5DZEA

Crystal structure of the catalytic nucleophile mutant of vveg16 in complex with cellotetraose
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
199
structure length
199
Chain Sequence
EAQPLKFIAVDYCPESCTHSPESSTITLTFDHRGGSRWRSTTRFQYGTFSSLIQCPKGNTSGLNFNIYLSSLEGDKSQDAIDFEFLGKDKRIVQTNYYTAGTGNREAIHDLGFDCSDGFHEYVIKWGPDLIQWLIDGKVIRSVRADGEGFPQKPMFLYASVWDASYIDEGRWTGPYVGCDAPYICLYKNVNVPVGTAVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords endo-glucanase
publication title Crystallographic insight into the evolutionary origins of xyloglucan endotransglycosylases and endohydrolases.
pubmed doi rcsb
source organism Vitis vinifera
total genus 47
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2015-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5dzeA00
2D6NA 3IPVA 4LBOA 1JBCA 1V6NA 2NMOA 3WG4A 3W58A 1V00A 3IMNA 1AJKA 1LGCA 1LHNA 1UZZA 3ZXKA 1LENA 3B3QE 4P9WA 1QU0A 3RRDA 1QOSA 5AVAA 3FLRA 1KJRA 3VKFC 3N3HA 2AENA 2V73A 1SLIA 2VUAA 2P3JA 3KQRA 4XBQA 1O4ZA 4FOWA 1APNA 1GZWA 3BOPA 1LHWA 3VKOA 2D44A 1KITA 3AP6A 1LOEA 4Y26A 4LBNA 1GICA 1YXWA 3RMXA 1HQWA 4R9BA 3LCPA 1CPNA 3N7MA 3D6EA 3HN1A 2ENRA 3MPPG 1LEMA 1LOGA 2P3KA 4FPEA 4P9XA 4XMIA 1V6KA 2DYCA 3A0NA 2GMMA 2ZGLA 5DXDA 1MS5A 1AVBA 3A0KA 4XJAA 3WDXA 3AYAA 1DYPA 1MS0A 4YW5A 5GLUA 2ZGPA 5GZDA 1ZA4A 1WW4A 5CBLA 3DUIA 4WVWA 1Q8QA 1DQ6A 1W6QB 2A6XA 2ZMNA 1SCRA 2UWBA 1R1ZA 1J1TA 5DG2A 1OQ1A 4DRVA 1SLCA 3L2YA 5DUWA 1MS8A 1DQ0A 3IN9A 5IK5A 5E89A 1S0BA 3AYCA 1FV2A 3LSDA 4H55A 4TZDA 1IS6A 4ATFA 4YGCA 3WCSA 4FPCA 1F31A 2GDFA 4LBQB 2NMNA 1EPWA 3OPZA 1PZ9A 4FP2A 3ZXFA 5IT6A 4Z8BA 4PCRA 4C1WA 1C1FA 1MS9A 5JDBA 1N1SA 2UWAA 1G8WA 3SH4A 1V6LA 1W0OA 1CQ9A 4YM3A 1AX0A 1SBFA 1DQ2A 2ES3A 4UW5A 2E7QA 1W6MB 2AUYA 1CN1A 3OY8B 1BYHA 3WNXA 2SLIA 3FUOA 5IK4A 1UN1A 5GZEA 3WDYA 2ZZJA 5JOXA 3V0AA 3AYEA 4GKXA 1UX6A 3NV3A 3ZYRA 1D2SA 4YZ4A 1VLNA 3RMYA 4LBQD 1CIWA 4FQ4A 1LOAA 1SCSA 2EALA 2AYHA 2ZGKA 2A3XA 5GLZA 3AZYA 4BM8A 4YZ2A 3GNEA 1AF9A 1LTEA 1MS3A 5IK7A 4LBQA 1LHUA 3M3QA 1F9KA 2VU9A 4FPLA 2WT0A 4YZ3A 1DQ1A 1GBGA 2ZHNA 1BJQA 3AJYA 2PHXA 4D69A 1A8DA 2P34A 4ITCA 2WSUA 2ZMLA 4KBBA 4AVSA 3WHTA 1W6NB 2W68A 3B00A 4YFZA 2OUHA 3O0XA 4YZ1A 1IS3A 3AXDA 1H9WA 2PELA 4TYSA 2E6VA 1LU2A 4AWDA 2P37A 1KQRA 2R16A 3OY8A 4U2AA 3B01A 2D6PA 2ARBA 1JYCA 2R1BA 3M3OA 2I2SA 3WLUA 1WUVA 3WG1A 5HCFA 3NV1A 5GZCA 1YI7A 3UL2A 2ZGTA 2DTWA 5EYXA 3R4UA 1LOFA 4BPZA 4Q1RA 1Y7BA 3FLPA 1WW7A 1WLWA 5FREA 1MZ5A 3AP9A 3UJQA 1A78A 4M3CE 2Q5TA 4DRRA 3V64A 3M3EA 1QOOA 2E53A 4XILA 1IKQA 1AX1A 1G86A 3TB0A 2JKBA 4XYXA 2DVDA 2XB6C 4UW6A 3USUB 2EAKA 1W6PB 1ULGA 4FPOB 1A3KA 1W6NA 5EWSA 1G9CA 3WUCA 1FAYA 1LECA 3T1LA 1HKDA 1OKQA 3WZ1A 1LOFC 3OGGA 5F9TA 3WDWA 2R0FA 4IQPA 1LEDA 2DVGA 2DV9A 4PQ9A 4U36A 3NV2A 3TAYA 4LBKA 5BYNA 3WG2A 4K1YA 5GLWA 2FHRA 1MACA 3M2MA 1CJPA 1DQ5A 1DZQA 5T5JA 2ZABA 4NOTA 2B7YA 3PMEA 3AYDA 1CONA 1QNYA 1LGBA 1LOBA 2A3YA 2ZHKA 4Q8KA 3VKMA 5KXDA 1W6OA 2DUOA 2A70A 2D6OX 2EXHA 4Q8LA 4YG3A 3AP4A 2UWCA 1S0JA 1Z0HA 5DZEA 1AXYA 2ERFA 4Q1PA 5JVVA 4CTEA 2CY6A 3USUA 1S1AA 1SACA 1ULFA 3JUUA 1S0CA 3APBA 4UW4A 1H9PA 4WVVA 1AXZA 3WDUA 2WJSA 4XJZA 4YW4A 3SLIA 2FMDA 3SH3A 4DQAA 4R9DA 1VAMA 2ZBJA 1ENSA 1GLHA 2ZGQA 2VW2A 5JOZA 1YIFA 2D43A 4OZXA 1DBNA 4GKYA 1N1VA 4YG6A 1LJ7A 2NM1A 4FOQA 4BMEA 1CVNA 5JLVA 5T54A 2RHPA 4XIKA 3B9CA 4FQZA 2PHWA 1FATA 2C5DA 4JCKA 3ZVXA 1VIWB 5T52A 4K20A 1WCSA 3SNMA 2TEPA 2ZAAA 1XQNA 3SH5A 3H0OA 4L8QA 2WSVA 2ZGNA 1PZ8A 1ZM1A 2EXJA 3I4IA 3SISA 4DFSA 1SBDA 4WV8A 1DIWA 2A6ZA 3D5OA 2DVAA 1DGLA 1BZWA 4GXLA 4MYEA 5E8AA 4Y1ZA 1DFQA 4LBJA 4WZFA 2UU8A 1UL9A 3SITA 1YO8A 2DUQA 1KDKA 1HQLA 1W6QA 1QDOA 1WD3A 2DTYA 2ZGUA 5DZFA 4BLIA 4YGBA 1F5FA 5L73A 1IS5A 1URXA 1BXHA 5SV8A 4XDQA 3OBRA 3MW4A 5JOYA 1GZCA 2Z42A 4XHBA 2DU0A 2P2KA 4FVVA 2JD4A 2A6VA 3N36A 3KM5A 3LSEA 3AK0A 1SLBA 1MVEA 2A75A 2ZGMA 1RINA 4BMBA 2AR6A 5HCAA 3ZSJA 4XJ8A 1FX5A 1RITA 4UW3A 1I3HA 3BODA 4FPGA 1S0DA 1MS1A 3PVEA 3HR9A 2WNEA 5IK8A 3ILNA 4FOYA 1GYKA 2AH2A 4Y1YA 3VKLA 2SBAA 1W0PA 1S0EA 3O0WA 2EF6A 2VH9A 1G9DA 4YGEA 5CA6A 3D4KA 4M00A 4GALA 3VKNA 4F83A 1IOAA 2XG3A 1H30A 4FPKA 1RIRA 2YY1A 1W6MA 1ENQA 1FV3A 2D3SA 2C9AA 5GALA 4XHXA 1ONAA 2V5YA 4XJ9A 1QMJA 2DVFA 2DU1A 4XBLA 4Y20B 5T50A 1WD4A 3OYWB 4XTMA 1LULA 2G4IA 3ZXJA 5T5OA 2AGSA 4LBMA 4DS0A 1LCLA 2PHUA 3ZPYA 4ISQA 1QDCA 1Q8SA 1JYIA 1JHNA 4YG0A 2KM2A 2YROA 3AP5A 3PVNA 3U4XA 3BTAA 3ZSLA 5KXEA 3IPVB 4NO4A 2CWSA 4XOGA 4AGGA 1VAVA 5DUUA 5DZGA 4YM1A 1DLLA 3FLTA 4Q26A 4DPNA 1WW5A 3QLQA 1PZ7A 3AXEA 1G7YA 1QKQA 3MW3A 3DGTA 4PBPA 2GMEA 4YM0A 4ZXKA 1N1YA 4C1XA 4LBLA 2NZ9A 3NWKA 4ISRA 3AX4A 3RS6A 1GZWB 1C57A 5EYYA 1AXKA 2JJ6A 3CNAA 1C4RA 1Q56A 3WHUA 1V6MA 2CTVA 2GNMA 3ZSKA 2ARXA 3M1HA 4AVVA 2D6KA 1N3PA 1QF3A 3AFKA 2WT1A 3ZYPA 2VW1A 1X50A 5IUQA 2OW4A 2EXKA 1JXNA 3R4SA 3R05A 4BQ1A 5E88A 4R9AA 2NN8A 4AVTA 3AJZA 5KXCA 1UMZA 3ZXLA 2BQPA 4YLZA 2JE7A 4CRQA 1SLAA 3N7JA 3ZXEA 1LODA 2GNTA 5GM0A 4BLJA 4FPJA 3WDVA 1S0GA 2E7TA 1GKBA 2CNAA 2YZ4A 3B69A 3MW2A 3T2TA 1W6PA 2YXSA 4ASMB 4ZKTB 4JRAA 1LESA 1S0IA 4M3CF 1IS4A 4PF5A 2DURA 3BIWE 1G9AA 4YW2A 4XBNA 1QGLA 1LHVA 1KRIA 5F5QA 3ASIA 5T5PA 