2Y6KA

Xylotetraose bound to x-2 engineered mutated cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
b'LVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSLDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
total genus 43
structure length 165
sequence length 165
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y6kA00
3CZJA 3P6BA 3C7OA 2J1EA 3GDBA 5G04L 2W3JA 2VZRA 4M4RA 3FL7A 2VZUA 2Y6GA 3VDAA 2ZEWA 3HNMA 4CUAA 4LQRA 2JDAA 3WNMA 1DLCA 2X10A 4L0PA 2VTFA 4KMQA 3K4DA 2L9LA 2J1AA 3K46A 3U37A 4XUOA 4DUXA 3WF3A 3IAPA 1WCQA 3BN6A 4OUEA 4UAPA 4FI9A 2RVAA 1P8JA 4LPLA 1LNSA 2J1RA 2JE8A 3DYMA 4P08A 3MBWA 4QDQA 2VZQA 3WEZA 1NUKA 2EICA 4ZZ8A 1W9SA 4A41A 3PUHA 3P1IA 3NRUA 4E8DA 2WZEA 5JUVA 4P00B 4BJ0A 2VMFA 4XUTA 1SG3A 1US3A 3I97A 4DEVA 1JYXA 2J1TA 4CU9A 2VQTA 4PQQA 5CZKA 2QQLA 1JZ2A 3NJXA 2WYSA 5EIYB 3SKJE 1CZSA 4YPJA 4P5YA 2VZ1A 1UYYA 1UXZA 4KWUA 2X09A 3GM8A 1UYZA 3J7HA 5LA2A 3MUZ1 4BXSV 1PX3A 1UMIA 4QDSA 1H6XA 1PMJX 2W1SA 3K4AA 5HXMA 1JU4A 4RN5A 4XURA 3T0DA 2VCAA 3I2KA 4OYUA 1UZ0A 3UNPA 4CU8A 3I2JA 4XVHA 1UY2A 2YFZA 3EYPA 1TVGA 1H6YA 4E8CA 4HG6B 5DPNA 5C7GA 2Y6KA 3WNKA 2JD9A 3C7FA 4MADA 3WNLA 1UY0A 1GU3A 4Z2AA 4QB2A 2JKXA 2VZVA 3K4ZA 3CMGA 4P02B 2ORXA 4QX0A 3T2PA 1DYOA 2V4VA 1O59A 4W4ZA 3K77A 4OZOA 2HLEA 5C71A 2ZEXA 1JZ5A 2QBXA 4LKSA 1JYNA 2Y6JA 4GWJA 2E31A 4IUGA 2W95A 2WQ8A 1J83A 2EIBA 2Y8KA 5CYYA 3VD7A 2YC2A 3I2IA 3EB7A 2WO2A 1GNYA 2BZDA 5LA0A 2ZXQA 4JHZA 5JXIA 2VO5A 2WN3A 3CKHA 1BHGA 2B4KA 3PUIA 2C26A 1F4HA 4MGQA 3HN3A 2W1WA 5DN2A 1JZ7A 1UWWA 1TG7A 4ZZ5A 2WAOA 4A3ZA 2VQUA 4MGSA 4QX1A 3WNNA 4D8MA 1K42A 4DUWA 2QQJA 2ID4A 1ULOA 2VR4A 2YB7A 3I3EA 5DQ0A 3IIIA 2C9KA 3SEPA 2Y6LA 1JHJA 4LHSA 3VDCA 2DDUA 1JYWA 2R7EB 3VD4A 2BGPA 3NQHA 2WDBA 3MV11 1OD3A 1D7PM 1XPWA 3BGAA 1O8PA 3GGLA 3T0AA 4AAXA 2VCBA 4MOAA 1US2A 3MV01 2Z4FA 3OGSA 2ZEYA 5LCWL 3C8XA 4CU6A 4TTGA 3JXSA 2CDOA 1ULPA 1SHWB 2VZPA 3HOBA 4QDRA 1UXXX 1W8NA 4CUBA 2EIDA 2RV9A 2WO1A 2YG0A 1DP0A 3MUY1 2X05A 2QQOA 3OG2A 5JMOA 3A23A 2ORZA 3NJVA 1MPXA 4GWIA 3I2GA 3IB3A 3A21A 4QPWA 2W87A 4JX0A 3LEIA 4XUPA 1CIYA 2DCJA 3T08A 2W92A 1W9WA 3ACFA 3ECQA 1NKGA 5A1AA 2HYXA 5I0DA 2XQXA 5IJRA 1R64A 4W50A 4QX2A 5JR2A 4PT6A 4A45A 4DXRA 2WUHA 2CDPA 4AG4A 4D0QA 4CU7A 1NX9A 1IQDC 1J84A 3I2HA 3UESA 5DMYA 2W1QA 2OKXA 3CZUA 4QX3A 1UY4A 3DECA 3HPNA 1JZ4A 4TXWA 2J1SA 2Y64A 4BK4A 2WN2A 1K45A 2VZOA 2VC9A 2E26A 5JXHA 1F4AA 3HEIA 3MO4A 4OMDA 1I5PA 1XC6A 3GXUA 3OGRA 1CZTA 2YC4A 1JYVA 3SKVA 2EIEA 1EUTA 1RYYA 1K12A 4GZ9A 2E33A 4ARYA 3FHAA 2VMDA 3HNYM 3A7QA 4MO3M 3NNGA 1XNTA 4M4PA 3IDAA 2B9VA 2WBKA 1JZ8A 2BGOA 4DEQA 3OGVA 3T2QA 3THCA 3WNOA 3OEAA 3FHQA 3I3DA 4W8JA 1W8OA 2QQKA 2W91A 2YFUA 4A4AA 1UX7A 5C70A 1GUIA 1GOFA 3THDA 4A42A 5JXJA 3ACGA 1SDDB 1JZ6A 1CX1A 2VZTA 3E1F1 2QQNA 4XZUG 4OMCA 3LPFA 4XUNA 5FUIA 1CZVA 2RJ2A 5B4NA 2VZ3A 5IYYA 1L7QA 2Y6HA 2W46A 3T09A 3C7GA 5F7UA 4PF1A 2LS6A 3VD5A 4QB6A 3C7EA 3SEEA 4RYDA 4BK5A 4UOJA 3ACHA 2J1VA 4DUVA 3ACIA 1K3IA 4DXTA 4JKMA 1XNAA 2WO3A 2V72A 4BDVB 5EJZB 2BBAA 1KEXA 2XOMA 1UMHA 2J7MA 3I2FA 3DYPA 5G05L 1PX4A 3HJRA 1W0NA 2WABA 1YQ2A 3AC0A 2VZSA 1JI6A 1OH4A 5LA1A 3WSOA 4A6OA 5HPOA 3IAQA 2ZEZA 3WF1A 2KD7A 5J1XA 2WZ8A 2XHNA 4QB1A 2E32A 1WKYA 2PQSA 3CQOA 4ARXA 3VD3A 3WF4A 3W5NA 3DYOA 5IHRA 2VMCA 3I3BA 3LE0A 2VL4A 3T0BA 2VM9A 2W5FA 3FN9A 2WAAA 3LQCA 4ET7A 1UY1A 2LW8A 2VCCA 4CVUA 3C7HA 4A44A 5JXGA 5IFTA 1UYXA 2VJXA 1JZ3A 2W94A 3CIHA 3LEKA 1W99A 3WNPA 4QAWA 2W1UA 2V5DA 1GMMA 2QQIA 1KGYA 2XONA 2BERA 1OT5A 2W9XA 3WF0A 1O8SA 4DXSA 3T2OA 1GOHA 2W47A 2J1UA 1HN1A 4JKLA 3VD9A 2VOTA 3WF2A 2VMEA 4CUCA 1JU3A 1GOGA 3CDZB 5B4XA 3HNBM 3A22A 1GQPA 1NAEA 2C4XA 4ZY9A 3OB8A 3UETA 3ZM8A 1OF3A 3OBAA 3ABZA 1EUUA 2J22A 2DCKA 4XUQA 3F2ZA 3OEBA 5IFPA 3VDBA 1L7RA 1W9TA 3W5MA 1T2XA 3D3AA 3WQBA 2QQMA 1PMHX 3LEGA 1OF4A 5EJ1B 4JKKA 4ZXEA 4KI5M 3LPGA 1UY3A 3K75B 4UI9L 3ETPA
chains in the Genus database with same CATH superfamily
3CZJA 3VBSA 2IXIA 2VPVA 5LY2A 1W6OA 3TEWA 2ADEA 1HB2A 2D3RA 4O61A 1I6XA 3RMYA 4CDXA 5G04L 5LW9A 4OLLA 4E2SA 3O1MA 3TEXA 2HWD2 3E5UA 5KHIA 2B8MA 5JDBA 2VXJA 1ENQA 5FWEA 2ZEWA 3MIHA 5JOXA 3VHNA 3ZOIA 1DG6A 3MW4A 5FFOC 1NXD1 2RMU3 3IMMA 5LB6A 1YHFA 3ZR5A 4E27A 3I2DA 5A3LA 2JWPA 2JDAA 1J3RA 1UN1A 3AFKA 3NWKA 4YZ3A 3WHTA 3MGUA 2X10A 2LROA 4L0PA 2VTFA 3EJKA 2Q8EA 2CGPA 5FY0A 2J1AA 3W9AA 4I2OA 4XUOA 2BVBA 1UX6A 3N36A 3IAPA 2WS92 2ARXA 1WCQA 3WT3A 1OURA 1XRUA 5CEHA 1BEV3 1KDMA 1R1A1 1SCSA 3OUIA 3AYAA 2AREA 4J6GA 3WW2A 1OOPB 5DUUA 2HYKA 4ES8A 3NVCA 2BNOA 4L8QA 1VBD1 1V6NA 4P5HA 2HH9A 2VZQA 1LESA 3WEZA 3ZYJB 5A70A 1NE4A 4ZZ8A 4XABA 1W9SA 5FLJA 2HWE3 1RMU3 2ZAAA 1SEFA 4AAPA 2Q5TA 4LBOA 4P00B 2VTXJ 2WWSA 4WVVA 3VBHA 4NN0A 1BLZA 2PHLA 2G19A 5IK5A 1NCQB 4NROA 2D5HA 3KSCA 1N1VA 2PLV2 2J1TA 4CU9A 3T2TA 1KJLA 1KXGA 5T50A 2J42A 3OYWB 2QQLA 2RS51 3ZN6B 4Q8KA 4QKBA 1U5YA 1YLLA 4LBQA 3NJXA 4H3WA 1O7FA 2WYSA 1MEC1 3J7LA 3BU0A 4XJ9A 5BNNB 5FZDA 2OZ6A 4YFZA 5AC93 4P5YA 4EN6B 1FOD1 3IM0A 2JDUA 3J8F1 3LA2A 4RHV2 1CR7A 1UYYA 1UU4A 5FYVA 4K40A 4C1XA 1VPHA 4JTNA 1AYN3 4CPBA 1V00A 2DTWA 1ACCA 1UMIA 5CKQA 1H6XA 4RN5A 4BCUA 5A6QA 4FPKA 1OLRA 1UZ0A 3TOJA 2PAMA 4URAA 4QD2A 2R042 1NCRA 4IEOA 4ZPIA 3RRDA 4XVHA 4Q26A 3L2YA 2D43A 4JGZB 2NP0A 4QXBA 2BW8A 1G7YA 1WLWA 3HT2A 3QBQA 4Q4Y2 4C1WA 4K7JA 3JB4C 2TBVA 4LBMA 3VDDC 5GZEA 3MHZA 2JD9A 2ZHMA 4GB32 3AB0A 5FZ6A 1WW5A 4DFSA 4E9KA 2GNMA 3LFMA 4EN0A 4YARA 2GMPA 5CISA 1WLCA 1ND3A 4QXHA 3DXTA 4LA2A 5BNPB 2ZHNA 5L7OC 1DQ0A 1MS5A 1HQLA 3LIHA 1H0BA 2PFWA 1OLME 5FO7B 5F6LB 1CAVB 1QXJA 5FBJA 3MPBA 2G1MA 1DYOA 3H1YA 4CEYA 2LRPA 1CD3G 4P9IA 4AWDA 1O59A 2WZPP 1WW7A 3N9QA 2CNAA 3PMEA 3ZSLA 3ZX7A 2XB6C 5CB7A 4CDUB 4COZA 1QU0A 2HLEA 4MX3A 4TWTA 4UXAA 5F5QA 1JXNA 1DGLA 3WCRA 3NNMA 2YYOA 3AMHA 3KHBA 4IUGA 1EPZA 3AZZA 4OULA 5K7PA 4DRVA 2Y8KA 5CYYA 5EYXA 5FTTC 4UW5A 4FPOB 1OD5A 5ISLA 4KU7A 2WO2A 3OF1A 5JOWA 2DTYA 4QPGB 5ABJC 2Q1FA 4BQ4A 3CKHA 3POBA 3LA3A 1D0GA 4D94A 1MS4A 1VMJA 4UBHA 3VBRC 1F4HA 4YM3A 1J58A 4OI0A 1REEA 2R062 4Q0VA 3ILFA 1UD1A 2W1WA 3WG4A 4BMEA 3BIEA 3L2HA 4LITA 2PHRA 2X53S 4LTAA 1O4YA 1VP6A 2PHDA 2VOVA 3JZVA 4Y24A 1GWLA 2BGCA 4RL7A 4AFMA 5FZHA 2ZGSA 5L36A 4HPKB 3BTZA 1W8FA 2R1DA 1C4RA 3POSA 4UYBA 1W28A 1LENA 3BB6A 1HRV2 4DINB 1ULOA 4FOVA 2C9KA 1L7LA 3U75A 1COV1 1GYKA 4BE3A 4LHSA 1W6MA 2BRTA 3UKNA 2R6QA 1GZTA 4MXWA 1V9U2 2YZ4A 2ZTNA 2JDHA 3VHRA 1TNRA 2JDZA 1OD3A 1T6BX 2GH8A 3BTAA 1CAUA 2OQ6A 2GN3A 2C6SA 3NV3A 3SNMA 1ZA7A 3ZYPA 1HN0A 3T0AA 1UOJA 4Q4X1 1AR91 2VCBA 3AMNA 3M3IA 5DDJ2 4BLJA 1KITA 5IK4A 1TME2 1US2A 1XE0A 1LGNA 2Y6FA 4BU2A 5JCTA 5LCWL 1SLCA 3C8XA 3VHPA 1VRH1 1ND2B 3TEYA 3JQXA 1SPPA 2EF6A 2WL1A 4W6YA 4TTGA 5ACA3 3RJRA 3JXSA 2NZ9A 1Z7S3 1QXRA 1QJY2 4ZONA 5A3UA 4BMBA 4XFGA 1OA4A 1R091 2ZGOA 4IEWA 3VBOB 4B3NA 1WD4A 5DAQA 4DB5A 5GZFA 2EIDA 3GZEA 3B94A 2WSUA 3MUY1 2X05A 3OG2A 2ZZQA 1S0EA 4DQAA 1OSGA 4BOWA 2JEMA 1RUH2 1MVQA 4PJYA 3SLIA 5EPAA 5FZ3A 1ZBA2 3MIFA 3SHRA 2E53A 3I2GA 5K0UA 2RR11 1RVF2 1ND3C 4QPWA 4JX0A 3R05A 3THPA 3SITA 1N1YA 4J1WA 4IEVA 2I2SA 2ZA9A 4XFAA 2VBPA 1LGBA 2JG9A 3VZMA 5CAZA 5FPUA 4IE4A 4CCNA 3K51A 1PO12 3I3MA 2QQUA 3ECQA 5FOJB 5FZGA 1NKGA 4UT5A 4XDPA 2HYXA 3H9AA 4XDQA 3WW3A 5IJRA 4FOYA 2HEYF 1YRZA 3RPQA 2A70A 2JG8B 1JUHA 3VHOA 1CPMA 2QQVA 4PT6A 3WR0A 1PM4A 2IXHA 4A45A 4FFIA 4D0QA 1ZBE1 4FQZA 1OH3A 3DPRC 1PIV3 3ZMNA 1ZRDA 5FPXA 4F3JA 3JQWA 1VIWB 3MDPA 1HXS1 5FYTA 1CJPA 2GMEA 4HFSA 4M0NA 4NPRA 2W1QA 3FJSA 2YBPA 2E63A 5F3CA 1VBA2 5HBAA 2SLIA 3VBUB 2XG3A 5F8PA 3FC0A 3T30A 5JWPA 1NLQA 5FZ7A 5JVVA 1JZ4A 3N7KA 1GNHA 1QHDA 1QQP3 3T1LA 5DZEA 2E7TA 2VMGA 2VZOA 5CBLA 2VC9A 1Y43B 1L3JA 5APAA 2PELA 1WMFA 2ZZJA 3HEIA 3MIBA 1OA3A 4QX7A 1UZYA 3ZYFA 1JODA 5F3GA 4C8DA 1I5PA 4KU8A 2DURA 3I2OA 4FT8A 2I74A 1YWKA 2DVGA 2YC4A 2ZGKA 1JYVA 4K1ZA 3SKVA 2UY8A 1EUTA 4R9CA 2XBO1 4RFRB 4GZ9A 2E33A 4S2HA 2WLPA 2VMDA 4JDNA 3HNYM 2SBAA 4IV1C 1OBNA 3ILNA 1VBC3 1RIRA 4N8MA 5DAVA 1IZ3A 2FMDA 3WDVA 4AOCA 1Q43A 1XJAA 2V5YA 4L9BA 4Y22A 1JZ8A 3ZN5A 4H55A 5F9TA 2GSYA 4BQXA 4R9BA 1RUF3 5DXDA 4GMP3 3X29B 3MLJA 5FKBA 3VKFC 1UNBA 1X8MA 1RUOA 3MEPA 4P9LA 3TNPB 5IAXA 1RUJ1 4HN1A 3FHQA 1U0AA 4HSLA 1MZ6A 2GDFA 1R1A2 2R071 4YW5A 3GZAA 1WCUA 1W8OA 1DGRA 5C4WA 1O6UA 5C70A 1GV9A 5FZ8A 1GOFA 1LCLA 3CBNA 5GLWA 1VBD2 3THDA 3O1OA 4LE3A 2WNVB 1GZWA 5JXJA 1R083 1ODNA 1ZVFA 3Q8FA 2PAEA 2WQZC 3NAPB 4Q4W1 1JZ6A 3W59A 4H14A 3E1F1 4R52A 4LHLA 4XZUG 1RUI3 4OMCA 4HKWA 3ZR6A 1GFF2 1EV11 4O65A 1CZVA 3VBOC 3C3VA 4Q29A 5CNAA 2HWB1 1ZX5A 5B4NA 5IYYA 5CFCA 3T09A 1LEDA 4Q0QA 4U36A 2GNBA 1IOAA 3WDTA 3WNXA 4ASMB 4QGMA 2RS52 1BMV1 2Z79A 3URFA 3PVBB 4RYDA 3TAYA 1F35A 1ALYA 3ACHA 5FJKA 3AZXA 3O0WA 4OZXA 4P9WA 3Q8EA 3Q9OA 4YVWA 3H42B 1FOD2 4L97A 1K3IA 4MHUA 4DXTA 2WR9A 3J8F2 3TWIA 4JKMA 2WO3A 2P6HA 2VW2A 2TEPA 4RS5A 2DVBA 3IMNA 4YGCA 2IFRA 1UMHA 4B1LA 2IXJA 2VMIA 4XF0A 3MIEA 4N90A 1QF3A 2HWD1 3IDCB 3TN91 4HL0A 4QU2A 3BALA 2D98A 1GP6A 1PVXA 3KT7A 5GKAC 4IEZA 4CRQA 2JG8C 2CAVA 5FQ0A 3MYXA 4LBQD 3WY6A 4AFBA 3IAQA 2IZWA 1AYM1 1SMVA 1UPIA 2AACA 4I0BA 2BJSA 1DQ5A 1ASJ3 5LBCA 3UYJA 4XDOA 1APNA 4XIKA 4B7EA 2WZ8A 4D7SA 2VW1A 2XHNA 4U2AA 5A6ZA 4B4RA 5EV7A 2OS2A 5T5JA 1WKYA 5JSOA 2B42B 1IG3A 1PK6B 2P3JA 4OHYA 1VE0A 2GU9A 3LGRA 3VBUC 2P2KA 5IHRA 1LEMA 1W8TA 1PZ8A 3I3BA 4KG0A 1YI7A 4WM7C 2W0XA 3WCSA 1JYTA 3FN9A 3APBA 3AYDA 2VVEA 1X9PA 2DCYA 3HAGA 3LQCA 1HKDA 4XIOA 5J48A 1UY1A 2LW8A 4AVCA 2VCCA 4OI4A 1LECA 3C7HA 3MPPG 4A44A 1AVBA 1TZOA 5IFTA 1Q8PA 1Z78A 5JXGA 1UYXA 4RSUA 3ENRA 2ARAA 1YCIA 1HRI1 1DBNA 4FOQA 2W94A 3LEKA 4EYUA 1U5XA 4E4SA 4YVSB 3SC7X 3SH5A 2PLV1 4YM1A 4ARXA 2C5DA 3KGLA 2IC1A 2UY9A 3JD72 3LEMA 5D8AB 5JMCA 4EZ4A 1W8HA 3BPZA 1I9RA 2BERA 2RS11 1ZZBA 4DO0A 2IXCA 1J3PA 2W9XA 4PDWA 3WF0A 1CONA 2FDJA 2PMWB 5IVYA 3OY8B 3HQRA 3PJQA 2J1UA 4DS0A 3HQUA 4AXOA 1VB4A 2F17A 1VJ2A 3K48A 3WDYA 3FBYA 4YLZA 2DUPA 2GNTA 2VOTA 3KZ4C 4YM0A 4Q0UA 5C9AA 4Q0SA 1U12A 1DZQA 2Y38A 3FFQA 1NAEA 4RQPB 1UMZA 4PLMA 1D2SA 4XJ8A 3UETA 4QKNA 3ABZA 4AW7A 2AH2A 3SCGA 1W6PA 3AMMA 1EAH3 5CFCC 2GALA 4LNVA 3KVBA 3POIA 4XUQA 5CG8A 4LOTA 4RR3A 5FY5A 3U4XA 1DZRA 2D6PA 2GP5A 3ZFEB 4LBLA 4XJZA 1HJGA 1H2MA 3SXWA 5HCHA 4NRQA 4PI0A 5FMDA 1QIQA 2EXJA 1Q3EA 4EWDA 5J7MA 1CJDA 4UBGA 5EJ3A 5CFDC 5IVJA 5D2AA 2XUMA 4IDZA 5AVPA 4DNYA 3USUB 1AXKA 2MNGA 1WWYA 1AR92 4Q4X2 4W6WA 5EJ1B 4AQ6A 5A3MA 1VBB3 4A7YA 1SBFA 2CV6A 4W6XA 4ZXEA 4TN7A 1MS3A 3LPGA 4IEYA 4OHWA 4J25A 5DABA 2JD4A 1VAKA 2A1XA 5H9QA 3WDXA 3BOWA 4D6SA 3IPVA 3RWNA 2O0OA 3T4HB 2WNUC 3C7OA 4NIIA 3EO6A 3OSDA 5HCFA 1G9CA 2UU8A 1SQ4A 