5D21A

Multivalency effects in glycopeptide dendrimer inhibitors of pseudomonas aeruginosa biofilms targeting lectin leca
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LecA
publication title Multivalency effects on Pseudomonas aeruginosa biofilm inhibition and dispersal by glycopeptide dendrimers targeting lectin LecA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 21
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 5d21A00
1UOJA 2O14A 1GWKA 2LRPA 4LKDA 4LK7A 2KR2A 4LJHA 4LK6A 1W8UA 3F95A 2Q1FA 4YWAA 4A6SA 4YW6A 3ORJA 1WCUA 1W8ZA 1WMXA 2C24A 4LKFA 1OKOA 4AL9A 2LROA 4CP9B 1W8WA 1HN0A 3ZYBA 2K46A 1GWLA 3ZYFA 5D21A 1OH3A 4BQ5A 4LKEA 4CPBD 4BQ4A 1W8TA 1WZXA 4YW7A 1W90A 1GWMA 1V0AA 3ZYHA 2WYFA 4CP9A 1W9FA 2JWPA 2VXJA 4BQ2A 3UT0A 4CPBA 4BQ3A 1L7LA
chains in the Genus database with same CATH superfamily
2IXKA 1WCQA 2YXSA 2QQVA 1QF3A 2KR2A 2WFPA 2XQRA 4L9BA 5FYVA 1RUF2 2WO3A 1G9BA 5CFDC 1E5SA 4AI0A 4QXHA 2BOIA 2BV4A 3QH6A 1XPWA 2ZGUA 3JD73 1PGW1 4FPGA 2HWB2 4QT6A 5GZFA 3VBOB 1YEWA 3DUIA 2R1BA 4NHMA 2R062 4XF1A 1JHNA 3B94A 1FMD1 5IAXA 4N53B 4XC9A 3WDVA 4AEDB 2J1AA 5FZ1A 1DDLA 1CVNA 1YQ8A 1QJY2 1D0GA 3B9IA 1UY0A 1AR93 4FPEA 2E33A 2VZTA 1F9KA 2VUAA 2BFUS 4EWDA 3I3BA 4CCDA 3JUUA 4LR4A 5F32A 1NLSA 1I6XA 1G9AA 2WT1A 4BXSV 2CWMA 5BNPC 4H7MA 4R52A 3SMHA 2G9FA 1W2TA 2KA3A 2RM23 2BNMA 1W6PB 3WP4A 5KR7A 1J59A 3MFAA 1XXNA 2GH2A 3VDDA 3A0NA 5GKAC 3PUSA 4A42A 2YB7A 4DS0A 1LNSA 1J58A 4OMCA 2D6PA 5LY1A 2F17A 1A3KA 1J3QA 1UAIA 5IVYA 4WV8A 4Q4X1 3O0WA 4EE2A 3VDBA 2WAOA 1OT5A 1F4AA 1F4HA 2UWCA 3BODA 3N3HA 2NP0A 2YBKA 2Y64A 3DPRA 4FXKB 1KEXA 1GOHA 4W65A 5FP4A 1H8TB 2CHHA 2D5HA 4COWA 1KJLA 4MADA 2JDNA 3N7MA 4JVAA 2A6VA 4Q0QA 4LBQA 4LHSA 2QUOA 1BEV3 1G86A 1W6QA 2UY8A 2Z69A 4V1PA 1KRIA 4AVSA 2AUYA 2QZ2A 4GH4C 4XTMA 1BVP1 4NIGA 4H3WA 1NE4A 5EHDA 3O1TA 2QQMA 3J8F1 3N9OA 4AFBA 1DYPA 2W1WA 2YDEA 2RMU1 4RGKA 3L2HA 1YFUA 4G9SB 1NCRA 2PYTA 4B7EA 1UPIA 3BN6A 1CJDA 2HWC3 1BMV2 5E8AA 5FMDA 1QNWA 1AYM1 4P9XA 4QAWA 2WZPP 1S2EA 1AXKA 1N47A 3KMHA 3ZO0B 1UYZA 3K77A 2RJLA 2DTYA 2GC3A 2HWF2 1UX7A 2RS12 1AL23 2VPVA 1AJOA 3UNPA 3I54A 5C7GA 3K2OA 4FO9A 1PO11 3UK9A 3SEEA 4AVCA 3S57A 2IVIB 4A6OA 4AI3A 1LRHA 1POV1 2ZGRA 3POGA 2E9QA 2EIDA 3KCCA 4DUVA 1WMXA 4B29A 1RGSA 1V6MA 1XBFA 3IDEA 1PIV2 2K9ZA 3LFIA 2BVBA 4FQ4A 5L9BA 3USUB 4GD4A 1IPKA 2N7GA 2OZ6A 3HBKA 3DF0A 4Z8BA 4N43A 2EIEA 4QPWA 1LB2A 1OLRA 3KZ4C 3KV5A 2W1SA 3VDCA 5K8SA 5ISLA 3AZXA 1MQTC 1W8HA 2XJRA 2ZEXA 1VBA3 2AEZA 3K46A 3POBA 4XFBA 2FDGA 1ND3C 1R092 2QQIA 5FZLA 1POV0 4XBNA 3J26N 1PO22 1DLCA 1UOFA 3LDKA 5EXOA 1XSRA 5J3UA 1I5PA 1W6MA 1QJX3 1VRH3 5A3TA 1O3SA 4YVSA 5JCTA 4DEVA 1YQ5A 3I3MA 4WVMB 1QOSA 3M3QA 4CCKA 1LOFA 4GWMA 5KHJA 2GC0A 4LHKA 1OH3A 3JQXA 3ITQA 1HRI1 4NAOA 1QDCA 3E6BA 5L19A 4KH9A 2QDNA 4HT1T 5KHHA 1CZVA 3VBSA 1Q3EA 4HKWA 2DTWA 2P4EA 1PNFA 2QQUA 3LGRA 4RHV2 4QB1A 3WNPA 2J7MA 2C1FA 1DU3D 1AX2A 2HWB3 3PVEA 4CDWC 2R071 5FYZA 5LATA 1IPJA 1UYPA 1K5MC 2JE7A 4AG4A 1ULCA 5LA1A 4A2UA 1ODNA 4YW2A 3O1PA 1QJY3 1WW5A 4XDPA 2XHNA 2CL2A 4MHUA 2YYOA 4FP3A 3RJRA 4CUGA 5LBFA 1OQEA 4LQRA 2A73B 2W1QA 4P9YA 5FZ0A 2ET7A 4E9KA 4JKLA 3KQRA 1V0AA 4X6QB 5K0UC 1IG0A 3FUOA 4PDWA 2YG0A 2VMIA 2OQ6A 2PMWB 2WNVC 1XYPA 1BZWA 2NN8A 1XNDA 2ZOEB 3AVRA 4AI2A 5CISA 1U5IA 1GQHA 1AR81 4FPHA 3ZIXA 4Y1VA 1C3HA 3LOBA 2JJ6A 1VBE2 2TNFA 2J1RA 4C90A 3SNMA 3J7NA 5TSWA 4B3NA 4XUNA 1DGWA 1UIJA 4M3CB 4LLFA 4AQTA 4NO4A 3GF6A 4FAGA 1Q43A 5FZKA 2V5YA 1OKQA 1Z78A 2VOVA 1I5ZA 1QQP1 1OH4A 2WABA 2ENRA 3WHTA 2XPJA 2WC2A 1NLQA 3VD9A 5IATA 2ZS6B 3OBZA 1ZM1A 3NVCA 1UMIA 5IJRA 3L9JT 1G8WA 4OHYA 1Q56A 1YO8A 1W3VA 4Y5SA 1OMIA 5ANNA 4BZ4A 1MZEA 4I0WB 1JYTA 2P1BA 2V72A 5GLZA 2JICA 4K20A 1ZRRA 1LULA 3CJIB 3FUQA 5J36A 2PAMA 3EB7A 4W50A 3C8XA 5C6CA 3PUAA 5BNPA 3IAPA 3MO4A 3WDWA 3K4AA 5C3OA 2HWF3 1FNZA 3PIGA 1HQLA 1IKQA 1F35A 1QDOA 1QOTA 2RS13 1K3IA 2VE1A 3HQUA 4HZFA 4KGGA 5FPBA 5FZFA 5FZEA 3VZJA 3HVDA 3WR0A 1IQDC 3SQOA 1K5JA 4AAXA 1Q8SA 3ZFEB 3S30A 2ZHNA 3V0AA 5EYXA 4LPLA 4FCAA 2D6NA 4AVAA 3OGJA 1ZBE1 2D44A 1DQ5A 4IETA 1PGL2 2VW1A 3TEZA 1PIV3 3CDZB 2XVLA 4YGEA 4COYA 3PMEA 4LBNA 3T1LA 1E5RA 3PU8A 5LK7B 3VBOC 1O6UA 1VBC3 1WMFA 5FY8A 4YARA 2XBO1 1QU0A 4GH4A 4KGQA 3WW2A 5AC92 2ZGOA 2WBKA 2CTVA 1AR61 2PLV3 5FCCA 2AREA 4N53C 1GKBA 1TG7A 5CKMA 4AEDC 3GZTB 5F37A 2RJKA 2DBIA 3V0BB 2D6MA 1QOOA 1RUG1 1DG6A 4LBMA 1UOGA 1Q8PA 4Q4W2 3RYPA 3J9SA 3O0VA 2OUJA 2NPIA 3ZKYA 3HPNA 3HR9A 3AC0A 3GXUA 5IVFA 2E7QA 1GP5A 4QDRA 2W87A 3H1MA 3M4FA 5DDJ2 4O61A 1UN1A 1H30A 4ONUA 4LKFA 2WFF2 2W1UA 1AR71 2VVEA 2QQJA 3WNKA 1C8M3 5C8WA 2A70A 3HWJA 5LEKA 2FDFA 2X5IB 2ETEA 2PHDA 4HSLA 3H3ZA 4MGSA 2FBEA 3AZWA 4RHV3 2ES3A 3WNLA 3VZMA 1NY71 2JX9A 4KBZA 3RI9A 3THDA 1GICA 4I09A 2PQSA 3VBUA 4EN0A 4Q0UA 5LEJA 4GMP3 3BGAA 1TNFA 1W6OB 3DXTA 2Y6KA 4QHBA 2FMYA 1FPN2 4D6RA 2VBDA 1C5IA 1OA3A 3H3LA 1ULEA 3OEBA 3PUHA 1H4GA 1MQTA 4MYEA 2NMNA 4IEYA 4IV1B 3VZLA 2Y0IA 2GZWA 2BWAA 1COV3 2RDRA 3NL1A 4OI4A 1ND3A 1SBDA 3ZXDA 4BIFA 3B69A 3MHZA 4LA2A 2OS2A 4E2GA 2BNOA 4QGMA 3MFCA 1GQPA 3SXWA 4LTAA 2ATFA 3WT3A 5FP9A 4CEWB 1R1ZA 1HX6A 3BCWA 1Y4WA 5FUNA 3VKNA 2YC4A 2DU1A 5FBJA 3O1MA 3IN9A 1OPMA 2WWJA 3RZZA 2CYFA 1FNYA 4AGRA 2HBTA 4IGPA 5F5CA 4XACA 3JBG1 2CAVA 2DUOA 3NSTA 1ZZ6A 4AVVA 2VMDA 5I0SA 5J37A 1W0OA 3DGTA 3ZN5A 3LA2A 5A7QA 4EWEA 3HNBM 3RMYA 4M00A 4CDWA 1FV3A 5I0DA 2JDKA 3QACA 2X8KA 1GFF2 1K5MA 2B5HA 1PMIA 3AMPA 2DCKA 3N7LA 3R4DB 4FTEA 3V65A 1KDKA 5KBFA 1MACA 3RVHA 2CV6A 5JAXA 4FI9A 2HYXA 5B4XA 4Q27A 1OFSA 2VZQA 2XXZA 3UKVA 2WNUB 1ALYA 3AZVA 3HJRA 4UT5A 1PHMA 1CX1A 2WA4A 3LKJA 4Q4X2 2IFWA 1CJPA 1J1TA 1WBFA 2OIIA 3ENRA 3KHBA 3OF1A 3NV4A 4UBHA 5FJHA 5K0UA 5C3RA 5JXGA 3KGZA 1NYWA 3K48A 1UZZA 2D93A 2WNVA 4MGKE 4UI9L 1XSQA 5JIUA 4QPGB 3Q8BA 3UJOA 1YWKA 2VUDA 4AZZA 3EMRA 2VMEA 5FTTC 1JN2P 1ZBA1 5AFEA 1C1LA 1BBT1 1W8TA 4XOGA 1UW8A 1FX5A 5FZMA 5HV4A 1W6NB 2ARBA 2P2KA 4K21A 3ZSJA 3AKRA 4BQYA 3J8F2 2GP5A 2RMU2 1YFXA 5HXMA 5A3UA 1H8VA 5FRAA 5JR2A 4Z07A 1UO9A 3C7OA 2WLQA 2CDOA 3JCIA 1AYM2 2EXJA 4BHPA 5AC93 4LXLA 4Y24A 1VBB3 3SH3A 3DYMA 5M0TA 1O7FA 2VOWA 4HSJA 1W8FA 4FFFA 2WO7A 4LNVA 2I74A 1X82A 1W39A 2VJXA 2OPWA 1W9TA 4MSVA 4TN7A 1GMMA 3IM0A 5L36A 2D5FA 1PO12 3NJVA 1OF3A 4AFAA 3D5OA 3HIFA 4LKEA 1SLBA 4PJYA 1JYNA 3WXPA 4HONA 4FOVA 2OQ7A 3I4IA 2PQQA 3AXEA 3NJXA 1DQ1A 3TN91 2VC9A 3RGBA 4D3WA 3WW4A 2PHWA 1REDA 3SC7X 5A1LA 4YFWA 3I59B 2ORXA 1S2BA 2WFF3 1S0FA 1KQRA 2OVUA 3VBRB 1W8UA 4YGDA 5A1AA 4OHWA 3ZYGA 3OPZA 1AXZA 2WQZC 4PLNA 2WT0A 2GC2A 4DINB 3H3UA 1HQNA 4ES8A 2Y26A 3NAPB 2AR6A 3GZAA 3ILFA 2EVXA 1VMFA 2SBAA 1RVF1 3HNYM 5DABA 2H6CA 5F5IA 2CGNA 3AP9A 3LIHA 5LA0A 2W39A 2E53A 1GV9A 2X10A 2PHFA 4HLTA 3WHUA 1CIYA 1LHOA 3DYOA 5T55A 3VBOA 2D7FA 5A3OA 4BIOA 4BWOA 3ACIA 4PLOA 1FPN3 1OD5A 5FPAA 3TYJA 4CCCA 4Q1RA 3RI8A 2HWE1 4DO0A 4N53A 4AEDA 1RUI1 4AHYA 3GZUC 3P6BA 1NQDA 2NYYA 1H1IA 2WRAA 4V2WA 4LO4B 1HRI2 2VQUA 1JZ7A 5FZHA 3AZZA 3CJIC 1SLTA 1XNAA 4YZ2A 2C5DA 3U14A 3WP3A 1W6PA 2WO2A 3ZYFA 1OA2A 2XOMA 1QJU2 3VKLA 5CYYA 1SFYA 3ACHA 2R072 2P37A 1VE0A 5L73A 3UL2A 3ZFEC 2P3YA 3G6JB 1PVC1 2VNGA 4OI1A 2RS33 3PMSA 1WLDA 3O14A 2JDMA 2JG9B 1W06A 1H8TA 3VHPA 4K9SA 4ZONA 5FPVA 1AVBA 3KT1A 2WSVA 2XKPA 3WW1A 3TEYA 3MUY1 3OYWB 5C3SA 3H42B 1RYYA 3CO2A 2PAEA 1V9U1 2NMOA 4WM8B 3OG2A 4QKFA 4COZA 1VAVA 2VMFA 2ZGQA 4LHNA 3KVBA 1ZRFA 4LT5A 1L7RA 2GAUA 2W94A 3AFKA 4J6GA 4NHLA 4BLJA 2W5FA 1D2SA 5B2GB 2DVFA 1AR82 3UV9A 5BV6A 3U1XA 4RR3B 4W4ZA 2OKXA 3CU7A 4TLGA 4BQ2A 3S6PA 4C91A 4YM2A 4F83A 3L2YA 1NCRC 3GJBA 2BZDA 2VVFA 3VV1A 5DG2A 2WZEA 3DN7A 3J7MA 4QKBA 5JR7B 4AI8A 2DWRA 3SISA 5IK5A 4E4HA 3QD6A 5F39A 1PX3A 2WT2A 4HPKB 1QQP2 1I3HA 2DFCA 3K3OA 5FQ0B 3ETQA 1TVGA 3GCXA 3LPGA 5HCHA 2X5IC 3EBRA 4DB5A 3J8F3 5IYYA 1B35B 1DBNA 1G7YA 2EF6A 2RMU3 1H2KA 1L3JA 1ZX5A 3N9QA 5I8YA 3VHOA 5F2SA 1LESA 4LOTA 4META 4YZ4A 5JSRA 4E8DA 3LAGA 5F3IA 4DNYA 1ULPA 3CHXA 3UKNA 5IWFA 1CAWB 2JDZA 3PDQA 3USUA 4ZS3A 5T54A 4A3ZA 3AL5A 3ELNA 4XW3A 5FP7A 1W8OA 2A71A 2WZR1 5FY4A 3BOWA 5JI7A 3ZDVA 3NJYA 2K0GA 5FUIA 4JGZB 3R05A 2WKKA 1IG3A 2ZX1A 3I2DA 3LQCA 4K6BA 4XQ4A 5DPNA 4I02A 1RUC2 1UCXA 3PLQA 2VD7A 4LORA 3E5UA 3UGGA 4JGYB 1POQA 1LU1A 5EJ1B 1FATA 3IIIA 5D2AA 1ZBE2 2ADEA 4OI2A 3PU3A 3AP6A 4P5YA 3WG2A 2ZEZA 3B9CA 2JENA 4AFMA 4ORFA 5LA9A 1W9WA 2E32A 4CYDA 4MGQA 4URTA 4WVMA 3OOXA 1W0NA 1WLTA 4XJAA 4YM3A 1TME1 3H1WA 3OBTA 4YRDA 4DQAA 2FDHA 3OEAA 4HK9A 5I91A 1CQ9A 4LULA 2MEV1 1QXRA 1CIWA 1YFYA 3IWZA 2IXJA 2WJSA 3WF1A 1AR62 1OLQA 4YVWB 2ZBJA 2FDKA 3NV2A 3PTRB 3SITA 1U5XA 3OGVA 