1C4RA

The structure of the ligand-binding domain of neurexin 1beta: regulation of lns domain function by alternative splicing
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
180
structure length
180
Chain Sequence
HAGTTYIFSKGGGQITYKWPPNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAIEESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAIVGNVRLVGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords NEUREXIN-I BETA
publication title The structure of the ligand-binding domain of neurexin Ibeta: regulation of LNS domain function by alternative splicing.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 41
structure length 180
sequence length 180
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1999-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02210 Laminin_G_2 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1c4rA00
1ULDA 3OY8A 5H9PA 1VAVA 1O4ZA 1YXWA 4WZFA 4FPCA 4BLJA 5HCFA 3VUOA 2ARXA 4I30A 1AX2A 3VKFC 3WG2A 3AP5A 5BYNA 4XIOA 3RS6A 1GZWA 2OW4A 4F83A 3ENRA 3D4KA 1W0OA 4FPKA 4JC1A 4WVWA 2V73A 2W52A 3OGGA 2D6OX 2GNDA 2C9AA 4P9XA 1CQ9A 3USUA 1UL9A 3WZ1A 1C1LA 1KJLA 1LOFC 5DUWA 2PHWA 3IMNA 4Q27A 3AYDA 3V0AB 1EPWA 4XHBA 2DUPA 1GV9A 2ZABA 1R1ZA 5EWSA 4JCKA 2ZGPA 4GWNA 4Z8BA 1S0IA 4R9BA 3DGTA 1QDCA 1LEMA 1LJ7A 3AYCA 1CPMA 3MEPA 4XTMA 2CNAA 2P37A 4YW2A 2VW2A 3B9CA 2R49A 4XBNA 3WDXA 2D3RA 3SISA 3APBA 2WT1A 1SLTA 3BOPA 1GKBA 1GSLA 2A7AA 2ZHKA 3B01A 2FHRA 4C1WA 4AVTA 3OYWB 2Q5TA 2PHRA 3IM0A 3NV4A 4KBBA 1LHNA 2PHTA 4LBQD 3ZXEA 5DG1A 3O0WA 1N1SA 4LBNA 1MZ6A 2NMOA 4FP3A 1G86A 4FPYA 4Q26A 4LBQB 3A0KA 2A6YA 2PHXA 2JD4A 2WNEA 4R9CA 2DURA 3B3QE 3NWKA 2P34A 2D3SA 3AJYA 4Q1PA 4TYSA 4YFZA 3IPVB 3V0BB 3R05A 4ATEA 4YG0A 2GMPA 2YXSA 1MR5A 2VY0A 2UWCA 3A4UA 1SLAA 4BQ1A 1MS0A 2R1DA 1N1YA 1CJPA 4IQPA 3VKNA 4DFSA 1HKDA 1Q8OA 3C2UA 5EXOA 1D2SA 1LOEA 4XBLA 1KQRA 1YIFA 2H0BA 2KM2A 3BODA 2CWMA 2GN3A 3AJZA 3ZXKA 1NLSA 3MW3A 5T5OA 1SLBA 1ENRA 3U4XA 3OBTA 5IK5A 4ISRA 4HANA 1F31A 2EXHA 2ZMLA 4DRRA 3W58A 3A0NA 5HCAA 2DVGA 4YGBA 4GKYA 1LHWA 4M3CE 4Q2FA 5F5QA 1N1VA 1TEIA 1V6OA 3NV2A 1AJKA 3FUQA 5IK4A 2ZMNA 1A78A 3V64A 1HLCA 3WVJA 2SLIA 1LOGA 2YMZA 3SH3A 1LGNA 5T5PA 1JBCA 4U2AA 4YGDA 4WV8A 1IOAA 5JMCA 3B69A 1A8DA 4Y1XA 5DZEA 1DBNA 4GALA 2R1BA 2AH2A 5DXDA 4FPGA 4YG6A 1QNYA 5AVAA 3NV3A 1UZZA 4XZPA 2VH9A 4YM1A 4YM0A 4FVVA 2AENA 4FPHA 4LBOA 3UL2A 4M01A 3FLTA 1W6MB 4XTPA 1JYCA 2WSVA 1SFYA 2PHFA 5T5JA 2ZZJA 1FAYA 4YW4A 1AXKA 3ZXJA 1MS4A 5CAZA 5GZCA 2A70A 1QOTA 4UW3A 5JDBA 1WW7A 3AZYA 1F5FA 3WDYA 1S0EA 3O5SA 3R4UA 4YW1A 1V6NA 1LULA 1MS8A 5IUQA 3RG0A 1N1TA 1UZYA 4GXLA 5CBLA 1RIRA 4ISQA 4PBOA 1QGLA 2D3PA 1GNHA 1JXNA 2XG3A 1SACA 3WNXA 2R0HA 4YW5A 3MW4A 3ZXFA 4BPZA 3N35A 3TAYA 3WV6A 5CNAA 3OJBA 3D6EA 2DVBA 1ULFA 2GDFA 1YI7A 2VXRA 2ZGOA 5JOXA 4YZ2A 1V6IA 1G9FA 4JRAA 5DUXA 3M3EA 5DG2A 5GJ6A 1HDKA 2WJSA 4XIKA 2NZ9A 3INAA 2DUQA 4Q8KA 3AZVA 1KDMA 2G4IA 1DQ4A 3RSJA 2E51A 3I8TA 2PHUA 4NOTA 3IKWA 4UW5A 3RMYA 1G7YA 1O4YA 3JU9A 4Y1ZA 5GALA 1V6LA 1DZQA 4WVVA 1JHNA 3AYEA 3GNEA 2JE7A 3WCRA 4FPEA 1Q8SA 2BQPA 4DRVA 1BQPA 1GANA 1PZ7A 2ARBA 4Y1VA 1SCSA 3IPVA 4YZ3A 2A75A 4R9AA 3ZVXA 3QCWA 3V0BA 3FUOA 3L2YA 3T2TA 3AP6A 3ATGA 4FOYA 3OBRA 2ES3A 2GNBA 5JOZA 1CIWA 1APNA 3PVOA 1J1TA 2UWBA 2NMNA 1BJQA 2ZMKA 4FPJA 4CRQA 3PMEA 4Y1YA 1CESA 4AGRA 1QMJA 1W6NB 2NYYA 4YM3A 2DTWA 4U36A 3D5OA 5H9QA 3SITA 3AYAA 5KXDA 1ENQA 1DQ0A 3N7LA 4M00A 1ZA4A 4YZ1A 1LTEA 1IKQA 3ILRA 1CN1A 1UX6A 3GALA 4SLIA 2W08A 3ZPYA 4Y20B 4PQ9A 1UPSA 2ZGSA 1URXA 1I3HA 4MYEA 3RRDA 4XYXA 3ZYPA 4DQAA 2CTVA 3ZSMA 1LODA 1UAIA 3B00A 4XBQA 1WLWA 1BKZA 1FYUA 1OQ1A 1PZ8A 4H55A 2D6KA 1G9AA 1JN2P 2ENRA 4BMEA 5JVVA 3SH4A 2D6PA 1S1AA 1WBFA 4XJ9A 3PVNA 1ULCA 2NM1A 1LOCA 3MW2A 5EYYA 3WDWA 1SLLA 1WW4A 2WQZC 4YM2A 2OUHA 1WD3A 3M3OA 1FX5A 2D6LX 1DQ1A 2TEPA 1WW5A 1IS6A 1B09A 4RA0A 5HCBA 1I1EA 2DTYA 2ZGNA 3AP4A 5SV8A 2D6MA 1G9DA 1LGCA 1YRZA 4BMBA 3SH5A 4XE9A 5E8AA 1IS4A 1N3OA 2C5DA 1CVNA 1WD4A 1W6OB 1C4RA 2PELA 2GMMA 3USUB 3RQ0A 3UJQA 4XJUA 2CWSA 1WLCA 4XILA 2D43A 1DQ2A 1QOOA 2YY1A 3HR9A 2AGSA 2DYCA 1Z0HA 2DVFA 5T52A 4M3CF 3VKMA 4YZ5A 1DIWA 1C57A 4FPFA 4XMAA 3ZSKA 5KXBA 1S0FA 5EYXA 1DGLA 2P3JA 4FOQA 1KDKA 3DUIA 2RHPA 1AF9A 2R16A 3SLIA 1MS1A 3OPZA 1NXD1 4Y22B 3M3QA 2EF6A 5L73A 3WDUA 4PBPA 2ZGUA 2ZKNA 1Q8PA 4YZ4A 3UJOA 4XJZA 3VKOA 4XXAA 1AXYA 1ONAA 1UKGA 2OUJA 1LHOA 4BM8A 5CA6A 1LOFA 2AUYA 2VU9A 3ILFA 4DPNA 1LESA 3N36A 1UN1A 5GLWA 2DV9A 4HL0A 1ZM1A 3O0XA 5T55A 5GLZA 1FV2A 1YO8A 2ZHMA 4FOWA 3WCSA 4XXPA 1VALA 4CTEA 1S0CA 5GLTA 1A3KA 4ATFA 3AP9A 3V0AA 4K21A 2VW0A 3HN1A 2ZGLA 2LALA 2A6WA 2E7TA 1F9KA 2A71A 1OFSA 3N7JA 5GLUA 3WDVA 4UW6A 2JDZA 1N47A 3POSA 2E6VA 2ZACA 5FRAA 4DS0A 4FPLA 1FNZA 1W6PB 1G8WA 1QOSA 1GLHA 1LGBA 3KM5A 2AREA 4Q1RA 4AVVA 2W39A 1CR7A 2P3IA 1S0JA 4AYUA 5DZGA 1GBGA 1W6QB 1LECA 4YGCA 4XMIA 3N7MA 1KITA 1OKQA 2B7YA 3N3HA 3N7KA 2FMDA 3LCPA 3NV1A 2EAKA 3OYWA 2A5ZA 4FP2A 1JUIA 4D69A 2GNMA 2UURA 1AZDA 2D7FA 2A6ZA 2CYFA 3WDTA 2YZ4A 1SLCA 1LOBA 1BXHA 3H0OA 2WT0A 3WHTA 1DLLA 3VKLA 1S0BA 1QNWA 3T1LA 5GZGA 4LBQA 1Q56A 1Q8QA 3FLRA 3IN9A 4XDQA 1RINA 2GNTA 2A3WA 1H9PA 1CPNA 