1REEA

Endo-1,4-beta-xylanase ii complex with 3,4-epoxybutyl-beta-d-xyloside
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
b'ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE II
publication title Covalent binding of three epoxyalkyl xylosides to the active site of endo-1,4-xylanase II from Trichoderma reesei.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1995-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1reeA00
3ZSEA 2NLRA 4S2HA 1H4HA 4HKWA 3WP4A 3VGIA 1M4WA 1XNCA 3LGRA 2DCKA 3WT3A 2F6BA 3VHPA 3AKQA 4S2DA 3VZNA 3LB9A 3WY6A 2D98A 1TE1B 3HD8B 2B45X 1PVXA 4H7MA 4XQ4A 3WQ1A 1OLRA 2JENA 1NLRA 1XNDA 1BK1A 1UKRA 1REEA 1ENXA 3WP5A 2JICA 3RI9A 1UU5A 3AMMA 1KS5A 1T6GC 1W2UA 2Z79A 4HK9A 1OLQA 4HKLA 1BCXA 2DCZA 3VZOA 3WX5A 3MFCA 5EJ3A 1UU4A 1HV0A 3WQ7A 1REFA 1HIXA 5K9YA 3B7MA 1OA4A 1OA3A 2DFBA 3RI8A 4XPVA 1H4GA 3M4FA 2DCJA 2BVVA 2C1FA 4S2FA 1C5IA 3WXPA 2D97A 2JEMA 2VUJA 1HV1A 3AMHA 2B46X 2VGDA 3AMNA 1BVVA 1AXKA 1XNKA 1QH7A 3AKPA 3MFAA 2BWCA 3MF6A 4XQWA 1H0BA 3VZLA 1REDA 1XYNA 3VL8A 3WP6A 3MF9A 3VL9A 3WR0A 1QH6A 1XXNA 1C5HA 4NPRA 3WQ0A 1YNAA 1XYOA 1XYPA 2BWAA 3AKSA 2DCYA 1OA2A 2QZ2A 4S2GA 5HXVA 3AMPA 3VHOA 2VULA 4HK8A 4XQDA 1UU6A 1XNBA 2QZ3A 3B5LB 3VLBB 2B42B 1IGOA 3AKTA 3EXUA 3VZJA 3WP3A 1H1AA 1KS4A 3VZMA 3AMQA 3AKRA 3VHNA 2NQYA 2BW8A 2VG9A 4HKOA 5K7PA 3VZKA 3O7OA 4IXLA 1F5JA 2DFCA 1H8VA
chains in the Genus database with same CATH superfamily
1PGL1 2ADDA 5C3RA 1HRV3 4COVA 4N43A 3FE5A 2YGMA 4ZS3A 2JDAA 3MW4A 1U12A 2K46A 3HT1A 3VKOA 1UY1A 2O1QA 3HBZA 3VGIA 2ZGSA 4B1MA 5C7GA 3ZN5A 3N36A 5FWEA 2ID4A 2WJSA 4NRPA 3VKMA 2R30A 4Q4X3 4ARXA 1CZSA 1Y9QA 1XRUA 4PI0A 1LKNA 2N7GA 3MIHA 3OB8A 3ZN6B 1BEV1 2D98A 4FPYA 2B45X 4XETA 2GAUA 1NQDA 1KXGA 2Z69A 3HAGA 2VXRA 3ACFA 5FK8A 4AEMA 3H1WA 5HI0A 4MGZE 4CCCA 3O1VA 1YFXA 1RC6A 1G86A 3MW3A 3OEBA 4FPKA 4UWDA 3WVJA 4NROA 1SPPA 4LHLA 1TME2 5IFPA 2DF7A 1S0BA 3ZSLA 2JICA 4LO4B 3IT8A 5HV4A 2CGOA 1F4HA 3NKTA 1OQ1A 5K0UB 2BQPA 1G7YA 5FYYA 3AL6A 3IZOA 1NCRA 2E32A 1FXZA 2OPKA 2WAAA 4FP2A 1UPSA 1EAH2 3WNLA 4A3ZA 3KSCA 2VW0A 4FT8A 4AG4A 1F5FA 4D6SA 3WP4A 1S0IA 1JYVA 3Q8FA 3NV4A 5CISA 2W5FA 1REFA 4PI2A 4XFBA 3IAPA 3VBFA 3ZMNA 3BU7A 4K7JA 4KU7A 4CDQB 1V6OA 4Y26A 1AR63 2BVVA 1ENQA 3KGLA 4KMQA 3CZUA 5FK7A 1S0GA 2WA3A 2BVBA 4Q4X2 3MPBA 5FLJA 1GP6A 1LODA 1LHUA 4QB6A 3GZTB 2Y6HA 1HX6A 1U0AA 3AJZA 2WNVA 2W52A 2P17A 4NWVA 4R4ZA 1ZZ7A 2P6CA 4QPGA 5T5PA 3D3AA 4LLFA 1KDKA 2BWCA 1W8UA 1OQEA 4NJ4A 3ETPA 1NCQA 5JOXA 3ZO0B 3EMRA 3NQHA 4K40A 2VOVA 3BOWA 4D6RA 5BNNB 2WL1A 2RS32 1OVSA 4B4PA 1XNTA 2IXCA 1WWYA 1Z0HA 4LA2A 1HN0A 4YWAA 5FZ3A 1W6MB 1YYNA 1S2EA 3ALQA 3WDTA 4Q0SA 3BTYA 1MVEA 1UZWA 1XQNA 3A0KA 5FZ6A 3R4SA 4N7UA 2RJ2A 4Q4V2 1DHKB 1W2AX 4NHKA 1VRH2 1AR73 2AENA 2QDRA 3GHMA 5F3EA 4FBFA 1JYXA 2XGXA 4M3CE 2OYZA 3URFA 1UN1A 3I2FA 1OA2A 4PLNA 3JB4C 4OHZA 2VZOA 4AEDA 1ULOA 4N53C 4W8JA 1W0OA 4WM7B 2VCMA 3I3EA 1F35A 1TME1 4YFZA 1COV2 4FVVA 2DVAA 4NAOA 3FBMA 4CEWB 1HRI2 1UOJA 5H9QA 3S57A 4QXHA 1FI2A 2VW1A 5T52A 1LJ7A 1W03A 5FXZA 3JUUA 2VH9A 4QQOA 3VBHC 2Y60A 3VZMA 3EQEA 4QDQA 2FHRA 1EAH1 1SFPA 1T6BX 1V70A 1YQ8A 4DNYA 2RS52 2VOWA 2A6VA 2RG4A 1QQP2 1ZRIA 3OD0A 5FZCA 1S55A 5H9RA 4BYYA 5KHKA 2IXLA 4A6OA 4DOUA 2Q1FA 1H2LA 3T1MA 1QWRA 3R4DB 4DY3A 1PK6C 5CYYA 4K1YA 2WINB 4BXSV 1AX0A 1S2BA 1VBA3 2B5HA 1GZCA 3MYXA 4W4ZA 1UOFA 1AR72 1W6QA 1K5MC 3ORJA 4S2DA 5DZGA 3KMHA 3USUB 1OF4A 3BYWA 3LB9A 4QHZA 5EQUA 5EZWA 3KV6A 3ASIA 5F2SA 4AGGA 5BNOA 1DYKA 3ZSJA 2UYBA 4Y24A 4QD2A 3O1MA 1VPHA 1AYM2 2ZAAA 3AP5A 1JZ5A 1C1LA 3C3VA 1MZ6A 1MPXA 2EICA 1HN1A 1WMXA 1YI9A 1REEA 2RS31 3OYWA 4DZGA 5FWJA 1PX3A 1Y3TA 3POEA 2BJSA 4HVOA 1OF3A 5A7WB 2EIDA 4LORA 4M0HA 4P08A 1BK0A 1LAJA 3AMMA 4OI0A 1PGSA 2Y0OA 4A3XA 1DQ1A 1S0JA 1WW7A 3WNKA 4Q4V1 3HOBA 4UW5A 4AEDB 1D0HA 1VRH1 2WA4A 1DZRA 2TUNA 3MFCA 4YW1A 5HBAA 2A73B 3LZZA 4CSWA 1EPWA 1US2A 1FMD3 2HWD3 2Z4FA 3LAGA 3NNFA 4FPFA 5C5UA 1RUC3 1OA3A 4YG6A 1UIKA 2BUKA 2WS91 1PO11 1V9U2 1W2OA 1VBA2 2R1BA 2MNGA 1COV1 5J1XA 4QPWA 4V1PA 1HRI1 5FLHA 2VCCA 2VUJA 4DUVA 1H2MA 1LGNA 2R0FA 4AFDA 4HL0A 1DLCA 5FOJB 5JR7B 1HB4A 4DEQA 1YI7A 3VZNA 5K8SA 5D8AC 1GYKA 2RS51 3AXEA 4TLGA 5G05L 1QXJA 5A6YA 5DAPA 2ZZJA 2HKXA 2ERFA 5GZFA 1QQP1 3WNNA 1RUJ3 3K46A 5FY8A 5CIRA 5T5OA 2Y6JA 1DFQA 2XBO3 3EBRA 1QH6A 5FP9A 2D44A 5BNOB 2QVSB 1AR71 1RVF1 2DURA 2IXIA 5A1AA 5GKAC 4V2WA 3TNPB 3O0XA 2V4VA 2Q1ZB 4OCTA 2H6BA 1XYPA 2D7FA 3AKSA 1RUC2 4YGDA 3UKNA 5FZ7A 2XMLA 1AYM1 2X53S 1W9WA 2RMU3 2VZQA 1GP5A 3QBQA 1R1ZA 1HKDA 4M4RA 3LOIA 4FAHA 4XQDA 2JIJA 1S0CA 4EV0A 3LA7A 1JODA 5I91A 5FPAA 4F83A 4NO4A 1VALA 3VZJA 3JQXA 5JXIA 3IB3A 2CV6A 2PHDA 2VPVA 2YGLA 1VMHA 3OY8A 4LLOA 1C4RA 3T30A 2F17A 2XL7A 1ZA7A 1VR3A 3RVHA 5JAXA 2YC0A 1RUNA 2PLV3 4JGZB 4RFRB 3OG2A 2JG9B 2XKOA 1FPN2 1HJFA 2VG9A 1UW8A 2VQ0A 3I8TA 4MV2A 4P02B 5FZ4A 3CJXA 5C9AB 1UXXX 3UNPA 1JOBA 2DWRA 3RGBA 1O3QA 3EJKA 4ZU4A 1V9U1 1RL3A 3DGTA 2XONA 2XBO2 1LGBA 4D3WA 5DUXA 1U5YA 1H8TB 1OFSA 1VBA1 1IPJA 2Y8KA 3I3QA 4BHPA 5C3OA 2VNOA 2LALA 4YVSA 4J25A 2Q8OA 5IK8A 3SCHA 1UOGA 2NN8A 2E31A 2O14A 2CGPA 