1O8PA

Unbound structure of cscbm6-3 from clostridium stercorarium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
131
structure length
131
Chain Sequence
PVGGTRSAFSNIQAEDYDSSYGPNLQIFSLPGGGSAIGYIENGYSTTYKNIDFGDGATSVTARVATQNATTIQVRLGSPSGTLLGTIYVGSTGSFDTYRDVSATISNTAGVKDIVLVFSGPVNVDWFVFSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and ligand binding of carbohydrate-binding module CsCBM6-3 reveals similarities with fucose-specific lectins and "galactose-binding" domains.
pubmed doi rcsb
source organism Clostridium stercorarium
molecule tags Hydrolase
molecule keywords PUTATUVE ENDO-XYLANASE
total genus 30
structure length 131
sequence length 131
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2002-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03422 CBM_6 Carbohydrate binding module (family 6)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 1o8pA00
2VZQA 1OH4A 1SG3A 3FHAA 3P1IA 1O8SA 4E8CA 5DMYA 4ARXA 2BGPA 4XUPA 3D3AA 4GWJA 4PQQA 2QQOA 3WQBA 5C70A 4XUNA 2WN2A 5EIYB 4QX2A 1PX4A 2WN3A 2RJ2A 2EICA 4QDRA 4A42A 5G05L 3I2HA 1US2A 3CKHA 3HOBA 3AC0A 2VZVA 2Y6KA 2V4VA 2VZPA 3NRUA 2JKXA 2VQUA 2WDBA 5HXMA 2X10A 2VZTA 3CDZB 4DXRA 2WAOA 4OMCA 3VDAA 2XQXA 3VD5A 2VCCA 2E26A 3I2JA 1W9WA 1L7QA 3VD7A 1UYZA 2E33A 2W5FA 4MOAA 3THDA 3OGRA 4LPLA 1CIYA 2DCKA 3EYPA 4UOJA 1TG7A 2ZEXA 4ZXEA 5J1XA 2Y6HA 1DP0A 2J1UA 2QQJA 4KI5M 3IIIA 3T09A 1D7PM 2B4KA 4A4AA 2VZRA 5B4XA 1OF4A 1UY3A 3VD3A 2ZXQA 3UETA 2VM9A 4XUTA 3WSOA 2BERA 3HNYM 3W5NA 4BK4A 1UX7A 4ET7A 1GOGA 5CYYA 2WYSA 2W92A 4AG4A 2ORXA 1JZ2A 2R7EB 4L0PA 1NX9A 1UYXA 2J1TA 3K77A 1SHWB 5DN2A 3K4ZA 4PT6A 3MO4A 3NQHA 3WEZA 5LA1A 2YC4A 5C71A 1JZ5A 4P00B 2Y6JA 3P6BA 1CZTA 3CMGA 2VZUA 3DYOA 1CZVA 4QX0A 1UXXX 2WAAA 3ACIA 3ACGA 1KGYA 1GUIA 2QQNA 3A22A 3K4AA 2CDOA 1UWWA 4LKSA 5IFPA 3HN3A 5LA2A 4DXSA 3UNPA 3NNGA 2W3JA 1UY4A 3ECQA 2Y8KA 3C7HA 2CDPA 3GXUA 2WO2A 2VL4A 2VMDA 3C7FA 1RYYA 2ID4A 1L7RA 4A44A 4W8JA 4CU8A 3C8XA 3JXSA 3OGVA 1W99A 1K3IA 1DYOA 2ORZA 4ARYA 4QPWA 2DCJA 4W50A 3MBWA 2W1UA 4DEQA 1MPXA 2DDUA 4XUOA 4HG6B 2QQLA 4A45A 1K42A 5IHRA 1O8PA 4XZUG 3CZJA 2LS6A 3OEAA 4CVUA 5JXJA 3CQOA 3LEIA 3LPGA 3WF0A 1EUTA 1W0NA 2OKXA 1LNSA 4MADA 2WABA 3WF3A 1XPWA 2HLEA 3E1F1 1UY0A 4DUXA 2W47A 5FUIA 1JZ7A 5CZKA 4XVHA 2VMCA 3DYPA 2W95A 3LEGA 4OUEA 4PF1A 4MGQA 4IUGA 2J1EA 4W4ZA 3BN6A 3I2GA 2W1WA 2WZEA 3ZM8A 4MGSA 4TXWA 5JXHA 1JYVA 3WNNA 3WNKA 2YFUA 3J7HA 3NJVA 3T08A 2PQSA 3NJXA 2JDAA 2RVAA 1UZ0A 3HPNA 4ZY9A 3ACFA 2X05A 1IQDC 1ULPA 4XUQA 4LHSA 1J83A 1YQ2A 3T2QA 2EIEA 5JMOA 3FHQA 3T0BA 4JKKA 4QB6A 1CX1A 4QDSA 4TTGA 1UY2A 2YC2A 3OBAA 3GDBA 5IYYA 2W94A 3VD4A 3OEBA 4ZZ5A 1WKYA 1UXZA 2VMEA 3IB3A 4QX3A 3FL7A 2J1VA 4KWUA 1F4HA 5LA0A 2HYXA 2WZ8A 2VTFA 3WNLA 1HN1A 3WF2A 1UMIA 3MV01 4CU6A 1US3A 3LE0A 3T0DA 3K75B 2LW8A 4FI9A 4RN5A 4MO3M 3MV11 1ULOA 2VCBA 5F7UA 1JYNA 2C26A 1GMMA 2J22A 2B9VA 5DPNA 3BGAA 3CIHA 4GWIA 2XOMA 1W9SA 3PUHA 2ZEYA 4CUCA 2J1AA 1W8NA 2VZSA 3C7EA 3I2IA 2J7MA 4D0QA 4BK5A 4CU7A 3I3EA 4BDVB 5JR2A 3PUIA 1P8JA 1OD3A 2Y64A 1JZ3A 2JE8A 3I3BA 1UY1A 1OF3A 5IFTA 4JKLA 2W9XA 1GNYA 3WNPA 5DQ0A 3I3DA 4QX1A 5IJRA 2VC9A 5B4NA 4QB1A 1K45A 4RYDA 1W8OA 3ABZA 2W46A 1R64A 2XONA 3C7GA 3CZUA 5I0DA 1GQPA 2QQMA 2VZ3A 1BHGA 3GM8A 2ZEZA 4CUBA 3HNBM 1GOHA 3F2ZA 4P5YA 1XC6A 1GU3A 2J1RA 2YB7A 4A3ZA 2BZDA 3WNOA 3HJRA 2V72A 2VCAA 4QDQA 2C9KA 1XNAA 3LPFA 5EJ1B 3VD9A 4D8MA 2VZ1A 2VQTA 1UMHA 1K12A 1UYYA 1J84A 2WQ8A 2YFZA 1PMJX 3C7OA 4OMDA 4GZ9A 4DUVA 2BBAA 5EJZB 2W1QA 3MUY1 2WO3A 3U37A 2RV9A 3SEPA 4CUAA 2QQIA 3ETPA 4BJ0A 2YG0A 1PMHX 4OZOA 1SDDB 1JU4A 2ZEWA 2VR4A 3K4DA 4M4PA 2J1SA 2BGOA 1T2XA 3VDCA 3K46A 2VJXA 4BXSV 4DXTA 5JXGA 5HPOA 2Y6LA 1GOFA 3THCA 2VMFA 1WCQA 1JU3A 3IAQA 4P08A 2Z4FA 1H6XA 3OB8A 1JZ8A 3EB7A 4ZZ8A 1DLCA 1JZ6A 4KMQA 3WF4A 5LCWL 2KD7A 3ACHA 4P02B 3I2KA 3DYMA 3HNMA 4QB2A 1F4AA 2XHNA 5G04L 2W87A 3MUZ1 4A6OA 4DUWA 2JD9A 1KEXA 1PX3A 2C4XA 3SEEA 3T0AA 3IAPA 2E32A 3FN9A 2EIDA 1JYWA 2W91A 5JUVA 5A1AA 2VOTA 5C7GA 2Y6GA 1NUKA 3T2PA 1OT5A 2W1SA 1JZ4A 3W5MA 4LQRA 4CU9A 5JXIA 3WNMA 2E31A 4OYUA 2V5DA 3HEIA 3LQCA 3IDAA 4JHZA 3A23A 4M4RA 4XURA 4UI9L 4DEVA 1CZSA 1H6YA 2EIBA 4YPJA 3A21A 1TVGA 1O59A 2WBKA 3SKJE 3GGLA 2QBXA 3SKVA 1NKGA 1XNTA 4AAXA 3UESA 1JI6A 1JHJA 1NAEA 2VO5A 1I5PA 3OGSA 3DECA 3WF1A 4QAWA 4JX0A 2WO1A 2VZOA 4JKMA 3I2FA 2WUHA 2QQKA 3VDBA 1EUUA 1W9TA 3LEKA 1JYXA 4Z2AA 2X09A 4E8DA 3I97A 4A41A 3A7QA 2L9LA 3T2OA 4UAPA 3OG2A
chains in the Genus database with same CATH superfamily
1YO8A 1ALYA 2B9UA 1YFWA 1Z7S1 2ILMA 3AXEA 4E8CA 4G3YC 4XIOA 1QNYA 3FX3A 5C70A 3KCCA 4XUNA 4QD2A 3WNMA 4RGGA 5ACA2 5HCHA 4OUMA 4AFBA 1EAH2 2RS53 5EIYB 4QX2A 5FBJA 4PF5A 3ZMOA 2WN3A 2FCVA 2RJ2A 2XXZA 2Z5WA 4YGCA 3ZFGB 4CDUC 2HWF2 4JC1A 1UO9A 3I49A 2PLV1 1FX5A 4RD7A 3AC0A 5FMOS 3MIDA 1FOD3 1OLMA 3V65A 5FQ0A 4Q0SA 5L7OA 2BOJA 1YRZA 2XLGA 2JKXA 3WY6A 1MS9A 1OA4A 1CR7A 5F6KA 1NY72 5A32B 1GWKA 3MW2A 5EYYA 2QZ2A 4A7KA 5LY1A 4XETA 1W8HA 4DZGA 3H9AA 1WMDA 5HXMA 4TZDA 4CDWB 1H8TA 3LDRA 1F9KA 2GU9A 1HQLA 1CJDA 3MGUA 3AKRA 3AXDA 2CV6A 2E26A 4LLFA 3GNEA 1DZTA 3OGRA 4YVWA 4YW1A 1ENRA 3OD4A 3FBYA 4EN0A 2DCKA 5DDJ2 1AR62 2ZEXA 3WNXA 5J1XA 3SLIA 1SFPA 4QPYA 2Y6HA 5LEKA 4FOVA 4HKLA 3VKOA 4O9GA 4AVCA 3T09A 1B35C 1LOEA 4V2VA 2XGXA 3JCIA 1RUI3 1RUD3 2VZRA 4Y22B 4NMIA 4IE5A 3VD3A 3UETA 4Y3OA 4BQXA 4BWOA 3OBZA 4BCUA 2BERA 3MICA 3V0AB 1AXYA 1W04A 2D98A 3IDBB 1YEWA 3RZHA 1HXS3 3B9IA 5J3UA 4BK4A 5EYXA 3AMQA 1FOD1 5KWRA 4AOCA 4OULA 4J25A 1WCKA 5CYYA 1N3QA 5I0TA 2ZJCA 1VBE3 3PMSA 2QQWA 1Q3EA 2VULA 4WVMA 5A6QA 2MEV1 5FZ0A 3ZXAC 2RHPA 3I3QA 2R7EB 2DTWA 1V9U3 1WBFA 2J1TA 5DN2A 4PT6A 3BB6A 3PJYA 1RL3A 4NIIA 5C71A 1JZ5A 4RS5B 2E63A 3KT1A 4P00B 2HEWF 2BYVE 4YVWC 1ND2C 4AVTA 5FZ3A 1NE6A 4YYOA 2EALA 4LKFA 2F4LA 5FQ0B 2JKBA 1HRV1 1V70A 3J8F1 4R52A 4RHV2 1LHOA 4LBQD 2JB4A 3VDDB 4FSJA 3UK9A 4AEDA 4OI4A 2GC2A 4OHVA 3KB5A 4PIYA 4XAAA 2ZGNA 1ULGA 1LOFC 2R061 2VCMA 4M3CE 1KGYA 1BK0A 3E97A 5KHKA 3FBMA 2QQNA 2C5DA 3FFZA 2DUPA 4EROA 3TN91 3HN3A 5IFPA 1OSGA 3IKWA 1RUH2 1S0FA 3T30A 4OUSA 1VB2A 2H6CA 2ZCWA 1QGLA 4R4ZA 2YPJA 1GP4A 1VBD2 4MH0E 5L73A 3UNPA 2W3JA 2ZACA 4NWWA 2FCTA 4LK6A 4YVWB 5L9VA 1VB4A 5HXVA 3L2YA 4AEMA 2CDPA 2X5IA 3ZYRA 3B93A 2Q1MA 1RUI1 3AKSA 2EAKA 3BOWA 2XMLA 3VZLA 3ZSJA 5JIUA 1JTZX 1L7RA 1W6NA 1ZRRA 2IVJA 3GZEA 1QU0A 3LEMA 2C9AA 2ZGKA 3VBOC 4CU8A 1EAH3 2RS52 4LITA 5FRAA 5K0UA 2JG8A 4ARYA 4NHYA 4I2OA 1B35A 1ZBA1 5JOYA 4HLTA 3TNPB 3USUB 2WSUA 5FY0A 1WCUA 1LENA 2QQLA 3B5LB 1S0BA 5LZ6A 4R8HA 1DG6A 4GB33 2XJQA 4YVSB 3RDIA 5AC93 5CFDA 1O8PA 1SPPA 1VRH1 4HT1T 5I8SA 4Q27A 3OEAA 3R0RA 4WVMB 3LEIA 4IV1A 3PVNA 3R6SA 5BNPA 5DG2A 2BNOA 2FBEA 5FAXA 2WABA 5L7OB 1XPWA 4OI1A 2HLEA 1DGWA 1BBT1 2O14A 2DURA 2IFWA 2XLFA 1FOD2 3M2MA 4C1XA 1W0OA 1QOTA 1FAYA 1NQDA 4SBVA 2BV4A 1ND3A 2OYZA 4IL7A 3NNFA 4NHKA 3K3OA 4UWDA 5FUIA 5GZFA 2R49A 1JZ7A 4Y20B 4K40A 2JG9B 5GZEA 1QY4A 2XBO3 3RYPA 4AEDB 3VKMA 4CDWC 4K21A 1W2AX 4COZA 2C6SA 3VB9A 4MXWB 4OUEA 1OOPA 1DQ1A 1SDWA 5FP8A 3S57A 5H9SA 3I54A 4IUGA 2GN3A 3BUCA 2W1WA 1C8NA 4MGSA 3NV1A 4AFMA 5A7NA 5FZCA 3GJBA 4D69A 3J7HA 2JICA 3N35A 4YSFA 2A3XA 1D4VB 5T50A 1RMU3 3BTYA 2VU9A 1OA3A 2RVAA 2YV8A 5EHDA 1UZ0A 2XG3A 4PHZA 3VHNA 1XYPA 5D8AC 1S55A 2BW8A 4AQSA 4FQZA 1H2NA 5FZOA 2ZAAA 4CDXA 4CCDA 4RL7A 1ULPA 4H55A 1A6CA 5I91A 5FPZA 1XB9A 3TBDA 1VBD3 4IERA 1J83A 1Q8PA 4QXBA 1LODA 4XCBA 5CKNA 4AVBA 1HJGA 1UF2C 4QDSA 4FOQA 3LFIA 3E6BA 1UPSA 3LZZA 3VHPA 3ZR5A 3SXWA 3TEYA 3RGBA 1JXNA 2A6VA 4XDOA 5E89A 1WKYA 5FK7A 4ZZ5A 2GZWA 1WA4A 4G9SB 5K7PA 4NIHA 2B42B 2XJVA 4COYA 4KH9A 4FFGA 5FZIA 1QOSA 2DTYA 2R1DA 1F4HA 5ACA1 2HYXA 3RYKA 1YHFA 2QTWB 2VTFA 2AENA 5E16A 2P3KA 4XTPA 3ZKUA 1HN1A 1UMIA 2EAAA 3MV01 1XNDA 4Q0QA 3WQ0A 4CU6A 2ARXA 1UZZA 1US3A 2XVKA 3LE0A 2FDIA 3AX4A 2JIJA 2JG9C 3K75B 1ULCA 1PO21 1DLLA 1N3PA 1OLME 1VLNA 4MO3M 5F8PA 5E6HA 4CA9A 4P14A 2VCBA 1SLIA 2RDQA 3ILNA 1S0DA 4R4XA 5CKMA 2JB8A 1REFA 2JJ6A 2WNVA 5FXXA 1LR5A 3N7KA 1NCRA 1EV12 2K2SA 1QDOA 3BOPA 4NRQA 2RS51 4XF3A 5FPAA 1DZQA 2HEVF 4CEYA 1NT0A 1F35A 1TMF1 2FDJA 2QE3A 2ZEYA 3VBSA 3WCSA 1OQ1A 3WG1A 5JSRA 1KDMA 3RZGA 1AL0G 2XDVA 3KD4A 3AYCA 1LOCA 1SZBA 2R041 1RUI2 2LTNA 5DUVA 3OUHA 4NR1A 2WFF3 4Y1ZA 2WWSA 3JBG1 1WW4A 1RGSA 2LUWA 1OHFA 3NAPC 3VBHB 4Y22A 4RQPA 3ZDVA 2RM22 1ZBA2 3JD71 3JQWA 5J7MA 1P8JA 1ZZ9A 4YW6A 4CXYA 3RZMA 3N9PA 4X6QB 1AXZA 1AR93 2WO7A 4YLZA 5GLZA 3TN92 2B39A 1YI7A 1V6MA 1VAMA 4TLGA 4JGYC 2WNUA 5IFTA 1Y9QA 4LMFA 2A75A 1TME2 1OLRA 2XUEA 4JKLA 4R9BA 1GNYA 3RZJA 1SPPB 1O4TA 2RMU2 4EV0A 3I3DA 3M3EA 3VBUA 1FPN1 4W6XA 3J8F2 1D2SA 4UXAA 4GAZA 5FK8A 2YROA 4IV1B 5B4NA 3KLSA 1K45A 2DFCA 1W8OA 4GB31 1F2NA 2W46A 1HB2A 1E5SA 2PA7A 3C7GA 2CWSA 3KWVA 4UFKA 3AZWA 3L2HA 4LE4A 4Y1VA 1MVQA 3H3ZA 3K2OA 2ZABA 1L3JA 1OUXA 1S0CA 2E7QA 5JZGA 1VALA 1U5YA 5E1RA 1VIWB 1XC6A 2VOXA 3WVJA 2OXBA 3T2TA 2YB7A 5I0SA 1LGBA 1HRV2 4RHV1 3P3NA 5CB7A 3WNOA 1PO11 1WW5A 4IGPA 4GKYA 3VDDC 4AVVA 1RUC1 4C91A 1Y9GA 1NA1B 4LIVA 1F5FA 1SLBA 1TNRA 2OQ7A 4FP3A 3DL3A 1UPIA 3FHIB 1W8UA 4MHUA 5BNOB 1GWLA 5EJ1B 2BNNA 4CYDA 5F3CA 3RJ2X 3VD9A 2VZ1A 1EYBA 1FPN3 2YU2A 1ZRIA 4LO8A 5D2AA 4A7YA 2B7YA 2WQ8A 1CESA 2XWBB 1TZOA 1CPMA 4GZ9A 1PGSA 4NROA 2JDZA 1LEDA 1XQNA 5DAWA 5JSOA 2ARCA 1FT9A 2W1QA 3MUY1 5C5TA 3O0WA 4B1MA 5FY4A 4JQRA 4AYUA 1V00A 1HRI2 2H6BA 3SCHA 1ULEA 3AMNA 4FTSA 4IXLA 4BJ0A 2YG0A 1PMHX 2V4AA 4OZOA 4JGYA 1Z7S3 1NCQA 4OHZA 1UZYA 2IXKA 4IEUA 1K5MB 2ZGMA 1ZA4A 4YZ3A 5C3QA 4ASLA 4AEDC 1T2XA 2I2SA 2IXLA 3VDCA 4JRLA 4YVSA 4QGLA 5JXGA 1UIKA 5HPOA 2Y6LA 3VBUB 2D7FA 5D8AB 4LBKA 1U5ZA 1WCQA 4K8FA 3LDKA 3TEXA 3IMNA 1F15A 2JDUA 4IGQA 2HWF1 3ZFEA 2Z4FA 3ZXKA 5GKAC 1PO23 3HT1A 1JZ8A 3WUCA 3BIWE 1ST8A 5F37A 1RTVA 3EXUA 4COWA 1DF0A 2BDRA 2WFPA 5JZGB 1O3RA 4DRRA 4Y20A 5BXXA 1SFNA 4QM9A 1NXMA 5LATA 2WZPP 4PIZA 3DYMA 4PBOA 1VR3A 3HNMA 3MYXA 3LF7A 4JGZB 3LIGA 4MXWA 1X9TA 1EPZA 2XWJB 3A0KA 1NLRA 3DPRC 4BQWA 5A6ZA 2DCZA 2IWGB 2XHNA 1HW5A 5G04L 1K5JA 3VGIA 3RZKA 1EAH1 3DEMA 3EMRA 3MUZ1 2CGPA 1OKQA 2FDGA 2EF6A 2W68A 4HK9A 5GJ6A 1GWMA 4KG0A 1KEXA 3VBFA 1J1TA 3KSCA 2W39A 4Y33A 5FPVA 3NSTA 1UAIA 1Y4WA 4GJZA 5FJHA 3SEEA 5FOBB 3TEZA 1LAJA 2CL2A 1F31A 1MS5A 5DZGA 1H2KA 1DIWA 2R072 2EXIA 5C33A 3AVSA 1COV2 2A6XA 1GZWA 4XE9A 4MLOA 2VD7A 2YHJA 4A6SA 2HWD2 3SCGA 3ZYHA 1O91A 1G6NA 2WKKA 2VOTA 3LSDA 5DUUA 5A1AA 1AYM2 3OBTA 5C8WA 1NG0A 1BEV3 1NYWA 2A7AA 1NXD1 4Q4X2 1OT5A 4XJ8A 4N9IA 1ONAA 4CCKA 2IVIB 3JU9A 5B2GB 1X33A 2ARAA 5FIXA 4O9EA 4ZU7A 3Q8FA 3K3NA 3ZXEA 1NQJA 2Q4SA 4EWEA 4OYUA 4HXCA 1V6KA 2GSYA 1MR5A 3GHMA 1RHI2 4I01A 1VBE2 4JHZA 3JUUA 3B02A 