3FBYA 2ZACA 2W52A 3W59A 1BQPA 4Q27A 4XXAA 3WUDA 1G9BA 4M01A 1Q8VA 1KDMA 5JMCA 1WLDA 4Y24A 2VXRA 1ULCA 3T1MA 4YFWA 1DHKB 1U0AA 1WW6A 4YM2A 1MR5A 3OBTA 5KXBA 1GV9A 3POSA 2CWMA 2GN7A 3WDTA 2WQZC 1WBFA 4Y1XA 1JOJA 4XJUA 1BKZA 1UKGA 2A71A 1YYNA 2JDZA 3M3CA 1V6IA 4P9YA 4RL7A 5H9PA 3ZSMA 1CR7A 3WG3A 1UZYA 1LHOA 1CPMA 5DG1A 5H9QA 2R0HA 2NYYA 2ZGRA 5T55A 3RQ0A 1N3OA 5JOWA 3HMYA 1B09A 4Y1VA 1Q8OA 3V0AB 1SLLA 4HL0A 2GALA 1GSLA 4YW1A 2DWRA 4GWNA 2JECA 1I1EA 2W39A 1V6OA 5CAZA 1MVQA 2YV8A 1LU1A 2WKKA 3N35A 3IKWA 4FPFA 3ATGA 4GWMA 1GNHA 1CESA 4JC1A 3ENRA 1DQ4A 3JU9A 3IM0A 1GZ9A 2PHTA 3AZXA 3QCWA 4FPYA 4Y22B 4AGVA 4ATEA 2A5ZA 3O0VA 1TEIA 1V6JA 1SBEA 3C2UA 3V0BB 2NP0A 3MEPA 1FNYA 2D7FA 1N1TA 1Q8PA 3N7KA 5CB7A 1JW6A 1QNWA 2OVUA 5GJ6A 4XIOA 2JE9A 5H9SA 2OUJA 3PVOA 5HCBA 4BOWA 2GNBA 3VUOA 3Q9OA 1WLCA 1ULDA 1YRZA 1DYKA 3AZWA 5EXOA 2GN3A 1S0FA 3I8TA 2A3WA 1AZDA 5T5LA 4HANA 1OFSA 1C1LA 1SLTA 2P3IA 2D6LX 2VW0A 2YMZA 3WOGA 1SFYA 2A7AA 4YW3A 1WBLA 4K1ZA 2PHRA 5GZGA 1LGNA 1UPSA 2PHFA 2ZKNA 1GNZA 4XMAA 3POWA 2R49A 2ZGOA 4GA9A 4RA0A 2D3RA 1HDKA 4FOVA 4PBOA 1FNZA 2WLQA 2CYFA 5DUVA 3UJOA 3A4UA 2AREA 5GLTA 4FPHA 4Y22A 1QOTA 1O4YA 1KJLA 4XTPA 2LTNA 1JN2P 5DUXA 2LALA 4XXPA 3V0BA 4P14A 2ZGSA 5H9RA 1Z78A 4I30A 4R9CA 2ZHMA 1N47A 4K21A 3O12A 2EIGA 1N3QA 3INAA 3POYA 1ENRA 3OJBA 4Q2FA 2D3PA 1AJOA 2WT2A 2A6YA 3FUQA 2DUPA 3ILRA 4FP3A 4M3CB 3AZVA 4SLIA 4XE9A 4YZ5A 2EXIA 3PJQA 3WV6A 5GLVA 1FYUA 2VY0A 1GANA 4CZSA 5GZFA 4XJWA 5CNAA 2ZHLA 1NXD1 1IKPA 2ZA9A 4YGDA 3RSJA 1NLSA 1LOCA 3NV4A 4AGRA 4W65A 2ZMKA 1ULEA 3UK9A 5FRAA 1UAIA 1G9FA 3V65A 2UURA 3GALA 4Y20A 5LK5A 3FFZA 2CL2A 3O5SA 3OYWA 1W6OB 3AZZA 4AYUA 2GMPA 3RG0A 2A6WA 2E51A 1MZ6A 1JUIA 2D6MA 4XZPA 1MS4A 1HLCA 3WVJA 2HYKA 3WCRA 3VV1A 3N7LA 3ILFA 4Y1UA 4M3CA 1D0HA 2H0BA 2R1DA 2W08A 2GNDA 3AP7A 1VALA 2DVBA 1AX2A
chains in the Genus database with same CATH superfamily
2D6NA 2Y0IA 3IPVA 1JBCA 3FFQA 2JDUA 5JR7B 4OMDA 3WG4A 5IAXA 2V4AA 1LGCA 3TBDA 4FAHA 1JZ7A 1LENA 3B3QE 4P9WA 2P6HA 1H4HA 1QU0A 2VOVA 1CD3G 2D40A 2F17A 4OHVA 5FR3A 2V73A 4QKNA 1YQ2A 4XBQA 5C9AB 1IG0A 1APNA 3KWVA 1IGOA 5FZGA 5CKNA 3I2FA 1LHWA 3VKOA 4CXWA 3FHQA 5I91A 5F32A 1LOEA 4G3YC 4W6XA 1J83A 2HWE3 2QCSB 2WO2A 5EJ3A 3RMXA 1ZZ6A 4R9BA 3LPGA 1DGWX 3N7MA 3J7MA 2ENRA 1LOGA 1OHFA 1FXZA 4FPEA 3NL1A 3MO4A 1HIXA 2VUCA 1Z7S2 4D8MA 1V6KA 2GMMA 5C4WC 3B5LB 4B29A 1UO9A 1MS5A 2Y64A 1R1A1 1QQP3 4D0QA 4BWOA 4YW5A 5GLUA 2ZGPA 4LE3A 3BB6A 5FDBA 4DNYA 5DQ0A 1DQ6A 3M8LA 1SPPA 2ZMNA 4L11A 1AR93 1UY4A 2WZEA 3AKTA 2E33A 3B9IA 1WWYA 1SLCA 1O3SA 1Q5OA 1TME1 4Q4V3 3L2YA 3LAGA 3KT7A 5IK5A 1Y3TA 3N9LA 4GB33 4Q4Y2 3ELNA 3W20A 4UFHA 5HV4A 3ITQA 5JPMB 4ATFA 3WCSA 2O8QA 1F31A 3W5NA 3VHRA 4LBQB 3DCQA 3UKNA 1VRBA 1XRUA 2VZOA 4Q5OA 4H7LA 2GP3A 2G1MA 5APAA 4C1WA 4CU6A 5JDBA 1N1SA 2UWAA 1G8WA 3SH4A 1V6LA 2D93A 2WBKA 4HFSA 4OUMA 2XWBB 1CQ9A 4QPYA 4XFIA 1I9RA 3LEIA 4QQ2A 5FY7A 1SBFA 5FLHA 1PO11 3B94A 1UMHA 4UW5A 4DEVA 3ORJA 2IXKA 5C8WA 1W6MB 4ZPIA 1GNYA 1UZWA 4XDOA 5I8SA 5CKMA 3SKJE 3QOPA 1QWRA 4AHZA 3HNYM 4J1WA 4YSFA 5GZEA 2VQAA 4KWLA 2JG9A 4W6YA 4E4DX 1W9WA 4N53B 4BMEA 1SQ4A 3DYPA 3SC7X 4AVVA 1LOAA 4AEJA 5FQ0A 5FMOS 5ISLA 4EN7B 3MF6A 4LJHA 1MS3A 4K7JA 4NRMA 5IK7A 4LBQA 2XR4A 1LHUA 3GCXA 5J98B 4CCJA 2VU9A 2EAAA 1AR73 2BYVE 3C7HA 3HBKA 1K5MA 1GBGA 1QH7A 2QUOA 3AJYA 2HBTA 4OI1A 4BQ5A 1ZZBA 5A33A 1OKOA 2JG9C 1TVGA 1FMD2 5F3EA 2R041 2W68A 3MLLA 1IS3A 1D0GA 2PELA 3NJYA 1FPN1 4BZ4A 2YG0A 2DDUA 4CSWA 3B01A 4FT8A 2VQTA 3O1PA 3OPTA 3GBGA 1VBD2 3J7NA 3JCIA 4FTBA 5ABJB 1C8M1 2R1BA 3LIHA 2I2SA 5GZCA 4NIGA 4N53A 1RVF1 2DTWA 1K5MC 4Q0VA 4MGYE 4QXBA 1FOD2 1OQEA 1YIPA 3AFGA 3BIEA 2WDBA 3A22A 4BPZA 5FPUA 5A3NA 3RYRA 2RV9A 1OBNA 1HB4A 1MZ5A 4YRDA 4JGYB 2VE1A 4M3CE 1BMV2 2Q5TA 3V64A 3RWNA 1G86A 5FFOC 3K4ZA 2WYFA 4XCBA 4MADA 2YU2A 4J1XA 4TLGA 3TB0A 4LORA 3D8CA 4IETA 2BWAA 2JDKA 2XB6C 2X5IB 1UOJA 2RM21 1BEV3 4XUNA 2PQQA 2VCCA 1FAYA 2WWSA 2YGLA 1ALYA 3UGHA 1SZBA 3GGLA 4B7KA 4NPMA 2VZPA 5F9TA 1ST8A 4AE2A 5ABJA 4IQPA 1MEC1 3NV2A 5BYNA 5D21A 4JQRA 2W1WA 4K1YA 1K3IA 5A1FA 4JKMA 2HWF2 1DQ5A 4YW7A 1YQCA 5CG9A 1AYN2 3PMEA 4CDWB 1COV1 4HONA 3MIGA 1W8UA 3R6SA 2ZHKA 3ZDVA 2VQ0A 1O5LA 1F2NA 1AYM2 4RD7A 3ZMOA 4B8EA 2QQKA 2A70A 2D6OX 3IT8A 4AEDB 3AP4A 1F4HA 4CTEA 4Q1PA 1DG6A 2CY6A 2JXAA 1BBT3 4IXLA 2Z4FA 1VBA1 2XQRA 3APBA 4UW4A 2WZPP 2PA7A 1AXZA 4N90A 4XF4A 2WJSA 1EV11 1RUD3 1RUF1 4XJZA 3KHCA 4COVA 2IVIB 4HXCA 1REDA 2IUWA 4Q4X2 5B4NA 2RS31 5IHRA 3CEWA 2XKPA 1R091 4AAPA 4KU8A 4AFDA 1C3HA 4UFJA 1YIFA 3FZ3A 2QJVA 4GJYA 1LJ7A 5FYYA 1OUSA 2J7MA 3LA2A 1CVNA 5JLVA 3B9CA 4FQZA 1W39A 2PHWA 1NA1A 1QXJA 1VIWB 3LA7A 4K20A 2ZPXA 4CU8A 1SDDB 4FFIA 3H0OA 5A3PA 3DYMA 1OA3A 2QFEA 2ZGNA 4L8QA 2G9FA 4XQWA 3V56A 4CPBA 4PIXA 3VDDA 4AVBA 5CG8A 2L9LA 1RMU3 3DKWA 4DFSA 3VHPA 4WV8A 3D5OA 4HVRA 2DVAA 4GXLA 4WVMA 3F2ZA 1RHI2 4CVUA 3RZLA 2W87A 1AR63 4NIAA 3OSDA 4O65A 1O7FA 3UKVA 5KWRA 2AACA 2UU8A 5F3IA 1PX4A 1SFPA 2JG8C 5IFTA 2PAKA 4IGPA 1L3JA 3CJXA 4DXZA 1NA1C 2F4PA 1HQLA 1REEA 1QDOA 1WD3A 2XLAA 2DTYA 2ZGUA 4NHLA 1HJGA 3KSCA 5FXWA 2Y6GA 2VZTA 1BXHA 2BRTA 2R071 1XU1A 4XDQA 5K4LA 3VDDC 1WCKA 3WNKA 