2Y6KA

Xylotetraose bound to x-2 engineered mutated cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
LVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSLDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XYLANASE
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
total genus 43
structure length 165
sequence length 165
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y6kA00
5JXIA 1HN1A 1SG3A 1SHWB 4RYDA 3NJVA 3HJRA 2OKXA 3WF2A 3EB7A 3CDZB 2VMCA 1K42A 2BGPA 5JXGA 3BGAA 3K4DA 1W8NA 2WZEA 2VCCA 2J1RA 1DYOA 1UY1A 1JU3A 4YPJA 4DXSA 3T08A 4IUGA 4OMCA 2W46A 2BGOA 2VL4A 3ACIA 2ID4A 1J84A 3CZJA 4L0PA 1GNYA 3IAPA 2QQIA 1W99A 1ULPA 1JYWA 3VDBA 3ACFA 2Y6KA 2XOMA 3D3AA 2ZEZA 1F4AA 2J1SA 1UYYA 1XPWA 4W50A 3MO4A 5DN2A 3VDCA 3E1F1 1UMHA 4P5YA 3CIHA 3OBAA 5HXMA 1XNTA 4OMDA 5IYYA 4BDVB 1IQDC 2CDOA 3I2FA 3HNMA 5CYYA 5JMOA 1JZ8A 3K75B 2ZEYA 3NRUA 4KWUA 1NAEA 4M4PA 1O59A 2BZDA 1UY4A 3A21A 4XUOA 4DUVA 3WSOA 4LHSA 4ET7A 3AC0A 3WF4A 4QDRA 4CU6A 3HOBA 2WO2A 1NKGA 1JZ5A 2X09A 1UY2A 3HNYM 4QX0A 2QQLA 3LEIA 4QX3A 3WNPA 2C4XA 4BJ0A 2QQJA 4JHZA 1UWWA 2KD7A 4ZY9A 4MOAA 3CMGA 4PT6A 4UAPA 1JHJA 3W5NA 1JU4A 1GMMA 3I3EA 4MGQA 4MGSA 1PMHX 1JZ3A 1L7QA 3WNMA 1O8SA 2VC9A 3I3DA 1TG7A 1ULOA 2W1WA 3C8XA 3HEIA 3A23A 3U37A 4OZOA 3THCA 3W5MA 3ETPA 1UYZA 1JZ7A 2Y6LA 1UZ0A 1W9WA 1XC6A 1NUKA 2EICA 3ACHA 3C7OA 3K4AA 3NNGA 5EJZB 2VR4A 1MPXA 1H6XA 2J22A 2DCJA 3OGSA 2QQNA 1CZTA 2VJXA 2VZ1A 2YFZA 5DMYA 1CX1A 3MUZ1 1PX3A 1US3A 1JZ6A 2J7MA 3LQCA 2YB7A 3CQOA 2W9XA 2QQOA 4CU8A 3IDAA 4HG6B 4TXWA 3OG2A 2W94A 3WQBA 2E32A 4GWJA 2XONA 4E8DA 1OF4A 4A45A 4JKMA 1GOFA 2VMEA 2V4VA 2W5FA 2YFUA 1PX4A 5LCWL 4LKSA 3A22A 3OGRA 4CUCA 5JXHA 4CVUA 3I2IA 3K77A 3T2OA 4XUTA 3T0DA 4QB2A 3SEPA 5B4XA 2VO5A 2VZ3A 4GZ9A 3FHAA 4OYUA 4XUQA 4ZZ8A 3LE0A 4QX1A 2E26A 1SDDB 3EYPA 5CZKA 3CKHA 1JZ4A 2JDAA 1P8JA 3ABZA 3NJXA 4PF1A 2E33A 1GOHA 4AG4A 4OUEA 4D8MA 2JD9A 4E8CA 2Z4FA 1W8OA 2ZEWA 3DYPA 2VQUA 2JE8A 2WBKA 1L7RA 5G04L 2J1EA 1JYNA 4JX0A 2VZOA 2WO1A 4BXSV 2WAAA 1O8PA 3SKJE 4QAWA 3T09A 4QDQA 4P08A 1WCQA 4GWIA 2BERA 3WNKA 3SKVA 4MO3M 2E31A 5B4NA 5C70A 3SEEA 2Y6JA 3OB8A 5IHRA 4A3ZA 2WDBA 5JR2A 3MV11 2JKXA 1KGYA 1GU3A 2RJ2A 3WF3A 5C71A 2J1TA 1W9TA 4A41A 4DUXA 2YC2A 5IFTA 3I2JA 2CDPA 2VCBA 3IIIA 2ZXQA 5EJ1B 4LQRA 2VMFA 3VDAA 4XUNA 3HPNA 5LA0A 3ZM8A 1NX9A 2WO3A 1K3IA 4AAXA 3MUY1 2J1UA 3JXSA 2QQMA 1OT5A 2W91A 2ORZA 2BBAA 3IAQA 1H6YA 3THDA 4ZZ5A 3MV01 2B4KA 1UMIA 1KEXA 1BHGA 4ZXEA 3VD9A 2C9KA 2J1VA 1US2A 3LPFA 2VM9A 2EIBA 3UNPA 2QBXA 3CZUA 3OGVA 1TVGA 2WYSA 4A42A 2HLEA 3C7HA 4QX2A 1GUIA 1LNSA 4MADA 2VZPA 2V72A 3K46A 3ACGA 1JZ2A 2Y6HA 3T0AA 2PQSA 3T0BA 2Y8KA 3FL7A 2ZEXA 3WNNA 1F4HA 4A44A 2QQKA 5DPNA 3LEGA 3LPGA 4XZUG 3UETA 5G05L 3FHQA 4TTGA 1UYXA 4DUWA 4XURA 3HN3A 3A7QA 1OD3A 3J7HA 2WUHA 2VZVA 1W9SA 4BK5A 2W1UA 3GGLA 4CUAA 5LA1A 3WF0A 2L9LA 5A1AA 1JI6A 2RVAA 2VZTA 3I3BA 4QB1A 1RYYA 2WAOA 3OEBA 4A4AA 3C7EA 1CZVA 2VMDA 2W87A 1K12A 2VZQA 2Y64A 4PQQA 2WZ8A 3F2ZA 3PUHA 3GXUA 3I2GA 4A6OA 3C7GA 3PUIA 3I97A 3MBWA 2X05A 1R64A 3DYMA 3IB3A 5HPOA 4XUPA 2DCKA 3DECA 3WNOA 1PMJX 3K4ZA 2WQ8A 5C7GA 5F7UA 3VD4A 3LEKA 2LS6A 4P00B 2W95A 4UI9L 4CU7A 2W47A 3T2PA 1JYVA 1I5PA 1DLCA 1OH4A 4LPLA 5JUVA 4P02B 2R7EB 3VD5A 2WN3A 2VZUA 4QPWA 2VTFA 2VCAA 2YC4A 3WNLA 3GDBA 2EIEA 2WN2A 4KMQA 4DXRA 3WF1A 4Z2AA 1JYXA 2HYXA 3GM8A 4DEQA 1UY3A 1W0NA 3I2HA 5IFPA 2EIDA 4XVHA 3P1IA 4W4ZA 2WABA 4ARXA 5J1XA 1GOGA 5FUIA 4CUBA 2B9VA 4JKKA 1DP0A 3I2KA 2V5DA 2VQTA 5EIYB 1YQ2A 2ORXA 4CU9A 4KI5M 3VD7A 1GQPA 1EUTA 1UY0A 4UOJA 4FI9A 1OF3A 4QB6A 3DYOA 1CZSA 2XQXA 3P6BA 5JXJA 2LW8A 3C7FA 5DQ0A 4DEVA 2W1SA 2VZRA 3T2QA 2W92A 1UXXX 3VD3A 3OEAA 2DDUA 3FN9A 2VOTA 1J83A 1EUUA 1K45A 2X10A 2W3JA 1UXZA 2C26A 4W8JA 1WKYA 4BK4A 1UX7A 2RV9A 2XHNA 4JKLA 3BN6A 4DXTA 1XNAA 3ECQA 1CIYA 4QDSA 3NQHA 5LA2A 3HNBM 4M4RA 1D7PM 3WEZA 4ARYA 5I0DA 5IJRA 3UESA 2VZSA 2YG0A 4D0QA 2Y6GA 2J1AA 1T2XA 2W1QA 4RN5A
chains in the Genus database with same CATH superfamily
3RQ0A 1PM4A 1G9DA 1QOSA 1S55A 4AOCA 4D7SA 3VL8A 5JOZA 4RYDA 5T5JA 1ULFA 5FPLA 5F2WA 1IPSA 4DMIA 2RHPA 4Y1UA 3WF2A 3CDZB 3N9LA 1L3JA 3RI8A 4Q1PA 3ZXEA 3IIAA 2G9ZA 1H9PA 2P6CA 3DN7A 3VKLA 2RDNA 3SCFA 5K0UA 2HWF1 3EMRA 4YPJA 4DXSA 4GMP3 1DQ5A 5CU1A 5FLIA 5A32B 3ZFGA 2NYYA 2ZGMA 1A6CA 5HV4A 1VE0A 4FAGA 3POJA 1GZCA 2FDGA 3U10A 4AQSA 2XWBB 1MR5A 2KM2A 4S2FA 2W2IA 2XJSA 3JCIA 1V70A 2JDKA 1SLLA 5T52A 4XJWA 5FZCA 4CDWB 1ASJ1 3AMMA 2F4LA 4BOWA 2R0FA 4F3JA 4OI0A 4NRQA 4YM0A 5EXOA 3NSTA 4XJAA 3IDEA 1IG0A 2VNOA 3POSA 4QPIB 4FOQA 1W90A 1VRBA 3AKTA 2GP3A 1FNYA 1BZWA 2P3JA 1I3HA 1V6KA 3CU7A 1GKBA 4LHNA 3WDXA 2EXJA 1RUI3 1S0IA 4N43A 4XXPA 3J26N 5FYBA 5HCFA 2ZHKA 5SV5A 4AFBA 5A3NA 5C8CA 5FPBA 4NRMA 2J1SA 5A7OA 2DTWA 1XPWA 5AVPA 1AX1A 3ZFEB 3MDPA 5FZMA 4CZSA 2CHHA 1SPPB 5E8AA 4P5YA 4H2AA 4MXWA 2A3WA 4QGLA 3UGHA 1VBC1 1W8ZA 5IYYA 3LOBA 4PHZA 1A3KA 4J6GA 4CXWA 4LBLA 2XBO2 3FFZA 3I49A 4W6XA 1BEV2 3LIHA 2CDOA 3ZPOA 5BNNC 5CYYA 1O3SA 1ENRA 1JZ8A 3K75B 3QBQA 4KWUA 5FYUA 4XF4A 4M4PA 1OSGA 2BZDA 4Q4V3 4HZFA 4LXLA 5AVAA 4UW6A 3WD5A 4FPCA 3BCWA 3HVDA 4KU7A 4LHSA 3ZIXA 1Z78A 5IVVA 2BNNA 3AC0A 4B1LA 4CU6A 3HOBA 4QGNA 3U4SA 1B35C 5GZCA 5JOYA 4NR1A 3KGLA 4MYEA 2GH2A 1POV0 4PIXA 4K20A 4RS5B 2CY6A 4EN8B 3HNYM 1TNRA 1YQ8A 1RUD2 3LEIA 5C3QA 4XDQA 2VXJA 1RUF3 2C4XA 3RGBA 2QJVA 2RMU2 5FZEA 4DZGA 1XNDA 4ZY9A 1PIV2 1REDA 5IVFA 3LFMA 4TN7A 4UWDA 1FPN1 3CMGA 2XLAA 3RZZA 4YW2A 3FZ3A 1U5YA 1H4HA 1HKDA 3NJZA 3Q8CA 4PDWC 1SBDA 2DBIA 2PYTA 1PVC2 1JU4A 3DKQA 4C8DA 3BU0A 3OBZA 3I3EA 2CGPA 3NV3A 4MHUA 1DG6A 1REEA 4RR3B 2R073 2BFUS 4QU2A 5AFEA 2ZGRA 3WNMA 1LAJA 1O8SA 1MEC1 1RXFA 1OKQA 3I3DA 1TZOA 3ZXFA 4H14A 1AYN3 1ZRFA 2JE9A 3I8TA 3M8LA 2GAUA 4N7IA 4LBJA 4ZPIA 1LOEA 4BQXA 2AEZA 2DCTA 3HEIA 4QX8A 2Z69A 4CCKA 3THCA 3ZFFA 1UYZA 5FYTA 1EPWA 2QFEA 3P5BA 1GQHA 4Y5Z0 1QU0A 2Y6LA 1ND2C 1W2UA 2NZ9A 1W9WA 1XC6A 1NUKA 1F5JA 2EICA 1FXZA 2UU8A 3AP6A 2D3PA 2ARXA 3C7OA 1X33A 2JG8A 3K4AA 2VR4A 3WQ7A 4Z1VA 4P9YA 3BKZA 5F3IA 2WNVC 5KHJA 1SACA 2ZS6B 3OGSA 4IEQA 4IE7A 4BM8A 1KITA 1EP0A 4MHRA 3WXPA 3DF0A 2HWE3 2JB8A 1F35A 3HQXA 4JGYC 4GH4A 1LOAA 4PLOA 5A80A 3AP7A 1JZ6A 3A4UA 1PO21 3LQCA 3SITA 5GKAC 4BQWA 1H8TC 2HEVF 3VZJA 5DAPA 5FMDA 1FV2A 2W94A 5EP9A 3B3QE 4IE6A 3TN93 1AJKA 1UL9A 4GWJA 4AEMA 5JDBA 2ZX2A 3GBFA 2YGMA 4AR2A 1OA4A 3MW2A 3BPZA 4K21A 5CB7A 4IV3B 3AZVA 2I74A 2MEV2 2RS52 4PF5A 4UFMA 4B4RA 4YZ1A 3I59B 3OYWB 3O1SA 2V4VA 1ZZ9A 1PX4A 3ZYPA 4FPEA 5CFCA 3T2OA 1RUG3 2RS33 1WGPA 4XUTA 3T0DA 2A71A 4QKNA 2E6VA 1BKZA 4N53C 2DV9A 2VZ3A 4NRPA 1NQJA 3VBOC 3LA7A 1UCXA 4FPKA 1WBLA 2ES3A 1A78A 4XUQA 5C5UA 4FP2A 3B69A 2E26A 4EWAA 4LO4B 3NAPA 2VD7A 1SDDB 4OI1A 1PGW1 1JZ4A 5T5PA 4HSLA 3POEA 4AGRA 3WP5A 3H50A 4YVSB 4B1MA 4H55A 1X50A 4PF1A 4AG4A 2AGSA 2FZ2A 3B01A 3WX5A 2GC3A 2QDRA 2JD9A 2IXIA 2XJVA 1W04A 2Z4FA 2ZEWA 4AEKA 2FCTA 4O7XA 3ZXAC 2CTVA 1QXPA 5C33A 2VVDA 2HWF3 4PQ9A 5G04L 3JQXA 5J36A 4XFCA 3RVHA 2BGCA 5L9BA 5L9RA 1CAUB 3DXUA 3KSCA 5JIAA 1CAVB 2GC2A 3SKJE 3VBRB 1ODMA 1YXWA 4U2AA 2PXJA 4NN0A 2ADDA 3ILNA 1C1FA 1ZRCA 4AGVA 4M3CE 4MH0E 4FP3A 5I0UA 4XJ9A 1RUNA 4MX3A 4GMP0 3WW4A 1NYWA 4LEJA 4LO7A 1ASJ3 4LKFA 4P08A 1ONAA 1PNGA 3QH6A 2WYFA 4GWIA 4YG3A 3LWCA 3BU7A 2ETEA 1C8M3 3KF5A 3SKVA 2GC1A 4KGQA 3PIGA 1RUI2 3S7EA 3ZN5A 4LUKA 4F8AA 3JQWA 5FPXA 1D4VB 1TQ5A 4A3ZA 1U5IA 5E1RA 1CAXA 4JHTA 3FC0A 4G4FA 2JKXA 1KGYA 1AXYA 3VZLA 4D6SA 4Z8BA 5FWJA 3WF3A 1LGCA 2JJ6A 1IOAA 1CWPA 5A6QA 4R4ZA 3NV2A 5IFTA 2QVSB 4Y1VA 5EPAA 1DQ4A 3FWEA 5EJ3A 4XYXA 1YJLA 1VMJA 2JXAA 1LOBA 5FQ0B 1LU1A 2P37A 5EJ1B 3SCHA 3UYJA 2RDRA 1S0GA 5FYZA 4YVWB 3VBHA 2OPWA 2H0VA 1VBC3 4UBHA 2E53A 1REFA 1WLCA 1XSRA 4XQ4A 4HBNA 3MIEA 3CJIA 4LLOA 4Q4V2 3ZM8A 4AEDC 4CCCA 1K3IA 4AAXA 1UKRA 3B02A 5L7OB 2QQMA 1GYKA 2EALA 2DFBA 3LSDA 5GM0A 1SZBA 4YZ2A 1RINA 3THDA 1BMV1 3MV01 1CAWA 2YXSA 1XOYA 1JBCA 1WCDJ 2NQYA 2VNGA 4Q0VA 4M3CF 5IWFA 3O1UA 1RUF2 4BH9A 4YM1A 5F39A 3LDKA 3VHPA 4ZXEA 4YW1A 5GZEA 1OPMA 3V56A 3V64A 1RUE1 2EXIA 5A7QA 2DFCA 1G9AA 4MSVA 3M3OA 1IZ3A 3UNPA 4XW3A 3RMXA 3CZUA 3T4VA 2GMEA 3S6PA 3K51A 4LBOA 2VGDA 2OIIA 2QZ2A 2R041 3S7IA 4NOTA 4Q0UA 4FOWA 1RVF3 4AF9A 1RTVA 5IW0A 3VDDA 1XNKA 3MLJA 5DZFA 4AWDA 1IS5A 1GUIA 1R091 2R072 4AFAA 1G8WA 2XKPA 2ZA9A 1LNSA 4CEYC 2VZPA 1WBFA 5LBEA 2VNRA 2LM3A 1JZ2A 1XBFA 2Y8KA 3FL7A 4ONUA 2ZEXA 3WNNA 1SLAA 2PAMA 2QQKA 5LEJA 4D6RA 3LEGA 3DKWA 2J42A 1H2NA 2TEPA 1LOFC 4OHWA 1BEV1 4AW7A 3FMGA 4JRAA 4NPRA 3A0KA 1AL0G 2EAKA 2BVBA 4DUWA 4CCDA 1M06G 1W0PA 2VNVA 4SBVA 1FX5A 1PHMA 1W9SA 4ORFA 4YW7A 1LULA 3GGLA 4UBGA 4K9SA 3FE5A 1N1TA 2VVFA 2HWE2 1RHI1 3GZTB 2JECA 3HBKA 1NCRA 4A7YA 3PUSA 3HIFA 2RVAA 2RE9A 2VZTA 1PVXA 2H0BA 3I3BA 2JG9C 5JPNB 4LHLA 1DYKA 2WNUA 1PIV1 2Q0AA 3M2MA 4XAEA 3OEBA 4DB5A 1PO23 3S5AA 2G1MA 4Q0QA 5BNNB 4I01A 3TN92 2WFPA 4C0HA 1CJPA 1Y9GA 2WA4A 1CZVA 1Z7S1 2W87A 1LRHA 3AZYA 4R8HA 1W6NA 1VBE2 5B2GB 3B94A 2Q8CA 1SCRA 2VXRA 4Y20B 3ZXLA 2WZ8A 1NCQC 3R4SA 4XETA 1GZWB 1YCIA 1W8UA 3CEWA 5D2AA 5LY1A 4AE2A 3R4DB 3RWKX 4X6QB 2LRPA 3AB0A 2W39A 4HN1A 5JMCA 3V0BA 3OY8B 4SLIA 1RUG2 2RS32 1DF0A 3MBWA 3QD6A 5FYIA 3DYMA 3IB3A 4NO4A 1XE8A 5I8YA 2Q8OA 5CADA 2E7TA 4OQ9A 1AX2A 3HD8B 4EROA 2UURA 3Q8AA 4FPLA 3O1OA 3H7JA 3HN1A 4PDWB 4ZKTB 2Y0OA 4P00B 1HRI1 2W95A 4IV1A 4EE2A 4IE0A 3H8OA 3BUCA 2A6ZA 2ZGLA 3T2PA 1YIPA 3OUJA 1F15A 1NZCA 1I5PA 1DLCA 1OH4A 3UGFA 1LECA 3HAGA 4JTNA 4M0NA 2IXCA 3PJYA 1NLQA 2WN3A 1S2KA 3WG4A 2BWCA 2HWF2 2YHJA 4IEUA 4XXAA 3TB0A 4DPNA 1WMDA 3AZZA 4RSUA 4L8QA 3WF1A 4Z2AA 1JYXA 2HYXA 1IQAA 1UY3A 5M0TA 1W0NA 3HBZA 4YW5A 4BIFA 2VMIA 1OXCA 4IEVA 4M3CA 4O61A 5K9YA 5ABJC 1XSQA 4I09A 3ZYIB 4E2SA 5JAXA 3O5SA 5FUIA 2WNVB 4WM7C 4IEYA 1OD5A 1ASJ2 3WT3A 2YPDA 3AX4A 2RS51 1VBA1 2V5DA 4AK3A 4CXXA 3W9AA 5EIYB 4PI2A 1C8M2 1NY71 3LOIA 5JI7A 3WP4A 3ZMOA 5FZKA 4R52A 1YLLA 3NJYA 3MW4A 4JGYB 2FDIA 1GQPA 2IVJA 1U5XA 2XKOA 5BV6A 4JZRA 4RL7A 4FTSA 3IMMA 1H8TB 1GBGA 1GP6A 4RQPA 3NL1A 5JZGA 3D8CA 3KWVA 1O5UA 3P6BA 1MS0A 3E97A 1F9KA 3WDVA 2NLRA 4HVQA 5C6CA 2FCUA 4JV4A 1AYM1 5DQ0A 5JVVA 1UOBA 3GZEA 1AR62 4GAZA 2W68A 3NNJA 2AR6A 3KCYA 2JDMA 3AMHA 5J3UA 1UZWA 1SLBA 2DDUA 5L19A 4FPJA 3WOGA 1VBC2 3WVJA 2IWGB 3B00A 3N3HA 4YW6A 2C26A 5A7SA 5T5OA 1R1A1 1GICA 2DVFA 2XUEA 3BN6A 2Q8EA 4C91A 2IVIB 1XNAA 2OZJA 2BDRA 3C2UA 2SBAA 2WRAA 3E6BA 1DGLA 2WJSA 4WM8A 4AXOA 3UKTA 4N53B 5GLTA 3VBOB 3FUOA 5C3OA 1FT9A 1K5JA 3H3LA 4L99A 5ANQA 5LA2A 3AM2A 2NMNA 3ZOIA 4M4RA 1LGBA 3BTXA 3ZN6A 3O14A 4EQVA 2G9FA 5A1LA 5FFOC 2JD4A 1RC6A 4I2OA 3FBMA 3OF1A 3UESA 2YG0A 5F9TA 1RUE3 