1QJU1

Human rhinovirus 16 coat protein in complex with antiviral compound vp61209
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
285
structure length
285
Chain Sequence
b'NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN VP1
molecule tags Virus
publication title Analysis of Three Structurally Related Antiviral Compounds in Complex with Human Rhinovirus 16
pubmed doi rcsb
total genus 59
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qju100
2BUKA 3VBOC 5CFCC 1AR71 1RMU2 1ZBE2 1Z7S2 2HWB2 1MEC2 1AR82 1OOPA 1VBE3 1VBB2 4N53C 5BNNB 3TN92 1NCRA 1VBE2 3NAPB 4WM8C 1K5MB 1FMD1 5GKAC 4JGYA 4RS5B 3LOBA 4FTSA 3VDDA 1SMVA 1AR73 1RUC1 2XBO2 5BNPC 5JZGC 1NCRC 1RUD2 4CDWC 2R073 5K0UA 4GMP0 2RS13 5ABJB 2HWC2 1QJX3 1ZBA1 3NAPA 2RS11 4JGZA 4LLFA 1OOPC 5BNOC 1RUI2 4NWVA 2QQPA 4CEYC 1VBD2 1PVC2 3VBUA 1NCQA 2ZAHA 2HWF3 5J96B 4N53B 3ZXAC 5DDJ2 1FMD3 2R071 2HWC3 1FOD1 4GMP3 4RS5C 2ZZQA 5LK7B 2FZ2A 1ZBA2 1MQTB 2R062 3ZFFA 2VQ0A 5C4WC 4FTEA 1V9U1 4BCUA 2WZR1 5FMOS 1HRI3 1PGL2 3VBRC 1FMD2 3VBOB 1X33A 1AYM2 1VAKA 4Q4V1 4Q4X3 1QJY1 2BFUL 4FTBA 1Z7S3 5BNPA 1PVC3 1RUH2 2WS93 3VBFB 5ABJA 2HWB1 1RHI1 4WM8A 2PLV3 4RHV3 1PO21 2RS52 4Q4Y1 4IV1A 5JZGB 1RUH3 5K0UC 4RQPB 1QQP3 3DPRB 1RUC3 1RVF1 1NY71 1RUF1 4FSJA 2X5IC 1OOPB 1RUF3 1R091 4QPIB 4YVSB 2WS91 5C8CC 4RR3C 3JD73 4CEWA 1QQP2 1RUI1 1RB8G 4CDWA 2DF7A 1BMV1 1RVF3 4CDWB 1VB4A 3CJIB 5BNOA 1AR93 4WM7A 3VBSA 2R061 1VBC1 1MQTC 3DPRC 1CD3G 4GB33 1RUI3 1HQNA 2HWD3 4WM7C 1B35B 4RR3A 4IV3A 1V9U3 1FPN2 1ND3C 1VBA2 2WLPA 4QPIC 4CEWB 4SBVA 4IV1B 3ZFEC 1PGL1 4Q4X1 1AR81 1FPN3 1VBA3 4YVSA 5A33A 2R063 1AR72 1RMU1 3VBFC 1PVC1 4N43C 1AR83 1H8TB 5A33B 4CDXC 1HRV1 5A32A 1RMU3 1NG0A 1HXS1 3CJIC 4GB32 3VBSC 2R041 3J8F1 1AYN1 5D8AB 2RS31 4RQPA 2R043 3J8F3 4IV3B 3JB8A 4N43A 5ACA1 1VRH2 1X36A 1R082 1AYM1 3VDDC 4Q4Y3 1MEC3 3ZFFC 2HWF1 2HWD2 3IDEA 2WS92 1ASJ1 4WM7B 3VBRA 1W39A 1D4M2 4YVSC 4GH4A 1FPN1 1ND3B 1VBA1 5FOJB 5ACA2 4CEWC 4Q4V3 1EV13 1QJY3 1B35A 4RR3B 1HRI2 5C9AC 3VBOA 1TMF2 2XBO3 4CDXB 4RQPC 3HAGA 2RS33 4Q4W1 2WZR3 3VBSB 1NA1C 4Z92B 2MEV3 4QPIA 3JD72 4Q4X2 4QPGA 1PO23 5C8CA 5CFCB 4RHV2 1R081 1COV2 4JGYC 5CFDB 1RUH1 4JGZB 1QJY2 1NA1A 1PIV3 4YVWA 4CDQB 1PO13 2HWB3 1GFF2 2BBVA 2WZR2 3JD71 4AEDB 1C8M2 1NCQB 1R1A3 2HWE3 3VBHC 3ZFGC 1TME2 1AR92 5C9AB 1HX6A 1K5MA 1VRH3 1NCRB 2MEV1 2PLV2 1VBE1 2Y26A 3DPRA 2R042 3J8F2 4Y5Z0 1EAH3 3S6PA 1AL22 1D4M1 1C8M3 4IV3C 1R093 1B35C 4PDWC 2HWD1 5J98B 3VDDB 1VBD1 1VB2A 3M8LA 1POV0 3JBG2 4WM8B 5AC93 3ZFFB 4JGYB 