2EALA 2E53A 4GWMA 3QLQA 5H9SA 3HMYA 1W0PA 1D0HA 1LU1A 2VW1A 4Y26A 1GZCA 3WG1A 1WLDA 3KQRA 1GYKA 1ULGA 1KRIA 2DWRA 2DVAA 2NN8A 2EIGA 2ERFA 2DU0A 4LBKA 1AX1A 1ULEA 1W6OA 5DUUA 1DYPA 2ZHNA 5GLVA 3AFKA 3AZZA 1H9WA 4ZXKA 1WBLA 4FOVA 2D44A 2SBAA 5IK8A 2DVDA 5GZEA 4M3CB 3ZXLA 4YGEA 1JW6A 3ILNA 4Q8LA 2JE9A 5IK7A 1H30A 1MS5A 1IS5A 1LEDA 1SLIA 1VLNA 3ZYRA 3O0VA 2DUOA 2R0FA 2CY6A 4XJ8A 2UU8A 1GICA 1X50A 2Z42A 4RL7A 4XJAA 4Y22A 3AP7A 3WUDA 5GM0A 5DZFA 2YV8A 3OY8B 1MVQA 4LBMA 1S0DA 1G9CA 3BIWE 1Y7BA 3R4SA 1QKQA 2JKBA 3T1MA 1LHUA 1GZWB 3AZXA 2W68A 1UMZA 1V6JA 4GA9A 4ZKTB 1G9BA 1AXZA 4YLZA 3FFZA 1FV3A 1HQLA 2ZGMA 2WLQA 1ENSA 3CNAA 5F9TA 2WKKA 2ZGTA 1XQNA 2A3YA 4P9YA 5T50A 5JLVA 3LSDA 5KXEA 3FLPA 1GZ9A 4YFWA 3Q9OA 2OVUA 1LCLA 3W59A 3I4IA 1W6MA 4Y24A 3ZSJA 4W65A 4AVSA 2AYHA 2HYKA 1MS9A 2WSUA 3VV1A 1BZWA 2P3KA 3WG3A 1LU2A 5H9RA 1V00A 1SCRA 2EXJA 1DHKB 4FPOB 1V6MA 1CONA 3PJQA 1KJRA 1DQ5A 2GN7A 1FATA 1BYHA 1S0GA 4L8QA 3SNMA 5LK5A 1MVEA 3WG4A 4Y1UA 4BOWA 5E88A 1JYIA 1W6PA 3V65A 1Z78A 1N3PA 1RITA 1AVBA 3POYA 1HQWA 2ZAAA 2ZGQA 4UW4A 5DUVA 5T54A 2ZGKA 5CB7A 4FQ4A 1W6QA 3WUCA 4R9DA 1SBFA 2UWAA 3WOGA 4OZXA 4PF5A 2DU1A 1AX0A 2E7QA 1LOAA 5GZFA 4C1XA 3AXDA 4FQZA 1VIWB 1VAMA 1LENA 5GZDA 1QDOA 3AZWA 3WHUA 3RMXA 2EXIA 1LHVA 1WCSA 4XOGA 1JOJA 3LSEA 4NO4A 2GMEA 2LTNA 3PVEA 4K1ZA 5KXCA 3O12A 2P2KA 2WT2A 1V6KA 3MPPG 5T5LA 2ZHLA 1YYNA 1U0AA 2AR6A 1SBEA 4AGVA 1N3QA 4ITCA 4AWDA 5JOWA 2VUAA 3BTAA 4BLIA 2D6NA 2CL2A 4LBJA 2YROA 3POWA 3M2MA 1DFQA 4P14A 3ZSLA 5FREA 3AXEA 3M3CA 1SBDA 2EXKA 5JOYA 1MZ5A 1QF3A 1W6NA 1WW6A 2JECA 4YW3A 3AX4A 1WUVA 4XHXA 4TZDA 2A3XA 5E89A 3WLUA 1IKPA 4K20A 4CZSA 5IT6A 4ASMB 1DQ6A 2XB6C 1DYKA 4XJWA 2ZBJA 4Y20A 3FBYA 4K1YA 3AK0A 4M3CA 1PZ9A 4PCRA 2ZA9A 3UK9A 2NP0A 2V5YA 1AJOA 1MS3A 1Q8VA 1QU0A 2A6XA 2JJ6A 4YG3A 2ZGRA 3JUUA 4AGGA 1GNZA 2I2SA 2GALA 4P9WA 1FNYA 4GKXA 1C1FA 3ASIA 1IS3A 4LBLA 3TB0A 3M1HA 1MACA 2A6VA
chains in the Genus database with same CATH superfamily
3AVSA 1ULDA 1YXWA 1RUF3 4WZFA 5C71A 4FPCA 3F95A 4BLJA 5C8WA 1DGWX 3MYXA 3WG2A 4L0PA 1RUE2 3K4ZA 1U5ZA 5A3OA 3AMNA 3U75A 2OW4A 3HNYM 3DL3A 4CCJA 4FPKA 1NA1C 4A7YA 3AM2A 4WVWA 2WNUC 4Z82A 4BIOA 1H2KA 2R32A 2PAMA 3SCHA 3ZN4A 4QT6A 1ZBA1 4P9XA 1C1LA 4PIXA 2HWB2 2R072 5F2WA 2XKOA 1R093 5KR7A 1EAH2 1LOFC 4X8NA 2W1QA 3IMNA 1OXCA 5FP3A 1IZ3A 3AYDA 5BUVA 1GOGA 4A6OA 2WNVA 4LLOA 3ACLA 2HH9A 2J1RA 2V5DA 2PN5A 2RDQA 3K51A 1OFNA 2BOJA 4EYUA 1W9FA 4B29A 4GWNA 4AI1A 3AFGA 3ZXGA 3DGTA 1O3QA 3AYCA 1HX6A 1LJ7A 3PIGA 2CNAA 3ZYBA 2QJVA 3B9CA 3RFRA 3APBA 5A1LA 4L97A 1QJFA 4CCNA 4JGZA 1SLTA 1PM4A 4L11A 4S2HA 2VUJA 2ZHKA 4JHTA 4AE2A 2FHRA 5FZ6A 5LATA 5CEHA 1UO9A 2VNRA 2PHRA 3OGSA 4QGLA 4RGKA 3ZXEA 3O0WA 1GWMA 2VZOA 1JZ7A 2OQ6A 1D2QA 4A3XA 2QQLA 3HPNA 4NUBA 5B4XA 4MHUA 1BBT3 1OHFA 1BEV1 4MGYE 3LFIA 5JXJA 3J9SA 4BDVB 2PHXA 3E97A 2GC0A 2JD4A 5FP8A 2WNEA 3NWKA 3BTZA 4QPGC 1PGL1 5ABJB 4ZZ5A 1W3XA 1UU5A 1PVC1 1ZBE3 2J1VA 4TYSA 3IPVB 4H3WA 3HQXA 4ATEA 3RGBA 2G9FA 2GMPA 4FFHA 2YXSA 4QPIB 3VN4A 1MR5A 4IL7A 2IFWA 4NIIA 4BQ1A 1MS0A 2FDKA 4IQPA 1HKDA 1Q8OA 1HV1A 3C2UA 3DXUA 1J3QA 2EIBA 2VVDA 5FY8A 5EIYB 1POV1 4RSUA 2H0BA 2P17A 2GN3A 4QMAA 3PUIA 1VBA2 1AHSA 1DU3D 1WMEA 2XQXA 4KI5M 5A70A 5F6KA 4NRQA 5C4WA 2BERA 1ENRA 5FK7A 3U4XA 4ISRA 1FOD1 2EXHA 2ZMLA 1HB2A 3A0NA 3SXWA 1C3HA 1OT5A 3GXUA 1JU4A 1OH3A 4DUXA 3H7YA 5C3PA 4AEJA 4JDOA 1TEIA 1V6OA 1O59A 3MIGA 4COYA 3CL1A 1R1A3 3D8CA 1HLCA 3MLJA 2V4AA 2Q30A 3CMGA 2DFCA 2PYTA 3DYMA 1Y9QA 2QQPA 1ASJ1 3B69A 1A8DA 4Y1XA 1OLQA 3SEEA 2QDRA 1OUXA 1LNSA 3N9OA 3CZJA 2AH2A 4LHSA 2DCJA 5A7NA 2QNKA 4YG6A 1RJ7A 1PO12 3ROUA 1L7LA 3DYOA 2YG0A 5J36A 1V9U3 4XZPA 1L3JA 3I3EA 1PK6B 5JIAA 4CCDA 1W8WA 1QHDA 1RMU2 2OS2A 3TN92 5G04L 2JDUA 1R64A 3ZN6A 3EXUA 2E32A 3AC0A 3FLTA 5I8YA 4XTPA 4PLOA 3ZFEA 3U07A 2JDHA 4AFAA 4NAMA 1AXKA 5JDBA 3I2KA 4K8FA 4Y5SA 1D4M1 1O5UA 1WW7A 3JBG1 3SCGA 4KL1A 1S0EA 4WBBA 5FO8B 2JDYA 4M0NA 3LDKA 2FDGA 3KVAA 1RIRA 4ISQA 4D3WA 2XLFA 1JXNA 1YQ5A 3WNXA 4N43B 2YUEA 5JZGA 1ND3C 3MDPA 5CU1A 3WEZA 3R4DB 3AKSA 4PLMA 4Q0PA 2ET7A 5HPOA 1PO22 3VBFC 4DO0A 2BNOA 3D6EA 2GDFA 1AL0G 1PMHX 1YI7A 2I74A 3KZ4C 2RDSA 4LO7A 2RMU2 5JIUA 1NCQA 1CAUA 2O8OA 1WCQA 1YCIA 1UMIA 3Q8FA 2WJSA 2NZ9A 3JB4C 4Y3OA 5FMOL 2WN2A 4Q8KA 2XOMA 2HEVF 4DNYA 2FQPA 2G4IA 4N9IA 1YFYA 2UYBA 2MEV2 1AR71 2PAEA 3RMYA 5KHHA 1V6LA 4K40A 1JHNA 3AYEA 3WCRA 4I0AA 3S57A 4LKFA 4DRVA 1BQPA 1GANA 1PZ7A 2ARBA 3I2IA 4Y1VA 1ULOA 4LNVA 1O8PA 5FO7B 2MHFA 1EY2A 3T2TA 4IEQA 2ZTNA 5A3PA 4UFMA 5ANNA 2PTMA 1QJEA 3KMHA 5C70A 1NAEA 2OT7A 4U36A 3SITA 5LEKA 4KQ7A 3AYAA 5F5IA 5KXDA 3KCXA 5FJHA 1ZA4A 4YZ1A 1POQA 3KT4A 3DF0A 4ZHNA 1HJFA 2E33A 4SLIA 3VBUA 2YB7A 4PQ9A 1I3HA 4MYEA 1PIV1 4AQSA 4N7IA 5FZ3A 3RRDA 3T0DA 3OCPA 4LE3A 2ARCA 3CJIC 1RUE3 1AR81 2CTVA 4DQAA 5FO9B 5KHGA 2HWC3 1WLWA 1PZ8A 2RS32 1U5XA 4BMEA 3Q8AA 4XJ9A 2NM1A 1IPSA 4HKOA 3MW2A 5EYYA 1Z7S3 2AEZA 1VRH2 1WW4A 1W2AX 5I0RA 2WO2A 1RUD1 2Y8KA 3M3OA 3MBWA 4RA0A 1IS6A 4HT1T 3WY6A 4AEKA 5HBAA 4MV2A 3AP4A 4XCBA 5A3TA 4GMP3 3DYPA 2RM21 2NLRA 1G9DA 3H8XA 3SH5A 5IVYA 4XE9A 4Y5Z0 3KHCA 4DY5A 1NY72 4ASLA 1RUJ2 4LK7A 3RQ0A 3UJQA 4QPIC 4XILA 1VBE2 