2Y6KA

Xylotetraose bound to x-2 engineered mutated cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
LVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSLDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
molecule keywords XYLANASE
total genus 43
structure length 165
sequence length 165
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y6kA00
3VDCA 2WYSA 5JXJA 3VDBA 4JKMA 3MBWA 1K45A 4PF1A 2WO3A 4QB1A 3IB3A 2WO2A 2J1TA 5JUVA 1O59A 3ABZA 4QB2A 3WQBA 1JZ5A 1OD3A 1T2XA 3BGAA 5EJ1B 1NAEA 5JMOA 3I2KA 1XNAA 4IUGA 1UYYA 3FN9A 3WF1A 2VZUA 1W99A 3NJVA 4MO3M 4E8CA 3ACFA 3MUZ1 2VMDA 2W1WA 3I2IA 2VC9A 4PQQA 2DCKA 3T2OA 2YG0A 4DUWA 4QDRA 3WNMA 3W5MA 1H6XA 4A42A 2W95A 4CU8A 3OGSA 4JHZA 4P00B 1KEXA 4DXSA 5HPOA 2W5FA 3VD4A 2J1EA 4MADA 3P1IA 4Z2AA 1MPXA 5F7UA 3P6BA 4GZ9A 3T09A 4ET7A 4UI9L 1O8PA 1NKGA 3ECQA 2VZRA 2VJXA 1W9TA 1H6YA 5CYYA 3HN3A 5G04L 4DXTA 3THDA 1SG3A 1R64A 2RVAA 1W8OA 5EIYB 3VD5A 1DYOA 1WCQA 4QX0A 3EB7A 1JU4A 2WAOA 3UETA 1I5PA 2E31A 3NRUA 1GOGA 1DLCA 2L9LA 3K75B 4JKKA 2W87A 2EICA 1WKYA 2ZXQA 2J1UA 3I3DA 3CMGA 2Y64A 2C4XA 2J1VA 2EIEA 3IIIA 2V72A 3I97A 5LA0A 1JZ3A 2J1AA 4QX2A 1UY2A 3PUIA 2VZTA 4CU7A 3W5NA 2VQUA 5B4NA 5LA2A 3GGLA 3DYOA 2ZEWA 2WN2A 4XUPA 2R7EB 1UYXA 1PMHX 2QQLA 2W1SA 4XUNA 3K4AA 4QX3A 3SKVA 4M4RA 4MGQA 4UOJA 2EIDA 3CKHA 4M4PA 1UXXX 2HYXA 2WZ8A 1OF3A 2W46A 4LKSA 4CVUA 1UX7A 4AAXA 3HEIA 4W50A 3NNGA 4W4ZA 2J7MA 2YFZA 3I2HA 5C70A 2VM9A 2VZ3A 4DEQA 4P5YA 1IQDC 2RJ2A 4L0PA 3LEKA 1US3A 1JYWA 3FL7A 3IDAA 3K77A 2WAAA 2J1RA 2W94A 1CZSA 2QQKA 3WEZA 4A41A 3C7HA 5DPNA 1JZ6A 1UZ0A 5EJZB 1JYVA 1BHGA 1GUIA 2VMEA 2JD9A 4GWIA 4CUBA 2CDOA 2QQNA 2VOTA 3K4DA 3WNPA 1OT5A 4XUTA 3A21A 2Y6JA 2YC2A 2WZEA 2BBAA 2ORZA 1JZ2A 1UXZA 1CX1A 3OEBA 4BXSV 3WSOA 2LW8A 2J22A 2VZQA 4ARYA 4TXWA 2W47A 2VCAA 2VZSA 4LHSA 4KI5M 2X10A 4ZZ5A 4TTGA 5IYYA 1NX9A 1UY3A 4ZZ8A 3FHAA 4MGSA 2VZOA 3CDZB 4BDVB 3DYPA 1CZTA 2VO5A 3T0AA 2DCJA 3LPGA 1NUKA 3CIHA 4D8MA 3ACGA 2JE8A 3I2JA 1PMJX 4P08A 4JX0A 4OZOA 2BGPA 4D0QA 1L7QA 5FUIA 2X05A 1EUUA 3C7OA 3T2QA 2VTFA 2YB7A 2XHNA 4E8DA 2VMFA 5IJRA 3OEAA 3UNPA 3WNLA 2LS6A 3LQCA 1W8NA 1F4AA 2ZEXA 4OYUA 3I2GA 5B4XA 1LNSA 2WUHA 3EYPA 3NJXA 3K46A 3MV11 4LPLA 2WDBA 3VD9A 2XQXA 3WF2A 5IFTA 3C7EA 3MUY1 2BGOA 5IHRA 1GNYA 5IFPA 1PX4A 2VCBA 3LEIA 3BN6A 3GDBA 1XNTA 2PQSA 5CZKA 5G05L 3HOBA 5JXGA 2E32A 3FHQA 5LA1A 4XZUG 2Y6HA 2ZEYA 1TVGA 4ZY9A 3D3AA 4A45A 4DEVA 5A1AA 1EUTA 1ULOA 2YFUA 5DQ0A 4P02B 2B4KA 2C26A 4A44A 2BERA 3E1F1 3WNNA 4BK5A 1SHWB 4QDQA 2Y8KA 3OB8A 1UWWA 3OGVA 2WN3A 2VMCA 3C7GA 4JKLA 4OUEA 1XPWA 3WF3A 4XUQA 1GQPA 3HJRA 2BZDA 3VDAA 1D7PM 4QDSA 4W8JA 1K42A 1UMHA 1GOHA 1GU3A 2YC4A 3NQHA 4KMQA 5J1XA 2V4VA 1UY4A 2VQTA 3OGRA 4QPWA 2W9XA 4ZXEA 4A6OA 4BK4A 3LPFA 1K3IA 1RYYA 4A4AA 4YPJA 3HNYM 4OMCA 2JKXA 5C7GA 1CIYA 3GM8A 3J7HA 2RV9A 1CZVA 4XURA 2XONA 2B9VA 2W91A 3PUHA 1K12A 4XUOA 1PX3A 3ETPA 1W0NA 3MO4A 1W9SA 4FI9A 3IAQA 4CUCA 1UMIA 3ZM8A 5JXHA 2JDAA 2E26A 3VD3A 1GMMA 3I3BA 3AC0A 3GXUA 3ACHA 4RYDA 1ULPA 2HLEA 5DMYA 3T08A 2W3JA 3JXSA 1US2A 1OF4A 2Z4FA 3VD7A 5JR2A 5I0DA 3UESA 2X09A 1JZ4A 1JI6A 2QQMA 4OMDA 3WNKA 4MOAA 2E33A 4CU6A 3OBAA 1JU3A 2Y6KA 2EIBA 2OKXA 3DYMA 2W1UA 3MV01 4QX1A 4CUAA 1O8SA 2VZ1A 2ORXA 3OG2A 3CZUA 3SEEA 3C7FA 3T0DA 3I3EA 2W1QA 2C9KA 3LEGA 4DUXA 2VL4A 1DP0A 2ZEZA 2KD7A 2XOMA 2Y6LA 3C8XA 2QQIA 2VZPA 1SDDB 1W9WA 1UY0A 2VZVA 5DN2A 4CU9A 2WO1A 3I2FA 3IAPA 1XC6A 1UY1A 1J84A 4AG4A 1YQ2A 1OH4A 3HNBM 1JYNA 3HNMA 2CDPA 4QB6A 1GOFA 3K4ZA 4XVHA 1F4HA 3T2PA 4DUVA 1HN1A 3U37A 4PT6A 3CZJA 2V5DA 2Y6GA 3ACIA 4QAWA 4BJ0A 4KWUA 1JZ8A 5C71A 1JZ7A 1JHJA 4A3ZA 4DXRA 1KGYA 4GWJA 3LE0A 1J83A 4HG6B 1JYXA 1UYZA 3THCA 2W92A 3WF4A 4ARXA 2WBKA 5LCWL 4RN5A 3CQOA 5HXMA 4LQRA 3A23A 2J1SA 2WABA 3T0BA 4UAPA 2WQ8A 2QQJA 2VCCA 3WF0A 2VR4A 3SEPA 2QQOA 3F2ZA 3A22A 3A7QA 5JXIA 3SKJE 1TG7A 2QBXA 2DDUA 1L7RA 1P8JA 3DECA 3WNOA 3HPNA 2ID4A
chains in the Genus database with same CATH superfamily
1CAXA 1UOFA 3VBHA 4N53B 1MEC2 3WR0A 3CHXA 3BTAA 5CNAA 3O0VA 2AR6A 4BOWA 3HR9A 4CDUC 1HRV3 5LK7B 5FZ6A 2X5IA 4P9IA 3M3CA 3AP5A 4QB1A 3LDBA 1HIXA 4A7YA 1GZTA 5CFDC 5C4WA 5A80A 1IPSA 1G9CA 1XYPA 3N7MA 1ZM1A 2E63A 2WNOA 3FLTA 1LOBA 3AP7A 4PBOA 3AYEA 2P6CA 4QB2A 1DZTA 1SLLA 3IPVB 1JODA 3LEMA 1HXS3 4JGYC 1EV13 1HRV2 4KG0A 4LK6A 3WUCA 1G9BA 1LOFA 1NZIA 3AXDA 3BGAA 3EQEA 5EJ1B 5T5LA 1NA1B 2YBKA 1XNAA 3AVSA 4XEZA 1N1YA 4IUGA 4AEMA 2HBUA 2XJUA 1UN1A 2VNRA 1LRHA 5AC92 1I9RA 4OHXA 2ATFA 2VECA 1F31A 1CD3G 3TEZA 2NYYA 5DZFA 4YWAA 1JBCA 1DGRN 3ACFA 3IBMA 3E6DA 3LGRA 4IETA 4MO3M 2XBO2 4PQQA 1HV0A 1R1A2 2DCKA 1MQTA 3B00A 1JHNA 2YG0A 4DUWA 4Q4W2 4R4XA 4QPIB 3VHRA 3LA3A 2BNMA 1HQLA 3APBA 1E5IA 3W5MA 1H6XA 3OGSA 2R042 3MYXA 1KEXA 4P00B 5FZFA 2W5FA 5LK5A 2J1EA 4KGQA 4TSVA 3DEMA 4OI1A 1C8M3 4MHRA 2JE9A 1GWMA 1MPXA 5FBZA 3P6BA 1SLAA 4GZ9A 2WYFA 1FAYA 1UX6A 1WGPA 1YFUA 2ZGMA 3AMPA 4ET7A 3ZXLA 4LE4A 3KD4A 3WDXA 1OUSA 3ZYJB 5A6XA 2A1XA 5A70A 1R092 2JB8A 1GP6A 5FP4A 4XJ9A 2FMYA 2SBAA 1V70A 4XACA 4HVOA 4OHVA 1Q8OA 3AP9A 4XMAA 3AFKA 1XRUA 1XYOA 2IXKA 1W04A 5EIYB 4QXBA 1ENQA 4H7LA 1WLCA 3EB7A 2CWMA 3GBFA 2DVFA 2ERFA 4Y4YA 5AVPA 5A7WA 3WP5A 1OLRA 4XHBA 3S7IA 4AEKA 1AR61 5C9AC 5IVCA 2DWRA 4HZFA 5I93A 1YO8A 1LEMA 1W2OA 1VR3A 5F8PA 1SBFA 5K0UC 3E97A 2E31A 3NRUA 1DLCA 1C1FA 2I45A 1HRV1 1UO9A 5T54A 3UK9A 3VZJA 1YI9A 4LHLA 3ZKUA 4JKKA 2W87A 2EICA 4CP9A 1WKYA 3UGHA 4BQ3A 1TME3 5T55A 4LBMA 5A7OA 2Q8CA 2ZXQA 3ES1A 1OLME 2NZ9A 4N53C 5CFDA 3S5QA 2Y64A 1BVP1 3BIEA 1HB3A 2ARAA 2VBBA 5H9PA 4DIQA 1V6LA 4IESA 1MS8A 4LO6B 4Y1YA 4L2NA 4JGZA 2XL7A 3V64A 5KXBA 1OOPA 4YVSC 5JSPA 5K7PA 2G9FA 4ONUA 4AVVA 5LA0A 3AB0A 4K40A 4QGNA 2R0HA 3PUIA 2GNTA 2VZTA 1GZWA 4FPYA 2JIGA 5FZOA 3ZYBA 4ZU5A 1RVF3 3W58A 1YWKA 3W5NA 5B4NA 1RUF1 3DYOA 2ZEWA 3ILNA 2WWJA 3RQ0A 4XILA 5IATA 2G4IA 4JC1A 1REDA 3AZVA 1F8VA 1RXGA 1WZXA 2AH2A 2H0VA 3KS7A 3S7EA 1BCXA 4MGTA 2BWAA 1ZBA3 2JD4A 3C2UA 5FLHA 3ZMOA 1R1A3 3NW4A 4NUBA 5KC5A 1AZDA 4FFHA 4M4RA 1LOGA 4MGQA 3KGLA 5BNPA 3FLPA 1GZ9A 1AR92 2A6XA 2HYXA 2A6VA 4Y20A 2P4EA 4Q0SA 5AC93 1SFPA 2G1MA 4CVUA 1VB4A 2QE3A 3N9LA 1XOYA 1S0CA 3PMEA 2FZ1A 4OHZA 2SLIA 3HEIA 4TWTA 3RNSA 3NNGA 4CCMA 2J7MA 4NMIA 1XJAA 1POQA 5C70A 1N1SA 1J3RA 2EIGA 3AXEA 3HBZA 4S2GA 3ZXEA 1SFYA 5BNOB 1KFUL 1EV12 1Y43B 2BV4A 5DG1A 3IT8A 3LEKA 1US3A 1CONA 1Y3TA 2WS92 3POEA 1Y9MA 2JDZA 3K77A 3WW2A 2HEWF 4CDQA 3LB9A 1WWYA 1QOSA 1H8TB 3IDCB 3J8F3 5A3PA 1GP5A 5HCFA 3LSEA 1ZZ7A 1W90A 4KQ7A 1S0FA 3WEZA 1QQP2 2C24A 2JG9B 1YCIA 1RUG3 3NKGA 1JUIA 1JZ6A 4XCBA 4DO0A 1GWLA 3M70A 2O8OA 2Q8EA 3MPBA 3M8LA 2JIJA 2NMNA 4FXKB 3TEWA 1DGWX 1ULCA 2JD9A 2HWC2 1NT0A 1FNZA 1QJU1 4HPKB 5FZBA 1F35A 2WFF3 3WDWA 1W6MB 2QQNA 4D6SA 4UFHA 2A5ZA 3U4XA 1REEA 3JU9A 3K4DA 3OSDA 3VHOA 3THTA 1EAH3 5GLVA 4EN0A 4AZZA 3PNAA 4JVAA 2ZGOA 4BWOA 2WT0A 2VQAA 4FAHA 4P9YA 1RIRA 3A21A 2D43A 2Y6JA 4FTSA 3KT1A 3LAGA 5JAXA 3OUIA 4FQ4A 3MLKA 4R4ZA 3B02A 3HWJA 3M3IA 4QQPA 5FXZA 2RDRA 2Y60A 3O1RA 3JBG2 1RL3A 1D0GA 1UXZA 5DDJ1 2WL1A 1QJY3 1SLCA 4ZHNA 4BXSV 3HQUA 2OIIA 3RI8A 5AVAA 4CP0A 4F7ZA 2NMOA 3JD73 3OF1A 3U75A 2LROA 2XG3A 4C0BA 1YQCA 3L2YA 1VBA3 3P5BA 5HCHA 2G19A 4LORA 2VZSA 4V2VA 3TNQA 1KJRA 2A73B 4G9SB 4LHSA 5C8CC 3O1TA 4KI5M 1KQRA 4ZZ5A 1X50A 4IEOA 5C3RA 4TTGA 5IUQA 3FBYA 1RUC1 1ND2A 3JQXA 5JCTA 1UY3A 2GH8A 3IWZA 4N43C 4MGSA 1RUI3 5H9QA 4GA9A 1NCQB 5JSOA 3DYPA 4QMAA 3BTYA 4FPFA 4LIUA 1FI2A 2R16A 2Z69A 3LPGA 1O7FA 5JLVA 2RG4A 3I2OA 1NXMA 2LRPA 1RUF3 1VRH3 4LTAA 4P08A 1QH7A 1NY72 2ET7A 3WW3A 3VBFC 5BYNA 4AEDB 2BQPA 5FUIA 4BXFA 4CXYA 1MS9A 4RFRB 3RS6A 3URFA 5IAVA 4E9KA 1EUUA 2BFUS 3C7OA 1OBNA 5D1IA 3T2QA 1DQ0A 3FLRA 1O5UA 3AMNA 2VMFA 4H55A 1XNDA 1UOGA 5FP9A 4I0AA 4K21A 2BJSA 2LS6A 2WNVB 2QNKA 1JN2P 4ZS2A 3LFMA 2VD7A 1W8NA 3U11A 4OYUA 2ZEXA 4E4HA 1MS4A 3I2GA 5HXVA 5JWPA 2WUHA 4AHXA 3AP4A 2B9UA 3K46A 5DAWA 1W9FA 2OA2A 2DBIA 3CBNA 1UOBA 2Z42A 3I3QA 4RQPA 1E5RA 4W6XA 3ZN5A 2WDBA 4HKOA 4MZUA 3HN1A 1YIFA 2XQXA 2X5IB 1ND3A 4WM7B 4YW6A 4DQAA 1WCKA 3ASIA 2BUKA 3D8CA 5FUNA 5IFTA 4GKXA 1OURA 4COVA 1DBNA 5FZMA 1VBD1 3N9OA 3U4SA 1PIV1 4AI3A 5FZAA 5EYXA 2YYOA 2E7QA 4LBNA 5FAXA 1H4GA 2VUJA 3KCCA 1PO22 3BOWA 5FKBA 5FV3A 2Y33A 5IFPA 2HWD1 3BN6A 5GLTA 3RSJA 3VBRA 1XNTA 2PQSA 3AK0A 4NROA 2WFF2 2Y34A 4G3YC 5K9YA 2DFCA 1XYNA 2HWC3 2RMU1 3N7LA 3MEPA 5A3MA 1XE7A 4GD4A 1TVGA 3DN7A 1J58A 3D3AA 4FFGA 2QDRA 3U0ZA 4PIXA 1EUTA 1XB9A 2EALA 4IEQA 5JSRA 2GP3A 1ZA7A 1AX2A 1QJU3 2A7AA 4GQ7A 4IE0A 2GU9A 5A7SA 4MSVA 4XJZA 3ZIXA 3WNNA 3T2TA 1OH3A 1HRI1 4XJUA 1NXD1 4AGGA 4ZU4A 3IIAA 4AI9A 5JOWA 1TZOA 4FTBA 1RUG1 1Q8VA 3AMQA 1UKGA 3D4KA 4ASLA 4QKBA 1KITA 3M3EA 2WN3A 2RS32 2X29A 1D0HA 4WVZA 3KQRA 3RG0A 2IWGB 4GJZA 1YYNA 4XUQA 1GQPA 5CIRA 4CDQC 3DUIA 1LECA 3MW3A 3HT1A 1QGLA 4QDSA 1YQ6A 1GOHA 1DF0A 4XTMA 5FK7A 3SITA 2ARCA 4KMQA 5J1XA 2VQTA 1UY4A 4MGIE 1OQEA 3OGRA 1YXWA 2UURA 4B4QA 1BK1A 4BIOA 4BH9A 2LTNA 1GQHA 1Y7BA 5E89A 4ASMB 1S2BA 5ABJB 1ODNA 1ZBA2 1W6NB 4XDPA 5A3TA 3HNYM 2A6WA 4HVQA 5H9SA 1F5FA 3OYWA 4PLNA 2PFWA 1V6JA 1CIYA 1V6IA 2ZAAA 4RA0A 1B09A 3J7HA 2XUMA 2YU2A 1RUE2 1OKOA 2ZACA 1RVF2 1S2EA 4O61A 2JDHA 5KHJA 3KT4A 2D5FA 1OOPC 4YVSA 1W0NA 3MO4A 2ADDA 1X36A 2NPIA 1PVC1 1ZBE3 3WQ7A 1W6PB 3IAQA 1POV3 1SQ4A 4CUCA 5A33B 1PZ7A 5JXHA 4URTA 4JV4A 1IS6A 4MVTA 3PTYA 3IMNA 3ACHA 4IE4A 5FREA 1D2QA 3O1UA 1PGW2 2HLEA 3VBRC 1HN0A 5FIXA 5IK7A 2W3JA 1AR91 1LODA 1TME2 3AMHA 4OHWA 3FFZA 2KM2A 3K2OA 2WNUB 2PQQA 3USUA 1FT9A 3MIBA 4HOOA 4P9WA 4LKDA 2WINB 1RUNA 1UZYA 3VD7A 3FHIB 1Q8SA 3IN9A 3UESA 1EYBA 3WG3A 1FNYA 1VE0A 3WNKA 1JMUB 1NG0A 3I59A 5FY1A 2WNUA 4UW3A 1WMDA 3RJRA 5CA6A 1QF3A 3N9MA 2E7AA 3DYMA 2OKXA 4CP2A 3NV2A 2XKOA 4RS5B 2D6PA 1AR81 2W1UA 3T1LA 4QX1A 4EROA 1LHVA 1QOOA 5FY9A 1KXGA 3O0XA 1PMIA 4PHZA 3UGGA 1DYPA 3POJA 3ZYHA 3V0AA 4MXWA 3OG2A 4LHNA 2G9GA 2ZBJA 4F8AA 4AOCA 1H8TC 5CADA 3I3EA 4XF0A 5KHGA 3BYWA 1Z78A 2XWJB 5JZGC 5D8AB 1IOAA 3M2MA 5FPBA 4URAA 4JGZB 1HQWA 1W8HA 2ZZQA 1QJY2 3VKNA 2HEVF 3SHRA 2BBVA 3C8XA 3RZGA 3VBSC 5ACA2 1UY0A 2PHTA 4CU9A 5GZGA 1F5JA 3E5XA 2TBVA 2WO1A 3I2FA 3IAPA 2I2SA 2VMGA 4HLTA 4JGZC 2BW8A 3AKPA 5F3EA 1PVXA 3VBFA 3WP3A 4JZRA 3ZYFA 5FZEA 4UF0A 5LRSA 1PGL1 1YQ2A 1UD1A 2A3YA 4FPGA 4HPKA 4WM7C 4YW5A 4FVVA 2Q1FA 4A3XA 4EN6B 1W0OA 2MEV1 2A75A 1JYNA 4AE2A 2X8KA 1AYN1 3KV5A 4INDA 2C0ZA 4XXPA 2D44A 2DF7A 2GALA 2GN3A 2Q0AA 4AGRA 3LOBA 1MS5A 4NHXA 3SH3A 3QLQA 5C9AA 1AL21 1ENRA 3BUCA 3D0JA 2XVGA 4LO4B 4ES8A 2D3SA 2XBO1 2EVXA 5FPZA 3H1MA 2BU9A 5LRRA 3RZHA 4XAEA 3MHZA 1PIV3 4A3ZA 3SISA 1ZRIA 5HV4A 4A7KA 2WS93 4DPNA 