4RS5A 4EJRA 3VBFA 1VRH1 4YVWB 1RVF2 3VBHA 3ZFGA 1H8TC 5BNPB 1RUE2 4QPGB 1AR91 2HWC1 2RS53 1EAH2 1EAH1 2GSYA 1POV3 1E57A 5AC91 4CDXA 1C8M1 1BBT3 4PDWA 5ACA3 1NA1B 5C4WB 1RUJ2 1RUG1 1COV1 2RM21 3JBG1 4PDWB 4RFT0 1QJU3 1ASJ3 4NWWA 1FOD2 1RUJ3 1ZBE1 1AR62 1AYM3 4Q4W2 1PGW2 1R083 1MEC1 1POV1 1Z7S1 1TME3 1PIV1 1EV11 1NY72 1RUF2 4CDUC 5L7OC 1PO11 1HRI1 1IHMA 4GH4C 1AYN3 2RMU2 1WCDJ 2RM23 1ND2C 2WFF1 2MEV2 2PLV1 1ND3A 5BNNA 3ZFEA 1QJU1 3VBRB 5C9AA 2WWSA 5K0UB 2ZTNA 1H8TA 2XBO1 5CFDC 2XPJA 4CDQC 1BEV2 2RR11 1F2NA 2X5IB 2HWF2 1D4M3 1QJU2 2RS32 5D8AA 1AYN2 1OHFA 2RMU3 5CFDA 5FMOL 1TMF3 3JB4C 4YVWC 2RR12 1HXS2 1BEV1 4Q4Y2 1C8NA 1HRV2 1EV12 4Q4W3 2R072 4AEDA 2BPA2 1ND2B 1RUE1 4CDQA 1PO12 5C8CB 5CFCA 1PIV2 1BEV3 5DDJ1 1AR61 5AC92 1R1A1 2HWE1 1V9U2 1VBC2 1QJX1 1ZBA3 1AUYA 1A6CA 4GMP1 1FOD3 1RUC2 1AL21 4QPGC 1VBD3 2RM22 1RUE3 1VBC3 4CDUA 5L7OA 1NOVA 4N43B 4GB31 1OPOA 3FBMA 4GH4B 4CEYA 1ND2A 1BBT2 1M06G 5DDJ3 1QJX2 5ABJC 1HRV3 1AR63 5D8AC 5A32B 2IZWA 1HXS3 1RUD3 1PGW1 1CJDA 1AL23 4IV1C 3ZFEB 1K5MC 4CEYB 2FZ1A 3TN91 1DDLA 2WFF2 3VBUC 1RUJ1 2RS12 3TN93 4CDUB 5L7OB 2X5IA 1TME1 3JBG3 4Y4YA 1AL0G 1RUD1 2RS51 1F8VA 2GH8A 1BBT1 5BNOB 2TBVA 1RHI2 1RUG3 1COV3 3CJIA 1QQP1 1BMV2 1VBB3 1RHI3 1RUG2 5C4WA 2BFUS 4Q4V2 5BNNC 1VBB1 2RR13 1ASJ2 1ZBE3 1R092 3NAPC 1R1A2 2HWE2 4N53A 4JGZC 1QJZA 1MQTA 3VBUB 1TMF1 4AEDC 4RHV1 1NCQC 2WFF3 3VBHB 3ZFGB 1PO22 2RMU1 5JZGA
chains in the Genus database with same CATH superfamily
4QB1A 2JXAA 1ULFA 4FQ4A 4YNIA 4B7KA 1CN1A 2IXIA 4DOUA 4L8QA 3AKQA 1C4RA 1UZYA 1RMU2 1YRZA 3P6BA 4LORA 4AFDA 4AOCA 4B4PA 3OEAA 2WNVC 5C3QA 3ATGA 4AEJA 2F6BA 1HB4A 3T4VA 4GQ7A 4TWTA 4JX0A 3P3PA 1BKZA 2VMFA 3M3IA 3I2KA 2IXJA 3GYDA 3O12A 1AVBA 3PVOA 1NCRA 4KG8A 4AGRA 5KHKA 3OPWA 4HXCA 3O0VA 2VE1A 1K5MB 4C1WA 3AL5A 2J1TA 4RS5B 5GALA 2PQQA 3LOBA 3AFGA 4PIZA 3SISA 3WCSA 1S55A 1SMVA 2C9AA 4CCCA 1L3JA 3I49A 4XFFA 1LOBA 4D7SA 2PXJA 1ULGA 2Y33A 4TTGA 1W8ZA 4GD4A 2R073 5K0UA 1KS5A 4AVSA 1EUUA 3BPSA 4XF9A 3MIEA 3C8XA 5JXHA 3IDBB 2GP5A 1DGRN 4KGQA 1OOPC 4XDQA 1UYXA 1NXD1 2WQ4A 1NLSA 1VBD2 5LB6A 1Q8PA 3I2IA 2PYTA 4BQ5A 1F5JA 4XJWA 4BLJA 3WG4A 5FUIA 2RJ2A 1FOD1 1YI9A 2WA3A 4GMP3 1ST8A 3W58A 1AZDA 1W06A 3B3QE 5JPMB 2C6SA 2A5ZA 1QOTA 2E63A 2J1RA 2NN8A 1CZSA 4RS5C 4BXFA 1WLWA 3IKWA 5GZEA 1W2UA 2QBXA 3ZOIA 1MPXA 5FYTA 3IAQA 3MIDA 2J42A 1S0DA 1YFYA 4MGQA 4FPYA 4QX3A 3OGVA 1W0NA 2R30A 3OSDA 5FPLA 1GZWB 4QGMA 3C7OA 3TYJA 5IK7A 2VQ0A 4BISA 2ADDA 5T52A 5K7PA 4LQRA 2WZR1 3O1MA 1DGWX 4UW5A 3VBRC 2X53S 1WUVA 