1REEA

Endo-1,4-beta-xylanase ii complex with 3,4-epoxybutyl-beta-d-xyloside
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
190
structure length
190
Chain Sequence
ETIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSRNPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQQGLTLGTMDYQIVAVEGYFSSGSASITVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE II
publication title Covalent binding of three epoxyalkyl xylosides to the active site of endo-1,4-xylanase II from Trichoderma reesei.
pubmed doi rcsb
total genus 56
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 1995-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00457 Glyco_hydro_11 Glycosyl hydrolases family 11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1reeA00
4S2FA 1XYOA 1W2UA 4HKLA 2DFBA 4XQDA 2D97A 1YNAA 3AMNA 1C5IA 1OLRA 1QH6A 3WQ0A 3O7OA 1UU6A 3WP5A 3WT3A 2JICA 4H7MA 3B5LB 1H0BA 1T6GC 2BVVA 2QZ3A 3WX5A 3VZMA 1H4HA 2DCYA 1UU5A 3VZJA 2BW8A 2B46X 5HXVA 2BWAA 2C1FA 3AKPA 1TE1B 1AXKA 3AKTA 1REDA 3WR0A 1HV1A 3MF6A 3VGIA 5K7PA 3VLBB 1C5HA 3WP4A 1PVXA 3VZLA 5K9YA 2DCZA 2DFCA 1XNKA 1QH7A 1XNBA 3AMPA 1IGOA 1M4WA 2BWCA 2JENA 3AKRA 4NPRA 3AKQA 4HK8A 3WY6A 4XQ4A 3MFAA 1BCXA 3MF9A 3VZKA 1XXNA 2DCJA 3VHOA 3VL8A 1OA4A 2NLRA 1OA2A 3AMMA 3WP3A 3VZOA 3LGRA 1REFA 4HK9A 2F6BA 3WQ1A 3AKSA 4S2HA 2D98A 3B7MA 1KS4A 2Z79A 1XYPA 1XYNA 4IXLA 3EXUA 2NQYA 2JEMA 3VHNA 2B45X 3RI9A 1OA3A 3ZSEA 4S2DA 1BVVA 1OLQA 3WXPA 1UKRA 1XNCA 2VG9A 2QZ2A 4S2GA 5EJ3A 1XNDA 3WP6A 4XPVA 2DCKA 3RI8A 1HIXA 3VHPA 3AMHA 3VZNA 1HV0A 2VULA 2VUJA 2VGDA 3HD8B 3MFCA 4HKOA 3LB9A 1BK1A 3WQ7A 3VL9A 1KS5A 3AMQA 1NLRA 1REEA 4HKWA 1ENXA 1F5JA 3M4FA 1UU4A 2B42B 1H8VA 4XQWA 1H4GA 1H1AA
chains in the Genus database with same CATH superfamily
2ZEYA 1S2BA 3M3QA 3LPFA 1URXA 1LEDA 5HV4A 3TRSB 1BKZA 5BPXA 2VMEA 5SV8A 4YVSA 3BOPA 4AZZA 1NUKA 1YEWA 3AMNA 1H30A 2W1UA 4ZXEA 1SACA 2WNEA 4H14A 1VRH2 2RS33 2CY6A 1W8UA 2PHFA 4C90A 5A7NA 4DXRA 1VBD2 1UY2A 3B5LB 4LBLA 3WHTA 1AYN1 4LO6B 2X05A 4BH9A 3CJIC 1GBGA 1G9FA 3DGTA 3RZZA 3N7MA 2YDEA 2QZ3A 1SBDA 1S0DA 2CWMA 1UU5A 4OI1A 1JYWA 2B46X 4ONUA 5HXVA 1CJDA 4P9GA 5T5OA 4WBBA 1REDA 3W5MA 4OHXA 2HWC2 2OPWA 1KD7A 4A7ZA 1RUE3 4M01A 3EQEA 3NWKA 1RUOA 2UWBA 2WWSA 2OQ6A 2ZGMA 1F4AA 1O4ZA 4IL7A 4L2NA 2Q8CA 3TNQA 3ZIWA 5K0UB 3I2DA 3O14A 2R0HA 4K1YA 4AF9A 2W1QA 2L9LA 4CCKA 3WQBA 3GM8A 2RM23 3I2OA 3ZFFA 5KXDA 2PLV1 2FHRA 1HQNA 1XXNA 4GB32 3IZOA 1ZZ7A 5GKAC 3ZPYA 1O3RA 5IW0A 1Q8PA 1OKQA 4M3CB 4Q1RA 4WM8A 5ABJC 5LCWL 2VECA 2QE3A 4NAOA 3H8XA 4Q4W2 2YYOA 5LASA 4CP9A 1QXRA 3CEWA 2A5ZA 4XUOA 1H8TB 2V73A 5DMYA 2N7GA 3WDXA 4RR3A 5FQ0B 2O14A 4RQPA 5CU1A 3GCXA 3UGFA 4JCKA 5IK8A 3NNGA 5FY9A 1V70A 1HKDA 2CAUA 1UNBA 2YGMA 1OLME 1JN2P 5LA2A 2Q8EA 2IZWA 4LBJA 2WZR1 3AVSA 3POBA 5A3PA 3O1OA 2Y0IA 4DQAA 4ORFA 1VJ2A 5E6HA 1OOPB 4RSUA 3RDIA 1OURA 3DL3A 1NCQC 2WC2A 5FZ7A 2P34A 5JUVA 1CAXA 4XJ9A 3S0MA 3QOPA 2MNGA 4UFKA 4LK6A 5DG1A 1C1FA 4NE9A 5JIAA 4ZZ5A 3WF3A 2QNKA 3DN7A 1R092 4KBBA 4FOQA 5C4WA 4IEYA 1VB2A 2LALA 4FPYA 3WVJA 5FWEA 1VLNA 5LW9A 1ZYBA 1TMF2 3H9AA 3KGZA 3AMHA 4AG4A 3KWVA 4X6RB 1R1A2 3VZNA 2VD7A 2VZQA 2VW0A 2XVKA 5DDJ2 3E5QA 4YW7A 1RUG3 1UZZA 2ILMA 1ND2A 3GBFA 5T52A 1FNYA 1WMFA 2NP0A 1RUF2 5FO7B 5FXZA 3UT0A 2KXLA 4XCBA 1A34A 4DMIA 5BNOC 4MGKE 1W9FA 2R0FA 2ZHNA 4BK4A 4DO0A 1YIPA 2JG9C 2ZGUA 1SDDB 2J1SA 4QGLA 1RHI1 4AGRA 2HWF3 2UWCA 4UFMA 1JYIA 1NY71 4XFFA 2VBDA 4GMP3 5CYYA 4D7SA 2UWAA 1YO8A 2D6OX 2W68A 2VZVA 2J22A 4N9HA 3IN9A 1KITA 1JMUB 2GN7A 2X10A 3W21A 3AVRA 3ITQA 2GNMA 1UF2C 5JIUA 1DQ0A 1UIJA 3AYDA 2BBVA 1NZIA 2Y6KA 3WP5A 3KT1A 3OGGA 1GYKA 1RYYA 4LHLA 3WDYA 2IUWA 1PMJX 3BN6A 3VD7A 5AC92 5JZGC 3LOIA 1LRHA 3ZMNA 5D1IA 5JVVA 3VKNA 1X8MA 3HBZA 1NYWA 2CHHA 3E1F1 1JU4A 1V0AA 1O8PA 2BW8A 2XJTA 2E53A 4EZ4A 1SMVA 2HJIA 3VD3A 3NNMA 1UQXA 4QXCA 1COV1 1US3A 1VBB1 4XVHA 1MZFA 1UMZA 2E63A 1LR5A 4MGQA 3DKQA 3RFRA 3Q8BA 2C24A 1E5RA 1I3HA 1FOD1 1GMMA 2IFWA 5JOYA 3AZXA 1WD4A 5LY2A 3VDBA 1HJGA 1Q56A 2IWGB 1NX9A 1J83A 2GH2A 4MGSA 5EP9A 4TWTA 4BCUA 4IV1B 5FZHA 2W91A 4JGZB 1LJ7A 4NRMA 3AKRA 2RMU3 3S30A 3T09A 5CIRA 3AZZA 2ET7A 4WM7B 3U37A 2ZMKA 2VBBA 2OX0A 1RUI1 2BFUL 2DVBA 5LBBA 3WNLA 4CEYC 4UI9L 1L7QA 4OUSA 3J8F2 2JE8A 1GWLA 1HRV1 3K77A 1V6KA 1ZZCA 2XLAA 3BTYA 3VZOA 3ZLIA 1K45A 3DYOA 4E4HA 1C8M1 4CSWA 3ZN4A 2B9UA 2VOKA 4MGZE 3WZ1A 2P3IA 1TQ5A 3AYAA 4QMAA 1W05A 4WVMA 3GJBA 1ZBA3 1F4HA 1OQDA 4JDMA 2UU8A 1Q43A 2Q4SA 4U36A 5FYMA 4BQXA 2R073 2VPVA 3ZMOA 4KGGA 5FUIA 5IVJA 3ACLA 2A73B 1MZ6A 1JHNA 1O5UA 1RUJ2 1YHFA 4GWIA 4YGDA 2D6MA 1WD3A 4OI4A 1HN1A 5FZLA 5IVFA 4LBOA 5I8YA 1OLQA 4OZXA 3FMGA 1W39A 5CISA 1NKGA 2HBUA 4BZ4A 3D5OA 1YJLA 3K3NA 4DXSA 5AFEA 2FCVA 1ZBE2 1DGLA 1W6NA 3I2HA 4N9IA 5FIXA 5FZ3A 1PZ9A 1QU0A 1WW4A 2WWJA 1CAWB 1J1TA 3OBRA 3V65A 2OPKA 5EWSA 4Y4RA 3SLIA 5A1FA 1SQ4A 2WA4A 3SC7X 5SV5A 4GJZA 3OYWB 4A44A 1HXS1 2ZGLA 4O9GA 2ZCWA 2YU1A 4LE4A 1OUSA 2W2IA 1RUD3 5GLZA 1C57A 1KQRA 3NKGA 1VAMA 3AJYA 5CA6A 2PLV2 3HMYA 3JD73 1LEMA 1LHVA 1XSRA 2F4LA 3TN91 4LBKA 1QJU1 2ZACA 1FPN1 3NNJA 1BBT2 1KJLA 4CDXA 4EE2A 4A2UA 4I2OA 1HB4A 3SHRA 1CIYA 2OQ7A 4XJWA 