1AX1A 4DOUA 1JYXA 3WY6A 2CGPA 1F2NA 3KWVA 3TN91 4QQOA 2VGDA 2W2IA 4M3CB 4ARXA 5J96B 4IE5A 4BPZA 1LAJA 2V09A 5CG9A 2HWE2 1DQ5A 2D3PA 2WABA 3T0BA 3WV6A 4YFWA 1EPWA 4L99A 2QQJA 4XJAA 2D98A 4RSUA 1ENXA 1GANA 2VMHA 4AGVA 1AR93 4AFAA 4I01A 3SEPA 5IVEA 2R061 2JXAA 5FXVA 1BEV3 3UKNA 5BPXA 4XBNA 2VTXJ 4NIIA 2QBXA 1L7RA 1YRZA 5FP8A 1FMD1 4HBNA 3I4IA 4NHMA 3DECA 2FCUA 2ID4A 2HWF1 2K2SA 3VDCA 4BE3A 5I0RA 4XDQA 1POV1 3VDBA 2OS2A 3BIWE 3ZR6A 2D7FA 1ALYA 2EAKA 2JDNA 2ZGSA 3NO8A 3PL0A 3HBKA 1HJFA 5FXXA 3T4VA 1A8DA 3DXTA 2WZR1 1K45A 1XSRA 4PF1A 1KD7A 1RUI1 1W0PA 2JJ6A 4CDXA 3GNEA 2XJSA 3NNJA 1URXA 5FY0A 1U5ZA 2J1TA 1O59A 4CDWA 3ABZA 3Q8CA 1JZ5A 3ZN6A 1EY2A 3N4MA 4XF3A 1OD3A 1OHFA 3AMMA 3Q9OA 1T2XA 5JMOA 1ZREA 3R4SA 1ACCA 3OCPA 1CIWA 1VBE1 1UKRA 2P2KA 4Q4V1 3ATGA 4OZXA 4DINB 5ISLA 3BU0A 2VULA 4XXAA 1CAXB 3IKWA 1ZYBA 3KVBA 4KWJA 4HANA 3NJVA 3O7OA 4Y1ZA 1DQ4A 4JGYA 3S0MA 2W1WA 3I2IA 2VC9A 4QQLA 4BYYA 2WT1A 4MGYE 3KM5A 5F5IA 4BQ1A 1VBB2 4Q29A 3VBHC 3PUAA 3VBOC 3ZXDA 1W6QA 3BOPA 3JB4C 4QDRA 2Q1MA 3ILFA 2W95A 5FLJA 5J7MA 4DXSA 5A32B 3VL8A 4GAZA 4CDUB 1NE6A 3AM2A 2PHRA 2BOIA 4KBBA 4QX5A 4YLZA 3ETQA 2RS13 4O9EA 3VUOA 5EHDA 3NAPC 2Z79A 1OQDA 2CNAA 1NYWA 3JCIA 2MHFA 2FDGA 2EXJA 4AQ2A 1W9TA 5DG2A 5ACA1 4IV3C 3ZXFA 1H6YA 1H2LA 4UBGA 1JW6A 4YM2A 3THDA 2RVAA 1JOJA 1RHI3 2FMDA 5F5CA 4CA9A 3RZJA 4C90A 4DY5A 4XHXA 2CAVA 4IEUA 4NHLA 2PYTA 4XABA 4L92A 3VD5A 1KS4A 2QQWA 2ZGLA 3VGIA 1DYOA 1WCQA 2JX9A 2UY8A 1SLIA 2XB6C 4BIFA 2BRTA 3GYDA 1PK6B 5LBEA 4DFSA 1V00A 4ORFA 4LLFA 4J6GA 1WLTA 2PHXA 4M01A 4CZSA 3V65A 2XBO3 4LBJA 2DCYA 4DS0A 1N3PA 2L9LA 4XFFA 5FUPA 3ZOIA 4FAGA 4OVEA 2EXKA 3H8XA 1AXYA 4DNYA 1SCSA 3O12A 3ZYRA 1TQ5A 3CMGA 5HV0A 4YW1A 2C4XA 4OLLA 2PHWA 3QD6A 2J1VA 5FZ7A 5KXCA 1XSQA 1AR73 2A3WA 1EPZA 2GDFA 4RS5C 1VAVA 4Q26A 4NHYA 2FDFA 5FP3A 4QM8A 4QU2A 5GKAC 5D8AA 2VTXA 3FMGA 4CEWA 1N47A 5L7OC 1JZ3A 1UU5A 3PIJA 3BCWA 1YIPA 4UW6A 4Y5TA 3OJBA 1D4M3 4YW7A 4DRVA 1IKPA 1W8ZA 2QFEA 5BNOA 5FZ8A 4RGKA 2VE1A 5C8CA 3TEYA 4RS5A 1QJEA 1L3JA 4WVWA 3WOGA 1MEC3 2IFRA 4XUPA 5IK8A 1JYCA 5FO8B 4KWLA 3WX5A 4MG2A 2YXSA 5F32A 1UYXA 3SCFA 3T3YA 1LHWA 3SXWA 2TUNA 4XUNA 3K4AA 4QX3A 3SKVA 1W05A 2TEPA 3O1SA 4OHYA 2WZ8A 3ZFEA 1OF3A 2RE9A 3CLPA 4NR1A 5FP7A 4Z2WA 1ULGA 1AR83 2WZR2 5LWBA 4M3CA 1GWKA 4W50A 4K6BA 4YRDA 3R05A 4YM1A 4EN9B 1EV11 1WW7A 1AR63 1BMV1 4BQXA 2YY1A 2RJ2A 3MF6A 4FOQA 2AENA 4QXHA 2QZ3A 2JG8B 3ZFFC 1JYWA 3RZKA 1TMF1 5FYIA 1NA1C 1K5MA 1BLZA 2FHRA 1VBD3 2UWCA 1UNBA 2QQVA 1C1LA 3VDDA 2ET1A 2FDHA 1RUD3 4J1WA 1CJDA 1RUE1 1CAWA 4IV1A 3I3MA 2QQKA 3PDQA 3LF7A 2QUOA 2VOWA 5FY8A 4A41A 3C7HA 2VUCA 3POIA 4NIAA 5EJZB 4GJYA 5CG8A 1LTEA 2KA3A 3LKJA 1BHGA 2H6CA 1Q3EA 2IXCA 2R30A 1GUIA 4IEPA 1G9DA 2ZGUA 5A1FA 4GWIA 2DUQA 5FZKA 1S55A 3USSA 3W21A 4IQPA 1D4VB 4CUBA 4YW2A 4IEVA 3AZXA 5F2WA 5F6KA 2P3YA 2YBPA 5FBJA 1VAKA 3WNPA 1OT5A 5LBCA 2ZTNA 3DPRA 1PGL2 2A70A 1G7YA 2D40A 3OUHA 2JG9C 4I09A 1W6OA 5FYVA 2YC2A 5BV6A 1UZWA 3WG1A 4P9JA 1Z0HA 2XH6A 5CU1A 1MZ5A 3GJBA 1EP0A 2RS33 4IV1B 2XMLA 3AYDA 3ZYIB 4H2AA 1CX1A 4EN7B 3OEBA 1RUJ1 2C5DA 2CTVA 1NE4A 5F37A 4LT5A 1LGNA 1PIV2 3CJIC 1F15A 5L7OB 4ARYA 2XJQA 4FOYA 4CCOA 2WJSA 2W47A 2VCAA 3D82A 4OCTA 3SMHA 3IZOA 4ISQA 4LOTA 3SLIA 1V0AA 1HXS1 3INAA 5KXDA 1PO11 2D97A 4LR4A 4Y1UA 1QOTA 1RUH3 3O0WA 4JHTA 1WMEA 4Q4W1 4LNVA 3LOIA 4R9DA 1BJQA 1LJ7A 4WVMA 2OX0A 1ULEA 1W6QB 2VZOA 3UV9A 4QPIA 1A8MA 1QJY1 1LCLA 1RB8G 4LBQA 1CZTA 4NAOA 3T30A 1MQTB 2DBNA 4XE9A 5BNNA 4OI0A 3N36A 4CTEA 5CBLA 2YGLA 1DGRA 3L2HA 1Q5OA 4NOTA 1ZRCA 2BGPA 4CCCA 4D0QA 2H0BA 5FZ1A 3WQ1A 1RUH2 5EP9A 2IXHA 5ACA3 1J3QA 1Q43A 2XHNA 1VLNA 1V6MA 4IV1C 2CYFA 5K0UB 1KJLA 1RHI1 3WNLA 2HEYF 3ZN6B 3LQCA 1KS5A 5FYMA 3H9AA 3KCXA 5A33A 1F4AA 1OFSA 4RFT0 3MZHA 2R32A 5B4XA 1JOBA 3UJQA 3NJXA 3ACLA 4LPLA 4Q0UA 5E16A 4Q4X1 3ZFGC 3ZMNA 3CJIB 2AYHA 5K0UA 4RR3A 3TBDA 3ELNA 1AF9A 2WNVC 3VD9A 3JB8A 1GKBA 3WF2A 1VB2A 4YZ4A 4CCEA 1B35C 5F3CA 1NOVA 4FCAA 3A0KA 5I0SA 3KSCA 4M00A 4BZ4A 5IHRA 1AYM1 4YGCA 1I1EA 2DU1A 1PX4A 2W08A 1WBFA 5FWJA 3A4UA 3KZ4C 3JBG1 3MIGA 4S2FA 5CZKA 4FPOB 2RR11 2PMWB 3ENRA 1S0DA 4LEJA 3B69A 3B7MA 1NCQA 4I0WB 4XZUG 4DEVA 5LA1A 2CAUA 2P5BA 4QQ2A 2YFUA 4IEYA 4WVMB 3WHTA 4O9GA 5DQ0A 1XNBA 4YG0A 2ZHLA 3AFGA 3E1F1 2VOXA 1UZZA 5DAQA 4GALA 1VBA2 3OPWA 5JPMB 3D5OA 1KFXL 1NCRA 2NP0A 4IW3A 1RUD2 3GHMA 4QDQA 3ROUA 4CEWC 5L7OA 3TEXA 2Y8KA 3OB8A 3H0OA 4DXZA 4FPHA 3ZSMA 4JKLA 2PELA 4OUEA 2Y26A 1RUC3 1XPWA 3WF3A 3OBTA 5JZGA 1Z7S2 4ZONA 1R083 2AUYA 3HJRA 5FO9B 4HKWA 2QZ2A 4LITA 1M06G 3VDAA 4UFLA 1D7PM 2ZGTA 2YC4A 4DMIA 4OI2A 1X33A 4UYBA 1DG6A 3B94A 4LJHA 4ZXEA 3S5AA 2K46A 3J7NA 2BEOA 2RDNA 4LMFA 1CPMA 2CSGA 2HWF3 3MGUA 4NE9A 2RDQA 4MXVA 2VNOA 2RMU2 4YPJA 5EYYA 4PLMA 3B93A 3KLSA 1SACA 4XJWA 4OMCA 3AVRA 5E1RA 2D5HA 1GR3A 1OPMA 5C7GA 3UYJA 1HQNA 3JD71 2ZJCA 3ORJA 4KU7A 3GM8A 1ND3B 3LSDA 5ABJC 5HCAA 2DVBA 4RR3B 2P17A 3GZAA 3RGBA 3J8F2 4UT5A 3WUDA 1SPPA 2B9VA 2R041 4P14A 5DAPA 1LKNA 1RMU1 1PX3A 1LOAA 4X6QB 4YSFA 1W9SA 4FI9A 2Q8DA 3BPSA 4LA2A 5LB6A 1K5MB 5APAA 2JDAA 2E26A 4MX3A 3VD3A 1SBDA 1GLHA 3AC0A 4H7MA 1AR72 5L9VA 4UFMA 4NIHA 1W03A 4RYDA 1ULPA 3ZPOA 1IS4A 1XNKA 4P9LA 5FYYA 2PHUA 1FPN1 5DMYA 5FYTA 3T08A 1FYUA 3WZ1A 2QCSB 4SLIA 4LO5B 5LEKA 3JXSA 2HYKA 5C5UA 1T6GC 2EA7A 4E4ZA 1JH5A 1BXHA 3I7DA 2ETEA 2HWB2 1Q56A 2DVAA 1LU2A 4BQ5A 1AJOA 3ST7A 4GMP3 5FDBA 3O1MA 3RZMA 2WWUA 4B1MA 4XMIA 2ZGRA 3NV4A 1ND2C 3NKTA 2GH2A 1JI6A 2PTMA 2XLAA 1IPKA 2E33A 3WDYA 3TOJA 4CU6A 1A34A 1JU3A 2EIBA 5BUVA 3VBSB 3LIHA 1RHI2 1E57A 2I07B 2YGMA 3A0NA 4CUAA 3GHNA 1W28A 3DGTA 3SQOA 1HB2A 5GZEA 5BXXA 5CVRA 1OA4A 3CF6E 3SCGA 4DY3A 5C33A 2XHKA 2YU1A 3WINE 3CZUA 5FZ3A 2VU9A 2GZWA 3B5LB 4XAAA 1V6KA 5FCCA 3MIHA 2W1QA 4A6SA 4CCDA 2C9KA 2MNGA 3OD4A 1H2NA 4DUXA 3OPTA 1FPN3 5T50A 4IL7A 5C9AB 2K0GA 5DXDA 2HH9A 1LOEA 2ZS6B 2DUOA 2FD8A 2KD7A 4XFHA 1GSLA 4LBOA 4QGLA 1REFA 1W39A 2VZVA 3RYKA 3BTXA 3PVBB 3NJYA 4JQRA 5LW9A 4FOVA 3NJZA 2WKKA 1XC6A 4A7ZA 2RS53 3OY8A 3MW4A 1UY1A 4I3GA 4EWDA 4BB3A 2AGSA 2JKBA 1N3OA 2CY6A 4AG4A 2VUDA 2XDVA 2WQ4A 2GC2A 5E8AA 2FZ2A 3VDDC 2VXJA 1PGW1 3TAYA 5ABJA 1OH4A 2NLRA 2R072 3HNBM 4K8RB 3GCXA 4NRMA 2PLV2 4N7IA 1WCDJ 2D6NA 2MEV2 3MFCA 2CDPA 4WM8A 5I8TA 3WG4A 2RHPA 3BTZA 3O5SA 1MVEA 2DTWA 4K9SA 3RWKX 3T2PA 4META 4RR3C 4KL1A 4DUVA 1UQXA 1YEWA 1IGOA 2P1BA 2UWBA 4XPVA 1ND3C 5EJ3A 1OLQA 3ZFGA 2JDYA 2WLQA 1OA3A 4RQPC 1DIWA 1IZ3A 1QDCA 1Q8QA 4QPYA 5GLUA 4D69A 4AAPA 2W0XA 3PUQA 1JZ8A 4CXXA 3ZSKA 2YUEA 5FPLA 4ES9A 1GBGA 5SV5A 2DFBA 3ZO0B 5LATA 2WSUA 2DVGA 3V0AB 3ZXJA 4HG6B 2WS91 3VHPA 4IGOA 1V9U3 1TMF2 1C5IA 2VMIA 4YM3A 1W06A 1WD4A 1UOJA 2JDUA 3NNMA 2WBKA 5DZGA 4XFGA 4RN5A 3I59B 4LQRA 4Q4W3 5DUWA 3V56A 1UIJA 5A3NA 5BNPB 1QJFA 2WQ8A 3CNAA 4RGGA 4UAPA 5I0UA 3VB9A 4YVWC 2VR4A 2ZX2A 1G86A 4XQWA 5A3UA 4QPIC 5AC91 3A22A 4FOWA 4AQ6A 5JXIA 3SNMA 3G7DA 1DGLA 4JGYB 3ZX7A 2DDUA 5LY2A 3ZIWA 2XLFA 3HPNA 1CVNA 2ZHKA 1AR71 2E53A 3OGJA 3LFIA 4K3UA 1OVSA 1DYKA 2IXIA 3E5QA 5FMCA 1RUG2 2OT7A 5FYHA 4K1ZA 2ZOEB 5LASA 4JKMA 4KGGA 3PU3A 1H2MA 4OUMA 5AFBA 2DUPA 3FE5A 3MBWA 5D2AA 2O8QA 2WO3A 4M3CE 3CJIA 4RQPB 4YZ1A 3IB3A 4AVBA 1OXCA 3AYAA 2YZ4A 2FCTA 1O4TA 3E6BA 3U14A 3HAGA 4PIZA 1BK0A 4ZPIA 3AZWA 3GZEA 5JUVA 5A7PA 4AFDA 3P3PA 3WQBA 1H30A 1JS9A 2WNVA 3I2DA 2QQPA 4NJ4A 1WMFA 3N9QA 5CFDB 2BGCA 4XDOA 3I2KA 4PIYA 1QNYA 1UYYA 1VMJA 2ZA9A 2E51A 3FN9A 3NV3A 4NVPA 5FMOS 4NHKA 4AYUA 1T6BX 1ZZCA 5FTTC 3SH5A 1W6NA 2PHDA 2R063 1RITA 2WWSA 2ZGKA 1ZZBA 1ZZ6A 3KV6A 1TEIA 3WG2A 4JDNA 5ERLA 1S0JA 4JTNA 3ZLIA 1UCXA 1PK6A 5C4WC 1HJGA 2JDPA 5A7WB 3H50A 4LBQB 2HWC1 5T5PA 1J59A 1DZRA 1WLDA 1A3KA 1NQJA 3BI3A 2RS51 3WNMA 3K3NA 4IERA 3J4UH 4CU8A 4K1YA 4JHZA 3H8OA 5HPOA 3GBWA 1A6CA 3AJYA 1YJKA 1WMXA 2HWD2 4HMZA 2DU0A 1LU1A 4PCRA 4XCAA 4BQWA 4YARA 5F7UA 3T09A 4B7KA 2JE7A 3ZSJA 1PK6C 5FJKA 3ZSLA 5A1LA 1W8WA 3VLBB 1GFF2 3HT2A 3BVCA 1NKGA 3DKQA 4AHWA 3ECQA 5FMBA 4AVSA 1MS1A 2VJXA 2ZX1A 1CJPA 1JXNA 1VALA 4IGQA 3AYCA 1AXZA 2Q30A 2YHJA 4XBQA 2XJTA 5CYYA 2BFUL 3HN3A 3WXPA 4FSJA 5G04L 1RXFA 3NSTA 2AC1A 5J36A 1W8OA 2WT2A 4I30A 2VVFA 1MR5A 4LBKA 1FXZA 2MEV3 1CESA 2VVEA 3DPRB 2HJIA 2ARBA 3I8TA 2CHHA 3GALA 2DV9A 4HSJA 3Q8AA 4QX0A 1LOCA 1JU4A 2FDJA 4N7UA 1VBB3 2WAOA 3LIGA 4PDWA 4PJYA 3UETA 3VBRB 3VZLA 4CEYB 4XQ4A 1I5PA 4FFIA 5IK5A 2E7TA 5CKNA 5LA9A 5E6HA 2BYVE 4BHPA 1QQP1 1DHKB 2E9QA 3AKQA 2C9AA 4E2SA 3I49A 1CAVB 3VBOB 5J98B 3RVHA 2VNVA 1FPN2 2ZX0A 2JG9A 5JPNB 3IIIA 4AEDC 3ZVXA 1R093 1HW5A 2RM23 4EJRA 5FY4A 1X7NA 4UFKA 4MUVA 4LOSA 1R1A1 2PXJA 3MIEA 1NLRA 1POV0 2NM1A 1UY2A 2P3IA 1DFQA 3DV8A 4O7XA 3DF0A 2R1BA 4TN7A 1H1MA 5I0TA 1RUE3 1YFXA 1NLSA 1H9WA 1XE0A 4QWNA 3R4DB 5FZGA 2WN2A 2XJVA 5EQUA 2XKPA 2FBEA 2OZJA 4OI4A 4TYSA 4P9GA 3FJSA 4ZKTB 2GMMA 3G6JB 4HXCA 1PMHX 2DURA 3ZXAC 4QPGA 3CU7A 5T5JA 3Q8FA 5BNNB 1BEV2 2EIDA 3CKHA 4FFFA 4LO8A 4M4PA 4Y3OA 4BISA 4CPBA 4CEYC 4QGMA 2W46A 4LKSA 4JDOA 1LGCA 4LBQD 4Y33A 5F5QA 1N3QA 2OPWA 2D6MA 3EHKA 5CKMA 4AAXA 2JECA 2JENA 4TLGA 3KT7A 2YFZA 4W4ZA 4WVVA 2VM9A 2PHLA 2VZ3A 4DEQA 2XWBB 1CPNA 1J3PA 3J26N 4P5YA 5JR7B 5I8YA 1HXS2 4L0PA 3MDPA 2A71A 2XR4A 1DLLA 4Y22A 3IDAA 5JOYA 1M4WA 1VBC3 2VBDA 5LY1A 2XVLA 1SBEA 2CGOA 3POFA 5IK4A 3WCSA 2J1RA 1FOD3 2XGXA 4OUSA 3ZFGB 4GB32 5K4LA 4ATFA 5J48A 1S0GA 3KVAA 4CRQA 5DPNA 2UWAA 1VRBA 3BALA 4K7JA 3VBOA 2R49A 2BDRA 2K9ZA 1JYVA 3PVEA 4WM8B 3IMMA 3KV4A 1N1VA 3OPZA 4UWDA 3WDVA 1BBT2 2VMEA 2ENRA 5LBFA 2CDOA 3I54A 2VOTA 1QIQA 1U5YA 4DB5A 5JI9A 5J37A 3BKZA 3BPZA 1G6NA 4LULA 4AL9A 4XUTA 1VRH1 5FZ9A 5FXWA 5CAZA 2O0OA 3EMRA 2Q8OA 1LESA 4BA6A 4LK7A 3FZ3A 3WP4A 3X29B 1W8UA 5F2SA 2VQ0A 2WZEA 2ORZA 2RS31 1V9U2 1OC1A 2OVUA 1YQ8A 5JZGB 1AXKA 5JDBA 3JQWA 1X9TA 1UMZA 2YDEA 1C8NA 3PIGA 4GXLA 1RGSA 5JVVA 1AYN2 2LW8A 3R6SA 4AI0A 3CO2A 4YM0A 4FT8A 5F9TA 2VZQA 4E2GA 4TXWA 2CWSA 4NIDA 2EXHA 2FDKA 4Q4Y3 2CU5A 3EBRA 3AKRA 4PI0A 2WZPP 3B9CA 3POSA 1AVBA 4XZPA 4AVAA 5FPUA 3RRDA 1CQ9A 1PVC3 4CCJA 3RPQA 3N7JA 5IYYA 3FFQA 3ON7A 5FZCA 5C5TA 1W8TA 4QPGC 4Z92B 4MLOA 1QWRA 5C3SA 5DAVA 3CDZB 5F3IA 3LZZA 5HI0A 3QCWA 2PLV3 4IV3B 4WM8C 1X9PA 1GICA 1W3VA 4YGEA 4D8MA 2PA7A 5FQ0B 5GJ6A 4ZU7A 2JE8A 2P37A 4ITCA 1PMJX 4X8PA 2AACA 2WO7A 4OZOA 1YC61 1L7QA 1GYKA 4XBLA 4AI2A 1DDLA 3THPA 3LWCA 4Q2FA 4QQHA 2X05A 2FDIA 4GKYA 1UYPA 1RUH1 2BWCA 4UXAA 1X8EA 2B5HA 1OA2A 2VTFA 2YB7A 4N43B 1G9AA 3PJQA 4BU2A 5FZOB 5IJRA 1S4CA 3TYJA 5FOJB 1W3XA 1QDOA 1UPIA 2C6SA 1X8MA 1PNGA 4QX7A 2JWPA 2OQ7A 1OOPB 4CEWB 1DCSA 1AYN3 2LALA 5M0TA 5FMOL 3WD5A 1LNSA 2R1DA 4Q4Y1 5B2GB 3EYPA 4PDWC 4XFBA 5DUXA 3MV11 4K8FA 5FY5A 1LEDA 