1O8PA

Unbound structure of cscbm6-3 from clostridium stercorarium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
PVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATUVE ENDO-XYLANASE
publication title Structure and ligand binding of carbohydrate-binding module CsCBM6-3 reveals similarities with fucose-specific lectins and "galactose-binding" domains.
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Hydrolase
total genus 30
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1o8pA00
2VJXA 4E8DA 5G05L 1O8SA 2VCCA 3LEIA 1UZ0A 3LE0A 2ID4A 4A42A 4TTGA 2ZXQA 3OBAA 4L0PA 2RVAA 2PQSA 4CUCA 1SG3A 1R64A 2J1TA 1W9WA 4CU8A 2Z4FA 3VD9A 1CX1A 2VZSA 4LHSA 4M4PA 3THDA 1NAEA 1JYXA 2X09A 1F4HA 4P08A 1JZ5A 2WBKA 3LPFA 3I3EA 4ZZ8A 3ABZA 1D7PM 3HEIA 1US2A 3HN3A 2ZEYA 3PUHA 2E26A 2VCBA 2QBXA 4BDVB 3SKJE 1XNAA 2VQTA 3K46A 3THCA 1JI6A 2WQ8A 3HOBA 1K12A 2B4KA 2W1SA 2V4VA 2ZEWA 4UAPA 3FHQA 3FHAA 4FI9A 4QX0A 2X10A 2Y6KA 1GMMA 2HLEA 3CKHA 3WF1A 2Y64A 4CU7A 4LQRA 3VD3A 5DQ0A 1PMJX 2J1UA 2QQLA 1K45A 2W95A 2X05A 4BK4A 1CZSA 5CZKA 3J7HA 1H6YA 3OG2A 4XUPA 3MBWA 4A41A 3OGRA 1KGYA 4ARXA 5LA0A 3WNOA 2W47A 5CYYA 4BK5A 4ZZ5A 2VCAA 4CU6A 3VDAA 1OF3A 2RJ2A 1UX7A 1PMHX 1DP0A 4RN5A 2WABA 2VC9A 4QPWA 1J83A 3OGSA 4QB6A 4A6OA 3GDBA 2VZTA 2VMDA 1H6XA 1UY1A 2DDUA 1OF4A 2E32A 1JZ6A 2BGPA 3I2HA 3D3AA 4IUGA 3HNYM 1UY2A 3SKVA 2ORXA 3DYOA 3LPGA 4XVHA 4JKKA 2VR4A 4QX3A 2Y6JA 4DUXA 3WSOA 3DYPA 3T2QA 4BXSV 1GOHA 1KEXA 3NJXA 2VTFA 1TG7A 4MO3M 3I2IA 3T0BA 4DXSA 2Y6LA 5C7GA 2W1UA 1UYXA 3OEBA 1GNYA 4AG4A 2C9KA 4GZ9A 2WAAA 1JZ2A 3WQBA 4QX1A 3AC0A 3K75B 4OZOA 1L7QA 5J1XA 1UYYA 5DN2A 4CUAA 1CZTA 4JX0A 2XHNA 1T2XA 1TVGA 2QQIA 3MO4A 3EYPA 4P02B 3ECQA 4OUEA 3WNNA 4BJ0A 1DYOA 1UMIA 5EJ1B 3I3DA 2HYXA 1EUUA 3A7QA 1W8OA 3ZM8A 2VZOA 3WEZA 4DUWA 5IFPA 4CU9A 4D0QA 3MV01 2W5FA 4QDQA 4GWJA 2W87A 1DLCA 3F2ZA 2XQXA 5IYYA 2VZVA 1JHJA 2EIDA 3C8XA 1HN1A 2VOTA 1K3IA 2VZ3A 5IJRA 3SEPA 4OYUA 2LS6A 2J1VA 4LKSA 5IFTA 3T0DA 3LEKA 3P1IA 3VD5A 1W9SA 5F7UA 2W92A 2QQJA 1JU3A 3IDAA 2V5DA 3IAPA 4UI9L 1UMHA 4OMDA 4XUNA 2VMFA 5I0DA 4QB2A 2WUHA 3ACIA 2J22A 4DEQA 5G04L 1K42A 4A3ZA 3W5MA 2ZEZA 3I2KA 2CDOA 2C26A 3UNPA 3CZJA 2R7EB 3K4ZA 4QB1A 2WO2A 2DCKA 4W8JA 2CDPA 1O59A 2VL4A 2Y6GA 1NUKA 2W9XA 2YFUA 4P00B 2XONA 2QQNA 3C7OA 5DPNA 1JU4A 1NX9A 3DECA 4W50A 3A23A 3BN6A 1MPXA 2J1EA 2VO5A 3MUZ1 4GWIA 3WF2A 5A1AA 1CIYA 5JMOA 5IHRA 5LCWL 1UXXX 2JDAA 4KWUA 1F4AA 4LPLA 4MOAA 2W91A 3WF4A 1I5PA 3HPNA 4A45A 1JYNA 3IB3A 3CMGA 3BGAA 1PX4A 3I2GA 2W46A 3GGLA 3WNPA 4ZY9A 1JZ8A 3T0AA 2WO3A 3U37A 1GOFA 4UOJA 2JKXA 3IAQA 1WCQA 3NRUA 3C7EA 2W3JA 3WNMA 4D8MA 4QDRA 2J1RA 4KI5M 3OB8A 1UY3A 1W8NA 2C4XA 3NQHA 3T2OA 4RYDA 3SEEA 1UYZA 1JZ3A 2WAOA 2YG0A 2EIEA 1O8PA 3ACHA 1YQ2A 5LA1A 2XOMA 2VMCA 2V72A 1GOGA 2OKXA 3ACGA 5HPOA 1P8JA 3DYMA 3P6BA 2W1WA 2L9LA 3T2PA 2YFZA 5C71A 1ULOA 3NNGA 2VZRA 3OGVA 4HG6B 4QDSA 1SDDB 3JXSA 3CZUA 3HNMA 4P5YA 2DCJA 2VZUA 2WZ8A 5EJZB 2QQKA 3I3BA 3HNBM 4W4ZA 2KD7A 2VZ1A 2EICA 2VZQA 4XUTA 4A44A 2E33A 2BERA 5B4XA 3C7FA 1XNTA 3CIHA 1UXZA 5EIYB 3K4AA 3OEAA 2B9VA 4MGSA 3ETPA 4Z2AA 5C70A 2QQOA 4OMCA 1SHWB 3VDCA 4ET7A 3T09A 1UY4A 2LW8A 5JXGA 1OT5A 4KMQA 3I2JA 1EUTA 3CDZB 3VD7A 2WN2A 3W5NA 5HXMA 1XPWA 2W1QA 4XURA 3WF0A 1GQPA 3FL7A 3I97A 4DXRA 5B4NA 1LNSA 2YC2A 5FUIA 1BHGA 2BZDA 4CUBA 3I2FA 3C7GA 4JKLA 1WKYA 4CVUA 1W9TA 3UESA 2WYSA 4DXTA 1W0NA 3GXUA 4XUQA 3GM8A 2Y8KA 3VDBA 2ZEXA 4JKMA 1JYVA 5JXHA 2EIBA 2JD9A 3K77A 4MGQA 1IQDC 1GU3A 2BGOA 2J1AA 2YC4A 5JR2A 3K4DA 2WN3A 1RYYA 5DMYA 1W99A 3WF3A 1J84A 3ACFA 5JXJA 5LA2A 4TXWA 1OH4A 1PX3A 1ULPA 3VD4A 2VQUA 4DUVA 3HJRA 2BBAA 2E31A 2QQMA 4XUOA 3NJVA 3LEGA 3A21A 4PF1A 3E1F1 2J1SA 2WDBA 1NKGA 1XC6A 3IIIA 2JE8A 3MUY1 4PT6A 4ZXEA 4PQQA 2WZEA 1JZ7A 4QAWA 2J7MA 1UY0A 3UETA 4YPJA 1JZ4A 3WNKA 3FN9A 4AAXA 3MV11 2Y6HA 3WNLA 1UWWA 1OD3A 5JUVA 2W94A 4A4AA 2VM9A 3LQCA 5JXIA 4MADA 3C7HA 3EB7A 3CQOA 4JHZA 3A22A 1L7RA 1JYWA 3T08A 1US3A 2RV9A 1CZVA 4QX2A 2ORZA 3PUIA 2WO1A 2VMEA 2YB7A 4ARYA 4XZUG 4DEVA 4E8CA 1GUIA 4M4RA 2VZPA
chains in the Genus database with same CATH superfamily
5K0UA 5A3OA 4DRRA 2VBBA 4EWEA 1LTEA 1BEV1 1VMJA 4U36A 1LGBA 1SBDA 5KXCA 1UZ0A 2JG8B 1TME1 2PTMA 1SLLA 2V73A 4D6RA 4A42A 4TTGA 1VBD3 2XBO3 4CE8A 4ZONA 3WDWA 4CUCA 1DQ0A 2WA4A 3WHUA 4QQHA 1W9WA 4Z82A 2XLGA 1UL9A 4M01A 1KFUL 1TMF2 3U78A 3VZMA 4NVPA 4CDQC 4Z1VA 1CX1A 3RI9A 5TSWA 2W68A 1RUF3 4B4RA 4FTEA 5GLUA 4AHZA 3O0VA 4FFIA 4CCOA 2G4IA 4H3WA 3NJZA 4GJZA 4EN8B 5DAQA 5DUVA 3TBDA 1UZZA 5GM0A 1OA2A 1VBE2 4RFRB 4Q1RA 4UF0B 4XF0A 2UWBA 5FYVA 1XNKA 2G19A 4P9IA 4QX5A 2JX9A 4ZZ8A 2EXHA 1QJEA 1RVF2 3LIGA 1AJOA 1VRH2 4AQ2A 4NPLA 3O1SA 2VOXA 2X5IB 2ZEYA 2VXRA 4FVVA 5KXDA 2A1XA 2VCBA 2QBXA 3SKJE 1VBD1 2XBO1 4OFGA 3K46A 5EWSA 3THCA 1JI6A 1QNYA 5A80A 2HBUA 1AX2A 2O0OA 1K12A 5C6CA 2W1SA 4CUGA 1T6BX 1JOPA 2AC1A 4RSUA 4CDUC 3N9QA 1CX4A 4YLZA 5FP4A 4B1MA 4JTOA 1RUF1 2BUKA 3VL8A 1RMU1 2Y64A 2D44A 3AMQA 5IVCA 2WYFA 4LQRA 5LBEA 4BE3A 3SCGA 5DQ0A 1PVC2 1ODNA 2ARCA 3RG0A 2WNUA 1DGWA 5FZGA 4UFMA 5E16A 3WT3A 4EJRA 1KQRA 2NQYA 1BEV2 2XLFA 4XUPA 4HK8A 5A7NA 3M1HA 4FFFA 2R043 4PLMA 4A41A 5C3RA 1TME2 1DIWA 1FV2A 2WKKA 2XMLA 3WOGA 2A6YA 3ILFA 4Q8KA 4Q2FA 2VCAA 5CIRA 2ZMLA 3POWA 2K46A 1WCDJ 5CG8A 1OHFA 4CDWB 2D6NA 2P6CA 5JLVA 3OJBA 5FY1A 2PLV2 4KH9A 4B7KA 2PHRA 4QHOA 5BV6A 2ZKNA 4NO4A 2KM2A 4Y22B 2VC9A 2EAKA 2ZGSA 3F95A 1J83A 2GC2A 4RS5B 5FWEA 1XBFA 1H4GA 1U12A 1H6XA 1JYCA 1QMJA 4JGZA 3KT7A 4RQPC 1WW4A 3SQOA 2DDUA 1OF4A 1U5XA 5CFCC 1QHDA 1ZBE1 3N9LA 3D3AA 4IUGA 3B69A 3ZX7A 1UY2A 2R041 5FZ0A 3T3YA 2ORXA 3DYOA 4AI8A 2JB4A 4Q26A 4N43B 5C9AA 2XBO2 1VB2A 1S2EA 4Q0PA 4AEJA 4UT5A 2C0ZA 3W59A 5FBJA 2CNAA 4AVCA 4NWWA 1OFSA 4K21A 3ME2A 4GWNA 5BNPB 4IW3A 4CEYC 3T0BA 3USUA 3DV8A 4HLTA 4NPMA 2VVEA 3O1MA 1CVNA 1GKBA 2BOIA 3CBNA 4AHYA 1RUE3 4WBBA 4Y33A 2WWUA 5L73A 4Y3OA 1RMU2 3ZXDA 4AG4A 2JE7A 4I09A 5CKQA 4TN7A 3M2MA 1ZNPA 4QX1A 3KQ4B 3L2YA 4HVQA 1VJ2A 3RWKX 4CUAA 1QEXA 5FZBA 2JJ6A 1W2TA 2B5HA 1F5JA 2QQIA 2VOKA 3EYPA 2ZABA 1VBC1 3WR0A 1UMIA 4IGOA 4BJ0A 5FR3A 2HYXA 5K7PA 2VU9A 1UU6A 3ZM8A 4K6BA 3B00A 1NLRA 5E6HA 3N7KA 1N1VA 3PIGA 3H1MA 4ORFA 1V6JA 4XBQA 4BZ4A 2XLAA 4GWJA 3DGTA 4BA6A 3ES4A 4I0WB 3B9IA 3TEWA 4LO5B 3OOXA 3C8XA 4QPIC 5FXVA 5CAZA 3VHRA 1HN1A 5A3PA 1RUE1 3S30A 4M0HA 4HKOA 4HXCA 5ANQA 2V4AA 3ZFEC 1NOVA 3I7DA 1VBB3 1WW6A 5ABJA 1DGLA 3WDTA 1BMV2 2JD4A 3Q8FA 5D2AA 2J1VA 4BQ5A 5CG9A 4Y1YA 3ZFFC 1H8VA 4UWDA 3WX5A 4WVMB 2ZGMA 1XYOA 3ZDSA 1PMIA 4B4PA 2C5DA 1ZM1A 2ZHMA 3T0DA 1ZBE2 5CFDC 4LBQA 2RMU3 5F7UA 2R042 4XDOA 3IDEA 5T5OA 4J1XA 1JU3A 2V5DA 3IAPA 4UI9L 1RJ7A 1AVBA 1A8DA 1AJKA 1ULDA 4DY3A 3LGRA 2RS53 1XSRA 4OI4A 2WQ4A 2VUCA 1O4ZA 2VQAA 1SLAA 5F5CA 3CJXA 4DEQA 2XGXA 5G04L 4P9GA 1K42A 3Q8EA 3AK0A 4A3ZA 4AQTA 5IT6A 3I2KA 1H8TA 3MZHA 5D8AC 3CU7A 4CDUB 1MVEA 4QGLA 2WO2A 1LOFA 1VBB1 5AVPA 2Q1FA 5FYBA 4CA9A 4YVSB 2CWMA 3MIFA 2SLIA 1GBGA 1CPMA 1ZZ6A 2XQRA 1JW6A 3GBWA 2ADEA 5AVAA 3VHOA 5F32A 2PMWB 3HQRA 1NUKA 1MZFA 2Q8CA 5A1LA 1D4M3 1VBC2 1MS4A 1ZRRA 2RMU1 5I91A 2UU8A 3C7OA 2GN7A 4X6QB 2JWPA 1LOGA 3T2TA 1LHNA 3FBYA 2QFEA 4H2AA 4ZU7A 3MEPA 1CAXA 3BN6A 4GKXA 4LBKA 4EZ4A 2VO5A 4MSVA 3BIEA 1XNBA 4HONA 3WW2A 3D4KA 2UWCA 4ATEA 5C8CC 2FHRA 4LUMA 1Y9QA 4IEUA 3WLUA 5J36A 4NWVA 2Y34A 1N3OA 4Q27A 4C8DA 2O14A 1DYKA 2IXIA 2HJIA 4JQRA 1RITA 1NCQC 1CAVB 4YVWA 1S4CA 1YQ8A 2ES3A 5FZ8A 2VBDA 4DMIA 1I5ZA 5T5JA 2VW1A 1QOSA 4N8MA 2G9FA 4Y20B 4A7YA 1ND3C 1D4M1 4PDWA 3I2GA 2B46X 1R1A2 2XJUA 3O1UA 4UYBA 4JGYB 1JZ8A 3HR9A 2YU2A 3T0AA 5CFCB 2VXJA 1B35A 3ZXFA 3CEWA 3ON7A 3RDIA 2WQZC 5FZOA 2JKXA 4CCMA 1O7FA 1WCQA 3H42B 4D3WA 3C7EA 3WNMA 5J96B 1QU0A 3LOIA 2PYTA 5A7WB 4QDRA 5GLTA 3ZXEA 2BNNA 1REEA 1LGCA 4LK6A 4E27A 3MPBA 3MLLA 3OTFA 2EXIA 4ONUA 4CEYB 5IK7A 3N4MA 5KXEA 2P34A 3NQHA 4H7MA 4UFKA 1VP6A 4RYDA 3JQWA 1ZZBA 1WCSA 4XJWA 4LR4A 2Q8EA 3O12A 3I2OA 1W3XA 4YM3A 2VULA 1S0FA 3ACHA 4HZFA 5FP9A 1XJAA 5GALA 2V72A 5DG1A 5J98B 3S7EA 1QJFA 1ZRIA 2DVDA 2YY1A 4HN1A 1OD5A 5HPOA 1UKRA 3J8F2 5JR7B 2Q30A 3AJYA 3POEA 2XKOA 5FYSA 2GDFA 3BCWA 2JENA 3N9OA 1U5YA 5C71A 5IK8A 3OGVA 2ZGLA 1ZRFA 4OHZA 1UOJA 2ET7A 2PHLA 1SDDB 3TOJA 1RC6A 4O65A 3HD8B 1JTZX 4IQPA 4E2GA 1HRV2 2EAAA 2ARXA 3MF6A 4O9GA 4N53C 1OXCA 4P9YA 4R9CA 4XTPA 3ZMNA 2DCJA 4QPIB 5EJZB 2GSYA 2D5FA 3IWZA 1UZVA 3WP3A 2VZ1A 1YQ6A 4QM8A 4RHV3 4MGIE 3UGGA 1LU2A 2IXKA 4A44A 1QH7A 4NHKA 4Y1UA 5LBBA 2OT7A 3ZSJA 3ZFFB 1O5LA 3I54A 3KF5A 2BERA 4N7IA 5B4XA 3C7FA 3Q8CA 2WT1A 4XMIA 2WNUC 4I30A 3BYWA 3CIHA 3UL2A 4F8AA 1FPN2 1IKPA 4LKDA 4LUKA 4WM7A 5KHJA 2BNOA 1LEMA 4OHXA 3CNAA 3GZAA 3OEAA 4L99A 1QGLA 2B9VA 1FNYA 4LJHA 5HXVA 3SMHA 4Y26A 2VY0A 3C2UA 3IZOA 3RNSA 5C70A 3OY8A 5JOZA 2QQOA 3LB9A 1W06A 3TNPB 4HVOA 1XYNA 5L9RA 3T09A 1UY4A 5FK8A 4DOUA 1SDWA 3IDBB 3I59A 1G9DA 4QXBA 4HFSA 1DZRA 4WV8A 3E97A 1WUVA 1MQTC 5D8AB 5FZCA 4RHV1 4XJUA 3VD7A 2WN2A 3UKNA 3GZUC 2ZHKA 2TBVA 4CDXB 3G7DA 4QU2A 2D3RA 5A7PA 3U11A 1W8TA 3URFA 4DXRA 1LNSA 2YC2A 2ZGQA 5IK4A 1SLBA 2QKDA 1WMFA 4NR1A 4JGZC 3AB0A 3C7GA 2EXJA 3ZIWA 4CCCA 4XJ9A 1COV2 2ZHNA 3ZXJA 5FZ1A 2GC3A 4ZS2A 1Z7S3 4LIUA 4LBQD 5DZGA 2YPJA 1Q8QA 4DXTA 4XAAA 5GJ6A 4ITCA 1MS3A 1UPSA 1C8M3 2V5YA 1W8ZA 3NV4A 5LATA 2G9ZA 2RS12 4BISA 4JDOA 4AQSA 2A6XA 4DINB 5C8CB 3MIBA 5JXHA 4YM2A 2B9UA 5DDJ2 2PHWA 4FQZA 1LAJA 4IV3A 3AFGA 2FCVA 2YC4A 1JH5A 4AGGA 5J37A 5DMYA 5FY4A 1FMD2 2E53A 3AYAA 3ZVXA 2B8MA 1GP5A 2CSGA 1POQA 4GH4B 1NCQB 3V0BA 5LA2A 4IV1A 1OH4A 3WINE 2G9GA 3POSA 3ITQA 4K8FA 2OYZA 1CAUA 4FPLA 1I1EA 1R092 3PU8A 4C0BA 1NLSA 2QQMA 1ND3B 2R0HA 3LF7A 3P5BA 5FCCA 1YUDA 2GNTA 1AR73 2W2IA 4FPOB 2HWE3 5A33A 2WDBA 3VBRB 4IEWA 1GZWB 3JCIA 5AC93 3IIIA 3VZJA 2JE8A 1C8M1 5T50A 5K0UB 2DBNA 2Y26A 1ZZ8A 4ISRA 2D98A 3PTYA 1GNZA 4HMZA 2BBVA 2J7MA 4Y5Z0 2ZX0A 2PHTA 2ENRA 4QQLA 4DRVA 3FJSA 5F5IA 1JZ4A 4ZS3A 2IFRA 1MZ6A 3WNKA 3SH3A 4AYUA 3BIWE 3MV11 5FO9B 3WVJA 1W2UA 4CYDA 1KFXL 4XCAA 1QXPA 2GH2A 4AW7A 1EV13 2RR12 2QVSB 1JYTA 2W0XA 2ILMA 5ABJC 1Q8SA 4LO6B 1NG0A 1ZVFA 2EVXA 4A4AA 4UFLA 5LWBA 3LQCA 4JC1A 4MXWA 5J7MA 5JXIA 4L92A 1BBT2 1SBEA 3O14A 4IETA 3TWIA 1AR71 4N9IA 3EB7A 2P3JA 2HWE1 2ZX2A 4JHTA 2LM3A 3W20A 4Q5OA 2IUWA 1ZZ7A 4KGGA 4YW4A 2XJVA 4YFZA 5AC91 3H7YA 5C3SA 5I8YA 1ZA4A 1CZVA 1DHKB 2E7QA 2D6MA 2CAUA 1U0AA 2YZ4A 3NAPC 3IBMA 1FI2A 1QQP2 4I3PA 3H8XA 2XPJA 1ND2A 2ORZA 3JU9A 4XILA 2VMEA 4ASKA 2WT2A 5A3WA 1J3RA 2D40A 3CJIA 3RVHA 4PBOA 1MS9A 3U4XA 3B94A 3D0JA 2V09A 2VZPA 4HBNA 3P3PA 1CQ9A 4YZ4A 5FFOC 5G05L 2DVBA 1H8TC 3E5XA 2WL1A 2UY9A 2VCCA 1EV11 5J3UA 4Y5SA 1FT9A 1OVPA 1LOFC 4QKNA 