4LUMA 5K8SA 2R6QA 3C7FA 4FTBA 4C1XA 5DXDA 4GWMA 4E2GA 2DUQA 4I3GA 3OGJA 1WLTA 1RUH2 4A3XA 3MHZA 2VC9A 5FQ0A 3KD4A 3VBFB 2A7AA 4IESA 3UT0A 1SCSA 4WM8A 2PLV3 2A75A 4QKBA 4B7EA 1W8UA 4EQVA 5FPXA 2XJUA 4CUGA 4Q1RA 5HV0A 2VZVA 2ZEZA 3KSCA 3DGTA 1KDKA 5EPAA 3WDTA 4AQSA 1XOYA 3FWEA 2AZ5A 4LPLA 4XZPA 1AX1A 3URFA 2P3YA 2YYOA 1UKGA 2D44A 4AVAA 3MUZ1 3LAGA 1CVNA 1QQP3 3RRDA 1BYHA 1DQ5A 2FDIA 1HQLA 3D5OA 5KR7A 3UYJA 2OIIA 1YYNA 2QQJA 3WSOA 5FLJA 1MZ6A 5I8TA 1N1SA 1S0JA 3PVEA 1W6QA 3WOGA 4AVTA 5FY9A 3NRUA 4QPIB 3OEBA 3WQBA 2Z69A 4K21A 2GMEA 1RINA 3M3OA 4CXXA 1CIWA 3M3QA 4URAA 4Y22B 3KCYA 3KMHA 3WW2A 5C5UA 1QQP2 2QQIA 3SKJE 2RJKA 3GDBA 2UWBA 2V09A 4O65A 2DF7A 4MGZE 4NUBA 1WA4A 1V6LA 3EB7A 1RVF3 2V72A 3MV01 1VB4A 3CJIB 3L2YA 3A22A 4RL7A 4AEDB 2JG8B 4I0AA 5HXMA 5CKNA 5BNOA 1AR93 1UU4A 3CEWA 1YIPA 3HQXA 1DQ1A 3C3VA 3WP4A 1RGSA 1G8WA 1QKQA 4HKOA 5FZBA 1MQTC 1MS0A 5JMCA 5LWBA 3VDBA 2XONA 2WAAA 4MADA 1CD3G 2YBKA 1IPSA 1RUI3 2PELA 1ZA7A 4OHZA 5BY5A 1AHSA 2WO7A 1W6NA 1AXYA 2XVKA 3AL6A 4WVWA 5FPAA 1DZQA 4QX1A 4IV3A 4WV8A 1V9U3 1ZM1A 2BNOA 3F2ZA 2E7TA 1GOGA 4R4ZA 1ND3C 3WR0A 4B3NA 4IV1B 2GC1A 5IAXA 1AR81 2Y8KA 1JOBA 1FPN3 1VBA3 5CEHA 3WHTA 1AR72 1PVC1 4B1LA 4XILA 1AR83 1NT0A 3KF3A 5A33B 1V70A 5FAXA 5F5QA 4COYA 5A32A 3NJVA 3FLRA 2PHUA 4IL7A 1JYVA 4GAZA 4LEJA 2NQYA 2CNAA 2GNMA 4BQXA 1KITA 2DWRA 1CPNA 2DU0A 2HLEA 3NNJA 5D8AB 4Y1UA 3LZZA 3DUIA 3JB8A 4N43A 4LNVA 5FY8A 4FPLA 3WDVA 1PZ7A 3ZYIB 5ACA1 2VZOA 4WZFA 5TSWA 5A3MA 1BHGA 5J09A 1QMJA 5F5IA 5GZGA 4OHYA 2HJIA 3RFRA 4XIOA 3WNLA 4ARXA 2HWD2 3IB3A 2PHDA 3O0WA 3IDEA 3T4HB 2XWJB 1LOAA 4UYBA 5FP7A 4AVVA 3PU8A 2IFRA 2Q1FA 3MLKA 4DEQA 4LBKA 3VBRA 1GNYA 1V6MA 2PHTA 5JR2A 1LODA 1ND3B 1VMHA 3H1YA 1G9BA 4FFHA 5A1LA 3AYDA 5ACA2 4Q4V3 5KC5A 1ENSA 4RR3B 1QJY3 4KMQA 2WSVA 4AI2A 5IJRA 3RJ2X 1A8MA 1HRI2 4M3CA 4BQWA 5FLHA 1WW5A 4FAHA 1XJAA 4AEMA 4DXRA 3S5AA 1TMF2 1XNCA 3BCWA 4YG6A 3SH3A 4OUSA 4RQPC 4RSUA 1CAUB 1AX0A 4K8FA 1IPKA 2E7QA 1YFWA 2RS33 5F3EA 3T30A 3AZVA 5JOXA 4Z92B 4P00B 3JD72 5H9SA 5FPUA 1PMHX 2K46A 4QPGA 2AR6A 3R4SA 3O1UA 4K7JA 5C8CA 2IXCA 3WP3A 1R081 1W3XA 2WO2A 3POYA 5FZ4A 2Z42A 1O3QA 2XXZA 1CGPA 1RUH1 1UMHA 3IBMA 1PIV3 2VNRA 4IE5A 4JGZB 4OMDA 4IGPA 4X8NA 3HT2A 4OLLA 3MGUA 3T2PA 1GFF2 3LE0A 4GALA 4YZ4A 3ZMOA 1WD4A 2WINB 4LA2A 5FP3A 3TEWA 2WZR2 1QXJA 2VD7A 4L99A 2VCCA 1C8M2 2P34A 2E26A 3MICA 4HSJA 2VECA 4O7XA 4K6BA 1JI6A 2O14A 1TNFA 1NZCA 3AZWA 3AVRA 1LGBA 2D3RA 2ZMKA 5LATA 2VQUA 4Y20B 1AR92 5C9AB 2A71A 3FUOA 4FXKB 1K42A 1ZRRA 2VULA 2Y26A 