4C1WA 1UD1A 1Y3TA 3H0OA 3H50A 3PVOA 4K8FA 1RUG2 1RUJ1 1DQ0A 4Y5Z0 4LO6B 2GNTA 2VH9A 4WM7B 3O1VA 1DZRA 3N9NA 3MIHA 4AWDA 1EPZA 2GMEA 3ZXGA 4GULA 1QXPA 3TBDA 5GLUA 1SMVA 3IDBB 3CEWA 4RA0A 5T5PA 4A7KA 2VXJA 2IUWA 4NHYA 1D2QA 1VAKA 3AL6A 1HRI3 2WNUC 1HXS3 5LASA 2BBVA 4PQQA 1S0CA 4AQ6A 4CVUA 2V09A 4ATFA 1ENRA 4YW6A 2P17A 4AI1A 3BIWE 3WVJA 4XDQA 1Q8OA 1YCIA 2BBAA 1QJU3 1NY72 2R041 2RR12 5GZEA 1BCXA 3TB0A 5JXHA 4QPGC 1F8VA 1UF2C 2R073 5I0RA 1NX9A 5CNAA 2UY9A 1V6OA 4PDWC 3KT4A 5F2WA 1YHFA 3KT7A 2SLIA 3H7JA 4S2DA 1WW6A 5KHGA 3MICA 5E88A 2TEPA 4MUVA 4OHXA 4BPZA 4QDSA 3MIGA 4Z2WA 5LBCA 4XMIA 3VBHB 4M3CA 4HOOA 4H14A 1YJKA 2KD7A 1E5HA 4AFDA 1OFNA 3OTFA 3ZOIA 4ZXKA 5FLHA 4YG3A 3K4ZA 1V6LA 2XUEA 1ND2B 1WGPA 3K4DA 1RUOA 1LU2A 3CZJA 3FX3A 1XC6A 2A6YA 2W3JA 3U07A 1RUH1 4OZXA 3NNGA 1R1A1 2LROA 1ZRCA 2XMLA 5K9YA 5LBBA 1AR83 4JDNA 1N3QA 1OLMA 2D98A 3CMGA 4XILA 4TYSA 1A6CA 1RTVA 1ZZ8A 1S0BA 2IXIA 4AQ2A 5EPAA 3DCQA 1XE8A 5IT6A 2ZCWA 3USSA 3CJIA 1XNKA 4QWNA 5F5QA 3ZYHA 2GP3A 4FVVA 3IMMA 1WWYA 4OYUA 4XJZA 5AVPA 1OVSA 4JTOA 3O7OA 1HV0A 2WYSA 3M2MA 1GWKA 1HKDA 4FPJA 4W6XA 4K8RB 3FE5A 3T0BA 4AGVA 1GANA 5KHKA 1KXGA 2P5BA 1SACA 4FPLA 1HRV1 2ZHLA 4LK6A 3HAGA 3VBRC 3ZYPA 3ZFEA 4D7SA 3P3NA 4FFGA 5CADA 1QKQA 2YZ4A 4FPFA 4HN0A 3N7JA 5FY7A 3PVBB 3C2UA 1LKNA 2DVBA 4LO8A 3AP7A 2XL7A 4QMAA 4AHZA 3NAPC 3MI8A 1UMHA 1DLLA 1PM4A 2XJQA 3A4UA 3HNMA 4AFCA 1FOD2 4LKSA 3MV01 1RHI3 3PTYA 1LENA 5SV8A 3AMHA 1JUIA 2O8OA 2YY1A 1W90A 4LEJA 4BA6A 2HEWF 4O9EA 2EIGA 5EP9A 5JSOA 2ZGMA 3DECA 3LDRA 2WIIB 4RFRB 1A8DA 2JB8A 2O14A 4Q4Y3 4D6SA 3U4SA 2ZACA 4QPIB 4RN5A 5ACA3 3DKQA 1MEC1 3RZLA 4MG2A 4MV2A 1RUC3 5FOBB 3V0BA 2K2SA 1NXMA 1ZBA2 4A3XA 1BBT2 3K3NA 4D8MA 5E6HA 1ZBE3 1OF4A 4R4ZA 1NG0A 4LUMA 2HEYF 2ZX4A 5A70A 5I8TA 2W08A 1ZA4A 5A6YA 1R081 5CU1A 2GALA 1MR5A 1DHKB 1IGOA 3C7GA 3WD5A 5HCBA 3FLTA 2VU9A 2D6OX 2JD4A 3ZR5A 1GNZA 1STMA 1W2AX 1S0GA 4GIQA 4Z1VA 1AR63 1B09A 2X5IA 3T1MA 4Y1YA 1L7LA 1MS0A 2YV8A 2MPFA 2OA2A 1GZTA 4IERA 1ZZ7A 1CONA 2JG9C 4MO3M 3UJQA 2VG9A 1JUHA 3MIDA 1H0BA 4XJ8A 5ANQA 4DXZA 1RUG3 1V00A 1Y9QA 2GNDA 3FJSA 2D3RA 1EY2A 1LGNA 1X9TA 2VCAA 4JC1A 4GWIA 5JDBA 3WF2A 1GP6A 2WWUA 3A7QA 4WM8C 2Q8DA 1W6OA 3TN92 3T2PA 4AVTA 4CUCA 5JWPA 4XABA 1JYCA 2WUHA 3RG0A 4A7YA 2BDRA 1G9CA 1XJAA 1XB9A 1LHVA 3VBUC 5C4WB 5D8AB 1RUE1 4IV1A 3OBAA 1IPSA 3LIGA 1YQ6A 4CU9A 4WZCA 1Z7S1 4RR3C 4ZS2A 3M70A 3B7MA 3GBGA 3LSDA 4P5HA 4TZDA 3BIEA 2H0VA 1IQAA 3OUIA 4QX7A 3AYDA 2EALA 4XFHA 3M3IA 4CEWA 2W46A 4YM0A 4XZUG 4XJWA 5J96B 1RVF2 2RR13 3WDTA 1GNYA 2JDHA 3UYJA 1C28A 1EV11 3KLSA 4OZOA 2VOKA 1RUNA 3HQRA 1D4M1 2QJVA 5IK8A 5BY5A 3ZFGB 3ZMNA 1V6IA 4IDZA 1VMHA 1DZTA 2CGPA 2P3KA 4C8DA 3JB4C 1TMF1 1N3PA 1B35C 1H1MA 1GUIA 2YC2A 4AF9A 4BDVB 3AFGA 3I3QA 1IS5A 3RYRA 3O12A 4M4PA 5KXDA 1TEIA 3U78A 1RUF3 3OBRA 1W2NA 3RWKX 4R8HA 4A7ZA 4IEZA 2Y6GA 4CCMA 2VUJA 1KS4A 3I7DA 4JV4A 1ASJ2 1T6GC 2W9XA 3FLRA 1CX4A 3I3EA 4IW3A 4OVEA 4WVVA 2CU5A 5F6LB 4IGQA 1LCLA 5IW0A 1AZDA 4JGZC 5FK7A 4AW7A 2R063 5KXEA 4FFIA 5IK7A 2WNUA 1F5JA 2BFUL 3NQHA 1PVC2 3H8XA 4JAAA 4JGYC 4OULA 5EV7A 1UU6A 2WLPA 3LEKA 4FT8A 3LPFA 2P6CA 1YIFA 2I07B 4O65A 1J84A 1UMZA 3ASIA 3FFQA 3HEIA 4XAAA 4COVA 4QPGA 2HJIA 2VQ0A 4XQDA 4ARXA 2IXCA 4I30A 2Y6LA 5CZKA 3HD8B 3WNMA 4CPBA 5GZGA 2CDPA 2DUQA 4IEWA 5EJ3A 3SHRA 1V9U2 4PIYA 1JS9A 1O4TA 3MGUA 5FY0A 1ACCA 1W28A 4B1LA 4XVHA 1W6NA 3V56A 3S7IA 2WN2A 2XWJB 4YVWC 1C57A 5FPLA 1SZBA 3SCHA 1FOD3 2XONA 3H8UA 1DGRN 2D6KA 2WAAA 4R9DA 5A7SA 4UW4A 1N3OA 5LBEA 4S2HA 2DUPA 3KCYA 4L92A 5FZ3A 5JXJA 3LA3A 4CDUB 2A3YA 4GB32 3SH4A 1ZA7A 2P3IA 4WM7C 3MIBA 2F4LA 2GN3A 3O1SA 4CZSA 1NUKA 1VBD2 3KV4A 4CUBA 4DPNA 2Q1MA 2J1SA 3JD71 1ZBA3 1BBT3 1OURA 3ZXJA 1X8MA 1REEA 5FBZA 3VHRA 2ZX2A 3N9MA 4I0BA 4IV3B 2UURA 2JDPA 1US2A 5LA2A 2E7AA 1WD4A 1RJ7A 4YW4A 3WZ1A 1YLLA 4XXAA 2ILMA 1IKPA 1LR5A 1EAH2 4G4FA 1NA1B 3S7EA 2ZKNA 3N9LA 1U5ZA 5GALA 2XUMA 5A6ZA 2Y34A 5CA6A 2DURA 3I59A 2YGMA 1XU2A 4JHZA 4XE9A 3VBRA 2G19A 2VTXA 5FY5A 2C26A 3BKZA 3B5LB 4K1YA 4XFIA 1BLZA 3FBYA 4KWKA 1X36A 5FZAA 4C1XA 2RM21 1CAXB 3NW4A 3T08A 3NAPA 5T5LA 3VBHC 5I93A 5DXDA 3N36A 1UXXX 1QIQA 3MDPA 5FP3A 5FUPA 4JDOA 2ZAHA 4RS5B 2VNVA 1JOJA 1MS1A 2LUWA 2Q1FA 1LHNA 4NUBA 2R0FA 5GJ6A 3OJBA 3TN93 2YBPA 2JDYA 3MW4A 5FZBA 3KHCA 1XNCA 3A0KA 3H8OA 2YC0A 4XAEA 4UXAA 3GALA 1S2KA 5EZWA 4YW3A 4KI5M 2VXRA 3LFMA 2Q8CA 2XVKA 2DCZA 2YUEA 4UF0B 4B1MA 1TME2 2W2IA 2GMMA 3MV11 1NZCA 2YBSA 4WZFA 3C3VA 4UFHA 1JODA 2BW8A 4HG6B 4B4QA 1SFPA 1J1LA 4GJYA 1VR3A 2A6WA 1RVF3 4BK5A 1R093 2BRTA 2WS92 4K3UA 4EN7B 1ENQA 1PO23 3A22A 4M0HA 5A3NA 4LOSA 2HWC1 2NLRA 3M3OA 4Q8LA 3RZHA 1HW5A 5CG9A 3ZFFB 4EZ4A 4P02B 3WP5A 3NV3A 1VP6A 4N90A 4I3PA 2VAUA 4BQ1A 4NOTA 5F7UA 5BNNB 3CQOA 3T3YA 2JG9A 1PM7A 3DEMA 2IXLA 1AL21 4Y4RA 1H4HA 3THCA 5KXCA 5LCWL 4DUWA 1HV1A 2ZMNA 5HV0A 1TZOA 5FZCA 1BKZA 4JKMA 3IBMA 2JXAA 2J1TA 3OYWA 4Q26A 4QQLA 1MVEA 3NO8A 4YGCA 1C1FA 1DGLA 3VBFB 1H8TC 1ASJ3 4WM8A 4QU1A 5CKQA 2JIJA 4ZPIA 3E5QA 5FXVA 3U4XA 4BK4A 1W9SA 5LB6A 1PGSA 2R042 2XJVA 5J09A 4LKDA 4OLLA 2IFRA 4QPIC 4FPOB 2RS52 4QB6A 1NQJA 2AACA 4YYOA 3A23A 3CBNA 4RR3A 3AM2A 3WV6A 1YIPA 4QX1A 3RDIA 4Q0SA 4XBLA 1O5UA 2BPA2 1O59A 2GSYA 1DF0A 1JHJA 3HMYA 5DN2A 1HN0A 1SBEA 3LZZA 4K7JA 4JQRA 1VJ2A 1EP0A 2BP6A 4HPKA 2RDSA 3KSCA 3MUZ1 1W0PA 5FQ0A 3CNAA 4Z82A 4RQPB 1VRH1 1RUH2 4QQOA 1B35A 3P5BA 1R1A2 1PGW2 1H2LA 5EFUA 1URXA 4KNCA 5F1RA 1O3QA 1QJEA 1VBE3 3TNPB 4XCAA 4LBOA 1YXWA 4IEUA 4NMIA 3NNFA 1FMD2 4KL1A 1J3RA 2YU2A 1MVQA 3MF6A 1CAWA 4GB33 4NIAA 3ON7A 2BWCA 4Y1UA 5FO7B 3MLKA 1HDKA 4HETA 3RSJA 3C7FA 2RG4A 2ARAA 1PZ8A 3OD0A 1VBD3 1DFQA 2PA7A 2C9KA 2NZ9A 3FHIB 4JGZA 3AJZA 5DAPA 1V6KA 5C4WC 4EWAA 1W9YA 3F2ZA 5D8AC 1HRV2 1RUD1 1UXZA 1GWMA 2F4PA 3K75B 2UWBA 1O8PA 4JGYA 4WVWA 4MHRA 1GBGA 5CFCB 1QJY1 2F6BA 1IZ3A 2NQYA 3AJYA 1EAH3 3AP4A 4XFAA 3B00A 4FBFA 5CAZA 4E4ZA 4ARYA 3OUHA 3EO6A 2RHPA 3FBMA 2VZRA 1HIXA 5H9SA 1YJLA 1DQ2A 3GYDA 3ZFGC 1M4WA 4AAPA 1ULOA 4BOWA 4A4AA 2C0ZA 1UKRA 1E5IA 5F3GA 2ZX0A 3VZNA 1D7PM 4YVWA 3RS6A 4I3GA 5JPMB 1EPWA 2BJSA 3ZLIA 2VNRA 3ZN6B 2W52A 1ZVFA 3D8CA 5CB7A 4BH9A 1ENXA 3X29B 4Z2AA 4P14A 4XYXA 4ISQA 1LAJA 1UU4A 1OQDA 2FMDA 1J3PA 2JG8B 3POSA 5IUQA 2VZSA 4MX3A 1DQ4A 4NRPA 3NRUA 3KGLA 4WM7A 4XEZA 1MS4A 4NIIA 2E63A 2YFUA 4JQTA 1R082 2Z79A 1HJGA 2EAAA 2ZXQA 2D3PA 2Q30A 2VO5A 3D4KA 4KU8A 3RPQA 2YFZA 4JTNA 1WMDA 3D3AA 5JVVA 3IB3A 4XUOA 1BYHA 2WDBA 5FZ9A 3I8TA 4M4RA 1VRBA 2YROA 1PMHX 3Q8AA 3WQ0A 1VAMA 1JOPA 2JD9A 3K51A 3PNAA 2WS93 1JI6A 2AZ5A 4Q4W3 2RE9A 5F6KA 1PMJX 4YW7A 2W92A 3LF7A 2QE3A 4LBKA 4QD2A 3TRSB 1JH5A 3MF9A 3N35A 2DFBA 3SEPA 4AI9A 2QQOA 4Q8KA 5A6XA 2D6LX 2Z5WA 5IVCA 3W21A 5DDJ3 2I45A 1QY4A 4M0NA 5CFDB 1XYNA 1NT0A 2UU8A 4JCKA 3VB9A 3VZKA 5BNOB 2QKDA 3NKGA 3VBHA 1DGWX 1W03A 3BPZA 1YYNA 1W8NA 5H9QA 5KWRA 3HT1A 4IEOA 1Z7S2 1W05A 3WP6A 4AEMA 3FHQA 3WQBA 1UU5A 4EZHA 4CDUC 1QJZA 3HN3A 4LO7A 2VGDA 1JZ3A 3I49A 1VLNA 1WZXA 1JYIA 4MGYE 1YI7A 4XHXA 1BK1A 2CGOA 2RS53 1EV12 1K45A 4LA3A 4XFGA 4NPMA 2WINB 3WF0A 4CCJA 1N1YA 1D4M2 2ZA9A 4BQ3A 1SLAA 2VMCA 3DYPA 3E97A 3IDCB 2B8MA 3AMMA 4XFCA 1VBC1 1OVPA 4OFGA 2Y38A 3FC0A 3AKPA 4LIVA 4LJHA 4NAMA 2C4XA 3VUOA 2PLV1 2BUKA 2J1EA 3M3CA 1CN1A 1TMF2 4QQPA 3SLIA 4Z92B 4X8PA 5T3NA 4M3CE 2CAUA 4FP2A 1NA1C 2FCUA 4GA9A 1W8WA 2O1QA 5CKNA 2BGPA 3AP5A 5FYMA 3W5MA 4ZU4A 2VQTA 4RYDA 5A3PA 3OD4A 3BTZA 2GU9A 5J1XA 3ROUA 2BQPA 4RL7A 1YRZA 1RUH3 2W68A 2A3XA 5DAXA 2OYZA 3B01A 3U75A 3WDYA 4B7KA 4EN6B 1OOPB 1LOCA 2X29A 3MPPG 2QNKA 2VM9A 4CCLA 2FCTA 4XUTA 2BU9A 5DAWA 3WNXA 1OLME 2PHUA 4BMBA 5I0TA 4QPYA 4J1XA 1FMD3 1C8M1 4GH4B 3T2TA 4ZZ8A 3AX4A 4IL7A 4UAPA 3KF3A 3BOPA 3AVSA 3C7EA 3HOBA 4L99A 4BE3A 4RS5C 1AYN1 5DUXA 3MW2A 5I0UA 5J98B 2VY0A 5GLTA 1VB4A 3AKTA 4RHV1 5EYYA 5C8CB 1MZFA 5FMCA 4AHWA 4AL9A 4FSJA 4QPIA 4DRVA 4QHOA 5APAA 1NOVA 5FMOS 3ST7A 2VULA 4HN1A 3FMGA 1JZ6A 3Q9OA 4BQ5A 1QGLA 1GZ9A 1RINA 1KFXL 2ZGLA 4N7UA 1IOAA 1LGCA 3RWNA 1REFA 1RJ8A 1Q8QA 1ZNPA 2A6XA 5FK8A 3IIAA 2WR9A 5FZ6A 4B4RA 4Q4X3 1AXYA 4FQZA 5A3WA 1COV1 2J42A 1W2OA 4IEPA 3IKWA 2I2SA 5CEHA 3Q8EA 1SCRA 1HB3A 4XIKA 2PHRA 1S0JA 3CZUA 1WCSA 5FR3A 1VMJA 4MGTA 1APNA 2G4IA 2VTFA 5H9RA 5FAXA 3VKMA 4CEYB 2FDIA 3OCPA 1OI6A 1LODA 1U5YA 2Q8OA 1PX4A 4KU7A 4CDQB 1SPPB 3W58A 5CG8A 5BNNC 4ZZ5A 5FZOB 4W6YA 4IESA 1AF9A 1SG3A 1K12A 2L9LA 2XL9A 5K7PA 5GZDA 3QBQA 2VBBA 4FPCA 4IEVA 1U12A 3EQEA 4QX8A 1XRUA 3KS7A 2G1MA 1QJFA 3VBFC 3ES4A 2HWD1 4XIOA 4Y1XA 2AC1A 5FKBA 5BXXA 3VLBB 5A6QA 3S0MA 4CDXB 4QQ2A 3SCFA 1AYM3 5H9PA 5DMYA 1JZ4A 4OHVA 4PCRA 3M7AA 2C9AA 4RGAA 5C4WA 5L9RA 