4P9XA 4CDXB 2H6BA 4WZCA 2VW2A 1PZ9A 3UKTA 5L36A 3N3HA 2UYAA 1JUHA 2ILMA 2IVJA 4LHKA 1HV1A 5BNPC 4HVRA 4N8MA 3MUY1 3PVNA 3V0BB 3RI9A 4V1PA 5KXEA 3H1YA 5IVVA 1CR7A 1XNCA 1RVF1 1C28A 4N90A 4B8EA 2BGOA 3VBUC 5C6CA 4CDXC 2ZABA 3ZXGA 2ZZJA 5FZHA 3PLQA 4IE6A 2BOJA 2WNEA 1EAH2 2VCBA 4YGBA 2QTWB 1GZCA 1JYIA 5G05L 4PDWB 5JXGA 3HOBA 4XW3A 5FQ0A 4N9HA 3R0RA 2NN8A 2WFPA 5FRAA 4MHUA 5EV7A 4KWKA 4IXLA 4C8DA 4CE8A 2HWB3 5A1AA 1ULOA 4CCNA 2GC0A 1DZQA 3AKSA 3DL3A 5FO7B 4B7EA 4P02B 3HQRA 2C26A 4A44A 2BERA 4CP1A 2V73A 2VH9A 3H7JA 2GC3A 5EZWA 4BK5A 3D0SA 3EXUA 4JRAA 5H9RA 4TLFA 4W65A 4XC9A 1AJKA 2BP6A 3WW4A 4XTPA 4S2DA 5L19A 1UWWA 1OUXA 2XLGA 1XU2A 1LULA 3PVOA 4AQTA 1B35A 1QJZA 1VBC1 2B8MA 3GJAA 4FXGB 2GMEA 5A32A 2BZDA 3QH6A 2BTVC 4W8JA 5FPAA 1GQGA 1KRIA 1J1LA 1GU3A 1EAH1 2QKDA 3NQHA 3PU8A 4GH4B 4BQ4A 2V4VA 4FPEA 1SZBA 1AYM2 4QPWA 3TNPB 4A6OA 2RMU3 5JI7A 4GWNA 1YLLA 2OXBA 3J9SA 1RYYA 1WA4A 4BCUA 4AQSA 5FWEA 1UAIA 4U36A 2OYZA 2VPVA 4KG8A 2JKXA 1MS3A 4Z1VA 1H2KA 2P3KA 3OOXA 1FV3A 3OTFA 2OPKA 1HB1A 1CZVA 2RDSA 3FBMA 4WM7A 1R082 1SFNA 1XQNA 4OQ9A 1H1IA 3PUHA 3RZZA 2D6LX 1K12A 4XUOA 2BVVA 4CDWB 4Z07A 1CAWB 5FOBB 4RGAA 4IDZA 2IXLA 2CGNA 1UMIA 2B46X 2WR9A 3ZM8A 5FY7A 5D8AC 1QEXA 1R1ZA 1GMMA 3I3BA 4LBLA 2WLPA 3GXUA 5FPVA 3BODA 4EZHA 4N43A 3W59A 5JIAA 1HKDA 1NCRC 1U12A 1ZX5A 3PJYA 4FQZA 5IVFA 1VMHA 1S2KA 2ZHNA 3VKOA 1ULFA 4D94A 1Q8PA 3VBSA 4AEDA 3MFAA 4XIKA 3NAPB 3RYPA 1US2A 5KHKA 5KR7A 4U2AA 3CL1A 1OF4A 3CEWA 4Y20B 5ANNA 1XBFA 4O65A 4GH4C 5JR2A 2ES3A 4NAMA 3WDUA 2X09A 5HCBA 1HB4A 2QQMA 4YNIA 3KMHA 4E4SA 4MV2A 4YZ2A 1RUI2 2VY0A 1ZRFA 2Y6KA 3F95A 4AR2A 4D7SA 4QHOA 1U0AA 4XF1A 5F5AA 1FATA 4FBFA 5C8CB 3WVJA 1FMD3 4YYOA 4COZA 4QXCA 1AUYA 2VZ1A 3S57A 2ORXA 4Q4Y2 5L73A 4AF9A 4W6WA 3W20A 4COYA 5FJHA 2WIIB 1ODMA 1IKQA 3GF6A 1G8WA 4Q0QA 4XOGA 4LO7A 1G9FA 1W8FA 3LEGA 2VL4A 2RS11 3LDRA 5A6QA 2HWD3 1H4HA 3E5UA 4JDMA 4L11A 4NN0A 5SV8A 2Y6LA 3AJZA 2QQIA 2UY9A 1SDDB 2R043 2VZPA 1O3TA 4HK8A 5DN2A 2PAMA 3KHCA 1UL9A 2A6ZA 1V6NA 4M0NA 1J84A 3ME2A 1KDMA 1AL0G 2FQPA 2B39A 4C1XA 1XE8A 1XU1A 4BMBA 2R071 5CFCC 4QKFA 2VXRA 2ZAHA 2Y0OA 2IXJA 3HNMA 4QD2A 1BMV2 1GOFA 4YZ5A 1LHUA 2YROA 3K4ZA 5EXOA 4XVHA 4UW5A 3SH4A 1F4HA 1AL22 1VBE2 4IGPA 4COUA 1HN1A 4OQ8A 3VKFC 3U37A 4PT6A 3Q8EA 2WA3A 3POBA 1CX4A 4SBVA 1QQP3 4HL0A 4QAWA 4D3WA 4BJ0A 3RDIA 1FOD2 4KWUA 1HDKA 1Y9QA 4KU8A 3TB0A 3VBUA 3ZSEA 4B3NA 3BU7A 1WA6X 4DXRA 2RS12 2DTYA 1VBC2 1HLCA 1ZNPA 4ZS3A 3VKMA 3ZDVA 4GWJA 2XXZA 1J83A 4LIVA 1W2AX 1RUOA 4ASKA 5IAXA 5DZEA 3OD0A 1MACA 4X8NA 3WF4A 4HFSA 3MPPG 3U1XA 4D6RA 5LCWL 5HXMA 3A23A 1SLTA 2J1SA 4GMP0 3LCPA 1OMIA 4XIOA 2D6OX 2F4LA 2EAAA 3NNFA 5JMCA 5CFCA 1TME1 5BNOC 3HQXA 3AZYA 3SKJE 4J25A 1VJ2A 3ILRA 1QNWA 3NMBA 4PQ9A 1MZEA 1O4ZA 1VAMA 3PURA 2JEMA 1NX9A 3VZOA 4MGZE 2IVIB 4D6QA 2WYSA 4E27A 1W2UA 5JXJA 2JICA 4ATEA 4YW4A 1QXJA 1YQ5A 5FKCA 2XJRA 4C1WA 2N7GA 4MGKE 1NA1A 4CPBD 1TMF3 2IC1A 2Y0IA 1UPSA 5GLZA 2KR2A 2YBSA 3OBRA 1CAUA 4YZ3A 3WP6A 1C5HA 2XJPA 2JB4A 5JOXA 2XUEA 4L8QA 4G4FA 1H1AA 1FX5A 1GNHA 1OKQA 1W6PA 2GNMA 1SLBA 4FPCA 2O14A 2WO2A 4EN8B 1IPJA 3H1WA 2KXLA 4Q4X3 5GLWA 5C4WB 1O3QA 3E6CC 4EE2A 3M4FA 1CAUB 2J42A 2RM22 3OBZA 2TNFA 3Q8BA 1NAEA 1U5XA 4PI2A 5D21A 3FUQA 4FTEA 4AI1A 1SDWA 4CP9B 5A6YA 2ZMNA 3WF1A 2Z5WA 1FV2A 2VZUA 2VW0A 2X5IC 3VBHB 4F3JA 1WW5A 1W99A 2ZGPA 4F83A 1OPOA 4QKNA 5FZ0A 4XYXA 4E8CA 2VOVA 3MUZ1 2VMDA 3ZKYA 1ASJ2 1X82A 3T2OA 5CISA 5FPXA 4IV3A 2HWE3 3UGFA 2RS52 4GH4A 4XJ8A 4AVCA 2OUJA 2JDMA 4HN1A 4XETA 4LKFA 2GN7A 4A42A 2QVSB 2YV8A 5BNNC 2HKXA 2Q1ZB 3TWIA 2RJLA 1C8M1 4AK3A 3VD4A 1YI7A 3JZVA 4MADA 1J1TA 1OI6A 1OLMA 4R9CA 3N35A 3P1IA 4XFAA 4YFZA 4Z82A 4Z2AA 3SC7X 3KV9A 4Q0PA 1O8PA 4UI9L 1BBT1 1BZWA 1SEFA 2VZRA 4FP2A 1I5ZA 1DU3D 3ES4A 3K3OA 4Y1XA 4YW3A 3VBUB 4QXKA 1I6XA 2LM3A 1CGPA 3B01A 3H3UA 4QX8A 1PGSA 3MLLA 4JTOA 3ZXKA 2AEYA 1VBE3 4Q0VA 5A3OA 4A2UA 1AHSA 4DXTA 1SG3A 3KCYA 1R64A 4NO4A 1STMA 2DVDA 1W6OB 2AEZA 3C3VA 3L9JT 4C0HA 2RJKA 1C57A 1V9U1 2C1FA 1E5HA 1A78A 3KHBA 3KF5A 2ZKNA 1ONAA 3WW1A 1QMJA 1O3RA 1GOGA 3MW2A 1ZRDA 3FWEA 3K75B 1QU0A 3AL6A 3V0BA 3M3OA 5GALA 1DQ2A 1COV3 1H0BA 3ZFFB 2WSVA 2J1UA 3I3DA 5DAXA 4Q27A 4HSLA 3J7LA 2F4PA 2QQUA 2EIEA 3VL9A 2V72A 1WCSA 3I97A 4AHYA 2GAUA 2XVKA 1OSGA 3KQ4B 1ASJ1 3VDDB 2X53S 4NIGA 4FPLA 1BQPA 4CDQB 4Y22B 2J1AA 3AKTA 4QX2A 4CXWA 2BNOA 2JG8A 3GBGA 4CU7A 1RJ7A 1FMD2 4R9BA 3J8F1 5LBBA 2VQUA 4UFIA 4CCLA 5LA2A 3GGLA 1D2SA 1BYHA 3PHMA 4CSWA 3S30A 1MVQA 2OW4A 2W52A 4FO9A 2G9ZA 1LGBA 3HIFA 2QJVA 4H3WA 5IVBA 1QJX2 4XFCA 2R7EB 2RM21 4QHZA 1GV9A 1MZ6A 2R0FA 4NPLA 1NQDA 1MS0A 2QQLA 1ASJ3 2W1SA 2HWF2 1PM7A 3R4UA 3ZDSA 4UOJA 4QPGB 3ZPYA 1UXXX 1YJLA 4YG6A 3AP6A 3TRSB 3USUB 1PNFA 5CKQA 1IHMA 1UX7A 4H14A 2B7YA 4CDWC 1ZZ8A 5K8SA 1TE1B 3I2HA 4RD7A 2OUHA 2UU8A 1UW8A 2D6KA 1Z7S3 1F9KA 3WLUA 4EWEA 1ZBA1 1IQDC 1S0IA 5GZFA 1Y4WA 1ST8A 4I0BA 5DUVA 1XXNA 3MICA 1S1AA 3FL7A 1NY71 4EQVA 3TN92 2VCMA 2FCVA 2Q4SA 1GNZA 1D4M1 2WAAA 4PF5A 5F1RA 1QH6A 4YVSB 2W94A 1CZSA 2B45X 2OZ6A 1SPPB 2MPFA 4LXLA 5DABA 3EO6A 1VMFA 1AX0A 3VHNA 4YVWA 3SCHA 3RMYA 3ZYGA 3M1HA 3VZNA 4RL7A 1UZ0A 2P6HA 4B1LA 2XPJA 1JTZX 1PO12 4JAAA 4WZFA 4P5HA 1MQTC 5IW0A 5GM0A 3UL2A 3OUJA 1WW4A 4CUGA 5DDJ3 4M3CF 5FZLA 3B3QE 4AFBA 2R073 1K5MC 1AYM3 4IE7A 4AFCA 3LDKA 3N9NA 5LZ6A 1FOD1 3ZYPA 3VBFB 3O1OA 2WC2A 2ZMKA 1H9PA 3MI8A 4BQ2A 3IM0A 4NRPA 4BLJA 3MIDA 3FUOA 4B29A 2VUAA 1QXPA 3UJOA 5HBAA 4YVWB 1S0BA 2BBAA 4I02A 2IZWA 3K48A 3ZFFA 2YPDA 1JZ2A 1RC6A 2WFF1 4JRLA 3WT3A 2PLV1 4BM8A 4Q8KA 3WSOA 3WQ0A 5I91A 3D6EA 2J22A 4BQYA 2ZGNA 1RJ8A 2WNUC 4UFJA 1PM4A 4MXWB 5KWRA 3GCWA 3H7YA 3QOPA 4Q4V2 1LB2A 4EYUA 4HKLA 2X10A 1ZRRA 2GNBA 2ZMLA 4MYEA 4B4PA 1AL23 2ZPXA 4BMEA 3T1MA 3U78A 2ZHMA 4RHV2 5IT6A 5IVJA 2BVBA 5KHIA 4ZZ8A 3ZN4A 1ZA4A 3FHAA 4FPJA 5EFUA 4BDVB 4KNCA 2YPJA 1DQ6A 2VVDA 3MIFA 1LR5A 2VG9A 2VO5A 4GB31 5IVYA 3T0AA 2DCJA 1PO23 1NUKA 3CIHA 4KH9A 3ACGA 4NWWA 4XFIA 4I2OA 3I2JA 4JX0A 3H8UA 3P3NA 3DXUA 3NNLA 4QU1A 1O91A 1WBLA 4RHV3 3T4HB 2F17A 5GZDA 4HETA 2GP5A 1H8VA 4HK9A 4E8DA 1L7LA 4Q1RA 3OEAA 1HRI2 3DKWA 5E88A 3H8RA 4Q4V3 4AI8A 2ZCWA 3ITQA 4EV0A 3UNPA 4E2QA 4JCKA 1OQ1A 1YHFA 4Q8LA 2Y6FA 1JOPA 5C3OA 1YFYA 4Y5Z0 2RR13 4S2HA 5LEJA 1I3HA 1LOFC 2HWB1 3IDEA 3POWA 2Q5TA 3JUUA 3VKLA 4FP3A 4RHV1 3VZKA 3LA2A 4HT1T 1NLQA 3HMYA 3C7EA 3QACA 3RJ2X 2R6QA 2UYBA 5FYBA 1IG0A 3J7MA 1Y9GA 4Y1VA 3W9AA 1GNYA 3AZZA 2GNDA 4R52A 4XQDA 5L9RA 1RUJ2 3QBQA 4CEYA 5T3NA 4NPMA 3H42B 5A6ZA 3LEIA 4B4RA 4TZDA 4EZ4A 1OVPA 3GDBA 5KHHA 5JIUA 5DDJ2 4QT6A 1K5JA 3VN4A 3DPRC 4CYDA 2HWE1 3RMXA 5KC6A 2E32A 3FHQA 2D93A 1OD5A 3H3LA 5FR3A 2Y6HA 2PAKA 2ZEYA 4ZY9A 3U07A 4A45A 1PVC2 5AFEA 5I8SA 4IEWA 2Y38A 5A7NA 3WNXA 1ND2B 3NWKA 4I3PA 1QHDA 2DCZA 2B4KA 2GSYA 4K20A 2PHFA 1SCRA 3WCRA 1B35B 1W9YA 4ISRA 1RUD1 1SHWB 5BY5A 5A3LA 1RUC2 3WDTA 2W39A 2WRAA 3NL1A 1QY4A 3U10A 2EXIA 5TSWA 3TN93 5FFOC 1ZBE2 4JQTA 5J09A 1RMU3 1RMU2 5FZDA 3H3ZA 3OGVA 4N9IA 2VMCA 1ZBE1 1NCRB 1PHMA 3C7GA 3PMSA 5FYSA 5L9BA 4PBPA 4L9BA 4AXOA 4AEJA 4NWVA 4XF9A 3HD8B 2YMZA 1CWPA 3LA7A 5F39A 5FMDA 4COWA 4NRQA 3KB5A 1UMHA 4DRRA 3HVDA 4HONA 1K42A 1ZZ9A 4WBBA 1KDKA 5KBFA 4LE3A 3FC0A 3WHUA 2W9XA 4BK4A 3LPFA 1R091 3LD8A 2NQYA 1K3IA 1V6OA 1WW6A 1BBT3 1W6MA 4HN0A 4A4AA 3OGGA 1IS3A 4X6RB 1BKZA 2ARXA 2P3JA 1IS5A 1QJX3 2P34A 3IDBB 4MH0E 3M7AA 1RUJ3 2OQ6A 4QHBA 2ZGQA 5FYZA 4IEXA 1LHOA 5C3PA 2AREA 1PO21 2YC0A 5GZCA 2RV9A 4GB33 4Y4RA 3VZMA 1N1TA 1DQ1A 2XONA 2IFWA 4LUMA 2DYCA 3N9PA 4XURA 4DZGA 1D4M2 2W91A 3IPVA 1E5SA 3ETPA 4PLOA 1QXRA 4J1XA 4QKDA 4OFGA 4YG3A 1WCUA 4QM9A 3GZUC 2RR12 1QJX1 5FLIA 2LUWA 3AL5A 1NCQC 4AVTA 3UKVA 5T5OA 3QH7A 3PTRB 4W6YA 2VOKA 4Q5OA 3N7KA 4GULA 1HRI3 1QJU2 4N53A 1COV2 2E6VA 2VW1A 4Y24A 3PUSA 1BEV1 1O6UA 2PN5A 2QDNA 4FPKA 1VPHA 4LLOA 1VIWB 3UT0A 3RZLA 2Z4FA 4NPRA 3ZFEB 4D7YA 4WV8A 5CFCB 1DGWA 2F6BA 3RYRA 4Z8BA 5I0DA 3POGA 1JZ4A 4LUKA 5ANQA 1QKQA 3MF9A 4OMDA 4C91A 1SMVA 1YNAA 4MOAA 2A3XA 2XL9A 2GMPA 3KGZA 3OBAA 5EWSA 3M3QA 3ZFEC 4XF4A 1VP6A 3AX4A 2BNNA 2O1QA 2B42B 5BNQA 3MV01 3O1VA 1O8SA 5EPAA 5T52A 2ZX3A 4Q1PA 1UIKA 5A3WA 4YGDA 5F3GA 1GZWB 3SEEA 3EJKA 3C7FA 3ZR5A 3T0DA 1UF2C 2VBPA 1TNFA 2JG8C 4UW4A 4L97A 1DP0A 1GP4A 1MZFA 2WA4A 5FYCA 2ZEZA 1UU6A 4BLIA 5CEHA 1IQAA 1WLWA 3CJXA 2W68A 1UZVA 3NVCA 2XOMA 2DCTA 1W2NA 2WQZC 1MEC1 1OFNA 1C3HA 1RINA 1TNRA 1W9WA 1CAVA 4Y26A 2VAUA 5CB7A 3DCQA 3OYWB 2EF6A 4V2WA 3NV1A 1C4RA 1R081 2V4AA 1VRH2 1RUF2 4IEZA 5FK8A 5FZIA 1S0EA 3BB6A 5C8WA 5DUUA 1ULDA 2VNGA 1ZVFA 2CV6A 2IUWA 2ZX4A 4UF0B 3S6PA 4AFMA 3OY8B 2GC1A 3ALQA 4QB6A 2AZ5A 1UU4A 4R9AA 1VBA1 1RTVA 1JYTA 2V5YA 1Z7S1 1BVVA 1PO13 5JOZA 1LENA 1YUDA 1CN1A 1IG3A 1O5LA 4M0HA 4ZXKA 4EWAA 1YFWA 3CZJA 3POYA 1HX6A 1H8TA 2V5DA 4UBHA 2Y6GA 3ACIA 4Q4X2 2Z2SB 5IWFA 3B9IA 4CCKA 3JD72 4Y5SA 3GZTB 5C71A 1JZ7A 2HBTA 1JHJA 2CL2A 1VBD2 2D3RA 4R8HA 4AW7A 2PAEA 1KGYA 2XQRA 2JDKA 3O14A 1U5IA 4LKEA 3LE0A 3O1PA 3JBG3 1O3SA 1C8M2 1UYZA 3MLJA 1ENSA 2ZKLA 2W92A 5F6LB 1APNA 3THCA 3VV1A 4LA3A 1AR62 4OULA 1VBB1 4CDUA 4D7TA 4GMP1 5FZ4A 1PZ8A 2I74A 3CQOA 2WZR3 1AR82 1W2TA 3KF3A 5C3QA 2A6YA 5A7QA 3FX3A 2BPA2 2VCCA 5J3UA 3WF0A 1WUVA 4KBZA 1WD3A 1NZCA 4E4DX 2QQOA 1LHNA 3F2ZA 3A7QA 1COV1 4AWDA 1O4YA 2R062 1TG7A 3RWNA 4GIQA 2ADEA 4GWMA 5FYUA 4AHZA 3K51A 3NAPA 1P8JA 3WNOA 3RFRA
chains in the Genus database with same CATH topology
