1C4RA

The structure of the ligand-binding domain of neurexin 1beta: regulation of lns domain function by alternative splicing
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
180
Chain Sequence
HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUREXIN-I BETA
publication title The structure of the ligand-binding domain of neurexin Ibeta: regulation of LNS domain function by alternative splicing.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 41
structure length 180
sequence length 180
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1999-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c4rA00
4TZDA 1Q8VA 3INAA 1JHNA 1MS9A 1AX2A 3AYAA 4M3CA 3W58A 4FPCA 1W6OA 4DQAA 3VKOA 1OFSA 4YG3A 1WW4A 5DZGA 3ZSLA 4M00A 2EXIA 1XQNA 1D0HA 4ASMB 1SLAA 1AXKA 4R9AA 5GLVA 1BZWA 1LEMA 4YM3A 1I1EA 3USUB 1QDCA 2P3IA 2DWRA 4JCKA 2DVFA 4XBQA 2PHTA 1CESA 2C9AA 2ZGKA 2OUHA 3O5SA 5FREA 5GZEA 5T54A 4ZKTB 2WKKA 2NMNA 3AYEA 1A3KA 4Y1YA 5H9RA 1UZYA 1G8WA 1EPWA 5JDBA 3APBA 4M01A 4Y20B 1GICA 4LBOA 1MS1A 5SV8A 3ZVXA 5CBLA 1FV2A 1BXHA 4I30A 4PCRA 3VKFC 5LK5A 1GKBA 4XBLA 3AP7A 3BIWE 2ZMKA 4FPOB 1CR7A 4XHBA 3JU9A 1W6QA 1DIWA 4AYUA 3OYWB 3NV1A 2A3WA 4HL0A 3ZXFA 1ULGA 1O4YA 3H0OA 2AYHA 1A78A 1AF9A 4FOYA 2E7QA 2OUJA 2P37A 4CRQA 1S0GA 4Y22B 5GZFA 3VKLA 4LBQD 3TB0A 4JC1A 4XDQA 1LHOA 1GLHA 2Z42A 4LBMA 3WDYA 2A3YA 4BPZA 3IN9A 1QU0A 1U0AA 3USUA 1QDOA 3AP4A 3CNAA 3QCWA 1Q8SA 4YGCA 1HQLA 1KDKA 1LHVA 4NO4A 2GNBA 1LECA 2FHRA 4YM0A 2ZGQA 1ZA4A 3RRDA 4DS0A 5E8AA 4Y20A 3SH5A 1Q8PA 5CA6A 2A5ZA 4XJ8A 4FPLA 1GV9A 3NV2A 5CAZA 1SLTA 1LOEA 4YZ3A 4YGBA 1WLWA 3VUOA 5GM0A 3AK0A 3MW2A 2NMOA 3UK9A 5JLVA 3B3QE 2OVUA 3OYWA 3WCRA 2UWCA 2YY1A 1MR5A 2GMEA 4GXLA 4Q1PA 1MVEA 2JECA 3M1HA 4K21A 1W6NB 2P2KA 4Q8LA 5T5LA 1HQWA 1Q56A 2PHWA 2ZGOA 4Y22A 3OBTA 4CTEA 4FVVA 4KBBA 3AZYA 4FPJA 3WUDA 1LCLA 2DVBA 2ZA9A 1SLIA 3O0VA 1YRZA 5GZGA 3BOPA 2AREA 1SCRA 3HR9A 1YYNA 3WCSA 1SBDA 1G7YA 1GYKA 2GNDA 2VW2A 3AFKA 1J1TA 2PHFA 1AXYA 1LODA 2PHUA 3MW3A 1WW6A 1URXA 3HMYA 3FLTA 4XJAA 4XTPA 1ONAA 3AZZA 1UPSA 1WLDA 1Y7BA 3TAYA 3V64A 5KXCA 4U36A 1QF3A 5GLTA 5HCFA 2WSVA 1S0EA 1DFQA 4UW4A 2UWAA 3WDWA 4ZXKA 4Q8KA 3ZPYA 5GLUA 1SFYA 2A75A 1W6NA 2GNMA 1ZM1A 5T5PA 4TYSA 4XZPA 2EALA 3ZXEA 3N7KA 1LOBA 3POYA 1CIWA 1N1TA 5IK7A 2EIGA 4FQ4A 1RIRA 2FMDA 1H30A 2A7AA 4BMEA 2NZ9A 4AGGA 3OGGA 2VY0A 1G9FA 2NM1A 3N36A 4WV8A 3VKNA 4K1ZA 2DVGA 2DTYA 3WLUA 5GLWA 4PQ9A 3FBYA 3N7MA 4FPKA 3JUUA 1BKZA 3WG3A 2ZGNA 2D3PA 2ZGLA 4GKYA 3AXDA 3M2MA 2DVDA 4JRAA 1VAMA 2D6LX 4ATFA 3NV4A 2XG3A 2H0BA 4ISRA 3DGTA 1CONA 1CPMA 1MS4A 1V6MA 2EXHA 1N3QA 3UL2A 2ZAAA 3KM5A 2GDFA 5DUWA 3O12A 3ASIA 2WT1A 1QKQA 4UW6A 2VW0A 2WT0A 1FNYA 3FLRA 2JDZA 4ITCA 4M3CF 4XOGA 3M3QA 4XHXA 4YW5A 3WDUA 2ZGMA 2R49A 1R1ZA 3WV6A 5GZDA 2JE9A 4XJ9A 1N3PA 3IPVB 5IK8A 3ILRA 3WG4A 3B69A 1V6OA 2ZHKA 3D5OA 4YZ4A 1OQ1A 2AUYA 4YG6A 3WNXA 2JJ6A 3SNMA 1CN1A 1LJ7A 4RA0A 2ZHNA 4AVTA 1CVNA 1KJLA 1N1YA 4DPNA 2ZGUA 1YI7A 3IMNA 1YXWA 2W08A 1LOCA 1QNWA 2YV8A 4BLJA 4IQPA 2D3SA 2WSUA 4FP3A 1F9KA 1G9AA 5DUXA 2GN7A 1GZ9A 5KXBA 1S0IA 2YZ4A 3ZYPA 1APNA 1W0OA 1DGLA 1QMJA 1FX5A 3AYCA 5KXEA 2ZMLA 2TEPA 1DYPA 1DQ5A 1FYUA 2HYKA 4WZFA 3AJZA 1LOAA 3LCPA 3M3EA 2R1BA 4LBKA 5CNAA 1MZ5A 2GALA 2ZGRA 4R9BA 2D6KA 3IPVA 3ENRA 3MW4A 5AVAA 4WVWA 3R4SA 2KM2A 4FPHA 2DU1A 4P9YA 3RG0A 3W59A 1DQ6A 1UL9A 2CWMA 1SBFA 4YGEA 5T5JA 1IS4A 2A3XA 3LSDA 4Y1XA 3RMXA 4Q1RA 4F83A 4WVVA 3WHUA 4D69A 5DZFA 2JE7A 5FRAA 1S0BA 4M3CE 3WG1A 4BMBA 5F9TA 1JN2P 1LULA 1W6PB 1O4ZA 2EAKA 3FUQA 2C5DA 4XJUA 3O0WA 2DURA 1QOTA 2W52A 3AP5A 1S0CA 1G9BA 1V6NA 3A4UA 3C2UA 4XIKA 1AJOA 2DTWA 3GALA 4PF5A 5F5QA 2RHPA 2I2SA 1V6LA 2XB6C 2EXKA 1S0FA 3B00A 4AGVA 4YFZA 3OJBA 3AX4A 3N7LA 2GN3A 3AZXA 4P9WA 5T5OA 4XE9A 1DYKA 1MS0A 2W68A 2EF6A 4NOTA 4YW3A 1NLSA 3ATGA 3VV1A 1ULFA 1WCSA 1WLCA 1ENQA 3B01A 4YW1A 4GA9A 3O0XA 3PVOA 1FAYA 2WQZC 4YM1A 4BOWA 1UMZA 3POSA 4FPYA 1LOGA 4YFWA 5L73A 4Y1VA 3GNEA 4YZ1A 4Y24A 1WBFA 1BJQA 1V6JA 4SLIA 4ATEA 1HLCA 1IKPA 2R1DA 1I3HA 2ARXA 2AR6A 2ES3A 1W6PA 4YW2A 2YMZA 3T1MA 3WZ1A 1PZ9A 5JOXA 1G9CA 3WOGA 1NXD1 1ULDA 2NN8A 1FNZA 3SH3A 1TEIA 2A6ZA 1LOFA 2DUOA 4PBPA 1DQ2A 4PBOA 5EWSA 1A8DA 3IKWA 1PZ7A 1AJKA 1LENA 1F31A 1GNHA 1N1VA 3MEPA 3RMYA 1LGNA 1LTEA 1RINA 3HN1A 2PHRA 1SLLA 1IS5A 1AX0A 1DQ0A 2A6YA 1S0DA 1ENSA 4LBJA 2SLIA 1HDKA 2LTNA 4XILA 5DZEA 2A70A 5H9SA 3T2TA 4AGRA 1GBGA 1N47A 2VW1A 4BLIA 5HCAA 1GNZA 1GSLA 4HANA 4MYEA 5EYYA 1KDMA 2YROA 5IK5A 1FATA 4GALA 2ZGSA 4YLZA 1LGBA 1LU1A 4FOWA 4XIOA 3WHTA 1V00A 5IUQA 2A6WA 2ARBA 3PMEA 1X50A 1KJRA 3UJOA 2WT2A 2JD4A 2D6MA 2Q5TA 3I8TA 3PVNA 2GMPA 5CB7A 1LGCA 1DLLA 1F5FA 1UKGA 1W6MB 3NV3A 4LBNA 3RSJA 3ZSJA 2UWBA 1VLNA 4BM8A 2W39A 5E89A 5IK4A 2ZHLA 1JYIA 5IT6A 3POWA 2GMMA 1UX6A 4K1YA 4Q2FA 5GJ6A 3FFZA 1S0JA 5HCBA 3WDTA 5GZCA 5JMCA 4P14A 1Z0HA 1WW5A 2CYFA 1IS6A 3ZXKA 3U4XA 1WUVA 3ZYRA 2A6VA 4GWNA 3AJYA 3T1LA 1KITA 2ZABA 1D2SA 1FV3A 2VXRA 2E6VA 2A71A 4K20A 1IS3A 1SCSA 2D6PA 5DUUA 4BQ1A 3OY8B 4YZ2A 3QLQA 1SLBA 4P9XA 1VAVA 1UN1A 5GALA 1W6MA 1CQ9A 2ZGPA 4YZ5A 5H9PA 4C1XA 5BYNA 2CTVA 2DV9A 2AENA 2DYCA 2E53A 3MPPG 