5DABA 1DYKA 1VBE1 1DIWA 3U07A 5J36A 5F2SA 1I5PA 2JE8A 2ZACA 5LBCA 3ZXDA 2W92A 4DRRA 1SFNA 4FOYA 3RI9A 3U14A 4UFKA 2VCBA 3MLLA 3BTAA 1U12A 1R093 5A6QA 1UOGA 5APAA 4PDWC 4DINB 2QNKA 5J98B 3IDAA 1VBD1 1ONAA 1VB2A 1W2TA 5DZGA 5HCBA 5FZ0A 4I0BA 2ATFA 1XBFA 1UW8A 4XTMA 2BP6A 2DUPA 3WF1A 1XNDA 3ZSJA 4JRAA 3TRSB 1VRH1 2WNUB 4PI2A 4H7LA 3H3UA 2DYCA 1HDKA 4J1WA 2WRAA 1I1EA 1RUE2 4YW5A 5J1XA 1N1VA 1UY1A 2FCVA 3DL3A 3SNMA 2JB8A 1XNAA 5LY1A 3FHAA 2YMZA 3VHNA 4QD2A 1W0PA 1Y3TA 3LIHA 4NVPA 5CNAA 4MLOA 2ZGLA 4XUTA 4I30A 2SLIA 4Y5TA 3AMPA 5JSRA 4XFCA 3WNMA 1VRBA 1CR7A 1O8SA 4OI2A 3HN1A 1O4ZA 2YBPA 3W9AA 1S0GA 4W4ZA 4LOTA 3WF2A 4ZU5A 3KCXA 5IYYA 2Q8CA 2CGOA 4PBPA 5DUUA 2CYFA 3OTFA 4QQ2A 2VZ3A 4Z2WA 1XE8A 4EE2A 3W5NA 1FI2A 1RUJ3 3WF4A 4LULA 4UFJA 3I2GA 1POV1 3FUQA 1UZVA 4OCTA 4KWJA 1RUF2 4UOJA 5L7OC 1MS8A 1IG0A 3H1WA 5E8AA 4GWIA 5FZ1A 5BNQA 2RMU2 1XPWA 4EN0A 1WCDJ 4ET7A 2ZGSA 5HI0A 3S5QA 2PLV1 4IUGA 5GZFA 3MIFA 5BNNA 4CPBA 2X29A 3ZFEA 3VBRB 1DQ2A 1VMJA 3D4KA 4XIKA 1ZNPA 4MUVA 3RMXA 2EF6A 5K0UB 1DBNA 5FY1A 2ZTNA 3QLQA 4ITCA 4E8CA 3I2JA 2XBO1 5CFDC 3G7DA 3NVCA 4IW3A 1H2MA 3ABZA 3P5BA 4XOGA 4BYYA 3OBTA 4LBJA 4UW4A 2R1BA 1RL3A 1V6IA 4QHBA 3GGLA 1VMFA 5FO8B 5LRSA 2RMU3 1SZBA 3LCPA 4XC9A 5FMOL 4Q29A 2FBEA 4G4FA 1IQAA 4QHZA 4YVWC 5F6LB 2V5DA 1JS9A 2KD7A 5DQ0A 1D0GA 2IXHA 4AFAA 1HRV2 4JHZA 3AJZA 4BH9A 1UAIA 2BVVA 1F9KA 2ZMLA 1ULDA 2R072 4FO9A 4AEDA 4YZ2A 2C24A 2BPA2 1MZ5A 1QOSA 4HZFA 2BU9A 3WDUA 3GALA 4D8MA 5IK8A 3O1TA 3VL8A 2E9QA 4FAGA 1SACA 3CJXA 3I8TA 2FDHA 2CU5A 2GAUA 3ZR5A 2W47A 1I6XA 3R05A 4JQTA 5EFUA 4KBZA 4BDVB 2VMHA 3I3EA 3RYPA 3THCA 1G6NA 5DDJ1 2WLQA 4QGLA 4CP9A 3S57A 3ORJA 4PIYA 2HEYF 5K4LA 5L9RA 1R1A1 2HWE1 3RI8A 4Q8KA 1V9U2 1VBC2 4XFAA 1CAVA 2BEOA 4GA9A 2W91A 1RUC2 5GLTA 1AL21 3ACLA 1RUE3 4KWUA 1JUIA 1BCXA 1NOVA 2YU1A 1XSQA 4DXZA 2AEYA 2ARXA 1KXGA 2VW1A 2VVDA 3HR9A 4Q0VA 4XABA 1LOFC 3AKRA 3HNMA 3FBMA 2GNDA 3QH6A 3N7MA 1M06G 3POWA 4IGOA 3UESA 3AP7A 1GZTA 5FPVA 4YZ1A 4EZHA 1H4HA 1PGW1 3CMGA 1CJDA 2A3YA 4LBLA 2VZQA 5CA6A 1E5SA 2RE9A 1REDA 3IAPA 3TEXA 3TEYA 3NKTA 3USUA 1PVXA 4DXSA 4YZ3A 1K5MC 5KHJA 4CEYB 5FIXA 2ZHNA 3KV4A 5DG2A 3TN91 3E6BA 3U0ZA 2EVXA 2O0OA 3NV1A 3TN93 3ZKYA 4I0WB 5FMCA 4MX3A 4YM0A 1UIJA 3OD4A 5FK8A 4NAMA 1Y9MA 4A45A 2RS51 3IIAA 1NX9A 3RWNA 4ZKTB 5JMOA 4Z2AA 4ES9A 1J1LA 1HJFA 5KHHA 4YW6A 4CU9A 1GZWA 1NQJA 1BBT1 1EPZA 1UU6A 4COWA 2EXJA 2Q0AA 3T0DA 1H9PA 4YG0A 2I45A 3UL2A 1WMDA 1N3QA 4LA3A 2E51A 5A3WA 2LTNA 2FDGA 3RS6A 4NIDA 2ZJCA 3WUDA 2W1WA 1H2KA 5AFEA 3KQRA 