5DZEA

Crystal structure of the catalytic nucleophile mutant of vveg16 in complex with cellotetraose
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
199
structure length
199
Chain Sequence
EAQPLKFIAVDYCPESCTHSPESSTITLTFDHRGGSRWRSTTRFQYGTFSSLIQCPKGNTSGLNFNIYLSSLEGDKSQDAIDFEFLGKDKRIVQTNYYTAGTGNREAIHDLGFDCSDGFHEYVIKWGPDLIQWLIDGKVIRSVRADGEGFPQKPMFLYASVWDASYIDEGRWTGPYVGCDAPYICLYKNVNVPVGTAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords endo-glucanase
publication title Crystallographic insight into the evolutionary origins of xyloglucan endotransglycosylases and endohydrolases.
pubmed doi rcsb
source organism Vitis vinifera
molecule tags Hydrolase
total genus 47
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5dzeA00
5EXOA 3WLUA 3M3OA 4YM0A 3AP7A 3AYEA 3SNMA 3B9CA 3B69A 3OBTA 4K20A 1IS3A 1WD3A 2YROA 5FREA 1G9DA 4LBJA 2DU0A 2WQZC 5GALA 2FHRA 4DRVA 1DHKB 1N3OA 3HN1A 3R05A 3V64A 1SCRA 1QMJA 4ITCA 2R16A 1LULA 3QLQA 1WCSA 2ENRA 1V00A 2R0HA 1VAVA 1HDKA 3ZSLA 3FFZA 2Z42A 2GDFA 2P3IA 3B3QE 4XXPA 1KJRA 1MS8A 1YYNA 5DG2A 3RRDA 3PVNA 3M3CA 2JECA 3WCRA 1GZ9A 1V6NA 1URXA 2PHXA 5LK5A 1FNYA 2YZ4A 1SLCA 3O0XA 1W6OB 3AX4A 1Q8PA 2ARXA 2WJSA 3FLTA 1N47A 4YG3A 1HKDA 4BMBA 1SBDA 4GXLA 2JE7A 1F5FA 2R0FA 4XXAA 5GZFA 1RIRA 1KJLA 1UMZA 3AYAA 3ILNA 2R49A 1SBFA 3INAA 1N1VA 4YZ4A 2V73A 1NLSA 3M1HA 4UW5A 1DBNA 1R1ZA 3WG1A 4ASMB 2A75A 5E8AA 1B09A 1FYUA 4ISQA 3RG0A 3R4UA 4CTEA 1LEDA 4BLIA 4XDQA 4YGBA 4XTMA 3HR9A 2A6VA 1ENRA 4XIKA 2R1DA 4M3CF 4Y1UA 3V0AB 4F83A 2W68A 1HQWA 4ZKTB 4FPFA 2DUQA 3M3EA 4YZ1A 2NM1A 1AVBA 3O0VA 5SV8A 2WSUA 4ATEA 2CNAA 2ZGLA 3ILRA 3ZPYA 1U0AA 3AP4A 4D69A 2ZHKA 2DURA 2CTVA 2XG3A 1JOJA 1BKZA 4M3CB 1JHNA 2EALA 2WNEA 3A0NA 3VV1A 2VY0A 4YZ2A 3IKWA 1MZ6A 5KXDA 3POSA 3AZXA 5DZEA 2EXJA 1WLWA 4BOWA 2PELA 3LCPA 4OZXA 2NN8A 1N1TA 3ATGA 1GZWA 1LGBA 1SLAA 4JC1A 1G9BA 1LU2A 2DVAA 2SBAA 2ZGUA 3VKFC 1WW7A 1LHOA 5JOZA 3AJYA 5DUWA 3U4XA 1DQ5A 4ZXKA 1GKBA 3T1MA 5JOYA 4YGEA 1C1LA 2CYFA 3O5SA 1CQ9A 3FLRA 3PVEA 3V65A 1FATA 2W52A 4LBMA 3AZVA 3GALA 1BXHA 3WG2A 3C2UA 5KXCA 3AZZA 2A7AA 1G8WA 2WSVA 3B00A 4XBNA 1SBEA 3WZ1A 3JU9A 4XJWA 1S0CA 3AP5A 1FX5A 4XIOA 1LHWA 1I1EA 1A3KA 3WG4A 2E7QA 2CY6A 4U36A 1W6QB 4YGCA 4DQAA 2ZMNA 1CR7A 4YLZA 3ENRA 4YG6A 5GLUA 4XBLA 1SACA 2ZGSA 4YZ5A 2VH9A 4UW4A 5IUQA 2YXSA 3RS6A 2PHWA 5DXDA 3AJZA 3ZYPA 3SH4A 3I4IA 4FPKA 1VLNA 5T5PA 1PZ9A 3VKMA 1AX2A 4AVSA 1O4ZA 1BZWA 4FP2A 4XJZA 1QDCA 4FOQA 1FAYA 2UURA 1YIFA 2NP0A 2E53A 4YW5A 2LALA 1G9FA 1DQ1A 3ZSJA 1ENQA 3AFKA 4C1XA 1G86A 2GNDA 3WCSA 2D3PA 4FP3A 2ZGQA 1LOFC 1WD4A 2NMNA 5H9RA 1QOOA 5T5OA 1PZ7A 3OYWA 3IPVA 2WKKA 1IS4A 1DQ0A 2ZAAA 1AXZA 5CA6A 1GZWB 2ZHMA 3L2YA 2DYCA 1UZZA 1JBCA 2ARBA 3IN9A 2D44A 2P2KA 2UWAA 3WV6A 1V6JA 4K21A 2GMPA 2ERFA 2YY1A 3SITA 3TB0A 4XHXA 3MPPG 3M3QA 1CPMA 2ZHNA 1UAIA 1YO8A 4RA0A 3N7JA 4WVWA 2AR6A 3OPZA 3MEPA 4AWDA 5CNAA 4XHBA 2ZACA 2GN3A 1W6MA 4AGRA 3USUB 1Q8QA 4Z8BA 2D6MA 1UZYA 2VXRA 1C57A 1DYKA 3BTAA 2EXHA 3AYDA 4FOWA 4Y1XA 5DUVA 4FPOB 4BPZA 5GZDA 3ZXKA 1IKQA 2DTWA 3VKOA 3AYCA 2ES3A 4P9WA 1VALA 4UW6A 4K1YA 3OY8A 1QF3A 2UU8A 1ULDA 4Y24A 4WVVA 1Q8OA 3QCWA 1QDOA 2UWCA 4YFWA 3WDWA 2JE9A 2DVFA 4LBQD 1N1SA 1ULFA 1GYKA 1S0EA 2YMZA 5GLZA 3AZYA 5FRAA 5GZGA 5DUUA 1FV3A 3V0BA 3POWA 1QNYA 1ZM1A 3WDVA 2A3XA 5HCAA 1KRIA 5T5JA 1G9AA 1G7YA 1ULGA 4GKYA 5T54A 5BYNA 1LHNA 3OYWB 3WUCA 2AH2A 3IPVB 4AVTA 2WT1A 3UJOA 1AXYA 3BIWE 4GKXA 3WHUA 4LBQA 4HL0A 4ISRA 4R9DA 4DFSA 3PVOA 4XBQA 4FPHA 1LEMA 2ZGKA 3ZYRA 3T2TA 1W6PA 5KXEA 1MS0A 2PHRA 3AP6A 4YZ3A 4AGVA 3N7LA 4XYXA 1UX6A 4FQ4A 5GZEA 1LHUA 2E7TA 5IK7A 1C1FA 2JDZA 2PHTA 1CESA 2AREA 2BQPA 2EIGA 3WDYA 4BMEA 2ZMKA 3JUUA 4TZDA 3AXDA 5GLTA 1LOFA 1KDKA 1YRZA 2EF6A 3FBYA 5IK8A 5JOWA 1QOTA 2XB6C 4SLIA 3PJQA 2I2SA 1GLHA 3D6EA 2GALA 1W6NA 1LOCA 2CL2A 1LGCA 1QOSA 1WW6A 2DUOA 4NOTA 4FVVA 2CWMA 1IOAA 5GJ6A 5JOXA 3OY8B 2G4IA 1CJPA 1HLCA 3AK0A 1CONA 1IS5A 1YI7A 5T52A 1AX0A 1F31A 1GANA 1GICA 4GWMA 1DLLA 4FOVA 2ZGMA 5AVAA 4Q27A 1DQ4A 1N3QA 1S0IA 3MW4A 1BYHA 4P9YA 4AVVA 2DVBA 2PHUA 3BODA 5EYYA 4P9XA 4PBPA 4YW1A 1N1YA 5GLVA 5H9PA 5T55A 1ENSA 3AZWA 4Y1YA 4UW3A 4FPYA 1S1AA 1X50A 1JN2P 2A70A 2LTNA 3VKLA 1AXKA 1DQ2A 3DGTA 4YG0A 3WNXA 5JMCA 2ZGNA 2WT0A 3I8TA 2KM2A 3N36A 4MYEA 2VW1A 1MS9A 2GMEA 2ZA9A 1QU0A 4AGGA 1AJOA 1MS3A 3H0OA 1QNWA 2RHPA 1V6MA 1W0OA 2E51A 5F5QA 3RMXA 2A3WA 1V6LA 4YW2A 5HCBA 2ZGRA 1IKPA 4K1ZA 2ZGPA 4XTPA 2D7FA 3UK9A 1LOEA 1A78A 2ZABA 1RITA 1W6OA 2NYYA 1UPSA 4ATFA 5E89A 1LOBA 2YV8A 4FPLA 4Y20A 3SISA 2ZKNA 3W59A 1MZ5A 2AYHA 4P14A 1CVNA 5L73A 3ZXEA 2JKBA 4YM2A 3W58A 1KQRA 1WBLA 4KBBA 1Q56A 1CIWA 4GWNA 4Q8KA 4Q2FA 3OGGA 4FQZA 2SLIA 3ILFA 1Q8SA 1YXWA 2TEPA 5JDBA 2A6XA 5JLVA 5IK5A 4Y1VA 1W0PA 1UKGA 2ZZJA 1DGLA 4CZSA 2DV9A 3POYA 1KDMA 2DWRA 4XZPA 1SLBA 1NXD1 2D6PA 2H0BA 2A6WA 2GN7A 3GNEA 4XILA 4XE9A 2C5DA 1MS1A 1IS6A 2ZHLA 3OBRA 1O4YA 2A71A 1WW5A 3T1LA 3FLPA 3RSJA 3V0AA 4LBLA 1RINA 4R9CA 3RMYA 3MW2A 3WDUA 1SFYA 1MVQA 2ZGOA 1ZA4A 3N7KA 1APNA 3WUDA 5F9TA 3Q9OA 2HYKA 5T5LA 1MACA 3VUOA 2V5YA 4Q1RA 4BM8A 1WLDA 2D6LX 2WT2A 1H9PA 1HQLA 4M3CA 2P3JA 4M01A 5H9QA 1GNZA 3FUQA 1AJKA 