3ETQA 4AVTA 1J59A 3B7MA 3RZJA 4L92A 2VULA 1AR71 1CX1A 1AL21 1SG3A 3PNAA 1RVF2 3NKTA 5F8PA 3NJVA 5I93A 5KC5A 2D44A 1W6PB 2R043 4WVMB 3PIJA 2VMCA 3FX3A 4JCKA 1K42A 4LMFA 1ALYA 3PDQA 2D40A 4YWAA 2XJRA 5JXGA 3TNPB 1R093 2VCCA 4DO0A 2J1RA 2C5DA 5A7NA 4AI8A 1OUSA 3T08A 5FZIA 3EHKA 3IDBB 4XC9A 3D0JA 2CU5A 5FLHA 1O3QA 2NN8A 3TYJA 1QDOA 2R061 1UU6A 1MQTA 1CONA 3VBSA 1J3QA 1V6NA 4OMCA 2W46A 4JGZA 3N7MA 2B7YA 3K3NA 5BNPA 5I0SA 1OOPC 1HDKA 4RGAA 3ACIA 3MIHA 3O0WA 3USUA 1BEV3 2ID4A 4RHV1 5IK8A 5LK5A 5I91A 1QH6A 4ISRA 2GMMA 1VIWB 1GNYA 3GYDA 4L0PA 4W65A 4I0AA 1JYCA 5AC91 4MGYE 3BVCA 2HWC1 2B8MA 1ULPA 3VBUA 5D8AC 4J25A 1RHI3 5KHHA 1WLTA 2K0GA 2R0HA 3D3AA 4AHYA 1PO22 3S5QA 2ZEZA 3W59A 1F4AA 3MI8A 4L11A 3EJKA 4W50A 1AVBA 2E7AA 5DN2A 1C3HA 3VDCA 1NG0A 4PBPA 2ZOEB 1Z7S3 1BQPA 4S2GA 1TME1 4HMZA 4IE5A 1JW6A 2ZX0A 1UW8A 5BNOA 1XYNA 4JQTA 3HNMA 4G9SB 2OXBA 1NAEA 4MGTA 1O59A 2QKDA 3A21A 4MGIE 2F6BA 1HB3A 4DUVA 2DURA 3RMYA 3ZXDA 3EO6A 4FXGB 4LA3A 4N8MA 2G4IA 4QDRA 1WD4A 3U07A 2WO2A 4GXLA 1F2NA 3LZZA 4JDOA 2DYCA 1DGRN 2X09A 4GULA 4RD7A 3DPRC 5C4WC 1JOBA 2JG8C 4XABA 2BNMA 4QX3A 1YFXA 3MZHA 2H6CA 1QWRA 2ZZQA 4JHZA 2OYZA 4A7ZA 2X5IA 3CBNA 4GJZA 3OCPA 4UW3A 4BJ0A 4FTBA 4MOAA 2WO7A 3FLRA 5A7WB 4CP9B 1W6QB 1MZ6A 1OHFA 4IESA 1HRI3 3URFA 4CEYB 3BPSA 2DF7A 1HIXA 2QQVA 3JU9A 2R6QA 5IVJA 5E89A 3H9AA 4UAPA 2PHLA 4QKBA 4BQ2A 1GMMA 2RM21 1X9TA 2ZMKA 3U0ZA 1ULGA 2GSYA 1JOJA 2GH8A 4XDOA 1ZA7A 4HKLA 3AMQA 5GZFA 4LBQB 4BQYA 1ULOA 4Z07A 3VKNA 4PIZA 2WLQA 3TEXA 3ZX7A 5A32A 3A23A 3ZSLA 2WQZC 1VBE1 3OGJA 5CA6A 5A3WA 3J7NA 3ETPA 2D43A 1OPOA 1AR83 1JZ7A 5JLVA 1QF3A 1VBA3 3NNGA 3ACHA 4CDWA 1U5ZA 1A8DA 5KXCA 2JG9B 1H6XA 1LOGA 2J22A 5F3CA 3RZKA 3WDUA 4ZU5A 4QMAA 5FRAA 4QPIA 3RJ2X 5KBFA 1W2NA 2ZAAA 1Q56A 5FP3A 2IFRA 2ZX3A 5GLWA 3L9JT 1W8TA 2PHXA 2XLGA 3MUZ1 5J48A 2GNBA 1ENSA 2WL1A 4YM2A 5FYMA 4CDUC 4CP1A 1AYM3 1V6IA 1WMFA 3WW1A 1DHKB 2QQOA 1UYPA 4CU8A 4URTA 2D6MA 4HG6B 5FMOS 5IAVA 2IC1A 3O1RA 4TXWA 1NCQB 3B9IA 3OG2A 1T6GC 1N3QA 1PMIA 3MIDA 1GR3A 1SPPA 3ENRA 2D3RA 3DUIA 3WCRA 5CAZA 4AHWA 1YYNA 5AFBA 3KS7A 1R1A3 5LATA 1YEWA 4UYBA 2ILMA 4CDXA 1XU2A 4JKMA 3WQ1A 2ZABA 4AVBA 3TBDA 1IS4A 3NNLA 5FYVA 4E9KA 1PGL2 1OURA 4EWEA 2DCYA 4Y22B 2ADEA 1Q5OA 4QXKA 2ZGNA 3OGRA 4XACA 1BMV2 4FPHA 5JXHA 1QGLA 5FKBA 2GP5A 4CVUA 1JN2P 5FCCA 4CDQC 4EZHA 4PJYA 1W6OB 3K77A 2D6KA 3ASIA 1YI9A 4CP0A 1CD3G 2WSUA 3SEPA 2VO5A 3P3NA 1RUE2 2JEMA 3E5UA 4RS5A 4XBNA 3O1MA 3WLUA 3UKVA 2W52A 1Z0HA 2FMDA 1YQCA 5H9RA 3VL9A 3WINE 5FR3A 1C8M1 1HJFA 3LE0A 1DQ6A 1VAVA 4QX1A 4COZA 5KWRA 2FDFA 2XHKA 4NIGA 1YWKA 2R042 2GNMA 3CKHA 1AR73 4NHKA 1AL23 1NLRA 3Q8BA 4LIUA 4O9GA 3O1TA 1AR91 5FIXA 1OA2A 1CGPA 3TEWA 3GCXA 3LD8A 4CYDA 1WA6X 1FI2A 1UZYA 1R092 4YGDA 2BV4A 1ZBE1 5CG9A 5HCHA 4CEWC 4E8CA 2PN5A 4ZU7A 1DFQA 1F31A 2CL2A 3DYPA 1AR61 4HONA 5GLUA 3VBHC 3IN9A 4LO8A 5ABJB 1EPZA 2WBKA 2HJIA 1SBEA 2J1EA 3RZLA 2G19A 3MIFA 3DXTA 4WM7B 5ANNA 5APAA 1SDWA 1SQ4A 4JX0A 2PLV1 4QQ2A 5K7PA 2R063 2VZOA 2VQ0A 2VAUA 1H30A 2WO1A 4BXSV 1VBB3 2C0ZA 2VBBA 1RUH1 5HCBA 4Y4RA 2ET1A 4NHMA 2JDPA 1OH3A 3LDBA 3BOWA 2ZGTA 4QDQA 4RHV3 3T09A 4YGBA 2ZZJA 3GALA 3L2YA 5A3OA 4QHBA 4WVWA 5KHIA 3GHMA 2XL9A 3RJRA 1SMVA 2BERA 4OQ8A 1SFNA 4MO3M 5AC93 5C70A 3SEEA 1RHI2 2Y6JA 2HWC3 3OB8A 2OUJA 4C1WA 4UFHA 4I0BA 1LB2A 3BODA 5JR2A 4BWOA 2HWB1 4PCRA 1GU3A 4A2UA 4LULA 1QKQA 4YRDA 1W9TA 3VDDC 2PHFA 2V09A 2YC2A 5IVYA 3APBA 4OHXA 2CDPA 1Z7S2 1RVF1 2VCBA 5J98B 2IXJA 4KH9A 1VMHA 4LQRA 2VMFA 5ISLA 2Q1FA 1TME3 1W6MA 2XLFA 3VKFC 1UD1A 5J09A 1KFUL 3M3QA 4P9XA 1C5HA 4E2QA 3MUY1 4NIAA 2J1UA 5F5IA 3UGGA 1GLHA 1FOD2 4FQZA 2ORZA 2BBAA 4XF9A 1H6YA 3I59A 1JXNA 4DRRA 2YDEA 2VCMA 3BTAA 2B39A 3E6DA 2YBPA 4XF1A 4PIYA 3LAGA 4QQHA 1LHUA 4AFMA 1K5MC 2O14A 2ZKNA 5BXXA 1BK1A 2C9KA 3N9PA 4WV8A 4ASMB 1PGSA 4XFGA 1Y9MA 4CCOA 1US2A 4I3PA 1ZA4A 4Q1RA 5TSWA 1HRI2 5T50A 1JYTA 2AZ5A 2JDHA 1YQ6A 1APNA 4XFIA 2C1FA 3MHZA 2Q4SA 2E9QA 4XCAA 4FPYA 2DUPA 3MF6A 3PMEA 2EIGA 4Q26A 3NNFA 1N47A 2HLEA 3C7HA 4OCTA 4HKWA 4XCBA 3VHNA 4A42A 4OZXA 4BLIA 3KV6A 4AI9A 4XIOA 3SMHA 2CSGA 2WZPP 1D4M3 2VECA 4MADA 2RM23 2Z2SB 5F2SA 3ACGA 5L36A 2D6OX 1LOCA 3ZO0B 2P4EA 4WBBA 1OOPB 2QTWB 4QPGC 4AEJA 2BPA2 2PHUA 3U11A 4FPFA 1ENXA 1YHFA 4ES9A 5A3MA 1PZ9A 1CAUA 1KJRA 1I9RA 1AR82 4MVTA 1Q8VA 3N7JA 1VBE3 5F32A 2H6BA 1OMIA 3ZYBA 2DVDA 4FQ4A 1C1LA 1VBA2 2AEYA 5G05L 5CBLA 5FOJB 2P1BA 1UYXA 5CFDB 1NY72 1VB4A 4QGMA 5D8AB 4XURA 3HN3A 3VLBB 3NO8A 1OD3A 3T3YA 2CWSA 2VZVA 1JUHA 5DABA 4N9IA 2VOVA 1SFPA 2WWUA 5IATA 4Y3OA 4CUGA 1CVNA 5LA1A 3WF0A 5GLVA 1DCSA 3PVOA 2XJQA 2WIIB 4MLOA 4XMAA 4YARA 1X9PA 1AYM2 3OGGA 3KF3A 5C9AC 4Y5TA 1G6NA 3H0OA 5JOXA 1Q8SA 1RYYA 2F17A 2WAOA 4WVVA 5FMOL 3KV9A 3ZR6A 4Z92B 1IGOA 1URXA 2OQ7A 3SNMA 5BNQA 4A4AA 5A1FA 4XTMA 3GF6A 1R1A2 3INAA 3KCCA 4IGOA 5CEHA 3VUOA 1W03A 2VTXA 5HV0A 5FQ0A 5FP8A 2BTVC 4IGPA 4YVWA 3FLPA 4CE8A 3SC7X 4CA9A 3KQ4B 1QQP2 2P34A 3V0AB 3THTA 4BQ4A 1GFF2 2ZACA 3DPRB 3I2GA 5C4WB 2JG8B 1X36A 2FDHA 4NJ4A 2QZ3A 4RGKA 5L7OA 2XMLA 3I97A 2QNKA 3KV5A 3O0VA 4NHYA 5FY1A 2X05A 3ZXKA 1ZRDA 5I0TA 1CPNA 2JDNA 1LEMA 2ZX4A 4YG6A 3T4HB 1SLCA 2ZX1A 3CL1A 3DECA 1PMJX 1H9WA 3D82A 2XQRA 1W9YA 4K6BA 2KA3A 2WQ8A 3MEPA 5C7GA 5F7UA 3O1VA 2OUHA 3LEKA 1AR72 1AL22 3J8F1 4ASLA 5JZGC 1LHOA 1M4WA 3IT8A 4M01A 4AYUA 4CU7A 1MS3A 2A75A 4XJUA 1NE4A 5DAWA 3P3PA 4JQRA 4P9JA 1JYVA 1OFNA 3BI3A 1AR93 1QJX3 4MZUA 4TWTA 2QQUA 2IXHA 4L2NA 4UF0B 3JUUA 2XUMA 1ZBE3 3VBFA 3ZLIA 2ZAHA 5FZOA 5A33A 3WNLA 3GJAA 3GJBA 3GDBA 1AR63 2B9UA 3WR0A 2EIEA 4BZ4A 2VVEA 4Y1YA 1IG3A 2R062 1BVVA 3GM8A 3HWJA 1ZVFA 4MV2A 1VBB2 2VOWA 2CWMA 1NE6A 3AVSA 1QOTA 1HLCA 2PLV3 2LROA 4K8RB 2XWJB 3I3QA 4XVHA 1NA1A 1Y7BA 5ACA1 4W4ZA 2WABA 1CESA 4IEWA 2D93A 3OD0A 3KVBA 4OULA 2B9VA 1LHWA 1QJU2 4RHV2 1DP0A 5JCTA 1RUH3 4F7ZA 5A7PA 1DZRA 3RWNA 2VQTA 1PGL1 2P3IA 2D6PA 3T30A 4NPMA 1HB1A 1N1VA 4LBMA 5AC92 4HPKB 4CU9A 4KI5M 1VALA 2HWC2 4CDUB 5FY8A 5IUQA 3MPPG 1OKOA 4QXHA 2BBVA 4AVAA 4DOUA 3DYOA 3B93A 3HR9A 3QH7A 4KU8A 5LB6A 4IL7A 1VBD3 4NROA 3C7FA 5E6HA 4Q4Y1 2HEWF 5FZAA 1NOVA 2HWB3 3T2QA 2TUNA 4R9CA 4XIKA 2JKBA 1HJGA 1MS5A 1UIJA 2WFF1 3KB5A 4IXLA 4B4PA 2X10A 4ES8A 2W3JA 3RI9A 1TME2 1UXZA 3H3ZA 4W8JA 4KGGA 2V73A 1UX7A 1BJQA 2BFUL 1GZ9A 1ULDA 2IUWA 3H42B 3ZYJB 5FDBA 4XMIA 4NHLA 3M3EA 4CDQB 2EVXA 1MZ5A 4UT5A 4Y20A 1DGRA 4LA2A 4GKXA 4D7YA 4CXYA 4JGZC 4LK6A 3ECQA 1A8MA 1CIYA 1SFYA 1GZWA 1W05A 1ZZ6A 5BNPC 1CPMA 3N9NA 5C3PA 2X53S 1U12A 4FFHA 2WC2A 3NW4A 1O3RA 5BPXA 3O1PA 5K4LA 1POQA 3FFQA 2YUEA 1ST8A 2JB4A 4DFSA 1Q43A 1UF2C 4QQLA 1CAXB 3WEZA 5A3UA 4MUVA 5F37A 5I0DA 3ZMNA 3IDCB 5IJRA 2VZSA 1QJFA 2ZHLA 1FMD3 1Q8QA 4XBLA 3CO2A 2W0XA 4S2HA 4AI1A 2R32A 1ND3C 5JXIA 1L7LA 4HVRA 3ZXGA 4CEWB 4PDWA 4XZPA 3N4MA 2A6WA 2OZ6A 3VBHB 5JIUA 2XH6A 3NVCA 5JSOA 3EB7A 3J7MA 1D4M2 5FO7B 5E88A 1PK6C 2RM22 5IVCA 2R16A 3K4DA 4AQ6A 1YFUA 1W8NA 1S1AA 1VRH1 3ZDSA 1DYOA 1KXGA 3GHNA 1HB4A 2VBDA 2ZHMA 1QNWA 4IUGA 1DQ2A 4XQDA 3TRSB 3N9MA 1QXRA 1S0FA 5BNOC 1OVPA 3TAYA 3AXEA 1CAWB 1DQ1A 1BYHA 1PZ7A 3Q9OA 4M0HA 1LENA 1W3XA 4N7UA 3WP6A 4RFRB 1N3PA 1XE7A 2BGOA 1DLLA 1WA4A 3ALQA 4J1XA 4AFDA 4K1YA 3ORJA 1ZZ8A 3OBTA 4N90A 1C28A 5FZ9A 3VN4A 1B35B 3RZMA 3WW3A 4V2VA 1KDMA 1FOD1 5FREA 3PJQA 4KWJA 2WT0A 2XJUA 4CP2A 5KHKA 3JD71 3IAPA 2DVGA 2UY9A 1NXMA 5F6KA 3ZIWA 5FAXA 2P2KA 1EAH2 2X5IC 2ZBJA 4JGYA 4HKOA 4QHZA 4LK7A 1GP5A 3K2OA 1Q8OA 3K3OA 4YZ3A 1W99A 3VDDB 3WHTA 5JPMB 3VDBA 2JIJA 1V9U1 3ACFA 4N9HA 1H8TA 1RL3A 2A6XA 1GV9A 2C24A 3KCXA 2XOMA 4BU2A 1Y9QA 3ACLA 3N7KA 5SV8A 4NUBA 3HT2A 1JHNA 1OLRA 5E16A 5A3TA 5HI0A 2RR11 3AXDA 2SLIA 5IK7A 3OBAA 1G9FA 2VW0A 1XNTA 4IERA 5LZ6A 3NWKA 5FZ3A 1ZM1A 4BXFA 4BDVB 2I2SA 1IQDC 4XJZA 3I2FA 1O4YA 4GWMA 5T54A 4KBBA 3VZKA 5A70A 2VG9A 2ZEYA 2ZGQA 2IXLA 2B46X 2CGNA 3PVEA 3KHBA 4EN9B 1K5MB 4FAHA 3GZUC 1HV0A 3WSOA 1OLME 1V00A 1G9CA 1ND2B 1R1ZA 5L73A 4ET7A 1ZRRA 1OI6A 1WW7A 3I2DA 4N53A 5FBZA 3VBOA 3WF4A 1NKGA 4Q4W1 3ITQA 4YGEA 2HKXA 5FLJA 1C57A 1AR81 1UY2A 2OT7A 2A1XA 4P9LA 3B9CA 3MICA 3H8RA 1UPIA 1QY4A 5H9PA 3E5QA 1GWLA 1UWWA 3WY6A 2KD7A 4CSWA 2DUQA 5F1RA 4B3NA 3RDIA 4LO5B 4WZFA 1J1TA 3J8F3 1AR92 1QJX2 5FYCA 5I0RA 4Q2FA 4P9WA 4QT6A 1WCKA 3MPBA 4PT6A 1GSLA 2AUYA 1UX6A 1ZBE2 3LEMA 4GKYA 4QPGB 1W6PA 3ZYHA 3W5NA 3U78A 3ZYGA 3D0SA 5FWEA 3BIEA 1I1EA 1PMHX 4W6WA 2BOIA 4Q29A 1JZ3A 1UAIA 1UOFA 1QMJA 3IMNA 2BP6A 3LB9A 5LASA 1HRV1 1RUJ1 4CDXC 4D6QA 1KFXL 2PLV2 3PHMA 5K0UC 2ZGOA 3NKGA 2ZMLA 4X6RB 2WKKA 2W1WA 3C8XA 3Q8EA 4JAAA 1YFYA 4XPVA 1CN1A 1ZBA1 4OZOA 1RUH2 3LSEA 4P9GA 4QU1A 3ZFGC 3W5MA 4E4DX 5ACA3 1COV3 1QQP1 2B42B 3TEYA 1E57A 5FYYA 3VB9A 4BIOA 5EJZB 2XXZA 5C9AB 1MPXA 2OQ6A 1H4GA 4LTAA 3D6EA 1VBD2 3NNMA 3AZWA 2BYVE 2VJXA 3AJYA 5DAXA 5FXWA 2VZ1A 4K3UA 4HFSA 2ARBA 3O0XA 2HWB2 5DG2A 1YQ5A 1PX3A 3WG1A 3ZSKA 5C3RA 1FV3A 1QJZA 3M70A 1XNBA 2J7MA 2PFWA 4Q4Y3 5FZ7A 3ZN4A 4AAPA 3S0MA 2GMPA 4N43C 5HXVA 2PAKA 5C8CC 3SLIA 2WFF3 5IVEA 2PA7A 1J1LA 3PUQA 3WQBA 2E51A 3KLSA 2P3YA 2XONA 5H9QA 1FYUA 1I5ZA 2BVVA 4IEPA 1OQ1A 3VZMA 4A45A 4DY5A 4TZDA 1O7FA 2B5HA 2VMEA 2V5YA 2W5FA 3GZAA 1C4RA 4INDA 5KXBA 5LCWL 1AHSA 4LKSA 3A22A 3HQRA 4IEXA 4ATFA 1VBB1 4CUCA 1RXGA 2PTMA 3ZSJA 5EQUA 3AK0A 1FMD2 5JZGB 2K2SA 4QB2A 2A73B 2ARCA 1QJU1 2A3XA 3FUQA 3QACA 3FHAA 1ZZ7A 2BEOA 1LEDA 4YNIA 1JUIA 1WMXA 1DBNA 4PLMA 3EYPA 3I2OA 5A7WA 1WLWA 1W6QA 1BXHA 1R081 2Q5TA 2FQPA 1P8JA 2QCSB 4IEOA 4LKEA 4TLGA 4YG0A 2ZHNA 5LBFA 5FYHA 3ZYFA 2PHWA 4CEYA 5FPUA 1KQRA 1DZQA 2E33A 2DWRA 3VZNA 3AP4A 4D8MA 1TEIA 1W8OA 1SCSA 1PO12 1X8EA 2VQUA 3KT4A 2AH2A 4QHOA 4JRLA 4XILA 5FP9A 1QH7A 1VRH3 3RZHA 4Y24A 4AEDB 1JYNA 1DDLA 5CNAA 1QJY1 1E5RA 1HW5A 5FV3A 1ACCA 3WP3A 4UFIA 4AQ2A 3RYKA 3T1LA 2HBTA 2ZJCA 2WAAA 5GJ6A 1O8PA 1HN0A 3OBRA 2XL7A 5JR7B 3PTRB 1SBFA 2BNOA 4XOGA 3OUIA 3UJQA 3RYPA 1HXS1 4DXZA 4ISQA 3MW3A 3OUHA 3PU3A 3ZFFC 2JE7A 4B4QA 2HBUA 3D5OA 1F5FA 5FXZA 1WCQA 1FOD3 2GDFA 2OVUA 3H8UA 4Q8KA 3BTZA 2ZKLA 2XVGA 3JD73 2E31A 3OTFA 2CAUA 5GZDA 3M3IA 2R1DA 3FJSA 3WUDA 4A3XA 4BQ5A 1D0HA 4EV0A 4PI0A 5DDJ1 5LY2A 5IHRA 2WDBA 4V1PA 4DIQA 1V9U3 2O0OA 3LCPA 5FP7A 3E5XA 5C71A 3SQOA 5FZDA 3ILFA 4DUXA 2AC1A 1J3PA 3U1XA 3H1WA 4GH4C 1YC61 4LJHA 1D2QA 3IIIA 4Y4YA 2DVAA 2RR13 2ZXQA 5FPAA 3VDAA 3ROUA 2BJSA 4LORA 5BNPB 1D4M1 4BMEA 3H7YA 1OLMA 3PU8A 5FZGA 1RUC1 4GB31 1AZDA 1XXNA 4HT1T 1NX9A 2PHTA 3KV4A 2X29A 5CKMA 2JICA 1OT5A 3IAQA 4Q0PA 1H1AA 1W3VA 4BQ1A 1TMF3 3M7AA 4YLZA 4ZZ5A 5A3PA 2VW1A 4Y1ZA 3RZGA 4Q0SA 4FTEA 4FFFA 4BYYA 3N9OA 4XE9A 4ZS3A 1ND3B 5C8WA 4Q4W3 3WQ0A 1C5IA 1Y4WA 1KRIA 1W6OA 3VD9A 2WNOA 3VGIA 4QM9A 2J1VA 