1O8PA

Unbound structure of cscbm6-3 from clostridium stercorarium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
PVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATUVE ENDO-XYLANASE
publication title Structure and ligand binding of carbohydrate-binding module CsCBM6-3 reveals similarities with fucose-specific lectins and "galactose-binding" domains.
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Hydrolase
total genus 30
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1o8pA00
3I3EA 2VZTA 1UYZA 2W92A 5CZKA 1W9SA 4P00B 3MO4A 1UY4A 3WNKA 1W9TA 2R7EB 4HG6B 3GM8A 3GDBA 1WKYA 2VMCA 2ZEYA 4XUOA 2J1TA 5DQ0A 2VZUA 1TVGA 4BXSV 3WNMA 1XNTA 3FL7A 4GWJA 3VD7A 1IQDC 3W5NA 1SDDB 2Y6KA 2V72A 3BN6A 2VOTA 3LPGA 1GOGA 3T0AA 1XPWA 1JYNA 3DECA 3P1IA 3VD4A 3T0DA 3VD9A 1XC6A 2C4XA 3VDCA 3C7HA 3WNNA 2VO5A 4LKSA 1NX9A 1NKGA 2EIBA 3T2QA 2CDOA 1O59A 2EICA 1EUTA 3OGVA 3ACHA 4FI9A 4OMCA 2ZEZA 5C71A 1UX7A 2WUHA 2WABA 3DYMA 4D8MA 3UETA 4A3ZA 3ABZA 2BGPA 3SEPA 1JU4A 4BK4A 2YC4A 4GWIA 2VM9A 1OD3A 5A1AA 2YB7A 2J7MA 1T2XA 4RYDA 2QBXA 5JXJA 5IJRA 1GQPA 4W50A 2VR4A 4JX0A 3I2FA 2Y6HA 4JKLA 5FUIA 1J84A 2LW8A 3E1F1 4ARXA 2V5DA 5EJZB 3T09A 1GUIA 2VL4A 2ORXA 1JZ2A 4A4AA 1UY2A 1DYOA 1K45A 4ZZ8A 2HLEA 1UY0A 4P5YA 2W46A 2W1QA 4DEVA 3U37A 2BGOA 3VDBA 2WDBA 2J1SA 2VC9A 2BZDA 3I2KA 4XURA 2QQKA 4JKKA 5F7UA 2Y8KA 3T2OA 3ACFA 2VMDA 1HN1A 3C7EA 4ZY9A 1XNAA 3ETPA 3BGAA 1W8NA 3MV11 4JKMA 4XUPA 1H6XA 4DUWA 3MBWA 5JR2A 2Y6GA 2VZ1A 2W1UA 4CUCA 1EUUA 2JD9A 4RN5A 1NAEA 4CUAA 4E8CA 1UMHA 2E31A 3ACGA 2LS6A 3K4DA 3OGSA 4AAXA 2WAOA 2W1SA 4OYUA 1J83A 2WYSA 3ECQA 4IUGA 1CIYA 1W8OA 3K75B 1KGYA 3IDAA 1L7RA 2XQXA 3HOBA 5C7GA 5IFTA 1JZ3A 3LEIA 4DXRA 2W94A 2VMFA 4KI5M 2QQOA 2OKXA 2QQNA 2L9LA 2VQUA 3HJRA 4BJ0A 2B4KA 3IAQA 4QB2A 2BERA 2VZ3A 1O8SA 2J1EA 1I5PA 2JKXA 1F4HA 3GXUA 4QAWA 1GNYA 1P8JA 4MGQA 3LPFA 3WSOA 2VCAA 3CMGA 3LQCA 3LEKA 1UMIA 3C7FA 1US3A 3I3DA 2J1UA 2DDUA 4CU7A 3JXSA 2VZVA 4ZZ5A 3IIIA 3WNPA 3WNLA 5JXGA 3WF2A 2WO1A 4AG4A 2WZ8A 3OBAA 3WF1A 3VD5A 4XUNA 1GOHA 3K4AA 5I0DA 1JZ8A 3PUIA 1BHGA 4OZOA 4CU9A 1CX1A 2VZQA 5G04L 2J22A 5C70A 5LA0A 2XOMA 1JZ4A 3CQOA 2ID4A 4QPWA 1GMMA 3CDZB 3K77A 3I2JA 5B4XA 3SEEA 3P6BA 1CZSA 3VDAA 2DCKA 2WN2A 1UXZA 2YG0A 1YQ2A 1GOFA 4XUTA 4DXSA 2W87A 4QX1A 2W9XA 2BBAA 3MUZ1 1UXXX 2C9KA 3DYOA 1LNSA 4LHSA 5JXHA 1UWWA 3FHQA 2J1AA 4QB1A 5B4NA 2ORZA 4DXTA 1TG7A 3MV01 2JDAA 5DMYA 3ACIA 2QQMA 3FN9A 5IYYA 1RYYA 3A23A 1JYVA 5JXIA 4PF1A 4KMQA 1UY3A 2VZRA 3J7HA 4LPLA 3WNOA 2WO3A 4QB6A 1W9WA 4CU8A 1JYWA 5LA2A 1W99A 4Z2AA 2Y6JA 2E32A 5IHRA 4YPJA 1UZ0A 4XUQA 3WF3A 1CZVA 4UI9L 4CU6A 4OMDA 1K42A 1UYYA 2X10A 4QX0A 4ARYA 4M4PA 3T0BA 4MADA 4P08A 2Y6LA 4GZ9A 1KEXA 2PQSA 3HEIA 3THCA 2YFUA 3OB8A 5EIYB 2XHNA 1JZ7A 3AC0A 3LE0A 1CZTA 3DYPA 3OEAA 4ZXEA 3NRUA 3A22A 3CIHA 1WCQA 2B9VA 2RV9A 2ZEXA 3IAPA 5EJ1B 1JI6A 2YC2A 1DP0A 1GU3A 1OF3A 3HN3A 1MPXA 3K46A 4OUEA 5CYYA 1R64A 1PMHX 2WZEA 2Z4FA 3GGLA 3C8XA 4CVUA 4E8DA 1US2A 3NQHA 3NJVA 3CZUA 4JHZA 3HNYM 3HNBM 3I2GA 1PX4A 3NNGA 4A44A 2YFZA 3I2IA 4M4RA 3A7QA 4BK5A 2W47A 2Y64A 1O8PA 4QDRA 3SKJE 2ZEWA 2C26A 3W5MA 1K12A 5HPOA 4UOJA 2EIDA 1K3IA 3CZJA 3C7OA 4A6OA 4A42A 2X09A 2RJ2A 3HNMA 2WBKA 4XZUG 2WN3A 3WF0A 3T2PA 5LA1A 1UY1A 2QQIA 1JU3A 2W95A 3OGRA 4CUBA 3OEBA 3NJXA 2XONA 1W0NA 3UESA 1NUKA 2CDPA 1PMJX 2VMEA 3FHAA 4MGSA 4QX2A 4L0PA 4MO3M 1PX3A 2VZOA 4W8JA 4DUVA 3HPNA 4XVHA 3A21A 4LQRA 4PT6A 5DN2A 1L7QA 4QDQA 4DEQA 4A41A 2EIEA 2E26A 3I3BA 2VTFA 3WF4A 5LCWL 4TXWA 2V4VA 3K4ZA 3T08A 2WAAA 1JYXA 5JMOA 2ZXQA 2WQ8A 1DLCA 3CKHA 4TTGA 3D3AA 1OF4A 2VZSA 1SG3A 1JHJA 2QQLA 5JUVA 1OT5A 3THDA 2E33A 3OG2A 3LEGA 3EYPA 4QX3A 3C7GA 5IFPA 5HXMA 2VCCA 1JZ6A 1ULOA 4A45A 1UYXA 4W4ZA 2W5FA 2VZPA 2HYXA 1D7PM 2J1VA 2VJXA 5DPNA 2RVAA 3PUHA 4QDSA 2JE8A 2W3JA 3UNPA 2X05A 3VD3A 3SKVA 3ZM8A 4ET7A 3MUY1 4P02B 3EB7A 2WO2A 4BDVB 3F2ZA 1SHWB 2W91A 2DCJA 2VQTA 2KD7A 4D0QA 4DUXA 3IB3A 5G05L 2J1RA 4PQQA 3WQBA 2VCBA 1ULPA 5J1XA 1H6YA 3I2HA 3I97A 3WEZA 1F4AA 2W1WA 4UAPA 1JZ5A 2QQJA 4KWUA 4MOAA 1OH4A
chains in the Genus database with same CATH superfamily
3I3EA 1WLDA 1RUF2 1NA1B 1CONA 3H3LA 3GNEA 3VHRA 5I93A 2DF7A 4HG6B 4R9CA 4LBQB 5IATA 1H4GA 3JB8A 5C3OA 2YBKA 4CZSA 3M70A 3T4VA 2XBO2 1OFSA 3AKRA 3E5UA 1HLCA 4HK8A 5E1RA 1TMF1 1OOPA 3WQ1A 2PMWB 4NRPA 4QU2A 4CSWA 4EZ4A 3IM0A 2J1TA 5CKMA 5DQ0A 1AUYA 1PGW2 2DUQA 2QDNA 2WZR3 5A3MA 1ENQA 4K1ZA 3LSDA 4QXBA 5HCFA 2HWF3 2HWB1 3LF7A 4CCCA 4Q0SA 1MS9A 1ND3A 4HKWA 3CU7A 3S5QA 5FYHA 2VOWA 1JH5A 4NRMA 4OHYA 2GC1A 4QX7A 1DGWA 1GOGA 4Y1VA 1HJGA 1RUD2 3T0AA 1CX4A 5EP9A 3ZYGA 4IE0A 1RGSA 4CEYC 4EROA 1HXS1 2ZHNA 3VD4A 3T0DA 1MQTB 1YLLA 4LR4A 2DFCA 4M3CE 4Z07A 1QQP3 4YG0A 5FY4A 4ES8A 4AFMA 5K0UC 3VDCA 4C8DA 2DYCA 4J1WA 5DZEA 2VO5A 1NX9A 3PMSA 2OZ6A 1NKGA 3KSCA 1ASJ1 1BBT2 1NCQC 1CD3G 2CDOA 4HETA 3RJ2X 4M0HA 1E5HA 3NV2A 1U5XA 3AVSA 5GZDA 2GNTA 4CCJA 1O5UA 2ARBA 2ZEZA 4OMCA 5C71A 3HQUA 2WUHA 4TWTA 5BNPB 4XIKA 3DYMA 3PVNA 1LOFA 5CA6A 2JG8A 4JGZB 5IVFA 1PM4A 2B45X 3NL1A 4A3ZA 2C5DA 2VQAA 4QPYA 4YFZA 4FFFA 3SH4A 4QD2A 1WLCA 1ZZ8A 4GMP3 1HDKA 5IAVA 4GWIA 4BQ1A 4LHLA 5K9YA 4Q0QA 3SCHA 1REDA 4RGAA 3WW1A 1T2XA 5FXWA 1SQ4A 3PHMA 1L3JA 2PXJA 3U4SA 1AR62 4W50A 1R1ZA 2A6ZA 3I49A 5D8AA 2D3PA 4YM3A 3A0NA 5JZGC 2DVDA 1LAJA 1CGPA 4MX3A 3WG1A 3I2FA 2Y6HA 3VBFC 5IT6A 5FY0A 1HIXA 2WA4A 3FFQA 2PHDA 3OD0A 4XJZA 1AF9A 2BJSA 4ARXA 1NZCA 4F8AA 5EJZB 3T4HB 4LLOA 3T09A 4Y20A 2D44A 2ORXA 1WMXA 1LOEA 3MI8A 4RS5B 4JRLA 1QJEA 3N9NA 3O0XA 1QGLA 2WINB 4JVAA 1VRBA 1AR73 1XJAA 2HLEA 4QM8A 4IE6A 3BU7A 4WM8B 1OD5A 3ZN6B 5F6LB 3OSDA 1DQ1A 1CAUA 1SCSA 4PBOA 4I0WB 1JUHA 4HPKB 4XF9A 4Y1XA 2D6OX 1VMFA 2RS11 2XL7A 4CYDA 1POQA 2G19A 1QJX3 1O3SA 1FXZA 5FPBA 5AC91 1XU2A 3OPWA 2AREA 4Z92B 4UF0A 3TN92 3T2OA 1W6OA 1RUF1 4XXPA 5FWJA 1BVVA 1JYCA 1QF3A 1W3XA 3BGAA 4XUPA 3ZSEA 4DUWA 4FPKA 2Q1ZB 3RVHA 2VBDA 3IMNA 2IFWA 1AR92 3AL5A 4Q29A 4QKBA 5FZKA 4CDUC 1YYNA 2ZS6B 4CUCA 1MZFA 2XJQA 4RQPB 5DDJ1 4DNYA 1NZIA 2I74A 4M3CF 4MLOA 3ACGA 4XCBA 4BQ2A 3EHKA 2CTVA 1PGW1 3NWKA 4LEJA 4WM7B 1HRV3 2WAOA 2JDYA 3N7MA 1H2KA 1O3TA 2D43A 2E6VA 1ND3B 2RS31 2I45A 1J83A 4NN0A 3ZXDA 3JD72 5F6KA 1IG3A 3VZMA 3JU9A 1H9WA 5T3NA 3WLUA 2W39A 1X9PA 2R071 3MIHA 4BH9A 5C9AC 2WO7A 2YUEA 1L7RA 2FHRA 2DCYA 4NOTA 5LEJA 1VRH2 3ZFFC 1ZBE3 3LEIA 3PTRB 2Z2SB 1IS4A 3OGJA 3PUQA 3VBOB 4AK3A 2VQUA 1MEC1 1LODA 1W8ZA 4Q1PA 5FXZA 2WQZC 4QB2A 1CR7A 2VZ3A 4IGOA 3D5OA 4AL9A 4ASKA 2BNOA 1WMFA 5A6ZA 1GLHA 3E6BA 5FYCA 1F4HA 4GIQA 4XF1A 3BKZA 3AKPA 2WFF2 2YV8A 2CGPA 2WR9A 2WS93 4FFHA 5ISLA 5T50A 5CFDC 3PJQA 4MGQA 2A5ZA 5F32A 1W3VA 1OVPA 1KFXL 5FZ6A 3TRSB 3KHCA 5K0UA 4XAAA 3U14A 3N4MA 2VCAA 2P6CA 3CMGA 1AR83 2LUWA 1SFYA 1GR3A 1E5RA 3TBDA 4YGDA 3VHNA 1F2NA 1ZBA3 4MH0E 2UY9A 4YZ2A 4AWDA 2R063 1PM7A 3I3DA 3M3IA 2WZPP 5J7MA 2DDUA 3FC0A 4XHBA 3RSJA 2K46A 4CU7A 3SITA 1F5JA 4S2GA 5ACA3 1VAMA 4XTMA 2XLFA 3A4UA 3IIIA 3WNLA 4CXYA 2BEOA 2BQPA 2WO1A 4AW7A 4CP9A 1R093 1RUI3 3EMRA 2WZ8A 5A32B 4XJ8A 4XUNA 5FZFA 1HW5A 3QH6A 5CG8A 4NJ4A 5I0DA 2D93A 1W6MB 2UWBA 1W0PA 3D4KA 4OZOA 4XFAA 2G9GA 2PHWA 2YGLA 5IK5A 4FP3A 2P1BA 4AGVA 4AHXA 2VZQA 5G04L 2J22A 5FOJB 3MIDA 2ZMNA 4INDA 5BNOC 1UAIA 3POSA 2ID4A 3PIJA 4BZ4A 1IS3A 5JZGA 4IGPA 1DQ5A 1B35C 4JC1A 4Q26A 5LB6A 3DKWA 1EPZA 5I91A 5GLTA 3AMHA 4COWA 4E27A 4YGBA 3ZOIA 5KHKA 3FX3A 1CAUB 2VW2A 4QGMA 4OQ9A 2RR12 3SEEA 5FYUA 2O1QA 3VDAA 1AX2A 1GKBA 2WN2A 3ILNA 1PK6B 4CCLA 4FBFA 2YG0A 2GDFA 1YQ2A 1GOFA 1NLRA 2FDIA 4UF0B 5EJ3A 1V6NA 1LHVA 1W6OB 4LKFA 3ZYJB 1SDWA 4DXSA 3KV9A 3VL8A 5IVBA 2R6QA 4NPLA 1EYBA 1WD3A 3RZJA 1QOSA 5E6HA 4CEWC 4NRQA 2JD4A 2C9KA 3KHBA 3GHNA 1FX5A 3CBNA 3KT4A 1UOBA 1AR91 4XFCA 5JXHA 2GC3A 1XNDA 1REFA 1SCRA 3ORJA 5F3GA 5JIAA 3M3QA 4BM8A 3VKMA 3AYCA 1RUNA 5EXOA 3ZIXA 1HB2A 4RHV2 1C1LA 5FZEA 5D1IA 5AVPA 2VECA 4BQXA 2JDAA 2J42A 1GWMA 3B93A 1HRI3 1V6KA 4Q4X1 5F5CA 1PO21 4IDZA 3FN9A 5FJKA 1RYYA 4CDUA 3JD71 4AVAA 4Q4Y1 1JYVA 3ZDVA 4QQPA 3AZZA 4XILA 3USSA 3VZNA 2VNRA 4GB32 4PLNA 1UY3A 5GLWA 5H9RA 3U75A 4LITA 2A6WA 1BMV2 1Y9QA 2WO3A 1Z7S1 5F2SA 3O1MA 2Y6JA 1XE8A 1SLAA 4GAZA 1ODMA 5KXCA 2RJKA 1RUE2 1VBE2 3WF3A 4XUQA 2WNOA 3ETQA 1V0AA 3N36A 1EV13 2AR6A 2NZ9A 4F3JA 2VMHA 5C33A 1K42A 3J7MA 1VBB3 3AJYA 4J1XA 2XJPA 5JI9A 3VB9A 3HD8B 4S2DA 2FDHA 1OLQA 4IEZA 1ZZBA 4GH4C 3UJQA 1E5SA 1AZDA 1D2QA 3NV3A 4L9BA 4OULA 1AYN3 4CP2A 5KHJA 1V70A 4NE9A 1FT9A 4GZ9A 2GSYA 1KEXA 2EXIA 1AL23 3HEIA 2E53A 4G3YC 1SBFA 1VBD2 4IV1C 4NIIA 2FZ2A 2YFUA 4LOSA 2VBBA 3LE0A 2JDKA 3RPQA 4IEWA 5CFDA 4E9KA 1I6XA 3USUA 4URTA 4Q27A 4YVSB 4H2AA 5FY5A 4ZXEA 2ZX4A 3NRUA 4FPLA 4XF3A 2D6MA 4JCKA 3VBRC 1GP6A 5FPVA 4NUBA 3IZOA 1OF3A 2BYVE 3HN3A 4XFGA 5CEHA 5CYYA 4YWAA 4KG8A 3UKTA 3R4SA 4OHXA 2Z4FA 5F8PA 4CVUA 3M3EA 4E8DA 5FZBA 1US2A 2C6SA 3ZN4A 3UJOA 2DU0A 4JHZA 1UIJA 3WXPA 2ZX1A 2WWSA 1QJFA 4QM9A 3H1YA 1PX4A 4FCAA 3G7DA 3I2IA 1J3RA 4Q8LA 3HT1A 4N53C 2JJ6A 1R1A1 3FUQA 3AZWA 4QDRA 4IEUA 1Y43B 5JSRA 3SKJE 4R52A 1HJFA 1V6OA 2OS2A 4D7YA 2GNDA 1PGL1 2ZEWA 4MSVA 1D2SA 1QMJA 2ZMLA 1XYPA 4PIYA 4G4FA 2R0HA 5LW9A 4XMIA 4DRRA 5K7PA 1N3PA 1S2EA 3LOIA 2XHKA 4ZKTB 1ZRIA 4I2OA 3LFMA 5HPOA 4P5HA 1FOD1 1PO12 4H7LA 4E2QA 3C7OA 1ALYA 5GZFA 3MPPG 5BNQA 2AACA 4QX5A 4A42A 1MS1A 5FY9A 3DPRC 5FYVA 5IVJA 2X09A 4IEXA 1MZ6A 2SLIA 4B29A 1NXD1 1OURA 3H1WA 5FMCA 5C4WC 1VP6A 5FP4A 3ZN5A 5FZHA 3I59A 3SXWA 4CDWB 2VY0A 4XBNA 3ZMNA 5FOBB 1RUG2 5LWBA 2H0VA 1WLTA 4XQDA 3SH5A 4CEWA 4DOUA 2LTNA 2KXLA 3ELNA 4Q4V1 3QOPA 3T3YA 4DFSA 5LK7B 3O1PA 4LJHA 2HWB3 4UT5A 3ZFGC 4GB31 3V0BB 4WBBA 4YM2A 2JDZA 4H7MA 3BPZA 3NJXA 1W28A 1W0NA 4LIUA 4B1MA 4V1PA 4PI0A 4IESA 5EYYA 4AHWA 3RWNA 3SQOA 4MGSA 1W2UA 2B7YA 2C0ZA 1HXS3 2C9AA 2VZOA 4UXAA 5GKAC 2XLAA 4KL1A 1DZTA 4NPMA 4Q4W1 2A1XA 3HPNA 1ZNPA 1ZYBA 3A21A 5FZMA 5H9QA 5IK8A 2MPFA 5B2GB 5CNAA 5DN2A 4CCMA 5I0SA 3OBTA 4FFGA 2P37A 2BW8A 3WQ7A 2RE9A 1ASJ3 2JICA 4UFMA 1LENA 1H8TC 2VTFA 2X5IA 3HMYA 5FZ0A 3RZKA 1YFYA 4TXWA 4MXWA 1KJLA 2A3YA 1E5IA 1XSQA 4A3XA 4UW6A 3T08A 4I3GA 4TYSA 4LBQD 2VCMA 5JMOA 1JOJA 2AZ5A 1DLCA 4MV2A 4OUMA 3LA7A 3N9OA 4GH4A 5AFBA 4L2NA 1C8M1 1UCXA 1QJU1 2QQLA 3CNAA 1OSGA 2CWMA 3D82A 4XTPA 5F5AA 5L9VA 1UN1A 4XBLA 2IXCA 4R9AA 3EYPA 3UK9A 3C7GA 1D0HA 3VZOA 2Y6FA 4A45A 2BVVA 3JQWA 3LA2A 3MIFA 4W4ZA 1D7PM 2ERFA 3GCWA 2E7QA 3KV6A 4AEDA 1BEV2 2XH6A 1X8MA 1RMU3 1MS8A 1XBFA 2X05A 1JODA 1OBNA 2OXBA 3G6JB 3VD3A 3IWZA 1STMA 4HKOA 2Q30A 5DAXA 2VH9A 3VBRA 3VBUC 4WVWA 5I0TA 1KITA 4UW4A 1S4CA 4D0QA 4DUXA 1BXHA 1S55A 3C2UA 1C8NA 5L7OB 3PVBB 4QQOA 3ITQA 4XPVA 3ZFEC 4DQAA 2XG3A 5KHHA 1N3QA 