5D21A

Multivalency effects in glycopeptide dendrimer inhibitors of pseudomonas aeruginosa biofilms targeting lectin leca
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
121
structure length
121
Chain Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LecA
publication title Multivalency effects on Pseudomonas aeruginosa biofilm inhibition and dispersal by glycopeptide dendrimers targeting lectin LecA.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Sugar binding protein
total genus 21
structure length 121
sequence length 121
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07828 PA-IL PA-IL-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.430 Mainly Beta Sandwich Jelly Rolls Galactose-binding lectin 5d21A00
1OH3A 1W9FA 4LJHA 2LRPA 2O14A 1GWLA 4CPBA 1W8UA 2WYFA 2KR2A 5D21A 4AL9A 1GWMA 1UOJA 4BQ3A 1WZXA 4BQ4A 1WCUA 4LKDA 2VXJA 3UT0A 3ZYFA 1HN0A 2K46A 2Q1FA 4LKFA 1GWKA 2C24A 3ORJA 4YWAA 1L7LA 3ZYBA 4CP9A 4CP9B 4A6SA 1W8WA 1V0AA 4LK7A 1W8ZA 4CPBD 1OKOA 3F95A 3ZYHA 4LK6A 4YW7A 4BQ2A 1W8TA 1WMXA 2JWPA 2LROA 1W90A 4BQ5A 4LKEA 4YW6A
chains in the Genus database with same CATH superfamily
4H55A 2W39A 1DGRA 1TVGA 4I09A 1YQCA 4FTEA 4CP2A 1FNYA 4SLIA 4XF1A 2Q8EA 1H9PA 1JUIA 1W6QA 3LFIA 3ACLA 4NO4A 4FXGB 1G6NA 2D6NA 1I3HA 1SACA 3B02A 3I2HA 2QQMA 5A3MA 5C33A 2Z5WA 2WC2A 5FFOC 1FOD3 4V2VA 1R64A 2HWB3 4B4RA 2IZWA 4GIQA 4HETA 4DUVA 4XMIA 5F1RA 1WCQA 1ZRCA 4AI3A 2PHXA 1QY4A 1VBC2 1KDMA 4MGIE 3T3YA 2Y0IA 3LA2A 3LPFA 1LHOA 3C7OA 3CBNA 2NLRA 4AFAA 5F8PA 3WZ1A 5I0SA 5JI9A 3AB0A 2IWGB 3THCA 2R041 3P3NA 4QPGC 1MZFA 3MIHA 1HRI1 3I4IA 4LBLA 2C4XA 4URAA 2K9ZA 2WLPA 3NJVA 4P5YA 3V0AB 4XXPA 3VBUB 1REDA 4GJYA 5BPXA 4DRRA 4CXWA 3I3MA 2W1WA 3MPPG 4O7XA 3B94A 2QZ2A 2NN8A 4MXWB 5FWJA 2GU9A 3BI3A 3AJZA 2FMYA 4Q8KA 5C71A 4Y33A 5DAXA 1F4AA 3HR9A 2X5IC 3EXUA 3VDDC 2CWMA 2WINB 2IXHA 1NCRC 1KITA 2OPKA 2Y8KA 2JE7A 3K46A 2DBNA 4GH4A 2CYFA 4LBQD 3T2QA 4AGGA 2RDRA 4COYA 4FP3A 3I7DA 1BXHA 2G4IA 3I2FA 3I2OA 4DIQA 2WFF2 1RUF2 4NHKA 1IQAA 1SDDB 2QQWA 1FPN3 3C7FA 3FHIB 4FQZA 4XUQA 3U10A 2E51A 2YG0A 5ACA2 4CCDA 2LS6A 1PMJX 5TSWA 5A70A 4JGZA 3SKJE 1JI6A 2J1TA 5C4WA 1B35A 2EAKA 3UL2A 1J1TA 1WMDA 1XNTA 4HPKA 1AZDA 1AR82 1XJAA 4A44A 4XCBA 1S0GA 4DUXA 5CYYA 2W95A 2RS52 1VB2A 1V00A 2HKXA 3MLJA 4OVEA 4PI2A 4E2SA 4XAAA 1RIRA 1RTVA 1UNBA 5H9QA 1LGCA 1SLTA 4OFGA 1VBC3 1OPOA 1W03A 3MFAA 5FZ6A 3AMQA 1YQ2A 2VXRA 2DCJA 3IIAA 3ZFGA 3VZLA 4I30A 2GDFA 4L11A 4HZFA 1QJFA 5DDJ2 5IK4A 1LOFA 1VE0A 1AR72 2VW2A 4JRLA 4EZ4A 2HWB1 4BB3A 3SITA 2OZ6A 4QX7A 1AXZA 4S2FA 3CO2A 3MW3A 3CLPA 5A33B 5E16A 1HJGA 3E5QA 5L7OC 3RMYA 3AFGA 1LHWA 1S0IA 1RXGA 2XOMA 4YM3A 3DPRA 4WV8A 4XW3A 3R6SA 3KV9A 4JDNA 1Q43A 2PELA 1FYUA 3G7DA 2ZJCA 3HAGA 5A6XA 1SMVA 1POV3 2VECA 3WVJA 3BOPA 5K9YA 4C1WA 3I2GA 4ET7A 3CJIC 1GUIA 2YPDA 3I2IA 4AEDB 4HK8A 5F2SA 5FZGA 4CDXC 5EXOA 4NIGA 1VRH2 4LBQB 4LORA 3K77A 5CADA 4XOGA 3WG3A 4P5HA 1S4CA 2RMU1 2WFF3 1RUF3 4AGRA 1YXWA 1OLRA 4URTA 2PHWA 2AEZA 5FXWA 4MV2A 5ACA3 1RVF1 2D6MA 2Y6FA 3N7KA 4BK4A 3FHQA 3VZKA 2Q5TA 4CDWC 2V09A 3AFKA 3PUIA 2DU1A 2E63A 3VBFA 3S7EA 2OUHA 4CDUA 4RGGA 4Y20B 1MS5A 1BZWA 3LA7A 1UYYA 4UW3A 4GKYA 2ARBA 2IVIB 4X6QB 3ZX7A 1DGRN 2ZGOA 4RN5A 5FKCA 3NL1A 1UY1A 2WO3A 5C9AC 3OUJA 3ZXFA 1OT5A 1SG3A 4IV3A 4XDOA 2A3WA 4BIOA 1D7PM 2LTNA 4SBVA 1AR92 1XYNA 5HV4A 1FATA 3TEWA 1EV11 1H9WA 2OQ7A 2VZ3A 4N53A 1IG3A 2GMEA 2WR9A 1MZ6A 3NW4A 3VD7A 2BWAA 4CDQC 4E2GA 5EJZB 1WMFA 4XFBA 5IJRA 3PTRB 4RR3C 3RSJA 3AVSA 5HPOA 1POV0 4GD4A 2XQXA 1BCXA 1VBC1 4PDWB 2ORZA 1O3SA 3OF1A 1IS4A 1FI2A 2VZ1A 5HCHA 1BYHA 3AYAA 4NIIA 1ZA4A 5FY4A 1WLWA 2PQQA 5EIYB 1UOJA 1S0EA 1UYPA 3HIFA 2WNUA 1AR62 3POGA 3IDAA 5GLVA 3CKHA 5JXIA 5DZEA 3K48A 5FDBA 2WZR1 3KS7A 4FTSA 5IAXA 3NO8A 5GZGA 2V73A 3ES4A 5BV6A 5ISLA 1OHFA 4QX5A 5JSRA 5KWRA 3KGZA 1V6IA 2VCCA 2VZUA 5L9BA 4BDVB 3LE0A 1TME3 4LO5B 3HT2A 5E88A 5KXBA 3OCPA 4BMBA 3WSOA 5ABJC 2YU2A 4E8CA 1RJ8A 1POV1 3E1F1 4C1XA 5LY1A 5FZOB 2YBPA 3JUUA 1Q8OA 4R9BA 4XFGA 1N3QA 2P1BA 5FZ3A 3RJRA 4IEPA 1LTEA 1U5ZA 5FZ8A 4DZGA 3BN6A 5IVVA 1DQ1A 3VBSA 3ZFFA 3JZVA 4XFCA 1O3QA 1K3IA 3DL3A 4D6QA 3WDXA 1V6KA 3VKFC 5DAWA 1GZTA 4KWLA 1UD1A 1WW7A 1S2EA 1JH5A 5FZ1A 4AVVA 4Z07A 3RQ0A 1TG7A 2WFPA 2YC2A 4HONA 1HW5A 1W99A 4BXSV 3WNKA 3RZGA 3BYWA 3WNMA 3VBHC 1AR81 4CCEA 1ULGA 4CP0A 4NPRA 3URFA 2RS51 2W3JA 5D8AC 2NYYA 1W6PA 5FYMA 4QM9A 2VMFA 5DAPA 5ANNA 4COZA 3OGVA 1LOAA 2IFRA 2A6YA 5LBCA 1PO22 2FZ2A 2YBSA 4COUA 2QQNA 4AHZA 4QX2A 4MGYE 3FFZA 4Q1PA 4CDXA 5FP9A 4AR2A 1K45A 2DYCA 3N7MA 4WVMB 4I02A 4PLNA 5DDJ1 5IVFA 4QDSA 1AR71 1CAVB 3V0BA 1J3QA 1AYM1 3Q8BA 3WQ7A 3LF7A 3O0VA 3BIEA 2BV4A 1I1EA 3TBDA 4FPGA 1HB4A 4S2GA 1ND3B 1QOTA 1XNKA 5FZEA 3VDBA 2Z4FA 5FZKA 5FP4A 3P1IA 5DXDA 1SLAA 1QKQA 1W8UA 5FWEA 1OH4A 4J6GA 1WW4A 4OYUA 1ZZ9A 4LXLA 5F5AA 2NP0A 5JOXA 4W6YA 3D5OA 4M0NA 3MUZ1 5FZ0A 4NIDA 3SQOA 2FCVA 1VRH1 2JB8A 4F3JA 3M2MA 3LSEA 1X8EA 2BGPA 2CWSA 3EB7A 2R072 2WZPP 1FV2A 4X8PA 4YM0A 4W4ZA 5FY8A 5F3IA 5F3CA 4O65A 4XUPA 1XBFA 5A3WA 5A7WA 1A3KA 4Z2WA 4TTGA 4C8DA 4QMAA 3OB8A 4XILA 4DXSA 2EIDA 4N7IA 1O4ZA 4BYYA 4XTMA 2JKBA 4RQPA 4K8FA 2NPIA 2XBO1 3FWEA 5IWFA 2XPJA 3NJXA 4BE3A 3MZHA 3POSA 4MGZE 4WVZA 3EBRA 4TXWA 5C7GA 1WZXA 2WWJA 2ARXA 3CJIA 4YVWA 2HLEA 5FLHA 5LK5A 3ZFEA 3W58A 4UI9L 5FBZA 1AR91 4YW3A 3U1XA 4JC1A 1OOPA 3DV8A 3K2OA 3O1RA 2UWAA 2K2SA 5JXGA 5LWBA 1VR3A 2GN3A 2W08A 3H7JA 4LA2A 3ZYHA 5A3OA 1DCSA 3H8UA 3IDCB 3CZJA 4HKOA 3GZEA 3POFA 2X29A 3OGRA 1V6MA 3AL5A 3QH6A 5LBFA 4A3ZA 2RR13 2WAAA 3N7JA 4JKMA 4AK3A 1CAWB 1K5MA 5JCTA 2BFUL 3POBA 2XHNA 3IWZA 1E57A 1GBGA 3IAQA 1ENQA 5E8AA 3NVCA 1RUI2 4M3CA 3CL1A 5C9AA 5LW9A 4COVA 1J58A 3BTYA 1SFPA 1HN0A 3INAA 2ZGUA 3I3EA 4WM7B 3EQEA 1F8VA 1AR61 1LGBA 2CU5A 5GZCA 4LMFA 3A22A 4KG0A 5DN2A 2DUOA 2Y6KA 4BM8A 1VBB3 5HI0A 5KC5A 4IEQA 5DAVA 1V6JA 1ZRDA 1QJEA 1UN1A 1EPWA 3W20A 1RUG2 3AC0A 1YHFA 1GYKA 2R073 1W8TA 5LRSA 1KFXL 1VPHA 2UU8A 1O8SA 1W05A 2VZOA 4FOQA 2UY8A 3DXTA 3PJYA 3ZSMA 1WBFA 4KH9A 3OGGA 2BTVC 4MGSA 4AEDC 2JX9A 1O4YA 3USUB 2RS12 4PJYA 1UOFA 4AHXA 4MUVA 1GV9A 3I8TA 1HB1A 1QH7A 2ET7A 2O1QA 2D97A 3J8F2 4L8QA 4CSWA 2E31A 4BPZA 1NZIA 1QIQA 3T2OA 4RYDA 1H1MA 3Q8CA 1MQTB 4CE8A 3ZN6A 4EV0A 1SLCA 4UF0A 3PUAA 5A32B 3O1SA 3D3AA 2PHLA 1Q3EA 3TWIA 2YPJA 3HNMA 5FZFA 2CGPA 5ABJA 1SLBA 4MGKE 5FZIA 3VKOA 3CZUA 5IT6A 3HQRA 3WP4A 1YQ5A 3KV5A 4XJAA 1MPXA 1VAVA 1NCQC 3HJRA 3UYJA 4Z2AA 4ZZ8A 4UW4A 4MYEA 2R0FA 1YI7A 1PO21 1XOYA 4HXCA 4QGLA 4QT6A 5A1FA 1ENSA 4QKDA 3HNBM 2VU9A 1RUI3 2BQPA 4P14A 2W47A 3R0RA 5CB7A 4FTBA 1AJOA 1PZ9A 2ZGSA 3RI9A 1LEDA 2E32A 4Q4X3 4PQ9A 1OKQA 1C8M1 1H6XA 2HWD3 4TN7A 5KBFA 5B2GB 5IATA 3JB8A 2QE3A 2R0HA 3VBHA 3O1PA 3GCWA 2VCMA 1PNFA 2FD8A 2GAUA 1GMMA 2RM22 3FZ3A 2Y6HA 4A41A 2X09A 2WYFA 1G9DA 1CAUB 1RUH3 2WN3A 1UPSA 4JTOA 5FQ0B 3LDBA 4XIOA 4I01A 2Y34A 2VZRA 3ZYIB 4YZ2A 5HCBA 5FXVA 1QHDA 4XJ8A 3SLIA 1UYXA 2Q0AA 2XJTA 4META 4O9GA 1ND2C 4Y22B 4CCLA 2KA3A 3MIFA 3CF6E 1F4HA 2YV8A 4WZFA 2A6ZA 3KVBA 2WIIB 2R071 2B4KA 1X7NA 3LPGA 3F95A 2DFCA 2KM2A 2R32A 4N43B 4XF4A 3RFRA 3RMXA 1OBNA 3WQ1A 2UYBA 3PVOA 1JZ5A 4DNYA 1OQDA 3Q8FA 2BVVA 3OUHA 4PIYA 2W68A 3U4SA 5I0UA 4CEWB 3BTAA 1IPSA 3VDDB 2FDJA 1NCRB 1RUD2 5BNNB 2GZWA 4LO8A 1G8WA 4RD7A 1RHI3 1GFF2 1WBLA 2PHDA 3TN92 2ZHLA 3KQ4B 5ANQA 1IHMA 3VBUA 4I0BA 4AVSA 1Y9MA 3IKWA 2A6WA 2DUQA 4NAOA 4D7SA 1LKNA 5CKQA 5JLVA 2E7QA 4XACA 4AE2A 1MACA 3GJAA 1YFUA 3OPTA 2EAAA 1RUJ3 2W92A 4C91A 1JOBA 4BA6A 1BKZA 1AX2A 2R6QA 4JHZA 2DVBA 3AVRA 4LIVA 2I07B 4Y1VA 1W90A 4ZU4A 2BNOA 4EN6B 3LGRA 5FXZA 3MLLA 3PIJA 4E27A 5IUQA 4M3CF 5EP9A 5BNOB 2Y6LA 2PLV3 3OBTA 2XJQA 5T5LA 2KR2A 4EN7B 3SC7X 1J1LA 1ONAA 2VNVA 4LBOA 3N9MA 4B1LA 3F2ZA 1VMFA 5JXJA 3LB9A 4BQWA 1Q8PA 2JDZA 5DZFA 3ABZA 1ODMA 2A7AA 2X53S 4B3NA 1RUC1 2XQRA 1WCKA 5J48A 2FCTA 3S0MA 4QDRA 2XJRA 2TNFA 5L9VA 4CEYA 4JGYB 3OYWB 2RV9A 3NV3A 1PGW1 4YGDA 3D82A 3OPWA 3ZPOA 4CVUA 4BQ5A 1KD7A 3VBRA 1DGWA 2XVLA 1RUG1 3CHXA 3WCSA 4PQQA 3RZKA 4M4PA 2R042 1CAXB 1I9RA 1KXGA 1UOBA 4YRDA 2KD7A 2ZMKA 2VZVA 4AW7A 5C3PA 2BP6A 4QPIB 4LOSA 1RUD3 1SBFA 2RS11 4Q4W2 4YZ4A 4YVSB 4N8MA 4X8NA 4ZU5A 1GR3A 1HB3A 4JVAA 1UPIA 1BVP1 2JDMA 2WQ4A 3QLQA 2ZX4A 3SCFA 1U0AA 3MI8A 1W6OB 3D0SA 3J8F1 3VB9A 5A33A 5T54A 1SLLA 4LBKA 1EAH3 3NMBA 2FBEA 3VD9A 3OPZA 4Y1UA 1QJU3 4FPOB 5BNPB 4IE5A 2NM1A 3I97A 2XUMA 2C0ZA 3N9NA 4CDWB 4CCKA 2LROA 5GLUA 1G9AA 2ZOEB 2WABA 1VBD3 3NRUA 4CU8A 3WHUA 4D94A 2W46A 4DMIA 2PHTA 3WINE 1T6BX 1UOGA 3MYXA 1KS5A 1NX9A 1JUHA 1D2SA 2B46X 4I3PA 3PL0A 2R16A 1D0HA 3WW1A 3T1LA 2Q30A 1N3PA 1ZVFA 4YZ5A 2MEV1 2ZACA 3ZM8A 