3UL2A 1ACCA 4L99A 4BMBA 4HKLA 1V6IA 1Q8SA 3T0BA 2JXAA 3MUZ1 4P00B 1IG3A 1QOOA 4IEUA 4IDZA 2JG8B 4UF0B 5IVYA 5C70A 2IXJA 1GZWA 1OLRA 1HX6A 4EZHA 2CDPA 5L36A 3ACIA 1NZCA 5JAXA 2JECA 3ACGA 3C7GA 3INAA 1W9TA 1RMU1 1U0AA 2VZRA 5A33A 1W3VA 4BLJA 2WS93 4ZY9A 2ZEXA 2X8KA 5ANNA 1CPNA 2AC1A 3K3OA 1ULCA 1B09A 3D4KA 4K9SA 1LOCA 2VMGA 1D4VB 3K2OA 1QJX2 1UL9A 4AEDC 2C1FA 1ZA7A 2Y26A 5L7OA 2OYZA 4FPKA 3U11A 2J1AA 2JB4A 3N9OA 4JVAA 3BALA 2V72A 2WBKA 1CQ9A 1W2AX 1Q8OA 4FSJA 1O5LA 4Y5Z0 4ATFA 4FAGA 3DF0A 4CU9A 4LBQA 4CPBA 3ACHA 4NUBA 1BJQA 4XIOA 5A1LA 1MS5A 2DDUA 3AMPA 4MZUA 5A6ZA 3LKJA 3CZJA 4GJYA 3S5QA 4MXVA 2BWCA 5JLVA 5F6LB 4QKNA 1LTEA 2VL4A 1GKBA 3TB0A 4CCDA 5C5UA 5T5JA 5IK7A 1RHI2 3VBUA 1Y9MA 4COWA 3O1VA 1K12A 1NE4A 1NY72 3ZXJA 1ND3B 2XVGA 1NA1C 1S2KA 1AHSA 3WDWA 3ZR5A 4Y1UA 5A3NA 3ZN6A 1S0CA 3RQ0A 3KF5A 4RFRB 3GZAA 1REFA 2BQPA 3OCPA 3UKVA 5C33A 4RHV3 1S0BA 2P1BA 4LHNA 4LIVA 5A1AA 4UT5A 1HB3A 4CVUA 1CAXB 3BTZA 2XPJA 2VUCA 3VD9A 5C3OA 1JYVA 3GBGA 4UW6A 4CRQA 1A3KA 2JD9A 3H3ZA 2B8MA 1U5YA 4JGYC 2VXJA 4OI0A 1QQP3 1GFF2 4QKFA 2EAAA 2RR11 5KXEA 4D7TA 1HW5A 3FUOA 5FY5A 5ANQA 2JD4A 1JTZX 1WBLA 3ZYPA 5IFPA 3RZMA 3M3IA 1CX4A 3ZDVA 4IEPA 3MGUA 1FOD2 2YC0A 2QZ2A 4FI9A 4IE0A 1PO22 3KHBA 4PI2A 2NZ9A 1PO11 1LNSA 1XE0A 2W87A 2ZGPA 1QJY3 2VNVA 3FE5A 3GXUA 4Q2FA 5CFDA 1BMV2 4BISA 1ZRIA 5A3MA 1NCRC 1D4M3 2Y8KA 2DU1A 3WCSA 4Y1VA 1D7PM 3OD0A 5LK5A 4NIAA 2K0GA 2D43A 3M7AA 1C3HA 1FMD3 2ZGQA 4I02A 2RDSA 2Q0AA 3PIJA 2VUJA 5FP3A 4Q5OA 4P02B 4IGQA 3POJA 3Q8AA 5LA9A 5BYNA 3D0JA 1LHWA 1B35C 1W90A 4KU8A 5AVPA 1PNGA 3FL7A 1AF9A 4Z1VA 3OG2A 3C7FA 4GA9A 3NJXA 4LITA 4AHZA 2WNUA 2XBO3 4J6GA 2C4XA 2Z42A 4LE3A 4EROA 5C71A 1OBNA 4QGMA 4QQOA 1W2NA 3POIA 2HWE1 4QHBA 2ZHKA 4LKDA 1VMJA 4CP0A 1O91A 4RS5A 4Q26A 2D40A 2R16A 2V09A 1YFXA 3MIEA 4QPGA 3A0KA 5C9AC 1RL3A 3LFMA 2WJSA 4HPKB 3J7HA 4CCCA 1T6GC 1ZZ9A 2QQKA 2QUOA 5DABA 4ZZ8A 3RZLA 2W92A 1JXNA 2FDIA 4OQ8A 4MXWA 3SEPA 4C8DA 1IS3A 3QH7A 1PX4A 4XE9A 3HT1A 1N1SA 5DUXA 5FPVA 3BUCA 3RYRA 1Q3EA 2AGSA 1AX0A 2Y0OA 4UFIA 3DPRB 2A6VA 2X5IB 4CDQC 5D8AC 5JR7B 4IV3C 1J1LA 1LGNA 2VCMA 4RYDA 5J37A 5IJRA 5C5TA 2FDFA 1IPJA 1QIQA 1MVQA 4OUMA 5G05L 1M4WA 4HONA 2JENA 4NPRA 3W59A 4QB1A 5C8CA 3VUOA 2RS53 4JKMA 4WVMB 1GANA 1FPN2 4W50A 4XQ4A 3TEXA 3IAPA 3MF9A 3WW2A 4QPIA 4IEZA 2DCJA 1N3OA 5J96B 2PAMA 3L9JT 5FPBA 3ZYFA 3FC0A 3AMMA 1OPOA 1O3TA 2MEV1 2EXJA 5FR3A 5FYIA 2VZTA 2EIEA 5FZ1A 5JOWA 4KG8A 4Q4Y1 5J36A 3FZ3A 1EAH2 4OHWA 3ZYJB 1OVSA 3LA3A 1W6NB 2NMOA 4IETA 1RMU2 4PF5A 3DKWA 1ASJ2 3O0XA 2LRPA 2OT7A 4QQLA 1LHNA 2CDOA 4AGVA 1DQ5A 5A80A 2FD8A 2GZWA 4IQPA 1AR72 2W08A 1J58A 2G19A 2Z4FA 5FMCA 4BE3A 4JRLA 1OQEA 4A6SA 3VD4A 3OJBA 1L7RA 2FZ2A 4Q0PA 2I07B 2XJVA 3PU8A 3MUY1 4Y22B 4QDQA 2Y33A 1AYM3 1UYPA 2ZHLA 5K0UA 4AL9A 4Z2WA 3SQOA 3CF6E 3SH3A 4CDXB 2EALA 2FMYA 2R063 4FFHA 3GNEA 2OA2A 2VTFA 5LK7B 1OUXA 1X33A 3J4UH 1J84A 5BNNB 5LBCA 1IS6A 3R0RA 1HDKA 2XHNA 1AUYA 1YQ5A 2VULA 3PHMA 4JX0A 2AEZA 2VGDA 3MFCA 4BQ3A 1QOTA 2RDRA 5L9BA 1BK1A 1PNFA 1K5MC 1SDWA 2CV6A 2JDPA 2YB7A 2ZMNA 3AMQA 3IBMA 3PU3A 4AEMA 4A4AA 4Q8KA 2LM3A 1VRH1 2ZZJA 1FV3A 1K42A 1VBD1 2D44A 1XE7A 1Z7S2 4FO9A 1H8TA 4R4XA 5FAXA 3DECA 3IT8A 1I1EA 3ES4A 3M8LA 5FQ0A 1L3JA 1UAIA 1LHOA 1KJRA 2OKXA 3AZVA 4NOTA 1QWRA 4N43C 1RUC3 3KCYA 2NPIA 2PA7A 4B8EA 4FTEA 3J9SA 3TWIA 5FYTA 1YXWA 2DVDA 4BQ1A 1H6XA 2Z5WA 4D7YA 1VR3A 2AR6A 2W52A 4XMAA 4ZS2A 3FHAA 4I3GA 4XFBA 3THCA 5J09A 1IOAA 5ACA3 4TLFA 2VAUA 4YZ4A 1XU2A 5F3IA 1AR63 1VBE3 4FPOB 4LBQB 3OTFA 4XFHA 1H0BA 5DN2A 5FYZA 1SCRA 2BYVE 5IHRA 1U12A 1CAVB 5LB6A 1XQNA 3URFA 5F7UA 1AR83 3ZSLA 1PO12 5K8SA 4L9BA 4GB31 1CZTA 1G86A 1TME1 3AKTA 1F31A 5LZ6A 2PN5A 2YC2A 4UW5A 5LY1A 2YFZA 1APNA 3P3PA 2XJPA 4LO7A 2JE7A 2VZPA 1YYNA 4Q4W1 4AVVA 1EY2A 2ATFA 1MACA 5F5AA 3RG0A 4WZFA 5FZIA 1WZXA 1V6JA 3PJQA 5DG2A 4AAPA 4FXGB 4UBGA 1YQ8A 4NPMA 4JQRA 2VNGA 2D6PA 2B7YA 2JDUA 5IVVA 1Y9GA 4RGKA 4YW6A 1LAJA 4HK8A 5LEJA 1F8VA 2A71A 1HRI2 4NN0A 4DIQA 2GALA 4HZFA 5FJKA 5JMCA 1LENA 1A78A 2HWB3 3JB4C 2A75A 2HWE2 2VCBA 1YUDA 4O7XA 4GQ7A 3RMYA 5FZFA 4XZUG 5IT6A 3TEYA 4LPLA 2XXZA 3DUIA 4LR4A 3WNKA 2D3SA 5GLUA 4KWLA 4BQ4A 5JPMB 1KS4A 1S4CA 1W9YA 1XYPA 4EN0A 2UY8A 2EIDA 4CDWA 4KMQA 2PHWA 3OD4A 4CEWB 4HN1A 2OXBA 2W9XA 2X53S 2V4VA 2ZGKA 1TMF1 1W3XA 2LUWA 2EXKA 3KQ4B 4S2DA 4C1WA 2IXLA 4RFT0 4XJUA 4XF9A 1I5ZA 4JTNA 5DDJ1 3R6SA 3S7EA 1UZ0A 4PF1A 1XNCA 1CD3G 1RXGA 1RJ8A 1X9PA 4ZONA 2GC1A 4PDWC 4AI1A 1V6NA 4B4QA 4MX3A 1BVP1 1AL23 1S1AA 1MQTB 3IKWA 3VBOC 1RUE1 3I3BA 2BU9A 3FBYA 3HT2A 4IV1A 3FUQA 3ZFEC 1POQA 1PK6B 2WNUB 3GJAA 1N3QA 4JGZA 4EJRA 3GYDA 3KCCA 3BIEA 1H2NA 1XRUA 4IEOA 5F8PA 4GH4B 1MPXA 4YG3A 4SLIA 1R083 4HKOA 5I0RA 2QQLA 1GWKA 1NLSA 2E9QA 3AP4A 5H9QA 3WW4A 2WAOA 1NLRA 2R32A 4NIIA 2GDFA 3FLPA 1ENXA 2BNOA 4AE2A 4QPGB 1PVC2 2MEV2 4Z8BA 3B01A 2DBNA 2FZ1A 2D3RA 3HPNA 2R042 3VBRB 1W8ZA 3ZXGA 5AC91 5AVAA 2YPDA 5H9RA 2ZA9A 3C3VA 3DEMA 1M06G 4MXWB 3WD5A 5IYYA 1PGSA 3OGSA 4UFHA 1SEFA 3LD8A 1JH5A 4XF0A 2XOMA 2RV9A 1QJEA 3NL1A 5T5PA 4XFGA 3E97A 1DYOA 2PELA 4E4DX 1SFYA 1IQAA 1WMXA 1T2XA 2DCTA 2GSYA 1ZRDA 4MLOA 4DY5A 4XAAA 1H2MA 3BIWE 4KH9A 4AFAA 