2GU9A 5CADA 5JIAA 4L0PA 4ZHNA 1QHDA 4AVTA 3HD8B 2RMU2 4Y5SA 1I5ZA 1X50A 4QB2A 1J84A 5A80A 1W0NA 3VUOA 4TZDA 1JYNA 2P3JA 5F8PA 4QQPA 1LENA 3PL0A 5J96B 3HWJA 5A3PA 4BH9A 3HNYM 4XJAA 4HSLA 2UY9A 1CX4A 4NAMA 4MO3M 5FJHA 3VBRA 5DZEA 1W90A 2CWMA 4UW3A 2PLV2 3OBZA 1ALYA 4LUMA 2CAVA 3ILFA 3VZOA 3N4MA 3WG2A 1UU4A 1RUC1 5KXBA 1AUYA 4M4PA 5EWSA 2XJVA 1HIXA 3AYEA 3WCSA 2BEOA 3ZFEC 4D69A 5FPBA 2HEYF 2YUEA 2WFF1 1PMJX 4AEKA 2PHTA 4BQXA 4DXRA 1G9DA 2C9KA 1C8M3 3MIBA 4Q8KA 5A7OA 1CJDA 1OKOA 1GV9A 2IUWA 1UNBA 2Y6FA 4ITCA 3SITA 3ZYBA 4Z2AA 3MLJA 2PN5A 1OH4A 5LW9A 3THPA 4ZZ8A 5HCHA 4ORFA 1PO23 1YFYA 2JJ6A 5C4WB 2VNRA 1FPN1 4QWNA 1GZTA 1MQTB 1UMZA 3SC7X 3KLSA 5LWBA 4XFHA 1NZCA 4C8DA 2XBO1 4EWDA 2DYCA 1KJLA 1PZ7A 4NMIA 5FZKA 3RJ2X 3ZYRA 2Y38A 3D8CA 2XH6A 4A6SA 1O5LA 4Y4YA 4Y20A 3O1SA 4WVWA 1DQ5A 3I59B 1J3RA 4A7KA 3ACIA 4PF1A 3BIEA 1SZBA 2RMU1 4LMFA 5AFEA 4Q27A 4YW2A 1UYPA 4S2GA 4D94A 3PNAA 3LEGA 5DMYA 1C8M2 5JLVA 5JPNB 1TQ5A 4AVBA 2FQPA 2HWB3 3DV8A 2H0VA 3LEMA 3GYDA 2R49A 3DCQA 5TSWA 3VV1A 1LOEA 5E1RA 4FPCA 2PHLA 3KB5A 4Q8LA 2HJIA 5CG9A 2PLV1 3J9SA 2Y64A 1LECA 1ST8A 1RXFA 1UXZA 3AMQA 4QQHA 4BCUA 1D7PM 2GDFA 1CX1A 1STMA 3KV5A 4ISRA 4OQ9A 4IW3A 2NQYA 2YDEA 1PIV3 5F9TA 4QXBA 5FV3A 1YQ5A 3I2DA 4IXLA 3U4XA 1SLCA 4Q0UA 3FFQA 3MIGA 2UU8A 4CU9A 3W20A 4KQ7A 4GWMA 5IJRA 1APNA 2P3YA 3C7OA 3FZ3A 1DQ4A 3LDBA 4BLIA 4BM8A 4BMEA 4YZ1A 3VDBA 5CA6A 2AH2A 3WUCA 5ISLA 4COUA 1VBB3 2VXJA 1ND3B 4E2SA 3KM5A 3O1RA 1L7QA 2XG3A 2GP3A 5GM0A 2V73A 2W0XA 3AVSA 2A6YA 2WNUB 1WW6A 2IWGB 3HIFA 4LUKA 2QCSB 3PUAA 4XUNA 5FYCA 5GZGA 2ARCA 4Y33A 2RDQA 4XBLA 1QJEA 5HCFA 2IC1A 5KC5A 5LK5A 1AJOA 3NV2A 3O0VA 1XNAA 1ASJ2 2VOTA 2FMYA 3VBHA 2D5FA 4Q29A 3SHRA 1XBFA 1RHI2 2W1SA 1OT5A 2EF6A 3GZUC 4ZS2A 3ZSMA 1ULGA 4FOQA 5FP4A 1W6OB 1QJX3 3VBUC 2HWF2 2VE1A 2KR2A 1GOGA 2YXSA 3BPSA 3WX5A 4AXOA 4BQ2A 1OC1A 2Z5WA 1FV2A 3M7AA 4OMDA 4RS5B 1OD3A 1VBE2 2RM23 4IEUA 5FPVA 1PK6A 2VL4A 3DF0A 1C8M1 3IBMA 4ISQA 5FY5A 4IEVA 4FPHA 4CCOA 1Q8VA 2DCJA 3LCPA 1JYCA 3IKWA 1W8WA 1K5MA 2YY1A 1J1TA 1NX9A 2J1TA 3NWKA 1YHFA 1S0FA 2NMOA 3M70A 2VZSA 2XHNA 3E5QA 3VDAA 1NCQC 2VCAA 5ANNA 3VKLA 1LGCA 2OQ6A 2QQUA 4YPJA 4ARYA 4R4XA 4IV3C 4YGCA 5FZMA 1LOFC 4AFCA 2DU0A 3QACA 2D6KA 5JI9A 4QPYA 3WF1A 3KV9A 3FLTA 4XQWA 4P5HA 4EE2A 2YHJA 4XJ9A 3N35A 4AHYA 1REDA 4LOTA 2XDVA 4CP9B 1FV3A 2XVLA 4WV8A 5HPOA 2VUAA 1LEDA 2NYYA 1QJX2 4O7XA 4MXWB 4GJYA 4LBJA 1ZZBA 4N53B 2VM9A 3K4ZA 3R0RA 2JKXA 1YNAA 4L8QA 4XHBA 2B9VA 4TTGA 4YZ3A 2E53A 1MS3A 5FYBA 3HNBM 4L97A 1GZWA 3ZMOA 4LBNA 1H2NA 2YG0A 3K3OA 4HK8A 5D1IA 5EHDA 3VD7A 3WLUA 3IMNA 1GQPA 3K75B 1V6IA 2AACA 4CCKA 1UY3A 4DY5A 1ASJ1 5JXHA 1KGYA 3NJZA 4GMP0 1UL9A 2P34A 2ZX0A 4LBQB 3CHXA 1E57A 1RHI1 4XCBA 3WW3A 2CHHA 3QLQA 1R083 3IM0A 1XU1A 2G9ZA 4XUPA 1MS1A 4LO6B 5D8AA 3W9AA 4COZA 3ZYJB 2HWF1 4EN8B 1RJ7A 2DUOA 1PK6B 4RYDA 3IDAA 4MGIE 2GNMA 2P3IA 2A71A 3LPFA 4IESA 2OZ6A 4XJWA 1POV0 1QGLA 1VBE1 2JIGA 4ZPIA 4UFIA 4CU8A 1QJY3 2B8MA 1FATA 2PFWA 1W2NA 2UWAA 1E5HA 2R7EB 2VVDA 1Q8OA 4U2AA 4AI8A 3GGLA 3ZFGC 3M3QA 5FBZA 2GNDA 1NA1C 1DQ2A 3GNEA 4BWOA 4FTEA 3QCWA 3SKVA 1W9YA 2A1XA 2MEV3 2WYSA 5DABA 4ES9A 1AL0G 3KQ4B 1UPIA 4XQ4A 2VCBA 4TXWA 1W2TA 4JGYA 1GICA 4AE2A 1SBDA 1ZBA3 1QDOA 5LA0A 4R52A 3RG0A 1VBD3 4MOAA 4YM2A 1ENXA 1KITA 4IETA 3Q8BA 3H50A 3FWEA 5FUPA 1R082 3INAA 4ZKTB 2DBIA 5BV6A 4YVWB 3UK9A 4UBGA 1OLME 2Z79A 2UURA 1X9TA 4N90A 4LHNA 3DKQA 2FMDA 2GMMA 3MIFA 5K4LA 1KDMA 3MLLA 5IK5A 2D5HA 1GZWB 3CQOA 1HB1A 1KEXA 5FYMA 2HBUA 1NYWA 5AVAA 1A8MA 3W5NA 1YJLA 3M4FA 1UZZA 3IPVB 4BISA 3B94A 1SLIA 4P00B 4K6BA 4QX5A 5FZAA 1RUE3 2QQVA 2WR9A 3DUIA 4QPIB 1CAXB 5HCBA 4A44A 1K5JA 4Q4W2 4S2FA 3N7MA 3U4SA 3T4HB 4LK6A 4IL7A 1IQDC 1O8SA 1Q8SA 2JDYA 1IS3A 1IG0A 1UIJA 2PTMA 1UYXA 4GQ7A 3JCIA 4MHUA 4NHMA 1ZBA2 5ABJC 1UX6A 2JG8B 1Q3EA 3AX4A 2BV4A 5A7QA 5DXDA 1ND2C 3U0ZA 2TBVA 4P14A 1ULDA 2NPIA 4CDXC 4E4SA 5AC93 1CONA 1OFNA 2E7AA 2OQ7A 4KWLA 3LOBA 4OFGA 1UQXA 2BNNA 3LDKA 4OMCA 3ZXAC 1VB2A 3H3ZA 4YM3A 5CFCC 1JS9A 1CQ9A 1H9WA 1MZ5A 3KGZA 4DUXA 5D2AA 4Q4Y2 1XXNA 3WD5A 5DZFA 3WG1A 1WBFA 2A3YA 1GOFA 4XUQA 4I0AA 5T5LA 1AL23 1OOPC 1SBFA 5IVBA 1TZOA 5JZGB 4QU1A 1O3SA 2ZGKA 4J1XA 5H9PA 3ZFEA 4AK3A 5DDJ3 1IPKA 1LOGA 1XJAA 4ATEA 5I0SA 5KBFA 4JKMA 1ODMA 5DQ0A 3V56A 3AMPA 4PDWC 3VHOA 4MSVA 4HFSA 1DBNA 4PBPA 2D6PA 2VUDA 3FFZA 2BTVC 2R6QA 3KT4A 4FFHA 1EP0A 2VECA 4PLOA 5IWFA 4D7SA 2YBPA 1OXCA 4HT1T 1IGOA 5ACA2 2VMCA 3IWZA 5FZLA 3OF1A 4LIUA 4C0BA 2BGOA 4DXZA 1ZZ8A 4NVPA 1RMU3 4C1WA 3A0NA 3DPRC 2L9LA 3B9CA 1OH3A 1QIQA 4XF1A 2WWJA 4IEWA 4IGQA 2E7TA 1HB3A 4QM9A 5AC92 1IKQA 5J09A 2O0OA 3WHUA 1RUI3 3KVAA 5EXOA 2FD8A 2DCTA 3I49A 4JCKA 2RVAA 2E63A 5LBFA 1HQWA 4HKWA 4JRAA 2QQJA 1CD3G 1GNZA 3OBAA 4OHVA 2J1AA 3CJIB 4OYUA 4Q4W1 2WC2A 4UBHA 5A7PA 2OKXA 4JHTA 1QJU2 4CDUC 1R093 3AKQA 4URTA 4Z8BA 5FZ1A 2XQXA 5DDJ2 1ZBA1 3E5UA 5C3SA 3WQ1A 2VU9A 2YU1A 4DMIA 5A3TA 1I5PA 1LU1A 2RJLA 4CXWA 4OI2A 3WG4A 3J26N 5J36A 5KHGA 1ZRCA 2QKDA 2WFPA 4IDZA 3J8F3 5EIYB 3CF6E 2CWSA 4IEOA 1J58A 1I6XA 1W99A 2FZ1A 5FXVA 3WW4A 4PF5A 5FREA 5CU1A 5FXWA 5FYSA 2G9GA 3N9MA 4LBKA 3VDDC 3ZIWA 