2Y6KA

Xylotetraose bound to x-2 engineered mutated cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
b'LVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSLDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE
molecule tags Hydrolase
source organism Rhodothermus marinus
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
total genus 43
structure length 165
sequence length 165
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y6kA00
1JU3A 2J22A 3T0AA 2YFUA 5JXIA 1ULOA 3WNMA 2VTFA 4GZ9A 1K3IA 4A42A 4OMCA 3ECQA 2QQJA 1JZ4A 1XPWA 1HN1A 2JD9A 3DYOA 3MUZ1 1PX4A 5G05L 3WEZA 4QB6A 4A6OA 4QX0A 4QPWA 3I2GA 3WNNA 4W4ZA 4KI5M 1KEXA 2YG0A 5HXMA 3ETPA 3T2PA 5DMYA 4DEVA 2Z4FA 3I2IA 2ZXQA 3FL7A 3OG2A 2EIBA 2W91A 2VC9A 1PMHX 1JZ3A 4BXSV 2W47A 4A41A 3K4ZA 2XOMA 4QX1A 3CZUA 4PF1A 1UWWA 4L0PA 4ARXA 5DN2A 2J7MA 4MGQA 4MGSA 4DUXA 3JXSA 5LA1A 3A23A 3ACHA 2WZEA 1UYZA 3OBAA 3GXUA 2JDAA 3OGVA 5C71A 3I2KA 1DP0A 2V72A 5CYYA 1UY4A 3UESA 4OYUA 4P00B 3E1F1 2W5FA 4M4PA 1SG3A 1IQDC 4OMDA 4UOJA 1UXXX 1DLCA 2JE8A 4LPLA 4QDQA 4Z2AA 1US2A 2VL4A 1W9TA 3SEEA 3CMGA 1DYOA 3VDAA 5IFPA 2CDOA 5A1AA 5J1XA 3IIIA 2WABA 1JI6A 4CVUA 4GWIA 2VO5A 2OKXA 3K75B 3THDA 3I97A 1JYVA 4UI9L 5G04L 2ZEYA 4ZXEA 4TTGA 1UMHA 3LEKA 4OZOA 5LCWL 2WBKA 3T08A 1EUTA 4LHSA 4QDRA 4A4AA 3SKJE 4LQRA 2E32A 1BHGA 1OH4A 2W92A 3CIHA 3HEIA 3HNYM 3NJVA 1NKGA 3VD3A 3BGAA 3CQOA 1JHJA 5JXGA 2VCBA 5JR2A 3C7HA 3WNPA 1WKYA 3VD5A 4AAXA 5JXHA 1CX1A 2E31A 1JZ8A 2VQUA 3LE0A 2DCKA 2VMDA 2WYSA 2VZUA 2Y6HA 4XVHA 2E33A 3C7EA 1CZSA 1W8NA 3WNOA 2QQKA 3SEPA 2B4KA 3U37A 1GUIA 3D3AA 2C9KA 4FI9A 4MO3M 1OF4A 4IUGA 1T2XA 3IDAA 4HG6B 1WCQA 1J84A 1UX7A 1SDDB 1UYXA 4YPJA 3GDBA 1F4AA 3WNLA 2YFZA 2X09A 1W9WA 1OD3A 4P08A 5DPNA 1CIYA 5DQ0A 2LW8A 5B4XA 1JYXA 4GWJA 3WF2A 1JZ6A 3K77A 2RJ2A 3C7GA 2VZVA 4CUBA 2VZOA 1PMJX 1K45A 3LQCA 2W3JA 3W5MA 3VD4A 1UYYA 2J1RA 4JX0A 2EIEA 1O8SA 3HPNA 4DXSA 4CU8A 3A22A 4JKMA 1XNAA 1JZ2A 1YQ2A 2BGPA 3LPFA 2Y6KA 3C7OA 2VZ3A 1TVGA 1H6YA 3P1IA 4DXRA 4QX2A 2W9XA 3PUHA 3WF4A 4JHZA 3GGLA 1I5PA 2W1SA 3MBWA 4XUPA 2WUHA 2VOTA 3VDBA 1XC6A 2B9VA 1W9SA 3W5NA 2WN3A 3GM8A 3MV01 5EJ1B 4LKSA 2Y6JA 3CZJA 1JU4A 2WO2A 3HJRA 2VQTA 3IB3A 2JKXA 2WAOA 1L7QA 3WF1A 4P5YA 3IAPA 3I2FA 5EIYB 4D8MA 4UAPA 5IYYA 2YC4A 2ORZA 2V4VA 1NX9A 1K42A 1UXZA 4CU9A 4XURA 4XUNA 1EUUA 2XQXA 1CZTA 3HOBA 3P6BA 2XHNA 1XNTA 2W1WA 3K46A 1SHWB 2BGOA 3MUY1 3FHAA 3OEAA 4QDSA 3THCA 3NJXA 3T2QA 3T09A 4W50A 1UY2A 4JKLA 1PX3A 2Y6GA 1OF3A 3I3DA 1JYWA 3CDZB 1UY0A 2QQMA 3K4DA 4KWUA 3BN6A 1O8PA 3VDCA 4E8DA 2WZ8A 4MADA 5JUVA 2WO1A 2XONA 3SKVA 4RN5A 3ZM8A 4A44A 2V5DA 1F4HA 2QQLA 3UETA 2VZPA 3NRUA 2VMEA 4CUCA 1P8JA 3J7HA 5JXJA 2ZEZA 1UZ0A 1TG7A 2R7EB 2HLEA 2X10A 3WSOA 1D7PM 3VD7A 2Y8KA 5CZKA 2L9LA 2QQIA 2W46A 3NQHA 5IFTA 4XZUG 3T0BA 3WQBA 2J1EA 4E8CA 1GMMA 2J1AA 1NUKA 2VZQA 3LEIA 4P02B 4DUVA 4W8JA 3VD9A 2Y64A 2J1UA 3DYPA 2WN2A 3EYPA 3HN3A 3PUIA 1GQPA 2VCAA 5JMOA 3OB8A 2QQNA 1JZ7A 3DYMA 5I0DA 1JZ5A 1UMIA 3ACFA 4DEQA 4BJ0A 4TXWA 4DXTA 2ORXA 2WO3A 4JKKA 4QX3A 1K12A 4ZZ5A 4QB1A 1W0NA 4A45A 4PQQA 1UY1A 3A21A 5IHRA 4BDVB 2Y6LA 2VZ1A 4A3ZA 2X05A 2VMCA 3OEBA 1W8OA 2WQ8A 3C7FA 5C70A 3OGSA 3A7QA 3ACGA 1US3A 2BZDA 5HPOA 3LEGA 1R64A 4M4RA 2RV9A 4AG4A 3AC0A 1KGYA 2W95A 4QB2A 2BBAA 3I3BA 3K4AA 2DCJA 2VZRA 2ZEXA 3ACIA 1CZVA 2KD7A 5EJZB 2EICA 5LA0A 2CDPA 1GOHA 1GOGA 2VM9A 4XUOA 3EB7A 2VJXA 5FUIA 4BK5A 3I2JA 1LNSA 3WF3A 1L7RA 2J1TA 2RVAA 2W1UA 3T0DA 3MV11 2C4XA 2J1SA 4ARYA 2W1QA 5B4NA 4ZZ8A 1RYYA 4DUWA 3DECA 5IJRA 2W94A 2DDUA 3HNBM 5F7UA 4CU7A 1GU3A 2ZEWA 2YB7A 1O59A 4BK4A 3I3EA 4KMQA 4RYDA 4QAWA 3CKHA 4XUTA 3C8XA 4XUQA 2VR4A 1OT5A 4PT6A 2VCCA 5LA2A 2HYXA 3OGRA 2YC2A 3FN9A 4ZY9A 1GOFA 3WNKA 3MO4A 4OUEA 2LS6A 3LPGA 3ABZA 2W87A 1ULPA 1NAEA 2WDBA 2WAAA 2QBXA 2EIDA 4D0QA 1MPXA 2E26A 4CUAA 2BERA 1J83A 2C26A 3UNPA 2VZSA 2VMFA 1JYNA 1W99A 2PQSA 1UY3A 3T2OA 3I2HA 3WF0A 3HNMA 4CU6A 2VZTA 3NNGA 2J1VA 2QQOA 4MOAA 5C7GA 3FHQA 4ET7A 1GNYA 2ID4A 3IAQA 1H6XA 3F2ZA
chains in the Genus database with same CATH superfamily
4AGRA 1O4YA 1ZBE3 2J22A 2IXJA 3T0AA 3R4DB 5H9RA 3U4SA 1AXKA 3O0VA 1XQNA 1N3QA 3HQRA 1FOD2 1UYPA 1OQEA 4M01A 4BMEA 2ZGQA 1B09A 2VTFA 1MQTC 1JZ4A 2GP3A 4NWWA 3ZFGC 3ASIA 3ZKYA 1CWPA 3M3CA 1HN1A 3ZXAC 2JD9A 2OUJA 4FPKA 4IE7A 3B5LB 2MEV2 1UZVA 4UFJA 1PX4A 3WEZA 1ULGA 1XNDA 4QPWA 1CESA 3AB0A 2HBTA 4QQOA 1PGL1 3IDBB 4IEXA 4R9AA 5FYIA 3N9MA 4FTBA 4IL7A 3ETPA 3T2PA 1YUDA 3S6PA 2Z4FA 4W6YA 2ZXQA 1LJ7A 3RQ0A 2BP6A 3OBRA 2BFUL 1LOCA 3DEMA 2P3JA 5FP7A 2VXRA 2W91A 2VC9A 1CX4A 5LBEA 3NW4A 1QIQA 4WM8A 4HPKB 4ZPIA 3EXUA 1YFXA 2J42A 4Y4RA 4FVVA 1JZ3A 4M3CF 2GH8A 2WSVA 1D4M1 2BPA2 2E7TA 2GU9A 2V4AA 2XOMA 1ZBA3 2B7YA 3V64A 4L0PA 3APBA 2BDRA 3I4IA 4YZ2A 1YFYA 1LR5A 5LA1A 1ZREA 3OBAA 4XJUA 4K40A 2YU1A 5DDJ3 5C3PA 1CAVB 2C0ZA 1A8DA 2P5BA 2DYCA 5DXDA 3WDXA 1W90A 1W6PB 3UESA 2XUEA 2VMIA 1GSLA 4EE2A 3H8RA 1XJAA 4JGYC 2Q8DA 4RHV1 4YFWA 4NRMA 2XJQA 4H3WA 1GP5A 2EIGA 4LIVA 2W2IA 1LHUA 1TE1B 5C9AB 5K4LA 4WZFA 4XDPA 5FZ3A 3UYJA 3BTZA 1ND3C 4Z2AA 1IQAA 3S5AA 1WWYA 4XHXA 4BWOA 3CLPA 5EYYA 5BNQA 1C8M1 1PO11 3DKQA 4PF5A 3FJSA 3OBTA 5FKBA 5TSWA 1YQ6A 4D6SA 1QJY3 2WABA 1QWRA 1UCXA 2BVVA 3X29B 3IM0A 4FBFA 2FCVA 5J37A 5GALA 4HT1T 1JYVA 1SBEA 5G04L 4IEWA 2JD4A 2ZEYA 1CVNA 4ZXEA 4NPMA 1UMHA 2UYAA 1GZWB 3LEKA 1C8NA 4XF3A 5T5PA 4AGVA 4COVA 1WD4A 5LRSA 5C4WA 1IHMA 1VBE3 4TYSA 2SLIA 3T08A 1EAH2 3O1TA 1J3PA 1ND2A 3SKJE 2BW8A 1OH4A 1SDWA 1IS5A 1ONAA 1WCKA 5ABJA 3HEIA 3VKOA 4AW7A 3RMYA 3FUOA 3A4UA 3BGAA 4I3PA 5ISLA 3PLQA 3RZLA 1G9DA 3T30A 1VB2A 5HCBA 3WHUA 2F4PA 2HWE1 3C7HA 3GF6A 1DQ1A 1W04A 2XJUA 3PIGA 3RJRA 4K21A 3MPPG 4AAXA 3GBFA 2FCUA 2A73B 2SBAA 3VBFA 2E31A 1HV1A 5FV3A 1RUJ2 2CTVA 2VMDA 2WYSA 4QHBA 3MIBA 2VZUA 3N4MA 2DUQA 1DQ6A 4OI2A 3ZYBA 2BNMA 3WDYA 2AH2A 1BK0A 3OPTA 3WNOA 3PJQA 2RJKA 2DFBA 2H0VA 4CDQB 1O3RA 4MHRA 1Z0HA 3P3NA 4PI2A 1C57A 4BQ3A 4AFBA 4BXFA 2PTMA 3TYJA 4XC9A 3N7LA 1BVP1 1GZ9A 3IDCB 1H1IA 4GH4B 4RFRB 4YVSB 5F3EA 4IE0A 5CNAA 3NJZA 4Q4V2 3VBOC 2WL1A 4CZSA 4P08A 4GKXA 4V2VA 2YY1A 1CIYA 3DF0A 2WNVB 5ANNA 5DQ0A 1NCQB 1ZA4A 1JYXA 1NCRA 2OS2A 2ZX0A 5FUPA 1YLLA 1MQTB 1Q43A 3H50A 2VZVA 2FD8A 1DZQA 2JIGA 2VZOA 2HWD3 3AYCA 2W3JA 4NHMA 3W5MA 3VD4A 2VU9A 2JKBA 2EIEA 2ZZJA 4UFIA 2O1QA 1H30A 2LRPA 4GWMA 3A22A 4JKMA 3W59A 2CAUA 1F31A 5FP8A 4CCOA 1NA1B 5C3SA 2VZ3A 5A7WB 1V00A 1W06A 3VLBB 4JHTA 1LTEA 1GZTA 3WUCA 1UF2C 3Q8BA 1QDCA 4DY3A 2A6WA 5KXEA 1GWKA 2ZGTA 4LK6A 4QWNA 1JYTA 5CFCC 1WUVA 3FWEA 4AI0A 2JDUA 3VDBA 3PVBB 2HWE2 2CU5A 5A32A 4XZPA 3ZN4A 2VMGA 5FCCA 5FYSA 2A6ZA 5FDBA 3LGRA 1AYN3 4KBBA 4AFCA 1F2NA 1OXCA 3I2DA 1PIV2 2Z79A 2CHHA 5FJKA 1DQ4A 2OT7A 4HANA 4OUMA 4LKSA 1JUIA 4FPLA 4OZXA 4XEZA 2WO2A 4AWDA 2X29A 1X7NA 2RM22 2VQTA 2HWC3 1L7QA 2WAOA 1KRIA 3AZWA 4DY5A 2MHFA 2XXZA 4CDUA 4QX5A 1HRI1 2WZR1 5FYCA 4M00A 5FYMA 4D8MA 2YC4A 4XFCA 4C0HA 4CCNA 5CFCA 5IYYA 4PBPA 1NX9A 3PVNA 1UZZA 4TWTA 4C1WA 1U5ZA 4RHV2 4H7LA 4QKNA 4AEKA 1ZBA2 2O14A 2RS31 3JCIA 4JRLA 2XQXA 4HLTA 5FXVA 3RYKA 2DUOA 2P1BA 4WM7B 3D6EA 4BQWA 1XNTA 2D7FA 3DKWA 1R081 3K46A 1PO23 2WIIB 4IV3B 1S0CA 4XJ8A 4Y5SA 1ZZ8A 1ND3B 2BGCA 3CF6E 2ARCA 3FHAA 3OEAA 3T4HB 5CU1A 5FYYA 3QD6A 1BVVA 3SITA 3GJAA 2V73A 1PX3A 2IXHA 2R073 3MZHA 5GKAC 1A78A 4XACA 3VBFB 5A6QA 1REFA 3J26N 1SBFA 3HWJA 5HBAA 2B8MA 2QQMA 5BNPC 3PTRB 4A7KA 4F7ZA 5M0TA 1WA4A 1V6MA 3VKLA 5JUVA 4KG0A 4ET7A 2UURA 2EXIA 4BQXA 1J3QA 1V6KA 2JDKA 4NRPA 1IKQA 1GR3A 1B35B 4RN5A 4A44A 4CDXB 4IGPA 4Y1YA 1W6NA 2P6HA 3MHZA 4CUCA 2NPIA 3R6SA 1HKDA 1OUXA 2H6CA 4BMBA 3L2YA 3ZFFA 1LOFC 3N9LA 2WA4A 4NIAA 4GD4A 2JG8A 4LO7A 4UT5A 1UZ0A 4B4PA 3QACA 3VBOB 4HSLA 2P3YA 5EFUA 4UBHA 4QGLA 5CBLA 1N47A 3VZLA 1HXS1 1D7PM 4IEOA 4R9BA 3RMXA 1LU1A 1PM4A 1V6LA 2R1BA 2HWB1 3GNEA 5FZAA 1RUE3 4DZGA 1Q8PA 1NCRB 5IFTA 2RDSA 4Z07A 2J1EA 4AHWA 3QCWA 2P37A 5CKMA 2J1AA 4QGMA 2GNMA 2WZPP 4LBOA 4NUBA 4C8DA 3AVSA 3ZN6B 1Q8QA 4QPGB 1PZ8A 1DG6A 3RZGA 3PUIA 5JMOA 2ET7A 4RA0A 1QXJA 2XL9A 3BKZA 1UN1A 1REEA 2G9GA 1URXA 4NOTA 4NROA 1UU6A 4RS5C 1JZ7A 5LK7B 5KXDA 2WLQA 1UMIA 5KHGA 1JZ5A 4DEQA 5FPBA 1PO13 1AJOA 1C8M3 1S0DA 4Q8LA 5JMCA 4DXTA 1Y43B 4RD7A 3WX5A 5AC93 1U5IA 4PIXA 3CJIC 1LENA 1RXFA 3ZOIA 4K1ZA 1FT9A 1VBB1 3LFIA 4JQTA 4JKKA 1MZEA 1I9RA 2ZOEB 2K2SA 3VBUC 3WG1A 1W0NA 1V6IA 4QXKA 3WP6A 3ZYPA 4A45A 4PQQA 4B7EA 1VR3A 5IHRA 2YHJA 1ZZBA 4WVWA 4N53C 5T5JA 3UJOA 4FTEA 1U12A 2ERFA 2YC0A 3LDKA 4A3ZA 5FZ6A 2AEYA 5LRRA 4M3CE 2WT1A 1H2LA 1LGCA 3A7QA 3EQEA 1LKNA 1US3A 2ZGLA 5KHIA 5LW9A 3LDRA 5FZDA 2JEMA 5L73A 3H7YA 5SV5A 3LEGA 1CAWA 4GQ7A 4JC1A 4RGGA 3S30A 4ISRA 5F3GA 4LBNA 1RHI2 3EJKA 4EWAA 3ZXLA 2ZCWA 1QQP3 1CAXB 4P9JA 1K5MA 4EWDA 3N7JA 2W95A 2YGMA 3CEWA 1Q3EA 2EAKA 5HXVA 1IG3A 3IBMA 3N3HA 3FUQA 4OQ8A 3I3BA 2PHDA 4Q4W3 1E5SA 2GDFA 3K4AA 4XCAA 4QU2A 1L7LA 2WNEA 1K5MC 2VOKA 5JZGB 2ZEXA 1W6QB 4IEZA 1X36A 1XOYA 3JQXA 3ACIA 3USUB 4ZU5A 2P2KA 1AL0G 2N7GA 4HKLA 5CEHA 4QQLA 1ZRFA 3WY6A 4WM8C 3U75A 4HXCA 4LR4A 3ZSMA 1ASJ2 2XVGA 4AE2A 1J3RA 4MSVA 1W8UA 2GMMA 2VVFA 5L7OC 4W6XA 4KGQA 2VJXA 5FUIA 4BK5A 4Q5OA 3WG3A 1IPKA 1XE7A 4IEUA 1SPPB 4K9SA 2WFF1 3ZXEA 3AMPA 1WMDA 1X82A 2DWRA 2QCSB 3LDBA 4K6BA 5C5TA 5GZCA 3BU0A 3KT7A 2Q8CA 2QTWB 3SCHA 3PURA 3FBMA 3VBUA 1BMV2 2VUDA 1BBT3 4FPYA 4RQPA 5B4NA 3GCWA 4ZZ8A 3D4KA 3O0WA 3MI8A 4LJHA 4XJZA 1B35A 3T4VA 4H55A 1NY72 4U2AA 4TLGA 4V2WA 3RYRA 3JUUA 2W94A 4XBNA 4NPLA 5L7OA 4BQ1A 3AM2A 3QBQA 2DDUA 1NZIA 4AVVA 3AP9A 1AR81 1CAVA 2GC1A 2VMHA 3O12A 4J25A 3QLQA 3TRSB 5IVYA 5LBFA 1NE4A 1OVSA 1N3OA 1O59A 4P9YA 4BK4A 4I30A 5FYBA 3GZEA 1WD3A 2ZGUA 4RYDA 1SLTA 1VBE1 2XWBB 4YW6A 4UXAA 1UKGA 2GNBA 2VUCA 2XR4A 3D5OA 3POIA 4BHPA 4XUQA 4UYBA 1OKOA 2VR4A 2VCCA 5FY9A 4C91A 3OGRA 4CYDA 4A3XA 1RUH3 2YBPA 2ET1A 4XCBA 4ZY9A 3KD4A 1GOFA 3WNKA 2R042 3WT3A 3POFA 4AEDC 5LY1A 2D5HA 5CIRA 1ALYA 3RDIA 1CD3G 4NHYA 4DO0A 4Z1VA 2OQ7A 1NAEA 1V6NA 2WAAA 4OHYA 2QBXA 1QJY1 4DNYA 5BY5A 4BCUA 2IXIA 2YV8A 3TB0A 2RS11 4ASLA 3L2HA 3MLKA 4I0WB 1X9TA 1LGNA 1JXNA 2D93A 2HWD1 5D2AA 5A3PA 4NIDA 5KC6A 1J83A 2ZMKA 2Q8EA 3ZFEA 1HJGA 5FBJA 1D2QA 2VMFA 4GMP0 4TN7A 3POYA 1JYNA 3GHNA 5K0UB 2D6PA 4WBBA 4JTOA 2ZKNA 1X8MA 5BXXA 1DGLA 2WQ4A 1VBD1 2B45X 3T2OA 3VL9A 4E2QA 3O1PA 3HNMA 1FPN1 1F8VA 5IAXA 1PGSA 3JQWA 1TME3 3J9SA 1J58A 2XLFA 3KCYA 3U1XA 3ZR5A 1I1EA 1GLHA 2EXJA 2ZGSA 4LBQD 5CVRA 4CPBD 1U0AA 2EXHA 2GH2A 4MOAA 1KFXL 3OF1A 3OGJA 4A7ZA 4NRQA 5IVFA 1YFWA 3FHQA 3BODA 3CJIA 1GNYA 3E97A 1YQ8A 2GZWA 4M0HA 4DRVA 4LE3A 2A3XA 3H9AA 3UL2A 1PVC3 5IT6A 4E2GA 1DDLA 3NMBA 5GZGA 2WZR3 1M4WA 1UOJA 1G8WA 4AQ6A 