1QJU1

Human rhinovirus 16 coat protein in complex with antiviral compound vp61209
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PROTEIN VP1
publication title Analysis of Three Structurally Related Antiviral Compounds in Complex with Human Rhinovirus 16
pubmed doi rcsb
total genus 59
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qju100
1PGW2 1MEC3 1R1A1 5D8AB 1RHI2 5BNNC 1AR91 1H8TB 2RS13 1RUD1 1OOPC 1ZBE1 2RM22 1VBC3 1SMVA 4FTEA 4GB32 3VBRC 5CFDC 1BEV1 1VBB3 1X33A 5L7OC 1QJY2 1HRV3 4QPIB 1TME2 4RFT0 1HXS3 1ASJ2 4YVWA 4FSJA 2HWC2 1PVC1 4GH4A 1EV13 1NCRA 5CFCB 3DPRA 1RUH1 1NA1B 2RS52 2Y26A 1AR81 2ZAHA 2RMU3 1AR63 4N43A 1AUYA 2R072 4CDXB 1AYM3 1AL22 4IV3A 4CEWC 1R1A3 1RUJ1 3TN91 4CDWB 5J98B 4RR3C 1ZBE3 4SBVA 1FMD2 1PGW1 1RHI1 1OPOA 4QPGC 3ZFGB 5C4WC 1BEV3 1K5MA 2IZWA 2RM21 2WZR2 4GMP1 4GB31 3NAPA 2HWF2 1MQTA 1QJY1 4JGZC 1TME1 1PVC3 2R042 1B35C 1ASJ1 3VDDB 2X5IA 2WS92 4Q4Y3 2HWC1 4Y5Z0 1RUH3 5C9AA 5ACA1 4YVSA 4RS5C 1AR83 4JGYA 1QJZA 4Y4YA 5D8AA 5JZGB 1PO12 1H8TA 2RS51 1ND2B 4Q4W2 3ZFEA 1VBB2 2BFUL 1RUJ3 3M8LA 2R071 3TN93 4Q4V2 3VBFC 1AL21 1FPN2 4QPIA 1BMV2 3VBHB 1FMD1 5J96B 2RM23 4GMP3 4GB33 5ABJC 1D4M2 1QJY3 5CFCA 2WZR1 1TME3 1ASJ3 1NA1A 1V9U2 2HWF1 3JB8A 2WFF2 4CDUC 2HWB2 2HWC3 5FMOL 2R041 1M06G 4CDXA 2WS91 5AC92 1AYN3 2RS53 4CDWA 1RVF2 1X36A 1PO11 1HQNA 3ZFGA 4PDWA 5FOJB 4Q4W1 2R073 1PIV2 1AL23 1VBB1 1A6CA 4Q4V1 1FPN1 1FMD3 4Q4Y2 2XPJA 3VDDA 1BMV1 4AEDC 2WZR3 1C8NA 2HWF3 1D4M1 1HRI2 4CDQC 3ZFFB 1POV0 2R043 4WM8C 5JZGA 2PLV2 3CJIC 1ND2A 1V9U1 1ND3A 2ZZQA 2WFF1 3VBUB 2WS93 2HWB1 2BBVA 1RUG2 1VBE2 3VBSC 2TBVA 3ZFEB 1F8VA 5AC91 1PO13 4Q4W3 5LK7B 1RVF1 3VBHA 5A33B 1C8M3 4CEYC 4Q4V3 1PIV1 1FPN3 1OOPA 4YVWC 4Q4Y1 3VBOB 1VBA2 2HWD3 2R062 1EAH2 4GH4C 1AYN2 1NCRC 1D4M3 3DPRC 1V9U3 4IV1B 2WFF3 5C8CB 1HRI1 2HWB3 2PLV1 4N43C 2WWSA 1RUG1 1VBE1 4IV3C 5AC93 1RVF3 4PDWB 2DF7A 3JB4C 1R082 1E57A 1PIV3 1K5MC 2RR12 4FTSA 2HWE2 3NAPC 4RR3A 3LOBA 1MQTC 3ZFFA 5BNPB 2GH8A 3VBUA 4N53B 2X5IC 1AR72 1VBA1 1Z7S2 2BFUS 2R061 1EAH1 5C9AC 1AYN1 4YVSC 1ND3B 1HRI3 1NY72 4JGYC 1W39A 1C8M2 2PLV3 5D8AC 1NG0A 1NCQB 1H8TC 5A33A 5K0UB 1RUG3 3ZFEC 1VBE3 3ZXAC 4WM7B 5BNOB 1VB2A 1HX6A 1BBT2 4QPIC 4RQPB 2HWD2 1RB8G 3JBG2 4RHV2 5FMOS 1R081 3VBOA 2ZTNA 5BNNB 5A32B 1OOPB 2RR11 5CFCC 5CFDB 3VBRB 1NOVA 2HWE1 4IV1A 5C8CA 1NA1C 1ZBA2 3J8F2 3JD72 5L7OB 1FOD3 1VBA3 2R063 1EAH3 2QQPA 4CDXC 5DDJ3 1AR71 1Z7S1 1RUC2 1VBD2 1NY71 4CDWC 4NWVA 2MEV2 1VRH2 2WLPA 1C8M1 3ZFGC 1TMF3 1F2NA 2XBO2 1AR92 1AL0G 5GKAC 1POV1 1RUD2 1R083 4CEWB 5BNPA 2FZ1A 1BBT1 2HWD1 1R092 3JBG1 3VDDC 1OHFA 4RHV1 4RR3B 2RR13 4N53A 4QPGB 5C4WB 1DDLA 2HWE3 2RS32 5JZGC 1NCQA 5K0UA 3JD71 1ZBA1 1ND2C 3J8F1 1CJDA 4Z92B 4JGZB 1AR73 1Z7S3 1B35B 1RUE2 4FTBA 1PGL2 1QJX2 4WM8A 4WM7A 5BNOA 4RQPA 2BPA2 1RUC1 4RS5B 1VBD1 1RUI2 3VBHC 1VRH1 5BNNA 1GFF2 5A32A 1POV3 4Q4X2 1FOD2 5CFDA 1BBT3 3VBRA 1COV3 2XBO1 3JBG3 3VBFB 4RHV3 5L7OA 1QQP2 1RMU2 5DDJ2 4CEYA 1R091 2BUKA 1QJU2 5ABJB 1RUF2 1PO22 2RS31 1ZBA3 3J8F3 3JD73 1TMF2 5ACA2 1VAKA 4CDUB 4NWWA 1RUE1 1IHMA 1RUC3 1CD3G 1VBD3 1PGL1 1QJX1 2FZ2A 2MEV3 1VRH3 4CEWA 1RUI1 4QPGA 5C4WA 2XBO3 1AR93 4Q4X1 1RUD3 1FOD1 3ZFFC 1WCDJ 1R093 3VBUC 1QQP1 4JGZA 1B35A 1RMU1 3IDEA 5DDJ1 4AEDB 3S6PA 3FBMA 4EJRA 2RS33 1QJU1 4RS5A 1RUF1 1PO21 4GMP0 4CDQB 1TMF1 4WM8B 1RUE3 1MEC2 3CJIB 1COV2 2RS12 1QJX3 2GSYA 3VBSB 1VBC2 1RUI3 3VBFA 4BCUA 1HRV2 3VBOC 1HXS2 4LLFA 4Q4X3 1RHI3 4CEYB 5ABJA 1EV12 4IV1C 1QQP3 5C8CC 1RMU3 4YVWB 4CDUA 2RMU2 1QJU3 1AR62 4GH4B 1NCRB 1RUF3 1PO23 4PDWC 1AYM2 3DPRB 5ACA3 1R1A2 1ZBE2 1VB4A 1MEC1 3HAGA 4N43B 1COV1 2RS11 1BEV2 4IV3B 1VBC1 5BNPC 4N53C 1HRV1 1PVC2 1HXS1 4AEDA 1K5MB 1ND3C 2VQ0A 1RUH2 1EV11 3NAPB 4CDQA 1AR82 1MQTB 1NCQC 5K0UC 3CJIA 2X5IB 3VBSA 2MEV1 4WM7C 5BNOC 2RMU1 1AR61 5C9AB 4YVSB 4RQPC 1RUJ2 3TN92 1AYM1 4JGYB
chains in the Genus database with same CATH superfamily
1R1A1 5FZCA 4BXFA 4D6QA 1H8TB 4NROA 5IK8A 5JVVA 2RVAA 2QQWA 1F35A 1K5JA 2B7YA 4ZHNA 2W47A 1SMVA 3M3OA 1MS3A 4M3CE 3CZUA 4FOWA 4XYXA 1BEV1 4URTA 2VTXA 3HWJA 5JR2A 2F4PA 3K3OA 1SCSA 2A6ZA 2ZHNA 4QPIB 2TNFA 3OSDA 3KGLA 3NVCA 3TB0A 2IXJA 5LA1A 2DV9A 2HWC2 2QFEA 5FR3A 1FAYA 2WSVA 4IEWA 1EV13 1OUXA 3K3NA 2B8MA 3SCHA 2FDHA 5T5JA 3ILFA 5CFCB 3DPRA 2PHRA 1YUDA 5FPVA 3E6BA 2QQVA 4K8RB 1IOAA 3DL3A 1XB9A 2VQTA 3VDBA 2VUCA 3D82A 4MHUA 2RMU3 5E89A 3ZXJA 4N43A 4KG0A 2WDBA 5F6KA 3T30A 1AUYA 1O3SA 1W0OA 3O0WA 1AHSA 2IXLA 5FK8A 1R1A3 4P9YA 3KS7A 4M4PA 3NJZA 2DURA 3K77A 1RUJ1 1WD3A 2VH9A 1RXFA 1ZA4A 2KA3A 4TYSA 1SACA 4E2GA 1DQ1A 1XC6A 4AEKA 4CCDA 1OPOA 4CYDA 5C4WC 1NAEA 3ZFGB 1BEV3 1HN0A 4GIQA 3BODA 2VCBA 2JWPA 3CZJA 4O9EA 3RQ0A 2B39A 2ZAAA 3RG0A 1OBNA 3THTA 1MQTA 1YQ6A 4CU8A 1V70A 3KF5A 2BGCA 4BK5A 4LO4B 4Q0UA 1W8FA 2R042 2VVEA 5HCHA 4ZZ8A 1H1IA 2OQ7A 3HBKA 2UWBA 4Q4Y3 1JHJA 2HWC1 4QX7A 2ZGSA 5CKQA 4Y5Z0 5HV4A 4KG8A 5IHRA 1MPXA 1GLHA 2GH2A 5FBJA 2WZPP 3OY8A 2K0GA 4CXYA 2YV8A 3KT7A 4Y4YA 5D8AA 3V64A 4BU2A 4FPLA 1W0PA 4A7KA 1PO12 3FHAA 2VMGA 1O5LA 4Z92B 5A3PA 3BU0A 2A75A 4DOUA 3SEPA 4AFMA 4E2QA 3RZHA 1E5SA 