3U78A 1FMD3 1R092 2VZRA 2JKBA 3I4IA 4JQRA 2Q30A 1W9FA 1X36A 2VUCA 3FUQA 2VZUA 2Y6GA 4MH0E 4MZUA 5FZKA 5LBBA 4C91A 3HNMA 5KXEA 1S0DA 1XNCA 2DVFA 4DY5A 5A7QA 5K8SA 3NSTA 2YGMA 3ZFFA 4EWAA 2Q0AA 1Q5OA 2Q8OA 1U5IA 3OGJA 4IE0A 2VH9A 1D4M2 1KFUL 3LDRA 3HIFA 5EHDA 1Q8VA 5FAXA 2ERFA 1LODA 3LOIA 5LY1A 2WFPA 3K46A 3ORJA 1FPN1 4SBVA 4DUXA 5JIUA 4D69A 4AI0A 5FBZA 3UK9A 1FXZA 4B4QA 4AYUA 3I49A 1OC1A 1PGW1 2OUHA 3BN6A 4XCBA 3ZFGA 1TNFA 1CAXA 4GULA 3AP6A 2XL9A 5JZGB 4FI9A 4Y33A 5J37A 2RVAA 3IIAA 5FYHA 1OKQA 4OQ9A 1DCSA 1GP5A 5SV8A 1NT0A 1PM7A 1ST8A 3VZJA 4ZS2A 1ZRFA 3CEWA 3MBWA 1Q56A 2PHFA 4XTPA 2EICA 1HRV1 4Y20B 1NLSA 3M70A 3LIGA 3P1IA 3PVEA 5FZFA 1LU1A 4E8DA 2WZEA 5AVAA 1AX0A 5H9SA 4Q2FA 1OQ1A 1V9U1 2YBKA 4COVA 2QJVA 4IV3B 4XUTA 4ORFA 2VAUA 4JGYC 2GMMA 1M06G 1FT9A 3ZVXA 1US3A 3I97A 1F15A 4CDWC 4DEVA 1VALA 4N53B 2CYFA 2JIGA 4MG2A 4PQQA 1IPSA 1HB3A 2OW4A 1JH5A 2AEYA 2D3SA 4MUVA 1QOTA 1QKQA 1JZ2A 1W05A 2HWE1 1RMU1 5EIYB 1AR73 4CCKA 3SKJE 3E6DA 1CZSA 2LM3A 4YPJA 5HCBA 2W39A 3MLKA 3HR9A 2XKPA 3BVCA 4N7UA 2YC0A 5FY4A 1SBDA 3R0RA 4CCOA 3O1VA 1UYZA 4MGYE 3J7HA 5F3IA 1C8M1 4WBBA 2XBO2 1XU1A 4QXCA 2BUKA 1PX3A 4XW3A 1W06A 4AVSA 1REFA 5A3PA 2P34A 1ZM1A 1LJ7A 4RR3C 1MQTB 1PMJX 4IE7A 2CU5A 5A7OA 3WG1A 1JOPA 1JU4A 1HQWA 2FDFA 5HI0A 4FTSA 3SQOA 3T0DA 2VG9A 5C8WA 3RYPA 3H0OA 4HKOA 4M3CF 3ZXFA 5AC91 1W6NA 2BBVA 3D5OA 3V0BB 3I2JA 1TQ5A 2R32A 1ULFA 4JRAA 1UY2A 1YXWA 4CP1A 1TVGA 2Z5WA 1LU2A 4E8CA 4HG6B 4CP9A 3OTFA 4WM8A 5GM0A 5C7GA 5CKNA 4PBPA 4AFDA 4HKLA 4FQ4A 1RUJ2 1VR3A 1RUE3 1PO11 2BNNA 4N43C 3CJIC 3RZMA 2OYZA 3ZDVA 3PLQA 3MLLA 2R072 2WQ4A 4QB2A 2HWC3 1PVC3 3PVOA 3K4ZA 3PUAA 1HDKA 4GH4B 2X5IB 1C5IA 1UZZA 3PHMA 5D21A 2XLFA 1OMIA 4AVAA 2ORXA 1AX1A 1DIWA 2NMNA 4IE6A 4QX0A 4EN7B 3PL0A 2A6WA 1F31A 5FUPA 5IVBA 2R043 3ZPYA 1RC6A 3BTXA 1OVSA 3HQXA 1STMA 3I3QA 4XAEA 3ZFFC 4W4ZA 4AHWA 1EV12 5C71A 4OCTA 3RZZA 2HWB2 2Y6JA 3O7OA 5A3OA 4GB33 4CXWA 1DQ4A 1F5FA 1XNKA 5J98B 5LRRA 1GICA 2WQ8A 2JJ6A 2EIBA 3WDUA 4G3YC 1H8VA 2D93A 3VDDA 2WO7A 1BMV2 4S2FA 1F8VA 1O3SA 4HZFA 4MGZE 2VO5A 1GZ9A 1UU5A 5GLTA 4Q8LA 1IHMA 1H2LA 1BHGA 3RZHA 5HCAA 2C26A 2ETEA 2R0HA 4E2GA 1K5MB 5L7OA 3MZHA 2WNEA 1ZRCA 4W65A 2BYVE 3LSDA 2IWGB 3H8RA 3AKRA 3RVHA 2ZJCA 1BXHA 5FPAA 3TN92 4XEZA 4QT6A 1JZ7A 1UWWA 1TG7A 2VOKA 2MHFA 2WAOA 4ZZ5A 4LBJA 2VULA 1B35B 1ULCA 1MVEA 3VBSB 2VQUA 4QX1A 1W6OB 2Y0OA 4Y4YA 4QGNA 1AYM2 1O4TA 2XJVA 3GCWA 3NV4A 4CDXB 4DUWA 2QQJA 4AGRA 5A6YA 1C5HA 5T52A 1HV1A 4XOGA 2VR4A 4AHZA 3I3EA 3IIIA 3SEPA 2O8OA 3OBZA 2O14A 3VDCA 2WKKA 3RYKA 3VD4A 2XLGA 3NQHA 2WDBA 1W2OA 1AJKA 1AXZA 1YFWA 4UFHA 2A3WA 3BOPA 5T5PA 3ZXLA 5ABJA 2R063 1KQRA 1O8PA 2NLRA 2OT7A 4XF4A 3R6SA 3NNJA 2WT2A 1CGPA 3VBRA 4ZU7A 1RUC1 1QJU3 4YM2A 2BWCA 3K3NA 4PLNA 3J9SA 1RUD3 2Z4FA 4LA3A 3J7MA 2HWF2 2AENA 5A32A 3T3YA 3EBRA 1MR5A 3UGFA 1A34A 3B7MA 3ZLIA 4XILA 3SCHA 4QPYA 4TLFA 3U11A 4XJUA 1HRI2 1RHI3 1TEIA 1DGWA 1UXXX 2DV9A 1YQCA 1MQTC 1PNGA 1W8NA 2UYAA 4XQ4A 1TMF2 2G9GA 2WJSA 4LO7A 1H30A 2OVUA 2RV9A 1H8TC 2YG0A 2JB8A 3N9PA 2QQOA 4HXCA 4WM8C 5JMOA 1GNZA 3FMGA 2FDIA 3A23A 1GQHA 4F8AA 2RS12 4MV2A 3GF6A 3V0AA 2E9QA 3MFCA 5DDJ3 4OI1A 1NA1C 1NE6A 3GJBA 4LK6A 1TME3 3IB3A 3VBHB 2MEV3 4B29A 3WXPA 4IXLA 4GIQA 4FVVA 1Z7S1 5A1FA 1UF2C 3ZYIB 2EXKA 1CIYA 2UYBA 3ZN6A 1W03A 3T08A 4KGQA 3M3EA 4H7LA 1IQAA 2W92A 3IDBB 1W9YA 1W9WA 3DEMA 3ACFA 4YW1A 3KF3A 4MYEA 5BNNA 2WA3A 3BODA 4XCAA 3WW1A 1N3OA 1QJY3 3LF7A 4C90A 4L99A 3LWCA 4AE2A 3MW2A 4MGKE 3UL2A 2P1BA 3GCXA 3VKMA 4BQ2A 4W50A 3CLPA 2X29A 4QX2A 1WCKA 5JR2A 2C1FA 1XSQA 1AL22 1ZZCA 2JX9A 3JU9A 3UKTA 1RUH3 3DCQA 4AHXA 4BPZA 5GLUA 4YYOA 2BEOA 1G9DA 4CDQB 1NX9A 1IQDC 1X50A 1RVF3 4XJAA 5BXXA 3I2HA 1OPOA 2VOWA 4HETA 1QJX1 1FV3A 3R4DB 4JGZA 1DQ6A 4K20A 4KL1A 2ZBJA 1NCRB 3I59A 1LB2A 4LIUA 1C1LA 1JOJA 2RM23 3HPNA 1O3TA 4HK9A 2J1SA 2W52A 5DZFA 5EWSA 4ASKA 1PMIA 1OLMA 4NHKA 1LR5A 1CESA 1ZA4A 2YBSA 1KD7A 1REDA 3O0VA 5TSWA 1F4AA 1O5LA 1PIV1 3GZTB 5JXHA 2VCMA 4GMP0 4QU1A 5FR3A 2C0ZA 4A7ZA 1C28A 2VNGA 2W68A 1G8WA 4L2NA 4PBOA 5FPZA 5GJ6A 5LEKA 3R4SA 1FAYA 1QDCA 2BQPA 4QGLA 1AX2A 1RYYA 1K12A 4NRMA 1KRIA 4UWDA 4GWNA 1S0FA 4IEQA 3JD71 1B35C 3CNAA 4Z1VA 1LGCA 1XNTA 4CEYB 1YJLA 3DPRA 4YGDA 4HOOA 1S2EA 3IDAA 3O14A 5E89A 5GALA 3RNSA 2WBKA 4AF9A 2VQAA 4Z2WA 3AZYA 2JENA 3IDEA 4XHBA 2QZ3A 4YRDA 1J1LA 1VBE3 1LHNA 1X7NA 2AEZA 1YQ8A 2OPKA 3OGVA 3T2QA 1KS4A 4PQ9A 1FPN2 3WNOA 1DQ1A 3OEAA 4Y3OA 2KM2A 3WP6A 4QMAA 3VBFC 5C5TA 1G86A 1PGW2 5BUVA 5KXCA 1VBC1 1PGSA 1OOPC 3ON7A 3POEA 2DCTA 2HEWF 4YW7A 3VN4A 1E5SA 1KDKA 2QQKA 1UX7A 3U07A 2ZX2A 2YU1A 2WC2A 2D6OX 3LKJA 4BYYA 5J09A 3J4UH 4CEWB 1ZZ9A 3ACGA 4QWNA 1POV1 2H6BA 3L9JT 4P9JA 1CX1A 5FREA 2VZTA 4V2VA 4IV1A 2QQNA 4KQ7A 4HPKA 2QZ2A 2RJ2A 2ZABA 4FPCA 3O1TA 1NCQC 2VZ3A 1BVP1 2W46A 4LHNA 3C7GA 4S2GA 2FD8A 5KC6A 1E5HA 1R1A3 1WBLA 5FY8A 4QB6A 2Q1MA 4GXLA 3MW3A 3C7EA 3AZWA 2CWMA 5BNNC 4MXWB 1GWMA 2HWE2 1RMU2 2ZMLA 4RA0A 5FZOA 4UOJA 4AI1A 2J1VA 4QX8A 5KHHA 1CAUB 4LT5A 1VMHA 4JV4A 4OHZA 4BDVB 4NPMA 1KEXA 2FHRA 4HT1T 2XOMA 2AR6A 1C8M2 2ZGPA 3OD0A 3I2FA 5CKMA 2YXSA 5FZCA 2FDKA 3OUJA 1VMFA 1PX4A 5DUWA 1W0NA 3VKLA 4FSJA 3N7JA 1QXPA 5IVCA 2PHUA 1OH4A 5JIAA 1IS5A 1SZBA 1SPPB 5T54A 1LOBA 2JDNA 2FBEA 5AC92 4IGQA 2A3YA 3VBOA 4JGZC 1D4M1 5FMBA 4EJRA 4CDQC 1NQJA 2KD7A 1BYHA 2ZAHA 4R4XA 5J1XA 2ZGUA 3D6EA 4AI8A 4QB1A 3KHCA 1MEC3 4KBBA 5FDBA 2XPJA 2VVFA 3TBDA 1ZNPA 2PQSA 2ARCA 1FOD3 2EAKA 3VD3A 5JLVA 3J8F3 4P9XA 5F3EA 1UKGA 1GR3A 3U10A 1AXYA 1QJFA 1GKBA 3BYWA 4DXRA 3W5NA 4BQYA 3UJQA 5BNPC 4Q4V3 5FYSA 5K0UB 5KWRA 5F2WA 5GLZA 2CGOA 3AKPA 5JOZA 3ME2A 1I3HA 1AL0G 1ASJ1 2VM9A 2W5FA 2WAAA 3BPSA 4CYDA 1AZDA 3KS7A 1HB1A 2AZ5A 2ADDA 3VZLA 2P17A 4KNCA 3PUQA 5E8AA 2GC3A 5LASA 4FFHA 2HEVF 4CDUC 5BNOC 2ZMKA 2JG8A 4AHYA 4Q1PA 3VZOA 5GLVA 1JZ3A 4JAAA 4I3GA 4N9IA 4QKFA 1QGLA 4O7XA 4X8PA 3G6JB 2VUJA 3NMBA 4QAWA 4WV8A 1JTZX 1D0HA 5KHJA 5LZ6A 4FO9A 4LUKA 1IS6A 2QQIA 1KGYA 1OUXA 1SDWA 2XONA 1OQEA 4K3UA 3ZXJA 2A3XA 4QPGC 2OA2A 5DUVA 2PAKA 1LTEA 2BFUS 3GZUC 1IG0A 1MS8A 2ILMA 1G9FA 4M3CB 3VBUA 1GZCA 4DXSA 3ALQA 1GOHA 4AQSA 1HN1A 3I7DA 2ZHLA 4WM7A 2ZKLA 4BIFA 1H2NA 2VE1A 4EV0A 3S7EA 3O5SA 4LULA 4M3CE 5FYIA 2WA4A 1JU3A 1GOGA 2YMZA 1URXA 2VNVA 5T5LA 4PHZA 4X8NA 1NG0A 3A22A 2GN7A 1GQPA 1ENSA 1YI9A 3H1MA 4L11A 4ZY9A 4D7TA 5L19A 1S2KA 3B69A 3POWA 3ZSMA 2HBTA 3THTA 2VNRA 5C8CB 3EHKA 4K1YA 2BNMA 3KQ4B 4PIZA 4CEWC 3GBGA 4HONA 2YGLA 4QM8A 3I54A 4J1XA 4JCKA 1W90A 1SBEA 2K46A 3A0KA 2PHWA 2WT0A 1RUG1 2Y34A 5IFPA 1AJOA 1EYBA 3VDBA 1L7RA 1FI2A 3W5MA 1J59A 1QMJA 1T2XA 5BPXA 3VL8A 3D3AA 5FZ0A 3UV9A 4FTEA 1XU2A 4XZPA 2VUDA 2G9FA 1PMHX 3RZJA 1OF4A 1X33A 1EAH1 3KLSA 5KHKA 1RUC2 3GBWA 3OD4A 5ERLA 3N4MA 1O91A 2RJLA 5EYYA 2BOIA 4MGTA 1ND2C 2W2IA 4UI9L 1E5RA 4Y1XA 4CCJA 3UGGA 4UFIA 1SACA 4QPIB 2JECA 3H50A 4LBNA 5C4WB 3OPZA 1H4GA 3RDIA 1COV3 4D7YA 1LHVA 4LJHA 1GZWB 4ZU5A 3VDAA 5FZ4A 4BQ1A 5GZGA 1NZCA 2P37A 4AVBA 1DYKA 2K2SA 4PLOA 4Q4X3 1AR93 1LOAA 1HV0A 2PTMA 2IXKA 3WG3A 3WNMA 2GH2A 2ZHKA 5CFDA 5ANQA 4PCRA 2XR4A 1UYPA 1Z7S2 4YW2A 5FY9A 1WA4A 4QHOA 4AK3A 1FMD1 4Y1YA 1VRH3 2KA3A 2WFF1 3POGA 3WF3A 4DZGA 3AP7A 3HWJA 1RGSA 4UAPA 5F6KA 3FZ3A 4ONUA 2DYCA 2VVDA 4F83A 4YVWB 5BYNA 1LNSA 2J1RA 2WNUA 4NHLA 1AF9A 5EZWA 1EPWA 2JDKA 4LR4A 3JBG3 5F2SA 5FMOS 3E5XA 2ZGMA 4I0WB 1QEXA 4RS5B 3H8OA 1C57A 5FV3A 5LWBA 3GNEA 3VBFA 2YY1A 3FX3A 4LHKA 1OI6A 4GKXA 3NRUA 4NHYA 4UF0A 4BHPA 4RD7A 2RR13 5JUVA 4HVQA 4HBNA 2QDRA 4BJ0A 5JR7B 1QJX2 1RTVA 4ISQA 1SG3A 3SISA 5HV0A 1HX6A 4E4HA 1YC61 5JI9A 1JYXA 2VQTA 3AJZA 3MFAA 2QFEA 4HVOA 2DBNA 4WVMA 3WUCA 5KR7A 2BU9A 1AR83 1GANA 1MS0A 1AUYA 2BP6A 3ITQA 3PURA 2HWF1 1YO8A 5CU1A 2ES3A 4HMZA 1PIV2 2D6NA 1YQ6A 1QJEA 4Q27A 5FMCA 3WP5A 2LTNA 2VZ1A 5A7WA 5M0TA 4XBNA 1I1EA 4KWUA 1ZBE3 2X09A 3E6CC 3NL1A 4XJWA 1SLTA 2PXJA 5FZAA 2RS33 1TMF1 1HXS3 4UFLA 3TB0A 3QCWA 1W0PA 4XF9A 2W1SA 1QQP2 4I02A 4LK7A 3ROUA 4XURA 3ZKUA 4ASLA 4B1MA 5C8CC 4G4FA 1AR63 3I2KA 5IT6A 3Q8AA 4JGYA 4CU8A 1JMUB 4NAMA 3M4FA 1QDOA 2YFZA 2Q8CA 2RG4A 4CDWA 1BBT3 3B9IA 5C3QA 2WZR1 2H0BA 1H6YA 5I0TA 1PO23 1LULA 2NN8A 2Y6KA 1X8EA 3C7FA 4D3WA 3M3CA 4FFGA 2ZX1A 4KWJA 3VUOA 4YW6A 1UY0A 4PDWB 3FWEA 5LATA 1VBC2 5FP7A 5LBEA 4Z2AA 2Y26A 4WVZA 2JKXA 1DZTA 3ZXAC 2XDVA 4Y1ZA 5H9PA 3WP4A 1KFXL 4OFGA 4Z92B 3KMHA 2WNVC 2NMOA 1R1ZA 2DU1A 4MGIE 1AL21 1RUF2 4PIXA 3O1SA 4P02B 5C9AB 3NAPC 3T2PA 4QPIC 2K9ZA 5EP9A 2V4VA 2HJIA 1RUE1 1UIKA 1W04A 3AXDA 2UWAA 4A3XA 4WZFA 1Q8OA 4BLIA 4FAHA 5GZCA 4LBKA 3K77A 4MXVA 4OZOA 4LORA 2FCVA 2ZEXA 4EN8B 2HWC1 2QBXA 1PVC1 4LO8A 5F32A 1IS4A 1W6PB 3IN9A 2R0FA 3M1HA 4YGBA 2E31A 1JYNA 1RUJ3 4EWEA 1UOFA 2P3IA 5JAXA 5EFUA 4YSFA 1RUNA 2CAUA 3W58A 1WMEA 2R073 3LSEA 2YC2A 3I2IA 5AFBA 4EROA 1R082 2BZDA 4LXLA 2PHTA 1M4WA 4M0HA 2D44A 4N43A 4DY3A 4JHZA 2QQWA 1ZZ6A 3CJIA 3O1UA 1HW5A 1CIWA 4AI3A 4GKYA 3N9OA 1MZEA 3USUA 3WD5A 2FCTA 2B4KA 2P3KA 3PUIA 5FO8B 2VBDA 5CG9A 2JDPA 4MSVA 3KCYA 4YG3A 1IS3A 1UAIA 4MGQA 3M3QA 4Q4W3 1WMXA 4R4ZA 3USSA 1GBGA 3TEZA 5IAVA 4XAAA 4FPGA 2CTVA 1EV13 3ZIWA 3KV9A 3CU7A 2XJQA 1QOOA 2HWB3 2NQYA 4KG8A 5A1LA 3IPVB 1W6QB 2CSGA 3V56A 4Z8BA 2YDEA 4MGSA 4LEJA 3WNNA 4ZHNA 3ZIXA 3FE5A 2F6BA 4AQ2A 1G9BA 1K42A 2ZS6B 3ZMOA 3LD8A 3OJBA 5BNOB 3O1RA 4D6QA 5DQ0A 2XQRA 3WG2A 1S0GA 1QH7A 3RYRA 4KWKA 2Y6LA 3B00A 3GBFA 2Q4SA 1VAVA 1PK6C 4KH9A 4E4ZA 5LRSA 2BGPA 4UW4A 3ZXGA 3MV11 1D7PM 4UW3A 5DG2A 4K6BA 4YZ2A 3POYA 3LAGA 2RMU1 1V0AA 4AAXA 2IVJA 1QNYA 4LUMA 4WZCA 2ET7A 2HWD3 4RGKA 1ASJ2 4MOAA 1E5IA 5A33A 1CAWA 4Y26A 1ZZ7A 4Z07A 3OGSA 3ZFGB 4NRPA 1Q8SA 3OPTA 1CAXB 4INDA 4OI2A 3SH3A 4LE4A 3KVAA 2PQQA 1IPKA 3AVSA 2JE9A 4HK8A 4NIAA 1BEV1 2CDOA 1WW4A 1ULPA 2V09A 1YFUA 2JXAA 1YIFA 4YVSC 3PU3A 4Y5Z0 5C3OA 5D8AC 5DG1A 3V65A 2WS93 4HLTA 1QJU1 4XFCA 3G7DA 1W8ZA 1W2NA 1DP0A 2DFCA 4XFHA 1RUD1 4B8EA 1UL9A 1H1IA 3PJYA 3ST7A 3NJVA 1MPXA 1JUIA 4GALA 3A21A 4N53A 3LA7A 3WQ1A 3LEIA 5JSRA 1SFNA 3QD6A 1BK1A 2CGNA 4FPYA 4ITCA 3DV8A 4XUPA 3NKTA 4H2AA 1KS5A 3NV1A 2DCJA 3ELNA 4XTMA 5DAWA 4COWA 3FFZA 3KF5A 4COUA 4ZU4A 2VW0A 4RQPC 1QY4A 3O0XA 4AEKA 1O4ZA 5I0DA 2FDHA 1CN1A 1NQDA 4IEPA 4FPLA 1R64A 4Y1VA 5I8TA 3ZDSA 3RWKX 3AP5A 2PLV3 2OQ7A 5IVEA 4ZXKA 1ODMA 4AEDA 2QUOA 2WUHA 2RS13 1MQTA 1LHOA 3AKTA 3NKGA 4AG4A 2ZX3A 4CU7A 5FXZA 3ZFEC 3OOXA 1AYN1 1H8TA 4OUMA 4OHXA 4XPVA 5E88A 4LO6B 4IESA 1H1MA 1RUG2 2ZX4A 3UESA 5AFEA 4IW3A 1IKQA 4NOTA 4RHV3 5DMYA 3V0BA 4CSWA 4EE2A 2OPWA 3MIGA 4AEMA 2ATFA 2XJUA 1NA1A 4V1PA 3CZUA 2OKXA 1W6NB 2QNKA 2VECA 4QX3A 4CE8A 4AR2A 2VTXA 4EQVA 3OBTA 3PU8A 4A7KA 1EAH2 2Y64A 2V73A 4BK4A 3JB8A 