1O8PA

Unbound structure of cscbm6-3 from clostridium stercorarium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
PVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PUTATUVE ENDO-XYLANASE
publication title Structure and ligand binding of carbohydrate-binding module CsCBM6-3 reveals similarities with fucose-specific lectins and "galactose-binding" domains.
pubmed doi rcsb
source organism Clostridium stercorarium
total genus 30
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1o8pA00
3WNNA 4LHSA 2E31A 2EICA 3FN9A 1JZ6A 4PF1A 3T0BA 1OH4A 1K45A 3WEZA 3A22A 5G04L 2C4XA 5B4NA 4XZUG 1NX9A 2ZEWA 2WO3A 3P1IA 4CU8A 2WO1A 4GZ9A 4E8DA 5JR2A 3VDBA 4ARXA 1K42A 1NAEA 2QQNA 1W0NA 4DXTA 4KMQA 4QDSA 1F4HA 4JX0A 2W9XA 2VQUA 4MGQA 2RJ2A 3C7HA 3K77A 2BERA 2J1SA 1EUTA 1TVGA 1O8SA 3MUY1 1CIYA 2E26A 1UY1A 2ZEZA 2W91A 4IUGA 4LPLA 4TXWA 2VMCA 2J1EA 3MV01 3CZJA 3GXUA 4BJ0A 1US2A 3T09A 2VCBA 5EIYB 1UMHA 4ZXEA 4W8JA 2DDUA 1PX3A 2HYXA 3OGVA 4A4AA 3T0AA 4OMCA 2YC2A 2YG0A 2VZ1A 4QX1A 5HXMA 1K12A 4TTGA 4BXSV 2J1TA 2WAOA 3I2FA 2VMEA 1UY3A 2ID4A 2KD7A 2VZUA 5LCWL 1CX1A 1GOGA 3W5NA 4XUNA 3OGSA 3WNLA 2VZOA 4XUQA 4QPWA 3WF1A 5F7UA 2XQXA 1UX7A 2W46A 3WF2A 3I2JA 3VD5A 4BDVB 5JXIA 4MADA 2YC4A 1W8NA 2QQKA 2VMDA 3MUZ1 5JXJA 5C70A 3EB7A 2W92A 1XC6A 3ABZA 5EJZB 3P6BA 1O8PA 2VJXA 1W9SA 4DEVA 2HLEA 1GU3A 3OEBA 2W3JA 3PUHA 4CUBA 4E8CA 2Y6KA 4CU9A 3HNYM 1OF3A 4XVHA 2V72A 4P5YA 2EIBA 5CZKA 4P00B 2OKXA 2YB7A 3OBAA 2C26A 2X10A 5FUIA 4DUWA 2VZPA 3AC0A 2BZDA 1RYYA 1R64A 5LA0A 2VZSA 5J1XA 4GWIA 1JYXA 3ACFA 5DMYA 1XNAA 3CIHA 2VMFA 3HNBM 4QDQA 3I97A 4ET7A 2J22A 1J83A 1UYXA 2VCCA 5IFPA 2L9LA 1US3A 1XNTA 5IJRA 1F4AA 2PQSA 1IQDC 1JYVA 2CDOA 4W4ZA 2RV9A 3LEGA 1W99A 1JI6A 4M4PA 1OT5A 2E32A 4DXSA 2VM9A 1UWWA 5LA1A 3OGRA 1LNSA 2W47A 3THCA 3THDA 4CVUA 2XHNA 1GOFA 1MPXA 2V5DA 3VD9A 2BGOA 3E1F1 2VZTA 4GWJA 2J1AA 3FHQA 4FI9A 4XUPA 2W95A 4MOAA 1O59A 3T2OA 1JHJA 2XOMA 5JMOA 3LPGA 3NRUA 3VD3A 1NUKA 1NKGA 2LW8A 5DQ0A 3IAQA 1KEXA 3F2ZA 1TG7A 5DPNA 3LEKA 2B4KA 5JXGA 1PMJX 3U37A 1UMIA 4QX0A 1UZ0A 1P8JA 3MBWA 1WCQA 2E33A 2Y6LA 1JZ5A 4XUOA 3ACGA 1OD3A 2R7EB 2Y6JA 2WQ8A 3K4AA 2WO2A 4D8MA 2QBXA 3VD4A 5IYYA 1HN1A 1H6XA 3OEAA 4D0QA 3VDAA 2WAAA 4OYUA 4UI9L 4LQRA 4UOJA 3K46A 2WZ8A 5IHRA 2Y6GA 1GOHA 4P02B 4BK4A 1GNYA 4XUTA 4RN5A 3T0DA 1CZSA 4A45A 2QQIA 2WBKA 3C7EA 1SDDB 2VC9A 3WF3A 3UESA 2VL4A 1CZTA 1JZ2A 3I3EA 3CDZB 4ZZ5A 2B9VA 1OF4A 4QDRA 3I2GA 3NJXA 4QX3A 4CUCA 4UAPA 3MO4A 3K4ZA 3ECQA 2JKXA 4KI5M 2CDPA 3WNPA 2VCAA 3VDCA 1UYYA 5G05L 3OG2A 4QB2A 1K3IA 2VTFA 1D7PM 3I3DA 2VZRA 4HG6B 1UXXX 2DCKA 3OB8A 5JUVA 2RVAA 3C7OA 1DLCA 3WNKA 2Y6HA 2ZEYA 3FL7A 3DYPA 3CKHA 1CZVA 4AAXA 3HN3A 3VD7A 4JHZA 4A3ZA 5JXHA 4ZY9A 3GDBA 3HNMA 4L0PA 2ORZA 3ACIA 2WABA 3C8XA 5C71A 1XPWA 2VZ3A 1JYNA 4QX2A 2WN3A 4JKLA 2Y8KA 4AG4A 4DUVA 5C7GA 4DEQA 4YPJA 1GMMA 1JZ8A 4QB1A 2VQTA 2C9KA 4DUXA 4CUAA 1ULOA 3I2IA 3ACHA 2QQJA 2W5FA 4ARYA 3WQBA 3A21A 2QQMA 1I5PA 2Z4FA 3LQCA 1JZ7A 1GUIA 3LE0A 1W9WA 2QQLA 2VZQA 4DXRA 1UXZA 2J1RA 2J7MA 3HPNA 2J1UA 3I3BA 2WN2A 1GQPA 2JDAA 5B4XA 1JZ3A 2WYSA 2VZVA 1JU4A 2W87A 3D3AA 4XURA 2W1QA 4RYDA 1JYWA 4LKSA 3LEIA 3BN6A 3EYPA 3SKVA 2ZXQA 2ZEXA 4JKMA 4KWUA 2DCJA 1PX4A 1EUUA 3K75B 3MV11 5DN2A 3T2PA 5IFTA 3DYOA 3HOBA 3PUIA 4PQQA 3LPFA 5I0DA 3IAPA 2W1UA 2X09A 3NJVA 4A44A 2JD9A 3GM8A 1KGYA 3IB3A 4MGSA 3BGAA 4MO3M 1UYZA 4QAWA 3WNMA 5HPOA 2BBAA 3WF0A 2QQOA 3IIIA 2W1WA 4CU6A 4A41A 1BHGA 3K4DA 3A7QA 3HJRA 3JXSA 4PT6A 3IDAA 2WZEA 3WSOA 1PMHX 2BGPA 2EIDA 3FHAA 3W5MA 3SEPA 3ETPA 1ULPA 4Z2AA 3CMGA 2YFUA 4OUEA 4QB6A 4A42A 4ZZ8A 1J84A 3CQOA 5EJ1B 5LA2A 4CU7A 3J7HA 1L7QA 1SG3A 2VOTA 3T08A 2Y64A 3DYMA 4P08A 2YFZA 1W8OA 4OZOA 3A23A 1YQ2A 3UETA 1UY2A 2W1SA 3HEIA 3WNOA 2EIEA 2VR4A 4A6OA 1H6YA 1SHWB 2W94A 1DYOA 4M4RA 3CZUA 3I2HA 3GGLA 4JKKA 2WUHA 3I2KA 1UY4A 2JE8A 1W9TA 1L7RA 3DECA 3C7FA 4OMDA 1JU3A 2WDBA 3NNGA 2ORXA 1T2XA 3SEEA 3T2QA 5A1AA 3SKJE 1JZ4A 3UNPA 2LS6A 2XONA 1WKYA 5CYYA 2VO5A 1DP0A 2X05A 1UY0A 3WF4A 4W50A 2V4VA 3C7GA 3NQHA 3ZM8A 2J1VA 4BK5A
chains in the Genus database with same CATH superfamily
3WNNA 4LHSA 3ZFEC 1NE6A 2E31A 2EICA 2VOKA 3FN9A 4NR1A 4PF1A 5F32A 3T0BA 3RDIA 1OH4A 3D5OA 1ZBE1 3RMYA 5F1RA 4JTOA 2CSGA 2GC1A 4KGQA 1VRH3 3M7AA 4AHXA 2WQ4A 2RE9A 4K1YA 1C4RA 1NX9A 1BCXA 2E7TA 4XF1A 2XJUA 3NVCA 1AYM1 5FZIA 4DQAA 1OPMA 1MEC2 2V5YA 4GZ9A 3RZJA 2OX0A 4A3XA 4P9XA 4XFHA 1RUE3 3HT1A 1LOAA 3F95A 4KH9A 1K42A 1DZQA 3WDXA 1R081 1W0NA 1YRZA 2R1BA 1A78A 4JX0A 3VLBB 2FDHA 4GMP1 2HWB2 1PO11 5FFOC 2YY1A 5T5LA 1WW4A 3QCWA 4Y1ZA 1MS8A 3HD8B 3K77A 3P3PA 4MX3A 3QBQA 1Y7BA 2BERA 2J1SA 1EUTA 2V4AA 2QFEA 1MS5A 2WINB 3KCYA 2K2SA 3KHBA 4ISRA 1QQP3 3MUY1 5DUVA 3AJZA 3VBRB 4MGIE 1D4M1 1W6OB 1UY1A 1BVVA 5A7SA 1ZA7A 1TMF1 1UU4A 2PHTA 2UWAA 1AYN1 3AXEA 5FZ8A 4LPLA 1RUH2 2OQ7A 4TXWA 4NHKA 4KWKA 5CFCB 2K9ZA 2RR12 2BQPA 3TBDA 4BM8A 1WCKA 1MQTC 1CAVA 5GKAC 3OY8A 4R52A 1F5FA 1WCDJ 4O9EA 3CJXA 3ON7A 4HN0A 2I45A 1UMHA 2CWSA 4XJUA 4W8JA 1W06A 2D93A 2IZWA 3ILRA 5FK8A 4QPIB 3KHCA 2GDFA 1U0AA 3WW3A 1AUYA 2YC2A 2YG0A 3BUCA 2Q8DA 4BXSV 2A3YA 1APNA 2WAOA 2X8KA 1RUG2 1NE4A 4O7XA 4J25A 4XE9A 2HWE1 3PVNA 4Y1XA 4LULA 2VZUA 3RRDA 5DZFA 4C0BA 1RINA 5KXEA 1GOGA 1AZDA 1S0FA 3MIGA 4XACA 1U5YA 2VU9A 4YGCA 4C1XA 5L19A 3O1UA 1RUNA 3V0AA 3FMGA 3KLSA 1SLCA 4QMAA 1KFUL 4FFIA 2W46A 4CXWA 2TEPA 2P6HA 3OD0A 2QQKA 1XSRA 1VBE3 2VMDA 1WLTA 4N9HA 1CPNA 1GBGA 4D69A 2BVBA 4Y4YA 2CHHA 4D7YA 3AYCA 5J37A 1EV13 2LALA 2QZ3A 2VPVA 3P6BA 4AVBA 1DQ0A 2B46X 4XAAA 4DEVA 3S7EA 1PGW2 4O65A 3KS7A 3GNEA 4CUBA 5L9BA 4C0HA 3U75A 1OLQA 3HNYM 5FZOA 2OUJA 1AR72 4HLTA 4XVHA 1GQGA 1VBA3 2ENRA 3MGUA 1REFA 1QJEA 2X5IB 1V6JA 4MSVA 1W6MB 3T3YA 5ANNA 2R041 1S4CA 1SCRA 2HWF3 3QOPA 4QQHA 5D8AB 1NCQB 2OKXA 5L9VA 1M06G 3POBA 5FUIA 4FPYA 3HIFA 3M3QA 5DUUA 5KHGA 4DUWA 1DZTA 2OPKA 3AC0A 3M3OA 2HWC1 1R64A 3HN1A 4W65A 2VZSA 3O0WA 3URFA 5LA0A 2WYFA 1W8FA 1XJAA 5J1XA 4YFWA 4CDXA 1ZRRA 2F6BA 4WZCA 1GZ9A 1ENXA 4IGPA 5DDJ2 2XXZA 1XNBA 5CFDB 2UY9A 3LA2A 4I09A 2WZR3 1OQEA 4H7MA 3UGFA 2B9UA 2ZKLA 3HNBM 3D0SA 4MHUA 2V09A 1ZNPA 3WG3A 1UYXA 2VCCA 2L9LA 4FQ4A 3WCSA 4JC1A 1O4YA 1F4AA 1SLIA 4WVMB 5FYZA 1LHWA 5A7WA 1LU1A 1VBC1 4NHXA 2CDOA 2ZACA 4YVSC 5HV4A 4FQZA 1UKGA 1O4ZA 4MGYE 1FNZA 4P9GA 1JI6A 5A7OA 4CP9A 1KS4A 2A6ZA 1AL21 4NPRA 3WNXA 2DVGA 4AFDA 1FPN2 4IEUA 4AHYA 4DXSA 5CNAA 4ASKA 5LA1A 3THCA 1EAH3 3N35A 1BEV1 4YW2A 3WP4A 2JD4A 1U5XA 4AI1A 2JX9A 1YCIA 2UYBA 2BOIA 1GOFA 2V5DA 2W68A 2BGOA 1A6CA 1U12A 5JZGB 5FZ0A 3A0KA 3PU8A 1GYKA 4GWJA 4XF0A 4FI9A 4OQ8A 2DCTA 1O59A 5FMOS 4RS5C 1ULEA 4Q4X3 2PHUA 2XOMA 5DUWA 5T54A 4U2AA 4ZU4A 1NA1C 3RVHA 3SXWA 2YMZA 3ZLIA 1HB3A 3NRUA 4R9CA 2LW8A 4FFHA 5LBCA 2BWCA 5KXBA 1KEXA 3N7LA 4LXLA 3ZKUA 4YGDA 5FZLA 2CYFA 4NHYA 4WVZA 4Y1UA 3LEMA 4HN1A 4KL1A 5F5AA 5DPNA 1IGOA 1R1ZA 5AFEA 2B4KA 1W8UA 1HRV2 3B00A 3K3OA 4UWDA 2BPA2 4K8FA 1G9FA 1LULA 4FBFA 1RJ7A 2DVBA 1KDKA 1WCQA 5FP7A 4UBHA 3WHUA 1NLRA 3H8OA 1UF2C 4XIKA 3DGTA 4JV4A 1H1AA 4XUOA 5LEJA 3G6JB 4R9DA 2ZX4A 3USUA 2D6MA 3LOBA 2Y6JA 3K4AA 2OPWA 2RS51 1VBB2 2JKBA 5A1LA 5FWJA 1X82A 3VD4A 3NV2A 5BNPA 4RD7A 2PHXA 3FBMA 1TEIA 4XBQA 3WQ0A 4YW4A 5A7PA 4ASLA 1UQXA 4UI9L 5FPLA 3DXUA 3DPRC 3K2OA 4PQ9A 3I3MA 1POV0 2E7AA 4Z07A 2CV6A 1W8WA 2WZ8A 3ZSKA 5EHDA 3HQUA 2Y6GA 4B4RA 5CU1A 2RM23 1GNYA 5FXXA 1T6GC 4JRLA 1RIRA 1RHI2 1CAWB 2F17A 1YNAA 2XBO3 3ES1A 4FPKA 4HETA 4N7IA 2WBKA 3C7EA 5AVAA 2VC9A 3ZYIB 1CZTA 4ES9A 1W05A 5T3NA 1NG0A 3RJRA 2RMU2 3RYPA 4AFCA 2C9AA 4QKFA 4Y22B 4K8RB 1AR82 4WZFA 4HK9A 3SH3A 3VHNA 1W90A 2FDJA 3IPVB 4FTEA 4CCOA 1Q8QA 3QACA 5FY4A 1RMU1 4PBOA 5I0UA 3J8F2 3NJXA 3POEA 4QX3A 4UAPA 1SPPB 3AMQA 3CNAA 4YW7A 1R1A2 1LOEA 2JDHA 3AMPA 4Q4V3 4TN7A 4KI5M 2KXLA 1FYUA 1WMXA 3DKQA 1NQDA 3WNPA 2VCAA 1BLZA 1ND2B 3DEMA 5F2WA 3VZJA 2WWJA 3Q8EA 2XUMA 3M4FA 3FLTA 4QKNA 4LORA 1D7PM 4NJ4A 5FZ7A 2VZRA 1QJU2 4E9KA 1RUC3 2DFCA 5EJ3A 4AFMA 2DCKA 3OB8A 2IVIB 2RVAA 3C7OA 4K20A 5FYUA 1B35C 3VBSB 3I59B 2ZEYA 3FL7A 5KC5A 3DYPA 5KBFA 1CR7A 5AC91 4CCKA 3RWKX 2WA3A 4AAXA 1RVF3 3HN3A 2XJRA 4ZY9A 3JQWA 2EXJA 4GALA 4YG6A 5FKBA 5GLWA 3VB9A 1Y4WA 5E16A 3I2OA 4ORFA 1LHNA 1ODNA 3ACIA 5C71A 3C8XA 2ZCWA 3VBOC 4C91A 3JD71 1LOCA 4UF0B 5FLIA 3W20A 1REEA 1PNFA 3NAPA 1H4HA 5GLUA 4AG4A 1ZBE2 1STMA 3BTZA 2VXJA 5GZFA 2QQWA 4AYUA 1W28A 5FZFA 4YW6A 1AJOA 1JHNA 2GSYA 4LBLA 4EE2A 5LWBA 3O1MA 4LUMA 1GMMA 4IETA 2XG3A 4L8QA 4XBLA 1TME1 2GP5A 1NCRC 5KXDA 1POV1 1FNYA 2MEV1 1AYM2 2C9KA 4QPGA 5FPUA 1O5LA 2VAUA 1YQCA 2BVVA 1PO21 3I2IA 2VNRA 1GZTA 2I2SA 3LWCA 1UIKA 1W2OA 3M1HA 3RZLA 4XFFA 1R082 2B5HA 3WQBA 1ND3A 4BOWA 4BPZA 1SACA 2EF6A 1X9TA 3J9SA 3LQCA 3AMNA 1PO12 2DVFA 1MS9A 3AFKA 1M4WA 1W9WA 3WVJA 4EWDA 5CEHA 4KU8A 2WWUA 4WM8C 1WZXA 1H0BA 2P3KA 2ZX3A 4XYXA 5JSOA 1ST8A 2QE3A 3PMSA 2VQAA 1UXZA 3HPNA 4AVAA 3MW4A 3FFZA 1D4M2 4SLIA 2DBIA 4I0WB 4NWVA 1TMF2 2ZKNA 2VNVA 1AYN2 4AFBA 1O5UA 1YJLA 5DAQA 5A7NA 1XNKA 2MPFA 4NIDA 2P17A 4HFSA 2G9GA 4AEDB 1JUHA 3ZN6B 4YSFA 3OBZA 1GZCA 4XIOA 4COVA 1LOGA 2P4EA 1BBT3 1OA4A 4GH4A 3SKVA 4UW6A 3VL8A 3UT0A 1SFPA 2R073 2ZEXA 3POWA 4JKMA 4XJZA 5FK7A 3ZIXA 1PVC1 1PX4A 1UZWA 3UJOA 3T2PA 2UYAA 1WW6A 2VOVA 4YZ4A 3PUSA 3E5XA 4XFAA 3LPFA 2ETEA 2YDEA 1CJPA 3IAPA 4LBMA 4LK7A 4HXCA 4M3CF 3L2HA 5L9RA 2HWE2 3JUUA 1O7FA 4A44A 4IGOA 3FHIB 3PJQA 2OIIA 4LBQD 3ZPOA 5LW9A 5EWSA 1UU6A 5HCBA 1OOPA 4JGYB 3LSEA 2G9ZA 3BGAA 1UYZA 5A6QA 3M3CA 4YZ2A 2BBAA 1CPMA 1AXZA 1LCLA 3ILNA 1ULCA 2W0XA 2GN3A 4I3GA 4QT6A 4CU6A 4UXAA 1I1EA 3ZXJA 5FZ9A 3K4DA 3A7QA 3VBFA 4CEYA 3HT2A 1DYKA 3RFRA 1BXHA 1TNRA 2IWGB 2PMWB 2WZEA 2CU5A 2HWD1 5JI9A 4IE6A 2VVEA 4QGMA 5F6KA 4IERA 1IS4A 1ONAA 2EIDA 1AR93 5EQUA 2VMIA 4NAMA 2P1BA 3ETPA 3B94A 3CMGA 4AQ6A 2WLQA 4OUEA 2R042 1CD3G 4ZU5A 2WL1A 3G7DA 4ZZ8A 4CP2A 5CBLA 2VUJA 1DYPA 4HVRA 2UWCA 4M0NA 2HWC2 4BLIA 3PHMA 1XXNA 5LA2A 5IK5A 2FCUA 5FO8B 5IUQA 3KM5A 4PBPA 4IEWA 4ONUA 3J26N 3AKQA 4QHZA 4QU2A 2VOTA 2JIGA 1RUD3 2Y64A 3DYMA 5IWFA 1HRI1 2YFZA 1FATA 4X8PA 4FP3A 1YQ2A 1GSLA 3ZXAC 3ENRA 4XPVA 3UETA 2HKXA 2ATFA 4YG3A 3PTRB 3WP6A 4IEYA 4Q0VA 2W94A 1DYOA 1TZOA 4LLOA 4S2FA 2VY0A 1OHFA 4BISA 3AYAA 2VW0A 1O3QA 4NWWA 2E9QA 2E6VA 1OC1A 4BH9A 2G4IA 5A70A 5T5JA 1NCQC 4HPKA 3CF6E 1L7RA 1GANA 1PK6A 4IE5A 5F37A 1NLQA 1G6NA 3C7FA 4QHBA 1ZX5A 4H14A 3MEPA 4Y26A 1AL22 2FDKA 3VGIA 1BJQA 5IK4A 4L97A 2N7GA 1IS5A 1V00A 3AZYA 2ORXA 3MF6A 4XBNA 1BEV2 4AEJA 3LFMA 2OT7A 1PZ7A 1WLDA 2P3IA 5F3IA 3T2TA 1AVBA 2ADDA 2R063 3T2QA 5CFDC 4DOUA 3UNPA 1UNBA 1WA4A 2LS6A 4FPCA 4AI2A 4COZA 2XONA 4LIUA 2VO5A 2QDRA 3OUIA 1CAVB 4RQPA 3RZHA 