1REEA

Endo-1,4-beta-xylanase ii complex with 3,4-epoxybutyl-beta-d-xyloside
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE II
publication title Covalent binding of three epoxyalkyl xylosides to the active site of endo-1,4-xylanase II from Trichoderma reesei.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1995-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1reeA00
2VUJA 1BCXA 2B45X 1BK1A 2QZ2A 1REFA 3RI8A 4HK8A 4HKWA 4S2FA 2VULA 3AMNA 3AKQA 1H4HA 3WP5A 3WX5A 3WXPA 3VGIA 4XPVA 3VHOA 3VL9A 3RI9A 1OLQA 4XQDA 4HK9A 3WQ0A 4HKOA 2QZ3A 3AMHA 1REDA 3AKRA 3VZNA 3WQ7A 3AMQA 2DCYA 3M4FA 3MFCA 1KS5A 5K9YA 1XNCA 1NLRA 4H7MA 2D97A 5K7PA 1BVVA 4S2DA 2BVVA 1XYNA 1XNDA 1W2UA 3LGRA 1C5HA 1HV1A 3VHNA 2DCZA 4XQ4A 1UU6A 2BWCA 4HKLA 5EJ3A 1UKRA 3VZOA 3O7OA 2NQYA 3AKSA 2D98A 3AKPA 1XXNA 1XYOA 3MF9A 3WY6A 1QH7A 2Z79A 1OLRA 3VHPA 1YNAA 5HXVA 4XQWA 1PVXA 1H4GA 1HV0A 1XNBA 3VZJA 2JEMA 1QH6A 2F6BA 4S2HA 1H0BA 2JICA 2B42B 4NPRA 3MF6A 2VGDA 3WT3A 1KS4A 2DCJA 1ENXA 2BWAA 3WP6A 2DCKA 3AMPA 3VL8A 3HD8B 1OA4A 4IXLA 3B5LB 3VZMA 2BW8A 2DFCA 2DFBA 1OA3A 3VZLA 2C1FA 3VZKA 1REEA 1HIXA 1F5JA 3MFAA 2JENA 2NLRA 4S2GA 1H1AA 3AMMA 1AXKA 1H8VA 3VLBB 3LB9A 3WP3A 3WQ1A 1XYPA 3EXUA 1UU5A 1XNKA 1C5IA 1M4WA 1TE1B 2B46X 2VG9A 3WR0A 1OA2A 1UU4A 1IGOA 1T6GC 3B7MA 3WP4A 3ZSEA 3AKTA
chains in the Genus database with same CATH superfamily
2ZS6B 1JHJA 4UFHA 2DVGA 1WA6X 2QZ2A 5FPLA 1V6OA 1YWKA 3A22A 4AEDA 4BQ5A 2XDVA 3NQHA 4OULA 4NOTA 4WM7B 2IXKA 2VMIA 3ZYJB 4HKWA 2JDZA 4XTMA 5ANNA 4SBVA 1R64A 3AKQA 1WBLA 4MXVA 3IWZA 4QPIC 4FPYA 1PX4A 4LBJA 4BDVB 3BPSA 3Q8AA 4OI2A 1QQP3 1ZX5A 1HRV2 2XR4A 1RUF3 3WQ0A 1GQHA 2JG8C 2RS13 2I45A 4UW4A 4LOTA 1WMFA 4HL0A 1REDA 5AFEA 4YNIA 4W8JA 1MQTB 2JWPA 2MEV3 2C6SA 1OLMA 2RM23 1HB3A 4OFGA 5FKBA 5CKNA 2ORXA 5K9YA 4H7MA 3CJIC 2XLFA 1WLTA 3SHRA 1PZ7A 3O0VA 1RHI1 4S2DA 4WVMB 3M1HA 2FMDA 4ONUA 3VBUB 1X8MA 1XNDA 3FC0A 4C91A 1XSRA 4AK3A 1J83A 1QJY1 2YY1A 4NVPA 4BWOA 5K0UB 1IS3A 1GUIA 4IV3B 3LFMA 1N1VA 4GB31 3FN9A 2PAEA 3Q9OA 2WO2A 2RS12 4D69A 1KGYA 5L7OB 5T5JA 3CF6E 3KGZA 2RDSA 3D8CA 2MEV2 4KQ7A 2RM22 4BQYA 4PLOA 1RUJ1 2JDKA 3ACFA 3GYDA 3RJRA 2EIEA 2D98A 3FHIB 1AR72 2VOXA 1ND3A 3W21A 3ZXKA 2XLAA 1SEFA 2K46A 4TWTA 2YFUA 5FLIA 5IVCA 1MZFA 3EMRA 3FUOA 5FJHA 1OMIA 5LA1A 3A23A 1IZ3A 5JIAA 3ZYGA 1H4GA 2RDRA 4KU7A 1DZQA 4YFWA 3RWKX 3KGLA 4E27A 5GKAC 3UJQA 4QPIA 1BLZA 1Y3TA 2BEOA 1RMU3 3KM5A 1ZYBA 3D82A 4Q4W1 1W6NB 3WNOA 3RFRA 2A3WA 2VE1A 2XJPA 2I74A 4C90A 5FZDA 4LHKA 4WVWA 4DXZA 5A32A 2EIGA 3RYPA 3OY8A 3GXUA 4RYDA 4GMP1 5JAXA 2JG8A 3KV6A 3ECQA 4GKXA 3GALA 5AVPA 2JB4A 4LKSA 3R4UA 3LEGA 3WDXA 5IVFA 1YXWA 2Z4FA 3CMGA 2ZKLA 1AYN1 1RUD2 1SHWB 1MS0A 1VIWB 3H3ZA 4RHV2 1VAVA 4RGAA 5FYZA 4A45A 5JXHA 1QHDA 3KT4A 3CJIA 3W9AA 2W1UA 1JYVA 5J96B 4TN7A 3O1MA 2ZZQA 5CKQA 1CPMA 4QD2A 1NAEA 4RFRB 1XYPA 1NOVA 3J8F2 1DQ0A 2OX0A 4UW6A 4R52A 1UU5A 2A6XA 3MIBA 4W65A 2JG9B 2DUOA 3B01A 1LAJA 1PX3A 5JWPA 2P2KA 4HANA 4Q4V1 3TN92 3U75A 3I4IA 4JAAA 3B7MA 4PI0A 3WG3A 2B9UA 5LB6A 4LA3A 2ZEWA 1ZZ6A 4XMIA 4WM8C 1AR92 5FY9A 3U37A 1MACA 3H8OA 4LUKA 3MW4A 4AG4A 2B45X 3THDA 1VBA3 2CTVA 4BQ2A 1BK1A 2QTWB 4R9CA 5DABA 5FMCA 4YZ5A 3MV01 1REFA 4NPLA 2HEVF 1XRUA 2Y38A 4AI9A 1QJFA 4FI9A 4QXKA 3GHMA 2ETEA 4RA0A 2VULA 1JZ5A 3APBA 3IDCB 3NSTA 1AZDA 1WLDA 1DHKB 2R32A 5FXZA 4OCTA 5DDJ3 2BNMA 5IAVA 1W6MB 3HT1A 3VHOA 3TOJA 2WJSA 5FOJB 2Q8OA 2K2SA 1STMA 1AYM1 3PUHA 2QFEA 2RR13 4JKLA 2JDYA 4GAZA 4LBLA 3V0BA 1S2EA 1WMDA 1SBDA 3KF5A 5F5IA 3OJBA 3BVCA 5CVRA 2XUEA 3N7MA 1S0JA 3T1MA 1JYXA 1RITA 2WNUC 1MS8A 1ASJ1 2D97A 3IDEA 1IPKA 4AXOA 1H6XA 3B00A 4E2SA 2ZX3A 4N7UA 5HI0A 1A8MA 2XB6C 4QKFA 4Y5Z0 1HRI2 2DTWA 1CAWA 1DGWA 4FOYA 3OYWB 4GJZA 4Q5OA 1JYTA 1NY72 3VHNA 2WFF1 4XQ4A 2R7EB 4U2AA 2VPVA 2ZGQA 2BOIA 5FXVA 3I3MA 2VMGA 4XF4A 3C7HA 2EA7A 5C5TA 2ZOEB 1H8TB 3BOWA 3WNKA 2ZHKA 4LO7A 1Z7S1 4K9SA 3WY6A 1EPWA 4GQ7A 4WM8A 5GALA 1W2NA 4C8DA 4JDNA 2AR6A 2D3SA 5TSWA 4XQWA 1PVXA 3GGLA 1NXMA 4IETA 2GH8A 1V9U3 2YPJA 1QH6A 2RS53 1OBNA 2WDBA 3RDIA 4UFIA 3ZXGA 2B42B 1DG6A 5ABJB 2G9ZA 3W5MA 1VALA 5DAVA 1KRIA 3ZXDA 5DUVA 1WLCA 1O3SA 5FY1A 4XFHA 5T52A 2RMU2 2HBTA 1DDLA 5CIRA 5LA2A 2YC0A 3RZMA 1WCUA 2Y6KA 2B7YA 2DTYA 3S0MA 1UY4A 3RQ0A 2FHRA 1H30A 5FYMA 3C7GA 1FYUA 3E1F1 4FSJA 4IE7A 4YG0A 2RS52 3K3OA 3TEYA 2WNUA 3RMXA 2WA3A 4XILA 1JZ2A 3RZHA 3MFAA 1XC6A 3O1TA 1D0HA 5A6QA 2DV9A 2CL2A 2ZEXA 1JYNA 2FDKA 1N3PA 3UKVA 1LKNA 5F7UA 4IUGA 1RHI3 2Y8KA 2ZGNA 3SH5A 4FPKA 2ZGRA 3R4SA 4GJYA 4ZPIA 3T2PA 4BIOA 2A71A 4Z1VA 1UZZA 3H42B 4P5YA 3INAA 3ZMNA 1VRH1 2CDOA 2PFWA 1YQ5A 4GB33 3M8LA 4QKNA 1XNAA 3WUCA 4LE3A 5L36A 1EUUA 1RUG1 4BIFA 3OUIA 2X10A 5JMCA 5HBAA 1I5ZA 2VOTA 4BJ0A 5FZIA 2E9QA 4AVAA 3V56A 1DFQA 4AI3A 3UV9A 1F2NA 3MUZ1 4CDWC 5A3NA 4P08A 2BOJA 3B02A 4Q4X2 1UO9A 1ENSA 1SCRA 3BIWE 4AQTA 5CZKA 4QB2A 3LDKA 3OGJA 5I0SA 5DG1A 5KXDA 4BQ1A 4F3JA 3OBTA 3ZM8A 3KVAA 4FT8A 2IWGB 3T2QA 3RSJA 4QPGC 5BV6A 2ZX2A 5DAPA 2GC1A 2GN3A 1AHSA 1JS9A 2P5BA 4Q4W3 4YVWC 4IEVA 3ZYIB 4O65A 1XU2A 2V73A 4OI0A 3NV4A 1DIWA 5C9AC 4K40A 3ZDVA 1RUOA 2E33A 2VQAA 