4XYXA 1LEDA 3DUIA 4OZXA 4Z8BA 5DUVA 1OKQA 1C1LA 2P3JA 2ZHMA 1V6KA 3L2YA 2NYYA 4AVVA 2JKBA 4Q26A 2UU8A 4FPGA 3PVEA 1WW7A 3SISA 1CPNA 3RQ0A 2CNAA 3M3CA 4FQZA 1QOOA 2VH9A 3LSEA 1DHKB 5T55A 4R9CA 4AWDA 2VU9A 1ULCA 1JBCA 1MS8A 3AXEA 3V65A 3WG2A 1MS5A 4H55A 3A0NA 2P3KA 1QGLA 2UURA 1BQPA 3D4KA 3BTAA 5GLZA 2D6NA 2VUAA 4XBNA 4GWMA 1CJPA 3OY8A 2DUQA 2ZZJA 3N3HA 4ISQA 1Z78A 5H9QA 3VKMA 3OBRA 1DZQA 4LBQB 1JUIA 1G86A 1AZDA 4W65A 2WNEA 2A6XA 4GKXA 1DBNA 3WVJA 3D6EA 1GZWB 1RITA 2E7TA 5DG2A 2V73A 4FPFA 2CL2A 2ZBJA 4UW3A 4XMAA 3AP6A 4YM2A 5E88A 4CZSA 3R4UA 3V0BB 3A0KA 1YO8A 1WD3A 2AGSA 2R16A 5JOYA 2GNTA 1C57A 4XJZA 1WBLA 4DRVA 1MVQA 1UZZA 1VIWB 2NP0A 1AX1A 4YW4A 2ENRA 1DQ1A 3UJQA 1QOSA 1ENRA 1SBEA 3KQRA 1UAIA 2DU0A 4FPEA 3N7JA 3AP9A 1MS3A 2P34A 2PELA 3WDVA 5JOZA 2SBAA 3ZXJA 1GANA 2D3RA 1Q8OA 3SLIA 2ZMNA 1IKQA 2LALA 3SITA 4Q27A 3I4IA 4RL7A 3OPZA 1LOFC 4FOVA 1MACA 2DUPA 4FP2A 4LBQA 1KQRA 2R0FA 2WLQA 1JXNA 1LHNA 1ULEA 3Q9OA 3ZSMA 3RS6A 1GZWA 4FOQA 1C4RA 1B09A 1JOJA 2OW4A 2R0HA 3IM0A 4DRRA 1KRIA 1GZCA 3FLPA 3AYDA 1H9WA 4U2AA 1WD4A 3V0AB 3FUOA 3V0BA 4UW5A 5T50A 4YGDA 2E51A 3ZSKA 5KXDA 3PJQA 1N3OA 4LBLA 4XTMA 4Y1UA 3SH4A 4YG0A 1W0PA 1AVBA 1DQ4A 3AZVA 3NWKA 1LHWA 2BQPA 1AXZA 5DXDA 4M3CB 3ILFA 3ILNA 3N35A 1MZ6A 1W6OB 3ZXLA 1SACA 1LESA 1HKDA 1Q8QA 5JOWA 1IOAA 4XXAA 2DVAA 1YIFA 2ZGTA 4DFSA 2D43A 1JW6A 2V5YA 2YXSA 1N1SA 2D44A 3M3OA 3WDXA 1SLCA 3BODA 4C1WA 1S1AA 4Y1ZA 5DG1A 5EXOA 1G9DA 2PHXA 4Y26A 2ZACA 3R05A 4L8QA 1LU2A 2EXJA 1VALA 1JYCA 1C1FA 3WUCA 3AZWA 4XXPA 1QNYA 3B9CA 4R9DA 5EYXA 1H9PA 2CWSA 2ZKNA 5T52A 1BYHA 2CY6A 3V0AA 5JVVA 2B7YA 4AVSA 1V6IA 2D7FA 2G4IA 1PZ8A 2D6OX 2ERFA 4XJWA 1W6QB 2AH2A 2WJSA 4XMIA 1LHUA
chains in the Genus database with same CATH superfamily
2CDOA 5JIAA 5FZOA 1JHNA 3N9LA 3VBRB 4LKFA 1OHFA 3W58A 1H4GA 4MSVA 4DQAA 1OFSA 2WN3A 3WSOA 1OH3A 3LF7A 4FSJA 2FCTA 2YC2A 4M00A 3ZYIB 4JDMA 4BZ4A 3EYPA 3IB3A 4O65A 4QXHA 4PIZA 5FZHA 4ASMB 1QJX2 4CCNA 3O1TA 1JH5A 4JTOA 4EZHA 1LEMA 1HXS1 4LTAA 3RJ2X 5IVBA 1I1EA 1EPZA 1GP6A 3LDRA 3PU8A 4JDOA 3USUB 2DWRA 1AR81 2DVFA 3AC0A 4O7XA 2PHTA 3ST7A 2ZGKA 1SQ4A 1J1LA 1FOD2 5H9RA 4CDQC 2VOWA 3RNSA 1W2TA 2VCBA 2C9KA 4LBOA 4Y20B 5AVPA 1QJU3 1MS1A 5F5AA 5SV8A 1QJY1 1UYYA 5FZ9A 1BXHA 5FKBA 4I30A 5I0DA 3TN92 4FFFA 2WS93 1OLRA 4XBLA 4NHLA 2ZMKA 3H1YA 3JU9A 1UU4A 3NNJA 4GQ7A 5L7OC 4CUCA 1ULGA 2Y60A 3O7OA 3H0OA 5FZ8A 4EN9B 1BEV2 2W94A 4FOYA 1DZTA 4QU2A 2RV9A 4JGYC 5KHKA 4Y22B 3ZLIA 4LHLA 2BJSA 3Q8EA 3NRUA 4W50A 1W9FA 5D8AC 4ZZ5A 3RFRA 2YHJA 3BUCA 5C3OA 4XUOA 2Q1ZB 3CNAA 4D7SA 1RHI1 4OYUA 3J7HA 1HQLA 1OLME 1C8NA 2GNBA 1DLCA 1LECA 2D5FA 1S2EA 2ZGQA 2MNGA 5FYYA 2VZPA 4I2OA 3MO4A 4I09A 1Q8PA 3AMPA 3SH5A 4XJ8A 4YW7A 4A2UA 2IXCA 1GV9A 2BTVC 1YFXA 4TLGA 4YZ3A 1LOEA 1RMU2 1WLWA 3R0RA 3JD73 3PDQA 1HRV1 4Q0UA 3OYWA 3WCRA 2YY1A 2GMEA 2CGPA 4EWAA 1ZZ7A 4GXLA 4CP9B 4K21A 4XF3A 2XUMA 4Q8LA 1STMA 3LEIA 1RGSA 1ZBE3 2FDGA 2WO3A 4RHV1 4YARA 4FVVA 4BYYA 1KFUL 2A1XA 4XABA 5FUIA 3ES1A 4L0PA 1VMHA 2DVBA 2RR12 1CZTA 2GP5A 2PA7A 1YQ5A 3R6SA 3RYKA 3HR9A 2ZZQA 1W8HA 1G7YA 2VW2A 2GNDA 3UYJA 2W2IA 3MW3A 4JZRA 5FXVA 4M0HA 4IDZA 2JE8A 3J8F3 3AKSA 3FLTA 3ZFGA 1NY71 3ES4A 3H8UA 4XTPA 3U4SA 1RC6A 4FFIA 1WLDA 2WUHA 1K5MA 2CGOA 4HN0A 1QF3A 4AHYA 3VBUC 5LB6A 1S0EA 4AEDC 4Y5TA 4ZXKA 3I3MA 4LA2A 3GXUA 5GLUA 1JYNA 1H1MA 1E5SA 5T5PA 5B4NA 3B93A 2L9LA 3ME2A 2EALA 1DGRN 1SEFA 4WM7A 4AFAA 1JYXA 2TUNA 1JZ2A 2WNUB 1Q43A 3GJBA 5ABJA 5BNNB 4BA6A 1H30A 2WZR3 1R091 2A7AA 2RS51 5LCWL 5F7UA 4AGGA 2DCYA 1G9FA 4CU6A 2XLGA 3OSDA 1ZZ6A 3VKNA 1D4M2 5A6QA 1W2NA 2RDQA 1CD3G 3BOWA 4PQ9A 4QX5A 2B8MA 1Y43B 3POJA 2XBO3 3WG3A 2D3PA 4JKMA 1UIKA 2PLV2 4IV3A 3D0SA 2D6LX 4ATFA 2XR4A 2XG3A 2W91A 4HOOA 2ET7A 2RS13 1CONA 2VQTA 2EXHA 2V4AA 4UFKA 1OH4A 4NIGA 3WX5A 2GDFA 2W1WA 1TMF3 1OD5A 4TXWA 2WT1A 2XJRA 1VBC2 4UW6A 4FAGA 3ZN4A 3FLRA 3HIFA 1QWRA 1D0GA 2VNGA 4XHXA 4YW5A 5IVEA 2JDHA 1R1ZA 5FBJA 3WV6A 4LE4A 5F1RA 5ERLA 2YDEA 5IK8A 3HNMA 3M70A 2ZHKA 3D5OA 5FQ0A 1ZRCA 2G9FA 4GWJA 3U14A 3FJSA 5C71A 4RA0A 3DPRC 4Q4W1 4AF9A 2W5FA 2Y8KA 4XVHA 4N43B 1KD7A 2PYTA 1PIV3 4CEWB 4YWAA 3SKVA 1RUJ1 1BLZA 3NAPA 2JG9B 4JHZA 4ZU5A 1LNSA 5F3IA 2I74A 1VBB2 5FMOS 4P5YA 1QJFA 2D3SA 2WSUA 1NA1C 1RUE1 5DABA 2GN7A 2YBSA 3BPZA 5KXBA 1S0IA 2QJVA 1DGLA 1FX5A 2ZMLA 2Z4FA 4CDWB 5FP4A 1DQ5A 3H3UA 5G04L 1PO21 3AJZA 1LOAA 3LCPA 1NCQB 1XNAA 1DZRA 4IV1B 3RZKA 4P9IA 2WFF2 2ZGRA 4MH0E 1PX4A 3IMMA 4FAHA 2B42B 1D4VB 2WYSA 2KM2A 3KD4A 3NL1A 1ZZ8A 5FJKA 1WA4A 1PMIA 2PXJA 2WFPA 1FPN1 4P9LA 5T5JA 5C3PA 3RMXA 2A3XA 3LSDA 4BQ3A 1W28A 4WVVA 1QQP2 3K46A 2DCZA 3AMHA 4ES9A 1GQHA 5JI7A 4D69A 3K2OA 4Y4YA 4HBNA 1UCXA 5FRAA 3THDA 4M3CE 5D2AA 2I45A 3J9SA 5F9TA 3BU0A 5FY0A 4NHXA 1RUNA 1QJX3 5JXJA 3ZFFB 3A4UA 1AR71 3URFA 3SCGA 2D93A 2BNMA 4RGKA 1FXZA 4HETA 5F5QA 5F32A 2RHPA 2B4KA 4AFCA 1UYZA 2H0VA 3B00A 4IUGA 1H1AA 4KG8A 3E5QA 3OJBA 3I59B 4CDXC 1XSQA 4Q0SA 5LBFA 4P9WA 4RSUA 5AFBA 4XE9A 2Y38A 3AL6A 3TYJA 2JG8C 3GZUC 3VZOA 2QZ2A 4LQRA 2C6SA 1WLCA 3PUHA 4ASLA 1PK6B 3VD9A 3LB9A 1AYM2 3HQRA 3MPBA 5BNPC 4QX8A 4QPIA 2JDKA 3I2DA 1UMZA 5CKQA 2EICA 4FPYA 2XWBB 3IT8A 