4CZSA 2BVVA 5FPZA 4AWDA 5B4NA 5CFCA 3MIHA 4K1ZA 1OD3A 1WW5A 5FZ9A 1CAWA 3VZMA 1K3IA 1GQHA 2FBEA 3AFGA 2WL1A 1WUVA 1TNFA 5HV0A 5C8CB 5HCFA 5DQ0A 2VVFA 3Q8EA 3O5SA 3OYWA 3ZXLA 4LA3A 1QJFA 1OD5A 2QQVA 1OSGA 2C5DA 2UY9A 4UW3A 5CVRA 5DAQA 3WF4A 3WNNA 4BQYA 5A3OA 5F9TA 2AH2A 1UN1A 2PXJA 4HN0A 5FZMA 1JOPA 2RHPA 1QNWA 3WP4A 2WNVC 4PBPA 1YJKA 2BV4A 4JRAA 3KB5A 2VUAA 5DUVA 1PMHX 3QACA 4FQ4A 4QX0A 5D2AA 2XKOA 3ZVXA 5FYHA 3OBTA 3HEIA 4Q29A 4WVVA 3I4IA 4YG0A 4CDUB 3I3DA 1SLTA 3ZFGB 1RUJ1 1ZNPA 1T6BX 2K46A 2XJSA 3M1HA 3L2HA 2HWF1 2RS13 1KDKA 3AYEA 3NKTA 3I2FA 3ZN5A 4YM2A 4NROA 4A3XA 5FLIA 5L73A 1FV2A 4F8AA 4Y5SA 3NVCA 2JG8A 3B94A 4UF0A 4ASLA 4P9YA 2IXCA 1W8TA 3NAPC 4M3CF 3KZ4C 2K9ZA 1ODNA 2TUNA 1PGW1 1ZBE1 1E5IA 1VBA2 1XNAA 1ZZ6A 2QQNA 2ZX0A 1XYNA 2LTNA 4Y24A 3NV3A 5BNPB 3JBG3 3THPA 2RDQA 3TNPB 2UYAA 2SLIA 3FHIB 1DGRN 2JKBA 4PIZA 4UFLA 3ILRA 2BBAA 3ZPOA 2YY1A 1R1A3 1LU1A 2QQIA 2YZ4A 1WCKA 2WN2A 3MW4A 1LOBA 3IPVB 1LHUA 2H0VA 1AX2A 1NQJA 1TME2 2UYBA 3ZX7A 1RUF3 2FDHA 3KMHA 2VZ3A 2WSUA 4P9IA 1MEC3 1LODA 3OBZA 1OFSA 4BDVB 1VALA 2O1QA 5EFUA 1OOPC 1BBT1 4ISQA 5EPAA 2EIGA 1V6MA 1OMIA 2ZABA 3RYPA 4CU6A 2WO7A 4RGGA 1SBEA 5F3GA 4M3CE 3MO4A 1PX3A 2QBXA 4L97A 3CJIB 3IM0A 3PIGA 2Q30A 2ZMLA 3O1SA 3ZSKA 3PUIA 3WG3A 4Q4V3 3WDTA 2RMU1 4M0NA 2YFUA 5CKMA 3FWEA 1ND3A 3LOBA 2Y6LA 4OYUA 4NHMA 2W3JA 4RD7A 3HJRA 3L2YA 1JYTA 3LEKA 2CTVA 2DF7A 4HKWA 4ES9A 1NE6A 3JU9A 3KHCA 3N36A 3M4FA 5A6XA 3H1MA 1UX6A 4NIGA 3N3HA 1H8VA 3SH5A 3ABZA 4P9JA 4XQWA 4KNCA 3HWJA 1DZRA 1QJX1 2CGNA 1YI7A 4SBVA 2Q8DA 4BXSV 5FK7A 5F2WA 3VB9A 2RS32 4NHLA 4CA9A 2O8OA 3B00A 1G9BA 3JQWA 2FMDA 3K48A 1ENSA 1W6MB 1XC6A 3PUAA 5CEHA 5E88A 1ODMA 3CMGA 4DS0A 1BEV3 5JMOA 5ABJB 5F3CA 3ILNA 1BXHA 1AJKA 3H1WA 4GWMA 5CZKA 1JU3A 4PLMA 4CXWA 2XGXA 2VUDA 3EHKA 1EPZA 3MV01 1SPPB 4PHZA 1RUE2 3C2UA 1WLTA 4I0WB 4EN9B 1PIV3 3B3QE 3UJQA 1LOFA 3WDVA 2DWRA 1I6XA 4UWDA 5GLTA 1RXFA 4LULA 3OSDA 4FPLA 1JW6A 3VD5A 3O1PA 5FYUA 2HLEA 5EQUA 5IVBA 3MZHA 2HBTA 1GOHA 2ARBA 2EF6A 1C5HA 2KR2A 4NHYA 3P5BA 5FUNA 3LSEA 4ZKTB 1PVXA 4YW1A 2DCZA 2ZX4A 4HT1T 5I91A 2RM22 4PLOA 2I2SA 3ZO0B 3VBHC 1NCQB 2DUOA 1AYN3 1AZDA 4LA2A 5A6YA 4YSFA 4OI2A 4O9EA 4CDWB 4MV2A 3QH6A 5B4XA 3VL8A 1RIRA 2VM9A 2FCTA 2NN8A 2VOWA 2VOTA 4QT6A 2TEPA 1V9U1 1ZZ8A 3MIFA 4AFCA 1R1ZA 2VR4A 3ZYHA 1RITA 4YZ2A 1RJ7A 4EN6B 1PO21 4NR1A 4D3WA 4HPKA 1P8JA 3OUJA 2IFRA 1SLBA 2BNNA 3C7EA 1BMV1 5BNOB 3IAQA 4FCAA 4OHZA 4AI2A 4D0QA 1JZ3A 2JG9B 3VDAA 1QXPA 2OUHA 3O0VA 3OUHA 5A7SA 2P6HA 2Q1FA 2WS91 4CCNA 1ZX5A 1RGSA 4XEZA 1PM4A 2GAUA 3CJXA 3H0OA 3AJZA 3NV2A 4ET7A 1BYHA 1FT9A 4QU2A 3RZKA 3DXTA 1DQ1A 1F2NA 4RL7A 3H7YA 4AAXA 3D0SA 3VDDC 3N35A 3DPRA 2X5IA 4DXTA 1UY1A 5F3EA 1GU3A 5JI9A 4FVVA 4XPVA 2RVAA 2ZKNA 3B9CA 1HIXA 4LBMA 1XSQA 2EVXA 3LQCA 1RUG2 3KF3A 3KT7A 4URTA 5JZGB 3T2TA 4E2QA 4AVCA 4IE7A 3NSTA 3JCIA 4JC1A 4XBNA 4B7KA 4QGNA 3BYWA 2WT2A 3KV9A 1KS5A 1WLWA 2HWF2 2A7AA 3RVHA 4PBOA 2WZR3 4HG6B 1VRBA 3T1MA 2GMEA 3ZXEA 5I8TA 3RZJA 4C91A 4OHVA 4YVSC 1AR93 3J26N 4FFFA 1RINA 5FZ6A 5F1RA 4ZPIA 4YW4A 1LB2A 2WWUA 1PGW2 4RHV1 3R4UA 1H1AA 5CFCB 2ET1A 3UJOA 4QKBA 2QQWA 3U75A 2D6NA 1Y43B 3A7QA 1ZRFA 4QM9A 2XJRA 3I7DA 3A0NA 4LOSA 4FPJA 4YW5A 3POGA 1C1LA 4DFSA 4ATEA 3FLRA 2WAAA 5FZ4A 4N53A 4BJ0A 1QQP1 3V0AA 1CX1A 2VE1A 1QJZA 3OPZA 4H2AA 5IAVA 2WR9A 1QDCA 1VAVA 2BDRA 3APBA 1S2EA 4IGPA 3EO6A 3I49A 1CAUB 2A6WA 2VQAA 4Y22A 5FZGA 1RHI3 5I8SA 3F2ZA 1W9WA 2QJVA 4BQWA 3MIDA 4P9WA 1TE1B 4Z92B 3RRDA 4TZDA 5BNNA 3C8XA 2ZGSA 3O1TA 4TSVA 3LAGA 2GH8A 1X82A 2BERA 3H8OA 1K5JA 3I97A 2RMU2 5FFOC 4GD4A 3ZFFC 5DAPA 1HLCA 2D93A 1X8EA 3OPWA 4XBQA 5JSRA 4FFGA 2Y6FA 3VKFC 1EAH1 2C26A 4WM8C 2I74A 1SLLA 4PI0A 3WY6A 1C8NA 2PQQA 2RE9A 1ASJ1 1BCXA 3FX3A 4RR3C 2BJSA 2XBO1 4MHUA 4RQPC 1J3RA 4QDRA 4XTPA 2A3XA 5ISLA 1OF3A 2VMFA 3SKJE 1DU3D 1AR71 1HJFA 1WGPA 2CYFA 2WN3A 3PMEA 2XKPA 1COV3 1VBB3 1CR7A 1FATA 4IGOA 1SCSA 1S0FA 1TNRA 2R072 2D5HA 2JIJA 3AKSA 1EV13 2D98A 2VZ1A 3B7MA 1O7FA 1WCSA 4FTBA 1UCXA 2FDJA 3AC0A 3F95A 2F4PA 4QB2A 3CZUA 3HOBA 3ZR6A 1TG7A 2NQYA 1CAVA 4CP2A 4D6QA 3VHNA 4LIUA 4HVOA 1AXYA 5F5IA 3RI9A 3WF1A 4MG2A 4L0PA 3AX4A 1JOBA 2DBIA 1WMDA 1YFUA 4IE5A 3SISA 1ENQA 3AFKA 4Y1ZA 5C4WC 3MBWA 1RUI3 5J1XA 1DQ4A 3EMRA 1HRV3 2RJKA 1LULA 2BRTA 3THTA 4Q0SA 4KL1A 1WLDA 4OCTA 3WV6A 1Z7S1 1C8M3 2VMIA 4BA6A 4E4ZA 1JI6A 4P5HA 4OUEA 4IEWA 1SFPA 3BPSA 1Y3TA 5FBJA 1ND2C 2B9VA 4ZHNA 2G1MA 2WT0A 2ZTNA 3N9MA 1QGLA 3LZZA 5FZ8A 4BMEA 1EUTA 2HWD3 1DCSA 3CDZB 3JD72 2IXIA 4LOTA 4N43A 2FDGA 4NJ4A 1MS3A 4DEQA 4XUTA 4FOWA 4PIYA 4AVTA 3LB9A 2E33A 4AEDB 3OBAA 4P9LA 2QCSB 4O61A 5FMDA 2WT1A 5C3QA 1W2TA 1V9U2 3AXDA 1G6NA 3DYPA 1LOAA 2IXKA 1OF4A 2BOIA 1ULFA 4WZCA 4LK7A 2C9AA 5FMBA 4CEWA 2ZBJA 1W03A 1J3PA 4XF1A 2QDNA 2CAVA 2P3JA 3OY8B 5LBFA 1HXS3 5FY1A 4R9CA 5CBLA 2WS92 3WNMA 4KGQA 3WQ0A 3S5AA 1UU6A 2E26A 2VW1A 4B4PA 1W8OA 3PUHA 1NA1B 4FP3A 2WQZC 4FPGA 2W94A 3NV1A 3TN93 4J1XA 2WFF3 4YVWA 5IATA 2ZGNA 1MQTA 2P4EA 1QJU3 1F15A 1FPN3 2XJUA 1L7LA 2DTYA 1HRI1 4TTGA 3J7MA 1PK6A 4RN5A 4K20A 1XE8A 4BIOA 4JKKA 3DV8A 4GH4A 5FYCA 5FPUA 1HV1A 2PHLA 4GZ9A 1W04A 1LKNA 4NAMA 2R061 2C0ZA 4JGYB 5FZBA 3T4HB 1EUUA 