2GN3A 5ANNA 1KFXL 4OHVA 3OYWB 3RZGA 3BYWA 2W94A 5CVRA 4COZA 5BNNC 2RG4A 3BGAA 1WD3A 2RR13 1LB2A 1ASJ2 1CAVB 1ZBE3 1LNSA 5IHRA 1ZZCA 4N53A 4UWDA 1W0OA 3M70A 4WVVA 1LESA 1JBCA 2WYSA 3OY8A 1MQTA 4QX2A 4HK8A 4FT8A 1IPJA 1S0BA 2CDOA 3PUHA 4G3YC 4D6RA 1TMF1 1US3A 2J1EA 2FDJA 1NCQC 4COVA 5F3CA 1H1IA 4N90A 3VBHB 4BK4A 3A7QA 4XYXA 2GN7A 2LS6A 3VD9A 3AZZA 3D6EA 2EICA 1JMUB 4UBHA 3BN6A 2WJSA 4N9HA 1W2NA 1IOAA 2VH9A 3N9MA 4ISRA 4R9CA 4Y22A 5A7QA 2BUKA 3QACA 3RYRA 3LGRA 2OT7A 1RJ7A 2KR2A 3PURA 1Z7S2 2HWB2 4DEVA 4L2NA 2XHNA 2D93A 1W6QB 2RDNA 4H3WA 1VBE3 1VBB2 2XUEA 3BTXA 1PHMA 1EPWA 3WINE 5FOBB 5M0TA 5BNNB 2P37A 2EAKA 5FO7B 4CSWA 1VBE2 1JYTA 3ASIA 3GNEA 1DGWA 5JVVA 1FMD1 5GKAC 2VZTA 1RITA 2ORXA 3JXSA 5KHGA 3LQCA 1AR73 3KGLA 5BNPC 5JZGC 1NCRC 1QH7A 4Y1XA 2W52A 1RUD2 3N35A 1WCQA 1XNTA 2ZOEB 2FCUA 1Z78A 3HMYA 1QJX3 4L0PA 5D21A 4CP2A 2WFPA 1H1MA 1NLRA 5FZDA 1G9FA 1Q8SA 3MFAA 2W2IA 3FL7A 2JICA 2VQAA 3ALQA 4ATEA 2JG9B 4V2WA 1PK6C 1L7RA 1F35A 2VOVA 1W8NA 1RUI2 3DEMA 4RYDA 3AZYA 1OURA 1CX1A 1V00A 5FYIA 1A34A 3W59A 3VBUA 1PVC2 4CEYC 1QIQA 2JDHA 1CZVA 3DV8A 2G19A 1NCQA 5JIAA 3K4DA 1XB9A 3H8RA 2HWF3 2KM2A 3LOIA 2ARAA 3NNMA 4JVAA 1SLLA 3RNSA 3D8CA 1K5JA 3ETPA 4K9SA 5I91A 5CAZA 4QX5A 1EYBA 1ACCA 2GMMA 3GZTB 5LEJA 1U5ZA 4EV0A 1XE0A 2JDYA 3F95A 4QX8A 5FBJA 5EZWA 5HPOA 4YW2A 2Y34A 3N4MA 5LK7B 3QH7A 1DZTA 5DUWA 1KEXA 1Y43B 4PHZA 3V65A 1ULEA 5IVJA 1G9CA 1J84A 5LEKA 3GZUC 4XJAA 1MQTB 3NNLA 5H9PA 3ZFFA 2A3WA 3SHRA 3AP5A 1NYWA 5EQUA 1HB1A 4BCUA 1YO8A 5FZEA 4E4SA 3I3MA 5FXVA 2ETEA 3B02A 4QXCA 2QTWB 1FMD2 3RZKA 4AYUA 4F83A 4CCNA 1DGLA 2VW0A 4Q4V1 2X8KA 1QJY1 5LA9A 1UOBA 4LBOA 2FD8A 2HYKA 2VOKA 2ZHMA 3ME2A 4HSLA 1JYWA 5FP8A 3C7EA 2IC1A 3RZMA 4NJ4A 5J37A 5I93A 3HJRA 2HWB1 1RHI1 4N7UA 4OUMA 2JDZA 3MUY1 4R9DA 5A3UA 3KGZA 3N3HA 4AI0A 3JCIA 5FP4A 3H8XA 3HQUA 1W9FA 4RHV3 4DO0A 4HVQA 4QB6A 4BWOA 4FP3A 1JYNA 3VD7A 1RUNA 2D6MA 3N36A 4XCBA 1D2SA 3VZOA 2BV4A 1RUH3 1LHOA 4PI0A 4Q5OA 3DPRB 1RUC3 1XNBA 2J7MA 4RFRB 2QJVA 1RVF1 1XU1A 5L9BA 1QY4A 1H30A 1NY71 3BU7A 4Q8LA 3K48A 4EROA 1OOPB 3DECA 1YLLA 1PZ8A 4BQ4A 3OG2A 4Q26A 3WHUA 1O3SA 4DUVA 3ZDVA 5C8CC 4YGDA 4MSVA 1YJLA 1FXZA 3CF6E 2VZ1A 2XMLA 1UOJA 2R0FA 3I3QA 3IWZA 3JD73 4K40A 4RR3C 5IK5A 3BTZA 2Z2SB 1ZZ6A 4LO6B 1UO9A 2JD4A 2OUHA 2ZEWA 4IEOA 3ZXJA 1GYKA 1RUI1 4FFIA 5LBFA 4MVTA 1KDMA 2VQTA 4FI9A 1IS6A 3AKTA 5LA0A 5KHIA 1IZ3A 3D3AA 2G1MA 3FFQA 5LK5A 5DPNA 3EHKA 5A3NA 5DAWA 1HB2A 5FZ7A 3FE5A 2ZX0A 3CLPA 3OY8B 4OYUA 4QU1A 3U75A 3WCRA 4V2VA 2D5HA 1DLLA 1QEXA 2EXHA 