1O8PA

Unbound structure of cscbm6-3 from clostridium stercorarium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
PVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and ligand binding of carbohydrate-binding module CsCBM6-3 reveals similarities with fucose-specific lectins and "galactose-binding" domains.
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Hydrolase
molecule keywords PUTATUVE ENDO-XYLANASE
total genus 30
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1o8pA00
1XNAA 2XQXA 4DUVA 4XUQA 5B4NA 3HPNA 2DCKA 2QQNA 2XOMA 3U37A 1SG3A 1JZ4A 2JKXA 2RVAA 5LA0A 1W9WA 1K45A 3GXUA 3IAPA 3P1IA 3OGSA 3C8XA 3FN9A 3K75B 2J1SA 3NJVA 2J1RA 2VZUA 2YG0A 2V5DA 1GOFA 4P02B 4LQRA 3T0DA 2VO5A 3AC0A 3HNBM 1PX3A 1EUTA 3OGRA 4P5YA 4BK5A 1L7RA 2W87A 3HEIA 1UMIA 1O8SA 2VJXA 3VDCA 3NJXA 2VMEA 2WUHA 3UNPA 1UY4A 4MGSA 4QB6A 4A6OA 4XUTA 3DYPA 1OT5A 3WNMA 4HG6B 4JHZA 1JU4A 3ETPA 3FHAA 4ZY9A 4CU8A 4JKMA 2KD7A 1UY2A 2VCBA 3A23A 1WKYA 2W92A 3W5NA 4CUCA 4W50A 3BGAA 3WNPA 2Y6LA 2X09A 3MO4A 3WF4A 3LEIA 1LNSA 2RV9A 1L7QA 3EYPA 2V4VA 4XUNA 4P08A 4Z2AA 4MOAA 3NNGA 3OB8A 3UESA 2Y6JA 1K12A 3PUHA 1UYXA 5JXHA 1UY0A 5LA2A 2WAAA 2W91A 1JZ6A 1D7PM 2HLEA 4ARXA 1W8OA 2J22A 4CU6A 3I3BA 3OBAA 4DXSA 3A22A 3MUZ1 5JXIA 5DMYA 2W46A 2EIDA 2DCJA 3ABZA 1NUKA 1UYYA 1PMHX 2JD9A 2ZEWA 5CZKA 3I2JA 4JKKA 3ZM8A 1J84A 1DLCA 1JZ5A 2Y8KA 3HOBA 4RYDA 5HXMA 1OF4A 1F4AA 5DPNA 4A42A 1DP0A 2X10A 4DXTA 2OKXA 4UAPA 4DUWA 5C70A 4GWIA 1GUIA 3VD7A 2JDAA 3C7HA 4D8MA 3WEZA 2W95A 1TG7A 4IUGA 2YC2A 2V72A 4CVUA 3WNOA 1ULPA 3LPGA 1EUUA 4QX3A 2ID4A 1JU3A 4DXRA 2VCCA 3WNNA 2VZ1A 3I2FA 4CUBA 2QQOA 2W1SA 2W47A 4QAWA 1JYWA 2J1TA 3IB3A 5EJZB 2C9KA 4GWJA 3I97A 1HN1A 1JYVA 3ACFA 1UYZA 3K46A 2BGOA 4LHSA 3WF1A 2XONA 1JZ7A 4OMDA 1UWWA 4KWUA 3K4DA 2WAOA 4XUOA 5C7GA 3T2OA 1O59A 3WF0A 2BGPA 4P00B 4QB2A 3FL7A 3I2KA 2LW8A 4BK4A 3C7EA 2VOTA 1KGYA 5LCWL 4W4ZA 1OD3A 3K77A 4FI9A 2WZ8A 3MV01 1O8PA 1UMHA 2C26A 3IIIA 4LKSA 4A45A 3A7QA 2ORXA 5IYYA 4OZOA 3HNYM 2VZRA 4CUAA 2WZEA 2ZEZA 3T2QA 3ACHA 3HN3A 5JMOA 4QX1A 3LEKA 1W8NA 4UOJA 1DYOA 1TVGA 2C4XA 4A4AA 2WN2A 2PQSA 5J1XA 4JX0A 3DYMA 4PT6A 3IDAA 4DEVA 3T09A 3LQCA 1I5PA 4M4PA 5JXGA 3J7HA 3OEBA 3LPFA 3T0BA 2VMFA 4MGQA 2BBAA 3IAQA 1K3IA 3THDA 4QDRA 5B4XA 2VZ3A 1JYXA 2W94A 2J7MA 2J1EA 3MUY1 5C71A 5FUIA 1UY1A 4D0QA 1W0NA 4JKLA 2W3JA 4RN5A 4OUEA 5IFTA 5LA1A 1UXZA 1PMJX 4XUPA 3WF3A 2YFUA 1UX7A 1GQPA 2WO1A 2WO3A 1JZ3A 3OEAA 4QDSA 3I3EA 4LPLA 1F4HA 4BXSV 3SKJE 3K4AA 3A21A 3UETA 5I0DA 3DECA 4XURA 2J1VA 5G04L 4YPJA 4BJ0A 2QQLA 3SEPA 2VC9A 1CZSA 1UY3A 1H6YA 2VL4A 4PF1A 3GDBA 4CU7A 3WSOA 3C7FA 4QX0A 3CMGA 3HJRA 5IFPA 4KI5M 5IJRA 1GOGA 2ZEYA 2Z4FA 1CZVA 2WO2A 1J83A 4QPWA 3VD4A 1H6XA 1K42A 3VDBA 2WYSA 1W9SA 3CQOA 3LEGA 1GU3A 3VD9A 1US2A 1WCQA 2VR4A 2ZEXA 2VM9A 2VTFA 1CX1A 2QQMA 3I2IA 2VQTA 2E26A 4A41A 1P8JA 2VMCA 2WABA 4XVHA 2W1UA 3OG2A 2Y64A 5JUVA 3WF2A 1OH4A 1R64A 4A44A 4XZUG 2EICA 4KMQA 2YB7A 4ARYA 2JE8A 3ACIA 5JR2A 2QBXA 1XNTA 1UZ0A 3NQHA 1NKGA 4AAXA 2DDUA 4OMCA 1IQDC 4CU9A 3P6BA 1YQ2A 3CKHA 1BHGA 3C7OA 2HYXA 4M4RA 3VD3A 2R7EB 2BZDA 5EJ1B 3WNKA 2BERA 4TTGA 1NAEA 2EIEA 2RJ2A 1T2XA 1W9TA 2B4KA 1JI6A 1SHWB 1ULOA 1MPXA 2YC4A 5DN2A 2Y6HA 2W9XA 4PQQA 2VMDA 4QB1A 4DEQA 2VCAA 2J1AA 2LS6A 2VQUA 3ECQA 1JYNA 3VD5A 4MADA 2VZSA 4DUXA 3K4ZA 2QQJA 2WN3A 3CDZB 4OYUA 2E31A 2CDPA 3I3DA 2X05A 1GNYA 3CZUA 1JZ8A 1PX4A 1RYYA 2E33A 2YFZA 4QX2A 2VZOA 2QQIA 4BDVB 3I2GA 2VZPA 4ZZ8A 3OGVA 4E8DA 1JHJA 3D3AA 2J1UA 1XC6A 2W1QA 4MO3M 5CYYA 2EIBA 3CIHA 3FHQA 1GOHA 2ZXQA 3DYOA 4AG4A 5IHRA 2Y6KA 3EB7A 2B9VA 3GGLA 5DQ0A 3T2PA 2VZTA 3T08A 2Y6GA 5JXJA 3W5MA 1CIYA 3SEEA 3T0AA 1OF3A 3I2HA 4W8JA 2L9LA 1JZ2A 2VZQA 1US3A 2WDBA 3F2ZA 1UXXX 3C7GA 3BN6A 5EIYB 1GMMA 2E32A 5A1AA 3THCA 4A3ZA 2WBKA 3CZJA 3HNMA 5F7UA 1NX9A 3LE0A 2ORZA 2VZVA 4TXWA 4ZXEA 5G05L 3GM8A 1CZTA 2W1WA 3NRUA 2WQ8A 2CDOA 5HPOA 3ACGA 4E8CA 4GZ9A 2QQKA 3WQBA 4ZZ5A 1XPWA 4ET7A 3PUIA 3WNLA 3E1F1 3VDAA 4L0PA 3MV11 1SDDB 3SKVA 4UI9L 1W99A 2W5FA 3MBWA 1KEXA 3JXSA 2XHNA 4QDQA
chains in the Genus database with same CATH superfamily
2HBTA 3HPNA 2DCKA 1XU2A 1DZRA 2QQNA 4JVAA 2VNVA 1RUF1 4NRMA 1D4M3 4AEMA 4FP3A 3WG2A 5CFDB 2VY0A 2RVAA 4P9LA 1YI9A 2CYFA 2P3YA 2DFCA 1VMFA 4FPFA 5BV6A 3GXUA 2A71A 5AC93 3IAPA 1R081 2LTNA 4MV2A 3RMYA 5DUWA 1COV1 3FN9A 3K75B 4YARA 1YIPA 5HCHA 5C4WA 1H2MA 1B35C 4GKXA 3H8OA 1D4M2 3MIFA 2RM21 4CEYC 1I3HA 5F5AA 3O5SA 1PIV3 2IFWA 4AEKA 3GBFA 3NNFA 4FVVA 3DV8A 4LBMA 2HEYF 2D6LX 3WDUA 3T0DA 1W8UA 3BOPA 4XMIA 1Q8VA 1DFQA 1EUTA 5JWPA 3B9CA 1IG3A 4XF9A 5FPBA 4XAAA 5F8PA 3VDCA 3NJXA 2VMEA 4PLNA 1W06A 1YJKA 1HB2A 1LTEA 1W2AX 3B3QE 4FFIA 5D8AC 5A3UA 4FFFA 2B42B 3WXPA 3EO6A 4QB6A 4A6OA 5F6LB 5DZFA 1W8HA 4Y1YA 1MQTA 1OH3A 3N9OA 4HZFA 4RD7A 3MZHA 3BOWA 5K4LA 4MGKE 2CWSA 2VVEA 3GZEA 1REFA 4XQWA 4BE3A 5IK4A 5FIXA 4E2GA 1XYOA 2NZ9A 2QZ2A 1NQDA 4XJAA 1SBEA 3ZX7A 4IV3A 3VBSA 3AYDA 1YFXA 2ZGSA 3E6BA 1YHFA 1OQ1A 1UY2A 3CJIB 3MICA 4Q4X2 1FV2A 1NQJA 1G8WA 1YFWA 5E16A 1ULCA 5KXCA 4L99A 1WKYA 2A5ZA 3AP6A 4GULA 1VP6A 1QJEA 1QJY1 1S0BA 4COWA 2ZZJA 5LEJA 4UFHA 1IHMA 2D6NA 4AVAA 1VJ2A 3KVAA 1FNZA 3MO4A 4JZRA 3WF4A 3LEIA 5C5UA 4XAEA 3UGGA 2WS93 1L7QA 2AZ5A 2V4VA 1W3XA 2IXHA 3UJQA 3JB8A 2ERFA 2VAUA 4Y22A 3G7DA 1GP5A 3JB4C 1UYXA 2VVDA 1SEFA 4RR3B 3H50A 2W91A 5A3WA 3DGTA 2Q8EA 1JZ6A 5ACA2 1FOD2 4WVVA 4YGBA 3R4UA 2DVBA 4AEJA 1AYN2 3LOIA 2J22A 4OVEA 3WP5A 1CGPA 1ZRCA 2D3PA 1XXNA 2BGCA 2Z2SB 1MQTC 1LHNA 3I3BA 1LAJA 1REDA 4HPKB 2FQPA 3BIEA 2VBBA 5JMCA 5JXIA 1AR63 5DMYA 1ZBA3 2W46A 3KHBA 1AL0G 1CAWA 3WG3A 3WCSA 5FJKA 1GNZA 3WUDA 1W0PA 3W21A 3TEXA 3NAPC 2BUKA 2RJKA 4IV3C 3ZDSA 4ATFA 1C4RA 2D98A 5LASA 2AR6A 4QU1A 1WW7A 3AMPA 4GKYA 1F15A 2DCTA 4YSFA 3CJIC 4LO6B 2WNVA 3VL9A 5L19A 3OTFA 5FZDA 3ZM8A 2ILMA 3UL2A 4S2GA 3WG4A 4AVTA 2RDNA 1Y9QA 4MLOA 4YVSA 1LHWA 2Y8KA 5D21A 1N1SA 3TBDA 3HOBA 4RYDA 3AYEA 1LKNA 4NR1A 3KF5A 1OVPA 4GMP3 2VECA 1QXJA 1F4AA 1QJZA 2IFRA 2Y0OA 3JCIA 4COUA 1O3RA 5IVBA 1C1LA 3K3OA 1WA6X 5L73A 2BBVA 2IVJA 1GUIA 2VW2A 3ORJA 1PO23 3FX3A 5KXDA 1RJ8A 3WEZA 4CEYB 2ZX0A 1AL23 1SLIA 2WLQA 2PTMA 2BP6A 1DYKA 3KSCA 5FZAA 1ND2C 3WNOA 3LPGA 1UO9A 4HKOA 3JBG2 1N3PA 2LRPA 2AREA 2YPDA 3SNMA 2K2SA 3WNNA 3I2FA 3HBKA 1U12A 1VB2A 2QQOA 4JQRA 4LTAA 2W1SA 2W47A 2RS53 2J1TA 5EJZB 1ZREA 1O3TA 4Y5TA 3T3YA 3KQ4B 1AHSA 4XBQA 2DV9A 4D7YA 2VXRA 4HMZA 1UKGA 4GMP0 4OHZA 1RUJ3 5DUVA 4QPIA 1H4GA 1LJ7A 1NY72 2XONA 3GHMA 1UOJA 1RUNA 2P3KA 4KWUA 3WOGA 1K5MA 3C3VA 1V70A 1TZOA 5FXZA 1DQ0A 2JWPA 2RR11 3ZPOA 5E1RA 4EYUA 4N43C 4BMEA 3MIBA 1XJAA 5FO8B 4QB2A 3HQRA 4J25A 4MXWB 1BEV1 3FL7A 4YGDA 2LW8A 4AL9A 4BK4A 3C7EA 3IMNA 1H2NA 1HN0A 2IXJA 1UCXA 2WQ4A 3MIDA 1A6CA 4FI9A 5JI7A 1YQ6A 2RM23 3ZFGB 4K3UA 1STMA 2VG9A 4KBBA 1UMHA 3V56A 3FFZA 5T5LA 2C26A 2ZMKA 3IIIA 3ZXEA 5K8SA 2Y0IA 3FUQA 2FDFA 1VPHA 2CSGA 4B4PA 5IVCA 3NWKA 4PCRA 5F37A 3K51A 4CUAA 4A3XA 2H0VA 1Z78A 5GLWA 3WW4A 5GZEA 4GD4A 5JMOA 3R4SA 5CVRA 3O1OA 1KJRA 3WD5A 1PZ7A 4CCKA 4HVQA 5ISLA 4Q4V2 4H55A 1ENRA 5AFEA 1XSRA 1TVGA 1A78A 1V6JA 2WLPA 1LRHA 5F1RA 3J8F3 4YZ4A 3J26N 3MFCA 1AR71 3NAPB 2XHKA 3O0XA 3QACA 5I0SA 3WCRA 2EXJA 4PBPA 5A32A 4JGZB 2RG4A 2ZHMA 4FAGA 3DYMA 5FKCA 1MZFA 3IDAA 3KCYA 1IOAA 4IV1A 3UKVA 3CO2A 4CCOA 5FYVA 3AK0A 3OEBA 4DS0A 5ANQA 5A3OA 4EWEA 3SH3A 4B1MA 5C8CB 2VMFA 4IGOA 3SCFA 4AFMA 2HWF3 4XYXA 1XNKA 1K3IA 1W6QB 4Q26A 3VBRC 2VZ3A 1Z7S3 4AVCA 4HN1A 1VMJA 3CEWA 4L97A 4D94A 2Q0AA 2J7MA 2UWAA 1JYXA 3LAGA 4UW6A 4DRRA 2UYBA 3WG1A 4EN7B 3MUY1 5FQ0B 4LIUA 2JDUA 4LMFA 4YM1A 2RMU2 3FBYA 2KR2A 2PHWA 5HCFA 1UY1A 4OHYA 1W0NA 2BPA2 2FCUA 3TOJA 1D2SA 1AL21 5A3TA 2NMNA 3H0OA 4RFRB 2W3JA 1SMVA 2G9ZA 3NNJA 2PLV2 1JTZX 2PAEA 4CDQB 1R1ZA 4LA3A 3WP4A 2MEV2 1WMEA 2HH9A 2WO1A 1F2NA 1VAMA 3OOXA 1ND3A 1PNGA 2R063 1S2BA 2EAKA 2JDNA 4INDA 2R0FA 4QGMA 5F3EA 3N4MA 1ODNA 1IS6A 1RB8G 3ENRA 3WX5A 1J3QA 1OLRA 3O14A 3PVBB 1K5JA 5I0DA 1AXZA 4XURA 1RHI2 4LXLA 5A33A 5C8CC 2GC2A 5A33B 4LKFA 5FCCA 1HRV3 3USSA 3ZN4A 2V73A 3HMYA 1QJU2 2JX9A 3AP7A 4BOWA 2VC9A 2OIIA 2RS12 2ZTNA 1CZSA 4Q4V1 2AGSA 3ZFEC 4CU7A 2VUAA 1S0GA 1NCQA 3DKWA 4AFAA 4CYDA 3U4XA 1R092 4NPLA 1GSLA 3CMGA 5FBZA 4BB3A 1RUE2 4YRDA 5IATA 3ZYBA 1S0CA 1AL22 3ZFFC 3RFRA 2AACA 1GOGA 5IJRA 4YLZA 4R9DA 2WO2A 1J83A 4ZHNA 1ND2B 4NUBA 1TNRA 1LCLA 1NG0A 3AYAA 1F9KA 1OPMA 1RUH1 3FZ3A 3VD4A 4EWDA 3V0BA 2WFF1 1G9CA 3I49A 5FPXA 4QHOA 3VD9A 3OF1A 1POV1 1UW8A 5FZKA 3SITA 1ND3C 3OGGA 1CX1A 1HRI3 1CR7A 1E5IA 1LOBA 4WM7C 2AYHA 2Y33A 2E26A 4QKFA 4FT8A 1MQTB 4BQ4A 4K9SA 2XQRA 4CDXB 1BMV2 4CXWA 2W1UA 3ZO0B 1KXGA 4I2OA 3OG2A 5FZHA 2TNFA 2VGDA 3WF2A 1OH4A 4CSWA 4EN9B 4J1WA 1YRZA 1BEV2 1AR72 2PLV1 1V6NA 4AF9A 4ARYA 2JE8A 3ACIA 4AR2A 1VBC2 1UZ0A 4IESA 1W2NA 1E5RA 2WZR1 4ZU5A 5FP4A 3NQHA 2G9FA 1HB1A 2P17A 2JG9C 3AP5A 3ZFGA 1NYWA 1ULFA 4OMCA 1FOD3 1DQ6A 4H3WA 5FR3A 3RNSA 3RWNA 1G7YA 2WA4A 1YFYA 4HKWA 4GH4B 4PI0A 5JZGB 2RDQA 2BZDA 3OD4A 1ULEA 5JPMB 1YJLA 3KCCA 2QFEA 1NAEA 1O4TA 2PLV3 3B69A 2WS92 2DUPA 3AKSA 1BXHA 3FBMA 1TME2 3ZYIB 5KHGA 2W0XA 1ST8A 4GIQA 5CKQA 3AP9A 5FXWA 5LRSA 4LHKA 2YC0A 4P9JA 4QM9A 1G9BA 1B09A 4KG8A 5DAVA 1CAUB 4UFLA 2IUWA 1LOFC 1S1AA 5FP8A 1JODA 1OFSA 1UKRA 2VMDA 3I59A 2J1AA 5T55A 3MIGA 2GZWA 4BH9A 2ZGTA 2CWMA 1ZA4A 4MADA 2P6CA 4DUXA 4CDUC 4OCTA 1UOBA 4AFDA 3CDZB 5L7OC 1ZRRA 3U78A 1W6OB 4EZ4A 4QX7A 2MNGA 3BODA 5DXDA 3GZTB 3OYWA 4FPCA 4KWLA 1MZEA 2CDPA 4BXFA 3OD0A 2ZABA 1CAXB 1CX4A 2XVGA 3KV6A 3I3DA 4Q0SA 4COZA 5FWEA 2KXLA 1S2EA 2C6SA 1BZWA 3W9AA 1JZ8A 3ILFA 3OUJA 3BB6A 2BU9A 1PX4A 2WQZC 2RMU1 3T4VA 3HQUA 4WVWA 5CFCC 2VMHA 1UNBA 5FZ8A 1ZRFA 4TN7A 3SC7X 3WW2A 1JHJA 4ES8A 4JGZA 4HVOA 3ZXGA 5IT6A 5FY0A 3AZVA 1GOHA 2QDNA 4G9SB 4ZPIA 1UU6A 4GMP1 4LUKA 1QF3A 4YW6A 4GJZA 3ON7A 4AG4A 4CP9B 1X33A 1MS1A 2B9VA 4CCMA 1ZZ7A 5H9PA 3GGLA 5AC92 5A7WA 1R1A2 3NKGA 1CWPA 2WFF2 2IXCA 3T08A 2RM22 1O7FA 2Y6GA 4AEDA 3AX4A 3OCPA 4XQ4A 3OPTA 5KR7A 4LBKA 3T0AA 4AI2A 5A1FA 1V6LA 4XIOA 2GC3A 3RYRA 1GBGA 1JZ2A 3KV5A 3M8LA 2YDEA 4O9GA 3WDXA 5L7OA 5A3PA 1DGWA 2OUJA 2YGLA 1GICA 3F2ZA 3S30A 4AHXA 1NT0A 4FOWA 1PIV1 2XJQA 3WQ1A 3C7GA 3BN6A 2XJPA 3APBA 1AUYA 1RUI2 5A6XA 1RUF2 5K0UC 4FOVA 1ZZCA 1HRI1 2NM1A 4YW5A 5FRAA 3BPZA 1E5HA 1RUJ2 1VAVA 1Y43B 3KQRA 2EA7A 3ZSLA 4JTNA 3USUA 3ES4A 3ATGA 3CNAA 5F3CA 3PIGA 1OLQA 4DQAA 4MX3A 4ZXEA 5FZ4A 2ES3A 3BTXA 4CDWC 2N7GA 4JGZC 2DFBA 2Q30A 4MVTA 3WV6A 4XCAA 3U4SA 4LNVA 4CEWA 1CZTA 4TZDA 4V2WA 2FCTA 3KT4A 1RUC1 1J3RA 2O8OA 5KHIA 3GF6A 1FPN1 2QQKA 4Z82A 1XPWA 2X5IC 2YU1A 3IDEA 1NLQA 3WNLA 3E1F1 3VGIA 4ET7A 5CFCB 3B94A 1IS3A 4B3NA 