2J7MA 1UNBA 5F2WA 2VD7A 5L73A 3VGIA 5A70A 4HT1T 4ATEA 1BEV3 1GFF2 2AR6A 3UKVA 3KGLA 2W1SA 3WZ1A 2LROA 4XFIA 1G9CA 4AFMA 1RVF2 3S7EA 4MGZE 5C33A 3WF3A 4JGZA 4AK3A 5CFCA 4FXGB 1QJU1 4A3XA 2ILMA 2VUCA 3JBG2 3VHRA 4AI2A 4YVSB 1LENA 1GNHA 1N1VA 1NX9A 3LEGA 1LTEA 1SMVA 1Y9GA 1U5ZA 1WMDA 1IS5A 1AX0A 1PK6C 2A6YA 4QKFA 2VAUA 4LBJA 4RS5C 2QQOA 5LW9A 5H9SA 2A70A 5DPNA 3C7GA 3LZZA 3RI8A 4AGRA 2VW1A 4D3WA 5FWEA 3PJYA 2RDRA 4HK9A 1ZYBA 4MYEA 4YPJA 4D6QA 2R073 1TME1 3C7EA 4CU7A 3PIJA 5EYYA 3O1MA 5FZIA 4GALA 5A3NA 4C0HA 2Y6HA 3C8XA 3VDDC 4Z2AA 2QCSB 4XIOA 1WMFA 1V00A 5JSRA 1J3QA 2A6WA 2Y6GA 2VZOA 3PNAA 4CCLA 4LHNA 2VMDA 1A6CA 2Q5TA 1OKOA 2ZPXA 1PM4A 1UKGA 2RMU1 3NV3A 3VL9A 1HRI1 2UWBA 3NJXA 2RR13 2VQ0A 4OI4A 4OQ9A 2WNVB 5IK4A 2XHNA 3BTZA 2GMMA 4K1YA 2BWAA 5HCBA 5A32B 3JD71 1PHMA 1BMV2 5JMCA 2MHFA 5K0UC 1PNGA 1GOHA 3AMQA 1IS6A 4KWLA 3ITQA 3ZXKA 3RZJA 1S2BA 3ZYRA 4BJ0A 4R4XA 2IC1A 1AL23 1FMD1 4UT5A 3POBA 3KLSA 4LEJA 1BVVA 4IESA 1ZBE1 1WMEA 1FV3A 2VXRA 4X8NA 2XJTA 2IWGB 4ZONA 1R1A2 3GHNA 2BP6A 2YU2A 1DGWX 2D6PA 5DUUA 3N9PA 4XAAA 3VBSA 5IHRA 5JSPA 4I0BA 2FCUA 4HFSA 4AOCA 4PDWB 1SLBA 4UBHA 1RUOA 2ZGPA 1ZZ9A 2HWE2 2PHLA 4MV2A 2JIGA 4P02B 4DUVA 4V2VA 2CTVA 2DV9A 2JDPA 3GCXA 4QHOA 4B1MA 1LEDA 3J8F1 4OZXA 1HV0A 2P3JA 4KL1A 3WP4A 3NO8A 4FFGA 4Q26A 1W8TA 1GMMA 3N9NA 5A7OA 4N53A 4Q4V2 3HBKA 1WW7A 5FV3A 3WW2A 5CFDB 3SQOA 3DKQA 4KG0A 3SISA 5K8SA 2VOKA 5B4XA 3M3CA 4A7ZA 2NLRA 3LSEA 5FZ4A 5A33B 5T55A 1AR63 2QQUA 2J1AA 2VU9A 3K4ZA 1WKYA 3VBFC 1H6XA 3WG2A 1VBD2 2RJLA 4YVWB 4HSJA 1QGLA 5F3GA 4OI0A 4PLNA 5LASA 5C3SA 2D6NA 3RJRA 4GWMA 4CCKA 5F8PA 2UYAA 4W8JA 4WM8C 1Z78A 3B02A 2BOIA 3LKJA 1BK1A 5FFOC 3ACLA 3TEZA 1AL0G 4XPVA 4FO9A 2WNEA 4OHXA 4AL9A 1DG6A 1DBNA 4HMZA 4K3UA 1GZWB 2VOXA 3WF4A 2DFBA 3CZJA 1YI9A 1UY0A 1GUIA 3C7HA 4XMAA 3RZZA 1UMIA 2RS11 5JIUA 3WF0A 1AR92 1L7RA 1SFNA 1WBLA 3VZKA 2VBPA 2H6BA 1VIWB 4DRVA 1SDWA 4E9KA 1AX1A 3AFGA 5A3LA 1QOSA 1EUTA 1VBB3 5FPLA 1UAIA 3AP9A 4LITA 1UXXX 5FY9A 4QX3A 2E63A 1DF0A 2F4LA 4IGQA 2SBAA 4AQSA 5CADA 4NIDA 2D3RA 2ZMNA 5A1AA 4B4QA 4Q27A 4GULA 4BCUA 5ISLA 1LOFC 2YPJA 3Q8CA 3BB6A 3CBNA 1MACA 1R64A 2DUPA 3DCQA 1B35A 3MIDA 4LBQA 5J09A 2R0FA 2Y6JA 1ZRFA 1O3RA 1JXNA 3C3VA 4ASKA 4CSWA 5C4WA 3Q9OA 1PIV1 4WZCA 1C4RA 1PGW2 4DINB 1R083 1RUG3 3H1WA 1XBFA 1I6XA 1X36A 3IIAA 3FLPA 1H9WA 4IE0A 5FP3A 1QQP3 3FUOA 4QXKA 2BRTA 4YGDA 2E51A 4V2WA 2BYVE 2VTXJ 3I3DA 4MGQA 1ND2A 4YG0A 1DQ4A 4EN7B 2CAVA 2R062 3HAGA 5FZOB 3NSTA 4BK4A 1XYNA 2ATFA 3N35A 1MZ6A 1W06A 1SACA 2QNKA 4XF9A 2BVVA 1OA2A 1Q8QA 1IOAA 1C8M2 1OQEA 2BNOA 2VBBA 3IDAA 2V5YA 1JW6A 3O1SA 1CAXA 4LIVA 2D44A 4B8EA 5L36A 1SLCA 3LFMA 4QX1A 1RJ8A 4HLTA 4JRLA 5IAVA 4COWA 3GBGA 1LU2A 1Z7S2 3TEYA 3JB8A 2PTMA 1VALA 4JTNA 4MZUA 3ABZA 4QXBA 4DY3A 2X5IA 4XXPA 5LRRA 4BXFA 2HWC3 4J25A 1H9PA 1K45A 2CWSA 3GZAA 3LPFA 5T52A 1WGPA 2BNNA 2CY6A 2FCVA 4QPYA 5FZKA 3U78A 4NVPA 4A42A 4GH4A 1AYN1 2G4IA 2VMGA 2QQLA 3NVCA 3PVBB 4IETA 1LHUA 1J59A 2ZXQA 3PURA 3ON7A 4NPRA 1MS9A 4OULA 3AYAA 4E4SA 4HN1A 4BXSV 1RUF3 1QJZA 1XRUA 1MPXA 3ZMNA 2Y34A 2TBVA 1YQ6A 3DV8A 5FY7A 3N9QA 2YG0A 2VR4A 4YG3A 5DZGA 3RWKX 3ZSLA 2XL7A 2EXIA 1SLAA 5I0RA 4CU8A 1YHFA 5HCHA 2ORXA 4XZUG 3T2OA 4BU2A 2ZOEB 5C6CA 2JEMA 2P3IA 4QPGC 4XBQA 1O3SA 5FZ1A 2C9AA 3O5SA 3GF6A 3LEMA 3PUAA 5GZEA 5T54A 3AYEA 1X82A 3LQCA 2FDHA 1X9TA 1G8WA 4D7TA 4CXYA 1YFWA 4M01A 1ND3A 2OZ6A 2IVIB 1UOJA 4PIYA 5L9BA 2VVDA 3H42B 3ZVXA 4CUBA 1FV2A 5KWRA 4LO5B 4PCRA 4QX2A 3CEWA 3VKFC 5LK5A 1GKBA 2Q1MA 1W6QA 1DIWA 4N8MA 3OYWB 2ZCWA 4JVAA 3ZXFA 3WF1A 4LPLA 1U12A 2AYHA 3JZVA 2CV6A 3TEXA 4IEZA 1CAVA 2OUJA 3KV4A 3NNMA 2O0OA 3IDBB 4LBQD 1HB1A 4XDQA 4GMP0 4AVBA 2E33A 3IN9A 2G1MA 1QU0A 5K4LA 3O1PA 2C26A 2R071 5FZBA 5JMOA 3BALA 3MI8A 1A8MA 5FO8B 3H1MA 2OIIA 1COV1 1LHVA 1WCDJ 2BZDA 2HJIA 2FHRA 4RGAA 1VBA2 1ZA4A 3EBRA 5E8AA 3E6BA 4DS0A 5D21A 5F6LB 3PTRB 1IG3A 3MLJA 3WT3A 1JODA 5CEHA 3TWIA 3F95A 1W99A 3ZFGB 1QIQA 5FYBA 4L99A 3VUOA 5GM0A 3MW2A 3B3QE 2CSGA 2PHDA 2W3JA 1K5MB 3ETQA 4COVA 2G9ZA 3AMMA 1R1A3 2UWCA 2UY9A 5E16A 5C7GA 2JECA 3ZOIA 1UU6A 1YQCA 3OTFA 3HNBM 3CHXA 4GB33 4AAXA 2ZGOA 4WM7B 2WAAA 2HWE3 4CTEA 4KBBA 3AZYA 4FPJA 1IGOA 4DUXA 4AEJA 5ABJB 3BGAA 2BGCA 4GWIA 3OF1A 3IAPA 4GMP3 4OZOA 1F4HA 2K9ZA 1H2LA 1RUC2 5FMBA 5DDJ3 1AL21 1SLIA 5FZAA 1YRZA 4GZ9A 2OYZA 5GZGA 5LBCA 5BNOC 5DAPA 1DCSA 2VJXA 4KWKA 3J26N 3WCSA 1GYKA 4I3PA 1MEC2 3AFKA 5DAQA 1LODA 5JZGA 1V9U2 5M0TA 4ZU4A 1WW6A 4J1XA 1REEA 1QXJA 4IV3B 4XJAA 1SFPA 1UF2C 2BVBA 5F5CA 3TAYA 1X8MA 3GDBA 1VBD3 4U36A 3RZGA 1UYXA 5GLTA 1A34A 4URTA 2WSVA 2ET1A 1DFQA 3OGJA 4P5HA 2UWAA 2XJUA 4A45A 4WVMA 4LT5A 4XF4A 2A75A 2GNMA 4HZFA 3KCCA 1ZM1A 4NHMA 4XCBA 5J1XA 2XVGA 3N7KA 5DAVA 3EMRA 2KXLA 1CAWA 1CIWA 2EIGA 4FQ4A 5I0TA 5AC92 1JYWA 4BB3A 1SPPA 4CEYA 4QB1A 3T2PA 1KS5A 5IVFA 1RL3A 5FZCA 1C3HA 2NM1A 2VVFA 5FQ0B 1LRHA 2CDPA 2Y6LA 1AR61 1NT0A 3VD7A 4HVQA 1OOPA 1AR93 1I9RA 3FWEA 3P1IA 2CHHA 2HWB3 3JUUA 2ZGNA 1VAMA 5F5IA 4LKEA 4RR3C 3NAPB 3HNYM 3EHKA 2H0BA 4ISRA 5FZ7A 3W20A 1HN0A 5FPUA 3VHOA 2OT7A 1CPMA 1YUDA 2FMYA 4Q4X1 3UL2A 4N9IA 3T4HB 3ASIA 2W95A 1QKQA 3FHIB 4IGOA 1X9PA 2VW0A 