4BJ0A 1T6GC 3AP4A 3GHNA 1HB2A 4M3CF 3OGVA 4Q4Y1 4HK9A 2VQTA 5FZDA 3S30A 1X36A 1TEIA 3ZX7A 4LQRA 3BIWE 1IS5A 4M3CB 5FKCA 1QDCA 1B35B 1MVQA 1D4M3 2OZJA 1S2KA 5KXEA 4CP2A 1BMV1 2QQMA 3GJBA 4CUAA 4B4QA 1X7NA 2Y0IA 4MG2A 4RHV2 3T2TA 3MBWA 3C8XA 2P5BA 4LKFA 3AL5A 3JD72 3TNQA 3ZPOA 5LRSA 3JB8A 4UFHA 4WBBA 3CL1A 2D97A 2VQUA 5ACA1 1NE4A 3KCXA 2R041 4Y1VA 2ZCWA 4DPNA 1KJRA 5CKMA 4GH4C 2VJXA 2WBKA 3WNPA 2FDIA 2V09A 2ZGQA 2MHFA 4ZY9A 2WZR2 3KVBA 2IFWA 2WT0A 3J8F2 1LOCA 2X5IB 5IATA 2PHWA 3K51A 2B39A 1JI6A 3ZXDA 4AGVA 5I0TA 4DRRA 2JDPA 3T0DA 4QKFA 1J1LA 4LBLA 1D4VB 3VBSB 5LEKA 3POYA 1HRV2 1ZZ9A 1GU3A 3VBUA 4WM8B 4XXAA 3WR0A 1WA4A 5C8CC 1QJU1 5I8YA 1V6NA 2QQOA 3PHMA 5GZEA 2JDNA 3ZVXA 2ZEYA 5FRAA 4PCRA 4A4AA 4XF9A 4Q1RA 4Z1VA 1KRIA 1IQAA 1WA6X 2YYOA 4XILA 5FY0A 2PAEA 4NHYA 4AI1A 3APBA 3DYOA 3LA2A 4AHZA 4ZXEA 3PUQA 2VZRA 2RR13 1UU6A 1RUH3 3ATGA 4IUGA 1IS6A 3M3IA 4SLIA 3VLBB 3VKFC 3BOPA 4N43B 2VOKA 1LHOA 4ZONA 3BCWA 4DRVA 2ZGNA 3IDBB 1BZWA 2EXKA 3ZPYA 4IV3A 1KS4A 1HLCA 1LOFA 4XABA 3ZXLA 3ZYPA 3ZXGA 2ES3A 4XUOA 3UL2A 3GBWA 2HWE3 2D3RA 3GF6A 1RIRA 3UT0A 5FZ9A 2K0GA 1W06A 2NMNA 2QTWB 1VLNA 2PA7A 4P9GA 1O6UA 2DFCA 1H8VA 2XUMA 3D4KA 4RHV1 3LIGA 3TB0A 1SBEA 1ENSA 2AEYA 3LFIA 1SPPB 3JD71 4PBOA 3KHBA 4PQQA 4HOOA 1N1TA 2JE7A 4LPLA 1AR62 3H9AA 4GMP3 2FCVA 3GJAA 4L9BA 1I1EA 1QKQA 3T0BA 4F7ZA 3MW2A 1UZYA 1QXPA 2R16A 2UY8A 3PLQA 3NW4A 2F6BA 4RR3C 2JECA 3FHIB 2QBXA 4A7YA 2ENRA 4FPEA 5GALA 1NCRB 2A7AA 5FCCA 3S0MA 3C2UA 3GBFA 1W9FA 2WZR1 3KWVA 1O4TA 1XU2A 1PHMA 1W6PA 5BNQA 4FPOB 1POV3 4OZXA 4UOJA 5DG2A 2UYAA 5BY5A 1RUH2 2XB6C 3QH7A 4KBZA 5DAWA 3VBFB 1ZZ6A 2IVIB 2GP5A 3HEIA 5KXDA 1LR5A 1PX4A 2BOIA 5HV0A 4FOVA 3KF3A 5KR7A 3E6DA 1HRV1 4O61A 1PZ8A 5A1FA 1BQPA 4CCDA 1TG7A 1W8TA 3OTFA 2HWE2 1S4CA 2VZUA 4BQ1A 2BNOA 5F6LB 2Z2SB 4IV1C 4Q4X1 4UF0A 1UOBA 2WNVB 3GZEA 3RPQA 4CPBA 4PIXA 3T2QA 3O1PA 1DZQA 1E5SA 1HV0A 3JQWA 1O91A 4L92A 4MGQA 4QPGB 2WWSA 1OSGA 4XEZA 1NCQB 4GKXA 3D0SA 3I97A 2W46A 2BFUS 1DGRN 1HJGA 1QOSA 2LM3A 4UFKA 5FP7A 3WDVA 5BNPA 4MHRA 1NA1A 3FBYA 3K48A 5HCAA 3J7MA 1E5RA 2WZEA 2VTXA 3Q8CA 1OUXA 4R8HA 4BQ5A 3FN9A 4GIQA 2ET1A 2Y33A 4NIAA 3T09A 1WMEA 4R9AA 4KWJA 3UGHA 3ZYIB 1QY4A 5T3NA 1BVVA 3PMSA 3LFMA 4QKDA 1N1SA 1G9CA 3ES4A 1XE7A 3TYJA 1SDDB 2P4EA 4I09A 4KG0A 3PUHA 1B09A 4NUBA 1O5UA 3OSDA 5E16A 5FBJA 3WSOA 4RQPC 3ZKYA 1DQ0A 4CUBA 2W94A 4NOTA 5FYUA 1AR61 1BBT3 1AR83 1CAVA 2JD9A 2VMGA 3I3BA 4MGKE 4XAAA 2Y6LA 3JXSA 4EYUA 3P6BA 3MF9A 3TEYA 1X33A 4K9SA 1C5HA 3WW2A 3D0JA 3CLPA 2JDUA 4I0BA 1JZ2A 3KT1A 1JHJA 4N7IA 5C70A 3MUY1 2W87A 3EYPA 1CAWA 1D2QA 1HXS3 1VMFA 1ZZCA 3PJQA 4AQ6A 4LBQD 2Y26A 5SV5A 5JUVA 4LULA 3SCGA 2R1DA 4E4ZA 4Z2WA 1RUH1 3OGJA 4FPJA 4LE3A 2E7QA 3ABZA 3DYMA 3H7JA 4D7TA 2W1UA 2J1RA 3TBDA 1W9TA 3PVBB 3HJRA 4IGOA 1QF3A 3SLIA 3HMYA 4MGSA 2J1SA 1VBC3 3WDWA 1RJ8A 1GBGA 3EXUA 5ABJA 4UF0B 5A32A 5IAVA 1ND2A 1LHWA 2HYKA 1NY72 1W6QB 2RS13 1ZRRA 2XKPA 5A6ZA 4CDXA 5KHJA 1ODNA 5JVVA 2DVDA 5J37A 1K45A 2AREA 3NL1A 5B2GB 1RXGA 1C3HA 1WMFA 4H14A 1GMMA 5FY9A 1FMD2 1BBT2 2HWD2 2JXAA 2QE3A 2Q8CA 5CFCA 4OHYA 4D0QA 4AVAA 3ZFFC 4Q0VA 1RUD3 2XXZA 1QOTA 1VRBA 3OYWB 5FPLA 2FDJA 4JGYC 4B1LA 1OOPA 3MLKA 4BQ4A 1YQ2A 3DN7A 2DCKA 2W1QA 5J98B 3C7EA 4XMIA 4DEVA 4X8NA 5EV7A 5F5AA 3WUDA 3WZ1A 2DUPA 1C8NA 4JX0A 5LA1A 1TE1B 1Q5OA 1WGPA 3GALA 3H0OA 3K3NA 4PDWA 4NIIA 1Z7S3 4H3WA 4XUTA 3WF2A 5BYNA 5JPMB 5IT6A 2OXBA 1VMJA 4XZPA 4C90A 4FQZA 3TOJA 1YQ6A 3FHAA 3ZLIA 1RUJ2 2ZJCA 4DXSA 4P9JA 3EO6A 1DGRA 1NT0A 4HVQA 4MGTA 4PJYA 1XPWA 3MIDA 4XFGA 5JMOA 1LB2A 2XHKA 4I02A 3DPRA 2BBAA 4UFMA 4HVRA 3GDBA 5FLIA 2RDRA 1NE6A 4COWA 4KBBA 5BUVA 3RYKA 3CU7A 3WDUA 2Q30A 1DIWA 1MZEA 1PMIA 4EROA 5K9YA 3ACHA 4OHXA 2X10A 3SH3A 2VTXJ 3AVRA 1AR93 1UZ0A 2DTYA 4INDA 5EYYA 5I93A 2XJQA 5CVRA 5ABJB 4CDUA 1QJZA 2C1FA 3AYAA 4MVTA 3KCYA 4XJ8A 2JDHA 1PVC3 5EYXA 1R1A3 1ND2B 5A1LA 1JZ8A 5LY1A 5BXXA 1SLAA 2AYHA 1Z78A 3O12A 4NIDA 4CU6A 4KG8A 3UV9A 1N1YA 3CZJA 4OUEA 4XOGA 5AVPA 1EV13 3ES1A 5DG1A 1DG6A 4BZ4A 4AOCA 1AXKA 1PZ9A 2WO2A 4JQTA 4XIKA 1GNYA 1TMF3 3MFAA 1W0PA 5FZOA 3N9PA 1FYUA 2JB4A 4GAZA 2Q5TA 1C1FA 1FMD1 2HWD1 4HANA 3HT2A 3SH5A 2BFUL 3AZYA 3HPNA 3SNMA 3UKVA 3VDDA 1LESA 3WNMA 3I2KA 5L7OC 1JW6A 1MS8A 1D2SA 2XVKA 4G3YC 4XYXA 4CCEA 2OW4A 3O1OA 2VVEA 2B4KA 3VL9A 5DUWA 4C91A 1UX7A 4NPRA 3NAPC 4QX3A 1JN2P 4DUWA 5JOWA 5E89A 3P3PA 3WQ0A 3DYPA 3EB7A 4H55A 4QX1A 3OY8B 2JKBA 3AP9A 5F5IA 2EAAA 2XQRA 2ZX3A 1YWKA 4QXKA 3SKJE 5C5TA 3RZHA 2PHUA 1X8MA 3UETA 3LSEA 1FNYA 4MXVA 5HXVA 3C7GA 1PVC2 1RUJ1 1CIYA 4YARA 3DPRB 3GM8A 2A70A 4Y5Z0 3RQ0A 2JE8A 3VD5A 4GH4A 3HR9A 4YVSB 1QXRA 2DTWA 3DXUA 2VZVA 3OGGA 3GBGA 4RFT0 4HN1A 1LRHA 1CAUA 2KM2A 2JDMA 2RDNA 4I30A 1TVGA 2FDGA 2WT1A 1WCDJ 4Q2FA 3MIEA 3UGFA 5GZDA 4LEJA 2BW8A 3R4UA 1GQHA 4NWWA 4CZSA 4J1WA 5CZKA 4DIQA 4JZRA 4CDUB 2E33A 1SLBA 2OA2A 3MHZA 2AEZA 1DF0A 3WF3A 4V2VA 5C8CA 2PMWB 2ZX1A 1DDLA 4AI0A 3ZM8A 5JWPA 4RGGA 3ZKUA 4YW3A 1K12A 4IEZA 4KU8A 1A8DA 3VBRB 2CGNA 5A7NA 3TAYA 5FPUA 1FOD3 5K0UC 3JZVA 4LO8A 4Z92B 2CTVA 2WQZC 3OUIA 2XL9A 1W04A 3I2JA 3WDYA 1PO22 1QNYA 4QKNA 3VDDB 5FZBA 1ZREA 1BK1A 