4GMP3 3RJ2X 3O1VA 2D6NA 3LIGA 2ID4A 4LPLA 3ZFFC 4SLIA 3WNLA 2LALA 4CCOA 2JXAA 3O14A 4Q4Y3 4AVSA 1GOFA 2H6BA 4L2NA 5I0UA 2EAKA 2QQKA 4COUA 2BFUS 1C5HA 5J36A 1OFSA 2NN8A 3VBSB 4XIKA 4E9KA 2GNDA 4GWMA 4YYOA 4YARA 1D7PM 1OPMA 1CONA 1NYWA 3OUJA 5FUNA 5ACA3 5BYNA 4MXWA 2VO5A 5B4XA 4AOCA 3UYJA 3H8XA 4FTBA 3N3HA 4M00A 1QU0A 2WRAA 5KC5A 5H9QA 2ZGTA 4ZXEA 1D4M1 1RUI1 1GZWB 2R1DA 4QQPA 2V4AA 4BISA 1GYKA 4Q4Y2 2A6VA 3AZVA 4Q4V3 4DQAA 5T50A 5GJ6A 1VBD2 1JU3A 2WFPA 4ET7A 5A1LA 1NA1B 4QMAA 3VZJA 2LM3A 4ORFA 1GOGA 4CDWA 3MIGA 3ZXFA 1ND2B 2D6LX 3AXDA 1TME2 5FBJA 1OOPC 1OI6A 3I3DA 5ACA2 5EYYA 3WT3A 2R0HA 1C8NA 1ENXA 2VMCA 2VNGA 4RGGA 4L11A 5A7NA 4CP9B 4CUBA 5J09A 4O7XA 1HN1A 2DCTA 1YO8A 1N47A 1WW4A 5KHJA 4FOQA 5EPAA 4QPGA 3D3AA 4AEDB 5JR2A 4TZDA 2E26A 1GP5A 2O8QA 4YVWA 1FMD2 2DFBA 5A1AA 1A3KA 2OQ6A 1U5XA 2XJSA 3MLJA 3VD4A 1AYM3 5C9AA 4DXRA 1T6BX 2XVLA 1HLCA 1AVBA 3N4MA 2FCTA 4QDRA 3TNPB 1QOSA 4U36A 5LY2A 4B1MA 2JDUA 4CCKA 4YM0A 2OZ6A 4Q27A 4LK6A 3ZO0B 1ASJ3 4A3ZA 4EN8B 5I91A 2VCBA 4BHPA 1QJX1 1W9FA 2W2IA 2R063 2WWJA 1HN0A 4TLGA 5C33A 1GNYA 3M3EA 5T54A 2PHLA 1U5ZA 4P9LA 4A2UA 2B46X 2LW8A 4CCEA 2NP0A 5EV7A 4XFIA 1HDKA 1W9TA 1CAVA 2XQXA 5CADA 3C3VA 2XLGA 2WFF3 3AP5A 4GD4A 4AHXA 2WO7A 4N8MA 2CAVA 4XDOA 4CUAA 4DMIA 4QGNA 1RTVA 3H8UA 5F5AA 4RL7A 4JQRA 3BTZA 3C8XA 1Z7S3 2A70A 2R062 5APAA 4MYEA 4P14A 4KWUA 2V4VA 2D43A 4EJRA 1OOPA 1DGWX 2VU9A 3A0NA 1NXD1 4UFJA 3RI9A 1ND3B 1WCQA 4M0NA 4AQ2A 1OLQA 5FZ6A 1MEC3 4WZCA 3VDDC 1LCLA 1LU1A 2WAOA 2ZACA 5FZ7A 3AZYA 1ULFA 1C8M3 3GBWA 4PCRA 2DURA 5LRRA 2ZMNA 4FTEA 3MFCA 1KS5A 4LIUA 1UD1A 3S30A 4AGVA 4MGYE 3BCWA 3FBYA 4CEYC 1G9AA 2RJLA 3ZFEC 2JDMA 4WV8A 4QPIB 1EV11 4M4RA 3AB0A 2YGLA 4AHZA 2JX9A 3NJVA 3B9CA 5A32B 1WCKA 2R1BA 4CCNA 2OPWA 3OY8B 4XJWA 4BPZA 2BGPA 2QE3A 1MEC2 5FZLA 3UGGA 1XU1A 2JG8B 1NX9A 3P5BA 2R49A 4AGRA 2ZGMA 3GZUC 4F83A 4Z92B 1C8M2 3ZXEA 2BWCA 5FYVA 2G1MA 5CAZA 1I9RA 2VR4A 5F6LB 2BPA2 3ST7A 4FAGA 1LRHA 3SLIA 3OGGA 4FO9A 3ZDSA 3VDBA 3AZWA 1FXZA 4KNCA 1LHWA 3H3UA 4FFGA 4QKDA 1UNBA 5CYYA 1TZOA 1JOBA 3PTRB 2ET7A 5T5PA 1UYYA 3FFZA 3OB8A 3MW3A 2HWF1 3POEA 4ES8A 4FP3A 2VCMA 3BYWA 3O12A 3DEMA 1RUG3 5FMBA 2SBAA 1HXS2 2BWAA 5GLUA 1UYXA 4ARYA 3ILFA 5F3CA 2HBUA 4TYSA 5FYBA 3ZXLA 4IQPA 4PF1A 1R1A1 1UY2A 1RJ7A 2E63A 2Z5WA 4P02B 4UF0A 4XFCA 3VDDA 2ZGOA 5FUPA 1CZSA 3B5LB 4HLTA 1GQGA 1UOFA 1G8WA 2WS91 5FP4A 4L0PA 3RZJA 1JBCA 1S0IA 1UMZA 5FMOL 1E5SA 2QQUA 1AR61 4CEYA 1J1TA 3L2HA 3BOPA 3ZFEA 2HWB2 4A44A 2V5YA 1H2MA 3THTA 2CGNA 4F8AA 1W8OA 4HVRA 4Y20A 5KHHA 4BQ3A 5DZEA 2RDNA 3CLPA 1UZYA 5A3LA 2UYAA 3DUIA 4LBQD 5LA9A 3V0BB 2IXIA 2QDRA 4LXLA 4P9WA 1AL22 1JW6A 1D2SA 2DUQA 5FY7A 2LUWA 3CZJA 5LK5A 3POWA 3B9IA 4JVAA 4NUBA 4NE9A 4CXYA 2VBDA 5JDBA 3AKTA 2Q8DA 5JR7B 2LRPA 4LUMA 3URFA 2FMYA 1BCXA 3AFGA 1W3XA 5DPNA 2FDFA 2XGXA 1CAWB 2Z69A 3JXSA 1R081 3MEPA 3RMYA 4AVBA 4N43C 4KL1A 1D4M3 1RUI3 2GNMA 3SC7X 2W9XA 3CZUA 1O8PA 1WWYA 1UYPA 2CY6A 3IT8A 3R05A 4XBLA 4LR4A 3VBFC 2JDAA 4AQ6A 2ZXQA 3NRUA 5E16A 1QY4A 4GIQA 4AE2A 5C71A 1QXJA 2XJRA 3VL9A 2GN7A 4W50A 5M0TA 1DQ2A 1ZZCA 3QBQA 1PGSA 3U14A 5FCCA 1J3PA 1MZ5A 2VC9A 5LATA 3RS6A 4K8RB 3ZSLA 3J7NA 4N9HA 4CP1A 1YCIA 1UOGA 2R6QA 2H6CA 2Z2SB 3H1MA 3JD73 4LQRA 3IPVA 2ES3A 1AX2A 1X7NA 3NV2A 2Q1MA 2QQPA 1CZVA 4QQOA 4N53B 3N9OA 4XW3A 4FPOB 4YVSC 2GMPA 2V09A 2XHKA 2WLQA 3ACIA 1OH4A 1JMUB 4D94A 3UNPA 1YFYA 1VAMA 5JVVA 2JE7A 5DZFA 1ZBE3 2W68A 2DCZA 1VBB1 3B93A 5A3WA 1UF2C 4BE3A 1YFWA 1DCSA 3JD72 1YEWA 4YW6A 1BVP1 2AGSA 2OQ7A 4DIQA 4YM1A 4CTEA 3WEZA 3VHRA 5KWRA 3ACLA 3MO4A 5LA0A 1QJX3 2VZSA 3I3EA 3KS7A 3WF4A 4BMEA 1QH7A 1OUSA 4MOAA 3VHPA 2SLIA 2OYZA 3ACGA 3KWVA 1IKPA 2VAUA 1GZTA 1IS4A 4QQHA 3TEXA 4N43A 1CPNA 1VBE1 4IW3A 1ZBE2 2IXLA 1O91A 4S2HA 1W8NA 1O8SA 1DQ1A 3FJSA 5FUIA 4HETA 5ISLA 4DO0A 3BB6A 4IEYA 3VBFA 1SLLA 1ULPA 2DCJA 3TEZA 3THPA 4CEWC 2ILMA 4DXSA 5FOBB 2WO3A 4H2AA 2B5HA 1DYPA 2Q1FA 3H8RA 4NMIA 5BUVA 2VQTA 3KSCA 2C0ZA 1YQ2A 1SBFA 4JQTA 4PT6A 5JI7A 4PBOA 3O1RA 5FP8A 2PN5A 1GZ9A 1RXGA 2E31A 4BQ4A 4A7ZA 3POJA 3O0WA 1LB2A 1LOAA 1WLWA 2QBXA 3WINE 2JENA 2ZEZA 3AMMA 5AFBA 4YVSA 2P3YA 4ISRA 4NIIA 3I49A 2CGPA 4OHYA 4EE2A 1E57A 5C5UA 4IL7A 3UL2A 4BK5A 1XOYA 1PVC2 5FWEA 4ZXKA 4YFZA 2KD7A 3KF3A 4NHMA 3BIEA 5A3MA 2GP5A 1EV13 2VZ1A 3M7AA 5SV5A 2VY0A 2CGOA 4HVOA 4I0BA 4MGSA 4NN0A 1DP0A 2J1UA 2WT1A 4QPWA 1OUXA 2WZR1 3WR0A 1VBC2 4XEZA 5EIYB 4XACA 1SLIA 3TAYA 1ZBA3 4AFMA 3IDBB 1U12A 3JU9A 3VDAA 3U07A 5LEJA 3DCQA 5IVYA 3WF2A 3QOPA 2OVUA 5LZ6A 1LHNA 3MHZA 1QMJA 5CNAA 1K5JA 1DQ4A 4MXWB 5FY5A 4MV2A 2F4LA 4HONA 3C2UA 2HWF3 5IT6A 2Q5TA 2HWC1 5F3EA 4CEWA 4HN1A 1ZBA2 3HN1A 1L7QA 1ZVFA 4N7IA 3ZSKA 2W5FA 3KQRA 1POV0 3HNYM 1CAXA 2XKOA 4P9XA 5FAXA 3N7JA 1CAUA 4LBQA 2XQRA 4PBPA 4UFMA 1GOHA 2KA3A 4Q0UA 3AKRA 2WN3A 2WA4A 3AMQA 3EJKA 1RVF3 3NNJA 3ON7A 1PZ9A 2EF6A 4CDWB 3ILRA 4FXGB 4A3XA 1R1A3 4LHLA 1RUH1 2WBKA 3UT0A 5JIUA 3LSDA 5J48A 4AYUA 3Q8BA 4INDA 5KHKA 1U5YA 2XUMA 1TNRA 1JZ3A 2WS93 4TSVA 3NKTA 3ZR5A 3BKZA 2BBVA 3M3QA 2VECA 3NJXA 1HW5A 4COWA 4IGPA 1AR63 1BEV1 2CSGA 3ELNA 4QPGB 1KFXL 1URXA 2DUPA 2PHTA 5ANQA 3OF1A 