5I91A 2A6VA 2ZX2A 4QKBA 3SKVA 4BWOA 1W99A 5KC6A 5CEHA 3GNEA 1RTVA 4NPMA 4L92A 4QQOA 4WZFA 4ATEA 4OLLA 3NV3A 3JXSA 3MGUA 2XHNA 5FZCA 1EAH1 1V9U2 4CCCA 4QDQA 1XNAA 4W6YA 3VHRA 2R1BA 3MW2A 3HAGA 3U37A 2R041 4QGNA 5KXBA 1RMU2 4RHV2 4XPVA 1JZ4A 4QPYA 1Y4WA 2HWE3 2NLRA 2K0GA 1NCRC 2A70A 3RI8A 4PIYA 2W52A 4IEUA 4NOTA 4NIAA 4Y1VA 2J1SA 4Y5SA 2PN5A 5FYCA 5C5TA 4R8HA 4RL7A 3HR9A 1NE4A 2JXAA 4SBVA 2V5DA 1QJY3 5FYUA 3SXWA 5BYNA 5CBLA 2JG9B 5F9TA 2X8KA 4P02B 3PU3A 2JDYA 3S5QA 1V9U3 4KU8A 4XF1A 4XTPA 2G1MA 4DOUA 2JG8A 2D93A 1N1VA 1AR92 4HFSA 4P5YA 2W87A 1ZBA2 2ATFA 3KGZA 4XJ8A 2BTVC 4PIXA 3VBUA 3ZIXA 4KGGA 1X7NA 3E5XA 5DUUA 3UNPA 3A0KA 2CAVA 3D8CA 2ZGKA 1FAYA 5ACA3 5ACA1 1CAVA 3J7LA 1WUVA 1POV0 2PHXA 5A7OA 2BJSA 3AMNA 4BM8A 5C3PA 3DUIA 1YQ5A 3ZXFA 4Y1UA 3I7DA 4CU8A 1ASJ1 3H3LA 3JD72 2QVSB 4C91A 5DAWA 3TWIA 1KS5A 1OBNA 1POQA 3WQ7A 4ITCA 1AYM1 2BQPA 2F4LA 3DN7A 3ZLIA 1LOCA 4CXXA 1NCRA 1XE7A 1PO13 1RVF2 4LBOA 4O7XA 1G9DA 1UZYA 3SISA 3WW3A 5FY1A 1MS3A 5CISA 2W92A 4BQ2A 1NCRB 3IDBB 4CUCA 3W5NA 4FTEA 1O91A 3J9SA 3AL6A 2XBO2 4W50A 2LUWA 5FPZA 2A7AA 2Y6LA 5FP3A 4GQ7A 3WNPA 4Q4X3 4XMAA 3D0SA 3WINE 1O5UA 1CAUA 1UIJA 4JV4A 1W6NB 2XWJB 3KV9A 2ZCWA 3EYPA 4Q4W1 3WHUA 3FE5A 4HOOA 4XUNA 1OHFA 2HWB3 4K20A 3OB8A 5CKMA 3UESA 4YW1A 3RYKA 1ONAA 1I1EA 1MS8A 2Y6JA 2R042 2FDHA 4OQ8A 1IKPA 2WNVB 3O1VA 5JOYA 4MG2A 1UY0A 2ETEA 1O5LA 2OQ6A 2ZS6B 2GU9A 3DEMA 4YNIA 1X8EA 4ARXA 1W8OA 4Q2FA 2GAUA 3KT7A 2MPFA 1W90A 4E2SA 3OYWB 5K9YA 2ARXA 1C28A 4I01A 3U75A 5FYZA 4Z2WA 4KNCA 4YW2A 1AR81 4MXVA 3PVNA 1DZTA 1K5MC 1S55A 2YROA 4X8PA 4EN8B 3ZN6B 1EAH3 4YZ3A 3AL5A 5JLVA 1QOSA 2JD9A 3ZYGA 1KS4A 2D44A 1UX6A 3PVEA 1PIV2 2VNGA 3VHOA 1MVEA 4QKNA 4FPKA 1COV3 4LOTA 2XKOA 1AJKA 3NMBA 3TEYA 4ASKA 4JKKA 5JSOA 2A6ZA 3D6EA 1HRV1 1SLTA 1W03A 1AVBA 2A6WA 5HXMA 4EWAA 2CGOA 2R043 3R4DB 4A42A 4Q1PA 1DP0A 3VKMA 1MZ5A 2OKXA 4DXTA 1FMD2 2R072 4QXCA 4GWIA 2Q8CA 4CEWB 4COVA 2BOJA 2CGNA 2H6CA 4HANA 3VDDC 5C9AA 3GCWA 4H14A 2W95A 1TG7A 2VOKA 4IUGA 4OHWA 4A7ZA 2XKPA 3KB5A 1LEMA 1YWKA 4OHVA 2R30A 1CN1A 5FBJA 4YW4A 1EUUA 5KBFA 1C57A 2ADEA 4QX3A 1JU3A 1EV13 1GP4A 5DZGA 1W6MB 4YZ2A 3POIA 2VCCA 4B8EA 4D7TA 2B39A 4AQTA 3W58A 4AHYA 1CONA 2D5HA 1V00A 2XJVA 4KWJA 1DQ5A 1JYWA 3IB3A 5L9RA 2GP3A 4PDWC 4Y20B 1XSQA 2Y6FA 4GWNA 4YZ1A 4UF0A 3AMMA 1IZ3A 1SACA 4OHXA 1HQWA 3I97A 4KQ7A 3ACFA 1QJX3 1UYZA 3AZZA 1GKBA 3H8UA 3LFMA 1H8VA 2AUYA 1JZ7A 4OMDA 2PELA 2WAOA 3BYWA 4QQLA 4YW7A 1AR73 2HYKA 2ZBJA 5EFUA 5FYHA 3T2OA 5A3LA 5J48A 1G6NA 4LT5A 2ZAAA 4K21A 2FDJA 2C24A 2Z69A 2BGPA 4XCBA 5IWFA 3LZZA 4LJHA 4P00B 3SLIA 4NWVA 3BVCA 1B35B 1Y3TA 3RDIA 1QJY2 5APAA 1W28A 1KITA 3K77A 3QH7A 3BI3A 3N7MA 2D40A 2E7QA 3MV01 1O8PA 2PAKA 2BWCA 4QWNA 4YGEA 4ZONA 3ZOIA 4DY3A 4LKSA 2LM3A 3QOPA 4YM3A 4A45A 4C1XA 1WA4A 4FAHA 5IYYA 1ZX5A 4IE0A 1EY2A 3HNYM 5E88A 1C8NA 1JHNA 1RUH2 4C0HA 1W6OA 2UWBA 3I3MA 4XFAA 1C8M3 1W8TA 5A7NA 2ZEZA 3HN3A 1QJU1 2AC1A 2D7FA 2GMPA 3LGRA 4GWMA 1WD4A 5C8CA 3AZXA 4KBZA 2ZHLA 4E2QA 4XFFA 1X36A 5FY7A 3MI8A 1PHMA 1CAXA 2C5DA 3J4UH 1W8FA 3WVJA 4FPOB 4A4AA 2D3RA 1W8WA 2Y26A 4Q0QA 3VLBB 2CV6A 4CZSA 2UWCA 2ZGPA 5LBEA 1PM4A 4P14A 1NCQC 1VRH1 2VE1A 4XC9A 4XXPA 5FYMA 1NLSA 2JIGA 3POJA 1M06G 1HX6A 3ZFFA 3POBA 3VBOA 3T09A 2CY6A 1YLLA 1LOGA 2FZ1A 1C8M2 1I5PA 4CDQA 2OZ6A 4CUGA 2WT2A 3V64A 3LPFA 1VBC1 1H9WA 3T0BA 2WFPA 4ZXKA 4YZ5A 3BU0A 1IS4A 2X5IB 1N3OA 3VBHC 2JE7A 1Q8SA 2IC1A 2XVLA 3IMMA 1MR5A 4CP2A 2DUQA 2PHFA 5B4XA 1NOVA 4NHLA 1CESA 3JU9A 5BNOA 3SCGA 2FZ2A 2UY8A 5LRRA 4Y3OA 5HI0A 3RZMA 1RUF3 4QPIB 2MEV3 4Q0UA 3O12A 5AVAA 1H8TB 5C71A 4B7EA 1EP0A 3PL0A 1ALYA 1C1FA 1Q56A 5ABJC 3OSDA 4D0QA 2JB8A 4RN5A 4UBHA 4OUEA 3WR0A 3ZSEA 3VBOB 2IXLA 2AENA 2HBUA 1SLCA 2W08A 1OA3A 4WBBA 4XUPA 2WFF3 1VRH2 1VBA3 3WF3A 1R1A3 1DGWX 1UX7A 2OPWA 2ZGMA 1LB2A 4LITA 3MEPA 2NQYA 2YZ4A 3VKFC 1JZ3A 4XF3A 5LATA 4LPLA 4NO4A 1BK0A 1SDWA 2CTVA 4J1XA 3RZKA 1F4HA 5DDJ1 4N7IA 4CCEA 4BXSV 3SKJE 3RJ2X 3K4AA 4R9BA 1S0FA 2O14A 4BIOA 4C90A 2OUHA 2FHRA 1D4M1 2K9ZA 3N36A 3U14A 1LULA 4YPJA 3BTAA 4N53B 1QOOA 1H1MA 1H2LA 3D0JA 5BY5A 1VBA1 2D5FA 4LO8A 4N9IA 3SEPA 1PNFA 1EV12 3TNQA 3PJQA 4XDQA 4AVVA 4F83A 3GDBA 4MYEA 3N7JA 3H7JA 5J98B 1W3VA 4I0BA 1VBE2 1FATA 5FO7B 1OQDA 4JGYC 2BVVA 5HV4A 3MF6A 2WZR2 5HBAA 3PDQA 4CCDA 4ZKTB 2K46A 4BQ5A 1JYIA 1PGL1 1MEC1 3FFQA 2RS33 5T54A 3LDBA 4KU7A 1H6XA 4XILA 5FZIA 5JSPA 2P1BA 5C4WC 5F32A 2E63A 5T52A 2QE3A 1UAIA 1W9SA 2DCZA 3CQOA 4NROA 3LEGA 3U07A 3I2OA 4NIIA 1OFNA 2VR4A 2ZEXA 1FOD1 5E8AA 2VTFA 2GNTA 2WS91 3AKRA 3MPPG 3NV2A 4HL0A 3PJYA 2RS11 4XOGA 4B4RA 1RUG2 3LOBA 4P9WA 1GWKA 2VMCA 2XGXA 5BXXA 4DMIA 4DO0A 1R091 4IW3A 4AGRA 1VLNA 1WZXA 4M01A 3SMHA 2VPVA 3LDRA 5JUVA 2CL2A 3I54A 1PM7A 1X9PA 4A44A 4OULA 2KA3A 1JMUB 2B45X 1N1TA 2ZJCA 3P3NA 4UT5A 1FX5A 1RUI1 5FYTA 5FXXA 1SFNA 3ASIA 2QBXA 1RC6A 1XNTA 1NA1C 3IPVA 4E4ZA 5A6YA 5JR2A 3OPZA 2XDVA 4P9XA 3TNPB 1NKGA 4KWKA 1OLMA 4TLGA 3MYXA 1LECA 5F3GA 1C8M1 4CU9A 3AB0A 3P6BA 4RFT0 5GZFA 3VBSC 4LBNA 1ASJ3 4FTBA 3CKHA 2JDZA 4AI0A 1BHGA 3SCHA 1VBC3 2ARAA 5FREA 2HYXA 4BLJA 3VHPA 2R7EB 4FPJA 3RSJA 3WDVA 4AHZA 2HWB2 4IEYA 5EYXA 3THPA 1WLWA 2LALA 3AZYA 4XACA 1T2XA 2FBEA 4AAPA 3POYA 4DPNA 1W6PA 1GNHA 1F35A 2DVAA 1JI6A 1ULOA 3KLSA 2P34A 1MPXA 3T4HB 3DXTA 1UU5A 5LB6A 1HJFA 5BNPA 3EMRA 5LW9A 3MLLA 5HV0A 4G3YC 5A3MA 4A2UA 3Q9OA 4PQQA 5A6QA 1PO12 1RVF3 1CPMA 3CJXA 4O9EA 3ZXLA 2VCAA 4B7KA 2VMGA 2VQUA 1TNFA 5H9SA 4MHUA 2VOXA 4V2VA 1VIWB 3LFIA 1OVSA 4XJWA 1W0OA 4Y33A 4CDWA 3O1UA 4CTEA 1NA1B 1MS4A 2UY9A 2QKDA 4JDOA 4OYUA 4CRQA 1J58A 5FZEA 2X53S 5FZOA 3H7YA 1GNYA 4N53A 4I02A 1QEXA 2X5IA 1VR3A 2ZGLA 5EPAA 4AFCA 4AI8A 4QX2A 2YFZA 5T3NA 1QWRA 2HWD1 4MGIE 1AR93 3VZKA 2GDFA 3ZXJA 3AFGA 1PO21 2XJUA 3AVSA 1RUJ1 1RIRA 3N35A 5T5JA 3SHRA 1YXWA 4E8DA 1KDMA 4XEZA 4B4QA 1RUC3 3D3AA 4MGZE 2R32A 4WV8A 5EQUA 5FMOL 3E6CC 5BNPC 3FHQA 4FPGA 1JOPA 2UYAA 4W6WA 2RS51 5AC91 2Y6KA 3EB7A 1KRIA 2R062 4MHRA 3V0AA 3POEA 1XOYA 3TN92 5C4WB 4KGQA 1DHKB 2GP5A 3MIHA 3ITQA 3W5MA 2QJVA 5BNNB 4JGYB 1ZYBA 3ZN6A 2B9UA 4E4SA 5J37A 1OUSA 1BBT3 4AQ6A 4GB33 4D3WA 4UFMA 1TQ5A 1E57A 3RQ0A 2XL9A 4WZCA 3JQXA 1XU1A 5LY1A 1TMF1 2J42A 3N9MA 1H1AA 1XE8A 1UD1A 2LROA 3ZYFA 4A3ZA 2VOVA 5FZ7A 3PURA 3S5AA 2HWC1 5L36A 5HXVA 1NX9A 1HB4A 2BV4A 4FFGA 4QXBA 3VBUC 4NHMA 2O8QA 2C1FA 1QJX2 3LE0A 1ND2A 4JQTA 4TXWA 1R1A1 3I4IA 2ZMLA 1LHUA 2JG8B 3VBFC 5G05L 2VUDA 3P3PA 1WMDA 3GM8A 1F31A 2ZOEB 4AZZA 5LK5A 1ACCA 2W1WA 3NRUA 2PHDA 4FPYA 5HPOA 1OD5A 2YGMA 1VB4A 4E8CA 1YQCA 4N43A 1CAVB 2BFUL 1OUXA 2P2KA 3O1MA 4U2AA 4YFWA 3Q8BA 4OUMA 3VDAA 3J8F2 2VTXJ 4L0PA 4M00A 3NW4A 4QQ2A 3POGA 1H8TC 1UF2C 3AXDA 4QPIC 2EXIA 3POWA 4URTA 4WM7B 1H0BA 2XQXA 4XF4A 4XUQA 5B4NA 2ADDA 3H1WA 1W9YA 4I3PA 5FK8A 1GZWB 5IW0A 3PIJA 3ZMOA 1AJOA 5FLJA 1O4YA 2RDSA 4EJRA 1FMD3 2R073 1PO11 2JKXA 2OS2A 3DKQA 1PVXA 2XG3A 3T30A 4ONUA 5GALA 4FXKB 3VBUB 3ZKYA 5KXEA 5H9QA 3SQOA 5FYYA 3NJYA 1RVF1 2VZUA 2YG0A 3PHMA 4Y4YA 3ZSJA 3O1RA 5FQ0A 3L2YA 4Y22B 4LQRA 2OPKA 1AR91 3AC0A 3HNBM 2FDIA 3WP6A 4W6XA 3M70A 3DPRC 1NE6A 3HN1A 1PGSA 3ZFEB 2BNOA 5I8SA 1L7RA 4OQ9A 1SLBA 3HEIA 4GALA 4YVWA 2VJXA 1D2QA 2WUHA 1G86A 2EXHA 1OOPA 3KS7A 1C5IA 1ENXA 3D4KA 1KQRA 4MGSA 5M0TA 2GN7A 3Q8AA 1SFYA 2DURA 4X6QB 4LK6A 1OT5A 1SLLA 3LF7A 2A6YA 4SLIA 3CBNA 1W04A 3KV4A 2Z5WA 2WL1A 5E6HA 3FHAA 4EV0A 2RS52 4ZY9A 4Q4W3 5FY8A 3K2OA 3VL8A 2QQPA 4GAZA 2KD7A 3AXEA 2WZPP 5C9AC 2V5YA 1GWLA 2DBIA 1L3JA 1LOAA 1X50A 2GNDA 1S2KA 2VCBA 3JBG3 4FOYA 2I2SA 3USUB 3W59A 5BNQA 3EHKA 4YM2A 5LBFA 2AEYA 3PMEA 3HQXA 2Q8OA 1OOPB 5GLTA 1KJLA 3VBRA 2X09A 2PHLA 3AKQA 4PF5A 1LENA 1SPPB 4BQYA 1SLAA 4GB32 2EALA 4XDPA 1ZVFA 3ZSMA 5FJHA 1AR83 2A1XA 2BNNA 1PZ8A 4B1LA 2E9QA 2ARCA 4M0NA 5LWBA 4K8FA 3NNGA 4RGAA 1FYUA 4YM0A 5FOBB 1XNDA 4Z1VA 5JIAA 5JXHA 4Q4Y2 4UFKA 3OBZA 3VKNA 3WDWA 2D6MA 4R9AA 2HLEA 4PDWB 3RI9A 3GHNA 5DG1A 2Y34A 2O1QA 3FHIB 5CIRA 2Q1ZB 3RZZA 1JYTA 3G6JB 3A22A 3MUZ1 1SBDA 2XPJA 4IE4A 1MZ6A 4ASMB 1RUC2 1NXMA 2R6QA 2EIDA 4QXKA 3AMQA 5CFDA 2PHTA 2DCJA 4M3CF 1I6XA 4CCLA 1L7LA 3ABZA 5FYBA 5AVPA 2GSYA 1NUKA 5IAVA 1PMHX 4IEPA 5FY9A 1ZZ8A 4L8QA 1Q3EA 5FZ3A 5DG2A 1CIWA 4Q27A 1UOFA 1WLCA 1BK1A 2ZHKA 4YG0A 3I2JA 5CZKA 5A6ZA 2WNUB 1HRI2 3VUOA 2I07B 1AYN3 1OA2A 1J84A 1DLCA 4GB31 1JZ5A 1J1TA 3NVCA 4XABA 1REEA 1F5FA 5TSWA 1FMD1 2P3JA 2R071 3A4UA 3PMSA 3LA3A 4NWWA 4O65A 2X10A 4QPGC 4WM7A 4RHV3 4UAPA 3LWCA 5EHDA 4XE9A 5I0UA 3VZNA 4DUWA 2WRAA 4IGPA 3UGFA 3H9AA 4BHPA 1QKQA 5BNNA 1WW6A 4D8MA 2XWBB 5JR7B 4HK9A 4IEWA 2HJIA 3N9NA 2DCYA 2NN8A 2V72A 3CU7A 1ENSA 4NVPA 1GZ9A 4TSVA 1BBT1 1ULPA 4LR4A 1F5JA 4HN0A 4IV1B 1W8ZA 1RITA 5DUXA 2ID4A 3IDCB 2P6HA 4HSJA 1NXD1 2R16A 4HT1T 2YU2A 4QX8A 2OW4A 2Q5TA 1VALA 3IKWA 1LGNA 2VZ1A 1N1YA 1V9U1 1ZBA1 5CFDC 1KD7A 4CUBA 2RE9A 1W6NA 4BQWA 3S57A 3D82A 4UFIA 4YVSB 1LU1A 4WVMA 1TE1B 4IL7A 3KGLA 1U5IA 1DYPA 2CHHA 1QIQA 3KF3A 3MFAA 1HN1A 3HIFA 4YG3A 5FMDA 2YY1A 3N7KA 2R0HA 1U5ZA 4FQZA 1XYPA 4IETA 3K46A 5LEKA 1F8VA 2BGOA 3DF0A 4Q4X1 2E7TA 3D5OA 4PLMA 3WF1A 1H30A 4S2FA 1A34A 4Q5OA 4CPBA 3K4DA 1YI7A 1CAWB 1J1LA 1PK6B 5FWJA 3ZYRA 4IXLA 2JG9A 3LB9A 1O59A 4WM8C 3ZIWA 3CL1A 3GCXA 1QH7A 4D7SA 5L9VA 2Q1FA 2G19A 2RR12 3AJYA 5BNNC 1JOBA 1EPZA 5ABJA 3I2KA 4BQ1A 3VBHB 2VOTA 3ILNA 1FI2A 1KGYA 2DTYA 5LCWL 4W4ZA 1OD3A 5ABJB 5IVFA 3UV9A 3MLJA 2JDHA 2WZ8A 4GXLA 1RXGA 3IWZA 5ERLA 2FMYA 2JD4A 3E5UA 4CDUA 1XB9A 3OPWA 1NZIA 4AYUA 2WINB 1RL3A 3A7QA 1CPNA 2B8MA 2ORXA 5IAXA 5FZ1A 5JAXA 2HWF2 2JJ6A 4EQVA 1Y7BA 1YCIA 2VZRA 3K3NA 3IT8A 1S0IA 3BPSA 2QZ3A 4CDWB 4LEJA 4GA9A 2VNOA 3JD71 4XETA 3PUAA 5FV3A 2QUOA 2FD8A 5FZ9A 1AX1A 4QX1A 5CFCA 1W8NA 4UOJA 3ROUA 1VBE3 1V6MA 2XJRA 4QQPA 3DXUA 1SCSA 3VN4A 4KH9A 2WO7A 2WN2A 2ENRA 4XFGA 2PQSA 4KG0A 1O4ZA 5DZEA 2OZJA 3GALA 4B29A 1QQP1 4C1WA 2DWRA 4ORFA 4WM8A 3LA7A 4BPZA 1XYNA 1LGCA 4PT6A 1RUD1 4DEVA 4NAOA 1MACA 5K7PA 3RRDA 4N90A 1Q8PA 5EP9A 2WWSA 3J7HA 5D8AA 3VZMA 4PQ9A 4MSVA 4RHV1 5KHKA 2GH2A 2BBAA 3IAQA 1GANA 4FCAA 3LKJA 5DAXA 4OI1A 5F5IA 3THDA 1V6OA 4QDRA 5FYIA 2ZACA 4NIGA 4DZGA 5J7MA 1ODMA 1GP6A 1VBA2 2XUMA 1V0AA 2J1EA 1MS5A 3RGBA 2ZGUA 5L7OB 4LBJA 3WLUA 1GQGA 1VBB3 2Z79A 1UIKA 4AHWA 1FPN3 1S0JA 5CNAA 3RZGA 3LEMA 1HIXA 1TMF3 5FMOS 2RR13 3S6PA 1QY4A 1TME3 4HLTA 5LA1A 1BBT2 5IFTA 1HXS2 4IEOA 4XFHA 2ET1A 2OXBA 5FLHA 2BRTA 4CXYA 3X29B 2ZX1A 4JRLA 4AI9A 2YFUA 5CA6A 2PFWA 4Y24A 3B00A 3NL1A 3GZAA 4XJ9A 4K1YA 3TN93 3UK9A 3VZOA 1OURA 1NCQB 3OEAA 4IGQA 5FAXA 3I3EA 5JSRA 2JEMA 4P9GA 2DU1A 2HWC3 5K0UA 2A3XA 4DIQA 2JDPA 3K48A 3J7MA 1BKZA 2VW0A 5CB7A 3DECA 3HT1A 1BEV3 3F95A 1XNBA 3FLRA 5G04L 3IIAA 1DBNA 4NHYA 