3IT8A 3OY8B 3KF5A 5DABA 1VP6A 3KCXA 5I93A 1HQWA 2V4VA 4NMIA 4W50A 4LK6A 5FYTA 5FRAA 1UZZA 2PLV1 4NIGA 2J1VA 4BK5A 5J48A 2PAMA 2VCMA 1JZ6A 1AXYA 5CFCA 4MXVA 4NIHA 2YV8A 3LDBA 1VALA 1DQ1A 4NAOA 5CISA 4LO8A 1XYNA 4MVTA 1E57A 2VVFA 5FYIA 2Z42A 1HXS1 4OUSA 2P3JA 2ZEWA 2YBPA 4F83A 1NXD1 3V0AB 2WO1A 2KA3A 5JZGC 2WT0A 3KZ4C 5JR2A 3WDUA 3WDVA 4ARXA 1VAKA 2OA2A 2B45X 1AX1A 2RS52 3SLIA 1EPWA 3CBNA 4XFIA 2QQNA 1YWKA 3RSJA 2RDQA 3T1LA 4ATFA 1KJLA 4LJHA 1G86A 1W2AX 2GC0A 1F4HA 2X29A 1DQ5A 3CEWA 2ZZJA 4EN9B 2VQUA 1V6OA 4V2WA 1QJZA 1H8TC 2GP3A 5FPBA 3L2YA 5C6CA 2NP0A 3VKMA 1NY71 2QQUA 1OKQA 1QDCA 4BQYA 1TVGA 1KJRA 4D6SA 2WNUA 1KRIA 4Z92B 2E26A 1CQ9A 2PN5A 5FZOB 3ZXGA 1ZRFA 2ZEZA 2VUCA 1HV0A 1OLRA 3ATGA 3PL0A 4C90A 2P34A 4TYSA 4YFZA 1OMIA 3GJAA 4AWDA 1WWYA 1RGSA 3MV01 1AXKA 5FWEA 3SH4A 3SQOA 5FQ0A 4RR3A 3ZDSA 3GBFA 4BJ0A 4FOYA 4QXBA 1D4VB 4FVVA 1GWMA 3VBHA 1ZZ8A 4JVAA 4CDXB 4IV1A 1RMU2 2AR6A 5J09A 1XE7A 1RTVA 5EIYB 2WWSA 2HBTA 3T1MA 2DDUA 1PIV1 1PX3A 5FP9A 3OGVA 1GR3A 1VJ2A 3GALA 4OMCA 1RUF1 3WV6A 2WJSA 1K5JA 4YW5A 5HXMA 1D2QA 2PHLA 2YBKA 3AL5A 3SC7X 4TTGA 3ZFEA 4L11A 2WNVC 5JSRA 3U0ZA 1GWKA 3I2FA 3RGBA 3UKNA 4I0BA 3N36A 1JXNA 3OPTA 5A7WB 4GULA 3D6EA 5KHJA 1COV1 4WM7A 1ENSA 3GYDA 3RJ2X 2QUOA 4YZ3A 3W5NA 4XUNA 2VZOA 1S2EA 3WF1A 1MEC3 1GZWA 4CP9B 5AC92 4X6RB 1LHUA 4LITA 5GZEA 4Q5OA 2B8MA 2CGOA 3AP5A 2BJSA 3I2JA 4KG0A 4A2UA 4BDVB 4DMIA 1YFWA 5J7MA 3FC0A 4LO7A 3MUZ1 1WW5A 5JXJA 3U07A 3RZGA 4Q4W1 3WOGA 5BNQA 1IPSA 5FYVA 4OZXA 2IUWA 3EB7A 2HEYF 2W92A 2HWB3 3JD72 4B29A 1O8PA 2XGXA 5ABJC 4KWJA 4B7KA 4X8NA 5EXOA 5BNOC 4QX8A 3WP5A 1R091 2YGMA 1RUI1 3OJBA 3PUHA 4GB33 5F5QA 4OHZA 5FZ1A 4A6SA 1XYPA 2NMOA 2Y6KA 5K7PA 3T30A 4Y3OA 4G4FA 5CG9A 4ASMB 4URTA 1TME2 4NIAA 3O1PA 2VOXA 1W9YA 2MEV2 3KB5A 3RQ0A 3OUHA 5CAZA 1RUH3 4J1WA 4F8AA 1PO22 4Q1RA 2OZJA 3UKVA 4P00B 5F5CA 3NWKA 5K0UA 5CA6A 2C26A 2RR13 3AX4A 1MS1A 1JH5A 2BZDA 5GLVA 2FDIA 1CVNA 3WW2A 1MQTA 3D8CA 4L2NA 4AGVA 1C5HA 2D97A 4U36A 5A6ZA 2GU9A 4COWA 1QDOA 3CIHA 3WW4A 5FZBA 1GV9A 2XMLA 4QDQA 4EROA 2JIJA 1JW6A 3USUB 1C57A 3I97A 4Y20A 3SCHA 4ET7A 1J83A 1D2SA 5FY1A 3NW4A 5IFPA 1Q56A 1RUG3 2BTVC 2UURA 1VB2A 4YGBA 4IEVA 5BNPB 5F2SA 1W6PA 5E6HA 2K46A 3PNAA 4N53C 2UU8A 3R4DB 1QXJA 4OUMA 3QH6A 4W4ZA 1F9KA 1I6XA 2JE9A 3BTAA 2H0VA 2XKOA 5DAXA 3LEGA 3ZYHA 4DXZA 2WR9A 3VZMA 1ULDA 2WFF1 4QM8A 2WRAA 2XVGA 4QHOA 3BU7A 3POIA 4DZGA 3KV9A 1UWWA 4NHLA 4FPJA 1LJ7A 1RXFA 3HQXA 3OGRA 2W47A 4P9IA 3LA3A 5E89A 4BQ3A 4EZHA 1A34A 1I3HA 5FUPA 1PVC2 2QJVA 4CVUA 3N9NA 2XL7A 2FZ2A 1MZ6A 3MDPA 5LA9A 4W6XA 1SFNA 3HAGA 3E6CC 3O5SA 1EP0A 1UD1A 2VZTA 4PDWC 3FHQA 1QH6A 3V0BA 4AGRA 2OQ6A 3T2OA 4DPNA 2J42A 4FOWA 3AXDA 4K9SA 3PIJA 2QZ2A 2BP6A 1SQ4A 2D5HA 2Q1MA 1AR73 3Q8FA 4ITCA 5JMOA 4GAZA 1AR63 3NMBA 5D21A 3WZ1A 2ZPXA 3EXUA 1NUKA 1NKGA 4GKYA 3VD3A 1QU0A 4CDQC 5FV3A 4DO0A 1J3RA 2E51A 3EJKA 2H6CA 4FXGB 1TG7A 3B9IA 1H4GA 2A1XA 4IE4A 1CGPA 5JXGA 3U37A 4LE3A 4Y5TA 1UZ0A 3FUOA 3ZFFC 2C24A 2GMMA 2ZMLA 5L36A 4K3UA 5DDJ3 5FZCA 5FYCA 2JDNA 1GP4A 2XWJB 3MW2A 4BWOA 4BZ4A 1OUSA 2HWD2 1OBNA 2PAKA 3ACGA 1ALYA 4Q0PA 4QGLA 1OD3A 3H7JA 2R7EB 1QH7A 4AVCA 3O1OA 2GN7A 1RUJ1 3KMHA 2QBXA 4AVSA 1HN1A 1H6XA 1C3HA 1Q5OA 5FZHA 2XKPA 4D0QA 3AP4A 1UO9A 2WAAA 4XDOA 3AP7A 2CGPA 2RJLA 2IXKA 4IV3C 3WDTA 2BBVA 4LQRA 3NAPB 1HN0A 4IEOA 4UFKA 4YVSA 4EN7B 2BW8A 4NUBA 1VMHA 3Q9OA 1N1YA 1HDKA 3SCGA 1GOHA 1DGRN 5FZEA 3U14A 3AMHA 4BK4A 1FPN3 4Q8KA 1WD4A 5BNNC 4K1ZA 1ULGA 3ZYJB 4QQPA 3Q8BA 4XCBA 1QJY1 3ES4A 4A45A 3BB6A 2QQIA 3PU3A 1HRI2 2DU0A 1SDDB 1E5SA 2Y26A 4RA0A 3H8UA 4PLOA 4QPGB 1A3KA 4NROA 5C4WC 2G19A 5FYHA 2PHRA 3LCPA 4JTNA 1VMJA 2DF7A 5T50A 2QKDA 5C3RA 2ZGTA 2YHJA 4ZZ5A 2R1DA 1KITA 4HVOA 4AHZA 1YQ5A 1ND3B 4B3NA 4I0AA 3I2GA 3NV4A 4I2OA 2D6KA 2JECA 1QJX1 2R32A 4W6WA 3O0XA 3MO4A 4RS5A 3T4HB 2JKXA 3VKLA 3FLPA 2DFBA 2JG8C 4LBJA 5APAA 3AYDA 1NA1A 2FMDA 1LRHA 3P3NA 4AVTA 4RFRB 1LHVA 3AFGA 2FDGA 4UFMA 2LM3A 3OG2A 2ZAAA 3AYEA 3I3DA 5FJKA 5FO7B 5F3CA 3NJZA 4HG6B 1HW5A 1ZRIA 1AR62 5C33A 3I4IA 1HRV3 2NZ9A 1GP6A 2JG9A 1RUOA 1H2LA 1OPOA 4H2AA 2CY6A 4GJZA 3NKTA 4LIVA 2XWBB 1WLWA 4QXKA 2B39A 5JI7A 4JHZA 3KT7A 2OS2A 4XJ9A 3H7YA 4YVWC 5IAVA 1IQAA 4CPBD 2GNDA 3BI3A 4GH4B 3HNMA 1LOFC 1VBB3 3ZFGA 4L0PA 3JBG1 1MS3A 1XU2A 2ORZA 2PLV2 3RPQA 4CA9A 4LKEA 4Q4Y3 1X33A 3H3UA 1UN1A 2VQ0A 3DXTA 5J3UA 5KR7A 4QX2A 4MGKE 4LE4A 3RZZA 5LRSA 3OTFA 3U78A 4DUVA 5BXXA 4RHV1 5GLZA 4HVQA 5C8CC 1DCSA 4DEQA 1FOD1 1QF3A 1HXS2 2P2KA 3QLQA 4PJYA 1RHI3 3H42B 3R6SA 1OOPB 2VQTA 4FOQA 3OPWA 1VBD1 3UJQA 1CIWA 2AC1A 2RS31 3UGHA 3AJYA 1DQ6A 1LU2A 2RMU3 2BV4A 4GWMA 4N7UA 3UV9A 3ZN4A 2WT1A 3I3QA 2QQJA 2W5FA 4ARYA 1AR83 3H9AA 2JB8A 5ANQA 2AH2A 3A21A 1OURA 3VBFB 1KS5A 3H1MA 2QQMA 4CEYB 1I5PA 3J8F3 4GJYA 4B8EA 1C8NA 1JZ7A 1GUIA 3NNLA 1G9DA 1CX4A 1R1A3 1S0CA 3RYKA 1ENRA 3JB4C 4CEWC 5IVVA 4XQDA 1GICA 1NY72 2ZHLA 2ZS6B 2J1RA 2J7MA 3BOPA 3MIDA 4KGGA 2P6CA 2Y0OA 1QJU3 3MIEA 1HX6A 5H9QA 4XF3A 1FXZA 4D7TA 2JDAA 5B4XA 2VZVA 4BQ1A 3N3HA 3ZXLA 4N43C 1AX2A 4J1XA 5CB7A 5BPXA 3GZTB 1FV2A 3D3AA 3CU7A 4LBOA 4XURA 1YFXA 2F4LA 2D5FA 2R6QA 4XAEA 4RYDA 4XHXA 3TEWA 3WDYA 2EAKA 3ZXKA 2YXSA 4BU2A 5ACA1 3BN6A 4OVEA 5GZGA 4CTEA 2XDVA 5GZDA 2ZXQA 4KWUA 3H0OA 1PIV2 1NXMA 2IXIA 3K75B 1LOBA 4V2VA 3MIBA 5AFBA 1RUF2 2BUKA 1K5MC 3ZPYA 3HOBA 4JQRA 5ISLA 1ASJ1 1W3XA 1KXGA 5A3PA 2ZHMA 1JN2P 1ZBE3 1XSQA 4L99A 3EMRA 2R0FA 1XOYA 2JD9A 5E1RA 4Q4Y2 5BYNA 1COV2 2XHKA 2XLAA 3GM8A 1KGYA 1JMUB 2AREA 2A6XA 3GCXA 1LTEA 3IB3A 3NNMA 1AYM3 4HPKB 1Q43A 4MO3M 1PK6B 4QAWA 1PMIA 5F3GA 3VBUB 3WNMA 2JB4A 1NCRA 3CJIC 2K0GA 1XU1A 3WF0A 2QQOA 4LO6B 2D6LX 1W0PA 1G7YA 5FIXA 3VKOA 4CDXC 3BODA 4A41A 1S0GA 1ZVFA 1R083 3KD4A 2FCTA 5FYBA 4Y4RA 4GQ7A 4XXAA 2JEMA 4Q4W2 3WXPA 4GKXA 3MPBA 1JUIA 1FMD1 1YI9A 4CDQA 4GMP3 5IVJA 1PO13 1CN1A 1UOGA 2DBNA 3PJYA 4RQPB 4Q0SA 2IXJA 2GALA 4YM3A 1R092 2Q8CA 1RUI2 3WSOA 1Z7S1 4CCNA 4QPYA 2YBSA 3BU0A 4WM8A 3GBGA 5LBEA 4CDWC 5FBZA 2R0HA 2EAAA 1D4M3 3H1WA 4CDUC 3KV5A 1ZZCA 4BB3A 3W5MA 2JWPA 1TMF3 4XMAA 1ULPA 1AYN3 1C28A 2DV9A 4QU1A 1O6UA 2F4PA 1LESA 2C0ZA 1W6QA 2XVLA 2EVXA 3DF0A 1J84A 2FHRA 1JBCA 1S2BA 2ARXA 3OCPA 3VDDC 4OQ9A 1H8VA 2FD8A 5A3WA 4Y1VA 5K9YA 4QWNA 4TLFA 1IKQA 3J7HA 1L7QA 2AGSA 4FAGA 1C1LA 2D3SA 4K6BA 3ZX7A 4KNCA 3WUDA 2ZAHA 4P08A 1W8OA 5I0SA 5FY5A 1A8DA 1H9WA 2R16A 3J7LA 2A7AA 1UY2A 5EPAA 2EIEA 4A6OA 1H6YA 2AYHA 4KBBA 4AI8A 1JYTA 2D7FA 4PLNA 3I2HA 5BV6A 2HWE3 2VECA 3J4UH 2WA4A 3A0NA 3CHXA 3IMMA 2E63A 2AUYA 3S5AA 2WUHA 2MHFA 1IG3A 1IOAA 2JE8A 4HZFA 3BALA 1W9TA 3ZYPA 1S1AA 2C1FA 4JGZC 1N3PA 1OSGA 2WFF2 1HIXA 3E97A 4P9LA 3ZYRA 1JU3A 2WDBA 2WNUB 3NNGA 4AI0A 2WS91 1LENA 4JHTA 4YRDA 3GF6A 5FPXA 1ZZBA 5JOWA 1T2XA 4Q29A 2VBPA 2JDZA 3D0JA 5FQ0B 3WG4A 1JTZX 1V6LA 4RR3B 5LZ6A 2X53S 2OZ6A 5E88A 2VMHA 3E5UA 1OQDA 1WKYA 2AENA 2O14A 2QCSB 5CYYA 4FOVA 4C1WA 2ZGLA 1REDA 4DY3A 4UFHA 4LHLA 3VBHB 1BKZA 1UY0A 3ILFA 3MI8A 2ZJCA 4IV1B 1PVXA 2HH9A 4BQXA 1HKDA 1MS0A 3C7GA 3IDCB 3I54A 3KV6A 2VXRA 1CONA 5GZCA 4UFIA 4XF4A 2R043 4XW3A 2YROA 2XJTA 4COUA 1IG0A 3ZFEB 4BIOA 1V9U1 3TN91 4FXKB 1K45A 4WVVA 2ZGMA 5I0RA 3A22A 1RL3A 2HWC3 4XC9A 3AB0A 3AKRA 3ZR5A 5G04L 2C4XA 2A71A 2A5ZA 1KD7A 5GLTA 4WM7B 3VHPA 3ZDVA 4N90A 1UMZA 1ZYBA 1LGNA 5JOYA 2WO3A 1XB9A 4CU8A 3WR0A 3MF9A 4BQ2A 1GZWB 1ZBA1 4UW4A 5FP4A 4E8DA 3C3VA 1YYNA 2CAUA 3VDBA 4OI4A 1IHMA 4NOTA 3Q8CA 5K8SA 3D82A 1Y9GA 1RUJ2 2Q1FA 4M3CA 5CKMA 5LASA 2GNMA 4LOTA 3AZZA 2R30A 4KMQA 4QDSA 1I9RA 1OA3A 4EWEA 3SISA 1VBC3 2W9XA 2ZGOA 3ZXFA 3RYRA 2A75A 3UKTA 1UX6A 5M0TA 5DAVA 4Q1PA 3C7HA 3LZZA 4GIQA 4OLLA 4YZ1A 3VBRC 1VAMA 1AL23 1DHKB 1MVEA 2BGCA 5F39A 1G9AA 3WINE 3LOIA 1QJY2 1IS3A 5FXZA 3LGRA 1BEV3 2W91A 5GALA 3WG1A 3WW1A 3I7DA 1H2KA 1NLSA 2B42B 1O4TA 2HJIA 2J1EA 1WW7A 3K3NA 4LBKA 3V64A 3LSDA 4AGGA 5K0UB 1F35A 2NM1A 3GXUA 1I5ZA 5LATA 4IQPA 1O91A 1US2A 2WC2A 1MQTB 1GQHA 1QJX2 1OFNA 4Q2FA 4QKBA 4QPIC 4B7EA 2QDNA 4E2SA 5FOBB 1Z78A 3O7OA 2XPJA 3NAPC 4A4AA 3T0AA 3VN4A 1XE0A 3ORJA 4Y20B 4QX1A 1X7NA 3M3IA 1K12A 1G8WA 1QNWA 3N9OA 3S30A 5C3OA 1BZWA 1W6PB 3KSCA 1RITA 1UY3A 3POSA 4EN8B 4NRMA 4YZ5A 4NE9A 2RS11 3SH5A 3O1SA 1ODMA 1DZRA 3H3ZA 4MH0E 4XFGA 1YXWA 2IXCA 3OGSA 3WNLA 2Y60A 3MYXA 4XUQA 4QPWA 5FMBA 2YGLA 5F7UA 3ZSEA 2XQXA 5JOXA 4EN0A 2DUPA 4LMFA 4MADA 2YC4A 5T52A 2RS53 2RDNA 3JBG2 1QNYA 3FFQA 3BIWE 1OKOA 1W9FA 3B9CA 5FZGA 5IVEA 5C70A 1H1MA 1WMFA 2VTXJ 4LBNA 4XZPA 5F8PA 1C8M1 2IXLA 1QXRA 4HSJA 1DG6A 2VJXA 5FXVA 4LUKA 4ZXKA 1W9SA 3BTXA 4BIFA 1W3VA 3N9PA 4RHV2 3V0BB 3WDWA 2FZ1A 1GU3A 4AOCA 2W3JA 4YW3A 4MXWA 5LK7B 1H8TA 4E8CA 1FOD2 5L7OA 4FTSA 1OVSA 2GC2A 1VBC2 5F5IA 1OF3A 2JICA 2X5IC 3U4XA 1ZREA 1WCUA 2V72A 5D8AC 1VBD2 4P5YA 5C9AA 4FPGA 1W2TA 2EIBA 2RS32 1O3SA 3VBUA 5FUNA 2Q0AA 4EJRA 3W59A 3OBAA 3ZYBA 1UOFA 4MV2A 1RYYA 5DAWA 3FJSA 1YQ8A 1VRH1 4GH4C 1NOVA 1UZYA 2Q1ZB 2SBAA 1KQRA 1RMU3 5BY5A 4E4ZA 2D6OX 5FZ3A 1N3OA 4PLMA 3LFIA 1IZ3A 2IXHA 2XJPA 1RUE1 1SZBA 3TB0A 3TRSB 1GLHA 4AI9A 4DINB 2ARAA 1DIWA 2ZX1A 2PQQA 2WNVA 1J3QA 2EALA 4LO5B 3E6BA 3O1TA 2ZGRA 4YVSB 3X29B 5CG8A 1DFQA 1W99A 5JPMB 3AZXA 2YPJA 1GWLA 4Y5Z0 5AC93 3S6PA 4KBZA 4EZ4A 4AZZA 1QQP1 1F2NA 2Z2SB 3AZWA 3N7JA 4IESA 4S2GA 2D98A 3HMYA 3GZEA 4M00A 1LNSA 3VBFC 1IPKA 1FV3A 5FXWA 2EXIA 4IW3A 2XHNA 2WT2A 1V6MA 1VIWB 1OI6A 5A3MA 2ILMA 3BOWA 3UYJA 1S2KA 2DTWA 3E1F1 3JD73 1ASJ2 2GNTA 1T6BX 4D6RA 5C9AB 3CLPA 3PVEA 2W95A 5ABJA 4IEQA 2YU1A 4QD2A 4QQLA 3WT3A 1DLLA 3KCCA 1POQA 2E7QA 1TME3 2VBDA 4RS5B 5CIRA 2A3WA 1POV3 2MEV3 5LRRA 1NA1B 1HV1A 5DQ0A 1PO23 3IAQA 3LD8A 4PF5A 3F2ZA 1FX5A 2ZTNA 5I0TA 4A7KA 1W2UA 5JIUA 4AFAA 1D0GA 3AKPA 1H30A 2PHWA 1UCXA 2LUWA 2JG9B 1FMD2 3AL6A 4AEKA 1P8JA 2ARBA 3MBWA 2PHFA 3J7MA 4P9WA 4TWTA 5FREA 2ZGSA 5FZKA 1UPIA 2Y6LA 3NJYA 2ZZQA 2BRTA 3LDRA 5KXCA 1Z7S2 3FUQA 4N9IA 4XTPA 4Y33A 2G9FA 3VZNA 1JOBA 2LTNA 4ISQA 4R8HA 3ZFGB 1VBE1 2WO2A 2KM2A 3WLUA 5IYYA 4HANA 3OEAA 1XBFA 3HR9A 2XLFA 3RG0A 5LEKA 4XETA 3ZXDA 1CJDA 4I3PA 5FZ6A 1EV11 4LR4A 1PK6C 1SFYA 1H1IA 4N53A 4UW5A 1SBFA 5EP9A 4UOJA 4XXPA 2JJ6A 3K46A 3H50A 4I30A 4AQTA 4FFFA 1CWPA 5IHRA 1DQ2A 2Z79A 4P02B 4XUTA 1FI2A 1OA2A 4RN5A 4LKFA 3T0DA 1BK1A 1CZSA 1YC61 3B02A 1VBA1 1AL0G 3RZKA 5FP3A 2Q8EA 3UESA 1LECA 3CL1A 1PVC3 2VL4A 2Z69A 4CYDA 3I3EA 3VUOA 2HWF1 1JYCA 4AI3A 1ULFA 5FMOL 2WKKA 1OF4A 2JDKA 3DUIA 3KQ4B 4NPLA 5J98B 2CAVA 4DNYA 1VR3A 4PDWA 4BHPA 2ES3A 4FPHA 2Q8OA 1TE1B 2PYTA 1Y9MA 2YUEA 4P9YA 4CCJA 3K4ZA 2OVUA 3ECQA 3EQEA 2WZR1 4E2GA 4NRPA 1ND2C 5KHKA 2VNOA 3WQ7A 3EO6A 3VDCA 2Y0IA 1H2MA 5FPZA 5FYSA 3M2MA 1Q8VA 3I8TA 3N9LA 3PTYA 5DZGA 5G05L 2WS92 1XNCA 4ZU7A 