4QB2A 1GOFA 3VKMA 5APAA 3ZSLA 3GXUA 4LHLA 2VULA 1JZ2A 1RMU2 4BQXA 5A6ZA 1OQ1A 4QB1A 1DZRA 5FO7B 4AI8A 1URXA 2OQ6A 3ZPYA 1YO8A 4B4PA 2OKXA 1LGNA 2P3JA 5EWSA 1DZTA 4AFMA 4DPNA 1UXXX 3LOBA 2XWBB 1A78A 1C1LA 1VBA1 2VUAA 5FZHA 2DUPA 3UESA 3W5NA 3D6EA 3HN1A 4XURA 2EXHA 2D93A 2IC1A 2RM21 3WW3A 4NIHA 4YG0A 3WHTA 2A75A 3VZJA 2A6VA 2R043 2NZ9A 2EA7A 4P9JA 4EN9B 3FE5A 1HRI3 1MS0A 1MVEA 4R9DA 3ZN4A 5K0UC 3C7HA 4ZS2A 1AVBA 1I5PA 2JB4A 4QAWA 2E6VA 5LK7B 2DWRA 2EXIA 1O7FA 2ZS6B 4Q4W3 4XQDA 2VMIA 3MIBA 2B9UA 2QQVA 4RL7A 4XIKA 3RNSA 3VHOA 1UKGA 1PM7A 2J42A 1NZCA 1UIJA 4YLZA 5FP7A 4HT1T 4PDWA 4DO0A 4FSJA 3CEWA 1W8FA 2VCAA 5LEKA 4YW1A 3ES1A 2JG8B 1BEV1 4U36A 1W0NA 5FKBA 4DEQA 1RITA 3PUQA 4UFKA 4V1PA 4XHXA 1RUD1 4FI9A 3R05A 4WM8A 1NQDA 4FPYA 5FMBA 3S30A 3APBA 3TN91 4XJWA 4B8EA 2RMU2 4OHVA 4U2AA 1WA6X 2ZHNA 2HWF2 1HRV2 3DYOA 3BIWE 4LHKA 4UFHA 4F83A 1RVF2 1US2A 2W2IA 5SV5A 1RUNA 3NNJA 1EP0A 1CQ9A 3A7QA 1NT0A 4YPJA 2XHKA 5FK8A 3ZMOA 1AL22 1LHNA 1OD5A 1OVPA 2BDRA 3PHMA 5BXXA 1XRUA 4P08A 2EF6A 4LKEA 5FZOA 1CPMA 2C26A 2I74A 2JE8A 3KHBA 4XCAA 2NQYA 5FYTA 3TNQA 1VJ2A 4LNVA 5D8AB 3KD4A 5LBBA 1CPNA 4A7YA 4DQAA 4CU9A 2V4VA 5IW0A 2P6CA 3IT8A 1EV12 4ZU7A 1Y4WA 1UWWA 1LESA 2BRTA 1G86A 2IXLA 4MGQA 2F6BA 4QX8A 4S2HA 1XYPA 3O0WA 5IVCA 3GCXA 2W87A 1W6NA 3HQXA 2BJSA 1FXZA 1JOJA 4BZ4A 1F15A 1AX0A 1PNGA 2IXJA 3SH4A 2JDPA 5C3RA 1BQPA 1CR7A 2JDHA 4R4XA 4YFZA 1CZSA 3SNMA 1UKRA 4F8AA 3AJYA 5FMDA 5C8CB 1H30A 4W6XA 1C28A 5L19A 3PVNA 3M1HA 2WRAA 3FUQA 4PLOA 5KHHA 1AF9A 1HJFA 2QQIA 2IXIA 4QX3A 1X50A 2ZAAA 2WZR2 3BALA 2DFBA 3HN3A 4OUSA 4XUTA 2HWE2 3ZIXA 3HMYA 2Q8DA 3VZOA 4Q4W1 4PBOA 2OYZA 2OW4A 4QX0A 3LEKA 2D6PA 2RMU3 4B1MA 2R1BA 2EICA 1PX4A 2TUNA 4H7MA 4N43C 2ID4A 5F5QA 4YARA 2D43A 1HRV3 3BCWA 1H1AA 1RVF3 3ZXDA 1MS9A 3LIHA 3BOWA 1LRHA 1VRBA 3I2DA 1ND3A 4QXCA 2J1RA 2Q8CA 4CEWC 3FJSA 5FPUA 3S5AA 4UFMA 4KNCA 5BNNC 2YDEA 1WD3A 2CY6A 2PTMA 4DY5A 3LA3A 1AL23 4KG8A 2OIIA 3S5QA 4XQ4A 2DDUA 5D21A 1GKBA 3AP6A 1NKGA 4PIXA 2G9FA 1O3RA 4GWIA 4KQ7A 3WXPA 1H4GA 1RINA 3OUIA 1VIWB 4BWOA 4Z82A 2XL7A 3CJXA 1EV13 1IS5A 3HD8B 5GM0A 1NA1B 1DYPA 2X05A 2QFEA 3B5LB 5FYSA 2AGSA 3ZMNA 4RHV2 4AGVA 2BZDA 5FZ7A 1R091 1PK6C 1RMU1 1VAKA 2GP3A 2YXSA 3U07A 4KU8A 4YNIA 4UYBA 5A7QA 2YFZA 4QQOA 3AZWA 5BNOC 1QNWA 3ATGA 4Y1XA 1NOVA 3UJQA 5KHKA 1C57A 3AP5A 5J98B 1IQDC 1BMV1 1UZZA 3NV1A 1HX6A 2WBKA 2WAOA 2DCYA 4BQ3A 1H8TA 3B93A 1CX4A 4Z1VA 1HQNA 5F37A 2GSYA 4IEVA 4DXZA 2DCTA 4Q5OA 4UWDA 5JVVA 2O0OA 5C3SA 1YNAA 1AYM2 2HBTA 1WMEA 3OOXA 3GGLA 4JGYC 1GWKA 3ZXKA 4K7JA 1K12A 1NLRA 2WZR3 5IK8A 4A6SA 4RGAA 2R49A 4GA9A 3WR0A 5CEHA 3POEA 2BYVE 2ZEZA 4D6RA 1TNFA 3CU7A 4NUBA 1WW6A 3AMPA 5HCFA 3V64A 3OGJA 3BODA 5JMOA 3DGTA 1YCIA 1CAWA 3Q9OA 2PMWB 5FREA 1R082 3DXUA 5C6CA 1XPWA 3KCYA 4IEZA 2E7AA 4QPIC 1FX5A 4FT8A 3ON7A 1DQ6A 1WCDJ 3E6BA 3NNGA 3CMGA 4QXBA 4YVSC 3BPZA 1GNZA 4AHWA 4ATEA 4LE3A 3ENRA 4A7KA 4DY3A 4WM7A 1SZBA 5I91A 1XU2A 3AZXA 4Q0PA 3O5SA 3WX5A 2ARCA 5LASA 3C7EA 5K0UA 2F4PA 2HEYF 1QXRA 1YEWA 2HWF1 1HRV1 1OFNA 2CSGA 1OFSA 1NE6A 4GWMA 3TEZA 5BNPC 3HNYM 5LA1A 1W8OA 5T5PA 4CPBD 3O7OA 4Y4YA 1R1A2 1W9TA 3WP6A 4KBBA 4JX0A 4AEMA 2XBO2 1BLZA 1AL21 1AR83 1UY4A 3MFCA 2UWCA 4RHV3 1OLQA 5KR7A 1LR5A 2RS53 3ALQA 3AL6A 4LE4A 4W50A 5C5UA 2VVDA 5SV8A 3USUA 3VV1A 2ZX2A 2MPFA 3FX3A 3I49A 2A3XA 1GWMA 3ZYRA 1IKPA 5CKMA 2GC3A 5LA2A 4A6OA 2P6HA 3T09A 4BIFA 4XJ9A 1NCQB 1OUSA 3N9LA 4TYSA 5DUVA 1KQRA 5DQ0A 5JUVA 5A6QA 2O8OA 4FFFA 1HIXA 5FYVA 4L2NA 1MQTA 1AXYA 5DDJ3 1AR73 3M3QA 4D3WA 3LDRA 1AYM3 1UMIA 2LUWA 2WS92 2VM9A 2VD7A 5LRRA 1IKQA 2B42B 2YZ4A 5A3TA 3HVDA 3POIA 1QJX1 3MDPA 1OH3A 2AEYA 5IHRA 1LOGA 1DYOA 4JV4A 4AFDA 4BMEA 1JYCA 2O14A 4Y24A 5GLTA 4C0BA 2VC9A 4GWNA 1R1ZA 5K4LA 1SPPB 3UKVA 2QDRA 2ZEYA 1COV1 2ZGPA 1O91A 2F17A 2JJ6A 2QZ3A 4HN0A 5DZGA 4A42A 2FDGA 1ZZ7A 5C70A 4FQ4A 3DCQA 2ZHMA 5KXCA 4MO3M 2R062 3VBOB 1QNYA 1OF4A 2HWE1 3PTYA 4PCRA 4NHLA 4NHXA 4BH9A 3BTZA 1VRH3 2GNMA 3AYEA 1JZ6A 1ND2B 3RYKA 2AYHA 2WNVC 5FY1A 3IPVB 4C0HA 2JG8C 2VZQA 2ZGTA 1HXS1 1OMIA 1W9WA 3UJOA 1KS4A 3M3IA 5HXVA 4AI9A 4BQ2A 2OVUA 2YGMA 2VBBA 1BJQA 1VMHA 2HEWF 5JSOA 1LOCA 2B5HA 2WZ8A 5FZDA 2XVGA 2D44A 1IPKA 2VOWA 4QKFA 4GULA 1CAUA 2XBO3 3H7YA 4JQTA 4AL9A 5AFBA 2UY9A 1W2AX 5FYZA 5FQ0A 4OQ9A 1O5LA 4XBLA 4QPGA 2GC0A 4R4ZA 2CDPA 4Y22A 3ZO0B 1U5XA 4LHNA 1SCRA 4FOWA 1CGPA 4OI0A 2JG9B 4LULA 2XUEA 2ZEWA 3RYPA 2JICA 1AR93 4DB5A 4XF0A 3WUDA 2AH2A 4JCKA 3U75A 4AFCA 2XJVA 4HANA 3H1WA 2EIBA 2YUEA 2JIGA 3M70A 3N35A 1UL9A 2AC1A 4PT6A 1S0CA 1JN2P 4RHV1 2X5IA 1ASJ2 1DYKA 1N1VA 1PM4A 3FBMA 1NCRA 3M7AA 2VR4A 1IGOA 3MLKA 4QKBA 3RPQA 3WNXA 2P4EA 5JZGC 3BTXA 4P9GA 1IS6A 1PZ8A 2XXZA 1ZRFA 4FFHA 4HVOA 2ZABA 2EVXA 5DPNA 4GXLA 2VCBA 3VD4A 1JU4A 2IVJA 4B4QA 4QDQA 1RUE2 3KZ4C 2NMNA 2OA2A 1DHKB 1GZ9A 4AAPA 4KI5M 5L36A 2BWCA 4LKFA 1QJY1 4KWKA 4YZ3A 1VAMA 3MIEA 2P3YA 2LALA 4HVQA 1F31A 3MICA 1LHUA 1AR63 1C8M2 3NAPC 4YM2A 4BU2A 4IEWA 3MW4A 5A1AA 2CDOA 1Z7S2 4QGMA 4UT5A 4OUMA 5C8CC 2PHRA 4NAMA 3R4DB 1D4M2 3ETPA 1Y43B 5KXEA 5IK7A 3T0BA 4MSVA 2RJ2A 3EMRA 1W2NA 1R081 5K8SA 4AF9A 2J22A 2RJKA 1TQ5A 4OQ8A 2XKPA 4DFSA 5FZ9A 1LU2A 1Y7BA 3OYWA 5A3NA 1LENA 2E26A 5HBAA 2CV6A 4PI0A 1NE4A 1ZNPA 2RDNA 4J25A 4RA0A 3S7IA 4ES8A 5BNQA 3WLUA 2XDVA 4F7ZA 5LCWL 2V4AA 5L7OA 4XAEA 4L92A 1UMHA 1SDWA 5B4XA 1R1A1 1PZ7A 3ACFA 3POJA 4IEYA 3BPSA 4EQVA 4QQ2A 2XH6A 4LO6B 4YFWA 1KDKA 2VNRA 1E5SA 3VDCA 4NRPA 1SBDA 4YGCA 2GC2A 2RS32 3AP4A 2WQZC 1DQ2A 2AR6A 3C8XA 1AL0G 1JYNA 1VP6A 3W5MA 3QCWA 3SISA 1YC61 4Y4RA 3DF0A 4JGZB 1PO23 1RGSA 2Z42A 4KWUA 2Q1FA 1NA1C 1W6OA 3JD71 2OUJA 3JQXA 4H2AA 2PQSA 2ZZJA 1B35B 1S1AA 1RUE3 2B39A 4PLMA 4YW2A 5C4WB 1G9CA 1JYIA 2A71A 2VUDA 3GBGA 2QQPA 4Q0QA 2YMZA 3AMMA 3WG4A 5FR3A 1NLQA 1OKOA 1W2UA 2CGOA 2DTWA 2QCSB 2QQUA 3JU9A 4FXKB 4NRMA 2QQOA 2QBXA 4CDWA 1H6YA 2WS91 1C8M3 1EYBA 1ZZ6A 2VOTA 3E5XA 1W04A 1W6MB 3FL7A 4UBHA 2Z2SB 1P8JA 3WQBA 1PVC2 4PHZA 4XPVA 1C5HA 3POYA 2ZX3A 3K3OA 3GZUC 2IXCA 3MV11 3OD4A 1RUC2 3LAGA 4MXVA 2B8MA 1J84A 3GALA 1UZ0A 1AX1A 4NVPA 3RDIA 1UY3A 4CP9A 3TYJA 2R061 5GZDA 1PGW2 5T55A 4CDQA 5C8WA 2QDNA 5JOYA 3DUIA 2VJXA 4HSJA 4RR3A 4GMP0 5GJ6A 4ES9A 5H9SA 1FAYA 3HT1A 1D2QA 1PO12 1QDOA 3DPRB 4OZOA 3RZMA 1GQPA 1XNCA 3ZN5A 1YWKA 1W8NA 4FO9A 4B29A 2WA4A 4LO7A 2VMDA 1RB8G 1H4HA 3GDBA 2PFWA 3SKVA 4I2OA 1H8VA 1UMZA 4LEJA 1J83A 3N9PA 3UK9A 3JBG2 1QQP2 4Y26A 3QACA 1JZ8A 1GQHA 4GB31 1ZBA2 4CUCA 2Y26A 1W0OA 2ET1A 2PA7A 1PMHX 5FYBA 2OXBA 3BKZA 1Q8VA 1MZ5A 3B9CA 1E5HA 4H3WA 5CZKA 4JRAA 3A21A 4RFRB 3IN9A 2C9KA 2PAMA 1LODA 2VUJA 3VBFB 1JHJA 1DGWX 1GNYA 1S0DA 3K4ZA 2AACA 2ZGNA 5A3LA 4GMP1 5CG9A 1LECA 4XMAA 3MGUA 1ASJ1 1IZ3A 1OA4A 2E33A 5FLIA 3LCPA 3E5UA 3WF1A 5EYYA 3SEPA 1XB9A 4YGEA 5CFDC 2ATFA 1OI6A 4PBPA 1PVC3 3QBQA 3OY8A 1QXPA 1O59A 2MEV2 2VGDA 3Q8AA 3N7LA 3ZYFA 3THDA 1RUE1 4N9HA 4P9YA 5FZBA 2VBDA 3WEZA 1H2MA 3PMEA 3L2HA 1OSGA 3UGFA 4XF3A 5DUWA 3WDYA 1RUC3 2C9AA 1AUYA 2W1UA 1N1TA 1V6LA 2RVAA 3QH7A 4Y5SA 3OEAA 1BBT2 4YW4A 3IDBB 3I3DA 4Q8LA 1NQJA 1GP6A 5F5IA 5FV3A 3J7NA 1VBA2 4Y3OA 1Z7S1 4NWVA 5FY5A 3VDAA 5DUUA 1YQ6A 5AC91 5D8AA 4D69A 3KVAA 4XBQA 1D4M1 1ULCA 1RUG3 5A7SA 1PO13 5JR7B 4ARXA 4BXFA 3D0JA 3OGSA 5FO9B 4J1XA 1E5IA 1DBNA 3KF5A 4FAGA 2BOJA 1TMF2 4MGTA 4JDOA 2WNUB 4K21A 4CZSA 3VBOC 3O14A 4EROA 3QOPA 4AVCA 3TEYA 4RS5C 1HDKA 2RS13 1VBE2 4W65A 2G9GA 5HV0A 2WUHA 3WG2A 5GLWA 4S2DA 3MPBA 1ZZ8A 4AWDA 1I5ZA 2DURA 2JXAA 3J8F3 3T08A 2FHRA 1I6XA 5CBLA 1ULFA 2P5BA 1UZWA 1BEV2 4CP1A 3NJYA 2BU9A 2WWUA 4Q4Y1 5IVYA 2ADDA 2G19A 3AXDA 4AFBA 4FCAA 5FYHA 1BK1A 4N9IA 4E4DX 1LU1A 4B7EA 1ULEA 2I45A 1U12A 2GNDA 3IMMA 1HB2A 3PIGA 2VAUA 5J7MA 4MHUA 4O61A 3I59B 3J7LA 3ZFFB 3V0AA 1UY0A 3KSCA 2RS31 2JG9C 1JHNA 4QXKA 1RL3A 4JDMA 3W21A 4PF5A 1Q5OA 4MXWA 2YHJA 3L9JT 2QTWB 3PURA 3VGIA 2MEV3 5BUVA 5JR2A 1V0AA 1ZA7A 2KXLA 5CFCC 2MHFA 2MNGA 3O1VA 4IV1C 1HQWA 2B45X 3GYDA 1UIKA 5T50A 4QD2A 1S2KA 5J09A 3C7GA 5FY7A 2VTXA 1V9U1 2XLGA 4JKLA 1PK6B 4I3GA 4OHYA 2ZEXA 1BBT3 2PYTA 4YGBA 3CDZB 4HK9A 4OCTA 1VBA3 4ORFA 2CGNA 1PVC1 2A70A 2ZMNA 3PMSA 3DKQA 5F9TA 4ATFA 2RM23 1GNHA 1UCXA 1YLLA 2DCZA 2R30A 5EJ1B 4DXTA 4JAAA 5JIAA 1JYWA 3ZYGA 3SMHA 1Q8SA 4FPLA 3V0BB 1MEC2 1OLME 2EIGA 1E5RA 2GH2A 3J26N 4W6WA 4HL0A 2VBPA 5FO8B 3Q8EA 3G6JB 3H1MA 3DYMA 3WG1A 1DGLA 4FFIA 2BW8A 1S2BA 2J1VA 2R1DA 3AMHA 1UU4A 1IS3A 1L7RA 4EJRA 1SQ4A 1PO11 2Q1ZB 5FRAA 1VLNA 3OBRA 4OMDA 2YFUA 1XSRA 2CTVA 3DECA 1BEV3 3NQHA 4MLOA 2GALA 3FN9A 3LEGA 3O12A 2FQPA 3U14A 3VHNA 4NOTA 2XB6C 4XC9A 3J7MA 1ZM1A 1RJ7A 4AVAA 4XVHA 3S57A 1CWPA 2VOXA 1D0GA 3JBG1 1DQ5A 1QQP1 3TN93 1XE7A 5F6KA 3ME2A 1ZBA1 2WNEA 