2Y6KA

Xylotetraose bound to x-2 engineered mutated cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
165
structure length
165
Chain Sequence
LVANINGGFESTPAGVVTDLAEGVEGWDLNVGSSVTNPPVFEVLETSDAPEGNKVLAVTVNGVGNNPFNIQATALPVNVRPGVTYTYTIRARAEQDGAVVSFTVGNQSLDEYGRLHHQQITTEWQPFTFEFTVSDQETVIRAPIHFGYAANVGNTIYIDGLAIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for carbohydrate-binding specificity--a comparative assessment of two engineered carbohydrate-binding modules.
pubmed doi rcsb
source organism Rhodothermus marinus
molecule tags Hydrolase
molecule keywords XYLANASE
total genus 43
structure length 165
sequence length 165
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02018 CBM_4_9 Carbohydrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2y6kA00
4QX0A 2ZEZA 3VD4A 4OMCA 3IIIA 3W5NA 1PX3A 3CZJA 4CU6A 2VR4A 2BZDA 2QQMA 2VMCA 3LE0A 3UETA 4GZ9A 2Y6LA 1W8OA 2VL4A 3NNGA 2V5DA 4JKLA 3MUZ1 2XQXA 2DCKA 1UZ0A 2W47A 1F4AA 4QX1A 4DUWA 3MV11 3DYPA 2J1AA 2YC2A 2PQSA 2W1QA 3WNKA 3I3EA 1W99A 2LS6A 2VZQA 4W50A 1XPWA 2J1RA 2JD9A 1XNAA 1JYXA 4ZXEA 3C7HA 3I2HA 3LEIA 1K3IA 4BK5A 3F2ZA 4QB2A 5DMYA 1F4HA 5LCWL 3SEPA 1UY1A 3WF2A 1CZSA 3VD7A 5G04L 3WNPA 4MGQA 5G05L 1XNTA 5EJZB 4A44A 1JZ8A 5LA1A 1DP0A 3HNBM 4DUVA 3WSOA 1JZ6A 1K45A 1O59A 1UXZA 2W92A 3JXSA 4Z2AA 1OH4A 5IYYA 5JXJA 3A23A 1EUTA 1UX7A 1HN1A 2J7MA 2Y6HA 5DN2A 5DQ0A 2BGPA 4A3ZA 2XHNA 3IB3A 4A42A 3WQBA 4DUXA 1DYOA 4XUOA 1UY4A 4ZZ5A 3W5MA 4W4ZA 3OEBA 2VCCA 5IFPA 3AC0A 2B4KA 2BERA 2WDBA 3GGLA 5J1XA 1JU4A 1UY0A 3VD9A 3IAQA 2Z4FA 5IHRA 3K4DA 4A6OA 3WF3A 1GQPA 2VCAA 2R7EB 1CIYA 2QQLA 2E32A 1GMMA 4CUCA 3A21A 2ZEXA 1PMHX 3ACGA 3K75B 2W95A 2VJXA 4D8MA 4ZZ8A 1GOGA 1UY2A 1J83A 2VZ1A 5C70A 2WO1A 3VDBA 3HNYM 2EIEA 1I5PA 2VM9A 3THCA 2JDAA 3CZUA 3T2QA 4YPJA 4PT6A 4AAXA 1CZTA 4IUGA 1UYZA 2YFUA 5IFTA 2L9LA 3GXUA 4QX3A 4XUTA 4XVHA 1TG7A 3VD3A 4CUBA 4DEQA 3E1F1 4MGSA 2VMEA 2Y6GA 2VZSA 3PUIA 4QDSA 4TXWA 2W87A 2CDOA 2RV9A 2VMDA 3OGVA 4E8CA 1H6YA 5EJ1B 1KEXA 3WNMA 3OBAA 4ARYA 4DEVA 2HYXA 5JUVA 2VCBA 2YG0A 1PMJX 3FHAA 3U37A 2VZTA 2QQIA 2ORZA 5C71A 1K42A 4LKSA 3HEIA 4KI5M 1JU3A 4A45A 2J1SA 1ULOA 2ORXA 4A4AA 1SG3A 4UI9L 3WF4A 3CKHA 3P1IA 1W8NA 3OB8A 4PQQA 3LQCA 1UYXA 2WAAA 2W91A 3LEKA 2C9KA 4DXTA 2W9XA 4JKKA 4TTGA 1W9TA 1JZ5A 4P02B 4QDRA 2WZEA 1SHWB 4JKMA 2XOMA 3NJVA 1P8JA 2VTFA 1RYYA 2V4VA 2BBAA 1T2XA 3C7GA 3HPNA 2X05A 5I0DA 3ACHA 3EB7A 3HN3A 5B4XA 3SKJE 4L0PA 1BHGA 4CU9A 3OGSA 4CU8A 3ETPA 1KGYA 2W1UA 1OD3A 3DYMA 2YFZA 5FUIA 2RJ2A 2WN2A 4ARXA 1JZ3A 1IQDC 3ABZA 4XURA 4LQRA 5LA2A 4E8DA 3I2FA 1JI6A 5CZKA 3ZM8A 4CU7A 4D0QA 1XC6A 2V72A 3WNNA 2QQKA 4FI9A 3IAPA 3CIHA 1K12A 3K46A 2WAOA 3I2GA 3ECQA 2YB7A 3I2JA 3EYPA 3GM8A 5C7GA 1UXXX 1CZVA 4OZOA 1W9WA 3T2OA 4AG4A 3LPFA 3BGAA 4LHSA 3CMGA 1W0NA 3PUHA 1GNYA 2QQJA 2VZ3A 2QBXA 4XUPA 4BJ0A 4OYUA 4OMDA 3ACIA 3SKVA 2J1VA 4LPLA 3UESA 2JKXA 2KD7A 4QPWA 3T0DA 1JHJA 2XONA 2JE8A 3I97A 4PF1A 3C7EA 4M4RA 2VZPA 2QQOA 4QAWA 2VQTA 1MPXA 4UOJA 2W5FA 2OKXA 5B4NA 4ET7A 3C7FA 1W9SA 2WABA 3IDAA 3NRUA 1JZ7A 1O8PA 1R64A 5JXHA 3DECA 3WNOA 4P00B 4ZY9A 3T0BA 3WF1A 3OG2A 3A22A 1GOFA 3WNLA 1JYNA 4HG6B 5CYYA 2E31A 1L7RA 2C4XA 3MBWA 1GUIA 3FHQA 3T0AA 2YC4A 1US3A 1H6XA 1JYWA 4W8JA 1O8SA 2J1EA 5JXIA 3FN9A 1UMIA 5JMOA 3DYOA 5LA0A 3J7HA 4UAPA 3MV01 1NKGA 4QX2A 2J22A 3CDZB 2Y6KA 4OUEA 2LW8A 3A7QA 4KWUA 3CQOA 4P5YA 3P6BA 1LNSA 2WUHA 4MOAA 2X10A 2WBKA 4XUQA 3MUY1 2WO2A 2W46A 3D3AA 4BDVB 2Y8KA 3K4AA 3UNPA 3I2KA 4KMQA 2ID4A 2QQNA 5A1AA 3C8XA 2VQUA 2CDPA 3HJRA 5F7UA 3OEAA 2EICA 4QB1A 2J1UA 4A41A 5EIYB 5JXGA 3T09A 4M4PA 1US2A 1UWWA 4CVUA 3BN6A 3I2IA 4BK4A 5HXMA 3I3DA 4XUNA 3T08A 3GDBA 4P08A 4QDQA 1DLCA 3MO4A 1L7QA 3WF0A 1JYVA 2DDUA 2EIDA 1UY3A 3VDCA 1WCQA 3SEEA 3THDA 2ZXQA 4JHZA 1OF4A 4GWIA 4QB6A 2WN3A 1CX1A 1UMHA 2Y6JA 1OT5A 4RN5A 2W1WA 1NUKA 1WKYA 5DPNA 2HLEA 4XZUG 2ZEYA 2VZOA 2WO3A 1D7PM 3FL7A 2E33A 1J84A 1SDDB 3HNMA 1OF3A 4MO3M 4CUAA 3ACFA 1JZ4A 2E26A 2RVAA 4DXRA 2WYSA 1GU3A 2EIBA 3NQHA 2VZRA 3HOBA 3C7OA 1EUUA 2Y64A 2VZVA 2VMFA 2ZEWA 3I3BA 1YQ2A 4DXSA 3LEGA 3NJXA 4BXSV 3LPGA 2VZUA 2DCJA 1TVGA 2VO5A 1UYYA 3WEZA 2B9VA 5JR2A 4RYDA 2WQ8A 3VD5A 5HPOA 2X09A 4JX0A 3K77A 4MADA 4GWJA 3K4ZA 2C26A 2W1SA 1GOHA 2BGOA 3OGRA 1ULPA 5IJRA 1NX9A 1PX4A 2VOTA 3VDAA 2VC9A 3T2PA 1JZ2A 2W94A 1NAEA 2J1TA 2W3JA 2WZ8A
chains in the Genus database with same CATH superfamily
2ZEZA 3VD4A 1IS3A 5C3RA 1OA2A 2PHDA 3VBRA 5IVFA 5LY1A 5KBFA 5DZEA 4EE2A 3AMQA 3LE0A 4GXLA 2AYHA 1LHWA 3B5LB 1NXD1 3ORJA 5D2AA 5FQ0A 5AVAA 2ILMA 2JJ6A 2WWJA 3MUZ1 4LBJA 2XQXA 2RS11 2UY8A 3MW3A 2DCKA 3ZLIA 1UZ0A 3WP5A 4BWOA 3IDEA 1GZTA 5FYVA 4NAOA 5KXDA 1OLMA 2E53A 2YC2A 2B7YA 5C3PA 2IXKA 4XJAA 5FPLA 1NE4A 1AR71 2PQSA 2W1QA 2VGDA 3N35A 4QX7A 2LTNA 1W3VA 4MH0E 4W50A 1V6KA 1RMU1 4XDOA 2WINB 1YQ5A 1LGBA 1PO11 5IAXA 1H30A 1Q8PA 3I2HA 3LEIA 3RI8A 3ALQA 3WDYA 1K3IA 5A6ZA 5CFDC 3RZGA 4BK5A 1VB2A 2VNGA 4UFLA 3WG3A 3OGJA 1VBD2 4UBHA 3FFZA 2W08A 1YFWA 2IUWA 5FZCA 1EAH2 2JDKA 4YARA 3TEWA 4J1XA 1X8MA 1UF2C 3VD7A 4UF0A 5G04L 4DFSA 2WNVC 1DQ0A 4XIOA 1VB4A 4MGQA 4FFGA 5JOZA 1H9PA 1VBE3 5EJZB 1OMIA 4OLLA 4LITA 3HNBM 2FCVA 1XRUA 5FBZA 3WSOA 2IXJA 5F5CA 1JZ6A 4YZ4A 3N7MA 3KCXA 1O59A 4XFCA 3AJZA 5F2SA 5C5UA 1LGCA 1UXZA 3KM5A 3JXSA 1HN0A 1OH4A 1PK6B 3EXUA 5A3LA 2R072 2DURA 1H1MA 3U1XA 2J7MA 5JMCA 4HVOA 4NRMA 1WGPA 1UCXA 3USUA 2ZGKA 4CZSA 1POV3 1LEDA 1WCDJ 4EYUA 1U12A 2Z2SB 3U07A 1SEFA 1VJ2A 4AQ6A 1D0GA 5K7PA 3NJYA 5FY8A 4ZZ5A 4ZS2A 2P6HA 2D6LX 1W3XA 4IL7A 4S2FA 1IPSA 4XFBA 1ND3B 4Y5TA 2G1MA 4M0NA 1W8UA 3PUAA 3LWCA 2B4KA 4GAZA 4NIDA 1MEC1 4ES8A 2RS13 2DUOA 1CONA 2JG8A 5FREA 3GGLA 1MZFA 2W68A 2WWSA 1JYIA 1RUJ3 3N36A 1UU6A 3WD5A 3IAQA 1GICA 3IM0A 3AKTA 3IT8A 3LZZA 1K5MC 1PO23 3JB4C 1GQPA 1TME1 3AP9A 1XYNA 1XSQA 3PVBB 5E6HA 1AL22 4TLGA 3E97A 5E1RA 4O9EA 3ZSEA 1UKGA 4Y1UA 2EXIA 3ZX7A 3FFQA 4HXCA 4C0HA 3A21A 2IFWA 5C8WA 2XLAA 3VBFA 1Y4WA 2PELA 4YVWB 5LBCA 2FCTA 1HDKA 1PMHX 1XBFA 3WDVA 3K75B 3ZFEC 4Q0VA 1PZ7A 2GN7A 4YZ1A 2HWC3 1MZEA 3FMGA 1GOGA 2R32A 1W39A 4MG2A 3WR0A 2XGXA 4AXOA 3WDTA 1YI7A 2D3PA 3N9PA 3VDBA 3D4KA 1IPJA 1C8M3 3HNYM 4JGYC 4K1YA 4AQSA 4EN0A 5FMCA 4IV3B 1HRV2 4AEJA 2A6VA 3T2QA 5F5QA 4PT6A 2JDZA 4IEWA 4JVAA 1CZTA 4AAXA 4HOOA 3RSJA 3FHIB 2QUOA 3LIHA 4WM8C 5D8AB 3BTYA 2GC2A 3NV3A 2YFUA 1S2BA 3WLUA 2L9LA 2JEMA 3K3NA 3GXUA 1LHNA 1NLRA 4XVHA 1SBDA 3D82A 2AH2A 4P14A 3VD3A 2GMEA 1PZ9A 2X29A 3CJIA 4MGSA 1CWPA 4K6BA 2VMEA 1PGW1 4QDSA 2XVGA 3SCFA 4RQPA 2HWB1 3GALA 5BNNC 2B8MA 2EF6A 4OQ8A 5CNAA 1JH5A 4IW3A 4R9DA 5GLUA 2UYBA 1AVBA 3CF6E 1S0IA 1MEC3 1SFPA 3OD4A 5CFCB 1KD7A 3L2HA 4ARYA 2BNMA 4GH4C 5C5TA 4CPBD 3BI3A 4QKNA 2VCBA 3FHAA 1GV9A 5A70A 2ORZA 4NIIA 5DZGA 4A7KA 3DV8A 4N9IA 1K5MA 1NE6A 2RS33 3ZYRA 4BU2A 1D4VB 4A45A 3B3QE 1GSLA 1QHDA 1CN1A 4DO0A 1TE1B 1PNFA 1VBA3 2ORXA 3MIDA 1XNKA 3MPPG 1QOTA 1SG3A 2KR2A 3ZYIB 4ES9A 4W6XA 3H3ZA 2NMOA 2VBBA 1AR72 4HN0A 3OYWA 1QKQA 4I09A 4XXAA 4AEDC 1YNAA 1SLBA 2JB4A 4NRPA 2P3IA 1LAJA 3H0OA 1UYXA 2W91A 4R52A 5CKNA 1RMU2 5BNQA 1S0FA 4WBBA 4JKKA 2RE9A 4LKFA 3AL6A 3LFMA 5E89A 4AYUA 1E5IA 1T6BX 1YLLA 2J42A 2PYTA 4COUA 4Z1VA 4DRRA 2WZEA 5AFBA 2R30A 1SHWB 3H42B 1KXGA 1CD3G 2QFEA 4KU7A 2XLFA 2N7GA 4QXKA 1T2XA 1VRH2 1BVVA 2GALA 4CEYA 1QJY3 1AJKA 1IG3A 1QXRA 3VHOA 2RS51 2F6BA 4H14A 5CA6A 3J26N 4YW3A 1UZYA 4FTSA 3FWEA 2A6ZA 1IQAA 1ULCA 1N3QA 1OPMA 1Q8SA 1YFYA 2K46A 4L0PA 1QQP1 5HV0A 4C8DA 4ISRA 1GQHA 5SV8A 3DYMA 2RJ2A 4Q4X3 4CE8A 4HVRA 5EV7A 3CBNA 1CVNA 4N43A 3MF9A 3TN92 1VALA 1XNCA 3O7OA 1IQDC 4K8RB 4XURA 5FZKA 3I2FA 1JI6A 1QNWA 1PIV3 3EHKA 3ZM8A 5C8CB 1IKQA 2VUJA 4D0QA 1C5HA 2V72A 5LASA 3GJAA 4FI9A 5A3TA 2JECA 1O91A 3PVEA 1X36A 4LA3A 4NHYA 2WAOA 3JD72 4XBNA 2PXJA 2XUEA 1AJOA 5CKMA 3KWVA 1Y9QA 1RUF1 3J8F3 3VZLA 2ENRA 3AP5A 4INDA 4CTEA 4JDNA 5F6KA 1CZVA 1EAH3 3R0RA 4IE6A 1PVXA 5IW0A 1A34A 4AG4A 5FAXA 1RVF2 3MHZA 3S7EA 1GNYA 4QHZA 1JMUB 2HWD2 5F9TA 3O0XA 4JGZB 5FZMA 1KRIA 2WS91 1HB3A 4BJ0A 4L8QA 1AR93 4KWJA 4OYUA 2PAEA 1AYM2 2HWC2 5KXEA 3KQRA 2KD7A 1SACA 2YGMA 1XJAA 1F9KA 1ULDA 2CU5A 1JHJA 3N9MA 5EJ3A 4LORA 4XF4A 1KFXL 2XONA 3KV4A 4MGTA 3SQOA 2PHWA 5GZCA 1SFYA 2XBO2 2WT1A 3HT2A 4GB33 4QPGA 4WM8B 1FATA 2R043 3VBOC 5FMOS 4XHXA 5EYXA 1HRV3 2A71A 2IZWA 2VZPA 1DQ5A 1NCRA 1OVPA 2D98A 2VQTA 2Y0IA 1W6PB 3UJOA 3V56A 1TNFA 4AEMA 2ET7A 1XU2A 2OKXA 1OI6A 4Z82A 3WP3A 3B69A 1D4M3 1W9SA 2QNKA 3DXTA 1WMEA 4D94A 5JXHA 5FZBA 4QU1A 4XETA 1RC6A 3WNOA 1VRH3 1COV1 3INAA 1RUG1 1Y3TA 2XVLA 4NMIA 3AM2A 1OC1A 4ZY9A 1S0DA 4CDXC 3WF1A 1V6MA 2YPDA 4XC9A 4NE9A 1RL3A 1N3OA 5F37A 5JSRA 3GCWA 1ASJ1 4IV3A 1OFNA 2V4AA 1YO8A 4Y1YA 5CYYA 2OW4A 3ZMNA 1YJLA 5C33A 1ZZ8A 1HV1A 1L7RA 2C4XA 4LNVA 3MBWA 3CNAA 3MYXA 4L11A 5M0TA 4IGPA 4Q1RA 5BNPC 2BU9A 4XFAA 1QJZA 1U5IA 4PIZA 1A8MA 2BOIA 2WO7A 2WNVA 4FPJA 3FLPA 5FDBA 4A6SA 1JYWA 4L99A 5EP9A 4CXYA 1DGWA 3ILNA 4XHBA 4M00A 3MLJA 3CJIB 4TSVA 1QXJA 3VBOB 1C8M2 4UFMA 4S2GA 3FX3A 5ANNA 1FMD1 3E5QA 1OQDA 2JDPA 3M2MA 1LESA 3FN9A 4LUMA 5JMOA 3LD8A 1LU1A 3J7HA 4E4HA 5EFUA 5BNPB 2E51A 4JRLA 2A3YA 5FO7B 3PLQA 2J22A 3Q8CA 1ZRCA 2WIIB 4OCTA 4AAPA 1WW4A 2B9UA 2YV8A 3TAYA 2ZX4A 1AR62 2BGCA 2WLQA 4QX8A 3ZSLA 4YYOA 2UWAA 3AFGA 1RUOA 4U2AA 1REFA 2VH9A 2WUHA 2VUCA 2YBPA 4Q4V3 2X10A 4V1PA 3T4VA 4NVPA 2HKXA 5BNOA 5A3NA 1GZWA 3APBA 2ZMKA 3WV6A 1UNBA 2LUWA 5L7OA 4XXPA 3S0MA 4HBNA 3AMNA 2HWF1 4YW1A 3K4AA 4QPIC 3O14A 1HIXA 3UK9A 1RUI2 3JZVA 1BLZA 4LXLA 3GYDA 3NNLA 4JQRA 1S0CA 5A1AA 1OOPB 3H3UA 1VE0A 1I6XA 1PGSA 2RG4A 1W03A 2Q1ZB 1BKZA 3WG2A 1H2MA 1XOYA 2J1UA 3Q8AA 1QWRA 4W6YA 1VMJA 3DN7A 4YZ2A 1HRI2 1NYWA 4MV2A 3DPRB 5FY1A 5FWJA 1JS9A 1MS3A 4U36A 2FZ1A 3I3DA 4FOVA 4ORFA 5FP3A 4YM0A 3VKNA 4HN1A 3KV6A 1GWMA 4P08A 3NAPC 4LJHA 1L7QA 2WSVA 2EA7A 2Y60A 2YROA 1JYVA 1QDCA 4JGYA 3A0KA 5FPAA 3ZYHA 4NIGA 4SLIA 1OA3A 5ABJC 4XJUA 4FOWA 4EN9B 2HWC1 4XDQA 2G4IA 2C0ZA 2RMU2 2WN3A 2XKPA 3JB8A 4Q0UA 5JIUA 1PGL1 3A0NA 4META 4Y22B 1UMHA 1QNYA 4RN5A 2D93A 4CCOA 4PBPA 5GM0A 2QDNA 3RI9A 2VCMA 5LZ6A 5KXBA 4N53A 1LENA 1VBE1 1WKYA 1YWKA 2IVJA 3KSCA 4JTNA 3KMHA 2XL9A 4RR3C 4KL1A 3SXWA 4XF0A 4XZUG 5C8CA 2YBSA 3WP4A 3IN9A 1E5SA 1D7PM 2NMNA 5C6CA 2Q8EA 1YC61 1MS5A 4Q8KA 1AL0G 1PGW2 5FYSA 1S1AA 1WWYA 1OF3A 1W8WA 3S5QA 5IK5A 1AYM1 1FOD2 4SBVA 1GLHA 5A7WA 1UQXA 2JIJA 2PLV3 2EIGA 3QD6A 1JZ4A 3KT4A 5C9AA 1AR63 1CQ9A 1ZRFA 2CSGA 1GANA 2RVAA 1POV1 5GZEA 3DPRC 2WQZC 4B1MA 2WFF2 4AEKA 3DKWA 3LEMA 1QDOA 2EIBA 4FPEA 3WW1A 3RZMA 5J37A 1FX5A 2PMWB 3POEA 1DYPA 3C7OA 5FZGA 4FFHA 2H6CA 3I3QA 4H55A 3Q9OA 4WVVA 1YQ2A 4CP1A 1UPSA 3BVCA 4BXSV 2K0GA 1S0GA 1FAYA 5FQ0B 5C4WA 5I8TA 