5D8AA 5DUVA 2QTWB 1D4VB 4H2AA 4BLIA 1UZVA 2V5DA 4PI0A 5FXWA 4L11A 3T30A 5FZIA 3ZVXA 2VZ1A 1F31A 3UETA 3WF3A 1LEDA 3ZXFA 1PO13 4IV1C 4IE0A 2ZEYA 3ZYIB 4CXWA 2TUNA 2DDUA 4HXCA 3FWEA 2VZPA 2X05A 5JI9A 4BQXA 1POV3 1X33A 1OUXA 1DIWA 2VBPA 3NWKA 2XLAA 3HT2A 4CEWC 3ZFGA 3D0JA 3PURA 4YLZA 4ZKTB 2D3SA 4L2NA 3T2OA 2D40A 4PF1A 4ASLA 2GN7A 3IT8A 3TAYA 4RQPC 3KV6A 4AK3A 5FO8B 4RFT0 2QFEA 3LOIA 2QDRA 4XURA 4IE6A 3T0DA 4O9GA 2LS6A 2XBO2 1UOBA 3ACLA 1S0EA 4QM8A 1Z7S3 4MXWB 4QXBA 2E51A 1DCSA 3PJYA 4E4SA 3NNJA 1PVXA 5L7OC 1DP0A 2E6VA 5T5JA 1US3A 1YNAA 3S5QA 5GM0A 1UZWA 5DQ0A 2VMHA 2B7YA 3LEGA 2HWC2 5IVJA 3VKFC 1SHWB 2DV9A 4Y22B 4Q1PA 5FV3A 5T50A 1UY2A 2A75A 1QXJA 3U11A 2ZZQA 1DYKA 1NAEA 1VBB1 4RD7A 1TMF3 3M3EA 1KJRA 4NRQA 5FZ7A 3EJKA 1AR72 5F3CA 5CFCC 3ILRA 1AL22 1O5LA 2XDVA 2YHJA 2FHRA 3O1RA 3WCRA 1YQ2A 2UYAA 2EXIA 2JE9A 4DRRA 4A44A 1LOAA 1ST8A 1S4CA 1LEMA 1U0AA 4URAA 5JOZA 1CAUB 1QH6A 1CAVB 5FZ8A 3URFA 4XF0A 4SBVA 2LTNA 2EXHA 1O4ZA 3RFRA 1YC61 5F3EA 3TWIA 1H1AA 2WFF1 2ZX3A 3KVAA 3VZOA 2V4VA 4XCBA 2A7AA 4HVRA 1GR3A 5E16A 2JG8C 1QWRA 3ACGA 1D0HA 3AKSA 2WQ8A 1HN1A 4CDUA 5FREA 1MS5A 5A33B 2A5ZA 2YPDA 2ZTNA 3MZHA 1V6NA 4A6SA 3BU7A 4GZ9A 3PIJA 5FMBA 3N7KA 2ZGNA 5HPOA 2ZHKA 4E8CA 2XH6A 3U37A 2BTVC 5FYTA 5FPZA 1J83A 3AMNA 1AX1A 5JUVA 3PL0A 4PQ9A 1UZ0A 1SLCA 1UYYA 1FPN1 4IV3A 3H7YA 4HL0A 4LUKA 1KDMA 1MS8A 2W91A 1VRH2 2AEYA 2PHXA 5L7OB 4KWLA 4EROA 1O91A 2DCJA 3BVCA 3ZXAC 2JDUA 2W95A 1NA1A 3JBG2 2ARCA 5F5AA 1SLLA 5IFPA 2XJSA 1CPNA 1IS6A 1CESA 1DQ6A 2R30A 3OUJA 4IE5A 5F8PA 3WUCA 1C4RA 4NIDA 2PAKA 1JXNA 4CU6A 4P9WA 1PK6B 4LK7A 3M1HA 4TXWA 4YGBA 5FWEA 2R0HA 4XPVA 4YM1A 5A3LA 1QQP3 1CAXA 4YWAA 3THPA 3VL8A 3AB0A 3ZN4A 4Q0PA 2XLFA 2XJTA 5BNOC 2FZ2A 2ID4A 4GKYA 4UW6A 2VOXA 1OKOA 2ZAAA 4NE9A 4R9AA 4CU8A 1RUD2 2ZGKA 4MH0E 4DXSA 1XNBA 4RS5A 5SV5A 1XU1A 4J1WA 3WUDA 3IPVB 2RS31 1GP4A 4SLIA 1XNTA 5D21A 5FPUA 1WA4A 2X09A 5L9VA 1SFNA 4QX2A 2XG3A 3AKQA 4OI0A 1M06G 2Y0OA 1XYOA 2G9ZA 1W9FA 4FOQA 2EICA 5A7OA 2ZHMA 1HJFA 1H2NA 4UF0A 5DZFA 4BCUA 1C5HA 3M8LA 1XE7A 4XF9A 5FYHA 5KXBA 5LK5A 1K42A 3ZDSA 3AYCA 1CD3G 4LBJA 1GZWB 1NZIA 3WG4A 4XHBA 1WW7A 2YMZA 1FAYA 3POIA 3MIFA 4A45A 3CKHA 3VDAA 5JZGB 3OPTA 3D0SA 5CIRA 4KQ7A 3MIEA 1V70A 1PZ7A 1LHWA 4L0PA 1JYVA 2IVJA 3ZFFA 5JLVA 5DAQA 1GU3A 2VMGA 1DYOA 3NKTA 3PVNA 1CR7A 1WKYA 1IS4A 3RQ0A 2IXHA 3UGFA 1TE1B 2XVGA 4U36A 1TNRA 3FN9A 4QX3A 3LEMA 4M01A 4DY5A 2CWSA 4P9JA 5BNNA 1OOPC 4BJ0A 1MS9A 1V6JA 2XBO3 4AYUA 2O0OA 1T2XA 3ALQA 4NPRA 4DOUA 1WLCA 3OPWA 4I01A 1RMU1 3OY8B 1DZQA 1W99A 4KG8A 2UYBA 3H1YA 3MPBA 3VBFA 1Q5OA 3H9AA 1AX0A 2OPKA 4XBQA 1LOBA 1JZ2A 3RNSA 4IE4A 3KD4A 2Z2SB 3IMNA 3ZPOA 4I0AA 5C8CC 1RITA 4Y20B 4PIZA 2J1UA 4NHKA 3RRDA 4I2OA 5FLJA 3ZYBA 5IK4A 5C3PA 2DU0A 2VTXJ 4NVPA 4BYYA 2ERFA 2VZ3A 1EUUA 2WO1A 3CIHA 2OZJA 3MLJA 1AR73 3OGRA 2P34A 3ZMOA 3ZX7A 4Y26A 1NLRA 1T6BX 3T0AA 4DEQA 1JYWA 1O3TA 1N1VA 3ZIWA 5C3QA 5C9AB 5E1RA 1Q8VA 3LB9A 3PUIA 4CP0A 1QNYA 4J25A 3ZSMA 2J1VA 1PZ9A 1RC6A 3FFZA 5A7PA 1RXFA 1WCUA 3POJA 3P1IA 4CEYC 1CPMA 2OUHA 2QZ3A 4RQPA 1RB8G 4C0BA 4CDQC 2VVDA 4CXYA 2JB4A 5EQUA 3WLUA 3TEXA 1Y43B 2G9GA 5A80A 2E31A 1RL3A 4DXTA 4Q4V1 1VBC2 2HWE2 1O8SA 4UFLA 5LRSA 3KCXA 4MGIE 4X6RB 1RUI2 2WA3A 1BVVA 2PLV2 5FYSA 1QH7A 5AFBA 2Y60A 1UL9A 4S2GA 2VW0A 5DG1A 1OBNA 4EQVA 3AXDA 4CDXC 4D94A 2VCMA 4EN9B 3VL9A 4XETA 2E7TA 1HB1A 3GNEA 4GWNA 4Y5TA 3THTA 3TOJA 3U0ZA 5FDBA 2ZKLA 5ABJB 5DZEA 4YZ5A 4E4DX 4H55A 1IS3A 2GDFA 4ZU7A 4W8JA 2VW2A 2A3WA 4FPYA 4JKKA 5CFCA 3LD8A 4BXFA 3JBG3 2GC1A 1FV2A 5A32B 4AQSA 1DGRA 3KWVA 3ZKUA 1HXS1 2KXLA 1C8M2 2PFWA 4MGZE 5HCFA 5HXVA 2B9UA 1AYN2 2ORZA 1GZCA 3W59A 3ACFA 3WNNA 3O1UA 1CGPA 4NN0A 1BQPA 3AYAA 4FAHA 3ZM8A 2EIBA 1EYBA 3I2KA 3Q8FA 1QJU1 4CRQA 1SEFA 3RZKA 5A1FA 3WG1A 1W3XA 2R7EB 1RUD3 1TQ5A 3ZN6A 3BUCA 3WQ7A 2RJ2A 4DFSA 3A21A 2QQWA 3BALA 4R9CA 4CP1A 4HVQA 5FWJA 3ZYRA 3QLQA 2C24A 4DUXA 4DZGA 2JG8A 2RDQA 1O3RA 3ME2A 4CE8A 4YFZA 4CP9B 2HYKA 2MHFA 1NCQB 3C7HA 4OQ8A 3I2OA 5GLWA 1I9RA 3N4MA 2JKBA 2WSUA 1WUVA 4XUQA 1ENSA 4KWJA 4OUMA 1COV2 5FYIA 2VOTA 2R6QA 4ITCA 4XJ9A 2BGOA 2Y33A 4LBQD 2B42B 2VZOA 2PXJA 4FOWA 5BUVA 3WSOA 1SCSA 3LDBA 4QQHA 1X7NA 5C5TA 1H6YA 1A8MA 4TTGA 1LOEA 3R0RA 4K40A 1S0DA 3AMQA 1X9PA 4QX0A 2R32A 2BVVA 5IAVA 4XZPA 4UOJA 4D0QA 2Y6FA 1OSGA 3R6SA 5FOJB 3VD3A 1KFUL 2DCTA 5JXIA 1AR91 3B3QE 5IVVA 2PHTA 2HWD2 3BTYA 5CFDA 5A7WB 3KB5A 4LE3A 1YUDA 5BNOA 1JBCA 4BQ4A 4NPLA 3IDAA 2LW8A 3PJQA 4GAZA 2Y6JA 3QOPA 2WZR2 5GLVA 4AGGA 3I2JA 5LRRA 2WYFA 5JMCA 1GLHA 4Y1ZA 2QQPA 4AEKA 4DMIA 2R16A 4M3CF 2JWPA 2VCCA 1FT9A 4GJZA 1FXZA 3BTXA 2Z42A 2V73A 2PHLA 2LRPA 4D6QA 4P00B 1S55A 5IVBA 1HB4A 4IQPA 5FXXA 1RHI1 4XF4A 1A78A 4G3YC 1R64A 1ND2C 3AYEA 2HH9A 4N9IA 4LBLA 2DF7A 1WD3A 1MPXA 4N7IA 5JOWA 3J4UH 3DXUA 2ZGSA 4Q4Y1 1BEV1 5ACA1 2YGLA 1RUC1 5C33A 1H6XA 2FCVA 1AUYA 1GQGA 2MEV2 2ZMKA 4R9BA 3VDDB 1I1EA 4YW1A 2Q4SA 3ETPA 4CXXA 3LA7A 4FXGB 3CLPA 2J22A 2VQAA 3GCWA 3B93A 2B4KA 3INAA 1PK6C 1XE0A 1ZZ9A 1UZYA 1RIRA 4XF3A 1OOPA 4YZ3A 4ES9A 5HI0A 1RUJ2 4EJRA 5G04L 3DPRB 3U10A 4FOYA 2LALA 3AK0A 2XJUA 2HWE3 3EXUA 4BU2A 1RUI3 4MOAA 2ZGTA 4NRMA 3WINE 1VBB2 4LBQB 2BOJA 4UFIA 4QGLA 2AENA 1W6QB 3GJAA 4BISA 1W2UA 2IC1A 1XQNA 5CBLA 1HLCA 2X53S 4L97A 1UX6A 5C8CA 3WDUA 1JMUB 2QQLA 4JRAA 2VECA 3I2FA 3OGSA 2KM2A 3R4SA 5IHRA 4GXLA 4WBBA 1NCRB 4S2FA 4BM8A 2YPJA 2FZ1A 2WWSA 3KV9A 1E57A 4MZUA 1ZRDA 1KGYA 2MNGA 4AE2A 2JECA 4GWJA 2QBXA 4Q5OA 4V2VA 2ADDA 4C0HA 1LECA 3MEPA 1ZZCA 1PVC3 1W8ZA 2JE8A 1WMEA 4NROA 1X50A 5JZGC 4NIHA 3I2HA 2AYHA 3PUQA 1GNHA 1AYN3 1ULFA 2E26A 2VL4A 4QXCA 1VBA1 3LCPA 3VN4A 4YZ1A 1VALA 1OXCA 5C5UA 4CEYA 4CPBD 3JXSA 5GZCA 5JMOA 2RR11 4CDQA 1SPPA 4DIQA 1V9U3 5FZOA 4JDMA 1A34A 1QHDA 1QJX1 1JTZX 3VD4A 2JEMA 2OW4A 3LE0A 4HVOA 1MS3A 2FDJA 3B02A 3W20A 4GKXA 3NJZA 4MVTA 4EV0A 2ZPXA 5T5OA 3APBA 3CJXA 4FFHA 1VIWB 2DVAA 5EJZB 1UYXA 4N43B 3DL3A 2VZVA 4CDXA 4IE7A 4XXPA 3WG3A 2AGSA 5KC5A 2B9VA 2HKXA 2C6SA 2TBVA 1RUF1 3ES1A 4UFJA 4PHZA 1G9FA 4N9HA 4KWUA 3UGHA 4AOCA 4BB3A 5LW9A 2OT7A 1S1AA 2GH8A 4ASKA 2RDNA 4HK8A 2HWB1 4CU7A 3TEWA 3OGGA 1LGBA 5FY1A 3P3PA 5KC6A 1FYUA 2AH2A 4YSFA 2R061 4ATEA 1W6MB 3R4UA 5DZGA 1BJQA 3FL7A 4R4XA 4UYBA 4YVSB 1UWWA 4CSWA 1SQ4A 1RXGA 5BNQA 5C9AC 2PTMA 1UY1A 2RS32 3F95A 4D69A 4A41A 2EAKA 4UFMA 5FIXA 2HWD3 1JOBA 3POWA 1LOGA 3QH7A 3RJ2X 2RVAA 2WNEA 3ECQA 3MW3A 2R1DA 4DXRA 3ZXKA 2VR4A 5FP8A 1ZYBA 3VBSB 4YW5A 2VZUA 4ZXEA 2WZR3 3I2IA 1XOYA 1Y9MA 2EA7A 3E1F1 4MXWA 4XMAA 3KQ4B 4WVZA 2DVGA 1MEC2 3O0XA 4GALA 3VKOA 3E5XA 2LM3A 3NNLA 3DKWA 5FFOC 5FZDA 4UBGA 1FOD1 3VD5A 3KF5A 2WZ8A 5FPXA 2OXBA 4UW3A 2ZMLA 3ATGA 3T2QA 3GBFA 3D6EA 4XFFA 2WNOA 1PNGA 2XWBB 4Y22A 2D43A 3GHMA 4OMDA 3MYXA 4NR1A 5HBAA 5ABJC 4TSVA 1YFWA 3OSDA 4D7YA 1TME3 2A1XA 1HB2A 4L8QA 3Q8CA 3ILNA 4PDWB 2MEV3 2Q1ZB 3D82A 1WLWA 1ODMA 3JU9A 4LE4A 5J48A 3WNOA 5JPNB 1UKGA 1RMU2 1JYXA 1SDDB 2Y6HA 2XQXA 2XB6C 1UNBA 4KG0A 1F5FA 4H7LA 3T09A 3MLLA 5FKCA 2QCSB 1CAUA 3DV8A 1CAVA 4XDOA 2D97A 3ZYJB 4CUAA 3ZPYA 2CY6A 1BMV1 1RUJ3 4F8AA 4BMEA 1WCKA 5FY9A 1YI9A 3HN1A 4COUA 2VNOA 4ZU5A 3OB8A 5BPXA 4OQ9A 3GDBA 3GBWA 3AZYA 2B46X 4YPJA 2Q8EA 4QB2A 1LJ7A 2HWF1 4QM9A 1WCDJ 2ZABA 1OPOA 2RS11 5T52A 1JU3A 5F9TA 5JIAA 2XLGA 1HQWA 2XGXA 3BU0A 1RUE2 5LWBA 3E6DA 4LMFA 5E89A 5A33A 4B8EA 1NCQC 4NWWA 1KITA 2B45X 2Z4FA 1AJKA 4Q0VA 2PELA 2Y8KA 5ERLA 4DY3A 4FTBA 1ND2A 3SKVA 3LSEA 3TNQA 1AL0G 2XR4A 4UW5A 1PIV1 2R043 2CSGA 4TLFA 3V64A 1P8JA 5C71A 5L7OA 3UT0A 3MBWA 1QMJA 4XQWA 5FZGA 5BNPB 2PN5A 4PLMA 5FYCA 4IXLA 3I97A 1OQ1A 4IV3C 5FJKA 4P9LA 1VPHA 4Y4YA 4W6WA 4Q4V2 4HKOA 1ZRIA 4E2SA 2BERA 4HFSA 4IEXA 4LLOA 2CNAA 2IWGB 1GOFA 4QDQA 4JRLA 1ZZBA 4CCNA 2FQPA 1PK6A 1R091 4QHZA 3V0AB 4QU2A 1O4YA 1PO21 1YQCA 4K1ZA 3O1OA 5JOYA 1JU4A 1CZTA 4OCTA 2YU1A 2QQNA 2DBNA 1ZREA 1WW4A 2R49A 3JB8A 4JX0A 5CVRA 4FTSA 1OA4A 4NJ4A 3J7LA 1R1A3 3HBZA 4CCOA 1UIKA 2W0XA 3POEA 4KBBA 3IPVA 2JIGA 3BB6A 4D7TA 4UWDA 3ZSEA 4Q2FA 3T4HB 1L7QA 2UWAA 3WF4A 3WQ1A 2DVDA 4PBPA 4CTEA 3O5SA 4FPKA 1HXS2 2P3JA 4X8NA 4YG0A 1UPSA 4IGOA 1NKGA 1JZ8A 1Y7BA 1AHSA 1SLIA 1ASJ1 4JZRA 4QKNA 1G6NA 2V4AA 1KD7A 3S5AA 4E2QA 4N8MA 2B39A 1GZWA 1HRV3 4QKDA 5FXZA 4KMQA 3W9AA 3E6CC 1GSLA 5JZGA 4GMP1 3SKJE 3POFA 4PF5A 1BXHA 3ABZA 1X8EA 3BPSA 3SCGA 1OD3A 2JDAA 4LO5B 4YG6A 3VDDC 2JKXA 3UESA 3W5NA 1OC1A 5FYBA 1G9DA 3T4VA 3J7HA 3WEZA 2ZZJA 3ZSKA 5K4LA 3ZFFC 1GYKA 1H9WA 1NXD1 1WBLA 3DPRC 4P9IA 4QXKA 4Y3OA 4XJUA 2H6BA 4AXOA 3RZMA 1H2MA 5A7NA 1OHFA 1N1TA 3OY8A 1MEC3 4LIUA 3QCWA 1UY3A 4HKLA 4HMZA 4GMP0 3GZEA 3RMXA 4OUSA 3JD72 3VBUB 2BGCA 4P9GA 3ZR6A 5FZ4A 