3J7NA 3OUIA 4CCLA 1JZ6A 1ULOA 2AZ5A 1WWYA 3SNMA 3ZXKA 4LTAA 2ZEZA 4QX8A 4W6XA 4UOJA 3I3MA 4HETA 4AI8A 3VBSA 4P9XA 5E16A 1ALYA 2JDHA 1Q8QA 3VBRA 1UPIA 1X9TA 1KFXL 4W65A 3GALA 3D8CA 2ZPXA 1LECA 4IUGA 4FPCA 1LGCA 5DZFA 3R05A 5T50A 5L9VA 4RHV2 3GHNA 4W6WA 2XH6A 4XACA 4B29A 4CU8A 1KGYA 3HR9A 4Z07A 1H9WA 1LGBA 2JDKA 1ULPA 2W46A 1IHMA 1HB1A 3GF6A 4QU1A 4YWAA 4BWOA 3KSCA 1RUH3 3RGBA 4JDNA 2ZGRA 4OVEA 1QQP2 1KEXA 4Q1PA 5JPNB 2VOVA 2X09A 4KWJA 1B35B 3J7LA 2OW4A 3NO8A 1EPWA 1VBE1 3IMNA 3LIHA 2XMLA 3ZFEA 4DEVA 5H9PA 1U5ZA 5M0TA 5K4LA 1DDLA 3VBFA 5HPOA 2GC3A 3CU7A 3HQUA 3KQRA 3LA7A 2HYXA 1AX1A 4QXKA 3HQRA 2VW2A 1QNYA 4QQ2A 3T2OA 1QJY2 2LROA 1GNYA 1W06A 3CL1A 3LWCA 4MGYE 4M00A 4MYEA 1DBNA 5A6QA 4OMCA 1PVC1 1D4M2 3HNMA 2R041 3NNLA 5FPAA 4MOAA 2VQTA 3ZDSA 1FMD2 4I30A 5C9AB 5FXVA 4XDOA 1FYUA 2P5BA 1MS9A 3PURA 5FYBA 5A7QA 4CP1A 1POV1 2D5FA 3ELNA 4I0BA 4CDUA 5EIYB 5FMOS 3ZFGA 2ZAAA 4L8QA 4CDXC 3H50A 4K21A 3HD8B 1MS1A 1MVEA 1YI9A 3W9AA 1NT0A 2WO3A 4QX7A 3WQ7A 5FO9B 2NMNA 1HQLA 1W8HA 2P3YA 2XBO2 2Y34A 5LATA 2RR13 1UOJA 1W8FA 4XOGA 3TBDA 1RVF3 4HL0A 3A23A 4N53B 1MZ5A 3V0AB 1W0NA 2WZPP 4EWEA 1UU4A 3VDCA 5E1RA 1ZRRA 3ZSMA 2J1UA 2G9GA 5F5CA 5BNPA 1TEIA 3WLUA 4NMIA 1UMIA 4IV3B 1XYOA 1S0IA 2PYTA 5FZCA 3SMHA 4GKXA 3NRUA 4HSLA 3KM5A 4C1XA 3BODA 1YNAA 4W4ZA 3I2GA 2MHFA 5EXOA 3IPVA 5FYSA 2JWPA 1HN0A 2A6ZA 3H3LA 4PCRA 5DAVA 1W6OA 1G7YA 5L7OC 3NW4A 3FLTA 3I59B 2XVLA 1O8SA 3TYJA 5FY7A 4OULA 5FY4A 4XAEA 5L19A 3Q8CA 3P1IA 1G9DA 5FBZA 5F32A 4QPWA 2CNAA 3I8TA 2YV8A 2IVIB 2VO5A 3IIIA 4CTEA 1OC1A 4QQHA 1W99A 2FDKA 4XABA 4LO4B 5A7OA 3Q8FA 4OHYA 2G9ZA 2KA3A 4BLIA 1AXKA 2C9KA 3CJIA 4QXHA 5GZFA 4GWNA 3GBWA 5FYVA 1V6LA 2DUQA 4OFGA 4Q4X3 4LBNA 3ON7A 4XJ8A 5F37A 5FDBA 1JS9A 3VBUC 3VLBB 4Y1XA 2RS52 5H9SA 2WKKA 3UETA 2BTVC 1VBA1 1XNBA 2A3YA 3NAPA 3N9PA 3ENRA 2XUMA 2JDZA 2YXSA 1ULGA 3K4ZA 4LLFA 1IGOA 1CIWA 1IQDC 4MO3M 4MADA 4YZ3A 5I0SA 4M0HA 4AQTA 5EYXA 4ZXKA 3UKNA 2DYCA 2YU2A 3MFAA 4R9AA 3ZKUA 1GNZA 2ID4A 1NOVA 3PJYA 1OLMA 1SLCA 4HSJA 5DXDA 2VC9A 4CCJA 2W5FA 4MSVA 1O6UA 1R64A 1OA2A 2TNFA 2WQ8A 4NIDA 2JDAA 3LGRA 5A7PA 4AW7A 1QF3A 2GNTA 4XJZA 1W6MA 2NM1A 2XLFA 3OF1A 2WO2A 1U5IA 1K5MB 3EXUA 5ABJA 2D6KA 4YARA 1OH4A 3IMMA 1JYCA 3H42B 2W0XA 2J7MA 2E6VA 5BXXA 4BPZA 4WVZA 5FZKA 4AVBA 2QQUA 2HYKA 1DG6A 1BK0A 2PFWA 4QHOA 3AZYA 1A6CA 1SPPA 1BVVA 3MW3A 4RA0A 1A8DA 2WZEA 5GLVA 1GICA 2WYFA 5CFDC 1STMA 2G4IA 4N43B 4LBQD 5FRAA 4LO8A 5FPLA 1XPWA 3HNBM 1YRZA 4CPBD 3I54A 2ARAA 1WMEA 1V00A 2GNDA 3K4AA 4KBZA 2QKDA 2SBAA 4CUCA 1XB9A 2R062 2V4AA 2F17A 4BB3A 2ZGOA 2HEYF 2V5YA 5JXGA 3H3UA 4I3PA 1KRIA 4Q4Y3 1NCQA 2YHJA 5FP8A 3EYPA 2DTWA 4FXKB 3SH4A 4LHKA 1IPSA 1IG0A 2RS31 2AEYA 1GZ9A 4K40A 1OQ1A 4D94A 2PTMA 1VBC3 1FXZA 4E9KA 3SXWA 2ERFA 4FFIA 5BNQA 5HXMA 1PZ7A 4IE6A 5C7GA 4FQZA 2ZX1A 2RG4A 1OH3A 3PVEA 2AACA 5JXJA 1RUC2 2OIIA 3PUSA 4RS5C 3TEZA 4LUMA 2B42B 3MEPA 5HI0A 5I93A 3LE0A 3NNFA 2HEWF 4QPGC 4XHXA 1LU2A 3V0BA 4BU2A 4YVWB 5KHJA 4UFJA 3B69A 3TAYA 2Y6HA 3BGAA 5BNOA 2CSGA 1PZ8A 1S55A 2R7EB 2JG9A 2WZ8A 2XL9A 3JBG1 4LLOA 4NRQA 4UBHA 4XQDA 1AL0G 4DNYA 4ISRA 5ACA2 1CZVA 1ZRCA 1VBE2 3FBMA 3RJRA 1AR62 4AHWA 4BOWA 1QH6A 4W6YA 4YM0A 3RNSA 4B7EA 1QXJA 4ITCA 4OQ9A 1G9AA 4TN7A 1DIWA 1AR82 3OPTA 3KS7A 4X8PA 1WLCA 3RWNA 1JUHA 2YPJA 2RM21 3ATGA 3K75B 4DUWA 3BU0A 1VRH3 2ZX3A 1RUNA 3U1XA 3ZYGA 1VBD3 3SCGA 5LA0A 3SCHA 5F6KA 4DY3A 3VBSB 1H9PA 3VBHA 5FV3A 2VBPA 4YGCA 3SEEA 3KVAA 4YRDA 5JSOA 5JZGA 2WSVA 4XTMA 5JWPA 5FZDA 3IDAA 1XU1A 4HBNA 1UOGA 2EA7A 5HCHA 1IKPA 5CKQA 3LDKA 3VKMA 4KG0A 2YUEA 1KXGA 4QAWA 3MYXA 4QPIC 2HWC3 4B4RA 3W5NA 2DFCA 4AVSA 3HVDA 3EB7A 3U14A 1SFNA 1CONA 2HWB2 4MGIE 3WNXA 2VZSA 3AKQA 4XFAA 4PDWB 2ZJCA 1DF0A 4X8NA 4W8JA 5J48A 2K2SA 4P14A 4YGEA 3M3OA 1POV0 4A45A 4EN7B 4FPEA 3NJYA 2H6CA 2ZEWA 3GHMA 3POEA 3PUQA 4K8RB 3ZFEB 1UXZA 4HVRA 3VBFB 1BHGA 2EIBA 1WCDJ 1EYBA 4GB33 4IESA 4CCOA 5JOXA 1W8WA 2VCAA 4HK9A 2F6BA 4G3YC 3MI8A 2R30A 4IEVA 4Q27A 4CEYA 5CKNA 3WUDA 3AM2A 4XETA 4OZOA 1PM7A 3WNPA 3GDBA 4EWAA 4Q4W3 1FX5A 3QBQA 1CAUA 1BEV1 2B45X 2HH9A 1RUG1 1PGL2 4BK5A 2Y6JA 5EV7A 4AHXA 1A8MA 5IUQA 2PHTA 3G7DA 3KV6A 5K0UC 3ALQA 5T5LA 4N90A 1DYKA 2P17A 4YG6A 3WXPA 3N9NA 1FAYA 1GP5A 4JKLA 3WEZA 3ZXAC 1O3QA 2HKXA 3S7IA 4AVAA 4K6BA 4GMP1 2AREA 5DUUA 4COZA 5A32B 3W58A 3E5UA 2CGPA 2QVSB 3UGHA 4QKDA 2Q8OA 3VV1A 1R082 5GZDA 3WSOA 4LO5B 1CPMA 2JIGA 3AL5A 1MR5A 1R093 3I2JA 1GZTA 1H1IA 1UY0A 1XNTA 2XQXA 1H8TC 4GIQA 4XXPA 2VQUA 4XILA 4Q8LA 2VMDA 1YC61 3LEMA 4MVTA 5KHHA 1TMF3 1VP6A 4GAZA 4GALA 2O8QA 1UZWA 4DRVA 5DDJ3 2ZZQA 3IDBB 4KWKA 1CWPA 1OXCA 1W6OB 5F5QA 2YBPA 3HNYM 5FYYA 4AR2A 2IC1A 5KR7A 3BVCA 1H4GA 2ENRA 2DVGA 3MPPG 2WNVB 2MPFA 3WINE 2EXHA 1C28A 1GOFA 3UESA 5J3UA 1Z78A 4JV4A 2B5HA 3V56A 3VKLA 4AFMA 3OEAA 3BB6A 2B4KA 1QOSA 5DAXA 2I45A 2XB6C 1BZWA 2QTWB 3JXSA 5FZEA 2Y64A 1JZ4A 3AP5A 1QKQA 2AYHA 2OVUA 2YROA 4BHPA 4F83A 4K3UA 1ONAA 5C8WA 4AQ2A 4NVPA 3ZIXA 3NAPB 2DCYA 3VZJA 1GR3A 5AC93 1N3PA 2GMMA 1YQ6A 2H6BA 1WKYA 3QCWA 3BTXA 1JBCA 2PHDA 2W1WA 3WR0A 4CXYA 3DXUA 1H1MA 2GP3A 4DOUA 5HCBA 4G9SB 5FP9A 4COVA 1ZBA1 1N47A 5LWBA 4FPFA 4AEDA 1Y9QA 2JKXA 2R071 2JX9A 