1AR93 1LOAA 1AHSA 1RVF1 2XB6C 1HQWA 1DHKB 1GZCA 2ZHMA 3VHPA 5IVVA 3BI3A 5FZ7A 4JCKA 3WNMA 4I01A 1K3IA 2O0OA 3WQ0A 4FXKB 2R071 2VW0A 4OMCA 3ZDSA 3RPQA 2LROA 4XXPA 3VKMA 1POV0 2R49A 1XPWA 3SH4A 3ALQA 4OI1A 5A7NA 1MS1A 4TSVA 4P9GA 4XMAA 1PMIA 5ACA2 1EV12 2F17A 2OZJA 3BCWA 4W4ZA 4FP3A 3ZFGB 4ATEA 1AYN2 5AC92 2YG0A 4KU7A 3VBRB 5DMYA 1VBC2 2IXLA 1CAUB 1OOPA 4HBNA 1XE8A 2ADDA 4FPEA 3WQ7A 4UFHA 5FZHA 5FR3A 5KWRA 1H4GA 3WW1A 3FL7A 1TZOA 2WNVA 3OG2A 1N3PA 2JG9A 3WP3A 2IFWA 4O65A 1RMU1 3DCQA 1PMHX 5J7MA 3AVRA 3CJIB 4BXSV 1LCLA 4M3CA 2VOXA 5CAZA 2AREA 2DBNA 2WKKA 4A41A 5F3IA 1Q8OA 4MGIE 3CZUA 2HWC1 1UWWA 4ARXA 3NNMA 1IG0A 1MEC3 4MGSA 4C0BA 3A23A 3ACHA 4N9HA 2WZEA 1UYZA 2WZR2 3U78A 5CADA 3GXUA 1ZA7A 1DF0A 1W8FA 5D21A 4YGCA 4P9IA 4JDMA 5C71A 3H3ZA 5JSPA 5C8CB 1UY4A 1RUD1 4OYUA 4CTEA 3UV9A 1VBD3 2UY9A 3WW4A 2D40A 3WP5A 3N7MA 1OLME 2VUJA 5I8TA 4OHZA 4OMDA 2RG4A 4FT8A 5CB7A 1UXXX 1APNA 3TN93 2PN5A 4DPNA 5LEKA 1BLZA 5AC91 5FUNA 3ZKUA 4UW5A 1BBT1 3N36A 5D8AA 1EV11 1W6MB 4CP1A 1DGRA 5FP9A 5ACA1 2GSYA 3CMGA 5J1XA 5FQ0A 1VBC3 5IFPA 4DRRA 4NE9A 1SCSA 2TNFA 3WG4A 3ZPYA 2WFF3 1JI6A 4JGYA 5A3UA 1H8TB 4QT6A 4GWIA 2FDHA 4YZ5A 3THDA 4WM8B 1W0OA 4UF0A 4AYUA 2EF6A 1LHWA 1OVPA 4FCAA 4NIIA 5FZBA 1RUC2 1RUI1 1SLIA 3G6JB 1W8HA 1RUOA 1SQ4A 2PHUA 4K8FA 2IC1A 1R1A3 2WBKA 3AKSA 1DIWA 2WC2A 4HN1A 1EUTA 4GJYA 1HW5A 3UK9A 4QDRA 3HT2A 4RL7A 4A4AA 5C3OA 2RDRA 1CR7A 4WM7A 2WT2A 1AR83 3KWVA 5KBFA 2CSGA 5DUXA 4GAZA 3HNYM 1Z78A 5F32A 4EN6B 4AEDB 1NKGA 1O5UA 3VD3A 5FZEA 4JQRA 1SACA 2X5IC 2XJVA 1RUG3 2VNGA 4ZXKA 2VCBA 4JV4A 4O9EA 5FXWA 5JR2A 3E5XA 3RWNA 5T5OA 4FSJA 3VD5A 4K3UA 4LO4B 2R041 1CX1A 4LOTA 1JZ8A 3POBA 2BOIA 2VQUA 5C9AA 3PMEA 3LE0A 1AXZA 3VBSA 4AHXA 4BPZA 4BU2A 2RDQA 1GP6A 2Y6HA 4OULA 4XOGA 5D8AB 4XVHA 2E33A 3C7EA 4AVAA 1CZSA 1JUHA 2HWE3 2JENA 2VBBA 4X8NA 3AJZA 1LAJA 1HQNA 4MVTA 1QJX1 3M4FA 5IK5A 4WV8A 2WINB 5A32B 1QJY2 4NN0A 4MO3M 2KA3A 1OF4A 1OPMA 4IUGA 1T2XA 3FFZA 4NPRA 3IDAA 4HG6B 4BA6A 2JWPA 1V70A 1VMJA 4ISQA 1UX7A 3KM5A 5FZ1A 1BEV2 4YVWA 4EV0A 1W9WA 1OD3A 2PELA 1IGOA 1NY71 1SFYA 1RUC3 4FO9A 3VBOA 4P9WA 4WVMA 1ST8A 1WLWA 3IKWA 2JG9C 3RNSA 4B1MA 1R1A2 3WD5A 1VBE2 1PO21 4F83A 1NZCA 3IDEA 3PJYA 2AZ5A 4PIYA 2ZMNA 3ZXFA 2I07B 4MXVA 5IWFA 4NJ4A 5B2GB 3KCXA 1EAH1 3C7GA 1AR82 2IXCA 5KC5A 3LQCA 3NWKA 1ZBE2 5FYZA 1XYPA 1UYYA 2HWF2 2Q0AA 3A0NA 1GP4A 5IAVA 3HPNA 4AI3A 5KHJA 4S2DA 1VMHA 4KQ7A 4RFT0 3O7OA 5H9PA 5IVCA 2QJVA 1SLAA 3O1RA 2WA3A 3UKNA 3LPFA 3BTXA 2ZKLA 3C7OA 3Q8CA 4IV1A 4BZ4A 1TVGA 4X6RB 3VBRC 2FDJA 4CPBA 3ILRA 4DXRA 4AF9A 4QX2A 4S2FA 3WF4A 3O1SA 1W05A 5H9QA 4PDWA 4E9KA 2PAEA 1OQ1A 3S7IA 4XUPA 2B5HA 2XPJA 2WUHA 2TBVA 1S55A 4URAA 3WLUA 3H1WA 3VZNA 1VBB3 5JCTA 3RI9A 3AMMA 3W5NA 4BB3A 2BFUS 2D44A 3K3NA 4ONUA 1NQDA 4XPVA 3KLSA 1YO8A 1KJRA 1SZBA 1ASJ1 1W8TA 2QQWA 3MV01 5EJ1B 1NLSA 3I2OA 5CG9A 2K0GA 5T52A 2DUPA 2TEPA 3H8XA 1COV2 4A6SA 1MS5A 1W0PA 2VCMA 3BOWA 4DB5A 2NM1A 4Q4Y1 2PAKA 3I59B 4P5YA 4L8QA 4AVBA 3AKQA 2XWJB 3I2FA 5FZ0A 2VBDA 3OD4A 1DZRA 1D2SA 1XSRA 5EIYB 3OUHA 5A1FA 4NHLA 5LWBA 4UAPA 4FP2A 1KJLA 1YRZA 2R16A 4CDQC 4CCDA 2V4VA 1UKRA 2CNAA 4CCJA 5J48A 4Y20B 1F5FA 1YIFA 1K42A 1RGSA 2ARAA 1GZWA 4GWNA 4IDZA 2PAMA 2LM3A 1EUUA 5CKNA 2AYHA 2BRTA 3AZYA 4QPIC 3I8TA 2JE9A 3IPVA 3WNXA 3HOBA 4QQHA 1C5IA 5EPAA 3P6BA 2PHTA 2E51A 2VD7A 4MH0E 3U14A 2W1WA 5CA6A 5BNNB 3RI8A 5HCAA 3H8OA 2DTYA 2GAUA 5E16A 1KDMA 2BGOA 2E7AA 1YI7A 4QDSA 4XF9A 3AP5A 3KGLA 3NJXA 1OBNA 1QNWA 3MPBA 4D7TA 4JDNA 4P5HA 5DAXA 5C5UA 4JKLA 5DAVA 5FYUA 2VULA 1J59A 5JOZA 3ZN6A 2C6SA 3I3DA 3LAGA 1MS9A 3CDZB 2BJSA 4HVRA 4BH9A 4FPFA 3TEZA 4LBQA 1ZRCA 1YI9A 4O7XA 4KWUA 4Q1PA 5C33A 2FDGA 3VDCA 2UYBA 4RGAA 1E5HA 1ZX5A 4MADA 1AL21 2QVSB 4WVVA 3CU7A 4XQDA 2HH9A 2PHFA 5D8AC 4EJRA 4R52A 1DQ0A 2A75A 1S0BA 2XG3A 2WO1A 3BTAA 4CDUB 1HXS2 4YGEA 2O8OA 2WRAA 3OYWA 4YFZA 5FPZA 5BUVA 5JOWA 5CFCB 2DVAA 3WXPA 1QXPA 5BNOB 2VW2A 2QQLA 3UETA 2VZPA 2XVLA 4LE4A 2PA7A 5FY1A 4YM0A 4XDQA 2I74A 1FYUA 1PM7A 1TEIA 5FFOC 3MF9A 4B29A 3DUIA 3VKNA 2DBIA 1YWKA 2D3PA 2Y34A 2K46A 2HEWF 1S0IA 1ZZ9A 2R7EB 2X10A 5IVBA 3VBSC 4RR3A 1VBA1 2XGXA 2IXKA 5DZEA 5FOBB 2HWB2 1O91A 2Y8KA 1H2MA 5BNNA 3WCRA 1YEWA 2W46A 3IMNA 1ZRIA 4E8CA 4AHYA 5IVJA 4OI0A 2A5ZA 4HZFA 4GJZA 1VRH1 5DDJ1 1AR92 1GMMA 2F6BA 2VZQA 5A33B 4OQ9A 1QJZA 4HVOA 4DUVA 4JRAA 4Q4Y2 4AHZA 4OHWA 1WW6A 3PU3A 4XQ4A 1HB4A 3DYPA 3KT1A 4IE4A 4E4SA 4ES9A 1FNZA 2WN2A 4IE5A 2VCAA 2JECA 3LOIA 4LIUA 4SLIA 5FZOB 1KXGA 1OC1A 1S2KA 4WM7C 4UFKA 3G7DA 3MW4A 2EAAA 5EP9A 2WS93 2X5IB 3OUIA 3DN7A 3C2UA 4TZDA 2WWSA 3VHOA 5T3NA 3ACFA 3RYPA 3AXEA 3MW3A 1QEXA 4BJ0A 1EV13 2D6KA 3HD8B 3URFA 1UW8A 2WO3A 3OPZA 5FY8A 3AYEA 3OCPA 2VGDA 1TMF1 3AK0A 1LOBA 4HOOA 4FOYA 3AMNA 1AR71 2RS32 3PIJA 5A3WA 3T1MA 2ARBA 4R4XA 5EJ3A 3MFCA 3HAGA 2VMCA 2UY8A 4XAEA 4B7KA 3AZXA 3F95A 3LOBA 2HWF1 4YARA 3VBUB 3RZHA 3RZKA 2ARXA 1ODMA 3POJA 1GNZA 2RJLA 4RQPB 5FZKA 1R082 2BZDA 5HPOA 1RUF2 4MYEA 1CQ9A 4JDOA 5JPMB 4YGDA 3GZAA 2VOWA 2UU8A 3C3VA 1R64A 1EP0A 1C3HA 1QJU3 4I2OA 2ZGPA 2D6NA 3RSJA 1PIV1 2GP5A 3AC0A 5JSOA 5DAWA 2FDKA 5KR7A 2F4LA 1ULCA 1UU4A 4DS0A 2ZAAA 4CDWB 3HVDA 1BEV1 1ZBE1 3KQRA 1DU3D 4P14A 4N43A 1IZ3A 4IEYA 3LWCA 2DCJA 2VZRA 3HN1A 2Y6FA 2Y38A 3MF6A 3KHBA 1CIWA 1HB2A 2DVFA 2RM21 1KITA 2CDPA 2VQAA 5F5CA 5FRAA 2HEYF 3UKVA 2ILMA 1R1A1 1NLRA 3ZYRA 2IWGB 2WNUC 1S0JA 2EXKA 3CHXA 3RJ2X 1WCDJ 4CXWA 1RUI3 1AJKA 3KCCA 5GZEA 1EPWA 3AXDA 3BPSA 4CRQA 4KWJA 5FO9B 1SCRA 4PDWC 1UD1A 2A6YA 2Q5TA 3EB7A 5FY5A 5F2SA 2WWUA 4Q0UA 5I91A 1V0AA 3U4XA 1ZM1A 2WNVC 2YBSA 3NKGA 3MIHA 3WDWA 4HKOA 4EN8B 1COV3 4Q1RA 1OFNA 1ENQA 2KM2A 3NSTA 1CONA 4AAPA 2W1UA 5JLVA 3T0DA 1E5IA 4CXYA 3ZFEB 1E57A 3UKTA 1ZRDA 4YYOA 2XJPA 3NV4A 1NLQA 5K0UA 4LKFA 4QD2A 5JAXA 3MLJA 3SCFA 3LD8A 3DECA 4DMIA 4E2SA 2FDIA 1YQCA 5IJRA 3ZIXA 3O1VA 2BNOA 5E88A 3J7MA 1RUH1 4KNCA 3IT8A 2DCZA 1NA1C 2VECA 2E7QA 1LOEA 4A2UA 5DABA 2QQPA 2R1DA 2ZEWA 3POGA 4XIOA 2YB7A 3WOGA 1RUC1 1F15A 1XYNA 4JGZB 1LULA 2DU0A 4MHUA 4LHNA 4QAWA 4YG0A 4YVWC 1YHFA 1HB3A 3GBWA 3HBZA 4XUTA 1YCIA 2WR9A 3N9PA 1W03A 1DYPA 1QH7A 4LO6B 4PJYA 3AP6A 2AR6A 4QPIB 3THTA 3U10A 1XNKA 4BIOA 4Q4V1 3W58A 3ORJA 1JOBA 4FXGB 2P6CA 5BPXA 1FATA 2LS6A 2EIDA 3DV8A 1OLRA 2DURA 4LXLA 3T1LA 1RUI2 2A70A 4L92A 1MPXA 3B00A 2XQRA 4I0AA 4JGYB 4GIQA 3TBDA 5H9SA 1O4TA 1AR63 3CNAA 2B9UA 4OHVA 5CG8A 3NVCA 4OUSA 1QOTA 4UF0B 2XDVA 2PMWB 2VZSA 4YGBA 1POV1 5E8AA 1W99A 3TEYA 5IATA 2PQSA 1GQHA 4Y5Z0 4N90A 4QX7A 3B69A 4XFGA 3WF0A 4LBKA 2A3WA 2JDZA 1ND2B 1BXHA 1F5JA 5L7OB 4AOCA 4CU6A 2A3YA 2VZTA 3AX4A 4ZU7A 2ZS6B 4IESA 2JB8A 2J1VA 2QQOA 4LHKA 4Q4X1 5FZMA 2NYYA 3VHRA 4AEDA 2A6XA 1RXGA 1S2BA 1OURA 1ZZ6A 1LEMA 1MVEA 3K48A 3NKTA 3IAQA 1YQ5A 2XH6A 5FKCA 3DGTA 5FLHA 4LA2A 4URTA 1WCUA 1W9TA 3FBYA 5IUQA 3UT0A 4CCEA 5FO8B 2QQVA 3S5QA 4MV2A 2D6OX 3KF3A 3POSA 5C6CA 1GYKA 2YFUA 1XU1A 5JXIA 5I0RA 5FXZA 2QKDA 5EV7A 1ULOA 4DQAA 4Q4Y3 3ZMOA 3SH3A 4Q29A 3VBSB 3N9QA 3I3QA 1V9U3 4YWAA 1RC6A 4A42A 3ECQA 4CEYA 2QQJA 1VBC1 1ZVFA 1OHFA 1IOAA 4N43C 4NVPA 1W6PA 4I3GA 4ATFA 4OVEA 2YMZA 3DYOA 2WS92 3NAPC 3PVEA 5DZFA 2DFCA 3MUZ1 4IETA 4YZ3A 1TME1 3B01A 3GHMA 4QB6A 1PO12 3GZTB 1F9KA 1B35C 3VZMA 4CDXC 4KI5M 3WW2A 3KHCA 1OMIA 3AFGA 4YW4A 4FPJA 3U11A 4RQPC 5HXMA 4ZS3A 2YZ4A 3I2IA 1W9YA 2D5FA 5CFDC 3RGBA 1C1FA 1DLLA 3KF5A 4K20A 4KG8A 1ZZCA 4HK9A 5JPNB 2EIBA 1FMD3 4CCMA 2ZABA 4KWLA 1QOOA 4G4FA 2ZA9A 2QNKA 1LHOA 1RJ8A 2OZ6A 3N9NA 4LBJA 4EN0A 1I3HA 1VRH2 4ZS2A 3I7DA 4DXZA 2VW1A 3LA3A 4QX1A 4PF1A 4G9SB 5DN2A 2RMU2 2V5YA 3OPWA 4ORFA 2B46X 3SQOA 1MZ6A 5FAXA 1SLLA 5F5AA 4QPGC 4D7SA 3Q8FA 3ELNA 1E5RA 1Q56A 4X8PA 4IV1B 2JDAA 1BKZA 3OGVA 3DL3A 5F9TA 2VQ0A 4Y1VA 1JW6A 2MNGA 4JGZA 3I2KA 2A1XA 1DP0A 1FPN3 4PDWB 1CPMA 1J1TA 2GNDA 1OA2A 1R092 2ZX2A 3E1F1 3HIFA 4FTSA 4XILA 4YZ1A 1IQDC 1GNHA 1UOFA 3BTYA 2YDEA 4CP9B 1AF9A 1H0BA 4YLZA 5C8CC 4FAGA 4CDWC 1G9AA 1XBFA 4XETA 4QDQA 1HRV1 3JU9A 1KFUL 3VBHB 4IGOA 4HFSA 2VNOA 1O5LA 2VPVA 2YPDA 1DYOA 3I59A 2JX9A 2CDOA 4W6WA 5A1AA 3IIIA 4BQ5A 1DGWX 1VIWB 3VZOA 4CVUA 2FZ1A 5KXCA 3K75B 2BU9A 5BYNA 1T6BX 1OUSA 3AP4A 4Q4V3 4UI9L 2FDFA 4BISA 3SISA 3TNPB 5DUVA 4XJ9A 3WG2A 2RS12 1FV3A 3DXUA 4TTGA 3BIEA 5A3TA 2R0FA 3B94A 4OZOA 4KH9A 5FMCA 1MZ5A 2VXJA 4YVWB 4A7YA 5LCWL 4ITCA 3TEXA 4LHSA 4AI2A 2Y33A 4GB31 4Q26A 4WVMB 2QZ2A 3IZOA 4GH4C 2E32A 4LQRA 1BHGA 2HWB3 1WZXA 4QXHA 3JBG1 4QHZA 4AVTA 3CIHA 3NJVA 2KXLA 4AVSA 3GYDA 1Q5OA 3CQOA 4LITA 1JHJA 5JXGA 1LGBA 2XBO1 2OQ6A 2R32A 5HV4A 2DVGA 1BMV1 1AVBA 3H1MA 4N7UA 1SFPA 2AUYA 2I2SA 5J3UA 1RL3A 5IW0A 4DFSA 5JXHA 4Y1ZA 1RITA 1MS0A 5FP3A 3VUOA 1DGRN 5A7WA 3DPRB 1NXD1 1JHNA 2DCKA 1COV1 4Z92B 1XNBA 4FFFA 5GJ6A 2Q1ZB 3ZXDA 2ZGNA 3NNJA 5ANQA 4LK7A 1LOFA 4X6QB 2JICA 2YGLA 3W21A 2B4KA 3U37A 2RR13 5JOXA 2ADEA 1FXZA 3R05A 3OYWB 2FMDA 4CEWB 4FI9A 5FTTC 2CGOA 1PVC1 5BNOA 1ZZ7A 2VTXJ 4MZUA 1LESA 4COYA 2WFF2 3DXTA 2VVDA 4UW4A 1WCQA 1J84A 2RM23 3D0JA 3AKRA 5FO7B 4LA3A 5GLTA 1F4AA 2JDYA 2ZX3A 2YFZA 2X09A 4LO8A 3WNLA 4EZHA 3OOXA 3VZKA 2GC3A 4CXXA 3LFMA 3JB8A 5F6LB 2Q8OA 4EWEA 4GA9A 1LODA 3FZ3A 3ILNA 2D3SA 2LW8A 3H8UA 1A34A 2D97A 3R0RA 3ZVXA 1OA4A 3ZPOA 1W28A 4YG6A 1G86A 5APAA 3VL8A 3PHMA 2PYTA 4F3JA 1JZ6A 1D4M3 2RJ2A 3ZSKA 3R4SA 3ZXJA 1PVC2 3KMHA 3M3IA 5CFDA 4BYYA 3ZSEA 1Q8VA 2J1RA 1IS6A 2PXJA 3AL6A 3M8LA 3VGIA 1W2NA 1XYOA 4CCCA 3CBNA 4CU8A 5LBBA 1JN2P 1PO22 2VOVA 2ZACA 1SLCA 5DAQA 1O3TA 4Y3OA 1XNAA 3PUAA 1YQ2A 1JZ2A 1CJDA 3NNFA 1HRI3 1H6YA 1FX5A 2X5IA 2FBEA 1KQRA 3P5BA 2Z5WA 2W9XA 3PUHA 1A3KA 5E89A 5FREA 2IVIB 1S1AA 2JDMA 4IV1C 1I5PA 3WHTA 3U07A 4CP2A 2W1SA 5GLZA 2VOTA 5FZLA 1N1VA 1C28A 5K8SA 3TNQA 4IV3C 4QHOA 3ENRA 4OHXA 1O3QA 1OQDA 1TQ5A 2OVUA 5A1LA 1O6UA 1GWMA 4W65A 1HX6A 2JJ6A 4XTPA 2JXAA 4QQ2A 5A7SA 2Y6JA 3CZJA 1JU4A 2GNTA 4XW3A 3JBG2 1LECA 3ZN5A 4AGGA 2RS53 2JKXA 4Y22A 1NQJA 1BEV3 5FMDA 5LK5A 5AFEA 2OPKA 1LRHA 2FHRA 4D6RA 2HKXA 1QJX3 1HRV2 2FMYA 4LNVA 2QDRA 3TOJA 3V0AB 4NMIA 1REDA 4Z8BA 1VRBA 2ORZA 4KBZA 3PTYA 5EQUA 4K7JA 2W39A 1AYM1 2LALA 4COWA 3VB9A 5LZ6A 4XURA 1CJPA 4ZKTB 5CFDB 2GALA 4XUNA 1PGW2 3LSDA 1W9FA 1XE0A 4Q0SA 1CZTA 1MEC2 2CV6A 2K9ZA 4AQTA 3QH6A 2XHNA 4FFGA 4Q2FA 5FK8A 4IERA 5ABJC 1S0FA 3D82A 4FPOB 2HYKA 2OX0A 4N53A 3ZYGA 4CUGA 1X33A 1SHWB 2CWSA 5GZDA 2UWCA 2JB4A 2XUMA 5FK7A 3VBHC 1ODNA 1NYWA 2QQUA 5KXBA 4BQ2A 3T2QA 1ENXA 3T09A 4W50A 1UY2A 2G4IA 1TMF3 1Y4WA 2Y6GA 4MXWB 2Y60A 4NIGA 1R091 2C24A 5GLUA 1N1YA 3OY8A 1NCRC 5A7PA 4Y1UA 5J09A 2RE9A 5F37A 3KV9A 1JYWA 2PHWA 3FE5A 4YZ4A 5FZOA 3M3QA 1UY0A 1VALA 2ZAHA 1QDOA 1TNRA 3K4DA 4L2NA 4L9BA 1S0GA 4L97A 4PLOA 2GC2A 4XFAA 