5FYTA 1FMD2 2AACA 3LOBA 1Z0HA 2DVFA 1H8TA 5T52A 4M3CF 4LULA 2IXJA 4XFAA 3W20A 3T2PA 4IE4A 2IXLA 4YSFA 4YZ5A 2WS92 3AMQA 1JTZX 4QQLA 2WABA 4M4PA 4XDOA 2DCZA 4FOQA 5EFUA 1QJX1 2QZ3A 3VZJA 1MS1A 4IGPA 5JR2A 1ZVFA 2WNVC 1W2TA 1JI6A 3WDUA 1V9U1 4BA6A 1E5HA 1NXMA 2ZGUA 4PBPA 2J1SA 4YZ4A 5C8CA 5FFOC 4XXAA 3RI9A 3WP3A 1ONAA 4M0HA 2OUJA 3RVHA 1NUKA 2HBUA 1UYPA 1OKOA 4P9JA 3VBOA 4H7MA 2RS13 4BU2A 4C0BA 1MEC2 1J3PA 3N36A 1W2OA 5LA0A 4ZPIA 1QEXA 4HSLA 1AYM3 2KR2A 2XL9A 3FJSA 2BDRA 4QXKA 2YC4A 3HT1A 3O0XA 1F8VA 1YO8A 4N53A 4W6WA 4XXPA 3SKJE 4BXFA 5LA9A 1QJU2 5GLTA 3MIEA 4HBNA 1GUIA 2I45A 1RL3A 5C3QA 2HWE2 5A7OA 2GSYA 2JG8A 1COV1 3VDDA 2E7TA 2QQUA 2A71A 1OFSA 4LIVA 3NAPB 1WCUA 4LKSA 4EWDA 1MQTB 1N47A 1C8NA 1IGOA 2JDKA 4CDUC 4B1LA 3THCA 2CGNA 2ZACA 2G1MA 1W6PB 1F4HA 1QOSA 2AREA 4EN6B 1FXZA 1JU3A 3I3QA 4AYUA 5F1RA 1AR92 3S6PA 1LECA 3TEXA 4YG3A 1KITA 2ZXQA 4P9WA 3ZOIA 1ACCA 3OYWA 3LA2A 3LCPA 4K9SA 2A5ZA 3VBHA 3WQBA 3VBSB 4N43C 2D7FA 5J3UA 2A6ZA 4CP9A 4JKKA 4IDZA 4ES9A 4Q5OA 1AR61 4RQPB 2EIEA 3C7HA 4XQDA 4MXWB 2WT0A 5GZGA 2WYFA 1AUYA 1QNWA 3T1LA 4LBQA 5C4WC 1Q56A 4LUMA 3FLRA 1XE8A 4XAEA 3ZFFA 4XDQA 4YVWB 4LJHA 5BNNB 3UNPA 1RMU3 1H9PA 4LA3A 5D1IA 1VBC3 3CQOA 3MIBA 4AG4A 4OUSA 4QKNA 2JG9B 2VW1A 2Y0IA 5JPMB 2ORZA 4Y26A 2RG4A 3NL1A 3ORJA 4IEZA 4OMDA 1GYKA 1UMHA 3NNFA 3KVBA 1GWKA 2ZAHA 2ZCWA 3DKQA 5A7WB 4HETA 1VPHA 2DU0A 4BE3A 2Z2SB 4LHKA 3URFA 4AVCA 1AX1A 1W6OA 3MUZ1 4XUPA 2OKXA 4CDQA 1DYPA 1RUE1 5ISLA 5A3UA 1IG0A 4X8PA 1H9WA 2YFUA 3RYKA 1WBLA 4FOVA 2CAUA 2PQSA 3VZLA 4UBGA 5A3NA 3BTYA 1PO23 2DVDA 5GZEA 2VNVA 2YC2A 4JTNA 4XPVA 3I3DA 5KC5A 4YGEA 3RDIA 2HWB1 2R071 5HXMA 2ZOEB 3QOPA 1EAH1 1IPJA 1SLIA 2C0ZA 2R0FA 2CY6A 4RR3C 5KWRA 5LW9A 2V09A 3UT0A 3FHAA 2Z42A 2Z69A 5FZOB 4CUBA 3VZOA 1NE6A 5GM0A 2YV8A 3OY8B 2VCBA 2MEV3 3TEWA 1CIYA 1S0DA 2F6BA 3GCWA 4W50A 1G9CA 3R4SA 4LA2A 3C7GA 2Y38A 1LHUA 3I2GA 1SG3A 4MO3M 5A1AA 4OI2A 3ELNA 1AXZA 3BPZA 4X6RB 4XUQA 1XE0A 2BP6A 1FV3A 5FLIA 4OMCA 5FPBA 1JYXA 2ZGMA 3OUJA 4QDQA 1UYYA 4CXYA 3CNAA 5FZIA 5F9TA 1M4WA 1QY4A 2WKKA 2ZGTA 5T50A 3DCQA 3LSDA 4I02A 4BQ2A 2E63A 5KXEA 3Q9OA 4B4QA 5LY1A 3CZUA 2OVUA 1LCLA 4WM8A 1NCQC 1W6MA 5FBJA 4XVHA 4W65A 3ZMNA 2AYHA 2HYKA 2Y6KA 2D5HA 3FL7A 4AEDA 4TLFA 2YGLA 5H9RA 5CFDA 3NMBA 2EXJA 1DHKB 2VZ3A 5SV5A 4IXLA 3PJQA 1DQ5A 1GP5A 4E8CA 2V72A 1H2MA 4Y1UA 4BOWA 5E88A 3WW1A 2VCAA 5L7OC 4BQWA 3TEYA 2OX0A 4RHV2 1TZOA 1BLZA 3KB5A 3NSTA 4XFGA 4ARYA 3POYA 1HQWA 2ZGQA 2WZR2 3ZR6A 2HEWF 5CB7A 1ZX5A 4EQVA 1QIQA 2TBVA 2VUCA 3OEBA 4BCUA 3L9JT 2XJVA 3TNPB 1HIXA 1VBA1 4CEYC 4CCEA 1LENA 2ZKLA 3VBRB 5JSRA 3MFCA 3RMXA 3WHUA 4BHPA 2R043 1A8MA 4IV1B 2LTNA 5CFCB 3ZFGB 5KXCA 2P2KA 1UY2A 5FQ0A 2ZHLA 3ACFA 1VBE3 2WINB 3PUHA 2MPFA 2VUAA 3T4VA 2FCUA 4GH4C 4PDWB 2Q8OA 4QPWA 1YJKA 3CLPA 3OPTA 5KBFA 5FREA 1RUI3 3SKVA 5FBZA 5LBEA 2WS93 4O65A 4OHXA 4W8JA 2JICA 4GB32 1VMFA 2J42A 1QF3A 5FZ9A 5LBFA 1LR5A 3AX4A 4XHXA 5JCTA 5IVCA 3IB3A 3ZYHA 4NHLA 1ND2B 1XNCA 3ABZA 1UY1A 1PO11 1XNTA 2ZX0A 3NAPC 4K20A 1OD3A 2LROA 4BQ5A 1K12A 5IT6A 4JAAA 1NQJA 4EN8B 3JQWA 3BN6A 5ACA3 4IE0A 4Y20A 4K1YA 1RMU1 1PZ9A 3TN91 3MIDA 4PCRA 2NP0A 3JXSA 2VVFA 1AJOA 1MS3A 1QU0A 2BNMA 3JCIA 4IEPA 4QX0A 2ZGRA 1MEC3 2XJSA 1W90A 3JUUA 3HQRA 4CCCA 1OUSA 3P1IA 4P00B 3RZMA 1NA1B 1M06G 2WNUB 3M1HA 5FLJA 2CAVA 4EWEA 2A6VA 5BNOA 2D97A 1XNBA 4N9HA 5FOJB 1UYZA 4MXVA 3X29B 4A41A 5FPUA 1JZ8A 2ARXA 5EQUA 2GP3A 4IV3B 2DCYA 1POV0 1CAWA 4XIOA 1YQ2A 4F83A 4JC1A 3D4KA 2YU1A 4KH9A 5FZLA 1NCRA 4E9KA 1PO21 2VZVA 2XWBB 2WWUA 1RUC2 2XXZA 1RJ8A 1C5HA 1G6NA 2RMU1 4CU9A 3A22A 5C9AA 1RB8G 1WMFA 4W4ZA 5DUWA 3B93A 3V0AB 1EPWA 2C26A 2ZEWA 3VHOA 2ZABA 3VGIA 1DG6A 3N4MA 1R1ZA 1O6UA 4NWVA 2MEV1 3LA7A 5EJ1B 1ZBA3 5FY5A 2JDPA 3D0JA 4Z8BA 4MG2A 5J48A 5HI0A 1H4GA 4N53C 4J25A 1LEMA 4QAWA 1UPIA 2JDAA 1UXZA 2P37A 3TNQA 1SQ4A 1B35C 3UKTA 3HNBM 4PLNA 1XJAA 1RVF2 4FXKB 1JMUB 2R49A 4CU7A 3IAQA 4CUCA 2D3RA 5L9VA 4Q0UA 4ES8A 4UF0A 3U4SA 3LEGA 1XNAA 4MGIE 4C1WA 4AVTA 3VD9A 3K3OA 3MV11 4OCTA 4YYOA 4BISA 1DP0A 3IM0A 3NV4A 1H2LA 4FO9A 1UW8A 4G9SB 4KBBA 4QPGB 5CKMA 4LO8A 3KV4A 4Z1VA 1G86A 1HJGA 1P8JA 1UIKA 4XURA 4Q26A 3FN9A 1R082 3ZIWA 3A0KA 4XCAA 2LW8A 3VBHC 2HWD2 2BU9A 4QQ2A 4ZU5A 4Q1PA 4QB6A 2ZEXA 3OGJA 3R05A 3P5BA 2IUWA 4YG0A 4OI1A 4CU8A 1ENXA 4QM8A 2RS31 3PTRB 2OYZA 4CDXB 1BEV3 3A4UA 1VB4A 2R1DA 2F4LA 3VKNA 3ZFFC 4DFSA 4SBVA 1D2SA 1LOEA 1VRH1 2WQ4A 4OULA 3MPBA 1JOPA 1XNDA 2JWPA 4F7ZA 3AJZA 4PT6A 3J26N 2YU2A 3HAGA 2CDOA 3H50A 3ZXKA 3MW3A 1GR3A 5T5OA 1SLBA 4JTOA 1HRV2 2VMDA 4WVMA 1O8SA 5IK5A 1F31A 1JS9A 4LR4A 1YFXA 1K5MB 1POV3 4EV0A 1KD7A 1NY71 3LA3A 1RUJ1 4GKYA 1ULPA 3PHMA 4AFCA 2PHDA 1WA6X 3KF5A 3NKGA 4M3CE 1VBE1 4Q2FA 4QHOA 5F5QA 5DAXA 2FDIA 1FMD1 1I5ZA 3NV2A 4OI4A 3BPSA 1IQDC 4FFFA 4CDWC 5IK4A 3H3UA 4DXSA 1FOD3 2B9VA 5A3LA 4UFKA 2WS91 2YMZA 3SH3A 1JBCA 1X36A 4U2AA 4ZONA 4WV8A 1JZ4A 2JE8A 5DZEA 4URTA 1OMIA 3K75B 2QE3A 4LEJA 4JKMA 5LRRA 4PI0A 4JKLA 2VVEA 2VH9A 2ARAA 4ONUA 3E1F1 1GOHA 4LBOA 1WCDJ 2JENA 4J6GA 4BJ0A 1UF2C 4M01A 4GJZA 1MEC1 1QJY2 3IDCB 4DXTA 5D21A 3RI8A 1ND3B 1SFYA 2VMEA 2PHFA 5T5JA 4A45A 3BALA 1MS4A 5FZ7A 4EJRA 1JHJA 4IETA 3ZKYA 5IUQA 3VBFB 