3E6DA 3WHUA 3N9LA 2CGOA 4X6QB 3B02A 4PIXA 1W9SA 3CLPA 3JUUA 3KD4A 3MIBA 2WO1A 4R9BA 4B1LA 5FLJA 2RS12 2ZS6B 4UAPA 4U2AA 1DFQA 4HVQA 5FY0A 3U78A 1DLCA 1AR91 2V5DA 1W2OA 1MZEA 4XDPA 1G8WA 4QX3A 2EICA 4E8DA 2QFEA 3A4UA 2VMCA 4YW3A 3ZYIB 4CDWC 5C3SA 4AQ6A 4F7ZA 3U07A 3OY8A 4QHZA 3SITA 1X36A 2PMWB 5GZGA 3JBG2 3J8F3 4FOVA 1JYXA 3WQ1A 3BTAA 3E6BA 4C0HA 5FJHA 2VU9A 1NA1A 2VNRA 4Y26A 4N7UA 4MGTA 3CO2A 4ASMB 1NG0A 5KHKA 2PAKA 1RUD1 1UOBA 4CCEA 4NPLA 5IAXA 3JD71 2XUEA 1HQWA 5LRRA 4JQTA 1MEC2 1RUJ3 4IV1C 4JGZC 2W95A 4UW4A 3UK9A 1OHFA 2VG9A 2JDMA 4GULA 5FK8A 1NXD1 4JGYA 4WM7C 1DHKB 1KDMA 4D6SA 1QY4A 2ZGTA 4A6OA 3LEGA 3IWZA 5EJ3A 3ILFA 2VY0A 2P6CA 4XFIA 5FOBB 4KWUA 4XFCA 4Q4V2 1DGRA 1ZBE3 5JR2A 2CWSA 2RJ2A 5KBFA 3HBKA 4PT6A 4META 1ST8A 3PDQA 3V0BB 1WA6X 2WUHA 2LS6A 3ETPA 4AFBA 3C7HA 4YZ5A 5FY8A 4FOYA 1OKOA 4R9DA 3CHXA 4IEQA 1W0PA 1ENRA 2ZKLA 3I3QA 3NQHA 1NCRA 3VL9A 2ADDA 4BQ2A 3WDUA 4DINB 3RZGA 4H7LA 1JODA 5JI7A 4ASKA 2BFUS 1DYPA 2XHKA 2PLV3 4BM8A 1JHJA 3P3NA 1ZM1A 2G9FA 1I5PA 4J1WA 3LDBA 4OLLA 2RDNA 4CUBA 1WBFA 5F39A 5GJ6A 1EV11 2DU0A 3MLLA 1B35A 4S2FA 1BBT3 1W2UA 2FQPA 5LA1A 2DURA 2UURA 3IB3A 3VBHB 4YNIA 4YM1A 3BOWA 2Y6GA 1HB2A 1BEV2 2VCCA 5FREA 1YIFA 1MS0A 2DVFA 5CFCC 1WCQA 3O1UA 2W39A 3O7OA 5IVEA 4O65A 1FNZA 2JICA 3LA2A 4XIKA 1YQCA 4H7MA 4QX1A 3A21A 5J98B 1FI2A 1IS4A 2KD7A 1W0OA 3PVNA 4INDA 1C4RA 3USUA 5HCAA 1H4HA 1PIV2 2DUPA 2O0OA 2OUJA 4I09A 3X29B 5AFBA 5C9AA 2PAEA 3WG4A 5LEKA 1AJOA 3RPQA 3O1RA 4R4ZA 2GU9A 3KT4A 1LESA 4CU7A 5GZEA 4ZU4A 1OVPA 1QJX3 2XJQA 3D6EA 3KVBA 2HWD1 5K7PA 2Q1MA 5FZ0A 2Q5TA 3AL6A 2YGLA 3WW1A 1YLLA 1GLHA 4AI9A 2W1SA 1AYN2 1QH7A 4EV0A 4GMP0 2BGOA 4CEYB 3JQXA 1XOYA 4LKSA 3RYKA 5C3PA 2JG8C 4D8MA 2WABA 2YBSA 4Y1YA 3VDDB 3LPGA 4DZGA 1VE0A 3FHQA 3VZKA 4CDQA 1OI6A 5D8AA 5JXHA 4AEJA 3R4DB 4IV3A 4PQQA 2JDNA 4R8HA 3ST7A 2D3PA 4N8MA 3WP3A 2NYYA 4XMIA 4XXAA 1UY3A 4LNVA 3GCWA 3W20A 1GSLA 3FFQA 5FZOA 4Z82A 3E6CC 5IWFA 1QDOA 1QJY1 1SZBA 2QQOA 5BV6A 5FOJB 2WA3A 4ARXA 2ZHMA 5KHGA 2Z79A 4P5YA 4Y5TA 1D4M1 1ULDA 3EBRA 2VOXA 5TSWA 3I59A 5JSPA 4UXAA 1FMD1 2JEMA 5JOZA 3CNAA 1OA3A 4ARYA 4YVSB 3LCPA 1BLZA 2WFF1 1CJPA 5ERLA 4IE4A 4M4PA 1GNHA 4OMDA 4QPYA 1GUIA 4LQRA 5GM0A 1UKRA 2BZDA 4V1PA 1DQ6A 1SG3A 4GXLA 1V9U3 4S2GA 2HEVF 1ZBA2 3WG2A 1ND3C 4LJHA 3HQXA 3PMSA 1Q5OA 1PMIA 1FOD3 1PO23 1UZVA 1X7NA 1E5SA 1O59A 4AOCA 1N1TA 5KC5A 3WOGA 3BKZA 1WW7A 1UYYA 2WZR2 4HOOA 4TYSA 4KQ7A 4N7IA 2ZX2A 5GLWA 1YFYA 3T30A 3C7OA 2D6LX 2AUYA 1AR92 4ES8A 2PQSA 1O3SA 3N9QA 1MS8A 2EAKA 3I2KA 4WVWA 4LEJA 5FCCA 3ROUA 1UXXX 2LW8A 3K46A 3GZUC 4FBFA 1J59A 1K5MA 1UOFA 2VNOA 5A3WA 3ZFFB 1CGPA 3LDRA 1NQDA 3MIGA 4LUKA 4PLNA 1F35A 3GZTB 2X29A 1RUH1 2BUKA 4WM8B 1GP6A 2Z2SB 2DFBA 2E51A 2A3WA 3ZOIA 1RUD2 2D97A 1JOJA 4QQPA 4CP9B 5C3RA 3T2PA 3PNAA 4RR3B 1ZVFA 2A70A 3IIAA 4RQPB 3WT3A 4A3ZA 4D69A 3OOXA 2RS51 3ME2A 3M3EA 1QEXA 4GKYA 5G04L 3V64A 1LOFC 3ZXFA 4V2VA 1IZ3A 3KLSA 3VHRA 2XQRA 5EZWA 5HBAA 3ECQA 5I0DA 2E7AA 3P6BA 4RGAA 2XONA 2Y38A 4FP2A 4YFWA 3U10A 5A7WA 4R52A 1DZTA 3IDEA 3WNOA 3DCQA 2JB8A 1N1YA 1JZ5A 1D2QA 4ZS3A 3LIGA 4Y3OA 5FUPA 4I0AA 3LSDA 3AB0A 4E2SA 4E4SA 1GQGA 1H2KA 2QQJA 3VGIA 2PHRA 1XBFA 2WYSA 4MUVA 1Z0HA 5JXIA 4C0BA 5FXXA 3N7JA 5K9YA 1UPSA 5C4WB 5BUVA 2J1TA 5GZCA 2A6XA 4DB5A 1TZOA 4Q0UA 3UGGA 1UIKA 4Q0QA 3KV4A 2D7FA 4Y20A 4YFZA 1RVF1 4JDOA 4NWVA 3I2IA 5EJZB 3S57A 4QWNA 1COV2 1VBB2 1UW8A 2VZOA 3ZXDA 1RC6A 1ND2B 1EV12 4TXWA 5LBEA 4DRRA 1Q8VA 3R4SA 3VN4A 1JZ7A 3G6JB 1QMJA 4IW3A 1AYM1 1WCUA 3AXEA 2Z69A 2GP5A 3ORJA 4Q0VA 4V2WA 5E89A 2IVJA 3GGLA 4CCMA 1DP0A 4TLGA 1VAKA 1VB4A 3ZM8A 2BEOA 3H7JA 1W6PA 4CE8A 2J1EA 4A42A 3RWKX 1EAH3 1RUI2 3M3CA 3ZSEA 2CU5A 3DPRC 2X5IC 4L11A 4QX5A 3IDCB 3CBNA 1HRV2 1RMU3 3CKHA 1ASJ3 2PHXA 4G4FA 1C8M2 5IK4A 4JHTA 4CUAA 1W28A 2J42A 4FPHA 5E8AA 3NV4A 2GC2A 5FO8B 1AR73 1NCRB 1RUC1 3POWA 2EXIA 3I3EA 2HWD2 1LOGA 4Q4X1 3WP6A 2VVDA 2BGCA 4XC9A 4FT8A 4COYA 3DYMA 4ZU7A 1W6QA 4PDWA 1NXMA 3OGRA 1HV0A 5ACA1 5DUWA 3VBOA 1DLLA 1U5XA 3PTYA 1AR61 3AYCA 4Y33A 2P3KA 3KV5A 2ARXA 1UYZA 2BVBA 5KWRA 3A22A 3B9IA 3FJSA 2KM2A 1AR81 1F5JA 4L92A 3POSA 4QX2A 5CB7A 2R49A 2QQPA 3JZVA 4YPJA 1DGWA 2VH9A 4N53C 1Z7S3 2FCUA 3OGVA 4XURA 5FZAA 1HXS2 4XUQA 2R1BA 3USUB 3QLQA 3WW3A 1SHWB 5DZGA 1RB8G 3NMBA 4A7YA 1SBFA 5A3TA 3BI3A 1C5IA 2WFPA 4JZRA 5CNAA 4URAA 2WNOA 3K4DA 3TN92 2WFF2 4QM8A 4XCAA 3LF7A 2GMPA 1OPMA 4NRPA 1QJU2 3HN1A 4QXBA 1G9CA 2WRAA 3OEBA 2ORXA 5BNNC 4DXZA 2WLPA 5A32A 4PQ9A 2HWB1 5LRSA 3Q9OA 3N4MA 4XW3A 5FPXA 4E2GA 2BPA2 3T1LA 2BWAA 3AKPA 3WG1A 1JYNA 4H3WA 4A41A 4P08A 3SCFA 4CDQB 5D8AB 1YWKA 3BCWA 4E27A 5A3LA 1PO13 2E31A 2WIIB 4WV8A 3CQOA 4FTSA 1JUIA 2PHUA 1CESA 3E5XA 3MLJA 3MW2A 5FMOL 1VMFA 3N7LA 1Y7BA 1XNKA 1BQPA 1VBC1 1GP4A 5FZOB 1IKQA 4YM3A 1YQ2A 5JDBA 3UKTA 3LEIA 4DUVA 1VMHA 1S0GA 3HAGA 1J3QA 4QD2A 3D82A 4XF3A 1Y4WA 2XL7A 1D0HA 1NLQA 1GOGA 2WNVA 3VHOA 1PGL1 2R6QA 4ZU5A 2RJLA 1IPKA 1OA4A 2P2KA 4HFSA 5EHDA 1CVNA 1HRI3 4AEKA 4DUXA 3MPBA 3ZKYA 1CN1A 4LHSA 1RUH2 3POYA 4AXOA 1AL21 4K8FA 4NHXA 1AXZA 2Q1ZB 3KCXA 4KI5M 5KXCA 2HWE3 2ORZA 3PLQA 4MHRA 2DVAA 3U4XA 1TVGA 5FXWA 4UYBA 4EN8B 1EP0A 4K7JA 2XLGA 4XYXA 4IXLA 