1O8PA

Unbound structure of cscbm6-3 from clostridium stercorarium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
b'PVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATUVE ENDO-XYLANASE
publication title Structure and ligand binding of carbohydrate-binding module CsCBM6-3 reveals similarities with fucose-specific lectins and "galactose-binding" domains.
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Hydrolase
total genus 30
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1o8pA00
1J83A 4JHZA 1JZ5A 3VDBA 2JKXA 4GWIA 2QQMA 2DCKA 2YFZA 4PF1A 4QPWA 1OD3A 3I97A 4Z2AA 4OMDA 2JDAA 2ZXQA 3OGRA 4ZY9A 3CDZB 2Z4FA 3LEKA 2WUHA 4AG4A 3EB7A 4TXWA 2Y6HA 1UX7A 2Y6LA 2WZ8A 3A7QA 4XVHA 3GGLA 2WZEA 2VO5A 3GM8A 4JX0A 5DPNA 4P00B 1W9WA 3IB3A 1O8SA 4UAPA 2QQOA 3E1F1 2W92A 3GDBA 2QQLA 3UESA 4XUQA 1LNSA 4D8MA 3SEEA 1JHJA 1PMHX 3A22A 1NUKA 2WO2A 3A23A 5B4XA 3W5MA 3JXSA 2QQJA 3PUHA 4BXSV 4DXSA 2VM9A 3WNLA 5JXGA 1JI6A 1JU3A 1D7PM 5C71A 1OH4A 3VD5A 3I2IA 1XPWA 1MPXA 3IIIA 3WNKA 1UMIA 1CZTA 4P5YA 3ACGA 1UY0A 2VCAA 1XNTA 4JKMA 3OBAA 3LE0A 4MADA 2VZVA 3C7FA 4QB6A 2VMEA 4QDQA 4UI9L 1ULOA 3MUY1 5DN2A 1W8OA 3WF3A 4MOAA 3I3DA 1JZ4A 1K42A 5JXJA 3C7EA 1F4AA 3VD3A 2ZEXA 2W3JA 2WQ8A 3OGSA 4OZOA 1PX4A 4BJ0A 3LEIA 2WYSA 4M4RA 3HEIA 2L9LA 1J84A 3WEZA 3W5NA 3K4ZA 3T2OA 1W0NA 2J7MA 3T09A 1OT5A 2W91A 4W8JA 4CUBA 5I0DA 4XUOA 4OUEA 2QBXA 5DQ0A 2J1TA 1DLCA 3T2PA 1W99A 3LEGA 4DUVA 2VMFA 2Y6GA 5LA1A 1GOGA 3MBWA 5EJ1B 1GOFA 2QQNA 3I2FA 4QX1A 4DUWA 2VL4A 4CUCA 3K4DA 1JYWA 2EICA 5JXIA 2WO1A 2VZ3A 5HXMA 4QX0A 2XOMA 2WAAA 4A4AA 3ECQA 4PT6A 4QB1A 3EYPA 1YQ2A 1EUUA 2W87A 2ZEZA 5C70A 4QX2A 4E8DA 2QQIA 3NJXA 2Y64A 4XUTA 3WF0A 3CZUA 1GQPA 3CZJA 2X05A 2WDBA 2Y8KA 1UWWA 3I3BA 3MV11 1EUTA 3K4AA 1TG7A 4A3ZA 1CZVA 3SEPA 1KEXA 3ACHA 3VDCA 5IHRA 2YFUA 4E8CA 3VD9A 4GZ9A 1K3IA 1L7RA 2YB7A 1US2A 4TTGA 3T2QA 2J1RA 2DCJA 4DXTA 2VC9A 1PX3A 2RVAA 3P1IA 2WBKA 2BBAA 3WNOA 2BGPA 1OF4A 3HOBA 2WABA 5J1XA 2V72A 3CQOA 2VMCA 3WNNA 3PUIA 4DXRA 1NAEA 2VZRA 1KGYA 1UYZA 3I2JA 5LA2A 3T0BA 5IFTA 4FI9A 1K45A 4CU6A 5EIYB 2WN2A 1GOHA 4DEQA 4A6OA 1W8NA 5B4NA 4CVUA 3WF4A 3HNMA 4P08A 2VZUA 3DYOA 1BHGA 4D0QA 5LCWL 3DYMA 3I3EA 3K75B 5DMYA 2EIEA 2Y6KA 1UXZA 5LA0A 1JZ8A 3F2ZA 3MUZ1 3ACFA 1UY4A 3OB8A 4LKSA 4ARXA 3CIHA 1H6YA 4XUPA 4QAWA 3J7HA 1GU3A 2OKXA 2W47A 3THDA 4ET7A 2E31A 4DUXA 3SKVA 1SG3A 1P8JA 4ZZ5A 1TVGA 1UY1A 4P02B 3DECA 1T2XA 3OGVA 3ZM8A 3CKHA 3BN6A 5EJZB 2J22A 4XZUG 2XHNA 4LPLA 4JKKA 2ID4A 2VZSA 5JR2A 3HNYM 1OF3A 1JZ7A 1PMJX 2HYXA 3I2GA 3P6BA 2VZTA 2VTFA 2CDOA 1IQDC 2VZQA 2DDUA 3I2KA 1UY2A 1JZ6A 1NKGA 4HG6B 2VMDA 3IAQA 1W9TA 2W1WA 1GUIA 2V4VA 4BK5A 3WQBA 4OMCA 4L0PA 2VQTA 4A45A 4PQQA 1W9SA 2YC4A 4BK4A 3C8XA 1I5PA 3MV01 4MGSA 2WO3A 3VD4A 1F4HA 1HN1A 1JU4A 4KI5M 2Y6JA 2VR4A 2J1VA 5IJRA 5JUVA 2VZOA 3FL7A 2WAOA 3AC0A 3IAPA 3NJVA 2E33A 2EIDA 2VZ1A 4LQRA 4ZXEA 2W9XA 3ETPA 2W95A 3DYPA 3SKJE 2JD9A 2W5FA 5G05L 4DEVA 3BGAA 2X09A 4CUAA 3T0DA 3A21A 2W94A 3FHAA 4KMQA 1DP0A 1GMMA 4MO3M 5F7UA 4M4PA 2KD7A 3C7HA 3WNMA 3ACIA 4ZZ8A 4CU9A 2C26A 4QDRA 2LW8A 4CU8A 1CIYA 3GXUA 5FUIA 2B9VA 5CYYA 4GWJA 1H6XA 2E32A 2J1AA 3FN9A 2XQXA 4LHSA 3I2HA 3OEBA 2LS6A 2BZDA 2ZEWA 1GNYA 1O8PA 2VZPA 2W1QA 3D3AA 3IDAA 5G04L 2J1EA 2VJXA 3HJRA 4YPJA 3K77A 4W4ZA 2V5DA 3THCA 2VCBA 3CMGA 3OEAA 3WNPA 2VCCA 4QX3A 1UYYA 3UETA 2ORXA 2EIBA 2C4XA 3NRUA 2X10A 1L7QA 1JZ2A 3UNPA 3C7OA 2R7EB 4IUGA 3ABZA 1NX9A 2HLEA 3WF2A 4W50A 4XUNA 2BERA 4AAXA 2YC2A 3HNBM 2YG0A 4CU7A 5JMOA 2VQUA 2BGOA 1ULPA 5HPOA 2J1UA 3HN3A 2B4KA 1JYVA 2XONA 4RN5A 2C9KA 3MO4A 5CZKA 4A44A 3WSOA 2QQKA 3U37A 2J1SA 2W1SA 3LQCA 4UOJA 1UMHA 5C7GA 2WN3A 1XC6A 2W1UA 4RYDA 4BDVB 2W46A 1US3A 1K12A 1RYYA 2E26A 2PQSA 3NNGA 2ORZA 1DYOA 4XURA 1R64A 3K46A 1O59A 4KWUA 1UXXX 1UYXA 3T08A 2RV9A 1WKYA 3VD7A 1UY3A 3FHQA 3LPGA 4QB2A 5A1AA 3HPNA 2CDPA 3WF1A 2ZEYA 1CX1A 1CZSA 3OG2A 4QDSA 4OYUA 2JE8A 3VDAA 1SDDB 1SHWB 3T0AA 1XNAA 5IFPA 5JXHA 3C7GA 5IYYA 2VOTA 3NQHA 1JZ3A 4MGQA 4A41A 4A42A 1JYNA 4ARYA 1UZ0A 1WCQA 1JYXA 2RJ2A 4JKLA 3LPFA
chains in the Genus database with same CATH superfamily
2YV8A 2FDJA 1NCQA 1DQ6A 1X9TA 4AI8A 1SBDA 1W2OA 1RVF1 5I8SA 3BKZA 2HH9A 2QQMA 4ATFA 4ES9A 2MHFA 5FP3A 1LHNA 2PQQA 2RS51 3VHRA 2YFZA 3BOPA 5J98B 3N9QA 3V0AB 1NY72 1QHDA 1V6OA 2ZZJA 3I59A 3WW4A 4Z92B 3VBOB 5FYZA 3O7OA 5EV7A 3RS6A 3APBA 1DIWA 1OA4A 2VECA 1W3XA 3SC7X 2VMGA 1TMF2 5LBBA 2G4IA 3MIHA 1RUH3 1YQ6A 2Z42A 1V6JA 2Y0IA 5FZGA 1UX7A 3A7QA 2WZ8A 2R062 2HJIA 4LOSA 1HLCA 2ARXA 3GGLA 3ITQA 3PL0A 5ERLA 2OYZA 4CUGA 3MPBA 3PTYA 1NCQB 2ES3A 4BQ5A 1W9WA 2BGCA 2PHXA 1O8SA 2YPJA 3C3VA 4TSVA 1TEIA 4Z1VA 2QQOA 3E1F1 3IKWA 3ZFGA 2WRAA 1WCUA 5DAQA 5A6XA 5FO7B 2FDKA 3GDBA 1ND3A 3N9LA 4FXKB 3UESA 4GMP0 3AP4A 3ES1A 4XUQA 5F5AA 2ARCA 1MS4A 1PMHX 2RS11 4FPYA 1Q8PA 4K40A 2WO2A 4LK7A 1T6GC 4LO6B 1YJKA 3A23A 4BQ3A 4AWDA 4DB5A 3MW3A 1H0BA 1RUC2 5FZKA 4C90A 2DTYA 2CGOA 4BXSV 1HRI1 2XJQA 3AP6A 5CKMA 1GWKA 5JI7A 1JI6A 3J26N 4MGKE 3SQOA 1ZZBA 3GNEA 3ZN5A 1UZVA 4XFIA 4GAZA 4QKDA 3H1YA 1XPWA 3UV9A 5DUVA 1MPXA 5JZGB 4YW6A 1GNHA 3CL1A 5A3TA 1MS0A 5FYUA 2OQ7A 4AHWA 4P5YA 2OQ6A 1YFUA 1RXGA 1XNTA 3MI8A 3VBSC 3ZYHA 3ZYRA 1R083 3S6PA 3E6DA 4GWMA 3NSTA 4PIYA 4P9YA 3ZXDA 3WF3A 5C9AA 2XKOA 2UYAA 3MYXA 5JI9A 3LFIA 3POGA 1R093 4K8FA 3ZFFC 2Q30A 5JXJA 3C7EA 5FDBA 2ADEA 5FZ1A 4NRQA 1DHKB 1NXD1 1U5XA 3DL3A 5CNAA 3VD3A 2ZEXA 5A3WA 2H6CA 1V6NA 4OZOA 1DZRA 2ZGUA 1YQ5A 2YY1A 4JDOA 4M4RA 2L9LA 2ZKLA 2WWSA 2Y60A 3JB4C 1SLBA 1CJPA 3W5NA 2XKPA 3V65A 4DRVA 4IGQA 4GB33 5J3UA 1Q43A 4RHV1 5F3IA 1HRV1 1YFWA 4B8EA 5EWSA 1IQAA 1AR61 1C57A 1JH5A 2I45A 1RUF2 2R49A 1JOJA 1QEXA 2J7MA 5FPUA 1JTZX 1VBB2 5FZHA 4LO5B 2RDSA 4BH9A 2W91A 2ZTNA 4NN0A 5LBFA 5FZFA 2GH2A 3WQ0A 4CUBA 2C6SA 1FMD2 2WNVA 5I0DA 2DV9A 4XUOA 5FFOC 1LHVA 1ZBE3 2QBXA 2QCSB 5K4LA 4CEYA 4D7TA 4PCRA 5BXXA 2HEYF 1V9U3 3J9SA 4QQOA 5FJKA 1ZVFA 3TN91 5A6ZA 1XXNA 5FBJA 1NA1B 1CONA 4XJ9A 4DUVA 3QH7A 4Y1YA 4KG8A 1VP6A 4YVWB 3B9IA 3J7LA 1H9PA 2RDNA 3I2FA 2BBVA 2HBUA 1O4TA 4DUWA 2P34A 1RITA 3TOJA 1JYWA 3M3OA 2ZJCA 1NE4A 2VZ3A 2UY9A 3I7DA 5E16A 5HXMA 4EWDA 1ULDA 1W8ZA 4QX0A 3HMYA 2VUAA 2JDNA 4MHUA 1LECA 4EWAA 4LTAA 1PVXA 1DZQA 2Z2SB 3ELNA 3ECQA 4EYUA 3UL2A 3RI8A 5C6CA 3EYPA 1YQ2A 4CRQA 4XFFA 5KHIA 1W9YA 2ZEZA 2GNBA 3IWZA 4MVTA 2QQVA 2WQZC 4KH9A 3R4DB 4QX2A 4UBGA 5JOZA 4B4QA 3O12A 3WDXA 3RDIA 4FXGB 3WW1A 3S5AA 4XUTA 4P9WA 1WGPA 2C5DA 3CZUA 3VL9A 3KCXA 4A7KA 1GQPA 4WZCA 4P9JA 4CDXA 3VZNA 4LJHA 4XIKA 5H9QA 4BISA 4YGDA 4LOTA 4M3CB 1RUJ2 3I3BA 3GHNA 1SLCA 4A3ZA 1CZVA 2QKDA 3IPVA 1B09A 1ODNA 4N90A 5DDJ2 1AL23 5FY5A 1KEXA 5IHRA 3VD9A 4E8CA 4RQPA 1FNYA 1RC6A 4NOTA 4CPBD 1K3IA 3R4UA 3BTYA 4CP9A 3D5OA 5IATA 1G9AA 3JBG2 4L8QA 1UNBA 4XJ8A 5A33A 3KHCA 3I54A 3KZ4C 4QU1A 2JIJA 1AX2A 1H2LA 2RM22 4QGMA 4URTA 5FAXA 3SCHA 4H7LA 3WNOA 5KWRA 4K1YA 5AC91 2WABA 3P3NA 4WVMA 4LUKA 5CKNA 2EVXA 1X33A 5J1XA 4PLOA 1OPMA 4RGGA 4K20A 5EJ3A 1F35A 3H3LA 3N7JA 2YDEA 4EN0A 4CDXB 2AACA 3PUIA 5JDBA 1KGYA 4NJ4A 3SH5A 1BQPA 2PYTA 4FI9A 3MZHA 2EIGA 1JODA 3POFA 1QJU3 2WNUA 3WUCA 4MGTA 4O7XA 4DQAA 4QX5A 3IPVB 3DKWA 5F3CA 4Q4W1 1S1AA 4XF3A 1GOHA 2BOJA 4DEQA 4A6OA 1AR92 1AF9A 4LO7A 1W8NA 3HR9A 3UJOA 4CYDA 5I93A 1MZFA 2DUQA 4AVCA 2WQ4A 1TMF3 4IETA 4AOCA 4P08A 1KFXL 3DYOA 4D0QA 4LT5A 3MIFA 4FPOB 2IFRA 4I0WB 2E7TA 3GJAA 3POWA 5AVAA 2DBNA 1W39A 2Y6KA 1JZ8A 4FPFA 4WVMB 1ZREA 3MUZ1 1Z78A 2OIIA 5C3QA 3ACFA 1UY4A 2E7AA 3J7MA 1IKPA 4ARXA 4ASKA 2I07B 4IV1C 3LDKA 4QXKA 3WR0A 1QJFA 4HK9A 2D6KA 2AC1A 3O1MA 3RG0A 4I0BA 3EO6A 1ND2B 1I1EA 2PTMA 5IK8A 2ZMNA 4XCBA 2HWE1 1WCDJ 4G4FA 1EYBA 3THDA 3ZXGA 4ET7A 4MHRA 1RUOA 3BODA 4N7UA 3SKVA 1FNZA 1SG3A 3POJA 5FLJA 5FXVA 4CDUC 1PGL2 4LHLA 1F8VA 1TVGA 4DO0A 2E6VA 4XJWA 5I0TA 3MIDA 3RJRA 1O4YA 3J8F3 1J59A 2VQAA 1QXRA 2ET7A 1GZWB 2D40A 1RHI1 4XZUG 1YWKA 4LPLA 4O9EA 2CV6A 4JKKA 1GLHA 1UZZA 2RJLA 3RVHA 2UU8A 4FQZA 2FDHA 2WZR1 4KU8A 3I3MA 1IPSA 1UQXA 3N4MA 5GZCA 1OXCA 2VTFA 4RS5C 1OOPC 3ILRA 4JDMA 2RS31 1OMIA 2KR2A 1WW7A 1ST8A 2K46A 2QDNA 3HQUA 4XBLA 1RIRA 2H0BA 3UK9A 4Q0UA 4Y4YA 5F8PA 3DUIA 2YU2A 4FBFA 2JDKA 3H7YA 2JXAA 5LK7B 2V4VA 1ZBA1 3WQBA 1BBT2 1NLSA 2G9GA 4PLMA 1TNFA 4CSWA 2B7YA 4I30A 4A45A 2XJSA 1W9SA 2YC4A 2GC2A 3RPQA 4AFCA 4MG2A 4HSLA 4MLOA 5JSPA 1IPKA 1POV0 2WO3A 3AP5A 3LF7A 4MGSA 4XQDA 1W6NA 3CJIA 2ATFA 2AENA 4CP0A 3D0JA 4MXWA 4E4ZA 4YGCA 5FZBA 3ORJA 3T3YA 2ZGPA 4BXFA 4YG6A 2QDRA 3LA3A 2DBIA 3VBHC 1MQTA 3Q9OA 1J58A 3NV1A 2ZAHA 3H9AA 4RS5B 1QQP2 4CCOA 2D3SA 5FREA 4ZS2A 1ULGA 2VNVA 4QX8A 2AEZA 2E33A 1RUG1 3Q8CA 1VBB3 4U2AA 3AYAA 2QNKA 3TB0A 1LOFC 3FFZA 1HKDA 1HQWA 1V6IA 4HSJA 5IK5A 2RR12 5FYSA 5FWEA 3ETPA 4CXYA 2BUKA 2VGDA 4DEVA 1LHUA 3ES4A 4Y1ZA 5L7OC 1X9PA 1W6NB 2P6HA 5ANQA 4CUAA 1YYNA 4CZSA 4YZ1A 5JR7B 2Y34A 4H3WA 4I0AA 1QJX3 4WBBA 5T54A 4IEQA 3M2MA 3VBHB 1B35A 2Z79A 3KVBA 3KT1A 3T2TA 3TNQA 1GMMA 4WM8C 2Y26A 2WFF3 3H0OA 2VULA 3WG2A 4B1LA 1DZTA 2KD7A 4MUVA 4LBOA 4EE2A 3ACIA 3GZEA 1Q8SA 1JUHA 1XB9A 2RMU2 5FYBA 2C26A 5T55A 5IK4A 3HD8B 2XJTA 2XL9A 4JQTA 5T3NA 3R6SA 4IEYA 4XDOA 4AVAA 4OHVA 2O8QA 4EN9B 3QACA 3HBKA 1VB4A 3WP6A 5LBCA 4BA6A 4C0HA 3BU0A 4GWJA 4OUMA 1H6XA 1HXS3 1NQJA 2E32A 5K0UA 3ZYBA 1MS8A 3N7LA 3BPSA 5ANNA 1VBC1 4LBKA 4HFSA 2LS6A 1SLAA 1LHOA 4AI2A 1AR82 2DYCA 1D4M2 1O8PA 1OA2A 3LOIA 3FFQA 1VRH3 4FPKA 1B35B 1RUJ3 3CHXA 5CFCC 1IZ3A 2PHRA 3R05A 1AR71 1N3OA 3IDAA 2VOVA 5DDJ3 5G04L 4GH4C 2HWC3 4FVVA 4KNCA 2HWD2 2PFWA 5C3RA 2NQYA 3THCA 3CMGA 4AI0A 1JXNA 4KWKA 1JYTA 2VCCA 2BU9A 4QX3A 3UETA 1SPPA 1YFXA 1YIPA 2C4XA 1HJFA 4IXLA 1L7QA 1JZ2A 1UN1A 2E51A 2QZ3A 5GLWA 1ZRCA 1POQA 2Z5WA 3OD4A 1NX9A 1QNWA 2HLEA 5C8CC 4W50A 4XUNA 5C5TA 2JG9C 5ACA1 3UKTA 2YC2A 4I2OA 2JDMA 3I2DA 4LMFA 4IE7A 5SV8A 4DY3A 4Q26A 4WM7C 3PVEA 2F6BA 2VQUA 2CHHA 1IS3A 1EPWA 2NYYA 4UF0B 4XAAA 1FT9A 3D0SA 2WSUA 2CU5A 3BPZA 2XONA 3VUOA 1MVEA 3MO4A 2WINB 5CZKA 1BLZA 1VBE1 2CGNA 1JMUB 4A44A 2E63A 2PHTA 4Q4Y3 1AYN1 4Q0VA 2A6WA 2DCZA 4RD7A 3U37A 1H2MA 1RUI3 1YFYA 2ILMA 2Y33A 1UMHA 2WT0A 2WN3A 4RYDA 4XF9A 5A80A 4QQLA 3TEYA 3L2YA 4XXPA 1RUE3 4PBPA 1QXJA 5J48A 4CDWC 1KS4A 2QQPA 1OQEA 2VMHA 4GULA 4CCCA 2AGSA 4QMAA 4OHXA 5IUQA 5FOJB 2JG9B 3NNGA 2EAAA 2ORZA 1O3QA 5JCTA 4KWUA 2C24A 4FPEA 4W6WA 4Y33A 1D0GA 1UYXA 2BFUS 2RV9A 2QUOA 5CAZA 4D6QA 4QB2A 3BTAA 3ZFEC 1MZ5A 4YNIA 5A1AA 3I2OA 1PK6C 4NIIA 2D44A 5BNNA 2E9QA 2DVFA 2WIIB 4UT5A 1YI7A 2CDPA 2ZEYA 3UJQA 1DGRN 2A3WA 4S2DA 3MGUA 1I9RA 1VAVA 3V56A 2MPFA 3LZZA 4JVAA 1XNAA 2WKKA 1OBNA 3VHOA 5I8TA 1EV13 4LBQB 3VHNA 4CEWC 1UX6A 1ZM1A 2D97A 1PO21 2Y38A 1BEV3 4IDZA 