1UYYA 3RZKA 2B9VA 2ES3A 4W6WA 5FPZA 3VD5A 3BALA 2BWAA 4JX0A 4AI0A 2LROA 2FMDA 5E88A 3ZVXA 1HXS2 1MR5A 4RR3B 1RIRA 4MADA 1RUC1 3MGUA 5GLTA 4S2HA 3H7YA 1TNRA 3ZN4A 4FTBA 3OGRA 4KGQA 1ULPA 1WLDA 3LOBA 2R49A 2Q8OA 5B2GB 1S2EA 3ETQA 5J7MA 5JPNB 1R1A2 1TMF3 2FDHA 3BPSA 3NNMA 4TYSA 4Z2WA 2OPWA 2Q0AA 4OVEA 4TZDA 1BK1A 4PDWB 5EYYA 5DDJ2 3ZR5A 2J1TA 4FSJA 4QPGC 4QX0A 1RUD3 5FY0A 2CWSA 1DQ4A 1QOSA 1UIKA 1PX3A 3IIIA 4GB32 4OMCA 4BMEA 1RHI1 3W5NA 2VR4A 2KXLA 3OBTA 2C1FA 4QPIA 4YG0A 3ZIXA 4XAAA 1NCQA 3KT7A 3POBA 3S5AA 1CJDA 2JDUA 5A3OA 4JKLA 1S4CA 4I3PA 4KNCA 5F32A 2GNTA 4D7YA 5BNOC 3URFA 3ZFEA 2W47A 3BPZA 3IDCB 1XYOA 4ONUA 1UOJA 3RWNA 5L73A 5A1LA 4C91A 5LWBA 2CYFA 2JENA 1NCQC 5L36A 5BV6A 3RYRA 1W99A 2BEOA 2LS6A 1AR61 3OUJA 2ADDA 4WZCA 3BIEA 4OHVA 3O1OA 1V0AA 5T5PA 2A73B 2VMGA 1JYXA 2OZ6A 1H4HA 1PO13 3C7HA 2BQPA 1GNHA 5FYIA 2BP6A 2D43A 3LIGA 4QB2A 3X29B 4BA6A 5DMYA 1XQNA 1F4HA 3EBRA 2EAKA 3N9NA 2VU9A 2IWGB 3SEPA 3WF2A 1CZSA 4RGGA 4IE7A 1Q8QA 3WT3A 1XNTA 3WUDA 1JZ8A 4A44A 1ZBA3 3JU9A 3PU3A 1DP0A 5BNPA 5LA1A 1AR83 1NT0A 3NKGA 2AEYA 2W3JA 3ZFGA 1IS4A 1K45A 4JV4A 4QD2A 4UW3A 2ZGQA 1GP4A 1RUJ2 4D3WA 2DVDA 1VBB1 4NHMA 2GMPA 3O0WA 1OOPA 2D6MA 5EJ1B 2OT7A 1Q8OA 1R081 5DG2A 2XG3A 1YCIA 3M4FA 1FPN3 3THPA 2BGPA 1OPOA 3WQBA 2WNVB 4E2QA 1DGRN 5HI0A 1ZZ9A 4XQWA 4G9SB 5LEJA 1FT9A 1QJEA 3AVRA 4FPOB 2I74A 4XFIA 4ZU5A 1LOFC 1WMXA 2R041 1JW6A 1SLCA 1AXZA 4Q2FA 3S7IA 1OKOA 4XOGA 4Y1VA 3HQRA 1AUYA 3AP4A 2UY9A 1LHVA 3E6BA 5AC91 4NOTA 4WZFA 4AGGA 1JU4A 3G7DA 3O1MA 3ZN6A 1UY0A 2X53S 2X5IC 2YC0A 3MLKA 5JDBA 1RUH1 2Z4FA 3K4DA 4A6OA 3VL8A 1JTZX 2VXRA 2VCAA 1ZX5A 2LALA 2R7EB 3Q8BA 5FZFA 5JZGB 1HQNA 4IGQA 5APAA 1BBT3 1GMMA 4Y22A 2F4LA 4PI2A 4PF5A 3I4IA 4GH4A 4Q4X1 1V70A 1ZZ7A 2ZEXA 4UW5A 2B46X 1B09A 2NZ9A 1G8WA 3ACGA 1QEXA 4D8MA 4LOSA 5L7OB 1J83A 4NHXA 2OUJA 2A75A 1LHOA 5DABA 2WJSA 4M0HA 2VNRA 4GKXA 3NV1A 4I0BA 2EIEA 1GYKA 2GC0A 4R9CA 4WVWA 1DDLA 3AKSA 1OHFA 4BQXA 4F8AA 3THCA 1VP6A 3CZUA 3T1MA 5FXXA 1QGLA 4K8FA 4CDQB 1HJGA 4UBGA 2VVEA 3U10A 5CADA 1EAH1 3AXDA 5LBBA 3W9AA 3USUB 2YMZA 3MIGA 1HXS3 1W8HA 1DCSA 1FXZA 1UYZA 4DIQA 3VBFB 3O1SA 3LF7A 4QX3A 4YWAA 4A7ZA 1LULA 2DYCA 4HK9A 3HT1A 4XABA 1W05A 4YSFA 1XNDA 1G86A 4HZFA 4IDZA 1R093 2BUKA 3PTRB 4DEQA 4DS0A 4COVA 3PUIA 1W8FA 3ZMOA 5FZDA 1CJPA 1MQTB 2DTYA 3EQEA 1OH3A 1PM4A 1ND2B 2CDOA 2WR9A 2ZA9A 4XJZA 2W39A 2P2KA 5FZ9A 2NYYA 3M3CA 4WM7B 1ODNA 1ODMA 1O5UA 1VLNA 1WCKA 3M3IA 3AZVA 3IPVA 3PUQA 2WA3A 3CEWA 2AC1A 3OBAA 3EO6A 2G9ZA 1VBC3 1PMJX 2YG0A 1HRI1 2VZTA 2BWCA 2X8KA 5FUPA 3POGA 3GHMA 3IMNA 3ZPYA 1DF0A 2Q8CA 2WS92 4EV0A 1OSGA 3HEIA 5E16A 4CDUA 1GBGA 4BYYA 2B42B 3RNSA 1FNZA 1WW7A 4UFJA 4B3NA 5CB7A 1TME2 5GLWA 5A3UA 4TN7A 4AI3A 4PQQA 4LHNA 3PVOA 4XE9A 1DIWA 1YI9A 4DINB 2WAAA 5C8CC 5KHIA 2C9KA 4KWKA 5IK8A 2OA2A 3ILRA 3RVHA 1MZ6A 3EMRA 4ZS3A 1W9TA 1RUE2 2AEZA 4LO6B 4N53C 4P9XA 5A7SA 2SLIA 3ZR6A 4CEWC 3AX4A 1CR7A 2VTXJ 1WBFA 5EHDA 2FDIA 1RJ8A 4QDRA 2XVKA 3AZYA 3HBZA 1ND3C 1GZCA 4CP2A 3UKTA 1MZ5A 2BNNA 5L19A 1J1TA 2Z42A 1RYYA 5DXDA 2BBAA 4HANA 4BQ2A 4B8EA 3JD73 3LDBA 4HKOA 1LGNA 2DCZA 2EXKA 2ETEA 2KM2A 4CCCA 5FZ8A 1X7NA 2VG9A 2Z79A 1OQ1A 3ENRA 4P9YA 5A7OA 1J3RA 3BCWA 3WDUA 3BTXA 1BHGA 3ES1A 4FXKB 1A8DA 2R061 4IEXA 5F3IA 4CU9A 4QWNA 2C24A 5A7WB 3OGSA 1H4GA 3RS6A 4CU8A 4ZU7A 5FOJB 2WC2A 4R8HA 5A80A 5FY9A 2YFZA 5F8PA 2WN2A 5F3CA 2GP5A 5FCCA 3R4DB 4ARXA 3POJA 1DZQA 1EY2A 3FLTA 4Z8BA 5FIXA 1JZ3A 3MZHA 2WFF1 3AK0A 3CO2A 4Q4V1 1AYM3 4FP3A 4GA9A 4QPGB 5BUVA 4JDMA 2WNUC 4AFBA 4E9KA 1QF3A 1YQCA 1W6NB 1VAKA 1JBCA 5CFDA 2QQKA 3JBG2 3PHMA 3IAPA 4YW4A 2O1QA 1C57A 4ZPIA 3CIHA 4XTPA 1K12A 4Y20B 1FMD2 3JCIA 4BIFA 3DL3A 4UFKA 3RZZA 2DCYA 3ECQA 4UF0B 3WX5A 1CPNA 1XE7A 4OHXA 1CIWA 4QU2A 1OVSA 4N53B 4EQVA 4PLOA 3W21A 5JOXA 2D3RA 5FFOC 3RYKA 4FPCA 2RR11 3T2OA 5CKQA 5I0UA 3LPFA 3BGAA 1VBC2 4JC1A 1I5ZA 1H1IA 1RUH2 1ACCA 1VIWB 3CMGA 3JQWA 3PUHA 2W0XA 4Q0SA 3VBFC 1E57A 1VMFA 2YYOA 5L9RA 4YM3A 2JDHA 2CGNA 4OMDA 3ACIA 3OUIA 2WZR2 3M3OA 3AZXA 1DQ6A 4PLNA 1QJX2 1SCRA 5F5IA 3POWA 5JAXA 1N1YA 5FJKA 3I97A 2WKKA 3TYJA 4M4RA 2CL2A 1YRZA 1LOAA 3PTYA 2VUDA 4ISQA 1NCQB 1MPXA 2XWJB 4UOJA 3VZMA 1LHUA 2XJTA 2JXAA 2YDEA 3IIAA 1ZRDA 1D4M1 3IWZA 3Q8EA 3VBSB 2O0OA 3R4SA 2PAMA 2WABA 1RHI3 2ZGMA 3LSEA 5FPXA 4Y1XA 4XBLA 4AVVA 3AYEA 1R64A 3ZFGB 2R063 4AR2A 1BEV3 3DECA 3SH5A 4NPRA 1R092 3BU7A 2CTVA 5E8AA 4PQ9A 2TUNA 3OG2A 3B94A 5FY7A 3A22A 4Z92B 3WNLA 4QQPA 3MDPA 3O12A 1JYNA 5LEKA 4B29A 1CAVB 2VOWA 5FZOB 2RDQA 1FV3A 2IXLA 5HBAA 1RXFA 3MW4A 4LBOA 2PQQA 2E31A 3R6SA 3V0AB 3OGGA 3FHQA 4YGCA 4EROA 4O9GA 2OQ7A 3PJYA 5IK7A 3ZYJB 2YY1A 3SC7X 5DZFA 1YYNA 1OFSA 3T2TA 5J48A 3N4MA 2HEYF 2ZGOA 1LB2A 5K0UA 3B01A 3MF6A 4N8MA 4YRDA 1V00A 3DF0A 5KHKA 2QTWB 2OS2A 4COWA 2ZHLA 2P6CA 1FMD3 5ABJB 4LBKA 5J09A 1O8SA 3CJXA 2G9GA 4AHZA 1NA1A 5LA0A 1RGSA 1RUJ1 3ZKUA 4ASLA 4XFGA 5FP8A 1VBB2 3TB0A 2RDSA 4GQ7A 1GKBA 4UAPA 4XZPA 4X6QB 4IETA 4K21A 1U5XA 2XQRA 3OF1A 1WCSA 2Y6KA 4I01A 5T5JA 2YGLA 3AXEA 5HCBA 1RVF1 2Q1FA 5F3GA 3AP6A 4RSUA 1LNSA 2Z69A 4YZ5A 1TMF1 2WBKA 4TWTA 2YU1A 1TZOA 3RJRA 4BQ1A 4L9BA 2TBVA 4RFRB 4BDVB 2Y8KA 3UNPA 4QMAA 1VMHA 3U14A 1WD4A 4YVWA 2HWE2 3ZXEA 2CHHA 5LRSA 3OUHA 2XH6A 3C8XA 3NAPA 2VQUA 5F7UA 4LE4A 5D1IA 1ULEA 2ARAA 4QB1A 2WYFA 1UN1A 4L2NA 4KQ7A 5JXGA 2ZACA 5FZ1A 1Z7S2 4XQ4A 1SLTA 2BW8A 1IKPA 1W6MB 4UFHA 3T3YA 4CVUA 1JOJA 4AE2A 3E6CC 4BK4A 1JYTA 2JICA 2XLGA 5HXMA 3POYA 3B9CA 2JDMA 3GDBA 4EN6B 4CDQC 5IVVA 1FNYA 3BOWA 1XB9A 1TEIA 4YG3A 1ASJ2 1UY3A 3PMSA 5C4WC 3BTZA 1FOD3 4YGEA 4I0AA 1WCQA 2A6XA 4NR1A 2ZXQA 1LR5A 1OF4A 1HB4A 1QJU1 4GWIA 4XEZA 3WDWA 4Q27A 4HMZA 2EXHA 1S0JA 3T1LA 3WQ1A 2CWMA 2OXBA 4LIUA 5FYYA 3O1PA 2QE3A 4Q29A 5DAWA 4AGVA 1V9U3 2NQYA 2QQWA 3OPZA 5FY5A 4EJRA 4YW6A 4E4ZA 1W0OA 4NJ4A 3D5OA 1SMVA 1URXA 2GAUA 5DAXA 4UYBA 2VZOA 3FL7A 4XFHA 1J84A 1APNA 1HB1A 3PVNA 4XMIA 3W58A 4BQ3A 1O3QA 1AXYA 4LKEA 2RM23 3VBRB 5I0TA 1PO22 1BK0A 1QQP2 2V73A 4LK6A 4HK8A 4E4DX 1GNZA 1G7YA 1QU0A 1W2OA 2VOVA 4CUAA 2VUAA 3ACFA 4YVSA 1N3PA 3HD8B 1MS8A 2JIGA 1MEC2 2Q5TA 4RGAA 3ZOIA 5FZ6A 1ZZBA 2ZMLA 4DXRA 3VBSA 1GU3A 3NQHA 4PIYA 3RG0A 3GZEA 2F17A 3HOBA 3J4UH 4HLTA 2Y64A 1QY4A 3L9JT 5DDJ3 3VHNA 2CAVA 1O7FA 3JBG3 3E5UA 2ZEWA 4UFIA 3LEGA 1ENSA 4XFFA 3B00A 5ACA3 3LCPA 3LPGA 2GNDA 1RUF2 1DU3D 1DGWX 2ARXA 2VO5A 4X6RB 4P9LA 5CU1A 1G9BA 1OUXA 2ZJCA 4UWDA 2E7AA 5FLIA 5IVBA 2R073 1SCSA 2ZGUA 2RDNA 4JQTA 1B35B 3VKOA 4G3YC 3K77A 2DU1A 3TNPB 3KV5A 1BBT1 1UU4A 3K4ZA 2C26A 1RMU3 1W8TA 3ZSMA 2W1SA 4HPKB 4D7TA 2D44A 1GOHA 1F15A 1AF9A 2E63A 3VBHA 2WRAA 1PX4A 5A6QA 1YIPA 2IFRA 3H7JA 4N7IA 4YVSB 2VC9A 2W94A 5FXVA 4ZHNA 5LB6A 1TQ5A 3ZN5A 1O4TA 3B93A 1OA4A 1GFF2 1RXGA 4IERA 5I8YA 2WZPP 5FXWA 1UOFA 3L2YA 2FD8A 5JOWA 2A3WA 4BZ4A 1RINA 5DAQA 2BZDA 4LT5A 1JUHA 2VMCA 3UETA 4AEDB 5L7OC 2Y6LA 1W8OA 2VL4A 2V5DA 3H1MA 4NIAA 1SPPA 5A3WA 3WW3A 3K48A 1AL23 1BZWA 5FZAA 2MEV3 5CEHA 3H1WA 3VLBB 1IZ3A 4QX1A 4URTA 2XR4A 5CBLA 3I2OA 1J59A 3DYPA 4Q4X2 5I91A 4NHLA 2GSYA 1UX6A 2B5HA 2P3YA 1AR91 1FYUA 3GBGA 3R4UA 2CGPA 3I3EA 5BYNA 2X5IB 3SCGA 1PVC1 1LODA 1XNAA 2DV9A 2O8OA 2DVFA 5H9SA 4Q4Y2 4PI0A 2BOJA 2HWE3 1C3HA 4Q4W2 1S0BA 2JG8C 4GALA 4ZONA 4CCKA 1PMIA 1AZDA 2D6KA 3D6EA 5F6LB 4AL9A 3F2ZA 5LBEA 4IXLA 4DY5A 2ARBA 4BMBA 1VR3A 3D0JA 3NW4A 5LCWL 4A3XA 2VULA 2RR12 5JR7B 5K0UC 5FKBA 3WNPA 4K7JA 4WVZA 3VZJA 1J3QA 1VBC1 2ZGRA 2OVUA 4OULA 2RS52 4XF1A 1SDWA 2ERFA 4IEVA 5FZLA 4LLFA 3VZNA 5ACA2 1MVEA 2PHFA 1H8TB 1QJY2 1AX0A 3VKLA 2W92A 4IV1B 4BIOA 5A3PA 5JZGA 2JG9B 2VBDA 3GZTB 1ASJ3 4CDXA 1QH6A 1EUTA 1UX7A 3KF3A 3TEYA 3BODA 4EWAA 3RPQA 2Y6HA 3LA3A 4RHV3 5DN2A 3HR9A 5DQ0A 4A3ZA 3O1TA 3IB3A 4BQWA 4A42A 3UGHA 4DUXA 1DYOA 3TN93 2ZHKA 3WW4A 4XW3A 2W52A 5K8SA 4AVBA 3M3EA 1R1A1 1UY4A 1D4M2 5GJ6A 3OEBA 5DUVA 4CP0A 2VCCA 5IFPA 4FBFA 1NCRC 3E5XA 2JG8B 2VOXA 4NO4A 2WDBA 2RS32 5CVRA 5BPXA 3V0BB 4YLZA 1VBA2 5J1XA 1XNBA 1RITA 3FUQA 3ZDVA 4AFMA 1W6OA 3RQ0A 5A6XA 4OUSA 1ZM1A 2GU9A 3KS7A 3NKTA 4HSLA 4OZXA 4XILA 5IHRA 5HCHA 1LOBA 2VD7A 1XYPA 2XB6C 1A3KA 1Z7S3 3I59B 2Q8DA 1N47A 3H8RA 2QQLA 2D40A 2E32A 3MFCA 2C6SA 1FPN2 4I30A 2D97A 4XCAA 1RB8G 3K3OA 4LBQB 4GIQA 4XF9A 3FC0A 4Y4RA 1RUNA 1T6GC 4BXFA 2VJXA 1PIV1 1REEA 4ZU4A 3U75A 3Q8FA 2QCSB 4AFCA 2PLV1 5EPAA 1K5MB 1WLWA 1DHKB 5GLZA 2TEPA 3ZXJA 4QXHA 2OZJA 3LDKA 2WO1A 4OI0A 3TOJA 4UW6A 2VM9A 4AWDA 3IPVB 1RUF3 3J8F1 5IAVA 4LHKA 1W2NA 1WA6X 4B1LA 3RZLA 2WWUA 4KG0A 4MLOA 4YPJA 1M4WA 2AR6A 2PHLA 3AYDA 4IUGA 1J58A 1LOEA 2IXHA 2RR13 1RTVA 5IUQA 2AREA 2EAAA 3ZXLA 3VKMA 5IFTA 1VBE2 1HJFA 4QKFA 1ALYA 1TG7A 3VBHB 2WS93 3BIWE 3BUCA 2XBO1 4M3CF 4GWNA 2IC1A 4Q4V2 2WT2A 3NNJA 4CUBA 3KGLA 3DEMA 4XYXA 1NCRB 4Y3OA 2V09A 4IV1A 1ZRIA 2VZSA 4E27A 2D6PA 3OCPA 3PIGA 1F2NA 2G9FA 3GBWA 2JB8A 4Y1ZA 2DVGA 2RV9A 1W2TA 2Y33A 3PMEA 2VXJA 3OGVA 4LBLA 3HAGA 3RWKX 2EVXA 4LE3A 5FPBA 4OHYA 2QZ3A 5FMBA 2XJVA 5KXCA 4DY3A 2O14A 1KEXA 5FZ3A 1RUD1 2MEV2 1C8M1 1W04A 5JUVA 1SFNA 3N7KA 1X9PA 3SH3A 4JGZA 3ZXGA 3MIHA 1JOPA 1O4YA 4M3CE 3SNMA 2HWD3 2ZX0A 3ITQA 4LKSA 4UXAA 1N1VA 1COV3 3LA2A 4V2WA 4XQDA 3FZ3A 2RHPA 1POQA 1NLSA 2X5IA 4COYA 2B39A 2DU0A 1N1SA 1HX6A 1OUSA 4A4AA 3ZFFA 4CXWA 3ZXKA 1Q5OA 2E6VA 4UI9L 3P1IA 1Y7BA 1W8NA 3OB8A 2YUEA 4LEJA 2UYAA 2XJRA 4YGBA 5AVPA 2AUYA 3QOPA 4MZUA 5JSOA 3I59A 1YFUA 1U5YA 1RUC2 4N7UA 3PURA 4QT6A 4R9AA 2WNUB 1H2NA 3H3LA 1YFXA 3B7MA 4MVTA 4XPVA 4RR3A 4IEUA 4DXTA 2PHRA 2W9XA 4QM8A 1X33A 4ZXKA 3VL9A 5CFDB 2R16A 1W06A 1NLQA 1JZ5A 4PDWC 5LA9A 3BYWA 3QACA 3WVJA 4JKMA 4FPYA 2NP0A 2BV4A 5FV3A 5KC6A 4QQOA 1P8JA 2XKOA 3NJVA 2V4VA 4J1WA 3HPNA 3C7GA 2X05A 1F31A 1LEMA 3ACHA 3WW2A 5T3NA 5I0SA 5A7PA 3HN3A 3UV9A 1AXKA 3AB0A 1BJQA 3VZKA 1EV12 4NPMA 1SQ4A 2UURA 3I49A 1CPMA 2BJSA 1KGYA 3ETPA 4NHKA 1CAXA 4W65A 1WUVA 4Y4YA 3WQ0A 3KQ4B 4RHV2 1K5JA 3OPWA 5EZWA 4I3GA 3WHTA 5JLVA 2XJQA 2A6YA 4LBQD 4YFZA 3FE5A 5JSPA 4WV8A 1L3JA 1RUE3 2Y34A 1WLTA 2WFF3 1LKNA 2RJKA 3ABZA 4LQRA 4QX5A 4L92A 4IEYA 4LR4A 3KVAA 5CZKA 4P9IA 4N9HA 5FMDA 4QXCA 3DCQA 4FPGA 4KG8A 2HYKA 2ZX2A 3EJKA 3LKJA 2IXCA 4QGMA 4AHWA 4RQPB 2Q1MA 4Q4Y3 4F7ZA 5FO8B 1VAMA 4P9GA 5IVEA 4QM9A 3I2JA 4PJYA 5A32B 2CV6A 4LK7A 3THTA 3EYPA 3GM8A 2DFBA 2VNVA 3LOIA 2BFUS 3VDDA 5AFEA 1UXXX 2DUPA 1AX1A 3OTFA 4OZOA 1UIJA 3QCWA 4F83A 1H2LA 2TNFA 5AC93 4RS5C 2ZX3A 5J98B 4F3JA 1V6NA 2EXJA 3PNAA 2RS53 4CP9B 1ZA7A 3H9AA 2QQJA 5IVCA 2QBXA 4C90A 3VDDC 4AGRA 3SKVA 1H2KA 1NQJA 1WCUA 4CCJA 1HKDA 4I2OA 3VBRC 4YW5A 4GWMA 4IESA 2ZAAA 4JRAA 2P3KA 1OQEA 2JE8A 3OJBA 3WUCA 1VRBA 3AMMA 2PLV2 4YNIA 2RJLA 2PFWA 1UL9A 2WNUA 4QQLA 1JOBA 2VW2A 4Y5Z0 4TLFA 4XJWA 3UGGA 4B4QA 2YBKA 2ZABA 2W5FA 3CL1A 