3J8F3 4XURA 4UI9L 4DEVA 1CZSA 2E51A 1IKQA 3NW4A 4FPCA 4B4QA 4CDQA 1UOJA 3O1MA 2FDKA 2TBVA 2ZOEB 3MIHA 2ZX1A 1CAXA 3J7MA 1UKRA 2WWUA 4XW3A 2CU5A 1NKGA 4FP2A 4I0BA 4AAXA 1JI6A 1AR72 4HL0A 3OGSA 3DECA 3FWEA 3WF1A 5BUVA 5EP9A 1WD4A 2B8MA 1VBC2 5LB6A 2WZR2 4HVRA 4JKMA 5APAA 2XVLA 5LK5A 3PU8A 3C2UA 1ENXA 4LR4A 1EUUA 5FP4A 5FFOC 1OA2A 1C4RA 2Q1FA 4CDWA 2NZ9A 2X09A 3DKWA 1YUDA 3NNMA 2WNVB 4WBBA 4A41A 5L9RA 1ZM1A 2L9LA 2CWMA 3ZYIB 1PGL1 3T2OA 2VZQA 2DVFA 2HWC3 3MIFA 4NRPA 3FHAA 3ITQA 4V2WA 1S0IA 4N90A 2HWC1 2WNOA 5C8CC 3VHRA 1I6XA 2BGPA 3D3AA 1Y9MA 3AZXA 3WQBA 5FZLA 5FOJB 4ITCA 4MUVA 5FZ1A 4FXKB 4QGMA 2JDHA 4XJZA 1XOYA 4GH4A 4O61A 3LOBA 1DGLA 3IN9A 1UIJA 4Y4YA 1W28A 3D4KA 1W6MA 4QDRA 4A42A 1ODMA 5AFBA 3O1RA 5DG1A 4B1LA 1US2A 1VBB3 3HOBA 4QQLA 4L9BA 4WVWA 4AFCA 2Y6KA 1PZ8A 5CEHA 5FMDA 1UW8A 1AUYA 1VBB2 2V4VA 3NRUA 4GKXA 3WCRA 1XSQA 1D4M2 2PN5A 2ZX4A 4MGTA 1BKZA 2VQUA 3M3QA 1QXPA 1ZA7A 2D5HA 3WINE 2BGCA 1H9WA 4O65A 4UFIA 1HB3A 3PUQA 1LEMA 2BQPA 1MS8A 4XEZA 1LOFA 3RYRA 1IS5A 2X10A 4I3PA 5C4WB 3NO8A 5F5IA 4A7ZA 1JYTA 2PHDA 2WAOA 1PVC2 4R9DA 4DXRA 4P9IA 2XQXA 3VD5A 1IS6A 3OCPA 5A3UA 2OUHA 2VOVA 3I2JA 1SBEA 2H0BA 3CU7A 3WDXA 2DFBA 2XHKA 1UYZA 2A73B 2W5FA 3BVCA 3I59A 4FPFA 2VQ0A 4MOAA 1D0GA 3ZFEB 5BYNA 2YBPA 4LPLA 4E4ZA 2VNRA 1LCLA 2RDNA 3B01A 4FCAA 1TME3 1FI2A 4LO4B 4ZXEA 2HH9A 4AEKA 2J1UA 1YJLA 2FDHA 1OXCA 4YG6A 4D6RA 3I4IA 1AR81 4QKFA 1WCDJ 2QKDA 4JZRA 1LHVA 1R1A1 5B4XA 1OF4A 3ZO0B 1UY3A 4N43B 2HBTA 4JGZA 5IVCA 2VM9A 2ZX2A 4XUTA 1RUE1 4XOGA 1DQ6A 3CJIB 4LOSA 3HNYM 5FYVA 5JZGC 3S0MA 3B9CA 4QHOA 3VLBB 2JX9A 5F32A 4EN8B 2MEV3 4IE7A 4F7ZA 2B5HA 5A32A 3H42B 5K8SA 1UX7A 2PHWA 1GOGA 3VBFB 5A3MA 2D40A 3A4UA 5F39A 3WD5A 2ET7A 1WGPA 4N53B 4XF0A 5EFUA 4HN1A 4XTMA 3ILFA 2BOIA 5A80A 2Z2SB 1G9FA 5JR7B 2GMMA 1SHWB 3K4ZA 4LXLA 3MO4A 3POBA 4Z8BA 4Y1YA 3GZAA 4HKWA 1YJKA 2Y6JA 1C5HA 2D93A 2Y0OA 5E8AA 1CZTA 1MZEA 4B7EA 5IVEA 1ND2A 3DYOA 3OY8A 1IG3A 4AGRA 2LROA 1NCQB 4LKEA 1W90A 3ACIA 2UY9A 3ACGA 1GUIA 1DQ4A 1C8M2 4KWLA 1IG0A 5LA2A 4CEWC 2ZGUA 3USSA 5FYZA 5LWBA 1OQDA 2DVAA 2D6LX 1CAVB 1J3RA 1XE7A 1GZTA 3IT8A 4B8EA 1O5UA 4ES9A 3IM0A 3I59B 5FDBA 2ES3A 1V6LA 3GZUC 4EWDA 3PIJA 3R05A 5J48A 1UU5A 4M0HA 5T5JA 4IV1C 1PK6A 1W9FA 4GH4C 1ZRDA 1XXNA 5K0UC 1HRI1 3GXUA 5BNNC 3QACA 1ND3B 3BODA 4I0AA 3UGGA 1FXZA 2BJSA 3EBRA 4FPOB 4NAOA 5A7QA 1NOVA 4HPKA 3KV5A 4UW5A 5LY2A 1MS0A 2VUDA 1UCXA 1DYOA 3UKNA 2PHUA 2E7TA 2GP5A 4P9XA 3JB4C 2BVVA 1CAUB 3MBWA 4AI0A 4DEQA 1ASJ2 2DDUA 2W0XA 4XUOA 4HG6B 4NRMA 3M3IA 3W20A 2IXHA 3LIHA 5ANNA 1DQ5A 1QMJA 2R6QA 5LRRA 4AW7A 2Z79A 2DU1A 4UF0B 2YGLA 1N3OA 5FLHA 1UN1A 1QJY1 4COUA 3MF9A 1PO12 3QOPA 1W6MB 3CQOA 3VN4A 4CVUA 1CJPA 2BP6A 3WP6A 4CEYB 3LPGA 4AQ2A 2GNBA 1EUTA 2GMEA 1W03A 1W0NA 2OKXA 3KT7A 4CDXB 5JOWA 4XHXA 3WF3A 4C0HA 2WA4A 4GULA 4WV8A 3W59A 3KV9A 1PGW1 1JUIA 4ASKA 1BXHA 1UY0A 1WW7A 1D4M3 2W47A 4S2DA 5FY8A 3VBOB 4CDXC 4Z92B 5CZKA 5GLVA 1AYN1 3KS7A 4BHPA 1GZ9A 1A34A 1BVVA 3O5SA 4JHTA 2VMIA 2VMHA 5C4WA 3U75A 4YZ2A 3OYWB 4C90A 2CNAA 4XMIA 4YG3A 4DRVA 5FY1A 1BVP1 5CFCC 1PGL2 3LA2A 2RMU1 4ISQA 4XQWA 1Q56A 1H4HA 2VTXJ 2E53A 4MGQA 1W6QB 4JDMA 2J1EA 3SMHA 1SCRA 5JIAA 2WZEA 3ZM8A 4TXWA 1JYVA 2X29A 3APBA 3IIAA 4WM8B 3ZXLA 2YFUA 5EJ3A 3NJXA 3RPQA 3BI3A 1MS4A 1VBC1 4Q8KA 3O1SA 1Q5OA 4JDOA 1UL9A 3JD72 2GNDA 5F3EA 3OUIA 4J1XA 1F5JA 5H9QA 2A6ZA 1RUF3 2RR12 3WG2A 3INAA 3I2DA 2Q1ZB 3WG3A 1UU4A 2ADEA 4QX7A 4CCCA 5A3TA 4YARA 2WFF1 1GZCA 4ZONA 2IXJA 3MPPG 3CLPA 1WUVA 1YQ2A 3EJKA 4WM7A 3T2QA 2EIEA 4KBBA 4QU1A 2HBUA 3T0BA 4QQHA 1TMF3 3O0XA 1UY2A 4IEWA 2VOKA 1S2EA 1QJEA 1EV11 5IYYA 3OEBA 2D3PA 3G6JB 3OSDA 4LBQB 5IW0A 4OZXA 1WD3A 3UKTA 1JMUB 3H3LA 4XDPA 1QWRA 2BRTA 4Q4X1 4JTOA 4Q4V3 5C8CB 3N9OA 1YI9A 2X5IC 5FZ4A 3W58A 3VBHA 3KHCA 4Q2FA 3WZ1A 4AFDA 3LA3A 2VUJA 3ZFFC 5CADA 4YW5A 1UZWA 5JPNB 3AZYA 4MSVA 5GZDA 4LORA 1I5ZA 5LBFA 4DXZA 5F2WA 2OVUA 1IS4A 2WFF2 4FI9A 1HQNA 1QQP3 1MZ6A 2HWE1 3RS6A 4XXPA 5J98B 1QIQA 5ACA3 3OYWA 4EYUA 1HIXA 1W3XA 4N53C 2C26A 3THTA 4ES8A 4BLJA 3P3PA 5F7UA 1GBGA 3BTAA 5ERLA 2XJTA 5KHIA 2J22A 1KRIA 3VBFC 3HQRA 5J36A 3DPRB 2EXHA 3U14A 4TWTA 4WM8C 1VBA1 3SNMA 1OI6A 2D3SA 2R30A 4DOUA 3PUHA 1QJX1 2D6KA 3Q8BA 1Q8SA 3LCPA 4MGZE 3CNAA 1M06G 2RMU3 2WS93 4EZ4A 3WR0A 1WWYA 5FYMA 3POYA 3V0BB 3FLTA 2WS91 4UT5A 2J7MA 3ZYPA 4D0QA 3ZN6A 1IS3A 2QQPA 2BEOA 3B3QE 2VY0A 3BALA 1H4GA 2XVGA 3I3EA 4XC9A 3POIA 5EWSA 1QXRA 3ROUA 3O1PA 3ZYGA 1JYCA 2WINB 5JR2A 3PUIA 4QQ2A 4XYXA 1BMV2 4MV2A 3WG4A 1AYN2 5IVFA 1YFXA 1SLCA 5FR3A 4GMP3 1LJ7A 1UY1A 5I93A 1OF3A 4UW3A 4WM7B 1QJZA 3OUJA 3KVBA 1W3VA 3VD7A 4UF0A 2NLRA 1BK1A 3WNPA 3HVDA 3POFA 2VECA 4X8PA 2XJSA 5DQ0A 3EO6A 2LM3A 2R32A 1JBCA 4QX1A 5DXDA 5IVYA 2XH6A 4XAEA 5F5QA 2VC9A 4ATEA 1QJY2 4QB1A 2WNEA 4XJUA 3ABZA 5JOZA 4X6RB 2UWAA 5C8CA 3E5XA 3H50A 3CZUA 5I0DA 3BU0A 1GQPA 1XYNA 2QQMA 4MVTA 4LBNA 5LBEA 5J37A 2DF7A 3KHBA 3SCFA 1DU3D 4CUBA 1ULFA 4Q4X3 1GOHA 4Q4V1 3ZYFA 4P5YA 3RQ0A 2J1RA 4AF9A 4A3ZA 1PIV2 1QOOA 3ZMNA 4NWVA 1GQHA 5H9PA 3HJRA 4Q4V2 2B45X 4W6YA 4IE4A 3HT2A 1L7LA 4LUMA 3DN7A 1IGOA 1C28A 1V9U2 2IUWA 4Y26A 3WW4A 5HCAA 4XJ9A 5CU1A 4OHWA 1GP6A 3CEWA 1QH6A 3LPFA 2O8OA 2YGMA 4WM8A 4DY3A 1X9PA 4GA9A 4XCAA 4D8MA 3HIFA 1YIFA 1W6PB 1UMHA 2VQTA 2YZ4A 3EHKA 4LO7A 3O1VA 4HK8A 1OOPC 1AL23 2V73A 4CRQA 4XJWA 1XE0A 2YFZA 1PK6B 1R083 1Y7BA 1GYKA 1X50A 1O7FA 4RHV3 4XBLA 4CEWB 3C7OA 2QJVA 3GBWA 4HETA 4K6BA 2PELA 4OMDA 1NE4A 5FYYA 4UFHA 4FAGA 2BBAA 1RUF2 1VAKA 2PHLA 2RR13 5CIRA 3NKTA 2QCSB 3LWCA 1OPOA 2ZGTA 4JTNA 3SEPA 4N9HA 1BMV1 2RS32 3ZXJA 4UFMA 3TWIA 4XFBA 4M3CA 4LBLA 1SDDB 2WC2A 2ZEWA 2VR4A 3VDDA 1FPN2 1GV9A 2WS92 2YMZA 1YFUA 4P9WA 3RI8A 3AB0A 1QJX3 3QD6A 3MI8A 1IPJA 4QPGA 3JB8A 3B94A 3GBFA 2CAVA 1LU2A 2D5FA 1Z78A 3VKLA 1KD7A 4BE3A 1HB1A 1Z0HA 3PMEA 1VBA2 4RFT0 3THCA 2BPA2 2ZAHA 4F83A 5JDBA 4MYEA 2P6HA 1JU3A 2MHFA 3IAQA 4YW7A 5HCBA 4P08A 3RG0A 1QH7A 3AM2A 5FY5A 2AEYA 3EB7A 3WW3A 2IC1A 2R042 3A0NA 4NPMA 4NPRA 4JAAA 1DLCA 1KJRA 1X36A 3IZOA 3QLQA 5FMCA 4CDUA 1T6GC 2GP3A 2VQAA 5DUXA 1LECA 4P02B 4BYYA 1H8TC 1DGWX 4PDWC 1G9CA 2FMDA 2OX0A 3HQXA 4QB2A 4XQDA 3RWKX 4QHZA 3V56A 1W6QA 2UU8A 4AI3A 4CTEA 2D43A 1WLTA 2V5YA 2Z42A 4Y5SA 4BPZA 1J3QA 2AH2A 1HDKA 1WZXA 3DXTA 3RVHA 2OQ6A 3NVCA 4A6OA 3MLJA 5CFDB 5DZEA 1PX3A 1ZYBA 2C4XA 5D8AA 4I3GA 2GMPA 3RI9A 1A8DA 3NJZA 4BQ1A 2E32A 2NP0A 3C3VA 3ZIWA 2HEYF 4XFAA 5FBZA 1RUOA 5M0TA 5A33A 1X8MA 5JUVA 5FYBA 3WW2A 5KHJA 1NUKA 1UU6A 1RUC3 1UOGA 2DUQA 3KMHA 4AI1A 2RDRA 5FWJA 1YWKA 4FOWA 2UURA 2VOWA 3PVEA 4HBNA 2Q8OA 3W5MA 5DDJ3 1VBB1 4Y5TA 4CU9A 3ZVXA 1IPSA 2Q30A 1WA6X 5FCCA 4AXOA 3B00A 2ZGPA 3M70A 4QXKA 4FPKA 4QX5A 2RS13 5FZHA 4K3UA 3W9AA 2V5DA 4NPLA 1MS1A 2DU0A 4LBQA 2OIIA 3IDAA 3A23A 4AEJA 4LHKA 1CPNA 4J1WA 4RFRB 3J9SA 3VUOA 1H6YA 4GJYA 2BWAA 2NPIA 2YC0A 3IMMA 4IW3A 1WLDA 4QKDA 1NLSA 2HWC2 1W05A 2DCYA 4YM1A 3ZOIA 3K48A 1N1VA 4K20A 1JHJA 3UESA 2PXJA 3FJSA 1I5PA 2DUOA 1RUNA 2NM1A 4RQPC 4QAWA 4WVVA 2WO1A 1IQAA 4E2SA 1W39A 4AHYA 2QQKA 1Y43B 3ZXDA 3VDBA 4OVEA 1YIPA 1W9TA 3E6CC 4XQ4A 4PIXA 4BH9A 4DMIA 4PLOA 3ES4A 2VW0A 3J26N 2DCTA 4C0BA 2P3IA 1G86A 3VL9A 1RUJ1 3A7QA 5GZCA 4IEPA 4E4SA 3OG2A 2VG9A 5FREA 1OH4A 2ARBA 3H7YA 3P1IA 3ZDSA 5CFCB 4OQ8A 1KITA 1O8SA 3WP5A 4EZHA 1QKQA 4U36A 3WLUA 5C9AC 1H2LA 1SLTA 3WHUA 3ZSLA 5KR7A 4KGGA 2GC1A 3V0BA 5BNQA 1IZ3A 3WHTA 1N1YA 1UOBA 3AZVA 5LBCA 4CE8A 1BJQA 4CDQB 4Z82A 5FLJA 1RHI1 1RXGA 4Q4W2 5G05L 3I2HA 4XFHA 5F3IA 3CKHA 3PJQA 3RMXA 1LU1A 2VZVA 4LA3A 4F8AA 1ODNA 4OQ9A 3GYDA 4Q29A 1HXS1 1VRH2 1ZNPA 3HWJA 2Y33A 2ZZJA 2ZX0A 4QWNA 5AC92 5FV3A 3AL6A 1QXJA 3CDZB 5D21A 4QT6A 4QMAA 1UD1A 1COV1 2YBSA 5FZ9A 4DNYA 1S2BA 2SLIA 1S4CA 4OMCA 4BZ4A 1XBFA 4Y1UA 2VCCA 1POV1 1QJU2 2VNOA 2E33A 3M3CA 1IPKA 3THDA 1U12A 2FD8A 3ME2A 2W52A 4YG0A 3VBSB 1CIYA 3EYPA 1TG7A 1CGPA 2QVSB 1C8M1 2QQVA 4RSUA 3NNJA 1DP0A 2WSVA 5KC5A 5KHGA 3CO2A 3IIIA 1PIV3 1D7PM 4L8QA 5FZ6A 2B4KA 4A4AA 5F3GA 1VMHA 5K0UB 3WX5A 1HJFA 2EVXA 5DAVA 2ZXQA 4PI0A 1VBD1 4RR3C 3WXPA 4A3XA 4P9LA 4KBZA 5CBLA 4CCJA 2NN8A 3USUA 2XB6C 4D7SA 4JCKA 4JQTA 4NIGA 3POJA 4OCTA 3N9MA 1RMU2 1PNGA 4AE2A 4FXGB 2NQYA 1AL22 3AL5A 3IDCB 3ZKYA 5A6XA 1W6PA 2R062 4Q0PA 1DCSA 1RHI3 1V6NA 2R063 3VBUC 1UNBA 4BQ3A 1DDLA 2EXJA 2WYSA 4AAPA 4AG4A 1JZ2A 4K8RB 2XBO2 5HI0A 4IEQA 3QH7A 4L0PA 4QXCA 3T4HB 3LKJA 1LHWA 3NQHA 3CF6E 3TNQA 2YC4A 1CONA 4IV3B 4P9GA 3WEZA 4L2NA 3SH5A 2UYBA 4RS5C 2RE9A 2WL1A 3GCWA 1R1A3 3ZFFB 2Q5TA 3CMGA 2GAUA 5C5UA 1JS9A 5D1IA 2VZUA 3MLLA 1R1A2 1CZVA 3ACLA 4QX0A 4NUBA 4YFZA 1SCSA 1AR82 2WRAA 1MQTA 2WAAA 4EWAA 1RVF1 4N7UA 4N43A 5FMOL 3POGA 3ZXFA 3WDYA 1SACA 3A22A 4LHLA 2XJUA 2F17A 1OLQA 5FYUA 4LKSA 5IVBA 2A70A 2ZZQA 4EN6B 2EIGA 2YU1A 1RVF2 5CVRA 4QM8A 4CP2A 3NL1A 1WLCA 1LHUA 3N3HA 1I1EA 3NKGA 4BM8A 2A5ZA 3NNGA 4FFFA 4K9SA 1POV0 3ECQA 2Y8KA 1R1ZA 4KG8A 4DB5A 5C3PA 5FZOB 2WO2A 3U10A 2CGOA 2VMDA 3PVOA 4KU8A 4Y1XA 1RYYA 4JVAA 2ID4A 3ILRA 3NNLA 1APNA 1FATA 3CL1A 1AR61 1G8WA 1DGRN 4W8JA 5E88A 3C8XA 4OFGA 1OVSA 3CJXA 4CCLA 1K3IA 1GQGA 4CPBD 5ISLA 5GLWA 4QPWA 1AJOA 1LRHA 2CYFA 4Q4W3 1ZRFA 2ZMKA 2W1UA 3FLPA 3HMYA 4XFIA 1MPXA 4H7LA 3V0AA 5CA6A 3H8XA 2ADDA 1K42A 4I02A 5C6CA 5A3NA 1U5XA 1I9RA 1PM4A 1LOGA 2OZ6A 1NY71 2VXRA 4LUKA 4YVSC 4CZSA 5FO9B 1R093 5JXJA 3ORJA 2BUKA 3OGJA 4IESA 2J42A 1MS3A 4OLLA 1LNSA 2ET1A 4MADA 2PLV2 1XSRA 1S0JA 3VBSC 3T1MA 1UOFA 3BPSA 3ZSEA 4IEZA 1G9BA 1DYKA 4QGNA 3JD73 4UW4A 3ETQA 3VZKA 4HVOA 4RGAA 5FO8B 1H8TB 3PL0A 1RITA 2RM21 1JW6A 1MQTB 2WNUC 3NV2A 2VE1A 2TEPA 2VNVA 4LBMA 4U2AA 4XIKA 5C4WC 4JRAA 5IAXA 3LEGA 2WT1A 1RC6A 2ZMLA 4B4PA 1LHNA 1OURA 3H8RA 2FZ2A 4DS0A 5GALA 4QHBA 5LA9A 3BN6A 3I2GA 2EA7A 1TE1B 4FPLA 4J6GA 1RB8G 4HVQA 5JXHA 1TMF2 1AR92 2OPKA 3WNKA 1REDA 1HXS2 3NJVA 1WLWA 2AGSA 2PQSA 1VBE1 3ZSMA 2JDAA 5FZGA 1HB4A 3AKTA 3UYJA 3VZMA 1VP6A 3HPNA 5FLIA 4ZY9A 1NLQA 4PLMA 3PU3A 3ACFA 1HV1A 4CP9A 1FNYA 1ND3C 2X05A 1AYM1 1IQDC 4BISA 2D6PA 5IK7A 4WZCA 4EJRA 1H30A 3POSA 4LHSA 4GQ7A 5JMOA 2PTMA 1QNWA 3AJYA 3DCQA 3FHQA 4H2AA 4JKKA 4O7XA 1CX1A 2ERFA 1VMFA 5KHHA 3OBAA 1XU2A 1XJAA 3GDBA 2W94A 3PURA 5A70A 3VD4A 1C8M3 1OH3A 1UXZA 3PLQA 2B46X 3UT0A 2VMEA 3IB3A 5IT6A 3KQ4B 3PNAA 3RSJA 3LOIA 2J1VA 3MIEA 3GBGA 4CP1A 4KWUA 4XDQA 3ZN6B 4AZZA 1PK6C 3O14A 5LA0A 2WZ8A 3N9NA 4CPBA 4BOWA 1QQP1 2FHRA 3FMGA 4JV4A 4KQ7A 5EXOA 3BCWA 1BZWA 3AMHA 5FP9A 4YW3A 2VXJA 3KGLA 1DQ0A 3D82A 3X29B 4G4FA 4F3JA 3T0DA 1Y3TA 1RUJ2 5K4LA 5FXWA 3TYJA 2LW8A 3JQXA 5IK8A 1EPWA 1E5HA 3TEWA 1D0HA 2WZR3 1ULOA 1W0PA 2HWF3 3TRSB 2A71A 3UGFA 2XJRA 4WM7C 5A3WA 3UL2A 3VKNA 2G9FA 1QJU3 2VBBA 5LRSA 2OUJA 3OPWA 1VAVA 4CCMA 3NWKA 1RVF3 5DPNA 5DZFA 1U0AA 2UYAA 4GWIA 