4XHBA 3GBWA 1OA2A 1HQNA 3N36A 3LGRA 5ANQA 4B4QA 3AK0A 1RINA 2RM23 4HG6B 1XNDA 1RITA 3POFA 4AW7A 2XBO2 2XJPA 4FPGA 1YFXA 3WQ0A 3NJVA 3Q8AA 2WNEA 5FZHA 2YC4A 2O1QA 2XVKA 2ILMA 3AMPA 4FOYA 3WNNA 2FDHA 2ZEZA 5FZ4A 1HRI2 1KGYA 3O0WA 1HB1A 1HRV2 2RVAA 5FZ0A 1MEC3 4ZU5A 1NOVA 4YGEA 5CA6A 4M00A 4P5YA 4BQWA 4A2UA 1IOAA 2HWB3 2XG3A 4FPKA 4XETA 2YY1A 1VRH2 3LOBA 1HX6A 1UWWA 5JI9A 3FHIB 5CFCA 1PO21 3BCWA 3CO2A 2C9AA 3MIFA 4OHZA 4H14A 2WNUB 3JQXA 3R0RA 2QKDA 5F3CA 1ONAA 2MEV2 2ID4A 1PIV3 5T50A 4MO3M 3OYWB 5FUIA 4XTMA 3WF4A 2WZR3 2ZX3A 3CMGA 2G4IA 3POJA 1VBB1 4QPWA 4WM7A 2AEYA 2C24A 2BBAA 5T5OA 3VZJA 3ZXJA 4DO0A 4DS0A 4ISQA 1KD7A 4RHV1 4NIDA 1GQPA 3DPRB 3H8XA 1JHNA 3MUY1 4QU1A 4V1PA 3S30A 3BKZA 2ARAA 3PVNA 5CFCC 1UIKA 2CWSA 1D4M2 4A3XA 5DUUA 2RMU1 4LK6A 3NW4A 4EWDA 1W2UA 4CDUB 1PZ7A 5L9VA 2QDNA 2OQ7A 2GMEA 2VVFA 4ZXKA 1VBE1 1UCXA 3KV5A 4WM7C 2BNMA 5LATA 1JZ3A 2Q8OA 3T0BA 3AX4A 4QX1A 2GH8A 2WNUA 4B4PA 3CNAA 1Q56A 1A8MA 3O1RA 4M4PA 1ZRCA 3DECA 2GNMA 2ZEXA 4UT5A 4PQQA 3ES1A 4JRLA 1I6XA 2VW1A 2OW4A 2EXKA 2VZ1A 4O61A 2JDMA 4R9AA 2NN8A 1UW8A 3H7YA 1SDWA 1TMF1 5TSWA 2JE7A 1FMD1 2ZCWA 3LE0A 3ZXEA 2GNTA 4QWNA 2HWC2 2I07B 3E5QA 1G6NA 4MUVA 1WMXA 1RJ7A 4AI8A 5FWJA 1V9U2 1S0GA 5EP9A 2FDFA 4IV1A 2IWGB 5BNQA 2YZ4A 3J7HA 2YXSA 4ASMB 2PQSA 4BISA 4M3CF 1K5JA 1OXCA 2DURA 4BQ2A 2OT7A 4P9IA 1LHVA 4RGAA 2JWPA 1L7LA 5T5PA 3LDKA 1Z7S3 4TN7A 5FYSA 2R6QA 2RJKA 3W59A 4ASLA 2JDAA 2XL7A 1BMV1 1Q8VA 3OGJA 1O4TA 3PLQA 1KDMA 4Y24A 4XF1A 2VXRA 4LT5A 4OVEA 1T6GC 5FP3A 1F35A 1TQ5A 2X05A 4QB2A 1U0AA 4IV1C 5FTTC 4QX8A 4YM2A 4IE6A 1H2MA 4C91A 2VBPA 4B3NA 3OBTA 4X6RB 5KXBA 2CWMA 2GN7A 3LEMA 5DAQA 2EIBA 3G7DA 4Y1XA 4EWEA 2ETEA 3SHRA 4Q4Y3 3UESA 4D7SA 1U12A 4M0NA 3FE5A 4RL7A 2NQYA 1PHMA 1JMUB 5I93A 2XJTA 2D5HA 2B9UA 2R0HA 5JR2A 1H1IA 2Y26A 1X82A 3I59B 2WNVC 2DCTA 2PMWB 4QB1A 4F3JA 5LA1A 1W03A 3V0AB 4LIVA 5JZGB 4HL0A 3NJXA 2DWRA 1I1EA 3IAQA 2VL4A 1TNFA 1UXZA 1YEWA 4V2VA 4QKBA 2Z2SB 2VCAA 1LU1A 2WKKA 2YV8A 3IKWA 4FPFA 4HBNA 1GNHA 3ENRA 1DQ4A 1CAWB 3POIA 1HB3A 4Y22B 4N9HA 3O0VA 1JU3A 2RDNA 3VD7A 1TEIA 3V0BB 3C2UA 3POEA 3LDBA 5G05L 3U78A 3MEPA 1FNYA 3M7AA 1Q8PA 4LKEA 2VNGA 4MGKE 4MXWB 3T3YA 3A21A 3E6BA 2YBSA 4LTAA 1RUG1 5F2WA 5HCBA 2X8KA 3LFIA 4UXAA 2GNBA 2XL9A 1ULDA 2IC1A 4MGSA 2Y33A 3I8TA 2A3WA 3L9JT 4LUMA 1QHDA 2VNRA 5T5LA 4BCUA 3I59A 1XSQA 5FYCA 2BV4A 3NJZA 1SFYA 3WNLA 3HNBM 1SFNA 4A7KA 1DZRA 3HN3A 1AR83 4RA0A 1ULOA 4LNVA 4FOVA 3U11A 4AQTA 2WLQA 2VVEA 3UJOA 4OI0A 1XNAA 3T2QA 3A4UA 4RGKA 3SCFA 4Y22A 3B93A 4OHXA 2LTNA 3VBOB 5DUXA 4XXPA 4RQPA 3V0BA 1TZOA 3K4DA 4QM9A 4XPVA 4X8NA 1VBD3 2JKXA 3B7MA 3SEPA 4AVAA 2C9KA 1N47A 3NNFA 4K21A 3POYA 4DUWA 2H6BA 4LKDA 5JIAA 1X8EA 4MVTA 2D3PA 2VUJA 4BQXA 2FBEA 3ILRA 1FOD3 3AZVA 4IE7A 3HEIA 1K45A 1UQXA 5EFUA 3PJQA 3WF1A 1WCUA 3RZMA 5GLVA 1OF3A 2VY0A 1GANA 1POQA 4XJWA 5CNAA 4RQPC 2VZSA 3RSJA 1R1A2 5FYBA 3RJ2X 1LOCA 5F3GA 1NZCA 4EN8B 2AZ5A 3D0SA 4AGRA 4KGQA 3UK9A 1UAIA 3ZFGB 3GALA 5LK5A 3OGVA 2O8OA 3AZZA 5JPNB 4GH4A 2Z5WA 3GM8A 5FO7B 1TME2 1RUC2 1PMIA 1HRI1 1OPMA 2B9VA 1DU3D 1MS4A 1YQ5A 5F39A 1HRV1 3ZYIB 1ZZ7A 3MPBA 1HLCA 2B5HA 4PF1A 5LB6A 1NT0A 1MZEA 1XE0A 2HYKA 2ZAHA 3WCRA 3Q8BA 2C0ZA 3WINE 2HWF3 4WVZA 5C3OA 1D0HA 2W08A 3AP7A 3VDAA 1AYN3 3H3UA 3SH3A 4LKSA 2QQWA 1V6NA 2NMOA 1NYWA 4BYYA 1AYM3 1AJKA 1OLMA 3ZR5A 1LHNA 4QX3A 3ZXKA 4DXSA 1O5UA 4GMP1 5FZOA 2BWCA 3RRDA 3O1UA 4GH4C 3Q8CA 1QXPA 3ACGA 3OF1A 4LO5B 2W95A 5LBCA 1SLIA 2XJUA 4FOWA 2Y60A 1GZWA 1PO12 1E5SA 1PK6B 5HXVA 4Z2WA 2B4KA 2VNVA 4JHTA 5LY2A 3ZFGA 3ZX7A 4CYDA 4COWA 3AP6A 5FP7A 3VN4A 4LBNA 4LO7A 1GFF2 4QQHA 1H8TB 1RC6A 5CU1A 2UYAA 4Q4X3 2ZTNA 1CPNA 2D98A 4N8MA 4UFMA 3MPPG 1D4M1 4P9XA 2W3JA 3GDBA 3GXUA 1W9TA 2ZGLA 5DXDA 1JUHA 2Y6LA 4XW3A 1YC61 2W47A 1MS0A 3CDZB 3OD0A 2VMGA 4XJAA 4PIYA 4QU2A 1ZA4A 5GZDA 4AI9A 1A34A 2QQNA 5CBLA 5IVEA 5DMYA 1A6CA 1OMIA 5LZ6A 2A6XA 5A6QA 3VBRB 2WS93 5F6KA 1R1ZA 2E7AA 3E6DA 2VTXJ 4JHZA 3MICA 3P5BA 3POBA 5FK7A 1MS8A 1RXGA 1YFYA 2R042 4LA2A 3LSDA 2XPJA 1RHI3 4HKWA 1W8ZA 1FPN2 2X29A 3I3DA 4HT1T 4LLFA 4YGCA 4AEMA 2E63A 1J3RA 3LPFA 4QXHA 4I0AA 1QEXA 1H8TA 1NCRB 1C8M2 5A3WA 2Y6HA 3WSOA 3E6CC 1NXMA 3AKQA 1SG3A 4XABA 4CEYA 1UZ0A 3O1SA 1PZ9A 3TWIA 4C8DA 1RVF2 5EV7A 4RFT0 4PCRA 4DMIA 1C1FA 1OI6A 3HWJA 3BUCA 5FYVA 2XUMA 2HWD1 3C3VA 1OQDA 1YI9A 2AEZA 4CP0A 2ES3A 1OD5A 3DYOA 2RS12 1CN1A 5IK4A 2DFCA 1QIQA 2XBO3 3VBUA 4LO4B 3WDYA 2ZZJA 2K2SA 1GP6A 4HK9A 4UBHA 5JOXA 4FBFA 4CEYC 4LUKA 1QJZA 3WP6A 3ZYRA 3RMYA 1VLNA 5C3PA 1HRI3 2EALA 2AYHA 4CDQA 1IHMA 3AZYA 3H1WA 1LTEA 4OHWA 1EY2A 5FJKA 3P3NA 1RB8G 4EN9B 1VRH3 3ZN5A 4JKKA 1OC1A 1RUE1 2WC2A 1BJQA 4NRQA 2PHXA 4D69A 5A7WB 1NCQB 1BHGA 2AC1A 2BGCA 1A8DA 3I3BA 4KI5M 3VBUC 2MEV3 1COV2 4JX0A 4KBBA 4LKFA 4AVSA 4E4HA 4HPKA 3B00A 2OUHA 1EYBA 3IBMA 3POGA 1AL0G 1H9WA 4TYSA 1JYTA 4CUGA 3VBHB 4MG2A 1XU2A 1JOBA 2JICA 1KQRA 2P37A 2R16A 1U5IA 4AWDA 5L9RA 3VBSC 4CDQC 4L99A 3O1MA 1JYCA 3M3OA 4F8AA 2VBDA 3OGRA 1VBA2 5HCFA 1YI7A 5FXZA 3VD3A 3GHMA 1EV12 3ROUA 3VHOA 3ETQA 3I2KA 3ALQA 2RJLA 4UI9L 1RTVA 5CZKA 4MOAA 2RS32 1R092 1WLWA 3HT2A 4IEQA 4E2GA 1XYNA 3UJQA 4OMCA 4UFKA 2VOTA 5FZIA 3M3EA 4N43A 