5B4NA 2DFCA 5FP9A 3H1YA 4JHTA 1KDMA 4XIKA 3SCHA 1JZ7A 3NRUA 3NAPB 4XCBA 2P5BA 1OBNA 1O8PA 3SLIA 1AYN3 2FDFA 3ZYFA 3I8TA 3AKQA 1GZWB 3ZSKA 1MS4A 1X50A 1YHFA 5FZEA 3N3HA 3ZPOA 3UGFA 1W90A 5FMOL 4P00B 3PUSA 3T0BA 1HXS1 1F5FA 2Q30A 3AYCA 4IGOA 4OHWA 2ZGLA 1VBB3 4HPKA 1GOFA 1PVC2 1N1TA 5JZGC 2A6WA 4HG6B 2ADEA 5FBJA 5KHGA 1OLME 1ND3A 3BU0A 1HV0A 3KV9A 5FZHA 2HWB2 2RMU3 4MXWB 1JUIA 4WM7A 4CRQA 3DKQA 2YC4A 3VBSC 4GD4A 2AGSA 4CEWA 1QH7A 4BLJA 4WVMB 1H6XA 2QDRA 5CG9A 1NZCA 3OYWB 1KS5A 4QKBA 4A2UA 3LFIA 4YVSC 1RHI2 4RA0A 4DZGA 1ENQA 1QJFA 3DXUA 4FAGA 2ZGSA 2GDFA 1ZREA 2H0VA 3HN1A 5EWSA 1RUD2 2PTMA 1R1ZA 3MICA 1GZ9A 3VBOA 2J1EA 4YM2A 1UMIA 1QJY1 3DYOA 1BQPA 2QQUA 1JYCA 3N9OA 5L9BA 1WBLA 1XXNA 2JDNA 4IE0A 4R9BA 1PO21 4QX2A 5GLVA 4CDUC 1AR73 3E6DA 4DRVA 4K1ZA 1GWLA 1RUC3 1VRH1 3PIJA 4GMP1 5FZ4A 2LW8A 1UPIA 3V0AA 5F2WA 3UT0A 1W6QA 4KBZA 1JN2P 3VBUB 4MYEA 4KWUA 3CQOA 4P5YA 1KFUL 5K4LA 3NVCA 5IWFA 4MOAA 5JVVA 1ST8A 1DBNA 4AOCA 1PHMA 4NN0A 1Q8VA 3AZZA 2W46A 3D3AA 4FVVA 4Z07A 5ABJA 4YW7A 4MUVA 5BNNA 5LW9A 4B4RA 1WLCA 1QJX1 3I2KA 5FZIA 3ES4A 2ID4A 2ZPXA 4Q0PA 1MQTC 1ULGA 4IV1C 2PA7A 3ST7A 2XHKA 1UD1A 2CDPA 2VMIA 2IXIA 3HJRA 2WNOA 3MW2A 3ZKYA 3N7LA 3RZHA 1I3HA 3HQUA 4AW7A 5JI9A 1HQWA 3HVDA 4A7YA 5ISLA 4IQPA 4JTOA 1ZRRA 3P3NA 3T09A 3WDXA 5EIYB 3VBHC 2OUHA 1V9U2 1BBT2 2XMLA 1UWWA 5A7QA 1REDA 4CCNA 2BTVC 3BN6A 3I54A 5FOBB 1AR82 5FRAA 4XUNA 3V65A 5HXVA 3ZN6B 2XJSA 3ZYGA 3AJYA 3KD4A 4FQ4A 4EWDA 5JPMB 1W9FA 5F5AA 1R091 2D3SA 4MHUA 4QDQA 3MO4A 4CDWC 3BTAA 3J9SA 4LO4B 3VHPA 2AACA 2I45A 2Q4SA 4CCDA 5A3MA 3O1UA 4QHOA 1PVC3 1G9FA 2EIDA 3M8LA 3N9QA 3VDCA 1LU2A 5F39A 5SV5A 4AHXA 4CXXA 2H6BA 4LO7A 5ANQA 3B02A 3SEEA 1ZBE3 2F4PA 5FPVA 1HRV1 3THDA 3VB9A 4AI8A 2BFUL 2LRPA 3KF5A 4QB6A 1DZRA 2WFPA 3VV1A 3WINE 5HCFA 2R0HA 2Y6JA 1CAWB 4HVQA 2JE7A 4QGLA 4XF3A 5FP4A 4H3WA 3NNFA 5F3EA 3P3PA 1BYHA 2FMYA 3TWIA 1KJLA 4IE4A 3H8XA 2HLEA 3QH6A 5FYHA 1R082 2A70A 2FDJA 3SHRA 2ZEYA 1KS4A 1B35C 2WO3A 4AEDA 4GMP3 1GWKA 1RUG3 1M06G 2E33A 4N43B 1C4RA 5C4WB 4RS5B 3HNMA 4XMAA 3H50A 1G9AA 2RM21 1I9RA 4K20A 1H0BA 5IATA 1EV13 3ZFFC 3NJZA 1SBEA 3FJSA 2XBO3 3GZAA 4Q4W1 2R042 3C2UA 4PHZA 1C1FA 2DF7A 3KCCA 5FLJA 2GN3A 1Q56A 4CEYB 2ZGTA 5T50A 1RJ7A 5IK4A 3P5BA 5A7NA 3UL2A 2VZVA 5JI7A 1KITA 3QH7A 3LB9A 3PL0A 3LSDA 4BOWA 2VMFA 3I3BA 1A6CA 5CFCA 4AQTA 5FK7A 1RUI3 1OKQA 2VZUA 4QQ2A 1OLRA 1SPPB 2D5FA 3WG1A 3RRDA 1KDKA 5JR2A 1MVQA 3AL5A 5HPOA 4P5HA 1UZWA 1ZYBA 4LA2A 5CAZA 1QQP3 4AVAA 1PZ8A 2X09A 3T4HB 2CY6A 2ARCA 3ZFFB 2ATFA 4E2SA 4GWJA 3V64A 1UW8A 1O6UA 2HEWF 4CDUB 2PN5A 3RGBA 5IJRA 2YU2A 2ZCWA 5D8AC 4AHYA 1JHNA 4HT1T 1YIFA 2VOTA 3VDAA 2YHJA 3T2PA 5L9VA 1JZ2A 4R4ZA 1U0AA 3B9IA 4S2DA 1NAEA 1QXPA 2QQVA 4NRQA 4LBMA 1KJRA 2WZ8A 2HWF3 3DGTA 2DVAA 1PNGA 5FTTC 4AFAA 2Y6FA 4AVTA 1JXNA 4JGYB 1O4ZA 1XSRA 4OI4A 3CZJA 4CU6A 3M70A 4FPFA 1ZBA1 3FUOA 1ZBE2 5JIAA 4FQZA 3USSA 3WNMA 2QQMA 4BHPA 1AHSA 1UU5A 4JCKA 4M01A 2BPA2 1W6NA 4GZ9A 3NNGA 3IMMA 1NQDA 3KT1A 2GMMA 1Y9MA 2GC3A 3ACLA 3ZFEB 4JDOA 2XWBB 2VY0A 3KGZA 3BB6A 1OXCA 3WG4A 1F4AA 4DUWA 2DTWA 3MV11 4QQHA 2J1AA 2H0BA 2FCUA 5H9RA 1R083 4LKDA 4BB3A 3VN4A 3I2DA 2Y0OA 3WNKA 2VVDA 1C5IA 3MIFA 2DWRA 5FWEA 3AZWA 3NV4A 4BM8A 1HB2A 2VZQA 5GZFA 4H7LA 1XPWA 2J1RA 2JD9A 2OX0A 2WL1A 5GZDA 2QVSB 2A1XA 3C3VA 3OSDA 4ZXEA 1ENXA 5H9PA 3JQXA 2YXSA 4TTGA 3ZO0B 2E9QA 5HCAA 2W2IA 5EXOA 1MS0A 2HEVF 4FPHA 4NWVA 3V0BA 3W20A 3VDDB 5JWPA 2ZOEB 1ND2C 1RUI1 3OY8A 2DCTA 1UY1A 4GMP0 1W6QB 1OURA 5DUWA 1HRI3 5G05L 5I8SA 1RUH3 1G9DA 1UOBA 1YQ8A 4WM7C 4DUVA 1BMV2 1W9YA 4MSVA 2D6OX 3J7NA 4NUBA 4XJ9A 3VKFC 2DBNA 4EWEA 2ZGNA 1WMDA 4GJYA 4CSWA 4LOTA 2A7AA 4Z2AA 4FO9A 1FI2A 5IYYA 2GZWA 4FT8A 5JXJA 2ZKNA 4M3CA 3A23A 3IDBB 2BNOA 1HN1A 1UO9A 4E2GA 1NXMA 2ZGPA 1CX4A 1NOVA 2I07B 2B45X 3KLSA 1SBFA 3K51A 1HW5A 5A1FA 4N90A 2XHNA 3NMBA 1VBD3 4O7XA 4AZZA 2ZAHA 2UU8A 4XUOA 3TEXA 1R1A3 1FOD1 1TMF2 3NSTA 4Q26A 4OQ9A 5J36A 3W5MA 4W4ZA 1X9TA 2HBTA 3H8UA 2A5ZA 1PGL2 2BBVA 5C3SA 3AC0A 3WY6A 4URAA 2R062 4LIVA 2BERA 4CP9A 5LBFA 3UJQA 1DFQA 4I02A 2NN8A 2EALA 3IKWA 1W6MA 1MS9A 2GNBA 4BQ5A 3VD9A 4IE5A 4CDXB 1Y43B 5J96B 1GQGA 2PHTA 3ZYBA 3WF3A 4HETA 1TME3 3M7AA 1Z7S1 1EPWA 2VW0A 1CIYA 2GC1A 4K40A 4B4PA 4YG6A 4CUCA 1PK6A 3H8OA 3I3MA 1ULFA 4GJZA 4Y20A 3MPBA 4FP2A 5LRRA 4FAHA 1STMA 1IS5A 1QOOA 4NWWA 4CEWB 4M3CB 4CA9A 2FDGA 5H9QA 1BCXA 2W95A 4WVMA 1S0EA 3U78A 4LTAA 2WZR3 4ZZ8A 4LMFA 1UY2A 1YUDA 3BOPA 5C3QA 2VZ1A 3J7MA 5T54A 1H8TA 5JCTA 1DQ1A 4J25A 2MPFA 5C70A 4PCRA 2C9AA 1I5PA 4Q4Y1 4V2VA 3OY8B 4IEPA 4KH9A 1CESA 2CNAA 2JDAA 3ZXAC 4CDWA 2K2SA 2JX9A 4OI2A 1XE8A 5DDJ1 4OI1A 3BKZA 2PHXA 1UZZA 4R4XA 1J3PA 1C8NA 4K3UA 1SLIA 4DXZA 1D2QA 2OPKA 4LBQA 3LGRA 1ZBA2 4XUTA 5FYMA 4FOYA 4GH4B 4XBQA 5FYUA 1H8VA 1GP5A 1VPHA 1G6NA 1NA1B 2VMHA 3ZXDA 1MS1A 4J6GA 1H9WA 1PM7A 4AF9A 1W2UA 1SZBA 1LOCA 3E1F1 5FR3A 3U0ZA 2Y6GA 2VECA 3MI8A 3MLLA 4MXWA 4EN8B 3POIA 3KZ4C 1MACA 2W87A 4JAAA 4O61A 4TXWA 2HWF2 2MNGA 3GZUC 3HIFA 2WT0A 3MEPA 3WCRA 5FYZA 3OPTA 4Y24A 4LBNA 2VMDA 2BVVA 3D8CA 4COZA 5CFCC 3OD0A 4LO5B 5DG1A 3D0SA 4E8CA 1CAUA 1H6YA 2VVFA 4BQ4A 2VOKA 4PDWA 3KB5A 1LRHA 4DEVA 2HYXA 5FKCA 1O3TA 5FPUA 1PK6C 3U37A 5FO9B 1LOGA 1I1EA 3A4UA 2P3JA 2QQIA 2VTXA 2HWD1 5C71A 1K42A 3POFA 3NWKA 1OD5A 2RS31 4KI5M 1JU3A 2JKBA 2BVBA 4PIXA 3N9LA 3ZYPA 2G19A 2J1SA 1ULOA 1NA1C 1V6JA 1VBA1 3SMHA 3WHUA 1UOGA 3CU7A 3M3QA 3UKVA 1ONAA 4Q0QA 3FLRA 5FY4A 3VHRA 3CKHA 4FOQA 4HKLA 1DLLA 1ZVFA 3WF4A 4EZ4A 2UWCA 1XU1A 5K0UB 1D0HA 4CYDA 5FP7A 1B35A 3LQCA 3LEKA 3VZOA 4D7SA 4MGKE 4DB5A 4FCAA 5DAVA 2QZ2A 5J3UA 2NPIA 2WSUA 3RYPA 3SH4A 1PIV2 4P02B 2HWE1 2RDRA 3K2OA 3MIEA 2JD4A 2QJVA 3RMXA 4NAMA 2XOMA 4QPYA 4YZ3A 4ASKA 1Y9GA 2VTFA 5DUUA 1E5RA 1NG0A 4BCUA 4BQYA 5GZGA 5CG8A 1COV2 5I0DA 3EB7A 1Q3EA 1EP0A 2OYZA 3ILFA 3J8F2 1LECA 1IHMA 1S2KA 3PJQA 5D21A 3WZ1A 3O1RA 2RM22 1IGOA 1BMV1 2ZZJA 5B4XA 2PHUA 3AVSA 3PU8A 2V5YA 4QKDA 3GNEA 3R05A 1ZA4A 2WNEA 3SKJE 4CDQA 1Z78A 3S30A 1FV2A 4RFT0 3TRSB 4PBOA 5FYBA 5AC92 1U5ZA 2FHRA 1RVF3 2W1UA 1OD3A 5FUIA 3ROUA 1C1LA 3RDIA 5KWRA 3U4SA 4LHLA 3HBKA 5LA2A 1AR92 4C0BA 4E8DA 5A32A 2R1DA 3POSA 4AI1A 1J1LA 3RMYA 4CU7A 1XC6A 2JE9A 3WNNA 2FZ2A 4OFGA 1QJU2 3O5SA 1EPZA 1DGRA 1MQTA 1PO12 3K46A 4JZRA 2CAUA 3I2GA 4YVWC 2YB7A 4D6SA 4HSJA 3ON7A 2ZKLA 5C7GA 2AZ5A 2K9ZA 1H8TC 2PAKA 4KWLA 1X8EA 3LDRA 4GULA 1BEV1 4LLOA 5T5LA 2C5DA 2DBIA 2YPJA 4UW4A 1W9WA 3AKRA 1UAIA 3FBYA 2AENA 2MEV1 5FJHA 2XPJA 2Y38A 5T55A 4LHSA 4NPLA 4FPLA 1A78A 1W0NA 4YGDA 1V6LA 2VE1A 2DUQA 2VZ3A 4XUPA 4X8NA 1LCLA 2ZS6B 3ZDSA 4IEQA 2VQAA 4MGYE 3AYAA 3RJ2X 2E7TA 2J1VA 4ASMB 4LPLA 3O1VA 3UESA 2JKXA 4E4SA 1JODA 4QPWA 1YQ6A 3T0DA 3KHBA 1WD3A 1NY71 4Q5OA 1DYKA 5BXXA 4DOUA 4MGIE 3ATGA 4B7EA 4XDPA 5KHHA 4Q8LA 2XJPA 1W8ZA 4GB31 1W0PA 4PF1A 3C7EA 2HJIA 1ZBE1 2QQOA 1POV0 4QAWA 1HQLA 1UZVA 5GALA 1W2AX 2R0FA 3JUUA 3LA7A 2QKDA 1LOFA 2MHFA 1YJKA 3J7LA 5A33A 4QXBA 4AFDA 4ET7A 3C7FA 1F8VA 1V9U1 5BNNB 3IDAA 1WW6A 3HMYA 5HV4A 3AMHA 3MFAA 3F95A 3IZOA 1AR81 3HQXA 1ZNPA 4FFFA 4KGGA 5BNOB 2BRTA 1DGLA 4P9JA 4YFWA 4RGKA 1V6OA 1GP6A 3VUOA 1F5JA 5DUXA 4CCLA 4CCMA 2GH2A 4IV3C 2NLRA 3GCXA 1L7LA 1CAVA 2FDKA 2XXZA 1AX2A 1EV11 2ZHNA 4HONA 4BLIA 4C1WA 4XJ8A 4CDWB 5LK7B 1CGPA 5CIRA 4YM1A 4Q4W3 4AI2A 2R1BA 2XDVA 2XL7A 1CAUB 2LM3A 3ZFGC 1FPN1 4RHV1 1GUIA 1D2SA 2RMU1 3T0AA 3WP6A 2FBEA 3NV2A 5DAPA 4EZHA 4MX3A 3DPRA 2ET1A 3TBDA 3QBQA 1IS6A 2JWPA 3ASIA 5CISA 1US3A 4D69A 4DQAA 3OBRA 1UKRA 1ND2A 2D5HA 1AYN2 3W59A 1IOAA 2OQ6A 5T5OA 4W8JA 1GR3A 4OUMA 4QHBA 2WLPA 2D6NA 1W6PA 2VBPA 2VW1A 3QLQA 5JXIA 1IG0A 2XUMA 4XTMA 4LO8A 3ME2A 3CLPA 2ZBJA 3AKPA 5FYTA 1Z0HA 3VGIA 3MV01 1NKGA 3AFKA 2GP3A 2YZ4A 4MXVA 3ZSJA 3CDZB 1SLLA 5FZOA 1IPKA 1YEWA 2VPVA 3N7JA 4OUEA 5TSWA 4JGZC 4BH9A 1KQRA 4H7MA 2JG9C 3ZIWA 4IEOA 3OBZA 2HWB3 3KCYA 4AI9A 2IVIB 3A7QA 4O65A 1QIQA 1XE0A 3P6BA 2ZTNA 4RS5A 3WXPA 5FLHA 3O0VA 4BE3A 4XUQA 3RZJA 3MUY1 1Q43A 2VNOA 2WO2A 2ZX1A 4BISA 4D6RA 5FZ7A 5FXZA 1VAVA 1F35A 4NROA 2JDYA 1VBD1 1QJX3 2Z5WA 2RS12 4RQPC 4KMQA 5KC5A 4UT5A 2QQNA 4RL7A 2R6QA 3GHNA 3NO8A 4GKYA 1CAWA 4LUKA 4Q1PA 4CUGA 5A33B 4AQ2A 2HH9A 1DZTA 3CJIC 3ZXFA 4CCEA 4AVCA 1BVP1 3OEAA 2WQ4A 1WW5A 2EICA 5KR7A 2A3XA 4P9WA 4OHZA 4A41A 4AVSA 3U11A 1WA4A 4M4PA 1WZXA 5D8AA 3T30A 3VBUC 3WQ7A 1US2A 4N43C 3VBUA 5BY5A 3WCSA 1C28A 1HLCA 2D7FA 2SBAA 1ENRA 3DUIA 3FBMA 3I2IA 1ZZCA 4WM8A 2VQ0A 5FYCA 5LK5A 1BEV2 5T52A 1W6OB 4L97A 3T08A 3WNXA 5K9YA 3NL1A 2QQPA 1O3SA 4LULA 1RUG2 2P34A 5F1RA 5JOYA 1DLCA 1O5LA 3KVBA 3WF0A 4QGNA 2DDUA 5LATA 5IT6A 1O3RA 4KU8A 1LJ7A 2BYVE 2ZZQA 3TNQA 4CEYC 5IVJA 3AP7A 4KBBA 3GJBA 4C1XA 4H2AA 2WZR1 4JHZA 1BXHA 3JBG1 2ZHMA 1E5HA 2HBUA 5ACA1 2OIIA 2XJUA 4FPKA 5ERLA 1CX1A 5FK8A 2BDRA 1OT5A 2Y26A 2W1WA 2WA4A 2JG9A 1NUKA 5DPNA 2R071 4Y33A 1G9CA 4ZKTB 4BPZA 4X8PA 4FXGB 4I0WB 3RFRA 5C9AC 2E7QA 4MGZE 5EQUA 4D6QA 1EYBA 4DNYA 2DVBA 1SDDB 4K9SA 1UYPA 2I2SA 2FQPA 5GKAC 3ELNA 4QPIB 1H1AA 4MO3M 2GNMA 1QMJA 3KHCA 1X82A 3IBMA 2P17A 4XAEA 3AMPA 5C3OA 3U4XA 1NY72 3I7DA 4Y26A 2E26A 2KA3A 1CAXB 4FFIA 4Y5SA 3UKNA 5I0RA 1WMFA 3TN91 4CPBA 3S57A 2VAUA 1V6IA 2WYSA 2ZMNA 3WOGA 2VZRA 5FZ0A 1EUUA 4ATFA 2UWBA 1W28A 1QJU3 2NM1A 2P37A 3UYJA 4ATEA 4DXSA 2GH8A 1AL21 1OOPC 1SLAA 3NJXA 4DPNA 3JD71 2DCJA 1OLQA 1TVGA 1ZZ6A 4IEZA 4XACA 3CHXA 4NIHA 3TEZA 3LAGA 3WEZA 3MIBA 3S6PA 5A6YA 3HWJA 4RYDA 2WQ8A 1AYN1 4YW2A 3M1HA 5FUNA 4ITCA 1LTEA 4AK3A 1DG6A 4G4FA 4DMIA 4B7KA 4HL0A 3GF6A 1DQ2A 1NZIA 2BGOA 1RUE1 5IVYA 3SISA 3G6JB 1NX9A 4RD7A 1UMZA 4MHRA 5LY2A 5I93A 5C9AB 4HFSA 2P1BA 4FTEA 4HKWA 3OOXA 2P4EA 2CGOA 1S55A 3GBFA 3SITA 4EN7B 4PLMA 1YXWA 5KHJA 2O8QA 3PDQA
chains in the Genus database with same CATH topology