2XOMA 5IVJA 3UJOA 1TNFA 4CUCA 1W8NA 1ULDA 3C7EA 1FYUA 1V6IA 3AP7A 3VKFC 1H1IA 2D6OX 5HBAA 5KXCA 3I2IA 3VV1A 4IEVA 5JLVA 1WMEA 1LB2A 1GR3A 2RM23 1SQ4A 2JG8B 2IXIA 5FKCA 4R9CA 2HWB2 1B35B 1YQ8A 2ZTNA 4BDVB 1POQA 2G9ZA 5FPXA 3J4UH 4AWDA 4BQ4A 1OD3A 2ZMNA 1AZDA 2Y64A 3MHZA 2JE8A 3HQUA 4E9KA 1NZCA 3AKPA 4Q1PA 4Q4Y2 4FT8A 2AEZA 3CHXA 4IGOA 3TOJA 5FO7B 4EN7B 3KZ4C 1OD5A 3N7LA 5ABJA 3TB0A 2RDSA 2BFUL 1REEA 4LULA 2W9XA 2BU9A 1H0BA 5LBBA 5SV8A 3SH4A 1R091 3BTXA 2TNFA 4XACA 1MEC3 4MG2A 4QPIA 2VAUA 1CN1A 3BKZA 4CEWA 3RZZA 5BNPB 2P1BA 1PVC3 3KF3A 4RYDA 2YBKA 1RUD1 2VNGA 4PJYA 1R64A 2O1QA 3UKVA 1XNBA 4IV3A 2I74A 2V09A 5F2SA 1CAXB 5A7PA 1BHGA 3GM8A 5FZBA 2DV9A 1RUC2 3SITA 4E4DX 3F2ZA 2YYOA 1GU3A 4XFGA 1YXWA 1YQ5A 5FZAA 3PUSA 3ZN5A 4XBQA 1AL21 1PNFA 4OHYA 2Y26A 1JOBA 1Q8VA 2AUYA 3D5OA 2CAUA 1COV3 2VH9A 3F95A 4QDQA 5FYSA 3N7MA 5L36A 1XNAA 3AP9A 2G19A 2YDEA 1QJFA 5CKQA 3AMMA 3Q8CA 2JDYA 3R4UA 1K12A 1Q8OA 4ATFA 2HJIA 1UYYA 3NAPA 1AX2A 2X5IB 3HD8B 2MPFA 1X8EA 1DBNA 5DABA 5AFEA 3POEA 2R16A 5EV7A 1W6OB 4FPEA 4DUVA 4CP9B 1RMU1 5EJZB 1N1SA 2BNMA 3N36A 4Q1RA 2UWCA 4DFSA 1PVXA 2WO3A 1GSLA 1AX1A 3U37A 2RV9A 3ALQA 3E5UA 3WDUA 2QQIA 1H1AA 4CUAA 2XPJA 1HRI3 2BFUS 4EQVA 3MIBA 3KCYA 3OY8B 4HANA 1I3HA 1GFF2 5BNOC 1VJ2A 1OBNA 2E9QA 4XHBA 2ZHKA 1H2MA 1MQTC 1GANA 2YY1A 1V9U1 3K46A 4LHNA 5JPMB 2G4IA 3ZPOA 4DXTA 1GOFA 4E2QA 5CNAA 3M7AA 1CAVA 4YW4A 1BBT3 1W2UA 2VTXA 3BU7A 5T5OA 1QJU1 2QQUA 5F6LB 4KNCA 4KWKA 4Q4Y3 4URAA 1IKPA 3S6PA 1KJLA 2X53S 1GNZA 2BWCA 3VZOA 5K9YA 5AVPA 5FYCA 4CXXA 4IE0A 4YM0A 2R1BA 1VRH3 3AJZA 3WT3A 1PO22 3O0VA 2PFWA 3J7LA 4ZZ8A 5AC91 5EPAA 4XBNA 1JZ6A 4KMQA 4CCNA 1O4YA 3CBNA 5LEJA 2XUMA 4QX8A 2KD7A 3O1UA 3ACHA 1PZ9A 3THPA 1DQ2A 1PIV1 3ENRA 5HCFA 1VBA3 2VVDA 3RNSA 2I07B 4M3CB 4WVZA 4XXAA 1MACA 4XJAA 4Q4W1 3ASIA 3U78A 2JENA 1H8VA 3MIGA 3MLKA 4HKOA 1ACCA 1AHSA 3HBZA 4QU2A 4TN7A 2W87A 2ZKNA 1E5RA 5DDJ1 3GF6A 4FFHA 2DYCA 3SC7X 2W2IA 4LK7A 2FDFA 2XKOA 2A6YA 4MGYE 2JD9A 3MDPA 2WLPA 1ENQA 4ONUA 4YRDA 3NAPB 3VBHC 1KS5A 2JXAA 4AHWA 3IAPA 3N7JA 2KR2A 4HSLA 2DBNA 5FZ7A 1ZBE3 2XQRA 3R4SA 1KQRA 2EIDA 2VUCA 4HN0A 1E5IA 5T3NA 2W91A 3PDQA 1RXFA 2Y6GA 4AHZA 4YZ5A 3DUIA 4WZFA 2W1SA 1YFYA 2ZGQA 5A6YA 3KVAA 5JXIA 5JI9A 2DVGA 2E31A 5EQUA 1YQ6A 2R0FA 3HBKA 3W21A 1S2KA 2E6VA 2NMOA 4QPIC 5GLTA 2GDFA 5KC6A 2GC3A 4YM2A 2XL7A 2GNTA 4JDNA 4YPJA 2QFEA 1IHMA 3O7OA 2H0VA 1O59A 3ZFGA 4AI9A 2ZGOA 1CIWA 2WBKA 3SKJE 4UW6A 1JHNA 4IV3C 3SKVA 1GKBA 2ENRA 1Z7S2 5FYTA 2O8QA 3PTYA 2IFRA 5FPLA 5CG8A 4Q0VA 4XF1A 1NAEA 1RUJ3 4XFFA 4AHXA 2P3YA 5FXVA 4AGGA 1CAWA 4BQ5A 2VZOA 2OW4A 3H0OA 3I2FA 3LAGA 2WUHA 4FTEA 3U11A 2NYYA 1FV2A 1NA1A 3R4DB 1X82A 2ETEA 1BBT2 2HKXA 4QKBA 3FE5A 2Y38A 5FTTC 5ANQA 3VZJA 4D6QA 1RUG2 1QHDA 3D0JA 4NOTA 5F5AA 4ZPIA 5F9TA 3IPVA 3M8LA 4YGEA 4AK3A 5A3PA 4UFLA 3B69A 1SG3A 1A8MA 1O3QA 2KM2A 5JI7A 2PYTA 4L92A 3OPZA 3O1TA 4A2UA 2GC0A 5DMYA 4ARXA 4XABA 4XUPA 4GWJA 4PQQA 2QQOA 3FLRA 2WT2A 3FUQA 5FP3A 4COVA 5DAPA 1URXA 4MGKE 4AVAA 2WN2A 3U0ZA 4AQTA 1PX4A 3WW1A 5T5PA 2EICA 1ZBA3 4K1YA 2LRPA 1FV3A 2JDNA 5BPXA 3VBRA 2JEMA 2VBPA 3WUDA 2OZJA 4FQ4A 2PAKA 3LGRA 5L7OC 4OI0A 4MZUA 1R081 4UBHA 1AR63 2VZPA 1POV3 2P17A 4GWNA 4OI2A 4Q5OA 4MHRA 4NAMA 4UYBA 2PHXA 3S7EA 1ZZ7A 4KL1A 2EXKA 3CJIC 3P5BA 1XYOA 2WDBA 4N43C 4CP0A 2K0GA 2VZTA 1HQWA 4LE3A 4D7YA 3VDAA 2Y60A 2RS31 3DPRA 1W9WA 2DVBA 3H1YA 1L7QA 1J1LA 1QDCA 3TN93 4AI8A 1JOPA 2AZ5A 1RUH1 4AL9A 3AYEA 4PLNA 4UOJA 1PGW2 3OOXA 4LJHA 4AQ6A 4CDQC 4HONA 2WJSA 2QQJA 1LOBA 2C1FA 2Y0IA 3S7IA 3HN1A 4KI5M 1HRV3 5I8TA 1VMJA 1CAWB 4ORFA 5FY9A 3BYWA 2ZBJA 3NJYA 1UQXA 2VW2A 4YW2A 1CD3G 1STMA 4YWAA 1CX4A 4QKNA 3ZR6A 3FUOA 1CAUA 3WSOA 1YLLA 2ZGLA 4CCOA 1O3SA 3H7JA 2HWD3 2AC1A 2G9GA 3W5NA 2LALA 3GZTB 1W2NA 4E4HA 1HLCA 1RUF1 4DQAA 4XFCA 4YZ4A 4YZ1A 2MEV2 4IEYA 4ET7A 1W06A 5FPUA 1FMD3 1ASJ1 5FMBA 2K46A 4FTBA 4DY5A 1RIRA 5LW9A 1O6UA 4D7TA 2W92A 1GZWB 2DWRA 2ORXA 3PIGA 3POWA 1BCXA 5FP7A 1W6OA 3RZLA 5FYIA 3GJAA 5FZDA 4E2GA 1NX9A 1UYXA 2ZA9A 3K77A 2G1MA 5C9AB 5LA1A 1N1TA 3IWZA 3ZLIA 2WQ4A 4AFAA 4GH4B 3KF5A 1WMFA 2CTVA 3LDBA 4LO5B 5IK5A 4GWMA 3P6BA 3VBOA 4BB3A 4DPNA 1O4ZA 3URFA 2WR9A 4P5HA 3D0SA 3KT4A 2WNVC 1XNKA 1XNCA 2VW1A 1UXXX 1K5MA 5JSPA 4NO4A 2JE7A 4Q8LA 3Q9OA 2ZGSA 3U1XA 2XLAA 5JWPA 2ZPXA 3K4AA 2CDOA 2JE9A 2QUOA 1UWWA 3S30A 4ZU5A 4AI2A 4LT5A 2K9ZA 1G7YA 1D2QA 2OS2A 3D8CA 1VRBA 2JECA 4MXVA 4DXSA 4INDA 5HV0A 5BV6A 1Q8QA 2A3WA 1Q43A 1OMIA 5ABJC 2CSGA 5A1FA 1UY4A 4HZFA 4LBJA 1UZVA 3ZYJB 5BNPC 3C7HA 1VPHA 3NV3A 4PI2A 4ZU4A 1AR83 1WW6A 2VL4A 3C7FA 5CFDC 4HOOA 2ZKLA 3LB9A 2RJLA 1ZZ6A 3MW3A 1VE0A 4A44A 2D97A 3JXSA 1W99A 3OGVA 2ORZA 3AYAA 3AZZA 2JDKA 1SEFA 2DCJA 2PLV3 3MFAA 5IAVA 3NV4A 4W50A 4ASMB 3CJIA 4D94A 2KXLA 4JGZC 2ZX3A 5LASA 1JH5A 4I09A 4PDWB 1U5IA 5FKBA 4A45A 2N7GA 5IHRA 5IK4A 3KM5A 2HWE2 4W65A 3IBMA 4N8MA 5KXDA 4QPGB 1BLZA 1GP5A 3AFKA 1AJKA 1NCRC 4GD4A 3ZPYA 2ZHLA 3U07A 1RUE2 1QJX2 4XZUG 4ZKTB 3CZJA 4N53A 1YCIA 2LS6A 2WA3A 4M3CF 1XU1A 3GHNA 4M00A 3WQ7A 5JCTA 3WF0A 2P5BA 4PBPA 2D6MA 5I0RA 3WQ1A 4BQ2A 2HWB3 1GLHA 5C9AA 4GMP0 2W08A 1JOJA 2VVEA 4YM3A 4MGIE 1PM7A 5HV4A 3E1F1 1WCSA 1V0AA 1W8FA 4NVPA 4DUXA 2CGNA 5H9RA 4GXLA 1UX6A 1UYPA 3AVRA 4XVHA 5KXBA 4S2GA 1RUD2 4LTAA 1HKDA 2R073 3I2OA 3AP4A 2VMCA 2WYFA 2X8KA 2XL9A 3DYPA 4BMEA 1RJ8A 1MEC2 1ZX5A 2W95A 1T6BX 3AK0A 1SMVA 3GALA 3RMYA 1R092 4PF1A 4EE2A 1RUG1 1S0GA 3KV4A 2AYHA 3KV6A 4W4ZA 1J3PA 2ZHMA 1H1MA 1KFUL 3V64A 1A3KA 2OT7A 3WNNA 4Q4Y1 2A6WA 1D4M1 3AKQA 2JD4A 2RS11 2JWPA 4YGBA 3TAYA 2YUEA 1OC1A 2RR11 5I0UA 5A7WB 3T08A 1ZZ8A 2RG4A 1FMD1 4ZXKA 4LKDA 4D6SA 5DAQA 3ZFGC 4ISRA 4FPGA 4TLFA 5A7OA 1ZRCA 1XE8A 4KU7A 1DHKB 1MVEA 1PZ7A 4H3WA 3U4XA 2D6NA 3EQEA 4HPKB 2AACA 2XKPA 3ZX7A 2BBVA 2UWBA 3JBG3 4K1ZA 5FPBA 2PMWB 2QDRA 4XUQA 3AP5A 3LFMA 1CQ9A 4I0WB 3RFRA 3IPVB 1AR73 5FUNA 2JIGA 4PCRA 3M1HA 3KGZA 4QB6A 1NA1C 2VUAA 4L97A 4TTGA 2YC2A 2ZGRA 2QZ3A 4QXHA 1OUSA 4L11A 2JG9A 2VBDA 1UMZA 4AGVA 5A7SA 1LESA 3VL8A 5T52A 4QX3A 3S5AA 3FL7A 1RUH3 3H1MA 1IOAA 4IEOA 3H3UA 2RS33 1EV13 2WZR1 3WNLA 2QDNA 4IE6A 3ZXGA 3VBRB 3WF2A 1J58A 1EY2A 1ND2B 1ZBE1 2OA2A 3AYDA 1E57A 3ON7A 4RR3B 3SISA 3UGHA 4MX3A 1QQP2 1W8WA 2WNUB 2WQZC 4GIQA 1LKNA 2O0OA 4NE9A 4RN5A 3N4MA 1C1FA 1PMIA 3MV11 2Q8EA 1LTEA 1PO13 3M3OA 1MZFA 3LD8A 4QQOA 4TYSA 3I8TA 3U4SA 1JYNA 1OFSA 3AFGA 1GMMA 4DIQA 1SFYA 4C1WA 4CEYC 4X8NA 1OVPA 2B9VA 5FZKA 5C3RA 3QCWA 3BGAA 5A1LA 3CIHA 1OQEA 4DINB 1QEXA 5CFCA 1YYNA 2VGDA 4IETA 1W9SA 2F6BA 5LK7B 1AX0A 3ZN4A 1CVNA 1G9DA 3ZSKA 2Z69A 4NHLA 1WBLA 3ST7A 4AR2A 3MEPA 1S0EA 2J1AA 2JDMA 3QH6A 3SHRA 4D3WA 2VZSA 3PHMA 4FVVA 5A7WA 1DZRA 4KGQA 4LIUA 4CU7A 3RJRA 4BK5A 1J59A 1M4WA 4NHMA 1V6OA 4LOTA 2R071 3L9JT 1AYN3 1RINA 5DUWA 1ENSA 4URTA 4Y5Z0 2VPVA 5GLUA 2D3RA 3LSEA 1DYPA 4HSJA 4M0NA 1JZ3A 3I3BA 4UBGA 4PDWA 4FAHA 4LBOA 4ZS2A 5BNOA 4TSVA 5GM0A 4HMZA 3WDWA 5L9BA 1BQPA 1C5IA 1KXGA 2WLQA 3OD0A 3PUAA 4Y4RA 4Z2WA 3MZHA 2HWE3 2QNKA 4FPHA 5SV5A 3S5QA 2HWD1 2P4EA 2ATFA 2GALA 3B7MA 1GICA 2CY6A 4LO6B 1N47A 1QJY3 1DGRA 4LA2A 5IJRA 5GZGA 1F8VA 1RUE3 4BIFA 4LNVA 1LGNA 1HN0A 4CCEA 4ZS3A 3JZVA 4BU2A 2Q8DA 1NCRB 3MW4A 3Q8EA 4B3NA 4QPGC 2AR6A 3T4VA 4META 2XONA 1W2OA 3BPZA 1C1LA 2C24A 2VZ3A 3QBQA 5L19A 2ZEZA 1XRUA 4H7MA 1BEV2 1RJ7A 3HNBM 3HAGA 5IATA 2BTVC 2BZDA 4CDUB 1AVBA 1SLAA 4RGKA 5JMCA 3VHOA 4Z1VA 4RQPB 3UV9A 2V72A 1NCQC 1BEV1 5F5CA 2FZ1A 2VCAA 5JAXA 3LA7A 2DBIA 2C0ZA 2C9KA 1HV0A 1K5MC 5IUQA 3WP4A 4BQYA 1LGCA 3RRDA 2HYKA 1OPMA 5ABJB 3KQRA 4S2HA 4NJ4A 4C8DA 3AMPA 4S2FA 1EP0A 1J84A 1OKOA 4L99A 4QPIB 3UJQA 3VZNA 5BNNA 1PMJX 2P37A 1SBDA 2VVFA 5KBFA 4GMP1 3GCXA 1ZZCA 2F4PA 1VBC3 1ZVFA 2UY8A 5IVVA 1AF9A 1ZZBA 5A33B 3G7DA 1B09A 2JDPA 1W8ZA 1LOAA 4FBFA 1GNHA 4GALA 4YGDA 1YC61 3J7NA 3OBRA 4YNIA 5FZEA 3OPTA 2D44A 3ETPA 2OPWA 3WOGA 3ZFFA 2Y6FA 5J09A 5JOXA 4ZHNA 4KWJA 2ZS6B 1JU4A 2DVDA 1SBFA 1PVC1 4LEJA 4P9JA 3RWNA 5T5LA 1WMXA 4OHXA 4B4RA 1FNZA 4NN0A 3SH3A 3ZIXA 3K4DA 4M4PA 1JODA 2J1SA 2FCUA 2P2KA 3AP6A 5FWEA 2BGOA 4IQPA 4NIDA 2PAMA 2PHRA 2GNMA 5FZFA 3WP3A 1O5LA 5CISA 2VJXA 4BXSV 3OF1A 3ES1A 2PHTA 1QF3A 2P34A 3Q8AA 5FZMA 2RJKA 2VMFA 5CAZA 5C3SA 3H8OA 1ASJ3 1HX6A 1KFXL 3OTFA 1MZ5A 3ZFEC 2IXCA 2HWB1 5FJKA 2BVBA 1H9PA 4XMAA 2ZHNA 5FXZA 3WDVA 4Q26A 1H6XA 2GN7A 3T3YA 3OGGA 3OB8A 2I45A 2JG8C 5CG9A 4UFJA 2SBAA 4M01A 4YFWA 1CWPA 3DKQA 3H1WA 2E7AA 2FQPA 2PQQA 1W6NB 5FUPA 4FPYA 3N9LA 3WF4A 2R043 5LCWL 3H8UA 4CUGA 1TEIA 4BIOA 2XBO1 3DGTA 5AVAA 1ZBE2 3DXUA 1UKGA 1YQCA 3I2KA 3BTZA 4Y24A 1SLLA 4IEXA 4CSWA 4FFIA 1X7NA 4V1PA 2A3YA 1F4AA 2TUNA 1TME1 3DV8A 4JGYB 3E6DA 1JUHA 4H14A 2NMNA 4HFSA 3BIEA 4E27A 4BMBA 1JYIA 5C3OA 1JN2P 1C3HA 4XILA 4W6WA 4DUWA 3M4FA 4AVSA 2YPDA 3FC0A 2WT0A 4GB32 5I8YA 1G9AA 3MF6A 4FO9A 4Z07A 2R0HA 3I3MA 3T0AA 5BNNB 2MNGA 2FMYA 1AR71 5A3OA 1LULA 2P6CA 2A1XA 3FN9A 4FOYA 4DO0A 2KA3A 3ELNA 3JBG2 4Q0UA 5JVVA 3T1LA 1BYHA 4SLIA 1O3TA 2PAEA 3PTRB 4I30A 1JYWA 1NZIA 2XR4A 3VBRC 4EN9B 5C7GA 3SQOA 2YXSA 4RS5A 3T2PA 2Q8CA 5DAXA 4R9AA 2P3JA 3D6EA 4PQ9A 1TQ5A 3DF0A 1JZ4A 1W8TA 4B7KA 4LQRA 1R082 3IDEA 3PVBB 4XPVA 3O1OA 1KDKA 4QQPA 5BY5A 3FZ3A 2GH2A 3MFCA 1FMD2 3E5QA 3HEIA 5IWFA 5EZWA 2PHFA 3LQCA 3ZYBA 2XJPA 4P9YA 2RS12 1OOPB 4N7IA 4M4RA 4RA0A 1A78A 1YNAA 2EIBA 1RUG3 2WIIB 3A21A 1PHMA 1S1AA 3N9QA 1TVGA 4XF4A 2Y34A 1V6JA 4NIAA 4IDZA 3GGLA 2QBXA 3FFQA 1AYM3 1W9YA 2Q0AA 5FZ8A 1MEC1 1XNTA 2AREA 4BA6A 5KXEA 5FYHA 1C57A 4CXWA 3I7DA 2VO5A 3MPBA 4RR3A 2CHHA 4FPJA 3O12A 4JX0A 5TSWA 3HR9A 4LLOA 2IZWA 1KS4A 4B29A 3WV6A 1DFQA 1AR91 3K51A 5F1RA 3LEKA 4NHXA 3ATGA 2GH8A 4BLIA 4K7JA 5J96B 5FY7A 1AXKA 4Z2AA 3NMBA 5T55A 1JYXA 4E8DA 2WWJA 3I97A 5A3LA 1ZREA 1OFNA 3OJBA 4BXFA 3WDTA 4XF9A 1W2TA 3KCXA 4XZPA 4UAPA 5T54A 2VMGA
chains in the Genus database with same CATH topology