1G6NA 4NRMA 4KBZA 1S2EA 4DY5A 1RUJ3 1XOYA 2QQIA 2VQUA 4CP0A 2CTVA 3CF6E 1TEIA 4MGKE 4XCAA 1RYYA 1CVNA 3ZN5A 4AF9A 4NE9A 3CJXA 4LKSA 3WP6A 4MHRA 1UU5A 2BERA 2OUHA 4ONUA 2VAUA 4Z2AA 1W2OA 1D4M2 4JRAA 3V56A 5CG9A 5LASA 2Y0OA 4QB2A 1TVGA 4CDUC 2JE8A 2HWC3 1J1LA 1MS0A 4L0PA 5FMOL 2R041 5EJ3A 2ZX3A 3MLKA 1S0EA 1M06G 5IK7A 1CPMA 4XBLA 4H7LA 2XLAA 3HT1A 3AP6A 1K12A 4ZY9A 4AHXA 4GXLA 5FXVA 1OI6A 1ZYBA 1RVF2 2X53S 5J36A 4PI2A 5FPZA 3DYPA 1T6BX 2Y64A 4QMAA 5KBFA 1DG6A 1PO11 1LHNA 4EYUA 3CQOA 2O14A 4LIVA 4IEOA 4FPKA 3BKZA 2E32A 2XKOA 3GHNA 3WW2A 2PYTA 3ZN6B 2AGSA 4K8FA 2A73B 3SHRA 5A80A 1D2QA 4NIHA 3BGAA 3NNFA 1DHKB 2NMNA 5A7WB 2WZ8A 3VDDA 3LFIA 2XR4A 4ISQA 1ULOA 1YCIA 3JZVA 3RNSA 4AEDC 5JWPA 2ARBA 1XSQA 2RG4A 2ZEWA 4W6YA 2ZGLA 5FWEA 1DYPA 1W6MA 2H6CA 4DEVA 1CESA 2AZ5A 4YG3A 1D4M1 1RIRA 5FYHA 3UT0A 4WM8C 2R043 4UOJA 5JZGA 2Q1ZB 3U37A 2PLV2 3PTYA 1LENA 3N7MA 1IS4A 4R9DA 3H9AA 2YBPA 4GKYA 2A7AA 3BPSA 4H7MA 1LR5A 4YW6A 3UL2A 5DZFA 4L11A 1SG3A 1ENQA 3ZFEB 1ULEA 1F8VA 5LA2A 3ME2A 1PO13 3WV6A 1LHVA 5LK7B 1RVF1 1SLCA 2WT1A 3VBHA 2WNUC 5IK4A 1LODA 1IKPA 2QQOA 1EPZA 2AC1A 2JDMA 4P9JA 2VM9A 5G04L 4XBNA 4W50A 4LBKA 4DS0A 4META 4JQRA 3LA3A 4LKEA 1NLRA 1REDA 5LRRA 3VKNA 2BWCA 4GZ9A 3LDBA 2DVDA 1EAH2 1ALYA 1SEFA 3WF1A 1D4M3 1JH5A 2IVJA 3AFGA 3AC0A 1UZZA 3IMNA 1UZ0A 1XNDA 4PIXA 1N3OA 3U4SA 4NIGA 3MUZ1 3C2UA 4Z1VA 2GMEA 2PLV1 5FZGA 3WHUA 4EWDA 1XJAA 1UMHA 2QTWB 2WWSA 3GYDA 4D7SA 5KHKA 3TEZA 3BOPA 3N9NA 2EICA 2VQAA 3MGUA 4FFGA 1RVF3 1M4WA 3GCXA 2VW1A 3U78A 4EN8B 1R082 4J6GA 5FY7A 2YDEA 3MF6A 1QH6A 5DZEA 5GLTA 3VD7A 4EN6B 1QJEA 4OZXA 1DQ2A 2EXJA 4IEPA 1K5MC 5JOZA 4M3CA 2AACA 4LBOA 4C0BA 4GWNA 1ULPA 4DZGA 4QXKA 3WQ0A 3ZM8A 5JIUA 2W1UA 1LU1A 2X8KA 4KMQA 1YI9A 1QY4A 4UW5A 1GOGA 2GH8A 3U07A 4XACA 3VBUA 1FT9A 3E5QA 4EWEA 4EV0A 3MIHA 1F9KA 4N53B 4LBMA 1IQDC 1WW6A 2NLRA 5G05L 1JUHA 2VY0A 1EAH1 1EYBA 1Q8VA 3HIFA 4QGLA 3LDRA 5DAXA 3UESA 4E2SA 3T4VA 5T55A 1ND3B 1GQGA 4I09A 4JGYC 1W39A 5IFPA 1GV9A 5FZDA 1C8M2 2PLV3 2JICA 1Q8PA 1GWMA 2D44A 2PHWA 2V5YA 5K0UB 1UOGA 4BQYA 3ZFEC 1HLCA 3HMYA 4TN7A 4Y1UA 2AR6A 2JENA 2ZMNA 4ATEA 2NPIA 5BNOB 2WNOA 1VB2A 3VDCA 3W5NA 1HX6A 1BK0A 2G9GA 2WUHA 3L2YA 4RQPB 1XYNA 3JBG2 3WNNA 4JHZA 4RHV2 4YRDA 1R081 1S2KA 2ZTNA 5F32A 3T08A 5IVVA 1UKGA 5EQUA 4QAWA 3MHZA 2YZ4A 3MIFA 4HK9A 3M4FA 2PN5A 4BJ0A 1Z78A 1LHUA 4R4XA 3VBRB 1N1YA 3F2ZA 4IV1A 4E4ZA 3J8F2 4K3UA 1XU1A 1CONA 1E5IA 2R49A 4CUCA 4XFFA 2C26A 1EAH3 1DZTA 1O8PA 4UW3A 2Y6HA 1OQDA 2JG9B 2ZX0A 3ZDSA 2DCJA 2PQSA 2FDJA 3KLSA 1UO9A 5CIRA 2WNEA 1PM4A 4B1MA 1AX0A 1C8M1 4Y26A 2QCSB 3BIWE 4OHXA 1OLQA 4DXRA 4EN0A 1RITA 1UNBA 3JXSA 3THPA 3O1MA 3NV3A 2XH6A 1L7RA 1TMF3 2AENA 1QWRA 1BVP1 1AR92 1AL0G 3SISA 4P14A 1BHGA 1QDCA 1BKZA 1RUD2 1R083 1LHOA 5A7OA 3MW2A 4CCNA 2EA7A 3JBG1 3SNMA 1OHFA 4RHV1 3O1SA 5K4LA 1LGBA 4P9IA 1IGOA 5J09A 4INDA 1CAXA 1LKNA 4MO3M 3A21A 5A7SA 2YMZA 2GNMA 5CB7A 3VHPA 3P5BA 1JW6A 5FZAA 1JODA 1AX1A 3E6DA 1AJOA 4LBQA 2G4IA 3J8F1 1NXMA 4OLLA 4UI9L 4PQQA 4QGMA 5IVEA 3VHOA 2WT0A 1DIWA 3VD5A 3JQWA 4BQ3A 1Y9GA 1RGSA 4Y1ZA 1KQRA 1S2BA 2BZDA 2ID4A 4R52A 4FP3A 3AZYA 2JX9A 4QU1A 3H0OA 4NHXA 4WM8A 4WM7A 4JV4A 5LY2A 3WUDA 4AHWA 1KS5A 3WG4A 1RUI2 5C3OA 3HJRA 3ZXKA 1F5JA 4GA9A 4D8MA 3QCWA 1QXRA 2Q4SA 3WP4A 4YG0A 3I3EA 3UK9A 5A32A 2WNVA 4XMAA 5FZ7A 2SLIA 1JI6A 4Q4X2 5FZOB 2VOXA 3AXEA 1FOD2 1C5IA 5BV6A 4AQSA 3I49A 1BJQA 4FXGB 3JBG3 1CX1A 1F4HA 2ET7A 3N7JA 3PUAA 1HB3A 4RHV3 5L7OA 3LPGA 1QQP2 1W2TA 1YQ5A 2XHKA 5DAVA 4GWJA 1JYNA 1WGPA 4NJ4A 5FLHA 3ZSMA 1C5HA 2CWSA 2R30A 4U36A 1LOFC 5LWBA 4XPVA 1X9PA 2BUKA 1CR7A 2EXIA 3I3BA 3PNAA 3WNPA 5ABJB 1RUF2 4H55A 3J7NA 3J8F3 3WHTA 3OF1A 3WY6A 1LOBA 5LA9A 3BVCA 1YLLA 3ZKUA 1VLNA 5KXBA 4AL9A 4A4AA 1SDDB 1C57A 1YHFA 4NWWA 1VRBA 5IT6A 1IHMA 1LESA 3IZOA 3UGHA 1CD3G 4CZSA 4BOWA 1CZTA 3GDBA 4CTEA 5C3RA 3V0BA 3W58A 3WF4A 2E53A 1NX9A 1LCLA 2G1MA 3MEPA 4AVAA 3ZLIA 2FDIA 1RUI1 4LKDA 4YNIA 3KSCA 5GZDA 4QPGA 4BMEA 4PIYA 4UT5A 5I0RA 1AR93 2YFZA 1O59A 4KWLA 3OD4A 1H2LA 2CWMA 1RUD3 1X8EA 4Q4X1 5EV7A 1FOD1 2BOJA 1RINA 5KHHA 1WCDJ 4LMFA 3ZMOA 1MZEA 3ZDVA 2DFBA 1KEXA 3W5MA 1CAVB 2XWJB 1OPMA 1QQP1 1ZRRA 4JGZA 1OQEA 4LO6B 4N9IA 1B35A 5F9TA 4LLOA 2I2SA 3U11A 2J1VA 3AK0A 2XWBB 3RJRA 2XUEA 2C0ZA 4NUBA 1YQCA 2GMPA 4AI1A 2UY8A 1RUF1 1W9YA 2E51A 1A3KA 5JIAA 3SH3A 3WG1A 4MXWB 2LM3A 2TUNA 4E8DA 2DFCA 4YW4A 3NKGA 2B42B 4LO7A 4AVVA 1HKDA 2ARXA 1MEC2 1RJ7A 2OPWA 3CJIB 4MLOA 2VZUA 2WIIB 4IW3A 3KM5A 1XYPA 3NV1A 4LK7A 3ZO0B 2O0OA 3VBSB 4CU6A 4WZCA 2BBAA 1VBC2 3ZSEA 2QQKA 1RUI3 1UOFA 2GMMA 4BCUA 3E97A 5C7GA 3RYPA 1U0AA 1HRV2 3VBOC 1ULDA 3ZYFA 1YO8A 3HPNA 4LLFA 1W8OA 4Q4X3 3USSA 5FYUA 4CCLA 2E31A 4JTOA 4CU9A 5IAXA 4K1YA 2GAUA 1QQP3 5C8CC 5A6YA 4HANA 3SXWA 3TOJA 3O5SA 2NQYA 1WLDA 5F7UA 1C28A 3MUY1 2CHHA 4NIIA 1YWKA 2W92A 2DUPA 3AP7A 3I2DA 3J7HA 1RUF3 3HT2A 3MV11 5KR7A 1OD5A 2W2IA 5JUVA 4PDWC 4HLTA 2WWJA 4O7XA 2V09A 2OIIA 3DPRB 3H8UA 1T6GC 2WO3A 3CMGA 3POYA 2VZ3A 2QQMA 2VZQA 2DBIA 3N35A 4XJUA 3C7OA 4IUGA 4ES8A 1MEC1 3H3UA 1V6IA 4N43B 2XL7A 3RI8A 3ZYGA 2RJKA 3I2OA 5JDBA 3VGIA 3IKWA 3LB9A 4UF0A 