2E53A 5FLJA 2VMDA 1AL21 1R081 1PMJX 3QD6A 4XILA 1NCQA 3OPWA 1UOGA 2MHFA 1OLME 2JKBA 4BQ4A 1OD3A 1XNKA 4RS5C 2C4XA 2DVDA 4UW6A 4XYXA 3T0AA 4ARYA 4K6BA 3AMHA 1W6PB 1A3KA 4ORFA 3IWZA 5EWSA 1LECA 3T1LA 1JZ5A 5EHDA 5EZWA 3VBHA 3N4MA 1QY4A 5D8AC 3K3NA 3NAPA 3OG2A 4Q0SA 4LO8A 5A7NA 4LOSA 4LOTA 3WDWA 2CGPA 4U36A 5DAXA 3NQHA 3ZOIA 2HWC3 3KB5A 4CXXA 5A70A 1RYYA 4LBKA 1ND2A 2HLEA 4N43C 4PDWA 1ODMA 1MACA 1V9U3 1POV1 1DZQA 2Z69A 2ZABA 5F1RA 1QJY1 4NOTA 5T3NA 3ZYGA 3I2HA 5AC91 4Q29A 3VKMA 3H8RA 3J7LA 5BNPA 1PVC1 1J58A 4UFLA 3OBAA 4YG3A 5FUNA 3RYPA 1S0JA 2R072 5JMOA 3NAPC 1UZVA 1W04A 2DBNA 2BOIA 5JVVA 4MV2A 3PUAA 1SACA 1YJLA 1OT5A 3BTXA 1ND3A 1ND2C 4PDWC 1F8VA 1TG7A 2BTVC 4MZUA 3RYKA 2DCZA 2FMDA 4YARA 5HPOA 1UYXA 4H7MA 2ZBJA 3M3IA 1ENSA 2FCTA 4R9DA 4CU9A 4NAMA 1GLHA 2ZGQA 5JOZA 2D43A 5I0RA 5BNPC 1N1VA 4YG6A 4DUXA 1RUC1 5C9AA 1IPJA 2RHPA 1VB2A 3A7QA 4KG8A 1JU4A 1UXXX 5CFDB 1GOFA 2C5DA 4R4ZA 4N7UA 3ZYHA 4PLMA 1W8OA 1OUXA 4YVSB 5C3QA 4LPLA 1ND3C 4E9KA 1PO22 5IJRA 3CJIB 3IDEA 1L7QA 2EXJA 3QH7A 1DDLA 4NN0A 3WW2A 3ZYJB 4I3GA 3ZFEB 1VBB2 2OYZA 2GAUA 3CIHA 2PFWA 4KBZA 3THCA 1GR3A 1RUI1 1E5IA 1HV1A 1DFQA 3IMMA 4RHV2 4WZFA 5C9AC 5FO8B 1O91A 1UL9A 2XH6A 4HKLA 3SITA 5JXGA 1EPZA 2DUQA 1KDKA 4DINB 5FKCA 2VC9A 5CEHA 4BIFA 4D6QA 2X53S 2VULA 4YGBA 3U14A 4CP2A 4JTOA 1RUJ1 3NRUA 1XE8A 5L73A 3I3MA 1URXA 3P1IA 4LIUA 2RMU2 5CKQA 2EICA 2E9QA 3OBRA 3MW4A 1DYOA 1GZCA 2Y0OA 3SQOA 3U0ZA 2C1FA 1PGL1 1J3PA 4FVVA 2DBIA 4K8FA 3LB9A 2BGPA 2R062 1VBE2 4YVSA 4JGZB 1RUH1 2JDPA 2O0OA 3LSEA 1SLBA 1R64A 5KC6A 2ZX0A 2WFF1 2AR6A 3QACA 2VO5A 1YFWA 3ZSJA 4XJ8A 1FX5A 3KZ4C 3LZZA 3ZKYA 3ACFA 3ZXGA 3BODA 4LULA 4E8DA 4AK3A 5J1XA 3PVEA 3HR9A 2WO3A 3UYJA 2EVXA 4NHMA 3T09A 2AH2A 4AI1A 5IATA 2OA2A 1W0PA 3H1YA 2BVBA 5F5CA 1QJEA 4KGGA 1TMF2 2VH9A 2RDSA 3KLSA 1P8JA 5FZAA 5FV3A 3VKNA 2CGNA 1I5ZA 3PL0A 2ZS6B 1W6MA 1FV3A 3C7OA 5BNNB 3MIDA 1H8VA 3RZGA 4M4RA 4AFCA 5KR7A 4QXCA 5GALA 4AI3A 5FMBA 4XHXA 3VD9A 1BK1A 1AHSA 2V5YA 3VD4A 2DVFA 2FZ2A 3IIIA 1WD4A 2PHLA 3Q8FA 3LKJA 2QQPA 1Y9GA 4FFFA 4JGZA 4XFFA 1LCLA 1ZNPA 2PHUA 1UYPA 2WL1A 1Q8SA 1JS9A 3T30A 2VMHA 1R1A3 2KM2A 3L2HA 5EJ1B 4JKLA 1GUIA 4B7EA 1ZBA1 2RS11 3LD8A 3U4XA 3DXUA 3ZSLA 1VB4A 3RDIA 3S57A 1PMHX 5ERLA 1NX9A 2LS6A 3ON7A 2PAEA 3FLTA 4DPNA 4N53C 1WW5A 3WD5A 5C5TA 3AXEA 1G7YA 1X9TA 1QKQA 1TME3 3J8F1 1RUC3 2VTXA 3CHXA 3ME2A 1N1YA 3N9PA 1W8WA 4GJZA 1BLZA 5FYMA 4JGZC 4ASKA 3MLKA 3NWKA 4ISRA 3S5QA 2HH9A 3E1F1 5J37A 3RS6A 3T2OA 4R4XA 2JJ6A 3WHUA 1V6MA 2JIGA 3ZSKA 1F4AA 2D6KA 5C3RA 4FTEA 1X50A 5FOJB 5JCTA 1YQ8A 1C5HA 4Q4W1 3JD71 4AVTA 5DAVA 4PI2A 3GF6A 4B4RA 4XAAA 2BQPA 3PNAA 4MGTA 1SLAA 4JGYA 3H8OA 1LODA 1VMHA 5A80A 4E2QA 4ZZ8A 2F4LA 1ZZ9A 4JV4A 1PO13 3WDVA 3IZOA 4I0BA 1ASJ1 3J9SA 4HVQA 4IESA 1W9SA 4EE2A 5ABJC 2CNAA 2X5IA 4ZKTB 1J59A 4DEQA 1OOPB 1GQHA 3I54A 4A3ZA 2LROA 1G9AA 4YW2A 4XBNA 3WF0A 1KFXL 1YHFA 1RUG2 1HB2A 3ASIA 5LWBA 3BTYA 4MHUA 2KR2A 2W52A 1BQPA 3DF0A 3WUDA 2J1TA 4JGYC 4M01A 3ACHA 4NPLA 3UGFA 4BE3A 5K8SA 5JMCA 4DOUA 4CEWB 5FPAA 4YFWA 1DHKB 3PTYA 1W99A 2X10A 4CDWA 3GZEA 4XQ4A 2X5IC 1WW6A 1JOPA 2PAMA 4CCLA 4BK5A 1B35B 3SCHA 2W94A 3ZIXA 5CYYA 3WDTA 2WQZC 2XVLA 4AEDA 2R043 1JOJA 1UKGA 2A71A 1YYNA 3M3CA 1FPN3 1V6IA 4P9YA 4LQRA 4TLFA 3TN91 3WNMA 3ZO0B 3RZKA 1KFUL 3EO6A 1UZYA 2Z79A 3HQUA 1OOPA 2NYYA 2VZVA 4CCOA 1C8M3 2VZQA 5T55A 1N3OA 5FZ8A 1B09A 2WN2A 1Q8OA 4XUPA 1SLLA 1RVF3 4WM8B 3U75A 3D3AA 4CDWC 3H9AA 4LR4A 2JECA 4BJ0A 3WR0A 5IVVA 3N35A 2VJXA 5FBJA 4GWMA 3ATGA 3K77A 2FQPA 1CESA 2XKOA 3DN7A 3EXUA 5I0UA 4ZY9A 3ZFFB 4AEDC 1GZ9A 3QCWA 3AZXA 4AGVA 4IEPA 4XAEA 5A1AA 5A6YA 5F7UA 1SBEA 1W9YA 3TRSB 3PIGA 2D7FA 5FOBB 1IQAA 3N7KA 5CB7A 4ZHNA 4P9GA 5F5AA 1ZX5A 1LRHA 1CAUB 2K9ZA 2YC0A 3NSTA 2JE9A 4XIOA 2GSYA 2BGOA 2FMYA 5F6LB 3VUOA 1WLCA 2XJVA 1DYKA 2QZ2A 1E5HA 2OZ6A 5EXOA 3WP3A 2JB4A 4IEWA 2RS51 1GOHA 1C1LA 2VW0A 4UFIA 4CCCA 2J42A 2P17A 4YW3A 5L19A 2PHRA 5GZGA 1UPSA 2PHFA 5FO9B 4WM8A 4CA9A 3POWA 1OURA 4GA9A 4QHOA 1HDKA 3PIJA 4PBOA 4UBGA 3VZKA 4ZU7A 2QQVA 4GULA 1COV3 5LK7B 4W50A 1US2A 3SEEA 1O8SA 3AC0A 1JN2P 3P6BA 1H6XA 4PLNA 2XHNA 4CU7A 1QH6A 4R8HA 4IV3B 2JDYA 4PHZA 1VBA3 2EIGA 1OLRA 1N3QA 1IPSA 1ENRA 3BOWA 1WGPA 3OJBA 4JZRA 3RWKX 5FZEA 1AJOA 1CX4A 1EV13 1RUF3 3FUQA 2XONA 4HETA 4UF0B 2CDOA 3MBWA 3VL9A 1GMMA 4H2AA 1UPIA 4SLIA 2RS33 1R093 1KS5A 4ZS2A 5FCCA 3ZIWA 2IVJA 2YFZA 3JZVA 3TEXA 3SMHA 2W9XA 2ZHLA 1NXD1 4IE5A 4LA3A 2R061 3TNQA 5ACA2 4D6SA 2YUEA 2RR11 5FPXA 3PUSA 1U5ZA 4ZXEA 1CZSA 2ZMKA 2JDNA 4BK4A 2J1RA 1ULPA 1QJU1 2CL2A 4V2WA 3OYWA 1W6OB 4QKDA 2ZEYA 3RG0A 2E51A 3U10A 1EP0A 2D6MA 3WW4A 1MQTB 4UAPA 4XZPA 3MV01 3I2JA 3DPRA 1H4GA 2QDRA 1FT9A 4UF0A 3VV1A 1Y43B 1NQDA 3N7LA 5FPVA 2YPJA 2H0BA 5A3OA 1HV0A 2DVBA 2PHDA 2WQ4A 3OCPA 5J96B 4NR1A 1IPKA 4QDSA 2OKXA 2WNUC 1SMVA 3IMNA 2ADEA 5HCHA 3ZN6B 2RJ2A 5IAVA 4CDUA 1QOSA 3WNOA 3IB3A 2CSGA 1KJRA 2R073 2WN3A 3FLRA 3N3HA 1PX3A 4XEZA 2AENA 2YGMA 2PLV1 2P3JA 2HWD2 2YPDA 3KQRA 1O4ZA 5FP4A 1AUYA 4OZOA 1UU6A 3DPRC 4FCAA 1DP0A 4Y26A 1GICA 1RUNA 3MF9A 1X7NA 1NAEA 1YXWA 3LCPA 5LEKA 3HN1A 1LEMA 2GC1A 1LAJA 3MLJA 5HBAA 4OI4A 5LA2A 2YB7A 4CDUC 1JYNA 2DYCA 3A0NA 