3RJ2X 4YWAA 5K7PA 4KGQA 2R7EB 1H1IA 1JZ7A 1ZBE1 5A7WB 3ZKYA 4GH4C 2WA3A 1O6UA 4NPMA 3LD8A 2Y60A 2BEOA 4KL1A 2WKKA 4FFGA 4UW5A 4Z92B 4HKWA 1YRZA 1XU1A 4LHSA 3VKLA 4QB6A 4AEDA 2GH8A 4GZ9A 1C3HA 4JGZC 4YVWB 3VHPA 3D8CA 4LBQA 3PVBB 4C90A 4Q4V2 1FMD2 2CNAA 5C4WC 1B35C 3MF9A 4EWAA 5JMCA 1AHSA 3RRDA 4P00B 1STMA 2QNKA 3V56A 1PIV2 2BGOA 1DP0A 1LOBA 1W8ZA 4ISRA 1R092 2UWBA 2WT1A 4FPKA 2QJVA 5FPBA 3RZJA 3AMNA 3VDDA 2CHHA 1GSLA 3SH3A 1N47A 4Y20A 1BBT1 2AREA 4MVTA 3U0ZA 5FK7A 3IB3A 4OMCA 3GZTB 1DLLA 4LJHA 3X29B 3ZFGC 2IUWA 1BMV2 1J3PA 2FZ1A 2HJIA 2LRPA 3AYCA 5F2WA 1K5MB 3VD3A 4Y1ZA 5FYIA 1W3XA 4MX3A 3H42B 2Y38A 2Z79A 4XFFA 1LOFC 4ZS3A 3O1OA 4QQLA 4AYUA 1NCQA 3M4FA 3OG2A 5EYXA 1SFNA 2Y6GA 3IIIA 1JYVA 4HFSA 1X33A 1RUOA 1C5IA 2ORXA 3WDVA 1TMF1 2Y33A 5JPNB 3SXWA 1WLTA 2AENA 1S0JA 2Y64A 2PAEA 5I8SA 3NV4A 4NRQA 5FMOS 3RG0A 1O4TA 1VBE1 5I0DA 3N9QA 3DPRC 2BNMA 4EWEA 4AI1A 4YYOA 3WNLA 2WT0A 4AVTA 5A3PA 1PGL2 2RHPA 2HWC2 2D6OX 4XF9A 1G9BA 1SHWB 2WNVB 2W0XA 3B7MA 4XEZA 3OBAA 4XZPA 3EO6A 2J1EA 4R9CA 5A6YA 1GANA 2XWJB 4MADA 3RVHA 3RZHA 1SPPA 2OT7A 1FOD2 4QM8A 3T0DA 1H2KA 1OPMA 1QOSA 3CIHA 3RWKX 3NNLA 3HEIA 2D5FA 1PGSA 4D8MA 2B7YA 2DVGA 1C4RA 3KT4A 1PMIA 4E2QA 2VG9A 3PU8A 4UFLA 3T2PA 5CAZA 1JZ3A 5DAQA 1ND2A 1SFYA 4ARYA 3NV2A 3VBFC 3MIDA 3IPVA 3RYRA 1QDCA 4TZDA 3ZN6B 4UF0B 4CDUC 1OXCA 4YW5A 3KT1A 5I0TA 5BY5A 3ZIWA 1PIV3 2L9LA 5A7OA 5FZ4A 5KHIA 3LDKA 1L7QA 2B9VA 1R093 1A8DA 1RMU3 3KMHA 4NMIA 4PF1A 5GKAC 5A7NA 3T0AA 5F7UA 5FPLA 5FZAA 1W0PA 4DEVA 5JAXA 4HLTA 4CPBA 4IV3C 3BB6A 2ZGQA 2ZXQA 2BUKA 3WQ0A 1Q8QA 5JZGB 3M3OA 1X9PA 4QHOA 2QVSB 2D6KA 4LBJA 3IM0A 4DS0A 1LOEA 1YIFA 3VZMA 1S0BA 2LW8A 5IVBA 2WLQA 1W28A 3OD0A 3T30A 1Z78A 4Y1YA 3I2KA 4AQTA 4GAZA 1WGPA 4K1YA 4P9WA 1MEC1 2WWSA 4PIZA 3R4UA 1VMJA 3HPNA 4G9SB 1QJX2 3NAPB 4HVRA 3A4UA 2G9ZA 2Z69A 4K1ZA 2JWPA 5I0RA 2IXKA 1XSQA 2Q4SA 1YUDA 4IETA 1FPN2 2GMMA 5IVEA 1W9FA 2JD9A 3WDUA 2WO7A 4UXAA 1CZTA 4LTAA 3UETA 3WD5A 1UQXA 2HWC3 2JDAA 1COV2 5FXXA 1FT9A 4IQPA 2QKDA 4KGGA 2WNUC 4BISA 4IE4A 3H8OA 1WCUA 1SCSA 4YG6A 4WVMA 2ZTNA 1QEXA 1OLMA 5FPXA 1F5JA 3U11A 1CAVA 1LULA 1UZVA 5JXHA 2QUOA 4AQ6A 3AP9A 5CA6A 2XG3A 5FPAA 5J3UA 1AYN2 1HXS2 3M3EA 3AKRA 2HWF3 3ZXJA 1QMJA 1AJKA 1OF3A 2J7MA 2ZX0A 3PUHA 4NHMA 2P37A 3NKTA 4RFT0 1W2TA 3ITQA 3N9OA 4LPLA 4AOCA 1YFXA 4CCCA 1SLIA 4QQPA 5FPVA 5A1LA 4DRVA 4IL7A 3VBSC 4E4ZA 3ZFFC 4KMQA 4FVVA 5FYUA 3ZVXA 1CIWA 3KM5A 3I2JA 4HBNA 4JTNA 3PJQA 2WO2A 2VXJA 2FMDA 3M8LA 3V65A 4CCOA 4AQ2A 1UX6A 1US3A 2VO5A 4GJZA 2GMPA 2YU1A 4Q4V1 1FMD1 1LAJA 3DN7A 3THPA 4OZXA 3WF0A 3MF6A 3U4XA 1POQA 3I3BA 4JKKA 3TRSB 3L2YA 2VMCA 3C2UA 1PIV1 3D4KA 3DKWA 4AEKA 1CD3G 1G9FA 1LCLA 2BBAA 2DVDA 2VTXJ 3WDTA 4ITCA 2Y6JA 1QJX3 2JEMA 1ENXA 5JOWA 1K42A 4EE2A 2JE9A 4BQ4A 4XXAA 3RI8A 1GZWB 5AVPA 1SEFA 1COV3 1CN1A 3E6CC 1QJY2 2ZBJA 3U78A 3USSA 1S0FA 2XLAA 3LEIA 4LO4B 3HBKA 1AXKA 4QWNA 4Q0UA 3ZSKA 4CEYB 3WOGA 1UYZA 3ECQA 5LZ6A 4IEUA 1WD4A 4AEJA 2HWE3 4OI1A 1EY2A 2W1QA 4OI2A 3CQOA 4A2UA 5C3OA 4DOUA 3ZXAC 3ZR5A 4O9EA 2JENA 3LFMA 1W6MA 3VBRB 1PGL1 3DEMA 1AYN3 1HXS3 2HWC1 3PNAA 3PDQA 4QQHA 4Q2FA 4A4AA 2ZMLA 2EALA 4XZUG 4FPHA 2W91A 3WCRA 5M0TA 1WLDA 3GHNA 3ZSEA 5FUPA 1C1FA 1A6CA 1NLSA 3AXEA 5F3GA 5IVJA 2F4LA 3AM2A 1FOD1 1ODNA 3H1YA 3WF2A 2VZSA 2YGLA 5FPZA 1VALA 4IE0A 1HV1A 1UW8A 5T3NA 3IBMA 4IEOA 4CUGA 3MO4A 3AKQA 2IFWA 2VOVA 4E8DA 1W2OA 4RQPC 3WNPA 1WKYA 2ES3A 5FY0A 3I54A 2HH9A 4UBGA 4EWDA 2YYOA 5DMYA 2JECA 1OUXA 1ST8A 5DUXA 4AXOA 5FYCA 1DZQA 4KU7A 4YVWC 3KHCA 4M01A 2OZJA 3BU7A 1HQLA 3ZFEC 2VMGA 4UOJA 1H2LA 4ZPIA 3VUOA 3HWJA 5CFDB 3JD72 1OOPC 2VY0A 1TME2 5I8TA 2DF7A 4ZXKA 3MBWA 5L73A 2C24A 1YI9A 3H3UA 4M00A 3A23A 4KBZA 1QJY3 2GP5A 1NXMA 4DUWA 5A32A 5IYYA 4IGQA 4LK6A 4YW7A 4D6SA 4M0HA 2ZGKA 1FV3A 2SLIA 1K5MC 3WW4A 1XNDA 1X36A 5FAXA 1NAEA 2K0GA 4K8RB 1FPN1 5EFUA 5F5CA 5FJKA 2V72A 3UGHA 4IE6A 3MEPA 2H6CA 3WW2A 1W8HA 4LITA 4M3CE 1A34A 1R083 4Z8BA 4CXXA 2YY1A 3TNPB 3KV4A 2A1XA 1GZCA 5FZLA 3W59A 4BOWA 1NUKA 2UURA 4XUNA 2WQ8A 1M06G 1F35A 1JOPA 3ZXLA 4LOTA 4K3UA 2ILMA 1UU6A 4RS5B 1GICA 1LEMA 5JOZA 1ACCA 1DG6A 3RZZA 2X8KA 4LT5A 2OS2A 4FBFA 2WJSA 1AYN1 4XUOA 1U5IA 2ENRA 1GP5A 2W9XA 1KJRA 5FP3A 2XMLA 1R1A3 3FFQA 1GOGA 4ZONA 3BVCA 4Q27A 1CONA 4WM8B 5FUIA 5AFEA 1REEA 4GB32 3ILRA 4GALA 5FIXA 3GF6A 4LKDA 3B00A 3WNOA 2RDQA 1JW6A 4WVVA 4UFIA 2FDHA 4N90A 1KRIA 4X6RB 4CYDA 4OHXA 1DIWA 5JDBA 1UO9A 3HBZA 4QU2A 3ILFA 2HEVF 2VL4A 1M4WA 2J1UA 1JU3A 3JD73 3ZOIA 1MS8A 4WZCA 4FAHA 3PU3A 1GLHA 1KGYA 4YSFA 4I0WB 3N4MA 2DVAA 4N43A 2V5DA 1U5YA 3GZAA 4L0PA 5CVRA 5CFCB 1X8MA 3NNMA 4IV1B 4UW6A 3NWKA 4L97A 4CEWA 1ULOA 1KJLA 4GQ7A 4ASLA 2WS93 2FDKA 2TEPA 4LBNA 5GALA 5BNNA 1JYXA 5EHDA 2Y0OA 2D6LX 2FDFA 2DVFA 4HN1A 3I59A 2VQTA 3TOJA 2WFF1 1APNA 1RUF1 1W6QB 4OULA 2A3YA 2VOKA 4XDPA 5DG1A 3VLBB 5ACA1 1XNAA 2ZX1A 1N1SA 2XR4A 4HOOA 1QJZA 2W1SA 3P6BA 3AKPA 2G1MA 5E89A 4XFAA 2ETEA 4QU1A 3ACHA 1Z0HA 4Q0SA 3UGGA 1QU0A 2J1AA 3OBZA 1ZRIA 2VH9A 4LLFA 4BK5A 1O8PA 3TB0A 1W6NB 2VNGA 3H3ZA 1MS4A 1XQNA 5E6HA 4GKXA 4L9BA 1PX3A 2WL1A 2R063 4HG6B 4G3YC 4LIUA 3ZDSA 3FBYA 4Y5Z0 2PHUA 1PK6A 5AC92 4ISQA 3ZYPA 3RZLA 5C5TA 5J96B 2XLFA 3KB5A 5BNOA 5LB6A 3KF3A 1YJLA 3VD5A 1UY2A 4LKSA 4E9KA 2VMHA 5JPMB 1IPJA 2LM3A 3SCHA 3FLPA 2WT2A 3C3VA 3AKTA 1T2XA 2ERFA 2XONA 5LA0A 3ZKUA 1UAIA 1UU5A 1Y9QA 3LSDA 4P9XA 3T4HB 3AZVA 3JB4C 4IERA 5CIRA 3UNPA 4GB33 3VL9A 1UF2C 4MH0E 1L7LA 4JGYA 1DLCA 4NE9A 4XJUA 2A5ZA 4YG3A 2OX0A 2SBAA 5A80A 2RR12 4BQYA 4NROA 2EXJA 1TZOA 3FLTA 3PLQA 2BOIA 2P3IA 4Q4Y2 1ZYBA 3VHRA 3MV01 4YW6A 3OTFA 4GH4B 1W9YA 3GJBA 1CAXA 4YM1A 1MS3A 3WY6A 1N3OA 4EN8B 3H8XA 4XYXA 1H0BA 4IUGA 4GMP3 2VQAA 4TSVA 3VBUC 1MZEA 5C3QA 1ASJ3 2YC4A 2ZA9A 3LZZA 1VBB2 3LQCA 4OHWA 4QPIA 5EQUA 2CL2A 3ACGA 1RXFA 4YVSA 1J59A 3H9AA 2A6XA 4JQRA 2J1SA 3TEXA 1BVVA 1EUUA 1TME1 1HV0A 2BFUS 4HPKB 4R9AA 2WNOA 3MUY1 4CTEA 1XE0A 4FOYA 2JD4A 4LR4A 2VNOA 5BNPA 2PN5A 4LBMA 4EZHA 1V9U2 3HQUA 2WN2A 2ZGLA 4ASMB 1QF3A 1QOOA 1ULDA 1O3TA 5FUNA 5FOJB 1NXD1 4LQRA 4I0AA 3IDEA 1Z7S3 4WVWA 3R4SA 3A0NA 1W3VA 3B69A 3ACIA 3KWVA 3O0XA 3RGBA 3JCIA 2JDYA 3ZFGB 5AC93 1JZ4A 4MOAA 1D4M3 1H8TB 1HLCA 3U37A 4Y5TA 5IFTA 2C6SA 1CJPA 2DTYA 4W8JA 1DDLA 4CU7A 4OI4A 5FY9A 3VZNA 5T5JA 4CEYC 1XYOA 2V5YA 3IMNA 5BYNA 3FMGA 4TWTA 4XFIA 1JXNA 1CX1A 1JMUB 1V70A 5JSPA 5KXDA 1YFYA 3ILNA 3VBRC 5L9RA 1CJDA 3LKJA 4IDZA 3KCXA 2HYXA 1ZRRA 2E7TA 3K51A 4AAXA 1Y3TA 2VVEA 3GHMA 2VQ0A 3RWNA 1DU3D 4Q4Y3 2P2KA 1MVQA 4CU6A 2E9QA 5I8YA 2BPA2 4HMZA 3NNFA 5FLJA 2A73B 2D5HA 3NSTA 3BGAA 4ONUA 4QXHA 3FC0A 4DXRA 2VMEA 3UT0A 1OVSA 4Q4X2 3ZXEA 3MHZA 5CG8A 3E6DA 4JZRA 3LOIA 4OUEA 2HWD2 2W5FA 2ZZQA 4ASKA 2N7GA 5KHJA 1ZREA 3PVEA 2RS33 1QH6A 2VQUA 1LNSA 3IAPA 3ST7A 1ZBE2 5FZCA 2X10A 4B7KA 3K75B 5T52A 1DF0A 4AQSA 2OPWA 3MIGA 4NWWA 1SBEA 2C1FA 5FZMA 1LHVA 2WNVA 2P3KA 1RUH2 5FOBB 2JG8A 3M3CA 3KV6A 4IGOA 4CDUB 3AKSA 1TNRA 5KC6A 4Q1RA 4XBNA 1KEXA 5HCAA 3J9SA 3SHRA 3WF4A 4CUBA 1XE8A 5H9PA 1V9U3 3K3NA 4N7UA 3QD6A 2UYAA 2BERA 3AZZA 4LUKA 4OLLA 1MR5A 3WNNA 5KHGA 1D4VB 2WZEA 4IV3B 4QHZA 4TLFA 3ETQA 2AUYA 3H8RA 3T2TA 3NJZA 2JKXA 2BGCA 1UXZA 4N53B 4IESA 2FCUA 1WWYA 4CCJA 1WCSA 3KT7A 5J1XA 1YFWA 3EYPA 3N36A 5JI7A 4BLJA 4Q26A 3GNEA 5JWPA 3O1TA 3FUOA 1RHI2 5H9RA 1NG0A 2VW0A 5FTTC 3ZLIA 3ASIA 4XHBA 1DFQA 5JZGA 5CKNA 1BHGA 4L99A 4IE7A 2WSVA 5CNAA 3THTA 3GBWA 2WO1A 5DABA 3POWA 2K46A 1RUJ2 1YJKA 2XJUA 2GN7A 2ZKNA 3TAYA 2XJSA 2GC1A 3JBG3 1XNBA 1F9KA 2ZGRA 1QQP3 3KCCA 4NN0A 5GLZA 3NKGA 1TE1B 4PDWC 5IFPA 1ZBA3 4XTPA 1ZZBA 5T5OA 3NAPA 2PLV2 5J36A 3BU0A 3OEBA 1OC1A 3LWCA 1ZBE3 2RR11 4CCNA 1DQ4A 1NY72 3WF3A 3WP5A 1UZYA 1S55A 5C8CA 1REFA 2ZPXA 4K40A 1CESA 1OA2A 2YBKA 3W9AA 4BQ1A 1PHMA 4FP2A 1ENRA 4WM8C 4ZZ5A 2ZGMA 4H14A 3E97A 3N3HA 5FP8A 4ZKTB 2D3RA 4XABA 3K4DA 4CXYA 5FMCA 4QPGB 3UKNA 4RGKA 2EIEA 2D7FA 3MW2A 5FCCA 3VBSB 5FJHA 2AZ5A 1NYWA 1VBB1 4P9LA 1ZZCA 3OJBA 4LLOA 4EYUA 3ZR6A 5GZFA 5D1IA 4BJ0A 4QGNA 2XJPA 3AP7A 2RJLA 3O1MA 4XDQA 2PXJA 3OSDA 4NHYA 2CAUA 1X9TA 4QX1A 1WLCA 4K9SA 5F32A 5LY2A 2HBUA 2VPVA 4J1WA 4LUMA 2X5IB 4E4SA 2DCKA 3LEMA 1W6PB 1CIYA 2NMOA 1K5JA 3EHKA 1JTZX 3CNAA 1O5UA 2XGXA 3FLRA 3SH5A 5K0UB 1V6OA 2VTFA 4QHBA 3GBFA 5LATA 4KWJA 2E53A 1T6GC 1F5FA 1FNZA 4YZ1A 3AK0A 1EAH2 2VVFA 1B09A 4AZZA 1QJU2 3WUCA 4P9IA 1J3RA 3ORJA 2H0VA 1NA1A 1TMF3 1VBD2 4MG2A 3AYDA 1LJ7A 5E1RA 2Q1MA 1VBE3 4HSLA 5A7PA 1CVNA 1H2NA 1KFUL 2VE1A 3A0KA 5F6LB 3ELNA 2D3PA 1GWLA 2JDNA 1IG0A 1PVXA 1JYTA 2PHFA 1GZWA 1RC6A 1GP4A 1N1YA 5FBJA 1RUI1 3VN4A 5EJ3A 1WW5A 4CCMA 1OA3A 4G4FA 5G04L 2H0BA 1JS9A 3P5BA 2JDUA 4GWJA 4Q4X1 4QPYA 3DYPA 4IW3A 2ADEA 4FPEA 2HWD1 