F8V A;  4MGI E;  2UWC A;  3BOW A;  3ILF A;  4FFF A;  5FMD A;  2X5I B;  4FAH A;  5BNP A;  5F37 A;  3QOP A;  2W0X A;  3NL1 A;  3B02 A;  1FMD 3;  2PLV 3;  2WQZ C;  2NQY A;  2VBB A;  3PVB B;  1U5Y A;  4GWI A;  1FV2 A;  2FCU A;  1OA3 A;  1IQD C;  1POQ A;  4YW6 A;  1SPP B;  3ZN5 A;  4EN9 B;  4RN5 A;  1YI7 A;  3LF7 A;  2JJ6 A;  2Y34 A;  1W90 A;  5GLW A;  1H8T C;  2N7G A;  4MSV A;  5FZ6 A;  1O8S A;  4LA2 A;  4K8R B;  3TN9 2;  4UW4 A;  1TMF 2;  1XNB A;  4KWJ A;  1WKY A;  4CA9 A;  1V6K A;  5E1R A;  5J3U A;  1RC6 A;  2VMC A;  4AVB A;  4XUT A;  2RDN A;  4LHS A;  4YPJ A;  1HQL A;  4NPR A;  5FQ0 B;  1I5P A;  3CHX A;  5BYN A;  4R9A A;  5JIU A;  1SLI A;  2IXJ A;  4YG3 A;  5F32 A;  3OBR A;  5FZG A;  3T1M A;  4CU8 A;  1MS9 A;  3POE A;  5K9Y A;  1NCQ A;  3WNL A;  5B4N A;  2B39 A;  1IPJ A;  1UW8 A;  2OQ7 A;  2ZAC A;  4W6W A;  5K0U A;  4D6S A;  2A6Z A;  3CEW A;  1UAI A;  2PHF A;  2X29 A;  5ANN A;  4HLT A;  5CKM A;  2NYY A;  2Y26 A;  2AYH A;  1NCR A;  3AMH A;  4ORF A;  2WAB A;  3D8C A;  4CP9 A;  1UOF A;  2DU1 A;  2VUL A;  4EWD A;  3KCX A;  5C3S A;  1H1I A;  5FK8 A;  2QQV A;  3HQR A;  1D2S A;  1WLT A;  3J7N A;  3H3U A;  2WA4 A;  2WNV B;  4LTA A;  3PJY A;  5J37 A;  3MDP A;  1ZZ7 A;  3MI8 A;  4AHX A;  3IDE A;  3HQU A;  3GBW A;  2CYF A;  3WP4 A;  2IVI B;  1S4C A;  1OUS A;  3HJR A;  3PTR B;  4Q4Y 3;  4C1X A;  1GNY A;  1ZZ8 A;  3IN9 A;  2VVF A;  3IWZ A;  3ROU A;  4DFS A;  3RZM A;  4AGG A;  1UX7 A;  2BFU S;  3FLP A;  4YM0 A;  4BME A;  5B2G B;  4A3Z A;  2CL2 A;  1EAH 1;  2Q0A A;  3AZY A;  4HK9 A;  5FYH A;  3U78 A;  3WW4 A;  1ZRC A;  1DQ2 A;  3ES1 A;  5BV6 A;  4HKO A;  2WNO A;  3NV1 A;  4DUV A;  2Q1M A;  2ADE A;  3WHU A;  3VD4 A;  3VBS A;  2Q1F A;  3LKJ A;  2DF7 A;  1WMD A;  2WAA A;  4K9S A;  5LA9 A;  1MZF A;  5DAX A;  1SFP A;  4M3C B;  5FBZ A;  2R1D A;  3THP A;  4AFC A;  1CZV A;  4C91 A;  2H6C A;  2JDU A;  3OUJ A;  1TMF 3;  1QOS A;  2XLG A;  2R16 A;  2YGM A;  3WF1 A;  5FOB B;  3VDB A;  4Q1R A;  2BPA 2;  2VZO A;  3EMR A;  4XAC A;  1EAH 2;  3RJR A;  4P9J A;  2ZHK A;  5DZE A;  1ZYB A;  1V6O A;  2VMD A;  3LWC A;  1LR5 A;  2PAK A;  5FP4 A;  3ACH A;  5IWF A;  4PCR A;  1C3H A;  1RED A;  1XSQ A;  2J42 A;  2OW4 A;  2XBO 1;  3H50 A;  2WII B;  4BQ3 A;  1QJX 1;  4K3U A;  3GGL A;  5I0S A;  3K4Z A;  4GMP 1;  2VJX A;  3S5A A;  4XMI A;  4RGA A;  2PA7 A;  5FYS A;  4MGY E;  3O1U A;  2ADD A;  2ET7 A;  3HN1 A;  3MBW A;  1ULP A;  1S1A A;  2VEC A;  2Y0O A;  3ETQ A;  3DYM A;  5IFP A;  1W9W A;  4NII A;  3M7A A;  4CDX C;  1ASJ 1;  3RSJ A;  1ODN A;  5T5P A;  1X9T A;  1KFX L;  3DCQ A;  4P08 A;  4TWT A;  4TSV A;  4XDP A;  2G9G A;  2YU2 A;  2VCB A;  1ZRI A;  4XF3 A;  4AOC A;  5JSP A;  2XBO 2;  3ZFE B;  2FD8 A;  1MVE A;  2NMO A;  4XW3 A;  1C5H A;  2VZP A;  4CU7 A;  1BVP 1;  4YNI A;  1QJX 2;  3U4X A;  5CA6 A;  1SBF A;  2B5H A;  2QQW A;  3EXU A;  3HT1 A;  3FHI B;  4JRL A;  2QCS B;  3LIG A;  2HWB 1;  3TNQ A;  4ET7 A;  5C5U A;  4TTG A;  5FYC A;  1W6N B;  1OOP B;  4E2G A;  1AYN 1;  5CFC C;  1ASJ 2;  2W47 A;  1RUG 3;  3MLL A;  2D6K A;  1KS5 A;  2IXC A;  4PF5 A;  1KDM A;  3GCX A;  4Q29 A;  3DF0 A;  1RUD 3;  4YFZ A;  2ZZJ A;  1FAY A;  1PK6 A;  2RJK A;  3TEW A;  5A70 A;  4QKN A;  4R52 A;  1OHF A;  2R06 1;  1H2M A;  3MW3 A;  3M2M A;  3B93 A;  4XZU G;  3NAP C;  1QF3 A;  1XNC A;  2HWB 2;  5L7O A;  1W8Z A;  3ZXG A;  1JYT A;  4YZ5 A;  1S0J A;  1J3R A;  2LS6 A;  1RUC 3;  2B46 X;  2ZX1 A;  3BPS A;  1AYN 2;  2DVF A;  5FZF A;  2OUJ A;  5FMO S;  1GBG A;  2BU9 A;  2RM2 1;  3R4D B;  4BOW A;  5M0T A;  1CJD A;  1EAH 3;  4EE2 A;  2EAK A;  4QDQ A;  2ZGR A;  2BV4 A;  2DU0 A;  2HH9 A;  2JIC A;  2R7E B;  3FBM A;  2D93 A;  3DPR B;  3DEC A;  3MIE A;  4IE4 A;  3PL0 A;  1HQW A;  3NW4 A;  1OQE A;  3AZV A;  3H9A A;  4NRP A;  4O7X A;  2R06 2;  5JAX A;  4E8C A;  2A6X A;  4HK8 A;  4AFA A;  2WSU A;  5EHD A;  4OMD A;  1NA1 A;  4H2A A;  1QY4 A;  1VAV A;  4QKD A;  2OYZ A;  2FCT A;  5ANQ A;  2FDH A;  4UWD A;  4YFW A;  3PUS A;  4ES9 A;  3VDD C;  4D69 A;  3SLI A;  3NKG A;  3BTZ A;  3CIH A;  1CIY A;  1U5I A;  1VRB A;  1XJA A;  2IC1 A;  2RM2 2;  2Y6J A;  4ZHN A;  3MGU A;  4HOO A;  5GJ6 A;  3MEP A;  5DUW A;  5GZG A;  3MIF A;  2K9Z A;  3HR9 A;  3N35 A;  4FPF A;  1SBE A;  1D0G A;  3OBA A;  3KVA A;  4Y20 A;  2ZAH A;  4A45 A;  1MPX A;  2ARB A;  2XBO 3;  4LBQ B;  3WD5 A;  1LU2 A;  2X8K A;  2ORZ A;  4Q4W 1;  3ZN6 A;  1QJX 3;  1DLL A;  4AED C;  3BI3 A;  4GMP 3;  5F6L B;  1SLA A;  3NVC A;  3E97 A;  4GAZ A;  2IUW A;  3GXU A;  3DKQ A;  4MOA A;  1NE6 A;  1NLQ A;  4WZC A;  4XET