3ACLA 1AVBA 4A6OA 3AYAA 1DYPA 2QQJA 4ES8A 4P08A 3DUIA 1Q8QA 1LNSA 1W6QB 1SCRA 2Y6FA 1RUE2 1PO23 5A32B 2XWJB 2W91A 4OLLA 1J1TA 5FZBA 5FZ9A 3UNPA 4ZONA 5FZCA 4QXKA 1DQ0A 4QDQA 4CCDA 1S0BA 1LR5A 1L7RA 1VBB3 2A73B 4Z1VA 3O1OA 4CP9B 3MZHA 1ENXA 3KGZA 1CZVA 1UOFA 5LA0A 4RHV3 3PURA 3PVBB 2P3YA 5AFBA 2NMNA 2VGDA 3FBMA 3OTFA 1EPWA 4ONUA 2BPA2 3U37A 1O3TA 4FP2A 3EQEA 5IT6A 4Z8BA 3NO8A 5C8CB 4MGIE 1MS9A 4HOOA 1XSRA 1BVVA 4IEZA 2RMU3 2FDIA 1W0OA 5EJZB 3VBFB 2HEYF 1NG0A 1DQ2A 1VBE3 2E7QA 4XCAA 1AL22 1R082 5I0SA 1V0AA 2FCVA 4LO6B 4YVWB 2WWUA 1UN1A 2YFUA 3R4DB 4FTSA 3V0AA 5JZGA 3AYEA 3EYPA 3PMSA 3NV3A 2OZJA 1D2SA 4YZ4A 4KWJA 4FQ4A 4LBQD 4DY5A 1SCSA 5GLZA 2A3XA 4D3WA 1TMF3 3PTRB 4AQ6A 2YU1A 2JENA 1FMD3 1CAWA 3M3QA 1F9KA 4FPLA 2Y6KA 2WT0A 4IEXA 4N9IA 1W2OA 3RI8A 3OOXA 1EUTA 1DQ1A 4B1MA 2R30A 5C8CA 5G04L 4JDNA 2OS2A 2NPIA 4O9GA 4MXWA 1QJY2 4DUVA 1UY1A 2O14A 2ZMLA 1UD1A 2CU5A 5AC92 4A45A 3VBFA 2BDRA 1UNBA 3WQ7A 4YFZA 5JZGC 1H6YA 2NLRA 3AXDA 4MH0E 4XZUG 1PVC2 3NNJA 4LEJA 4AFBA 5F37A 5IVBA 4NIHA 4Q0QA 1SHWB 4U2AA 2GH2A 4AI0A 2D6PA 3TOJA 1VBC1 1QJX1 5DDJ1 4AG4A 1YFUA 3WG1A 3NV1A 3UL2A 2XLGA 2J1EA 4LITA 5K0UB 5EYXA 3R4UA 1J1LA 4JTNA 5C71A 2BFUL 4Q1RA 4OQ9A 5FREA 3FLPA 1WW7A 4CDXB 3AP9A 3HPNA 1A78A 4I09A 4JVAA 5FPZA 3VBOA 4DRRA 4KU7A 3F95A 3ZLIA 1QOOA 1NY71 1W0NA 3S7IA 4EZ4A 3HVDA 1IKQA 2CHHA 1XYPA 5E6HA 2XLFA 3K2OA 1CZTA 1DGRN 2LRPA 1ULGA 1W9FA 2XXZA 4I0WB 1WMEA 2I74A 2VZRA 2FDJA 3PU8A 3OB8A 1V70A 4AR2A 2FDGA 4XFHA 3JBG1 3GYDA 2QQIA 2R0FA 4IERA 3T4VA 1HXS1 2DVGA 2DV9A 2ORZA 1NZIA 4FFGA 3VBOC 3T0DA 3TAYA 1WCDJ 4OQ8A 5E1RA 2FHRA 1RUI2 2RE9A 3UETA 5T5JA 4KG0A 2KD7A 2OPKA 4Y4YA 2VG9A 3N9NA 4FO9A 3M70A 4KMQA 1QNYA 4S2DA 1LGBA 1F15A 2IXLA 1VAKA 1LOBA 2A3YA 2Q1ZB 1JHJA 1CJDA 3VDBA 4QPGB 4OULA 5KXDA 3KV9A 3CF6E 3ZPOA 1RUJ2 1RUG3 2EXHA 2Y38A 3LWCA 4Q8LA 2UWCA 4LHKA 1Z0HA 5DZEA 2XHKA 1AXYA 2ERFA 5AVPA 1PGL2 3JUUA 3OGSA 4YW6A 4AAXA 3VGIA 1U5XA 1DGWA 3K46A 1RUH2 2XJRA 4YW4A 3CKHA 2WFF2 3SLIA 3I3EA 1YLLA 2VMEA 5JAXA 5IWFA 4AVCA 1VMFA 3WQBA 3WP4A 4XFAA 5A3TA 1VAMA 3TEYA 2J22A 4G9SB 4S2HA 2VW2A 3ZFGC 2XOMA 1EAH1 4RR3B 1ZRDA 3VZMA 1VE0A 2ATFA 5FZ6A 1D2QA 2W46A 3FWEA 4RSUA 3HBZA 1RUD2 1VJ2A 2G9GA 5FY1A 5T54A 4O7XA 1PK6A 4LLOA 1UF2C 2JB8A 5T52A 2CV6A 3MUZ1 3SNMA 3TNPB 4CPBD 1JI6A 4HN0A 1XQNA 3GZTB 4GIQA 5FPBA 5FY4A 3SH5A 4AFMA 4AEKA 3TYJA 2K46A 2H6CA 1ZM1A 1RUOA 3ZYBA 2IFRA 3WXPA 1S4CA 3I4IA 2VUDA 4A6SA 1SBDA 3K4AA 5L7OB 1DIWA 3CQOA 3KVAA 4HSLA 1BZWA 4URAA 4GQ7A 5E8AA 4Z82A 3KF3A 4LBJA 2VD7A 4AHWA 3UT0A 3EB7A 3MDPA 1PK6C 4KNCA 5LBBA 3EHKA 3VBRA 1ZBA2 5DZFA 5LBEA 4BLIA 5A1LA 3LEGA 1H8TC 4GD4A 2RDRA 4I02A 1EUUA 4QX2A 4ZU4A 5SV8A 1I5PA 4OYUA 1AR62 4CXYA 4IEOA 4INDA 4SBVA 1XC6A 5JOYA 2P4EA 2DU0A 3AMQA 3J8F2 2JD4A 2A6VA 4BXSV 2IZWA 1HRV3 2A75A 1MVEA 1Y9QA 2XDVA 2ZGMA 4BMBA 5BNOB 5IVJA 3C7GA 5HCAA 4GMP0 1NCRA 3ZN4A 3LOIA 2HWE1 5E16A 5C70A 5L9BA 1HW5A 2XQXA 2H0VA 4NROA 3CU7A 4IEUA 4W4ZA 4KL1A 3ILNA 2GC3A 2P1BA 3VBRC 4FFHA 1GYKA 2SBAA 2YBPA 4Q4W2 3IDBB 1H1AA 2WAAA 3JD72 2P5BA 1G9DA 3D0JA 5FYIA 2DCJA 4FSJA 4GMP3 3I2OA 3GCWA 2Y8KA 4F83A 1H30A 3P3PA 4CUCA 3ZXAC 4TSVA 1ENQA 3NNMA 2B42B 2IFWA 1AR91 1H2KA 2BFUS 3IDAA 1ASJ2 2BBVA 4YYOA 1NCRC 1W28A 4NVPA 4IW3A 1DZTA 2Q8CA 4Q4V1 1UX7A 2W92A 4XJ9A 4XBLA 1ZBE2 2DU1A 4Y20B 4Y5Z0 4YNIA 4NIIA 3KCXA 3FHAA 3VL8A 1UKRA 1LULA 2QBXA 4GB31 2YC2A 4AQSA 1D4M3 2AGSA 3KV6A 4LBMA 3AVRA 3RJRA 5SV5A 2VZUA 5FMOL 1XXNA 4AHYA 5LW9A 1VPHA 2ZX2A 4KWUA 2ARCA 3RI9A 5K7PA 1JYIA 5ACA3 1XPWA 2YROA 5BXXA 3ZYFA 3AP5A 1XOYA 5FKBA 4XF9A 5A7WA 5JXIA 1JYVA 5KXEA 3OUIA 3IPVB 4LK7A 1VAVA 5DZGA 2W1SA 2TNFA 1DLLA 4YM1A 5FZ3A 4FAGA 2OXBA 2VQUA 4Y5TA 3VD5A 3QLQA 2JX9A 4CUAA 5JUVA 3THPA 5C4WB 3MW3A 3DGTA 4PBPA 5FY5A 2YYOA 3LFMA 5FBZA 5FPLA 4EROA 2OIIA 2NZ9A 4LBLA 5LA9A 1MZFA 4C0BA 3TN92 1HN0A 1C57A 1AXKA 5CISA 1UU5A 5A3MA 2OX0A 2ARXA 3M1HA 4N7IA 4XURA 4MGZE 3AFKA 3PU3A 1SEFA 5IUQA 5JXJA 5FZLA 1JXNA 4BQ1A 3M4FA 4W6WA 3WY6A 1NCQC 5E88A 4RGGA 3AJZA 1UMZA 1W90A 3ZXLA 1J84A 1NQJA 4YLZA 2JEMA 3N7JA 3JQWA 1OF4A 3B02A 5LRSA 5GM0A 2LM3A 3I2IA 1XYOA 2HWD3 1W3VA 2MNGA 4NHXA 2Q1MA 3VBHC 4BLJA 4AZZA 3CZJA 5JSOA 4XACA 2Y34A 3JB4C 2E7TA 5EPAA 2W5FA 5B4XA 3ZKUA 1SPPB 3WW3A 3T2TA 1W6PA 1YQ6A 2B8MA 2DCKA 2WYSA 1LESA 3NKGA 2G9ZA 2J1AA 4JRAA 4PF5A 5C4WA 3BIWE 1ZZCA 2QZ3A 3ZSEA 3RZHA 1KRIA 4L2NA 4BIOA 1UYZA 4P9LA 1GQGA 1GWLA 2ZACA 3EMRA 3N9MA 2VMCA 1Q43A 4NWWA 4Q27A 4HSJA 4Q0PA 4Q0UA 3E5UA 2BNNA 5M0TA 1WLDA 2RS52 3DL3A 4NRPA 5C6CA 3T1MA 3WF2A 1FI2A 1C28A 1D7PM 4QDRA 5FMCA 1RUE3 2HBUA 1OLQA 2DFBA 3ZR6A 3GJBA 5C3SA 1GV9A 1KXGA 3RFRA 4L97A 4MSVA 2VECA 4GZ9A 1JYXA 4QM8A 1JZ6A 3RGBA 2XVGA 4F7ZA 1BKZA 3LIGA 3VB9A 2JDZA 2WO7A 3DV8A 5IVYA 3SKVA 4NE9A 1O3RA 3X29B 1CR7A 5F8PA 3WG3A 5DG1A 1LHOA 4BH9A 5H9QA 1BEV1 3O1VA 1GWKA 3USSA 3RQ0A 3GJAA 4BDVB 5JOWA 2JG9B 4Y1VA 3J26N 3MIEA 5KHJA 1WCQA 2GALA 2IXIA 3QBQA 5FZDA 3IAPA 4GWNA 3LF7A 2BOJA 2W39A 2QTWB 1V6OA 5FQ0B 5CAZA 4I01A 4JC1A 3N9QA 3CL1A 1O3QA 3GZUC 3IM0A 2PHTA 2WWJA 4ATEA 5J3UA 3AVSA 5CFDA 2WR9A 3KHBA 4OUEA 1AL23 1R083 3U1XA 1V6JA 2J1VA 1XNBA 3T08A 2NP0A 1K5MB 4XUTA 3TEWA 5I0DA 2RR12 2EA7A 