4E4SA 5IK4A 4A7KA 1ZZCA 2VUCA 2HWC1 5H9PA 2BBVA 2BWAA 2RS13 5CADA 4NPRA 3J7NA 1OQDA 3RMYA 3T30A 2FDGA 5KR7A 1KXGA 1NE4A 1F4AA 2A75A 5AC93 1NG0A 4KGGA 1MACA 2V4AA 2AEYA 2MEV2 1HB1A 1NQJA 2XPJA 3WVJA 5FMDA 1OH4A 4ISQA 2WKKA 2OUHA 3Q8BA 2DVGA 2WNEA 4B4RA 2W92A 3HWJA 3JB4C 5CZKA 2IXJA 4RL7A 4P00B 3WP4A 4FPGA 5DDJ3 5A7WA 1MZ5A 4QQ2A 1W9TA 3LIGA 1BKZA 2R7EB 3MLJA 3HVDA 5FK7A 4YZ5A 1Q8QA 1V6IA 3WDUA 3ZLIA 3Q9OA 3GBFA 1CWPA 1MS4A 1WKYA 3RRDA 5LBCA 4AI3A 2RS33 4YG3A 2VMCA 1VIWB 5DAVA 2DVFA 1XB9A 4SBVA 3ILFA 2NMNA 4CA9A 3TEXA 5HV0A 4RFRB 3S6PA 3E6DA 3MFAA 1PHMA 4BOWA 2R073 2VTXJ 3OBRA 1CJDA 5FBJA 1H4HA 1H8VA 3R4UA 4K8FA 4BXSV 3OGGA 2RM21 4DY5A 4S2FA 3J4UH 1UOJA 5BV6A 4FXGB 4RS5C 5HCAA 3RG0A 3LEMA 1W8FA 3W5NA 3ZPYA 2Y6KA 2CNAA 2V72A 2GC0A 4LUMA 3UGHA 4IEOA 3ZFGA 4AYUA 2PLV2 1MEC3 3D6EA 3PVEA 4E4DX 3I4IA 4KNCA 1HQLA 1BLZA 1REEA 3U11A 4HT1T 5C8CC 1JYNA 3DECA 3P1IA 5FZGA 1O6UA 3KVAA 5FJHA 4AEKA 3TEZA 4LUKA 2TUNA 2CL2A 2BRTA 2D6LX 2BUKA 3NKGA 4MXWB 3RZHA 4LKSA 1IOAA 2P3YA 1QOOA 3T2QA 4AXOA 3U0ZA 4KBZA 3ZYBA 1AX1A 3LZZA 1EUTA 1VB4A 1JYIA 4IEYA 1N1TA 2XJVA 1VE0A 3I3MA 4I02A 2WABA 3VL9A 4D8MA 1H8TA 2FDKA 3UETA 1EPWA 3VBHA 4TZDA 3WG4A 2ZGTA 5EPAA 4XDOA 2BP6A 5A6XA 4PJYA 4TN7A 3FZ3A 1RHI2 3T1LA 1RUH2 5FZ9A 3LWCA 2XKPA 3MF6A 1GANA 2YXSA 4AEDB 1D4M2 1D4VB 4Q0VA 1O5LA 1CAXA 2JDHA 3OUIA 3URFA 1LOCA 1ZREA 4ASMB 4A2UA 4COVA 1BCXA 4XJ9A 1ONAA 5ABJA 2RS52 2VR4A 3KMHA 4META 4OHWA 5FKCA 1FNYA 5HV4A 3VBOC 1F8VA 1XNKA 3AMPA 4R8HA 1HQNA 5K8SA 1QKQA 2JG9B 3GHMA 1ND2B 1X9TA 1LHNA 3BOWA 1YNAA 1SFNA 2VL4A 3KQ4B 3MEPA 4COUA 3RDIA 5AVAA 1WCDJ 1DDLA 3EBRA 2ZGUA 1J3QA 1JZ2A 2VTXA 4CPBD 4IERA 5BPXA 2KA3A 1OPMA 4IEVA 5CVRA 4D6RA 2WWJA 4JQTA 4L8QA 3VBUA 4P5YA 5FZ7A 2OIIA 2WNUC 1LGCA 1LOAA 4K6BA 3VBSC 4XFIA 4ZU4A 3ZFEA 4D94A 1DF0A 5DZFA 4AVSA 2UWCA 4B3NA 2BZDA 3I2KA 1WW6A 2QQKA 4IV3C 4JKKA 4CRQA 2Y8KA 4ZY9A 1HN1A 2YBPA 5FPZA 1XNAA 4P14A 4QGNA 2EA7A 5LEKA 4FTBA 2EXHA 4JKMA 4I30A 3MBWA 1GP4A 3VUOA 1PIV2 3GZAA 5L73A 2VZ1A 4HOOA 4X6QB 1XE7A 2HEVF 2PYTA 2W1UA 1RJ7A 1FMD2 4M3CB 4IW3A 2CHHA 4K8RB 4Q4X3 5ANQA 4DINB 1PO23 1W6PA 5JAXA 4QHZA 4AOCA 4Q4Y3 2LS6A 2YU2A 3K4DA 4AAXA 3BTZA 1KS5A 4TLGA 5FXVA 2OQ6A 3LCPA 4OYUA 1TQ5A 1VBA2 2WYSA 1COV2 2Q1MA 3KV5A 5KXDA 3O1UA 1RJ8A 1Z7S3 5T55A 1V6MA 5C9AA 5CB7A 4CCKA 3AJZA 4BCUA 2D6NA 3PLQA 2DCTA 3HOBA 4NAOA 3OOXA 2P17A 2W94A 3LSEA 4KI5M 4N43C 2QQOA 5F3EA 4XYXA 3MICA 5DZGA 5FXXA 4Y22A 2B4KA 3IAQA 3RYPA 2DBIA 2HYKA 2J1EA 4AFAA 1YI9A 1I5PA 2A6VA 1IQAA 2JKXA 3J8F3 5HCBA 3MZHA 2QE3A 4LTAA 4FPFA 5C8CA 4Q0PA 3M8LA 1CQ9A 2BNNA 3ZYHA 4H14A 1JYTA 3O1SA 3LPFA 2G4IA 3BTYA 3JUUA 4UBGA 3S30A 2TEPA 4C90A 2ZGQA 3N9QA 4KWJA 2BGCA 2HEYF 4RFT0 3VBHB 3LQCA 4BPZA 4QPIC 5J09A 3BUCA 3LEKA 4XDQA 4PI2A 4JGYA 1US3A 1SLCA 2WA3A 5T52A 2Z79A 1RHI1 1YQCA 4TSVA 1M06G 1RVF1 1CPNA 2HBTA 2WWUA 1OHFA 4FO9A 1D4M1 2BVBA 4ZZ5A 2XR4A 2VOVA 5JPMB 1RUC1 3WNPA 2HWD2 3FJSA 3KF5A 3RJRA 1GV9A 2QNKA 5I8SA 1W04A 3BIEA 5ABJB 4IXLA 4AG4A 4QT6A 2NM1A 3I3QA 1FV2A 1SPPA 2IFRA 3VD5A 1D0GA 2ZOEB 2KM2A 2RS51 1GOHA 4YW1A 2P4EA 3F95A 5KWRA 4MGTA 4DPNA 1BK1A 5A80A 3B7MA 1BHGA 3PJYA 5FYSA 3AYAA 5IVCA 1DCSA 1VBC3 4ONUA 3N7JA 1R1A3 4LKDA 1YQ8A 5C70A 5LA0A 2XOMA 4HSLA 4U36A 5DUXA 4Z1VA 5FZ4A 3CF6E 1F35A 1EAH3 3NAPA 3POGA 1AYM1 1MS5A 3K77A 2A7AA 2ZHMA 2WL1A 2ZGMA 3NMBA 3SMHA 4BHPA 1LB2A 1YC61 2ADEA 3CEWA 3HIFA 3P6BA 1CZSA 3BIWE 2HWE1 2DCKA 1W6NB 1RUJ2 1FOD3 3KVBA 4HVOA 4FQZA 5EQUA 5FZ8A 3HQXA 1JMUB 4FPYA 3WHUA 3PL0A 2W87A 2XQRA 4YVSC 4XE9A 4NIHA 3MUZ1 2QTWB 3V64A 4E2GA 2VBPA 5FP7A 4BQ5A 2YU1A 4W6XA 4IL7A 1V9U2 4Y5SA 4Z82A 4YZ3A 1NT0A 4IV3A 1W6PB 2VNOA 4Q4V3 2RG4A 5EFUA 4Q2FA 5E89A 2Q4SA 2WNVC 5FP8A 1TG7A 1OA4A 2ADDA 1G8WA 1O7FA 1PVC2 3DXTA 1IS6A 1J58A 1N3OA 5LBBA 2VXJA 3W59A 1UMZA 1S1AA 2GMEA 4RA0A 5JXIA 3BALA 1O4YA 5KC5A 5FUPA 4LPLA 3J7HA 4KWKA 5T5PA 3WY6A 1SFPA 1W2AX 5FZLA 3FFZA 1UPIA 3KD4A 5BXXA 4QB6A 1W9WA 1FPN3 4LXLA 1DQ6A 1C5HA 5LA2A 1UIKA 4CU8A 3KB5A 4Q4W3 1LR5A 1JYWA 3OJBA 2WRAA 4N8MA 5EZWA 1X33A 2RHPA 1QU0A 1UZ0A 4KH9A 4XC9A 2O14A 1CZVA 4BIFA 4AVTA 2GN7A 1YFWA 2WYFA 2XBO1 3AYDA 1OOPB 1OA2A 3Q8AA 3OY8A 3QACA 1ODNA 3L2YA 4DO0A 1W9FA 5C3RA 4QX0A 2YMZA 4LE4A 2OZJA 2RMU2 3FLPA 4M4PA 4N43A 2F4LA 1YQ6A 3NV4A 3T0BA 5DUVA 2Y6LA 3T2TA 1Y9MA 4DMIA 5IUQA 4F83A 2PQSA 3J9SA 1WMDA 2VNGA 4AVCA 1DGWX 2Q5TA 1RXFA 1C8M3 4JGYB 1QJU3 4X8NA 1H0BA 4YRDA 3JBG3 3RYRA 5EWSA 1N1YA 1OLME 2XHNA 1G9CA 2JX9A 1ULGA 1MVQA 1CZTA 1RUD1 1ULDA 2IUWA 4CDQC 3KGZA 3IMMA 4CTEA 5C5UA 2QDRA 1LHUA 2YHJA 1WCQA 4N7UA 4URAA 1DYKA 3IAPA 3QH7A 1JI6A 3VKNA 3OPZA 2BWCA 3CJIC 4YGEA 1DP0A 4LK7A 1POV3 1S2KA 1BBT1 3J7LA 1MPXA 4IEQA 4PCRA 4XJWA 5FY8A 1R64A 4CEYA 1QJY2 3ZDSA 2EAAA 3ZSKA 4BQ4A 5F39A 1QY4A 2D6KA 4XBQA 1HX6A 3NQHA 1VMJA 3NJVA 2JG8B 5CKNA 4P9WA 2PAMA 3NAPB 2FCUA 2G9FA 2WFPA 4RR3C 2YFZA 5SV5A 3VHPA 5D2AA 1NCQA 3CLPA 1GICA 2W2IA 4M4RA 1OH3A 5L19A 2HWC3 1SEFA 4AQ6A 3FUOA 2D5FA 1XYOA 2CAVA 2PHTA 4YZ4A 3K51A 3LDRA 1H2LA 1H30A 3NNLA 1RTVA 4QPGC 4R4ZA 3WZ1A 3DXUA 5T5JA 2WT2A 1AR61 4JTNA 5D8AB 5FMOL 3I2DA 1NY72 5FFOC 1W8WA 4UOJA 2EIDA 1RITA 1K3IA 2EALA 3CZJA 3O0VA 2WZR2 5FP9A 4Y20B 3MIBA 4AQ2A 2HWF2 1V9U1 4SLIA 1O4ZA 2JE9A 1GZWA 1RC6A 3E5XA 4KU8A 3ZPOA 3H8XA 3D8CA 4MHRA 1ZM1A 3NKTA 1KDMA 4R9BA 3BI3A 1F31A 4L11A 4XZUG 4MVTA 2WN3A 4QU1A 3L9JT 3VBFA 3T2PA 1W39A 3MHZA 4I0AA 1PVC1 5LA1A 3BODA 4A6SA 3CJXA 4FOYA 5ERLA 1WW4A 2RM23 1A6CA 1QQP2 2W95A 3LDBA 1XE0A 1W0OA 1A3KA 4M0NA 4WVMA 4CUBA 3V0AA 2WNVA 1QXJA 3W9AA 3OEBA 4AFBA 5M0TA 2XONA 3TN91 1LHOA 1NUKA 4YW6A 2AGSA 1C4RA 3CHXA 2VMEA 1W9YA 2YZ4A 3FHAA 4ZHNA 1ULFA 4MO3M 3S57A 3DGTA 3VZKA 1GZCA 1ZA4A 3MPBA 3BTXA 3KCYA 1C5IA 1IPSA 1LRHA 4MHUA 4S2HA 4XVHA 3VGIA 2V5YA 4D69A 4PT6A 2PAEA 2JDMA 5DABA 1L7QA 4QDQA 2P3JA 3KF3A 5A3OA 4EWAA 4A41A 2ZGOA 1OQEA 3MGUA 2E26A 3C3VA 3I3BA 3QBQA 2EIGA 5FRAA 4E4ZA 1BK0A 3ME2A 5CU1A 1U0AA 4UFHA 1CJPA 4K3UA 4Y1UA 3O12A 2CAUA 2V4VA 3E97A 4B7KA 3T1MA 3MW3A 2WAAA 3GJAA 3H9AA 5GJ6A 3WOGA 1NYWA 3ZIWA 5BUVA 4GXLA 1SBDA 1G9BA 4LBJA 4F7ZA 4KU7A 4CDXC 3FWEA 1JHJA 1VRH1 1OT5A 4MGKE 1N47A 3GZUC 1O3RA 4J25A 4PLMA 2R30A 1W03A 2FCTA 1JZ6A 4KQ7A 1UYXA 1JXNA 2VQ0A 2YY1A 1XNCA 2W5FA 3PUSA 2VZPA 3ES4A 3LDKA 4WZFA 2HYXA 1RIRA 4OHZA 2WFF1 4EN0A 2RVAA 4CDQA 4QDSA 2DV9A 2BDRA 2JE8A 1AR72 4N7IA 3ZFFA 2VOXA 3APBA 2W3JA 5BNNC 5I0UA 2NMOA 4FT8A 2F17A 5GLZA 1KD7A 2D7FA 2ZX3A 3SKVA 5K0UB 1DLLA 1CAVA 4YW2A 2WT0A 4XDPA 4J6GA 4PDWC 5DAWA 2DCJA 2ZKNA 1F15A 1NCQB 4YARA 1QJX2 4RGGA 1K5MC 4ZU7A 2KD7A 5LATA 4CUGA 1OPOA 3ASIA 4DXZA 3TEYA 2DWRA 4YM0A 1JN2P 2EAKA 3IB3A 4MG2A 4JTOA 2J1RA 3N9LA 1ACCA 2XL9A 1ULPA 2PA7A 3HBZA 3AP7A 4AHYA 4CP9B 2GMPA 2GU9A 2ZZQA 3B01A 3I2HA 4RR3A 5T5LA 3W58A 4AVVA 3SC7X 2MHFA 1NY71 2VD7A 1G9AA 3WEZA 3ZSMA 2W1WA 5FIXA 2NPIA 1SLLA 3OUJA 1HRV2 1W8UA 1NE6A 1V00A 4QPGA 3MLKA 3PURA 1DGRA 5JR7B 2A70A 1UYZA 3MIEA 2WSVA 4MUVA 1XSRA 5JZGB 1G7YA 2YROA 3AFGA 2GMMA 3MO4A 4QXKA 3VBFB 1QWRA 2IVJA 2ETEA 3WNKA 1FYUA 3FHIB 1ZBE2 4OUSA 2R043 2RR11 2VGDA 3GDBA 2BPA2 2PTMA 2GALA 1I9RA 2CWSA 1Y9GA 3BTAA 4Y5Z0 5FWEA 2ZEYA 3V0AB 4XUOA 5BNOA 5CFCC 2VZUA 1I1EA 4UFKA 3H8OA 5A7OA 1B35A 2B8MA 4OI4A 1TVGA 3POBA 5A7SA 1UZWA 4U2AA 2WS92 3WNMA 1XNTA 4A7ZA 4EE2A 3FL7A 3KQRA 1NCRC 4GWJA 3VD7A 3ZVXA 3X29B 4W6WA 3BN6A 3NW4A 3LD8A 3WCRA 4C0HA 2D5HA 2VOTA 3LPGA 4Y1YA 4N9HA 2R1BA 1AR82 4P9LA 4BXFA 5FZDA 3IKWA 4H55A 4RHV1 4YLZA 1ZBA2 2MNGA 1W2NA 1TMF3 1XC6A 3ZX7A 3VD9A 2R062 2ZGRA 4PHZA 3WV6A 4BISA 4HK9A 5FPUA 2FDFA 4CDUB 1OKQA 1UX6A 4YVWC 5ACA2 1LGBA 5JOYA 2XJTA 2EIBA 4YW7A 2DVAA 2YGMA 1CAWA 1WUVA 1GWKA 1WCKA 1AX0A 1R092 1RINA 1RUI2 4XFHA 5C3SA 4QGLA 1ZRCA 4AQTA 4EWEA 1W2TA 4FI9A 4FXKB 1BMV1 1AL0G 3WCSA 4Y3OA 4K1YA 3RQ0A 3WW4A 2WJSA 4QMAA 1RVF3 5FZAA 1AHSA 5FPAA 2JWPA 1D4M3 1RUE1 1VBE1 1RUC3 3ABZA 2BGPA 2QZ3A 5C9AB 3IN9A 3UYJA 1A78A 3MW2A 2Y0OA 3KZ4C 1LKNA 2I2SA 5A1AA 2YB7A 4CDXA 3R6SA 2RS53 1H1IA 2BU9A 4BIOA 2NP0A 4RYDA 4OHVA 4LO4B 5J36A 5JCTA 3VDDC 2ZMKA 2UYBA 3S0MA 4LBMA 1NA1C 1OLRA 1VBD1 2JB8A 5C5TA 1GP5A 1QH7A 2FCVA 4JKLA 4X8PA 4GD4A 1J84A 4XOGA 5FUIA 4HXCA 5L36A 4XF4A 2LW8A 2RDRA 5FQ0A 3IDCB 4HVQA 5CFDB 2V5DA 4NHXA 4BE3A 1ZZ6A 1H1AA 3USUB 1AYM3 3NNJA 4I01A 5BNNA 1AJKA 1DU3D 5FDBA 1SZBA 5F9TA 4AF9A 1VLNA 4PDWA 5GLVA 1W90A 4IV1A 4ZZ8A 2HWE3 1G86A 3PMEA 3AMNA 1UY0A 3ZYRA 1K5MA 4EQVA 2W1QA 2BFUL 4DEVA 3U37A 3GCXA 4JQRA 5FYYA 5CAZA 1NQDA 2H0BA 1AXZA 2HBUA 4LLFA 5LY2A 2WDBA 4D6SA 1H9PA 1HRI2 4I3PA 3BYWA 3WUDA 3VKLA 1IPJA 3INAA 3ACFA 4GKYA 2FZ1A 4R4XA 1MS0A 1DYPA 4ISRA 5IWFA 1HKDA 1MQTC 4XF0A 2PAKA 3ZXJA 2ARXA 2R1DA 2Y6GA 3TOJA 3M7AA 3WD5A 4AI9A 1EUUA 2JD9A 4XMAA 4RN5A 4CP0A 3UL2A 1S0EA 1NAEA 3O0WA 1V6JA 4CUAA 2DU1A 4EYUA 3ZSJA 4CCOA 4ZS2A 1EV12 3H7YA 1B35B 2B9UA 1TE1B 5HCHA 1GNZA 1X82A 2W1SA 4GQ7A 1VBB2 2B39A 2YYOA 2VOKA 4N53A 5F5QA 1W6QA 1LOGA 2C1FA 3RYKA 3VLBB 4I09A 4XEZA 1PO11 3U78A 4JGZC 4IUGA 1RUF3 4ES9A 2JIGA 5A33A 1CIYA 3TWIA 1AYN2 1YFXA 2G9ZA 4LHNA 3IDAA 3WINE 1AL22 2XQXA 5CFCA 4JHTA 5IFTA 1KJRA 1JZ3A 3I59B 2ZGPA 4PIZA 2ILMA 2XBO3 4DXRA 5LASA 4CEWB 2VMGA 4AHZA 1RUG1 2QQNA 3HJRA 4XW3A 1NCRA 1LJ7A 3GZEA 4BJ0A 4EN9B 1ZRRA 5A6QA 1EP0A 2FBEA 1IHMA 1O8SA 1DGRN 5FO7B 4LMFA 2VE1A 3DPRA 5AFEA 1L7LA 3S7EA 1OXCA 3ZKYA 4LA3A 2QKDA 4QAWA 1NLQA 1P8JA 4JDOA 5C4WA 4NROA 4BU2A 1B09A 1XYNA 1YIFA 3Q8FA 3WSOA 1TME2 2JE7A 3BCWA 2PHUA 1Q8OA 1RUD3 3B3QE 4HN1A 4YVWA 3SLIA 4AGRA 4CCDA 1HB3A 4LO7A 3EQEA 2A6YA 1T6BX 2D6PA 4C0BA 1ULEA 3IPVA 4WM8C 5F37A 5HBAA 5FPXA 1S0CA 3GJBA 3PUAA 2ZGKA 3Q8CA 5FK8A 3JXSA 4YYOA 2VZVA 2OUJA 2XWBB 3B02A 4ZONA 5KHGA 4Y4YA 1QDCA 3S5AA 3QCWA 1UPSA 3KCCA 4B4PA 4LNVA 5JXGA 1BBT3 3WF2A 3GF6A 3O1OA 1XXNA 3N3HA 2X5IB 3ATGA 1PMIA 4BB3A 4MGIE 3OBAA 3ZO0B 3WF1A 1WBLA 5H9SA 5LBEA 2QQWA 1UU4A 1IGOA 4LBOA 5HXVA 1G6NA 5FCCA 5FQ0B 3THTA 1U5IA 1JZ8A 4GH4B 5FZIA 1SLBA 2VU9A 1LULA 5A1FA 2VVEA 4XCAA 5FYZA 4CU9A 1Q3EA 4RQPC 3VDDA 3ZXLA 2RDQA 5A3TA 3VZJA 3M3OA 1JZ4A 4IV1B 4HBNA 1MZEA 1NA1A 5A7NA 4WM7C 4QPWA 4DRVA 5JOZA 3CDZB 4KBBA 3H42B 5FZOA 3MFCA 1ND3C 2JEMA 3H8UA 4LBQA 5B4XA 1AR63 2UU8A 3ON7A 5IVYA 1ZVFA 1BEV1 5FBZA 3SCGA 5F1RA 3DEMA 1C1FA 3U10A 2ZPXA 5E16A 3WG2A 2CSGA 3MLLA 2P2KA 4XUTA 3KLSA 2HWB2 3HN1A 3VBRB 3WX5A 2EXJA 3H8RA 2XJSA 4MGZE 4D7TA 4GMP0 4M00A 3OYWA 3DYOA 1LNSA 3N9MA 4DY3A 4LBLA 4GJZA 5FTTC 1UWWA 3FHQA 4YSFA 2J1AA 4QB1A 3ZXAC 1QH6A 1HXS2 3HR9A 4NR1A 4L92A 2JB4A 4DXTA 1DQ4A 1N1VA 3AM2A 1EV11 3SCFA 3OTFA 3WP3A 5DMYA 3ACIA 4N53B 1MQTA 2QQMA 3S7IA 1W6QB 3AKQA 1LOFC 2JDNA 1WGPA 3M4FA 4XXAA 5IYYA 4BLIA 3A23A 1G9DA 3TN93 1ASJ2 3CL1A 5ANNA 3EO6A 