4QB2A 1K3IA 2VTFA 4FPLA 4JDNA 1CAUA 4AK3A 5IT6A 1W0OA 3BIEA 1DGLA 2JDPA 2R49A 3IN9A 3ZYGA 4FP2A 1U5ZA 4MLOA 5JUVA 3VBSC 1DLCA 1Q3EA 4S2DA 1V0AA 3ZO0B 4PCRA 3ZFFA 3WNKA 2Y6HA 2XQRA 4XJ8A 1SLTA 1LAJA 4BCUA 5FTTC 2HWD3 2BDRA 3VD7A 4A3ZA 1Z0HA 4QX7A 1EY2A 4O61A 5JXHA 3GDBA 1SDWA 3SHRA 1WD3A 1EAH1 2WNEA 3LDKA 3VL9A 4H3WA 4YLZA 3I2DA 2MNGA 4UFJA 2JE7A 4QQOA 1JYNA 4Q27A 2WN3A 3BCWA 1QHDA 3KF3A 3KWVA 1V9U2 2BNNA 2Y8KA 5D1IA 4IV3A 3TN92 2PFWA 1SLBA 2OXBA 3EBRA 3O12A 3IIAA 1HJFA 4Q4X1 5AVPA 3H3LA 1JZ8A 5BNNA 1HRI3 3RS6A 1ZBA2 1NCRB 4W6YA 4XQ4A 1HB1A 3BYWA 3S7IA 5C4WA 3ACHA 1V6IA 2QVSB 5E8AA 3PMEA 4AQSA 1QIQA 3OF1A 1TQ5A 4XJAA 1PZ8A 4H7LA 1FT9A 4NHMA 2Z4FA 3AK0A 4YW1A 5I91A 1W8ZA 1N47A 2QQLA 2ZX2A 3LE0A 3B93A 1W04A 3KVAA 4LT5A 1F5JA 5FLHA 4CCEA 2JG8A 4DXRA 2FDFA 4WM8B 3SCFA 5F9TA 3KGZA 2VG9A 4ATEA 2ET7A 3H8XA 3IDEA 5IW0A 4BMEA 1DBNA 2HYKA 1V6NA 4WM7C 2W39A 3I3BA 2WN2A 5GM0A 4P5HA 4AEDC 1W6QB 2WLPA 1UOJA 1VB4A 2I07B 4CXYA 3U4SA 1NZCA 5DG1A 1W2NA 2ZHNA 2W1QA 3MPPG 2RM21 4GXLA 1JYWA 4YYOA 3LEIA 4I01A 4BYYA 3E5QA 3EYPA 4XMIA 4E4DX 2XBO1 1LEMA 1ZZ6A 3VHOA 4ZHNA 1F31A 4YVWA 4QGNA 4WVWA 2W08A 4XCAA 2PLV3 1LOFA 1EUUA 2NLRA 4RSUA 1YFYA 4FO9A 1JS9A 5C8WA 5IFTA 3PUIA 3RI9A 3I49A 1N3QA 5I0DA 2W1UA 5L73A 1KDMA 5FR3A 4XDQA 4BLJA 4QXHA 1V6KA 3B7MA 5C8CA 2I74A 4G3YC 4JGYC 2RS12 1HXS3 1UAIA 5FZAA 3JZVA 1S55A 3H1YA 4OI2A 5A6XA 4Q4V1 3LF7A 1O3TA 5K0UC 4EV0A 4F3JA 4IEPA 3ZVXA 1PGL1 1TNFA 3TNQA 2UY8A 5DZEA 5KC6A 3IIIA 4E4HA 2H6BA 3L9JT 2W1WA 1N1TA 1L3JA 2HEWF 3POGA 1BHGA 2ZMNA 1DGWA 1QOTA 1RUC1 3AZVA 4RGKA 1ZM1A 5ERLA 5I8TA 2G1MA 3U10A 1C8M2 4GA9A 5KHHA 4CCDA 5JCTA 5A1FA 4D94A 1AJKA 2XJSA 4SBVA 1S0JA 3OUJA 1WUVA 4PT6A 3M3EA 4LO4B 3VZOA 4OI0A 4MUVA 1RVF1 1PZ9A 4HSLA 3THTA 4BQ4A 2VE1A 4CEWA 1DGWX 3WY6A 4XHBA 2BGPA 4ES8A 3RWNA 3KQRA 4AW7A 5C3SA 3MFAA 2E53A 2VGDA 3VKNA 1Q8SA 1E5RA 3SEPA 1SEFA 5TSWA 5FZDA 3W9AA 2CNAA 2D6NA 4A42A 2GH2A 1LGBA 5A7QA 4PIXA 3WD5A 3P5BA 3CQOA 1WMDA 4EQVA 5FDBA 4CZSA 4NRQA 5EJ1B 4N43A 1BVP1 1VRH2 3RMXA 3W21A 5J96B 4IDZA 5CADA 1SG3A 2D43A 5C5TA 2ZHKA 1OLMA 3Q8AA 4BMBA 1X36A 4HKOA 1PNGA 4LBQA 2IC1A 4OZOA 1PIV3 3FLRA 1RUF3 3LIHA 3NNJA 4HL0A 2EIGA 1RUE2 2DU1A 1SHWB 4H55A 4DY5A 1K5MA 1JODA 4M3CB 3CZUA 1QJFA 4COYA 4LKDA 1W03A 5FCCA 1OFSA 3GGLA 4FCAA 2OW4A 4LA3A 1W8HA 1UZVA 2YYOA 1COV3 4XF9A 5FBJA 5A32A 1QOSA 4ZS2A 2A70A 1W39A 5IVCA 3ZSMA 5LY1A 2ET1A 3DPRA 1YEWA 2BU9A 1Q8PA 1QQP2 3OPZA 1RC6A 2NN8A 3CJIA 3IMNA 3POFA 3ZSLA 5KHIA 2GNBA 4UT5A 1BQPA 4Q4W3 2CTVA 4IGQA 4ZPIA 3SKJE 5A1AA 1UU5A 4Y5SA 4CSWA 3JU9A 2OYZA 2CWMA 4V1PA 3WUCA 5F3EA 5CKNA 5SV5A 1OH3A 2X05A 2WSUA 4AQ2A 1R093 1RUI3 3WG2A 3ZXEA 1BBT1 3WF4A 5JAXA 2R071 1CESA 3ZM8A 4CDWA 5IK8A 1LGCA 4CDUA 1G9CA 1ZRCA 4IE7A 2PXJA 5DG2A 3O1RA 3MLLA 5K4LA 4N8MA 4F7ZA 3WEZA 3VDDA 5A33A 5JPNB 4OHXA 1WBLA 2PTMA 2VW2A 3POYA 4PI2A 5D2AA 4D3WA 1CAXB 1RXGA 3R4UA 2CGNA 3USSA 5B4NA 2DCZA 2JENA 3FE5A 4JRAA 3N7MA 4XZUG 4LOSA 3C2UA 4OI1A 2C5DA 3GJBA 4C8DA 3FBYA 3P1IA 4ZS3A 1W6NA 2IFRA 4CCMA 3TEXA 2DWRA 4TZDA 3OSDA 1B35A 2FBEA 5IVYA 3EHKA 3NNFA 5A3LA 1IPJA 2GAUA 2YC0A 1VBE2 1NAEA 1OUXA 2JDMA 4DXTA 4BQ5A 1HB4A 4GWNA 2VUDA 4LTAA 1VMFA 1YIFA 1EV12 1SBEA 4IEXA 2ZMKA 4R9AA 4XTMA 1SLLA 1MVQA 3N4MA 2VNGA 4MGQA 3VBOA 4CCLA 4AE2A 4MZUA 2RJ2A 2JDUA 3JCIA 3PURA 4RL7A 3UK9A 3ZMNA 3ZMOA 5JLVA 4MXWB 3TOJA 1H8TB 2WFF3 4OCTA 4CUGA 1C1FA 1O8SA 5L7OB 1CIYA 1MS4A 4JGZA 1AR91 4ZKTB 4OHVA 2JG9C 1VBA2 1ZA4A 4R9BA 4IUGA 2O8QA 3B69A 4X6QB 2VMCA 2HWF2 4K7JA 3CZJA 1LHOA 2A6YA 5JMCA 4Z1VA 4YG0A 3TNPB 4FFGA 2W2IA 2TBVA 2WQZC 3POJA 4RGAA 5JSPA 1YI7A 3ZFGC 5J36A 2TUNA 2WSVA 3T09A 4DFSA 5A3TA 2VCBA 2DUOA 3DKWA 1RUD1 2DURA 2RG4A 2YPDA 1ACCA 4B4QA 4ZXEA 2BYVE 2WO7A 2WZR2 2ZGQA 2HYXA 2LRPA 2ZGPA 4ZONA 2H0BA 4PIZA 2VZ1A 5JDBA 3AKSA 3ZN5A 5C3QA 3LIGA 1LKNA 2J1TA 1X9PA 3OYWB 3OOXA 3VKFC 1OLME 2VMEA 4LLFA 4HOOA 2WNVB 4LEJA 4Q0UA 4HONA 2ID4A 2KD7A 2VD7A 2ZX0A 1LB2A 5LCWL 2YZ4A 1CX1A 2GMEA 3MLJA 4Z82A 3IDBB 2DVDA 5FYMA 5C3PA 1VLNA 4NO4A 1UX7A 2P5BA 4JQTA 3WF2A 3VD5A 5JXIA 2CL2A 1W8NA 3R05A 1EAH2 1RUJ3 2VH9A 3KT1A 1N1VA 1AF9A 1RB8G 1EYBA 2R061 1G9BA 1X8EA 2Q30A 1DGRA 4UYBA 4EN6B 1XC6A 3ABZA 5EJZB 3TEYA 5IVBA 4IL7A 2QNKA 2RHPA 4CCCA 4E4SA 3J7NA 1F15A 2UWBA 2EXKA 2GH8A 3GBWA 5ABJB 2HLEA 1GKBA 3OEBA 3GZAA 5LY2A 5BNOB 4Q4X2 1LODA 1HB2A 3ITQA 3VBRA 4CU9A 4DB5A 1W6OA 3VV1A 1QJY3 4FSJA 1MACA 4PHZA 2AACA 4HKWA 5KWRA 1QGLA 2QQPA 1AX0A 2ZGKA 2ARCA 1X50A 5CZKA 1NQJA 2YB7A 2ZABA 3ELNA 3GHMA 3LKJA 2X10A 3MIFA 3PVOA 3FZ3A 5JIAA 5IVFA 3NKGA 2D40A 2VZPA 3DL3A 4CE8A 1O3RA 2HEVF 4INDA 1QWRA 4GWIA 2WFPA 5FY0A 3UL2A 1UKRA 1QJX3 1JYXA 1W8TA 3ACFA 2XR4A 4DRRA 4OHWA 1PM4A 3O14A 1S0IA 1UYPA 1XNAA 5FJHA 5DMYA 5JWPA 1BMV1 4QPIA 2VMFA 3JB8A 2J22A 2DVAA 5CVRA 5BNPC 2LROA 1KFXL 3OD4A 4D7SA 2P37A 3ZIWA 1US3A 4TLGA 1EPZA 1XNTA 4FPEA 2VTXA 5IJRA 3H8RA 2PQSA 2WIIB 3MHZA 4AL9A 1IQDC 1OD5A 3RI8A 3R0RA 1JYVA 4QXCA 4N53B 5T5PA 1OXCA 2O0OA 3SNMA 2RV9A 2Y38A 1OVPA 2RDRA 4M4PA 2WNOA 2A73B 5A6YA 1OT5A 2B7YA 2E32A 3O1VA 2RM22 1MZ5A 4XFCA 4AEMA 2D3RA 4RFT0 1UL9A 2QQVA 2VM9A 2XBO2 5F6LB 1JYIA 4Q8LA 3GHNA 3THDA 3JBG3 4XFBA 2A6VA 1SBDA 4QX5A 3V65A 1MPXA 1X8MA 5DUXA 3VD9A 2ZGNA 1HQLA 4HBNA 2GMPA 4UFLA 3N9QA 3S0MA 2BFUL 2W52A 2J1AA 3MIHA 4XUPA 3CO2A 4RHV3 5HCFA 4A7YA 4MOAA 4XOGA 5HPOA 4PDWB 1UPSA 1FOD3 1JHJA 5EZWA 3LPGA 5IAXA 4LHNA 5CKQA 1HJGA 1LEDA 1SLAA 1H2NA 4Q4V2 1VBD3 3T4VA 1PHMA 5HXVA 2X5IA 1W6MA 2RS33 1PGL2 5D8AA 3JQXA 1NCQA 3QH7A 4CDQB 1Y43B 4TSVA 4Z2WA 3LB9A 3OBTA 1CAUB 3QD6A 4I02A 3LEKA 2ZA9A 1PMJX 1RUC2 1UMIA 4QX0A 1GFF2 2AEZA 1ENQA 2Y6FA 4WBBA 5CFDA 3ZFFB 3BTYA 2P3YA 1MEC1 2E33A 5FP8A 2RJKA 4DRVA 1JZ5A 3NL1A 1L7LA 4QQ2A 3KGLA 1BYHA 1RVF2 3TAYA 1DQ4A 1U5IA 2WQ8A 5H9SA 1WCSA 3ZSJA 4OHYA 3VHRA 3ZYFA 4BQWA 3NO8A 4D8MA 2QTWB 4WVMA 4JZRA 3TYJA 3VDAA 3M8LA 4OYUA 5JVVA 2HWB1 2VW1A 3ALQA 3TWIA 5IK7A 3AM2A 4KQ7A 3INAA 4IV3B 1QY4A 1JOPA 1QMJA 4GB31 1ZZ7A 5DXDA 4XQWA 2D44A 3U11A 1MZEA 1A8MA 1D0HA 2Y34A 5ACA3 1CAXA 1PGSA 2DUQA 3M70A 4YM1A 2XVKA 5DAPA 3ME2A 4QPGC 3HWJA 5FMDA 5BNNB 5I8YA 4IXLA 1J1LA 3W58A 4UBGA 1F8VA 2XL9A 3HVDA 3WF3A 3MZHA 1RUH1 1JZ2A 3CDZB 1SCSA 3MICA 1XNDA 2DYCA 4URAA 1ZRDA 2BOJA 4UW3A 2V73A 3ZOIA 2RR11 5C4WB 1ASJ3 2VOWA 5JZGA 1ND3C 3ROUA 4Y24A 1Y9QA 2B9VA 3N9MA 1H9PA 3D4KA 3PIGA 4QDRA 2TNFA 2ADEA 3V56A 5IATA 3R4SA 4WV8A 4Y1YA 1YLLA 4CUCA 2BNOA 4O9GA 4B1MA 4CXXA 5H9RA 3OGGA 2CDPA 1LR5A 1UYYA 2JG8B 2HBUA 4JDMA 5FLJA 5HCAA 1HQNA 1GNZA 1RUG1 4XABA 1YQ6A 1UXXX 3RZMA 4HT1T 1QOOA 3BPSA 1FMD3 4YGEA 1NZIA 1WLCA 3WX5A 3TEZA 1QKQA 4PI0A 4XDPA 1XE8A 2D3PA 4QM9A 3CKHA 4K40A 2ZGUA 5FOJB 1CZVA 1C5IA 2Y33A 5LBFA 4E2QA 1Z7S3 1MZFA 5HCHA 2EA7A 1BBT2 2A3XA 3NV1A 3MFCA 4YVWB 2R072 2ERFA 5FPAA 5FY8A 1YFUA 4BA6A 4YARA 3AKTA 1WBFA 4JAAA 2WABA 3K48A 1XPWA 4RGGA 2VZ3A 1QXPA 3KV4A 2JDYA 3S57A 3MLKA 4JKLA 3PUQA 1IS6A 3N7KA 2O1QA 1MR5A 3OYWA 1Y3TA 1PGW1 5C7GA 4XEZA 1XYOA 2VUAA 2PELA 1OOPC 4OFGA 4QKDA 1GNHA 1NYWA 4XJWA 4YPJA 5C8CB 1J1TA 3HQRA 3B3QE 1CAWA 1AR71 5EYXA 2D6PA 4QB1A 1DDLA 5LB6A 1AR61 1NT0A 4CP1A 5A80A 3IWZA 4DUXA 4M3CE 4LNVA 3VZLA 4CUAA 4GD4A 4BE3A 2BNMA 1ULOA 3O0VA 5ACA2 4Y22A 3DCQA 3HBKA 1DU3D 2Z5WA 3NV3A 4CEYC 3IPVA 5FYYA 3PUAA 4GB32 5GJ6A 3KT4A 4AXOA 4M0HA 5DDJ1 1SPPA 3PLQA 4LHKA 4AAPA 4NPMA 1VAVA 3AVRA 4IE0A 2FMYA 4AR2A 1PM7A 2VZQA 2NPIA 2ZBJA 2DCYA 4FPFA 1ND2A 5JR7B 1QEXA 3SITA 4CEWB 5A3UA 5BNOA 1GP5A 2WS93 1AR92 4MG2A 1VPHA 2J1UA 3GZUC 1WGPA 2AZ5A 4CPBA 1GQPA 5EYYA 3BKZA 3LA7A 1OQ1A 2EXHA 2WYSA 2XB6C 4L9BA 2KR2A 4L92A 3AVSA 1JZ3A 1JU4A 5BUVA 4NIIA 4MGTA 4YM2A 4FTBA 3VBSA 3I59A 2W87A 1E5IA 5C5UA 3AP9A 3PVBB 4N43B 2PA7A 1FPN1 4LKSA 4B1LA 3UGGA 3VZKA 3E6DA 3IM0A 1RUD2 2XJVA 5B2GB 3FWEA 4LBQB 4K21A 5T55A 2DCJA 5FAXA 3MV11 5DN2A 4EWAA 3AP6A 3PDQA 4AF9A 4OULA 3OBRA 3DYOA 4PQQA 4UF0A 4P14A 1S0BA 3B01A 1V9U3 1K5MB 2A6WA 2X09A 2AEYA 2IFWA 3TN93 1S0DA 5L7OC 3ZR6A 3NJVA 1BK0A 1UOBA 4AVVA 4KG8A 2VMGA 5A32B 5C9AC 1J59A 4IEZA 5FPVA 4D6QA 3VBUC 4MGSA 2SLIA 1S0EA 1WA6X 2ZOEB 4DS0A 1ZBA3 1E5HA 3ZKYA 3DPRB 2GC3A 2XH6A 3WP3A 3CJIB 3LAGA 4NVPA 2VBBA 1ZZ9A 1HRV1 3NSTA 4AHWA 4FPOB 4NN0A 2JXAA 4EYUA 2R062 5I8SA 3HJRA 2PHDA 3ASIA 4FAHA 4RQPC 3WHTA 3BVCA 4YNIA 2Q4SA 3JXSA 5H9PA 3IDAA 3B5LB 1J58A 2WZPP 2XJQA 4A7ZA 1PMHX 4CP0A 3SMHA 5A3OA 3ST7A 2OUHA 4BXFA 1VBB1 5FY9A 3FHAA 5FKCA 4CDWB 3RNSA 3DV8A 3THPA 5FZ4A 4Z2AA 1VRBA 4Q4Y1 4CDUB 1B09A 5CFCC 3OGJA 2YFUA 5FY7A 5T5OA 4QB6A 1UIJA 5EFUA 1J3PA 1YIPA 1YJKA 1RJ8A 3WCRA 4B4PA 5HBAA 4AEDA 3ZN6A 4G9SB 3VDDB 4JDOA 5A33B 4CU7A 5JOZA 1HLCA 1Q8OA 1YHFA 4YWAA 3A4UA 4E27A 2FQPA 2XUEA 1RHI1 3T08A 3APBA 4P9JA 2BEOA 3A23A 1JOJA 2NQYA 4M01A 1W6NB 4JCKA 5LBBA 1BMV2 1WMEA 1IKPA 1YO8A 2RMU1 1B35B 2W1SA 3HEIA 3KVBA 4KU7A 3WNOA 4DIQA 4GMP0 2DTYA 2VR4A 3K51A 4FT8A 4S2HA 5EV7A 1AR81 4PIYA 5HV0A 4M4RA 2O8OA 2VULA 5FMCA 5SV8A 3ETQA 2Q5TA 1FAYA 3MW3A 2BFUS 4Q26A 4Z8BA 5HI0A 2FCVA 4R4ZA 1XQNA 3BPZA 2RS13 3J8F1 2GZWA 4JKKA 5FO9B 4R4XA 2BWAA 3U1XA 2RDSA 3I2KA 1UY4A 4HK8A 1R1A1 3IBMA 4HMZA 4JGYA 4LA2A 3VBOB 2IVJA 5FZMA 3DECA 2WNUC 4CRQA 4OMDA 2VVDA 4MGZE 4JGZB 2NMNA 3HBZA 2XLGA 1UW8A 4KWLA 1QJU1 2PAEA 2NYYA 4RR3C 3SEEA 1DF0A 3IZOA 4Q0QA 1JZ4A 3FX3A 1C8M3 4MHRA 3AMMA 3IKWA 3VBHC 4HKLA 1URXA 1V70A 3S5QA 1DP0A 4IV1C 1N1SA 1XRUA 3ACLA 4XILA 2C6SA 1SMVA 4MYEA 1VE0A 2YU2A 3WQ1A 4J6GA 4META 3GCWA 4YM0A 1AHSA 3DN7A 5A3NA 3NQHA 5LK5A 1YUDA
chains in the Genus database with same CATH topology