1W2AX 4AHXA 3ZDVA 1UU4A 5DABA 2WZPP 2ID4A 3RI8A 4CZSA 3WDXA 5A32A 5JPNB 4L0PA 4P9XA 4XF3A 2R072 3DPRA 5F5AA 4NOTA 1SG3A 2BJSA 2HEWF 4AGRA 2Z2SB 4YW7A 5LASA 2YU1A 2VMGA 3ATGA 3DEMA 4K40A 2DFBA 4RR3A 4XC9A 3ZIXA 5C33A 2WNUB 2YBPA 2R0FA 2ZS6B 4CU8A 1W0PA 4QXKA 2DU1A 2VZSA 1NAEA 1W05A 3LOBA 4LO8A 3RZZA 2X09A 3CL1A 1SEFA 2XH6A 3U0ZA 3K3NA 2TEPA 2WBKA 3TN92 1EYBA 1YJLA 2P5BA 3LZZA 5FJHA 5T5LA 5GLWA 3ZFGA 2WFF2 1WCUA 5FZ9A 5HBAA 3W21A 3O1PA 1YFWA 1D7PM 2P2KA 4AK3A 4MVTA 2RDRA 1US2A 3RFRA 4AI0A 4NIHA 4HN0A 1H2NA 3RZKA 1XSQA 1VALA 3PUHA 4QQOA 3BOWA 1V00A 4YVWC 4NIIA 1XNAA 2LALA 1RJ8A 4D7SA 3M4FA 4JAAA 4DO0A 3QCWA 2X8KA 1PZ8A 3AP5A 2I07B 1OSGA 1WW7A 2CY6A 2V4VA 3H8UA 3A4UA 2ZEWA 4IXLA 4UAPA 1LCLA 2P3IA 2PHFA 2QQVA 2RM22 1F5FA 1JODA 1VPHA 3FHAA 4PDWC 2F4PA 3VBOA 2DBIA 2Y6KA 1DF0A 1S0BA 4UFJA 1OA3A 1B35C 2HLEA 3WF1A 1VR3A 5FUNA 3VKOA 2GP5A 4CU7A 1KJRA 3UKTA 3ZPYA 4QPYA 4DB5A 1PZ9A 1QDOA 3RYRA 1CJDA 3L2HA 2Z5WA 3E6DA 5C9AB 3O5SA 3HVDA 5I0UA 1F2NA 1KS4A 2JEMA 2P37A 2PAMA 3LA3A 2W95A 4HSJA 3UGFA 5F3EA 1UF2C 1H6YA 3IT8A 3OG2A 2D43A 1EV12 1JOJA 1RVF3 2ADDA 3MBWA 4GXLA 1VRH3 1URXA 1UQXA 3USUB 3ZYHA 2BPA2 4XE9A 3ZYIB 3KMHA 4IDZA 1W90A 2GALA 2VW2A 5CYYA 4BK5A 4D7YA 1JHNA 1LOBA 3LA2A 4AHWA 3JB8A 4LT5A 2FDKA 1UZYA 4GD4A 4XDQA 4OHVA 1DQ4A 3ZN5A 1I9RA 1WWYA 1H2LA 2HWF2 4NPRA 2WABA 3I49A 3BODA 4QGNA 5FYUA 4NN0A 4DNYA 3V64A 3KV9A 1XU1A 3OGSA 2ZX1A 2QZ3A 1PGSA 4X6RB 4QKFA 3NKGA 1S0GA 2VMDA 4META 3KZ4C 1UY1A 3THPA 1PVC3 4LBLA 2ZA9A 4CCKA 5I0RA 1JUHA 2HEYF 2BGPA 5BNNA 1VMHA 1RVF1 2Y33A 5FOBB 2JICA 3LPGA 1O91A 1XOYA 4W6WA 3JUUA 2FQPA 3U10A 2Y60A 5FWJA 3WV6A 3DUIA 2Y6JA 5SV8A 5DAVA 3RZHA 2Q4SA 2BEOA 3O0XA 2AH2A 1GOHA 3NJXA 4AFMA 1V6LA 4NUBA 5FPXA 1Q8OA 4CPBA 1C1LA 2DUQA 2IXCA 3FWEA 3I2IA 1UOBA 1C5IA 2JDMA 2IFWA 3FBMA 1AUYA 4K20A 4W6XA 3R6SA 3ZYPA 1KS5A 2W1UA 4E4SA 4KWLA 2NPIA 5IK5A 2PLV3 2BOJA 4GZ9A 4WM7C 1RHI3 4LBQB 1C5HA 1JZ2A 1Q3EA 3WQBA 2FDJA 1N1TA 2JDNA 3AC0A 3AZVA 2NMOA 1QDCA 1UYYA 5FMOL 1OKQA 1CZTA 4JX0A 1HIXA 1PVC1 4BLIA 5GZCA 3JD72 3UGHA 1WMDA 2GNBA 1T2XA 5CU1A 5DZEA 4IL7A 3VBUA 4P02B 4Y4RA 2OQ7A 4B29A 1AR62 1DYOA 1NQJA 1XB9A 1IOAA 2VZOA 2GP3A 4DUWA 5D1IA 5IFPA 4CU9A 1GLHA 1Z78A 4NHLA 2VGDA 4YNIA 4YWAA 4GAZA 3IM0A 1OLRA 2NMNA 4FFGA 4QDQA 1W2OA 2IXLA 2OIIA 2B45X 2XQXA 1BVVA 3KS7A 2C1FA 2WINB 2XJRA 1JHJA 2EIDA 4MHRA 1RUI2 4IEOA 2PLV1 2QQWA 3PUQA 5FYHA 5FZ4A 1RHI1 2VOTA 1W6PA 1K3IA 2BVBA 3PMEA 3WW4A 5L9VA 1RMU3 4BQXA 1OUSA 4LEJA 4YZ2A 2FZ2A 4LKSA 4GKYA 1CAXB 3AXDA 5FTTC 1HDKA 5FYIA 3ZYFA 3AVSA 3KWVA 1ST8A 4WM8A 2FCUA 3LEKA 4CTEA 3ZSKA 3VD5A 5KBFA 3ZR6A 2W92A 1HQLA 4K9SA 5EFUA 4IV3C 1MS0A 4M3CB 5F9TA 4NRMA 1NZCA 1UMHA 4TLGA 4UBHA 4W6YA 2R063 1ENQA 5L7OA 1GZ9A 3Q8AA 4QB2A 2PFWA 4IEVA 2WUHA 5LRSA 1LU1A 1ULCA 1POV3 2D5HA 1IG3A 1X36A 4PHZA 4IV1C 4YVWB 4AL9A 4N53A 4M3CF 4OHWA 5JIAA 3WNXA 5CISA 4FTSA 1W8UA 1A3KA 2ZGKA 3ES1A 3W5MA 2BWAA 3B9CA 4LLFA 4FT8A 1WMEA 2CDOA 4G4FA 2C26A 3SC7X 3UNPA 1O4TA 5FZHA 4ZPIA 1Y43B 4PDWB 4QB1A 1ZBA2 1ASJ3 2BWCA 1OOPA 4QD2A 3ETQA 5BYNA 4R9BA 5EHDA 1O4YA 1B35B 2JE9A 4XJZA 2WZR2 2HWC1 4FAGA 5FZOB 4XQDA 4MLOA 3T1LA 1MZEA 1H1MA 3HBKA 2WLQA 3OBTA 4ZU5A 4COWA 3POYA 2AREA 1ZBE3 1TEIA 1W6OA 1EAH1 1YWKA 1XNCA 2HYKA 1HN0A 1JU4A 3QH6A 2R061 3NNLA 3H3UA 2PHDA 5KHKA 2A6WA 5F3IA 2DVAA 3GF6A 3UJOA 1W6QA 2WJSA 5A1AA 1POV1 1UMZA 3ILRA 1UIKA 3JQXA 2DUOA 3LSEA 5F2SA 5IHRA 1UXXX 2JDAA 2KA3A 1SFPA 4NAMA 1MQTA 3VDDB 1YEWA 2VMHA 3N35A 2WLPA 1S2KA 3MLJA 4OZXA 5BNOA 3HAGA 5AFEA 1RHI2 4Q4X1 1ASJ1 2ZOEB 1CIWA 5EXOA 2TUNA 5FZ6A 1NCRB 4SBVA 1BMV1 3MW4A 5FYTA 1I5PA 2GNMA 1W03A 2ZMNA 1O3QA 1JYNA 2JDPA 3H1WA 3BGAA 3SXWA 1DCSA 3DL3A 1ND2C 4OI2A 5BXXA 3FE5A 5T55A 1EPZA 4AVVA 2W39A 2W46A 3ASIA 4JRAA 4I02A 1VBC3 1RB8G 3WNPA 5KR7A 3CJIC 2D6LX 3VBHA 1R083 2WO3A 3GCWA 3KHBA 2AYHA 4PI2A 4UOJA 4D69A 1X9PA 4CEWA 4H7LA 2P3KA 1PK6A 2B42B 2W3JA 3TEYA 1HB2A 3KD4A 5J09A 5LBCA 4CCJA 4FAHA 4KI5M 3KCXA 1RUG2 3DPRC 3KV5A 5BPXA 1W8NA 5FO7B 2C4XA 4IEZA 2NM1A 4E9KA 2RHPA 4LOSA 3T2OA 4RR3C 4I0BA 3MW3A 1UYZA 5EYYA 5JI9A 4F7ZA 5LW9A 1JZ3A 3KSCA 3WQ7A 2HH9A 2DTWA 2HWC2 2Y38A 4Y5TA 3MFAA 5LA1A 4OUSA 2XOMA 2Q1MA 1AYN2 3U4SA 1GOGA 1F15A 1EAH2 2XUMA 3OY8B 1WA4A 3FMGA 4BQWA 3VUOA 1GP4A 1R081 1R1A3 1STMA 3BTAA 2R062 3J7LA 3P6BA 3U14A 3ZFGC 4JZRA 2L9LA 3KLSA 2D7FA 4NHYA 3I59B 5T5PA 2ZTNA 2IC1A 1KDKA 4XFAA 3HBZA 3AP7A 4QMAA 4BB3A 5KC5A 1AL23 2R6QA 3HIFA 1ZYBA 4CCDA 2TNFA 1KDMA 3CZUA 1NYWA 2BDRA 4HOOA 1M06G 4Q4X2 4IGPA 2ZZJA 5C4WA 1ASJ2 3H8OA 4FOVA 4BLJA 2WZ8A 1UN1A 2A70A 3J9SA 4PLOA 3I3BA 2H6BA 2BNMA 3HQUA 4INDA 4P9JA 4CDQB 3VBOC 4CPBD 1SLTA 4XIOA 4I2OA 1GZTA 2VZQA 3GCXA 5FPAA 1FAYA 4LHKA 4Z8BA 3POBA 4COZA 2DFCA 5DUXA 2UYAA 1FOD2 5K8SA 3QLQA 3Q8BA 1XNTA 3WCSA 5FZDA 1R1A1 1LOAA 1H9PA 1UXZA 1DGRA 1JS9A 3J8F3 3NL1A 4AVTA 1V0AA 4NMIA 4OHYA 1DG6A 3NAPA 4COUA 1WD3A 2XWBB 3NV3A 3ZSLA 1D4VB 2W52A 3WG4A 1SLIA 3H9AA 1ULEA 3I3QA 2XUEA 3ETPA 4XEZA 4URAA 4XF9A 2YV8A 1AL21 4B3NA 4K7JA 4ASLA 2XJPA 3WZ1A 4ET7A 3V0BB 3N36A 4IV1B 1QXJA 5FZAA 2LW8A 5A3NA 4COYA 5IVVA 2IXJA 4KMQA 1CAUB 4AFDA 1HRV3 1CAWA 1QIQA 3EHKA 3JB4C 5HCBA 3TRSB 4I01A 2B7YA 1J58A 3DXTA 3CDZB 4LBJA 2VG9A 4AGVA 1KRIA 3AMPA 4EWAA 4BCUA 2ZKLA 4AEDA 5A33B 2W1QA 3OYWA 3PHMA 2WSVA 4EN9B 2OA2A 4ASMB 4UW5A 3NNJA 4G3YC 2BZDA 1GQHA 1RL3A 1R082 4XXAA 4CUBA 3J8F1 4JKLA 4E2SA 2NN8A 4XFIA 1FPN3 1WKYA 1X33A 1HRI3 1ACCA 3PURA 4KGQA 4AFAA 5BNNC 5L19A 4CXYA 2WYSA 3OPTA 3LD8A 3NMBA 1W0NA 1PIV2 1O6UA 4Q1PA 4YG6A 5FQ0A 3GM8A 3M3EA 4GQ7A 3WG2A 1DQ6A 1VBA2 4FBFA 2ZEXA 1RUNA 2ZGRA 1CR7A 1MS5A 1UD1A 2OPKA 2EIBA 1BK1A 1OBNA 2JG9A 3K77A 4XDPA 3KT1A 4MGQA 5M0TA 1K5MA 3MHZA 1HRV1 1IQDC 1GU3A 3IDCB 4XXPA 4MXWB 3KCCA 3T4HB 1W9YA 3M3IA 3OUIA 1Y9GA 3INAA 5FV3A 1I3HA 5EV7A 4Q8LA 1YC61 4OULA 3HQXA 2O8QA 4JDNA 2A6ZA 2E31A 4RQPB 3NJVA 3LEGA 1LHWA 3A21A 2XWJB 1ND2B 4MXVA 4XMAA 1AF9A 3VBUC 4EYUA 1FPN1 1HRI1 2J1SA 3PVBB 5A70A 2IWGB 1COV3 2VUJA 3BPZA 3CJIB 1Z0HA 1OUXA 2OQ6A 1IS5A 3UV9A 1NKGA 3ZPOA 4B7EA 2A75A 2H6CA 1AL22 4Q0UA 4AI2A 4OVEA 1JUIA 4PQQA 5FY0A 4BYYA 2HWD3 1NT0A 4TYSA 5F8PA 2RS13 1UY0A 1DZTA 1C28A 4QGMA 1LHUA 2DCZA 3S6PA 1U5IA 5DDJ3 1QF3A 2AEYA 1H2MA 2HWB2 3DPRB 3QOPA 5JOWA 4CP2A 4URTA 1RXFA 4YM0A 1C4RA 4RR3B 1FMD3 1N1SA 1UWWA 2VCMA 4PIXA 5DAXA 3H7JA 3T1MA 3ZOIA 4E4HA 4P9LA 2Q8DA 1GWMA 1VAVA 1AXZA 2Y6FA 3R0RA 1HLCA 3GHNA 4Q4Y2 4XFCA 4MADA 1AYM2 1I6XA 3C7HA 1R093 4FFHA 3CQOA 4WM8C 4YW3A 3U1XA 4KQ7A 1COV1 4QXHA 3NO8A 2RDNA 3ZFGB 1JYWA 3T08A 3H50A 3AMNA 1IPSA 1PM4A 1U5ZA 3WP5A 5JWPA 1YQ5A 2HWD1 4YG3A 5L7OC 2RS11 1S0DA 2WO1A 4Q4V2 4DEVA 1HX6A 5DDJ1 5HCHA 4CP1A 2MEV2 2JDUA 3AMHA 4E8CA 2YGLA 2UURA 1W8HA 1HJGA 3AVRA 4FPFA 4PIZA 4XAEA 1OPOA 5FP8A 3WW3A 1L7LA 4C1WA 2JDHA 5FBZA 2GMEA 1O8SA 2Z79A 1FMD1 2ZAHA 4FPYA 3LEIA 5IUQA 3ZFEB 4YW5A 2ZX4A 4B1LA 4CCEA 2EIGA 3VBOB 1O3SA 1WCKA 1OOPC 2R16A 2FZ1A 2RR13 4JV4A 1QKQA 5HCFA 3VLBB 5CBLA 1GSLA 5A6ZA 1GZCA 3OBAA 2JDYA 2RVAA 3K48A 2PQSA 4COVA 3AMMA 1RINA 3OPZA 3M8LA 1R091 1UOGA 4TSVA 3MLKA 4XFGA 5CFDB 1HRI2 3R4DB 1BBT3 1XU2A 2WWSA 3X29B 3LCPA 2Z4FA 3VD9A 4YZ1A 4LHSA 3LWCA 4M4PA 1N3PA 2BRTA 3THDA 3HT2A 4NIDA 4AEMA 3EJKA 2DCTA 1VAKA 3R4UA 5IVYA 4L97A 2EALA 3TEXA 1JXNA 1Q8VA 1S0IA 4JDMA 1F4HA 2YMZA 1JYXA 3BTXA 1XYPA 4P08A 2C9AA 1QQP3 1JZ5A 4LBOA 1CD3G 3RMYA 2YC0A 3LPFA 3I3EA 5E8AA 2PHXA 5A6QA 3AYEA 1Q5OA 3VKNA 1EY2A 5IATA 3ABZA 4YRDA 1YJKA 3GHMA 3HEIA 4YGDA 1NZIA 3MIHA 3HN3A 5BNOC 4DS0A 3AP6A 2QDRA 2RR11 1WGPA 5F3CA 4BDVB 4HKLA 5FPBA 5C3PA 2WR9A 2BQPA 1VE0A 2VQTA 1G9CA 3FHIB 1DQ5A 3WUDA 2WO7A 4IEXA 2WQ8A 2R073 2B4KA 1BBT1 3J4UH 4K1YA 3WHTA 3B01A 1LESA 2EF6A 5FREA 1UOFA 1FXZA 2X10A 3IPVA 1HQNA 3JBG3 4HVRA 3VBHC 1GMMA 1QXRA 3KB5A 5BNNB 4FTBA 1Q43A 3V0AA 1OLME 2HWD2 2UYBA 5FZ7A 3RZGA 5A3TA 1SFNA 1QQP1 3VD3A 1LECA 4CCLA 5FPVA 4JVAA 4CEWC 3LDBA 3ORJA 1PK6C 1PMJX 4OQ8A 2WT0A 5FMCA 1YLLA 2QQLA 1MVQA 1K45A 4P5HA 3TN93 4CCNA 1CZSA 4MX3A 5GZDA 4XZPA 5CZKA 3J7HA 2WFF3 3AZZA 4YYOA 1S1AA 1PGW2 3MIDA 1GWLA 2N7GA 5A3LA 2XB6C 4KG0A 3OGRA 4LHLA 4RGGA 1KGYA 4J1WA 4ARXA 1MS1A 5LA0A 3WNOA 5LEJA 5I8TA 1CPNA 1N1YA 2LRPA 2W47A 3HN1A 4M0NA 2JECA 3ZR5A 5E1RA 4YM1A 4FPGA 2XL9A 4AZZA 2R071 4MYEA 1G9BA 4WVVA 3OSDA 5JAXA 2ARBA 1SPPA 1PMHX 4LA3A 2FMYA 2RM23 4R9DA 3VBUB 4EQVA 4RN5A 3JBG1 3RS6A 3OF1A 3VBFA 1RUC2 5JI7A 1SMVA 2XR4A 4ZU4A 1W2NA 3S5AA 3NV1A 1ENSA 4QB6A 1J3PA 3GDBA 2RS32 5A7SA 4A6OA 4A2UA 2UWAA 2YDEA 5FZKA 4V1PA 5FXXA 4IE6A 5FP3A 5BUVA 1SACA 2XKPA 3TN91 5FLHA 2CV6A 1AL0G 4OQ9A 5FLIA 1N3QA 4P9WA 2WFF1 2DCYA 4E4ZA 1QH6A 1RUD2 1WA6X 3SH4A 3WDVA 3CO2A 5C4WC 2ARAA 3SKVA 4BQ2A 5I0SA 5FMOS 4JKKA 3VBSA 4BPZA 4OLLA 3BU7A 4U2AA 1XXNA 2VR4A 3SCHA 3RGBA 4QX3A 5CNAA 3U75A 3PVOA 4DUXA 2VVDA 1ZREA 3OBRA 2GC0A 3ZXKA 4BXSV 2VTFA 4MO3M 5L36A 5K4LA 1HB4A 1X8EA 1Y9MA 2Y6LA 2RM21 1H1AA 3PNAA 5C7GA 5JZGA 5CVRA 3VV1A 3OEBA 2RDQA 4WM8B 3QH7A 2DVGA 2C9KA 2HWF3 3O1RA 1OLQA 2WAAA 3OUHA 4GB32 4C90A 2AUYA 2QZ2A 2CL2A 4XABA 4OZOA 5J1XA 5LBFA 5DN2A 3AKSA 1HQWA 1QJX2 2GH8A 1QJZA 3LKJA 4CP0A 3ZO0B 5L7OB 3V56A 1G86A 2WRAA 3K2OA 3ECQA 4OUEA 3WNNA 5F6LB 4HT1T 1CAVA 4N53B 2EXKA 2ZX3A 1EUUA 3I3DA 5EJ1B 3NJYA 2QQPA 1FV3A 5FMDA 3D8CA 4Y1XA 3UKVA 4Q0VA 4FOQA 3E5QA 2ERFA 2P3YA 2F6BA 4S2HA 2WNEA 1IGOA 4Y4YA 4D0QA 4Z07A 4KBBA 1LENA 4YZ3A 2LROA 1OOPB 4AEDC 3MICA 2Y0OA 2XHKA 5FPZA 2E63A 1DLCA 3F2ZA 5J48A 1W3VA 2GMPA 5F39A 4AWDA 3RWNA 1ZA7A 2J42A 3FLTA 3JBG2 5F3GA 3I3MA 2HWF1 3N7LA 2OXBA 4LO7A 5T3NA 2VZ3A 4AFCA 5IJRA 1MS8A 1W6OB 4OYUA 5A7WA 1VAMA 1YIFA 2YBKA 1KJLA 3OCPA 5AFBA 1YO8A 2GU9A 4BHPA 1W6QB 1CWPA 3JD73 5EPAA 5JPMB 4QWNA 1RUJ3 1PO22 4ZXKA 4ZKTB 4TZDA 2JG9C 3GBGA 4KL1A 4LE4A 4BQ3A 1AR63 1K5MC 2YPDA 2QQJA 3AM2A 1MQTB 4BMEA 1IZ3A 3WQ0A 4OMDA 4XUNA 3N9PA 4AFBA 5DG2A 1SFYA 4XACA 5I0DA 3HWJA 2HBTA 2VNRA 1BK0A 3ZSMA 5GZFA 2J22A 2O1QA 3KM5A 4S2GA 4HSLA 3B7MA 3DKWA 5IAVA 5FZEA 3ZYRA 5APAA 2Y0IA 2QTWB 1GFF2 2ZEZA 4JGZB 2RE9A 3A0KA 5KWRA 5E88A 5DZFA 2LTNA 1RUI3 2R7EB 4QT6A 3SLIA 1N47A 3AJZA 1YI7A 3T4VA 2DCKA 4W8JA 4UXAA 5C3QA 2D6PA 4GIQA 1AX0A 2DYCA 3B02A 1LULA 5HV0A 1GYKA 3VBHB 2ET1A 1DQ1A 3I4IA 2VL4A 3ZKYA 1KXGA 4ES9A 2P17A 2Y6GA 3JD71 4L11A 1E5IA 1WLWA 3GJAA 4IE5A 4P00B 4QQ2A 1PK6B 1RUJ1 2XONA 4X8PA 2QQNA 3THTA 1AR61 2YUEA 4LMFA 5FMBA 3J7MA 4F83A 3AP9A 1RGSA 1NX9A 4CP9A 4L9BA 3MPPG 2QE3A 4A7ZA 3PU3A 3NVCA 5LA9A 1NXD1 1IS3A 1JOBA 2P1BA 1R1ZA 3O1VA 1IS6A 1OQ1A 5JSPA 1GQGA 4KWKA 5LCWL 4KWUA 4UW4A 2JKBA 5DUUA 2B39A 4AI3A 1ZZCA 5CADA 1RUI1 3QD6A 2NLRA 2DU0A 1S55A 1W6NA 2VD7A 4LPLA 4MOAA 2GC1A 2W91A 1HW5A 3S7IA 5CKNA 1DBNA 1DDLA 1ZBA3 