4EWDA 2ADEA 3M4FA 3DPRC 1ZZBA 1W8FA 3TBDA 5BXXA 2GH2A 2HWD3 2R32A 5FY5A 5E88A 4QKDA 1B35B 2ZHKA 3FFZA 5AVPA 1VE0A 3VL9A 4NR1A 5FYVA 2WLPA 3ZIXA 2YC4A 4CEWB 1YQ5A 3KT7A 4SBVA 5H9QA 1H8VA 1UWWA 3ZFEC 3HPNA 1S2KA 1YWKA 1PM4A 2DBNA 2PHWA 2UY8A 4Q4X1 1NUKA 2YB7A 5JUVA 1UXZA 1IQDC 3B9CA 2R063 3FHIB 2XLGA 4META 5FFOC 1S2EA 4N43C 1H8TB 3V0AA 2ZX1A 4NHKA 2VW2A 3ZVXA 2LW8A 2VCMA 3OGGA 1NG0A 2VZRA 1HXS1 1S0FA 4RD7A 3EMRA 2QFEA 1W8HA 2E31A 4DNYA 2R041 3IMNA 3GBFA 3J8F1 4AZZA 3JQWA 1AYN1 1ENXA 4XFGA 3JU9A 1W9SA 5A3TA 1UXXX 2R043 3J8F3 4QX0A 3U4XA 3OD0A 4HPKA 2JE7A 4LBQD 3ES1A 3LPGA 1X36A 5FYZA 4QWNA 3TAYA 4J25A 3VDDC 4J1XA 4Q4Y3 2VCAA 3AMQA 4KNCA 2WIIB 3NO8A 4QM8A 1WMFA 5C3OA 5FY4A 1TVGA 4XQ4A 3I59A 4AW7A 4FP2A 2WS92 1ASJ1 4NHXA 3NJXA 4BLIA 2WZ8A 2XJPA 4D3WA 4Q0SA 4CU6A 5LASA 1FAYA 4YVSC 3K3NA 3MBWA 4GH4A 4Y5SA 5FTTC 1FPN1 1VBA1 3KB5A 2AGSA 1MS4A 3EQEA 4LITA 4LIUA 3K75B 4LOSA 3P3NA 4CEWC 1HV0A 1B35A 1QHDA 3T0BA 3UK9A 5JAXA 4HANA 2W39A 3E5QA 3THDA 3RMYA 4BA6A 4BK5A 4BMEA 4AFBA 2XBO3 2X09A 1V0AA 4CDXB 2ZX4A 1XNKA 1YJKA 4P5YA 2JB4A 4WVMB 4CUAA 2W68A 4Q4W1 3VBSB 5AFBA 3GCXA 2D6LX 3FBYA 4TSVA 2ERFA 4IE6A 1WBFA 4EYUA 4IDZA 2EIDA 4XDOA 5FZLA 2TNFA 4RHV2 5FYCA 2WNVB 4LTAA 4JGYC 3IN9A 2BNNA 4XURA 2ID4A 1AX2A 2JKBA 2W9XA 3OUIA 4CDQB 1UF2C 2I2SA 2LROA 5A7PA 1N3PA 5HCFA 4IEUA 4INDA 5LRRA 5L9VA 2WNEA 1I5ZA 4AGGA 1YCIA 2D97A 1SDDB 3R4DB 4LKFA 3BIEA 1I3HA 4HKLA 2JWPA 4YWAA 3O5SA 2EALA 3BPZA 1JOPA 1OI6A 3POBA 1TME2 3NJZA 4Y24A 2ET7A 1HX6A 2JENA 5K9YA 5FQ0B 1VRH3 5FWEA 1PGSA 2PLV2 1GQPA 2J1VA 4RN5A 5E6HA 4XFHA 4FOVA 4LKEA 3S6PA 4Y1ZA 1REFA 4IEYA 2BGCA 1AL22 3CZUA 4CA9A 1QWRA 1C8M3 3OGRA 4IV3C 3VB9A 3VD3A 3LDRA 2NMOA 3ZN5A 1ULOA 3BOWA 3LEGA 4M4PA 2RDQA 4OI1A 3PHMA 5GZDA 1YFUA 1BLZA 1H2LA 2K2SA 1LAJA 4QQOA 1Y4WA 3U37A 2GP3A 4JGYB 2B5HA 1M4WA 4D6QA 5C70A 5JI9A 2KA3A 4LR4A 2DDUA 1O6UA 3VBHA 2XLAA 1H8TC 2A3XA 1FX5A 2D6KA 3O1VA 5BNPB 2C9KA 2BRTA 1V6OA 1S4CA 1CAWB 2LUWA 2P3KA 3E1F1 4QPGB 3LDBA 5CISA 4JKKA 3MFCA 3GHNA 3KQ4B 3OPZA 2UWAA 4WVMA 4CP1A 1POV3 1VAMA 4L92A 1PK6B 1SQ4A 2ZGPA 1KJRA 4NPRA 5AC91 4P14A 1OF4A 4ZS3A 3O1OA 4L11A 5ACA3 2WZEA 2V4VA 1W6OB 2IWGB 3RDIA 1YIFA 3POSA 1LGCA 4M00A 3O0XA 2XLFA 3WP5A 4RFT0 3AKSA 5T54A 1UY2A 3M1HA 3ILFA 4LT5A 2XVGA 1YC61 5DAPA 3MW4A 2WKKA 1W6PB 3SC7X 1AYM3 3P1IA 3K46A 4Q4W2 5GJ6A 3ZDSA 1MEC1 2ARCA 2QQKA 3GHMA 4DUXA 5FDBA 4S2DA 2YFZA 3IIIA 4NPMA 1PO11 5I0DA 4GJZA 1OT5A 5JXIA 3N7KA 2QCSB 4GH4C 4XAEA 4JZRA 2B8MA 2WFF1 4ZXKA 3RJRA 3V0BA 2JDPA 1ND3A 5FZ3A 2PN5A 