5IYYA 4BMBA 5HV4A 2OT7A 3MIBA 2XXZA 2GMEA 1NLRA 4MGQA 2RJKA 4A42A 4A41A 2NP0A 1ZRFA 1UZ0A 5J36A 2FDFA 1OUXA 5LA9A 5C4WC 1JYXA 2IXLA 3AZXA 2LTNA 4HXCA 2RJ2A 4CDQA 1NYWA 4JKLA 3VBFC 5HBAA 3ZFEB 3BI3A 3AXEA 1AX1A 1NLQA 4JHZA 5J7MA 4DS0A 1H8TC 3FLPA 3ZYGA 2WYFA 3VDBA 4GWIA 1WBFA 3AYDA 2WWUA 2XJVA 3ATGA 3M7AA 4LO4B 4W65A 1VMFA 4AEJA 4HT1T 1C1LA 1SBEA 2D43A 5F5QA 3ROUA 5F3GA 1MS9A 2Q0AA 3JZVA 3OGRA 4FPLA 4NE9A 5FY9A 1BK0A 2D6PA 2Z4FA 4OULA 1TZOA 5FMCA 5J37A 1O5UA 4P5HA 2IUWA 5FKBA 4HL0A 2W0XA 1YXWA 4AG4A 5D8AC 3O1SA 3M3QA 1UO9A 4X6QB 4XETA 1PIV2 3ZMNA 2Y6HA 4COWA 5C4WB 3O0WA 3KD4A 1C8NA 2YROA 4XVHA 5IVFA 3VZJA 3OCPA 5BNPC 3NNJA 3PU3A 1R082 1W6OA 4JGYC 3LAGA 5DPNA 1ULFA 1H8TB 4P00B 2B39A 1TME1 4LBQD 5FZ8A 3ON7A 3SHRA 5FR3A 2ZABA 3LEMA 5A7OA 1VBD2 1QNYA 3OY8A 1W6MA 4NIGA 2OPWA 1W9FA 1OD5A 1R092 1VE0A 4TWTA 2W92A 4XFBA 2JE9A 4ZXKA 4AL9A 2O8OA 3PVOA 3AZYA 3EJKA 2MEV3 1JYCA 5JWPA 4A2UA 4HPKB 4CXWA 3QD6A 4K21A 4LUMA 1PMIA 3A22A 4Q1RA 2R0FA 5T5LA 1ODMA 3M1HA 1QY4A 3UGFA 1YO8A 2XDVA 3FC0A 4K6BA 1FOD3 2HWF3 5JVVA 2F4PA 2ZX0A 2A6ZA 2ZOEB 4J1XA 4BLJA 4XEZA 4E4HA 3PVBB 4GB32 2NZ9A 3TRSB 4DPNA 1EP0A 5JXGA 5SV5A 5GLTA 2OS2A 4Y22A 5BNPB 2RMU3 5K7PA 1NCRA 3IMMA 1PZ7A 4D7YA 3WT3A 5C71A 3FWEA 3QLQA 1OH4A 1VPHA 3VD5A 3ZKUA 1HB1A 3MFAA 2V73A 1ASJ1 3THPA 4WV8A 1ZBE2 1VIWB 4HMZA 4S2GA 4AHZA 2JB4A 3OBAA 4DXZA 4MADA 1SLLA 4QPGB 3C7FA 2VMEA 4GIQA 4UI9L 3RZZA 1ULOA 3PLQA 5DN2A 4BLIA 5FZMA 1W8OA 1MVQA 4O9GA 3AZZA 4Q4V1 1D4M3 5GKAC 2XBO1 2D6OX 2ZGNA 1LOEA 3GCXA 3ME2A 5CBLA 1JZ4A 1ZYBA 1K42A 1PNGA 5T52A 4P14A 4LR4A 1MS3A 4YZ5A 3W21A 5KXDA 3OGSA 3WHUA 4EN8B 2WYSA 3HEIA 1LRHA 1UOFA 2RS52 3POSA 3NAPB 1GKBA 5T50A 2JIGA 1WMEA 3AKRA 3PTRB 5J96B 3O1UA 3T2OA 1W6QA 1PVC1 3H1WA 2JX9A 5EPAA 2X5IA 1CAUA 4OQ8A 4YGBA 1OQDA 1NOVA 5GALA 3DV8A 3OOXA 3VGIA 3G7DA 1LESA 3H7JA 3O1TA 3EQEA 1HN0A 4ATEA 2JWPA 2BFUL 2YBPA 4UFIA 5DQ0A 3CEWA 2WLQA 4Q1PA 3GYDA 1DLCA 3H50A 3KGLA 3AK0A 3T2PA 3KT7A 5FZOB 3V0AA 2YYOA 2MNGA 3PUQA 4UW5A 5A6YA 3AYCA 1OVSA 3OBTA 2Y6GA 3VBOA 4LNVA 5LA1A 1V00A 1GOGA 2R043 3MBWA 2QQNA 4QX1A 4ES8A 1JOPA 4QQPA 4YVSC 4CUCA 4DOUA 2ZKNA 2EICA 3BVCA 3ZPYA 5JXIA 1UOJA 2WO1A 4KWLA 4NMIA 1JYIA 2ZGQA 2VNRA 1ZZ6A 3GF6A 1ULEA 1RUD1 2ZBJA 2WS93 5FMDA 1X36A 1PGSA 3NJYA 2WAAA 3JD71 1C28A 1LENA 4PT6A 2P17A 2TNFA 3ZXFA 3IM0A 2VW0A 4QB1A 4FOQA 5EP9A 4YARA 2GN3A 2PMWB 3TYJA 1HRI2 1Y9QA 1XYPA 4JC1A 1VBA1 2AZ5A 1N3QA 5LZ6A 1QJU2 4E8DA 2QQIA 1ALYA 2RE9A 3NJXA 4RR3C 4XFCA 4JAAA 3NV2A 5ABJC 2ZMLA 4PJYA 2R071 5LB6A 3RSJA 1Q8VA 2GP5A 1UMZA 4AAPA 2QQWA 2HEVF 4ZONA 3U10A 1OH3A 1UPSA 2VH9A 4YVSB 5LEKA 4LORA 1EUTA 3MF9A 3SXWA 1BMV2 1DCSA 5DAXA 3SEPA 1GP6A 4LE3A 5IWFA 3VDCA 1QJY1 2YFUA 1WUVA 4XE9A 2WR9A 3ZN6B 5IVVA 4GZ9A 4TTGA 5IVBA 4HLTA 1OI6A 5DZFA 2DCJA 2VC9A 2FZ1A 4EWEA 2QFEA 4AHXA 5JZGA 1WLWA 1R1A1 3IDEA 4OQ9A 3AYEA 4AQ6A 4Y5TA 5FP8A 3ASIA 1OF4A 1UU6A 3RMXA 2D3PA 3O1OA 3SH4A 2BWCA 2W2IA 2VVEA 1WMDA 1LB2A 3GZUC 4QPIC 2XH6A 1S0FA 4OCTA 4DMIA 1NAEA 2VZRA 1UYZA 5JOWA 5A7WB 4G3YC 1HRV2 1S4CA 4AVSA 1G9FA 3A0NA 1K45A 1WA6X 5JIAA 3ZSEA 1UU5A 3J8F2 2WN2A 1U5IA 4AK3A 1KJRA 1XNKA 4OI0A 2PHWA 5A3PA 1OUSA 4IEUA 5B4NA 2D5FA 4N9HA 3X29B 2A70A 3WF4A 2VVDA 3M3IA 4ZU5A 4N53C 5FMBA 5BUVA 4HVQA 1PIV3 3ILNA 3TN92 4ZKTB 1BHGA 1ULCA 5FPAA 5LCWL 1N1YA 4Z82A 1FPN3 1XJAA 3Q8EA 5DXDA 2OZ6A 2EIEA 5DMYA 3SCGA 3WXPA 3OGJA 2JG8C 4BU2A 1F5FA 3CIHA 4HN0A 4LBJA 5L9RA 1VBD3 3U14A 1DBNA 1PO13 2Q1ZB 3NV4A 3B00A 4TN7A 3T1LA 5FK8A 4M3CE 1BJQA 3ZFFA 4CPBA 4H2AA 4JTNA 4K7JA 1NY71 4QHOA 4FAGA 3LB9A 4OHWA 1NA1A 1D4VB 4S2HA 3RI9A 3ZX7A 1DU3D 3MW4A 2E31A 2QE3A 5E8AA 4YVWA 4DUXA 1AZDA 3AMHA 3TWIA 4NHYA 2P3IA 2WA3A 2FD8A 2IC1A 1X8EA 1K5MC 4IE0A 2ZGLA 1T2XA 3DECA 4HK8A 4N53B 4BQ1A 3CKHA 2VXRA 1WBLA 2A1XA 2R061 2VE1A 2VZSA 2HYKA 3HNYM 3VBSB 5FYTA 1JZ7A 2JG8B 1O7FA 2PLV1 1FXZA 4LULA 1WLCA 4Y1VA 3I2GA 3P6BA 2I74A 4YFWA 3ZKYA 5FCCA 3ZPOA 1C1FA 1CIWA 1TQ5A 1NG0A 1IQDC 1XU1A 3ZFFB 3I2KA 2IVJA 1UY2A 4I02A 5KC6A 1NKGA 1JZ6A 4BPZA 1GICA 1Z7S3 1DG6A 2ZX3A 4XTPA 3H3ZA 5DZEA 4QU2A 1H4HA 1KFUL 3WG1A 1CWPA 2HWB1 5JOXA 5JSOA 3ZYFA 1AHSA 1QJX2 1SQ4A 2VQTA 3L2HA 1ENSA 1SCRA 5IW0A 1RUC1 1YJLA 4M3CA 4PQQA 4QD2A 3MV01 4C91A 1H1AA 1PM7A 2BTVC 2WFF2 3ALQA 4CXXA 4OZXA 3VD4A 2WNVC 1KDMA 3IT8A 3MHZA 5EHDA 1F4HA 1RVF3 2ADDA 1KQRA 4KI5M 3H1MA 2RS53 1SZBA 3BCWA 3KV4A 5LATA 3FUOA 2J1VA 1HQNA 5IJRA 5JUVA 2VZOA 2VMIA 1UW8A 3BTZA 4HVRA 4HKWA 4S2FA 1AYM1 1HXS2 3NJVA 4D94A 2EIDA 2BP6A 2VZ1A 4R4ZA 1KRIA 1REEA 3E5UA 4ZXEA 3USSA 4HZFA 1OC1A 2ZA9A 1DLLA 5FLHA 5F9TA 1VMJA 1VRH2 1W8TA 1CGPA 3BIWE 1IHMA 2W5FA 3NJZA 5G05L 4BQ4A 3ZXKA 4HN1A 2HWC2 1SACA 3POEA 1SFYA 2A71A 4KWJA 4XHBA 1YEWA 2W94A 3FHAA 4KMQA 4BMEA 1COV1 1SCSA 4GMP1 4SBVA 2OXBA 4MXVA 4B1MA 1G9BA 4L92A 4MO3M 5AVPA 5FXZA 2YBSA 3SISA 2XVKA 4QHZA 1WW5A 2DCTA 5IAXA 3C7HA 1SLTA 1RUF1 1U0AA 2ARAA 2RS13 3OF1A 5CIRA 2LROA 3WNMA 1W05A 4CU9A 1Y4WA 4NWVA 4OI4A 4XABA 2UURA 4CU8A 2Q8DA 1FMD1 4GA9A 5E6HA 3UKVA 1PGW2 2QJVA 4UXAA 3MF6A 1LODA 2B9VA 1HRI3 2CSGA 5JSRA 3VB9A 3W9AA 4RQPC 1SFPA 1RHI2 4IEWA 1CPMA 2JE7A 3W58A 3WD5A 2J1AA 1ND2A 4UW3A 2BNMA 4XIOA 3ZOIA 4LHSA 4E2SA 4JCKA 1QDCA 3WQ1A 5FUPA 2V09A 3BIEA 3T1MA 4URAA 2WSVA 2BZDA 1HIXA 3AFGA 3KCYA 1DGLA 3P3PA 2ZEWA 4IE5A 4Q4Y2 3WP5A 1GNYA 1O4ZA 1ENRA 4I3GA 5FKCA 3MLLA 1RUI2 2DVDA 3CO2A 5FYYA 3HIFA 5T5PA 3TAYA 4XJAA 5L9BA 1H4GA 1RUE2 1T6BX 5FZ0A 2J1EA 1GZWA 1MEC1 4YPJA 2YC0A 4GWNA 2AUYA 4LKDA 1JN2P 1ZBA2 4AFAA 3WVJA 2X29A 2VCBA 2PHLA 2JDZA 4WVZA 5GM0A 2XJPA 5FO8B 1UYYA 2WNUC 3DCQA 4IV1A 2EIBA 4PHZA 2X10A 5DUXA 4ZPIA 3UYJA 3UNPA 1Q5OA 3C7OA 2R7EB 4IUGA 5TSWA 3PURA 5K9YA 4IEOA 4V2WA 2BERA 2YPDA 1M4WA 4FAHA 4YZ2A 3D8CA 3OBZA 1LTEA 3KLSA 2H6BA 4CDUA 5IVEA 4RHV3 4CU7A 3WY6A 1HRV3 1AR63 1ULPA 5LRRA 3U11A 4W6YA 5C8WA 3WQ7A 2Q5TA 5HV0A 1EV12 1GP5A 2JKBA 4AFBA 4AGGA 5B2GB 1BEV2 4BQWA 3E6CC 4CE8A 3WSOA 5CFDC 2R1DA 1ZRDA 2LRPA 4OVEA 2VNOA 4E2GA 1QJEA 2J1SA 2W1SA 2QQUA 3JBG1 3LQCA 5HXVA 3VBUC 1JS9A 1XC6A 2W1UA 3B69A 4IV1B 4RS5A 4BB3A 1UCXA 3TN93 4BDVB 2RM21 4ZS3A 1H2KA 2W46A 2GH8A 1UD1A 1LOBA 2CYFA 4XFGA 1R64A 1A8DA 1IS4A 1UXXX 1A8MA 4CDUB 2WT2A 1LGCA 1WKYA 3FZ3A 1UY3A 3VD7A 5LW9A 4X6RB 4NPLA 5FYMA 4RGKA 3IIAA 2DVAA 5IVJA 3PJQA 3ZIXA 2PA7A 2PHUA 1CZSA 3OG2A 1AR91 4QDSA 1EY2A 1YC61 3U07A 1JBCA 3AX4A 4OYUA 5CFDB 2XWJB 2EA7A 4P9GA 4M00A 1SDDB 1FI2A 1QOSA 1SHWB 3VBHA 3VKLA 4A6SA 5F1RA 2VUJA 2OUJA 1W6PB 3ZR6A 1OOPB 5JXHA 1VBC2 1WD3A 3S5QA 4C0BA 2VOTA 4UYBA 3NNFA 2WLPA 1RMU1 2TBVA 1W2UA 2AR6A 3U4SA 4P9LA 5KHGA 4PLNA 4BQYA 1LOFA 1QH7A 4Y5SA 5AFBA 5HCHA 1WCKA 1GNZA 4DRRA 3CJIC 4IERA 5GZDA 1I5ZA 4OHYA 1TE1B 2HEWF 2Q8CA 3LPFA 1YIFA 2DWRA 1HV1A 1IG3A 2CAVA 2DTWA 4CP2A 1DQ2A 2MEV2 3CU7A 2JKXA 2JDHA 3WX5A 1PGL1 4P9XA 4LBLA 2FDIA 2WC2A 2JENA 4Q0QA 4LLOA 2DCKA 2P2KA 1FOD2 2HWF2 4Y20B 1VMHA 2P4EA 4PF1A 4WM8A 5FYIA 5AC93 4Z2AA 3IZOA 4OMDA 1OHFA 2JDAA 2ZXQA 5JPNB 2P3JA 3CDZB 5FK7A 1C3HA 2WUHA 1QIQA 3B02A 3O5SA 4TXWA 5FRAA 2F4LA 3S7IA 4UFJA 1BCXA 3WNXA 4UFLA 2Y6LA 4Q4W3 4C8DA 3CF6E 2D98A 2A3XA 5JIUA 3L9JT 2FMDA 2WZEA 4FT8A 5EZWA 1CD3G 3GM8A 4ISQA 2TEPA 5L7OB 4J1WA 3EHKA 1KXGA 3IB3A 3U75A 3FE5A 3WDTA 3U78A 1BBT1 4UAPA 2CWSA 4G9SB 1W2TA 1AL0G 2BNOA 4FFGA 4RFRB 3ZMOA 1CESA 4UF0A 2QQLA 4WM8B 5A1LA 4D8MA 2VOXA 4GH4A 1C8M1 3EMRA 4NHLA 3SEEA 4NRMA 1GSLA 3RYKA 3U1XA 4N43C 3UGGA 1JHJA 4XILA 3ZYPA 5I0RA 5LWBA 2R1BA 1HW5A 4RGAA 5B4XA 2KA3A 2IXIA 5H9RA 4F8AA 1CPNA 3LWCA 1UYPA 2IXKA 3KV9A 2QQJA 4FSJA 1QQP1 2ENRA 3JUUA 5FY1A 2E53A 4DXSA 2VM9A 2W68A 2E7QA 2HWE3 1UL9A 4R4XA 3VZMA 3WNLA 5FP4A 4AR2A 3QH6A 2A6XA 2JDYA 2D3RA 3RMYA 5C8CA 1DF0A 1V6LA 2JG9A 5FUNA 2Q1MA 4XDPA 1ZZCA 4XMAA 3SMHA 2G9FA 4Q4X1 4OI1A 3I2IA 3T4HB 4MYEA 4DZGA 3GBWA 3OYWB 1X7NA 4COVA 2RR11 4WM7A 3WNKA 1UMIA 1ENQA 1ZRIA 3MEPA 2JJ6A 2XVGA 1PO22 3USUB 1RHI3 5CFCB 3U4XA 2VCAA 4YM2A 4XHXA 4HONA 3LE0A 3AMNA 4GALA 2WZR3 2VZVA 1APNA 2NMOA 4GH4B 4KGQA 3TEZA 1XE7A 3WDUA 1GWMA 4X8PA 3I3DA 2R042 3AXDA 3N3HA 2RS33 1MS1A 1H9WA 1GANA 3FLRA 5C3PA 1ZZ8A 2I2SA 3VDDC 1OVPA 2NMNA 1J1TA 1DQ4A 1MZEA 1Y43B 2QTWB 1FV2A 2Z69A 5KHJA 5A7PA 4LBQA 1NE6A 5CG8A 1IPJA 2W3JA 4AEDC 4O65A 1ZBA3 5FZ4A 3RJ2X 2WS92 5C8CB 1POV1 3WEZA 4YM0A 1GQGA 2OZJA 1XYNA 2IXCA 3K4ZA 3SCFA 4WM7B 2N7GA 4ISRA 4XCAA 4YG3A 2G9ZA 4Q2FA 5I8YA 1OSGA 1GWLA 2PN5A 3ZFEA 3P5BA 4LEJA 2KM2A 1OT5A 1CAXB 3WINE 4W8JA 4FFHA 5GLZA 2ERFA 1AR81 4IEPA 2ZGSA 4FP2A 2J1TA 2YHJA 4NIHA 1YHFA 1RUG3 3KGZA 3NNMA 4IV3C 3LEGA 4YWAA 2HWD1 1S0GA 3V64A 4CEWA 3WP4A 1TME2 2VMFA 4AEDB 4CDWB 4PDWC 2D5HA 5FZ9A 2O0OA 1AXYA 1GOFA 5JOYA 2DU0A 3ILFA 3FX3A 4M01A 5APAA 2VL4A 2GC0A 1A34A 2FCVA 2XL7A 4YZ3A 3VZKA 1YCIA 5I91A 4Y5Z0 5C4WA 2XLAA 1EAH1 4H55A 4DIQA 4NWWA 4EJRA 5A3OA 2XMLA 3A0KA 3VKMA 2XOMA 1PK6B 2OW4A 2O1QA 2ZHLA 4BHPA 1H8TA 4MZUA 4FOWA 4AFDA 4QKFA 5D2AA 2AEYA 1RGSA 3Q8AA 3K51A 5C70A 3MFCA 5LK5A 2B46X 1MACA 5F5CA 4LBMA 4FPHA 5A7SA 4LO8A 3W20A 4INDA 3DN7A 2Y64A 3OTFA 3FMGA 1VJ2A 3WF0A 4HPKA 4CEWB 1X82A 2JDPA 3DPRC 3CZJA 2GMPA 4PDWB 1ASJ2 3VLBB 1GYKA 4QPYA 3MIEA 2WDBA 3R0RA 2GAUA 1XSRA 2TUNA 2Y8KA 3AKPA 5D1IA 4CDQC 5JPMB 2W39A 3KF3A 3K4AA 3HWJA 5M0TA 1VBC3 5FY4A 5BNQA 1W06A 1FPN2 5F6KA 3BOWA 3VBFB 5BNPA 5KR7A 1O5LA 4KGGA 1E57A 1L7RA 5L19A 1O6UA 4Q4V2 4NROA 5A32A 2J1RA 3WP3A 4IEXA 4DXTA 3MW2A 5FWJA 2RVAA 1Q8QA 3O0VA 3ZO0B 1AR73 2DF7A 2VAUA 1J3PA 2VTXJ 1PO12 2BBAA 2BGPA 4AFMA 2K2SA 2EF6A 2VVFA 3HOBA 4FOYA 5CEHA 1AUYA 1VAKA 1CJDA 1OFSA 5I0UA 2OA2A 2V72A 4YM3A 4R9BA 4KBBA 3PUAA 4Q0PA 4QPGA 5A3LA 2VY0A 1LU2A 5FYCA 5J09A 2ZPXA 3I2JA 2W08A 3T0BA 5LA2A 2NN8A 1PVC2 1YLLA 2BYVE 1F9KA 1ZNPA 3E6BA 3IDCB 2BV4A 3KV5A 1RUH1 2WNEA 5D8AB 4CU6A 3OPTA 5DAPA 2D6LX 5ACA3 1H8VA 4CCNA 1OLME 3RNSA 1L7LA 2RDQA 2V5YA 2WWJA 4BWOA 2WNOA 1J3QA 1U5YA 2PHFA 4CCLA 4JGYB 5A32B 3AVRA 3NAPA 1STMA 1HQLA 3NMBA 3RFRA 3Q8BA 4LITA 3H8OA 4K8RB 1BZWA 2VZUA 2AH2A 2HKXA 5ISLA 1GR3A 1DGWX 1MZ6A 2SBAA 1VBE3 4QXBA 5AFEA 3V0BA 3F2ZA 4AQSA 1AYN3 2ZGKA 3VBRC 3N36A 1QWRA 1Z7S2 2FZ2A 2D93A 3OB8A 4HANA 5A3MA 4V2VA 2FDGA 5CISA 4C1WA 5BNOC 1WW4A 4C1XA 1H6YA 3ZXAC 1W03A 1S0EA 2ZX2A 4LKEA 3MICA 1NCRC 3C2UA 1KD7A 4XAEA 5DUWA 2BNNA 5CKQA 2NM1A 2JB8A 5FZOA 1DQ5A 1GU3A 2ZMKA 3JD72 2XLGA 2W47A 3PDQA 1Q8OA 1ENXA 4JRAA 2OKXA 4K3UA 1VAMA 3DKQA 4BOWA 1RVF2 1PHMA 5FZDA 4ZZ5A 3WDVA 1AJKA 4M0HA 2UYBA 1G9CA 1VBA2 2ZGRA 1UY1A 4OI2A 3OPWA 1XYOA 2ZGTA 3UKNA 1OLMA 3OGGA 3NWKA 4DNYA 3BB6A 2ID4A 5JR2A 4BIOA 5C5UA 1W8UA 1LGBA 1R081 5GZEA 3J4UH 3V0BB 4M0NA 1N1TA 2HYXA 1WZXA 3WW3A 2CAUA 2VZTA 5T5OA 2ZS6B 1LAJA 4X8NA 5FPBA 3BTXA 3RZKA 2PAMA 1QOTA 1R091 