4Y22A 3SH5A 2A6YA 4HANA 2OUHA 3SLIA 1GSLA 2GMMA 2FMDA 4XMIA 1LCLA 3R4SA 4PF5A 2W39A 4AYUA 3HMYA 2EXKA 1MR5A 3RQ0A 4DRRA 2DVDA 1G9CA 3NV1A 1LJ7A 2D6NA 3A4UA 1LOGA 1WUVA 1LODA 4I30A 1KITA 2W08A 5DZFA 1LECA 1SLIA 1WBFA 1JYCA 1AX1A 2VW2A 2ZBJA 1UN1A 4Y20B 4YW3A 5CAZA 3SH3A 2DUPA 5CBLA 4XMAA 1VAMA 1GBGA 2P3KA 4Y1ZA 3UL2A 3D4KA 3IM0A 3LSDA 5EWSA 1MVEA 1Z78A 2OUJA 2DVGA 4WZFA 4YM3A 4XJ9A 3D5OA 5GLWA 4NO4A 3ZVXA 1LHVA 1H9WA 1MS4A 1OFSA 1W6QA 4FOYA 3APBA 4FPEA 3WVJA 1D0HA 1DYPA 1LGNA 1V6IA 4JCKA 3ZXJA 1S0GA 1DZQA 1S0FA 2A5ZA 4IQPA 2AGSA 4PCRA 1OQ1A 2A3YA 4LBNA 1BQPA 4XJAA 5GZCA 2VU9A 4CRQA 1TEIA 1W6MB 3ZXLA 2VW0A 3KM5A 3O12A 3O0WA 2ZMLA 5GM0A 4FPCA 4FPGA 1JW6A 3B01A 4H55A 1LTEA 5JVVA 2UWBA 2VUAA 3NV3A 4Q26A 1GZCA 1F9KA 1C4RA 1MS5A 2A6ZA 2Q5TA 3WHTA 1ULEA 2P37A 2JD4A 4DPNA 1CPNA 1VIWB 3N7MA 3A0KA 4YGDA 2EXIA 2DTYA 5IT6A 4PBOA 4Y26A 5EYXA 4WV8A 3ZSKA 4Y22B 2D43A 2CWSA 1Z0HA 2NZ9A 5T50A 2D6KA 4LBKA 3N3HA 5KXBA 1JYIA 2EAKA 4M3CE 1DIWA 1H30A 2AENA 2DU1A 2OW4A 3V0BB 1D2SA 4Q1PA 4GA9A 2GNTA 5IK4A 3LSEA 4U2AA 1QGLA 1QKQA 1CN1A 1Q8VA 1Y7BA 1I3HA 3WOGA 3MW3A 4LBQB 3WDXA 4YFZA 3M2MA 1AF9A 5DZGA 5E88A 5DUXA 3UJQA 5HCFA 1W6PB 2C9AA 1A8DA 4XOGA 3KQRA 3CNAA 2PHFA 1FV2A 1GNHA 1N3PA 1S0JA 2GNBA 2R1BA 3WDTA 4Q8LA 1AZDA 1LESA 1ULCA 4DS0A 4RL7A 2P34A 3USUA 3PMEA 4YW4A 3ASIA 2E6VA 1BJQA 4W65A 1WLCA 1LOAA 3FUOA 4M00A 3IMNA 4FPJA 1PZ8A 1S0BA 2JJ6A 1DQ6A 2D3SA 3AP9A 5H9SA 2OVUA 3N35A 3NWKA 2D3RA 4BQ1A 2GNMA 3BOPA 4R9BA 2D6OX 2AUYA 4LBOA 1DFQA 1JUIA 1J1TA 1SLLA 1SCSA 1W6NB 2B7YA 3NV2A 4GALA 1S0DA 3OJBA 1LU1A 4TYSA 4JRAA 4XJ8A 3NV4A 1LENA 1OKQA 1EPWA 4PQ9A 3AXEA 1V6OA 3ZSMA 4R9AA 1V6KA 1JXNA 2WLQA 3TAYA 4L8QA 1XQNA 4C1WA 2NMOA 5DG1A 5CB7A 3VKNA 1FNZA 1UL9A 1GV9A 1SLTA 1WW4A 4XJUA 1ONAA 4YM1A 3ZXFA 3DUIA 2ZGTA 4BLJA 3WG3A
chains in the Genus database with same CATH superfamily
2BBAA 4CPBD 3ON7A 5A7PA 3B9CA 3HN3A 2YROA 5A3LA 2XJRA 5DDJ3 4LBJA 1YQCA 5FV3A 3PUSA 2FHRA 2R071 1PO11 1W03A 4DRVA 3GDBA 1DHKB 1PK6A 3M4FA 3O14A 3HN1A 2Y6KA 1YLLA 4LT5A 3R05A 5FKBA 3V64A 1RUI2 2WABA 2R16A 5A32B 4EN8B 2W92A 4NHKA 1VAVA 4F7ZA 2P6HA 5L7OC 1UIKA 3H3ZA 1XXNA 1PO22 1Y43B 3K3OA 2IXKA 3WF0A 5DG2A 4M4RA 1SFPA 3HAGA 3M3CA 3WNKA 1V6NA 4HFSA 2GAUA 2W46A 5LK5A 1FNYA 1SLCA 1YQ6A 1XOYA 1QXJA 1J3RA 1Q8PA 4LUMA 2CAUA 1D4VB 4V2VA 1SBDA 3VBHB 1CIYA 1A34A 2R0FA 3ETQA 4AEDB 2DBIA 3JD72 5FP4A 3AYAA 4CUCA 1GQHA 3ILNA 2R49A 1H1IA 2VCMA 3X29B 4YZ4A 2WA4A 1W8NA 4QU1A 3VBOB 2VTXJ 1WCQA 2X5IC 5ANNA 2Z2SB 3M1HA 1OBNA 2JDMA 5E8AA 4I0AA 4Q0QA 4XDPA 2RM22 2B42B 3NAPC 3T4HB 2FD8A 1PIV2 1POQA 3EJKA 1ENRA 4M4PA 3E1F1 2R1DA 1G6NA 4NRPA 1ZRFA 1J3PA 4JKMA 3WNLA 1X9PA 1HQWA 4ORFA 1IPSA 1WA6X 4KBZA 5F7UA 5FYBA 1K5MC 2QNKA 3NO8A 1CAXB 1OVPA 5FY7A 5SV8A 2EA7A 2X10A 2ZGLA 3ILRA 1AR92 1BK0A 3QD6A 4QT6A 5FYSA 1UU5A 1YCIA 5CG9A 4D7TA 2PYTA 1RB8G 2XG3A 1DF0A 4UT5A 4AEJA 4W6XA 4AEKA 1NT0A 1QH6A 4XFHA 2XJPA 1MZ6A 1X82A 2LS6A 2FCVA 3AZXA 3POSA 4P9JA 5FUIA 4BOWA 4OZXA 1N1TA 3ATGA 1GZWA 3C7EA 4S2HA 3H1MA 2DVAA 2W95A 5FZ1A 1VE0A 3AJYA 3U4XA 4RR3A 3MIGA 3RJ2X 2YC4A 3M70A 4E8DA 3RZGA 2CYFA 1JZ2A 1CQ9A 5KHJA 3PVEA 1H2MA 1CAVB 3GALA 3KCXA 3I2JA 2C24A 4OQ9A 3WG2A 1O4TA 3AZZA 3FX3A 2A7AA 3H1WA 1XYPA 4XBNA 4KU8A 2G19A 4QKDA 4BH9A 1FX5A 2PLV2 1ND3A 3MUY1 3P3PA 2E7QA 1XE0A 2W1QA 4CDUA 1W6QB 2O8QA 3EB7A 5FO8B 2ZMNA 4GQ7A 2BWCA 4OHVA 5FZIA 4CDWA 4XBLA 4EWEA 5LA1A 2HWC1 4UW4A 1RUG3 1IPKA 3WX5A 3EXUA 1BVVA 3SH4A 5FZFA 3W5NA 3KHCA 2FDFA 1VLNA 1YFXA 4AVSA 1OF3A 4Q4W3 4RQPB 4LXLA 3V56A 3WF3A 1QDCA 1JMUB 4FOQA 1FAYA 3TEZA 2UURA 1W9FA 1WGPA 1XRUA 2E53A 1VB4A 2WFF1 1WMEA 3AFKA 4HSJA 3T3YA 4C1XA 2IXJA 4DZGA 1UOFA 2RS13 1PX3A 2GNDA 3JB4C 4S2FA 1BK1A 3ZFFC 1X8EA 1XNBA 1QJX3 2B5HA 3KLSA 2QCSB 5H9RA 5F3IA 3W20A 2Q1ZB 4ASLA 3IPVA 1YQ8A 3NW4A 2WKKA 4GMP0 5FZEA 4AI0A 1AXZA 3J4UH 3J8F2 3UNPA 2HWF2 4WM7A 3WQBA 3PDQA 3ZN4A 2D5HA 4Y5TA 2WQ4A 3RZZA 2WA3A 1RUG1 2YY1A 2E7AA 3RGBA 1U12A 5EQUA 5C5TA 3KB5A 3VKNA 1MEC3 4H7LA 1QWRA 1YO8A 4JTOA 5A3OA 3GHNA 1HIXA 2AR6A 3OBZA 4AEMA 2VZTA 4XHBA 1CAWA 2XXZA 2VVFA 4AI8A 3TRSB 4AGRA 2WWSA 4WM8A 5DAVA 5HI0A 1NUKA 5L7OB 1XPWA 2VXRA 2YU1A 2EXHA 3AYDA 4FOWA 4Y1XA 1QJX1 4BQYA 5KWRA 4BPZA 4MXWB 5GZDA 3HEIA 1UY4A 1RUH2 1JHJA 3AYCA 5ISLA 1XU2A 3L9JT 4K1YA 4COVA 1QF3A 4IEZA 2VNGA 1QJEA 4QQOA 1QH7A 2GSYA 3QCWA 4HVOA 4PLMA 4QGNA 1RUF1 2PHLA 1V9U3 1W8TA 2DVFA 1QJFA 1ASJ3 1S0EA 4Y33A 2J7MA 4XFIA 2XONA 2YFZA 4HOOA 3SEEA 3PIJA 3OUIA 1R082 1FV3A 5DUUA 3POWA 4GB33 1TNRA 1ZM1A 2JDYA 4D7SA 4QPIA 2YUEA 3U37A 4UFLA 3ZXDA 1W2TA 2X5IB 4HMZA 3PU8A 4BISA 5A7WA 1X33A 1GQGA 1DLCA 4AVTA 1RUOA 1AXYA 4OMDA 4LBQA 4LO7A 5EJ3A 3T0DA 2QTWB 1BLZA 1QJY2 1XNTA 2Y33A 3GHMA 3RYPA 3T2TA 4A7KA 3UESA 1W8WA 4XYXA 4FQ4A 4YSFA 3LEGA 1K5MB 5GZEA 4E4HA 2ZPXA 1C5IA 5DAWA 1GOHA 4BWOA 3VBRA 4QX3A 1CESA 1V9U1 4TZDA 1DGWX 3AXDA 1FMD1 1LOFA 1YRZA 2RS53 1COV3 5D8AA 5IK8A 1F4AA 4CCLA 5A6QA 1ZBA3 1QOTA 2XB6C 3DYPA 3LPGA 4SLIA 4X8PA 4UAPA 3PJQA 4CDQA 3NNGA 4JZRA 1GLHA 3D6EA 3IMMA 3VHNA 4AE2A 1LGCA 3ES4A 4NOTA 4FVVA 2CWMA 1IOAA 2ZCWA 5DPNA 3WR0A 1QJU1 3VZOA 1AR63 1OOPA 3AK0A 3J7NA 1IS5A 3F95A 4N8MA 2BTVC 4IXLA 