2VZQA 1OH4A 1SG3A 3FHAA 3P1IA 1O8SA 4E8CA 5DMYA 4ARXA 2BGPA 4XUPA 3D3AA 4GWJA 4PQQA 2QQOA 3WQBA 5C70A 4XUNA 2WN2A 5EIYB 4QX2A 1PX4A 2WN3A 2RJ2A 2EICA 4QDRA 4A42A 5G05L 3I2HA 1US2A 3CKHA 3HOBA 3AC0A 2VZVA 2Y6KA 2V4VA 2VZPA 3NRUA 2JKXA 2VQUA 2WDBA 5HXMA 2X10A 2VZTA 3CDZB 4DXRA 2WAOA 4OMCA 3VDAA 2XQXA 3VD5A 2VCCA 2E26A 3I2JA 1W9WA 1L7QA 3VD7A 1UYZA 2E33A 2W5FA 4MOAA 3THDA 3OGRA 4LPLA 1CIYA 2DCKA 3EYPA 4UOJA 1TG7A 2ZEXA 4ZXEA 5J1XA 2Y6HA 1DP0A 2J1UA 2QQJA 4KI5M 3IIIA 3T09A 1D7PM 2B4KA 4A4AA 2VZRA 5B4XA 1OF4A 1UY3A 3VD3A 2ZXQA 3UETA 2VM9A 4XUTA 3WSOA 2BERA 3HNYM 3W5NA 4BK4A 1UX7A 4ET7A 1GOGA 5CYYA 2WYSA 2W92A 4AG4A 2ORXA 1JZ2A 2R7EB 4L0PA 1NX9A 1UYXA 2J1TA 3K77A 1SHWB 5DN2A 3K4ZA 4PT6A 3MO4A 3NQHA 3WEZA 5LA1A 2YC4A 5C71A 1JZ5A 4P00B 2Y6JA 3P6BA 1CZTA 3CMGA 2VZUA 3DYOA 1CZVA 4QX0A 1UXXX 2WAAA 3ACIA 3ACGA 1KGYA 1GUIA 2QQNA 3A22A 3K4AA 2CDOA 1UWWA 4LKSA 5IFPA 3HN3A 5LA2A 4DXSA 3UNPA 3NNGA 2W3JA 1UY4A 3ECQA 2Y8KA 3C7HA 2CDPA 3GXUA 2WO2A 2VL4A 2VMDA 3C7FA 1RYYA 2ID4A 1L7RA 4A44A 4W8JA 4CU8A 3C8XA 3JXSA 3OGVA 1W99A 1K3IA 1DYOA 2ORZA 4ARYA 4QPWA 2DCJA 4W50A 3MBWA 2W1UA 4DEQA 1MPXA 2DDUA 4XUOA 4HG6B 2QQLA 4A45A 1K42A 5IHRA 1O8PA 4XZUG 3CZJA 2LS6A 3OEAA 4CVUA 5JXJA 3CQOA 3LEIA 3LPGA 3WF0A 1EUTA 1W0NA 2OKXA 1LNSA 4MADA 2WABA 3WF3A 1XPWA 2HLEA 3E1F1 1UY0A 4DUXA 2W47A 5FUIA 1JZ7A 5CZKA 4XVHA 2VMCA 3DYPA 2W95A 3LEGA 4OUEA 4PF1A 4MGQA 4IUGA 2J1EA 4W4ZA 3BN6A 3I2GA 2W1WA 2WZEA 3ZM8A 4MGSA 4TXWA 5JXHA 1JYVA 3WNNA 3WNKA 2YFUA 3J7HA 3NJVA 3T08A 2PQSA 3NJXA 2JDAA 2RVAA 1UZ0A 3HPNA 4ZY9A 3ACFA 2X05A 1IQDC 1ULPA 4XUQA 4LHSA 1J83A 1YQ2A 3T2QA 2EIEA 5JMOA 3FHQA 3T0BA 4JKKA 4QB6A 1CX1A 4QDSA 4TTGA 1UY2A 2YC2A 3OBAA 3GDBA 5IYYA 2W94A 3VD4A 3OEBA 4ZZ5A 1WKYA 1UXZA 2VMEA 3IB3A 4QX3A 3FL7A 2J1VA 4KWUA 1F4HA 5LA0A 2HYXA 2WZ8A 2VTFA 3WNLA 1HN1A 3WF2A 1UMIA 3MV01 4CU6A 1US3A 3LE0A 3T0DA 3K75B 2LW8A 4FI9A 4RN5A 4MO3M 3MV11 1ULOA 2VCBA 5F7UA 1JYNA 2C26A 1GMMA 2J22A 2B9VA 5DPNA 3BGAA 3CIHA 4GWIA 2XOMA 1W9SA 3PUHA 2ZEYA 4CUCA 2J1AA 1W8NA 2VZSA 3C7EA 3I2IA 2J7MA 4D0QA 4BK5A 4CU7A 3I3EA 4BDVB 5JR2A 3PUIA 1P8JA 1OD3A 2Y64A 1JZ3A 2JE8A 3I3BA 1UY1A 1OF3A 5IFTA 4JKLA 2W9XA 1GNYA 3WNPA 5DQ0A 3I3DA 4QX1A 5IJRA 2VC9A 5B4NA 4QB1A 1K45A 4RYDA 1W8OA 3ABZA 2W46A 1R64A 2XONA 3C7GA 3CZUA 5I0DA 1GQPA 2QQMA 2VZ3A 1BHGA 3GM8A 2ZEZA 4CUBA 3HNBM 1GOHA 3F2ZA 4P5YA 1XC6A 1GU3A 2J1RA 2YB7A 4A3ZA 2BZDA 3WNOA 3HJRA 2V72A 2VCAA 4QDQA 2C9KA 1XNAA 3LPFA 5EJ1B 3VD9A 4D8MA 2VZ1A 2VQTA 1UMHA 1K12A 1UYYA 1J84A 2WQ8A 2YFZA 1PMJX 3C7OA 4OMDA 4GZ9A 4DUVA 2BBAA 5EJZB 2W1QA 3MUY1 2WO3A 3U37A 2RV9A 3SEPA 4CUAA 2QQIA 3ETPA 4BJ0A 2YG0A 1PMHX 4OZOA 1SDDB 1JU4A 2ZEWA 2VR4A 3K4DA 4M4PA 2J1SA 2BGOA 1T2XA 3VDCA 3K46A 2VJXA 4BXSV 4DXTA 5JXGA 5HPOA 2Y6LA 1GOFA 3THCA 2VMFA 1WCQA 1JU3A 3IAQA 4P08A 2Z4FA 1H6XA 3OB8A 1JZ8A 3EB7A 4ZZ8A 1DLCA 1JZ6A 4KMQA 3WF4A 5LCWL 2KD7A 3ACHA 4P02B 3I2KA 3DYMA 3HNMA 4QB2A 1F4AA 2XHNA 5G04L 2W87A 3MUZ1 4A6OA 4DUWA 2JD9A 1KEXA 1PX3A 2C4XA 3SEEA 3T0AA 3IAPA 2E32A 3FN9A 2EIDA 1JYWA 2W91A 5JUVA 5A1AA 2VOTA 5C7GA 2Y6GA 1NUKA 3T2PA 1OT5A 2W1SA 1JZ4A 3W5MA 4LQRA 4CU9A 5JXIA 3WNMA 2E31A 4OYUA 2V5DA 3HEIA 3LQCA 3IDAA 4JHZA 3A23A 4M4RA 4XURA 4UI9L 4DEVA 1CZSA 1H6YA 2EIBA 4YPJA 3A21A 1TVGA 1O59A 2WBKA 3SKJE 3GGLA 2QBXA 3SKVA 1NKGA 1XNTA 4AAXA 3UESA 1JI6A 1JHJA 1NAEA 2VO5A 1I5PA 3OGSA 3DECA 3WF1A 4QAWA 4JX0A 2WO1A 2VZOA 4JKMA 3I2FA 2WUHA 2QQKA 3VDBA 1EUUA 1W9TA 3LEKA 1JYXA 4Z2AA 2X09A 4E8DA 3I97A 4A41A 3A7QA 2L9LA 3T2OA 4UAPA 3OG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZQ A;  1OH4 A;  1SG3 A;  3FHA A;  3P1I A;  1O8S A;  4E8C A;  5DMY A;  4ARX A;  2BGP A;  4XUP A;  3D3A A;  4GWJ A;  4PQQ A;  2QQO A;  3WQB A;  5C70 A;  4XUN A;  2WN2 A;  5EIY B;  4QX2 A;  1PX4 A;  2WN3 A;  2RJ2 A;  2EIC A;  4QDR A;  4A42 A;  5G05 L;  3I2H A;  1US2 A;  3CKH A;  3HOB A;  3AC0 A;  2VZV A;  2Y6K A;  2V4V A;  2VZP A;  3NRU A;  2JKX A;  2VQU A;  2WDB A;  5HXM A;  2X10 A;  2VZT A;  3CDZ B;  4DXR A;  2WAO A;  4OMC A;  3VDA A;  2XQX A;  3VD5 A;  2VCC A;  2E26 A;  3I2J A;  1W9W A;  1L7Q A;  3VD7 A;  1UYZ A;  2E33 A;  2W5F A;  4MOA A;  3THD A;  3OGR A;  4LPL A;  1CIY A;  2DCK A;  3EYP A;  4UOJ A;  1TG7 A;  2ZEX A;  4ZXE A;  5J1X A;  2Y6H A;  1DP0 A;  2J1U A;  2QQJ A;  4KI5 M;  3III A;  3T09 A;  1D7P M;  2B4K A;  4A4A A;  2VZR A;  5B4X A;  1OF4 A;  1UY3 A;  3VD3 A;  2ZXQ A;  3UET A;  2VM9 A;  4XUT A;  3WSO A;  2BER A;  3HNY M;  3W5N A;  4BK4 A;  1UX7 A;  4ET7 A;  1GOG A;  5CYY A;  2WYS A;  2W92 A;  4AG4 A;  2ORX A;  1JZ2 A;  2R7E B;  4L0P A;  1NX9 A;  1UYX A;  2J1T A;  3K77 A;  1SHW B;  5DN2 A;  3K4Z A;  4PT6 A;  3MO4 A;  3NQH A;  3WEZ A;  5LA1 A;  2YC4 A;  5C71 A;  1JZ5 A;  4P00 B;  2Y6J A;  3P6B A;  1CZT A;  3CMG A;  2VZU A;  3DYO A;  1CZV A;  4QX0 A;  1UXX X;  2WAA A;  3ACI A;  3ACG A;  1KGY A;  1GUI A;  2QQN A;  3A22 A;  3K4A A;  2CDO A;  1UWW A;  4LKS A;  5IFP A;  3HN3 A;  5LA2 A;  4DXS A;  3UNP A;  3NNG A;  2W3J A;  1UY4 A;  3ECQ A;  2Y8K A;  3C7H A;  2CDP A;  3GXU A;  2WO2 A;  2VL4 A;  2VMD A;  3C7F A;  1RYY A;  2ID4 A;  1L7R A;  4A44 A;  4W8J A;  4CU8 A;  3C8X A;  3JXS A;  3OGV A;  1W99 A;  1K3I A;  1DYO A;  2ORZ A;  4ARY A;  4QPW A;  2DCJ A;  4W50 A;  3MBW A;  2W1U A;  4DEQ A;  1MPX A;  2DDU A;  4XUO A;  4HG6 B;  2QQL A;  4A45 A;  1K42 A;  5IHR A;  1O8P A;  4XZU G;  3CZJ A;  2LS6 A;  3OEA A;  4CVU A;  5JXJ A;  3CQO A;  3LEI A;  3LPG A;  3WF0 A;  1EUT A;  1W0N A;  2OKX A;  1LNS A;  4MAD A;  2WAB A;  3WF3 A;  1XPW A;  2HLE A;  3E1F 1;  1UY0 A;  4DUX A;  2W47 A;  5FUI A;  1JZ7 A;  5CZK A;  4XVH A;  2VMC A;  3DYP A;  2W95 A;  3LEG A;  4OUE A;  4PF1 A;  4MGQ A;  4IUG A;  2J1E A;  4W4Z A;  3BN6 A;  3I2G A;  2W1W A;  2WZE A;  3ZM8 A;  4MGS A;  4TXW A;  5JXH A;  1JYV A;  3WNN A;  3WNK A;  2YFU A;  3J7H A;  3NJV A;  3T08 A;  2PQS A;  3NJX A;  2JDA A;  2RVA A;  1UZ0 A;  3HPN A;  4ZY9 A;  3ACF A;  2X05 A;  1IQD C;  1ULP A;  4XUQ A;  4LHS A;  1J83 A;  1YQ2 A;  3T2Q A;  2EIE A;  5JMO A;  3FHQ A;  3T0B A;  4JKK A;  4QB6 A;  1CX1 A;  4QDS A;  4TTG A;  1UY2 A;  2YC2 A;  3OBA A;  3GDB A;  5IYY A;  2W94 A;  3VD4 A;  3OEB A;  4ZZ5 A;  1WKY A;  1UXZ A;  2VME A;  3IB3 A;  4QX3 A;  3FL7 A;  2J1V A;  4KWU A;  1F4H A;  5LA0 A;  2HYX A;  2WZ8 A;  2VTF A;  3WNL A;  1HN1 A;  3WF2 A;  1UMI A;  3MV0 1;  4CU6 A;  1US3 A;  3LE0 A;  3T0D A;  3K75 B;  2LW8 A;  4FI9 A;  4RN5 A;  4MO3 M;  3MV1 1;  1ULO A;  2VCB A;  5F7U A;  1JYN A;  2C26 A;  1GMM A;  2J22 A;  2B9V A;  5DPN A;  3BGA A;  3CIH A;  4GWI A;  2XOM A;  1W9S A;  3PUH A;  2ZEY A;  4CUC A;  2J1A A;  1W8N A;  2VZS A;  3C7E A;  3I2I A;  2J7M A;  4D0Q A;  4BK5 A;  4CU7 A;  3I3E A;  4BDV B;  5JR2 A;  3PUI A;  1P8J A;  1OD3 A;  2Y64 A;  1JZ3 A;  2JE8 A;  3I3B A;  1UY1 A;  1OF3 A;  5IFT A;  4JKL A;  2W9X A;  1GNY A;  3WNP A;  5DQ0 A;  3I3D A;  4QX1 A;  5IJR A;  2VC9 A;  5B4N A;  4QB1 A;  1K45 A;  4RYD A;  1W8O A;  3ABZ A;  2W46 A;  1R64 A;  2XON A;  3C7G A;  3CZU A;  5I0D A;  1GQP A;  2QQM A;  2VZ3 A;  1BHG A;  3GM8 A;  2ZEZ A;  4CUB A;  3HNB M;  1GOH A;  3F2Z A;  4P5Y A;  1XC6 A;  1GU3 A;  2J1R A;  2YB7 A;  4A3Z A;  2BZD A;  3WNO A;  3HJR A;  2V72 A;  2VCA A;  4QDQ A;  2C9K A;  1XNA A;  3LPF A;  5EJ1 B;  3VD9 A;  4D8M A;  2VZ1 A;  2VQT A;  1UMH A;  1K12 A;  1UYY A;  1J84 A;  2WQ8 A;  2YFZ A;  1PMJ X;  3C7O A;  4OMD A;  4GZ9 A;  4DUV A;  2BBA A;  5EJZ B;  2W1Q A;  3MUY 1;  2WO3 A;  3U37 A;  2RV9 A;  3SEP A;  4CUA A;  2QQI A;  3ETP A;  4BJ0 A;  2YG0 A;  1PMH X;  4OZO A;  1SDD B;  1JU4 A;  2ZEW A;  2VR4 A;  3K4D A;  4M4P A;  2J1S A;  2BGO A;  1T2X A;  3VDC A;  3K46 A;  2VJX A;  4BXS V;  4DXT A;  5JXG A;  5HPO A;  2Y6L A;  1GOF A;  3THC A;  2VMF A;  1WCQ A;  1JU3 A;  3IAQ A;  4P08 A;  2Z4F A;  1H6X A;  3OB8 A;  1JZ8 A;  3EB7 A;  4ZZ8 A;  1DLC A;  1JZ6 A;  4KMQ A;  3WF4 A;  5LCW L;  2KD7 A;  3ACH A;  4P02 B;  3I2K A;  3DYM A;  3HNM A;  4QB2 A;  1F4A A;  2XHN A;  5G04 L;  2W87 A;  3MUZ 1;  4A6O A;  4DUW A;  2JD9 A;  1KEX A;  1PX3 A;  2C4X A;  3SEE A;  3T0A A;  3IAP A;  2E32 A;  3FN9 A;  2EID A;  1JYW A;  2W91 A;  5JUV A;  5A1A A;  2VOT A;  5C7G A;  2Y6G A;  1NUK A;  3T2P A;  1OT5 A;  2W1S A;  1JZ4 A;  3W5M A;  4LQR A;  4CU9 A;  5JXI A;  3WNM A;  2E31 A;  4OYU A;  2V5D A;  3HEI A;  3LQC A;  3IDA A;  4JHZ A;  3A23 A;  4M4R A;  4XUR A;  4UI9 L;  4DEV A;  1CZS A;  1H6Y A;  2EIB A;  4YPJ A;  3A21 A;  1TVG A;  1O59 A;  2WBK A;  3SKJ E;  3GGL A;  2QBX A;  3SKV A;  1NKG A;  1XNT A;  4AAX A;  3UES A;  1JI6 A;  1JHJ A;  1NAE A;  2VO5 A;  1I5P A;  3OGS A;  3DEC A;  3WF1 A;  4QAW A;  4JX0 A;  2WO1 A;  2VZO A;  4JKM A;  3I2F A;  2WUH A;  2QQK A;  3VDB A;  1EUU A;  1W9T A;  3LEK A;  1JYX A;  4Z2A A;  2X09 A;  4E8D A;  3I97 A;  4A41 A;  3A7Q A;  2L9L A;  3T2O A;  4UAP A;  3OG2 A; 
#chains in the Genus database with same CATH topology
 1YO8 A;  1ALY A;  2B9U A;  1YFW A;  1Z7S 1;  2ILM A;  3AXE A;  4E8C A;  4G3Y C;  4XIO A;  1QNY A;  3FX3 A;  5C70 A;  3KCC A;  4XUN A;  4QD2 A;  3WNM A;  4RGG A;  5ACA 2;  5HCH A;  4OUM A;  4AFB A;  1EAH 2;  2RS5 3;  5EIY B;  4QX2 A;  5FBJ A;  4PF5 A;  3ZMO A;  2WN3 A;  2FCV A;  2RJ2 A;  2XXZ A;  2Z5W A;  4YGC A;  3ZFG B;  4CDU C;  2HWF 2;  4JC1 A;  1UO9 A;  3I49 A;  2PLV 1;  1FX5 A;  4RD7 A;  3AC0 A;  5FMO S;  3MID A;  1FOD 3;  1OLM A;  3V65 A;  5FQ0 A;  4Q0S A;  5L7O A;  2BOJ A;  1YRZ A;  2XLG A;  2JKX A;  3WY6 A;  1MS9 A;  1OA4 A;  1CR7 A;  5F6K A;  1NY7 2;  5A32 B;  1GWK A;  3MW2 A;  5EYY A;  2QZ2 A;  4A7K A;  5LY1 A;  4XET A;  1W8H A;  4DZG A;  3H9A A;  1WMD A;  5HXM A;  4TZD A;  4CDW B;  1H8T A;  3LDR A;  1F9K A;  2GU9 A;  1HQL A;  1CJD A;  3MGU A;  3AKR A;  3AXD A;  2CV6 A;  2E26 A;  4LLF A;  3GNE A;  1DZT A;  3OGR A;  4YVW A;  4YW1 A;  1ENR A;  3OD4 A;  3FBY A;  4EN0 A;  2DCK A;  5DDJ 2;  1AR6 2;  2ZEX A;  3WNX A;  5J1X A;  3SLI A;  1SFP A;  4QPY A;  2Y6H A;  5LEK A;  4FOV A;  4HKL A;  3VKO A;  4O9G A;  4AVC A;  3T09 A;  1B35 C;  1LOE A;  4V2V A;  2XGX A;  3JCI A;  1RUI 3;  1RUD 3;  2VZR A;  4Y22 B;  4NMI A;  4IE5 A;  3VD3 A;  3UET A;  4Y3O A;  4BQX A;  4BWO A;  3OBZ A;  4BCU A;  2BER A;  3MIC A;  3V0A B;  1AXY A;  1W04 A;  2D98 A;  3IDB B;  1YEW A;  3RZH A;  1HXS 3;  3B9I A;  5J3U A;  4BK4 A;  5EYX A;  3AMQ A;  1FOD 1;  5KWR A;  4AOC A;  4OUL A;  4J25 A;  1WCK A;  5CYY A;  1N3Q A;  5I0T A;  2ZJC A;  1VBE 3;  3PMS A;  2QQW A;  1Q3E A;  2VUL A;  4WVM A;  5A6Q A;  2MEV 1;  5FZ0 A;  3ZXA C;  2RHP A;  3I3Q A;  2R7E B;  2DTW A;  1V9U 3;  1WBF A;  2J1T A;  5DN2 A;  4PT6 A;  3BB6 A;  3PJY A;  1RL3 A;  4NII A;  5C71 A;  1JZ5 A;  4RS5 B;  2E63 A;  3KT1 A;  4P00 B;  2HEW F;  2BYV E;  4YVW C;  1ND2 C;  4AVT A;  5FZ3 A;  1NE6 A;  4YYO A;  2EAL A;  4LKF A;  2F4L A;  5FQ0 B;  2JKB A;  1HRV 1;  1V70 A;  3J8F 1;  4R52 A;  4RHV 2;  1LHO A;  4LBQ D;  2JB4 A;  3VDD B;  4FSJ A;  3UK9 A;  4AED A;  4OI4 A;  2GC2 A;  4OHV A;  3KB5 A;  4PIY A;  4XAA A;  2ZGN A;  1ULG A;  1LOF C;  2R06 1;  2VCM A;  4M3C E;  1KGY A;  1BK0 A;  3E97 A;  5KHK A;  3FBM A;  2QQN A;  2C5D A;  3FFZ A;  2DUP A;  4ERO A;  3TN9 1;  3HN3 A;  5IFP A;  1OSG A;  3IKW A;  1RUH 2;  1S0F A;  3T30 A;  4OUS A;  1VB2 A;  2H6C A;  2ZCW A;  1QGL A;  4R4Z A;  2YPJ A;  1GP4 A;  1VBD 2;  4MH0 E;  5L73 A;  3UNP A;  2W3J A;  2ZAC A;  4NWW A;  2FCT A;  4LK6 A;  4YVW B;  5L9V A;  1VB4 A;  5HXV A;  3L2Y