3VDCA 2WYSA 5JXJA 3VDBA 4JKMA 3MBWA 1K45A 4PF1A 2WO3A 4QB1A 3IB3A 2WO2A 2J1TA 5JUVA 1O59A 3ABZA 4QB2A 3WQBA 1JZ5A 1OD3A 1T2XA 3BGAA 5EJ1B 1NAEA 5JMOA 3I2KA 1XNAA 4IUGA 1UYYA 3FN9A 3WF1A 2VZUA 1W99A 3NJVA 4MO3M 4E8CA 3ACFA 3MUZ1 2VMDA 2W1WA 3I2IA 2VC9A 4PQQA 2DCKA 3T2OA 2YG0A 4DUWA 4QDRA 3WNMA 3W5MA 1H6XA 4A42A 2W95A 4CU8A 3OGSA 4JHZA 4P00B 1KEXA 4DXSA 5HPOA 2W5FA 3VD4A 2J1EA 4MADA 3P1IA 4Z2AA 1MPXA 5F7UA 3P6BA 4GZ9A 3T09A 4ET7A 4UI9L 1O8PA 1NKGA 3ECQA 2VZRA 2VJXA 1W9TA 1H6YA 5CYYA 3HN3A 5G04L 4DXTA 3THDA 1SG3A 1R64A 2RVAA 1W8OA 5EIYB 3VD5A 1DYOA 1WCQA 4QX0A 3EB7A 1JU4A 2WAOA 3UETA 1I5PA 2E31A 3NRUA 1GOGA 1DLCA 2L9LA 3K75B 4JKKA 2W87A 2EICA 1WKYA 2ZXQA 2J1UA 3I3DA 3CMGA 2Y64A 2C4XA 2J1VA 2EIEA 3IIIA 2V72A 3I97A 5LA0A 1JZ3A 2J1AA 4QX2A 1UY2A 3PUIA 2VZTA 4CU7A 3W5NA 2VQUA 5B4NA 5LA2A 3GGLA 3DYOA 2ZEWA 2WN2A 4XUPA 2R7EB 1UYXA 1PMHX 2QQLA 2W1SA 4XUNA 3K4AA 4QX3A 3SKVA 4M4RA 4MGQA 4UOJA 2EIDA 3CKHA 4M4PA 1UXXX 2HYXA 2WZ8A 1OF3A 2W46A 4LKSA 4CVUA 1UX7A 4AAXA 3HEIA 4W50A 3NNGA 4W4ZA 2J7MA 2YFZA 3I2HA 5C70A 2VM9A 2VZ3A 4DEQA 4P5YA 1IQDC 2RJ2A 4L0PA 3LEKA 1US3A 1JYWA 3FL7A 3IDAA 3K77A 2WAAA 2J1RA 2W94A 1CZSA 2QQKA 3WEZA 4A41A 3C7HA 5DPNA 1JZ6A 1UZ0A 5EJZB 1JYVA 1BHGA 1GUIA 2VMEA 2JD9A 4GWIA 4CUBA 2CDOA 2QQNA 2VOTA 3K4DA 3WNPA 1OT5A 4XUTA 3A21A 2Y6JA 2YC2A 2WZEA 2BBAA 2ORZA 1JZ2A 1UXZA 1CX1A 3OEBA 4BXSV 3WSOA 2LW8A 2J22A 2VZQA 4ARYA 4TXWA 2W47A 2VCAA 2VZSA 4LHSA 4KI5M 2X10A 4ZZ5A 4TTGA 5IYYA 1NX9A 1UY3A 4ZZ8A 3FHAA 4MGSA 2VZOA 3CDZB 4BDVB 3DYPA 1CZTA 2VO5A 3T0AA 2DCJA 3LPGA 1NUKA 3CIHA 4D8MA 3ACGA 2JE8A 3I2JA 1PMJX 4P08A 4JX0A 4OZOA 2BGPA 4D0QA 1L7QA 5FUIA 2X05A 1EUUA 3C7OA 3T2QA 2VTFA 2YB7A 2XHNA 4E8DA 2VMFA 5IJRA 3OEAA 3UNPA 3WNLA 2LS6A 3LQCA 1W8NA 1F4AA 2ZEXA 4OYUA 3I2GA 5B4XA 1LNSA 2WUHA 3EYPA 3NJXA 3K46A 3MV11 4LPLA 2WDBA 3VD9A 2XQXA 3WF2A 5IFTA 3C7EA 3MUY1 2BGOA 5IHRA 1GNYA 5IFPA 1PX4A 2VCBA 3LEIA 3BN6A 3GDBA 1XNTA 2PQSA 5CZKA 5G05L 3HOBA 5JXGA 2E32A 3FHQA 5LA1A 4XZUG 2Y6HA 2ZEYA 1TVGA 4ZY9A 3D3AA 4A45A 4DEVA 5A1AA 1EUTA 1ULOA 2YFUA 5DQ0A 4P02B 2B4KA 2C26A 4A44A 2BERA 3E1F1 3WNNA 4BK5A 1SHWB 4QDQA 2Y8KA 3OB8A 1UWWA 3OGVA 2WN3A 2VMCA 3C7GA 4JKLA 4OUEA 1XPWA 3WF3A 4XUQA 1GQPA 3HJRA 2BZDA 3VDAA 1D7PM 4QDSA 4W8JA 1K42A 1UMHA 1GOHA 1GU3A 2YC4A 3NQHA 4KMQA 5J1XA 2V4VA 1UY4A 2VQTA 3OGRA 4QPWA 2W9XA 4ZXEA 4A6OA 4BK4A 3LPFA 1K3IA 1RYYA 4A4AA 4YPJA 3HNYM 4OMCA 2JKXA 5C7GA 1CIYA 3GM8A 3J7HA 2RV9A 1CZVA 4XURA 2XONA 2B9VA 2W91A 3PUHA 1K12A 4XUOA 1PX3A 3ETPA 1W0NA 3MO4A 1W9SA 4FI9A 3IAQA 4CUCA 1UMIA 3ZM8A 5JXHA 2JDAA 2E26A 3VD3A 1GMMA 3I3BA 3AC0A 3GXUA 3ACHA 4RYDA 1ULPA 2HLEA 5DMYA 3T08A 2W3JA 3JXSA 1US2A 1OF4A 2Z4FA 3VD7A 5JR2A 5I0DA 3UESA 2X09A 1JZ4A 1JI6A 2QQMA 4OMDA 3WNKA 4MOAA 2E33A 4CU6A 3OBAA 1JU3A 2Y6KA 2EIBA 2OKXA 3DYMA 2W1UA 3MV01 4QX1A 4CUAA 1O8SA 2VZ1A 2ORXA 3OG2A 3CZUA 3SEEA 3C7FA 3T0DA 3I3EA 2W1QA 2C9KA 3LEGA 4DUXA 2VL4A 1DP0A 2ZEZA 2KD7A 2XOMA 2Y6LA 3C8XA 2QQIA 2VZPA 1SDDB 1W9WA 1UY0A 2VZVA 5DN2A 4CU9A 2WO1A 3I2FA 3IAPA 1XC6A 1UY1A 1J84A 4AG4A 1YQ2A 1OH4A 3HNBM 1JYNA 3HNMA 2CDPA 4QB6A 1GOFA 3K4ZA 4XVHA 1F4HA 3T2PA 4DUVA 1HN1A 3U37A 4PT6A 3CZJA 2V5DA 2Y6GA 3ACIA 4QAWA 4BJ0A 4KWUA 1JZ8A 5C71A 1JZ7A 1JHJA 4A3ZA 4DXRA 1KGYA 4GWJA 3LE0A 1J83A 4HG6B 1JYXA 1UYZA 3THCA 2W92A 3WF4A 4ARXA 2WBKA 5LCWL 4RN5A 3CQOA 5HXMA 4LQRA 3A23A 2J1SA 2WABA 3T0BA 4UAPA 2WQ8A 2QQJA 2VCCA 3WF0A 2VR4A 3SEPA 2QQOA 3F2ZA 3A22A 3A7QA 5JXIA 3SKJE 1TG7A 2QBXA 2DDUA 1L7RA 1P8JA 3DECA 3WNOA 3HPNA 2ID4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDC A;  2WYS A;  5JXJ A;  3VDB A;  4JKM A;  3MBW A;  1K45 A;  4PF1 A;  2WO3 A;  4QB1 A;  3IB3 A;  2WO2 A;  2J1T A;  5JUV A;  1O59 A;  3ABZ A;  4QB2 A;  3WQB A;  1JZ5 A;  1OD3 A;  1T2X A;  3BGA A;  5EJ1 B;  1NAE A;  5JMO A;  3I2K A;  1XNA A;  4IUG A;  1UYY A;  3FN9 A;  3WF1 A;  2VZU A;  1W99 A;  3NJV A;  4MO3 M;  4E8C A;  3ACF A;  3MUZ 1;  2VMD A;  2W1W A;  3I2I A;  2VC9 A;  4PQQ A;  2DCK A;  3T2O A;  2YG0 A;  4DUW A;  4QDR A;  3WNM A;  3W5M A;  1H6X A;  4A42 A;  2W95 A;  4CU8 A;  3OGS A;  4JHZ A;  4P00 B;  1KEX A;  4DXS A;  5HPO A;  2W5F A;  3VD4 A;  2J1E A;  4MAD A;  3P1I A;  4Z2A A;  1MPX A;  5F7U A;  3P6B A;  4GZ9 A;  3T09 A;  4ET7 A;  4UI9 L;  1O8P A;  1NKG A;  3ECQ A;  2VZR A;  2VJX A;  1W9T A;  1H6Y A;  5CYY A;  3HN3 A;  5G04 L;  4DXT A;  3THD A;  1SG3 A;  1R64 A;  2RVA A;  1W8O A;  5EIY B;  3VD5 A;  1DYO A;  1WCQ A;  4QX0 A;  3EB7 A;  1JU4 A;  2WAO A;  3UET A;  1I5P A;  2E31 A;  3NRU A;  1GOG A;  1DLC A;  2L9L A;  3K75 B;  4JKK A;  2W87 A;  2EIC A;  1WKY A;  2ZXQ A;  2J1U A;  3I3D A;  3CMG A;  2Y64 A;  2C4X A;  2J1V A;  2EIE A;  3III A;  2V72 A;  3I97 A;  5LA0 A;  1JZ3 A;  2J1A A;  4QX2 A;  1UY2 A;  3PUI A;  2VZT A;  4CU7 A;  3W5N A;  2VQU A;  5B4N A;  5LA2 A;  3GGL A;  3DYO A;  2ZEW A;  2WN2 A;  4XUP A;  2R7E B;  1UYX A;  1PMH X;  2QQL A;  2W1S A;  4XUN A;  3K4A A;  4QX3 A;  3SKV A;  4M4R A;  4MGQ A;  4UOJ A;  2EID A;  3CKH A;  4M4P A;  1UXX X;  2HYX A;  2WZ8 A;  1OF3 A;  2W46 A;  4LKS A;  4CVU A;  1UX7 A;  4AAX A;  3HEI A;  4W50 A;  3NNG A;  4W4Z A;  2J7M A;  2YFZ A;  3I2H A;  5C70 A;  2VM9 A;  2VZ3 A;  4DEQ A;  4P5Y A;  1IQD C;  2RJ2 A;  4L0P A;  3LEK A;  1US3 A;  1JYW A;  3FL7 A;  3IDA A;  3K77 A;  2WAA A;  2J1R A;  2W94 A;  1CZS A;  2QQK A;  3WEZ A;  4A41 A;  3C7H A;  5DPN A;  1JZ6 A;  1UZ0 A;  5EJZ B;  1JYV A;  1BHG A;  1GUI A;  2VME A;  2JD9 A;  4GWI A;  4CUB A;  2CDO A;  2QQN A;  2VOT A;  3K4D A;  3WNP A;  1OT5 A;  4XUT A;  3A21 A;  2Y6J A;  2YC2 A;  2WZE A;  2BBA A;  2ORZ A;  1JZ2 A;  1UXZ A;  1CX1 A;  3OEB A;  4BXS V;  3WSO A;  2LW8 A;  2J22 A;  2VZQ A;  4ARY A;  4TXW A;  2W47 A;  2VCA A;  2VZS A;  4LHS A;  4KI5 M;  2X10 A;  4ZZ5 A;  4TTG A;  5IYY A;  1NX9 A;  1UY3 A;  4ZZ8 A;  3FHA A;  4MGS A;  2VZO A;  3CDZ B;  4BDV B;  3DYP A;  1CZT A;  2VO5 A;  3T0A A;  2DCJ A;  3LPG A;  1NUK A;  3CIH A;  4D8M A;  3ACG A;  2JE8 A;  3I2J A;  1PMJ X;  4P08 A;  4JX0 A;  4OZO A;  2BGP A;  4D0Q A;  1L7Q A;  5FUI A;  2X05 A;  1EUU A;  3C7O A;  3T2Q A;  2VTF A;  2YB7 A;  2XHN A;  4E8D A;  2VMF A;  5IJR A;  3OEA A;  3UNP A;  3WNL A;  2LS6 A;  3LQC A;  1W8N A;  1F4A A;  2ZEX A;  4OYU A;  3I2G A;  5B4X A;  1LNS A;  2WUH A;  3EYP A;  3NJX A;  3K46 A;  3MV1 1;  4LPL A;  2WDB A;  3VD9 A;  2XQX A;  3WF2 A;  5IFT A;  3C7E A;  3MUY 1;  2BGO A;  5IHR A;  1GNY A;  5IFP A;  1PX4 A;  2VCB A;  3LEI A;  3BN6 A;  3GDB A;  1XNT A;  2PQS A;  5CZK A;  5G05 L;  3HOB A;  5JXG A;  2E32 A;  3FHQ A;  5LA1 A;  4XZU G;  2Y6H A;  2ZEY A;  1TVG A;  4ZY9 A;  3D3A A;  4A45 A;  4DEV A;  5A1A A;  1EUT A;  1ULO A;  2YFU A;  5DQ0 A;  4P02 B;  2B4K A;  2C26 A;  4A44 A;  2BER A;  3E1F 1;  3WNN A;  4BK5 A;  1SHW B;  4QDQ A;  2Y8K A;  3OB8 A;  1UWW A;  3OGV A;  2WN3 A;  2VMC A;  3C7G A;  4JKL A;  4OUE A;  1XPW A;  3WF3 A;  4XUQ A;  1GQP A;  3HJR A;  2BZD A;  3VDA A;  1D7P M;  4QDS A;  4W8J A;  1K42 A;  1UMH A;  1GOH A;  1GU3 A;  2YC4 A;  3NQH A;  4KMQ A;  5J1X A;  2V4V A;  1UY4 A;  2VQT A;  3OGR A;  4QPW A;  2W9X A;  4ZXE A;  4A6O A;  4BK4 A;  3LPF A;  1K3I A;  1RYY A;  4A4A A;  4YPJ A;  3HNY M;  4OMC A;  2JKX A;  5C7G A;  1CIY A;  3GM8 A;  3J7H A;  2RV9 A;  1CZV A;  4XUR A;  2XON A;  2B9V A;  2W91 A;  3PUH A;  1K12 A;  4XUO A;  1PX3 A;  3ETP A;  1W0N A;  3MO4 A;  1W9S A;  4FI9 A;  3IAQ A;  4CUC A;  1UMI A;  3ZM8 A;  5JXH A;  2JDA A;  2E26 A;  3VD3 A;  1GMM A;  3I3B A;  3AC0 A;  3GXU A;  3ACH A;  4RYD A;  1ULP A;  2HLE A;  5DMY A;  3T08 A;  2W3J A;  3JXS A;  1US2 A;  1OF4 A;  2Z4F A;  3VD7 A;  5JR2 A;  5I0D A;  3UES A;  2X09 A;  1JZ4 A;  1JI6 A;  2QQM A;  4OMD A;  3WNK A;  4MOA A;  2E33 A;  4CU6 A;  3OBA A;  1JU3 A;  2Y6K A;  2EIB A;  2OKX A;  3DYM A;  2W1U A;  3MV0 1;  4QX1 A;  4CUA A;  1O8S A;  2VZ1 A;  2ORX A;  3OG2 A;  3CZU A;  3SEE A;  3C7F A;  3T0D A;  3I3E A;  2W1Q A;  2C9K A;  3LEG A;  4DUX A;  2VL4 A;  1DP0 A;  2ZEZ A;  2KD7 A;  2XOM A;  2Y6L A;  3C8X A;  2QQI A;  2VZP A;  1SDD B;  1W9W A;  1UY0 A;  2VZV A;  5DN2 A;  4CU9 A;  2WO1 A;  3I2F A;  3IAP A;  1XC6 A;  1UY1 A;  1J84 A;  4AG4 A;  1YQ2 A;  1OH4 A;  3HNB M;  1JYN A;  3HNM A;  2CDP A;  4QB6 A;  1GOF A;  3K4Z A;  4XVH A;  1F4H A;  3T2P A;  4DUV A;  1HN1 A;  3U37 A;  4PT6 A;  3CZJ A;  2V5D A;  2Y6G A;  3ACI A;  4QAW A;  4BJ0 A;  4KWU A;  1JZ8 A;  5C71 A;  1JZ7 A;  1JHJ A;  4A3Z A;  4DXR A;  1KGY A;  4GWJ A;  3LE0 A;  1J83 A;  4HG6 B;  1JYX A;  1UYZ A;  3THC A;  2W92 A;  3WF4 A;  4ARX A;  2WBK A;  5LCW L;  4RN5 A;  3CQO A;  5HXM A;  4LQR A;  3A23 A;  2J1S A;  2WAB A;  3T0B A;  4UAP A;  2WQ8 A;  2QQJ A;  2VCC A;  3WF0 A;  2VR4 A;  3SEP A;  2QQO A;  3F2Z A;  3A22 A;  3A7Q A;  5JXI A;  3SKJ E;  1TG7 A;  2QBX A;  2DDU A;  1L7R A;  1P8J A;  3DEC A;  3WNO A;  3HPN A;  2ID4 A; 
#chains in the Genus database with same CATH topology
 1CAX A;  1UOF A;  3VBH A;  4N53 B;  1MEC 2;  3WR0 A;  3CHX A;  3BTA A;  5CNA A;  3O0V A;  2AR6 A;  4BOW A;  3HR9 A;  4CDU C;  1HRV 3;  5LK7 B;  5FZ6 A;  2X5I A;  4P9I A;  3M3C A;  3AP5 A;  4QB1 A;  3LDB A;  1HIX A;  4A7Y A;  1GZT A;  5CFD C;  5C4W A;  5A80 A;  1IPS A;  1G9C A;  1XYP A;  3N7M A;  1ZM1 A;  2E63 A;  2WNO A;  3FLT A;  1LOB A;  3AP7 A;  4PBO A;  3AYE A;  2P6C A;  4QB2 A;  1DZT A;  1SLL A;  3IPV B;  1JOD A;  3LEM A;  1HXS 3;  4JGY C;  1EV1 3;  1HRV 2;  4KG0 A;  4LK6 A;  3WUC A;  1G9B A;  1LOF A;  1NZI A;  3AXD A;  3BGA A;  3EQE A;  5EJ1 B;  5T5L A;  1NA1 B;  2YBK A;  1XNA A;  3AVS A;  4XEZ A;  1N1Y A;  4IUG A;  4AEM A;  2HBU A;  2XJU A;  1UN1 A;  2VNR A;  1LRH A;  5AC9 2;  1I9R A;  4OHX A;  2ATF A;  2VEC A;  1F31 A;  1CD3 G;  3TEZ A;  2NYY A;  5DZF A;  4YWA A;  1JBC A;  1DGR N;  3ACF A;  3IBM A;  3E6D A;  3LGR A;  4IET A;  4MO3 M;  2XBO 2;  4PQQ A;  1HV0 A;  1R1A 2;  2DCK A;  1MQT A;  3B00 A;  1JHN A;  2YG0 A;  4DUW A;  4Q4W 2;  4R4X A;  4QPI B;  3VHR A;  3LA3 A;  2BNM A;  1HQL A;  3APB A;  1E5I A;  3W5M A;  1H6X A;  3OGS A;  2R04 2;  3MYX A;  1KEX A;  4P00 B;  5FZF A;  2W5F A;  5LK5 A;  2J1E A;  4KGQ A;  4TSV A;  3DEM A;  4OI1 A;  1C8M 3;  4MHR A;  2JE9 A;  1GWM A;  1MPX A;  5FBZ A;  3P6B A;  1SLA A;  4GZ9 A;  2WYF A;  1FAY A;  1UX6 A;  1WGP A;  1YFU A;  2ZGM A;  3AMP A;  4ET7 A;  3ZXL A;  4LE4 A;  3KD4 A;  3WDX A;  1OUS A;  3ZYJ B;  5A6X A;  2A1X A;  5A70 A;  1R09 2;  2JB8 A;  1GP6 A;  5FP4 A;  4XJ9 A;  2FMY A;  2SBA A;  1V70 A;  4XAC A;  4HVO A;  4OHV A;  1Q8O A;  3AP9 A;  4XMA A;  3AFK A;  1XRU A;  1XYO A;  2IXK A;  1W04 A;  5EIY B;  4QXB A;  1ENQ A;  4H7L A;  1WLC A;  3EB7 A;  2CWM A;  3GBF A;  2DVF A;  2ERF A;  4Y4Y A;  5AVP A;  5A7W A;  3WP5 A;  1OLR A;  4XHB A;  3S7I A;  4AEK A;  1AR6 1;  5C9A C;  5IVC A;  2DWR A;  4HZF A;  5I93 A;  1YO8 A;  1LEM A;  1W2O A;  1VR3 A;  5F8P A;  1SBF A;  5K0U C;  3E97 A;  2E31 A;  3NRU A;  1DLC A;  1C1F A;  2I45 A;  1HRV 1;  1UO9 A;  5T54 A;  3UK9 A;  3VZJ A;  1YI9 A;  4LHL A;  3ZKU A;  4JKK A;  2W87 A;  2EIC A;  4CP9 A;  1WKY A;  3UGH A;  4BQ3 A;  1TME 3;  5T55 A;  4LBM A;  5A7O A;  2Q8C A;  2ZXQ A;  3ES1 A;  1OLM E;  2NZ9 A;  4N53 C;  5CFD A;  3S5Q A;  2Y64 A;  1BVP 1;  3BIE A;  1HB3 A;  2ARA A;  2VBB A;  5H9P A;  4DIQ A;  1V6L A;  4IES A;  1MS8 A;  4LO6 B;  4Y1Y A;  4L2N A;  4JGZ A;  2XL7 A;  3V64 A;  5KXB A;  1OOP A;  4YVS C;  5JSP A;  5K7P A;  2G9F A;  4ONU A;  4AVV A;  5LA0 A;  3AB0 A;  4K40 A;  4QGN A;  2R0H A;  3PUI A;  2GNT A;  2VZT A;  1GZW A;  4FPY A;  2JIG A;  5FZO A;  3ZYB A;  4ZU5 A;  1RVF 3;  3W58 A;  1YWK A;  3W5N A;  5B4N A;  1RUF 1;  3DYO A;  2ZEW A;  3ILN A;  2WWJ A;  3RQ0 A;  4XIL A;  5IAT A;  2G4I A;  4JC1 A;  1RED A;  3AZV