1AX0A 3MIEA 3PU3A 1GICA 4GWMA 1DLLA 1VP6A 4FOVA 4NN0A 5AVAA 4FFGA 5BV6A 1S0IA 1N3QA 1PO12 2R072 2H6CA 3ECQA 3MW4A 3GGLA 4JTNA 4JGZA 2PHUA 1HV0A 1OLQA 2VMFA 1K42A 1N1YA 4AFDA 4E4DX 4LLOA 1BVP1 4IEVA 3FMGA 4UW3A 4D0QA 4QQHA 1NCQC 4RGKA 3ZYFA 2ET1A 5A3UA 2R042 1UQXA 3I3EA 1W9WA 4N9HA 1JN2P 1NLQA 5CIRA 2A70A 2LTNA 4L2NA 4A3XA 4E2GA 5FDBA 3DGTA 4YG0A 2CGOA 1XNKA 1OURA 2VW1A 3PTYA 2DBNA 2WO3A 5JI7A 3H0OA 4NIAA 4KGGA 5DABA 3KV5A 3S0MA 1O8SA 5FPXA 3HQRA 3POFA 3CZJA 1OPMA 3PURA 4AK3A 2VZUA 3H8OA 5J48A 4BDVB 3UK9A 3ZFFB 3HNMA 4Z2WA 4OUMA 5FCCA 1A78A 1RITA 2YDEA 2VOKA 2XLGA 4ZZ5A 4XURA 2YV8A 3SISA 3ZDVA 1UY0A 1MZ5A 1E5SA 2AYHA 5LK7B 3I2IA 1POV0 3CJXA 4YM2A 5T3NA 3HQUA 1CIWA 2CV6A 5LASA 4GWNA 3OGGA 1Q8SA 2VUDA 2W5FA 3AFGA 4N53C 5JDBA 2ARCA 5HXVA 3TEXA 5JLVA 4OQ8A 5LBCA 2ADEA 5EZWA 3TEWA 2JIJA 2WS91 3LE0A 5C71A 4AFBA 3LOBA 2VJXA 5FPAA 2ZS6B 4DUXA 3DYMA 1UYZA 2A6WA 2ATFA 4XILA 2JEMA 2ZHLA 3NRUA 1O4YA 1OPOA 2LROA 3ZFEC 1YJKA 3T1LA 3URFA 1PGL2 5CU1A 3WNMA 4QXCA 4LTAA 3KV6A 4LBLA 5LW9A 2ET7A 5F5IA 4OMCA 3FWEA 3RMYA 1SFYA 3W5MA 4UBHA 1ZA4A 4RS5A 5FP7A 3UKVA 1ZRRA 4OHWA 4B7KA 4QXHA 1APNA 5F9TA 3B94A 3VZMA 4B1MA 2BRTA 1PM7A 2D6LX 4PJYA 1JZ6A 3P6BA 5K4LA 4M0NA 4I2OA 2XQRA 3EBRA 4DXRA 3ABZA 2OZJA 3ZN6A 4HANA 1VRBA 2OUHA 3O1PA 3SLIA 1S2EA 4CA9A 2VZRA 3PNAA 4PF5A 3H8UA 4PI2A 1UY3A 3LD8A 5FZBA 3RQ0A 4LO5B 3NV1A 3THPA 5SV5A 1LECA 2VXJA 1PVXA 3CHXA 2VW2A 1JOBA 2ZBJA 4UF0A 4XAAA 5CBLA 4CUAA 4XMAA 4MO3M 2P3KA 3UL2A 3D4KA 4UXAA 3LSDA 2ZOEB 4NAMA 3P3NA 2OUJA 4WZFA 3D5OA 5D21A 1KFUL 3BTYA 1HV1A 2RV9A 4AW7A 5FMBA 4YYOA 1JU3A 5TSWA 5IWFA 3R6SA 3KF3A 1MS4A 1OFSA 4FOYA 1JZ8A 3RYRA 1REEA 3MYXA 3ALQA 2VCCA 2DFBA 4K6BA 2WFF2 1UZVA 3E97A 4IQPA 2A5ZA 4AHYA 4PCRA 1QXRA 5FKCA 1BQPA 1TEIA 3T2PA 5F5AA 4Y5SA 5F37A 3ZXLA 2HBUA 2HWE1 3O12A 3L2HA 1CWPA 4B1LA 4GWJA 4E4ZA 1A6CA 4B4RA 4H55A 4Q26A 1GZCA 1MS5A 4HPKA 4FTSA 2WBKA 4DPNA 1PMHX 5BXXA 1Q5OA 1RUG2 4YGDA 5HBAA 3OG2A 4HBNA 5F5CA 3OUJA 2CWSA 2HWB1 4QB1A 3WQ7A 3N3HA 3ZKUA 5KXBA 4Q4W2 2JDHA 5FZ6A 4M3CE 4JDNA 2AENA 5FPVA 2JIGA 3LPFA 2J1UA 3ROUA 3V0BB 2GNTA 3LSEA 1O3QA 1OHFA 2E32A 4MGZE 4P9GA 1I3HA 1D2QA 4H3WA 2RS12 4YFZA 1SPPB 5FY0A 1NCQB 1QJX2 3DKWA 3OSDA 1L7LA 3D82A 5EJ1B 5GKAC 4XOGA 1DZTA 1WMXA 4HETA 3VBSA 2R1BA 2VTXA 4O65A 1OD3A 1NZIA 5FMOS 3WNPA 4DS0A 4GZ9A 2VMHA 1UF2C 1CJDA 1YC61 2P34A 2W0XA 1ALYA 2OT7A 3FC0A 1BJQA 1GR3A 2BDRA 1OF4A 4IL7A 1LOAA 3FUOA 1LB2A 1K5JA 2KR2A 3OGSA 3NWKA 4NPRA 4TXWA 2XL9A 2RR13 3Q8EA 3VLBB 2Y6GA 2X53S 3ME2A 5HV0A 4LBOA 1BBT3 1NG0A 4QGLA 3RI9A 3ZYGA 1SLLA 1J83A 4TYSA 5C3SA 4N43A 3OJBA 4ZS3A 4AI1A 1QIQA 5M0TA 1V6OA 1JZ4A 4BIOA 2QZ3A 4Z1VA 3OD0A 4N53B 1EY2A 4L11A 4ZY9A 5L9RA 3UT0A 1UCXA 1OT5A 3U10A 2BBVA 2HLEA 2HEWF 1TME3 5A1FA 3VL9A 4IE6A 3VBUA 1ONAA 2QQUA 4RR3C 1V9U2 3SC7X 1UPIA 2ZGTA 4TWTA 4AL9A 5FQ0A 2FCUA 3VDDC 5FY5A 5IAVA 3IZOA 3K4DA 3ZFEB 4NR1A 5IHRA 4QQLA 4HG6B 1FMD2 3ELNA 4BA6A 1DG6A 2JDPA 3B69A 3OBTA 3SNMA 1XJAA 3LA3A 2WFPA 3W21A 1DYOA 5GALA 4XVHA 3PIGA 2R32A 2E26A 2RR11 3MLLA 3NSTA 3AB0A 1N3OA 2PLV1 2VE1A 3GCWA 3AL6A 2VZPA 2K46A 4L92A 3SQOA 1QMJA 4GJZA 4ITCA 1BBT1 3F2ZA 4OLLA 3U1XA 2ENRA 3UV9A 1ND3C 2QQLA 4LHKA 5I91A 3IWZA 3TN91 4CDUC 2JG9A 2LUWA 4BHPA 4XXPA 2WO7A 4OUSA 4LJHA 4CXXA 2RJ2A 1MS8A 1YYNA 3PVNA 3WCRA 1GZ9A 1Y9MA 1EV13 4KG8A 1OSGA 4OUEA 2RDQA 3ZR6A 1TG7A 2YZ4A 4IE0A 3O0XA 2BZDA 4AQ2A 1TME1 5APAA 2ARXA 2WJSA 1GMMA 4JHZA 3RZHA 1HKDA 2LRPA 1SEFA 4QX8A 5LY1A 2JE7A 1F5FA 2OYZA 4LKSA 2FDKA 5CZKA 1COV2 1KJLA 4MADA 1SBFA 3AMMA 2XVLA 2QFEA 1ZBA2 2ZX0A 1NLSA 4QM8A 2ZEZA 3THTA 3CEWA 1KGYA 3OPWA 3J8F1 1PVC3 2WC2A 4XPVA 4SBVA 1D7PM 4CVUA 3H8XA 3R4UA 3ZLIA 1LEDA 3MI8A 4YGBA 1SQ4A 4Y5Z0 1WCKA 1EAH3 5LA0A 3O1TA 2IZWA 4M3CF 4H7MA 2VPVA 3V0AB 2W68A 1EV11 5FZLA 2WNUA 4O7XA 4FPFA 1O5LA 3M3EA 4YZ1A 3A7QA 1VMFA 2NM1A 4XABA 3ZMOA 3E6CC 1ZRIA 4CP2A 4EWAA 2FDGA 3FHAA 4AF9A 3MF6A 2VECA 3VGIA 2ZHKA 3LEIA 4MGQA 5C9AC 2DURA 3NQHA 3AMQA 4NE9A 4C90A 5C33A 1JOJA 4ONUA 2O14A 1BKZA 3O1MA 1VBA3 2RE9A 4Q4Y3 4V1PA 1I6XA 2X05A 4IV1C 3BU7A 4XW3A 5CFDA 3ACGA 2VVDA 5KXDA 1QJZA 2OA2A 3WNNA 2B39A 1WLWA 3LCPA 4LO6B 3OBAA 3UKTA 1SLAA 4JC1A 1NOVA 2WS92 3JB8A 1CX4A 1H0BA 4B8EA 1LHOA 5JOZA 3OPTA 4BXSV 4K7JA 1QQP3 3M3IA 3T1MA 3UKNA 1HQNA 5JOYA 2OQ7A 3E5QA 5FY4A 1EAH1 1CZTA 4A44A 2ORXA 5KC6A 3LKJA 1R081 3TEYA 5FTTC 4CE8A 2WSVA 2ZJCA 2RMU3 5I0TA 1C8M1 1OQDA 3FJSA 3JU9A 1S0CA 3AP5A 3LDKA 4QPIC 4XJWA 5JPMB 4GWIA 3N9LA 1A3KA 1CZVA 4AVBA 4U36A 4DQAA 3MV01 4TSVA 3WNOA 4YZ5A 1QJY1 5FZCA 1VBA1 2FDJA 2XVKA 2ZGSA 1OLME 2GZWA 4Q4Y1 5LBFA 4F3JA 2YXSA 5DXDA 1EUUA 5A3MA 3E5XA 3AJZA 3KV9A 3I4IA 5T5PA 1PZ9A 1AYM1 3CQOA 5C3OA 1BZWA 4QHZA 5J36A 1O7FA 4XJZA 5C3PA 5IVJA 4NWVA 4XZUG 5FP3A 4JQTA 4CCJA 1FOD3 1QEXA 2LALA 4YW5A 2BGOA 3QH7A 3ZSJA 4Q4V1 4FCAA 2VCAA 2WL1A 5A6YA 1S55A 4LMFA 4FTEA 2BNOA 2PQQA 3FZ3A 2ZGQA 1LOFC 4J6GA 2IUWA 3J7MA 2VVEA 4AI2A 2V4AA 2Q1FA 5T5OA 1PZ7A 4IV3A 3KT1A 4ZXEA 5FZDA 5IVCA 1IS4A 3IIAA 3MGUA 4FFHA 1WMDA 4XF4A 2GC3A 5FLHA 3WW1A 1GZWB 3L2YA 4KNCA 1OA3A 1UZZA 5A7OA 5A33B 3IN9A 3BTZA 4IEOA 2D44A 4RR3B 3FFQA 4XQWA 5FZ3A 4LHNA 1OOPC 1U5IA 1H4GA 4K21A 3NNLA 