A;  4AEM A;  2CDP A;  2X5I A;  3ZYR A;  3B93 A;  2Q1M A;  1RUI 1;  3AKS A;  2EAK A;  3BOW A;  2XML A;  3VZL A;  3ZSJ A;  5JIU A;  1JTZ X;  1L7R A;  1W6N A;  1ZRR A;  2IVJ A;  3GZE A;  1QU0 A;  3LEM A;  2C9A A;  2ZGK A;  3VBO C;  4CU8 A;  1EAH 3;  2RS5 2;  4LIT A;  5FRA A;  5K0U A;  2JG8 A;  4ARY A;  4NHY A;  4I2O A;  1B35 A;  1ZBA 1;  5JOY A;  4HLT A;  3TNP B;  3USU B;  2WSU A;  5FY0 A;  1WCU A;  1LEN A;  2QQL A;  3B5L B;  1S0B A;  5LZ6 A;  4R8H A;  1DG6 A;  4GB3 3;  2XJQ A;  4YVS B;  3RDI A;  5AC9 3;  5CFD A;  1O8P A;  1SPP A;  1VRH 1;  4HT1 T;  5I8S A;  4Q27 A;  3OEA A;  3R0R A;  4WVM B;  3LEI A;  4IV1 A;  3PVN A;  3R6S A;  5BNP A;  5DG2 A;  2BNO A;  2FBE A;  5FAX A;  2WAB A;  5L7O B;  1XPW A;  4OI1 A;  2HLE A;  1DGW A;  1BBT 1;  2O14 A;  2DUR A;  2IFW A;  2XLF A;  1FOD 2;  3M2M A;  4C1X A;  1W0O A;  1QOT A;  1FAY A;  1NQD A;  4SBV A;  2BV4 A;  1ND3 A;  2OYZ A;  4IL7 A;  3NNF A;  4NHK A;  3K3O A;  4UWD A;  5FUI A;  5GZF A;  2R49 A;  1JZ7 A;  4Y20 B;  4K40 A;  2JG9 B;  5GZE A;  1QY4 A;  2XBO 3;  3RYP A;  4AED B;  3VKM A;  4CDW C;  4K21 A;  1W2A X;  4COZ A;  2C6S A;  3VB9 A;  4MXW B;  4OUE A;  1OOP A;  1DQ1 A;  1SDW A;  5FP8 A;  3S57 A;  5H9S A;  3I54 A;  4IUG A;  2GN3 A;  3BUC A;  2W1W A;  1C8N A;  4MGS A;  3NV1 A;  4AFM A;  5A7N A;  5FZC A;  3GJB A;  4D69 A;  3J7H A;  2JIC A;  3N35 A;  4YSF A;  2A3X A;  1D4V B;  5T50 A;  1RMU 3;  3BTY A;  2VU9 A;  1OA3 A;  2RVA A;  2YV8 A;  5EHD A;  1UZ0 A;  2XG3 A;  4PHZ A;  3VHN A;  1XYP A;  5D8A C;  1S55 A;  2BW8 A;  4AQS A;  4FQZ A;  1H2N A;  5FZO A;  2ZAA A;  4CDX A;  4CCD A;  4RL7 A;  1ULP A;  4H55 A;  1A6C A;  5I91 A;  5FPZ A;  1XB9 A;  3TBD A;  1VBD 3;  4IER A;  1J83 A;  1Q8P A;  4QXB A;  1LOD A;  4XCB A;  5CKN A;  4AVB A;  1HJG A;  1UF2 C;  4QDS A;  4FOQ A;  3LFI A;  3E6B A;  1UPS A;  3LZZ A;  3VHP A;  3ZR5 A;  3SXW A;  3TEY A;  3RGB A;  1JXN A;  2A6V A;  4XDO A;  5E89 A;  1WKY A;  5FK7 A;  4ZZ5 A;  2GZW A;  1WA4 A;  4G9S B;  5K7P A;  4NIH A;  2B42 B;  2XJV A;  4COY A;  4KH9 A;  4FFG A;  5FZI A;  1QOS A;  2DTY A;  2R1D A;  1F4H A;  5ACA 1;  2HYX A;  3RYK A;  1YHF A;  2QTW B;  2VTF A;  2AEN A;  5E16 A;  2P3K A;  4XTP A;  3ZKU A;  1HN1 A;  1UMI A;  2EAA A;  3MV0 1;  1XND A;  4Q0Q A;  3WQ0 A;  4CU6 A;  2ARX A;  1UZZ A;  1US3 A;  2XVK A;  3LE0 A;  2FDI A;  3AX4 A;  2JIJ A;  2JG9 C;  3K75 B;  1ULC A;  1PO2 1;  1DLL A;  1N3P A;  1OLM E;  1VLN A;  4MO3 M;  5F8P A;  5E6H A;  4CA9 A;  4P14 A;  2VCB A;  1SLI A;  2RDQ A;  3ILN A;  1S0D A;  4R4X A;  5CKM A;  2JB8 A;  1REF A;  2JJ6 A;  2WNV A;  5FXX A;  1LR5 A;  3N7K A;  1NCR A;  1EV1 2;  2K2S A;  1QDO A;  3BOP A;  4NRQ A;  2RS5 1;  4XF3 A;  5FPA A;  1DZQ A;  2HEV F;  4CEY A;  1NT0 A;  1F35 A;  1TMF 1;  2FDJ A;  2QE3 A;  2ZEY A;  3VBS A;  3WCS A;  1OQ1 A;  3WG1 A;  5JSR A;  1KDM A;  3RZG A;  1AL0 G;  2XDV A;  3KD4 A;  3AYC A;  1LOC A;  1SZB A;  2R04 1;  1RUI 2;  2LTN A;  5DUV A;  3OUH A;  4NR1 A;  2WFF 3;  4Y1Z A;  2WWS A;  3JBG 1;  1WW4 A;  1RGS A;  2LUW A;  1OHF A;  3NAP C;  3VBH B;  4Y22 A;  4RQP A;  3ZDV A;  2RM2 2;  1ZBA 2;  3JD7 1;  3JQW A;  5J7M A;  1P8J A;  1ZZ9 A;  4YW6 A;  4CXY A;  3RZM A;  3N9P A;  4X6Q B;  1AXZ A;  1AR9 3;  2WO7 A;  4YLZ A;  5GLZ A;  3TN9 2;  2B39 A;  1YI7 A;  1V6M A;  1VAM A;  4TLG A;  4JGY C;  2WNU A;  5IFT A;  1Y9Q A;  4LMF A;  2A75 A;  1TME 2;  1OLR A;  2XUE A;  4JKL A;  4R9B A;  1GNY A;  3RZJ A;  1SPP B;  1O4T A;  2RMU 2;  4EV0 A;  3I3D A;  3M3E A;  3VBU A;  1FPN 1;  4W6X A;  3J8F 2;  1D2S A;  4UXA A;  4GAZ A;  5FK8 A;  2YRO A;  4IV1 B;  5B4N A;  3KLS A;  1K45 A;  2DFC A;  1W8O A;  4GB3 1;  1F2N A;  2W46 A;  1HB2 A;  1E5S A;  2PA7 A;  3C7G A;  2CWS A;  3KWV A;  4UFK A;  3AZW A;  3L2H A;  4LE4 A;  4Y1V A;  1MVQ A;  3H3Z A;  3K2O A;  2ZAB A;  1L3J A;  1OUX A;  1S0C A;  2E7Q A;  5JZG A;  1VAL A;  1U5Y A;  5E1R A;  1VIW B;  1XC6 A;  2VOX A;  3WVJ A;  2OXB A;  3T2T A;  2YB7 A;  5I0S A;  1LGB A;  1HRV 2;  4RHV 1;  3P3N A;  5CB7 A;  3WNO A;  1PO1 1;  1WW5 A;  4IGP A;  4GKY A;  3VDD C;  4AVV A;  1RUC 1;  4C91 A;  1Y9G A;  1NA1 B;  4LIV A;  1F5F A;  1SLB A;  1TNR A;  2OQ7 A;  4FP3 A;  3DL3 A;  1UPI A;  3FHI B;  1W8U A;  4MHU A;  5BNO B;  1GWL A;  5EJ1 B;  2BNN A;  4CYD A;  5F3C A;  3RJ2 X;  3VD9 A;  2VZ1 A;  1EYB A;  1FPN 3;  2YU2 A;  1ZRI A;  4LO8 A;  5D2A A;  4A7Y A;  2B7Y A;  2WQ8 A;  1CES A;  2XWB B;  1TZO A;  1CPM A;  4GZ9 A;  1PGS A;  4NRO A;  2JDZ A;  1LED A;  1XQN A;  5DAW A;  5JSO A;  2ARC A;  1FT9 A;  2W1Q A;  3MUY 1;  5C5T A;  3O0W A;  4B1M A;  5FY4 A;  4JQR A;  4AYU A;  1V00 A;  1HRI 2;  2H6B A;  3SCH A;  1ULE A;  3AMN A;  4FTS A;  4IXL A;  4BJ0 A;  2YG0 A;  1PMH X;  2V4A A;  4OZO A;  4JGY A;  1Z7S 3;  1NCQ A;  4OHZ A;  1UZY A;  2IXK A;  4IEU A;  1K5M B;  2ZGM A;  1ZA4 A;  4YZ3 A;  5C3Q A;  4ASL A;  4AED C;  1T2X A;  2I2S A;  2IXL A;  3VDC A;  4JRL A;  4YVS A;  4QGL A;  5JXG A;  1UIK A;  5HPO A;  2Y6L A;  3VBU B;  2D7F A;  5D8A B;  4LBK A;  1U5Z A;  1WCQ A;  4K8F A;  3LDK A;  3TEX A;  3IMN A;  1F15 A;  2JDU A;  4IGQ A;  2HWF 1;  3ZFE A;  2Z4F A;  3ZXK A;  5GKA C;  1PO2 3;  3HT1 A;  1JZ8 A;  3WUC A;  3BIW E;  1ST8 A;  5F37 A;  1RTV A;  3EXU A;  4COW A;  1DF0 A;  2BDR A;  2WFP A;  5JZG B;  1O3R A;  4DRR A;  4Y20 A;  5BXX A;  1SFN A;  4QM9 A;  1NXM A;  5LAT A;  2WZP P;  4PIZ A;  3DYM A;  4PBO A;  1VR3 A;  3HNM A;  3MYX A;  3LF7 A;  4JGZ B;  3LIG A;  4MXW A;  1X9T A;  1EPZ A;  2XWJ B;  3A0K A;  1NLR A;  3DPR C;  4BQW A;  5A6Z A;  2DCZ A;  2IWG B;  2XHN A;  1HW5 A;  5G04 L;  1K5J A;  3VGI A;  3RZK A;  1EAH 1;  3DEM A;  3EMR A;  3MUZ 1;  2CGP A;  1OKQ A;  2FDG A;  2EF6 A;  2W68 A;  4HK9 A;  5GJ6 A;  1GWM A;  4KG0 A;  1KEX A;  3VBF A;  1J1T A;  3KSC A;  2W39 A;  4Y33 A;  5FPV A;  3NST A;  1UAI A;  1Y4W A;  4GJZ A;  5FJH A;  3SEE A;  5FOB B;  3TEZ A;  1LAJ A;  2CL2 A;  1F31 A;  1MS5 A;  5DZG A;  1H2K A;  1DIW A;  2R07 2;  2EXI A;  5C33 A;  3AVS A;  1COV 2;  2A6X A;  1GZW A;  4XE9 A;  4MLO A;  2VD7 A;  2YHJ A;  4A6S A;  2HWD 2;  3SCG A;  3ZYH A;  1O91 A;  1G6N A;  2WKK A;  2VOT A;  3LSD A;  5DUU A;  5A1A A;  1AYM 2;  3OBT A;  5C8W A;  1NG0 A;  1BEV 3;  1NYW A;  2A7A A;  1NXD 1;  4Q4X 2;  1OT5 A;  4XJ8 A;  4N9I A;  1ONA A;  4CCK A;  2IVI B;  3JU9 A;  5B2G B;  1X33 A;  2ARA A;  5FIX A;  4O9E A;  4ZU7 A;  3Q8F A;  3K3N A;  3ZXE A;  1NQJ A;  2Q4S A;  4EWE A;  4OYU A;  4HXC A;  1V6K A;  2GSY A;  1MR5 A;  3GHM A;  1RHI 2;  4I01 A;  1VBE 2;  4JHZ A;  3JUU A;  3B02 A;  3J8F 3;  4XUR A;  4UI9 L;  4DEV A;  1CZS A;  2E51 A;  1IKQ A;  3NW4 A;  4FPC A;  4B4Q A;  4CDQ A;  1UOJ A;  3O1M A;  2FDK A;  2TBV A;  2ZOE B;  3MIH A;  2ZX1 A;  1CAX A;  3J7M A;  1UKR A;  2WWU A;  4XW3 A;  2CU5 A;  1NKG A;  4FP2 A;  4I0B A;  4AAX A;  1JI6 A;  1AR7 2;  4HL0 A;  3OGS A;  3DEC A;  3FWE A;  3WF1 A;  5BUV A;  5EP9 A;  1WD4 A;  2B8M A;  1VBC 2;  5LB6 A;  2WZR 2;  4HVR A;  4JKM A;  5APA A;  2XVL A;  5LK5 A;  3PU8 A;  3C2U A;  1ENX A;  4LR4 A;  1EUU A;  5FP4 A;  5FFO C;  1OA2 A;  1C4R A;  2Q1F A;  4CDW A;  2NZ9 A;  2X09 A;  3DKW A;  1YUD A;  3NNM A;  2WNV B;  4WBB A;  4A41 A;  5L9R A;  1ZM1 A;  2L9L A;  2CWM A;  3ZYI B;  1PGL 1;  3T2O A;  2VZQ A;  2DVF A;  2HWC 3;  3MIF A;  4NRP A;  3FHA A;  3ITQ A;  4V2W A;  1S0I A;  4N90 A;  2HWC 1;  2WNO A;  5C8C C;  3VHR A;  1I6X A;  2BGP A;  3D3A A;  1Y9M A;  3AZX A;  3WQB A;  5FZL A;  5FOJ B;  4ITC A;  4MUV A;  5FZ1 A;  4FXK B;  4QGM A;  2JDH A;  4XJZ A;  1XOY A;  4GH4 A;  4O61 A;  3LOB A;  1DGL A;  3IN9 A;  1UIJ A;  4Y4Y A;  1W28 A;  3D4K A;  1W6M A;  4QDR A;  4A42 A;  1ODM A;  5AFB A;  3O1R A;  5DG1 A;  4B1L A;  1US2 A;  1VBB 3;  3HOB A;  4QQL A;  4L9B A;  4WVW A;  4AFC A;  2Y6K A;  1PZ8 A;  5CEH A;  5FMD A;  1UW8 A;  1AUY A;  1VBB 2;  2V4V A;  3NRU A;  4GKX A;  3WCR A;  1XSQ A;  1D4M 2;  2PN5 A;  2ZX4 A;  4MGT A;  1BKZ A;  2VQU A;  3M3Q A;  1QXP A;  1ZA7 A;  2D5H A;  3WIN E;  2BGC A;  1H9W A;  4O65 A;  4UFI A;  1HB3 A;  3PUQ A;  1LEM A;  2BQP A;  1MS8 A;  4XEZ A;  1LOF A;  3RYR A;  1IS5 A;  2X10 A;  4I3P A;  5C4W B;  3NO8 A;  5F5I A;  4A7Z A;  1JYT A;  2PHD A;  2WAO A;  1PVC 2;  4R9D A;  4DXR A;  4P9I A;  2XQX A;  3VD5 A;  1IS6 A;  3OCP A;  5A3U A;  2OUH A;  2VOV A;  3I2J A;  1SBE A;  2H0B A;  3CU7 A;  3WDX A;  2DFB A;  2XHK A;  1UYZ A;  2A73 B;  2W5F A;  3BVC A;  3I59 A;  4FPF A;  2VQ0 A;  4MOA A;  1D0G A;  3ZFE B;  5BYN A;  2YBP A;  4LPL A;  4E4Z A;  2VNR A;  1LCL A;  2RDN A;  3B01 A;  4FCA A;  1TME 3;  1FI2 A;  4LO4 B;  4ZXE A;  2HH9 A;  4AEK A;  2J1U A;  1YJL A;  2FDH A;  1OXC A;  4YG6 A;  4D6R A;  3I4I A;  1AR8 1;  4QKF A;  1WCD J;  2QKD A;  4JZR A;  1LHV A;  1R1A 1;  5B4X A;  1OF4 A;  3ZO0 B;  1UY3 A;  4N43 B;  2HBT A;  4JGZ A;  5IVC A;  2VM9 A;  2ZX2 A;  4XUT A;  1RUE 1;  4XOG A;  1DQ6 A;  3CJI B;  4LOS A;  3HNY M;  5FYV A;  5JZG C;  3S0M A;  3B9C A;  4QHO A;  3VLB B;  2JX9 A;  5F32 A;  4EN8 B;  2MEV 3;  4IE7 A;  4F7Z A;  2B5H A;  5A32 A;  3H42 B;  5K8S A;  1UX7 A;  2PHW A;  1GOG A;  3VBF B;  5A3M A;  2D40 A;  3A4U A;  5F39 A;  3WD5 A;  2ET7 A;  1WGP A;  4N53 B;  4XF0 A;  5EFU A;  4HN1 A;  4XTM A;  3ILF A;  2BOI A;  5A80 A;  2Z2S B;  1G9F A;  5JR7 B;  2GMM A;  1SHW B;  3K4Z A;  4LXL A;  3MO4 A;  3POB A;  4Z8B A;  4Y1Y A;  3GZA A;  4HKW A;  1YJK A;  2Y6J A;  1C5H A;  2D93 A;  2Y0O A;  5E8A A;  1CZT A;  1MZE A;  4B7E A;  5IVE A;  1ND2 A;  3DYO A;  3OY8 A;  1IG3 A;  4AGR A;  2LRO A;  1NCQ B;  4LKE A;  1W90 A;  3ACI A;  2UY9 A;  3ACG A;  1GUI A;  1DQ4 A;  1C8M 2;  4KWL A;  1IG0 A;  5LA2 A;  4CEW C;  2ZGU A;  3USS A;  5FYZ A;  5LWB A;  1OQD A;  2DVA A;  2D6L X;  1CAV B;  1J3R A;  1XE7 A;  1GZT A;  3IT8 A;  4B8E A;  1O5U A;  4ES9 A;  3IM0 A;  3I59 B;  5FDB A;  2ES3 A;  1V6L A;  3GZU C;  4EWD A;  3PIJ A;  3R05 A;  5J48 A;  1UU5 A;  4M0H A;  5T5J A;  4IV1 C;  1PK6 A;  1W9F A;  4GH4 C;  1ZRD A;  1XXN A;  5K0U C;  1HRI 1;  3GXU A;  5BNN C;  3QAC A;  1ND3 B;  3BOD A;  4I0A A;  3UGG A;  1FXZ A;  2BJS A;  3EBR A;  4FPO B;  4NAO A;  5A7Q A;  1NOV A;  4HPK A;  3KV5 A;  4UW5 A;  5LY2 A;  1MS0 A;  2VUD A;  1UCX A;  1DYO A;  3UKN A;  2PHU A;  2E7T A;  2GP5 A;  4P9X A;  3JB4 C;  2BVV A;  1CAU B;  3MBW A;  4AI0 A;  4DEQ A;  1ASJ 2;  2DDU A;  2W0X A;  4XUO A;  4HG6 B;  4NRM A;  3M3I A;  3W20 A;  2IXH A;  3LIH A;  5ANN A;  1DQ5 A;  1QMJ A;  2R6Q A;  5LRR A;  4AW7 A;  2Z79 A;  2DU1 A;  4UF0 B;  2YGL A;  1N3O A;  5FLH A;  1UN1 A;  1QJY 1;  4COU A;  3MF9 A;  1PO1 2;  3QOP A;  1W6M B;  3CQO