5LK7B 1DZTA 5CFCC 1F8VA 1DU3D 3J8F2 1MS9A 4IGQA 4QQPA 2ZGPA 2VOKA 2YGLA 2EXHA 1PK6B 1VJ2A 4XHBA 1TVGA 4K1ZA 1EAH1 3JB8A 2BU9A 5BY5A 4DS0A 1W06A 3NAPC 5FZ8A 3MFCA 3SH3A 5BNOB 4AI3A 3AP5A 4Y33A 2FDKA 1FAYA 2WS91 2ZGSA 1H0BA 1V0AA 4B29A 5KR7A 3TEZA 2E63A 3WDWA 3K46A 2Y6HA 3T0AA 4Q4X1 1OC1A 2GU9A 5ABJA 3KHCA 4XBQA 4YVWC 5EYYA 1QNYA 4BHPA 3ZFEA 1ZZCA 1HRV3 1RUJ3 2GC0A 1XQNA 3HMYA 3POIA 2P17A 3JB4C 5ACA2 3ES4A 1COV2 1CR7A 4XFFA 2XJTA 4OUSA 1IS6A 3WG2A 2QQWA 2ET7A 1DIWA 1ZBA3 4Q5OA 4XZUG 5F6LB 3UETA 1VPHA 3FHQA 5DXDA 1O6UA 1QQP3 2HH9A 3A7QA 4WVZA 1ULEA 2WUHA 2GZWA 4NVPA 2WNEA 4YFWA 3SXWA 1W8FA 3K48A 3DGTA 1OQEA 2ENRA 4CCNA 1S0CA 5DUVA 4CUAA 2ZPXA 3IPVB 4IEZA 4AI0A 3AVRA 5LA9A 2XG3A 5A1AA 4Q4Y2 4C90A 4KWKA 1AXZA 4HOOA 1QJEA 3WZ1A 3UKNA 1NQDA 4CRQA 4LLFA 2WFF2 1ZREA 4DNYA 1W2TA 3C7EA 3VBFC 1QJX1 2DVBA 2TNFA 2MPFA 2XJPA 3H1MA 4GQ7A 3WHUA 5CISA 3N35A 4UW4A 1YNAA 5FYSA 1K12A 2UWCA 3OOXA 1W39A 2IZWA 2Y64A 1A34A 1J3RA 1X7NA 1X82A 4GIQA 3F2ZA 1VMFA 2ZCWA 5CG8A 3FLTA 4RR3A 1IKPA 1NA1C 3GXUA 4HL0A 5LBBA 4KBZA 4A6OA 4A7KA 4COUA 3CJIC 3C7GA 3HT1A 1WMEA 3OPWA 2Q30A 2DUOA 1SEFA 2D98A 1RMU1 1XYOA 4UFLA 4AFCA 5HPOA 4ASKA 2JENA 4FOYA 2DCKA 3WNOA 2CV6A 1LKNA 3AMPA 1HB2A 5FZ1A 3K4ZA 1QJU3 1N1YA 1LHNA 1GNHA 1WWYA 2W08A 4JVAA 4UI9L 4L97A 2HEYF 3ZPYA 5GLZA 5A3LA 3PLQA 2W47A 4YW4A 1BBT1 1J58A 1VBD1 1R083 2P5BA 3AL6A 4LE3A 4Y1XA 2PHDA 4CCMA 3VD5A 4CDXB 4QPWA 3BYWA 2VTFA 4XFAA 3X29B 4QM8A 1O3TA 3AYAA 4QD2A 1VRH2 5K0UB 2YC4A 3JBG1 4DRVA 2CGOA 3KMHA 3M1HA 2RJLA 2WN2A 3ZFGB 4JC1A 2UYAA 3THPA 5KHGA 4NIHA 2EAAA 2HWD2 1HQWA 4EYUA 5IFPA 1OOPA 1QJY3 2I07B 3MIBA 1ZZBA 2HYKA 4MGKE 4EN7B 4BA6A 3ME2A 5J37A 2GN7A 4ARXA 1H2LA 5J1XA 2YZ4A 4OFGA 4CUBA 5IVBA 4JKKA 2DBNA 4KG8A 2E7QA 3CJXA 3I2KA 4G3YC 4IV3A 4AVVA 1HXS3 2LUWA 3R6SA 3JD72 3OYWA 5CFDA 5D8AA 4GWNA 3VD7A 4AZZA 2BRTA 4UOJA 4UFJA 4BB3A 5KC6A 4FI9A 4N43B 1V9U2 1OBNA 1FMD1 3WDTA 1LU2A 2ATFA 1U0AA 1KS5A 5C8CB 2XQXA 5DDJ3 5JXJA 2Q1MA 5DUXA 1LTEA 3MLLA 2W1SA 1VP6A 2VZRA 3FBYA 1ZRIA 1AJOA 2D6LX 2W92A 1NCRC 3GNEA 2RS11 3ZSMA 3VD3A 2Y0IA 2RR12 3FN9A 4MXWB 5FUNA 5LW9A 2VBPA 2VOTA 4AVSA 1J83A 1NZIA 1OFSA 1K45A 2WNUC 4YSFA 5FZLA 4Q8LA 2UYBA 1MS1A 2WZR1 1WKYA 4FBFA 2R1BA 3PL0A 4YGCA 4YVSA 4JKLA 4QQOA 4XF0A 3H1YA 2YU1A 1MS8A 2X8KA 1V6OA 4HSJA 1WCUA 3U75A 1PO11 1RUC3 3N7LA 4GB33 4LITA 1TMF2 3KT1A 3VKOA 3AKRA 5LWBA 3V0AA 4NIDA 4QDSA 3UL2A 4IE4A 3DPRA 3NQHA 4J1WA 5C4WA 3SH4A 3HNBM 2Z5WA 3DV8A 3J9SA 3NV1A 4Q4W2 3SCGA 2WLPA 4COYA 4RA0A 4C1XA 1CAVA 3AKQA 2KR2A 3VBRA 3T2TA 4D0QA 4E27A 4XTPA 1IKQA 5FJHA 4RN5A 2BW8A 2FHRA 2WQ4A 3OSDA 5FZ6A 1BVP1 1HN1A 3WG3A 2OA2A 3U4XA 4A6SA 4B7EA 1GANA 1SHWB 4XDPA 1T6BX 2B45X 4B8EA 4COVA 4MG2A 1QIQA 2PELA 4LT5A 1UMZA 4H7MA 1IPKA 3HJRA 2OKXA 1CX4A 1EAH3 2RDQA 4IV1C 4R9BA 1KD7A 1RJ8A 1W6MB 2DU0A 5CIRA 2BGPA 3BGAA 1EYBA 2WS93 1FNZA 2WZEA 4JDMA 1GWKA 2I45A 4UF0A 1YIFA 2XPJA 1UY1A 1JU3A 3GCWA 5FJKA 2XDVA 1EV12 1HRV2 1RUJ2 4E2GA 2CNAA 3H3UA 2OS2A 4Q4X3 4BQ3A 4OI4A 5FXVA 3VV1A 1N1SA 4NE9A 1PNFA 2O1QA 1ZBA2 4I30A 3ZFFB 5K8SA 2VUJA 3IBMA 1OUXA 3RYRA 3ATGA 3RPQA 3J4UH 2VL4A 4PLNA 5IAXA 1O4ZA 5DUWA 3UT0A 2V4AA 4I3GA 1HV1A 4W6YA 2FDJA 2JWPA 1FATA 3ZSEA 1J84A 3CZJA 4EN0A 3QCWA 5FPZA 2WR9A 3BOPA 4FPGA 1O4TA 4HPKA 4JTOA 2QQIA 1VAMA 3NV4A 1RUOA 4CDUA 1JYWA 1IHMA 2YROA 1DQ0A 4GH4B 4F83A 4JDNA 3KT7A 1UOGA 2Y6KA 3QLQA 2CYFA 1TE1B 4XF3A 5FXXA 3TWIA 2YBSA 3J7LA 1W2AX 3LDRA 4RQPC 5FK8A 1UYYA 2A5ZA 5FZBA 4RGGA 1UO9A 3MO4A 5C5TA 4HLTA 3EQEA 3E1F1 1UMHA 1XYPA 3WNXA 3CIHA 2IXKA 2WT1A 5HXMA 1G7YA 2YBKA 2PHRA 4OMDA 5FY4A 3MLKA 1UPSA 2A3YA 1AX0A 1BCXA 1DGWX 3LGRA 5JMOA 2ERFA 3NRUA 1RJ7A 4HK8A 4MXVA 2VUDA 3O7OA 1LHVA 5F5CA 1UY4A 4XUOA 2OX0A 4CDQA 4EJRA 1WW6A 4E4HA 2K46A 2JDUA 2CAVA 1V6LA 4OHZA 1N3OA 5FY9A 2PQQA 4WM8C 4Y5SA 4D7TA 2FCVA 4IDZA 5CFCB 1COV1 1I6XA 2D5FA 2NP0A 1RMU3 3BALA 4QX0A 4Z82A 2QQLA 2P3KA 4GJYA 4LO6B 4TLFA 3WNPA 2QQJA 1MS4A 4FT8A 3NAPB 5JSRA 4P9IA 2PAEA 3OPZA 5JWPA 4FFGA 3AFGA 5T55A 4NHXA 4FO9A 1PM7A 3I54A 3MGUA 4NPLA 4OHVA 1R082 2NMOA 4LNVA 1RGSA 4UW5A 3PVNA 4U36A 3RSJA 4CEWA 1BBT3 4KL1A 1JHJA 2DU1A 4LOSA 3RNSA 3CLPA 4R4XA 4MGSA 1S2EA 4MGQA 2Q1ZB 4R9DA 2Z42A 3KZ4C 1L7QA 3JBG3 4WZCA 3S30A 3W20A 1MVQA 1QJY2 2VC9A 4YZ5A 3KGZA 1TG7A 4FCAA 5BNNA 1OLQA 4O65A 1S0BA 1LJ7A 4LHKA 1TNFA 3BB6A 5KXEA 2Q8DA 3U37A 1JYIA 1QEXA 1MQTC 5A6ZA 1HXS2 3TOJA 5D1IA 1AUYA 4FOVA 1UOJA 1UZZA 4KNCA 2UWBA 3VBSC 1UZ0A 4QXBA 1B35A 1X8MA 2NM1A 4KG0A 3FHIB 1XRUA 4OI2A 2Y26A 5A6XA 2VOXA 4QPYA 3N36A 4UFKA 4ZONA 3KM5A 2XVKA 3OY8A 1FPN3 2DCJA 2KXLA 2QDNA 2QQNA 2UWAA 5DDJ2 1CZTA 4NAOA 3G7DA 3DEMA 4H3WA 2YFZA 3O12A 5DMYA 2NPIA 3ILRA 4IW3A 2XR4A 5EFUA 5ERLA 5A6YA 5FKCA 3VBFB 5A33B 5FZOB 5GALA 2WWJA 1US3A 3VBUC 3OJBA 2YB7A 3D4KA 3CQOA 5F3GA 2W9XA 2AYHA 3A0NA 1AYN2 1OA3A 3IDAA 2RS13 4IQPA 4OVEA 1MZEA 2D6NA 2E32A 1MEC3 1E5IA 2ARAA 4LUMA 1NA1B 5D21A 1BK0A 1POV1 5FY5A 4TYSA 4E8DA 2WZR3 3CJIB 5H9SA 1OF4A 1RUC2 3IKWA 4GB32 4YW3A 1KS4A 2XBO1 4X8PA 4YM3A 3BTYA 4GALA 1GOFA 1LGNA 5FZ0A 3IM0A 4M00A 1PO13 2YFUA 2AREA 3IZOA 3SH5A 1UU4A 4META 4CCEA 2HWD1 1K5MA 4HANA 4O9EA 5LRRA 3USSA 1OVSA 5HBAA 3I2IA 1ND2A 3GBWA 2EA7A 4HXCA 4COWA 1E5SA 1WW4A 1CQ9A 5B4XA 5FO9B 5FBJA 2FMYA 1GP4A 4GZ9A 1VB2A 1XJAA 3ON7A 1VR3A 2VUAA 1RUD1 2RG4A 2WNVA 4OYUA 3ZXJA 3WDYA 4LBNA 4ZZ8A 3H8XA 2C9AA 1HX6A 2RMU1 4D69A 1MZFA 3POYA 5FZ4A 1S4CA 1UN1A 1V6MA 3R05A 1RIRA 5CZKA 2VH9A 2JDAA 3POFA 1Y3TA 4MGZE 2LALA 3N9QA 1C8NA 3ABZA 3SISA 1WD3A 5J7MA 3EBRA 1S0EA 3ZVXA 3NJXA 3Q8FA 2WS92 2QUOA 4IETA 4EN6B 1GOHA 1UIKA 4GA9A 2WT2A 3POWA 4OUEA 3PMSA 4QKDA 3ZKUA 5FY0A 1H1MA 1PVC1 4QPGA 4AI2A 4D94A 4NMIA 2DTYA 4Q4X2 5FP4A 2JE8A 1XU1A 4EZ4A 1L7RA 2ZGKA 3DCQA 4DQAA 2D7FA 4XJ8A 3ZR5A 4D3WA 1JS9A 3PURA 5IT6A 4XQWA 3I3MA 2IFWA 4NWWA 4URAA 1W9FA 4V2WA 3AFKA 1ZX5A 1NLSA 1GNZA 1GWMA 4HETA 5LEKA 4LBKA 1WUVA 4QAWA 1E5HA 1TMF1 3PUAA 4EWDA 2VU9A 4NAMA 2WSVA 2EXKA 3WNKA 4CTEA 1CJDA 2AACA 1VLNA 2GNDA 2VQAA 1MVEA 2BWAA 3AYEA 5B4NA 3AYCA 4CDWC 1NCRB 4Z2WA 2TBVA 2VE1A 3MIGA 4I0WB 5C9AA 1IS3A 1Q8PA 3DL3A 3RFRA 4R9AA 4E4SA 3MV11 1LCLA 2WNUB 5F5QA 4QPIC 2RJ2A 4BCUA 2QQPA 1UKGA 2J1TA 1B09A 2BUKA 4A41A 3I2JA 3VKMA 3UK9A 4B7KA 5EV7A 1RB8G 3IWZA 3T1MA 4NIIA 1JODA 3W21A 1W6NB 1YUDA 2JDYA 4XUNA 4KWLA 2JDZA 1Q3EA 4WVMA 2Y33A 3AZXA 1LR5A 3HPNA 1O91A 3ZFEC 1H1IA 4CPBA 2D3SA 2Y38A 4QX5A 4BPZA 4LE4A 5LA0A 2Y6FA 3KVAA 2WO3A 2VMHA 1JH5A 5FK7A 1ODNA 3JXSA 4OLLA 3VHRA 2MEV1 2D97A 3WCSA 3V0BB 2W91A 4X8NA 1XE0A 1EV11 5FO8B 4XAAA 5JOWA 5JSPA 4LIVA 3U14A 1JOPA 1G86A 1RITA 4NWVA 2BOJA 1RMU2 2YU2A 4K7JA 2B4KA 1XB9A 1UMIA 2ZMNA 3HQUA 1HQLA 1KEXA 5T5LA 5BUVA 1S2BA 4HN0A 1W2OA 2Y34A 1QDCA 3AP9A 3RRDA 1BHGA 1YFWA 3CNAA 4RFT0 2PMWB 1YRZA 4QX7A 3LPFA 1UNBA 1WW5A 3MFAA 4ZHNA 3ELNA 4IV1B 2VM9A 4FSJA 2EIBA 1H8VA 4RS5C 2QBXA 3OGVA 1YJKA 4E4ZA 5C3SA 1BBT2 4FFIA 4OUMA 1IPJA 2R49A 3E6CC 2MNGA 5DG1A 2WYSA 4KQ7A 4S2DA 4BMBA 3WW2A 4XHXA 4AGGA 5L9VA 4FXKB 1OQDA 4QX2A 4Y26A 3ST7A 3TNQA 2R30A 2GNTA 3LKJA 3JBG2 4OHYA 1UQXA 1WZXA 5FZFA 2VPVA 4CCLA 2V72A 4GMP1 2PQSA 1QHDA 3T0BA 4M3CB 2A6VA 3POBA 5F5AA 4ZXKA 2RDSA 2F4PA 5DUUA 4AEDA 4AHZA 1F4HA 2AENA 1W8WA 4P14A 4A44A 1HQNA 4BE3A 1W8HA 4BISA 4RR3C 1W0OA 5DPNA 2VUCA 5I8TA 4HVOA 5J96B 3LPGA 3LA2A 3WV6A 4XFBA 1NXD1 4TTGA 3WUCA 2GALA 1LODA 1H2KA 3AJZA 3BIWE 3EXUA 1GZTA 3J7HA 1FPN2 3AMNA 2YV8A 2JX9A 4DINB 3GBGA 2RJKA 2W1UA 3G6JB 4BK5A 3W58A 2BQPA 1H2MA 4RQPB 1DYPA 1RUI1 1WLDA 2DCZA 2L9LA 1SLIA 2N7GA 1V6JA 3ZDVA 1JI6A 3B5LB 4DY3A 2A70A 4BLJA 2FZ1A 3V65A 4QB1A 2P6HA 2RS12 3ZYRA 2WINB 2Y60A 3PTYA 3R4UA 1MEC2 2QE3A 4CP9A 2LTNA 1DGWA 3M4FA 1S0JA 4XFHA 3MF9A 2VMDA 2WZR2 4YYOA 2A6YA 4L9BA 3I7DA 3UJOA 3ZKYA 2VZQA 2XB6C 1CIWA 1POV3 2YPJA 4PQQA 4UXAA 2C6SA 4WM8B 4CPBD 2XBO3 4GD4A 1VAKA 4Q4V1 3L2HA 3PUHA 2VMGA 3CF6E 3C3VA 5EYXA 3F95A 4AL9A 4ITCA 1LOFA 5IK4A 3ZN6B 1PZ8A 3PUIA 2FD8A 4LBQA 5KXDA 1S0DA 1R64A 2GN3A 2HWD3 3LIGA 4IV3C 4XUPA 5CFDC 4K8FA 2G9GA 2YC0A 1RUF1 1ND3A 3LA3A 5FTTC 1Y43B 3M3CA 2WA3A 3AKSA 5LRSA 2ZTNA 3VD4A 1RUD3 2ZGUA 2XVLA 2LS6A 5DAVA 1WCSA 3RS6A 5IK5A 1YO8A 2RMU3 4QWNA 2OPKA 3KD4A 1KJLA 1PIV3 3JZVA 3QOPA 1PK6A 3R0RA 4QKFA 3CHXA 5FZHA 5GZGA 2JG9A 3UV9A 5FOBB 5LBCA 5FY7A 4LPLA 5JUVA 4P02B 2R7EB 1MACA 2VZUA 3KQRA 2K9ZA 2YYOA 1ULCA 4ATEA 2R071 2VCAA 1G9BA 3S57A 1W28A 5EHDA 5FPVA 2VTXJ 1PVC3 3MYXA 2UY8A 1XNCA 4YVSC 1QXJA 1AYN1 4KMQA 4DXRA 1MQTB 3AKPA 3PVBB 4DEQA 5DZGA 3I2HA 4LR4A 3VBSB 2VW2A 2EIDA 1STMA 1NCQA 2JIGA 4JGZB 4Q27A 3RG0A 1ENQA 2O8OA 4FPOB 1ZYBA 1UU5A 1ZNPA 3USUB 1GQGA 3P1IA 4HK9A 5CVRA 1JTZX 1UZVA 4ZU4A 1GOGA 2EF6A 4AQTA 4LKDA 2D5HA 1D0GA 2A7AA 4LOTA 2OW4A 1QOOA 1YQ2A 3SHRA 3VBRC 1KDKA 4P5HA 4Y22A 5HCAA 1YI7A 2ORXA 1PGW2 2VY0A 3OPTA 2O8QA 3VZOA 1EUTA 3I4IA 4C0BA 3VBUB 1UY0A 1JZ5A 2MHFA 1OF3A 2YY1A 3AYDA 4QB6A 4QXCA 1CZSA 2HWE1 2XGXA 3OD4A 3IPVA 4CCJA 2LW8A 4YZ4A 4DEVA 5F3EA 2YMZA 4YFZA 3VHOA 5EZWA 5DZEA 4AVCA 1UXXX 3OEAA 1SLTA 1D2SA 2FBEA 4H7LA 4AHXA 1EUUA 3ES1A 3LFIA 3TN91 5JI9A 5DAQA 1AXKA 4TSVA 4BK4A 1AF9A 1JMUB 2RV9A 2XHNA 2Z79A 4DXTA 2WWSA 5EWSA 4FVVA 4PBOA 1LESA 5FMBA 2MEV3 2RS53 5T3NA 4I02A 1EV13 3AL5A 3NMBA 4ZS2A 5FMCA 4WM7A 1O5LA 1RUG1 2RS31 4LBQD 4XEZA 5FUPA 1D7PM 5L7OC 4K40A 4ARYA 5CKNA 2X5IB 1BLZA 1EY2A 2Y6GA 1NT0A 5I8SA 3LF7A 5CKQA 5BYNA 2J1AA 1T2XA 2W1QA 3POGA
chains in the Genus database with same CATH topology