4YSFA 3M3CA 4NRQA 4IEZA 4YVWB 3SITA 3N9LA 2R041 3ZKUA 1UQXA 1RVF2 3AVRA 1YHFA 3DGTA 3O7OA 1S0GA 3AYAA 3CEWA 2JJ6A 1ZRIA 2LROA 4RS5C 3ZFFB 1WZXA 2KR2A 2VW0A 5A6ZA 1RJ8A 5J37A 4DB5A 2GP3A 2QQMA 5F39A 1XE0A 2GAUA 3LEKA 2XL9A 3M3OA 4MGZE 4QDQA 4YW4A 1NG0A 4XABA 2VBPA 2W92A 4Y22A 1AXYA 1QQP2 1KXGA 1OVSA 4NPRA 4ZS2A 4AFDA 3MZHA 1LESA 1ZZ9A 2YB7A 2ZAAA 4LNVA 1KJLA 1R083 1RUF2 4P00B 1CAVB 4BK4A 5IVJA 4AGGA 5IK8A 3R4DB 3DXTA 3ZYBA 4GKYA 1JYCA 2E7AA 2JDPA 2WNVC 2PAMA 3HD8B 3MIEA 5DUXA 1FPN1 4IXLA 3VDCA 3O1OA 2Y6LA 5LBFA 4KG8A 3VZMA 3ZN4A 4ATEA 2QKDA 1V70A 1B09A 2PAKA 2CWMA 2YUEA 2BGOA 3M70A 5LCWL 1OOPB 1REEA 2ZEYA 2BRTA 4XYXA 5A33A 4AFAA 3NMBA 2E7QA 3V0AB 5D8AC 1TQ5A 1DGRA 2EXHA 4XF3A 1LHUA 2JKBA 4DINB 4BMBA 5DN2A 3CU7A 2NPIA 1AJOA 5B4NA 4NIAA 5FO8B 2C9AA 1J3RA 1HB4A 3MGUA 3S7EA 4JTOA 4QU2A 2B8MA 2HKXA 4G9SB 1C57A 1VP6A 2ZKNA 3B3QE 2X5IB 1NKGA 4XJZA 5LBCA 1CX1A 1YJKA 5I0RA 5KC6A 4B4RA 3H7YA 1QJU1 4FPEA 1VBB3 3DYMA 1KQRA 4G4FA 4P9JA 4RS5A 3BN6A 3WNMA 4DRRA 3WCRA 1GZCA 1U0AA 3MIFA 2RE9A 4CU8A 1G9FA 1EY2A 3I3BA 2AREA 3EHKA 3HBKA 1XJAA 4CCJA 5DUUA 5IFPA 4HK8A 1BMV2 1AR81 4CDXC 1RMU2 1W28A 1SACA 3K4DA 2XMLA 3PU3A 5FMDA 3CO2A 4EN0A 5BNQA 3WQBA 5IYYA 4Y26A 5BNNC 2UY8A 4YGBA 1VBE3 1YC61 4JRAA 5JOWA 5KXBA 1UZVA 3T4VA 3RGBA 5GZGA 2RS33 2WNVA 1K42A 2TNFA 4K20A 1YIPA 1DYOA 4XUNA 3VZNA 1DLCA 1EAH1 1RGSA 1K3IA 3ZVXA 1WMXA 1FV3A 3T30A 4OMDA 1S0BA 5D8AA 3SH4A 5KR7A 1MZ6A 4CDUC 5CFCC 1UIKA 2ARXA 2XBO1 2O8OA 3VDDB 4PDWC 4UF0B 3WDTA 4MGTA 2RS32 2DVBA 3WNXA 4FBFA 2YXSA 3H7JA 1ZRFA 4MX3A 2Q4SA 1OF3A 4CEYB 1SFYA 2AC1A 2IXHA 1ZM1A 4YW5A 1RL3A 1W6PA 4JKMA 1VBA2 1PO21 2AENA 3GZAA 1W8UA 3AKPA 4KMQA 2C26A 3W59A 1Q3EA 2CV6A 4ZZ5A 4FPJA 4R9DA 2CU5A 3NVCA 4Y20B 4AFBA 1YNAA 2EICA 5HCAA 3JB8A 1N1TA 3H1YA 3LDRA 2YV8A 3N35A 2WT0A 5AVAA 4D3WA 4EWEA 1CD3G 1YRZA 1FV2A 3AYCA 2P37A 3JBG1 1ULCA 1S0FA 3OBAA 2VVEA 1GR3A 3H0OA 4HMZA 3H3LA 5DDJ2 3SNMA 5JSRA 4CDXA 1S2BA 1NCQC 1XNTA 4LLOA 4ZU5A 1GKBA 4IDZA 5T5LA 2RR12 1N3OA 4NO4A 2DBIA 5BNNA 2QQNA 1PMHX 3ZIXA 2A6YA 2Q0AA 3WOGA 1LGNA 3CNAA 4CRQA 1CZTA 3OCPA 4Q0QA 2HWC3 5A6YA 5FR3A 2HWE3 5FO9B 2DFCA 3K75B 4IGQA 3AP6A 5A70A 3VZLA 3EYPA 1ZA7A 4Q8KA 2EALA 3ORJA 4D6QA 1Y4WA 2XG3A 5A7WA 1IQDC 5C7GA 4LTAA 1VMJA 4I3PA 5EWSA 5HCFA 3LB9A 4CDUA 1OPOA 5CFCA 1FX5A 3KCXA 5FY8A 4DXTA 2XWBB 4PDWA 1RUH3 3AZZA 3H9AA 5FXXA 4D7SA 2ZCWA 2VJXA 3LOIA 1JOJA 1V6JA 2J1RA 4IERA 2YHJA 2VUCA 3HJRA 3PUQA 4OZOA 3WDVA 4OQ8A 3KHCA 2D6OX 3C7OA 4LO5B 2VNVA 2VH9A 2DYCA 4EZHA 4YM2A 1BEV3 4AQSA 2XJTA 3PVEA 2G4IA 4QX5A 2VOWA 5EYXA 1ENRA 5IVEA 2R043 1QKQA 4HFSA 1V9U2 1O59A 1Z78A 1VB2A 3A21A 1QJZA 3KVBA 3ZSJA 2K9ZA 1NE4A 2DF7A 2DU0A 4MLOA 4E4DX 3LWCA 3NAPB 3G7DA 3ZOIA 5K4LA 4NRPA 1LOGA 3HIFA 2X29A 1WW5A 1NCQA 4Y3OA 2VTXA 2ZGSA 5E88A 1PO11 3D0SA 4MGKE 3VGIA 3WX5A 1X8EA 3AP7A 1U5IA 2XJUA 3J7MA 4XUOA 5DG2A 4MZUA 3POBA 1QJY3 4RQPC 3VKNA 4TTGA 2QQJA 4QQ2A 2Y6FA 2J22A 4NAMA 4N43B 4MG2A 4Y1YA 3AYEA 1LU2A 4ZZ8A 2DCYA 5ERLA 2P1BA 3QACA 3DXUA 4R9BA 1BHGA 1XE7A 5FZOA 1IG0A 4IE5A 4IEWA 3WF3A 1NLRA 3IM0A 2HYKA 4MHUA 1FPN3 1F8VA 4L97A 1RUJ3 2PYTA 4QX3A 5I8TA 2P6HA 4JCKA 4P9IA 1RHI2 3BALA 2W1SA 3POFA 4KWKA 3OBZA 4XBNA 1F35A 2K0GA 1HB2A 1KDKA 3MYXA 4ITCA 4GWNA 5C70A 1PGW1 3TYJA 2D6KA 3I2KA 3L9JT 5JPNB 4GB32 5EJ3A 3PL0A 1RUC1 2C9KA 2CWSA 1UY0A 3AP4A 4BU2A 4EN7B 1KFUL 5A6XA 1KJRA 1TMF1 3QCWA 3IDAA 5BNPC 1S4CA 3FHQA 4YVSB 1XYOA 1RUJ2 3NNLA 3WW2A 4COYA 1VB4A 1QOTA 4RSUA 2FDJA 3GBGA 3K48A 5FLHA 1MR5A 2BVBA 2HWD1 3N9QA 3CBNA 1HQNA 5F3GA 5IJRA 1POV1 2MPFA 3QLQA 3DYOA 5LEKA 4OHZA 4H7LA 3USUA 2LS6A 3WDUA 4HOOA 4QX7A 1AYN3 1MS3A 3AFKA 1W06A 5KXEA 2AYHA 4JHZA 3LD8A 4E4HA 2NMNA 1AR83 3NNGA 4QHZA 4Q4W2 3HVDA 4DS0A 4NPMA 1C1LA 4HVQA 4RQPA 4HBNA 1AF9A 3ABZA 1OD3A 3FLPA 1JZ4A 4XJ8A 4R8HA 1AXZA 5IAXA 4Y1VA 2R071 3MLLA 4OHXA 2GMMA 3KQ4B 3U4XA 1W90A 2JKXA 4YGCA 4NIDA 1PMIA 3FX3A 3ES1A 1W8HA 1AYN2 3DPRC 2NLRA 4UWDA 1FOD1 2BU9A 1EAH3 1R091 1UOBA 4I30A 5A3UA 4Z07A 1MVQA 1K45A 1CAXB 3WW3A 3PJYA 1O7FA 1CAUB 4LBQB 3VBUC 3VBRC 3IBMA 3RZZA 3WW1A 4BH9A 5HV0A 4FPCA 4LOSA 4GALA 3PURA 4OUSA 4IV3C 4AW7A 1UX6A 3IMMA 4COVA 1X9TA 2WZEA 1QNYA 5BNPA 4Q4V2 4P9GA 2VZ3A 5FQ0A 1COV1 5KBFA 1PIV1 4CPBD 4COZA 3BU0A 2YROA 4CU9A 1DQ6A 2P34A 3PJQA 1DGLA 3BPZA 3PVBB 2PLV1 1LOFC 1NE6A 1LGBA 3ZPOA 1O5UA 4S2FA 1F4HA 2E32A 4EYUA 1OSGA 4NIGA 3SKJE 3H50A 2ZABA 5FKCA 3ALQA 1IKQA 4QX0A 4QDSA 1US3A 4FPGA 1S0CA 2VL4A 3JBG3 4H55A 3ETQA 5FYYA 3OG2A 2A6WA 3ZX7A 4LA2A 3WCSA 5IFTA 5A3TA 4HK9A 2GSYA 3OBRA 4HKOA 3GCXA 4XBQA 2W3JA 4BLIA 2ADEA 1GWMA 1AYM2 2WQ4A 1W8TA 3AMHA 4GULA 3IN9A 4ES9A 4NRMA 4Y22B 1HB1A 2OT7A 3E6BA 3W5NA 2J1TA 3A4UA 4WBBA 1JN2P 3ZXJA 4XAEA 3GCWA 4DEQA 3DPRA 2BFUL 4M01A 5C8CC 1ASJ2 1XYNA 4K1ZA 1Y43B 1N3QA 2OW4A 2E7TA 1OKOA 1UY1A 3LF7A 1F31A 2D6MA 2HYXA 2PA7A 2ZX4A 3MICA 4WVMA 4AAPA 4LORA 3VBUA 3ITQA 3OOXA 3VBRA 2KM2A 2RJ2A 1MS9A 3GDBA 2Y34A 3K4ZA 1UU6A 1W2AX 2IFRA 4IV3A 3FWEA 2D7FA 4E4ZA 4QT6A 2WFF2 1SFPA 3K2OA 2W46A 5CG8A 5A33B 1HRV3 1V00A 3T0DA 2EXIA 2TUNA 2XPJA 5C4WC 4XFGA 1YI9A 2H0BA 3MBWA 4KBBA 1Z7S2 1V6MA 1BBT1 2W08A 