A;  1F8V A;  1RXG A;  1WZX A;  2AH2 A;  2H0V A;  3KS7 A;  3S7E A;  1BCX A;  4MGT A;  2BWA A;  1ZBA 3;  2JD4 A;  3C2U A;  5FLH A;  3ZMO A;  1R1A 3;  3NW4 A;  4NUB A;  5KC5 A;  1AZD A;  4FFH A;  4M4R A;  1LOG A;  4MGQ A;  3KGL A;  5BNP A;  3FLP A;  1GZ9 A;  1AR9 2;  2A6X A;  2HYX A;  2A6V A;  4Y20 A;  2P4E A;  4Q0S A;  5AC9 3;  1SFP A;  2G1M A;  4CVU A;  1VB4 A;  2QE3 A;  3N9L A;  1XOY A;  1S0C A;  3PME A;  2FZ1 A;  4OHZ A;  2SLI A;  3HEI A;  4TWT A;  3RNS A;  3NNG A;  4CCM A;  2J7M A;  4NMI A;  1XJA A;  1POQ A;  5C70 A;  1N1S A;  1J3R A;  2EIG A;  3AXE A;  3HBZ A;  4S2G A;  3ZXE A;  1SFY A;  5BNO B;  1KFU L;  1EV1 2;  1Y43 B;  2BV4 A;  5DG1 A;  3IT8 A;  3LEK A;  1US3 A;  1CON A;  1Y3T A;  2WS9 2;  3POE A;  1Y9M A;  2JDZ A;  3K77 A;  3WW2 A;  2HEW F;  4CDQ A;  3LB9 A;  1WWY A;  1QOS A;  1H8T B;  3IDC B;  3J8F 3;  5A3P A;  1GP5 A;  5HCF A;  3LSE A;  1ZZ7 A;  1W90 A;  4KQ7 A;  1S0F A;  3WEZ A;  1QQP 2;  2C24 A;  2JG9 B;  1YCI A;  1RUG 3;  3NKG A;  1JUI A;  1JZ6 A;  4XCB A;  4DO0 A;  1GWL A;  3M70 A;  2O8O A;  2Q8E A;  3MPB A;  3M8L A;  2JIJ A;  2NMN A;  4FXK B;  3TEW A;  1DGW X;  1ULC A;  2JD9 A;  2HWC 2;  1NT0 A;  1FNZ A;  1QJU 1;  4HPK B;  5FZB A;  1F35 A;  2WFF 3;  3WDW A;  1W6M B;  2QQN A;  4D6S A;  4UFH A;  2A5Z A;  3U4X A;  1REE A;  3JU9 A;  3K4D A;  3OSD A;  3VHO A;  3THT A;  1EAH 3;  5GLV A;  4EN0 A;  4AZZ A;  3PNA A;  4JVA A;  2ZGO A;  4BWO A;  2WT0 A;  2VQA A;  4FAH A;  4P9Y A;  1RIR A;  3A21 A;  2D43 A;  2Y6J A;  4FTS A;  3KT1 A;  3LAG A;  5JAX A;  3OUI A;  4FQ4 A;  3MLK A;  4R4Z A;  3B02 A;  3HWJ A;  3M3I A;  4QQP A;  5FXZ A;  2RDR A;  2Y60 A;  3O1R A;  3JBG 2;  1RL3 A;  1D0G A;  1UXZ A;  5DDJ 1;  2WL1 A;  1QJY 3;  1SLC A;  4ZHN A;  4BXS V;  3HQU A;  2OII A;  3RI8 A;  5AVA A;  4CP0 A;  4F7Z A;  2NMO A;  3JD7 3;  3OF1 A;  3U75 A;  2LRO A;  2XG3 A;  4C0B A;  1YQC A;  3L2Y A;  1VBA 3;  3P5B A;  5HCH A;  2G19 A;  4LOR A;  2VZS A;  4V2V A;  3TNQ A;  1KJR A;  2A73 B;  4G9S B;  4LHS A;  5C8C C;  3O1T A;  4KI5 M;  1KQR A;  4ZZ5 A;  1X50 A;  4IEO A;  5C3R A;  4TTG A;  5IUQ A;  3FBY A;  1RUC 1;  1ND2 A;  3JQX A;  5JCT A;  1UY3 A;  2GH8 A;  3IWZ A;  4N43 C;  4MGS A;  1RUI 3;  5H9Q A;  4GA9 A;  1NCQ B;  5JSO A;  3DYP A;  4QMA A;  3BTY A;  4FPF A;  4LIU A;  1FI2 A;  2R16 A;  2Z69 A;  3LPG A;  1O7F A;  5JLV A;  2RG4 A;  3I2O A;  1NXM A;  2LRP A;  1RUF 3;  1VRH 3;  4LTA A;  4P08 A;  1QH7 A;  1NY7 2;  2ET7 A;  3WW3 A;  3VBF C;  5BYN A;  4AED B;  2BQP A;  5FUI A;  4BXF A;  4CXY A;  1MS9 A;  4RFR B;  3RS6 A;  3URF A;  5IAV A;  4E9K A;  1EUU A;  2BFU S;  3C7O A;  1OBN A;  5D1I A;  3T2Q A;  1DQ0 A;  3FLR A;  1O5U A;  3AMN A;  2VMF A;  4H55 A;  1XND A;  1UOG A;  5FP9 A;  4I0A A;  4K21 A;  2BJS A;  2LS6 A;  2WNV B;  2QNK A;  1JN2 P;  4ZS2 A;  3LFM A;  2VD7 A;  1W8N A;  3U11 A;  4OYU A;  2ZEX A;  4E4H A;  1MS4 A;  3I2G A;  5HXV A;  5JWP A;  2WUH A;  4AHX A;  3AP4 A;  2B9U A;  3K46 A;  5DAW A;  1W9F A;  2OA2 A;  2DBI A;  3CBN A;  1UOB A;  2Z42 A;  3I3Q A;  4RQP A;  1E5R A;  4W6X A;  3ZN5 A;  2WDB A;  4HKO A;  4MZU A;  3HN1 A;  1YIF A;  2XQX A;  2X5I B;  1ND3 A;  4WM7 B;  4YW6 A;  4DQA A;  1WCK A;  3ASI A;  2BUK A;  3D8C A;  5FUN A;  5IFT A;  4GKX A;  1OUR A;  4COV A;  1DBN A;  5FZM A;  1VBD 1;  3N9O A;  3U4S A;  1PIV 1;  4AI3 A;  5FZA A;  5EYX A;  2YYO A;  2E7Q A;  4LBN A;  5FAX A;  1H4G A;  2VUJ A;  3KCC A;  1PO2 2;  3BOW A;  5FKB A;  5FV3 A;  2Y33 A;  5IFP A;  2HWD 1;  3BN6 A;  5GLT A;  3RSJ A;  3VBR A;  1XNT A;  2PQS A;  3AK0 A;  4NRO A;  2WFF 2;  2Y34 A;  4G3Y C;  5K9Y A;  2DFC A;  1XYN A;  2HWC 3;  2RMU 1;  3N7L A;  3MEP A;  5A3M A;  1XE7 A;  4GD4 A;  1TVG A;  3DN7 A;  1J58 A;  3D3A A;  4FFG A;  2QDR A;  3U0Z A;  4PIX A;  1EUT A;  1XB9 A;  2EAL A;  4IEQ A;  5JSR A;  2GP3 A;  1ZA7 A;  1AX2 A;  1QJU 3;  2A7A A;  4GQ7 A;  4IE0 A;  2GU9 A;  5A7S A;  4MSV A;  4XJZ A;  3ZIX A;  3WNN A;  3T2T A;  1OH3 A;  1HRI 1;  4XJU A;  1NXD 1;  4AGG A;  4ZU4 A;  3IIA A;  4AI9 A;  5JOW A;  1TZO A;  4FTB A;  1RUG 1;  1Q8V A;  3AMQ A;  1UKG A;  3D4K A;  4ASL A;  4QKB A;  1KIT A;  3M3E A;  2WN3 A;  2RS3 2;  2X29 A;  1D0H A;  4WVZ A;  3KQR A;  3RG0 A;  2IWG B;  4GJZ A;  1YYN A;  4XUQ A;  1GQP A;  5CIR A;  4CDQ C;  3DUI A;  1LEC A;  3MW3 A;  3HT1 A;  1QGL A;  4QDS A;  1YQ6 A;  1GOH A;  1DF0 A;  4XTM A;  5FK7 A;  3SIT A;  2ARC A;  4KMQ A;  5J1X A;  2VQT A;  1UY4 A;  4MGI E;  1OQE A;  3OGR A;  1YXW A;  2UUR A;  4B4Q A;  1BK1 A;  4BIO A;  4BH9 A;  2LTN A;  1GQH A;  1Y7B A;  5E89 A;  4ASM B;  1S2B A;  5ABJ B;  1ODN A;  1ZBA 2;  1W6N B;  4XDP A;  5A3T A;  3HNY M;  2A6W A;  4HVQ A;  5H9S A;  1F5F A;  3OYW A;  4PLN A;  2PFW A;  1V6J A;  1CIY A;  1V6I A;  2ZAA A;  4RA0 A;  1B09 A;  3J7H A;  2XUM A;  2YU2 A;  1RUE 2;  1OKO A;  2ZAC A;  1RVF 2;  1S2E A;  4O61 A;  2JDH A;  5KHJ A;  3KT4 A;  2D5F A;  1OOP C;  4YVS A;  1W0N A;  3MO4 A;  2ADD A;  1X36 A;  2NPI A;  1PVC 1;  1ZBE 3;  3WQ7 A;  1W6P B;  3IAQ A;  1POV 3;  1SQ4 A;  4CUC A;  5A33 B;  1PZ7 A;  5JXH A;  4URT A;  4JV4 A;  1IS6 A;  4MVT A;  3PTY A;  3IMN A;  3ACH A;  4IE4 A;  5FRE A;  1D2Q A;  3O1U A;  1PGW 2;  2HLE A;  3VBR C;  1HN0 A;  5FIX A;  5IK7 A;  2W3J A;  1AR9 1;  1LOD A;  1TME 2;  3AMH A;  4OHW A;  3FFZ A;  2KM2 A;  3K2O A;  2WNU B;  2PQQ A;  3USU A;  1FT9 A;  3MIB A;  4HOO A;  4P9W A;  4LKD A;  2WIN B;  1RUN A;  1UZY A;  3VD7 A;  3FHI B;  1Q8S A;  3IN9 A;  3UES A;  1EYB A;  3WG3 A;  1FNY A;  1VE0 A;  3WNK A;  1JMU B;  1NG0 A;  3I59 A;  5FY1 A;  2WNU A;  4UW3 A;  1WMD A;  3RJR A;  5CA6 A;  1QF3 A;  3N9M A;  2E7A A;  3DYM A;  2OKX A;  4CP2 A;  3NV2 A;  2XKO A;  4RS5 B;  2D6P A;  1AR8 1;  2W1U A;  3T1L A;  4QX1 A;  4ERO A;  1LHV A;  1QOO A;  5FY9 A;  1KXG A;  3O0X A;  1PMI A;  4PHZ A;  3UGG A;  1DYP A;  3POJ A;  3ZYH A;  3V0A A;  4MXW A;  3OG2 A;  4LHN A;  2G9G A;  2ZBJ A;  4F8A A;  4AOC A;  1H8T C;  5CAD A;  3I3E A;  4XF0 A;  5KHG A;  3BYW A;  1Z78 A;  2XWJ B;  5JZG C;  5D8A B;  1IOA A;  3M2M A;  5FPB A;  4URA A;  4JGZ B;  1HQW A;  1W8H A;  2ZZQ A;  1QJY 2;  3VKN A;  2HEV F;  3SHR A;  2BBV A;  3C8X A;  3RZG A;  3VBS C;  5ACA 2;  1UY0 A;  2PHT A;  4CU9 A;  5GZG A;  1F5J A;  3E5X A;  2TBV A;  2WO1 A;  3I2F A;  3IAP A;  2I2S A;  2VMG A;  4HLT A;  4JGZ C;  2BW8 A;  3AKP A;  5F3E A;  1PVX A;  3VBF A;  3WP3 A;  4JZR A;  3ZYF A;  5FZE A;  4UF0 A;  5LRS A;  1PGL 1;  1YQ2 A;  1UD1 A;  2A3Y A;  4FPG A;  4HPK A;  4WM7 C;  4YW5 A;  4FVV A;  2Q1F A;  4A3X A;  4EN6 B;  1W0O A;  2MEV 1;  2A75 A;  1JYN A;  4AE2 A;  2X8K A;  1AYN 1;  3KV5 A;  4IND A;  2C0Z A;  4XXP A;  2D44 A;  2DF7 A;  2GAL A;  2GN3 A;  2Q0A A;  4AGR A;  3LOB A;  1MS5 A;  4NHX A;  3SH3 A;  3QLQ A;  5C9A A;  1AL2 1;  1ENR A;  3BUC A;  3D0J A;  2XVG A;  4LO4 B;  4ES8 A;  2D3S A;  2XBO 1;  2EVX A;  5FPZ A;  3H1M A;  2BU9 A;  5LRR A;  3RZH A;  4XAE A;  3MHZ A;  1PIV 3;  4A3Z A;  3SIS A;  1ZRI A;  5HV4 A;  4A7K A;  2WS9 3;  4DPN A;  1AX1 A;  4DOU A;  1JYX A;  3WY6 A;  2CGP A;  1F2N A;  3KWV A;  3TN9 1;  4QQO A;  2VGD A;  2W2I A;  4M3C B;  4ARX A;  5J96 B;  4IE5 A;  4BPZ A;  1LAJ A;  2V09 A;  5CG9 A;  2HWE 2;  1DQ5 A;  2D3P A;  2WAB A;  3T0B A;  3WV6 A;  4YFW A;  1EPW A;  4L99 A;  2QQJ A;  4XJA A;  2D98 A;  4RSU A;  1ENX A;  1GAN A;  2VMH A;  4AGV A;  1AR9 3;  4AFA A;  4I01 A;  3SEP A;  5IVE A;  2R06 1;  2JXA A;  5FXV A;  1BEV 3;  3UKN A;  5BPX A;  4XBN A;  2VTX J;  4NII A;  2QBX A;  1L7R A;  1YRZ A;  5FP8 A;  1FMD 1;  4HBN A;  3I4I A;  4NHM A;  3DEC A;  2FCU A;  2ID4 A;  2HWF 1;  2K2S A;  3VDC A;  4BE3 A;  5I0R A;  4XDQ A;  1POV 1;  3VDB A;  2OS2 A;  3BIW E;  3ZR6 A;  2D7F A;  1ALY A;  2EAK A;  2JDN A;  2ZGS A;  3NO8 A;  3PL0 A;  3HBK A;  1HJF A;  5FXX A;  3T4V A;  1A8D A;  3DXT A;  2WZR 1;  1K45 A;  1XSR A;  4PF1 A;  1KD7 A;  1RUI 1;  1W0P A;  2JJ6 A;  4CDX A;  3GNE A;  2XJS A;  3NNJ A;  1URX A;  5FY0 A;  1U5Z A;  2J1T A;  1O59 A;  4CDW A;  3ABZ A;  3Q8C A;  1JZ5 A;  3ZN6 A;  1EY2 A;  3N4M A;  4XF3 A;  1OD3 A;  1OHF A;  3AMM A;  3Q9O A;  1T2X A;  5JMO A;  1ZRE A;  3R4S A;  1ACC A;  3OCP A;  1CIW A;  1VBE 1;  1UKR A;  2P2K A;  4Q4V 1;  3ATG A;  4OZX A;  4DIN B;  5ISL A;  3BU0 A;  2VUL A;  4XXA A;  1CAX B;  3IKW A;  1ZYB A;  3KVB A;  4KWJ A;  4HAN A;  3NJV A;  3O7O A;  4Y1Z A;  1DQ4 A;  4JGY A;  3S0M A;  2W1W A;  3I2I A;  2VC9 A;  4QQL A;  4BYY A;  2WT1 A;  4MGY E;  3KM5 A;  5F5I A;  4BQ1 A;  1VBB 2;  4Q29 A;  3VBH C;  3PUA A;  3VBO C;  3ZXD A;  1W6Q A;  3BOP A;  3JB4 C;  4QDR A;  2Q1M A;  3ILF A;  2W95 A;  5FLJ A;  5J7M A;  4DXS A;  5A32 B;  3VL8 A;  4GAZ A;  4CDU B;  1NE6 A;  3AM2 A;  2PHR A;  2BOI A;  4KBB A;  4QX5 A;  4YLZ A;  3ETQ A;  2RS1 3;  4O9E A;  3VUO A;  5EHD A;  3NAP C;  2Z79 A;  1OQD A;  2CNA A;  1NYW A;  3JCI A;  2MHF A;  2FDG A;  2EXJ A;  4AQ2 A;  1W9T A;  5DG2 A;  5ACA 1;  4IV3 C;  3ZXF A;  1H6Y A;  1H2L A;  4UBG A;  1JW6 A;  4YM2 A;  3THD A;  2RVA A;  1JOJ A;  1RHI 3;  2FMD A;  5F5C A;  4CA9 A;  3RZJ A;  4C90 A;  4DY5 A;  4XHX A;  2CAV A;  4IEU A;  4NHL A;  2PYT A;  4XAB A;  4L92 A;  3VD5 A;  1KS4 A;  2QQW A;  2ZGL A;  3VGI A;  1DYO A;  1WCQ A;  2JX9 A;  2UY8 A;  1SLI A;  2XB6 C;  4BIF A;  2BRT A;  3GYD A;  1PK6 B;  5LBE A;  4DFS A;  1V00 A;  4ORF A;  4LLF A;  4J6G A;  1WLT A;  2PHX A;  4M01 A;  4CZS A;  3V65 A;  2XBO 3;  4LBJ A;  2DCY A;  4DS0 A;  1N3P A;  2L9L A;  4XFF A;  5FUP A;  3ZOI A;  4FAG A;  4OVE A;  2EXK A;  3H8X A;  1AXY A;  4DNY A;  1SCS A;  3O12 A;  3ZYR A;  1TQ5 A;  3CMG A;  5HV0 A;  4YW1 A;  2C4X A;  4OLL A;  2PHW A;  3QD6 A;  2J1V A;  5FZ7 A;  5KXC A;  1XSQ A;  1AR7 3;  2A3W A;  1EPZ A;  2GDF A;  4RS5 C;  1VAV A;  4Q26 A;  4NHY A;  2FDF A;  5FP3 A;  4QM8 A;  4QU2 A;  5GKA C;  5D8A A;  2VTX A;  3FMG A;  4CEW A;  1N47 A;  5L7O C;  1JZ3 A;  1UU5 A;  3PIJ A;  3BCW A;  1YIP A;  4UW6 A;  4Y5T A;  3OJB A;  1D4M 3;  4YW7 A;  4DRV A;  1IKP A;  1W8Z A;  2QFE A;  5BNO A;  5FZ8 A;  4RGK A;  2VE1 A;  5C8C A;  3TEY A;  4RS5 A;  1QJE A;  1L3J A;  4WVW A;  3WOG A;  1MEC 3;  2IFR A;  4XUP A;  5IK8 A;  1JYC A;  5FO8 B;  4KWL A;  3WX5 A;  4MG2 A;  2YXS A;  5F32 A;  1UYX A;  3SCF A;  3T3Y A;  1LHW A;  3SXW A;  2TUN A;  4XUN A;  3K4A A;  4QX3 A;  3SKV A;  1W05 A;  2TEP A;  3O1S A;  4OHY A;  2WZ8 A;  3ZFE A;  1OF3 A;  2RE9 A;  3CLP A;  4NR1 A;  5FP7 A;  4Z2W A;  1ULG A;  1AR8 3;  2WZR 2;  5LWB A;  4M3C A;  1GWK A;  4W50 A;  4K6B A;  4YRD A;  3R05 A;  4YM1 