5G05L 1QWRA 4LK7A 4Q0VA 1GU3A 4XJZA 2TBVA 1ND3C 2O8QA 3KLSA 4TLGA 5L7OB 2QQJA 3H50A 2RE9A 1JBCA 1GOHA 3H3LA 2CAVA 3B9IA 5AVAA 3S6PA 4D7TA 4UFJA 5EV7A 4FPJA 1BK0A 4RQPB 1W06A 1RUH1 1HRI2 4R52A 2DU0A 2FDIA 3ZSJA 3LIGA 2HYKA 1IOAA 1RYYA 2VUCA 3T4VA 4LA3A 5B4NA 3CJIB 5EPAA 4A45A 3H0OA 2BNNA 1W9SA 4AHYA 3SCGA 2D98A 2QQKA 1YIPA 1CZVA 4CDXB 3ZFEB 2VW1A 2ZKLA 4ZY9A 2BBVA 1EUTA 1OURA 1YQ8A 4XETA 5I93A 1DQ0A 5CISA 1OOPB 3ZYBA 4V2WA 1Y9GA 4FPFA 4WBBA 5ERLA 1QGLA 1W39A 1WA4A 5F3EA 5LA9A 1MS1A 5HXMA 3O1UA 1XXNA 3SEEA 2W52A 1MEC3 1WMXA 2H6BA 1C8NA 5CU1A 2WYSA 3PUSA 2GNTA 3K4AA 4P02B 4DINB 1RHI1 3B01A 1V6NA 4MHRA 1F2NA 4XQWA 5FYYA 1H8TC 3FHAA 2Q8OA 3T1MA 4D0QA 4IGPA 1GQGA 1VB4A 4M3CB 5CFDA 5C9AB 2ZAHA 3GM8A 4M4RA 1UX7A 4EN0A 4XFHA 2ARAA 4R8HA 4MZUA 2RG4A 3P3PA 2DBIA 4IXLA 3WP3A 4HKLA 5LEJA 1RUJ1 3RS6A 2VZTA 2YC0A 3ROUA 4CP9B 4OHZA 4CDQB 1HN1A 1ALYA 2XKOA 2I2SA 4RR3B 3J4UH 3UV9A 3WDWA 2PLV1 2WDBA 4CUAA 4D7YA 4A7ZA 4FPCA 1NY71 1QXJA 1EPZA 2JDKA 2JIJA 4CRQA 1Q56A 3KGLA 5EZWA 2EXKA 5JIUA 4WM7C 2HWB2 2BVBA 2XVKA 1X82A 1YYNA 2YROA 3EJKA 4K6BA 4RSUA 5D2AA 4NIAA 1OQEA 2XL9A 4FOVA 3KQRA 4COWA 3ZYJB 2D40A 5GZEA 4K20A 2VZPA 5A3UA 2QQLA 3VBOA 2DV9A 4RS5A 2C5DA 1W8WA 3JQWA 4Q4V3 1FMD3 5F39A 4Q29A 1L3JA 1G7YA 3ZXGA 4UAPA 4ZHNA 3I3QA 4NJ4A 3AX4A 2ZCWA 5IAVA 4BLIA 4BCUA 3ZDVA 4ZXEA 3WT3A 4H7LA 4A3XA 4INDA 5FMOL 5ABJB 4AI0A 4AG4A 3HOBA 3UKTA 2PAKA 2W94A 4QKNA 2P34A 2P17A 2D3SA 3VKNA 2YB7A 3OY8B 4XE9A 3J7HA 4N53C 3JXSA 3VL8A 1MQTC 1EAH1 5DG2A 2ZHKA 4AI2A 3AZYA 2JG9A 4JHTA 4CA9A 5IK5A 1OD3A 3BUCA 1QJU1 5LBEA 4AVBA 4BHPA 1HKDA 5J37A 3WV6A 1XC6A 1LB2A 2GNBA 2WSUA 3B3QE 4QPWA 1A8MA 1ULPA 1TEIA 5CFCA 4NPLA 2RDSA 1VBD1 4NR1A 4IV1A 1ZX5A 1JODA 3IZOA 4E4HA 4IEXA 3VBHB 1WUVA
chains in the Genus database with same CATH topology
1OH3A 1W9FA 4LJHA 2LRPA 2O14A 1GWLA 4CPBA 1W8UA 2WYFA 2KR2A 5D21A 4AL9A 1GWMA 1UOJA 4BQ3A 1WZXA 4BQ4A 1WCUA 4LKDA 2VXJA 3UT0A 3ZYFA 1HN0A 2K46A 2Q1FA 4LKFA 1GWKA 2C24A 3ORJA 4YWAA 1L7LA 3ZYBA 4CP9A 4CP9B 4A6SA 1W8WA 1V0AA 4LK7A 1W8ZA 4CPBD 1OKOA 3F95A 3ZYHA 4LK6A 4YW7A 4BQ2A 1W8TA 1WMXA 2JWPA 2LROA 1W90A 4BQ5A 4LKEA 4YW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OH3 A;  1W9F A;  4LJH A;  2LRP A;  2O14 A;  1GWL A;  4CPB A;  1W8U A;  2WYF A;  2KR2 A;  5D21 A;  4AL9 A;  1GWM A;  1UOJ A;  4BQ3 A;  1WZX A;  4BQ4 A;  1WCU A;  4LKD A;  2VXJ A;  3UT0 A;  3ZYF A;  1HN0 A;  2K46 A;  2Q1F A;  4LKF A;  1GWK A;  2C24 A;  3ORJ A;  4YWA A;  1L7L A;  3ZYB A;  4CP9 A;  4CP9 B;  4A6S A;  1W8W A;  1V0A A;  4LK7 A;  1W8Z A;  4CPB D;  1OKO A;  3F95 A;  3ZYH A;  4LK6 A;  4YW7 A;  4BQ2 A;  1W8T A;  1WMX A;  2JWP A;  2LRO A;  1W90 A;  4BQ5 A;  4LKE A;  4YW6 A; 
#chains in the Genus database with same CATH topology
 4H55 A;  2W39 A;  1DGR A;  1TVG A;  4I09 A;  1YQC A;  4FTE A;  4CP2 A;  1FNY A;  4SLI A;  4XF1 A;  2Q8E A;  1H9P A;  1JUI A;  1W6Q A;  3LFI A;  3ACL A;  4NO4 A;  4FXG B;  1G6N A;  2D6N A;  1I3H A;  1SAC A;  3B02 A;  3I2H A;  2QQM A;  5A3M A;  5C33 A;  2Z5W A;  2WC2 A;  5FFO C;  1FOD 3;  4V2V A;  1R64 A;  2HWB 3;  4B4R A;  2IZW A;  4GIQ A;  4HET A;  4DUV A;  4XMI A;  5F1R A;  1WCQ A;  1ZRC A;  4AI3 A;  2PHX A;  1QY4 A;  1VBC 2;  1KDM A;  4MGI E;  3T3Y A;  2Y0I A;  3LA2 A;  3LPF A;  1LHO A;  3C7O A;  3CBN A;  2NLR A;  4AFA A;  5F8P A;  3WZ1 A;  5I0S A;  5JI9 A;  3AB0 A;  2IWG B;  3THC A;  2R04 1;  3P3N A;  4QPG C;  1MZF A;  3MIH A;  1HRI 1;  3I4I A;  4LBL A;  2C4X A;  4URA A;  2K9Z A;  2WLP A;  3NJV A;  4P5Y A;  3V0A B;  4XXP A;  3VBU B;  1RED A;  4GJY A;  5BPX A;  4DRR A;  4CXW A;  3I3M A;  2W1W A;  3MPP G;  4O7X A;  3B94 A;  2QZ2 A;  2NN8 A;  4MXW B;  5FWJ A;  2GU9 A;  3BI3 A;  3AJZ A;  2FMY A;  4Q8K A;  5C71 A;  4Y33 A;  5DAX A;  1F4A A;  3HR9 A;  2X5I C;  3EXU A;  3VDD C;  2CWM A;  2WIN B;  2IXH A;  1NCR C;  1KIT A;  2OPK A;  2Y8K A;  2JE7 A;  3K46 A;  2DBN A;  4GH4 A;  2CYF A;  4LBQ D;  3T2Q A;  4AGG A;  2RDR A;  4COY A;  4FP3 A;  3I7D A;  1BXH A;  2G4I A;  3I2F A;  3I2O A;  4DIQ A;  2WFF 2;  1RUF 2;  4NHK A;  1IQA A;  1SDD B;  2QQW A;  1FPN 3;  3C7F A;  3FHI B;  4FQZ A;  4XUQ A;  3U10 A;  2E51 A;  2YG0 A;  5ACA 2;  4CCD A;  2LS6 A;  1PMJ X;  5TSW A;  5A70 A;  4JGZ A;  3SKJ E;  1JI6 A;  2J1T A;  5C4W A;  1B35 A;  2EAK A;  3UL2 A;  1J1T A;  1WMD A;  1XNT A;  4HPK A;  1AZD A;  1AR8 2;  1XJA A;  4A44 A;  4XCB A;  1S0G A;  4DUX A;  5CYY A;  2W95 A;  2RS5 2;  1VB2 A;  1V00 A;  2HKX A;  3MLJ A;  4OVE A;  4PI2 A;  4E2S A;  4XAA A;  1RIR A;  1RTV A;  1UNB A;  5H9Q A;  1LGC A;  1SLT A;  4OFG A;  1VBC 3;  1OPO A;  1W03 A;  3MFA A;  5FZ6 A;  3AMQ A;  1YQ2 A;  2VXR A;  2DCJ A;  3IIA A;  3ZFG A;  3VZL A;  4I30 A;  2GDF A;  4L11 A;  4HZF A;  1QJF A;  5DDJ 2;  5IK4 A;  1LOF A;  1VE0 A;  1AR7 2;  2VW2 A;  4JRL A;  4EZ4 A;  2HWB 1;  4BB3 A;  3SIT A;  2OZ6 A;  4QX7 A;  1AXZ A;  4S2F A;  3CO2 A;  3MW3 A;  3CLP A;  5A33 B;  5E16 A;  1HJG A;  3E5Q A;  5L7O C;  3RMY A;  3AFG A;  1LHW A;  1S0I A;  1RXG A;  2XOM A;  4YM3 A;  3DPR A;  4WV8 A;  4XW3 A;  3R6S A;  3KV9 A;  4JDN A;  1Q43 A;  2PEL A;  1FYU A;  3G7D A;  2ZJC A;  3HAG A;  5A6X A;  1SMV A;  1POV 3;  2VEC A;  3WVJ A;  3BOP A;  5K9Y A;  4C1W A;  3I2G A;  4ET7 A;  3CJI C;  1GUI A;  2YPD A;  3I2I A;  4AED B;  4HK8 A;  5F2S A;  5FZG A;  4CDX C;  5EXO A;  4NIG A;  1VRH 2;  4LBQ B;  4LOR A;  3K77 A;  5CAD A;  4XOG A;  3WG3 A;  4P5H A;  1S4C A;  2RMU 1;  2WFF 3;  1RUF 3;  4AGR A;  1YXW A;  1OLR A;  4URT A;  2PHW A;  2AEZ A;  5FXW A;  4MV2 A;  5ACA 3;  1RVF 1;  2D6M A;  2Y6F A;  3N7K A;  4BK4 A;  3FHQ A;  3VZK A;  2Q5T A;  4CDW C;  2V09 A;  3AFK A;  3PUI A;  2DU1 A;  2E63 A;  3VBF A;  3S7E A;  2OUH A;  4CDU A;  4RGG A;  4Y20 B;  1MS5 A;  1BZW A;  3LA7 A;  1UYY A;  4UW3 A;  4GKY A;  2ARB A;  2IVI B;  4X6Q B;  3ZX7 A;  1DGR N;  2ZGO A;  4RN5 A;  5FKC A;  3NL1 A;  1UY1 A;  2WO3 A;  5C9A C;  3OUJ A;  3ZXF A;  1OT5 A;  1SG3 A;  4IV3 A;  4XDO A;  2A3W A;  4BIO A;  1D7P M;  2LTN A;  4SBV A;  1AR9 2;  1XYN A;  5HV4 A;  1FAT A;  3TEW A;  1EV1 1;  1H9W A;  2OQ7 A;  2VZ3 A;  4N53 A;  1IG3 A;  2GME A;  2WR9 A;  1MZ6 A;  3NW4 A;  3VD7 A;  2BWA A;  4CDQ C;  4E2G A;  5EJZ B;  1WMF A;  4XFB A;  5IJR A;  3PTR B;  4RR3 C;  3RSJ A;  3AVS A;  5HPO A;  1POV 0;  4GD4 A;  2XQX A;  1BCX A;  1VBC 1;  4PDW B;  2ORZ A;  1O3S A;  3OF1 A;  1IS4 A;  1FI2 A;  2VZ1 A;  5HCH A;  1BYH A;  3AYA A;  4NII A;  1ZA4 A;  5FY4 A;  1WLW A;  2PQQ A;  5EIY B;  1UOJ A;  1S0E A;  1UYP A;  3HIF A;  2WNU A;  1AR6 2;  3POG A;  3IDA A;  5GLV A;  3CKH A;  5JXI A;  5DZE A;  3K48 A;  5FDB A;  2WZR 1;  3KS7 A;  4FTS A;  5IAX A;  3NO8 A;  5GZG A;  2V73 A;  3ES4 A;  5BV6 A;  5ISL A;  1OHF A;  4QX5 A;  5JSR A;  5KWR A;  3KGZ A;  1V6I A;  2VCC A;  2VZU A;  5L9B A;  4BDV B;  3LE0 A;  1TME 3;  4LO5 B;  3HT2 A;  5E88 A;  5KXB A;  3OCP A;  4BMB A;  3WSO A;  5ABJ C;  2YU2 A;  4E8C A;  1RJ8 A;  1POV 1;  3E1F 1;  4C1X A;  5LY1 A;  5FZO B;  2YBP A;  3JUU A;  1Q8O A;  4R9B A;  4XFG A;  1N3Q A;  2P1B A;  5FZ3 A;  3RJR A;  4IEP A;  1LTE A;  1U5Z A;  5FZ8 A;  4DZG A;  3BN6 A;  5IVV A;  1DQ1 A;  3VBS A;  3ZFF A;  3JZV A;  4XFC A;  1O3Q A;  1K3I A;  3DL3 A;  4D6Q A;  3WDX A;  1V6K A;  3VKF C;  5DAW A;  1GZT A;  4KWL A;  1UD1 A;  1WW7 A;  1S2E A;  1JH5 A;  5FZ1 A;  4AVV A;  4Z07 A;  3RQ0 A;  1TG7 A;  2WFP A;  2YC2 A;  4HON A;  1HW5 A;  1W99 A;  4BXS V;  3WNK A;  3RZG A;  3BYW A;  3WNM A;  3VBH C;  1AR8 1;  4CCE A;  1ULG A;  4CP0 A;  4NPR A;  3URF A;  2RS5 1;  2W3J A;  5D8A C;  2NYY A;  1W6P A;  5FYM A;  4QM9 A;  2VMF A;  5DAP A;  5ANN A;  4COZ A;  3OGV A;  1LOA A;  2IFR A;  2A6Y A;  5LBC A;  1PO2 2;  2FZ2 A;  2YBS A;  4COU A;  2QQN A;  4AHZ A;  4QX2 A;  4MGY E;  3FFZ A;  4Q1P A;  4CDX A;  5FP9 A;  4AR2 A;  1K45 A;  2DYC A;  3N7M A;  4WVM B;  4I02 A;  4PLN A;  5DDJ 1;  5IVF A;  4QDS A;  1AR7 1;  1CAV B;  3V0B A;  1J3Q A;  1AYM 1;  3Q8B A;  3WQ7 A;  3LF7 A;  3O0V A;  3BIE A;  2BV4 A;  1I1E A;  3TBD A;  4FPG A;  1HB4 A;  4S2G A;  1ND3 B;  1QOT A;  1XNK A;  5FZE A;  3VDB A;  2Z4F A;  5FZK A;  5FP4 A;  3P1I A;  5DXD A;  1SLA A;  1QKQ A;  1W8U A;  5FWE A;  1OH4 A;  4J6G A;  1WW4 A;  4OYU A;  1ZZ9 A;  4LXL A;  5F5A A;  2NP0 A;  5JOX A;  4W6Y A;  3D5O A;  4M0N A;  3MUZ 1;  5FZ0 A;  4NID A;  3SQO A;  2FCV A;  1VRH 1;  2JB8 A;  4F3J A;  3M2M A;  3LSE A;  1X8E A;  2BGP A;  2CWS A;  3EB7 A;  2R07 2;  2WZP P;  1FV2 A;  4X8P A;  4YM0 A;  4W4Z A;  5FY8 A;  5F3I A;  5F3C A;  4O65 A;  4XUP A;  1XBF A;  5A3W A;  