2VZQA 1PO23 2DDUA 1QJZA 2R0HA 3N7KA 5FZ7A 2A7AA 4Z8BA 3GALA 4Y1XA 2UY8A 3WCRA 3U0ZA 3HN1A 1W9TA 3IAQA 1GUIA 5EQUA 4XF1A 3B94A 5A70A 1WCSA 3KCCA 4OMCA 4L0PA 2FCTA 4SLIA 2IVIB 2X5IC 4YVSA 3C8XA 1W04A 4GB31 1WWYA 1ZX5A 3KSCA 3OBRA 3AP7A 4YW4A 4ZU4A 4NO4A 2RS12 1HN1A 3ZN6A 2XVLA 4AZZA 2XR4A 1YNAA 3CNAA 4XC9A 1D2SA 3HT1A 1QH6A 2VR4A 3AJZA 4N9IA 5FQ0B 4JGZC 3FL7A 5FPXA 1ZBE1 2WAOA 3IAPA 3VBOC 3AL6A 2XJRA 5GLUA 1V9U1 4RR3A 2EAKA 3AZWA 1XSQA 4FO9A 1PZ8A 1HX6A 3D6EA 2Y6FA 2UWCA 4LQRA 1LULA 3UGHA 5A7WA 2W9XA 5FXWA 1GFF2 4FPCA 5FIXA 1Q56A 3DYPA 3SKJE 2R32A 3NO8A 4Y3OA 1C5HA 3BGAA 2X09A 1NCQC 4XFAA 2GSYA 1TME3 5EYXA 2A6VA 3A21A 1LHWA 3WW2A 4JRLA 2P6CA 5LBEA 3NW4A 4QT6A 1XBFA 5KHHA 3AL5A 4JGZB 1KJLA 3GBFA 2EXIA 2GALA 3S7EA 4H14A 4M4PA 3O0XA 2WJSA 1X50A 4YW1A 4RR3B 4NRPA 3SLIA 3I49A 5ABJB 2LW8A 3B5LB 1WA4A 1GQHA 4HBNA 4QPIA 2YMZA 1XRUA 1IS5A 5FUIA 1G9DA 1CX4A 2B5HA 4OUSA 4RHV2 5CYYA 3VKFC 4LHKA 4EZ4A 1AR62 4GJZA 3FBYA 2VUDA 2XQXA 2VD7A 3KM5A 3RQ0A 1E5SA 1QGLA 3OEBA 1AL21 2PLV2 3ZVXA 4EROA 3LA7A 4EV0A 5JZGC 3R4SA 1BYHA 1ASJ3 4L99A 2LM3A 1MR5A 5A3UA 4JDNA 4AI3A 2ZHMA 2VZPA 2W1QA 3D3AA 3ZFGC 3S57A 2P3KA 4QM8A 5FZEA 1KITA 2DFCA 4TZDA 4N53A 1ND3C 3GZTB 2ZX1A 3TEXA 5A3NA 1RINA 3I59B 4N7IA 3I4IA 2VJXA 2WA4A 3K77A 4W4ZA 3VKOA 4E4SA 1AX0A 2V5DA 3ST7A 2ZZQA 5CADA 2HWB2 1S0IA 4FFFA 1GZ9A 1WD4A 3VBSA 5KHKA 3OEAA 4Q4V3 2JG8A 2XBO3 2JICA 3WNPA 4E4DX 5A7QA 4QPIB 4L11A 3AKTA 2FMYA 4R9DA 2OX0A 2P5BA 3ABZA 1QJU1 4EQVA 1OKOA 3LIGA 5FZIA 1WW6A 1VRBA 3TBDA 1W28A 3ZDSA 4L2NA 3HAGA 1LKNA 2YG0A 5DAVA 1UAIA 4Z2WA 3ZFGB 3WHTA 1DGWA 1PVC3 5IAVA 2BGOA 1TMF1 4QM9A 3S0MA 1AYM2 1NZCA 2J1UA 1K5MA 1ND3B 2B4KA 4Z07A 1BMV1 3LCPA 5I0SA 1FV3A 2VUCA 4RN5A 2DU1A 1NZIA 1AVBA 4HKLA 2JDUA 1CAWA 4J6GA 4I09A 3IDBB 4NAMA 5C9AC 2PAEA 3LIHA 2YGLA 1QMJA 2B8MA 4NPMA 4COUA 4UOJA 5IT6A 5C7GA 2DFBA 4ASLA 4QQHA 3EXUA 1LOGA 3NKTA 1NA1C 1US3A 1SFNA 4YVWC 1JHNA 3H3UA 1SMVA 4LE4A 3PIJA 4LIUA 3ZSKA 4AEMA 2PQSA 3ZYJB 4FTEA 1COV2 1DYOA 4P9IA 1QXPA 4UBHA 4XURA 1JUIA 1O59A 4CCDA 4AYUA 3KWVA 3KQ4B 4YW5A 3KHBA 3FHQA 4OFGA 4MV2A 4R9CA 4XQ4A 1RUD3 3VZOA 3HQRA 1K5MB 1XOYA 3J8F1 4BQXA 2K9ZA 2PHDA 4NVPA 3ZN4A 4YSFA 2C1FA 2VG9A 4ZU7A 3JD73 4DFSA 3WF1A 2WT1A 4GKXA 3H8UA 3GZAA 1CAWB 3KT4A 4D7SA 4QGNA 5C9AB 4B4RA 3VDAA 2WFPA 4CEYC 5JLVA 1VBA3 3GBGA 4D69A 5IFPA 5FZAA 1RXFA 2DUOA 3C7GA 2R073 4Q4W2 4F7ZA 3LSDA 1U12A 2RDRA 3VHPA 3IBMA 3NQHA 4LBNA 3WLUA 3BALA 4NAOA 4I01A 1G7YA 4IGPA 1JYNA 3RZGA 4CCKA 1Y7BA 3W59A 4Q8KA 1WCQA 1JW6A 1MEC2 2NPIA 5FZCA 5A1FA 1UIKA 1QJY3 2GU9A 4BCUA 1NT0A 5FY8A 1J83A 4BM8A 1OPOA 1QF3A 1S0DA 3N9PA 4UW6A 4B7KA 1CVNA 2RG4A 2YGMA 2YXSA 4GQ7A 1JZ5A 3RZJA 5CVRA 2WNVB 4WVWA 4XFHA 5KXEA 1R1A3 1E5HA 1GZCA 4CEYB 3RZLA 4QPWA 1OD3A 3I97A 2JEMA 5BV6A 1UZYA 1YQ8A 3VZLA 2VXJA 1V6KA 3O1VA 2HWE2 4META 4ZY9A 2LALA 1LEMA 4CDXC 4OLLA 3LEKA 4XQWA 1VBB1 3QBQA 1DFQA 2A3YA 3EBRA 3EB7A 1W90A 4W6XA 4XOGA 1ZZ9A 1BVP1 1JOBA 5E89A 1NQDA 2QZ2A 2UWBA 1N47A 3GCWA 2B9UA 2HBTA 4ZZ8A 2WZPP 2A73B 2BVVA 1LGNA 4IW3A 3B9CA 2R30A 1IGOA 4O61A 3WUDA 2VO5A 3O1PA 2WZR2 4JX0A 4UFKA 4LLFA 1UF2C 2UWAA 4XPVA 5LY1A 3LA2A 2BDRA 5LEJA 1QJX1 2RS32 5FYVA 3OUJA 4R8HA 2B42B 3MIGA 3M8LA 1IOAA 1LNSA 4IESA 2WFF1 1WLDA 3HQXA 5HI0A 4MGYE 1WMXA 4AEKA 5LRSA 1RB8G 4RSUA 1NUKA 2WO7A 3N9MA 2BJSA 1H1MA 4AVVA 5F37A 5HCAA 2CNAA 3W5MA 2VW2A 4XF4A 3JXSA 1HB4A 1K5JA 1L3JA 1ND2C 2OUHA 3PUHA 1ZA7A 4LK6A 1S0BA 1W3VA 1QDOA 1LOCA 4ITCA 4RQPB 1HXS1 1JU3A 4KU7A 5BY5A 1D7PM 4XTMA 1CR7A 1VLNA 4CP9B 5FPZA 5FY0A 1LOAA 5F6LB 5FYHA 1V6MA 2IWGB 3AB0A 3BU7A 3S30A 5A33B 2YU1A 2XGXA 1HB3A 3TEWA 4JZRA 2GC1A 3IIIA 1C5IA 5CA6A 1OFNA 1CZTA 1VRH1 1RUJ1 2R063 4PF5A 3ACGA 3VKNA 1UY0A 4JKMA 1G86A 2VCMA 3OD0A 3GJBA 1OA3A 4AW7A 3PMSA 1RMU2 4IQPA 1RUG2 5DDJ1 2HWC1 4QB6A 4Y24A 2PLV3 1GP4A 5KXBA 2EXJA 4QDQA 3MUY1 4CP1A 3H42B 4MOAA 5CFDA 2VOKA 4TYSA 4XJZA 4NUBA 1O91A 3VBUA 1DQ0A 2WNUB 3PU8A 4XYXA 3RYRA 5EYYA 1VB2A 3B3QE 5CG9A 1SBFA 1J3RA 1W6PA 5IK7A 1F4AA 1OOPA 4XJUA 1UZWA 1PNFA 2WQ8A 2HWB3 3ZXLA 1PX4A 4BJ0A 1ACCA 3LEIA 3ZDVA 2XJUA 4AI9A 1J84A 1RUC3 2C9AA 3D4KA 5E1RA 3RZMA 1PGW1 1S2BA 2O14A 1Y3TA 4N8MA 4WZFA 4LIVA 4XMIA 1HDKA 4AGRA 3FJSA 5FMOS 1S2KA 1PZ9A 2BRTA 4GJYA 1W0NA 2VPVA 2YZ4A 5F2SA 1A3KA 2BPA2 2CTVA 1S0JA 5FPLA 3T09A 1D0HA 3OUHA 4KBZA 4BE3A 1S0CA 4FP3A 1OLRA 1LR5A 4OUEA 4Q4Y1 3NL1A 5L73A 4AHYA 2P1BA 1RUI1 3I3QA 3VBUB 4Y20A 1AYM3 3ZXEA 1DDLA 4Q5OA 2GNMA 2F17A 3IN9A 1RUE1 1W99A 3HT2A 4YYOA 1F31A 3POIA 1KDKA 4A7ZA 3RWNA 5A6QA 4KG0A 1TNRA 5FOBB 2XHKA 5EJ1B 1W8FA 4ONUA 1U5ZA 3PIGA 4AGVA 1BK1A 3THTA 2ET1A 3K4DA 1AR72 2XUMA 2ZACA 4PIXA 1C8M2 4AQ2A 1MS5A 4IE4A 3OPZA 1ZZ7A 3E97A 3BYWA 3DXUA 1COV3 1F5JA 4GMP3 4A4AA 5L7OA 3AJYA 1MQTC 3KV6A 4YRDA 3N35A 5KXCA 4MH0E 3AMQA 1EUUA 4HVOA 2W87A 4AVBA 4H7MA 1RUF3 1VALA 5DG2A 2OVUA 3WCSA 1SDWA 4NR1A 4JHTA 1EV11 4J25A 3F95A 2YBKA 4OHZA 1X8MA 4AXOA 2ETEA 4DINB 5ACA2 4Q4X2 1BEV1 1FMD3 2X05A 3K3NA 3M3EA 4U36A 2VU9A 2VTXA 1BXHA 3POYA 5JMCA 1LJ7A 1UWWA 2J42A 3MV11 4BYYA 4FTSA 1DYPA 1TG7A 2G19A 3FLTA 3CJIB 4LA3A 3ACHA 1HV0A 3DXTA 2H0VA 3B7MA 4MXWB 4Y26A 3ZSMA 3KMHA 5L9VA 1VBE2 3ZIWA 1PM4A 4RA0A 1HB2A 2YB7A 1AYN2 1US2A 3T2QA 1MQTB 1B35C 2ZAAA 1PX3A 3KQRA 4E27A 3P1IA 5K8SA 5LASA 1R1ZA 3OYWA 2WBKA 3WDWA 1MEC3 3PJYA 4Q27A 1OKQA 2P3YA 4PQ9A 3USUA 5CFCA 3MDPA 2GNTA 5FO9B 4HOOA 4YLZA 4QWNA 2FHRA 3HBZA 4FQ4A 4CCMA 4NHKA 3E5QA 2GMMA 1F15A 2X53S 4K9SA 3IMNA 4D6RA 3CQOA 4IEVA 2VBDA 4N43A 2VMCA 1RJ8A 2P37A 5FZ6A 2VW1A 3WNNA 5H9PA 4DXRA 1I6XA 4COZA 1G8WA 4Y4RA 2PAKA 5IFTA 4A7YA 4YZ4A 1W0PA 1LEDA 1REFA 2EXHA 4XBNA 1CQ9A 5EIYB 2CWMA 5FP7A 5K0UC 5F5IA 4FFIA 4UWDA 1IKQA 1CAVA 1FX5A 3J7NA 1OLQA 3K48A 4MX3A 3M3CA 4IGOA 1GZTA 4QXCA 1FAYA 3HVDA 4CVUA 3CLPA 4GD4A 1DYKA 1SEFA 3I8TA 2WL1A 4F83A 3Q8FA 3B01A 3HNMA 3PVNA 2ZGOA 4ORFA 4CA9A 1XNDA 1H30A 3DYMA 2ZGMA 3I3EA 3K75B 4D6SA 3RZHA 3INAA 5FV3A 2K0GA 5LA0A 1UXZA 3H8RA 2BVBA 4RL7A 2MEV1 1CAXA 2ZX4A 3JBG3 4LKSA 5IVCA 4N43B 3ZR5A 3JB8A 5JAXA 3H8XA 1RJ7A 1V0AA 2BQPA 2RM23 3AZVA 3SH3A 3O14A 2VBBA 1EAH2 1FOD1 1W2NA 2HWF1 4QAWA 4XUPA 3AKSA 3J7HA 3RWKX 3VDDA 1G6NA 2GNDA 5BYNA 5K0UB 2SLIA 4HETA 1IG0A 1N1VA 3ZXJA 5HCBA 1CAVB 4AEDA 4JTOA 1QOOA 1Y9MA 4FCAA 4CDWA 1ONAA 5T5JA 4B7EA 4FPGA 2RMU1 4PBOA 2ZHNA 3POBA 1P8JA 5LY2A 5F32A 3OUIA 4P02B 1AXKA 5CU1A 2D6NA 2Q1FA 3LDBA 3OGVA 3ZM8A 1M06G 3CBNA 2A75A 5GLVA 1S55A 3BN6A 5EJZB 5F39A 2J22A 1E5IA 1E5RA 4XF0A 2XHNA 1AR93 2C0ZA 2XPJA 1OF3A 5FZ3A 4ZHNA 1PK6A 3FUQA 1XU2A 3NV3A 1PMJX 4CCEA 2CGPA 1SPPB 3K3OA 5E88A 5FBZA 4QHBA 2CDOA 4PIZA 4Q8LA 1D2QA 2GP3A 2VQ0A 1D4M1 4YW2A 5FMOL 1DGRA 3VDDB 4HG6B 4IV3A 1RMU3 4BZ4A 2VMDA 2Q8EA 2W1WA 5DG1A 1XE8A 4PDWA 4BK5A 4YM1A 4YW3A 1F2NA 1H1IA 5DUUA 4BK4A 5GZGA 1LU1A 4XDQA 1I5PA 3CJXA 1UOGA 2BW8A 4COYA 5BNNC 3LKJA 4Q0SA 3M4FA 4QGLA 3WG4A 5IVYA 4BQ2A 3VBFA 1OURA 3B93A 1JU4A 4I3PA 1URXA 2D7FA 3AP9A 3KS7A 2Y6JA 3NNLA 4AVTA 1RUH2 3AFKA 1A6CA 1UKGA 3AM2A 4AE2A 3DEMA 3AC0A 3AVSA 4YW7A 4K1ZA 5DABA 4XXAA 1SLIA 1C4RA 2JECA 4IV3B 2XUEA 1ZRRA 5C3OA 2XLFA 3KF5A 4NIAA 3DPRA 3PHMA 5KBFA 1W8HA 1H2NA 4KL1A 4RFT0 3RRDA 5FXXA 1XQNA 2R041 1UPIA 3DF0A 1AJOA 1DQ1A 3ENRA 4HKOA 3TNPB 3SITA 4EZHA 5D8AA 2W95A 2IZWA 1UOBA 1XNCA 3M70A 4L9BA 2JD9A 5BNNB 3JQWA 1GV9A 1S2EA 4MGZE 3T0DA 1W0OA 4L97A 2WS91 3NKGA 1CN1A 1REDA 1BBT3 2QVSB 4LHNA 4Y1UA 2BEOA 1I3HA 2Y0OA 4JGYA 4QQ2A 2XBO2 3PNAA 4R9AA 3SNMA 2DCYA 4AQTA 1DP0A 2DVBA 2XB6C 1FYUA 5F7UA 1C8M3 3A4UA 3ZSJA 4B4PA 3AMMA 4E9KA 3OSDA 4GKYA 5A7NA 2OPKA 4D3WA 5L36A 5FTTC 4FTBA 5BPXA 4ASMB 3T4VA 4QDRA 5F3EA 3NVCA 1CIYA 1XNBA 3DPRB 2G1MA 4B29A 1QQP3 3GXUA 4IEZA 4R52A 5AC92 1O3TA 2FBEA 4BIFA 2R6QA 3RYPA 2AYHA 4CDQB 3WOGA 4DY5A 3FN9A 3RGBA 2ARBA 1XE0A 1IS6A 1GBGA 1NXMA 2RHPA 3I2HA 3MLKA 3K2OA 1HJGA 1FATA 4QX7A 2CL2A 4Q4X3 3D82A 1LCLA 3OJBA 3T30A 1V70A 3N9NA 4YGEA 3ZLIA 4QKBA 2RR13 3QCWA 4GXLA 4IL7A 1W2AX 2X8KA 4B3NA 3MPPG 2YUEA 3G6JB 4E2QA 3AKQA 4NPRA 1WLTA 1ZA4A 2AREA 1QKQA 2V4AA 1Z0HA 3HJRA 3N9OA 4QPGC 3AMPA 5DAWA 3LD8A 5C33A 5FPVA 3FBMA 2XWBB 3VBRA 5FLIA 5F2WA 3N7MA 3PMEA 3O1RA 4UW4A 2PELA 2ORXA 4AF9A 5BNOA 4EN7B 3NRUA 2DUPA 2NLRA 4F3JA 2DURA 5H9SA 3ACLA 3WZ1A 3JU9A 4NHMA 5D21A 5FZLA 2GC3A 1RUD2 3WF2A 4LA2A 5DZGA 3LFMA 1W6OB 5EFUA 1POV3 3VL8A 3NAPC 4PI0A 1RTVA 5GZFA 1KS5A 4AAXA 2IFWA 3JCIA 2D6MA 3HNBM 5FP9A 3OY8B 1W6MB 2DVGA 4YFZA 4IE6A 2Q4SA 5JMOA 3DGTA 1N1SA 1W8WA 3KVAA 4A3XA 5HPOA 1UKRA 3HN3A 1V9U2 4XBQA 1PIV1 2FCUA 1BKZA 1AXZA 3JQXA 4XZPA 1WMFA 1JYVA 2C9KA 2EALA 2R072 1UIJA 3QOPA 1FPN1 2W52A 2GZWA 1Y9GA 1YQCA 3LDRA 3VBRB 1AR83 2QQKA 4XACA 3LGRA 5CB7A 3ETQA 2KXLA 3BUCA 3E5XA 5FQ0A 4JV4A 1VBD1 5BNOB 2VNGA 4WVVA 3URFA 1PO11 4UFHA 2HWD3 4Q29A 1YUDA 2VOWA 1RL3A 2XG3A 5EXOA 1QJY2 3LOBA 1K12A 4XW3A 1RYYA 4Y22B 5GJ6A 4CCJA 5C3SA 2E26A 1NCRB 2A5ZA 3WDYA 2R16A 4AI1A 1VR3A 2EXKA 3K46A 2JD4A 3ZYIB 1O3SA 3PUSA 4QKNA 3T08A 1R1A2 2IXHA 3VN4A 3WV6A 3UT0A 1EAH3 4CTEA 4UFMA 2BOIA 3LPGA 2B45X 2FQPA 4YG0A 3WG3A 3LSEA 4NIDA 2LUWA 3HPNA 2IXJA 1QU0A 4EN6B 3KB5A 4FOVA 4JQRA 1CX1A 1A78A 4LKFA 2A6YA 4QXHA 2JE8A 4KQ7A 1YRZA 3VV1A 2VBPA 5FJHA 3T0AA 4TLGA 1EPZA 4JGZA 4MGIE 1OQ1A 1N3PA 4TLFA 2ZCWA 2CY6A 1RUNA 1AL22 2GN7A 3GHMA 4LXLA 3FHIB 4FPJA 2XQRA 3MLJA 1Q3EA 3ZSLA 1Z7S1 2Q8OA 5ABJA 4NHXA 1UU4A 5HCFA 2ZHKA 1JZ3A 1O3RA 1J1LA 2PXJA 2GDFA 4ARYA 5KC5A 1BVVA 4MSVA 1YI9A 4PI2A 4M3CF 5FY7A 1W6QB 2X5IB 1CAUB 2BWAA 4V1PA
chains in the Genus database with same CATH topology