2CHHA 4LJHA 4TXWA 4QMAA 1DGRA 4XETA 4KI5M 3M3CA 4BXSV 1RTVA 2JIGA 4AL9A 2R0HA 2UWCA 2XPJA 3UKNA 4YSFA 4CDQC 2RDSA 4AVBA 3H42B 1UY0A 1LHVA 2X5IB 4I2OA 4Y3OA 2BWAA 1NKGA 3WLUA 1L7QA 5J48A 5B4NA 1D4M3 3HVDA 4C8DA 4CTEA 5FYBA 1N3OA 1U5IA 4QQLA 2ENRA 1IKPA 1AYN2 1OHFA 1OLQA 5GLZA 5CFDA 5FZKA 4BU2A 2AYHA 4CCOA 4DIQA 4LO5B 4NROA 5FPBA 4QHOA 1GWLA 2P2KA 3WNNA 1D7PM 2OQ7A 2RR12 4W6WA 1HXS2 4X6RB 2CAUA 2H6BA 4A2UA 2BERA 3LEMA 1OQDA 1EV12 2B39A 1WWYA 1V6KA 2B42B 1ZYBA 3LDKA 1LOEA 3K77A 4AHZA 1Q8QA 4PLNA 2Q8OA 2JDNA 2JJ6A 1DCSA 4PQ9A 2XDVA 1RUE1 3VKOA 2FHRA 4LLOA 2RV9A 2NMNA 3PLQA 3BOPA 3VZKA 5CFCA 5T5LA 4HK9A 1HIXA 1BEV3 4OZOA 4XF4A 4CCEA 2XVLA 3MIHA 1H6YA 1RC6A 2C26A 4IQPA 5F3IA 4IE4A 1OMIA 3T1LA 2BW8A 4JDOA 4EN8B 2QKDA 2UURA 3KT1A 3SKVA 4BB3A 4XDPA 1QDCA 3I4IA 1WA6X 1QJX1 1LHWA 1AUYA 4FVVA 1A6CA 5C71A 1FOD3 3KM5A 4GMP1 4QPGC 2ZZJA 1HN0A 2WZPP 3TWIA 4YW3A 1RJ8A 2RM22 4MYEA 1RYYA 1VBC3 4PLOA 2FQPA 3AX4A 5L7OA 4LBMA 5I8YA 4A7YA 1WLDA 2P4EA 5DAXA 2VPVA 2GC0A 4AI1A 1ND2A 3DXUA 3UV9A 2BTVC 2XR4A 3CKHA 4PCRA 2G9ZA 4XUPA 5C3SA 4S2GA 2W1UA 2XG3A 1AR63 4ZONA 2QQMA 4WBBA 1HXS3 5T5JA 4IEZA 2G9FA 2VOXA 1JZ2A 3THTA 4ZS2A 2NZ9A 1IS3A 2H6CA 4QDQA 1QOOA 3ZFEB 1C1FA 4NIAA 1RUOA 3ON7A 3L9JT 1SBDA 3V0BB 4M3CE 2XJTA 3VBUC 3ZN4A 1RUJ1 1XQNA 4XF3A 1BVP1 4AFCA 3WQ0A 1XYOA 3JBG3 5A1FA 1G86A 1RUD1 1GQHA 3T2OA 1O5UA 3FLTA 2VXJA 2VY0A 2WQ8A 5C3RA 5HBAA 3HWJA 5CKQA 1O4YA 5GLWA 4OQ8A 5BNOB 2VBPA 4P02B 1RHI2 1RUG3 3NV4A 4FPKA 4XXPA 1COV3 3SLIA 2WT1A 1OD3A 1QQP1 4DXTA 2MNGA 1VBB3 4JDNA 1RHI3 1RUG2 4P08A 4UW6A 4OVEA 4Q4V2 5HCHA 5J7MA 1VBB1 3M3EA 5JLVA 4CXYA 2HH9A 3KT4A 3ZR6A 1F4HA 3FHQA 4TLFA 2F17A 5KXCA 2QVSB 2W08A 2CGNA 5FJKA 3SEEA 4JKMA 1HLCA 3HBZA 4QM9A 2XGXA 4QQHA 2YFUA 3VBUB 2Q5TA 1UPSA 2BBAA 4GZ9A 5F32A 2G9GA 4GXLA 1T6BX 3DYOA 4QT6A 1VAVA 5BV6A 4YW4A 1LR5A 5FZGA 1JHNA 1W6OA 5A7NA 3ZFGB 3I2OA 5I0UA 2D6OX 3L2HA 2FMDA 2Z79A 3I2DA 5FJHA 1GP5A 3HOBA 5A6YA 1SLIA 2VL4A 2Q8DA 3VBOC 3WQ1A 2JEMA 1AR71 1ZBE2 4AQTA 3K3OA 4UXAA 4ZZ5A 2DVFA 4LO7A 1AR82 4RGAA 1OOPA 1XU2A 2K0GA 1GOHA 4ASLA 5G05L 1GP4A 1OLMA 5E16A 3NV2A 4IETA 5F6KA 3DKQA 3E5XA 5IVFA 2RDRA 3NAPB 2E53A 3PUSA 3RYKA 4XFBA 4F7ZA 3LEKA 2WL1A 2CSGA 1W03A 1GWMA 4MOAA 3VDDA 4EZ4A 2AC1A 1F5FA 4XEZA 5DZFA 5A3OA 5T5PA 3WF3A 3MIBA 3DN7A 2AENA 2WWJA 1X50A 2DCZA 2N7GA 4AK3A 3LPFA 4GMP0 1DQ4A 5ABJB 1DG6A 2HWC2 1KRIA 3T0AA 1JW6A 3ES4A 3NAPA 1EY2A 3LEIA 5CB7A 1ZA4A 4JGZA 1T6GC 3OJBA 1G9DA 1W9YA 2WN2A 4LLFA 3B93A 2ZAAA 3TEZA 2HYXA 5A7WA 3WDYA 1C28A 3ZXKA 1N47A 