A;  1C8M 1;  1PHM A;  3GZE A;  3OBT A;  5JOX A;  1OPO A;  3MO4 A;  4JGZ C;  2HYK A;  4HMZ A;  1XBF A;  4I0A A;  3ZIX A;  4AI3 A;  5ERL A;  1WA6 X;  5FY4 A;  3WHT A;  2E26 A;  2OUH A;  1VBC 3;  5CKN A;  4D6R A;  2RS3 3;  4DXZ A;  2HJI A;  1W6P B;  5A1A A;  3GAL A;  1H6X A;  3ENR A;  2E32 A;  2XH6 A;  3DKW A;  4CRQ A;  2D40 A;  3GBF A;  3S7I A;  3EJK A;  1YXW A;  3WOG A;  1YFY A;  4Q4W 2;  2JD9 A;  1APN A;  2VZQ A;  3PU3 A;  4QDR A;  2BFU L;  4RS5 B;  4HL0 A;  1X36 A;  2HWB 3;  1C8M 2;  5AVP A;  1LED A;  3X29 B;  4UXA A;  1CD3 G;  1UOG A;  4MGK E;  3NJZ A;  2ZGN A;  5D8A A;  2V5Y A;  4BCU A;  1RIT A;  2E9Q A;  2V5D A;  2VTX J;  1COV 1;  3N7L A;  1IKP A;  1GAN A;  2VZT A;  3AZZ A;  4D6Q A;  1XYO A;  4E2S A;  4JKM A;  1PGS A;  1HJF A;  1OD5 A;  1SEF A;  1VAM A;  3AYA A;  1GWK A;  5EJ1 B;  3WVJ A;  5FP9 A;  5ABJ A;  2R06 3;  5IAX A;  1ULG A;  1GZW A;  3BAL A;  5L73 A;  1DQ4 A;  2B4K A;  5KR7 A;  3M3I A;  4G3Y C;  3AP5 A;  1LOF C;  4PDW A;  3CZJ A;  4QPG B;  4XUO A;  4IDZ A;  4CDQ A;  4ASL A;  2XLA A;  2JDY A;  1LEN A;  2D98 A;  3FE5 A;  4YVW A;  4AQ6 A;  5A3T A;  5FUP A;  3WXP A;  2HKX A;  5BNN A;  2ORX A;  4RR3 B;  3I3M A;  1COV 2;  3ZR5 A;  1W0O A;  4L11 A;  1LB2 A;  3UNP A;  1P8J A;  4QPY A;  3N9P A;  4E4S A;  2YUE A;  4LBN A;  5F8P A;  2TNF A;  1YFW A;  4JC1 A;  4QQL A;  3UKV A;  1Q5O A;  3B94 A;  2LW8 A;  4JGY C;  4XFB A;  4CDW A;  4UW6 A;  4QQO A;  1QJY 1;  3MLJ A;  2YXS A;  4YW3 A;  1CAV B;  4L99 A;  4ZS3 A;  4OQ8 A;  4CEW A;  1O3T A;  1RIR A;  2OPK A;  1LOG A;  4AL9 A;  1OA4 A;  3C3V A;  1MR5 A;  1QJZ A;  3III A;  3PVE A;  3H7Y A;  5KHK A;  1A78 A;  4Y5T A;  2VBD A;  3A4U A;  4Y1Y A;  2IXI A;  2UY9 A;  4LUL A;  4GMP 0;  4UFH A;  4G4F A;  2LRO A;  1OUR A;  2RDQ A;  4QHO A;  3RZZ A;  2VMH A;  3IPV A;  5C70 A;  4XZP A;  3VBH C;  3R05 A;  4LOR A;  2CGN A;  4Q5O A;  2DDU A;  4HSJ A;  5FY0 A;  3FN9 A;  3GCW A;  2VTX A;  1QJY 2;  1VRH 1;  2VOW A;  4LUM A;  4UF0 A;  2D7F A;  4Q4W 3;  4C8D A;  1X9P A;  3I2I A;  5FYM A;  4RQP B;  1UYX A;  1ND3 C;  1AR6 1;  2OA2 A;  1LEM A;  1O4Z A;  1W8H A;  3E5U A;  1C8M 3;  3NWK A;  2Y38 A;  4YZ4 A;  4JV4 A;  2A3Y A;  3WF4 A;  3OSD A;  3K48 A;  2XVL A;  1B09 A;  3MF9 A;  1DGW A;  5A33 A;  3ZXF A;  3B7M A;  1UZ0 A;  3TWI A;  1JI6 A;  1GFF 2;  3VD7 A;  1O4T A;  3LA2 A;  4IEP A;  3N36 A;  2W94 A;  1ONA A;  2RDS A;  4HSL A;  1KFU L;  2JDH A;  1TEI A;  3MW4 A;  4PT6 A;  5LY2 A;  3D82 A;  1Q8O A;  1VRH 2;  3G7D A;  4XF1 A;  1DYK A;  5FPU A;  2VCM A;  4R9D A;  1Z78 A;  2CAU A;  4Y1X A;  1AR6 2;  2BVB A;  4LBQ D;  3VDC A;  1JOJ A;  4Z2A A;  4JKK A;  1WCU A;  3LEI A;  2J22 A;  4OHV A;  3BTY A;  4MXW B;  2VNG A;  1LJ7 A;  4S2G A;  3FL7 A;  1OI6 A;  2YRO A;  3K4A A;  4OZO A;  4Z8B A;  4HVQ A;  4L9B A;  3RDI A;  1PGL 1;  2DYC A;  1COV 3;  5L9B A;  5LK5 A;  4HZF A;  5G05 L;  4CCJ A;  3I59 A;  2RDR A;  5A7W A;  1SLB A;  4XJ9 A;  2UWB A;  4XJU A;  4IGO A;  3D6E A;  2FMD A;  4AI2 A;  3R6S A;  3VN4 A;  1AXK A;  2YG0 A;  3B9I A;  2R1B A;  5K7P A;  1XYP A;  5DZF A;  1JZ4 A;  1F4H A;  1DGR N;  4FPJ A;  4S2D A;  2EXJ A;  2QZ2 A;  4A7Y A;  1ND2 C;  1UWW A;  1S0G A;  3O14 A;  4ZXE A;  2CU5 A;  4GJY A;  1R09 1;  4AHZ A;  4IGP A;  3AKS A;  3ZKY A;  1H6Y A;  1HIX A;  1KIT A;  1QH7 A;  4G9S B;  4JTO A;  1VB4 A;  5DXD A;  3ZO0 B;  2G19 A;  1PGL 2;  2WNE A;  4IEZ A;  4KU7 A;  4XAB A;  3V0A B;  4PQQ A;  4QPI A;  4AI8 A;  1PVC 1;  3POF A;  1LUL A;  4M4R A;  4DY3 A;  1WMF A;  1DIW A;  3WX5 A;  2W68 A;  2WNU A;  4AWD A;  2MHF A;  2P6C A;  2ZAB A;  2OXB A;  4FPH A;  2WAO A;  3ZR6 A;  3VBH B;  1FNZ A;  1M4W A;  3NV2 A;  4Q26 A;  5E89 A;  1ZRR A;  1GWL A;  2WSV A;  1LAJ A;  2JWP A;  5HCF A;  2ZGT A;  1R09 2;  2QVS B;  4L0P A;  1HV0 A;  4ATF A;  4FPO B;  1DGR A;  1Y9Q A;  2ET1 A;  4CU9 A;  3USU B;  1PVX A;  1R08 1;  3KD4 A;  4PLM A;  4BQ2 A;  2HBT A;  2C9A A;  3HEI A;  3FJS A;  4HET A;  1GQG A;  1LHW A;  4IE7 A;  4B4P A;  4EJR A;  1YIF A;  2G1M A;  1N47 A;  1PVC 2;  4WM7 A;  3VUO A;  4PIX A;  2O0O A;  2A1X A;  3LPF A;  1S0D A;  2I74 A;  3GNE A;  5F3G A;  1D4V B;  4YVS A;  1W9F A;  4CTE A;  5L9V A;  5KXD A;  1XOY A;  5CFD A;  3B69 A;  5FZC A;  1VRH 3;  4DUW A;  5LBC A;  3W9A A;  3N7J A;  4D7S A;  1FX5 A;  3VBU C;  1CON A;  4RGG A;  1AR6 3;  4WM8 C;  2J1A A;  4LLO A;  3WQ1 A;  5I0T A;  1XPW A;  1W2A X;  4FQZ A;  4LQR A;  1W6O B;  1D7P M;  3AP6 A;  1VBD 1;  4S2F A;  5IAV A;  3V0B B;  2Y6F A;  1R08 2;  1Y9M A;  4F3J A;  5HCA A;  4KGQ A;  4FVV A;  3SC7 X;  4A2U A;  1HB3 A;  