2WN2A 1K45A 5CIRA 3AP9A 2ZCWA 5IVVA 1Y4WA 3MO4A 4FXKB 1XYPA 1XC6A 3GXUA 2EIGA 3OGRA 2OZJA 3KWVA 4GH4A 4Q4Y3 1CZTA 1Y9QA 4NUBA 2RM21 4N9HA 1DYPA 3QH6A 4RFT0 1Q8QA 3FHAA 4YG0A 1RJ7A 3VL9A 1VBB2 1I5ZA 1ONAA 4JHTA 4MO3M 1V6KA 5A7NA 3KQRA 4M4PA 1OUSA 2BPA2 5IATA 2VUAA 1V6MA 1JW6A 4YZ5A 4Q5OA 1HIXA 4EN9B 1QOSA 1A78A 5JOYA 2BGOA 3QH7A 4BQWA 3J7NA 4NPLA 3AYCA 4OUSA 3DUIA 1FMD2 5HV4A 4CCCA 5FY7A 2WFF2 3KD4A 3VDDB 4YFWA 5JZGC 2ZGTA 4H7MA 3V64A 3TNQA 3POJA 1QH6A 2VNOA 4LLFA 2R1BA 3I3DA 2YV8A 3A0NA 1K5MA 4Y4RA 2W91A 5D1IA 4O9GA 4KGGA 3NJZA 5L7OB 5DUXA 1Y9GA 2ZGLA 3TYJA 4A42A 4NIDA 4CXYA 3BU7A 3PNAA 3OCPA 4FXGB 1B35A 3JUUA 4YZ1A 1OHFA 1FX5A 3AL5A 4IV3C 5BNQA 5FYCA 5FUIA 2AUYA 4P9YA 1FPN3 5F37A 1S0IA 1L7QA 4N53C 2Y6HA 4S2DA 5F5AA 3VB9A 5F7UA 3LDKA 2R16A 1RL3A 1O3QA 3OUHA 1YQ5A 5A6XA 2A6ZA 4FCAA 5FZMA 3AKQA 3N7LA 3RG0A 1UU6A 4YWAA 5KXBA 2GP3A 2B5HA 3NO8A 1LOCA 4DXZA 3H3LA 2DFBA 4QQHA 4DUVA 1OOPA 2XLAA 3D4KA 5ABJB 2A5ZA 5FYBA 5JPNB 1HQNA 3CHXA 4DPNA 2Q8DA 1HRV3 4FP3A 3VGIA 1XNAA 2WSVA 2V72A 2LUWA 5EJZB 2VMHA 3VBRB 4IGOA 2DU0A 2XVGA 3DYPA 2QE3A 3RMXA 1CQ9A 4AEDC 1V9U3 3HJRA 2WABA 3HT1A 1YQ2A 3ES4A 3AC0A 5C3RA 1BJQA 4Q1RA 1LAJA 2EXIA 5A32B 3B3QE 3WSOA 1XBFA 1AR72 2VY0A 1UIJA 1S0JA 3FLTA 3OBRA 2X8KA 2RJKA 5HPOA 1UOGA 2A6VA 5C3PA 2XGXA 1NCQA 4GA9A 4R9AA 3P3NA 3VV1A 5ACA1 2CHHA 5C33A 1YJKA 1UO9A 3LZZA 3PIJA 4CUGA 2WZR2 3O12A 2ZX0A 3OYWA 1LOFC 2K0GA 4NE9A 4I09A 1WBFA 3KM5A 3M2MA 1S55A 2XH6A 2ZOEB 4ZS3A 3WF4A 3V0AB 4LBQB 1XYNA 3AMPA 3INAA 5DZGA 1C8M3 3JCIA 5BV6A 3T0BA 5FO9B 3S57A 4GH4C 2VBBA 2JB4A 3CO2A 1CX4A 2X5IC 2NYYA 1VLNA 2XVKA 4META 4XMAA 4OQ8A 4IERA 3VZKA 1ZBA3 1RJ8A 1WMDA 2RE9A 2Y0IA 1C3HA 1RUE2 3C2UA 4COYA 4GWMA 2RDQA 2PN5A 4Q4V1 1NYWA 1WW6A 2D6MA 2HWC2 1PVC2 4X6RB 4XFBA 3DKQA 1OQDA 3H3UA 5FP4A 3WNPA 1ZREA 4LOSA 5T55A 3KCXA 4CDQA 1PO13 2W1UA 1V6LA 1QJZA 1F2NA 1OFSA 4FFFA 3RZGA 1N47A 1EP0A 5LK5A 3ZYHA 2GZWA 5T5OA 1JHNA 3BUCA 3KV5A 1OT5A 4NHMA 1O8SA 2R49A 4BISA 3MF9A 3W21A 2W47A 5BNPA 1WLTA 1WCDJ 1D4VB 2BWAA 1K5MC 1ND3B 3I59B 3A4UA 4JKLA 3VD9A 4JQTA 3WF2A 4HSJA 3VLBB 2BVVA 1OLQA 4CUCA 2YPDA 5J96B 1CAVA 5B4XA 3WQ7A 1JYCA 2CY6A 2E6VA 2O1QA 2RDNA 4YW3A 3IBMA 3HNBM 5FZLA 3ZXDA 3FLRA 4TLGA 1IPJA 2HKXA 1CVNA 1MS9A 1QQP1 1OVPA 1LKNA 2XKOA 1VBA3 3VBSC 4CDUA 5BNOA 5I8YA 2ZACA 4UW6A 1EUUA 4ATEA 2B46X 4CDXC 1O3RA 3LCPA 3K3OA 4PI2A 5FIXA 4FPJA 2AGSA 5JSPA 2DCKA 3M7AA 1PNFA 2BDRA 1U5ZA 2OXBA 4C0HA 3F2ZA 3BKZA 4OVEA 2UWBA 2D97A 1POV0 3DPRB 3ZSEA 4CXXA 2BOJA 4QPGA 2FMYA 3ZPOA 5FZIA 3DL3A 5I0UA 1W9TA 1DDLA 4G9SB 1IKPA 2EVXA 5FK8A 1ULDA 4HVRA 3WQBA 4Z82A 2RMU2 4BXFA 1Y3TA 1N3PA 4JTOA 5FJHA 3EMRA 2H6CA 1BK0A 4JKKA 4NMIA 3U1XA 1RUF1 1UY3A 3PUSA 1QWRA 3K75B 1W8WA 2BV4A 4GMP1 4YNIA 2ZGNA 1V70A 4I30A 5J36A 3H7JA 2WRAA 1OXCA 3ETPA 1BKZA 3IKWA 3P6BA 2J1EA 2IUWA 3PMSA 3GDBA 5GZDA 1BEV2 3CL1A 3NNFA 4NO4A 5E16A 4BZ4A 5FXXA 5CADA 2VQ0A 2W3JA 4CEWA 4NWVA 2N7GA 4M4RA 3T4VA 1ZRRA 1GLHA 1XYOA 3FL7A 1QJU2 1WD3A 3D8CA 1RB8G 3DXUA 2DCZA 4K8FA 2QTWB 1RUD2 3B93A 4A2UA 1DF0A 4IV1B 4CUAA 1R081 1W6MB 2XMLA 2Z2SB 2QDNA 3PDQA 3QOPA 4RGGA 3VBHC 4LQRA 1V6OA 1BVVA 1RUC3 1GSLA 2P3YA 1RUI1 1VBD3 2JIJA 1C8NA 1DLCA 1UOBA 4FOWA 2XXZA 4KMQA 3K4DA 2L9LA 1XE7A 3U37A 5LEJA 4X6QB 5A3WA 4BM8A 1RHI2 3NW4A 4TZDA 2CL2A 1X9TA 4C0BA 3H3ZA 4OUEA 5FOBB 1ND2A 5L9RA 5FZOB 2RHPA 3WV6A 4AEDB 2XJRA 5FPLA 1P8JA 4IQPA 4LPLA 1ULEA 2YHJA 2WYFA 3LB9A 1XSRA 5FZ9A 2MEV2 2JE8A 3DYMA 1AHSA 4P08A 3RSJA 2B9UA 4QDQA 1LHWA 1UKRA 3LDBA 4URTA 2I07B 1NUKA 1W8UA 1YFXA 2RS53 3PIGA 4A41A 4EZHA 2DVDA 3PUHA 4FP2A 4FPHA 2FQPA 3MIDA 1AYN2 4P9GA 5FYZA 3GHMA 4AI2A 3KT1A 5L9VA 3WOGA 1PHMA 2DUOA 1XQNA 4JRLA 2VMFA 4NHXA 1PZ7A 5FP8A 1NCRC 1RXGA 4XF1A 4XXPA 3S30A 3KV6A 2D40A 1WCSA 1YYNA 1S2BA 4JDMA 1W2TA 3JBG1 4XFFA 3HBZA 4B7KA 5CZKA 3RZLA 3CF6E 4A6SA 2JG9B 1VRBA 3R4UA 5A7PA 5L9BA 1BCXA 2VGDA 3KCCA 4YGEA 1XNDA 1KJRA 4QHBA 1K5JA 1H2KA 3RS6A 1UXZA 3H8XA 3GM8A 5FWJA 5LA2A 1YFYA 2RM22 3MUZ1 3W20A 4B4PA 5KC5A 4XE9A 4BXSV 1QJX3 4CEYC 4QDSA 2EALA 2XHKA 1AR81 1V6IA 1W39A 3VKOA 3K4AA 5HXMA 1F5JA 4AEJA 1EY2A 2I45A 4IETA 4XMIA 3QACA 2VCAA 1ENXA 3KGZA 1BQPA 4OYUA 3WDWA 4AGGA 4XBQA 2F4LA 3UNPA 3CJXA 2DF7A 4I01A 4R9DA 3EYPA 4AVVA 1DU3D 4Y1UA 4DMIA 5H9RA 1XOYA 3ZYBA 1E57A 1ZYBA 5DPNA 3E5QA 3WNKA 2RS31 4AQTA 1OA2A 4MADA 3B01A 4M3CA 3ZKYA 3PVNA 3WNLA 3RZKA 2FZ2A 2WINB 2C9AA 4QM9A 1GU3A 4YZ4A 1AR61 2IVIB 5C6CA 4V2WA 2VZVA 3DGTA 1VBE2 3JD73 4WM7B 1UZWA 5EXOA 2YU2A 4QX5A 2A73B 2Q1ZB 2ZPXA 1BBT1 1DHKB 1X82A 3CMGA 4BA6A 1PO21 1W0OA 4K8RB 3ACLA 2XVLA 4M00A 4SLIA 4XHXA 1HLCA 4O9EA 4CCLA 1ENRA 2QCSB 4MVTA 3ZO0B 1JN2P 2EA7A 3B9CA 4TSVA 3WINE 4E2QA 5C8CA 4XYXA 1YEWA 1JZ5A 4DIQA 2VXRA 4LKSA 4I0AA 4Y22B 2JICA 4GWJA 1DGWX 1S4CA 5EQUA 2W95A 1J83A 4BQ5A 3VD7A 4ES9A 4QHZA 1JS9A 5FYUA 1A3KA 4NWWA 3EB7A 1XNBA 1GNYA 3OPWA 5LA0A 1PGL1 3E6BA 4Q0PA 2ZXQA 3ZYRA 1RXFA 5JXIA 2WN3A 4TYSA 1YIPA 2XJPA 4LKDA 4QQOA 3HMYA 4AZZA 5BY5A 2FCUA 5FY1A 3VZNA 2D3PA 1POV3 1RINA 2WNVA 3BCWA 5K4LA 1WLDA 3HN3A 4GJYA 1FNYA 2NM1A 1UPSA 2WIIB 5DN2A 3NAPA 2GNDA 1VBB1 2UURA 1SLIA 4QPIA 1DGRN 5KBFA 2OIIA 4HN0A 3GALA 3DKWA 3K2OA 3ZXEA 4A3ZA 3POFA 5A80A 3LOBA 2B45X 4D8MA 3AK0A 1SLAA 3HN1A 4DRRA 5DAXA 5E1RA 2ID4A 2D6LX 2ZKNA 3AJYA 4CCEA 2YB7A 5LBFA 5ACA2 2B7YA 5CFCB 3U0ZA 1LOGA 1Z0HA 2EAAA 1JHJA 3WLUA 2B39A 1NY71 5IK8A 2DDUA 3AP4A 1JYWA 4M01A 2R7EB 2RDRA 5F5CA 2XJTA 4AI9A 1UQXA 4QKDA 4BB3A 4UFMA 5FK7A 5K0UC 3BTYA 1Y7BA 1XPWA 2GC1A 3BGAA 2A71A 2JDYA 4LKEA 3GGLA 4FAGA 2VU9A 2UWCA 5CFDB 1R093 4RGAA 3DN7A 2JG9C 5ANNA 3KT4A 3ES1A 3MV01 4IEXA 4P14A 1MEC2 1CWPA 3AFGA 2ZEYA 4CP2A 3AMQA 4LIVA 3S5QA 4NAOA 1VAMA 1D4M3 4CU6A 1N3QA 1UW8A 1LHUA 5I91A 2WNUB 5FQ0B 1SHWB 4Q4V2 1W2AX 3WZ1A 2VZPA 3HOBA 4QDRA 1W3VA 5FUNA 3J26N 3H1WA 4CUBA 1S0BA 5KHGA 4XQWA 2A6XA 3D0JA 2WO1A 3VBFB 4ATFA 2OUJA 1N1TA 5JPMB 5FYMA 4UF0B 1PK6A 5CVRA 2PYTA 3WQ0A 5CA6A 2ORZA 4GWIA 3AYEA 2ZGRA 3AX4A 3ZSJA 2W87A 1MZFA 3RQ0A 3BI3A 1NLRA 1A6CA 1VB2A 3WHUA 2VD7A 1GP4A 5I8SA 2GC0A 4CPBD 1V6JA 2WS91 3M3OA 4WVMB 1SLBA 3DF0A 3WUDA 4GQ7A 2KR2A 5FXVA 2E7AA 5A1AA 1ZZ8A 2XWBB 1SLLA 3EQEA 3HBKA 3P5BA 4JVAA 4YW4A 1W2UA 2XQXA 5FKCA 5B2GB 1AR71 4PF5A 5HXVA 1SFYA 2ENRA 4CZSA 5A7WB 2DBIA 1G6NA 4NJ4A 4NVPA 4YVSA 3RGBA 3P3PA 5KXDA 3HD8B 5D8AA 2CDPA 2D5FA 4HANA 3UJOA 1POQA 3E97A 3FBMA 4XF3A 1J84A 5FPVA 1J3QA 4DOUA 2Z42A 3AKSA 1A8MA 5FRAA 3OY8A 5FZBA 4CA9A 2YPJA 1UY4A 4JGYB 3DECA 2XBO3 5F5IA 1OPMA 2CWSA 3SMHA 4MHRA 4TXWA 4CDWB 1LOEA 4Y5TA 3KB5A 4AFAA 4F7ZA 4QQ2A 2W08A 1ZRIA 3N9NA 3AVRA 3S5AA 2DVAA 1S0CA 1NXMA 2E26A 4OMDA 4RQPA 4K21A 1FATA 2GC2A 4RHV1 4BH9A 1W3XA 2FZ1A 5C4WC 3NJYA 5E6HA 3TRSB 2RDSA 4UFKA 2EIEA 2F4PA 1C1FA 2R30A 1GWKA 1RUG3 1XB9A 2LALA 4FTBA 4XXAA 4ARYA 4BQ3A 3A7QA 3NNGA 4FPEA 1QNWA 3ZFEA 2A75A 4RR3B 2B9VA 4IE5A 1MS1A 2V4AA 3WW4A 1JOBA 3IZOA 4IGPA 3U14A 5IK7A 1H4HA 2R041 2XL7A 3VKNA 5F39A 2YUEA 4CTEA 1RUI2 1CPNA 4Q4Y1 4DEQA 1NZIA 2WWUA 3THCA 1COV2 3GYDA 2ZMNA 3M8LA 1HJFA 2JDMA 3PTYA 4GB31 2EXHA 2XJSA 4QQPA 3D0SA 4IL7A 3WP3A 4LO5B 1D2QA 1YUDA 4N43B 4JC1A 3OGGA 4FPFA 4CCMA 1LRHA 3CJIB 3S7IA 4YVWC 4W8JA 2XWJB 5DAPA 5FP3A 2YFUA 2QVSB 4A4AA 2IXLA 1FV2A 2IFWA 1FNZA 1GUIA 4RS5C 1XE8A 3N3HA 5SV5A 1ULGA 2Y33A 1JBCA 3MICA 2HBUA 3FHIB 2FDGA 1SDDB 2WT1A 3T1MA 1TE1B 2PHXA 4AGVA 1VRH2 2QQPA 1W6QA 4XBLA 2QKDA 2KXLA 3LPFA 4XUNA 3RJ2X 1F9KA 3FUOA 1G9AA 3ZFFB 5I0SA 1FYUA 2D7FA 1A8DA 4LO4B 4I3PA 2WFF3 4KWLA 5I0RA 1WUVA 3N9LA 4PF1A 4E4DX 3JBG2 4XETA 1JYIA 2G9ZA 2LS6A 3VD5A 3TN93 5T3NA 3MF6A 4MLOA 2BFUL 3SEEA 3B5LB 5IWFA 5JZGA 4BK5A 4XQDA 5F1RA 4GD4A 5IVFA 5FLHA 2RR12 3RI8A 3ZXKA 1AYM3 3ACIA 3B02A 2P4EA 5I93A 5FLIA 1GQGA 4Y5SA 1SFPA 2R061 2BBAA 1PZ9A 2DWRA 4N7IA 2J7MA 5A33B 4Y20A 1CAWB 5G05L 2A7AA 2WNOA 2NPIA 4LKFA 5K9YA 2BTVC 2O8QA 1DFQA 2VZSA 1AR82 1JI6A 4OHVA 3FLPA 1WA6X 5JI7A 5A3NA 5LA1A 2TNFA 3Q8BA 1DLLA 4IV3A 3ASIA 4GJZA 4WVWA 3NV2A 3IT8A 4L92A 4JDOA 3RFRA 4A6OA 2ZEZA 3WF1A 3RI9A 2TUNA 4K9SA 4KBZA 3LFIA 4NIHA 1WZXA 2ARBA 5IUQA 3H7YA 1ZBE2 3S0MA 2P6CA 1S1AA 2HWF3 1YNAA 2DUQA 2E32A 3HVDA 1RHI1 3N9MA 3ZN4A 4BWOA 4ZKTB 3CQOA 1XXNA 4R8HA 2XUEA 2RS32 3AZVA 3KV4A 1SCRA 4PDWC 2OX0A 1HXS2 3UKVA 3AL6A 5A7SA 3MI8A 5IW0A 4BIOA 2P5BA 3DYOA 4UFJA 3UGHA 2VMCA 1HRI3 2C24A 2AC1A 4QXKA 4NIGA 1IGOA 3BIWE 1AR62 3LE0A 2VL4A 1HB4A 5J3UA 5DDJ1 1TMF3 1MACA 1TME1 2MEV1 5FZEA 4ET7A 3U4SA 5C9AC 3O1PA 3WX5A 1BBT2 4GAZA 1J1TA 4FBFA 1PO22 1B09A 2Y60A 4CVUA 5FXWA 2VJXA 1H9WA 4LMFA 3SH4A 5C5UA 1QJY1 1UZVA 2WZR3 3CIHA 1MZ5A 4D6RA 4AL9A 1N1SA 1W99A 4YG6A 3AXEA 5FZ1A 2V5DA 2YROA 1GMMA 5FPBA 4XFIA 1UCXA 3F95A 4IEUA 4ISRA 1RUH1 1H8TB 1LOFA 1Y9MA 4CP9B 4WM8B 3GJAA 3SCFA 1OFNA 1ZBA1 2AYHA 1PGL2 3S6PA 1RVF1 3T2OA 3N7MA 1WGPA 1NA1B 1AL23 1H1AA 1H9PA 3AM2A 4JZRA 2VMEA 3NNLA 2X5IA 3QLQA 2VOXA 5A3TA 2WLQA 5LK7B 2JE7A 4CCDA 3CDZB 4LLOA 4CP0A 2C4XA 4NR1A 1O5UA 3IWZA 2E7QA 1OKOA 5C3SA 3OB8A 2GAUA 3ILRA 1DQ2A 3ZM8A 1OF3A 3D82A 3EXUA 3OBAA 5FMOL 4AVTA 3ZSKA 2E51A 2Z69A 2J22A 1RITA 5FYYA 2WWJA 1BZWA 3N35A 2PA7A 5FP9A 1NOVA 3ZYGA 4Q4W2 3WVJA 3Q8CA 1T6GC 4QQLA 4PIYA 5LA9A 1NY72 3ETQA 3OEBA 3UT0A 3I8TA 3GHNA 4XC9A 3PTRB 1VBA1 2ET1A 2H0VA 2G4IA 2QQMA 3LEGA 2ZGQA 5FCCA 2D6KA 2A6YA 2MPFA 1VBE1 4AFCA 3ZFGC 4KI5M 3ATGA 4XACA 5L73A 3H8UA
chains in the Genus database with same CATH topology