3WHTA 4EWEA 4BOWA 2FDFA 5FP8A 4AVCA 4CDQC 2W39A 2QQKA 3SEEA 4E8DA 5FZEA 4RGAA 3Q8EA 1OLMA 3ZXEA 4UXAA 4BQ3A 2XPJA 4QAWA 1MEC3 4L11A 2E6VA 1A6CA 4NPMA 3AB0A 5EJ3A 1L3JA 1CZTA 3WNOA 2DBNA 4F8AA 5FMOS 4LOSA 1HQNA 4AQTA 2ZAHA 3RDIA 2VZ1A 3F2ZA 1R64A 2VC9A 5I8SA 4OUMA 2HWB2 2HWC3 4RR3A 1SLTA 1MZFA 4AQSA 1SMVA 1WCSA 3DL3A 4EN9B 1CAUB 1NLSA 1YFWA 5LBCA 1LOBA 1WMDA 5JOYA 5EJ1B 4B7KA 2IXKA 4EJRA 4GB33 5FQ0A 3BTZA 4Y20B 1WW4A 1XE8A 2ZGLA 2B46X 1RTVA 4Y22A 4HPKA 4BB3A 1H2KA 4TWTA 3ACLA 4E2QA 2WO7A 1V6JA 2R073 4ZU5A 1XNKA 4BLJA 1QH7A 1V00A 3B01A 3MPPG 1NQJA 2YZ4A 1FT9A 1PIV2 1Q8PA 2A75A 2D6LX 4XF4A 3AK0A 3VD3A 1ZRDA 1G9FA 5LY2A 3ECQA 4WM7C 4CP1A 4R9CA 3T2PA 1MS5A 4IV1A 1MEC2 2GALA 3B02A 4Z07A 4CEWC 3THDA 3POFA 2ZBJA 1MACA 5F5CA 2LTNA 4YZ2A 3ELNA 5C33A 3BUCA 1VBB2 1URXA 3KF5A 2R063 4XMAA 2BWAA 2HYXA 2ZHKA 1CVNA 4CXXA 4CYDA 1RB8G 2YPDA 1PO21 4BXFA 3POGA 3W21A 1WLCA 2YFZA 5IAXA 4NN0A 1W8OA 1G9AA 1OMIA 2GC1A 4OLLA 1XNBA 2QZ3A 4LTAA 2W2IA 2C0ZA 1VP6A 3H42B 2FCTA 1CPMA 1LHVA 5FYHA 5JR2A 2TNFA 3P1IA 2IXHA 2NM1A 2XUEA 4XURA 3OGSA 5E88A 1A3KA 1FAYA 1LCLA 2Y6KA 1O59A 3MEPA 4RN5A 4RQPA 3N3HA 2XJPA 2FBEA 2A3XA 3GCXA 3V65A 4MUVA 4RR3B 1VE0A 2RM22 2D3PA 2VMFA 3LD8A 3ZSEA 4TYSA 2PELA 4NRMA 3ZIXA 4NHLA 2HWB1 4K1ZA 3J7LA 2WN3A 1YJKA 1G6NA 3DKWA 3B9IA 1P8JA 3ITQA 3KZ4C 4WZFA 5LA2A 1GSLA 3SMHA 3VBHB 2R32A 2R062 5JI7A 4BK5A 3USSA 3S6PA 3SXWA 4YYOA 2P3KA 2ZPXA 4PHZA 5F32A 1PVXA 1GWLA 4PIZA 5L36A 2LS6A 5IVCA 1IOAA 4HN0A 1NLRA 3UGGA 3PVNA 1A34A 3JBG3 1RUG3 3H3UA 5FYIA 1PIV1 5J7MA 1H1MA 1PMHX 1HQLA 1HW5A 2ZHNA 3LWCA 4W6WA 1WZXA 4DQAA 2C6SA 3GCWA 1JTZX 5EP9A 3RI9A 2DUQA 1K5MB 4LBOA 5F3CA 1UD1A 3OD4A 4TLFA 1ENRA 4HKLA 5A33A 1VBB1 1BCXA 4AYUA 5BNPC 3NVCA 2GMEA 3U37A 3MICA 3PIGA 1YXWA 4QHBA 2KXLA 2ZMLA 2ZABA 4Q1PA 5DPNA 3X29B 3ZFFA 4EN6B 5J48A 3C7HA 4CUCA 1JZ7A 3ENRA 1H4GA 3HN1A 1IZ3A 3AP7A 2ZMNA 3S7IA 1POQA 1W28A 3OGRA 5GLZA 3WQBA 2ZX4A 2B9UA 3V0AA 1U5XA 2BGCA 4CP0A 3S5AA 2CDPA 1X8EA 3B00A 4RD7A 5F5QA 5C6CA 2EIBA 1HV1A 4ONUA 3AMHA 1F15A 4OHWA 1QJX1 3LSDA 1BLZA 1L7LA 3M3OA 3NRUA 3FHQA 4IE6A 1Y7BA 4P9IA 4YG0A 3TEWA 2A5ZA 2IVJA 2ZXQA 5FMOL 3ZR6A 3U78A 4D8MA 1W8HA 1OKQA 1H0BA 4U36A 1GP4A 2RM21 2XLAA 1GLHA 1QJY2 2LW8A 3HQXA 3MDPA 3QD6A 4UFLA 3F95A 4MZUA 5JDBA 5JMCA 1XYNA 3OPTA 4YG3A 1WBLA 3BODA 4ET7A 4HONA 3KHCA 2WLQA 5F3IA 2SBAA 3WP6A 2FCUA 2VAUA 4LA3A 4LO5B 1JUIA 4I01A 2WABA 3WW1A 5IYYA 4MLOA 1NKGA 3MO4A 3AFGA 4EZ4A 1YRZA 2MEV2 5D8AB 5FZ8A 5A3UA 2PHXA 4E4DX 4MGYE 2UWBA 2DCYA 1CIWA 4JGZC 1VIWB 4Y1UA 5FIXA 1I3HA 5C9AC 1DCSA 2A6XA 1Y9GA 4XIOA 1VBD2 4EZHA 3B5LB 1BKZA 5FO7B 1H8TC 2WUHA 3AZWA 1PM7A 2YBSA 3DECA 4WVZA 4RL7A 5A6XA 3SEPA 1ZM1A 1RINA 1ZX5A 3AKRA 2XJTA 4XW3A 2W9XA 3BTAA 3ZFFB 4EQVA 5JCTA 3ILRA 4WZCA 5E6HA 1T2XA 4CRQA 3LF7A 4JGYB 2BOJA 4Q5OA 3ZXJA 4YFWA 1JXNA 1UZVA 1F5JA 4A7ZA 1YC61 5L7OA 5H9SA 1OBNA 2ZOEB 4WVMA 3A21A 4CUGA 3NAPA 3KQRA 1RUE2 4NR1A 4B8EA 4A41A 1QNWA 2X09A 5L9RA 1WLTA 2XWBB 4QMAA 4FOWA 1QU0A 2Z42A 2VNVA 4XCAA 1R081 2WYFA 3I3MA 1NXMA 3BU0A 4IEXA 4YLZA 2F4PA 3LEKA 4IE0A 2JENA 4XDPA 3VKNA 2ZKLA 1JYTA 2LUWA 3OJBA 2V5YA 5B4NA 4CCMA 4I2OA 1K42A 1YIFA 1JU3A 1QJY1 2G1MA 3S5QA 5EFUA 4R9DA 3M2MA 4LE4A 1J83A 4HG6B 4LXLA 3E6BA 3TWIA 4LO7A 5EPAA 4CDWC 3T2OA 3WINE 3ZN6A 3V64A 4YGEA 4GJZA 2AZ5A 3AFKA 1CZVA 4AGRA 1AL22 2MEV1 2HH9A 1Q8QA 2PXJA 2WDBA 2WO1A 4XACA 3BI3A 5I0UA 3LEIA 2OIIA 5C4WC 2TEPA 3H3LA 2JDZA 3RI8A 1FNZA 2DFBA 4O9EA 4XF3A 4P9LA 3NNGA 3MGUA 1MQTC 1YO8A 1GWKA 1VBD1 3KD4A 1LHNA 4META 5D21A 1JYIA 4QM8A 1AX2A 5A3MA 3AC0A 5K0UA 1C5IA 4XVHA 3AZXA 3CKHA 2D6NA 2P37A 2EIGA 3VB9A 2JDKA 2VBPA 2VGDA 1SACA 5FMCA 4BQWA 3KCCA 5L73A 1RMU2 1PNFA 2K9ZA 2ATFA 4IQPA 2ZHLA 3ZFEB 2P2KA 1V6MA 2QUOA 2J1UA 3MF6A 4QB1A 2PAMA 4CDQA 4GWJA 5LB6A 2X05A 1TME3 3L9JT 2VZ3A 4BA6A 1RUI2 2CAUA 1AJKA 3ZDSA 3M3CA 4HETA 1RUE1 4N9IA 3K2OA 4FQ4A 3IIIA 1GQGA 5HXMA 3LA3A 4E4HA 2GN3A 1EAH3 3L2HA 4HMZA 1R092 4N8MA 1GNHA 3FJSA 3CEWA 3ZYHA 4B29A 2D40A 2YV8A 4M01A 4MYEA 4AFBA 5JIUA 4HLTA 4UYBA 1GUIA 2VZTA 5BNNA 2GN7A 5FJKA 2JE9A 3OOXA 5T50A 1XE0A 3B93A 5AC91 4P9WA 1W6MA 1QMJA 1W8NA 2DVGA 2GMPA 4CU7A 4KGQA 1CJPA 4B3NA 5C3PA 5F7UA 1SG3A 1RITA 4KL1A 1I9RA 1ZYBA 4UW4A 5T54A 2ET7A 4OZOA 1ND3C 3UYJA 1AL21 3VHNA 2Y6GA 3N7KA 4ZXKA 1OHFA 3I54A 2D3SA 4XAEA 1F8VA 3SH4A 4IE5A 5DDJ1 2D6MA 1D4M2 2WNUC 1ZNPA 3VZKA 4WM7A 3WNXA 2CY6A 2RS33 5LRRA 4HZFA 1WKYA 3PUIA 3NJVA 2XJRA 3ZXFA 2DV9A 4CEWA 4XJZA 2JB8A 3CO2A 5A3WA 3NJYA 3H8UA 3RFRA 1M4WA 1ULPA 2HBTA 3I4IA 3T08A 4E8CA 4AI2A 4CA9A 3PDQA 5LEJA 1TNRA 4URAA 1KFUL 4Q4V3 4BIOA 1VRH3 2WNOA 4AW7A 4MX3A 1NLQA 1QJFA 1RMU1 2OS2A 4A42A 2GC0A 2E51A 2ZEZA 2ADEA 2BP6A 2WS93 1PO13 4JV4A 3BGAA 4FTSA 4RS5C 2NZ9A 1COV3 3SQOA 1AXYA 1RUI1 5L9BA 3DXTA 1LEMA 3CIHA 1HRI3 4Q0QA 2PQSA 1RYYA 5GLWA 3WP5A 1UKGA 1U5IA 1SHWB 1UU5A 2Q4SA 4PLMA 1LNSA 1KS5A 3USUA 1PM4A 4OULA 4PIYA 3J7HA 4Y3OA 1C57A 1R091 4AZZA 4QX2A 2VBBA 2RS53 1N1VA 2WSUA 2VNGA 1QQP3 2C5DA 2YC4A 5FXXA 2EXIA 2FDHA 1RUOA 4Y5TA 2W95A 4XPVA 1W9SA 4Z82A 5FP3A 3IDCB 3P3NA 3N9QA 5A7WA 4TSVA 3J8F1 4XFAA 2ORXA 2RR12 2ARAA 4L99A 3U14A 