3SITA 2VQ0A 4QQ2A 3VDDB 3VDCA 3WW3A 4JAAA 3Q8AA 2HWE2 1SG3A 4L99A 3RZMA 1UU4A 4CEWA 1KEXA 1UAIA 4LKFA 2QQWA 2VM9A 5B4XA 3C8XA 4NRMA 4RA0A 5C7GA 3N7JA 4COZA 3OCPA 4JGZC 3U0ZA 3MIBA 3NKTA 1FOD1 3N9OA 4IEWA 1ZREA 2GN3A 4TLGA 4P02B 4CU6A 1SFNA 1ND3B 1Z7S3 3USUB 4GIQA 4CDUB 2R041 2D6MA 4Z8BA 3IDEA 3AL5A 1CD3G 5DUVA 5C3RA 3KHBA 4FPOB 5KHGA 3C7GA 2DTWA 2HWB2 4FXGB 3ZN5A 3VZLA 2XWJB 1CZSA 2E33A 1VALA 4P9WA 4UW6A 1V0AA 2MHFA 2VZVA 3OY8A 1RMU1 2BVVA 4YW6A 2UU8A 1ULDA 1RUD3 3GZUC 4Y24A 4WVVA 2GC1A 4XCBA 2W9XA 1QDOA 4Q5OA 2UWCA 3KSCA 4RGAA 3CJIC 2VNVA 3WDWA 2JE9A 4BZ4A 4BQ4A 3KGZA 5JSPA 4I02A 2HJIA 1N1SA 1ULFA 1UYXA 5GLZA 2B9UA 1TE1B 5DDJ1 2B9VA 5AC93 5JR2A 1OLMA 2VMIA 3AZYA 1YQ2A 2A73B 2J42A 1DU3D 2R063 1GP6A 2ARAA 5HCAA 2J1RA 3H42B 5T5JA 1LNSA 1ZNPA 4LHSA 1NKGA 2QVSB 3IPVB 1O3RA 3FN9A 4JGYA 3K3NA 3B5LB 2B4KA 2W3JA 3HNBM 4QGMA 1Q3EA 1HB4A 4XUPA 1LEMA 1OC1A 2Z5WA 3AM2A 4IE4A 3I59A 4RFRB 1W6PA 4CEYA 5KXEA 2VNOA 1MS0A 2PHRA 3AP6A 3AVRA 1VBB3 2CGNA 4YZ3A 2D97A 3N7LA 1UX6A 1PNFA 2VOWA 1RUD1 2XKPA 4AHXA 3ZR5A 5IFPA 1I9RA 5L19A 1LAJA 2VR4A 3I97A 2AREA 2BQPA 5C9AB 2E63A 4LOTA 3RZJA 1PGL1 3JUUA 1Y9QA 3K4ZA 1WLTA 5L9VA 1CAWB 1REFA 1KDKA 2EF6A 2ZX3A 5AC91 4JRLA 1VBE3 2NLRA 4IV1B 4CU9A 1H6XA 5F2SA 2R061 5LA9A 5DAQA 2WO2A 4RS5C 3ETPA 3EMRA 2GALA 5JOXA 4ES9A 2EICA 1XNCA 4UFHA 4AXOA 1AYN3 1HLCA 1UWWA 2W91A 5FOJB 3NVCA 3PL0A 1YI7A 5FPBA 4UFKA 1F31A 4HLTA 1GANA 4MHRA 5FYZA 5JZGA 2WWUA 2XBO3 3JBG3 1UZWA 2ZGMA 1D4M3 4P9YA 1BYHA 2RR12 4LPLA 2OX0A 2DVBA 3DN7A 3HOBA 3K2OA 4PBPA 3LEKA 1BBT2 5GLVA 4QPIB 1W8UA 3FL7A 3TN92 5JSOA 5JXIA 5A7WB 4FPYA 3C7FA 2XOMA 1ODMA 1S4CA 1X50A 5FZ9A 2C9KA 3ZYBA 4AFAA 5I0SA 1W99A 2WN2A 3LEMA 4QWNA 2Q8OA 3VKLA 1AXKA 1DQ2A 2KM2A 3N36A 5BY5A 1GWKA 5BPXA 5JXHA 1TME2 2ZA9A 1QU0A 4AGGA 2VD7A 1AJOA 3POEA 4O9GA 3MIHA 1UO9A 1E5HA 2CDPA 4G9SB 3BGAA 3ORJA 4UFMA 2E51A 5F5QA 1AYN1 2HEYF 4W6WA 4W6YA 2BOIA 5FBJA 4YW2A 5HCBA 2VBBA 2ZGRA 4ARYA 2ZGPA 5FPLA 2XBO1 2BW8A 4BCUA 4GH4C 2VNRA 1OVSA 4NUBA 5FK8A 1UPSA 5E89A 4W4ZA 1H8VA 4Y20A 3W59A 4A2UA 3KF5A 1CVNA 4DIQA 4MV2A 1KQRA 4AEDA 3GZEA 4KBBA 1Q56A 4A7ZA 1VB2A 5ACA3 4GD4A 4LNVA 2SLIA 3NMBA 1BEV3 2VUCA 3ILFA 3I2FA 1OOPB 4LOSA 1EV12 1W0PA 1UKGA 4Q4X3 3BUCA 3KVBA 2CAVA 4Q4W1 4A3ZA 5LB6A 4R4XA 5LBEA 4PIXA 1SLBA 3H50A 5EFUA 2D6PA 2H0BA 1PM4A 2XMLA 2G1MA 4XE9A 4Y3OA 1IS6A 4EZHA 4JGZB 2CU5A 1OH4A 1GZTA 1WW5A 1F35A 2RS11 3RSJA 4OULA 5F3GA 4IGQA 5IAXA 4RGGA 5F6LB 2Y60A 4Y4YA 4CU7A 5FZOB 5A7SA 2H6BA 5LRRA 3WDUA 1CAXA 1STMA 3TWIA 2R7EB 3OF1A 3GJBA 4E2SA 4W50A 2WIIB 1JYIA 3C3VA 3VBSC 2D98A 2P3YA 2DF7A 5FIXA 4BB3A 4CCMA 3UETA 2WYSA 3VUOA 4Q1RA 3NJYA 4BM8A 2ZX4A 2P3JA 5JI9A 5H9QA 4LK6A 3CJIB 1EAH2 3MHZA 3OGRA 1BEV1 2YGLA 1MZFA 4XMIA 2FMDA 5CISA 1LCLA 1MEC1 3MV11 3BYWA 1MR5A 3IDAA 4DRRA 2QQVA 1VMHA 1C8M2 1LJ7A 1VMJA 1ZBE3 2WNVA 2XJTA 1LOGA 1MZEA 1WUVA 1LODA 1RUC3 4K3UA 4XDOA 3MFCA 5CVRA 5DZFA 5JSRA 1SLIA 3GZAA 1AX1A 2QQPA 3VBFC 1UN1A 1VBA2 4HKWA 2DUPA 1RUJ3 4N43C 4Q4Y2 1GBGA 2GU9A 3SH3A 4NROA 1KS5A 2FBEA 1ENXA 3WINE 2UYAA 4S2DA 5GLWA 2Q1MA 1AYM2 4NO4A 3WF2A 4QQPA 3VD5A 1W6QA 4I3GA 1QQP2 3APBA 3OGJA 4PDWC 1OD5A 3T0AA 1DYPA 4JCKA 2Y8KA 3WSOA 3WVJA 2G9GA 5FR3A 3ZXGA 1S0GA 1DZQA 2QBXA 2XDVA 4Q4V2 3NJXA 1ASJ1 1AUYA 3B7MA 4LBNA 4QM9A 5FOBB 5GZCA 5FBZA 2NPIA 1XE8A 1W6MB 3AC0A 4MVTA 3A22A 2VW0A 2CSGA 1W2NA 4GB31 1NQJA 4RQPA 2ZMLA 5GM0A 3N9QA 1PHMA 1JW6A 4NVPA 3B01A 3K4AA 4YWAA 2E9QA 4XC9A 2VZOA 1RUC1 5JVVA 1B35C 2UWBA 4INDA 4UWDA 2VUAA 4RS5B 4XUQA 4NIGA 1X7NA 2FDHA 4OZOA 1AL23 3GXUA 1CPNA 1RUJ1 4PT6A 1RGSA 3A0KA 4RSUA 1HB1A 2JG9C 4R8HA 4ZZ8A 5IT6A 4CUBA 3D8CA 5EYXA 2DCYA 3ZSKA 4A4AA 1KS4A 4HN1A 5T50A 3E6DA 2HYXA 1UX7A 2EAKA 1DIWA 1H30A 1RHI3 4IEXA 1D2SA 3WF4A 4AAPA 4CP9A 4FFFA 4NHMA 4U2AA 2KD7A 1FOD2 2F6BA 1P8JA 1SHWB 1Y7BA 1SDWA 2Q0AA 4AHWA 3WQ0A 2RS51 3MW3A 2RDNA 4BU2A 1COV1 2WZR3 5B2GB 1AF9A 1R1A3 1ZBA1 2RVAA 4UF0B 3A23A 2WAAA 1HRI3 5HCFA 5K0UC 4E27A 2Y6HA 5KHKA 2C9AA 4ZU7A 5LA2A 1S0JA 1N3PA 1RMU2 2GNBA 4MZUA 3WDTA 5HCHA 1GWLA 3KGLA 1AR83 3S6PA 1AR61 3J7HA 2XQXA 4YNIA 3ASIA 4KH9A 5L7OA 3ST7A 2QQIA 3RI8A 2W47A 4K8RB 2JG8C 1KFXL 4QX1A 3VZNA 4MXWA 5DDJ2 5LZ6A 2YU2A 4M00A 1HRV3 1OFNA 1UY1A 2D3SA 3AVSA 2OVUA 4GH4B 5AFEA 2GNMA 2F17A 3BOPA 4RYDA 4XUNA 3QACA 2OQ6A 2QJVA 1DFQA 2Y6JA 2EVXA 2PMWB 1W6NB 1SCSA 4GALA 2WLPA 1S0DA 5FYMA 1LU1A 1GWMA 1H1AA 3BPZA 4XJ8A 3NV4A 4I0WB 1EPWA 4HPKB 5JR7B 5FZMA 1AHSA 4AOCA 2BOJA 1NA1A 1R1A1 4KU7A 4YVSA 4FFIA 4C91A 1H6YA 4MHUA 2X5IA 4C1WA 5BNPC 2NMOA 5CB7A 3THDA 3JQWA 3SCFA 4JKLA 2QQKA 3OOXA 4MH0E 1GV9A 5FJKA 5FZ0A 2XR4A 3AMPA 1SLTA 1RUD2 3WP4A 3ZYJB 3POIA 3OB8A 1AR81 3POBA 2WYFA 2PAKA 2C26A 4YM1A 2Z4FA 1RVF3 3DUIA 3NAPA 4B3NA 3M3OA 5BNNA 4LA3A 2XHKA 3AYEA 5AC92 4K20A 1IGOA 5FREA 2RDSA 1G9DA 2R062 2VZQA 2WQZC 3I7DA 1O91A 1UW8A 2RS33 4Z82A 1FPN3 2JDKA 2OS2A 4META 4MUVA 3GBFA 2O8OA 3VBSB 5A1AA 2WRAA 1LULA 3QLQA 2DCJA 1WCSA 2BFUL 4JDOA 4AVCA 3ZSLA 4CPBA 2Z42A 3B3QE 1MQTC 1X9TA 3IB3A 4PLOA 2O1QA 3IDBB 4UI9L 4ZHNA 3BVCA 3HJRA 3RRDA 5DAXA 2WNOA 2VGDA 2Y38A 1JZ7A 2ZXQA 1VBB2 3TBDA 1JYXA 1UNBA 1URXA 1RUE3 2PHXA 1ZRDA 5ABJA 5E16A 2A1XA 5FLJA 