2BYVE 2YMZA 2ZKNA 2QQLA 4YVSC 5FPUA 3ZN5A 2P37A 3TEWA 4CEWC 3WSOA 4AGVA 2XJSA 3FC0A 3C7FA 5FDBA 4NHKA 3EQEA 4XBLA 1SFPA 3NAPA 5C3OA 1GR3A 1CVNA 4MGYE 2DUOA 5GZDA 3ZYJB 1AYM3 2WT0A 4HBNA 2ZEYA 3VZJA 5IK5A 5JI9A 2ARBA 2BNMA 3KWVA 3MDPA 4QXHA 4AOCA 2E7AA 4OI0A 1PVC3 4LLFA 1S0EA 3CJIA 3LIHA 2WNVC 3VDBA 2WYSA 3IM0A 3ZSKA 5GLZA 5JZGC 5A32B 2TUNA 1GU3A 1HQNA 1RHI1 4IE7A 1D0GA 3JUUA 1US2A 1WCQA 4QT6A 1PZ9A 4QHZA 5C3QA 4YYOA 4QHBA 1RUG1 1BJQA 2JE9A 4FFHA 2QQMA 4DNYA 2JG8C 2VQTA 3VBFB 1WCKA 2WIIB 3Q8FA 1WGPA 3LCPA 4G4FA 5FTTC 3RMXA 2VQAA 1XNCA 3MLKA 2WABA 2XLFA 4N53C 4XVHA 4K8RB 4DY5A 5I93A 4UW5A 3EBRA 3H3ZA 1OQEA 1LHOA 3M4FA 2HEVF 2R49A 1JBCA 3PNAA 1UYPA 2OA2A 2GALA 4UW4A 4XZUG 2EICA 3VKLA 1PGL2 2VH9A 1HXS1 3ST7A 2ET7A 5FY4A 1LESA 1WBFA 3M7AA 4WM8B 3BKZA 5HCBA 4PI2A 1ZRDA 2OYZA 2HWC2 4AAXA 1Q5OA 4CDUB 1ZRIA 2PXJA 1R082 5FMCA 5IVVA 1RUD3 3M3CA 1IQDC 3SH5A 5LA9A 5FY5A 3LIGA 3AM2A 2QQUA 5FFOC 3ZXAC 1OC1A 1QQP3 5JIUA 2V09A 2ZPXA 3M3EA 3INAA 4M4RA 1O3QA 3VD3A 5EJ1B 1URXA 3WNKA 2BERA 1LGBA 1AR82 3GJBA 1HXS3 2BFUS 2EIEA 4M3CB 1IG0A 5FZOB 4BQXA 1DQ4A 1K5MB 2B4KA 1W9TA 2CU5A 2PMWB 1TMF2 4FXGB 3NJZA 1VE0A 1VBB2 1IQAA 5GLUA 3QLQA 5B2GB 3Q8EA 5D1IA 2Y6HA 3UT0A 5C33A 4R9CA 4IEVA 4QB1A 1Z7S2 1SQ4A 2DU0A 4DEQA 4EN6B 4LO4B 2VU9A 3AFKA 3FJSA 4UXAA 4UYBA 3CHXA 3ECQA 4NRQA 1QOTA 2WNOA 2EAAA 1JYNA 1OKQA 2GNMA 1RMU1 2IXIA 2ZGRA 3IN9A 4Y5Z0 2VBPA 2WN3A 3T2TA 3OGJA 4E9KA 2FDGA 2DVGA 2GNBA 3TB0A 2WA3A 2JB4A 4W65A 1SCRA 3WW1A 2E53A 2WZR3 3M3IA 2HWE1 4XIKA 2JDMA 2A6XA 1NY71 3U11A 4HK8A 3BUCA 2ZGNA 4XFBA 4RGGA 1HLCA 2OVUA 3CZUA 3KVBA 1IPKA 3VHNA 1OMIA 2HWD2 3H8RA 2VW1A 1XQNA 4I09A 4Y4RA 1JN2P 2E33A 2XMLA 2H6BA 4Q4V3 1VBD1 4BDVB 3I2GA 3R0RA 2VZPA 4PHZA 4ZZ8A 4BCUA 5K0UB 1GZCA 4P9YA 1IS5A 3LSDA 1GLHA 3VKOA 3MPBA 2WYFA 4BU2A 3BTYA 3CIHA 1MS9A 5L9BA 1H1IA 2ZXQA 3UJOA 1KFXL 3IPVB 3DYOA 1BCXA 3PLQA 1H9PA 4URAA 1QDOA 2X29A 5KHJA 3HVDA 1YIFA 2YBKA 1GWMA 2PA7A 3L2HA 4XF0A 4AVBA 1A8DA 3GBWA 5DQ0A 2EXKA 1APNA 3T2PA 3P5BA 5JXJA 2CNAA 2Q4SA 3SEEA 3I2HA 4IV3B 2VMIA 1CQ9A 4TLFA 4RS5B 4PBOA 1UOGA 4UFJA 3ZDVA 2ZX4A 1YYNA 3ETQA 1M4WA 1UXXX 1AXKA 3FLPA 5I0RA 1KDKA 1UPSA 5GJ6A 5EIYB 5J09A 3LA2A 4YFZA 1W6QA 1DG6A 5DAQA 5JPNB 4O61A 4L2NA 4EN0A 2WBKA 4YVWC 2E6VA 5F7UA 2GN3A 4JDMA 2EVXA 4DFSA 1Z7S1 2ORZA 2VZVA 4MXWA 3PTRB 1LOEA 1WCSA 1GFF2 2QQWA 4K40A 4AFBA 5JOWA 2VCMA 2I74A 4HVRA 1DZQA 1TEIA 2ZGQA 4M3CE 3U10A 3GZUC 2F17A 3WQ0A 4NHXA 2WQ8A 3FLTA 4Y1XA 4AI3A 2CDOA 4XHBA 4JHTA 3ACGA 5CADA 1WD3A 1CJPA 2QDRA 4JRAA 1Q8QA 1QHDA 2HWB1 2WWUA 3OUIA 5KHHA 2HKXA 3WP3A 4FSJA 1SDDB 2RDRA 4CP9A 1BYHA 2A3WA 1W39A 4QX5A 4RR3A 2W5FA 3MBWA 3N7LA 1QNWA 1UMZA 5FUPA 1H2KA 3ZR5A 1VBD2 3URFA 4DUVA 3BALA 3RYPA 3UGHA 1WW4A 4Y26A 3ZFEA 5J3UA 1GZWA 2GC1A 2XOMA 1WWYA 3KCXA 4RS5C 1SG3A 3I8TA 4AGGA 2BDRA 4Q4Y1 1JH5A 2I45A 1V6IA 5LA0A 3VBRB 3RZLA 1W9WA 1K45A 1UZZA 5CG9A 5F2SA 3P1IA 3RPQA 2SBAA 3OGSA 4AE2A 3QCWA 3C8XA 4NPRA 4YVWB 1YFUA 2FCVA 3KHCA 1A3KA 1XRUA 1O3SA 4DXZA 5IVYA 2XLGA 1RMU3 3NJVA 2J1RA 2QTWB 1OSGA 1GOFA 5C9AB 5LZ6A 2VULA 4Y1ZA 4QM8A 5IVEA 2VO5A 1VBD3 2W68A 4FO9A 2D6PA 3CF6E 1AXYA 1PX3A 3TYJA 1G9FA 3THTA 3OGRA 3ZFGC 1EV11 4BK5A 3PUSA 5C3RA 1WW5A 3B01A 2JKBA 1JOJA 1UMIA 1O8SA 4XW3A 5EZWA 2MEV1 3VBOC 4U36A 4QMAA 3EXUA 5FKBA 1BVVA 1UY4A 5LBBA 3H1MA 4L9BA 5FPLA 5GZCA 4XUTA 3DYPA 2JICA 2NMOA 3WNMA 4HG6B 4JCKA 1X8MA 2GH8A 1YQ8A 2V4AA 4NE9A 5DDJ2 3RS6A 4JHZA 1CJDA 1X9TA 3PUQA 4UW3A 5A7SA 1EYBA 5CG8A 1JU4A 3ETPA 5EJ3A 1RINA 4A7KA 1C3HA 4LOSA 4QPGB 2AEZA 4QPGA 2GMEA 4F3JA 4JKMA 3T1LA 2YV8A 3LDKA 5C3SA 1Y9MA 2D6OX 4OFGA 3ME2A 1RUOA 1IKQA 4LLOA 5SV5A 3T1MA 1ZNPA 1MVQA 1BQPA 1IPSA 3A23A 4LA2A 4N43B 4ZS3A 5LY2A 5I8TA 2D6KA 3V0AB 4IEZA 1GYKA 3BGAA 5T5PA 1RUE1 2NPIA 1LNSA 3A0NA 2RV9A 2UU8A 5F2WA 4P08A 1PGW1 4DB5A 4Z2AA 4I0AA 4MOAA 1Q43A 5KWRA 2F4PA 1J59A 4Q4W2 5GLVA 1LU2A 1YO8A 5IK7A 2WC2A 5JDBA 3O1TA 4HONA 1K12A 2YYOA 1QGLA 1ASJ2 3J7NA 3PUHA 4LHLA 2WR9A 1QJX1 1MS0A 2RS31 2WAAA 5LA2A 4F7ZA 1D7PM 1ZBE3 4BMBA 1HKDA 1B35A 1OXCA 3JZVA 3KT1A 4CU6A 3TN91 4E4HA 3MHZA 4IDZA 1AYN1 1COV2 3OBAA 4DXSA 4HETA 3L9JT 2DBNA 4RQPA 5FZ0A 3BTZA 1JXNA 1JUHA 2DVDA 4HXCA 5EYYA 1BVP1 5GKAC 2YBPA 4UBGA 1HJGA 4R52A 3CLPA 1EAH2 3FMGA 1WLDA 3FWEA 1DLLA 2RHPA 1UYYA 3DCQA 4OI2A 1SBFA 4LIVA 4X6RB 2ZEWA 1U5YA 3HD8B 4ZU7A 3O0WA 4Q0VA 2WSVA 3B02A 4Q0PA 2DTWA 2H0BA 1OLME 4AEDC 5AFBA 1D4VB 1PMIA 4P9IA 5KC5A 1W2OA 4PLOA 5SV8A 2YBSA 2XB6C 4FPHA 3AYCA 4PJYA 1UN1A 2BOIA 4H7LA 3TEZA 1WCUA 2DVFA 1OF4A 4D6RA 1IPJA 3WHTA 5DPNA 5FYSA 3BU7A 5JVVA 3RG0A 1A8MA 5C70A 1RGSA 2VBDA 1EPWA 4QKDA 2QQVA 2G4IA 1W2TA 2RS32 4LO7A 5F5QA 1DGRN 4ASLA 3VD7A 2JDAA 3C7HA 5A70A 3VDDA 3C2UA 2OT7A 1HB3A 2F6BA 3ELNA 4TWTA 3W20A 3PTYA 3B9IA 2YC2A 3ES1A 2XBO3 5JOXA 4CVUA 2VNRA 3ZFFB 2Y38A 3J8F1 3QH6A 5J36A 3NKTA 2QNKA 1N47A 3N3HA 4RQPC 5FP9A 4D69A 2PQQA 4EE2A 5CAZA 5HCAA 3RZJA 1NA1A 1QMJA 4LULA 3UYJA 4DXRA 5A1LA 3N9QA 2BWAA 3HBZA 3ILRA 4NAMA 2YXSA 2VTXA 3TAYA 4AQ2A 4L11A 3JD73 3I2DA 4EROA 4QAWA 4NJ4A 4V1PA 1W6PB 5LBCA 3OY8B 1U5XA 2C9KA 3AMHA 1DCSA 2P4EA 4GWJA 4LORA 4JAAA 1DQ1A 4CCNA 5C6CA 5LK7B 4LUMA 1JYVA 1OA4A 4Q1RA 4FPEA 1R083 4N9HA 3UKNA 1I5ZA 5FPAA 4LHSA 1UL9A 2Q8DA 1YNAA 2ZGOA 4EZHA 1VRH3 1ZZBA 2XL7A 4XUOA 1FNYA 1ND3B 2RJLA 2TBVA 1QXPA 2NYYA 5C7GA 4K6BA 3NV4A 5ANNA 4DINB 3WF0A 4KL1A 5F39A 3WDTA 5FXVA 5IK8A 3R05A 4AEDB 4AI1A 3V0BB 1E5SA 3KMHA 3POFA 3JBG1 4YG6A 2JENA 2BEOA 4MZUA 3AKTA 3DPRB 5A7QA 1VBE1 2VUJA 4XHXA 3B7MA 5IVJA 4HKLA 1FT9A 3ZMNA 1ZBE1 2R061 1HV0A 3M2MA 4CE8A 1VAKA 1RJ7A 2XR4A 2IZWA 4OZOA 3RJRA 1MEC2 1QXRA 1UZWA 3WY6A 4E27A 2XXZA 2BVBA 4M3CA 5FOJB 5J96B 2WSUA 4QQHA 2WZEA 1GQHA 1AF9A 3AZWA 1JUIA 3T2QA 3ACHA 4GH4C 3OBTA 1TME1 3WT3A 4BLIA 3OY8A 2B7YA 5GZGA 3LEKA 1RUE3 5A7PA 4F8AA 3M1HA 1DYOA 1R093 2C4XA 3E5QA 4E4DX 4I30A 4AW7A 2PHUA 2A3YA 2QCSB 5H9RA 4LE4A 2JDKA 4S2HA 5J1XA 3S7IA 2RS13 1W6MA 4JX0A 2VUCA 3QBQA 3GJAA 1X82A 4JDNA 4FQ4A 1HRV2 5FMBA 1O6UA 4BQ3A 2UURA 3LQCA 4K7JA 1I9RA 1PGW2 4M4PA 5JXGA 1YC61 3KZ4C 1IGOA 1RUH3 2IXKA 2VOWA 4MGQA 4NMIA 1QJFA 4FP2A 4CDXA 5FZBA 4QD2A 5F6KA 1DGRA 5JZGA 4IE5A 1POV3 3WUCA 2R1DA 1WMXA 4LE3A 3POSA 4N8MA 1HV1A 2W94A 3LD8A 4MH0E 1RUI3 4R4XA 2W2IA 4CA9A 4XJZA 3U1XA 1DF0A 4AQSA 4YGCA 5FUIA 3E6DA 4IEQA 5FZFA 2D43A 3OBRA 4JKLA 4GH4A 4IQPA 4NIHA 2ZZQA 2RMU3 3IZOA 1UXZA 1HW5A 1PMJX 2A75A 2D3SA 2YHJA 3I59B 4LO5B 4R4ZA 3IBMA 4LBQD 3S7EA 2JECA 4MUVA 1LODA 2IWGB 1GQPA 1FXZA 1W9FA 2WO3A 3I3QA 4BYYA 2EIGA 1PK6A 3QD6A 5DABA 5BNPB 4QDSA 4J6GA 2OX0A 1OI6A 2PHRA 1VMHA 1YUDA 4LKDA 3BCWA 2VD7A 1WCDJ 2FMDA 3VB9A 3A21A 3UETA 2G9GA 2J1VA 3H1YA 3MW3A 3NO8A 4OUSA 3ZXKA 2B46X 4BJ0A 4CDXC 2NP0A 2W39A 1H8TA 5T50A 3VBFA 1YEWA 4XDOA 1UY3A 1ZZ6A 3AKPA 2HWD3 3O7OA 1H6YA 2VL4A 2Z42A 4H2AA 4PF1A 5CKNA 1DDLA 4M0HA 4XFIA 1RUG3 4CP0A 4QX0A 1BMV1 2MHFA 5BPXA 4BA6A 3HJRA 1BLZA 1U0AA 5EWSA 1QU0A 3ZR6A 1OPOA 4IV1C 4KI5M 3V65A 3KD4A 5A3NA 3U0ZA 4D6SA 2Z4FA 1CZVA 4RA0A 2TEPA 4C8DA 1ZM1A 4N7UA 4AVSA 4QPWA 2CGPA 1W05A 3E97A 1ENQA 1QDCA 1JYCA 5FK7A 1K42A 3GBGA 1WBLA 2EF6A 1CD3G 4META 4K1ZA 1T6BX 2VM9A 2ZMNA 3NV1A 4I0WB 1VRBA 4LBQA 1PK6C 4LBQB 3I2IA 3SH4A 3MIEA 4XJUA 3N9PA 5BNOB 1W2UA 4A41A 1VBB1 1P8JA 3HWJA 4PDWA 2D97A 2WNUA 1OKOA 1N3QA 1OOPC 2Y64A 4BISA 1R64A 5A7WB 4Z8BA 4JC1A 4KMQA 4WVZA 2GC0A 3AP4A 2YB7A 1NLRA 2VXJA 5FLIA 5IFPA 4IE6A 1QQP2 1DU3D 3ZVXA 4COYA 4IERA 2DDUA 1NZCA 4NRPA 1RUD2 3MF9A 3DPRA 2E51A 1ZBE2 1S0DA 4ISRA 1YQ2A 4LK7A 3TRSB 1GV9A 2CAUA 4XFCA 3DL3A 2ZA9A 3C7OA 2XH6A 3ZKUA 4P5HA 2Q1MA 5EV7A 4YW3A 3UKTA 4RSUA 5F3IA 3WNXA 4OI4A 5I0TA 4TTGA 2ZAHA 3ZYPA 2XVKA 5D8AB 2RJ2A 5E89A 4Y20A 5CU1A 3MW4A 4AK3A 4ZU4A 1SHWB 5I8YA 3JQWA 4FBFA 2YC4A 5DN2A 1GZTA 2BW8A 5T5OA 2WWJA 4LBLA 4PIZA 4A7YA 1SPPA 2GMMA 2AH2A 2WT1A 1AX0A 3Q8CA 2W9XA 4X8NA 1ULGA 2SLIA 3O0VA 3B93A 4LKEA 1PO22 1SZBA 2WNUC 4UF0B 2ZX3A 1QH6A 4ES9A 2LS6A 4GJYA 1AX2A 2DF7A 2VQ0A 5FZ6A 5EXOA 2JIJA 4OZXA 3ALQA 3VD5A 1T6GC 1UPIA 2VZSA 1ZZ9A 3HT2A 4CCJA 3K4ZA 1LHVA 1PVC2 2IVIB 2QQJA 3VBSB 4NIDA 3RVHA 5DDJ3 1XBFA 5FPVA 5F5CA 1DGLA 1AYM2 3WZ1A 2WJSA 3ZYHA 4C0BA 4RQPB 2E31A 1UZVA 2P3IA 4HPKA 4BIFA 3KM5A 2XJTA 4XTMA 2VVFA 4ZS2A 2X05A 1Y9GA 3RZHA 3R6SA 4Q8KA 4CDQC 4AXOA 1ZA7A 1RYYA 4S2DA 5FUNA 2VZOA 4TYSA 1QJU3 2QQIA 1HQLA 3H3UA 5FZLA 3N9LA 4RR3C 4DRVA 3O1SA 3OGVA 3VBHA 1JS9A 1S4CA 2WNEA 1RHI3 4HSLA 3VV1A 1AR62 3PU8A 2J1UA 1XC6A 2W1QA 4CPBD 2DYCA 3OJBA 4Z07A 4BZ4A 2P5BA 1V6KA 2C9AA 4MO3M 2EIBA 5CYYA 4I3GA 4H7MA 5FZGA 4RS5A 1MEC3 3H42B 1DIWA 3LSEA 5IHRA 4A6SA 2KM2A 4MGTA 4XBNA 4Q29A 4Q4Y3 3EJKA 1JW6A 2O0OA 1FV3A 2HWF1 2HWE2 3GYDA 5D2AA 2VZTA 3NNLA 5FO9B 1PVC1 1CIYA 3RWKX 3AVRA 2YPJA 4NN0A 1OF3A 2ZHNA 3VDDB 3ZXDA 3O1PA 4W8JA 2XLAA 2L9LA 4RGKA 1KFUL 2HEWF 2XBO1 1Z0HA 2VZQA 2Y60A 4XQDA 1US3A 4FOQA 1LEDA 5GM0A 5BNOC 4FTSA 1RXFA 2WDBA 4AWDA 4ISQA 1FPN2 4QU2A 3H8XA 5FZMA 5JCTA 3VZLA 3FUOA 1GMMA 2E32A 5A1AA 3S0MA 3B5LB 3THCA 1LOFA 2OQ7A 3ACLA 2C0ZA 3CZJA 3HNMA 4XXAA 2WKKA 3AJZA 4XZPA 1UQXA 4JTOA 3NSTA 1Q8OA 4WVMB 3WDYA 3M3QA 1AR61 5IUQA 4YWAA 5BUVA 1DQ2A 4CEYA 4UWDA 1HDKA 1ULDA 4IEXA 1D0HA 2A73B 2PYTA 2PAMA 2XUEA 4LHNA 5FP7A 4D6QA 1WMFA 3PVOA 1H4HA 4Q8LA 1UU4A 5JOZA 3OUHA 4JGYA 5A80A 1C5HA 2YUEA 1G9AA 1WLTA 4GZ9A 3WQBA 3M3OA 4ZZ5A 1J3PA 3PUIA 1QNYA 5C8WA 3MV11 4UI9L 2FDKA 2B5HA 1LR5A 3NNMA 5DAPA 3BIWE 4QGLA 3ZPYA 1AZDA 1KEXA 1XE0A 2ZKLA 1UWWA 4Z92B 4FPLA 4CP1A
chains in the Genus database with same CATH topology