1J83A 4JHZA 1JZ5A 3VDBA 2JKXA 4GWIA 2QQMA 2DCKA 2YFZA 4PF1A 4QPWA 1OD3A 3I97A 4Z2AA 4OMDA 2JDAA 2ZXQA 3OGRA 4ZY9A 3CDZB 2Z4FA 3LEKA 2WUHA 4AG4A 3EB7A 4TXWA 2Y6HA 1UX7A 2Y6LA 2WZ8A 3A7QA 4XVHA 3GGLA 2WZEA 2VO5A 3GM8A 4JX0A 5DPNA 4P00B 1W9WA 3IB3A 1O8SA 4UAPA 2QQOA 3E1F1 2W92A 3GDBA 2QQLA 3UESA 4XUQA 1LNSA 4D8MA 3SEEA 1JHJA 1PMHX 3A22A 1NUKA 2WO2A 3A23A 5B4XA 3W5MA 3JXSA 2QQJA 3PUHA 4BXSV 4DXSA 2VM9A 3WNLA 5JXGA 1JI6A 1JU3A 1D7PM 5C71A 1OH4A 3VD5A 3I2IA 1XPWA 1MPXA 3IIIA 3WNKA 1UMIA 1CZTA 4P5YA 3ACGA 1UY0A 2VCAA 1XNTA 4JKMA 3OBAA 3LE0A 4MADA 2VZVA 3C7FA 4QB6A 2VMEA 4QDQA 4UI9L 1ULOA 3MUY1 5DN2A 1W8OA 3WF3A 4MOAA 3I3DA 1JZ4A 1K42A 5JXJA 3C7EA 1F4AA 3VD3A 2ZEXA 2W3JA 2WQ8A 3OGSA 4OZOA 1PX4A 4BJ0A 3LEIA 2WYSA 4M4RA 3HEIA 2L9LA 1J84A 3WEZA 3W5NA 3K4ZA 3T2OA 1W0NA 2J7MA 3T09A 1OT5A 2W91A 4W8JA 4CUBA 5I0DA 4XUOA 4OUEA 2QBXA 5DQ0A 2J1TA 1DLCA 3T2PA 1W99A 3LEGA 4DUVA 2VMFA 2Y6GA 5LA1A 1GOGA 3MBWA 5EJ1B 1GOFA 2QQNA 3I2FA 4QX1A 4DUWA 2VL4A 4CUCA 3K4DA 1JYWA 2EICA 5JXIA 2WO1A 2VZ3A 5HXMA 4QX0A 2XOMA 2WAAA 4A4AA 3ECQA 4PT6A 4QB1A 3EYPA 1YQ2A 1EUUA 2W87A 2ZEZA 5C70A 4QX2A 4E8DA 2QQIA 3NJXA 2Y64A 4XUTA 3WF0A 3CZUA 1GQPA 3CZJA 2X05A 2WDBA 2Y8KA 1UWWA 3I3BA 3MV11 1EUTA 3K4AA 1TG7A 4A3ZA 1CZVA 3SEPA 1KEXA 3ACHA 3VDCA 5IHRA 2YFUA 4E8CA 3VD9A 4GZ9A 1K3IA 1L7RA 2YB7A 1US2A 4TTGA 3T2QA 2J1RA 2DCJA 4DXTA 2VC9A 1PX3A 2RVAA 3P1IA 2WBKA 2BBAA 3WNOA 2BGPA 1OF4A 3HOBA 2WABA 5J1XA 2V72A 3CQOA 2VMCA 3WNNA 3PUIA 4DXRA 1NAEA 2VZRA 1KGYA 1UYZA 3I2JA 5LA2A 3T0BA 5IFTA 4FI9A 1K45A 4CU6A 5EIYB 2WN2A 1GOHA 4DEQA 4A6OA 1W8NA 5B4NA 4CVUA 3WF4A 3HNMA 4P08A 2VZUA 3DYOA 1BHGA 4D0QA 5LCWL 3DYMA 3I3EA 3K75B 5DMYA 2EIEA 2Y6KA 1UXZA 5LA0A 1JZ8A 3F2ZA 3MUZ1 3ACFA 1UY4A 3OB8A 4LKSA 4ARXA 3CIHA 1H6YA 4XUPA 4QAWA 3J7HA 1GU3A 2OKXA 2W47A 3THDA 4ET7A 2E31A 4DUXA 3SKVA 1SG3A 1P8JA 4ZZ5A 1TVGA 1UY1A 4P02B 3DECA 1T2XA 3OGVA 3ZM8A 3CKHA 3BN6A 5EJZB 2J22A 4XZUG 2XHNA 4LPLA 4JKKA 2ID4A 2VZSA 5JR2A 3HNYM 1OF3A 1JZ7A 1PMJX 2HYXA 3I2GA 3P6BA 2VZTA 2VTFA 2CDOA 1IQDC 2VZQA 2DDUA 3I2KA 1UY2A 1JZ6A 1NKGA 4HG6B 2VMDA 3IAQA 1W9TA 2W1WA 1GUIA 2V4VA 4BK5A 3WQBA 4OMCA 4L0PA 2VQTA 4A45A 4PQQA 1W9SA 2YC4A 4BK4A 3C8XA 1I5PA 3MV01 4MGSA 2WO3A 3VD4A 1F4HA 1HN1A 1JU4A 4KI5M 2Y6JA 2VR4A 2J1VA 5IJRA 5JUVA 2VZOA 3FL7A 2WAOA 3AC0A 3IAPA 3NJVA 2E33A 2EIDA 2VZ1A 4LQRA 4ZXEA 2W9XA 3ETPA 2W95A 3DYPA 3SKJE 2JD9A 2W5FA 5G05L 4DEVA 3BGAA 2X09A 4CUAA 3T0DA 3A21A 2W94A 3FHAA 4KMQA 1DP0A 1GMMA 4MO3M 5F7UA 4M4PA 2KD7A 3C7HA 3WNMA 3ACIA 4ZZ8A 4CU9A 2C26A 4QDRA 2LW8A 4CU8A 1CIYA 3GXUA 5FUIA 2B9VA 5CYYA 4GWJA 1H6XA 2E32A 2J1AA 3FN9A 2XQXA 4LHSA 3I2HA 3OEBA 2LS6A 2BZDA 2ZEWA 1GNYA 1O8PA 2VZPA 2W1QA 3D3AA 3IDAA 5G04L 2J1EA 2VJXA 3HJRA 4YPJA 3K77A 4W4ZA 2V5DA 3THCA 2VCBA 3CMGA 3OEAA 3WNPA 2VCCA 4QX3A 1UYYA 3UETA 2ORXA 2EIBA 2C4XA 3NRUA 2X10A 1L7QA 1JZ2A 3UNPA 3C7OA 2R7EB 4IUGA 3ABZA 1NX9A 2HLEA 3WF2A 4W50A 4XUNA 2BERA 4AAXA 2YC2A 3HNBM 2YG0A 4CU7A 5JMOA 2VQUA 2BGOA 1ULPA 5HPOA 2J1UA 3HN3A 2B4KA 1JYVA 2XONA 4RN5A 2C9KA 3MO4A 5CZKA 4A44A 3WSOA 2QQKA 3U37A 2J1SA 2W1SA 3LQCA 4UOJA 1UMHA 5C7GA 2WN3A 1XC6A 2W1UA 4RYDA 4BDVB 2W46A 1US3A 1K12A 1RYYA 2E26A 2PQSA 3NNGA 2ORZA 1DYOA 4XURA 1R64A 3K46A 1O59A 4KWUA 1UXXX 1UYXA 3T08A 2RV9A 1WKYA 3VD7A 1UY3A 3FHQA 3LPGA 4QB2A 5A1AA 3HPNA 2CDPA 3WF1A 2ZEYA 1CX1A 1CZSA 3OG2A 4QDSA 4OYUA 2JE8A 3VDAA 1SDDB 1SHWB 3T0AA 1XNAA 5IFPA 5JXHA 3C7GA 5IYYA 2VOTA 3NQHA 1JZ3A 4MGQA 4A41A 4A42A 1JYNA 4ARYA 1UZ0A 1WCQA 1JYXA 2RJ2A 4JKLA 3LPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J83 A;  4JHZ A;  1JZ5 A;  3VDB A;  2JKX A;  4GWI A;  2QQM A;  2DCK A;  2YFZ A;  4PF1 A;  4QPW A;  1OD3 A;  3I97 A;  4Z2A A;  4OMD A;  2JDA A;  2ZXQ A;  3OGR A;  4ZY9 A;  3CDZ B;  2Z4F A;  3LEK A;  2WUH A;  4AG4 A;  3EB7 A;  4TXW A;  2Y6H A;  1UX7 A;  2Y6L A;  2WZ8 A;  3A7Q A;  4XVH A;  3GGL A;  2WZE A;  2VO5 A;  3GM8 A;  4JX0 A;  5DPN A;  4P00 B;  1W9W A;  3IB3 A;  1O8S A;  4UAP A;  2QQO A;  3E1F 1;  2W92 A;  3GDB A;  2QQL A;  3UES A;  4XUQ A;  1LNS A;  4D8M A;  3SEE A;  1JHJ A;  1PMH X;  3A22 A;  1NUK A;  2WO2 A;  3A23 A;  5B4X A;  3W5M A;  3JXS A;  2QQJ A;  3PUH A;  4BXS V;  4DXS A;  2VM9 A;  3WNL A;  5JXG A;  1JI6 A;  1JU3 A;  1D7P M;  5C71 A;  1OH4 A;  3VD5 A;  3I2I A;  1XPW A;  1MPX A;  3III A;  3WNK A;  1UMI A;  1CZT A;  4P5Y A;  3ACG A;  1UY0 A;  2VCA A;  1XNT A;  4JKM A;  3OBA A;  3LE0 A;  4MAD A;  2VZV A;  3C7F A;  4QB6 A;  2VME A;  4QDQ A;  4UI9 L;  1ULO A;  3MUY 1;  5DN2 A;  1W8O A;  3WF3 A;  4MOA A;  3I3D A;  1JZ4 A;  1K42 A;  5JXJ A;  3C7E A;  1F4A A;  3VD3 A;  2ZEX A;  2W3J A;  2WQ8 A;  3OGS A;  4OZO A;  1PX4 A;  4BJ0 A;  3LEI A;  2WYS A;  4M4R A;  3HEI A;  2L9L A;  1J84 A;  3WEZ A;  3W5N A;  3K4Z A;  3T2O A;  1W0N A;  2J7M A;  3T09 A;  1OT5 A;  2W91 A;  4W8J A;  4CUB A;  5I0D A;  4XUO A;  4OUE A;  2QBX A;  5DQ0 A;  2J1T A;  1DLC A;  3T2P A;  1W99 A;  3LEG A;  4DUV A;  2VMF A;  2Y6G A;  5LA1 A;  1GOG A;  3MBW A;  5EJ1 B;  1GOF A;  2QQN A;  3I2F A;  4QX1 A;  4DUW A;  2VL4 A;  4CUC A;  3K4D A;  1JYW A;  2EIC A;  5JXI A;  2WO1 A;  2VZ3 A;  5HXM A;  4QX0 A;  2XOM A;  2WAA A;  4A4A A;  3ECQ A;  4PT6 A;  4QB1 A;  3EYP A;  1YQ2 A;  1EUU A;  2W87 A;  2ZEZ A;  5C70 A;  4QX2 A;  4E8D A;  2QQI A;  3NJX A;  2Y64 A;  4XUT A;  3WF0 A;  3CZU A;  1GQP A;  3CZJ A;  2X05 A;  2WDB A;  2Y8K A;  1UWW A;  3I3B A;  3MV1 1;  1EUT A;  3K4A A;  1TG7 A;  4A3Z A;  1CZV A;  3SEP A;  1KEX A;  3ACH A;  3VDC A;  5IHR A;  2YFU A;  4E8C A;  3VD9 A;  4GZ9 A;  1K3I A;  1L7R A;  2YB7 A;  1US2 A;  4TTG A;  3T2Q A;  2J1R A;  2DCJ A;  4DXT A;  2VC9 A;  1PX3 A;  2RVA A;  3P1I A;  2WBK A;  2BBA A;  3WNO A;  2BGP A;  1OF4 A;  3HOB A;  2WAB A;  5J1X A;  2V72 A;  3CQO A;  2VMC A;  3WNN A;  3PUI A;  4DXR A;  1NAE A;  2VZR A;  1KGY A;  1UYZ A;  3I2J A;  5LA2 A;  3T0B A;  5IFT A;  4FI9 A;  1K45 A;  4CU6 A;  5EIY B;  2WN2 A;  1GOH A;  4DEQ A;  4A6O A;  1W8N A;  5B4N A;  4CVU A;  3WF4 A;  3HNM A;  4P08 A;  2VZU A;  3DYO A;  1BHG A;  4D0Q A;  5LCW L;  3DYM A;  3I3E A;  3K75 B;  5DMY A;  2EIE A;  2Y6K A;  1UXZ A;  5LA0 A;  1JZ8 A;  3F2Z A;  3MUZ 1;  3ACF A;  1UY4 A;  3OB8 A;  4LKS A;  4ARX A;  3CIH A;  1H6Y A;  4XUP A;  4QAW A;  3J7H A;  1GU3 A;  2OKX A;  2W47 A;  3THD A;  4ET7 A;  2E31 A;  4DUX A;  3SKV A;  1SG3 A;  1P8J A;  4ZZ5 A;  1TVG A;  1UY1 A;  4P02 B;  3DEC A;  1T2X A;  3OGV A;  3ZM8 A;  3CKH A;  3BN6 A;  5EJZ B;  2J22 A;  4XZU G;  2XHN A;  4LPL A;  4JKK A;  2ID4 A;  2VZS A;  5JR2 A;  3HNY M;  1OF3 A;  1JZ7 A;  1PMJ X;  2HYX A;  3I2G A;  3P6B A;  2VZT A;  2VTF A;  2CDO A;  1IQD C;  2VZQ A;  2DDU A;  3I2K A;  1UY2 A;  1JZ6 A;  1NKG A;  4HG6 B;  2VMD A;  3IAQ A;  1W9T A;  2W1W A;  1GUI A;  2V4V A;  4BK5 A;  3WQB A;  4OMC A;  4L0P A;  2VQT A;  4A45 A;  4PQQ A;  1W9S A;  2YC4 A;  4BK4 A;  3C8X A;  1I5P A;  3MV0 1;  4MGS A;  2WO3 A;  3VD4 A;  1F4H A;  1HN1 A;  1JU4 A;  4KI5 M;  2Y6J A;  2VR4 A;  2J1V A;  5IJR A;  5JUV A;  2VZO A;  3FL7 A;  2WAO A;  3AC0 A;  3IAP A;  3NJV A;  2E33 A;  2EID A;  2VZ1 A;  4LQR A;  4ZXE A;  2W9X A;  3ETP A;  2W95 A;  3DYP A;  3SKJ E;  2JD9 A;  2W5F A;  5G05 L;  4DEV A;  3BGA A;  2X09 A;  4CUA A;  3T0D A;  3A21 A;  2W94 A;  3FHA A;  4KMQ A;  1DP0 A;  1GMM A;  4MO3 M;  5F7U A;  4M4P A;  2KD7 A;  3C7H A;  3WNM A;  3ACI A;  4ZZ8 A;  4CU9 A;  2C26 A;  4QDR A;  2LW8 A;  4CU8 A;  1CIY A;  3GXU A;  5FUI A;  2B9V A;  5CYY A;  4GWJ A;  1H6X A;  2E32 A;  2J1A A;  3FN9 A;  2XQX A;  4LHS A;  3I2H A;  3OEB A;  2LS6 A;  2BZD A;  2ZEW A;  1GNY A;  1O8P A;  2VZP A;  2W1Q A;  3D3A A;  3IDA A;  5G04 L;  2J1E A;  2VJX A;  3HJR A;  4YPJ A;  3K77 A;  4W4Z A;  2V5D A;  3THC A;  2VCB A;  3CMG A;  3OEA A;  3WNP A;  2VCC A;  4QX3 A;  1UYY A;  3UET A;  2ORX A;  2EIB A;  2C4X A;  3NRU A;  2X10 A;  1L7Q A;  1JZ2 A;  3UNP A;  3C7O A;  2R7E B;  4IUG A;  3ABZ A;  1NX9 A;  2HLE A;  3WF2 A;  4W50 A;  4XUN A;  2BER A;  4AAX A;  2YC2 A;  3HNB M;  2YG0 A;  4CU7 A;  5JMO A;  2VQU A;  2BGO A;  1ULP A;  5HPO A;  2J1U A;  3HN3 A;  2B4K A;  1JYV A;  2XON A;  4RN5 A;  2C9K A;  3MO4 A;  5CZK A;  4A44 A;  3WSO A;  2QQK A;  3U37 A;  2J1S A;  2W1S A;  3LQC A;  4UOJ A;  1UMH A;  5C7G A;  2WN3 A;  1XC6 A;  2W1U A;  4RYD A;  4BDV B;  2W46 A;  1US3 A;  1K12 A;  1RYY A;  2E26 A;  2PQS A;  3NNG A;  2ORZ A;  1DYO A;  4XUR A;  1R64 A;  3K46 A;  1O59 A;  4KWU A;  1UXX X;  1UYX A;  3T08 A;  2RV9 A;  1WKY A;  3VD7 A;  1UY3 A;  3FHQ A;  3LPG A;  4QB2 A;  5A1A A;  3HPN A;  2CDP A;  3WF1 A;  2ZEY A;  1CX1 A;  1CZS A;  3OG2 A;  4QDS A;  4OYU A;  2JE8 A;  3VDA A;  1SDD B;  1SHW B;  3T0A A;  1XNA A;  5IFP A;  5JXH A;  3C7G A;  5IYY A;  2VOT A;  3NQH A;  1JZ3 A;  4MGQ A;  4A41 A;  4A42 A;  1JYN A;  4ARY A;  1UZ0 A;  1WCQ A;  1JYX A;  2RJ2 A;  4JKL A;  3LPF A; 
#chains in the Genus database with same CATH topology
 2YV8 A;  2FDJ A;  1NCQ A;  1DQ6 A;  1X9T A;  4AI8 A;  1SBD A;  1W2O A;  1RVF 1;  5I8S A;  3BKZ A;  2HH9 A;  2QQM A;  4ATF A;  4ES9 A;  2MHF A;  5FP3 A;  1LHN A;  2PQQ A;  2RS5 1;  3VHR A;  2YFZ A;  3BOP A;  5J98 B;  3N9Q A;  3V0A B;  1NY7 2;  1QHD A;  1V6O A;  2ZZJ A;  3I59 A;  3WW4 A;  4Z92 B;  3VBO B;  5FYZ A;  3O7O A;  5EV7 A;  3RS6 A;  3APB A;  1DIW A;  1OA4 A;  2VEC A;  1W3X A;  3SC7 X;  2VMG A;  1TMF 2;  5LBB A;  2G4I A;  3MIH A;  1RUH 3;  1YQ6 A;  2Z42 A;  1V6J A;  2Y0I A;  5FZG A;  1UX7 A;  3A7Q A;  2WZ8 A;  2R06 2;  2HJI A;  4LOS A;  1HLC A;  2ARX A;  3GGL A;  3ITQ A;  3PL0 A;  5ERL A;  2OYZ A;  4CUG A;  3MPB A;  3PTY A;  1NCQ B;  2ES3 A;  4BQ5 A;  1W9W A;  2BGC A;  2PHX A;  1O8S A;  2YPJ A;  3C3V A;  4TSV A;  1TEI A;  4Z1V A;  2QQO A;  3E1F 1;  3IKW A;  3ZFG A;  2WRA A;  1WCU A;  5DAQ A;  5A6X A;  5FO7 B;  2FDK A;  3GDB A;  1ND3 A;  3N9L A;  4FXK B;  3UES A;  4GMP 0;  3AP4 A;  3ES1 A;  4XUQ A;  5F5A A;  2ARC A;  1MS4 A;  1PMH X;  2RS1 1;  4FPY A;  1Q8P A;  4K40 A;  2WO2 A;  4LK7 A;  1T6G C;  4LO6 B;  1YJK A;  3A23 A;  4BQ3 A;  4AWD A;  4DB5 A;  3MW3 A;  1H0B A;  1RUC 2;  5FZK A;  4C90 A;  2DTY A;  2CGO A;  4BXS V;  1HRI 1;  2XJQ A;  3AP6 A;  5CKM A;  1GWK A;  5JI7 A;  1JI6 A;  3J26 N;  4MGK E;  3SQO A;  1ZZB A;  3GNE A;  3ZN5 A;  1UZV A;  4XFI A;  4GAZ A;  4QKD A;  3H1Y A;  1XPW A;  3UV9 A;  5DUV A;  1MPX A;  5JZG B;  4YW6 A;  1GNH A;  3CL1 A;  5A3T A;  1MS0 A;  5FYU A;  2OQ7 A;  4AHW A;  4P5Y A;  2OQ6 A;  1YFU A;  1RXG A;  1XNT A;  3MI8 A;  3VBS C;  3ZYH A;  3ZYR A;  1R08 3;  3S6P A;  3E6D A;  4GWM A;  3NST A;  4PIY A;  4P9Y A;  3ZXD A;  3WF3 A;  5C9A A;  2XKO A;  2UYA A;  3MYX A;  5JI9 A;  3LFI A;  3POG A;  1R09 3;  4K8F A;  3ZFF C;  2Q30 A;  5JXJ A;  3C7E A;  5FDB A;  2ADE A;  5FZ1 A;  4NRQ A;  1DHK B;  1NXD 1;  1U5X A;  3DL3 A;  5CNA A;  3VD3 A;  2ZEX A;  5A3W A;  2H6C A;  1V6N A;  4OZO A;  1DZR A;  2ZGU A;  1YQ5 A;  2YY1 A;  4JDO A;  4M4R A;  2L9L A;  2ZKL A;  2WWS A;  2Y60 A;  3JB4 C;  1SLB A;  1CJP A;  3W5N A;  2XKP A;  3V65 A;  4DRV A;  4IGQ A;  4GB3 3;  5J3U A;  1Q43 A;  4RHV 1;  5F3I A;  1HRV 1;  1YFW A;  4B8E A;  5EWS A;  1IQA A;  1AR6 1;  1C57 A;  1JH5 A;  2I45 A;  1RUF 2;  2R49 A;  1JOJ A;  1QEX A;  2J7M A;  5FPU A;  1JTZ X;  1VBB 2;  5FZH A;  4LO5 B;  2RDS A;  4BH9 A;  2W91 A;  2ZTN A;  4NN0 A;  5LBF A;  5FZF A;  2GH2 A;  3WQ0 A;  4CUB A;  2C6S A;  1FMD 2;  2WNV A;  5I0D A;  2DV9 A;  4XUO A;  5FFO C;  1LHV A;  1ZBE 3;  2QBX A;  2QCS B;  5K4L A;  4CEY A;  4D7T A;  4PCR A;  5BXX A;  2HEY F;  1V9U 3;  3J9S A;  4QQO A;  5FJK A;  1ZVF A;  3TN9 1;  5A6Z A;  1XXN A;  5FBJ A;  1NA1 B;  1CON A;  4XJ9 A;  4DUV