3RI9A 2MEV1 1WZXA 4AR2A 2BTVC 1AL21 1GQHA 2CYFA 1LECA 1AR93 4NO4A 2RDNA 1JOPA 1OMIA 2IXKA 1W99A 2WLQA 3ZR6A 1OLMA 5BNPA 5A7WB 2E32A 2ET7A 3V65A 1OUSA 2TBVA 4EN7B 5IHRA 3V56A 3NNFA 4JGZA 4Y1ZA 1R082 3WW2A 3RWKX 3GALA 1ZZ9A 3QD6A 5I0RA 3DPRB 4YM1A 4AAPA 2VXRA 3PIGA 4OMDA 4AI0A 2PQQA 1UYYA 2X10A 3JD73 2ZA9A 1TZOA 2VNVA 1BZWA 2ET1A 4WZCA 4ZU5A 3ENRA 2F4PA 5A3NA 4MADA 1TME1 4P08A 3BPSA 4K21A 1FNZA 5KXEA 4QWNA 3GBGA 3TNQA 1RMU2 1URXA 1PZ9A 1UL9A 1VRH3 4NWVA 3AK0A 3RI8A 3ZFGB 2E7TA 3HAGA 3IPVB 4YW3A 2VPVA 4C91A 1JZ7A 2PLV1 2SBAA 3AC0A 3N7LA 2R32A 1UQXA 2VUAA 4Y33A 2FDJA 4FAHA 1QDOA 3OEAA 4LK6A 5KXBA 2CGNA 3UKNA 1OQ1A 3EJKA 3NV1A 1PK6C 1UOGA 2H6CA 2WFF3 4K20A 4RS5A 2GN3A 3K2OA 3RNSA 1CESA 4MGYE 2VUDA 3LIHA 4QXCA 2YC2A 4WM8A 4XIOA 5EJ1B 4YW4A 3ZN6A 4HL0A 2DFBA 1GU3A 3K46A 4OUEA 3POWA 2HJIA 1LHWA 4HPKA 2RS12 3GBWA 1PMHX 3CO2A 1WD4A 3GGLA 5HI0A 4FP2A 3ZXGA 3BU0A 2PHLA 3WDYA 5AC92 1H8TB 2ZGSA 2JIJA 4ORFA 3HNBM 3NNGA 5FYTA 3MDPA 4E2SA 1WLWA 3H3UA 1KRIA 5FZOB 5F3IA 1RUH1 2DBNA 1S2BA 1POV0 1WA4A 2W47A 1O8PA 3AFKA 1CAXB 2ZCWA 2D98A 5DDJ2 3NJYA 4RQPA 1U5YA 5JI7A 2C26A 2CY6A 5FLJA 1KDKA 3M3CA 4WM7A 5EYXA 4P9XA 2RS32 3W5MA 5DAQA 1K12A 3ZYFA 4HSJA 4N9IA 4V2WA 4H3WA 3OYWB 4BLJA 1HV1A 1YFUA 2R072 1YO8A 2Y26A 1LU1A 3PVOA 4K9SA 3KT7A 1YI7A 2VMIA 1NOVA 4O65A 4OCTA 5FO8B 3IBMA 1UKRA 4XJAA 4D3WA 2RJ2A 4AQSA 1Z0HA 3HNMA 4EWDA 1LCLA 3O14A 2RR13 3AP9A 3VBUB 2PELA 3AZXA 4QXHA 1MEC2 3VBOA 5DG1A 1UZZA 3NSTA 3AKSA 1X36A 1YXWA 5CG9A 1I5ZA 1UY1A 5GZEA 5A3LA 5J48A 4AGGA 3ZFEB 4RGKA 3P3PA 5A3WA 4BMBA 4XABA 3AP4A 1G9FA 1WA6X 1UNBA 2BFUS 2P6HA 4CPBA 1UKGA 5FZ3A 3ZKUA 2Q0AA 2WNUA 4L99A 3VBSA 5FAXA 2ARAA 1X50A 1Z78A 4IEPA 4L0PA 3UKVA 1R081 2TNFA 4RHV3 3RZGA 2WQ4A 1PIV1 2GP5A 5J37A 3POFA 4NHMA 4W8JA 4FSJA 1CIWA 1BQPA 1FMD1 4DUVA 4LQRA 2V09A 2XLGA 5FLIA 5FY7A 5C3QA 3B94A 4DEQA 4FPJA 4GB33 2UWAA 1FI2A 2QQUA 4O9EA 1VBA1 4IE7A 2A71A 1W05A 1COV1 2AENA 2VAUA 5A32A 1W8TA 1RMU1 2XJRA 2ZX2A 3K4ZA 5FZCA 1F5FA 1HQWA 2WQ8A 4TTGA 1RUE3 1W6MA 3DV8A 1VBE3 3D3AA 2VZSA 1SG3A 2XMLA 5JUVA 3THDA 3B9CA 3TYJA 3OG2A 2BOJA 3ZYPA 4XQ4A 3U07A 1XU1A 4Y22B 5HXMA 3O1VA 2D3RA 2FMDA 1ULOA 5JOXA 4C1WA 1LTEA 1QNWA 3HBKA 2J1VA 2VJXA 2NN8A 4WV8A 5C8CB 5JPNB 2JDUA 4OI1A 3E6CC 4YZ1A 1VBD3 1WCUA 3IDEA 2E51A 4NVPA 1PK6A 1CPMA 1ZRFA 1H1MA 3MUY1 4Q0UA 4ZPIA 2YC0A 3EB7A 2WO2A 3PU3A 4JRAA 3F2ZA 1H2MA 1GZ9A 1SHWB 3M1HA 4BDVB 2Z5WA 4CDWC 4MXVA 4IE5A 1IKPA 5F5IA 2Q8DA 2ENRA 1ZX5A 4BQWA 1DZRA 1ST8A 2QQPA 4XFBA 5G05L 4YW5A 3DL3A 2ES3A 2GC2A 2IZWA 2VCBA 4NIGA 2HWD1 4W6YA 2XB6C 5FYMA 5J1XA 4QPIA 2H6BA 1SPPB 1Q8SA 3RMXA 2XVGA 2AEZA 2KR2A 1FAYA 2X8KA 4AI2A 4EJRA 4Q4X2 2A3WA 4EV0A 1PO22 4QKNA 3KV4A 3BVCA 4Q4Y2 5KHIA 4KWUA 4MOAA 3B9IA 1X8EA 4GWMA 1HN0A 2E9QA 1XQNA 4OQ8A 4CCEA 5LBFA 3WW3A 2VZTA 2QZ2A 1GWLA 4WVZA 3VHOA 1Z7S2 2HEWF 1W9SA 4XAEA 4LIVA 1UOFA 2IWGB 4KGQA 3RGBA 4ZXKA 4CE8A 1UY4A 1SMVA 4B8EA 4AI8A 1Y3TA 5I8YA 3DF0A 4K40A 3GM8A 1YJLA 5DUWA 4O7XA 3SH3A 4GULA 3ZR5A 1HB4A 4AEJA 1RUJ1 1PO13 1BVP1 5LZ6A 1U12A 1DIWA 2YBSA 2P3KA 5J96B 3VV1A 3J8F2 2WNUB 4IE4A 2ZHKA 1IPKA 1S0BA 2DUOA 2HH9A 3UGFA 5KC6A 3VBSB 5A1LA 1IQDC 5DXDA 2B42B 5A3UA 1YWKA 5JMCA 1QJZA 3I7DA 4FPEA 1SDDB 4QKDA 1RUG3 4IV3B 2LRPA 3LAGA 4FVVA 4YNIA 4Q1RA 5C8WA 1Q56A 1XPWA 2VG9A 4R9DA 5FMBA 1YQ5A 3O5SA 1QXPA 4P9GA 4MZUA 4YVSA 5LRSA 2OT7A 1Q8PA 3LGRA 3A0KA 3B5LB 3DUIA 2C4XA 2NYYA 3C7HA 3WNNA 4M01A 1O3QA 3WR0A 3O1TA 3AP5A 2D40A 1MVEA 2C24A 2DCZA 3N35A 2OYZA 2YDEA 5FKBA 2QVSB 1O59A 2EICA 5GALA 4XETA 4EN6B 4FPCA 3OGVA 3ACHA 3R05A 2BOIA 4LO6B 5CISA 1RUOA 1GQGA 1UX7A 3N9PA 1NXMA 5L7OC 1WCSA 3ES1A 1ENSA 4XHXA 2XKOA 2K2SA 2RJLA 5FP3A 1OI6A 1VBC2 2FD8A 3SEPA 4BK4A 1JU4A 1VMHA 1R1A2 2Q1FA 2RDSA 4UFIA 2QJVA 2YC4A 5TSWA 3OY8B 4FOVA 4HVRA 2VM9A 1OD3A 5LK5A 1EAH2 1UU6A 1PGL2 1KFUL 1YCIA 2J7MA 3GZTB 1KS4A 4N43B 4RSUA 1OC1A 2RMU1 2QBXA 2V73A 5JXJA 5IJRA 1GQPA 4E4HA 2AUYA 1U5ZA 1TNFA 2ZAHA 1JW6A 4JX0A 1FOD2 3TB0A 4UW3A 2OQ7A 5DAPA 2DTYA 3DKQA 3K3NA 4EZHA 3E1F1 4JDMA 3TAYA 4WVVA 3I2OA 3VN4A 1GUIA 2DURA 3AMQA 2LALA 1Y4WA 2XUMA 4QPIB 4A4AA 1UU5A 1E57A 2CGOA 1UY2A 1DYOA 1K45A 1NLSA 1WW7A 2ZHLA 1BEV3 1UZVA 3AL6A 3WUCA 4CDWA 1JBCA 1SBEA 4XQWA 3AXDA 2W46A 4CCNA 4Z2WA 5GLUA 3LOBA 2VW0A 4Q4V2 5T54A 5A70A 1JHNA 1SLTA 4TLFA 1JS9A 1TEIA 4G9SB 4CEYB 2BGOA 3VDBA 5A3PA 1YHFA 1QJY1 2J1SA 2VC9A 1C3HA 4ASLA 4XURA 1JUIA 2GAUA 1ZZ7A 3V0BA 3MIGA 3ILRA 2P3IA 4MYEA 4P9YA 5F7UA 2VMDA 3KM5A 3C7EA 3O7OA 2AH2A 2ZACA 4GJYA 5JOWA 3ETPA 3R0RA 2HKXA 3CJIA 4ITCA 2ZX0A 1W8NA 3MV11 3ACLA 4JAAA 1H6XA 4LORA 4Y24A 4C1XA 5JR2A 2X5IC 4NIAA 4BWOA 4QHBA 1DFQA 1C28A 2Y0IA 1FPN2 4NWWA 5A7QA 3RZLA 4Q4W2 3WP6A 4FAGA 2A73B 5L9RA 2QFEA 4E8CA 2CU5A 1UMHA 1VB2A 1DQ2A 2E31A 3H0OA 5GZGA 2GZWA 3FLTA 3D0JA 3KS7A 3OGSA 2PHFA 1ENXA 1ZRDA 2GH8A 5A7PA 3WHTA 4ATEA 2MEV3 3J8F1 3ECQA 4RD7A 5SV8A 3HT2A 4QKFA 2WZR1 4FQ4A 4OLLA 4DIQA 1I3HA 1W8OA 2PHXA 3K75B 4LA2A 1KGYA 1GZWB 4Y4RA 2HWF1 5EV7A 3P3NA 4NAMA 4OI2A 2XVKA 5C7GA 4AEDC 1C8M2 1OUXA 1QJU2 4LULA 4QX8A 3JBG2 4GKXA 4DB5A 2VMFA 1DHKB 2OKXA 3WG3A 2L9LA 3IDBB 2XXZA 3DCQA 4LO8A 2BERA 2PFWA 1QHDA 3KWVA 2W0XA 1PNFA 4OFGA 2DTWA 4LE3A 1TME3 2OVUA 2Y33A 1LOBA 1QQP1 3GXUA 4HMZA 4WVMB 5LY1A 2WNVB 1Q43A 1GNYA 2JG9C 3I54A 3JQXA 1ND2C 3PTYA 4AFCA 2ZGNA 4OZXA 4BA6A 4LHKA 4NMIA 3N7KA 5FLHA 1VR3A 2PLV3 1A8DA 2PN5A 2W52A 1HV0A 4UFLA 5APAA 1GNHA 1UMIA 2GNBA 2D3SA 1VBC1 2JECA 3C7FA 5DG2A 1VJ2A 4B7EA 5A6YA 5E88A 4FPHA 2D97A 3HQRA 4NHYA 4BMEA 4JV4A 2J1UA 2W08A 1RB8G 2G1MA 1O4TA 1AXKA 4O9GA 5L7OA 1EAH1 4Z8BA 1SLIA 1WW5A 1YUDA 3AZVA 2HWC2 2EVXA 2WC2A 4GMP1 1IS5A 3OCPA 3U1XA 4BQYA 2ARCA 1V6LA 5J98B 3K4AA 2EF6A 2W68A 3ZSLA 2FQPA 3PUIA 4XACA 5FV3A 1YEWA 1DZQA 4COZA 1CX1A 1XOYA 3PDQA 1RHI3 2O0OA 1RUH3 3RS6A 4CP1A 1A34A 5EHDA 4UBHA 1OKOA 3CQOA 2Q8CA 1VPHA 3M2MA 4D6QA 1GMMA 2O8QA 4GA9A 4IETA 1LESA 4KG0A 1S0IA 3TNPB 3I2JA 4CDQB 1ZA7A 1W2OA 4QHOA 3ZFFB 1K5JA 3NO8A 1AR71 1WWYA 2ZABA 1AXYA 1UXZA 3ZXEA 3VZLA 3EXUA 3FBMA 1CAVB 1RXGA 1RL3A 1VAVA 2X29A 4AFDA 4BQ3A 1Y7BA 2RM22 5BY5A 4CXXA 3CJIB 4QX1A 2W9XA 1T6GC 2BBAA 2NQYA 2GH2A 1QJX1 1UXXX 1WBFA 3ZYIB 1UF2C 2OX0A 2ZGLA 3H50A 4L97A 4LHSA 3KT1A 3NVCA 5DUUA 1FPN1 3B00A 3ZXFA 4IGQA 5IVVA 3VKOA 3H1MA 3W21A 3WDWA 3WDVA 3WQ0A 2JENA 4AVBA 5FUNA 3FE5A 2YPJA 2IVIB 4Y5TA 5B4NA 2ORZA 2WT1A 3MV01 4RR3B 4GALA 5I8TA 2ZTNA 1UD1A 2R16A 1PVXA 5LRRA 4I0BA 3VBHC 1S0DA 3DN7A 3H7JA 4O61A 4PF1A 1J3PA 2E7AA 3POIA 4KMQA 1HRV1 2VVFA 2Z42A 4QPGB 2VZRA 2Q8OA 5FO9B 2Y34A 2E63A 3WNOA 1R083 1PIV3 1DGLA 2Q8EA 2ZAAA 3THPA 4FFIA 3SNMA 1YIPA 5KBFA 3JBG1 4Z2AA 1FMD3 1IZ3A 4YPJA 4AZZA 3RZZA 1J1LA 1PNGA 3IT8A 5ABJC 1DG6A 5FPLA 3D0SA 4UI9L 2WSUA 4XFFA 1ZBE1 4CU6A 5GZCA 5F2WA 2JXAA 3K3OA 4Y26A 1VBA3 4ATFA 5BNOB 5JWPA 1COV3 1YJKA 2F6BA 4ARYA 3I8TA 2BNMA 4AI1A 1POV1 2WS91 1MS3A 3PNAA 3THCA 3ZMOA 4DZGA 4FTEA 3Q8EA 1BYHA 3OB8A 4OVEA 5IVEA 5EIYB 5FMOS 1H2NA 1QEXA 1QNYA 2JG9A 1LGNA 2LROA 3DYPA 5FREA 1CN1A 1ND2A 1AVBA 3BB6A 5JSPA 1AR81 1OVSA 4IQPA 1ZBA1 4HKLA 3A22A 3QLQA 2R061 3CIHA 4NHKA 3OD4A 2B9VA 2GNMA 2OPWA 2RV9A 2BV4A 2ZEXA 1DQ0A 5ACA1 4HZFA 1KQRA 3BOPA 1ENRA 1CAWB 3POYA 1S0GA 2K0GA 1R091 1RUI1 1A8MA 4B4QA 1M4WA 2OA2A 2WZEA 2XVLA 4DS0A 4LOTA 5CBLA 3C8XA 5JSOA 3MF9A 4XJUA 4FPOB 3LB9A 1J1TA 3CZUA 3LKJA 4W65A 1JTZX 5CKQA 3HNYM 4HONA 3I2GA 4YGCA 4UYBA 4A44A 5L9BA 1GBGA 4FTSA 5C6CA 2XGXA 2Y38A 3POEA 5IK7A 2R0FA 3LFIA 3A7QA 4QQLA 2HWD3 4BK5A 2Y64A 5JLVA 4CDXB 4QQHA 1PZ8A 1MR5A 4M3CA 2VULA 3UGGA 4PQ9A 1GZTA 1O91A 3POJA 3WDXA 2B46X 2WIIB 4LBKA 5IW0A 2R042 4NHLA 5JVVA 1ULCA 1BJQA 5J3UA 4UW5A 3TEWA 2A6XA 3ROUA 5IAXA 4FOQA 3FBYA 1GFF2 1WMEA 2YPDA 4A6OA 4AE2A 5BNNB 3WT3A 3UV9A 2ZBJA 1S0FA 1Q5OA 3AYEA 2R49A 4FOWA 1OOPC 4LO5B 4COYA 3ALQA 2B5HA 4PDWB 5LA9A 3AXEA 1LEDA 2WBKA 3RZMA 1K5MB 3JZVA 3WF0A 1RUJ3 4JZRA 3JCIA 1DBNA 3OF1A 1PZ7A 1SACA 2I07B 3FLRA 2QQIA 1JU3A 5C3PA 1S0JA 2WLPA 4JGYC 1TMF2 4AEMA 2P5BA 4P9JA 5BNPC 1AJOA 3OGRA 1UO9A 1W8HA 2DVBA 3UT0A 1HRI1 4HFSA 4HN0A 4NIDA 1LEMA 2XWJB 3GYDA 1QOTA 2UYAA 3OBZA 1V9U3 2CDPA 1JOBA 2OPKA 3UESA 2XDVA 4Q8KA 1PMJX 3P5BA 4PIXA 3OUHA 3U4XA 3MW4A 2IXIA 5GM0A 4QX2A 1PX3A 3WNXA 4PBPA 4OI0A 3WP5A 1XNBA 1UZYA 2ZKLA 1RVF2 5FYIA 1VALA 5JDBA 1XRUA 5F3CA 1PVC3 3LA3A 1RUC2 4LKEA 5FY1A 2VW1A 4UFJA 2EIEA 1GYKA 2DUPA 3AX4A 3K48A 2QQVA 2EXKA 1J59A 5D21A 1TNRA 1IKQA 1VBB1 2IXLA 3PU8A 3WF4A 2JG8C 5LCWL 5FR3A 1OA3A 3B69A 3IIAA 2ATFA 3L2HA 2K9ZA 4CXWA 5A33B 2IC1A 4ZS3A 3NAPC 1JYXA 2QCSB 2ZXQA 3OPTA 4XZPA 1AYN1 3E5QA 2P34A 3NJZA 3VKFC 3CKHA 2AYHA 5CFCB 1QXRA 4UWDA 3SHRA 4B1LA 1OF4A 4LT5A 4HANA 3ST7A 1GSLA 2LM3A 1OFNA 2E33A 1NCRB 2OW4A 1FATA 3LEGA 2ZZJA 4KWLA 4QX3A 1CVNA 4YG6A 5IFPA 2VCCA 4X6RB 1AYM2 4GWNA 4YFWA 2VVDA 5D8AC 3SISA 2RMU3 2Z69A 1YRZA 5FZ1A 2O8OA 2X53S 3NNMA 1EY2A 4PF5A 4V2VA 5DPNA 5C4WB 1FV3A 3PUHA 1Q8VA 2HWE2 4HLTA 3AZYA 1IG0A 2FMYA 3AVRA 3UNPA 1QIQA 1W6NA 3ZXKA 2VUJA 3ZM8A 2NLRA 5E8AA 4ET7A 3AB0A 1C57A 4YVWB 3KCXA 4P02B 2JKBA 3O1RA 2W91A 1X7NA 4JDNA 5CIRA 4EN8B 2QUOA 3W20A 2VQTA 3RFRA 3J26N 2IXHA 1UW8A 2PHRA 2UY8A 1APNA 2UURA 4P9IA 4Q5OA 1UYPA 3KGLA 3AMMA 1W06A 2GP3A 4PQQA 3WQBA 3H3ZA 4BYYA 3FMGA 3AP6A 2CV6A 2AC1A 1H6YA 2R041 3WDTA 2XUEA 1QJY3 4LBNA 3MYXA 5T5OA 4A7YA 4D7SA 3I97A 1PGSA 2N7GA 3AKTA 5K4LA 1VAKA 2A3XA 2JDPA 4UAPA 3R4DB 2QQJA 4N90A 5JIUA 2Y60A 1JZ5A 1N1SA 5BYNA 1F9KA 2ZJCA 2XJUA 4K7JA 1LU2A 4PLOA 3VDDB 5FYBA
chains in the Genus database with same CATH topology