4QX0A 2ZEZA 3VD4A 4OMCA 3IIIA 3W5NA 1PX3A 3CZJA 4CU6A 2VR4A 2BZDA 2QQMA 2VMCA 3LE0A 3UETA 4GZ9A 2Y6LA 1W8OA 2VL4A 3NNGA 2V5DA 4JKLA 3MUZ1 2XQXA 2DCKA 1UZ0A 2W47A 1F4AA 4QX1A 4DUWA 3MV11 3DYPA 2J1AA 2YC2A 2PQSA 2W1QA 3WNKA 3I3EA 1W99A 2LS6A 2VZQA 4W50A 1XPWA 2J1RA 2JD9A 1XNAA 1JYXA 4ZXEA 3C7HA 3I2HA 3LEIA 1K3IA 4BK5A 3F2ZA 4QB2A 5DMYA 1F4HA 5LCWL 3SEPA 1UY1A 3WF2A 1CZSA 3VD7A 5G04L 3WNPA 4MGQA 5G05L 1XNTA 5EJZB 4A44A 1JZ8A 5LA1A 1DP0A 3HNBM 4DUVA 3WSOA 1JZ6A 1K45A 1O59A 1UXZA 2W92A 3JXSA 4Z2AA 1OH4A 5IYYA 5JXJA 3A23A 1EUTA 1UX7A 1HN1A 2J7MA 2Y6HA 5DN2A 5DQ0A 2BGPA 4A3ZA 2XHNA 3IB3A 4A42A 3WQBA 4DUXA 1DYOA 4XUOA 1UY4A 4ZZ5A 3W5MA 4W4ZA 3OEBA 2VCCA 5IFPA 3AC0A 2B4KA 2BERA 2WDBA 3GGLA 5J1XA 1JU4A 1UY0A 3VD9A 3IAQA 2Z4FA 5IHRA 3K4DA 4A6OA 3WF3A 1GQPA 2VCAA 2R7EB 1CIYA 2QQLA 2E32A 1GMMA 4CUCA 3A21A 2ZEXA 1PMHX 3ACGA 3K75B 2W95A 2VJXA 4D8MA 4ZZ8A 1GOGA 1UY2A 1J83A 2VZ1A 5C70A 2WO1A 3VDBA 3HNYM 2EIEA 1I5PA 2VM9A 3THCA 2JDAA 3CZUA 3T2QA 4YPJA 4PT6A 4AAXA 1CZTA 4IUGA 1UYZA 2YFUA 5IFTA 2L9LA 3GXUA 4QX3A 4XUTA 4XVHA 1TG7A 3VD3A 4CUBA 4DEQA 3E1F1 4MGSA 2VMEA 2Y6GA 2VZSA 3PUIA 4QDSA 4TXWA 2W87A 2CDOA 2RV9A 2VMDA 3OGVA 4E8CA 1H6YA 5EJ1B 1KEXA 3WNMA 3OBAA 4ARYA 4DEVA 2HYXA 5JUVA 2VCBA 2YG0A 1PMJX 3FHAA 3U37A 2VZTA 2QQIA 2ORZA 5C71A 1K42A 4LKSA 3HEIA 4KI5M 1JU3A 4A45A 2J1SA 1ULOA 2ORXA 4A4AA 1SG3A 4UI9L 3WF4A 3CKHA 3P1IA 1W8NA 3OB8A 4PQQA 3LQCA 1UYXA 2WAAA 2W91A 3LEKA 2C9KA 4DXTA 2W9XA 4JKKA 4TTGA 1W9TA 1JZ5A 4P02B 4QDRA 2WZEA 1SHWB 4JKMA 2XOMA 3NJVA 1P8JA 2VTFA 1RYYA 2V4VA 2BBAA 1T2XA 3C7GA 3HPNA 2X05A 5I0DA 3ACHA 3EB7A 3HN3A 5B4XA 3SKJE 4L0PA 1BHGA 4CU9A 3OGSA 4CU8A 3ETPA 1KGYA 2W1UA 1OD3A 3DYMA 2YFZA 5FUIA 2RJ2A 2WN2A 4ARXA 1JZ3A 1IQDC 3ABZA 4XURA 4LQRA 5LA2A 4E8DA 3I2FA 1JI6A 5CZKA 3ZM8A 4CU7A 4D0QA 1XC6A 2V72A 3WNNA 2QQKA 4FI9A 3IAPA 3CIHA 1K12A 3K46A 2WAOA 3I2GA 3ECQA 2YB7A 3I2JA 3EYPA 3GM8A 5C7GA 1UXXX 1CZVA 4OZOA 1W9WA 3T2OA 4AG4A 3LPFA 3BGAA 4LHSA 3CMGA 1W0NA 3PUHA 1GNYA 2QQJA 2VZ3A 2QBXA 4XUPA 4BJ0A 4OYUA 4OMDA 3ACIA 3SKVA 2J1VA 4LPLA 3UESA 2JKXA 2KD7A 4QPWA 3T0DA 1JHJA 2XONA 2JE8A 3I97A 4PF1A 3C7EA 4M4RA 2VZPA 2QQOA 4QAWA 2VQTA 1MPXA 4UOJA 2W5FA 2OKXA 5B4NA 4ET7A 3C7FA 1W9SA 2WABA 3IDAA 3NRUA 1JZ7A 1O8PA 1R64A 5JXHA 3DECA 3WNOA 4P00B 4ZY9A 3T0BA 3WF1A 3OG2A 3A22A 1GOFA 3WNLA 1JYNA 4HG6B 5CYYA 2E31A 1L7RA 2C4XA 3MBWA 1GUIA 3FHQA 3T0AA 2YC4A 1US3A 1H6XA 1JYWA 4W8JA 1O8SA 2J1EA 5JXIA 3FN9A 1UMIA 5JMOA 3DYOA 5LA0A 3J7HA 4UAPA 3MV01 1NKGA 4QX2A 2J22A 3CDZB 2Y6KA 4OUEA 2LW8A 3A7QA 4KWUA 3CQOA 4P5YA 3P6BA 1LNSA 2WUHA 4MOAA 2X10A 2WBKA 4XUQA 3MUY1 2WO2A 2W46A 3D3AA 4BDVB 2Y8KA 3K4AA 3UNPA 3I2KA 4KMQA 2ID4A 2QQNA 5A1AA 3C8XA 2VQUA 2CDPA 3HJRA 5F7UA 3OEAA 2EICA 4QB1A 2J1UA 4A41A 5EIYB 5JXGA 3T09A 4M4PA 1US2A 1UWWA 4CVUA 3BN6A 3I2IA 4BK4A 5HXMA 3I3DA 4XUNA 3T08A 3GDBA 4P08A 4QDQA 1DLCA 3MO4A 1L7QA 3WF0A 1JYVA 2DDUA 2EIDA 1UY3A 3VDCA 1WCQA 3SEEA 3THDA 2ZXQA 4JHZA 1OF4A 4GWIA 4QB6A 2WN3A 1CX1A 1UMHA 2Y6JA 1OT5A 4RN5A 2W1WA 1NUKA 1WKYA 5DPNA 2HLEA 4XZUG 2ZEYA 2VZOA 2WO3A 1D7PM 3FL7A 2E33A 1J84A 1SDDB 3HNMA 1OF3A 4MO3M 4CUAA 3ACFA 1JZ4A 2E26A 2RVAA 4DXRA 2WYSA 1GU3A 2EIBA 3NQHA 2VZRA 3HOBA 3C7OA 1EUUA 2Y64A 2VZVA 2VMFA 2ZEWA 3I3BA 1YQ2A 4DXSA 3LEGA 3NJXA 4BXSV 3LPGA 2VZUA 2DCJA 1TVGA 2VO5A 1UYYA 3WEZA 2B9VA 5JR2A 4RYDA 2WQ8A 3VD5A 5HPOA 2X09A 4JX0A 3K77A 4MADA 4GWJA 3K4ZA 2C26A 2W1SA 1GOHA 2BGOA 3OGRA 1ULPA 5IJRA 1NX9A 1PX4A 2VOTA 3VDAA 2VC9A 3T2PA 1JZ2A 2W94A 1NAEA 2J1TA 2W3JA 2WZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QX0 A;  2ZEZ A;  3VD4 A;  4OMC A;  3III A;  3W5N A;  1PX3 A;  3CZJ A;  4CU6 A;  2VR4 A;  2BZD A;  2QQM A;  2VMC A;  3LE0 A;  3UET A;  4GZ9 A;  2Y6L A;  1W8O A;  2VL4 A;  3NNG A;  2V5D A;  4JKL A;  3MUZ 1;  2XQX A;  2DCK A;  1UZ0 A;  2W47 A;  1F4A A;  4QX1 A;  4DUW A;  3MV1 1;  3DYP A;  2J1A A;  2YC2 A;  2PQS A;  2W1Q A;  3WNK A;  3I3E A;  1W99 A;  2LS6 A;  2VZQ A;  4W50 A;  1XPW A;  2J1R A;  2JD9 A;  1XNA A;  1JYX A;  4ZXE A;  3C7H A;  3I2H A;  3LEI A;  1K3I A;  4BK5 A;  3F2Z A;  4QB2 A;  5DMY A;  1F4H A;  5LCW L;  3SEP A;  1UY1 A;  3WF2 A;  1CZS A;  3VD7 A;  5G04 L;  3WNP A;  4MGQ A;  5G05 L;  1XNT A;  5EJZ B;  4A44 A;  1JZ8 A;  5LA1 A;  1DP0 A;  3HNB M;  4DUV A;  3WSO A;  1JZ6 A;  1K45 A;  1O59 A;  1UXZ A;  2W92 A;  3JXS A;  4Z2A A;  1OH4 A;  5IYY A;  5JXJ A;  3A23 A;  1EUT A;  1UX7 A;  1HN1 A;  2J7M A;  2Y6H A;  5DN2 A;  5DQ0 A;  2BGP A;  4A3Z A;  2XHN A;  3IB3 A;  4A42 A;  3WQB A;  4DUX A;  1DYO A;  4XUO A;  1UY4 A;  4ZZ5 A;  3W5M A;  4W4Z A;  3OEB A;  2VCC A;  5IFP A;  3AC0 A;  2B4K A;  2BER A;  2WDB A;  3GGL A;  5J1X A;  1JU4 A;  1UY0 A;  3VD9 A;  3IAQ A;  2Z4F A;  5IHR A;  3K4D A;  4A6O A;  3WF3 A;  1GQP A;  2VCA A;  2R7E B;  1CIY A;  2QQL A;  2E32 A;  1GMM A;  4CUC A;  3A21 A;  2ZEX A;  1PMH X;  3ACG A;  3K75 B;  2W95 A;  2VJX A;  4D8M A;  4ZZ8 A;  1GOG A;  1UY2 A;  1J83 A;  2VZ1 A;  5C70 A;  2WO1 A;  3VDB A;  3HNY M;  2EIE A;  1I5P A;  2VM9 A;  3THC A;  2JDA A;  3CZU A;  3T2Q A;  4YPJ A;  4PT6 A;  4AAX A;  1CZT A;  4IUG A;  1UYZ A;  2YFU A;  5IFT A;  2L9L A;  3GXU A;  4QX3 A;  4XUT A;  4XVH A;  1TG7 A;  3VD3 A;  4CUB A;  4DEQ A;  3E1F 1;  4MGS A;  2VME A;  2Y6G A;  2VZS A;  3PUI A;  4QDS A;  4TXW A;  2W87 A;  2CDO A;  2RV9 A;  2VMD A;  3OGV A;  4E8C A;  1H6Y A;  5EJ1 B;  1KEX A;  3WNM A;  3OBA A;  4ARY A;  4DEV A;  2HYX A;  5JUV A;  2VCB A;  2YG0 A;  1PMJ X;  3FHA A;  3U37 A;  2VZT A;  2QQI A;  2ORZ A;  5C71 A;  1K42 A;  4LKS A;  3HEI A;  4KI5 M;  1JU3 A;  4A45 A;  2J1S A;  1ULO A;  2ORX A;  4A4A A;  1SG3 A;  4UI9 L;  3WF4 A;  3CKH A;  3P1I A;  1W8N A;  3OB8 A;  4PQQ A;  3LQC A;  1UYX A;  2WAA A;  2W91 A;  3LEK A;  2C9K A;  4DXT A;  2W9X A;  4JKK A;  4TTG A;  1W9T A;  1JZ5 A;  4P02 B;  4QDR A;  2WZE A;  1SHW B;  4JKM A;  2XOM A;  3NJV A;  1P8J A;  2VTF A;  1RYY A;  2V4V A;  2BBA A;  1T2X A;  3C7G A;  3HPN A;  2X05 A;  5I0D A;  3ACH A;  3EB7 A;  3HN3 A;  5B4X A;  3SKJ E;  4L0P A;  1BHG A;  4CU9 A;  3OGS A;  4CU8 A;  3ETP A;  1KGY A;  2W1U A;  1OD3 A;  3DYM A;  2YFZ A;  5FUI A;  2RJ2 A;  2WN2 A;  4ARX A;  1JZ3 A;  1IQD C;  3ABZ A;  4XUR A;  4LQR A;  5LA2 A;  4E8D A;  3I2F A;  1JI6 A;  5CZK A;  3ZM8 A;  4CU7 A;  4D0Q A;  1XC6 A;  2V72 A;  3WNN A;  2QQK A;  4FI9 A;  3IAP A;  3CIH A;  1K12 A;  3K46 A;  2WAO A;  3I2G A;  3ECQ A;  2YB7 A;  3I2J A;  3EYP A;  3GM8 A;  5C7G A;  1UXX X;  1CZV A;  4OZO A;  1W9W A;  3T2O A;  4AG4 A;  3LPF A;  3BGA A;  4LHS A;  3CMG A;  1W0N A;  3PUH A;  1GNY A;  2QQJ A;  2VZ3 A;  2QBX A;  4XUP A;  4BJ0 A;  4OYU A;  4OMD A;  3ACI A;  3SKV A;  2J1V A;  4LPL A;  3UES A;  2JKX A;  2KD7 A;  4QPW A;  3T0D A;  1JHJ A;  2XON A;  2JE8 A;  3I97 A;  4PF1 A;  3C7E A;  4M4R A;  2VZP A;  2QQO A;  4QAW A;  2VQT A;  1MPX A;  4UOJ A;  2W5F A;  2OKX A;  5B4N A;  4ET7 A;  3C7F A;  1W9S A;  2WAB A;  3IDA A;  3NRU A;  1JZ7 A;  1O8P A;  1R64 A;  5JXH A;  3DEC A;  3WNO A;  4P00 B;  4ZY9 A;  3T0B A;  3WF1 A;  3OG2 A;  3A22 A;  1GOF A;  3WNL A;  1JYN A;  4HG6 B;  5CYY A;  2E31 A;  1L7R A;  2C4X A;  3MBW A;  1GUI A;  3FHQ A;  3T0A A;  2YC4 A;  1US3 A;  1H6X A;  1JYW A;  4W8J A;  1O8S A;  2J1E A;  5JXI A;  3FN9 A;  1UMI A;  5JMO A;  3DYO A;  5LA0 A;  3J7H A;  4UAP A;  3MV0 1;  1NKG A;  4QX2 A;  2J22 A;  3CDZ B;  2Y6K A;  4OUE A;  2LW8 A;  3A7Q A;  4KWU A;  3CQO A;  4P5Y A;  3P6B A;  1LNS A;  2WUH A;  4MOA A;  2X10 A;  2WBK A;  4XUQ A;  3MUY 1;  2WO2 A;  2W46 A;  3D3A A;  4BDV B;  2Y8K A;  3K4A A;  3UNP A;  3I2K A;  4KMQ A;  2ID4 A;  2QQN A;  5A1A A;  3C8X A;  2VQU A;  2CDP A;  3HJR A;  5F7U A;  3OEA A;  2EIC A;  4QB1 A;  2J1U A;  4A41 A;  5EIY B;  5JXG A;  3T09 A;  4M4P A;  1US2 A;  1UWW A;  4CVU A;  3BN6 A;  3I2I A;  4BK4 A;  5HXM A;  3I3D A;  4XUN A;  3T08 A;  3GDB A;  4P08 A;  4QDQ A;  1DLC A;  3MO4 A;  1L7Q A;  3WF0 A;  1JYV A;  2DDU A;  2EID A;  1UY3 A;  3VDC A;  1WCQ A;  3SEE A;  3THD A;  2ZXQ A;  4JHZ A;  1OF4 A;  4GWI A;  4QB6 A;  2WN3 A;  1CX1 A;  1UMH A;  2Y6J A;  1OT5 A;  4RN5 A;  2W1W A;  1NUK A;  1WKY A;  5DPN A;  2HLE A;  4XZU G;  2ZEY A;  2VZO A;  2WO3 A;  1D7P M;  3FL7 A;  2E33 A;  1J84 A;  1SDD B;  3HNM A;  1OF3 A;  4MO3 M;  4CUA A;  3ACF A;  1JZ4 A;  2E26 A;  2RVA A;  4DXR A;  2WYS A;  1GU3 A;  2EIB A;  3NQH A;  2VZR A;  3HOB A;  3C7O A;  1EUU A;  2Y64 A;  2VZV A;  2VMF A;  2ZEW A;  3I3B A;  1YQ2 A;  4DXS A;  3LEG A;  3NJX A;  4BXS V;  3LPG A;  2VZU A;  2DCJ A;  1TVG A;  2VO5 A;  1UYY A;  3WEZ A;  2B9V A;  5JR2 A;  4RYD A;  2WQ8 A;  3VD5 A;  5HPO A;  2X09 A;  4JX0 A;  3K77 A;  4MAD A;  4GWJ A;  3K4Z A;  2C26 A;  2W1S A;  1GOH A;  2BGO A;  3OGR A;  1ULP A;  5IJR A;  1NX9 A;  1PX4 A;  2VOT A;  3VDA A;  2VC9 A;  3T2P A;  1JZ2 A;  2W94 A;  1NAE A;  2J1T A;  2W3J A;  2WZ8 A; 
#chains in the Genus database with same CATH topology
 2ZEZ A;  3VD4 A;  1IS3 A;  5C3R A;  1OA2 A;  2PHD A;  3VBR A;  5IVF A;  5LY1 A;  5KBF A;  5DZE A;  4EE2 A;  3AMQ A;  3LE0 A;  4GXL A;  2AYH A;  1LHW A;  3B5L B;  1NXD 1;  3ORJ A;  5D2A A;  5FQ0 A;  5AVA A;  2ILM A;  2JJ6 A;  2WWJ A;  3MUZ 1;  4LBJ A;  2XQX A;  2RS1 1;  2UY8 A;  3MW3 A;  2DCK A;  3ZLI A;  1UZ0 A;  3WP5 A;  4BWO A;  3IDE A;  1GZT A;  5FYV A;  4NAO A;  5KXD A;  1OLM A;  2E53 A;  2YC2 A;  2B7Y A;  5C3P A;  2IXK A;  4XJA A;  5FPL A;  1NE4 A;  1AR7 1;  2PQS A;  2W1Q A;  2VGD A;  3N35 A;  4QX7 A;  2LTN A;  1W3V A;  4MH0 E;  4W50 A;  1V6K A;  1RMU 1;  4XDO A;  2WIN B;  1YQ5 A;  1LGB A;  1PO1 1;  5IAX A;  1H30 A;  1Q8P A;  3I2H A;  3LEI A;  3RI8 A;  3ALQ A;  3WDY A;  1K3I A;  5A6Z A;  5CFD C;  3RZG A;  4BK5 A;  1VB2 A;  2VNG A;  4UFL A;  3WG3 A;  3OGJ A;  1VBD 2;  4UBH A;  3FFZ A;  2W08 A;  1YFW A;  2IUW A;  5FZC A;  1EAH 2;  2JDK A;  4YAR A;  3TEW A;  4J1X A;  1X8M A;  1UF2 C;  3VD7 A;  4UF0 A;  5G04 L;  4DFS A;  2WNV C;  1DQ0 A;  4XIO A;  1VB4 A;  4MGQ A;  4FFG A;  5JOZ A;  1H9P A;  1VBE 3;  5EJZ B;  1OMI A;  4OLL A;  4LIT A;  3HNB M;  2FCV A;  1XRU A;  5FBZ A;  3WSO A;  2IXJ A;  5F5C A;  1JZ6 A;  4YZ4 A;  3N7M A;  3KCX A;  1O59 A;  4XFC A;  3AJZ A;  5F2S A;  5C5U A;  1LGC A;  1UXZ A;  3KM5 A;  3JXS A;  1HN0 A;  1OH4 A;  1PK6 B;  3EXU A;  5A3L A;  2R07 2;  2DUR A;  1H1M A;  3U1X A;  2J7M A;  5JMC A;  4HVO A;  4NRM A;  1WGP A;  1UCX A;  3USU A;  2ZGK A;  4CZS A;  1POV 3;  1LED A;  1WCD J;  4EYU A;  1U12 A;  2Z2S B;  3U07 A;  1SEF A;  1VJ2 A;  4AQ6 A;  1D0G A;  5K7P A;  3NJY A;  5FY8 A;  4ZZ5 A;  4ZS2 A;  2P6H A;  2D6L X;  1W3X A;  4IL7 A;  4S2F A;  1IPS A;  4XFB A;  1ND3 B;  4Y5T A;  2G1M A;  4M0N A;  1W8U A;  3PUA A;  3LWC A;  2B4K A;  4GAZ A;  4NID A;  1MEC 1;  4ES8 A;  2RS1 3;  2DUO A;  1CON A;  2JG8 A;  5FRE A;  3GGL A;  1MZF A;  2W68 A;  2WWS A;  1JYI A;  1RUJ 3;  3N36 A;  1UU6 A;  3WD5 A;  3IAQ A;  1GIC A;  3IM0 A;  3AKT A;  3IT8 A;  3LZZ A;  1K5M C;  1PO2 3;  3JB4 C;  1GQP A;  1TME 1;  3AP9 A;  1XYN A;  1XSQ A;  3PVB B;  5E6H A;  1AL2 2;  4TLG A;  3E97 A;  5E1R A;  4O9E A;  3ZSE A;  1UKG A;  4Y1U A;  2EXI A;  3ZX7 A;  3FFQ A;  4HXC A;  4C0H A;  3A21 A;  2IFW A;  5C8W A;  2XLA A;  3VBF A;  1Y4W A;  2PEL A;  4YVW B;  5LBC A;  2FCT A;  1HDK A;  1PMH X;  1XBF A;  3WDV A;  3K75 B;  3ZFE C;  4Q0V A;  1PZ7 A;  2GN7 A;  4YZ1 A;  2HWC 3;  1MZE A;  3FMG A;  1GOG A;  2R32 A;  1W39 A;  4MG2 A;  3WR0 A;  2XGX A;  4AXO A;  3WDT A;  1YI7 A;  2D3P A;  3N9P A;  3VDB A;  3D4K A;  1IPJ A;  1C8M 3;  