2VC9A 1W6OB 2BV4A 3Q8BA 3K51A 3FLTA 4BMBA 1N47A 3CKHA 5I0DA 4OHXA 5FY1A 4KI5M 2MEV3 1RVF1 5FUNA 4IEUA 4AQ6A 2BP6A 3T2QA 3CL1A 4OI4A 5KR7A 4XXAA 1W9TA 5GZFA 3VBFB 1RIRA 3AKSA 3EHKA 4N43B 1UMZA 3INAA 1YUDA 2PHDA 1KD7A 3IBMA 3I3DA 1RXFA 3DF0A 3HNYM 3LF7A 2RS31 1ZVFA 3DKQA 4GULA 1ND2A 1F5JA 3WP5A 5JIUA 4UW5A 1DBNA 3WG1A 5CFCA 2O0OA 3WXPA 3Q8CA 3DXTA 4ISQA 3C7OA 5FZHA 2QQNA 3LDBA 4N7UA 4QAWA 4PDWB 3FHIB 4B29A 1RUI3 4CTEA 1AYN2 3OUHA 4XDQA 1IQAA 2A6VA 1IPJA 1IG3A 4J1XA 4NIHA 4NMIA 4Y1UA 1PO23 2XBO2 5FQ0B 4F83A 4KG0A 1RUE1 3KWVA 1UOBA 4XAEA 4QHOA 2DUQA 4ZKTB 1VRH3 4HKLA 2WSUA 4ATEA 1PK6C 1OQEA 2CNAA 4OVEA 3ZPYA 1U0AA 4D69A 1B35B 4NHLA 2VMDA 2MEV1 2CTVA 3CMGA 1H8TA 3WY6A 1ZA7A 1XNAA 4XUTA 4M3CB 1JHNA 3VD3A 3VV1A 2VQUA 1YFUA 1ZZ8A 4YZ2A 3IKWA 4GMP3 2JG9B 3CU7A 3JD73 5DZEA 5J3UA 1W0NA 4L97A 5LRSA 1OKOA 1NYWA 2ILMA 2ZGUA 3VKFC 1WW7A 2CHHA 2IC1A 4IEQA 5CKQA 3NJZA 5DUWA 4EN0A 1NE4A 3JQXA 4ZXKA 4NWWA 3U11A 3BOWA 4HT1T 1SDDB 4YGEA 5I8YA 4D7YA 5I8SA 4ARXA 4AFCA 2W52A 1RXGA 2YBPA 4EYUA 1L7RA 3AZVA 4J25A 4XFCA 4Q0SA 2LW8A 3C2UA 2Y34A 2VMCA 1CX1A 3WP6A 3B00A 1VRH1 2K9ZA 5K0UB 2JB8A 2VZ3A 5FPUA 1IG0A 4FT8A 3WZ1A 3RZLA 4X6QB 4XIOA 1I1EA 4ES8A 3WG4A 4JDMA 3MUZ1 3LGRA 2KXLA 2ZZQA 4YLZA 1DCSA 3ENRA 4JGYC 5ACA2 1SACA 1UMIA 2YBSA 1QXPA 1BEV2 2VH9A 2YB7A 4HVRA 4GMP1 5IUQA 3PUIA 2JG8B 3RS6A 1MEC2 2BNMA 5BNOA 1BCXA 3ZYPA 1ZX5A 2BWAA 1AX2A 5C3QA 5LEKA 4FP2A 1XSQA 3GBGA 2VTFA 1YNAA 2HWD3 4QX7A 1G9FA 1Q43A 4DO0A 3R0RA 4LHLA 1ENQA 5CEHA 5F1RA 1G86A 4PIYA 3H7JA 1O5UA 1H4HA 2NMNA 1WD4A 5E6HA 5LWBA 2VBPA 5I8TA 3OYWA 1YWKA 4XFAA 5F3EA 4BQXA 5BNPB 2WUHA 4LORA 5CA6A 1JYWA 2DYCA 1J84A 2ARBA 1ASJ2 4XF9A 3WV6A 1V6JA 3I54A 4PI0A 1GQPA 2MNGA 5KBFA 3TB0A 3ITQA 4TTGA 4OCTA 1QY4A 4XHXA 2QKDA 1VPHA 4GB32 5IJRA 1W06A 2NQYA 5FLIA 2Z69A 3N9MA 3RWKX 3OEBA 1RUC2 1YQ5A 1NZCA 4C0BA 3OPZA 4AWDA 3GYDA 5BNQA 2Y26A 4LLFA 1ZYBA 2ZACA 5CNAA 2VZ1A 3NNMA 4EE2A 2FCTA 1RUJ2 3SEPA 5FZGA 2QDNA 4CDWC 1UZYA 1DYKA 1MQTB 3BTAA 1JOPA 3LA2A 5G04L 5CG8A 1VBC3 3K77A 2OPWA 3J7LA 4LKDA 4XF3A 1IKQA 5C8CA 3AMHA 1W8FA 3ZYIB 1WZXA 1PX4A 3NL1A 3O1SA 1C28A 2WWJA 2JX9A 1NCRA 1S2BA 2HWF3 4N7IA 5DQ0A 2ID4A 4LBQD 3VD4A 2RS52 3ACHA 1GYKA 2YMZA 3UYJA 3J9SA 1PMJX 4NPLA 3V0BA 2D40A 3WDVA 4HZFA 4QPYA 5G05L 1KRIA 3I2DA 2YPDA 3SMHA 5T54A 5BYNA 1LHNA 5A3WA 4LK7A 2AH2A 2WT1A 2XLAA 4URTA 3BIWE 4GKXA 4WM7C 3WHUA 4BQWA 1IHMA 1AR62 4R9DA 1LR5A 4DFSA 1NCQA 5EPAA 2ZGKA 3T09A 5F2WA 2W94A 3ZYRA 1VBC1 3H9AA 3PLQA 4IUGA 3ZPOA 4YARA 3VN4A 1PMIA 2IXLA 4O9EA 4AGVA 1RUNA 2DCTA 2L9LA 2JICA 1PK6B 2EIDA 1C1FA 3PJYA 2AEYA 1S2KA 1UD1A 2EIGA 4LQRA 3VHPA 3VHRA 3WDYA 1O3TA 4BMEA 4WM8C 1HB3A 1R1A2 3PUAA 1H2LA 5CADA 2ZEXA 3AKRA 3FBYA 3ZM8A 1T2XA 4HK9A 4EN7B 4Q29A 1POV3 1ZZ7A 4D3WA 1PVC1 5IATA 1W2AX 4JX0A 4QHBA 4FBFA 2YGMA 3EO6A 4PLNA 2DUOA 1AR82 1QOSA 1WW6A 3D0SA 3KD4A 5GJ6A 2C4XA 3BALA 2BJSA 3ZKYA 3K46A 1R64A 3LAGA 3OY8B 3S30A 1CJPA 4UFJA 1CONA 2UY9A 3LFIA 3T4VA 5A7QA 5T52A 3C7HA 3MBWA 2MPFA 1HRV2 4P08A 3LB9A 4HVQA 3CO2A 4Q27A 1VJ2A 4AVVA 4D6SA 3BKZA 3IAPA 2F4LA 4YW1A 5FZKA 2WNVC 3H7YA 5FXWA 5H9PA 3GF6A 1ENSA 3PVBB 1HN1A 1W3XA 3AZWA 1F2NA 3KQ4B 3MLKA 3RDIA 3PUQA 5J1XA 2QE3A 3HVDA 2WQ8A 4DNYA 5IFTA 4JGYB 4D94A 5IVVA 3HPNA 5F6KA 4CCDA 4CXYA 4KWLA 5EP9A 2HEVF 1GNYA 3ZXAC 5JMCA 4HKOA 1POV1 2ZGNA 1GFF2 3I8TA 1GP5A 4UYBA 4MYEA 1UKRA 1QQP1 1MS9A 3TYJA 1NAEA 4DY5A 2TNFA 1GP4A 1MS3A 2UYBA 4LO8A 3LDRA 4NRQA 1RVF2 4YVWA 1QNWA 2RHPA 1V6MA 1W0OA 3RMXA 4QX2A 4COUA 2A3WA 1V6LA 4MGTA 2G9FA 4RD7A 1CGPA 4K1ZA 3KS7A 3DXUA 2BGPA 5FMCA 2YG0A 3JXSA 5D8AC 4NIDA 2RMU1 4NAOA 2RS32 1LKNA 5F8PA 3LOIA 3E5UA 1UMHA 3W9AA 4CDQC 4Z92B 5DN2A 1PO13 5C4WA 4FPLA 4CUGA 5J09A 1EP0A 1W39A 2ZAHA 3DL3A 2HH9A 4P14A 2XLFA 5L73A 1UOJA 4H2AA 4P5YA 2JKBA 3H3UA 3J26N 4WVMA 2Q8EA 3W58A 1EYBA 3HT2A 1E5RA 4IESA 4QB2A 5FXVA 4LULA 3BB6A 4FQZA 4Q2FA 1YXWA 2TEPA 2YYOA 1H1MA 2A6XA 4CDXA 1UIJA 5IK5A 1RUE2 1DGLA 4DXZA 2DV9A 4XZPA 1NXD1 3VL8A 2Y64A 1ZZ9A 2C5DA 4XQDA 2PAMA 4A6OA 4CCNA 2MEV2 2R30A 2X8KA 2A71A 4GJYA 3DYOA 3DECA 3V0AA 3PUHA 2HBTA 4CDWB 4A6SA 2BVBA 1L3JA 2G9ZA 4QKBA 1KXGA 3CLPA 4QPGA 3N7KA 1RL3A 1HX6A 5LY2A 3WUDA 1W28A 2V4VA 3Q9OA 4XF0A 5T5LA 4PHZA 4DINB 5C70A 4A41A 4DXSA 1H9PA 4R4ZA 3K48A 1GNZA 4IGOA 1AJKA 4Y22A 3FBMA 2AEZA 5KHHA 2XKOA 1GSLA 1R093 2JD9A 4Z07A 1ACCA 3R4SA 5FZ4A 2W39A 3I2OA 2VAUA 3HMYA 2VMEA 2EXKA 1VRH2 3S7IA 3ZFGA 5I0UA 2D6NA 3A4UA 4I30A 2W08A 1U5XA 1VAKA 2OPKA 1WBFA 4MXVA 1JYCA 5D1IA 1Z7S1 4Y20B 4WM7B 4CCKA 1O6UA 4Y1ZA 4V2WA 3DPRA 1HXS3 3IM0A 2K0GA 2WZ8A 1MVEA 5FZ7A 3I3QA 5FYCA 2DVGA 4YRDA 4YM3A 1NA1C 3HWJA 2Q30A 4YVSC 2DDUA 5FJHA 2JE8A 1I5PA 3ZVXA 2ETEA 5IVEA 4JQRA 3ES1A 4FPEA 1TNFA 1LGNA 2JKXA 3PHMA 1FT9A 4OYUA 4JVAA 5A1LA 2JDAA 2JWPA 3WP3A 2AGSA 1OQ1A 4XJAA 4LE3A 2XWBB 1RJ8A 4CRQA 1R091 5BNNC 4WM8B 3O1UA 3KM5A 3Q8FA 3D3AA 3O0WA 3I2KA 1EPZA 2EIBA 1CAUA 5FZ8A 4C0HA 4CCEA 4CXWA 2ORZA 3BIEA 3EYPA 4HK8A 1F9KA 2A6ZA 2IFRA 2Q5TA 3WHTA 3ZMNA 1ULEA 2GC2A 2P37A 2WZEA 1VIWB 3N7MA 3RNSA 1HXS1 2EXIA 1FI2A 3KV4A 1VBB1 2HWC3 4LO4B 4Y26A 4CYDA 4M0HA 3U14A 4PF1A 2D43A 5IVFA 1Z0HA 5FMDA 3P1IA 2D6KA 1JTZX 4LBKA 4XQ4A 