3WF4A 5LB6A 1M4WA 4A45A 3ST7A 3FUOA 2A7AA 4OCTA 1RTVA 2E6VA 5A6YA 2VNVA 2D97A 2WZR3 4FOWA 1OFNA 1PX4A 1IQAA 1LJ7A 1YCIA 2E7TA 2WS92 4IEPA 3EXUA 1W39A 4ZY9A 1YFUA 3ZYJB 3SNMA 3ZYBA 1GOFA 1OH3A 4CDXA 2FCTA 1V9U2 5C4WB 3MYXA 4WZCA 3VKFC 4HL0A 1RUOA 2IVIB 5A7QA 1HV1A 1POV0 2ZPXA 3APBA 4YSFA 2CYFA 3GNEA 3RZLA 5ABJB 1QJY2 5F6KA 2J1RA 2I2SA 4I0AA 3ZMOA 5KXBA 2VMIA 3AKPA 2FDIA 1D0HA 1UY3A 1NA1A 2BU9A 1WD4A 1YFXA 1ALYA 4D6SA 3SEEA 3O1TA 2MNGA 1ZBA1 4M00A 4YW6A 1PNFA 2YHJA 4J6GA 3NAPB 1YHFA 1YQ2A 2WZR1 3VHPA 4DY5A 2VMCA 5JVVA 1RUJ2 5FY7A 1QOOA 5BNPC 1Q8PA 2XVKA 4MGKE 1LGNA 1K5JA 2CWSA 4LKFA 4RFT0 4C0HA 4JQTA 1P8JA 2XJSA 1UZWA 3DYMA 4GH4A 2W1WA 2JIGA 3AYCA 5JOXA 1H8TB 2VH9A 2YYOA 5LEKA 1SZBA 1CAWB 1OMIA 4HG6B 2K2SA 4LTAA 4IE7A 3K3OA 3OGGA 4QDSA 1W6MA 2PHUA 4QXCA 4NROA 4AEDB 1OPMA 4XJ8A 3OYWB 3HNMA 3VBRA 1RUG3 4UW6A 1OVSA 1WW5A 4RD7A 1GZWA 2F17A 2QQKA 2NZ9A 2DURA 2KD7A 4LULA 1JBCA 4XBNA 4AAPA 4PF5A 2ETEA 4LE3A 1B09A 1BKZA 4XFHA 2HWC3 4XUTA 3OBZA 3FZ3A 2E33A 1L3JA 2VUDA 5FQ0B 4XQ4A 1AYN3 2F4LA 4AVBA 4XIKA 1EAH3 1QNWA 3QACA 5FO8B 4QX8A 3K4AA 4XHBA 2JG9B 4MGSA 1K5MB 4J25A 5C5UA 2JDKA 2KXLA 1RUH1 2GZWA 3VZKA 2AGSA 5DAPA 2YBSA 4KU8A 1HB1A 1SHWB 1YNAA 3VDCA 3WY6A 1APNA 3FX3A 3BU0A 1A78A 1D0GA 2CHHA 1YXWA 4OUMA 3UJQA 1RUG1 5C5TA 4BH9A 1GNHA 3ZXAC 1BYHA 1OT5A 2NYYA 2XVLA 3I2JA 4Q4X3 3PMSA 3E5UA 1A34A 1EUTA 4KG8A 5A1FA 3AXEA 4GMP3 4HPKA 4NAOA 3SITA 4AEKA 4BIOA 3VBFC 3RSJA 4FQ4A 2XL7A 4SLIA 3ZKUA 3EQEA 1XPWA 3NKTA 4XURA 3WF0A 1GQPA 3FL7A 3I97A 5B4NA 1FNZA 1AYN1 1ULGA 1E57A 4QHZA 1FOD3 3POIA 1X8MA 3POFA 3WD5A 1PZ7A 5DUWA 4AR2A 1XRUA 4XJAA 4FO9A 4LA2A 4CVUA 1W9TA 1ZX5A 2VUAA 4YVSC 3GXUA 4MGYE 5T54A 3VBSC 4JKMA 2HEVF 4FXGB 2X29A 4E2QA 5FKCA 1AR92 4IE0A 3WP4A 2SBAA 2BGOA 1NY72 3SHRA 4EN6B 5I93A 2J1AA 1PM7A 1RYYA 3DN7A 5JZGC 2LUWA 1NE6A 4GMP1 3CLPA 3WF3A 1J84A 3ZN6A 2BV4A 2CU5A 1UAIA 2IVJA 1REFA 3TB0A 1PX3A 2PAKA 4R4XA 2C6SA 2VQUA 5LK7B 3HJRA 4AQ6A 1FOD1 1H2KA 1CGPA 4NRQA 1GICA 4PF1A 2GMMA 2VPVA 3E1F1 5EZWA 4F3JA 4AOCA 1GP6A 4WVWA 1D2QA 1RUH2 4EWDA 1J59A 5FY5A 3MUY1 3ACLA 1PIV3 4PT6A 3BI3A 4ZXEA 4ZHNA 2AENA 3MF9A 2WZEA 2XJQA 1X7NA 1VBA3 3I2DA 1G9FA 4QAWA 1JZ7A 1LKNA 4GULA 4B8EA 4D6QA 2VECA 3UETA 4YPJA 2VOWA 5HI0A 2JB8A 4Q4W3 3FN9A 4JGYC 4AAXA 4BWOA 5FPUA 1W28A 5EQUA 1C1FA 2ZMKA 1V6IA 2Y6HA 4S2DA 1DGWX 5ACA3 2MPFA 3BVCA 2RJKA 4WM7B 5CEHA 1S0CA 1VBD2 4XF4A 3W58A 5FZLA 2W94A 3B93A 1SLCA 5CA6A 4XOGA 4QKBA 3KVBA 5F5QA 1O5UA 3O1OA 4YGEA 1YQCA 4LO4B 4JHZA 2GNDA 5C8WA 4Z92B 1RUF2 4IGQA 4PBPA 1AR83 1V6NA 3L9JT 4QPGA 4FPCA 4IEYA 5F37A 3OD4A 1V6OA 4QX2A 1PIV1 4A3XA 4LNVA 2DWRA 1FYUA 5KHGA 3PTRB 1VBA1 4HANA 4NRPA 3RMXA 2YB7A 4ARYA 4XZUG 3V65A 1Q56A 2PXJA 1NQDA 2XVGA 4Q4W1 1SCRA 4MGTA 4W65A 3B3QE 1GUIA 4MGZE 1YYNA 2A3WA 3E6BA 2VJXA 3WDUA 2OX0A 4AVAA 4E8DA 5ACA1 1V6MA 2HWB3 2AEZA 3G6JB 5IVJA 3S0MA 2VE1A 3M70A 4AI9A 4C1XA 2G1MA 3IPVB 3LE0A 3E6CC 1X9TA 2OVUA 2A3YA 2ZXQA 4G9SB 4Z2WA 5JCTA 2WNVA 3V0AB 2ZBJA 2E51A 1R64A 3O7OA 4L2NA 1MR5A 4A6SA 3WUCA 3MGUA 4Q4Y3 2J1TA 4NE9A 1AYM3 1BCXA 1T6GC 1LOCA 3EMRA 5LY1A 1UU5A 1AR81 3VL9A 4IV3B 3KT4A 5A6XA 1S0EA 1AHSA 2VOVA 4FPJA 3M3CA 2XXZA 3ZXLA 5IWFA 3GYDA 3LDRA 4MUVA 1DU3D 2A6VA 2PQQA 4Q4V3 3USSA 2WA3A 1H9WA 3VZLA 4D7TA 3BTZA 2VTXJ 5FAXA 3HT1A 2MEV3 4YG0A 2HWB1 4PLNA 3N9NA 1LHVA 1PO13 2C24A 1UNBA 3U07A 1ODMA 1SPPB 2E26A 2WNOA 1TNFA 3AZWA 4Y24A 4BOWA 4FPHA 4JTNA 1HJFA 3VBFB 1CJPA 4LOTA 1WBFA 4YW2A 1UIJA 2E9QA 5H9QA 3HOBA 4Q4Y1 3CF6E 1AYM1 3LIHA 3AX4A 3FHQA 4R9AA 2ZGPA 1W8FA 2P6HA 5FZMA 4FI9A 2JG8A 1J3QA 1ULFA 2RDSA 1WZXA 3NNMA 4QX0A 3AKRA 3EBRA 5FRAA 4BQYA 2VAUA 3CKHA 3UYJA 4JCKA 4CDXC 1MZ5A 2A3XA 1YFYA 2ZGTA 3OPWA 4YFWA 3LFMA 3VBSB 4Q4V1 4R52A 4Q4W2 2R30A 3AL5A 2J1UA 3ZN4A 5FK7A 3NNFA 3SH5A 1G8WA 2X05A 4BK4A 2FDGA 5ACA2 2MEV1 1F35A 3EO6A 1PO11 2XDVA 3UK9A 3AYDA 1NA1C 3J26N 1TNRA 1TZOA 1PHMA 5FXZA 5JZGB 2D93A 1S2BA 1C57A 2RS51 4C91A 4UF0A 4LLOA 4ZZ5A 2EA7A 4CU6A 3VDAA 1OF3A 1MACA 2ZAAA 1LHOA 2RJ2A 3RRDA 3K51A 2X5IA 4M3CA 1UX7A 3GZEA 3IMMA 4ES8A 2WWJA 1AR82 1RUE2 3AZXA 4LXLA 3D5OA 2OS2A 1DP0A 4MV2A 5H9PA 5D21A 4NIGA 3H3LA 2Q1ZB 1J1TA 3KHCA 2RG4A 1UX6A 1C8NA 3POJA 4EROA 4QPWA 4GH4C 2QQUA 4M3CE 3KCYA 3TAYA 2VZTA 5A3UA 2DV9A 3AP4A 1EP0A 4IERA 5A32B 5IVBA 2E32A 4MHUA 2E7AA 4AXOA 1JZ6A 3CHXA 3I2HA 3RJRA 2RJLA 3KV6A 4N9HA 3HNYM 3KV4A 4Q29A 4DFSA 3VBRC 4KWJA 3TYJA 4QX7A 4XVHA 2ZGOA 3T30A 4CXWA 4N7UA 4ATFA 1IPJA 5KHIA 2OPWA 5H9RA 2K9ZA 1NE4A 4UBGA 4IEQA 3M3OA 5K0UC 2ZCWA 2VNOA 3WSOA 3DYPA 1XE7A 1EPWA 1WLDA 3T2QA 1KEXA 3MI8A 4NIAA 1TG7A 4GALA 4QHBA 3FFZA 3VZOA 5GLVA 4DXSA 3FUQA 4H55A 3AZYA 1JYIA 1DZQA 1UYXA 3D82A 3BB6A 1VBB2 2IZWA 1GNYA 3H8RA 5FLJA 1RUC3 1J1LA 2QJVA 3MW2A 3OUJA 3K75B 1L7QA 2PN5A 3N9MA 1BJQA 2ZZQA 4CDWA 1UYPA 3LEMA 3ZLIA 3VDDA 1IPKA 1BZWA 1D2SA 2RS33 3DF0A 4HK9A 5F2WA 5BNQA 5C3OA 1GWKA 1QJU3 1VRBA 2XHNA 1SQ4A 1DQ2A 1LR5A 1TVGA 2RMU2 3MO4A 5ISLA 4Y22A 1X82A 1F31A 3DXUA 3BUCA 1C3HA 2MHFA 3LAGA 1PO12 5LY2A 1NCRA 4BQ1A 4DZGA 3A7QA 3MIGA 1ZRCA 1W8OA 3D6EA 1RUD3 2ZJCA 1PGW1 4RS5A 3WEZA 1G6NA 2RS52 4K3UA 5SV5A 3MV01 2W5FA 2QUOA 3H3ZA 5FY8A 1FX5A 2D6OX 1QOTA 2W87A 4X8NA 5IYYA 5BY5A 2VZVA 5K9YA 4CXXA 4N43A 1BVP1 4L8QA 2I74A 4XCBA 4UFHA 3ZSEA 1F9KA 1OQDA 4A7KA 2DF7A 3WDYA 5LZ6A 1RUC1 3SISA 3SEPA 5IVEA 2LS6A 3H1YA 1WBLA 2Q0AA 4OI1A 4GB33 5BNPA 5FOJB 4PJYA 2RS31 2VW0A 1OQEA 3ENRA 3JZVA 4BXFA 4QQPA 4CP9B 1QJU1 3ALQA 4LORA 1D4M2 5JSRA 1QJX3 2CGNA 3O0WA 5IFTA 4XFBA 4O61A 3LDKA 4H14A 1VIWB 3P1IA 5KHHA 1ENXA 1W9SA 5LRRA 1RUD1 4YGBA 3IDAA 5HCAA 4I3GA 3POGA 5H9SA 3TNQA 5FIXA 1XNDA 2BFUS 1O3TA 3PL0A 1V6KA 2Q5TA 1REDA 2VVFA 1W6NB 2VMFA 3IIAA 2PAEA 3BALA 2BTVC 3ACIA 1NLQA 3ROUA 3M3QA 3PVNA 3GZTB 4HKWA 1DLLA 1A6CA 1OLMA 2A73B 2UY8A 3VGIA 3VZNA 1MEC3 3DCQA 1O3RA 1IHMA 4FPEA 3FLPA 3AKQA 4P14A 4IE4A 3CZJA 1E5SA 1YRZA 3K4ZA 3DKQA 4TWTA 2K0GA 2OZJA 4QM9A 5E89A 5ERLA 3MFCA 2IXHA 4GB31 1SBFA 3KQRA 3QBQA 5LK5A 3VB9A 2CDPA 1O59A 3WW1A 4DXZA 3FLRA 3VKMA 1QJX1 4YW1A 3RPQA 2W9XA 2YFUA 1F8VA 2OUHA 4CDQA 3GALA 1Y4WA 3KF3A 5DPNA 5FYMA 4EE2A 1H1IA 1PO23 3I8TA 3IMNA 1KD7A 4NJ4A 3KVAA 4D94A 5FYCA 3DECA 3LA7A 4W50A 2FMDA 3A23A 4WVMA 5GZEA 1XE8A 1MPXA 2J1EA 2P4EA 3D0SA 1NA1B 3MUZ1 4GWIA 5FKBA 3WF2A 1S0JA 3PIJA 1NXMA 1PGL1 2XG3A 4XF1A 5I0TA 1CIYA 3N7MA 5C9AC 4CRQA 5JMOA 4KU7A 5JSOA 1MEC1 3BTYA 3PVEA 5FZIA 2CGOA 1UPIA 1CN1A 1F4AA 2KR2A 2R32A 3RZMA 2AZ5A 5DXDA 4RGAA 4N90A 3BPSA 3RQ0A 3NWKA 3AKTA 3HPNA 2WFPA 4QPGC 1QJU2 2WSUA 4PQ9A 4YZ5A 3S57A 3IB3A 3CMGA 2AR6A 2CAVA 1H30A 2W08A 3OD0A 1UKGA 4CDUA 4NHMA 4KBZA 4TLFA 1W6MB 1BQPA 3PJQA 1PO21 3GGLA 3NSTA 4YVSA 5FJKA 2JIJA 1W8WA 4V2WA 5FZ3A 2QDNA 2QNKA 3U37A 1Z7S1 1WMXA 4MZUA 2JDZA 1W6PB 3IAQA 4FXKB 4S2FA 3NRUA 4D8MA 4YARA 2WC2A 3RYPA 3N3HA 1VB4A 4B4QA 5DAWA 4AF9A 5IAXA 5FY9A 3PLQA 3VN4A 2D3SA 2WNVC 1DGRN 3P3NA 3OB8A 4E4DX 3NW4A 1OC1A 2BP6A 4XW3A 3GJBA 1RXGA 4AE2A 3AFKA 1AXYA 4FP2A 1SCSA 4LKEA 4RHV2 3FFQA 5FXWA 5GLZA 4BU2A 1W0OA 2JXAA 2WAOA 2YG0A 3ELNA 2EIEA 2FBEA 4DIQA 1ZRDA 1OI6A 1O8PA 2BYVE 2Q8OA 5FYZA 3KGLA 3VKLA 5CB7A 4XETA 3LSDA 3ACGA 2OKXA 1XE0A 3WG1A 4GA9A 5JIUA 1E5HA 1GV9A 2YROA 4LHNA 1KITA 2WS93 2H0VA 1QY4A 3T2PA 2YFZA 4IESA 4Y20A 2OW4A 2NP0A 1ULOA 1V9U3 3NNGA 1PGL2 3PJYA 2VZRA 2YGMA 3R05A 1GANA 1LRHA 1MEC2 1YIPA 3B5LB 3C3VA 4O7XA 4RQPA 5CKMA 1ONAA 4JGYA 5IW0A 4ISQA 4HPKB 1AX1A 5CFCA 2VNGA 3JXSA 1QJY3 5EP9A 4UW3A 1IKQA 4LK7A 5JDBA 2QCSB 5JMCA 4EZHA 4P5YA 2VZUA 4MG2A 1JN2P 4K8RB 3HNBM 3WQ1A 4W4ZA 2JG8C 1DYPA 2BGCA 1UO9A 2EICA 5JOYA 1A8MA 1YI9A 2PA7A 1LOEA 2D3PA 4PIYA 5I8SA 4CEYA 2O8OA 3PUAA 2R49A 5T52A 4BM8A 2OUJA 1IG0A 2FDFA 1ENRA 4LBMA 3R4SA 2WS91 1LODA 1TQ5A 4RGKA 1VMFA 5EIYB 1Z7S2 1HXS3 3KGZA 5BNOB 4LIVA 1V9U1 4XHXA 3BOPA 3FC0A 4PCRA 3RJ2X 1C8M2 4Z2AA 1XQNA 1WLCA 2ZHLA 5F1RA 4OMCA 4XQWA 3ZN6B 2ZGUA 5KC6A 5FDBA 5B2GB 1QJY1 4LBNA 4BMBA 5A3MA 5JXGA 3Q9OA 1JMUB 5FUPA 4O9EA 1CESA 2X5IC 2ZGNA 4DQAA 3N7JA 1H4HA 2WIIB 3IKWA 4XPVA 4Y1ZA 5EJ3A 1BLZA 1AZDA 2A5ZA 4XFFA 3W5NA 4DPNA 3WCRA 4R8HA 4AI1A 2BFUL 1RIRA 2VBPA 5HXMA 3TEZA 4CEWB 1FATA 1HB3A 4QPIA 5FUIA 1BHGA 5IVFA 2DTYA 2HKXA 1AR72 1BXHA 3I2FA 2H0BA 2HWE2 2I45A 4FP3A 3ZFEA 1OKOA 1HXS1 5FP7A 5AC92 1TMF3 3UESA 2PELA 4GWMA 3ZFFA 3J7NA 3AL6A 4HETA 4CSWA 1G7YA 4XUQA 1ZZ9A 1Y3TA 2Y8KA 5GKAC 3VDBA 1VLNA 1JYVA 4BIFA 4R4ZA 4WZFA 2YXSA 4Q0SA 1AXKA 5CFDA 3ZYGA 2JD9A 2R1BA 1E5RA 1CONA 1PVXA 5FYYA 3BKZA 1VBE3 2AACA 4WVZA 4MH0E 4BQ4A 3K4DA 5JR2A 2WN3A 3MDPA 5A7OA 1W99A 2X53S 3S5QA 5L9BA 2DUPA 3ACFA 4FCAA 3UT0A 5JXJA 4TXWA 4V2VA 3ILNA 1ULPA 4QPGB 3SCFA 3VD4A 4AVSA 4UFIA 4CDWC 4DUVA 2BBAA 3PUSA 3VDDC 2A71A 4XUOA 3ZXGA 5D8AA 4EN0A 2FDHA 3H0OA 1HV0A 1OA4A 2CGPA 2Z42A 1TMF1 4PI0A 4QU1A 5EYXA 2BW8A 1NCRC 1GR3A 1XC6A 2GN3A 4RS5C 4XYXA 2XJTA 1TE1B 2FD8A 4JRLA 4K1ZA 4RL7A 5FPLA 4GJYA 2DVFA 1G9AA 3RZJA 5HV4A 1VBE1 3A0NA 1HKDA 1AR93 1PNGA 2VQ0A 2WNVB 3PDQA 1X50A 4XBLA 4N43C 2D6KA 1DFQA 1VRH1 1H0BA 3LFIA 4GMP0 3RYKA 1BEV3 3WNLA 5C8CA 4YGCA 4LITA 3VHNA 1OD3A 3WXPA 4OI0A 2VTXA 5JUVA 3WP6A 1TME3 1OURA 1UW8A 4Y1VA 4FSJA 2VM9A 4QKDA 2OZ6A 1W9FA 4NHXA 1Y7BA 1IS4A 2Z69A 1W04A 2ZACA 3IN9A 1UCXA 1HXS2 1NCQA 1L7RA 3A22A 3NV2A 4FPKA 2CTVA 5FZFA 4FOYA 1QWRA 1LEDA 1US3A 1V70A 2RV9A 4KNCA 3WG3A 4EV0A 1ND3A 3MIEA 4XTMA 1RUH3 3W9AA 2GAUA 3PUIA 2BVVA 3HMYA 3OGJA 2R1DA 3GBFA 1WLTA 4Q0QA 4RA0A 4EN7B 1LB2A 5GZGA 2ATFA 1AR91 3M7AA 5ANNA 4M4RA 1NY71
chains in the Genus database with same CATH topology