1XNAA 2XQXA 4DUVA 4XUQA 5B4NA 3HPNA 2DCKA 2QQNA 2XOMA 3U37A 1SG3A 1JZ4A 2JKXA 2RVAA 5LA0A 1W9WA 1K45A 3GXUA 3IAPA 3P1IA 3OGSA 3C8XA 3FN9A 3K75B 2J1SA 3NJVA 2J1RA 2VZUA 2YG0A 2V5DA 1GOFA 4P02B 4LQRA 3T0DA 2VO5A 3AC0A 3HNBM 1PX3A 1EUTA 3OGRA 4P5YA 4BK5A 1L7RA 2W87A 3HEIA 1UMIA 1O8SA 2VJXA 3VDCA 3NJXA 2VMEA 2WUHA 3UNPA 1UY4A 4MGSA 4QB6A 4A6OA 4XUTA 3DYPA 1OT5A 3WNMA 4HG6B 4JHZA 1JU4A 3ETPA 3FHAA 4ZY9A 4CU8A 4JKMA 2KD7A 1UY2A 2VCBA 3A23A 1WKYA 2W92A 3W5NA 4CUCA 4W50A 3BGAA 3WNPA 2Y6LA 2X09A 3MO4A 3WF4A 3LEIA 1LNSA 2RV9A 1L7QA 3EYPA 2V4VA 4XUNA 4P08A 4Z2AA 4MOAA 3NNGA 3OB8A 3UESA 2Y6JA 1K12A 3PUHA 1UYXA 5JXHA 1UY0A 5LA2A 2WAAA 2W91A 1JZ6A 1D7PM 2HLEA 4ARXA 1W8OA 2J22A 4CU6A 3I3BA 3OBAA 4DXSA 3A22A 3MUZ1 5JXIA 5DMYA 2W46A 2EIDA 2DCJA 3ABZA 1NUKA 1UYYA 1PMHX 2JD9A 2ZEWA 5CZKA 3I2JA 4JKKA 3ZM8A 1J84A 1DLCA 1JZ5A 2Y8KA 3HOBA 4RYDA 5HXMA 1OF4A 1F4AA 5DPNA 4A42A 1DP0A 2X10A 4DXTA 2OKXA 4UAPA 4DUWA 5C70A 4GWIA 1GUIA 3VD7A 2JDAA 3C7HA 4D8MA 3WEZA 2W95A 1TG7A 4IUGA 2YC2A 2V72A 4CVUA 3WNOA 1ULPA 3LPGA 1EUUA 4QX3A 2ID4A 1JU3A 4DXRA 2VCCA 3WNNA 2VZ1A 3I2FA 4CUBA 2QQOA 2W1SA 2W47A 4QAWA 1JYWA 2J1TA 3IB3A 5EJZB 2C9KA 4GWJA 3I97A 1HN1A 1JYVA 3ACFA 1UYZA 3K46A 2BGOA 4LHSA 3WF1A 2XONA 1JZ7A 4OMDA 1UWWA 4KWUA 3K4DA 2WAOA 4XUOA 5C7GA 3T2OA 1O59A 3WF0A 2BGPA 4P00B 4QB2A 3FL7A 3I2KA 2LW8A 4BK4A 3C7EA 2VOTA 1KGYA 5LCWL 4W4ZA 1OD3A 3K77A 4FI9A 2WZ8A 3MV01 1O8PA 1UMHA 2C26A 3IIIA 4LKSA 4A45A 3A7QA 2ORXA 5IYYA 4OZOA 3HNYM 2VZRA 4CUAA 2WZEA 2ZEZA 3T2QA 3ACHA 3HN3A 5JMOA 4QX1A 3LEKA 1W8NA 4UOJA 1DYOA 1TVGA 2C4XA 4A4AA 2WN2A 2PQSA 5J1XA 4JX0A 3DYMA 4PT6A 3IDAA 4DEVA 3T09A 3LQCA 1I5PA 4M4PA 5JXGA 3J7HA 3OEBA 3LPFA 3T0BA 2VMFA 4MGQA 2BBAA 3IAQA 1K3IA 3THDA 4QDRA 5B4XA 2VZ3A 1JYXA 2W94A 2J7MA 2J1EA 3MUY1 5C71A 5FUIA 1UY1A 4D0QA 1W0NA 4JKLA 2W3JA 4RN5A 4OUEA 5IFTA 5LA1A 1UXZA 1PMJX 4XUPA 3WF3A 2YFUA 1UX7A 1GQPA 2WO1A 2WO3A 1JZ3A 3OEAA 4QDSA 3I3EA 4LPLA 1F4HA 4BXSV 3SKJE 3K4AA 3A21A 3UETA 5I0DA 3DECA 4XURA 2J1VA 5G04L 4YPJA 4BJ0A 2QQLA 3SEPA 2VC9A 1CZSA 1UY3A 1H6YA 2VL4A 4PF1A 3GDBA 4CU7A 3WSOA 3C7FA 4QX0A 3CMGA 3HJRA 5IFPA 4KI5M 5IJRA 1GOGA 2ZEYA 2Z4FA 1CZVA 2WO2A 1J83A 4QPWA 3VD4A 1H6XA 1K42A 3VDBA 2WYSA 1W9SA 3CQOA 3LEGA 1GU3A 3VD9A 1US2A 1WCQA 2VR4A 2ZEXA 2VM9A 2VTFA 1CX1A 2QQMA 3I2IA 2VQTA 2E26A 4A41A 1P8JA 2VMCA 2WABA 4XVHA 2W1UA 3OG2A 2Y64A 5JUVA 3WF2A 1OH4A 1R64A 4A44A 4XZUG 2EICA 4KMQA 2YB7A 4ARYA 2JE8A 3ACIA 5JR2A 2QBXA 1XNTA 1UZ0A 3NQHA 1NKGA 4AAXA 2DDUA 4OMCA 1IQDC 4CU9A 3P6BA 1YQ2A 3CKHA 1BHGA 3C7OA 2HYXA 4M4RA 3VD3A 2R7EB 2BZDA 5EJ1B 3WNKA 2BERA 4TTGA 1NAEA 2EIEA 2RJ2A 1T2XA 1W9TA 2B4KA 1JI6A 1SHWB 1ULOA 1MPXA 2YC4A 5DN2A 2Y6HA 2W9XA 4PQQA 2VMDA 4QB1A 4DEQA 2VCAA 2J1AA 2LS6A 2VQUA 3ECQA 1JYNA 3VD5A 4MADA 2VZSA 4DUXA 3K4ZA 2QQJA 2WN3A 3CDZB 4OYUA 2E31A 2CDPA 3I3DA 2X05A 1GNYA 3CZUA 1JZ8A 1PX4A 1RYYA 2E33A 2YFZA 4QX2A 2VZOA 2QQIA 4BDVB 3I2GA 2VZPA 4ZZ8A 3OGVA 4E8DA 1JHJA 3D3AA 2J1UA 1XC6A 2W1QA 4MO3M 5CYYA 2EIBA 3CIHA 3FHQA 1GOHA 2ZXQA 3DYOA 4AG4A 5IHRA 2Y6KA 3EB7A 2B9VA 3GGLA 5DQ0A 3T2PA 2VZTA 3T08A 2Y6GA 5JXJA 3W5MA 1CIYA 3SEEA 3T0AA 1OF3A 3I2HA 4W8JA 2L9LA 1JZ2A 2VZQA 1US3A 2WDBA 3F2ZA 1UXXX 3C7GA 3BN6A 5EIYB 1GMMA 2E32A 5A1AA 3THCA 4A3ZA 2WBKA 3CZJA 3HNMA 5F7UA 1NX9A 3LE0A 2ORZA 2VZVA 4TXWA 4ZXEA 5G05L 3GM8A 1CZTA 2W1WA 3NRUA 2WQ8A 2CDOA 5HPOA 3ACGA 4E8CA 4GZ9A 2QQKA 3WQBA 4ZZ5A 1XPWA 4ET7A 3PUIA 3WNLA 3E1F1 3VDAA 4L0PA 3MV11 1SDDB 3SKVA 4UI9L 1W99A 2W5FA 3MBWA 1KEXA 3JXSA 2XHNA 4QDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNA A;  2XQX A;  4DUV A;  4XUQ A;  5B4N A;  3HPN A;  2DCK A;  2QQN A;  2XOM A;  3U37 A;  1SG3 A;  1JZ4 A;  2JKX A;  2RVA A;  5LA0 A;  1W9W A;  1K45 A;  3GXU A;  3IAP A;  3P1I A;  3OGS A;  3C8X A;  3FN9 A;  3K75 B;  2J1S A;  3NJV A;  2J1R A;  2VZU A;  2YG0 A;  2V5D A;  1GOF A;  4P02 B;  4LQR A;  3T0D A;  2VO5 A;  3AC0 A;  3HNB M;  1PX3 A;  1EUT A;  3OGR A;  4P5Y A;  4BK5 A;  1L7R A;  2W87 A;  3HEI A;  1UMI A;  1O8S A;  2VJX A;  3VDC A;  3NJX A;  2VME A;  2WUH A;  3UNP A;  1UY4 A;  4MGS A;  4QB6 A;  4A6O A;  4XUT A;  3DYP A;  1OT5 A;  3WNM A;  4HG6 B;  4JHZ A;  1JU4 A;  3ETP A;  3FHA A;  4ZY9 A;  4CU8 A;  4JKM A;  2KD7 A;  1UY2 A;  2VCB A;  3A23 A;  1WKY A;  2W92 A;  3W5N A;  4CUC A;  4W50 A;  3BGA A;  3WNP A;  2Y6L A;  2X09 A;  3MO4 A;  3WF4 A;  3LEI A;  1LNS A;  2RV9 A;  1L7Q A;  3EYP A;  2V4V A;  4XUN A;  4P08 A;  4Z2A A;  4MOA A;  3NNG A;  3OB8 A;  3UES A;  2Y6J A;  1K12 A;  3PUH A;  1UYX A;  5JXH A;  1UY0 A;  5LA2 A;  2WAA A;  2W91 A;  1JZ6 A;  1D7P M;  2HLE A;  4ARX A;  1W8O A;  2J22 A;  4CU6 A;  3I3B A;  3OBA A;  4DXS A;  3A22 A;  3MUZ 1;  5JXI A;  5DMY A;  2W46 A;  2EID A;  2DCJ A;  3ABZ A;  1NUK A;  1UYY A;  1PMH X;  2JD9 A;  2ZEW A;  5CZK A;  3I2J A;  4JKK A;  3ZM8 A;  1J84 A;  1DLC A;  1JZ5 A;  2Y8K A;  3HOB A;  4RYD A;  5HXM A;  1OF4 A;  1F4A A;  5DPN A;  4A42 A;  1DP0 A;  2X10 A;  4DXT A;  2OKX A;  4UAP A;  4DUW A;  5C70 A;  4GWI A;  1GUI A;  3VD7 A;  2JDA A;  3C7H A;  4D8M A;  3WEZ A;  2W95 A;  1TG7 A;  4IUG A;  2YC2 A;  2V72 A;  4CVU A;  3WNO A;  1ULP A;  3LPG A;  1EUU A;  4QX3 A;  2ID4 A;  1JU3 A;  4DXR A;  2VCC A;  3WNN A;  2VZ1 A;  3I2F A;  4CUB A;  2QQO A;  2W1S A;  2W47 A;  4QAW A;  1JYW A;  2J1T A;  3IB3 A;  5EJZ B;  2C9K A;  4GWJ A;  3I97 A;  1HN1 A;  1JYV A;  3ACF A;  1UYZ A;  3K46 A;  2BGO A;  4LHS A;  3WF1 A;  2XON A;  1JZ7 A;  4OMD A;  1UWW A;  4KWU A;  3K4D A;  2WAO A;  4XUO A;  5C7G A;  3T2O A;  1O59 A;  3WF0 A;  2BGP A;  4P00 B;  4QB2 A;  3FL7 A;  3I2K A;  2LW8 A;  4BK4 A;  3C7E A;  2VOT A;  1KGY A;  5LCW L;  4W4Z A;  1OD3 A;  3K77 A;  4FI9 A;  2WZ8 A;  3MV0 1;  1O8P A;  1UMH A;  2C26 A;  3III A;  4LKS A;  4A45 A;  3A7Q A;  2ORX A;  5IYY A;  4OZO A;  3HNY M;  2VZR A;  4CUA A;  2WZE A;  2ZEZ A;  3T2Q A;  3ACH A;  3HN3 A;  5JMO A;  4QX1 A;  3LEK A;  1W8N A;  4UOJ A;  1DYO A;  1TVG A;  2C4X A;  4A4A A;  2WN2 A;  2PQS A;  5J1X A;  4JX0 A;  3DYM A;  4PT6 A;  3IDA A;  4DEV A;  3T09 A;  3LQC A;  1I5P A;  4M4P A;  5JXG A;  3J7H A;  3OEB A;  3LPF A;  3T0B A;  2VMF A;  4MGQ A;  2BBA A;  3IAQ A;  1K3I A;  3THD A;  4QDR A;  5B4X A;  2VZ3 A;  1JYX A;  2W94 A;  2J7M A;  2J1E A;  3MUY 1;  5C71 A;  5FUI A;  1UY1 A;  4D0Q A;  1W0N A;  4JKL A;  2W3J A;  4RN5 A;  4OUE A;  5IFT A;  5LA1 A;  1UXZ A;  1PMJ X;  4XUP A;  3WF3 A;  2YFU A;  1UX7 A;  1GQP A;  2WO1 A;  2WO3 A;  1JZ3 A;  3OEA A;  4QDS A;  3I3E A;  4LPL A;  1F4H A;  4BXS V;  3SKJ E;  3K4A A;  3A21 A;  3UET A;  5I0D A;  3DEC A;  4XUR A;  2J1V A;  5G04 L;  4YPJ A;  4BJ0 A;  2QQL A;  3SEP A;  2VC9 A;  1CZS A;  1UY3 A;  1H6Y A;  2VL4 A;  4PF1 A;  3GDB A;  4CU7 A;  3WSO A;  3C7F A;  4QX0 A;  3CMG A;  3HJR A;  5IFP A;  4KI5 M;  5IJR A;  1GOG A;  2ZEY A;  2Z4F A;  1CZV A;  2WO2 A;  1J83 A;  4QPW A;  3VD4 A;  1H6X A;  1K42 A;  3VDB A;  2WYS A;  1W9S A;  3CQO A;  3LEG A;  1GU3 A;  3VD9 A;  1US2 A;  1WCQ A;  2VR4 A;  2ZEX A;  2VM9 A;  2VTF A;  1CX1 A;  2QQM A;  3I2I A;  2VQT A;  2E26 A;  4A41 A;  1P8J A;  2VMC A;  2WAB A;  4XVH A;  2W1U A;  3OG2 A;  2Y64 A;  5JUV A;  3WF2 A;  1OH4 A;  1R64 A;  4A44 A;  4XZU G;  2EIC A;  4KMQ A;  2YB7 A;  4ARY A;  2JE8 A;  3ACI A;  5JR2 A;  2QBX A;  1XNT A;  1UZ0 A;  3NQH A;  1NKG A;  4AAX A;  2DDU A;  4OMC A;  1IQD C;  4CU9 A;  3P6B A;  1YQ2 A;  3CKH A;  1BHG A;  3C7O A;  2HYX A;  4M4R A;  3VD3 A;  2R7E B;  2BZD A;  5EJ1 B;  3WNK A;  2BER A;  4TTG A;  1NAE A;  2EIE A;  2RJ2 A;  1T2X A;  1W9T A;  2B4K A;  1JI6 A;  1SHW B;  1ULO A;  1MPX A;  2YC4 A;  5DN2 A;  2Y6H A;  2W9X A;  4PQQ A;  2VMD A;  4QB1 A;  4DEQ A;  2VCA A;  2J1A A;  2LS6 A;  2VQU A;  3ECQ A;  1JYN A;  3VD5 A;  4MAD A;  2VZS A;  4DUX A;  3K4Z A;  2QQJ A;  2WN3 A;  3CDZ B;  4OYU A;  2E31 A;  2CDP A;  3I3D A;  2X05 A;  1GNY A;  3CZU A;  1JZ8 A;  1PX4 A;  1RYY A;  2E33 A;  2YFZ A;  4QX2 A;  2VZO A;  2QQI A;  4BDV B;  3I2G A;  2VZP A;  4ZZ8 A;  3OGV A;  4E8D A;  1JHJ A;  3D3A A;  2J1U A;  1XC6 A;  2W1Q A;  4MO3 M;  5CYY A;  2EIB A;  3CIH A;  3FHQ A;  1GOH A;  2ZXQ A;  3DYO A;  4AG4 A;  5IHR A;  2Y6K A;  3EB7 A;  2B9V A;  3GGL A;  5DQ0 A;  3T2P A;  2VZT A;  3T08 A;  2Y6G A;  5JXJ A;  3W5M A;  1CIY A;  3SEE A;  3T0A A;  1OF3 A;  3I2H A;  4W8J A;  2L9L A;  1JZ2 A;  2VZQ A;  1US3 A;  2WDB A;  3F2Z A;  1UXX X;  3C7G A;  3BN6 A;  5EIY B;  1GMM A;  2E32 A;  5A1A A;  3THC A;  4A3Z A;  2WBK A;  3CZJ A;  3HNM A;  5F7U A;  1NX9 A;  3LE0 A;  2ORZ A;  2VZV A;  4TXW A;  4ZXE A;  5G05 L;  3GM8 A;  1CZT A;  2W1W A;  3NRU A;  2WQ8 A;  2CDO A;  5HPO A;  3ACG A;  4E8C A;  4GZ9 A;  2QQK A;  3WQB A;  4ZZ5 A;  1XPW A;  4ET7 A;  3PUI A;  3WNL A;  3E1F 1;  3VDA A;  4L0P A;  3MV1 1;  1SDD B;  3SKV A;  4UI9 L;  1W99 A;  2W5F A;  3MBW A;  1KEX A;  3JXS A;  2XHN A;  4QDQ A; 
#chains in the Genus database with same CATH topology
 2HBT A;  3HPN A;  2DCK A;  1XU2 A;  1DZR A;  2QQN A;  4JVA A;  2VNV A;  1RUF 1;  4NRM A;  1D4M 3;  4AEM A;  4FP3 A;  3WG2 A;  5CFD B;  2VY0 A;  2RVA A;  4P9L A;  1YI9 A;  2CYF A;  2P3Y A;  2DFC A;  1VMF A;  4FPF A;  5BV6 A;  3GXU A;  2A71 A;  5AC9 3;  3IAP A;  1R08 1;  2LTN A;  4MV2 A;  3RMY A;  5DUW A;  1COV 1;  3FN9 A;  3K75 B;  4YAR A;  1YIP A;  5HCH A;  5C4W A;  1H2M A;  1B35 C;  4GKX A;  3H8O A;  1D4M 2;  3MIF A;  2RM2 1;  4CEY C;  1I3H A;  5F5A A;  3O5S A;  1PIV 3;  2IFW A;  4AEK A;  3GBF A;  3NNF A;  4FVV A;  3DV8 A;  4LBM A;  2HEY F;  2D6L X;  3WDU A;  3T0D A;  1W8U A;  3BOP A;  4XMI A;  1Q8V A;  1DFQ A;  1EUT A;  5JWP A;  3B9C A;  1IG3 A;  4XF9 A;  5FPB A;  4XAA A;  5F8P A;  3VDC A;  3NJX A;  2VME A;  4PLN A;  1W06 A;  1YJK A;  1HB2 A;  1LTE A;  1W2A X;  3B3Q E;  4FFI A;  5D8A C;  5A3U A;  4FFF A;  2B42 B;  3WXP A;  3EO6 A;  4QB6 A;  4A6O A;  5F6L B;  5DZF A;  1W8H A;  4Y1Y A;  1MQT A;  1OH3 A;  3N9O A;  4HZF A;  4RD7 A;  3MZH A;  3BOW A;  5K4L A;  4MGK E;  2CWS A;  2VVE A;  3GZE A;  1REF A;  4XQW A;  4BE3 A;  5IK4 A;  5FIX A;  4E2G A;  1XYO A;  2NZ9 A;  2QZ2 A;  1NQD A;  4XJA A;  1SBE A;  3ZX7 A;  4IV3 A;  3VBS A;  3AYD A;  1YFX A;  2ZGS A;  3E6B A;  1YHF A;  1OQ1 A;  1UY2 A;  3CJI B;  3MIC A;  4Q4X 2;  1FV2 A;  1NQJ A;  1G8W A;  1YFW A;  5E16 A;  1ULC A;  5KXC A;  4L99 A;  1WKY A;  2A5Z A;  3AP6 A;  4GUL A;  1VP6 A;  1QJE A;  1QJY 1;  1S0B A;  4COW A;  2ZZJ A;  5LEJ A;  4UFH A;  1IHM A;  2D6N A;  4AVA A;  1VJ2 A;  3KVA A;  1FNZ A;  3MO4 A;  4JZR A;  3WF4 A;  3LEI A;  5C5U A;  4XAE A;  3UGG A;  2WS9 3;  1L7Q A;  2AZ5 A;  2V4V A;  1W3X A;  2IXH A;  3UJQ A;  3JB8 A;  2ERF A;  2VAU A;  4Y22 A;  3G7D A;  1GP5 A;  3JB4 C;  1UYX A;  2VVD A;  1SEF A;  4RR3 B;  3H50 A;  2W91 A;  5A3W A;  3DGT A;  2Q8E A;  1JZ6 A;  5ACA 2;  1FOD 2;  4WVV A;  4YGB A;  3R4U A;  2DVB A;  4AEJ A;  1AYN 2;  3LOI A;  2J22 A;  4OVE A;  3WP5 A;  1CGP A;  1ZRC A;  2D3P A;  1XXN A;  2BGC A;  2Z2S B;  1MQT C;  1LHN A;  3I3B A;  1LAJ A;  1RED A;  4HPK B;  2FQP A;  3BIE A;  2VBB A;  5JMC A;  5JXI A;  1AR6 3;  5DMY A;  1ZBA 3;  2W46 A;  3KHB A;  1AL0 G;  1CAW A;  3WG3 A;  3WCS A;  5FJK A;  1GNZ A;  3WUD A;  1W0P A;  3W21 A;  3TEX A;  3NAP C;  2BUK A;  2RJK A;  4IV3 C;  3ZDS A;  4ATF A;  1C4R A;  2D98 A;  5LAS A;  2AR6 A;  4QU1 A;  1WW7 A;  3AMP A;  4GKY A;  1F15 A;  2DCT A;  4YSF A;  3CJI C;  4LO6 B;  2WNV A;  3VL9 A;  5L19 A;  3OTF A;  5FZD A;  3ZM8 A;  2ILM A;  3UL2 A;  4S2G A;  3WG4 A;  4AVT A;  2RDN A;  1Y9Q A;  4MLO A;  4YVS A;  1LHW A;  2Y8K A;  5D21 A;  1N1S A;  3TBD A;  3HOB A;  4RYD A;  3AYE A;  1LKN A;  4NR1 A;  3KF5 A;  1OVP A;  4GMP 3;  2VEC A;  