3HNY M;  4JGY C;  4K1Y A;  4AQS A;  4EN0 A;  5FMC A;  4IV3 B;  1HRV 2;  4AEJ A;  2A6V A;  3T2Q A;  5F5Q A;  4PT6 A;  2JDZ A;  4IEW A;  4JVA A;  1CZT A;  4AAX A;  4HOO A;  3RSJ A;  3FHI B;  2QUO A;  3LIH A;  4WM8 C;  5D8A B;  3BTY A;  2GC2 A;  3NV3 A;  2YFU A;  1S2B A;  3WLU A;  2L9L A;  2JEM A;  3K3N A;  3GXU A;  1LHN A;  1NLR A;  4XVH A;  1SBD A;  3D82 A;  2AH2 A;  4P14 A;  3VD3 A;  2GME A;  1PZ9 A;  2X29 A;  3CJI A;  4MGS A;  1CWP A;  4K6B A;  2VME A;  1PGW 1;  4QDS A;  2XVG A;  3SCF A;  4RQP A;  2HWB 1;  3GAL A;  5BNN C;  2B8M A;  2EF6 A;  4OQ8 A;  5CNA A;  1JH5 A;  4IW3 A;  4R9D A;  5GLU A;  2UYB A;  1AVB A;  3CF6 E;  1S0I A;  1MEC 3;  1SFP A;  3OD4 A;  5CFC B;  1KD7 A;  3L2H A;  4ARY A;  2BNM A;  4GH4 C;  5C5T A;  4CPB D;  3BI3 A;  4QKN A;  2VCB A;  3FHA A;  1GV9 A;  5A70 A;  2ORZ A;  4NII A;  5DZG A;  4A7K A;  3DV8 A;  4N9I A;  1K5M A;  1NE6 A;  2RS3 3;  3ZYR A;  4BU2 A;  1D4V B;  4A45 A;  3B3Q E;  1GSL A;  1QHD A;  1CN1 A;  4DO0 A;  1TE1 B;  1PNF A;  1VBA 3;  2ORX A;  3MID A;  1XNK A;  3MPP G;  1QOT A;  1SG3 A;  2KR2 A;  3ZYI B;  4ES9 A;  4W6X A;  3H3Z A;  2NMO A;  2VBB A;  1AR7 2;  4HN0 A;  3OYW A;  1QKQ A;  4I09 A;  4XXA A;  4AED C;  1YNA A;  1SLB A;  2JB4 A;  4NRP A;  2P3I A;  1LAJ A;  3H0O A;  1UYX A;  2W91 A;  4R52 A;  5CKN A;  1RMU 2;  5BNQ A;  1S0F A;  4WBB A;  4JKK A;  2RE9 A;  4LKF A;  3AL6 A;  3LFM A;  5E89 A;  4AYU A;  1E5I A;  1T6B X;  1YLL A;  2J42 A;  2PYT A;  4COU A;  4Z1V A;  4DRR A;  2WZE A;  5AFB A;  2R30 A;  1SHW B;  3H42 B;  1KXG A;  1CD3 G;  2QFE A;  4KU7 A;  2XLF A;  2N7G A;  4QXK A;  1T2X A;  1VRH 2;  1BVV A;  2GAL A;  4CEY A;  1QJY 3;  1AJK A;  1IG3 A;  1QXR A;  3VHO A;  2RS5 1;  2F6B A;  4H14 A;  5CA6 A;  3J26 N;  4YW3 A;  1UZY A;  4FTS A;  3FWE A;  2A6Z A;  1IQA A;  1ULC A;  1N3Q A;  1OPM A;  1Q8S A;  1YFY A;  2K46 A;  4L0P A;  1QQP 1;  5HV0 A;  4C8D A;  4ISR A;  1GQH A;  5SV8 A;  3DYM A;  2RJ2 A;  4Q4X 3;  4CE8 A;  4HVR A;  5EV7 A;  3CBN A;  1CVN A;  4N43 A;  3MF9 A;  3TN9 2;  1VAL A;  1XNC A;  3O7O A;  1IQD C;  4K8R B;  4XUR A;  5FZK A;  3I2F A;  1JI6 A;  1QNW A;  1PIV 3;  3EHK A;  3ZM8 A;  5C8C B;  1IKQ A;  2VUJ A;  4D0Q A;  1C5H A;  2V72 A;  5LAS A;  3GJA A;  4FI9 A;  5A3T A;  2JEC A;  1O91 A;  3PVE A;  1X36 A;  4LA3 A;  4NHY A;  2WAO A;  3JD7 2;  4XBN A;  2PXJ A;  2XUE A;  1AJO A;  5CKM A;  3KWV A;  1Y9Q A;  1RUF 1;  3J8F 3;  3VZL A;  2ENR A;  3AP5 A;  4IND A;  4CTE A;  4JDN A;  5F6K A;  1CZV A;  1EAH 3;  3R0R A;  4IE6 A;  1PVX A;  5IW0 A;  1A34 A;  4AG4 A;  5FAX A;  1RVF 2;  3MHZ A;  3S7E A;  1GNY A;  4QHZ A;  1JMU B;  2HWD 2;  5F9T A;  3O0X A;  4JGZ B;  5FZM A;  1KRI A;  2WS9 1;  1HB3 A;  4BJ0 A;  4L8Q A;  1AR9 3;  4KWJ A;  4OYU A;  2PAE A;  1AYM 2;  2HWC 2;  5KXE A;  3KQR A;  2KD7 A;  1SAC A;  2YGM A;  1XJA A;  1F9K A;  1ULD A;  2CU5 A;  1JHJ A;  3N9M A;  5EJ3 A;  4LOR A;  4XF4 A;  1KFX L;  2XON A;  3KV4 A;  4MGT A;  3SQO A;  2PHW A;  5GZC A;  1SFY A;  2XBO 2;  2WT1 A;  3HT2 A;  4GB3 3;  4QPG A;  4WM8 B;  1FAT A;  2R04 3;  3VBO C;  5FMO S;  4XHX A;  5EYX A;  1HRV 3;  2A71 A;  2IZW A;  2VZP A;  1DQ5 A;  1NCR A;  1OVP A;  2D98 A;  2VQT A;  2Y0I A;  1W6P B;  3UJO A;  3V56 A;  1TNF A;  4AEM A;  2ET7 A;  1XU2 A;  2OKX A;  1OI6 A;  4Z82 A;  3WP3 A;  3B69 A;  1D4M 3;  1W9S A;  2QNK A;  3DXT A;  1WME A;  4D94 A;  5JXH A;  5FZB A;  4QU1 A;  4XET A;  1RC6 A;  3WNO A;  1VRH 3;  1COV 1;  3INA A;  1RUG 1;  1Y3T A;  2XVL A;  4NMI A;  3AM2 A;  1OC1 A;  4ZY9 A;  1S0D A;  4CDX C;  3WF1 A;  1V6M A;  2YPD A;  4XC9 A;  4NE9 A;  1RL3 A;  1N3O A;  5F37 A;  5JSR A;  3GCW A;  1ASJ 1;  4IV3 A;  1OFN A;  2V4A A;  1YO8 A;  4Y1Y A;  5CYY A;  2OW4 A;  3ZMN A;  1YJL A;  5C33 A;  1ZZ8 A;  1HV1 A;  1L7R A;  2C4X A;  4LNV A;  3MBW A;  3CNA A;  3MYX A;  4L11 A;  5M0T A;  4IGP A;  4Q1R A;  5BNP C;  2BU9 A;  4XFA A;  1QJZ A;  1U5I A;  4PIZ A;  1A8M A;  2BOI A;  2WO7 A;  2WNV A;  4FPJ A;  3FLP A;  5FDB A;  4A6S A;  1JYW A;  4L99 A;  5EP9 A;  4CXY A;  1DGW A;  3ILN A;  4XHB A;  4M00 A;  3MLJ A;  3CJI B;  4TSV A;  1QXJ A;  3VBO B;  1C8M 2;  4UFM A;  4S2G A;  3FX3 A;  5ANN A;  1FMD 1;  3E5Q A;  1OQD A;  2JDP A;  3M2M A;  1LES A;  3FN9 A;  4LUM A;  5JMO A;  3LD8 A;  1LU1 A;  3J7H A;  4E4H A;  5EFU A;  5BNP B;  2E51 A;  4JRL A;  2A3Y A;  5FO7 B;  3PLQ A;  2J22 A;  3Q8C A;  1ZRC A;  2WII B;  4OCT A;  4AAP A;  1WW4 A;  2B9U A;  2YV8 A;  3TAY A;  2ZX4 A;  1AR6 2;  2BGC A;  2WLQ A;  4QX8 A;  3ZSL A;  4YYO A;  2UWA A;  3AFG A;  1RUO A;  4U2A A;  1REF A;  2VH9 A;  2WUH A;  2VUC A;  2YBP A;  4Q4V 3;  2X10 A;  4V1P A;  3T4V A;  4NVP A;  2HKX A;  5BNO A;  5A3N A;  1GZW A;  3APB A;  2ZMK A;  3WV6 A;  1UNB A;  2LUW A;  5L7O A;  4XXP A;  3S0M A;  4HBN A;  3AMN A;  2HWF 1;  4YW1 A;  3K4A A;  4QPI C;  3O14 A;  1HIX A;  3UK9 A;  1RUI 2;  3JZV A;  1BLZ A;  4LXL A;  3GYD A;  3NNL A;  4JQR A;  1S0C A;  5A1A A;  1OOP B;  3H3U A;  1VE0 A;  1I6X A;  1PGS A;  2RG4 A;  1W03 A;  2Q1Z B;  1BKZ A;  3WG2 A;  1H2M A;  1XOY A;  2J1U A;  3Q8A A;  1QWR A;  4W6Y A;  1VMJ A;  3DN7 A;  4YZ2 A;  1HRI 2;  1NYW A;  4MV2 A;  3DPR B;  5FY1 A;  5FWJ A;  1JS9 A;  1MS3 A;  4U36 A;  2FZ1 A;  3I3D A;  4FOV A;  4ORF A;  5FP3 A;  4YM0 A;  3VKN A;  4HN1 A;  3KV6 A;  1GWM A;  4P08 A;  3NAP C;  4LJH A;  1L7Q A;  2WSV A;  2EA7 A;  2Y60 A;  2YRO A;  1JYV A;  1QDC A;  4JGY A;  3A0K A;  5FPA A;  3ZYH A;  4NIG A;  4SLI A;  1OA3 A;  5ABJ C;  4XJU A;  4FOW A;  4EN9 B;  2HWC 1;  4XDQ A;  2G4I A;  2C0Z A;  2RMU 2;  2WN3 A;  2XKP A;  3JB8 A;  4Q0U A;  5JIU A;  1PGL 1;  3A0N A;  4MET A;  4Y22 B;  1UMH A;  1QNY A;  4RN5 A;  2D93 A;  4CCO A;  4PBP A;  5GM0 A;  2QDN A;  3RI9 A;  2VCM A;  5LZ6 A;  5KXB A;  4N53 A;  1LEN A;  1VBE 1;  1WKY A;  1YWK A;  2IVJ A;  3KSC A;  4JTN A;  3KMH A;  2XL9 A;  4RR3 C;  4KL1 A;  3SXW A;  4XF0 A;  4XZU G;  5C8C A;  2YBS A;  3WP4 A;  3IN9 A;  1E5S A;  1D7P M;  2NMN A;  5C6C A;  2Q8E A;  1YC6 1;  1MS5 A;  4Q8K A;  1AL0 G;  1PGW 2;  5FYS A;  1S1A A;  1WWY A;  1OF3 A;  1W8W A;  3S5Q A;  5IK5 A;  1AYM 1;  1FOD 2;  4SBV A;  1GLH A;  5A7W A;  1UQX A;  2JIJ A;  2PLV 3;  2EIG A;  3QD6 A;  1JZ4 A;  3KT4 A;  5C9A A;  1AR6 3;  1CQ9 A;  1ZRF A;  2CSG A;  1GAN A;  2RVA A;  1POV 1;  5GZE A;  3DPR C;  2WQZ C;  4B1M A;  2WFF 2;  4AEK A;  3DKW A;  3LEM A;  1QDO A;  2EIB A;  4FPE A;  3WW1 A;  3RZM A;  5J37 A;  1FX5 A;  2PMW B;  3POE A;  1DYP A;  3C7O A;  5FZG A;  4FFH A;  2H6C A;  3I3Q A;  4H55 A;  3Q9O A;  4WVV A;  1YQ2 A;  4CP1 A;  1UPS A;  3BVC A;  4BXS V;  2K0G A;  1S0G A;  1FAY A;  5FQ0 B;  5C4W A;  5I8T A;  1UYY A;  3RZK A;  2B9V A;  2ES3 A;  4W6W A;  5FPZ A;  3VD5 A;  3BAL A;  2BWA A;  4JX0 A;  4AI0 A;  2LRO A;  2FMD A;  5E88 A;  3ZVX A;  1HXS 2;  1MR5 A;  4RR3 B;  1RIR A;  4MAD A;  1RUC 1;  3MGU A;  5GLT A;  4S2H A;  3H7Y A;  1TNR A;  3ZN4 A;  4FTB A;  3OGR A;  4KGQ A;  1ULP A;  1WLD A;  3LOB A;  2R49 A;  2Q8O A;  5B2G B;  1S2E A;  3ETQ A;  5J7M A;  5JPN B;  1R1A 2;  1TMF 3;  2FDH A;  3BPS A;  3NNM A;  4TYS A;  4Z2W A;  2OPW A;  2Q0A A;  4OVE A;  4TZD A;  1BK1 A;  4PDW B;  5EYY A;  5DDJ 2;  3ZR5 A;  2J1T A;  4FSJ A;  4QPG C;  4QX0 A;  1RUD 3;  5FY0 A;  2CWS A;  1DQ4 A;  1QOS A;  1UIK A;  1PX3 A;  3III A;  4GB3 2;  4OMC A;  4BME A;  1RHI 1;  3W5N A;  2VR4 A;  2KXL A;  3OBT A;  2C1F A;  4QPI A;  4YG0 A;  3ZIX A;  4XAA A;  1NCQ A;  3KT7 A;  3POB A;  3S5A A;  1CJD A;  2JDU A;  5A3O A;  4JKL A;  1S4C A;  4I3P A;  4KNC A;  5F32 A;  2GNT A;  4D7Y A;  5BNO C;  3URF A;  3ZFE A;  2W47 A;  3BPZ A;  3IDC B;  1XYO A;  4ONU A;  1UOJ A;  3RWN A;  5L73 A;  5A1L A;  4C91 A;  5LWB A;  2CYF A;  2JEN A;  1NCQ C;  5L36 A;  5BV6 A;  3RYR A;  1W99 A;  2BEO A;  2LS6 A;  1AR6 1;  3OUJ A;  2ADD A;  4WZC A;  3BIE A;  4OHV A;  3O1O A;  1V0A A;  5T5P A;  2A73 B;  2VMG A;  1JYX A;  2OZ6 A;  1H4H A;  1PO1 3;  3C7H A;  2BQP A;  1GNH A;  5FYI A;  2BP6 A;  2D43 A;  3LIG A;  4QB2 A;  3X29 B;  4BA6 A;  5DMY A;  1XQN A;  1F4H A;  3EBR A;  2EAK A;  3N9N A;  2VU9 A;  2IWG B;  3SEP A;  3WF2 A;  1CZS A;  4RGG A;  4IE7 A;  1Q8Q A;  3WT3 A;  1XNT A;  3WUD A;  1JZ8 A;  4A44 A;  1ZBA 3;  3JU9 A;  3PU3 A;  1DP0 A;  5BNP A;  5LA1 A;  1AR8 3;  1NT0 A;  3NKG A;  2AEY A;  2W3J A;  3ZFG A;  1IS4 A;  1K45 A;  4JV4 A;  4QD2 A;  4UW3 A;  2ZGQ A;  1GP4 A;  1RUJ 2;  4D3W A;  2DVD A;  1VBB 1;  4NHM A;  2GMP A;  3O0W A;  1OOP A;  2D6M A;  5EJ1 B;  2OT7 A;  1Q8O A;  1R08 1;  5DG2 A;  2XG3 A;  1YCI A;  3M4F A;  1FPN 3;  3THP A;  2BGP A;  1OPO A;  3WQB A;  2WNV B;  4E2Q A;  1DGR N;  5HI0 A;  1ZZ9 A;  4XQW A;  4G9S B;  5LEJ A;  1FT9 A;  1QJE A;  3AVR A;  4FPO B;  2I74 A;  4XFI A;  4ZU5 A;  1LOF C;  1WMX A;  2R04 1;  1JW6 A;  1SLC A;  1AXZ A;  4Q2F A;  3S7I A;  1OKO A;  4XOG A;  4Y1V A;  3HQR A;  1AUY A;  3AP4 A;  2UY9 A;  1LHV A;  3E6B A;  5AC9 1;  4NOT A;  4WZF A;  4AGG A;  1JU4 A;  3G7D A;  3O1M A;  3ZN6 A;  1UY0 A;  2X53 S;  2X5I C;  2YC0 A;  3MLK A;  5JDB A;  1RUH 1;  2Z4F A;  3K4D A;  4A6O A;  3VL8 A;  1JTZ X;  2VXR A;  2VCA A;  1ZX5 A;  2LAL A;  2R7E B;  3Q8B A;  5FZF A;  5JZG B;  1HQN A;  4IGQ A;  5APA A;  1BBT 3;  1GMM A;  4Y22 A;  2F4L A;  4PI2 A;  4PF5 A;  3I4I A;  4GH4 A;  4Q4X 1;  1V70 A;  1ZZ7 A;  2ZEX A;  4UW5 A;  2B46 X;  1B09 A;  2NZ9 A;  1G8W A;  3ACG A;  1QEX A;  4D8M A;  4LOS A;  5L7O B;  1J83 A;  4NHX A;  2OUJ A;  2A75 A;  1LHO A;  5DAB A;  2WJS A;  4M0H A;  2VNR A;  4GKX A;  3NV1 A;  4I0B A;  2EIE A;  1GYK A;  2GC0 A;  4R9C A;  4WVW A;  1DDL A;  3AKS A;  1OHF A;  4BQX A;  4F8A A;  3THC A;  1VP6 A;  3CZU A;  3T1M A;  5FXX A;  1QGL A;  4K8F A;  4CDQ B;  1HJG A;  4UBG A;  2VVE A;  3U10 A;  5CAD A;  1EAH 1;  3AXD A;  5LBB A;  3W9A A;  3USU B;  2YMZ A;  3MIG A;  1HXS 3;  1W8H A;  1DCS A;  1FXZ A;  1UYZ A;  4DIQ A;  3VBF B;  3O1S A;  3LF7 A;  4QX3 A;  4YWA A;  4A7Z A;  1LUL A;  2DYC A;  4HK9 A;  3HT1 A;  4XAB A;  1W05 A;  4YSF A;  1XND A;  1G86 A;  4HZF A;  4IDZ A;  1R09 3;  2BUK A;  3PTR B;  4DEQ A;  4DS0 A;  4COV A;  3PUI A;  1W8F A;  3ZMO A;  5FZD A;  1CJP A;  1MQT B;  2DTY A;  3EQE A;  1OH3 A;  1PM4 A;  1ND2 B;  2CDO A;  2WR9 A;  2ZA9 A;  4XJZ A;  2W39 A;  2P2K A;  5FZ9 A;  2NYY A;  3M3C A;  4WM7 B;  1ODN A;  1ODM A;  1O5U A;  1VLN A;  1WCK A;  3M3I A;  3AZV A;  3IPV A;  3PUQ A;  2WA3 A;  3CEW A;  2AC1 A;  3OBA A;  3EO6 A;  2G9Z A;  1VBC 3;  1PMJ X;  2YG0 A;  1HRI 1;  2VZT A;  2BWC A;  2X8K A;  5FUP A;  3POG A;  3GHM A;  3IMN A;  3ZPY A;  1DF0 A;  2Q8C A;  2WS9 