3WNNA 4LHSA 2E31A 2EICA 3FN9A 1JZ6A 4PF1A 3T0BA 1OH4A 1K45A 3WEZA 3A22A 5G04L 2C4XA 5B4NA 4XZUG 1NX9A 2ZEWA 2WO3A 3P1IA 4CU8A 2WO1A 4GZ9A 4E8DA 5JR2A 3VDBA 4ARXA 1K42A 1NAEA 2QQNA 1W0NA 4DXTA 4KMQA 4QDSA 1F4HA 4JX0A 2W9XA 2VQUA 4MGQA 2RJ2A 3C7HA 3K77A 2BERA 2J1SA 1EUTA 1TVGA 1O8SA 3MUY1 1CIYA 2E26A 1UY1A 2ZEZA 2W91A 4IUGA 4LPLA 4TXWA 2VMCA 2J1EA 3MV01 3CZJA 3GXUA 4BJ0A 1US2A 3T09A 2VCBA 5EIYB 1UMHA 4ZXEA 4W8JA 2DDUA 1PX3A 2HYXA 3OGVA 4A4AA 3T0AA 4OMCA 2YC2A 2YG0A 2VZ1A 4QX1A 5HXMA 1K12A 4TTGA 4BXSV 2J1TA 2WAOA 3I2FA 2VMEA 1UY3A 2ID4A 2KD7A 2VZUA 5LCWL 1CX1A 1GOGA 3W5NA 4XUNA 3OGSA 3WNLA 2VZOA 4XUQA 4QPWA 3WF1A 5F7UA 2XQXA 1UX7A 2W46A 3WF2A 3I2JA 3VD5A 4BDVB 5JXIA 4MADA 2YC4A 1W8NA 2QQKA 2VMDA 3MUZ1 5JXJA 5C70A 3EB7A 2W92A 1XC6A 3ABZA 5EJZB 3P6BA 1O8PA 2VJXA 1W9SA 4DEVA 2HLEA 1GU3A 3OEBA 2W3JA 3PUHA 4CUBA 4E8CA 2Y6KA 4CU9A 3HNYM 1OF3A 4XVHA 2V72A 4P5YA 2EIBA 5CZKA 4P00B 2OKXA 2YB7A 3OBAA 2C26A 2X10A 5FUIA 4DUWA 2VZPA 3AC0A 2BZDA 1RYYA 1R64A 5LA0A 2VZSA 5J1XA 4GWIA 1JYXA 3ACFA 5DMYA 1XNAA 3CIHA 2VMFA 3HNBM 4QDQA 3I97A 4ET7A 2J22A 1J83A 1UYXA 2VCCA 5IFPA 2L9LA 1US3A 1XNTA 5IJRA 1F4AA 2PQSA 1IQDC 1JYVA 2CDOA 4W4ZA 2RV9A 3LEGA 1W99A 1JI6A 4M4PA 1OT5A 2E32A 4DXSA 2VM9A 1UWWA 5LA1A 3OGRA 1LNSA 2W47A 3THCA 3THDA 4CVUA 2XHNA 1GOFA 1MPXA 2V5DA 3VD9A 2BGOA 3E1F1 2VZTA 4GWJA 2J1AA 3FHQA 4FI9A 4XUPA 2W95A 4MOAA 1O59A 3T2OA 1JHJA 2XOMA 5JMOA 3LPGA 3NRUA 3VD3A 1NUKA 1NKGA 2LW8A 5DQ0A 3IAQA 1KEXA 3F2ZA 1TG7A 5DPNA 3LEKA 2B4KA 5JXGA 1PMJX 3U37A 1UMIA 4QX0A 1UZ0A 1P8JA 3MBWA 1WCQA 2E33A 2Y6LA 1JZ5A 4XUOA 3ACGA 1OD3A 2R7EB 2Y6JA 2WQ8A 3K4AA 2WO2A 4D8MA 2QBXA 3VD4A 5IYYA 1HN1A 1H6XA 3OEAA 4D0QA 3VDAA 2WAAA 4OYUA 4UI9L 4LQRA 4UOJA 3K46A 2WZ8A 5IHRA 2Y6GA 1GOHA 4P02B 4BK4A 1GNYA 4XUTA 4RN5A 3T0DA 1CZSA 4A45A 2QQIA 2WBKA 3C7EA 1SDDB 2VC9A 3WF3A 3UESA 2VL4A 1CZTA 1JZ2A 3I3EA 3CDZB 4ZZ5A 2B9VA 1OF4A 4QDRA 3I2GA 3NJXA 4QX3A 4CUCA 4UAPA 3MO4A 3K4ZA 3ECQA 2JKXA 4KI5M 2CDPA 3WNPA 2VCAA 3VDCA 1UYYA 5G05L 3OG2A 4QB2A 1K3IA 2VTFA 1D7PM 3I3DA 2VZRA 4HG6B 1UXXX 2DCKA 3OB8A 5JUVA 2RVAA 3C7OA 1DLCA 3WNKA 2Y6HA 2ZEYA 3FL7A 3DYPA 3CKHA 1CZVA 4AAXA 3HN3A 3VD7A 4JHZA 4A3ZA 5JXHA 4ZY9A 3GDBA 3HNMA 4L0PA 2ORZA 3ACIA 2WABA 3C8XA 5C71A 1XPWA 2VZ3A 1JYNA 4QX2A 2WN3A 4JKLA 2Y8KA 4AG4A 4DUVA 5C7GA 4DEQA 4YPJA 1GMMA 1JZ8A 4QB1A 2VQTA 2C9KA 4DUXA 4CUAA 1ULOA 3I2IA 3ACHA 2QQJA 2W5FA 4ARYA 3WQBA 3A21A 2QQMA 1I5PA 2Z4FA 3LQCA 1JZ7A 1GUIA 3LE0A 1W9WA 2QQLA 2VZQA 4DXRA 1UXZA 2J1RA 2J7MA 3HPNA 2J1UA 3I3BA 2WN2A 1GQPA 2JDAA 5B4XA 1JZ3A 2WYSA 2VZVA 1JU4A 2W87A 3D3AA 4XURA 2W1QA 4RYDA 1JYWA 4LKSA 3LEIA 3BN6A 3EYPA 3SKVA 2ZXQA 2ZEXA 4JKMA 4KWUA 2DCJA 1PX4A 1EUUA 3K75B 3MV11 5DN2A 3T2PA 5IFTA 3DYOA 3HOBA 3PUIA 4PQQA 3LPFA 5I0DA 3IAPA 2W1UA 2X09A 3NJVA 4A44A 2JD9A 3GM8A 1KGYA 3IB3A 4MGSA 3BGAA 4MO3M 1UYZA 4QAWA 3WNMA 5HPOA 2BBAA 3WF0A 2QQOA 3IIIA 2W1WA 4CU6A 4A41A 1BHGA 3K4DA 3A7QA 3HJRA 3JXSA 4PT6A 3IDAA 2WZEA 3WSOA 1PMHX 2BGPA 2EIDA 3FHAA 3W5MA 3SEPA 3ETPA 1ULPA 4Z2AA 3CMGA 2YFUA 4OUEA 4QB6A 4A42A 4ZZ8A 1J84A 3CQOA 5EJ1B 5LA2A 4CU7A 3J7HA 1L7QA 1SG3A 2VOTA 3T08A 2Y64A 3DYMA 4P08A 2YFZA 1W8OA 4OZOA 3A23A 1YQ2A 3UETA 1UY2A 2W1SA 3HEIA 3WNOA 2EIEA 2VR4A 4A6OA 1H6YA 1SHWB 2W94A 1DYOA 4M4RA 3CZUA 3I2HA 3GGLA 4JKKA 2WUHA 3I2KA 1UY4A 2JE8A 1W9TA 1L7RA 3DECA 3C7FA 4OMDA 1JU3A 2WDBA 3NNGA 2ORXA 1T2XA 3SEEA 3T2QA 5A1AA 3SKJE 1JZ4A 3UNPA 2LS6A 2XONA 1WKYA 5CYYA 2VO5A 1DP0A 2X05A 1UY0A 3WF4A 4W50A 2V4VA 3C7GA 3NQHA 3ZM8A 2J1VA 4BK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WNN A;  4LHS A;  2E31 A;  2EIC A;  3FN9 A;  1JZ6 A;  4PF1 A;  3T0B A;  1OH4 A;  1K45 A;  3WEZ A;  3A22 A;  5G04 L;  2C4X A;  5B4N A;  4XZU G;  1NX9 A;  2ZEW A;  2WO3 A;  3P1I A;  4CU8 A;  2WO1 A;  4GZ9 A;  4E8D A;  5JR2 A;  3VDB A;  4ARX A;  1K42 A;  1NAE A;  2QQN A;  1W0N A;  4DXT A;  4KMQ A;  4QDS A;  1F4H A;  4JX0 A;  2W9X A;  2VQU A;  4MGQ A;  2RJ2 A;  3C7H A;  3K77 A;  2BER A;  2J1S A;  1EUT A;  1TVG A;  1O8S A;  3MUY 1;  1CIY A;  2E26 A;  1UY1 A;  2ZEZ A;  2W91 A;  4IUG A;  4LPL A;  4TXW A;  2VMC A;  2J1E A;  3MV0 1;  3CZJ A;  3GXU A;  4BJ0 A;  1US2 A;  3T09 A;  2VCB A;  5EIY B;  1UMH A;  4ZXE A;  4W8J A;  2DDU A;  1PX3 A;  2HYX A;  3OGV A;  4A4A A;  3T0A A;  4OMC A;  2YC2 A;  2YG0 A;  2VZ1 A;  4QX1 A;  5HXM A;  1K12 A;  4TTG A;  4BXS V;  2J1T A;  2WAO A;  3I2F A;  2VME A;  1UY3 A;  2ID4 A;  2KD7 A;  2VZU A;  5LCW L;  1CX1 A;  1GOG A;  3W5N A;  4XUN A;  3OGS A;  3WNL A;  2VZO A;  4XUQ A;  4QPW A;  3WF1 A;  5F7U A;  2XQX A;  1UX7 A;  2W46 A;  3WF2 A;  3I2J A;  3VD5 A;  4BDV B;  5JXI A;  4MAD A;  2YC4 A;  1W8N A;  2QQK A;  2VMD A;  3MUZ 1;  5JXJ A;  5C70 A;  3EB7 A;  2W92 A;  1XC6 A;  3ABZ A;  5EJZ B;  3P6B A;  1O8P A;  2VJX A;  1W9S A;  4DEV A;  2HLE A;  1GU3 A;  3OEB A;  2W3J A;  3PUH A;  4CUB A;  4E8C A;  2Y6K A;  4CU9 A;  3HNY M;  1OF3 A;  4XVH A;  2V72 A;  4P5Y A;  2EIB A;  5CZK A;  4P00 B;  2OKX A;  2YB7 A;  3OBA A;  2C26 A;  2X10 A;  5FUI A;  4DUW A;  2VZP A;  3AC0 A;  2BZD A;  1RYY A;  1R64 A;  5LA0 A;  2VZS A;  5J1X A;  4GWI A;  1JYX A;  3ACF A;  5DMY A;  1XNA A;  3CIH A;  2VMF A;  3HNB M;  4QDQ A;  3I97 A;  4ET7 A;  2J22 A;  1J83 A;  1UYX A;  2VCC A;  5IFP A;  2L9L A;  1US3 A;  1XNT A;  5IJR A;  1F4A A;  2PQS A;  1IQD C;  1JYV A;  2CDO A;  4W4Z A;  2RV9 A;  3LEG A;  1W99 A;  1JI6 A;  4M4P A;  1OT5 A;  2E32 A;  4DXS A;  2VM9 A;  1UWW A;  5LA1 A;  3OGR A;  1LNS A;  2W47 A;  3THC A;  3THD A;  4CVU A;  2XHN A;  1GOF A;  1MPX A;  2V5D A;  3VD9 A;  2BGO A;  3E1F 1;  2VZT A;  4GWJ A;  2J1A A;  3FHQ A;  4FI9 A;  4XUP A;  2W95 A;  4MOA A;  1O59 A;  3T2O A;  1JHJ A;  2XOM A;  5JMO A;  3LPG A;  3NRU A;  3VD3 A;  1NUK A;  1NKG A;  2LW8 A;  5DQ0 A;  3IAQ A;  1KEX A;  3F2Z A;  1TG7 A;  5DPN A;  3LEK A;  2B4K A;  5JXG A;  1PMJ X;  3U37 A;  1UMI A;  4QX0 A;  1UZ0 A;  1P8J A;  3MBW A;  1WCQ A;  2E33 A;  2Y6L A;  1JZ5 A;  4XUO A;  3ACG A;  1OD3 A;  2R7E B;  2Y6J A;  2WQ8 A;  3K4A A;  2WO2 A;  4D8M A;  2QBX A;  3VD4 A;  5IYY A;  1HN1 A;  1H6X A;  3OEA A;  4D0Q A;  3VDA A;  2WAA A;  4OYU A;  4UI9 L;  4LQR A;  4UOJ A;  3K46 A;  2WZ8 A;  5IHR A;  2Y6G A;  1GOH A;  4P02 B;  4BK4 A;  1GNY A;  4XUT A;  4RN5 A;  3T0D A;  1CZS A;  4A45 A;  2QQI A;  2WBK A;  3C7E A;  1SDD B;  2VC9 A;  3WF3 A;  3UES A;  2VL4 A;  1CZT A;  1JZ2 A;  3I3E A;  3CDZ B;  4ZZ5 A;  2B9V A;  1OF4 A;  4QDR A;  3I2G A;  3NJX A;  4QX3 A;  4CUC A;  4UAP A;  3MO4 A;  3K4Z A;  3ECQ A;  2JKX A;  4KI5 M;  2CDP A;  3WNP A;  2VCA A;  3VDC A;  1UYY A;  5G05 L;  3OG2 A;  4QB2 A;  1K3I A;  2VTF A;  1D7P M;  3I3D A;  2VZR A;  4HG6 B;  1UXX X;  2DCK A;  3OB8 A;  5JUV A;  2RVA A;  3C7O A;  1DLC A;  3WNK A;  2Y6H A;  2ZEY A;  3FL7 A;  3DYP A;  3CKH A;  1CZV A;  4AAX A;  3HN3 A;  3VD7 A;  4JHZ A;  4A3Z A;  5JXH A;  4ZY9 A;  3GDB A;  3HNM A;  4L0P A;  2ORZ A;  3ACI A;  2WAB A;  3C8X A;  5C71 A;  1XPW A;  2VZ3 A;  1JYN A;  4QX2 A;  2WN3 A;  4JKL A;  2Y8K A;  4AG4 A;  4DUV A;  5C7G A;  4DEQ A;  4YPJ A;  1GMM A;  1JZ8 A;  4QB1 A;  2VQT A;  2C9K A;  4DUX A;  4CUA A;  1ULO A;  3I2I A;  3ACH A;  2QQJ A;  2W5F A;  4ARY A;  3WQB A;  3A21 A;  2QQM A;  1I5P A;  2Z4F A;  3LQC A;  1JZ7 A;  1GUI A;  3LE0 A;  1W9W A;  2QQL A;  2VZQ A;  4DXR A;  1UXZ A;  2J1R A;  2J7M A;  3HPN A;  2J1U A;  3I3B A;  2WN2 A;  1GQP A;  2JDA A;  5B4X A;  1JZ3 A;  2WYS A;  2VZV A;  1JU4 A;  2W87 A;  3D3A A;  4XUR A;  2W1Q A;  4RYD A;  1JYW A;  4LKS A;  3LEI A;  3BN6 A;  3EYP A;  3SKV A;  2ZXQ A;  2ZEX A;  4JKM A;  4KWU A;  2DCJ A;  1PX4 A;  1EUU A;  3K75 B;  3MV1 1;  5DN2 A;  3T2P A;  5IFT A;  3DYO A;  3HOB A;  3PUI A;  4PQQ A;  3LPF A;  5I0D A;  3IAP A;  2W1U A;  2X09 A;  3NJV A;  4A44 A;  2JD9 A;  3GM8 A;  1KGY A;  3IB3 A;  4MGS A;  3BGA A;  4MO3 M;  1UYZ A;  4QAW A;  3WNM A;  5HPO A;  2BBA A;  3WF0 A;  2QQO A;  3III A;  2W1W A;  4CU6 A;  4A41 A;  1BHG A;  3K4D A;  3A7Q A;  3HJR A;  3JXS A;  4PT6 A;  3IDA A;  2WZE A;  3WSO A;  1PMH X;  2BGP A;  2EID A;  3FHA A;  3W5M A;  3SEP A;  3ETP A;  1ULP A;  4Z2A A;  3CMG A;  2YFU A;  4OUE A;  4QB6 A;  4A42 A;  4ZZ8 A;  1J84 A;  3CQO A;  5EJ1 B;  5LA2 A;  4CU7 A;  3J7H A;  1L7Q A;  1SG3 A;  2VOT A;  3T08 A;  2Y64 A;  3DYM A;  4P08 A;  2YFZ A;  1W8O A;  4OZO A;  3A23 A;  1YQ2 A;  3UET A;  1UY2 A;  2W1S A;  3HEI A;  3WNO A;  2EIE A;  2VR4 A;  4A6O A;  1H6Y A;  1SHW B;  2W94 A;  1DYO A;  4M4R A;  3CZU A;  3I2H A;  3GGL A;  4JKK A;  2WUH A;  3I2K A;  1UY4 A;  2JE8 A;  1W9T A;  1L7R A;  3DEC A;  3C7F A;  4OMD A;  1JU3 A;  2WDB A;  3NNG A;  2ORX A;  1T2X A;  3SEE A;  3T2Q A;  5A1A A;  3SKJ E;  1JZ4 A;  3UNP A;  2LS6 A;  2XON A;  1WKY A;  5CYY A;  2VO5 A;  1DP0 A;  2X05 A;  1UY0 A;  3WF4 A;  4W50 A;  2V4V A;  3C7G A;  3NQH A;  3ZM8 A;  2J1V A;  4BK5 A; 
#chains in the Genus database with same CATH topology
 3WNN A;  4LHS A;  3ZFE C;  1NE6 A;  2E31 A;  2EIC A;  2VOK A;  3FN9 A;  4NR1 A;  4PF1 A;  5F32 A;  3T0B A;  3RDI A;  1OH4 A;  3D5O A;  1ZBE 1;  3RMY A;  5F1R A;  4JTO A;  2CSG A;  2GC1 A;  4KGQ A;  1VRH 3;  3M7A A;  4AHX A;  2WQ4 A;  2RE9 A;  4K1Y A;  1C4R A;  1NX9 A;  1BCX A;  2E7T A;  4XF1 A;  2XJU A;  3NVC A;  1AYM 1;  5FZI A;  4DQA A;  1OPM A;  1MEC 2;  2V5Y A;  4GZ9 A;  3RZJ A;  2OX0 A;  4A3X A;  4P9X A;  4XFH A;  1RUE 3;  3HT1 A;  1LOA A;  3F95 A;  4KH9 A;  1K42 A;  1DZQ A;  3WDX A;  1R08 1;  1W0N A;  1YRZ A;  2R1B A;  1A78 A;  4JX0 A;  3VLB B;  2FDH A;  4GMP 1;  2HWB 2;  1PO1 1;  5FFO C;  2YY1 A;  5T5L A;  1WW4 A;  3QCW A;  4Y1Z A;  1MS8 A;  3HD8 B;  3K77 A;  3P3P A;  4MX3 A;  3QBQ A;  1Y7B A;  2BER A;  2J1S A;  1EUT A;  2V4A A;  2QFE A;  1MS5 A;  2WIN B;  3KCY A;  2K2S A;  3KHB A;  4ISR A;  1QQP 3;  3MUY 1;  5DUV A;  3AJZ A;  3VBR B;  4MGI E;  1D4M 1;  1W6O B;  1UY1 A;  1BVV A;  5A7S A;  1ZA7 A;  1TMF 1;  1UU4 A;  2PHT A;  2UWA A;  1AYN 1;  3AXE A;  5FZ8 A;  4LPL A;  1RUH 2;  2OQ7 A;  4TXW A;  4NHK A;  4KWK A;  5CFC B;  2K9Z A;  2RR1 2;  2BQP A;  3TBD A;  4BM8 A;  1WCK A;  1MQT C;  1CAV A;  5GKA C;  3OY8 A;  4R52 A;  1F5F A;  1WCD J;  4O9E A;  3CJX A;  3ON7 A;  4HN0 A;  2I45 A;  1UMH A;  2CWS A;  4XJU A;  4W8J A;  1W06 A;  2D93 A;  2IZW A;  3ILR A;  5FK8 A;  4QPI B;  3KHC A;  2GDF A;  1U0A A;  3WW3 A;  1AUY A;  2YC2 A;  2YG0 A;  3BUC A;  2Q8D A;  4BXS V;  2A3Y A;  1APN A;  2WAO A;  2X8K A;  1RUG 2;  1NE4 A;  4O7X A;  4J25 A;  4XE9 A;  2HWE 1;  3PVN A;  4Y1X A;  4LUL A;  2VZU A;  3RRD A;  5DZF A;  4C0B A;  1RIN A;  5KXE A;  1GOG A;  1AZD A;  1S0F A;  3MIG A;  4XAC A;  1U5Y A;  2VU9 A;  4YGC A;  4C1X A;  5L19 A;  3O1U A;  1RUN A;  3V0A A;  3FMG A;  3KLS A;  1SLC A;  4QMA A;  1KFU L;  4FFI A;  2W46 A;  4CXW A;  2TEP A;  2P6H A;  3OD0 A;  2QQK A;  1XSR A;  1VBE 3;  2VMD A;  1WLT A;  4N9H A;  1CPN A;  1GBG A;  4D69 A;  2BVB A;  4Y4Y A;  2CHH A;  4D7Y A;  3AYC A;  5J37 A;  1EV1 3;  2LAL A;  2QZ3 A;  2VPV A;  3P6B A;  4AVB A;  1DQ0 A;  2B46 X;  4XAA A;  4DEV A;  3S7E A;  1PGW 2;  4O65 A;  3KS7 A;  3GNE A;  4CUB A;  5L9B A;  4C0H A;  3U75 A;  1OLQ A;  3HNY M;  5FZO A;  2OUJ A;  1AR7 2;  4HLT A;  4XVH A;  1GQG A;  1VBA 3;  2ENR A;  3MGU A;  1REF A;  1QJE A;  2X5I B;  1V6J A;  4MSV A;  1W6M B;  3T3Y A;  5ANN A;  2R04 1;  1S4C A;  1SCR A;  2HWF 3;  3QOP A;  4QQH A;  5D8A B;  1NCQ B;  2OKX A;  5L9V A;  1M06 G;  3POB A;  5FUI A;  4FPY A;  3HIF A;  3M3Q A;  5DUU A;  5KHG A;  4DUW A;  1DZT A;  2OPK A;  3AC0 A;  3M3O A;  2HWC 1;  1R64 A;  3HN1 A;  4W65 A;  2VZS A;  3O0W A;  3URF A;  5LA0 A;  2WYF A;  1W8F A;  1XJA A;  5J1X A;  4YFW A;  