A;  3QH7 A;  4Y1Y A;  4KG8 A;  1VP6 A;  4YVW B;  3B9I A;  3J7L A;  1H9P A;  2RDN A;  3I2F A;  2BBV A;  2HBU A;  1O4T A;  4DUW A;  2P34 A;  1RIT A;  3TOJ A;  1JYW A;  3M3O A;  2ZJC A;  1NE4 A;  2VZ3 A;  2UY9 A;  3I7D A;  5E16 A;  5HXM A;  4EWD A;  1ULD A;  1W8Z A;  4QX0 A;  3HMY A;  2VUA A;  2JDN A;  4MHU A;  1LEC A;  4EWA A;  4LTA A;  1PVX A;  1DZQ A;  2Z2S B;  3ELN A;  3ECQ A;  4EYU A;  3UL2 A;  3RI8 A;  5C6C A;  3EYP A;  1YQ2 A;  4CRQ A;  4XFF A;  5KHI A;  1W9Y A;  2ZEZ A;  2GNB A;  3IWZ A;  4MVT A;  2QQV A;  2WQZ C;  4KH9 A;  3R4D B;  4QX2 A;  4UBG A;  5JOZ A;  4B4Q A;  3O12 A;  3WDX A;  3RDI A;  4FXG B;  3WW1 A;  3S5A A;  4XUT A;  4P9W A;  1WGP A;  2C5D A;  3CZU A;  3VL9 A;  3KCX A;  4A7K A;  1GQP A;  4WZC A;  4P9J A;  4CDX A;  3VZN A;  4LJH A;  4XIK A;  5H9Q A;  4BIS A;  4YGD A;  4LOT A;  4M3C B;  1RUJ 2;  3I3B A;  3GHN A;  1SLC A;  4A3Z A;  1CZV A;  2QKD A;  3IPV A;  1B09 A;  1ODN A;  4N90 A;  5DDJ 2;  1AL2 3;  5FY5 A;  1KEX A;  5IHR A;  3VD9 A;  4E8C A;  4RQP A;  1FNY A;  1RC6 A;  4NOT A;  4CPB D;  1K3I A;  3R4U A;  3BTY A;  4CP9 A;  3D5O A;  5IAT A;  1G9A A;  3JBG 2;  4L8Q A;  1UNB A;  4XJ8 A;  5A33 A;  3KHC A;  3I54 A;  3KZ4 C;  4QU1 A;  2JIJ A;  1AX2 A;  1H2L A;  2RM2 2;  4QGM A;  4URT A;  5FAX A;  3SCH A;  4H7L A;  3WNO A;  5KWR A;  4K1Y A;  5AC9 1;  2WAB A;  3P3N A;  4WVM A;  4LUK A;  5CKN A;  2EVX A;  1X33 A;  5J1X A;  4PLO A;  1OPM A;  4RGG A;  4K20 A;  5EJ3 A;  1F35 A;  3H3L A;  3N7J A;  2YDE A;  4EN0 A;  4CDX B;  2AAC A;  3PUI A;  5JDB A;  1KGY A;  4NJ4 A;  3SH5 A;  1BQP A;  2PYT A;  4FI9 A;  3MZH A;  2EIG A;  1JOD A;  3POF A;  1QJU 3;  2WNU A;  3WUC A;  4MGT A;  4O7X A;  4DQA A;  4QX5 A;  3IPV B;  3DKW A;  5F3C A;  4Q4W 1;  1S1A A;  4XF3 A;  1GOH A;  2BOJ A;  4DEQ A;  4A6O A;  1AR9 2;  1AF9 A;  4LO7 A;  1W8N A;  3HR9 A;  3UJO A;  4CYD A;  5I93 A;  1MZF A;  2DUQ A;  4AVC A;  2WQ4 A;  1TMF 3;  4IET A;  4AOC A;  4P08 A;  1KFX L;  3DYO A;  4D0Q A;  4LT5 A;  3MIF A;  4FPO B;  2IFR A;  4I0W B;  2E7T A;  3GJA A;  3POW A;  5AVA A;  2DBN A;  1W39 A;  2Y6K A;  1JZ8 A;  4FPF A;  4WVM B;  1ZRE A;  3MUZ 1;  1Z78 A;  2OII A;  5C3Q A;  3ACF A;  1UY4 A;  2E7A A;  3J7M A;  1IKP A;  4ARX A;  4ASK A;  2I07 B;  4IV1 C;  3LDK A;  4QXK A;  3WR0 A;  1QJF A;  4HK9 A;  2D6K A;  2AC1 A;  3O1M A;  3RG0 A;  4I0B A;  3EO6 A;  1ND2 B;  1I1E A;  2PTM A;  5IK8 A;  2ZMN A;  4XCB A;  2HWE 1;  1WCD J;  4G4F A;  1EYB A;  3THD A;  3ZXG A;  4ET7 A;  4MHR A;  1RUO A;  3BOD A;  4N7U A;  3SKV A;  1FNZ A;  1SG3 A;  3POJ A;  5FLJ A;  5FXV A;  4CDU C;  1PGL 2;  4LHL A;  1F8V A;  1TVG A;  4DO0 A;  2E6V A;  4XJW A;  5I0T A;  3MID A;  3RJR A;  1O4Y A;  3J8F 3;  1J59 A;  2VQA A;  1QXR A;  2ET7 A;  1GZW B;  2D40 A;  1RHI 1;  4XZU G;  1YWK A;  4LPL A;  4O9E A;  2CV6 A;  4JKK A;  1GLH A;  1UZZ A;  2RJL A;  3RVH A;  2UU8 A;  4FQZ A;  2FDH A;  2WZR 1;  4KU8 A;  3I3M A;  1IPS A;  1UQX A;  3N4M A;  5GZC A;  1OXC A;  2VTF A;  4RS5 C;  1OOP C;  3ILR A;  4JDM A;  2RS3 1;  1OMI A;  2KR2 A;  1WW7 A;  1ST8 A;  2K46 A;  2QDN A;  3HQU A;  4XBL A;  1RIR A;  2H0B A;  3UK9 A;  4Q0U A;  4Y4Y A;  5F8P A;  3DUI A;  2YU2 A;  4FBF A;  2JDK A;  3H7Y A;  2JXA A;  5LK7 B;  2V4V A;  1ZBA 1;  3WQB A;  1BBT 2;  1NLS A;  2G9G A;  4PLM A;  1TNF A;  4CSW A;  2B7Y A;  4I30 A;  4A45 A;  2XJS A;  1W9S A;  2YC4 A;  2GC2 A;  3RPQ A;  4AFC A;  4MG2 A;  4HSL A;  4MLO A;  5JSP A;  1IPK A;  1POV 0;  2WO3 A;  3AP5 A;  3LF7 A;  4MGS A;  4XQD A;  1W6N A;  3CJI A;  2ATF A;  2AEN A;  4CP0 A;  3D0J A;  4MXW A;  4E4Z A;  4YGC A;  5FZB A;  3ORJ A;  3T3Y A;  2ZGP A;  4BXF A;  4YG6 A;  2QDR A;  3LA3 A;  2DBI A;  3VBH C;  1MQT A;  3Q9O A;  1J58 A;  3NV1 A;  2ZAH A;  3H9A A;  4RS5 B;  1QQP 2;  4CCO A;  2D3S A;  5FRE A;  4ZS2 A;  1ULG A;  2VNV A;  4QX8 A;  2AEZ A;  2E33 A;  1RUG 1;  3Q8C A;  1VBB 3;  4U2A A;  3AYA A;  2QNK A;  3TB0 A;  1LOF C;  3FFZ A;  1HKD A;  1HQW A;  1V6I A;  4HSJ A;  5IK5 A;  2RR1 2;  5FYS A;  5FWE A;  3ETP A;  4CXY A;  2BUK A;  2VGD A;  4DEV A;  1LHU A;  3ES4 A;  4Y1Z A;  5L7O C;  1X9P A;  1W6N B;  2P6H A;  5ANQ A;  4CUA A;  1YYN A;  4CZS A;  4YZ1 A;  5JR7 B;  2Y34 A;  4H3W A;  4I0A A;  1QJX 3;  4WBB A;  5T54 A;  4IEQ A;  3M2M A;  3VBH B;  1B35 A;  2Z79 A;  3KVB A;  3KT1 A;  3T2T A;  3TNQ A;  1GMM A;  4WM8 C;  2Y26 A;  2WFF 3;  3H0O A;  2VUL A;  3WG2 A;  4B1L A;  1DZT A;  2KD7 A;  4MUV A;  4LBO A;  4EE2 A;  3ACI A;  3GZE A;  1Q8S A;  1JUH A;  1XB9 A;  2RMU 2;  5FYB A;  2C26 A;  5T55 A;  5IK4 A;  3HD8 B;  2XJT A;  2XL9 A;  4JQT A;  5T3N A;  3R6S A;  4IEY A;  4XDO A;  4AVA A;  4OHV A;  2O8Q A;  4EN9 B;  3QAC A;  3HBK A;  1VB4 A;  3WP6 A;  5LBC A;  4BA6 A;  4C0H A;  3BU0 A;  4GWJ A;  4OUM A;  1H6X A;  1HXS 3;  1NQJ A;  2E32 A;  5K0U A;  3ZYB A;  1MS8 A;  3N7L A;  3BPS A;  5ANN A;  1VBC 1;  4LBK A;  4HFS A;  2LS6 A;  1SLA A;  1LHO A;  4AI2 A;  1AR8 2;  2DYC A;  1D4M 2;  1O8P A;  1OA2 A;  3LOI A;  3FFQ A;  1VRH 3;  4FPK A;  1B35 B;  1RUJ 3;  3CHX A;  5CFC C;  1IZ3 A;  2PHR A;  3R05 A;  1AR7 1;  1N3O A;  3IDA A;  2VOV A;  5DDJ 3;  5G04 L;  4GH4 C;  2HWC 3;  4FVV A;  4KNC A;  2HWD 2;  2PFW A;  5C3R A;  2NQY A;  3THC A;  3CMG A;  4AI0 A;  1JXN A;  4KWK A;  1JYT A;  2VCC A;  2BU9 A;  4QX3 A;  3UET A;  1SPP A;  1YFX A;  1YIP A;  2C4X A;  1HJF A;  4IXL A;  1L7Q A;  1JZ2 A;  1UN1 A;  2E51 A;  2QZ3 A;  5GLW A;  1ZRC A;  1POQ A;  2Z5W A;  3OD4 A;  1NX9 A;  1QNW A;  2HLE A;  5C8C C;  4W50 A;  4XUN A;  5C5T A;  2JG9 C;  5ACA 1;  3UKT A;  2YC2 A;  4I2O A;  2JDM A;  3I2D A;  4LMF A;  4IE7 A;  5SV8 A;  4DY3 A;  4Q26 A;  4WM7 C;  3PVE A;  2F6B A;  2VQU A;  2CHH A;  1IS3 A;  1EPW A;  2NYY A;  4UF0 B;  4XAA A;  1FT9 A;  3D0S A;  2WSU A;  2CU5 A;  3BPZ A;  2XON A;  3VUO A;  1MVE A;  3MO4 A;  2WIN B;  5CZK A;  1BLZ A;  1VBE 1;  2CGN A;  1JMU B;  4A44 A;  2E63 A;  2PHT A;  4Q4Y 3;  1AYN 1;  4Q0V A;  2A6W A;  2DCZ A;  4RD7 A;  3U37 A;  1H2M A;  1RUI 3;  1YFY A;  2ILM A;  2Y33 A;  1UMH A;  2WT0 A;  2WN3 A;  4RYD A;  4XF9 A;  5A80 A;  4QQL A;  3TEY A;  3L2Y A;  4XXP A;  1RUE 3;  4PBP A;  1QXJ A;  5J48 A;  4CDW C;  1KS4 A;  2QQP A;  1OQE A;  2VMH A;  4GUL A;  4CCC A;  2AGS A;  4QMA A;  4OHX A;  5IUQ A;  5FOJ B;  2JG9 B;  3NNG A;  2EAA A;  2ORZ A;  1O3Q A;  5JCT A;  4KWU A;  2C24 A;  4FPE A;  4W6W A;  4Y33 A;  1D0G A;  1UYX A;  2BFU S;  2RV9 A;  2QUO A;  5CAZ A;  4D6Q A;  4QB2 A;  3BTA A;  3ZFE C;  1MZ5 A;  4YNI A;  5A1A A;  3I2O A;  1PK6 C;  4NII A;  2D44 A;  5BNN A;  2E9Q A;  2DVF A;  2WII B;  4UT5 A;  1YI7 A;  2CDP A;  2ZEY A;  3UJQ A;  1DGR N;  2A3W A;  4S2D A;  3MGU A;  1I9R A;  1VAV A;  3V56 A;  2MPF A;  3LZZ A;  4JVA A;  1XNA A;  2WKK A;  1OBN A;  3VHO A;  5I8T A;  1EV1 3;  4LBQ B;  3VHN A;  4CEW C;  1UX6 A;  1ZM1 A;  2D97 A;  1PO2 1;  2Y38 A;  1BEV 3;  4IDZ A;  5IYY A;  4BMB A;  5HV4 A;  2OT7 A;  3MIB A;  2XXZ A;  2GME A;  1NLR A;  4MGQ A;  2RJK A;  4A42 A;  4A41 A;  2NP0 A;  1ZRF A;  1UZ0 A;  5J36 A;  2FDF A;  1OUX A;  5LA9 A;  5C4W C;  1JYX A;  2IXL A;  3AZX A;  2LTN A;  4HXC A;  2RJ2 A;  4CDQ A;  1NYW A;  4JKL A;  3VBF C;  5HBA A;  3ZFE B;  3BI3 A;  3AXE A;  1AX1 A;  1NLQ A;  4JHZ A;  5J7M A;  4DS0 A;  1H8T C;  3FLP A;  3ZYG A;  2WYF A;  3VDB A;  4GWI A;  1WBF A;  3AYD A;  2WWU A;  2XJV A;  3ATG A;  3M7A A;  4LO4 B;  4W65 A;  1VMF A;  4AEJ A;  4HT1 T;  1C1L A;  1SBE A;  2D43 A;  5F5Q A;  3ROU A;  5F3G A;  1MS9 A;  2Q0A A;  3JZV A;  3OGR A;  4FPL A;  4NE9 A;  5FY9 A;  1BK0 A;  2D6P A;  2Z4F A;  4OUL A;  1TZO A;  5FMC A;  5J37 A;  1O5U A;  4P5H A;  2IUW A;  5FKB A;  4HL0 A;  2W0X A;  1YXW A;  4AG4 A;  5D8A C;  3O1S A;  3M3Q A;  1UO9 A;  4X6Q B;  4XET A;  1PIV 2;  3ZMN A;  2Y6H A;  4COW A;  5C4W B;  3O0W A;  3KD4 A;  1C8N A;  2YRO A;  4XVH A;  5IVF A;  3VZJ A;  3OCP A;  5BNP C;  3NNJ A;  3PU3 A;  1R08 2;  1W6O A;  4JGY C;  3LAG A;  5DPN A;  1ULF A;  1H8T B;  4P00 B;  2B39 A;  1TME 1;  4LBQ D;  5FZ8 A;  3ON7 A;  3SHR A;  5FR3 A;  2ZAB A;  3LEM A;  5A7O A;  1VBD 2;  1QNY A;  3OY8 A;  1W6M A;  4NIG A;  2OPW A;  1W9F A;  1OD5 A;  1R09 2;  1VE0 A;  4TWT A;  2W92 A;  4XFB A;  2JE9 A;  4ZXK A;  4AL9 A;  2O8O A;  3PVO A;  3AZY A;  3EJK A;  2MEV 3;  1JYC A;  5JWP A;  4A2U A;  4HPK B;  4CXW A;  3QD6 A;  4K21 A;  4LUM A;  1PMI A;  3A22 A;  4Q1R A;  2R0F A;  5T5L A;  1ODM A;  3M1H A;  1QY4 A;  3UGF A;  1YO8 A;  2XDV A;  3FC0 A;  4K6B A;  1FOD 3;  2HWF 3;  5JVV A;  2F4P A;  2ZX0 A;  2A6Z A;  2ZOE B;  4J1X A;  4BLJ A;  4XEZ A;  4E4H A;  3PVB B;  4GB3 2;  2NZ9 A;  3TRS B;  4DPN A;  1EP0 A;  5JXG A;  5SV5 A;  5GLT A;  2OS2 A;  4Y22 A;  5BNP B;  2RMU 3;  5K7P A;  1NCR A;  3IMM A;  1PZ7 A;  4D7Y A;  3WT3 A;  5C71 A;  3FWE A;  3QLQ A;  1OH4 A;  1VPH A;  3VD5 A;  3ZKU A;  1HB1 A;  3MFA A;  2V73 A;  1ASJ 1;  3THP A;  4WV8 A;  1ZBE 2;  1VIW B;  4HMZ A;  4S2G A;  4AHZ A;  2JB4 A;  3OBA A;  4DXZ A;  4MAD A;  1SLL A;  4QPG B;  3C7F A;  2VME A;  4GIQ A;  4UI9 L;  3RZZ A;  1ULO A;  3PLQ A;  5DN2 A;  4BLI A;  5FZM A;  1W8O A;  1MVQ A;  4O9G A;  3AZZ A;  4Q4V 1;  1D4M 3;  5GKA C;  2XBO 1;  2D6O X;  2ZGN A;  1LOE A;  3GCX A;  3ME2 A;  5CBL A;  1JZ4 A;  1ZYB A;  1K42 A;  1PNG A;  5T52 A;  4P14 A;  4LR4 A;  1MS3 A;  4YZ5 A;  3W21 A;  5KXD A;  3OGS A;  3WHU A;  4EN8 B;  2WYS A;  3HEI A;  1LRH A;  1UOF A;  2RS5 2;  3POS A;  3NAP B;  1GKB A;  5T50 A;  2JIG A;  1WME A;  3AKR A;  3PTR B;  5J96 B;  3O1U A;  3T2O A;  1W6Q A;  1PVC 1;  3H1W A;  2JX9 A;  5EPA A;  2X5I A;  1CAU A;  4OQ8 A;  4YGB A;  1OQD A;  1NOV A;  5GAL A;  3DV8 A;  3OOX A;  3VGI A;  3G7D A;  1LES A;  3H7J A;  3O1T A;  3EQE A;  1HN0 A;  4ATE A;  2JWP A;  2BFU L;  2YBP A;  4UFI A;  5DQ0 A;  3CEW A;  2WLQ A;  4Q1P A;  3GYD A;  1DLC A;  3H50 A;  3KGL A;  3AK0 A;  3T2P A;  3KT7 A;  5FZO B;  3V0A A;  2YYO A;  2MNG A;  3PUQ A;  4UW5 A;  5A6Y A;  3AYC A;  1OVS A;  3OBT A;  2Y6G A;  3VBO A;  4LNV A;  5LA1 A;  1V00 A;  1GOG A;  2R04 3;  3MBW A;  2QQN A;  4QX1 A;  4ES8 A;  1JOP A;  4QQP A;  4YVS C;  4CUC A;  4DOU A;  2ZKN A;  2EIC A;  3BVC A;  3ZPY A;  5JXI A;  1UOJ A;  2WO1 A;  4KWL A;  4NMI A;  1JYI A;  2ZGQ A;  2VNR A;  1ZZ6 A;  3GF6 A;  1ULE A;  1RUD 1;  2ZBJ A;  2WS9 3;  5FMD A;  1X36 A;  1PGS A;  3NJY A;  2WAA A;  3JD7 1;  1C28 A;  1LEN A;  4PT6 A;  2P17 A;  2TNF A;  3ZXF A;  3IM0 A;  2VW0 A;  4QB1 A;  4FOQ A;  5EP9 A;  4YAR A;  2GN3 A;  2PMW B;  3TYJ A;  1HRI 2;  1Y9Q A;  1XYP A;  4JC1 A;  1VBA 1;  2AZ5 