5JXIA 1HN1A 1SG3A 1SHWB 4RYDA 3NJVA 3HJRA 2OKXA 3WF2A 3EB7A 3CDZB 2VMCA 1K42A 2BGPA 5JXGA 3BGAA 3K4DA 1W8NA 2WZEA 2VCCA 2J1RA 1DYOA 1UY1A 1JU3A 4YPJA 4DXSA 3T08A 4IUGA 4OMCA 2W46A 2BGOA 2VL4A 3ACIA 2ID4A 1J84A 3CZJA 4L0PA 1GNYA 3IAPA 2QQIA 1W99A 1ULPA 1JYWA 3VDBA 3ACFA 2Y6KA 2XOMA 3D3AA 2ZEZA 1F4AA 2J1SA 1UYYA 1XPWA 4W50A 3MO4A 5DN2A 3VDCA 3E1F1 1UMHA 4P5YA 3CIHA 3OBAA 5HXMA 1XNTA 4OMDA 5IYYA 4BDVB 1IQDC 2CDOA 3I2FA 3HNMA 5CYYA 5JMOA 1JZ8A 3K75B 2ZEYA 3NRUA 4KWUA 1NAEA 4M4PA 1O59A 2BZDA 1UY4A 3A21A 4XUOA 4DUVA 3WSOA 4LHSA 4ET7A 3AC0A 3WF4A 4QDRA 4CU6A 3HOBA 2WO2A 1NKGA 1JZ5A 2X09A 1UY2A 3HNYM 4QX0A 2QQLA 3LEIA 4QX3A 3WNPA 2C4XA 4BJ0A 2QQJA 4JHZA 1UWWA 2KD7A 4ZY9A 4MOAA 3CMGA 4PT6A 4UAPA 1JHJA 3W5NA 1JU4A 1GMMA 3I3EA 4MGQA 4MGSA 1PMHX 1JZ3A 1L7QA 3WNMA 1O8SA 2VC9A 3I3DA 1TG7A 1ULOA 2W1WA 3C8XA 3HEIA 3A23A 3U37A 4OZOA 3THCA 3W5MA 3ETPA 1UYZA 1JZ7A 2Y6LA 1UZ0A 1W9WA 1XC6A 1NUKA 2EICA 3ACHA 3C7OA 3K4AA 3NNGA 5EJZB 2VR4A 1MPXA 1H6XA 2J22A 2DCJA 3OGSA 2QQNA 1CZTA 2VJXA 2VZ1A 2YFZA 5DMYA 1CX1A 3MUZ1 1PX3A 1US3A 1JZ6A 2J7MA 3LQCA 2YB7A 3CQOA 2W9XA 2QQOA 4CU8A 3IDAA 4HG6B 4TXWA 3OG2A 2W94A 3WQBA 2E32A 4GWJA 2XONA 4E8DA 1OF4A 4A45A 4JKMA 1GOFA 2VMEA 2V4VA 2W5FA 2YFUA 1PX4A 5LCWL 4LKSA 3A22A 3OGRA 4CUCA 5JXHA 4CVUA 3I2IA 3K77A 3T2OA 4XUTA 3T0DA 4QB2A 3SEPA 5B4XA 2VO5A 2VZ3A 4GZ9A 3FHAA 4OYUA 4XUQA 4ZZ8A 3LE0A 4QX1A 2E26A 1SDDB 3EYPA 5CZKA 3CKHA 1JZ4A 2JDAA 1P8JA 3ABZA 3NJXA 4PF1A 2E33A 1GOHA 4AG4A 4OUEA 4D8MA 2JD9A 4E8CA 2Z4FA 1W8OA 2ZEWA 3DYPA 2VQUA 2JE8A 2WBKA 1L7RA 5G04L 2J1EA 1JYNA 4JX0A 2VZOA 2WO1A 4BXSV 2WAAA 1O8PA 3SKJE 4QAWA 3T09A 4QDQA 4P08A 1WCQA 4GWIA 2BERA 3WNKA 3SKVA 4MO3M 2E31A 5B4NA 5C70A 3SEEA 2Y6JA 3OB8A 5IHRA 4A3ZA 2WDBA 5JR2A 3MV11 2JKXA 1KGYA 1GU3A 2RJ2A 3WF3A 5C71A 2J1TA 1W9TA 4A41A 4DUXA 2YC2A 5IFTA 3I2JA 2CDPA 2VCBA 3IIIA 2ZXQA 5EJ1B 4LQRA 2VMFA 3VDAA 4XUNA 3HPNA 5LA0A 3ZM8A 1NX9A 2WO3A 1K3IA 4AAXA 3MUY1 2J1UA 3JXSA 2QQMA 1OT5A 2W91A 2ORZA 2BBAA 3IAQA 1H6YA 3THDA 4ZZ5A 3MV01 2B4KA 1UMIA 1KEXA 1BHGA 4ZXEA 3VD9A 2C9KA 2J1VA 1US2A 3LPFA 2VM9A 2EIBA 3UNPA 2QBXA 3CZUA 3OGVA 1TVGA 2WYSA 4A42A 2HLEA 3C7HA 4QX2A 1GUIA 1LNSA 4MADA 2VZPA 2V72A 3K46A 3ACGA 1JZ2A 2Y6HA 3T0AA 2PQSA 3T0BA 2Y8KA 3FL7A 2ZEXA 3WNNA 1F4HA 4A44A 2QQKA 5DPNA 3LEGA 3LPGA 4XZUG 3UETA 5G05L 3FHQA 4TTGA 1UYXA 4DUWA 4XURA 3HN3A 3A7QA 1OD3A 3J7HA 2WUHA 2VZVA 1W9SA 4BK5A 2W1UA 3GGLA 4CUAA 5LA1A 3WF0A 2L9LA 5A1AA 1JI6A 2RVAA 2VZTA 3I3BA 4QB1A 1RYYA 2WAOA 3OEBA 4A4AA 3C7EA 1CZVA 2VMDA 2W87A 1K12A 2VZQA 2Y64A 4PQQA 2WZ8A 3F2ZA 3PUHA 3GXUA 3I2GA 4A6OA 3C7GA 3PUIA 3I97A 3MBWA 2X05A 1R64A 3DYMA 3IB3A 5HPOA 4XUPA 2DCKA 3DECA 3WNOA 1PMJX 3K4ZA 2WQ8A 5C7GA 5F7UA 3VD4A 3LEKA 2LS6A 4P00B 2W95A 4UI9L 4CU7A 2W47A 3T2PA 1JYVA 1I5PA 1DLCA 1OH4A 4LPLA 5JUVA 4P02B 2R7EB 3VD5A 2WN3A 2VZUA 4QPWA 2VTFA 2VCAA 2YC4A 3WNLA 3GDBA 2EIEA 2WN2A 4KMQA 4DXRA 3WF1A 4Z2AA 1JYXA 2HYXA 3GM8A 4DEQA 1UY3A 1W0NA 3I2HA 5IFPA 2EIDA 4XVHA 3P1IA 4W4ZA 2WABA 4ARXA 5J1XA 1GOGA 5FUIA 4CUBA 2B9VA 4JKKA 1DP0A 3I2KA 2V5DA 2VQTA 5EIYB 1YQ2A 2ORXA 4CU9A 4KI5M 3VD7A 1GQPA 1EUTA 1UY0A 4UOJA 4FI9A 1OF3A 4QB6A 3DYOA 1CZSA 2XQXA 3P6BA 5JXJA 2LW8A 3C7FA 5DQ0A 4DEVA 2W1SA 2VZRA 3T2QA 2W92A 1UXXX 3VD3A 3OEAA 2DDUA 3FN9A 2VOTA 1J83A 1EUUA 1K45A 2X10A 2W3JA 1UXZA 2C26A 4W8JA 1WKYA 4BK4A 1UX7A 2RV9A 2XHNA 4JKLA 3BN6A 4DXTA 1XNAA 3ECQA 1CIYA 4QDSA 3NQHA 5LA2A 3HNBM 4M4RA 1D7PM 3WEZA 4ARYA 5I0DA 5IJRA 3UESA 2VZSA 2YG0A 4D0QA 2Y6GA 2J1AA 1T2XA 2W1QA 4RN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JXI A;  1HN1 A;  1SG3 A;  1SHW B;  4RYD A;  3NJV A;  3HJR A;  2OKX A;  3WF2 A;  3EB7 A;  3CDZ B;  2VMC A;  1K42 A;  2BGP A;  5JXG A;  3BGA A;  3K4D A;  1W8N A;  2WZE A;  2VCC A;  2J1R A;  1DYO A;  1UY1 A;  1JU3 A;  4YPJ A;  4DXS A;  3T08 A;  4IUG A;  4OMC A;  2W46 A;  2BGO A;  2VL4 A;  3ACI A;  2ID4 A;  1J84 A;  3CZJ A;  4L0P A;  1GNY A;  3IAP A;  2QQI A;  1W99 A;  1ULP A;  1JYW A;  3VDB A;  3ACF A;  2Y6K A;  2XOM A;  3D3A A;  2ZEZ A;  1F4A A;  2J1S A;  1UYY A;  1XPW A;  4W50 A;  3MO4 A;  5DN2 A;  3VDC A;  3E1F 1;  1UMH A;  4P5Y A;  3CIH A;  3OBA A;  5HXM A;  1XNT A;  4OMD A;  5IYY A;  4BDV B;  1IQD C;  2CDO A;  3I2F A;  3HNM A;  5CYY A;  5JMO A;  1JZ8 A;  3K75 B;  2ZEY A;  3NRU A;  4KWU A;  1NAE A;  4M4P A;  1O59 A;  2BZD A;  1UY4 A;  3A21 A;  4XUO A;  4DUV A;  3WSO A;  4LHS A;  4ET7 A;  3AC0 A;  3WF4 A;  4QDR A;  4CU6 A;  3HOB A;  2WO2 A;  1NKG A;  1JZ5 A;  2X09 A;  1UY2 A;  3HNY M;  4QX0 A;  2QQL A;  3LEI A;  4QX3 A;  3WNP A;  2C4X A;  4BJ0 A;  2QQJ A;  4JHZ A;  1UWW A;  2KD7 A;  4ZY9 A;  4MOA A;  3CMG A;  4PT6 A;  4UAP A;  1JHJ A;  3W5N A;  1JU4 A;  1GMM A;  3I3E A;  4MGQ A;  4MGS A;  1PMH X;  1JZ3 A;  1L7Q A;  3WNM A;  1O8S A;  2VC9 A;  3I3D A;  1TG7 A;  1ULO A;  2W1W A;  3C8X A;  3HEI A;  3A23 A;  3U37 A;  4OZO A;  3THC A;  3W5M A;  3ETP A;  1UYZ A;  1JZ7 A;  2Y6L A;  1UZ0 A;  1W9W A;  1XC6 A;  1NUK A;  2EIC A;  3ACH A;  3C7O A;  3K4A A;  3NNG A;  5EJZ B;  2VR4 A;  1MPX A;  1H6X A;  2J22 A;  2DCJ A;  3OGS A;  2QQN A;  1CZT A;  2VJX A;  2VZ1 A;  2YFZ A;  5DMY A;  1CX1 A;  3MUZ 1;  1PX3 A;  1US3 A;  1JZ6 A;  2J7M A;  3LQC A;  2YB7 A;  3CQO A;  2W9X A;  2QQO A;  4CU8 A;  3IDA A;  4HG6 B;  4TXW A;  3OG2 A;  2W94 A;  3WQB A;  2E32 A;  4GWJ A;  2XON A;  4E8D A;  1OF4 A;  4A45 A;  4JKM A;  1GOF A;  2VME A;  2V4V A;  2W5F A;  2YFU A;  1PX4 A;  5LCW L;  4LKS A;  3A22 A;  3OGR A;  4CUC A;  5JXH A;  4CVU A;  3I2I A;  3K77 A;  3T2O A;  4XUT A;  3T0D A;  4QB2 A;  3SEP A;  5B4X A;  2VO5 A;  2VZ3 A;  4GZ9 A;  3FHA A;  4OYU A;  4XUQ A;  4ZZ8 A;  3LE0 A;  4QX1 A;  2E26 A;  1SDD B;  3EYP A;  5CZK A;  3CKH A;  1JZ4 A;  2JDA A;  1P8J A;  3ABZ A;  3NJX A;  4PF1 A;  2E33 A;  1GOH A;  4AG4 A;  4OUE A;  4D8M A;  2JD9 A;  4E8C A;  2Z4F A;  1W8O A;  2ZEW A;  3DYP A;  2VQU A;  2JE8 A;  2WBK A;  1L7R A;  5G04 L;  2J1E A;  1JYN A;  4JX0 A;  2VZO A;  2WO1 A;  4BXS V;  2WAA A;  1O8P A;  3SKJ E;  4QAW A;  3T09 A;  4QDQ A;  4P08 A;  1WCQ A;  4GWI A;  2BER A;  3WNK A;  3SKV A;  4MO3 M;  2E31 A;  5B4N A;  5C70 A;  3SEE A;  2Y6J A;  3OB8 A;  5IHR A;  4A3Z A;  2WDB A;  5JR2 A;  3MV1 1;  2JKX A;  1KGY A;  1GU3 A;  2RJ2 A;  3WF3 A;  5C71 A;  2J1T A;  1W9T A;  4A41 A;  4DUX A;  2YC2 A;  5IFT A;  3I2J A;  2CDP A;  2VCB A;  3III A;  2ZXQ A;  5EJ1 B;  4LQR A;  2VMF A;  3VDA A;  4XUN A;  3HPN A;  5LA0 A;  3ZM8 A;  1NX9 A;  2WO3 A;  1K3I A;  4AAX A;  3MUY 1;  2J1U A;  3JXS A;  2QQM A;  1OT5 A;  2W91 A;  2ORZ A;  2BBA A;  3IAQ A;  1H6Y A;  3THD A;  4ZZ5 A;  3MV0 1;  2B4K A;  1UMI A;  1KEX A;  1BHG A;  4ZXE A;  3VD9 A;  2C9K A;  2J1V A;  1US2 A;  3LPF A;  2VM9 A;  2EIB A;  3UNP A;  2QBX A;  3CZU A;  3OGV A;  1TVG A;  2WYS A;  4A42 A;  2HLE A;  3C7H A;  4QX2 A;  1GUI A;  1LNS A;  4MAD A;  2VZP A;  2V72 A;  3K46 A;  3ACG A;  1JZ2 A;  2Y6H A;  3T0A A;  2PQS A;  3T0B A;  2Y8K A;  3FL7 A;  2ZEX A;  3WNN A;  1F4H A;  4A44 A;  2QQK A;  5DPN A;  3LEG A;  3LPG A;  4XZU G;  3UET A;  5G05 L;  3FHQ A;  4TTG A;  1UYX A;  4DUW A;  4XUR A;  3HN3 A;  3A7Q A;  1OD3 A;  3J7H A;  2WUH A;  2VZV A;  1W9S A;  4BK5 A;  2W1U A;  3GGL A;  4CUA A;  5LA1 A;  3WF0 A;  2L9L A;  5A1A A;  1JI6 A;  2RVA A;  2VZT A;  3I3B A;  4QB1 A;  1RYY A;  2WAO A;  3OEB A;  4A4A A;  3C7E A;  1CZV A;  2VMD A;  2W87 A;  1K12 A;  2VZQ A;  2Y64 A;  4PQQ A;  2WZ8 A;  3F2Z A;  3PUH A;  3GXU A;  3I2G A;  4A6O A;  3C7G A;  3PUI A;  3I97 A;  3MBW A;  2X05 A;  1R64 A;  3DYM A;  3IB3 A;  5HPO A;  4XUP A;  2DCK A;  3DEC A;  3WNO A;  1PMJ X;  3K4Z A;  2WQ8 A;  5C7G A;  5F7U A;  3VD4 A;  3LEK A;  2LS6 A;  4P00 B;  2W95 A;  4UI9 L;  4CU7 A;  2W47 A;  3T2P A;  1JYV A;  1I5P A;  1DLC A;  1OH4 A;  4LPL A;  5JUV A;  4P02 B;  2R7E B;  3VD5 A;  2WN3 A;  2VZU A;  4QPW A;  2VTF A;  2VCA A;  2YC4 A;  3WNL A;  3GDB A;  2EIE A;  2WN2 A;  4KMQ A;  4DXR A;  3WF1 A;  4Z2A A;  1JYX A;  2HYX A;  3GM8 A;  4DEQ A;  1UY3 A;  1W0N A;  3I2H A;  5IFP A;  2EID A;  4XVH A;  3P1I A;  4W4Z A;  2WAB A;  4ARX A;  5J1X A;  1GOG A;  5FUI A;  4CUB A;  2B9V A;  4JKK A;  1DP0 A;  3I2K A;  2V5D A;  2VQT A;  5EIY B;  1YQ2 A;  2ORX A;  4CU9 A;  4KI5 M;  3VD7 A;  1GQP A;  1EUT A;  1UY0 A;  4UOJ A;  4FI9 A;  1OF3 A;  4QB6 A;  3DYO A;  1CZS A;  2XQX A;  3P6B A;  5JXJ A;  2LW8 A;  3C7F A;  5DQ0 A;  4DEV A;  2W1S A;  2VZR A;  3T2Q A;  2W92 A;  1UXX X;  3VD3 A;  3OEA A;  2DDU A;  3FN9 A;  2VOT A;  1J83 A;  1EUU A;  1K45 A;  2X10 A;  2W3J A;  1UXZ A;  2C26 A;  4W8J A;  1WKY A;  4BK4 A;  1UX7 A;  2RV9 A;  2XHN A;  4JKL A;  3BN6 A;  4DXT A;  1XNA A;  3ECQ A;  1CIY A;  4QDS A;  3NQH A;  5LA2 A;  3HNB M;  4M4R A;  1D7P M;  3WEZ A;  4ARY A;  5I0D A;  5IJR A;  3UES A;  2VZS A;  2YG0 A;  4D0Q A;  2Y6G A;  2J1A A;  1T2X A;  2W1Q A;  4RN5 A; 
#chains in the Genus database with same CATH topology
 3RQ0 A;  1PM4 A;  1G9D A;  1QOS A;  1S55 A;  4AOC A;  4D7S A;  3VL8 A;  5JOZ A;  4RYD A;  5T5J A;  1ULF A;  5FPL A;  5F2W A;  1IPS A;  4DMI A;  2RHP A;  4Y1U A;  3WF2 A;  3CDZ B;  3N9L A;  1L3J A;  3RI8 A;  4Q1P A;  3ZXE A;  3IIA A;  2G9Z A;  1H9P A;  2P6C A;  3DN7 A;  3VKL A;  2RDN A;  3SCF A;  5K0U A;  2HWF 1;  3EMR A;  4YPJ A;  4DXS A;  4GMP 3;  1DQ5 A;  5CU1 A;  5FLI A;  5A32 B;  3ZFG A;  2NYY A;  2ZGM A;  1A6C A;  5HV4 A;  1VE0 A;  4FAG A;  3POJ A;  1GZC A;  2FDG A;  3U10 A;  4AQS A;  2XWB B;  1MR5 A;  2KM2 A;  4S2F A;  2W2I A;  2XJS A;  3JCI A;  1V70 A;  2JDK A;  1SLL A;  5T52 A;  4XJW A;  5FZC A;  4CDW B;  1ASJ 1;  3AMM A;  2F4L A;  4BOW A;  2R0F A;  4F3J A;  4OI0 A;  4NRQ A;  4YM0 A;  5EXO A;  3NST A;  4XJA A;  3IDE A;  1IG0 A;  2VNO A;  3POS A;  4QPI B;  4FOQ A;  1W90 A;  1VRB A;  3AKT A;  2GP3 A;  1FNY A;  1BZW A;  2P3J A;  1I3H A;  1V6K A;  3CU7 A;  1GKB A;  4LHN A;  3WDX A;  2EXJ A;  1RUI 3;  1S0I A;  4N43 A;  4XXP A;  3J26 N;  5FYB A;  5HCF A;  2ZHK A;  5SV5 A;  4AFB A;  5A3N A;  5C8C A;  5FPB A;  4NRM A;  2J1S A;  5A7O A;  2DTW A;  1XPW A;  5AVP A;  1AX1 A;  3ZFE B;  3MDP A;  5FZM A;  4CZS A;  2CHH A;  1SPP B;  5E8A A;  4P5Y A;  4H2A A;  4MXW A;  2A3W A;  4QGL A;  3UGH A;  1VBC 1;  1W8Z A;  5IYY A;  3LOB A;  4PHZ A;  1A3K A;  4J6G A;  4CXW A;  4LBL A;  2XBO 2;  3FFZ A;  3I49 A;  4W6X A;  1BEV 2;  3LIH A;  2CDO A;  3ZPO A;  5BNN C;  5CYY A;  1O3S A;  1ENR A;  1JZ8 A;  3K75 B;  3QBQ A;  4KWU A;  5FYU A;  4XF4 A;  4M4P A;  1OSG A;  2BZD A;  4Q4V 3;  4HZF A;  4LXL A;  5AVA A;  4UW6 A;  3WD5 A;  4FPC A;  3BCW A;  3HVD A;  4KU7 A;  4LHS A;  3ZIX A;  1Z78 A;  5IVV A;  2BNN A;  3AC0 A;  4B1L A;  4CU6 A;  3HOB A;  4QGN A;  3U4S A;  1B35 C;  5GZC A;  5JOY A;  4NR1 A;  3KGL A;  4MYE A;  2GH2 A;  1POV 0;  4PIX A;  4K20 A;  4RS5 B;  2CY6 A;  4EN8 B;  3HNY M;  1TNR A;  1YQ8 A;  1RUD 2;  3LEI A;  5C3Q A;  4XDQ A;  2VXJ A;  1RUF 3;  2C4X A;  3RGB A;  2QJV A;  2RMU 2;  5FZE A;  4DZG A;  1XND A;  4ZY9 A;  1PIV 2;  1RED A;  5IVF A;  3LFM A;  4TN7 A;  4UWD A;  1FPN 1;  3CMG A;  2XLA A;  3RZZ A;  4YW2 A;  3FZ3 A;  1U5Y A;  1H4H A;  1HKD A;  3NJZ A;  3Q8C A;  4PDW C;  1SBD A;  2DBI A;  2PYT A;  1PVC 2;  1JU4 A;  3DKQ A;  4C8D A;  3BU0 A;  3OBZ A;  3I3E A;  2CGP A;  3NV3 A;  4MHU A;  1DG6 A;  1REE A;  4RR3 B;  2R07 3;  2BFU S;  4QU2 A;  5AFE A;  2ZGR A;  3WNM A;  1LAJ A;  1O8S A;  1MEC 1;  1RXF A;  1OKQ A;  3I3D A;  1TZO A;  3ZXF A;  4H14 A;  1AYN 3;  1ZRF A;  2JE9 A;  3I8T A;  3M8L A;  2GAU A;  4N7I A;  4LBJ A;  4ZPI A;  1LOE A;  4BQX A;  2AEZ A;  2DCT A;  3HEI A;  4QX8 A;  2Z69 A;  4CCK A;  3THC A;  3ZFF A;  1UYZ A;  5FYT A;  1EPW A;  2QFE A;  3P5B A;  1GQH A;  4Y5Z 0;  1QU0 A;  2Y6L