4A45A 2Y0OA 2DU1A 2OW4A 5ABJC 4HN0A 4GA9A 2HWD2 4XUOA 1PGW1 5A33A 5L9BA 5IK4A 2WNVB 3VB9A 1QKQA 1UOGA 1CN1A 2PA7A 3BPSA 4COYA 4QX5A 3VDDA 1V70A 2WFF3 4LBQB 3WDXA 3ZDSA 1VBE1 4E9KA 5DZGA 3LA7A 4XEZA 5I93A 4KWUA 2QQJA 2OXBA 4COWA 1A8DA 3KQRA 2DCZA 3CNAA 4AG4A 1T6GC 1GNHA 4BXFA 5A32A 5JXJA 1ND2C 1ULCA 1ULPA 2VOTA 5FY9A 3UGGA 3FHQA 3USUA 5CFCC 5KC5A 4YW4A 5A3NA 4DUWA 3VBRB 4NJ4A 3WW2A 4XACA 4W65A 5ANQA 3A21A 3JBG1 3GCXA 5FXZA 5F3CA 1DDLA 1D4M1 3IMNA 2D5FA 1UU6A 3MIFA 1S0BA 2JJ6A 1DQ6A 5CKMA 5AVPA 3HBZA 5D8AB 3GBWA 5FYHA 3POGA 4R9BA 3VBHA 4CDQB 4QX0A 1UXZA 1JUIA 2D93A 4G3YC 3NV2A 4E2QA 1XB9A 1MPXA 4HSLA 5ERLA 1H8TC 4B4QA 4E4SA 1LENA 4PQ9A 3S7EA 3U75A 3VBOA 3LFMA 1VBC2 2BNNA 4R9AA 2ADDA 4YW7A 1V6KA 4EJRA 2WLQA 1ZZBA 1JH5A 2Y0IA 3HD8B 1O3SA 4IETA 5DG1A 2PTMA 2WN3A 1UL9A 2BEOA 3MF9A 4LUKA 3O1VA 1E5IA 1WW4A 2YHJA 3AKPA 4XJUA 3S5QA 2GH8A 2QDRA 3VD9A 3ZXFA 3NV3A 2BUKA 2FZ2A 4BLJA 3WG3A 5EXOA 4CP9B 1HJFA 1RUF3 3WLUA 3ZIXA 3PTRB 4D6QA 4Q0UA 1DP0A 4YM0A 3AP7A 1OLRA 1IS3A 1WD3A 2VQTA 3JZVA 3UGHA 5EIYB 2DU0A 2BPA2 3NJVA 2ZTNA 1W2OA 1PVC2 1AR73 2OIIA 1RTVA 3B93A 1SCRA 2TBVA 3ACLA 4XFFA 4TN7A 5C9AA 4UFIA 1V00A 3T30A 2R0HA 4EZ4A 1HDKA 4Q0VA 5ACA1 5C6CA 5JPNB 3FFZA 2GDFA 2P3IA 4IDZA 1IZ3A 2ZX2A 1KJRA 4IV1A 2PXJA 2YC2A 4Q4X1 5FYTA 4LKEA 3VD7A 2JECA 4AZZA 1DZRA 2FMYA 3RJRA 5C8WA 3GZTB 5BNOC 1NY71 2ZEYA 4DOUA 2B46X 4KGQA 2BYVE 1RJ7A 2VG9A 3R4DB 4I0BA 4AQTA 3AX4A 2VUJA 3RWNA 3H1YA 1F8VA 4YG3A 4P00B 1CAVA 4GXLA 1L7QA 4BE3A 4A42A 5J98B 3BN6A 2VQAA 3WD5A 3KZ4C 1C3HA 1LRHA 3BU0A 5IW0A 1J1LA 1N1VA 1FMD3 4LA2A 4XETA 2V73A 3RFRA 5A6ZA 1NA1B 1AR71 3KCYA 3MIDA 1XC6A 4KWKA 4YVSB 4R52A 1R1ZA 4ASMB 2A75A 2VZSA 1BMV2 1UZ0A 2I07B 1B09A 1FYUA 4X8NA 3IT8A 4XCAA 2EIEA 3RG0A 2CGPA 1JZ5A 1OH3A 3VBUC 4BLIA 2Z79A 3G6JB 1QJU3 2VOXA 5FFOC 1OXCA 4XTMA 1H2KA 3HR9A 5FZAA 3IAQA 4XIKA 5CKNA 1GOGA 2YFUA 3NAPB 1TQ5A 2RMU2 4UBGA 5BNNB 5B4NA 2PN5A 1ZBE1 2H0VA 3POJA 4EWDA 5K8SA 3O0VA 1AVBA 5FMOL 3LIHA 1W05A 1M06G 4JV4A 2YPJA 4MLOA 3AP4A 2PQSA 4KL1A 4OI2A 3ZOIA 4BYYA 4JHTA 1QHDA 2J1AA 2EALA 2WNEA 3A0NA 3DEMA 2VY0A 2X29A 2XGXA 4XFGA 4YPJA 1HB2A 3ZN6B 3ZYHA 4CCCA 5JAXA 2FDIA 2EXJA 2PELA 5L36A 2NN8A 1G9BA 1LGBA 5C8CC 1NLRA 1LU2A 2SBAA 5J37A 5EHDA 4H14A 4QB6A 2GP3A 2VMGA 1DQ5A 1J58A 4ZU5A 3SHRA 4BQ5A 1GKBA 4N90A 1VBD3 5ABJB 4ZPIA 5JXGA 5J96B 1C1LA 3O5SA 3FLRA 2F4PA 3V65A 3VHOA 3VZKA 1NCRC 1FATA 1JU4A 4LBMA 2KA3A 1BXHA 1W04A 2TUNA 1OUXA 4URAA 5KXCA 1Y9GA 4DY3A 1G8WA 4CCOA 1C8NA 1ZZCA 1SBEA 2XUEA 4X6RB 3MFAA 1PGSA 1LHWA 3ACIA 1YIPA 4OHZA 1ND2B 1YFYA 2CY6A 1AL21 3HT1A 1D0GA 4YGCA 4ET7A 5FWJA 3MZHA 4A7YA 1CR7A 1REDA 2HKXA 4YG6A 5CFCB 5FZOA 5GLUA 3D0JA 3I2GA 2PHWA 4MX3A 3N9PA 4LR4A 2WNUC 5IVYA 4FPKA 1RHI1 4ZONA 1XU1A 3VKMA 1WA4A 1O4ZA 4LE4A 1J59A 4Y4RA 5A6XA 2WS93 4RFT0 3OD4A 1UY2A 1VBD1 3KT4A 4ASKA 1YIFA 3CJIA 3I3MA 1Z7S2 3CIHA 5FAXA 2NP0A 1DQ1A 5FWEA 4Q0PA 2WZR1 4ZS2A 1WCDJ 1JUHA 2Y6FA 5IVBA 1JYNA 4LEJA 1H8TB 1HRI1 4EN6B 1YHFA 2D3PA 3WCSA 5CFDC 4I09A 4FP3A 4Z2AA 1QOOA 1YEWA 3N4MA 5FO9B 2P6CA 2QZ2A 1DQ0A 2V09A 1RC6A 2ZAAA 2IVJA 2ZHMA 3WW4A 3S57A 3SCGA 1JBCA 2IWGB 3JCIA 5A7NA 5JCTA 2P2KA 2UWAA 2PAEA 3UGFA 3LWCA 2XUMA 2GMPA 2RJKA 4FO9A 2ERFA 1R092 1EUTA 2ZKLA 2VCBA 1HRV1 4RN5A 3MPPG 1XE7A 1CPMA 1K5MA 2XJQA 3M3QA 3OEAA 1RYYA 1US3A 4FSJA 2ZHNA 4G4FA 4MGKE 2J1VA 4WVWA 4MGYE 2IVIB 2Y6LA 4QPWA 1DGWA 1W8ZA 3MEPA 5FPZA 4BK5A 3MO4A 1W6MA 4AAXA 1Q8QA 1HXS2 1C57A 4RHV3 4XF1A 4I3PA 2IFWA 4HONA 3ZXKA 2P4EA 1OA4A 4TLFA 3VKOA 2ES3A 3HIFA 4ZU4A 5BNOB 2JDUA 5I0RA 1HW5A 2XH6A 4PQQA 5JWPA 4E8CA 1PGW2 1GUIA 1Q8OA 1C5HA 1TMF3 4EN9B 4YFWA 4DEQA 4FTBA 5JMOA 4YVWC 2W1UA 4CU8A 1JI6A 2LM3A 1VBE2 2EAAA 4AQSA 1I5ZA 1U5YA 5FRAA 5GZGA 3T08A 1FPN1 2WZPP 2HWE3 1QNYA 3AKTA 2A3XA 3N9NA 4IV3C 4CP0A 5LATA 2XHNA 3U78A 1G9AA 4BIFA 1G7YA 1ULGA 1W9YA 2OKXA 4GKYA 2YC0A 1HN0A 4F8AA 3OYWB 4NHYA 3M7AA 3WUCA 5C4WC 3UJOA 2IXHA 4HL0A 4ISRA 3RVHA 1WKYA 3THCA 3WEZA 3VBUB 3PVOA 1SMVA 4XBQA 3P5BA 1XSRA 4FPHA 5E1RA 3VDAA 5FP9A 3JBG2 2HWC2 4RHV1 5FY8A 1D4M2 2XPJA 4OI0A 1W90A 4QD2A 2WAOA 4CDXC 4WZCA 4CEWC 2HWB3 2AACA 4KWJA 1JYVA 1LHUA 2E7TA 5IK7A 1TMF1 1U5ZA 2JDZA 2PHTA 3ZSEA 1AL0G 4D6RA 1DGRN 4WVZA 2ZMKA 3ZFFA 1OI6A 5GLTA 2FQPA 1W8OA 4GH4A 2CDOA 4AFMA 5JOWA 1OMIA 1J3QA 3H3LA 3O7OA 2XL7A 2I2SA 3MDPA 4IGPA 4W8JA 3IIIA 3GM8A 4QPGC 5C8CB 3CDZB 1W6NA 1LOCA 1TZOA 2CL2A 3DCQA 1RUI1 2C6SA 3O1OA 2Q8DA 1H2NA 2W1WA 2G4IA 2R6QA 4BK4A 2RM23 3BCWA 3G7DA 3OGVA 5FUPA 5A3TA 1PO21 2Q4SA 4QKFA 5FP8A 5BUVA 3QH6A 1PIV3 2J22A 1NCRB 5HPOA 4QXKA 3LZZA 5FYIA 3AKQA 1DQ4A 4L9BA 3SKJE 4J1WA 1F4HA 4FAHA 4IE5A 3ZFGC 2VO5A 1AR93 3BODA 4P9XA 4K9SA 5EYYA 5T55A 4FAGA 3VDBA 4OHYA 2VOVA 2X09A 4Y1YA 2GC0A 1BHGA 1S1AA 3KCCA 4EQVA 1W9SA 1NE6A 4XFBA 3JD71 1ODNA 3KVAA 4NPMA 4Q4X2 3O1RA 3TOJA 4CEYC 3DPRC 4BQ3A 4P9IA 3WNXA 1NY72 2BERA 4B4PA 4D8MA 2WNUB 2WT0A 2XJVA 4MSVA 1OA2A 1US2A 2GMEA 5JIAA 4CSWA 1W2UA 1W3VA 3LQCA 5IYYA 5A80A 1RUF2 1UXXX 1Y4WA 1T6BX 1X8MA 2QUOA 2RM21 5K7PA 1XNDA 1IKPA 1PIV1 4XTPA 1M4WA 2RG4A 2D7FA 4NHXA 3B02A 4KQ7A 1LOEA 3WF1A 4QU2A 5CFDB 4UOJA 3MICA 2K2SA 1AR72 1K45A 1W6OA 2NYYA 2W87A 2ZABA 4ATFA 4AVAA 