2W9XA 3RG0A 4CEWB 1PHMA 3FZ3A 3ZDVA 1N1TA 2NQYA 4GXLA 3KT1A 1QJU1 1HXS2 1QGLA 2XG3A 4WM8C 1SACA 3GZUC 4JDNA 3O1UA 2HWE1 1IQAA 1JZ2A 4HVRA 2LUWA 1TMF2 3CBNA 3ZXFA 4BPZA 2VULA 3JBG3 5CFDC 3TAYA 5CNAA 4MGZE 3UYJA 4LUKA 3TWIA 2YYOA 2ZGOA 4COVA 3LE0A 4LOSA 2JEMA 1V6IA 4FI9A 4JRAA 5BY5A 1BVP1 4IE7A 4L9BA 5GJ6A 1LKNA 2R062 3GJBA 1AR91 4RFRB 4NIGA 2WWJA 5C5TA 3M3IA 2BV4A 2IWGB 5D8AA 4Y5TA 4GB33 4IV3C 5GALA 1QXRA 5F3CA 3EYPA 4QX2A 4JX0A 4NMIA 5FYIA 5JPNB 2DBIA 4JQTA 5ABJA 3DPRA 2W87A 3IPVA 4LORA 4R9AA 1KS5A 3QCWA 3FUOA 3L2YA 5C3RA 5A32B 1SZBA 1UYXA 3ATGA 1AR73 3OBRA 3C8XA 2GNBA 3GYDA 3NO8A 5JOZA 3PVOA 1J1TA 1BJQA 2ZMKA 1RHI2 4FPJA 2A1XA 5JXIA 4UWDA 2BGCA 4AGRA 4D7TA 3T08A 2DTWA 3CJIB 4HONA 1W8OA 3GZAA 4PF1A 1YLLA 3J7NA 1ENQA 4M00A 5A33A 3NJZA 3D82A 3GBGA 5FP4A 4AI8A 2B39A 4ASKA 4IEYA 1UOJA 2X5IC 2W08A 1W9WA 3Q8EA 1XOYA 1UPSA 2R7EB 2YFZA 3LKJA 1URXA 2IC1A 1RTVA 2CSGA 3KSCA 2IFRA 4Q4W2 5CKNA 1GNYA 4NWWA 5K0UA 3ZXDA 1FYUA 1OQ1A 1G9AA 2K46A 2ENRA 4F3JA 4KU8A 5JVVA 4CP2A 1S1AA 3PVNA 5DDJ2 1PIV3 5IHRA 3PURA 3WDWA 4D8MA 1SLLA 1AR83 2R30A 5KHJA 2WQZC 5A6ZA 1UOFA 1WD3A 5F6LB 2GH8A 2D6LX 2XL7A 5HCBA 2TEPA 4CP0A 3RWKX 1B09A 2X29A 2DTYA 2ZGNA 3VHNA 3VZMA 2XUMA 4EN9B 2B9UA 4G3YC 3RZKA 4CVUA 3OF1A 1KEXA 2C5DA 5J37A 1WD4A 1PK6A 1C4RA 3S7IA 1RUD3 4XJUA 3LD8A 5AFEA 2D43A 1RVF3 1W8ZA 2RR12 2AGSA 3PNAA 3WNKA 4AI2A 4CDXC 4DEVA 4XQWA 2RM23 5F8PA 4O61A 4URAA 2WNVB 3THDA 1DF0A 1DIWA 1OF4A 3ZXAC 1C57A 2BVBA 5KXBA 3ZSKA 3O1OA 4NIDA 2AC1A 2P3JA 3LIGA 5C9AC 2R16A 1FT9A 1NXD1 4Y22B 2VBBA 1WZXA 1W8FA 1K5MC 2VCMA 3CU7A 3VKOA 2ZKNA 1ZZBA 2WN3A 4FTSA 2YGMA 3KHBA 1NG0A 2B46X 1OOPA 1QJX3 1LHOA 1UKGA 4NR1A 3U1XA 4CP1A 1W04A 3O1PA 4CSWA 4UFJA 4RHV1 2VU9A 4P9LA 4DXZA 4S2DA 2WLPA 3IIAA 1UN1A 2WZR1 3OGVA 5FY7A 2DV9A 5I0UA 2WUHA 2O0OA 1ZZCA 3I2FA 2WO3A 4IGOA 4L92A 4NN0A 5L9RA 3S5QA 4DINB 2I07B 1C5IA 3H1YA 2LM3A 5T55A 3IDBB 4CDUB 1W2UA 4GD4A 2GC3A 4AFDA 2W92A 1TNFA 3AP9A 2RS52 4R4XA 5FY1A 5CISA 1W8HA 5A3WA 1HRV3 1F9KA 3N7JA 5GLUA 3WDVA 2PAKA 1BK1A 4GMP0 4MH0E 1UOGA 3BIEA 1UIJA 2XGXA 5FPZA 5TSWA 4AHWA 4DS0A 2HEYF 4W6XA 3PU3A 5FR3A 4N7UA 5IVFA 4Q1RA 3NJVA 4AVVA 3UETA 1COV3 3WW3A 4JZRA 2VCCA 4CEWC 4XUTA 5C4WB 3LEKA 4XMIA 3O7OA 3N7KA 4YGCA 3N3HA 5FKBA 1YFWA 3NV1A 2VOKA 4GB31 4FP2A 1JUIA 1RC6A 2UURA 4OHYA 4LO6B 1DGRA 4LE4A 3AMMA 2VZTA 1SPPB 1LOBA 1JZ6A 1UCXA 3U37A 4TWTA 3WHTA 3VKLA 1S0BA 4DXRA 3M70A 4ARXA 1S2EA 2K0GA 4LO5B 4ZY9A 2WO1A 3IN9A 2XDVA 2GU9A 3ACIA 4A7KA 2A3WA 3S5AA 1CPNA 1J84A 3KGLA 3ST7A 1AR63 3QLQA 5H9SA 4UI9L 1CZTA 1W0PA 2MNGA 1LU1A 1EV12 3IAPA 3I3BA 3PL0A 1X8MA 1WLDA 5LASA 2AEYA 3AMPA 3RZGA 2W46A 4LHLA 4LK6A 1KRIA 2VNGA 2DVAA 1JYVA 1UOBA 1F15A 1YQ8A 2BJSA 1HW5A 3LDRA 3N9NA 3HNMA 1ULEA 4WM7A 3MIHA 1RYYA 4FFIA 3SC7X 1HN0A 5GLVA 3AFKA 3AZZA 3TBDA 4RR3B 4AHYA 4RGGA 3BKZA 2DFBA 1WCKA 1Q43A 1RUC1 4P5YA 2QCSB 5IK8A 5JR7B 4QQPA 3GDBA 1W9SA 3J8F2 4M3CB 4OVEA 1BCXA 4Q4X2 1JW6A 1H6XA 4Q8LA 4DOUA 2YBKA 5IK7A 1VRBA 2X8KA 4XFCA 3LFMA 1IS5A 3O1MA 2C4XA 2DUOA 2J7MA 5EJ3A 1OF3A 1XE7A 5JZGB 3S0MA 1GICA 4XJAA 3OEAA 3WUDA 2BFUL 4LITA 4C0HA 2BW8A 3J7HA 3RJ2X 1OLMA 2WR9A 4LBMA 2HWB3 2R073 4EROA 3GBFA 1EAH3 4UT5A 4V2VA 1GZWB 1SDDB 1RVF1 2D98A 2R6QA 4Y33A 5HV4A 5DQ0A 1NCQB 1CAUB 2W68A 1V6JA 5FZAA 4A2UA 2VTFA 2HWF2 4YLZA 1PX4A 4MGQA 3MF6A 3GZEA 1UNBA 1OPOA 4P9YA 2A3YA 2QBXA 4BQXA 5FZ4A 5HV0A 4YFWA 4HVOA 4GAZA 1SEFA 4Y24A 5L9BA 1QQP2 5AFBA 1RXGA 3ZSJA 4AVSA 4MLOA 5L7OB 1MS9A 4NHKA 2WZ8A 1VP6A 1R081 3VV1A 3WG3A 3BU0A 3VDBA 5KHKA 4CCKA 5I0SA 3PUQA 4FPOB 4JHZA 1V6MA 1UX7A 2HWD1 1KJRA 3CIHA 3KT7A 3OUIA 4LPLA 4NPLA 5FYHA 5C6CA 5J1XA 3I2OA 1MQTA 5C33A 2W1UA 2XVGA 1A6CA 4L8QA 5LK5A 1MVEA 1JYIA 4QDSA 5JAXA 1W6PA 2P6HA 3DPRC 4QX5A 4CEYB 3EMRA 3ZMOA 3V65A 1Z78A 1RITA 1AVBA 4AOCA 2ZAAA 1NE4A 5B2GB 3EO6A 1SDWA 4AQ6A 5FPAA 3WUCA 3VBUB 1SBFA 5JXGA 2UWAA 2PFWA 3WOGA 3VDAA 1AX0A 5FKCA 5GZFA 3WF1A 3VBSA 4FQZA 4AHZA 2ZJCA 4META 4QHZA 5GZDA 1FPN2 1QDOA 4JGZC 3AZWA 4RQPA 2E7AA 4GH4B 4ORFA 1HRV1 4QKDA 2JB4A 3PVEA 2W47A 2WNOA 4A44A 2K9ZA 3I2JA 4W6YA 3R0RA 1V6KA 4YVWA 5BNNA 1D0GA 1QXPA 1SFNA 1VBA3 3GGLA 1J1LA 2AR6A 4H7LA 5F2SA 1ZRRA 5A7SA 2VZPA 2XJUA 1W8TA 1N3QA 3W5NA 4AI0A 4AWDA 2RR13 3PVBB 2JG9A 5K8SA 2VQUA 4YW7A 5K0UC 2J1EA 1DFQA 4P14A 3ZKUA 1W06A 3AXEA 2IXKA 3GCXA 2QQJA 2N7GA 5A7WA 2C24A 3D0SA 1HB4A 2P5BA 1MZ5A 1W6NA 1WW6A 5FMCA 4D7SA 1RUH2 3N9MA 1WUVA 4YW6A 1XYPA 5E89A 3WLUA 5IVJA 2VG9A 4CZSA 1PVXA 1H8TB 4AXOA 4QGMA 4XJWA 1J83A 2VGDA 4COWA 1MZEA 3FBYA 1T6GC 2BBAA 5FZ0A 2G9GA 2DF7A 2ZA9A 1Q8VA 1QJY1 4BK5A 1PO13 1BVVA 5LCWL 4AGGA 2WFPA 2GALA 1FNYA 1S55A 2ZEYA 1C1FA 1D7PM 4LKDA 3LEMA 5KHIA 3BB6A 5FZOA 2OQ7A 1XXNA 3TN93 3OY8A 4I2OA 1HXS1 3J7MA 4AVAA 1KXGA 1AX2A 3VKFC 3WQ0A 3AP5A 4ZZ8A 5BYNA 1JH5A 3NW4A 2RS53 3OPWA 3RS6A 4PHZA 4B7KA 4EN7B 1TMF1 5F7UA 4MADA 1AL22 1W0OA 1OA4A 3ME2A 3KV9A 3WP6A 5FMOS 4AI3A 2JD9A 2V73A 3OGGA 5HXVA 1QH7A 3SMHA 4E4SA 2C9AA 3I7DA 5JMOA 3USUA 4N53B 1UL9A 3WZ1A 2Y64A 1H1IA 5FJKA 1KJLA 3NJYA 4X6QB 5CVRA 4YWAA 1LB2A 1B35B 2R061 4Q27A 4E2QA 2ZS6B 2FBEA 2DUPA 1GV9A 3ITQA 2VL4A 4K8RB 1KFXL 4XHBA 3U0ZA 4B4PA 1KS4A 4JCKA 2ZGPA 3QD6A 3HBZA 