A;  3VN4 A;  4CVU A;  1CJP A;  2BP6 A;  3WP6 A;  4CEY B;  3LPG A;  4AQ2 A;  2GNB A;  1EUT A;  2GME A;  1W03 A;  1W0N A;  2OKX A;  3KT7 A;  4CDX B;  5JOW A;  4XHX A;  3WF3 A;  4C0H A;  2WA4 A;  4GUL A;  4WV8 A;  3W59 A;  3KV9 A;  1PGW 1;  1JUI A;  4ASK A;  1BXH A;  1UY0 A;  1WW7 A;  1D4M 3;  2W47 A;  4S2D A;  5FY8 A;  3VBO B;  4CDX C;  4Z92 B;  5CZK A;  5GLV A;  1AYN 1;  3KS7 A;  4BHP A;  1GZ9 A;  1A34 A;  1BVV A;  3O5S A;  4JHT A;  2VMI A;  2VMH A;  5C4W A;  3U75 A;  4YZ2 A;  3OYW B;  4C90 A;  2CNA A;  4XMI A;  4YG3 A;  4DRV A;  5FY1 A;  1BVP 1;  5CFC C;  1PGL 2;  3LA2 A;  2RMU 1;  4ISQ A;  4XQW A;  1Q56 A;  1H4H A;  2VTX J;  2E53 A;  4MGQ A;  1W6Q B;  4JDM A;  2J1E A;  3SMH A;  1SCR A;  5JIA A;  2WZE A;  3ZM8 A;  4TXW A;  1JYV A;  2X29 A;  3APB A;  3IIA A;  4WM8 B;  3ZXL A;  2YFU A;  5EJ3 A;  3NJX A;  3RPQ A;  3BI3 A;  1MS4 A;  1VBC 1;  4Q8K A;  3O1S A;  1Q5O A;  4JDO A;  1UL9 A;  3JD7 2;  2GND A;  5F3E A;  3OUI A;  4J1X A;  1F5J A;  5H9Q A;  2A6Z A;  1RUF 3;  2RR1 2;  3WG2 A;  3INA A;  3I2D A;  2Q1Z B;  3WG3 A;  1UU4 A;  2ADE A;  4QX7 A;  4CCC A;  5A3T A;  4YAR A;  2WFF 1;  1GZC A;  4ZON A;  2IXJ A;  3MPP G;  3CLP A;  1WUV A;  1YQ2 A;  3EJK A;  4WM7 A;  3T2Q A;  2EIE A;  4KBB A;  4QU1 A;  2HBU A;  3T0B A;  4QQH A;  1TMF 3;  3O0X A;  1UY2 A;  4IEW A;  2VOK A;  1S2E A;  1QJE A;  1EV1 1;  5IYY A;  3OEB A;  2D3P A;  3G6J B;  3OSD A;  4LBQ B;  5IW0 A;  4OZX A;  1WD3 A;  3UKT A;  1JMU B;  3H3L A;  4XDP A;  1QWR A;  2BRT A;  4Q4X 1;  4JTO A;  4Q4V 3;  5C8C B;  3N9O A;  1YI9 A;  2X5I C;  5FZ4 A;  3W58 A;  3VBH A;  3KHC A;  4Q2F A;  3WZ1 A;  4AFD A;  3LA3 A;  2VUJ A;  3ZFF C;  5CAD A;  4YW5 A;  1UZW A;  5JPN B;  3AZY A;  4MSV A;  5GZD A;  4LOR A;  1I5Z A;  5LBF A;  4DXZ A;  5F2W A;  2OVU A;  1IS4 A;  2WFF 2;  4FI9 A;  1HQN A;  1QQP 3;  1MZ6 A;  2HWE 1;  3RS6 A;  4XXP A;  5J98 B;  1QIQ A;  5ACA 3;  3OYW A;  4EYU A;  1HIX A;  1W3X A;  4N53 C;  2C26 A;  3THT A;  4ES8 A;  4BLJ A;  3P3P A;  5F7U A;  1GBG A;  3BTA A;  5ERL A;  2XJT A;  5KHI A;  2J22 A;  1KRI A;  3VBF C;  3HQR A;  5J36 A;  3DPR B;  2EXH A;  3U14 A;  4TWT A;  4WM8 C;  1VBA 1;  3SNM A;  1OI6 A;  2D3S A;  2R30 A;  4DOU A;  3PUH A;  1QJX 1;  2D6K A;  3Q8B A;  1Q8S A;  3LCP A;  4MGZ E;  3CNA A;  1M06 G;  2RMU 3;  2WS9 3;  4EZ4 A;  3WR0 A;  1WWY A;  5FYM A;  3POY A;  3V0B B;  3FLT A;  2WS9 1;  4UT5 A;  2J7M A;  3ZYP A;  4D0Q A;  3ZN6 A;  1IS3 A;  2QQP A;  2BEO A;  3B3Q E;  2VY0 A;  3BAL A;  1H4G A;  2XVG A;  3I3E A;  4XC9 A;  3POI A;  5EWS A;  1QXR A;  3ROU A;  3O1P A;  3ZYG A;  1JYC A;  2WIN B;  5JR2 A;  3PUI A;  4QQ2 A;  4XYX A;  1BMV 2;  4MV2 A;  3WG4 A;  1AYN 2;  5IVF A;  1YFX A;  1SLC A;  5FR3 A;  4GMP 3;  1LJ7 A;  1UY1 A;  5I93 A;  1OF3 A;  4UW3 A;  4WM7 B;  1QJZ A;  3OUJ A;  3KVB A;  1W3V A;  3VD7 A;  4UF0 A;  2NLR A;  1BK1 A;  3WNP A;  3HVD A;  3POF A;  2VEC A;  4X8P A;  2XJS A;  5DQ0 A;  3EO6 A;  2LM3 A;  2R32 A;  1JBC A;  4QX1 A;  5DXD A;  5IVY A;  2XH6 A;  4XAE A;  5F5Q A;  2VC9 A;  4ATE A;  1QJY 2;  4QB1 A;  2WNE A;  4XJU A;  3ABZ A;  5JOZ A;  4X6R B;  2UWA A;  5C8C A;  3E5X A;  3H50 A;  3CZU A;  5I0D A;  3BU0 A;  1GQP A;  1XYN A;  2QQM A;  4MVT A;  4LBN A;  5LBE A;  5J37 A;  2DF7 A;  3KHB A;  3SCF A;  1DU3 D;  4CUB A;  1ULF A;  4Q4X 3;  1GOH A;  4Q4V 1;  3ZYF A;  4P5Y A;  3RQ0 A;  2J1R A;  4AF9 A;  4A3Z A;  1PIV 2;  1QOO A;  3ZMN A;  4NWV A;  1GQH A;  5H9P A;  3HJR A;  4Q4V 2;  2B45 X;  4W6Y A;  4IE4 A;  3HT2 A;  1L7L A;  4LUM A;  3DN7 A;  1IGO A;  1C28 A;  1V9U 2;  2IUW A;  4Y26 A;  3WW4 A;  5HCA A;  4XJ9 A;  5CU1 A;  4OHW A;  1GP6 A;  3CEW A;  1QH6 A;  3LPF A;  2O8O A;  2YGM A;  4WM8 A;  4DY3 A;  1X9P A;  4GA9 A;  4XCA A;  4D8M A;  3HIF A;  1YIF A;  1W6P B;  1UMH A;  2VQT A;  2YZ4 A;  3EHK A;  4LO7 A;  3O1V A;  4HK8 A;  1OOP C;  1AL2 3;  2V73 A;  4CRQ A;  4XJW A;  1XE0 A;  2YFZ A;  1PK6 B;  1R08 3;  1Y7B A;  1GYK A;  1X50 A;  1O7F A;  4RHV 3;  4XBL A;  4CEW B;  3C7O A;  2QJV A;  3GBW A;  4HET A;  4K6B A;  2PEL A;  4OMD A;  1NE4 A;  5FYY A;  4UFH A;  4FAG A;  2BBA A;  1RUF 2;  1VAK A;  2PHL A;  2RR1 3;  5CIR A;  3NKT A;  2QCS B;  3LWC A;  1OPO A;  2ZGT A;  4JTN A;  3SEP A;  4N9H A;  1BMV 1;  2RS3 2;  3ZXJ A;  4UFM A;  3TWI A;  4XFB A;  4M3C A;  4LBL A;  1SDD B;  2WC2 A;  2ZEW A;  2VR4 A;  3VDD A;  1FPN 2;  1GV9 A;  2WS9 2;  2YMZ A;  1YFU A;  4P9W A;  3RI8 A;  3AB0 A;  1QJX 3;  3QD6 A;  3MI8 A;  1IPJ A;  4QPG A;  3JB8 A;  3B94 A;  3GBF A;  2CAV A;  1LU2 A;  2D5F A;  1Z78 A;  3VKL A;  1KD7 A;  4BE3 A;  1HB1 A;  1Z0H A;  3PME A;  1VBA 2;  4RFT 0;  3THC A;  2BPA 2;  2ZAH A;  4F83 A;  5JDB A;  4MYE A;  2P6H A;  1JU3 A;  2MHF A;  3IAQ A;  4YW7 A;  5HCB A;  4P08 A;  3RG0 A;  1QH7 A;  3AM2 A;  5FY5 A;  2AEY A;  3EB7 A;  3WW3 A;  2IC1 A;  2R04 2;  3A0N A;  4NPM A;  4NPR A;  4JAA A;  1DLC A;  1KJR A;  1X36 A;  3IZO A;  3QLQ A;  5FMC A;  4CDU A;  1T6G C;  2GP3 A;  2VQA A;  5DUX A;  1LEC A;  4P02 B;  4BYY A;  1H8T C;  1DGW X;  4PDW C;  1G9C A;  2FMD A;  2OX0 A;  3HQX A;  4QB2 A;  4XQD A;  3RWK X;  4QHZ A;  3V56 A;  1W6Q A;  2UU8 A;  4AI3 A;  4CTE A;  2D43 A;  1WLT A;  2V5Y A;  2Z42 A;  4Y5S A;  4BPZ A;  1J3Q A;  2AH2 A;  1HDK A;  1WZX A;  3DXT A;  3RVH A;  2OQ6 A;  3NVC A;  4A6O A;  3MLJ A;  5CFD B;  5DZE A;  1PX3 A;  1ZYB A;  2C4X A;  5D8A A;  4I3G A;  2GMP A;  3RI9 A;  1A8D A;  3NJZ A;  4BQ1 A;  2E32 A;  2NP0 A;  3C3V A;  3ZIW A;  2HEY F;  4XFA A;  5FBZ A;  1RUO A;  5M0T A;  5A33 A;  1X8M A;  5JUV A;  5FYB A;  3WW2 A;  5KHJ A;  1NUK A;  1UU6 A;  1RUC 3;  1UOG A;  2DUQ A;  3KMH A;  4AI1 A;  2RDR A;  5FWJ A;  1YWK A;  4FOW A;  2UUR A;  2VOW A;  3PVE A;  4HBN A;  2Q8O A;  3W5M A;  5DDJ 3;  1VBB 1;  4Y5T A;  4CU9 A;  3ZVX A;  1IPS A;  2Q30 A;  1WA6 X;  5FCC A;  4AXO A;  3B00 A;  2ZGP A;  3M70 A;  4QXK A;  4FPK A;  4QX5 A;  2RS1 3;  5FZH A;  4K3U A;  3W9A A;  2V5D A;  4NPL A;  1MS1 A;  2DU0 A;  4LBQ A;  2OII A;  3IDA A;  3A23 A;  4AEJ A;  4LHK A;  1CPN A;  4J1W A;  4RFR B;  3J9S A;  3VUO A;  1H6Y A;  4GJY A;  2BWA A;  2NPI A;  2YC0 A;  3IMM A;  4IW3 A;  1WLD A;  4QKD A;  1NLS A;  2HWC 2;  1W05 A;  2DCY A;  4YM1 A;  3ZOI A;  3K48 A;  1N1V A;  4K20 A;  1JHJ A;  3UES A;  2PXJ A;  3FJS A;  1I5P A;  2DUO A;  1RUN A;  2NM1 A;  4RQP C;  4QAW A;  4WVV A;  2WO1 A;  1IQA A;  4E2S A;  1W39 A;  4AHY A;  2QQK A;  1Y43 B;  3ZXD A;  3VDB A;  4OVE A;  1YIP A;  1W9T A;  3E6C C;  4XQ4 A;  4PIX A;  4BH9 A;  4DMI A;  4PLO A;  3ES4 A;  2VW0 A;  3J26 N;  2DCT A;  4C0B A;  2P3I A;  1G86 A;  3VL9 A;  1RUJ 1;  3A7Q A;  5GZC A;  4IEP A;  4E4S A;  3OG2 A;  2VG9 A;  5FRE A;  1OH4 A;  2ARB A;  3H7Y A;  3P1I A;  3ZDS A;  5CFC B;  4OQ8 A;  1KIT A;  1O8S A;  3WP5 A;  4EZH A;  1QKQ A;  4U36 A;  3WLU A;  5C9A C;  1H2L A;  1SLT A;  3WHU A;  3ZSL A;  5KR7 A;  4KGG A;  2GC1 A;  3V0B A;  5BNQ A;  1IZ3 A;  3WHT A;  1N1Y A;  1UOB A;  3AZV A;  5LBC A;  4CE8 A;  1BJQ A;  4CDQ B;  4Z82 A;  5FLJ A;  1RHI 1;  1RXG A;  4Q4W 2;  5G05 L;  3I2H A;  4XFH A;  5F3I A;  3CKH A;  3PJQ A;  3RMX A;  1LU1 A;  2VZV A;  4LA3 A;  4F8A A;  1ODN A;  4OQ9 A;  3GYD A;  4Q29 A;  1HXS 1;  1VRH 2;  1ZNP A;  3HWJ A;  2Y33 A;  2ZZJ A;  2ZX0 A;  4QWN A;  5AC9 2;  5FV3 A;  3AL6 A;  1QXJ A;  3CDZ B;  5D21 A;  4QT6 A;  4QMA A;  1UD1 A;  1COV 1;  2YBS A;  5FZ9 A;  4DNY A;  1S2B A;  2SLI A;  1S4C A;  4OMC A;  4BZ4 A;  1XBF A;  4Y1U A;  2VCC A;  1POV 1;  1QJU 2;  2VNO A;  2E33 A;  3M3C A;  1IPK A;  3THD A;  1U12 A;  2FD8 A;  3ME2 A;  2W52 A;  4YG0 A;  3VBS B;  1CIY A;  3EYP A;  1TG7 A;  1CGP A;  2QVS B;  1C8M 1;  2QQV A;  4RSU A;  3NNJ A;  1DP0 A;  2WSV A;  5KC5 A;  5KHG A;  3CO2 A;  3III A;  1PIV 3;  1D7P M;  4L8Q A;  5FZ6 A;  2B4K A;  4A4A A;  5F3G A;  1VMH A;  5K0U B;  3WX5 A;  1HJF A;  2EVX A;  5DAV A;  2ZXQ A;  4PI0 A;  1VBD 1;  4RR3 C;  3WXP A;  4A3X A;  4P9L A;  4KBZ A;  5CBL A;  4CCJ A;  2NN8 A;  3USU A;  2XB6 C;  4D7S A;  4JCK A;  4JQT A;  4NIG A;  3POJ A;  4OCT A;  3N9M A;  1RMU 2;  1PNG A;  4AE2 A;  4FXG B;  2NQY A;  1AL2 2;  3AL5 A;  3IDC B;  3ZKY A;  5A6X A;  1W6P A;  2R06 2;  4Q0P A;  1DCS A;  1RHI 3;  1V6N A;  2R06 3;  3VBU C;  1UNB A;  4BQ3 A;  1DDL A;  2EXJ A;  2WYS A;  4AAP A;  4AG4 A;  1JZ2 A;  4K8R B;  2XBO 2;  5HI0 A;  4IEQ A;  3QH7 A;  4L0P A;  4QXC A;  3T4H B;  3LKJ A;  1LHW A;  3NQH A;  3CF6 E;  3TNQ A;  2YC4 A;  1CON A;  4IV3 B;  4P9G A;  3WEZ A;  4L2N A;  3SH5 A;  2UYB A;  4RS5 C;  2RE9 A;  2WL1 A;  3GCW A;  1R1A 3;  3ZFF B;  2Q5T A;  3CMG A;  2GAU A;  5C5U A;  1JS9 A;  5D1I A;  2VZU A;  3MLL A;  1R1A 2;  1CZV A;  3ACL A;  4QX0 A;  4NUB A;  4YFZ A;  1SCS A;  1AR8 2;  2WRA A;  1MQT A;  2WAA A;  4EWA A;  1RVF 1;  4N7U A;  4N43 A;  5FMO L;  3POG A;  3ZXF A;  3WDY A;  1SAC A;  3A22 A;  4LHL A;  2XJU A;  2F17 A;  1OLQ A;  5FYU A;  4LKS A;  5IVB A;  2A70 A;  2ZZQ A;  4EN6 B;  2EIG A;  2YU1 A;  1RVF 2;  5CVR A;  4QM8 A;  4CP2 A;  3NL1 A;  1WLC A;  1LHU A;  3N3H A;  1I1E A;  3NKG A;  4BM8 A;  2A5Z A;  3NNG A;  4FFF A;  4K9S A;  1POV 0;  3ECQ A;  2Y8K A;  1R1Z A;  4KG8 A;  4DB5 A;  5C3P A;  5FZO B;  2WO2 A;  3U10 A;  2CGO A;  2VMD A;  3PVO A;  4KU8 A;  4Y1X A;  1RYY A;  4JVA A;  2ID4 A;  3ILR A;  3NNL A;  1APN A;  1FAT A;  3CL1 A;  1AR6 1;  1G8W A;  1DGR N;  4W8J A;  5E88 A;  3C8X A;  4OFG A;  1OVS A;  3CJX A;  4CCL A;  1K3I A;  1GQG A;  4CPB D;  5ISL A;  5GLW A;  4QPW A;  1AJO A;  1LRH A;  2CYF A;  4Q4W 3;  1ZRF A;  2ZMK A;  2W1U A;  3FLP A;  3HMY A;  4XFI A;  1MPX A;  4H7L A;  3V0A A;  5CA6 A;  3H8X A;  2ADD A;  1K42 A;  4I02 A;  5C6C A;  5A3N A;  1U5X A;  1I9R A;  1PM4 A;  1LOG A;  2OZ6 A;  1NY7 1;  2VXR A;  4LUK A;  4YVS C;  4CZS A;  5FO9 B;  1R09 3;  5JXJ A;  3ORJ A;  2BUK A;  3OGJ A;  4IES A;  2J42 A;  1MS3 A;  4OLL A;  1LNS A;  2ET1 A;  4MAD A;  2PLV 2;  1XSR A;  1S0J A;  3VBS C;  3T1M A;  1UOF A;  3BPS A;  3ZSE A;  4IEZ A;  1G9B A;  1DYK A;  4QGN A;  3JD7 3;  4UW4 A;  3ETQ A;  3VZK A;  4HVO A;  4RGA A;  5FO8 B;  1H8T B;  3PL0 A;  1RIT A;  2RM2 1;  1JW6 A;  1MQT B;  2WNU C;  3NV2 A;  2VE1 A;  2TEP A;  2VNV A;  4LBM A;  4U2A A;  4XIK A;  5C4W C;  4JRA A;  5IAX A;  3LEG A;  2WT1 A;  1RC6 A;  2ZML A;  4B4P A;  1LHN A;  1OUR A;  3H8R A;  2FZ2 A;  4DS0 A;  5GAL A;  4QHB A;  5LA9 A;  3BN6 A;  3I2G A;  2EA7 A;  1TE1 B;  4FPL A;  4J6G A;  1RB8 G;  4HVQ A;  5JXH A;  1TMF 2;  1AR9 2;  2OPK A;  3WNK A;  1RED A;  1HXS 2;  3NJV A;  1WLW A;  2AGS A;  2PQS A;  1VBE 1;  3ZSM A;  2JDA A;  5FZG A;  1HB4 A;  3AKT