5A7NA 1VBC1 2FDFA 3LKJA 5FZMA 5EJZB 1QOOA 5DZGA 1HRV1 1L7LA 4IE6A 1QXPA 4CPBD 2YROA 4D7TA 5A3WA 2QQJA 1UWWA 2JDAA 1ZRIA 2JDKA 5LY1A 1RUH2 5DXDA 3LQCA 1O3RA 1YFUA 1AR82 1MQTB 1NCQC 2BGPA 4CDQA 4DNYA 2XLFA 2W87A 4M0HA 1H6XA 2ZMKA 4CXXA 2JE9A 1PMJX 3ROUA 3RYRA 4P5HA 4AE2A 1MS9A 5JXIA 1ZZ7A 2MEV1 2ZGOA 3POWA 1UYXA 4DUWA 1QOSA 4YLZA 2EIDA 1STMA 1JZ2A 1RTVA 3OY8B 3LWCA 4AI9A 4K1ZA 1WCUA 4ORFA 1PGW2 1MEC3 2WT2A 5D8AB 5BNNC 2X09A 2DVAA 2YC4A 3TEXA 1H2KA 1XE0A 5A3OA 1J58A 3ON7A 1VBC3 4OYUA 5CFDC 3H1MA 4BLIA 3GHMA 3POIA 4COYA 5FY4A 3U0ZA 1OUSA 4IXLA 1QNWA 1QJY2 2VCCA 1HRV3 1W6QA 1TME2 3WDTA 3J7MA 1ASJ2 4YVWA 2IXHA 3RFRA 1LHWA 1AXYA 4M0NA 5FZ9A 4L97A 1UN1A 4GH4A 1IKQA 2E6VA 2VZTA 1KITA 2MHFA 3KQRA 4IQPA 2LW8A 2FMDA 3MYXA 4YARA 2A6VA 1RUH1 3T1LA 2Y6JA 4HETA 3VL9A 3WD5A 5F1RA 3KWVA 1AR81 2JG8C 4XJ9A 4BH9A 4XZUG 2GN7A 4NRPA 1UZVA 1GSLA 3DF0A 2R072 5A1AA 3M3EA 4IV3A 4TZDA 4CEWC 3IIAA 3EQEA 1C4RA 1N47A 3ZIXA 4OUSA 1V6LA 2ZX1A 3B93A 3GGLA 4RR3C 3K75B 4DMIA 2UYAA 1FMD2 1VAMA 1PGW1 1W05A 3CL1A 3FWEA 3MIDA 2QDRA 3UJOA 3N7LA 2GP3A 2R32A 5HBAA 5FUIA 2K2SA 3KCCA 2RDSA 2QJVA 2QE3A 3M3QA 4GMP1 2WWUA 3A0NA 3NAPA 3OBAA 4CCKA 5FYVA 2HWF2 1QJY1 1W3XA 4QQOA 1TME1 1ASJ1 5JAXA 3VDDB 4OZOA 2WS92 2OA2A 1XBFA 2P34A 3ZYHA 3OEBA 1RUH3 3WG2A 5ACA1 5C9AA 3I3MA 1W6MB 4RS5C 1AR83 5HV0A 3KV6A 2XOMA 5LBCA 4AFDA 1QJZA 1XYOA 2AREA 3OUIA 5JZGB 3I7DA 4QX1A 2V72A 4TSVA 4BHPA 1WA6X 4XW3A 5JI9A 3NJVA 4OQ8A 4W4ZA 4MGSA 4B8EA 4QKDA 4Q0PA 3FJSA 5HCAA 2R071 3I2GA 3MF9A 3MIGA 4LBNA 1OFNA 3VBFC 4CCCA 1YIFA 4HPKA 4S2FA 3I59A 1BMV2 5DUVA 4FPHA 1UZYA 3NO8A 3VBHB 3TNPB 2J1SA 1FMD1 4O61A 1PM7A 1GZTA 1YIPA 3D5OA 4FI9A 4GMP3 4COWA 4A3XA 1SLLA 2YU1A 3OGRA 4DRVA 4QDQA 1QJY3 4FPGA 1W04A 1TME3 5FXXA 1ASJ3 1NA1A 2HWF1 1OXCA 3JB8A 2MNGA 2HWB2 5A3TA 1DCSA 4LKFA 4CUGA 3S57A 3V65A 5GLWA 3HNYM 3WW4A 3O1TA 5DG1A 3AP9A 3CIHA 2Q8EA 3ST7A 1VPHA 4CDXA 2LUWA 2WS91 3WQ7A 1OD3A 1U5IA 5BY5A 3KMHA 5KHJA 4D3WA 2X05A 5A7QA 5AC92 1LRHA 3L2HA 4CDWA 4YZ1A 5F39A 3IN9A 3HD8B 1O4TA 1MS4A 5FUNA 4NAOA 2J7MA 2AYHA 1HQNA 2VJXA 4WBBA 4PDWA 5CU1A 5E6HA 3WNLA 2R073 2P1BA 2D5FA 3N9QA 3OB8A 1H2MA 5EPAA 4CP1A 1PK6A 2GN3A 3I8TA 2XUMA 3WT3A 2A6XA 1FMD3 4Q4Y2 1JMUB 5FZFA 4MGIE 1O6UA 1CGPA 1UY4A 3NNGA 4OVEA 3B5LB 3WNOA 1BMV1 3VD9A 3A0KA 1FV2A 4M3CB 3BIEA 4PHZA 3O12A 3VN4A 1QF3A 2HWF3 2WYFA 2IFRA 5FY1A 3GZEA 2WO1A 2GP5A 1POV0 4DO0A 4LA2A 1SBEA 1ND2A 3VBUB 2WS93 2DCKA 1OMIA 2HWB1 2JKBA 3QLQA 5FIXA 3ZSJA 2BBVA 1F31A 4XUNA 3I54A 4QX8A 4GD4A 4HMZA 5KXDA 2VCMA 4AGGA 3Q9OA 1GR3A 1ZNPA 3EBRA 4WZFA 5AC91 2PELA 1WCKA 3ZYJB 2DVGA 3C7EA 3WCSA 4UW4A 3ILNA 4P5YA 3MIBA 1TNRA 4IE0A 2EIGA 1V6JA 1W03A 4RFRB 1KD7A 4CEYC 2GNBA 3MLJA 1UY0A 2DCZA 3H8XA 5FYTA 3AVRA 3OBRA 4LUKA 3CKHA 4V2VA 3RDIA 4FAGA 5FPUA 3BTXA 1V6KA 2K46A 4B29A 3A7QA 2IVIB 1D2SA 3DXTA 3MICA 4Y22A 3ASIA 1IPKA 3MO4A 4B4QA 4Q4Y1 5GLZA 2QQNA 2WO2A 2ZHLA 1VBA2 3SITA 2HWD3 2R062 1TNFA 4LO5B 4XFGA 5IVJA 1NCRC 5B4XA 3H3ZA 1IQAA 1YFXA 2BQPA 3T4HB 4K40A 1GQHA 1P8JA 4IEUA 1OVSA 3PU8A 4IV1B 5H9QA 2HWB3 2B9UA 5T52A 1SHWB 1GNHA 4BXSV 1JHNA 1DLLA 1SQ4A 2VG9A 5IFTA 2VE1A 1VAVA 1UU6A 2XJVA 3POFA 5B4NA 2D7FA 1HQWA 5AC93 2I07B 5FQ0A 4ES9A 3SQOA 5IAVA 4Q1RA 3WDUA 2HLEA 2G9FA 1AXZA 2R1BA 3WVJA 4A41A 3O1OA 4S2HA 4YFZA 5A3MA 1W9FA 3CHXA 1XNAA 1GYKA 2XJTA 2ET1A 1OF4A 1ZZ9A 4RR3A 3LOBA 4XURA 2ZHMA 3O14A 3H8OA 3EXUA 3ZFFA 4F3JA 1DQ6A 4AEDB 3JUUA 4E4SA 2XVLA 2BV4A 2KXLA 1V6OA 3ILRA 4FP2A 3GM8A 2X5IC 4BIFA 3M7AA 5EFUA 1VBA1 2D3PA 1SBFA 4LUMA 1HJGA 2R061 3RPQA 1YI7A 2WFPA 3GNEA 3KT1A 4AI8A 1CAXB 4YVSC 1ZRFA 2QVSB 3AKPA 1NY72 2WAOA 3WUCA 3WSOA 2Z69A 3VV1A 2K9ZA 4YGBA 2E9QA 2W1WA 1PZ7A 4URAA 1H8TC 1O7FA 4JTNA 4LBQB 2YUEA 5A33A 2ILMA 2D6LX 5L73A 3FN9A 1Q3EA 3ZXAC 1CJPA 1PVXA 4WM7B 3WQ1A 4IEXA 3IM0A 4QPIC 4DEQA 1RB8G 1GICA 1JYCA 2WL1A 3VD3A 2D6KA 5FMOS 5H9SA 1G9CA 1RC6A 1VMJA 2XB6C 1ENRA 2Q1FA 5FP4A 4HL0A 5A32B 2WNVB 3D8CA 1NUKA 1OOPB 4YZ5A 5F3IA 5CFCC 4LK6A 2Q8DA 5A6ZA 1EP0A 1MACA 3MDPA 4AFCA 3N3HA 4AFBA 1ZBA2 5L7OB 3S5AA 1NQJA 3HQXA 3QACA 2DUOA 4YSFA 4LBQD 1VBA3 2R063 2CU5A 3ZXDA 3PLQA 4YM3A 4HN0A 5J1XA 2VPVA 3KD4A 4Y20A 1RUOA 3IPVB 1RUC2 1MVQA 2YB7A 3PTRB 1NY71 1FI2A 4LIUA 4NWVA 1F4AA 2WLPA 3PU3A 3WDVA 3PJQA 3FZ3A 3OBZA 5FAXA 4XILA 3ZFGC 1DYKA 3BYWA 5FDBA 4PLMA 1F2NA 2QZ3A 2ERFA 4Q1PA 4R9CA 5FZEA 4LQRA 4AGVA 5L9VA 1RXGA 3V0BB 1J84A 2ZA9A 1W6OA 4XF3A 2RDQA 5BNPA 4JC1A 4V2WA 1R092 1ZREA 4KWKA 4O9GA 3VZNA 2P6HA 4QPGB 2A3YA 1DDLA 2F17A 1Y4WA 1UYYA 2W46A 3S0MA 3FL7A 3URFA 5I93A 2E7TA 5FY0A 5F8PA 3OGGA 3RWNA 1ZBA1 1WBLA 4JGZB 1WLWA 4UFKA 1JS9A 5CG8A 1B35B 3PL0A 2VL4A 1O3TA 1UL9A 3SMHA 1APNA 1UYPA 1FXZA 3PHMA 3PVNA 4P9XA 1UMZA 4QB1A 3ZR6A 5I0DA 4FTBA 5FZBA 2BRTA 1EY2A 2HKXA 1N1TA 1YFYA 2BPA2 2ZX2A 1RUC1 5JSRA 2Q1MA 4DXTA 1E5RA 2PAMA 1HW5A 4C1WA 5GZGA 1EUTA 1G9FA 1K3IA 2XJSA 1JYWA 4QQPA 1QEXA 4QKBA 1Y9QA 1UIJA 1H8VA 3OD0A 2QQLA 3AFKA 3MBWA 2V4VA 1COV3 3VZMA 4GULA 5CNAA 4IGQA 4KNCA 3LA2A 1ENSA 3RSJA 3M3IA 1RMU2 4CEYA 1R091 3H1YA 1F5FA 4LORA 4MX3A 5EIYB 4BK4A 4H3WA 3WQBA 2DTYA 3BI3A 5DG2A 2Z4FA 3KCYA 2ORZA 