5LK7B 2RMU3 4A7ZA 4JGYA 4R9BA 3T3YA 4CPBA 4BB3A 2Y0OA 4XTMA 5FAXA 1RGSA 1VBB2 5FWEA 3TEZA 4MZUA 5AC92 1GQGA 4R4ZA 5FLHA 3ZFEC 3KS7A 4D6RA 2GAUA 2BEOA 4Q4Y2 4DMIA 4XBNA 4D0QA 1RUG2 4I09A 5LEJA 3WW2A 5T3NA 1HN1A 2WT1A 3BOPA 1GKBA 4P9IA 1WKYA 3B01A 3VDCA 4XF9A 2VZRA 1JZ5A 5F39A 3OYWB 4B3NA 1RHI1 3VBHB 4XC9A 2X53S 1VBD2 2Q5TA 4BIFA 1CAXB 1LHNA 4LBQD 5BNPA 3IDAA 5JZGC 4Z92B 1UD1A 3I59B 5J96B 1I5PA 4LKEA 2NMOA 2QQOA 3PJYA 4TN7A 1LRHA 2VMCA 3VBRA 3K4AA 3WT3A 2TNFA 4RS5A 3OSDA 4NAOA 1VB2A 4LBQB 4QXHA 5DABA 4IV1A 2Y60A 3ZFFB 3H8RA 1SHWB 2P34A 1L7RA 4IUGA 4Q4W1 2D3SA 3AJYA 4UXAA 3WSOA 4BH9A 4OLLA 2Y6FA 3HEIA 3V0BB 2BYVE 3FHIB 3AKPA 4GIQA 4AL9A 5K7PA 4PDWA 2VY0A 1SLAA 5DDJ1 5IFTA 1N1YA 1CJPA 4YVSA 3K46A 4UFHA 2Q4SA 2QUOA 4FXGB 4Q4X3 4HPKB 3B7MA 4RYDA 1F35A 3UESA 1ZRCA 2XMLA 4XBLA 4E4HA 1KQRA 3BODA 2CWMA 1NZCA 4GWJA 2GP5A 1WA4A 4AQ2A 2RS33 3SEPA 4RD7A 4QGNA 1DZTA 2XJRA 4CDWB 3WP4A 3POFA 1PX3A 2BOIA 3HVDA 3GJAA 4H2AA 2DVGA 1VRH3 3CKHA 1GQPA 4QXCA 1N1VA 3LPGA 2QVSB 2RR11 4COUA 3ACGA 4TXWA 1AJKA 5A7PA 5FZFA 2HWF3 3FE5A 1O3TA 3KGZA 3VBUC 3I2HA 3V64A 4YNIA 1LOGA 1NA1A 2WNUA 1RUJ3 3UGFA 2J1UA 2KA3A 5T5PA 4YGDA 1IOAA 5JMCA 1FMD3 2F4PA 3MIFA 3ZX7A 4AAPA 2CGOA 2PLV2 3H7JA 1DBNA 4GALA 2R1BA 5DXDA 1HB1A 1BHGA 4KG0A 4D94A 4HKWA 2YBSA 5CYYA 1ODNA 5IVEA 3GHNA 4FVVA 2X09A 2ETEA 4FPHA 1U5IA 4OHWA 1RUF2 4WM8B 3K3NA 4XEZA 1W6MB 1W8UA 2WSVA 4KWJA 5LY2A 1VE0A 5CAZA 2ZZJA 1FAYA 4YW4A 2JKXA 3ZXJA 5GZCA 2A70A 1QOTA 4Q0SA 3AZYA 4KWLA 1F5FA 3M8LA 3KCYA 2VMGA 3O5SA 1BK0A 3R4UA 1SMVA 1V6NA 1MS8A 4CXXA 5IATA 2YBPA 1UZYA 1K3IA 2OPWA 1E57A 2D3PA 3LF7A 1GNHA 2H6CA 2RS51 4QX7A 5FMBA 1H8TC 4YW5A 1R092 3WR0A 4Q4V2 5K4LA 3WV6A 2YPJA 5A6YA 2XVKA 1QJU3 3A21A 3B94A 4DY3A 4QKFA 4JV4A 2RDRA 1OLRA 1CGPA 5GKAC 2HWE3 1OH4A 3LDBA 5DG2A 5DUXA 1HDKA 5C8CC 4XIKA 2CGPA 2VOXA 5HCHA 4IE6A 3UGHA 3K48A 4QU1A 4P08A 1KDMA 5C5UA 2XJQA 3RSJA 1FI2A 1H2NA 1US2A 2E51A 3I8TA 3A23A 4NRMA 4NOTA 3HN3A 3IKWA 4UW5A 5DPNA 3JU9A 4Y1ZA 4GZ9A 1W9YA 5A7QA 3VBOC 1RUH3 2JE7A 1MPXA 3C7FA 3GNEA 2W94A 4FPEA 2BQPA 2OPKA 4MX3A 1OSGA 5FWJA 1AR93 2IZWA 3VHPA 2XJTA 4YZ3A 3ZVXA 2A75A 2XUEA 5LWBA 3KLSA 4FOYA 2ES3A 1T2XA 4ZU7A 4JDMA 2WIIB 1APNA 2X5IB 4MGSA 1BBT2 2DCKA 2NMNA 3EQEA 4CRQA 3AKQA 3R6SA 2FDJA 1CESA 4QWNA 1QMJA 3ZYGA 4B8EA 1E5SA 1EV11 3MV01 1WMXA 3D5OA 1WGPA 2JG8C 1Y9MA 3VDDC 1DQ0A 1ZBE2 3NKTA 1UY4A 3ILRA 4NHXA 5J7MA 3GALA 3ZPYA 1K45A 4Y20B 2FDFA 3POBA 2Y33A 4KMQA 3ZYPA 5DAPA 2FCTA 2E26A 4D6QA 4LOTA 3GM8A 2Z5WA 4XBQA 1BKZA 4H55A 2XVLA 3ZSEA 2D6KA 3E5UA 1JN2P 3KWVA 1A34A 3DEMA 2X05A 3SH4A 1HV0A 2D6PA 3J8F1 5JSOA 4Q4X1 2BGOA 1LOCA 5BNOB 5FUIA 1HRI2 1YC61 2ADDA 2OUHA 4YM2A 2W91A 1CAWB 1WW5A 1I1EA 2JXAA 2HYXA 3MLLA 5F3EA 5JUVA 3E6DA 3PDQA 5SV8A 2D6MA 1ZZ9A 4BMBA 1NCRB 1R1A2 1YWKA 1YRZA 2PQQA 3ON7A 4MGKE 2Q8CA 1N3OA 1I9RA 3ZM8A 2W95A 2PELA 2GMMA 5AC93 2VC9A 3POJA 3KF3A 3HR9A 1QOOA 5FY0A 5C9AB 2HWF1 2DYCA 2A73B 3CF6E 1ND3A 4IERA 1UU6A 5FYUA 4FSJA 1AYN2 4QB1A 4QB2A 4UOJA 4FPFA 4XMAA 3NJXA 4CDQC 1OVPA 4C91A 1VBD3 3VBFA 1S4CA 1S0FA 2GH2A 1DGLA 3A7QA 3WNLA 4IEWA 1KDKA 3DUIA 1QQP1 1AF9A 2RHPA 3T30A 3OG2A 2XLAA 4BYYA 2EF6A 5L73A 1NT0A 2W5FA 3UJOA 1Q8PA 4FAGA 5APAA 2H0VA 2XPJA 4KG8A 4EN0A 1TME2 4JGYC 4COZA 4BM8A 2XR4A 4A42A 5J98B 4L99A 2BWCA 2AUYA 3O14A 3ILFA 3CDZB 1LESA 4XETA 4S2GA 4DPNA 1TNRA 3ZIXA 5FZMA 4Q0QA 2QTWB 3WCSA 3U78A 2FDHA 3WX5A 1X7NA 4RHV3 5BNPC 4E27A 4CTEA 4A3ZA 1FPN1 1UY0A 4Y4RA 2WZR3 5FZCA 1F4AA 3K4DA 4IEXA 4K21A 2BPA2 2VW0A 3HN1A 2LALA 4IGQA 1CAVB 4RS5C 5FZHA 4ZXEA 1EPZA 2VD7A 2Z79A 2IVJA 4IW3A 2W2IA 2NPIA 1PM7A 2BWAA 2JDZA 4ZU4A 4BZ4A 3POSA 5FRAA 1XBFA 4FPLA 1FNZA 1GLHA 1LGBA 3BI3A 1OPMA 4AEDC 3G6JB 4V1PA 5FYCA 3KM5A 1W39A 3CJIA 1CR7A 1S0JA 4GULA 4P9GA 2QQMA 5DZGA 5JI9A 1W6QB 2Y6GA 4CUAA 5A6XA 1OKQA 2B7YA 2W1WA 3H8OA 4YVSC 3ETPA 2EAKA 1YHFA 4XF1A 1NZIA 4D69A 4KGGA 1QJZA 2QQKA 4R52A 1RUH1 3SHRA 3PIJA 3WF2A 2L9LA 2ZEZA 2Q8DA 4TSVA 3H0OA 2WBKA 2Y34A 2E9QA 5FZGA 5FZEA 3K2OA 1O91A 4HLTA 4AQTA 3LPFA 1Q8QA 2VXJA 1WLTA 4Q0VA 2EALA 4S2FA 4XQ4A 2E53A 1OLME 3HMYA 3IZOA 2W0XA 2GZWA 4UYBA 3VZNA 4EZHA 5IAXA 2QQWA 4QPIA 3N9LA 3WG1A 3UGGA 3WNOA 3KQRA 1H1AA 1Y43B 2YC0A 3H3ZA 4N8MA 3WF3A 4E2GA 2HWC2 2NN8A 4HG6B 5EV7A 2O14A 4IEVA 4LBKA 4UFLA 3NNJA 3RWNA 3FWEA 3O1TA 2VNOA 1GFF2 1UU4A 5CZKA 1Z7S2 1AL21 2EIDA 5IVVA 3RZLA 4Q4V3 2FZ1A 4QU2A 2SBAA 2VO5A 5FPVA 4YARA 4RN5A 5JI7A 2ET1A 3OBAA 4YPJA 3ILNA 1XU2A 2JE9A 3VLBB 2WA4A 3SCFA 1LEDA 3U11A 4AI9A 4C90A 3CJXA 3ZYRA 4XJ8A 1ZZ8A 2Q1FA 1S2BA 1Q5OA 2UU8A 1X50A 2YHJA 1RUC3 4RL7A 4Y22A 5FP7A 5DZFA 2FCVA 1C8M2 1KFUL 2BBVA 3SQOA 1Y7BA 3T2QA 1VBB1 1QKQA 5AC91 4DZGA 3BGAA 3I49A 4D7YA 3GHMA 4Q4Y1 3EB7A 5BPXA 2FZ2A 4Z07A 1RUG1 1XSRA 3AZXA 1G9BA 4GA9A 3VL9A 3V56A 4JQRA 1U12A 3DN7A 4Z2AA 3BU7A 1HQLA 5B4NA 5BNOC 3LWCA 1XQNA 2RVAA 3BCWA 2VBPA 2XHKA 1VBD1 5D8AB 3FLPA 4ZS3A 1CX1A 2ID4A 4OHVA 2P1BA 5LZ6A 4CDUA 3W59A 5CADA 3I54A 1NOVA 3JD72 4JRLA 1RXFA 1U5YA 3DPRB 3DV8A 3HT2A 4GWIA 1NCRC 2RS12 2P3KA 4YRDA 1LU2A 4G4FA 1V00A 1SCRA 2ZX4A 4LT5A 5FZBA 4NHYA 2ZX2A 2O1QA 1AYM2 2GN7A 1FATA 4LMFA 1BYHA 1S0GA 4QKBA 5G05L 1V70A 5FZKA 2ZPXA 3WG4A 5E16A 1JYWA 