A;  1N3Q A;  5LZ6 A;  1QJU 2;  4E8D A;  2QQI A;  1ALY A;  2RE9 A;  3NJX A;  4RR3 C;  4XFC A;  4JAA A;  3NV2 A;  5ABJ C;  2ZML A;  4PJY A;  2R07 1;  5LB6 A;  3RSJ A;  1Q8V A;  2GP5 A;  1UMZ A;  4AAP A;  2QQW A;  2HEV F;  4ZON A;  3U10 A;  1OH3 A;  1UPS A;  2VH9 A;  4YVS B;  5LEK A;  4LOR A;  1EUT A;  3MF9 A;  3SXW A;  1BMV 2;  1DCS A;  5DAX A;  3SEP A;  1GP6 A;  4LE3 A;  5IWF A;  3VDC A;  1QJY 1;  2YFU A;  1WUV A;  4XE9 A;  2WR9 A;  3ZN6 B;  5IVV A;  4GZ9 A;  4TTG A;  5IVB A;  4HLT A;  1OI6 A;  5DZF A;  2DCJ A;  2VC9 A;  2FZ1 A;  4EWE A;  2QFE A;  4AHX A;  5JZG A;  1WLW A;  1R1A 1;  3IDE A;  4OQ9 A;  3AYE A;  4AQ6 A;  4Y5T A;  5FP8 A;  3ASI A;  1OF4 A;  1UU6 A;  3RMX A;  2D3P A;  3O1O A;  3SH4 A;  2BWC A;  2W2I A;  2VVE A;  1WMD A;  1LB2 A;  3GZU C;  4QPI C;  2XH6 A;  1S0F A;  4OCT A;  4DMI A;  1NAE A;  2VZR A;  1UYZ A;  5JOW A;  5A7W B;  4G3Y C;  1HRV 2;  1S4C A;  4AVS A;  1G9F A;  3A0N A;  1K45 A;  1WA6 X;  5JIA A;  3ZSE A;  1UU5 A;  3J8F 2;  2WN2 A;  1U5I A;  4AK3 A;  1KJR A;  1XNK A;  4OI0 A;  2PHW A;  5A3P A;  1OUS A;  4IEU A;  5B4N A;  2D5F A;  4N9H A;  3X29 B;  2A70 A;  3WF4 A;  2VVD A;  3M3I A;  4ZU5 A;  4N53 C;  5FMB A;  5BUV A;  4HVQ A;  1PIV 3;  3ILN A;  3TN9 2;  4ZKT B;  1BHG A;  1ULC A;  5FPA A;  5LCW L;  1N1Y A;  4Z82 A;  1FPN 3;  1XJA A;  3Q8E A;  5DXD A;  2OZ6 A;  2EIE A;  5DMY A;  3SCG A;  3WXP A;  3OGJ A;  2JG8 C;  4BU2 A;  1F5F A;  3CIH A;  4HN0 A;  4LBJ A;  5L9R A;  1VBD 3;  3U14 A;  1DBN A;  1PO1 3;  2Q1Z B;  3NV4 A;  3B00 A;  4TN7 A;  3T1L A;  5FK8 A;  4M3C E;  1BJQ A;  3ZFF A;  4CPB A;  4H2A A;  4JTN A;  4K7J A;  1NY7 1;  4QHO A;  4FAG A;  3LB9 A;  4OHW A;  1NA1 A;  1D4V B;  4S2H A;  3RI9 A;  3ZX7 A;  1DU3 D;  3MW4 A;  2E31 A;  2QE3 A;  5E8A A;  4YVW A;  4DUX A;  1AZD A;  3AMH A;  3TWI A;  4NHY A;  2P3I A;  2WA3 A;  2FD8 A;  2IC1 A;  1X8E A;  1K5M C;  4IE0 A;  2ZGL A;  1T2X A;  3DEC A;  4HK8 A;  4N53 B;  4BQ1 A;  3CKH A;  2VXR A;  1WBL A;  2A1X A;  2R06 1;  2VE1 A;  2VZS A;  2HYK A;  3HNY M;  3VBS B;  5FYT A;  1JZ7 A;  2JG8 B;  1O7F A;  2PLV 1;  1FXZ A;  4LUL A;  1WLC A;  4Y1V A;  3I2G A;  3P6B A;  2I74 A;  4YFW A;  3ZKY A;  5FCC A;  3ZPO A;  1C1F A;  1CIW A;  1TQ5 A;  1NG0 A;  1IQD C;  1XU1 A;  3ZFF B;  3I2K A;  2IVJ A;  1UY2 A;  4I02 A;  5KC6 A;  1NKG A;  1JZ6 A;  4BPZ A;  1GIC A;  1Z7S 3;  1DG6 A;  2ZX3 A;  4XTP A;  3H3Z A;  5DZE A;  4QU2 A;  1H4H A;  1KFU L;  3WG1 A;  1CWP A;  2HWB 1;  5JOX A;  5JSO A;  3ZYF A;  1AHS A;  1QJX 2;  1SQ4 A;  2VQT A;  3L2H A;  1ENS A;  1SCR A;  5IW0 A;  1RUC 1;  1YJL A;  4M3C A;  4PQQ A;  4QD2 A;  3MV0 1;  4C91 A;  1H1A A;  1PM7 A;  2BTV C;  2WFF 2;  3ALQ A;  4CXX A;  4OZX A;  3VD4 A;  2WNV C;  1KDM A;  3IT8 A;  3MHZ A;  5EHD A;  1F4H A;  1RVF 3;  2ADD A;  1KQR A;  4KI5 M;  3H1M A;  2RS5 3;  1SZB A;  3BCW A;  3KV4 A;  5LAT A;  3FUO A;  2J1V A;  1HQN A;  5IJR A;  5JUV A;  2VZO A;  2VMI A;  1UW8 A;  3BTZ A;  4HVR A;  4HKW A;  4S2F A;  1AYM 1;  1HXS 2;  3NJV A;  4D94 A;  2EID A;  2BP6 A;  2VZ1 A;  4R4Z A;  1KRI A;  1REE A;  3E5U A;  4ZXE A;  3USS A;  4HZF A;  1OC1 A;  2ZA9 A;  1DLL A;  5FLH A;  5F9T A;  1VMJ A;  1VRH 2;  1W8T A;  1CGP A;  3BIW E;  1IHM A;  2W5F A;  3NJZ A;  5G05 L;  4BQ4 A;  3ZXK A;  4HN1 A;  2HWC 2;  1SAC A;  3POE A;  1SFY A;  2A71 A;  4KWJ A;  4XHB A;  1YEW A;  2W94 A;  3FHA A;  4KMQ A;  4BME A;  1COV 1;  1SCS A;  4GMP 1;  4SBV A;  2OXB A;  4MXV A;  4B1M A;  1G9B A;  4L92 A;  4MO3 M;  5AVP A;  5FXZ A;  2YBS A;  3SIS A;  2XVK A;  4QHZ A;  1WW5 A;  2DCT A;  5IAX A;  3C7H A;  1SLT A;  1RUF 1;  1U0A A;  2ARA A;  2RS1 3;  3OF1 A;  5CIR A;  2LRO A;  3WNM A;  1W05 A;  4CU9 A;  1Y4W A;  4NWV A;  4OI4 A;  4XAB A;  2UUR A;  4CU8 A;  2Q8D A;  1FMD 1;  4GA9 A;  5E6H A;  3UKV A;  1PGW 2;  2QJV A;  4UXA A;  3MF6 A;  1LOD A;  2B9V A;  1HRI 3;  2CSG A;  5JSR A;  3VB9 A;  3W9A A;  4RQP C;  1SFP A;  1RHI 2;  4IEW A;  1CPM A;  2JE7 A;  3W58 A;  3WD5 A;  2J1A A;  1ND2 A;  4UW3 A;  2BNM A;  4XIO A;  3ZOI A;  4LHS A;  4E2S A;  4JCK A;  1QDC A;  3WQ1 A;  5FUP A;  2V09 A;  3BIE A;  3T1M A;  4URA A;  2WSV A;  2BZD A;  1HIX A;  3AFG A;  3KCY A;  1DGL A;  3P3P A;  2ZEW A;  4IE5 A;  4Q4Y 2;  3WP5 A;  1GNY A;  1O4Z A;  1ENR A;  4I3G A;  5FKC A;  3MLL A;  1RUI 2;  2DVD A;  3CO2 A;  5FYY A;  3HIF A;  5T5P A;  3TAY A;  4XJA A;  5L9B A;  1H4G A;  1RUE 2;  1T6B X;  5FZ0 A;  2J1E A;  1GZW A;  1MEC 1;  4YPJ A;  2YC0 A;  4GWN A;  2AUY A;  4LKD A;  1JN2 P;  1ZBA 2;  4AFA A;  3WVJ A;  2X29 A;  2VCB A;  2PHL A;  2JDZ A;  4WVZ A;  5GM0 A;  2XJP A;  5FO8 B;  1UYY A;  2WNU C;  3DCQ A;  4IV1 A;  2EIB A;  4PHZ A;  2X10 A;  5DUX A;  4ZPI A;  3UYJ A;  3UNP A;  1Q5O A;  3C7O A;  2R7E B;  4IUG A;  5TSW A;  3PUR A;  5K9Y A;  4IEO A;  4V2W A;  2BER A;  2YPD A;  1M4W A;  4FAH A;  4YZ2 A;  3D8C A;  3OBZ A;  1LTE A;  3KLS A;  2H6B A;  4CDU A;  5IVE A;  4RHV 3;  4CU7 A;  3WY6 A;  1HRV 3;  1AR6 3;  1ULP A;  5LRR A;  3U11 A;  4W6Y A;  5C8W A;  3WQ7 A;  2Q5T A;  5HV0 A;  1EV1 2;  1GP5 A;  2JKB A;  4AFB A;  4AGG A;  5B2G B;  1BEV 2;  4BQW A;  3E6C C;  4CE8 A;  3WSO A;  5CFD C;  2R1D A;  1ZRD A;  2LRP A;  4OVE A;  2VNO A;  4E2G A;  1QJE A;  2J1S A;  2W1S A;  2QQU A;  3JBG 1;  3LQC A;  5HXV A;  3VBU C;  1JS9 A;  1XC6 A;  2W1U A;  3B69 A;  4IV1 B;  4RS5 A;  4BB3 A;  1UCX A;  3TN9 3;  4BDV B;  2RM2 1;  4ZS3 A;  1H2K A;  2W46 A;  2GH8 A;  1UD1 A;  1LOB A;  2CYF A;  4XFG A;  1R64 A;  1A8D A;  1IS4 A;  1UXX X;  1A8M A;  4CDU B;  2WT2 A;  1LGC A;  1WKY A;  3FZ3 A;  1UY3 A;  3VD7 A;  5LW9 A;  4X6R B;  4NPL A;  5FYM A;  4RGK A;  3IIA A;  2DVA A;  5IVJ A;  3PJQ A;  3ZIX A;  2PA7 A;  2PHU A;  1CZS A;  3OG2 A;  1AR9 1;  4QDS A;  1EY2 A;  1YC6 1;  3U07 A;  1JBC A;  3AX4 A;  4OYU A;  5CFD B;  2XWJ B;  2EA7 A;  4P9G A;  4M00 A;  1SDD B;  1FI2 A;  1QOS A;  1SHW B;  3VBH A;  3VKL A;  4A6S A;  5F1R A;  2VUJ A;  2OUJ A;  1W6P B;  3ZR6 A;  1OOP B;  5JXH A;  1VBC 2;  1WD3 A;  3S5Q A;  4C0B A;  2VOT A;  4UYB A;  3NNF A;  2WLP A;  1RMU 1;  2TBV A;  1W2U A;  2AR6 A;  3U4S A;  4P9L A;  5KHG A;  4PLN A;  4BQY A;  1LOF A;  1QH7 A;  4Y5S A;  5AFB A;  5HCH A;  1WCK A;  1GNZ A;  4DRR A;  3CJI C;  4IER A;  5GZD A;  1I5Z A;  4OHY A;  1TE1 B;  2HEW F;  2Q8C A;  3LPF A;  1YIF A;  2DWR A;  1HV1 A;  1IG3 A;  2CAV A;  2DTW A;  4CP2 A;  1DQ2 A;  2MEV 2;  3CU7 A;  2JKX A;  2JDH A;  3WX5 A;  1PGL 1;  4P9X A;  4LBL A;  2FDI A;  2WC2 A;  2JEN A;  4Q0Q A;  4LLO A;  2DCK A;  2P2K A;  1FOD 2;  2HWF 2;  4Y20 B;  1VMH A;  2P4E A;  4PF1 A;  4WM8 A;  5FYI A;  5AC9 3;  4Z2A A;  3IZO A;  4OMD A;  1OHF A;  2JDA A;  2ZXQ A;  5JPN B;  2P3J A;  3CDZ B;  5FK7 A;  1C3H A;  2WUH A;  1QIQ A;  3B02 A;  3O5S A;  4TXW A;  5FRA A;  2F4L A;  3S7I A;  4UFJ A;  1BCX A;  3WNX A;  4UFL A;  2Y6L A;  4Q4W 3;  4C8D A;  3CF6 E;  2D98 A;  2A3X A;  5JIU A;  3L9J T;  2FMD A;  2WZE A;  4FT8 A;  5EZW A;  1CD3 G;  3GM8 A;  4ISQ A;  2TEP A;  5L7O B;  4J1W A;  3EHK A;  1KXG A;  3IB3 A;  3U75 A;  3FE5 A;  3WDT A;  3U78 A;  1BBT 1;  4UAP A;  2CWS A;  4G9S B;  1W2T A;  1AL0 G;  2BNO A;  4FFG A;  4RFR B;  3ZMO A;  1CES A;  4UF0 A;  2QQL A;  4WM8 B;  5A1L A;  4D8M A;  2VOX A;  4GH4 A;  1C8M 1;  3EMR A;  4NHL A;  3SEE A;  4NRM A;  1GSL A;  3RYK A;  3U1X A;  4N43 C;  3UGG A;  1JHJ A;  4XIL A;  3ZYP A;  5I0R A;  5LWB A;  2R1B A;  1HW5 A;  4RGA A;  5B4X A;  2KA3 A;  2IXI A;  5H9R A;  4F8A A;  1CPN A;  3LWC A;  1UYP A;  2IXK A;  3KV9 A;  2QQJ A;  4FSJ A;  1QQP 1;  2ENR A;  3JUU A;  5FY1 A;  2E53 A;  4DXS A;  2VM9 A;  2W68 A;  2E7Q A;  2HWE 3;  1UL9 A;  4R4X A;  3VZM A;  3WNL A;  5FP4 A;  4AR2 A;  3QH6 A;  2A6X A;  2JDY A;  2D3R A;  3RMY A;  5C8C A;  1DF0 A;  1V6L A;  2JG9 A;  5FUN A;  2Q1M A;  4XDP A;  1ZZC A;  4XMA A;  3SMH A;  2G9F A;  4Q4X 1;  4OI1 A;  3I2I A;  3T4H B;  4MYE A;  4DZG A;  3GBW A;  3OYW B;  1X7N A;  4COV A;  2RR1 1;  4WM7 A;  3WNK A;  1UMI A;  1ENQ A;  1ZRI A;  3MEP A;  2JJ6 A;  2XVG A;  1PO2 2;  3USU B;  1RHI 3;  5CFC B;  3U4X A;  2VCA A;  4YM2 A;  4XHX A;  4HON A;  3LE0 A;  3AMN A;  4GAL A;  2WZR 3;  2VZV A;  1APN A;  2NMO A;  4GH4 B;  4KGQ A;  3TEZ A;  1XE7 A;  3WDU A;  1GWM A;  4X8P A;  3I3D A;  2R04 2;  3AXD A;  3N3H A;  2RS3 3;  1MS1 A;  1H9W A;  1GAN A;  3FLR A;  5C3P A;  1ZZ8 A;  2I2S A;  3VDD C;  1OVP A;  2NMN A;  1J1T A;  1DQ4 A;  1MZE A;  1Y43 B;  2QTW B;  1FV2 A;  2Z69 A;  5KHJ A;  5A7P A;  4LBQ A;  1NE6 A;  5CG8 A;  1IPJ A;  2W3J A;  4AED C;  4O65 A;  1ZBA 3;  5FZ4 A;  3RJ2 X;  2WS9 2;  5C8C B;  1POV 1;  3WEZ A;  4YM0 A;  1GQG A;  2OZJ A;  1XYN A;  2IXC A;  3K4Z A;  3SCF A;  4WM7 B;  2N7G A;  4ISR A;  4XCA A;  4YG3 A;  2G9Z A;  4Q2F A;  5I8Y A;  1OSG A;  1GWL A;  2PN5 A;  3ZFE A;  3P5B A;  4LEJ A;  2KM2 A;  1OT5 A;  1CAX B;  3WIN E;  4W8J A;  4FFH A;  5GLZ A;  2ERF A;  1AR8 1;  4IEP A;  2ZGS A;  4FP2 A;  2J1T A;  2YHJ A;  4NIH A;  1YHF A;  1RUG 3;  3KGZ A;  3NNM A;  4IV3 C;  3LEG A;  4YWA A;  2HWD 1;  1S0G A;  3V64 A;  4CEW A;  3WP4 A;  1TME 2;  2VMF A;  4AED B;  4CDW B;  4PDW C;  2D5H A;  5FZ9 A;  2O0O A;  1AXY A;  1GOF A;  5JOY A;  2DU0 A;  3ILF A;  3FX3 A;  4M01 A;  5APA A;  2VL4 A;  2GC0 A;  1A34 A;  2FCV A;  2XL7 A;  4YZ3 A;  3VZK A;  1YCI A;  5I91 A;  4Y5Z 0;  5C4W A;  2XLA A;  1EAH 1;  4H55 A;  4DIQ A;  4NWW A;  4EJR A;  5A3O A;  2XML A;  3A0K A;  3VKM A;  2XOM A;  1PK6 B;  2OW4 A;  2O1Q A;  2ZHL A;  4BHP A;  1H8T A;  4MZU A;  4FOW A;  4AFD A;  4QKF A;  5D2A A;  2AEY A;  1RGS A;  3Q8A A;  3K51 A;  5C70 A;  3MFC A;  5LK5 A;  2B46 X;  1MAC A;  5F5C A;  4LBM A;  4FPH A;  5A7S A;  4LO8 A;  3W20 A;  4IND A;  3DN7 A;  2Y64 A;  3OTF A;  3FMG A;  1VJ2 A;  3WF0 A;  4HPK A;  4CEW B;  1X82 A;  2JDP A;  3DPR C;  3CZJ A;  2GMP A;  4PDW B;  1ASJ 2;  3VLB B;  1GYK A;  4QPY A;  3MIE A;  2WDB A;  3R0R A;  2GAU A;  1XSR A;  2TUN A;  2Y8K A;  3AKP A;  5D1I A;  4CDQ C;  5JPM B;  2W39 A;  3KF3 A;  3K4A A;  3HWJ A;  5M0T A;  1VBC 3;  5FY4 A;  5BNQ A;  1W06 A;  1FPN 2;  5F6K A;  3BOW A;  3VBF B;  5BNP A;  5KR7 A;  1O5L A;  4KGG A;  1E57 A;  1L7R A;  5L19 A;  1O6U A;  4Q4V 2;  4NRO A;  5A32 A;  2J1R A;  3WP3 A;  4IEX A;  4DXT A;  3MW2 A;  5FWJ A;  2RVA A;  1Q8Q A;  3O0V A;  3ZO0 B;  1AR7 3;  2DF7 A;  2VAU A;  1J3P A;  2VTX J;  1PO1 2;  2BBA A;  2BGP A;  4AFM A;  2K2S A;  2EF6 A;  2VVF A;  3HOB A;  4FOY A;  5CEH A;  1AUY A;  1VAK A;  1CJD A;  1OFS A;  5I0U A;  2OA2 A;  2V72 A;  4YM3 A;  4R9B A;  4KBB A;  