2R6QA 1K5JA 2JDZA 4CCEA 1J3RA 2ZGMA 2R49A 3D82A 5KR7A 3OPTA 5ACA2 4XJ9A 5F37A 5FLJA 2JWPA 1EY2A 2PAMA 3B69A 2N7GA 5CIRA 3CKHA 3T4VA 2VZVA 3OD0A 4QGLA 5C8CB 5I93A 2HWD2 2XKPA 3KQ4B 3H8XA 3OUHA 4LUMA 3TRSB 3P3PA 3SKJE 3ZR5A 1KJLA 4CP0A 1N1YA 4DPNA 2ZGUA 3AKRA 5FZMA 1NE4A 2Q0AA 4AI0A 1MQTA 2QQWA 3VBOA 4GJYA 3ZFEC 3U0ZA 1UZ0A 3LFIA 4QDQA 1LOCA 1QNWA 2VQUA 2JDAA 4LMFA 1UKRA 5FIXA 4DXSA 1CZVA 3CJIA 3DL3A 4IQPA 4QMAA 3RDIA 3VBHB 3VBRC 2Q4SA 1DU3D 5FWJA 1F9KA 4YRDA 1ACCA 5FXXA 5J96B 2DCKA 5KXEA 2GZWA 2WA4A 1QMJA 1VRH3 2WAOA 4KGGA 4TN7A 1R081 1RUG1 3WW3A 3PU3A 3JXSA 1FYUA 2ZEYA 3MV11 3ZR6A 1VE0A 1IPJA 1Z7S3 1QJEA 3K4AA 3PUQA 4GD4A 1X33A 5KC6A 2EIDA 4LLFA 1XNTA 1HIXA 4N90A 3IPVA 2BDRA 3OEBA 5FYCA 1RUH1 4WVWA 3R4SA 3RG0A 1RUD1 3WP6A 1RXFA 1XYOA 2CWMA 1REFA 3BU7A 5LA0A 4AFBA 3I2FA 4QPIB 2YPDA 4YGEA 3CQOA 1G6NA 5FAXA 1J58A 2WABA 3W21A 5EJZB 1Q3EA 4FTSA 2DDUA 2JE7A 4RD7A 3VL8A 1S0BA 3FHAA 5LA9A 4RQPA 5F39A 3VBHC 1LULA 1IPSA 2RS32 4LKDA 2IXIA 4XJUA 2VTFA 2JD9A 1QOTA 2W52A 4HSLA 4TWTA 3U10A 1ZBA2 1V6NA 1YEWA 4E8DA 3O1OA 4JGZB 3GALA 3E6DA 1E5RA 2HWC1 4O9EA 1Y9MA 4X6RB 2WQ8A 5CFCB 2BBVA 3MLKA 1V6LA 4XF0A 2EXKA 1S0FA 3MBWA 1XE0A 3ZIWA 4COZA 2GP3A 3AX4A 1RUI1 2BU9A 3VB9A 5T5OA 3LE0A 1MS0A 3KZ4C 4NOTA 3VV1A 4H14A 4DEVA 1XNBA 1ENQA 3B01A 1H8TA 1FAYA 1RUF1 5F2SA 2LW8A 1O7FA 1PMHX 5FMDA 3HVDA 4B29A 3EO6A 4NIHA 4OHYA 1LOGA 1TE1B 1PO12 4Y1VA 2J1SA 4YZ1A 2KR2A 4Y24A 4QB6A 2J1TA 1BJQA 1V6JA 4K6BA 4URAA 3G7DA 5L9VA 1HQNA 1VBE3 1W6PA 1WLTA 2EAAA 2WL1A 2YMZA 4ORFA 3T1MA 2KD7A 2LM3A 1NG0A 1NXD1 3K77A 1FNZA 2C1FA 4W4ZA 4IEVA 1TEIA 4J6GA 5A3OA 4PBPA 3I3BA 2A73B 3VHNA 2YGMA 1PVC3 3IKWA 3MEPA 4XCAA 2J1RA 1LGNA 1RINA 2K2SA 4HPKA 1ASJ2 1VP6A 3POIA 1JZ3A 4O61A 4XILA 5DZEA 2LTNA 3GBWA 4B1LA 4DEQA 4AVCA 4RGGA 1CJDA 1N47A 3MICA 1W90A 5HCAA 1GNZA 3DF0A 2P6CA 1CAUA 5EZWA 5FCCA 1KDMA 2YROA 2R043 3I3QA 3WW1A 4K7JA 4YLZA 5DMYA 1XU1A 1XJAA 5IYYA 4NRPA 5LWBA 1UU5A 4ZU7A 3NKGA 3WP3A 2G9GA 5LATA 1NUKA 3O14A 4OVEA 4FTEA 1OVSA 1TZOA 3PMEA 4NPLA 4Q4Y1 3VBSB 2D6MA 4DB5A 2YFZA 3CDZB 3WNLA 1K3IA 1BBT3 3ZYFA 4CDUA 4LBNA 3T0AA 5I0UA 1VLNA 2WNUC 4BM8A 5BNQA 2W39A 4DUWA 5CKNA 5E89A 5BNNC 5IAXA 5IT6A 3K3NA 2UYBA 2QKDA 4Q2FA 1S0JA 4XQ4A 3I2HA 3KVBA 3ZPOA 1WW5A 1V9U3 2AACA 4N53B 4RN5A 1BCXA 4EV0A 3U4XA 1PGL2 5ANQA 3WNMA 3HEIA 2QQKA 3WD5A 5DQ0A 4QM8A 2VO5A 2W9XA 3AJYA 4GWNA 5CU1A 3A23A 1GOFA 5FPAA 4WBBA 4GB31 3T1LA 4CXWA 1KITA 5FMOL 3RYRA 5AFEA 1D2SA 2X29A 5K9YA 3S6PA 2FDKA 1XE8A 3S7IA 2E32A 5FYVA 1CIYA 2GAUA 5DDJ1 1C5HA 2JICA 2RM23 1ZRDA 3QLQA 5AC93 5A7PA 3T30A 1UN1A 1CQ9A 4YYOA 4AAPA 5KHJA 4MGKE 3OGRA 4IEQA 3MPPG 1ZNPA 2AENA 4DIQA 1W8OA 1GR3A 3DUIA 2ZAHA 2Z79A 4CXXA 4Z8BA 1UPIA 3MFAA 5DUVA 4AVVA 2ZHMA 5FK7A 1V6KA 1W05A 2WZPP 3H3ZA 2JKBA 4CDQA 1HXS2 1UW8A 2UU8A 1GNYA 2ETEA 3ALQA 1F35A 5IW0A 1EAH3 2PN5A 2XJSA 4LOSA 1AR82 5CZKA 5KHIA 4C8DA 3ACFA 2CNAA 2YU1A 4N43C 1W9YA 2MEV1 3IAQA 4R9CA 4CEWC 5L7OA 1NQDA 1GWLA 3BN6A 1EV11 3OGSA 2Q8OA 2JG9C 4D94A 1QJY2 2HWF1 4QXCA 2AEYA 2IXLA 3RGBA 4JV4A 2P3KA 2UURA 5GLZA 4JGYA 1I5ZA 4PIXA 2VUAA 4R52A 4XQWA 1CJPA 3OY8A 3BVCA 4Y5Z0 4AI8A 2Y26A 5H9QA 5D8AA 3WINE 2V5DA 1ZVFA 1B35B 4LBQB 1JUIA 4CDWC 1HJGA 3KT7A 2RVAA 2HWB1 4IV1C 1NCQC 4AW7A 3M8LA 3WVJA 2ZEWA 1RITA 1POQA 2B9UA 3RWNA 1FOD3 2E7TA 5DG2A 1DGRA 2V73A 2XMLA 2CL2A 3X29B 1L7LA 2JXAA 4YM2A 4CZSA 1GP5A 3R4UA 4NHKA 3RZHA 1YO8A 1JHJA 5JOYA 1RHI2 1ND2B 3TN93 3NW4A 1MVQA 1UZZA 2UY8A 2W1UA 2NP0A 2D40A 2ENRA 3UJQA 3VD3A 4FPEA 1YNAA 2DU0A 2WC2A 3KQRA 2B5HA 3N7JA 5G05L 3SHRA 1DDLA 3CMGA 2P34A 2WZEA 3LEKA 3ZXJA 4Y33A 1Q8OA 1W3XA 3ECQA 3OGVA 4L92A 2B45X 4ZZ8A 1CAXB 1HRV2 3KVAA 3ZFFC 4I0AA 1E5IA 2QE3A 4EWDA 5JR7B 4QDSA 1ODMA 4IERA 3GZEA 1ULEA 4K8FA 4KBZA 4RHV2 2HH9A 3SCHA 1B09A 2WS91 2OW4A 1KRIA 3QOPA 4OHVA 1GZCA 4DO0A 3AYDA 5FOJB 4KWJA 4MOAA 4EQVA 1EYBA 4XFCA 4GH4B 4QDRA 4XW3A 2V4VA 1BK0A 2X8KA 1N3OA 4LBLA 4XTMA 4EWEA 1RMU3 1ULPA 1AVBA 1W0PA 4Q0PA 4YNIA 1LHWA 1VRH1 5DXDA 3PUSA 3P3NA 2B46X 3ILFA 3VBUA 4AEDA 4NR1A 4P9GA 1LESA 3H7YA 3KT1A 5JOWA 2G19A 2JDUA 4QHZA 2DVAA 4XXAA 2WN2A 5FXZA 1K42A 3V56A 1NY72 5JR2A 4LORA 5FLHA 2VTXA 4Z07A 1YWKA 3M3OA 4QU1A 3SXWA 1QXPA 4C1WA 3IDEA 2YB7A 5EXOA 1G9DA 2PHXA 4Y26A 2ZACA 2HEVF 4L8QA 2OX0A 4YVSC 3PIGA 5FR3A 3HPNA 1Y3TA 4XQDA 5EQUA 3WUCA 3B9CA 3CIHA 2IXJA 2W87A 1ND3B 4G9SB 4R9DA 4UWDA 3TOJA 5C8WA 2QQNA 3HJRA 3GM8A 3I49A 1R092 2RS52 3UGFA 4HK8A 2B7YA 2D7FA 1UXZA 1PZ8A 2ERFA 3FL7A 4XJWA 1W6QB 2GC1A 4AQTA 1QH6A 3DYPA 4XMIA 4DMIA 2YGLA 4TZDA 1Q8VA 1H4HA 4AQ6A 2PFWA 5ANNA 1OI6A 4FPCA 3W9AA 2MPFA 3N9MA 2QQJA 1CAVB 3VKOA 2FBEA 3THCA 5FY8A 2ORZA 4HKWA 1D0HA 2BPA2 1AXKA 3IWZA 5GLVA 1PM7A 3BPSA 3KF5A 4Q0VA 1HB4A 4BQYA 1BZWA 2WYFA 3U07A 3MZHA 1H6YA 2DBNA 4JCKA 3AB0A 4ZKTB 2WNVC 3M3IA 5FREA 4QM9A 2HEWF 5JPNB 2WKKA 2HBUA 3JB4C 2NMNA 1A3KA 1GWMA 5C5UA 1UZYA 2Y0IA 1D4M3 4I0WB 1D2QA 3DPRA 1L3JA 1ZX5A 1C28A 1VBE1 5CBLA 2RJ2A 1LR5A 3AP7A 2Z5WA 3M4FA 4X6QB 1CR7A 2PLV3 4XHBA 3UESA 4AHXA 4AYUA 3NV1A 1M4WA 1Y9QA 4NWVA 5LEKA 4BDVB 2K46A 1F2NA 2D98A 1AF9A 1X7NA 1PVC1 2B39A 1NA1A 2E7QA 4Q4W2 5A7NA 5JWPA 3CF6E 2P37A 3MDPA 