5A3MA 1VBE1 4E27A 4GQ7A 2Q0AA 2BYVE 3CF6E 4XTPA 4Y20A 1MQTB 2OX0A 2O8QA 2P6HA 4P08A 4LITA 4UFKA 1R083 4GB31 1AR92 1MZ5A 1ND3B 4YNIA 1S0IA 5G05L 1VB2A 1ULDA 2ARXA 5KHIA 1VBD1 3WCSA 2VUCA 1IHMA 1FI2A 2FD8A 4Q29A 5IVEA 1Z0HA 1RMU3 3NNMA 4HBNA 2RM22 4MXVA 3WW3A 5C9AA 3FLPA 1MZ6A 3VGIA 4IEQA 1GWLA 3WOGA 5HCAA 5LY2A 1EAH1 3I2GA 4LHLA 4AHXA 5DAVA 2A6ZA 4IUGA 4Y33A 4AVBA 1F15A 1RHI2 1BHGA 2ZJCA 3N9PA 1N1SA 2XHKA 1GOGA 1EUTA 5AVAA 4HANA 3VHNA 1W04A 4QGNA 3IAQA 3BYWA 4ISRA 4CDWB 3H8RA 1RUE3 3HQXA 5B4NA 4EYUA 1K5MB 4Q4Y2 4OHZA 1WA6X 3PHMA 1BEV2 4QX5A 3SH5A 5ACA2 5DUUA 1ULGA 2DCYA 4O7XA 5JOXA 1SBFA 3KM5A 4N43C 1BK0A 2EXKA 3GGLA 4MLOA 2ET1A 1PGL1 1OUSA 2RV9A 4INDA 3VD7A 2ZEWA 3BTAA 4BQWA 2HLEA 5ABJA 3FZ3A 4OUEA 1C8NA 1EV13 5EWSA 1KS5A 3JZVA 3NV1A 1D4M3 1H9PA 2XJPA 5FYYA 5K0UB 2QQKA 2IZWA 2ZGPA 3I3DA 4F3JA 5AC91 3JQWA 4PIXA 2NM1A 3NMBA 5A32A 5D1IA 4AR2A 2HEVF 2WNVB 4Q4V3 2XKOA 4ZY9A 4YVSC 4F7ZA 4NHXA 1LOFC 2H0BA 2WS91 3LWCA 4Q4W1 3POYA 3ZXLA 2VCBA 1LTEA 1CWPA 3IZOA 4B4PA 5BYNA 4EN8B 3VBSC 2K46A 3LEIA 4XUPA 5FLIA 5DDJ1 3ZSLA 5EIYB 3GHNA 4ZHNA 5FO9B 2GNMA 1LHUA 3GM8A 3RYKA 5JSPA 1NE6A 4CP9A 2BEOA 1NCQA 2BNNA 2WL1A 3EYPA 4NWVA 3WY6A 3EHKA 4CCEA 3ZXEA 5C70A 4CP2A 1JZ5A 1UOJA 2WQ4A 4PI2A 3G7DA 5I8SA 1F2NA 4RGGA 5FMOL 3WX5A 1QEXA 1VBA2 4PT6A 4JHTA 3ORJA 3CL1A 3WDXA 4ASMB 2QVSB 2HBUA 3RZJA 1UQXA 1Y9GA 4U2AA 2GMPA 2RS51 4RSUA 4PBOA 5DUWA 5FYUA 4TWTA 3UKTA 2WN3A 4ET7A 5J7MA 1UY4A 2W47A 1CZSA 1JW6A 1ONAA 1SDWA 2DYCA 1QJX2 2Q5TA 2GNBA 3BI3A 4AEJA 5IFTA 5LZ6A 4CA9A 3FHAA 5A7WA 3RZGA
chains in the Genus database with same CATH topology
1UOJA 2O14A 1GWKA 2LRPA 4LKDA 4LK7A 2KR2A 4LJHA 4LK6A 1W8UA 3F95A 2Q1FA 4YWAA 4A6SA 4YW6A 3ORJA 1WCUA 1W8ZA 1WMXA 2C24A 4LKFA 1OKOA 4AL9A 2LROA 4CP9B 1W8WA 1HN0A 3ZYBA 2K46A 1GWLA 3ZYFA 5D21A 1OH3A 4BQ5A 4LKEA 4CPBD 4BQ4A 1W8TA 1WZXA 4YW7A 1W90A 1GWMA 1V0AA 3ZYHA 2WYFA 4CP9A 1W9FA 2JWPA 2VXJA 4BQ2A 3UT0A 4CPBA 4BQ3A 1L7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UOJ A;  2O14 A;  1GWK A;  2LRP A;  4LKD A;  4LK7 A;  2KR2 A;  4LJH A;  4LK6 A;  1W8U A;  3F95 A;  2Q1F A;  4YWA A;  4A6S A;  4YW6 A;  3ORJ A;  1WCU A;  1W8Z A;  1WMX A;  2C24 A;  4LKF A;  1OKO A;  4AL9 A;  2LRO A;  4CP9 B;  1W8W A;  1HN0 A;  3ZYB A;  2K46 A;  1GWL A;  3ZYF A;  5D21 A;  1OH3 A;  4BQ5 A;  4LKE A;  4CPB D;  4BQ4 A;  1W8T A;  1WZX A;  4YW7 A;  1W90 A;  1GWM A;  1V0A A;  3ZYH A;  2WYF A;  4CP9 A;  1W9F A;  2JWP A;  2VXJ A;  4BQ2 A;  3UT0 A;  4CPB A;  4BQ3 A;  1L7L A; 
#chains in the Genus database with same CATH topology
 2IXK A;  1WCQ A;  2YXS A;  2QQV A;  1QF3 A;  2KR2 A;  2WFP A;  2XQR A;  4L9B A;  5FYV A;  1RUF 2;  2WO3 A;  1G9B A;  5CFD C;  1E5S A;  4AI0 A;  4QXH A;  2BOI A;  2BV4 A;  3QH6 A;  1XPW A;  2ZGU A;  3JD7 3;  1PGW 1;  4FPG A;  2HWB 2;  4QT6 A;  5GZF A;  3VBO B;  1YEW A;  3DUI A;  2R1B A;  4NHM A;  2R06 2;  4XF1 A;  1JHN A;  3B94 A;  1FMD 1;  5IAX A;  4N53 B;  4XC9 A;  3WDV A;  4AED B;  2J1A A;  5FZ1 A;  1DDL A;  1CVN A;  1YQ8 A;  1QJY 2;  1D0G A;  3B9I A;  1UY0 A;  1AR9 3;  4FPE A;  2E33 A;  2VZT A;  1F9K A;  2VUA A;  2BFU S;  4EWD A;  3I3B A;  4CCD A;  3JUU A;  4LR4 A;  5F32 A;  1NLS A;  1I6X A;  1G9A A;  2WT1 A;  4BXS V;  2CWM A;  5BNP C;  4H7M A;  4R52 A;  3SMH A;  2G9F A;  1W2T A;  2KA3 A;  2RM2 3;  2BNM A;  1W6P B;  3WP4 A;  5KR7 A;  1J59 A;  3MFA A;  1XXN A;  2GH2 A;  3VDD A;  3A0N A;  5GKA C;  3PUS A;  4A42 A;  2YB7 A;  4DS0 A;  1LNS A;  1J58 A;  4OMC A;  2D6P A;  5LY1 A;  2F17 A;  1A3K A;  1J3Q A;  1UAI A;  5IVY A;  4WV8 A;  4Q4X 1;  3O0W A;  4EE2 A;  3VDB A;  2WAO A;  1OT5 A;  1F4A A;  1F4H A;  2UWC A;  3BOD A;  3N3H A;  2NP0 A;  2YBK A;  2Y64 A;  3DPR A;  4FXK B;  1KEX A;  1GOH A;  4W65 A;  5FP4 A;  1H8T B;  2CHH A;  2D5H A;  4COW A;  1KJL A;  4MAD A;  2JDN A;  3N7M A;  4JVA A;  2A6V A;  4Q0Q A;  4LBQ A;  4LHS A;  2QUO A;  1BEV 3;  1G86 A;  1W6Q A;  2UY8 A;  2Z69 A;  4V1P A;  1KRI A;  4AVS A;  2AUY A;  2QZ2 A;  4GH4 C;  4XTM A;  1BVP 1;  4NIG A;  4H3W A;  1NE4 A;  5EHD A;  3O1T A;  2QQM A;  3J8F 1;  3N9O A;  4AFB A;  1DYP A;  2W1W A;  2YDE A;  2RMU 1;  4RGK A;  3L2H A;  1YFU A;  4G9S B;  1NCR A;  2PYT A;  4B7E A;  1UPI A;  3BN6 A;  1CJD A;  2HWC 3;  1BMV 2;  5E8A A;  5FMD A;  1QNW A;  1AYM 1;  4P9X A;  4QAW A;  2WZP P;  1S2E A;  1AXK A;  1N47 A;  3KMH A;  3ZO0 B;  1UYZ A;  3K77 A;  2RJL A;  2DTY A;  2GC3 A;  2HWF 2;  1UX7 A;  2RS1 2;  1AL2 3;  2VPV A;  1AJO A;  3UNP A;  3I54 A;  5C7G A;  3K2O A;  4FO9 A;  1PO1 1;  3UK9 A;  3SEE A;  4AVC A;  3S57 A;  2IVI B;  4A6O A;  4AI3 A;  1LRH A;  1POV 1;  2ZGR A;  3POG A;  2E9Q A;  2EID A;  3KCC A;  4DUV A;  1WMX A;  4B29 A;  1RGS A;  1V6M A;  1XBF A;  3IDE A;  1PIV 2;  2K9Z A;  3LFI A;  2BVB A;  4FQ4 A;  5L9B A;  3USU B;  4GD4 A;  1IPK A;  2N7G A;  2OZ6 A;  3HBK A;  3DF0 A;  4Z8B A;  4N43 A;  2EIE A;  4QPW A;  1LB2 A;  1OLR A;  3KZ4 C;  3KV5 A;  2W1S A;  3VDC A;  5K8S A;  5ISL A;  3AZX A;  1MQT C;  1W8H A;  2XJR A;  2ZEX A;  1VBA 3;  2AEZ A;  3K46 A;  3POB A;  4XFB A;  2FDG A;  1ND3 C;  1R09 2;  2QQI A;  5FZL A;  1POV 0;  4XBN A;  3J26 N;  1PO2 2;  1DLC A;  1UOF A;  3LDK A;  5EXO A;  1XSR A;  5J3U A;  1I5P A;  1W6M A;  1QJX 3;  1VRH 3;  5A3T A;  1O3S A;  4YVS A;  5JCT A;  4DEV A;  1YQ5 A;  3I3M A;  4WVM B;  1QOS A;  3M3Q A;  4CCK A;  1LOF A;  4GWM A;  5KHJ A;  2GC0 A;  4LHK A;  1OH3 A;  3JQX A;  3ITQ A;  1HRI 1;  4NAO A;  1QDC A;  3E6B A;  5L19 A;  4KH9 A;  2QDN A;  4HT1 T;  5KHH A;  1CZV A;  3VBS A;  1Q3E A;  4HKW A;  2DTW A;  2P4E A;  1PNF A;  2QQU A;  3LGR A;  4RHV 2;  4QB1 A;  3WNP A;  2J7M A;  2C1F A;  1DU3 D;  1AX2 A;  2HWB 3;  3PVE A;  4CDW C;  2R07 1;  5FYZ A;  5LAT A;  1IPJ A;  1UYP A;  1K5M C;  2JE7 A;  4AG4 A;  1ULC A;  5LA1 A;  4A2U A;  1ODN A;  4YW2 A;  3O1P A;  1QJY 3;  1WW5 A;  4XDP A;  2XHN A;  2CL2 A;  4MHU A;  2YYO A;  4FP3 A;  3RJR A;  4CUG A;  5LBF A;  1OQE A;  4LQR A;  2A73 B;  2W1Q A;  4P9Y A;  5FZ0 A;  2ET7 A;  4E9K A;  4JKL A;  3KQR A;  1V0A A;  4X6Q B;  5K0U C;  1IG0 A;  3FUO A;  4PDW A;  2YG0 A;  2VMI A;  2OQ6 A;  2PMW B;  2WNV C;  1XYP A;  1BZW A;  2NN8 A;  1XND A;  2ZOE B;  3AVR A;  4AI2 A;  5CIS A;  1U5I A;  1GQH A;  1AR8 1;  4FPH A;  3ZIX A;  4Y1V A;  1C3H A;  3LOB A;  2JJ6 A;  1VBE 2;  2TNF A;  2J1R A;  4C90 A;  3SNM A;  3J7N A;  5TSW A;  4B3N A;  4XUN A;  1DGW A;  1UIJ A;  4M3C B;  4LLF A;  4AQT A;  4NO4 A;  3GF6 A;  4FAG A;  1Q43 A;  5FZK A;  2V5Y A;  1OKQ A;  1Z78 A;  2VOV A;  1I5Z A;  1QQP 1;  1OH4 A;  2WAB A;  2ENR A;  3WHT A;  2XPJ A;  2WC2 A;  1NLQ A;  3VD9 A;  5IAT A;  2ZS6 B;  3OBZ A;  1ZM1 A;  3NVC A;  1UMI A;  5IJR A;  3L9J T;  1G8W A;  4OHY A;  1Q56 A;  1YO8 A;  1W3V A;  4Y5S A;  1OMI A;  5ANN A;  4BZ4 A;  1MZE A;  4I0W B;  1JYT A;  2P1B A;  2V72 A;  5GLZ A;  2JIC A;  4K20 A;  1ZRR A;  1LUL A;  3CJI B;  3FUQ A;  5J36 A;  2PAM A;  3EB7 A;  4W50 A;  3C8X A;  5C6C A;  3PUA A;  5BNP A;  3IAP A;  3MO4 A;  3WDW A;  3K4A A;  5C3O A;  2HWF 3;  1FNZ A;  3PIG A;  1HQL A;  1IKQ A;  1F35 A;  1QDO A;  1QOT A;  2RS1 3;  1K3I A;  2VE1 A;  3HQU A;  4HZF A;  4KGG A;  5FPB A;  5FZF A;  5FZE A;  3VZJ A;  3HVD A;  3WR0 A;  1IQD C;  3SQO A;  1K5J A;  4AAX A;  1Q8S A;  3ZFE B;  3S30 A;  2ZHN A;  3V0A A;  5EYX A;  4LPL A;  4FCA A;  2D6N A;  4AVA A;  3OGJ A;  1ZBE 1;  2D44 A;  1DQ5 A;  4IET A;  1PGL 2;  2VW1 A;  3TEZ A;  1PIV 3;  3CDZ B;  2XVL A;  4YGE A;  4COY A;  3PME A;  4LBN A;  3T1L A;  1E5R A;  3PU8 A;  5LK7 B;  3VBO C;  1O6U A;  1VBC 3;  1WMF A;  5FY8 A;  4YAR A;  2XBO 1;  1QU0 A;  4GH4 A;  4KGQ A;  3WW2 A;  5AC9 2;  2ZGO A;  2WBK A;  2CTV A;  1AR6 1;  2PLV 3;  5FCC A;  2ARE A;  4N53 C;  1GKB A;  1TG7 A;  5CKM A;  4AED C;  3GZT B;  5F37 A;  2RJK A;  2DBI A;  3V0B B;  2D6M A;  1QOO A;  1RUG 1;  1DG6 A;  4LBM A;  1UOG A;  1Q8P A;  4Q4W 2;  3RYP A;  3J9S A;  3O0V A;  2OUJ A;  2NPI A;  3ZKY A;  3HPN A;  3HR9 A;  3AC0 A;  3GXU A;  5IVF A;  2E7Q A;  1GP5 A;  4QDR A;  2W87 A;  3H1M A;  3M4F A;  5DDJ 2;  4O61 A;  1UN1 A;  1H30 A;  4ONU A;  4LKF A;  2WFF 2;  2W1U A;  1AR7 1;  2VVE A;  2QQJ A;  3WNK A;  1C8M 3;  5C8W A;  2A70 A;  3HWJ A;  5LEK A;  2FDF A;  2X5I B;  2ETE A;  2PHD A;  4HSL A;  3H3Z A;  4MGS A;  2FBE A;  3AZW A;  4RHV 3;  2ES3 A;  3WNL A;  3VZM A;  1NY7 1;  2JX9 A;  4KBZ A;  3RI9 A;  3THD A;  1GIC A;  4I09 A;  2PQS A;  3VBU A;  4EN0 A;  4Q0U A;  5LEJ A;  4GMP 3;  3BGA A;  1TNF A;  1W6O B;  3DXT A;  2Y6K A;  4QHB A;  2FMY