3CZJA 3P6BA 3C7OA 2J1EA 3GDBA 5G04L 2W3JA 2VZRA 4M4RA 3FL7A 2VZUA 2Y6GA 3VDAA 2ZEWA 3HNMA 4CUAA 4LQRA 2JDAA 3WNMA 1DLCA 2X10A 4L0PA 2VTFA 4KMQA 3K4DA 2L9LA 2J1AA 3K46A 3U37A 4XUOA 4DUXA 3WF3A 3IAPA 1WCQA 3BN6A 4OUEA 4UAPA 4FI9A 2RVAA 1P8JA 4LPLA 1LNSA 2J1RA 2JE8A 3DYMA 4P08A 3MBWA 4QDQA 2VZQA 3WEZA 1NUKA 2EICA 4ZZ8A 1W9SA 4A41A 3PUHA 3P1IA 3NRUA 4E8DA 2WZEA 5JUVA 4P00B 4BJ0A 2VMFA 4XUTA 1SG3A 1US3A 3I97A 4DEVA 1JYXA 2J1TA 4CU9A 2VQTA 4PQQA 5CZKA 2QQLA 1JZ2A 3NJXA 2WYSA 5EIYB 3SKJE 1CZSA 4YPJA 4P5YA 2VZ1A 1UYYA 1UXZA 4KWUA 2X09A 3GM8A 1UYZA 3J7HA 5LA2A 3MUZ1 4BXSV 1PX3A 1UMIA 4QDSA 1H6XA 1PMJX 2W1SA 3K4AA 5HXMA 1JU4A 4RN5A 4XURA 3T0DA 2VCAA 3I2KA 4OYUA 1UZ0A 3UNPA 4CU8A 3I2JA 4XVHA 1UY2A 2YFZA 3EYPA 1TVGA 1H6YA 4E8CA 4HG6B 5DPNA 5C7GA 2Y6KA 3WNKA 2JD9A 3C7FA 4MADA 3WNLA 1UY0A 1GU3A 4Z2AA 4QB2A 2JKXA 2VZVA 3K4ZA 3CMGA 4P02B 2ORXA 4QX0A 3T2PA 1DYOA 2V4VA 1O59A 4W4ZA 3K77A 4OZOA 2HLEA 5C71A 2ZEXA 1JZ5A 2QBXA 4LKSA 1JYNA 2Y6JA 4GWJA 2E31A 4IUGA 2W95A 2WQ8A 1J83A 2EIBA 2Y8KA 5CYYA 3VD7A 2YC2A 3I2IA 3EB7A 2WO2A 1GNYA 2BZDA 5LA0A 2ZXQA 4JHZA 5JXIA 2VO5A 2WN3A 3CKHA 1BHGA 2B4KA 3PUIA 2C26A 1F4HA 4MGQA 3HN3A 2W1WA 5DN2A 1JZ7A 1UWWA 1TG7A 4ZZ5A 2WAOA 4A3ZA 2VQUA 4MGSA 4QX1A 3WNNA 4D8MA 1K42A 4DUWA 2QQJA 2ID4A 1ULOA 2VR4A 2YB7A 3I3EA 5DQ0A 3IIIA 2C9KA 3SEPA 2Y6LA 1JHJA 4LHSA 3VDCA 2DDUA 1JYWA 2R7EB 3VD4A 2BGPA 3NQHA 2WDBA 3MV11 1OD3A 1D7PM 1XPWA 3BGAA 1O8PA 3GGLA 3T0AA 4AAXA 2VCBA 4MOAA 1US2A 3MV01 2Z4FA 3OGSA 2ZEYA 5LCWL 3C8XA 4CU6A 4TTGA 3JXSA 2CDOA 1ULPA 1SHWB 2VZPA 3HOBA 4QDRA 1UXXX 1W8NA 4CUBA 2EIDA 2RV9A 2WO1A 2YG0A 1DP0A 3MUY1 2X05A 2QQOA 3OG2A 5JMOA 3A23A 2ORZA 3NJVA 1MPXA 4GWIA 3I2GA 3IB3A 3A21A 4QPWA 2W87A 4JX0A 3LEIA 4XUPA 1CIYA 2DCJA 3T08A 2W92A 1W9WA 3ACFA 3ECQA 1NKGA 5A1AA 2HYXA 5I0DA 2XQXA 5IJRA 1R64A 4W50A 4QX2A 5JR2A 4PT6A 4A45A 4DXRA 2WUHA 2CDPA 4AG4A 4D0QA 4CU7A 1NX9A 1IQDC 1J84A 3I2HA 3UESA 5DMYA 2W1QA 2OKXA 3CZUA 4QX3A 1UY4A 3DECA 3HPNA 1JZ4A 4TXWA 2J1SA 2Y64A 4BK4A 2WN2A 1K45A 2VZOA 2VC9A 2E26A 5JXHA 1F4AA 3HEIA 3MO4A 4OMDA 1I5PA 1XC6A 3GXUA 3OGRA 1CZTA 2YC4A 1JYVA 3SKVA 2EIEA 1EUTA 1RYYA 1K12A 4GZ9A 2E33A 4ARYA 3FHAA 2VMDA 3HNYM 3A7QA 4MO3M 3NNGA 1XNTA 4M4PA 3IDAA 2B9VA 2WBKA 1JZ8A 2BGOA 4DEQA 3OGVA 3T2QA 3THCA 3WNOA 3OEAA 3FHQA 3I3DA 4W8JA 1W8OA 2QQKA 2W91A 2YFUA 4A4AA 1UX7A 5C70A 1GUIA 1GOFA 3THDA 4A42A 5JXJA 3ACGA 1SDDB 1JZ6A 1CX1A 2VZTA 3E1F1 2QQNA 4XZUG 4OMCA 3LPFA 4XUNA 5FUIA 1CZVA 2RJ2A 5B4NA 2VZ3A 5IYYA 1L7QA 2Y6HA 2W46A 3T09A 3C7GA 5F7UA 4PF1A 2LS6A 3VD5A 4QB6A 3C7EA 3SEEA 4RYDA 4BK5A 4UOJA 3ACHA 2J1VA 4DUVA 3ACIA 1K3IA 4DXTA 4JKMA 1XNAA 2WO3A 2V72A 4BDVB 5EJZB 2BBAA 1KEXA 2XOMA 1UMHA 2J7MA 3I2FA 3DYPA 5G05L 1PX4A 3HJRA 1W0NA 2WABA 1YQ2A 3AC0A 2VZSA 1JI6A 1OH4A 5LA1A 3WSOA 4A6OA 5HPOA 3IAQA 2ZEZA 3WF1A 2KD7A 5J1XA 2WZ8A 2XHNA 4QB1A 2E32A 1WKYA 2PQSA 3CQOA 4ARXA 3VD3A 3WF4A 3W5NA 3DYOA 5IHRA 2VMCA 3I3BA 3LE0A 2VL4A 3T0BA 2VM9A 2W5FA 3FN9A 2WAAA 3LQCA 4ET7A 1UY1A 2LW8A 2VCCA 4CVUA 3C7HA 4A44A 5JXGA 5IFTA 1UYXA 2VJXA 1JZ3A 2W94A 3CIHA 3LEKA 1W99A 3WNPA 4QAWA 2W1UA 2V5DA 1GMMA 2QQIA 1KGYA 2XONA 2BERA 1OT5A 2W9XA 3WF0A 1O8SA 4DXSA 3T2OA 1GOHA 2W47A 2J1UA 1HN1A 4JKLA 3VD9A 2VOTA 3WF2A 2VMEA 4CUCA 1JU3A 1GOGA 3CDZB 5B4XA 3HNBM 3A22A 1GQPA 1NAEA 2C4XA 4ZY9A 3OB8A 3UETA 3ZM8A 1OF3A 3OBAA 3ABZA 1EUUA 2J22A 2DCKA 4XUQA 3F2ZA 3OEBA 5IFPA 3VDBA 1L7RA 1W9TA 3W5MA 1T2XA 3D3AA 3WQBA 2QQMA 1PMHX 3LEGA 1OF4A 5EJ1B 4JKKA 4ZXEA 4KI5M 3LPGA 1UY3A 3K75B 4UI9L 3ETPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CZJ A;  3P6B A;  3C7O A;  2J1E A;  3GDB A;  5G04 L;  2W3J A;  2VZR A;  4M4R A;  3FL7 A;  2VZU A;  2Y6G A;  3VDA A;  2ZEW A;  3HNM A;  4CUA A;  4LQR A;  2JDA A;  3WNM A;  1DLC A;  2X10 A;  4L0P A;  2VTF A;  4KMQ A;  3K4D A;  2L9L A;  2J1A A;  3K46 A;  3U37 A;  4XUO A;  4DUX A;  3WF3 A;  3IAP A;  1WCQ A;  3BN6 A;  4OUE A;  4UAP A;  4FI9 A;  2RVA A;  1P8J A;  4LPL A;  1LNS A;  2J1R A;  2JE8 A;  3DYM A;  4P08 A;  3MBW A;  4QDQ A;  2VZQ A;  3WEZ A;  1NUK A;  2EIC A;  4ZZ8 A;  1W9S A;  4A41 A;  3PUH A;  3P1I A;  3NRU A;  4E8D A;  2WZE A;  5JUV A;  4P00 B;  4BJ0 A;  2VMF A;  4XUT A;  1SG3 A;  1US3 A;  3I97 A;  4DEV A;  1JYX A;  2J1T A;  4CU9 A;  2VQT A;  4PQQ A;  5CZK A;  2QQL A;  1JZ2 A;  3NJX A;  2WYS A;  5EIY B;  3SKJ E;  1CZS A;  4YPJ A;  4P5Y A;  2VZ1 A;  1UYY A;  1UXZ A;  4KWU A;  2X09 A;  3GM8 A;  1UYZ A;  3J7H A;  5LA2 A;  3MUZ 1;  4BXS V;  1PX3 A;  1UMI A;  4QDS A;  1H6X A;  1PMJ X;  2W1S A;  3K4A A;  5HXM A;  1JU4 A;  4RN5 A;  4XUR A;  3T0D A;  2VCA A;  3I2K A;  4OYU A;  1UZ0 A;  3UNP A;  4CU8 A;  3I2J A;  4XVH A;  1UY2 A;  2YFZ A;  3EYP A;  1TVG A;  1H6Y A;  4E8C A;  4HG6 B;  5DPN A;  5C7G A;  2Y6K A;  3WNK A;  2JD9 A;  3C7F A;  4MAD A;  3WNL A;  1UY0 A;  1GU3 A;  4Z2A A;  4QB2 A;  2JKX A;  2VZV A;  3K4Z A;  3CMG A;  4P02 B;  2ORX A;  4QX0 A;  3T2P A;  1DYO A;  2V4V A;  1O59 A;  4W4Z A;  3K77 A;  4OZO A;  2HLE A;  5C71 A;  2ZEX A;  1JZ5 A;  2QBX A;  4LKS A;  1JYN A;  2Y6J A;  4GWJ A;  2E31 A;  4IUG A;  2W95 A;  2WQ8 A;  1J83 A;  2EIB A;  2Y8K A;  5CYY A;  3VD7 A;  2YC2 A;  3I2I A;  3EB7 A;  2WO2 A;  1GNY A;  2BZD A;  5LA0 A;  2ZXQ A;  4JHZ A;  5JXI A;  2VO5 A;  2WN3 A;  3CKH A;  1BHG A;  2B4K A;  3PUI A;  2C26 A;  1F4H A;  4MGQ A;  3HN3 A;  2W1W A;  5DN2 A;  1JZ7 A;  1UWW A;  1TG7 A;  4ZZ5 A;  2WAO A;  4A3Z A;  2VQU A;  4MGS A;  4QX1 A;  3WNN A;  4D8M A;  1K42 A;  4DUW A;  2QQJ A;  2ID4 A;  1ULO A;  2VR4 A;  2YB7 A;  3I3E A;  5DQ0 A;  3III A;  2C9K A;  3SEP A;  2Y6L A;  1JHJ A;  4LHS A;  3VDC A;  2DDU A;  1JYW A;  2R7E B;  3VD4 A;  2BGP A;  3NQH A;  2WDB A;  3MV1 1;  1OD3 A;  1D7P M;  1XPW A;  3BGA A;  1O8P A;  3GGL A;  3T0A A;  4AAX A;  2VCB A;  4MOA A;  1US2 A;  3MV0 1;  2Z4F A;  3OGS A;  2ZEY A;  5LCW L;  3C8X A;  4CU6 A;  4TTG A;  3JXS A;  2CDO A;  1ULP A;  1SHW B;  2VZP A;  3HOB A;  4QDR A;  1UXX X;  1W8N A;  4CUB A;  2EID A;  2RV9 A;  2WO1 A;  2YG0 A;  1DP0 A;  3MUY 1;  2X05 A;  2QQO A;  3OG2 A;  5JMO A;  3A23 A;  2ORZ A;  3NJV A;  1MPX A;  4GWI A;  3I2G A;  3IB3 A;  3A21 A;  4QPW A;  2W87 A;  4JX0 A;  3LEI A;  4XUP A;  1CIY A;  2DCJ A;  3T08 A;  2W92 A;  1W9W A;  3ACF A;  3ECQ A;  1NKG A;  5A1A A;  2HYX A;  5I0D A;  2XQX A;  5IJR A;  1R64 A;  4W50 A;  4QX2 A;  5JR2 A;  4PT6 A;  4A45 A;  4DXR A;  2WUH A;  2CDP A;  4AG4 A;  4D0Q A;  4CU7 A;  1NX9 A;  1IQD C;  1J84 A;  3I2H A;  3UES A;  5DMY A;  2W1Q A;  2OKX A;  3CZU A;  4QX3 A;  1UY4 A;  3DEC A;  3HPN A;  1JZ4 A;  4TXW A;  2J1S A;  2Y64 A;  4BK4 A;  2WN2 A;  1K45 A;  2VZO A;  2VC9 A;  2E26 A;  5JXH A;  1F4A A;  3HEI A;  3MO4 A;  4OMD A;  1I5P A;  1XC6 A;  3GXU A;  3OGR A;  1CZT A;  2YC4 A;  1JYV A;  3SKV A;  2EIE A;  1EUT A;  1RYY A;  1K12 A;  4GZ9 A;  2E33 A;  4ARY A;  3FHA A;  2VMD A;  3HNY M;  3A7Q A;  4MO3 M;  3NNG A;  1XNT A;  4M4P A;  3IDA A;  2B9V A;  2WBK A;  1JZ8 A;  2BGO A;  4DEQ A;  3OGV A;  3T2Q A;  3THC A;  3WNO A;  3OEA A;  3FHQ A;  3I3D A;  4W8J A;  1W8O A;  2QQK A;  2W91 A;  2YFU A;  4A4A A;  1UX7 A;  5C70 A;  1GUI A;  1GOF A;  3THD A;  4A42 A;  5JXJ A;  3ACG A;  1SDD B;  1JZ6 A;  1CX1 A;  2VZT A;  3E1F 1;  2QQN A;  4XZU G;  4OMC A;  3LPF A;  4XUN A;  5FUI A;  1CZV A;  2RJ2 A;  5B4N A;  2VZ3 A;  5IYY A;  1L7Q A;  2Y6H A;  2W46 A;  3T09 A;  3C7G A;  5F7U A;  4PF1 A;  2LS6 A;  3VD5 A;  4QB6 A;  3C7E A;  3SEE A;  4RYD A;  4BK5 A;  4UOJ A;  3ACH A;  2J1V A;  4DUV A;  3ACI A;  1K3I A;  4DXT A;  4JKM A;  1XNA A;  2WO3 A;  2V72 A;  4BDV B;  5EJZ B;  2BBA A;  1KEX A;  2XOM A;  1UMH A;  2J7M A;  3I2F A;  3DYP A;  5G05 L;  1PX4 A;  3HJR A;  1W0N A;  2WAB A;  1YQ2 A;  3AC0 A;  2VZS A;  1JI6 A;  1OH4 A;  5LA1 A;  3WSO A;  4A6O A;  5HPO A;  3IAQ A;  2ZEZ A;  3WF1 A;  2KD7 A;  5J1X A;  2WZ8 A;  2XHN A;  4QB1 A;  2E32 A;  1WKY A;  2PQS A;  3CQO A;  4ARX A;  3VD3 A;  3WF4 A;  3W5N A;  3DYO A;  5IHR A;  2VMC A;  3I3B A;  3LE0 A;  2VL4 A;  3T0B A;  2VM9 A;  2W5F A;  3FN9 A;  2WAA A;  3LQC A;  4ET7 A;  1UY1 A;  2LW8 A;  2VCC A;  4CVU A;  3C7H A;  4A44 A;  5JXG A;  5IFT A;  1UYX A;  2VJX A;  1JZ3 A;  2W94 A;  3CIH A;  3LEK A;  1W99 A;  3WNP A;  4QAW A;  2W1U A;  2V5D A;  1GMM A;  2QQI A;  1KGY A;  2XON A;  2BER A;  1OT5 A;  2W9X A;  3WF0 A;  1O8S A;  4DXS A;  3T2O A;  1GOH A;  2W47 A;  2J1U A;  1HN1 A;  4JKL A;  3VD9 A;  2VOT A;  3WF2 A;  2VME A;  4CUC A;  1JU3 A;  1GOG A;  3CDZ B;  5B4X A;  3HNB M;  3A22 A;  1GQP A;  1NAE A;  2C4X A;  4ZY9 A;  3OB8 A;  3UET A;  3ZM8 A;  1OF3 A;  3OBA A;  3ABZ A;  1EUU A;  2J22 A;  2DCK A;  4XUQ A;  3F2Z A;  3OEB A;  5IFP A;  3VDB A;  1L7R A;  1W9T A;  3W5M A;  1T2X A;  3D3A A;  3WQB A;  2QQM A;  1PMH X;  3LEG A;  1OF4 A;  5EJ1 B;  4JKK A;  4ZXE A;  4KI5 M;  3LPG A;  1UY3 A;  3K75 B;  4UI9 L;  3ETP A; 
#chains in the Genus database with same CATH topology
 3CZJ A;  3VBS A;  2IXI A;  2VPV A;  5LY2 A;  1W6O A;  3TEW A;  2ADE A;  1HB2 A;  2D3R A;  4O61 A;  1I6X A;  3RMY A;  4CDX A;  5G04 L;  5LW9 A;  4OLL A;  4E2S A;  3O1M A;  3TEX A;  2HWD 2;  3E5U A;  5KHI A;  2B8M A;  5JDB A;  2VXJ A;  1ENQ A;  5FWE A;  2ZEW A;  3MIH A;  5JOX A;  3VHN A;  3ZOI A;  1DG6 A;  3MW4 A;  5FFO C;  1NXD 1;  2RMU 3;  3IMM A;  5LB6 A;  1YHF A;  3ZR5 A;  4E27 A;  3I2D A;  5A3L A;  2JWP A;  2JDA A;  1J3R A;  1UN1 A;  3AFK A;  3NWK A;  4YZ3 A;  3WHT A;  3MGU A;  2X10 A;  2LRO A;  4L0P A;  2VTF A;  3EJK A;  2Q8E A;  2CGP A;  5FY0 A;  2J1A A;  3W9A A;  4I2O A;  4XUO A;  2BVB A;  1UX6 A;  3N36 A;  3IAP A;  2WS9 2;  2ARX A;  1WCQ A;  3WT3 A;  1OUR A;  1XRU A;  5CEH A;  1BEV 3;  1KDM A;  1R1A 1;  1SCS A;  3OUI A;  3AYA A;  2ARE A;  4J6G A;  3WW2 A;  1OOP B;  5DUU A;  2HYK A;  4ES8 A;  3NVC A;  2BNO A;  4L8Q A;  1VBD 1;  1V6N A;  4P5H A;  2HH9 A;  2VZQ A;  1LES A;  3WEZ A;  3ZYJ B;  5A70 A;  1NE4 A;  4ZZ8 A;  4XAB A;  1W9S A;  5FLJ A;  2HWE 3;  1RMU 3;  2ZAA A;  1SEF A;  4AAP A;  2Q5T A;  4LBO A;  4P00 B;  2VTX J;  2WWS A;  4WVV A;  3VBH A;  4NN0 A;  1BLZ A;  2PHL A;  2G19 A;  5IK5 A;  1NCQ B;  4NRO A;  2D5H A;  3KSC A;  1N1V A;  2PLV 2;  2J1T A;  4CU9 A;  3T2T A;  1KJL A;  1KXG A;  5T50 A;  2J42 A;  3OYW B;  2QQL A;  2RS5 1;  3ZN6 B;  4Q8K A;  4QKB A;  1U5Y A;  1YLL A;  4LBQ A;  3NJX A;  4H3W A;  1O7F A;  2WYS A;  1MEC 1;  3J7L A;  3BU0 A;  4XJ9 A;  5BNN B;  5FZD A;  2OZ6 A;  4YFZ A;  5AC9 3;  4P5Y A;  4EN6 B;  1FOD 1;  3IM0 A;  2JDU A;  3J8F 1;  3LA2 A;  4RHV 2;  1CR7 A;  1UYY A;  1UU4 A;  5FYV A;  4K40 A;  4C1X A;  1VPH A;  4JTN A;  1AYN 3;  4CPB A;  1V00 A;  2DTW A;  1ACC A;  1UMI A;  5CKQ A;  1H6X A;  4RN5 A;  4BCU A;  5A6Q A;  4FPK A;  1OLR A;  1UZ0 A;  3TOJ A;  2PAM A;  4URA A;  4QD2 A;  2R04 2;  1NCR A;  4IEO A;  4ZPI A;  3RRD A;  4XVH A;  4Q26 A;  3L2Y A;  2D43 A;  4JGZ B;  2NP0 A;  4QXB A;  2BW8 A;  1G7Y A;  1WLW A;  3HT2 A;  3QBQ A;  4Q4Y 2;  4C1W A;  4K7J A;  3JB4 C;  2TBV A;  4LBM A;  3VDD C;  5GZE A;  3MHZ A;  2JD9 A;  2ZHM A;  4GB3 2;  3AB0 A;  5FZ6 A;  1WW5 A;  4DFS A;  4E9K A;  2GNM A;  3LFM A;  4EN0 A;  4YAR A;  2GMP A;  5CIS A;  1WLC A;  1ND3 A;  4QXH A;  3DXT A;  4LA2 A;  5BNP B;  2ZHN A;  5L7O C;  1DQ0 A;  1MS5 A;  1HQL A;  3LIH A;  1H0B A;  2PFW A;  1OLM E;  5FO7 B;  5F6L B;  1CAV B;  1QXJ A;  5FBJ A;  3MPB A;  2G1M A;  1DYO A;  3H1Y A;  4CEY A;  2LRP A;  1CD3 G;  4P9I A;  4AWD A;  1O59 A;  2WZP P;  1WW7 A;  3N9Q A;  2CNA A;  3PME A;  3ZSL A;  3ZX7 A;  2XB6 C;  5CB7 A;  4CDU B;  4COZ A;  1QU0 A;  2HLE A;  4MX3 A;  4TWT A;  4UXA A;  5F5Q A;  1JXN A;  1DGL A;  3WCR A;  3NNM A;  2YYO A;  3AMH A;  3KHB A;  4IUG A;  1EPZ A;  3AZZ A;  4OUL A;  5K7P A;  4DRV A;  2Y8K A;  5CYY A;  