3I3EA 2VZTA 1UYZA 2W92A 5CZKA 1W9SA 4P00B 3MO4A 1UY4A 3WNKA 1W9TA 2R7EB 4HG6B 3GM8A 3GDBA 1WKYA 2VMCA 2ZEYA 4XUOA 2J1TA 5DQ0A 2VZUA 1TVGA 4BXSV 3WNMA 1XNTA 3FL7A 4GWJA 3VD7A 1IQDC 3W5NA 1SDDB 2Y6KA 2V72A 3BN6A 2VOTA 3LPGA 1GOGA 3T0AA 1XPWA 1JYNA 3DECA 3P1IA 3VD4A 3T0DA 3VD9A 1XC6A 2C4XA 3VDCA 3C7HA 3WNNA 2VO5A 4LKSA 1NX9A 1NKGA 2EIBA 3T2QA 2CDOA 1O59A 2EICA 1EUTA 3OGVA 3ACHA 4FI9A 4OMCA 2ZEZA 5C71A 1UX7A 2WUHA 2WABA 3DYMA 4D8MA 3UETA 4A3ZA 3ABZA 2BGPA 3SEPA 1JU4A 4BK4A 2YC4A 4GWIA 2VM9A 1OD3A 5A1AA 2YB7A 2J7MA 1T2XA 4RYDA 2QBXA 5JXJA 5IJRA 1GQPA 4W50A 2VR4A 4JX0A 3I2FA 2Y6HA 4JKLA 5FUIA 1J84A 2LW8A 3E1F1 4ARXA 2V5DA 5EJZB 3T09A 1GUIA 2VL4A 2ORXA 1JZ2A 4A4AA 1UY2A 1DYOA 1K45A 4ZZ8A 2HLEA 1UY0A 4P5YA 2W46A 2W1QA 4DEVA 3U37A 2BGOA 3VDBA 2WDBA 2J1SA 2VC9A 2BZDA 3I2KA 4XURA 2QQKA 4JKKA 5F7UA 2Y8KA 3T2OA 3ACFA 2VMDA 1HN1A 3C7EA 4ZY9A 1XNAA 3ETPA 3BGAA 1W8NA 3MV11 4JKMA 4XUPA 1H6XA 4DUWA 3MBWA 5JR2A 2Y6GA 2VZ1A 2W1UA 4CUCA 1EUUA 2JD9A 4RN5A 1NAEA 4CUAA 4E8CA 1UMHA 2E31A 3ACGA 2LS6A 3K4DA 3OGSA 4AAXA 2WAOA 2W1SA 4OYUA 1J83A 2WYSA 3ECQA 4IUGA 1CIYA 1W8OA 3K75B 1KGYA 3IDAA 1L7RA 2XQXA 3HOBA 5C7GA 5IFTA 1JZ3A 3LEIA 4DXRA 2W94A 2VMFA 4KI5M 2QQOA 2OKXA 2QQNA 2L9LA 2VQUA 3HJRA 4BJ0A 2B4KA 3IAQA 4QB2A 2BERA 2VZ3A 1O8SA 2J1EA 1I5PA 2JKXA 1F4HA 3GXUA 4QAWA 1GNYA 1P8JA 4MGQA 3LPFA 3WSOA 2VCAA 3CMGA 3LQCA 3LEKA 1UMIA 3C7FA 1US3A 3I3DA 2J1UA 2DDUA 4CU7A 3JXSA 2VZVA 4ZZ5A 3IIIA 3WNPA 3WNLA 5JXGA 3WF2A 2WO1A 4AG4A 2WZ8A 3OBAA 3WF1A 3VD5A 4XUNA 1GOHA 3K4AA 5I0DA 1JZ8A 3PUIA 1BHGA 4OZOA 4CU9A 1CX1A 2VZQA 5G04L 2J22A 5C70A 5LA0A 2XOMA 1JZ4A 3CQOA 2ID4A 4QPWA 1GMMA 3CDZB 3K77A 3I2JA 5B4XA 3SEEA 3P6BA 1CZSA 3VDAA 2DCKA 2WN2A 1UXZA 2YG0A 1YQ2A 1GOFA 4XUTA 4DXSA 2W87A 4QX1A 2W9XA 2BBAA 3MUZ1 1UXXX 2C9KA 3DYOA 1LNSA 4LHSA 5JXHA 1UWWA 3FHQA 2J1AA 4QB1A 5B4NA 2ORZA 4DXTA 1TG7A 3MV01 2JDAA 5DMYA 3ACIA 2QQMA 3FN9A 5IYYA 1RYYA 3A23A 1JYVA 5JXIA 4PF1A 4KMQA 1UY3A 2VZRA 3J7HA 4LPLA 3WNOA 2WO3A 4QB6A 1W9WA 4CU8A 1JYWA 5LA2A 1W99A 4Z2AA 2Y6JA 2E32A 5IHRA 4YPJA 1UZ0A 4XUQA 3WF3A 1CZVA 4UI9L 4CU6A 4OMDA 1K42A 1UYYA 2X10A 4QX0A 4ARYA 4M4PA 3T0BA 4MADA 4P08A 2Y6LA 4GZ9A 1KEXA 2PQSA 3HEIA 3THCA 2YFUA 3OB8A 5EIYB 2XHNA 1JZ7A 3AC0A 3LE0A 1CZTA 3DYPA 3OEAA 4ZXEA 3NRUA 3A22A 3CIHA 1WCQA 2B9VA 2RV9A 2ZEXA 3IAPA 5EJ1B 1JI6A 2YC2A 1DP0A 1GU3A 1OF3A 3HN3A 1MPXA 3K46A 4OUEA 5CYYA 1R64A 1PMHX 2WZEA 2Z4FA 3GGLA 3C8XA 4CVUA 4E8DA 1US2A 3NQHA 3NJVA 3CZUA 4JHZA 3HNYM 3HNBM 3I2GA 1PX4A 3NNGA 4A44A 2YFZA 3I2IA 4M4RA 3A7QA 4BK5A 2W47A 2Y64A 1O8PA 4QDRA 3SKJE 2ZEWA 2C26A 3W5MA 1K12A 5HPOA 4UOJA 2EIDA 1K3IA 3CZJA 3C7OA 4A6OA 4A42A 2X09A 2RJ2A 3HNMA 2WBKA 4XZUG 2WN3A 3WF0A 3T2PA 5LA1A 1UY1A 2QQIA 1JU3A 2W95A 3OGRA 4CUBA 3OEBA 3NJXA 2XONA 1W0NA 3UESA 1NUKA 2CDPA 1PMJX 2VMEA 3FHAA 4MGSA 4QX2A 4L0PA 4MO3M 1PX3A 2VZOA 4W8JA 4DUVA 3HPNA 4XVHA 3A21A 4LQRA 4PT6A 5DN2A 1L7QA 4QDQA 4DEQA 4A41A 2EIEA 2E26A 3I3BA 2VTFA 3WF4A 5LCWL 4TXWA 2V4VA 3K4ZA 3T08A 2WAAA 1JYXA 5JMOA 2ZXQA 2WQ8A 1DLCA 3CKHA 4TTGA 3D3AA 1OF4A 2VZSA 1SG3A 1JHJA 2QQLA 5JUVA 1OT5A 3THDA 2E33A 3OG2A 3LEGA 3EYPA 4QX3A 3C7GA 5IFPA 5HXMA 2VCCA 1JZ6A 1ULOA 4A45A 1UYXA 4W4ZA 2W5FA 2VZPA 2HYXA 1D7PM 2J1VA 2VJXA 5DPNA 2RVAA 3PUHA 4QDSA 2JE8A 2W3JA 3UNPA 2X05A 3VD3A 3SKVA 3ZM8A 4ET7A 3MUY1 4P02B 3EB7A 2WO2A 4BDVB 3F2ZA 1SHWB 2W91A 2DCJA 2VQTA 2KD7A 4D0QA 4DUXA 3IB3A 5G05L 2J1RA 4PQQA 3WQBA 2VCBA 1ULPA 5J1XA 1H6YA 3I2HA 3I97A 3WEZA 1F4AA 2W1WA 4UAPA 1JZ5A 2QQJA 4KWUA 4MOAA 1OH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I3E A;  2VZT A;  1UYZ A;  2W92 A;  5CZK A;  1W9S A;  4P00 B;  3MO4 A;  1UY4 A;  3WNK A;  1W9T A;  2R7E B;  4HG6 B;  3GM8 A;  3GDB A;  1WKY A;  2VMC A;  2ZEY A;  4XUO A;  2J1T A;  5DQ0 A;  2VZU A;  1TVG A;  4BXS V;  3WNM A;  1XNT A;  3FL7 A;  4GWJ A;  3VD7 A;  1IQD C;  3W5N A;  1SDD B;  2Y6K A;  2V72 A;  3BN6 A;  2VOT A;  3LPG A;  1GOG A;  3T0A A;  1XPW A;  1JYN A;  3DEC A;  3P1I A;  3VD4 A;  3T0D A;  3VD9 A;  1XC6 A;  2C4X A;  3VDC A;  3C7H A;  3WNN A;  2VO5 A;  4LKS A;  1NX9 A;  1NKG A;  2EIB A;  3T2Q A;  2CDO A;  1O59 A;  2EIC A;  1EUT A;  3OGV A;  3ACH A;  4FI9 A;  4OMC A;  2ZEZ A;  5C71 A;  1UX7 A;  2WUH A;  2WAB A;  3DYM A;  4D8M A;  3UET A;  4A3Z A;  3ABZ A;  2BGP A;  3SEP A;  1JU4 A;  4BK4 A;  2YC4 A;  4GWI A;  2VM9 A;  1OD3 A;  5A1A A;  2YB7 A;  2J7M A;  1T2X A;  4RYD A;  2QBX A;  5JXJ A;  5IJR A;  1GQP A;  4W50 A;  2VR4 A;  4JX0 A;  3I2F A;  2Y6H A;  4JKL A;  5FUI A;  1J84 A;  2LW8 A;  3E1F 1;  4ARX A;  2V5D A;  5EJZ B;  3T09 A;  1GUI A;  2VL4 A;  2ORX A;  1JZ2 A;  4A4A A;  1UY2 A;  1DYO A;  1K45 A;  4ZZ8 A;  2HLE A;  1UY0 A;  4P5Y A;  2W46 A;  2W1Q A;  4DEV A;  3U37 A;  2BGO A;  3VDB A;  2WDB A;  2J1S A;  2VC9 A;  2BZD A;  3I2K A;  4XUR A;  2QQK A;  4JKK A;  5F7U A;  2Y8K A;  3T2O A;  3ACF A;  2VMD A;  1HN1 A;  3C7E A;  4ZY9 A;  1XNA A;  3ETP A;  3BGA A;  1W8N A;  3MV1 1;  4JKM A;  4XUP A;  1H6X A;  4DUW A;  3MBW A;  5JR2 A;  2Y6G A;  2VZ1 A;  2W1U A;  4CUC A;  1EUU A;  2JD9 A;  4RN5 A;  1NAE A;  4CUA A;  4E8C A;  1UMH A;  2E31 A;  3ACG A;  2LS6 A;  3K4D A;  3OGS A;  4AAX A;  2WAO A;  2W1S A;  4OYU A;  1J83 A;  2WYS A;  3ECQ A;  4IUG A;  1CIY A;  1W8O A;  3K75 B;  1KGY A;  3IDA A;  1L7R A;  2XQX A;  3HOB A;  5C7G A;  5IFT A;  1JZ3 A;  3LEI A;  4DXR A;  2W94 A;  2VMF A;  4KI5 M;  2QQO A;  2OKX A;  2QQN A;  2L9L A;  2VQU A;  3HJR A;  4BJ0 A;  2B4K A;  3IAQ A;  4QB2 A;  2BER A;  2VZ3 A;  1O8S A;  2J1E A;  1I5P A;  2JKX A;  1F4H A;  3GXU A;  4QAW A;  1GNY A;  1P8J A;  4MGQ A;  3LPF A;  3WSO A;  2VCA A;  3CMG A;  3LQC A;  3LEK A;  1UMI A;  3C7F A;  1US3 A;  3I3D A;  2J1U A;  2DDU A;  4CU7 A;  3JXS A;  2VZV A;  4ZZ5 A;  3III A;  3WNP A;  3WNL A;  5JXG A;  3WF2 A;  2WO1 A;  4AG4 A;  2WZ8 A;  3OBA A;  3WF1 A;  3VD5 A;  4XUN A;  1GOH A;  3K4A A;  5I0D A;  1JZ8 A;  3PUI A;  1BHG A;  4OZO A;  4CU9 A;  1CX1 A;  2VZQ A;  5G04 L;  2J22 A;  5C70 A;  5LA0 A;  2XOM A;  1JZ4 A;  3CQO A;  2ID4 A;  4QPW A;  1GMM A;  3CDZ B;  3K77 A;  3I2J A;  5B4X A;  3SEE A;  3P6B A;  1CZS A;  3VDA A;  2DCK A;  2WN2 A;  1UXZ A;  2YG0 A;  1YQ2 A;  1GOF A;  4XUT A;  4DXS A;  2W87 A;  4QX1 A;  2W9X A;  2BBA A;  3MUZ 1;  1UXX X;  2C9K A;  3DYO A;  1LNS A;  4LHS A;  5JXH A;  1UWW A;  3FHQ A;  2J1A A;  4QB1 A;  5B4N A;  2ORZ A;  4DXT A;  1TG7 A;  3MV0 1;  2JDA A;  5DMY A;  3ACI A;  2QQM A;  3FN9 A;  5IYY A;  1RYY A;  3A23 A;  1JYV A;  5JXI A;  4PF1 A;  4KMQ A;  1UY3 A;  2VZR A;  3J7H A;  4LPL A;  3WNO A;  2WO3 A;  4QB6 A;  1W9W A;  4CU8 A;  1JYW A;  5LA2 A;  1W99 A;  4Z2A A;  2Y6J A;  2E32 A;  5IHR A;  4YPJ A;  1UZ0 A;  4XUQ A;  3WF3 A;  1CZV A;  4UI9 L;  4CU6 A;  4OMD A;  1K42 A;  1UYY A;  2X10 A;  4QX0 A;  4ARY A;  4M4P A;  3T0B A;  4MAD A;  4P08 A;  2Y6L A;  4GZ9 A;  1KEX A;  2PQS A;  3HEI A;  3THC A;  2YFU A;  3OB8 A;  5EIY B;  2XHN A;  1JZ7 A;  3AC0 A;  3LE0 A;  1CZT A;  3DYP A;  3OEA A;  4ZXE A;  3NRU A;  3A22 A;  3CIH A;  1WCQ A;  2B9V A;  2RV9 A;  2ZEX A;  3IAP A;  5EJ1 B;  1JI6 A;  2YC2 A;  1DP0 A;  1GU3 A;  1OF3 A;  3HN3 A;  1MPX A;  3K46 A;  4OUE A;  5CYY A;  1R64 A;  1PMH X;  2WZE A;  2Z4F A;  3GGL A;  3C8X A;  4CVU A;  4E8D A;  1US2 A;  3NQH A;  3NJV A;  3CZU A;  4JHZ A;  3HNY M;  3HNB M;  3I2G A;  1PX4 A;  3NNG A;  4A44 A;  2YFZ A;  3I2I A;  4M4R A;  3A7Q A;  4BK5 A;  2W47 A;  2Y64 A;  1O8P A;  4QDR A;  3SKJ E;  2ZEW A;  2C26 A;  3W5M A;  1K12 A;  5HPO A;  4UOJ A;  2EID A;  1K3I A;  3CZJ A;  3C7O A;  4A6O A;  4A42 A;  2X09 A;  2RJ2 A;  3HNM A;  2WBK A;  4XZU G;  2WN3 A;  3WF0 A;  3T2P A;  5LA1 A;  1UY1 A;  2QQI A;  1JU3 A;  2W95 A;  3OGR A;  4CUB A;  3OEB A;  3NJX A;  2XON A;  1W0N A;  3UES A;  1NUK A;  2CDP A;  1PMJ X;  2VME A;  3FHA A;  4MGS A;  4QX2 A;  4L0P A;  4MO3 M;  1PX3 A;  2VZO A;  4W8J A;  4DUV A;  3HPN A;  4XVH A;  3A21 A;  4LQR A;  4PT6 A;  5DN2 A;  1L7Q A;  4QDQ A;  4DEQ A;  4A41 A;  2EIE A;  2E26 A;  3I3B A;  2VTF A;  3WF4 A;  5LCW L;  4TXW A;  2V4V A;  3K4Z A;  3T08 A;  2WAA A;  1JYX A;  5JMO A;  2ZXQ A;  2WQ8 A;  1DLC A;  3CKH A;  4TTG A;  3D3A A;  1OF4 A;  2VZS A;  1SG3 A;  1JHJ A;  2QQL A;  5JUV A;  1OT5 A;  3THD A;  2E33 A;  3OG2 A;  3LEG A;  3EYP A;  4QX3 A;  3C7G A;  5IFP A;  5HXM A;  2VCC A;  1JZ6 A;  1ULO A;  4A45 A;  1UYX A;  4W4Z A;  2W5F A;  2VZP A;  2HYX A;  1D7P M;  2J1V A;  2VJX A;  5DPN A;  2RVA A;  3PUH A;  4QDS A;  2JE8 A;  2W3J A;  3UNP A;  2X05 A;  3VD3 A;  3SKV A;  3ZM8 A;  4ET7 A;  3MUY 1;  4P02 B;  3EB7 A;  2WO2 A;  4BDV B;  3F2Z A;  1SHW B;  2W91 A;  2DCJ A;  2VQT A;  2KD7 A;  4D0Q A;  4DUX A;  3IB3 A;  5G05 L;  2J1R A;  4PQQ A;  3WQB A;  2VCB A;  1ULP A;  5J1X A;  1H6Y A;  3I2H A;  3I97 A;  3WEZ A;  1F4A A;  2W1W A;  4UAP A;  1JZ5 A;  2QQJ A;  4KWU A;  4MOA A;  1OH4 A; 
#chains in the Genus database with same CATH topology
 3I3E A;  1WLD A;  1RUF 2;  1NA1 B;  1CON A;  3H3L A;  3GNE A;  3VHR A;  5I93 A;  2DF7 A;  4HG6 B;  4R9C A;  4LBQ B;  5IAT A;  1H4G A;  3JB8 A;  5C3O A;  2YBK A;  4CZS A;  3M70 A;  3T4V A;  2XBO 2;  1OFS A;  3AKR A;  3E5U A;  1HLC A;  4HK8 A;  5E1R A;  1TMF 1;  1OOP A;  3WQ1 A;  2PMW B;  4NRP A;  4QU2 A;  4CSW A;  4EZ4 A;  3IM0 A;  2J1T A;  5CKM A;  5DQ0 A;  1AUY A;  1PGW 2;  2DUQ A;  2QDN A;  2WZR 3;  5A3M A;  1ENQ A;  4K1Z A;  3LSD A;  4QXB A;  5HCF A;  2HWF 3;  2HWB 1;  3LF7 A;  4CCC A;  4Q0S A;  1MS9 A;  1ND3 A;  4HKW A;  3CU7 A;  3S5Q A;  5FYH A;  2VOW A;  1JH5 A;  4NRM A;  4OHY A;  2GC1 A;  4QX7 A;  1DGW A;  1GOG A;  4Y1V A;  1HJG A;  1RUD 2;  3T0A A;  1CX4 A;  5EP9 A;  3ZYG A;  4IE0 A;  1RGS A;  4CEY C;  4ERO A;  1HXS 1;  2ZHN A;  3VD4 A;  3T0D A;  1MQT B;  1YLL A;  4LR4 A;  2DFC A;  4M3C E;  4Z07 A;  1QQP 3;  4YG0 A;  5FY4 A;  4ES8 A;  4AFM A;  5K0U C;  3VDC A;  4C8D A;  2DYC A;  4J1W A;  5DZE A;  2VO5 A;  1NX9 A;  3PMS A;  2OZ6 A;  1NKG A;  3KSC A;  1ASJ 1;  1BBT 2;  1NCQ C;  1CD3 G;  2CDO A;  4HET A;  3RJ2 X;  4M0H A;  1E5H A;  3NV2 A;  1U5X A;  3AVS A;  5GZD A;  2GNT A;  4CCJ A;  1O5U A;  2ARB A;  2ZEZ A;  4OMC A;  5C71 A;  3HQU A;  2WUH A;  4TWT A;  5BNP B;  4XIK A;  3DYM A;  3PVN A;  1LOF A;  5CA6 A;  2JG8 A;  4JGZ B;  5IVF A;  1PM4 A;  2B45 X;  3NL1 A;  4A3Z A;  2C5D A;  2VQA A;  4QPY A;  4YFZ A;  4FFF A;  3SH4 A;  4QD2 A;  1WLC A;  1ZZ8 A;  4GMP 3;  1HDK A;  5IAV A;  4GWI A;  4BQ1 A;  4LHL A;  5K9Y A;  4Q0Q A;  3SCH A;  1RED A;  4RGA A;  3WW1 A;  1T2X A;  5FXW A;  1SQ4 A;  3PHM A;  1L3J A;  2PXJ A;  3U4S A;  1AR6 2;  4W50 A;  1R1Z A;  2A6Z A;  3I49 A;  5D8A A;  2D3P A;  4YM3 A;  3A0N A;  5JZG C;  2DVD A;  1LAJ A;  1CGP A;  4MX3 A;  3WG1 A;  3I2F A;  2Y6H A;  3VBF C;  5IT6 A;  5FY0 A;  1HIX A;  2WA4 A;  3FFQ A;  2PHD A;  3OD0 A;  4XJZ A;  1AF9 A;  2BJS A;  4ARX A;  1NZC A;  4F8A A;  5EJZ B;  3T4H B;  4LLO A;  3T09 A;  4Y20 A;  2D44 A;  2ORX A;  1WMX A;  1LOE A;  3MI8 A;  4RS5 B;  4JRL A;  1QJE A;  3N9N A;  3O0X A;  1QGL A;  2WIN B;  4JVA A;  1VRB A;  1AR7 3;  1XJA A;  2HLE A;  4QM8 A;  4IE6 A;  3BU7 A;  4WM8 B;  1OD5 A;  3ZN6 B;  5F6L B;  3OSD A;  1DQ1 A;  1CAU A;  1SCS A;  4PBO A;  4I0W B;  1JUH A;  4HPK B;  4XF9 A;  4Y1X A;  2D6O X;  1VMF A;  2RS1 1;  2XL7 A;  4CYD A;  1POQ A;  2G19 A;  1QJX 3;  1O3S A;  1FXZ A;  5FPB A;  5AC9 1;  1XU2 A;  3OPW A;  2ARE A;  4Z92 B;  4UF0 A;  3TN9 2;  3T2O A;  1W6O A;  1RUF 1;  4XXP A;  5FWJ A;  1BVV A;  1JYC A;  1QF3 A;  1W3X A;  3BGA A;  4XUP A;  3ZSE A;  4DUW A;  4FPK A;  2Q1Z B;  3RVH A;  2VBD A;  3IMN A;  2IFW A;  1AR9 2;  3AL5 A;  4Q29 A;  4QKB A;  5FZK A;  4CDU C;  1YYN A;  