2D43A 3QOPA 4I3PA 3RZGA 5AFBA 3NV3A 3GZAA 1RVF3 1VAVA 3K4AA 2XR4A 3NMBA 2JX9A 3CNAA 3JU9A 3PMEA 3VBUB 2WRAA 4QGMA 4G4FA 4DO0A 4EWAA 4F3JA 5I8TA 1EUUA 2WS92 1PO12 1AYM3 2AGSA 1DLLA 2ZGPA 1AVBA 3AKPA 3FC0A 5FY1A 3R6SA 2ETEA 3RZZA 1D4M1 5GJ6A 3MZHA 3NNMA 2XJSA 1MS4A 3UJOA 1V6KA 1O4YA 3VZLA 4H7LA 2PHFA 5FKBA 5CFDC 3C7FA 2VQAA 2GC3A 3UESA 5FY4A 3U75A 1IHMA 2RDSA 2VMDA 2EVXA 1PGW2 1YEWA 1OPOA 3OUHA 3MUZ1 3PJYA 3RNSA 2YBKA 4CCNA 4CCLA 4IV3B 2HEWF 3P5BA 3ETQA 4K8RB 3U1XA 5FZGA 3N9LA 1QOOA 1XC6A 2QZ2A 2WQ4A 1X82A 4GKYA 4B7EA 5JSPA 1V9U3 4O9GA 2W92A 4QT6A 1US3A 4R9BA 5CB7A 4AL9A 3I2GA 1DZTA 1S0EA 2F4LA 2XLFA 4XBQA 4ASKA 1V6LA 2MPFA 1RVF2 5APAA 2VVFA 1CPNA 1VAKA 2YB7A 3L2YA 4C1XA 1WD4A 4FO9A 2EXHA 5CNAA 4J6GA 4D6QA 3PU8A 5FZIA 4AF9A 2VD7A 2WSVA 4UI9L 2HEVF 4M0NA 2NP0A 4ZU7A 1EUTA 1WCKA 3S7EA 1O7FA 5IK4A 2RV9A 1ZRFA 2WQ8A 1W6PB 3VHRA 2JD4A 5K7PA 3PTRB 2ZGTA 5A6QA 3NKGA 3Q8AA 2BU9A 1SFYA 4AI3A 2NLRA 4S2HA 1GWMA 2J7MA 2RR11 4X6RB 5FZHA 2BYVE 3BTXA 2VW2A 4JDNA 1EPZA 4FP3A 3WF4A 3ZYGA 3LIHA 2OPWA 3RZLA 3TRSB 3FL7A 4QDSA 4YVWC 5L19A 2ZGRA 5LATA 5IVVA 2VMEA 4IERA 2W08A 4JGZA 2JG9A 5IHRA 2G4IA 5C9AA 3AZVA 4DFSA 2EIEA 4JTOA 3POWA 2HWE1 3E1F1 4GA9A 3UKTA 3D5OA 1DGWX 2WFF3 3BPZA 4BE3A 1UKRA 1H8TA 1QEXA 3FMGA 4LBMA 3RYRA 3W59A 3ZFGB 5BNPB 3AM2A 2QQLA 1XOYA 4AAXA 1NA1B 4XFFA 1AR82 1GFF2 2QJVA 4QPIC 4GMP1 1WW5A 2P1BA 2UWCA 5KWRA 5IVEA 1PGW1 2OT7A 3RS6A 2D93A 5A3LA 2AR6A 1AYN3 2XOMA 1SDWA 3E97A 3LQCA 1O3TA 1FPN3 4SBVA 4IEPA 2KD7A 1HXS2 2JG8C 5FOBB 5I0DA 5LBEA 2ORZA 5FMDA 2AUYA 4AHWA 4C0HA 2W3JA 3RZKA 3J4UH 5J3UA 1POV1 1OA4A 3B7MA 5FMBA 1G8WA 3D82A 5IW0A 1IKPA 1MR5A 5LZ6A 5F39A 2CNAA 4QGNA 4QKBA 1CAVB 3FX3A 5IVFA 4XXPA 1OURA 3PIJA 3AZZA 1SCSA 3M1HA 1VBC2 4GXLA 2BERA 2V5DA 3O14A 3FUOA 3U07A 2EA7A 2IFRA 4FAGA 1DGLA 4AEJA 1ZBE3 5JZGC 2RS12 4DINB 3A23A 5KHHA 2WFF2 3NSTA 4IEQA 2A6WA 1CAWB 4WVVA 2GC2A 4NHXA 4FSJA 3OPZA 4G9SB 3NJXA 2WIIB 5LASA 5IFTA 4RA0A 4KI5M 5G04L 2ZX2A 4AFMA 3B69A 2YMZA 4NIGA 3NV1A 2WLPA 2I07B 4CDWA 3A4UA 2GZWA 1Y9MA 4QXCA 3VBOC 3M8LA 1RUD2 1AYN2 3KS7A 4KWKA 1LTEA 5T5JA 1O3RA 2KA3A 1NG0A 1WCUA 5A32B 1UO9A 3N7JA 4ZZ5A 3RZJA 4NRQA 5C4WA 4A45A 4GWIA 1AF9A 4YW5A 4CDXB 1E5IA 4I0WB 1MQTA 1Z7S2 3OCPA 4FXGB 1NY71 4LKDA 4P9YA 3AYCA 3R05A 2VULA 2V4AA 2GSYA 3POSA 5CFCB 4PT6A 1BYHA 2OVUA 4CCJA 1N47A 1BBT1 1AR81 2B42B 1VB4A 2WKKA 3KT7A 2VZPA 1F4AA 1H1AA 1W3VA 1OOPB 1ZBE2 3CJIC 1SLLA 3A22A 3BKZA 3I59A 4MH0E 4E2GA 1VJ2A 1AZDA 1DYOA 1W3XA 4Y1ZA 2Q1MA 1HXS1 3AJYA 5A7SA 4PDWB 3Q9OA 3PUSA 1OQDA 2ZGOA 4FXKB 2BDRA 2ZEWA 2WN2A 3NO8A 5IUQA 2QQWA 2OUJA 4CTEA 5FAXA 4XF0A 2Q8DA 1AR92 1KFXL 1H4HA 3FLPA 4CEYC 1AHSA 4JDMA 1RUF3 1R1A2 1YCIA 5KHIA 2WWUA 1VBC1 2DU1A 2P6HA 5FPZA 3HBKA 1N3PA 3TEZA 1C28A 3ZDVA 1H6YA 3WY6A 4ASMB 4DXTA 3AXDA 4JC1A 1EV12 5FY7A 2CSGA 2RS11 1OLRA 1JOPA 5FR3A 3VD4A 4OQ8A 5F3GA 2J42A 5GLTA 1B35C 1JBCA 4KNCA 4QHOA 1TMF2 2ARBA 4CDWB 1Q56A 5LK7B 1CR7A 4QGLA 1ACCA 2RE9A 3RWNA 3AP6A 1RUD1 1AYN1 4RGKA 1ND3A 3OUJA 1DYPA 1HDKA 2PQQA 1WUVA 1ULFA 5E8AA 4TN7A 4M00A 1XSRA 2WNUA 1BJQA 1F9KA 2LROA 4IE7A 1YQCA 2YPJA 4BU2A 1CWPA 2D6OX 2VMIA 1Z7S1 4L2NA 2X5IC 5FZOB 3I3DA 1M06G 1W8ZA 1UCXA 4JDOA 4N9HA 1RUF2 4OVEA 4Y1YA 5FZ0A 1F2NA 4FFIA 4GD4A 5B4XA 2H6CA 1NAEA 5IK7A 1GOHA 3VBSC 3E6CC 4QX8A 4GULA 1DU3D 1W6OA 1ZBE1 1UYYA 3MV01 3H8XA 4WM8C 5A70A 4DS0A 1BVP1 5FO9B 5CKNA 3V0BA 3FUQA 3VD9A 3BALA 4OI1A 5CAZA 5IVJA 5CG8A 3ACGA 4RS5A 4BPZA 2J22A 3WDXA 3WCRA 1SEFA 1A78A 2W68A 1UY0A 2GNTA 3GXUA 4LK7A 3K77A 1UAIA 3HNMA 4YM1A 2YU2A 5A3NA 1YFUA 1ASJ3 5DUUA 5C3QA 1AR91 5SV8A 3WF0A 4CE8A 1UMHA 1RHI3 3BB6A 1VAMA 1PVC1 1R1A1 1JZ6A 2ZGUA 4GH4B 4N43C 4XFCA 4DB5A 4JKKA 3ST7A 5FUIA 4BQYA 5BNNC 2HWF3 1MS0A 3U10A 3POBA 3ZFGA 1FOD2 4LKEA 4BIFA 1XYOA 2XJUA 1EV11 4Q0PA 1VBE3 3OPWA 1JYWA 3T3YA 2ZMKA 2C26A 1TMF1 4JHZA 3RWKX 4P9XA 4QU2A 5KC6A 3D6EA 4CP9A 1CESA 4ATFA 2B7YA 1XB9A 4MXWA 3PU3A 3UJQA 5C8CB 4K20A 1KQRA 2BZDA 3J7NA 4N53A 3LKJA 5FFOC 3ZOIA 1NCRC 4LHKA 1SCRA 1YIPA 5CFDA 4AHXA 4IE4A 1K3IA 1WLDA 3E5XA 3ROUA 3ILNA 4XHXA 5C71A 1Y43B 3SISA 1RUF1 2J1EA 1EYBA 3CDZB 4YNIA 3MV11 4YW7A 3VBFC 2GH8A 2WO3A 5JOZA 4LBQA 4NIHA 1JZ3A 4FFGA 2HWC2 2C4XA 1XNCA 2RJKA 5A3OA 3LGRA 3V0BB 2Q0AA 1Y4WA 3DEMA 4NE9A 2XLGA 2ZA9A 3RMYA 2VR4A 3WT3A 2VBDA 4YRDA 1G9BA 2H0BA 5FYVA 4GB32 1UYZA 3O1UA 1U5ZA 3H8RA 1H9PA 4P5YA 5DUVA 5GLVA 2Q8EA 4UAPA 2WNVC 1X9PA 4FFFA 2BPA2 1XSQA 2R072 4BMBA 2X29A 1XNDA 4QPGC 3RZMA 4RSUA 3O0WA 4LKSA 5GZCA 1O8PA 4QDRA 4XFIA 2I45A 3NNLA 4FPGA 2G9FA 1TNFA 2QDNA 2ZZQA 3CMGA 5BPXA 4JQRA 4XC9A 1W2UA 2G19A 2ZS6B 1CGPA 1OLQA 4QX7A 1LOAA 1MS9A 5FQ0B 1FOD1 1IPSA 3G6JB 1OUSA 4Y22B 4AVSA 4HPKB 4GZ9A 3W5MA 2AC1A 3WQ7A 5F37A 2CDOA 4XBNA 3PVEA 5ERLA 3T0AA 1GANA 2XWJB 4JAAA 2PAKA 5DN2A 2BBVA 2EAKA 4XZUG 1PNGA 4JTNA 4AEDC 5LCWL 3VN4A 3WV6A 4W65A 4YVWA 4AR2A 2JWPA 1DGWA 4BK4A 1L7RA 3AYDA 4ASLA 1UWWA 4AI9A 1AX1A 1JU4A 4IV1B 5LBBA 2LRPA 4PQ9A 3THCA 3OEAA 3BVCA 1EY2A 2OUHA 3AMNA 1CN1A 3PURA 2E9QA 4H2AA 3A7QA 1FX5A 1MEC1 2X8KA 4IGPA 4QX0A 5CFDB 3HQRA 3W58A 5FO8B 2WNEA 2DVFA 1WLWA 2VUCA 4LIVA 2FDKA 5GLUA 3B3QE 