A;  1FPN 2;  4D6R A;  2VBD A;  1C5I A;  1OA3 A;  3H3L A;  1ULE A;  3OEB A;  3PUH A;  1H4G A;  1MQT A;  4MYE A;  2NMN A;  4IEY A;  4IV1 B;  3VZL A;  2Y0I A;  2GZW A;  2BWA A;  1COV 3;  2RDR A;  3NL1 A;  4OI4 A;  1ND3 A;  1SBD A;  3ZXD A;  4BIF A;  3B69 A;  3MHZ A;  4LA2 A;  2OS2 A;  4E2G A;  2BNO A;  4QGM A;  3MFC A;  1GQP A;  3SXW A;  4LTA A;  2ATF A;  3WT3 A;  5FP9 A;  4CEW B;  1R1Z A;  1HX6 A;  3BCW A;  1Y4W A;  5FUN A;  3VKN A;  2YC4 A;  2DU1 A;  5FBJ A;  3O1M A;  3IN9 A;  1OPM A;  2WWJ A;  3RZZ A;  2CYF A;  1FNY A;  4AGR A;  2HBT A;  4IGP A;  5F5C A;  4XAC A;  3JBG 1;  2CAV A;  2DUO A;  3NST A;  1ZZ6 A;  4AVV A;  2VMD A;  5I0S A;  5J37 A;  1W0O A;  3DGT A;  3ZN5 A;  3LA2 A;  5A7Q A;  4EWE A;  3HNB M;  3RMY A;  4M00 A;  4CDW A;  1FV3 A;  5I0D A;  2JDK A;  3QAC A;  2X8K A;  1GFF 2;  1K5M A;  2B5H A;  1PMI A;  3AMP A;  2DCK A;  3N7L A;  3R4D B;  4FTE A;  3V65 A;  1KDK A;  5KBF A;  1MAC A;  3RVH A;  2CV6 A;  5JAX A;  4FI9 A;  2HYX A;  5B4X A;  4Q27 A;  1OFS A;  2VZQ A;  2XXZ A;  3UKV A;  2WNU B;  1ALY A;  3AZV A;  3HJR A;  4UT5 A;  1PHM A;  1CX1 A;  2WA4 A;  3LKJ A;  4Q4X 2;  2IFW A;  1CJP A;  1J1T A;  1WBF A;  2OII A;  3ENR A;  3KHB A;  3OF1 A;  3NV4 A;  4UBH A;  5FJH A;  5K0U A;  5C3R A;  5JXG A;  3KGZ A;  1NYW A;  3K48 A;  1UZZ A;  2D93 A;  2WNV A;  4MGK E;  4UI9 L;  1XSQ A;  5JIU A;  4QPG B;  3Q8B A;  3UJO A;  1YWK A;  2VUD A;  4AZZ A;  3EMR A;  2VME A;  5FTT C;  1JN2 P;  1ZBA 1;  5AFE A;  1C1L A;  1BBT 1;  1W8T A;  4XOG A;  1UW8 A;  1FX5 A;  5FZM A;  5HV4 A;  1W6N B;  2ARB A;  2P2K A;  4K21 A;  3ZSJ A;  3AKR A;  4BQY A;  3J8F 2;  2GP5 A;  2RMU 2;  1YFX A;  5HXM A;  5A3U A;  1H8V A;  5FRA A;  5JR2 A;  4Z07 A;  1UO9 A;  3C7O A;  2WLQ A;  2CDO A;  3JCI A;  1AYM 2;  2EXJ A;  4BHP A;  5AC9 3;  4LXL A;  4Y24 A;  1VBB 3;  3SH3 A;  3DYM A;  5M0T A;  1O7F A;  2VOW A;  4HSJ A;  1W8F A;  4FFF A;  2WO7 A;  4LNV A;  2I74 A;  1X82 A;  1W39 A;  2VJX A;  2OPW A;  1W9T A;  4MSV A;  4TN7 A;  1GMM A;  3IM0 A;  5L36 A;  2D5F A;  1PO1 2;  3NJV A;  1OF3 A;  4AFA A;  3D5O A;  3HIF A;  4LKE A;  1SLB A;  4PJY A;  1JYN A;  3WXP A;  4HON A;  4FOV A;  2OQ7 A;  3I4I A;  2PQQ A;  3AXE A;  3NJX A;  1DQ1 A;  3TN9 1;  2VC9 A;  3RGB A;  4D3W A;  3WW4 A;  2PHW A;  1RED A;  3SC7 X;  5A1L A;  4YFW A;  3I59 B;  2ORX A;  1S2B A;  2WFF 3;  1S0F A;  1KQR A;  2OVU A;  3VBR B;  1W8U A;  4YGD A;  5A1A A;  4OHW A;  3ZYG A;  3OPZ A;  1AXZ A;  2WQZ C;  4PLN A;  2WT0 A;  2GC2 A;  4DIN B;  3H3U A;  1HQN A;  4ES8 A;  2Y26 A;  3NAP B;  2AR6 A;  3GZA A;  3ILF A;  2EVX A;  1VMF A;  2SBA A;  1RVF 1;  3HNY M;  5DAB A;  2H6C A;  5F5I A;  2CGN A;  3AP9 A;  3LIH A;  5LA0 A;  2W39 A;  2E53 A;  1GV9 A;  2X10 A;  2PHF A;  4HLT A;  3WHU A;  1CIY A;  1LHO A;  3DYO A;  5T55 A;  3VBO A;  2D7F A;  5A3O A;  4BIO A;  4BWO A;  3ACI A;  4PLO A;  1FPN 3;  1OD5 A;  5FPA A;  3TYJ A;  4CCC A;  4Q1R A;  3RI8 A;  2HWE 1;  4DO0 A;  4N53 A;  4AED A;  1RUI 1;  4AHY A;  3GZU C;  3P6B A;  1NQD A;  2NYY A;  1H1I A;  2WRA A;  4V2W A;  4LO4 B;  1HRI 2;  2VQU A;  1JZ7 A;  5FZH A;  3AZZ A;  3CJI C;  1SLT A;  1XNA A;  4YZ2 A;  2C5D A;  3U14 A;  3WP3 A;  1W6P A;  2WO2 A;  3ZYF A;  1OA2 A;  2XOM A;  1QJU 2;  3VKL A;  5CYY A;  1SFY A;  3ACH A;  2R07 2;  2P37 A;  1VE0 A;  5L73 A;  3UL2 A;  3ZFE C;  2P3Y A;  3G6J B;  1PVC 1;  2VNG A;  4OI1 A;  2RS3 3;  3PMS A;  1WLD A;  3O14 A;  2JDM A;  2JG9 B;  1W06 A;  1H8T A;  3VHP A;  4K9S A;  4ZON A;  5FPV A;  1AVB A;  3KT1 A;  2WSV A;  2XKP A;  3WW1 A;  3TEY A;  3MUY 1;  3OYW B;  5C3S A;  3H42 B;  1RYY A;  3CO2 A;  2PAE A;  1V9U 1;  2NMO A;  4WM8 B;  3OG2 A;  4QKF A;  4COZ A;  1VAV A;  2VMF A;  2ZGQ A;  4LHN A;  3KVB A;  1ZRF A;  4LT5 A;  1L7R A;  2GAU A;  2W94 A;  3AFK A;  4J6G A;  4NHL A;  4BLJ A;  2W5F A;  1D2S A;  5B2G B;  2DVF A;  1AR8 2;  3UV9 A;  5BV6 A;  3U1X A;  4RR3 B;  4W4Z A;  2OKX A;  3CU7 A;  4TLG A;  4BQ2 A;  3S6P A;  4C91 A;  4YM2 A;  4F83 A;  3L2Y A;  1NCR C;  3GJB A;  2BZD A;  2VVF A;  3VV1 A;  5DG2 A;  2WZE A;  3DN7 A;  3J7M A;  4QKB A;  5JR7 B;  4AI8 A;  2DWR A;  3SIS A;  5IK5 A;  4E4H A;  3QD6 A;  5F39 A;  1PX3 A;  2WT2 A;  4HPK B;  1QQP 2;  1I3H A;  2DFC A;  3K3O A;  5FQ0 B;  3ETQ A;  1TVG A;  3GCX A;  3LPG A;  5HCH A;  2X5I C;  3EBR A;  4DB5 A;  3J8F 3;  5IYY A;  1B35 B;  1DBN A;  1G7Y A;  2EF6 A;  2RMU 3;  1H2K A;  1L3J A;  1ZX5 A;  3N9Q A;  5I8Y A;  3VHO A;  5F2S A;  1LES A;  4LOT A;  4MET A;  4YZ4 A;  5JSR A;  4E8D A;  3LAG A;  5F3I A;  4DNY A;  1ULP A;  3CHX A;  3UKN A;  5IWF A;  1CAW B;  2JDZ A;  3PDQ A;  3USU A;  4ZS3 A;  5T54 A;  4A3Z A;  3AL5 A;  3ELN A;  4XW3 A;  5FP7 A;  1W8O A;  2A71 A;  2WZR 1;  5FY4 A;  3BOW A;  5JI7 A;  3ZDV A;  3NJY A;  2K0G A;  5FUI A;  4JGZ B;  3R05 A;  2WKK A;  1IG3 A;  2ZX1 A;  3I2D A;  3LQC A;  4K6B A;  4XQ4 A;  5DPN A;  4I02 A;  1RUC 2;  1UCX A;  3PLQ A;  2VD7 A;  4LOR A;  3E5U A;  3UGG A;  4JGY B;  1POQ A;  1LU1 A;  5EJ1 B;  1FAT A;  3III A;  5D2A A;  1ZBE 2;  2ADE A;  4OI2 A;  3PU3 A;  3AP6 A;  4P5Y A;  3WG2 A;  2ZEZ A;  3B9C A;  2JEN A;  4AFM A;  4ORF A;  5LA9 A;  1W9W A;  2E32 A;  4CYD A;  4MGQ A;  4URT A;  4WVM A;  3OOX A;  1W0N A;  1WLT A;  4XJA A;  4YM3 A;  1TME 1;  3H1W A;  3OBT A;  4YRD A;  4DQA A;  2FDH A;  3OEA A;  4HK9 A;  5I91 A;  1CQ9 A;  4LUL A;  2MEV 1;  1QXR A;  1CIW A;  1YFY A;  3IWZ A;  2IXJ A;  2WJS A;  3WF1 A;  1AR6 2;  1OLQ A;  4YVW B;  2ZBJ A;  2FDK A;  3NV2 A;  3PTR B;  3SIT A;  1U5X A;  3OGV A;  4C1W A;  1UD1 A;  1Y3T A;  3H0O A;  3H50 A;  3PVO A;  4K8F A;  1RUG 2;  1RUJ 1;  1DQ0 A;  4Y5Z 0;  4LO6 B;  2GNT A;  2VH9 A;  4WM7 B;  3O1V A;  1DZR A;  3N9N A;  3MIH A;  4AWD A;  1EPZ A;  2GME A;  3ZXG A;  4GUL A;  1QXP A;  3TBD A;  5GLU A;  1SMV A;  3IDB B;  3CEW A;  4RA0 A;  5T5P A;  4A7K A;  2VXJ A;  2IUW A;  4NHY A;  1D2Q A;  1VAK A;  3AL6 A;  1HRI 3;  2WNU C;  1HXS 3;  5LAS A;  2BBV A;  4PQQ A;  1S0C A;  4AQ6 A;  4CVU A;  2V09 A;  4ATF A;  1ENR A;  4YW6 A;  2P17 A;  4AI1 A;  3BIW E;  3WVJ A;  4XDQ A;  1Q8O A;  1YCI A;  2BBA A;  1QJU 3;  1NY7 2;  2R04 1;  2RR1 2;  5GZE A;  1BCX A;  3TB0 A;  5JXH A;  4QPG C;  1F8V A;  1UF2 C;  2R07 3;  5I0R A;  1NX9 A;  5CNA A;  2UY9 A;  1V6O A;  4PDW C;  3KT4 A;  5F2W A;  1YHF A;  3KT7 A;  2SLI A;  3H7J A;  4S2D A;  1WW6 A;  5KHG A;  3MIC A;  5E88 A;  2TEP A;  4MUV A;  4OHX A;  4BPZ A;  4QDS A;  3MIG A;  4Z2W A;  5LBC A;  4XMI A;  3VBH B;  4M3C A;  4HOO A;  4H14 A;  1YJK A;  2KD7 A;  1E5H A;  4AFD A;  1OFN A;  3OTF A;  3ZOI A;  4ZXK A;  5FLH A;  4YG3 A;  3K4Z A;  1V6L A;  2XUE A;  1ND2 B;  1WGP A;  3K4D A;  1RUO A;  1LU2 A;  3CZJ A;  3FX3 A;  1XC6 A;  2A6Y A;  2W3J A;  3U07 A;  1RUH 1;  4OZX A;  3NNG A;  1R1A 1;  2LRO A;  1ZRC A;  2XML A;  5K9Y A;  5LBB A;  1AR8 3;  4JDN A;  1N3Q A;  1OLM A;  2D98 A;  3CMG A;  4XIL A;  4TYS A;  1A6C A;  1RTV A;  1ZZ8 A;  1S0B A;  2IXI A;  4AQ2 A;  5EPA A;  3DCQ A;  1XE8 A;  5IT6 A;  2ZCW A;  3USS A;  3CJI A;  1XNK A;  4QWN A;  5F5Q A;  3ZYH A;  2GP3 A;  4FVV A;  3IMM A;  1WWY A;  4OYU A;  4XJZ A;  5AVP A;  1OVS A;  4JTO A;  3O7O A;  1HV0 A;  2WYS A;  3M2M A;  1GWK A;  1HKD A;  4FPJ A;  4W6X A;  4K8R B;  3FE5 A;  3T0B A;  4AGV A;  1GAN A;  5KHK A;  1KXG A;  2P5B A;  1SAC A;  4FPL A;  1HRV 1;  2ZHL A;  4LK6 A;  3HAG A;  3VBR C;  3ZYP A;  3ZFE A;  4D7S A;  3P3N A;  4FFG A;  5CAD A;  1QKQ A;  2YZ4 A;  4FPF A;  4HN0 A;  3N7J A;  5FY7 A;  3PVB B;  3C2U A;  1LKN A;  2DVB A;  4LO8 A;  3AP7 A;  2XL7 A;  4QMA A;  4AHZ A;  3NAP C;  3MI8 A;  1UMH A;  1DLL A;  1PM4 A;  2XJQ A;  3A4U A;  3HNM A;  4AFC A;  1FOD 2;  4LKS A;  3MV0 1;  1RHI 3;  3PTY A;  1LEN A;  5SV8 A;  3AMH A;  1JUI A;  2O8O A;  2YY1 A;  1W90 A;  4LEJ A;  4BA6 A;  2HEW F;  4O9E A;  2EIG A;  5EP9 A;  5JSO A;  2ZGM A;  3DEC A;  3LDR A;  2WII B;  4RFR B;  1A8D A;  2JB8 A;  2O14 A;  4Q4Y 3;  4D6S A;  3U4S A;  2ZAC A;  4QPI B;  4RN5 A;  5ACA 3;  3DKQ A;  1MEC 1;  3RZL A;  4MG2 A;  4MV2 A;  1RUC 3;  5FOB B;  3V0B A;  2K2S A;  1NXM A;  1ZBA 2;  4A3X A;  1BBT 2;  3K3N A;  4D8M A;  5E6H A;  1ZBE 3;  1OF4 A;  4R4Z A;  1NG0 A;  4LUM A;  2HEY F;  2ZX4 A;  5A70 A;  5I8T A;  2W08 A;  1ZA4 A;  5A6Y A;  1R08 1;  5CU1 A;  2GAL A;  1MR5 A;  1DHK B;  1IGO A;  3C7G A;  3WD5 A;  5HCB A;  3FLT A;  2VU9 A;  2D6O X;  2JD4 A;  3ZR5 A;  1GNZ A;  1STM A;  1W2A X;  1S0G A;  4GIQ A;  4Z1V A;  1AR6 3;  1B09 A;  2X5I A;  3T1M A;  4Y1Y A;  1L7L A;  1MS0 A;  2YV8 A;  2MPF A;  