4CRQA 3KHCA 1S0GA 4IL7A 4L9BA 2WZR1 5CG8A 1VBC3 1RUJ2 1IG0A 1LHOA 4PDWC 1GLHA 4LBMA 3LA2A 4MO3M 4LE3A 3LA3A 3AP4A 1RUE2 1O4TA 3QCWA 1UOBA 1W8WA 2R041 3LPGA 2X05A 1KDKA 1YC61 2XBO1 2XONA 4NO4A 4UOJA 4YM0A 3S5QA 5IVVA 3RRDA 1WCKA 1YLLA 2OA2A 2VPVA 1PO22 3CU7A 3VDBA 5JZGB 4FPLA 3I2KA 3DN7A 2R7EB 3U75A 5CFDC 3NV2A 1SLTA 4YGBA 5FDBA 3LGRA 1NCRB 4MUVA 2NMOA 1TMF1 1EUUA 1BBT1 1HW5A 3UK9A 5JLVA 1W8UA 4XDOA 1MR5A 3T09A 1FPN2 4Q1PA 4BQ2A 4WVMB 3FFQA 5FLIA 2VOTA 2IZWA 2DFCA 4YVWC 3E5XA 2P2KA 5LA1A 4IEPA 4HONA 4LO7A 2PHWA 3LAGA 3OBTA 4XACA 3VHPA 4M4PA 4S2DA 3WUDA 2Q1FA 4A7YA 1LCLA 5I8TA 3H9AA 1SPPB 4CDXA 4AI3A 2WFF3 2ZA9A 3O0VA 2HKXA 1AR72 3T0BA 2ID4A 1L7QA 1SCRA 2JG8A 5I8SA 1YYNA 5C9AB 3THPA 4ZHNA 1SBDA 1OOPB 1BVP1 5BNPA 2PHFA 4UF0A 3ZSEA 3PMSA 1NKGA 1NCRC 4AZZA 1YIPA 4LHSA 2RM21 2QQVA 1HN1A 2XVKA 3GCWA 3QBQA 5FYZA 1XSRA 4COYA 1UPSA 2HYXA 1Y7BA 2V09A 5A3WA 1WZXA 3ZDSA 3ZN6A 5KXCA 5HCFA 4A7KA 2Q30A 5EV7A 1WWYA 2NQYA 2Y6FA 3WDWA 4Q8KA 5A7SA 1W6NA 3K75B 5FY1A 4XZPA 1ALYA 3B5LB 3ZXEA 1LOBA 3POYA 2QDNA 4XEZA 1N1TA 4AI9A 1RIRA 3I59A 4IEYA 1EAH1 2ZEZA 2WWJA 4LO8A 4QHBA 2NZ9A 4BMEA 1VAKA 3RZLA 2DCTA 4I3GA 2VY0A 1W9WA 3N36A 1XNCA 5FUNA 4WV8A 4RS5A 2D97A 1PK6A 3KCXA 4LLOA 5FP7A 3UKNA 4YW6A 3SCFA 2DVGA 2CGNA 2DTYA 1QJU2 3HT1A 1AYM3 3N7MA 2F6BA 1MQTB 1OC1A 4BE3A 1W8NA 2ZGLA 4GKYA 2P5BA 3M2MA 4JRAA 4QAWA 3ACGA 4QQLA 3VDDA 3H3LA 3NV4A 4UFMA 1W9SA 1QJX1 2J42A 3ZYJB 1NLQA 3CJIB 2P4EA 3DGTA 1H2KA 3WNKA 2OQ7A 4B4RA 4ARYA 2XJQA 1TME2 2WO2A 2ZAAA 1ZZBA 3JCIA 4DXZA 1HRV3 3T0DA 1RVF3 1FOD1 3W5MA 2WT0A 4XOGA 3WDUA 3KCYA 4LA3A 5GZDA 3JBG3 4AHWA 3IPVB 1TQ5A 4RHV3 1UD1A 3TN91 3WG4A 4MGTA 1RYYA 1W2UA 4YZ4A 2RMU2 4YG6A 3WNXA 4AEKA 2JJ6A 5K0UA 1OUSA 4F8AA 1HRI2 1CN1A 3PL0A 1LJ7A 2ZHNA 2JKXA 2VBDA 2VNOA 1CVNA 3OBZA 5EP9A 3HQXA 5A7WA 5JCTA 4AVAA 1BEV1 5J3UA 2I07B 4F7ZA 3JD72 4PI2A 3H50A 1UY1A 4EN8B 2PAEA 3NKTA 1ST8A 4E8CA 1W03A 1W2OA 2YV8A 4RQPB 5C3RA 4CU9A 2OZJA 4W6WA 1POV0 4G3YC 1T6BX 1FMD2 4D0QA 3LOBA 4OHWA 1GZ9A 4ARXA 4C91A 2YZ4A 1ZBE2 1W0OA 3W59A 4HKOA 4Q5OA 2TEPA 4XFFA 4BK5A 4DY5A 4XF1A 3SEEA 1JI6A 4E4HA 1MZ5A 2GALA 2IFRA 3VD4A 4ZY9A 3ENRA 4PHZA 1RMU1 2OPWA 4MXWA 1IHMA 4SBVA 4XAEA 4XFBA 4AE2A 3B7MA 2GC2A 1H8TB 4Z1VA 2RS53 3AKTA 3S30A 5A3UA 5TSWA 4AHZA 2R32A 4Y1XA 1XNDA 3ZN5A 3J8F2 3D8CA 3GJAA 3OD4A 4QGMA 5FZGA 3WHUA 2J1UA 2VCMA 2BGOA 5DZFA 3G6JB 4BHPA 3A22A 3WG1A 1VB2A 3VBFA 4QQ2A 5BV6A 1W6PB 2EAKA 3FUQA 2LS6A 4CCCA 2C5DA 1F4AA 1NZCA 3OG2A 3ZX7A 2TNFA 3O0WA 5C70A 1G9BA 2RR11 5FP9A 2ZX4A 4Y4RA 3WNNA 1POV3 3C2UA 4WM8A 3O1VA 2DTWA 1WA6X 3IZOA 4PF5A 1OF4A 2XJVA 4A44A 2XB6C 2ZX3A 3N7LA 3ZXGA 2AEZA 3AZXA 4HPKB 4LIUA 2W68A 5I91A 4YW3A 3ATGA 1ULFA 1TVGA 3ORJA 3NNGA 4YW1A 5L19A 1PGSA 3USSA 1JZ5A 4Q4V3 2X53S 4CVUA 4BOWA 1CAUB 3POEA 5LY1A 2E9QA 2WA3A 4E2GA 4KNCA 3ZIXA 3QACA 1W0NA 4HKLA 3ZFGC 3GNEA 1WBFA 5DAXA 1HLCA 2RS12 1K5MC 1O8PA 2BEOA 2ES3A 2QQIA 1OA3A 2HLEA 1OMIA 5DN2A 4X8PA 1TNRA 2NN8A 2WLPA 3IIIA 4QQHA 4CDUB 3SH3A 1U5IA 2A6ZA 2VNVA 1LOFA 1O5UA 2DUOA 2XDVA 4WM7C 5JI9A 1D4M1 1DQ2A 3OOXA 4PBOA 4IE6A 1Q5OA 4LK6A 5EWSA 5ABJC 4FI9A 3ACIA 1AJKA 4NIIA 3RMYA 4PT6A 3KWVA 3HN1A 1NYWA 2PLV1 3POGA 1CWPA 1UZVA 3T2TA 1X8EA 1HDKA 4UYBA 4BLIA 3OBAA 1GSLA 4HANA 1PIV2 1FATA 4PQQA 2ZGSA 3D3AA 3RPQA 1LGBA 1VBC1 1LU1A 1OURA 1W8ZA 1UQXA 4IV3C 5HI0A 3KS7A 4FOWA 1QY4A 4TLFA 2VXJA 5IUQA 2ARBA 2XWJB 1T2XA 1VMFA 1X50A 1KJRA 3NJZA 2WT2A 3UJOA 1JYTA 3GZTB 3I8TA 1H2MA 1UY2A 3WQ1A 3PVNA 1RTVA 4RYDA 4UXAA 5CB7A 5FYUA 1LGCA 3ZSJA 4MG2A 2E26A 1WMXA 5CG9A 1UYPA 3UNPA 2ZHLA 5A3MA 1V0AA 3MIHA 3POWA 4XFHA 5GJ6A 2WDBA 5GZCA 3WDTA 3E1F1 4CDQB 1OLMA 4P14A 4LO4B 4XUNA 5J36A 3ZDVA 1Z0HA 4QB2A 4JDNA 4CCOA 4H7LA 1VJ2A 4KI5M 1LKNA 1VBB1 4NJ4A 4KMQA 4UFHA 2JB8A 4EE2A 1OFNA 5L7OB 3ELNA 3MIGA 2ZABA 4OMCA 2R063 3KT4A 5E1RA 3VLBB 3NAPC 3K4DA 3GHMA 4C90A 2E6VA 4JAAA 4OUMA 3UV9A 4JGYB 4CP1A 2B9VA 1AYN2 1C8M3 2WFF1 3OY8B 3KV6A 3UKTA 5D8AB 4P9XA 5BXXA 5GALA 2Y33A 1W6MA 5IJRA 1XYPA 3LWCA 3WR0A 2IXKA 4DZGA 2VZ3A 5HXVA 4QPGA 3S0MA 4Z92B 4XYXA 2XQXA 5FUPA 2E53A 4HG6B 2YC0A 3T08A 1MZEA 4IE5A 1QQP1 4MGIE 4QX7A 4L97A 3L2YA 2NYYA 1H8VA 2JX9A 5C8CC 4H3WA 3DXTA 4NAOA 1O6UA 3PVEA 1YCIA 3CO2A 1CPNA 3RQ0A 3HOBA 4AWDA 2ZKLA 2O8OA 4PF1A 4LNVA 1JBCA 1TME3 1MS8A 2WWSA 4N7UA 4COUA 3V65A 1VPHA 3QH7A 5FZDA 1MS5A 3M7AA 4H55A 1YJKA 4D6SA 1BQPA 3D4KA 3BTAA 3MIFA 3VZNA 2VC9A 4P00B 2DUQA 1RJ7A 2EIBA 2W0XA 2VMFA 1TG7A 4ISQA 3K48A 3CLPA 1HJFA 2Q8DA 2GU9A 1QEXA 1AYM1 1AZDA 1VB4A 2BERA 2VL4A 5FPZA 5EFUA 4BWOA 3MIBA 2J22A 2A6XA 3LD8A 1LB2A 1NXMA 2VZ1A 3J7NA 2RMU3 2NPIA 3U37A 5F6KA 1XE7A 2JDMA 3Q8AA 1HRI3 3NQHA 4UW3A 4PI0A 3AP6A 3PTYA 5E88A 4EN0A 2WNOA 3Q8FA 4E2SA 2AGSA 2R072 3MIEA 2R16A 1QH7A 4JQTA 4PJYA 4QPIC 2VZSA 2VCAA 4IEWA 1COV2 4HXCA 1RVF1 2EIEA 3L9JT 4MLOA 3P5BA 2FZ2A 2GH2A 2HBTA 3VBUB 1SBEA 4AEDB 1VMJA 1FMD3 4A3ZA 3GBFA 1YQ8A 3JBG1 1YQ2A 5C3QA 1VRBA 2WR9A 1SDDB 4NPMA 3AKPA 4W6XA 1NOVA 3UT0A 3E97A 4CYDA 3FBMA 3J4UH 5D1IA 1IKQA 2V72A 4Y5SA 3I4IA 2VGDA 4DNYA 4FOVA 4JGZC 5EHDA 5CFCC 2J1VA 2CU5A 5LZ6A 4AG4A 1KQRA 5HV0A 5FOBB 4GIQA 2WLQA 4BIOA 1UY3A 3U1XA 5BNOA 2VQAA 