4YG0 A;  3KV5 A;  4YGB A;  3LA3 A;  2A7A A;  1MS4 A;  3U75 A;  1JYN A;  1O3Q A;  2DUO A;  2PAE A;  4CU6 A;  5FCC A;  1T6B X;  2QQJ A;  4EN8 B;  3U10 A;  1OH3 A;  1NY7 1;  1DZQ A;  2YBK A;  3O7O A;  3I2F A;  4NN0 A;  4HT1 T;  4Q2F A;  3KGL A;  4Z92 B;  1KJL A;  1ZZB A;  1W2N A;  4O65 A;  3CJI B;  3ZXJ A;  3KCY A;  5FZA A;  2ZGU A;  1CAW B;  2GMP A;  3T2Q A;  3WDY A;  3WQ0 A;  1WWY A;  4XBQ A;  5JOZ A;  1HKD A;  3DV8 A;  1F31 A;  3PVN A;  2NMN A;  3ALQ A;  1DU3 D;  1VBD 2;  3KCC A;  3WP3 A;  1D2Q A;  3KV4 A;  1AXZ A;  3O1S A;  1ND2 B;  1UX6 A;  1IHM A;  1VMH A;  3VLB B;  4BQ5 A;  1SCR A;  2WWJ A;  2ZX0 A;  3RFR A;  3JXS A;  1MQT C;  4M4P A;  2DVD A;  4GIQ A;  2MEV 1;  4UW5 A;  3FFZ A;  2EF6 A;  1RB8 G;  1UY2 A;  2W1S A;  3LAG A;  1NY7 2;  1PNG A;  1T2X A;  3MUZ 1;  5FZ9 A;  3M3O A;  1RUO A;  4URA A;  3TEX A;  5CKQ A;  3O1P A;  4AW7 A;  4X6R B;  3NKT A;  4B7K A;  1QJU 1;  1HDK A;  1R09 3;  1TG7 A;  3QD6 A;  4PJY A;  5FZE A;  3ZYB A;  4CEY C;  1GNH A;  1HN1 A;  2W1U A;  1NAE A;  2EIC A;  4LO6 B;  1YJL A;  4CDU C;  4EYU A;  1JOD A;  3T0B A;  2QQL A;  5HBA A;  4IET A;  3HVD A;  1CR7 A;  2MEV 2;  4Y24 A;  2G4I A;  3PTY A;  1VIW B;  3I2D A;  3THD A;  4C90 A;  2D6P A;  4K20 A;  4Y1V A;  4XCB A;  4PIY A;  5I8T A;  5GZF A;  1PGW 1;  3DYP A;  3IDA A;  1FPN 1;  1OVS A;  3EBR A;  2JG8 A;  3DN7 A;  1QJU 2;  2AH2 A;  2EAL A;  2ZGK A;  4BPZ A;  4W65 A;  1PO1 1;  3ZYI B;  4OI1 A;  3GDB A;  1AX1 A;  1CQ9 A;  2VO5 A;  3HAG A;  1R08 3;  4J25 A;  3OPT A;  5JR7 B;  1LHO A;  5HXV A;  1PIV 1;  1FOD 1;  2XUE A;  4YW1 A;  3H1Y A;  4AHY A;  4MGZ E;  2VUC A;  4RL7 A;  3ZFF B;  1QQP 3;  3G6J B;  5FZI A;  3VGI A;  5T55 A;  1SDW A;  5LA0 A;  4AGR A;  4BQY A;  3C7O A;  5FY9 A;  1PGW 2;  1NCQ C;  1RVF 3;  2P5B A;  3O0X A;  5GLU A;  2KXL A;  1QXJ A;  3O5S A;  3RWN A;  1XU2 A;  1XNK A;  4JQR A;  4MXV A;  4XQW A;  5FJK A;  2WO7 A;  4MGS A;  2YMZ A;  4ONU A;  1PO1 2;  1C1L A;  1NCR C;  3LDR A;  4ZXK A;  1VBD 3;  2WJS A;  2ZZQ A;  1BQP A;  2I07 B;  1GR3 A;  1PIV 2;  1DCS A;  2JEC A;  1FOD 2;  3WQ7 A;  3E1F 1;  5DUV A;  3WNK A;  1O3S A;  2YGL A;  1LOD A;  4O9E A;  2WZR 3;  4N43 A;  4MLO A;  4D0Q A;  1IG3 A;  3KT7 A;  4JHZ A;  4FPC A;  1MQT B;  4YZ3 A;  3AYC A;  3OUI A;  5FRE A;  2GP5 A;  1KGY A;  4LOS A;  1L7R A;  4HVO A;  3VBO A;  4AQS A;  2ATF A;  1NE4 A;  1ZBE 1;  1TE1 B;  3T0D A;  4BQ1 A;  3AP9 A;  5FZK A;  2OKX A;  1IOA A;  4UFJ A;  2XHK A;  4OQ9 A;  4HPK A;  3OGR A;  2C5D A;  4QMA A;  3AMN A;  2E53 A;  4LBO A;  1DFQ A;  5C9A B;  3VBF B;  2R6Q A;  1YO8 A;  3QBQ A;  4LK6 A;  4CEY B;  1BZW A;  2MEV 3;  2O8Q A;  4IV3 C;  4QXC A;  4CDU B;  2YC0 A;  3ZFG A;  4A7K A;  2GC1 A;  4NVP A;  1YI9 A;  3ETP A;  5BNP B;  2RVA A;  4R4Z A;  2KD7 A;  5A32 A;  5C3Q A;  5JDB A;  4FTS A;  3VD9 A;  1GP6 A;  5EJZ B;  3FLR A;  4DXR A;  1D4M 3;  5JCT A;  4XHX A;  3RZK A;  1TME 1;  2VXJ A;  1QJU 3;  3NO8 A;  1QKQ A;  1ZBE 2;  1OVP A;  1W0P A;  5JLV A;  4XUQ A;  5AVA A;  2Q1Z B;  5J96 B;  3KMH A;  2BQP A;  1U5X A;  4AF9 A;  2WNV C;  2W87 A;  4FFH A;  4K8F A;  2ZGM A;  3L9J T;  3SHR A;  3VKO A;  4XAE A;  4QX8 A;  5H9Q A;  2ARA A;  1ACC A;  2W9X A;  3A23 A;  2W46 A;  3JZV A;  4J1W A;  4EWA A;  2OZJ A;  5JXH A;  4QXH A;  3WCR A;  4LHL A;  3INA A;  1GKB A;  4BQW A;  1ZZ9 A;  5GAL A;  3C7F A;  3H8O A;  5C33 A;  3UGF A;  1W8F A;  1FPN 3;  1YIP A;  2V4V A;  5J09 A;  1BK0 A;  3WUC A;  5FPV A;  3LSD A;  4NWV A;  1NCQ B;  1PO1 3;  1SG3 A;  3E5X A;  3LDK A;  2J1V A;  5F3E A;  5TSW A;  4ZZ8 A;  1IGO A;  5K0U B;  5FZ1 A;  4CXY A;  1W9S A;  3K75 B;  1H1A A;  5BNO A;  2Q5T A;  1PIV 3;  1ZBA 1;  4BA6 A;  1Q8P A;  1FOD 3;  1NCR B;  2ZXQ A;  4XBN A;  2W2I A;  1SFY A;  2ZGS A;  2RG4 A;  3TOJ A;  4CP9 B;  2J7M A;  1AYM 1;  1MAC A;  3PHM A;  1O8P A;  2WQ8 A;  2JDA A;  2EXH A;  1DP0 A;  1ZNP A;  5DAQ A;  2PFW A;  3Q8E A;  5FZO A;  3SMH A;  3THT A;  4GH4 A;  1CVN A;  1NX9 A;  1GP5 A;  1AR7 1;  1QOO A;  1PMH X;  2HYX A;  4IEU A;  2BBA A;  3CMG A;  5FV3 A;  2JEN A;  3IKW A;  4CP2 A;  5HXM A;  3WNX A;  2ZA9 A;  4Y4Y A;  4KG8 A;  3VZN A;  1ZBA 2;  1UY1 A;  2K46 A;  4GUL A;  4Q0P A;  2F4L A;  4YW5 A;  1OKQ A;  2R49 A;  1AYM 2;  2W52 A;  2ERF A;  2WFF 1;  1GU3 A;  4CPB D;  2P3I A;  1QMJ A;  1OH4 A;  5JXI A;  4XIK A;  4DEV A;  4AI0 A;  3BOP A;  4IV3 B;  3N3H A;  3RGB A;  3T30 A;  2BNM A;  3DEM A;  4H3W A;  4IV1 C;  4F8A A;  1AR7 2;  5G04 L;  5L7O C;  1AUY A;  1OC1 A;  1HJG A;  2VGD A;  5IUQ A;  4Y3O A;  2DFB A;  1ZBE 3;  3M3C A;  3VBS B;  5IVE A;  1ULD