5FP4A 3ZYBA 1XJAA 4F3JA 5T3NA 3THDA 3HN3A 4LKFA 4IEXA 1OFNA 1UKGA 1UYXA 2OS2A 2JDYA 1R081 3UV9A 1S0JA 2VQ0A 4YGBA 1LCLA 4XHBA 4M3CA 4XJAA 3WF2A 4NIHA 3FFZA 1ZZBA 5KXBA 1GZWB 4EWDA 5CG9A 3PVOA 2VVEA 4B1MA 4NWWA 1GWMA 1X50A 1UO9A 1UY4A 1S0EA 2R1DA 3BU7A 1KFUL 3MICA 3VKOA 5A33B 3K51A 5FLHA 2ZXQA 2AENA 2CL2A 2Y60A 4BQ5A 1I9RA 2DCKA 2ZAHA 3H8UA 4IERA 3O0WA 4FAHA 4AQSA 2HWC1 2XWJB 5I0TA 5L7OB 1WA4A 4HANA 5I0UA 1IS5A 3O12A 1OOPA 2RR12 4AK3A 1RVF2 4AGGA 2VTXA 4QB6A 2JE9A 4D6RA 5CG8A 1RTVA 1YCIA 2JJ6A 4CEWC 1REEA 5IVCA 3OGJA 5B2GB 2ZOEB 3MDPA 2C6SA 1LOEA 3QD6A 4BXFA 1SLAA 1AYM2 4PJYA 4Y4YA 1CZSA 1VPHA 3T3YA 4JHZA 4AHYA 4NO4A 3GZEA 3VBUB 1PVC3 1WW6A 2MEV3 2QQMA 2R043 5FKBA 5CADA 5J7MA 1D2SA 3ZN6B 5A7WB 3ES1A 3H1YA 4Z2AA 1UZYA 2IXHA 2XG3A 2WLQA 2WDBA 1POV3 4YVWC 1JZ8A 2GC0A 1MQTC 4J25A 3WUCA 3T0AA 3ETQA 4E8CA 5FP7A 4EYUA 3HIFA 1H2LA 3ACFA 1PK6C 2WNUC 1E57A 1ZREA 3S6PA 3TOJA 4H55A 1F5FA 2YG0A 1UMHA 5T55A 4BIFA 4GH4C 3UYJA 5T54A 1H6YA 2WINB 2E7QA 2YMZA 3OB8A 4HLTA 2BNMA 3WX5A 5IFTA 3EJKA 4CYDA 2RS11 3AK0A 1DGWX 3ZSJA 4GWJA 2YC4A 4XZPA 4Q4X2 3RSJA 1O4YA 5A3UA 2E32A 4A7KA 4I01A 4Y20B 5D21A 4YW2A 3B93A 3MF6A 3VBSC 3CIHA 4BYYA 3VBRC 1VIWB 4LXLA 1F9KA 1R091 5JCTA 3T08A 1GQPA 2ES3A 2XWBB 3VZLA 1MS4A 5CFDB 5APAA 3RZHA 4XBLA 1O4TA 5FKCA 1GZCA 1UD1A 4AI3A 3SKVA 2A6YA 4AFDA 5A70A 5BY5A 2A1XA 5EYYA 3JB8A 5DPNA 1R1A1 3PTRB 2VXRA 4AI0A 1QHDA 1E5HA 5F2SA 5EJ1B 1W6PB 4COUA 1UX7A 3UNPA 1RUF1 3MHZA 3NJZA 4M4RA 3WF0A 3M70A 1MEC1 2ARCA 2NLRA 4HXCA 4XUPA 2OZJA 2W47A 4CUGA 3RJ2X 1AVBA 4QDSA 2BGPA 1ULEA 2BP6A 1N1VA 5GALA 1US2A 4LT5A 3RMXA 2WQ4A 1YFWA 4S2HA 4LORA 3VBFC 2VTXJ 3MLKA 5C8CC 3PL0A 3LFIA 4WM7A 1SLIA 3RS6A 5KHIA 3NJVA 5IK5A 2ADEA 4HMZA 1OT5A 4Q4V1 2ETEA 2B39A 1VBA3 4LMFA 3T0DA 4RS5B 4JTOA 4XDQA 4XUNA 5CAZA 3PVBB 4NHKA 4YLZA 1DZQA 2VZUA 1W6QB 4DPNA 3AP9A 4B3NA 3TEWA 2GNBA 2QDRA 4CXXA 3BPZA 3VBOB 1W8NA 3POFA 2VMHA 4CDUC 2XR4A 1JZ2A 4Q4Y2 3ZFGC 1GV9A 5DAWA 3O1MA 3FN9A 3H8RA 1TME3 3ASIA 1XNDA 5L9RA 2OZ6A 1DQ2A 4XF4A 3RI8A 1PHMA 1NAEA 1ZA4A 1VBC2 3MV11 3VHPA 3WCRA 5FTTC 5FWJA 5C6CA 1D0GA 2J1VA 3VDDA 3U0ZA 2TBVA 2P37A 4JAAA 4YYOA 4MH0E 3ZYRA 4AYUA 2BOJA 1V6OA 1UWWA 2J1RA 3AP6A 5BNPC 2VJXA 3D3AA 3USSA 4EQVA 3T4VA 2H0BA 2YBKA 3N7KA 4LKEA 3M2MA 2GN3A 3U4SA 3AZWA 5DZEA 1AL22 3KGLA 4YZ1A 5KC6A 2XDVA 2DV9A 2E7TA 3J8F1 3AP7A 4KU7A 3T2QA 1PIV1 4QPIB
chains in the Genus database with same CATH topology
1S2BA 3M3QA 1URXA 1LEDA 3TRSB 1BKZA 5BPXA 5SV8A 4YVSA 3BOPA 3AMNA 1H30A 1SACA 2WNEA 4H14A 1VRH2 2RS33 2CY6A 4C90A 2PHFA 1VBD2 3B5LB 4LBLA 3WHTA 1AYN1 4LO6B 4BH9A 3CJIC 1GBGA 1G9FA 3DGTA 3RZZA 3N7MA 2YDEA 2QZ3A 1SBDA 1S0DA 2CWMA 1UU5A 4OI1A 2B46X 4ONUA 5HXVA 1CJDA 4P9GA 5T5OA 4WBBA 1REDA 4OHXA 2HWC2 1KD7A 4A7ZA 1RUE3 4M01A 3EQEA 3NWKA 1RUOA 2UWBA 2WWSA 2ZGMA 1O4ZA 4IL7A 4L2NA 3TNQA 3ZIWA 5K0UB 3I2DA 3O14A 2R0HA 4K1YA 4AF9A 2RM23 3ZFFA 5KXDA 2PLV1 2FHRA 1HQNA 1XXNA 4GB32 5GKAC 1ZZ7A 3ZPYA 1O3RA 1Q8PA 1OKQA 4M3CB 4Q1RA 4WM8A 5ABJC 2VECA 2QE3A 4Q4W2 2YYOA 1QXRA 3CEWA 2A5ZA 1H8TB 2V73A 2N7GA 3WDXA 4RR3A 5FQ0B 4RQPA 5CU1A 5IK8A 4JCKA 1V70A 1HKDA 2CAUA 2YGMA 1JN2P 2IZWA 4LBJA 2WZR1 2Y0IA 4DQAA 1VJ2A 1OOPB 4RSUA 3RDIA 3DL3A 1NCQC 2WC2A 2P34A 1CAXA 4XJ9A 3S0MA 3QOPA 2MNGA 5DG1A 1C1FA 5JIAA 2QNKA 3DN7A 1R092 4KBBA 4FOQA 5C4WA 4IEYA 1VB2A 2LALA 4FPYA 3WVJA 1VLNA 1ZYBA 1TMF2 3H9AA 3KGZA 3AMHA 4AG4A 4X6RB 3VZNA 1R1A2 2VW0A 2XVKA 5DDJ2 3E5QA 1RUG3 1UZZA 2ILMA 1ND2A 3GBFA 5T52A 1FNYA 1WMFA 2NP0A 1RUF2 5FO7B 2KXLA 4DMIA 5BNOC 4MGKE 2ZHNA 2R0FA 1YIPA 2JG9C 2ZGUA 4QGLA 1RHI1 4AGRA 2HWF3 2UWCA 1JYIA 1NY71 4XFFA 4GMP3 4D7SA 2UWAA 1YO8A 2D6OX 2W68A 4N9HA 3IN9A 1KITA 2GN7A 2GNMA 1UF2C 5JIUA 1DQ0A 1UIJA 3AYDA 2BBVA 3WP5A 3KT1A 3OGGA 1GYKA 4LHLA 3WDYA 5AC92 5JZGC 3LOIA 1LRHA 3ZMNA 5D1IA 3VKNA 1X8MA 3HBZA 1NYWA 2BW8A 2XJTA 2E53A 1SMVA 2HJIA 1COV1 1VBB1 1MZFA 1UMZA 2E63A 1LR5A 1I3HA 1FOD1 2IFWA 5JOYA 3AZXA 1WD4A 1Q56A 2IWGB 2GH2A 4TWTA 4BCUA 4IV1B 4JGZB 1LJ7A 3AKRA 2RMU3 3S30A 5CIRA 3AZZA 2ET7A 4WM7B 2ZMKA 4CEYC 1RUI1 2BFUL 2DVBA 4OUSA 3J8F2 1HRV1 1V6KA 1ZZCA 2XLAA 3VZOA 1C8M1 3ZN4A 2B9UA 2VOKA 4MGZE 3WZ1A 2P3IA 1TQ5A 3AYAA 4QMAA 4WVMA 1ZBA3 1OQDA 4JDMA 2UU8A 1Q43A 2Q4SA 4U36A 2R073 2VPVA 3ZMOA 4KGGA 3ACLA 2A73B 1MZ6A 1JHNA 1O5UA 1RUJ2 1YHFA 4YGDA 2D6MA 1WD3A 4OI4A 4LBOA 5I8YA 1OLQA 4OZXA 3FMGA 1W39A 4BZ4A 3D5OA 1YJLA 5AFEA 1ZBE2 1DGLA 1W6NA 4N9IA 1PZ9A 1QU0A 1WW4A 3OBRA 1CAWB 1J1TA 3V65A 2OPKA 5EWSA 3SLIA 1SQ4A 2WA4A 5SV5A 3OYWB 1HXS1 2ZGLA 4O9GA 2ZCWA 4LE4A 1RUD3 5GLZA 1C57A 1KQRA 3NKGA 1VAMA 3AJYA 5CA6A 2PLV2 3HMYA 3JD73 1LEMA 1LHVA 3TN91 4LBKA 1QJU1 2ZACA 1FPN1 1BBT2 1KJLA 4CDXA 4A2UA 4I2OA 3SHRA 4XJWA 3UL2A 4L99A 4BMBA 4HKLA 1V6IA 1Q8SA 2JXAA 1QOOA 4IEUA 2JG8B 2IXJA 1GZWA 1OLRA 1HX6A 5L36A 1NZCA 5JAXA 2JECA 3INAA 5A33A 1RMU1 1U0AA 4BLJA 2WS93 2X8KA 1CPNA 1ULCA 1B09A 3D4KA 4K9SA 1LOCA 2VMGA 1D4VB 4AEDC 1QJX2 1UL9A 2C1FA 2Y26A 5L7OA 2OYZA 4FPKA 3U11A 4JVAA 3BALA 1CQ9A 1Q8OA 4FSJA 1O5LA 4Y5Z0 4ATFA 4FAGA 3DF0A 4LBQA 1BJQA 4XIOA 1MS5A 3AMPA 4MZUA 3LKJA 4MXVA 2BWCA 5JLVA 5F6LB 1LTEA 1GKBA 3TB0A 5T5JA 5IK7A 1RHI2 3VBUA 4COWA 1NE4A 