5EYX A;  5FTT C;  4UW5 A;  4FPO B;  1OD5 A;  5ISL A;  4KU7 A;  2WO2 A;  3OF1 A;  5JOW A;  2DTY A;  4QPG B;  5ABJ C;  2Q1F A;  4BQ4 A;  3CKH A;  3POB A;  3LA3 A;  1D0G A;  4D94 A;  1MS4 A;  1VMJ A;  4UBH A;  3VBR C;  1F4H A;  4YM3 A;  1J58 A;  4OI0 A;  1REE A;  2R06 2;  4Q0V A;  3ILF A;  1UD1 A;  2W1W A;  3WG4 A;  4BME A;  3BIE A;  3L2H A;  4LIT A;  2PHR A;  2X53 S;  4LTA A;  1O4Y A;  1VP6 A;  2PHD A;  2VOV A;  3JZV A;  4Y24 A;  1GWL A;  2BGC A;  4RL7 A;  4AFM A;  5FZH A;  2ZGS A;  5L36 A;  4HPK B;  3BTZ A;  1W8F A;  2R1D A;  1C4R A;  3POS A;  4UYB A;  1W28 A;  1LEN A;  3BB6 A;  1HRV 2;  4DIN B;  1ULO A;  4FOV A;  2C9K A;  1L7L A;  3U75 A;  1COV 1;  1GYK A;  4BE3 A;  4LHS A;  1W6M A;  2BRT A;  3UKN A;  2R6Q A;  1GZT A;  4MXW A;  1V9U 2;  2YZ4 A;  2ZTN A;  2JDH A;  3VHR A;  1TNR A;  2JDZ A;  1OD3 A;  1T6B X;  2GH8 A;  3BTA A;  1CAU A;  2OQ6 A;  2GN3 A;  2C6S A;  3NV3 A;  3SNM A;  1ZA7 A;  3ZYP A;  1HN0 A;  3T0A A;  1UOJ A;  4Q4X 1;  1AR9 1;  2VCB A;  3AMN A;  3M3I A;  5DDJ 2;  4BLJ A;  1KIT A;  5IK4 A;  1TME 2;  1US2 A;  1XE0 A;  1LGN A;  2Y6F A;  4BU2 A;  5JCT A;  5LCW L;  1SLC A;  3C8X A;  3VHP A;  1VRH 1;  1ND2 B;  3TEY A;  3JQX A;  1SPP A;  2EF6 A;  2WL1 A;  4W6Y A;  4TTG A;  5ACA 3;  3RJR A;  3JXS A;  2NZ9 A;  1Z7S 3;  1QXR A;  1QJY 2;  4ZON A;  5A3U A;  4BMB A;  4XFG A;  1OA4 A;  1R09 1;  2ZGO A;  4IEW A;  3VBO B;  4B3N A;  1WD4 A;  5DAQ A;  4DB5 A;  5GZF A;  2EID A;  3GZE A;  3B94 A;  2WSU A;  3MUY 1;  2X05 A;  3OG2 A;  2ZZQ A;  1S0E A;  4DQA A;  1OSG A;  4BOW A;  2JEM A;  1RUH 2;  1MVQ A;  4PJY A;  3SLI A;  5EPA A;  5FZ3 A;  1ZBA 2;  3MIF A;  3SHR A;  2E53 A;  3I2G A;  5K0U A;  2RR1 1;  1RVF 2;  1ND3 C;  4QPW A;  4JX0 A;  3R05 A;  3THP A;  3SIT A;  1N1Y A;  4J1W A;  4IEV A;  2I2S A;  2ZA9 A;  4XFA A;  2VBP A;  1LGB A;  2JG9 A;  3VZM A;  5CAZ A;  5FPU A;  4IE4 A;  4CCN A;  3K51 A;  1PO1 2;  3I3M A;  2QQU A;  3ECQ A;  5FOJ B;  5FZG A;  1NKG A;  4UT5 A;  4XDP A;  2HYX A;  3H9A A;  4XDQ A;  3WW3 A;  5IJR A;  4FOY A;  2HEY F;  1YRZ A;  3RPQ A;  2A70 A;  2JG8 B;  1JUH A;  3VHO A;  1CPM A;  2QQV A;  4PT6 A;  3WR0 A;  1PM4 A;  2IXH A;  4A45 A;  4FFI A;  4D0Q A;  1ZBE 1;  4FQZ A;  1OH3 A;  3DPR C;  1PIV 3;  3ZMN A;  1ZRD A;  5FPX A;  4F3J A;  3JQW A;  1VIW B;  3MDP A;  1HXS 1;  5FYT A;  1CJP A;  2GME A;  4HFS A;  4M0N A;  4NPR A;  2W1Q A;  3FJS A;  2YBP A;  2E63 A;  5F3C A;  1VBA 2;  5HBA A;  2SLI A;  3VBU B;  2XG3 A;  5F8P A;  3FC0 A;  3T30 A;  5JWP A;  1NLQ A;  5FZ7 A;  5JVV A;  1JZ4 A;  3N7K A;  1GNH A;  1QHD A;  1QQP 3;  3T1L A;  5DZE A;  2E7T A;  2VMG A;  2VZO A;  5CBL A;  2VC9 A;  1Y43 B;  1L3J A;  5APA A;  2PEL A;  1WMF A;  2ZZJ A;  3HEI A;  3MIB A;  1OA3 A;  4QX7 A;  1UZY A;  3ZYF A;  1JOD A;  5F3G A;  4C8D A;  1I5P A;  4KU8 A;  2DUR A;  3I2O A;  4FT8 A;  2I74 A;  1YWK A;  2DVG A;  2YC4 A;  2ZGK A;  1JYV A;  4K1Z A;  3SKV A;  2UY8 A;  1EUT A;  4R9C A;  2XBO 1;  4RFR B;  4GZ9 A;  2E33 A;  4S2H A;  2WLP A;  2VMD A;  4JDN A;  3HNY M;  2SBA A;  4IV1 C;  1OBN A;  3ILN A;  1VBC 3;  1RIR A;  4N8M A;  5DAV A;  1IZ3 A;  2FMD A;  3WDV A;  4AOC A;  1Q43 A;  1XJA A;  2V5Y A;  4L9B A;  4Y22 A;  1JZ8 A;  3ZN5 A;  4H55 A;  5F9T A;  2GSY A;  4BQX A;  4R9B A;  1RUF 3;  5DXD A;  4GMP 3;  3X29 B;  3MLJ A;  5FKB A;  3VKF C;  1UNB A;  1X8M A;  1RUO A;  3MEP A;  4P9L A;  3TNP B;  5IAX A;  1RUJ 1;  4HN1 A;  3FHQ A;  1U0A A;  4HSL A;  1MZ6 A;  2GDF A;  1R1A 2;  2R07 1;  4YW5 A;  3GZA A;  1WCU A;  1W8O A;  1DGR A;  5C4W A;  1O6U A;  5C70 A;  1GV9 A;  5FZ8 A;  1GOF A;  1LCL A;  3CBN A;  5GLW A;  1VBD 2;  3THD A;  3O1O A;  4LE3 A;  2WNV B;  1GZW A;  5JXJ A;  1R08 3;  1ODN A;  1ZVF A;  3Q8F A;  2PAE A;  2WQZ C;  3NAP B;  4Q4W 1;  1JZ6 A;  3W59 A;  4H14 A;  3E1F 1;  4R52 A;  4LHL A;  4XZU G;  1RUI 3;  4OMC A;  4HKW A;  3ZR6 A;  1GFF 2;  1EV1 1;  4O65 A;  1CZV A;  3VBO C;  3C3V A;  4Q29 A;  5CNA A;  2HWB 1;  1ZX5 A;  5B4N A;  5IYY A;  5CFC A;  3T09 A;  1LED A;  4Q0Q A;  4U36 A;  2GNB A;  1IOA A;  3WDT A;  3WNX A;  4ASM B;  4QGM A;  2RS5 2;  1BMV 1;  2Z79 A;  3URF A;  3PVB B;  4RYD A;  3TAY A;  1F35 A;  1ALY A;  3ACH A;  5FJK A;  3AZX A;  3O0W A;  4OZX A;  4P9W A;  3Q8E A;  3Q9O A;  4YVW A;  3H42 B;  1FOD 2;  4L97 A;  1K3I A;  4MHU A;  4DXT A;  2WR9 A;  3J8F 2;  3TWI A;  4JKM A;  2WO3 A;  2P6H A;  2VW2 A;  2TEP A;  4RS5 A;  2DVB A;  3IMN A;  4YGC A;  2IFR A;  1UMH A;  4B1L A;  2IXJ A;  2VMI A;  4XF0 A;  3MIE A;  4N90 A;  1QF3 A;  2HWD 1;  3IDC B;  3TN9 1;  4HL0 A;  4QU2 A;  3BAL A;  2D98 A;  1GP6 A;  1PVX A;  3KT7 A;  5GKA C;  4IEZ A;  4CRQ A;  2JG8 C;  2CAV A;  5FQ0 A;  3MYX A;  4LBQ D;  3WY6 A;  4AFB A;  3IAQ A;  2IZW A;  1AYM 1;  1SMV A;  1UPI A;  2AAC A;  4I0B A;  2BJS A;  1DQ5 A;  1ASJ 3;  5LBC A;  3UYJ A;  4XDO A;  1APN A;  4XIK A;  4B7E A;  2WZ8 A;  4D7S A;  2VW1 A;  2XHN A;  4U2A A;  5A6Z A;  4B4R A;  5EV7 A;  2OS2 A;  5T5J A;  1WKY A;  5JSO A;  2B42 B;  1IG3 A;  1PK6 B;  2P3J A;  4OHY A;  1VE0 A;  2GU9 A;  3LGR A;  3VBU C;  2P2K A;  5IHR A;  1LEM A;  1W8T A;  1PZ8 A;  3I3B A;  4KG0 A;  1YI7 A;  4WM7 C;  2W0X A;  3WCS A;  1JYT A;  3FN9 A;  3APB A;  3AYD A;  2VVE A;  1X9P A;  2DCY A;  3HAG A;  3LQC A;  1HKD A;  4XIO A;  5J48 A;  1UY1 A;  2LW8 A;  4AVC A;  2VCC A;  4OI4 A;  1LEC A;  3C7H A;  3MPP G;  4A44 A;  1AVB A;  1TZO A;  5IFT A;  1Q8P A;  1Z78 A;  5JXG A;  1UYX A;  4RSU A;  3ENR A;  2ARA A;  1YCI A;  1HRI 1;  1DBN A;  4FOQ A;  2W94 A;  3LEK A;  4EYU A;  1U5X A;  4E4S A;  4YVS B;  3SC7 X;  3SH5 A;  2PLV 1;  4YM1 A;  4ARX A;  2C5D A;  3KGL A;  2IC1 A;  2UY9 A;  3JD7 2;  3LEM A;  5D8A B;  5JMC A;  4EZ4 A;  1W8H A;  3BPZ A;  1I9R A;  2BER A;  2RS1 1;  1ZZB A;  4DO0 A;  2IXC A;  1J3P A;  2W9X A;  4PDW A;  3WF0 A;  1CON A;  2FDJ A;  2PMW B;  5IVY A;  3OY8 B;  3HQR A;  3PJQ A;  2J1U A;  4DS0 A;  3HQU A;  4AXO A;  1VB4 A;  2F17 A;  1VJ2 A;  3K48 A;  3WDY A;  3FBY A;  4YLZ A;  2DUP A;  2GNT A;  2VOT A;  3KZ4 C;  4YM0 A;  4Q0U A;  5C9A A;  4Q0S A;  1U12 A;  1DZQ A;  2Y38 A;  3FFQ A;  1NAE A;  4RQP B;  1UMZ A;  4PLM A;  1D2S A;  4XJ8 A;  3UET A;  4QKN A;  3ABZ A;  4AW7 A;  2AH2 A;  3SCG A;  1W6P A;  3AMM A;  1EAH 3;  5CFC C;  2GAL A;  4LNV A;  3KVB A;  3POI A;  4XUQ A;  5CG8 A;  4LOT A;  4RR3 A;  5FY5 A;  3U4X A;  1DZR A;  2D6P A;  2GP5 A;  3ZFE B;  4LBL A;  4XJZ A;  1HJG A;  1H2M A;  3SXW A;  5HCH A;  4NRQ A;  4PI0 A;  5FMD A;  1QIQ A;  2EXJ A;  1Q3E A;  4EWD A;  5J7M A;  1CJD A;  4UBG A;  5EJ3 A;  5CFD C;  5IVJ A;  5D2A A;  2XUM A;  4IDZ A;  5AVP A;  4DNY A;  3USU B;  1AXK A;  2MNG A;  1WWY A;  1AR9 2;  4Q4X 2;  4W6W A;  5EJ1 B;  4AQ6 A;  5A3M A;  1VBB 3;  4A7Y A;  1SBF A;  2CV6 A;  4W6X A;  4ZXE A;  4TN7 A;  1MS3 A;  3LPG A;  4IEY A;  4OHW A;  4J25 A;  5DAB A;  2JD4 A;  1VAK A;  2A1X A;  5H9Q A;  3WDX A;  3BOW A;  4D6S A;  3IPV A;  3RWN A;  2O0O A;  3T4H B;  2WNU C;  3C7O A;  4NII A;  3EO6 A;  3OSD A;  5HCF A;  1G9C A;  2UU8 A;  1SQ4 A;  3U78 A;  1FMD 3;  1R09 2;  2VZR A;  2JKB A;  3I4I A;  4JQR A;  2Q30 A;  1W9F A;  1X36 A;  2VUC A;  3FUQ A;  2VZU A;  2Y6G A;  4MH0 E;  4MZU A;  5FZK A;  5LBB A;  4C91 A;  3HNM A;  5KXE A;  1S0D A;  1XNC A;  2DVF A;  4DY5 A;  5A7Q A;  5K8S A;  3NST A;  2YGM A;  3ZFF A;  4EWA A;  2Q0A A;  1Q5O A;  2Q8O A;  1U5I A;  3OGJ A;  4IE0 A;  2VH9 A;  1D4M 2;  1KFU L;  3LDR A;  3HIF A;  5EHD A;  1Q8V A;  5FAX A;  2ERF A;  1LOD A;  3LOI A;  5LY1 A;  2WFP A;  3K46 A;  3ORJ A;  1FPN 1;  4SBV A;  4DUX A;  5JIU A;  4D69 A;  4AI0 A;  5FBZ A;  3UK9 A;  1FXZ A;  4B4Q A;  4AYU A;  3I49 A;  1OC1 A;  1PGW 1;  2OUH A;  3BN6 A;  4XCB A;  3ZFG A;  1TNF A;  1CAX A;  4GUL A;  3AP6 A;  2XL9 A;  5JZG B;  4FI9 A;  4Y33 A;  5J37 A;  2RVA A;  3IIA A;  5FYH A;  1OKQ A;  4OQ9 A;  1DCS A;  1GP5 A;  5SV8 A;  1NT0 A;  1PM7 A;  1ST8 A;  3VZJ A;  4ZS2 A;  1ZRF A;  3CEW A;  3MBW A;  1Q56 A;  2PHF A;  4XTP A;  2EIC A;  1HRV 1;  4Y20 B;  1NLS A;  3M70 A;  3LIG A;  3P1I A;  3PVE A;  5FZF A;  1LU1 A;  4E8D A;  2WZE A;  5AVA A;  1AX0 A;  5H9S A;  4Q2F A;  1OQ1 A;  1V9U 1;  2YBK A;  4COV A;  2QJV A;  4IV3 B;  4XUT A;  4ORF A;  2VAU A;  4JGY C;  2GMM A;  1M06 G;  1FT9 A;  3ZVX A;  1US3 A;  3I97 A;  1F15 A;  4CDW C;  4DEV A;  1VAL A;  4N53 B;  2CYF A;  2JIG A;  4MG2 A;  4PQQ A;  1IPS A;  1HB3 A;  2OW4 A;  1JH5 A;  2AEY A;  2D3S A;  4MUV A;  1QOT A;  1QKQ A;  1JZ2 A;  1W05 A;  2HWE 1;  1RMU 1;  5EIY B;  1AR7 3;  4CCK A;  3SKJ E;  3E6D A;  1CZS A;  2LM3 A;  4YPJ A;  5HCB A;  2W39 A;  3MLK A;  3HR9 A;  2XKP A;  3BVC A;  4N7U A;  2YC0 A;  5FY4 A;  1SBD A;  3R0R A;  4CCO A;  3O1V A;  1UYZ A;  4MGY E;  3J7H A;  5F3I A;  1C8M 1;  4WBB A;  2XBO 2;  1XU1 A;  4QXC A;  2BUK A;  1PX3 A;  4XW3 A;  1W06 A;  4AVS A;  1REF A;  5A3P A;  2P34 A;  1ZM1 A;  1LJ7 A;  4RR3 C;  1MQT B;  1PMJ X;  4IE7 A;  2CU5 A;  5A7O A;  3WG1 A;  1JOP A;  1JU4 A;  1HQW A;  2FDF A;  5HI0 A;  4FTS A;  3SQO A;  3T0D A;  2VG9 A;  5C8W A;  3RYP A;  3H0O A;  4HKO A;  4M3C F;  3ZXF A;  5AC9 1;  1W6N A;  2BBV A;  3D5O A;  3V0B B;  3I2J A;  1TQ5 A;  2R32 A;  1ULF A;  4JRA A;  1UY2 A;  1YXW A;  4CP1 A;  1TVG A;  2Z5W A;  1LU2 A;  4E8C A;  4HG6 B;  4CP9 A;  3OTF A;  4WM8 A;  5GM0 A;  5C7G A;  5CKN A;  4PBP A;  4AFD A;  4HKL A;  4FQ4 A;  1RUJ 2;  1VR3 A;  1RUE 3;  1PO1 1;  2BNN A;  4N43 C;  3CJI C;  3RZM A;  2OYZ A;  3ZDV A;  3PLQ A;  3MLL A;  2R07 2;  2WQ4 A;  4QB2 A;  2HWC 3;  1PVC 3;  3PVO A;  3K4Z A;  3PUA A;  1HDK A;  4GH4 B;  2X5I B;  1C5I A;  1UZZ A;  3PHM A;  5D21 A;  2XLF A;  1OMI A;  4AVA A;  2ORX A;  1AX1 A;  1DIW A;  2NMN A;  4IE6 A;  4QX0 A;  4EN7 B;  3PL0 A;  2A6W A;  1F31 A;  5FUP A;  5IVB A;  2R04 3;  3ZPY A;  1RC6 A;  3BTX A;  1OVS A;  3HQX A;  1STM A;  3I3Q A;  4XAE A;  3ZFF C;  4W4Z A;  4AHW A;  1EV1 2;  5C71 A;  4OCT A;  3RZZ A;  2HWB 2;  2Y6J A;  3O7O A;  5A3O A;  4GB3 3;  4CXW A;  1DQ4 A;  1F5F A;  1XNK A;  5J98 B;  5LRR A;  1GIC A;  2WQ8 A;  2JJ6 A;  2EIB A;  3WDU A;  4G3Y C;  1H8V A;  2D93 A;  3VDD A;  2WO7 A;  1BMV 2;  4S2F A;  1F8V A;  1O3S A;  4HZF A;  4MGZ E;  2VO5 A;  1GZ9 A;  1UU5 A;  5GLT A;  4Q8L A;  1IHM A;  1H2L A;  1BHG A;  3RZH A;  5HCA A;  2C26 A;  2ETE A;  2R0H A;  4E2G A;  1K5M B;  5L7O A;  3MZH A;  2WNE A;  1ZRC A;  4W65 A;  2BYV E;  3LSD A;  2IWG B;  3H8R A;  3AKR A;  3RVH A;  2ZJC A;  1BXH A;  5FPA A;  3TN9 2;  4XEZ A;  4QT6 A;  1JZ7 A;  1UWW A;  1TG7 A;  2VOK A;  2MHF