1JZ7A 1ULOA 4AEMA 5IVCA 3KMHA 1JS9A 4XFAA 3MF9A 4DRRA 3IM0A 1QHDA 1VBA3 4WVZA 4U2AA 3DYOA 3V0BA 1WD4A 5CISA 1ZREA 1NLRA 2WBKA 2XHKA 4UW5A 4XC9A 3IBMA 3AL5A 1AL22 2D5HA 5EIYB 4QWNA 3PJQA 4Y1UA 4AFDA 3NWKA 1REDA 3WQBA 4OQ8A 3ILNA 3ZXLA 4H7MA 2AZ5A 4QGNA 2Y64A 2J1EA 3H7JA 1YIFA 5FZFA 5FMCA 2X09A 4OHZA 5KBFA 5FYMA 1YJLA 4KWUA 2D43A 4NN0A 1U5XA 1BMV1 3K3OA 3WDXA 3BODA 1E57A 1S1AA 2XKOA 3CL1A 4Z2WA 4Z82A 5A6YA 3R05A 2FDFA 1KGYA 1KS4A 1UZWA 5A1FA 1RUC3 3FC0A 4IEXA 2ZS6B 5J7MA 4L2NA 4OI2A 1JYCA 5LBBA 4CPBA 1QNYA 5EYXA 3DPRB 3KGZA 1MEC3 1SHWB 1OA4A 2W92A 3NNFA 5FYHA 3V0AA 1LAJA 1R1A1 3DECA 5JVVA 4AVSA 3U11A 4DOUA 1POV1 2D6OX 4HVRA 2WJSA 2AH2A 4KQ7A 4Q1RA 4RR3A 1AR62 3ZO0B 2DCJA 1JOPA 4FCAA 3EQEA 3WQ0A 3INAA 2VUJA 4M3CA 1AX2A 3UETA 2HWE1 2RE9A 4PLOA 1W6OA 1NA1B 3RZMA 1S55A 2HEYF 1WW4A 2OS2A 4GMP1 3VBSC 1XQNA 2BOJA 1ZRIA 2GC0A 4R9AA 5I0SA 1SZBA 4YM3A 3NJYA 4JQRA 2P1BA 4OCTA 1QDCA 1TNFA 4Q4V1 4Q4X2 3EB7A 2WINB 5APAA 3A21A 1CESA 4BIFA 3H8OA 2OUHA 5FY4A 3I2OA 3FZ3A 2BUKA 3LIHA 5HBAA 4Y1YA 1JTZX 1EPWA 5JDBA 3APBA 2ZEXA 3OEAA 1GICA 4IEOA 2Z2SB 4N53C 3KF3A 1VBD1 2KA3A 3KV9A 3ZFEA 3BIWE 2VZQA 4FPOB 1UOFA 2QZ3A 2R30A 2YYOA 3AMNA 4Q0QA 2A3WA 3THTA 4HL0A 2ADDA 5J98B 4LHKA 1O4YA 3K51A 2VMIA 3VBRA 5FBZA 1A78A 3VDCA 2QDRA 4OMDA 4K8RB 4LULA 5GZFA 3VKLA 1KEXA 1K12A 3TB0A 4JC1A 4CCJA 2XXZA 1UWWA 3MFCA 3WDYA 2A3YA 3WEZA 4BPZA 4CDXB 4CA9A 1U0AA 3USUA 1QDOA 5A80A 5ACA3 3JQXA 1Q8SA 1AR91 5C8CA 2JG8B 4YGCA 5IVJA 5C4WB 2IFWA 1R082 1RUG2 4BQWA 2P6HA 3T2QA 2HWD3 5FPVA 3KB5A 5BNPB 5JSOA 4UF0B 1H0BA 4Y20A 5CA6A 2A5ZA 2O14A 4IXLA 3ZMOA 5CAZA 4Y3OA 3BIEA 1RUH2 3AK0A 4G4FA 1RUD2 4MGYE 5FTTC 3ROUA 2H6CA 3TNQA 3ZN6B 2OVUA 3IDCB 3C7OA 3VBHA 4OUEA 2IXHA 2ARCA 1AYN3 4LR4A 1MVEA 1NZIA 4META 3M1HA 1XB9A 1W6NB 5L9RA 1XOYA 4EZ4A 2XLFA 4L11A 1HQWA 5T5LA 1Q56A 4EN6B 2Q8CA 1NAEA 4Y22A 2VMCA 1OUXA 1PGW1 1UO9A 3BKZA 1OXCA 3HD8B 2BWCA 4FFHA 5HV4A 1B35C 3UGHA 1MZFA 4CPBD 5FYTA 3WNPA 1OBNA 4RS5B 3BOPA 5C4WC 2AREA 1H1IA 2YFUA 3P6BA 3W5NA 2HWC2 2R061 1F5JA 2X5IB 3DYMA 1J1TA 3FX3A 1AXYA 2PHUA 4EYUA 1RUI2 1URXA 2ZX0A 3HMYA 3OCPA 1C8M1 2PQSA 4NE9A 4CP2A 2VUDA 3VDDB 2AC1A 3LA7A 5LK7B 1ND2C 1ONAA 1M06G 3AZZA 1YFUA 1F15A 3V64A 2BBAA 4C0BA 4CUGA 1RUF2 4MVTA 3E6CC 1RXGA 4UW4A 3RVHA 2RS33 2C0ZA 3ZPYA 1Z7S1 1HV1A 4QX0A 1SFYA 4CP9A 3TEWA 3A7QA 4TYSA 1ZBA3 3L2HA 3MUZ1 5FZLA 4FXKB 4A6SA 1UMHA 5IK7A 3SMHA 4JKKA 4XUTA 2FMDA 3OGGA 5FJHA 2WRAA 2BFUL 3WXPA 5K0UB 1JOBA 1OSGA 1XXNA 2X5IC 4K1ZA 2BW8A 2Q8EA 3EJKA 3WLUA 5A7WB 5FO7B 5GLWA 3FBYA 4FPKA 2BFUS 5FYSA 4ZS3A 1COV3 1BKZA 4LXLA 5E6HA 2X10A 4GH4C 3AXDA 1UY4A 2DVDA 1PO13 2XLAA 1OQDA 4IEUA 3AVRA 1MS4A 1V6MA 1N3QA 3KM5A 4UI9L 5DUWA 2JIJA 3O12A 5JPMB 1YFYA 3I97A 2ARAA 2Y0OA 1FNYA 3MUY1 2DBIA 4ITCA 4M3CF 1OF3A 4PLMA 3M3QA 1WCQA 4NRQA 5FZEA 2WNUA 1UIJA 4Q29A 3TBDA 5JXIA 3N4MA 4Q4Y2 2JE9A 5BNNA 2W46A 4TSVA 1CX4A 2FD8A 1N3PA 3ILRA 1V6OA 4MXWB 4OFGA 5A1LA 3RYPA 1OQ1A 2AUYA 1ASJ3 5K7PA 4UFJA 3SNMA 1KFXL 1JMUB 1ND3C 4IGPA 5LBEA 2FQPA 4INDA 4UAPA 4AVTA 2C24A 4XURA 1YI7A 2W47A 3IMNA 1YXWA 1US2A 2W08A 4RFT0 3VN4A 3J7LA 2BGPA 4MXVA 5A6XA 1W3VA 3VBFB 4OI1A 4BLJA 3MLLA 3ZXAC 2WQ4A 1RB8G 4FP3A 1XNKA 1JZ8A 1G9AA 5DUXA 2PAKA 2RDSA 4WM8B 2ZX1A 4GB32 4AR2A 3ZYPA 1APNA 3AYCA 2XH6A 3AVSA 3J7MA 4QKDA 1T6GC 1DYPA 2HYKA 3NMBA 1VBA1 2O1QA 1NE6A 4WZFA 3M3EA 4BQXA 4XFGA 2R1BA 4LBKA 2BV4A 5CNAA 2RJKA 4BQ4A 4M0NA 4R9BA 4LOTA 5DDJ2 3T3YA 3I2JA 2D6KA 3MW4A 4BQ5A 3ZYGA 4QQPA 5AVAA 1GOGA 4FPHA 2DU1A 3MV01 4P9YA 2PMWB 1DQ6A 3BYWA 1UL9A 3QD6A 1IQAA 4P08A 1AHSA 1SBFA 2IVJA 3F2ZA 2K0GA 5IVYA 1CGPA 4RFRB 5JAXA 1IS4A 1JUHA 5BUVA 3EXUA 1J83A 4F83A 4CE8A 4N43A 4E2QA 4QT6A 3CZUA 4CEWA 5BY5A 5EJ1B 3TNPB 2YBPA 1S4CA 5JUVA 2JG9A 3LOIA 4NWWA 4BMBA 3O1UA 1JN2P 3N9OA 1NQJA 1O4ZA 5BPXA 2QBXA 3C7FA 2JDNA 4QD2A 5CKMA 1RUC1 1O5LA 2DURA 3AP5A 1S0CA 2VCCA 5GKAC 3ZYHA 4DXTA 2MEV2 4XIKA 5FP8A 1AJOA 1JU3A 3I2IA 5F3CA 1EV12 2VOVA 1US3A 4CDWA 4Q4X3 4LO6B 2HWF2 2I2SA 3D0JA 1CAWB 5IWFA 2JDYA 1MEC1 5JXGA 3O1RA 4AGVA 2VM9A 4IV1A 2VG9A 1NCQA 4I02A 1V9U1 4NAMA 4YFZA 2GN3A 2XVLA 4CEYB 2VMEA 1DYKA 2EF6A 1PNFA 1GQPA 1NLSA 3E5UA 1JYVA 1WCSA 4AI1A 2XJPA 1HXS3 3CJXA 3O0XA 3PVOA 2VZUA 4GA9A 3FE5A 4R8HA 2WQZC 4IE4A 2HWB2 3Q8BA 4JHTA 4YM1A 3VZLA 1AR83 3POSA 4AQ2A 5JZGC 1XPWA 3GYDA 4YFWA 2XGXA 4KU8A 4V1PA 1E5HA 1WCUA 4SLIA 3KHBA 1IKPA 2R1DA 3HWJA 1I3HA 4ZPIA 2ARXA 1H2NA 1QJY3 3ETPA 4GAZA 1ODNA 4R4ZA 4YW2A 5AC91 1J3PA 4GJZA 1PZ9A 5JOXA 1CZSA 3WOGA 1ULDA 1W39A 3ZFFA 2WO7A 3UGGA 2QTWB 3DKWA 5J48A 1ZRRA 3PLQA 4UFLA 2WZ8A 4QQOA 4MX3A 1A8DA 4BH9A 1PZ7A 5I8YA 4D8MA 4CEYC 1F31A 4IE7A 1VR3A 2PHRA 1SLLA 4XUPA 1DQ0A 5FZ3A 1S0DA 1ENSA 2SLIA 3OUIA 5CYYA 3VZJA 5C9AC 4QKBA 1GBGA 1W8FA 1ZA7A 1OOPC 5F3EA 4DXRA 5FXWA 4CCDA 1RUH3 1RUD3 5IK5A 1RHI3 3I2GA 3MHZA 3VBOB 2WS92 1J84A 2DF7A 4MGSA 1KXGA 4ZXEA 3ZKYA 5IATA 2OXBA 3WHTA 1O8SA 4NUBA 2O8QA 4ZS2A 5ACA1 1Y4WA 3GGLA 4F3JA 4XDPA 2JD4A 2OPKA 3POFA 1GU3A 3KV5A 2YBKA 1VRH2 2GMPA 1V70A 4N9HA 1DLLA 1F5FA 1W6MB 3RSJA 2HWD1 1DGWA 3ACHA 4QPGB 1S2KA 3B9IA 1BHGA 2E7AA 1JYIA 4YVSA 1P8JA 1XU2A 1UX6A 2WWUA 3FFZA 3H8RA 5KHHA 