1QXJ A;  1F4A A;  1QJZ A;  2IFR A;  2Y0O A;  3JCI A;  4COU A;  1O3R A;  5IVB A;  1C1L A;  3K3O A;  1WA6 X;  5L73 A;  2BBV A;  2IVJ A;  1GUI A;  2VW2 A;  3ORJ A;  1PO2 3;  3FX3 A;  5KXD A;  1RJ8 A;  3WEZ A;  4CEY B;  2ZX0 A;  1AL2 3;  1SLI A;  2WLQ A;  2PTM A;  2BP6 A;  1DYK A;  3KSC A;  5FZA A;  1ND2 C;  3WNO A;  3LPG A;  1UO9 A;  4HKO A;  3JBG 2;  1N3P A;  2LRP A;  2ARE A;  2YPD A;  3SNM A;  2K2S A;  3WNN A;  3I2F A;  3HBK A;  1U12 A;  1VB2 A;  2QQO A;  4JQR A;  4LTA A;  2W1S A;  2W47 A;  2RS5 3;  2J1T A;  5EJZ B;  1ZRE A;  1O3T A;  4Y5T A;  3T3Y A;  3KQ4 B;  1AHS A;  4XBQ A;  2DV9 A;  4D7Y A;  2VXR A;  4HMZ A;  1UKG A;  4GMP 0;  4OHZ A;  1RUJ 3;  5DUV A;  4QPI A;  1H4G A;  1LJ7 A;  1NY7 2;  2XON A;  3GHM A;  1UOJ A;  1RUN A;  2P3K A;  4KWU A;  3WOG A;  1K5M A;  3C3V A;  1V70 A;  1TZO A;  5FXZ A;  1DQ0 A;  2JWP A;  2RR1 1;  3ZPO A;  5E1R A;  4EYU A;  4N43 C;  4BME A;  3MIB A;  1XJA A;  5FO8 B;  4QB2 A;  3HQR A;  4J25 A;  4MXW B;  1BEV 1;  3FL7 A;  4YGD A;  2LW8 A;  4AL9 A;  4BK4 A;  3C7E A;  3IMN A;  1H2N A;  1HN0 A;  2IXJ A;  1UCX A;  2WQ4 A;  3MID A;  1A6C A;  4FI9 A;  5JI7 A;  1YQ6 A;  2RM2 3;  3ZFG B;  4K3U A;  1STM A;  2VG9 A;  4KBB A;  1UMH A;  3V56 A;  3FFZ A;  5T5L A;  2C26 A;  2ZMK A;  3III A;  3ZXE A;  5K8S A;  2Y0I A;  3FUQ A;  2FDF A;  1VPH A;  2CSG A;  4B4P A;  5IVC A;  3NWK A;  4PCR A;  5F37 A;  3K51 A;  4CUA A;  4A3X A;  2H0V A;  1Z78 A;  5GLW A;  3WW4 A;  5GZE A;  4GD4 A;  5JMO A;  3R4S A;  5CVR A;  3O1O A;  1KJR A;  3WD5 A;  1PZ7 A;  4CCK A;  4HVQ A;  5ISL A;  4Q4V 2;  4H55 A;  1ENR A;  5AFE A;  1XSR A;  1TVG A;  1A78 A;  1V6J A;  2WLP A;  1LRH A;  5F1R A;  3J8F 3;  4YZ4 A;  3J26 N;  3MFC A;  1AR7 1;  3NAP B;  2XHK A;  3O0X A;  3QAC A;  5I0S A;  3WCR A;  2EXJ A;  4PBP A;  5A32 A;  4JGZ B;  2RG4 A;  2ZHM A;  4FAG A;  3DYM A;  5FKC A;  1MZF A;  3IDA A;  3KCY A;  1IOA A;  4IV1 A;  3UKV A;  3CO2 A;  4CCO A;  5FYV A;  3AK0 A;  3OEB A;  4DS0 A;  5ANQ A;  5A3O A;  4EWE A;  3SH3 A;  4B1M A;  5C8C B;  2VMF A;  4IGO A;  3SCF A;  4AFM A;  2HWF 3;  4XYX A;  1XNK A;  1K3I A;  1W6Q B;  4Q26 A;  3VBR C;  2VZ3 A;  1Z7S 3;  4AVC A;  4HN1 A;  1VMJ A;  3CEW A;  4L97 A;  4D94 A;  2Q0A A;  2J7M A;  2UWA A;  1JYX A;  3LAG A;  4UW6 A;  4DRR A;  2UYB A;  3WG1 A;  4EN7 B;  3MUY 1;  5FQ0 B;  4LIU A;  2JDU A;  4LMF A;  4YM1 A;  2RMU 2;  3FBY A;  2KR2 A;  2PHW A;  5HCF A;  1UY1 A;  4OHY A;  1W0N A;  2BPA 2;  2FCU A;  3TOJ A;  1D2S A;  1AL2 1;  5A3T A;  2NMN A;  3H0O A;  4RFR B;  2W3J A;  1SMV A;  2G9Z A;  3NNJ A;  2PLV 2;  1JTZ X;  2PAE A;  4CDQ B;  1R1Z A;  4LA3 A;  3WP4 A;  2MEV 2;  1WME A;  2HH9 A;  2WO1 A;  1F2N A;  1VAM A;  3OOX A;  1ND3 A;  1PNG A;  2R06 3;  1S2B A;  2EAK A;  2JDN A;  4IND A;  2R0F A;  4QGM A;  5F3E A;  3N4M A;  1ODN A;  1IS6 A;  1RB8 G;  3ENR A;  3WX5 A;  1J3Q A;  1OLR A;  3O14 A;  3PVB B;  1K5J A;  5I0D A;  1AXZ A;  4XUR A;  1RHI 2;  4LXL A;  5A33 A;  5C8C C;  2GC2 A;  5A33 B;  4LKF A;  5FCC A;  1HRV 3;  3USS A;  3ZN4 A;  2V73 A;  3HMY A;  1QJU 2;  2JX9 A;  3AP7 A;  4BOW A;  2VC9 A;  2OII A;  2RS1 2;  2ZTN A;  1CZS A;  4Q4V 1;  2AGS A;  3ZFE C;  4CU7 A;  2VUA A;  1S0G A;  1NCQ A;  3DKW A;  4AFA A;  4CYD A;  3U4X A;  1R09 2;  4NPL A;  1GSL A;  3CMG A;  5FBZ A;  4BB3 A;  1RUE 2;  4YRD A;  5IAT A;  3ZYB A;  1S0C A;  1AL2 2;  3ZFF C;  3RFR A;  2AAC A;  1GOG A;  5IJR A;  4YLZ A;  4R9D A;  2WO2 A;  1J83 A;  4ZHN A;  1ND2 B;  4NUB A;  1TNR A;  1LCL A;  1NG0 A;  3AYA A;  1F9K A;  1OPM A;  1RUH 1;  3FZ3 A;  3VD4 A;  4EWD A;  3V0B A;  2WFF 1;  1G9C A;  3I49 A;  5FPX A;  4QHO A;  3VD9 A;  3OF1 A;  1POV 1;  1UW8 A;  5FZK A;  3SIT A;  1ND3 C;  3OGG A;  1CX1 A;  1HRI 3;  1CR7 A;  1E5I A;  1LOB A;  4WM7 C;  2AYH A;  2Y33 A;  2E26 A;  4QKF A;  4FT8 A;  1MQT B;  4BQ4 A;  4K9S A;  2XQR A;  4CDX B;  1BMV 2;  4CXW A;  2W1U A;  3ZO0 B;  1KXG A;  4I2O A;  3OG2 A;  5FZH A;  2TNF A;  2VGD A;  3WF2 A;  1OH4 A;  4CSW A;  4EN9 B;  4J1W A;  1YRZ A;  1BEV 2;  1AR7 2;  2PLV 1;  1V6N A;  4AF9 A;  4ARY A;  2JE8 A;  3ACI A;  4AR2 A;  1VBC 2;  1UZ0 A;  4IES A;  1W2N A;  1E5R A;  2WZR 1;  4ZU5 A;  5FP4 A;  3NQH A;  2G9F A;  1HB1 A;  2P17 A;  2JG9 C;  3AP5 A;  3ZFG A;  1NYW A;  1ULF A;  4OMC A;  1FOD 3;  1DQ6 A;  4H3W A;  5FR3 A;  3RNS A;  3RWN A;  1G7Y A;  2WA4 A;  1YFY A;  4HKW A;  4GH4 B;  4PI0 A;  5JZG B;  2RDQ A;  2BZD A;  3OD4 A;  1ULE A;  5JPM B;  1YJL A;  3KCC A;  2QFE A;  1NAE A;  1O4T A;  2PLV 3;  3B69 A;  2WS9 2;  2DUP A;  3AKS A;  1BXH A;  3FBM A;  1TME 2;  3ZYI B;  5KHG A;  2W0X A;  1ST8 A;  4GIQ A;  5CKQ A;  3AP9 A;  5FXW A;  5LRS A;  4LHK A;  2YC0 A;  4P9J A;  4QM9 A;  1G9B A;  1B09 A;  4KG8 A;  5DAV A;  1CAU B;  4UFL A;  2IUW A;  1LOF C;  1S1A A;  5FP8 A;  1JOD A;  1OFS A;  1UKR A;  2VMD A;  3I59 A;  2J1A A;  5T55 A;  3MIG A;  2GZW A;  4BH9 A;  2ZGT A;  2CWM A;  1ZA4 A;  4MAD A;  2P6C A;  4DUX A;  4CDU C;  4OCT A;  1UOB A;  4AFD A;  3CDZ B;  5L7O C;  1ZRR A;  3U78 A;  1W6O B;  4EZ4 A;  4QX7 A;  2MNG A;  3BOD A;  5DXD A;  3GZT B;  3OYW A;  4FPC A;  4KWL A;  1MZE A;  2CDP A;  4BXF A;  3OD0 A;  2ZAB A;  1CAX B;  1CX4 A;  2XVG A;  3KV6 A;  3I3D A;  4Q0S A;  4COZ A;  5FWE A;  2KXL A;  1S2E A;  2C6S A;  1BZW A;  3W9A A;  1JZ8 A;  3ILF A;  3OUJ A;  3BB6 A;  2BU9 A;  1PX4 A;  2WQZ C;  2RMU 1;  3T4V A;  3HQU A;  4WVW A;  5CFC C;  2VMH A;  1UNB A;  5FZ8 A;  1ZRF A;  4TN7 A;  3SC7 X;  3WW2 A;  1JHJ A;  4ES8 A;  4JGZ A;  4HVO A;  3ZXG A;  5IT6 A;  5FY0 A;  3AZV A;  1GOH A;  2QDN A;  4G9S B;  4ZPI A;  1UU6 A;  4GMP 1;  4LUK A;  1QF3 A;  4YW6 A;  4GJZ A;  3ON7 A;  4AG4 A;  4CP9 B;  1X33 A;  1MS1 A;  2B9V A;  4CCM A;  1ZZ7 A;  5H9P A;  3GGL A;  5AC9 2;  5A7W A;  1R1A 2;  3NKG A;  1CWP A;  2WFF 2;  2IXC A;  3T08 A;  2RM2 2;  1O7F A;  2Y6G A;  4AED A;  3AX4 A;  3OCP A;  4XQ4 A;  3OPT A;  5KR7 A;  4LBK A;  3T0A A;  4AI2 A;  5A1F A;  1V6L A;  4XIO A;  2GC3 A;  3RYR A;  1GBG A;  1JZ2 A;  3KV5 A;  3M8L A;  2YDE A;  4O9G A;  3WDX A;  5L7O A;  5A3P A;  1DGW A;  2OUJ A;  2YGL A;  1GIC A;  3F2Z A;  3S30 A;  4AHX A;  1NT0 A;  4FOW A;  1PIV 1;  2XJQ A;  3WQ1 A;  3C7G A;  3BN6 A;  2XJP A;  3APB A;  1AUY A;  1RUI 2;  5A6X A;  1RUF 2;  5K0U C;  4FOV A;  1ZZC A;  1HRI 1;  2NM1 A;  4YW5 A;  5FRA A;  3BPZ A;  1E5H A;  1RUJ 2;  1VAV A;  1Y43 B;  3KQR A;  2EA7 A;  3ZSL A;  4JTN A;  3USU A;  3ES4 A;  3ATG A;  3CNA A;  5F3C A;  3PIG A;  1OLQ A;  4DQA A;  4MX3 A;  4ZXE A;  5FZ4 A;  2ES3 A;  3BTX A;  4CDW C;  2N7G A;  4JGZ C;  2DFB A;  2Q30 A;  4MVT A;  3WV6 A;  4XCA A;  3U4S A;  4LNV A;  4CEW A;  1CZT A;  4TZD A;  4V2W A;  2FCT A;  3KT4 A;  1RUC 1;  1J3R A;  2O8O A;  5KHI A;  3GF6 A;  1FPN 1;  2QQK A;  4Z82 A;  1XPW A;  2X5I C;  2YU1 A;  3IDE A;  1NLQ A;  3WNL A;  3E1F 1;  3VGI A;  4ET7 A;  5CFC B;  3B94 A;  1IS3 A;  4B3N A;  5I91 A;  2A6V A;  2ZX2 A;  4QKB A;  3SKV A;  4BWO A;  1W99 A;  5KC6 A;  5CEH A;  3GNE A;  1RTV A;  4NPM A;  4L92 A;  4QQO A;  4WZF A;  4ATE A;  4OLL A;  3NV3 A;  3JXS A;  3MGU A;  2XHN A;  5FZC A;  1EAH 1;  1V9U 2;  4CCC A;  4QDQ A;  1XNA A;  4W6Y A;  3VHR A;  2R1B A;  3MW2 A;  3HAG A;  3U37 A;  2R04 1;  4QGN A;  5KXB A;  1RMU 2;  4RHV 2;  4XPV A;  1JZ4 A;  4QPY A;  1Y4W A;  2HWE 3;  2NLR A;  2K0G A;  1NCR C;  2A70 A;  3RI8 A;  4PIY A;  2W52 A;  4IEU A;  4NOT A;  4NIA A;  4Y1V A;  2J1S A;  4Y5S A;  2PN5 A;  5FYC A;  5C5T A;  4R8H A;  4RL7 A;  3HR9 A;  1NE4 A;  2JXA A;  4SBV A;  2V5D A;  1QJY 3;  5FYU A;  3SXW A;  5BYN A;  5CBL A;  2JG9 B;  5F9T A;  2X8K A;  4P02 B;  3PU3 A;  2JDY A;  3S5Q A;  1V9U 3;  4KU8 A;  4XF1 A;  4XTP A;  2G1M A;  4DOU A;  2JG8 A;  2D93 A;  1N1V A;  1AR9 2;  4HFS A;  4P5Y A;  2W87 A;  1ZBA 2;  2ATF A;  3KGZ A;  4XJ8 A;  2BTV C;  4PIX A;  3VBU A;  3ZIX A;  4KGG A;  1X7N A;  3E5X A;  5DUU A;  3UNP A;  3A0K A;  2CAV A;  3D8C A;  2ZGK A;  1FAY A;  5ACA 3;  5ACA 1;  1CAV A;  3J7L A;  1WUV A;  1POV 0;  2PHX A;  5A7O A;  2BJS A;  3AMN A;  4BM8 A;  5C3P A;  3DUI A;  1YQ5 A;  3ZXF A;  4Y1U A;  3I7D A;  4CU8 A;  1ASJ 1;  3H3L A;  3JD7 2;  2QVS B;  4C91 A;  5DAW A;  3TWI A;  1KS5 A;  1OBN A;  1POQ A;  3WQ7 A;  4ITC A;  1AYM 1;  2BQP A;  2F4L A;  3DN7 A;  3ZLI A;  1LOC A;  4CXX A;  1NCR A;  1XE7 A;  1PO1 3;  1RVF 2;  4LBO A;  4O7X A;  1G9D A;  1UZY A;  3SIS A;  3WW3 A;  5FY1 A;  1MS3 A;  5CIS A;  2W92 A;  4BQ2 A;  1NCR B;  3IDB B;  4CUC A;  3W5N A;  4FTE A;  1O91 A;  3J9S A;  3AL6 A;  2XBO 2;  4W50 A;  2LUW A;  5FPZ A;  2A7A A;  2Y6L A;  5FP3 A;  4GQ7 A;  3WNP A;  4Q4X 3;  4XMA A;  3D0S A;  3WIN E;  1O5U A;  1CAU A;  1UIJ A;  4JV4 A;  1W6N B;  2XWJ B;  3KV9 A;  2ZCW A;  3EYP A;  4Q4W 1;  3WHU A;  3FE5 A;  4HOO A;  4XUN A;  1OHF A;  2HWB 3;  4K20 A;  3OB8 A;  5CKM A;  3UES A;  4YW1 A;  3RYK A;  1ONA A;  1I1E A;  1MS8 A;  2Y6J A;  2R04 2;  2FDH A;  4OQ8 A;  1IKP A;  2WNV B;  3O1V A;  5JOY A;  4MG2 A;  1UY0 A;  2ETE A;  1O5L A;  2OQ6 A;  2ZS6 B;  2GU9 A;  3DEM A;  4YNI A;  1X8E A;  4ARX A;  1W8O A;  4Q2F A;  2GAU A;  3KT7 A;  2MPF A;  1W90 A;  4E2S A;  3OYW B;  5K9Y A;  2ARX A;  1C28 A;  4I01 A;  3U75 A;  5FYZ A;  4Z2W A;  4KNC A;  4YW2 A;  1AR8 1;  4MXV A;  3PVN A;  1DZT A;  1K5M C;  1S55 A;  2YRO A;  4X8P A;  4EN8 B;  3ZN6 B;  1EAH 3;  4YZ3 A;  3AL5 A;  5JLV A;  1QOS A;  2JD9 A;  3ZYG A;  1KS4 A;  2D44 A;  1UX6 A;  3PVE A;  1PIV 2;  2VNG A;  3VHO A;  1MVE A;  4QKN A;  4FPK A;  1COV 3;  4LOT A;  2XKO A;  1AJK A;  3NMB A;  3TEY A;  4ASK A;  4JKK A;  5JSO A;  2A6Z A;  3D6E A;  1HRV 1;  1SLT A;  1W03 A;  1AVB A;  2A6W A;  5HXM A;  4EWA A;  2CGO A;  2R04 3;  3R4D B;  4A42 A;  4Q1P A;  1DP0 A;  3VKM A;  1MZ5 A;  2OKX A;  4DXT A;  1FMD 2;  2R07 2;  4QXC A;  4GWI A;  2Q8C A;  4CEW B;  4COV A;  2BOJ A;  2CGN A;  2H6C A;  4HAN A;  3VDD C;  5C9A A;  3GCW A;  4H14 A;  2W95 A;  1TG7 A;  2VOK A;  4IUG A;  4OHW A;  4A7Z A;  2XKP A;  3KB5 A;  1LEM A;  1YWK A;  4OHV A;  2R30 A;  1CN1 A;  5FBJ A;  4YW4 A;  1EUU A;  5KBF A;  1C57 A;  2ADE A;  4QX3 A;  1JU3 A;  1EV1 3;  1GP4 A;  5DZG A;  1W6M B;  4YZ2 A;  3POI A;  2VCC A;  4B8E A;  4D7T A;  2B39 A;  4AQT A;  3W58 A;  4AHY A;  1CON A;  2D5H A;  1V00 A;  2XJV A;  4KWJ A;  1DQ5 A;  1JYW A;  3IB3 A;  5L9R A;  2GP3 A;  4PDW C;  4Y20 B;  1XSQ A;  2Y6F A;  4GWN A;  4YZ1 A;  4UF0 A;  3AMM A;  1IZ3 A;  1SAC A;  4OHX A;  1HQW A;  3I97 A;  4KQ7 A;  3ACF A;  1QJX 3;  1UYZ A;  3AZZ A;  1GKB A;  3H8U A;  3LFM A;  1H8V A;  2AUY A;  1JZ7 A;  