2;  4EV0 A;  1OSG A;  3HEI A;  5E16 A;  4CDU A;  1GBG A;  4BYY A;  2B42 B;  3RNS A;  1FNZ A;  1WW7 A;  4UFJ A;  4B3N A;  5CB7 A;  1TME 2;  5GLW A;  5A3U A;  4TN7 A;  4AI3 A;  4PQQ A;  4LHN A;  3PVO A;  4XE9 A;  1DIW A;  1YI9 A;  4DIN B;  2WAA A;  5C8C C;  5KHI A;  2C9K A;  4KWK A;  5IK8 A;  2OA2 A;  3ILR A;  3RVH A;  1MZ6 A;  3EMR A;  4ZS3 A;  1W9T A;  1RUE 2;  2AEZ A;  4LO6 B;  4N53 C;  4P9X A;  5A7S A;  2SLI A;  3ZR6 A;  4CEW C;  3AX4 A;  1CR7 A;  2VTX J;  1WBF A;  5EHD A;  2FDI A;  1RJ8 A;  4QDR A;  2XVK A;  3AZY A;  3HBZ A;  1ND3 C;  1GZC A;  4CP2 A;  3UKT A;  1MZ5 A;  2BNN A;  5L19 A;  1J1T A;  2Z42 A;  1RYY A;  5DXD A;  2BBA A;  4HAN A;  4BQ2 A;  4B8E A;  3JD7 3;  3LDB A;  4HKO A;  1LGN A;  2DCZ A;  2EXK A;  2ETE A;  2KM2 A;  4CCC A;  5FZ8 A;  1X7N A;  2VG9 A;  2Z79 A;  1OQ1 A;  3ENR A;  4P9Y A;  5A7O A;  1J3R A;  3BCW A;  3WDU A;  3BTX A;  1BHG A;  3ES1 A;  4FXK B;  1A8D A;  2R06 1;  4IEX A;  5F3I A;  4CU9 A;  4QWN A;  2C24 A;  5A7W B;  3OGS A;  1H4G A;  3RS6 A;  4CU8 A;  4ZU7 A;  5FOJ B;  2WC2 A;  4R8H A;  5A80 A;  5FY9 A;  2YFZ A;  5F8P A;  2WN2 A;  5F3C A;  2GP5 A;  5FCC A;  3R4D B;  4ARX A;  3POJ A;  1DZQ A;  1EY2 A;  3FLT A;  4Z8B A;  5FIX A;  1JZ3 A;  3MZH A;  2WFF 1;  3AK0 A;  3CO2 A;  4Q4V 1;  1AYM 3;  4FP3 A;  4GA9 A;  4QPG B;  5BUV A;  4JDM A;  2WNU C;  4AFB A;  4E9K A;  1QF3 A;  1YQC A;  1W6N B;  1VAK A;  1JBC A;  5CFD A;  2QQK A;  3JBG 2;  3PHM A;  3IAP A;  4YW4 A;  2O1Q A;  1C57 A;  4ZPI A;  3CIH A;  4XTP A;  1K12 A;  4Y20 B;  1FMD 2;  3JCI A;  4BIF A;  3DL3 A;  4UFK A;  3RZZ A;  2DCY A;  3ECQ A;  4UF0 B;  3WX5 A;  1CPN A;  1XE7 A;  4OHX A;  1CIW A;  4QU2 A;  1OVS A;  4N53 B;  4EQV A;  4PLO A;  3W21 A;  5JOX A;  2D3R A;  5FFO C;  3RYK A;  4FPC A;  2RR1 1;  3T2O A;  5CKQ A;  5I0U A;  3LPF A;  3BGA A;  1VBC 2;  4JC1 A;  1I5Z A;  1H1I A;  1RUH 2;  1ACC A;  1VIW B;  3CMG A;  3JQW A;  3PUH A;  2W0X A;  4Q0S A;  3VBF C;  1E57 A;  1VMF A;  2YYO A;  5L9R A;  4YM3 A;  2JDH A;  2CGN A;  4OMD A;  3ACI A;  3OUI A;  2WZR 2;  3M3O A;  3AZX A;  1DQ6 A;  4PLN A;  1QJX 2;  1SCR A;  5F5I A;  3POW A;  5JAX A;  1N1Y A;  5FJK A;  3I97 A;  2WKK A;  3TYJ A;  4M4R A;  2CL2 A;  1YRZ A;  1LOA A;  3PTY A;  2VUD A;  4ISQ A;  1NCQ B;  1MPX A;  2XWJ B;  4UOJ A;  3VZM A;  1LHU A;  2XJT A;  2JXA A;  2YDE A;  3IIA A;  1ZRD A;  1D4M 1;  3IWZ A;  3Q8E A;  3VBS B;  2O0O A;  3R4S A;  2PAM A;  2WAB A;  1RHI 3;  2ZGM A;  3LSE A;  5FPX A;  4Y1X A;  4XBL A;  4AVV A;  3AYE A;  1R64 A;  3ZFG B;  2R06 3;  4AR2 A;  1BEV 3;  3DEC A;  3SH5 A;  4NPR A;  1R09 2;  3BU7 A;  2CTV A;  5E8A A;  4PQ9 A;  2TUN A;  3OG2 A;  3B94 A;  5FY7 A;  3A22 A;  4Z92 B;  3WNL A;  4QQP A;  3MDP A;  3O12 A;  1JYN A;  5LEK A;  4B29 A;  1CAV B;  2VOW A;  5FZO B;  2RDQ A;  1FV3 A;  2IXL A;  5HBA A;  1RXF A;  3MW4 A;  4LBO A;  2PQQ A;  2E31 A;  3R6S A;  3V0A B;  3OGG A;  3FHQ A;  4YGC A;  4ERO A;  4O9G A;  2OQ7 A;  3PJY A;  5IK7 A;  3ZYJ B;  2YY1 A;  3SC7 X;  5DZF A;  1YYN A;  1OFS A;  3T2T A;  5J48 A;  3N4M A;  2HEY F;  2ZGO A;  1LB2 A;  5K0U A;  3B01 A;  3MF6 A;  4N8M A;  4YRD A;  1V00 A;  3DF0 A;  5KHK A;  2QTW B;  2OS2 A;  4COW A;  2ZHL A;  2P6C A;  1FMD 3;  5ABJ B;  4LBK A;  5J09 A;  1O8S A;  3CJX A;  2G9G A;  4AHZ A;  1NA1 A;  5LA0 A;  1RGS A;  1RUJ 1;  3ZKU A;  4ASL A;  4XFG A;  5FP8 A;  1VBB 2;  3TB0 A;  2RDS A;  4GQ7 A;  1GKB A;  4UAP A;  4XZP A;  4X6Q B;  4IET A;  4K21 A;  1U5X A;  2XQR A;  3OF1 A;  1WCS A;  2Y6K A;  4I01 A;  5T5J A;  2YGL A;  3AXE A;  5HCB A;  1RVF 1;  2Q1F A;  5F3G A;  3AP6 A;  4RSU A;  1LNS A;  2Z69 A;  4YZ5 A;  1TMF 1;  2WBK A;  4TWT A;  2YU1 A;  1TZO A;  3RJR A;  4BQ1 A;  4L9B A;  2TBV A;  4RFR B;  4BDV B;  2Y8K A;  3UNP A;  4QMA A;  1VMH A;  3U14 A;  1WD4 A;  4YVW A;  2HWE 2;  3ZXE A;  2CHH A;  5LRS A;  3OUH A;  2XH6 A;  3C8X A;  3NAP A;  2VQU A;  5F7U A;  4LE4 A;  5D1I A;  1ULE A;  2ARA A;  4QB1 A;  2WYF A;  1UN1 A;  4L2N A;  4KQ7 A;  5JXG A;  2ZAC A;  5FZ1 A;  1Z7S 2;  4XQ4 A;  1SLT A;  2BW8 A;  1IKP A;  1W6M B;  4UFH A;  3T3Y A;  4CVU A;  1JOJ A;  4AE2 A;  3E6C C;  4BK4 A;  1JYT A;  2JIC A;  2XLG A;  5HXM A;  3POY A;  3B9C A;  2JDM A;  3GDB A;  4EN6 B;  4CDQ C;  5IVV A;  1FNY A;  3BOW A;  1XB9 A;  1TEI A;  4YG3 A;  1ASJ 2;  1UY3 A;  3PMS A;  5C4W C;  3BTZ A;  1FOD 3;  4YGE A;  4I0A A;  1WCQ A;  2A6X A;  4NR1 A;  2ZXQ A;  1LR5 A;  1OF4 A;  1HB4 A;  1QJU 1;  4GWI A;  4XEZ A;  3WDW A;  4Q27 A;  4HMZ A;  2EXH A;  1S0J A;  3T1L A;  3WQ1 A;  2CWM A;  2OXB A;  4LIU A;  5FYY A;  3O1P A;  2QE3 A;  4Q29 A;  5DAW A;  4AGV A;  1V9U 3;  2NQY A;  2QQW A;  3OPZ A;  5FY5 A;  4EJR A;  4YW6 A;  4E4Z A;  1W0O A;  4NJ4 A;  3D5O A;  1SMV A;  1URX A;  2GAU A;  5DAX A;  4UYB A;  2VZO A;  3FL7 A;  4XFH A;  1J84 A;  1APN A;  1HB1 A;  3PVN A;  4XMI A;  3W58 A;  4BQ3 A;  1O3Q A;  1AXY A;  4LKE A;  2RM2 3;  3VBR B;  5I0T A;  1PO2 2;  1BK0 A;  1QQP 2;  2V73 A;  4LK6 A;  4HK8 A;  4E4D X;  1GNZ A;  1G7Y A;  1QU0 A;  1W2O A;  2VOV A;  4CUA A;  2VUA A;  3ACF A;  4YVS A;  1N3P A;  3HD8 B;  1MS8 A;  2JIG A;  1MEC 2;  2Q5T A;  4RGA A;  3ZOI A;  5FZ6 A;  1ZZB A;  2ZML A;  4DXR A;  3VBS A;  1GU3 A;  3NQH A;  4PIY A;  3RG0 A;  3GZE A;  2F17 A;  3HOB A;  3J4U H;  4HLT A;  2Y64 A;  1QY4 A;  3L9J T;  5DDJ 3;  3VHN A;  2CAV A;  1O7F A;  3JBG 3;  3E5U A;  2ZEW A;  4UFI A;  3LEG A;  1ENS A;  4XFF A;  3B00 A;  5ACA 3;  3LCP A;  3LPG A;  2GND A;  1RUF 2;  1DU3 D;  1DGW X;  2ARX A;  2VO5 A;  4X6R B;  4P9L A;  5CU1 A;  1G9B A;  1OUX A;  2ZJC A;  4UWD A;  2E7A A;  5FLI A;  5IVB A;  2R07 3;  1SCS A;  2ZGU A;  2RDN A;  4JQT A;  1B35 B;  3VKO A;  4G3Y C;  3K77 A;  2DU1 A;  3TNP B;  3KV5 A;  1BBT 1;  1UU4 A;  3K4Z A;  2C26 A;  1RMU 3;  1W8T A;  3ZSM A;  2W1S A;  4HPK B;  4D7T A;  2D44 A;  1GOH A;  1F15 A;  1AF9 A;  2E63 A;  3VBH A;  2WRA A;  1PX4 A;  5A6Q A;  1YIP A;  2IFR A;  3H7J A;  4N7I A;  4YVS B;  2VC9 A;  2W94 A;  5FXV A;  4ZHN A;  5LB6 A;  1TQ5 A;  3ZN5 A;  1O4T A;  3B93 A;  1OA4 A;  1GFF 2;  1RXG A;  4IER A;  5I8Y A;  2WZP P;  5FXW A;  1UOF A;  3L2Y A;  2FD8 A;  5JOW A;  2A3W A;  4BZ4 A;  1RIN A;  5DAQ A;  2BZD A;  4LT5 A;  1JUH A;  2VMC A;  3UET A;  4AED B;  5L7O C;  2Y6L A;  1W8O A;  2VL4 A;  2V5D A;  3H1M A;  4NIA A;  1SPP A;  5A3W A;  3WW3 A;  3K48 A;  1AL2 3;  1BZW A;  5FZA A;  2MEV 3;  5CEH A;  3H1W A;  3VLB B;  1IZ3 A;  4QX1 A;  4URT A;  2XR4 A;  5CBL A;  3I2O A;  1J59 A;  3DYP A;  4Q4X 2;  5I91 A;  4NHL A;  2GSY A;  1UX6 A;  2B5H A;  2P3Y A;  1AR9 1;  1FYU A;  3GBG A;  3R4U A;  2CGP A;  3I3E A;  5BYN A;  2X5I B;  3SCG A;  1PVC 1;  1LOD A;  1XNA A;  2DV9 A;  2O8O A;  2DVF A;  5H9S A;  4Q4Y 2;  4PI0 A;  2BOJ A;  2HWE 3;  1C3H A;  4Q4W 2;  1S0B A;  2JG8 C;  4GAL A;  4ZON A;  4CCK A;  1PMI A;  1AZD A;  2D6K A;  3D6E A;  5F6L B;  4AL9 A;  3F2Z A;  5LBE A;  4IXL A;  4DY5 A;  2ARB A;  4BMB A;  1VR3 A;  3D0J A;  3NW4 A;  5LCW L;  4A3X A;  2VUL A;  2RR1 2;  5JR7 B;  5K0U C;  5FKB A;  3WNP A;  4K7J A;  4WVZ A;  3VZJ A;  1J3Q A;  1VBC 1;  2ZGR A;  2OVU A;  4OUL A;  2RS5 2;  4XF1 A;  1SDW A;  2ERF A;  4IEV A;  5FZL A;  4LLF A;  3VZN A;  5ACA 2;  1MVE A;  2PHF A;  1H8T B;  1QJY 2;  1AX0 A;  3VKL A;  2W92 A;  4IV1 B;  4BIO A;  5A3P A;  5JZG A;  2JG9 B;  2VBD A;  3GZT B;  1ASJ 3;  4CDX A;  1QH6 A;  1EUT A;  1UX7 A;  3KF3 A;  3TEY A;  3BOD A;  4EWA A;  3RPQ A;  2Y6H A;  3LA3 A;  4RHV 3;  5DN2 A;  3HR9 A;  5DQ0 A;  4A3Z A;  3O1T A;  3IB3 A;  4BQW A;  4A42 A;  3UGH A;  4DUX A;  1DYO A;  3TN9 3;  2ZHK A;  3WW4 A;  4XW3 A;  2W52 A;  5K8S A;  4AVB A;  3M3E A;  1R1A 1;  1UY4 A;  1D4M 2;  5GJ6 A;  3OEB A;  5DUV A;  4CP0 A;  2VCC A;  5IFP A;  4FBF A;  1NCR C;  3E5X A;  2JG8 B;  2VOX A;  4NO4 A;  2WDB A;  2RS3 2;  5CVR A;  5BPX A;  3V0B B;  4YLZ A;  1VBA 2;  5J1X A;  1XNB A;  1RIT A;  3FUQ A;  3ZDV A;  4AFM A;  1W6O A;  3RQ0 A;  5A6X A;  4OUS A;  1ZM1 A;  2GU9 A;  3KS7 A;  3NKT A;  4HSL A;  4OZX A;  4XIL A;  5IHR A;  5HCH A;  1LOB A;  2VD7 A;  1XYP A;  2XB6 C;  1A3K A;  1Z7S 3;  3I59 B;  2Q8D A;  1N47 A;  3H8R A;  2QQL A;  2D40 A;  2E32 A;  3MFC A;  2C6S A;  1FPN 2;  4I30 A;  2D97 A;  4XCA A;  1RB8 G;  3K3O A;  4LBQ B;  4GIQ A;  4XF9 A;  3FC0 A;  4Y4R A;  1RUN A;  1T6G C;  4BXF A;  2VJX A;  1PIV 1;  1REE A;  4ZU4 A;  3U75 A;  3Q8F A;  2QCS B;  4AFC A;  2PLV 1;  5EPA A;  1K5M B;  1WLW A;  1DHK B;  5GLZ A;  2TEP A;  3ZXJ A;  4QXH A;  2OZJ A;  3LDK A;  2WO1 A;  4OI0 A;  3TOJ A;  4UW6 A;  2VM9 A;  4AWD A;  3IPV B;  1RUF 3;  3J8F 1;  5IAV A;  4LHK A;  1W2N A;  1WA6 X;  4B1L A;  3RZL A;  2WWU A;  4KG0 A;  4MLO A;  4YPJ A;  1M4W A;  2AR6 A;  2PHL A;  3AYD A;  4IUG A;  1J58 A;  1LOE A;  2IXH A;  2RR1 3;  1RTV A;  5IUQ A;  2ARE A;  2EAA A;  3ZXL A;  3VKM A;  5IFT A;  1VBE 2;  1HJF A;  4QKF A;  1ALY A;  1TG7 A;  3VBH B;  2WS9 3;  3BIW E;  3BUC A;  2XBO 1;  4M3C F;  4GWN A;  2IC1 A;  4Q4V 2;  2WT2 A;  3NNJ A;  4CUB A;  3KGL A;  3DEM A;  4XYX A;  1NCR B;  4Y3O A;  2V09 A;  4IV1 A;  1ZRI A;  2VZS A;  4E27 A;  2D6P A;  3OCP A;  3PIG A;  1F2N A;  2G9F A;  3GBW A;  2JB8 A;  4Y1Z A;  2DVG A;  2RV9 A;  1W2T A;  2Y33 A;  3PME A;  2VXJ A;  3OGV A;  4LBL A;  3HAG A;  3RWK X;  2EVX A;  4LE3 A;  5FPB A;  4OHY A;  2QZ3 A;  5FMB A;  2XJV A;  5KXC A;  4DY3 A;  2O14 A;  1KEX A;  5FZ3 A;  1RUD 1;  2MEV 2;  1C8M 1;  1W04 A;  5JUV A;  1SFN A;  3N7K A;  1X9P A;  3SH3 A;  4JGZ A;  3ZXG A;  3MIH A;  1JOP A;  1O4Y A;  4M3C E;  3SNM A;  2HWD 3;  2ZX0 A;  3ITQ A;  4LKS A;  4UXA A;  1N1V A;  1COV 3;  3LA2 A;  4V2W A;  4XQD A;  3FZ3 A;  2RHP A;  1POQ A;  1NLS A;  2X5I A;  4COY A;  2B39 A;  2DU0 A;  1N1S A;  1HX6 A;  1OUS A;  4A4A A;  3ZFF A;  4CXW A;  3ZXK A;  1Q5O A;  2E6V A;  4UI9 L;  3P1I A;  1Y7B A;  1W8N A;  3OB8 A;  2YUE A;  4LEJ A;  2UYA A;  2XJR A;  4YGB A;  5AVP A;  2AUY A;  3QOP A;  4MZU A;  5JSO A;  3I59 A;  1YFU A;  1U5Y A;  1RUC 2;  4N7U A;  3PUR A;  4QT6 A;  4R9A A;  2WNU B;  1H2N A;  3H3L A;  1YFX A;  3B7M A;  4MVT A;  4XPV A;  4RR3 A;  4IEU A;  4DXT A;  2PHR A;  2W9X A;  4QM8 A;  1X33 A;  4ZXK A;  3VL9 A;  5CFD B;  2R16 A;  1W06 A;  1NLQ A;  1JZ5 A;  4PDW C;  5LA9 A;  3BYW A;  3QAC A;  3WVJ A;  4JKM A;  4FPY A;  2NP0 A;  2BV4 A;  5FV3 A;  5KC6 A;  4QQO A;  1P8J A;  2XKO A;  3NJV A;  2V4V A;  4J1W A;  3HPN A;  3C7G A;  2X05 A;  1F31 A;  1LEM A;  3ACH A;  3WW2 A;  5T3N A;  5I0S A;  5A7P A;  3HN3 A;  3UV9 A;  1AXK A;  3AB0 A;  1BJQ A;  3VZK A;  1EV1 2;  4NPM A;  1SQ4 A;  2UUR A;  