2VJXA 4E8DA 5G05L 1O8SA 2VCCA 3LEIA 1UZ0A 3LE0A 2ID4A 4A42A 4TTGA 2ZXQA 3OBAA 4L0PA 2RVAA 2PQSA 4CUCA 1SG3A 1R64A 2J1TA 1W9WA 4CU8A 2Z4FA 3VD9A 1CX1A 2VZSA 4LHSA 4M4PA 3THDA 1NAEA 1JYXA 2X09A 1F4HA 4P08A 1JZ5A 2WBKA 3LPFA 3I3EA 4ZZ8A 3ABZA 1D7PM 3HEIA 1US2A 3HN3A 2ZEYA 3PUHA 2E26A 2VCBA 2QBXA 4BDVB 3SKJE 1XNAA 2VQTA 3K46A 3THCA 1JI6A 2WQ8A 3HOBA 1K12A 2B4KA 2W1SA 2V4VA 2ZEWA 4UAPA 3FHQA 3FHAA 4FI9A 4QX0A 2X10A 2Y6KA 1GMMA 2HLEA 3CKHA 3WF1A 2Y64A 4CU7A 4LQRA 3VD3A 5DQ0A 1PMJX 2J1UA 2QQLA 1K45A 2W95A 2X05A 4BK4A 1CZSA 5CZKA 3J7HA 1H6YA 3OG2A 4XUPA 3MBWA 4A41A 3OGRA 1KGYA 4ARXA 5LA0A 3WNOA 2W47A 5CYYA 4BK5A 4ZZ5A 2VCAA 4CU6A 3VDAA 1OF3A 2RJ2A 1UX7A 1PMHX 1DP0A 4RN5A 2WABA 2VC9A 4QPWA 1J83A 3OGSA 4QB6A 4A6OA 3GDBA 2VZTA 2VMDA 1H6XA 1UY1A 2DDUA 1OF4A 2E32A 1JZ6A 2BGPA 3I2HA 3D3AA 4IUGA 3HNYM 1UY2A 3SKVA 2ORXA 3DYOA 3LPGA 4XVHA 4JKKA 2VR4A 4QX3A 2Y6JA 4DUXA 3WSOA 3DYPA 3T2QA 4BXSV 1GOHA 1KEXA 3NJXA 2VTFA 1TG7A 4MO3M 3I2IA 3T0BA 4DXSA 2Y6LA 5C7GA 2W1UA 1UYXA 3OEBA 1GNYA 4AG4A 2C9KA 4GZ9A 2WAAA 1JZ2A 3WQBA 4QX1A 3AC0A 3K75B 4OZOA 1L7QA 5J1XA 1UYYA 5DN2A 4CUAA 1CZTA 4JX0A 2XHNA 1T2XA 1TVGA 2QQIA 3MO4A 3EYPA 4P02B 3ECQA 4OUEA 3WNNA 4BJ0A 1DYOA 1UMIA 5EJ1B 3I3DA 2HYXA 1EUUA 3A7QA 1W8OA 3ZM8A 2VZOA 3WEZA 4DUWA 5IFPA 4CU9A 4D0QA 3MV01 2W5FA 4QDQA 4GWJA 2W87A 1DLCA 3F2ZA 2XQXA 5IYYA 2VZVA 1JHJA 2EIDA 3C8XA 1HN1A 2VOTA 1K3IA 2VZ3A 5IJRA 3SEPA 4OYUA 2LS6A 2J1VA 4LKSA 5IFTA 3T0DA 3LEKA 3P1IA 3VD5A 1W9SA 5F7UA 2W92A 2QQJA 1JU3A 3IDAA 2V5DA 3IAPA 4UI9L 1UMHA 4OMDA 4XUNA 2VMFA 5I0DA 4QB2A 2WUHA 3ACIA 2J22A 4DEQA 5G04L 1K42A 4A3ZA 3W5MA 2ZEZA 3I2KA 2CDOA 2C26A 3UNPA 3CZJA 2R7EB 3K4ZA 4QB1A 2WO2A 2DCKA 4W8JA 2CDPA 1O59A 2VL4A 2Y6GA 1NUKA 2W9XA 2YFUA 4P00B 2XONA 2QQNA 3C7OA 5DPNA 1JU4A 1NX9A 3DECA 4W50A 3A23A 3BN6A 1MPXA 2J1EA 2VO5A 3MUZ1 4GWIA 3WF2A 5A1AA 1CIYA 5JMOA 5IHRA 5LCWL 1UXXX 2JDAA 4KWUA 1F4AA 4LPLA 4MOAA 2W91A 3WF4A 1I5PA 3HPNA 4A45A 1JYNA 3IB3A 3CMGA 3BGAA 1PX4A 3I2GA 2W46A 3GGLA 3WNPA 4ZY9A 1JZ8A 3T0AA 2WO3A 3U37A 1GOFA 4UOJA 2JKXA 3IAQA 1WCQA 3NRUA 3C7EA 2W3JA 3WNMA 4D8MA 4QDRA 2J1RA 4KI5M 3OB8A 1UY3A 1W8NA 2C4XA 3NQHA 3T2OA 4RYDA 3SEEA 1UYZA 1JZ3A 2WAOA 2YG0A 2EIEA 1O8PA 3ACHA 1YQ2A 5LA1A 2XOMA 2VMCA 2V72A 1GOGA 2OKXA 3ACGA 5HPOA 1P8JA 3DYMA 3P6BA 2W1WA 2L9LA 3T2PA 2YFZA 5C71A 1ULOA 3NNGA 2VZRA 3OGVA 4HG6B 4QDSA 1SDDB 3JXSA 3CZUA 3HNMA 4P5YA 2DCJA 2VZUA 2WZ8A 5EJZB 2QQKA 3I3BA 3HNBM 4W4ZA 2KD7A 2VZ1A 2EICA 2VZQA 4XUTA 4A44A 2E33A 2BERA 5B4XA 3C7FA 1XNTA 3CIHA 1UXZA 5EIYB 3K4AA 3OEAA 2B9VA 4MGSA 3ETPA 4Z2AA 5C70A 2QQOA 4OMCA 1SHWB 3VDCA 4ET7A 3T09A 1UY4A 2LW8A 5JXGA 1OT5A 4KMQA 3I2JA 1EUTA 3CDZB 3VD7A 2WN2A 3W5NA 5HXMA 1XPWA 2W1QA 4XURA 3WF0A 1GQPA 3FL7A 3I97A 4DXRA 5B4NA 1LNSA 2YC2A 5FUIA 1BHGA 2BZDA 4CUBA 3I2FA 3C7GA 4JKLA 1WKYA 4CVUA 1W9TA 3UESA 2WYSA 4DXTA 1W0NA 3GXUA 4XUQA 3GM8A 2Y8KA 3VDBA 2ZEXA 4JKMA 1JYVA 5JXHA 2EIBA 2JD9A 3K77A 4MGQA 1IQDC 1GU3A 2BGOA 2J1AA 2YC4A 5JR2A 3K4DA 2WN3A 1RYYA 5DMYA 1W99A 3WF3A 1J84A 3ACFA 5JXJA 5LA2A 4TXWA 1OH4A 1PX3A 1ULPA 3VD4A 2VQUA 4DUVA 3HJRA 2BBAA 2E31A 2QQMA 4XUOA 3NJVA 3LEGA 3A21A 4PF1A 3E1F1 2J1SA 2WDBA 1NKGA 1XC6A 3IIIA 2JE8A 3MUY1 4PT6A 4ZXEA 4PQQA 2WZEA 1JZ7A 4QAWA 2J7MA 1UY0A 3UETA 4YPJA 1JZ4A 3WNKA 3FN9A 4AAXA 3MV11 2Y6HA 3WNLA 1UWWA 1OD3A 5JUVA 2W94A 4A4AA 2VM9A 3LQCA 5JXIA 4MADA 3C7HA 3EB7A 3CQOA 4JHZA 3A22A 1L7RA 1JYWA 3T08A 1US3A 2RV9A 1CZVA 4QX2A 2ORZA 3PUIA 2WO1A 2VMEA 2YB7A 4ARYA 4XZUG 4DEVA 4E8CA 1GUIA 4M4RA 2VZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJX A;  4E8D A;  5G05 L;  1O8S A;  2VCC A;  3LEI A;  1UZ0 A;  3LE0 A;  2ID4 A;  4A42 A;  4TTG A;  2ZXQ A;  3OBA A;  4L0P A;  2RVA A;  2PQS A;  4CUC A;  1SG3 A;  1R64 A;  2J1T A;  1W9W A;  4CU8 A;  2Z4F A;  3VD9 A;  1CX1 A;  2VZS A;  4LHS A;  4M4P A;  3THD A;  1NAE A;  1JYX A;  2X09 A;  1F4H A;  4P08 A;  1JZ5 A;  2WBK A;  3LPF A;  3I3E A;  4ZZ8 A;  3ABZ A;  1D7P M;  3HEI A;  1US2 A;  3HN3 A;  2ZEY A;  3PUH A;  2E26 A;  2VCB A;  2QBX A;  4BDV B;  3SKJ E;  1XNA A;  2VQT A;  3K46 A;  3THC A;  1JI6 A;  2WQ8 A;  3HOB A;  1K12 A;  2B4K A;  2W1S A;  2V4V A;  2ZEW A;  4UAP A;  3FHQ A;  3FHA A;  4FI9 A;  4QX0 A;  2X10 A;  2Y6K A;  1GMM A;  2HLE A;  3CKH A;  3WF1 A;  2Y64 A;  4CU7 A;  4LQR A;  3VD3 A;  5DQ0 A;  1PMJ X;  2J1U A;  2QQL A;  1K45 A;  2W95 A;  2X05 A;  4BK4 A;  1CZS A;  5CZK A;  3J7H A;  1H6Y A;  3OG2 A;  4XUP A;  3MBW A;  4A41 A;  3OGR A;  1KGY A;  4ARX A;  5LA0 A;  3WNO A;  2W47 A;  5CYY A;  4BK5 A;  4ZZ5 A;  2VCA A;  4CU6 A;  3VDA A;  1OF3 A;  2RJ2 A;  1UX7 A;  1PMH X;  1DP0 A;  4RN5 A;  2WAB A;  2VC9 A;  4QPW A;  1J83 A;  3OGS A;  4QB6 A;  4A6O A;  3GDB A;  2VZT A;  2VMD A;  1H6X A;  1UY1 A;  2DDU A;  1OF4 A;  2E32 A;  1JZ6 A;  2BGP A;  3I2H A;  3D3A A;  4IUG A;  3HNY M;  1UY2 A;  3SKV A;  2ORX A;  3DYO A;  3LPG A;  4XVH A;  4JKK A;  2VR4 A;  4QX3 A;  2Y6J A;  4DUX A;  3WSO A;  3DYP A;  3T2Q A;  4BXS V;  1GOH A;  1KEX A;  3NJX A;  2VTF A;  1TG7 A;  4MO3 M;  3I2I A;  3T0B A;  4DXS A;  2Y6L A;  5C7G A;  2W1U A;  1UYX A;  3OEB A;  1GNY A;  4AG4 A;  2C9K A;  4GZ9 A;  2WAA A;  1JZ2 A;  3WQB A;  4QX1 A;  3AC0 A;  3K75 B;  4OZO A;  1L7Q A;  5J1X A;  1UYY A;  5DN2 A;  4CUA A;  1CZT A;  4JX0 A;  2XHN A;  1T2X A;  1TVG A;  2QQI A;  3MO4 A;  3EYP A;  4P02 B;  3ECQ A;  4OUE A;  3WNN A;  4BJ0 A;  1DYO A;  1UMI A;  5EJ1 B;  3I3D A;  2HYX A;  1EUU A;  3A7Q A;  1W8O A;  3ZM8 A;  2VZO A;  3WEZ A;  4DUW A;  5IFP A;  4CU9 A;  4D0Q A;  3MV0 1;  2W5F A;  4QDQ A;  4GWJ A;  2W87 A;  1DLC A;  3F2Z A;  2XQX A;  5IYY A;  2VZV A;  1JHJ A;  2EID A;  3C8X A;  1HN1 A;  2VOT A;  1K3I A;  2VZ3 A;  5IJR A;  3SEP A;  4OYU A;  2LS6 A;  2J1V A;  4LKS A;  5IFT A;  3T0D A;  3LEK A;  3P1I A;  3VD5 A;  1W9S A;  5F7U A;  2W92 A;  2QQJ A;  1JU3 A;  3IDA A;  2V5D A;  3IAP A;  4UI9 L;  1UMH A;  4OMD A;  4XUN A;  2VMF A;  5I0D A;  4QB2 A;  2WUH A;  3ACI A;  2J22 A;  4DEQ A;  5G04 L;  1K42 A;  4A3Z A;  3W5M A;  2ZEZ A;  3I2K A;  2CDO A;  2C26 A;  3UNP A;  3CZJ A;  2R7E B;  3K4Z A;  4QB1 A;  2WO2 A;  2DCK A;  4W8J A;  2CDP A;  1O59 A;  2VL4 A;  2Y6G A;  1NUK A;  2W9X A;  2YFU A;  4P00 B;  2XON A;  2QQN A;  3C7O A;  5DPN A;  1JU4 A;  1NX9 A;  3DEC A;  4W50 A;  3A23 A;  3BN6 A;  1MPX A;  2J1E A;  2VO5 A;  3MUZ 1;  4GWI A;  3WF2 A;  5A1A A;  1CIY A;  5JMO A;  5IHR A;  5LCW L;  1UXX X;  2JDA A;  4KWU A;  1F4A A;  4LPL A;  4MOA A;  2W91 A;  3WF4 A;  1I5P A;  3HPN A;  4A45 A;  1JYN A;  3IB3 A;  3CMG A;  3BGA A;  1PX4 A;  3I2G A;  2W46 A;  3GGL A;  3WNP A;  4ZY9 A;  1JZ8 A;  3T0A A;  2WO3 A;  3U37 A;  1GOF A;  4UOJ A;  2JKX A;  3IAQ A;  1WCQ A;  3NRU A;  3C7E A;  2W3J A;  3WNM A;  4D8M A;  4QDR A;  2J1R A;  4KI5 M;  3OB8 A;  1UY3 A;  1W8N A;  2C4X A;  3NQH A;  3T2O A;  4RYD A;  3SEE A;  1UYZ A;  1JZ3 A;  2WAO A;  2YG0 A;  2EIE A;  1O8P A;  3ACH A;  1YQ2 A;  5LA1 A;  2XOM A;  2VMC A;  2V72 A;  1GOG A;  2OKX A;  3ACG A;  5HPO A;  1P8J A;  3DYM A;  3P6B A;  2W1W A;  2L9L A;  3T2P A;  2YFZ A;  5C71 A;  1ULO A;  3NNG A;  2VZR A;  3OGV A;  4HG6 B;  4QDS A;  1SDD B;  3JXS A;  3CZU A;  3HNM A;  4P5Y A;  2DCJ A;  2VZU A;  2WZ8 A;  5EJZ B;  2QQK A;  3I3B A;  3HNB M;  4W4Z A;  2KD7 A;  2VZ1 A;  2EIC A;  2VZQ A;  4XUT A;  4A44 A;  2E33 A;  2BER A;  5B4X A;  3C7F A;  1XNT A;  3CIH A;  1UXZ A;  5EIY B;  3K4A A;  3OEA A;  2B9V A;  4MGS A;  3ETP A;  4Z2A A;  5C70 A;  2QQO A;  4OMC A;  1SHW B;  3VDC A;  4ET7 A;  3T09 A;  1UY4 A;  2LW8 A;  5JXG A;  1OT5 A;  4KMQ A;  3I2J A;  1EUT A;  3CDZ B;  3VD7 A;  2WN2 A;  3W5N A;  5HXM A;  1XPW A;  2W1Q A;  4XUR A;  3WF0 A;  1GQP A;  3FL7 A;  3I97 A;  4DXR A;  5B4N A;  1LNS A;  2YC2 A;  5FUI A;  1BHG A;  2BZD A;  4CUB A;  3I2F A;  3C7G A;  4JKL A;  1WKY A;  4CVU A;  1W9T A;  3UES A;  2WYS A;  4DXT A;  1W0N A;  3GXU A;  4XUQ A;  3GM8 A;  2Y8K A;  3VDB A;  2ZEX A;  4JKM A;  1JYV A;  5JXH A;  2EIB A;  2JD9 A;  3K77 A;  4MGQ A;  1IQD C;  1GU3 A;  2BGO A;  2J1A A;  2YC4 A;  5JR2 A;  3K4D A;  2WN3 A;  1RYY A;  5DMY A;  1W99 A;  3WF3 A;  1J84 A;  3ACF A;  5JXJ A;  5LA2 A;  4TXW A;  1OH4 A;  1PX3 A;  1ULP A;  3VD4 A;  2VQU A;  4DUV A;  3HJR A;  2BBA A;  2E31 A;  2QQM A;  4XUO A;  3NJV A;  3LEG A;  3A21 A;  4PF1 A;  3E1F 1;  2J1S A;  2WDB A;  1NKG A;  1XC6 A;  3III A;  2JE8 A;  3MUY 1;  4PT6 A;  4ZXE A;  4PQQ A;  2WZE A;  1JZ7 A;  4QAW A;  2J7M A;  1UY0 A;  3UET A;  4YPJ A;  1JZ4 A;  3WNK A;  3FN9 A;  4AAX A;  3MV1 1;  2Y6H A;  3WNL A;  1UWW A;  1OD3 A;  5JUV A;  2W94 A;  4A4A A;  2VM9 A;  3LQC A;  5JXI A;  4MAD A;  3C7H A;  3EB7 A;  3CQO A;  4JHZ A;  3A22 A;  1L7R A;  1JYW A;  3T08 A;  1US3 A;  2RV9 A;  1CZV A;  4QX2 A;  2ORZ A;  3PUI A;  2WO1 A;  2VME A;  2YB7 A;  4ARY A;  4XZU G;  4DEV A;  4E8C A;  1GUI A;  4M4R A;  2VZP A; 
#chains in the Genus database with same CATH topology
 5K0U A;  5A3O A;  4DRR A;  2VBB A;  4EWE A;  1LTE A;  1BEV 1;  1VMJ A;  4U36 A;  1LGB A;  1SBD A;  5KXC A;  1UZ0 A;  2JG8 B;  1TME 1;  2PTM A;  1SLL A;  2V73 A;  4D6R A;  4A42 A;  4TTG A;  1VBD 3;  2XBO 3;  4CE8 A;  4ZON A;  3WDW A;  4CUC A;  1DQ0 A;  2WA4 A;  3WHU A;  4QQH A;  1W9W A;  4Z82 A;  2XLG A;  1UL9 A;  4M01 A;  1KFU L;  1TMF 2;  3U78 A;  3VZM A;  4NVP A;  4CDQ C;  4Z1V A;  1CX1 A;  3RI9 A;  5TSW A;  2W68 A;  1RUF 3;  4B4R A;  4FTE A;  5GLU A;  4AHZ A;  3O0V A;  4FFI A;  4CCO A;  2G4I A;  4H3W A;  3NJZ A;  4GJZ A;  4EN8 B;  5DAQ A;  5DUV A;  3TBD A;  1UZZ A;  5GM0 A;  1OA2 A;  1VBE 2;  4RFR B;  4Q1R A;  4UF0 B;  4XF0 A;  2UWB A;  5FYV A;  1XNK A;  2G19 A;  4P9I A;  4QX5 A;  2JX9 A;  4ZZ8 A;  2EXH A;  1QJE A;  1RVF 2;  3LIG A;  1AJO A;  1VRH 2;  4AQ2 A;  4NPL A;  3O1S A;  2VOX A;  2X5I B;  2ZEY A;  2VXR A;  4FVV A;  5KXD A;  2A1X A;  2VCB A;  2QBX A;  3SKJ E;  1VBD 1;  2XBO 1;  4OFG A;  3K46 A;  5EWS A;  3THC A;  1JI6 A;  1QNY A;  5A80 A;  2HBU A;  1AX2 A;  2O0O A;  1K12 A;  5C6C A;  2W1S A;  4CUG A;  1T6B X;  1JOP A;  2AC1 A;  4RSU A;  4CDU C;  3N9Q A;  1CX4 A;  4YLZ A;  5FP4 A;  4B1M A;  4JTO A;  1RUF 1;  2BUK A;  3VL8 A;  1RMU 1;  2Y64 A;  2D44 A;  3AMQ A;  5IVC A;  2WYF A;  4LQR A;  5LBE A;  4BE3 A;  3SCG A;  5DQ0 A;  1PVC 2;  1ODN A;  2ARC A;  3RG0 A;  2WNU A;  1DGW A;  5FZG A;  4UFM A;  5E16 A;  3WT3 A;  4EJR A;  1KQR A;  2NQY A;  1BEV 2;  2XLF A;  4XUP A;  4HK8 A;  5A7N A;  3M1H A;  4FFF A;  2R04 3;  4PLM A;  4A41 A;  5C3R A;  1TME 2;  1DIW A;  1FV2 A;  2WKK A;  2XML A;  3WOG A;  2A6Y A;  3ILF A;  4Q8K A;  4Q2F A;  2VCA A;  5CIR A;  2ZML A;  3POW A;  2K46 A;  1WCD J;  5CG8 A;  1OHF A;  4CDW B;  2D6N A;  2P6C A;  5JLV A;  3OJB A;  5FY1 A;  2PLV 2;  4KH9 A;  4B7K A;  2PHR A;  4QHO A;  5BV6 A;  2ZKN A;  4NO4 A;  2KM2 A;  4Y22 B;  2VC9 A;  2EAK A;  2ZGS A;  3F95 A;  1J83 A;  2GC2 A;  4RS5 B;  5FWE A;  1XBF A;  1H4G A;  1U12 A;  1H6X A;  1JYC A;  1QMJ A;  4JGZ A;  3KT7 A;  4RQP C;  1WW4 A;  3SQO A;  2DDU A;  1OF4 A;  1U5X A;  5CFC C;  1QHD A;  1ZBE 1;  3N9L A;  3D3A A;  4IUG A;  3B69 A;  3ZX7 A;  1UY2 A;  2R04 1;  5FZ0 A;  3T3Y A;  2ORX A;  3DYO A;  4AI8 A;  2JB4 A;  4Q26 A;  4N43 B;  5C9A A;  2XBO 2;  1VB2 A;  1S2E A;  4Q0P A;  4AEJ A;  4UT5 A;  2C0Z A;  3W59 A;  5FBJ A;  2CNA A;  4AVC A;  4NWW A;  1OFS A;  4K21 A;  3ME2 A;  4GWN A;  5BNP B;  4IW3 A;  4CEY C;  3T0B A;  3USU A;  3DV8 A;  4HLT A;  4NPM A;  2VVE A;  3O1M A;  1CVN A;  1GKB A;  2BOI A;  3CBN A;  4AHY A;  1RUE 3;  4WBB A;  4Y33 A;  2WWU A;  5L73 A;  4Y3O A;  1RMU 2;  3ZXD A;  4AG4 A;  2JE7 A;  4I09 A;  5CKQ A;  4TN7 A;  3M2M A;  1ZNP A;  4QX1 A;  3KQ4 B;  