4W6XA 1M06G 1LOFA 2BBAA 3B94A 2VMEA 4B4QA 2UWBA 3PUIA 1XE8A 2IFWA 4M3CA 2AEYA 2F6BA 4YZ2A 5C3OA 4FQ4A 1W05A 3LOBA 4PIZA 4DOUA 5AC91 1Q8PA 1YQ6A 3I2FA 5F6KA 3U1XA 5FZHA 2XVKA 3WP6A 4RS5B 3KV4A 1VR3A 4XFBA 5FRAA 1PK6C 5JSOA 3DYPA 1PGL1 3D0JA 4YZ1A 2YPDA 3VL8A 1UW8A 1UXXX 1OFNA 3MW2A 2VMFA 3ZIWA 5L9RA 1PO13 1RUE1 2JE8A 3CJIB 3PU8A 4WVVA 3S7IA 1OKQA 2YZ4A 1W9WA 4UI9L 1OA3A 1UWWA 4IEOA 2BDRA 1OC1A 4BXFA 3AYDA 3F95A 4XE9A 2VQUA 4QX1A 4B1LA 4XHBA 1ULGA 1VRH3 3SH3A 3GF6A 3AP9A 5C8CA 5JSPA 5CU1A 3VBOC 2DDUA 4RD7A 2A75A 4UOJA 2ARAA 4YW7A 4DEVA 2ERFA 3I54A 5IVVA 5FZ3A 2VZRA 5HCBA 4BB3A 1JH5A 1HJFA 4UXAA 3N9PA 3ENRA 2EXKA 1MS5A 2HJIA 3HQUA 4NHXA 4OQ9A 3WNPA 1UU4A 2G9FA 1MPXA 3V64A 2PHWA 4I2OA 1OHFA 1XBFA 4YRDA 1H6YA 3CJXA 3FLTA 1QDCA 1VRH2 3K46A 3QH7A 5D8AB 3NNFA 5FYIA 2B9VA 5J98B 5C4WA 3IMNA 4AZZA 1RUC3 1V6LA 1VPHA 1LGCA 1RUG2 3JUUA 3BUCA 3PIGA 1W2TA 5GZFA 1WA4A 2VCCA 4XCBA 2DVDA 2HLEA 1O4YA 2W94A 3N9MA 2OXBA 4GXLA 4P9YA 3T2OA 4W4ZA 4BQWA 5A1FA 2YBSA 3K77A 4AI8A 4QGMA 4B4PA 4IEUA 3WLUA 3WUDA 1W6PB 1HRV1 2VZTA 3WXPA 2HWD3 4ASKA 1G9BA 4Y24A 1O5LA 2UURA 1PK6A 5ABJC 1H2KA 1GNHA 1POV3 3QD6A 1WW7A 1AX0A 2C4XA 2F4PA 4FTSA 1UMHA 2YDEA 3U4SA 5FYUA 4QHOA 1W3VA 2VZPA 4AHYA 4QX2A 1JI6A 3UK9A 1TG7A 1SZBA 4X8PA 4CDXB 4CSWA 4WZFA 4YM3A 3P3NA 1UKGA 3I97A 4IGOA 4XOGA 1Q8SA 4QM9A 4BM8A 5HV4A 5KXCA 1E5RA 1S2KA 2OKXA 4CP2A 2N7GA 1W04A 3NWKA 2R073 4CPBA 5BNNB 5A7OA 3J7HA 1OQEA 1QXRA 2WO1A 4B8EA 3VBOA 2RS11 5BY5A 4Y5TA 3ZN6A 3HBZA 3OEBA 3THCA 1GBGA 1BK0A 4AI2A 2MEV1 3HEIA 3NV1A 2PELA 3ILNA 1GQPA 2RM21 3FE5A 3KD4A 4FXKB 4GH4C 4UBHA 1FOD3 4DUVA 4YLZA 5FJKA 4G3YC 4WM8B 2I2SA 5FYCA 2X53S 1AR71 5FZEA 3TB0A 1O4ZA 5E89A 4Y5SA 3ZSMA 3HQXA 4O9EA 5A7WB 1J59A 2GDFA 3QH6A 3CL1A 1GSLA 1JTZX 1UX7A 1ZA4A 2XVGA 4CDUB 1I3HA 1OLRA 1D4M2 1RUI2 5LRSA 3SEPA 3ZYPA 4PDWB 1IPSA 4KWJA 3IAPA 3C7FA 3RRDA 1HV0A 3P6BA 1COV3 1PIV3 1JHNA 3NNMA 5DAWA 5LBEA 1LOBA 1WCSA 2Q1ZB 1BZWA 5DAQA 1WGPA 4LKEA 3EQEA 2ET1A 2WKKA 2IVJA 4CCLA 1JUHA 2PHUA 2QQIA 2DCKA 2BYVE 4HG6B 5FZ9A 1SG3A 2MHFA 4BYYA 5FPAA 5ABJA 1DF0A 3LSEA 1GWLA 1UPSA 2WNUB 4A42A 3GNEA 1RC6A 5DQ0A 5FZCA 2Y0OA 1K5MC 1OLME 1RUD1 3VKLA 4RHV1 1W2OA 3W58A 4BA6A 1LEDA 1L7LA 3MPBA 4AR2A 4A4AA 2AACA 2B39A 4EN9B 1HIXA 5L19A 1W99A 2RVAA 3ME2A 2D6PA 4BCUA 3J8F1 5L9BA 1CESA 2BQPA 1GMMA 3TRSB 2VZUA 2WR9A 1WW6A 4TXWA 3I2DA 1GWKA 3TN91 5C3RA 4XUTA 4GH4A 4Q2FA 4DRVA 1QJX2 5FZOB 4C0BA 1Q43A 1Y7BA 1OT5A 5FZ4A 3WG1A 1O3RA 4LLFA 4QB1A 1AR91 5FZ0A 4JC1A 5FPXA 3FZ3A 3I2IA 2YU2A 4J25A 1NLSA 4UFLA 3EB7A 2VW2A 4JHTA 2O1QA 4XFFA 5F32A 3U11A 5FV3A 4K8FA 1W8ZA 2ZJCA 3WHUA 4YGEA 5EJZB 1TEIA 2YMZA 3GZEA 1HJGA 4J1WA 5I93A 4CCCA 4XUQA 4PIXA 2R0FA 2HEYF 5D2AA 5A7SA 1BBT3 4XURA 1W6QA 3J26N 2ZZJA 4XPVA 3SCGA 3OPWA 4KGQA 4AAXA 4L9BA 5L73A 1VBA1 1X33A 4IEQA 3T3YA 4XQDA 5AC93 3ETPA 3N7KA 4BOWA 5JOYA 1V6KA 5CG9A 1CX4A 1LR5A 4FOVA 1D0GA 1K5MA 1MZEA 4Q0PA 1GICA 2OZJA 2P3JA 3POSA 3KV9A 3USUB 4FP2A 1SPPA 4CP0A 5GLZA 2Q8CA 3RNSA 4M3CF 5K7PA 1JZ7A 1NUKA 1KITA 1W03A 4Q0VA 5JOZA 3F2ZA 1RUE3 3VD7A 1SLTA 1HRI1 2BNNA 2CAUA 2QQVA 3HR9A 1EV12 2CNAA 4LKFA 2OUHA 1TVGA 2R30A 3LA7A 1O3TA 4N9IA 1NY71 5JI9A 1G9DA 2UWAA 4RQPB 4ZONA 1LHOA 1YYNA 5F5CA 2A3XA 5JOXA 1G6NA 2BUKA 2WIIB 4IV1C 4V2WA 3MIDA 2XKPA 3AL6A 3RZGA 1ST8A 2OUJA 4QX8A 4BXSV 2HH9A 2XJVA 1VMHA 5G05L 3U10A 5F3IA 3Q8CA 4YG6A 5K8SA 5FBZA 4NHLA 3W20A 1JUIA 1UMIA 3OGVA 1IS5A 3MF9A 4JX0A 4XAAA 4E4SA 5CFDC 5F2WA 4FFFA 4OHVA 1SLCA 4CDQC 2QCSB 4QXCA 2D3PA 4Y1ZA 4Y4YA 4OI1A 2Y33A 3I2JA 3SEEA 2HWF2 2J7MA 2OA2A 3PMEA 4Y33A 1RB8G 2FD8A 4K21A 4OHWA 1UYZA 1LJ7A 2BTVC 3MI8A 4HPKA 1KS4A 4V2VA 3V65A 2JDHA 2ZX0A 3H1WA 5L9VA 3FFQA 2D5FA 5H9RA 2RMU1 3PVNA 5BNPB 1YUDA 1ZZBA 2WZ8A 2XJQA 4OZXA 1GV9A 2Y60A 2OS2A 1Q56A 2OIIA 5FFOC 5I0DA 1ODMA 1IHMA 3IB3A 5C9AB 5FIXA 3ZMOA 1CIYA 1R1A2 1ULEA 2RS51 2BW8A 4DNYA 5FTTC 1ZNPA 2A1XA 2BZDA 2WS92 1FI2A 5IW0A 4KWLA 3KCYA 3KT1A 5EZWA 5LBBA 3LZZA 5SV8A 1AR62 4FPFA 3T2TA 4RGKA 4CUCA 5CB7A 4Z2AA 3I2OA 3CIHA 3WP3A 2VOKA 3CHXA 4YZ4A 2GC0A 2LTNA 2WINB 4KG0A 2FQPA 4QAWA 2ENRA 1Y9MA 3T0AA 1L7RA 2EIBA 1JXNA 3K3NA 3PUSA 4IV1A 4M4PA 4QHBA 3ZLIA 3O1SA 1EYBA 4QM8A 4YPJA 5JXJA 2VG9A 2VZQA 1OA2A 3E97A 3LKJA 2W87A 3ASIA 1CVNA 1H2LA 4BLJA 1RXFA 1XB9A 3RG0A 4KU8A 2IUWA 2VCAA 3DPRB 1QNWA 1SLAA 4Y1UA 5FP3A 2WL1A 1J1LA 5CFDA 1RUNA 1X50A 4X6QB 2VZVA 4NWVA 1JYIA 4CDQA 1AR73 4CU7A 3VBRB 3WF1A 2ZHMA 4Q4X1 4JGYC 1GLHA 3RI8A 1R082 1QJEA 1DQ5A 1UY3A 1IS6A 3POYA 3M3IA 3ZFGC 2A73B 1ULOA 1OF4A 5LASA 1EUTA 3WP5A 3MLKA 4NR1A 3S6PA 3KMHA 4E2QA 3UKTA 1N1YA 2WLPA 3HWJA 4ISQA 4K3UA 2G19A 5A80A 1CN1A 1FT9A 2GC2A 4F7ZA 1VMFA 4CU6A 4AVVA 3KCCA 4ZY9A 3RVHA 2WC2A 5FREA 3MDPA 3GHNA 2IZWA 4M3CB 4ZU4A 3RZKA 1QWRA 2J1AA 2VXRA 4LBKA 4XF0A 4UYBA 3ZKYA 3LEIA 3MPPG 3POIA 1SLBA 4K1YA 5FP9A 4M0HA 3OD4A 1Q8VA 2WZPP 1RUD3 1EPZA 1J84A 1SDWA 4RHV3 1A34A 1W2UA 1QXPA 4YGDA 4XXPA 4P5HA 2UY9A 2V5DA 4FPLA 1DZTA 1KDMA 4IE0A 4RR3C 3LGRA 3VBHC 4EN6B 1UZ0A 5FPVA 3PHMA 3UESA 3BTAA 2Y64A 3NV3A 1F15A 4JDMA 2VNOA 4META 1VJ2A 2XL7A 3J8F3 4QWNA 1X36A 1SMVA 2VZOA 1VBB2 2NQYA 