A;  2WAO A;  4ZZ5 A;  4LBJ A;  2VUL A;  1B35 B;  1ULC A;  1MVE A;  3VBS B;  2VQU A;  4QX1 A;  1W6O B;  2Y0O A;  4Y4Y A;  4QGN A;  1AYM 2;  1O4T A;  2XJV A;  3GCW A;  3NV4 A;  4CDX B;  4DUW A;  2QQJ A;  4AGR A;  5A6Y A;  1C5H A;  5T52 A;  1HV1 A;  4XOG A;  2VR4 A;  4AHZ A;  3I3E A;  3III A;  3SEP A;  2O8O A;  3OBZ A;  2O14 A;  3VDC A;  2WKK A;  3RYK A;  3VD4 A;  2XLG A;  3NQH A;  2WDB A;  1W2O A;  1AJK A;  1AXZ A;  1YFW A;  4UFH A;  2A3W A;  3BOP A;  5T5P A;  3ZXL A;  5ABJ A;  2R06 3;  1KQR A;  1O8P A;  2NLR A;  2OT7 A;  4XF4 A;  3R6S A;  3NNJ A;  2WT2 A;  1CGP A;  3VBR A;  4ZU7 A;  1RUC 1;  1QJU 3;  4YM2 A;  2BWC A;  3K3N A;  4PLN A;  3J9S A;  1RUD 3;  2Z4F A;  4LA3 A;  3J7M A;  2HWF 2;  2AEN A;  5A32 A;  3T3Y A;  3EBR A;  1MR5 A;  3UGF A;  1A34 A;  3B7M A;  3ZLI A;  4XIL A;  3SCH A;  4QPY A;  4TLF A;  3U11 A;  4XJU A;  1HRI 2;  1RHI 3;  1TEI A;  1DGW A;  1UXX X;  2DV9 A;  1YQC A;  1MQT C;  1PNG A;  1W8N A;  2UYA A;  4XQ4 A;  1TMF 2;  2G9G A;  2WJS A;  4LO7 A;  1H30 A;  2OVU A;  2RV9 A;  1H8T C;  2YG0 A;  2JB8 A;  3N9P A;  2QQO A;  4HXC A;  4WM8 C;  5JMO A;  1GNZ A;  3FMG A;  2FDI A;  3A23 A;  1GQH A;  4F8A A;  2RS1 2;  4MV2 A;  3GF6 A;  3V0A A;  2E9Q A;  3MFC A;  5DDJ 3;  4OI1 A;  1NA1 C;  1NE6 A;  3GJB A;  4LK6 A;  1TME 3;  3IB3 A;  3VBH B;  2MEV 3;  4B29 A;  3WXP A;  4IXL A;  4GIQ A;  4FVV A;  1Z7S 1;  5A1F A;  1UF2 C;  3ZYI B;  2EXK A;  1CIY A;  2UYB A;  3ZN6 A;  1W03 A;  3T08 A;  4KGQ A;  3M3E A;  4H7L A;  1IQA A;  2W92 A;  3IDB B;  1W9Y A;  1W9W A;  3DEM A;  3ACF A;  4YW1 A;  3KF3 A;  4MYE A;  5BNN A;  2WA3 A;  3BOD A;  4XCA A;  3WW1 A;  1N3O A;  1QJY 3;  3LF7 A;  4C90 A;  4L99 A;  3LWC A;  4AE2 A;  3MW2 A;  4MGK E;  3UL2 A;  2P1B A;  3GCX A;  3VKM A;  4BQ2 A;  4W50 A;  3CLP A;  2X29 A;  4QX2 A;  1WCK A;  5JR2 A;  2C1F A;  1XSQ A;  1AL2 2;  1ZZC A;  2JX9 A;  3JU9 A;  3UKT A;  1RUH 3;  3DCQ A;  4AHX A;  4BPZ A;  5GLU A;  4YYO A;  2BEO A;  1G9D A;  4CDQ B;  1NX9 A;  1IQD C;  1X50 A;  1RVF 3;  4XJA A;  5BXX A;  3I2H A;  1OPO A;  2VOW A;  4HET A;  1QJX 1;  1FV3 A;  3R4D B;  4JGZ A;  1DQ6 A;  4K20 A;  4KL1 A;  2ZBJ A;  1NCR B;  3I59 A;  1LB2 A;  4LIU A;  1C1L A;  1JOJ A;  2RM2 3;  3HPN A;  1O3T A;  4HK9 A;  2J1S A;  2W52 A;  5DZF A;  5EWS A;  4ASK A;  1PMI A;  1OLM A;  4NHK A;  1LR5 A;  1CES A;  1ZA4 A;  2YBS A;  1KD7 A;  1RED A;  3O0V A;  5TSW A;  1F4A A;  1O5L A;  1PIV 1;  3GZT B;  5JXH A;  2VCM A;  4GMP 0;  4QU1 A;  5FR3 A;  2C0Z A;  4A7Z A;  1C28 A;  2VNG A;  2W68 A;  1G8W A;  4L2N A;  4PBO A;  5FPZ A;  5GJ6 A;  5LEK A;  3R4S A;  1FAY A;  1QDC A;  2BQP A;  4QGL A;  1AX2 A;  1RYY A;  1K12 A;  4NRM A;  1KRI A;  4UWD A;  4GWN A;  1S0F A;  4IEQ A;  3JD7 1;  1B35 C;  3CNA A;  4Z1V A;  1LGC A;  1XNT A;  4CEY B;  1YJL A;  3DPR A;  4YGD A;  4HOO A;  1S2E A;  3IDA A;  3O14 A;  5E89 A;  5GAL A;  3RNS A;  2WBK A;  4AF9 A;  2VQA A;  4Z2W A;  3AZY A;  2JEN A;  3IDE A;  4XHB A;  2QZ3 A;  4YRD A;  1J1L A;  1VBE 3;  1LHN A;  1X7N A;  2AEZ A;  1YQ8 A;  2OPK A;  3OGV A;  3T2Q A;  1KS4 A;  4PQ9 A;  1FPN 2;  3WNO A;  1DQ1 A;  3OEA A;  4Y3O A;  2KM2 A;  3WP6 A;  4QMA A;  3VBF C;  5C5T A;  1G86 A;  1PGW 2;  5BUV A;  5KXC A;  1VBC 1;  1PGS A;  1OOP C;  3ON7 A;  3POE A;  2DCT A;  2HEW F;  4YW7 A;  3VN4 A;  1E5S A;  1KDK A;  2QQK A;  1UX7 A;  3U07 A;  2ZX2 A;  2YU1 A;  2WC2 A;  2D6O X;  3LKJ A;  4BYY A;  5J09 A;  3J4U H;  4CEW B;  1ZZ9 A;  3ACG A;  4QWN A;  1POV 1;  2H6B A;  3L9J T;  4P9J A;  1CX1 A;  5FRE A;  2VZT A;  4V2V A;  4IV1 A;  2QQN A;  4KQ7 A;  4HPK A;  2QZ2 A;  2RJ2 A;  2ZAB A;  4FPC A;  3O1T A;  1NCQ C;  2VZ3 A;  1BVP 1;  2W46 A;  4LHN A;  3C7G A;  4S2G A;  2FD8 A;  5KC6 A;  1E5H A;  1R1A 3;  1WBL A;  5FY8 A;  4QB6 A;  2Q1M A;  4GXL A;  3MW3 A;  3C7E A;  3AZW A;  2CWM A;  5BNN C;  4MXW B;  1GWM A;  2HWE 2;  1RMU 2;  2ZML A;  4RA0 A;  5FZO A;  4UOJ A;  4AI1 A;  2J1V A;  4QX8 A;  5KHH A;  1CAU B;  4LT5 A;  1VMH A;  4JV4 A;  4OHZ A;  4BDV B;  4NPM A;  1KEX A;  2FHR A;  4HT1 T;  2XOM A;  2AR6 A;  1C8M 2;  2ZGP A;  3OD0 A;  3I2F A;  5CKM A;  2YXS A;  5FZC A;  2FDK A;  3OUJ A;  1VMF A;  1PX4 A;  5DUW A;  1W0N A;  3VKL A;  4FSJ A;  3N7J A;  1QXP A;  5IVC A;  2PHU A;  1OH4 A;  5JIA A;  1IS5 A;  1SZB A;  1SPP B;  5T54 A;  1LOB A;  2JDN A;  2FBE A;  5AC9 2;  4IGQ A;  2A3Y A;  3VBO A;  4JGZ C;  1D4M 1;  5FMB A;  4EJR A;  4CDQ C;  1NQJ A;  2KD7 A;  1BYH A;  2ZAH A;  4R4X A;  5J1X A;  2ZGU A;  3D6E A;  4AI8 A;  4QB1 A;  3KHC A;  1MEC 3;  4KBB A;  5FDB A;  2XPJ A;  2VVF A;  3TBD A;  1ZNP A;  2PQS A;  2ARC A;  1FOD 3;  2EAK A;  3VD3 A;  5JLV A;  3J8F 3;  4P9X A;  5F3E A;  1UKG A;  1GR3 A;  3U10 A;  1AXY A;  1QJF A;  1GKB A;  3BYW A;  4DXR A;  3W5N A;  4BQY A;  3UJQ A;  5BNP C;  4Q4V 3;  5FYS A;  5K0U B;  5KWR A;  5F2W A;  5GLZ A;  2CGO A;  3AKP A;  5JOZ A;  3ME2 A;  1I3H A;  1AL0 G;  1ASJ 1;  2VM9 A;  2W5F A;  2WAA A;  3BPS A;  4CYD A;  1AZD A;  3KS7 A;  1HB1 A;  2AZ5 A;  2ADD A;  3VZL A;  2P17 A;  4KNC A;  3PUQ A;  5E8A A;  2GC3 A;  5LAS A;  4FFH A;  2HEV F;  4CDU C;  5BNO C;  2ZMK A;  2JG8 A;  4AHY A;  4Q1P A;  3VZO A;  5GLV A;  1JZ3 A;  4JAA A;  4I3G A;  4N9I A;  4QKF A;  1QGL A;  4O7X A;  4X8P A;  3G6J B;  2VUJ A;  3NMB A;  4QAW A;  4WV8 A;  1JTZ X;  1D0H A;  5KHJ A;  5LZ6 A;  4FO9 A;  4LUK A;  1IS6 A;  2QQI A;  1KGY A;  1OUX A;  1SDW A;  2XON A;  1OQE A;  4K3U A;  3ZXJ A;  2A3X A;  4QPG C;  2OA2 A;  5DUV A;  2PAK A;  1LTE A;  2BFU S;  3GZU C;  1IG0 A;  1MS8 A;  2ILM A;  1G9F A;  4M3C B;  3VBU A;  1GZC A;  4DXS A;  3ALQ A;  1GOH A;  4AQS A;  1HN1 A;  3I7D A;  2ZHL A;  4WM7 A;  2ZKL A;  4BIF A;  1H2N A;  2VE1 A;  4EV0 A;  3S7E A;  3O5S A;  4LUL A;  4M3C E;  5FYI A;  2WA4 A;  1JU3 A;  1GOG A;  2YMZ A;  1URX A;  2VNV A;  5T5L A;  4PHZ A;  4X8N A;  1NG0 A;  3A22 A;  2GN7 A;  1GQP A;  1ENS A;  1YI9 A;  3H1M A;  4L11 A;  4ZY9 A;  4D7T A;  5L19 A;  1S2K A;  3B69 A;  3POW A;  3ZSM A;  2HBT A;  3THT A;  2VNR A;  5C8C B;  3EHK A;  4K1Y A;  2BNM A;  3KQ4 B;  4PIZ A;  4CEW C;  3GBG A;  4HON A;  2YGL A;  4QM8 A;  3I54 A;  4J1X A;  4JCK A;  1W90 A;  1SBE A;  2K46 A;  3A0K A;  2PHW A;  2WT0 A;  1RUG 1;  2Y34 A;  5IFP A;  1AJO A;  1EYB A;  3VDB A;  1L7R A;  1FI2 A;  3W5M A;  1J59 A;  1QMJ A;  1T2X A;  5BPX A;  3VL8 A;  3D3A A;  5FZ0 A;  3UV9 A;  4FTE A;  1XU2 A;  4XZP A;  2VUD A;  2G9F A;  1PMH X;  3RZJ A;  1OF4 A;  1X33 A;  1EAH 1;  3KLS A;  5KHK A;  1RUC 2;  3GBW A;  3OD4 A;  5ERL A;  3N4M A;  1O91 A;  2RJL A;  5EYY A;  2BOI A;  4MGT A;  1ND2 C;  2W2I A;  4UI9 L;  1E5R A;  4Y1X A;  4CCJ A;  3UGG A;  4UFI A;  1SAC A;  4QPI B;  2JEC A;  3H50 A;  4LBN A;  5C4W B;  3OPZ A;  1H4G A;  3RDI A;  1COV 3;  4D7Y A;  1LHV A;  4LJH A;  1GZW B;  4ZU5 A;  3VDA A;  5FZ4 A;  4BQ1 A;  5GZG A;  1NZC A;  2P37 A;  4AVB A;  1DYK A;  2K2S A;  4PLO A;  4Q4X 3;  1AR9 3;  1LOA A;  1HV0 A;  2PTM A;  2IXK A;  3WG3 A;  3WNM A;  2GH2 A;  2ZHK A;  5CFD A;  5ANQ A;  4PCR A;  2XR4 A;  1UYP A;  1Z7S 2;  4YW2 A;  5FY9 A;  1WA4 A;  4QHO A;  4AK3 A;  1FMD 1;  4Y1Y A;  1VRH 3;  2KA3 A;  2WFF 1;  3POG A;  3WF3 A;  4DZG A;  3AP7 A;  3HWJ A;  1RGS A;  4UAP A;  5F6K A;  3FZ3 A;  4ONU A;  2DYC A;  2VVD A;  4F83 A;  4YVW B;  5BYN A;  1LNS A;  2J1R A;  2WNU A;  4NHL A;  1AF9 A;  5EZW A;  1EPW A;  2JDK A;  4LR4 A;  3JBG 3;  5F2S A;  5FMO S;  3E5X A;  2ZGM A;  4I0W B;  1QEX A;  4RS5 B;  3H8O A;  1C57 A;  5FV3 A;  5LWB A;  3GNE A;  3VBF A;  2YY1 A;  3FX3 A;  4LHK A;  1OI6 A;  4GKX A;  3NRU A;  4NHY A;  4UF0 A;  4BHP A;  4RD7 A;  2RR1 3;  5JUV A;  4HVQ A;  4HBN A;  2QDR A;  4BJ0 A;  5JR7 B;  1QJX 2;  1RTV A;  4ISQ A;  1SG3 A;  3SIS A;  5HV0 A;  1HX6 A;  4E4H A;  1YC6 1;  5JI9 A;  1JYX A;  2VQT A;  3AJZ A;  3MFA A;  2QFE A;  4HVO A;  2DBN A;  4WVM A;  3WUC A;  5KR7 A;  2BU9 A;  1AR8 3;  1GAN A;  1MS0 A;  1AUY A;  2BP6 A;  3ITQ A;  3PUR A;  2HWF 1;  1YO8 A;  5CU1 A;  2ES3 A;  4HMZ A;  1PIV 2;  2D6N A;  1YQ6 A;  1QJE A;  4Q27 A;  5FMC A;  3WP5 A;  2LTN A;  2VZ1 A;  5A7W A;  5M0T A;  4XBN A;  1I1E A;  4KWU A;  1ZBE 3;  2X09 A;  3E6C C;  3NL1 A;  4XJW A;  1SLT A;  2PXJ A;  5FZA A;  2RS3 3;  1TMF 1;  1HXS 3;  4UFL A;  3TB0 A;  3QCW A;  1W0P A;  4XF9 A;  2W1S A;  1QQP 2;  4I02 A;  4LK7 A;  3ROU A;  4XUR A;  3ZKU A;  4ASL A;  4B1M A;  5C8C C;  4G4F A;  1AR6 3;  3I2K A;  5IT6 A;  3Q8A A;  4JGY A;  4CU8 A;  1JMU B;  4NAM A;  3M4F A;  1QDO A;  2YFZ A;  2Q8C A;  2RG4 A;  4CDW A;  1BBT 3;  3B9I A;  5C3Q A;  2WZR 1;  2H0B A;  1H6Y A;  5I0T A;  1PO2 3;  1LUL A;  2NN8 A;  2Y6K A;  1X8E A;  3C7F A;  4D3W A;  3M3C A;  4FFG A;  2ZX1 A;  4KWJ A;  3VUO A;  4YW6 A;  1UY0 A;  4PDW B;  3FWE A;  5LAT A;  1VBC 2;  5FP7 A;  5LBE A;  4Z2A A;  2Y26 A;  4WVZ A;  2JKX A;  1DZT A;  3ZXA C;  2XDV A;  4Y1Z A;  5H9P A;  3WP4 A;  1KFX L;  4OFG A;  4Z92 B;  3KMH A;  2WNV C;  2NMO A;  1R1Z A;  2DU1 A;  4MGI E;  1AL2 1;  1RUF 2;  4PIX A;  3O1S A;  4P02 B;  5C9A B;  3NAP C;  3T2P A;  4QPI C;  2K9Z A;  5EP9 A;  2V4V A;  2HJI A;  1RUE 1;  1UIK A;  1W04 A;  3AXD A;  2UWA A;  4A3X A;  4WZF A;  1Q8O A;  4BLI A;  4FAH A;  5GZC A;  4LBK A;  3K77 A;  4MXV A;  4OZO A;  4LOR A;  2FCV A;  2ZEX A;  4EN8 B;  2HWC 1;  2QBX A;  1PVC 1;  4LO8 A;  5F32 A;  1IS4 A;  1W6P B;  3IN9 A;  2R0F A;  3M1H A;  4YGB A;  2E31 A;  1JYN A;  1RUJ 3;  4EWE A;  1UOF A;  2P3I A;  5JAX A;  5EFU A;  4YSF A;  1RUN A;  2CAU A;  3W58 A;  1WME A;  2R07 3;  3LSE A;  2YC2 A;  3I2I A;  5AFB A;  4ERO A;  1R08 2;  2BZD A;  4LXL A;  2PHT A;  1M4W A;  4M0H A;  2D44 A;  4N43 A;  4DY3 A;  4JHZ A;  2QQW A;  1ZZ6 A;  3CJI A;  3O1U A;  1HW5 A;  1CIW A;  4AI3 A;  4GKY A;  3N9O A;  1MZE A;  3USU A;  3WD5 A;  2FCT A;  2B4K A;  2P3K A;  3PUI A;  5FO8 B;  2VBD A;  5CG9 A;  2JDP A;  4MSV A;  3KCY A;  4YG3 A;  1IS3 A;  1UAI A;  4MGQ A;  3M3Q A;  4Q4W 3;  1WMX A;  4R4Z A;  3USS A;  1GBG A;  3TEZ A;  5IAV A;  4XAA A;  4FPG A;  2CTV A;  1EV1 3;  3ZIW A;  3KV9 A;  3CU7 A;  2XJQ A;  1QOO A;  2HWB 3;  2NQY A;  4KG8 A;  5A1L A;  3IPV B;  1W6Q B;  2CSG A;  3V56 A;  4Z8B A;  2YDE A;  4MGS A;  4LEJ A;  3WNN A;  4ZHN A;  3ZIX A;  3FE5 A;  2F6B A;  4AQ2 A;  1G9B A;  1K42 A;  2ZS6 B;  3ZMO A;  3LD8 A;  3OJB A;  5BNO B;  3O1R A;  4D6Q A;  5DQ0 A;  2XQR A;  3WG2 A;  1S0G A;  1QH7 A;  3RYR A;  4KWK A;  2Y6L A;  3B00 A;  3GBF A;  2Q4S A;  1VAV A;  1PK6 C;  4KH9 A;  4E4Z A;  5LRS A;  2BGP A;  4UW4 A;  3ZXG A;  3MV1 1;  