5DAWA 1OPMA 4MHRA 3SC7X 4LJHA 2CYFA 4ET7A 5SV5A 1RUI3 4MADA 5JXHA 2JB4A 1IQDC 1WUVA 2PQQA 2FDIA 3NNLA 2A6VA 3DEMA 4J1WA 4O9GA 2C4XA 5EJ3A 1MQTC 3ZM8A 3VBOC 1QXRA 3I3EA 3HBZA 2OQ6A 3BTXA 4AXOA 5FY5A 2QVSB 3FN9A 2VZTA 5T3NA 2P17A 4A41A 3MGUA 1O3QA 1IPKA 2A71A 4K20A 1IS3A 2WO1A 1SCSA 3CJIC 4K40A 5C5TA 2EVXA 4BQ1A 5HPOA 5FZ0A 4E27A 3WY6A 4YZ2A 2OKXA 1JU4A 1VAVA 4YZ5A 4K9SA 4UBGA 1OPOA 5H9PA 3WW4A 4C1XA 5BYNA 4FTBA 2EA7A 2DYCA 1SG3A 2WNVA 4IW3A 5FKCA 3VDAA 4FBFA 5A32A 5HXMA 1OKQA 1C1LA 4YSFA 5EPAA 4I01A 4A4AA 4FPGA 4LK7A 3B94A 2YC4A 2QUOA 1R093 2RS31 5LY2A 3ZKUA 3VZMA 4FQZA 1QOOA 2VH9A 1ZBA1 1DHKB 4B7EA 5FO9B 3SEPA 4P9JA 1ULCA 1OT5A 5A6ZA 3AXEA 1VBE2 4RQPC 5LRSA 3A0NA 2E31A 1CX1A 1GP4A 3FMGA 1DP0A 4XBNA 3BCWA 1GZTA 3WP5A 5KHGA 4B4PA 3S57A 2ZZJA 5FK8A 3N3HA 4D6RA 4B7KA 3VKMA 4PDWA 4H2AA 4KGQA 4NRMA 2ZJCA 3OBRA 1DZQA 4Q4Y3 1G86A 3MF6A 1PVC2 4W65A 3I54A 1U5YA 5A7QA 1PX3A 4GKXA 5BNOB 3PHMA 2WZR2 3RI9A 1FI2A 3D6EA 3KSCA 4M4RA 2CAUA 1PO11 5LA2A 4FPFA 1GQGA 2ZBJA 4JX0A 2GC3A 4HVOA 3V0BB 3A0KA 2XL9A 1H8TC 4S2FA 1WD3A 4XETA 1ZZCA 2RDNA 1OLQA 2YUEA 5CFDA 5IFTA 2GNTA 3OUJA 2R042 3DXUA 1GWKA 4A6OA 1C57A 4XJZA 5CVRA 3WF2A 5A3TA 2XBO2 5A33A 4YW4A 1C5IA 1DQ1A 1EP0A 1HB2A 3VD5A 1ENRA 1O59A 2P3YA 1ENXA 1FT9A 4NIAA 1MS3A 1UX7A 2PELA 4Q4W3 3OB8A 3WDVA 4LUKA 2VZRA 3ZYBA 4YVWA 3NJVA 5JOZA 2VVEA 2ZTNA 4ONUA 1GANA 2FZ1A 4KH9A 1DYOA 3SLIA 4B3NA 2IUWA 1TMF2 2XOMA 1BBT2 1ASJ1 2LALA 2Z69A 3LDKA 1RUJ3 4OLLA 2ZX2A 4RL7A 4QPWA 3SITA 4BISA 2WIIB 3OPZA 5FZ6A 5FPXA 4E4ZA 4FP2A 2JENA 1JZ6A 2GH8A 5B2GB 1RUE3 3S5AA 2XQRA 4NMIA 4MHUA 5FYIA 1LHNA 3MYXA 3ZSMA 3BTYA 5LEJA 2QFEA 4S2GA 1HB3A 3RS6A 1GZWA 3AM2A 4FOQA 3JQWA 1JOJA 2R0HA 4QKNA 5IFPA 3HQUA 1PO23 3V0AB 3WNOA 4JKLA 4EJRA 2LRPA 5T50A 4ES8A 1F8VA 1NCRA 3ZSKA 5KXDA 3AKQA 2W1QA 4RR3B 4LKSA 1OD3A 3SH4A 4CCMA 2FDJA 2RG4A 3AZVA 4XUQA 2BQPA 2XUEA 1AXZA 3R4DB 4M3CB 2Y6KA 4E4DX 1O3TA 2VMHA 3ZXDA 3WQ7A 1W6OB 1FPN3 1OVPA 2LUWA 1I5PA 1HKDA 2VULA 3PUIA 4EROA 2F4PA 2QQPA 2VE1A 2MEV3 5KC5A 1PVXA 1PMJX 2ZGTA 4DFSA 2RM22 1EV13 3FHQA 2YXSA 1UOGA 2HWF3 3HN3A 1N1SA 4S2HA 4CDUC 1JZ4A 3LDBA 4TTGA 4Y1ZA 1W2AX 5DG1A 4D7YA 1PGL1 2XPJA 4OUSA 1XC6A 5A3PA 1D7PM 2EXJA 2QQMA 4CUAA 5C9AA 1AR73 2GSYA 3LIGA 4W6YA 1C1FA 3AZWA 3HT2A 1W04A 1HX6A 2ZKNA 3QH6A 1O91A 2VECA 4N7IA 4UFIA 1BYHA 1EAH2 4FT8A 2VNRA 5J37A 2F17A 1IZ3A 3ZFEB 1W9TA 3OPWA 1V6IA 5FPBA 4NROA 1AUYA 2ADEA 2Z42A 3I7DA 3BI3A 4KU7A 4NHYA
chains in the Genus database with same CATH topology
5JIAA 1JHNA 3VBRB 1OHFA 3W58A 1H4GA 4MSVA 4DQAA 1OFSA 4FSJA 4M00A 3ZYIB 4JDMA 4BZ4A 4ASMB 4PIZA 1QJX2 1JH5A 4JTOA 1LEMA 1HXS1 4LTAA 3RJ2X 1I1EA 1EPZA 3USUB 4JDOA 2DWRA 1AR81 2DVFA 2PHTA 3ST7A 2ZGKA 1SQ4A 1J1LA 1FOD2 5H9RA 4CDQC 2VOWA 3RNSA 4Y20B 4LBOA 5AVPA 1QJU3 1MS1A 5SV8A 1QJY1 1BXHA 4I30A 3TN92 2WS93 1OLRA 4XBLA 4NHLA 2ZMKA 3H1YA 3JU9A 1UU4A 4GQ7A 5L7OC 1ULGA 3O7OA 3H0OA 4EN9B 1BEV2 4FOYA 1DZTA 4QU2A 4JGYC 5KHKA 4Y22B 4LHLA 5D8AC 2YHJA 2Q1ZB 3CNAA 4D7SA 1RHI1 1HQLA 1C8NA 2GNBA 1LECA 2D5FA 2ZGQA 2MNGA 4I2OA 3SH5A 4I09A 1Q8PA 3AMPA 4A2UA 4XJ8A 2IXCA 1GV9A 2BTVC 1YFXA 4YZ3A 1LOEA 1RMU2 1WLWA 3R0RA 3JD73 1HRV1 4Q0UA 3OYWA 3WCRA 2YY1A 2GMEA 2CGPA 4EWAA 1ZZ7A 4GXLA 4K21A 4XF3A 2XUMA 4Q8LA 1RGSA 1ZBE3 4RHV1 4YARA 4FVVA 4BYYA 1KFUL 3ES1A 2DVBA 2RR12 2PA7A 3R6SA 3RYKA 3HR9A 2ZZQA 1G7YA 2VW2A 2GNDA 3MW3A 4M0HA 3J8F3 3AKSA 3FLTA 3ZFGA 1NY71 3ES4A 3H8UA 4XTPA 1RC6A 1WLDA 1K5MA 2CGOA 4HN0A 1QF3A 4AHYA 3VBUC 1S0EA 4AEDC 4ZXKA 4LA2A 5GLUA 1H1MA 5T5PA 3B93A 3ME2A 2EALA 1DGRN 1SEFA 4WM7A 4AFAA 2TUNA 2WNUB 1Q43A 5ABJA 5BNNB 4BA6A 1H30A 2WZR3 1R091 2A7AA 2RS51 4AGGA 2DCYA 1G9FA 2XLGA 1ZZ6A 3VKNA 1D4M2 1CD3G 3BOWA 4PQ9A 4QX5A 2B8MA 1Y43B 2XBO3 3WG3A 2D3PA 1UIKA 2PLV2 4IV3A 3D0SA 2D6LX 4ATFA 2XG3A 2ET7A 2RS13 1CONA 2EXHA 3WX5A 2GDFA 1TMF3 1OD5A 2WT1A 2XJRA 1VBC2 4UW6A 4FAGA 3ZN4A 3FLRA 3HIFA 1QWRA 1D0GA 2VNGA 4XHXA 4YW5A 1R1ZA 3WV6A 4LE4A 5F1RA 2YDEA 5IK8A 3M70A 2ZHKA 3D5OA 5FQ0A 1ZRCA 2G9FA 3FJSA 4RA0A 3DPRC 4Q4W1 4AF9A 4N43B 1KD7A 2PYTA 1PIV3 4CEWB 1RUJ1 3NAPA 4ZU5A 2JG9B 2I74A 1VBB2 5FMOS 2D3SA 2WSUA 1NA1C 1RUE1 2GN7A 3BPZA 5KXBA 1S0IA 2QJVA 1DGLA 1FX5A 2ZMLA 4CDWB 1DQ5A 3H3UA 1PO21 3AJZA 1LOAA 3LCPA 1NCQB 4IV1B 1DZRA 4P9IA 2WFF2 2ZGRA 4MH0E 4FAHA 2B42B 1D4VB 2KM2A 3KD4A 3NL1A 1ZZ8A 1WA4A 1PMIA 2WFPA 1FPN1 4P9LA 5T5JA 3RMXA 2A3XA 3LSDA 4WVVA 1QQP2 2DCZA 3AMHA 4ES9A 1GQHA 5JI7A 4D69A 4Y4YA 4HBNA 1UCXA 5FRAA 4M3CE 2I45A 3J9SA 5F9TA 1RUNA 1QJX3 3ZFFB 3A4UA 1AR71 3URFA 3SCGA 2D93A 2BNMA 1FXZA 4HETA 5F5QA 4AFCA 2RHPA 2H0VA 3B00A 1H1AA 4KG8A 3E5QA 3OJBA 3I59B 4CDXC 4Q0SA 4P9WA 4RSUA 5AFBA 4XE9A 2Y38A 3TYJA 2JG8C 3GZUC 3VZOA 2QZ2A 4ASLA 1WLCA 1PK6B 3LB9A 1AYM2 3MPBA 5BNPC 4QPIA 3I2DA 1UMZA 4FPYA 2XWBB 3IT8A 5L73A 3VGIA 4HT1T 4ATEA 1BEV3 1GFF2 2AR6A 3UKVA 3KGLA 3WZ1A 1G9CA 4XFIA 4AFMA 1RVF2 3S7EA 4MGZE 5C33A 4JGZA 4AK3A 5CFCA 4FXGB 1QJU1 2ILMA 3JBG2 3VHRA 4AI2A 4YVSB 1LENA 1GNHA 1N1VA 1LTEA 1SMVA 1U5ZA 1WMDA 1IS5A 1AX0A 1PK6C 2A6YA 4RS5C 4LBJA 5H9SA 2A70A 3LZZA 3RI8A 4AGRA 2VW1A 4D3WA 3PJYA 4HK9A 1ZYBA 4MYEA 2R073 1TME1 5EYYA 4GALA 4C0HA 3VDDC 