2ZPXA 2WZ8A 3ZXKA 4S2HA 1AR62 2NLRA 3DPRC 1C5HA 3WR0A 3ETQA 3L9JT 4QXCA 4XF4A 3RRDA 4S2GA 3PVOA 2VG9A 3N7KA 2JE7A 2RMU1 3GJBA 5A6XA 4XYXA 2AENA 5ERLA 3ST7A 2RS52 3ZXGA 3AP7A 3SKVA 3ACLA 3LA2A 5FZ9A 1JODA 2ZHLA 5JIUA 1BCXA 1ZNPA 4YVSA 3TEWA 2VMEA 1P8JA 1TME2 3J7HA 1STMA 2QZ3A 5JIAA 2JDPA 2P17A 2OXBA 4F8AA 5JXJA 2ZEZA 5L9RA 3O1MA 1RUG1 2VH9A 1S0EA 2NMNA 5A3OA 2HLEA 2WLPA 4UW3A 1AR73 2AEZA 4BE3A 3VD7A 4Y26A 1LHNA 2L9LA 2NN8A 2PHXA 4N53B 1JYIA 3PU8A 2QQIA 3CJXA 4XZUG 3WP4A 4XBQA 1QXRA 1WW7A 2UWAA 5FMOL 4ZHNA 2NP0A 4R9CA 3AKPA 3E5UA 3INAA 1CAXA 1FOD3 4QPIA 1H1MA 1LOGA 4RSUA 4Q4W2 2EALA 2NMOA 2Y64A 1G9BA 2QUOA 1N1TA 2P3KA 1OPOA 3HN3A 1ZBA1 1GQPA 4Y5TA 5A3MA 2GMEA 2XMLA 3MGUA 4KU8A 4Q4X2 3RS6A 5JZGA 4K8RB 1N1SA 2QQNA 3USUA 3DYMA 4LTAA 1XB9A 4QKFA 4FPGA 1QF3A 4LORA 1H4HA 1HJFA 2ORXA 3MEPA 2ZTNA 4QM8A 1RUE1 1K12A 4AFMA 4ZZ5A 5KHKA 4QB1A 5A7QA 2E9QA 5C9AC 4NAOA 3KS7A 2XHKA 3OTFA 3M7AA 3LIGA 4UW6A 1UY1A 2D6LX 4BDVB 4YSFA 1EPZA 1OI6A 3ZIWA 2RHPA 2DVDA 2VZ1A 3O1UA 2X05A 1DQ5A 3OEBA 1W8OA 4SBVA 4BOWA 5FOJB 3AFKA 5F3CA 1ZYBA 3B9CA 3OGSA 3ZR6A 4LUMA 3AJYA 4H7MA 3ACGA 3KZ4C 1HLCA 2YYOA 4BQYA 3J8F1 4OCTA 3LZZA 4HL0A 1UOGA 4M4RA 5C3RA 4XFBA 1PHMA 1Y9GA 2RV9A 3EHKA 3OBZA 4P9XA 5I8YA 2ZGKA 4XQWA 2ETEA 2HWF3 3VDDC 2CGPA 1KGYA 2VNRA 1XU2A 2OA2A 3BB6A 4QPGA 2NQYA 4QB2A 4IGQA 4EN9B 5JSRA 1MS3A 5EXOA 3BVCA 2ZBJA 1FPN2 3J7LA 2VE1A 1FMD1 3FHIB 1VBD2 1RUH2 5BNPB 1CZVA 1NE6A 2KD7A 3ZSJA 5EJZB 1QH6A 4Q4X3 2BNNA 3O1OA 4IXLA 1GOHA 1W3XA 2D3RA 2G9ZA 1KS4A 1GOGA 3R4UA 2Q4SA 3JB4C 3EBRA 5GLVA 4LBMA 5F2WA 3I2JA 1UAIA 3H42B 2J1TA 4HMZA 1AX1A 2JG9B 1QJU1 2WNUB 3BYWA 1KD7A 5LASA 2W08A 2ZZQA 3A0KA 4M0NA 1DQ2A 3MV11 2C4XA 2J1SA 1V9U1 5T54A 2W1QA 4GMP1 4QQPA 1SFNA 5DZGA 4CSWA 1HRV3 3NAPA 2C1FA 4FOWA 2XBO3 1CAWB 2BEOA 2YROA 2ZHKA 3KVAA 3WDTA 5A80A 2GN3A 2Q1FA 3B7MA 5EYXA 4ES8A 1RUJ1 1SEFA 3ZFEC 1K5MB 5JZGC 1WW5A 2DCYA 1HV0A 3SH5A 4MUVA 1RHI3 3HNBM 3USSA 4B8EA 5F7UA 1RUD3 5JWPA 2IFRA 2RDNA 1JOPA 4IEPA 1NCQC 4PI0A 1DCSA 4EZ4A 4FQ4A 5LBCA 3ITQA 4KMQA 1UZYA 4G3YC 3RZJA 1OLQA 1G6NA 3LA7A 1JS9A 1VMFA 3TAYA 3D8CA 4RS5B 3ON7A 1M06G 3TWIA 4AFAA 3C8XA 5FPUA 1OT5A 2B42B 4RGKA 2YPJA 3N35A 4QKDA 5LA2A 4Q27A 1QY4A 1QKQA 1VJ2A 3FN9A 4FPHA 4HVQA 3KQ4B 3ZO0B 2WFPA 3MO4A 3RFRA 1RUF1 4OUEA 3LPGA 3MIEA 3ABZA 1UZWA 2EA7A 2W87A 2OUHA 4LEJA 5FP4A 1CGPA 4YNIA 3UJQA 1QNYA 3CO2A 4D0QA 5ACA3 1YIPA 1WBLA 2YBKA 1RMU3 3E6BA 2E26A 3VKFC 4B3NA 3JD73 4GKYA 1OLMA 1AUYA 4LT5A 3N9OA 2ZHNA 2H6BA 3UNPA 4XTMA 2JDNA 4JAAA 4IQPA 1GFF2 2PQQA 1IS3A 4D94A 1GKBA 1T6GC 1CAUA 1UQXA 3ILFA 4LUKA 3I2HA 5FY0A 1W2AX 2R062 3I49A 1J1LA 2A7AA 3MW2A 1DYKA 4AFDA 2CWMA 5FY4A 4BQ4A 3NNGA 2WJSA 1GV9A 1OSGA 1YFUA 5FPXA 5C7GA 5L9BA 1WBFA 1RIRA 2Z42A 2DCTA 1A6CA 1AR72 5LY2A 1D4M2 4E4HA 2RMU3 1H6XA 3F2ZA 1JU3A 3OJBA 5F5IA 4CA9A 1SLBA 3K51A 1U5YA 5FZ4A 1AR91 1H2KA 2HEVF 4Q0QA 5DDJ2 4AEMA 4PLMA 3UGGA 4N8MA 1HIXA 2RS51 3W9AA 4MGZE 2EVXA 1W2OA 1QMJA 4GZ9A 1Q8SA 1R093 2WWJA 4KWKA 4EQVA 4KGGA 1WMEA 4Q0VA 5C8CA 1W8ZA 1YC61 1SBDA 3RZZA 5K0UC 2WSUA 1UOBA 2WNOA 1VBB2 2MEV1 5G05L 4A6OA 1PZ9A 4QX0A 5GM0A 3I2GA 3WNNA 1OOPC 4CP9A 3ZX7A 1KEXA 2E6VA 3JD72 1WMFA 3POWA 4B4RA 2Z69A 4DEVA 5FBZA 1JTZX 3H3LA 5T5LA 5LATA 4Y24A 4FOQA 1UMZA 2VUAA 3PNAA 1AL22 4IEVA 4PIZA 4Q8KA 1PNGA 1XXNA 1PGL2 2RS13 1AYM3 3UGHA 4DOUA 3VDDB 1O3SA 3M3OA 4AVCA 3HT1A 4E4ZA 2W47A 3K2OA 1FI2A 3ATGA 3WVJA 1EAH3 1RUF3 2OYZA 1PGW1 3EMRA 3K4ZA 1W3VA 1EY2A 4U36A 3OUJA 2J7MA 3NV1A 2DU1A 4MGQA 4DUXA 5E6HA 1Y9MA 3JXSA 3NJYA 5D1IA 4COZA 2BQPA 4O9GA 1FOD1 2ZX4A 4LBLA 4ZONA 1HB1A 4MGKE 5DUWA 1GWLA 5J36A 3WINE 1NXMA 2IZWA 2P4EA 1UIKA 4MX3A 3E6CC 2OW4A 2BVBA 2V72A 3PMSA 4IEQA 4V1PA 4XHBA 5CYYA 2DV9A 4HSJA 5FZIA 5I0TA 1FV2A 4P00B 3MIGA 1VE0A 5A3NA 1H1AA 2W5FA 4M4PA 1POQA 1SG3A 1UO9A 1RUJ3 3PDQA 4XMIA 5FZFA 5JOYA 3O14A 2BWAA 4UOJA 2BTVC 2MEV3 1WCSA 2KR2A 1DLCA 3PUQA 2YU2A 2JE8A 3JD71 1W39A 1BK1A 1O4ZA 4LPLA 4YW7A 2JIJA 1US2A 2VL4A 4GMP3 4IE6A 5L36A 2BBVA 2HJIA 3BIWE 4Y4YA 4CCKA 3SEEA 3NV3A 3VDAA 3OSDA 1WLCA 5F6KA 3E6DA 3MIFA 2Z2SB 3RZMA 3V0BA 2QDNA 2ENRA 2PHRA 2VO5A 1SMVA 2XVKA 2OKXA 5CISA 2LUWA 3I97A 2R6QA 1K5JA 2E53A 5IK8A 2OIIA 5A3LA 1JH5A 4YM2A 3BOPA 5F8PA 1VLNA 4FFIA 4LULA 1QOSA 4XFFA 3J4UH 4XFHA 4AQ2A 3IIAA 2R061 2C9AA 2V09A 3THPA 4XDOA 4B4QA 3IPVB 1QGLA 2D6MA 1GICA 2OPWA 3S7EA 1NCQA 4GB33 2B39A 3BALA 3E5QA 2W92A 5FIXA 3H0OA 3AYDA 2D98A 3H7JA 4IV3A 4PQ9A 4BLJA 3ZYJB 1HN0A 1WA6X 4C1XA 4HKWA 1OKQA 1WLDA 1W2UA 5F39A 4D3WA 3WNPA 1POV3 1HRI2 2CGNA 1WKYA 4QMAA 2X53S 4E27A 1H9PA 4FQZA 1GBGA 3GALA 2FQPA 3PL0A 4D69A 2R043 1CN1A 2XJRA 2X8KA 3AMHA 3RWKX 3ME2A 1I6XA 1W8NA 4PLNA 2QQKA 1HDKA 3B02A 5A7OA 3SEPA 1IPSA 1KDKA 1ULDA 2Y0IA 3V0BB 1GUIA 4OI4A 5FY7A 3BU7A 3D3AA 2C9KA 3O0XA 5I0SA 5FPVA 3KGZA 4JTNA 2FCTA 3FC0A 1V6OA 5FLIA 3JBG3 1BZWA 2JDHA 4XJWA 1W6NB 1RUNA 1SDDB 5CKQA 1UYXA 4YPJA 3GDBA 1X50A 1OOPB 3QOPA 2I45A 1QJX2 3I3MA 1LEDA 3MIDA 5DPNA 2R063 1PNFA 3NV2A 4OLLA 4EROA 3B93A 1NG0A 1Z7S3 2QE3A 2ZJCA 3MYXA 3IWZA 3NO8A 5B4XA 1LHVA 2BUKA 5LA9A 3T3YA 1R083 4AEJA 3NNLA 3M1HA 3ZYIB 3WDUA 5BNOC 4GWJA 5HCHA 3WF2A 4JVAA 4GB32 2ZMLA 4Y20A 4ASKA 3K77A 3LCPA 4QPYA 1QJU2 4CCLA 5EZWA 4CUBA 5SV8A 1K45A 1PMJX 1IKPA 2JG8C 3WUDA 2VVEA 2W0XA 4JX0A 1O8SA 1A8MA 5DG2A 3VBFC 3ZYFA 4DXSA 2WO7A 5L19A 5F5QA 3WZ1A 2AGSA 4YW1A 2BGPA 4EN7B 2Y6KA 4N9IA 4MG2A 2CAVA 3P1IA 1V9U2 5EWSA 1UNBA 1AZDA 2VNVA 2BV4A 4JHZA 3GGLA 4XBLA 2A71A 3MBWA 4CDQA 4AK3A 3HQUA 3KB5A 1XC6A 2B9VA 1Z7S1 1VPHA 4J1XA 3RVHA 4QX8A 1W9SA 3VV1A 4CEWA 5FMBA 1RJ7A 2PLV2 3FX3A 4I02A 2WN3A 2A6VA 5AVPA 1AXYA 3JZVA 2R0HA 3IN9A 3I54A 5T50A 4YW2A 4GH4A 2QFEA 3W20A 1C4RA 3GM8A 4LBQB 3M3EA 3HQXA 4XABA 3HJRA 4LMFA 2G19A 4BIFA 3IB3A 1S2EA 1AL23 3KV4A 3WF1A 4XIKA 1D0GA 1W6OA 4LLOA 3IAPA 3J8F2 5JVVA 5GZFA 3WCSA 1BBT2 4GXLA 1UPIA 1NOVA 1FMD2 2WT0A 3KVBA 3MICA 4LKDA 4XXAA 1AX2A 1RB8G 2IVJA 3KT4A 4J1WA 3HBKA 2XLGA 4CDXA 5A6ZA 1QQP1 3NL1A 3POEA 1VRH3 4CEWC 4FOVA 3J7NA 1UXZA 4HONA 4AL9A 4CU9A 1KS5A 3Q8AA 4MGYE 3M2MA 3H1YA 1UU5A 4XF0A 5C4WB 1RUD2 5FLJA 3IMMA 4K1YA 3WDVA 2ES3A 1RUE2 4CDWA 1OFSA 2ZX1A 4RR3B 3Q9OA 1G7YA 3FMGA 1IPJA 3AZZA 4N43B 2VAUA 2GC0A 4NHXA 5I93A 2G1MA 2AC1A 5C3QA 3MUY1 3THCA 5J96B 1UX6A 1O7FA 2CYFA 3ZSLA 3ZFFC 3AMQA 2FZ2A 1F35A 4PBOA 3SHRA 1AX0A 2P3IA 3CL1A 1PK6C 2WQZC 5FZ8A 4EYUA 1OF3A 2Q1MA 4Z82A 1VAMA 4DINB 3SCGA 1ENSA 4Q4W1 1D0HA 3GCXA 4XJAA 4YM1A 5DUUA 3TN92 3GZUC 1RVF3 3DPRA 2LTNA 2PLV3 2XJTA 2ZGMA 1C8M2 2WS91 1RMU2 3BN6A 1SPPA 4I0BA 5FZCA 3UGFA 1O8PA 2WNUA 4L11A 4E8DA 5K7PA 2WYFA 3LIHA 5LEJA 5A70A 3B3QE 4Z2WA 1PIV3 3S0MA 1NT0A 3LKJA 3SLIA 1WW4A 4LOSA 1VP6A 4QXBA 2E63A 4C90A 2HWC2 2XONA 3ZM8A 4INDA 1FAYA 1AYN1 1F4HA 2V5DA 3J8F3 1JBCA 2XL7A 3ES1A 4AR2A 3Q8EA 1GQGA 5JDBA 3NRUA 4AI9A 1RTVA 1MACA 1WMXA 5FPAA 3TN91 1YYNA 2VTXA 5JI7A 2YUEA 1Y7BA 1UL9A 1TG7A 1YNAA 1VBA3 4H2AA 5FXXA 3WQ1A 3O5SA 1QU0A 1D4VB 2HBUA 5FPLA 3WSOA 5CZKA 1QQP2 1UPSA 2DVBA 5KHHA 3NQHA 4NWVA 3U0ZA 1ND3A 1AR61 2C5DA 3AYAA 3MLLA 1MQTA 3T0BA 3WQBA 1RUG2 4D7YA 4NIHA 3M70A 4BM8A 1W8WA 3LEIA 1NUKA 4QKBA 4P02B 3FLRA 4W8JA 4CEYC 3MDPA 4FAHA 3VD9A 3OY8B 5DG1A 2J1UA 3BPZA 3V56A 3EYPA 1CPNA 4TLFA 1NA1A 3OB8A 4XFIA 4NAMA 1UIJA 2R072 3RG0A 4CDUC 2ZGRA 1H9WA 3K3OA 3S57A 4XE9A 5I0DA 2PLV1 2H0BA 1ASJ3 4YW5A 5LB6A 1RVF2 4TXWA 4IW3A 4AI8A 4MGTA 1OA3A 5HV0A 2Q30A 1HQLA 1PK6A 1L3JA 4CE8A 1G9CA 4QX3A 2VY0A 5A6YA 4KL1A 3P3PA 1I5ZA 3GBGA 4PCRA 3FFQA 1HXS3 5K9YA 2GN7A 3LSEA 2R30A 3A21A 5EHDA 5FYHA 2Y6LA 2XLAA 2VBPA 5HCFA 1AYM2 2JG8B 3HMYA 4Y22B 5FJHA 2WQ8A 1GANA 3C7FA 1W6OB 4QM9A 1Z7S2 1X9PA 2CL2A 2O8QA 1H8TC 2DTWA 5C70A 3V0AA 2ZGOA 5FZGA 2GMPA 4UFLA 5BNNC 1OD5A 1R1ZA 2ATFA 4D6QA 1MEC1 1OH3A 1W2TA 1ND2C 4I09A 1IS4A 1MR5A 4LO5B 3ROUA 2HWD2 4AG4A 4COUA 5F1RA 5IK4A 5AVAA 2G9FA 2UWBA 1BQPA 3KV5A 1YXWA 3WV6A 3AKTA 3KSCA 4NHKA 1XRUA 3BUCA 1Y3TA 1WGPA 2BBAA 2TUNA 2BOJA 1JMUB 4WVZA 1LU2A 4CP0A 3VHNA 4RS5A 3HR9A 3OGGA 4META 4HK8A 2EICA 1BJQA 1JYCA 3FLTA 5T55A 1YJKA 3EO6A 5LA0A 2DF7A 4Q0PA 3SC7X 3PUSA 3B9IA 4MXWA 3ZLIA 1U5XA 2VM9A 1ULFA 2AACA 2RR11 3VZJA 4XUOA 5L9VA 1X8EA 4PHZA 3H3UA 2Y26A 4LHLA 5FWEA 5JR7B 5FYVA 1LNSA 3WF3A 1L7RA 5C8WA 5IVEA 2RVAA 4MLOA 1PVXA 5J98B 2RS33 4XAAA 3VDDA 4HPKA 4ARYA 5BV6A 3VN4A 4M3CB 4UBGA 1RYYA 2D43A 1DZTA 4DUWA 3QH7A 2CY6A 3AL5A 4Y1XA 1LB2A 4O61A 4YW3A 2PHLA 1MVQA 5I8SA 4WZCA 1VB4A 1DGWA 4GALA 4RHV3 5E1RA 3T2TA 1DFQA 2XKPA 3ZFFB 5FYTA 4LKEA 4NR1A 4ASMB 4XF1A 2PFWA 4CU7A 2IUWA 2P34A 1XSQA 1GU3A 4AXOA 1YJLA 1MZFA 1G9FA 3I3EA 4FPCA 4B1LA 2MPFA 3CKHA 4FFHA 1W6QA 1XNCA 5BNPA 2YXSA 4QGNA 3LB9A 4H14A 4BLIA 3SXWA 4PT6A 1MS8A 2HYXA 4HN0A 1RHI1 5C4WC 4HETA 2YC2A 3ES4A 3FLPA 5A33A 1TMF2 1DBNA 1PZ7A 1S4CA 4ZU4A 4N7IA 1ZRRA 4RR3C 4UFMA 3VBHA 2W68A 3ZYHA 1ULPA 2BWCA 2WDBA 2Y0OA 1W6MA 5FMOS 4CEYB 2XJSA 4OFGA 4YG3A 1VAKA 5FQ0B 1ULEA 3ZMNA 5HI0A 4E4DX 1ACCA 4P9LA 2RR12 3LEMA 4UWDA 1WLTA 4R4ZA 1H8TA 5I0UA 4AZZA 1RINA 1Y9QA 3OD0A 4YRDA 4AI1A 1FNYA 5JI9A 4R9DA 4CUAA 2BERA 4DIQA 2C26A 2W52A 5DAPA 2BYVE 1PK6B 3ZFGA 4AQSA 1ENRA 3V65A 1BYHA 3VBRA 1QJFA 3NAPB 4GULA 1H2NA 1UY3A 4J6GA 4L99A 4LLFA 3KV6A 3WW3A 3SMHA 2NZ9A 3MFAA 4NO4A 1TNFA 2XKOA 5GLWA 5FWJA 1JOJA 4YM3A 1QHDA 4JGZC 5IK7A 2XBO2 3LF7A 4JZRA 3AZVA 5ABJB 1VBA2 4Y33A 5AFBA 4R8HA 3D0SA 1QJEA 2ID4A 1H8VA 4YVSC 1EYBA 1MS4A 1V6JA 1VAVA 4QU1A 3ZDVA 3SNMA 1C1LA
chains in the Genus database with same CATH topology