2OA2 A;  1GZT A;  4IER A;  1ZZ7 A;  1CON A;  2JG9 C;  4MO3 M;  3UJQ A;  2VG9 A;  1JUH A;  3MID A;  1H0B A;  4XJ8 A;  5ANQ A;  4DXZ A;  1RUG 3;  1V00 A;  1Y9Q A;  2GND A;  3FJS A;  2D3R A;  1EY2 A;  1LGN A;  1X9T A;  2VCA A;  4JC1 A;  4GWI A;  5JDB A;  3WF2 A;  1GP6 A;  2WWU A;  3A7Q A;  4WM8 C;  2Q8D A;  1W6O A;  3TN9 2;  3T2P A;  4AVT A;  4CUC A;  5JWP A;  4XAB A;  1JYC A;  2WUH A;  3RG0 A;  4A7Y A;  2BDR A;  1G9C A;  1XJA A;  1XB9 A;  1LHV A;  3VBU C;  5C4W B;  5D8A B;  1RUE 1;  4IV1 A;  3OBA A;  1IPS A;  3LIG A;  1YQ6 A;  4CU9 A;  4WZC A;  1Z7S 1;  4RR3 C;  4ZS2 A;  3M70 A;  3B7M A;  3GBG A;  3LSD A;  4P5H A;  4TZD A;  3BIE A;  2H0V A;  1IQA A;  3OUI A;  4QX7 A;  3AYD A;  2EAL A;  4XFH A;  3M3I A;  4CEW A;  2W46 A;  4YM0 A;  4XZU G;  4XJW A;  5J96 B;  1RVF 2;  2RR1 3;  3WDT A;  1GNY A;  2JDH A;  3UYJ A;  1C28 A;  1EV1 1;  3KLS A;  4OZO A;  2VOK A;  1RUN A;  3HQR A;  1D4M 1;  2QJV A;  5IK8 A;  5BY5 A;  3ZFG B;  3ZMN A;  1V6I A;  4IDZ A;  1VMH A;  1DZT A;  2CGP A;  2P3K A;  4C8D A;  3JB4 C;  1TMF 1;  1N3P A;  1B35 C;  1H1M A;  1GUI A;  2YC2 A;  4AF9 A;  4BDV B;  3AFG A;  3I3Q A;  1IS5 A;  3RYR A;  3O12 A;  4M4P A;  5KXD A;  1TEI A;  3U78 A;  1RUF 3;  3OBR A;  1W2N A;  3RWK X;  4R8H A;  4A7Z A;  4IEZ A;  2Y6G A;  4CCM A;  2VUJ A;  1KS4 A;  3I7D A;  4JV4 A;  1ASJ 2;  1T6G C;  2W9X A;  3FLR A;  1CX4 A;  3I3E A;  4IW3 A;  4OVE A;  4WVV A;  2CU5 A;  5F6L B;  4IGQ A;  1LCL A;  5IW0 A;  1AZD A;  4JGZ C;  5FK7 A;  4AW7 A;  2R06 3;  5KXE A;  4FFI A;  5IK7 A;  2WNU A;  1F5J A;  2BFU L;  3NQH A;  1PVC 2;  3H8X A;  4JAA A;  4JGY C;  4OUL A;  5EV7 A;  1UU6 A;  2WLP A;  3LEK A;  4FT8 A;  3LPF A;  2P6C A;  1YIF A;  2I07 B;  4O65 A;  1J84 A;  1UMZ A;  3ASI A;  3FFQ A;  3HEI A;  4XAA A;  4COV A;  4QPG A;  2HJI A;  2VQ0 A;  4XQD A;  4ARX A;  2IXC A;  4I30 A;  2Y6L A;  5CZK A;  3HD8 B;  3WNM A;  4CPB A;  5GZG A;  2CDP A;  2DUQ A;  4IEW A;  5EJ3 A;  3SHR A;  1V9U 2;  4PIY A;  1JS9 A;  1O4T A;  3MGU A;  5FY0 A;  1ACC A;  1W28 A;  4B1L A;  4XVH A;  1W6N A;  3V56 A;  3S7I A;  2WN2 A;  2XWJ B;  4YVW C;  1C57 A;  5FPL A;  1SZB A;  3SCH A;  1FOD 3;  2XON A;  3H8U A;  1DGR N;  2D6K A;  2WAA A;  4R9D A;  5A7S A;  4UW4 A;  1N3O A;  5LBE A;  4S2H A;  2DUP A;  3KCY A;  4L92 A;  5FZ3 A;  5JXJ A;  3LA3 A;  4CDU B;  2A3Y A;  4GB3 2;  3SH4 A;  1ZA7 A;  2P3I A;  4WM7 C;  3MIB A;  2F4L A;  2GN3 A;  3O1S A;  4CZS A;  1NUK A;  1VBD 2;  3KV4 A;  4CUB A;  4DPN A;  2Q1M A;  2J1S A;  3JD7 1;  1ZBA 3;  1BBT 3;  1OUR A;  3ZXJ A;  1X8M A;  1REE A;  5FBZ A;  3VHR A;  2ZX2 A;  3N9M A;  4I0B A;  4IV3 B;  2UUR A;  2JDP A;  1US2 A;  5LA2 A;  2E7A A;  1WD4 A;  1RJ7 A;  4YW4 A;  3WZ1 A;  1YLL A;  4XXA A;  2ILM A;  1IKP A;  1LR5 A;  1EAH 2;  4G4F A;  1NA1 B;  3S7E A;  2ZKN A;  3N9L A;  1U5Z A;  5GAL A;  2XUM A;  5A6Z A;  2Y34 A;  5CA6 A;  2DUR A;  3I59 A;  2YGM A;  1XU2 A;  4JHZ A;  4XE9 A;  3VBR A;  2G19 A;  2VTX A;  5FY5 A;  2C26 A;  3BKZ A;  3B5L B;  4K1Y A;  4XFI A;  1BLZ A;  3FBY A;  4KWK A;  1X36 A;  5FZA A;  4C1X A;  2RM2 1;  1CAX B;  3NW4 A;  3T08 A;  3NAP A;  5T5L A;  3VBH C;  5I93 A;  5DXD A;  3N36 A;  1UXX X;  1QIQ A;  3MDP A;  5FP3 A;  5FUP A;  4JDO A;  2ZAH A;  4RS5 B;  2VNV A;  1JOJ A;  1MS1 A;  2LUW A;  2Q1F A;  1LHN A;  4NUB A;  2R0F A;  5GJ6 A;  3OJB A;  3TN9 3;  2YBP A;  2JDY A;  3MW4 A;  5FZB A;  3KHC A;  1XNC A;  3A0K A;  3H8O A;  2YC0 A;  4XAE A;  4UXA A;  3GAL A;  1S2K A;  5EZW A;  4YW3 A;  4KI5 M;  2VXR A;  3LFM A;  2Q8C A;  2XVK A;  2DCZ A;  2YUE A;  4UF0 B;  4B1M A;  1TME 2;  2W2I A;  2GMM A;  3MV1 1;  1NZC A;  2YBS A;  4WZF A;  3C3V A;  4UFH A;  1JOD A;  2BW8 A;  4HG6 B;  4B4Q A;  1SFP A;  1J1L A;  4GJY A;  1VR3 A;  2A6W A;  1RVF 3;  4BK5 A;  1R09 3;  2BRT A;  2WS9 2;  4K3U A;  4EN7 B;  1ENQ A;  1PO2 3;  3A22 A;  4M0H A;  5A3N A;  4LOS A;  2HWC 1;  2NLR A;  3M3O A;  4Q8L A;  3RZH A;  1HW5 A;  5CG9 A;  3ZFF B;  4EZ4 A;  4P02 B;  3WP5 A;  3NV3 A;  1VP6 A;  4N90 A;  4I3P A;  2VAU A;  4BQ1 A;  4NOT A;  5F7U A;  5BNN B;  3CQO A;  3T3Y A;  2JG9 A;  1PM7 A;  3DEM A;  2IXL A;  1AL2 1;  4Y4R A;  1H4H A;  3THC A;  5KXC A;  5LCW L;  4DUW A;  1HV1 A;  2ZMN A;  5HV0 A;  1TZO A;  5FZC A;  1BKZ A;  4JKM A;  3IBM A;  2JXA A;  2J1T A;  3OYW A;  4Q26 A;  4QQL A;  1MVE A;  3NO8 A;  4YGC A;  1C1F A;  1DGL A;  3VBF B;  1H8T C;  1ASJ 3;  4WM8 A;  4QU1 A;  5CKQ A;  2JIJ A;  4ZPI A;  3E5Q A;  5FXV A;  3U4X A;  4BK4 A;  1W9S A;  5LB6 A;  1PGS A;  2R04 2;  2XJV A;  5J09 A;  4LKD A;  4OLL A;  2IFR A;  4QPI C;  4FPO B;  2RS5 2;  4QB6 A;  1NQJ A;  2AAC A;  4YYO A;  3A23 A;  3CBN A;  4RR3 A;  3AM2 A;  3WV6 A;  1YIP A;  4QX1 A;  3RDI A;  4Q0S A;  4XBL A;  1O5U A;  2BPA 2;  1O59 A;  2GSY A;  1DF0 A;  1JHJ A;  3HMY A;  5DN2 A;  1HN0 A;  1SBE A;  3LZZ A;  4K7J A;  4JQR A;  1VJ2 A;  1EP0 A;  2BP6 A;  4HPK A;  2RDS A;  3KSC A;  3MUZ 1;  1W0P A;  5FQ0 A;  3CNA A;  4Z82 A;  4RQP B;  1VRH 1;  1RUH 2;  4QQO A;  1B35 A;  3P5B A;  1R1A 2;  1PGW 2;  1H2L A;  5EFU A;  1URX A;  4KNC A;  5F1R A;  1O3Q A;  1QJE A;  1VBE 3;  3TNP B;  4XCA A;  4LBO A;  1YXW A;  4IEU A;  4NMI A;  3NNF A;  1FMD 2;  4KL1 A;  1J3R A;  2YU2 A;  1MVQ A;  3MF6 A;  1CAW A;  4GB3 3;  4NIA A;  3ON7 A;  2BWC A;  4Y1U A;  5FO7 B;  3MLK A;  1HDK A;  4HET A;  3RSJ A;  3C7F A;  2RG4 A;  2ARA A;  1PZ8 A;  3OD0 A;  1VBD 3;  1DFQ A;  2PA7 A;  2C9K A;  2NZ9 A;  3FHI B;  4JGZ A;  3AJZ A;  5DAP A;  1V6K A;  5C4W C;  4EWA A;  1W9Y A;  3F2Z A;  5D8A C;  1HRV 2;  1RUD 1;  1UXZ A;  1GWM A;  2F4P A;  3K75 B;  2UWB A;  1O8P A;  4JGY A;  4WVW A;  4MHR A;  1GBG A;  5CFC B;  1QJY 1;  2F6B A;  1IZ3 A;  2NQY A;  3AJY A;  1EAH 3;  3AP4 A;  4XFA A;  3B00 A;  4FBF A;  5CAZ A;  4E4Z A;  4ARY A;  3OUH A;  3EO6 A;  2RHP A;  3FBM A;  2VZR A;  1HIX A;  5H9S A;  1YJL A;  1DQ2 A;  3GYD A;  3ZFG C;  1M4W A;  4AAP A;  1ULO A;  4BOW A;  4A4A A;  2C0Z A;  1UKR A;  1E5I A;  5F3G A;  2ZX0 A;  3VZN A;  1D7P M;  4YVW A;  3RS6 A;  4I3G A;  5JPM B;  1EPW A;  2BJS A;  3ZLI A;  2VNR A;  3ZN6 B;  2W52 A;  1ZVF A;  3D8C A;  5CB7 A;  4BH9 A;  1ENX A;  3X29 B;  4Z2A A;  4P14 A;  4XYX A;  4ISQ A;  1LAJ A;  1UU4 A;  1OQD A;  2FMD A;  1J3P A;  2JG8 B;  3POS A;  5IUQ A;  2VZS A;  4MX3 A;  1DQ4 A;  4NRP A;  3NRU A;  3KGL A;  4WM7 A;  4XEZ A;  1MS4 A;  4NII A;  2E63 A;  2YFU A;  4JQT A;  1R08 2;  2Z79 A;  1HJG A;  2EAA A;  2ZXQ A;  2D3P A;  2Q30 A;  2VO5 A;  3D4K A;  4KU8 A;  3RPQ A;  2YFZ A;  4JTN A;  1WMD A;  3D3A A;  5JVV A;  3IB3 A;  4XUO A;  1BYH A;  2WDB A;  5FZ9 A;  3I8T A;  4M4R A;  1VRB A;  2YRO A;  1PMH X;  3Q8A A;  3WQ0 A;  1VAM A;  1JOP A;  2JD9 A;  3K51 A;  3PNA A;  2WS9 3;  1JI6 A;  2AZ5 A;  4Q4W 3;  2RE9 A;  5F6K A;  1PMJ X;  4YW7 A;  2W92 A;  3LF7 A;  2QE3 A;  4LBK A;  4QD2 A;  3TRS B;  1JH5 A;  3MF9 A;  3N35 A;  2DFB A;  3SEP A;  4AI9 A;  2QQO A;  4Q8K A;  5A6X A;  2D6L X;  2Z5W A;  5IVC A;  3W21 A;  5DDJ 3;  2I45 A;  1QY4 A;  4M0N A;  5CFD B;  1XYN A;  1NT0 A;  2UU8 A;  4JCK A;  3VB9 A;  3VZK A;  5BNO B;  2QKD A;  3NKG A;  3VBH A;  1DGW X;  1W03 A;  3BPZ A;  1YYN A;  1W8N A;  5H9Q A;  5KWR A;  3HT1 A;  4IEO A;  1Z7S 2;  1W05 A;  3WP6 A;  4AEM A;  3FHQ A;  3WQB A;  1UU5 A;  4EZH A;  4CDU C;  1QJZ A;  3HN3 A;  4LO7 A;  2VGD A;  1JZ3 A;  3I49 A;  1VLN A;  1WZX A;  1JYI A;  4MGY E;  1YI7 A;  4XHX A;  1BK1 A;  2CGO A;  2RS5 3;  1EV1 2;  1K45 A;  4LA3 A;  4XFG A;  4NPM A;  2WIN B;  3WF0 A;  4CCJ A;  1N1Y A;  1D4M 2;  2ZA9 A;  4BQ3 A;  1SLA A;  2VMC A;  3DYP A;  3E97 A;  3IDC B;  2B8M A;  3AMM A;  4XFC A;  1VBC 1;  1OVP A;  4OFG A;  2Y38 A;  3FC0 A;  3AKP A;  4LIV A;  4LJH A;  4NAM A;  2C4X A;  3VUO A;  2PLV 1;  2BUK A;  2J1E A;  3M3C A;  1CN1 A;  1TMF 2;  4QQP A;  3SLI A;  4Z92 B;  4X8P A;  5T3N A;  4M3C E;  2CAU A;  4FP2 A;  1NA1 C;  2FCU A;  4GA9 A;  1W8W A;  2O1Q A;  5CKN A;  2BGP A;  3AP5 A;  5FYM A;  3W5M A;  4ZU4 A;  2VQT A;  4RYD A;  5A3P A;  3OD4 A;  3BTZ A;  2GU9 A;  5J1X A;  3ROU A;  2BQP A;  4RL7 A;  1YRZ A;  1RUH 3;  2W68 A;  2A3X A;  5DAX A;  2OYZ A;  3B01 A;  3U75 A;  3WDY A;  4B7K A;  4EN6 B;  1OOP B;  1LOC A;  2X29 A;  3MPP G;  2QNK A;  2VM9 A;  4CCL A;  2FCT A;  4XUT A;  2BU9 A;  5DAW A;  3WNX A;  1OLM E;  2PHU A;  4BMB A;  5I0T A;  4QPY A;  4J1X A;  1FMD 3;  1C8M 1;  4GH4 B;  3T2T A;  4ZZ8 A;  3AX4 A;  4IL7 A;  4UAP A;  3KF3 A;  3BOP A;  3AVS A;  3C7E A;  3HOB A;  4L99 A;  4BE3 A;  4RS5 C;  1AYN 1;  5DUX A;  3MW2 A;  5I0U