A;  1ND2 C;  1W2U A;  2NZ9 A;  1W9W A;  1XC6 A;  1NUK A;  1F5J A;  2EIC A;  1FXZ A;  2UU8 A;  3AP6 A;  2D3P A;  2ARX A;  3C7O A;  1X33 A;  2JG8 A;  3K4A A;  2VR4 A;  3WQ7 A;  4Z1V A;  4P9Y A;  3BKZ A;  5F3I A;  2WNV C;  5KHJ A;  1SAC A;  2ZS6 B;  3OGS A;  4IEQ A;  4IE7 A;  4BM8 A;  1KIT A;  1EP0 A;  4MHR A;  3WXP A;  3DF0 A;  2HWE 3;  2JB8 A;  1F35 A;  3HQX A;  4JGY C;  4GH4 A;  1LOA A;  4PLO A;  5A80 A;  3AP7 A;  1JZ6 A;  3A4U A;  1PO2 1;  3LQC A;  3SIT A;  5GKA C;  4BQW A;  1H8T C;  2HEV F;  3VZJ A;  5DAP A;  5FMD A;  1FV2 A;  2W94 A;  5EP9 A;  3B3Q E;  4IE6 A;  3TN9 3;  1AJK A;  1UL9 A;  4GWJ A;  4AEM A;  5JDB A;  2ZX2 A;  3GBF A;  2YGM A;  4AR2 A;  1OA4 A;  3MW2 A;  3BPZ A;  4K21 A;  5CB7 A;  4IV3 B;  3AZV A;  2I74 A;  2MEV 2;  2RS5 2;  4PF5 A;  4UFM A;  4B4R A;  4YZ1 A;  3I59 B;  3OYW B;  3O1S A;  2V4V A;  1ZZ9 A;  1PX4 A;  3ZYP A;  4FPE A;  5CFC A;  3T2O A;  1RUG 3;  2RS3 3;  1WGP A;  4XUT A;  3T0D A;  2A71 A;  4QKN A;  2E6V A;  1BKZ A;  4N53 C;  2DV9 A;  2VZ3 A;  4NRP A;  1NQJ A;  3VBO C;  3LA7 A;  1UCX A;  4FPK A;  1WBL A;  2ES3 A;  1A78 A;  4XUQ A;  5C5U A;  4FP2 A;  3B69 A;  2E26 A;  4EWA A;  4LO4 B;  3NAP A;  2VD7 A;  1SDD B;  4OI1 A;  1PGW 1;  1JZ4 A;  5T5P A;  4HSL A;  3POE A;  4AGR A;  3WP5 A;  3H50 A;  4YVS B;  4B1M A;  4H55 A;  1X50 A;  4PF1 A;  4AG4 A;  2AGS A;  2FZ2 A;  3B01 A;  3WX5 A;  2GC3 A;  2QDR A;  2JD9 A;  2IXI A;  2XJV A;  1W04 A;  2Z4F A;  2ZEW A;  4AEK A;  2FCT A;  4O7X A;  3ZXA C;  2CTV A;  1QXP A;  5C33 A;  2VVD A;  2HWF 3;  4PQ9 A;  5G04 L;  3JQX A;  5J36 A;  4XFC A;  3RVH A;  2BGC A;  5L9B A;  5L9R A;  1CAU B;  3DXU A;  3KSC A;  5JIA A;  1CAV B;  2GC2 A;  3SKJ E;  3VBR B;  1ODM A;  1YXW A;  4U2A A;  2PXJ A;  4NN0 A;  2ADD A;  3ILN A;  1C1F A;  1ZRC A;  4AGV A;  4M3C E;  4MH0 E;  4FP3 A;  5I0U A;  4XJ9 A;  1RUN A;  4MX3 A;  4GMP 0;  3WW4 A;  1NYW A;  4LEJ A;  4LO7 A;  1ASJ 3;  4LKF A;  4P08 A;  1ONA A;  1PNG A;  3QH6 A;  2WYF A;  4GWI A;  4YG3 A;  3LWC A;  3BU7 A;  2ETE A;  1C8M 3;  3KF5 A;  3SKV A;  2GC1 A;  4KGQ A;  3PIG A;  1RUI 2;  3S7E A;  3ZN5 A;  4LUK A;  4F8A A;  3JQW A;  5FPX A;  1D4V B;  1TQ5 A;  4A3Z A;  1U5I A;  5E1R A;  1CAX A;  4JHT A;  3FC0 A;  4G4F A;  2JKX A;  1KGY A;  1AXY A;  3VZL A;  4D6S A;  4Z8B A;  5FWJ A;  3WF3 A;  1LGC A;  2JJ6 A;  1IOA A;  1CWP A;  5A6Q A;  4R4Z A;  3NV2 A;  5IFT A;  2QVS B;  4Y1V A;  5EPA A;  1DQ4 A;  3FWE A;  5EJ3 A;  4XYX A;  1YJL A;  1VMJ A;  2JXA A;  1LOB A;  5FQ0 B;  1LU1 A;  2P37 A;  5EJ1 B;  3SCH A;  3UYJ A;  2RDR A;  1S0G A;  5FYZ A;  4YVW B;  3VBH A;  2OPW A;  2H0V A;  1VBC 3;  4UBH A;  2E53 A;  1REF A;  1WLC A;  1XSR A;  4XQ4 A;  4HBN A;  3MIE A;  3CJI A;  4LLO A;  4Q4V 2;  3ZM8 A;  4AED C;  4CCC A;  1K3I A;  4AAX A;  1UKR A;  3B02 A;  5L7O B;  2QQM A;  1GYK A;  2EAL A;  2DFB A;  3LSD A;  5GM0 A;  1SZB A;  4YZ2 A;  1RIN A;  3THD A;  1BMV 1;  3MV0 1;  1CAW A;  2YXS A;  1XOY A;  1JBC A;  1WCD J;  2NQY A;  2VNG A;  4Q0V A;  4M3C F;  5IWF A;  3O1U A;  1RUF 2;  4BH9 A;  4YM1 A;  5F39 A;  3LDK A;  3VHP A;  4ZXE A;  4YW1 A;  5GZE A;  1OPM A;  3V56 A;  3V64 A;  1RUE 1;  2EXI A;  5A7Q A;  2DFC A;  1G9A A;  4MSV A;  3M3O A;  1IZ3 A;  3UNP A;  4XW3 A;  3RMX A;  3CZU A;  3T4V A;  2GME A;  3S6P A;  3K51 A;  4LBO A;  2VGD A;  2OII A;  2QZ2 A;  2R04 1;  3S7I A;  4NOT A;  4Q0U A;  4FOW A;  1RVF 3;  4AF9 A;  1RTV A;  5IW0 A;  3VDD A;  1XNK A;  3MLJ A;  5DZF A;  4AWD A;  1IS5 A;  1GUI A;  1R09 1;  2R07 2;  4AFA A;  1G8W A;  2XKP A;  2ZA9 A;  1LNS A;  4CEY C;  2VZP A;  1WBF A;  5LBE A;  2VNR A;  2LM3 A;  1JZ2 A;  1XBF A;  2Y8K A;  3FL7 A;  4ONU A;  2ZEX A;  3WNN A;  1SLA A;  2PAM A;  2QQK A;  5LEJ A;  4D6R A;  3LEG A;  3DKW A;  2J42 A;  1H2N A;  2TEP A;  1LOF C;  4OHW A;  1BEV 1;  4AW7 A;  3FMG A;  4JRA A;  4NPR A;  3A0K A;  1AL0 G;  2EAK A;  2BVB A;  4DUW A;  4CCD A;  1M06 G;  1W0P A;  2VNV A;  4SBV A;  1FX5 A;  1PHM A;  1W9S A;  4ORF A;  4YW7 A;  1LUL A;  3GGL A;  4UBG A;  4K9S A;  3FE5 A;  1N1T A;  2VVF A;  2HWE 2;  1RHI 1;  3GZT B;  2JEC A;  3HBK A;  1NCR A;  4A7Y A;  3PUS A;  3HIF A;  2RVA A;  2RE9 A;  2VZT A;  1PVX A;  2H0B A;  3I3B A;  2JG9 C;  5JPN B;  4LHL A;  1DYK A;  2WNU A;  1PIV 1;  2Q0A A;  3M2M A;  4XAE A;  3OEB A;  4DB5 A;  1PO2 3;  3S5A A;  2G1M A;  4Q0Q A;  5BNN B;  4I01 A;  3TN9 2;  2WFP A;  4C0H A;  1CJP A;  1Y9G A;  2WA4 A;  1CZV A;  1Z7S 1;  2W87 A;  1LRH A;  3AZY A;  4R8H A;  1W6N A;  1VBE 2;  5B2G B;  3B94 A;  2Q8C A;  1SCR A;  2VXR A;  4Y20 B;  3ZXL A;  2WZ8 A;  1NCQ C;  3R4S A;  4XET A;  1GZW B;  1YCI A;  1W8U A;  3CEW A;  5D2A A;  5LY1 A;  4AE2 A;  3R4D B;  3RWK X;  4X6Q B;  2LRP A;  3AB0 A;  2W39 A;  4HN1 A;  5JMC A;  3V0B A;  3OY8 B;  4SLI A;  1RUG 2;  2RS3 2;  1DF0 A;  3MBW A;  3QD6 A;  5FYI A;  3DYM A;  3IB3 A;  4NO4 A;  1XE8 A;  5I8Y A;  2Q8O A;  5CAD A;  2E7T A;  4OQ9 A;  1AX2 A;  3HD8 B;  4ERO A;  2UUR A;  3Q8A A;  4FPL A;  3O1O A;  3H7J A;  3HN1 A;  4PDW B;  4ZKT B;  2Y0O A;  4P00 B;  1HRI 1;  2W95 A;  4IV1 A;  4EE2 A;  4IE0 A;  3H8O A;  3BUC A;  2A6Z A;  2ZGL A;  3T2P A;  1YIP A;  3OUJ A;  1F15 A;  1NZC A;  1I5P A;  1DLC A;  1OH4 A;  3UGF A;  1LEC A;  3HAG A;  4JTN A;  4M0N A;  2IXC A;  3PJY A;  1NLQ A;  2WN3 A;  1S2K A;  3WG4 A;  2BWC A;  2HWF 2;  2YHJ A;  4IEU A;  4XXA A;  3TB0 A;  4DPN A;  1WMD A;  3AZZ A;  4RSU A;  4L8Q A;  3WF1 A;  4Z2A A;  1JYX A;  2HYX A;  1IQA A;  1UY3 A;  5M0T A;  1W0N A;  3HBZ A;  4YW5 A;  4BIF A;  2VMI A;  1OXC A;  4IEV A;  4M3C A;  4O61 A;  5K9Y A;  5ABJ C;  1XSQ A;  4I09 A;  3ZYI B;  4E2S A;  5JAX A;  3O5S A;  5FUI A;  2WNV B;  4WM7 C;  4IEY A;  1OD5 A;  1ASJ 2;  3WT3 A;  2YPD A;  3AX4 A;  2RS5 1;  1VBA 1;  2V5D A;  4AK3 A;  4CXX A;  3W9A A;  5EIY B;  4PI2 A;  1C8M 2;  1NY7 1;  3LOI A;  5JI7 A;  3WP4 A;  3ZMO A;  5FZK A;  4R52 A;  1YLL A;  3NJY A;  3MW4 A;  4JGY B;  2FDI A;  1GQP A;  2IVJ A;  1U5X A;  2XKO A;  5BV6 A;  4JZR A;  4RL7 A;  4FTS A;  3IMM A;  1H8T B;  1GBG A;  1GP6 A;  4RQP A;  3NL1 A;  5JZG A;  3D8C A;  3KWV A;  1O5U A;  3P6B A;  1MS0 A;  3E97 A;  1F9K A;  3WDV A;  2NLR A;  4HVQ A;  5C6C A;  2FCU A;  4JV4 A;  1AYM 1;  5DQ0 A;  5JVV A;  1UOB A;  3GZE A;  1AR6 2;  4GAZ A;  2W68 A;  3NNJ A;  2AR6 A;  3KCY A;  2JDM A;  3AMH A;  5J3U A;  1UZW A;  1SLB A;  2DDU A;  5L19 A;  4FPJ A;  3WOG A;  1VBC 2;  3WVJ A;  2IWG B;  3B00 A;  3N3H A;  4YW6 A;  2C26 A;  5A7S A;  5T5O A;  1R1A 1;  1GIC A;  2DVF A;  2XUE A;  3BN6 A;  2Q8E A;  4C91 A;  2IVI B;  1XNA A;  2OZJ A;  2BDR A;  3C2U A;  2SBA A;  2WRA A;  3E6B A;  1DGL A;  2WJS A;  4WM8 A;  4AXO A;  3UKT A;  4N53 B;  5GLT A;  3VBO B;  3FUO A;  5C3O A;  1FT9 A;  1K5J A;  3H3L A;  4L99 A;  5ANQ A;  5LA2 A;  3AM2 A;  2NMN A;  3ZOI A;  4M4R A;  1LGB A;  3BTX A;  3ZN6 A;  3O14 A;  4EQV A;  2G9F A;  5A1L A;  5FFO C;  2JD4 A;  1RC6 A;  4I2O A;  3FBM A;  3OF1 A;  3UES A;  2YG0 A;  5F9T A;  1RUE 3;  3ETQ A;  4AVT A;  1J59 A;  3B7M A;  3RZJ A;  4L92 A;  2VUL A;  1AR7 1;  1CX1 A;  1AL2 1;  1SG3 A;  3PNA A;  1RVF 2;  3NKT A;  5F8P A;  3NJV A;  5I93 A;  5KC5 A;  2D44 A;  1W6P B;  2R04 3;  4WVM B;  3PIJ A;  2VMC A;  3FX3 A;  4JCK A;  1K42 A;  4LMF A;  1ALY A;  3PDQ A;  2D40 A;  4YWA A;  2XJR A;  5JXG A;  3TNP B;  1R09 3;  2VCC A;  4DO0 A;  2J1R A;  2C5D A;  5A7N A;  4AI8 A;  1OUS A;  3T08 A;  5FZI A;  3EHK A;  3IDB B;  4XC9 A;  3D0J A;  2CU5 A;  5FLH A;  1O3Q A;  2NN8 A;  3TYJ A;  1QDO A;  2R06 1;  1UU6 A;  1MQT A;  1CON A;  3VBS A;  1J3Q A;  1V6N A;  4OMC A;  2W46 A;  4JGZ A;  3N7M A;  2B7Y A;  3K3N A;  5BNP A;  5I0S A;  1OOP C;  1HDK A;  4RGA A;  3ACI A;  3MIH A;  3O0W A;  3USU A;  1BEV 3;  2ID4 A;  4RHV 1;  5IK8 A;  5LK5 A;  5I91 A;  1QH6 A;  4ISR A;  2GMM A;  1VIW B;  1GNY A;  3GYD A;  4L0P A;  4W65 A;  4I0A A;  1JYC A;  5AC9 1;  4MGY E;  3BVC A;  2HWC 1;  2B8M A;  1ULP A;  3VBU A;  5D8A C;  4J25 A;  1RHI 3;  5KHH A;  1WLT A;  2K0G A;  2R0H A;  3D3A A;  4AHY A;  1PO2 2;  3S5Q A;  2ZEZ A;  3W59 A;  1F4A A;  3MI8 A;  4L11 A;  3EJK A;  4W50 A;  1AVB A;  2E7A A;  5DN2 A;  1C3H A;  3VDC A;  1NG0 A;  4PBP A;  2ZOE B;  1Z7S 3;  1BQP A;  4S2G A;  1TME 1;  4HMZ A;  4IE5 A;  1JW6 A;  2ZX0 A;  1UW8 A;  5BNO A;  1XYN A;  4JQT A;  3HNM A;  4G9S B;  2OXB A;  1NAE A;  4MGT A;  1O59 A;  2QKD A;  3A21 A;  4MGI E;  2F6B A;  1HB3 A;  4DUV A;  2DUR A;  3RMY A;  3ZXD A;  3EO6 A;  4FXG B;  4LA3 A;  4N8M A;  2G4I A;  4QDR A;  1WD4 A;  3U07 A;  2WO2 A;  4GXL A;  1F2N A;  3LZZ A;  4JDO A;  2DYC A;  1DGR N;  2X09 A;  4GUL A;  4RD7 A;  3DPR C;  5C4W C;  1JOB A;  2JG8 C;  4XAB A;  2BNM A;  4QX3 A;  1YFX A;  3MZH A;  2H6C A;  1QWR A;  2ZZQ A;  4JHZ A;  2OYZ A;  4A7Z A;  2X5I A;  3CBN A;  4GJZ A;  3OCP A;  4UW3 A;  4BJ0 A;  4FTB A;  4MOA A;  2WO7 A;  3FLR A;  5A7W B;  4CP9 B;  1W6Q B;  1MZ6 A;  1OHF A;  4IES A;  1HRI 3;  3URF A;  4CEY B;  3BPS A;  2DF7 A;  1HIX A;  2QQV A;  3JU9 A;  2R6Q A;  5IVJ A;  5E89 A;  3H9A A;  4UAP A;  2PHL A;  4QKB A;  4BQ2 A;  1GMM A;  2RM2 1;  1X9T A;  2ZMK A;  3U0Z A;  1ULG A;  2GSY A;  1JOJ A;  2GH8 A;  4XDO A;  1ZA7 A;  4HKL A;  3AMQ A;  5GZF A;  4LBQ B;  4BQY A;  1ULO A;  4Z07 A;  3VKN A;  4PIZ A;  2WLQ A;  3TEX A;  3ZX7 A;  5A32 A;  3A23 A;  3ZSL A;  2WQZ C;  1VBE 1;  3OGJ A;  5CA6 A;  5A3W A;  3J7N A;  3ETP A;  2D43 A;  1OPO A;  1AR8 3;  1JZ7 A;  5JLV A;  1QF3 A;  1VBA 3;  3NNG A;  3ACH A;  4CDW A;  1U5Z A;  1A8D A;  5KXC A;  2JG9 B;  1H6X A;  1LOG A;  2J22 A;  5F3C A;  3RZK A;  3WDU A;  4ZU5 A;  4QMA A;  5FRA A;  4QPI A;  3RJ2 X;  5KBF A;  1W2N A;  2ZAA A;  1Q56 A;  5FP3 A;  2IFR A;  2ZX3 A;  5GLW A;  3L9J T;  1W8T A;  2PHX A;  2XLG A;  3MUZ 1;  5J48 A;  2GNB A;  1ENS A;  2WL1 A;  4YM2 A;  5FYM A;  4CDU C;  4CP1 A;  1AYM 3;  1V6I A;  1WMF A;  3WW1 A;  1DHK B;  2QQO A;  1UYP A;  4CU8 A;  4URT A;  2D6M A;  4HG6 B;  5FMO S;  5IAV A;  2IC1 A;  3O1R A;  4TXW A;  1NCQ B;  3B9I A;  3OG2 A;  1T6G C;  1N3Q A;  1PMI A;  3MID A;  1GR3 A;  1SPP A;  3ENR A;  2D3R A;  3DUI A;  3WCR A;  5CAZ A;  4AHW A;  1YYN A;  5AFB A;  3KS7 A;  1R1A 3;  5LAT A;  1YEW A;  4UYB A;  2ILM A;  4CDX A;  1XU2 A;  4JKM A;  3WQ1 A;  2ZAB A;  4AVB A;  3TBD A;  1IS4 A;  3NNL A;  5FYV A;  4E9K A;  1PGL 2;  1OUR A;  4EWE A;  2DCY A;  4Y22 B;  2ADE A;  1Q5O A;  4QXK A;  2ZGN A;  3OGR A;  4XAC A;  1BMV 2;  4FPH A;  5JXH A;  1QGL A;  5FKB A;  2GP5 A;  4CVU A;  1JN2 P;  5FCC A;  4CDQ C;  4EZH A;  4PJY A;  