1JU3A 2J22A 3T0AA 2YFUA 5JXIA 1ULOA 3WNMA 2VTFA 4GZ9A 1K3IA 4A42A 4OMCA 3ECQA 2QQJA 1JZ4A 1XPWA 1HN1A 2JD9A 3DYOA 3MUZ1 1PX4A 5G05L 3WEZA 4QB6A 4A6OA 4QX0A 4QPWA 3I2GA 3WNNA 4W4ZA 4KI5M 1KEXA 2YG0A 5HXMA 3ETPA 3T2PA 5DMYA 4DEVA 2Z4FA 3I2IA 2ZXQA 3FL7A 3OG2A 2EIBA 2W91A 2VC9A 1PMHX 1JZ3A 4BXSV 2W47A 4A41A 3K4ZA 2XOMA 4QX1A 3CZUA 4PF1A 1UWWA 4L0PA 4ARXA 5DN2A 2J7MA 4MGQA 4MGSA 4DUXA 3JXSA 5LA1A 3A23A 3ACHA 2WZEA 1UYZA 3OBAA 3GXUA 2JDAA 3OGVA 5C71A 3I2KA 1DP0A 2V72A 5CYYA 1UY4A 3UESA 4OYUA 4P00B 3E1F1 2W5FA 4M4PA 1SG3A 1IQDC 4OMDA 4UOJA 1UXXX 1DLCA 2JE8A 4LPLA 4QDQA 4Z2AA 1US2A 2VL4A 1W9TA 3SEEA 3CMGA 1DYOA 3VDAA 5IFPA 2CDOA 5A1AA 5J1XA 3IIIA 2WABA 1JI6A 4CVUA 4GWIA 2VO5A 2OKXA 3K75B 3THDA 3I97A 1JYVA 4UI9L 5G04L 2ZEYA 4ZXEA 4TTGA 1UMHA 3LEKA 4OZOA 5LCWL 2WBKA 3T08A 1EUTA 4LHSA 4QDRA 4A4AA 3SKJE 4LQRA 2E32A 1BHGA 1OH4A 2W92A 3CIHA 3HEIA 3HNYM 3NJVA 1NKGA 3VD3A 3BGAA 3CQOA 1JHJA 5JXGA 2VCBA 5JR2A 3C7HA 3WNPA 1WKYA 3VD5A 4AAXA 5JXHA 1CX1A 2E31A 1JZ8A 2VQUA 3LE0A 2DCKA 2VMDA 2WYSA 2VZUA 2Y6HA 4XVHA 2E33A 3C7EA 1CZSA 1W8NA 3WNOA 2QQKA 3SEPA 2B4KA 3U37A 1GUIA 3D3AA 2C9KA 4FI9A 4MO3M 1OF4A 4IUGA 1T2XA 3IDAA 4HG6B 1WCQA 1J84A 1UX7A 1SDDB 1UYXA 4YPJA 3GDBA 1F4AA 3WNLA 2YFZA 2X09A 1W9WA 1OD3A 4P08A 5DPNA 1CIYA 5DQ0A 2LW8A 5B4XA 1JYXA 4GWJA 3WF2A 1JZ6A 3K77A 2RJ2A 3C7GA 2VZVA 4CUBA 2VZOA 1PMJX 1K45A 3LQCA 2W3JA 3W5MA 3VD4A 1UYYA 2J1RA 4JX0A 2EIEA 1O8SA 3HPNA 4DXSA 4CU8A 3A22A 4JKMA 1XNAA 1JZ2A 1YQ2A 2BGPA 3LPFA 2Y6KA 3C7OA 2VZ3A 1TVGA 1H6YA 3P1IA 4DXRA 4QX2A 2W9XA 3PUHA 3WF4A 4JHZA 3GGLA 1I5PA 2W1SA 3MBWA 4XUPA 2WUHA 2VOTA 3VDBA 1XC6A 2B9VA 1W9SA 3W5NA 2WN3A 3GM8A 3MV01 5EJ1B 4LKSA 2Y6JA 3CZJA 1JU4A 2WO2A 3HJRA 2VQTA 3IB3A 2JKXA 2WAOA 1L7QA 3WF1A 4P5YA 3IAPA 3I2FA 5EIYB 4D8MA 4UAPA 5IYYA 2YC4A 2ORZA 2V4VA 1NX9A 1K42A 1UXZA 4CU9A 4XURA 4XUNA 1EUUA 2XQXA 1CZTA 3HOBA 3P6BA 2XHNA 1XNTA 2W1WA 3K46A 1SHWB 2BGOA 3MUY1 3FHAA 3OEAA 4QDSA 3THCA 3NJXA 3T2QA 3T09A 4W50A 1UY2A 4JKLA 1PX3A 2Y6GA 1OF3A 3I3DA 1JYWA 3CDZB 1UY0A 2QQMA 3K4DA 4KWUA 3BN6A 1O8PA 3VDCA 4E8DA 2WZ8A 4MADA 5JUVA 2WO1A 2XONA 3SKVA 4RN5A 3ZM8A 4A44A 2V5DA 1F4HA 2QQLA 3UETA 2VZPA 3NRUA 2VMEA 4CUCA 1P8JA 3J7HA 5JXJA 2ZEZA 1UZ0A 1TG7A 2R7EB 2HLEA 2X10A 3WSOA 1D7PM 3VD7A 2Y8KA 5CZKA 2L9LA 2QQIA 2W46A 3NQHA 5IFTA 4XZUG 3T0BA 3WQBA 2J1EA 4E8CA 1GMMA 2J1AA 1NUKA 2VZQA 3LEIA 4P02B 4DUVA 4W8JA 3VD9A 2Y64A 2J1UA 3DYPA 2WN2A 3EYPA 3HN3A 3PUIA 1GQPA 2VCAA 5JMOA 3OB8A 2QQNA 1JZ7A 3DYMA 5I0DA 1JZ5A 1UMIA 3ACFA 4DEQA 4BJ0A 4TXWA 4DXTA 2ORXA 2WO3A 4JKKA 4QX3A 1K12A 4ZZ5A 4QB1A 1W0NA 4A45A 4PQQA 1UY1A 3A21A 5IHRA 4BDVB 2Y6LA 2VZ1A 4A3ZA 2X05A 2VMCA 3OEBA 1W8OA 2WQ8A 3C7FA 5C70A 3OGSA 3A7QA 3ACGA 1US3A 2BZDA 5HPOA 3LEGA 1R64A 4M4RA 2RV9A 4AG4A 3AC0A 1KGYA 2W95A 4QB2A 2BBAA 3I3BA 3K4AA 2DCJA 2VZRA 2ZEXA 3ACIA 1CZVA 2KD7A 5EJZB 2EICA 5LA0A 2CDPA 1GOHA 1GOGA 2VM9A 4XUOA 3EB7A 2VJXA 5FUIA 4BK5A 3I2JA 1LNSA 3WF3A 1L7RA 2J1TA 2RVAA 2W1UA 3T0DA 3MV11 2C4XA 2J1SA 4ARYA 2W1QA 5B4NA 4ZZ8A 1RYYA 4DUWA 3DECA 5IJRA 2W94A 2DDUA 3HNBM 5F7UA 4CU7A 1GU3A 2ZEWA 2YB7A 1O59A 4BK4A 3I3EA 4KMQA 4RYDA 4QAWA 3CKHA 4XUTA 3C8XA 4XUQA 2VR4A 1OT5A 4PT6A 2VCCA 5LA2A 2HYXA 3OGRA 2YC2A 3FN9A 4ZY9A 1GOFA 3WNKA 3MO4A 4OUEA 2LS6A 3LPGA 3ABZA 2W87A 1ULPA 1NAEA 2WDBA 2WAAA 2QBXA 2EIDA 4D0QA 1MPXA 2E26A 4CUAA 2BERA 1J83A 2C26A 3UNPA 2VZSA 2VMFA 1JYNA 1W99A 2PQSA 1UY3A 3T2OA 3I2HA 3WF0A 3HNMA 4CU6A 2VZTA 3NNGA 2J1VA 2QQOA 4MOAA 5C7GA 3FHQA 4ET7A 1GNYA 2ID4A 3IAQA 1H6XA 3F2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JU3 A;  2J22 A;  3T0A A;  2YFU A;  5JXI A;  1ULO A;  3WNM A;  2VTF A;  4GZ9 A;  1K3I A;  4A42 A;  4OMC A;  3ECQ A;  2QQJ A;  1JZ4 A;  1XPW A;  1HN1 A;  2JD9 A;  3DYO A;  3MUZ 1;  1PX4 A;  5G05 L;  3WEZ A;  4QB6 A;  4A6O A;  4QX0 A;  4QPW A;  3I2G A;  3WNN A;  4W4Z A;  4KI5 M;  1KEX A;  2YG0 A;  5HXM A;  3ETP A;  3T2P A;  5DMY A;  4DEV A;  2Z4F A;  3I2I A;  2ZXQ A;  3FL7 A;  3OG2 A;  2EIB A;  2W91 A;  2VC9 A;  1PMH X;  1JZ3 A;  4BXS V;  2W47 A;  4A41 A;  3K4Z A;  2XOM A;  4QX1 A;  3CZU A;  4PF1 A;  1UWW A;  4L0P A;  4ARX A;  5DN2 A;  2J7M A;  4MGQ A;  4MGS A;  4DUX A;  3JXS A;  5LA1 A;  3A23 A;  3ACH A;  2WZE A;  1UYZ A;  3OBA A;  3GXU A;  2JDA A;  3OGV A;  5C71 A;  3I2K A;  1DP0 A;  2V72 A;  5CYY A;  1UY4 A;  3UES A;  4OYU A;  4P00 B;  3E1F 1;  2W5F A;  4M4P A;  1SG3 A;  1IQD C;  4OMD A;  4UOJ A;  1UXX X;  1DLC A;  2JE8 A;  4LPL A;  4QDQ A;  4Z2A A;  1US2 A;  2VL4 A;  1W9T A;  3SEE A;  3CMG A;  1DYO A;  3VDA A;  5IFP A;  2CDO A;  5A1A A;  5J1X A;  3III A;  2WAB A;  1JI6 A;  4CVU A;  4GWI A;  2VO5 A;  2OKX A;  3K75 B;  3THD A;  3I97 A;  1JYV A;  4UI9 L;  5G04 L;  2ZEY A;  4ZXE A;  4TTG A;  1UMH A;  3LEK A;  4OZO A;  5LCW L;  2WBK A;  3T08 A;  1EUT A;  4LHS A;  4QDR A;  4A4A A;  3SKJ E;  4LQR A;  2E32 A;  1BHG A;  1OH4 A;  2W92 A;  3CIH A;  3HEI A;  3HNY M;  3NJV A;  1NKG A;  3VD3 A;  3BGA A;  3CQO A;  1JHJ A;  5JXG A;  2VCB A;  5JR2 A;  3C7H A;  3WNP A;  1WKY A;  3VD5 A;  4AAX A;  5JXH A;  1CX1 A;  2E31 A;  1JZ8 A;  2VQU A;  3LE0 A;  2DCK A;  2VMD A;  2WYS A;  2VZU A;  2Y6H A;  4XVH A;  2E33 A;  3C7E A;  1CZS A;  1W8N A;  3WNO A;  2QQK A;  3SEP A;  2B4K A;  3U37 A;  1GUI A;  3D3A A;  2C9K A;  4FI9 A;  4MO3 M;  1OF4 A;  4IUG A;  1T2X A;  3IDA A;  4HG6 B;  1WCQ A;  1J84 A;  1UX7 A;  1SDD B;  1UYX A;  4YPJ A;  3GDB A;  1F4A A;  3WNL A;  2YFZ A;  2X09 A;  1W9W A;  1OD3 A;  4P08 A;  5DPN A;  1CIY A;  5DQ0 A;  2LW8 A;  5B4X A;  1JYX A;  4GWJ A;  3WF2 A;  1JZ6 A;  3K77 A;  2RJ2 A;  3C7G A;  2VZV A;  4CUB A;  2VZO A;  1PMJ X;  1K45 A;  3LQC A;  2W3J A;  3W5M A;  3VD4 A;  1UYY A;  2J1R A;  4JX0 A;  2EIE A;  1O8S A;  3HPN A;  4DXS A;  4CU8 A;  3A22 A;  4JKM A;  1XNA A;  1JZ2 A;  1YQ2 A;  2BGP A;  3LPF A;  2Y6K A;  3C7O A;  2VZ3 A;  1TVG A;  1H6Y A;  3P1I A;  4DXR A;  4QX2 A;  2W9X A;  3PUH A;  3WF4 A;  4JHZ A;  3GGL A;  1I5P A;  2W1S A;  3MBW A;  4XUP A;  2WUH A;  2VOT A;  3VDB A;  1XC6 A;  2B9V A;  1W9S A;  3W5N A;  2WN3 A;  3GM8 A;  3MV0 1;  5EJ1 B;  4LKS A;  2Y6J A;  3CZJ A;  1JU4 A;  2WO2 A;  3HJR A;  2VQT A;  3IB3 A;  2JKX A;  2WAO A;  1L7Q A;  3WF1 A;  4P5Y A;  3IAP A;  3I2F A;  5EIY B;  4D8M A;  4UAP A;  5IYY A;  2YC4 A;  2ORZ A;  2V4V A;  1NX9 A;  1K42 A;  1UXZ A;  4CU9 A;  4XUR A;  4XUN A;  1EUU A;  2XQX A;  1CZT A;  3HOB A;  3P6B A;  2XHN A;  1XNT A;  2W1W A;  3K46 A;  1SHW B;  2BGO A;  3MUY 1;  3FHA A;  3OEA A;  4QDS A;  3THC A;  3NJX A;  3T2Q A;  3T09 A;  4W50 A;  1UY2 A;  4JKL A;  1PX3 A;  2Y6G A;  1OF3 A;  3I3D A;  1JYW A;  3CDZ B;  1UY0 A;  2QQM A;  3K4D A;  4KWU A;  3BN6 A;  1O8P A;  3VDC A;  4E8D A;  2WZ8 A;  4MAD A;  5JUV A;  2WO1 A;  2XON A;  3SKV A;  4RN5 A;  3ZM8 A;  4A44 A;  2V5D A;  1F4H A;  2QQL A;  3UET A;  2VZP A;  3NRU A;  2VME A;  4CUC A;  1P8J A;  3J7H A;  5JXJ A;  2ZEZ A;  1UZ0 A;  1TG7 A;  2R7E B;  2HLE A;  2X10 A;  3WSO A;  1D7P M;  3VD7 A;  2Y8K A;  5CZK A;  2L9L A;  2QQI A;  2W46 A;  3NQH A;  5IFT A;  4XZU G;  3T0B A;  3WQB A;  2J1E A;  4E8C A;  1GMM A;  2J1A A;  1NUK A;  2VZQ A;  3LEI A;  4P02 B;  4DUV A;  4W8J A;  3VD9 A;  2Y64 A;  2J1U A;  3DYP A;  2WN2 A;  3EYP A;  3HN3 A;  3PUI A;  1GQP A;  2VCA A;  5JMO A;  3OB8 A;  2QQN A;  1JZ7 A;  3DYM A;  5I0D A;  1JZ5 A;  1UMI A;  3ACF A;  4DEQ A;  4BJ0 A;  4TXW A;  4DXT A;  2ORX A;  2WO3 A;  4JKK A;  4QX3 A;  1K12 A;  4ZZ5 A;  4QB1 A;  1W0N A;  4A45 A;  4PQQ A;  1UY1 A;  3A21 A;  5IHR A;  4BDV B;  2Y6L A;  2VZ1 A;  4A3Z A;  2X05 A;  2VMC A;  3OEB A;  1W8O A;  2WQ8 A;  3C7F A;  5C70 A;  3OGS A;  3A7Q A;  3ACG A;  1US3 A;  2BZD A;  5HPO A;  3LEG A;  1R64 A;  4M4R A;  2RV9 A;  4AG4 A;  3AC0 A;  1KGY A;  2W95 A;  4QB2 A;  2BBA A;  3I3B A;  3K4A A;  2DCJ A;  2VZR A;  2ZEX A;  3ACI A;  1CZV A;  2KD7 A;  5EJZ B;  2EIC A;  5LA0 A;  2CDP A;  1GOH A;  1GOG A;  2VM9 A;  4XUO A;  3EB7 A;  2VJX A;  5FUI A;  4BK5 A;  3I2J A;  1LNS A;  3WF3 A;  1L7R A;  2J1T A;  2RVA A;  2W1U A;  3T0D A;  3MV1 1;  2C4X A;  2J1S A;  4ARY A;  2W1Q A;  5B4N A;  4ZZ8 A;  1RYY A;  4DUW A;  3DEC A;  5IJR A;  2W94 A;  2DDU A;  3HNB M;  5F7U A;  4CU7 A;  1GU3 A;  2ZEW A;  2YB7 A;  1O59 A;  4BK4 A;  3I3E A;  4KMQ A;  4RYD A;  4QAW A;  3CKH A;  4XUT A;  3C8X A;  4XUQ A;  2VR4 A;  1OT5 A;  4PT6 A;  2VCC A;  5LA2 A;  2HYX A;  3OGR A;  2YC2 A;  3FN9 A;  4ZY9 A;  1GOF A;  3WNK A;  3MO4 A;  4OUE A;  2LS6 A;  3LPG A;  3ABZ A;  2W87 A;  1ULP A;  1NAE A;  2WDB A;  2WAA A;  2QBX A;  2EID A;  4D0Q A;  1MPX A;  2E26 A;  4CUA A;  2BER A;  1J83 A;  2C26 A;  3UNP A;  2VZS A;  2VMF A;  1JYN A;  1W99 A;  2PQS A;  1UY3 A;  3T2O A;  3I2H A;  3WF0 A;  3HNM A;  4CU6 A;  2VZT A;  3NNG A;  2J1V A;  2QQO A;  4MOA A;  5C7G A;  3FHQ A;  4ET7 A;  1GNY A;  2ID4 A;  3IAQ A;  1H6X A;  3F2Z A; 
#chains in the Genus database with same CATH topology
 4AGR A;  1O4Y A;  1ZBE 3;  2J22 A;  2IXJ A;  3T0A A;  3R4D B;  5H9R A;  3U4S A;  1AXK A;  3O0V A;  1XQN A;  1N3Q A;  3HQR A;  1FOD 2;  1UYP A;  1OQE A;  4M01 A;  4BME A;  2ZGQ A;  1B09 A;  2VTF A;  1MQT C;  1JZ4 A;  2GP3 A;  4NWW A;  3ZFG C;  3ASI A;  3ZKY A;  1CWP A;  3M3C A;  1HN1 A;  3ZXA C;  2JD9 A;  2OUJ A;  4FPK A;  4IE7 A;  3B5L B;  2MEV 2;  1UZV A;  4UFJ A;  1PX4 A;  3WEZ A;  1ULG A;  1XND A;  4QPW A;  1CES A;  3AB0 A;  2HBT A;  4QQO A;  1PGL 1;  3IDB B;  4IEX A;  4R9A A;  5FYI A;  3N9M A;  4FTB A;  4IL7 A;  3ETP A;  3T2P A;  1YUD A;  3S6P A;  2Z4F A;  4W6Y A;  2ZXQ A;  1LJ7 A;  3RQ0 A;  2BP6 A;  3OBR A;  2BFU L;  1LOC A;  3DEM A;  2P3J A;  5FP7 A;  2VXR A;  2W91 A;  2VC9 A;  1CX4 A;  5LBE A;  3NW4 A;  1QIQ A;  4WM8 A;  4HPK B;  4ZPI A;  3EXU A;  1YFX A;  2J42 A;  4Y4R A;  4FVV A;  1JZ3 A;  4M3C F;  2GH8 A;  2WSV A;  1D4M 1;  2BPA 2;  2E7T A;  2GU9 A;  2V4A A;  2XOM A;  1ZBA 3;  2B7Y A;  3V64 A;  4L0P A;  3APB A;  2BDR A;  3I4I A;  4YZ2 A;  1YFY A;  1LR5 A;  5LA1 A;  1ZRE A;  3OBA A;  4XJU A;  4K40 A;  2YU1 A;  5DDJ 3;  5C3P A;  1CAV B;  2C0Z A;  1A8D A;  2P5B A;  2DYC A;  5DXD A;  3WDX A;  1W90 A;  1W6P B;  3UES A;  2XUE A;  2VMI A;  1GSL A;  4EE2 A;  3H8R A;  1XJA A;  4JGY C;  2Q8D A;  4RHV 1;  4YFW A;  4NRM A;  2XJQ A;  4H3W A;  1GP5 A;  2EIG A;  4LIV A;  2W2I A;  1LHU A;  1TE1 B;  5C9A B;  5K4L A;  4WZF A;  4XDP A;  5FZ3 A;  3UYJ A;  3BTZ A;  1ND3 C;  4Z2A A;  1IQA A;  3S5A A;  1WWY A;  4XHX A;  4BWO A;  3CLP A;  5EYY A;  5BNQ A;  1C8M 1;  1PO1 1;  3DKQ A;  4PF5 A;  3FJS A;  3OBT A;  5FKB A;  5TSW A;  1YQ6 A;  4D6S A;  1QJY 3;  2WAB A;  1QWR A;  1UCX A;  2BVV A;  3X29 B;  3IM0 A;  4FBF A;  2FCV A;  5J37 A;  5GAL A;  4HT1 T;  1JYV A;  1SBE A;  5G04 L;  4IEW A;  2JD4 A;  2ZEY A;  1CVN A;  4ZXE A;  4NPM A;  1UMH A;  2UYA A;  1GZW B;  3LEK A;  1C8N A;  4XF3 A;  5T5P A;  4AGV A;  4COV A;  1WD4 A;  5LRS A;  5C4W A;  1IHM A;  1VBE 3;  4TYS A;  2SLI A;  3T08 A;  1EAH 2;  3O1T A;  1J3P A;  1ND2 A;  3SKJ E;  2BW8 A;  1OH4 A;  1SDW A;  1IS5 A;  1ONA A;  1WCK A;  5ABJ A;  3HEI A;  3VKO A;  4AW7 A;  3RMY A;  3FUO A;  3A4U A;  3BGA A;  4I3P A;  5ISL A;  3PLQ A;  3RZL A;  1G9D A;  3T30 A;  1VB2 A;  5HCB A;  3WHU A;  2F4P A;  2HWE 1;  3C7H A;  3GF6 A;  1DQ1 A;  1W04 A;  2XJU A;  3PIG A;  3RJR A;  4K21 A;  3MPP G;  4AAX A;  3GBF A;  2FCU A;  2A73 B;  2SBA A;  3VBF A;  2E31 A;  1HV1 A;  5FV3 A;  1RUJ 2;  2CTV A;  2VMD A;  2WYS A;  4QHB A;  3MIB A;  2VZU A;  3N4M A;  2DUQ A;  1DQ6 A;  4OI2 A;  3ZYB A;  2BNM A;  3WDY A;  2AH2 A;  1BK0 A;  3OPT A;  3WNO A;  3PJQ A;  2RJK A;  2DFB A;  2H0V A;  4CDQ B;  1O3R A;  4MHR A;  1Z0H A;  3P3N A;  4PI2 A;  1C57 A;  4BQ3 