5A7W A;  1A3K A;  4Z2W A;  4TTG A;  4C8D A;  4QMA A;  3OB8 A;  4XIL A;  4DXS A;  2EID A;  4N7I A;  1O4Z A;  4BYY A;  4XTM A;  2JKB A;  4RQP A;  4K8F A;  2NPI A;  2XBO 1;  3FWE A;  5IWF A;  2XPJ A;  3NJX A;  4BE3 A;  3MZH A;  3POS A;  4MGZ E;  4WVZ A;  3EBR A;  4TXW A;  5C7G A;  1WZX A;  2WWJ A;  2ARX A;  3CJI A;  4YVW A;  2HLE A;  5FLH A;  5LK5 A;  3ZFE A;  3W58 A;  4UI9 L;  5FBZ A;  1AR9 1;  4YW3 A;  3U1X A;  4JC1 A;  1OOP A;  3DV8 A;  3K2O A;  3O1R A;  2UWA A;  2K2S A;  5JXG A;  5LWB A;  1VR3 A;  2GN3 A;  2W08 A;  3H7J A;  4LA2 A;  3ZYH A;  5A3O A;  1DCS A;  3H8U A;  3IDC B;  3CZJ A;  4HKO A;  3GZE A;  3POF A;  2X29 A;  3OGR A;  1V6M A;  3AL5 A;  3QH6 A;  5LBF A;  4A3Z A;  2RR1 3;  2WAA A;  3N7J A;  4JKM A;  4AK3 A;  1CAW B;  1K5M A;  5JCT A;  2BFU L;  3POB A;  2XHN A;  3IWZ A;  1E57 A;  1GBG A;  3IAQ A;  1ENQ A;  5E8A A;  3NVC A;  1RUI 2;  4M3C A;  3CL1 A;  5C9A A;  5LW9 A;  4COV A;  1J58 A;  3BTY A;  1SFP A;  1HN0 A;  3INA A;  2ZGU A;  3I3E A;  4WM7 B;  3EQE A;  1F8V A;  1AR6 1;  1LGB A;  2CU5 A;  5GZC A;  4LMF A;  3A22 A;  4KG0 A;  5DN2 A;  2DUO A;  2Y6K A;  4BM8 A;  1VBB 3;  5HI0 A;  5KC5 A;  4IEQ A;  5DAV A;  1V6J A;  1ZRD A;  1QJE A;  1UN1 A;  1EPW A;  3W20 A;  1RUG 2;  3AC0 A;  1YHF A;  1GYK A;  2R07 3;  1W8T A;  5LRS A;  1KFX L;  1VPH A;  2UU8 A;  1O8S A;  1W05 A;  2VZO A;  4FOQ A;  2UY8 A;  3DXT A;  3PJY A;  3ZSM A;  1WBF A;  4KH9 A;  3OGG A;  2BTV C;  4MGS A;  4AED C;  2JX9 A;  1O4Y A;  3USU B;  2RS1 2;  4PJY A;  1UOF A;  4AHX A;  4MUV A;  1GV9 A;  3I8T A;  1HB1 A;  1QH7 A;  2ET7 A;  2O1Q A;  2D97 A;  3J8F 2;  4L8Q A;  4CSW A;  2E31 A;  4BPZ A;  1NZI A;  1QIQ A;  3T2O A;  4RYD A;  1H1M A;  3Q8C A;  1MQT B;  4CE8 A;  3ZN6 A;  4EV0 A;  1SLC A;  4UF0 A;  3PUA A;  5A32 B;  3O1S A;  3D3A A;  2PHL A;  1Q3E A;  3TWI A;  2YPJ A;  3HNM A;  5FZF A;  2CGP A;  5ABJ A;  1SLB A;  4MGK E;  5FZI A;  3VKO A;  3CZU A;  5IT6 A;  3HQR A;  3WP4 A;  1YQ5 A;  3KV5 A;  4XJA A;  1MPX A;  1VAV A;  1NCQ C;  3HJR A;  3UYJ A;  4Z2A A;  4ZZ8 A;  4UW4 A;  4MYE A;  2R0F A;  1YI7 A;  1PO2 1;  1XOY A;  4HXC A;  4QGL A;  4QT6 A;  5A1F A;  1ENS A;  4QKD A;  3HNB M;  2VU9 A;  1RUI 3;  2BQP A;  4P14 A;  2W47 A;  3R0R A;  5CB7 A;  4FTB A;  1AJO A;  1PZ9 A;  2ZGS A;  3RI9 A;  1LED A;  2E32 A;  4Q4X 3;  4PQ9 A;  1OKQ A;  1C8M 1;  1H6X A;  2HWD 3;  4TN7 A;  5KBF A;  5B2G B;  5IAT A;  3JB8 A;  2QE3 A;  2R0H A;  3VBH A;  3O1P A;  3GCW A;  2VCM A;  1PNF A;  2FD8 A;  2GAU A;  1GMM A;  2RM2 2;  3FZ3 A;  2Y6H A;  4A41 A;  2X09 A;  2WYF A;  1G9D A;  1CAU B;  1RUH 3;  2WN3 A;  1UPS A;  4JTO A;  5FQ0 B;  3LDB A;  4XIO A;  4I01 A;  2Y34 A;  2VZR A;  3ZYI B;  4YZ2 A;  5HCB A;  5FXV A;  1QHD A;  4XJ8 A;  3SLI A;  1UYX A;  2Q0A A;  2XJT A;  4MET A;  4O9G A;  1ND2 C;  4Y22 B;  4CCL A;  2KA3 A;  3MIF A;  3CF6 E;  1F4H A;  2YV8 A;  4WZF A;  2A6Z A;  3KVB A;  2WII B;  2R07 1;  2B4K A;  1X7N A;  3LPG A;  3F95 A;  2DFC A;  2KM2 A;  2R32 A;  4N43 B;  4XF4 A;  3RFR A;  3RMX A;  1OBN A;  3WQ1 A;  2UYB A;  3PVO A;  1JZ5 A;  4DNY A;  1OQD A;  3Q8F A;  2BVV A;  3OUH A;  4PIY A;  2W68 A;  3U4S A;  5I0U A;  4CEW B;  3BTA A;  1IPS A;  3VDD B;  2FDJ A;  1NCR B;  1RUD 2;  5BNN B;  2GZW A;  4LO8 A;  1G8W A;  4RD7 A;  1RHI 3;  1GFF 2;  1WBL A;  2PHD A;  3TN9 2;  2ZHL A;  3KQ4 B;  5ANQ A;  1IHM A;  3VBU A;  4I0B A;  4AVS A;  1Y9M A;  3IKW A;  2A6W A;  2DUQ A;  4NAO A;  4D7S A;  1LKN A;  5CKQ A;  5JLV A;  2E7Q A;  4XAC A;  4AE2 A;  1MAC A;  3GJA A;  1YFU A;  3OPT A;  2EAA A;  1RUJ 3;  2W92 A;  4C91 A;  1JOB A;  4BA6 A;  1BKZ A;  1AX2 A;  2R6Q A;  4JHZ A;  2DVB A;  3AVR A;  4LIV A;  2I07 B;  4Y1V A;  1W90 A;  4ZU4 A;  2BNO A;  4EN6 B;  3LGR A;  5FXZ A;  3MLL A;  3PIJ A;  4E27 A;  5IUQ A;  4M3C F;  5EP9 A;  5BNO B;  2Y6L A;  2PLV 3;  3OBT A;  2XJQ A;  5T5L A;  2KR2 A;  4EN7 B;  3SC7 X;  1J1L A;  1ONA A;  2VNV A;  4LBO A;  3N9M A;  4B1L A;  3F2Z A;  1VMF A;  5JXJ A;  3LB9 A;  4BQW A;  1Q8P A;  2JDZ A;  5DZF A;  3ABZ A;  1ODM A;  2A7A A;  2X53 S;  4B3N A;  1RUC 1;  2XQR A;  1WCK A;  5J48 A;  2FCT A;  3S0M A;  4QDR A;  2XJR A;  2TNF A;  5L9V A;  4CEY A;  4JGY B;  3OYW B;  2RV9 A;  3NV3 A;  1PGW 1;  4YGD A;  3D82 A;  3OPW A;  3ZPO A;  4CVU A;  4BQ5 A;  1KD7 A;  3VBR A;  1DGW A;  2XVL A;  1RUG 1;  3CHX A;  3WCS A;  4PQQ A;  3RZK A;  4M4P A;  2R04 2;  1CAX B;  1I9R A;  1KXG A;  1UOB A;  4YRD A;  2KD7 A;  2ZMK A;  2VZV A;  4AW7 A;  5C3P A;  2BP6 A;  4QPI B;  4LOS A;  1RUD 3;  1SBF A;  2RS1 1;  4Q4W 2;  4YZ4 A;  4YVS B;  4N8M A;  4X8N A;  4ZU5 A;  1GR3 A;  1HB3 A;  4JVA A;  1UPI A;  1BVP 1;  2JDM A;  2WQ4 A;  3QLQ A;  2ZX4 A;  3SCF A;  1U0A A;  3MI8 A;  1W6O B;  3D0S A;  3J8F 1;  3VB9 A;  5A33 A;  5T54 A;  1SLL A;  4LBK A;  1EAH 3;  3NMB A;  2FBE A;  3VD9 A;  3OPZ A;  4Y1U A;  1QJU 3;  4FPO B;  5BNP B;  4IE5 A;  2NM1 A;  3I97 A;  2XUM A;  2C0Z A;  3N9N A;  4CDW B;  4CCK A;  2LRO A;  5GLU A;  1G9A A;  2ZOE B;  2WAB A;  1VBD 3;  3NRU A;  4CU8 A;  3WHU A;  4D94 A;  2W46 A;  4DMI A;  2PHT A;  3WIN E;  1T6B X;  1UOG A;  3MYX A;  1KS5 A;  1NX9 A;  1JUH A;  1D2S A;  2B46 X;  4I3P A;  3PL0 A;  2R16 A;  1D0H A;  3WW1 A;  3T1L A;  2Q30 A;  1N3P A;  1ZVF A;  4YZ5 A;  2MEV 1;  2ZAC A;  3ZM8 A;  4QB2 A;  1GOF A;  3VKM A;  5APA A;  3ZSL A;  3GXU A;  4LHL A;  2VUL A;  1JZ2 A;  1RMU 2;  4BQX A;  5A6Z A;  1OQ1 A;  4QB1 A;  1DZR A;  5FO7 B;  4AI8 A;  1URX A;  2OQ6 A;  3ZPY A;  1YO8 A;  4B4P A;  2OKX A;  1LGN A;  2P3J A;  5EWS A;  1DZT A;  4AFM A;  4DPN A;  1UXX X;  3LOB A;  2XWB B;  1A78 A;  1C1L A;  1VBA 1;  2VUA A;  5FZH A;  2DUP A;  3UES A;  3W5N A;  3D6E A;  3HN1 A;  4XUR A;  2EXH A;  2D93 A;  2IC1 A;  2RM2 1;  3WW3 A;  4NIH A;  4YG0 A;  3WHT A;  2A75 A;  3VZJ A;  2A6V A;  2R04 3;  2NZ9 A;  2EA7 A;  4P9J A;  4EN9 B;  3FE5 A;  1HRI 3;  1MS0 A;  1MVE A;  4R9D A;  3ZN4 A;  5K0U C;  3C7H A;  4ZS2 A;  1AVB A;  1I5P A;  2JB4 A;  4QAW A;  2E6V A;  5LK7 B;  2DWR A;  2EXI A;  1O7F A;  2ZS6 B;  4Q4W 3;  4XQD A;  2VMI A;  3MIB A;  2B9U A;  2QQV A;  4RL7 A;  4XIK A;  3RNS A;  3VHO A;  1UKG A;  1PM7 A;  2J42 A;  1NZC A;  1UIJ A;  4YLZ A;  5FP7 A;  4HT1 T;  4PDW A;  4DO0 A;  4FSJ A;  3CEW A;  1W8F A;  2VCA A;  5LEK A;  4YW1 A;  3ES1 A;  2JG8 B;  1BEV 1;  4U36 A;  1W0N A;  5FKB A;  4DEQ A;  1RIT A;  3PUQ A;  4UFK A;  4V1P A;  4XHX A;  1RUD 1;  4FI9 A;  3R05 A;  4WM8 A;  1NQD A;  4FPY A;  5FMB A;  3S30 A;  3APB A;  3TN9 1;  4XJW A;  4B8E A;  2RMU 2;  4OHV A;  4U2A A;  1WA6 X;  2ZHN A;  2HWF 2;  1HRV 2;  3DYO A;  3BIW E;  4LHK A;  4UFH A;  4F83 A;  1RVF 2;  1US2 A;  2W2I A;  5SV5 A;  1RUN A;  3NNJ A;  1EP0 A;  1CQ9 A;  3A7Q A;  1NT0 A;  4YPJ A;  2XHK A;  5FK8 A;  3ZMO A;  1AL2 2;  1LHN A;  1OD5 A;  1OVP A;  2BDR A;  3PHM A;  5BXX A;  1XRU A;  4P08 A;  2EF6 A;  4LKE A;  5FZO A;  1CPM A;  2C26 A;  2I74 A;  2JE8 A;  3KHB A;  4XCA A;  2NQY A;  5FYT A;  3TNQ A;  1VJ2 A;  4LNV A;  5D8A B;  3KD4 A;  5LBB A;  1CPN A;  4A7Y A;  4DQA A;  4CU9 A;  2V4V A;  5IW0 A;  2P6C A;  3IT8 A;  1EV1 2;  4ZU7 A;  1Y4W A;  1UWW A;  1LES A;  2BRT A;  1G86 A;  2IXL A;  4MGQ A;  2F6B A;  4QX8 A;  4S2H A;  1XYP A;  3O0W A;  5IVC A;  3GCX A;  2W87 A;  1W6N A;  3HQX A;  2BJS A;  1FXZ A;  1JOJ A;  4BZ4 A;  1F15 A;  1AX0 A;  1PNG A;  2IXJ A;  3SH4 A;  2JDP A;  5C3R A;  1BQP A;  1CR7 A;  2JDH A;  4R4X A;  4YFZ A;  1CZS A;  3SNM A;  1UKR A;  4F8A A;  3AJY A;  5FMD A;  5C8C B;  1H30 A;  4W6X A;  1C28 A;  5L19 A;  3PVN A;  3M1H A;  2WRA A;  3FUQ A;  4PLO A;  5KHH A;  1AF9 A;  1HJF A;  2QQI A;  2IXI A;  4QX3 A;  1X50 A;  2ZAA A;  2WZR 2;  3BAL A;  2DFB A;  3HN3 A;  4OUS A;  4XUT A;  2HWE 2;  3ZIX A;  3HMY A;  2Q8D A;  3VZO A;  4Q4W 1;  4PBO A;  2OYZ A;  2OW4 A;  4QX0 A;  3LEK A;  2D6P A;  2RMU 3;  4B1M A;  2R1B A;  2EIC A;  1PX4 A;  2TUN A;  4H7M A;  4N43 C;  2ID4 A;  5F5Q A;  4YAR A;  2D43 A;  1HRV 3;  3BCW A;  1H1A A;  1RVF 3;  3ZXD A;  1MS9 A;  3LIH A;  3BOW A;  1LRH A;  1VRB A;  3I2D A;  1ND3 A;  4QXC A;  2J1R A;  2Q8C A;  4CEW C;  3FJS A;  5FPU A;  3S5A A;  4UFM A;  4KNC A;  5BNN C;  2YDE A;  1WD3 A;  2CY6 A;  2PTM A;  4DY5 A;  3LA3 A;  1AL2 3;  4KG8 A;  2OII A;  3S5Q A;  4XQ4 A;  2DDU A;  5D21 A;  1GKB A;  3AP6 A;  1NKG A;  4PIX A;  2G9F A;  1O3R A;  4GWI A;  4KQ7 A;  3WXP A;  1H4G A;  1RIN A;  3OUI A;  1VIW B;  4BWO A;  4Z82 A;  2XL7 A;  3CJX A;  1EV1 3;  1IS5 A;  3HD8 B;  5GM0 A;  1NA1 B;  1DYP A;  2X05 A;  2QFE A;  3B5L B;  5FYS A;  2AGS A;  3ZMN A;  4RHV 2;  4AGV A;  