A;  3UYJ A;  3VZM A;  1VP6 A;  3HPN A;  5FLI A;  4ZY9 A;  1NLQ A;  4PLM A;  3PU3 A;  3ACF A;  1HV1 A;  4CP9 A;  1FNY A;  1ND3 C;  2X05 A;  1AYM 1;  1IQD C;  4BIS A;  2D6P A;  5IK7 A;  4WZC A;  4EJR A;  1H30 A;  3POS A;  4LHS A;  4GQ7 A;  5JMO A;  2PTM A;  1QNW A;  3AJY A;  3DCQ A;  3FHQ A;  4H2A A;  4JKK A;  4O7X A;  1CX1 A;  2ERF A;  1VMF A;  5KHH A;  3OBA A;  1XU2 A;  1XJA A;  3GDB A;  2W94 A;  3PUR A;  5A70 A;  3VD4 A;  1C8M 3;  1OH3 A;  1UXZ A;  3PLQ A;  2B46 X;  3UT0 A;  2VME A;  3IB3 A;  5IT6 A;  3KQ4 B;  3PNA A;  3RSJ A;  3LOI A;  2J1V A;  3MIE A;  3GBG A;  4CP1 A;  4KWU A;  4XDQ A;  3ZN6 B;  4AZZ A;  1PK6 C;  3O14 A;  5LA0 A;  2WZ8 A;  3N9N A;  4CPB A;  4BOW A;  1QQP 1;  2FHR A;  3FMG A;  4JV4 A;  4KQ7 A;  5EXO A;  3BCW A;  1BZW A;  3AMH A;  5FP9 A;  4YW3 A;  2VXJ A;  3KGL A;  1DQ0 A;  3D82 A;  3X29 B;  4G4F A;  4F3J A;  3T0D A;  1Y3T A;  1RUJ 2;  5K4L A;  5FXW A;  3TYJ A;  2LW8 A;  3JQX A;  5IK8 A;  1EPW A;  1E5H A;  3TEW A;  1D0H A;  2WZR 3;  1ULO A;  1W0P A;  2HWF 3;  3TRS B;  2A71 A;  3UGF A;  2XJR A;  4WM7 C;  5A3W A;  3UL2 A;  3VKN A;  2G9F A;  1QJU 3;  2VBB A;  5LRS A;  2OUJ A;  3OPW A;  1VAV A;  4CCM A;  3NWK A;  1RVF 3;  5DPN A;  5DZF A;  1U0A A;  2UYA A;  4GWI A;  2XOM A;  5IVJ A;  3UJO A;  1TNF A;  4CUC A;  1W8N A;  1ULD A;  3C7E A;  1FYU A;  1V6I A;  3AP7 A;  3VKF C;  1H1I A;  2D6O X;  5HBA A;  5KXC A;  3I2I A;  3VV1 A;  4IEV A;  5JLV A;  1WME A;  1LB2 A;  1GR3 A;  2RM2 3;  1SQ4 A;  2JG8 B;  2IXI A;  5FKC A;  4R9C A;  2HWB 2;  1B35 B;  1YQ8 A;  2ZTN A;  4BDV B;  1POQ A;  2G9Z A;  5FPX A;  3J4U H;  4AWD A;  4BQ4 A;  1OD3 A;  2ZMN A;  1AZD A;  2Y64 A;  3MHZ A;  2JE8 A;  3HQU A;  4E9K A;  1NZC A;  3AKP A;  4Q1P A;  4Q4Y 2;  4FT8 A;  2AEZ A;  3CHX A;  4IGO A;  3TOJ A;  5FO7 B;  4EN7 B;  3KZ4 C;  1OD5 A;  3N7L A;  5ABJ A;  3TB0 A;  2RDS A;  2BFU L;  1REE A;  4LUL A;  2W9X A;  2BU9 A;  1H0B A;  5LBB A;  5SV8 A;  3SH4 A;  1R09 1;  3BTX A;  2TNF A;  4XAC A;  1MEC 3;  4MG2 A;  4QPI A;  2VAU A;  1CN1 A;  3BKZ A;  4CEW A;  3RZZ A;  5BNP B;  2P1B A;  1PVC 3;  3KF3 A;  4RYD A;  2YBK A;  1RUD 1;  2VNG A;  4PJY A;  1R64 A;  2O1Q A;  3UKV A;  1XNB A;  4IV3 A;  2I74 A;  2V09 A;  5F2S A;  1CAX B;  5A7P A;  1BHG A;  3GM8 A;  5FZB A;  2DV9 A;  1RUC 2;  3SIT A;  4E4D X;  3F2Z A;  2YYO A;  1GU3 A;  4XFG A;  1YXW A;  1YQ5 A;  5FZA A;  3PUS A;  3ZN5 A;  4XBQ A;  1AL2 1;  1PNF A;  4OHY A;  2Y26 A;  1JOB A;  1Q8V A;  2AUY A;  3D5O A;  2CAU A;  1COV 3;  2VH9 A;  3F95 A;  4QDQ A;  5FYS A;  3N7M A;  5L36 A;  1XNA A;  3AP9 A;  2G19 A;  2YDE A;  1QJF A;  5CKQ A;  3AMM A;  3Q8C A;  2JDY A;  3R4U A;  1K12 A;  1Q8O A;  4ATF A;  2HJI A;  1UYY A;  3NAP A;  1AX2 A;  2X5I B;  3HD8 B;  2MPF A;  1X8E A;  1DBN A;  5DAB A;  5AFE A;  3POE A;  2R16 A;  5EV7 A;  1W6O B;  4FPE A;  4DUV A;  4CP9 B;  1RMU 1;  5EJZ B;  1N1S A;  2BNM A;  3N36 A;  4Q1R A;  2UWC A;  4DFS A;  1PVX A;  2WO3 A;  1GSL A;  1AX1 A;  3U37 A;  2RV9 A;  3ALQ A;  3E5U A;  3WDU A;  2QQI A;  1H1A A;  4CUA A;  2XPJ A;  1HRI 3;  2BFU S;  4EQV A;  3MIB A;  3KCY A;  3OY8 B;  4HAN A;  1I3H A;  1GFF 2;  5BNO C;  1VJ2 A;  1OBN A;  2E9Q A;  4XHB A;  2ZHK A;  1H2M A;  1MQT C;  1GAN A;  2YY1 A;  1V9U 1;  3K46 A;  4LHN A;  5JPM B;  2G4I A;  3ZPO A;  4DXT A;  1GOF A;  4E2Q A;  5CNA A;  3M7A A;  1CAV A;  4YW4 A;  1BBT 3;  1W2U A;  2VTX A;  3BU7 A;  5T5O A;  1QJU 1;  2QQU A;  5F6L B;  4KNC A;  4KWK A;  4Q4Y 3;  4URA A;  1IKP A;  3S6P A;  1KJL A;  2X53 S;  1GNZ A;  2BWC A;  3VZO A;  5K9Y A;  5AVP A;  5FYC A;  4CXX A;  4IE0 A;  4YM0 A;  2R1B A;  1VRH 3;  3AJZ A;  3WT3 A;  1PO2 2;  3O0V A;  2PFW A;  3J7L A;  4ZZ8 A;  5AC9 1;  5EPA A;  4XBN A;  1JZ6 A;  4KMQ A;  4CCN A;  1O4Y A;  3CBN A;  5LEJ A;  2XUM A;  4QX8 A;  2KD7 A;  3O1U A;  3ACH A;  1PZ9 A;  3THP A;  1DQ2 A;  1PIV 1;  3ENR A;  5HCF A;  1VBA 3;  2VVD A;  3RNS A;  2I07 B;  4M3C B;  4WVZ A;  4XXA A;  1MAC A;  4XJA A;  4Q4W 1;  3ASI A;  3U78 A;  2JEN A;  1H8V A;  3MIG A;  3MLK A;  4HKO A;  1ACC A;  1AHS A;  3HBZ A;  4QU2 A;  4TN7 A;  2W87 A;  2ZKN A;  1E5R A;  5DDJ 1;  3GF6 A;  4FFH A;  2DYC A;  3SC7 X;  2W2I A;  4LK7 A;  2FDF A;  2XKO A;  2A6Y A;  4MGY E;  2JD9 A;  3MDP A;  2WLP A;  1ENQ A;  4ONU A;  4YRD A;  3NAP B;  3VBH C;  1KS5 A;  2JXA A;  4AHW A;  3IAP A;  3N7J A;  2KR2 A;  4HSL A;  2DBN A;  5FZ7 A;  1ZBE 3;  2XQR A;  3R4S A;  1KQR A;  2EID A;  2VUC A;  4HN0 A;  1E5I A;  5T3N A;  2W91 A;  3PDQ A;  1RXF A;  2Y6G A;  4AHZ A;  4YZ5 A;  3DUI A;  4WZF A;  2W1S A;  1YFY A;  2ZGQ A;  5A6Y A;  3KVA A;  5JXI A;  5JI9 A;  2DVG A;  2E31 A;  5EQU A;  1YQ6 A;  2R0F A;  3HBK A;  3W21 A;  1S2K A;  2E6V A;  2NMO A;  4QPI C;  5GLT A;  2GDF A;  5KC6 A;  2GC3 A;  4YM2 A;  2XL7 A;  2GNT A;  4JDN A;  4YPJ A;  2QFE A;  1IHM A;  3O7O A;  2H0V A;  1O59 A;  3ZFG A;  4AI9 A;  2ZGO A;  1CIW A;  2WBK A;  3SKJ E;  4UW6 A;  1JHN A;  4IV3 C;  3SKV A;  1GKB A;  2ENR A;  1Z7S 2;  5FYT A;  2O8Q A;  3PTY A;  2IFR A;  5FPL A;  5CG8 A;  4Q0V A;  4XF1 A;  1NAE A;  1RUJ 3;  4XFF A;  4AHX A;  2P3Y A;  5FXV A;  4AGG A;  1CAW A;  4BQ5 A;  2VZO A;  2OW4 A;  3H0O A;  3I2F A;  3LAG A;  2WUH A;  4FTE A;  3U11 A;  2NYY A;  1FV2 A;  1NA1 A;  3R4D B;  1X82 A;  2ETE A;  1BBT 2;  2HKX A;  4QKB A;  3FE5 A;  2Y38 A;  5FTT C;  5ANQ A;  3VZJ A;  4D6Q A;  1RUG 2;  1QHD A;  3D0J A;  4NOT A;  5F5A A;  4ZPI A;  5F9T A;  3IPV A;  3M8L A;  4YGE A;  4AK3 A;  5A3P A;  4UFL A;  3B69 A;  1SG3 A;  1A8M A;  1O3Q A;  2KM2 A;  5JI7 A;  2PYT A;  4L92 A;  3OPZ A;  3O1T A;  4A2U A;  2GC0 A;  5DMY A;  4ARX A;  4XAB A;  4XUP A;  4GWJ A;  4PQQ A;  2QQO A;  3FLR A;  2WT2 A;  3FUQ A;  5FP3 A;  4COV A;  5DAP A;  1URX A;  4MGK E;  4AVA A;  2WN2 A;  3U0Z A;  4AQT A;  1PX4 A;  3WW1 A;  5T5P A;  2EIC A;  1ZBA 3;  4K1Y A;  2LRP A;  1FV3 A;  2JDN A;  5BPX A;  3VBR A;  2JEM A;  2VBP A;  3WUD A;  2OZJ A;  4FQ4 A;  2PAK A;  3LGR A;  5L7O C;  4OI0 A;  4MZU A;  1R08 1;  4UBH A;  1AR6 3;  2VZP A;  1POV 3;  2P17 A;  4GWN A;  4OI2 A;  4Q5O A;  4MHR A;  4NAM A;  4UYB A;  2PHX A;  3S7E A;  1ZZ7 A;  4KL1 A;  2EXK A;  3CJI C;  3P5B A;  1XYO A;  2WDB A;  4N43 C;  4CP0 A;  2K0G A;  2VZT A;  1HQW A;  4LE3 A;  4D7Y A;  3VDA A;  2Y60 A;  2RS3 1;  3DPR A;  1W9W A;  2DVB A;  3H1Y A;  1L7Q A;  1J1L A;  1QDC A;  3TN9 3;  4AI8 A;  1JOP A;  2AZ5 A;  1RUH 1;  4AL9 A;  3AYE A;  4PLN A;  4UOJ A;  1PGW 2;  3OOX A;  4LJH A;  4AQ6 A;  4CDQ C;  4HON A;  2WJS A;  2QQJ A;  1LOB A;  2C1F A;  2Y0I A;  3S7I A;  3HN1 A;  4KI5 M;  1HRV 3;  5I8T A;  1VMJ A;  1CAW B;  4ORF A;  5FY9 A;  3BYW A;  2ZBJ A;  3NJY A;  1UQX A;  2VW2 A;  4YW2 A;  1CD3 G;  1STM A;  4YWA A;  1CX4 A;  4QKN A;  3ZR6 A;  3FUO A;  1CAU A;  3WSO A;  1YLL A;  2ZGL A;  4CCO A;  1O3S A;  3H7J A;  2HWD 3;  2AC1 A;  2G9G A;  3W5N A;  2LAL A;  3GZT B;  1W2N A;  4E4H A;  1HLC A;  1RUF 1;  4DQA A;  4XFC A;  4YZ4 A;  4YZ1 A;  2MEV 2;  4IEY A;  4ET7 A;  1W06 A;  5FPU A;  1FMD 3;  1ASJ 1;  5FMB A;  2K46 A;  4FTB A;  4DY5 A;  1RIR A;  5LW9 A;  1O6U A;  4D7T A;  2W92 A;  1GZW B;  2DWR A;  2ORX A;  3PIG A;  3POW A;  1BCX A;  5FP7 A;  1W6O A;  3RZL A;  5FYI A;  3GJA A;  5FZD A;  4E2G A;  1NX9 A;  1UYX A;  2ZA9 A;  3K77 A;  2G1M A;  5C9A B;  5LA1 A;  1N1T A;  3IWZ A;  3ZLI A;  2WQ4 A;  4AFA A;  4GH4 B;  3KF5 A;  1WMF A;  2CTV A;  3LDB A;  4LO5 B;  5IK5 A;  4GWM A;  3P6B A;  3VBO A;  4BB3 A;  4DPN A;  1O4Z A;  3URF A;  2WR9 A;  4P5H A;  3D0S A;  3KT4 A;  2WNV C;  1XNK A;  1XNC A;  2VW1 A;  1UXX X;  1K5M A;  5JSP A;  4NO4 A;  2JE7 A;  4Q8L A;  3Q9O A;  2ZGS A;  3U1X A;  2XLA A;  5JWP A;  2ZPX A;  3K4A A;  2CDO A;  2JE9 A;  2QUO A;  1UWW A;  3S30 A;  4ZU5 A;  4AI2 A;  4LT5 A;  2K9Z A;  1G7Y A;  1D2Q A;  2OS2 A;  3D8C A;  1VRB A;  2JEC A;  4MXV A;  4DXS A;  4IND A;  5HV0 A;  5BV6 A;  1Q8Q A;  2A3W A;  1Q43 A;  1OMI A;  5ABJ C;  2CSG A;  5A1F A;  1UY4 A;  4HZF A;  4LBJ A;  1UZV A;  3ZYJ B;  5BNP C;  3C7H A;  1VPH A;  3NV3 A;  4PI2 A;  4ZU4 A;  1AR8 3;  1WW6 A;  2VL4 A;  3C7F A;  5CFD C;  4HOO A;  2ZKL A;  3LB9 A;  2RJL A;  1ZZ6 A;  3MW3 A;  1VE0 A;  4A44 A;  2D97 A;  3JXS A;  1W99 A;  3OGV A;  2ORZ A;  3AYA A;  3AZZ A;  2JDK A;  1SEF A;  2DCJ A;  2PLV 3;  3MFA A;  5IAV A;  3NV4 A;  4W50 A;  4ASM B;  3CJI A;  4D94 A;  2KXL A;  4JGZ C;  2ZX3 A;  5LAS A;  1JH5 A;  4I09 A;  4PDW B;  1U5I A;  5FKB A;  4A45 A;  2N7G A;  5IHR A;  5IK4 A;  3KM5 A;  2HWE 2;  4W65 A;  3IBM A;  4N8M A;  5KXD A;  4QPG B;  1BLZ A;  1GP5 A;  3AFK A;  1AJK A;  1NCR C;  4GD4 A;  3ZPY A;  2ZHL A;  3U07 A;  1RUE 2;  1QJX 2;  4XZU G;  4ZKT B;  3CZJ A;  4N53 A;  1YCI A;  2LS6 A;  2WA3 A;  4M3C F;  1XU1 A;  3GHN A;  4M00 A;  3WQ7 A;  5JCT A;  3WF0 A;  2P5B A;  4PBP A;  2D6M A;  5I0R A;  3WQ1 A;  4BQ2 A;  2HWB 3;  1GLH A;  5C9A A;  4GMP 0;  2W08 A;  1JOJ A;  2VVE A;  4YM3 A;  4MGI E;  1PM7 A;  5HV4 A;  3E1F 1;  1WCS A;  1V0A A;  1W8F A;  4NVP A;  4DUX A;  2CGN A;  5H9R A;  4GXL A;  1UX6 A;  1UYP A;  3AVR A;  4XVH A;  5KXB A;  4S2G A;  1RUD 2;  4LTA A;  1HKD A;  2R07 3;  3I2O A;  3AP4 A;  2VMC A;  2WYF A;  2X8K A;  2XL9 A;  3DYP A;  4BME A;  1RJ8 A;  1MEC 2;  1ZX5 A;  2W95 A;  1T6B X;  3AK0 A;  1SMV A;  3GAL A;  3RMY A;  1R09 2;  4PF1 A;  4EE2 A;  1RUG 1;  1S0G A;  3KV4 A;  2AYH A;  3KV6 A;  4W4Z A;  1J3P A;  2ZHM A;  1H1M A;  1KFU L;  3V64 A;  1A3K A;  2OT7 A;  3WNN A;  4Q4Y 1;  2A6W A;  1D4M 1;  3AKQ A;  2JD4 A;  2RS1 1;  2JWP A;  4YGB A;  3TAY A;  2YUE A;  1OC1 A;  2RR1 1;  5I0U A;  5A7W B;  3T08 A;  1ZZ8 A;  2RG4 A;  1FMD 1;  4ZXK A;  4LKD A;  4D6S A;  5DAQ A;  3ZFG C;  4ISR A;  4FPG A;  4TLF A;  5A7O A;  1ZRC A;  1XE8 A;  4KU7 A;  1DHK B;  1MVE A;  1PZ7 A;  4H3W A;  3U4X A;  2D6N A;  3EQE A;  4HPK B;  2AAC A;  2XKP A;  3ZX7 A;  2BBV A;  2UWB A;  3JBG 3;  4K1Z A;  5FPB A;  2PMW B;  2QDR A;  4XUQ A;  3AP5 A;  3LFM A;  1CQ9 A;  4I0W B;  3RFR A;  3IPV B;  1AR7 3;  5FUN A;  2JIG A;  4PCR A;  3M1H A;  3KGZ A;  4QB6 A;  1NA1 C;  2VUA A;  4L97 A;  4TTG A;  2YC2 A;  2ZGR A;  2QZ3 A;  4QXH A;  1OUS A;  4L11 A;  2JG9 A;  2VBD A;  1UMZ A;  4AGV A;  5A7S A;  1LES A;  3VL8 A;  5T52 A;  4QX3 A;  3S5A A;  3FL7 A;  1RUH 3;  3H1M A;  1IOA A;  4IEO A;  3H3U A;  2RS3 3;  1EV1 3;  2WZR 1;  3WNL A;  2QDN A;  4IE6 A;  3ZXG A;  3VBR B;  3WF2 A;  1J58 A;  1EY2 A;  1ND2 B;  1ZBE 1;  2OA2 A;  3AYD A;  1E57 A;  3ON7 A;  4RR3 B;  3SIS A;  3UGH A;  4MX3 A;  1QQP 2;  1W8W A;  2WNU B;  2WQZ C;  4GIQ A;  1LKN A;  2O0O A;  4NE9 A;  4RN5 A;  3N4M