2ZS6 B;  4CUC A;  1MZF A;  2XJQ A;  4RQP B;  5DDJ 1;  4DNY A;  1NZI A;  2I74 A;  4M3C F;  4MLO A;  3ACG A;  4XCB A;  4BQ2 A;  3EHK A;  2CTV A;  1PGW 1;  3NWK A;  4LEJ A;  4WM7 B;  1HRV 3;  2WAO A;  2JDY A;  3N7M A;  1H2K A;  1O3T A;  2D43 A;  2E6V A;  1ND3 B;  2RS3 1;  2I45 A;  1J83 A;  4NN0 A;  3ZXD A;  3JD7 2;  5F6K A;  1IG3 A;  3VZM A;  3JU9 A;  1H9W A;  5T3N A;  3WLU A;  2W39 A;  1X9P A;  2R07 1;  3MIH A;  4BH9 A;  5C9A C;  2WO7 A;  2YUE A;  1L7R A;  2FHR A;  2DCY A;  4NOT A;  5LEJ A;  1VRH 2;  3ZFF C;  1ZBE 3;  3LEI A;  3PTR B;  2Z2S B;  1IS4 A;  3OGJ A;  3PUQ A;  3VBO B;  4AK3 A;  2VQU A;  1MEC 1;  1LOD A;  1W8Z A;  4Q1P A;  5FXZ A;  2WQZ C;  4QB2 A;  1CR7 A;  2VZ3 A;  4IGO A;  3D5O A;  4AL9 A;  4ASK A;  2BNO A;  1WMF A;  5A6Z A;  1GLH A;  3E6B A;  5FYC A;  1F4H A;  4GIQ A;  4XF1 A;  3BKZ A;  3AKP A;  2WFF 2;  2YV8 A;  2CGP A;  2WR9 A;  2WS9 3;  4FFH A;  5ISL A;  5T50 A;  5CFD C;  3PJQ A;  4MGQ A;  2A5Z A;  5F32 A;  1W3V A;  1OVP A;  1KFX L;  5FZ6 A;  3TRS B;  3KHC A;  5K0U A;  4XAA A;  3U14 A;  3N4M A;  2VCA A;  2P6C A;  3CMG A;  1AR8 3;  2LUW A;  1SFY A;  1GR3 A;  1E5R A;  3TBD A;  4YGD A;  3VHN A;  1F2N A;  1ZBA 3;  4MH0 E;  2UY9 A;  4YZ2 A;  4AWD A;  2R06 3;  1PM7 A;  3I3D A;  3M3I A;  2WZP P;  5J7M A;  2DDU A;  3FC0 A;  4XHB A;  3RSJ A;  2K46 A;  4CU7 A;  3SIT A;  1F5J A;  4S2G A;  5ACA 3;  1VAM A;  4XTM A;  2XLF A;  3A4U A;  3III A;  3WNL A;  4CXY A;  2BEO A;  2BQP A;  2WO1 A;  4AW7 A;  4CP9 A;  1R09 3;  1RUI 3;  3EMR A;  2WZ8 A;  5A32 B;  4XJ8 A;  4XUN A;  5FZF A;  1HW5 A;  3QH6 A;  5CG8 A;  4NJ4 A;  5I0D A;  2D93 A;  1W6M B;  2UWB A;  1W0P A;  3D4K A;  4OZO A;  4XFA A;  2G9G A;  2PHW A;  2YGL A;  5IK5 A;  4FP3 A;  2P1B A;  4AGV A;  4AHX A;  2VZQ A;  5G04 L;  2J22 A;  5FOJ B;  3MID A;  2ZMN A;  4IND A;  5BNO C;  1UAI A;  3POS A;  2ID4 A;  3PIJ A;  4BZ4 A;  1IS3 A;  5JZG A;  4IGP A;  1DQ5 A;  1B35 C;  4JC1 A;  4Q26 A;  5LB6 A;  3DKW A;  1EPZ A;  5I91 A;  5GLT A;  3AMH A;  4COW A;  4E27 A;  4YGB A;  3ZOI A;  5KHK A;  3FX3 A;  1CAU B;  2VW2 A;  4QGM A;  4OQ9 A;  2RR1 2;  3SEE A;  5FYU A;  2O1Q A;  3VDA A;  1AX2 A;  1GKB A;  2WN2 A;  3ILN A;  1PK6 B;  4CCL A;  4FBF A;  2YG0 A;  2GDF A;  1YQ2 A;  1GOF A;  1NLR A;  2FDI A;  4UF0 B;  5EJ3 A;  1V6N A;  1LHV A;  1W6O B;  4LKF A;  3ZYJ B;  1SDW A;  4DXS A;  3KV9 A;  3VL8 A;  5IVB A;  2R6Q A;  4NPL A;  1EYB A;  1WD3 A;  3RZJ A;  1QOS A;  5E6H A;  4CEW C;  4NRQ A;  2JD4 A;  2C9K A;  3KHB A;  3GHN A;  1FX5 A;  3CBN A;  3KT4 A;  1UOB A;  1AR9 1;  4XFC A;  5JXH A;  2GC3 A;  1XND A;  1REF A;  1SCR A;  3ORJ A;  5F3G A;  5JIA A;  3M3Q A;  4BM8 A;  3VKM A;  3AYC A;  1RUN A;  5EXO A;  3ZIX A;  1HB2 A;  4RHV 2;  1C1L A;  5FZE A;  5D1I A;  5AVP A;  2VEC A;  4BQX A;  2JDA A;  2J42 A;  1GWM A;  3B93 A;  1HRI 3;  1V6K A;  4Q4X 1;  5F5C A;  1PO2 1;  4IDZ A;  3FN9 A;  5FJK A;  1RYY A;  4CDU A;  3JD7 1;  4AVA A;  4Q4Y 1;  1JYV A;  3ZDV A;  4QQP A;  3AZZ A;  4XIL A;  3USS A;  3VZN A;  2VNR A;  4GB3 2;  4PLN A;  1UY3 A;  5GLW A;  5H9R A;  3U75 A;  4LIT A;  2A6W A;  1BMV 2;  1Y9Q A;  2WO3 A;  1Z7S 1;  5F2S A;  3O1M A;  2Y6J A;  1XE8 A;  1SLA A;  4GAZ A;  1ODM A;  5KXC A;  2RJK A;  1RUE 2;  1VBE 2;  3WF3 A;  4XUQ A;  2WNO A;  3ETQ A;  1V0A A;  3N36 A;  1EV1 3;  2AR6 A;  2NZ9 A;  4F3J A;  2VMH A;  5C33 A;  1K42 A;  3J7M A;  1VBB 3;  3AJY A;  4J1X A;  2XJP A;  5JI9 A;  3VB9 A;  3HD8 B;  4S2D A;  2FDH A;  1OLQ A;  4IEZ A;  1ZZB A;  4GH4 C;  3UJQ A;  1E5S A;  1AZD A;  1D2Q A;  3NV3 A;  4L9B A;  4OUL A;  1AYN 3;  4CP2 A;  5KHJ A;  1V70 A;  4NE9 A;  1FT9 A;  4GZ9 A;  2GSY A;  1KEX A;  2EXI A;  1AL2 3;  3HEI A;  2E53 A;  4G3Y C;  1SBF A;  1VBD 2;  4IV1 C;  4NII A;  2FZ2 A;  2YFU A;  4LOS A;  2VBB A;  3LE0 A;  2JDK A;  3RPQ A;  4IEW A;  5CFD A;  4E9K A;  1I6X A;  3USU A;  4URT A;  4Q27 A;  4YVS B;  4H2A A;  5FY5 A;  4ZXE A;  2ZX4 A;  3NRU A;  4FPL A;  4XF3 A;  2D6M A;  4JCK A;  3VBR C;  1GP6 A;  5FPV A;  4NUB A;  3IZO A;  1OF3 A;  2BYV E;  3HN3 A;  4XFG A;  5CEH A;  5CYY A;  4YWA A;  4KG8 A;  3UKT A;  3R4S A;  4OHX A;  2Z4F A;  5F8P A;  4CVU A;  3M3E A;  4E8D A;  5FZB A;  1US2 A;  2C6S A;  3ZN4 A;  3UJO A;  2DU0 A;  4JHZ A;  1UIJ A;  3WXP A;  2ZX1 A;  2WWS A;  1QJF A;  4QM9 A;  3H1Y A;  1PX4 A;  4FCA A;  3G7D A;  3I2I A;  1J3R A;  4Q8L A;  3HT1 A;  4N53 C;  2JJ6 A;  1R1A 1;  3FUQ A;  3AZW A;  4QDR A;  4IEU A;  1Y43 B;  5JSR A;  3SKJ E;  4R52 A;  1HJF A;  1V6O A;  2OS2 A;  4D7Y A;  2GND A;  1PGL 1;  2ZEW A;  4MSV A;  1D2S A;  1QMJ A;  2ZML A;  1XYP A;  4PIY A;  4G4F A;  2R0H A;  5LW9 A;  4XMI A;  4DRR A;  5K7P A;  1N3P A;  1S2E A;  3LOI A;  2XHK A;  4ZKT B;  1ZRI A;  4I2O A;  3LFM A;  5HPO A;  4P5H A;  1FOD 1;  1PO1 2;  4H7L A;  4E2Q A;  3C7O A;  1ALY A;  5GZF A;  3MPP G;  5BNQ A;  2AAC A;  4QX5 A;  4A42 A;  1MS1 A;  5FY9 A;  3DPR C;  5FYV A;  5IVJ A;  2X09 A;  4IEX A;  1MZ6 A;  2SLI A;  4B29 A;  1NXD 1;  1OUR A;  3H1W A;  5FMC A;  5C4W C;  1VP6 A;  5FP4 A;  3ZN5 A;  5FZH A;  3I59 A;  3SXW A;  4CDW B;  2VY0 A;  4XBN A;  3ZMN A;  5FOB B;  1RUG 2;  5LWB A;  2H0V A;  1WLT A;  4XQD A;  3SH5 A;  4CEW A;  4DOU A;  2LTN A;  2KXL A;  3ELN A;  4Q4V 1;  3QOP A;  3T3Y A;  4DFS A;  5LK7 B;  3O1P A;  4LJH A;  2HWB 3;  4UT5 A;  3ZFG C;  4GB3 1;  3V0B B;  4WBB A;  4YM2 A;  2JDZ A;  4H7M A;  3BPZ A;  3NJX A;  1W28 A;  1W0N A;  4LIU A;  4B1M A;  4V1P A;  4PI0 A;  4IES A;  5EYY A;  4AHW A;  3RWN A;  3SQO A;  4MGS A;  1W2U A;  2B7Y A;  2C0Z A;  1HXS 3;  2C9A A;  2VZO A;  4UXA A;  5GKA C;  2XLA A;  4KL1 A;  1DZT A;  4NPM A;  4Q4W 1;  2A1X A;  3HPN A;  1ZNP A;  1ZYB A;  3A21 A;  5FZM A;  5H9Q A;  5IK8 A;  2MPF A;  5B2G B;  5CNA A;  5DN2 A;  4CCM A;  5I0S A;  3OBT A;  4FFG A;  2P37 A;  2BW8 A;  3WQ7 A;  2RE9 A;  1ASJ 3;  2JIC A;  4UFM A;  1LEN A;  1H8T C;  2VTF A;  2X5I A;  3HMY A;  5FZ0 A;  3RZK A;  1YFY A;  4TXW A;  4MXW A;  1KJL A;  2A3Y A;  1E5I A;  1XSQ A;  4A3X A;  4UW6 A;  3T08 A;  4I3G A;  4TYS A;  4LBQ D;  2VCM A;  5JMO A;  1JOJ A;  2AZ5 A;  1DLC A;  4MV2 A;  4OUM A;  3LA7 A;  3N9O A;  4GH4 A;  5AFB A;  4L2N A;  1C8M 1;  1UCX A;  1QJU 1;  2QQL A;  3CNA A;  1OSG A;  2CWM A;  3D82 A;  4XTP A;  5F5A A;  5L9V A;  1UN1 A;  4XBL A;  2IXC A;  4R9A A;  3EYP A;  3UK9 A;  3C7G A;  1D0H A;  3VZO A;  2Y6F A;  4A45 A;  2BVV A;  3JQW A;  3LA2 A;  3MIF A;  4W4Z A;  1D7P M;  2ERF A;  3GCW A;  2E7Q A;  3KV6 A;  4AED A;  1BEV 2;  2XH6 A;  1X8M A;  1RMU 3;  1MS8 A;  1XBF A;  2X05 A;  1JOD A;  1OBN A;  2OXB A;  3G6J B;  3VD3 A;  3IWZ A;  1STM A;  4HKO A;  2Q30 A;  5DAX A;  2VH9 A;  3VBR A;  3VBU C;  4WVW A;  5I0T A;  1KIT A;  4UW4 A;  1S4C A;  4D0Q A;  4DUX A;  1BXH A;  1S55 A;  3C2U A;  1C8N A;  5L7O B;  3PVB B;  4QQO A;  3ITQ A;  4XPV A;  3ZFE C;  4DQA A;  2XG3 A;  5KHH A;  1N3Q A;  4E4S A;  5IK4 A;  4A7K A;  1ZZC A;  2VUC A;  2HWC 1;  5H9P A;  2BBV A;  2BWA A;  2RS1 3;  5CAD A;  4NPR A;  3J7N A;  1OQD A;  3RMY A;  3T30 A;  2FDG A;  5KR7 A;  1KXG A;  1NE4 A;  1F4A A;  2A75 A;  5AC9 3;  1NG0 A;  4KGG A;  1MAC A;  2V4A A;  2AEY A;  2MEV 2;  1HB1 A;  1NQJ A;  2XPJ A;  3WVJ A;  5FMD A;  1OH4 A;  4ISQ A;  2WKK A;  2OUH A;  3Q8B A;  2DVG A;  2WNE A;  4B4R A;  2W92 A;  3HWJ A;  3JB4 C;  5CZK A;  2IXJ A;  4RL7 A;  4P00 B;  3WP4 A;  4FPG A;  5DDJ 3;  5A7W A;  1MZ5 A;  4QQ2 A;  1W9T A;  3LIG A;  1BKZ A;  2R7E B;  3MLJ A;  3HVD A;  5FK7 A;  4YZ5 A;  1Q8Q A;  1V6I A;  3WDU A;  3ZLI A;  3Q9O A;  3GBF A;  1CWP A;  1MS4 A;  1WKY A;  3RRD A;  5LBC A;  4AI3 A;  2RS3 3;  4YG3 A;  2VMC A;  1VIW B;  5DAV A;  2DVF A;  1XB9 A;  4SBV A;  3ILF A;  2NMN A;  4CA9 A;  3TEX A;  5HV0 A;  4RFR B;  3S6P A;  3E6D A;  3MFA A;  1PHM A;  4BOW A;  2R07 3;  2VTX J;  3OBR A;  1CJD A;  5FBJ A;  1H4H A;  1H8V A;  3R4U A;  4K8F A;  4BXS V;  3OGG A;  2RM2 1;  4DY5 A;  4S2F A;  3J4U H;  1UOJ A;  5BV6 A;  4FXG B;  4RS5 C;  5HCA A;  3RG0 A;  3LEM A;  1W8F A;  3W5N A;  3ZPY A;  2Y6K A;  2CNA A;  2V72 A;  2GC0 A;  4LUM A;  3UGH A;  4IEO A;  3ZFG A;  4AYU A;  2PLV 2;  1MEC 3;  3D6E A;  3PVE A;  4E4D X;  3I4I A;  4KNC A;  1HQL A;  1BLZ A;  1REE A;  3U11 A;  4HT1 T;  5C8C C;  1JYN A;  3DEC A;  3P1I A;  5FZG A;  1O6U A;  3KVA A;  5FJH A;  4AEK A;  3TEZ A;  4LUK A;  2TUN A;  2CL2 A;  2BRT A;  2D6L X;  2BUK A;  3NKG A;  4MXW B;  3RZH A;  4LKS A;  1IOA A;  2P3Y A;  1QOO A;  3T2Q A;  4AXO A;  3U0Z A;  4KBZ A;  3ZYB A;  1AX1 A;  3LZZ A;  1EUT A;  1VB4 A;  1JYI A;  4IEY A;  1N1T A;  2XJV A;  1VE0 A;  3I3M A;  4I02 A;  2WAB A;  3VL9 A;  4D8M A;  1H8T A;  2FDK A;  3UET A;  1EPW A;  3VBH A;  4TZD A;  3WG4 A;  2ZGT A;  5EPA A;  4XDO A;  2BP6 A;  5A6X A;  4PJY A;  4TN7 A;  3FZ3 A;  1RHI 2;  3T1L A;  1RUH 2;  5FZ9 A;  3LWC A;  2XKP A;  3MF6 A;  1GAN A;  2YXS A;  4AED B;  1D4M 2;  1D4V B;  4Q0V A;  1O5L A;  1CAX A;  2JDH A;  3OUI A;  3URF A;  1LOC A;  1ZRE A;  4ASM B;  4A2U A;  4COV A;  1BCX A;  4XJ9 A;  1ONA A;  5ABJ A;  2RS5 2;  2VR4 A;  3KMH A;  4MET A;  4OHW A;  5FKC A;  1FNY A;  5HV4 A;  3VBO C;  1F8V A;  1XNK A;  3AMP A;  4R8H A;  1HQN A;  5K8S A;  1QKQ A;  2JG9 B;  3GHM A;  1ND2 B;  1X9T A;  1LHN A;  3BOW A;  1YNA A;  1SFN A;  2VL4 A;  3KQ4 B;  3MEP A;  4COU A;  3RDI A;  5AVA A;  1WCD J;  1DDL A;  3EBR A;  2ZGU A;  1J3Q A;  1JZ2 A;  2VTX A;  4CPB D;  4IER A;  5BPX A;  2KA3 A;  1OPM A;  4IEV A;  5CVR A;  4D6R A;  2WWJ A;  4JQT A;  4L8Q A;  3VBU A;  4P5Y A;  5FZ7 A;  2OII A;  2WNU C;  1LGC A;  1LOA A;  4K6B A;  3VBS C;  4XFI A;  4ZU4 A;  3ZFE A;  4D94 A;  1DF0 A;  5DZF A;  4AVS A;  2UWC A;  4B3N A;  2BZD A;  3I2K A;  1WW6 A;  2QQK A;  4IV3 C;  4JKK A;  4CRQ A;  2Y8K A;  4ZY9 A;  1HN1 A;  2YBP A;  5FPZ A;  1XNA A;  4P14 A;  4QGN A;  2EA7 A;  5LEK A;  4FTB A;  2EXH A;  4JKM A;  4I30 A;  3MBW A;  1GP4 A;  3VUO A;  1PIV 2;  3GZA A;  5L73 A;  2VZ1 A;  4HOO A;  4X6Q B;  1XE7 A;  2HEV F;  2PYT A;  2W1U A;  1RJ7 A;  1FMD 2;  4M3C B;  4IW3 A;  2CHH A;  4K8R B;  4Q4X 3;  5ANQ A;  4DIN B;  1PO2 3;  1W6P A;  5JAX A;  4QHZ A;  4AOC A;  4Q4Y 3;  2LS6 A;  2YU2 A;  3K4D A;  4AAX A;  3BTZ A;  1KS5 A;  4TLG A;  5FXV A;  2OQ6 A;  3LCP A;  4OYU A;  1TQ5 A;  1VBA 2;  2WYS A;  1COV 2;  2Q1M A;  3KV5 A;  5KXD A;  3O1U A;  1RJ8 A;  1Z7S 3;  5T55 A;  1V6M A;  5C9A A;  5CB7 A;  4CCK A;  3AJZ A;  4BCU A;  2D6N A;  3PLQ A;  2DCT A;  3HOB A;  4NAO A;  3OOX A;  2P17 A;  2W94 A;  3LSE A;  4KI5 M;  4N43 C;  2QQO A;  5F3E A;  4XYX A;  3MIC