2BZD A;  5FZ7 A;  1R09 1;  1PK6 C;  1RMU 1;  1VAK A;  2GP3 A;  2YXS A;  3U07 A;  4KU8 A;  4YNI A;  4UYB A;  5A7Q A;  2YFZ A;  4QQO A;  3AZW A;  5BNO C;  1QNW A;  3ATG A;  4Y1X A;  1NOV A;  3UJQ A;  5KHK A;  1C57 A;  3AP5 A;  5J98 B;  1IQD C;  1BMV 1;  1UZZ A;  3NV1 A;  1HX6 A;  2WBK A;  2WAO A;  2DCY A;  4BQ3 A;  1H8T A;  3B93 A;  1CX4 A;  4Z1V A;  1HQN A;  5F37 A;  2GSY A;  4IEV A;  4DXZ A;  2DCT A;  4Q5O A;  4UWD A;  5JVV A;  2O0O A;  5C3S A;  1YNA A;  1AYM 2;  2HBT A;  1WME A;  3OOX A;  3GGL A;  4JGY C;  1GWK A;  3ZXK A;  4K7J A;  1K12 A;  1NLR A;  2WZR 3;  5IK8 A;  4A6S A;  4RGA A;  2R49 A;  4GA9 A;  3WR0 A;  5CEH A;  3POE A;  2BYV E;  2ZEZ A;  4D6R A;  1TNF A;  3CU7 A;  4NUB A;  1WW6 A;  3AMP A;  5HCF A;  3V64 A;  3OGJ A;  3BOD A;  5JMO A;  3DGT A;  1YCI A;  1CAW A;  3Q9O A;  2PMW B;  5FRE A;  1R08 2;  3DXU A;  5C6C A;  1XPW A;  3KCY A;  4IEZ A;  2E7A A;  4QPI C;  1FX5 A;  4FT8 A;  3ON7 A;  1DQ6 A;  1WCD J;  3E6B A;  3NNG A;  3CMG A;  4QXB A;  4YVS C;  3BPZ A;  1GNZ A;  4AHW A;  4ATE A;  4LE3 A;  3ENR A;  4A7K A;  4DY3 A;  4WM7 A;  1SZB A;  5I91 A;  1XU2 A;  3AZX A;  4Q0P A;  3O5S A;  3WX5 A;  2ARC A;  5LAS A;  3C7E A;  5K0U A;  2F4P A;  2HEY F;  1QXR A;  1YEW A;  2HWF 1;  1HRV 1;  1OFN A;  2CSG A;  1OFS A;  1NE6 A;  4GWM A;  3TEZ A;  5BNP C;  3HNY M;  5LA1 A;  1W8O A;  5T5P A;  4CPB D;  3O7O A;  4Y4Y A;  1R1A 2;  1W9T A;  3WP6 A;  4KBB A;  4JX0 A;  4AEM A;  2XBO 2;  1BLZ A;  1AL2 1;  1AR8 3;  1UY4 A;  3MFC A;  2UWC A;  4RHV 3;  1OLQ A;  5KR7 A;  1LR5 A;  2RS5 3;  3ALQ A;  3AL6 A;  4LE4 A;  4W50 A;  5C5U A;  2VVD A;  5SV8 A;  3USU A;  3VV1 A;  2ZX2 A;  2MPF A;  3FX3 A;  3I49 A;  2A3X A;  1GWM A;  3ZYR A;  1IKP A;  5CKM A;  2GC3 A;  5LA2 A;  4A6O A;  2P6H A;  3T09 A;  4BIF A;  4XJ9 A;  1NCQ B;  1OUS A;  3N9L A;  4TYS A;  5DUV A;  1KQR A;  5DQ0 A;  5JUV A;  5A6Q A;  2O8O A;  4FFF A;  1HIX A;  5FYV A;  4L2N A;  1MQT A;  1AXY A;  5DDJ 3;  1AR7 3;  3M3Q A;  4D3W A;  3LDR A;  1AYM 3;  1UMI A;  2LUW A;  2WS9 2;  2VM9 A;  2VD7 A;  5LRR A;  1IKQ A;  2B42 B;  2YZ4 A;  5A3T A;  3HVD A;  3POI A;  1QJX 1;  3MDP A;  1OH3 A;  2AEY A;  5IHR A;  1LOG A;  1DYO A;  4JV4 A;  4AFD A;  4BME A;  1JYC A;  2O14 A;  4Y24 A;  5GLT A;  4C0B A;  2VC9 A;  4GWN A;  1R1Z A;  5K4L A;  1SPP B;  3UKV A;  2QDR A;  2ZEY A;  1COV 1;  2ZGP A;  1O91 A;  2F17 A;  2JJ6 A;  2QZ3 A;  4HN0 A;  5DZG A;  4A42 A;  2FDG A;  1ZZ7 A;  5C70 A;  4FQ4 A;  3DCQ A;  2ZHM A;  5KXC A;  4MO3 M;  2R06 2;  3VBO B;  1QNY A;  1OF4 A;  2HWE 1;  3PTY A;  4PCR A;  4NHL A;  4NHX A;  4BH9 A;  3BTZ A;  1VRH 3;  2GNM A;  3AYE A;  1JZ6 A;  1ND2 B;  3RYK A;  2AYH A;  2WNV C;  5FY1 A;  3IPV B;  4C0H A;  2JG8 C;  2VZQ A;  2ZGT A;  1HXS 1;  1OMI A;  1W9W A;  3UJO A;  1KS4 A;  3M3I A;  5HXV A;  4AI9 A;  4BQ2 A;  2OVU A;  2YGM A;  2VBB A;  1BJQ A;  1VMH A;  2HEW F;  5JSO A;  1LOC A;  2B5H A;  2WZ8 A;  5FZD A;  2XVG A;  2D44 A;  1IPK A;  2VOW A;  4QKF A;  4GUL A;  1CAU A;  2XBO 3;  3H7Y A;  4JQT A;  4AL9 A;  5AFB A;  2UY9 A;  1W2A X;  5FYZ A;  5FQ0 A;  4OQ9 A;  1O5L A;  4XBL A;  4QPG A;  2GC0 A;  4R4Z A;  2CDP A;  4Y22 A;  3ZO0 B;  1U5X A;  4LHN A;  1SCR A;  4FOW A;  1CGP A;  4OI0 A;  2JG9 B;  4LUL A;  2XUE A;  2ZEW A;  3RYP A;  2JIC A;  1AR9 3;  4DB5 A;  4XF0 A;  3WUD A;  2AH2 A;  4JCK A;  3U75 A;  4AFC A;  2XJV A;  4HAN A;  3H1W A;  2EIB A;  2YUE A;  2JIG A;  3M70 A;  3N35 A;  1UL9 A;  2AC1 A;  4PT6 A;  1S0C A;  1JN2 P;  4RHV 1;  2X5I A;  1ASJ 2;  1DYK A;  1N1V A;  1PM4 A;  3FBM A;  1NCR A;  3M7A A;  2VR4 A;  1IGO A;  3MLK A;  4QKB A;  3RPQ A;  3WNX A;  2P4E A;  5JZG C;  3BTX A;  4P9G A;  1IS6 A;  1PZ8 A;  2XXZ A;  1ZRF A;  4FFH A;  4HVO A;  2ZAB A;  2EVX A;  5DPN A;  4GXL A;  2VCB A;  3VD4 A;  1JU4 A;  2IVJ A;  4B4Q A;  4QDQ A;  1RUE 2;  3KZ4 C;  2NMN A;  2OA2 A;  1DHK B;  1GZ9 A;  4AAP A;  4KI5 M;  5L36 A;  2BWC A;  4LKF A;  1QJY 1;  4KWK A;  4YZ3 A;  1VAM A;  3MIE A;  2P3Y A;  2LAL A;  4HVQ A;  1F31 A;  3MIC A;  1LHU A;  1AR6 3;  1C8M 2;  3NAP C;  4YM2 A;  4BU2 A;  4IEW A;  3MW4 A;  5A1A A;  2CDO A;  1Z7S 2;  4QGM A;  4UT5 A;  4OUM A;  5C8C C;  2PHR A;  4NAM A;  3R4D B;  1D4M 2;  3ETP A;  1Y43 B;  5KXE A;  5IK7 A;  3T0B A;  4MSV A;  2RJ2 A;  3EMR A;  1W2N A;  1R08 1;  5K8S A;  4AF9 A;  2J22 A;  2RJK A;  1TQ5 A;  4OQ8 A;  2XKP A;  4DFS A;  5FZ9 A;  1LU2 A;  1Y7B A;  3OYW A;  5A3N A;  1LEN A;  2E26 A;  5HBA A;  2CV6 A;  4PI0 A;  1NE4 A;  1ZNP A;  2RDN A;  4J25 A;  4RA0 A;  3S7I A;  4ES8 A;  5BNQ A;  3WLU A;  2XDV A;  4F7Z A;  5LCW L;  2V4A A;  5L7O A;  4XAE A;  4L92 A;  1UMH A;  1SDW A;  5B4X A;  1R1A 1;  1PZ7 A;  3ACF A;  3POJ A;  4IEY A;  3BPS A;  4EQV A;  4QQ2 A;  2XH6 A;  4LO6 B;  4YFW A;  1KDK A;  2VNR A;  1E5S A;  3VDC A;  4NRP A;  1SBD A;  4YGC A;  2GC2 A;  2RS3 2;  3AP4 A;  2WQZ C;  1DQ2 A;  2AR6 A;  3C8X A;  1AL0 G;  1JYN A;  1VP6 A;  3W5M A;  3QCW A;  3SIS A;  1YC6 1;  4Y4R A;  3DF0 A;  4JGZ B;  1PO2 3;  1RGS A;  2Z42 A;  4KWU A;  2Q1F A;  1NA1 C;  1W6O A;  3JD7 1;  2OUJ A;  3JQX A;  4H2A A;  2PQS A;  2ZZJ A;  1B35 B;  1S1A A;  1RUE 3;  2B39 A;  4PLM A;  4YW2 A;  5C4W B;  1G9C A;  1JYI A;  2A71 A;  2VUD A;  3GBG A;  2QQP A;  4Q0Q A;  2YMZ A;  3AMM A;  3WG4 A;  5FR3 A;  1NLQ A;  1OKO A;  1W2U A;  2CGO A;  2DTW A;  2QCS B;  2QQU A;  3JU9 A;  4FXK B;  4NRM A;  2QQO A;  2QBX A;  4CDW A;  1H6Y A;  2WS9 1;  1C8M 3;  1EYB A;  1ZZ6 A;  2VOT A;  3E5X A;  1W04 A;  1W6M B;  3FL7 A;  4UBH A;  2Z2S B;  1P8J A;  3WQB A;  1PVC 2;  4PHZ A;  4XPV A;  1C5H A;  3POY A;  2ZX3 A;  3K3O A;  3GZU C;  2IXC A;  3MV1 1;  3OD4 A;  1RUC 2;  3LAG A;  4MXV A;  2B8M A;  1J84 A;  3GAL A;  1UZ0 A;  1AX1 A;  4NVP A;  3RDI A;  1UY3 A;  4CP9 A;  3TYJ A;  2R06 1;  5GZD A;  1PGW 2;  5T55 A;  4CDQ A;  5C8W A;  2QDN A;  5JOY A;  3DUI A;  2VJX A;  4HSJ A;  4RR3 A;  4GMP 0;  5GJ6 A;  4ES9 A;  5H9S A;  1FAY A;  3HT1 A;  1D2Q A;  1PO1 2;  1QDO A;  3DPR B;  4OZO A;  3RZM A;  1GQP A;  1XNC A;  3ZN5 A;  1YWK A;  1W8N A;  4FO9 A;  4B29 A;  2WA4 A;  4LO7 A;  2VMD A;  1RB8 G;  1H4H A;  3GDB A;  2PFW A;  3SKV A;  4I2O A;  1H8V A;  1UMZ A;  4LEJ A;  1J83 A;  3N9P A;  3UK9 A;  3JBG 2;  1QQP 2;  4Y26 A;  3QAC A;  1JZ8 A;  1GQH A;  4GB3 1;  1ZBA 2;  4CUC A;  2Y26 A;  1W0O A;  2ET1 A;  2PA7 A;  1PMH X;  5FYB A;  2OXB A;  3BKZ A;  1Q8V A;  1MZ5 A;  3B9C A;  1E5H A;  4H3W A;  5CZK A;  4JRA A;  3A21 A;  4RFR B;  3IN9 A;  2C9K A;  2PAM A;  1LOD A;  2VUJ A;  3VBF B;  1JHJ A;  1DGW X;  1GNY A;  1S0D A;  3K4Z A;  2AAC A;  2ZGN A;  5A3L A;  4GMP 1;  5CG9 A;  1LEC A;  4XMA A;  3MGU A;  1ASJ 1;  1IZ3 A;  1OA4 A;  2E33 A;  5FLI A;  3LCP A;  3E5U A;  3WF1 A;  5EYY A;  3SEP A;  1XB9 A;  4YGE A;  5CFD C;  2ATF A;  1OI6 A;  4PBP A;  1PVC 3;  3QBQ A;  3OY8 A;  1QXP A;  1O59 A;  2MEV 2;  2VGD A;  3Q8A A;  3N7L A;  3ZYF A;  3THD A;  1RUE 1;  4N9H A;  4P9Y A;  5FZB A;  2VBD A;  3WEZ A;  1H2M A;  3PME A;  3L2H A;  1OSG A;  3UGF A;  4XF3 A;  5DUW A;  3WDY A;  1RUC 3;  2C9A A;  1AUY A;  2W1U A;  1N1T A;  1V6L A;  2RVA A;  3QH7 A;  4Y5S A;  3OEA A;  1BBT 2;  4YW4 A;  3IDB B;  3I3D A;  4Q8L A;  1NQJ A;  1GP6 A;  5F5I A;  5FV3 A;  3J7N A;  1VBA 2;  4Y3O A;  1Z7S 1;  4NWV A;  5FY5 A;  3VDA A;  5DUU A;  1YQ6 A;  5AC9 1;  5D8A A;  4D69 A;  3KVA A;  4XBQ A;  1D4M 1;  1ULC A;  1RUG 3;  5A7S A;  1PO1 3;  5JR7 B;  4ARX A;  4BXF A;  3D0J A;  3OGS A;  5FO9 B;  4J1X A;  1E5I A;  1DBN A;  3KF5 A;  4FAG A;  2BOJ A;  1TMF 2;  4MGT A;  4JDO A;  2WNU B;  4K21 A;  4CZS A;  3VBO C;  3O14 A;  4ERO A;  3QOP A;  4AVC A;  3TEY A;  4RS5 C;  1HDK A;  2RS1 3;  1VBE 2;  4W65 A;  2G9G A;  5HV0 A;  2WUH A;  3WG2 A;  5GLW A;  4S2D A;  3MPB A;  1ZZ8 A;  4AWD A;  1I5Z A;  2DUR A;  2JXA A;  3J8F 3;  3T08 A;  2FHR A;  1I6X A;  5CBL A;  1ULF A;  2P5B A;  1UZW A;  1BEV 2;  4CP1 A;  3NJY A;  2BU9 A;  2WWU A;  4Q4Y 1;  5IVY A;  2ADD A;  2G19 A;  3AXD A;  4AFB A;  4FCA A;  5FYH A;  1BK1 A;  4N9I A;  4E4D X;  1LU1 A;  4B7E A;  1ULE A;  2I45 A;  1U12 A;  2GND A;  3IMM A;  1HB2 A;  3PIG A;  2VAU A;  5J7M A;  4MHU A;  4O61 A;  3I59 B;  3J7L A;  3ZFF B;  3V0A A;  1UY0 A;  3KSC A;  2RS3 1;  2JG9 C;  1JHN A;  4QXK A;  1RL3 A;  4JDM A;  3W21 A;  4PF5 A;  1Q5O A;  4MXW A;  2YHJ A;  3L9J T;  2QTW B;  3PUR A;  3VGI A;  2MEV 3;  5BUV A;  5JR2 A;  1V0A A;  1ZA7 A;  2KXL A;  5CFC C;  2MHF A;  2MNG A;  3O1V A;  4IV1 C;  1HQW A;  2B45 X;  3GYD A;  1UIK A;  5T50 A;  4QD2 A;  1S2K A;  5J09 A;  3C7G A;  5FY7 A;  2VTX A;  1V9U 