4OMD A;  2PEL A;  2WAO A;  3BYW A;  4QQL A;  4YW7 A;  1AR7 3;  2HYK A;  2ZBJ A;  5EFU A;  5FYH A;  3T2O A;  5A3L A;  5J48 A;  1G6N A;  4LT5 A;  2ZAA A;  4K21 A;  2FDJ A;  2C24 A;  2Z69 A;  2BGP A;  4XCB A;  5IWF A;  3LZZ A;  4LJH A;  4P00 B;  3SLI A;  4NWV A;  3BVC A;  1B35 B;  1Y3T A;  3RDI A;  1QJY 2;  5APA A;  1W28 A;  1KIT A;  3K77 A;  3QH7 A;  3BI3 A;  3N7M A;  2D40 A;  2E7Q A;  3MV0 1;  1O8P A;  2PAK A;  2BWC A;  4QWN A;  4YGE A;  4ZON A;  3ZOI A;  4DY3 A;  4LKS A;  2LM3 A;  3QOP A;  4YM3 A;  4A45 A;  4C1X A;  1WA4 A;  4FAH A;  5IYY A;  1ZX5 A;  4IE0 A;  1EY2 A;  3HNY M;  5E88 A;  1C8N A;  1JHN A;  1RUH 2;  4C0H A;  1W6O A;  2UWB A;  3I3M A;  4XFA A;  1C8M 3;  1W8T A;  5A7N A;  2ZEZ A;  3HN3 A;  1QJU 1;  2AC1 A;  2D7F A;  2GMP A;  3LGR A;  4GWM A;  1WD4 A;  5C8C A;  3AZX A;  4KBZ A;  2ZHL A;  4E2Q A;  4XFF A;  1X36 A;  5FY7 A;  3MI8 A;  1PHM A;  1CAX A;  2C5D A;  3J4U H;  1W8F A;  3WVJ A;  4FPO B;  4A4A A;  2D3R A;  1W8W A;  2Y26 A;  4Q0Q A;  3VLB B;  2CV6 A;  4CZS A;  2UWC A;  2ZGP A;  5LBE A;  1PM4 A;  4P14 A;  1NCQ C;  1VRH 1;  2VE1 A;  4XC9 A;  4XXP A;  5FYM A;  1NLS A;  2JIG A;  3POJ A;  1M06 G;  1HX6 A;  3ZFF A;  3POB A;  3VBO A;  3T09 A;  2CY6 A;  1YLL A;  1LOG A;  2FZ1 A;  1C8M 2;  1I5P A;  4CDQ A;  2OZ6 A;  4CUG A;  2WT2 A;  3V64 A;  3LPF A;  1VBC 1;  1H9W A;  3T0B A;  2WFP A;  4ZXK A;  4YZ5 A;  3BU0 A;  1IS4 A;  2X5I B;  1N3O A;  3VBH C;  2JE7 A;  1Q8S A;  2IC1 A;  2XVL A;  3IMM A;  1MR5 A;  4CP2 A;  2DUQ A;  2PHF A;  5B4X A;  1NOV A;  4NHL A;  1CES A;  3JU9 A;  5BNO A;  3SCG A;  2FZ2 A;  2UY8 A;  5LRR A;  4Y3O A;  5HI0 A;  3RZM A;  1RUF 3;  4QPI B;  2MEV 3;  4Q0U A;  3O12 A;  5AVA A;  1H8T B;  5C71 A;  4B7E A;  1EP0 A;  3PL0 A;  1ALY A;  1C1F A;  1Q56 A;  5ABJ C;  3OSD A;  4D0Q A;  2JB8 A;  4RN5 A;  4UBH A;  4OUE A;  3WR0 A;  3ZSE A;  3VBO B;  2IXL A;  2AEN A;  2HBU A;  1SLC A;  2W08 A;  1OA3 A;  4WBB A;  4XUP A;  2WFF 3;  1VRH 2;  1VBA 3;  3WF3 A;  1R1A 3;  1DGW X;  1UX7 A;  2OPW A;  2ZGM A;  1LB2 A;  4LIT A;  3MEP A;  2NQY A;  2YZ4 A;  3VKF C;  1JZ3 A;  4XF3 A;  5LAT A;  4LPL A;  4NO4 A;  1BK0 A;  1SDW A;  2CTV A;  4J1X A;  3RZK A;  1F4H A;  5DDJ 1;  4N7I A;  4CCE A;  4BXS V;  3SKJ E;  3RJ2 X;  3K4A A;  4R9B A;  1S0F A;  2O14 A;  4BIO A;  4C90 A;  2OUH A;  2FHR A;  1D4M 1;  2K9Z A;  3N36 A;  3U14 A;  1LUL A;  4YPJ A;  3BTA A;  4N53 B;  1QOO A;  1H1M A;  1H2L A;  3D0J A;  5BY5 A;  1VBA 1;  2D5F A;  4LO8 A;  4N9I A;  3SEP A;  1PNF A;  1EV1 2;  3TNQ A;  3PJQ A;  4XDQ A;  4AVV A;  4F83 A;  3GDB A;  4MYE A;  3N7J A;  3H7J A;  5J98 B;  1W3V A;  4I0B A;  1VBE 2;  1FAT A;  5FO7 B;  1OQD A;  4JGY C;  2BVV A;  5HV4 A;  3MF6 A;  2WZR 2;  5HBA A;  3PDQ A;  4CCD A;  4ZKT B;  2K46 A;  4BQ5 A;  1JYI A;  1PGL 1;  1MEC 1;  3FFQ A;  2RS3 3;  5T54 A;  3LDB A;  4KU7 A;  1H6X A;  4XIL A;  5FZI A;  5JSP A;  2P1B A;  5C4W C;  5F32 A;  2E63 A;  5T52 A;  2QE3 A;  1UAI A;  1W9S A;  2DCZ A;  3CQO A;  4NRO A;  3LEG A;  3U07 A;  3I2O A;  4NII A;  1OFN A;  2VR4 A;  2ZEX A;  1FOD 1;  5E8A A;  2VTF A;  2GNT A;  2WS9 1;  3AKR A;  3MPP G;  3NV2 A;  4HL0 A;  3PJY A;  2RS1 1;  4XOG A;  4B4R A;  1RUG 2;  3LOB A;  4P9W A;  1GWK A;  2VMC A;  2XGX A;  5BXX A;  4DMI A;  4DO0 A;  1R09 1;  4IW3 A;  4AGR A;  1VLN A;  1WZX A;  4M01 A;  3SMH A;  2VPV A;  3LDR A;  5JUV A;  2CL2 A;  3I54 A;  1PM7 A;  1X9P A;  4A44 A;  4OUL A;  2KA3 A;  1JMU B;  2B45 X;  1N1T A;  2ZJC A;  3P3N A;  4UT5 A;  1FX5 A;  1RUI 1;  5FYT A;  5FXX A;  1SFN A;  3ASI A;  2QBX A;  1RC6 A;  1XNT A;  1NA1 C;  3IPV A;  4E4Z A;  5A6Y A;  5JR2 A;  3OPZ A;  2XDV A;  4P9X A;  3TNP B;  1NKG A;  4KWK A;  1OLM A;  4TLG A;  3MYX A;  1LEC A;  5F3G A;  1C8M 1;  4CU9 A;  3AB0 A;  3P6B A;  4RFT 0;  5GZF A;  3VBS C;  4LBN A;  1ASJ 3;  4FTB A;  3CKH A;  2JDZ A;  4AI0 A;  1BHG A;  3SCH A;  1VBC 3;  2ARA A;  5FRE A;  2HYX A;  4BLJ A;  3VHP A;  2R7E B;  4FPJ A;  3RSJ A;  3WDV A;  4AHZ A;  2HWB 2;  4IEY A;  5EYX A;  3THP A;  1WLW A;  2LAL A;  3AZY A;  4XAC A;  1T2X A;  2FBE A;  4AAP A;  3POY A;  4DPN A;  1W6P A;  1GNH A;  1F35 A;  2DVA A;  1JI6 A;  1ULO A;  3KLS A;  2P34 A;  1MPX A;  3T4H B;  3DXT A;  1UU5 A;  5LB6 A;  1HJF A;  5BNP A;  3EMR A;  5LW9 A;  3MLL A;  5HV0 A;  4G3Y C;  5A3M A;  4A2U A;  3Q9O A;  4PQQ A;  5A6Q A;  1PO1 2;  1RVF 3;  1CPM A;  3CJX A;  4O9E A;  3ZXL A;  2VCA A;  4B7K A;  2VMG A;  2VQU A;  1TNF A;  5H9S A;  4MHU A;  2VOX A;  4V2V A;  1VIW B;  3LFI A;  1OVS A;  4XJW A;  1W0O A;  4Y33 A;  4CDW A;  3O1U A;  4CTE A;  1NA1 B;  1MS4 A;  2UY9 A;  2QKD A;  4JDO A;  4OYU A;  4CRQ A;  1J58 A;  5FZE A;  2X53 S;  5FZO A;  3H7Y A;  1GNY A;  4N53 A;  4I02 A;  1QEX A;  2X5I A;  1VR3 A;  2ZGL A;  5EPA A;  4AFC A;  4AI8 A;  4QX2 A;  2YFZ A;  5T3N A;  1QWR A;  2HWD 1;  4MGI E;  1AR9 3;  3VZK A;  2GDF A;  3ZXJ A;  3AFG A;  1PO2 1;  2XJU A;  3AVS A;  1RUJ 1;  1RIR A;  3N35 A;  5T5J A;  3SHR A;  1YXW A;  4E8D A;  1KDM A;  4XEZ A;  4B4Q A;  1RUC 3;  3D3A A;  4MGZ E;  2R32 A;  4WV8 A;  5EQU A;  5FMO L;  3E6C C;  5BNP C;  3FHQ A;  4FPG A;  1JOP A;  2UYA A;  4W6W A;  2RS5 1;  5AC9 1;  2Y6K A;  3EB7 A;  1KRI A;  2R06 2;  4MHR A;  3V0A A;  3POE A;  1XOY A;  3TN9 2;  5C4W B;  4KGQ A;  1DHK B;  2GP5 A;  3MIH A;  3ITQ A;  3W5M A;  2QJV A;  5BNN B;  4JGY B;  1ZYB A;  3ZN6 A;  2B9U A;  4E4S A;  5J37 A;  1OUS A;  1BBT 3;  4AQ6 A;  4GB3 3;  4D3W A;  4UFM A;  1TQ5 A;  1E57 A;  3RQ0 A;  2XL9 A;  4WZC A;  3JQX A;  1XU1 A;  5LY1 A;  1TMF 1;  2J42 A;  3N9M A;  1H1A A;  1XE8 A;  1UD1 A;  2LRO A;  3ZYF A;  4A3Z A;  2VOV A;  5FZ7 A;  3PUR A;  3S5A A;  2HWC 1;  5L36 A;  5HXV A;  1NX9 A;  1HB4 A;  2BV4 A;  4FFG A;  4QXB A;  3VBU C;  4NHM A;  2O8Q A;  2C1F A;  1QJX 2;  3LE0 A;  1ND2 A;  4JQT A;  4TXW A;  1R1A 1;  3I4I A;  2ZML A;  1LHU A;  2JG8 B;  3VBF C;  5G05 L;  2VUD A;  3P3P A;  1WMD A;  3GM8 A;  1F31 A;  2ZOE B;  4AZZ A;  5LK5 A;  1ACC A;  2W1W A;  3NRU A;  2PHD A;  4FPY A;  5HPO A;  1OD5 A;  2YGM A;  1VB4 A;  4E8C A;  1YQC A;  4N43 A;  1CAV B;  2BFU L;  1OUX A;  2P2K A;  3O1M A;  4U2A A;  4YFW A;  3Q8B A;  4OUM A;  3VDA A;  3J8F 2;  2VTX J;  4L0P A;  4M00 A;  3NW4 A;  4QQ2 A;  3POG A;  1H8T C;  1UF2 C;  3AXD A;  4QPI C;  2EXI A;  3POW A;  4URT A;  4WM7 B;  1H0B A;  2XQX A;  4XF4 A;  4XUQ A;  5B4N A;  2ADD A;  3H1W A;  1W9Y A;  4I3P A;  5FK8 A;  1GZW B;  5IW0 A;  3PIJ A;  3ZMO A;  1AJO A;  5FLJ A;  1O4Y A;  2RDS A;  4EJR A;  1FMD 3;  2R07 3;  1PO1 1;  2JKX A;  2OS2 A;  3DKQ A;  1PVX A;  2XG3 A;  3T30 A;  4ONU A;  5GAL A;  4FXK B;  3VBU B;  3ZKY A;  5KXE A;  5H9Q A;  3SQO A;  5FYY A;  3NJY A;  1RVF 1;  2VZU A;  2YG0 A;  3PHM A;  4Y4Y A;  3ZSJ A;  3O1R A;  5FQ0 A;  3L2Y A;  4Y22 B;  4LQR A;  2OPK A;  1AR9 1;  3AC0 A;  3HNB M;  2FDI A;  3WP6 A;  4W6X A;  3M70 A;  3DPR C;  1NE6 A;  3HN1 A;  1PGS A;  3ZFE B;  2BNO A;  5I8S A;  1L7R A;  4OQ9 A;  1SLB A;  3HEI A;  4GAL A;  4YVW A;  2VJX A;  1D2Q A;  2WUH A;  1G86 A;  2EXH A;  1OOP A;  3KS7 A;  1C5I A;  1ENX A;  3D4K A;  1KQR A;  4MGS A;  5M0T A;  2GN7 A;  3Q8A A;  1SFY A;  2DUR A;  4X6Q B;  4LK6 A;  1OT5 A;  1SLL A;  3LF7 A;  2A6Y A;  4SLI A;  3CBN A;  1W04 A;  3KV4 A;  2Z5W A;  2WL1 A;  5E6H A;  3FHA A;  4EV0 A;  2RS5 2;  4ZY9 A;  4Q4W 3;  5FY8 A;  3K2O A;  3VL8 A;  2QQP A;  4GAZ A;  2KD7 A;  3AXE A;  2WZP P;  5C9A C;  2V5Y A;  1GWL A;  2DBI A;  1L3J A;  1LOA A;  1X50 A;  2GND A;  1S2K A;  2VCB A;  3JBG 3;  4FOY A;  2I2S A;  3USU B;  3W59 A;  5BNQ A;  3EHK A;  4YM2 A;  5LBF A;  2AEY A;  3PME A;  3HQX A;  2Q8O A;  1OOP B;  5GLT A;  1KJL A;  3VBR A;  2X09 A;  2PHL A;  3AKQ A;  4PF5 A;  1LEN A;  1SPP B;  4BQY A;  1SLA A;  4GB3 2;  2EAL A;  4XDP A;  1ZVF A;  3ZSM A;  5FJH A;  1AR8 3;  2A1X A;  2BNN A;  1PZ8 A;  4B1L A;  2E9Q A;  2ARC A;  4M0N A;  5LWB A;  4K8F A;  3NNG A;  4RGA A;  1FYU A;  4YM0 A;  5FOB B;  1XND A;  4Z1V A;  5JIA A;  5JXH A;  4Q4Y 2;  4UFK A;  3OBZ A;  3VKN A;  3WDW A;  2D6M A;  4R9A A;  2HLE A;  4PDW B;  3RI9 A;  3GHN A;  5DG1 A;  2Y34 A;  2O1Q A;  3FHI B;  5CIR A;  2Q1Z B;  3RZZ A;  1JYT A;  3G6J B;  3A22 A;  3MUZ 1;  1SBD A;  2XPJ A;  4IE4 A;  1MZ6 A;  4ASM B;  1RUC 2;  1NXM A;  2R6Q A;  2EID A;  4QXK A;  3AMQ A;  5CFD A;  2PHT A;  2DCJ A;  4M3C F;  1I6X A;  4CCL A;  1L7L A;  3ABZ A;  5FYB A;  5AVP A;  2GSY A;  1NUK A;  5IAV A;  1PMH X;  4IEP A;  5FY9 A;  1ZZ8 A;  4L8Q A;  1Q3E A;  5FZ3 A;  5DG2 A;  1CIW A;  4Q27 A;  1UOF A;  1WLC A;  1BK1 A;  2ZHK A;  4YG0 A;  3I2J A;  5CZK A;  5A6Z A;  2WNU B;  1HRI 2;  3VUO A;  2I07 B;  1AYN 3;  1OA2 A;  1J84 A;  1DLC A;  4GB3 1;  1JZ5 A;  1J1T A;  3NVC A;  4XAB A;  1REE A;  1F5F A;  5TSW A;  1FMD 1;  2P3J A;  2R07 1;  3A4U A;  3PMS A;  3LA3 A;  4NWW A;  4O65 A;  2X10 A;  4QPG C;  4WM7 A;  4RHV 3;  4UAP A;  3LWC A;  5EHD A;  4XE9 A;  5I0U A;  3VZN A;  4DUW A;  2WRA A;  4IGP A;  3UGF A;  3H9A A;  4BHP A;  1QKQ A;  5BNN A;  1WW6 A;  4D8M A;  2XWB B;  5JR7 B;  4HK9 A;  4IEW A;  2HJI A;  3N9N A;  2DCY A;  2NN8 A;  2V72 A;  3CU7 A;  1ENS A;  4NVP A;  1GZ9 A;  4TSV A;  1BBT 1;  1ULP A;  4LR4 A;  1F5J A;  4HN0 A;  4IV1 B;  1W8Z A;  1RIT A;  5DUX A;  2ID4 A;  3IDC B;  2P6H A;  4HSJ A;  1NXD 1;  2R16 A;  4HT1 T;  2YU2 A;  4QX8 A;  2OW4 A;  2Q5T A;  1VAL A;  3IKW A;  1LGN A;  2VZ1 A;  1N1Y A;  1V9U 1;  1ZBA 1;  5CFD C;  1KD7 A;  4CUB A;  2RE9 A;  1W6N A;  4BQW A;  3S57 A;  3D82 A;  4UFI A;  4YVS B;  1LU1 A;  4WVM A;  1TE1 B;  4IL7 A;  3KGL A;  1U5I A;  1DYP A;  2CHH A;  1QIQ A;  3KF3 A;  3MFA A;  1HN1 A;  3HIF A;  4YG3 A;  5FMD A;  2YY1 A;  3N7K A;  2R0H A;  1U5Z A;  4FQZ A;  1XYP A;  4IET A;  3K46 A;  5LEK A;  1F8V A;  2BGO A;  3DF0 A;  4Q4X 1;  2E7T A;  3D5O A;  4PLM A;  3WF1 A;  1H30 A;  4S2F A;  1A34 A;  4Q5O A;  4CPB A;  3K4D A;  1YI7 A;  1CAW B;  1J1L A;  1PK6 B;  5FWJ A;  3ZYR A;  4IXL A;  2JG9 A;  3LB9 A;  1O59 A;  4WM8 C;  3ZIW A;  3CL1 A;  3GCX A;  1QH7 A;  4D7S A;  5L9V A;  2Q1F A;  2G19 A;  2RR1 2;  3AJY A;  5BNN C;  1JOB A;  1EPZ A;  5ABJ A;  3I2K A;  4BQ1 A;  3VBH B;  2VOT A;  3ILN A;  1FI2 A;  1KGY A;  2DTY A;  5LCW L;  4W4Z A;  1OD3 A;  5ABJ B;  5IVF A;  3UV9 A;  3MLJ A;  2JDH A;  2WZ8 A;  4GXL A;  1RXG A;  3IWZ A;  5ERL A;  2FMY A;  2JD4 A;  3E5U A;  4CDU A;  1XB9 A;  3OPW A;  1NZI A;  4AYU A;  2WIN B;  1RL3 A;  3A7Q A;  1CPN A;  2B8M A;  2ORX A;  5IAX A;  5FZ1 A;  5JAX A;  2HWF 2;  2JJ6 A;  4EQV A;  1Y7B A;  1YCI A;  2VZR A;  3K3N