A;  5DZG A;  5FXX A;  4Y22 A;  2B4K A;  3IAQ A;  3RYP A;  2DBI A;  2HYK A;  2J1E A;  4AFA A;  1YI9 A;  1I5P A;  2A6V A;  1IQA A;  2JKX A;  3J8F 3;  5HCB A;  3MZH A;  2QE3 A;  4LTA A;  4FPF A;  5C8C A;  4Q0P A;  3M8L A;  1CQ9 A;  2BNN A;  3ZYH A;  4H14 A;  1JYT A;  3O1S A;  3LPF A;  2G4I A;  3BTY A;  3JUU A;  4UBG A;  3S30 A;  2TEP A;  4C90 A;  2ZGQ A;  3N9Q A;  4KWJ A;  2BGC A;  2HEY F;  4RFT 0;  3VBH B;  3LQC A;  4BPZ A;  4QPI C;  5J09 A;  3BUC A;  3LEK A;  4XDQ A;  4PI2 A;  4JGY A;  1US3 A;  1SLC A;  2WA3 A;  5T52 A;  2Z79 A;  1RHI 1;  1YQC A;  4TSV A;  1M06 G;  1RVF 1;  1CPN A;  2HBT A;  2WWU A;  1OHF A;  4FO9 A;  1D4M 1;  2BVB A;  4ZZ5 A;  2XR4 A;  2VOV A;  5JPM B;  1RUC 1;  3WNP A;  2HWD 2;  3FJS A;  3KF5 A;  3RJR A;  1GV9 A;  2QNK A;  5I8S A;  1W04 A;  3BIE A;  5ABJ B;  4IXL A;  4AG4 A;  4QT6 A;  2NM1 A;  3I3Q A;  1FV2 A;  1SPP A;  2IFR A;  3VD5 A;  1D0G A;  2ZOE B;  2KM2 A;  2RS5 1;  1GOH A;  4YW1 A;  2P4E A;  3F95 A;  5KWR A;  4MGT A;  4DPN A;  1BK1 A;  5A80 A;  3B7M A;  1BHG A;  3PJY A;  5FYS A;  3AYA A;  5IVC A;  1DCS A;  1VBC 3;  4ONU A;  3N7J A;  1R1A 3;  4LKD A;  1YQ8 A;  5C70 A;  5LA0 A;  2XOM A;  4HSL A;  4U36 A;  5DUX A;  4Z1V A;  5FZ4 A;  3CF6 E;  1F35 A;  1EAH 3;  3NAP A;  3POG A;  1AYM 1;  1MS5 A;  3K77 A;  2A7A A;  2ZHM A;  2WL1 A;  2ZGM A;  3NMB A;  3SMH A;  4BHP A;  1LB2 A;  1YC6 1;  2ADE A;  3CEW A;  3HIF A;  3P6B A;  1CZS A;  3BIW E;  2HWE 1;  2DCK A;  1W6N B;  1RUJ 2;  1FOD 3;  3KVB A;  4HVO A;  4FQZ A;  5EQU A;  5FZ8 A;  3HQX A;  1JMU B;  4FPY A;  3WHU A;  3PL0 A;  2W87 A;  2XQR A;  4YVS C;  4XE9 A;  4NIH A;  3MUZ 1;  2QTW B;  3V64 A;  4E2G A;  2VBP A;  5FP7 A;  4BQ5 A;  2YU1 A;  4W6X A;  4IL7 A;  1V9U 2;  4Y5S A;  4Z82 A;  4YZ3 A;  1NT0 A;  4IV3 A;  1W6P B;  2VNO A;  4Q4V 3;  2RG4 A;  5EFU A;  4Q2F A;  5E89 A;  2Q4S A;  2WNV C;  5FP8 A;  1TG7 A;  1OA4 A;  2ADD A;  1G8W A;  1O7F A;  1PVC 2;  3DXT A;  1IS6 A;  1J58 A;  1N3O A;  5LBB A;  2VXJ A;  3W59 A;  1UMZ A;  1S1A A;  2GME A;  4RA0 A;  5JXI A;  3BAL A;  1O4Y A;  5KC5 A;  5FUP A;  4LPL A;  3J7H A;  4KWK A;  5T5P A;  3WY6 A;  1SFP A;  1W2A X;  5FZL A;  3FFZ A;  1UPI A;  3KD4 A;  5BXX A;  4QB6 A;  1W9W A;  1FPN 3;  4LXL A;  1DQ6 A;  1C5H A;  5LA2 A;  1UIK A;  4CU8 A;  3KB5 A;  4Q4W 3;  1LR5 A;  1JYW A;  3OJB A;  2WRA A;  4N8M A;  5EZW A;  1X33 A;  2RHP A;  1QU0 A;  1UZ0 A;  4KH9 A;  4XC9 A;  2O14 A;  1CZV A;  4BIF A;  4AVT A;  2GN7 A;  1YFW A;  2WYF A;  2XBO 1;  3AYD A;  1OOP B;  1OA2 A;  3Q8A A;  3OY8 A;  3QAC A;  1ODN A;  3L2Y A;  4DO0 A;  1W9F A;  5C3R A;  4QX0 A;  2YMZ A;  4LE4 A;  2OZJ A;  2RMU 2;  3FLP A;  4M4P A;  4N43 A;  2F4L A;  1YQ6 A;  3NV4 A;  3T0B A;  5DUV A;  2Y6L A;  3T2T A;  1Y9M A;  4DMI A;  5IUQ A;  4F83 A;  2PQS A;  3J9S A;  1WMD A;  2VNG A;  4AVC A;  1DGW X;  2Q5T A;  1RXF A;  1C8M 3;  4JGY B;  1QJU 3;  4X8N A;  1H0B A;  4YRD A;  3JBG 3;  3RYR A;  5EWS A;  1N1Y A;  1OLM E;  2XHN A;  1G9C A;  2JX9 A;  1ULG A;  1MVQ A;  1CZT A;  1RUD 1;  1ULD A;  2IUW A;  4CDQ C;  3KGZ A;  3IMM A;  4CTE A;  5C5U A;  2QDR A;  1LHU A;  2YHJ A;  1WCQ A;  4N7U A;  4URA A;  1DYK A;  3IAP A;  3QH7 A;  1JI6 A;  3VKN A;  3OPZ A;  2BWC A;  3CJI C;  4YGE A;  1DP0 A;  4LK7 A;  1POV 3;  1S2K A;  1BBT 1;  3J7L A;  1MPX A;  4IEQ A;  4PCR A;  4XJW A;  5FY8 A;  1R64 A;  4CEY A;  1QJY 2;  3ZDS A;  2EAA A;  3ZSK A;  4BQ4 A;  5F39 A;  1QY4 A;  2D6K A;  4XBQ A;  1HX6 A;  3NQH A;  1VMJ A;  3NJV A;  2JG8 B;  5CKN A;  4P9W A;  2PAM A;  3NAP B;  2FCU A;  2G9F A;  2WFP A;  4RR3 C;  2YFZ A;  5SV5 A;  3VHP A;  5D2A A;  1NCQ A;  3CLP A;  1GIC A;  2W2I A;  4M4R A;  1OH3 A;  5L19 A;  2HWC 3;  1SEF A;  4AQ6 A;  3FUO A;  2D5F A;  1XYO A;  2CAV A;  2PHT A;  4YZ4 A;  3K51 A;  3LDR A;  1H2L A;  1H30 A;  3NNL A;  1RTV A;  4QPG C;  4R4Z A;  3WZ1 A;  3DXU A;  5T5J A;  2WT2 A;  1AR6 1;  4JTN A;  5D8A B;  5FMO L;  3I2D A;  1NY7 2;  5FFO C;  1W8W A;  4UOJ A;  2EID A;  1RIT A;  1K3I A;  2EAL A;  3CZJ A;  3O0V A;  2WZR 2;  5FP9 A;  4Y20 B;  3MIB A;  4AQ2 A;  2HWF 2;  1V9U 1;  4SLI A;  1O4Z A;  2JE9 A;  1GZW A;  1RC6 A;  3E5X A;  4KU8 A;  3ZPO A;  3H8X A;  3D8C A;  4MHR A;  1ZM1 A;  3NKT A;  1KDM A;  4R9B A;  3BI3 A;  1F31 A;  4L11 A;  4XZU G;  4MVT A;  2WN3 A;  4QU1 A;  3L9J T;  3VBF A;  3T2P A;  1W39 A;  3MHZ A;  4I0A A;  1PVC 1;  5LA1 A;  3BOD A;  4A6S A;  3CJX A;  4FOY A;  5ERL A;  1WW4 A;  2RM2 3;  1A6C A;  1QQP 2;  2W95 A;  3LDB A;  1XE0 A;  1W0O A;  1A3K A;  4M0N A;  4WVM A;  4CUB A;  3V0A A;  2WNV A;  1QXJ A;  3W9A A;  3OEB A;  4AFB A;  5M0T A;  2XON A;  3TN9 1;  1LHO A;  1NUK A;  4YW6 A;  2AGS A;  1C4R A;  3CHX A;  2VME A;  1W9Y A;  2YZ4 A;  3FHA A;  4ZHN A;  1ULF A;  4MO3 M;  3S57 A;  3DGT A;  3VZK A;  1GZC A;  1ZA4 A;  3MPB A;  3BTX A;  3KCY A;  1C5I A;  1IPS A;  1LRH A;  4MHU A;  4S2H A;  4XVH A;  3VGI A;  2V5Y A;  4D69 A;  4PT6 A;  2PAE A;  2JDM A;  5DAB A;  1L7Q A;  4QDQ A;  2P3J A;  3KF3 A;  5A3O A;  4EWA A;  4A41 A;  2ZGO A;  1OQE A;  3MGU A;  2E26 A;  3C3V A;  3I3B A;  3QBQ A;  2EIG A;  5FRA A;  4E4Z A;  1BK0 A;  3ME2 A;  5CU1 A;  1U0A A;  4UFH A;  1CJP A;  4K3U A;  4Y1U A;  3O12 A;  2CAU A;  2V4V A;  3E97 A;  4B7K A;  3T1M A;  3MW3 A;  2WAA A;  3GJA A;  3H9A A;  5GJ6 A;  3WOG A;  1NYW A;  3ZIW A;  5BUV A;  4GXL A;  1SBD A;  1G9B A;  4LBJ A;  4F7Z A;  4KU7 A;  4CDX C;  3FWE A;  1JHJ A;  1VRH 1;  1OT5 A;  4MGK E;  1N47 A;  3GZU C;  1O3R A;  4J25 A;  4PLM A;  2R30 A;  1W03 A;  2FCT A;  1JZ6 A;  4KQ7 A;  1UYX A;  1JXN A;  2VQ0 A;  2YY1 A;  1XNC A;  2W5F A;  3PUS A;  2VZP A;  3ES4 A;  3LDK A;  4WZF A;  2HYX A;  1RIR A;  4OHZ A;  2WFF 1;  4EN0 A;  2RVA A;  4CDQ A;  4QDS A;  2DV9 A;  2BDR A;  2JE8 A;  1AR7 2;  4N7I A;  3ZFF A;  2VOX A;  3APB A;  2W3J A;  5BNN C;  5I0U A;  2NMO A;  4FT8 A;  2F17 A;  5GLZ A;  1KD7 A;  2D7F A;  2ZX3 A;  3SKV A;  5K0U B;  1DLL A;  1CAV A;  4YW2 A;  2WT0 A;  4XDP A;  4J6G A;  4PDW C;  5DAW A;  2DCJ A;  2ZKN A;  1F15 A;  1NCQ B;  4YAR A;  1QJX 2;  4RGG A;  1K5M C;  4ZU7 A;  2KD7 A;  5LAT A;  4CUG A;  1OPO A;  3ASI A;  4DXZ A;  3TEY A;  2DWR A;  4YM0 A;  1JN2 P;  2EAK A;  3IB3 A;  4MG2 A;  4JTO A;  2J1R A;  3N9L A;  1ACC A;  2XL9 A;  1ULP A;  2PA7 A;  3HBZ A;  3AP7 A;  4AHY A;  4CP9 B;  2GMP A;  2GU9 A;  2ZZQ A;  3B01 A;  3I2H A;  4RR3 A;  5T5L A;  3W58 A;  4AVV A;  3SC7 X;  2MHF A;  1NY7 1;  2VD7 A;  1G9A A;  3WEZ A;  3ZSM A;  2W1W A;  5FIX A;  2NPI A;  1SLL A;  3OUJ A;  1HRV 2;  1W8U A;  1NE6 A;  1V00 A;  4QPG A;  3MLK A;  3PUR A;  1DGR A;  5JR7 B;  2A70 A;  1UYZ A;  3MIE A;  2WSV A;  4MUV A;  1XSR A;  5JZG B;  1G7Y A;  2YRO A;  3AFG A;  2GMM A;  3MO4 A;  4QXK A;  3VBF B;  1QWR A;  2IVJ A;  2ETE A;  3WNK A;  1FYU A;  3FHI B;  1ZBE 2;  4OUS A;  2R04 3;  2RR1 1;  2VGD A;  3GDB A;  2BPA 2;  2PTM A;  2GAL A;  1I9R A;  2CWS A;  1Y9G A;  3BTA A;  4Y5Z 0;  5FWE A;  2ZEY A;  3V0A B;  4XUO A;  5BNO A;  5CFC C;  2VZU A;  1I1E A;  4UFK A;  3H8O A;  5A7O A;  1B35 A;  2B8M A;  4OI4 A;  1TVG A;  3POB A;  5A7S A;  1UZW A;  4U2A A;  2WS9 2;  3WNM A;  1XNT A;  4A7Z A;  4EE2 A;  3FL7 A;  3KQR A;  1NCR C;  4GWJ A;  3VD7 A;  3ZVX A;  3X29 B;  4W6W A;  3BN6 A;  3NW4 A;  3LD8 A;  3WCR A;  4C0H A;  2D5H A;  2VOT A;  3LPG A;  4Y1Y A;  4N9H A;  2R1B A;  1AR8 2;  4P9L A;  4BXF A;  5FZD A;  3IKW A;  4H55 A;  4RHV 1;  4YLZ A;  1ZBA 2;  2MNG A;  1W2N A;  1TMF 3;  1XC6 A;  3ZX7 A;  3VD9 A;  2R06 2;  2ZGR A;  4PHZ A;  3WV6 A;  4BIS A;  4HK9 A;  5FPU A;  2FDF A;  4CDU B;  1OKQ A;  1UX6 A;  4YVW C;  5ACA 2;  1LGB A;  5JOY A;  2XJT A;  2EIB A;  4YW7 A;  2DVA A;  2YGM A;  1CAW A;  1WUV A;  1GWK A;  1WCK A;  1AX0 A;  1R09 2;  1RIN A;  1RUI 2;  4XFH A;  5C3S A;  4QGL A;  1ZRC A;  4AQT A;  4EWE A;  1W2T A;  4FI9 A;  4FXK B;  1BMV 1;  1AL0 G;  3WCS A;  4Y3O A;  4K1Y A;  3RQ0 A;  3WW4 A;  2WJS A;  4QMA A;  1RVF 3;  5FZA A;  1AHS A;  5FPA A;  2JWP A;  1D4M 3;  1RUE 1;  1VBE 1;  1RUC 3;  3ABZ A;  2BGP A;  2QZ3 A;  5C9A B;  3IN9 A;  3UYJ A;  1A78 A;  3MW2 A;  2Y0O A;  3KZ4 C;  1LKN A;  2I2S A;  5A1A A;  2YB7 A;  4CDX A;  3R6S A;  2RS5 3;  1H1I A;  2BU9 A;  4BIO A;  2NP0 A;  4RYD A;  4OHV A;  4LO4 B;  5J36 A;  5JCT A;  3VDD C;  2ZMK A;  2UYB A;  3S0M A;  4LBM A;  1NA1 C;  1OLR A;  1VBD 1;  2JB8 A;  5C5T A;  1GP5 A;  1QH7 A;  2FCV A;  4JKL A;  4X8P A;  4GD4 A;  1J84 A;  4XOG A;  5FUI A;  4HXC A;  5L36 A;  4XF4 A;  2LW8 A;  2RDR A;  5FQ0 A;  3IDC B;  4HVQ A;  5CFD B;  2V5D A;  4NHX A;  4BE3 A;  1ZZ6 A;  1H1A A;  3USU B;  1AYM 3;  3NNJ A;  4I01 A;  5BNN A;  1AJK A;  1DU3 D;  5FDB A;  1SZB A;  5F9T A;  4AF9 A;  1VLN A;  4PDW A;  5GLV A;  1W90 A;  4IV1 A;  4ZZ8 A;  2HWE 3;  1G86 A;  3PME A;  3AMN A;  1UY0 A;  3ZYR A;  1K5M A;  4EQV A;  2W1Q A;  2BFU L;  4DEV A;  3U37 A;  3GCX A;  4JQR A;  5FYY A;  5CAZ A;  1NQD A;  2H0B A;  1AXZ A;  2HBU A;  4LLF A;  5LY2 A;  2WDB A;  4D6S A;  1H9P A;  1HRI 2;  4I3P A;  3BYW A;  3WUD A;  3VKL A;  1IPJ A;  3INA A;  3ACF A;  4GKY A;  2FZ1 A;  4R4X A;  1MS0 A;  1DYP A;  4ISR A;  5IWF A;  1HKD A;  1MQT C;  4XF0 A;  2PAK A;  3ZXJ A;  2ARX A;  2R1D A;  2Y6G A;  3TOJ A;  3M7A A;  3WD5 A;  4AI9 A;  1EUU A;  2JD9 A;  4XMA A;  4RN5 A;  4CP0 A;  3UL2 A;  1S0E A;  1NAE A;  3O0W A;  1V6J A;  4CUA A;  2DU1 A;  4EYU A;  3ZSJ A;  4CCO A;  4ZS2 A;  1EV1 2;  3H7Y A;  1B35 B;  2B9U A;  1TE1 B;  5HCH A;  1GNZ A;  1X82 A;  2W1S A;  4GQ7 A;  1VBB 2;  2B39 A;  2YYO A;  2VOK A;  4N53 A;  5F5Q A;  1W6Q A;  1LOG A;  2C1F A;  3RYK A;  3VLB B;  4I09 A;  4XEZ A;  1PO1 1;  3U78 A;  4JGZ C;  4IUG A;  1RUF 3;  4ES9 A;  2JIG A;  5A33 A;  1CIY A;  3TWI A;  1AYN 2;  1YFX A;  2G9Z A;  4LHN A;  3IDA A;  3WIN E;  1AL2 2;  2XQX A;  5CFC A;  4JHT A;  5IFT A;  1KJR A;  1JZ3 A;  3I59 B;  2ZGP A;  4PIZ A;  2ILM A;  2XBO 3;  4DXR A;  5LAS A;  4CEW B;  2VMG A;  4AHZ A;  1RUG 1;  2QQN A;  3HJR A;  4XW3 A;  1NCR A;  1LJ7 A;  3GZE A;  4BJ0 A;  4EN9 B;  1ZRR A;  5A6Q A;  1EP0 A;  2FBE A;  1IHM A;  1O8S A;  1DGR N;  5FO7 B;  4LMF A;  2VE1 A;  3DPR A;  5AFE A;  1L7L A;  3S7E A;  1OXC A;  3ZKY A;  4LA3 A;  2QKD A;  4QAW A;  1NLQ A;  1P8J A;  4JDO A;  5C4W A;  4NRO A;  4BU2 A;  1B09 A;  1XYN A;  1YIF A;  3Q8F A;  3WSO A;  1TME 2;  2JE7 A;  3BCW A;  2PHU A;  1Q8O A;  1RUD 3;  3B3Q E;  4HN1 A;  4YVW A;  3SLI A;  4AGR A;  4CCD A;  1HB3 A;  4LO7 A;  3EQE A;  2A6Y A;  1T6B X;  2D6P A;  4C0B A;  1ULE A;  3IPV A;  4WM8 C;  5F37 A;  5HBA A;  