4XQDA 3MPBA 3ACIA 1XNCA 2WN2A 2XONA 3RZGA 2BDRA 1PO22 1CAUB 1I9RA 1ZBA3 2H0VA 1SZBA 4HVOA 4RSUA 1TMF2 4ASKA 3H50A 3N9MA 1VAKA 5F2SA 1HV1A 1AXKA 2Y6GA 3GZAA 5FY8A 4MGZE 4XXAA 2D3RA 4OQ9A 3WP5A 1GWLA 1RUC3 2CL2A 2WJSA 3P6BA 3PUSA 5GALA 1QOTA 5CZKA 4EWAA 4XF0A 2LRPA 1I6XA 3MW3A 1OKOA 2BNMA 2PXJA 1NQDA 2Y8KA 3M3CA 4M3CF 5FYSA 1JZ6A 5FK7A 2XQRA 3KV9A 3THDA 3H42B 3H7YA 3M2MA 3PMEA 5C4WA 5EYXA 1HB1A 1UXXX 2RJ2A 2XKPA 2OYZA 4LA3A 2FMYA 1GMMA 1W0NA 1DQ0A 2EVXA 3EJKA 4UF0B 1R093 2ZGRA 3VKFC 2WKKA 3OBTA 2Q8OA 1RMU1 1WMEA 1LOCA 4YW3A 3N7KA 3RS6A 4EJRA 1KFXL 4UFIA 1QIQA 1LAJA 1PO21 5F2WA 4CDQB 2WQZC 1MZFA 5EJ1B 1TMF1 2YY1A 3N36A 4LT5A 2D43A 5L9BA 1XE8A 2RS12 2GZWA 4NHKA 3MI8A 1FNYA 1SLIA 3E5UA 2WZEA 5DAWA 3IT8A 2NM1A 1WA4A 4MH0E 1BQPA 4IEYA 3NNJA 5E1RA 3A22A 2OX0A 2A5ZA 3DKQA 4P9WA 2J1UA 2OW4A 2P17A 5CBLA 1HXS2 3VDAA 1ULGA 4G9SB 3IIIA 1G9BA 4JKMA 1W8ZA 1REFA 1LOGA 3I3DA 1RHI3 3AKQA 5A3LA 4CCEA 1YJLA 2RHPA 5F3EA 1GOFA 3J7LA 4IESA 1RMU3 2KD7A 1W6QB 1CN1A 5JXJA 1XNKA 4YVWB 4CDUA 2A70A 4LULA 4MZUA 4XE9A 4GH4B 5IW0A 4RGGA 5CA6A 4A3ZA 1PO23 3VB9A 5FKCA 5CADA 3S30A 4YG6A 4DPNA 5FZ6A 1S0GA 5IATA 3AMMA 3D0JA 1IPJA 4FPEA 5FTTC 1MZ5A 4NIAA 1DLCA 1PZ9A 3O1PA 4K21A 4Y33A 1QJFA 1ZBE2 3AMPA 2RS11 2VZVA 4PLNA 5DMYA 3BOWA 1UQXA 3E6CC 3BTZA 3OPZA 1C1LA 1JN2P 4UWDA 4HOOA 4IV3B 4XHXA 3Q8EA 5FMBA 5H9RA 4JHTA 3TNQA 5AVAA 3QD6A 1X9TA 2VMIA 2JD9A 3I2KA 4D6SA 4N53C 4AWDA 4L2NA 2CAUA 5LZ6A 4PCRA 1PVC2 1HXS1 4AEDA 2ADDA 3PURA 4ARYA 4HONA 4LXLA 2CDPA 4UFHA 1V6MA 2E63A 5L19A 1ND3C 2FDKA 5J3UA 5JOWA 3FUQA 2P5BA 3NAPB 4QX3A 2I45A 2H0BA 2VCAA 2FD8A 5K0UC 1N1VA 1OSGA 1WMFA 4JCKA 4XIKA 1AX2A 2VGDA 2JDNA 4LITA 3LAGA 2ZXQA 4QQHA 4BLJA 1CIYA 4Y1XA 1W8HA 5BNOC 2C1FA 2PA7A 2W3JA 3RZLA 4FFIA 4QKNA 5C9AB 1NT0A 4RQPC 1X50A 1WCQA 4ZU5A 2CY6A 3RZKA 4M4RA 2ZEZA 1H4HA 2TEPA 1LEDA 1AR91 2RS13 2WNUA 4LHKA 3SKJE 3UGGA 5CKNA 1TE1B 1RUD1 5C5TA 3V0AA 4MYEA 1ZBE1 5GM0A 2VVFA 4YM2A 2XVKA 3PUHA 5LEJA 4FTEA 1ZZCA 3VLBB 4GB32 3POEA 3VBRC 5HPOA 3TEWA 1GWKA 1Y43B 2C4XA 4LJHA 4XJAA 1VBB3 1X33A 1XPWA 3OPTA 2CV6A 2Z2SB 4RFT0 1HXS3 2ADEA 2VZPA 1S0FA 3I59B 4Z07A 3TWIA 5KWRA 3UNPA 4IL7A 2A71A 1SPPA 2JG9C 3ETQA 5EP9A 1G7YA 5LCWL 1OH3A 1PVC1 1VP6A 1GNYA 3KHBA 4XAAA 2ES3A 4LEJA 1CPNA 4PBOA 2CNAA 5FREA 1SFNA 5KHIA 1YC61 3LEKA 4JKKA 1NA1B 2RS52 4QGNA 2ZAHA 4JDMA 2P3KA 2D93A 2DYCA 4JDOA 1KRIA 5FZ8A 3HN3A 4LTAA 1OFSA 2HEWF 3NW4A 2W5FA 3SLIA 5T5OA 2ZEXA 3S5QA 4CDXB 2V5DA 2ZKLA 4FAHA 2RV9A 4HVQA 1MS1A 3INAA 4OI4A 3U10A 4CDWB 1WZXA 2YC0A 5J98B 3GXUA 3OOXA 5LATA 1ZBE3 2BU9A 3B69A 2LTNA 5HCBA 1K5MA 2D98A 2IZWA 3HNBM 3HOBA 3EHKA 3OCPA 3P3NA 4IEVA 5JLVA 3WNMA 2JB4A 4GB31 3AZXA 2D97A 2IFWA 4AXOA 4Y1YA 2AH2A 5FUPA 1DYOA 2W1SA 3G7DA 1PVC3 3I3QA 3KV5A 4FPCA 1Q8OA 2FCVA 4BQ4A 4I3GA 4CP9B 5D21A 3K51A 3AYDA 1Z0HA 3FE5A 3LSEA 4R9AA 3VKMA 3BTAA 4MADA 1J3PA 2W9XA 4JGYA 4GQ7A 2VNVA 3H7JA 4NRQA 4EZHA 1O91A 2R16A 1WUVA 3KVAA 4PIZA 5BXXA 4IE7A 3WOGA 2RS51 1A78A 1ND2B 3KHCA 5FCCA 3ZFEA 5E16A 2J1RA 4XFBA 2R6QA 1K45A 5SV5A 2BFUL 3BCWA 3O1UA 5F5CA 1LOAA 1FPN2 2E7QA 5JXGA 4XJZA 3FFQA 4AYUA 3D4KA 3ZX7A 2D6MA 1H4GA 5FZ3A 2A6YA 5FMDA 3WG3A 2EXKA 2VW0A 4MGTA 3SCFA 3UKNA 1LEMA 5J96B 1G8WA 3S7EA 4GB33 1JUIA 3AXDA 3OG2A 3Q8CA 4Q2FA 5ABJC 3NNMA 2HBUA 3VD4A 2HEVF 2J22A 4V1PA 2Y6KA 1CQ9A 1V9U2 2WFF2 3GJBA 2CGNA 4Z8BA 4HFSA 5ERLA 2ARAA 3PJYA 2ZX4A 4A2UA 4DFSA 4OI1A 1LECA 2E33A 5FMCA 1A8DA 1XRUA 3L9JT 1QGLA 4IERA 1AYN3 2RS53 2FCUA 3R0RA 1X36A 4QXBA 3WDYA 1FYUA 5L36A 4YGDA 3R05A 2IXCA 2GDFA 2G19A 3B9IA 2FBEA 2RDNA 4OI2A 5FXZA 4CVUA 1WBFA 3ZSKA 5FQ0B 1W8UA 3EO6A 3THCA 1GP4A 1FPN1 2NYYA 4W6XA 3D0SA 3HN1A 1SLAA 3HEIA 2AEZA 1S1AA 3AKRA 4NPMA 3VHRA 5B2GB 1GQPA 1YQ2A 4HSJA 4XF1A 4EN9B 1KXGA 1S4CA 1KDKA 1LNSA 3LIHA 1HRI2 5FY5A 2ORXA 1UF2C 1FATA 3ZFFB 1U12A 2YPDA 4AEJA 4HKLA 1YEWA 4C1XA 3CJIC 4WVMA 1V9U1 1TZOA 2Q5TA 1ND3A 2WFF1 1JOBA 4HKWA 3VBSC 4B4PA 4OHYA 2Y34A 4GAZA 1O3QA 3ACGA 1OKQA 1Q5OA 3VL8A 3D3AA 1TG7A 2JIGA 2Q30A 4NHLA 4QHOA 4PQ9A 4XJWA 1XSRA 1UX7A 3WINE 3OUJA 3OYWA 5A33B 3N9PA 4ISRA 4XUQA 4K20A 3FLRA 3AMQA 2WC2A 5DPNA 3ACFA 1PHMA 1FPN3 2R0HA 3ETPA 4KU8A 3RRDA 1DGLA 2XMLA 1FNZA 3DN7A 3NWKA 4N9HA 5IVBA 4PF5A 2V73A 4QHBA 4ASMB 1X7NA 1ZZ6A 2VR4A 5EYYA 3ALQA 1OC1A 4OFGA 4A45A 4DUXA 1LOFA 5F6LB 5HXVA 3OPWA 4Y5SA 2VU9A 3DPRC 4XFHA 3AB0A 1C3HA 3K4ZA 1V9U3 2VD7A 2WFF3 1HRI1 5DUWA 3QH6A 3BALA 1XE7A 2LALA 4M00A 2PHLA 4N43C 5A1FA 3B3QE 4KGQA 5I8TA 4QKFA 4W8JA 2W94A 2XHNA 3GJAA 3DKWA 4Y20B 5C3SA 1CX4A 1O5UA 2VMDA 4QPWA 4Y5TA 4TTGA 3DYOA 3ZIWA 3JB4C 5LA0A 1H9PA 5FZHA 3WCRA 5JR7B 3I2FA 1O4ZA 4PI0A 4Q29A 2GC0A 3ACHA 4BQ5A 4H14A 2ZHKA 2EIEA 5GZCA 1QU0A 1NZCA 3K46A 1I3HA 2HWE2 3WLUA 3LEGA 1RL3A 4AOCA 4BWOA 3POBA 5KHGA 1MQTC 4ZONA 4AGRA 4BQ1A 5BNPB 3IDCB 3QBQA 5FY9A 1A34A 1W06A 2XJPA 3KB5A 3RJ2X 2VNGA 4NR1A 4QM9A 3UYJA 3AZWA 3RZMA 1AR72 1H6YA 5T5PA 1D0GA 3A23A 1JZ7A 2EXHA 3IDBB 4GJZA 1HRI3 2WABA 3EB7A 2PHUA 4UYBA 3ZPYA 2DCYA 5D8AC 5SV8A 1NG0A 5DN2A 4CCMA 3MFCA 4UAPA 2ATFA 4KI5M 5I0TA 1WKYA 1MZ6A 4FQ4A 5E8AA 2ARCA 3KVBA 4YGEA 4AHYA 4J25A 5BPXA 4KBBA 