4IEYA 1WMFA 2E31A 2P1BA 2N7GA 1AR91 1LOBA 4DB5A 3KT7A 1TVGA 3HBKA 2ZKNA 2PLV3 2YBKA 1XYNA 3ZXEA 1JZ3A 3I49A 2C1FA 2JENA 1K3IA 3VBFA 1WBLA 4EV0A 4MG2A 3TN93 4Q8KA 3RZKA 2W2IA 3MPBA 3E6BA 5FK7A 2V72A 4P5HA 3TNPB 5JZGC 4Y1VA 2ZZJA 4LIUA 1ZBE2 3SXWA 4CZSA 3DV8A 2QQMA 2J1EA 2VULA 3POYA 4QKNA 1KDMA 2DWRA 2HWD1 3BTXA 4PDWA 2I45A 2GN7A 2XJSA 3GNEA 4HXCA 1MS1A 3OBRA 3VZJA 3H8RA 1GOFA 2J1SA 4KMQA 5D2AA 3FLPA 1NX9A 3QBQA 3GJAA 2FZ1A 3I2HA 3MLJA 4EROA 4AHZA 1RINA 4R9CA 2VBDA 3MW2A 1MVQA 2ZGOA 4LITA 2P5BA 1E57A 1UYYA 5FYYA 5F32A 1B35A 3PMSA 2HYKA 1MACA 3EQEA 2V5YA 2IXIA 3J8F3 1WLDA 2WT2A 1HQLA 2I74A 4M3CA 4M01A 1NQDA 4AI3A 1QJU2 3FUQA 3SH5A 2A6YA 4YVWB 5DAPA 2DFCA 1F15A 2GMMA 4FI9A 4AYUA 2V5DA 1G9CA 3RYKA 5FO7B 5C5UA 2DVDA 4IEPA 5LEJA 2WR9A 2UY8A 4DUVA 1XBFA 2JXAA 4IV3B 1VR3A 1KITA 2JB4A 2PFWA 3B9IA 4FXKB 4MGIE 1WWYA 1AL22 2AC1A 3VBHC 1SPPA 4N9IA 4C8DA 5C4WB 4JKKA 5EJZB 5FYVA 3SCHA 4AEDC 4YW3A 5CAZA 1VAMA 4WVMB 4IERA 5EWSA 2ZEWA 1Z78A 2WINB 3VBOC 5K0UA 4K8FA 4XJ9A 1FXZA 4LIVA 1ST8A 1RHI2 1JS9A 1RUH3 2WO1A 5LBBA 4CDXB 5KHIA 1LHVA 3TNQA 4CEWB 1JODA 1H9WA 3SKVA 1D0HA 1VBD2 1V6IA 4NIIA 2HWF1 3ZXJA 3VBRC 1S0FA 2BFUS 2WZR2 2JG8A 2A3YA 4CP1A 3QOPA 4OI1A 2VU9A 2VL4A 1HRI2 3USSA 1R083 4FPCA 4FPGA 2JDNA 3U07A 4QMAA 3IDCB 1C8M3 1LTEA 4QPGB 2QQOA 1C4RA 2JD4A 1O8PA 1YJLA 4DEVA 4N53A 3KMHA 2AZ5A 1QJY3 3M8LA 4QDSA 2DTYA 4O61A 4PBOA 4IW3A 4WV8A 5A3PA 4QDQA 4Y22B 4OFGA 2NZ9A 5BNPA 1RUH1 2P17A 3LIGA 2XVGA 3ACFA 3NKGA 5HV4A 2B45X 3HQXA 1AYM3 1NXMA 4Q1PA 3BI3A 2XJUA 3ZFGB 3ZFEA 5J7MA 1QGLA 3CBNA 5K9YA 1IQDC 1Q8VA 5HXMA 1A8MA 3RPQA 3WOGA 2BU9A 1Y3TA 4Q4V3 4I01A 5FYUA 3T0BA 2C0ZA 3M2MA 4K40A 1UYPA 5E88A 5DUXA 3UJQA 5F39A 3I59B 3OTFA 1W6PB 1SZBA 2GH2A 3DPRB 2ZX1A 1YFWA 4CEYB 4MGSA 1JYTA 2PHFA 1FV2A 4S2GA 1BMV1 3S5AA 2RJLA 4Q8LA 1XYOA 1X36A 4DXTA 1AZDA 2Q8CA 5JUVA 1LESA 4GAZA 5A70A 4RL7A 4P9LA 3ZIWA 3PMEA 4AI9A 1GU3A 5LCWL 5EV7A 3ZX7A 2E6VA 1WCUA 4BJ0A 1MQTA 1O59A 1YI9A 3NNJA 1OUSA 1WLCA 2RDRA 4FPJA 4L0PA 1PZ8A 4QXBA 3WT3A 1FPN2 3AP9A 3FE5A 4MOAA 4RQPC 5H9SA 3N35A 2R073 2D3RA 2DCKA 4BQ1A 4B7EA 1DGRA 5DMYA 4WBBA 2WDBA 5FXXA 3U4SA 2D6OX 2AUYA 3I3BA 3CZUA 4QDRA 1CAUB 1J1TA 3T2OA 2B8MA 2B7YA 2IXCA 3ZO0B 2BGCA 4JRAA 2GP5A 1PNGA 1OKQA 2W1SA 1HJGA 3AXEA 4RHV2 2R043 3ZSMA 1JXNA 3TAYA 4L8QA 5AFBA 3K75B 2OZ6A 1XQNA 4IE7A 5JZGB 1ZRCA 1FNZA 1W8HA 4PIZA 3AMNA 3CF6E 1K12A 4AR2A 1ZZ6A 1RMU3 1TMF2 5CYYA 3WQ1A 1ULOA 3NNFA 2J1TA 4BQ2A 4DMIA
chains in the Genus database with same CATH topology
3B9CA 2YROA 5A3LA 2XJRA 5DDJ3 4LBJA 2FHRA 2R071 1PO11 4DRVA 1DHKB 1PK6A 3M4FA 3O14A 3HN1A 1YLLA 4LT5A 3R05A 3V64A 1RUI2 2R16A 5A32B 4EN8B 4NHKA 1VAVA 4F7ZA 5L7OC 1UIKA 3H3ZA 1XXNA 1PO22 1Y43B 2IXKA 5DG2A 3HAGA 3M3CA 1V6NA 4HFSA 2GAUA 5LK5A 1FNYA 1SLCA 1QXJA 1J3RA 1Q8PA 4LUMA 2CAUA 1D4VB 1SBDA 3VBHB 2R0FA 3ETQA 4AEDB 3JD72 3AYAA 1GQHA 3ILNA 2R49A 1H1IA 3X29B 4YZ4A 2WA4A 3VBOB 2X5IC 2Z2SB 3M1HA 5E8AA 4I0AA 4Q0QA 2RM22 2B42B 3NAPC 1PIV2 3EJKA 1ZRFA 1ENRA 2R1DA 1G6NA 1J3PA 1HQWA 4ORFA 1K5MC 2QNKA 3NO8A 1CAXB 5SV8A 2EA7A 2ZGLA 3ILRA 1AR92 3QD6A 4QT6A 1UU5A 1YCIA 5CG9A 4D7TA 2PYTA 1RB8G 2XG3A 1DF0A 4AEJA 4W6XA 4AEKA 1QH6A 4XFHA 2XJPA 1MZ6A 1X82A 3POSA 3AZXA 4P9JA 4BOWA 4OZXA 1N1TA 3ATGA 1GZWA 4S2HA 3H1MA 2DVAA 3AJYA 3U4XA 4RR3A 3MIGA 3RJ2X 3M70A 2CYFA 1CQ9A 5KHJA 3PVEA 1H2MA 1CAVB 3GALA 3KCXA 3WG2A 1O4TA 3AZZA 3FX3A 2A7AA 3H1WA 1XYPA 4XBNA 4KU8A 4BH9A 1FX5A 2PLV2 1ND3A 3P3PA 2E7QA 4CDUA 1W6QB 2O8QA 5FO8B 2ZMNA 4GQ7A 2BWCA 4OHVA 4CDWA 4XBLA 4EWEA 2HWC1 4UW4A 1RUG3 1IPKA 3WX5A 3EXUA 1BVVA 3SH4A 1VLNA 1YFXA 4AVSA 4Q4W3 4RQPB 3V56A 1QDCA 4FOQA 1FAYA 2UURA 1WGPA 1XRUA 2E53A 1VB4A 2WFF1 1WMEA 3AFKA 4HSJA 4C1XA 4DZGA 2IXJA 2RS13 3JB4C 4S2FA 2GNDA 1BK1A 3ZFFC 1X8EA 1XNBA 1QJX3 2B5HA 3KLSA 2QCSB 5H9RA 4ASLA 2Q1ZB 3IPVA 3NW4A 2WKKA 4GMP0 4AI0A 1AXZA 3J4UH 3J8F2 2HWF2 4WM7A 3ZN4A 2D5HA 2WQ4A 3RZZA 2WA3A 1RUG1 2YY1A 2E7AA 1U12A 3KB5A 1MEC3 4H7LA 1QWRA 1YO8A 4JTOA 3GHNA 1HIXA 2AR6A 4AEMA 4XHBA 4AI8A 1CAWA 2VVFA 3TRSB 4AGRA 2WWSA 4WM8A 5HI0A 5L7OB 2VXRA 2EXHA 3AYDA 4FOWA 4Y1XA 1QJX1 5KWRA 4BPZA 4MXWB 5GZDA 1RUH2 3AYCA 1XU2A 3L9JT 4K1YA 4COVA 1QF3A 4IEZA 2VNGA 4QQOA 1QH7A 2GSYA 3QCWA 4HVOA 4PLMA 4QGNA 1RUF1 2PHLA 1V9U3 2DVFA 1ASJ3 1S0EA 4XFIA 5DUUA 1R082 1FV3A 3POWA 4GB33 1TNRA 1ZM1A 4D7SA 4QPIA 2YUEA 3ZXDA 2X5IB 4HMZA 1X33A 1GQGA 4AVTA 1RUOA 1AXYA 4LBQA 4LO7A 5EJ3A 3GHMA 1QJY2 3RYPA 3T2TA 4A7KA 4XYXA 4FQ4A 4YSFA 5GZEA 1K5MB 2ZPXA 1C5IA 4BWOA 3VBRA 1CESA 1V9U1 4TZDA 1DGWX 3AXDA 1FMD1 1LOFA 1YRZA 2RS53 1COV3 5D8AA 5IK8A 1ZBA3 1QOTA 2XB6C 4SLIA 4X8PA 3PJQA 4CDQA 1GLHA 3D6EA 3VHNA 1LGCA 3ES4A 4NOTA 4FVVA 2CWMA 1IOAA 2ZCWA 3WR0A 1QJU1 3VZOA 1AR63 1OOPA 3AK0A 1IS5A 2BTVC 4IXLA 1AX0A 3MIEA 1GICA 4GWMA 1DLLA 1VP6A 4FOVA 4NN0A 5AVAA 5BV6A 1S0IA 1N3QA 1PO12 2R072 2H6CA 3ECQA 3MW4A 4JTNA 4JGZA 2PHUA 1HV0A 1OLQA 1N1YA 4AFDA 4E4DX 4LLOA 1BVP1 4IEVA 3FMGA 4UW3A 4QQHA 1NCQC 2ET1A 2R042 4N9HA 1JN2P 5CIRA 4E2GA 2A70A 2LTNA 4L2NA 4A3XA 5FDBA 3DGTA 4YG0A 2CGOA 1XNKA 2VW1A 3PTYA 5JI7A 3H0OA 4KGGA 3S0MA 5FPXA 1OPMA 4AK3A 5J48A 3UK9A 3ZFFB 4Z2WA 4OUMA 5FCCA 1A78A 