1W6O B;  3K77 A;  2D6K A;  3ASI A;  1YI9 A;  4CP0 A;  1CD3 G;  2WSU A;  3SEP A;  2VO5 A;  3P3N A;  1RUE 2;  2JEM A;  3E5U A;  4RS5 A;  4XBN A;  3O1M A;  3WLU A;  3UKV A;  2W52 A;  1Z0H A;  2FMD A;  1YQC A;  5H9R A;  3VL9 A;  3WIN E;  5FR3 A;  1C8M 1;  1HJF A;  3LE0 A;  1DQ6 A;  1VAV A;  4QX1 A;  4COZ A;  5KWR A;  2FDF A;  2XHK A;  4NIG A;  1YWK A;  2R04 2;  2GNM A;  3CKH A;  1AR7 3;  4NHK A;  1AL2 3;  1NLR A;  3Q8B A;  4LIU A;  4O9G A;  3O1T A;  1AR9 1;  5FIX A;  1OA2 A;  1CGP A;  3TEW A;  3GCX A;  3LD8 A;  4CYD A;  1WA6 X;  1FI2 A;  1UZY A;  1R09 2;  4YGD A;  2BV4 A;  1ZBE 1;  5CG9 A;  5HCH A;  4CEW C;  4E8C A;  2PN5 A;  4ZU7 A;  1DFQ A;  1F31 A;  2CL2 A;  3DYP A;  1AR6 1;  4HON A;  5GLU A;  3VBH C;  3IN9 A;  4LO8 A;  5ABJ B;  1EPZ A;  2WBK A;  2HJI A;  1SBE A;  2J1E A;  3RZL A;  2G19 A;  3MIF A;  3DXT A;  4WM7 B;  5ANN A;  5APA A;  1SDW A;  1SQ4 A;  4JX0 A;  2PLV 1;  4QQ2 A;  5K7P A;  2R06 3;  2VZO A;  2VQ0 A;  2VAU A;  1H30 A;  2WO1 A;  4BXS V;  1VBB 3;  2C0Z A;  2VBB A;  1RUH 1;  5HCB A;  4Y4R A;  2ET1 A;  4NHM A;  2JDP A;  1OH3 A;  3LDB A;  3BOW A;  2ZGT A;  4QDQ A;  4RHV 3;  3T09 A;  4YGB A;  2ZZJ A;  3GAL A;  3L2Y A;  5A3O A;  4QHB A;  4WVW A;  5KHI A;  3GHM A;  2XL9 A;  3RJR A;  1SMV A;  2BER A;  4OQ8 A;  1SFN A;  4MO3 M;  5AC9 3;  5C70 A;  3SEE A;  1RHI 2;  2Y6J A;  2HWC 3;  3OB8 A;  2OUJ A;  4C1W A;  4UFH A;  4I0B A;  1LB2 A;  3BOD A;  5JR2 A;  4BWO A;  2HWB 1;  4PCR A;  1GU3 A;  4A2U A;  4LUL A;  1QKQ A;  4YRD A;  1W9T A;  3VDD C;  2PHF A;  2V09 A;  2YC2 A;  5IVY A;  3APB A;  4OHX A;  2CDP A;  1Z7S 2;  1RVF 1;  2VCB A;  5J98 B;  2IXJ A;  4KH9 A;  1VMH A;  4LQR A;  2VMF A;  5ISL A;  2Q1F A;  1TME 3;  1W6M A;  2XLF A;  3VKF C;  1UD1 A;  5J09 A;  1KFU L;  3M3Q A;  4P9X A;  1C5H A;  4E2Q A;  3MUY 1;  4NIA A;  2J1U A;  5F5I A;  3UGG A;  1GLH A;  1FOD 2;  4FQZ A;  2ORZ A;  2BBA A;  4XF9 A;  1H6Y A;  3I59 A;  1JXN A;  4DRR A;  2YDE A;  2VCM A;  3BTA A;  2B39 A;  3E6D A;  2YBP A;  4XF1 A;  4PIY A;  3LAG A;  4QQH A;  1LHU A;  4AFM A;  1K5M C;  2O14 A;  2ZKN A;  5BXX A;  1BK1 A;  2C9K A;  3N9P A;  4WV8 A;  4ASM B;  1PGS A;  4XFG A;  1Y9M A;  4CCO A;  1US2 A;  4I3P A;  1ZA4 A;  4Q1R A;  5TSW A;  1HRI 2;  5T50 A;  1JYT A;  2AZ5 A;  2JDH A;  1YQ6 A;  1APN A;  4XFI A;  2C1F A;  3MHZ A;  2Q4S A;  2E9Q A;  4XCA A;  4FPY A;  2DUP A;  3MF6 A;  3PME A;  2EIG A;  4Q26 A;  3NNF A;  1N47 A;  2HLE A;  3C7H A;  4OCT A;  4HKW A;  4XCB A;  3VHN A;  4A42 A;  4OZX A;  4BLI A;  3KV6 A;  4AI9 A;  4XIO A;  3SMH A;  2CSG A;  2WZP P;  1D4M 3;  2VEC A;  4MAD A;  2RM2 3;  2Z2S B;  5F2S A;  3ACG A;  5L36 A;  2D6O X;  1LOC A;  3ZO0 B;  2P4E A;  4WBB A;  1OOP B;  2QTW B;  4QPG C;  4AEJ A;  2BPA 2;  2PHU A;  3U11 A;  4FPF A;  1ENX A;  1YHF A;  4ES9 A;  5A3M A;  1PZ9 A;  1CAU A;  1KJR A;  1I9R A;  1AR8 2;  4MVT A;  1Q8V A;  3N7J A;  1VBE 3;  5F32 A;  2H6B A;  1OMI A;  3ZYB A;  2DVD A;  4FQ4 A;  1C1L A;  1VBA 2;  2AEY A;  5G05 L;  5CBL A;  5FOJ B;  2P1B A;  1UYX A;  5CFD B;  1NY7 2;  1VB4 A;  4QGM A;  5D8A B;  4XUR A;  3HN3 A;  3VLB B;  3NO8 A;  1OD3 A;  3T3Y A;  2CWS A;  2VZV A;  1JUH A;  5DAB A;  4N9I A;  2VOV A;  1SFP A;  2WWU A;  5IAT A;  4Y3O A;  4CUG A;  1CVN A;  5LA1 A;  3WF0 A;  5GLV A;  1DCS A;  3PVO A;  2XJQ A;  2WII B;  4MLO A;  4XMA A;  4YAR A;  1X9P A;  1AYM 2;  3OGG A;  3KF3 A;  5C9A C;  4Y5T A;  1G6N A;  3H0O A;  5JOX A;  1Q8S A;  1RYY A;  2F17 A;  2WAO A;  4WVV A;  5FMO L;  3KV9 A;  3ZR6 A;  4Z92 B;  1IGO A;  1URX A;  2OQ7 A;  3SNM A;  5BNQ A;  4A4A A;  5A1F A;  4XTM A;  3GF6 A;  1R1A 2;  3INA A;  3KCC A;  4IGO A;  5CEH A;  3VUO A;  1W03 A;  2VTX A;  5HV0 A;  5FQ0 A;  5FP8 A;  2BTV C;  4IGP A;  4YVW A;  3FLP A;  4CE8 A;  3SC7 X;  4CA9 A;  3KQ4 B;  1QQP 2;  2P34 A;  3V0A B;  3THT A;  4BQ4 A;  1GFF 2;  2ZAC A;  3DPR B;  3I2G A;  5C4W B;  2JG8 B;  1X36 A;  2FDH A;  4NJ4 A;  2QZ3 A;  4RGK A;  5L7O A;  2XML A;  3I97 A;  2QNK A;  3KV5 A;  3O0V A;  4NHY A;  5FY1 A;  2X05 A;  3ZXK A;  1ZRD A;  5I0T A;  1CPN A;  2JDN A;  1LEM A;  2ZX4 A;  4YG6 A;  3T4H B;  1SLC A;  2ZX1 A;  3CL1 A;  3DEC A;  1PMJ X;  1H9W A;  3D82 A;  2XQR A;  1W9Y A;  4K6B A;  2KA3 A;  2WQ8 A;  3MEP A;  5C7G A;  5F7U A;  3O1V A;  2OUH A;  3LEK A;  1AR7 2;  1AL2 2;  3J8F 1;  4ASL A;  5JZG C;  1LHO A;  1M4W A;  3IT8 A;  4M01 A;  4AYU A;  4CU7 A;  1MS3 A;  2A75 A;  4XJU A;  1NE4 A;  5DAW A;  3P3P A;  4JQR A;  4P9J A;  1JYV A;  1OFN A;  3BI3 A;  1AR9 3;  1QJX 3;  4MZU A;  4TWT A;  2QQU A;  2IXH A;  4L2N A;  4UF0 B;  3JUU A;  2XUM A;  1ZBE 3;  3VBF A;  3ZLI A;  2ZAH A;  5FZO A;  5A33 A;  3WNL A;  3GJA A;  3GJB A;  3GDB A;  1AR6 3;  2B9U A;  3WR0 A;  2EIE A;  4BZ4 A;  2VVE A;  4Y1Y A;  1IG3 A;  2R06 2;  1BVV A;  3GM8 A;  3HWJ A;  1ZVF A;  4MV2 A;  1VBB 2;  2VOW A;  2CWM A;  1NE6 A;  3AVS A;  1QOT A;  1HLC A;  2PLV 3;  2LRO A;  4K8R B;  2XWJ B;  3I3Q A;  4XVH A;  1NA1 A;  1Y7B A;  5ACA 1;  4W4Z A;  2WAB A;  1CES A;  4IEW A;  2D93 A;  3OD0 A;  3KVB A;  4OUL A;  2B9V A;  1LHW A;  1QJU 2;  4RHV 2;  1DP0 A;  5JCT A;  1RUH 3;  4F7Z A;  5A7P A;  1DZR A;  3RWN A;  2VQT A;  1PGL 1;  2P3I A;  2D6P A;  3T30 A;  4NPM A;  1HB1 A;  1N1V A;  4LBM A;  5AC9 2;  4HPK B;  4CU9 A;  4KI5 M;  1VAL A;  2HWC 2;  4CDU B;  5FY8 A;  5IUQ A;  3MPP G;  1OKO A;  4QXH A;  2BBV A;  4AVA A;  4DOU A;  3DYO A;  3B93 A;  3HR9 A;  3QH7 A;  4KU8 A;  5LB6 A;  4IL7 A;  1VBD 3;  4NRO A;  3C7F A;  5E6H A;  4Q4Y 1;  2HEW F;  5FZA A;  1NOV A;  2HWB 3;  3T2Q A;  2TUN A;  4R9C A;  4XIK A;  2JKB A;  1HJG A;  1MS5 A;  1UIJ A;  2WFF 1;  3KB5 A;  4IXL A;  4B4P A;  2X10 A;  4ES8 A;  2W3J A;  3RI9 A;  1TME 2;  1UXZ A;  3H3Z A;  4W8J A;  4KGG A;  2V73 A;  1UX7 A;  1BJQ A;  2BFU L;  1GZ9 A;  1ULD A;  2IUW A;  3H42 B;  3ZYJ B;  5FDB A;  4XMI A;  4NHL A;  3M3E A;  4CDQ B;  2EVX A;  1MZ5 A;  4UT5 A;  4Y20 A;  1DGR A;  4LA2 A;  4GKX A;  4D7Y A;  4CXY A;  4JGZ C;  4LK6 A;  3ECQ A;  1A8M A;  1CIY A;  1SFY A;  1GZW A;  1W05 A;  1ZZ6 A;  5BNP C;  1CPM A;  3N9N A;  5C3P A;  2X53 S;  1U12 A;  4FFH A;  2WC2 A;  3NW4 A;  1O3R A;  5BPX A;  3O1P A;  5K4L A;  1POQ A;  3FFQ A;  2YUE A;  1ST8 A;  2JB4 A;  4DFS A;  1Q43 A;  1UF2 C;  4QQL A;  1CAX B;  3WEZ A;  5A3U A;  4MUV A;  5F37 A;  5I0D A;  3ZMN A;  3IDC B;  5IJR A;  2VZS A;  1QJF A;  2ZHL A;  1FMD 3;  1Q8Q A;  4XBL A;  3CO2 A;  2W0X A;  4S2H A;  4AI1 A;  2R32 A;  1ND3 C;  5JXI A;  1L7L A;  4HVR A;  3ZXG A;  4CEW B;  4PDW A;  4XZP A;  3N4M A;  2A6W A;  2OZ6 A;  3VBH B;  5JIU A;  2XH6 A;  3NVC A;  5JSO A;  3EB7 A;  3J7M A;  1D4M 2;  5FO7 B;  5E88 A;  1PK6 C;  2RM2 2;  5IVC A;  2R16 A;  3K4D A;  4AQ6 A;  1YFU A;  1W8N A;  1S1A A;  1VRH 1;  3ZDS A;  1DYO A;  1KXG A;  3GHN A;  1HB4 A;  2VBD A;  2ZHM A;  1QNW A;  4IUG A;  1DQ2 A;  4XQD A;  3TRS B;  3N9M A;  1QXR A;  1S0F A;  5BNO C;  1OVP A;  3TAY A;  3AXE A;  1CAW B;  1DQ1 A;  1BYH A;  1PZ7 A;  3Q9O A;  4M0H A;  1LEN A;  1W3X A;  4N7U A;  3WP6 A;  4RFR B;  1N3P A;  1XE7 A;  2BGO A;  1DLL A;  1WA4 A;  3ALQ A;  4J1X A;  4AFD A;  4K1Y A;  3ORJ A;  1ZZ8 A;  3OBT A;  4N90 A;  1C28 A;  5FZ9 A;  3VN4 A;  1B35 B;  3RZM A;  3WW3 A;  4V2V A;  1KDM A;  1FOD 1;  5FRE A;  3PJQ A;  4KWJ A;  2WT0 A;  2XJU A;  4CP2 A;  5KHK A;  3JD7 1;  3IAP A;  2DVG A;  2UY9 A;  1NXM A;  5F6K A;  3ZIW A;  5FAX A;  2P2K A;  1EAH 2;  2X5I C;  2ZBJ A;  4JGY A;  4HKO A;  4QHZ A;  4LK7 A;  1GP5 A;  3K2O A;  1Q8O A;  3K3O A;  4YZ3 A;  1W99 A;  3VDD B;  3WHT A;  5JPM B;  3VDB A;  2JIJ A;  1V9U 1;  3ACF A;  4N9H A;  1H8T A;  1RL3 A;  2A6X A;  1GV9 A;  2C24 A;  3KCX A;  2XOM A;  4BU2 A;  1Y9Q A;  3ACL A;  3N7K A;  5SV8 A;  4NUB A;  3HT2 A;  1JHN A;  1OLR A;  5E16 A;  5A3T A;  5HI0 A;  2RR1 1;  3AXD A;  2SLI A;  5IK7 A;  3OBA A;  1G9F A;  2VW0 A;  1XNT A;  4IER A;  5LZ6 A;  3NWK A;  5FZ3 A;  1ZM1 A;  4BXF A;  4BDV B;  2I2S A;  1IQD C;  4XJZ A;  3I2F A;  1O4Y A;  4GWM A;  5T54 A;  4KBB A;  3VZK A;  5A70 A;  2VG9 A;  2ZEY A;  2ZGQ A;  2IXL A;  2B46 X;  2CGN A;  3PVE A;  3KHB A;  4EN9 B;  1K5M B;  4FAH A;  3GZU C;  1HV0 A;  3WSO A;  1OLM E;  1V00 A;  1G9C A;  1ND2 B;  1R1Z A;  5L73 A;  4ET7 A;  1ZRR A;  1OI6 A;  1WW7 A;  3I2D A;  4N53 A;  5FBZ A;  3VBO A;  3WF4 A;  1NKG A;  4Q4W 1;  3ITQ A;  4YGE A;  2HKX A;  5FLJ A;  1C57 A;  1AR8 1;  1UY2 A;  2OT7 A;  2A1X A;  4P9L A;  3B9C A;  3MIC A;  3H8R A;  1UPI A;  1QY4 A;  5H9P A;  3E5Q A;  1GWL A;  1UWW A;  3WY6 A;  2KD7 A;  4CSW A;  2DUQ A;  5F1R A;  4B3N A;  3RDI A;  4LO5 B;  4WZF A;  1J1T A;  3J8F 3;  1AR9 2;  1QJX 2;  5FYC A;  5I0R A;  4Q2F A;  4P9W A;  4QT6 A;  1WCK A;  3MPB A;  4PT6 A;  1GSL A;  2AUY A;  1UX6 A;  1ZBE 2;  3LEM A;  4GKY A;  4QPG B;  1W6P A;  3ZYH A;  3W5N A;  3U78 A;  3ZYG A;  3D0S A;  5FWE A;  3BIE A;  1I1E A;  1PMH X;  4W6W A;  2BOI A;  4Q29 A;  1JZ3 A;  1UAI A;  1UOF A;  1QMJ A;  3IMN A;  2BP6 A;  3LB9 A;  5LAS A;  1HRV 1;  1RUJ 1;  4CDX C;  4D6Q A;  1KFX L;  2PLV 2;  3PHM A;  5K0U C;  2ZGO A;  3NKG A;  2ZML A;  4X6R B;  2WKK A;  2W1W A;  3C8X A;  3Q8E A;  4JAA A;  1YFY A;  4XPV A;  1CN1 A;  1ZBA 1;  4OZO A;  1RUH 2;  3LSE A;  4P9G A;  4QU1 A;  3ZFG C;  3W5M A;  4E4D X;  5ACA 3;  1COV 3;  1QQP 1;  2B42 B;  3TEY A;  1E57 A;  5FYY A;  3VB9 A;  4BIO A;  5EJZ B;  2XXZ A;  5C9A B;  1MPX A;  2OQ6 A;  1H4G A;  4LTA A;  3D6E A;  1VBD 2;  3NNM A;  3AZW A;  2BYV E;  2VJX A;  3AJY A;  5DAX A;  5FXW A;  2VZ1 A;  4K3U A;  4HFS A;  2ARB A;  3O0X A;  2HWB 2;  5DG2 A;  1YQ5 A;  1PX3 A;  3WG1 A;  3ZSK A;  5C3R A;  1FV3 A;  1QJZ A;  3M70 A;  1XNB A;  2J7M A;  2PFW A;  4Q4Y 3;  5FZ7 A;  3ZN4 A;  4AAP A;  3S0M A;  2GMP A;  4N43 C;  5HXV A;  2PAK A;  5C8C C;  3SLI A;  2WFF 3;  5IVE A;  2PA7 A;  1J1L A;  3PUQ A;  3WQB A;  2E51 A;  3KLS A;  2P3Y A;  2XON A;  5H9Q A;  1FYU A;  1I5Z A;  2BVV A;  4IEP A;  1OQ1 A;  3VZM A;  4A45 A;  4DY5 A;  4TZD A;  1O7F A;  2B5H A;  2VME A;  2V5Y A;  2W5F A;  3GZA A;  1C4R A;  4IND A;  5KXB A;  5LCW L;  1AHS A;  4LKS A;  3A22 A;  3HQR A;  4IEX A;  4ATF A;  1VBB 1;  4CUC A;  1RXG A;  2PTM A;  3ZSJ A;  5EQU A;  3AK0 A;  1FMD 2;  5JZG B;  2K2S A;  4QB2 A;  2A73 B;  2ARC A;  1QJU 1;  2A3X A;  3FUQ A;  3QAC A;  3FHA A;  1ZZ7 A;  2BEO A;  1LED A;  4YNI A;  1JUI A;  1WMX A;  1DBN A;  4PLM A;  3EYP A;  3I2O A;  5A7W A;  1WLW A;  1W6Q A;  1BXH A;  1R08 1;  2Q5T A;  2FQP A;  1P8J A;  2QCS B;  4IEO A;  4LKE A;  4TLG A;  4YG0 A;  2ZHN A;  