1D7P M;  4UW3 A;  5DG2 A;  4K6B A;  4YZ2 A;  3POY A;  3LAG A;  2RMU 1;  1V0A A;  4AAX A;  2IVJ A;  1QNY A;  4LUM A;  4WZC A;  2ET7 A;  2HWD 3;  4RGK A;  1ASJ 2;  4MOA A;  1E5I A;  5A33 A;  1CAW A;  4Y26 A;  1ZZ7 A;  4Z07 A;  3OGS A;  3ZFG B;  4NRP A;  1Q8S A;  3OPT A;  1CAX B;  4IND A;  4OI2 A;  3SH3 A;  4LE4 A;  3KVA A;  2PQQ A;  1IPK A;  3AVS A;  2JE9 A;  4HK8 A;  4NIA A;  1BEV 1;  2CDO A;  1WW4 A;  1ULP A;  2V09 A;  1YFU A;  2JXA A;  1YIF A;  4YVS C;  3PU3 A;  4Y5Z 0;  5C3O A;  5D8A C;  5DG1 A;  3V65 A;  2WS9 3;  4HLT A;  1QJU 1;  4XFC A;  3G7D A;  1W8Z A;  1W2N A;  1DP0 A;  2DFC A;  4XFH A;  1RUD 1;  4B8E A;  1UL9 A;  1H1I A;  3PJY A;  3ST7 A;  3NJV A;  1MPX A;  1JUI A;  4GAL A;  3A21 A;  4N53 A;  3LA7 A;  3WQ1 A;  3LEI A;  5JSR A;  1SFN A;  3QD6 A;  1BK1 A;  2CGN A;  4FPY A;  4ITC A;  3DV8 A;  4XUP A;  3NKT A;  4H2A A;  1KS5 A;  3NV1 A;  2DCJ A;  3ELN A;  4XTM A;  5DAW A;  4COW A;  3FFZ A;  3KF5 A;  4COU A;  4ZU4 A;  2VW0 A;  4RQP C;  1QY4 A;  3O0X A;  4AEK A;  1O4Z A;  5I0D A;  2FDH A;  1CN1 A;  1NQD A;  4IEP A;  4FPL A;  1R64 A;  4Y1V A;  5I8T A;  3ZDS A;  3RWK X;  3AP5 A;  2PLV 3;  2OQ7 A;  5IVE A;  4ZXK A;  1ODM A;  4AED A;  2QUO A;  2WUH A;  2RS1 3;  1MQT A;  1LHO A;  3AKT A;  3NKG A;  4AG4 A;  2ZX3 A;  4CU7 A;  5FXZ A;  3ZFE C;  3OOX A;  1AYN 1;  1H8T A;  4OUM A;  4OHX A;  4XPV A;  5E88 A;  4LO6 B;  4IES A;  1H1M A;  1RUG 2;  2ZX4 A;  3UES A;  5AFE A;  4IW3 A;  1IKQ A;  4NOT A;  4RHV 3;  5DMY A;  3V0B A;  4CSW A;  4EE2 A;  2OPW A;  3MIG A;  4AEM A;  2ATF A;  2XJU A;  1NA1 A;  4V1P A;  3CZU A;  2OKX A;  1W6N B;  2QNK A;  2VEC A;  4QX3 A;  4CE8 A;  4AR2 A;  2VTX A;  4EQV A;  3OBT A;  3PU8 A;  4A7K A;  1EAH 2;  2Y64 A;  2V73 A;  4BK4 A;  3JB8 A;  2WN2 A;  1K45 A;  5CIR A;  3AP9 A;  2ZCW A;  5IVV A;  1Y4W A;  3MO4 A;  4FXK B;  1XYP A;  1XC6 A;  3GXU A;  2EIG A;  3OGR A;  2OZJ A;  3KWV A;  4GH4 A;  4Q4Y 3;  1CZT A;  1Y9Q A;  4NUB A;  2RM2 1;  4N9H A;  1DYP A;  3QH6 A;  4RFT 0;  1Q8Q A;  3FHA A;  4YG0 A;  1RJ7 A;  3VL9 A;  1VBB 2;  1I5Z A;  1ONA A;  4JHT A;  4MO3 M;  1V6K A;  5A7N A;  3KQR A;  4M4P A;  1OUS A;  2BPA 2;  5IAT A;  2VUA A;  1V6M A;  1JW6 A;  4YZ5 A;  4Q5O A;  1HIX A;  4EN9 B;  1QOS A;  1A78 A;  5JOY A;  2BGO A;  3QH7 A;  4BQW A;  3J7N A;  4NPL A;  3AYC A;  4OUS A;  3DUI A;  1FMD 2;  5HV4 A;  4CCC A;  5FY7 A;  2WFF 2;  3KD4 A;  3VDD B;  4YFW A;  5JZG C;  2ZGT A;  4H7M A;  3V64 A;  3TNQ A;  3POJ A;  1QH6 A;  2VNO A;  4LLF A;  2R1B A;  3I3D A;  2YV8 A;  3A0N A;  1K5M A;  4Y4R A;  2W91 A;  5D1I A;  4O9G A;  4KGG A;  3NJZ A;  5L7O B;  5DUX A;  1Y9G A;  2ZGL A;  3TYJ A;  4A42 A;  4NID A;  4CXY A;  3BU7 A;  3PNA A;  3OCP A;  4FXG B;  1B35 A;  3JUU A;  4YZ1 A;  1OHF A;  1FX5 A;  3AL5 A;  4IV3 C;  5BNQ A;  5FYC A;  5FUI A;  2AUY A;  4P9Y A;  1FPN 3;  5F37 A;  1S0I A;  1L7Q A;  4N53 C;  2Y6H A;  4S2D A;  5F5A A;  3VB9 A;  5F7U A;  3LDK A;  2R16 A;  1RL3 A;  1O3Q A;  3OUH A;  1YQ5 A;  5A6X A;  2A6Z A;  4FCA A;  5FZM A;  3AKQ A;  3N7L A;  3RG0 A;  1UU6 A;  4YWA A;  5KXB A;  2GP3 A;  2B5H A;  3NO8 A;  1LOC A;  4DXZ A;  3H3L A;  2DFB A;  4QQH A;  4DUV A;  1OOP A;  2XLA A;  3D4K A;  5ABJ B;  2A5Z A;  5FYB A;  5JPN B;  1HQN A;  3CHX A;  4DPN A;  2Q8D A;  1HRV 3;  4FP3 A;  3VGI A;  1XNA A;  2WSV A;  2V72 A;  2LUW A;  5EJZ B;  2VMH A;  3VBR B;  4IGO A;  2DU0 A;  2XVG A;  3DYP A;  2QE3 A;  3RMX A;  1CQ9 A;  4AED C;  1V9U 3;  3HJR A;  2WAB A;  3HT1 A;  1YQ2 A;  3ES4 A;  3AC0 A;  5C3R A;  1BJQ A;  4Q1R A;  1LAJ A;  2EXI A;  5A32 B;  3B3Q E;  3WSO A;  1XBF A;  1AR7 2;  2VY0 A;  1UIJ A;  1S0J A;  3FLT A;  3OBR A;  2X8K A;  2RJK A;  5HPO A;  1UOG A;  2A6V A;  5C3P A;  2XGX A;  1NCQ A;  4GA9 A;  4R9A A;  3P3N A;  3VV1 A;  5ACA 1;  2CHH A;  5C33 A;  1YJK A;  1UO9 A;  3LZZ A;  3PIJ A;  4CUG A;  2WZR 2;  3O12 A;  2ZX0 A;  3OYW A;  1LOF C;  2K0G A;  4NE9 A;  4I09 A;  1WBF A;  3KM5 A;  3M2M A;  1S55 A;  2XH6 A;  2ZOE B;  4ZS3 A;  3WF4 A;  3V0A B;  4LBQ B;  1XYN A;  3AMP A;  3INA A;  5DZG A;  1C8M 3;  3JCI A;  5BV6 A;  3T0B A;  5FO9 B;  3S57 A;  4GH4 C;  2VBB A;  2JB4 A;  3CO2 A;  1CX4 A;  2X5I C;  2NYY A;  1VLN A;  2XVK A;  4MET A;  4XMA A;  4OQ8 A;  4IER A;  3VZK A;  1ZBA 3;  1RJ8 A;  1WMD A;  2RE9 A;  2Y0I A;  1C3H A;  1RUE 2;  3C2U A;  4COY A;  4GWM A;  2RDQ A;  2PN5 A;  4Q4V 1;  1NYW A;  1WW6 A;  2D6M A;  2HWC 2;  1PVC 2;  4X6R B;  4XFB A;  3DKQ A;  1OQD A;  3H3U A;  5FP4 A;  3WNP A;  1ZRE A;  4LOS A;  5T55 A;  3KCX A;  4CDQ A;  1PO1 3;  2W1U A;  1V6L A;  1QJZ A;  1F2N A;  1OFS A;  4FFF A;  3RZG A;  1N47 A;  1EP0 A;  5LK5 A;  3ZYH A;  2GZW A;  5T5O A;  1JHN A;  3BUC A;  3KV5 A;  1OT5 A;  4NHM A;  1O8S A;  2R49 A;  4BIS A;  3MF9 A;  3W21 A;  2W47 A;  5BNP A;  1WLT A;  1WCD J;  1D4V B;  2BWA A;  1K5M C;  1ND3 B;  3I59 B;  3A4U A;  4JKL A;  3VD9 A;  4JQT A;  3WF2 A;  4HSJ A;  3VLB B;  2BVV A;  1OLQ A;  4CUC A;  2YPD A;  5J96 B;  1CAV A;  5B4X A;  3WQ7 A;  1JYC A;  2CY6 A;  2E6V A;  2O1Q A;  2RDN A;  4YW3 A;  3IBM A;  3HNB M;  5FZL A;  3ZXD A;  3FLR A;  4TLG A;  1IPJ A;  2HKX A;  1CVN A;  1MS9 A;  1QQP 1;  1OVP A;  1LKN A;  2XKO A;  1VBA 3;  3VBS C;  4CDU A;  5BNO A;  5I8Y A;  2ZAC A;  4UW6 A;  1EUU A;  4ATE A;  2B46 X;  4CDX C;  1O3R A;  3LCP A;  3K3O A;  4PI2 A;  5FIX A;  4FPJ A;  2AGS A;  5JSP A;  2DCK A;  3M7A A;  1PNF A;  2BDR A;  1U5Z A;  2OXB A;  4C0H A;  3F2Z A;  3BKZ A;  4OVE A;  2UWB A;  2D97 A;  1POV 0;  3DPR B;  3ZSE A;  4CXX A;  2BOJ A;  4QPG A;  2FMY A;  3ZPO A;  5FZI A;  3DL3 A;  5I0U A;  1W9T A;  1DDL A;  4G9S B;  1IKP A;  2EVX A;  5FK8 A;  1ULD A;  4HVR A;  3WQB A;  4Z82 A;  2RMU 2;  4BXF A;  1Y3T A;  1N3P A;  4JTO A;  5FJH A;  3EMR A;  2H6C A;  1BK0 A;  4JKK A;  4NMI A;  3U1X A;  1RUF 1;  1UY3 A;  3PUS A;  1QWR A;  3K75 B;  1W8W A;  2BV4 A;  4GMP 1;  4YNI A;  2ZGN A;  1V70 A;  4I30 A;  5J36 A;  3H7J A;  2WRA A;  1OXC A;  3ETP A;  1BKZ A;  3IKW A;  3P6B A;  2J1E A;  2IUW A;  3PMS A;  3GDB A;  5GZD A;  1BEV 2;  3CL1 A;  3NNF A;  4NO4 A;  5E16 A;  4BZ4 A;  5FXX A;  5CAD A;  2VQ0 A;  2W3J A;  4CEW A;  4NWV A;  2N7G A;  4M4R A;  3T4V A;  1ZRR A;  1GLH A;  1XYO A;  3FL7 A;  1QJU 2;  1WD3 A;  3D8C A;  1RB8 G;  3DXU A;  2DCZ A;  4K8F A;  2QTW B;  1RUD 2;  3B93 A;  4A2U A;  1DF0 A;  4IV1 B;  4CUA A;  1R08 1;  1W6M B;  2XML A;  2Z2S B;  2QDN A;  3PDQ A;  3QOP A;  4RGG A;  3VBH C;  4LQR A;  1V6O A;  1BVV A;  1RUC 3;  1GSL A;  2P3Y A;  1RUI 1;  1VBD 3;  2JIJ A;  1C8N A;  1DLC A;  1UOB A;  4FOW A;  2XXZ A;  4KMQ A;  3K4D A;  2L9L A;  1XE7 A;  3U37 A;  5LEJ A;  4X6Q B;  5A3W A;  4BM8 A;  1RHI 2;  3NW4 A;  4TZD A;  2CL2 A;  1X9T A;  4C0B A;  3H3Z A;  4OUE A;  5FOB B;  1ND2 A;  5L9R A;  5FZO B;  2RHP A;  3WV6 A;  4AED B;  2XJR A;  5FPL A;  1P8J A;  4IQP A;  4LPL A;  1ULE A;  2YHJ A;  2WYF A;  3LB9 A;  1XSR A;  5FZ9 A;  2MEV 2;  2JE8 A;  3DYM A;  1AHS A;  4P08 A;  3RSJ A;  2B9U A;  4QDQ A;  1LHW A;  1UKR A;  3LDB A;  4URT A;  2I07 B;  1NUK A;  1W8U A;  1YFX A;  2RS5 3;  3PIG A;  4A41 A;  4EZH A;  2DVD A;  3PUH A;  4FP2 A;  4FPH A;  2FQP A;  3MID A;  1AYN 2;  4P9G A;  5FYZ A;  3GHM A;  4AI2 A;  3KT1 A;  5L9V A;  3WOG A;  1PHM A;  2DUO A;  1XQN A;  4JRL A;  2VMF A;  4NHX A;  1PZ7 A;  5FP8 A;  1NCR C;  1RXG A;  4XF1 A;  4XXP A;  3S30 A;  3KV6 A;  2D40 A;  1WCS A;  1YYN A;  1S2B A;  4JDM A;  1W2T A;  3JBG 1;  4XFF A;  3HBZ A;  4B7K A;  5CZK A;  3RZL A;  3CF6 E;  4A6S A;  2JG9 B;  1VRB A;  3R4U A;  5A7P A;  5L9B A;  1BCX A;  2VGD A;  3KCC A;  4YGE A;  1XND A;  1KJR A;  4QHB A;  1K5J A;  1H2K A;  3RS6 A;  1UXZ A;  3H8X A;  3GM8 A;  5FWJ A;  5LA2 A;  1YFY A;  2RM2 2;  3MUZ 1;  3W20 A;  4B4P A;  5KC5 A;  4XE9 A;  4BXS V;  1QJX 3;  4CEY C;  4QDS A;  2EAL A;  2XHK A;  1AR8 1;  1V6I A;  1W39 A;  3VKO A;  3K4A A;  5HXM A;  1F5J A;  4AEJ A;  1EY2 A;  2I45 A;  4IET A;  4XMI A;  3QAC A;  2VCA A;  1ENX A;  3KGZ A;  1BQP A;  4OYU A;  3WDW A;  4AGG A;  4XBQ A;  2F4L A;  3UNP A;  3CJX A;  2DF7 A;  4I01 A;  4R9D A;  3EYP A;  4AVV A;  1DU3 D;  4Y1U A;  4DMI A;  5H9R A;  1XOY A;  3ZYB A;  1E57 A;  1ZYB A;  5DPN A;  3E5Q A;  3WNK A;  2RS3 1;  4AQT A;  1OA2 A;  4MAD A;  3B01 A;  4M3C A;  3ZKY A;  3PVN A;  3WNL A;  3RZK A;  2FZ2 A;  2WIN B;  2C9A A;  4QM9 A;  1GU3 A;  4YZ4 A;  1AR6 1;  2IVI B;  5C6C A;  4V2W A;  2VZV A;  3DGT A;  1VBE 2;  3JD7 3;  4WM7 B;  1UZW A;  5EXO A;  2YU2 A;  4QX5 A;  2A73 B;  2Q1Z B;  2ZPX A;  1BBT 1;  1DHK B;  1X82 A;  3CMG A;  4BA6 A;  1PO2 1;  1W0O A;  4K8R B;  3ACL A;  2XVL A;  4M00 A;  4SLI A;  4XHX A;  1HLC A;  4O9E A;  4CCL A;  1ENR A;  2QCS B;  4MVT A;  3ZO0 B;  1JN2 P;  2EA7 A;  3B9C A;  4TSV A;  3WIN E;  4E2Q A;  5C8C A;  4XYX A;  1YEW A;  1JZ5 A;  4DIQ A;  2VXR A;  4LKS A;  4I0A A;  4Y22 B;  2JIC A;  4GWJ A;  1DGW X;  1S4C A;  5EQU A;  2W95 A;  1J83 A;  4BQ5 A;  3VD7 A;  4ES9 A;  4QHZ A;  1JS9 A;  5FYU A;  1A3K A;  4NWW A;  3EB7 A;  1XNB A;  1GNY A;  3OPW A;  5LA0 A;  1PGL 1;  3E6B A;  4Q0P A;  2ZXQ A;  3ZYR A;  1RXF A;  5JXI A;  2WN3 A;  4TYS A;  1YIP A;  2XJP A;  4LKD A;  4QQO A;  3HMY A;  4AZZ A;  5BY5 A;  2FCU A;  5FY1 A;  3VZN A;  2D3P A;  1POV 3;  1RIN A;  2WNV A;  3BCW A;  5K4L A;  1WLD A;  3HN3 A;  4GJY A;  1FNY A;  2NM1 A;  1UPS A;  2WII B;  5DN2 A;  3NAP A;  2GND A;  1VBB 1;  2UUR A;  1SLI A;  4QPI A;  1DGR N;  5KBF A;  2OII A;  4HN0 A;  3GAL A;  3DKW A;  3K2O A;  3ZXE A;  4A3Z A;  3POF A;  5A80 A;  3LOB A;  2B45 X;  4D8M A;  3AK0 A;  1SLA A;  3HN1 A;  4DRR A;  5DAX A;  5E1R A;  2ID4 A;  2D6L X;  2ZKN A;  3AJY A;  4CCE A;  2YB7 A;  5LBF A;  5ACA 2;  2B7Y A;  5CFC B;  3U0Z A;  1LOG A;  1Z0H A;  2EAA A;  1JHJ A;  3WLU A;  2B39 A;  1NY7 1;  5IK8 A;  2DDU A;  3AP4 A;  1JYW A;  4M01 A;  2R7E B;  2RDR A;  5F5C A;  2XJT A;  4AI9 A;  1UQX A;  4QKD A;  4BB3 A;  4UFM A;  5FK7 A;  5K0U C;  3BTY A;  1Y7B A;  1XPW A;  2GC1 A;  3BGA A;  2A71 A;  2JDY A;  4LKE A;  3GGL A;  4FAG A;  2VU9 A;  2UWC A;  5CFD B;  1R09 3;  4RGA A;  3DN7 A;  2JG9 C;  5ANN A;  3KT4 A;  3ES1 A;  3MV0 1;  4IEX A;  4P14 A;  1MEC 2;  1CWP A;  3AFG A;  2ZEY A;  4CP2 A;  3AMQ A;  4LIV A;  3S5Q A;  4NAO A;  1VAM A;  1D4M 3;  4CU6 A;  1N3Q A;  1UW8 A;  1LHU A;  5I91 A;  2WNU B;  5FQ0 B;  1SHW B;  4Q4V 2;  1W2A X;  3WZ1 A;  2VZP A;  3HOB A;  4QDR A;  1W3V A;  5FUN A;  3J26 N;  3H1W A;  4CUB A;  1S0B A;  5KHG A;  4XQW A;  2A6X A;  3D0J A;  2WO1 A;  3VBF B;  4ATF