4P08A 2QDNA 3KGZA 2VO5A 1DZQA 4JAAA 1GOHA 5FP9A 1UX6A 4I01A 2HWD2 2UURA 4XBQA 5FZ4A 1OURA 2XJQA 3NL1A 5FZOA 3VBOA 2JECA 1EPWA 2WA3A 1QNYA 2C6SA 5EXOA 3AKTA 4BZ4A 1NE6A 2CGOA 3SH5A 2KR2A 4C90A 4N7IA 2HWE1 5C8CA 4DXSA 2WQ8A 5JPMB 2JDHA 3ABZA 1POQA 3HR9A 5FXWA 3QOPA 1S55A 1QH7A 4XFAA 5FZ0A 1I5ZA 2VZRA 3AYCA 1YJKA 2J1AA 2OZJA 2DU0A 5T5LA 4A44A 2HH9A 5DDJ3 1AR71 3NKTA 1WWYA 5IJRA 4LHLA 1KDMA 2BGOA 4BA6A 1MS5A 3IB3A 3T0BA 1WW5A 2W1QA 4I0WB 5FPXA 2VTFA 3TBDA 2WLQA 3USUA 2JDPA 3POJA 2WYSA 4FXKB 1Q8SA 3KF3A 5FPBA 2JDYA 3OTFA 4A7YA 5GKAC 1POV1 4D69A 1JYXA 3RZJA 3AVSA 2HWD1 1UAIA 1US2A 2VNRA 1XXNA 2VTXJ 4NVPA 3VDDC 4XTMA 4ZPIA 5C4WB 5LBBA 3PIGA 2HWE3 4B4RA 4LE3A 4I2OA 2EAKA 1ULFA 3ES4A 5JZGC 1NCQA 3OGSA 4C8DA 2Z79A 5FO8B 4KGGA 1D4VB 4B1LA 1CJDA 1BLZA 1SDWA 4I3PA 4UFLA 2L9LA 1AR73 5KC5A 2JKXA 4FFHA 4AEMA 2D6OX 1W28A 3N4MA 3C7HA 3T3YA 4QHZA 1QJX2 2VUDA 1GUIA 4HVRA 2VULA 4MG2A 1PGL2 2DCTA 1UY2A 3I4IA 4AR2A 3VBHC 5BNNA 3GZUC 1OA2A 1G9AA 3NNLA 4IEZA 1F15A 1POV3 3O0XA 1OLME 4TXWA 3CU7A 3MZHA 3X29B 4ZU7A 5CFDA 4YM0A 1LOEA 1SLTA 2DBNA 2NMOA 3SKVA 4CA9A 2WO7A 3CBNA 3CDZB 1ST8A 2BOIA 4JZRA 2OXBA 1NLSA 3R4UA 4AI0A 1LU2A 5K9YA 5LB6A 3W9AA 1VE0A 1ODMA 2C24A 3PVEA 4N90A 4QXHA 2ETEA 1QJU2 3AM2A 4NOTA 1YXWA 4CPBA 5F37A 1ODNA 4I30A 4DB5A 3I2IA 4CRQA 2JG8A 2N7GA 1GP6A 3LOIA 4CDUB 2BJSA 3HNMA 4DRRA 2Y0IA 3BUCA 1JU4A 2OVUA 4S2DA 1R1ZA 3SEEA 2ZGMA 3UKVA 5FZIA 4O65A 1JYTA 5ANNA 1J83A 1QJX1 2WRAA 1G86A 3S7IA 1VR3A 2QBXA 2UWCA 3NSTA 4HSLA 3VZOA 3AX4A 2Q0AA 4CEWA 4LOTA 4QX2A 3K4AA 3OGJA 2D5HA 2P3JA 2O8QA 3OEAA 2ZEYA 1LULA 1VJ2A 3CEWA 1U5YA 4OHWA 4M01A 3T2QA 2Z5WA 4HK8A 3LE0A 5IVFA 3FLPA 3DGTA 1PNFA 2A3WA 4B7KA 4GALA 5A7PA 3PVOA 1SFYA 5FZKA 1B09A 1S0IA 4XQWA 3LGRA 1W6NA 3HQRA 5FYCA 2B46X 3VBUC 3IDEA 3AL5A 1YFWA 2PHTA 3GF6A 5DAPA 2P6CA 1CZSA 1US3A 5FLIA 3S6PA 3SH4A 3GBWA 3IMMA 4Y1VA 1CAWA 1ZX5A 3T2OA 2ZGTA 4C91A 1QJU1 4RS5A 5F5QA 4AVCA 4R4ZA 4HBNA 3A4UA 4MOAA 4WM8B 4FOVA 5GZFA 5J37A 1Q56A 2R1DA 2F4LA 1COV2 1QJX3 4QB6A 3RYKA 4E27A 3WZ1A 5A6QA 4CSWA 2GSYA 1LJ7A 3GALA 4DUVA 1S0DA 1OH4A 3LCPA 3VUOA 3VBFA 3SC7X 4MGQA 4AQ6A 1J3QA 4XFCA 2QUOA 4EROA 1N3PA 1ULCA 1OQ1A 2D40A 4A6SA 4HXCA 4AFAA 2NZ9A 2WNUB 1ZZBA 4AG4A 3V0AB 4P9LA 1ZRDA 3DV8A 3TRSB 1DP0A 2GU9A 4IV1C 1UY1A 4XDPA 5FJHA 3VZLA 1PNGA 2B4KA 5BUVA 2O8OA 1H1MA 1H2NA 4E4HA 1BK1A 1SPPB 2E26A 4CCJA 1QJU3 3AMNA 1AR62 2EF6A 3TYJA 3ZOIA 2LROA 4YPJA 1DZRA 1AYM2 4QDSA 3H3LA 1IZ3A 3B9CA 5J48A 1ZZ8A 4WVVA 3ZYBA 3I2HA 4ATFA 4Q8LA 1ZRCA 3APBA 3FUOA 2LS6A 1J1TA 1VB4A 3U1XA 1W8WA 5H9PA 2XVGA 1COV1 1W6PA 4AAPA 1AJKA 4OI0A 2JB8A 2FQPA 5DQ0A 2CAVA 2VBBA 1GBGA 1I5PA 1SBDA 2YHJA 2C5DA 1AF9A 3LSDA 4FOYA 4BE3A 2JE7A 4A6OA 1JYIA 2GALA 2XQXA 1K5MB 1VALA 2XJUA 5FO9B 1UXZA 2PHFA 4XTPA 5IVCA 4Q0QA 1IS6A 3DECA 4L9BA 3WDWA 1O4YA 5APAA 3R4SA 5HCFA 4GWMA 3OJBA 1GKBA 4BYYA 2X29A 4DY3A 1IPSA 4GKXA 1H0BA 2JJ6A 1W9TA 4JKLA 5FRAA 3WF0A 4CCOA 4LOSA 4WM7C 1KGYA 4GWIA 4ITCA 1AR61 1LGNA 2VOWA 3T1MA 4RN5A 5ISLA 3TN92 1AYM1 3ES1A 4JGYB 4KWJA 2Q8CA 4NIDA 4L99A 1DU3D 1JZ4A 1E5HA 1RHI2 4XJ8A 5FPAA 3IWZA 3D6EA 4OHVA 5FP7A 3WW1A 4FFFA 2WNVC 3PVBB 4XMIA 3WF2A 1OOPC 3RI9A 3KCXA 2RM22 2NN8A 3O1RA 3BPZA 1AZDA 2VOKA 5C6CA 3LDKA 5L7OC 4HG6B 2XXZA 2G9ZA 4A7ZA 2Y60A 2ZCWA 3WX5A 1QXJA 5LEKA 4UFJA 5FOBB 4FSJA 4XC9A 3GBFA 1SCRA 1V00A 1NXD1 1GZWA 1NCRA 3R4DB 3ZYPA 4J1XA 4G3YC 3U75A 4P9GA 4KH9A 4E8CA 4NAMA 5IWFA 2Y26A 5A3UA 1H30A 3PDQA 2R0FA 1AR63 4NPLA 4EZ4A 4BDVB 3P3PA 4XDQA 2JEMA 4R9BA 3BU7A 2ZGQA 4BQ2A 1AYM3 3FC0A 4OMDA 1AL22 2YG0A 4OHZA 3IBMA 2QQUA 2YBKA 4N8MA 1PMHX 4S2GA 3TN91 4JDNA 1HDKA 1IS3A 4IE5A 4SBVA 5I91A 4BQWA 4Q26A 1RHI1 4CE8A 1PX3A 1OLMA 4QPGC 5A70A 1X8MA 5AFEA 3KT4A 1AVBA 4AQ2A 1LB2A 2RM21 2WZR2 4Y4RA 3WP3A 4IETA 4LHSA 3VKOA 1GP5A 3ZXGA 2D6NA 4H2AA 1V6NA 2C9AA 3DUIA 1N3QA 4XAEA 4JGZC 1B35C 2QZ2A 4HKOA 5C33A 1H9WA 2OQ6A 5DUUA 3LF7A 3B02A 1WLTA 1PX4A 1YNAA 2X5IA 3POGA 3R6SA 5FYBA 3WDXA 1NLQA 4XETA 2DUQA 2VC9A 4YVSA 4LR4A 2YGMA 4OUMA 4FCAA 1A8MA 2VZ1A 3MV01 2OPKA 3BN6A 1KFUL 3FHQA 3ZXFA 4A42A 1H8TA 4WVMB 1CZVA 2YC2A 4Q4W2 4EQVA 5CEHA 2X10A 1VBB2 1I1EA 3KZ4C 1KJLA 1UOBA 4NO4A 3M8LA 3TN93 4OUEA 4Q4V2 4QPYA 4I0AA 1AL21 4QD2A 4RD7A 1HQLA 4QPIA 4K6BA 5C71A 3O7OA 2GC1A 3OYWB 2YYOA 4YZ2A 2I74A 2RM23 4DQAA 5JOXA 4HZFA 3ATGA 3ORJA 1KJRA 2FHRA 5CFCA 3UGFA 4C0HA 2WZR1 2O1QA 4FPFA 3LPFA 5FYZA 1W2UA 1XQNA 1YYNA 4MVTA 4GJYA 1HB2A 3VHNA 2JXAA 2WN3A 3J26N 1IS5A 3LD8A 1DBNA 4U2AA 5ANQA 3WF3A 4K7JA 5JPNB 4BMBA 1W2AX 2P37A 4IDZA 5C3PA 4UFMA 2ZACA 3JQXA 2Y38A 5A3NA 4YW5A 3ZVXA 4QM8A 4XZPA 2VECA 5IK5A 1CWPA 1WMXA 1NZIA 1WD4A 1HIXA 2ENRA 5DAQA 5EWSA 4Q4W1 3ZFGA 2HBTA 5FOJB 3U4XA 1PIV2 1AL23 1VBB1 4QX0A 4RA0A 1A6CA 5JOYA 2W0XA 5LBEA 4Z2WA 1L7QA 3CO2A 4WV8A 5FLJA 4B7EA 5EHDA 2P4EA 4Q4V1 3K48A 5FFOC 5T3NA 3O1VA 2XPJA 2R7EB 3H1WA 2H6BA 5FJKA 2GC2A 2DDUA 2VMEA 4HN1A 2WZR3 1HV0A 1DQ4A 1ONAA 1C8NA 1GU3A 1UPSA 4X6RB 1EUUA 2YPJA 4E9KA 4F8AA 4CDQC 5CISA 3NJXA 3AJYA 2VOTA 1R64A 1WMDA 2Y6LA 3PMSA 3PUIA 4Z82A 2ZZQA 4ZXEA 4MV2A 1WLCA 3DEMA 3AJZA 4TLFA 1RUG2 5JI7A 1VBE2 3F95A 3NV4A 1DGWA 