5LBF A;  5FYH A;  3ZYF A;  2PHW A;  4CEY A;  5FPU A;  1KQR A;  1DZQ A;  2E33 A;  2DWR A;  3VZN A;  3AP4 A;  4D8M A;  1TEI A;  1W8O A;  1SCS A;  1PO1 2;  1X8E A;  2VQU A;  3KT4 A;  2AH2 A;  4QHO A;  4JRL A;  4XIL A;  5FP9 A;  1QH7 A;  1VRH 3;  3RZH A;  4Y24 A;  4AED B;  1JYN A;  1DDL A;  5CNA A;  1QJY 1;  1E5R A;  1HW5 A;  5FV3 A;  1ACC A;  3WP3 A;  4UFI A;  4AQ2 A;  3RYK A;  3T1L A;  2HBT A;  2ZJC A;  2WAA A;  5GJ6 A;  1O8P A;  1HN0 A;  3OBR A;  2XL7 A;  5JR7 B;  3PTR B;  1SBF A;  2BNO A;  4XOG A;  3OUI A;  3UJQ A;  3RYP A;  1HXS 1;  4DXZ A;  4ISQ A;  3MW3 A;  3OUH A;  3PU3 A;  3ZFF C;  2JE7 A;  4B4Q A;  2HBU A;  3D5O A;  1F5F A;  5FXZ A;  1WCQ A;  1FOD 3;  2GDF A;  2OVU A;  3H8U A;  4Q8K A;  3BTZ A;  2ZKL A;  2XVG A;  3JD7 3;  2E31 A;  3OTF A;  2CAU A;  5GZD A;  3M3I A;  2R1D A;  3FJS A;  3WUD A;  4A3X A;  4BQ5 A;  1D0H A;  4EV0 A;  4PI0 A;  5DDJ 1;  5LY2 A;  5IHR A;  2WDB A;  4V1P A;  4DIQ A;  1V9U 3;  2O0O A;  3LCP A;  5FP7 A;  3E5X A;  5C71 A;  3SQO A;  5FZD A;  3ILF A;  4DUX A;  2AC1 A;  1J3P A;  3U1X A;  3H1W A;  4GH4 C;  1YC6 1;  4LJH A;  1D2Q A;  3III A;  4Y4Y A;  2DVA A;  2RR1 3;  2ZXQ A;  5FPA A;  3VDA A;  3ROU A;  2BJS A;  4LOR A;  5BNP B;  1D4M 1;  4BME A;  3H7Y A;  1OLM A;  3PU8 A;  5FZG A;  1RUC 1;  4GB3 1;  1AZD A;  1XXN A;  4HT1 T;  1NX9 A;  2PHT A;  3KV4 A;  2X29 A;  5CKM A;  2JIC A;  1OT5 A;  3IAQ A;  4Q0P A;  1H1A A;  1W3V A;  4BQ1 A;  1TMF 3;  3M7A A;  4YLZ A;  4ZZ5 A;  5A3P A;  2VW1 A;  4Y1Z A;  3RZG A;  4Q0S A;  4FTE A;  4FFF A;  4BYY A;  3N9O A;  4XE9 A;  4ZS3 A;  1ND3 B;  5C8W A;  4Q4W 3;  3WQ0 A;  1C5I A;  1Y4W A;  1KRI A;  1W6O A;  3VD9 A;  2WNO A;  3VGI A;  4QM9 A;  2J1V A;  5LK7 B;  1DZT A;  5CFC C;  1F8V A;  1DU3 D;  3J8F 2;  1MS9 A;  4IGQ A;  4QQP A;  2ZGP A;  2VOK A;  2YGL A;  2EXH A;  1PK6 B;  1VJ2 A;  4XHB A;  1TVG A;  4K1Z A;  1EAH 1;  3JB8 A;  2BU9 A;  5BY5 A;  4DS0 A;  1W06 A;  3NAP C;  5FZ8 A;  3MFC A;  3SH3 A;  5BNO B;  4AI3 A;  3AP5 A;  4Y33 A;  2FDK A;  1FAY A;  2WS9 1;  2ZGS A;  1H0B A;  1V0A A;  4B29 A;  5KR7 A;  3TEZ A;  2E63 A;  3WDW A;  3K46 A;  2Y6H A;  3T0A A;  4Q4X 1;  1OC1 A;  2GU9 A;  5ABJ A;  3KHC A;  4XBQ A;  4YVW C;  5EYY A;  1QNY A;  4BHP A;  3ZFE A;  1ZZC A;  1HRV 3;  1RUJ 3;  2GC0 A;  1XQN A;  3HMY A;  3POI A;  2P17 A;  3JB4 C;  5ACA 2;  3ES4 A;  1COV 2;  1CR7 A;  4XFF A;  2XJT A;  4OUS A;  1IS6 A;  3WG2 A;  2QQW A;  2ET7 A;  1DIW A;  1ZBA 3;  4Q5O A;  4XZU G;  5F6L B;  3UET A;  1VPH A;  3FHQ A;  5DXD A;  1O6U A;  1QQP 3;  2HH9 A;  3A7Q A;  4WVZ A;  1ULE A;  2WUH A;  2GZW A;  4NVP A;  2WNE A;  4YFW A;  3SXW A;  1W8F A;  3K48 A;  3DGT A;  1OQE A;  2ENR A;  4CCN A;  1S0C A;  5DUV A;  4CUA A;  2ZPX A;  3IPV B;  4IEZ A;  4AI0 A;  3AVR A;  5LA9 A;  2XG3 A;  5A1A A;  4Q4Y 2;  4C90 A;  4KWK A;  1AXZ A;  4HOO A;  1QJE A;  3WZ1 A;  3UKN A;  1NQD A;  4CRQ A;  4LLF A;  2WFF 2;  1ZRE A;  4DNY A;  1W2T A;  3C7E A;  3VBF C;  1QJX 1;  2DVB A;  2TNF A;  2MPF A;  2XJP A;  3H1M A;  4GQ7 A;  3WHU A;  5CIS A;  3N35 A;  4UW4 A;  1YNA A;  5FYS A;  1K12 A;  2UWC A;  3OOX A;  1W39 A;  2IZW A;  2Y64 A;  1A34 A;  1J3R A;  1X7N A;  1X82 A;  4GIQ A;  3F2Z A;  1VMF A;  2ZCW A;  5CG8 A;  3FLT A;  4RR3 A;  1IKP A;  1NA1 C;  3GXU A;  4HL0 A;  5LBB A;  4KBZ A;  4A6O A;  4A7K A;  4COU A;  3CJI C;  3C7G A;  3HT1 A;  1WME A;  3OPW A;  2Q30 A;  2DUO A;  1SEF A;  2D98 A;  1RMU 1;  1XYO A;  4UFL A;  4AFC A;  5HPO A;  4ASK A;  2JEN A;  4FOY A;  2DCK A;  3WNO A;  2CV6 A;  1LKN A;  3AMP A;  1HB2 A;  5FZ1 A;  3K4Z A;  1QJU 3;  1N1Y A;  1LHN A;  1GNH A;  1WWY A;  2W08 A;  4JVA A;  4UI9 L;  4L97 A;  2HEY F;  3ZPY A;  5GLZ A;  5A3L A;  3PLQ A;  2W47 A;  4YW4 A;  1BBT 1;  1J58 A;  1VBD 1;  1R08 3;  2P5B A;  3AL6 A;  4LE3 A;  4Y1X A;  2PHD A;  4CCM A;  3VD5 A;  4CDX B;  4QPW A;  3BYW A;  2VTF A;  4XFA A;  3X29 B;  4QM8 A;  1O3T A;  3AYA A;  4QD2 A;  1VRH 2;  5K0U B;  2YC4 A;  3JBG 1;  4DRV A;  2CGO A;  3KMH A;  3M1H A;  2RJL A;  2WN2 A;  3ZFG B;  4JC1 A;  2UYA A;  3THP A;  5KHG A;  4NIH A;  2EAA A;  2HWD 2;  1HQW A;  4EYU A;  5IFP A;  1OOP A;  1QJY 3;  2I07 B;  3MIB A;  1ZZB A;  2HYK A;  4MGK E;  4EN7 B;  4BA6 A;  3ME2 A;  5J37 A;  2GN7 A;  4ARX A;  1H2L A;  5J1X A;  2YZ4 A;  4OFG A;  4CUB A;  5IVB A;  4JKK A;  2DBN A;  4KG8 A;  2E7Q A;  3CJX A;  3I2K A;  4G3Y C;  4IV3 A;  4AVV A;  1HXS 3;  2LUW A;  3R6S A;  3JD7 2;  3OYW A;  5CFD A;  5D8A A;  4GWN A;  3VD7 A;  4AZZ A;  2BRT A;  4UOJ A;  4UFJ A;  4BB3 A;  5KC6 A;  4FI9 A;  4N43 B;  1V9U 2;  1OBN A;  1FMD 1;  3WDT A;  1LU2 A;  2ATF A;  1U0A A;  1KS5 A;  5C8C B;  2XQX A;  5DDJ 3;  5JXJ A;  2Q1M A;  5DUX A;  1LTE A;  3MLL A;  2W1S A;  1VP6 A;  2VZR A;  3FBY A;  1ZRI A;  1AJO A;  2D6L X;  2W92 A;  1NCR C;  3GNE A;  2RS1 1;  3ZSM A;  3VD3 A;  2Y0I A;  2RR1 2;  3FN9 A;  4MXW B;  5FUN A;  5LW9 A;  2VBP A;  2VOT A;  4AVS A;  1J83 A;  1NZI A;  1OFS A;  1K45 A;  2WNU C;  4YSF A;  5FZL A;  4Q8L A;  2UYB A;  1MS1 A;  2WZR 1;  1WKY A;  4FBF A;  2R1B A;  3PL0 A;  4YGC A;  4YVS A;  4JKL A;  4QQO A;  4XF0 A;  3H1Y A;  2YU1 A;  1MS8 A;  2X8K A;  1V6O A;  4HSJ A;  1WCU A;  3U75 A;  1PO1 1;  1RUC 3;  3N7L A;  4GB3 3;  4LIT A;  1TMF 2;  3KT1 A;  3VKO A;  3AKR A;  5LWB A;  3V0A A;  4NID A;  4QDS A;  3UL2 A;  4IE4 A;  3DPR A;  3NQH A;  4J1W A;  5C4W A;  3SH4 A;  3HNB M;  2Z5W A;  3DV8 A;  3J9S A;  3NV1 A;  4Q4W 2;  3SCG A;  2WLP A;  4COY A;  4RA0 A;  4C1X A;  1CAV A;  3AKQ A;  2KR2 A;  3VBR A;  3T2T A;  4D0Q A;  4E27 A;  4XTP A;  1IKQ A;  5FJH A;  4RN5 A;  2BW8 A;  2FHR A;  2WQ4 A;  3OSD A;  5FZ6 A;  1BVP 1;  1HN1 A;  3WG3 A;  2OA2 A;  3U4X A;  4A6S A;  4B7E A;  1GAN A;  1SHW B;  4XDP A;  1T6B X;  2B45 X;  4B8E A;  4COV A;  4MG2 A;  1QIQ A;  2PEL A;  4LT5 A;  1UMZ A;  4H7M A;  1IPK A;  3HJR A;  2OKX A;  1CX4 A;  1EAH 3;  2RDQ A;  4IV1 C;  4R9B A;  1KD7 A;  1RJ8 A;  1W6M B;  2DU0 A;  5CIR A;  2BGP A;  3BGA A;  1EYB A;  2WS9 3;  1FNZ A;  2WZE A;  4JDM A;  1GWK A;  2I45 A;  4UF0 A;  1YIF A;  2XPJ A;  1UY1 A;  1JU3 A;  3GCW A;  5FJK A;  2XDV A;  1EV1 2;  1HRV 2;  1RUJ 2;  4E2G A;  2CNA A;  3H3U A;  2OS2 A;  4Q4X 3;  4BQ3 A;  4OI4 A;  5FXV A;  3VV1 A;  1N1S A;  4NE9 A;  1PNF A;  2O1Q A;  1ZBA 2;  4I30 A;  3ZFF B;  5K8S A;  2VUJ A;  3IBM A;  1OUX A;  3RYR A;  3ATG A;  3RPQ A;  3J4U H;  2VL4 A;  4PLN A;  5IAX A;  1O4Z A;  5DUW A;  3UT0 A;  2V4A A;  4I3G A;  1HV1 A;  4W6Y A;  2FDJ A;  2JWP A;  1FAT A;  3ZSE A;  1J84 A;  3CZJ A;  4EN0 A;  3QCW A;  5FPZ A;  2WR9 A;  3BOP A;  4FPG A;  1O4T A;  4HPK A;  4JTO A;  2QQI A;  1VAM A;  3NV4 A;  1RUO A;  4CDU A;  1JYW A;  1IHM A;  2YRO A;  1DQ0 A;  4GH4 B;  4F83 A;  4JDN A;  3KT7 A;  1UOG A;  2Y6K A;  3QLQ A;  2CYF A;  1TE1 B;  4XF3 A;  5FXX A;  3TWI A;  2YBS A;  3J7L A;  1W2A X;  3LDR A;  4RQP C;  5FK8 A;  1UYY A;  2A5Z A;  5FZB A;  4RGG A;  1UO9 A;  3MO4 A;  5C5T A;  4HLT A;  3EQE A;  3E1F 1;  1UMH A;  1XYP A;  3WNX A;  3CIH A;  2IXK A;  2WT1 A;  5HXM A;  1G7Y A;  2YBK A;  2PHR A;  4OMD A;  5FY4 A;  3MLK A;  1UPS A;  2A3Y A;  1AX0 A;  1BCX A;  1DGW X;  3LGR A;  5JMO A;  2ERF A;  3NRU A;  1RJ7 A;  4HK8 A;  4MXV A;  2VUD A;  3O7O A;  1LHV A;  5F5C A;  1UY4 A;  4XUO A;  2OX0 A;  4CDQ A;  4EJR A;  1WW6 A;  4E4H A;  2K46 A;  2JDU A;  2CAV A;  1V6L A;  4OHZ A;  1N3O A;  5FY9 A;  2PQQ A;  4WM8 C;  4Y5S A;  4D7T A;  2FCV A;  4IDZ A;  5CFC B;  1COV 1;  1I6X A;  2D5F A;  2NP0 A;  1RMU 3;  3BAL A;  4QX0 A;  4Z82 A;  2QQL A;  2P3K A;  4GJY A;  4LO6 B;  4TLF A;  3WNP A;  2QQJ A;  1MS4 A;  4FT8 A;  3NAP B;  5JSR A;  4P9I A;  2PAE A;  3OPZ A;  5JWP A;  4FFG A;  3AFG A;  5T55 A;  4NHX A;  4FO9 A;  1PM7 A;  3I54 A;  3MGU A;  4NPL A;  4OHV A;  1R08 2;  2NMO A;  4LNV A;  1RGS A;  4UW5 A;  3PVN A;  4U36 A;  3RSJ A;  4CEW A;  1BBT 3;  4KL1 A;  1JHJ A;  2DU1 A;  4LOS A;  3RNS A;  3CLP A;  4R4X A;  4MGS A;  1S2E A;  4MGQ A;  2Q1Z B;  4R9D A;  2Z42 A;  3KZ4 C;  1L7Q A;  3JBG 3;  4WZC A;  3S30 A;  3W20 A;  1MVQ A;  1QJY 2;  2VC9 A;  4YZ5 A;  3KGZ A;  1TG7 A;  4FCA A;  5BNN A;  1OLQ A;  4O65 A;  1S0B A;  1LJ7 A;  4LHK A;  1TNF A;  3BB6 A;  5KXE A;  2Q8D A;  3U37 A;  1JYI A;  1QEX A;  1MQT C;  5A6Z A;  1HXS 2;  3TOJ A;  5D1I A;  1AUY A;  4FOV A;  1UOJ A;  1UZZ A;  4KNC A;  2UWB A;  3VBS C;  1UZ0 A;  4QXB A;  1B35 A;  1X8M A;  2NM1 A;  4KG0 A;  3FHI B;  1XRU A;  4OI2 A;  2Y26 A;  5A6X A;  2VOX A;  4QPY A;  3N36 A;  4UFK A;  4ZON A;  3KM5 A;  2XVK A;  3OY8 A;  1FPN 3;  2DCJ A;  2KXL A;  2QDN A;  2QQN A;  2UWA A;  5DDJ 2;  1CZT A;  4NAO A;  3G7D A;  3DEM A;  4H3W A;  2YFZ A;  3O12 A;  5DMY A;  2NPI A;  3ILR A;  4IW3 A;  2XR4 A;  5EFU A;  5ERL A;  5A6Y A;  5FKC A;  3VBF B;  5A33 B;  5FZO B;  5GAL A;  2WWJ A;  1US3 A;  3VBU C;  3OJB A;  2YB7 A;  3D4K A;  3CQO A;  5F3G A;  2W9X A;  2AYH A;  3A0N A;  1AYN 2;  1OA3 A;  3IDA A;  2RS1 3;  4IQP A;  4OVE A;  1MZE A;  2D6N A;  2E32 A;  1MEC 3;  1E5I A;  2ARA A;  4LUM A;  1NA1 B;  5D21 A;  1BK0 A;  1POV 1;  5FY5 A;  4TYS A;  4E8D A;  2WZR 3;  3CJI B;  5H9S A;  1OF4 A;  1RUC 2;  3IKW A;  4GB3 2;  4YW3 A;  1KS4 A;  2XBO 1;  4X8P A;  4YM3 A;  3BTY A;  4GAL A;  1GOF A;  1LGN A;  5FZ0 A;  3IM0 A;  4M00 A;  1PO1 3;  2YFU A;  2ARE A;  3IZO A;  3SH5 A;  1UU4 A;  4MET A;  4CCE A;  2HWD 1;  1K5M A;  4HAN A;  4O9E A;  5LRR A;  3USS A;  1OVS A;  5HBA A;  3I2I A;  1ND2 A;  3GBW A;  2EA7 A;  4HXC A;  4COW A;  1E5S A;  1WW4 A;  1CQ9 A;  5B4X A;  5FO9 B;  5FBJ A;  2FMY A;  1GP4 A;  4GZ9 A;  1VB2 A;  1XJA A;  3ON7 A;  1VR3 A;  2VUA A;  1RUD 1;  2RG4 A;  2WNV A;  4OYU A;  3ZXJ A;  3WDY A;  4LBN A;  4ZZ8 A;  3H8X A;  2C9A A;  1HX6 A;  2RMU 1;  4D69 A;  1MZF A;  3POY A;  5FZ4 A;  1S4C A;  1UN1 A;  1V6M A;  3R05 A;  1RIR A;  5CZK A;  2VH9 A;  2JDA A;  3POF A;  1Y3T A;  4MGZ E;  2LAL A;  3N9Q A;  1C8N A;  3ABZ A;  3SIS A;  1WD3 A;  5J7M A;  3EBR A;  1S0E A;  3ZVX A;  3NJX A;  3Q8F A;  2WS9 2;  2QUO A;  4IET A;  4EN6 B;  1GOH A;  1UIK A;  4GA9 A;  2WT2 A;  3POW A;  4OUE A;  3PMS A;  4QKD A;  3ZKU A;  5FY0 A;  1H1M A;  1PVC 1;  4QPG A;  4AI2 A;  4D94 A;  4NMI A;  2DTY A;  4Q4X 2;  5FP4 A;  2JE8 A;  1XU1 A;  4EZ4 A;  1L7R A;  2ZGK A;  3DCQ A;  4DQA A;  2D7F A;  4XJ8 A;  3ZR5 A;  4D3W A;  1JS9 A;  3PUR A;  5IT6 A;  4XQW A;  3I3M A;  2IFW A;  4NWW A;  4URA A;  1W9F A;  4V2W A;  3AFK A;  1ZX5 A;  1NLS A;  1GNZ A;  1GWM A;  4HET A;  5LEK A;  4LBK A;  1WUV A;  4QAW A;  1E5H A;  1TMF 