1NY72 3ZXJA 1ND3B 2XVGA 1NA1C 1S2KA 1AHSA 3WDWA 4Y1UA 3ZN6A 1S0CA 3RQ0A 3GZAA 1REFA 2BQPA 3OCPA 3UKVA 5C33A 4RHV3 1S0BA 4LHNA 1CAXB 2XPJA 3GBGA 4UW6A 4CRQA 1A3KA 3H3ZA 2B8MA 1U5YA 4JGYC 4OI0A 1QQP3 1GFF2 2EAAA 2RR11 5KXEA 4D7TA 1HW5A 3FUOA 2JD4A 1JTZX 1WBLA 3ZYPA 3M3IA 1CX4A 4IEPA 3MGUA 1FOD2 2YC0A 2QZ2A 2CGPA 1KRIA 1PO22 2NZ9A 1PO11 2ZGPA 5CFDA 1QJY3 4Q2FA 3FE5A 1BMV2 5A3MA 1NCRC 1D4M3 2DU1A 3WCSA 4Y1VA 3OD0A 5LK5A 2K0GA 2D43A 3M7AA 1C3HA 1FMD3 2ZGQA 4I02A 2Q0AA 2VUJA 5BYNA 3D0JA 1LHWA 1B35C 5AVPA 4KU8A 1PNGA 1AF9A 4Z1VA 4GA9A 4AHZA 2WNUA 2XBO3 4J6GA 2Z42A 4EROA 4LE3A 4QGMA 4QQOA 2HWE1 4QHBA 2ZHKA 4CP0A 1O91A 4RS5A 4Q26A 2D40A 2R16A 2V09A 1YFXA 3MIEA 4QPGA 3A0KA 5C9AC 1RL3A 2WJSA 4HPKB 1T6GC 1ZZ9A 2QUOA 1JXNA 4MXWA 1IS3A 3QH7A 4XE9A 3HT1A 1N1SA 5DUXA 3RYRA 1Q3EA 2AGSA 1AX0A 2Y0OA 3DPRB 2A6VA 2X5IB 4CDQC 5D8AC 5JR7B 4IV3C 1J1LA 1LGNA 5J37A 1IPJA 4OUMA 1MVQA 3W59A 1M4WA 4NPRA 2JENA 5C8CA 3VUOA 2RS53 4WVMB 1GANA 1FPN2 4XQ4A 3MF9A 3WW2A 4QPIA 4IEZA 2DCJA 1N3OA 5J96B 2PAMA 3L9JT 3FC0A 3AMMA 1OPOA 1O3TA 2MEV1 2EXJA 5JOWA 4KG8A 4Q4Y1 5J36A 3FZ3A 1EAH2 4OHWA 3ZYJB 3LA3A 1W6NB 2NMOA 4IETA 1RMU2 4PF5A 3DKWA 1ASJ2 3O0XA 4QQLA 1LHNA 4AGVA 1DQ5A 2GZWA 4IQPA 1AR72 2W08A 1J58A 4BE3A 4JRLA 1OQEA 3OJBA 2FZ2A 4Q0PA 2I07B 2XJVA 4Y22B 1AYM3 2ZHLA 5K0UA 4Z2WA 3CF6E 3SH3A 4CDXB 2EALA 2FMYA 2R063 3GNEA 2OA2A 5LK7B 1X33A 3J4UH 5BNNB 1IS6A 3R0RA 1HDKA 1AUYA 2VULA 3PHMA 2VGDA 3MFCA 1QOTA 1BK1A 1PNFA 1K5MC 1SDWA 2CV6A 3IBMA 3AMQA 2ZMNA 4AEMA 4Q8KA 2LM3A 1VRH1 2ZZJA 1FV3A 1VBD1 2D44A 1XE7A 1Z7S2 4FO9A 1H8TA 4R4XA 5FAXA 1I1EA 3IT8A 3ES4A 3M8LA 5FQ0A 1L3JA 1UAIA 1LHOA 1KJRA 3AZVA 4NOTA 1QWRA 4N43C 1RUC3 3KCYA 2NPIA 2PA7A 4B8EA 4FTEA 3J9SA 3TWIA 1YXWA 2DVDA 4BQ1A 2Z5WA 4D7YA 1VR3A 2AR6A 2W52A 4XMAA 4I3GA 4XFBA 5J09A 1IOAA 5ACA3 4TLFA 4YZ4A 1XU2A 1AR63 1VBE3 4FPOB 4LBQB 3OTFA 4XFHA 1H0BA 1SCRA 2BYVE 1U12A 1CAVB 1XQNA 3URFA 1AR83 3ZSLA 1PO12 5K8SA 4L9BA 4GB31 1G86A 1TME1 3AKTA 1F31A 2PN5A 4UW5A 1APNA 3P3PA 2XJPA 4LO7A 2JE7A 1YYNA 4Q4W1 4AVVA 1EY2A 2ATFA 1MACA 3RG0A 4WZFA 5DG2A 1V6JA 3PJQA 4FXGB 4UBGA 4JQRA 2VNGA 2D6PA 2B7YA 1F8VA 4HK8A 5LEJA 2A71A 1HRI2 4NN0A 2GALA 4HZFA 5JMCA 1LENA 1A78A 2HWB3 3JB4C 2A75A 2HWE2 3RMYA 1YUDA 4GQ7A 5IT6A 3DUIA 4LR4A 2D3SA 5GLUA 4KWLA 5JPMB 1KS4A 4EN0A 1XYPA 2UY8A 4CDWA 4CEWB 2PHWA 3OD4A 4HN1A 2X53S 2ZGKA 1TMF1 2LUWA 2EXKA 4S2DA 4C1WA 2IXLA 4RFT0 4XJUA 4XF9A 1I5ZA 4JTNA 5DDJ1 3R6SA 3S7EA 1XNCA 1CD3G 1RJ8A 2GC1A 4PDWC 4AI1A 1V6NA 4B4QA 4MX3A 1BVP1 1AL23 1S1AA 1MQTB 3IKWA 3VBOC 1RUE1 3FBYA 3HT2A 4IV1A 3FUQA 3ZFEC 4JGZA 1PK6B 2WNUB 4EJRA 1N3QA 3GYDA 3KCCA 1H2NA 1XRUA 4IEOA 4GH4B 4YG3A 4SLIA 1R083 4HKOA 5I0RA 1NLSA 2E9QA 3AP4A 5H9QA 3WW4A 1NLRA 2R32A 2GDFA 3FLPA 1ENXA 2BNOA 4AE2A 4QPGB 1PVC2 2MEV2 4Z8BA 3B01A 2FZ1A 3ZXGA 2D3RA 5AC91 2R042 3VBRB 5AVAA 5H9RA 2ZA9A 3C3VA 1M06G 4MXWB 3WD5A 1PGSA 1SEFA 1JH5A 4XF0A 3NL1A 5T5PA 4XFGA 3E97A 4E4DX 2PELA 1SFYA 1IQAA 2DCTA 2GSYA 1ZRDA 4MLOA 4DY5A 4AFAA 1H2MA 3BIWE 4KH9A 4CZSA 2BVVA 5FPZA 4AWDA 5CFCA 3MIHA 4K1ZA 3VZMA 1WW5A 1CAWA 1GQHA 2FBEA 3AFGA 2WL1A 1WUVA 1TNFA 5C8CB 5HCFA 2VVFA 3O5SA 3OYWA 3ZXLA 4LA3A 1OD5A 1OSGA 2C5DA 2UY9A 4UW3A 5CVRA 5F9TA 2AH2A 1UN1A 4HN0A 2RHPA 1QNWA 3WP4A 2WNVC 4PBPA 1YJKA 4JRAA 3KB5A 2VUAA 5DUVA 4FQ4A 3QACA 3ZVXA 2XKOA 3OBTA 4Q29A 4WVVA 4YG0A 3I4IA 4CDUB 1SLTA 3ZFGB 1RUJ1 1ZNPA 2XJSA 3M1HA 3L2HA 2HWF1 2RS13 1KDKA 3AYEA 3NKTA 3ZN5A 4YM2A 4A3XA 5FLIA 5L73A 1FV2A 4F8AA 3NVCA 2JG8A 3B94A 4ASLA 4P9YA 2IXCA 3NAPC 4M3CF 3KZ4C 2K9ZA 2TUNA 1PGW1 1ZBE1 1ZZ6A 1VBA2 2ZX0A 4Y24A 1XYNA 2LTNA 3NV3A 5BNPB 3JBG3 3THPA 3TNPB 2UYAA 2SLIA 3FHIB 1DGRN 2JKBA 4PIZA 3ILRA 2YY1A 1R1A3 1LU1A 2YZ4A 1WCKA 3MW4A 1LOBA 3IPVB 1LHUA 2H0VA 1AX2A 1NQJA 1TME2 2UYBA 3ZX7A 1RUF3 3KMHA 2WSUA 4P9IA 1MEC3 1LODA 1OFSA 1VALA 2O1QA 5EFUA 1OOPC 1BBT1 4ISQA 2EIGA 1V6MA 1OMIA 2ZABA 3RYPA 4RGGA 1SBEA 4M3CE 4L97A 3CJIB 3IM0A 2Q30A 2ZMLA 3ZSKA 3WG3A 4Q4V3 3WDTA 2RMU1 4M0NA 3FWEA 1ND3A 3LOBA 4NHMA 4RD7A 3L2YA 2CTVA 2DF7A 4HKWA 4ES9A 1NE6A 3JU9A 3N36A 3M4FA 3H1MA 1UX6A 3N3HA 1H8VA 3SH5A 4P9JA 4XQWA 4KNCA 3HWJA 1DZRA 1QJX1 2CGNA 1YI7A 4SBVA 2RS32 4NHLA 2O8OA 3B00A 1G9BA 3JQWA 2FMDA 3K48A 1ENSA 1W6MB 5E88A 4DS0A 1BEV3 5ABJB 3ILNA 1BXHA 1AJKA 3H1WA 4GWMA 4PLMA 2XGXA 3EHKA 1EPZA 1RUE2 3C2UA 1WLTA 4I0WB 4EN9B 1PIV3 3B3QE 3UJQA 1LOFA 3WDVA 2DWRA 1I6XA 5GLTA 4LULA 4FPLA 1JW6A 3MZHA 2ARBA 2EF6A 1C5HA 4ZKTB 3LSEA 1PVXA 4YW1A 2DCZA 2ZX4A 4HT1T 5I91A 2RM22 4PLOA 2I2SA 3ZO0B 3VBHC 1NCQB 2DUOA 1AYN3 1AZDA 4LA2A 4YSFA 4OI2A 4O9EA 4CDWB 4MV2A 3QH6A 3VL8A 1RIRA 2NN8A 2VOWA 4QT6A 2TEPA 1V9U1 1ZZ8A 3MIFA 4AFCA 1R1ZA 1RITA 4YZ2A 1RJ7A 4EN6B 1PO21 4NR1A 4D3WA 4HPKA 2IFRA 1SLBA 2BNNA 1BMV1 5BNOB 4FCAA 4OHZA 4AI2A 2JG9B 1QXPA 2OUHA 3O0VA 2WS91 1ZX5A 1RGSA 4XEZA 2GAUA 3CJXA 3H0OA 3AJZA 3NV2A 1BYHA 1FT9A 4QU2A 1DQ1A 1F2NA 4RL7A 3H7YA 3D0SA 3VDDC 3N35A 3DPRA 2X5IA 5JI9A 4FVVA 4XPVA 2ZKNA 3B9CA 1HIXA 4LBMA 2EVXA 1RUG2 3KT7A 4URTA 5JZGB 3T2TA 4E2QA 4AVCA 3NSTA 3JCIA 4JC1A 4XBNA 4B7KA 4QGNA 2WT2A 1KS5A 1WLWA 2HWF2 2A7AA 4PBOA 2WZR3 3T1MA 2GMEA 3ZXEA 5I8TA 4C91A 4OHVA 4YVSC 