2VQTA 4N43A 4BQ3A 3MZHA 2VMFA 4KWKA 5LRSA 1R083 1CD3G 2EVXA 4JGZB 5A33B 4IEOA 4UW4A 1PGSA 5T54A 4FAHA 2ZGKA 3AB0A 2HWD3 4FQ4A 3IBMA 2PA7A 1EUTA 4BQ4A 3NNGA 1LAJA 4NRPA 2E7QA 4XUNA 1HRI3 1VIWB 3ECQA 5FIXA 4MVTA 2WO7A 1PNFA 2VZSA 1SPPA 1REEA 2IXHA 4HN1A 3S7EA 3KD4A 2WAOA 5K0UB 4XOGA 4NO4A 5CKQA 5JXHA 2GMEA 4INDA 4K1ZA 3O12A 1GZTA 2WT2A 4B1MA 1U0AA 1YYNA 1NQDA 4CUGA 1SBEA 1JODA 4ITCA 3HJRA 4LTAA 4N90A 3MLKA 1X9TA 2XKPA 2CL2A 1DGRN 2YROA 1XRUA 4FT8A 4EE2A 1AYN3 4OUEA 4XABA 5FXZA 1RUOA 1ZREA 1TE1B 1SBDA 4ZS2A 3CO2A 2EXKA 4R8HA 4WZCA 2PLV1 5EHDA 2JECA 5FK8A 4HZFA 3ZYFA 5J09A 4AAXA 4F8AA 1VBC2 2A3XA 4HOOA 4ASMB 1DQ6A 3OGRA 4Q29A 4RGAA 4RR3A 4OUMA 2ZBJA 3WP5A 3RJRA 4XFHA 1TME3 1PMIA 3IMMA 4M3CA 1W9TA 1RUF1 2QZ2A 2V5YA 3K77A 4LLFA 2WFF2 4BQYA 1H1MA 4BWOA 1HQNA 2I2SA 2WDBA 1BMV1 1IHMA 4GKXA 3CEWA 3ASIA 5LBCA 3USSA 2ZZQA 3TB0A 4OQ9A 1JZ3A 2OXBA 2CV6A 1MACA 1DDLA 2RJ2A 1OC1A 1VAVA 1O4ZA 5H9PA 4Z2WA 4NIAA 1W0NA 1OOPB 1QJY3 3N9QA 4I30A 2OZJA 5HCFA 3VUOA 2VUDA 3I97A 2VE1A 4MSVA 1GZWA 1R091 2P6CA 2J1TA 5C7GA 2W3JA 2WAAA 3ENRA 3H42B 4Q4V1 3RZHA 2XBO2 2BUKA 2W52A 2XHNA 3KV5A 4FTEA 2D6OX 1HXS3 2GNDA 5F5AA 1GP4A 5FPXA 1CQ9A 2IXIA 1X33A 3MHZA 2DBNA 3ZN6B 2EA7A 3UKNA 2VZ1A 3AKTA 1TMF3 3RZZA 5IFPA 3C3VA 1CWPA 2PHWA 3ZFEB 2D5FA 1YEWA 5L7OA 5LA2A 4AFMA 4I01A 3ZN5A 5JWPA 4B4RA 5IWFA 4XF4A 2J22A 5EWSA 4DEQA 3J7LA 4A6SA 2K2SA 2IVIB 1T6BX 1S0IA 2WYSA 5F3IA 2QQNA 1QDCA 3ETQA 3MEPA 2XJPA 1CPMA 3OD0A 4YW2A 5IAVA 4DUVA 1ST8A 2R063 2VW2A 4AHXA 3WNPA 3I3MA 3BUCA 4BXSV 2DDUA 3WDXA 3QH6A 4CEYA 3SISA 2BNNA 3TRSB 3POGA 2A7AA 1GSLA 2D40A 1BBT1 3WF0A 4LIUA 3HD8B 3T0AA 2XQRA 4L2NA 1XC6A 3MI8A 2Q1ZB 4QX1A 3LB9A 2PHTA 5FY9A 5DG1A 1SFPA 1YQCA 4HK9A 1N1SA 4LBNA 1MZ6A 4HVQA 1ZBE1 4FP3A 1X82A 3FBMA 4FPYA 2Q8EA 1NLQA 1OD5A 4GH4A 1VR3A 5FPLA 3TOJA 1RHI3 2VM9A 1Y4WA 2A6YA 1F2NA 3LAGA 4E8DA 3S30A 5L19A 4R9CA 2DURA 3B3QE 3KQ4B 3OTFA 2JIJA 4YFZA 2H6BA 2YPDA 2ZX3A 4OZOA 2QQIA 5FCCA 3NAPA 5D8AC 2UWCA 1E5IA 2BRTA 2HLEA 1PGW2 3NQHA 1EYBA 2R042 4LQRA 5F32A 1Y9GA 3T0BA 2VECA 4QD2A 4Q4W3 1HRI1 5EXOA 5FXVA 5ABJC 1YIFA 2KM2A 5FUNA 4WM7B 3E5QA 3QH7A 1CX4A 1NLSA 1YNAA 3DXTA 5DDJ3 1YQ6A 1R1A1 2VPVA 5FV3A 1W2NA 3OBTA 3T09A 4DRRA 1C8M3 4HANA 1BMV2 2FMYA 1UZWA 2D93A 4K6BA 3W58A 5HCAA 3W5MA 1RUI2 3ACHA 4NROA 1LHWA 4YGBA 2JDNA 5FYYA 1GWLA 4CYDA 4XF0A 3VHRA 3ZO0B 5FYZA 5FXXA 4HFSA 4M4RA 1YFUA 4MXWA 2RDNA 4XW3A 3FUQA 1UQXA 1A78A 2ZMNA 3WVJA 4A4AA 1AYN1 2SLIA 1LGNA 2C9KA 2VZUA 4B7EA 2VOVA 5ACA2 3FFQA 2VZQA 1GMMA 1DCSA 2W1SA 3HOBA 2CHHA 3JD73 4AFBA 5LB6A 3L2HA 4AR2A 1Y3TA 4FPGA 1QNYA 5AVAA 3NV3A 1UZZA 1ZZ6A 3LQCA 4YM1A 3RZJA 1TME1 3LZZA 4YM0A 3T2OA 2C6SA 5CFDB 3OOXA 1XB9A 2AENA 2WZPP 2BZDA 3UL2A 3H1MA 3AVRA 5I91A 1ZZ7A 1W28A 2VOWA 2WRAA 1B35A 1JYCA 1REDA 1VAKA 3AL5A 4KBZA 1I6XA 4PI2A 5DAWA 4UW3A 1Q3EA 1QXJA 1F5JA 1PK6C 4XDPA 3WDYA 4YW1A 4CCLA 3IWZA 1LULA 1H0BA 2XONA 4J1WA 5CBLA 4K7JA 5FZ8A 4PBOA 1QH6A 1ZRDA 5FP9A 1OURA 2R0HA 3VL8A 2QFEA 3MW4A 5C8CB 2JDMA 4AEMA 5BXXA 1W05A 3N35A 3OBZA 4MUVA 4H14A 3ZYIB 4CCOA 3FHQA 3OJBA 5IW0A 1C28A 1ULFA 2DVBA 3VD7A 5L36A 5DAVA 1ZBA2 1TVGA 2VXRA 3MUY1 2P3YA 3VBOB 4YZ2A 5JOXA 1G9FA 2RE9A 2IXCA 1CAXA 4UBHA 5FMDA 3M3EA 3ZDSA 2G19A 1OBNA 3I59A 3WINE 1ZRFA 1PMJX 5EPAA 2WC2A 3INAA 2DUQA 4OFGA 3AZVA 1OVSA 1DQ4A 1OOPC 5I8SA 2PHUA 1L7QA 1O4TA 1G7YA 1O4YA 5A1FA 3WXPA 1DZQA 4WVVA 1W03A 4QQHA 4JVAA 1Q8SA 2Y6LA 3EBRA 3FX3A 3RYPA 2V4VA 5FTTC 1IG3A 5FDBA 1DGWA 1SCSA 2JG8B 3VDDB 3JB8A 3VB9A 5FYVA 3V0BA 5CG8A 4P5HA 3AP6A 3MICA 1YJLA 2EICA 3HIFA 1CIWA 5DMYA 2UWBA 4I3PA 2KD7A 2OIIA 4HPKA 3PMEA 4Y1YA 1W6NB 2WFF3 2NYYA 4YM3A 1S2KA 3BYWA 5H9QA 3ZLIA 4D6SA 4TLGA 3N7LA 5FZDA 4E4ZA 1UKRA 1EUUA 1LTEA 3F2ZA 1IKQA 2HWC1 1CN1A 1UX6A 4CDWA 3Q8CA 1BEV2 4XFFA 5AVPA 4NE9A 4CP9B 1XSQA 2ZGSA 3B9IA 2LS6A 1EV13 3M4FA 4HN0A 3RPQA 4XYXA 2UYAA 1Z7S1 4NJ4A 1PGL2 4I3GA 5FYBA 1PVC2 1LODA 1UAIA 3B00A 3ZSMA 3AKRA 4CU6A 2ATFA 2XBO3 3T4HB 3E6CC 2BFUS 3THPA 5CFCA 1GU3A 2RJKA 3ZFGA 1TG7A 4GMP1 1WBFA 5F5CA 5JSPA 1ULCA 3IDEA 5ERLA 1STMA 2VAUA 1H6YA 1KGYA 3IIIA 2B4KA 4KNCA 1W3VA 1FX5A 1DQ1A 3WNMA 2QDNA 3H9AA 3J8F3 5F37A 4MOAA 1C8M1 3H8UA 1LGCA 3NNMA 5I0DA 2VJXA 1FOD2 1ALYA 1IS4A 5E8AA 1CVNA 2J1AA 2BGPA 4CDQB 1W6OB 4C8DA 3USUB 1O5LA 1X8EA 1WLCA 2CWSA 4IESA 2YY1A 1DQ2A 1OQDA 2PMWB 1ND2A 3HBKA 2WQ8A 3NRUA 3DECA 4CPBD 5ANQA 4LXLA 1JOBA 3GF6A 4QDRA 4ET7A 3VKMA 4NIHA 2X10A 3QBQA 1H8VA 1UWWA 2AZ5A 3PLQA 4CE8A 4E2SA 4FCAA 3O1RA 4HMZA 3EHKA 4WM7C 4JGYB 5FYSA 2PHLA 3W21A 4P02B 1RUNA 5EYXA 1ASJ2 2QKDA 3JD71 3UV9A 1O3SA 1W99A 3PUSA 2Q0AA 3SLIA 3OPZA 1YI9A 4LO4B 1DLCA 2RS11 1UZ0A 2Y26A 2HJIA 5K9YA 2UY9A 3M3QA 3VD3A 5IJRA 4XJZA 4UAPA 4CCMA 1AXYA 1AYM1 1GP6A 4I0BA 2BVVA 2LRPA 3JQXA 2VMHA 2VMIA 1REFA 1QQP3 4IV3A 5D2AA 1VJ2A 5CA6A 5BNPB 1K42A 1LOFA 5A6QA 2RV9A 5GLWA 4HL0A 1ZM1A 4RS5B 5LA1A 1D4M2 3QACA 4HSJA 3JBG2 4WVZA 1FV2A 5GLZA 4OHZA 2VBDA 5I93A 2ZHMA 4FOWA 1WWYA 4PJYA 3FC0A 1VALA 3OUHA 3ZPOA 1S0CA 1A3KA 4ATFA 2CU5A 4AEDB 3V0AA 3H1WA 2O8QA 2ZGLA 3IT8A 2A6WA 4UW6A 4O9EA 3LIHA 3BOWA 1OI6A 4YVSB 2X5IA 2E6VA 2JB8A 1UY3A 3POEA 1FPN3 4XFIA 4Y4YA 1G8WA 2XLGA 3BTXA 4FTBA 3ES4A 1NYWA 1NX9A 