3IPVA 2ZTNA 5ANQA 4OI4A 1CAXA 4QPIA 2GH2A 1NOVA 4NPLA 4GALA 3OBRA 3ZR5A 4LR4A 1UY4A 3VL8A 4A2UA 4CXYA 4FI9A 2HWC1 2FZ2A 3OBTA 3BN6A 2VTFA 3LPGA 2JG8A 4FCAA 4GB31 4JKLA 2QNKA 3I2OA 3H1MA 3HVDA 5EJZB 1WCQA 1SFNA 2CL2A 2WT2A 2QFEA 3ON7A 4XTPA 2PHRA 4RQPB 2R071 5BNOC 2K2SA 4LJHA 4XDOA 2QQNA 2W91A 3JBG2 1RUG2 4W6YA 2I74A 4Q4W3 4B4RA 4HBNA 4CVUA 5JXJA 5JSRA 2QQIA 1ZVFA 3AKTA 4LHSA 3WP3A 4AFAA 1NUKA 2WZ8A 5JZGA 1RGSA 3KV4A 4HSJA 1WD3A 3TEXA 4AWDA 4KWUA 4EN0A 5KXCA 1JOJA 2ZACA 2SLIA 5CBLA 3K4DA 4QQLA 2EXJA 1J59A 5IVYA 3N9NA 1ZA4A 4LT5A 2R061 4COYA 3TN93 1W8FA 5F6KA 3IDEA 4HKOA 1JMUB 2VOXA 2W1WA 1N3OA 3POJA 2RHPA 3I2HA 1S0DA 4E27A 1JZ4A 4HXCA 2PYTA 4IEYA 3VBOA 1IS4A 5CKQA 2VY0A 2GNBA 5LA9A 3ZYFA 1UF2C 4CPBD 1OI6A 1UY2A 2EALA 4X6QB 2JG9C 3WG3A 3FLRA 3VDCA 4Q4Y3 3I2IA 3ZXKA 4FPLA 2BNMA 4AAPA 2CYFA 3N9OA 4ES8A 3H7YA 3VHPA 1H6XA 5F1RA 1JUHA 1KD7A 1DQ6A 2V72A 4K21A 5A33B 1YLLA 2DDUA 3LDRA 1N3QA 4H7MA 2CU5A 2WZPP 2W47A 3RRDA 1YUDA 3ZN4A 1BEV3 2OX0A 5FDBA 3G7DA 5CEHA 2ZEXA 2ZHMA 3I7DA 4Q26A 1H30A 1AXZA 3CJIA 1BHGA 3NNJA 4YM0A 1S1AA 5FTTC 4W50A 5ACA3 4OUSA 1J3PA 2R043 1J3QA 4XJUA 3V0AB 4YZ5A 2J1VA 3U11A 3WEZA 4KGGA 3M3EA 2IZWA 3TN92 1W6NA 2DCZA 5FPXA 1BXHA 4MADA 1ULEA 4Y4RA 1F31A 2WAOA 1UMIA 4YW6A 3THTA 4CEYA 3QH6A 5FYTA 5DAQA 3JBG1 1RUG1 1OD5A 3PVOA 4I3GA 5JXGA 1PGL2 1JHNA 2I2SA 3O5SA 1W05A 4KH9A 2C24A 2YC2A 1QJU3 4FOYA 3H8OA 3ZSKA 2ZGMA 3WXPA 3O1TA 3T4VA 2JEMA 4BDVB 4K3UA 2C9AA 2E26A 3T1LA 1BMV2 1Q43A 4M3CA 4YZ4A 1BEV2 1B35A 1GKBA 1H1IA 1NXD1 2R0HA 3SCFA 4O65A 2Y34A 1NZIA 3RSJA 1OPMA 5C8WA 2A6ZA 4UW6A 3VBOB 5L9VA 4YGBA 5FYZA 1OVPA 1O4ZA 5M0TA 5F2WA 3RMXA 2A3WA 2BGPA 4AVVA 4XE9A 2R042 4LNVA 3RYPA 5FUNA 1D0GA 3MI8A 3RJRA 2QQPA 3IMMA 1V0AA 3HN3A 3N7LA 2IXJA 2ILMA 2VMHA 4X8PA 4YVSC 1ULCA 3PTYA 2ARXA 4UFJA 4UT5A 2O8OA 4XTMA 2YROA 2X5IA 1DP0A 1W39A 2VO5A 5DAXA 5DAVA 1LU2A 1LULA 2O8QA 4RHV3 4YSFA 3POIA 3VBSA 3JD73 5T55A 4E9KA 5L7OB 1SQ4A 4WVMB 2ZKNA 5I0RA 4WM8A 2BRTA 1JH5A 4AQ2A 3NAPB 1GR3A 1W6NB 2DVBA 4FTBA 1ONAA 4JVAA 3IN9A 4QQ2A 1GZ9A 3HQUA 4Y1XA 3IAQA 2WZR3 2HLEA 3TN91 4JRLA 3VBRC 3WOGA 4EN7B 3ME2A 5JSOA 2YFUA 3EHKA 4YW4A 4CEYB 4LITA 5FZFA 3IIAA 3H1YA 3LE0A 4D7YA 2XVGA 4K8FA 4XDQA 1IG3A 3O7OA 3CBNA 4GWNA 4W6XA
chains in the Genus database with same CATH topology
1PGL1 1HRV3 4COVA 4N43A 3FE5A 2YGMA 3MW4A 1U12A 3HT1A 3VKOA 3VGIA 2O1QA 3HBZA 2ZGSA 3ZN5A 3N36A 2WJSA 3VKMA 2R30A 4Q4X3 1Y9QA 1XRUA 1LKNA 2N7GA 3MIHA 3ZN6B 1BEV1 2D98A 4FPYA 2B45X 4XETA 2GAUA 1NQDA 1KXGA 2Z69A 3HAGA 2VXRA 4AEMA 5HI0A 3H1WA 4MGZE 1YFXA 1RC6A 1G86A 3MW3A 4FPKA 3WVJA 4LHLA 1TME2 2DF7A 1S0BA 3ZSLA 2JICA 4LO4B 3IT8A 2CGOA 3NKTA 5K0UB 1OQ1A 2BQPA 1G7YA 1NCRA 2OPKA 1FXZA 4FP2A 1UPSA 1EAH2 3KSCA 2VW0A 4FT8A 4AG4A 1F5FA 1S0IA 3NV4A 1REFA 4XFBA 3VBFA 3ZMNA 3BU7A 4K7JA 4KU7A 4CDQB 1V6OA 4Y26A 1AR63 2BVVA 1ENQA 3KGLA 1S0GA 2WA3A 2BVBA 4Q4X2 3MPBA 5FLJA 1LODA 1LHUA 3GZTB 3AJZA 1HX6A 1U0AA 2WNVA 2W52A 2P17A 4NWVA 4R4ZA 1ZZ7A 4QPGA 5T5PA 4LLFA 1KDKA 2BWCA 5JOXA 1OQEA 1NCQA 3ZO0B 4K40A 2VOVA 3BOWA 5BNNB 2WL1A 2RS32 4B4PA 2IXCA 1Z0HA 4LA2A 1W6MB 1YYNA 3WDTA 3ALQA 4Q0SA 1MVEA 1XQNA 3A0KA 3R4SA 4N7UA 4Q4V2 1DHKB 4NHKA 1VRH2 1AR73 2AENA 2QDRA 3GHMA 4FBFA 2XGXA 4M3CE 2OYZA 3URFA 1UN1A 4OHZA 1OA2A 4PLNA 3JB4C 4AEDA 4N53C 1W0OA 4WM7B 1TME1 4YFZA 1COV2 4FVVA 2DVAA 3FBMA 4CEWB 1HRI2 5H9QA 1FI2A 2VW1A 5T52A 1LJ7A 3JUUA 2VH9A 4QQOA 3VBHC 3VZMA 3EQEA 2FHRA 1EAH1 1V70A 4DNYA 2RS52 2VOWA 2A6VA 1QQP2 3OD0A 4BYYA 1S55A 5H9RA 5KHKA 2IXLA 4DOUA 1H2LA 3T1MA 1QWRA 3R4DB 4DY3A 1PK6C 4K1YA 2WINB 1AX0A 1S2BA 1VBA3 2B5HA 1GZCA 3MYXA 1AR72 1W6QA 1K5MC 4S2DA 5DZGA 3KMHA 3USUB 3VZNA 4AGGA 3LB9A 5EZWA 3ASIA 5BNOA 1DYKA 3ZSJA 2UYBA 4Y24A 4QD2A 1AYM2 2ZAAA 3AP5A 1C1LA 3C3VA 1MZ6A 1YI9A 1REEA 2RS31 3OYWA 4DZGA 1Y3TA 4HVOA 4M0HA 3AMMA 4OI0A 1PGSA 2Y0OA 4A3XA 1DQ1A 1S0JA 1WW7A 4Q4V1 4UW5A 4AEDB 1D0HA 1VRH1 2WA4A 1DZRA 2TUNA 3MFCA 4YW1A 5HBAA 2A73B 3LZZA 1EPWA 4FPFA 1FMD3 2HWD3 3LAGA 1RUC3 1OA3A 4YG6A 1UIKA 2BUKA 2WS91 1PO11 1V9U2 2R1BA 1VBA2 2MNGA 1COV1 4V1PA 1HRI1 5FLHA 2VUJA 1H2MA 1LGNA 2R0FA 4AFDA 4HL0A 5FOJB 5JR7B 1YI7A 5K8SA 5D8AC 1GYKA 2RS51 3AXEA 1QXJA 2ZZJA 2HKXA 2ERFA 5GZFA 1QQP1 1RUJ3 5CIRA 5T5OA 1DFQA 2XBO3 3EBRA 1QH6A 5BNOB 2D44A 2QVSB 1AR71 1RVF1 2DURA 2IXIA 5GKAC 3TNPB 3O0XA 2Q1ZB 2H6BA 1XYPA 2D7FA 3AKSA 1RUC2 4YGDA 3UKNA 1AYM1 2X53S 2RMU3 3QBQA 1R1ZA 1HKDA 3LOIA 4FAHA 4XQDA 1S0CA 4EV0A 3LA7A 5I91A 4F83A 4NO4A 1VALA 3VZJA 3JQXA 2CV6A 2PHDA 2VPVA 2YGLA 3OY8A 4LLOA 1C4RA 1RUNA 2XL7A 1VR3A 5JAXA 2YC0A 2PLV3 4JGZB 4MV2A 2JG9B 2XKOA 1FPN2 2VG9A 2VQ0A 1UW8A 5C9AB 3I8TA 3CJXA 2DWRA 1O3QA 3EJKA 4ZU4A 1V9U1 1RL3A 3DGTA 4D3WA 2XBO2 1LGBA 5DUXA 1U5YA 1H8TB 1OFSA 1VBA1 1IPJA 4BHPA 2VNOA 2LALA 4YVSA 2Q8OA 5IK8A 3SCHA 2NN8A 2CGPA 2GU9A 5CADA 5JIAA 1QHDA 4AVTA 3HD8B 2RMU2 1I5ZA 1X50A 3VUOA 4TZDA 2P3JA 4QQPA 1LENA 5J96B 3HWJA 4BH9A 4XJAA 4HSLA 2UY9A 1CX4A 3VBRA 5DZEA 2CWMA 4UW3A 2PLV2 1ALYA 4LUMA 2CAVA 3ILFA 3VZOA 3N4MA 3WG2A 1UU4A 1RUC1 5KXBA 1AUYA 5EWSA 2XJVA 1HIXA 3AYEA 3WCSA 2BEOA 3ZFEC 4D69A 2HEYF 2YUEA 2WFF1 