1RITA 2YDEA 2VOKA 2XLGA 2YV8A 3SISA 1MZ5A 2AYHA 5LK7B 1POV0 3CJXA 4YM2A 5T3NA 1CIWA 2CV6A 4GWNA 3OGGA 1Q8SA 4N53C 5JLVA 3AFGA 5JDBA 5HXVA 5EZWA 2WS91 3LOBA 4AFBA 2ZS6B 2A6WA 2ATFA 4XILA 2JEMA 2ZHLA 1O4YA 1OPOA 3ZFEC 1YJKA 3T1LA 3URFA 1PGL2 5CU1A 4LTAA 4LBLA 2ET7A 3RMYA 3FWEA 1SFYA 4UBHA 1ZA4A 4RS5A 3UKVA 1ZRRA 4OHWA 4B7KA 1APNA 5F9TA 3B94A 3VZMA 1PM7A 2D6LX 4PJYA 4I2OA 4M0NA 3EBRA 3ZN6A 2OZJA 4HANA 2OUHA 3SLIA 3PNAA 4PF5A 3H8UA 3RQ0A 4LO5B 3NV1A 3THPA 5SV5A 1LECA 1PVXA 2VW2A 2ZBJA 5CBLA 4XMAA 2P3KA 3UL2A 3D4KA 4UXAA 3LSDA 2ZOEB 3P3NA 2OUJA 4WZFA 3D5OA 1KFUL 1HV1A 4AW7A 4YYOA 3R6SA 5TSWA 1MS4A 1OFSA 4FOYA 3RYRA 1REEA 3MYXA 3ALQA 2DFBA 4K6BA 2WFF2 3E97A 4IQPA 2A5ZA 4AHYA 4PCRA 1QXRA 1BQPA 1TEIA 3ZXLA 2HWE1 3O12A 3L2HA 4E4ZA 1A6CA 4B4RA 4H55A 4Q26A 1GZCA 1MS5A 4HPKA 4FTSA 4DPNA 5BXXA 1Q5OA 1RUG2 4YGDA 5HBAA 4HBNA 2CWSA 2HWB1 3WQ7A 3N3HA 5KXBA 4Q4W2 1JYIA 4M3CE 4JDNA 2AENA 3V0BB 3ROUA 2GNTA 3LSEA 1O3QA 1OHFA 4MGZE 4P9GA 1I3HA 1D2QA 4H3WA 2RS12 4YFZA 1NCQB 1QJX2 3DKWA 3D82A 5GKAC 3VBSA 4XOGA 1DZTA 4HETA 2R1BA 5FMOS 4DS0A 2VMHA 1UF2C 1CJDA 2P34A 2W0XA 1ALYA 3FC0A 1BJQA 1GR3A 4IL7A 1LOAA 3FUOA 1LB2A 3NWKA 4NPRA 2XL9A 2RR13 3VLBB 2X53S 3ME2A 4LBOA 1BBT3 1NG0A 4QGLA 3RI9A 3ZYGA 1SLLA 4TYSA 4N43A 3OJBA 4AI1A 1V6OA 4BIOA 2QZ3A 4Z1VA 3OD0A 4N53B 1EY2A 4L11A 1UCXA 2BBVA 3U10A 2HEWF 1TME3 3VL9A 3VBUA 1ONAA 4RR3C 1V9U2 1UPIA 2ZGTA 4TWTA 5FQ0A 3VDDC 3ZFEB 4NR1A 4QQLA 1FMD2 3ELNA 4BA6A 1DG6A 3SNMA 3B69A 3OBTA 3LA3A 2WFPA 5GALA 2R32A 2RR11 3MLLA 3NSTA 3AB0A 1N3OA 2PLV1 4L92A 1QMJA 4ITCA 1BBT1 4OLLA 2ENRA 3UV9A 1ND3C 4LHKA 5I91A 3IWZA 3TN91 4CDUC 2JG9A 2LUWA 4BHPA 4XXPA 4OUSA 1MS8A 1YYNA 3PVNA 3WCRA 1GZ9A 1EV13 4KG8A 1OSGA 2YZ4A 3O0XA 4AQ2A 1TME1 2ARXA 2WJSA 1HKDA 1SEFA 2JE7A 1F5FA 2OYZA 1COV2 1KJLA 1SBFA 3AMMA 2XVLA 2QFEA 1ZBA2 2ZX0A 1NLSA 4QM8A 3THTA 3CEWA 3J8F1 1PVC3 2WC2A 4XPVA 4SBVA 3R4UA 1LEDA 3MI8A 4YGBA 1SQ4A 4Y5Z0 1WCKA 1EAH3 2IZWA 4M3CF 4H7MA 2VPVA 3V0AB 2W68A 1EV11 2WNUA 4FPFA 1O5LA 3M3EA 4YZ1A 2NM1A 3ZMOA 3E6CC 4CP2A 4EWAA 4AF9A 3MF6A 2VECA 3VGIA 2ZHKA 5C9AC 2DURA 3AMQA 4C90A 5C33A 1JOJA 4ONUA 1BKZA 1VBA3 2RE9A 4Q4Y3 4V1PA 1I6XA 4IV1C 3BU7A 4XW3A 5CFDA 2VVDA 5KXDA 1QJZA 2OA2A 2B39A 1WLWA 3LCPA 4LO6B 3UKTA 1SLAA 4JC1A 1NOVA 2WS92 3JB8A 1CX4A 1H0BA 4B8EA 1LHOA 5JOZA 4K7JA 1QQP3 3M3IA 3T1MA 3UKNA 1HQNA 5JOYA 3E5QA 1EAH1 5KC6A 3LKJA 1R081 5FTTC 2WSVA 2ZJCA 2RMU3 5I0TA 1C8M1 1OQDA 3FJSA 3JU9A 1S0CA 3AP5A 4QPIC 4XJWA 5JPMB 1A3KA 4AVBA 4U36A 4DQAA 4TSVA 4YZ5A 1QJY1 1VBA1 2XVKA 2ZGSA 2GZWA 4Q4Y1 4F3JA 2YXSA 5DXDA 5A3MA 3E5XA 3AJZA 3I4IA 5T5PA 1PZ9A 1AYM1 1BZWA 5J36A 1O7FA 4XJZA 4NWVA 1FOD3 4YW5A 2LALA 3QH7A 3ZSJA 4Q4V1 4FCAA 2WL1A 1S55A 4FTEA 2BNOA 2PQQA 3FZ3A 2ZGQA 1LOFC 4J6GA 2VVEA 4AI2A 5T5OA 1PZ7A 4IV3A 3KT1A 1IS4A 3IIAA 3MGUA 4XF4A 1WMDA 5FLHA 2GC3A 3WW1A 1GZWB 3L2YA 4KNCA 1OA3A 1UZZA 5A33B 3IN9A 4IEOA 2D44A 4RR3B 3FFQA 4XQWA 5F1RA 4LHNA 1OOPC 1U5IA 1H4GA 4K21A 3SITA 2VQ0A 4QQ2A 3VDDB 3WW3A 4JAAA 2HWE2 4L99A 1UU4A 4CEWA 1UAIA 4RA0A 3N7JA 4COZA 3OCPA 4JGZC 3U0ZA 3MIBA 3NKTA 1FOD1 4IEWA 1ZREA 2GN3A 1SFNA 1ND3B 1Z7S3 3USUB 4GIQA 4CDUB 2R041 2D6MA 4Z8BA 3IDEA 1CD3G 5DUVA 4FPOB 5KHGA 2DTWA 2HWB2 4FXGB 3ZN5A 3VZLA 2XWJB 4P9WA 1VALA 4UW6A 2MHFA 3OY8A 1RMU1 2BVVA 2UU8A 1ULDA 1RUD3 3GZUC 4Y24A 4WVVA 2GC1A 4RGAA 1QDOA 2UWCA 3KSCA 3WDWA 3CJIC 2JE9A 4BZ4A 5JSPA 3KGZA 4I02A 2HJIA 1N1SA 1ULFA 5GLZA 2B9UA 1TE1B 5DDJ1 5AC93 2VMIA 3AZYA 2A73B 1DU3D 2R063 5HCAA 5T5JA 1ZNPA 2QVSB 3IPVB 1O3RA 4JGYA 3B5LB 4QGMA 1Q3EA 1LEMA 2Z5WA 3AM2A 3I59A 4CEYA 1W6PA 5KXEA 2VNOA 1MS0A 2PHRA 3AP6A 1VBB3 2CGNA 4YZ3A 2D97A 3N7LA 1UX6A 1PNFA 2VOWA 1RUD1 2XKPA 4AHXA 1I9RA 5L19A 2AREA 2BQPA 5C9AB 2E63A 1PGL1 3JUUA 1Y9QA 1WLTA 1CAWB 1REFA 1KDKA 2EF6A 2ZX3A 5AC91 4JRLA 1VBE3 2NLRA 4IV1B 2R061 4RS5C 2GALA 5JOXA 4ES9A 1XNCA 4AXOA 1AYN3 1HLCA 5FOJB 3NVCA 1YI7A 1F31A 4HLTA 1GANA 5JZGA 2XBO3 3JBG3 2ZGMA 1D4M3 4P9YA 1BYHA 2RR12 2DVBA 3DN7A 4PBPA 5GLVA 1BBT2 4QPIB 3TN92 5JSOA 4FPYA 1X50A 5I0SA 4AFAA 2Q8OA 3VKLA 1AXKA 1DQ2A 2KM2A 3N36A 5BY5A 5BPXA 1TME2 2ZA9A 1QU0A 4AGGA 1AJOA 4O9GA 3MIHA 4G9SB 5F5QA 2E51A 1AYN1 2HEYF 4W6WA 4W6YA 5HCBA 4YW2A 2ZGRA 2ZGPA 2XBO1 2BW8A 4BCUA 4GH4C 2VNRA 1UPSA 5E89A 1H8VA 4Y20A 3W59A 4A2UA 1CVNA 4MV2A 1KQRA 4AEDA 4KBBA 1Q56A 4A7ZA 1VB2A 5ACA3 4LNVA 2SLIA 1BEV3 3ILFA 1OOPB 1EV12 1W0PA 1UKGA 4Q4X3 2CAVA 4Q4W1 4R4XA 4PIXA 1SLBA 3H50A 5EFUA 2D6PA 2H0BA 4XE9A 1IS6A 4JGZB 1WW5A 2RS11 3RSJA 4OULA 4RGGA 5F6LB 4Y4YA 2H6BA 5LRRA 3WDUA 1CAXA 3TWIA 3OF1A 4E2SA 2WIIB 3C3VA 3VBSC 2D98A 2DF7A 3VUOA 4Q1RA 4BM8A 2ZX4A 2P3JA 5JI9A 5H9QA 3CJIB 1EAH2 1BEV1 2YGLA 1MZFA 4XMIA 2FMDA 1LCLA 1MEC1 1MR5A 4DRRA 1C8M2 1LJ7A 2XJTA 1ZBE3 2WNVA 1LOGA 1MZEA 1WUVA 1LODA 1RUC3 4K3UA 3MFCA 5CVRA 5DZFA 5JSRA 1SLIA 3GZAA 1AX1A 2QQPA 3VBFC 1UN1A 1VBA2 4HKWA 2DUPA 1RUJ3 4N43C 4Q4Y2 1GBGA 2GU9A 3SH3A 1KS5A 2FBEA 1ENXA 3WINE 2UYAA 4S2DA 5GLWA 2Q1MA 1AYM2 4NO4A 4QQPA 1W6QA 4I3GA 1QQP2 3APBA 3OGJA 4PDWC 1OD5A 3WVJA 1DYPA 4JCKA 2G9GA 3ZXGA 1S0GA 1DZQA 4Q4V2 1ASJ1 1AUYA 3B7MA 4LBNA 4QM9A 5FOBB 5GZCA 5FBZA 2NPIA 1XE8A 1W6MB 4MVTA 2VW0A 4GB31