2QCSB 4XIOA 1WMFA 1V00A 5JSRA 1J3QA 2A6WA 3PNAA 4LHNA 1A6CA 2Q5TA 2ZPXA 1UKGA 2RMU1 3NV3A 3VL9A 1HRI1 2UWBA 2RR13 2VQ0A 4OI4A 2WNVB 5IK4A 2GMMA 4K1YA 2BWAA 5HCBA 5A32B 3JD71 1PHMA 1BMV2 5JMCA 2MHFA 5K0UC 1PNGA 3AMQA 1IS6A 4KWLA 3ZXKA 1S2BA 3ZYRA 4R4XA 2IC1A 1AL23 1FMD1 3KLSA 4LEJA 1BVVA 4IESA 1ZBE1 1WMEA 1FV3A 2VXRA 4X8NA 2XJTA 2IWGB 1R1A2 3GHNA 1DGWX 2D6PA 5DUUA 3VBSA 5JSPA 4I0BA 4HFSA 4PDWB 1SLBA 4UBHA 1RUOA 2ZGPA 1ZZ9A 2HWE2 2PHLA 4MV2A 2CTVA 2DV9A 1LEDA 3J8F1 4OZXA 1HV0A 2P3JA 4KL1A 3WP4A 3NO8A 4Q26A 4N53A 4Q4V2 1WW7A 3WW2A 5CFDB 4KG0A 3SISA 5K8SA 2VOKA 3M3CA 4A7ZA 2NLRA 3LSEA 5A33B 5T55A 1AR63 2VU9A 3VBFC 3WG2A 1VBD2 2RJLA 4YVWB 4HSJA 1QGLA 4OI0A 4PLNA 2D6NA 3RJRA 4GWMA 2UYAA 4WM8C 1Z78A 3B02A 3LKJA 1BK1A 5FFOC 3ACLA 1AL0G 4XPVA 4FO9A 2WNEA 4OHXA 1DG6A 1DBNA 4HMZA 4K3UA 1GZWB 2VOXA 2DFBA 1YI9A 4XMAA 3RZZA 2RS11 5JIUA 1AR92 1SFNA 1WBLA 3VZKA 4DRVA 1VIWB 2H6BA 4E9KA 1SDWA 1AX1A 3AFGA 5A3LA 1QOSA 1VBB3 1UAIA 3AP9A 5CADA 2E63A 1DF0A 4AQSA 2SBAA 2D3RA 2ZMNA 4B4QA 4Q27A 4GULA 4BCUA 1LOFC 2YPJA 4G4FA 3BB6A 5BNQA 1MACA 2DUPA 5J09A 3MIDA 1B35A 4LBQA 2R0FA 1ZRFA 1O3RA 1JXNA 3C3VA 5C4WA 3Q9OA 1PIV1 4WZCA 1C4RA 1PGW2 4DINB 1R083 1RUG3 3H1WA 1I6XA 1X36A 3IIAA 3FLPA 1H9WA 1QQP3 3FUOA 4QXKA 4YGDA 2E51A 2BYVE 4YG0A 1ND2A 1DQ4A 4EN7B 2CAVA 2R062 3HAGA 3NSTA 1XYNA 2ATFA 3N35A 1MZ6A 2QNKA 1SACA 4XF9A 2BVVA 1OA2A 1Q8QA 1IOAA 1C8M2 1OQEA 2BNOA 2V5YA 1JW6A 1CAXA 2D44A 4B8EA 5L36A 1SLCA 4COWA 1RJ8A 4HLTA 4JRLA 3GBGA 1LU2A 1Z7S2 3JB8A 2PTMA 1VALA 4JTNA 4MZUA 4DY3A 2X5IA 4XXPA 5LRRA 2HWC3 1H9PA 2CWSA 3GZAA 5T52A 1WGPA 2BNNA 2CY6A 4QPYA 4NVPA 4GH4A 1AYN1 2G4IA 2VMGA 3NVCA 3PVBB 4IETA 1LHUA 1J59A 4NPRA 1MS9A 4OULA 3AYAA 4E4SA 4HN1A 1RUF3 1QJZA 1XRUA 3ZMNA 4A3XA 3DV8A 2TBVA 4YG3A 5DZGA 3ZSLA 2XL7A 2EXIA 1SLAA 5I0RA 1YHFA 2ZOEB 5C6CA 2JEMA 2P3IA 4QPGC 4XBQA 1O3SA 2C9AA 3O5SA 3GF6A 5T54A 5GZEA 3AYEA 1X82A 1G8WA 4D7TA 1YFWA 4M01A 1ND3A 2OZ6A 4PIYA 2VVDA 3ZVXA 1FV2A 5KWRA 4LO5B 4PCRA 3CEWA 3VKFC 5LK5A 1GKBA 2Q1MA 1W6QA 1DIWA 3OYWB 2ZCWA 4JVAA 3ZXFA 1U12A 2AYHA 3JZVA 2CV6A 4IEZA 1CAVA 2OUJA 2O0OA 3IDBB 4LBQD 4XDQA 4GMP0 4AVBA 3IN9A 1QU0A 2R071 3BALA 3MI8A 1A8MA 5FO8B 3H1MA 2OIIA 1COV1 1LHVA 1WCDJ 2HJIA 4RGAA 2FHRA 1VBA2 1ZA4A 3EBRA 5E8AA 3E6BA 4DS0A 5F6LB 3MLJA 3WT3A 3TWIA 3ZFGB 4L99A 3VUOA 5GM0A 3MW2A 3B3QE 2PHDA 1K5MB 3ETQA 4COVA 3AMMA 1R1A3 2UWCA 2UY9A 5E16A 2JECA 1UU6A 3OTFA 4GB33 2ZGOA 4WM7B 2HWE3 4CTEA 4KBBA 3AZYA 4FPJA 1IGOA 4AEJA 5ABJB 2BGCA 3OF1A 4GMP3 2K9ZA 1H2LA 1RUC2 5DDJ3 1AL21 1SLIA 5GZGA 1YRZA 2OYZA 5BNOC 4KWKA 3J26N 3WCSA 1GYKA 4I3PA 1MEC2 3AFKA 1LODA 5JZGA 1V9U2 4ZU4A 1WW6A 4J1XA 1REEA 1QXJA 4IV3B 4XJAA 1UF2C 2BVBA 3TAYA 1X8MA 1VBD3 4U36A 5GLTA 4URTA 2WSVA 2ET1A 1DFQA 3OGJA 4P5HA 2UWAA 2XJUA 4WVMA 4LT5A 4XF4A 2A75A 2GNMA 4HZFA 3KCCA 1ZM1A 4NHMA 2XVGA 3N7KA 2KXLA 1CAWA 1CIWA 2EIGA 4FQ4A 5I0TA 5AC92 4CEYA 1KS5A 1RL3A 1C3HA 2NM1A 2VVFA 5FQ0B 1LRHA 1AR61 4HVQA 1OOPA 1AR93 1I9RA 3FWEA 2HWB3 3JUUA 2ZGNA 1VAMA 4RR3C 3NAPB 3EHKA 2H0BA 4ISRA 3VHOA 1CPMA 1YUDA 2FMYA 4Q4X1 3UL2A 4N9IA 3ASIA 1QKQA 3FHIB 2VW0A 2R6QA 2JDZA 1J3RA 2ZGMA 2R49A 3D82A 5ACA2 4XJ9A 5FLJA 1EY2A 2PAMA 3B69A 2N7GA 5CIRA 3OD0A 4QGLA 5C8CB 5I93A 2HWD2 2XKPA 4LUMA 3TRSB 3P3PA 1KJLA 4CP0A 1N1YA 4DPNA 2ZGUA 3AKRA 1NE4A 2Q0AA 4AI0A 1MQTA 3VBOA 3U0ZA 3ZFEC 1LOCA 1QNWA 1UKRA 3CJIA 3DL3A 4IQPA 3RDIA 4QMAA 3VBHB 3VBRC 2Q4SA 1DU3D 1F9KA 4YRDA 5J96B 2DCKA 5KXEA 2GZWA 2WA4A 1QMJA 1VRH3 4KGGA 1R081 1RUG1 3WW3A 1FYUA 1IPJA 1Z7S3 5KC6A 1X33A 4LLFA 1HIXA 4N90A 3IPVA 1RUH1 4WVWA 3R4SA 3RG0A 1RUD1 3WP6A 1XYOA 2CWMA 1REFA 3BU7A 4AFBA 4QPIB 4YGEA 5FAXA 1G6NA 1J58A 1Q3EA 4FTSA 2JE7A 4RD7A 3VL8A 1S0BA 4RQPA 3VBHC 1LULA 2RS32 2IXIA 4XJUA 4HSLA 1QOTA 2W52A 4TWTA 3U10A 1ZBA2 1V6NA 4JGZB 3GALA 3E6DA 4O9EA 2HWC1 4X6RB 5CFCB 2BBVA 3MLKA 1V6LA 4XF0A 2EXKA 1S0FA 3ZIWA 4COZA 3AX4A 1RUI1 5T5OA 1MS0A 3KZ4C 4NOTA 3VV1A 4H14A 1XNBA 1ENQA 3B01A 1H8TA 1FAYA 1RUF1 1O7FA 4OHYA 4B29A 3EO6A 1LOGA 1TE1B 1PO12 4Y1VA 4YZ1A 4Y24A 1BJQA 1V6JA 4K6BA 3G7DA 1HQNA 1VBE3 1W6PA 1WLTA 2EAAA 2WL1A 2YMZA 4ORFA 3T1MA 2LM3A 1NG0A 1NXD1 1FNZA 2C1FA 4IEVA 1TEIA 4J6GA 4PBPA 2A73B 3VHNA 2YGMA 1PVC3 3IKWA 3MEPA 1LGNA 1RINA 2K2SA 4HPKA 1ASJ2 1VP6A 4XILA 5DZEA 2LTNA 3GBWA 4AVCA 4RGGA 1CJDA 1N47A 3MICA 5HCAA 1GNZA 3DF0A 5EZWA 1CAUA 5FCCA 1KDMA 2YROA 2R043 3WW1A 4K7JA 4YLZA 1XU1A 1UU5A 4ZU7A 3NKGA 3WP3A 2G9GA 4OVEA 3O14A 4FTEA 3PMEA 4Q4Y1 3VBSB 2D6MA 4DB5A 1BBT3 4CDUA 4LBNA 5I0UA 1VLNA 2WNUC 4BM8A 2W39A 5E89A 5BNNC 5IT6A 2UYBA 2QKDA 4Q2FA 1S0JA 4XQ4A 1WW5A 1V9U3 4N53B 4EV0A 1BCXA 3U4XA 1PGL2 3WD5A 4QM8A 4GWNA 3AJYA 5CU1A 4WBBA 4GB31 3T1LA 1KITA 5FMOL 3RYRA 5AFEA 1D2SA 2X29A 5K9YA 3S6PA 1XE8A 3S7IA 2GAUA 5DDJ1 1C5HA 2JICA 2RM23 1ZRDA 3QLQA 5AC93 1UN1A 1CQ9A 4YYOA 5KHJA 4MGKE 4IEQA 3MPPG 1ZNPA 2AENA 1GR3A 3DUIA 2ZAHA 2Z79A 4Z8BA 1UPIA 3MFAA 5DUVA 4AVVA 2ZHMA 4CDQA 1V6KA 2WZPP 3H3ZA 2JKBA 1HXS2 1UW8A 2UU8A 2ETEA 3ALQA 1EAH3 2PN5A 2XJSA 1AR82 5KHIA 2CNAA 4N43C 2MEV1 4R9CA 4CEWC 5L7OA 1NQDA 1EV11 2Q8OA 2JG9C 4D94A 1QJY2 2HWF1 2IXLA 4JV4A 2P3KA 2UURA 5GLZA 4JGYA 1I5ZA