5EJZB 4UFIA 2W39A 1E5RA 2P3IA 1OQEA 3P3NA 3THTA 1GBGA 3N7MA 2VOTA 1J58A 2FMDA 1MQTC 3B5LB 3LGRA 3ZR5A 5BNQA 4J1XA 3PTYA 1AR72 2OZ6A 4MHRA 2GNMA 4QPGA 1AZDA 4DIQA 2CYFA 1XYOA 1NKGA 1YUDA 2B8MA 5FZ1A 2YZ4A 3WDTA 4AZZA 1D4VB 2RJLA 1VMJA 1SLCA 1VBC1 2B5HA 2B45X 4CXWA 1BXHA 4LHNA 2WA3A 4QQOA 1TQ5A 3P6BA 2CDPA 1DLLA 2YDEA 4NPMA 1UXXX 3RYRA 1JYTA 4KGQA 3TYJA 2P4EA 3N9PA 4HXCA 5FQ0B 3WQ7A 1RINA 4AK3A 3VBSC 5CG9A 2GNTA 1JUHA 2PXJA 4GWMA 1QWRA 3PUAA 2ILMA 1ZNPA 4HK8A 3ZYJB 4AW7A 4PIYA 2WFF1 1D0HA 3JZVA 4RQPC 1CZVA 3MO4A 4FFGA 4QX3A 5DN2A 1J59A 1GZCA 4QHBA 1GOFA 2B42B 5E1RA 4IE5A 4CDXA 4MGTA 4EZ4A 1IPKA 1ULGA 3NVCA 4AVBA 4EWAA 2DWRA 1H4HA 4YVWC 2EIGA 3I2DA 5BNNC 2ERFA 3ES1A 5C3SA 2XH6A 1NLRA 1OA2A 5DUUA 1PIV2 2JG9C 3NNLA 5M0TA 1XPWA 2ZHNA 3MF9A 5CIRA 1AR82 4GQ7A 1MZFA 2XBO1 4ZXKA 3Q8BA 4IEUA 3HWJA 4OI0A 2D44A 3GBWA 2E31A 1K5MA 1ZA7A 3AL6A 3ZXLA 1J3RA 1H30A 1MS5A 1AL23 1PNGA 5I0TA 1VLNA 1HB3A 5FOBB 3O0VA 5FYMA 1RUD2 2ZX1A 3AP7A 3DKWA 4XF3A 3O1SA 2RM22 2GC2A 1MVQA 1UZVA 4NHMA 4O7XA 3BIWE 2C1FA 5FUPA 2JKBA 3T1MA 1JYNA 4XUOA 4GJYA 3M7AA 4E4DX 4HKLA 4ZKTB 1UMZA 5DAQA 3U14A 3FFZA 2VQ0A 3C7EA 3WNNA 2ORXA 2WLQA 4QXBA 3POIA 3H3LA 1ENSA 4PIZA 4QM9A 2HKXA 3G7DA 1VBB3 5JLVA 1K5JA 2ADEA 4BK4A 4FBFA 3MGUA 3AMHA 1GZ9A 3WQ1A 2JIGA 1ODMA 4Q4Y3 3BVCA 2Q1MA 4QPYA 1RUG3 1QJX2 3I4IA 5C3OA 5F3GA 2DCTA 4AF9A 2VTXJ 2WSUA 3D3AA 1EP0A 5IYYA 1BZWA 2F17A 1V0AA 1DZRA 1V9U2 5EP9A 1CAVA 5BV6A 4CEWA 1CZSA 1CONA 3LEIA 4K3UA 3VD4A 2VTXA 1GQHA 3SNMA 4TTGA 1PVC3 4UF0B 1N3PA 5DUVA 1O3RA 3HQUA 2WL1A 1PGW1 3O1VA 2FD8A 2R041 1W6QA 2OA2A 2EAAA 4R9DA 4OZXA 4PF5A 4RFT0 5FY4A 2DU1A 1LOAA 4C1XA 3WW4A 3AXDA 1X9PA 3EJKA 1VAMA 4XZUG 5EZWA 3WD5A 5E6HA 3U10A 4QX8A 3VZKA 2JX9A 3RNSA 2XWJB 2EXIA 2TUNA 1LHVA 1CJDA 1WCSA 3E5XA 4OYUA 1JOJA 3LSEA 4XAAA 1COV2 5FXWA 3C7OA 2VQAA 2GC1A 3PU8A 1YIPA 3WF4A 4V2WA 1RUI1 4OQ8A 3MPPG 1W8NA 2BTVC 5T5LA 2HBTA 3ALQA 3FMGA 3B02A 2G9ZA 1US3A 4AGVA 3VBRC 5IVBA 4PQQA 5JOWA 3UKVA 2QQVA 3BTAA 2Z4FA 2D6NA 3OB8A 4NPRA 2WWSA 4LBJA 4BLIA 3POWA 3M2MA 3ZSLA 5A32A 1XYNA 4IV1C 3GZTB 5CFCC 3M3CA 4O9GA 2KXLA 3ZFGC 4NVPA 2WZEA 5ACA1 1ZRIA 3PMSA 4I0WB 3W9AA 4DUWA 5JOYA 4CA9A 3OD4A 2Y6HA 1ASJ3 1XU1A 1VMHA 5A3MA 4YW3A 4TZDA 1OA3A 4KWUA 1XNKA 3CHXA 1AR62 3MFAA 3P3PA 1ZYBA 4PDWC 1IKPA 2UY8A 4WVMB 2XB6C 1DYKA 1DYOA 3LOIA 1O7FA 4KU7A 5LBBA 3E6BA 3AK0A 4XACA 2PLV3 1WMDA 2Y6JA 3VD5A 3UK9A 3KV6A 2JJ6A 2A6XA 3J4UH 1ND2C 1GNZA 2VR4A 3KCCA 5A80A 4DB5A 5I8TA 1IS3A 4LBLA 4XFBA 5KC6A 1D4M3
chains in the Genus database with same CATH topology
1ULDA 1YXWA 1RUF3 4WZFA 4FPCA 5C8WA 4BLJA 1DGWX 3MYXA 3WG2A 1RUE2 1U5ZA 3AMNA 2OW4A 3DL3A 4FPKA 1NA1C 4A7YA 3AM2A 4WVWA 2WNUC 4Z82A 4BIOA 1H2KA 2R32A 2PAMA 3SCHA 3ZN4A 4QT6A 1ZBA1 4P9XA 1C1LA 4PIXA 2HWB2 2R072 2XKOA 1R093 1EAH2 1LOFC 4X8NA 3IMNA 1IZ3A 3AYDA 5BUVA 2WNVA 4LLOA 3ACLA 2PN5A 3K51A 1OFNA 4B29A 4GWNA 4AI1A 3AFGA 3ZXGA 3DGTA 1O3QA 3AYCA 1HX6A 1LJ7A 2CNAA 2QJVA 3B9CA 3APBA 4L97A 4JGZA 1SLTA 4L11A 4S2HA 2VUJA 2ZHKA 4AE2A 2FHRA 2VNRA 2PHRA 3ZXEA 4QGLA 3O0WA 4A3XA 1D2QA 1BBT3 1OHFA 1BEV1 4MGYE 3J9SA 2PHXA 3E97A 2GC0A 2JD4A 2WNEA 3NWKA 4QPGC 1PGL1 5ABJB 1UU5A 1PVC1 1ZBE3 4TYSA 3IPVB 4H3WA 3HQXA 4ATEA 2G9FA 2GMPA 2YXSA 4QPIB 3VN4A 1MR5A 4IL7A 2IFWA 4BQ1A 1MS0A 4IQPA 1HKDA 1Q8OA 1HV1A 3C2UA 1J3QA 2VVDA 1POV1 4RSUA 2H0BA 2P17A 2GN3A 4QMAA 1VBA2 1AHSA 1DU3D 1WMEA 5F6KA 5C4WA 1ENRA 3U4XA 4ISRA 1FOD1 2EXHA 2ZMLA 3A0NA 3SXWA 1C3HA 3H7YA 4AEJA 4JDOA 1TEIA 1V6OA 3MIGA 4COYA 3CL1A 1R1A3 3D8CA 1HLCA 3MLJA 2Q30A 2DFCA 2PYTA 1Y9QA 2QQPA 1ASJ1 3B69A 1A8DA 4Y1XA 1OLQA 2QDRA 2AH2A 2DCJA 2QNKA 4YG6A 1RJ7A 1PO12 3ROUA 5J36A 1V9U3 4XZPA 1L3JA 1PK6B 5JIAA 1QHDA 1RMU2 3TN92 3ZN6A 3EXUA 3FLTA 5I8YA 4XTPA 4PLOA 3ZFEA 3U07A 4AFAA 1AXKA 5JDBA 4K8FA 3SCGA 1D4M1 1O5UA 1WW7A 3JBG1 4KL1A 1S0EA 4WBBA 5FO8B 4M0NA 1RIRA 4ISQA 4D3WA 2XLFA 1JXNA 3WNXA 4N43B 2YUEA 5JZGA 1ND3C 3MDPA 5CU1A 3R4DB 3AKSA 4PLMA 4Q0PA 2ET7A 1PO22 3VBFC 2BNOA 3D6EA 2GDFA 1AL0G 1YI7A 2I74A 3KZ4C 4LO7A 2RMU2 5JIUA 1NCQA 1CAUA 2O8OA 1YCIA 2WJSA 2NZ9A 3JB4C 5FMOL 4Q8KA 2HEVF 4DNYA 2FQPA 2G4IA 4N9IA 1YFYA 2UYBA 2MEV2 1AR71 2PAEA 3RMYA 5KHHA 1V6LA 4K40A 1JHNA 3AYEA 3WCRA 4I0AA 4DRVA 1BQPA 1GANA 1PZ7A 2ARBA 4Y1VA 4LNVA 5FO7B 2MHFA 1EY2A 3T2TA 4IEQA 2ZTNA 2PTMA 3KMHA 4U36A 3SITA 5LEKA 4KQ7A 3AYAA 5KXDA 3KCXA 1ZA4A 4YZ1A 3KT4A 3DF0A 4SLIA 3VBUA 4PQ9A 1I3HA 4MYEA 1PIV1 4AQSA 4N7IA 3RRDA 3OCPA 4LE3A 3CJIC 4DQAA 1RUE3 1AR81 2CTVA 5FO9B 5KHGA 2HWC3 1WLWA 1PZ8A 2RS32 1U5XA 4BMEA 4XJ9A 2NM1A 4HKOA 3MW2A 5EYYA 1Z7S3 1VRH2 1WW4A 5I0RA 1RUD1 3M3OA 4RA0A 1IS6A 4HT1T 3WY6A 4AEKA 5HBAA 4MV2A 3AP4A 4GMP3 2RM21 2NLRA 1G9DA 3SH5A 4XE9A 4Y5Z0 4DY5A 1NY72 4ASLA 1RUJ2 3RQ0A 3UJQA 4QPIC 4XILA 1VBE2 1FMD2 3LOBA 1Z0HA 2DVFA 1H8TA 5T52A 4M3CF 4LULA 2IXJA 4XFAA 4YSFA 4YZ5A 2IXLA 2WS92 3AMQA 1JTZX 4QQLA 2DCZA 4FOQA 5EFUA 1QJX1 2QZ3A 3VZJA 1MS1A 1ZVFA 2WNVC 4BA6A 3WDUA 1V9U1 5C8CA 1NXMA 2ZGUA 4PBPA 4YZ4A 5FFOC 4XXAA 3RI9A 3WP3A 1ONAA 4M0HA 2OUJA 4P9JA 3VBOA 4H7MA 2RS13 4C0BA 1MEC2 1J3PA 3N36A 4HSLA 1AYM3 3FJSA 2XL9A 4QXKA 3HT1A 3O0XA 1F8VA 1YO8A 4N53A 4W6WA 4XXPA 1QJU2 5GLTA 3MIEA 