3I49 A;  1CPM A;  2BJS A;  1KGY A;  3ETP A;  4NHK A;  1CAX A;  4W65 A;  1WUV A;  4Y4Y A;  3WQ0 A;  3KQ4 B;  4RHV 2;  1K5J A;  3OPW A;  5EZW A;  4I3G A;  3WHT A;  5JLV A;  2XJQ A;  2A6Y A;  4LBQ D;  4YFZ A;  3FE5 A;  5JSP A;  4WV8 A;  1L3J A;  1RUE 3;  2Y34 A;  1WLT A;  2WFF 3;  1LKN A;  2RJK A;  3ABZ A;  4LQR A;  4QX5 A;  4L92 A;  4IEY A;  4LR4 A;  3KVA A;  5CZK A;  4P9I A;  4N9H A;  5FMD A;  4QXC A;  3DCQ A;  4FPG A;  4KG8 A;  2HYK A;  2ZX2 A;  3EJK A;  3LKJ A;  2IXC A;  4QGM A;  4AHW A;  4RQP B;  2Q1M A;  4Q4Y 3;  4F7Z A;  5FO8 B;  1VAM A;  4P9G A;  5IVE A;  4QM9 A;  3I2J A;  4PJY A;  5A32 B;  2CV6 A;  4LK7 A;  3THT A;  3EYP A;  3GM8 A;  2DFB A;  2VNV A;  3LOI A;  2BFU S;  3VDD A;  5AFE A;  1UXX X;  2DUP A;  1AX1 A;  3OTF A;  4OZO A;  1UIJ A;  3QCW A;  4F83 A;  1H2L A;  2TNF A;  5AC9 3;  4RS5 C;  2ZX3 A;  5J98 B;  4F3J A;  1V6N A;  2EXJ A;  3PNA A;  2RS5 3;  4CP9 B;  1ZA7 A;  3H9A A;  2QQJ A;  5IVC A;  2QBX A;  4C90 A;  3VDD C;  4AGR A;  3SKV A;  1H2K A;  1NQJ A;  1WCU A;  4CCJ A;  1HKD A;  4I2O A;  3VBR C;  4YW5 A;  4GWM A;  4IES A;  2ZAA A;  4JRA A;  2P3K A;  1OQE A;  2JE8 A;  3OJB A;  3WUC A;  1VRB A;  3AMM A;  2PLV 2;  4YNI A;  2RJL A;  2PFW A;  1UL9 A;  2WNU A;  4QQL A;  1JOB A;  2VW2 A;  4Y5Z 0;  4TLF A;  4XJW A;  3UGG A;  4B4Q A;  2YBK A;  2ZAB A;  2W5F A;  3CL1 A;  5B4N A;  2DFC A;  5FP9 A;  3H1Y A;  4JHT A;  1KDM A;  4XIK A;  3SCH A;  1JZ7 A;  3NRU A;  3NAP B;  4XCB A;  2P5B A;  1OBN A;  1O8P A;  3SLI A;  1AYN 3;  2FDF A;  3ZYF A;  3I8T A;  3AKQ A;  1GZW B;  3ZSK A;  1MS4 A;  1X50 A;  1YHF A;  5FZE A;  3N3H A;  3ZPO A;  3UGF A;  1W90 A;  5FMO L;  4P00 B;  3PUS A;  3T0B A;  1HXS 1;  1F5F A;  2Q30 A;  3AYC A;  4IGO A;  4OHW A;  2ZGL A;  1VBB 3;  4HPK A;  1GOF A;  1PVC 2;  1N1T A;  5JZG C;  2A6W A;  4HG6 B;  2ADE A;  5FBJ A;  5KHG A;  1OLM E;  1ND3 A;  3BU0 A;  1HV0 A;  3KV9 A;  5FZH A;  2HWB 2;  2RMU 3;  4MXW B;  1JUI A;  4WM7 A;  4CRQ A;  3DKQ A;  2YC4 A;  3VBS C;  4GD4 A;  2AGS A;  4CEW A;  1QH7 A;  4BLJ A;  4WVM B;  1H6X A;  2QDR A;  5CG9 A;  1NZC A;  3OYW B;  1KS5 A;  4QKB A;  4A2U A;  3LFI A;  4YVS C;  1RHI 2;  4RA0 A;  4DZG A;  1ENQ A;  1QJF A;  3DXU A;  4FAG A;  2ZGS A;  2GDF A;  1ZRE A;  2H0V A;  3HN1 A;  5EWS A;  1RUD 2;  2PTM A;  1R1Z A;  3MIC A;  1GZ9 A;  3VBO A;  2J1E A;  4YM2 A;  1UMI A;  1QJY 1;  3DYO A;  1BQP A;  2QQU A;  1JYC A;  3N9O A;  5L9B A;  1WBL A;  1XXN A;  2JDN A;  4IE0 A;  4R9B A;  1PO2 1;  4QX2 A;  5GLV A;  4CDU C;  1AR7 3;  3E6D A;  4DRV A;  4K1Z A;  1GWL A;  1RUC 3;  1VRH 1;  3PIJ A;  4GMP 1;  5FZ4 A;  2LW8 A;  1UPI A;  3V0A A;  5F2W A;  3UT0 A;  1W6Q A;  4KBZ A;  1JN2 P;  3VBU B;  4MYE A;  4KWU A;  3CQO A;  4P5Y A;  1KFU L;  5K4L A;  3NVC A;  5IWF A;  4MOA A;  5JVV A;  1ST8 A;  1DBN A;  4AOC A;  1PHM A;  4NN0 A;  1Q8V A;  3AZZ A;  2W46 A;  3D3A A;  4FVV A;  4Z07 A;  5ABJ A;  4YW7 A;  4MUV A;  5BNN A;  5LW9 A;  4B4R A;  1WLC A;  1QJX 1;  3I2K A;  5FZI A;  3ES4 A;  2ID4 A;  2ZPX A;  4Q0P A;  1MQT C;  1ULG A;  4IV1 C;  2PA7 A;  3ST7 A;  2XHK A;  1UD1 A;  2CDP A;  2VMI A;  2IXI A;  3HJR A;  2WNO A;  3MW2 A;  3ZKY A;  3N7L A;  3RZH A;  1I3H A;  3HQU A;  4AW7 A;  5JI9 A;  1HQW A;  3HVD A;  4A7Y A;  5ISL A;  4IQP A;  4JTO A;  1ZRR A;  3P3N A;  3T09 A;  3WDX A;  5EIY B;  3VBH C;  2OUH A;  1V9U 2;  1BBT 2;  2XML A;  1UWW A;  5A7Q A;  1RED A;  4CCN A;  2BTV C;  3BN6 A;  3I54 A;  5FOB B;  1AR8 2;  5FRA A;  4XUN A;  3V65 A;  5HXV A;  3ZN6 B;  2XJS A;  3ZYG A;  3AJY A;  3KD4 A;  4FQ4 A;  4EWD A;  5JPM B;  1W9F A;  5F5A A;  1R09 1;  2D3S A;  4MHU A;  4QDQ A;  3MO4 A;  4CDW C;  3BTA A;  3J9S A;  4LO4 B;  3VHP A;  2AAC A;  2I45 A;  2Q4S A;  4CCD A;  5A3M A;  3O1U A;  4QHO A;  1PVC 3;  1G9F A;  2EID A;  3M8L A;  3N9Q A;  3VDC A;  1LU2 A;  5F39 A;  5SV5 A;  4AHX A;  4CXX A;  2H6B A;  4LO7 A;  5ANQ A;  3B02 A;  3SEE A;  1ZBE 3;  2F4P A;  5FPV A;  1HRV 1;  3THD A;  3VB9 A;  4AI8 A;  2BFU L;  2LRP A;  3KF5 A;  4QB6 A;  1DZR A;  2WFP A;  3VV1 A;  3WIN E;  5HCF A;  2R0H A;  2Y6J A;  1CAW B;  4HVQ A;  2JE7 A;  4QGL A;  4XF3 A;  5FP4 A;  4H3W A;  3NNF A;  5F3E A;  3P3P A;  1BYH A;  2FMY A;  3TWI A;  1KJL A;  4IE4 A;  3H8X A;  2HLE A;  3QH6 A;  5FYH A;  1R08 2;  2A70 A;  2FDJ A;  3SHR A;  2ZEY A;  1KS4 A;  1B35 C;  2WO3 A;  4AED A;  4GMP 3;  1GWK A;  1RUG 3;  1M06 G;  2E33 A;  4N43 B;  1C4R A;  5C4W B;  4RS5 B;  3HNM A;  4XMA A;  3H50 A;  1G9A A;  2RM2 1;  1I9R A;  4K20 A;  1H0B A;  5IAT A;  1EV1 3;  3ZFF C;  3NJZ A;  1SBE A;  3FJS A;  2XBO 3;  3GZA A;  4Q4W 1;  2R04 2;  3C2U A;  4PHZ A;  1C1F A;  2DF7 A;  3KCC A;  5FLJ A;  2GN3 A;  1Q56 A;  4CEY B;  2ZGT A;  5T50 A;  1RJ7 A;  5IK4 A;  3P5B A;  5A7N A;  3UL2 A;  2VZV A;  5JI7 A;  1KIT A;  3QH7 A;  3LB9 A;  3PL0 A;  3LSD A;  4BOW A;  2VMF A;  3I3B A;  1A6C A;  5CFC A;  4AQT A;  5FK7 A;  1RUI 3;  1OKQ A;  2VZU A;  4QQ2 A;  1OLR A;  1SPP B;  2D5F A;  3WG1 A;  3RRD A;  1KDK A;  5JR2 A;  1MVQ A;  3AL5 A;  5HPO A;  4P5H A;  1UZW A;  1ZYB A;  4LA2 A;  5CAZ A;  1QQP 3;  4AVA A;  1PZ8 A;  2X09 A;  3T4H B;  2CY6 A;  2ARC A;  3ZFF B;  2ATF A;  4E2S A;  4GWJ A;  3V64 A;  1UW8 A;  1O6U A;  2HEW F;  4CDU B;  2PN5 A;  3RGB A;  5IJR A;  2YU2 A;  2ZCW A;  5D8A C;  4AHY A;  1JHN A;  4HT1 T;  1YIF A;  2VOT A;  3VDA A;  2YHJ A;  3T2P A;  5L9V A;  1JZ2 A;  4R4Z A;  1U0A A;  3B9I A;  4S2D A;  1NAE A;  1QXP A;  2QQV A;  4NRQ A;  4LBM A;  1KJR A;  2WZ8 A;  2HWF 3;  3DGT A;  2DVA A;  1PNG A;  5FTT C;  4AFA A;  2Y6F A;  4AVT A;  1JXN A;  4JGY B;  1O4Z A;  1XSR A;  4OI4 A;  3CZJ A;  4CU6 A;  3M70 A;  4FPF A;  1ZBA 1;  3FUO A;  1ZBE 2;  5JIA A;  4FQZ A;  3USS A;  3WNM A;  2QQM A;  4BHP A;  1AHS A;  1UU5 A;  4JCK A;  4M01 A;  2BPA 2;  1W6N A;  4GZ9 A;  3NNG A;  3IMM A;  1NQD A;  3KT1 A;  2GMM A;  1Y9M A;  2GC3 A;  3ACL A;  3ZFE B;  4JDO A;  2XWB B;  2VY0 A;  3KGZ A;  3BB6 A;  1OXC A;  3WG4 A;  1F4A A;  4DUW A;  2DTW A;  3MV1 1;  4QQH A;  2J1A A;  2H0B A;  2FCU A;  5H9R A;  1R08 3;  4LKD A;  4BB3 A;  3VN4 A;  3I2D A;  2Y0O A;  3WNK A;  2VVD A;  1C5I A;  3MIF A;  2DWR A;  5FWE A;  3AZW A;  3NV4 A;  4BM8 A;  1HB2 A;  2VZQ A;  5GZF A;  4H7L A;  1XPW A;  2J1R A;  2JD9 A;  2OX0 A;  2WL1 A;  5GZD A;  2QVS B;  2A1X A;  3C3V A;  3OSD A;  4ZXE A;  1ENX A;  5H9P A;  3JQX A;  2YXS A;  4TTG A;  3ZO0 B;  2E9Q A;  5HCA A;  2W2I A;  5EXO A;  1MS0 A;  2HEV F;  4FPH A;  4NWV A;  3V0B A;  3W20 A;  3VDD B;  5JWP A;  2ZOE B;  1ND2 C;  1RUI 1;  3OY8 A;  2DCT A;  1UY1 A;  4GMP 0;  1W6Q B;  1OUR A;  5DUW A;  1HRI 3;  5G05 L;  5I8S A;  1RUH 3;  1G9D A;  1UOB A;  1YQ8 A;  4WM7 C;  4DUV A;  1BMV 2;  1W9Y A;  4MSV A;  2D6O X;  3J7N A;  4NUB A;  4XJ9 A;  3VKF C;  2DBN A;  4EWE A;  2ZGN A;  1WMD A;  4GJY A;  4CSW A;  4LOT A;  2A7A A;  4Z2A A;  4FO9 A;  1FI2 A;  5IYY A;  2GZW A;  4FT8 A;  5JXJ A;  2ZKN A;  4M3C A;  3A23 A;  3IDB B;  2BNO A;  1HN1 A;  1UO9 A;  4E2G A;  1NXM A;  2ZGP A;  1CX4 A;  1NOV A;  2I07 B;  2B45 X;  3KLS A;  1SBF A;  3K51 A;  1HW5 A;  5A1F A;  4N90 A;  2XHN A;  3NMB A;  1VBD 3;  4O7X A;  4AZZ A;  2ZAH A;  2UU8 A;  4XUO A;  3TEX A;  1R1A 3;  1FOD 1;  1TMF 2;  3NST A;  4Q26 A;  4OQ9 A;  5J36 A;  3W5M A;  4W4Z A;  1X9T A;  2HBT A;  3H8U A;  2A5Z A;  1PGL 2;  2BBV A;  5C3S A;  3AC0 A;  3WY6 A;  4URA A;  2R06 2;  4LIV A;  2BER A;  4CP9 A;  5LBF A;  3UJQ A;  1DFQ A;  4I02 A;  2NN8 A;  2EAL A;  3IKW A;  1W6M A;  1MS9 A;  2GNB A;  4BQ5 A;  3VD9 A;  4IE5 A;  4CDX B;  1Y43 B;  5J96 B;  1GQG A;  2PHT A;  3ZYB A;  3WF3 A;  4HET A;  1TME 3;  3M7A A;  1Z7S 1;  1EPW A;  2VW0 A;  1CIY A;  2GC1 A;  4K40 A;  4B4P A;  4YG6 A;  4CUC A;  1PK6 A;  3H8O A;  3I3M A;  1ULF A;  4GJZ A;  4Y20 A;  3MPB A;  4FP2 A;  5LRR A;  4FAH A;  1STM A;  1IS5 A;  1QOO A;  4NWW A;  4CEW B;  4M3C B;  4CA9 A;  2FDG A;  5H9Q A;  1BCX A;  2W95 A;  4WVM A;  1S0E A;  3U78 A;  4LTA A;  2WZR 3;  4ZZ8 A;  4LMF A;  1UY2 A;  1YUD A;  3BOP A;  5C3Q A;  2VZ1 A;  3J7M A;  5T54 A;  1H8T A;  5JCT A;  1DQ1 A;  4J25 A;  2MPF A;  5C70 A;  4PCR A;  2C9A A;  1I5P A;  4Q4Y 1;  4V2V A;  3OY8 B;  4IEP A;  4KH9 A;  1CES A;  2CNA A;  2JDA A;  3ZXA C;  4CDW A;  2K2S A;  2JX9 A;  4OI2 A;  1XE8 A;  5DDJ 1;  4OI1 A;  3BKZ A;  2PHX A;  1UZZ A;  4R4X A;  1J3P A;  1C8N A;  4K3U A;  1SLI A;  4DXZ A;  1D2Q A;  2OPK A;  4LBQ A;  3LGR A;  1ZBA 2;  4XUT A;  5FYM A;  4FOY A;  4GH4 B;  4XBQ A;  5FYU A;  1H8V A;  1GP5 A;  1VPH A;  1G6N A;  1NA1 B;  2VMH A;  3ZXD A;  1MS1 A;  4J6G A;  1H9W A;  1PM7 A;  4AF9 A;  1W2U A;  1SZB A;  1LOC A;  3E1F 1;  5FR3 A;  3U0Z A;  2Y6G A;  2VEC A;  3MI8 A;  3MLL A;  4MXW A;  4EN8 B;  3POI A;  3KZ4 C;  1MAC A;  2W87 A;  4JAA A;  4O61 A;  4TXW A;  2HWF 2;  2MNG A;  3GZU C;  3HIF A;  2WT0 A;  3MEP A;  3WCR A;  5FYZ A;  3OPT A;  4Y24 A;  4LBN A;  2VMD A;  2BVV A;  3D8C A;  4COZ A;  5CFC C;  3OD0 A;  4LO5 B;  5DG1 A;  3D0S A;  4E8C A;  1CAU A;  1H6Y A;  2VVF A;  4BQ4 A;  2VOK A;  4PDW A;  3KB5 A;  1LRH A;  4DEV A;  2HYX A;  5FKC A;  1O3T A;  5FPU A;  1PK6 C;  3U37 A;  5FO9 B;  1LOG A;  1I1E A;  3A4U A;  2P3J A;  2QQI A;  2VTX A;  2HWD 1;  5C71 A;  1K42 A;  3POF A;  3NWK A;  1OD5 A;  2RS3 1;  4KI5 M;  1JU3 A;  2JKB A;  2BVB A;  4PIX A;  3N9L A;  3ZYP A;  2G19 A;  2J1S A;  1ULO A;  1NA1 C;  1V6J A;  1VBA 1;  3SMH A;  3WHU A;  1UOG A;  3CU7 A;  3M3Q A;  3UKV A;  1ONA A;  4Q0Q A;  3FLR A;  5FY4 A;  3VHR A;  3CKH A;  4FOQ A;  4HKL A;  1DLL A;  1ZVF A;  3WF4 A;  4EZ4 A;  2UWC A;  1XU1 A;  5K0U B;  1D0H A;  4CYD A;  5FP7 A;  1B35 A;  3LQC A;  3LEK A;  3VZO A;  4D7S A;  4MGK E;  4DB5 A;  4FCA A;  5DAV A;  2QZ2 A;  5J3U A;  2NPI A;  2WSU A;  3RYP A;  3SH4 A;  1PIV 2;  4P02 B;  2HWE 1;  2RDR A;  3K2O A;  3MIE A;  2JD4 A;  2QJV A;  3RMX A;  4NAM A;  2XOM A;  4QPY A;  4YZ3 A;  4ASK A;  1Y9G A;  2VTF A;  5DUU A;  1E5R A;  1NG0 A;  4BCU A;  4BQY A;  5GZG A;  5CG8 A;  1COV 2;  5I0D A;  3EB7 A;  1Q3E A;  1EP0 A;  2OYZ A;  3ILF A;  3J8F 2;  1LEC A;  1IHM A;  1S2K A;  3PJQ A;  5D21 A;  3WZ1 A;  3O1R A;  2RM2 2;  1IGO A;  1BMV 1;  2ZZJ A;  5B4X A;  2PHU A;  3AVS A;  3PU8 A;  2V5Y A;  4QKD A;  3GNE A;  3R05 A;  1ZA4 A;  2WNE A;  3SKJ E;  4CDQ A;  1Z78 A;  3S30 A;  1FV2 A;  4RFT 0;  3TRS B;  4PBO A;  5FYB A;  5AC9 2;  1U5Z A;  2FHR A;  1RVF 3;  2W1U A;  1OD3 A;  5FUI A;  3ROU A;  1C1L A;  3RDI A;  5KWR A;  3U4S A;  4LHL A;  3HBK A;  5LA2 A;  1AR9 2;  4C0B A;  4E8D A;  5A32 A;  2R1D A;  3POS A;  4AI1 A;  1J1L A;  3RMY A;  