4CDX A;  1ZRR A;  2F6B A;  4WZC A;  1GZ9 A;  1ENX A;  4IGP A;  5DDJ 2;  2XXZ A;  1XNB A;  5CFD B;  2UY9 A;  3LA2 A;  4I09 A;  2WZR 3;  1OQE A;  4H7M A;  3UGF A;  2B9U A;  2ZKL A;  3HNB M;  3D0S A;  4MHU A;  2V09 A;  1ZNP A;  3WG3 A;  1UYX A;  2VCC A;  2L9L A;  4FQ4 A;  3WCS A;  4JC1 A;  1O4Y A;  1F4A A;  1SLI A;  4WVM B;  5FYZ A;  1LHW A;  5A7W A;  1LU1 A;  1VBC 1;  4NHX A;  2CDO A;  2ZAC A;  4YVS C;  5HV4 A;  4FQZ A;  1UKG A;  1O4Z A;  4MGY E;  1FNZ A;  4P9G A;  1JI6 A;  5A7O A;  4CP9 A;  1KS4 A;  2A6Z A;  1AL2 1;  4NPR A;  3WNX A;  2DVG A;  4AFD A;  1FPN 2;  4IEU A;  4AHY A;  4DXS A;  5CNA A;  4ASK A;  5LA1 A;  3THC A;  1EAH 3;  3N35 A;  1BEV 1;  4YW2 A;  3WP4 A;  2JD4 A;  1U5X A;  4AI1 A;  2JX9 A;  1YCI A;  2UYB A;  2BOI A;  1GOF A;  2V5D A;  2W68 A;  2BGO A;  1A6C A;  1U12 A;  5JZG B;  5FZ0 A;  3A0K A;  3PU8 A;  1GYK A;  4GWJ A;  4XF0 A;  4FI9 A;  4OQ8 A;  2DCT A;  1O59 A;  5FMO S;  4RS5 C;  1ULE A;  4Q4X 3;  2PHU A;  2XOM A;  5DUW A;  5T54 A;  4U2A A;  4ZU4 A;  1NA1 C;  3RVH A;  3SXW A;  2YMZ A;  3ZLI A;  1HB3 A;  3NRU A;  4R9C A;  2LW8 A;  4FFH A;  5LBC A;  2BWC A;  5KXB A;  1KEX A;  3N7L A;  4LXL A;  3ZKU A;  4YGD A;  5FZL A;  2CYF A;  4NHY A;  4WVZ A;  4Y1U A;  3LEM A;  4HN1 A;  4KL1 A;  5F5A A;  5DPN A;  1IGO A;  1R1Z A;  5AFE A;  2B4K A;  1W8U A;  1HRV 2;  3B00 A;  3K3O A;  4UWD A;  2BPA 2;  4K8F A;  1G9F A;  1LUL A;  4FBF A;  1RJ7 A;  2DVB A;  1KDK A;  1WCQ A;  5FP7 A;  4UBH A;  3WHU A;  1NLR A;  3H8O A;  1UF2 C;  4XIK A;  3DGT A;  4JV4 A;  1H1A A;  4XUO A;  5LEJ A;  3G6J B;  4R9D A;  2ZX4 A;  3USU A;  2D6M A;  3LOB A;  2Y6J A;  3K4A A;  2OPW A;  2RS5 1;  1VBB 2;  2JKB A;  5A1L A;  5FWJ A;  1X82 A;  3VD4 A;  3NV2 A;  5BNP A;  4RD7 A;  2PHX A;  3FBM A;  1TEI A;  4XBQ A;  3WQ0 A;  4YW4 A;  5A7P A;  4ASL A;  1UQX A;  4UI9 L;  5FPL A;  3DXU A;  3DPR C;  3K2O A;  4PQ9 A;  3I3M A;  1POV 0;  2E7A A;  4Z07 A;  2CV6 A;  1W8W A;  2WZ8 A;  3ZSK A;  5EHD A;  3HQU A;  2Y6G A;  4B4R A;  5CU1 A;  2RM2 3;  1GNY A;  5FXX A;  1T6G C;  4JRL A;  1RIR A;  1RHI 2;  1CAW B;  2F17 A;  1YNA A;  2XBO 3;  3ES1 A;  4FPK A;  4HET A;  4N7I A;  2WBK A;  3C7E A;  5AVA A;  2VC9 A;  3ZYI B;  1CZT A;  4ES9 A;  1W05 A;  5T3N A;  1NG0 A;  3RJR A;  2RMU 2;  3RYP A;  4AFC A;  2C9A A;  4QKF A;  4Y22 B;  4K8R B;  1AR8 2;  4WZF A;  4HK9 A;  3SH3 A;  3VHN A;  1W90 A;  2FDJ A;  3IPV B;  4FTE A;  4CCO A;  1Q8Q A;  3QAC A;  5FY4 A;  1RMU 1;  4PBO A;  5I0U A;  3J8F 2;  3NJX A;  3POE A;  4QX3 A;  4UAP A;  1SPP B;  3AMQ A;  3CNA A;  4YW7 A;  1R1A 2;  1LOE A;  2JDH A;  3AMP A;  4Q4V 3;  4TN7 A;  4KI5 M;  2KXL A;  1FYU A;  1WMX A;  3DKQ A;  1NQD A;  3WNP A;  2VCA A;  1BLZ A;  1ND2 B;  3DEM A;  5F2W A;  3VZJ A;  2WWJ A;  3Q8E A;  2XUM A;  3M4F A;  3FLT A;  4QKN A;  4LOR A;  1D7P M;  4NJ4 A;  5FZ7 A;  2VZR A;  1QJU 2;  4E9K A;  1RUC 3;  2DFC A;  5EJ3 A;  4AFM A;  2DCK A;  3OB8 A;  2IVI B;  2RVA A;  3C7O A;  4K20 A;  5FYU A;  1B35 C;  3VBS B;  3I59 B;  2ZEY A;  3FL7 A;  5KC5 A;  3DYP A;  5KBF A;  1CR7 A;  5AC9 1;  4CCK A;  3RWK X;  2WA3 A;  4AAX A;  1RVF 3;  3HN3 A;  2XJR A;  4ZY9 A;  3JQW A;  2EXJ A;  4GAL A;  4YG6 A;  5FKB A;  5GLW A;  3VB9 A;  1Y4W A;  5E16 A;  3I2O A;  4ORF A;  1LHN A;  1ODN A;  3ACI A;  5C71 A;  3C8X A;  2ZCW A;  3VBO C;  4C91 A;  3JD7 1;  1LOC A;  4UF0 B;  5FLI A;  3W20 A;  1REE A;  1PNF A;  3NAP A;  1H4H A;  5GLU A;  4AG4 A;  1ZBE 2;  1STM A;  3BTZ A;  2VXJ A;  5GZF A;  2QQW A;  4AYU A;  1W28 A;  5FZF A;  4YW6 A;  1AJO A;  1JHN A;  2GSY A;  4LBL A;  4EE2 A;  5LWB A;  3O1M A;  4LUM A;  1GMM A;  4IET A;  2XG3 A;  4L8Q A;  4XBL A;  1TME 1;  2GP5 A;  1NCR C;  5KXD A;  1POV 1;  1FNY A;  2MEV 1;  1AYM 2;  2C9K A;  4QPG A;  5FPU A;  1O5L A;  2VAU A;  1YQC A;  2BVV A;  1PO2 1;  3I2I A;  2VNR A;  1GZT A;  2I2S A;  3LWC A;  1UIK A;  1W2O A;  3M1H A;  3RZL A;  4XFF A;  1R08 2;  2B5H A;  3WQB A;  1ND3 A;  4BOW A;  4BPZ A;  1SAC A;  2EF6 A;  1X9T A;  3J9S A;  3LQC A;  3AMN A;  1PO1 2;  2DVF A;  1MS9 A;  3AFK A;  1M4W A;  1W9W A;  3WVJ A;  4EWD A;  5CEH A;  4KU8 A;  2WWU A;  4WM8 C;  1WZX A;  1H0B A;  2P3K A;  2ZX3 A;  4XYX A;  5JSO A;  1ST8 A;  2QE3 A;  3PMS A;  2VQA A;  1UXZ A;  3HPN A;  4AVA A;  3MW4 A;  3FFZ A;  1D4M 2;  4SLI A;  2DBI A;  4I0W B;  4NWV A;  1TMF 2;  2ZKN A;  2VNV A;  1AYN 2;  4AFB A;  1O5U A;  1YJL A;  5DAQ A;  5A7N A;  1XNK A;  2MPF A;  4NID A;  2P17 A;  4HFS A;  2G9G A;  4AED B;  1JUH A;  3ZN6 B;  4YSF A;  3OBZ A;  1GZC A;  4XIO A;  4COV A;  1LOG A;  2P4E A;  1BBT 3;  1OA4 A;  4GH4 A;  3SKV A;  4UW6 A;  3VL8 A;  3UT0 A;  1SFP A;  2R07 3;  2ZEX A;  3POW A;  4JKM A;  4XJZ A;  5FK7 A;  3ZIX A;  1PVC 1;  1PX4 A;  1UZW A;  3UJO A;  3T2P A;  2UYA A;  1WW6 A;  2VOV A;  4YZ4 A;  3PUS A;  3E5X A;  4XFA A;  3LPF A;  2ETE A;  2YDE A;  1CJP A;  3IAP A;  4LBM A;  4LK7 A;  4HXC A;  4M3C F;  3L2H A;  5L9R A;  2HWE 2;  3JUU A;  1O7F A;  4A44 A;  4IGO A;  3FHI B;  3PJQ A;  2OII A;  4LBQ D;  3ZPO A;  5LW9 A;  5EWS A;  1UU6 A;  5HCB A;  1OOP A;  4JGY B;  3LSE A;  2G9Z A;  3BGA A;  1UYZ A;  5A6Q A;  3M3C A;  4YZ2 A;  2BBA A;  1CPM A;  1AXZ A;  1LCL A;  3ILN A;  1ULC A;  2W0X A;  2GN3 A;  4I3G A;  4QT6 A;  4CU6 A;  4UXA A;  1I1E A;  3ZXJ A;  5FZ9 A;  3K4D A;  3A7Q A;  3VBF A;  4CEY A;  3HT2 A;  1DYK A;  3RFR A;  1BXH A;  1TNR A;  2IWG B;  2PMW B;  2WZE A;  2CU5 A;  2HWD 1;  5JI9 A;  4IE6 A;  2VVE A;  4QGM A;  5F6K A;  4IER A;  1IS4 A;  1ONA A;  2EID A;  1AR9 3;  5EQU A;  2VMI A;  4NAM A;  2P1B A;  3ETP A;  3B94 A;  3CMG A;  4AQ6 A;  2WLQ A;  4OUE A;  2R04 2;  1CD3 G;  4ZU5 A;  2WL1 A;  3G7D A;  4ZZ8 A;  4CP2 A;  5CBL A;  2VUJ A;  1DYP A;  4HVR A;  2UWC A;  4M0N A;  2HWC 2;  4BLI A;  3PHM A;  1XXN A;  5LA2 A;  5IK5 A;  2FCU A;  5FO8 B;  5IUQ A;  3KM5 A;  4PBP A;  4IEW A;  4ONU A;  3J26 N;  3AKQ A;  4QHZ A;  4QU2 A;  2VOT A;  2JIG A;  1RUD 3;  2Y64 A;  3DYM A;  5IWF A;  1HRI 1;  2YFZ A;  1FAT A;  4X8P A;  4FP3 A;  1YQ2 A;  1GSL A;  3ZXA C;  3ENR A;  4XPV A;  3UET A;  2HKX A;  2ATF A;  4YG3 A;  3PTR B;  3WP6 A;  4IEY A;  4Q0V A;  2W94 A;  1DYO A;  1TZO A;  4LLO A;  4S2F A;  2VY0 A;  1OHF A;  4BIS A;  3AYA A;  2VW0 A;  1O3Q A;  4NWW A;  2E9Q A;  2E6V A;  1OC1 A;  4BH9 A;  2G4I A;  5A70 A;  5T5J A;  1NCQ C;  4HPK A;  3CF6 E;  1L7R A;  1GAN A;  1PK6 A;  4IE5 A;  5F37 A;  1NLQ A;  1G6N A;  3C7F A;  4QHB A;  1ZX5 A;  4H14 A;  3MEP A;  4Y26 A;  1AL2 2;  2FDK A;  3VGI A;  1BJQ A;  5IK4 A;  4L97 A;  2N7G A;  1IS5 A;  1V00 A;  3AZY A;  2ORX A;  3MF6 A;  4XBN A;  1BEV 2;  4AEJ A;  3LFM A;  2OT7 A;  1PZ7 A;  1WLD A;  2P3I A;  5F3I A;  3T2T A;  1AVB A;  2ADD A;  2R06 3;  3T2Q A;  5CFD C;  4DOU A;  3UNP A;  1UNB A;  1WA4 A;  2LS6 A;  4FPC A;  4AI2 A;  4COZ A;  2XON A;  4LIU A;  2VO5 A;  2QDR A;  3OUI A;  1CAV B;  4RQP A;  3RZH A;  3IT8 A;  3OY8 B;  3KF5 A;  5DAB A;  1VP6 A;  3KCX A;  5I93 A;  1HQW A;  2V4V A;  4NMI A;  4W50 A;  4LK6 A;  5FYT A;  5FRA A;  1UZZ A;  2PLV 1;  4NIG A;  2J1V A;  4BK5 A;  5J48 A;  2PAM A;  2VCM A;  1JZ6 A;  1AXY A;  5CFC A;  4MXV A;  4NIH A;  2YV8 A;  3LDB A;  1VAL A;  1DQ1 A;  4NAO A;  5CIS A;  4LO8 A;  1XYN A;  4MVT A;  1E57 A;  2VVF A;  5FYI A;  2Z42 A;  1HXS 1;  4OUS A;  2P3J A;  2ZEW A;  2YBP A;  4F83 A;  1NXD 1;  3V0A B;  2WO1 A;  2KA3 A;  5JZG C;  2WT0 A;  3KZ4 C;  5JR2 A;  3WDU A;  3WDV A;  4ARX A;  1VAK A;  2OA2 A;  2B45 X;  1AX1 A;  2RS5 2;  3SLI A;  1EPW A;  3CBN A;  4XFI A;  2QQN A;  1YWK A;  3RSJ A;  2RDQ A;  3T1L A;  4ATF A;  1KJL A;  4LJH A;  1G86 A;  1W2A X;  2GC0 A;  1F4H A;  2X29 A;  1DQ5 A;  3CEW A;  2ZZJ A;  4EN9 B;  2VQU A;  1V6O A;  4V2W A;  1QJZ A;  1H8T C;  2GP3 A;  5FPB A;  3L2Y A;  5C6C A;  2NP0 A;  3VKM A;  1NY7 1;  2QQU A;  1OKQ A;  1QDC A;  4BQY A;  1TVG A;  1KJR A;  4D6S A;  2WNU A;  1KRI A;  4Z92 B;  2E26 A;  1CQ9 A;  2PN5 A;  5FZO B;  3ZXG A;  1ZRF A;  2ZEZ A;  2VUC A;  1HV0 A;  1OLR A;  3ATG A;  3PL0 A;  4C90 A;  2P34 A;  4TYS A;  4YFZ A;  1OMI A;  3GJA A;  4AWD A;  1WWY A;  1RGS A;  3MV0 1;  1AXK A;  5FWE A;  3SH4 A;  3SQO A;  5FQ0 A;  4RR3 A;  3ZDS A;  3GBF A;  4BJ0 A;  4FOY A;  4QXB A;  1D4V B;  4FVV A;  1GWM A;  3VBH A;  1ZZ8 A;  4JVA A;  4CDX B;  4IV1 A;  1RMU 2;  2AR6 A;  5J09 A;  1XE7 A;  1RTV A;  5EIY B;  2WWS A;  2HBT A;  3T1M A;  2DDU A;  1PIV 1;  1PX3 A;  5FP9 A;  3OGV A;  1GR3 A;  1VJ2 A;  3GAL A;  4OMC A;  1RUF 1;  3WV6 A;  2WJS A;  1K5J A;  4YW5 A;  5HXM A;  1D2Q A;  2PHL A;  2YBK A;  3AL5 A;  3SC7 X;  4TTG A;  3ZFE A;  4L11 A;  2WNV C;  5JSR A;  3U0Z A;  1GWK A;  3I2F A;  3RGB A;  3UKN A;  4I0B A;  3N36 A;  1JXN A;  3OPT A;  5A7W B;  4GUL A;  3D6E A;  5KHJ A;  1COV 1;  4WM7 A;  1ENS A;  3GYD A;  3RJ2 X;  2QUO A;  4YZ3 A;  3W5N A;  4XUN A;  2VZO A;  1S2E A;  3WF1 A;  1MEC 3;  1GZW A;  4CP9 B;  5AC9 2;  4X6R B;  1LHU A;  4LIT A;  5GZE A;  4Q5O A;  2B8M A;  2CGO A;  3AP5 A;  2BJS A;  3I2J A;  4KG0 A;  4A2U A;  4BDV B;  4DMI A;  1YFW A;  5J7M A;  3FC0 A;  4LO7 A;  3MUZ 1;  1WW5 A;  5JXJ A;  3U07 A;  3RZG A;  4Q4W 1;  3WOG A;  5BNQ A;  1IPS A;  5FYV A;  4OZX A;  2IUW A;  3EB7 A;  2HEY F;  2W92 A;  2HWB 3;  3JD7 2;  4B29 A;  1O8P A;  2XGX A;  5ABJ C;  4KWJ A;  4B7K A;  4X8N A;  5EXO A;  5BNO C;  4QX8 A;  3WP5 A;  1R09 1;  2YGM A;  1RUI 1;  3OJB A;  3PUH A;  4GB3 3;  5F5Q A;  4OHZ A;  5FZ1 A;  4A6S A;  1XYP A;  2NMO A;  2Y6K A;  5K7P A;  3T30 A;  4Y3O A;  4G4F A;  5CG9 A;  4ASM B;  4URT A;  1TME 2;  4NIA A;  3O1P A;  2VOX A;  1W9Y A;  2MEV 2;  3KB5 A;  3RQ0 A;  3OUH A;  5CAZ A;  1RUH 3;  4J1W A;  4F8A A;  1PO2 2;  4Q1R A;  2OZJ A;  3UKV A;  4P00 B;  5F5C A;  3NWK A;  5K0U A;  5CA6 A;  2C26 A;  2RR1 3;  3AX4 A;  1MS1 A;  1JH5 A;  2BZD A;  5GLV A;  2FDI A;  1CVN A;  3WW2 A;  1MQT A;  3D8C A;  4L2N A;  4AGV A;  1C5H A;  2D97 A;  4U36 A;  5A6Z A;  2GU9 A;  4COW A;  1QDO A;  3CIH A;  3WW4 A;  5FZB A;  1GV9 A;  2XML A;  4QDQ A;  4ERO A;  2JIJ A;  1JW6 A;  3USU B;  1C57 A;  3I97 A;  4Y20 A;  3SCH A;  4ET7 A;  1J83 A;  1D2S A;  5FY1 A;  3NW4 A;  5IFP A;  1Q56 A;  1RUG 3;  2BTV C;  2UUR A;  1VB2 A;  4YGB A;  4IEV A;  5BNP B;  5F2S A;  1W6P A;  5E6H A;  2K46 A;  3PNA A;  4N53 C;  2UU8 A;  3R4D B;  1QXJ A;  4OUM A;  3QH6 A;  4W4Z A;  1F9K A;  1I6X A;  2JE9 A;  3BTA A;  2H0V A;  2XKO A;  5DAX A;  3LEG A;  3ZYH A;  4DXZ A;  2WR9 A;  3VZM A;  1ULD A;  2WFF 1;  4QM8 A;  2WRA A;  2XVG A;  4QHO A;  3BU7 A;  3POI A;  4DZG A;  3KV9 A;  1UWW