3I3QA 1I6XA 4LKDA 2ARCA 5FPUA 2WSUA 1ULDA 2JIJA 2VOVA 1HQLA 5T55A 2YBPA 1MS4A 2QQLA 4Q4Y1 5C8CB 2JB8A 3TN93 1LOEA 3WZ1A 3S5QA 2VVFA 2Z79A 1VBD1 1IG3A 4YW2A 1OD5A 4URTA 5DUWA 2YC4A 4B29A 1AR93 1Q5OA 3N9NA 4K6BA 4JGYA 2V72A 1TME1 5ACA1 4E8DA 4NIHA 5EFUA 1D4VB 2JEMA 1B35C 2ATFA 1PZ8A 4Q1RA 5BPXA 3DKWA 3FUQA 1VBE2 4XIOA 3ZFGA 3PIJA 1XSQA 3OPTA 2UYBA 5C4WB 2FDGA 2VXJA 1QDOA 1IPJA 1YI7A 2Y0IA 2UU8A 4PI2A 4QKBA 2J42A 2Z42A 4XC9A 1N1SA 2W39A 1DU3D 2VMHA 1FMD1 1E5IA 5I0TA 3BODA 4C1XA 3ZFEB 5FK7A 3RWNA 4IEXA 3SQOA 3WSOA 2ZMKA 4XVHA 2C1FA 2GMEA 2ZHNA 3HT2A 4B7EA 4BZ4A 2WZR3 3TBDA 1Y9QA 1F5JA 3FMGA 4OI4A 1UIJA 5CEHA 4JDOA 1H1AA 2PHXA 4KGGA 4DZGA 1UL9A 1A78A 1PK6B 4CVUA 4UT5A 1RINA 2L9LA 2VTFA 3PMSA 4UW5A 4B3NA 4CUGA 4N53C 3VKFC 3M2MA 4RFT0 4RR3A 3VBHA 1CR7A 1Q8QA 1BXHA 4Q0SA 4CZSA 1HRI3 1MVEA 1A8DA 1H1MA 2WT2A 4XFAA 1KD7A 1T6GC 5JZGC 2WZR2 4AF9A 5IATA 1NT0A 1UPIA 2QJVA 3VBOB 3AXEA 3VUOA 1HKDA 2WYSA 4ZHNA 5FZFA 3ZN6B 3E6CC 1QEXA 2IVIB 2R061 2CDPA 2RG4A 1UZWA 1X82A 2XWJB 3BTXA 3I59A 4TLFA 4LJHA 3VD9A 2FDIA 1QGLA 1B35A 2P3IA 1W9SA 2AZ5A 4LT5A 1ZREA 3AL5A 4NROA 1DZRA 1VLNA 2PHRA 3E6DA 5HPOA 1G7YA 2PHFA 2WN2A 1FNZA 3I2HA 1OXCA 2WWUA 1SQ4A 3LEMA 5EXOA 4EWAA 2ZGKA 2HWC2 1PM7A 3AZXA 3A0KA 2FBEA 3ATGA 2HWE2 3IPVB 4I09A 4D8MA 2QZ3A 5JXGA 1JODA 5D21A 2RMU3 3AVSA 1DYKA 3HPNA 4JGZC 4EZ4A 3VB9A 3M4FA 3GZTB 1S55A 5GZEA 4FAHA 5BNOC 3GM8A 1XNCA 3L2YA 4MADA 4AEJA 5IHRA 2WNEA 5D1IA 3KT7A 3DF0A 2X05A 1I5PA 1OH3A 2G9GA 3BTYA 2H0VA 2WQ8A 3E5UA 3T08A 1RUH2 2BVVA 5C8WA 2A7AA 1MEC1 1OQ1A 2E51A 2GNTA 4BQXA 3LFIA 2PQSA 4LO8A 1C8M1 4N53A 5DMYA 1K12A 1VAKA 4ARXA 4LEJA 4J6GA 1BEV2 2J1VA 5JCTA 1DGRN 2KXLA 2WQZC 1ZZ7A 3PLQA 5FXWA 4AEMA 3PNAA 2DU1A 3KV5A 1S0DA 4Q1PA 2R042 2W1QA 3AKSA 4UFKA 2QQWA 5JZGA 3NO8A 1XXNA 3ZPYA 4A7KA 1W39A 5FZBA 3LDBA 2IXCA 3O0XA 4FPHA 1R1ZA 2YFZA 3VKOA 2JE9A 4DY5A 3VBFB 5J3UA 3HMYA 1TNFA 3NJZA 4HZFA 4AL9A 3KHBA 2D5HA 3UGFA 4LK7A 1HXS1 2BGCA 2YYOA 2GU9A 4GH4B 1H0BA 2JICA 5FPZA 5FO7B 4UW3A 3SMHA 4AEKA 4A41A 1LHVA 1CJDA 5GZCA 4JV4A 3D6EA 1PNFA 2VGDA 1BJQA 2GC3A 3KLSA 1F5FA 1AJKA 5IUQA 1QJY2 2JDNA 4Q4X3 3ZYFA 2VBBA 4FVVA 2ZMLA 3POGA 4FFHA 2XHNA 4XUPA 4JKKA 4LO4B 1XPWA 2W0XA 4JRLA 3SCHA 3T09A 4ASLA 4D7TA 2FDHA 1O4TA 3E5QA 1NCRC 4FFIA 2A3YA 1FPN2 4JGZA 2DBNA 1O3QA 2EIDA 5BNOA 2HWB1 5FYSA 1HQWA 3ZR6A 3A7QA 1NLQA 3T0BA 4PLNA 5KHIA 1W6QB 4M3CE 5EP9A 1IQAA 1GP6A 4A6OA 5H9SA 4S2GA 5A3PA 4WVZA 4XF1A 3MIHA 2RDQA 1QJU3 4EWDA 3PTYA 1C4RA 2JIGA 2RJKA 3WQ1A 3WV6A 2TEPA 1AL21 3EXUA 2WSVA 1XNKA 3TEWA 2Q8EA 1M4WA 1G86A 1K5MB 3J7LA 4WM7C 1G9CA 1FATA 4I01A 3TNQA 1ONAA 3S57A 4AFCA 3P1IA 2BV4A 2O0OA 5B2GB 2W1WA 1I1EA 3OGRA 1SPPB 4OUEA 5FZGA 1D2QA 2MNGA 2PHDA 3ZSEA 1ZRRA 3KZ4C 3LA3A 2JD4A 2VUJA 5F5QA 1CIWA 1QJU2 1JZ8A 1ACCA 3RYRA 3AM2A 5GLWA 1GP4A 2D3RA 2VW1A 4Q29A 5FZ8A 1MQTC 4HXCA 3BU7A 4X8NA 4CEWB 3OGSA 3AMNA 5A7QA 1VBD3 3U78A 5FP7A 4DUWA 1AR82 1YQCA 5IK5A 1CGPA 5LK7B 4YW1A 4N90A 3C7EA 4LIVA 4MGIE 1ZRDA 3OD0A 1TME3 2BJSA 4H14A 1W6OA 2ZGPA 4XZUG 4QGLA 1J3QA 1S0EA 2CYFA 3RPQA 5K0UC 2VUDA 2VM9A 4O61A 3JQXA 1W8WA 4OVEA 5C3QA 2ZBJA 2XBO3 4X6RB 1OQDA 3Q8FA 3P3PA 3HNBM 1O6UA 2CHHA 1PMJX 3X29B 4B7KA 1W0NA 3WQ7A 4CE8A 3OUHA 5L7OC 1NCRA 4LMFA 1EAH2 1V6IA 4HPKB 5FY0A 1FMD3 1BVVA 5KHGA 4FQZA 2ZA9A 4UBGA 2VNRA 5FY4A 1PO23 2DWRA 4XZPA 1WD3A 1H1IA 2GALA 4CXXA 4MSVA 2DVAA 5IK4A 3BGAA 5IVBA 4Z8BA 3AK0A 1HV1A 1YIFA 2ZX1A 2XBO2 3HOBA 2ZTNA 3GBFA 3JD71 1YLLA 2QQOA 2WWSA 3HNMA 4WM7A 4CP9A 4CXWA 1POQA 1ODNA 5C6CA 3FBMA 4D0QA 2WABA 4EQVA 4HSLA 3LAGA 3WF0A 3PVOA 4Y1XA 3ZYHA 2X5IC 5HXMA 1PO22 3GJBA 2B4KA 2ZGUA 5DXDA 4LE4A 1ZBE1 2ZAHA 3ZFFA 1ZRCA 4IV1B 3DKQA 1XNBA 1MQTA 3HQRA 1T2XA 3MUY1 4XJ9A 3CDZB 3JBG2 4UAPA 1SBEA 2FCVA 3RZLA 1PM4A 2GNBA 2WAAA 4KI5M 2FZ2A 4LBNA 4DUXA 4L99A 4URAA 4CA9A 5CFDB 5I8SA 1DLLA 5K0UA 3ZYRA 4CDQB 4K7JA 4JZRA 1OA4A 4E2GA 4OLLA 2C5DA 3GJAA 5L7OA 3O1PA 2JG9C 4LITA 5FYHA 1QOOA 1AX1A 4L8QA 2BNOA 1ENQA 2YU1A 2VD7A 1NQDA 4XETA 3D4KA 1PVC1 1PHMA 5FMOS 2RHPA 3DV8A 4NHKA 5E1RA 2YG0A 3VLBB 3OSDA 3DL3A 3IIAA 5EJ1B 5EHDA 2I07B 2X09A 1SFNA 4D6RA 2AUYA 2NMOA 2JD9A 3O5SA 3SKVA 4ZU7A 5FZAA 3V0AA 2XXZA 4PLMA 1LOCA 3IIIA 1VBC1 3PUAA 4H3WA 1TE1B 1C1FA 3ES4A 2ORZA 4LO6B 4PJYA 5T5OA 4MGQA 2IC1A 2TBVA 4XMAA 2AEZA 1QIQA 5F37A 3B69A 5BXXA 3WP4A 4MO3M 3ZN5A 4ZKTB 1W6NA 4V1PA 2Y6HA 4JTNA 2Y26A 2X5IA 3SCFA 1WD4A 3WD5A 4D7YA 2ARBA 4ZS3A 4CYDA 1UN1A 2XONA 4Y4RA 2ZHLA 2W91A 5CISA 1IOAA 3AC0A 3EBRA 3OEAA 2EAAA 3WHTA 1H4HA 1GANA 1ZBA1 4A6SA 5A7PA 4AVTA 1GNZA 2WNVB 5CBLA 3FHAA 1HXS3 1PO12 5GZDA 1F4AA 1GFF2 2ADDA 4IESA 2ZGLA 4Z82A 3Q8EA 2X8KA 3K51A 4J1XA 2BP6A 3FL7A 4XJUA 1JYWA 4JGYB 4HT1T 2JG9A 4LULA 2YGMA 2P17A 4NHYA 4KBZA 5E6HA 3LIHA 1H8TC 2BERA 3UGHA 1ALYA 2EVXA 3ZFGB 4GMP0 2PTMA 4EROA 1TMF3 5CKMA 5FDBA 4KH9A 1WKYA 1BYHA 2IXJA 4LBOA 2HWB3 2R16A 5C3PA 1W8FA 3BI3A 1BKZA 4MH0E 5LWBA 4GA9A 2C24A 1RVF1 3LA2A 1LTEA 1UAIA 3HN3A 5LW9A 1PGW2 1UKRA 3VZOA 1WMEA 1X9PA 1YFXA 5J1XA 3RYKA 4HN0A 4Q8LA 5F2SA 1AL23 1QF3A 1RUC2 1FNYA 3VD3A 1VRBA 1W6MA 4DFSA 2D93A 3JZVA 3J9SA 1L3JA 4AI0A 4FOWA 1TMF2 2QUOA 