A;  5J98 B;  2VY0 A;  5GLT A;  1VB4 A;  3AKT A;  4RHV 1;  5EYY A;  5C8C B;  1MZF A;  5FMC A;  4AHW A;  4AL9 A;  4FSJ A;  4QPI A;  4DRV A;  4QHO A;  5APA A;  1NOV A;  5FMO S;  3ST7 A;  2VUL A;  4HN1 A;  3FMG A;  1JZ6 A;  3Q9O A;  4BQ5 A;  1QGL A;  1GZ9 A;  1RIN A;  1KFX L;  2ZGL A;  4N7U A;  1IOA A;  1LGC A;  3RWN A;  1REF A;  1RJ8 A;  1Q8Q A;  1ZNP A;  2A6X A;  5FK8 A;  3IIA A;  2WR9 A;  5FZ6 A;  4B4R A;  4Q4X 3;  1AXY A;  4FQZ A;  5A3W A;  1COV 1;  2J42 A;  1W2O A;  4IEP A;  3IKW A;  2I2S A;  5CEH A;  3Q8E A;  1SCR A;  1HB3 A;  4XIK A;  2PHR A;  1S0J A;  3CZU A;  1WCS A;  5FR3 A;  1VMJ A;  4MGT A;  1APN A;  2G4I A;  2VTF A;  5H9R A;  5FAX A;  3VKM A;  4CEY B;  2FDI A;  3OCP A;  1OI6 A;  1LOD A;  1U5Y A;  2Q8O A;  1PX4 A;  4KU7 A;  4CDQ B;  1SPP B;  3W58 A;  5CG8 A;  5BNN C;  4ZZ5 A;  5FZO B;  4W6Y A;  4IES A;  1AF9 A;  1SG3 A;  1K12 A;  2L9L A;  2XL9 A;  5K7P A;  5GZD A;  3QBQ A;  2VBB A;  4FPC A;  4IEV A;  1U12 A;  3EQE A;  4QX8 A;  1XRU A;  3KS7 A;  2G1M A;  1QJF A;  3VBF C;  3ES4 A;  2HWD 1;  4XIO A;  4Y1X A;  2AC1 A;  5FKB A;  5BXX A;  3VLB B;  5A6Q A;  3S0M A;  4CDX B;  4QQ2 A;  3SCF A;  1AYM 3;  5H9P A;  5DMY A;  1JZ4 A;  4OHV A;  4PCR A;  3M7A A;  2C9A A;  4RGA A;  5C4W A;  5L9R A;  5D8A A;  5DUV A;  2QTW B;  1D4V B;  4H2A A;  4BLI A;  1UZV A;  2V5D A;  4PI0 A;  5FXW A;  4L11 A;  3T30 A;  5FZI A;  3ZVX A;  2VZ1 A;  1F31 A;  3UET A;  3WF3 A;  1LED A;  3ZXF A;  1PO1 3;  4IV1 C;  4IE0 A;  2ZEY A;  3ZYI B;  4CXW A;  2TUN A;  2DDU A;  4HXC A;  3FWE A;  2VZP A;  2X05 A;  5JI9 A;  4BQX A;  1POV 3;  1X33 A;  1OUX A;  1DIW A;  2VBP A;  3NWK A;  2XLA A;  3HT2 A;  4CEW C;  3ZFG A;  3D0J A;  3PUR A;  4YLZ A;  4ZKT B;  2D3S A;  4L2N A;  3T2O A;  2D40 A;  4PF1 A;  4ASL A;  2GN7 A;  3IT8 A;  3TAY A;  4RQP C;  3KV6 A;  4AK3 A;  5FO8 B;  4RFT 0;  2QFE A;  3LOI A;  2QDR A;  4XUR A;  4IE6 A;  3T0D A;  4O9G A;  2LS6 A;  2XBO 2;  1UOB A;  3ACL A;  1S0E A;  4QM8 A;  1Z7S 3;  4MXW B;  4QXB A;  2E51 A;  1DCS A;  3PJY A;  4E4S A;  3NNJ A;  1PVX A;  5L7O C;  1DP0 A;  2E6V A;  5T5J A;  1US3 A;  1YNA A;  3S5Q A;  5GM0 A;  1UZW A;  5DQ0 A;  2VMH A;  2B7Y A;  3LEG A;  2HWC 2;  5IVJ A;  3VKF C;  1SHW B;  2DV9 A;  4Y22 B;  4Q1P A;  5FV3 A;  5T50 A;  1UY2 A;  2A75 A;  1QXJ A;  3U11 A;  2ZZQ A;  1DYK A;  1NAE A;  1VBB 1;  4RD7 A;  1TMF 3;  3M3E A;  1KJR A;  4NRQ A;  5FZ7 A;  3EJK A;  1AR7 2;  5F3C A;  5CFC C;  3ILR A;  1AL2 2;  1O5L A;  2XDV A;  2YHJ A;  2FHR A;  3O1R A;  3WCR A;  1YQ2 A;  2UYA A;  2EXI A;  2JE9 A;  4DRR A;  4A44 A;  1LOA A;  1ST8 A;  1S4C A;  1LEM A;  1U0A A;  4URA A;  5JOZ A;  1CAU B;  1QH6 A;  1CAV B;  5FZ8 A;  3URF A;  4XF0 A;  4SBV A;  2LTN A;  2EXH A;  1O4Z A;  3RFR A;  1YC6 1;  5F3E A;  3TWI A;  1H1A A;  2WFF 1;  2ZX3 A;  3KVA A;  3VZO A;  2V4V A;  4XCB A;  2A7A A;  4HVR A;  1GR3 A;  5E16 A;  2JG8 C;  1QWR A;  3ACG A;  1D0H A;  3AKS A;  2WQ8 A;  1HN1 A;  4CDU A;  5FRE A;  1MS5 A;  5A33 B;  2A5Z A;  2YPD A;  2ZTN A;  3MZH A;  1V6N A;  4A6S A;  3BU7 A;  4GZ9 A;  3PIJ A;  5FMB A;  3N7K A;  2ZGN A;  5HPO A;  2ZHK A;  4E8C A;  2XH6 A;  3U37 A;  2BTV C;  5FYT A;  5FPZ A;  1J83 A;  3AMN A;  1AX1 A;  5JUV A;  3PL0 A;  4PQ9 A;  1UZ0 A;  1SLC A;  1UYY A;  1FPN 1;  4IV3 A;  3H7Y A;  4HL0 A;  4LUK A;  1KDM A;  1MS8 A;  2W91 A;  1VRH 2;  2AEY A;  2PHX A;  5L7O B;  4KWL A;  4ERO A;  1O91 A;  2DCJ A;  3BVC A;  3ZXA C;  2JDU A;  2W95 A;  1NA1 A;  3JBG 2;  2ARC A;  5F5A A;  1SLL A;  5IFP A;  2XJS A;  1CPN A;  1IS6 A;  1CES A;  1DQ6 A;  2R30 A;  3OUJ A;  4IE5 A;  5F8P A;  3WUC A;  1C4R A;  4NID A;  2PAK A;  1JXN A;  4CU6 A;  4P9W A;  1PK6 B;  4LK7 A;  3M1H A;  4TXW A;  4YGB A;  5FWE A;  2R0H A;  4XPV A;  4YM1 A;  5A3L A;  1QQP 3;  1CAX A;  4YWA A;  3THP A;  3VL8 A;  3AB0 A;  3ZN4 A;  4Q0P A;  2XLF A;  2XJT A;  5BNO C;  2FZ2 A;  2ID4 A;  4GKY A;  4UW6 A;  2VOX A;  1OKO A;  2ZAA A;  4NE9 A;  4R9A A;  4CU8 A;  1RUD 2;  2ZGK A;  4MH0 E;  4DXS A;  1XNB A;  4RS5 A;  5SV5 A;  1XU1 A;  4J1W A;  3WUD A;  3IPV B;  2RS3 1;  1GP4 A;  4SLI A;  1XNT A;  5D21 A;  5FPU A;  1WA4 A;  2X09 A;  5L9V A;  1SFN A;  4QX2 A;  2XG3 A;  3AKQ A;  4OI0 A;  1M06 G;  2Y0O A;  1XYO A;  2G9Z A;  1W9F A;  4FOQ A;  2EIC A;  5A7O A;  2ZHM A;  1HJF A;  1H2N A;  4UF0 A;  5DZF A;  4BCU A;  1C5H A;  3M8L A;  1XE7 A;  4XF9 A;  5FYH A;  5KXB A;  5LK5 A;  1K42 A;  3ZDS A;  3AYC A;  1CD3 G;  4LBJ A;  1GZW B;  1NZI A;  3WG4 A;  4XHB A;  1WW7 A;  2YMZ A;  1FAY A;  3POI A;  3MIF A;  4A45 A;  3CKH A;  3VDA A;  5JZG B;  3OPT A;  3D0S A;  5CIR A;  4KQ7 A;  3MIE A;  1V70 A;  1PZ7 A;  1LHW A;  4L0P A;  1JYV A;  2IVJ A;  3ZFF A;  5JLV A;  5DAQ A;  1GU3 A;  2VMG A;  1DYO A;  3NKT A;  3PVN A;  1CR7 A;  1WKY A;  1IS4 A;  3RQ0 A;  2IXH A;  3UGF A;  1TE1 B;  2XVG A;  4U36 A;  1TNR A;  3FN9 A;  4QX3 A;  3LEM A;  4M01 A;  4DY5 A;  2CWS A;  4P9J A;  5BNN A;  1OOP C;  4BJ0 A;  1MS9 A;  1V6J A;  2XBO 3;  4AYU A;  2O0O A;  1T2X A;  3ALQ A;  4NPR A;  4DOU A;  1WLC A;  3OPW A;  4I01 A;  1RMU 1;  3OY8 B;  1DZQ A;  1W99 A;  4KG8 A;  2UYB A;  3H1Y A;  3MPB A;  3VBF A;  1Q5O A;  3H9A A;  1AX0 A;  2OPK A;  4XBQ A;  1LOB A;  1JZ2 A;  3RNS A;  4IE4 A;  3KD4 A;  2Z2S B;  3IMN A;  3ZPO A;  4I0A A;  5C8C C;  1RIT A;  4Y20 B;  4PIZ A;  2J1U A;  4NHK A;  3RRD A;  4I2O A;  5FLJ A;  3ZYB A;  5IK4 A;  5C3P A;  2DU0 A;  2VTX J;  4NVP A;  4BYY A;  2ERF A;  2VZ3 A;  1EUU A;  2WO1 A;  3CIH A;  2OZJ A;  3MLJ A;  1AR7 3;  3OGR A;  2P34 A;  3ZMO A;  3ZX7 A;  4Y26 A;  1NLR A;  1T6B X;  3T0A A;  4DEQ A;  1JYW A;  1O3T A;  1N1V A;  3ZIW A;  5C3Q A;  5C9A B;  5E1R A;  1Q8V A;  3LB9 A;  3PUI A;  4CP0 A;  1QNY A;  4J25 A;  3ZSM A;  2J1V A;  1PZ9 A;  1RC6 A;  3FFZ A;  5A7P A;  1RXF A;  1WCU A;  3POJ A;  3P1I A;  4CEY C;  1CPM A;  2OUH A;  2QZ3 A;  4RQP A;  1RB8 G;  4C0B A;  4CDQ C;  2VVD A;  4CXY A;  2JB4 A;  5EQU A;  3WLU A;  3TEX A;  1Y43 B;  2G9G A;  5A80 A;  2E31 A;  1RL3 A;  4DXT A;  4Q4V 1;  1VBC 2;  2HWE 2;  1O8S A;  4UFL A;  5LRS A;  3KCX A;  4MGI E;  4X6R B;  1RUI 2;  2WA3 A;  1BVV A;  2PLV 2;  5FYS A;  1QH7 A;  5AFB A;  2Y60 A;  1UL9 A;  4S2G A;  2VW0 A;  5DG1 A;  1OBN A;  4EQV A;  3AXD A;  4CDX C;  4D94 A;  2VCM A;  4EN9 B;  3VL9 A;  4XET A;  2E7T A;  1HB1 A;  3GNE A;  4GWN A;  4Y5T A;  3THT A;  3TOJ A;  3U0Z A;  5FDB A;  2ZKL A;  5ABJ B;  5DZE A;  4YZ5 A;  4E4D X;  4H55 A;  1IS3 A;  2GDF A;  4ZU7 A;  4W8J A;  2VW2 A;  2A3W A;  4FPY A;  4JKK A;  5CFC A;  3LD8 A;  4BXF A;  3JBG 3;  2GC1 A;  1FV2 A;  5A32 B;  4AQS A;  1DGR A;  3KWV A;  3ZKU A;  1HXS 1;  2KXL A;  1C8M 2;  2PFW A;  4MGZ E;  5HCF A;  5HXV A;  2B9U A;  1AYN 2;  2ORZ A;  1GZC A;  3W59 A;  3ACF A;  3WNN A;  3O1U A;  1CGP A;  4NN0 A;  1BQP A;  3AYA A;  4FAH A;  3ZM8 A;  2EIB A;  1EYB A;  3I2K A;  3Q8F A;  1QJU 1;  4CRQ A;  1SEF A;  3RZK A;  5A1F A;  3WG1 A;  1W3X A;  2R7E B;  1RUD 3;  1TQ5 A;  3ZN6 A;  3BUC A;  3WQ7 A;  2RJ2 A;  4DFS A;  3A21 A;  2QQW A;  3BAL A;  4R9C A;  4CP1 A;  4HVQ A;  5FWJ A;  3ZYR A;  3QLQ A;  2C24 A;  4DUX A;  4DZG A;  2JG8 A;  2RDQ A;  1O3R A;  3ME2 A;  4CE8 A;  4YFZ A;  4CP9 B;  2HYK A;  2MHF A;  1NCQ B;  3C7H A;  4OQ8 A;  3I2O A;  5GLW A;  1I9R A;  3N4M A;  2JKB A;  2WSU A;  1WUV A;  4XUQ A;  1ENS A;  4KWJ A;  4OUM A;  1COV 2;  5FYI A;  2VOT A;  2R6Q A;  4ITC A;  4XJ9 A;  2BGO A;  2Y33 A;  4LBQ D;  2B42 B;  2VZO A;  2PXJ A;  4FOW A;  5BUV A;  3WSO A;  1SCS A;  3LDB A;  4QQH A;  1X7N A;  5C5T A;  1H6Y A;  1A8M A;  4TTG A;  1LOE A;  3R0R A;  4K40 A;  1S0D A;  3AMQ A;  1X9P A;  4QX0 A;  2R32 A;  2BVV A;  5IAV A;  4XZP A;  4UOJ A;  4D0Q A;  2Y6F A;  1OSG A;  3R6S A;  5FOJ B;  3VD3 A;  1KFU L;  2DCT A;  5JXI A;  1AR9 1;  3B3Q E;  5IVV A;  2PHT A;  2HWD 2;  3BTY A;  5CFD A;  5A7W B;  3KB5 A;  4LE3 A;  1YUD A;  5BNO A;  1JBC A;  4BQ4 A;  4NPL A;  3IDA A;  2LW8 A;  3PJQ A;  4GAZ A;  2Y6J A;  3QOP A;  2WZR 2;  5GLV A;  4AGG A;  3I2J A;  5LRR A;  2WYF A;  5JMC A;  1GLH A;  4Y1Z A;  2QQP A;  4AEK A;  4DMI A;  2R16 A;  4M3C F;  2JWP A;  2VCC A;  1FT9 A;  4GJZ A;  1FXZ A;  3BTX A;  2Z42 A;  2V73 A;  2PHL A;  2LRP A;  4D6Q A;  4P00 B;  1S55 A;  5IVB A;  1HB4 A;  4IQP A;  5FXX A;  1RHI 1;  4XF4 A;  1A78 A;  4G3Y C;  1R64 A;  1ND2 C;  3AYE A;  2HH9 A;  4N9I A;  4LBL A;  2DF7 A;  1WD3 A;  1MPX A;  4N7I A;  5JOW A;  3J4U H;  3DXU A;  2ZGS A;  4Q4Y 1;  1BEV 1;  5ACA 1;  2YGL A;  1RUC 1;  5C33 A;  1H6X A;  2FCV A;  1AUY A;  1GQG A;  