A;  4X8N A;  4E4H A;  3A7Q A;  1RUG 1;  1GIC A;  1ZM1 A;  4BK5 A;  4K40 A;  2VM9 A;  3F2Z A;  2VXR A;  3ZFE C;  1YFU A;  5ACA 1;  5LAT A;  1UZW A;  1BJQ A;  1GZC A;  3RNS A;  1RUD 1;  3ASI A;  3H7J A;  3I2K A;  1WCD J;  3E6D A;  1V6N A;  2WFF 2;  3FHQ A;  5F2S A;  1WD4 A;  2DTY A;  4F83 A;  4FPK A;  1RUI 3;  4BIS A;  2LUW A;  1OOP C;  2Y6G A;  1NA1 C;  4Q0S A;  4DXS A;  2YHJ A;  2ZHM A;  3D4K A;  3WY6 A;  1ZZ6 A;  2HBU A;  4N7U A;  1AJO A;  4W4Z A;  1RUC 1;  2L9L A;  1TME 3;  4RFT 0;  2BER A;  4XUR A;  2WT0 A;  1RUJ 1;  2I2S A;  1CZS A;  1RUG 2;  1I9R A;  4TZD A;  3RZL A;  2RS1 1;  1H4H A;  1UY3 A;  4GD4 A;  1UMH A;  1YQ2 A;  3JCI A;  5ACA 2;  1SPP A;  4IE6 A;  1RUD 2;  2TEP A;  5E88 A;  2C1F A;  2OII A;  1BYH A;  2VUD A;  2YBS A;  5JR2 A;  1R1A 1;  4QX2 A;  5KHG A;  1GUI A;  4NIA A;  3T08 A;  5LB6 A;  1SQ4 A;  3K77 A;  5EQU A;  4LR4 A;  3AB0 A;  2OS2 A;  4NAO A;  2RV9 A;  5CB7 A;  1Y9G A;  4KH9 A;  5C7G A;  2GNM A;  1JYW A;  1NOV A;  1RUC 2;  3AKR A;  1L7L A;  1JYV A;  1QNW A;  3CZU A;  3DXU A;  4LKS A;  1RUJ 2;  1ZVF A;  2BOI A;  2Z4F A;  1C57 A;  1OFN A;  3DPR C;  2RS1 2;  3P3P A;  3VZM A;  1CX1 A;  3SEP A;  4N9I A;  4YRD A;  1A3K A;  2JEM A;  3AYE A;  4FI9 A;  1ZBA 3;  1BKZ A;  4BYY A;  4XJW A;  1O4Y A;  3NJX A;  1URX A;  1R1A 2;  5D21 A;  3U07 A;  1AYM 3;  3DUI A;  4JQT A;  3IDC B;  3UJO A;  4D7T A;  3H8R A;  3PUI A;  1UKG A;  4QB1 A;  1HXS 1;  2DBI A;  3ELN A;  1NXD 1;  3I3B A;  4N53 C;  2XB6 C;  4UOJ A;  4Y4R A;  3W20 A;  4BIO A;  2VY0 A;  1BXH A;  1AR7 3;  2VMG A;  1W3V A;  5FWJ A;  2ZKN A;  5BNQ A;  2PHW A;  2VZS A;  4CUC A;  1AHS A;  2IFR A;  1LTE A;  4IV1 B;  4NHY A;  5L7O B;  1JTZ X;  3OPZ A;  3PUA A;  4LLF A;  4P9L A;  3OD4 A;  1VBC 1;  2XJT A;  2RS3 1;  3OOX A;  4NRM A;  5JPM B;  2AEN A;  3OB8 A;  1XXN A;  1W6Q A;  3LFI A;  2C26 A;  1K5M A;  3QLQ A;  4OUS A;  1ULC A;  2DVA A;  1WLW A;  4AR2 A;  3B9C A;  1CES A;  2H0B A;  2WFF 3;  4NHM A;  5CVR A;  5FKB A;  4FFG A;  1HXS 2;  5T52 A;  4K1Y A;  4ITC A;  4MYE A;  5H9S A;  1HB2 A;  4QQH A;  5FY5 A;  5F39 A;  3MPP G;  5IK5 A;  3NJV A;  4ZS2 A;  3RPQ A;  4QXB A;  4DUX A;  2J1R A;  5FR3 A;  4LHN A;  1NA1 B;  2SLI A;  5FPX A;  1LOA A;  2CTV A;  5FMB A;  4P9X A;  1UPI A;  4BIF A;  5BNN C;  5I0D A;  4RYD A;  5C8C A;  4W8J A;  1RXG A;  4TXW A;  1VBC 2;  2W92 A;  3S7E A;  4JDM A;  2RS3 2;  5ACA 3;  1KQR A;  3R0R A;  5IK7 A;  4JX0 A;  3MHZ A;  3MID A;  1N1Y A;  3RZG A;  4IQP A;  2ZX2 A;  3GHM A;  4RS5 C;  1V6L A;  4I01 A;  5FJH A;  4B3N A;  1J3Q A;  2Z42 A;  1ZRD A;  3H0O A;  2ZS6 B;  1W2O A;  3C7H A;  3ZDS A;  4UBG A;  1TZO A;  1H8T A;  2ZPX A;  4CEW C;  3JD7 3;  2WO1 A;  2OVU A;  1G9D A;  2ENR A;  3U11 A;  3ZYP A;  3ZSL A;  2BUK A;  3ZN6 B;  2WZP P;  1RUJ 3;  2YC4 A;  3LB9 A;  2A73 B;  4PBP A;  4CCM A;  2A6V A;  5DDJ 1;  1UYP A;  2HWD 3;  2RS1 3;  5FK7 A;  4OUE A;  1B35 A;  5BPX A;  4ES8 A;  5KHI A;  1OA2 A;  4QPG C;  2Y6L A;  4AQ2 A;  1R1A 3;  4XJA A;  3HN3 A;  3WG2 A;  3BKZ A;  1EYB A;  2R0F A;  5JMO A;  5DMY A;  2J1U A;  1RMU 1;  2ZML A;  3O0V A;  3WW1 A;  3LOI A;  2WO3 A;  3FHA A;  4RR3 C;  2PQS A;  1CGP A;  4XIL A;  4P14 A;  4NHX A;  4PHZ A;  5A3U A;  3DL3 A;  4URT A;  3HOB A;  4ZZ5 A;  1YUD A;  4N53 B;  4N7I A;  1DF0 A;  1UU6 A;  4YZ2 A;  4NO4 A;  5DDJ 2;  2WWU A;  5JXG A;  5DAP A;  1LOC A;  2D3S A;  2F17 A;  1RYY A;  1H2N A;  3IMM A;  4ARX A;  3GZT B;  3ZPY A;  5FO8 B;  3LD8 A;  4JDN A;  3FLT A;  5A3W A;  3SCG A;  1VBB 1;  2C24 A;  2JE7 A;  4LIT A;  3ZOI A;  1YJK A;  5FZ8 A;  5D8A B;  1A8D A;  4XUP A;  1VMF A;  4NPM A;  5CEH A;  5JZG A;  1W6N A;  2A5Z A;  3W5M A;  2CHH A;  4IEX A;  1HXS 3;  1RMU 2;  3NNG A;  1YFX A;  1BK1 A;  3AM2 A;  1IQA A;  2XVK A;  4C1W A;  4GZ9 A;  1WLC A;  5FBJ A;  1PZ9 A;  4E9K A;  4HG6 B;  1XSR A;  5ABJ B;  1GZW B;  3FUO A;  1SLL A;  4YG6 A;  4Q0Q A;  4B1L A;  4NJ4 A;  3I3D A;  5CIS A;  2VG9 A;  2A3W A;  4AYU A;  2BDR A;  4CCL A;  1UF2 C;  1KXG A;  1VBB 2;  2DBN A;  3SH3 A;  4OI4 A;  4RQP C;  5BNN B;  4CUG A;  3ACL A;  3W5N A;  2ZOE B;  1E5I A;  2H6B A;  2A75 A;  4A7Z A;  4I0B A;  4ZKT B;  1W0N A;  4YLZ A;  4GAL A;  2DVB A;  3KS7 A;  3B3Q E;  4OI2 A;  5DUX A;  5DAB A;  3ZXE A;  4EN0 A;  5F1R A;  1JXN A;  1W8T A;  4QX5 A;  4CDW B;  5HV0 A;  1M06 G;  1O3R A;  1DLC A;  3FFQ A;  4B8E A;  5IFT A;  2PHL A;  2GNT A;  1UYZ A;  1IZ3 A;  4FPL A;  1R64 A;  3D0S A;  5FP3 A;  5FZL A;  2Q8C A;  2DCZ A;  4YW2 A;  4CCK A;  2VOV A;  4BXS V;  4PQ9 A;  4Q0U A;  1JHJ A;  4MGQ A;  1C4R A;  4QPI C;  