3L2Y A;  4HVQ A;  1VJ2 A;  3RWK X;  4CUA A;  1QEX A;  5FZB A;  2JJ6 A;  1W2T A;  2B5H A;  1F5J A;  2QQI A;  2VOK A;  3EYP A;  2ZAB A;  1VBC 1;  3WR0 A;  1UMI A;  4IGO A;  4BJ0 A;  5FR3 A;  2HYX A;  5K7P A;  2VU9 A;  1UU6 A;  3ZM8 A;  4K6B A;  3B00 A;  1NLR A;  5E6H A;  3N7K A;  1N1V A;  3PIG A;  3H1M A;  4ORF A;  1V6J A;  4XBQ A;  4BZ4 A;  2XLA A;  4GWJ A;  3DGT A;  4BA6 A;  3ES4 A;  4I0W B;  3B9I A;  3TEW A;  4LO5 B;  3OOX A;  3C8X A;  4QPI C;  5FXV A;  5CAZ A;  3VHR A;  1HN1 A;  5A3P A;  1RUE 1;  3S30 A;  4M0H A;  4HKO A;  4HXC A;  5ANQ A;  2V4A A;  3ZFE C;  1NOV A;  3I7D A;  1VBB 3;  1WW6 A;  5ABJ A;  1DGL A;  3WDT A;  1BMV 2;  2JD4 A;  3Q8F A;  5D2A A;  2J1V A;  4BQ5 A;  5CG9 A;  4Y1Y A;  3ZFF C;  1H8V A;  4UWD A;  3WX5 A;  4WVM B;  2ZGM A;  1XYO A;  3ZDS A;  1PMI A;  4B4P A;  2C5D A;  1ZM1 A;  2ZHM A;  3T0D A;  1ZBE 2;  5CFD C;  4LBQ A;  2RMU 3;  5F7U A;  2R04 2;  4XDO A;  3IDE A;  5T5O A;  4J1X A;  1JU3 A;  2V5D A;  3IAP A;  4UI9 L;  1RJ7 A;  1AVB A;  1A8D A;  1AJK A;  1ULD A;  4DY3 A;  3LGR A;  2RS5 3;  1XSR A;  4OI4 A;  2WQ4 A;  2VUC A;  1O4Z A;  2VQA A;  1SLA A;  5F5C A;  3CJX A;  4DEQ A;  2XGX A;  5G04 L;  4P9G A;  1K42 A;  3Q8E A;  3AK0 A;  4A3Z A;  4AQT A;  5IT6 A;  3I2K A;  1H8T A;  3MZH A;  5D8A C;  3CU7 A;  4CDU B;  1MVE A;  4QGL A;  2WO2 A;  1LOF A;  1VBB 1;  5AVP A;  2Q1F A;  5FYB A;  4CA9 A;  4YVS B;  2CWM A;  3MIF A;  2SLI A;  1GBG A;  1CPM A;  1ZZ6 A;  2XQR A;  1JW6 A;  3GBW A;  2ADE A;  5AVA A;  3VHO A;  5F32 A;  2PMW B;  3HQR A;  1NUK A;  1MZF A;  2Q8C A;  5A1L A;  1D4M 3;  1VBC 2;  1MS4 A;  1ZRR A;  2RMU 1;  5I91 A;  2UU8 A;  3C7O A;  2GN7 A;  4X6Q B;  2JWP A;  1LOG A;  3T2T A;  1LHN A;  3FBY A;  2QFE A;  4H2A A;  4ZU7 A;  3MEP A;  1CAX A;  3BN6 A;  4GKX A;  4LBK A;  4EZ4 A;  2VO5 A;  4MSV A;  3BIE A;  1XNB A;  4HON A;  3WW2 A;  3D4K A;  2UWC A;  4ATE A;  5C8C C;  2FHR A;  4LUM A;  1Y9Q A;  4IEU A;  3WLU A;  5J36 A;  4NWV A;  2Y34 A;  1N3O A;  4Q27 A;  4C8D A;  2O14 A;  1DYK A;  2IXI A;  2HJI A;  4JQR A;  1RIT A;  1NCQ C;  1CAV B;  4YVW A;  1S4C A;  1YQ8 A;  2ES3 A;  5FZ8 A;  2VBD A;  4DMI A;  1I5Z A;  5T5J A;  2VW1 A;  1QOS A;  4N8M A;  2G9F A;  4Y20 B;  4A7Y A;  1ND3 C;  1D4M 1;  4PDW A;  3I2G A;  2B46 X;  1R1A 2;  2XJU A;  3O1U A;  4UYB A;  4JGY B;  1JZ8 A;  3HR9 A;  2YU2 A;  3T0A A;  5CFC B;  2VXJ A;  1B35 A;  3ZXF A;  3CEW A;  3ON7 A;  3RDI A;  2WQZ C;  5FZO A;  2JKX A;  4CCM A;  1O7F A;  1WCQ A;  3H42 B;  4D3W A;  3C7E A;  3WNM A;  5J96 B;  1QU0 A;  3LOI A;  2PYT A;  5A7W B;  4QDR A;  5GLT A;  3ZXE A;  2BNN A;  1REE A;  1LGC A;  4LK6 A;  4E27 A;  3MPB A;  3MLL A;  3OTF A;  2EXI A;  4ONU A;  4CEY B;  5IK7 A;  3N4M A;  5KXE A;  2P34 A;  3NQH A;  4H7M A;  4UFK A;  1VP6 A;  4RYD A;  3JQW A;  1ZZB A;  1WCS A;  4XJW A;  4LR4 A;  2Q8E A;  3O12 A;  3I2O A;  1W3X A;  4YM3 A;  2VUL A;  1S0F A;  3ACH A;  4HZF A;  5FP9 A;  1XJA A;  5GAL A;  2V72 A;  5DG1 A;  5J98 B;  3S7E A;  1QJF A;  1ZRI A;  2DVD A;  2YY1 A;  4HN1 A;  1OD5 A;  5HPO A;  1UKR A;  3J8F 2;  5JR7 B;  2Q30 A;  3AJY A;  3POE A;  2XKO A;  5FYS A;  2GDF A;  3BCW A;  2JEN A;  3N9O A;  1U5Y A;  5C71 A;  5IK8 A;  3OGV A;  2ZGL A;  1ZRF A;  4OHZ A;  1UOJ A;  2ET7 A;  2PHL A;  1SDD B;  3TOJ A;  1RC6 A;  4O65 A;  3HD8 B;  1JTZ X;  4IQP A;  4E2G A;  1HRV 2;  2EAA A;  2ARX A;  3MF6 A;  4O9G A;  4N53 C;  1OXC A;  4P9Y A;  4R9C A;  4XTP A;  3ZMN A;  2DCJ A;  4QPI B;  5EJZ B;  2GSY A;  2D5F A;  3IWZ A;  1UZV A;  3WP3 A;  2VZ1 A;  1YQ6 A;  4QM8 A;  4RHV 3;  4MGI E;  3UGG A;  1LU2 A;  2IXK A;  4A44 A;  1QH7 A;  4NHK A;  4Y1U A;  5LBB A;  2OT7 A;  3ZSJ A;  3ZFF B;  1O5L A;  3I54 A;  3KF5 A;  2BER A;  4N7I A;  5B4X A;  3C7F A;  3Q8C A;  2WT1 A;  4XMI A;  2WNU C;  4I30 A;  3BYW A;  3CIH A;  3UL2 A;  4F8A A;  1FPN 2;  1IKP A;  4LKD A;  4LUK A;  4WM7 A;  5KHJ A;  2BNO A;  1LEM A;  4OHX A;  3CNA A;  3GZA A;  3OEA A;  4L99 A;  1QGL A;  2B9V A;  1FNY A;  4LJH A;  5HXV A;  3SMH A;  4Y26 A;  2VY0 A;  3C2U A;  3IZO A;  3RNS A;  5C70 A;  3OY8 A;  5JOZ A;  2QQO A;  3LB9 A;  1W06 A;  3TNP B;  4HVO A;  1XYN A;  5L9R A;  3T09 A;  1UY4 A;  5FK8 A;  4DOU A;  1SDW A;  3IDB B;  3I59 A;  1G9D A;  4QXB A;  4HFS A;  1DZR A;  4WV8 A;  3E97 A;  1WUV A;  1MQT C;  5D8A B;  5FZC A;  4RHV 1;  4XJU A;  3VD7 A;  2WN2 A;  3UKN A;  3GZU C;  2ZHK A;  2TBV A;  4CDX B;  3G7D A;  4QU2 A;  2D3R A;  5A7P A;  3U11 A;  1W8T A;  3URF A;  4DXR A;  1LNS A;  2YC2 A;  2ZGQ A;  5IK4 A;  1SLB A;  2QKD A;  1WMF A;  4NR1 A;  4JGZ C;  3AB0 A;  3C7G A;  2EXJ A;  3ZIW A;  4CCC A;  4XJ9 A;  1COV 2;  2ZHN A;  3ZXJ A;  5FZ1 A;  2GC3 A;  4ZS2 A;  1Z7S 3;  4LIU A;  4LBQ D;  5DZG A;  2YPJ A;  1Q8Q A;  4DXT A;  4XAA A;  5GJ6 A;  4ITC A;  1MS3 A;  1UPS A;  1C8M 3;  2V5Y A;  1W8Z A;  3NV4 A;  5LAT A;  2G9Z A;  2RS1 2;  4BIS A;  4JDO A;  4AQS A;  2A6X A;  4DIN B;  5C8C B;  3MIB A;  5JXH A;  4YM2 A;  2B9U A;  5DDJ 2;  2PHW A;  4FQZ A;  1LAJ A;  4IV3 A;  3AFG A;  2FCV A;  2YC4 A;  1JH5 A;  4AGG A;  5J37 A;  5DMY A;  5FY4 A;  1FMD 2;  2E53 A;  3AYA A;  3ZVX A;  2B8M A;  1GP5 A;  2CSG A;  1POQ A;  4GH4 B;  1NCQ B;  3V0B A;  5LA2 A;  4IV1 A;  1OH4 A;  3WIN E;  2G9G A;  3POS A;  3ITQ A;  4K8F A;  2OYZ A;  1CAU A;  4FPL A;  1I1E A;  1R09 2;  3PU8 A;  4C0B A;  1NLS A;  2QQM A;  1ND3 B;  2R0H A;  3LF7 A;  3P5B A;  5FCC A;  1YUD A;  2GNT A;  1AR7 3;  2W2I A;  4FPO B;  2HWE 3;  5A33 A;  2WDB A;  3VBR B;  4IEW A;  1GZW B;  3JCI A;  5AC9 3;  3III A;  3VZJ A;  2JE8 A;  1C8M 1;  5T50 A;  5K0U B;  2DBN A;  2Y26 A;  1ZZ8 A;  4ISR A;  2D98 A;  3PTY A;  1GNZ A;  4HMZ A;  2BBV A;  2J7M A;  4Y5Z 0;  2ZX0 A;  2PHT A;  2ENR A;  4QQL A;  4DRV A;  3FJS A;  5F5I A;  1JZ4 A;  4ZS3 A;  2IFR A;  1MZ6 A;  3WNK A;  3SH3 A;  4AYU A;  3BIW E;  3MV1 1;  5FO9 B;  3WVJ A;  1W2U A;  4CYD A;  1KFX L;  4XCA A;  1QXP A;  2GH2 A;  4AW7 A;  1EV1 3;  2RR1 2;  2QVS B;  1JYT A;  2W0X A;  2ILM A;  5ABJ C;  1Q8S A;  4LO6 B;  1NG0 A;  1ZVF A;  2EVX A;  4A4A A;  4UFL A;  5LWB A;  3LQC A;  4JC1 A;  4MXW A;  5J7M A;  5JXI A;  4L92 A;  1BBT 2;  1SBE A;  3O14 A;  4IET A;  3TWI A;  1AR7 1;  4N9I A;  3EB7 A;  2P3J A;  2HWE 1;  2ZX2 A;  4JHT A;  2LM3 A;  3W20 A;  4Q5O A;  2IUW A;  1ZZ7 A;  4KGG A;  4YW4 A;  2XJV A;  4YFZ A;  5AC9 1;  3H7Y A;  5C3S A;  5I8Y A;  1ZA4 A;  1CZV A;  1DHK B;  2E7Q A;  2D6M A;  2CAU A;  1U0A A;  2YZ4 A;  3NAP C;  3IBM A;  1FI2 A;  1QQP 2;  4I3P A;  3H8X A;  2XPJ A;  1ND2 A;  2ORZ A;  3JU9 A;  4XIL A;  2VME A;  4ASK A;  2WT2 A;  5A3W A;  1J3R A;  2D40 A;  3CJI A;  3RVH A;  4PBO A;  1MS9 A;  3U4X A;  3B94 A;  3D0J A;  2V09 A;  2VZP A;  4HBN A;  3P3P A;  1CQ9 A;  4YZ4 A;  5FFO C;  5G05 L;  2DVB A;  1H8T C;  3E5X A;  2WL1 A;  2UY9 A;  2VCC A;  1EV1 1;  5J3U A;  4Y5S A;  1FT9 A;  1OVP A;  1LOF C;  4QKN A;  1W2A X;  4AHX A;  3ZDV A;  1UU4 A;  5DAB A;  2WZP P;  2ID4 A;  3RI8 A;  4CZS A;  3WDX A;  5A32 A;  5JPN B;  4L0P A;  4P9X A;  4XF3 A;  2R07 2;  3DPR A;  5F5A A;  4NOT A;  1SG3 A;  2BJS A;  2HEW F;  4AGR A;  2Z2S B;  4YW7 A;  5LAS A;  2YU1 A;  2VMG A;  3ATG A;  3DEM A;  4K40 A;  2DFB A;  4RR3 A;  4XC9 A;  3ZIX A;  5C33 A;  2WNU B;  2YBP A;  2R0F A;  2ZS6 B;  4CU8 A;  1W0P A;  4QXK A;  2DU1 A;  2VZS A;  1NAE A;  1W05 A;  3LOB A;  4LO8 A;  3RZZ A;  2X09 A;  3CL1 A;  1SEF A;  2XH6 A;  3U0Z A;  3K3N A;  2TEP A;  2WBK A;  3TN9 2;  1EYB A;  1YJL A;  2P5B A;  3LZZ A;  5FJH A;  5T5L A;  5GLW A;  3ZFG A;  2WFF 2;  1WCU A;  5FZ9 A;  5HBA A;  3W21 A;  3O1P A;  1YFW A;  1D7P M;  2P2K A;  4AK3 A;  4MVT A;  2RDR A;  1US2 A;  3RFR A;  4AI0 A;  4NIH A;  4HN0 A;  1H2N A;  3RZK A;  1XSQ A;  1VAL A;  3PUH A;  4QQO A;  3BOW A;  1V00 A;  4YVW C;  4NII A;  1XNA A;  2LAL A;  1RJ8 A;  4D7S A;  3M4F A;  4JAA A;  4DO0 A;  3QCW A;  2X8K A;  1PZ8 A;  3AP5 A;  2I07 B;  1OSG A;  1WW7 A;  2CY6 A;  2V4V A;  3H8U A;  3A4U A;  2ZEW A;  4IXL A;  4UAP A;  1LCL A;  2P3I A;  2PHF A;  2QQV A;  2RM2 2;  1F5F A;  1JOD A;  1VPH A;  3FHA A;  4PDW C;  2F4P A;  3VBO A;  2DBI A;  2Y6K A;  1DF0 A;  1S0B A;  4UFJ A;  1OA3 A;  1B35 C;  2HLE A;  3WF1 A;  1VR3 A;  5FUN A;  3VKO A;  2GP5 A;  4CU7 A;  1KJR A;  3UKT A;  3ZPY A;  4QPY A;  4DB5 A;  1PZ9 A;  1QDO A;  3RYR A;  1CJD A;  3L2H A;  2Z5W A;  3E6D A;  5C9A B;  3O5S A;  3HVD A;  5I0U A;  1F2N A;  1KS4 A;  2JEM A;  2P37 A;  2PAM A;  3LA3 A;  2W95 A;  4HSJ A;  3UGF A;  5F3E A;  1UF2 C;  1H6Y A;  3IT8 A;  3OG2 A;  2D43 A;  1EV1 2;  1JOJ A;  1RVF 3;  2ADD A;  3MBW A;  4GXL A;  1VRH 3;  1URX A;  1UQX A;  3USU B;  3ZYH A;  2BPA 2;  4XE9 A;  3ZYI B;  3KMH A;  4IDZ A;  1W90 A;  2GAL A;  2VW2 A;  5CYY A;  4BK5 A;  4D7Y A;  1JHN A;  1LOB A;  3LA2 A;  4AHW A;  3JB8 A;  4LT5 A;  2FDK A;  1UZY A;  4GD4 A;  4XDQ A;  4OHV A;  1DQ4 A;  3ZN5 A;  1I9R A;  1WWY A;  1H2L A;  2HWF 2;  4NPR A;  2WAB A;  3I49 A;  3BOD A;  4QGN A;  5FYU A;  4NN0 A;  4DNY A;  3V64 A;  3KV9 A;  1XU1 A;  3OGS A;  2ZX1 A;  2QZ3 A;  1PGS A;  4X6R B;  4QKF A;  3NKG A;  1S0G A;  2VMD A;  4MET A;  3KZ4 C;  1UY1 A;  3THP A;  1PVC 3;  4LBL A;  2ZA9 A;  4CCK A;  5I0R A;  1JUH A;  2HEY F;  2BGP A;  5BNN A;  1VMH A;  1RVF 1;  2Y33 A;  5FOB B;  2JIC A;  3LPG A;  1O91 A;  1XOY A;  4W6W A;  3JUU A;  2FQP A;  3U10 A;  2Y60 A;  5FWJ A;  3WV6 A;  3DUI A;  2Y6J A;  5SV8 A;  5DAV A;  3RZH A;  2Q4S A;  2BEO A;  3O0X A;  2AH2 A;  1GOH A;  3NJX A;  4AFM A;  1V6L A;  4NUB A;  5FPX A;  1Q8O A;  4CPB A;  1C1L A;  2DUQ A;  2IXC A;  3FWE A;  3I2I A;  1UOB A;  1C5I A;  2JDM A;  2IFW A;  3FBM A;  1AUY A;  4K20 A;  4W6X A;  3R6S A;  3ZYP A;  1KS5 A;  2W1U A;  4E4S A;  4KWL A;  2NPI A;  5IK5 A;  2PLV 3;  2BOJ A;  4GZ9 A;  4WM7 C;  1RHI 3;  4LBQ B;  1C5H A;  1JZ2 A;  1Q3E A;  3WQB A;  2FDJ A;  1N1T A;  2JDN A;  3AC0 A;  3AZV A;  2NMO A;  1QDC A;  1UYY A;  5FMO L;  1OKQ A;  1CZT A;  4JX0 A;  1HIX A;  1PVC 1;  4BLI A;  5GZC A;  3JD7 2;  3UGH A;  1WMD A;  2GNB A;  1T2X A;  5CU1 A;  5DZE A;  4IL7 A;  3VBU A;  4P02 B;  4Y4R A;  2OQ7 A;  4B29 A;  1AR6 2;  1DYO A;  1NQJ A;  1XB9 A;  1IOA A;  2VZO A;  2GP3 A;  4DUW A;  5D1I A;  5IFP A;  4CU9 A;  1GLH A;  1Z78 A;  4NHL A;  2VGD A;  4YNI A;  4YWA A;  4GAZ A;  3IM0 A;  1OLR A;  2NMN A;  4FFG A;  4QDQ A;  1W2O A;  2IXL A;  2OII A;  2B45 X;  2XQX A;  1BVV A;  3KS7 A;  2C1F A;  2WIN B;  2XJR A;  1JHJ A;  2EID A;  4MHR A;  1RUI 2;  4IEO A;  2PLV 1;  2QQW A;  3PUQ A;  5FYH A;  5FZ4 A;  1RHI 1;  2VOT A;  1W6P