2MEV 2;  2ZMK A;  4R9B A;  3VDD B;  1I1E A;  4YW1 A;  2Q4S A;  3ETP A;  4CXX A;  3LA7 A;  4FXG B;  3CLP A;  2J22 A;  2VQA A;  3GCW A;  3B93 A;  2B4K A;  3INA A;  1PK6 C;  1XE0 A;  1ZZ9 A;  1UZY A;  1RIR A;  4XF3 A;  1OOP A;  4YZ3 A;  4ES9 A;  5HI0 A;  1RUJ 2;  4EJR A;  5G04 L;  3DPR B;  3U10 A;  4FOY A;  2LAL A;  3AK0 A;  2XJU A;  2HWE 3;  3EXU A;  4BU2 A;  1RUI 3;  4MOA A;  2ZGT A;  4NRM A;  3WIN E;  1VBB 2;  4LBQ B;  2BOJ A;  4UFI A;  4QGL A;  2AEN A;  1W6Q B;  3GJA A;  4BIS A;  1W2U A;  2IC1 A;  1XQN A;  5CBL A;  1HLC A;  2X53 S;  4L97 A;  1UX6 A;  5C8C A;  3WDU A;  1JMU B;  2QQL A;  4JRA A;  2VEC A;  3I2F A;  3OGS A;  2KM2 A;  3R4S A;  5IHR A;  4GXL A;  4WBB A;  1NCR B;  4S2F A;  4BM8 A;  2YPJ A;  2FZ1 A;  2WWS A;  3KV9 A;  1E57 A;  4MZU A;  1ZRD A;  1KGY A;  2MNG A;  4AE2 A;  2JEC A;  4GWJ A;  2QBX A;  4Q5O A;  4V2V A;  2ADD A;  4C0H A;  1LEC A;  3MEP A;  1ZZC A;  1PVC 3;  1W8Z A;  2JE8 A;  1WME A;  4NRO A;  1X50 A;  5JZG C;  4NIH A;  3I2H A;  2AYH A;  3PUQ A;  1GNH A;  1AYN 3;  1ULF A;  2E26 A;  2VL4 A;  4QXC A;  1VBA 1;  3LCP A;  3VN4 A;  4YZ1 A;  1VAL A;  1OXC A;  5C5U A;  4CEY A;  4CPB D;  3JXS A;  5GZC A;  5JMO A;  2RR1 1;  4CDQ A;  1SPP A;  4DIQ A;  1V9U 3;  5FZO A;  4JDM A;  1A34 A;  1QHD A;  1QJX 1;  1JTZ X;  3VD4 A;  2JEM A;  2OW4 A;  3LE0 A;  4HVO A;  1MS3 A;  2FDJ A;  3B02 A;  3W20 A;  4GKX A;  3NJZ A;  4MVT A;  4EV0 A;  2ZPX A;  5T5O A;  3APB A;  3CJX A;  4FFH A;  1VIW B;  2DVA A;  5EJZ B;  1UYX A;  4N43 B;  3DL3 A;  2VZV A;  4CDX A;  4IE7 A;  4XXP A;  3WG3 A;  2AGS A;  5KC5 A;  2B9V A;  2HKX A;  2C6S A;  2TBV A;  1RUF 1;  3ES1 A;  4UFJ A;  4PHZ A;  1G9F A;  4N9H A;  4KWU A;  3UGH A;  4AOC A;  4BB3 A;  5LW9 A;  2OT7 A;  1S1A A;  2GH8 A;  4ASK A;  2RDN A;  4HK8 A;  2HWB 1;  4CU7 A;  3TEW A;  3OGG A;  1LGB A;  5FY1 A;  3P3P A;  5KC6 A;  1FYU A;  2AH2 A;  4YSF A;  2R06 1;  4ATE A;  1W6M B;  3R4U A;  5DZG A;  1BJQ A;  3FL7 A;  4R4X A;  4UYB A;  4YVS B;  1UWW A;  4CSW A;  1SQ4 A;  1RXG A;  5BNQ A;  5C9A C;  2PTM A;  1UY1 A;  2RS3 2;  3F95 A;  4D69 A;  4A41 A;  2EAK A;  4UFM A;  5FIX A;  2HWD 3;  1JOB A;  3POW A;  1LOG A;  3QH7 A;  3RJ2 X;  2RVA A;  2WNE A;  3ECQ A;  3MW3 A;  2R1D A;  4DXR A;  3ZXK A;  2VR4 A;  5FP8 A;  1ZYB A;  3VBS B;  4YW5 A;  2VZU A;  4ZXE A;  2WZR 3;  3I2I A;  1XOY A;  1Y9M A;  2EA7 A;  3E1F 1;  4MXW A;  4XMA A;  3KQ4 B;  4WVZ A;  2DVG A;  1MEC 2;  3O0X A;  4GAL A;  3VKO A;  3E5X A;  2LM3 A;  3NNL A;  3DKW A;  5FFO C;  5FZD A;  4UBG A;  1FOD 1;  3VD5 A;  3KF5 A;  2WZ8 A;  5FPX A;  2OXB A;  4UW3 A;  2ZML A;  3ATG A;  3T2Q A;  3GBF A;  3D6E A;  4XFF A;  2WNO A;  1PNG A;  2XWB B;  4Y22 A;  2D43 A;  3GHM A;  4OMD A;  3MYX A;  4NR1 A;  5HBA A;  5ABJ C;  4TSV A;  1YFW A;  3OSD A;  4D7Y A;  1TME 3;  2A1X A;  1HB2 A;  4L8Q A;  3Q8C A;  3ILN A;  4PDW B;  2MEV 3;  2Q1Z B;  3D82 A;  1WLW A;  1ODM A;  3JU9 A;  4LE4 A;  5J48 A;  3WNO A;  5JPN B;  1UKG A;  1RMU 2;  1JYX A;  1SDD B;  2Y6H A;  2XQX A;  2XB6 C;  1UNB A;  4KG0 A;  1F5F A;  4H7L A;  3T09 A;  3MLL A;  5FKC A;  2QCS B;  1CAU A;  3DV8 A;  1CAV A;  4XDO A;  2D97 A;  3ZYJ B;  4CUA A;  3ZPY A;  2CY6 A;  1BMV 1;  1RUJ 3;  4F8A A;  4BME A;  1WCK A;  5FY9 A;  1YI9 A;  3HN1 A;  4COU A;  2VNO A;  4ZU5 A;  3OB8 A;  5BPX A;  4OQ9 A;  3GDB A;  3GBW A;  3AZY A;  2B46 X;  4YPJ A;  2Q8E A;  4QB2 A;  1LJ7 A;  2HWF 1;  4QM9 A;  1WCD J;  2ZAB A;  1OPO A;  2RS1 1;  5T52 A;  1JU3 A;  5F9T A;  5JIA A;  2XLG A;  1HQW A;  2XGX A;  3BU0 A;  1RUE 2;  5LWB A;  3E6D A;  4LMF A;  5E89 A;  5A33 A;  4B8E A;  1NCQ C;  4NWW A;  1KIT A;  2B45 X;  2Z4F A;  1AJK A;  4Q0V A;  2PEL A;  2Y8K A;  5ERL A;  4DY3 A;  4FTB A;  1ND2 A;  3SKV A;  3LSE A;  3TNQ A;  1AL0 G;  2XR4 A;  4UW5 A;  1PIV 1;  2R04 3;  2CSG A;  4TLF A;  3V64 A;  1P8J A;  5C71 A;  5L7O A;  3UT0 A;  3MBW A;  1QMJ A;  4XQW A;  5FZG A;  5BNP B;  2PN5 A;  4PLM A;  5FYC A;  4IXL A;  3I97 A;  1OQ1 A;  4IV3 C;  5FJK A;  4P9L A;  1VPH A;  4Y4Y A;  4W6W A;  4Q4V 2;  4HKO A;  1ZRI A;  4E2S A;  2BER A;  4HFS A;  4IEX A;  4LLO A;  2CNA A;  2IWG B;  1GOF A;  4QDQ A;  4JRL A;  1ZZB A;  4CCN A;  2FQP A;  1PK6 A;  1R09 1;  4QHZ A;  3V0A B;  4QU2 A;  1O4Y A;  1PO2 1;  1YQC A;  4K1Z A;  3O1O A;  5JOY A;  1JU4 A;  1CZT A;  4OCT A;  2YU1 A;  2QQN A;  2DBN A;  1ZRE A;  1WW4 A;  2R49 A;  3JB8 A;  4JX0 A;  5CVR A;  4FTS A;  1OA4 A;  4NJ4 A;  3J7L A;  1R1A 3;  3HBZ A;  4CCO A;  1UIK A;  2W0X A;  3POE A;  4KBB A;  3IPV A;  2JIG A;  3BB6 A;  4D7T A;  4UWD A;  3ZSE A;  4Q2F A;  3T4H B;  1L7Q A;  2UWA A;  3WF4 A;  3WQ1 A;  2DVD A;  4PBP A;  4CTE A;  3O5S A;  4FPK A;  1HXS 2;  2P3J A;  4X8N A;  4YG0 A;  1UPS A;  4IGO A;  1NKG A;  1JZ8 A;  1Y7B A;  1AHS A;  1SLI A;  1ASJ 1;  4JZR A;  4QKN A;  1G6N A;  2V4A A;  1KD7 A;  3S5A A;  4E2Q A;  4N8M A;  2B39 A;  1GZW A;  1HRV 3;  4QKD A;  5FXZ A;  4KMQ A;  3W9A A;  3E6C C;  1GSL A;  5JZG A;  4GMP 1;  3SKJ E;  3POF A;  4PF5 A;  1BXH A;  3ABZ A;  1X8E A;  3BPS A;  3SCG A;  1OD3 A;  2JDA A;  4LO5 B;  4YG6 A;  3VDD C;  2JKX A;  3UES A;  3W5N A;  1OC1 A;  5FYB A;  1G9D A;  3T4V A;  3J7H A;  3WEZ A;  2ZZJ A;  3ZSK A;  5K4L A;  3ZFF C;  1GYK A;  1H9W A;  1NXD 1;  1WBL A;  3DPR C;  4P9I A;  4QXK A;  4Y3O A;  4XJU A;  2H6B A;  4AXO A;  3RZM A;  1H2M A;  5A7N A;  1OHF A;  1N1T A;  3OY8 A;  1MEC 3;  4LIU A;  3QCW A;  1UY3 A;  4HKL A;  4HMZ A;  4GMP 0;  3GZE A;  3RMX A;  4OUS A;  3JD7 2;  3VBU B;  2BGC A;  4P9G A;  3ZR6 A;  5FZ4 A;  5A3M A;  1VBE 1;  4E27 A;  4GQ7 A;  2Q0A A;  2BYV E;  3CF6 E;  4XTP A;  4Y20 A;  1MQT B;  2OX0 A;  2O8Q A;  2P6H A;  4P08 A;  4LIT A;  4UFK A;  1R08 3;  4GB3 1;  1AR9 2;  1MZ5 A;  1ND3 B;  4YNI A;  1S0I A;  5G05 L;  1VB2 A;  1ULD A;  2ARX A;  5KHI A;  1VBD 1;  3WCS A;  2VUC A;  1IHM A;  1FI2 A;  2FD8 A;  4Q29 A;  5IVE A;  1Z0H A;  1RMU 3;  3NNM A;  4HBN A;  2RM2 2;  4MXV A;  3WW3 A;  5C9A A;  3FLP A;  1MZ6 A;  3VGI A;  4IEQ A;  1GWL A;  3WOG A;  5HCA A;  5LY2 A;  1EAH 1;  3I2G A;  4LHL A;  4AHX A;  5DAV A;  2A6Z A;  4IUG A;  4Y33 A;  4AVB A;  1F15 A;  1RHI 2;  1BHG A;  2ZJC A;  3N9P A;  1N1S A;  2XHK A;  1GOG A;  1EUT A;  5AVA A;  4HAN A;  3VHN A;  1W04 A;  4QGN A;  3IAQ A;  3BYW A;  4ISR A;  4CDW B;  3H8R A;  1RUE 3;  3HQX A;  5B4N A;  4EYU A;  1K5M B;  4Q4Y 2;  4OHZ A;  1WA6 X;  3PHM A;  1BEV 2;  4QX5 A;  3SH5 A;  5ACA 2;  5DUU A;  1ULG A;  2DCY A;  4O7X A;  5JOX A;  1SBF A;  3KM5 A;  4N43 C;  1BK0 A;  2EXK A;  3GGL A;  4MLO A;  2ET1 A;  1PGL 1;  1OUS A;  2RV9 A;  4IND A;  3VD7 A;  2ZEW A;  3BTA A;  4BQW A;  2HLE A;  5ABJ A;  3FZ3 A;  4OUE A;  1C8N A;  1EV1 3;  5EWS A;  1KS5 A;  3JZV A;  3NV1 A;  1D4M 3;  1H9P A;  2XJP A;  5FYY A;  5K0U B;  2QQK A;  2IZW A;  2ZGP A;  3I3D A;  4F3J A;  5AC9 1;  3JQW A;  4PIX A;  2NM1 A;  3NMB A;  5A32 A;  5D1I A;  4AR2 A;  2HEV F;  2WNV B;  4Q4V 3;  2XKO A;  4ZY9 A;  4YVS C;  4F7Z A;  4NHX A;  1LOF C;  2H0B A;  2WS9 1;  3LWC A;  4Q4W 1;  3POY A;  3ZXL A;  2VCB A;  1LTE A;  1CWP A;  3IZO A;  4B4P A;  5BYN A;  4EN8 B;  3VBS C;  2K46 A;  3LEI A;  4XUP A;  5FLI A;  5DDJ 1;  3ZSL A;  5EIY B;  3GHN A;  4ZHN A;  5FO9 B;  2GNM A;  1LHU A;  3GM8 A;  3RYK A;  5JSP A;  1NE6 A;  4CP9 A;  2BEO A;  1NCQ A;  2BNN A;  2WL1 A;  3EYP A;  4NWV A;  3WY6 A;  3EHK A;  4CCE A;  3ZXE A;  5C70 A;  4CP2 A;  1JZ5 A;  1UOJ A;  2WQ4 A;  4PI2 A;  3G7D A;  5I8S A;  1F2N A;  4RGG A;  5FMO L;  3WX5 A;  1QEX A;  1VBA 2;  4PT6 A;  4JHT A;  3ORJ A;  3CL1 A;  3WDX A;  4ASM B;  2QVS B;  2HBU A;  3RZJ A;  1UQX A;  1Y9G A;  4U2A A;  2GMP A;  2RS5 1;  4RSU A;  4PBO A;  5DUW A;  5FYU A;  4TWT A;  3UKT A;  2WN3 A;  4ET7 A;  5J7M A;  1UY4 A;  2W47 A;  1CZS A;  1JW6 A;  1ONA A;  1SDW A;  2DYC A;  1QJX 2;  2Q5T A;  2GNB A;  3BI3 A;  4AEJ A;  5IFT A;  5LZ6 A;  4CA9 A;  3FHA A;  5A7W A;  3RZG A; 
#chains in the Genus database with same CATH homology
 1UOJ A;  2O14 A;  1GWK A;  2LRP A;  4LKD A;  4LK7 A;  2KR2 A;  4LJH A;  4LK6 A;  1W8U A;  3F95 A;  2Q1F A;  4YWA A;  4A6S A;  4YW6 A;  3ORJ A;  1WCU A;  1W8Z A;  1WMX A;  2C24 A;  4LKF A;  1OKO A;  4AL9 A;  2LRO A;  4CP9 B;  1W8W A;  1HN0 A;  3ZYB A;  2K46 A;  1GWL A;  3ZYF A;  5D21 A;  1OH3 A;  4BQ5 A;  4LKE A;  4CPB D;  4BQ4 A;  1W8T A;  1WZX A;  4YW7 A;  1W90 A;  1GWM A;  1V0A A;  3ZYH A;  2WYF A;  4CP9 A;  1W9F A;  2JWP A;  2VXJ A;  4BQ2 A;  3UT0 A;  4CPB A;  4BQ3 A;  1L7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...