3PUA A;  4Q0P A;  4QPG A;  5A3L A;  2VY0 A;  1LU2 A;  5FYC A;  5J09 A;  2ZPX A;  3I2J A;  2W08 A;  3T0B A;  5LA2 A;  2NN8 A;  1PVC 2;  1YLL A;  2BYV E;  1F9K A;  1ZNP A;  3E6B A;  3IDC B;  2BV4 A;  3KV5 A;  1RUH 1;  2WNE A;  5D8A B;  4CU6 A;  3OPT A;  5DAP A;  2D6L X;  5ACA 3;  1H8V A;  4CCN A;  1OLM E;  3RNS A;  1L7L A;  2RDQ A;  2V5Y A;  2WWJ A;  4BWO A;  2WNO A;  1J3Q A;  1U5Y A;  2PHF A;  4CCL A;  4JGY B;  5A32 B;  3AVR A;  3NAP A;  1STM A;  1HQL A;  3NMB A;  3RFR A;  3Q8B A;  4LIT A;  3H8O A;  4K8R B;  1BZW A;  2VZU A;  2AH2 A;  2HKX A;  5ISL A;  1GR3 A;  1DGW X;  1MZ6 A;  2SBA A;  1VBE 3;  4QXB A;  5AFE A;  3V0B A;  3F2Z A;  4AQS A;  1AYN 3;  2ZGK A;  3VBR C;  3N36 A;  1QWR A;  1Z7S 2;  2FZ2 A;  2D93 A;  3OB8 A;  4HAN A;  5A3M A;  4V2V A;  2FDG A;  5CIS A;  4C1W A;  5BNO C;  1WW4 A;  4C1X A;  1H6Y A;  3ZXA C;  1W03 A;  1S0E A;  2ZX2 A;  4LKE A;  3MIC A;  1NCR C;  3C2U A;  1KD7 A;  4XAE A;  5DUW A;  2BNN A;  5CKQ A;  2NM1 A;  2JB8 A;  5FZO A;  1DQ5 A;  1GU3 A;  2ZMK A;  3JD7 2;  2XLG A;  2W47 A;  3PDQ A;  1Q8O A;  1ENX A;  4JRA A;  2OKX A;  4K3U A;  1VAM A;  3DKQ A;  4BOW A;  1RVF 2;  1PHM A;  5FZD A;  4ZZ5 A;  3WDV A;  1AJK A;  4M0H A;  2UYB A;  1G9C A;  1VBA 2;  2ZGR A;  1UY1 A;  4OI2 A;  3OPW A;  1XYO A;  2ZGT A;  3UKN A;  1OLM A;  3OGG A;  3NWK A;  4DNY A;  3BB6 A;  2ID4 A;  5JR2 A;  4BIO A;  5C5U A;  1W8U A;  1LGB A;  1R08 1;  5GZE A;  3J4U H;  3V0B B;  4M0N A;  1N1T A;  2HYX A;  1WZX A;  3WW3 A;  2CAU A;  2VZT A;  5T5O A;  2ZS6 B;  1LAJ A;  4X8N A;  5FPB A;  3BTX A;  3RZK A;  2PAM A;  1QOT A;  1R09 1;  2VZQ A;  1PO2 3;  2DDU A;  1QJZ A;  2R0H A;  3N7K A;  5FZ7 A;  2A7A A;  4Z8B A;  3GAL A;  4Y1X A;  2UY8 A;  3WCR A;  3U0Z A;  3HN1 A;  1W9T A;  3IAQ A;  1GUI A;  5EQU A;  4XF1 A;  3B94 A;  5A70 A;  1WCS A;  3KCC A;  4OMC A;  4L0P A;  2FCT A;  4SLI A;  2IVI B;  2X5I C;  4YVS A;  3C8X A;  1W04 A;  4GB3 1;  1WWY A;  1ZX5 A;  3KSC A;  3OBR A;  3AP7 A;  4YW4 A;  4ZU4 A;  4NO4 A;  2RS1 2;  1HN1 A;  3ZN6 A;  2XVL A;  4AZZ A;  2XR4 A;  1YNA A;  3CNA A;  4XC9 A;  1D2S A;  3HT1 A;  1QH6 A;  2VR4 A;  3AJZ A;  4N9I A;  5FQ0 B;  4JGZ C;  3FL7 A;  5FPX A;  1ZBE 1;  2WAO A;  3IAP A;  3VBO C;  3AL6 A;  2XJR A;  5GLU A;  1V9U 1;  4RR3 A;  2EAK A;  3AZW A;  1XSQ A;  4FO9 A;  1PZ8 A;  1HX6 A;  3D6E A;  2Y6F A;  2UWC A;  4LQR A;  1LUL A;  3UGH A;  5A7W A;  2W9X A;  5FXW A;  1GFF 2;  4FPC A;  5FIX A;  1Q56 A;  3DYP A;  3SKJ E;  2R32 A;  3NO8 A;  4Y3O A;  1C5H A;  3BGA A;  2X09 A;  1NCQ C;  4XFA A;  2GSY A;  1TME 3;  5EYX A;  2A6V A;  3A21 A;  1LHW A;  3WW2 A;  4JRL A;  2P6C A;  5LBE A;  3NW4 A;  4QT6 A;  1XBF A;  5KHH A;  3AL5 A;  4JGZ B;  1KJL A;  3GBF A;  2EXI A;  2GAL A;  3S7E A;  4H14 A;  4M4P A;  3O0X A;  2WJS A;  1X50 A;  4YW1 A;  4RR3 B;  4NRP A;  3SLI A;  3I49 A;  5ABJ B;  2LW8 A;  3B5L B;  1WA4 A;  1GQH A;  4HBN A;  4QPI A;  2YMZ A;  1XRU A;  1IS5 A;  5FUI A;  1G9D A;  1CX4 A;  2B5H A;  4OUS A;  4RHV 2;  5CYY A;  3VKF C;  4LHK A;  4EZ4 A;  1AR6 2;  4GJZ A;  3FBY A;  2VUD A;  2XQX A;  2VD7 A;  3KM5 A;  3RQ0 A;  1E5S A;  1QGL A;  3OEB A;  1AL2 1;  2PLV 2;  3ZVX A;  4ERO A;  3LA7 A;  4EV0 A;  5JZG C;  3R4S A;  1BYH A;  1ASJ 3;  4L99 A;  2LM3 A;  1MR5 A;  5A3U A;  4JDN A;  4AI3 A;  2ZHM A;  2VZP A;  2W1Q A;  3D3A A;  3ZFG C;  3S57 A;  2P3K A;  4QM8 A;  5FZE A;  1KIT A;  2DFC A;  4TZD A;  4N53 A;  1ND3 C;  3GZT B;  2ZX1 A;  3TEX A;  5A3N A;  1RIN A;  3I59 B;  4N7I A;  3I4I A;  2VJX A;  2WA4 A;  3K77 A;  4W4Z A;  3VKO A;  4E4S A;  1AX0 A;  2V5D A;  3ST7 A;  2ZZQ A;  5CAD A;  2HWB 2;  1S0I A;  4FFF A;  1GZ9 A;  1WD4 A;  3VBS A;  5KHK A;  3OEA A;  4Q4V 3;  2JG8 A;  2XBO 3;  2JIC A;  3WNP A;  4E4D X;  5A7Q A;  4QPI B;  4L11 A;  3AKT A;  2FMY A;  4R9D A;  2OX0 A;  2P5B A;  3ABZ A;  1QJU 1;  4EQV A;  1OKO A;  3LIG A;  5FZI A;  1WW6 A;  1VRB A;  3TBD A;  1W28 A;  3ZDS A;  4L2N A;  3HAG A;  1LKN A;  2YG0 A;  5DAV A;  1UAI A;  4Z2W A;  3ZFG B;  3WHT A;  1DGW A;  1PVC 3;  5IAV A;  2BGO A;  1TMF 1;  4QM9 A;  3S0M A;  1AYM 2;  1NZC A;  2J1U A;  1K5M A;  1ND3 B;  2B4K A;  4Z07 A;  1BMV 1;  3LCP A;  5I0S A;  1FV3 A;  2VUC A;  4RN5 A;  2DU1 A;  1NZI A;  1AVB A;  4HKL A;  2JDU A;  1CAW A;  4J6G A;  4I09 A;  3IDB B;  4NAM A;  5C9A C;  2PAE A;  3LIH A;  2YGL A;  1QMJ A;  2B8M A;  4NPM A;  4COU A;  4UOJ A;  5IT6 A;  5C7G A;  2DFB A;  4ASL A;  4QQH A;  3EXU A;  1LOG A;  3NKT A;  1NA1 C;  1US3 A;  1SFN A;  4YVW C;  1JHN A;  3H3U A;  1SMV A;  4LE4 A;  3PIJ A;  4LIU A;  3ZSK A;  4AEM A;  2PQS A;  3ZYJ B;  4FTE A;  1COV 2;  1DYO A;  4P9I A;  1QXP A;  4UBH A;  4XUR A;  1JUI A;  1O59 A;  4CCD A;  4AYU A;  3KWV A;  3KQ4 B;  4YW5 A;  3KHB A;  3FHQ A;  4OFG A;  4MV2 A;  4R9C A;  4XQ4 A;  1RUD 3;  3VZO A;  3HQR A;  1K5M B;  1XOY A;  3J8F 1;  4BQX A;  2K9Z A;  2PHD A;  4NVP A;  3ZN4 A;  4YSF A;  2C1F A;  2VG9 A;  4ZU7 A;  3JD7 3;  4DFS A;  3WF1 A;  2WT1 A;  4GKX A;  3H8U A;  3GZA A;  1CAW B;  3KT4 A;  4D7S A;  4QGN A;  5C9A B;  4B4R A;  3VDA A;  2WFP A;  4CEY C;  5JLV A;  1VBA 3;  3GBG A;  4D69 A;  5IFP A;  5FZA A;  1RXF A;  2DUO A;  3C7G A;  2R07 3;  4Q4W 2;  4F7Z A;  3LSD A;  1U12 A;  2RDR A;  3VHP A;  3IBM A;  3NQH A;  4LBN A;  3WLU A;  3BAL A;  4NAO A;  4I01 A;  1G7Y A;  4IGP A;  1JYN A;  3RZG A;  4CCK A;  1Y7B A;  3W59 A;  4Q8K A;  1WCQ A;  1JW6 A;  1MEC 2;  2NPI A;  5FZC A;  5A1F A;  1UIK A;  1QJY 3;  2GU9 A;  4BCU A;  1NT0 A;  5FY8 A;  1J83 A;  4BM8 A;  1OPO A;  1QF3 A;  1S0D A;  3N9P A;  4UW6 A;  4B7K A;  1CVN A;  2RG4 A;  2YGM A;  2YXS A;  4GQ7 A;  1JZ5 A;  3RZJ A;  5CVR A;  2WNV B;  4WVW A;  4XFH A;  5KXE A;  1R1A 3;  1E5H A;  1GZC A;  4CEY B;  3RZL A;  4QPW A;  1OD3 A;  3I97 A;  2JEM A;  5BV6 A;  1UZY A;  1YQ8 A;  3VZL A;  2VXJ A;  1V6K A;  3O1V A;  2HWE 2;  4MET A;  4ZY9 A;  2LAL A;  1LEM A;  4CDX C;  4OLL A;  3LEK A;  4XQW A;  1VBB 1;  3QBQ A;  1DFQ A;  2A3Y A;  3EBR A;  3EB7 A;  1W90 A;  4W6X A;  4XOG A;  1ZZ9 A;  1BVP 1;  1JOB A;  5E89 A;  1NQD A;  2QZ2 A;  2UWB A;  1N47 A;  3GCW A;  2B9U A;  2HBT A;  4ZZ8 A;  2WZP P;  2A73 B;  2BVV A;  1LGN A;  4IW3 A;  3B9C A;  2R30 A;  1IGO A;  4O61 A;  3WUD A;  2VO5 A;  3O1P A;  2WZR 2;  4JX0 A;  4UFK A;  4LLF A;  1UF2 C;  2UWA A;  4XPV A;  5LY1 A;  3LA2 A;  2BDR A;  5LEJ A;  1QJX 1;  2RS3 2;  5FYV A;  3OUJ A;  4R8H A;  2B42 B;  3MIG A;  3M8L A;  1IOA A;  1LNS A;  4IES A;  2WFF 1;  1WLD A;  3HQX A;  5HI0 A;  4MGY E;  1WMX A;  4AEK A;  5LRS A;  1RB8 G;  4RSU A;  1NUK A;  2WO7 A;  3N9M A;  2BJS A;  1H1M A;  4AVV A;  5F37 A;  5HCA A;  2CNA A;  3W5M A;  2VW2 A;  4XF4 A;  3JXS A;  1HB4 A;  1K5J A;  1L3J A;  1ND2 C;  2OUH A;  3PUH A;  1ZA7 A;  4LK6 A;  1S0B A;  1W3V A;  1QDO A;  1LOC A;  4ITC A;  4RQP B;  1HXS 1;  1JU3 A;  4KU7 A;  5BY5 A;  1D7P M;  4XTM A;  1CR7 A;  1VLN A;  4CP9 B;  5FPZ A;  5FY0 A;  1LOA A;  5F6L B;  5FYH A;  1V6M A;  2IWG B;  3AB0 A;  3BU7 A;  3S30 A;  5A33 B;  2YU1 A;  2XGX A;  1HB3 A;  3TEW A;  4JZR A;  2GC1 A;  3III A;  1C5I A;  5CA6 A;  1OFN A;  1CZT A;  1VRH 1;  1RUJ 1;  2R06 3;  4PF5 A;  3ACG A;  3VKN A;  1UY0 A;  4JKM A;  1G86 A;  2VCM A;  3OD0 A;  3GJB A;  1OA3 A;  4AW7 A;  3PMS A;  1RMU 2;  4IQP A;  1RUG 2;  5DDJ 1;  2HWC 1;  4QB6 A;  4Y24 A;  2PLV 3;  1GP4 A;  5KXB A;  2EXJ A;  4QDQ A;  3MUY 1;  4CP1 A;  3H42 B;  4MOA A;  5CFD A;  2VOK A;  4TYS A;  4XJZ A;  4NUB A;  1O91 A;  3VBU A;  1DQ0 A;  2WNU B;  3PU8 A;  4XYX A;  3RYR A;  5EYY A;  1VB2 A;  3B3Q E;  5CG9 A;  1SBF A;  1J3R A;  1W6P A;  5IK7 A;  1F4A A;  1OOP A;  4XJU A;  1UZW A;  1PNF A;  2WQ8 A;  2HWB 3;  3ZXL A;  1PX4 A;  4BJ0 A;  1ACC A;  3LEI A;  3ZDV A;  2XJU A;  4AI9 A;  1J84 A;  1RUC 3;  2C9A A;  3D4K A;  5E1R A;  3RZM A;  1PGW 1;  1S2B A;  2O14 A;  1Y3T A;  4N8M A;  4WZF A;  4LIV A;  4XMI A;  1HDK A;  4AGR A;  3FJS A;  5FMO S;  1S2K A;  1PZ9 A;  2BRT A;  4GJY A;  1W0N A;  2VPV A;  2YZ4 A;  5F2S A;  1A3K A;  2BPA 2;  2CTV A;  1S0J A;  5FPL A;  3T09 A;  1D0H A;  3OUH A;  4KBZ A;  4BE3 A;  1S0C A;  4FP3 A;  1OLR A;  1LR5 A;  4OUE A;  4Q4Y 1;  3NL1 A;  5L73 A;  4AHY A;  2P1B A;  1RUI 1;  3I3Q A;  3VBU B;  4Y20 A;  1AYM 3;  3ZXE A;  1DDL A;  4Q5O A;  2GNM A;  2F17 A;  3IN9 A;  1RUE 1;  1W99 A;  3HT2 A;  4YYO A;  1F31 A;  3POI A;  1KDK A;  4A7Z A;  3RWN A;  5A6Q A;  4KG0 A;  1TNR A;  5FOB B;  2XHK A;  5EJ1 B;  1W8F A;  4ONU A;  1U5Z A;  3PIG A;  4AGV A;  1BK1 A;  3THT A;  2ET1 A;  3K4D A;  1AR7 2;  2XUM A;  2ZAC A;  4PIX A;  1C8M 2;  4AQ2 A;  1MS5 A;  4IE4 A;  3OPZ A;  1ZZ7 A;  3E97 A;  3BYW A;  3DXU A;  1COV 3;  1F5J A;  4GMP 3;  4A4A A;  5L7O A;  3AJY A;  1MQT C;  3KV6 A;  4YRD A;  3N35 A;  5KXC A;  4MH0 E;  3AMQ A;  1EUU A;  4HVO A;  2W87 A;  4AVB A;  4H7M A;  1RUF 3;  1VAL A;  5DG2 A;  2OVU A;  3WCS A;  1SDW A;  4NR1 A;  4JHT A;  1EV1 1;  4J25 A;  3F95 A;  2YBK A;  4OHZ A;  1X8M A;  4AXO A;  2ETE A;  4DIN B;  5ACA 2;  4Q4X 2;  1BEV 1;  1FMD 3;  2X05 A;  3K3N A;  3M3E A;  4U36 A;  2VU9 A;  2VTX A;  1BXH A;  3POY A;  5JMC A;  1LJ7 A;  1UWW A;  2J42 A;  3MV1 1;  4BYY A;  4FTS A;  1DYP A;  1TG7 A;  2G19 A;  3FLT A;  3CJI B;  4LA3 A;  3ACH A;  1HV0 A;  3DXT A;  2H0V A;  3B7M A;  4MXW B;  4Y26 A;  3ZSM A;  3KMH A;  5L9V A;  1VBE 2;  3ZIW A;  1PM4 A;  4RA0 A;  1HB2 A;  2YB7 A;  1AYN 2;  1US2 A;  3T2Q A;  1MQT B;  1B35 C;  2ZAA A;  1PX3 A;  3KQR A;  4E27 A;  3P1I A;  5K8S A;  5LAS A;  1R1Z A;  3OYW A;  2WBK A;  3WDW A;  1MEC 3;  3PJY A;  4Q27 A;  1OKQ A;  2P3Y A;  4PQ9 A;  3USU A;  5CFC A;  3MDP A;  2GNT A;  5FO9 B;  4HOO A;  4YLZ A;  4QWN A;  2FHR A;  3HBZ A;  4FQ4 A;  4CCM A;  4NHK A;  3E5Q A;  2GMM A;  1F15 A;  2X53 S;  4K9S A;  3IMN A;  4D6R A;  3CQO A;  4IEV A;  2VBD A;  4N43 A;  2VMC A;  1RJ8 A;  2P37 A;  5FZ6 A;  2VW1 A;  3WNN A;  5H9P A;  4DXR A;  1I6X A;  4COZ A;  1G8W A;  4Y4R A;  2PAK A;  5IFT A;  4A7Y A;  4YZ4 A;  1W0P A;  1LED A;  1REF A;  2EXH A;  4XBN A;  1CQ9 A;  5EIY B;  2CWM A;  5FP7 A;  5K0U C;  5F5I A;  4FFI A;  4UWD A;  1IKQ A;  1CAV A;  1FX5 A;  3J7N A;  1OLQ A;  3K48 A;  4MX3 A;  3M3C A;  4IGO A;  1GZT A;  4QXC A;  1FAY A;  3HVD A;  4CVU A;  3CLP A;  4GD4 A;  1DYK A;  1SEF A;  3I8T A;  2WL1 A;  4F83 A;  3Q8F A;  3B01 A;  3HNM A;  3PVN A;  2ZGO A;  4ORF A;  4CA9 A;  1XND A;  1H30 A;  3DYM A;  2ZGM A;  3I3E A;  3K75 B;  4D6S A;  3RZH A;  3INA A;  5FV3 A;  2K0G A;  5LA0 A;  1UXZ A;  3H8R A;  2BVB A;  4RL7 A;  2MEV 1;  1CAX A;  2ZX4 A;  