1QNWA 4QQLA 4COYA 3S5AA 1T2XA 1CAXB 3CJIA 3ECQA 5A33B 5FZ7A 1ZRIA 3BI3A 4BOWA 1POV0 1QJU2 2ADDA 1YRZA 3BU7A 4LHNA 4GWJA 5FUPA 3AL6A 3ZFEA 1BBT1 3JXSA 5I8TA 3GHNA 1ODNA 1AZDA 3VHNA 2TUNA 4FXGB 2YMZA 2D6LX 1GWMA 1RUD1 1YUDA 2A7AA 3ZMNA 1WBLA 2JDHA 1K42A 4HZFA 1O6UA 4L9BA 2GP5A 2ZKNA 5CFDC 1POV3 2D3RA 3JB8A 4META 1YWKA 4XF0A 1QJY3 4YVSC 1STMA 4X8PA 1VMJA 2CYFA 3H7JA 2C6SA 5DUVA 5EIYB 3HT1A 2AREA 3KGLA 5AC93 3CJIC 4FPHA 4DB5A 1QOTA 1KJLA 4P00B 1PVC3 2LALA 1JH5A 2VZ3A 3ZFEC 5H9RA 1DGRA 1AR82 2BW8A 4R9CA 2PLV2 3URFA 3W9AA 3O12A 3INAA 1CAXA 1OSGA 2FDKA 1HN1A 4QGNA 3MFCA 5D1IA 2WT2A 1WKYA 2OQ6A 2A6YA 2WIIB 2DUPA 2FZ1A 4WBBA 5BV6A 1UU4A 1RMU1 5FP9A 5FY0A 1F5JA 5DAPA 2EXIA 1AR61 2IXCA 2YHJA 2C26A 1FYUA 5A7SA 5GZFA 3W21A 1IKPA 3FMGA 4YGDA 4IGOA 4AL9A 4ET7A 5BNNA 3H1MA 4JDMA 2DF7A 2UY8A 2VCMA 4NHYA 5ANNA 3C7EA 4W65A 4OUSA 2Q8DA 5C7GA 4I2OA 3FFZA 3KQ4B 1W8FA 1NLRA 2W0XA 3MHZA 2GMPA 1MZ6A 1ZREA 3CLPA 1W3XA 5FZ1A 2HEVF 5C5UA 4BQ3A 4TXWA 3WVJA 1RUI3 4Y1UA 5BNNC 1VALA 1AX2A 2G19A 3ABZA 3M2MA 5BUVA 4LBOA 3W58A 4ZZ5A 4BU2A 1V00A 3C8XA 1BCXA 1UZZA 4JDOA 1ZBE1 2V72A 1RUJ3 1W2TA 2FCUA 2V4VA 3BN6A 2W1QA 4XVHA 5A7OA 3U4SA 5AVAA 4K9SA 2HWB1 3VKFC 4CCNA 2ZZQA 3LQCA 3AB0A 2VUAA 2JG8B 4HK8A 3HOBA 4IGQA 5DPNA 1NA1B 2I45A 3BOPA 1RUH3 1JYWA 2D44A 1KITA 2WFF3 1YNAA 1PNGA 1PIV1 2UY9A 4BXFA 1HQWA 3AKPA 3SCGA 2WZR1 3D6EA 3RNSA 3VDDB 3THDA 5KBFA 2P3KA 5A7QA 3KT1A 1VP6A 4UWDA 4B1LA 4XMIA 4WVMB 4AFAA 5I0TA 4DZGA 3A0KA 2ZJCA 1S2KA 1WW4A 2E32A 3D82A 4WVWA 4Y33A 4I3PA 3RZZA 3WNPA 4KQ7A 4NPRA 1U5YA 2UWBA 5DG2A 1OQ1A 4DRVA 3BPSA 2QE3A 5DUWA 1RGSA 3IN9A 2JG8A 3PUIA 5E89A 3AYCA 1FV2A 3KT4A 4WZCA 4H55A 2B46X 4TZDA 3HIFA 1IS6A 1KEXA 4FPCA 2XGXA 1E5RA 1OPOA 5LASA 2GDFA 3UGGA 4Z2AA 1VBC2 5EQUA 1QJX2 2RDQA 2WS92 5DDJ2 4CEWA 5ACA1 5J36A 1PM4A 2VPVA 3AMMA 1REFA 3KMHA 2GC2A 3OPZA 3ZXFA 1ZBA3 2RS13 4NMIA 5FAXA 3T2PA 3WEZA 4AOCA 1CX1A 3BGAA 1OOPC 1B35A 4EV0A 1H2NA 4L92A 3I49A 1ZZ8A 4D94A 2VCBA 4YM3A 1AX0A 3J8F3 3MV11 2BUKA 4AXOA 3I7DA 4S2GA 1M4WA 1NY72 2AUYA 3OY8B 1CWPA 1BYHA 2IXJA 2SLIA 3FUOA 3G6JB 4QX0A 3WNXA 5A7PA 5CFCB 4QHBA 4CEWC 2JD9A 3O14A 4A7ZA 2HJIA 2WUHA 4GKXA 4D6RA 2WQ8A 1UX6A 4E8CA 1TNRA 1CIWA 1Z7S1 4Q4W3 3JD73 2ZGKA 4WM7B 3JBG2 1B35C 3ACIA 4BM8A 1QXRA 4YZ2A 1OVSA 3GNEA 1AF9A 1W06A 2BERA 3BYWA 3DXTA 4KH9A 4TWTA 3ZFFA 2GZWA 5J7MA 5LCWL 1HXS2 2WABA 1LB2A 3DKQA 4E4ZA 4YZ3A 1WMDA 2WA4A 1JZ8A 1ASJ3 2ZHNA 4LHSA 2PN5A 5JSPA 1CAUA 1ZRRA 1NE6A 2P34A 2VAUA 2WSUA 4ITCA 1ZBE3 3WHTA 1W6NB 4WM8C 5FXXA 4YZ1A 5LEJA 3FJSA 3O0XA 4Q4Y1 5GKAC 1YCIA 2Q30A 4LMFA 2E6VA 1LU2A 3OY8A 5IYYA 1PGW2 2HYXA 3I97A 4O9EA 3KV4A 3ZFFC 4DY3A 2ARBA 3NMBA 3WLUA 1WUVA 3IDCB 1IQDC 3ES4A 3H8UA 2PTMA 2ZGTA 5LRRA 1X33A 3THTA 4NHKA 1LOFA 2GC0A 2B45X 4CE8A 1PGSA 1Y7BA 4Y3OA 1VR3A 1W8NA 2WFPA 2ZX1A 3WF3A 4DIQA 2LUWA 1EAH2 4GWIA 1O59A 3UV9A 1AX1A 3TN93 1GP4A 4JQTA 3VZLA 3KF5A 4IV3A 1S2EA 1YJKA 3MI8A 3HJRA 4QPIA 4IV1B 1IG3A 3USUB 4RN5A 2EAKA 3EJKA 4FPOB 1W6NA 1G9CA 4CP1A 2ZX4A 3WUCA 4ES9A 4QAWA 1HKDA 1M06G 1OKQA 5HI0A 3OUHA 3WZ1A 5KC5A 1LOFC 3OGGA 4MXVA 2D97A 3S0MA 2E31A 3BALA 5KHKA 3OD4A 1LEDA 4PQ9A 1LKNA 3S7EA 3WG2A 5GLWA 1NKGA 2WNVB 3KD4A 1AR81 1CJPA 3LA3A 5FMDA 4PJYA 4A7YA 4A41A 4IV3C 2B7YA 3AYDA 1CONA 4QPIC 5IW0A 2ET1A 2ET7A 4Q8KA 4CUBA 1W8TA 3WT3A 1W6OA 2DUOA 2XUEA 4K40A 4L0PA 4LHLA 1ACCA 1MQTA 4URTA 1VBD1 4QQPA 4A42A 3USUA 1S1AA 2RG4A 1ULFA 1WA6X 1S0CA 3A23A 4NAOA 1H9PA 2RS53 1C8NA 2WNOA 4WVVA 3WDUA 5LY1A 4A44A 1CAVB 2N7GA 1FOD1 1TE1B 2B39A 2HWE2 4R52A 4QGLA 3HQRA 4DQAA 5FYZA 5A6ZA 4J6GA 3VZNA 3ZN6A 4OZXA 3AL5A 4EZHA 1DBNA 4GKYA 5KXCA 5KHIA 1X8MA 3I3QA 2WNVA 2NM1A 4FOQA 3BVCA 3BPZA 1MQTC 3DEMA 1QQP2 5FY8A 4XIKA 5L36A 5J48A 2YDEA 1FATA 3AKSA 5FZMA 2CAUA 2JE8A 4JCKA 1GZTA 5D2AA 3ZVXA 4TTGA 1WCSA 5HXMA 2TEPA 4Z07A 3RPQA 4BQYA 1AR92 3ETPA 2ZAAA 4XC9A 5AFEA 2VR4A 3WX5A 2WSVA 3O7OA 3NNLA 1PZ8A 5K9YA 4Q4V2 4PIZA 3O1TA 2WINB 3SISA 1ZVFA 4GB32 2A6ZA 2PXJA 1DGLA 2YBKA 4MYEA 4XDPA 1JODA 4Y1ZA 1CAVA 2HWF1 4JAAA 1AYN1 1C5IA 1Q3EA 1YO8A 2R063 1W6QA 3KCCA 1JTZX 1WZXA 2RR13 3H3LA 4QB6A 5A32A 4BA6A 1AYM1 1F5FA 1IS5A 4XF3A 1UIJA 2R32A 1QJU3 5JWPA 5C33A 2Z42A 5CADA 2P2KA 3NNGA 4RQPB 1NLQA 5F5IA 4CP9A 2W1UA 4COUA 1OH4A 4MHRA 3KM5A 1GU3A 4OI2A 5FZKA 2WAOA 3N9OA 3K3OA 5CVRA 4E4SA 3NKTA 2XMLA 4E2SA 4UW3A 1S2BA 1I3HA 4Q4X1 1S0DA 3AMNA 1MS1A 3BU0A 3OUJA 5IK8A 2J1UA 5IVCA 4IE4A 2IXHA 1S55A 5JXHA 4X6QB 2QQLA 4Y1YA 3VKLA 1S0EA 3PHMA 4BHPA 3SXWA 2EF6A 2KA3A 5KHGA 2Q0AA 4W8JA 4HVOA 3D4KA 4GALA 3CZUA 1RIRA 1GP5A 1W05A 1AR72 2PLV3 2BNOA 3C7FA 3W5MA 3TEZA 2D3SA 2QQUA 4YVWA 4PI0A 2WS91 3IIAA 2WLPA 3MIHA 2FD8A 2HKXA 4E27A 1QJFA 3Q8EA 2K0GA 5I8YA 3KCYA 1QMJA 5DAWA 4K8RB 4FI9A 5FYHA 3PUHA 1W8HA 4GH4B 5JSRA 5C8CC 1RHI1 4HLTA 2J1SA 3ZPYA 4UOJA 1QDCA 1DCSA 3H42B 4AF9A 3UKTA 3RZJA 4OCTA 4YG0A 3VBFC 5KHHA 1ZRFA 1W2NA 4EWAA 3ST7A 4K3UA 5FY9A 5DN2A 4IEYA 4J25A 2V5DA 3H3ZA 5DABA 3BTAA 4RYDA 2X09A 4NO4A 4XOGA 4YVWC 3U07A 4XFGA 4AGGA 4HKOA 4DXTA 4Q26A 1H0BA 3WP5A 3K48A 4EQVA 4H3WA 2ZEWA 5FZOB 4YM0A 3OBZA 4M0HA 5A3LA 3I2GA 4C1XA 2XJQA 2W2IA 2QVSB 4IE0A 4FXKB 5FYTA 1GZWB 1OH3A 5EYYA 1T6BX 2R7EB 