2AC1 A;  3AL5 A;  2R04 1;  4RSU A;  4OMC A;  4XE9 A;  5HV4 A;  1W3X A;  1XB9 A;  2D43 A;  4IER A;  5L19 A;  1O59 A;  1IS6 A;  4LK7 A;  5F5C A;  3BIE A;  2B9U A;  1F4A A;  3IPV B;  3MLK A;  4I02 A;  4HON A;  4BQ4 A;  1F9K A;  1UL9 A;  4XUN A;  3BTX A;  2WUH A;  1Q8Q A;  1ENX A;  1GOG A;  3MIH A;  3PNA A;  4UF0 B;  5GLT A;  4CDX A;  1BBT 1;  3JQX A;  4JZR A;  2XG3 A;  5BUV A;  1US3 A;  4X8P A;  4FOQ A;  5DDJ 3;  4DRV A;  5DAW A;  5APA A;  5FLI A;  3V65 A;  1IKQ A;  2R04 2;  3FC0 A;  2D6M A;  2XKO A;  4EN7 B;  4I30 A;  5DQ0 A;  3I3Q A;  3RYP A;  3EYP A;  5A33 B;  4OHX A;  5FUN A;  1UMI A;  2W1Q A;  1OXC A;  3A21 A;  2JE9 A;  3OJB A;  4LBJ A;  5CFD C;  2CSG A;  2AEY A;  3JB8 A;  3HBZ A;  2A6W A;  1GYK A;  2GSY A;  1Q3E A;  2D6L X;  2DV9 A;  4Q0V A;  1RMU 3;  1S0E A;  4CXW A;  4FTE A;  4LT5 A;  5I0R A;  3TYJ A;  3BOD A;  2LTN A;  4I3P A;  2PHX A;  1CJP A;  1DHK B;  2EIG A;  3GJB A;  1CAU A;  1W6M B;  4K1Z A;  3BUC A;  5CFC A;  1BBT 2;  2CWS A;  1HB4 A;  4XTP A;  1CIW A;  4NIH A;  4XPV A;  1E5S A;  4XF0 A;  5FDB A;  2R32 A;  1QDO A;  4QAW A;  1K42 A;  2DFC A;  1YWK A;  4KI5 M;  2EXK A;  1JZ8 A;  3KM5 A;  3WW2 A;  1F5F A;  1KS4 A;  1VBB 3;  3CU7 A;  2TUN A;  1V6I A;  5FZD A;  4NMI A;  3PUR A;  1LNS A;  4GKX A;  1HW5 A;  3KV6 A;  4BQX A;  2DUR A;  1VAK A;  2BWC A;  2DWR A;  1BLZ A;  1RJ8 A;  1K3I A;  3I59 B;  3NAP A;  1U0A A;  4P9W A;  5A7W B;  3WG4 A;  5KXB A;  1UNB A;  5LW9 A;  2VVE A;  4FBF A;  2JD4 A;  4NRO A;  3KQR A;  3J8F 1;  2A6Y A;  4OUL A;  1C28 A;  2J1T A;  1XQN A;  3RZJ A;  2MPF A;  1JUI A;  4A41 A;  3AJZ A;  1UIK A;  1WBF A;  1YNA A;  1AL0 G;  5DUU A;  2Z2S B;  5HI0 A;  4I0W B;  4V1P A;  4O9G A;  2FZ2 A;  3OBZ A;  3VBR A;  3NV3 A;  1UMZ A;  4QPI B;  1KDK A;  3ES4 A;  2Q8E A;  4FTB A;  2VAU A;  3AFG A;  1ENQ A;  4I2O A;  1GOH A;  3SKV A;  2GP3 A;  2WNU B;  4NHL A;  2NPI A;  3B00 A;  4GKY A;  5JOW A;  3H1M A;  5C4W C;  3VDD A;  2VOT A;  4Q8L A;  3J8F 2;  4AEM A;  2ILM A;  5F7U A;  5GLZ A;  1QIQ A;  3NV4 A;  4Y5S A;  4UFK A;  3EB7 A;  3T4H B;  4ZU4 A;  3HT2 A;  1YC6 1;  1SZB A;  2R04 3;  3CJI C;  4DIQ A;  2UY8 A;  2VCC A;  4P9Y A;  3OG2 A;  4FPY A;  4JHT A;  3S57 A;  1W8W A;  2JG9 C;  3ME2 A;  4KBB A;  1RHI 1;  3WNP A;  1PM7 A;  4QKF A;  5F5I A;  4FCA A;  1TNR A;  4WM7 B;  5LRR A;  1N3O A;  4AED A;  3BU0 A;  3N9N A;  4E2Q A;  2QZ3 A;  1S55 A;  1V70 A;  2W5F A;  5FXV A;  1UXZ A;  2E31 A;  4YVS B;  1VB2 A;  1K12 A;  1X8M A;  3A0N A;  4PLO A;  2WC2 A;  5CFD B;  2XON A;  4JGZ A;  1HRV 3;  2GAU A;  4FXK B;  1MEC 1;  3IB3 A;  1BBT 3;  4PI2 A;  2Q30 A;  1STM A;  2Q8O A;  5JXJ A;  3VZK A;  4CCC A;  5ISL A;  4TLF A;  4GWM A;  2JX9 A;  5A7S A;  1VBE 1;  2CNA A;  1ZA4 A;  1S0I A;  1MS8 A;  4GWJ A;  3KF3 A;  1HLC A;  1RHI 2;  2VW2 A;  3M1H A;  3U37 A;  4DZG A;  4Q27 A;  3ZSK A;  5I0U A;  3THC A;  4A42 A;  4BWO A;  3AP4 A;  4HKW A;  3PIG A;  1I6X A;  3ZDV A;  5T50 A;  2K0G A;  2P3J A;  3CQO A;  1UYY A;  3CF6 E;  2IZW A;  2P2K A;  1MEC 2;  5FPL A;  4Y1Z A;  1QDC A;  4LBM A;  3NJY A;  4ZY9 A;  5LCW L;  3ZSM A;  1GZ9 A;  2JXA A;  2AR6 A;  2I45 A;  1QWR A;  1LU1 A;  1W2T A;  1VLN A;  3A22 A;  2VOX A;  5FZH A;  1VBE 2;  4Y5Z 0;  1L3J A;  1HV1 A;  4MV2 A;  1QQP 1;  4CZS A;  4QDS A;  3OGV A;  3ZYR A;  2E7T A;  1UU5 A;  3O1V A;  3I2H A;  4WVW A;  1RVF 1;  1RUF 3;  1BHG A;  4XQD A;  1LOF A;  4CP1 A;  1H4G A;  2FMY A;  3SEE A;  2HWF 3;  3QH6 A;  1OD3 A;  3ZMO A;  1QJE A;  5I8S A;  3J8F 3;  2PTM A;  4O61 A;  2Y33 A;  1DYO A;  3ZFF C;  2WYS A;  2VR4 A;  2RJ2 A;  2VH9 A;  4LO8 A;  4RFR B;  4FO9 A;  3HNY M;  3MW2 A;  3WDV A;  2P4E A;  2W95 A;  3TBD A;  5C4W B;  2CWM A;  1V9U 1;  2WZR 1;  2DTW A;  5SV5 A;  5T5J A;  4BE3 A;  4R9C A;  1QQP 2;  2ZEW A;  4EZ4 A;  1Q8S A;  3ZLI A;  4JGY A;  1OLM A;  1NUK A;  1OLR A;  3W59 A;  2WO2 A;  3K3N A;  5C3R A;  3ZYH A;  5FY8 A;  1RVF 2;  5E16 A;  2OX0 A;  4IND A;  3POI A;  1KD7 A;  3MUY 1;  3N9M A;  3ZYF A;  3MPB A;  2JG9 B;  1POV 1;  3UYJ A;  3ZXA C;  3OPW A;  3V0A A;  1AX0 A;  2OQ6 A;  2PHD A;  3ACF A;  2P17 A;  2JG8 B;  1Q8V A;  5J48 A;  1C1F A;  1H2L A;  1JU4 A;  1W2U A;  2Y64 A;  1Z0H A;  4KQ7 A;  1QEX A;  3JBG 1;  4XFH A;  3WDT A;  2WZR 2;  1V9U 2;  3VBH A;  5E6H A;  2VCA A;  4UFM A;  3VDA A;  3N7K A;  1PZ8 A;  1RHI 3;  2CY6 A;  2DUQ A;  1PX4 A;  1OQ1 A;  4XYX A;  3UT0 A;  2V4A A;  2NLR A;  2R0H A;  3AVS A;  1ND3 A;  2JIJ A;  1LRH A;  1OLM E;  4Q8K A;  1S2K A;  1LCL A;  3F95 A;  1D4M 1;  3UET A;  4E4Z A;  5C9A C;  2BGC A;  1J58 A;  3P6B A;  1JZ6 