5FPX A;  1S0C A;  3GJB A;  3PUA A;  2ZGK A;  3Q8C A;  5FK8 A;  3JXS A;  4YYO A;  2VZV A;  2OUJ A;  2XWB B;  3B02 A;  4ZON A;  5KHG A;  4Y4Y A;  1QDC A;  3S5A A;  3QCW A;  1UPS A;  3KCC A;  4B4P A;  4LNV A;  5JXG A;  1BBT 3;  3WF2 A;  3GF6 A;  3O1O A;  1XXN A;  3N3H A;  2X5I B;  3ATG A;  1PMI A;  4BB3 A;  4MGI E;  3OBA A;  3ZO0 B;  3WF1 A;  1WBL A;  5H9S A;  5LBE A;  2QQW A;  1UU4 A;  1IGO A;  4LBO A;  5HXV A;  1G6N A;  5FCC A;  5FQ0 B;  3THT A;  1U5I A;  1JZ8 A;  4GH4 B;  5FZI A;  1SLB A;  2VU9 A;  1LUL A;  5A1F A;  2VVE A;  4XCA A;  5FYZ A;  4CU9 A;  1Q3E A;  4RQP C;  3VDD A;  3ZXL A;  2RDQ A;  5A3T A;  3VZJ A;  3M3O A;  1JZ4 A;  4IV1 B;  4HBN A;  1MZE A;  1NA1 A;  5A7N A;  4WM7 C;  4QPW A;  4DRV A;  5JOZ A;  3CDZ B;  4KBB A;  3H42 B;  5FZO A;  3MFC A;  1ND3 C;  2JEM A;  3H8U A;  4LBQ A;  5B4X A;  1AR6 3;  2UU8 A;  3ON7 A;  5IVY A;  1ZVF A;  1BEV 1;  5FBZ A;  3SCG A;  5F1R A;  3DEM A;  1C1F A;  3U10 A;  2ZPX A;  5E16 A;  3WG2 A;  2CSG A;  3MLL A;  2P2K A;  4XUT A;  3KLS A;  2HWB 2;  3HN1 A;  3VBR B;  3WX5 A;  2EXJ A;  3H8R A;  2XJS A;  4MGZ E;  4D7T A;  4GMP 0;  4M00 A;  3OYW A;  3DYO A;  1LNS A;  3N9M A;  4DY3 A;  4LBL A;  4GJZ A;  5FTT C;  1UWW A;  3FHQ A;  4YSF A;  2J1A A;  4QB1 A;  3ZXA C;  1QH6 A;  1HXS 2;  3HR9 A;  4NR1 A;  4L92 A;  2JB4 A;  4DXT A;  1DQ4 A;  1N1V A;  3AM2 A;  1EV1 1;  3SCF A;  3OTF A;  3WP3 A;  5DMY A;  3ACI A;  4N53 B;  1MQT A;  2QQM A;  3S7I A;  1W6Q B;  3AKQ A;  1LOF C;  2JDN A;  1WGP A;  3M4F A;  4XXA A;  5IYY A;  4BLI A;  3A23 A;  1G9D A;  3TN9 3;  1ASJ 2;  3CL1 A;  5ANN A;  3EO6 A;  3RI9 A;  2MEV 1;  1WZX A;  4AR2 A;  2BTV C;  1AL2 1;  1GQH A;  2CYF A;  1LEC A;  1AR9 3;  4NO4 A;  2RDN A;  1JOP A;  1OMI A;  2IXK A;  1W99 A;  2WLQ A;  3ZR6 A;  1OLM A;  5BNP A;  5A7W B;  2E32 A;  2ET7 A;  3V65 A;  1OUS A;  2TBV A;  4EN7 B;  5IHR A;  3V56 A;  3NNF A;  4JGZ A;  4Y1Z A;  1R08 2;  3WW2 A;  3RWK X;  3GAL A;  1ZZ9 A;  3QD6 A;  5I0R A;  3DPR B;  4YM1 A;  4AAP A;  2VXR A;  3PIG A;  4OMD A;  4AI0 A;  2PQQ A;  1UYY A;  2X10 A;  3JD7 3;  2ZA9 A;  1TZO A;  2VNV A;  1BZW A;  2ET1 A;  4WZC A;  4ZU5 A;  3ENR A;  2F4P A;  5A3N A;  4MAD A;  1TME 1;  4P08 A;  3BPS A;  4K21 A;  1FNZ A;  5KXE A;  4QWN A;  3GBG A;  3TNQ A;  1RMU 2;  1URX A;  1PZ9 A;  1UL9 A;  1VRH 3;  4NWV A;  3AK0 A;  3RI8 A;  3ZFG B;  2E7T A;  3HAG A;  3IPV B;  4YW3 A;  2VPV A;  4C91 A;  1JZ7 A;  2PLV 1;  2SBA A;  3AC0 A;  3N7L A;  2R32 A;  1UQX A;  2VUA A;  4Y33 A;  2FDJ A;  4FAH A;  1QDO A;  3OEA A;  4LK6 A;  5KXB A;  2CGN A;  3UKN A;  1OQ1 A;  3EJK A;  3NV1 A;  1PK6 C;  1UOG A;  2H6C A;  2WFF 3;  4K20 A;  4RS5 A;  2GN3 A;  3K2O A;  3RNS A;  1CES A;  4MGY E;  2VUD A;  3LIH A;  4QXC A;  2YC2 A;  4WM8 A;  4XIO A;  5EJ1 B;  4YW4 A;  3ZN6 A;  4HL0 A;  2DFB A;  1GU3 A;  3K46 A;  4OUE A;  3POW A;  2HJI A;  1LHW A;  4HPK A;  2RS1 2;  3GBW A;  1PMH X;  3CO2 A;  1WD4 A;  3GGL A;  5HI0 A;  4FP2 A;  3ZXG A;  3BU0 A;  2PHL A;  3WDY A;  5AC9 2;  1H8T B;  2ZGS A;  2JIJ A;  4ORF A;  3HNB M;  3NNG A;  5FYT A;  3MDP A;  4E2S A;  1WLW A;  3H3U A;  1KRI A;  5FZO B;  5F3I A;  1RUH 1;  2DBN A;  1S2B A;  1POV 0;  1WA4 A;  2W47 A;  1O8P A;  3AFK A;  1CAX B;  2ZCW A;  2D98 A;  5DDJ 2;  3NJY A;  4RQP A;  1U5Y A;  5JI7 A;  2C26 A;  2CY6 A;  5FLJ A;  1KDK A;  3M3C A;  4WM7 A;  5EYX A;  4P9X A;  2RS3 2;  3W5M A;  5DAQ A;  1K12 A;  3ZYF A;  4HSJ A;  4N9I A;  4V2W A;  4H3W A;  3OYW B;  4BLJ A;  1HV1 A;  1YFU A;  2R07 2;  1YO8 A;  2Y26 A;  1LU1 A;  3PVO A;  4K9S A;  3KT7 A;  1YI7 A;  2VMI A;  1NOV A;  4O65 A;  4OCT A;  5FO8 B;  3IBM A;  1UKR A;  4XJA A;  4D3W A;  2RJ2 A;  4AQS A;  1Z0H A;  3HNM A;  4EWD A;  1LCL A;  3O14 A;  2RR1 3;  3AP9 A;  3VBU B;  2PEL A;  3AZX A;  4QXH A;  1MEC 2;  3VBO A;  5DG1 A;  1UZZ A;  3NST A;  3AKS A;  1X36 A;  1YXW A;  5CG9 A;  1I5Z A;  1UY1 A;  5GZE A;  5A3L A;  5J48 A;  4AGG A;  3ZFE B;  4RGK A;  3P3P A;  5A3W A;  4BMB A;  4XAB A;  3AP4 A;  1G9F A;  1WA6 X;  1UNB A;  2BFU S;  2P6H A;  4CPB A;  1UKG A;  5FZ3 A;  3ZKU A;  2Q0A A;  2WNU A;  4L99 A;  3VBS A;  5FAX A;  2ARA A;  1X50 A;  1Z78 A;  4IEP A;  4L0P A;  3UKV A;  1R08 1;  2TNF A;  4RHV 3;  3RZG A;  2WQ4 A;  1PIV 1;  2GP5 A;  5J37 A;  3POF A;  4NHM A;  4W8J A;  4FSJ A;  1CIW A;  1BQP A;  1FMD 1;  4DUV A;  4LQR A;  2V09 A;  2XLG A;  5FLI A;  5FY7 A;  5C3Q A;  3B94 A;  4DEQ A;  4FPJ A;  4GB3 3;  2UWA A;  1FI2 A;  2QQU A;  4O9E A;  1VBA 1;  4IE7 A;  2A71 A;  1W05 A;  1COV 1;  2AEN A;  2VAU A;  5A32 A;  1W8T A;  1RMU 1;  2XJR A;  2ZX2 A;  3K4Z A;  5FZC A;  1F5F A;  1HQW A;  2WQ8 A;  4TTG A;  1RUE 3;  1W6M A;  3DV8 A;  1VBE 3;  3D3A A;  2VZS A;  1SG3 A;  2XML A;  5JUV A;  3THD A;  3B9C A;  3TYJ A;  3OG2 A;  2BOJ A;  3ZYP A;  4XQ4 A;  3U07 A;  1XU1 A;  4Y22 B;  5HXM A;  3O1V A;  2D3R A;  2FMD A;  1ULO A;  5JOX A;  4C1W A;  1LTE A;  1QNW A;  3HBK A;  2J1V A;  2VJX A;  2NN8 A;  4WV8 A;  5C8C B;  5JPN B;  2JDU A;  4OI1 A;  3E6C C;  4YZ1 A;  1VBD 3;  1WCU A;  3IDE A;  2E51 A;  4NVP A;  1PK6 A;  1CPM A;  1ZRF A;  1H1M A;  3MUY 1;  4Q0U A;  4ZPI A;  2YC0 A;  3EB7 A;  2WO2 A;  3PU3 A;  4JRA A;  3F2Z A;  1H2M A;  1GZ9 A;  1SHW B;  3M1H A;  4BDV B;  2Z5W A;  4CDW C;  4MXV A;  4IE5 A;  1IKP A;  5F5I A;  2Q8D A;  2ENR A;  1ZX5 A;  4BQW A;  1DZR A;  1ST8 A;  2QQP A;  4XFB A;  5G05 L;  4YW5 A;  3DL3 A;  2ES3 A;  2GC2 A;  2IZW A;  2VCB A;  4NIG A;  2HWD 1;  4W6Y A;  2XB6 C;  5FYM A;  5J1X A;  4QPI A;  2H6B A;  1SPP B;  1Q8S A;  3RMX A;  2XVG A;  2AEZ A;  2KR2 A;  1FAY A;  2X8K A;  4AI2 A;  4EJR A;  4Q4X 2;  2A3W A;  4EV0 A;  1PO2 2;  4QKN A;  3KV4 A;  3BVC A;  4Q4Y 2;  5KHI A;  4KWU A;  4MOA A;  3B9I A;  1X8E A;  4GWM A;  1HN0 A;  2E9Q A;  1XQN A;  4OQ8 A;  4CCE A;  5LBF A;  3WW3 A;  2VZT A;  2QZ2 A;  1GWL A;  4WVZ A;  3VHO A;  1Z7S 2;  2HEW F;  1W9S A;  4XAE A;  4LIV A;  1UOF A;  2IWG B;  4KGQ A;  3RGB A;  4ZXK A;  4CE8 A;  1UY4 A;  1SMV A;  4B8E A;  4AI8 A;  1Y3T A;  5I8Y A;  3DF0 A;  4K40 A;  3GM8 A;  1YJL A;  5DUW A;  4O7X A;  3SH3 A;  4GUL A;  3ZR5 A;  1HB4 A;  4AEJ A;  1RUJ 1;  1PO1 3;  1BVP 1;  5LZ6 A;  1U12 A;  1DIW A;  2YBS A;  2P3K A;  5J96 B;  3VV1 A;  3J8F 2;  2WNU B;  4IE4 A;  2ZHK A;  1IPK A;  1S0B A;  2DUO A;  2HH9 A;  3UGF A;  5KC6 A;  3VBS B;  5A1L A;  1IQD C;  5DXD A;  2B42 B;  5A3U A;  1YWK A;  5JMC A;  1QJZ A;  3I7D A;  4FPE A;  1SDD B;  4QKD A;  1RUG 3;  4IV3 B;  2LRP A;  3LAG A;  4FVV A;  4YNI A;  4Q1R A;  5C8W A;  1Q56 A;  1XPW A;  2VG9 A;  4R9D A;  5FMB A;  1YQ5 A;  3O5S A;  1QXP A;  4P9G A;  4MZU A;  4YVS A;  5LRS A;  2OT7 A;  1Q8P A;  3LGR A;  3A0K A;  3B5L B;  3DUI A;  2C4X A;  2NYY A;  3C7H A;  3WNN A;  4M01 A;  1O3Q A;  3WR0 A;  3O1T A;  3AP5 A;  2D40 A;  1MVE A;  2C24 A;  2DCZ A;  3N35 A;  2OYZ A;  2YDE A;  5FKB A;  2QVS B;  1O59 A;  2EIC A;  5GAL A;  4XET A;  4EN6 B;  4FPC A;  3OGV A;  3ACH A;  3R05 A;  2BOI A;  4LO6 B;  5CIS A;  1RUO A;  1GQG A;  1UX7 A;  3N9P A;  1NXM A;  5L7O C;  1WCS A;  3ES1 A;  1ENS A;  4XHX A;  2XKO A;  2K2S A;  2RJL A;  5FP3 A;  1OI6 A;  1VBC 2;  2FD8 A;  3SEP A;  4BK4 A;  1JU4 A;  1VMH A;  1R1A 2;  2Q1F A;  2RDS A;  4UFI A;  2QJV A;  2YC4 A;  5TSW A;  3OY8 B;  4FOV A;  4HVR A;  2VM9 A;  1OD3 A;  5LK5 A;  1EAH 2;  1UU6 A;  1PGL 2;  1KFU L;  1YCI A;  2J7M A;  3GZT B;  1KS4 A;  4N43 B;  4RSU A;  1OC1 A;  2RMU 1;  2QBX A;  2V73 A;  5JXJ A;  5IJR A;  1GQP A;  4E4H A;  2AUY A;  1U5Z A;  1TNF A;  2ZAH A;  1JW6 A;  4JX0 A;  1FOD 2;  3TB0 A;  4UW3 A;  2OQ7 A;  5DAP A;  2DTY A;  3DKQ A;  3K3N A;  4EZH A;  3E1F 1;  4JDM A;  3TAY A;  4WVV A;  3I2O A;  3VN4 A;  1GUI A;  2DUR A;  3AMQ A;  2LAL A;  1Y4W A;  2XUM A;  4QPI B;  4A4A A;  1UU5 A;  1E57 A;  2CGO A;  1UY2 A;  1DYO A;  1K45 A;  1NLS A;  1WW7 A;  2ZHL A;  1BEV 3;  1UZV A;  3AL6 A;  3WUC A;  4CDW A;  1JBC A;  1SBE A;  4XQW A;  3AXD A;  2W46 A;  4CCN A;  4Z2W A;  5GLU A;  3LOB A;  2VW0 A;  4Q4V 2;  5T54 A;  5A70 A;  1JHN A;  1SLT A;  4TLF A;  1JS9 A;  1TEI A;  4G9S B;  4CEY B;  2BGO A;  3VDB A;  5A3P A;  1YHF A;  1QJY 1;  2J1S A;  2VC9 A;  1C3H A;  4ASL A;  4XUR A;  1JUI A;  2GAU A;  1ZZ7 A;  3V0B A;  3MIG A;  3ILR A;  2P3I A;  4MYE A;  4P9Y A;  5F7U A;  2VMD A;  3KM5 A;  3C7E A;  3O7O A;  2AH2 A;  2ZAC A;  4GJY A;  5JOW A;  3ETP A;  3R0R A;  2HKX A;  3CJI A;  4ITC A;  2ZX0 A;  1W8N A;  3MV1 1;  3ACL A;  4JAA A;  1H6X A;  4LOR A;  4Y24 A;  4C1X A;  5JR2 A;  2X5I C;  4NIA A;  4BWO A;  4QHB A;  1DFQ A;  1C28 A;  2Y0I A;  1FPN 2;  4NWW A;  5A7Q A;  3RZL A;  4Q4W 2;  3WP6 A;  4FAG A;  2A73 B;  5L9R A;  2QFE A;  4E8C A;  2CU5 A;  1UMH A;  1VB2 A;  1DQ2 A;  2E31 A;  3H0O A;  5GZG A;  2GZW A;  3FLT A;  3D0J A;  3KS7 A;  3OGS A;  2PHF A;  1ENX A;  1ZRD A;  2GH8 A;  5A7P A;  3WHT A;  4ATE A;  2MEV 3;  3J8F 1;  3ECQ A;  4RD7 A;  5SV8 A;  3HT2 A;  4QKF A;  2WZR 1;  4FQ4 A;  4OLL A;  4DIQ A;  1I3H A;  1W8O A;  2PHX A;  3K75 B;  4LA2 A;  1KGY A;  1GZW B;  4Y4R A;  2HWF 1;  5EV7 A;  3P3N A;  4NAM A;  4OI2 A;  2XVK A;  5C7G A;  4AED C;  1C8M 2;  1OUX A;  1QJU 2;  4LUL A;  4QX8 A;  3JBG 2;  4GKX A;  4DB5 A;  2VMF A;  1DHK B;  2OKX A;  3WG3 A;  2L9L A;  3IDB B;  2XXZ A;  3DCQ A;  4LO8 A;  2BER A;  2PFW A;  1QHD A;  3KWV A;  2W0X A;  1PNF A;  4OFG A;  2DTW A;  4LE3 A;  1TME 3;  2OVU A;  2Y33 A;  1LOB A;  1QQP 1;  3GXU A;  4HMZ A;  4WVM B;  5LY1 A;  2WNV B;  1Q43 A;  1GNY A;  2JG9 C;  3I54 A;  3JQX A;  1ND2 C;  3PTY A;  4AFC A;  2ZGN A;  4OZX A;  4BA6 A;  4LHK A;  4NMI A;  3N7K A;  5FLH A;  1VR3 A;  2PLV 3;  1A8D A;  2PN5 A;  2W52 A;  1HV0 A;  4UFL A;  5APA A;  1GNH A;  1UMI A;  2GNB A;  2D3S A;  1VBC 1;  2JEC A;  3C7F A;  5DG2 A;  1VJ2 A;  4B7E A;  5A6Y A;  5E88 A;  4FPH A;  2D97 A;  3HQR A;  4NHY A;  4BME A;  4JV4 A;  2J1U A;  2W08 A;  1RB8 G;  2G1M A;  1O4T A;  1AXK A;  4O9G A;  5L7O A;  1EAH 1;  4Z8B A;  1SLI A;  1WW5 A;  1YUD A;  3AZV A;  2HWC 2;  2EVX A;  2WC2 A;  4GMP 1;  1IS5 A;  3OCP A;  3U1X A;  4BQY A;  2ARC A;  1V6L A;  5J98 B;  3K4A A;  2EF6 A;  2W68 A;  3ZSL A;  2FQP A;  3PUI A;  4XAC A;  5FV3 A;  1YEW A;  1DZQ A;  4COZ A;  1CX1 A;  1XOY A;  3PDQ A;  1RHI 3;  2O0O A;  1RUH 3;  3RS6 A;  4CP1 A;  1A34 A;  5EHD A;  4UBH A;  1OKO A;  3CQO A;  2Q8C A;  1VPH A;  3M2M A;  4D6Q A;  1GMM A;  2O8Q A;  4GA9 A;  4IET A;  1LES A;  4KG0 A;  1S0I A;  3TNP B;  3I2J A;  4CDQ B;  1ZA7 A;  1W2O A;  4QHO A;  3ZFF B;  1K5J A;  3NO8 A;  1AR7 1;  1WWY A;  2ZAB A;  