A;  1K3I A;  2BVB A;  3PME A;  3WW4 A;  5L9V A;  1RMU 3;  4BQX A;  1OUS A;  4LEJ A;  4YZ2 A;  2FZ2 A;  4LKS A;  4GKY A;  1CAX B;  3AXD A;  5FTT C;  1HDK A;  5FYI A;  3ZYF A;  3AVS A;  3KWV A;  1ST8 A;  4WM8 A;  2FCU A;  3LEK A;  4CTE A;  3ZSK A;  3VD5 A;  5KBF A;  3ZR6 A;  2W92 A;  1HQL A;  4K9S A;  5EFU A;  4IV3 C;  1MS0 A;  4M3C B;  5F9T A;  4NRM A;  1NZC A;  1UMH A;  4TLG A;  4UBH A;  4W6Y A;  2R06 3;  1ENQ A;  5L7O A;  1GZ9 A;  3Q8A A;  4QB2 A;  2PFW A;  4IEV A;  2WUH A;  5LRS A;  1LU1 A;  1ULC A;  1POV 3;  2D5H A;  1IG3 A;  1X36 A;  4PHZ A;  4IV1 C;  4YVW B;  4AL9 A;  4N53 A;  4M3C F;  4OHW A;  5JIA A;  3WNX A;  5CIS A;  4FTS A;  1W8U A;  1A3K A;  2ZGK A;  3ES1 A;  3W5M A;  2BWA A;  3B9C A;  4LLF A;  4FT8 A;  1WME A;  2CDO A;  4G4F A;  2C26 A;  3SC7 X;  3UNP A;  1O4T A;  5FZH A;  4ZPI A;  1Y43 B;  4PDW B;  4QB1 A;  1ZBA 2;  1ASJ 3;  2BWC A;  1OOP A;  4QD2 A;  3ETQ A;  5BYN A;  4R9B A;  5EHD A;  1O4Y A;  1B35 B;  2JE9 A;  4XJZ A;  2WZR 2;  2HWC 1;  4FAG A;  5FZO B;  4XQD A;  4MLO A;  3T1L A;  1MZE A;  1H1M A;  3HBK A;  2WLQ A;  3OBT A;  4ZU5 A;  4COW A;  3POY A;  2ARE A;  1ZBE 3;  1TEI A;  1W6O A;  1EAH 1;  1YWK A;  1XNC A;  2HYK A;  1HN0 A;  1JU4 A;  3QH6 A;  2R06 1;  3NNL A;  3H3U A;  2PHD A;  5KHK A;  2A6W A;  5F3I A;  2DVA A;  3GF6 A;  3UJO A;  1W6Q A;  2WJS A;  5A1A A;  1POV 1;  1UMZ A;  3ILR A;  1UIK A;  3JQX A;  2DUO A;  3LSE A;  5F2S A;  5IHR A;  1UXX X;  2JDA A;  2KA3 A;  1SFP A;  4NAM A;  1MQT A;  3VDD B;  1YEW A;  2VMH A;  3N35 A;  2WLP A;  1S2K A;  3MLJ A;  4OZX A;  5BNO A;  3HAG A;  5AFE A;  1RHI 2;  4Q4X 1;  1ASJ 1;  2ZOE B;  1CIW A;  5EXO A;  2TUN A;  5FZ6 A;  1NCR B;  4SBV A;  1BMV 1;  3MW4 A;  5FYT A;  1I5P A;  2GNM A;  1W03 A;  2ZMN A;  1O3Q A;  1JYN A;  2JDP A;  3H1W A;  3BGA A;  3SXW A;  1DCS A;  3DL3 A;  1ND2 C;  4OI2 A;  5BXX A;  3FE5 A;  5T55 A;  1EPZ A;  4AVV A;  2W39 A;  2W46 A;  3ASI A;  4JRA A;  4I02 A;  1VBC 3;  1RB8 G;  3WNP A;  5KR7 A;  3CJI C;  2D6L X;  3VBH A;  1R08 3;  2WO3 A;  3GCW A;  3KHB A;  2AYH A;  4PI2 A;  4UOJ A;  4D69 A;  1X9P A;  4CEW A;  4H7L A;  2P3K A;  1PK6 A;  2B42 B;  2W3J A;  3TEY A;  1HB2 A;  3KD4 A;  5J09 A;  5LBC A;  4CCJ A;  4FAH A;  4KI5 M;  3KCX A;  1RUG 2;  3DPR C;  3KV5 A;  5BPX A;  1W8N A;  5FO7 B;  2C4X A;  4IEZ A;  2NM1 A;  4E9K A;  2RHP A;  4LOS A;  3T2O A;  4RR3 C;  4I0B A;  3MW3 A;  1UYZ A;  5EYY A;  5JI9 A;  4F7Z A;  5LW9 A;  1JZ3 A;  3KSC A;  3WQ7 A;  2HH9 A;  2DTW A;  2HWC 2;  2Y38 A;  4Y5T A;  3MFA A;  5LA1 A;  4OUS A;  2XOM A;  2Q1M A;  1AYN 2;  3U4S A;  1GOG A;  1F15 A;  1EAH 2;  2XUM A;  3OY8 B;  1WA4 A;  3FMG A;  4BQW A;  3VUO A;  1GP4 A;  1R08 1;  1R1A 3;  1STM A;  3BTA A;  2R06 2;  3J7L A;  3P6B A;  3U14 A;  3ZFG C;  4JZR A;  2L9L A;  3KLS A;  2D7F A;  4NHY A;  3I59 B;  5T5P A;  2ZTN A;  2IC1 A;  1KDK A;  4XFA A;  3HBZ A;  3AP7 A;  4QMA A;  4BB3 A;  5KC5 A;  1AL2 3;  2R6Q A;  3HIF A;  1ZYB A;  4CCD A;  2TNF A;  1KDM A;  3CZU A;  1NYW A;  2BDR A;  4HOO A;  1M06 G;  4Q4X 2;  4IGP A;  2ZZJ A;  5C4W A;  1ASJ 2;  3H8O A;  4FOV A;  4BLJ A;  2WZ8 A;  1UN1 A;  2A70 A;  3J9S A;  4PLO A;  3I3B A;  2H6B A;  2BNM A;  3HQU A;  4IND A;  4P9J A;  4CDQ B;  3VBO C;  4CPB D;  1SLT A;  4XIO A;  4I2O A;  1GZT A;  2VZQ A;  3GCX A;  5FPA A;  1FAY A;  4LHK A;  4Z8B A;  3POB A;  4COZ A;  2DFC A;  5DUX A;  2UYA A;  1FOD 2;  5K8S A;  3QLQ A;  3Q8B A;  1XNT A;  3WCS A;  5FZD A;  1R1A 1;  1LOA A;  1H9P A;  1UXZ A;  1DGR A;  1JS9 A;  3J8F 3;  3NL1 A;  4AVT A;  1V0A A;  4NMI A;  4OHY A;  1DG6 A;  3NAP A;  4COU A;  1WD3 A;  2XWB B;  3NV3 A;  3ZSL A;  1D4V B;  2W52 A;  3WG4 A;  1SLI A;  3H9A A;  1ULE A;  3I3Q A;  2XUE A;  3ETP A;  4XEZ A;  4URA A;  4XF9 A;  2YV8 A;  1AL2 1;  4B3N A;  4K7J A;  4ASL A;  2XJP A;  3WZ1 A;  4ET7 A;  3V0B B;  3N36 A;  4IV1 B;  1QXJ A;  5FZA A;  2LW8 A;  5A3N A;  4COY A;  5IVV A;  2IXJ A;  4KMQ A;  1CAU B;  4AFD A;  1HRV 3;  1CAW A;  1QIQ A;  3EHK A;  3JB4 C;  5HCB A;  3TRS B;  4I01 A;  2B7Y A;  1J58 A;  3DXT A;  3CDZ B;  4LBJ A;  2VG9 A;  4AGV A;  1KRI A;  3AMP A;  4EWA A;  4BCU A;  2ZKL A;  4AED A;  5A33 B;  2W1Q A;  3OYW A;  3PHM A;  2WSV A;  4EN9 B;  2OA2 A;  4ASM B;  4UW5 A;  3NNJ A;  4G3Y C;  2BZD A;  1GQH A;  1RL3 A;  1R08 2;  4XXA A;  4CUB A;  3J8F 1;  4JKL A;  4E2S A;  2NN8 A;  4XFI A;  1FPN 3;  1WKY A;  1X33 A;  1HRI 3;  1ACC A;  3PUR A;  4KGQ A;  4AFA A;  5BNN C;  5L19 A;  4CXY A;  2WYS A;  3OPT A;  3LD8 A;  3NMB A;  1W0N A;  1PIV 2;  1O6U A;  4Q1P A;  4YG6 A;  5FQ0 A;  3GM8 A;  3M3E A;  4GQ7 A;  3WG2 A;  1DQ6 A;  1VBA 2;  4FBF A;  2ZEX A;  1RUN A;  2ZGR A;  1CR7 A;  1MS5 A;  1UD1 A;  2OPK A;  2EIB A;  1BK1 A;  1OBN A;  2JG9 A;  3K77 A;  4XDP A;  3KT1 A;  4MGQ A;  5M0T A;  1K5M A;  3MHZ A;  1HRV 1;  1IQD C;  1GU3 A;  3IDC B;  4XXP A;  4MXW B;  3KCC A;  3T4H B;  1W9Y A;  3M3I A;  3OUI A;  1Y9G A;  3INA A;  5FV3 A;  1I3H A;  5EV7 A;  4Q8L A;  1YC6 1;  4OUL A;  3HQX A;  2O8Q A;  4JDN A;  2A6Z A;  2E31 A;  4RQP B;  3NJV A;  3LEG A;  1LHW A;  3A21 A;  2XWJ B;  1ND2 B;  4MXV A;  4XMA A;  1AF9 A;  3VBU C;  4EYU A;  1FPN 1;  1HRI 1;  2J1S A;  3PVB B;  5A70 A;  2IWG B;  1COV 3;  2VUJ A;  3BPZ A;  3CJI B;  1Z0H A;  1OUX A;  2OQ6 A;  1IS5 A;  3UV9 A;  1NKG A;  3ZPO A;  4B7E A;  2A75 A;  2H6C A;  1AL2 2;  4Q0U A;  4AI2 A;  4OVE A;  1JUI A;  4PQQ A;  5FY0 A;  4BYY A;  2HWD 3;  1NT0 A;  4TYS A;  5F8P A;  2RS1 3;  1UY0 A;  1DZT A;  1C28 A;  4QGM A;  1LHU A;  2DCZ A;  3S6P A;  1U5I A;  5DDJ 3;  1QF3 A;  2AEY A;  1H2M A;  2HWB 2;  3DPR B;  3QOP A;  5JOW A;  4CP2 A;  4URT A;  1RXF A;  4YM0 A;  1C4R A;  4RR3 B;  1FMD 3;  1N1S A;  1UWW A;  2VCM A;  4PIX A;  5DAX A;  3H7J A;  3T1M A;  3ZOI A;  4E4H A;  4P9L A;  2Q8D A;  1GWM A;  1VAV A;  1AXZ A;  2Y6F A;  3R0R A;  1HLC A;  3GHN A;  4Q4Y 2;  4XFC A;  4MAD A;  1AYM 2;  1I6X A;  3C7H A;  1R09 3;  4FFH A;  3CQO A;  4WM8 C;  4YW3 A;  3U1X A;  4KQ7 A;  1COV 1;  4QXH A;  3NO8 A;  2RDN A;  3ZFG B;  1JYW A;  3T08 A;  3H50 A;  3AMN A;  1IPS A;  1PM4 A;  1U5Z A;  3WP5 A;  5JWP A;  1YQ5 A;  2HWD 1;  4YG3 A;  5L7O C;  2RS1 1;  1S0D A;  2WO1 A;  4Q4V 2;  4DEV A;  1HX6 A;  5DDJ 1;  5HCH A;  4CP1 A;  2MEV 2;  2JDU A;  3AMH A;  4E8C A;  2YGL A;  2UUR A;  1W8H A;  1HJG A;  3AVR A;  4FPF A;  4PIZ A;  4XAE A;  1OPO A;  5FP8 A;  3WW3 A;  1L7L A;  4C1W A;  2JDH A;  5FBZ A;  2GME A;  1O8S A;  2Z79 A;  1FMD 1;  2ZAH A;  4FPY A;  3LEI A;  5IUQ A;  3ZFE B;  4YW5 A;  2ZX4 A;  4B1L A;  4CCE A;  2EIG A;  3VBO B;  1O3S A;  1WCK A;  1OOP C;  2R16 A;  2FZ1 A;  2RR1 3;  4JV4 A;  1QKQ A;  5HCF A;  3VLB B;  5CBL A;  1GSL A;  5A6Z A;  1GZC A;  3OBA A;  2JDY A;  2RVA A;  3K48 A;  2PQS A;  4COV A;  3AMM A;  1RIN A;  3OPZ A;  3M8L A;  1R09 1;  1UOG A;  4TSV A;  3MLK A;  4XFG A;  5CFD B;  1HRI 2;  3R4D B;  1BBT 3;  1XU2 A;  2WWS A;  3X29 B;  3LCP A;  2Z4F A;  3VD9 A;  4YZ1 A;  4LHS A;  3LWC A;  4M4P A;  1N3P A;  2BRT A;  3THD A;  3HT2 A;  4NID A;  4AEM A;  3EJK A;  2DCT A;  1VAK A;  3R4U A;  5IVY A;  4L97 A;  2EAL A;  3TEX A;  1JXN A;  1Q8V A;  1S0I A;  4JDM A;  1F4H A;  2YMZ A;  1JYX A;  3BTX A;  1XYP A;  4P08 A;  2C9A A;  1QQP 3;  1JZ5 A;  4LBO A;  1CD3 G;  3RMY A;  2YC0 A;  3LPF A;  3I3E A;  5E8A A;  2PHX A;  5A6Q A;  3AYE A;  1Q5O A;  3VKN A;  1EY2 A;  5IAT A;  3ABZ A;  4YRD A;  1YJK A;  3GHM A;  3HEI A;  4YGD A;  1NZI A;  3MIH A;  3HN3 A;  5BNO C;  4DS0 A;  3AP6 A;  2QDR A;  2RR1 1;  1WGP A;  5F3C A;  4BDV B;  4HKL A;  5FPB A;  5C3P A;  2WR9 A;  2BQP A;  1VE0 A;  2VQT A;  1G9C A;  3FHI B;  1DQ5 A;  3WUD A;  2WO7 A;  4IEX A;  2WQ8 A;  2R07 3;  2B4K A;  1BBT 1;  3J4U H;  4K1Y A;  3WHT A;  3B01 A;  1LES A;  2EF6 A;  5FRE A;  1UOF A;  1FXZ A;  2X10 A;  3IPV A;  1HQN A;  3JBG 3;  4HVR A;  3VBH C;  1GMM A;  1QXR A;  3KB5 A;  5BNN B;  4FTB A;  1Q43 A;  3V0A A;  1OLM E;  2HWD 2;  2UYB A;  5FZ7 A;  3RZG A;  5A3T A;  1SFN A;  1QQP 1;  3VD3 A;  1LEC A;  4CCL A;  5FPV A;  4JVA A;  4CEW C;  3LDB A;  3ORJ A;  1PK6 C;  1PMJ X;  4OQ8 A;  2WT0 A;  5FMC A;  1YLL A;  2QQL A;  1MVQ A;  1K45 A;  4P5H A;  3TN9 3;  4CCN A;  1CZS A;  4MX3 A;  5GZD A;  4XZP A;  5CZK A;  3J7H A;  2WFF 3;  3AZZ A;  4YYO A;  1S1A A;  1PGW 2;  3MID A;  1GWL A;  2N7G A;  5A3L A;  2XB6 C;  4KG0 A;  3OGR A;  4LHL A;  4RGG A;  1KGY A;  4J1W A;  4ARX A;  1MS1 A;  5LA0 A;  3WNO A;  5LEJ A;  5I8T A;  1CPN A;  1N1Y A;  2LRP A;  2W47 A;  3HN1 A;  4M0N A;  2JEC A;  3ZR5 A;  5E1R A;  4YM1 A;  4FPG A;  2XL9 A;  4AZZ A;  2R07 1;  4MYE A;  1G9B A;  4WVV A;  3OSD A;  5JAX A;  2ARB A;  1SPP A;  1PMH X;  4LA3 A;  2FMY A;  2RM2 3;  4R9D A;  3VBU B;  4EQV A;  4RN5 A;  3JBG 1;  3RS6 A;  3OF1 A;  3VBF A;  1RUC 2;  5JI7 A;  1SMV A;  2XR4 A;  4ZU4 A;  1W2N A;  3S5A A;  3NV1 A;  1ENS A;  4QB6 A;  1J3P A;  3GDB A;  2RS3 2;  5A7S A;  4A6O A;  4A2U A;  2UWA A;  2YDE A;  5FZK A;  4V1P A;  5FXX A;  4IE6 A;  5FP3 A;  5BUV A;  1SAC A;  2XKP A;  3TN9 1;  5FLH A;  2CV6 A;  1AL0 G;  4OQ9 A;  5FLI A;  1N3Q A;  4P9W A;  2WFF 1;  2DCY A;  4E4Z A;  1QH6 A;  1RUD 2;  1WA6 X;  3SH4 A;  3WDV A;  3CO2 A;  5C4W C;  2ARA A;  3SKV A;  4BQ2 A;  5I0S A;  5FMO S;  4JKK A;  3VBS A;  4BPZ A;  4OLL A;  3BU7 A;  4U2A A;  1XXN A;  2VR4 A;  3SCH A;  3RGB A;  4QX3 A;  5CNA A;  3U75 A;  3PVO A;  4DUX A;  2VVD A;  1ZRE A;  3OBR A;  2GC0 A;  3ZXK A;  4BXS V;  2VTF A;  4MO3 M;  5L36 A;  5K4L A;  1HB4 A;  1X8E A;  1Y9M A;  2Y6L A;  2RM2 1;  1H1A A;  3PNA A;  5C7G A;  5JZG A;  5CVR A;  3VV1 A;  3OEB A;  2RDQ A;  4WM8 B;  3QH7 A;  2DVG A;  2C9K A;  2HWF 3;  3O1R A;  1OLQ A;  2WAA A;  3OUH A;  4GB3 2;  4C90 A;  2AUY A;  2QZ2 A;  2CL2 A;  4XAB A;  4OZO A;  5J1X A;  5LBF A;  5DN2 A;  3AKS A;  1HQW A;  1QJX 2;  2GH8 A;  1QJZ A;  3LKJ A;  4CP0 A;  3ZO0 B;  5L7O B;  3V56 A;  1G86 A;  2WRA A;  3K2O A;  3ECQ A;  4OUE A;  3WNN A;  5F6L B;  4HT1 T;  1CAV A;  4N53 B;  2EXK A;  2ZX3 A;  1EUU A;  3I3D A;  5EJ1 B;  3NJY A;  2QQP A;  1FV3 A;  5FMD A;  3D8C A;  4Y1X A;  3UKV A;  4Q0V A;  4FOQ A;  3E5Q A;  2ERF A;  2P3Y A;  2F6B A;  4S2H A;  2WNE A;  1IGO A;  4Y4Y A;  4D0Q A;  4Z07 A;  4KBB A;  1LEN A;  4YZ3 A;  2LRO A;  1OOP B;  4AED C;  3MIC A;  2Y0O A;  2XHK A;  5FPZ A;  2E63 A;  1DLC A;  3F2Z A;  5J48 A;  1W3V A;  2GMP A;  5F39 A;  4AWD A;  3RWN A;  1ZA7 A;  2J42 A;  3FLT A;  3JBG 2;  5F3G A;  3I3M A;  2HWF 1;  3N7L A;  2OXB A;  4LO7 A;  5T3N A;  2VZ3 A;  4AFC A;  5IJR A;  1MS8 A;  