A;  4AFB A;  4BXF A;  2PTM A;  3TYJ A;  4XC9 A;  3N7L A;  1BVP 1;  1GZ9 A;  3IDC B;  1H1I A;  4GH4 B;  4RFR B;  4YVS B;  5F3E A;  4IE0 A;  5CNA A;  3NJZ A;  4Q4V 2;  3VBO C;  2WL1 A;  4CZS A;  4P08 A;  4GKX A;  4V2V A;  2YY1 A;  1CIY A;  3DF0 A;  2WNV B;  5ANN A;  5DQ0 A;  1NCQ B;  1ZA4 A;  1JYX A;  1NCR A;  2OS2 A;  2ZX0 A;  5FUP A;  1YLL A;  1MQT B;  1Q43 A;  3H50 A;  2VZV A;  2FD8 A;  1DZQ A;  2JIG A;  2VZO A;  2HWD 3;  3AYC A;  2W3J A;  4NHM A;  3W5M A;  3VD4 A;  2VU9 A;  2JKB A;  2EIE A;  2ZZJ A;  4UFI A;  2O1Q A;  1H30 A;  2LRP A;  4GWM A;  3A22 A;  4JKM A;  3W59 A;  2CAU A;  1F31 A;  5FP8 A;  4CCO A;  1NA1 B;  5C3S A;  2VZ3 A;  5A7W B;  1V00 A;  1W06 A;  3VLB B;  4JHT A;  1LTE A;  1GZT A;  3WUC A;  1UF2 C;  3Q8B A;  1QDC A;  4DY3 A;  2A6W A;  5KXE A;  1GWK A;  2ZGT A;  4LK6 A;  4QWN A;  1JYT A;  5CFC C;  1WUV A;  3FWE A;  4AI0 A;  2JDU A;  3VDB A;  3PVB B;  2HWE 2;  2CU5 A;  5A32 A;  4XZP A;  3ZN4 A;  2VMG A;  5FCC A;  5FYS A;  2A6Z A;  5FDB A;  3LGR A;  1AYN 3;  4KBB A;  4AFC A;  1F2N A;  1OXC A;  3I2D A;  1PIV 2;  2Z79 A;  2CHH A;  5FJK A;  1DQ4 A;  2OT7 A;  4HAN A;  4OUM A;  4LKS A;  1JUI A;  4FPL A;  4OZX A;  4XEZ A;  2WO2 A;  4AWD A;  2X29 A;  1X7N A;  2RM2 2;  2VQT A;  2HWC 3;  1L7Q A;  2WAO A;  1KRI A;  3AZW A;  4DY5 A;  2MHF A;  2XXZ A;  4CDU A;  4QX5 A;  1HRI 1;  2WZR 1;  5FYC A;  4M00 A;  5FYM A;  4D8M A;  2YC4 A;  4XFC A;  4C0H A;  4CCN A;  5CFC A;  5IYY A;  4PBP A;  1NX9 A;  3PVN A;  1UZZ A;  4TWT A;  4C1W A;  1U5Z A;  4RHV 2;  4H7L A;  4QKN A;  4AEK A;  1ZBA 2;  2O14 A;  2RS3 1;  3JCI A;  4JRL A;  2XQX A;  4HLT A;  5FXV A;  3RYK A;  2DUO A;  2P1B A;  4WM7 B;  3D6E A;  4BQW A;  1XNT A;  2D7F A;  3DKW A;  1R08 1;  3K46 A;  1PO2 3;  2WII B;  4IV3 B;  1S0C A;  4XJ8 A;  4Y5S A;  1ZZ8 A;  1ND3 B;  2BGC A;  3CF6 E;  2ARC A;  3FHA A;  3OEA A;  3T4H B;  5CU1 A;  5FYY A;  3QD6 A;  1BVV A;  3SIT A;  3GJA A;  2V73 A;  1PX3 A;  2IXH A;  2R07 3;  3MZH A;  5GKA C;  1A78 A;  4XAC A;  3VBF B;  5A6Q A;  1REF A;  3J26 N;  1SBF A;  3HWJ A;  5HBA A;  2B8M A;  2QQM A;  5BNP C;  3PTR B;  4A7K A;  4F7Z A;  5M0T A;  1WA4 A;  1V6M A;  3VKL A;  5JUV A;  4KG0 A;  4ET7 A;  2UUR A;  2EXI A;  4BQX A;  1J3Q A;  1V6K A;  2JDK A;  4NRP A;  1IKQ A;  1GR3 A;  1B35 B;  4RN5 A;  4A44 A;  4CDX B;  4IGP A;  4Y1Y A;  1W6N A;  2P6H A;  3MHZ A;  4CUC A;  2NPI A;  3R6S A;  1HKD A;  1OUX A;  2H6C A;  4BMB A;  3L2Y A;  3ZFF A;  1LOF C;  3N9L A;  2WA4 A;  4NIA A;  4GD4 A;  2JG8 A;  4LO7 A;  4UT5 A;  1UZ0 A;  4B4P A;  3QAC A;  3VBO B;  4HSL A;  2P3Y A;  5EFU A;  4UBH A;  4QGL A;  5CBL A;  1N47 A;  3VZL A;  1HXS 1;  1D7P M;  4IEO A;  4R9B A;  3RMX A;  1LU1 A;  1PM4 A;  1V6L A;  2R1B A;  2HWB 1;  3GNE A;  5FZA A;  1RUE 3;  4DZG A;  1Q8P A;  1NCR B;  5IFT A;  2RDS A;  4Z07 A;  2J1E A;  4AHW A;  3QCW A;  2P37 A;  5CKM A;  2J1A A;  4QGM A;  2GNM A;  2WZP P;  4LBO A;  4NUB A;  4C8D A;  3AVS A;  3ZN6 B;  1Q8Q A;  4QPG B;  1PZ8 A;  1DG6 A;  3RZG A;  3PUI A;  5JMO A;  2ET7 A;  4RA0 A;  1QXJ A;  2XL9 A;  3BKZ A;  1UN1 A;  1REE A;  2G9G A;  1URX A;  4NOT A;  4NRO A;  1UU6 A;  4RS5 C;  1JZ7 A;  5LK7 B;  5KXD A;  2WLQ A;  1UMI A;  5KHG A;  1JZ5 A;  4DEQ A;  5FPB A;  1PO1 3;  1AJO A;  1C8M 3;  1S0D A;  4Q8L A;  5JMC A;  4DXT A;  1Y43 B;  4RD7 A;  3WX5 A;  5AC9 3;  1U5I A;  4PIX A;  3CJI C;  1LEN A;  1RXF A;  3ZOI A;  4K1Z A;  1FT9 A;  1VBB 1;  3LFI A;  4JQT A;  4JKK A;  1MZE A;  1I9R A;  2ZOE B;  2K2S A;  3VBU C;  3WG1 A;  1W0N A;  1V6I A;  4QXK A;  3WP6 A;  3ZYP A;  4A45 A;  4PQQ A;  4B7E A;  1VR3 A;  5IHR A;  2YHJ A;  1ZZB A;  4WVW A;  4N53 C;  5T5J A;  3UJO A;  4FTE A;  1U12 A;  2ERF A;  2YC0 A;  3LDK A;  4A3Z A;  5FZ6 A;  2AEY A;  5LRR A;  4M3C E;  2WT1 A;  1H2L A;  1LGC A;  3A7Q A;  3EQE A;  1LKN A;  1US3 A;  2ZGL A;  5KHI A;  5LW9 A;  3LDR A;  5FZD A;  2JEM A;  5L73 A;  3H7Y A;  5SV5 A;  3LEG A;  1CAW A;  4GQ7 A;  4JC1 A;  4RGG A;  3S30 A;  4ISR A;  5F3G A;  4LBN A;  1RHI 2;  3EJK A;  4EWA A;  3ZXL A;  2ZCW A;  1QQP 3;  1CAX B;  4P9J A;  1K5M A;  4EWD A;  3N7J A;  2W95 A;  2YGM A;  3CEW A;  1Q3E A;  2EAK A;  5HXV A;  1IG3 A;  3IBM A;  3N3H A;  3FUQ A;  4OQ8 A;  3I3B A;  2PHD A;  4Q4W 3;  1E5S A;  2GDF A;  3K4A A;  4XCA A;  4QU2 A;  1L7L A;  2WNE A;  1K5M C;  2VOK A;  5JZG B;  2ZEX A;  1W6Q B;  4IEZ A;  1X36 A;  1XOY A;  3JQX A;  3ACI A;  3USU B;  4ZU5 A;  2P2K A;  1AL0 G;  2N7G A;  4HKL A;  5CEH A;  4QQL A;  1ZRF A;  3WY6 A;  4WM8 C;  3U75 A;  4HXC A;  4LR4 A;  3ZSM A;  1ASJ 2;  2XVG A;  4AE2 A;  1J3R A;  4MSV A;  1W8U A;  2GMM A;  2VVF A;  5L7O C;  4W6X A;  4KGQ A;  2VJX A;  5FUI A;  4BK5 A;  4Q5O A;  3WG3 A;  1IPK A;  1XE7 A;  4IEU A;  1SPP B;  4K9S A;  2WFF 1;  3ZXE A;  3AMP A;  1WMD A;  1X82 A;  2DWR A;  2QCS B;  3LDB A;  4K6B A;  5C5T A;  5GZC A;  3BU0 A;  3KT7 A;  2Q8C A;  2QTW B;  3SCH A;  3PUR A;  3FBM A;  3VBU A;  1BMV 2;  2VUD A;  1BBT 3;  4FPY A;  4RQP A;  5B4N A;  3GCW A;  4ZZ8 A;  3D4K A;  3O0W A;  3MI8 A;  4LJH A;  4XJZ A;  1B35 A;  3T4V A;  4H55 A;  1NY7 2;  4U2A A;  4TLG A;  4V2W A;  3RYR A;  3JUU A;  2W94 A;  4XBN A;  4NPL A;  5L7O A;  4BQ1 A;  3AM2 A;  3QBQ A;  2DDU A;  1NZI A;  4AVV A;  3AP9 A;  1AR8 1;  1CAV A;  2GC1 A;  2VMH A;  3O12 A;  4J25 A;  3QLQ A;  3TRS B;  5IVY A;  5LBF A;  1NE4 A;  1OVS A;  1N3O A;  1O59 A;  4P9Y A;  4BK4 A;  4I30 A;  5FYB A;  3GZE A;  1WD3 A;  2ZGU A;  4RYD A;  1SLT A;  1VBE 1;  2XWB B;  4YW6 A;  4UXA A;  1UKG A;  2GNB A;  2VUC A;  2XR4 A;  3D5O A;  3POI A;  4BHP A;  4XUQ A;  4UYB A;  1OKO A;  2VR4 A;  2VCC A;  5FY9 A;  4C91 A;  3OGR A;  4CYD A;  4A3X A;  1RUH 3;  2YBP A;  2ET1 A;  4XCB A;  4ZY9 A;  3KD4 A;  1GOF A;  3WNK A;  2R04 2;  3WT3 A;  3POF A;  4AED C;  5LY1 A;  2D5H A;  5CIR A;  1ALY A;  3RDI A;  1CD3 G;  4NHY A;  4DO0 A;  4Z1V A;  2OQ7 A;  1NAE A;  1V6N A;  2WAA A;  4OHY A;  2QBX A;  1QJY 1;  4DNY A;  5BY5 A;  4BCU A;  2IXI A;  2YV8 A;  3TB0 A;  2RS1 1;  4ASL A;  3L2H A;  3MLK A;  4I0W B;  1X9T A;  1LGN A;  1JXN A;  2D93 A;  2HWD 1;  5D2A A;  5A3P A;  4NID A;  5KC6 A;  1J83 A;  2ZMK A;  2Q8E A;  3ZFE A;  1HJG A;  5FBJ A;  1D2Q A;  2VMF A;  4GMP 0;  4TN7 A;  3POY A;  1JYN A;  3GHN A;  5K0U B;  2D6P A;  4WBB A;  4JTO A;  2ZKN A;  1X8M A;  5BXX A;  1DGL A;  2WQ4 A;  1VBD 1;  2B45 X;  3T2O A;  3VL9 A;  4E2Q A;  3O1P A;  3HNM A;  1FPN 1;  1F8V A;  5IAX A;  1PGS A;  3JQW A;  1TME 3;  3J9S A;  1J58 A;  2XLF A;  3KCY A;  3U1X A;  3ZR5 A;  1I1E A;  1GLH A;  2EXJ A;  2ZGS A;  4LBQ D;  5CVR A;  4CPB D;  1U0A A;  2EXH A;  2GH2 A;  4MOA A;  1KFX L;  3OF1 A;  3OGJ A;  4A7Z A;  4NRQ A;  5IVF A;  1YFW A;  3FHQ A;  3BOD A;  3CJI A;  1GNY A;  3E97 A;  1YQ8 A;  2GZW A;  4M0H A;  4DRV A;  4LE3 A;  2A3X A;  3H9A A;  3UL2 A;  1PVC 3;  5IT6 A;  4E2G A;  1DDL A;  3NMB A;  5GZG A;  2WZR 3;  1M4W A;  1UOJ A;  1G8W A;  4AQ6 A;  1AR9 3;  1LOA A;  1AHS A;  1RVF 1;  2XB6 C;  1HQW A;  1DHK B;  1GZC A;  2ZHM A;  3VHP A;  5IVV A;  3BI3 A;  5FZ7 A;  4JCK A;  3WNM A;  4I01 A;  1K3I A;  2O0O A;  3WQ0 A;  4FXK B;  2R07 1;  2VW0 A;  4OMC A;  3ZDS A;  3RPQ A;  2LRO A;  4XXP A;  3VKM A;  1POV 0;  2R49 A;  1XPW A;  3SH4 A;  3ALQ A;  4OI1 A;  5A7N A;  1MS1 A;  4TSV A;  4P9G A;  4XMA A;  1PMI A;  5ACA 2;  1EV1 2;  2F17 A;  2OZJ A;  3BCW A;  4W4Z A;  4FP3 A;  3ZFG B;  4ATE A;  1AYN 2;  5AC9 2;  2YG0 A;  4KU7 A;  3VBR B;  5DMY A;  1VBC 2;  2IXL A;  1CAU B;  1OOP A;  4HBN A;  1XE8 A;  2ADD A;  4FPE A;  3WQ7 A;  4UFH A;  5FZH A;  5FR3 A;  5KWR A;  1H4G A;  3WW1 A;  3FL7 A;  1TZO A;  2WNV A;  3OG2 A;  1N3P A;  2JG9 A;  3WP3 A;  2IFW A;  4O65 A;  1RMU 1;  3DCQ A;  1PMH X;  5J7M A;  3AVR A;  3CJI B;  4BXS V;  1LCL A;  4M3C A;  2VOX A;  5CAZ A;  2ARE A;  2DBN A;  2WKK A;  4A41 A;  5F3I A;  1Q8O A;  4MGI E;  3CZU A;  2HWC 1;  1UWW A;  4ARX A;  3NNM A;  1IG0 A;  1MEC 3;  4MGS A;  4C0B A;  3A23 A;  3ACH A;  4N9H A;  2WZE A;  1UYZ A;  2WZR 2;  3U78 A;  5CAD A;  3GXU A;  1ZA7 A;  1DF0 A;  1W8F A;  5D21 A;  4YGC A;  4P9I A;  4JDM A;  5C71 A;  3H3Z A;  5JSP A;  5C8C B;  1UY4 A;  1RUD 1;  4OYU A;  4CTE A;  3UV9 A;  1VBD 3;  2UY9 A;  3WW4 A;  2D40 A;  3WP5 A;  3N7M A;  1OLM E;  2VUJ A;  5I8T A;  4OHZ A;  4OMD A;  2RG4 A;  4FT8 A;  5CB7 A;  1UXX X;  1APN A;  3TN9 3;  2PN5 A;  4DPN A;  5LEK A;  1BLZ A;  5AC9 1;  5FUN A;  3ZKU A;  4UW5 A;  1BBT 1;  3N36 A;  5D8A A;  1EV1 1;  1W6M B;  4CP1 A;  1DGR A;  5FP9 A;  5ACA 1;  2GSY A;  3CMG A;  5J1X A;  5FQ0 A;  1VBC 3;  5IFP A;  4DRR A;  4NE9 A;  1SCS A;  2TNF A;  3WG4 A;  3ZPY A;  2WFF 3;  1JI6 A;  4JGY A;  5A3U A;  1H8T B;  4QT6 A;  4GWI A;  2FDH A;  4YZ5 A;  3THD A;  4WM8 B;  1W0O A;  4UF0 A;  4AYU A;  2EF6 A;  1LHW A;  1OVP A;  4FCA A;  4NII A;  5FZB A;  1RUC 2;  1RUI 1;  1SLI A;  3G6J B;  1W8H A;  1RUO A;  1SQ4 A;  2PHU A;  4K8F A;  2IC1 A;  1R1A 3;  2WBK A;  3AKS A;  1DIW A;  2WC2 A;  4HN1 A;  1EUT A;  4GJY A;  1HW5 A;  3UK9 A;  4QDR A;  3HT2 A;  4RL7 A;  4A4A A;  5C3O A;  2RDR A;  1CR7 A;  4WM7 A;  2WT2 A;  1AR8 3;  3KWV A;  5KBF A;  2CSG A;  5DUX A;  4GAZ A;  3HNY M;  1Z78 A;  5F32 A;  4EN6 B;  4AED B;  1NKG A;  1O5U A;  3VD3 A;  5FZE A;  4JQR A;  1SAC A;  2X5I C;  2XJV A;  1RUG 3;  2VNG A;  4ZXK A;  2VCB A;  4JV4 A;  4O9E A;  5FXW A;  5JR2 A;  3E5X A;  3RWN A;  5T5O A;  4FSJ A;  3VD5 A;  4K3U A;  4LO4 B;  2R04 1;  1CX1 A;  4LOT A;  1JZ8 A;  3POB A;  2BOI A;  2VQU A;  5C9A A;  3PME A;  3LE0 A;  1AXZ A;  3VBS A;  4AHX A;  4BPZ A;  4BU2 A;  2RDQ A;  1GP6 A;  2Y6H A;  4OUL A;  4XOG A;  5D8A B;  4XVH A;  2E33 A;  3C7E A;  4AVA A;  1CZS A;  1JUH A;  2HWE 3;  2JEN A;  2VBB A;  4X8N A;  3AJZ A;  1LAJ A;  1HQN A;  4MVT A;  1QJX 1;  3M4F A;  5IK5 A;  4WV8 A;  2WIN B;  5A32 B;  1QJY 2;  4NN0 A;  4MO3 M;  2KA3 A;  1OF4 A;  1OPM A;  4IUG A;  1T2X A;  3FFZ A;  4NPR A;  3IDA A;  4HG6 B;  4BA6 A;  2JWP A;  1V70 A;  1VMJ A;  4ISQ A;  1UX7 A;  3KM5 A;  5FZ1 A;  1BEV 2;  4YVW A;  4EV0 A;  1W9W A;  1OD3 A;  2PEL A;  1IGO A;  1NY7 1;  1SFY A;  1RUC 3;  4FO9 A;  3VBO A;  4P9W A;  4WVM A;  1ST8 A;  1WLW A;  3IKW A;  2JG9 C;  3RNS A;  4B1M A;  1R1A 2;  3WD5 A;  1VBE 2;  1PO2 1;  4F83 A;  1NZC A;  3IDE A;  3PJY A;  2AZ5 A;  4PIY A;  2ZMN A;  3ZXF A;  2I07 B;  4MXV A;  5IWF A;  4NJ4 A;  5B2G B;  3KCX A;  1EAH 1;  3C7G A;  1AR8 2;  2IXC A;  5KC5 A;  3LQC A;  3NWK A;  1ZBE 2;  5FYZ A;  1XYP A;  1UYY A;  2HWF 2;  2Q0A A;  3A0N A;  1GP4 A;  5IAV A;  3HPN