4YZ3A 5HXVA 2YC2A 5F8PA 4RR3B 4E8CA 4W6WA 3VBHB 1SDDB 4CCMA 4Z2WA 1QQP1 1AL0G 5JLVA 4D6SA 2HWD2 4GZ9A 1OVPA 3WVJA 1RUF1 2O14A 3LPFA 4ASMB 3WG2A 1C3HA 3AX4A 5FLJA 2WNOA 3DECA 5F1RA 2GZWA 3NAPC 5GM0A 3VKMA 2HEWF 2VVDA 4PHZA 3N36A 4PF5A 3AMPA 1LEMA 5G04L 3IZOA 1R093 1OURA 4QQLA 3SISA 1LECA 2WYFA 5A3OA 1GU3A 2FZ1A 3E5XA 3OYWA 5C3SA 1YJLA 3TWIA 1NZIA 3I59B 1FAYA 3WNNA 1B35B 3IAQA 4FCAA 1BQPA 1VE0A 2R072 4QPYA 2A5ZA 3DN7A 1C28A 5EQUA 5CFCB 5FZMA 1H8TA 1JU4A 1HX6A 3WG4A 3NL1A 2Y6JA 1AXKA 4O9GA 5IK7A 4PQ9A 4Q26A 1H9WA 4L92A 4AI1A 2VTXJ 5HCHA 1FOD2 1US2A 2P3KA 1R092 2WUHA 5FZKA 5GLVA 5FZ1A 2PLV3 1C5IA 2D40A 3ZXAC 1LODA 2XOMA 4QB6A 1AUYA 2VMDA 5JPMB 3VD5A 2W52A 3LQCA 3USSA 2NYYA 1WUVA 5J7MA 2QDNA 2J1EA 4PIYA 4RN5A 4XDPA 1YFUA 3K4AA 4AHWA 2PXJA 5FPBA 1COV2 1DBNA 1PIV2 2Q30A 4ATFA 3I7DA 5GLTA 1BMV1 1RMU1 1NCQB 2VUAA 1YQ8A 2PLV2 3ROUA 1JZ6A 2RV9A 4XDQA 3PDQA 1A6CA 1W0OA 5CA6A 4MHRA 1RYYA 2QVSB 5FYTA 5JZGB 4OUMA 1E5HA 4A7YA 3NAPA 3NW4A 4XJAA 1WBFA 1F9KA 1XQNA 1LULA 3AJZA 4NAOA 4OMCA 1LENA 3AJYA 2D44A 2E53A 3FLRA 3VBSC 4LHSA 1KEXA 3CQOA 1CJPA 3LCPA 3T4HB 1J58A 1UXZA 2PQQA 4R9AA 4LBMA 4R4ZA 3WDYA 3U0ZA 2F17A 2NZ9A 3NKGA 4IEPA 3WW4A 3OTFA 2E6VA 4QXHA 3I2GA 4HSJA 1NZCA 3LE0A 4AVCA 2OPKA 1Q8OA 1LNSA 1NQJA 2RS31 4QU1A 1W9YA 1ZZ8A 3CKHA 2VQ0A 4XXAA 1EP0A 1V0AA 3KB5A 2DVFA 3D5OA 4C1WA 1NA1C 4DY3A 5IWFA 1PVC3 4JGZB 2GH2A 1WCDJ 4HKLA 4I0WB 1ND2C 1MS1A 4PQQA 1UOJA 5BNOB 2EXJA 4I3GA 4XF9A 5F9TA 2P6CA 3UETA 2AH2A 2QNKA 4IE6A 1VBC3 4QXBA 2W47A 4NJ4A 3J4UH 5I8YA 5DAXA 1JOPA 4C0HA 4GWIA 4IE4A 5H9PA 3WDWA 1S1AA 1H9PA 1H2NA 5DDJ1 4AEDC 2A6ZA 4YW3A 3UJOA 1BBT2 5JUVA 1CQ9A 2J1SA 1P8JA 4XHXA 2RR11 3MF6A 1UCXA 2NM1A 3ACHA 5FK8A 3SXWA 3VN4A 2Y6GA 1SCSA 4MVTA 5AC92 3O1UA 5FWJA 4AWDA 1W0PA 4GWJA 4EV0A 5T3NA 5E8AA 2JECA 2W95A 5JXIA 1PGL2 5DZGA 3VBSA 4XCAA 2PMWB 4MUVA 4LHNA 1V6NA 3JQWA 3G6JB 3LPGA 3IKWA 4NWWA 3T1LA 1RUE2 3N7LA 4CCDA 3VZKA 1PNGA 4XTPA 3OPZA 4R4XA 3JB4C 3HAGA 3MV11 2XH6A 4I02A 3EO6A 4W6YA 4YG3A 1GZWA 1W6OB 1Z0HA 1H8VA 2YBKA 3R6SA 1Y9GA 2FCUA 3R0RA 2ZPXA 4YWAA 2HWE1 4OYUA 3JCIA 5LY1A 1NA1A 1RIRA 1NCRB 5FQ0B 2UWCA 3UKNA 1ND2A 4DPNA 1CWPA 2P4EA 1APNA 1IGOA 5JMOA 3I8TA 3NJYA 3VV1A 3S5AA 4I0AA 1ND3C 1V9U1
chains in the Genus database with same CATH topology
2ZS6B 2DVGA 2QZ2A 1V6OA 1YWKA 4AEDA 4OULA 4NOTA 4WM7B 2IXKA 2VMIA 3ZYJB 4HKWA 2JDZA 4XTMA 4SBVA 3AKQA 1WBLA 4MXVA 3IWZA 4QPIC 4FPYA 4LBJA 4OI2A 1QQP3 1ZX5A 1HRV2 1RUF3 3WQ0A 1GQHA 2JG8C 2RS13 2I45A 4UW4A 1WMFA 4HL0A 1REDA 5AFEA 4YNIA 1MQTB 2MEV3 2RM23 4OFGA 5K9YA 4H7MA 3CJIC 2XLFA 1WLTA 3SHRA 1PZ7A 3O0VA 1RHI1 4S2DA 4WVMB 3M1HA 2FMDA 4ONUA 3VBUB 1X8MA 1XNDA 3FC0A 4C91A 4AK3A 4NVPA 1QJY1 2YY1A 4BWOA 5K0UB 1IS3A 4IV3B 1N1VA 4GB31 3Q9OA 2PAEA 2RS12 4D69A 5L7OB 5T5JA 3CF6E 3KGZA 3D8CA 2MEV2 4KQ7A 2RM22 4PLOA 1RUJ1 3GYDA 3RJRA 2D98A 3FHIB 1AR72 2VOXA 1ND3A 3ZXKA 2XLAA 1SEFA 4TWTA 5FLIA 1MZFA 3FUOA 1OMIA 1IZ3A 5JIAA 3ZYGA 1H4GA 4KU7A 1DZQA 4YFWA 3KGLA 4E27A 5GKAC 3UJQA 4QPIA 1Y3TA 2BEOA 4Q4W1 1RMU3 3KM5A 1ZYBA 3D82A 1W6NB 2A3WA 2XJPA 5A32A 2I74A 4C90A 4DXZA 4LHKA 4WVWA 2EIGA 3RYPA 3OY8A 4GMP1 5JAXA 2JG8A 3ECQA 4GKXA 3GALA 5AVPA 3R4UA 3WDXA 1YXWA 2ZKLA 1AYN1 1RUD2 1VIWB 1MS0A 3H3ZA 4RHV2 4RGAA 1VAVA 1QHDA 3KT4A 3CJIA 3W9AA 5J96B 2ZZQA 1CPMA 4QD2A 1XYPA 1NOVA 3J8F2 1DQ0A 4UW6A 4R52A 1UU5A 2A6XA 3MIBA 4W65A 2JG9B 2DUOA 3B01A 5JWPA 2P2KA 4HANA 4Q4V1 3TN92 3I4IA 4JAAA 3B7MA 3WG3A 2B9UA 4LA3A 1ZZ6A 4XMIA 4WM8C 1AR92 1MACA 4LUKA 3MW4A 4AG4A 2B45X 1VBA3 2CTVA 4YZ5A 1BK1A 4R9CA 1REFA 2HEVF 1XRUA 2Y38A 4QXKA 3GHMA 2ETEA 4RA0A 2VULA 3APBA 3IDCB 3NSTA 1AZDA 1WLDA 1DHKB 2R32A 5DDJ3 2BNMA 1W6MB 3HT1A 3VHOA 3TOJA 2WJSA 5FOJB 2Q8OA 2K2SA 1AYM1 2QFEA 2RR13 3V0BA 4LBLA 1WMDA 1SBDA 3OJBA 5CVRA 3N7MA 1S0JA 3T1MA 1RITA 2WNUC 1MS8A 1ASJ1 2D97A 3IDEA 1IPKA 4AXOA 3B00A 2ZX3A 4N7UA 5HI0A 1A8MA 2XB6C 4Y5Z0 1HRI2 2DTWA 1CAWA 1DGWA 4FOYA 3OYWB 1NY72 3VHNA 2WFF1 4XQ4A 4U2AA 2VPVA 2ZGQA 2VMGA 4XF4A 2EA7A 2ZOEB 1H8TB 3BOWA 2ZHKA 4LO7A 1Z7S1 4K9SA 3WY6A 1EPWA 4GQ7A 4WM8A 5GALA 4JDNA 2AR6A 2D3SA 5TSWA 4XQWA 1PVXA 1NXMA 4IETA 2GH8A 1V9U3 2YPJA 1QH6A 2RS53 3RDIA 3ZXGA 2B42B 1DG6A 5ABJB 1VALA 1KRIA 3ZXDA 5DUVA 1WLCA 1O3SA 4XFHA 5T52A 2RMU2 1DDLA 5CIRA 2YC0A 3S0MA 2B7YA 2DTYA 3RQ0A 2FHRA 1H30A 4FSJA 1FYUA 4YG0A 2RS52 2WNUA 3RMXA 2WA3A 4XILA 3MFAA 1D0HA 2DV9A 2CL2A 1N3PA 3UKVA 1LKNA 1RHI3 3SH5A 2ZGNA 4FPKA 2ZGRA 3R4SA 4BIOA 2A71A 4Z1VA 1UZZA 3INAA 3ZMNA 1VRH1 2PFWA 4GB33 3M8LA 3WUCA 4LE3A 5L36A 1RUG1 4BIFA 5JMCA 5HBAA 1I5ZA 2E9QA 4AVAA 3V56A 1DFQA 4AI3A 3UV9A 1F2NA 4CDWC 3B02A 4Q4X2 1ENSA 1SCRA 3BIWE 4AQTA 3OGJA 5I0SA 5DG1A 5KXDA 4BQ1A 4F3JA 3OBTA 4FT8A 2IWGB 3RSJA 4QPGC 5BV6A 2ZX2A 2GC1A 2GN3A 1AHSA 4Q4W3 4YVWC 4IEVA 3ZYIB 1XU2A 2V73A 4OI0A 3NV4A 1DIWA 5C9AC 4K40A 1RUOA 3RJ2X 2VQAA 4GMP3 2D6NA 3ZFFC 4SLIA 2LALA 2JXAA 3O14A 4Q4Y3 4AVSA 2H6BA 5I0UA 4L2NA 2EAKA 4COUA 2BFUS 1C5HA 5J36A 1OFSA 2NN8A 3VBSB 4XIKA 4E9KA 2GNDA 4GWMA 4YYOA 4YARA 1OPMA 1CONA 1NYWA 5ACA3 5BYNA 4MXWA 4FTBA 3N3HA 4M00A 1QU0A 5KC5A 5H9QA 2ZGTA 1D4M1 1RUI1 1GZWB 2R1DA 