A;  4EN9 B;  1EV1 1;  1WW7 A;  1AR6 3;  1BMV 1;  4BQX A;  2YY1 A;  2RJ2 A;  3MF6 A;  4FOQ A;  2AEN A;  4QXH A;  2QZ3 A;  2JG8 B;  3ZFF C;  1JYW A;  3RZK A;  1TMF 1;  5FYI A;  1NA1 C;  1K5M A;  1BLZ A;  2FHR A;  1VBD 3;  2UWC A;  1UNB A;  2QQV A;  1C1L A;  3VDD A;  2ET1 A;  2FDH A;  1RUD 3;  4J1W A;  1CJD A;  1RUE 1;  1CAW A;  4IV1 A;  3I3M A;  2QQK A;  3PDQ A;  3LF7 A;  2QUO A;  2VOW A;  5FY8 A;  4A41 A;  3C7H A;  2VUC A;  3POI A;  4NIA A;  5EJZ B;  4GJY A;  5CG8 A;  1LTE A;  2KA3 A;  3LKJ A;  1BHG A;  2H6C A;  1Q3E A;  2IXC A;  2R30 A;  1GUI A;  4IEP A;  1G9D A;  2ZGU A;  5A1F A;  4GWI A;  2DUQ A;  5FZK A;  1S55 A;  3USS A;  3W21 A;  4IQP A;  1D4V B;  4CUB A;  4YW2 A;  4IEV A;  3AZX A;  5F2W A;  5F6K A;  2P3Y A;  2YBP A;  5FBJ A;  1VAK A;  3WNP A;  1OT5 A;  5LBC A;  2ZTN A;  3DPR A;  1PGL 2;  2A70 A;  1G7Y A;  2D40 A;  3OUH A;  2JG9 C;  4I09 A;  1W6O A;  5FYV A;  2YC2 A;  5BV6 A;  1UZW A;  3WG1 A;  4P9J A;  1Z0H A;  2XH6 A;  5CU1 A;  1MZ5 A;  3GJB A;  1EP0 A;  2RS3 3;  4IV1 B;  2XML A;  3AYD A;  3ZYI B;  4H2A A;  1CX1 A;  4EN7 B;  3OEB A;  1RUJ 1;  2C5D A;  2CTV A;  1NE4 A;  5F37 A;  4LT5 A;  1LGN A;  1PIV 2;  3CJI C;  1F15 A;  5L7O B;  4ARY A;  2XJQ A;  4FOY A;  4CCO A;  2WJS A;  2W47 A;  2VCA A;  3D82 A;  4OCT A;  3SMH A;  3IZO A;  4ISQ A;  4LOT A;  3SLI A;  1V0A A;  1HXS 1;  3INA A;  5KXD A;  1PO1 1;  2D97 A;  4LR4 A;  4Y1U A;  1QOT A;  1RUH 3;  3O0W A;  4JHT A;  1WME A;  4Q4W 1;  4LNV A;  3LOI A;  4R9D A;  1BJQ A;  1LJ7 A;  4WVM A;  2OX0 A;  1ULE A;  1W6Q B;  2VZO A;  3UV9 A;  4QPI A;  1A8M A;  1QJY 1;  1LCL A;  1RB8 G;  4LBQ A;  1CZT A;  4NAO A;  3T30 A;  1MQT B;  2DBN A;  4XE9 A;  5BNN A;  4OI0 A;  3N36 A;  4CTE A;  5CBL A;  2YGL A;  1DGR A;  3L2H A;  1Q5O A;  4NOT A;  1ZRC A;  2BGP A;  4CCC A;  4D0Q A;  2H0B A;  5FZ1 A;  3WQ1 A;  1RUH 2;  5EP9 A;  2IXH A;  5ACA 3;  1J3Q A;  1Q43 A;  2XHN A;  1VLN A;  1V6M A;  4IV1 C;  2CYF A;  5K0U B;  1KJL A;  1RHI 1;  3WNL A;  2HEY F;  3ZN6 B;  3LQC A;  1KS5 A;  5FYM A;  3H9A A;  3KCX A;  5A33 A;  1F4A A;  1OFS A;  4RFT 0;  3MZH A;  2R32 A;  5B4X A;  1JOB A;  3UJQ A;  3NJX A;  3ACL A;  4LPL A;  4Q0U A;  5E16 A;  4Q4X 1;  3ZFG C;  3ZMN A;  3CJI B;  2AYH A;  5K0U A;  4RR3 A;  3TBD A;  3ELN A;  1AF9 A;  2WNV C;  3VD9 A;  3JB8 A;  1GKB A;  3WF2 A;  1VB2 A;  4YZ4 A;  4CCE A;  1B35 C;  5F3C A;  1NOV A;  4FCA A;  3A0K A;  5I0S A;  3KSC A;  4M00 A;  4BZ4 A;  5IHR A;  1AYM 1;  4YGC A;  1I1E A;  2DU1 A;  1PX4 A;  2W08 A;  1WBF A;  5FWJ A;  3A4U A;  3KZ4 C;  3JBG 1;  3MIG A;  4S2F A;  5CZK A;  4FPO B;  2RR1 1;  2PMW B;  3ENR A;  1S0D A;  4LEJ A;  3B69 A;  3B7M A;  1NCQ A;  4I0W B;  4XZU G;  4DEV A;  5LA1 A;  2CAU A;  2P5B A;  4QQ2 A;  2YFU A;  4IEY A;  4WVM B;  3WHT A;  4O9G A;  5DQ0 A;  1XNB A;  4YG0 A;  2ZHL A;  3AFG A;  3E1F 1;  2VOX A;  1UZZ A;  5DAQ A;  4GAL A;  1VBA 2;  3OPW A;  5JPM B;  3D5O A;  1KFX L;  1NCR A;  2NP0 A;  4IW3 A;  1RUD 2;  3GHM A;  4QDQ A;  3ROU A;  4CEW C;  5L7O A;  3TEX A;  2Y8K A;  3OB8 A;  3H0O A;  4DXZ A;  4FPH A;  3ZSM A;  4JKL A;  2PEL A;  4OUE A;  2Y26 A;  1RUC 3;  1XPW A;  3WF3 A;  3OBT A;  5JZG A;  1Z7S 2;  4ZON A;  1R08 3;  2AUY A;  3HJR A;  5FO9 B;  4HKW A;  2QZ2 A;  4LIT A;  1M06 G;  3VDA A;  4UFL A;  1D7P M;  2ZGT A;  2YC4 A;  4DMI A;  4OI2 A;  1X33 A;  4UYB A;  1DG6 A;  3B94 A;  4LJH A;  4ZXE A;  3S5A A;  2K46 A;  3J7N A;  2BEO A;  2RDN A;  4LMF A;  1CPM A;  2CSG A;  2HWF 3;  3MGU A;  4NE9 A;  2RDQ A;  4MXV A;  2VNO A;  2RMU 2;  4YPJ A;  5EYY A;  4PLM A;  3B93 A;  3KLS A;  1SAC A;  4XJW A;  4OMC A;  3AVR A;  5E1R A;  2D5H A;  1GR3 A;  1OPM A;  5C7G A;  3UYJ A;  1HQN A;  3JD7 1;  2ZJC A;  3ORJ A;  4KU7 A;  3GM8 A;  1ND3 B;  3LSD A;  5ABJ C;  5HCA A;  2DVB A;  4RR3 B;  2P17 A;  3GZA A;  3RGB A;  3J8F 2;  4UT5 A;  3WUD A;  1SPP A;  2B9V A;  2R04 1;  4P14 A;  5DAP A;  1LKN A;  1RMU 1;  1PX3 A;  1LOA A;  4X6Q B;  4YSF A;  1W9S A;  4FI9 A;  2Q8D A;  3BPS A;  4LA2 A;  5LB6 A;  1K5M B;  5APA A;  2JDA A;  2E26 A;  4MX3 A;  3VD3 A;  1SBD A;  1GLH A;  3AC0 A;  4H7M A;  1AR7 2;  5L9V A;  4UFM A;  4NIH A;  1W03 A;  4RYD A;  1ULP A;  3ZPO A;  1IS4 A;  1XNK A;  4P9L A;  5FYY A;  2PHU A;  1FPN 1;  5DMY A;  5FYT A;  3T08 A;  1FYU A;  3WZ1 A;  2QCS B;  4SLI A;  4LO5 B;  5LEK A;  3JXS A;  2HYK A;  5C5U A;  1T6G C;  2EA7 A;  4E4Z A;  1JH5 A;  1BXH A;  3I7D A;  2ETE A;  2HWB 2;  1Q56 A;  2DVA A;  1LU2 A;  4BQ5 A;  1AJO A;  3ST7 A;  4GMP 3;  5FDB A;  3O1M A;  3RZM A;  2WWU A;  4B1M A;  4XMI A;  2ZGR A;  3NV4 A;  1ND2 C;  3NKT A;  2GH2 A;  1JI6 A;  2PTM A;  2XLA A;  1IPK A;  2E33 A;  3WDY A;  3TOJ A;  4CU6 A;  1A34 A;  1JU3 A;  2EIB A;  5BUV A;  3VBS B;  3LIH A;  1RHI 2;  1E57 A;  2I07 B;  2YGM A;  3A0N A;  4CUA A;  3GHN A;  1W28 A;  3DGT A;  3SQO A;  1HB2 A;  5GZE A;  5BXX A;  5CVR A;  1OA4 A;  3CF6 E;  3SCG A;  4DY3 A;  5C33 A;  2XHK A;  2YU1 A;  3WIN E;  3CZU A;  5FZ3 A;  2VU9 A;  2GZW A;  3B5L B;  4XAA A;  1V6K A;  5FCC A;  3MIH A;  2W1Q A;  4A6S A;  4CCD A;  2C9K A;  2MNG A;  3OD4 A;  1H2N A;  4DUX A;  3OPT A;  1FPN 3;  5T50 A;  4IL7 A;  5C9A B;  2K0G A;  5DXD A;  2HH9 A;  1LOE A;  2ZS6 B;  2DUO A;  2FD8 A;  2KD7 A;  4XFH A;  1GSL A;  4LBO A;  4QGL A;  1REF A;  1W39 A;  2VZV A;  3RYK A;  3BTX A;  3PVB B;  3NJY A;  4JQR A;  5LW9 A;  4FOV A;  3NJZ A;  2WKK A;  1XC6 A;  4A7Z A;  2RS5 3;  3OY8 A;  3MW4 A;  1UY1 A;  4I3G A;  4EWD A;  4BB3 A;  2AGS A;  2JKB A;  1N3O A;  2CY6 A;  4AG4 A;  2VUD A;  2XDV A;  2WQ4 A;  2GC2 A;  5E8A A;  2FZ2 A;  3VDD C;  2VXJ A;  1PGW 1;  3TAY A;  5ABJ A;  1OH4 A;  2NLR A;  2R07 2;  3HNB M;  4K8R B;  3GCX A;  4NRM A;  2PLV 2;  4N7I A;  1WCD J;  2D6N A;  2MEV 2;  3MFC A;  2CDP A;  4WM8 A;  5I8T A;  3WG4 A;  2RHP A;  3BTZ A;  3O5S A;  1MVE A;  2DTW A;  4K9S A;  3RWK X;  3T2P A;  4MET A;  4RR3 C;  4KL1 A;  4DUV A;  1UQX A;  1YEW A;  1IGO A;  2P1B A;  2UWB A;  4XPV A;  1ND3 C;  5EJ3 A;  1OLQ A;  3ZFG A;  2JDY A;  2WLQ A;  1OA3 A;  4RQP C;  1DIW A;  1IZ3 A;  1QDC A;  1Q8Q A;  4QPY A;  5GLU A;  4D69 A;  4AAP A;  2W0X A;  3PUQ A;  1JZ8 A;  4CXX A;  3ZSK A;  2YUE A;  5FPL A;  4ES9 A;  1GBG A;  5SV5 A;  2DFB A;  3ZO0 B;  5LAT A;  2WSU A;  2DVG A;  3V0A B;  3ZXJ A;  4HG6 B;  2WS9 1;  3VHP A;  4IGO A;  1V9U 3;  1TMF 2;  1C5I A;  2VMI A;  4YM3 A;  1W06 A;  1WD4 A;  1UOJ A;  2JDU A;  3NNM A;  2WBK A;  5DZG A;  4XFG A;  4RN5 A;  3I59 B;  4LQR A;  4Q4W 3;  5DUW A;  3V56 A;  1UIJ A;  5A3N A;  5BNP B;  1QJF A;  2WQ8 A;  3CNA A;  4RGG A;  4UAP A;  5I0U A;  3VB9 A;  4YVW C;  2VR4 A;  2ZX2 A;  1G86 A;  4XQW A;  5A3U A;  4QPI C;  5AC9 1;  3A22 A;  4FOW A;  4AQ6 A;  5JXI A;  3SNM A;  3G7D A;  1DGL A;  4JGY B;  3ZX7 A;  2DDU A;  5LY2 A;  3ZIW A;  2XLF A;  3HPN A;  1CVN A;  2ZHK A;  1AR7 1;  2E53 A;  3OGJ A;  3LFI A;  4K3U A;  1OVS A;  1DYK A;  2IXI A;  3E5Q A;  5FMC A;  1RUG 2;  2OT7 A;  5FYH A;  4K1Z A;  2ZOE B;  5LAS A;  4JKM A;  4KGG A;  3PU3 A;  1H2M A;  4OUM A;  5AFB A;  2DUP A;  3FE5 A;  3MBW A;  5D2A A;  2O8Q A;  2WO3 A;  4M3C E;  3CJI A;  4RQP B;  4YZ1 A;  3IB3 A;  4AVB A;  1OXC A;  3AYA A;  2YZ4 A;  2FCT A;  1O4T A;  3E6B A;  3U14 A;  3HAG A;  4PIZ A;  1BK0 A;  4ZPI A;  3AZW A;  3GZE A;  5JUV A;  5A7P A;  4AFD A;  3P3P A;  3WQB A;  1H30 A;  1JS9 A;  2WNV A;  3I2D A;  2QQP A;  4NJ4 A;  1WMF A;  3N9Q A;  5CFD B;  2BGC A;  4XDO A;  3I2K A;  4PIY A;  1QNY A;  1UYY A;  1VMJ A;  2ZA9 A;  2E51 A;  3FN9 A;  3NV3 A;  4NVP A;  5FMO S;  4NHK A;  4AYU A;  1T6B X;  1ZZC A;  5FTT C;  3SH5 A;  1W6N A;  2PHD A;  2R06 3;  1RIT A;  2WWS A;  2ZGK A;  1ZZB A;  1ZZ6 A;  3KV6 A;  1TEI A;  3WG2 A;  4JDN A;  5ERL A;  1S0J A;  4JTN A;  3ZLI A;  1UCX A;  1PK6 A;  5C4W C;  1HJG A;  2JDP A;  5A7W B;  3H50 A;  4LBQ B;  2HWC 1;  5T5P A;  1J59 A;  1DZR A;  1WLD A;  1A3K A;  1NQJ A;  3BI3 A;  2RS5 1;  3WNM A;  3K3N A;  4IER A;  3J4U H;  4CU8 A;  4K1Y A;  4JHZ A;  3H8O A;  5HPO A;  3GBW A;  1A6C A;  3AJY A;  1YJK A;  1WMX A;  2HWD 2;  4HMZ A;  2DU0 A;  1LU1 A;  4PCR A;  4XCA A;  4BQW A;  4YAR A;  5F7U A;  3T09 A;  4B7K A;  2JE7 A;  3ZSJ A;  1PK6 C;  5FJK A;  3ZSL A;  5A1L A;  1W8W A;  3VLB B;  1GFF 2;  3HT2 A;  3BVC A;  1NKG A;  3DKQ A;  4AHW A;  3ECQ A;  5FMB A;  4AVS A;  1MS1 A;  2VJX A;  2ZX1 A;  1CJP A;  1JXN A;  1VAL A;  4IGQ A;  3AYC A;  1AXZ A;  2Q30 A;  2YHJ A;  4XBQ A;  2XJT A;  5CYY A;  2BFU L;  3HN3 A;  3WXP A;  4FSJ A;  5G04 L;  1RXF A;  3NST A;  2AC1 A;  5J36 A;  1W8O A;  2WT2 A;  4I30 A;  2VVF A;  1MR5 A;  4LBK A;  1FXZ A;  2MEV 3;  1CES A;  2VVE A;  3DPR B;  2HJI A;  2ARB A;  3I8T A;  2CHH A;  3GAL A;  2DV9 A;  4HSJ A;  3Q8A A;  4QX0 A;  1LOC A;  1JU4 A;  2FDJ A;  4N7U A;  1VBB 3;  2WAO A;  3LIG A;  4PDW A;  4PJY A;  3UET A;  3VBR B;  3VZL A;  4CEY B;  4XQ4 A;  1I5P A;  4FFI A;  5IK5 A;  2E7T A;  5CKN A;  5LA9 A;  5E6H A;  2BYV E;  4BHP A;  1QQP 1;  1DHK B;  2E9Q A;  3AKQ A;  2C9A A;  4E2S A;  3I49 A;  1CAV B;  3VBO B;  5J98 B;  3RVH A;  2VNV A;  1FPN 2;  2ZX0 A;  2JG9 A;  5JPN B;  3III A;  4AED C;  3ZVX A;  1R09 3;  1HW5 A;  2RM2 3;  4EJR A;  5FY4 A;  1X7N A;  4UFK A;  4MUV A;  4LOS A;  1R1A 1;  2PXJ A;  3MIE A;  1NLR A;  1POV 0;  2NM1 A;  1UY2 A;  2P3I A;  1DFQ A;  3DV8 A;  4O7X A;  3DF0 A;  2R1B A;  4TN7 A;  1H1M A;  5I0T A;  1RUE 3;  1YFX A;  1NLS A;  1H9W A;  1XE0 A;  4QWN A;  3R4D B;  5FZG A;  2WN2 A;  2XJV A;  5EQU A;  2XKP A;  2FBE A;  2OZJ A;  4OI4 A;  4TYS A;  4P9G A;  3FJS A;  4ZKT B;  2GMM A;  3G6J B;  4HXC A;  1PMH X;  2DUR A;  3ZXA C;  4QPG A;  3CU7 A;  5T5J A;  3Q8F A;  5BNN B;  1BEV 2;  2EID A;  3CKH A;  4FFF A;  4LO8 A;  4M4P A;  4Y3O A;  4BIS A;  4CPB A;  4CEY C;  4QGM A;  2W46 A;  4LKS A;  4JDO A;  1LGC A;  4LBQ D;  4Y33 A;  5F5Q A;  1N3Q A;  2OPW A;  2D6M A;  3EHK A;  5CKM A;  4AAX A;  2JEC A;  2JEN A;  4TLG A;  3KT7 A;  2YFZ A;  4W4Z A;  4WVV A;  2VM9 A;  2PHL A;  2VZ3 A;  4DEQ A;  2XWB B;  1CPN A;  1J3P A;  3J26 N;  4P5Y A;  5JR7 B;  5I8Y A;  1HXS 2;  4L0P A;  3MDP A;  2A71 A;  2XR4 A;  1DLL A;  4Y22 A;  3IDA A;  5JOY A;  1M4W A;  1VBC 3;  2VBD A;  5LY1 A;  2XVL A;  1SBE A;  2CGO A;  3POF A;  5IK4 A;  3WCS A;  2J1R A;  1FOD 3;  2XGX A;  4OUS A;  3ZFG B;  4GB3 2;  5K4L A;  4ATF A;  5J48 A;  1S0G A;  3KVA A;  4CRQ A;  5DPN A;  2UWA A;  1VRB A;  3BAL A;  4K7J A;  3VBO A;  2R49 A;  2BDR A;  2K9Z A;  1JYV A;  3PVE A;  4WM8 B;  3IMM A;  3KV4 A;  1N1V A;  3OPZ A;  