A;  4NHL A;  4FPJ A;  1LJ7 A;  1RXF A;  3HQX A;  3OGR A;  2W47 A;  4P9I A;  3LA3 A;  5E89 A;  4BQ3 A;  4EZH A;  1A34 A;  1I3H A;  5FUP A;  1PVC 2;  2QJV A;  4CVU A;  3N9N A;  2XL7 A;  2FZ2 A;  1MZ6 A;  3MDP A;  5LA9 A;  4W6X A;  1SFN A;  3HAG A;  3E6C C;  3O5S A;  1EP0 A;  1UD1 A;  2VZT A;  4PDW C;  3FHQ A;  1QH6 A;  3V0B A;  4AGR A;  2OQ6 A;  3T2O A;  4DPN A;  2J42 A;  4FOW A;  3AXD A;  4K9S A;  3PIJ A;  2QZ2 A;  2BP6 A;  1SQ4 A;  2D5H A;  2Q1M A;  1AR7 3;  3Q8F A;  4ITC A;  5JMO A;  4GAZ A;  1AR6 3;  3NMB A;  5D21 A;  3WZ1 A;  2ZPX A;  3EXU A;  1NUK A;  1NKG A;  4GKY A;  3VD3 A;  1QU0 A;  4CDQ C;  5FV3 A;  4DO0 A;  1J3R A;  2E51 A;  3EJK A;  2H6C A;  4FXG B;  1TG7 A;  3B9I A;  1H4G A;  2A1X A;  4IE4 A;  1CGP A;  5JXG A;  3U37 A;  4LE3 A;  4Y5T A;  1UZ0 A;  3FUO A;  3ZFF C;  2C24 A;  2GMM A;  2ZML A;  5L36 A;  4K3U A;  5DDJ 3;  5FZC A;  5FYC A;  2JDN A;  1GP4 A;  2XWJ B;  3MW2 A;  4BWO A;  4BZ4 A;  1OUS A;  2HWD 2;  1OBN A;  2PAK A;  3ACG A;  1ALY A;  4Q0P A;  4QGL A;  1OD3 A;  3H7J A;  2R7E B;  1QH7 A;  4AVC A;  3O1O A;  2GN7 A;  1RUJ 1;  3KMH A;  2QBX A;  4AVS A;  1HN1 A;  1H6X A;  1C3H A;  1Q5O A;  5FZH A;  2XKP A;  4D0Q A;  3AP4 A;  1UO9 A;  2WAA A;  4XDO A;  3AP7 A;  2CGP A;  2RJL A;  2IXK A;  4IV3 C;  3WDT A;  2BBV A;  4LQR A;  3NAP B;  1HN0 A;  4IEO A;  4UFK A;  4YVS A;  4EN7 B;  2BW8 A;  4NUB A;  1VMH A;  3Q9O A;  1N1Y A;  1HDK A;  3SCG A;  1GOH A;  1DGR N;  5FZE A;  3U14 A;  3AMH A;  4BK4 A;  1FPN 3;  4Q8K A;  1WD4 A;  5BNN C;  4K1Z A;  1ULG A;  3ZYJ B;  4QQP A;  3Q8B A;  4XCB A;  1QJY 1;  3ES4 A;  4A45 A;  3BB6 A;  2QQI A;  3PU3 A;  1HRI 2;  2DU0 A;  1SDD B;  1E5S A;  2Y26 A;  4RA0 A;  3H8U A;  4PLO A;  4QPG B;  1A3K A;  4NRO A;  5C4W C;  2G19 A;  5FYH A;  2PHR A;  3LCP A;  4JTN A;  1VMJ A;  2DF7 A;  5T50 A;  2QKD A;  5C3R A;  2ZGT A;  2YHJ A;  4ZZ5 A;  2R1D A;  1KIT A;  4HVO A;  4AHZ A;  1YQ5 A;  1ND3 B;  4B3N A;  4I0A A;  3I2G A;  3NV4 A;  4I2O A;  2D6K A;  2JEC A;  1QJX 1;  2R32 A;  4W6W A;  3O0X A;  3MO4 A;  4RS5 A;  3T4H B;  2JKX A;  3VKL A;  3FLP A;  2DFB A;  2JG8 C;  4LBJ A;  5APA A;  3AYD A;  1NA1 A;  2FMD A;  1LRH A;  3P3N A;  4AVT A;  4RFR B;  1LHV A;  3AFG A;  2FDG A;  4UFM A;  2LM3 A;  3OG2 A;  2ZAA A;  3AYE A;  3I3D A;  5FJK A;  5FO7 B;  5F3C A;  3NJZ A;  4HG6 B;  1HW5 A;  1ZRI A;  1AR6 2;  5C33 A;  3I4I A;  1HRV 3;  2NZ9 A;  1GP6 A;  2JG9 A;  1RUO A;  1H2L A;  1OPO A;  4H2A A;  2CY6 A;  4GJZ A;  3NKT A;  4LIV A;  2XWB B;  1WLW A;  4QXK A;  2B39 A;  5JI7 A;  4JHZ A;  3KT7 A;  2OS2 A;  4XJ9 A;  3H7Y A;  4YVW C;  5IAV A;  1IQA A;  4CPB D;  2GND A;  3BI3 A;  4GH4 B;  3HNM A;  1LOF C;  1VBB 3;  3ZFG A;  4L0P A;  3JBG 1;  1MS3 A;  1XU2 A;  2ORZ A;  2PLV 2;  3RPQ A;  4CA9 A;  4LKE A;  4Q4Y 3;  1X33 A;  3H3U A;  1UN1 A;  2VQ0 A;  3DXT A;  5J3U A;  5KR7 A;  4QX2 A;  4MGK E;  4LE4 A;  3RZZ A;  5LRS A;  3OTF A;  3U78 A;  4DUV A;  5BXX A;  4RHV 1;  5GLZ A;  4HVQ A;  5C8C C;  1DCS A;  4DEQ A;  1FOD 1;  1QF3 A;  1HXS 2;  2P2K A;  3QLQ A;  4PJY A;  1RHI 3;  3H42 B;  3R6S A;  1OOP B;  2VQT A;  4FOQ A;  3OPW A;  1VBD 1;  3UJQ A;  1CIW A;  2AC1 A;  2RS3 1;  3UGH A;  3AJY A;  1DQ6 A;  1LU2 A;  2RMU 3;  2BV4 A;  4GWM A;  4N7U A;  3UV9 A;  3ZN4 A;  2WT1 A;  3I3Q A;  2QQJ A;  2W5F A;  4ARY A;  1AR8 3;  3H9A A;  2JB8 A;  5ANQ A;  2AH2 A;  3A21 A;  1OUR A;  3VBF B;  1KS5 A;  3H1M A;  2QQM A;  4CEY B;  1I5P A;  3J8F 3;  4GJY A;  4B8E A;  1C8N A;  1JZ7 A;  1GUI A;  3NNL A;  1G9D A;  1CX4 A;  1R1A 3;  1S0C A;  3RYK A;  1ENR A;  3JB4 C;  4CEW C;  5IVV A;  4XQD A;  1GIC A;  1NY7 2;  2ZHL A;  2ZS6 B;  2J1R A;  2J7M A;  3BOP A;  3MID A;  4KGG A;  2P6C A;  2Y0O A;  1QJU 3;  3MIE A;  1HX6 A;  5H9Q A;  4XF3 A;  1FXZ A;  4D7T A;  2JDA A;  5B4X A;  2VZV A;  4BQ1 A;  3N3H A;  3ZXL A;  4N43 C;  1AX2 A;  4J1X A;  5CB7 A;  5BPX A;  3GZT B;  1FV2 A;  3D3A A;  3CU7 A;  4LBO A;  4XUR A;  1YFX A;  2F4L A;  2D5F A;  2R6Q A;  4XAE A;  4RYD A;  4XHX A;  3TEW A;  3WDY A;  2EAK A;  3ZXK A;  2YXS A;  4BU2 A;  5ACA 1;  3BN6 A;  4OVE A;  5GZG A;  4CTE A;  2XDV A;  5GZD A;  2ZXQ A;  4KWU A;  3H0O A;  1PIV 2;  1NXM A;  2IXI A;  3K75 B;  1LOB A;  4V2V A;  3MIB A;  5AFB A;  1RUF 2;  2BUK A;  1K5M C;  3ZPY A;  3HOB A;  4JQR A;  5ISL A;  1ASJ 1;  1W3X A;  1KXG A;  5A3P A;  2ZHM A;  1JN2 P;  1ZBE 3;  1XSQ A;  4L99 A;  3EMR A;  2R0F A;  1XOY A;  2JD9 A;  5E1R A;  4Q4Y 2;  5BYN A;  1COV 2;  2XHK A;  2XLA A;  3GM8 A;  1KGY A;  1JMU B;  2ARE A;  2A6X A;  3GCX A;  1LTE A;  3IB3 A;  3NNM A;  1AYM 3;  4HPK B;  1Q43 A;  4MO3 M;  1PK6 B;  4QAW A;  1PMI A;  5F3G A;  3VBU B;  3WNM A;  2JB4 A;  1NCR A;  3CJI C;  2K0G A;  1XU1 A;  3WF0 A;  2QQO A;  4LO6 B;  2D6L X;  1W0P A;  1G7Y A;  5FIX A;  3VKO A;  4CDX C;  3BOD A;  4A41 A;  1S0G A;  1ZVF A;  1R08 3;  3KD4 A;  2FCT A;  5FYB A;  4Y4R A;  4GQ7 A;  4XXA A;  2JEM A;  4Q4W 2;  3WXP A;  4GKX A;  3MPB A;  1JUI A;  1FMD 1;  1YI9 A;  4CDQ A;  4GMP 3;  5IVJ A;  1PO1 3;  1CN1 A;  1UOG A;  2DBN A;  3PJY A;  4RQP B;  4Q0S A;  2IXJ A;  2GAL A;  4YM3 A;  1R09 2;  2Q8C A;  1RUI 2;  3WSO A;  1Z7S 1;  4CCN A;  4QPY A;  2YBS A;  3BU0 A;  4WM8 A;  3GBG A;  5LBE A;  4CDW C;  5FBZ A;  2R0H A;  2EAA A;  1D4M 3;  3H1W A;  4CDU C;  3KV5 A;  1ZZC A;  4BB3 A;  3W5M A;  2JWP A;  1TMF 3;  4XMA A;  1ULP A;  1AYN 3;  1C28 A;  2DV9 A;  4QU1 A;  1O6U A;  2F4P A;  1LES A;  2C0Z A;  1W6Q A;  2XVL A;  2EVX A;  3DF0 A;  1J84 A;  2FHR A;  1JBC A;  1S2B A;  2ARX A;  3OCP A;  3VDD C;  4OQ9 A;  1H8V A;  2FD8 A;  5A3W A;  4Y1V A;  5K9Y A;  4QWN A;  4TLF A;  1IKQ A;  3J7H A;  1L7Q A;  2AGS A;  4FAG A;  1C1L A;  2D3S A;  4K6B A;  3ZX7 A;  4KNC A;  3WUD A;  2ZAH A;  4P08 A;  1W8O A;  5I0S A;  5FY5 A;  1A8D A;  1H9W A;  2R16 A;  3J7L A;  2A7A A;  1UY2 A;  5EPA A;  2EIE A;  4A6O A;  1H6Y A;  2AYH A;  4KBB A;  4AI8 A;  1JYT A;  2D7F A;  4PLN A;  3I2H A;  5BV6 A;  2HWE 3;  2VEC A;  3J4U H;  2WA4 A;  3A0N A;  3CHX A;  3IMM A;  2E63 A;  2AUY A;  3S5A A;  2WUH A;  2MHF A;  1IG3 A;  1IOA A;  2JE8 A;  4HZF A;  3BAL A;  1W9T A;  3ZYP A;  1S1A A;  2C1F A;  4JGZ C;  1N3P A;  1OSG A;  2WFF 2;  1HIX A;  3E97 A;  4P9L A;  3ZYR A;  1JU3 A;  2WDB A;  2WNU B;  3NNG A;  4AI0 A;  2WS9 1;  1LEN A;  4JHT A;  4YRD A;  3GF6 A;  5FPX A;  1ZZB A;  5JOW A;  1T2X A;  4Q29 A;  2VBP A;  2JDZ A;  3D0J A;  5FQ0 B;  3WG4 A;  1JTZ X;  1V6L A;  4RR3 B;  5LZ6 A;  2X53 S;  2OZ6 A;  5E88 A;  2VMH A;  3E5U A;  1OQD A;  1WKY A;  2AEN A;  2O14 A;  2QCS B;  5CYY A;  4FOV A;  4C1W A;  2ZGL A;  1RED A;  4DY3 A;  4UFH A;  4LHL A;  3VBH B;  1BKZ A;  1UY0 A;  3ILF A;  3MI8 A;  2ZJC A;  4IV1 B;  1PVX A;  2HH9 A;  4BQX A;  1HKD A;  1MS0 A;  3C7G A;  3IDC B;  3I54 A;  3KV6 A;  2VXR A;  1CON A;  5GZC A;  4UFI A;  4XF4 A;  2R04 3;  4XW3 A;  2YRO A;  2XJT A;  4COU A;  1IG0 A;  3ZFE B;  4BIO A;  1V9U 1;  3TN9 1;  4FXK B;  1K45 A;  4WVV A;  2ZGM A;  5I0R A;  3A22 A;  1RL3 A;  2HWC 3;  4XC9 A;  3AB0 A;  3AKR A;  3ZR5 A;  5G04 L;  2C4X A;  2A71 A;  2A5Z A;  1KD7 A;  5GLT A;  4WM7 B;  3VHP A;  3ZDV A;  4N90 A;  1UMZ A;  1ZYB A;  1LGN A;  5JOY A;  2WO3 A;  1XB9 A;  4CU8 A;  3WR0 A;  3MF9 A;  4BQ2 A;  1GZW B;  1ZBA 1;  4UW4 A;  5FP4 A;  4E8D A;  3C3V A;  1YYN A;  2CAU A;  3VDB A;  4OI4 A;  1IHM A;  4NOT A;  3Q8C A;  5K8S A;  3D82 A;  1Y9G A;  1RUJ 2;  2Q1F A;  4M3C A;  5CKM A;  5LAS A;  2GNM A;  4LOT A;  3AZZ A;  2R30 A;  4KMQ A;  4QDS A;  1I9R A;  1OA3 A;  4EWE A;  3SIS A;  1VBC 3;  2W9X A;  2ZGO A;  3ZXF A;  3RYR A;  2A75 A;  3UKT A;  1UX6 A;  5M0T A;  5DAV A;  4Q1P A;  3C7H A;  3LZZ A;  4GIQ A;  4OLL A;  4YZ1 A;  3VBR C;  1VAM A;  1AL2 3;  1DHK B;  1MVE A;  2BGC A;  5F39 A;  1G9A A;  3WIN E;  3LOI A;  1QJY 2;  1IS3 A;  5FXZ A;  3LGR A;  1BEV 3;  2W91 A;  5GAL A;  3WG1 A;  3WW1 A;  3I7D A;  1H2K A;  1NLS A;  2B42 B;  1O4T A;  2HJI A;  2J1E A;  1WW7 A;  3K3N A;  4LBK A;  3V64 A;  3LSD A;  4AGG A;  5K0U B;  1F35 A;  2NM1 A;  3GXU A;  1I5Z A;  5LAT A;  4IQP A;  1O91 A;  1US2 A;  2WC2 A;  1MQT B;  1GQH A;  1QJX 2;  1OFN A;  4Q2F A;  4QKB A;  4QPI C;  4B7E A;  2QDN A;  4E2S A;  5FOB B;  1Z78 A;  3O7O A;  2XPJ A;  3NAP C;  4A4A A;  3T0A A;  3VN4 A;  1XE0 A;  3ORJ A;  4Y20 B;  4QX1 A;  1X7N A;  3M3I A;  1K12 A;  1G8W A;  1QNW A;  3N9O A;  3S30 A;  5C3O A;  1BZW A;  1W6P B;  3KSC A;  1RIT A;  1UY3 A;  3POS A;  4EN8 B;  4NRM A;  4YZ5 A;  4NE9 A;  2RS1 1;  3SH5 A;  3O1S A;  1ODM A;  1DZR A;  3H3Z A;  4MH0 E;  4XFG A;  1YXW A;  2IXC A;  3OGS A;  3WNL A;  2Y60 A;  3MYX A;  4XUQ A;  4QPW A;  5FMB A;  2YGL A;  5F7U A;  3ZSE A;  2XQX A;  5JOX A;  4EN0 A;  2DUP A;  4LMF A;  4MAD A;  2YC4 A;  5T52 A;  2RS5 3;  2RDN A;  3JBG 2;  1QNY A;  3FFQ A;  3BIW E;  1OKO A;  1W9F A;  3B9C A;  5FZG A;  5IVE A;  5C70 A;  1H1M A;  1WMF A;  2VTX J;  4LBN A;  4XZP A;  5F8P A;  1C8M 1;  2IXL A;  1QXR A;  4HSJ A;  1DG6 A;  2VJX A;  5FXV A;  4LUK A;  4ZXK A;  1W9S A;  3BTX A;  4BIF A;  1W3V A;  3N9P A;  4RHV 2;  3V0B B;  3WDW A;  2FZ1 A;  1GU3 A;  4AOC A;  2W3J A;  4YW3 A;  4MXW A;  5LK7 B;  1H8T A;  4E8C A;  1FOD 2;  5L7O A;  4FTS A;  1OVS A;  2GC2 A;  1VBC 2;  5F5I A;  1OF3 A;  2JIC A;  2X5I C;  3U4X A;  1ZRE A;  1WCU A;  2V72 A;  5D8A C;  1VBD 2;  4P5Y A;  5C9A A;  4FPG A;  1W2T A;  2EIB A;  2RS3 2;  1O3S A;  3VBU A;  5FUN A;  2Q0A A;  4EJR A;  3W59 A;  3OBA A;  3ZYB A;  1UOF A;  4MV2 A;  1RYY A;  5DAW A;  3FJS A;  1YQ8 A;  1VRH 1;  4GH4 C;  1NOV A;  1UZY A;  2Q1Z B;  2SBA A;  1KQR A;  1RMU 3;  5BY5 A;  4E4Z A;  2D6O X;  5FZ3 A;  1N3O A;  4PLM A;  3LFI A;  1IZ3 A;  2IXH A;  2XJP A;  1RUE 1;  1SZB A;  3TB0 A;  3TRS B;  1GLH A;  4AI9 A;  4DIN B;  2ARA A;  1DIW A;  2ZX1 A;  2PQQ A;  2WNV A;  1J3Q A;  2EAL A;  4LO5 B;  3E6B A;  3O1T A;  2ZGR A;  4YVS B;  3X29 B;  5CG8 A;  1DFQ A;  1W99 A;  5JPM B;  3AZX A;  2YPJ A;  1GWL A;  4Y5Z 0;  5AC9 3;  3S6P A;  4KBZ A;  4EZ4 A;  4AZZ A;  1QQP 1;  1F2N A;  2Z2S B;  3AZW A;  3N7J A;  4IES A;  4S2G A;  2D98 A;  3HMY A;  3GZE A;  4M00 A;  1LNS A;  3VBF C;  1IPK A;  1FV3 A;  5FXW A;  2EXI A;  4IW3 A;  2XHN A;  2WT2 A;  1V6M A;  1VIW B;  1OI6 A;  5A3M A;  2ILM A;  3BOW A;  3UYJ A;  1S2K A;  2DTW A;  3E1F 1;  3JD7 3;  1ASJ 2;  2GNT A;  1T6B X;  4D6R A;  5C9A B;  3CLP A;  3PVE A;  2W95 A;  5ABJ A;  4IEQ A;  2YU1 A;  4QD2 A;  4QQL A;  3WT3 A;  1DLL A;  3KCC A;  1POQ A;  2E7Q A;  1TME 3;  2VBD A;  4RS5 B;  5CIR A;  2A3W A;  1POV 3;  2MEV 3;  5LRR