1AR93 3J26N 1RINA 5F1RA 4YW4A 1LB2A 1PGW2 4RHV1 3R4UA 1H1AA 5CFCB 2ET1A 3UJOA 2D6NA 1Y43B 1ZRFA 4QM9A 2XJRA 3I7DA 3A0NA 4FPJA 4YW5A 4DFSA 1C1LA 4ATEA 3FLRA 4N53A 1QQP1 3V0AA 1QJZA 3OPZA 1QDCA 1VAVA 3APBA 3EO6A 1CAUB 2A6WA 2VQAA 4Y22A 1RHI3 5I8SA 2QJVA 3MIDA 4P9WA 1TE1B 4Z92B 3RRDA 4TZDA 5BNNA 2ZGSA 4TSVA 3LAGA 2GH8A 1X82A 2RMU2 5FFOC 3ZFFC 1HLCA 2D93A 1X8EA 5JSRA 4XBQA 3VKFC 1EAH1 4WM8C 2I74A 1SLLA 3WY6A 1C8NA 2PQQA 2RE9A 1ASJ1 1BCXA 3FX3A 4RR3C 2XBO1 4RQPC 1J3RA 4XTPA 2A3XA 1DU3D 1AR71 1WGPA 2CYFA 4ORFA 3PMEA 2XKPA 1COV3 1VBB3 1CR7A 1FATA 5JVVA 1SCSA 1S0FA 1TNRA 2R072 2D5HA 3AKSA 1EV13 2D98A 3B7MA 1O7FA 1WCSA 4FTBA 1UCXA 2F4PA 2NQYA 4CP2A 1CAVA 3VHNA 4HVOA 1AXYA 3RI9A 3AX4A 1WMDA 1YFUA 3SISA 1ENQA 3AFKA 4Y1ZA 5C4WC 1RUI3 1DQ4A 1HRV3 2RJKA 1LULA 3THTA 4Q0SA 4KL1A 1WLDA 3WV6A 1Z7S1 1C8M3 2VMIA 4BA6A 4E4ZA 4P5HA 4IEWA 1Y3TA 1ND2C 2WT0A 2ZTNA 1QGLA 3LZZA 4BMEA 2HWD3 3JD72 2IXIA 4N43A 1MS3A 4FOWA 4PIYA 4AVTA 3LB9A 4AEDB 4P9LA 2QCSB 2WT1A 1V9U2 3AXDA 1G6NA 1LOAA 2IXKA 1ULFA 4WZCA 2C9AA 4CEWA 2ZBJA 1J3PA 4XF1A 2QDNA 2CAVA 2P3JA 3OY8B 1HXS3 4R9CA 5CBLA 2WS92 4KGQA 3WQ0A 1UU6A 2VW1A 4B4PA 1NA1B 4FP3A 2WQZC 4FPGA 3NV1A 3TN93 4J1XA 2WFF3 4YVWA 2ZGNA 1MQTA 1QJU3 1FPN3 2XJUA 2DTYA 1HRI1 1PK6A 4K20A 1XE8A 4BIOA 3DV8A 4GH4A 1HV1A 2PHLA 1LKNA 2R061 2C0ZA 4JGYB 3SNMA 2AZ5A 3ZXKA 4LTAA 4W6XA 4HETA 4AI8A 3VBSA 4P9XA 5E16A 1ALYA 3VBRA 1Q8QA 1UPIA 4W65A 1KFXL 3GALA 3D8CA 2ZPXA 1LECA 4FPCA 1LGCA 5DZFA 3R05A 5T50A 4RHV2 3GHNA 4W6WA 2XH6A 4B29A 3HR9A 4Z07A 1H9WA 1LGBA 3GF6A 1IHMA 4BWOA 3KSCA 1RUH3 4JDNA 2ZGRA 4OVEA 1QQP2 4Q1PA 5JPNB 2VOVA 4KWJA 1B35B 2OW4A 3NO8A 1EPWA 1VBE1 3IMNA 1DDLA 3ZFEA 5H9PA 1U5ZA 3VBFA 2GC3A 3CU7A 3KQRA 3LA7A 1AX1A 4QXKA 2VW2A 1QNYA 4QQ2A 1QJY2 3CL1A 4MGYE 3LWCA 4M00A 4MYEA 1DBNA 1PVC1 1D4M2 2R041 3ZDSA 1FMD2 4I30A 5C9AB 1FYUA 1MS9A 4CP1A 1POV1 2D5FA 3ELNA 4I0BA 4CDUA 5FMOS 3ZFGA 2ZAAA 4L8QA 4CDXC 3H50A 4K21A 3HD8B 1MS1A 1MVEA 1YI9A 3W9AA 3WQ7A 5FO9B 2NMNA 1HQLA 2XBO2 2RR13 3TBDA 4XOGA 1RVF3 4HL0A 4N53B 1MZ5A 3V0AB 2WZPP 4EWEA 1UU4A 5E1RA 1ZRRA 3ZSMA 2G9GA 5BNPA 1TEIA 3WLUA 4IV3B 1XYOA 1S0IA 2PYTA 3SMHA 4GKXA 4HSLA 3KM5A 4C1XA 3BODA 1YNAA 2MHFA 5EXOA 3IPVA 2A6ZA 4PCRA 1W6OA 1G7YA 5L7OC 3NW4A 3FLTA 3I59B 2XVLA 3TYJA 4OULA 5L19A 1G9DA 5FBZA 2CNAA 3I8TA 2YV8A 4CTEA 4QQHA 4LO4B 4OHYA 4BLIA 2KA3A 1AXKA 3CJIA 5GZFA 4GWNA 3GBWA 1V6LA 2DUQA 4OFGA 4Q4X3 4LBNA 4XJ8A 5FDBA 3VLBB 3VBUC 4Y1XA 2RS52 5H9SA 2WKKA 2BTVC 1VBA1 1XNBA 2A3YA 3NAPA 3ENRA 2XUMA 2JDZA 2YXSA 1ULGA 4LLFA 1IGOA 1CIWA 4YZ3A 5I0SA 4M0HA 4AQTA 5EYXA 4ZXKA 3UKNA 2DYCA 3MFAA 4R9AA 1GNZA 1NOVA 3PJYA 1SLCA 4HSJA 5DXDA 4MSVA 1OA2A 2TNFA 3LGRA 4AW7A 1QF3A 2GNTA 4XJZA 1W6MA 2NM1A 2XLFA 3OF1A 1U5IA 1K5MB 3EXUA 5ABJA 2D6KA 4YARA 1JYCA 2W0XA 2E6VA 5BXXA 4BPZA 4WVZA 4AVBA 2HYKA 1DG6A 2PFWA 3AZYA 1A6CA 4RA0A 1BVVA 3MW3A 1A8DA 5GLVA 5CFDC 1GICA 2G4IA 5FRAA 4N43B 4LBQD 4LO8A 1YRZA 3I54A 1WMEA 1V00A 2GNDA 2QKDA 2SBAA 2R062 2ZGOA 2HEYF 2V5YA 3H3UA 4I3PA 4Q4Y3 1NCQA 2YHJA 4FXKB 2DTWA 3SH4A 4LHKA 2RS31 4K40A 1GZ9A 1OQ1A 4D94A 2PTMA 1VBC3 1FXZA 4E9KA 3SXWA 2ERFA 5BNQA 1PZ7A 4FQZA 2ZX1A 3PVEA 1RUC2 2OIIA 4RS5C 4LUMA 2B42B 3MEPA 5HI0A 5I93A 2HEWF 4QPGC 4XHXA 1LU2A 3V0BA 4YVWB 5KHJA 3B69A 3TAYA 5BNOA 1PZ8A 1S55A 2JG9A 2XL9A 3JBG1 4LLOA 4DNYA 4UBHA 4XQDA 1AL0G 5ACA2 4ISRA 1ZRCA 1VBE2 3FBMA 3RJRA 1AR62 4AHWA 4BOWA 1QH6A 4W6YA 4YM0A 3RNSA 4B7EA 1QXJA 4ITCA 1G9AA 1DIWA 1AR82 3KS7A 4X8PA 1WLCA 3RWNA 1JUHA 2YPJA 2RM21 3ATGA 1VRH3 2ZX3A 1RUNA 3ZYGA 1VBD3 3SCGA 3SCHA 5F6KA 4DY3A 3VBSB 1H9PA 3VBHA 4YGCA 4YRDA 5JSOA 5JZGA 2WSVA 4XTMA 5JWPA 1XU1A 4HBNA 2EA7A 1IKPA 3VKMA 4KG0A 2YUEA 1KXGA 3MYXA 4QPIC 2HWC3 4B4RA 2DFCA 4AVSA 1SFNA 1CONA 2HWB2 4MGIE 3WNXA 3AKQA 4XFAA 4PDWB 2ZJCA 1DF0A 4X8NA 5J48A 2K2SA 4P14A 4YGEA 3M3OA 1POV0 4EN7B 4FPEA 3ZFEB 2H6CA 5JSPA 3GHMA 4HVRA 3VBFB 1WCDJ 1EYBA 4GB33 4IESA 5JOXA 4HK9A 2F6BA 4G3YC 3MI8A 2R30A 4IEVA 4Q27A 4CEYA 3WUDA 3AM2A 4XETA 1PM7A 4EWAA 4Q4W3 1FX5A 3QBQA 1CAUA 1BEV1 2B45X 1RUG1 1PGL2 5EV7A 4AHXA 1A8MA 5IUQA 2PHTA 3G7DA 5K0UC 3ALQA 5T5LA 4N90A 1DYKA 2P17A 4YG6A 3WXPA 3ZXAC 1FAYA 1O3QA 2HKXA 3S7IA 4AVAA 4K6BA 4GMP1 2AREA 5DUUA 4COZA 5A32B 3W58A 3E5UA 2QVSB 2Q8OA 3VV1A 1R082 5GZDA 4LO5B 1CPMA 1MR5A 1R093 1H1IA 4GIQA 4XXPA 1H8TC 4XILA 4Q8LA 4MVTA 5KHHA 1TMF3 1VP6A 4GALA 2O8QA 4DRVA 5DDJ3 2ZZQA 3IDBB 4KWKA 1W6OB 5F5QA 2IC1A 1H4GA 2ENRA 2DVGA 3MPPG 2WNVB 2MPFA 3WINE 2EXHA 1C28A 5J3UA 1Z78A 4JV4A 2B5HA 3V56A 3VKLA 4AFMA 3BB6A 1QOSA 2I45A 2XB6C 1BZWA 3AP5A 1QKQA 2AYHA 2OVUA 2YROA 4BHPA 4F83A 4K3UA 1ONAA 5C8WA 4AQ2A 4NVPA 3ZIXA 3NAPB 2DCYA 3VZJA 1GR3A 5AC93 1N3PA 2GMMA 2H6BA 3QCWA 1JBCA 2PHDA 3WR0A 1H1MA 4DOUA 5HCBA 4G9SB 4COVA 1ZBA1 1N47A 4FPFA 4AEDA 1Y9QA 2R071 2JX9A 3E6DA 3WHUA 4X6QB 2CGOA 3B02A 4PIXA 4R9BA 3CLPA 3JUUA 3KD4A 3MIBA 5FLJA 2RS12 2ZS6B 4U2AA 1DFQA 4HVQA 1AR91 1MZEA 1G8WA 2QFEA 3A4UA 4YW3A 3ZYIB 4CDWC 4AQ6A 4F7ZA 3U07A 3OY8A 3SITA 1X36A 5GZGA 3JBG2 3J8F3 4FOVA 3WQ1A 3BTAA 3E6BA 4C0HA 2VU9A 1NA1A 2VNRA 4Y26A 4N7UA 3CO2A 4ASMB 1NG0A 5KHKA 2PAKA 1RUD1 3JD71 1HQWA 5LRRA 1MEC2 1RUJ3 4IV1C 4JGZC 4UW4<