1;  2XLG A;  4JKL A;  1PK6 B;  4I3G A;  4OHY A;  2ZEX A;  1BBT 3;  2PYT A;  4YGB A;  3CDZ B;  4HK9 A;  4OCT A;  1VBA 3;  4ORF A;  2CGN A;  1PVC 1;  2A70 A;  2ZMN A;  3PMS A;  3DKQ A;  5F9T A;  4ATF A;  2RM2 3;  1GNH A;  1UCX A;  1YLL A;  2DCZ A;  2R30 A;  5EJ1 B;  4DXT A;  4JAA A;  5JIA A;  1JYW A;  3ZYG A;  3SMH A;  1Q8S A;  4FPL A;  3V0B B;  1MEC 2;  1OLM E;  2EIG A;  1E5R A;  2GH2 A;  3J26 N;  4W6W A;  4HL0 A;  2VBP A;  5FO8 B;  3Q8E A;  3G6J B;  3H1M A;  3DYM A;  3WG1 A;  1DGL A;  4FFI A;  2BW8 A;  1S2B A;  2J1V A;  2R1D A;  3AMH A;  1UU4 A;  1IS3 A;  1L7R A;  4EJR A;  1SQ4 A;  1PO1 1;  2Q1Z B;  5FRA A;  1VLN A;  3OBR A;  4OMD A;  2YFU A;  1XSR A;  2CTV A;  3DEC A;  1BEV 3;  3NQH A;  4MLO A;  2GAL A;  3FN9 A;  3LEG A;  3O12 A;  2FQP A;  3U14 A;  3VHN A;  4NOT A;  2XB6 C;  4XC9 A;  3J7M A;  1ZM1 A;  1RJ7 A;  4AVA A;  4XVH A;  3S57 A;  1CWP A;  2VOX A;  1D0G A;  3JBG 1;  1DQ5 A;  1QQP 1;  3TN9 3;  1XE7 A;  5F6K A;  3ME2 A;  1ZBA 1;  2WNE A;  3RJ2 X;  4YWA A;  5K7P A;  4KGQ A;  2R7E B;  1H1I A;  1JZ7 A;  1ZBE 1;  5A7W B;  3ZKY A;  4GH4 C;  2WA3 A;  1O6U A;  4NPM A;  3LD8 A;  2Y60 A;  2BEO A;  4KL1 A;  2WKK A;  4FFG A;  4UW5 A;  4Z92 B;  4HKW A;  1YRZ A;  1XU1 A;  4LHS A;  3VKL A;  4QB6 A;  4AED A;  2GH8 A;  4GZ9 A;  1C3H A;  4JGZ C;  4YVW B;  3VHP A;  3D8C A;  4LBQ A;  3PVB B;  4C90 A;  4Q4V 2;  1FMD 2;  2CNA A;  5C4W C;  1B35 C;  3MF9 A;  4EWA A;  5JMC A;  1AHS A;  3RRD A;  4P00 B;  1STM A;  2QNK A;  3V56 A;  1PIV 2;  2BGO A;  1DP0 A;  1LOB A;  1W8Z A;  4ISR A;  1R09 2;  2UWB A;  2WT1 A;  4FPK A;  2QJV A;  5FPB A;  3RZJ A;  3AMN A;  3VDD A;  2CHH A;  1GSL A;  3SH3 A;  1N47 A;  4Y20 A;  1BBT 1;  2ARE A;  4MVT A;  3U0Z A;  5FK7 A;  3IB3 A;  4OMC A;  3GZT B;  1DLL A;  4LJH A;  3X29 B;  3ZFG C;  2IUW A;  1BMV 2;  1J3P A;  2FZ1 A;  2HJI A;  2LRP A;  3AYC A;  5F2W A;  1K5M B;  3VD3 A;  4Y1Z A;  5FYI A;  1W3X A;  4MX3 A;  3H42 B;  2Y38 A;  2Z79 A;  4XFF A;  1LOF C;  4ZS3 A;  3O1O A;  4QQL A;  4AYU A;  1NCQ A;  3M4F A;  3OG2 A;  5EYX A;  1SFN A;  2Y6G A;  3III A;  1JYV A;  4HFS A;  1X33 A;  1RUO A;  1C5I A;  2ORX A;  3WDV A;  1TMF 1;  2Y33 A;  5JPN B;  3SXW A;  1WLT A;  2AEN A;  1S0J A;  2Y64 A;  2PAE A;  5I8S A;  3NV4 A;  4NRQ A;  5FMO S;  3RG0 A;  1O4T A;  1VBE 1;  5I0D A;  3N9Q A;  3DPR C;  2BNM A;  4EWE A;  4AI1 A;  4YYO A;  3WNL A;  2WT0 A;  4AVT A;  5A3P A;  1PGL 2;  2RHP A;  2HWC 2;  2D6O X;  4XF9 A;  1G9B A;  1SHW B;  2WNV B;  2W0X A;  3B7M A;  4XEZ A;  3OBA A;  4XZP A;  3EO6 A;  2J1E A;  4R9C A;  5A6Y A;  1GAN A;  2XWJ B;  4MAD A;  3RVH A;  3RZH A;  1SPP A;  2OT7 A;  1FOD 2;  4QM8 A;  3T0D A;  1H2K A;  1OPM A;  1QOS A;  3CIH A;  3RWK X;  3NNL A;  3HEI A;  2D5F A;  1PGS A;  4D8M A;  2B7Y A;  2DVG A;  1C4R A;  3KT4 A;  1PMI A;  4E2Q A;  2VG9 A;  3PU8 A;  4UFL A;  3T2P A;  5CAZ A;  1JZ3 A;  5DAQ A;  1ND2 A;  1SFY A;  4ARY A;  3NV2 A;  3VBF C;  3MID A;  3IPV A;  3RYR A;  1QDC A;  4TZD A;  3ZN6 B;  4UF0 B;  4CDU C;  1OXC A;  4YW5 A;  3KT1 A;  5I0T A;  5BY5 A;  3ZIW A;  1PIV 3;  2L9L A;  5A7O A;  5FZ4 A;  5KHI A;  3LDK A;  1L7Q A;  2B9V A;  1R09 3;  1A8D A;  1RMU 3;  3KMH A;  4NMI A;  4PF1 A;  5GKA C;  5A7N A;  3T0A A;  5F7U A;  5FPL A;  5FZA A;  1W0P A;  4DEV A;  5JAX A;  4HLT A;  4CPB A;  4IV3 C;  3BB6 A;  2ZGQ A;  2ZXQ A;  2BUK A;  3WQ0 A;  1Q8Q A;  5JZG B;  3M3O A;  1X9P A;  4QHO A;  2QVS B;  2D6K A;  4LBJ A;  3IM0 A;  4DS0 A;  1LOE A;  1YIF A;  3VZM A;  1S0B A;  2LW8 A;  5IVB A;  2WLQ A;  1W28 A;  3OD0 A;  3T30 A;  1Z78 A;  4Y1Y A;  3I2K A;  4AQT A;  4GAZ A;  1WGP A;  4K1Y A;  4P9W A;  1MEC 1;  2WWS A;  4PIZ A;  3R4U A;  1VMJ A;  3HPN A;  4G9S B;  1QJX 2;  3NAP B;  4HVR A;  3A4U A;  2G9Z A;  2Z69 A;  4K1Z A;  2JWP A;  5I0R A;  2IXK A;  1XSQ A;  2Q4S A;  1YUD A;  4IET A;  1FPN 2;  2GMM A;  5IVE A;  1W9F A;  2JD9 A;  3WDU A;  2WO7 A;  4UXA A;  1CZT A;  4LTA A;  3UET A;  3WD5 A;  1UQX A;  2HWC 3;  2JDA A;  1COV 2;  5FXX A;  1FT9 A;  4IQP A;  2QKD A;  4KGG A;  2WNU C;  4BIS A;  4IE4 A;  3H8O A;  1WCU A;  1SCS A;  4YG6 A;  4WVM A;  2ZTN A;  1QEX A;  1OLM A;  5FPX A;  1F5J A;  3U11 A;  1CAV A;  1LUL A;  1UZV A;  5JXH A;  2QUO A;  4AQ6 A;  3AP9 A;  5CA6 A;  2XG3 A;  5FPA A;  5J3U A;  1AYN 2;  1HXS 2;  3M3E A;  3AKR A;  2HWF 3;  3ZXJ A;  1QMJ A;  1AJK A;  1OF3 A;  2J7M A;  2ZX0 A;  3PUH A;  4NHM A;  2P37 A;  3NKT A;  4RFT 0;  1W2T A;  3ITQ A;  3N9O A;  4LPL A;  4AOC A;  1YFX A;  4CCC A;  1SLI A;  4QQP A;  5FPV A;  5A1L A;  4DRV A;  4IL7 A;  3VBS C;  4E4Z A;  3ZFF C;  4KMQ A;  4FVV A;  5FYU A;  3ZVX A;  1CIW A;  3KM5 A;  3I2J A;  4HBN A;  4JTN A;  3PJQ A;  2WO2 A;  2VXJ A;  2FMD A;  3M8L A;  3V65 A;  4CCO A;  4AQ2 A;  1UX6 A;  1US3 A;  2VO5 A;  4GJZ A;  2GMP A;  2YU1 A;  4Q4V 1;  1FMD 1;  1LAJ A;  3DN7 A;  3THP A;  4OZX A;  3WF0 A;  3MF6 A;  3U4X A;  1POQ A;  3I3B A;  4JKK A;  3TRS B;  3L2Y A;  2VMC A;  3C2U A;  1PIV 1;  3D4K A;  3DKW A;  4AEK A;  1CD3 G;  1G9F A;  1LCL A;  2BBA A;  2DVD A;  2VTX J;  3WDT A;  4ITC A;  2Y6J A;  1QJX 3;  2JEM A;  1ENX A;  5JOW A;  1K42 A;  4EE2 A;  2JE9 A;  4BQ4 A;  4XXA A;  3RI8 A;  1GZW B;  5AVP A;  1SEF A;  1COV 3;  1CN1 A;  3E6C C;  1QJY 2;  2ZBJ A;  3U78 A;  3USS A;  1S0F A;  2XLA A;  3LEI A;  4LO4 B;  3HBK A;  1AXK A;  4QWN A;  4Q0U A;  3ZSK A;  4CEY B;  3WOG A;  1UYZ A;  3ECQ A;  5LZ6 A;  4IEU A;  1WD4 A;  4AEJ A;  2HWE 3;  4OI1 A;  1EY2 A;  2W1Q A;  4OI2 A;  3CQO A;  4A2U A;  5C3O A;  4DOU A;  3ZXA C;  3ZR5 A;  4O9E A;  2JEN A;  3LFM A;  1W6M A;  3VBR B;  1PGL 1;  3DEM A;  1AYN 3;  1HXS 3;  2HWC 1;  3PNA A;  3PDQ A;  4QQH A;  4Q2F A;  4A4A A;  2ZML A;  2EAL A;  4XZU G;  4FPH A;  2W91 A;  3WCR A;  5M0T A;  1WLD A;  3GHN A;  3ZSE A;  5FUP A;  1C1F A;  1A6C A;  1NLS A;  3AXE A;  5F3G A;  5IVJ A;  2F4L A;  3AM2 A;  1FOD 1;  1ODN A;  3H1Y A;  3WF2 A;  2VZS A;  2YGL A;  5FPZ A;  1VAL A;  4IE0 A;  1HV1 A;  1UW8 A;  5T3N A;  3IBM A;  4IEO A;  4CUG A;  3MO4 A;  3AKQ A;  2IFW A;  2VOV A;  4E8D A;  1W2O A;  4RQP C;  3WNP A;  1WKY A;  2ES3 A;  5FY0 A;  3I54 A;  2HH9 A;  4UBG A;  4EWD A;  2YYO A;  5DMY A;  2JEC A;  1OUX A;  1ST8 A;  5DUX A;  4AXO A;  5FYC A;  1DZQ A;  4KU7 A;  4YVW C;  3KHC A;  4M01 A;  2OZJ A;  3BU7 A;  1HQL A;  3ZFE C;  2VMG A;  4UOJ A;  1H2L A;  4ZPI A;  3VUO A;  3HWJ A;  5CFD B;  3JD7 2;  1OOP C;  2VY0 A;  1TME 2;  5I8T A;  2DF7 A;  4ZXK A;  3MBW A;  5L73 A;  2C24 A;  1YI9 A;  3H3U A;  4M00 A;  3A23 A;  4KBZ A;  1QJY 3;  2GP5 A;  1NXM A;  4DUW A;  5A32 A;  5IYY A;  4IGQ A;  4LK6 A;  4YW7 A;  4D6S A;  4M0H A;  2ZGK A;  1FV3 A;  2SLI A;  1K5M C;  3WW4 A;  1XND A;  1X36 A;  5FAX A;  1NAE A;  2K0G A;  4K8R B;  1FPN 1;  5EFU A;  5F5C A;  5FJK A;  2V72 A;  3UGH A;  4IE6 A;  3MEP A;  2H6C A;  3WW2 A;  1W8H A;  4LIT A;  4M3C E;  1A34 A;  1R08 3;  4Z8B A;  4CXX A;  2YY1 A;  3TNP B;  3KV4 A;  2A1X A;  1GZC A;  5FZL A;  3W59 A;  4BOW A;  1NUK A;  2UUR A;  4XUN A;  2WQ8 A;  1M06 G;  1F35 A;  1JOP A;  3ZXL A;  4LOT A;  4K3U A;  2ILM A;  1UU6 A;  4RS5 B;  1GIC A;  1LEM A;  5JOZ A;  1ACC A;  1DG6 A;  3RZZ A;  2X8K A;  4LT5 A;  2OS2 A;  4FBF A;  2WJS A;  1AYN 1;  4XUO A;  1U5I A;  2ENR A;  1GP5 A;  2W9X A;  1KJR A;  5FP3 A;  2XML A;  1R1A 3;  3FFQ A;  1GOG A;  4ZON A;  3BVC A;  4Q27 A;  1CON A;  4WM8 B;  5FUI A;  5AFE A;  1REE A;  4GB3 2;  3ILR A;  4GAL A;  5FIX A;  3GF6 A;  4LKD A;  3B00 A;  3WNO A;  2RDQ A;  1JW6 A;  4WVV A;  4UFI A;  2FDH A;  4N90 A;  1KRI A;  4X6R B;  4CYD A;  4OHX A;  1DIW A;  5JDB A;  1UO9 A;  3HBZ A;  4QU2 A;  3ILF A;  2HEV F;  2VL4 A;  1M4W A;  2J1U A;  1JU3 A;  3JD7 3;  3ZOI A;  1MS8 A;  4WZC A;  4FAH A;  3PU3 A;  1GLH A;  1KGY A;  4YSF A;  4I0W B;  3N4M A;  2DVA A;  4N43 A;  2V5D A;  1U5Y A;  3GZA A;  4L0P A;  5CVR A;  5CFC B;  1X8M A;  3NNM A;  4IV1 B;  4UW6 A;  3NWK A;  4L97 A;  4CEW A;  1ULO A;  1KJL A;  4GQ7 A;  4ASL A;  2WS9 3;  2FDK A;  2TEP A;  4LBN A;  5GAL A;  5BNN A;  1JYX A;  5EHD A;  2Y0O A;  2D6L X;  2FDF A;  2DVF A;  4HN1 A;  3I59 A;  2VQT A;  3TOJ A;  2WFF 1;  1APN A;  1RUF 1;  1W6Q B;  4OUL A;  2A3Y A;  2VOK A;  4XDP A;  5DG1 A;  3VLB B;  5ACA 1;  1XNA A;  2ZX1 A;  1N1S A;  2XR4 A;  4HOO A;  1QJZ A;  2W1S A;  3P6B A;  3AKP A;  2G1M A;  5E89 A;  4XFA A;  2ETE A;  4QU1 A;  3ACH A;  1Z0H A;  4Q0S A;  3UGG A;  1QU0 A;  2J1A A;  3OBZ A;  1ZRI A;  2VH9 A;  4LLF A;  4BK5 A;  1O8P A;  3TB0 A;  1W6N B;  2VNG A;  3H3Z A;  1MS4 A;  1XQN A;  5E6H A;  4GKX A;  4L9B A;  1PX3 A;  