1J3RA 1IG3A 2GC3A 4FVVA 2TBVA 4IEQA 5I0SA 2WSUA 1Y3TA 2VUJA 3AZZA 3LEMA 3MFAA 1YRZA 2EAAA 4XIOA 2SBAA 2F6BA 4Q4W3 5FBZA 3ZKYA 4QWNA 4F7ZA 3EYPA 3B01A 5D2AA 1UOJA 1C8M3 4HPKB 4XUPA 4ET7A 2VZOA 3RZZA 4MXVA 3ZXLA 4YW2A 4Q4V3 1PIV1 2ZMLA 5T54A 4BQXA 5FYIA 4WVWA 4DIQA 5JSPA 2BEOA 2IWGB 4LNVA 4XHBA 4Q0SA 2QKDA 1GZ9A 1OOPA 4YVWC 1URXA 1V0AA 4D0QA 1JZ5A 4LHNA 3HVDA 3VBOB 2FDGA 5EZWA 3HBZA 4E4DX 1W90A 2Y33A 2ZZJA 4GH4C 4CU7A 1AYN2 1JBCA 1JZ3A 1WW4A 3DYMA 1Q43A 3M1HA 3P1IA 4XF9A 5LW9A 4FT8A 1SLBA 1SFPA 1BCXA 5C8CB 2P3YA 3LZZA 2HEYF 5JMCA 3ZSLA 1FV3A 3AKSA 1S0BA 3AMHA 3IPVA 5GJ6A 1FX5A 1W2NA 1ZA7A 2ZPXA 3N9OA 1VMHA 4HT1T 2WA4A 1RUG1 1XNBA 3C7FA 1U5XA 3QH7A 1VBE1 3MW4A 3U14A 3E1F1 4IV3C 4LBLA 5FYMA 3ZN6A 2VW2A 4Q8KA 5JCTA 4PDWB 1ZM1A 2DF7A 2ZOEB 4QXCA 1W99A 4Q5OA 4COVA 1UPIA 4JRLA 1UW8A 5A7WA 1PK6B 2B45X 3USUB 3FLTA 5FV3A 1QKQA 4L92A 3Q8BA 5I0UA 5BYNA 1E57A 1PIV3 3WEZA 2RR12 4ZS2A 3NQHA 5A6XA 5M0TA 4K9SA 4RYDA 4FTSA 2PFWA 2DVBA 1OT5A 1GNZA 5CYYA 2W91A 1CIWA 3NAPC 2BVBA 1XU2A 3T0DA 1UZWA 4JX0A 5HI0A 3GCWA 2FZ2A 4KL1A 5IUQA 3C7GA 3ENRA 1Z7S2 4QQLA 2BFUS 4W6WA 1AYN1 1DGRA 5C9AC 1DQ5A 1Q8QA 1YQ8A 4RGKA 2BNNA 4XQ4A 5C3QA 4ARXA 1OA4A 2XLGA 2BP6A 2YFUA 4N7UA 4OMCA 1NCQB 1VMFA 4BPZA 1RUG3 2PHXA 1VBE3 4YFWA 3VZKA 4Q0VA 3EMRA 5FPLA 5KXCA 4FPJA 4X8NA 5TSWA 4FBFA 4PT6A 1UYZA 1BBT2 3Q8AA 2DVFA 4Y24A 4KQ7A 5FZ1A 2D3SA 2XL9A 3W20A 5GLUA 5DUXA 3NRUA 3GBGA 2PAKA 2VBDA 2YXSA 3ZR5A 2FCTA 2V4AA 2P2KA 2PQQA 4LPLA 2JD4A 4NHMA 4XF4A 5BNNB 1UU4A 1J59A 4PJYA 3VKLA 5T50A 4Y22B 2RR11 1HJFA 1QDOA 4AI2A 4BISA 3C3VA 2UY9A 5GLVA 1VIWB 4NPRA 5CFDB 1NOVA 2IC1A 1XNTA 2RDRA 1UY3A 4I02A 1NA1C 3JD72 5LK5A 3T2PA 4OULA 3ZN4A 1FOD3 3TEYA 2OZ6A 2E7AA 2VMCA 2QQPA 1CAUA 3MLLA 1OLRA 5D1IA 2WQ4A 4CDXC 3BB6A 4MSVA 4QT6A 1Z7S1 2JDZA 2VXJA 2ZGPA 3NMBA 4LO8A 4CP2A 3NJYA 4XCBA 4XEZA 3CLPA 1VBD2 4CDWC 4ZZ5A 2MEV2 1VRH2 2JG8B 1O8SA 5AVPA 3WW3A 4BIOA 2W95A 3N9LA 4NMIA 4YWAA 3ITQA 4AQTA 1MS8A 1UD1A 3RWKX 3LIGA 4L8QA 1WW7A 1PK6C 2XBO2 2EALA 5F3GA 4UBGA 5I8YA 4CEWB 2VOVA 5F5IA 2FZ1A 1BBT1 2W52A 3M70A 5FWJA 5IVYA 4AAXA 2HYKA 4RR3B 2RR13 2WAAA 3IAQA 3ACLA 4N53A 3Q8FA 5C5UA 1X82A 3RGBA 3ZYRA 5GZEA 1DGRN 5FP3A 5J7MA 4D94A 3T2TA 4QX5A 3UJQA 2RS32 1W9WA 1L3JA 3AP5A 3UETA 1H1AA 3OUHA 2J1EA 1DF0A 5IYYA 4YZ4A 4UBHA 1IG0A 3JD71 1ND2C 5K0UA 1W6NB 1JU3A 4UXAA 2B9VA 1Z7S3 2CYFA 4F83A 2WINB 1RUE2 5A1LA 3W59A 5C70A 1W8TA 2DTWA 2Z42A 3J9SA 2BWAA 2VXRA 3LEIA 5BNOA 1MVEA 2ZGNA 1CAWB 2YBSA 4RQPA 4ZXKA 1ZVFA 4RS5B 2CSGA 1VBD1 2XG3A 2CDOA 1PZ8A 3H8RA 1BXHA 1TQ5A 1VRH1 1BZWA 1GFF2 3O0VA 3WR0A 4P00B 5LBFA 5CVRA 3WNXA 4JQTA 4D7YA 3I97A 1MR5A 3IDAA 2VNOA 1BBT3 2Y6FA 2ZGUA 2W39A 3VBRA 2XBO1 4XUOA 3WXPA 4JVAA 3VBFB 5JXHA 1QMJA 1PGL1 4Y3OA 3LA7A 4P02B 5DDJ2 4AI3A 3ZMNA 5JMOA 1JTZX 2AUYA 4OCTA 4IE4A 4PLOA 3KQ4B 2CGPA 2JG9A 4COUA 3DCQA 4AK3A 2BW8A 2RE9A 2XGXA 3IAPA 5KXEA 2ZJCA 2RS31 3JD73 4RL7A 1JXNA 1W3VA 2WBKA 3E5XA 1UIKA 1GANA 4COZA 2VUAA 5ACA2 3B94A 1BYHA 3FHIB 3W21A 4EE2A 5C8WA 2ZKNA 4ASLA 4BB3A 4XXPA 2ZGKA 4LBJA 4TLGA 1JYVA 1RUE1 2DU1A 1D0HA 1VBD3 4PBPA 1K42A 3JU9A 2MEV3 1UCXA 1ACCA 1VRH3 4BM8A 3AZVA 3ZPOA 2ZBJA 4IGOA 4XVHA 4YGCA 4CUBA 4Q27A 2OS2A 4XABA 1W6OB 4QDRA 4CUAA 3GZTB 4J1WA 2XBO3 3LFMA 4KWUA 1LTEA 4D6RA 5L9RA 3I2JA 1W6PB 1Y9MA 3B7MA 3C8XA 4G4FA 4TWTA 4YW7A 2UYBA 3ZFFC 3FFZA 5CAZA 4UW6A 2BTVC 3UKTA 1UKRA 2J1TA 2P3IA 1QHDA 2UWAA 4QU2A 5DDJ1 3G6JB 3FMGA 1OF3A 3RMYA 5F3CA 1JZ8A 2DWRA 2VMFA 3FBMA 4MGYE 2RS33 3PUQA 4AVSA 3AYAA 2BYVE 2VBPA 2HYXA 1N1SA 5FO7B 2GNTA 2IXKA 1OA3A 3SCGA 5JSOA 4GMP0 3MPPG 4XFIA 1WCSA 4PF1A 4XDOA 1RUE3 1U5ZA 2XJRA 4SLIA 1HN1A 3ELNA 5AFBA 1UMIA 5DABA 3OGVA 4YZ3A 4AW7A 5F5AA 4X8PA 5BNQA 3ECQA 1DFQA 2GNDA 2A1XA 2OKXA 1KS4A 1RUNA 2PTMA 3UV9A 1HB4A 3DXUA 3FBYA 5K7PA 2ZABA 2BNOA 4AVTA 5HXMA 2IXIA 2BVVA 3VZJA 1W9SA 2J42A 3RMXA 4XUTA 3AL6A 4YW1A 5K8SA 2VZSA 3MIEA 4CEYB 1EV12 5ABJA 2QNKA 1JOJA 1Y7BA 1S0JA 3CNAA 4LE4A 4QQ2A 5CKMA 4YM1A 4FQZA 2UU8A 5FYYA 3T0AA 4IGPA 4X6QB 1G9DA 3PIJA 2A3XA 4NN0A 4I0BA 1ENXA 2MPFA 4FPOB 5LRSA 2RMU2 3FX3A 4W65A 5FKBA 1GZWB 1NCRB 1NYWA 4NHYA 2W08A 4ZU4A 4ZS3A 4KU7A 2C9KA 3J4UH 3K4DA 2VVDA 5ACA3 1R1A2 1RJ8A 4RGAA 4DXZA 2JDUA 2OUJA 4CXWA 5FZLA 2PAEA 2WR9A 1NKGA 1D7PM 3HAGA 1BEV2 4FPYA 3RVHA 1PGSA 1LGCA 3AYEA 2XDVA 5BNPC 1CAVA 2KM2A 2YGLA 3NV2A 5KC6A 2RJLA 1OVPA 1NE4A 1T2XA 1REEA 2W68A 4EN7B 2AEYA 3B00A 3HQUA 1JOPA 2VQ0A 4MUVA 4XOGA 4WVZA 2B5HA 2IUWA 3JCIA 1EV11 2PMWB 2VMHA 4R8HA 3T09A 1S0CA 2YU2A 3AP4A 4B3NA 4MXWA 4CP9A 2NP0A 5I8SA 1W8NA 2OT7A 3POSA 5FP8A 1C1FA 2PHDA 3CJIA 3K2OA 5E88A 2ZS6B 3WNKA 2D6PA 2EIBA 4YYOA 2X5IB 4FO9A 3ZYIB 3VBSA 2HJIA 3KV4A 1DGWX 2RMU1 4ZKTB 3TAYA 4DINB 2A6WA 4YVSB 4AHZA 4AVBA 1RUJ2 1GZCA 2JIJA 4FOQA 1PMIA 3ZXEA 4AZZA 3BTYA 1BVVA
chains in the Genus database with same CATH topology