A;  3IMN A;  3VBF C;  4KMQ A;  1MEC 3;  4CSW A;  3N4M A;  3M70 A;  2QQU A;  2WZE A;  1CAX A;  2GMM A;  4AVS A;  4KBZ A;  3JBG 2;  5BNP C;  2XXZ A;  1VJ2 A;  3AKP A;  3MIB A;  4AXO A;  1VBE 3;  4LO7 A;  3AMQ A;  3FBY A;  4FPG A;  3VKM A;  4WVZ A;  5CU1 A;  3URF A;  5SV8 A;  2EIB A;  4U2A A;  1IS4 A;  2K2S A;  1AXY A;  4AFM A;  3PMS A;  1EUU A;  5DG1 A;  2NN8 A;  4GH4 C;  5C3O A;  3ILN A;  5AFE A;  3UV9 A;  1D4M 2;  1DZT A;  1MZ5 A;  2LM3 A;  3POG A;  2ZBJ A;  2UWA A;  4H14 A;  5EIY B;  4XIO A;  4BHP A;  1Y3T A;  2E7Q A;  2PHT A;  1AZD A;  4IEO A;  3VBO B;  1OLQ A;  1OPM A;  3OGG A;  4DNY A;  3OEA A;  4EWE A;  2GC0 A;  3OYW A;  2D6O X;  3VZL A;  2D5H A;  4LUK A;  1UOJ A;  1YLL A;  4PIZ A;  2WFP A;  2ZGQ A;  4ISR A;  1BVV A;  2QQM A;  1ST8 A;  4HPK B;  4Z2W A;  4QGL A;  3TEY A;  4HXC A;  4RD7 A;  3PUH A;  2XL7 A;  5FXZ A;  4DPN A;  1V6J A;  5JPN B;  4JVA A;  1FPN 2;  4PBO A;  5IHR A;  4QX3 A;  4ERO A;  5K0U C;  1E5R A;  3ZFG B;  5A6Q A;  4ZU5 A;  3WV6 A;  2EA7 A;  4Y22 A;  4C0H A;  2XJU A;  5FTT C;  4M3C F;  1DQ5 A;  5JSR A;  1QHD A;  1SCS A;  4IUG A;  4LE3 A;  4WVM A;  4YYO A;  3RYK A;  3IZO A;  4COV A;  1EP0 A;  1W05 A;  4QWN A;  1JMU B;  4V2V A;  3PDQ A;  3IAP A;  3ZM8 A;  1ALY A;  1V0A A;  4KU8 A;  1JYC A;  3JUU A;  1V9U 3;  2YB7 A;  3O1O A;  1W28 A;  1WA4 A;  3LDB A;  5KXC A;  4AFB A;  4B4Q A;  2XJP A;  2BEO A;  1Q56 A;  3K4D A;  2FDK A;  2DCK A;  2XOM A;  1POV 3;  4MET A;  4QQP A;  4QX7 A;  2EAA A;  4WZF A;  4EV0 A;  3GYD A;  2PYT A;  4AGV A;  3WUD A;  4QB6 A;  4EN6 B;  5FP7 A;  5C3P A;  1LGN A;  3LE0 A;  2PHR A;  2EVX A;  1LEC A;  4CE8 A;  2JE8 A;  4QHB A;  2GH2 A;  5DPN A;  1SMV A;  3JBG 3;  4DOU A;  5A6X A;  5LY1 A;  4LO5 B;  2CDO A;  1Y4W A;  1WME A;  4FQ4 A;  1FV3 A;  2R07 1;  5A7P A;  5JI7 A;  5KXE A;  5EXO A;  1RUI 1;  5FLJ A;  2BNN A;  2WL1 A;  3ZIW A;  1XYN A;  3U1X A;  4Q4V 1;  4HVR A;  4LIV A;  4COU A;  2AEZ A;  3VBU A;  2C6S A;  3DGT A;  3MV0 1;  3VBS C;  4EZH A;  1OSG A;  4WM8 A;  5KBF A;  4BU2 A;  1J1L A;  2XJQ A;  4KG0 A;  3B5L B;  1OFS A;  4LKE A;  2JDK A;  1Y43 B;  2ZAA A;  3WNM A;  3ZX7 A;  4LIU A;  4OLL A;  3RRD A;  4GH4 B;  2V09 A;  4NRQ A;  5CNA A;  5CAD A;  4QT6 A;  2BWA A;  3QAC A;  4XFC A;  5D2A A;  1G9B A;  4P9I A;  4BB3 A;  4LBK A;  5A3L A;  2VNO A;  4XMA A;  2R07 2;  3RZH A;  4NUB A;  3D0J A;  5IW0 A;  1RUI 2;  3LEG A;  3LQC A;  5C6C A;  2ZEZ A;  4GB3 1;  4Q4V 2;  5F3I A;  5FOJ B;  1DG6 A;  3KHC A;  3WG1 A;  3AL6 A;  2BBV A;  5KWR A;  4DXT A;  3WR0 A;  4K7J A;  3PU8 A;  4H55 A;  2VBP A;  2XDV A;  5K8S A;  1TME 2;  4XOG A;  2EIE A;  5LBE A;  5T3N A;  3NNJ A;  3RWK X;  3SKJ E;  3U4S A;  1LHU A;  4XF4 A;  1HQN A;  1FI2 A;  4D8M A;  5IVF A;  3OY8 A;  5LA1 A;  1NLS A;  2O1Q A;  3ST7 A;  1DGL A;  1RTV A;  1MQT A;  2X09 A;  2XJS A;  3ITQ A;  3N9L A;  4Y1U A;  3R4U A;  1QGL A;  3U14 A;  4IL7 A;  3AXD A;  4XXA A;  5A80 A;  4GB3 2;  4NPL A;  3AYD A;  5LAS A;  5IVB A;  4IGQ A;  1A8M A;  1VBA 3;  5T5L A;  3RI8 A;  1BMV 1;  5CZK A;  1S0B A;  4LOT A;  2Y60 A;  2A71 A;  1XE8 A;  3FX3 A;  1SHW B;  2BVV A;  5H9P A;  4CEY A;  4IE0 A;  2ID4 A;  3LCP A;  4M0H A;  5F2W A;  3WW3 A;  1C8N A;  4CDU A;  5LK7 B;  5K4L A;  5GM0 A;  3RYR A;  5C8C C;  5A3O A;  1WW5 A;  2X53 S;  5CG8 A;  3WDW A;  1POV 0;  4DS0 A;  4YZ1 A;  4E27 A;  5IAT A;  2W1W A;  3D5O A;  3ACI A;  3U0Z A;  1PK6 C;  2YV8 A;  2Y8K A;  2W39 A;  4M0N A;  2KA3 A;  3POY A;  4P5Y A;  3S30 A;  4YM3 A;  3HWJ A;  3T2O A;  1WCQ A;  2XR4 A;  2WT2 A;  4QXK A;  1AR8 1;  4DMI A;  3S0M A;  5EJ3 A;  4XJZ A;  4IES A;  4P9G A;  1BMV 2;  4XVH A;  3PJQ A;  3I2O A;  3KVB A;  1WBL A;  2XGX A;  4R4X A;  4AVC A;  1X82 A;  5FFO C;  3EQE A;  5C71 A;  3LIH A;  4OVE A;  4AAP A;  2E51 A;  1FXZ A;  1JHN A;  4JAA A;  1EPW A;  3S5Q A;  2WT1 A;  4KWL A;  5CAZ A;  1S2B A;  1B35 C;  4UAP A;  3WZ1 A;  3NNF A;  2R07 3;  4BM8 A;  2NM1 A;  2W08 A;  4Q4V 3;  1AR8 2;  2P37 A;  2VZ1 A;  1OKO A;  2ZHN A;  2PXJ A;  3I7D A;  3L2H A;  2DVG A;  4FOY A;  3MF6 A;  2XHN A;  2GDF A;  3JD7 1;  4S2H A;  1JYX A;  2X5I A;  1G9A A;  1W06 A;  3NMB A;  2H0V A;  3Q8F A;  3PLQ A;  3R4S A;  4FPE A;  4PLN A;  1C5I A;  2HWD 1;  2ZGL A;  3J4U H;  4RA0 A;  3BGA A;  4OYU A;  4B29 A;  1CPN A;  4QB2 A;  1ENS A;  1DDL A;  3OF1 A;  4FOV A;  1X7N A;  4KNC A;  1NT0 A;  1RUE 3;  2QNK A;  5JZG C;  3O12 A;  1XE7 A;  2WLP A;  3SNM A;  4GB3 3;  3C2U A;  2OT7 A;  3E6B A;  4W6Y A;  1W6Q B;  1X33 A;  4XHB A;  1K5M B;  3JD7 2;  5DN2 A;  4YGC A;  3RJ2 X;  4WBB A;  3VHO