1C4RA 4EJRA 2XBO1 2KXLA 2CTVA 4QX5A 1XB9A 1BEV2 5K0UA 1N3PA 1QF3A 1W2AX 2WT1A 3ZYPA 3HD8B 4D7YA 1H1MA 3FN9A 3R4SA 3R05A 4UYBA 1X36A 2D5FA 2TBVA 3MGUA 5F2SA 1OVPA 5FK8A 5FZFA 3ZXDA 4QX7A 4ARXA 4CDXA 2OPWA 4CRQA 1PM7A 5IVFA 1K12A 3E5XA 2V09A 4CCMA 1ZYBA 2A1XA 2JIJA 2ORXA 1VRH1 4IL7A 4XUOA 1DLCA 4AHXA 4FPJA 4EN6B 2VOXA 1PGW1 5CIRA 3RVHA 1GKBA 3B69A 3OEBA 3MW2A 4QKFA 4PLOA 2MEV1 2PYTA 1S0IA 1XE7A 3QH6A 1IS4A 1UY3A 2HEWF 4QPIB 5K0UC 1OFNA 5LBFA 1QGLA 3MFAA 1ZA7A 5F5QA 3FBYA 4C0HA 4CDXC 2VBBA 4XXAA 4CCEA 1G9BA 2BEOA 2EIDA 1BBT2 1BVP1 4HN1A 3ZM8A 3HQXA 4P02B 4ZS3A 4EN0A 1ULCA 2BVVA 3KVBA 1RJ8A 4LXLA 2VMIA 4CEYB 3S6PA 2BP6A 3I2DA 1MR5A 4DXRA 4QPGA 3POSA 3LDRA 3WDXA 2UYBA 4XFBA 4QQOA 1XNCA 2BU9A 4XUQA 5J09A 1WBFA 4XJUA 3ZSMA 5H9PA 3K75B 1CPMA 1DF0A 2Q4SA 1VBC3 1QJX3 2XJSA 5DDJ3 4S2FA 2ZGRA 2WZ8A 3PJYA 3HMYA 3MYXA 4NJ4A 3VBUB 1PVXA 3GBFA 3WW1A 2CGOA 3MIBA 3PDQA 1GSLA 4YW1A 1UYYA 1XJAA 2DCYA 1RMU2 3AKRA 4G4FA 5FP8A 1H2LA 4QT6A 1NE4A 4QPGC 1MVQA 1US3A 4RR3A 4CDQB 2Q1FA 4YWAA 1NUKA 2HWC1 2ZXQA 4OFGA 2MPFA 3PUQA 3VBSB 3ZDSA 3JU9A 1E57A 5FIXA 4FPYA 3AM2A 1V9U1 2A5ZA 2VM9A 1WA4A 3E97A 3VDCA 2EIEA 2VVDA 2LW8A 4RFRB 5A6XA 5FYUA 4LE4A 4MGQA 1N1TA 2GU9A 4XFCA 1JW6A 1D4VB 2OVUA 5GJ6A 2Q8EA 5A3UA 4NWVA 3VLBB 4IEVA 2OUJA 5FXVA 5H9SA 2ZOEB 3PVOA 4HPKB 5BPXA 3Q9OA 5L7OA 1CGPA 1GOGA 3AZWA 2WO1A 3JBG3 4Y5SA 4EYUA 2GN3A 1S0FA 4RR3C 3GZAA 5FLIA 5FWEA 4NUBA 3LEKA 1OFSA 1SLTA 4HANA 2F6BA 1HXS3 2P3IA 3FX3A 4RS5B 5FJHA 3WOGA 1HJFA 4XQDA 1QQP1 4K1ZA 2RM22 4YPJA 1LGNA 1GNZA 4XMAA 3CBNA 1RL3A 2R49A 2WRAA 2ZGOA 4QD2A 2VTFA 3VZOA 3NVCA 2VXJA 1FNZA 4P9JA 1J3QA 5D8AB 4IUGA 3VBSA 3OEAA 5GLTA 4A4AA 1XBFA 2Y6JA 2BJSA 1O4YA 4XTPA 1MEC2 2VOWA 4OHYA 5L7OC 4N43B 4P14A 2ZGSA 2HWB2 3EBRA 1Z78A 4I30A 1XNTA 4D7TA 5BNOA 2ZHMA 5HV0A 4Q2FA 3FC0A 4AI2A 1WMFA 5B2GB 1WLTA 1O8PA 3H50A 4FP3A 1PIV2 4M3CB 5IFPA 5JIUA 5BY5A 1X9PA 2WZR2 4C90A 4XE9A 4YZ5A 3NAPB 4AQ2A 2P6CA 1Y4WA 4KWKA 4COZA 4IDZA 4QHZA 1Y9MA 1UOBA 4RS5A 1EAH3 3J4UH 3WV6A 4P5HA 1BK0A 4QMAA 3T4HB 1OA4A 4CZSA 1JZ4A 1ND2B 4BB3A 1RUF2 3K51A 2ZA9A 4PDWB 2VNOA 1UY0A 2WA3A 1NLSA 4CCKA 4Y4RA 5D8AA 2QQMA 3HNMA 4MX3A 3NV4A 5BNOC 3BTZA 2QNKA 4Z92B 1UY2A 2CDPA 4GAZA 1ULEA 2E26A 2BZDA 4MLOA 5FRAA 1G9FA 3V65A 3FL7A 2UURA 4Y20A 4QGMA 2CAVA 1RXFA 2VOKA 2QQOA 3O5SA 5JI7A 5BNPB 1JZ2A 4AYUA 2VMFA 2A6WA 1MPXA 1JUIA 4PT6A 1IZ3A 1UMIA 3HAGA 1KS4A 2ZKLA 3WQ1A 1ND3B 1CIYA 1AR71 3ILFA 4M3CA 2R1DA 3KS7A 2GNDA 4HMZA 1PNFA
chains in the Genus database with same CATH topology
2D6NA 2Y0IA 3IPVA 1JBCA 3FFQA 5JR7B 3WG4A 1LGCA 3TBDA 4FAHA 1LENA 3B3QE 4P9WA 1H4HA 1QU0A 2VOVA 1CD3G 2D40A 4OHVA 2V73A 5C9AB 4XBQA 1APNA 1IGOA 1LHWA 3VKOA 5I91A 1LOEA 4G3YC 4W6XA 2HWE3 2QCSB 5EJ3A 3RMXA 1ZZ6A 4R9BA 1DGWX 3N7MA 2ENRA 1LOGA 1OHFA 1FXZA 4FPEA 3NL1A 1HIXA 1Z7S2 1V6KA 2GMMA 5C4WC 3B5LB 4B29A 1MS5A 1R1A1 1QQP3 4BWOA 4YW5A 5GLUA 2ZGPA 4LE3A 3BB6A 5FDBA 4DNYA 1DQ6A 3M8LA 2ZMNA 4L11A 1AR93 3AKTA 3B9IA 1O3SA 1SLCA 1Q5OA 1TME1 4Q4V3 3L2YA 3LAGA 3KT7A 5IK5A 1Y3TA 4GB33 4Q4Y2 3ELNA 5JPMB 4ATFA 3WCSA 2O8QA 1F31A 3VHRA 4LBQB 3UKNA 1XRUA 4H7LA 4C1WA 5JDBA 1N1SA 2UWAA 1G8WA 3SH4A 1V6LA 2D93A 4OUMA 4HFSA 2XWBB 1CQ9A 4QPYA 4XFIA 1I9RA 4QQ2A 1SBFA 5FLHA 1PO11 3B94A 4UW5A 5C8WA 2IXKA 1W6MB 5I8SA 3QOPA 1QWRA 4AHZA 4J1WA 4YSFA 5GZEA 2VQAA 4KWLA 2JG9A 4W6YA 4E4DX 4N53B 4BMEA 1SQ4A 4AVVA 1LOAA 4AEJA 5FQ0A 5FMOS 4EN7B 3MF6A 1MS3A 4K7JA 5IK7A 4LBQA 1LHUA 5J98B 2VU9A 2EAAA 1AR73 2BYVE 1K5MA 1GBGA 1QH7A 2QUOA 3AJYA 4OI1A 1ZZBA 5A33A 2JG9C 1FMD2 2R041 2W68A 3MLLA 1IS3A 1D0GA 2PELA 1FPN1 4BZ4A 3B01A 4FT8A 3GBGA 1VBD2 3JCIA 4FTBA 5ABJB 1C8M1 2R1BA 2I2SA 5GZCA 4N53A 1RVF1 2DTWA 1K5MC 4Q0VA 4MGYE 1FOD2 1OQEA 1YIPA 3AFGA 4BPZA 3RYRA 1MZ5A 4YRDA 4JGYB 4M3CE 1BMV2 2Q5TA 3V64A 3RWNA 1G86A 5FFOC 4J1XA 3TB0A 3D8CA 4IETA 2BWAA 2XB6C 2X5IB 2RM21 1BEV3 2PQQA 1FAYA 2WWSA 2YGLA 1ALYA 4B7KA 5F9TA 4AE2A 5ABJA 4IQPA 1MEC1 3NV2A 5BYNA 4JQRA 4K1YA 2HWF2 1DQ5A 5CG9A 1AYN2 3PMEA 4CDWB 1COV1 3MIGA 3R6SA 2ZHKA 2VQ0A 1O5LA 1F2NA 1AYM2 4RD7A 3ZMOA 4B8EA 2A70A 2D6OX 3IT8A 4AEDB 3AP4A 4CTEA 4Q1PA 1DG6A 2CY6A 2JXAA 1BBT3 4IXLA 1VBA1 3APBA 4UW4A 2WZPP 2PA7A 1AXZA 4N90A 4XF4A 2WJSA 1EV11 1RUD3 1RUF1 4XJZA 4COVA 1REDA 4Q4X2 2RS31 3CEWA 2XKPA 1R091 4KU8A 4AFDA 1C3HA 1YIFA 3FZ3A 2QJVA 1LJ7A 3LA2A 1CVNA 5JLVA 3B9CA 4FQZA 1W39A 2PHWA 1NA1A 1QXJA 1VIWB 3LA7A 4K20A 2ZPXA 3H0OA 4L8QA 1OA3A 2QFEA 2ZGNA 5CG8A 2G9FA 4XQWA 3V56A 4PIXA 3VDDA 4AVBA 1RMU3 3DKWA 4DFSA 3VHPA 4WV8A 3D5OA 4HVRA 2DVAA 4GXLA 4WVMA 1RHI2 1AR63 5KWRA 1O7FA 3UKVA 2UU8A 2JG8C 2PAKA 1L3JA 3CJXA 4DXZA 1NA1C 2F4PA 1HQLA 1REEA 1QDOA 1WD3A 2XLAA 2DTYA 2ZGUA 4NHLA 3KSCA 1BXHA 2R071 1XU1A 4XDQA 3VDDC 1WCKA 4XHBA 3GBWA 1OA2A 1HQNA 3N36A 3LGRA 4B4QA 3AK0A 1RINA 2RM23 1XNDA 1RITA 4AW7A 2XBO2 2XJPA 4FPGA 1YFXA 3WQ0A 2WNEA 2O1QA 2XVKA 2ILMA 3AMPA 4FOYA 1HRI2 3O0WA 1HRV2 1MEC3 4ZU5A 1NOVA 4YGEA 5CA6A 4M00A 4A2UA 1IOAA 2HWB3 2XG3A 4FPKA 4XETA 2YY1A 1VRH2 3LOBA 1HX6A 5JI9A 3FHIB 5CFCA 1PO21 3BCWA 3CO2A 2C9AA 3MIFA 4OHZA 4H14A 2WNUB 3JQXA 3R0RA 2QKDA 1ONAA 2MEV2 1PIV3 5T50A 3OYWB 4XTMA 2WZR3 2ZX3A 2G4IA 3ZXJA 1VBB1 4WM7A 