1R1A1 1H8TB 5IK8A 5JVVA 2B7YA 1SMVA 3M3OA 1MS3A 4M3CE 4FOWA 4XYXA 1BEV1 4URTA 3HWJA 2F4PA 1SCSA 2A6ZA 2ZHNA 4QPIB 2TNFA 3KGLA 3NVCA 2IXJA 2DV9A 2HWC2 2QFEA 1FAYA 2WSVA 4IEWA 1EV13 3SCHA 2B8MA 5T5JA 3ILFA 5CFCB 3DPRA 2PHRA 1YUDA 3E6BA 1IOAA 3DL3A 3D82A 2RMU3 5E89A 3ZXJA 4N43A 4KG0A 5F6KA 1O3SA 1AUYA 1W0OA 3O0WA 1AHSA 2IXLA 1R1A3 4P9YA 3KS7A 3NJZA 2DURA 1RUJ1 1WD3A 2VH9A 1ZA4A 4TYSA 2KA3A 1SACA 4E2GA 1DQ1A 4CYDA 4AEKA 1OPOA 5C4WC 3ZFGB 1BEV3 4GIQA 3BODA 4O9EA 3RQ0A 2B39A 2ZAAA 3RG0A 3THTA 1MQTA 1V70A 2BGCA 4LO4B 4Q0UA 2VVEA 2R042 1H1IA 2UWBA 4Q4Y3 2HWC1 2ZGSA 4Y5Z0 4KG8A 1GLHA 2GH2A 2WZPP 3OY8A 2K0GA 2YV8A 3KT7A 4Y4YA 5D8AA 3V64A 4FPLA 1W0PA 4A7KA 1PO12 2VMGA 1O5LA 2A75A 4AFMA 4E2QA 1G6NA 4DY5A 1RUJ3 4CP0A 2CTVA 3CF6E 1TEIA 4MGKE 1CVNA 3ZN5A 4AF9A 3CJXA 3WP6A 1UU5A 2OUHA 4ONUA 1D4M2 4JRAA 3V56A 5CG9A 2Y0OA 4CDUC 2HWC3 1J1LA 1MS0A 5FMOL 2R041 5EJ3A 2ZX3A 3MLKA 1S0EA 1M06G 5IK7A 1CPMA 4XBLA 4H7LA 2XLAA 3HT1A 3AP6A 4AHXA 4GXLA 1OI6A 1ZYBA 1RVF2 2X53S 5J36A 5FPZA 4QMAA 5KBFA 1DG6A 1PO11 1LHNA 4IEOA 4FPKA 2XKOA 3GHNA 3WW2A 2PYTA 3ZN6B 2AGSA 4K8FA 2A73B 3SHRA 1D2QA 1DHKB 2NMNA 3VDDA 4ISQA 4AEDC 3JZVA 1YCIA 3RNSA 5JWPA 2ARBA 4W6YA 2ZGLA 1DYPA 1W6MA 2H6CA 1CESA 2AZ5A 4YG3A 1D4M1 1RIRA 4WM8C 2R043 5JZGA 2Q1ZB 2PLV2 3PTYA 1LENA 3N7MA 1IS4A 4R9DA 3H9AA 4GKYA 2A7AA 4H7MA 1LR5A 3UL2A 5DZFA 4L11A 1ENQA 3ZFEB 1ULEA 1F8VA 3WV6A 3ME2A 1PO13 1LHVA 5LK7B 1RVF1 1SLCA 2WT1A 3VBHA 2WNUC 5IK4A 1LODA 1IKPA 1EPZA 4P9JA 4XBNA 4LBKA 4DS0A 4META 4JQRA 3LA3A 1NLRA 1REDA 5LRRA 3VKNA 2BWCA 2DVDA 1EAH2 1ALYA 1SEFA 1D4M3 1JH5A 3AFGA 1UZZA 3IMNA 1XNDA 4PIXA 1N3OA 3C2UA 4Z1VA 2GMEA 2PLV1 3WHUA 4EWDA 3GYDA 2WWSA 4D7SA 5KHKA 3BOPA 2VQAA 3MGUA 1RVF3 1M4WA 2VW1A 4EN8B 1R082 4J6GA 2YDEA 3MF6A 1QH6A 5DZEA 5GLTA 4EN6B 4OZXA 1DQ2A 2EXJA 4IEPA 1K5MC 5JOZA 4M3CA 4LBOA 4C0BA 4GWNA 4DZGA 4QXKA 3WQ0A 5JIUA 1LU1A 2X8KA 4UW5A 1YI9A 1QY4A 2GH8A 3U07A 4EWEA 3VBUA 1FT9A 3E5QA 4EV0A 3MIHA 1F9KA 4N53B 4LBMA 2NLRA 1WW6A 5T55A 1JUHA 2VY0A 1EAH1 1EYBA 1Q8VA 3HIFA 4QGLA 4E2SA 1ND3B 1GQGA 4I09A 4JGYC 1W39A 1GV9A 1C8M2 2PLV3 2JICA 1Q8PA 2D44A 2PHWA 2V5YA 5K0UB 3ZFEC 1HLCA 3HMYA 4Y1UA 2AR6A 2JENA 2ZMNA 4ATEA 2NPIA 5BNOB 1VB2A 1HX6A 2G9GA 4RQPB 3L2YA 1XYNA 3JBG2 4YRDA 4RHV2 1R081 1S2KA 2ZTNA 1UKGA 2YZ4A 3MIFA 4HK9A 3M4FA 2PN5A 1Z78A 1LHUA 4R4XA 3VBRB 1N1YA 4IV1A 4E4ZA 3J8F2 4K3UA 1XU1A 1CONA 2R49A 4XFFA 1EAH3 1DZTA 4UW3A 1OQDA 2JG9B 2ZX0A 3ZDSA 2DCJA 3KLSA 5CIRA 2WNEA 1AX0A 1C8M1 4Y26A 2QCSB 3BIWE 4OHXA 1OLQA 4EN0A 1RITA 3THPA 3NV3A 2XH6A 1TMF3 2AENA 1QWRA 1BVP1 1AR92 1AL0G 3SISA 4P14A 1QDCA 1RUD2 1BKZA 1R083 1LHOA 3MW2A 2EA7A 3JBG1 3SNMA 1OHFA 4RHV1 1LGBA 4P9IA 1IGOA 5J09A 4INDA 1CAXA 1LKNA 2YMZA 2GNMA 5CB7A 3VHPA 1JW6A 3E6DA 1AX1A 1AJOA 4LBQA 2G4IA 3J8F1 1NXMA 4OLLA 4QGMA 3VHOA 2WT0A 1DIWA 3JQWA 1RGSA 4Y1ZA 1KQRA 1S2BA 4R52A 3TB0A 4FP3A 3AZYA 2JX9A 4WM8A 3H0OA 4WM7A 3WUDA 4JV4A 4AHWA 1KS5A 3WG4A 1RUI2 3ZXKA 1F5JA 4GA9A 3QCWA 1QXRA 2Q4SA 3WP4A 4YG0A 3UK9A 5A32A 2WNVA 4XMAA 2SLIA 4Q4X2 2VOXA 3AXEA 1FOD2 1C5IA 5BV6A 4AQSA 1BJQA 4FXGB 3JBG3 2ET7A 3N7JA 4RHV3 5L7OA 1QQP2 2XHKA 1WGPA 5FLHA 3ZSMA 1C5HA 2CWSA 2R30A 4U36A 1LOFC 4XPVA 2EXIA 2BUKA 1CR7A 3PNAA 5ABJB 1RUF2 4H55A 3J8F3 3WHTA 3OF1A 3WY6A 1LOBA 1YLLA 1VLNA 5KXBA 1C57A 1YHFA 4NWWA 5IT6A 1IHMA 1LESA 1CD3G 4CZSA 4BOWA 4CTEA 3V0BA 3W58A 2E53A 1LCLA 3MEPA 4AVAA 1RUI1 4YNIA 3KSCA 5GZDA 4QPGA 4BMEA 4PIYA 5I0RA 1AR93 4KWLA 3OD4A 1H2LA 2CWMA 1RUD3 1X8EA 4Q4X1 5EV7A 1FOD1 1RINA 5KHHA 1WCDJ 3ZMOA 1MZEA 2DFBA 1CAVB 2XWJB 1OPMA 1QQP1 1ZRRA 4JGZA 1OQEA 4LO6B 4N9IA 1B35A 5F9TA 4LLOA 2I2SA 3U11A 3AK0A 2XWBB 3RJRA 2C0ZA 2GMPA 4AI1A 2UY8A 1RUF1 2E51A 5JIAA 1A3KA 3SH3A 3WG1A 4MXWB 2LM3A 2TUNA 2DFCA 4YW4A 3NKGA 2B42B 4LO7A 4AVVA 1HKDA 2ARXA 1MEC2 1RJ7A 3CJIB 4MLOA 2WIIB 3KM5A 1XYPA 3NV1A 3ZO0B 2O0OA 3VBSB 4WZCA 1VBC2 3ZSEA 1RUI3 2GMMA 4BCUA 3E97A 3RYPA 1U0AA 1HRV2 3VBOC 1ULDA 1YO8A 4LLFA 4Q4X3 3USSA 4JTOA 4K1YA 2GAUA 1QQP3 5C8CC 4HANA 3SXWA 3TOJA 3O5SA 2NQYA 1WLDA 1C28A 1YWKA 2DUPA 3AP7A 3I2DA 1RUF3 3HT2A 1OD5A 4PDWC 4HLTA 2V09A 2OIIA 3DPRB 3H8UA 1T6GC 3POYA 3N35A 4XJUA 4ES8A 1MEC1 3H3UA 1V6IA 4N43B 2XL7A 3RI8A 3ZYGA 2RJKA 5JDBA 3VGIA 3IKWA 3LB9A 1VBC1 3LKJA 1QOOA 5DZGA 1HRV1 1QXPA 2YROA 4D7TA 1RUH2 5DXDA 1O3RA 1YFUA 1AR82 1MQTB 1NCQC 4CDQA 4DNYA 2XLFA 4M0HA 2ZMKA 2JE9A 3ROUA 3RYRA 4P5HA 4AE2A 1MS9A 1ZZ7A 2MEV1 2ZGOA 3POWA 1QOSA 4YLZA 1RTVA 3OY8B 3LWCA 4K1ZA 4ORFA 1PGW2 1MEC3 2WT2A 5D8AB 5BNNC 2DVAA 1H2KA 1J58A 1VBC3 5CFDC 3H1MA 4BLIA 3GHMA 3U0ZA 4COYA 4IXLA 1QNWA 1QJY2 1HRV3 1W6QA 1TME2 3WDTA 1ASJ2 4YVWA 2IXHA 1LHWA 1AXYA 4M0NA 4L97A 1UN1A 4GH4A 1IKQA 2E6VA 1KITA 2MHFA 3KQRA 4IQPA 2FMDA 3MYXA 4YARA 2A6VA 1RUH1 3T1LA 4HETA 3VL9A 3WD5A 5F1RA 1AR81 2JG8C 4XJ9A 4BH9A 2GN7A 1GSLA 3DF0A 2R072 3M3EA 4IV3A 4TZDA 4CEWC 3IIAA 3EQEA 1C4RA 1N47A 3ZIXA 4OUSA 1V6LA 2ZX1A 3B93A 4RR3C 4DMIA 2UYAA 1FMD2 1VAMA 1PGW1 3CL1A 3FWEA 3MIDA 2QDRA 3UJOA 3N7LA 2R32A 5HBAA 2K2SA 3KCCA 4GMP1 2QJVA 2QE3A 3M3QA 3A0NA 3NAPA 2HWF2 1QJY1 4QQOA 1TME1 1ASJ1 5JAXA 3VDDB 2WS92 2OA2A 2P34A 1RUH3 3WG2A 5ACA1 5C9AA 1W6MB 4RS5C 1AR83 4AFDA 1QJZA 1XYOA 2AREA 5JZGB 3I7DA 4TSVA 4BHPA 4XW3A 5JI9A 4B8EA 4Q0PA 3FJSA 5HCAA 2R071 3MIGA 3MF9A 4LBNA 1OFNA 3VBFC 1YIFA 4HPKA 4S2FA 3I59A 1BMV2 5DUVA 4FPHA 1UZYA 3NO8A 3VBHB 3TNPB 1FMD1 4COWA 