4AEKA 2PHTA 1G9DA 1C8M3 3MIBA 4Q8KA 1CJDA 1GV9A 4ITCA 3SITA 3MLJA 2PN5A 3THPA 4ORFA 1PO23 1YFYA 2JJ6A 5C4WB 2VNRA 1FPN1 1MQTB 1UMZA 3KLSA 4XFHA 1NZCA 2XBO1 4EWDA 2DYCA 1KJLA 1PZ7A 3ZYRA 3RJ2X 2Y38A 3D8CA 2XH6A 1O5LA 4Y4YA 4Y20A 4WVWA 1DQ5A 3I59B 1J3RA 4A7KA 2RMU1 5AFEA 4Q27A 4YW2A 4S2GA 4D94A 3PNAA 5JPNB 5JLVA 1C8M2 1TQ5A 4AVBA 2FQPA 2HWB3 3DV8A 2H0VA 3GYDA 2R49A 5TSWA 3VV1A 1LOEA 5E1RA 4FPCA 2PHLA 3KB5A 4Q8LA 2HJIA 5CG9A 2PLV1 3J9SA 1LECA 3AMQA 4QQHA 4BCUA 2GDFA 4ISRA 2NQYA 2YDEA 1PIV3 5F9TA 3I2DA 4IXLA 3U4XA 1SLCA 4Q0UA 3FFQA 3MIGA 2UU8A 4KQ7A 4GWMA 4BLIA 1APNA 4BMEA 3FZ3A 1DQ4A 4YZ1A 4BM8A 5CA6A 2AH2A 3WUCA 4COUA 1VBB3 1ND3B 4E2SA 3KM5A 2XG3A 5GM0A 2V73A 2W0XA 2A6YA 2WNUB 1WW6A 2IWGB 3HIFA 4LUKA 2QCSB 5GZGA 4XBLA 5HCFA 2IC1A 5KC5A 5LK5A 1AJOA 3NV2A 3O0VA 1ASJ2 2FMYA 3VBHA 2D5FA 4Q29A 3SHRA 1RHI2 2EF6A 3GZUC 3ZSMA 1ULGA 4FOQA 1W6OB 1QJX3 3VBUC 2HWF2 2YXSA 3WX5A 4AXOA 2Z5WA 1FV2A 3M7AA 4RS5B 1VBE2 2RM23 4IEUA 1PK6A 3DF0A 1C8M1 3IBMA 4ISQA 4IEVA 4FPHA 1Q8VA 2DCJA 3LCPA 1JYCA 3IKWA 1K5MA 2YY1A 1J1TA 3NWKA 1YHFA 1S0FA 2NMOA 3M70A 3E5QA 1NCQC 3VKLA 1LGCA 4R4XA 4IV3C 4YGCA 1LOFC 2DU0A 3QACA 2D6KA 5JI9A 4QPYA 3FLTA 4XQWA 4P5HA 2YHJA 4XJ9A 3N35A 4AHYA 1REDA 1FV3A 2XVLA 4WV8A 2VUAA 1LEDA 2NYYA 1QJX2 4MXWB 4LBJA 1ZZBA 4N53B 3R0RA 1YNAA 4L8QA 4XHBA 4YZ3A 2E53A 1MS3A 4L97A 1GZWA 3ZMOA 4LBNA 1H2NA 4HK8A 5D1IA 3WLUA 3IMNA 1V6IA 4DY5A 1ASJ1 4GMP0 3NJZA 1UL9A 2P34A 2ZX0A 4LBQB 1E57A 1RHI1 3WW3A 3QLQA 1R083 3IM0A 1XU1A 1MS1A 4LO6B 5D8AA 3W9AA 4COZA 3ZYJB 2HWF1 4EN8B 1RJ7A 2DUOA 1PK6B 4MGIE 2GNMA 2P3IA 2A71A 4IESA 2OZ6A 4XJWA 1POV0 1QGLA 1VBE1 1QJY3 2B8MA 1FATA 2PFWA 2UWAA 2VVDA 1Q8OA 4U2AA 4AI8A 3ZFGC 3M3QA 5FBZA 2GNDA 1NA1C 1DQ2A 3GNEA 4BWOA 4FTEA 3QCWA 2MEV3 4ES9A 1AL0G 1UPIA 4XQ4A 4JGYA 1GICA 4AE2A 1SBDA 1ZBA3 1QDOA 4R52A 3RG0A 1VBD3 4YM2A 1ENXA 1KITA 4IETA 3H50A 3FWEA 1R082 3INAA 4ZKTB 5BV6A 4YVWB 3UK9A 4UBGA 2Z79A 2UURA 4N90A 4LHNA 2FMDA 2GMMA 3MIFA 1KDMA 3MLLA 5IK5A 2D5HA 1GZWB 1NYWA 5AVAA 1A8MA 1YJLA 3M4FA 1UZZA 3IPVB 3B94A 1SLIA 4K6BA 4QX5A 1RUE3 3DUIA 4QPIB 1CAXB 5HCBA 4Q4W2 4S2FA 3N7MA 4IL7A 4AFCA 1Q8SA 4GQ7A 1IS3A 2PTMA 1UIJA 4YGBA 3JCIA 4NHMA 1ZBA2 5ABJC 1UX6A 2JG8B 1Q3EA 3AX4A 5DXDA 1ND2C 3U0ZA 2TBVA 4P14A 1ULDA 2NPIA 4CDXC 4E4SA 5AC93 1CONA 1OFNA 2E7AA 4KWLA 3LOBA 4OFGA 2BNNA 3ZXAC 1VB2A 3H3ZA 4YM3A 5CFCC 1MZ5A 1CQ9A 1H9WA 3KGZA 4Q4Y2 1XXNA 3WD5A 5DZFA 3WG1A 1WBFA 2A3YA 5T5LA 5JZGB 4I0AA 1AL23 1OOPC 1SBFA 1O3SA 2ZGKA 4J1XA 5H9PA 3ZFEA 4AK3A 5DDJ3 1IPKA 1LOGA 4ATEA 5I0SA 5KBFA 3V56A 3AMPA 4PDWC 3VHOA 4MSVA 4HFSA 1DBNA 4PBPA 2D6PA 3FFZA 3KT4A 2BTVC 2R6QA 1EP0A 2VECA 4PLOA 4D7SA 4HT1T 1IGOA 5ACA2 3IWZA 3OF1A 4C0BA 4DXZA 1ZZ8A 4NVPA 1RMU3 4C1WA 3A0NA 3DPRC 3B9CA 4XF1A 4IEWA 4QM9A 2E7TA 5AC92 1IKQA 5J09A 2O0OA 3WHUA 1RUI3 5EXOA 2DCTA 4JCKA 2E63A 1HQWA 4HKWA 4JRAA 3WP4A 1CD3G 1GNZA 5JSRA 4OHVA 3CJIB 4Q4W1 2WC2A 4UBHA 1QJU2 4CDUC 1R093 3AKQA 4URTA 4Z8BA 5DDJ2 1ZBA1 3E5UA 3WQ1A 2VU9A 4DMIA 1LU1A 2RJLA 4OI2A 3WG4A 3J26N 5J36A 5KHGA 1ZRCA 2QKDA 2WFPA 3J8F3 3CF6E 2CWSA 4IEOA 1J58A 1I6XA 2FZ1A 3WW4A 4PF5A 5FREA 5CU1A 2G9GA 4LBKA 3VDDC 3ZIWA 1T6GC 3AP4A 3GHNA 4M3CF 4Q4Y1 4E2QA 4HK9A 3S30A 1X36A 1TEIA 3ZX7A 3BIWE 1IS5A 4M3CB 1QDCA 1B35B 1MVQA 1D4M3 2OZJA 1S2KA 5KXEA 4CP2A 1BMV1 4B4QA 1X7NA 2Y0IA 4RHV2 3T2TA 3TNQA 3JD72 5LRSA 3JB8A 4WBBA 3CL1A 2D97A 5ACA1 1NE4A 3KCXA 2R041 4Y1VA 2ZCWA 4DPNA 1KJRA 4GH4C 2V09A 2ZGQA 2MHFA 2WZR2 2IFWA 2WT0A 3J8F2 1LOCA 2X5IB 2PHWA 3K51A 2B39A 3ZXDA 4AGVA 5I0TA 4DRRA 1J1LA 4LBLA 1D4VB 3VBSB 5LEKA 3POYA 1HRV2 1ZZ9A 3VBUA 4WM8B 4XXAA 3WR0A 1WA4A 5C8CC 1QJU1 5I8YA 1V6NA 3PHMA 5GZEA 3ZVXA 5FRAA 4PCRA 4XF9A 4Q1RA 4Z1VA 1KRIA 1IQAA 4XILA 2YYOA 2PAEA 4AI1A 3APBA 4AHZA 3LA2A 2RR13 1UU6A 1RUH3 3ATGA 1IS6A 3M3IA 4SLIA 3VLBB 3VKFC 3BOPA 4N43B 2VOKA 1LHOA 3BCWA 2ZGNA 3IDBB 1BZWA 2EXKA 3ZPYA 4IV3A 1KS4A 1HLCA 1LOFA 3ZXLA 3ZYPA 3ZXGA 2ES3A 3UL2A 3GBWA 2HWE3 2D3RA 3GF6A 1RIRA 2K0GA 2NMNA 1VLNA 2PA7A 4P9GA 2DFCA 2XUMA 1H8VA 3D4KA 4RHV1 3TB0A 1SBEA 1ENSA 3JD71 4PBOA 1AR62 1N1TA 2JE7A 1I1EA 3H9AA 4GMP3 4L9BA 1QKQA 4F7ZA 3MW2A 1UZYA 1QXPA 2R16A 2UY8A 3PLQA 3NW4A 2F6BA 4RR3C 2JECA 3FHIB 4A7YA 2ENRA 4FPEA 5GALA 1NCRB 2A7AA 5FCCA 3S0MA 3C2UA 3GBFA 2WZR1 1O4TA 1XU2A 1PHMA 1W6PA 5BNQA 4FPOB 1POV3 4OZXA 5DG2A 2UYAA 5BY5A 1RUH2 2XB6C 3QH7A 3VBFB 1ZZ6A 1LR5A 4FOVA 3E6DA 1HRV1 1PZ8A 1BQPA 3OTFA 2HWE2 4BQ1A 2BNOA 5F6LB 2Z2SB 4IV1C 4Q4X1 3RPQA 2WNVB 4PIXA 1DZQA 3JQWA 1HV0A 4L92A 1O91A 4QPGB 2WWSA 1OSGA 4XEZA 1NCQB 4GKXA 3D0SA 3ZFGA 2BFUS 1DGRN 5BNPA 1QOSA 2LM3A 3WDVA 1NA1A 3FBYA 3K48A 5HCAA 4R8HA 4GIQA 2ET1A 1WMEA 4R9AA 4KWJA 3ZYIB 1QY4A 5T3NA 1BVVA 3PMSA 1N1SA 1G9CA 3ES4A 1XE7A 3TYJA 4I09A 4KG0A 1B09A 1O5UA 5E16A 4RQPC 1DQ0A 4NOTA 1AR61 1BBT3 1AR83 1CAVA 2VMGA 4MGKE 3MF9A 1X33A 4K9SA 1C5HA 3WW2A 3D0JA 3CLPA 4I0BA 3KT1A 4N7IA 4AQ6A 1CAWA 1D2QA 1HXS3 1ZZCA 3PJQA 4LBQD 2Y26A 5SV5A 4LULA 3SCGA 2R1DA 4E4ZA 4Z2WA 1RUH1 3OGJA 4FPJA 4LE3A 2E7QA 3H7JA 4D7TA 3TBDA 3PVBB 3SLIA 1QF3A 3HMYA 1VBC3 3WDWA 1RJ8A 1GBGA 3EXUA 5ABJA 5A32A 1ND2A 1LHWA 2HYKA 