A;  4AI3 A;  5KHJ A;  4S2D A;  1VMH A;  4KQ7 A;  4RFT 0;  3O7O A;  5H9P A;  5IVC A;  2QJV A;  1SLA A;  3O1R A;  2WA3 A;  3UKN A;  3LPF A;  3BTX A;  2ZKL A;  3C7O A;  3Q8C A;  4IV1 A;  4BZ4 A;  1TVG A;  4X6R B;  3VBR C;  2FDJ A;  4CPB A;  3ILR A;  4DXR A;  4AF9 A;  4QX2 A;  4S2F A;  3WF4 A;  3O1S A;  1W05 A;  5H9Q A;  4PDW A;  4E9K A;  2PAE A;  1OQ1 A;  3S7I A;  4XUP A;  2B5H A;  2XPJ A;  2WUH A;  2TBV A;  1S55 A;  4URA A;  3WLU A;  3H1W A;  3VZN A;  1VBB 3;  5JCT A;  3RI9 A;  3AMM A;  3W5N A;  4BB3 A;  2BFU S;  2D44 A;  3K3N A;  4ONU A;  1NQD A;  4XPV A;  3KLS A;  1YO8 A;  1KJR A;  1SZB A;  1ASJ 1;  1W8T A;  2QQW A;  3MV0 1;  5EJ1 B;  1NLS A;  3I2O A;  5CG9 A;  2K0G A;  5T52 A;  2DUP A;  2TEP A;  3H8X A;  1COV 2;  4A6S A;  1MS5 A;  1W0P A;  2VCM A;  3BOW A;  4DB5 A;  2NM1 A;  4Q4Y 1;  2PAK A;  3I59 B;  4P5Y A;  4L8Q A;  4AVB A;  3AKQ A;  2XWJ B;  3I2F A;  5FZ0 A;  2VBD A;  3OD4 A;  1DZR A;  1D2S A;  1XSR A;  5EIY B;  3OUH A;  5A1F A;  4NHL A;  5LWB A;  4UAP A;  4FP2 A;  1KJL A;  1YRZ A;  2R16 A;  4CDQ C;  4CCD A;  2V4V A;  1UKR A;  2CNA A;  4CCJ A;  5J48 A;  4Y20 B;  1F5F A;  1YIF A;  1K42 A;  1RGS A;  2ARA A;  1GZW A;  4GWN A;  4IDZ A;  2PAM A;  2LM3 A;  1EUU A;  5CKN A;  2AYH A;  2BRT A;  3AZY A;  4QPI C;  3I8T A;  2JE9 A;  3IPV A;  3WNX A;  3HOB A;  4QQH A;  1C5I A;  5EPA A;  3P6B A;  2PHT A;  2E51 A;  2VD7 A;  4MH0 E;  3U14 A;  2W1W A;  5CA6 A;  5BNN B;  3RI8 A;  5HCA A;  3H8O A;  2DTY A;  2GAU A;  5E16 A;  1KDM A;  2BGO A;  2E7A A;  1YI7 A;  4QDS A;  4XF9 A;  3AP5 A;  3KGL A;  3NJX A;  1OBN A;  1QNW A;  3MPB A;  4D7T A;  4JDN A;  4P5H A;  5DAX A;  5C5U A;  4JKL A;  5DAV A;  5FYU A;  2VUL A;  1J59 A;  5JOZ A;  3ZN6 A;  2C6S A;  3I3D A;  3LAG A;  1MS9 A;  3CDZ B;  2BJS A;  4HVR A;  4BH9 A;  4FPF A;  3TEZ A;  4LBQ A;  1ZRC A;  1YI9 A;  4O7X A;  4KWU A;  4Q1P A;  5C33 A;  2FDG A;  3VDC A;  2UYB A;  4RGA A;  1E5H A;  1ZX5 A;  4MAD A;  1AL2 1;  2QVS B;  4WVV A;  3CU7 A;  4XQD A;  2HH9 A;  2PHF A;  5D8A C;  4EJR A;  4R52 A;  1DQ0 A;  2A75 A;  1S0B A;  2XG3 A;  2WO1 A;  3BTA A;  4CDU B;  1HXS 2;  4YGE A;  2O8O A;  2WRA A;  3OYW A;  4YFZ A;  5FPZ A;  5BUV A;  5JOW A;  5CFC B;  2DVA A;  3WXP A;  1QXP A;  5BNO B;  2VW2 A;  2QQL A;  3UET A;  2VZP A;  2XVL A;  4LE4 A;  2PA7 A;  5FY1 A;  4YM0 A;  4XDQ A;  2I74 A;  1FYU A;  1PM7 A;  1TEI A;  5FFO C;  3MF9 A;  4B29 A;  3DUI A;  3VKN A;  2DBI A;  1YWK A;  2D3P A;  2Y34 A;  2K46 A;  2HEW F;  1S0I A;  1ZZ9 A;  2R7E B;  2X10 A;  5IVB A;  3VBS C;  4RR3 A;  1VBA 1;  2XGX A;  2IXK A;  5DZE A;  5FOB B;  2HWB 2;  1O91 A;  2Y8K A;  1H2M A;  5BNN A;  3WCR A;  1YEW A;  2W46 A;  3IMN A;  1ZRI A;  4E8C A;  4AHY A;  5IVJ A;  4OI0 A;  2A5Z A;  4HZF A;  4GJZ A;  1VRH 1;  5DDJ 1;  1AR9 2;  1GMM A;  2F6B A;  2VZQ A;  5A33 B;  4OQ9 A;  1QJZ A;  4HVO A;  4DUV A;  4JRA A;  4Q4Y 2;  4AHZ A;  4OHW A;  1WW6 A;  3PU3 A;  4XQ4 A;  1HB4 A;  3DYP A;  3KT1 A;  4IE4 A;  4E4S A;  4ES9 A;  1FNZ A;  2WN2 A;  4IE5 A;  2VCA A;  2JEC A;  3LOI A;  4LIU A;  4SLI A;  5FZO B;  1KXG A;  1OC1 A;  1S2K A;  4WM7 C;  4UFK A;  3G7D A;  3MW4 A;  2EAA A;  5EP9 A;  2WS9 3;  2X5I B;  3OUI A;  3DN7 A;  3C2U A;  4TZD A;  2WWS A;  3VHO A;  5T3N A;  3ACF A;  3RYP A;  3AXE A;  3MW3 A;  1QEX A;  4BJ0 A;  1EV1 3;  2D6K A;  3HD8 B;  3URF A;  1UW8 A;  2WO3 A;  3OPZ A;  5FY8 A;  3AYE A;  3OCP A;  2VGD A;  1TMF 1;  3AK0 A;  1LOB A;  4HOO A;  4FOY A;  3AMN A;  1AR7 1;  2RS3 2;  3PIJ A;  5A3W A;  3T1M A;  2ARB A;  4R4X A;  5EJ3 A;  3MFC A;  3HAG A;  2VMC A;  2UY8 A;  4XAE A;  4B7K A;  3AZX A;  3F95 A;  3LOB A;  2HWF 1;  4YAR A;  3VBU B;  3RZH A;  3RZK A;  2ARX A;  1ODM A;  3POJ A;  1GNZ A;  2RJL A;  4RQP B;  5FZK A;  1R08 2;  2BZD A;  5HPO A;  1RUF 2;  4MYE A;  1CQ9 A;  4JDO A;  5JPM B;  4YGD A;  3GZA A;  2VOW A;  2UU8 A;  3C3V A;  1R64 A;  1EP0 A;  1C3H A;  1QJU 3;  4I2O A;  2ZGP A;  2D6N A;  3RSJ A;  1PIV 1;  2GP5 A;  3AC0 A;  5JSO A;  5DAW A;  2FDK A;  5KR7 A;  2F4L A;  1ULC A;  1UU4 A;  4DS0 A;  2ZAA A;  4CDW B;  3HVD A;  1BEV 1;  1ZBE 1;  3KQR A;  1DU3 D;  4P14 A;  4N43 A;  1IZ3 A;  4IEY A;  3LWC A;  2DCJ A;  2VZR A;  3HN1 A;  2Y6F A;  2Y38 A;  3MF6 A;  3KHB A;  1CIW A;  1HB2 A;  2DVF A;  2RM2 1;  1KIT A;  2CDP A;  2VQA A;  5F5C A;  5FRA A;  2HEY F;  3UKV A;  2ILM A;  1R1A 1;  1NLR A;  3ZYR A;  2IWG B;  2WNU C;  1S0J A;  2EXK A;  3CHX A;  3RJ2 X;  1WCD J;  4CXW A;  1RUI 3;  1AJK A;  3KCC A;  5GZE A;  1EPW A;  3AXD A;  3BPS A;  4CRQ A;  4KWJ A;  5FO9 B;  1SCR A;  4PDW C;  1UD1 A;  2A6Y A;  2Q5T A;  3EB7 A;  5FY5 A;  5F2S A;  2WWU A;  4Q0U A;  5I91 A;  1V0A A;  3U4X A;  1ZM1 A;  2WNV C;  2YBS A;  3NKG A;  3MIH A;  3WDW A;  4HKO A;  4EN8 B;  1COV 3;  4Q1R A;  1OFN A;  1ENQ A;  2KM2 A;  3NST A;  1CON A;  4AAP A;  2W1U A;  5JLV A;  3T0D A;  1E5I A;  4CXY A;  3ZFE B;  1E57 A;  3UKT A;  1ZRD A;  4YYO A;  2XJP A;  3NV4 A;  1NLQ A;  5K0U A;  4LKF A;  4QD2 A;  5JAX A;  3MLJ A;  3SCF A;  3LD8 A;  3DEC A;  4DMI A;  4E2S A;  2FDI A;  1YQC A;  5IJR A;  3ZIX A;  3O1V A;  2BNO A;  5E88 A;  3J7M A;  1RUH 1;  4KNC A;  3IT8 A;  2DCZ A;  1NA1 C;  2VEC A;  2E7Q A;  1LOE A;  4A2U A;  5DAB A;  2QQP A;  2R1D A;  2ZEW A;  3POG A;  4XIO A;  2YB7 A;  3WOG A;  1RUC 1;  1F15 A;  1XYN A;  4JGZ B;  1LUL A;  2DU0 A;  4MHU A;  4LHN A;  4QAW A;  4YG0 A;  4YVW C;  1YHF A;  1HB3 A;  3GBW A;  3HBZ A;  4XUT A;  1YCI A;  2WR9 A;  3N9P A;  1W03 A;  1DYP A;  1QH7 A;  4LO6 B;  4PJY A;  3AP6 A;  2AR6 A;  4QPI B;  3THT A;  3U10 A;  1XNK A;  4BIO A;  4Q4V 1;  3W58 A;  3ORJ A;  1JOB A;  4FXG B;  2P6C A;  5BPX A;  1FAT A;  2LS6 A;  2EID A;  3DV8 A;  1OLR A;  2DUR A;  4LXL A;  3T1L A;  1RUI 2;  2A70 A;  4L92 A;  1MPX A;  3B00 A;  2XQR A;  4I0A A;  4JGY B;  4GIQ A;  3TBD A;  5H9S A;  1O4T A;  1AR6 3;  3CNA A;  2B9U A;  4OHV A;  5CG8 A;  3NVC A;  4OUS A;  1QOT A;  4UF0 B;  2XDV A;  2PMW B;  2VZS A;  4YGB A;  1POV 1;  5E8A A;  1W99 A;  3TEY A;  5IAT A;  2PQS A;  1GQH A;  4Y5Z 0;  4N90 A;  4QX7 A;  3B69 A;  4XFG A;  3WF0 A;  4LBK A;  2A3W A;  2JDZ A;  1ND2 B;  1BXH A;  1F5J A;  5L7O B;  4AOC A;  4CU6 A;  2A3Y A;  2VZT A;  3AX4 A;  4ZU7 A;  2ZS6 B;  4IES A;  2JB8 A;  2J1V A;  2QQO A;  4LHK A;  4Q4X 1;  5FZM A;  2NYY A;  3VHR A;  4AED A;  2A6X A;  1RXG A;  1S2B A;  1OUR A;  1ZZ6 A;  1LEM A;  1MVE A;  3K48 A;  3NKT A;  3IAQ A;  1YQ5 A;  2XH6 A;  5FKC A;  3DGT A;  5FLH A;  4LA2 A;  4URT A;  1WCU A;  1W9T A;  3FBY A;  5IUQ A;  3UT0 A;  4CCE A;  5FO8 B;  2QQV A;  3S5Q A;  4MV2 A;  2D6O X;  3KF3 A;  3POS A;  5C6C A;  1GYK A;  2YFU A;  1XU1 A;  5JXI A;  5I0R A;  5FXZ A;  2QKD A;  5EV7 A;  1ULO A;  4DQA A;  4Q4Y 3;  3ZMO A;  3SH3 A;  4Q29 A;  3VBS B;  3N9Q A;  3I3Q A;  1V9U 3;  4YWA A;  1RC6 A;  4A42 A;  3ECQ A;  4CEY A;  2QQJ A;  1VBC 1;  1ZVF A;  1OHF A;  1IOA A;  4N43 C;  4NVP A;  1W6P A;  4I3G A;  4ATF A;  4OVE A;  2YMZ A;  3DYO A;  2WS9 2;  3NAP C;  3PVE A;  5DZF A;  2DFC A;  3MUZ 1;  4IET A;  4YZ3 A;  1TME 1;  3B01 A;  3GHM A;  4QB6 A;  1PO1 2;  3GZT B;  1F9K A;  1B35 C;  3VZM A;  4CDX C;  4KI5 M;  3WW2 A;  3KHC A;  1OMI A;  3AFG A;  4YW4 A;  4FPJ A;  3U11 A;  4RQP C;  5HXM A;  4ZS3 A;  2YZ4 A;  3I2I A;  1W9Y A;  2D5F A;  5CFD C;  3RGB A;  1C1F A;  1DLL A;  3KF5 A;  4K20 A;  4KG8 A;  1ZZC A;  4HK9 A;  5JPN B;  2EIB A;  1FMD 3;  4CCM A;  2ZAB A;  4KWL A;  1QOO A;  4G4F A;  2ZA9 A;  2QNK A;  1LHO A;  1RJ8 A;  2OZ6 A;  3N9N A;  4LBJ A;  4EN0 A;  1I3H A;  1VRH 2;  4ZS2 A;  3I7D A;  4DXZ A;  2VW1 A;  3LA3 A;  4QX1 A;  4PF1 A;  4G9S B;  5DN2 A;  2RMU 2;  2V5Y A;  3OPW A;  4ORF A;  2B46 X;  3SQO A;  1MZ6 A;  5FAX A;  1SLL A;  5F5A A;  4QPG C;  4D7S A;  3Q8F A;  3ELN A;  1E5R A;  1Q56 A;  4X8P A;  4IV1 B;  2JDA A;  1BKZ A;  3OGV A;  3DL3 A;  5F9T A;  2VQ0 A;  4Y1V A;  1JW6 A;  2MNG A;  4JGZ A;  3I2K A;  2A1X A;  1DP0 A;  1FPN 3;  4PDW B;  1CPM A;  1J1T A;  2GND A;  1OA2 A;  1R09 2;  2ZX2 A;  3E1F 1;  3HIF A;  4FTS A;  4XIL A;  4YZ1 A;  1IQD C;  1GNH A;  1UOF A;  3BTY A;  2YDE A;  4CP9 B;  1AF9 A;  1H0B A;  4YLZ A;  5C8C C;  4FAG A;  4CDW C;  1G9A A;  1XBF A;  4XET A;  4QDQ A;  1HRV 1;  3JU9 A;  1KFU L;  3VBH B;  4IGO A;  4HFS A;  2VNO A;  1O5L A;  2VPV A;  2YPD A;  1DYO A;  3I59 A;  2JX9 A;  2CDO A;  4W6W A;  5A1A A;  3III A;  4BQ5 A;  1DGW X;  1VIW B;  3VZO A;  4CVU A;  2FZ1 A;  5KXC A;  3K75 B;  2BU9 A;  5BYN A;  1T6B X;  1OUS A;  3AP4 A;  4Q4V 3;  4UI9 L;  2FDF A;  4BIS A;  3SIS A;  3TNP B;  5DUV A;  4XJ9 A;  3WG2 A;  2RS1 2;  1FV3 A;  3DXU A;  4TTG A;  3BIE A;  5A3T A;  2R0F A;  3B94 A;  4OZO A;  4KH9 A;  5FMC A;  1MZ5 A;  2VXJ A;  4YVW B;  4A7Y A;  5LCW L;  4ITC A;  3TEX A;  4LHS A;  4AI2 A;  2Y33 A;  4GB3 1;  4Q26 A;  4WVM B;  2QZ2 A;  3IZO A;  4GH4 C;  2E32 A;  4LQR A;  1BHG A;  2HWB 3;  1WZX A;  4QXH A;  3JBG 1;  4QHZ A;  4AVT A;  3CIH A;  3NJV A;  2KXL A;  4AVS A;  3GYD A;  1Q5O A;  3CQO A;  4LIT A;  1JHJ A;  5JXG A;  1LGB A;  2XBO 1;  2OQ6 A;  2R32 A;  5HV4 A;  2DVG A;  1BMV 1;  1AVB A;  3H1M A;  4N7U A;  1SFP A;  2AUY A;  2I2S A;  5J3U A;  1RL3 A;  5IW0 A;  4DFS A;  5JXH A;  4Y1Z A;  1RIT A;  1MS0 A;  5FP3 A;  3VUO A;  1DGR N;  5A7W A;  3DPR B;  1NXD 1;  1JHN A;  2DCK A;  1COV 1;  4Z92 B;  1XNB A;  4FFF A;  5GJ6 A;  2Q1Z B;  3ZXD A;  2ZGN A;  3NNJ A;  5ANQ A;  4LK7 A;  1LOF A;  4X6Q B;  2JIC A;  2YGL A;  3W21 A;  2B4K A;  3U37 A;  2RR1 3;  5JOX A;  2ADE A;  1FXZ A;  3R05 A;  3OYW B;  2FMD A;  4CEW B;  4FI9 A;  5FTT C;  2CGO A;  1PVC 1;  5BNO A;  1ZZ7 A;  2VTX J;  4MZU A;  1LES A;  4COY A;  2WFF 2;  3DXT A;  2VVD A;  4UW4 A;  1WCQ A;  1J84 A;  2RM2 3;  3D0J A;  3AKR A;  5FO7 B;  4LA3 A;  5GLT A;  1F4A A;  2JDY A;  2ZX3 A;  2YFZ A;  2X09 A;  4LO8 A;  3WNL A;  4EZH A;  3OOX A;  3VZK A;  2GC3 A;  4CXX A;  3LFM A;  3JB8 A;  5F6L B;  2Q8O A;  4EWE A;  4GA9 A;  1LOD A;  3FZ3 A;  3ILN A;  2D3S A;  2LW8 A;  3H8U A;  1A34 A;  2D97 A;  3R0R A;  3ZVX A;  1OA4 A;  3ZPO A;  1W28 A;  4YG6 A;  1G86 A;  5APA A;  3VL8 A;  3PHM A;  2PYT A;  4F3J A;  1JZ6 A;  1D4M 3;  2RJ2 A;  3ZSK A;  3R4S A;  3ZXJ A;  1PVC 2;  3KMH A;  3M3I A;  5CFD A;  4BYY A;  3ZSE A;  1Q8V A;  2J1R A;  1IS6 A;  2PXJ A;  3AL6 A;  3M8L A;  3VGI A;  1W2N A;  1XYO A;  4CCC A;  3CBN A;  4CU8 A;  5LBB A;  1JN2 P;  1PO2 2;  2VOV A;  2ZAC A;  1SLC A;  5DAQ A;  1O3T A;  4Y3O A;  1XNA A;  3PUA A;  1YQ2 A;  1JZ2 A;  1CJD A;  3NNF A;  1HRI 3;  1H6Y A;  1FX5 A;  2X5I