1PM7A 1YIPA 3D5OA 4GMP3 4A3XA 1SLLA 4DRVA 1QJY3 4FPGA 1TME3 1ASJ3 1NA1A 2HWF1 3JB8A 2MNGA 2HWB2 3V65A 5GLWA 3WW4A 5DG1A 3AP9A 3ST7A 4CDXA 2LUWA 2WS91 3WQ7A 1U5IA 5BY5A 3KMHA 5KHJA 4D3WA 5AC92 1LRHA 3L2HA 4CDWA 4YZ1A 3IN9A 3HD8B 1O4TA 1MS4A 4WBBA 2AYHA 1HQNA 5CU1A 4PDWA 2R073 2D5FA 1H2MA 4CP1A 1PK6A 2GN3A 3I8TA 2XUMA 3WT3A 2A6XA 1FMD3 4Q4Y2 4MGIE 1CGPA 1BMV1 4OVEA 3B5LB 3A0KA 1FV2A 4M3CB 3O12A 3VN4A 1QF3A 2HWF3 2IFRA 1POV0 4LA2A 1SBEA 1ND2A 3VBUB 2WS93 2DCKA 1OMIA 2HWB1 2JKBA 3QLQA 3ZSJA 2BBVA 1F31A 3I54A 4HMZA 5KXDA 4AGGA 3Q9OA 1GR3A 1ZNPA 3EBRA 4WZFA 5AC91 2PELA 1WCKA 3ZYJB 2DVGA 3WCSA 4UW4A 3ILNA 3MIBA 1TNRA 2EIGA 1V6JA 1KD7A 4CEYC 2GNBA 3MLJA 2DCZA 3OBRA 4LUKA 3RDIA 4FAGA 1V6KA 4B29A 1D2SA 4Y22A 3MICA 3ASIA 1IPKA 4B4QA 4Q4Y1 5GLZA 2ZHLA 3SITA 1VBA2 2HWD3 2R062 1TNFA 4LO5B 4XFGA 1NCRC 3H3ZA 1IQAA 1YFXA 2BQPA 4K40A 1GQHA 4IEUA 4IV1B 5H9QA 2HWB3 2B9UA 5T52A 1GNHA 1JHNA 1DLLA 1SQ4A 2VG9A 1VAVA 1UU6A 2XJVA 2D7FA 1HQWA 5AC93 2I07B 5FQ0A 4ES9A 4Q1RA 3WDUA 2G9FA 1AXZA 2R1BA 3WVJA 4S2HA 4YFZA 5A3MA 2XJTA 1GYKA 2ET1A 1ZZ9A 4RR3A 3LOBA 2ZHMA 3O14A 3EXUA 3ZFFA 4F3JA 1DQ6A 3JUUA 4E4SA 2XVLA 2KXLA 1V6OA 3ILRA 4FP2A 2X5IC 4BIFA 3M7AA 5EFUA 1VBA1 2D3PA 1SBFA 4LUMA 2R061 3RPQA 1YI7A 2WFPA 3GNEA 3KT1A 4AI8A 1CAXB 4YVSC 1ZRFA 2QVSB 3AKPA 1NY72 3WUCA 2Z69A 3VV1A 2K9ZA 4YGBA 2E9QA 1PZ7A 1H8TC 1O7FA 4JTNA 4LBQB 2YUEA 5A33A 2ILMA 2D6LX 5L73A 1Q3EA 3ZXAC 1CJPA 1PVXA 4WM7B 3WQ1A 4IEXA 3IM0A 4QPIC 1RB8G 1GICA 1JYCA 2WL1A 2D6KA 5FMOS 5H9SA 1G9CA 1RC6A 2XB6C 1ENRA 4HL0A 5A32B 2WNVB 3D8CA 1OOPB 4YZ5A 5CFCC 1EP0A 1MACA 3MDPA 4AFCA 3N3HA 4AFBA 1ZBA2 5L7OB 1NQJA 3HQXA 3QACA 2DUOA 4YSFA 4LBQD 1VBA3 2R063 3ZXDA 3PLQA 4YM3A 4HN0A 2VPVA 3KD4A 4Y20A 1RUOA 3IPVB 1RUC2 1MVQA 1NY71 1FI2A 4NWVA 2WLPA 3WDVA 3PJQA 3FZ3A 5FAXA 4XILA 3ZFGC 1DYKA 5FDBA 4PLMA 1F2NA 2QZ3A 2ERFA 4Q1PA 4R9CA 4AGVA 3V0BB 2ZA9A 1W6OA 4XF3A 5BNPA 4JC1A 1R092 1ZREA 4KWKA 4O9GA 3VZNA 4QPGB 2A3YA 1DDLA 3S0MA 3URFA 5I93A 2E7TA 3OGGA 3RWNA 1ZBA1 1WBLA 4JGZB 1WLWA 5CG8A 1O3TA 1B35B 1UL9A 3SMHA 1APNA 4P9XA 1FXZA 3PHMA 3PVNA 4DOUA 1UMZA 4FTBA 1EY2A 2HKXA 1N1TA 1YFYA 2BPA2 2ZX2A 1RUC1 5JSRA 2Q1MA 5GZGA 2PAMA 1HW5A 4C1WA 1G9FA 2XJSA 4QQPA 1Y9QA 1UIJA 1H8VA 3OD0A 3AFKA 1COV3 3VZMA 4GULA 5CNAA 4KNCA 3LA2A 1ENSA 3RSJA 3M3IA 1RMU2 4CEYA 1R091 3H1YA 1F5FA 4MX3A 4H3WA 2DTYA 5DG2A 3KCYA 4XQDA 3MPBA 1XNCA 1PO22 1CAUB 1I9RA 1ZBA3 2H0VA 4HVOA 4RSUA 1TMF2 3H50A 1VAKA 1HV1A 1AXKA 3GZAA 4MGZE 4XXAA 2D3RA 3WP5A 1RUC3 2CL2A 2WJSA 5GALA 4EWAA 1QOTA 4XF0A 1I6XA 3MW3A 2BNMA 1NQDA 3M3CA 4M3CF 3PMEA 3H7YA 3M2MA 5C4WA 5EYXA 2XKPA 2OYZA 4LA3A 2FMYA 3EJKA 2EVXA 1DQ0A 1R093 2ZGRA 3VKFC 2WKKA 3OBTA 2Q8OA 1RMU1 1WMEA 1LOCA 4YW3A 3N7KA 3RS6A 4EJRA 1KFXL 1PO21 4CDQB 2WQZC 1MZFA 1TMF1 2YY1A 3N36A 4LT5A 2D43A 1XE8A 2RS12 2GZWA 4NHKA 3MI8A 1FNYA 1SLIA 3E5UA 3IT8A 2NM1A 1WA4A 4MH0E 1BQPA 4IEYA 5E1RA 2A5ZA 4P9WA 2OW4A 2P17A 5CBLA 1HXS2 1ULGA 4G9SB 1G9BA 1REFA 1LOGA 1RHI3 3AKQA 5A3LA 1YJLA 2RHPA 4IESA 1RMU3 1W6QB 1CN1A 1XNKA 4YVWB 4CDUA 2A70A 4LULA 4MZUA 4XE9A 4GH4B 4RGGA 5CA6A 1PO23 5CADA 3S30A 4YG6A 4DPNA 1S0GA 3AMMA 3D0JA 1IPJA 4FPEA 5FTTC 1MZ5A 1PZ9A 4K21A 1ZBE2 3AMPA 2RS11 4PLNA 3E6CC 3BOWA 3OPZA 1C1LA 1JN2P 4XHXA 4IV3B 5H9RA 3TNQA 5AVAA 3QD6A 2VMIA 4N53C 4AWDA 4L2NA 2CAUA 4PCRA 1PVC2 1HXS1 4AEDA 1V6MA 2E63A 5L19A 1ND3C 5J3UA 5JOWA 3FUQA 3NAPB 2I45A 2H0BA 5K0UC 1N1VA 1OSGA 1WMFA 4JCKA 4XIKA 1AX2A 2VGDA 3LAGA 4BLJA 4QQHA 4Y1XA 5BNOC 2C1FA 2PA7A 5C9AB 4RQPC 1X50A 4ZU5A 2CY6A 1H4HA 2TEPA 1LEDA 1AR91 2RS13 2WNUA 4LHKA 1TE1B 1RUD1 3V0AA 5LEJA 4MYEA 1ZBE1 5GM0A 2VVFA 4YM2A 2XVKA 1ZRDA 4FTEA 1ZZCA 3VLBB 4GB32 3VBRC 1Y43B 4XJAA 1VBB3 1X33A 2CV6A 2Z2SB 4RFT0 1HXS3 1S0FA 3I59B 4Z07A 3TWIA 5KWRA 4IL7A 2A71A 2JG9C 3ETQA 1G7YA 1PVC1 1VP6A 2ES3A 4LEJA 1CPNA 4PBOA 2CNAA 5FREA 1SFNA 5KHIA 1NA1B 2RS52 4QGNA 2ZAHA 4JDMA 2P3KA 2D93A 2DYCA 4JDOA 1KRIA 4LTAA 1OFSA 2HEWF 3NW4A 3SLIA 5T5OA 4CDXB 2ZKLA 4FAHA 4HVQA 1MS1A 3INAA 4OI4A 3U10A 4CDWB 2YC0A 5J98B 1ZBE3 3B69A 2LTNA 5HCBA 1K5MA 2D98A 2IZWA 3EHKA 3OCPA 3P3NA 4IEVA 5JLVA 4GB31 3AZXA 2D97A 2IFWA 4AXOA 4Y1YA 2AH2A 3G7DA 1PVC3 4FPCA 1Q8OA 4I3GA 3K51A 3AYDA 1Z0HA 3FE5A 3LSEA 4R9AA 3VKMA 3BTAA 1J3PA 4JGYA 4GQ7A 3H7JA 1O91A 2R16A 1WUVA 4PIZA 5BXXA 3WOGA 2RS51 1A78A 1ND2B 5FCCA 3ZFEA 5E16A 4XFBA 2R6QA 5SV5A 2BFUL 3BCWA 1LOAA 1FPN2 2E7QA 4XJZA 3FFQA 4AYUA 3D4KA 3ZX7A 2D6MA 1H4GA 3WG3A 2A6YA 2EXKA 2VW0A 3SCFA 3UKNA 1LEMA 5J96B 1G8WA 3S7EA 4GB33 1JUIA 3AXDA 5ABJC 4Q2FA 2HEVF 4V1PA 1CQ9A 1V9U2 2WFF2 2CGNA 4Z8BA 4HFSA 3PJYA 2ZX4A 4A2UA 4DFSA 4OI1A 1LECA 1A8DA 1XRUA 3L9JT 1QGLA 4IERA 1AYN3 2RS53 3R0RA 1X36A 5L36A 3WDYA 1FYUA 4YGDA 3R05A 2IXCA 2GDFA 4OI2A 3B9IA 2FBEA 1WBFA 3ZSKA 5FQ0B 3EO6A 4W6XA 1FPN1 2NYYA 3D0SA 3HN1A 1SLAA 3AKRA 1S1AA 3VHRA 5B2GB 4HSJA 4XF1A 4EN9B 1KXGA 1KDKA 1HRI2 1UF2C 1FATA 3ZFFB 1U12A 4AEJA 4HKLA 4C1XA 3CJIC 4WVMA 1V9U1 2Q5TA 1ND3A 2WFF1 4HKWA 3VBSC 4B4PA 4OHYA 1O3QA 3VL8A 1OKQA 1Q5OA 2Q30A 4NHLA 4PQ9A 4XJWA 3WINE 3OYWA 5A33B 4ISRA 4K20A 3FLRA 3AMQA 2WC2A 1PHMA 1FPN3 2R0HA 4KU8A