1;  3PUA A;  4EWD A;  2VU9 A;  4NAM A;  2WSV A;  2EXK A;  3WNK A;  4CTE A;  1CJD A;  2AAC A;  1VLN A;  2GND A;  2VQA A;  1MVE A;  2BWA A;  3AYE A;  5B4N A;  3AYC A;  4CDW C;  1NCR B;  4Z2W A;  2TBV A;  2VE1 A;  3MIG A;  4I0W B;  5C9A A;  1IS3 A;  1Q8P A;  3DL3 A;  3RFR A;  4R9A A;  4E4S A;  3MV1 1;  1LCL A;  2WNU B;  5F5Q A;  4QPI C;  2RJ2 A;  4BCU A;  2QQP A;  1UKG A;  2J1T A;  1B09 A;  2BUK A;  4A41 A;  3I2J A;  3VKM A;  3UK9 A;  4B7K A;  5EV7 A;  1RB8 G;  3IWZ A;  3T1M A;  4NII A;  1JOD A;  3W21 A;  1W6N B;  1YUD A;  2JDY A;  4XUN A;  4KWL A;  2JDZ A;  1Q3E A;  4WVM A;  2Y33 A;  3AZX A;  1LR5 A;  3HPN A;  1O91 A;  3ZFE C;  1H1I A;  4CPB A;  2D3S A;  2Y38 A;  4QX5 A;  4BPZ A;  4LE4 A;  5LA0 A;  2Y6F A;  3KVA A;  2WO3 A;  2VMH A;  1JH5 A;  5FK7 A;  1ODN A;  3JXS A;  4OLL A;  3VHR A;  2MEV 1;  2D97 A;  3WCS A;  3V0B B;  2W91 A;  4X8N A;  1XE0 A;  1EV1 1;  5FO8 B;  4XAA A;  5JOW A;  5JSP A;  4LIV A;  3U14 A;  1JOP A;  1G86 A;  1RIT A;  4NWV A;  2BOJ A;  1RMU 2;  2YU2 A;  4K7J A;  2B4K A;  1XB9 A;  1UMI A;  2ZMN A;  3HQU A;  1HQL A;  1KEX A;  5T5L A;  5BUV A;  1S2B A;  4HN0 A;  1W2O A;  2Y34 A;  1QDC A;  3AP9 A;  3RRD A;  1BHG A;  1YFW A;  3CNA A;  4RFT 0;  2PMW B;  1YRZ A;  4QX7 A;  3LPF A;  1UNB A;  1WW5 A;  3MFA A;  4ZHN A;  3ELN A;  4IV1 B;  2VM9 A;  4FSJ A;  2EIB A;  1H8V A;  4RS5 C;  2QBX A;  3OGV A;  1YJK A;  4E4Z A;  5C3S A;  1BBT 2;  4FFI A;  4OUM A;  1IPJ A;  2R49 A;  3E6C C;  2MNG A;  5DG1 A;  2WYS A;  4KQ7 A;  4S2D A;  4BMB A;  3WW2 A;  4XHX A;  4AGG A;  5L9V A;  4FXK B;  1OQD A;  4QX2 A;  4Y26 A;  3ST7 A;  3TNQ A;  2R30 A;  2GNT A;  3LKJ A;  3JBG 2;  4OHY A;  1UQX A;  1WZX A;  5FZF A;  2VPV A;  4CCL A;  2V72 A;  4GMP 1;  2PQS A;  1QHD A;  3T0B A;  4M3C B;  2A6V A;  3POB A;  5F5A A;  4ZXK A;  2RDS A;  2F4P A;  5DUU A;  4AED A;  4AHZ A;  1F4H A;  2AEN A;  1W8W A;  4P14 A;  4A44 A;  1HQN A;  4BE3 A;  1W8H A;  4BIS A;  4RR3 C;  1W0O A;  5DPN A;  2VUC A;  5I8T A;  4HVO A;  5J96 B;  3LPG A;  3LA2 A;  3WV6 A;  4XFB A;  1NXD 1;  4TTG A;  3WUC A;  2GAL A;  1LOD A;  1H2K A;  3AJZ A;  3BIW E;  3EXU A;  1GZT A;  3J7H A;  1FPN 2;  3AMN A;  2YV8 A;  2JX9 A;  4DIN B;  3GBG A;  2RJK A;  2W1U A;  3G6J B;  4BK5 A;  3W58 A;  2BQP A;  1H2M A;  4RQP B;  1DYP A;  1RUI 1;  1WLD A;  2DCZ A;  2L9L A;  1SLI A;  2N7G A;  1V6J A;  3ZDV A;  1JI6 A;  3B5L B;  4DY3 A;  2A70 A;  4BLJ A;  2FZ1 A;  3V65 A;  4QB1 A;  2P6H A;  2RS1 2;  3ZYR A;  2WIN B;  2Y60 A;  3PTY A;  3R4U A;  1MEC 2;  2QE3 A;  4CP9 A;  2LTN A;  1DGW A;  3M4F A;  1S0J A;  4XFH A;  3MF9 A;  2VMD A;  2WZR 2;  4YYO A;  2A6Y A;  4L9B A;  3I7D A;  3UJO A;  3ZKY A;  2VZQ A;  2XB6 C;  1CIW A;  1POV 3;  2YPJ A;  4PQQ A;  4UXA A;  2C6S A;  4WM8 B;  4CPB D;  2XBO 3;  4GD4 A;  1VAK A;  4Q4V 1;  3L2H A;  3PUH A;  2VMG A;  3CF6 E;  3C3V A;  5EYX A;  3F95 A;  4AL9 A;  4ITC A;  1LOF A;  5IK4 A;  3ZN6 B;  1PZ8 A;  3PUI A;  2FD8 A;  4LBQ A;  5KXD A;  1S0D A;  1R64 A;  2GN3 A;  2HWD 3;  3LIG A;  4IV3 C;  4XUP A;  5CFD C;  4K8F A;  2G9G A;  2YC0 A;  1RUF 1;  1ND3 A;  3LA3 A;  5FTT C;  1Y43 B;  3M3C A;  2WA3 A;  3AKS A;  5LRS A;  2ZTN A;  3VD4 A;  1RUD 3;  2ZGU A;  2XVL A;  2LS6 A;  5DAV A;  1WCS A;  3RS6 A;  5IK5 A;  1YO8 A;  2RMU 3;  4QWN A;  2OPK A;  3KD4 A;  1KJL A;  1PIV 3;  3JZV A;  3QOP A;  1PK6 A;  3R0R A;  4QKF A;  3CHX A;  5FZH A;  5GZG A;  2JG9 A;  3UV9 A;  5FOB B;  5LBC A;  5FY7 A;  4LPL A;  5JUV A;  4P02 B;  2R7E B;  1MAC A;  2VZU A;  3KQR A;  2K9Z A;  2YYO A;  1ULC A;  4ATE A;  2R07 1;  2VCA A;  1G9B A;  3S57 A;  1W28 A;  5EHD A;  5FPV A;  2VTX J;  1PVC 3;  3MYX A;  2UY8 A;  1XNC A;  4YVS C;  1QXJ A;  1AYN 1;  4KMQ A;  4DXR A;  1MQT B;  3AKP A;  3PVB B;  4DEQ A;  5DZG A;  3I2H A;  4LR4 A;  3VBS B;  2VW2 A;  2EID A;  1STM A;  1NCQ A;  2JIG A;  4JGZ B;  4Q27 A;  3RG0 A;  1ENQ A;  2O8O A;  4FPO B;  1ZYB A;  1UU5 A;  1ZNP A;  3USU B;  1GQG A;  3P1I A;  4HK9 A;  5CVR A;  1JTZ X;  1UZV A;  4ZU4 A;  1GOG A;  2EF6 A;  4AQT A;  4LKD A;  2D5H A;  1D0G A;  2A7A A;  4LOT A;  2OW4 A;  1QOO A;  1YQ2 A;  3SHR A;  3VBR C;  1KDK A;  4P5H A;  4Y22 A;  5HCA A;  1YI7 A;  2ORX A;  1PGW 2;  2VY0 A;  3OPT A;  2O8Q A;  3VZO A;  1EUT A;  3I4I A;  4C0B A;  3VBU B;  1UY0 A;  1JZ5 A;  2MHF A;  1OF3 A;  2YY1 A;  3AYD A;  4QB6 A;  4QXC A;  1CZS A;  2HWE 1;  2XGX A;  3OD4 A;  3IPV A;  4CCJ A;  2LW8 A;  4YZ4 A;  4DEV A;  5F3E A;  2YMZ A;  4YFZ A;  3VHO A;  5EZW A;  5DZE A;  4AVC A;  1UXX X;  3OEA A;  1SLT A;  1D2S A;  2FBE A;  4H7L A;  4AHX A;  1EUU A;  3ES1 A;  3LFI A;  3TN9 1;  5JI9 A;  5DAQ A;  1AXK A;  4TSV A;  4BK4 A;  1AF9 A;  1JMU B;  2RV9 A;  2XHN A;  2Z79 A;  4DXT A;  2WWS A;  5EWS A;  4FVV A;  4PBO A;  1LES A;  5FMB A;  2MEV 3;  2RS5 3;  5T3N A;  4I02 A;  1EV1 3;  3AL5 A;  3NMB A;  4ZS2 A;  5FMC A;  4WM7 A;  1O5L A;  1RUG 1;  2RS3 1;  4LBQ D;  4XEZ A;  5FUP A;  1D7P M;  5L7O C;  4K40 A;  4ARY A;  5CKN A;  2X5I B;  1BLZ A;  1EY2 A;  2Y6G A;  1NT0 A;  5I8S A;  3LF7 A;  5CKQ A;  5BYN A;  2J1A A;  1T2X A;  2W1Q A;  3POG A; 
#chains in the Genus database with same CATH homology
 5JXI A;  1HN1 A;  1SG3 A;  1SHW B;  4RYD A;  3NJV A;  3HJR A;  2OKX A;  3WF2 A;  3EB7 A;  3CDZ B;  2VMC A;  1K42 A;  2BGP A;  5JXG A;  3BGA A;  3K4D A;  1W8N A;  2WZE A;  2VCC A;  2J1R A;  1DYO A;  1UY1 A;  1JU3 A;  4YPJ A;  4DXS A;  3T08 A;  4IUG A;  4OMC A;  2W46 A;  2BGO A;  2VL4 A;  3ACI A;  2ID4 A;  1J84 A;  3CZJ A;  4L0P A;  1GNY A;  3IAP A;  2QQI A;  1W99 A;  1ULP A;  1JYW A;  3VDB A;  3ACF A;  2Y6K A;  2XOM A;  3D3A A;  2ZEZ A;  1F4A A;  2J1S A;  1UYY A;  1XPW A;  4W50 A;  3MO4 A;  5DN2 A;  3VDC A;  3E1F 1;  1UMH A;  4P5Y A;  3CIH A;  3OBA A;  5HXM A;  1XNT A;  4OMD A;  5IYY A;  4BDV B;  1IQD C;  2CDO A;  3I2F A;  3HNM A;  5CYY A;  5JMO A;  1JZ8 A;  3K75 B;  2ZEY A;  3NRU A;  4KWU A;  1NAE A;  4M4P A;  1O59 A;  2BZD A;  1UY4 A;  3A21 A;  4XUO A;  4DUV A;  3WSO A;  4LHS A;  4ET7 A;  3AC0 A;  3WF4 A;  4QDR A;  4CU6 A;  3HOB A;  2WO2 A;  1NKG A;  1JZ5 A;  2X09 A;  1UY2 A;  3HNY M;  4QX0 A;  2QQL A;  3LEI A;  4QX3 A;  3WNP A;  2C4X A;  4BJ0 A;  2QQJ A;  4JHZ A;  1UWW A;  2KD7 A;  4ZY9 A;  4MOA A;  3CMG A;  4PT6 A;  4UAP A;  1JHJ A;  3W5N A;  1JU4 A;  1GMM A;  3I3E A;  4MGQ A;  4MGS A;  1PMH X;  1JZ3 A;  1L7Q A;  3WNM A;  1O8S A;  2VC9 A;  3I3D A;  1TG7 A;  1ULO A;  2W1W A;  3C8X A;  3HEI A;  3A23 A;  3U37 A;  4OZO A;  3THC A;  3W5M A;  3ETP A;  1UYZ A;  1JZ7 A;  2Y6L A;  1UZ0 A;  1W9W A;  1XC6 A;  1NUK A;  2EIC A;  3ACH A;  3C7O A;  3K4A A;  3NNG A;  5EJZ B;  2VR4 A;  1MPX A;  1H6X A;  2J22 A;  2DCJ A;  3OGS A;  2QQN A;  1CZT A;  2VJX A;  2VZ1 A;  2YFZ A;  5DMY A;  1CX1 A;  3MUZ 1;  1PX3 A;  1US3 A;  1JZ6 A;  2J7M A;  3LQC A;  2YB7 A;  3CQO A;  2W9X A;  2QQO A;  4CU8 A;  3IDA A;  4HG6 B;  4TXW A;  3OG2 A;  2W94 A;  3WQB A;  2E32 A;  4GWJ A;  2XON A;  4E8D A;  1OF4 A;  4A45 A;  4JKM A;  1GOF A;  2VME A;  2V4V A;  2W5F A;  2YFU A;  1PX4 A;  5LCW L;  4LKS A;  3A22 A;  3OGR A;  4CUC A;  5JXH A;  4CVU A;  3I2I A;  3K77 A;  3T2O A;  4XUT A;  3T0D A;  4QB2 A;  3SEP A;  5B4X A;  2VO5 A;  2VZ3 A;  4GZ9 A;  3FHA A;  4OYU A;  4XUQ A;  4ZZ8 A;  3LE0 A;  4QX1 A;  2E26 A;  1SDD B;  3EYP A;  5CZK A;  3CKH A;  1JZ4 A;  2JDA A;  1P8J A;  3ABZ A;  3NJX A;  4PF1 A;  2E33 A;  1GOH A;  4AG4 A;  4OUE A;  4D8M A;  2JD9 A;  4E8C A;  2Z4F A;  1W8O A;  2ZEW A;  3DYP A;  2VQU A;  2JE8 A;  2WBK A;  1L7R A;  5G04 L;  2J1E A;  1JYN A;  4JX0 A;  2VZO A;  2WO1 A;  4BXS V;  2WAA A;  1O8P A;  3SKJ E;  4QAW A;  3T09 A;  4QDQ A;  4P08 A;  1WCQ A;  4GWI A;  2BER A;  3WNK A;  3SKV A;  4MO3 M;  2E31 A;  5B4N A;  5C70 A;  3SEE A;  2Y6J A;  3OB8 A;  5IHR A;  4A3Z A;  2WDB A;  5JR2 A;  3MV1 1;  2JKX A;  1KGY A;  1GU3 A;  2RJ2 A;  3WF3 A;  5C71 A;  2J1T A;  1W9T A;  4A41 A;  4DUX A;  2YC2 A;  5IFT A;  3I2J A;  2CDP A;  2VCB A;  3III A;  2ZXQ A;  5EJ1 B;  4LQR A;  2VMF A;  3VDA A;  4XUN A;  3HPN A;  5LA0 A;  3ZM8 A;  1NX9 A;  2WO3 A;  1K3I A;  4AAX A;  3MUY 1;  2J1U A;  3JXS A;  2QQM A;  1OT5 A;  2W91 A;  2ORZ A;  2BBA A;  3IAQ A;  1H6Y A;  3THD A;  4ZZ5 A;  3MV0 1;  2B4K A;  1UMI A;  1KEX A;  1BHG A;  4ZXE A;  3VD9 A;  2C9K A;  2J1V A;  1US2 A;  3LPF A;  2VM9 A;  2EIB A;  3UNP A;  2QBX A;  3CZU A;  3OGV A;  1TVG A;  2WYS A;  4A42 A;  2HLE A;  3C7H A;  4QX2 A;  1GUI A;  1LNS A;  4MAD A;  2VZP A;  2V72 A;  3K46 A;  3ACG A;  1JZ2 A;  2Y6H A;  3T0A A;  2PQS A;  3T0B A;  2Y8K A;  3FL7 A;  2ZEX A;  3WNN A;  1F4H A;  4A44 A;  2QQK A;  5DPN A;  3LEG A;  3LPG A;  4XZU G;  3UET A;  5G05 L;  3FHQ A;  4TTG A;  1UYX A;  4DUW A;  4XUR A;  3HN3 A;  3A7Q A;  1OD3 A;  3J7H A;  2WUH A;  2VZV A;  1W9S A;  4BK5 A;  2W1U A;  3GGL A;  4CUA A;  5LA1 A;  3WF0 A;  2L9L A;  5A1A A;  1JI6 A;  2RVA A;  2VZT A;  3I3B A;  4QB1 A;  1RYY A;  2WAO A;  3OEB A;  4A4A A;  3C7E A;  1CZV A;  2VMD A;  2W87 A;  1K12 A;  2VZQ A;  2Y64 A;  4PQQ A;  2WZ8 A;  3F2Z A;  3PUH A;  3GXU A;  3I2G A;  4A6O A;  3C7G A;  3PUI A;  3I97 A;  3MBW A;  2X05 A;  1R64 A;  3DYM A;  3IB3 A;  5HPO A;  4XUP A;  2DCK A;  3DEC A;  3WNO A;  1PMJ X;  3K4Z A;  2WQ8 A;  5C7G A;  5F7U A;  3VD4 A;  3LEK A;  2LS6 A;  4P00 B;  2W95 A;  4UI9 L;  4CU7 A;  2W47 A;  3T2P A;  1JYV A;  1I5P A;  1DLC A;  1OH4 A;  4LPL A;  5JUV A;  4P02 B;  2R7E B;  3VD5 A;  2WN3 A;  2VZU A;  4QPW A;  2VTF A;  2VCA A;  2YC4 A;  3WNL A;  3GDB A;  2EIE A;  2WN2 A;  4KMQ A;  4DXR A;  3WF1 A;  4Z2A A;  1JYX A;  2HYX A;  3GM8 A;  4DEQ A;  1UY3 A;  1W0N A;  3I2H A;  5IFP A;  2EID A;  4XVH A;  3P1I A;  4W4Z A;  2WAB A;  4ARX A;  5J1X A;  1GOG A;  5FUI A;  4CUB A;  2B9V A;  4JKK A;  1DP0 A;  3I2K A;  2V5D A;  2VQT A;  5EIY B;  1YQ2 A;  2ORX A;  4CU9 A;  4KI5 M;  3VD7 A;  1GQP A;  1EUT A;  1UY0 A;  4UOJ A;  4FI9 A;  1OF3 A;  4QB6 A;  3DYO A;  1CZS A;  2XQX A;  3P6B A;  5JXJ A;  2LW8 A;  3C7F A;  5DQ0 A;  4DEV A;  2W1S A;  2VZR A;  3T2Q A;  2W92 A;  1UXX X;  3VD3 A;  3OEA A;  2DDU A;  3FN9 A;  2VOT A;  1J83 A;  1EUU A;  1K45 A;  2X10 A;  2W3J A;  1UXZ A;  2C26 A;  4W8J A;  1WKY A;  4BK4 A;  1UX7 A;  2RV9 A;  2XHN A;  4JKL A;  3BN6 A;  4DXT A;  1XNA A;  3ECQ A;  1CIY A;  4QDS A;  3NQH A;  5LA2 A;  3HNB M;  4M4R A;  1D7P M;  3WEZ A;  4ARY A;  5I0D A;  5IJR A;  3UES A;  2VZS A;  2YG0 A;  4D0Q A;  2Y6G A;  2J1A A;  1T2X A;  2W1Q A;  4RN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...