A;  3WCS A;  2JDP A;  3ZXD A;  4ASK A;  1W04 A;  5LRS A;  2FCV A;  2VW1 A;  4E4D X;  1KRI A;  5FQ0 A;  3SQO A;  2FQP A;  5FZ7 A;  4IEQ A;  2Q4S A;  1UCX A;  1SLC A;  5F5Q A;  4BXF A;  1N1V A;  2DCY A;  3D3A A;  2HWD 2;  4YGE A;  1A34 A;  1O5U A;  1WLD A;  2B45 X;  1H1M A;  3CO2 A;  3J7L A;  2B42 B;  3POB A;  3I3E A;  1XND A;  4ISQ A;  1EUT A;  1RUH 1;  3IBM A;  1X8E A;  3P5B A;  1S2E A;  5EFU A;  3VZO A;  4IV3 A;  3WNN A;  4BJ0 A;  3LOB A;  2VQ0 A;  3KT1 A;  2LRP A;  4QM9 A;  5C8C B;  2Y0I A;  1DQ1 A;  1GQH A;  5FZ0 A;  2OZ6 A;  3QH7 A;  4FP3 A;  3WLU A;  1XU1 A;  1LKN A;  3LSE A;  2ARX A;  1H30 A;  1SAC A;  4DIN B;  4LO4 B;  3RVH A;  1PK6 B;  3TAY A;  4OFG A;  1H8V A;  3T3Y A;  1JBC A;  5LBF A;  3CNA A;  3TN9 3;  4MX3 A;  2QQI A;  5EV7 A;  3ECQ A;  1VMJ A;  1H8T B;  3POS A;  4YAR A;  5I8Y A;  2VZR A;  2WNV A;  3M4F A;  2XKP A;  5D8A C;  4MG2 A;  1UKR A;  2ZX4 A;  1RUH 2;  4FXG B;  4MH0 E;  4PI0 A;  4AEJ A;  3MIC A;  3ON7 A;  1LES A;  4U36 A;  3P1I A;  2W91 A;  3AX4 A;  1SFN A;  4GA9 A;  5FYB A;  1PZ7 A;  2VL4 A;  2XUM A;  1QXR A;  4P5H A;  5ABJ C;  2BRT A;  2IXK A;  1B35 B;  5F9T A;  3HNB M;  1AR8 3;  4UFI A;  2HLE A;  4PDW C;  4KWU A;  1ULF A;  4KWK A;  4XFI A;  4CDQ C;  2AZ5 A;  2QKD A;  5FIX A;  2QFE A;  5C5T A;  5AFB A;  1W8O A;  2XQR A;  4XAA A;  2B7Y A;  4YVW C;  1FYU A;  5IVY A;  4H7M A;  2WIN B;  3M8L A;  4IEV A;  4LE4 A;  4XCA A;  5A6Z A;  4SLI A;  5JI9 A;  2BP6 A;  3E6C C;  4YM1 A;  2ZMK A;  2ZMN A;  2F4P A;  1YQ5 A;  5A6Y A;  5GZC A;  1W8U A;  2UU8 A;  4CUA A;  5JUV A;  2YC2 A;  5FZB A;  2Q8D A;  2XPJ A;  2D44 A;  1I1E A;  4M3C A;  4CDW C;  5IVJ A;  1V6M A;  4N8M A;  1UZZ A;  2YBP A;  5CIR A;  1PNF A;  3CLP A;  2GNB A;  2XL9 A;  2BGO A;  2ZX3 A;  4GJZ A;  4QGM A;  5FZ3 A;  2FHR A;  4Y20 B;  5JZG B;  4UW3 A;  3I97 A;  3C7E A;  2UYA A;  4AI9 A;  4L8Q A;  2VE1 A;  1MS1 A;  3C7G A;  5FYV A;  1O6U A;  4CCE A;  4CP0 A;  1XNA A;  2BZD A;  4NIG A;  3VD5 A;  4QD2 A;  3KWV A;  5T5O A;  2CGO A;  5FRA A;  2F6B A;  1VPH A;  2FDF A;  2EXI A;  3ILR A;  1LGC A;  1QU0 A;  4N9H A;  1US2 A;  1YEW A;  2VZV A;  2JB4 A;  3OTF A;  4QKB A;  3EO6 A;  2GN3 A;  5FZM A;  1HX6 A;  2WDB A;  3IT8 A;  1ENR A;  1DZR A;  4E8D A;  4RHV 1;  3N7M A;  4LMF A;  1UIJ A;  4IV1 A;  1ZRE A;  4JTN A;  2GND A;  2VQU A;  4XBL A;  4ZON A;  2C9K A;  3I2G A;  4M3C E;  4AI1 A;  2JKX A;  3JB4 C;  3WF2 A;  2G9F A;  4C0B A;  4LPL A;  4JCK A;  4A44 A;  1NYW A;  3CKH A;  1W03 A;  3NQH A;  4OHY A;  4LXL A;  1L7Q A;  4XEZ A;  5FWE A;  3ZFE A;  1AJK A;  1WW4 A;  2P34 A;  4K6B A;  1SLT A;  3RG0 A;  3RMY A;  3UGG A;  4CCN A;  4MGT A;  1REF A;  3I2J A;  5DG2 A;  1GQP A;  3VHR A;  1REE A;  1RUH 3;  3M3Q A;  1UD1 A;  3I8T A;  5FPB A;  3ZPO A;  3VD3 A;  4UFL A;  1GWM A;  5FXW A;  3K2O A;  3T0A A;  3VBR C;  1OOP A;  5FAX A;  3KQ4 B;  4RHV 2;  1H0B A;  2PHU A;  4YM2 A;  1OBN A;  1G8W A;  3SCH A;  4F7Z A;  3AP7 A;  3APB A;  3QCW A;  3AZX A;  4IEY A;  3N9O A;  4AQT A;  4PDW B;  1QH6 A;  3H8X A;  3H1W A;  4CDQ B;  3UKT A;  3GBG A;  3WG3 A;  1WW6 A;  4B4R A;  4QGN A;  4CDX B;  4YVW B;  3VHP A;  3TNP B;  3VL8 A;  2PN5 A;  2QQK A;  3AJY A;  1A6C A;  1LOB A;  2VQA A;  3OGJ A;  4NR1 A;  3T1L A;  1WD3 A;  1GNZ A;  4XXP A;  3T2P A;  5F3C A;  2Y6H A;  5LEJ A;  1XNT A;  1VR3 A;  4LKF A;  4XC9 A;  1NXM A;  3VHN A;  2D5F A;  3VL9 A;  1EPZ A;  3HPN A;  2WR9 A;  3DPR A;  1R1Z A;  5FYI A;  1ASJ 3;  1VP6 A;  5FP8 A;  2ZJC A;  2J1S A;  2AAC A;  5LZ6 A;  4FP2 A;  2LAL A;  1CAU B;  1JS9 A;  1RJ7 A;  4NE9 A;  4JDO A;  5H9R A;  5CFC B;  3GM8 A;  1NQD A;  2IVJ A;  3DXT A;  1HB1 A;  2PMW B;  2VOK A;  2WNU C;  3A0K A;  1CX4 A;  3AK0 A;  4XFG A;  3W21 A;  3K51 A;  4N53 A;  4AFD A;  2QJV A;  1N3Q A;  4NWW A;  2WKK A;  1KJR A;  1W8N A;  1HRV 1;  4ATE A;  1AYN 3;  2HWC 1;  4A6O A;  1JH5 A;  3NAP B;  4NHK A;  3UJQ A;  1JZ3 A;  3Q8B A;  4LBQ A;  1F2N A;  2QQO A;  2P6H A;  3H42 B;  4CXX A;  4LBL A;  4WM7 C;  1FT9 A;  1SDD B;  2VC9 A;  1G9F A;  3FZ3 A;  4Z1V A;  3ZSJ A;  2RMU 1;  1XC6 A;  2SBA A;  1GLH A;  3FUQ A;  3JU9 A;  4QPW A;  5D1I A;  1RGS A;  1FNY A;  1CPM A;  4M01 A;  4YVS C;  4XFA A;  5CG9 A;  3KB5 A;  4R9B A;  5LA2 A;  1NQJ A;  1W99 A;  2BNO A;  3NNM A;  4RHV 3;  1O91 A;  4I09 A;  4QU2 A;  3ZYJ B;  1OMI A;  4FAG A;  1UN1 A;  5A7N A;  5J1X A;  2VME A;  5JSO A;  1V00 A;  3T2T A;  4MO3 M;  4EQV A;  5BY5 A;  1HRV 2;  3VBR B;  4UBH A;  3WNO A;  3J7H A;  1N1T A;  1I3H A;  1W6P A;  2HWC 2;  2RS5 1;  3MFC A;  4J1X A;  4Y33 A;  2GAL A;  5EWS A;  