1NY72 1W6QB 2RS13 1ZRRA 2XKPA 4CDXA 5KHJA 5JVVA 2DVDA 5J37A 2AREA 3NL1A 5B2GB 1C3HA 1WMFA 4H14A 1FMD2 1BBT2 2HWD2 2JXAA 2QE3A 5CFCA 4OHYA 4AVAA 3ZFFC 4Q0VA 1RUD3 3OYWB 1QOTA 4JGYC 1OOPA 3MLKA 3DN7A 2DCKA 5J98B 4XMIA 4X8NA 5EV7A 3WUDA 3WZ1A 2DUPA 1C8NA 1TE1B 1Q5OA 1WGPA 3GALA 3H0OA 4PDWA 1Z7S3 4H3WA 5BYNA 5JPMB 5IT6A 4XZPA 4C90A 4FQZA 3TOJA 1RUJ2 2ZJCA 4P9JA 3EO6A 1DGRA 4HVQA 4PJYA 3MIDA 4XFGA 1LB2A 2XHKA 4I02A 3DPRA 4HVRA 5FLIA 1NE6A 4COWA 4KBBA 5BUVA 3RYKA 3CU7A 3WDUA 2Q30A 1DIWA 1MZEA 1PMIA 4EROA 5K9YA 4OHXA 3SH3A 1AR93 2DTYA 4INDA 5EYYA 5I93A 2XJQA 5CVRA 5ABJB 4CDUA 1QJZA 2C1FA 3AYAA 4MVTA 3KCYA 4XJ8A 5EYXA 1PVC3 4DRVA 1R1A3 1ND2B 5BXXA 1SLAA 2AYHA 1Z78A 3O12A 4KG8A 3UV9A 1N1YA 4XOGA 5AVPA 1EV13 3ES1A 5DG1A 1DG6A 4BZ4A 1AXKA 1PZ9A 4XIKA 1TMF3 3MFAA 1W0PA 1FYUA 2Q5TA 1C1FA 1FMD1 2HWD1 4HANA 3HT2A 3SH5A 2BFUL 3AZYA 3SNMA 3UKVA 3VDDA 1LESA 5L7OC 1JW6A 1MS8A 1D2SA 2XVKA 4G3YC 4XYXA 2OW4A 2VVEA 3VL9A 5DUWA 4C91A 4NPRA 3NAPC 5JOWA 1JN2P 5E89A 3P3PA 3WQ0A 4H55A 3OY8B 2JKBA 3AP9A 2EAAA 2ZX3A 1YWKA 4QXKA 2PHUA 1X8MA 3LSEA 1FNYA 4MXVA 5HXVA 1PVC2 1RUJ1 4YARA 3DPRB 2A70A 4Y5Z0 3RQ0A 4GH4A 3HR9A 4YVSB 1QXRA 2DTWA 3OGGA 3GBGA 4RFT0 4HN1A 1LRHA 1CAUA 2KM2A 4I30A 2WT1A 1WCDJ 4Q2FA 3MIEA 5GZDA 4LEJA 2BW8A 3R4UA 1GQHA 4NWWA 4CZSA 4J1WA 4CDUB 1SLBA 2OA2A 1DF0A 5C8CA 2ZX1A 1DDLA 4AI0A 5JWPA 4RGGA 4YW3A 4IEZA 4KU8A 1A8DA 3VBRB 2CGNA 3TAYA 1FOD3 5K0UC 3JZVA 4LO8A 4Z92B 2CTVA 2WQZC 2XL9A 3WDYA 1PO22 1QNYA 3VDDB 1ZREA 1BK1A 3WHTA 4EWEA 4BOWA 4AVCA 4CDQC 2W39A 4RGAA 3ZXEA 4UXAA 2XPJA 1MEC3 4L11A 2E6VA 1A6CA 3AB0A 5EJ3A 1L3JA 4F8AA 5FMOS 1HQNA 4AQTA 2ZAHA 3RDIA 5I8SA 4OUMA 2HWB2 2HWC3 4RR3A 1SLTA 1MZFA 4AQSA 1SMVA 1WCSA 3DL3A 4EN9B 1CAUB 1NLSA 1YFWA 1LOBA 1WMDA 5JOYA 4B7KA 4EJRA 2IXKA 4GB33 5FQ0A 4Y20B 1WW4A 1XE8A 2ZGLA 2B46X 1RTVA 4Y22A 4HPKA 1H2KA 4TWTA 3ACLA 1V6JA 2R073 4ZU5A 1XNKA 1QH7A 1V00A 3B01A 3MPPG 1NQJA 2YZ4A 1FT9A 1PIV2 1Q8PA 2A75A 2D6LX 4XF4A 3AK0A 1G9FA 3ECQA 4WM7C 4CP1A 4R9CA 1MS5A 4IV1A 1MEC2 2GALA 3B02A 4Z07A 4CEWC 2ZBJA 1MACA 4YZ2A 2LTNA 3ELNA 5C33A 1VBB2 1URXA 2R063 4XMAA 2BWAA 1RB8G 2ZHKA 1CVNA 4CYDA 1PO21 1WLCA 4NN0A 1G9AA 1OMIA 2GC1A 4OLLA 1XNBA 2QZ3A 4LTAA 2C0ZA 1VP6A 1CPMA 1LHVA 2TNFA 2IXHA 2NM1A 5E88A 1A3KA 1FAYA 1LCLA 3MEPA 4RQPA 3N3HA 2XJPA 2FBEA 2A3XA 3V65A 4MUVA 4RR3B 2RM22 2D3PA 3ZSEA 4TYSA 2PELA 3ZIXA 4NHLA 2HWB1 4K1ZA 1YJKA 1G6NA 3DKWA 3B9IA 4WZFA 3KZ4C 3VBHB 3SMHA 1GSLA 2R32A 2R062 5JI7A 3USSA 3S6PA 3SXWA 4YYOA 2P3KA 2ZPXA 1PVXA 4PIZA 5L36A 1IOAA 4HN0A 1NLRA 3PVNA 3JBG3 1RUG3 3H3UA 1PIV1 5J7MA 1H1MA 1HQLA 1HW5A 2ZHNA 3LWCA 4W6WA 4DQAA 1JTZX 3RI9A 2DUQA 1K5MB 4LBOA 1UD1A 3OD4A 4TLFA 1ENRA 4HKLA 5A33A 1VBB1 1BCXA 4AYUA 5BNPC 3NVCA 2GMEA 3MICA 1YXWA 4QHBA 2KXLA 2ZMLA 2ZABA 4Q1PA 3X29B 3ZFFA 4EN6B 5J48A 3ENRA 1H4GA 3HN1A 1IZ3A 3AP7A 2ZMNA 3S7IA 5GLZA 2ZX4A 2B9UA 3V0AA 1U5XA 2BGCA 4CP0A 1X8EA 3B00A 4RD7A 5F5QA 5C6CA 1HV1A 4ONUA 3AMHA 4OHWA 1QJX1 3LSDA 3M3OA 4YG0A 1Y7BA 4P9IA 2A5ZA 5FMOL 1OKQA 1H0BA 4U36A 2RM21 2XLAA 3HQXA 1GLHA 1QJY2 3QD6A 5JDBA 3MDPA 5JMCA 4MZUA 1XYNA 4YG3A 1WBLA 3BODA 2WLQA 2SBAA 3WP6A 4LA3A 4LO5B 1JUIA 4I01A 3WW1A 4MLOA 3AFGA 1YRZA 2MEV2 5D8AB 2PHXA 4E4DX 4MGYE 2UWBA 2DCYA 1CIWA 4JGZC 1VIWB 4Y1UA 1I3HA 5C9AC 2A6XA 4XIOA 1VBD2 3B5LB 1BKZA 5FO7B 1H8TC 3AZWA 1PM7A 4WVZA 4RL7A 1ZM1A 1RINA 1ZX5A 3AKRA 2XJTA 4XW3A 3BTAA 3ZFFB 5JCTA 3ILRA 4WZCA 4CRQA 4JGYB 3ZXJA 4YFWA 1JXNA 1F5JA 4A7ZA 5L7OA 5H9SA 2ZOEB 4WVMA 3NAPA 3KQRA 1RUE2 4NR1A 4B8EA 1QNWA 1WLTA 2XWBB 4QMAA 4FOWA 1QU0A 2Z42A 1R081 1NXMA 4IEXA 4YLZA 2F4PA 2JENA 3VKNA 2ZKLA 2LUWA 3OJBA 2V5YA 4I2OA 1YIFA 1QJY1 5EFUA 4R9DA 3M2MA 4LE4A 3E6BA 3TWIA 4LO7A 4CDWC 3WINE 3ZN6A 3V64A 4YGEA 2AZ5A 3AFKA 4AGRA 1AL22 2MEV1 1Q8QA 5I0UA 2OIIA 5C4WC 2TEPA 2JDZA 3RI8A 1FNZA 2DFBA 4O9EA 4XF3A 4P9LA 3MGUA 1MQTC 1YO8A 1VBD1 3KD4A 1LHNA 4META 1JYIA 4QM8A 1AX2A 5A3MA 5K0UA 1C5IA 3AZXA 2D6NA 2P37A 2EIGA 2VGDA 1SACA 3KCCA 5L73A 1RMU2 1PNFA 2K9ZA 2ATFA 4IQPA 2ZHLA 3ZFEB 2P2KA 1V6MA 2QUOA 3MF6A 2PAMA 4CDQA 1TME3 3L9JT 4BA6A 1RUI2 2CAUA 1AJKA 3ZDSA 3M3CA 4HETA 1RUE1 4N9IA 4FQ4A 1GQGA 3LA3A 2GN3A 1EAH3 3L2HA 4HMZA 1R092 1GNHA 3FJSA 3CEWA 4B29A 2D40A 2YV8A 4M01A 4MYEA 4AFBA 5JIUA 4HLTA 5BNNA 2GN7A 2JE9A 5T50A 3B93A 5AC91 4P9WA 1W6MA 1QMJA 2DVGA 2GMPA 4KGQA 1CJPA 4B3NA 1RITA 4KL1A 1I9RA 1ZYBA 4UW4A 5T54A 2ET7A 1ND3C 1AL21 3VHNA 3N7KA 4ZXKA 1OHFA 3I54A 2D3SA 1F8VA 3SH4A 5DDJ1 2D6MA 1D4M2 2WNUC 1ZNPA 3VZKA 4WM7A 3WNXA 2CY6A 2RS33 5LRRA 4HZFA 2XJRA 3ZXFA 2DV9A 4CEWA 4XJZA 3CO2A 3H8UA 1M4WA 3I4IA 5LEJA 4AI2A 1TNRA 1KFUL 4Q4V3 4BIOA 1VRH3 4AW7A 4MX3A 1RMU1 2GC0A 2E51A 2WS93 1PO13 4JV4A 4FTSA 4RS5C 2NZ9A 1COV3 1AXYA 1RUI1 4Q0QA 1LEMA 1HRI3 5GLWA 3WP5A 1UKGA 1U5IA 1UU5A 2Q4SA 4PLMA 1KS5A 3USUA 4PIYA 4OULA 1C57A 1R091 2RS53 1N1VA 2WSUA 2VNGA 1QQP3 2C5DA 2EXIA 1RUOA 4XPVA 4Z82A 3IDCB 3P3NA 4TSVA 3J8F1 4XFAA 2RR12 4L99A 2D43A 3QOPA 4I3PA 5AFBA 3NV3A 3GZAA 1RVF3 1VAVA 5KXDA 3VBUB 2JX9A 3CNAA 3JU9A 3PMEA 4QGMA 4EWAA 4G4FA 4F3JA 5I8TA 2WS92 1PO12 1AYM3 2AGSA 1DLLA 2ZGPA 1AVBA 3AKPA 3FC0A 3R6SA