4HBNA 2I45A 1RL3A 2HWE2 2GSYA 2JG8A 1COV1 3VDDA 2E7TA 2A71A 1OFSA 3NAPB 4EWDA 1MQTB 1N47A 1C8NA 1IGOA 4CDUC 2CGNA 2ZACA 1W6PB 1QOSA 2AREA 4EN6B 1FXZA 4AYUA 5F1RA 1AR92 3S6PA 1LECA 4YG3A 1KITA 4P9WA 4K9SA 3OYWA 3LA2A 3LCPA 2A5ZA 3VBHA 3VBSB 4N43C 2D7FA 5J3UA 2A6ZA 4ES9A 1AR61 4RQPB 4XQDA 4MXWB 2WT0A 5GZGA 1AUYA 1QNWA 3T1LA 4LBQA 5C4WC 1Q56A 4LUMA 3FLRA 1XE8A 3ZFFA 4XDQA 4YVWB 5BNNB 1RMU3 1H9PA 4LA3A 5D1IA 1VBC3 4AG4A 3MIBA 4OUSA 2JG9B 2VW1A 2Y0IA 5JPMB 4Y26A 3NL1A 4IEZA 1GYKA 2ZAHA 2ZCWA 4HETA 2DU0A 4BE3A 2Z2SB 4LHKA 3URFA 4AVCA 1AX1A 1W6OA 4CDQA 1DYPA 1RUE1 4X8PA 1H9WA 3RYKA 1WBLA 4FOVA 2CAUA 3VZLA 4UBGA 1PO23 2DVDA 5GZEA 4JTNA 4XPVA 5KC5A 4YGEA 3RDIA 2HWB1 2R071 2ZOEB 3QOPA 1EAH1 1IPJA 1SLIA 2C0ZA 2R0FA 2CY6A 4RR3C 5KWRA 2V09A 2Z42A 2Z69A 3VZOA 1NE6A 5GM0A 2YV8A 3OY8B 2MEV3 1S0DA 2F6BA 1G9CA 3R4SA 4LA2A 2Y38A 1LHUA 4OI2A 3ELNA 1AXZA 3BPZA 4X6RB 5FLIA 1FV3A 2ZGMA 3CNAA 5F9TA 1M4WA 1QY4A 2WKKA 2ZGTA 5T50A 3LSDA 4I02A 5KXEA 2E63A 3Q9OA 4B4QA 2OVUA 1LCLA 4WM8A 1NCQC 1W6MA 3ZMNA 4W65A 2AYHA 2HYKA 2D5HA 4AEDA 4TLFA 2YGLA 5H9RA 5CFDA 2EXJA 1DHKB 5SV5A 4IXLA 3PJQA 1DQ5A 1H2MA 4Y1UA 4BOWA 5E88A 3WW1A 5L7OC 4RHV2 3KB5A 3NSTA 4XFGA 3POYA 1HQWA 2ZGQA 2WZR2 2HEWF 5CB7A 1ZX5A 2TBVA 4BCUA 3L9JT 2XJVA 3TNPB 1HIXA 1VBA1 4CEYC 1LENA 2ZKLA 3VBRB 5JSRA 3MFCA 3RMXA 3WHUA 4BHPA 2R043 1A8MA 4IV1B 2LTNA 5CFCB 3ZFGB 5KXCA 2P2KA 5FQ0A 2ZHLA 1VBE3 2WINB 2MPFA 2VUAA 4GH4C 4PDWB 2Q8OA 1YJKA 3CLPA 5KBFA 5FREA 1RUI3 5FBZA 2WS93 4OHXA 2JICA 4GB32 1QF3A 1LR5A 3AX4A 4XHXA 5JCTA 4NHLA 1ND2B 1XNCA 1PO11 2ZX0A 3NAPC 4K20A 5IT6A 4JAAA 1NQJA 4EN8B 3JQWA 5ACA3 4Y20A 4K1YA 1RMU1 1PZ9A 3TN91 3MIDA 4PCRA 2NP0A 2VVFA 1AJOA 1MS3A 1QU0A 2BNMA 3JCIA 4IEPA 2ZGRA 1MEC3 2XJSA 3JUUA 1NA1B 1M06G 2WNUB 3M1HA 5FLJA 2CAVA 4EWEA 2A6VA 5BNOA 2D97A 1XNBA 4N9HA 5FOJB 4MXVA 3X29B 2ARXA 4IV3B 2DCYA 1POV0 1CAWA 4XIOA 4F83A 4JC1A 3D4KA 4KH9A 1NCRA 4E9KA 1PO21 2XWBB 1RUC2 1RJ8A 1C5HA 1G6NA 2RMU1 5C9AA 1RB8G 1WMFA 5DUWA 3B93A 3V0AB 1EPWA 3VHOA 2ZABA 3VGIA 1DG6A 3N4MA 1R1ZA 4NWVA 2MEV1 3LA7A 1ZBA3 3D0JA 4Z8BA 5J48A 5HI0A 1H4GA 4N53C 1LEMA 1UPIA 2P37A 3TNQA 1SQ4A 1B35C 3UKTA 4PLNA 1RVF2 4FXKB 2R49A 2D3RA 4Q0UA 4ES8A 4MGIE 4C1WA 4AVTA 4YYOA 3IM0A 3NV4A 1H2LA 4FO9A 1UW8A 4G9SB 4KBBA 4QPGB 4LO8A 4Z1VA 1G86A 1UIKA 4Q26A 1R082 3ZIWA 3A0KA 3VBHC 2HWD2 4QQ2A 4ZU5A 4Q1PA 4OI1A 3R05A 3OGJA 4YG0A 1ENXA 4QM8A 2RS31 2OYZA 4CDXB 1BEV3 3A4UA 1VB4A 2R1DA 3VKNA 3ZFFC 4DFSA 4SBVA 1D2SA 1LOEA 1VRH1 2WQ4A 4OULA 3MPBA 1XNDA 4F7ZA 3AJZA 3J26N 3HAGA 3ZXKA 3H50A 3MW3A 1GR3A 5T5OA 1SLBA 4JTOA 1HRV2 4WVMA 5IK5A 1F31A 4LR4A 1YFXA 1K5MB 1POV3 4EV0A 1KD7A 1NY71 3LA3A 1RUJ1 4GKYA 4AFCA 3PHMA 2PHDA 3NKGA 4M3CE 1VBE1 4Q2FA 5F5QA 1FMD1 1I5ZA 3NV2A 4OI4A 4CDWC 5IK4A 3H3UA 1FOD3 5A3LA 2WS91 2YMZA 3SH3A 1JBCA 1X36A 4U2AA 4WV8A 5DZEA 4URTA 1OMIA 2QE3A 4LEJA 5LRRA 2VVEA 2VH9A 4ONUA 4LBOA 1WCDJ 2JENA 4J6GA 1UF2C 4M01A 1MEC1 1QJY2 3IDCB 3RI8A 1ND3B 1SFYA 2PHFA 5T5JA 3BALA 1MS4A 4EJRA 4IETA 5IUQA 3VBFB 4CEWB 3RG0A 1PHMA 3FZ3A 1N1TA 2NQYA 4GXLA 3KT1A 1QJU1 1HXS2 1QGLA 2XG3A 4WM8C 1SACA 3GZUC 4JDNA 2HWE1 1IQAA 4HVRA 2LUWA 1TMF2 3ZXFA 4BPZA 2VULA 3JBG3 5CFDC 3TAYA 5CNAA 4MGZE 4LUKA 3TWIA 2YYOA 2ZGOA 4COVA 2JEMA 1V6IA 4JRAA 5BY5A 1BVP1 4L9BA 5GJ6A 1LKNA 2R062 1AR91 3M3IA 2IWGB 5D8AA 4GB33 4IV3C 5GALA 1QXRA 5JPNB 5ABJA 3DPRA 3IPVA 4R9AA 1KS5A 3QCWA 3FUOA 3L2YA 5A32B 3ATGA 1AR73 3OBRA 2GNBA 3GYDA 3NO8A 5JOZA 3PVOA 1J1TA 1BJQA 2ZMKA 1RHI2 4FPJA 4AGRA 2BGCA 4D7TA 2DTWA 3CJIB 3GZAA 1YLLA 1ENQA 4M00A 5A33A 3NJZA 3D82A 3GBGA 4AI8A 2B39A 4IEYA 2X5IC 2W08A 1UPSA 3LKJA 1URXA 2IC1A 1RTVA 3KSCA 2IFRA 4Q4W2 4NWWA 5K0UA 3ZXDA 1FYUA 1OQ1A 1G9AA 2ENRA 4F3JA 4KU8A 5JVVA 4CP2A 1S1AA 3PVNA 5DDJ2 1PIV3 3WDWA 1SLLA 1AR83 2R30A 5KHJA 2WQZC 1WD3A 5F6LB 2GH8A 2D6LX 2XL7A 5HCBA 2TEPA 4CP0A 1B09A 2X29A 2DTYA 2ZGNA 3VHNA 3VZMA 2XUMA 4EN9B 2B9UA 4G3YC 3OF1A 2C5DA 5J37A 1WD4A 1PK6A 1C4RA 3S7IA 1RUD3 4XJUA 5AFEA 2D43A 1RVF3 4CDXC 2RR12 2AGSA 3PNAA 4AI2A 4XQWA 2RM23 2WNVB 1DF0A 1DIWA 3ZXAC 1C57A 2BVBA 5KXBA 3ZSKA 2P3JA 5C9AC 2R16A 1FT9A 1NXD1 4Y22B 1K5MC 3CU7A 3VKOA 2ZKNA 1ZZBA 4FTSA 2YGMA 1NG0A 2B46X 1OOPA 1QJX3 1LHOA 1UKGA 4NR1A 4CP1A 4RHV1 2VU9A 4P9LA 4DXZA 4S2DA 2WLPA 3IIAA 1UN1A 2WZR1 5I0UA 2DV9A 2O0OA 1ZZCA 4L92A 4NN0A 4DINB 2I07B 1C5IA 3H1YA 2LM3A 5T55A 3IDBB 4CDUB 1W2UA 2GC3A 4AFDA 1TNFA 3AP9A 2RS52 4R4XA 1HRV3 1F9KA 3N7JA 5GLUA 3WDVA 2PAKA 1BK1A 4GMP0 4MH0E 1UIJA 2XGXA 5FPZA 5TSWA 4AHWA 4DS0A 2HEYF 4W6XA 4N7UA 4Q1RA 4AVVA 1COV3 3WW3A 4CEWC 5C4WB 4YGCA 4XMIA 3O7OA 3N7KA 3N3HA 1YFWA 3NV1A 2VOKA 4GB31 4FP2A 1JUIA 1RC6A 2UURA 4OHYA 4LO6B 1DGRA 4LE4A 3AMMA 1LOBA 1UCXA 4TWTA 3WHTA 3VKLA 1S0BA 3M70A 2K0GA 4LO5B 3IN9A 2GU9A 4A7KA 2A3WA 1CPNA 3KGLA 3ST7A 1AR63 3QLQA 5H9SA 2MNGA 1W0PA 1LU1A 1EV12 1X8MA 1WLDA 3AMPA 4LHLA 1KRIA 2VNGA 2DVAA 1HW5A 1ULEA 4WM7A 3MIHA 5GLVA 3AFKA 3AZZA 3TBDA 4RR3B 4AHYA 4RGGA 2DFBA 1WCKA 1Q43A 1RUC1 2QCSB 5IK8A 5JR7B 4QQPA 4OVEA 4M3CB 3J8F2 1BCXA 4Q4X2 1JW6A 4DOUA 4Q8LA 5IK7A 2X8KA 4XFCA 1IS5A 2DUOA 5EJ3A 3S0MA 5JZGB 1XE7A 1GICA 4XJAA 3WUDA 2BFUL 4C0HA 2BW8A 3RJ2X 4LBMA 2HWB3 2R073 4EROA</