3WP5 A;  4D7Y A;  1JZ5 A;  4TYS A;  2VUJ A;  4MVT A;  3AFK A;  2RM2 3;  2XQX A;  4MUV A;  3UKN A;  3SIT A;  3ZMN A;  1UZV A;  3EHK A;  3ABZ A;  3J9S A;  2NP0 A;  3VDD B;  3RI9 A;  3K3O A;  2RMU 2;  5IJR A;  1J1T A;  1E57 A;  3P3N A;  4RS5 A;  3ZVX A;  4PF1 A;  3VKL A;  3TRS B;  3O1R A;  5CBL A;  1JZ7 A;  1UZY A;  1RUF 1;  3NNL A;  3E5Q A;  1S0C A;  4AVA A;  3LEK A;  2DCT A;  2YFU A;  3MZH A;  2HWF 1;  2QBX A;  2E6V A;  1GZT A;  2PQQ A;  1AF9 A;  2IWG B;  2RS5 2;  3H3L A;  1RL3 A;  3AC0 A;  3N9Q A;  4AAX A;  4AED B;  1O5L A;  4ASM B;  3Q8A A;  2E63 A;  4HKL A;  1S0F A;  4AVV A;  5JOY A;  2WA3 A;  2DCJ A;  2HWE 1;  4JGZ B;  1J84 A;  4DB5 A;  1VAL A;  1HN0 A;  3CBN A;  3FWE A;  3IDB B;  4QPG A;  4MHU A;  3AZW A;  4CYD A;  1EY2 A;  1AX2 A;  2XJR A;  5IK4 A;  1G6N A;  2CV6 A;  5FY7 A;  4BK4 A;  1RUF 2;  2HEW F;  3I54 A;  4XDO A;  2Z5W A;  2IXL A;  1YQ8 A;  4DQA A;  2V73 A;  2HWF 2;  4RR3 A;  2CGP A;  2WWS A;  3HD8 B;  3RQ0 A;  4HN1 A;  1JZ2 A;  2QQP A;  3KV9 A;  4UI9 L;  2GME A;  1ZRF A;  2WN3 A;  3IIA A;  3GHN A;  5I91 A;  2HWE 2;  1CAV A;  3KLS A;  3LFM A;  5EP9 A;  4D94 A;  1AL2 1;  2IFW A;  5JMC A;  4KGG A;  3LPG A;  1W6M A;  4LEJ A;  2CDP A;  2O8O A;  2G9Z A;  4JKL A;  2CAV A;  3Q9O A;  3POJ A;  3VB9 A;  5CYY A;  2WS9 1;  2FDG A;  1NLR A;  1LHN A;  2JG8 C;  5IVC A;  3AMM A;  2WRA A;  5FMO L;  4R8H A;  2Z79 A;  3GJA A;  2XLF A;  1I5Z A;  3JQW A;  2D97 A;  3K46 A;  4LHK A;  2HWC 3;  4NAM A;  4AEK A;  4LNV A;  4TLG A;  4LA3 A;  2VQT A;  2VZU A;  4FOW A;  1WCS A;  2JDN A;  3UGH A;  3USS A;  1Z7S 1;  4FFI A;  2WBK A;  1IPS A;  5GKA C;  1AL2 2;  3KT4 A;  4RQP A;  4AK3 A;  1HRI 1;  2RMU 3;  4MHR A;  4OHZ A;  1WMX A;  4Z82 A;  1UXX X;  1SBD A;  2D6N A;  3I4I A;  2WYF A;  4HFS A;  4IEW A;  2WS9 2;  1YHF A;  1MS3 A;  1IPK A;  1G86 A;  1W9Y A;  3FMG A;  3WP6 A;  4JGY B;  1H2K A;  3H3Z A;  2DUP A;  2RHP A;  2D3R A;  3OGS A;  3LA7 A;  2YPJ A;  4QX0 A;  2RS5 3;  1BEV 1;  1BCX A;  1YYN A;  3MV1 1;  3HMY A;  2YPD A;  5EYX A;  3ZSE A;  2ZKL A;  2BYV E;  4AZZ A;  1QXP A;  5A1F A;  3RS6 A;  4B1M A;  1Z7S 2;  4CCD A;  2WLQ A;  1DBN A;  1AR9 1;  3KGZ A;  1HRI 2;  3H8U A;  1ZA7 A;  3VKN A;  4N43 C;  5A3M A;  3SH5 A;  2B9V A;  1WGP A;  2FDI A;  3J7M A; 
#chains in the Genus database with same CATH homology
 4XDP A;  3UYJ A;  5FZM A;  3OPW A;  5FZ6 A;  2OQ6 A;  4IGO A;  2YU2 A;  4TN7 A;  5A7P A;  4EYU A;  4LIV A;  5FPV A;  3K3O A;  4EZH A;  2Q8E A;  4D6Q A;  4GJY A;  5FY1 A;  4BU2 A;  5A1L A;  5F3E A;  4IGP A;  5E6H A;  5FZ1 A;  2GP3 A;  5FYC A;  5FXX A;  4CCL A;  4LXL A;  4Y4R A;  5FWE A;  5IVV A;  5FP9 A;  4LIU A;  5F32 A;  4CCN A;  2OT7 A;  5FZG A;  2W2I A;  4CUG A;  5FWJ A;  3AVR A;  5KR7 A;  4ASK A;  3AVS A;  3N9Q A;  5FPB A;  3ZPO A;  5FYU A;  2OQ7 A;  4D6S A;  5FXW A;  3K2O A;  5FZ7 A;  3PUA A;  4NUB A;  5IW0 A;  3OPT A;  4DIQ A;  4BXF A;  5FZO A;  5A3T A;  5FUP A;  4CSW A;  5F3I A;  5A3N A;  2XUE A;  3AL6 A;  5F5I A;  5FV3 A;  5FP3 A;  2Q8C A;  3PU8 A;  3N9N A;  5LY1 A;  5F5A A;  3N9P A;  5FZL A;  5FZI A;  4CCK A;  2XDV A;  2XXZ A;  5FXV A;  3N9O A;  5FY7 A;  4DO0 A;  3U4S A;  4XDO A;  5FY9 A;  5FZ0 A;  3AL5 A;  2P5B A;  5FY5 A;  5FZF A;  5F39 A;  5IVF A;  4QXB A;  5FJK A;  3RVH A;  5A3P A;  5FZO B;  3KV9 A;  3N9L A;  5F5C A;  5ISL A;  5F3G A;  4HON A;  3PTR B;  5A7S A;  5A80 A;  5FZC A;  5A7Q A;  5F3C A;  4UF0 B;  5IVB A;  4IGQ A;  4V2W A;  5FJH A;  4Y3O A;  5IVE A;  5FYH A;  5FZ4 A;  3U78 A;  4E4H A;  5FY0 A;  4QU1 A;  5ANQ A;  5FYI A;  5FYB A;  5FP8 A;  5FPA A;  3PUS A;  5F2W A;  5FYY A;  5IVC A;  4UF0 A;  5FPL A;  5K4L A;  4C8D A;  5FXZ A;  3KV5 A;  2GP5 A;  1VRB A;  3NJY A;  5FYT A;  5FYM A;  5FUN A;  5LWB A;  5F2S A;  4CCM A;  4HOO A;  4CCO A;  3DXT A;  5FZE A;  5FYZ A;  5FZK A;  5FZH A;  4BIS A;  2YBK A;  5IVY A;  5A7O A;  3KVA A;  5FZA A;  4QWN A;  4V2V A;  4QXC A;  3PDQ A;  4GAZ A;  5FZB A;  2VD7 A;  3KVB A;  5LY2 A;  2Q8D A;  2XML A;  3KV4 A;  4GD4 A;  3LDB A;  5FP4 A;  5IWF A;  5FPU A;  5IVJ A;  4AAP A;  2YBP A;  2WWJ A;  5FZD A;  2YBS A;  5FY4 A;  3PUR A;  4GJZ A;  5FZ3 A;  3KV6 A;  4D6R A;  4AI9 A;  2WWU A;  2YU1 A;  2YPD A;  4QX7 A;  5F37 A;  5FYV A;  5FYS A;  5A7W B;  2OS2 A;  5A1F A;  3LD8 A;  5FZ9 A;  4EZ4 A;  5LW9 A;  3ZLI A;  5FP7 A;  5A3W A;  4URA A;  5A7N A;  3K3N A;  4LIT A;  4QX8 A;  5FBJ A;  5FZ8 A;  2PXJ A;  5FY8 A;  2OX0 A;  3PUQ A;  5CEH A;  3DXU A;  3PU3 A;  4QXH A;  4CCJ A;  3N9M A;  4Y33 A;  5A7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...