A;  2OUJ A;  1N1T A;  5JPM B;  5FYM A;  4UF0 B;  1PK6 A;  5CVR A;  2PYT A;  3WQ0 A;  5CA6 A;  2ORZ A;  4GWI A;  3AYE A;  2ZGR A;  3AX4 A;  3ZSJ A;  2W87 A;  1MZF A;  3RQ0 A;  3BI3 A;  1NLR A;  1A6C A;  1VB2 A;  3WHU A;  2VD7 A;  1GP4 A;  5I8S A;  2GC0 A;  4CPB D;  1V6J A;  2WS9 1;  3M3O A;  4WVM B;  1SLB A;  3DF0 A;  3WUD A;  4GQ7 A;  2KR2 A;  5FXV A;  2E7A A;  5A1A A;  1ZZ8 A;  2XWB B;  1SLL A;  3EQE A;  3HBK A;  3P5B A;  4JVA A;  4YW4 A;  1W2U A;  2XQX A;  5FKC A;  5B2G B;  1AR7 1;  4PF5 A;  5HXV A;  1SFY A;  2ENR A;  4CZS A;  5A7W B;  2DBI A;  1G6N A;  4NJ4 A;  4NVP A;  4YVS A;  3RGB A;  3P3P A;  5KXD A;  3HD8 B;  5D8A A;  2CDP A;  2D5F A;  4HAN A;  3UJO A;  1POQ A;  3E97 A;  3FBM A;  4XF3 A;  1J84 A;  5FPV A;  1J3Q A;  4DOU A;  2Z42 A;  3AKS A;  1A8M A;  5FRA A;  3OY8 A;  5FZB A;  4CA9 A;  2YPJ A;  1UY4 A;  4JGY B;  3DEC A;  2XBO 3;  5F5I A;  1OPM A;  2CWS A;  3SMH A;  4MHR A;  4TXW A;  4CDW B;  1LOE A;  4Y5T A;  3KB5 A;  4AFA A;  4F7Z A;  4QQ2 A;  2W08 A;  1ZRI A;  3N9N A;  3AVR A;  3S5A A;  2DVA A;  1S0C A;  1NXM A;  2E26 A;  4OMD A;  4RQP A;  4K21 A;  1FAT A;  2GC2 A;  4RHV 1;  4BH9 A;  1W3X A;  2FZ1 A;  5C4W C;  3NJY A;  5E6H A;  3TRS B;  2RDS A;  4UFK A;  2EIE A;  2F4P A;  1C1F A;  2R30 A;  1GWK A;  1RUG 3;  1XB9 A;  2LAL A;  4FTB A;  4XXA A;  4ARY A;  4BQ3 A;  3A7Q A;  3NNG A;  4FPE A;  1QNW A;  3ZFE A;  2A75 A;  4RR3 B;  2B9V A;  4IE5 A;  1MS1 A;  2V4A A;  3WW4 A;  1JOB A;  3IZO A;  4IGP A;  3U14 A;  5IK7 A;  1H4H A;  2R04 1;  2XL7 A;  3VKN A;  5F39 A;  2YUE A;  4CTE A;  1RUI 2;  1CPN A;  4Q4Y 1;  4DEQ A;  1NZI A;  2WWU A;  3THC A;  1COV 2;  3GYD A;  2ZMN A;  3M8L A;  1HJF A;  2JDM A;  3PTY A;  4GB3 1;  2EXH A;  2XJS A;  4QQP A;  3D0S A;  4IL7 A;  3WP3 A;  4LO5 B;  1D2Q A;  1YUD A;  4N43 B;  4JC1 A;  3OGG A;  4FPF A;  4CCM A;  1LRH A;  3CJI B;  3S7I A;  4YVW C;  4W8J A;  2XWJ B;  5DAP A;  5FP3 A;  2YFU A;  2QVS B;  4A4A A;  2IXL A;  1FV2 A;  2IFW A;  1FNZ A;  1GUI A;  4RS5 C;  1XE8 A;  3N3H A;  5SV5 A;  1ULG A;  2Y33 A;  1JBC A;  3MIC A;  2HBU A;  3FHI B;  2FDG A;  1SDD B;  2WT1 A;  3T1M A;  1TE1 B;  2PHX A;  4AGV A;  1VRH 2;  2QQP A;  1W6Q A;  4XBL A;  2QKD A;  2KXL A;  3LPF A;  4XUN A;  3RJ2 X;  1F9K A;  3FUO A;  1G9A A;  3ZFF B;  5I0S A;  1FYU A;  2D7F A;  1A8D A;  4LO4 B;  4I3P A;  2WFF 3;  4KWL A;  5I0R A;  1WUV A;  3N9L A;  4PF1 A;  4E4D X;  3JBG 2;  4XET A;  1JYI A;  2G9Z A;  2LS6 A;  3VD5 A;  3TN9 3;  5T3N A;  3MF6 A;  4MLO A;  2BFU L;  3SEE A;  3B5L B;  5IWF A;  5JZG A;  4BK5 A;  4XQD A;  5F1R A;  4GD4 A;  5IVF A;  5FLH A;  2RR1 2;  3RI8 A;  3ZXK A;  1AYM 3;  3ACI A;  3B02 A;  2P4E A;  5I93 A;  5FLI A;  1GQG A;  4Y5S A;  1SFP A;  2R06 1;  2BBA A;  1PZ9 A;  2DWR A;  4N7I A;  2J7M A;  5A33 B;  4Y20 A;  1CAW B;  5G05 L;  2A7A A;  2WNO A;  2NPI A;  4LKF A;  5K9Y A;  2BTV C;  2O8Q A;  1DFQ A;  2VZS A;  1AR8 2;  1JI6 A;  4OHV A;  3FLP A;  1WA6 X;  5JI7 A;  5A3N A;  5LA1 A;  2TNF A;  3Q8B A;  1DLL A;  4IV3 A;  3ASI A;  4GJZ A;  4WVW A;  3NV2 A;  3IT8 A;  4L92 A;  4JDO A;  3RFR A;  4A6O A;  2ZEZ A;  3WF1 A;  3RI9 A;  2TUN A;  4K9S A;  4KBZ A;  3LFI A;  4NIH A;  1WZX A;  2ARB A;  5IUQ A;  3H7Y A;  1ZBE 2;  3S0M A;  2P6C A;  1S1A A;  2HWF 3;  1YNA A;  2DUQ A;  2E32 A;  3HVD A;  1RHI 1;  3N9M A;  3ZN4 A;  4BWO A;  4ZKT B;  3CQO A;  1XXN A;  4R8H A;  2XUE A;  2RS3 2;  3AZV A;  3KV4 A;  1SCR A;  4PDW C;  2OX0 A;  1HXS 2;  3UKV A;  3AL6 A;  5A7S A;  3MI8 A;  5IW0 A;  4BIO A;  2P5B A;  3DYO A;  4UFJ A;  3UGH A;  2VMC A;  1HRI 3;  2C24 A;  2AC1 A;  4QXK A;  4NIG A;  1IGO A;  3BIW E;  1AR6 2;  3LE0 A;  2VL4 A;  1HB4 A;  5J3U A;  5DDJ 1;  1TMF 3;  1MAC A;  1TME 1;  2MEV 1;  5FZE A;  4ET7 A;  3U4S A;  5C9A C;  3O1P A;  3WX5 A;  1BBT 2;  4GAZ A;  1J1T A;  4FBF A;  1PO2 2;  1B09 A;  2Y60 A;  4CVU A;  5FXW A;  2VJX A;  1H9W A;  4LMF A;  3SH4 A;  5C5U A;  1QJY 1;  1UZV A;  2WZR 3;  3CIH A;  1MZ5 A;  4D6R A;  4AL9 A;  1N1S A;  1W99 A;  4YG6 A;  3AXE A;  5FZ1 A;  2V5D A;  2YRO A;  1GMM A;  5FPB A;  4XFI A;  1UCX A;  3F95 A;  4IEU A;  4ISR A;  1RUH 1;  1H8T B;  1LOF A;  1Y9M A;  4CP9 B;  4WM8 B;  3GJA A;  3SCF A;  1OFN A;  1ZBA 1;  2AYH A;  1PGL 2;  3S6P A;  1RVF 1;  3T2O A;  3N7M A;  1WGP A;  1NA1 B;  1AL2 3;  1H1A A;  1H9P A;  3AM2 A;  4JZR A;  2VME A;  3NNL A;  2X5I A;  3QLQ A;  2VOX A;  5A3T A;  2WLQ A;  5LK7 B;  2JE7 A;  4CCD A;  3CDZ B;  4LLO A;  4CP0 A;  2C4X A;  4NR1 A;  1O5U A;  3IWZ A;  2E7Q A;  1OKO A;  5C3S A;  3OB8 A;  2GAU A;  3ILR A;  1DQ2 A;  3ZM8 A;  1OF3 A;  3D82 A;  3EXU A;  3OBA A;  5FMO L;  4AVT A;  3ZSK A;  2E51 A;  2Z69 A;  2J22 A;  1RIT A;  5FYY A;  2WWJ A;  1BZW A;  3N35 A;  2PA7 A;  5FP9 A;  1NOV A;  3ZYG A;  4Q4W 2;  3WVJ A;  3Q8C A;  1T6G C;  4QQL A;  4PIY A;  5LA9 A;  1NY7 2;  3ETQ A;  3OEB A;  3UT0 A;  3I8T A;  3GHN A;  4XC9 A;  3PTR B;  1VBA 1;  2ET1 A;  2H0V A;  2G4I A;  2QQM A;  3LEG A;  2ZGQ A;  5FCC A;  2D6K A;  2A6Y A;  2MPF A;  1VBE 1;  4AFC A;  3ZFG C;  4KI5 M;  3ATG A;  4XAC A;  5L73 A;  3H8U A; 
#chains in the Genus database with same CATH homology
 3CZJ A;  3P6B A;  3C7O A;  2J1E A;  3GDB A;  5G04 L;  2W3J A;  2VZR A;  4M4R A;  3FL7 A;  2VZU A;  2Y6G A;  3VDA A;  2ZEW A;  3HNM A;  4CUA A;  4LQR A;  2JDA A;  3WNM A;  1DLC A;  2X10 A;  4L0P A;  2VTF A;  4KMQ A;  3K4D A;  2L9L A;  2J1A A;  3K46 A;  3U37 A;  4XUO A;  4DUX A;  3WF3 A;  3IAP A;  1WCQ A;  3BN6 A;  4OUE A;  4UAP A;  4FI9 A;  2RVA A;  1P8J A;  4LPL A;  1LNS A;  2J1R A;  2JE8 A;  3DYM A;  4P08 A;  3MBW A;  4QDQ A;  2VZQ A;  3WEZ A;  1NUK A;  2EIC A;  4ZZ8 A;  1W9S A;  4A41 A;  3PUH A;  3P1I A;  3NRU A;  4E8D A;  2WZE A;  5JUV A;  4P00 B;  4BJ0 A;  2VMF A;  4XUT A;  1SG3 A;  1US3 A;  3I97 A;  4DEV A;  1JYX A;  2J1T A;  4CU9 A;  2VQT A;  4PQQ A;  5CZK A;  2QQL A;  1JZ2 A;  3NJX A;  2WYS A;  5EIY B;  3SKJ E;  1CZS A;  4YPJ A;  4P5Y A;  2VZ1 A;  1UYY A;  1UXZ A;  4KWU A;  2X09 A;  3GM8 A;  1UYZ A;  3J7H A;  5LA2 A;  3MUZ 1;  4BXS V;  1PX3 A;  1UMI A;  4QDS A;  1H6X A;  1PMJ X;  2W1S A;  3K4A A;  5HXM A;  1JU4 A;  4RN5 A;  4XUR A;  3T0D A;  2VCA A;  3I2K A;  4OYU A;  1UZ0 A;  3UNP A;  4CU8 A;  3I2J A;  4XVH A;  1UY2 A;  2YFZ A;  3EYP A;  1TVG A;  1H6Y A;  4E8C A;  4HG6 B;  5DPN A;  5C7G A;  2Y6K A;  3WNK A;  2JD9 A;  3C7F A;  4MAD A;  3WNL A;  1UY0 A;  1GU3 A;  4Z2A A;  4QB2 A;  2JKX A;  2VZV A;  3K4Z A;  3CMG A;  4P02 B;  2ORX A;  4QX0 A;  3T2P A;  1DYO A;  2V4V A;  1O59 A;  4W4Z A;  3K77 A;  4OZO A;  2HLE A;  5C71 A;  2ZEX A;  1JZ5 A;  2QBX A;  4LKS A;  1JYN A;  2Y6J A;  4GWJ A;  2E31 A;  4IUG A;  2W95 A;  2WQ8 A;  1J83 A;  2EIB A;  2Y8K A;  5CYY A;  3VD7 A;  2YC2 A;  3I2I A;  3EB7 A;  2WO2 A;  1GNY A;  2BZD A;  5LA0 A;  2ZXQ A;  4JHZ A;  5JXI A;  2VO5 A;  2WN3 A;  3CKH A;  1BHG A;  2B4K A;  3PUI A;  2C26 A;  1F4H A;  4MGQ A;  3HN3 A;  2W1W A;  5DN2 A;  1JZ7 A;  1UWW A;  1TG7 A;  4ZZ5 A;  2WAO A;  4A3Z A;  2VQU A;  4MGS A;  4QX1 A;  3WNN A;  4D8M A;  1K42 A;  4DUW A;  2QQJ A;  2ID4 A;  1ULO A;  2VR4 A;  2YB7 A;  3I3E A;  5DQ0 A;  3III A;  2C9K A;  3SEP A;  2Y6L A;  1JHJ A;  4LHS A;  3VDC A;  2DDU A;  1JYW A;  2R7E B;  3VD4 A;  2BGP A;  3NQH A;  2WDB A;  3MV1 1;  1OD3 A;  1D7P M;  1XPW A;  3BGA A;  1O8P A;  3GGL A;  3T0A A;  4AAX A;  2VCB A;  4MOA A;  1US2 A;  3MV0 1;  2Z4F A;  3OGS A;  2ZEY A;  5LCW L;  3C8X A;  4CU6 A;  4TTG A;  3JXS A;  2CDO A;  1ULP A;  1SHW B;  2VZP A;  3HOB A;  4QDR A;  1UXX X;  1W8N A;  4CUB A;  2EID A;  2RV9 A;  2WO1 A;  2YG0 A;  1DP0 A;  3MUY 1;  2X05 A;  2QQO A;  3OG2 A;  5JMO A;  3A23 A;  2ORZ A;  3NJV A;  1MPX A;  4GWI A;  3I2G A;  3IB3 A;  3A21 A;  4QPW A;  2W87 A;  4JX0 A;  3LEI A;  4XUP A;  1CIY A;  2DCJ A;  3T08 A;  2W92 A;  1W9W A;  3ACF A;  3ECQ A;  1NKG A;  5A1A A;  2HYX A;  5I0D A;  2XQX A;  5IJR A;  1R64 A;  4W50 A;  4QX2 A;  5JR2 A;  4PT6 A;  4A45 A;  4DXR A;  2WUH A;  2CDP A;  4AG4 A;  4D0Q A;  4CU7 A;  1NX9 A;  1IQD C;  1J84 A;  3I2H A;  3UES A;  5DMY A;  2W1Q A;  2OKX A;  3CZU A;  4QX3 A;  1UY4 A;  3DEC A;  3HPN A;  1JZ4 A;  4TXW A;  2J1S A;  2Y64 A;  4BK4 A;  2WN2 A;  1K45 A;  2VZO A;  2VC9 A;  2E26 A;  5JXH A;  1F4A A;  3HEI A;  3MO4 A;  4OMD A;  1I5P A;  1XC6 A;  3GXU A;  3OGR A;  1CZT A;  2YC4 A;  1JYV A;  3SKV A;  2EIE A;  1EUT A;  1RYY A;  1K12 A;  4GZ9 A;  2E33 A;  4ARY A;  3FHA A;  2VMD A;  3HNY M;  3A7Q A;  4MO3 M;  3NNG A;  1XNT A;  4M4P A;  3IDA A;  2B9V A;  2WBK A;  1JZ8 A;  2BGO A;  4DEQ A;  3OGV A;  3T2Q A;  3THC A;  3WNO A;  3OEA A;  3FHQ A;  3I3D A;  4W8J A;  1W8O A;  2QQK A;  2W91 A;  2YFU A;  4A4A A;  1UX7 A;  5C70 A;  1GUI A;  1GOF A;  3THD A;  4A42 A;  5JXJ A;  3ACG A;  1SDD B;  1JZ6 A;  1CX1 A;  2VZT A;  3E1F 1;  2QQN A;  4XZU G;  4OMC A;  3LPF A;  4XUN A;  5FUI A;  1CZV A;  2RJ2 A;  5B4N A;  2VZ3 A;  5IYY A;  1L7Q A;  2Y6H A;  2W46 A;  3T09 A;  3C7G A;  5F7U A;  4PF1 A;  2LS6 A;  3VD5 A;  4QB6 A;  3C7E A;  3SEE A;  4RYD A;  4BK5 A;  4UOJ A;  3ACH A;  2J1V A;  4DUV A;  3ACI A;  1K3I A;  4DXT A;  4JKM A;  1XNA A;  2WO3 A;  2V72 A;  4BDV B;  5EJZ B;  2BBA A;  1KEX A;  2XOM A;  1UMH A;  2J7M A;  3I2F A;  3DYP A;  5G05 L;  1PX4 A;  3HJR A;  1W0N A;  2WAB A;  1YQ2 A;  3AC0 A;  2VZS A;  1JI6 A;  1OH4 A;  5LA1 A;  3WSO A;  4A6O A;  5HPO A;  3IAQ A;  2ZEZ A;  3WF1 A;  2KD7 A;  5J1X A;  2WZ8 A;  2XHN A;  4QB1 A;  2E32 A;  1WKY A;  2PQS A;  3CQO A;  4ARX A;  3VD3 A;  3WF4 A;  3W5N A;  3DYO A;  5IHR A;  2VMC A;  3I3B A;  3LE0 A;  2VL4 A;  3T0B A;  2VM9 A;  2W5F A;  3FN9 A;  2WAA A;  3LQC A;  4ET7 A;  1UY1 A;  2LW8 A;  2VCC A;  4CVU A;  3C7H A;  4A44 A;  5JXG A;  5IFT A;  1UYX A;  2VJX A;  1JZ3 A;  2W94 A;  3CIH A;  3LEK A;  1W99 A;  3WNP A;  4QAW A;  2W1U A;  2V5D A;  1GMM A;  2QQI A;  1KGY A;  2XON A;  2BER A;  1OT5 A;  2W9X A;  3WF0 A;  1O8S A;  4DXS A;  3T2O A;  1GOH A;  2W47 A;  2J1U A;  1HN1 A;  4JKL A;  3VD9 A;  2VOT A;  3WF2 A;  2VME A;  4CUC A;  1JU3 A;  1GOG A;  3CDZ B;  5B4X A;  3HNB M;  3A22 A;  1GQP A;  1NAE A;  2C4X A;  4ZY9 A;  3OB8 A;  3UET A;  3ZM8 A;  1OF3 A;  3OBA A;  3ABZ A;  1EUU A;  2J22 A;  2DCK A;  4XUQ A;  3F2Z A;  3OEB A;  5IFP A;  3VDB A;  1L7R A;  1W9T A;  3W5M A;  1T2X A;  3D3A A;  3WQB A;  2QQM A;  1PMH X;  3LEG A;  1OF4 A;  5EJ1 B;  4JKK A;  4ZXE A;  4KI5 M;  3LPG A;  1UY3 A;  3K75 B;  4UI9 L;  3ETP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...