A;  3IT8 A;  1S0I A;  3BPS A;  2QZ3 A;  4CDW B;  4LEJ A;  4GA9 A;  2VNO A;  3JD7 1;  4XET A;  3PUA A;  5FV3 A;  2QUO A;  2FD8 A;  5FZ9 A;  1AX1 A;  4QX1 A;  5CFC A;  1W8N A;  4UOJ A;  3ROU A;  1VBE 3;  1V6M A;  2XJR A;  4QQP A;  3DXU A;  1SCS A;  3VN4 A;  4KH9 A;  2WO7 A;  2WN2 A;  2ENR A;  4XFG A;  2PQS A;  4KG0 A;  1O4Z A;  5DZE A;  2OZJ A;  3GAL A;  4B29 A;  1QQP 1;  4C1W A;  2DWR A;  4ORF A;  4WM8 A;  3LA7 A;  4BPZ A;  1XYN A;  1LGC A;  4PT6 A;  1RUD 1;  4DEV A;  4NAO A;  1MAC A;  5K7P A;  3RRD A;  4N90 A;  1Q8P A;  5EP9 A;  2WWS A;  3J7H A;  5D8A A;  3VZM A;  4PQ9 A;  4MSV A;  4RHV 1;  5KHK A;  2GH2 A;  2BBA A;  3IAQ A;  1GAN A;  4FCA A;  3LKJ A;  5DAX A;  4OI1 A;  5F5I A;  3THD A;  1V6O A;  4QDR A;  5FYI A;  2ZAC A;  4NIG A;  4DZG A;  5J7M A;  1ODM A;  1GP6 A;  1VBA 2;  2XUM A;  1V0A A;  2J1E A;  1MS5 A;  3RGB A;  2ZGU A;  5L7O B;  4LBJ A;  3WLU A;  1GQG A;  1VBB 3;  2Z79 A;  1UIK A;  4AHW A;  1FPN 3;  1S0J A;  5CNA A;  3RZG A;  3LEM A;  1HIX A;  1TMF 3;  5FMO S;  2RR1 3;  3S6P A;  1QY4 A;  1TME 3;  4HLT A;  5LA1 A;  1BBT 2;  5IFT A;  1HXS 2;  4IEO A;  4XFH A;  2ET1 A;  2OXB A;  5FLH A;  2BRT A;  4CXY A;  3X29 B;  2ZX1 A;  4JRL A;  4AI9 A;  2YFU A;  5CA6 A;  2PFW A;  4Y24 A;  3B00 A;  3NL1 A;  3GZA A;  4XJ9 A;  4K1Y A;  3TN9 3;  3UK9 A;  3VZO A;  1OUR A;  1NCQ B;  3OEA A;  4IGQ A;  5FAX A;  3I3E A;  5JSR A;  2JEM A;  4P9G A;  2DU1 A;  2HWC 3;  5K0U A;  2A3X A;  4DIQ A;  2JDP A;  3K48 A;  3J7M A;  1BKZ A;  2VW0 A;  5CB7 A;  3DEC A;  3HT1 A;  1BEV 3;  3F95 A;  1XNB A;  3FLR A;  5G04 L;  3IIA A;  1DBN A;  4NHY A;  2BYV E;  2YMZ A;  2ZKN A;  2QQL A;  4YVS C;  5FPU A;  3ZN5 A;  2P37 A;  3TEW A;  4CEW C;  3WSO A;  4AGV A;  2XJS A;  3FC0 A;  3C7F A;  5FDB A;  4NHK A;  3EQE A;  4XBL A;  1SFP A;  3NAP A;  5C3O A;  1GR3 A;  1CVN A;  4MGY E;  2DUO A;  5GZD A;  3ZYJ B;  1AYM 3;  2WT0 A;  4HBN A;  2ZEY A;  3VZJ A;  5IK5 A;  5JI9 A;  2ARB A;  2BNM A;  3KWV A;  3MDP A;  4QXH A;  4AOC A;  2E7A A;  4OI0 A;  1PVC 3;  4LLF A;  1S0E A;  3CJI A;  3LIH A;  2WNV C;  3VDB A;  2WYS A;  3IM0 A;  3ZSK A;  5GLZ A;  5JZG C;  5A32 B;  2TUN A;  1GU3 A;  1HQN A;  1RHI 1;  4IE7 A;  1D0G A;  3JUU A;  1US2 A;  1WCQ A;  4QT6 A;  1PZ9 A;  4QHZ A;  5C3Q A;  4YYO A;  4QHB A;  1RUG 1;  1BJQ A;  2JE9 A;  4FFH A;  2QQM A;  4DNY A;  2JG8 C;  2VQT A;  3VBF B;  1WCK A;  2WII B;  3Q8F A;  1WGP A;  3LCP A;  4G4F A;  5FTT C;  3RMX A;  2VQA A;  1XNC A;  3MLK A;  2WAB A;  2XLF A;  4N53 C;  4XVH A;  4K8R B;  4DY5 A;  5I93 A;  4UW5 A;  3EBR A;  3H3Z A;  1OQE A;  1LHO A;  3M4F A;  2HEV F;  2R49 A;  1JBC A;  3PNA A;  1UYP A;  2OA2 A;  2GAL A;  4UW4 A;  4XZU G;  2EIC A;  3VKL A;  1PGL 2;  2VH9 A;  1HXS 1;  3ST7 A;  2ET7 A;  5FY4 A;  1LES A;  1WBF A;  3M7A A;  4WM8 B;  3BKZ A;  5HCB A;  4PI2 A;  1ZRD A;  2OYZ A;  2HWC 2;  4AAX A;  1Q5O A;  4CDU B;  1ZRI A;  2PXJ A;  1R08 2;  5FMC A;  5IVV A;  1RUD 3;  3M3C A;  1IQD C;  3SH5 A;  5LA9 A;  5FY5 A;  3LIG A;  3AM2 A;  2QQU A;  5FFO C;  3ZXA C;  1OC1 A;  1QQP 3;  5JIU A;  2V09 A;  2ZPX A;  3M3E A;  3INA A;  4M4R A;  1O3Q A;  3VD3 A;  5EJ1 B;  1URX A;  3WNK A;  2BER A;  1LGB A;  1AR8 2;  3GJB A;  1HXS 3;  2BFU S;  2EIE A;  4M3C B;  1IG0 A;  5FZO B;  4BQX A;  1DQ4 A;  1K5M B;  2B4K A;  1W9T A;  2CU5 A;  2PMW B;  1TMF 2;  4FXG B;  3NJZ A;  1VE0 A;  1VBB 2;  1IQA A;  5GLU A;  3QLQ A;  5B2G B;  3Q8E A;  5D1I A;  2Y6H A;  3UT0 A;  5C33 A;  4R9C A;  4IEV A;  4QB1 A;  1Z7S 2;  1SQ4 A;  2DU0 A;  4DEQ A;  4EN6 B;  4LO4 B;  2VU9 A;  3AFK A;  3FJS A;  4UXA A;  4UYB A;  3CHX A;  3ECQ A;  4NRQ A;  1QOT A;  2WNO A;  2EAA A;  1JYN A;  1OKQ A;  2GNM A;  1RMU 1;  2IXI A;  2ZGR A;  3IN9 A;  4Y5Z 0;  2VBP A;  2WN3 A;  3T2T A;  3OGJ A;  4E9K A;  2FDG A;  2DVG A;  2GNB A;  3TB0 A;  2WA3 A;  2JB4 A;  4W65 A;  1SCR A;  3WW1 A;  2E53 A;  2WZR 3;  3M3I A;  2HWE 1;  4XIK A;  2JDM A;  2A6X A;  1NY7 1;  3U11 A;  4HK8 A;  3BUC A;  2ZGN A;  4XFB A;  4RGG A;  1HLC A;  2OVU A;  3CZU A;  3KVB A;  1IPK A;  3VHN A;  1OMI A;  2HWD 2;  3H8R A;  2VW1 A;  1XQN A;  4I09 A;  4Y4R A;  1JN2 P;  2E33 A;  2XML A;  2H6B A;  4Q4V 3;  1VBD 1;  4BDV B;  3I2G A;  3R0R A;  2VZP A;  4PHZ A;  4ZZ8 A;  4BCU A;  5K0U B;  1GZC A;  4P9Y A;  1IS5 A;  3LSD A;  1GLH A;  3VKO A;  3MPB A;  2WYF A;  4BU2 A;  3BTY A;  3CIH A;  1MS9 A;  5L9B A;  1H1I A;  2ZXQ A;  3UJO A;  1KFX L;  3IPV B;  3DYO A;  1BCX A;  3PLQ A;  1H9P A;  4URA A;  1QDO A;  2X29 A;  5KHJ A;  3HVD A;  1YIF A;  2YBK A;  1GWM A;  2PA7 A;  3L2H A;  4XF0 A;  4AVB A;  1A8D A;  3GBW A;  5DQ0 A;  2EXK A;  1APN A;  3T2P A;  3P5B A;  5JXJ A;  2CNA A;  2Q4S A;  3SEE A;  3I2H A;  4IV3 B;  2VMI A;  1CQ9 A;  4TLF A;  4RS5 B;  4PBO A;  1UOG A;  4UFJ A;  3ZDV A;  2ZX4 A;  1YYN A;  3ETQ A;  1M4W A;  1UXX X;  1AXK A;  3FLP A;  5I0R A;  1KDK A;  1UPS A;  5GJ6 A;  5EIY B;  5J09 A;  3LA2 A;  4YFZ A;  1W6Q A;  1DG6 A;  5DAQ A;  5JPN B;  4O61 A;  4L2N A;  4EN0 A;  2WBK A;  4YVW C;  2E6V A;  5F7U A;  2GN3 A;  4JDM A;  2EVX A;  4DFS A;  1Z7S 1;  2ORZ A;  2VZV A;  4MXW A;  3PTR B;  1LOE A;  1WCS A;  1GFF 2;  2QQW A;  4K40 A;  4AFB A;  5JOW A;  2VCM A;  2I74 A;  4HVR A;  1DZQ A;  1TEI A;  2ZGQ A;  4M3C E;  3U10 A;  3GZU C;  2F17 A;  3WQ0 A;  4NHX A;  2WQ8 A;  3FLT A;  4Y1X A;  4AI3 A;  2CDO A;  4XHB A;  4JHT A;  3ACG A;  5CAD A;  1WD3 A;  1CJP A;  2QDR A;  4JRA A;  1Q8Q A;  1QHD A;  2HWB 1;  2WWU A;  3OUI A;  5KHH A;  2HKX A;  3WP3 A;  4FSJ A;  1SDD B;  2RDR A;  4CP9 A;  1BYH A;  2A3W A;  1W39 A;  4QX5 A;  4RR3 A;  2W5F A;  3MBW A;  3N7L A;  1QNW A;  1UMZ A;  5FUP A;  1H2K A;  3ZR5 A;  1VBD 2;  3URF A;  4DUV A;  3BAL A;  3RYP A;  3UGH A;  1WW4 A;  4Y26 A;  3ZFE A;  5J3U A;  1GZW A;  2GC1 A;  2XOM A;  1WWY A;  3KCX A;  4RS5 C;  1SG3 A;  3I8T A;  4AGG A;  2BDR A;  4Q4Y 1;  1JH5 A;  2I45 A;  1V6I A;  5LA0 A;  3VBR B;  3RZL A;  1W9W A;  1K45 A;  1UZZ A;  5CG9 A;  5F2S A;  3P1I A;  3RPQ A;  2SBA A;  3OGS A;  4AE2 A;  3QCW A;  3C8X A;  4NPR A;  4YVW B;  1YFU A;  2FCV A;  3KHC A;  1A3K A;  1XRU A;  1O3S A;  4DXZ A;  5IVY A;  2XLG A;  1RMU 3;  3NJV A;  2J1R A;  2QTW B;  1OSG A;  1GOF A;  5C9A B;  5LZ6 A;  2VUL A;  4Y1Z A;  4QM8 A;  5IVE A;  2VO5 A;  1VBD 3;  2W68 A;  4FO9 A;  2D6P A;  3CF6 E;  1AXY A;  1PX3 A;  3TYJ A;  1G9F A;  3THT A;  3OGR A;  3ZFG C;  1EV1 1;  4BK5 A;  3PUS A;  5C3R A;  1WW5 A;  3B01 A;  2JKB A;  1JOJ A;  1UMI A;  1O8S A;  4XW3 A;  5EZW A;  2MEV 1;  3VBO C;  4U36 A;  4QMA A;  3EXU A;  5FKB A;  1BVV A;  1UY4 A;  5LBB A;  3H1M A;  4L9B A;  5FPL A;  5GZC A;  4XUT A;  3DYP A;  2JIC A;  2NMO A;  3WNM A;  4HG6 B;  4JCK A;  1X8M A;  2GH8 A;  1YQ8 A;  2V4A A;  4NE9 A;  5DDJ 2;  3RS6 A;  4JHZ A;  1CJD A;  1X9T A;  3PUQ A;  4UW3 A;  5A7S A;  1EYB A;  5CG8 A;  1JU4 A;  3ETP A;  5EJ3 A;  1RIN A;  4A7K A;  1C3H A;  4LOS A;  4QPG B;  2AEZ A;  4QPG A;  2GME A;  4F3J A;  4JKM A;  3T1L A;  2YV8 A;  3LDK A;  5C3S A;  1Y9M A;  2D6O X;  4OFG A;  3ME2 A;  1RUO A;  1IKQ A;  4LLO A;  5SV5 A;  3T1M A;  1ZNP A;  1MVQ A;  1BQP A;  1IPS A;  3A23 A;  4LA2 A;  4N43 B;  4ZS3 A;  5LY2 A;  5I8T A;  2D6K A;  3V0A B;  4IEZ A;  1GYK A;  3BGA A;  5T5P A;  1RUE 1;  2NPI A;  1LNS A;  3A0N A;  2RV9 A;  2UU8 A;  5F2W A;  4P08 A;  1PGW 1;  4DB5 A;  4Z2A A;  4I0A A;  4MOA A;  1Q43 A;  5KWR A;  2F4P A;  1J59 A;  4Q4W 2;  5GLV A;  1LU2 A;  1YO8 A;  5IK7 A;  2WC2 A;  5JDB A;  3O1T A;  4HON A;  1K12 A;  2YYO A;  1QGL A;  1ASJ 2;  3J7N A;  3PUH A;  4LHL A;  2WR9 A;  1QJX 1;  1MS0 A;  2RS3 1;  2WAA A;  5LA2 A;  4F7Z A;  1D7P M;  1ZBE 3;  4BMB A;  1HKD A;  1B35 A;  1OXC A;  3JZV A;  3KT1 A;  4CU6 A;  3TN9 1;  4E4H A;  3MHZ A;  4IDZ A;  1AYN 1;  1COV 2;  3OBA A;  4DXS A;  4HET A;  3L9J T;  2DBN A;  4RQP A;  5FZ0 A;  3BTZ A;  1JXN A;  1JUH A;  2DVD A;  4HXC A;  5EYY A;  1BVP 1;  5GKA C;  2YBP A;  4UBG A;  1HJG A;  4R52 A;  3CLP A;  1EAH 2;  3FMG A;  1WLD A;  3FWE A;  1DLL A;  2RHP A;  1UYY A;  3DCQ A;  4OI2 A;  1SBF A;  4LIV A;  4X6R B;  2ZEW A;  1U5Y A;  3HD8 B;  4ZU7 A;  3O0W A;  4Q0V A;  2WSV A;  3B02 A;  4Q0P A;  2DTW A;  2H0B A;  1OLM E;  4AED C;  5AFB A;  1D4V B;  1PMI A;  4P9I A;  5KC5 A;  1W2O A;  4PLO A;  5SV8 A;  2YBS A;  2XB6 C;  4FPH A;  3AYC A;  4PJY A;  1UN1 A;  2BOI A;  4H7L A;  3TEZ A;  1WCU A;  2DVF A;  1OF4 A;  4D6R A;  1IPJ A;  3WHT A;  5DPN A;  5FYS A;  3BU7 A;  5JVV A;  3RG0 A;  1A8M A;  5C70 A;  1RGS A;  2VBD A;  1EPW A;  4QKD A;  2QQV A;  2G4I A;  1W2T A;  2RS3 2;  4LO7 A;  5F5Q A;  1DGR N;  4ASL A;  3VD7 A;  2JDA A;  3C7H A;  5A70 A;  3VDD A;  3C2U A;  2OT7 A;  1HB3 A;  2F6B A;  3ELN A;  4TWT A;  3W20 A;  3PTY A;  3B9I A;  2YC2 A;  3ES1 A;  2XBO 3;  5JOX A;  4CVU A;  2VNR A;  3ZFF B;  2Y38 A;  3J8F 1;  3QH6 A;  5J36 A;  3NKT A;  2QNK A;  1N47 A;  3N3H A;  4RQP C;  5FP9 A;  4D69 A;  2PQQ A;  4EE2 A;  5CAZ A;  5HCA A;  3RZJ A;  1NA1 A;  1QMJ A;  4LUL A;  3UYJ A;  4DXR A;  5A1L A;  3N9Q A;  2BWA A;  3HBZ A;  3ILR A;  4NAM A;  2YXS A;  2VTX A;  3TAY A;  4AQ2 A;  4L11 A;  3JD7 3;  3I2D A;  4ERO A;  4QAW A;  4NJ4 A;  4V1P A;  1W6P B;  5LBC A;  3OY8 B;  1U5X A;  2C9K A;  3AMH A;  1DCS A;  2P4E A;  4GWJ A;  4LOR A;  4JAA A;  1DQ1 A;  4CCN A;  5C6C A;  5LK7 B;  4LUM A;  1JYV A;  1OA4 A;  4Q1R A;  4FPE A;  1R08 3;  4N9H A;  3UKN A;  1I5Z A;  5FPA A;  4LHS A;  1UL9 A;  2Q8D A;  1YNA A;  2ZGO A;  4EZH A;  1VRH 3;  1ZZB A;  2XL7 A;  4XUO A;  1FNY A;  1ND3 B;  2RJL A;  2TBV A;  1QXP A;  2NYY A;  5C7G A;  4K6B A;  3NV4 A;  5ANN A;  4DIN B;  3WF0 A;  4KL1 A;  5F39 A;  3WDT A;  5FXV A;  5IK8 A;  3R05 A;  4AED B;  4AI1 A;  3V0B B;  1E5S A;  3KMH A;  3POF A;  3JBG 1;  4YG6 A;  2JEN A;  2BEO A;  4MZU A;  3AKT A;  3DPR B;  5A7Q A;  1VBE 1;  2VUJ A;  4XHX A;  3B7M A;  5IVJ A;  4HKL A;  1FT9 A;  3ZMN A;  1ZBE 1;  2R06 1;  1HV0 A;  3M2M A;  4CE8 A;  1VAK A;  1RJ7 A;  2XR4 A;  2IZW A;  4OZO A;  3RJR A;  1MEC 2;  1QXR A;  1UZW A;  3WY6 A;  4E27 A;  2XXZ A;  2BVB A;  4M3C A;  5FOJ B;  5J96 B;  2WSU A;  4QQH A;  2WZE A;  1GQH A;  1AF9 A;  3AZW A;  1JUI A;  3T2Q A;  3ACH A;  4GH4 C;  3OBT A;  1TME 1;  3WT3 A;  4BLI A;  3OY8 A;  2B7Y A;  5GZG A;  3LEK A;  1RUE 3;  5A7P A;  4F8A A;  3M1H A;  1DYO A;  1R09 3;  2C4X A;  3E5Q A;  4E4D X;  4I30 A;  4AW7 A;  2PHU A;  2A3Y A;  2QCS B;  5H9R A;  4LE4 A;  2JDK A;  4S2H A;  5J1X A;  3S7I A;  2RS1 3;  1W6M A;  4JX0 A;  2VUC A;  3QBQ A;  3GJA A;  1X82 A;  4JDN A;  4FQ4 A;  