A;  1NA1 B;  1HV1 A;  5DQ0 A;  1PO2 3;  3IAQ A;  3LD8 A;  4PF5 A;  3F2Z A;  1FX5 A;  2ZTN A;  5I0T A;  4A7K A;  1W2U A;  5JIU A;  4AFA A;  1D0G A;  3AKP A;  1H30 A;  2PHW A;  1UCX A;  2LUW A;  2JG9 B;  1FMD 2;  3AL6 A;  4AEK A;  1P8J A;  2ARB A;  3MBW A;  2PHF A;  3J7M A;  4P9W A;  4TWT A;  5FRE A;  2ZGS A;  5FZK A;  1UPI A;  2Y6L A;  3NJY A;  2ZZQ A;  2BRT A;  3LDR A;  5KXC A;  1Z7S 2;  3FUQ A;  4N9I A;  4XTP A;  4Y33 A;  2G9F A;  3VZN A;  1JOB A;  2LTN A;  4ISQ A;  4R8H A;  3ZFG B;  1VBE 1;  2WO2 A;  2KM2 A;  3WLU A;  5IYY A;  4HAN A;  3OEA A;  1XBF A;  3HR9 A;  2XLF A;  3RG0 A;  5LEK A;  4XET A;  3ZXD A;  1CJD A;  4I3P A;  5FZ6 A;  1EV1 1;  4LR4 A;  1PK6 C;  1SFY A;  1H1I A;  4N53 A;  4UW5 A;  1SBF A;  5EP9 A;  4UOJ A;  4XXP A;  2JJ6 A;  3K46 A;  3H50 A;  4I30 A;  4AQT A;  4FFF A;  1CWP A;  5IHR A;  1DQ2 A;  2Z79 A;  4P02 B;  4XUT A;  1FI2 A;  1OA2 A;  4RN5 A;  4LKF A;  3T0D A;  1BK1 A;  1CZS A;  1YC6 1;  3B02 A;  1VBA 1;  1AL0 G;  3RZK A;  5FP3 A;  2Q8E A;  3UES A;  1LEC A;  3CL1 A;  1PVC 3;  2VL4 A;  2Z69 A;  4CYD A;  3I3E A;  3VUO A;  2HWF 1;  1JYC A;  4AI3 A;  1ULF A;  5FMO L;  2WKK A;  1OF4 A;  2JDK A;  3DUI A;  3KQ4 B;  4NPL A;  5J98 B;  2CAV A;  4DNY A;  1VR3 A;  4PDW A;  4BHP A;  2ES3 A;  4FPH A;  2Q8O A;  1TE1 B;  2PYT A;  1Y9M A;  2YUE A;  4P9Y A;  4CCJ A;  3K4Z A;  2OVU A;  3ECQ A;  3EQE A;  2WZR 1;  4E2G A;  4NRP A;  1ND2 C;  5KHK A;  2VNO A;  3WQ7 A;  3EO6 A;  3VDC A;  2Y0I A;  1H2M A;  5FPZ A;  5FYS A;  3M2M A;  1Q8V A;  3I8T A;  3N9L A;  3PTY A;  5DZG A;  5G05 L;  2WS9 2;  1XNC A;  4ZU7 A;  4QB2 A;  1K3I A;  2VTF A;  4FPL A;  4JDN A;  1CAU A;  4AK3 A;  5IT6 A;  1W0O A;  3BIE A;  1DGL A;  2JDP A;  2R49 A;  3IN9 A;  3ZYG A;  4FP2 A;  1U5Z A;  4MLO A;  5JUV A;  3VBS C;  1DLC A;  1Q3E A;  4S2D A;  1V0A A;  3ZO0 B;  4PCR A;  3ZFF A;  3WNK A;  2Y6H A;  2XQR A;  4XJ8 A;  1SLT A;  1LAJ A;  4BCU A;  5FTT C;  2HWD 3;  2BDR A;  3VD7 A;  4A3Z A;  1Z0H A;  4QX7 A;  1EY2 A;  4O61 A;  5JXH A;  3GDB A;  1SDW A;  3SHR A;  1WD3 A;  1EAH 1;  2WNE A;  3LDK A;  3VL9 A;  4H3W A;  4YLZ A;  3I2D A;  2MNG A;  4UFJ A;  2JE7 A;  4QQO A;  1JYN A;  4Q27 A;  2WN3 A;  3BCW A;  1QHD A;  3KF3 A;  3KWV A;  1V9U 2;  2BNN A;  2Y8K A;  5D1I A;  4IV3 A;  3TN9 2;  2PFW A;  1SLB A;  2OXB A;  3EBR A;  3O12 A;  3IIA A;  1HJF A;  4Q4X 1;  5AVP A;  3H3L A;  1JZ8 A;  5BNN A;  1HRI 3;  3RS6 A;  1ZBA 2;  1NCR B;  4W6Y A;  4XQ4 A;  1HB1 A;  3BYW A;  3S7I A;  5C4W A;  3ACH A;  1V6I A;  2QVS B;  5E8A A;  3PME A;  4AQS A;  1QIQ A;  3OF1 A;  1TQ5 A;  4XJA A;  1PZ8 A;  4H7L A;  1FT9 A;  4NHM A;  2Z4F A;  3AK0 A;  4YW1 A;  5I91 A;  1W8Z A;  1N47 A;  2QQL A;  2ZX2 A;  3LE0 A;  3B93 A;  1W04 A;  3KVA A;  4LT5 A;  1F5J A;  5FLH A;  4CCE A;  2JG8 A;  4DXR A;  2FDF A;  4WM8 B;  3SCF A;  5F9T A;  3KGZ A;  2VG9 A;  4ATE A;  2ET7 A;  3H8X A;  3IDE A;  5IW0 A;  4BME A;  1DBN A;  2HYK A;  1V6N A;  4WM7 C;  2W39 A;  3I3B A;  2WN2 A;  5GM0 A;  4P5H A;  4AED C;  1W6Q B;  2WLP A;  1UOJ A;  1VB4 A;  2I07 B;  4CXY A;  3U4S A;  1NZC A;  5DG1 A;  1W2N A;  2ZHN A;  2W1Q A;  3MPP G;  2RM2 1;  4GXL A;  1JYW A;  4YYO A;  3LEI A;  4I01 A;  4BYY A;  3E5Q A;  3EYP A;  4XMI A;  4E4D X;  2XBO 1;  1LEM A;  1ZZ6 A;  3VHO A;  4ZHN A;  1F31 A;  4YVW A;  4QGN A;  4WVW A;  2W08 A;  4XCA A;  2PLV 3;  1LOF A;  1EUU A;  2NLR A;  4RSU A;  1YFY A;  4FO9 A;  1JS9 A;  5C8W A;  5IFT A;  3PUI A;  3RI9 A;  3I49 A;  1N3Q A;  5I0D A;  2W1U A;  5L73 A;  1KDM A;  5FR3 A;  4XDQ A;  4BLJ A;  4QXH A;  1V6K A;  3B7M A;  5C8C A;  2I74 A;  4G3Y C;  4JGY C;  2RS1 2;  1HXS 3;  1UAI A;  5FZA A;  3JZV A;  1S55 A;  3H1Y A;  4OI2 A;  5A6X A;  4Q4V 1;  3LF7 A;  1O3T A;  5K0U C;  4EV0 A;  4F3J A;  4IEP A;  3ZVX A;  1PGL 1;  1TNF A;  3TNQ A;  2UY8 A;  5DZE A;  5KC6 A;  3III A;  4E4H A;  2H6B A;  3L9J T;  2W1W A;  1N1T A;  1L3J A;  2HEW F;  3POG A;  1BHG A;  2ZMN A;  1DGW A;  1QOT A;  1RUC 1;  3AZV A;  4RGK A;  1ZM1 A;  5ERL A;  5I8T A;  2G1M A;  3U10 A;  1C8M 2;  4GA9 A;  5KHH A;  4CCD A;  5JCT A;  5A1F A;  4D94 A;  1AJK A;  2XJS A;  4SBV A;  1S0J A;  3OUJ A;  1WUV A;  4PT6 A;  3M3E A;  4LO4 B;  3VZO A;  4OI0 A;  4MUV A;  1RVF 1;  1PZ9 A;  4HSL A;  3THT A;  4BQ4 A;  2VE1 A;  4CEW A;  1DGW X;  3WY6 A;  4XHB A;  2BGP A;  4ES8 A;  3RWN A;  3KQR A;  4AW7 A;  5C3S A;  3MFA A;  2E53 A;  2VGD A;  3VKN A;  1Q8S A;  1E5R A;  3SEP A;  1SEF A;  5TSW A;  5FZD A;  3W9A A;  2CNA A;  2D6N A;  4A42 A;  2GH2 A;  1LGB A;  5A7Q A;  4PIX A;  3WD5 A;  3P5B A;  3CQO A;  1WMD A;  4EQV A;  5FDB A;  4CZS A;  4NRQ A;  5EJ1 B;  4N43 A;  1BVP 1;  1VRH 2;  3RMX A;  3W21 A;  5J96 B;  4IDZ A;  5CAD A;  1SG3 A;  2D43 A;  5C5T A;  2ZHK A;  1OLM A;  3Q8A A;  4BMB A;  1X36 A;  4HKO A;  1PNG A;  4LBQ A;  2IC1 A;  4OZO A;  1PIV 3;  3FLR A;  1RUF 3;  3LIH A;  3NNJ A;  4HL0 A;  2EIG A;  1RUE 2;  2DU1 A;  1SHW B;  4H55 A;  4DY5 A;  1K5M A;  1JOD A;  4M3C B;  3CZU A;  1QJF A;  4COY A;  4LKD A;  1W03 A;  5FCC A;  1OFS A;  3GGL A;  4FCA A;  2OW4 A;  4LA3 A;  1W8H A;  1UZV A;  2YYO A;  1COV 3;  4XF9 A;  5FBJ A;  5A32 A;  1QOS A;  4ZS2 A;  2A70 A;  1W39 A;  5IVC A;  3ZSM A;  5LY1 A;  2ET1 A;  3DPR A;  1YEW A;  2BU9 A;  1Q8P A;  1QQP 2;  3OPZ A;  1RC6 A;  2NN8 A;  3CJI A;  3IMN A;  3POF A;  3ZSL A;  5KHI A;  2GNB A;  4UT5 A;  1BQP A;  4Q4W 3;  2CTV A;  4IGQ A;  4ZPI A;  3SKJ E;  5A1A A;  1UU5 A;  4Y5S A;  4CSW A;  3JU9 A;  2OYZ A;  2CWM A;  4V1P A;  3WUC A;  5F3E A;  5CKN A;  5SV5 A;  1OH3 A;  2X05 A;  2WSU A;  4AQ2 A;  1R09 3;  1RUI 3;  3WG2 A;  3ZXE A;  1BBT 1;  3WF4 A;  5JAX A;  2R07 1;  1CES A;  3ZM8 A;  4CDW A;  5IK8 A;  1LGC A;  4CDU A;  1G9C A;  1ZRC A;  4IE7 A;  2PXJ A;  5DG2 A;  3O1R A;  3MLL A;  5K4L A;  4N8M A;  4F7Z A;  3WEZ A;  3VDD A;  5A33 A;  5JPN B;  4OHX A;  1WBL A;  2PTM A;  2VW2 A;  3POY A;  4PI2 A;  5D2A A;  4D3W A;  1CAX B;  1RXG A;  3R4U A;  2CGN A;  3USS A;  5B4N A;  2DCZ A;  2JEN A;  3FE5 A;  4JRA A;  3N7M A;  4XZU G;  4LOS A;  3C2U A;  4OI1 A;  2C5D A;  3GJB A;  4C8D A;  3FBY A;  3P1I A;  4ZS3 A;  1W6N A;  2IFR A;  4CCM A;  3TEX A;  2DWR A;  4TZD A;  3OSD A;  1B35 A;  2FBE A;  5IVY A;  3EHK A;  3NNF A;  5A3L A;  1IPJ A;  2GAU A;  2YC0 A;  1VBE 2;  1NAE A;  1OUX A;  2JDM A;  4DXT A;  4BQ5 A;  1HB4 A;  4GWN A;  2VUD A;  4LTA A;  1VMF A;  1YIF A;  1EV1 2;  1SBE A;  4IEX A;  2ZMK A;  4R9A A;  4XTM A;  1SLL A;  1MVQ A;  3N4M A;  2VNG A;  4MGQ A;  3VBO A;  4CCL A;  4AE2 A;  4MZU A;  2RJ2 A;  2JDU A;  3JCI A;  3PUR A;  4RL7 A;  3UK9 A;  3ZMN A;  3ZMO A;  5JLV A;  4MXW B;  3TOJ A;  1H8T B;  2WFF 3;  4OCT A;  4CUG A;  1C1F A;  1O8S A;  5L7O B;  1CIY A;  1MS4 A;  4JGZ A;  1AR9 1;  4ZKT B;  4OHV A;  2JG9 C;  1VBA 2;  1ZA4 A;  4R9B A;  4IUG A;  2O8Q A;  3B69 A;  4X6Q B;  2VMC A;  2HWF 2;  4K7J A;  3CZJ A;  1LHO A;  2A6Y A;  5JMC A;  4Z1V A;  4YG0 A;  3TNP B;  4FFG A;  2W2I A;  2TBV A;  2WQZ C;  3POJ A;  4RGA A;  5JSP A;  1YI7 A;  3ZFG C;  5J36 A;  2TUN A;  2WSV A;  3T09 A;  4DFS A;  5A3T A;  2VCB A;  2DUO A;  3DKW A;  1RUD 1;  2DUR A;  2RG4 A;  2YPD A;  1ACC A;  4B4Q A;  4ZXE A;  2BYV E;  2WO7 A;  2WZR 2;  2ZGQ A;  2HYX A;  2LRP A;  2ZGP A;  4ZON A;  2H0B A;  4PIZ A;  2VZ1 A;  5JDB A;  3AKS A;  3ZN5 A;  5C3Q A;  3LIG A;  1LKN A;  2J1T A;  1X9P A;  3OYW B;  3OOX A;  3VKF C;  1OLM E;  2VME A;  4LLF A;  4HOO A;  2WNV B;  4LEJ A;  4Q0U A;  4HON A;  2ID4 A;  2KD7 A;  2VD7 A;  2ZX0 A;  1LB2 A;  5LCW L;  2YZ4 A;  1CX1 A;  2GME A;  3MLJ A;  4Z82 A;  3IDB B;  2DVD A;  5FYM A;  5C3P A;  1VLN A;  4NO4 A;  1UX7 A;  2P5B A;  4JQT A;  3WF2 A;  3VD5 A;  5JXI A;  2CL2 A;  1W8N A;  3R05 A;  1EAH 2;  1RUJ 3;  2VH9 A;  3KT1 A;  1N1V A;  1AF9 A;  1RB8 G;  1EYB A;  2R06 1;  1G9B A;  1X8E A;  2Q30 A;  1DGR A;  4UYB A;  4EN6 B;  1XC6 A;  3ABZ A;  5EJZ B;  3TEY A;  5IVB A;  4IL7 A;  2QNK A;  2RHP A;  4CCC A;  4E4S A;  3J7N A;  1F15 A;  2UWB A;  2EXK A;  2GH8 A;  3GBW A;  5ABJ B;  2HLE A;  1GKB A;  3OEB A;  3GZA A;  5LY2 A;  5BNO B;  4Q4X 2;  1LOD A;  1HB2 A;  3ITQ A;  3VBR A;  4CU9 A;  4DB5 A;  1W6O A;  3VV1 A;  1QJY 3;  4FSJ A;  1MAC A;  4PHZ A;  2AAC A;  4HKW A;  5KWR A;  1QGL A;  2QQP A;  1AX0 A;  2ZGK A;  2ARC A;  1X50 A;  5CZK A;  1NQJ A;  2YB7 A;  2ZAB A;  3ELN A;  3GHM A;  3LKJ A;  2X10 A;  3MIF A;  3PVO A;  3FZ3 A;  5JIA A;  5IVF A;  3NKG A;  2D40 A;  2VZP A;  3DL3 A;  4CE8 A;  1O3R A;  2HEV F;  4IND A;  1QWR A;  4GWI A;  2WFP A;  5FY0 A;  3UL2 A;  1UKR A;  1QJX 3;  1JYX A;  1W8T A;  3ACF A;  2XR4 A;  4DRR A;  4OHW A;  1PM4 A;  3O14 A;  1S0I A;  1UYP A;  1XNA A;  5FJH A;  5DMY A;  5JWP A;  1BMV 1;  4QPI A;  2VMF A;  3JB8 A;  2J22 A;  2DVA A;  5CVR A;  5BNP C;  2LRO A;  1KFX L;  3OD4 A;  4D7S A;  2P37 A;  3ZIW A;  1US3 A;  4TLG A;  1EPZ A;  1XNT A;  4FPE A;  2VTX A;  5IJR A;  3H8R A;  2PQS A;  2WII B;  3MHZ A;  4AL9 A;  1IQD C;  1OD5 A;  3RI8 A;  3R0R A;  1JYV A;  4QXC A;  4N53 B;  5T5P A;  1OXC A;  2O0O A;  3SNM A;  2RV9 A;  2Y38 A;  1OVP A;  2RDR A;  4M4P A;  2WNO A;  2A73 B;  5A6Y A;  1OT5 A;  2B7Y A;  2E32 A;  3O1V A;  2RM2 2;  1MZ5 A;  4XFC A;  4AEM A;  2D3R A;  4RFT 0;  1UL9 A;  2QQV A;  2VM9 A;  2XBO 2;  5F6L B;  1JYI A;  4Q8L A;  3GHN A;  3THD A;  3JBG 3;  4XFB A;  2A6V A;  1SBD A;  4QX5 A;  3V65 A;  1MPX A;  1X8M A;  5DUX A;  3VD9 A;  2ZGN A;  1HQL A;  4HBN A;  2GMP A;  4UFL A;  3N9Q A;  3S0M A;  2BFU L;  2W52 A;  2J1A A;  3MIH A;  4XUP A;  3CO2 A;  4RHV 3;  5HCF A;  4A7Y A;  4MOA A;  4XOG A;  5HPO A;  4PDW B;  1UPS A;  1FOD 3;  1JHJ A;  5EZW A;  3LPG A;  5IAX A;  4LHN A;  5CKQ A;  1HJG A;  1LED A;  1SLA A;  1H2N A;  4Q4V 2;  1VBD 3;  3T4V A;  1PHM A;  5HXV A;  2X5I A;  1W6M A;  2RS3 3;  1PGL 2;  5D8A A;  3JQX A;  1NCQ A;  3QH7 A;  4CDQ B;  1Y43 B;  4TSV A;  4Z2W A;  3LB9 A;  3OBT A;  1CAU B;  3QD6 A;  4I02 A;  3LEK A;  2ZA9 A;  1PMJ X;  1RUC 2;  1UMI A;  4QX0 A;  1GFF 2;  2AEZ A;  1ENQ A;  2Y6F A;  4WBB A;  5CFD A;  3ZFF B;  3BTY A;  2P3Y A;  1MEC 1;  2E33 A;  5FP8 A;  2RJK A;  4DRV A;  1JZ5 A;  3NL1 A;  1L7L A;  4QQ2 A;  3KGL A;  1BYH A;  1RVF 2;  3TAY A;  1DQ4 A;  1U5I A;  2WQ8 A;  5H9S A;  1WCS A;  3ZSJ A;  4OHY A;  3VHR A;  3ZYF A;  4BQW A;  3NO8 A;  4D8M A;  2QTW B;  4WVM A;  4JZR A;  3TYJ A;  3VDA A;  3M8L A;  4OYU A;  5JVV A;  2HWB 1;  2VW1 A;  3ALQ A;  3TWI A;  5IK7 A;  3AM2 A;  4KQ7 A;  3INA A;  4IV3 B;  1QY4 A;  1JOP A;  1QMJ A;  4GB3 1;  1ZZ7 A;  5DXD A;  4XQW A;  