4UWD A;  3WDV A;  1BBT 2;  2VME A;  2ENR A;  5LBF A;  2CDO A;  3I54 A;  2VOT A;  1QIQ A;  1U5Y A;  4DB5 A;  5JI9 A;  5J37 A;  3BKZ A;  3BPZ A;  1G6N A;  4LUL A;  4AL9 A;  4XUT A;  1VRH 1;  5FZ9 A;  5FXW A;  5CAZ A;  2O0O A;  3EMR A;  2Q8O A;  1LES A;  4BA6 A;  4LK7 A;  3FZ3 A;  3WP4 A;  3X29 B;  1W8U A;  5F2S A;  2VQ0 A;  2WZE A;  2ORZ A;  2RS3 1;  1V9U 2;  1OC1 A;  2OVU A;  1YQ8 A;  5JZG B;  1AXK A;  5JDB A;  3JQW A;  1X9T A;  1UMZ A;  2YDE A;  1C8N A;  3PIG A;  4GXL A;  1RGS A;  5JVV A;  1AYN 2;  2LW8 A;  3R6S A;  4AI0 A;  3CO2 A;  4YM0 A;  4FT8 A;  5F9T A;  2VZQ A;  4E2G A;  4TXW A;  2CWS A;  4NID A;  2EXH A;  2FDK A;  4Q4Y 3;  2CU5 A;  3EBR A;  3AKR A;  4PI0 A;  2WZP P;  3B9C A;  3POS A;  1AVB A;  4XZP A;  4AVA A;  5FPU A;  3RRD A;  1CQ9 A;  1PVC 3;  4CCJ A;  3RPQ A;  3N7J A;  5IYY A;  3FFQ A;  3ON7 A;  5FZC A;  5C5T A;  1W8T A;  4QPG C;  4Z92 B;  4MLO A;  1QWR A;  5C3S A;  5DAV A;  3CDZ B;  5F3I A;  3LZZ A;  5HI0 A;  3QCW A;  2PLV 3;  4IV3 B;  4WM8 C;  1X9P A;  1GIC A;  1W3V A;  4YGE A;  4D8M A;  2PA7 A;  5FQ0 B;  5GJ6 A;  4ZU7 A;  2JE8 A;  2P37 A;  4ITC A;  1PMJ X;  4X8P A;  2AAC A;  2WO7 A;  4OZO A;  1YC6 1;  1L7Q A;  1GYK A;  4XBL A;  4AI2 A;  1DDL A;  3THP A;  3LWC A;  4Q2F A;  4QQH A;  2X05 A;  2FDI A;  4GKY A;  1UYP A;  1RUH 1;  2BWC A;  4UXA A;  1X8E A;  2B5H A;  1OA2 A;  2VTF A;  2YB7 A;  4N43 B;  1G9A A;  3PJQ A;  4BU2 A;  5FZO B;  5IJR A;  1S4C A;  3TYJ A;  5FOJ B;  1W3X A;  1QDO A;  1UPI A;  2C6S A;  1X8M A;  1PNG A;  4QX7 A;  2JWP A;  2OQ7 A;  1OOP B;  4CEW B;  1DCS A;  1AYN 3;  2LAL A;  5M0T A;  5FMO L;  3WD5 A;  1LNS A;  2R1D A;  4Q4Y 1;  5B2G B;  3EYP A;  4PDW C;  4XFB A;  5DUX A;  3MV1 1;  4K8F A;  5FY5 A;  1LED A;  4P9X A;  4CDX B;  2H6B A;  4WZC A;  2VW2 A;  1PZ9 A;  3UKT A;  5L36 A;  3N3H A;  2UYA A;  1JUH A;  2ILM A;  2IVJ A;  4LHK A;  1HV1 A;  5BNP C;  4HVR A;  4N8M A;  3MUY 1;  3PVN A;  3V0B B;  3RI9 A;  4V1P A;  5KXE A;  3H1Y A;  5IVV A;  1CR7 A;  1XNC A;  1RVF 1;  1C28 A;  4N90 A;  4B8E A;  2BGO A;  3VBU C;  5C6C A;  4CDX C;  2ZAB A;  3ZXG A;  2ZZJ A;  5FZH A;  3PLQ A;  4IE6 A;  2BOJ A;  2WNE A;  1EAH 2;  2VCB A;  4YGB A;  2QTW B;  1GZC A;  1JYI A;  5G05 L;  4PDW B;  5JXG A;  3HOB A;  4XW3 A;  5FQ0 A;  4N9H A;  3R0R A;  2NN8 A;  2WFP A;  5FRA A;  4MHU A;  5EV7 A;  4KWK A;  4IXL A;  4C8D A;  4CE8 A;  2HWB 3;  5A1A A;  1ULO A;  4CCN A;  2GC0 A;  1DZQ A;  3AKS A;  3DL3 A;  5FO7 B;  4B7E A;  4P02 B;  3HQR A;  2C26 A;  4A44 A;  2BER A;  4CP1 A;  2V73 A;  2VH9 A;  3H7J A;  2GC3 A;  5EZW A;  4BK5 A;  3D0S A;  3EXU A;  4JRA A;  5H9R A;  4TLF A;  4W65 A;  4XC9 A;  1AJK A;  2BP6 A;  3WW4 A;  4XTP A;  4S2D A;  5L19 A;  1UWW A;  1OUX A;  2XLG A;  1XU2 A;  1LUL A;  3PVO A;  4AQT A;  1B35 A;  1QJZ A;  1VBC 1;  2B8M A;  3GJA A;  4FXG B;  2GME A;  5A32 A;  2BZD A;  3QH6 A;  2BTV C;  4W8J A;  5FPA A;  1GQG A;  1KRI A;  1J1L A;  1GU3 A;  1EAH 1;  2QKD A;  3NQH A;  3PU8 A;  4GH4 B;  4BQ4 A;  2V4V A;  4FPE A;  1SZB A;  1AYM 2;  4QPW A;  3TNP B;  4A6O A;  2RMU 3;  5JI7 A;  4GWN A;  1YLL A;  2OXB A;  3J9S A;  1RYY A;  1WA4 A;  4BCU A;  4AQS A;  5FWE A;  1UAI A;  4U36 A;  2OYZ A;  2VPV A;  4KG8 A;  2JKX A;  1MS3 A;  4Z1V A;  1H2K A;  2P3K A;  3OOX A;  1FV3 A;  3OTF A;  2OPK A;  1HB1 A;  1CZV A;  2RDS A;  3FBM A;  4WM7 A;  1R08 2;  1SFN A;  1XQN A;  4OQ9 A;  1H1I A;  3PUH A;  3RZZ A;  2D6L X;  1K12 A;  4XUO A;  2BVV A;  4CDW B;  4Z07 A;  1CAW B;  5FOB B;  4RGA A;  4IDZ A;  2IXL A;  2CGN A;  1UMI A;  2B46 X;  2WR9 A;  3ZM8 A;  5FY7 A;  5D8A C;  1QEX A;  1R1Z A;  1GMM A;  3I3B A;  4LBL A;  2WLP A;  3GXU A;  5FPV A;  3BOD A;  4EZH A;  4N43 A;  3W59 A;  5JIA A;  1HKD A;  1NCR C;  1U12 A;  1ZX5 A;  3PJY A;  4FQZ A;  5IVF A;  1VMH A;  1S2K A;  2ZHN A;  3VKO A;  1ULF A;  4D94 A;  1Q8P A;  3VBS A;  4AED A;  3MFA A;  4XIK A;  3NAP B;  3RYP A;  1US2 A;  5KHK A;  5KR7 A;  4U2A A;  3CL1 A;  1OF4 A;  3CEW A;  4Y20 B;  5ANN A;  1XBF A;  4O65 A;  4GH4 C;  5JR2 A;  2ES3 A;  4NAM A;  3WDU A;  2X09 A;  5HCB A;  1HB4 A;  2QQM A;  4YNI A;  3KMH A;  4E4S A;  4MV2 A;  4YZ2 A;  1RUI 2;  2VY0 A;  1ZRF A;  2Y6K A;  3F95 A;  4AR2 A;  4D7S A;  4QHO A;  1U0A A;  4XF1 A;  5F5A A;  1FAT A;  4FBF A;  5C8C B;  3WVJ A;  1FMD 3;  4YYO A;  4COZ A;  4QXC A;  1AUY A;  2VZ1 A;  3S57 A;  2ORX A;  4Q4Y 2;  5L73 A;  4AF9 A;  4W6W A;  3W20 A;  4COY A;  5FJH A;  2WII B;  1ODM A;  1IKQ A;  3GF6 A;  1G8W A;  4Q0Q A;  4XOG A;  4LO7 A;  1G9F A;  1W8F A;  3LEG A;  2VL4 A;  2RS1 1;  3LDR A;  5A6Q A;  2HWD 3;  1H4H A;  3E5U A;  4JDM A;  4L11 A;  4NN0 A;  5SV8 A;  2Y6L A;  3AJZ A;  2QQI A;  2UY9 A;  1SDD B;  2R04 3;  2VZP A;  1O3T A;  4HK8 A;  5DN2 A;  2PAM A;  3KHC A;  1UL9 A;  2A6Z A;  1V6N A;  4M0N A;  1J84 A;  3ME2 A;  1KDM A;  1AL0 G;  2FQP A;  2B39 A;  4C1X A;  1XE8 A;  1XU1 A;  4BMB A;  2R07 1;  5CFC C;  4QKF A;  2VXR A;  2ZAH A;  2Y0O A;  2IXJ A;  3HNM A;  4QD2 A;  1BMV 2;  1GOF A;  4YZ5 A;  1LHU A;  2YRO A;  3K4Z A;  5EXO A;  4XVH A;  4UW5 A;  3SH4 A;  1F4H A;  1AL2 2;  1VBE 2;  4IGP A;  4COU A;  1HN1 A;  4OQ8 A;  3VKF C;  3U37 A;  4PT6 A;  3Q8E A;  2WA3 A;  3POB A;  1CX4 A;  4SBV A;  1QQP 3;  4HL0 A;  4QAW A;  4D3W A;  4BJ0 A;  3RDI A;  1FOD 2;  4KWU A;  1HDK A;  1Y9Q A;  4KU8 A;  3TB0 A;  3VBU A;  3ZSE A;  4B3N A;  3BU7 A;  1WA6 X;  4DXR A;  2RS1 2;  2DTY A;  1VBC 2;  1HLC A;  1ZNP A;  4ZS3 A;  3VKM A;  3ZDV A;  4GWJ A;  2XXZ A;  1J83 A;  4LIV A;  1W2A X;  1RUO A;  4ASK A;  5IAX A;  5DZE A;  3OD0 A;  1MAC A;  4X8N A;  3WF4 A;  4HFS A;  3MPP G;  3U1X A;  4D6R A;  5LCW L;  5HXM A;  3A23 A;  1SLT A;  2J1S A;  4GMP 0;  3LCP A;  1OMI A;  4XIO A;  2D6O X;  2F4L A;  2EAA A;  3NNF A;  5JMC A;  5CFC A;  1TME 1;  5BNO C;  3HQX A;  3AZY A;  3SKJ E;  4J25 A;  1VJ2 A;  3ILR A;  1QNW A;  3NMB A;  4PQ9 A;  1MZE A;  1O4Z A;  1VAM A;  3PUR A;  2JEM A;  1NX9 A;  3VZO A;  4MGZ E;  2IVI B;  4D6Q A;  2WYS A;  4E27 A;  1W2U A;  5JXJ A;  2JIC A;  4ATE A;  4YW4 A;  1QXJ A;  1YQ5 A;  5FKC A;  2XJR A;  4C1W A;  2N7G A;  4MGK E;  1NA1 A;  4CPB D;  1TMF 3;  2IC1 A;  2Y0I A;  1UPS A;  5GLZ A;  2KR2 A;  2YBS A;  3OBR A;  1CAU A;  4YZ3 A;  3WP6 A;  1C5H A;  2XJP A;  2JB4 A;  5JOX A;  2XUE A;  4L8Q A;  4G4F A;  1H1A A;  1FX5 A;  1GNH A;  1OKQ A;  1W6P A;  2GNM A;  1SLB A;  4FPC A;  2O14 A;  2WO2 A;  4EN8 B;  1IPJ A;  3H1W A;  2KXL A;  4Q4X 3;  5GLW A;  5C4W B;  1O3Q A;  3E6C C;  4EE2 A;  3M4F A;  1CAU B;  2J42 A;  2RM2 2;  3OBZ A;  2TNF A;  3Q8B A;  1NAE A;  1U5X A;  4PI2 A;  5D21 A;  3FUQ A;  4FTE A;  4AI1 A;  1SDW A;  4CP9 B;  5A6Y A;  2ZMN A;  3WF1 A;  2Z5W A;  1FV2 A;  2VZU A;  2VW0 A;  2X5I C;  3VBH B;  4F3J A;  1WW5 A;  1W99 A;  2ZGP A;  4F83 A;  1OPO A;  4QKN A;  5FZ0 A;  4XYX A;  4E8C A;  2VOV A;  3MUZ 1;  2VMD A;  3ZKY A;  1ASJ 2;  1X82 A;  3T2O A;  5CIS A;  5FPX A;  4IV3 A;  2HWE 3;  3UGF A;  2RS5 2;  4GH4 A;  4XJ8 A;  4AVC A;  2OUJ A;  2JDM A;  4HN1 A;  4XET A;  4LKF A;  2GN7 A;  4A42 A;  2QVS B;  2YV8 A;  5BNN C;  2HKX A;  2Q1Z B;  3TWI A;  2RJL A;  1C8M 1;  4AK3 A;  3VD4 A;  1YI7 A;  3JZV A;  4MAD A;  1J1T A;  1OI6 A;  1OLM A;  4R9C A;  3N35 A;  3P1I A;  4XFA A;  4YFZ A;  4Z82 A;  4Z2A A;  3SC7 X;  3KV9 A;  4Q0P A;  1O8P A;  4UI9 L;  1BBT 1;  1BZW A;  1SEF A;  2VZR A;  4FP2 A;  1I5Z A;  1DU3 D;  3ES4 A;  3K3O A;  4Y1X A;  4YW3 A;  3VBU B;  4QXK A;  1I6X A;  2LM3 A;  1CGP A;  3B01 A;  3H3U A;  4QX8 A;  1PGS A;  3MLL A;  4JTO A;  3ZXK A;  2AEY A;  1VBE 3;  4Q0V A;  5A3O A;  4A2U A;  1AHS A;  4DXT A;  1SG3 A;  3KCY A;  1R64 A;  4NO4 A;  1STM A;  2DVD A;  1W6O B;  2AEZ A;  3C3V A;  3L9J T;  4C0H A;  2RJK A;  1C57 A;  1V9U 1;  2C1F A;  1E5H A;  1A78 A;  3KHB A;  3KF5 A;  2ZKN A;  1ONA A;  3WW1 A;  1QMJ A;  1O3R A;  1GOG A;  3MW2 A;  1ZRD A;  3FWE A;  3K75 B;  1QU0 A;  3AL6 A;  3V0B A;  3M3O A;  5GAL A;  1DQ2 A;  1COV 3;  1H0B A;  3ZFF B;  2WSV A;  2J1U A;  3I3D A;  5DAX A;  4Q27 A;  4HSL A;  3J7L A;  2F4P A;  2QQU A;  2EIE A;  3VL9 A;  2V72 A;  1WCS A;  3I97 A;  4AHY A;  2GAU A;  2XVK A;  1OSG A;  3KQ4 B;  1ASJ 1;  3VDD B;  2X53 S;  4NIG A;  4FPL A;  1BQP A;  4CDQ B;  4Y22 B;  2J1A A;  3AKT A;  4QX2 A;  4CXW A;  2BNO A;  2JG8 A;  3GBG A;  4CU7 A;  1RJ7 A;  1FMD 2;  4R9B A;  3J8F 1;  5LBB A;  2VQU A;  4UFI A;  4CCL A;  5LA2 A;  3GGL A;  1D2S A;  1BYH A;  3PHM A;  4CSW A;  3S30 A;  1MVQ A;  2OW4 A;  2W52 A;  4FO9 A;  2G9Z A;  1LGB A;  3HIF A;  2QJV A;  4H3W A;  5IVB A;  1QJX 2;  4XFC A;  2R7E B;  2RM2 1;  4QHZ A;  1GV9 A;  1MZ6 A;  2R0F A;  4NPL A;  1NQD A;  1MS0 A;  2QQL A;  1ASJ 3;  2W1S A;  2HWF 2;  1PM7 A;  3R4U A;  3ZDS A;  4UOJ A;  4QPG B;  3ZPY A;  1UXX X;  1YJL A;  4YG6 A;  3AP6 A;  3TRS B;  3USU B;  1PNF A;  5CKQ A;  1IHM A;  1UX7 A;  4H14 A;  2B7Y A;  4CDW C;  1ZZ8 A;  5K8S A;  1TE1 B;  3I2H A;  4RD7 A;  2OUH A;  2UU8 A;  1UW8 A;  2D6K A;  1Z7S 3;  1F9K A;  3WLU A;  4EWE A;  1ZBA 1;  1IQD C;  1S0I A;  5GZF A;  1Y4W A;  1ST8 A;  4I0B A;  5DUV A;  1XXN A;  3MIC A;  1S1A A;  3FL7 A;  1NY7 1;  4EQV A;  3TN9 2;  2VCM A;  2FCV A;  2Q4S A;  1GNZ A;  1D4M 1;  2WAA A;  4PF5 A;  5F1R A;  1QH6 A;  4YVS B;  2W94 A;  1CZS A;  2B45 X;  2OZ6 A;  1SPP B;  2MPF A;  4LXL A;  5DAB A;  3EO6 A;  1VMF A;  1AX0 A;  3VHN A;  4YVW A;  3SCH A;  3RMY A;  3ZYG A;  3M1H A;  3VZN A;  4RL7 A;  1UZ0 A;  2P6H A;  4B1L A;  2XPJ A;  1JTZ X;  1PO1 2;  4JAA A;  4WZF A;  4P5H A;  1MQT C;  5IW0 A;  5GM0 A;  3UL2 A;  3OUJ A;  1WW4 A;  4CUG A;  5DDJ 3;  4M3C F;  5FZL A;  3B3Q E;  4AFB A;  2R07 3;  1K5M C;  1AYM 3;  4IE7 A;  4AFC A;  3LDK A;  3N9N A;  5LZ6 A;  1FOD 1;  3ZYP A;  3VBF B;  3O1O A;  2WC2 A;  2ZMK A;  1H9P A;  3MI8 A;  4BQ2 A;  3IM0 A;  4NRP A;  4BLJ A;  3MID A;  3FUO A;  4B29 A;  2VUA A;  1QXP A;  3UJO A;  5HBA A;  4YVW B;  1S0B A;  2BBA A;  4I02 A;  2IZW A;  3K48 A;  3ZFF A;  2YPD A;  1JZ2 A;  1RC6 A;  2WFF 1;  4JRL A;  3WT3 A;  2PLV 1;  4BM8 A;  4Q8K A;  3WSO A;  3WQ0 A;  5I91 A;  3D6E A;  2J22 A;  4BQY A;  2ZGN A;  1RJ8 A;  2WNU C;  4UFJ A;  1PM4 A;  4MXW B;  5KWR A;  3GCW A;  3H7Y A;  3QOP A;  4Q4V 2;  1LB2 A;  4EYU A;  4HKL A;  2X10 A;  1ZRR A;  2GNB A;  2ZML A;  4MYE A;  4B4P A;  1AL2 3;  2ZPX A;  4BME A;  3T1M A;  3U78 A;  2ZHM A;  4RHV 2;  5IT6 A;  5IVJ A;  2BVB A;  5KHI A;  4ZZ8 A;  3ZN4 A;  1ZA4 A;  3FHA A;  4FPJ A;  5EFU A;  4BDV B;  4KNC A;  2YPJ A;  1DQ6 A;  2VVD A;  3MIF A;  1LR5 A;  2VG9 A;  