1W6O B;  4OYU A;  5A7W A;  1VAM A;  1YIF A;  2YBK A;  1KJL A;  3OCP A;  5AFB A;  1YO8 A;  2GU9 A;  4BHP A;  1W6Q B;  1CWP A;  3JD7 3;  5EPA A;  5JPM B;  4QWN A;  1RUJ 3;  1PO2 2;  4ZXK A;  4ZKT B;  4TZD A;  2JG9 C;  3GBG A;  4KL1 A;  4LE4 A;  4BQ3 A;  1AR6 3;  1K5M C;  2YPD A;  2QQJ A;  3AM2 A;  1MQT B;  4BME A;  1IZ3 A;  3WQ0 A;  4OMD A;  4XUN A;  3N9P A;  4AFB A;  5DG2 A;  1SFY A;  4XAC A;  5I0D A;  3HWJ A;  2HBT A;  2VNR A;  1BK0 A;  3ZSM A;  5GZF A;  2J22 A;  2O1Q A;  3KM5 A;  4S2G A;  4HSL A;  3B7M A;  3DKW A;  5IAV A;  5FZE A;  3ZYR A;  5APA A;  2Y0I A;  2QTW B;  1GFF 2;  2ZEZ A;  4JGZ B;  2RE9 A;  3A0K A;  5KWR A;  5E88 A;  5DZF A;  2LTN A;  1RUI 3;  2R7E B;  4QT6 A;  3SLI A;  1N47 A;  3AJZ A;  1YI7 A;  3T4V A;  2DCK A;  4W8J A;  4UXA A;  5C3Q A;  2D6P A;  4GIQ A;  1AX0 A;  2DYC A;  3B02 A;  1LUL A;  5HV0 A;  1GYK A;  3VBH B;  2ET1 A;  1DQ1 A;  3I4I A;  2VL4 A;  3ZKY A;  1KXG A;  4ES9 A;  2P17 A;  2Y6G A;  3JD7 1;  4L11 A;  1E5I A;  1WLW A;  3GJA A;  4IE5 A;  4P00 B;  4QQ2 A;  1PK6 B;  1RUJ 1;  2XON A;  4X8P A;  2QQN A;  3THT A;  1AR6 1;  2YUE A;  4LMF A;  5FMB A;  3J7M A;  4F83 A;  3AP9 A;  1RGS A;  1NX9 A;  4CP9 A;  4L9B A;  3MPP G;  2QE3 A;  4A7Z A;  3PU3 A;  3NVC A;  5LA9 A;  1NXD 1;  1IS3 A;  1JOB A;  2P1B A;  1R1Z A;  3O1V A;  1IS6 A;  1OQ1 A;  5JSP A;  1GQG A;  4KWK A;  5LCW L;  4KWU A;  4UW4 A;  2JKB A;  5DUU A;  2B39 A;  4AI3 A;  1ZZC A;  5CAD A;  1RUI 1;  3QD6 A;  2NLR A;  2DU0 A;  1S55 A;  1W6N A;  2VD7 A;  4LPL A;  4MOA A;  2GC1 A;  2W91 A;  1HW5 A;  3S7I A;  5CKN A;  1DBN A;  1DDL A;  1ZBA 3;  3WF4 A;  5LB6 A;  1M4W A;  4A45 A;  3ST7 A;  3FUO A;  2A7A A;  4OCT A;  1RTV A;  2E6V A;  5A6Y A;  2VNV A;  2D97 A;  2WZR 3;  4FOW A;  1OFN A;  1PX4 A;  1IQA A;  1LJ7 A;  1YCI A;  2E7T A;  2WS9 2;  4IEP A;  3EXU A;  1W39 A;  4ZY9 A;  1YFU A;  3ZYJ B;  3SNM A;  3ZYB A;  1GOF A;  1OH3 A;  4CDX A;  2FCT A;  1V9U 2;  5C4W B;  3MYX A;  4WZC A;  3VKF C;  4HL0 A;  1RUO A;  2IVI B;  5A7Q A;  1HV1 A;  1POV 0;  2ZPX A;  3APB A;  4YSF A;  2CYF A;  3GNE A;  3RZL A;  5ABJ B;  1QJY 2;  5F6K A;  2J1R A;  2I2S A;  4I0A A;  3ZMO A;  5KXB A;  2VMI A;  3AKP A;  2FDI A;  1D0H A;  1UY3 A;  1NA1 A;  2BU9 A;  1WD4 A;  1YFX A;  1ALY A;  4D6S A;  3SEE A;  3O1T A;  2MNG A;  1ZBA 1;  4M00 A;  4YW6 A;  1PNF A;  2YHJ A;  4J6G A;  3NAP B;  1YHF A;  1YQ2 A;  2WZR 1;  3VHP A;  4DY5 A;  2VMC A;  5JVV A;  1RUJ 2;  5FY7 A;  1QOO A;  5BNP C;  1Q8P A;  2XVK A;  4MGK E;  1LGN A;  1K5J A;  2CWS A;  4LKF A;  4RFT 0;  4C0H A;  4JQT A;  1P8J A;  2XJS A;  1UZW A;  3DYM A;  4GH4 A;  2W1W A;  2JIG A;  3AYC A;  5JOX A;  1H8T B;  2VH9 A;  2YYO A;  5LEK A;  1SZB A;  1CAW B;  1OMI A;  4HG6 B;  2K2S A;  4LTA A;  4IE7 A;  3K3O A;  3OGG A;  4QDS A;  1W6M A;  2PHU A;  4QXC A;  4NRO A;  4AED B;  1OPM A;  4XJ8 A;  3OYW B;  3HNM A;  3VBR A;  1RUG 3;  4UW6 A;  1OVS A;  1WW5 A;  4RD7 A;  1GZW A;  2F17 A;  2QQK A;  2NZ9 A;  2DUR A;  2KD7 A;  4LUL A;  1JBC A;  4XBN A;  4AAP A;  4PF5 A;  2ETE A;  4LE3 A;  1B09 A;  1BKZ A;  4XFH A;  2HWC 3;  4XUT A;  3OBZ A;  3FZ3 A;  2E33 A;  1L3J A;  2VUD A;  5FQ0 B;  4XQ4 A;  1AYN 3;  2F4L A;  4AVB A;  4XIK A;  1EAH 3;  1QNW A;  3QAC A;  5FO8 B;  4QX8 A;  3K4A A;  4XHB A;  2JG9 B;  4MGS A;  1K5M B;  4J25 A;  5C5U A;  2JDK A;  2KXL A;  1RUH 1;  2GZW A;  3VZK A;  2AGS A;  5DAP A;  2YBS A;  4KU8 A;  1HB1 A;  1SHW B;  1YNA A;  3VDC A;  3WY6 A;  1APN A;  3FX3 A;  3BU0 A;  1A78 A;  1D0G A;  2CHH A;  1YXW A;  4OUM A;  3UJQ A;  1RUG 1;  5C5T A;  4BH9 A;  1GNH A;  3ZXA C;  1BYH A;  1OT5 A;  2NYY A;  2XVL A;  3I2J A;  4Q4X 3;  3PMS A;  3E5U A;  1A34 A;  1EUT A;  4KG8 A;  5A1F A;  3AXE A;  4GMP 3;  4HPK A;  4NAO A;  3SIT A;  4AEK A;  4BIO A;  3VBF C;  3RSJ A;  4FQ4 A;  2XL7 A;  4SLI A;  3ZKU A;  3EQE A;  1XPW A;  3NKT A;  4XUR A;  3WF0 A;  1GQP A;  3FL7 A;  3I97 A;  5B4N A;  1FNZ A;  1AYN 1;  1ULG A;  1E57 A;  4QHZ A;  1FOD 3;  3POI A;  1X8M A;  3POF A;  3WD5 A;  1PZ7 A;  5DUW A;  4AR2 A;  1XRU A;  4XJA A;  4FO9 A;  4LA2 A;  4CVU A;  1W9T A;  1ZX5 A;  2VUA A;  4YVS C;  3GXU A;  4MGY E;  5T54 A;  3VBS C;  4JKM A;  2HEV F;  4FXG B;  2X29 A;  4E2Q A;  5FKC A;  1AR9 2;  4IE0 A;  3WP4 A;  2SBA A;  2BGO A;  1NY7 2;  3SHR A;  4EN6 B;  5I93 A;  2J1A A;  1PM7 A;  1RYY A;  3DN7 A;  5JZG C;  2LUW A;  1NE6 A;  4GMP 1;  3CLP A;  3WF3 A;  1J84 A;  3ZN6 A;  2BV4 A;  2CU5 A;  1UAI A;  2IVJ A;  1REF A;  3TB0 A;  1PX3 A;  2PAK A;  4R4X A;  2C6S A;  2VQU A;  5LK7 B;  3HJR A;  4AQ6 A;  1FOD 1;  1H2K A;  1CGP A;  4NRQ A;  1GIC A;  4PF1 A;  2GMM A;  2VPV A;  3E1F 1;  5EZW A;  4F3J A;  4AOC A;  1GP6 A;  4WVW A;  1D2Q A;  1RUH 2;  4EWD A;  1J59 A;  5FY5 A;  3MUY 1;  3ACL A;  1PIV 3;  4PT6 A;  3BI3 A;  4ZXE A;  4ZHN A;  2AEN A;  3MF9 A;  2WZE A;  2XJQ A;  1X7N A;  1VBA 3;  3I2D A;  1G9F A;  4QAW A;  1JZ7 A;  1LKN A;  4GUL A;  4B8E A;  4D6Q A;  2VEC A;  3UET A;  4YPJ A;  2VOW A;  5HI0 A;  2JB8 A;  4Q4W 3;  3FN9 A;  4JGY C;  4AAX A;  4BWO A;  5FPU A;  1W28 A;  5EQU A;  1C1F A;  2ZMK A;  1V6I A;  2Y6H A;  4S2D A;  1DGW X;  5ACA 3;  2MPF A;  3BVC A;  2RJK A;  4WM7 B;  5CEH A;  1S0C A;  1VBD 2;  4XF4 A;  3W58 A;  5FZL A;  2W94 A;  3B93 A;  1SLC A;  5CA6 A;  4XOG A;  4QKB A;  3KVB A;  5F5Q A;  1O5U A;  3O1O A;  4YGE A;  1YQC A;  4LO4 B;  4JHZ A;  2GND A;  5C8W A;  4Z92 B;  1RUF 2;  4IGQ A;  4PBP A;  1AR8 3;  1V6N A;  3L9J T;  4QPG A;  4FPC A;  4IEY A;  5F37 A;  3OD4 A;  1V6O A;  4QX2 A;  1PIV 1;  4A3X A;  4LNV A;  2DWR A;  1FYU A;  5KHG A;  3PTR B;  1VBA 1;  4HAN A;  4NRP A;  3RMX A;  2YB7 A;  4ARY A;  4XZU G;  3V65 A;  1Q56 A;  2PXJ A;  1NQD A;  2XVG A;  4Q4W 1;  1SCR A;  4MGT A;  4W65 A;  3B3Q E;  1GUI A;  4MGZ E;  1YYN A;  2A3W A;  3E6B A;  2VJX A;  3WDU A;  2OX0 A;  4AVA A;  4E8D A;  5ACA 1;  1V6M A;  2HWB 3;  2AEZ A;  3G6J B;  5IVJ A;  3S0M A;  2VE1 A;  3M70 A;  4AI9 A;  4C1X A;  2G1M A;  3IPV B;  3LE0 A;  3E6C C;  1X9T A;  2OVU A;  2A3Y A;  2ZXQ A;  4G9S B;  4Z2W A;  5JCT A;  2WNV A;  3V0A B;  2ZBJ A;  2E51 A;  1R64 A;  3O7O A;  4L2N A;  1MR5 A;  4A6S A;  3WUC A;  3MGU A;  4Q4Y 3;  2J1T A;  4NE9 A;  1AYM 3;  1BCX A;  1T6G C;  1LOC A;  3EMR A;  5LY1 A;  1UU5 A;  1AR8 1;  3VL9 A;  4IV3 B;  3KT4 A;  5A6X A;  1S0E A;  1AHS A;  2VOV A;  4FPJ A;  3M3C A;  2XXZ A;  3ZXL A;  5IWF A;  3GYD A;  3LDR A;  4MUV A;  1DU3 D;  2A6V A;  2PQQ A;  4Q4V 3;  3USS A;  2WA3 A;  1H9W A;  3VZL A;  4D7T A;  3BTZ A;  2VTX J;  5FAX A;  3HT1 A;  2MEV 3;  4YG0 A;  2HWB 1;  4PLN A;  3N9N A;  1LHV A;  1PO1 3;  2C24 A;  1UNB A;  3U07 A;  1ODM A;  1SPP B;  2E26 A;  2WNO A;  1TNF A;  3AZW A;  4Y24 A;  4BOW A;  4FPH A;  4JTN A;  1HJF A;  3VBF B;  1CJP A;  4LOT A;  1WBF A;  4YW2 A;  1UIJ A;  2E9Q A;  5H9Q A;  3HOB A;  4Q4Y 1;  3CF6 E;  1AYM 1;  3LIH A;  3AX4 A;  3FHQ A;  4R9A A;  2ZGP A;  1W8F A;  2P6H A;  5FZM A;  4FI9 A;  2JG8 A;  1J3Q A;  1ULF A;  2RDS A;  1WZX A;  3NNM A;  4QX0 A;  3AKR A;  3EBR A;  5FRA A;  4BQY A;  2VAU A;  3CKH A;  3UYJ A;  4JCK A;  4CDX C;  1MZ5 A;  2A3X A;  1YFY A;  2ZGT A;  3OPW A;  4YFW A;  3LFM A;  3VBS B;  4Q4V 1;  4R52 A;  4Q4W 2;  2R30 A;  3AL5 A;  2J1U A;  3ZN4 A;  5FK7 A;  3NNF A;  3SH5 A;  1G8W A;  2X05 A;  4BK4 A;  2FDG A;  5ACA 2;  2MEV 1;  1F35 A;  3EO6 A;  1PO1 1;  2XDV A;  3UK9 A;  3AYD A;  1NA1 C;  3J26 N;  1TNR A;  1TZO A;  1PHM A;  5FXZ A;  5JZG B;  2D93 A;  1S2B A;  1C57 A;  2RS5 1;  4C91 A;  4UF0 A;  4LLO A;  4ZZ5 A;  2EA7 A;  4CU6 A;  3VDA A;  1OF3 A;  1MAC A;  2ZAA A;  1LHO A;  2RJ2 A;  3RRD A;  3K51 A;  2X5I A;  4M3C A;  1UX7 A;  3GZE A;  3IMM A;  4ES8 A;  2WWJ A;  1AR8 2;  1RUE 2;  3AZX A;  4LXL A;  3D5O A;  2OS2 A;  1DP0 A;  4MV2 A;  5H9P A;  5D21 A;  4NIG A;  3H3L A;  2Q1Z B;  1J1T A;  3KHC A;  2RG4 A;  1UX6 A;  1C8N A;  3POJ A;  4ERO A;  4QPW A;  4GH4 C;  2QQU A;  4M3C E;  3KCY A;  3TAY A;  2VZT A;  5A3U A;  2DV9 A;  3AP4 A;  1EP0 A;  4IER A;  5A32 B;  5IVB A;  2E32 A;  4MHU A;  2E7A A;  4AXO A;  1JZ6 A;  3CHX A;  3I2H A;  3RJR A;  2RJL A;  3KV6 A;  4N9H A;  3HNY M;  3KV4 A;  4Q29 A;  4DFS A;  3VBR C;  4KWJ A;  3TYJ A;  4QX7 A;  4XVH A;  2ZGO A;  3T30 A;  4CXW A;  4N7U A;  4ATF A;  1IPJ A;  5KHI A;  2OPW A;  5H9R A;  2K9Z A;  1NE4 A;  4UBG A;  4IEQ A;  3M3O A;  5K0U C;  2ZCW A;  2VNO A;  3WSO A;  3DYP A;  1XE7 A;  1EPW A;  1WLD A;  3T2Q A;  1KEX A;  3MI8 A;  4NIA A;  1TG7 A;  4GAL A;  4QHB A;  3FFZ A;  3VZO A;  5GLV A;  4DXS A;  3FUQ A;  4H55 A;  3AZY A;  1JYI A;  1DZQ A;  1UYX A;  3D82 A;  3BB6 A;  1VBB 2;  2IZW A;  1GNY A;  3H8R A;  5FLJ A;  1RUC 3;  1J1L A;  2QJV A;  3MW2 A;  3OUJ A;  3K75 B;  1L7Q A;  2PN5 A;  3N9M A;  1BJQ A;  2ZZQ A;  4CDW A;  1UYP A;  3LEM A;  3ZLI A;  3VDD A;  1IPK A;  1BZW A;  1D2S A;  2RS3 3;  3DF0 A;  4HK9 A;  5F2W A;  5BNQ A;  5C3O A;  1GWK A;  1QJU 3;  1VRB A;  2XHN A;  1SQ4 A;  1DQ2 A;  1LR5 A;  1TVG A;  2RMU 2;  3MO4 A;  5ISL A;  4Y22 A;  1X82 A;  1F31 A;  3DXU A;  3BUC A;  1C3H A;  2MHF A;  3LAG A;  1PO1 2;  5LY2 A;  1NCR A;  4BQ1 A;  4DZG A;  3A7Q A;  3MIG A;  1ZRC A;  1W8O A;  3D6E A;  1RUD 3;  2ZJC A;  1PGW 1;  4RS5 A;  3WEZ A;  1G6N A;  2RS5 2;  4K3U A;  5SV5 A;  3MV0 1;  2W5F A;  2QUO A;  3H3Z A;  5FY8 A;  1FX5 A;  2D6O X;  1QOT A;  2W87 A;  4X8N A;  5IYY A;  5BY5 A;  2VZV A;  5K9Y A;  4CXX A;  4N43 A;  1BVP 1;  4L8Q A;  2I74 A;  4XCB A;  4UFH A;  3ZSE A;  1F9K A;  1OQD A;  4A7K A;  2DF7 A;  3WDY A;  5LZ6 A;  1RUC 1;  3SIS A;  3SEP A;  5IVE A;  2LS6 A;  3H1Y A;  1WBL A;  2Q0A A;  4OI1 A;  4GB3 3;  5BNP A;  5FOJ B;  4PJY A;  2RS3 1;  2VW0 A;  1OQE A;  3ENR A;  3JZV A;  4BXF A;  4QQP A;  4CP9 B;  1QJU 1;  3ALQ A;  4LOR A;  1D4M 2;  5JSR A;  1QJX 3;  2CGN A;  3O0W A;  5IFT A;  4XFB A;  4O61 A;  3LDK A;  4H14 A;  1VIW B;  3P1I A;  5KHH A;  1ENX A;  1W9S A;  5LRR A;  1RUD 1;  4YGB A;  3IDA A;  5HCA A;  4I3G A;  3POG A;  5H9S A;  3TNQ A;  5FIX A;  1XND A;  2BFU S;  1O3T A;  3PL0 A;  1V6K A;  2Q5T A;  1RED A;  2VVF A;  1W6N B;  2VMF A;  3IIA A;  2PAE A;  3BAL A;  2BTV C;  3ACI A;  1NLQ A;  3ROU A;  3M3Q A;  3PVN A;  3GZT B;  4HKW A;  1DLL A;  1A6C A;  1OLM A;  2A73 B;  2UY8 A;  3VGI A;  3VZN A;  1MEC 3;  3DCQ A;  1O3R A;  1IHM A;  4FPE A;  3FLP A;  3AKQ A;  4P14 A;  4IE4 A;  3CZJ A;  1E5S A;  1YRZ A;  3K4Z A;  3DKQ A;  4TWT A;  2K0G A;  2OZJ A;  4QM9 A;  5E89 A;  5ERL A;  3MFC A;  2IXH A;  4GB3 1;  1SBF A;  3KQR A;  3QBQ A;  5LK5 A;  3VB9 A;  2CDP A;  