A;  1C1F A;  1PMI A;  3MV1 1;  2Q8E A;  1LTE A;  1PO1 3;  3M3O A;  1MZF A;  3LD8 A;  4QQO A;  4TYS A;  3I8T A;  3U4S A;  1JYN A;  1OFS A;  3AFG A;  1GMM A;  4DIQ A;  1SFY A;  4C1W A;  4CEY C;  4X8N A;  1OVP A;  2B9V A;  5FZK A;  5C3R A;  3QCW A;  3BGA A;  5A1L A;  3CIH A;  1OQE A;  4DIN B;  1QEX A;  5CFC A;  1YYN A;  2VGD A;  4IET A;  1W9S A;  2F6B A;  5LK7 B;  1AX0 A;  3ZN4 A;  1CVN A;  1G9D A;  3ZSK A;  2Z69 A;  4NHL A;  1WBL A;  3ST7 A;  4AR2 A;  3MEP A;  1S0E A;  2J1A A;  2JDM A;  3QH6 A;  3SHR A;  4D3W A;  2VZS A;  3PHM A;  4FVV A;  5A7W A;  1DZR A;  4KGQ A;  4LIU A;  4CU7 A;  3RJR A;  4BK5 A;  1J59 A;  1M4W A;  4NHM A;  1V6O A;  4LOT A;  2R07 1;  3L9J T;  1AYN 3;  1RIN A;  5DUW A;  1ENS A;  4URT A;  4Y5Z 0;  2VPV A;  5GLU A;  2D3R A;  3LSE A;  1DYP A;  4HSJ A;  4M0N A;  1JZ3 A;  3I3B A;  4UBG A;  4PDW A;  4FAH A;  4LBO A;  4ZS2 A;  5BNO A;  4TSV A;  5GM0 A;  4HMZ A;  3WDW A;  5L9B A;  1BQP A;  1C5I A;  1KXG A;  2WLQ A;  3OD0 A;  3PUA A;  4Y4R A;  4Z2W A;  3MZH A;  2HWE 3;  2QNK A;  4FPH A;  5SV5 A;  3S5Q A;  2HWD 1;  2P4E A;  2ATF A;  2GAL A;  3B7M A;  1GIC A;  2CY6 A;  4LO6 B;  1N47 A;  1QJY 3;  1DGR A;  4LA2 A;  5IJR A;  5GZG A;  1F8V A;  1RUE 3;  4BIF A;  4LNV A;  1LGN A;  1HN0 A;  4CCE A;  4ZS3 A;  3JZV A;  4BU2 A;  2Q8D A;  1NCR B;  3MW4 A;  3Q8E A;  4B3N A;  4QPG C;  2AR6 A;  3T4V A;  4MET A;  2XON A;  1W2O A;  3BPZ A;  1C1L A;  2C24 A;  2VZ3 A;  3QBQ A;  5L19 A;  2ZEZ A;  1XRU A;  4H7M A;  1BEV 2;  1RJ7 A;  3HNB M;  3HAG A;  5IAT A;  2BTV C;  2BZD A;  4CDU B;  1AVB A;  1SLA A;  4RGK A;  5JMC A;  3VHO A;  4Z1V A;  4RQP B;  3UV9 A;  2V72 A;  1NCQ C;  1BEV 1;  5F5C A;  2FZ1 A;  2VCA A;  5JAX A;  3LA7 A;  2DBI A;  2C0Z A;  2C9K A;  1HV0 A;  1K5M C;  5IUQ A;  3WP4 A;  4BQY A;  1LGC A;  3RRD A;  2HYK A;  1OPM A;  5ABJ B;  3KQR A;  4S2H A;  4NJ4 A;  4C8D A;  3AMP A;  4S2F A;  1EP0 A;  1J84 A;  1OKO A;  4L99 A;  4QPI B;  3UJQ A;  3VZN A;  5BNN A;  1PMJ X;  2P37 A;  1SBD A;  2VVF A;  5KBF A;  4GMP 1;  3GCX A;  1ZZC A;  2F4P A;  1VBC 3;  1ZVF A;  2UY8 A;  5IVV A;  1AF9 A;  1ZZB A;  5A33 B;  3G7D A;  1B09 A;  2JDP A;  1W8Z A;  1LOA A;  4FBF A;  1GNH A;  4GAL A;  4YGD A;  1YC6 1;  3J7N A;  3OBR A;  4YNI A;  5FZE A;  3OPT A;  2D44 A;  3ETP A;  2OPW A;  3WOG A;  3ZFF A;  2Y6F A;  5J09 A;  5JOX A;  4ZHN A;  4KWJ A;  2ZS6 B;  1JU4 A;  2DVD A;  1SBF A;  1PVC 1;  4LEJ A;  4P9J A;  3RWN A;  5T5L A;  1WMX A;  4OHX A;  4B4R A;  1FNZ A;  4NN0 A;  3SH3 A;  3ZIX A;  3K4D A;  4M4P A;  1JOD A;  2J1S A;  2FCU A;  2P2K A;  3AP6 A;  5FWE A;  2BGO A;  4IQP A;  4NID A;  2PAM A;  2PHR A;  2GNM A;  5FZF A;  3WP3 A;  1O5L A;  5CIS A;  2VJX A;  4BXS V;  3OF1 A;  3ES1 A;  2PHT A;  1QF3 A;  2P34 A;  3Q8A A;  5FZM A;  2RJK A;  2VMF A;  5CAZ A;  5C3S A;  3H8O A;  1ASJ 3;  1HX6 A;  1KFX L;  3OTF A;  1MZ5 A;  3ZFE C;  2IXC A;  2HWB 1;  5FJK A;  2BVB A;  1H9P A;  4XMA A;  2ZHN A;  5FXZ A;  3WDV A;  4Q26 A;  1H6X A;  2GN7 A;  3T3Y A;  3OGG A;  3OB8 A;  2I45 A;  2JG8 C;  5CG9 A;  4UFJ A;  2SBA A;  4M01 A;  4YFW A;  1CWP A;  3DKQ A;  3H1W A;  2E7A A;  2FQP A;  2PQQ A;  1W6N B;  5FUP A;  4FPY A;  3N9L A;  3WF4 A;  2R04 3;  5LCW L;  3H8U A;  4CUG A;  1TEI A;  4BIO A;  2XBO 1;  3DGT A;  5AVA A;  1ZBE 2;  3DXU A;  1UKG A;  1YQC A;  3I2K A;  3BTZ A;  4Y24 A;  1SLL A;  4IEX A;  4CSW A;  4FFI A;  1X7N A;  4V1P A;  2A3Y A;  1F4A A;  2TUN A;  1TME 1;  3DV8 A;  4JGY B;  3E6D A;  1JUH A;  4H14 A;  2NMN A;  4HFS A;  3BIE A;  4E27 A;  4BMB A;  1JYI A;  5C3O A;  1JN2 P;  1C3H A;  4XIL A;  4W6W A;  4DUW A;  3M4F A;  4AVS A;  2YPD A;  3FC0 A;  2WT0 A;  4GB3 2;  5I8Y A;  1G9A A;  3MF6 A;  4FO9 A;  4Z07 A;  2R0H A;  3I3M A;  3T0A A;  5BNN B;  2MNG A;  2FMY A;  1AR7 1;  5A3O A;  1LUL A;  2P6C A;  2A1X A;  3FN9 A;  4FOY A;  4DO0 A;  2KA3 A;  3ELN A;  3JBG 2;  4Q0U A;  5JVV A;  3T1L A;  1BYH A;  4SLI A;  1O3T A;  2PAE A;  3PTR B;  4I30 A;  1JYW A;  1NZI A;  2XR4 A;  3VBR C;  4EN9 B;  5C7G A;  3SQO A;  2YXS A;  4RS5 A;  3T2P A;  2Q8C A;  5DAX A;  4R9A A;  2P3J A;  3D6E A;  4PQ9 A;  1TQ5 A;  3DF0 A;  1JZ4 A;  1W8T A;  4B7K A;  4LQR A;  1R08 2;  3IDE A;  3PVB B;  4XPV A;  3O1O A;  1KDK A;  4QQP A;  5BY5 A;  3FZ3 A;  2GH2 A;  3MFC A;  1FMD 2;  3E5Q A;  3HEI A;  5IWF A;  5EZW A;  2PHF A;  3LQC A;  3ZYB A;  2XJP A;  4P9Y A;  2RS1 2;  1OOP B;  4N7I A;  4M4R A;  4RA0 A;  1A78 A;  1YNA A;  2EIB A;  1RUG 3;  2WII B;  3A21 A;  1PHM A;  1S1A A;  3N9Q A;  1TVG A;  4XF4 A;  2Y34 A;  1V6J A;  4NIA A;  4IDZ A;  3GGL A;  2QBX A;  3FFQ A;  1AYM 3;  1W9Y A;  2Q0A A;  5FZ8 A;  1MEC 1;  1XNT A;  2ARE A;  4BA6 A;  5KXE A;  5FYH A;  1C57 A;  4CXW A;  3I7D A;  2VO5 A;  3MPB A;  4RR3 A;  2CHH A;  4FPJ A;  3O12 A;  4JX0 A;  5TSW A;  3HR9 A;  4LLO A;  2IZW A;  1KS4 A;  4B29 A;  3WV6 A;  1DFQ A;  1AR9 1;  3K51 A;  5F1R A;  3LEK A;  4NHX A;  3ATG A;  2GH8 A;  4BLI A;  4K7J A;  5J96 B;  5FY7 A;  1AXK A;  4Z2A A;  3NMB A;  5T55 A;  1JYX A;  4E8D A;  2WWJ A;  3I97 A;  5A3L A;  1ZRE A;  1OFN A;  3OJB A;  4BXF A;  3WDT A;  4XF9 A;  1W2T A;  3KCX A;  4XZP A;  4UAP A;  5T54 A;  2VMG A; 
#chains in the Genus database with same CATH homology
 2VZQ A;  1OH4 A;  1SG3 A;  3FHA A;  3P1I A;  1O8S A;  4E8C A;  5DMY A;  4ARX A;  2BGP A;  4XUP A;  3D3A A;  4GWJ A;  4PQQ A;  2QQO A;  3WQB A;  5C70 A;  4XUN A;  2WN2 A;  5EIY B;  4QX2 A;  1PX4 A;  2WN3 A;  2RJ2 A;  2EIC A;  4QDR A;  4A42 A;  5G05 L;  3I2H A;  1US2 A;  3CKH A;  3HOB A;  3AC0 A;  2VZV A;  2Y6K A;  2V4V A;  2VZP A;  3NRU A;  2JKX A;  2VQU A;  2WDB A;  5HXM A;  2X10 A;  2VZT A;  3CDZ B;  4DXR A;  2WAO A;  4OMC A;  3VDA A;  2XQX A;  3VD5 A;  2VCC A;  2E26 A;  3I2J A;  1W9W A;  1L7Q A;  3VD7 A;  1UYZ A;  2E33 A;  2W5F A;  4MOA A;  3THD A;  3OGR A;  4LPL A;  1CIY A;  2DCK A;  3EYP A;  4UOJ A;  1TG7 A;  2ZEX A;  4ZXE A;  5J1X A;  2Y6H A;  1DP0 A;  2J1U A;  2QQJ A;  4KI5 M;  3III A;  3T09 A;  1D7P M;  2B4K A;  4A4A A;  2VZR A;  5B4X A;  1OF4 A;  1UY3 A;  3VD3 A;  2ZXQ A;  3UET A;  2VM9 A;  4XUT A;  3WSO A;  2BER A;  3HNY M;  3W5N A;  4BK4 A;  1UX7 A;  4ET7 A;  1GOG A;  5CYY A;  2WYS A;  2W92 A;  4AG4 A;  2ORX A;  1JZ2 A;  2R7E B;  4L0P A;  1NX9 A;  1UYX A;  2J1T A;  3K77 A;  1SHW B;  5DN2 A;  3K4Z A;  4PT6 A;  3MO4 A;  3NQH A;  3WEZ A;  5LA1 A;  2YC4 A;  5C71 A;  1JZ5 A;  4P00 B;  2Y6J A;  3P6B A;  1CZT A;  3CMG A;  2VZU A;  3DYO A;  1CZV A;  4QX0 A;  1UXX X;  2WAA A;  3ACI A;  3ACG A;  1KGY A;  1GUI A;  2QQN A;  3A22 A;  3K4A A;  2CDO A;  1UWW A;  4LKS A;  5IFP A;  3HN3 A;  5LA2 A;  4DXS A;  3UNP A;  3NNG A;  2W3J A;  1UY4 A;  3ECQ A;  2Y8K A;  3C7H A;  2CDP A;  3GXU A;  2WO2 A;  2VL4 A;  2VMD A;  3C7F A;  1RYY A;  2ID4 A;  1L7R A;  4A44 A;  4W8J A;  4CU8 A;  3C8X A;  3JXS A;  3OGV A;  1W99 A;  1K3I A;  1DYO A;  2ORZ A;  4ARY A;  4QPW A;  2DCJ A;  4W50 A;  3MBW A;  2W1U A;  4DEQ A;  1MPX A;  2DDU A;  4XUO A;  4HG6 B;  2QQL A;  4A45 A;  1K42 A;  5IHR A;  1O8P A;  4XZU G;  3CZJ A;  2LS6 A;  3OEA A;  4CVU A;  5JXJ A;  3CQO A;  3LEI A;  3LPG A;  3WF0 A;  1EUT A;  1W0N A;  2OKX A;  1LNS A;  4MAD A;  2WAB A;  3WF3 A;  1XPW A;  2HLE A;  3E1F 1;  1UY0 A;  4DUX A;  2W47 A;  5FUI A;  1JZ7 A;  5CZK A;  4XVH A;  2VMC A;  3DYP A;  2W95 A;  3LEG A;  4OUE A;  4PF1 A;  4MGQ A;  4IUG A;  2J1E A;  4W4Z A;  3BN6 A;  3I2G A;  2W1W A;  2WZE A;  3ZM8 A;  4MGS A;  4TXW A;  5JXH A;  1JYV A;  3WNN A;  3WNK A;  2YFU A;  3J7H A;  3NJV A;  3T08 A;  2PQS A;  3NJX A;  2JDA A;  2RVA A;  1UZ0 A;  3HPN A;  4ZY9 A;  3ACF A;  2X05 A;  1IQD C;  1ULP A;  4XUQ A;  4LHS A;  1J83 A;  1YQ2 A;  3T2Q A;  2EIE A;  5JMO A;  3FHQ A;  3T0B A;  4JKK A;  4QB6 A;  1CX1 A;  4QDS A;  4TTG A;  1UY2 A;  2YC2 A;  3OBA A;  3GDB A;  5IYY A;  2W94 A;  3VD4 A;  3OEB A;  4ZZ5 A;  1WKY A;  1UXZ A;  2VME A;  3IB3 A;  4QX3 A;  3FL7 A;  2J1V A;  4KWU A;  1F4H A;  5LA0 A;  2HYX A;  2WZ8 A;  2VTF A;  3WNL A;  1HN1 A;  3WF2 A;  1UMI A;  3MV0 1;  4CU6 A;  1US3 A;  3LE0 A;  3T0D A;  3K75 B;  2LW8 A;  4FI9 A;  4RN5 A;  4MO3 M;  3MV1 1;  1ULO A;  2VCB A;  5F7U A;  1JYN A;  2C26 A;  1GMM A;  2J22 A;  2B9V A;  5DPN A;  3BGA A;  3CIH A;  4GWI A;  2XOM A;  1W9S A;  3PUH A;  2ZEY A;  4CUC A;  2J1A A;  1W8N A;  2VZS A;  3C7E A;  3I2I A;  2J7M A;  4D0Q A;  4BK5 A;  4CU7 A;  3I3E A;  4BDV B;  5JR2 A;  3PUI A;  1P8J A;  1OD3 A;  2Y64 A;  1JZ3 A;  2JE8 A;  3I3B A;  1UY1 A;  1OF3 A;  5IFT A;  4JKL A;  2W9X A;  1GNY A;  3WNP A;  5DQ0 A;  3I3D A;  4QX1 A;  5IJR A;  2VC9 A;  5B4N A;  4QB1 A;  1K45 A;  4RYD A;  1W8O A;  3ABZ A;  2W46 A;  1R64 A;  2XON A;  3C7G A;  3CZU A;  5I0D A;  1GQP A;  2QQM A;  2VZ3 A;  1BHG A;  3GM8 A;  2ZEZ A;  4CUB A;  3HNB M;  1GOH A;  3F2Z A;  4P5Y A;  1XC6 A;  1GU3 A;  2J1R A;  2YB7 A;  4A3Z A;  2BZD A;  3WNO A;  3HJR A;  2V72 A;  2VCA A;  4QDQ A;  2C9K A;  1XNA A;  3LPF A;  5EJ1 B;  3VD9 A;  4D8M A;  2VZ1 A;  2VQT A;  1UMH A;  1K12 A;  1UYY A;  1J84 A;  2WQ8 A;  2YFZ A;  1PMJ X;  3C7O A;  4OMD A;  4GZ9 A;  4DUV A;  2BBA A;  5EJZ B;  2W1Q A;  3MUY 1;  2WO3 A;  3U37 A;  2RV9 A;  3SEP A;  4CUA A;  2QQI A;  3ETP A;  4BJ0 A;  2YG0 A;  1PMH X;  4OZO A;  1SDD B;  1JU4 A;  2ZEW A;  2VR4 A;  3K4D A;  4M4P A;  2J1S A;  2BGO A;  1T2X A;  3VDC A;  3K46 A;  2VJX A;  4BXS V;  4DXT A;  5JXG A;  5HPO A;  2Y6L A;  1GOF A;  3THC A;  2VMF A;  1WCQ A;  1JU3 A;  3IAQ A;  4P08 A;  2Z4F A;  1H6X A;  3OB8 A;  1JZ8 A;  3EB7 A;  4ZZ8 A;  1DLC A;  1JZ6 A;  4KMQ A;  3WF4 A;  5LCW L;  2KD7 A;  3ACH A;  4P02 B;  3I2K A;  3DYM A;  3HNM A;  4QB2 A;  1F4A A;  2XHN A;  5G04 L;  2W87 A;  3MUZ 1;  4A6O A;  4DUW A;  2JD9 A;  1KEX A;  1PX3 A;  2C4X A;  3SEE A;  3T0A A;  3IAP A;  2E32 A;  3FN9 A;  2EID A;  1JYW A;  2W91 A;  5JUV A;  5A1A A;  2VOT A;  5C7G A;  2Y6G A;  1NUK A;  3T2P A;  1OT5 A;  2W1S A;  1JZ4 A;  3W5M A;  4LQR A;  4CU9 A;  5JXI A;  3WNM A;  2E31 A;  4OYU A;  2V5D A;  3HEI A;  3LQC A;  3IDA A;  4JHZ A;  3A23 A;  4M4R A;  4XUR A;  4UI9 L;  4DEV A;  1CZS A;  1H6Y A;  2EIB A;  4YPJ A;  3A21 A;  1TVG A;  1O59 A;  2WBK A;  3SKJ E;  3GGL A;  2QBX A;  3SKV A;  1NKG A;  1XNT A;  4AAX A;  3UES A;  1JI6 A;  1JHJ A;  1NAE A;  2VO5 A;  1I5P A;  3OGS A;  3DEC A;  3WF1 A;  4QAW A;  4JX0 A;  2WO1 A;  2VZO A;  4JKM A;  3I2F A;  2WUH A;  2QQK A;  3VDB A;  1EUU A;  1W9T A;  3LEK A;  1JYX A;  4Z2A A;  2X09 A;  4E8D A;  3I97 A;  4A41 A;  3A7Q A;  2L9L A;  3T2O A;  4UAP A;  3OG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...