2VO5 A;  4GB3 1;  5IVY A;  3T0A A;  2DCJ A;  1PO2 3;  1NUK A;  3CIH A;  4KH9 A;  3ACG A;  4NWW A;  4XFI A;  4I2O A;  3I2J A;  4JX0 A;  3H8U A;  3P3N A;  3DXU A;  3NNL A;  4QU1 A;  1O91 A;  1WBL A;  4RHV 3;  3T4H B;  2F17 A;  5GZD A;  4HET A;  2GP5 A;  1H8V A;  4HK9 A;  4E8D A;  1L7L A;  4Q1R A;  3OEA A;  1HRI 2;  3DKW A;  5E88 A;  3H8R A;  4Q4V 3;  4AI8 A;  2ZCW A;  3ITQ A;  4EV0 A;  3UNP A;  4E2Q A;  4JCK A;  1OQ1 A;  1YHF A;  4Q8L A;  2Y6F A;  1JOP A;  5C3O A;  1YFY A;  4Y5Z 0;  2RR1 3;  4S2H A;  5LEJ A;  1I3H A;  1LOF C;  2HWB 1;  3IDE A;  3POW A;  2Q5T A;  3JUU A;  3VKL A;  4FP3 A;  4RHV 1;  3VZK A;  3LA2 A;  4HT1 T;  1NLQ A;  3HMY A;  3C7E A;  3QAC A;  3RJ2 X;  2R6Q A;  2UYB A;  5FYB A;  1IG0 A;  3J7M A;  1Y9G A;  4Y1V A;  3W9A A;  1GNY A;  3AZZ A;  2GND A;  4R52 A;  4XQD A;  5L9R A;  1RUJ 2;  3QBQ A;  4CEY A;  5T3N A;  4NPM A;  3H42 B;  5A6Z A;  3LEI A;  4B4R A;  4TZD A;  4EZ4 A;  1OVP A;  3GDB A;  5KHH A;  5JIU A;  5DDJ 2;  4QT6 A;  1K5J A;  3VN4 A;  3DPR C;  4CYD A;  2HWE 1;  3RMX A;  5KC6 A;  2E32 A;  3FHQ A;  2D93 A;  1OD5 A;  3H3L A;  5FR3 A;  2Y6H A;  2PAK A;  2ZEY A;  4ZY9 A;  3U07 A;  4A45 A;  1PVC 2;  5AFE A;  5I8S A;  4IEW A;  2Y38 A;  5A7N A;  3WNX A;  1ND2 B;  3NWK A;  4I3P A;  1QHD A;  2DCZ A;  2B4K A;  2GSY A;  4K20 A;  2PHF A;  1SCR A;  3WCR A;  1B35 B;  1W9Y A;  4ISR A;  1RUD 1;  1SHW B;  5BY5 A;  5A3L A;  1RUC 2;  3WDT A;  2W39 A;  2WRA A;  3NL1 A;  1QY4 A;  3U10 A;  2EXI A;  5TSW A;  3TN9 3;  5FFO C;  1ZBE 2;  4JQT A;  5J09 A;  1RMU 3;  1RMU 2;  5FZD A;  3H3Z A;  3OGV A;  4N9I A;  2VMC A;  1ZBE 1;  1NCR B;  1PHM A;  3C7G A;  3PMS A;  5FYS A;  5L9B A;  4PBP A;  4L9B A;  4AXO A;  4AEJ A;  4NWV A;  4XF9 A;  3HD8 B;  2YMZ A;  1CWP A;  3LA7 A;  5F39 A;  5FMD A;  4COW A;  4NRQ A;  3KB5 A;  1UMH A;  4DRR A;  3HVD A;  4HON A;  1K42 A;  1ZZ9 A;  4WBB A;  1KDK A;  5KBF A;  4LE3 A;  3FC0 A;  3WHU A;  2W9X A;  4BK4 A;  3LPF A;  1R09 1;  3LD8 A;  2NQY A;  1K3I A;  1V6O A;  1WW6 A;  1BBT 3;  1W6M A;  4HN0 A;  4A4A A;  3OGG A;  1IS3 A;  4X6R B;  1BKZ A;  2ARX A;  2P3J A;  1IS5 A;  1QJX 3;  2P34 A;  3IDB B;  4MH0 E;  3M7A A;  1RUJ 3;  2OQ6 A;  4QHB A;  2ZGQ A;  5FYZ A;  4IEX A;  1LHO A;  5C3P A;  2ARE A;  1PO2 1;  2YC0 A;  5GZC A;  2RV9 A;  4GB3 3;  4Y4R A;  3VZM A;  1N1T A;  1DQ1 A;  2XON A;  2IFW A;  4LUM A;  2DYC A;  3N9P A;  4XUR A;  4DZG A;  1D4M 2;  2W91 A;  3IPV A;  1E5S A;  3ETP A;  4PLO A;  1QXR A;  4J1X A;  4QKD A;  4OFG A;  4YG3 A;  1WCU A;  4QM9 A;  3GZU C;  2RR1 2;  1QJX 1;  5FLI A;  2LUW A;  3AL5 A;  1NCQ C;  4AVT A;  3UKV A;  5T5O A;  3QH7 A;  3PTR B;  4W6Y A;  2VOK A;  4Q5O A;  3N7K A;  4GUL A;  1HRI 3;  1QJU 2;  4N53 A;  1COV 2;  2E6V A;  2VW1 A;  4Y24 A;  3PUS A;  1BEV 1;  1O6U A;  2PN5 A;  2QDN A;  4FPK A;  1VPH A;  4LLO A;  1VIW B;  3UT0 A;  3RZL A;  2Z4F A;  4NPR A;  3ZFE B;  4D7Y A;  4WV8 A;  5CFC B;  1DGW A;  2F6B A;  3RYR A;  4Z8B A;  5I0D A;  3POG A;  1JZ4 A;  4LUK A;  5ANQ A;  1QKQ A;  3MF9 A;  4OMD A;  4C91 A;  1SMV A;  1YNA A;  4MOA A;  2A3X A;  2XL9 A;  2GMP A;  3KGZ A;  3OBA A;  5EWS A;  3M3Q A;  3ZFE C;  4XF4 A;  1VP6 A;  3AX4 A;  2BNN A;  2O1Q A;  2B42 B;  5BNQ A;  3MV0 1;  3O1V A;  1O8S A;  5EPA A;  5T52 A;  2ZX3 A;  4Q1P A;  1UIK A;  5A3W A;  4YGD A;  5F3G A;  1GZW B;  3SEE A;  3EJK A;  3C7F A;  3ZR5 A;  3T0D A;  1UF2 C;  2VBP A;  1TNF A;  2JG8 C;  4UW4 A;  4L97 A;  1DP0 A;  1GP4 A;  1MZF A;  2WA4 A;  5FYC A;  2ZEZ A;  1UU6 A;  4BLI A;  5CEH A;  1IQA A;  1WLW A;  3CJX A;  2W68 A;  1UZV A;  3NVC A;  2XOM A;  2DCT A;  1W2N A;  2WQZ C;  1MEC 1;  1OFN A;  1C3H A;  1RIN A;  1TNR A;  1W9W A;  1CAV A;  4Y26 A;  2VAU A;  5CB7 A;  3DCQ A;  3OYW B;  2EF6 A;  4V2W A;  3NV1 A;  1C4R A;  1R08 1;  2V4A A;  1VRH 2;  1RUF 2;  4IEZ A;  5FK8 A;  5FZI A;  1S0E A;  3BB6 A;  5C8W A;  5DUU A;  1ULD A;  2VNG A;  1ZVF A;  2CV6 A;  2IUW A;  2ZX4 A;  4UF0 B;  3S6P A;  4AFM A;  3OY8 B;  2GC1 A;  3ALQ A;  4QB6 A;  2AZ5 A;  1UU4 A;  4R9A A;  1VBA 1;  1RTV A;  1JYT A;  2V5Y A;  1Z7S 1;  1BVV A;  1PO1 3;  5JOZ A;  1LEN A;  1YUD A;  1CN1 A;  1IG3 A;  1O5L A;  4M0H A;  4ZXK A;  4EWA A;  1YFW A;  3CZJ A;  3POY A;  1HX6 A;  1H8T A;  2V5D A;  4UBH A;  2Y6G A;  3ACI A;  4Q4X 2;  2Z2S B;  5IWF A;  3B9I A;  4CCK A;  3JD7 2;  4Y5S A;  3GZT B;  5C71 A;  1JZ7 A;  2HBT A;  1JHJ A;  2CL2 A;  1VBD 2;  2D3R A;  4R8H A;  4AW7 A;  2PAE A;  1KGY A;  2XQR A;  2JDK A;  3O14 A;  1U5I A;  4LKE A;  3LE0 A;  3O1P A;  3JBG 3;  1O3S A;  1C8M 2;  1UYZ A;  3MLJ A;  1ENS A;  2ZKL A;  2W92 A;  5F6L B;  1APN A;  3THC A;  3VV1 A;  4LA3 A;  1AR6 2;  4OUL A;  1VBB 1;  4CDU A;  4D7T A;  4GMP 1;  5FZ4 A;  1PZ8 A;  2I74 A;  3CQO A;  2WZR 3;  1AR8 2;  1W2T A;  3KF3 A;  5C3Q A;  2A6Y A;  5A7Q A;  3FX3 A;  2BPA 2;  2VCC A;  5J3U A;  3WF0 A;  1WUV A;  4KBZ A;  1WD3 A;  1NZC A;  4E4D X;  2QQO A;  1LHN A;  3F2Z A;  3A7Q A;  1COV 1;  4AWD A;  1O4Y A;  2R06 2;  1TG7 A;  3RWN A;  4GIQ A;  2ADE A;  4GWM A;  5FYU A;  4AHZ A;  3K51 A;  3NAP A;  1P8J A;  3WNO A;  3RFR A; 
#chains in the Genus database with same CATH homology
 3VDC A;  2WYS A;  5JXJ A;  3VDB A;  4JKM A;  3MBW A;  1K45 A;  4PF1 A;  2WO3 A;  4QB1 A;  3IB3 A;  2WO2 A;  2J1T A;  5JUV A;  1O59 A;  3ABZ A;  4QB2 A;  3WQB A;  1JZ5 A;  1OD3 A;  1T2X A;  3BGA A;  5EJ1 B;  1NAE A;  5JMO A;  3I2K A;  1XNA A;  4IUG A;  1UYY A;  3FN9 A;  3WF1 A;  2VZU A;  1W99 A;  3NJV A;  4MO3 M;  4E8C A;  3ACF A;  3MUZ 1;  2VMD A;  2W1W A;  3I2I A;  2VC9 A;  4PQQ A;  2DCK A;  3T2O A;  2YG0 A;  4DUW A;  4QDR A;  3WNM A;  3W5M A;  1H6X A;  4A42 A;  2W95 A;  4CU8 A;  3OGS A;  4JHZ A;  4P00 B;  1KEX A;  4DXS A;  5HPO A;  2W5F A;  3VD4 A;  2J1E A;  4MAD A;  3P1I A;  4Z2A A;  1MPX A;  5F7U A;  3P6B A;  4GZ9 A;  3T09 A;  4ET7 A;  4UI9 L;  1O8P A;  1NKG A;  3ECQ A;  2VZR A;  2VJX A;  1W9T A;  1H6Y A;  5CYY A;  3HN3 A;  5G04 L;  4DXT A;  3THD A;  1SG3 A;  1R64 A;  2RVA A;  1W8O A;  5EIY B;  3VD5 A;  1DYO A;  1WCQ A;  4QX0 A;  3EB7 A;  1JU4 A;  2WAO A;  3UET A;  1I5P A;  2E31 A;  3NRU A;  1GOG A;  1DLC A;  2L9L A;  3K75 B;  4JKK A;  2W87 A;  2EIC A;  1WKY A;  2ZXQ A;  2J1U A;  3I3D A;  3CMG A;  2Y64 A;  2C4X A;  2J1V A;  2EIE A;  3III A;  2V72 A;  3I97 A;  5LA0 A;  1JZ3 A;  2J1A A;  4QX2 A;  1UY2 A;  3PUI A;  2VZT A;  4CU7 A;  3W5N A;  2VQU A;  5B4N A;  5LA2 A;  3GGL A;  3DYO A;  2ZEW A;  2WN2 A;  4XUP A;  2R7E B;  1UYX A;  1PMH X;  2QQL A;  2W1S A;  4XUN A;  3K4A A;  4QX3 A;  3SKV A;  4M4R A;  4MGQ A;  4UOJ A;  2EID A;  3CKH A;  4M4P A;  1UXX X;  2HYX A;  2WZ8 A;  1OF3 A;  2W46 A;  4LKS A;  4CVU A;  1UX7 A;  4AAX A;  3HEI A;  4W50 A;  3NNG A;  4W4Z A;  2J7M A;  2YFZ A;  3I2H A;  5C70 A;  2VM9 A;  2VZ3 A;  4DEQ A;  4P5Y A;  1IQD C;  2RJ2 A;  4L0P A;  3LEK A;  1US3 A;  1JYW A;  3FL7 A;  3IDA A;  3K77 A;  2WAA A;  2J1R A;  2W94 A;  1CZS A;  2QQK A;  3WEZ A;  4A41 A;  3C7H A;  5DPN A;  1JZ6 A;  1UZ0 A;  5EJZ B;  1JYV A;  1BHG A;  1GUI A;  2VME A;  2JD9 A;  4GWI A;  4CUB A;  2CDO A;  2QQN A;  2VOT A;  3K4D A;  3WNP A;  1OT5 A;  4XUT A;  3A21 A;  2Y6J A;  2YC2 A;  2WZE A;  2BBA A;  2ORZ A;  1JZ2 A;  1UXZ A;  1CX1 A;  3OEB A;  4BXS V;  3WSO A;  2LW8 A;  2J22 A;  2VZQ A;  4ARY A;  4TXW A;  2W47 A;  2VCA A;  2VZS A;  4LHS A;  4KI5 M;  2X10 A;  4ZZ5 A;  4TTG A;  5IYY A;  1NX9 A;  1UY3 A;  4ZZ8 A;  3FHA A;  4MGS A;  2VZO A;  3CDZ B;  4BDV B;  3DYP A;  1CZT A;  2VO5 A;  3T0A A;  2DCJ A;  3LPG A;  1NUK A;  3CIH A;  4D8M A;  3ACG A;  2JE8 A;  3I2J A;  1PMJ X;  4P08 A;  4JX0 A;  4OZO A;  2BGP A;  4D0Q A;  1L7Q A;  5FUI A;  2X05 A;  1EUU A;  3C7O A;  3T2Q A;  2VTF A;  2YB7 A;  2XHN A;  4E8D A;  2VMF A;  5IJR A;  3OEA A;  3UNP A;  3WNL A;  2LS6 A;  3LQC A;  1W8N A;  1F4A A;  2ZEX A;  4OYU A;  3I2G A;  5B4X A;  1LNS A;  2WUH A;  3EYP A;  3NJX A;  3K46 A;  3MV1 1;  4LPL A;  2WDB A;  3VD9 A;  2XQX A;  3WF2 A;  5IFT A;  3C7E A;  3MUY 1;  2BGO A;  5IHR A;  1GNY A;  5IFP A;  1PX4 A;  2VCB A;  3LEI A;  3BN6 A;  3GDB A;  1XNT A;  2PQS A;  5CZK A;  5G05 L;  3HOB A;  5JXG A;  2E32 A;  3FHQ A;  5LA1 A;  4XZU G;  2Y6H A;  2ZEY A;  1TVG A;  4ZY9 A;  3D3A A;  4A45 A;  4DEV A;  5A1A A;  1EUT A;  1ULO A;  2YFU A;  5DQ0 A;  4P02 B;  2B4K A;  2C26 A;  4A44 A;  2BER A;  3E1F 1;  3WNN A;  4BK5 A;  1SHW B;  4QDQ A;  2Y8K A;  3OB8 A;  1UWW A;  3OGV A;  2WN3 A;  2VMC A;  3C7G A;  4JKL A;  4OUE A;  1XPW A;  3WF3 A;  4XUQ A;  1GQP A;  3HJR A;  2BZD A;  3VDA A;  1D7P M;  4QDS A;  4W8J A;  1K42 A;  1UMH A;  1GOH A;  1GU3 A;  2YC4 A;  3NQH A;  4KMQ A;  5J1X A;  2V4V A;  1UY4 A;  2VQT A;  3OGR A;  4QPW A;  2W9X A;  4ZXE A;  4A6O A;  4BK4 A;  3LPF A;  1K3I A;  1RYY A;  4A4A A;  4YPJ A;  3HNY M;  4OMC A;  2JKX A;  5C7G A;  1CIY A;  3GM8 A;  3J7H A;  2RV9 A;  1CZV A;  4XUR A;  2XON A;  2B9V A;  2W91 A;  3PUH A;  1K12 A;  4XUO A;  1PX3 A;  3ETP A;  1W0N A;  3MO4 A;  1W9S A;  4FI9 A;  3IAQ A;  4CUC A;  1UMI A;  3ZM8 A;  5JXH A;  2JDA A;  2E26 A;  3VD3 A;  1GMM A;  3I3B A;  3AC0 A;  3GXU A;  3ACH A;  4RYD A;  1ULP A;  2HLE A;  5DMY A;  3T08 A;  2W3J A;  3JXS A;  1US2 A;  1OF4 A;  2Z4F A;  3VD7 A;  5JR2 A;  5I0D A;  3UES A;  2X09 A;  1JZ4 A;  1JI6 A;  2QQM A;  4OMD A;  3WNK A;  4MOA A;  2E33 A;  4CU6 A;  3OBA A;  1JU3 A;  2Y6K A;  2EIB A;  2OKX A;  3DYM A;  2W1U A;  3MV0 1;  4QX1 A;  4CUA A;  1O8S A;  2VZ1 A;  2ORX A;  3OG2 A;  3CZU A;  3SEE A;  3C7F A;  3T0D A;  3I3E A;  2W1Q A;  2C9K A;  3LEG A;  4DUX A;  2VL4 A;  1DP0 A;  2ZEZ A;  2KD7 A;  2XOM A;  2Y6L A;  3C8X A;  2QQI A;  2VZP A;  1SDD B;  1W9W A;  1UY0 A;  2VZV A;  5DN2 A;  4CU9 A;  2WO1 A;  3I2F A;  3IAP A;  1XC6 A;  1UY1 A;  1J84 A;  4AG4 A;  1YQ2 A;  1OH4 A;  3HNB M;  1JYN A;  3HNM A;  2CDP A;  4QB6 A;  1GOF A;  3K4Z A;  4XVH A;  1F4H A;  3T2P A;  4DUV A;  1HN1 A;  3U37 A;  4PT6 A;  3CZJ A;  2V5D A;  2Y6G A;  3ACI A;  4QAW A;  4BJ0 A;  4KWU A;  1JZ8 A;  5C71 A;  1JZ7 A;  1JHJ A;  4A3Z A;  4DXR A;  1KGY A;  4GWJ A;  3LE0 A;  1J83 A;  4HG6 B;  1JYX A;  1UYZ A;  3THC A;  2W92 A;  3WF4 A;  4ARX A;  2WBK A;  5LCW L;  4RN5 A;  3CQO A;  5HXM A;  4LQR A;  3A23 A;  2J1S A;  2WAB A;  3T0B A;  4UAP A;  2WQ8 A;  2QQJ A;  2VCC A;  3WF0 A;  2VR4 A;  3SEP A;  2QQO A;  3F2Z A;  3A22 A;  3A7Q A;  5JXI A;  3SKJ E;  1TG7 A;  2QBX A;  2DDU A;  1L7R A;  1P8J A;  3DEC A;  3WNO A;  3HPN A;  2ID4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...