4CU7 A;  1XC6 A;  2JE9 A;  3WNN A;  2FZ2 A;  4OFG A;  1QJU 2;  3O5S A;  1EPZ A;  1DGR A;  1MQT A;  1PO1 2;  3K46 A;  4JZR A;  2CAU A;  3I2G A;  4YVW C;  2YB7 A;  4D6S A;  4HSJ A;  3ON7 A;  2ZKL A;  5C7G A;  2AZ5 A;  2K9Z A;  1H8T C;  2PAK A;  4KWL A;  1X8E A;  3LDR A;  4GUL A;  1BEV 1;  4LLO A;  5T5L A;  2C5D A;  2DBI A;  2YPJ A;  4UW4 A;  1W9W A;  3AKR A;  1UAI A;  3FBY A;  2AEN A;  2MEV 1;  5FJH A;  2XPJ A;  2Y38 A;  5T55 A;  4LHS A;  4NPL A;  4FPL A;  1A78 A;  1W0N A;  4YGD A;  1V6L A;  2VE1 A;  2DUQ A;  2VZ3 A;  4XUP A;  4X8N A;  1LCL A;  2ZS6 B;  3ZDS A;  4IEQ A;  2VQA A;  4MGY E;  3AYA A;  3RJ2 X;  2E7T A;  2J1V A;  4ASM B;  4LPL A;  3O1V A;  3UES A;  2JKX A;  4E4S A;  1JOD A;  4QPW A;  1YQ6 A;  3T0D A;  3KHB A;  1WD3 A;  1NY7 1;  4Q5O A;  1DYK A;  5BXX A;  4DOU A;  4MGI E;  3ATG A;  4B7E A;  4XDP A;  5KHH A;  4Q8L A;  2XJP A;  1W8Z A;  4GB3 1;  1W0P A;  4PF1 A;  3C7E A;  2HJI A;  1ZBE 1;  2QQO A;  1POV 0;  4QAW A;  1HQL A;  1UZV A;  5GAL A;  1W2A X;  2R0F A;  3JUU A;  3LA7 A;  2QKD A;  1LOF A;  2MHF A;  1YJK A;  3J7L A;  5A33 A;  4QXB A;  4AFD A;  4ET7 A;  3C7F A;  1F8V A;  1V9U 1;  5BNN B;  3IDA A;  1WW6 A;  3HMY A;  5HV4 A;  3AMH A;  3MFA A;  3F95 A;  3IZO A;  1AR8 1;  3HQX A;  1ZNP A;  4FFF A;  4KGG A;  5BNO B;  2BRT A;  1DGL A;  4P9J A;  4YFW A;  4RGK A;  1V6O A;  1GP6 A;  3VUO A;  1F5J A;  5DUX A;  4CCL A;  4CCM A;  2GH2 A;  4IV3 C;  2NLR A;  3GCX A;  1L7L A;  1CAV A;  2FDK A;  2XXZ A;  1AX2 A;  1EV1 1;  2ZHN A;  4HON A;  4BLI A;  4C1W A;  4XJ8 A;  4CDW B;  5LK7 B;  1CGP A;  5CIR A;  4YM1 A;  4Q4W 3;  4AI2 A;  2R1B A;  2XDV A;  2XL7 A;  1CAU B;  2LM3 A;  3ZFG C;  1FPN 1;  4RHV 1;  1GUI A;  1D2S A;  2RMU 1;  3T0A A;  3WP6 A;  2FBE A;  3NV2 A;  5DAP A;  4EZH A;  4MX3 A;  3DPR A;  2ET1 A;  3TBD A;  3QBQ A;  1IS6 A;  2JWP A;  3ASI A;  5CIS A;  1US3 A;  4D69 A;  4DQA A;  3OBR A;  1UKR A;  1ND2 A;  2D5H A;  1AYN 2;  3W59 A;  1IOA A;  2OQ6 A;  5T5O A;  4W8J A;  1GR3 A;  4OUM A;  4QHB A;  2WLP A;  2D6N A;  1W6P A;  2VBP A;  2VW1 A;  3QLQ A;  5JXI A;  1IG0 A;  2XUM A;  4XTM A;  4LO8 A;  3ME2 A;  3CLP A;  2ZBJ A;  3AKP A;  5FYT A;  1Z0H A;  3VGI A;  3MV0 1;  1NKG A;  3AFK A;  2GP3 A;  2YZ4 A;  4MXV A;  3ZSJ A;  3CDZ B;  1SLL A;  5FZO A;  1IPK A;  1YEW A;  2VPV A;  3N7J A;  4OUE A;  5TSW A;  4JGZ C;  4BH9 A;  1KQR A;  4H7M A;  2JG9 C;  3ZIW A;  4IEO A;  3OBZ A;  2HWB 3;  3KCY A;  4AI9 A;  2IVI B;  3A7Q A;  4O65 A;  1QIQ A;  1XE0 A;  3P6B A;  2ZTN A;  4RS5 A;  3WXP A;  5FLH A;  3O0V A;  4BE3 A;  4XUQ A;  3RZJ A;  3MUY 1;  1Q43 A;  2VNO A;  2WO2 A;  2ZX1 A;  4BIS A;  4D6R A;  5FZ7 A;  5FXZ A;  1VAV A;  1F35 A;  4NRO A;  2JDY A;  1VBD 1;  1QJX 3;  2Z5W A;  2RS1 2;  4RQP C;  4KMQ A;  5KC5 A;  4UT5 A;  2QQN A;  4RL7 A;  2R6Q A;  3GHN A;  3NO8 A;  4GKY A;  1CAW A;  4LUK A;  4Q1P A;  4CUG A;  5A33 B;  4AQ2 A;  2HH9 A;  1DZT A;  3CJI C;  3ZXF A;  4CCE A;  4AVC A;  1BVP 1;  3OEA A;  2WQ4 A;  1WW5 A;  2EIC A;  5KR7 A;  2A3X A;  4P9W A;  4OHZ A;  4A41 A;  4AVS A;  3U11 A;  1WA4 A;  4M4P A;  1WZX A;  5D8A A;  3T30 A;  3VBU C;  3WQ7 A;  1US2 A;  4N43 C;  3VBU A;  5BY5 A;  3WCS A;  1C28 A;  1HLC A;  2D7F A;  2SBA A;  1ENR A;  3DUI A;  3FBM A;  3I2I A;  1ZZC A;  4WM8 A;  2VQ0 A;  5FYC A;  5LK5 A;  1BEV 2;  5T52 A;  1W6O B;  4L97 A;  3T08 A;  3WNX A;  5K9Y A;  3NL1 A;  2QQP A;  1O3S A;  4LUL A;  1RUG 2;  2P34 A;  5F1R A;  5JOY A;  1DLC A;  1O5L A;  3KVB A;  3WF0 A;  4QGN A;  2DDU A;  5LAT A;  5IT6 A;  1O3R A;  4KU8 A;  1LJ7 A;  2BYV E;  2ZZQ A;  3TNQ A;  4CEY C;  5IVJ A;  3AP7 A;  4KBB A;  3GJB A;  4C1X A;  4H2A A;  2WZR 1;  4JHZ A;  1BXH A;  3JBG 1;  2ZHM A;  1E5H A;  2HBU A;  5ACA 1;  2OII A;  2XJU A;  4FPK A;  5ERL A;  1CX1 A;  5FK8 A;  2BDR A;  1OT5 A;  2Y26 A;  2W1W A;  2WA4 A;  2JG9 A;  1NUK A;  5DPN A;  2R07 1;  4Y33 A;  1G9C A;  4ZKT B;  4BPZ A;  4X8P A;  4FXG B;  4I0W B;  3RFR A;  5C9A C;  2E7Q A;  4MGZ E;  5EQU A;  4D6Q A;  1EYB A;  4DNY A;  2DVB A;  1SDD B;  4K9S A;  1UYP A;  2I2S A;  2FQP A;  5GKA C;  3ELN A;  4QPI B;  1H1A A;  4MO3 M;  2GNM A;  1QMJ A;  3KHC A;  1X82 A;  3IBM A;  2P17 A;  4XAE A;  3AMP A;  5C3O A;  3U4X A;  1NY7 2;  3I7D A;  4Y26 A;  2E26 A;  2KA3 A;  1CAX B;  4FFI A;  4Y5S A;  3UKN A;  5I0R A;  1WMF A;  3TN9 1;  4CPB A;  3S57 A;  2VAU A;  1V6I A;  2WYS A;  2ZMN A;  3WOG A;  2VZR A;  5FZ0 A;  1EUU A;  4ATF A;  2UWB A;  1W28 A;  1QJU 3;  2NM1 A;  2P37 A;  3UYJ A;  4ATE A;  4DXS A;  2GH8 A;  1AL2 1;  1OOP C;  1SLA A;  3NJX A;  4DPN A;  3JD7 1;  2DCJ A;  1OLQ A;  1TVG A;  1ZZ6 A;  4IEZ A;  4XAC A;  3CHX A;  4NIH A;  3TEZ A;  3LAG A;  3WEZ A;  3MIB A;  3S6P A;  5A6Y A;  3HWJ A;  4RYD A;  2WQ8 A;  1AYN 1;  4YW2 A;  3M1H A;  5FUN A;  4ITC A;  1LTE A;  4AK3 A;  1DG6 A;  4G4F A;  4DMI A;  4B7K A;  4HL0 A;  3GF6 A;  1DQ2 A;  1NZI A;  2BGO A;  1RUE 1;  5IVY A;  3SIS A;  3G6J B;  1NX9 A;  4RD7 A;  1UMZ A;  4MHR A;  5LY2 A;  5I93 A;  5C9A B;  4HFS A;  2P1B A;  4FTE A;  4HKW A;  3OOX A;  2P4E A;  2CGO A;  1S55 A;  3GBF A;  3SIT A;  4EN7 B;  4PLM A;  1YXW A;  5KHJ A;  2O8Q A;  3PDQ A; 
#chains in the Genus database with same CATH homology
 4QX0 A;  2ZEZ A;  3VD4 A;  4OMC A;  3III A;  3W5N A;  1PX3 A;  3CZJ A;  4CU6 A;  2VR4 A;  2BZD A;  2QQM A;  2VMC A;  3LE0 A;  3UET A;  4GZ9 A;  2Y6L A;  1W8O A;  2VL4 A;  3NNG A;  2V5D A;  4JKL A;  3MUZ 1;  2XQX A;  2DCK A;  1UZ0 A;  2W47 A;  1F4A A;  4QX1 A;  4DUW A;  3MV1 1;  3DYP A;  2J1A A;  2YC2 A;  2PQS A;  2W1Q A;  3WNK A;  3I3E A;  1W99 A;  2LS6 A;  2VZQ A;  4W50 A;  1XPW A;  2J1R A;  2JD9 A;  1XNA A;  1JYX A;  4ZXE A;  3C7H A;  3I2H A;  3LEI A;  1K3I A;  4BK5 A;  3F2Z A;  4QB2 A;  5DMY A;  1F4H A;  5LCW L;  3SEP A;  1UY1 A;  3WF2 A;  1CZS A;  3VD7 A;  5G04 L;  3WNP A;  4MGQ A;  5G05 L;  1XNT A;  5EJZ B;  4A44 A;  1JZ8 A;  5LA1 A;  1DP0 A;  3HNB M;  4DUV A;  3WSO A;  1JZ6 A;  1K45 A;  1O59 A;  1UXZ A;  2W92 A;  3JXS A;  4Z2A A;  1OH4 A;  5IYY A;  5JXJ A;  3A23 A;  1EUT A;  1UX7 A;  1HN1 A;  2J7M A;  2Y6H A;  5DN2 A;  5DQ0 A;  2BGP A;  4A3Z A;  2XHN A;  3IB3 A;  4A42 A;  3WQB A;  4DUX A;  1DYO A;  4XUO A;  1UY4 A;  4ZZ5 A;  3W5M A;  4W4Z A;  3OEB A;  2VCC A;  5IFP A;  3AC0 A;  2B4K A;  2BER A;  2WDB A;  3GGL A;  5J1X A;  1JU4 A;  1UY0 A;  3VD9 A;  3IAQ A;  2Z4F A;  5IHR A;  3K4D A;  4A6O A;  3WF3 A;  1GQP A;  2VCA A;  2R7E B;  1CIY A;  2QQL A;  2E32 A;  1GMM A;  4CUC A;  3A21 A;  2ZEX A;  1PMH X;  3ACG A;  3K75 B;  2W95 A;  2VJX A;  4D8M A;  4ZZ8 A;  1GOG A;  1UY2 A;  1J83 A;  2VZ1 A;  5C70 A;  2WO1 A;  3VDB A;  3HNY M;  2EIE A;  1I5P A;  2VM9 A;  3THC A;  2JDA A;  3CZU A;  3T2Q A;  4YPJ A;  4PT6 A;  4AAX A;  1CZT A;  4IUG A;  1UYZ A;  2YFU A;  5IFT A;  2L9L A;  3GXU A;  4QX3 A;  4XUT A;  4XVH A;  1TG7 A;  3VD3 A;  4CUB A;  4DEQ A;  3E1F 1;  4MGS A;  2VME A;  2Y6G A;  2VZS A;  3PUI A;  4QDS A;  4TXW A;  2W87 A;  2CDO A;  2RV9 A;  2VMD A;  3OGV A;  4E8C A;  1H6Y A;  5EJ1 B;  1KEX A;  3WNM A;  3OBA A;  4ARY A;  4DEV A;  2HYX A;  5JUV A;  2VCB A;  2YG0 A;  1PMJ X;  3FHA A;  3U37 A;  2VZT A;  2QQI A;  2ORZ A;  5C71 A;  1K42 A;  4LKS A;  3HEI A;  4KI5 M;  1JU3 A;  4A45 A;  2J1S A;  1ULO A;  2ORX A;  4A4A A;  1SG3 A;  4UI9 L;  3WF4 A;  3CKH A;  3P1I A;  1W8N A;  3OB8 A;  4PQQ A;  3LQC A;  1UYX A;  2WAA A;  2W91 A;  3LEK A;  2C9K A;  4DXT A;  2W9X A;  4JKK A;  4TTG A;  1W9T A;  1JZ5 A;  4P02 B;  4QDR A;  2WZE A;  1SHW B;  4JKM A;  2XOM A;  3NJV A;  1P8J A;  2VTF A;  1RYY A;  2V4V A;  2BBA A;  1T2X A;  3C7G A;  3HPN A;  2X05 A;  5I0D A;  3ACH A;  3EB7 A;  3HN3 A;  5B4X A;  3SKJ E;  4L0P A;  1BHG A;  4CU9 A;  3OGS A;  4CU8 A;  3ETP A;  1KGY A;  2W1U A;  1OD3 A;  3DYM A;  2YFZ A;  5FUI A;  2RJ2 A;  2WN2 A;  4ARX A;  1JZ3 A;  1IQD C;  3ABZ A;  4XUR A;  4LQR A;  5LA2 A;  4E8D A;  3I2F A;  1JI6 A;  5CZK A;  3ZM8 A;  4CU7 A;  4D0Q A;  1XC6 A;  2V72 A;  3WNN A;  2QQK A;  4FI9 A;  3IAP A;  3CIH A;  1K12 A;  3K46 A;  2WAO A;  3I2G A;  3ECQ A;  2YB7 A;  3I2J A;  3EYP A;  3GM8 A;  5C7G A;  1UXX X;  1CZV A;  4OZO A;  1W9W A;  3T2O A;  4AG4 A;  3LPF A;  3BGA A;  4LHS A;  3CMG A;  1W0N A;  3PUH A;  1GNY A;  2QQJ A;  2VZ3 A;  2QBX A;  4XUP A;  4BJ0 A;  4OYU A;  4OMD A;  3ACI A;  3SKV A;  2J1V A;  4LPL A;  3UES A;  2JKX A;  2KD7 A;  4QPW A;  3T0D A;  1JHJ A;  2XON A;  2JE8 A;  3I97 A;  4PF1 A;  3C7E A;  4M4R A;  2VZP A;  2QQO A;  4QAW A;  2VQT A;  1MPX A;  4UOJ A;  2W5F A;  2OKX A;  5B4N A;  4ET7 A;  3C7F A;  1W9S A;  2WAB A;  3IDA A;  3NRU A;  1JZ7 A;  1O8P A;  1R64 A;  5JXH A;  3DEC A;  3WNO A;  4P00 B;  4ZY9 A;  3T0B A;  3WF1 A;  3OG2 A;  3A22 A;  1GOF A;  3WNL A;  1JYN A;  4HG6 B;  5CYY A;  2E31 A;  1L7R A;  2C4X A;  3MBW A;  1GUI A;  3FHQ A;  3T0A A;  2YC4 A;  1US3 A;  1H6X A;  1JYW A;  4W8J A;  1O8S A;  2J1E A;  5JXI A;  3FN9 A;  1UMI A;  5JMO A;  3DYO A;  5LA0 A;  3J7H A;  4UAP A;  3MV0 1;  1NKG A;  4QX2 A;  2J22 A;  3CDZ B;  2Y6K A;  4OUE A;  2LW8 A;  3A7Q A;  4KWU A;  3CQO A;  4P5Y A;  3P6B A;  1LNS A;  2WUH A;  4MOA A;  2X10 A;  2WBK A;  4XUQ A;  3MUY 1;  2WO2 A;  2W46 A;  3D3A A;  4BDV B;  2Y8K A;  3K4A A;  3UNP A;  3I2K A;  4KMQ A;  2ID4 A;  2QQN A;  5A1A A;  3C8X A;  2VQU A;  2CDP A;  3HJR A;  5F7U A;  3OEA A;  2EIC A;  4QB1 A;  2J1U A;  4A41 A;  5EIY B;  5JXG A;  3T09 A;  4M4P A;  1US2 A;  1UWW A;  4CVU A;  3BN6 A;  3I2I A;  4BK4 A;  5HXM A;  3I3D A;  4XUN A;  3T08 A;  3GDB A;  4P08 A;  4QDQ A;  1DLC A;  3MO4 A;  1L7Q A;  3WF0 A;  1JYV A;  2DDU A;  2EID A;  1UY3 A;  3VDC A;  1WCQ A;  3SEE A;  3THD A;  2ZXQ A;  4JHZ A;  1OF4 A;  4GWI A;  4QB6 A;  2WN3 A;  1CX1 A;  1UMH A;  2Y6J A;  1OT5 A;  4RN5 A;  2W1W A;  1NUK A;  1WKY A;  5DPN A;  2HLE A;  4XZU G;  2ZEY A;  2VZO A;  2WO3 A;  1D7P M;  3FL7 A;  2E33 A;  1J84 A;  1SDD B;  3HNM A;  1OF3 A;  4MO3 M;  4CUA A;  3ACF A;  1JZ4 A;  2E26 A;  2RVA A;  4DXR A;  2WYS A;  1GU3 A;  2EIB A;  3NQH A;  2VZR A;  3HOB A;  3C7O A;  1EUU A;  2Y64 A;  2VZV A;  2VMF A;  2ZEW A;  3I3B A;  1YQ2 A;  4DXS A;  3LEG A;  3NJX A;  4BXS V;  3LPG A;  2VZU A;  2DCJ A;  1TVG A;  2VO5 A;  1UYY A;  3WEZ A;  2B9V A;  5JR2 A;  4RYD A;  2WQ8 A;  3VD5 A;  5HPO A;  2X09 A;  4JX0 A;  3K77 A;  4MAD A;  4GWJ A;  3K4Z A;  2C26 A;  2W1S A;  1GOH A;  2BGO A;  3OGR A;  1ULP A;  5IJR A;  1NX9 A;  1PX4 A;  2VOT A;  3VDA A;  2VC9 A;  3T2P A;  1JZ2 A;  2W94 A;  1NAE A;  2J1T A;  2W3J A;  2WZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...