4QQPA 1GYKA 4Q4Y2 2A6VA 3AZVA 4Q4V3 4DQAA 5T50A 5GJ6A 1VBD2 2WFPA 1NA1B 4QMAA 3VZJA 2LM3A 4ORFA 4CDWA 3MIGA 3ZXFA 1ND2B 2D6LX 3AXDA 1TME2 5ACA2 1OOPC 1OI6A 5EYYA 3WT3A 2R0HA 1C8NA 1ENXA 2VNGA 4RGGA 4L11A 5J09A 2DCTA 1YO8A 1N47A 1WW4A 5KHJA 4FOQA 4QPGA 4AEDB 4TZDA 2O8QA 4YVWA 1FMD2 2DFBA 1A3KA 2XJSA 1U5XA 3MLJA 1AYM3 5C9AA 2XVLA 1HLCA 1AVBA 3N4MA 3TNPB 1QOSA 4U36A 4YM0A 2OZ6A 4Q27A 3ZO0B 1ASJ3 4EN8B 5I91A 4BHPA 1QJX1 5C33A 2R063 5T54A 3M3EA 2PHLA 1U5ZA 4P9LA 4A2UA 2B46X 5EV7A 4XFIA 1HDKA 1CAVA 5CADA 3C3VA 2XLGA 2WFF3 3AP5A 4AHXA 2CAVA 4DMIA 4QGNA 1RTVA 3H8UA 4RL7A 4JQRA 1Z7S3 2A70A 2R062 4MYEA 4P14A 2D43A 4EJRA 1OOPA 1DGWX 2VU9A 3A0NA 1NXD1 3RI9A 1ND3B 4M0NA 4AQ2A 1OLQA 1MEC3 4WZCA 3VDDC 1LCLA 1LU1A 2ZACA 3AZYA 1ULFA 1C8M3 3GBWA 4PCRA 2DURA 5LRRA 2ZMNA 4FTEA 3MFCA 1KS5A 4AGVA 1UD1A 3S30A 4CEYC 4MGYE 3BCWA 3FBYA 1G9AA 2RJLA 3ZFEC 4WV8A 4QPIB 1EV11 3AB0A 2YGLA 4AHZA 2JX9A 5A32B 3B9CA 1WCKA 2R1BA 3OY8B 4XJWA 4BPZA 2QE3A 1MEC2 1XU1A 2JG8B 4AGRA 4F83A 2R49A 2ZGMA 3GZUC 4Z92B 1C8M2 3ZXEA 2BWCA 5CAZA 1I9RA 2BPA2 5F6LB 3ST7A 4FAGA 1LRHA 3SLIA 3OGGA 4FO9A 3ZDSA 3AZWA 1FXZA 4KNCA 1LHWA 3H3UA 2ET7A 5T5PA 3FFZA 3MW3A 2HWF1 4ES8A 4FP3A 3O12A 1RUG3 2SBAA 1HXS2 2BWAA 5GLUA 3ILFA 4TYSA 3ZXLA 4IQPA 1R1A1 2E63A 1RJ7A 2Z5WA 4XFCA 3VDDA 2ZGOA 3B5LB 4HLTA 1GQGA 1G8WA 2WS91 1JBCA 1S0IA 1UMZA 5FMOL 4CEYA 1AR61 1J1TA 3L2HA 3BOPA 3ZFEA 2HWB2 2V5YA 1H2MA 3THTA 2CGNA 4F8AA 4HVRA 4Y20A 5KHHA 5DZEA 3CLPA 1UZYA 5A3LA 2UYAA 3DUIA 4LBQD 3V0BB 2IXIA 2QDRA 4P9WA 1AL22 1JW6A 1D2SA 2DUQA 2LUWA 5LK5A 3POWA 3B9IA 4JVAA 5JDBA 3AKTA 5JR7B 4LUMA 3URFA 2FMYA 1BCXA 3AFGA 2XGXA 1CAWB 2Z69A 1R081 3MEPA 3RMYA 4AVBA 4N43C 4KL1A 1D4M3 1RUI3 2GNMA 2CY6A 3IT8A 3R05A 4XBLA 4LR4A 3VBFC 4AQ6A 5E16A 1QY4A 4GIQA 4AE2A 1QXJA 2XJRA 3VL9A 2GN7A 1DQ2A 1ZZCA 3QBQA 1PGSA 5FCCA 1J3PA 1MZ5A 3RS6A 3ZSLA 4CP1A 4N9HA 1YCIA 2R6QA 2H6CA 2Z2SB 3H1MA 3JD73 3IPVA 2ES3A 1AX2A 1X7NA 3NV2A 2Q1MA 2QQPA 4QQOA 4N53B 4XW3A 4FPOB 4YVSC 2GMPA 2V09A 2XHKA 2WLQA 4D94A 1YFYA 1VAMA 5JVVA 2JE7A 5DZFA 1ZBE3 2W68A 2DCZA 1VBB1 3B93A 4BE3A 1UF2C 1YFWA 3JD72 1BVP1 2AGSA 4YM1A 4CTEA 3VHRA 5KWRA 3ACLA 1QJX3 3KS7A 4BMEA 1QH7A 3VHPA 2SLIA 2OYZA 1IKPA 1IS4A 4QQHA 4N43A 1CPNA 1VBE1 1ZBE2 2IXLA 1O91A 4S2HA 3FJSA 1DQ1A 4HETA 3BB6A 4IEYA 3VBFA 1SLLA 2DCJA 3THPA 4CEWC 2ILMA 5FOBB 2B5HA 1DYPA 5BUVA 3KSCA 2C0ZA 1SBFA 5JI7A 4PBOA 2PN5A 1GZ9A 4A7ZA 3O0WA 1LB2A 1LOAA 1WLWA 3WINE 2JENA 3AMMA 5AFBA 4YVSA 2CGPA 4ISRA 4OHYA 1E57A 4IL7A 3UL2A 1PVC2 4ZXKA 4YFZA 4NHMA 5A3MA 1EV13 3M7AA 5SV5A 2VY0A 2CGOA 4HVOA 4I0BA 4NN0A 2WT1A 2WZR1 3WR0A 1VBC2 4XEZA 3TAYA 1SLIA 1ZBA3 4AFMA 3IDBB 1U12A 3JU9A 3U07A 5LEJA 3QOPA 2OVUA 1LHNA 1QMJA 5CNAA 1DQ4A 4MXWB 4MV2A 3C2UA 2HWF3 5IT6A 2Q5TA 2HWC1 4CEWA 4HN1A 1ZBA2 3HN1A 1ZVFA 4N7IA 3ZSKA 3KQRA 1POV0 1CAXA 2XKOA 4P9XA 5FAXA 3N7JA 1CAUA 4LBQA 4PBPA 2KA3A 4Q0UA 3AKRA 2WA4A 3AMQA 3EJKA 1RVF3 4CDWB 1PZ9A 2EF6A 3ILRA 4FXGB 4A3XA 1R1A3 4LHLA 1RUH1 5JIUA 3LSDA 5J48A 4AYUA 4INDA 5KHKA 1U5YA 2XUMA 1TNRA 2WS93 4TSVA 3NKTA 2BBVA 3M3QA 2VECA 4COWA 1HW5A 1AR63 1BEV1 3ELNA 4QPGB 1KFXL 1URXA 2DUPA 2PHTA 3OF1A 4YSFA 3M3CA 4IEZA 4YVWB 3SITA 2R041 1RVF2 3O7OA 1YHFA 3DGTA 1S0GA 3AYAA 3CEWA 2JJ6A 4RS5C 3ZFFB 2VW0A 1RJ8A 5J37A 4DB5A 2GAUA 2XL9A 3M3OA 4MGZE 4YW4A 1NG0A 4Y22A 1AXYA 1QQP2 1KXGA 4NPRA 4AFDA 3MZHA 1LESA 1ZZ9A 2ZAAA 4LNVA 1KJLA 1R083 1RUF2 1CAVB 4AGGA 5IK8A 3R4DB 4GKYA 1JYCA 2E7AA 3MIEA 2WNVC 2PAMA 3HD8B 5DUXA 1FPN1 4IXLA 3VZMA 4KG8A 3ZN4A 4ATEA 2QKDA 1V70A 1B09A 2PAKA 2CWMA 2YUEA 3M70A 1OOPB 1REEA 4XYXA 5A33A 4AFAA 2E7QA 3V0AB 5D8AC 1TQ5A 1DGRA 2EXHA 4XF3A 1LHUA 2JKBA 4DINB 4BMBA 3CU7A 2NPIA 1AJOA 5FO8B 2C9AA 1J3RA 3MGUA 3S7EA 4JTOA 4QU2A 2B8MA 2HKXA 4G9SB 1C57A 1VP6A 2ZKNA 3B3QE 2X5IB 4XJZA 1YJKA 5I0RA 5KC6A 4B4RA 3H7YA 1QJU1 4FPEA 1VBB3 4G4FA 1KQRA 4RS5A 4P9JA 4DRRA 4E2QA 3WCRA 1GZCA 1U0AA 3MIFA 2RE9A 1G9FA 1EY2A 2AREA 3EHKA 5DUUA 4HK8A 1BMV2 1AR81 4CDXC 1RMU2 1SACA 3CO2A 4EN0A 5BNQA 4Y26A 5BNNC 2UY8A 4YGBA 1VBE3 4JRAA 5JOWA 5KXBA 5GZGA 2RS33 2WNVA 2TNFA 4K20A 1YIPA 3VZNA 1EAH1 1RGSA 3ZVXA 1FV3A 1S0BA 5D8AA 3SH4A 1MZ6A 4CDUC 5CFCC 1UIKA 2ARXA 2XBO1 2O8OA 3VDDB 4PDWC 3WDTA 2RS32 2DVBA 3WNXA 4FBFA 2YXSA 3H7JA 1ZRFA 4MX3A 2Q4SA 4CEYB 1SFYA 2IXHA 4YW5A 1ZM1A 1RL3A 1W6PA 1VBA2 1PO21 2AENA 3GZAA 3AKPA 3W59A 1Q3EA 2CV6A 4FPJA 4R9DA 3NVCA 4Y20B 4AFBA 1YNAA 5HCAA 3JB8A 1N1TA 3H1YA 4D3WA 2YV8A 3N35A 2WT0A 5AVAA 4EWEA 1CD3G 1YRZA 1FV2A 3AYCA 2P37A 3JBG1 1ULCA 1S0FA 4HMZA 2VVEA 1GR3A 3H0OA 5DDJ2 5JSRA 3SNMA 4CDXA 1S2BA 1NCQC 4LLOA 4ZU5A 1GKBA 5T5LA 2RR12 1N3OA 4NO4A 5BNNA 3ZIXA 2A6YA 2Q0AA 3WOGA 1LGNA 3CNAA 4CRQA 3OCPA 4Q0QA 2HWC3 2HWE3 5FO9B 2DFCA 3AP6A 3VZLA 4Q8KA 2EALA 2XG3A 4LTAA 4I3PA 5EWSA 5HCFA 3LB9A 4CDUA 1OPOA 5CFCA 1FX5A 3KCXA 2XWBB 4PDWA 1RUH3 3AZZA 3H9AA 4D7SA 2ZCWA 3LOIA 1JOJA 1V6JA 4IERA 2YHJA 3WDVA 2D6OX 4LO5B 2VH9A 2DYCA 4YM2A 1BEV3 4AQSA 2XJTA 3PVEA 2G4IA 4QX5A 2VOWA 5EYXA 1ENRA 2R043 1QKQA 4HFSA 1V9U2 1Z78A 1VB2A 3ZSJA 1QJZA 2K9ZA 1NE4A 2DF7A 2DU0A 4MLOA 4E4DX 3LWCA 3NAPB 3G7DA 1LOGA 3HIFA 2X29A 