2D44 A;  3U11 A;  1MZE A;  1A8M A;  1D0H A;  2Y34 A;  5ACA 3;  1CAX A;  1PGS A;  2DUQ A;  3M70 A;  4YM1 A;  2XVK A;  5DAP A;  3ME2 A;  4QPG C;  3HWJ A;  5FMD A;  5BNN B;  5I8Y A;  4IXL A;  1J1L A;  3W58 A;  4UBG A;  1F8V A;  2XL9 A;  3HVD A;  3WF3 A;  3MZH A;  1RUH 1;  1JZ2 A;  3CDZ B;  1SCS A;  3MIC A;  1XND A;  2DYC A;  4URA A;  1ZRD A;  2BOJ A;  4UW3 A;  2V73 A;  3ZOI A;  2RR1 1;  5C4W B;  1ASJ 3;  2VOW A;  5JZG A;  1ND3 C;  3ROU A;  4Y24 A;  1Y9Q A;  2B9V A;  3N9M A;  1H9P A;  3D4K A;  3PIG A;  4QDR A;  2TNF A;  2ADE A;  3V56 A;  5IAT A;  3R4S A;  4WV8 A;  4Y1Y A;  1YLL A;  4CUC A;  2BNO A;  4O9G A;  4B1M A;  4CXX A;  5H9R A;  3OGG A;  2CDP A;  1LR5 A;  1UYY A;  2JG8 B;  2HBU A;  4JDM A;  5FLJ A;  5HCA A;  1HQN A;  1GNZ A;  1RUG 1;  4XAB A;  1YQ6 A;  1UXX X;  3RZM A;  4HT1 T;  1QOO A;  3BPS A;  1FMD 3;  4YGE A;  1NZI A;  1WLC A;  3WX5 A;  3TEZ A;  1QKQ A;  4PI0 A;  4XDP A;  1XE8 A;  2D3P A;  4QM9 A;  3CKH A;  4K40 A;  2ZGU A;  5FOJ B;  1CZV A;  1C5I A;  2Y33 A;  5LBF A;  4E2Q A;  1Z7S 3;  1MZF A;  5HCH A;  2EA7 A;  1BBT 2;  2A3X A;  3NV1 A;  3MFC A;  4YVW B;  2R07 2;  2ERF A;  5FPA A;  5FY8 A;  1YFU A;  4BA6 A;  4YAR A;  3AKT A;  1WBF A;  4JAA A;  2WAB A;  3K48 A;  1XPW A;  4RGG A;  2VZ3 A;  1QXP A;  3KV4 A;  2JDY A;  3S57 A;  3MLK A;  4JKL A;  3PUQ A;  1IS6 A;  3N7K A;  2O1Q A;  1MR5 A;  3OYW A;  1Y3T A;  1PGW 1;  5C7G A;  4XEZ A;  1XYO A;  2VUA A;  2PEL A;  1OOP C;  4OFG A;  4QKD A;  1GNH A;  1NYW A;  4XJW A;  4YPJ A;  5C8C B;  1J1T A;  3HQR A;  3B3Q E;  1CAW A;  1AR7 1;  5EYX A;  2D6P A;  4QB1 A;  1DDL A;  5LB6 A;  1AR6 1;  1NT0 A;  4CP1 A;  5A80 A;  3IWZ A;  4DUX A;  4M3C E;  4LNV A;  3VZL A;  4CUA A;  4GD4 A;  4BE3 A;  2BNM A;  1ULO A;  3O0V A;  5ACA 2;  4Y22 A;  3DCQ A;  3HBK A;  1DU3 D;  2Z5W A;  3NV3 A;  4CEY C;  3IPV A;  5FYY A;  3PUA A;  4GB3 2;  5GJ6 A;  3KT4 A;  4AXO A;  4M0H A;  5DDJ 1;  1SPP A;  3PLQ A;  4LHK A;  4AAP A;  4NPM A;  1VAV A;  3AVR A;  4IE0 A;  2FMY A;  4AR2 A;  1PM7 A;  2VZQ A;  2NPI A;  2ZBJ A;  2DCY A;  4FPF A;  1ND2 A;  5JR7 B;  1QEX A;  3SIT A;  4CEW B;  5A3U A;  5BNO A;  1GP5 A;  2WS9 3;  1AR9 2;  4MG2 A;  1VPH A;  2J1U A;  3GZU C;  1WGP A;  2AZ5 A;  4CPB A;  1GQP A;  5EYY A;  3BKZ A;  3LA7 A;  1OQ1 A;  2EXH A;  2WYS A;  2XB6 C;  4L9B A;  2KR2 A;  4L92 A;  3AVS A;  1JZ3 A;  1JU4 A;  5BUV A;  4NII A;  4MGT A;  4YM2 A;  4FTB A;  3VBS A;  3I59 A;  2W87 A;  1E5I A;  5C5U A;  3AP9 A;  3PVB B;  4N43 B;  2PA7 A;  1FPN 1;  4LKS A;  4B1L A;  3UGG A;  3VZK A;  3E6D A;  3IM0 A;  1RUD 2;  2XJV A;  5B2G B;  3FWE A;  4LBQ B;  4K21 A;  5T55 A;  2DCJ A;  5FAX A;  3MV1 1;  5DN2 A;  4EWA A;  3AP6 A;  3PDQ A;  4AF9 A;  4OUL A;  3OBR A;  3DYO A;  4PQQ A;  4UF0 A;  4P14 A;  1S0B A;  3B01 A;  1V9U 3;  1K5M B;  2A6W A;  2X09 A;  2AEY A;  2IFW A;  3TN9 3;  1S0D A;  5L7O C;  3ZR6 A;  3NJV A;  1BK0 A;  1UOB A;  4AVV A;  4KG8 A;  2VMG A;  5A32 B;  5C9A C;  1J59 A;  4IEZ A;  5FPV A;  4D6Q A;  3VBU C;  4MGS A;  2SLI A;  1S0E A;  1WA6 X;  2ZOE B;  4DS0 A;  1ZBA 3;  1E5H A;  3ZKY A;  3DPR B;  2GC3 A;  2XH6 A;  3WP3 A;  3CJI B;  3LAG A;  4NVP A;  2VBB A;  1ZZ9 A;  1HRV 1;  3NST A;  4AHW A;  4FPO B;  4NN0 A;  2JXA A;  4EYU A;  2R06 2;  5I8S A;  3HJR A;  2PHD A;  3ASI A;  4FAH A;  4RQP C;  3WHT A;  3BVC A;  4YNI A;  2Q4S A;  3JXS A;  5H9P A;  3IDA A;  3B5L B;  1J58 A;  2WZP P;  2XJQ A;  4A7Z A;  1PMH X;  4CP0 A;  3SMH A;  5A3O A;  3ST7 A;  2OUH A;  4BXF A;  1VBB 1;  5FY9 A;  3FHA A;  5FKC A;  4CDW B;  3RNS A;  3DV8 A;  3THP A;  5FZ4 A;  4Z2A A;  1VRB A;  4Q4Y 1;  4CDU B;  1B09 A;  5CFC C;  3OGJ A;  2YFU A;  5FY7 A;  5T5O A;  4QB6 A;  1UIJ A;  5EFU A;  1J3P A;  1YIP A;  1YJK A;  1RJ8 A;  3WCR A;  4B4P A;  5HBA A;  4AED A;  3ZN6 A;  4G9S B;  3VDD B;  4JDO A;  5A33 B;  4CU7 A;  5JOZ A;  1HLC A;  1Q8O A;  1YHF A;  4YWA A;  3A4U A;  4E27 A;  2FQP A;  2XUE A;  1RHI 1;  3T08 A;  3APB A;  4P9J A;  2BEO A;  3A23 A;  1JOJ A;  2NQY A;  4M01 A;  1W6N B;  4JCK A;  5LBB A;  1BMV 2;  1WME A;  1IKP A;  1YO8 A;  2RMU 1;  1B35 B;  2W1S A;  3HEI A;  3KVB A;  4KU7 A;  3WNO A;  4DIQ A;  4GMP 0;  2DTY A;  2VR4 A;  3K51 A;  4FT8 A;  4S2H A;  5EV7 A;  1AR8 1;  4PIY A;  5HV0 A;  4M4R A;  2O8O A;  2VUL A;  5FMC A;  5SV8 A;  3ETQ A;  2Q5T A;  1FAY A;  3MW3 A;  2BFU S;  4Q26 A;  4Z8B A;  5HI0 A;  2FCV A;  4R4Z A;  1XQN A;  3BPZ A;  2RS1 3;  3J8F 1;  2GZW A;  4JKK A;  5FO9 B;  4R4X A;  2BWA A;  3U1X A;  2RDS A;  3I2K A;  1UY4 A;  4HK8 A;  1R1A 1;  3IBM A;  4HMZ A;  4JGY A;  4LA2 A;  3VBO B;  2IVJ A;  5FZM A;  3DEC A;  2WNU C;  4CRQ A;  4OMD A;  2VVD A;  4MGZ E;  4JGZ B;  2NMN A;  3HBZ A;  2XLG A;  1UW8 A;  4KWL A;  1QJU 1;  2PAE A;  2NYY A;  4RR3 C;  3SEE A;  1DF0 A;  3IZO A;  4Q0Q A;  1JZ4 A;  3FX3 A;  1C8M 3;  4MHR A;  3AMM A;  3IKW A;  3VBH C;  4HKL A;  1URX A;  1V70 A;  3S5Q A;  1DP0 A;  4IV1 C;  1N1S A;  1XRU A;  3ACL A;  4XIL A;  2C6S A;  1SMV A;  4MYE A;  1VE0 A;  2YU2 A;  3WQ1 A;  4J6G A;  4MET A;  3GCW A;  4YM0 A;  1AHS A;  3DN7 A;  5A3N A;  3NQH A;  5LK5 A;  1YUD A; 
#chains in the Genus database with same CATH homology
 3WNN A;  4LHS A;  2E31 A;  2EIC A;  3FN9 A;  1JZ6 A;  4PF1 A;  3T0B A;  1OH4 A;  1K45 A;  3WEZ A;  3A22 A;  5G04 L;  2C4X A;  5B4N A;  4XZU G;  1NX9 A;  2ZEW A;  2WO3 A;  3P1I A;  4CU8 A;  2WO1 A;  4GZ9 A;  4E8D A;  5JR2 A;  3VDB A;  4ARX A;  1K42 A;  1NAE A;  2QQN A;  1W0N A;  4DXT A;  4KMQ A;  4QDS A;  1F4H A;  4JX0 A;  2W9X A;  2VQU A;  4MGQ A;  2RJ2 A;  3C7H A;  3K77 A;  2BER A;  2J1S A;  1EUT A;  1TVG A;  1O8S A;  3MUY 1;  1CIY A;  2E26 A;  1UY1 A;  2ZEZ A;  2W91 A;  4IUG A;  4LPL A;  4TXW A;  2VMC A;  2J1E A;  3MV0 1;  3CZJ A;  3GXU A;  4BJ0 A;  1US2 A;  3T09 A;  2VCB A;  5EIY B;  1UMH A;  4ZXE A;  4W8J A;  2DDU A;  1PX3 A;  2HYX A;  3OGV A;  4A4A A;  3T0A A;  4OMC A;  2YC2 A;  2YG0 A;  2VZ1 A;  4QX1 A;  5HXM A;  1K12 A;  4TTG A;  4BXS V;  2J1T A;  2WAO A;  3I2F A;  2VME A;  1UY3 A;  2ID4 A;  2KD7 A;  2VZU A;  5LCW L;  1CX1 A;  1GOG A;  3W5N A;  4XUN A;  3OGS A;  3WNL A;  2VZO A;  4XUQ A;  4QPW A;  3WF1 A;  5F7U A;  2XQX A;  1UX7 A;  2W46 A;  3WF2 A;  3I2J A;  3VD5 A;  4BDV B;  5JXI A;  4MAD A;  2YC4 A;  1W8N A;  2QQK A;  2VMD A;  3MUZ 1;  5JXJ A;  5C70 A;  3EB7 A;  2W92 A;  1XC6 A;  3ABZ A;  5EJZ B;  3P6B A;  1O8P A;  2VJX A;  1W9S A;  4DEV A;  2HLE A;  1GU3 A;  3OEB A;  2W3J A;  3PUH A;  4CUB A;  4E8C A;  2Y6K A;  4CU9 A;  3HNY M;  1OF3 A;  4XVH A;  2V72 A;  4P5Y A;  2EIB A;  5CZK A;  4P00 B;  2OKX A;  2YB7 A;  3OBA A;  2C26 A;  2X10 A;  5FUI A;  4DUW A;  2VZP A;  3AC0 A;  2BZD A;  1RYY A;  1R64 A;  5LA0 A;  2VZS A;  5J1X A;  4GWI A;  1JYX A;  3ACF A;  5DMY A;  1XNA A;  3CIH A;  2VMF A;  3HNB M;  4QDQ A;  3I97 A;  4ET7 A;  2J22 A;  1J83 A;  1UYX A;  2VCC A;  5IFP A;  2L9L A;  1US3 A;  1XNT A;  5IJR A;  1F4A A;  2PQS A;  1IQD C;  1JYV A;  2CDO A;  4W4Z A;  2RV9 A;  3LEG A;  1W99 A;  1JI6 A;  4M4P A;  1OT5 A;  2E32 A;  4DXS A;  2VM9 A;  1UWW A;  5LA1 A;  3OGR A;  1LNS A;  2W47 A;  3THC A;  3THD A;  4CVU A;  2XHN A;  1GOF A;  1MPX A;  2V5D A;  3VD9 A;  2BGO A;  3E1F 1;  2VZT A;  4GWJ A;  2J1A A;  3FHQ A;  4FI9 A;  4XUP A;  2W95 A;  4MOA A;  1O59 A;  3T2O A;  1JHJ A;  2XOM A;  5JMO A;  3LPG A;  3NRU A;  3VD3 A;  1NUK A;  1NKG A;  2LW8 A;  5DQ0 A;  3IAQ A;  1KEX A;  3F2Z A;  1TG7 A;  5DPN A;  3LEK A;  2B4K A;  5JXG A;  1PMJ X;  3U37 A;  1UMI A;  4QX0 A;  1UZ0 A;  1P8J A;  3MBW A;  1WCQ A;  2E33 A;  2Y6L A;  1JZ5 A;  4XUO A;  3ACG A;  1OD3 A;  2R7E B;  2Y6J A;  2WQ8 A;  3K4A A;  2WO2 A;  4D8M A;  2QBX A;  3VD4 A;  5IYY A;  1HN1 A;  1H6X A;  3OEA A;  4D0Q A;  3VDA A;  2WAA A;  4OYU A;  4UI9 L;  4LQR A;  4UOJ A;  3K46 A;  2WZ8 A;  5IHR A;  2Y6G A;  1GOH A;  4P02 B;  4BK4 A;  1GNY A;  4XUT A;  4RN5 A;  3T0D A;  1CZS A;  4A45 A;  2QQI A;  2WBK A;  3C7E A;  1SDD B;  2VC9 A;  3WF3 A;  3UES A;  2VL4 A;  1CZT A;  1JZ2 A;  3I3E A;  3CDZ B;  4ZZ5 A;  2B9V A;  1OF4 A;  4QDR A;  3I2G A;  3NJX A;  4QX3 A;  4CUC A;  4UAP A;  3MO4 A;  3K4Z A;  3ECQ A;  2JKX A;  4KI5 M;  2CDP A;  3WNP A;  2VCA A;  3VDC A;  1UYY A;  5G05 L;  3OG2 A;  4QB2 A;  1K3I A;  2VTF A;  1D7P M;  3I3D A;  2VZR A;  4HG6 B;  1UXX X;  2DCK A;  3OB8 A;  5JUV A;  2RVA A;  3C7O A;  1DLC A;  3WNK A;  2Y6H A;  2ZEY A;  3FL7 A;  3DYP A;  3CKH A;  1CZV A;  4AAX A;  3HN3 A;  3VD7 A;  4JHZ A;  4A3Z A;  5JXH A;  4ZY9 A;  3GDB A;  3HNM A;  4L0P A;  2ORZ A;  3ACI A;  2WAB A;  3C8X A;  5C71 A;  1XPW A;  2VZ3 A;  1JYN A;  4QX2 A;  2WN3 A;  4JKL A;  2Y8K A;  4AG4 A;  4DUV A;  5C7G A;  4DEQ A;  4YPJ A;  1GMM A;  1JZ8 A;  4QB1 A;  2VQT A;  2C9K A;  4DUX A;  4CUA A;  1ULO A;  3I2I A;  3ACH A;  2QQJ A;  2W5F A;  4ARY A;  3WQB A;  3A21 A;  2QQM A;  1I5P A;  2Z4F A;  3LQC A;  1JZ7 A;  1GUI A;  3LE0 A;  1W9W A;  2QQL A;  2VZQ A;  4DXR A;  1UXZ A;  2J1R A;  2J7M A;  3HPN A;  2J1U A;  3I3B A;  2WN2 A;  1GQP A;  2JDA A;  5B4X A;  1JZ3 A;  2WYS A;  2VZV A;  1JU4 A;  2W87 A;  3D3A A;  4XUR A;  2W1Q A;  4RYD A;  1JYW A;  4LKS A;  3LEI A;  3BN6 A;  3EYP A;  3SKV A;  2ZXQ A;  2ZEX A;  4JKM A;  4KWU A;  2DCJ A;  1PX4 A;  1EUU A;  3K75 B;  3MV1 1;  5DN2 A;  3T2P A;  5IFT A;  3DYO A;  3HOB A;  3PUI A;  4PQQ A;  3LPF A;  5I0D A;  3IAP A;  2W1U A;  2X09 A;  3NJV A;  4A44 A;  2JD9 A;  3GM8 A;  1KGY A;  3IB3 A;  4MGS A;  3BGA A;  4MO3 M;  1UYZ A;  4QAW A;  3WNM A;  5HPO A;  2BBA A;  3WF0 A;  2QQO A;  3III A;  2W1W A;  4CU6 A;  4A41 A;  1BHG A;  3K4D A;  3A7Q A;  3HJR A;  3JXS A;  4PT6 A;  3IDA A;  2WZE A;  3WSO A;  1PMH X;  2BGP A;  2EID A;  3FHA A;  3W5M A;  3SEP A;  3ETP A;  1ULP A;  4Z2A A;  3CMG A;  2YFU A;  4OUE A;  4QB6 A;  4A42 A;  4ZZ8 A;  1J84 A;  3CQO A;  5EJ1 B;  5LA2 A;  4CU7 A;  3J7H A;  1L7Q A;  1SG3 A;  2VOT A;  3T08 A;  2Y64 A;  3DYM A;  4P08 A;  2YFZ A;  1W8O A;  4OZO A;  3A23 A;  1YQ2 A;  3UET A;  1UY2 A;  2W1S A;  3HEI A;  3WNO A;  2EIE A;  2VR4 A;  4A6O A;  1H6Y A;  1SHW B;  2W94 A;  1DYO A;  4M4R A;  3CZU A;  3I2H A;  3GGL A;  4JKK A;  2WUH A;  3I2K A;  1UY4 A;  2JE8 A;  1W9T A;  1L7R A;  3DEC A;  3C7F A;  4OMD A;  1JU3 A;  2WDB A;  3NNG A;  2ORX A;  1T2X A;  3SEE A;  3T2Q A;  5A1A A;  3SKJ E;  1JZ4 A;  3UNP A;  2LS6 A;  2XON A;  1WKY A;  5CYY A;  2VO5 A;  1DP0 A;  2X05 A;  1UY0 A;  3WF4 A;  4W50 A;  2V4V A;  3C7G A;  3NQH A;  3ZM8 A;  2J1V A;  4BK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...