3JBG 3;  4LKS A;  5IVC A;  4N43 B;  3ZR5 A;  3JB8 A;  5JAX A;  3H8X A;  1RJ7 A;  1V0A A;  2BQP A;  2RM2 3;  3AZV A;  3SH3 A;  3O14 A;  2VBB A;  1EAH 2;  1FOD 1;  1W2N A;  2HWF 1;  4QAW A;  4XUP A;  3AKS A;  3J7H A;  3RWK X;  3VDD A;  1G6N A;  2GND A;  5BYN A;  5K0U B;  2SLI A;  4HET A;  1IG0 A;  1N1V A;  3ZXJ A;  5HCB A;  1CAV B;  4AED A;  4JTO A;  1QOO A;  1Y9M A;  4FCA A;  4CDW A;  1ONA A;  5T5J A;  4B7E A;  4FPG A;  2RMU 1;  4PBO A;  2ZHN A;  3POB A;  1P8J A;  5LY2 A;  5F32 A;  3OUI A;  4P02 B;  1AXK A;  5CU1 A;  2D6N A;  2Q1F A;  3LDB A;  3OGV A;  3ZM8 A;  1M06 G;  3CBN A;  2A75 A;  5GLV A;  1S55 A;  3BN6 A;  5EJZ B;  5F39 A;  2J22 A;  1E5I A;  1E5R A;  4XF0 A;  2XHN A;  1AR9 3;  2C0Z A;  2XPJ A;  1OF3 A;  5FZ3 A;  4ZHN A;  1PK6 A;  3FUQ A;  1XU2 A;  3NV3 A;  1PMJ X;  4CCE A;  2CGP A;  1SPP B;  3K3O A;  5E88 A;  5FBZ A;  4QHB A;  2CDO A;  4PIZ A;  4Q8L A;  1D2Q A;  2GP3 A;  2VQ0 A;  1D4M 1;  4YW2 A;  5FMO L;  1DGR A;  3VDD B;  4HG6 B;  4IV3 A;  1RMU 3;  4BZ4 A;  2VMD A;  2Q8E A;  2W1W A;  5DG1 A;  1XE8 A;  4PDW A;  4BK5 A;  4YM1 A;  4YW3 A;  1F2N A;  1H1I A;  5DUU A;  4BK4 A;  5GZG A;  1LU1 A;  4XDQ A;  1I5P A;  3CJX A;  1UOG A;  2BW8 A;  4COY A;  5BNN C;  3LKJ A;  4Q0S A;  3M4F A;  4QGL A;  3WG4 A;  5IVY A;  4BQ2 A;  3VBF A;  1OUR A;  3B93 A;  1JU4 A;  4I3P A;  1URX A;  2D7F A;  3AP9 A;  3KS7 A;  2Y6J A;  3NNL A;  4AVT A;  1RUH 2;  3AFK A;  1A6C A;  1UKG A;  3AM2 A;  4AE2 A;  3DEM A;  3AC0 A;  3AVS A;  4YW7 A;  4K1Z A;  5DAB A;  4XXA A;  1SLI A;  1C4R A;  2JEC A;  4IV3 B;  2XUE A;  1ZRR A;  5C3O A;  2XLF A;  3KF5 A;  4NIA A;  3DPR A;  3PHM A;  5KBF A;  1W8H A;  1H2N A;  4KL1 A;  4RFT 0;  3RRD A;  5FXX A;  1XQN A;  2R04 1;  1UPI A;  3DF0 A;  1AJO A;  1DQ1 A;  3ENR A;  4HKO A;  3TNP B;  3SIT A;  4EZH A;  5D8A A;  2W95 A;  2IZW A;  1UOB A;  1XNC A;  3M70 A;  4L9B A;  2JD9 A;  5BNN B;  3JQW A;  1GV9 A;  1S2E A;  4MGZ E;  3T0D A;  1W0O A;  4L97 A;  2WS9 1;  3NKG A;  1CN1 A;  1RED A;  1BBT 3;  2QVS B;  4LHN A;  4Y1U A;  2BEO A;  1I3H A;  2Y0O A;  4JGY A;  4QQ2 A;  2XBO 2;  3PNA A;  4R9A A;  3SNM A;  2DCY A;  4AQT A;  1DP0 A;  2DVB A;  2XB6 C;  1FYU A;  5F7U A;  1C8M 3;  3A4U A;  3ZSJ A;  4B4P A;  3AMM A;  4E9K A;  3OSD A;  4GKY A;  5A7N A;  2OPK A;  4D3W A;  5L36 A;  5FTT C;  4FTB A;  5BPX A;  4ASM B;  3T4V A;  4QDR A;  5F3E A;  3NVC A;  1CIY A;  1XNB A;  3DPR B;  2G1M A;  4B29 A;  1QQP 3;  3GXU A;  4IEZ A;  4R52 A;  5AC9 2;  1O3T A;  2FBE A;  4BIF A;  2R6Q A;  3RYP A;  2AYH A;  4CDQ B;  3WOG A;  4DY5 A;  3FN9 A;  3RGB A;  2ARB A;  1XE0 A;  1IS6 A;  1GBG A;  1NXM A;  2RHP A;  3I2H A;  3MLK A;  3K2O A;  1HJG A;  1FAT A;  4QX7 A;  2CL2 A;  4Q4X 3;  3D82 A;  1LCL A;  3OJB A;  3T30 A;  1V70 A;  3N9N A;  4YGE A;  3ZLI A;  4QKB A;  2RR1 3;  3QCW A;  4GXL A;  4IL7 A;  1W2A X;  2X8K A;  4B3N A;  3MPP G;  2YUE A;  3G6J B;  4E2Q A;  3AKQ A;  4NPR A;  1WLT A;  1ZA4 A;  2ARE A;  1QKQ A;  2V4A A;  1Z0H A;  3HJR A;  3N9O A;  4QPG C;  3AMP A;  5DAW A;  3LD8 A;  5C33 A;  5FPV A;  3FBM A;  2XWB B;  3VBR A;  5FLI A;  5F2W A;  3N7M A;  3PME A;  3O1R A;  4UW4 A;  2PEL A;  2ORX A;  4AF9 A;  5BNO A;  4EN7 B;  3NRU A;  2DUP A;  2NLR A;  4F3J A;  2DUR A;  5H9S A;  3ACL A;  3WZ1 A;  3JU9 A;  4NHM A;  5D21 A;  5FZL A;  2GC3 A;  1RUD 2;  3WF2 A;  4LA2 A;  5DZG A;  3LFM A;  1W6O B;  5EFU A;  1POV 3;  3VL8 A;  3NAP C;  4PI0 A;  1RTV A;  5GZF A;  1KS5 A;  4AAX A;  2IFW A;  3JCI A;  2D6M A;  3HNB M;  5FP9 A;  3OY8 B;  1W6M B;  2DVG A;  4YFZ A;  4IE6 A;  2Q4S A;  5JMO A;  3DGT A;  1N1S A;  1W8W A;  3KVA A;  4A3X A;  5HPO A;  1UKR A;  3HN3 A;  1V9U 2;  4XBQ A;  1PIV 1;  2FCU A;  1BKZ A;  1AXZ A;  3JQX A;  4XZP A;  1WMF A;  1JYV A;  2C9K A;  2EAL A;  2R07 2;  1UIJ A;  3QOP A;  1FPN 1;  2W52 A;  2GZW A;  1Y9G A;  1YQC A;  3LDR A;  3VBR B;  1AR8 3;  2QQK A;  4XAC A;  3LGR A;  5CB7 A;  3ETQ A;  2KXL A;  3BUC A;  3E5X A;  5FQ0 A;  4JV4 A;  1VBD 1;  5BNO B;  2VNG A;  4WVV A;  3URF A;  1PO1 1;  4UFH A;  2HWD 3;  4Q29 A;  1YUD A;  2VOW A;  1RL3 A;  2XG3 A;  5EXO A;  1QJY 2;  3LOB A;  1K12 A;  4XW3 A;  1RYY A;  4Y22 B;  5GJ6 A;  4CCJ A;  5C3S A;  2E26 A;  1NCR B;  2A5Z A;  3WDY A;  2R16 A;  4AI1 A;  1VR3 A;  2EXK A;  3K46 A;  2JD4 A;  3ZYI B;  1O3S A;  3PUS A;  4QKN A;  3T08 A;  1R1A 2;  2IXH A;  3VN4 A;  3WV6 A;  3UT0 A;  1EAH 3;  4CTE A;  4UFM A;  2BOI A;  3LPG A;  2B45 X;  2FQP A;  4YG0 A;  3WG3 A;  3LSE A;  4NID A;  2LUW A;  3HPN A;  2IXJ A;  1QU0 A;  4EN6 B;  3KB5 A;  4FOV A;  4JQR A;  1CX1 A;  1A78 A;  4LKF A;  2A6Y A;  4QXH A;  2JE8 A;  4KQ7 A;  1YRZ A;  3VV1 A;  2VBP A;  5FJH A;  3T0A A;  4TLG A;  1EPZ A;  4JGZ A;  4MGI E;  1OQ1 A;  1N3P A;  4TLF A;  2ZCW A;  2CY6 A;  1RUN A;  1AL2 2;  2GN7 A;  3GHM A;  4LXL A;  3FHI B;  4FPJ A;  2XQR A;  3MLJ A;  1Q3E A;  3ZSL A;  1Z7S 1;  2Q8O A;  5ABJ A;  4NHX A;  1UU4 A;  5HCF A;  2ZHK A;  1JZ3 A;  1O3R A;  1J1L A;  2PXJ A;  2GDF A;  4ARY A;  5KC5 A;  1BVV A;  4MSV A;  1YI9 A;  4PI2 A;  4M3C F;  5FY7 A;  1W6Q B;  2X5I B;  1CAU B;  2BWA A;  4V1P A; 
#chains in the Genus database with same CATH homology
 1J83 A;  4JHZ A;  1JZ5 A;  3VDB A;  2JKX A;  4GWI A;  2QQM A;  2DCK A;  2YFZ A;  4PF1 A;  4QPW A;  1OD3 A;  3I97 A;  4Z2A A;  4OMD A;  2JDA A;  2ZXQ A;  3OGR A;  4ZY9 A;  3CDZ B;  2Z4F A;  3LEK A;  2WUH A;  4AG4 A;  3EB7 A;  4TXW A;  2Y6H A;  1UX7 A;  2Y6L A;  2WZ8 A;  3A7Q A;  4XVH A;  3GGL A;  2WZE A;  2VO5 A;  3GM8 A;  4JX0 A;  5DPN A;  4P00 B;  1W9W A;  3IB3 A;  1O8S A;  4UAP A;  2QQO A;  3E1F 1;  2W92 A;  3GDB A;  2QQL A;  3UES A;  4XUQ A;  1LNS A;  4D8M A;  3SEE A;  1JHJ A;  1PMH X;  3A22 A;  1NUK A;  2WO2 A;  3A23 A;  5B4X A;  3W5M A;  3JXS A;  2QQJ A;  3PUH A;  4BXS V;  4DXS A;  2VM9 A;  3WNL A;  5JXG A;  1JI6 A;  1JU3 A;  1D7P M;  5C71 A;  1OH4 A;  3VD5 A;  3I2I A;  1XPW A;  1MPX A;  3III A;  3WNK A;  1UMI A;  1CZT A;  4P5Y A;  3ACG A;  1UY0 A;  2VCA A;  1XNT A;  4JKM A;  3OBA A;  3LE0 A;  4MAD A;  2VZV A;  3C7F A;  4QB6 A;  2VME A;  4QDQ A;  4UI9 L;  1ULO A;  3MUY 1;  5DN2 A;  1W8O A;  3WF3 A;  4MOA A;  3I3D A;  1JZ4 A;  1K42 A;  5JXJ A;  3C7E A;  1F4A A;  3VD3 A;  2ZEX A;  2W3J A;  2WQ8 A;  3OGS A;  4OZO A;  1PX4 A;  4BJ0 A;  3LEI A;  2WYS A;  4M4R A;  3HEI A;  2L9L A;  1J84 A;  3WEZ A;  3W5N A;  3K4Z A;  3T2O A;  1W0N A;  2J7M A;  3T09 A;  1OT5 A;  2W91 A;  4W8J A;  4CUB A;  5I0D A;  4XUO A;  4OUE A;  2QBX A;  5DQ0 A;  2J1T A;  1DLC A;  3T2P A;  1W99 A;  3LEG A;  4DUV A;  2VMF A;  2Y6G A;  5LA1 A;  1GOG A;  3MBW A;  5EJ1 B;  1GOF A;  2QQN A;  3I2F A;  4QX1 A;  4DUW A;  2VL4 A;  4CUC A;  3K4D A;  1JYW A;  2EIC A;  5JXI A;  2WO1 A;  2VZ3 A;  5HXM A;  4QX0 A;  2XOM A;  2WAA A;  4A4A A;  3ECQ A;  4PT6 A;  4QB1 A;  3EYP A;  1YQ2 A;  1EUU A;  2W87 A;  2ZEZ A;  5C70 A;  4QX2 A;  4E8D A;  2QQI A;  3NJX A;  2Y64 A;  4XUT A;  3WF0 A;  3CZU A;  1GQP A;  3CZJ A;  2X05 A;  2WDB A;  2Y8K A;  1UWW A;  3I3B A;  3MV1 1;  1EUT A;  3K4A A;  1TG7 A;  4A3Z A;  1CZV A;  3SEP A;  1KEX A;  3ACH A;  3VDC A;  5IHR A;  2YFU A;  4E8C A;  3VD9 A;  4GZ9 A;  1K3I A;  1L7R A;  2YB7 A;  1US2 A;  4TTG A;  3T2Q A;  2J1R A;  2DCJ A;  4DXT A;  2VC9 A;  1PX3 A;  2RVA A;  3P1I A;  2WBK A;  2BBA A;  3WNO A;  2BGP A;  1OF4 A;  3HOB A;  2WAB A;  5J1X A;  2V72 A;  3CQO A;  2VMC A;  3WNN A;  3PUI A;  4DXR A;  1NAE A;  2VZR A;  1KGY A;  1UYZ A;  3I2J A;  5LA2 A;  3T0B A;  5IFT A;  4FI9 A;  1K45 A;  4CU6 A;  5EIY B;  2WN2 A;  1GOH A;  4DEQ A;  4A6O A;  1W8N A;  5B4N A;  4CVU A;  3WF4 A;  3HNM A;  4P08 A;  2VZU A;  3DYO A;  1BHG A;  4D0Q A;  5LCW L;  3DYM A;  3I3E A;  3K75 B;  5DMY A;  2EIE A;  2Y6K A;  1UXZ A;  5LA0 A;  1JZ8 A;  3F2Z A;  3MUZ 1;  3ACF A;  1UY4 A;  3OB8 A;  4LKS A;  4ARX A;  3CIH A;  1H6Y A;  4XUP A;  4QAW A;  3J7H A;  1GU3 A;  2OKX A;  2W47 A;  3THD A;  4ET7 A;  2E31 A;  4DUX A;  3SKV A;  1SG3 A;  1P8J A;  4ZZ5 A;  1TVG A;  1UY1 A;  4P02 B;  3DEC A;  1T2X A;  3OGV A;  3ZM8 A;  3CKH A;  3BN6 A;  5EJZ B;  2J22 A;  4XZU G;  2XHN A;  4LPL A;  4JKK A;  2ID4 A;  2VZS A;  5JR2 A;  3HNY M;  1OF3 A;  1JZ7 A;  1PMJ X;  2HYX A;  3I2G A;  3P6B A;  2VZT A;  2VTF A;  2CDO A;  1IQD C;  2VZQ A;  2DDU A;  3I2K A;  1UY2 A;  1JZ6 A;  1NKG A;  4HG6 B;  2VMD A;  3IAQ A;  1W9T A;  2W1W A;  1GUI A;  2V4V A;  4BK5 A;  3WQB A;  4OMC A;  4L0P A;  2VQT A;  4A45 A;  4PQQ A;  1W9S A;  2YC4 A;  4BK4 A;  3C8X A;  1I5P A;  3MV0 1;  4MGS A;  2WO3 A;  3VD4 A;  1F4H A;  1HN1 A;  1JU4 A;  4KI5 M;  2Y6J A;  2VR4 A;  2J1V A;  5IJR A;  5JUV A;  2VZO A;  3FL7 A;  2WAO A;  3AC0 A;  3IAP A;  3NJV A;  2E33 A;  2EID A;  2VZ1 A;  4LQR A;  4ZXE A;  2W9X A;  3ETP A;  2W95 A;  3DYP A;  3SKJ E;  2JD9 A;  2W5F A;  5G05 L;  4DEV A;  3BGA A;  2X09 A;  4CUA A;  3T0D A;  3A21 A;  2W94 A;  3FHA A;  4KMQ A;  1DP0 A;  1GMM A;  4MO3 M;  5F7U A;  4M4P A;  2KD7 A;  3C7H A;  3WNM A;  3ACI A;  4ZZ8 A;  4CU9 A;  2C26 A;  4QDR A;  2LW8 A;  4CU8 A;  1CIY A;  3GXU A;  5FUI A;  2B9V A;  5CYY A;  4GWJ A;  1H6X A;  2E32 A;  2J1A A;  3FN9 A;  2XQX A;  4LHS A;  3I2H A;  3OEB A;  2LS6 A;  2BZD A;  2ZEW A;  1GNY A;  1O8P A;  2VZP A;  2W1Q A;  3D3A A;  3IDA A;  5G04 L;  2J1E A;  2VJX A;  3HJR A;  4YPJ A;  3K77 A;  4W4Z A;  2V5D A;  3THC A;  2VCB A;  3CMG A;  3OEA A;  3WNP A;  2VCC A;  4QX3 A;  1UYY A;  3UET A;  2ORX A;  2EIB A;  2C4X A;  3NRU A;  2X10 A;  1L7Q A;  1JZ2 A;  3UNP A;  3C7O A;  2R7E B;  4IUG A;  3ABZ A;  1NX9 A;  2HLE A;  3WF2 A;  4W50 A;  4XUN A;  2BER A;  4AAX A;  2YC2 A;  3HNB M;  2YG0 A;  4CU7 A;  5JMO A;  2VQU A;  2BGO A;  1ULP A;  5HPO A;  2J1U A;  3HN3 A;  2B4K A;  1JYV A;  2XON A;  4RN5 A;  2C9K A;  3MO4 A;  5CZK A;  4A44 A;  3WSO A;  2QQK A;  3U37 A;  2J1S A;  2W1S A;  3LQC A;  4UOJ A;  1UMH A;  5C7G A;  2WN3 A;  1XC6 A;  2W1U A;  4RYD A;  4BDV B;  2W46 A;  1US3 A;  1K12 A;  1RYY A;  2E26 A;  2PQS A;  3NNG A;  2ORZ A;  1DYO A;  4XUR A;  1R64 A;  3K46 A;  1O59 A;  4KWU A;  1UXX X;  1UYX A;  3T08 A;  2RV9 A;  1WKY A;  3VD7 A;  1UY3 A;  3FHQ A;  3LPG A;  4QB2 A;  5A1A A;  3HPN A;  2CDP A;  3WF1 A;  2ZEY A;  1CX1 A;  1CZS A;  3OG2 A;  4QDS A;  4OYU A;  2JE8 A;  3VDA A;  1SDD B;  1SHW B;  3T0A A;  1XNA A;  5IFP A;  5JXH A;  3C7G A;  5IYY A;  2VOT A;  3NQH A;  1JZ3 A;  4MGQ A;  4A41 A;  4A42 A;  1JYN A;  4ARY A;  1UZ0 A;  1WCQ A;  1JYX A;  2RJ2 A;  4JKL A;  3LPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...