3VZJA 5T5OA 4DS0A 4ISQA 1KD7A 4RHV1 3DPRB 1JHNA 4V1PA 3S30A 3PVNA 5CFCC 1UIKA 2CWSA 1D4M2 4A3XA 5DUUA 2RMU1 3NW4A 4EWDA 1W2UA 4CDUB 1PZ7A 2QDNA 2GMEA 2VVFA 4ZXKA 1VBE1 1UCXA 4WM7C 2BNMA 2Q8OA 3AX4A 2GH8A 2WNUA 4B4PA 3CNAA 1Q56A 1A8MA 1ZRCA 2GNMA 3ES1A 4JRLA 1I6XA 2VW1A 2OW4A 2EXKA 4R9AA 2NN8A 1UW8A 3H7YA 1SDWA 1TMF1 5TSWA 2JE7A 1FMD1 2ZCWA 3ZXEA 2GNTA 2HWC2 2I07B 3E5QA 1G6NA 4MUVA 1RJ7A 4AI8A 1V9U2 1S0GA 4IV1A 2IWGB 5BNQA 2YZ4A 2YXSA 4ASMB 4M3CF 2DURA 4P9IA 1LHVA 4RGAA 5T5PA 1Z7S3 2R6QA 2RJKA 3W59A 4ASLA 2XL7A 1BMV1 1Q8VA 3OGJA 1O4TA 3PLQA 1KDMA 4Y24A 4XF1A 2VXRA 4LT5A 4OVEA 1T6GC 1TQ5A 1U0AA 4IV1C 5FTTC 4YM2A 1H2MA 4C91A 4B3NA 3OBTA 4X6RB 5KXBA 2CWMA 2GN7A 3G7DA 4Y1XA 4EWEA 2ETEA 3SHRA 4Q4Y3 4D7SA 1U12A 4M0NA 3FE5A 4RL7A 2NQYA 1PHMA 5I93A 2XJTA 2D5HA 2B9UA 2R0HA 1H1IA 2Y26A 1X82A 3I59B 2WNVC 2DCTA 4F3JA 3V0AB 5JZGB 4HL0A 2DWRA 1I1EA 1TNFA 2Z2SB 2YV8A 1LU1A 2WKKA 3IKWA 4FPFA 4HBNA 1GNHA 3ENRA 1DQ4A 1CAWB 4Y22B 4N9HA 3O0VA 1TEIA 3V0BB 3C2UA 3MEPA 1FNYA 3M7AA 1Q8PA 2VNGA 4MGKE 4MXWB 3E6BA 4LTAA 1RUG1 5HCBA 2X8KA 4UXAA 2GNBA 2XL9A 1ULDA 2IC1A 3I8TA 2A3WA 3L9JT 4LUMA 1QHDA 2VNRA 5T5LA 4BCUA 3I59A 3NJZA 1SFYA 1SFNA 4A7KA 1DZRA 1AR83 4RA0A 4LNVA 4FOVA 3U11A 4AQTA 2WLQA 2VVEA 3UJOA 4OI0A 3A4UA 3SCFA 4Y22A 3B93A 4OHXA 2LTNA 3VBOB 5DUXA 4XXPA 4RQPA 3V0BA 4QM9A 4XPVA 4X8NA 1VBD3 3B7MA 4AVAA 1N47A 4K21A 3POYA 2H6BA 5JIAA 1X8EA 4MVTA 2D3PA 2VUJA 2FBEA 3ILRA 1FOD3 3AZVA 5EFUA 3PJQA 5GLVA 2VY0A 1GANA 4XJWA 5CNAA 4RQPC 3RSJA 1R1A2 3RJ2X 1LOCA 1NZCA 4EN8B 2AZ5A 3D0SA 4AGRA 4KGQA 3UK9A 1UAIA 3ZFGB 3GALA 5LK5A 2O8OA 3AZZA 5JPNB 4GH4A 2Z5WA 5FO7B 1TME2 1RUC2 1PMIA 1HRI1 1OPMA 1DU3D 1MS4A 3ZYIB 1HRV1 1ZZ7A 3MPBA 1HLCA 2B5HA 1MZEA 2HYKA 2ZAHA 3WCRA 3WINE 2C0ZA 2HWF3 4WVZA 1D0HA 2W08A 3AP7A 1AYN3 3H3UA 3SH3A 1V6NA 2NMOA 1NYWA 4BYYA 1AYM3 1AJKA 1LHNA 3ZXKA 1O5UA 4GMP1 3RRDA 2BWCA 4GH4C 1QXPA 3OF1A 4LO5B 1SLIA 2XJUA 4FOWA 1GZWA 1PO12 1PK6B 5HXVA 4Z2WA 4CYDA 3ZX7A 3ZFGA 4COWA 3AP6A 3VN4A 4LBNA 4LO7A 1GFF2 4QQHA 1H8TB 1RC6A 5CU1A 2UYAA 4Q4X3 2ZTNA 1CPNA 2D98A 3MPPG 1D4M1 4P9XA 2ZGLA 5DXDA 1JUHA 4XW3A 4XJAA 3WDXA 5ACA1 1MS0A 3OD0A 2VMGA 5GZDA 4PIYA 4QU2A 1ZA4A 5CBLA 1A6CA 1OMIA 2A6XA 3VBRB 2WS93 5F6KA 1R1ZA 2E7AA 3E6DA 3MICA 1MS8A 1YFYA 2R042 4LA2A 3LSDA 2XPJA 1RHI3 4HKWA 1FPN2 2X29A 4HT1T 4LLFA 4AEMA 4YGCA 2E63A 1J3RA 4I0AA 1H8TA 1NCRB 1C8M2 3E6CC 1NXMA 3AKQA 4CEYA 1PZ9A 3TWIA 1RVF2 5EV7A 4RFT0 4PCRA 4DMIA 1C1FA 1OI6A 3HWJA 2XUMA 2HWD1 3C3VA 1OQDA 1YI9A 4CP0A 2ES3A 1OD5A 2RS12 1CN1A 5IK4A 2DFCA 2XBO3 3VBUA 4LO4B 3WDYA 2ZZJA 2K2SA 4HK9A 4UBHA 5JOXA 4FBFA 4CEYC 4LUKA 1QJZA 3WP6A 3ZYRA 3RMYA 1VLNA 1HRI3 2EALA 2AYHA 4CDQA 1IHMA 3AZYA 3H1WA 1LTEA 4OHWA 1EY2A 3P3NA 1RB8G 4EN9B 1VRH3 3ZN5A 1RUE1 2WC2A 1BJQA 2PHXA 4D69A 1NCQB 2BGCA 1A8DA 3VBUC 2MEV3 1COV2 4KBBA 4AVSA 4HPKA 3B00A 2OUHA 1EYBA 3IBMA 1AL0G 1H9WA 4TYSA 3VBHB 1XU2A 2JICA 2P37A 1KQRA 2R16A 4AWDA 1U5IA 4CDQC 3VBSC 4L99A 1JYCA 3M3OA 4F8AA 1VBA2 5HCFA 1YI7A 3GHMA 1EV12 3ROUA 3VHOA 3ETQA 3ALQA 2RJLA 1RTVA 2RS32 1R092 1WLWA 3HT2A 4IEQA 4E2GA 1XYNA 3UJQA 3M3EA 4N43A 2E53A 5FLJA 1AL21 1R081 3QD6A 4XILA 1NCQA 2MHFA 2JKBA 4RS5C 1XNKA 4XYXA 2DVDA 4UW6A 4K6BA 3AMHA 1W6PB 1A3KA 4ORFA 3IWZA 5EWSA 1LECA 3T1LA 5EZWA 3VBHA 3N4MA 1QY4A 5D8AC 3NAPA 4Q0SA 4LO8A 3WDWA 2CGPA 4U36A 2HWC3 3KB5A 4LBKA 1ND2A 4N43C 4PDWA 1MACA 1V9U3 1POV1 1DZQA 2Z69A 2ZABA 5F1RA 1QJY1 4NOTA 5T3NA 3ZYGA 5AC91 4Q29A 3VKMA 5BNPA 1PVC1 1J58A 4YG3A 3RYPA 1S0JA 2R072 3NAPC 5JVVA 4MV2A 1SACA 1YJLA 1ND3A 1ND2C 4PDWC 1F8VA 2BTVC 4MZUA 3RYKA 2DCZA 2FMDA 4YARA 4R9DA 4H7MA 2ZBJA 3M3IA 1ENSA 1GLHA 2ZGQA 5JOZA 2D43A 5I0RA 5BNPC 1N1VA 4YG6A 1RUC1 5C9AA 1IPJA 2RHPA 1VB2A 4KG8A 5CFDB 2C5DA 4R4ZA 4N7UA 4PLMA 4YVSB 1ND3C 4E9KA 1PO22 3CJIB 3IDEA 2EXJA 3QH7A 1DDLA 4NN0A 3WW2A 3ZYJB 4I3GA 3ZFEB 1VBB2 2OYZA 2GAUA 2PFWA 1GR3A 1RUI1 1HV1A 1DFQA 4RHV2 4WZFA 5C9AC 5FO8B 1O91A 1UL9A 2XH6A 4HKLA 3SITA 1EPZA 2DUQA 1KDKA 4DINB 4BIFA 2X53S 2VULA 4YGBA 4CP2A 4JTOA 1RUJ1 5L73A 1XE8A 1URXA 2RMU2 2E9QA 3OBRA 3MW4A 1GZCA 2Y0OA 3U0ZA 2C1FA 1PGL1 1J3PA 4FVVA 4K8FA 3LB9A 2R062 1VBE2 4YVSA 4JGZB 1RUH1 3LSEA 2O0OA 1SLBA 5KC6A 2ZX0A 2WFF1 2AR6A 3QACA 1YFWA 3ZSJA 4XJ8A 1FX5A 3KZ4C 3LZZA 3ZXGA 3BODA 4LULA 4AK3A 3PVEA 3HR9A 2EVXA 4NHMA 2AH2A 4AI1A 2OA2A 1W0PA 3H1YA 2BVBA 4KGGA 1TMF2 2VH9A 3KLSA 3VKNA 2CGNA 1I5ZA 2ZS6B 1W6MA 1FV3A 5BNNB 3MIDA 1H8VA 4AFCA 4AI3A 5GALA 4XHXA 2FZ2A 1BK1A 1AHSA 2V5YA 2DVFA 1WD4A 2PHLA 3LKJA 2QQPA 4JGZA 4XFFA 1LCLA 1ZNPA 2PHUA 2WL1A 1Q8SA 2VMHA 1R1A3 2KM2A 3L2HA 4B7EA 1ZBA1 2RS11 3U4XA 3ZSLA 1VB4A 3RDIA 2PAEA 3FLTA 4DPNA 4N53C 1WW5A 3WD5A 3AXEA 1G7YA 1QKQA 1TME3 3J8F1 1RUC3 3ME2A 1N1YA 4JGZC 3MLKA 3NWKA 4ISRA 5J37A 3RS6A 4R4XA 2JJ6A 3WHUA 1V6MA 3ZSKA 2D6KA 4FTEA 1X50A 5FOJB 5JCTA 1C5HA 4Q4W1 3JD71 4AVTA 3GF6A 4B4RA 2BQPA 3PNAA 1SLAA 4JGYA 1LODA 4E2QA 1ZZ9A 4JV4A 1PO13 3WDVA 4I0BA 1ASJ1 3J9SA 4HVQA 4IESA 5ABJC 2CNAA 2X5IA 4ZKTB 1J59A 1OOPB 1GQHA 3I54A 1G9AA 4YW2A 4XBNA 1KFXL 1YHFA 1RUG2 3ASIA 2W52A 1BQPA 3DF0A 3WUDA 4JGYC 4M01A 4BE3A 5K8SA 5JMCA 4DOUA 4CEWB 4YFWA 1DHKB 3PTYA 4CDWA 4XQ4A 2X5IC 1WW6A