2WL1 A;  2R06 3;  4HG6 B;  4G3Y C;  4LIU A;  3ZDS A;  3FBY A;  4Y5Z 0;  2PHU A;  1PK6 A;  5AC9 2;  4ISQ A;  3ZYP A;  3RZL A;  5C5T A;  5J96 B;  2XLF A;  3KB5 A;  5BNO A;  5LB6 A;  3KF3 A;  1YJL A;  3VD5 A;  1UY2 A;  4LKS A;  4E9K A;  2VMH A;  5JPM B;  1IPJ A;  2LM3 A;  3SCH A;  3FLP A;  2WT2 A;  3C3V A;  3AKT A;  1T2X A;  2ERF A;  2XON A;  5LA0 A;  3ZKU A;  1UAI A;  1UU5 A;  1Y9Q A;  3LSD A;  4P9X A;  3T4H B;  3AZV A;  3JB4 C;  4IER A;  5CIR A;  3UNP A;  4GB3 3;  3VL9 A;  1UF2 C;  4MH0 E;  1L7L A;  4JGY A;  1DLC A;  4NE9 A;  4XJU A;  2A5Z A;  4YG3 A;  2OX0 A;  2SBA A;  5A80 A;  2RR1 2;  4BQY A;  4NRO A;  2EXJ A;  1TZO A;  3FLT A;  3PLQ A;  2BOI A;  2P3I A;  4Q4Y 2;  1ZYB A;  3VHR A;  3MV0 1;  4YW6 A;  3OTF A;  4GH4 B;  1W9Y A;  3GJB A;  1CAX A;  4YM1 A;  1MS3 A;  3WY6 A;  1N3O A;  4EN8 B;  3H8X A;  4XYX A;  1H0B A;  4IUG A;  4GMP 3;  2VQA A;  4TSV A;  3VBU C;  1MZE A;  5C3Q A;  1ASJ 3;  2YC4 A;  2ZA9 A;  3LZZ A;  1VBB 2;  3LQC A;  4OHW A;  4QPI A;  5EQU A;  2CL2 A;  3ACG A;  1RXF A;  4YVS A;  1J59 A;  3H9A A;  2A6X A;  4JQR A;  2J1S A;  3TEX A;  1BVV A;  1EUU A;  1TME 1;  1HV0 A;  2BFU S;  4HPK B;  4R9A A;  2WNO A;  3MUY 1;  4CTE A;  1XE0 A;  4FOY A;  2JD4 A;  4LR4 A;  2VNO A;  5BNP A;  2PN5 A;  4LBM A;  4EZH A;  1V9U 2;  3HQU A;  2WN2 A;  2ZGL A;  4ASM B;  1QF3 A;  1QOO A;  1ULD A;  1O3T A;  5FUN A;  5FOJ B;  1NXD 1;  4LQR A;  4I0A A;  3IDE A;  1Z7S 3;  4WVW A;  3R4S A;  3A0N A;  1W3V A;  3B69 A;  3ACI A;  3KWV A;  3O0X A;  3RGB A;  3JCI A;  2JDY A;  3ZFG B;  5AC9 3;  1JZ4 A;  4MOA A;  1D4M 3;  1H8T B;  1HLC A;  3U37 A;  4Y5T A;  5IFT A;  2C6S A;  1CJP A;  2DTY A;  4W8J A;  1DDL A;  4CU7 A;  4OI4 A;  5FY9 A;  3VZN A;  5T5J A;  4CEY C;  1XYO A;  2V5Y A;  3IMN A;  5BYN A;  3FMG A;  4TWT A;  4XFI A;  1JXN A;  1CX1 A;  1JMU B;  1V70 A;  5JSP A;  5KXD A;  1YFY A;  3ILN A;  3VBR C;  5L9R A;  1CJD A;  3LKJ A;  4IDZ A;  3KCX A;  2HYX A;  1ZRR A;  2E7T A;  3K51 A;  4AAX A;  1Y3T A;  2VVE A;  3GHM A;  2VQ0 A;  3RWN A;  1DU3 D;  4Q4Y 3;  2P2K A;  1MVQ A;  4CU6 A;  2E9Q A;  5I8Y A;  2BPA 2;  4HMZ A;  3NNF A;  5FLJ A;  2A73 B;  2D5H A;  3NST A;  3BGA A;  4ONU A;  4QXH A;  3FC0 A;  4DXR A;  2VME A;  3UT0 A;  1OVS A;  4Q4X 2;  3ZXE A;  3MHZ A;  5CG8 A;  3E6D A;  4JZR A;  3LOI A;  4OUE A;  2HWD 2;  2W5F A;  2ZZQ A;  4ASK A;  2N7G A;  5KHJ A;  1ZRE A;  3PVE A;  2RS3 3;  1QH6 A;  2VQU A;  1LNS A;  3IAP A;  3ST7 A;  1ZBE 2;  5FZC A;  2X10 A;  4B7K A;  3K75 B;  5T52 A;  1DF0 A;  4AQS A;  2OPW A;  3MIG A;  4NWW A;  1SBE A;  2C1F A;  5FZM A;  1LHV A;  2WNV A;  2P3K A;  1RUH 2;  5FOB B;  2JG8 A;  3M3C A;  3KV6 A;  4IGO A;  4CDU B;  3AKS A;  1TNR A;  5KC6 A;  4Q1R A;  4XBN A;  1KEX A;  5HCA A;  3J9S A;  3SHR A;  3WF4 A;  4CUB A;  1XE8 A;  5H9P A;  1V9U 3;  3K3N A;  4N7U A;  3QD6 A;  2UYA A;  2BER A;  3AZZ A;  4LUK A;  4OLL A;  1MR5 A;  3WNN A;  5KHG A;  1D4V B;  2WZE A;  4IV3 B;  4QHZ A;  4TLF A;  3ETQ A;  2AUY A;  3H8R A;  3T2T A;  3NJZ A;  2JKX A;  2BGC A;  1UXZ A;  4N53 B;  4IES A;  2FCU A;  1WWY A;  4CCJ A;  1WCS A;  3KT7 A;  5J1X A;  1YFW A;  3EYP A;  3N36 A;  5JI7 A;  4BLJ A;  4Q26 A;  3GNE A;  5JWP A;  3O1T A;  3FUO A;  1RHI 2;  5H9R A;  1NG0 A;  2VW0 A;  5FTT C;  3ZLI A;  3ASI A;  4XHB A;  1DFQ A;  5JZG A;  5CKN A;  1BHG A;  4L99 A;  4IE7 A;  2WSV A;  5CNA A;  3THT A;  3GBW A;  2WO1 A;  5DAB A;  3POW A;  2K46 A;  1RUJ 2;  1YJK A;  2XJU A;  2GN7 A;  2ZKN A;  3TAY A;  2XJS A;  2GC1 A;  3JBG 3;  1XNB A;  1F9K A;  2ZGR A;  1QQP 3;  3KCC A;  4NN0 A;  5GLZ A;  3NKG A;  1TE1 B;  4PDW C;  5IFP A;  1ZBA 3;  4XTP A;  1ZZB A;  5T5O A;  3NAP A;  2PLV 2;  5J36 A;  3BU0 A;  3OEB A;  1OC1 A;  3LWC A;  1ZBE 3;  2RR1 1;  4CCN A;  1DQ4 A;  1NY7 2;  3WF3 A;  3WP5 A;  1UZY A;  1S55 A;  5C8C A;  1REF A;  2ZPX A;  4K40 A;  1CES A;  1OA2 A;  2YBK A;  3W9A A;  4BQ1 A;  1PHM A;  4FP2 A;  1ENR A;  4WM8 C;  4ZZ5 A;  2ZGM A;  4H14 A;  3E97 A;  3N3H A;  5FP8 A;  4ZKT B;  2D3R A;  4XAB A;  3K4D A;  4CXY A;  5FMC A;  4QPG B;  3UKN A;  4RGK A;  2EIE A;  2D7F A;  3MW2 A;  5FCC A;  3VBS B;  5FJH A;  2AZ5 A;  1NYW A;  1VBB 1;  4P9L A;  1ZZC A;  3OJB A;  4LLO A;  4EYU A;  3ZR6 A;  5GZF A;  5D1I A;  4BJ0 A;  4QGN A;  2XJP A;  3AP7 A;  2RJL A;  3O1M A;  4XDQ A;  2PXJ A;  3OSD A;  4NHY A;  2CAU A;  1X9T A;  4QX1 A;  1WLC A;  4K9S A;  5F32 A;  5LY2 A;  2HBU A;  2VPV A;  4J1W A;  4LUM A;  2X5I B;  4E4S A;  2DCK A;  3LEM A;  1W6P B;  1CIY A;  2NMO A;  1K5J A;  3EHK A;  1JTZ X;  3CNA A;  1O5U A;  2XGX A;  3FLR A;  3SH5 A;  5K0U B;  1V6O A;  2VTF A;  4QHB A;  3GBF A;  5LAT A;  4KWJ A;  2E53 A;  1T6G C;  1F5F A;  1FNZ A;  4YZ1 A;  3AK0 A;  1EAH 2;  2VVF A;  1B09 A;  4AZZ A;  1QJU 2;  3WUC A;  4P9I A;  1J3R A;  3ORJ A;  2H0V A;  1NA1 A;  1TMF 3;  1VBD 2;  4MG2 A;  3AYD A;  1LJ7 A;  5E1R A;  2Q1M A;  1VBE 3;  4HSL A;  5A7P A;  1CVN A;  1H2N A;  1KFU L;  2VE1 A;  3A0K A;  5F6L B;  3ELN A;  2D3P A;  1GWL A;  2JDN A;  1IG0 A;  1PVX A;  1JYT A;  2PHF A;  1GZW A;  1RC6 A;  1GP4 A;  1N1Y A;  5FBJ A;  1RUI 1;  3VN4 A;  5EJ3 A;  1WW5 A;  4CCM A;  1OA3 A;  4G4F A;  5G04 L;  2H0B A;  1JS9 A;  3P5B A;  2JDU A;  4GWJ A;  4Q4X 1;  4QPY A;  3DYP A;  4IW3 A;  2ADE A;  4FPE A;  2HWD 1;  5G05 L;  1QWR A;  4LK7 A;  4Q0V A;  1GU3 A;  4XJZ A;  2TBV A;  1ND3 C;  2O8Q A;  3KLS A;  4TLG A;  5L7O B;  2QQJ A;  3H50 A;  2RE9 A;  1JBC A;  1GOH A;  3H3L A;  2CAV A;  3B9I A;  5AVA A;  3S6P A;  4D7T A;  4UFJ A;  5EV7 A;  4FPJ A;  1BK0 A;  4RQP B;  1W06 A;  1RUH 1;  1HRI 2;  4R52 A;  2DU0 A;  2FDI A;  3ZSJ A;  3LIG A;  2HYK A;  1IOA A;  1RYY A;  2VUC A;  3T4V A;  4LA3 A;  5B4N A;  3CJI B;  5EPA A;  4A45 A;  3H0O A;  2BNN A;  1W9S A;  4AHY A;  3SCG A;  2D98 A;  2QQK A;  1YIP A;  1CZV A;  4CDX B;  3ZFE B;  2VW1 A;  2ZKL A;  4ZY9 A;  2BBV A;  1EUT A;  1OUR A;  1YQ8 A;  4XET A;  5I93 A;  1DQ0 A;  5CIS A;  1OOP B;  3ZYB A;  4V2W A;  1Y9G A;  4FPF A;  4WBB A;  5ERL A;  1QGL A;  1W39 A;  1WA4 A;  5F3E A;  5LA9 A;  1MS1 A;  5HXM A;  3O1U A;  1XXN A;  3SEE A;  2W52 A;  1MEC 3;  1WMX A;  2H6B A;  1C8N A;  5CU1 A;  2WYS A;  3PUS A;  2GNT A;  3K4A A;  4P02 B;  4DIN B;  1RHI 1;  3B01 A;  1V6N A;  4MHR A;  1F2N A;  4XQW A;  5FYY A;  1H8T C;  3FHA A;  2Q8O A;  3T1M A;  4D0Q A;  4IGP A;  1GQG A;  1VB4 A;  4M3C B;  5CFD A;  5C9A B;  2ZAH A;  3GM8 A;  4M4R A;  1UX7 A;  4EN0 A;  4XFH A;  2ARA A;  4R8H A;  4MZU A;  2RG4 A;  3P3P A;  2DBI A;  4IXL A;  3WP3 A;  4HKL A;  5LEJ A;  1RUJ 1;  3RS6 A;  2VZT A;  2YC0 A;  3ROU A;  4CP9 B;  4OHZ A;  4CDQ B;  1HN1 A;  1ALY A;  2XKO A;  2I2S A;  4RR3 B;  3J4U H;  3UV9 A;  3WDW A;  2PLV 1;  2WDB A;  4CUA A;  4D7Y A;  4A7Z A;  4FPC A;  1NY7 1;  1QXJ A;  1EPZ A;  2JDK A;  2JIJ A;  4CRQ A;  1Q56 A;  3KGL A;  5EZW A;  2EXK A;  5JIU A;  4WM7 C;  2HWB 2;  2BVB A;  2XVK A;  1X82 A;  1YYN A;  2YRO A;  3EJK A;  4K6B A;  4RSU A;  5D2A A;  4NIA A;  1OQE A;  2XL9 A;  4FOV A;  3KQR A;  4COW A;  3ZYJ B;  2D40 A;  5GZE A;  4K20 A;  2VZP A;  5A3U A;  2QQL A;  3VBO A;  2DV9 A;  4RS5 A;  2C5D A;  1W8W A;  3JQW A;  4Q4V 3;  1FMD 3;  5F39 A;  4Q29 A;  1L3J A;  1G7Y A;  3ZXG A;  4UAP A;  4ZHN A;  3I3Q A;  4NJ4 A;  3AX4 A;  2ZCW A;  5IAV A;  4BLI A;  4BCU A;  3ZDV A;  4ZXE A;  3WT3 A;  4H7L A;  4A3X A;  4IND A;  5FMO L;  5ABJ B;  4AI0 A;  4AG4 A;  3HOB A;  3UKT A;  2PAK A;  2W94 A;  4QKN A;  2P34 A;  2P17 A;  2D3S A;  3VKN A;  2YB7 A;  3OY8 B;  4XE9 A;  3J7H A;  4N53 C;  3JXS A;  3VL8 A;  1MQT C;  1EAH 1;  5DG2 A;  2ZHK A;  4AI2 A;  3AZY A;  2JG9 A;  4JHT A;  4CA9 A;  5IK5 A;  1OD3 A;  3BUC A;  1QJU 1;  5LBE A;  4AVB A;  4BHP A;  1HKD A;  5J37 A;  3WV6 A;  1XC6 A;  1LB2 A;  2GNB A;  2WSU A;  3B3Q E;  4QPW A;  1A8M A;  1ULP A;  1TEI A;  5CFC A;  4NPL A;  2RDS A;  1VBD 1;  4NR1 A;  4IV1 A;  1ZX5 A;  1JOD A;  3IZO A;  4E4H A;  4IEX A;  3VBH B;  1WUV A; 
#chains in the Genus database with same CATH homology
 1OH3 A;  1W9F A;  4LJH A;  2LRP A;  2O14 A;  1GWL A;  4CPB A;  1W8U A;  2WYF A;  2KR2 A;  5D21 A;  4AL9 A;  1GWM A;  1UOJ A;  4BQ3 A;  1WZX A;  4BQ4 A;  1WCU A;  4LKD A;  2VXJ A;  3UT0 A;  3ZYF A;  1HN0 A;  2K46 A;  2Q1F A;  4LKF A;  1GWK A;  2C24 A;  3ORJ A;  4YWA A;  1L7L A;  3ZYB A;  4CP9 A;  4CP9 B;  4A6S A;  1W8W A;  1V0A A;  4LK7 A;  1W8Z A;  4CPB D;  1OKO A;  3F95 A;  3ZYH A;  4LK6 A;  4YW7 A;  4BQ2 A;  1W8T A;  1WMX A;  2JWP A;  2LRO A;  1W90 A;  4BQ5 A;  4LKE A;  4YW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...