1WW5A 1NCQA 5E88A 3WX5A 2ZGSA 1PO11 3D0SA 4MGKE 3VGIA 1X8EA 3AP7A 1U5IA 2XJUA 5DG2A 4MZUA 1QJY3 4RQPC 3VKNA 4QQ2A 4N43B 4Y1YA 3AYEA 1LU2A 2DCYA 3QACA 4R9BA 1XE7A 4IEWA 1NLRA 3IM0A 2HYKA 1FPN3 1F8VA 4L97A 1RUJ3 2PYTA 5I8TA 4JCKA 4P9IA 1RHI2 3BALA 4KWKA 4XBNA 2K0GA 1KDKA 3MYXA 4ITCA 4GWNA 1PGW1 3TYJA 2D6KA 3L9JT 5JPNB 4GB32 5EJ3A 1RUC1 2CWSA 3AP4A 4EN7B 1KFUL 1KJRA 1TMF1 3QCWA 5BNPC 4YVSB 1XYOA 1RUJ2 3WW2A 4COYA 1VB4A 1QOTA 4RSUA 3K48A 3GBGA 5FLHA 1MR5A 2BVBA 2HWD1 1HQNA 1POV1 2MPFA 3QLQA 5LEKA 4OHZA 4H7LA 3USUA 3WDUA 1AYN3 1MS3A 3AFKA 5KXEA 2AYHA 2NMNA 1AR83 4Q4W2 4DS0A 1C1LA 4HVQA 4RQPA 4HBNA 1AF9A 3FLPA 4XJ8A 4R8HA 1AXZA 4Y1VA 2R071 3MLLA 4OHXA 2GMMA 3U4XA 4YGCA 1PMIA 3FX3A 3ES1A 1AYN2 3DPRC 2NLRA 1FOD1 1EAH3 1R091 4I30A 4Z07A 1MVQA 1CAXB 3WW3A 3PJYA 1O7FA 1CAUB 4LBQB 3VBUC 3VBRC 3IBMA 3RZZA 3WW1A 4BH9A 4FPCA 4GALA 4OUSA 4IV3C 4AW7A 1UX6A 4COVA 1QNYA 5BNPA 4Q4V2 4P9GA 5FQ0A 1COV1 5KBFA 1PIV1 4COZA 2YROA 1DQ6A 2P34A 3PJQA 1DGLA 3BPZA 3PVBB 2PLV1 1LOFC 1NE6A 1LGBA 1O5UA 4S2FA 1OSGA 3H50A 2ZABA 3ALQA 1IKQA 4FPGA 1S0CA 3JBG3 4H55A 3ETQA 2A6WA 3ZX7A 4LA2A 3WCSA 4HK9A 2GSYA 3OBRA 4HKOA 4XBQA 4BLIA 2WQ4A 1AYM2 3AMHA 4GULA 3IN9A 4ES9A 4Y22B 3E6BA 3A4UA 4WBBA 1JN2P 3ZXJA 3DPRA 2BFUL 4M01A 5C8CC 1ASJ2 1XYNA 4K1ZA 1Y43B 1N3QA 2OW4A 2E7TA 1F31A 2D6MA 2ZX4A 2PA7A 3MICA 4WVMA 3VBUA 3VBRA 2KM2A 1MS9A 1UU6A 2IFRA 4IV3A 3FWEA 2D7FA 4E4ZA 4QT6A 2WFF2 5CG8A 5A33B 1HRV3 1V00A 2EXIA 2TUNA 2XPJA 5C4WC 4XFGA 1YI9A 2H0BA 4KBBA 1Z7S2 1V6MA 1BBT1 2W08A 4W6XA 1M06G 1LOFA 3B94A 4B4QA 2UWBA 4YZ2A 1XE8A 2IFWA 4M3CA 2F6BA 4FQ4A 3LOBA 4PIZA 4DOUA 5AC91 1Q8PA 5F6KA 2XVKA 3WP6A 4RS5B 1VR3A 4XFBA 5FRAA 1PK6C 5JSOA 1PGL1 3D0JA 4YZ1A 3VL8A 1UW8A 1OFNA 3MW2A 3ZIWA 1PO13 1RUE1 3CJIB 4WVVA 3S7IA 1OKQA 2YZ4A 1OA3A 4IEOA 3AYDA 4XE9A 4XHBA 1ULGA 1VRH3 3SH3A 3GF6A 3AP9A 5C8CA 5JSPA 5CU1A 3VBOC 4RD7A 2A75A 2ERFA 3I54A 5HCBA 1JH5A 4UXAA 3ENRA 2EXKA 1MS5A 2HJIA 1UU4A 2G9FA 3V64A 2PHWA 4I2OA 1OHFA 4YRDA 3QH7A 3CJXA 3FLTA 1QDCA 1VRH2 5D8AB 5C4WA 5J98B 4E2SA 4DZGA 5IK7A 3IMNA 1RUC3 1V6LA 1LGCA 1RUG2 3JUUA 5GZFA 1WA4A 2DVDA 1O4YA 4GXLA 4P9YA 4AI8A 4QGMA 4B4PA 4IEUA 3WLUA 3WUDA 1W6PB 1HRV1 3WXPA 2HWD3 1G9BA 4Y24A 1O5LA 2UURA 1PK6A 5ABJC 1H2KA 1GNHA 1POV3 3QD6A 1WW7A 1AX0A 2F4PA 4FTSA 2YDEA 4AHYA 3UK9A 4CDXB 4X8PA 4WZFA 4YM3A 3P3NA 1UKGA 4XOGA 1Q8SA 4QM9A 4BM8A 5KXCA 1S2KA 4CP2A 2N7GA 3NWKA 2NP0A 2R073 5BNNB 4B8EA 1OQEA 1QXRA 3VBOA 2RS11 5BY5A 3ZN6A 3HBZA 1GBGA 4AI2A 2MEV1 3NV1A 2PELA 3ILNA 2RM21 3KD4A 3FE5A 4UBHA 4FXKB 4GH4C 1FOD3 4YLZA 4G3YC 4WM8B 2I2SA 2X53S 1AR71 3TB0A 1O4ZA 5E89A 3ZSMA 3HQXA 4O9EA 1J59A 2GDFA 3QH6A 3CL1A 1GSLA 1JTZX 1ZA4A 2XVGA 4CDUB 1I3HA 1OLRA 1D4M2 1RUI2 5LRSA 3ZYPA 4PDWB 4KWJA 3RRDA 1HV0A 1COV3 1PIV3 1JHNA 1LOBA 1WCSA 2Q1ZB 1BZWA 1WGPA 3EQEA 2ET1A 2WKKA 1JUHA 2PHUA 2DCKA 2BYVE 2MHFA 4BYYA 5ABJA 1DF0A 3LSEA 1UPSA 2WNUB 3GNEA 1RC6A 2Y0OA 1K5MC 1RUD1 3VKLA 4BA6A 4RHV1 3W58A 1LEDA 3MPBA 2B39A 4EN9B 1HIXA 5L19A 3ME2A 2D6PA 4BCUA 3J8F1 1CESA 2BQPA 3TRSB 1WW6A 3I2DA 3TN91 4DRVA 4GH4A 4Q2FA 1QJX2 4C0BA 1Q43A 1Y7BA 3WG1A 1O3RA 4LLFA 1AR91 4JC1A 5FPXA 3FZ3A 1NLSA 2VW2A 4XFFA 2O1QA 3U11A 4K8FA 2ZJCA 3WHUA 4YGEA 1TEIA 2YMZA 4J1WA 5I93A 4PIXA 2R0FA 2HEYF 1BBT3 1W6QA 3J26N 2ZZJA 4XPVA 3SCGA 4KGQA 4L9BA 5L73A 1VBA1 1X33A 4IEQA 4XQDA 5AC93 3N7KA 4BOWA 5JOYA 1V6KA 5CG9A 1CX4A 1LR5A 4FOVA 1D0GA 1K5MA 1MZEA 4Q0PA 1GICA 2OZJA 2P3JA 3POSA 3USUB 4FP2A 4CP0A 5GLZA 3RNSA 4M3CF 5K7PA 1KITA 4Q0VA 5JOZA 1RUE3 1SLTA 1HRI1 2BNNA 2CAUA 3HR9A 1EV12 2CNAA 2OUHA 2R30A 3LA7A 1O3TA 4N9IA 1NY71 5JI9A 1G9DA 2UWAA 4RQPB 1LHOA 1YYNA 2A3XA 5JOXA 1G6NA 2BUKA 2WIIB 4IV1C 3MIDA 2XKPA 2OUJA 2XJVA 3U10A 4YG6A 5K8SA 5FBZA 4NHLA 1JUIA 1IS5A 3MF9A 4E4SA 5CFDC 4OHVA 1SLCA 4CDQC 2QCSB 2D3PA 4Y1ZA 4Y4YA 4OI1A 2HWF2 2OA2A 3PMEA 1RB8G 4K21A 4OHWA 1LJ7A 2BTVC 3MI8A 4HPKA 1KS4A 3V65A 2ZX0A 3H1WA 3FFQA 2D5FA 5H9RA 2RMU1 3PVNA 5BNPB 1YUDA 1ZZBA 2XJQA 4OZXA 1GV9A 1Q56A 2OIIA 5FFOC 1IHMA 5C9AB 3ZMOA 1R1A2 1ULEA 2RS51 2BW8A 4DNYA 5FTTC 1ZNPA 2WS92 1FI2A 4KWLA 3KCYA 3KT1A 5EZWA 5SV8A 3LZZA 1AR62 4FPFA 3T2TA 5CB7A 3WP3A 2VOKA 4YZ4A 2GC0A 2LTNA 2WINB 4KG0A 2FQPA 2ENRA 4IV1A 1JXNA 4QHBA 1EYBA 4QM8A 2VG9A 1OA2A 3E97A 3LKJA 3ASIA 1CVNA 1H2LA 4BLJA 3RG0A 4KU8A 3DPRB 4Y1UA 1QNWA 1SLAA 2WL1A 1J1LA 5CFDA 1RUNA 1X50A 4X6QB 4NWVA 1JYIA 4CDQA 1AR73 3VBRB 2ZHMA 4Q4X1 4JGYC 1GLHA 3RI8A 1R082 1DQ5A 1IS6A 3POYA 3M3IA 3ZFGC 2A73B 3WP5A 3MLKA 4NR1A 3S6PA 3KMHA 3UKTA 1N1YA 2WLPA 3HWJA 4ISQA 4K3UA 1CN1A 1FT9A 2GC2A 4F7ZA 4AVVA 3KCCA 2WC2A 5FREA 3MDPA 3GHNA 2IZWA 4M3CB 4ZU4A 1QWRA 4LBKA 2VXRA 4XF0A 4K1YA 3MPPG 1SLBA 4M0HA 3OD4A 1Q8VA 2WZPP 1RUD3 1EPZA 1SDWA 4RHV3 1W2UA 1QXPA 4YGDA 4XXPA 4P5HA 2UY9A 4FPLA 1KDMA 1DZTA 4RR3C 3LGRA 3VBHC 4EN6B 3PHMA 3BTAA 3NV3A 4JDMA 2VNOA 4META 1VJ2A 2XL7A 3J8F3 1X36A 1SMVA 1VBB2 2NQYA 1I6XA 2WSUA 1ULDA 2VOVA 5T55A 1HQLA 1MS4A 4Q4Y1 5C8CB 3TN93 1LOEA 3WZ1A 2VVFA 2Z79A 1VBD1 4YW2A 1OD5A 4URTA 5DUWA 4B29A 1AR93 1Q5OA 4K6BA 4JGYA 5ACA1 1TME1 5EFUA 1D4VB 2JEMA 1B35C 2ATFA 1PZ8A 4Q1RA 5BPXA 3DKWA