1HRV 2;  5FMB A;  1O6U A;  4BQ3 A;  2UUR A;  3LQC A;  4K7J A;  1I9R A;  1PGW 2;  4M4P A;  5JXG A;  1YC6 1;  3KZ4 C;  1IGO A;  1RUH 3;  2IXK A;  2VOW A;  4MGQ A;  4NMI A;  1QJF A;  4FP2 A;  4CDX A;  5FZB A;  4QD2 A;  5F6K A;  1DGR A;  5JZG A;  4IE5 A;  1POV 3;  3WUC A;  2R1D A;  1WMX A;  4LE3 A;  3POS A;  4N8M A;  1HV1 A;  2W94 A;  3LD8 A;  4MH0 E;  1RUI 3;  4R4X A;  2W2I A;  4CA9 A;  4XJZ A;  3U1X A;  1DF0 A;  4AQS A;  4YGC A;  5FUI A;  3E6D A;  4IEQ A;  5FZF A;  2D43 A;  3OBR A;  4JKL A;  4GH4 A;  4IQP A;  4NIH A;  2ZZQ A;  2RMU 3;  3IZO A;  1UXZ A;  1HW5 A;  1PMJ X;  2A75 A;  2D3S A;  2YHJ A;  3I59 B;  4LO5 B;  4R4Z A;  3IBM A;  4LBQ D;  3S7E A;  2JEC A;  4MUV A;  1LOD A;  2IWG B;  1GQP A;  1FXZ A;  1W9F A;  2WO3 A;  3I3Q A;  4BYY A;  2EIG A;  1PK6 A;  3QD6 A;  5DAB A;  5BNP B;  4QDS A;  4J6G A;  2OX0 A;  1OI6 A;  2PHR A;  1VMH A;  1YUD A;  4LKD A;  3BCW A;  2VD7 A;  1WCD J;  2FMD A;  3VB9 A;  3A21 A;  3UET A;  2G9G A;  2J1V A;  3H1Y A;  3MW3 A;  3NO8 A;  4OUS A;  3ZXK A;  2B46 X;  4BJ0 A;  4CDX C;  2NP0 A;  2W39 A;  1H8T A;  5T50 A;  3VBF A;  1YEW A;  4XDO A;  1UY3 A;  1ZZ6 A;  3AKP A;  2HWD 3;  3O7O A;  1H6Y A;  2VL4 A;  2Z42 A;  4H2A A;  4PF1 A;  5CKN A;  1DDL A;  4M0H A;  4XFI A;  1RUG 3;  4CP0 A;  4QX0 A;  1BMV 1;  2MHF A;  5BPX A;  4BA6 A;  3HJR A;  1BLZ A;  1U0A A;  5EWS A;  1QU0 A;  3ZR6 A;  1OPO A;  4IV1 C;  4KI5 M;  3V65 A;  3KD4 A;  5A3N A;  3U0Z A;  4D6S A;  2Z4F A;  1CZV A;  4RA0 A;  2TEP A;  4C8D A;  1ZM1 A;  4N7U A;  4AVS A;  4QPW A;  2CGP A;  1W05 A;  3E97 A;  1ENQ A;  1QDC A;  1JYC A;  5FK7 A;  1K42 A;  3GBG A;  1WBL A;  2EF6 A;  1CD3 G;  4MET A;  4K1Z A;  1T6B X;  2VM9 A;  2ZMN A;  3NV1 A;  4I0W B;  1VRB A;  4LBQ A;  1PK6 C;  4LBQ B;  3I2I A;  3SH4 A;  3MIE A;  4XJU A;  3N9P A;  5BNO B;  1W2U A;  4A41 A;  1VBB 1;  1P8J A;  3HWJ A;  4PDW A;  2D97 A;  2WNU A;  1OKO A;  1N3Q A;  1OOP C;  2Y64 A;  4BIS A;  1R64 A;  5A7W B;  4Z8B A;  4JC1 A;  4KMQ A;  4WVZ A;  2GC0 A;  3AP4 A;  2YB7 A;  1NLR A;  2VXJ A;  5FLI A;  5IFP A;  4IE6 A;  1QQP 2;  1DU3 D;  3ZVX A;  4COY A;  4IER A;  2DDU A;  1NZC A;  4NRP A;  1RUD 2;  3MF9 A;  3DPR A;  2E51 A;  1ZBE 2;  1S0D A;  4ISR A;  1YQ2 A;  4LK7 A;  3TRS B;  1GV9 A;  2CAU A;  4XFC A;  3DL3 A;  2ZA9 A;  3C7O A;  2XH6 A;  3ZKU A;  4P5H A;  2Q1M A;  5EV7 A;  4YW3 A;  3UKT A;  4RSU A;  5F3I A;  3WNX A;  4OI4 A;  5I0T A;  4TTG A;  2ZAH A;  3ZYP A;  2XVK A;  5D8A B;  2RJ2 A;  5E89 A;  4Y20 A;  5CU1 A;  3MW4 A;  4AK3 A;  4ZU4 A;  1SHW B;  5I8Y A;  3JQW A;  4FBF A;  2YC4 A;  5DN2 A;  1GZT A;  2BW8 A;  5T5O A;  2WWJ A;  4LBL A;  4PIZ A;  4A7Y A;  1SPP A;  2GMM A;  2AH2 A;  2WT1 A;  1AX0 A;  3Q8C A;  2W9X A;  4X8N A;  1ULG A;  2SLI A;  3O0V A;  3B93 A;  4LKE A;  1PO2 2;  1SZB A;  2WNU C;  4UF0 B;  2ZX3 A;  1QH6 A;  4ES9 A;  2LS6 A;  4GJY A;  1AX2 A;  2DF7 A;  2VQ0 A;  5FZ6 A;  5EXO A;  2JIJ A;  4OZX A;  3ALQ A;  3VD5 A;  1T6G C;  1UPI A;  2VZS A;  1ZZ9 A;  3HT2 A;  4CCJ A;  3K4Z A;  1LHV A;  1PVC 2;  2IVI B;  2QQJ A;  3VBS B;  4NID A;  3RVH A;  5DDJ 3;  1XBF A;  5FPV A;  5F5C A;  1DGL A;  1AYM 2;  3WZ1 A;  2WJS A;  3ZYH A;  4C0B A;  4RQP B;  2E31 A;  1UZV A;  2P3I A;  4HPK A;  4BIF A;  3KM5 A;  2XJT A;  4XTM A;  2VVF A;  4ZS2 A;  2X05 A;  1Y9G A;  3RZH A;  3R6S A;  4Q8K A;  4CDQ C;  4AXO A;  1ZA7 A;  1RYY A;  4S2D A;  5FUN A;  2VZO A;  4TYS A;  1QJU 3;  2QQI A;  1HQL A;  3H3U A;  5FZL A;  3N9L A;  4RR3 C;  4DRV A;  3O1S A;  3OGV A;  3VBH A;  1JS9 A;  1S4C A;  2WNE A;  1RHI 3;  4HSL A;  3VV1 A;  1AR6 2;  3PU8 A;  2J1U A;  1XC6 A;  2W1Q A;  4CPB D;  2DYC A;  3OJB A;  4Z07 A;  4BZ4 A;  2P5B A;  1V6K A;  2C9A A;  4MO3 M;  2EIB A;  5CYY A;  4I3G A;  4H7M A;  5FZG A;  4RS5 A;  1MEC 3;  3H42 B;  1DIW A;  3LSE A;  5IHR A;  4A6S A;  2KM2 A;  4MGT A;  4XBN A;  4Q29 A;  4Q4Y 3;  3EJK A;  1JW6 A;  2O0O A;  1FV3 A;  2HWF 1;  2HWE 2;  3GYD A;  5D2A A;  2VZT A;  3NNL A;  5FO9 B;  1PVC 1;  1CIY A;  3RWK X;  3AVR A;  2YPJ A;  4NN0 A;  1OF3 A;  2ZHN A;  3VDD B;  3ZXD A;  3O1P A;  4W8J A;  2XLA A;  2L9L A;  4RGK A;  1KFU L;  2HEW F;  2XBO 1;  1Z0H A;  2VZQ A;  2Y60 A;  4XQD A;  1US3 A;  4FOQ A;  1LED A;  5GM0 A;  5BNO C;  4FTS A;  1RXF A;  2WDB A;  4AWD A;  4ISQ A;  1FPN 2;  4QU2 A;  3H8X A;  5FZM A;  5JCT A;  3VZL A;  3FUO A;  1GMM A;  2E32 A;  5A1A A;  3S0M A;  3B5L B;  3THC A;  1LOF A;  2OQ7 A;  3ACL A;  2C0Z A;  3CZJ A;  3HNM A;  4XXA A;  2WKK A;  3AJZ A;  4XZP A;  1UQX A;  4JTO A;  3NST A;  1Q8O A;  4WVM B;  3WDY A;  3M3Q A;  1AR6 1;  5IUQ A;  4YWA A;  5BUV A;  1DQ2 A;  4CEY A;  4UWD A;  1HDK A;  1ULD A;  4IEX A;  1D0H A;  2A73 B;  2PYT A;  2PAM A;  2XUE A;  4LHN A;  5FP7 A;  4D6Q A;  1WMF A;  3PVO A;  1H4H A;  4Q8L A;  1UU4 A;  5JOZ A;  3OUH A;  4JGY A;  5A80 A;  1C5H A;  2YUE A;  1G9A A;  1WLT A;  4GZ9 A;  3WQB A;  3M3O A;  4ZZ5 A;  1J3P A;  3PUI A;  1QNY A;  5C8W A;  3MV1 1;  4UI9 L;  2FDK A;  2B5H A;  1LR5 A;  3NNM A;  5DAP A;  3BIW E;  4QGL A;  3ZPY A;  1AZD A;  1KEX A;  1XE0 A;  2ZKL A;  1UWW A;  4Z92 B;  4FPL A;  4CP1 A; 
#chains in the Genus database with same CATH homology
 1XNA A;  2XQX A;  4DUV A;  4XUQ A;  5B4N A;  3HPN A;  2DCK A;  2QQN A;  2XOM A;  3U37 A;  1SG3 A;  1JZ4 A;  2JKX A;  2RVA A;  5LA0 A;  1W9W A;  1K45 A;  3GXU A;  3IAP A;  3P1I A;  3OGS A;  3C8X A;  3FN9 A;  3K75 B;  2J1S A;  3NJV A;  2J1R A;  2VZU A;  2YG0 A;  2V5D A;  1GOF A;  4P02 B;  4LQR A;  3T0D A;  2VO5 A;  3AC0 A;  3HNB M;  1PX3 A;  1EUT A;  3OGR A;  4P5Y A;  4BK5 A;  1L7R A;  2W87 A;  3HEI A;  1UMI A;  1O8S A;  2VJX A;  3VDC A;  3NJX A;  2VME A;  2WUH A;  3UNP A;  1UY4 A;  4MGS A;  4QB6 A;  4A6O A;  4XUT A;  3DYP A;  1OT5 A;  3WNM A;  4HG6 B;  4JHZ A;  1JU4 A;  3ETP A;  3FHA A;  4ZY9 A;  4CU8 A;  4JKM A;  2KD7 A;  1UY2 A;  2VCB A;  3A23 A;  1WKY A;  2W92 A;  3W5N A;  4CUC A;  4W50 A;  3BGA A;  3WNP A;  2Y6L A;  2X09 A;  3MO4 A;  3WF4 A;  3LEI A;  1LNS A;  2RV9 A;  1L7Q A;  3EYP A;  2V4V A;  4XUN A;  4P08 A;  4Z2A A;  4MOA A;  3NNG A;  3OB8 A;  3UES A;  2Y6J A;  1K12 A;  3PUH A;  1UYX A;  5JXH A;  1UY0 A;  5LA2 A;  2WAA A;  2W91 A;  1JZ6 A;  1D7P M;  2HLE A;  4ARX A;  1W8O A;  2J22 A;  4CU6 A;  3I3B A;  3OBA A;  4DXS A;  3A22 A;  3MUZ 1;  5JXI A;  5DMY A;  2W46 A;  2EID A;  2DCJ A;  3ABZ A;  1NUK A;  1UYY A;  1PMH X;  2JD9 A;  2ZEW A;  5CZK A;  3I2J A;  4JKK A;  3ZM8 A;  1J84 A;  1DLC A;  1JZ5 A;  2Y8K A;  3HOB A;  4RYD A;  5HXM A;  1OF4 A;  1F4A A;  5DPN A;  4A42 A;  1DP0 A;  2X10 A;  4DXT A;  2OKX A;  4UAP A;  4DUW A;  5C70 A;  4GWI A;  1GUI A;  3VD7 A;  2JDA A;  3C7H A;  4D8M A;  3WEZ A;  2W95 A;  1TG7 A;  4IUG A;  2YC2 A;  2V72 A;  4CVU A;  3WNO A;  1ULP A;  3LPG A;  1EUU A;  4QX3 A;  2ID4 A;  1JU3 A;  4DXR A;  2VCC A;  3WNN A;  2VZ1 A;  3I2F A;  4CUB A;  2QQO A;  2W1S A;  2W47 A;  4QAW A;  1JYW A;  2J1T A;  3IB3 A;  5EJZ B;  2C9K A;  4GWJ A;  3I97 A;  1HN1 A;  1JYV A;  3ACF A;  1UYZ A;  3K46 A;  2BGO A;  4LHS A;  3WF1 A;  2XON A;  1JZ7 A;  4OMD A;  1UWW A;  4KWU A;  3K4D A;  2WAO A;  4XUO A;  5C7G A;  3T2O A;  1O59 A;  3WF0 A;  2BGP A;  4P00 B;  4QB2 A;  3FL7 A;  3I2K A;  2LW8 A;  4BK4 A;  3C7E A;  2VOT A;  1KGY A;  5LCW L;  4W4Z A;  1OD3 A;  3K77 A;  4FI9 A;  2WZ8 A;  3MV0 1;  1O8P A;  1UMH A;  2C26 A;  3III A;  4LKS A;  4A45 A;  3A7Q A;  2ORX A;  5IYY A;  4OZO A;  3HNY M;  2VZR A;  4CUA A;  2WZE A;  2ZEZ A;  3T2Q A;  3ACH A;  3HN3 A;  5JMO A;  4QX1 A;  3LEK A;  1W8N A;  4UOJ A;  1DYO A;  1TVG A;  2C4X A;  4A4A A;  2WN2 A;  2PQS A;  5J1X A;  4JX0 A;  3DYM A;  4PT6 A;  3IDA A;  4DEV A;  3T09 A;  3LQC A;  1I5P A;  4M4P A;  5JXG A;  3J7H A;  3OEB A;  3LPF A;  3T0B A;  2VMF A;  4MGQ A;  2BBA A;  3IAQ A;  1K3I A;  3THD A;  4QDR A;  5B4X A;  2VZ3 A;  1JYX A;  2W94 A;  2J7M A;  2J1E A;  3MUY 1;  5C71 A;  5FUI A;  1UY1 A;  4D0Q A;  1W0N A;  4JKL A;  2W3J A;  4RN5 A;  4OUE A;  5IFT A;  5LA1 A;  1UXZ A;  1PMJ X;  4XUP A;  3WF3 A;  2YFU A;  1UX7 A;  1GQP A;  2WO1 A;  2WO3 A;  1JZ3 A;  3OEA A;  4QDS A;  3I3E A;  4LPL A;  1F4H A;  4BXS V;  3SKJ E;  3K4A A;  3A21 A;  3UET A;  5I0D A;  3DEC A;  4XUR A;  2J1V A;  5G04 L;  4YPJ A;  4BJ0 A;  2QQL A;  3SEP A;  2VC9 A;  1CZS A;  1UY3 A;  1H6Y A;  2VL4 A;  4PF1 A;  3GDB A;  4CU7 A;  3WSO A;  3C7F A;  4QX0 A;  3CMG A;  3HJR A;  5IFP A;  4KI5 M;  5IJR A;  1GOG A;  2ZEY A;  2Z4F A;  1CZV A;  2WO2 A;  1J83 A;  4QPW A;  3VD4 A;  1H6X A;  1K42 A;  3VDB A;  2WYS A;  1W9S A;  3CQO A;  3LEG A;  1GU3 A;  3VD9 A;  1US2 A;  1WCQ A;  2VR4 A;  2ZEX A;  2VM9 A;  2VTF A;  1CX1 A;  2QQM A;  3I2I A;  2VQT A;  2E26 A;  4A41 A;  1P8J A;  2VMC A;  2WAB A;  4XVH A;  2W1U A;  3OG2 A;  2Y64 A;  5JUV A;  3WF2 A;  1OH4 A;  1R64 A;  4A44 A;  4XZU G;  2EIC A;  4KMQ A;  2YB7 A;  4ARY A;  2JE8 A;  3ACI A;  5JR2 A;  2QBX A;  1XNT A;  1UZ0 A;  3NQH A;  1NKG A;  4AAX A;  2DDU A;  4OMC A;  1IQD C;  4CU9 A;  3P6B A;  1YQ2 A;  3CKH A;  1BHG A;  3C7O A;  2HYX A;  4M4R A;  3VD3 A;  2R7E B;  2BZD A;  5EJ1 B;  3WNK A;  2BER A;  4TTG A;  1NAE A;  2EIE A;  2RJ2 A;  1T2X A;  1W9T A;  2B4K A;  1JI6 A;  1SHW B;  1ULO A;  1MPX A;  2YC4 A;  5DN2 A;  2Y6H A;  2W9X A;  4PQQ A;  2VMD A;  4QB1 A;  4DEQ A;  2VCA A;  2J1A A;  2LS6 A;  2VQU A;  3ECQ A;  1JYN A;  3VD5 A;  4MAD A;  2VZS A;  4DUX A;  3K4Z A;  2QQJ A;  2WN3 A;  3CDZ B;  4OYU A;  2E31 A;  2CDP A;  3I3D A;  2X05 A;  1GNY A;  3CZU A;  1JZ8 A;  1PX4 A;  1RYY A;  2E33 A;  2YFZ A;  4QX2 A;  2VZO A;  2QQI A;  4BDV B;  3I2G A;  2VZP A;  4ZZ8 A;  3OGV A;  4E8D A;  1JHJ A;  3D3A A;  2J1U A;  1XC6 A;  2W1Q A;  4MO3 M;  5CYY A;  2EIB A;  3CIH A;  3FHQ A;  1GOH A;  2ZXQ A;  3DYO A;  4AG4 A;  5IHR A;  2Y6K A;  3EB7 A;  2B9V A;  3GGL A;  5DQ0 A;  3T2P A;  2VZT A;  3T08 A;  2Y6G A;  5JXJ A;  3W5M A;  1CIY A;  3SEE A;  3T0A A;  1OF3 A;  3I2H A;  4W8J A;  2L9L A;  1JZ2 A;  2VZQ A;  1US3 A;  2WDB A;  3F2Z A;  1UXX X;  3C7G A;  3BN6 A;  5EIY B;  1GMM A;  2E32 A;  5A1A A;  3THC A;  4A3Z A;  2WBK A;  3CZJ A;  3HNM A;  5F7U A;  1NX9 A;  3LE0 A;  2ORZ A;  2VZV A;  4TXW A;  4ZXE A;  5G05 L;  3GM8 A;  1CZT A;  2W1W A;  3NRU A;  2WQ8 A;  2CDO A;  5HPO A;  3ACG A;  4E8C A;  4GZ9 A;  2QQK A;  3WQB A;  4ZZ5 A;  1XPW A;  4ET7 A;  3PUI A;  3WNL A;  3E1F 1;  3VDA A;  4L0P A;  3MV1 1;  1SDD B;  3SKV A;  4UI9 L;  1W99 A;  2W5F A;  3MBW A;  1KEX A;  3JXS A;  2XHN A;  4QDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...