1AXY A;  1UXZ A;  3ZXE A;  3VZL A;  3EXU A;  3FBM A;  1CAV B;  1RXG A;  1RL3 A;  1VAV A;  2X29 A;  4AFD A;  4BQ3 A;  1Y7B A;  2RM2 2;  5BY5 A;  4CXX A;  3CJI B;  4QX1 A;  2W9X A;  1T6G C;  2BBA A;  2NQY A;  2GH2 A;  1QJX 1;  1UXX X;  1WBF A;  3ZYI B;  1UF2 C;  2OX0 A;  2ZGL A;  3H50 A;  4L97 A;  4LHS A;  3KT1 A;  3NVC A;  5DUU A;  1FPN 1;  3B00 A;  3ZXF A;  4IGQ A;  5IVV A;  3VKO A;  3H1M A;  3W21 A;  3WDW A;  3WDV A;  3WQ0 A;  2JEN A;  4AVB A;  5FUN A;  3FE5 A;  2YPJ A;  2IVI B;  4Y5T A;  5B4N A;  2ORZ A;  2WT1 A;  3MV0 1;  4RR3 B;  4GAL A;  5I8T A;  2ZTN A;  1UD1 A;  2R16 A;  1PVX A;  5LRR A;  4I0B A;  3VBH C;  1S0D A;  3DN7 A;  3H7J A;  4O61 A;  4PF1 A;  1J3P A;  2E7A A;  3POI A;  4KMQ A;  1HRV 1;  2VVF A;  2Z42 A;  4QPG B;  2VZR A;  2Q8O A;  5FO9 B;  2Y34 A;  2E63 A;  3WNO A;  1R08 3;  1PIV 3;  1DGL A;  2Q8E A;  2ZAA A;  3THP A;  4FFI A;  3SNM A;  1YIP A;  5KBF A;  3JBG 1;  4Z2A A;  1FMD 3;  1IZ3 A;  4YPJ A;  4AZZ A;  3RZZ A;  1J1L A;  1PNG A;  3IT8 A;  5ABJ C;  1DG6 A;  5FPL A;  3D0S A;  4UI9 L;  2WSU A;  4XFF A;  1ZBE 1;  4CU6 A;  5GZC A;  5F2W A;  2JXA A;  3K3O A;  4Y26 A;  1VBA 3;  4ATF A;  5BNO B;  5JWP A;  1COV 3;  1YJK A;  2F6B A;  4ARY A;  3I8T A;  2BNM A;  4AI1 A;  1POV 1;  2WS9 1;  1MS3 A;  3PNA A;  3THC A;  3ZMO A;  4DZG A;  4FTE A;  3Q8E A;  1BYH A;  3OB8 A;  4OVE A;  5IVE A;  5EIY B;  5FMO S;  1H2N A;  1QEX A;  1QNY A;  2JG9 A;  1LGN A;  2LRO A;  3DYP A;  5FRE A;  1CN1 A;  1ND2 A;  1AVB A;  3BB6 A;  5JSP A;  1AR8 1;  1OVS A;  4IQP A;  1ZBA 1;  4HKL A;  3A22 A;  3QLQ A;  2R06 1;  3CIH A;  4NHK A;  3OD4 A;  2B9V A;  2GNM A;  2OPW A;  2RV9 A;  2BV4 A;  2ZEX A;  1DQ0 A;  5ACA 1;  4HZF A;  1KQR A;  3BOP A;  1ENR A;  1CAW B;  3POY A;  1S0G A;  2K0G A;  1R09 1;  1RUI 1;  1A8M A;  4B4Q A;  1M4W A;  2OA2 A;  2WZE A;  2XVL A;  4DS0 A;  4LOT A;  5CBL A;  3C8X A;  5JSO A;  3MF9 A;  4XJU A;  4FPO B;  3LB9 A;  1J1T A;  3CZU A;  3LKJ A;  4W65 A;  1JTZ X;  5CKQ A;  3HNY M;  4HON A;  3I2G A;  4YGC A;  4UYB A;  4A44 A;  5L9B A;  1GBG A;  4FTS A;  5C6C A;  2XGX A;  2Y38 A;  3POE A;  5IK7 A;  2R0F A;  3LFI A;  3A7Q A;  4QQL A;  2HWD 3;  4BK5 A;  2Y64 A;  5JLV A;  4CDX B;  4QQH A;  1PZ8 A;  1MR5 A;  4M3C A;  2VUL A;  3UGG A;  4PQ9 A;  1GZT A;  1O91 A;  3POJ A;  3WDX A;  2B46 X;  2WII B;  4LBK A;  5IW0 A;  2R04 2;  4NHL A;  5JVV A;  1ULC A;  1BJQ A;  5J3U A;  4UW5 A;  3TEW A;  2A6X A;  3ROU A;  5IAX A;  4FOQ A;  3FBY A;  1GFF 2;  1WME A;  2YPD A;  4A6O A;  4AE2 A;  5BNN B;  3WT3 A;  3UV9 A;  2ZBJ A;  1S0F A;  1Q5O A;  3AYE A;  2R49 A;  4FOW A;  1OOP C;  4LO5 B;  4COY A;  3ALQ A;  2B5H A;  4PDW B;  5LA9 A;  3AXE A;  1LED A;  2WBK A;  3RZM A;  1K5M B;  3JZV A;  3WF0 A;  1RUJ 3;  4JZR A;  3JCI A;  1DBN A;  3OF1 A;  1PZ7 A;  1SAC A;  2I07 B;  3FLR A;  2QQI A;  1JU3 A;  5C3P A;  1S0J A;  2WLP A;  4JGY C;  1TMF 2;  4AEM A;  2P5B A;  4P9J A;  5BNP C;  1AJO A;  3OGR A;  1UO9 A;  1W8H A;  2DVB A;  3UT0 A;  1HRI 1;  4HFS A;  4HN0 A;  4NID A;  1LEM A;  2XWJ B;  3GYD A;  1QOT A;  2UYA A;  3OBZ A;  1V9U 3;  2CDP A;  1JOB A;  2OPK A;  3UES A;  2XDV A;  4Q8K A;  1PMJ X;  3P5B A;  4PIX A;  3OUH A;  3U4X A;  3MW4 A;  2IXI A;  5GM0 A;  4QX2 A;  1PX3 A;  3WNX A;  4PBP A;  4OI0 A;  3WP5 A;  1XNB A;  1UZY A;  2ZKL A;  1RVF 2;  5FYI A;  1VAL A;  5JDB A;  1XRU A;  5F3C A;  1PVC 3;  3LA3 A;  1RUC 2;  4LKE A;  5FY1 A;  2VW1 A;  4UFJ A;  2EIE A;  1GYK A;  2DUP A;  3AX4 A;  3K48 A;  2QQV A;  2EXK A;  1J59 A;  5D21 A;  1TNR A;  1IKQ A;  1VBB 1;  2IXL A;  3PU8 A;  3WF4 A;  2JG8 C;  5LCW L;  5FR3 A;  1OA3 A;  3B69 A;  3IIA A;  2ATF A;  3L2H A;  2K9Z A;  4CXW A;  5A33 B;  2IC1 A;  4ZS3 A;  3NAP C;  1JYX A;  2QCS B;  2ZXQ A;  3OPT A;  4XZP A;  1AYN 1;  3E5Q A;  2P34 A;  3NJZ A;  3VKF C;  3CKH A;  2AYH A;  5CFC B;  1QXR A;  4UWD A;  3SHR A;  4B1L A;  1OF4 A;  4LT5 A;  4HAN A;  3ST7 A;  1GSL A;  2LM3 A;  1OFN A;  2E33 A;  1NCR B;  2OW4 A;  1FAT A;  3LEG A;  2ZZJ A;  4KWL A;  4QX3 A;  1CVN A;  4YG6 A;  5IFP A;  2VCC A;  4X6R B;  1AYM 2;  4GWN A;  4YFW A;  2VVD A;  5D8A C;  3SIS A;  2RMU 3;  2Z69 A;  1YRZ A;  5FZ1 A;  2O8O A;  2X53 S;  3NNM A;  1EY2 A;  4PF5 A;  4V2V A;  5DPN A;  5C4W B;  1FV3 A;  3PUH A;  1Q8V A;  2HWE 2;  4HLT A;  3AZY A;  1IG0 A;  2FMY A;  3AVR A;  3UNP A;  1QIQ A;  1W6N A;  3ZXK A;  2VUJ A;  3ZM8 A;  2NLR A;  5E8A A;  4ET7 A;  3AB0 A;  1C57 A;  4YVW B;  3KCX A;  4P02 B;  2JKB A;  3O1R A;  2W91 A;  1X7N A;  4JDN A;  5CIR A;  4EN8 B;  2QUO A;  3W20 A;  2VQT A;  3RFR A;  3J26 N;  2IXH A;  1UW8 A;  2PHR A;  2UY8 A;  1APN A;  2UUR A;  4P9I A;  4Q5O A;  1UYP A;  3KGL A;  3AMM A;  1W06 A;  2GP3 A;  4PQQ A;  3WQB A;  3H3Z A;  4BYY A;  3FMG A;  3AP6 A;  2CV6 A;  2AC1 A;  1H6Y A;  2R04 1;  3WDT A;  2XUE A;  1QJY 3;  4LBN A;  3MYX A;  5T5O A;  4A7Y A;  4D7S A;  3I97 A;  1PGS A;  2N7G A;  3AKT A;  5K4L A;  1VAK A;  2A3X A;  2JDP A;  4UAP A;  3R4D B;  2QQJ A;  4N90 A;  5JIU A;  2Y60 A;  1JZ5 A;  1N1S A;  5BYN A;  1F9K A;  2ZJC A;  2XJU A;  4K7J A;  1LU2 A;  4PLO A;  3VDD B;  5FYB A; 
#chains in the Genus database with same CATH homology
 3I3E A;  2VZT A;  1UYZ A;  2W92 A;  5CZK A;  1W9S A;  4P00 B;  3MO4 A;  1UY4 A;  3WNK A;  1W9T A;  2R7E B;  4HG6 B;  3GM8 A;  3GDB A;  1WKY A;  2VMC A;  2ZEY A;  4XUO A;  2J1T A;  5DQ0 A;  2VZU A;  1TVG A;  4BXS V;  3WNM A;  1XNT A;  3FL7 A;  4GWJ A;  3VD7 A;  1IQD C;  3W5N A;  1SDD B;  2Y6K A;  2V72 A;  3BN6 A;  2VOT A;  3LPG A;  1GOG A;  3T0A A;  1XPW A;  1JYN A;  3DEC A;  3P1I A;  3VD4 A;  3T0D A;  3VD9 A;  1XC6 A;  2C4X A;  3VDC A;  3C7H A;  3WNN A;  2VO5 A;  4LKS A;  1NX9 A;  1NKG A;  2EIB A;  3T2Q A;  2CDO A;  1O59 A;  2EIC A;  1EUT A;  3OGV A;  3ACH A;  4FI9 A;  4OMC A;  2ZEZ A;  5C71 A;  1UX7 A;  2WUH A;  2WAB A;  3DYM A;  4D8M A;  3UET A;  4A3Z A;  3ABZ A;  2BGP A;  3SEP A;  1JU4 A;  4BK4 A;  2YC4 A;  4GWI A;  2VM9 A;  1OD3 A;  5A1A A;  2YB7 A;  2J7M A;  1T2X A;  4RYD A;  2QBX A;  5JXJ A;  5IJR A;  1GQP A;  4W50 A;  2VR4 A;  4JX0 A;  3I2F A;  2Y6H A;  4JKL A;  5FUI A;  1J84 A;  2LW8 A;  3E1F 1;  4ARX A;  2V5D A;  5EJZ B;  3T09 A;  1GUI A;  2VL4 A;  2ORX A;  1JZ2 A;  4A4A A;  1UY2 A;  1DYO A;  1K45 A;  4ZZ8 A;  2HLE A;  1UY0 A;  4P5Y A;  2W46 A;  2W1Q A;  4DEV A;  3U37 A;  2BGO A;  3VDB A;  2WDB A;  2J1S A;  2VC9 A;  2BZD A;  3I2K A;  4XUR A;  2QQK A;  4JKK A;  5F7U A;  2Y8K A;  3T2O A;  3ACF A;  2VMD A;  1HN1 A;  3C7E A;  4ZY9 A;  1XNA A;  3ETP A;  3BGA A;  1W8N A;  3MV1 1;  4JKM A;  4XUP A;  1H6X A;  4DUW A;  3MBW A;  5JR2 A;  2Y6G A;  2VZ1 A;  2W1U A;  4CUC A;  1EUU A;  2JD9 A;  4RN5 A;  1NAE A;  4CUA A;  4E8C A;  1UMH A;  2E31 A;  3ACG A;  2LS6 A;  3K4D A;  3OGS A;  4AAX A;  2WAO A;  2W1S A;  4OYU A;  1J83 A;  2WYS A;  3ECQ A;  4IUG A;  1CIY A;  1W8O A;  3K75 B;  1KGY A;  3IDA A;  1L7R A;  2XQX A;  3HOB A;  5C7G A;  5IFT A;  1JZ3 A;  3LEI A;  4DXR A;  2W94 A;  2VMF A;  4KI5 M;  2QQO A;  2OKX A;  2QQN A;  2L9L A;  2VQU A;  3HJR A;  4BJ0 A;  2B4K A;  3IAQ A;  4QB2 A;  2BER A;  2VZ3 A;  1O8S A;  2J1E A;  1I5P A;  2JKX A;  1F4H A;  3GXU A;  4QAW A;  1GNY A;  1P8J A;  4MGQ A;  3LPF A;  3WSO A;  2VCA A;  3CMG A;  3LQC A;  3LEK A;  1UMI A;  3C7F A;  1US3 A;  3I3D A;  2J1U A;  2DDU A;  4CU7 A;  3JXS A;  2VZV A;  4ZZ5 A;  3III A;  3WNP A;  3WNL A;  5JXG A;  3WF2 A;  2WO1 A;  4AG4 A;  2WZ8 A;  3OBA A;  3WF1 A;  3VD5 A;  4XUN A;  1GOH A;  3K4A A;  5I0D A;  1JZ8 A;  3PUI A;  1BHG A;  4OZO A;  4CU9 A;  1CX1 A;  2VZQ A;  5G04 L;  2J22 A;  5C70 A;  5LA0 A;  2XOM A;  1JZ4 A;  3CQO A;  2ID4 A;  4QPW A;  1GMM A;  3CDZ B;  3K77 A;  3I2J A;  5B4X A;  3SEE A;  3P6B A;  1CZS A;  3VDA A;  2DCK A;  2WN2 A;  1UXZ A;  2YG0 A;  1YQ2 A;  1GOF A;  4XUT A;  4DXS A;  2W87 A;  4QX1 A;  2W9X A;  2BBA A;  3MUZ 1;  1UXX X;  2C9K A;  3DYO A;  1LNS A;  4LHS A;  5JXH A;  1UWW A;  3FHQ A;  2J1A A;  4QB1 A;  5B4N A;  2ORZ A;  4DXT A;  1TG7 A;  3MV0 1;  2JDA A;  5DMY A;  3ACI A;  2QQM A;  3FN9 A;  5IYY A;  1RYY A;  3A23 A;  1JYV A;  5JXI A;  4PF1 A;  4KMQ A;  1UY3 A;  2VZR A;  3J7H A;  4LPL A;  3WNO A;  2WO3 A;  4QB6 A;  1W9W A;  4CU8 A;  1JYW A;  5LA2 A;  1W99 A;  4Z2A A;  2Y6J A;  2E32 A;  5IHR A;  4YPJ A;  1UZ0 A;  4XUQ A;  3WF3 A;  1CZV A;  4UI9 L;  4CU6 A;  4OMD A;  1K42 A;  1UYY A;  2X10 A;  4QX0 A;  4ARY A;  4M4P A;  3T0B A;  4MAD A;  4P08 A;  2Y6L A;  4GZ9 A;  1KEX A;  2PQS A;  3HEI A;  3THC A;  2YFU A;  3OB8 A;  5EIY B;  2XHN A;  1JZ7 A;  3AC0 A;  3LE0 A;  1CZT A;  3DYP A;  3OEA A;  4ZXE A;  3NRU A;  3A22 A;  3CIH A;  1WCQ A;  2B9V A;  2RV9 A;  2ZEX A;  3IAP A;  5EJ1 B;  1JI6 A;  2YC2 A;  1DP0 A;  1GU3 A;  1OF3 A;  3HN3 A;  1MPX A;  3K46 A;  4OUE A;  5CYY A;  1R64 A;  1PMH X;  2WZE A;  2Z4F A;  3GGL A;  3C8X A;  4CVU A;  4E8D A;  1US2 A;  3NQH A;  3NJV A;  3CZU A;  4JHZ A;  3HNY M;  3HNB M;  3I2G A;  1PX4 A;  3NNG A;  4A44 A;  2YFZ A;  3I2I A;  4M4R A;  3A7Q A;  4BK5 A;  2W47 A;  2Y64 A;  1O8P A;  4QDR A;  3SKJ E;  2ZEW A;  2C26 A;  3W5M A;  1K12 A;  5HPO A;  4UOJ A;  2EID A;  1K3I A;  3CZJ A;  3C7O A;  4A6O A;  4A42 A;  2X09 A;  2RJ2 A;  3HNM A;  2WBK A;  4XZU G;  2WN3 A;  3WF0 A;  3T2P A;  5LA1 A;  1UY1 A;  2QQI A;  1JU3 A;  2W95 A;  3OGR A;  4CUB A;  3OEB A;  3NJX A;  2XON A;  1W0N A;  3UES A;  1NUK A;  2CDP A;  1PMJ X;  2VME A;  3FHA A;  4MGS A;  4QX2 A;  4L0P A;  4MO3 M;  1PX3 A;  2VZO A;  4W8J A;  4DUV A;  3HPN A;  4XVH A;  3A21 A;  4LQR A;  4PT6 A;  5DN2 A;  1L7Q A;  4QDQ A;  4DEQ A;  4A41 A;  2EIE A;  2E26 A;  3I3B A;  2VTF A;  3WF4 A;  5LCW L;  4TXW A;  2V4V A;  3K4Z A;  3T08 A;  2WAA A;  1JYX A;  5JMO A;  2ZXQ A;  2WQ8 A;  1DLC A;  3CKH A;  4TTG A;  3D3A A;  1OF4 A;  2VZS A;  1SG3 A;  1JHJ A;  2QQL A;  5JUV A;  1OT5 A;  3THD A;  2E33 A;  3OG2 A;  3LEG A;  3EYP A;  4QX3 A;  3C7G A;  5IFP A;  5HXM A;  2VCC A;  1JZ6 A;  1ULO A;  4A45 A;  1UYX A;  4W4Z A;  2W5F A;  2VZP A;  2HYX A;  1D7P M;  2J1V A;  2VJX A;  5DPN A;  2RVA A;  3PUH A;  4QDS A;  2JE8 A;  2W3J A;  3UNP A;  2X05 A;  3VD3 A;  3SKV A;  3ZM8 A;  4ET7 A;  3MUY 1;  4P02 B;  3EB7 A;  2WO2 A;  4BDV B;  3F2Z A;  1SHW B;  2W91 A;  2DCJ A;  2VQT A;  2KD7 A;  4D0Q A;  4DUX A;  3IB3 A;  5G05 L;  2J1R A;  4PQQ A;  3WQB A;  2VCB A;  1ULP A;  5J1X A;  1H6Y A;  3I2H A;  3I97 A;  3WEZ A;  1F4A A;  2W1W A;  4UAP A;  1JZ5 A;  2QQJ A;  4KWU A;  4MOA A;  1OH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...