A;  2FBE A;  1KQR A;  3P5B A;  2Z5W A;  2W9X A;  3PUH A;  1A3K A;  5E89 A;  5FRE A;  2IVI B;  1S1A A;  2JDM A;  4IV1 C;  1I5P A;  3WHT A;  3U07 A;  4CP2 A;  2W1S A;  5GLZ A;  2VOT A;  5FZL A;  1N1V A;  1C28 A;  5K8S A;  3TNQ A;  4IV3 C;  4QHO A;  3ENR A;  4OHX A;  1O3Q A;  1OQD A;  1TQ5 A;  2OVU A;  5A1L A;  1O6U A;  1GWM A;  4W65 A;  1HX6 A;  2JJ6 A;  4XTP A;  2JXA A;  4QQ2 A;  5A7S A;  2Y6J A;  3CZJ A;  1JU4 A;  2GNT A;  4XW3 A;  3JBG 2;  1LEC A;  3ZN5 A;  4AGG A;  2RS5 3;  2JKX A;  4Y22 A;  1NQJ A;  1BEV 3;  5FMD A;  5LK5 A;  5AFE A;  2OPK A;  1LRH A;  2FHR A;  4D6R A;  2HKX A;  1QJX 3;  1HRV 2;  2FMY A;  4LNV A;  2QDR A;  3TOJ A;  3V0A B;  4NMI A;  1RED A;  4Z8B A;  1VRB A;  2ORZ A;  4KBZ A;  3PTY A;  5EQU A;  4K7J A;  2W39 A;  1AYM 1;  2LAL A;  4COW A;  3VB9 A;  5LZ6 A;  4XUR A;  1CJP A;  4ZKT B;  5CFD B;  2GAL A;  4XUN A;  1PGW 2;  3LSD A;  1W9F A;  1XE0 A;  4Q0S A;  1CZT A;  1MEC 2;  2CV6 A;  2K9Z A;  4AQT A;  3QH6 A;  2XHN A;  4FFG A;  4Q2F A;  5FK8 A;  4IER A;  5ABJ C;  1S0F A;  3D82 A;  4FPO B;  2HYK A;  2OX0 A;  4N53 A;  3ZYG A;  4CUG A;  1X33 A;  1SHW B;  2CWS A;  5GZD A;  2UWC A;  2JB4 A;  2XUM A;  5FK7 A;  3VBH C;  1ODN A;  1NYW A;  2QQU A;  5KXB A;  4BQ2 A;  3T2Q A;  1ENX A;  3T09 A;  4W50 A;  1UY2 A;  2G4I A;  1TMF 3;  1Y4W A;  2Y6G A;  4MXW B;  2Y60 A;  4NIG A;  1R09 1;  2C24 A;  5GLU A;  1N1Y A;  3OY8 A;  1NCR C;  5A7P A;  4Y1U A;  5J09 A;  2RE9 A;  5F37 A;  3KV9 A;  1JYW A;  2PHW A;  3FE5 A;  4YZ4 A;  5FZO A;  3M3Q A;  1UY0 A;  1VAL A;  2ZAH A;  1QDO A;  1TNR A;  3K4D A;  4L2N A;  4L9B A;  1S0G A;  4L97 A;  4PLO A;  2GC2 A;  4XFA A;  2ZPX A;  2WZ8 A;  3ZXK A;  4S2H A;  1AR6 2;  2NLR A;  3DPR C;  1C5H A;  3WR0 A;  3ETQ A;  3L9J T;  4QXC A;  4XF4 A;  3RRD A;  4S2G A;  3PVO A;  2VG9 A;  3N7K A;  2JE7 A;  2RMU 1;  3GJB A;  5A6X A;  4XYX A;  2AEN A;  5ERL A;  3ST7 A;  2RS5 2;  3ZXG A;  3AP7 A;  3SKV A;  3ACL A;  3LA2 A;  5FZ9 A;  1JOD A;  2ZHL A;  5JIU A;  1BCX A;  1ZNP A;  4YVS A;  3TEW A;  2VME A;  1P8J A;  1TME 2;  3J7H A;  1STM A;  2QZ3 A;  5JIA A;  2JDP A;  2P17 A;  2OXB A;  4F8A A;  5JXJ A;  2ZEZ A;  5L9R A;  3O1M A;  1RUG 1;  2VH9 A;  1S0E A;  2NMN A;  5A3O A;  2HLE A;  2WLP A;  4UW3 A;  1AR7 3;  2AEZ A;  4BE3 A;  3VD7 A;  4Y26 A;  1LHN A;  2L9L A;  2NN8 A;  2PHX A;  4N53 B;  1JYI A;  3PU8 A;  2QQI A;  3CJX A;  4XZU G;  3WP4 A;  4XBQ A;  1QXR A;  1WW7 A;  2UWA A;  5FMO L;  4ZHN A;  2NP0 A;  4R9C A;  3AKP A;  3E5U A;  3INA A;  1CAX A;  1FOD 3;  4QPI A;  1H1M A;  1LOG A;  4RSU A;  4Q4W 2;  2EAL A;  2NMO A;  2Y64 A;  1G9B A;  2QUO A;  1N1T A;  2P3K A;  1OPO A;  3HN3 A;  1ZBA 1;  1GQP A;  4Y5T A;  5A3M A;  2GME A;  2XML A;  3MGU A;  4KU8 A;  4Q4X 2;  3RS6 A;  5JZG A;  4K8R B;  1N1S A;  2QQN A;  3USU A;  3DYM A;  4LTA A;  1XB9 A;  4QKF A;  4FPG A;  1QF3 A;  4LOR A;  1H4H A;  1HJF A;  2ORX A;  3MEP A;  2ZTN A;  4QM8 A;  1RUE 1;  1K12 A;  4AFM A;  4ZZ5 A;  5KHK A;  4QB1 A;  5A7Q A;  2E9Q A;  5C9A C;  4NAO A;  3KS7 A;  2XHK A;  3OTF A;  3M7A A;  3LIG A;  4UW6 A;  1UY1 A;  2D6L X;  4BDV B;  4YSF A;  1EPZ A;  1OI6 A;  3ZIW A;  2RHP A;  2DVD A;  2VZ1 A;  3O1U A;  2X05 A;  1DQ5 A;  3OEB A;  1W8O A;  4SBV A;  4BOW A;  5FOJ B;  3AFK A;  5F3C A;  1ZYB A;  3B9C A;  3OGS A;  3ZR6 A;  4LUM A;  3AJY A;  4H7M A;  3ACG A;  3KZ4 C;  1HLC A;  2YYO A;  4BQY A;  3J8F 1;  4OCT A;  3LZZ A;  4HL0 A;  1UOG A;  4M4R A;  5C3R A;  4XFB A;  1PHM A;  1Y9G A;  2RV9 A;  3EHK A;  3OBZ A;  4P9X A;  5I8Y A;  2ZGK A;  4XQW A;  2ETE A;  2HWF 3;  3VDD C;  2CGP A;  1KGY A;  2VNR A;  1XU2 A;  2OA2 A;  3BB6 A;  4QPG A;  2NQY A;  4QB2 A;  4IGQ A;  4EN9 B;  5JSR A;  1MS3 A;  5EXO A;  3BVC A;  2ZBJ A;  1FPN 2;  3J7L A;  2VE1 A;  1FMD 1;  3FHI B;  1VBD 2;  1RUH 2;  5BNP B;  1CZV A;  1NE6 A;  2KD7 A;  3ZSJ A;  5EJZ B;  1QH6 A;  4Q4X 3;  2BNN A;  3O1O A;  4IXL A;  1GOH A;  1W3X A;  2D3R A;  2G9Z A;  1KS4 A;  1GOG A;  3R4U A;  2Q4S A;  3JB4 C;  3EBR A;  5GLV A;  4LBM A;  5F2W A;  3I2J A;  1UAI A;  3H42 B;  2J1T A;  4HMZ A;  1AX1 A;  2JG9 B;  1QJU 1;  2WNU B;  3BYW A;  1KD7 A;  5LAS A;  2W08 A;  2ZZQ A;  3A0K A;  4M0N A;  1DQ2 A;  3MV1 1;  2C4X A;  2J1S A;  1V9U 1;  5T54 A;  2W1Q A;  4GMP 1;  4QQP A;  1SFN A;  5DZG A;  4CSW A;  1HRV 3;  3NAP A;  2C1F A;  4FOW A;  2XBO 3;  1CAW B;  2BEO A;  2YRO A;  2ZHK A;  3KVA A;  3WDT A;  5A80 A;  2GN3 A;  2Q1F A;  3B7M A;  5EYX A;  4ES8 A;  1RUJ 1;  1SEF A;  3ZFE C;  1K5M B;  5JZG C;  1WW5 A;  2DCY A;  1HV0 A;  3SH5 A;  4MUV A;  1RHI 3;  3HNB M;  3USS A;  4B8E A;  5F7U A;  1RUD 3;  5JWP A;  2IFR A;  2RDN A;  1JOP A;  4IEP A;  1NCQ C;  4PI0 A;  1DCS A;  4EZ4 A;  4FQ4 A;  5LBC A;  3ITQ A;  4KMQ A;  1UZY A;  4G3Y C;  3RZJ A;  1OLQ A;  1G6N A;  3LA7 A;  1JS9 A;  1VMF A;  3TAY A;  3D8C A;  4RS5 B;  3ON7 A;  1M06 G;  3TWI A;  4AFA A;  3C8X A;  5FPU A;  1OT5 A;  2B42 B;  4RGK A;  2YPJ A;  3N35 A;  4QKD A;  5LA2 A;  4Q27 A;  1QY4 A;  1QKQ A;  1VJ2 A;  3FN9 A;  4FPH A;  4HVQ A;  3KQ4 B;  3ZO0 B;  2WFP A;  3MO4 A;  3RFR A;  1RUF 1;  4OUE A;  3LPG A;  3MIE A;  3ABZ A;  1UZW A;  2EA7 A;  2W87 A;  2OUH A;  4LEJ A;  5FP4 A;  1CGP A;  4YNI A;  3UJQ A;  1QNY A;  3CO2 A;  4D0Q A;  5ACA 3;  1YIP A;  1WBL A;  2YBK A;  1RMU 3;  3E6B A;  2E26 A;  3VKF C;  4B3N A;  3JD7 3;  4GKY A;  1OLM A;  1AUY A;  4LT5 A;  3N9O A;  2ZHN A;  2H6B A;  3UNP A;  4XTM A;  2JDN A;  4JAA A;  4IQP A;  1GFF 2;  2PQQ A;  1IS3 A;  4D94 A;  1GKB A;  1T6G C;  1CAU A;  1UQX A;  3ILF A;  4LUK A;  3I2H A;  5FY0 A;  1W2A X;  2R06 2;  3I49 A;  1J1L A;  2A7A A;  3MW2 A;  1DYK A;  4AFD A;  2CWM A;  5FY4 A;  4BQ4 A;  3NNG A;  2WJS A;  1GV9 A;  1OSG A;  1YFU A;  5FPX A;  5C7G A;  5L9B A;  1WBF A;  1RIR A;  2Z42 A;  2DCT A;  1A6C A;  1AR7 2;  5LY2 A;  1D4M 2;  4E4H A;  2RMU 3;  1H6X A;  3F2Z A;  1JU3 A;  3OJB A;  5F5I A;  4CA9 A;  1SLB A;  3K51 A;  1U5Y A;  5FZ4 A;  1AR9 1;  1H2K A;  2HEV F;  4Q0Q A;  5DDJ 2;  4AEM A;  4PLM A;  3UGG A;  4N8M A;  1HIX A;  2RS5 1;  3W9A A;  4MGZ E;  2EVX A;  1W2O A;  1QMJ A;  4GZ9 A;  1Q8S A;  1R09 3;  2WWJ A;  4KWK A;  4EQV A;  4KGG A;  1WME A;  4Q0V A;  5C8C A;  1W8Z A;  1YC6 1;  1SBD A;  3RZZ A;  5K0U C;  2WSU A;  1UOB A;  2WNO A;  1VBB 2;  2MEV 1;  5G05 L;  4A6O A;  1PZ9 A;  4QX0 A;  5GM0 A;  3I2G A;  3WNN A;  1OOP C;  4CP9 A;  3ZX7 A;  1KEX A;  2E6V A;  3JD7 2;  1WMF A;  3POW A;  4B4R A;  2Z69 A;  4DEV A;  5FBZ A;  1JTZ X;  3H3L A;  5T5L A;  5LAT A;  4Y24 A;  4FOQ A;  1UMZ A;  2VUA A;  3PNA A;  1AL2 2;  4IEV A;  4PIZ A;  4Q8K A;  1PNG A;  1XXN A;  1PGL 2;  2RS1 3;  1AYM 3;  3UGH A;  4DOU A;  3VDD B;  1O3S A;  3M3O A;  4AVC A;  3HT1 A;  4E4Z A;  2W47 A;  3K2O A;  1FI2 A;  3ATG A;  3WVJ A;  1EAH 3;  1RUF 3;  2OYZ A;  1PGW 1;  3EMR A;  3K4Z A;  1W3V A;  1EY2 A;  4U36 A;  3OUJ A;  2J7M A;  3NV1 A;  2DU1 A;  4MGQ A;  4DUX A;  5E6H A;  1Y9M A;  3JXS A;  3NJY A;  5D1I A;  4COZ A;  2BQP A;  4O9G A;  1FOD 1;  2ZX4 A;  4LBL A;  4ZON A;  1HB1 A;  4MGK E;  5DUW A;  1GWL A;  5J36 A;  3WIN E;  1NXM A;  2IZW A;  2P4E A;  1UIK A;  4MX3 A;  3E6C C;  2OW4 A;  2BVB A;  2V72 A;  3PMS A;  4IEQ A;  4V1P A;  4XHB A;  5CYY A;  2DV9 A;  4HSJ A;  5FZI A;  5I0T A;  1FV2 A;  4P00 B;  3MIG A;  1VE0 A;  5A3N A;  1H1A A;  2W5F A;  4M4P A;  1POQ A;  1SG3 A;  1UO9 A;  1RUJ 3;  3PDQ A;  4XMI A;  5FZF A;  5JOY A;  3O14 A;  2BWA A;  4UOJ A;  2BTV C;  2MEV 3;  1WCS A;  2KR2 A;  1DLC A;  3PUQ A;  2YU2 A;  2JE8 A;  3JD7 1;  1W39 A;  1BK1 A;  1O4Z A;  4LPL A;  4YW7 A;  2JIJ A;  1US2 A;  2VL4 A;  4GMP 3;  4IE6 A;  5L36 A;  2BBV A;  2HJI A;  3BIW E;  4Y4Y A;  4CCK A;  3SEE A;  3NV3 A;  3VDA A;  3OSD A;  1WLC A;  5F6K A;  3E6D A;  3MIF A;  2Z2S B;  3RZM A;  3V0B A;  2QDN A;  2ENR A;  2PHR A;  2VO5 A;  1SMV A;  2XVK A;  2OKX A;  5CIS A;  2LUW A;  3I97 A;  2R6Q A;  1K5J A;  2E53 A;  5IK8 A;  2OII A;  5A3L A;  1JH5 A;  4YM2 A;  3BOP A;  5F8P A;  1VLN A;  4FFI A;  4LUL A;  1QOS A;  4XFF A;  3J4U H;  4XFH A;  4AQ2 A;  3IIA A;  2R06 1;  2C9A A;  2V09 A;  3THP A;  4XDO A;  4B4Q A;  3IPV B;  1QGL A;  2D6M A;  1GIC A;  2OPW A;  3S7E A;  1NCQ A;  4GB3 3;  2B39 A;  3BAL A;  3E5Q A;  2W92 A;  5FIX A;  3H0O A;  3AYD A;  2D98 A;  3H7J A;  4IV3 A;  4PQ9 A;  4BLJ A;  3ZYJ B;  1HN0 A;  1WA6 X;  4C1X A;  4HKW A;  1OKQ A;  1WLD A;  1W2U A;  5F39 A;  4D3W A;  3WNP A;  1POV 3;  1HRI 2;  2CGN A;  1WKY A;  4QMA A;  2X53 S;  4E27 A;  1H9P A;  4FQZ A;  1GBG A;  3GAL A;  2FQP A;  3PL0 A;  4D69 A;  2R04 3;  1CN1 A;  2XJR A;  2X8K A;  3AMH A;  3RWK X;  3ME2 A;  1I6X A;  1W8N A;  4PLN A;  2QQK A;  1HDK A;  3B02 A;  5A7O A;  3SEP A;  1IPS A;  1KDK A;  1ULD A;  2Y0I A;  3V0B B;  1GUI A;  4OI4 A;  5FY7 A;  3BU7 A;  3D3A A;  2C9K A;  3O0X A;  5I0S A;  5FPV A;  3KGZ A;  4JTN A;  2FCT A;  3FC0 A;  1V6O A;  5FLI A;  3JBG 3;  1BZW A;  2JDH A;  4XJW A;  1W6N B;  1RUN A;  1SDD B;  5CKQ A;  1UYX A;  4YPJ A;  3GDB A;  1X50 A;  1OOP B;  3QOP A;  2I45 A;  1QJX 2;  3I3M A;  1LED A;  3MID A;  5DPN A;  2R06 3;  1PNF A;  3NV2 A;  4OLL A;  4ERO A;  3B93 A;  1NG0 A;  1Z7S 3;  2QE3 A;  2ZJC A;  3MYX A;  3IWZ A;  3NO8 A;  5B4X A;  1LHV A;  2BUK A;  5LA9 A;  3T3Y A;  1R08 3;  4AEJ A;  3NNL A;  3M1H A;  3ZYI B;  3WDU A;  5BNO C;  4GWJ A;  5HCH A;  3WF2 A;  4JVA A;  4GB3 2;  2ZML A;  4Y20 A;  4ASK A;  3K77 A;  3LCP A;  4QPY A;  1QJU 2;  4CCL A;  5EZW A;  4CUB A;  5SV8 A;  1K45 A;  1PMJ X;  1IKP A;  2JG8 C;  3WUD A;  2VVE A;  2W0X A;  4JX0 A;  1O8S A;  1A8M A;  5DG2 A;  3VBF C;  3ZYF A;  4DXS A;  2WO7 A;  5L19 A;  5F5Q A;  3WZ1 A;  2AGS A;  4YW1 A;  2BGP A;  4EN7 B;  2Y6K A;  4N9I A;  4MG2 A;  2CAV A;  3P1I A;  1V9U 2;  5EWS A;  1UNB A;  1AZD A;  2VNV A;  2BV4 A;  4JHZ A;  3GGL A;  4XBL A;  2A71 A;  3MBW A;  4CDQ A;  4AK3 A;  3HQU A;  3KB5 A;  1XC6 A;  2B9V A;  1Z7S 1;  1VPH A;  4J1X A;  3RVH A;  4QX8 A;  1W9S A;  3VV1 A;  4CEW A;  5FMB A;  1RJ7 A;  2PLV 2;  3FX3 A;  4I02 A;  2WN3 A;  2A6V A;  5AVP A;  1AXY A;  3JZV A;  2R0H A;  3IN9 A;  3I54 A;  5T50 A;  4YW2 A;  4GH4 A;  2QFE A;  3W20 A;  1C4R A;  3GM8 A;  4LBQ B;  3M3E A;  3HQX A;  4XAB A;  3HJR A;  4LMF A;  2G19 A;  4BIF A;  3IB3 A;  1S2E A;  1AL2 3;  3KV4 A;  3WF1 A;  4XIK A;  1D0G A;  1W6O A;  4LLO A;  3IAP A;  3J8F 2;  5JVV A;  5GZF A;  3WCS A;  1BBT 2;  4GXL A;  1UPI A;  1NOV A;  1FMD 2;  2WT0 A;  3KVB A;  3MIC A;  4LKD A;  4XXA A;  1AX2 A;  1RB8 G;  2IVJ A;  3KT4 A;  4J1W A;  3HBK A;  2XLG