1O59 A;  3WW1 A;  4DXZ A;  3FLR A;  3VKM A;  1QJX 1;  4YW1 A;  3RPQ A;  2W9X A;  2YFU A;  1F8V A;  2OUH A;  4CDQ A;  3GAL A;  1Y4W A;  3KF3 A;  5DPN A;  5FYM A;  4EE2 A;  1H1I A;  1PO2 3;  3I8T A;  3IMN A;  1KD7 A;  4NJ4 A;  3KVA A;  4D94 A;  5FYC A;  3DEC A;  3LA7 A;  4W50 A;  2FMD A;  3A23 A;  4WVM A;  5GZE A;  1XE8 A;  1MPX A;  2J1E A;  2P4E A;  3D0S A;  1NA1 B;  3MUZ 1;  4GWI A;  5FKB A;  3WF2 A;  1S0J A;  3PIJ A;  1NXM A;  1PGL 1;  2XG3 A;  4XF1 A;  5I0T A;  1CIY A;  3N7M A;  5C9A C;  4CRQ A;  5JMO A;  4KU7 A;  5JSO A;  1MEC 1;  3BTY A;  3PVE A;  5FZI A;  2CGO A;  1UPI A;  1CN1 A;  1F4A A;  2KR2 A;  2R32 A;  3RZM A;  2AZ5 A;  5DXD A;  4RGA A;  4N90 A;  3BPS A;  3RQ0 A;  3NWK A;  3AKT A;  3HPN A;  2WFP A;  4QPG C;  1QJU 2;  2WSU A;  4PQ9 A;  4YZ5 A;  3S57 A;  3IB3 A;  3CMG A;  2AR6 A;  2CAV A;  1H30 A;  2W08 A;  3OD0 A;  1UKG A;  4CDU A;  4NHM A;  4KBZ A;  4TLF A;  1W6M B;  1BQP A;  3PJQ A;  1PO2 1;  3GGL A;  3NST A;  4YVS A;  5FJK A;  2JIJ A;  1W8W A;  4V2W A;  5FZ3 A;  2QDN A;  2QNK A;  3U37 A;  1Z7S 1;  1WMX A;  4MZU A;  2JDZ A;  1W6P B;  3IAQ A;  4FXK B;  4S2F A;  3NRU A;  4D8M A;  4YAR A;  2WC2 A;  3RYP A;  3N3H A;  1VB4 A;  4B4Q A;  5DAW A;  4AF9 A;  5IAX A;  5FY9 A;  3PLQ A;  3VN4 A;  2D3S A;  2WNV C;  1DGR N;  3P3N A;  3OB8 A;  4E4D X;  3NW4 A;  1OC1 A;  2BP6 A;  4XW3 A;  3GJB A;  1RXG A;  4AE2 A;  3AFK A;  1AXY A;  4FP2 A;  1SCS A;  4LKE A;  4RHV 2;  3FFQ A;  5FXW A;  5GLZ A;  4BU2 A;  1W0O A;  2JXA A;  2WAO A;  2YG0 A;  3ELN A;  2EIE A;  2FBE A;  4DIQ A;  1ZRD A;  1OI6 A;  1O8P A;  2BYV E;  2Q8O A;  5FYZ A;  3KGL A;  3VKL A;  5CB7 A;  4XET A;  3LSD A;  3ACG A;  2OKX A;  1XE0 A;  3WG1 A;  4GA9 A;  5JIU A;  1E5H A;  1GV9 A;  2YRO A;  4LHN A;  1KIT A;  2WS9 3;  2H0V A;  1QY4 A;  3T2P A;  2YFZ A;  4IES A;  4Y20 A;  2OW4 A;  2NP0 A;  1ULO A;  1V9U 3;  3NNG A;  1PGL 2;  3PJY A;  2VZR A;  2YGM A;  3R05 A;  1GAN A;  1LRH A;  1MEC 2;  1YIP A;  3B5L B;  3C3V A;  4O7X A;  4RQP A;  5CKM A;  1ONA A;  4JGY A;  5IW0 A;  4ISQ A;  4HPK B;  1AX1 A;  5CFC A;  2VNG A;  3JXS A;  1QJY 3;  5EP9 A;  4UW3 A;  1IKQ A;  4LK7 A;  5JDB A;  2QCS B;  5JMC A;  4EZH A;  4P5Y A;  2VZU A;  4MG2 A;  1JN2 P;  4K8R B;  3HNB M;  3WQ1 A;  4W4Z A;  2JG8 C;  1DYP A;  2BGC A;  1UO9 A;  2EIC A;  5JOY A;  1A8M A;  1YI9 A;  2PA7 A;  1LOE A;  2D3P A;  4PIY A;  5I8S A;  4CEY A;  2O8O A;  3PUA A;  2R49 A;  5T52 A;  4BM8 A;  2OUJ A;  1IG0 A;  2FDF A;  1ENR A;  4LBM A;  3R4S A;  2WS9 1;  1LOD A;  1TQ5 A;  4RGK A;  1VMF A;  5EIY B;  1Z7S 2;  1HXS 3;  3KGZ A;  5BNO B;  4LIV A;  1V9U 1;  4XHX A;  3BOP A;  3FC0 A;  4PCR A;  3RJ2 X;  1C8M 2;  4Z2A A;  1XQN A;  1WLC A;  2ZHL A;  5F1R A;  4OMC A;  4XQW A;  3ZN6 B;  2ZGU A;  5KC6 A;  5FDB A;  5B2G B;  1QJY 1;  4LBN A;  4BMB A;  5A3M A;  5JXG A;  3Q9O A;  1JMU B;  5FUP A;  4O9E A;  1CES A;  2X5I C;  2ZGN A;  4DQA A;  3N7J A;  1H4H A;  2WII B;  3IKW A;  4XPV A;  4Y1Z A;  5EJ3 A;  1BLZ A;  1AZD A;  2A5Z A;  4XFF A;  3W5N A;  4DPN A;  3WCR A;  4R8H A;  4AI1 A;  2BFU L;  1RIR A;  2VBP A;  5HXM A;  3TEZ A;  4CEW B;  1FAT A;  1HB3 A;  4QPI A;  5FUI A;  1BHG A;  5IVF A;  2DTY A;  2HKX A;  1AR7 2;  1BXH A;  3I2F A;  2H0B A;  2HWE 2;  2I45 A;  4FP3 A;  3ZFE A;  1OKO A;  1HXS 1;  5FP7 A;  5AC9 2;  1TMF 3;  3UES A;  2PEL A;  4GWM A;  3ZFF A;  3J7N A;  3AL6 A;  4HET A;  4CSW A;  1G7Y A;  4XUQ A;  1ZZ9 A;  1Y3T A;  2Y8K A;  5GKA C;  3VDB A;  1VLN A;  1JYV A;  4BIF A;  4R4Z A;  4WZF A;  2YXS A;  4Q0S A;  1AXK A;  5CFD A;  3ZYG A;  2JD9 A;  2R1B A;  1E5R A;  1CON A;  1PVX A;  5FYY A;  3BKZ A;  1VBE 3;  2AAC A;  4WVZ A;  4MH0 E;  4BQ4 A;  3K4D A;  5JR2 A;  2WN3 A;  3MDP A;  5A7O A;  1W99 A;  2X53 S;  3S5Q A;  5L9B A;  2DUP A;  3ACF A;  4FCA A;  3UT0 A;  5JXJ A;  4TXW A;  4V2V A;  3ILN A;  1ULP A;  4QPG B;  3SCF A;  3VD4 A;  4AVS A;  4UFI A;  4CDW C;  4DUV A;  2BBA A;  3PUS A;  3VDD C;  2A71 A;  4XUO A;  3ZXG A;  5D8A A;  4EN0 A;  2FDH A;  3H0O A;  1HV0 A;  1OA4 A;  2CGP A;  2Z42 A;  1TMF 1;  4PI0 A;  4QU1 A;  5EYX A;  2BW8 A;  1NCR C;  1GR3 A;  1XC6 A;  2GN3 A;  4RS5 C;  4XYX A;  2XJT A;  1TE1 B;  2FD8 A;  4JRL A;  4K1Z A;  4RL7 A;  5FPL A;  4GJY A;  2DVF A;  1G9A A;  3RZJ A;  5HV4 A;  1VBE 1;  3A0N A;  1HKD A;  1AR9 3;  1PNG A;  2VQ0 A;  2WNV B;  3PDQ A;  1X50 A;  4XBL A;  4N43 C;  2D6K A;  1DFQ A;  1VRH 1;  1H0B A;  3LFI A;  4GMP 0;  3RYK A;  1BEV 3;  3WNL A;  5C8C A;  4YGC A;  4LIT A;  3VHN A;  1OD3 A;  3WXP A;  4OI0 A;  2VTX A;  5JUV A;  3WP6 A;  1TME 3;  1OUR A;  1UW8 A;  4Y1V A;  4FSJ A;  2VM9 A;  4QKD A;  2OZ6 A;  1W9F A;  4NHX A;  1Y7B A;  1IS4 A;  2Z69 A;  1W04 A;  2ZAC A;  3IN9 A;  1UCX A;  1HXS 2;  1NCQ A;  1L7R A;  3A22 A;  3NV2 A;  4FPK A;  2CTV A;  5FZF A;  4FOY A;  1QWR A;  1LED A;  1US3 A;  1V70 A;  2RV9 A;  4KNC A;  3WG3 A;  4EV0 A;  1ND3 A;  3MIE A;  4XTM A;  1RUH 3;  3W9A A;  2GAU A;  3PUI A;  2BVV A;  3HMY A;  3OGJ A;  2R1D A;  3GBF A;  1WLT A;  4Q0Q A;  4RA0 A;  4EN7 B;  1LB2 A;  5GZG A;  2ATF A;  1AR9 1;  3M7A A;  5ANN A;  4M4R A;  1NY7 1; 
#chains in the Genus database with same CATH homology
 2VJX A;  4E8D A;  5G05 L;  1O8S A;  2VCC A;  3LEI A;  1UZ0 A;  3LE0 A;  2ID4 A;  4A42 A;  4TTG A;  2ZXQ A;  3OBA A;  4L0P A;  2RVA A;  2PQS A;  4CUC A;  1SG3 A;  1R64 A;  2J1T A;  1W9W A;  4CU8 A;  2Z4F A;  3VD9 A;  1CX1 A;  2VZS A;  4LHS A;  4M4P A;  3THD A;  1NAE A;  1JYX A;  2X09 A;  1F4H A;  4P08 A;  1JZ5 A;  2WBK A;  3LPF A;  3I3E A;  4ZZ8 A;  3ABZ A;  1D7P M;  3HEI A;  1US2 A;  3HN3 A;  2ZEY A;  3PUH A;  2E26 A;  2VCB A;  2QBX A;  4BDV B;  3SKJ E;  1XNA A;  2VQT A;  3K46 A;  3THC A;  1JI6 A;  2WQ8 A;  3HOB A;  1K12 A;  2B4K A;  2W1S A;  2V4V A;  2ZEW A;  4UAP A;  3FHQ A;  3FHA A;  4FI9 A;  4QX0 A;  2X10 A;  2Y6K A;  1GMM A;  2HLE A;  3CKH A;  3WF1 A;  2Y64 A;  4CU7 A;  4LQR A;  3VD3 A;  5DQ0 A;  1PMJ X;  2J1U A;  2QQL A;  1K45 A;  2W95 A;  2X05 A;  4BK4 A;  1CZS A;  5CZK A;  3J7H A;  1H6Y A;  3OG2 A;  4XUP A;  3MBW A;  4A41 A;  3OGR A;  1KGY A;  4ARX A;  5LA0 A;  3WNO A;  2W47 A;  5CYY A;  4BK5 A;  4ZZ5 A;  2VCA A;  4CU6 A;  3VDA A;  1OF3 A;  2RJ2 A;  1UX7 A;  1PMH X;  1DP0 A;  4RN5 A;  2WAB A;  2VC9 A;  4QPW A;  1J83 A;  3OGS A;  4QB6 A;  4A6O A;  3GDB A;  2VZT A;  2VMD A;  1H6X A;  1UY1 A;  2DDU A;  1OF4 A;  2E32 A;  1JZ6 A;  2BGP A;  3I2H A;  3D3A A;  4IUG A;  3HNY M;  1UY2 A;  3SKV A;  2ORX A;  3DYO A;  3LPG A;  4XVH A;  4JKK A;  2VR4 A;  4QX3 A;  2Y6J A;  4DUX A;  3WSO A;  3DYP A;  3T2Q A;  4BXS V;  1GOH A;  1KEX A;  3NJX A;  2VTF A;  1TG7 A;  4MO3 M;  3I2I A;  3T0B A;  4DXS A;  2Y6L A;  5C7G A;  2W1U A;  1UYX A;  3OEB A;  1GNY A;  4AG4 A;  2C9K A;  4GZ9 A;  2WAA A;  1JZ2 A;  3WQB A;  4QX1 A;  3AC0 A;  3K75 B;  4OZO A;  1L7Q A;  5J1X A;  1UYY A;  5DN2 A;  4CUA A;  1CZT A;  4JX0 A;  2XHN A;  1T2X A;  1TVG A;  2QQI A;  3MO4 A;  3EYP A;  4P02 B;  3ECQ A;  4OUE A;  3WNN A;  4BJ0 A;  1DYO A;  1UMI A;  5EJ1 B;  3I3D A;  2HYX A;  1EUU A;  3A7Q A;  1W8O A;  3ZM8 A;  2VZO A;  3WEZ A;  4DUW A;  5IFP A;  4CU9 A;  4D0Q A;  3MV0 1;  2W5F A;  4QDQ A;  4GWJ A;  2W87 A;  1DLC A;  3F2Z A;  2XQX A;  5IYY A;  2VZV A;  1JHJ A;  2EID A;  3C8X A;  1HN1 A;  2VOT A;  1K3I A;  2VZ3 A;  5IJR A;  3SEP A;  4OYU A;  2LS6 A;  2J1V A;  4LKS A;  5IFT A;  3T0D A;  3LEK A;  3P1I A;  3VD5 A;  1W9S A;  5F7U A;  2W92 A;  2QQJ A;  1JU3 A;  3IDA A;  2V5D A;  3IAP A;  4UI9 L;  1UMH A;  4OMD A;  4XUN A;  2VMF A;  5I0D A;  4QB2 A;  2WUH A;  3ACI A;  2J22 A;  4DEQ A;  5G04 L;  1K42 A;  4A3Z A;  3W5M A;  2ZEZ A;  3I2K A;  2CDO A;  2C26 A;  3UNP A;  3CZJ A;  2R7E B;  3K4Z A;  4QB1 A;  2WO2 A;  2DCK A;  4W8J A;  2CDP A;  1O59 A;  2VL4 A;  2Y6G A;  1NUK A;  2W9X A;  2YFU A;  4P00 B;  2XON A;  2QQN A;  3C7O A;  5DPN A;  1JU4 A;  1NX9 A;  3DEC A;  4W50 A;  3A23 A;  3BN6 A;  1MPX A;  2J1E A;  2VO5 A;  3MUZ 1;  4GWI A;  3WF2 A;  5A1A A;  1CIY A;  5JMO A;  5IHR A;  5LCW L;  1UXX X;  2JDA A;  4KWU A;  1F4A A;  4LPL A;  4MOA A;  2W91 A;  3WF4 A;  1I5P A;  3HPN A;  4A45 A;  1JYN A;  3IB3 A;  3CMG A;  3BGA A;  1PX4 A;  3I2G A;  2W46 A;  3GGL A;  3WNP A;  4ZY9 A;  1JZ8 A;  3T0A A;  2WO3 A;  3U37 A;  1GOF A;  4UOJ A;  2JKX A;  3IAQ A;  1WCQ A;  3NRU A;  3C7E A;  2W3J A;  3WNM A;  4D8M A;  4QDR A;  2J1R A;  4KI5 M;  3OB8 A;  1UY3 A;  1W8N A;  2C4X A;  3NQH A;  3T2O A;  4RYD A;  3SEE A;  1UYZ A;  1JZ3 A;  2WAO A;  2YG0 A;  2EIE A;  1O8P A;  3ACH A;  1YQ2 A;  5LA1 A;  2XOM A;  2VMC A;  2V72 A;  1GOG A;  2OKX A;  3ACG A;  5HPO A;  1P8J A;  3DYM A;  3P6B A;  2W1W A;  2L9L A;  3T2P A;  2YFZ A;  5C71 A;  1ULO A;  3NNG A;  2VZR A;  3OGV A;  4HG6 B;  4QDS A;  1SDD B;  3JXS A;  3CZU A;  3HNM A;  4P5Y A;  2DCJ A;  2VZU A;  2WZ8 A;  5EJZ B;  2QQK A;  3I3B A;  3HNB M;  4W4Z A;  2KD7 A;  2VZ1 A;  2EIC A;  2VZQ A;  4XUT A;  4A44 A;  2E33 A;  2BER A;  5B4X A;  3C7F A;  1XNT A;  3CIH A;  1UXZ A;  5EIY B;  3K4A A;  3OEA A;  2B9V A;  4MGS A;  3ETP A;  4Z2A A;  5C70 A;  2QQO A;  4OMC A;  1SHW B;  3VDC A;  4ET7 A;  3T09 A;  1UY4 A;  2LW8 A;  5JXG A;  1OT5 A;  4KMQ A;  3I2J A;  1EUT A;  3CDZ B;  3VD7 A;  2WN2 A;  3W5N A;  5HXM A;  1XPW A;  2W1Q A;  4XUR A;  3WF0 A;  1GQP A;  3FL7 A;  3I97 A;  4DXR A;  5B4N A;  1LNS A;  2YC2 A;  5FUI A;  1BHG A;  2BZD A;  4CUB A;  3I2F A;  3C7G A;  4JKL A;  1WKY A;  4CVU A;  1W9T A;  3UES A;  2WYS A;  4DXT A;  1W0N A;  3GXU A;  4XUQ A;  3GM8 A;  2Y8K A;  3VDB A;  2ZEX A;  4JKM A;  1JYV A;  5JXH A;  2EIB A;  2JD9 A;  3K77 A;  4MGQ A;  1IQD C;  1GU3 A;  2BGO A;  2J1A A;  2YC4 A;  5JR2 A;  3K4D A;  2WN3 A;  1RYY A;  5DMY A;  1W99 A;  3WF3 A;  1J84 A;  3ACF A;  5JXJ A;  5LA2 A;  4TXW A;  1OH4 A;  1PX3 A;  1ULP A;  3VD4 A;  2VQU A;  4DUV A;  3HJR A;  2BBA A;  2E31 A;  2QQM A;  4XUO A;  3NJV A;  3LEG A;  3A21 A;  4PF1 A;  3E1F 1;  2J1S A;  2WDB A;  1NKG A;  1XC6 A;  3III A;  2JE8 A;  3MUY 1;  4PT6 A;  4ZXE A;  4PQQ A;  2WZE A;  1JZ7 A;  4QAW A;  2J7M A;  1UY0 A;  3UET A;  4YPJ A;  1JZ4 A;  3WNK A;  3FN9 A;  4AAX A;  3MV1 1;  2Y6H A;  3WNL A;  1UWW A;  1OD3 A;  5JUV A;  2W94 A;  4A4A A;  2VM9 A;  3LQC A;  5JXI A;  4MAD A;  3C7H A;  3EB7 A;  3CQO A;  4JHZ A;  3A22 A;  1L7R A;  1JYW A;  3T08 A;  1US3 A;  2RV9 A;  1CZV A;  4QX2 A;  2ORZ A;  3PUI A;  2WO1 A;  2VME A;  2YB7 A;  4ARY A;  4XZU G;  4DEV A;  4E8C A;  1GUI A;  4M4R A;  2VZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...