A;  4CDX A;  5A6Z A;  1QQP 1;  3NL1 A;  3POE A;  1VRH 3;  4CEW C;  4FOV A;  3J7N A;  1UXZ A;  4HON A;  4AL9 A;  4CU9 A;  1KS5 A;  3Q8A A;  4MGY E;  3M2M A;  3H1Y A;  1UU5 A;  4XF0 A;  5C4W B;  1RUD 2;  5FLJ A;  3IMM A;  4K1Y A;  3WDV A;  2ES3 A;  1RUE 2;  4CDW A;  1OFS A;  2ZX1 A;  4RR3 B;  3Q9O A;  1G7Y A;  3FMG A;  1IPJ A;  3AZZ A;  4N43 B;  2VAU A;  2GC0 A;  4NHX A;  5I93 A;  2G1M A;  2AC1 A;  5C3Q A;  3MUY 1;  3THC A;  5J96 B;  1UX6 A;  1O7F A;  2CYF A;  3ZSL A;  3ZFF C;  3AMQ A;  2FZ2 A;  1F35 A;  4PBO A;  3SHR A;  1AX0 A;  2P3I A;  3CL1 A;  1PK6 C;  2WQZ C;  5FZ8 A;  4EYU A;  1OF3 A;  2Q1M A;  4Z82 A;  1VAM A;  4DIN B;  3SCG A;  1ENS A;  4Q4W 1;  1D0H A;  3GCX A;  4XJA A;  4YM1 A;  5DUU A;  3TN9 2;  3GZU C;  1RVF 3;  3DPR A;  2LTN A;  2PLV 3;  2XJT A;  2ZGM A;  1C8M 2;  2WS9 1;  1RMU 2;  3BN6 A;  1SPP A;  4I0B A;  5FZC A;  3UGF A;  1O8P A;  2WNU A;  4L11 A;  4E8D A;  5K7P A;  2WYF A;  3LIH A;  5LEJ A;  5A70 A;  3B3Q E;  4Z2W A;  1PIV 3;  3S0M A;  1NT0 A;  3LKJ A;  3SLI A;  1WW4 A;  4LOS A;  1VP6 A;  4QXB A;  2E63 A;  4C90 A;  2HWC 2;  2XON A;  3ZM8 A;  4IND A;  1FAY A;  1AYN 1;  1F4H A;  2V5D A;  3J8F 3;  1JBC A;  2XL7 A;  3ES1 A;  4AR2 A;  3Q8E A;  1GQG A;  5JDB A;  3NRU A;  4AI9 A;  1RTV A;  1MAC A;  1WMX A;  5FPA A;  3TN9 1;  1YYN A;  2VTX A;  5JI7 A;  2YUE A;  1Y7B A;  1UL9 A;  1TG7 A;  1YNA A;  1VBA 3;  4H2A A;  5FXX A;  3WQ1 A;  3O5S A;  1QU0 A;  1D4V B;  2HBU A;  5FPL A;  3WSO A;  5CZK A;  1QQP 2;  1UPS A;  2DVB A;  5KHH A;  3NQH A;  4NWV A;  3U0Z A;  1ND3 A;  1AR6 1;  2C5D A;  3AYA A;  3MLL A;  1MQT A;  3T0B A;  3WQB A;  1RUG 2;  4D7Y A;  4NIH A;  3M70 A;  4BM8 A;  1W8W A;  3LEI A;  1NUK A;  4QKB A;  4P02 B;  3FLR A;  4W8J A;  4CEY C;  3MDP A;  4FAH A;  3VD9 A;  3OY8 B;  5DG1 A;  2J1U A;  3BPZ A;  3V56 A;  3EYP A;  1CPN A;  4TLF A;  1NA1 A;  3OB8 A;  4XFI A;  4NAM A;  1UIJ A;  2R07 2;  3RG0 A;  4CDU C;  2ZGR A;  1H9W A;  3K3O A;  3S57 A;  4XE9 A;  5I0D A;  2PLV 1;  2H0B A;  1ASJ 3;  4YW5 A;  5LB6 A;  1RVF 2;  4TXW A;  4IW3 A;  4AI8 A;  4MGT A;  1OA3 A;  5HV0 A;  2Q30 A;  1HQL A;  1PK6 A;  1L3J A;  4CE8 A;  1G9C A;  4QX3 A;  2VY0 A;  5A6Y A;  4KL1 A;  3P3P A;  1I5Z A;  3GBG A;  4PCR A;  3FFQ A;  1HXS 3;  5K9Y A;  2GN7 A;  3LSE A;  2R30 A;  3A21 A;  5EHD A;  5FYH A;  2Y6L A;  2XLA A;  2VBP A;  5HCF A;  1AYM 2;  2JG8 B;  3HMY A;  4Y22 B;  5FJH A;  2WQ8 A;  1GAN A;  3C7F A;  1W6O B;  4QM9 A;  1Z7S 2;  1X9P A;  2CL2 A;  2O8Q A;  1H8T C;  2DTW A;  5C70 A;  3V0A A;  2ZGO A;  5FZG A;  2GMP A;  4UFL A;  5BNN C;  1OD5 A;  1R1Z A;  2ATF A;  4D6Q A;  1MEC 1;  1OH3 A;  1W2T A;  1ND2 C;  4I09 A;  1IS4 A;  1MR5 A;  4LO5 B;  3ROU A;  2HWD 2;  4AG4 A;  4COU A;  5F1R A;  5IK4 A;  5AVA A;  2G9F A;  2UWB A;  1BQP A;  3KV5 A;  1YXW A;  3WV6 A;  3AKT A;  3KSC A;  4NHK A;  1XRU A;  3BUC A;  1Y3T A;  1WGP A;  2BBA A;  2TUN A;  2BOJ A;  1JMU B;  4WVZ A;  1LU2 A;  4CP0 A;  3VHN A;  4RS5 A;  3HR9 A;  3OGG A;  4MET A;  4HK8 A;  2EIC A;  1BJQ A;  1JYC A;  3FLT A;  5T55 A;  1YJK A;  3EO6 A;  5LA0 A;  2DF7 A;  4Q0P A;  3SC7 X;  3PUS A;  3B9I A;  4MXW A;  3ZLI A;  1U5X A;  2VM9 A;  1ULF A;  2AAC A;  2RR1 1;  3VZJ A;  4XUO A;  5L9V A;  1X8E A;  4PHZ A;  3H3U A;  2Y26 A;  4LHL A;  5FWE A;  5JR7 B;  5FYV A;  1LNS A;  3WF3 A;  1L7R A;  5C8W A;  5IVE A;  2RVA A;  4MLO A;  1PVX A;  5J98 B;  2RS3 3;  4XAA A;  3VDD A;  4HPK A;  4ARY A;  5BV6 A;  3VN4 A;  4M3C B;  4UBG A;  1RYY A;  2D43 A;  1DZT A;  4DUW A;  3QH7 A;  2CY6 A;  3AL5 A;  4Y1X A;  1LB2 A;  4O61 A;  4YW3 A;  2PHL A;  1MVQ A;  5I8S A;  4WZC A;  1VB4 A;  1DGW A;  4GAL A;  4RHV 3;  5E1R A;  3T2T A;  1DFQ A;  2XKP A;  3ZFF B;  5FYT A;  4LKE A;  4NR1 A;  4ASM B;  4XF1 A;  2PFW A;  4CU7 A;  2IUW A;  2P34 A;  1XSQ A;  1GU3 A;  4AXO A;  1YJL A;  1MZF A;  1G9F A;  3I3E A;  4FPC A;  4B1L A;  2MPF A;  3CKH A;  4FFH A;  1W6Q A;  1XNC A;  5BNP A;  2YXS A;  4QGN A;  3LB9 A;  4H14 A;  4BLI A;  3SXW A;  4PT6 A;  1MS8 A;  2HYX A;  4HN0 A;  1RHI 1;  5C4W C;  4HET A;  2YC2 A;  3ES4 A;  3FLP A;  5A33 A;  1TMF 2;  1DBN A;  1PZ7 A;  1S4C A;  4ZU4 A;  4N7I A;  1ZRR A;  4RR3 C;  4UFM A;  3VBH A;  2W68 A;  3ZYH A;  1ULP A;  2BWC A;  2WDB A;  2Y0O A;  1W6M A;  5FMO S;  4CEY B;  2XJS A;  4OFG A;  4YG3 A;  1VAK A;  5FQ0 B;  1ULE A;  3ZMN A;  5HI0 A;  4E4D X;  1ACC A;  4P9L A;  2RR1 2;  3LEM A;  4UWD A;  1WLT A;  4R4Z A;  1H8T A;  5I0U A;  4AZZ A;  1RIN A;  1Y9Q A;  3OD0 A;  4YRD A;  4AI1 A;  1FNY A;  5JI9 A;  4R9D A;  4CUA A;  2BER A;  4DIQ A;  2C26 A;  2W52 A;  5DAP A;  2BYV E;  1PK6 B;  3ZFG A;  4AQS A;  1ENR A;  3V65 A;  1BYH A;  3VBR A;  1QJF A;  3NAP B;  4GUL A;  1H2N A;  1UY3 A;  4J6G A;  4L99 A;  4LLF A;  3KV6 A;  3WW3 A;  3SMH A;  2NZ9 A;  3MFA A;  4NO4 A;  1TNF A;  2XKO A;  5GLW A;  5FWJ A;  1JOJ A;  4YM3 A;  1QHD A;  4JGZ C;  5IK7 A;  2XBO 2;  3LF7 A;  4JZR A;  3AZV A;  5ABJ B;  1VBA 2;  4Y33 A;  5AFB A;  4R8H A;  3D0S A;  1QJE A;  2ID4 A;  1H8V A;  4YVS C;  1EYB A;  1MS4 A;  1V6J A;  1VAV A;  4QU1 A;  3ZDV A;  3SNM A;  1C1L A; 
#chains in the Genus database with same CATH homology
 1JU3 A;  2J22 A;  3T0A A;  2YFU A;  5JXI A;  1ULO A;  3WNM A;  2VTF A;  4GZ9 A;  1K3I A;  4A42 A;  4OMC A;  3ECQ A;  2QQJ A;  1JZ4 A;  1XPW A;  1HN1 A;  2JD9 A;  3DYO A;  3MUZ 1;  1PX4 A;  5G05 L;  3WEZ A;  4QB6 A;  4A6O A;  4QX0 A;  4QPW A;  3I2G A;  3WNN A;  4W4Z A;  4KI5 M;  1KEX A;  2YG0 A;  5HXM A;  3ETP A;  3T2P A;  5DMY A;  4DEV A;  2Z4F A;  3I2I A;  2ZXQ A;  3FL7 A;  3OG2 A;  2EIB A;  2W91 A;  2VC9 A;  1PMH X;  1JZ3 A;  4BXS V;  2W47 A;  4A41 A;  3K4Z A;  2XOM A;  4QX1 A;  3CZU A;  4PF1 A;  1UWW A;  4L0P A;  4ARX A;  5DN2 A;  2J7M A;  4MGQ A;  4MGS A;  4DUX A;  3JXS A;  5LA1 A;  3A23 A;  3ACH A;  2WZE A;  1UYZ A;  3OBA A;  3GXU A;  2JDA A;  3OGV A;  5C71 A;  3I2K A;  1DP0 A;  2V72 A;  5CYY A;  1UY4 A;  3UES A;  4OYU A;  4P00 B;  3E1F 1;  2W5F A;  4M4P A;  1SG3 A;  1IQD C;  4OMD A;  4UOJ A;  1UXX X;  1DLC A;  2JE8 A;  4LPL A;  4QDQ A;  4Z2A A;  1US2 A;  2VL4 A;  1W9T A;  3SEE A;  3CMG A;  1DYO A;  3VDA A;  5IFP A;  2CDO A;  5A1A A;  5J1X A;  3III A;  2WAB A;  1JI6 A;  4CVU A;  4GWI A;  2VO5 A;  2OKX A;  3K75 B;  3THD A;  3I97 A;  1JYV A;  4UI9 L;  5G04 L;  2ZEY A;  4ZXE A;  4TTG A;  1UMH A;  3LEK A;  4OZO A;  5LCW L;  2WBK A;  3T08 A;  1EUT A;  4LHS A;  4QDR A;  4A4A A;  3SKJ E;  4LQR A;  2E32 A;  1BHG A;  1OH4 A;  2W92 A;  3CIH A;  3HEI A;  3HNY M;  3NJV A;  1NKG A;  3VD3 A;  3BGA A;  3CQO A;  1JHJ A;  5JXG A;  2VCB A;  5JR2 A;  3C7H A;  3WNP A;  1WKY A;  3VD5 A;  4AAX A;  5JXH A;  1CX1 A;  2E31 A;  1JZ8 A;  2VQU A;  3LE0 A;  2DCK A;  2VMD A;  2WYS A;  2VZU A;  2Y6H A;  4XVH A;  2E33 A;  3C7E A;  1CZS A;  1W8N A;  3WNO A;  2QQK A;  3SEP A;  2B4K A;  3U37 A;  1GUI A;  3D3A A;  2C9K A;  4FI9 A;  4MO3 M;  1OF4 A;  4IUG A;  1T2X A;  3IDA A;  4HG6 B;  1WCQ A;  1J84 A;  1UX7 A;  1SDD B;  1UYX A;  4YPJ A;  3GDB A;  1F4A A;  3WNL A;  2YFZ A;  2X09 A;  1W9W A;  1OD3 A;  4P08 A;  5DPN A;  1CIY A;  5DQ0 A;  2LW8 A;  5B4X A;  1JYX A;  4GWJ A;  3WF2 A;  1JZ6 A;  3K77 A;  2RJ2 A;  3C7G A;  2VZV A;  4CUB A;  2VZO A;  1PMJ X;  1K45 A;  3LQC A;  2W3J A;  3W5M A;  3VD4 A;  1UYY A;  2J1R A;  4JX0 A;  2EIE A;  1O8S A;  3HPN A;  4DXS A;  4CU8 A;  3A22 A;  4JKM A;  1XNA A;  1JZ2 A;  1YQ2 A;  2BGP A;  3LPF A;  2Y6K A;  3C7O A;  2VZ3 A;  1TVG A;  1H6Y A;  3P1I A;  4DXR A;  4QX2 A;  2W9X A;  3PUH A;  3WF4 A;  4JHZ A;  3GGL A;  1I5P A;  2W1S A;  3MBW A;  4XUP A;  2WUH A;  2VOT A;  3VDB A;  1XC6 A;  2B9V A;  1W9S A;  3W5N A;  2WN3 A;  3GM8 A;  3MV0 1;  5EJ1 B;  4LKS A;  2Y6J A;  3CZJ A;  1JU4 A;  2WO2 A;  3HJR A;  2VQT A;  3IB3 A;  2JKX A;  2WAO A;  1L7Q A;  3WF1 A;  4P5Y A;  3IAP A;  3I2F A;  5EIY B;  4D8M A;  4UAP A;  5IYY A;  2YC4 A;  2ORZ A;  2V4V A;  1NX9 A;  1K42 A;  1UXZ A;  4CU9 A;  4XUR A;  4XUN A;  1EUU A;  2XQX A;  1CZT A;  3HOB A;  3P6B A;  2XHN A;  1XNT A;  2W1W A;  3K46 A;  1SHW B;  2BGO A;  3MUY 1;  3FHA A;  3OEA A;  4QDS A;  3THC A;  3NJX A;  3T2Q A;  3T09 A;  4W50 A;  1UY2 A;  4JKL A;  1PX3 A;  2Y6G A;  1OF3 A;  3I3D A;  1JYW A;  3CDZ B;  1UY0 A;  2QQM A;  3K4D A;  4KWU A;  3BN6 A;  1O8P A;  3VDC A;  4E8D A;  2WZ8 A;  4MAD A;  5JUV A;  2WO1 A;  2XON A;  3SKV A;  4RN5 A;  3ZM8 A;  4A44 A;  2V5D A;  1F4H A;  2QQL A;  3UET A;  2VZP A;  3NRU A;  2VME A;  4CUC A;  1P8J A;  3J7H A;  5JXJ A;  2ZEZ A;  1UZ0 A;  1TG7 A;  2R7E B;  2HLE A;  2X10 A;  3WSO A;  1D7P M;  3VD7 A;  2Y8K A;  5CZK A;  2L9L A;  2QQI A;  2W46 A;  3NQH A;  5IFT A;  4XZU G;  3T0B A;  3WQB A;  2J1E A;  4E8C A;  1GMM A;  2J1A A;  1NUK A;  2VZQ A;  3LEI A;  4P02 B;  4DUV A;  4W8J A;  3VD9 A;  2Y64 A;  2J1U A;  3DYP A;  2WN2 A;  3EYP A;  3HN3 A;  3PUI A;  1GQP A;  2VCA A;  5JMO A;  3OB8 A;  2QQN A;  1JZ7 A;  3DYM A;  5I0D A;  1JZ5 A;  1UMI A;  3ACF A;  4DEQ A;  4BJ0 A;  4TXW A;  4DXT A;  2ORX A;  2WO3 A;  4JKK A;  4QX3 A;  1K12 A;  4ZZ5 A;  4QB1 A;  1W0N A;  4A45 A;  4PQQ A;  1UY1 A;  3A21 A;  5IHR A;  4BDV B;  2Y6L A;  2VZ1 A;  4A3Z A;  2X05 A;  2VMC A;  3OEB A;  1W8O A;  2WQ8 A;  3C7F A;  5C70 A;  3OGS A;  3A7Q A;  3ACG A;  1US3 A;  2BZD A;  5HPO A;  3LEG A;  1R64 A;  4M4R A;  2RV9 A;  4AG4 A;  3AC0 A;  1KGY A;  2W95 A;  4QB2 A;  2BBA A;  3I3B A;  3K4A A;  2DCJ A;  2VZR A;  2ZEX A;  3ACI A;  1CZV A;  2KD7 A;  5EJZ B;  2EIC A;  5LA0 A;  2CDP A;  1GOH A;  1GOG A;  2VM9 A;  4XUO A;  3EB7 A;  2VJX A;  5FUI A;  4BK5 A;  3I2J A;  1LNS A;  3WF3 A;  1L7R A;  2J1T A;  2RVA A;  2W1U A;  3T0D A;  3MV1 1;  2C4X A;  2J1S A;  4ARY A;  2W1Q A;  5B4N A;  4ZZ8 A;  1RYY A;  4DUW A;  3DEC A;  5IJR A;  2W94 A;  2DDU A;  3HNB M;  5F7U A;  4CU7 A;  1GU3 A;  2ZEW A;  2YB7 A;  1O59 A;  4BK4 A;  3I3E A;  4KMQ A;  4RYD A;  4QAW A;  3CKH A;  4XUT A;  3C8X A;  4XUQ A;  2VR4 A;  1OT5 A;  4PT6 A;  2VCC A;  5LA2 A;  2HYX A;  3OGR A;  2YC2 A;  3FN9 A;  4ZY9 A;  1GOF A;  3WNK A;  3MO4 A;  4OUE A;  2LS6 A;  3LPG A;  3ABZ A;  2W87 A;  1ULP A;  1NAE A;  2WDB A;  2WAA A;  2QBX A;  2EID A;  4D0Q A;  1MPX A;  2E26 A;  4CUA A;  2BER A;  1J83 A;  2C26 A;  3UNP A;  2VZS A;  2VMF A;  1JYN A;  1W99 A;  2PQS A;  1UY3 A;  3T2O A;  3I2H A;  3WF0 A;  3HNM A;  4CU6 A;  2VZT A;  3NNG A;  2J1V A;  2QQO A;  4MOA A;  5C7G A;  3FHQ A;  4ET7 A;  1GNY A;  2ID4 A;  3IAQ A;  1H6X A;  3F2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...