4MG2A 4NIGA 2IXLA 4K1YA 3CQOA 3SH5A 3GZEA 4R9AA 1HV1A 2AACA 1YQ2A 2P5BA 2ZAHA 3ZYHA 2ZGMA 4B8EA 1IS5A 3C7GA 2XWBB 2LM3A 2WUHA 1X8EA 1VLNA 2X05A 3SITA 3AMMA 3J7LA 4G9SB 1O3TA 1FMD3 2HWC3 4MH0E 1LOCA 2BOJA 4X8PA 4A7KA 4Z8BA 1JXNA 4YZ5A 3NV3A 1JZ3A 2UY9A 2WNVA 3VDAA 5A1AA 1UX6A 1UPIA 2OVUA 1ZVFA 3N9PA 5FPZA 5SV8A 2RJLA 2Y0OA 4AE2A 4COUA 2XB6C 4HOOA 3WT3A 4D69A 4DFSA 2FZ2A 3PMEA 3D0JA 1WMEA 1WW4A 2J1AA 2ZGKA 4YFWA 3PL0A 5F9TA 4OZXA 2OUJA 2OKXA 2I74A 5C4WC 2OZJA 1V9U1 4YW7A 3AM2A 3RZHA 5FMOS 2ZGNA 1PGL2 3S7EA 1X33A 1OA2A 5JPNB 5LBEA 2D3SA 3ETQA 4HL0A 3SCGA 4NPLA 4UI9L 4EN7B 1PVC3 4RGGA 4N7IA 1LHNA 3E97A 4MXVA 4UBGA 1UYZA 4YW1A 1E5RA 2WS93 2SBAA 1KD7A 3DKWA 1RXGA 5IK4A 2QQNA 1H1AA 4DS0A 2R7EB 5DUXA 1CWPA 3SCFA 3W5MA 4XQWA 3T2QA 4KGGA 3IT8A 4XJ8A 1A8DA 2VXRA 5A7SA 5JWPA 1KFUL 3KV5A 3FN9A 2Y6FA 2QQUA 4U2AA 1O59A 1QF3A 2JG8C 2Y0IA 4V1PA 4Z07A 3ZYBA 3NW4A 4BZ4A 2D6PA 2RS52 1Q56A 2J1SA 4IV1A 1IGOA 5EV7A 1O8PA 3NNFA 3ZO0B 5JZGB 2W1SA 4PF5A 5FWJA 4PBOA 2VZPA 1SPPB 4RQPB 1X82A 3MLJA 2VVFA 2P6CA 1X9PA 4LBQB 3ZKUA 3SEPA 2OW4A 3PNAA 3UJQA 1XXNA 2GZWA 5IVEA 1LJ7A 1ZZ9A 3OGSA 4FSJA 2X5IC 4PJYA 1S2BA 2WO3A 4IEQA 4PQQA 1SCRA 2ZMNA 5IWFA 1R091 4TYSA 4XFIA 4AQ6A 4YVSB 5EJ3A 1MS1A 2D40A 2OS2A 2OYZA 1XE7A 5F2WA 3B5LB 5LA2A 3ZYFA 4MGSA 4QX7A 4CEWA 2CTVA 1LKNA 3AK0A 2R16A 3ZN6A 5A70A 3OYWA 1RB8G 3H7YA 3GXUA 4CDWA 2BOIA 3R0RA 1BMV1 2JDMA 3AYAA 1Y9GA 3ITQA 5FMBA 2VTFA 1GUIA 1C5HA 4D6SA 4ONUA 4AAXA 2OA2A 2JIJA 3HN3A 4KU7A 5IUQA 1OVSA 1LEDA 1W8OA 1AXKA 2EIEA 3H3ZA 1QJFA 3VD4A 2R061 1JZ4A 1GU3A 5B4XA 1OVPA 1VBC1 5T55A 2P17A 2GDFA 4Z82A 2PMWB 1S0CA 5EXOA 4JTOA 5F5AA 4GJYA 3ILRA 3IM0A 5KC6A 3RZLA 3C2UA 1OH3A 1U0AA 4WM7C 3LA7A 3S7IA 3HD8B 3AXEA 4BHPA 4OI0A 4YPJA 1FPN2 1VBA2 4QPIC 4UF0B 1F31A 2PHXA 4BE3A 2IUWA 1K45A 2J22A 4XUNA 1YEWA 3KHCA 2XL7A 2KXLA 1PGL1 3ZSKA 3DXTA 4Y33A 4Q27A 3VKFC 3WDWA 2WNUC 3H1MA 5IVYA 1RMU1 2D43A 2ZS6B 4B4QA 4QXBA 4D94A 1JZ5A 3BU0A 1HRV1 1RMU3 1NLQA 5FY7A 2ZPXA 2WQZC 1OXCA 3T2TA 5FZOB 5BUVA 3ZLIA 3CJIC 4A41A 5F37A 1LHUA 1C57A 5FZMA 4UF0A 2XL9A 4MGYE 4FOWA 3WG3A 4RQPA 4IV3B 1SEFA 4IEWA 3AC0A 4OULA 3WW1A 1UL9A 3THPA 1VRH2 2BZDA 2WBKA 1ZREA 2P3JA 3KVBA 3H50A 3MEPA 1CAXA 4HKWA 2WT2A 1AYM1 2B4KA 5CG8A 4FPJA 2DTWA 3PTYA 3LA3A 1MEC3 1TNRA 4UFMA 5IVCA 1QDOA 2VU9A 2IVJA 3VZJA 1W3VA 4EN6B 4WM7B 2OQ6A 1W39A 5FK7A 4BMBA 2FMYA 3BTYA 2VR4A 3WF0A 4YG3A 1EV13 1FV2A 1URXA 3LSDA 3WNXA 2H0VA 2ZKLA 3H0OA 3PTRB 5C9AC 1VJ2A 1STMA 1GV9A 3KF5A 5D2AA 3VBOA 4ATFA 4HG6B 5KBFA 4JDMA 3HAGA 2C0ZA 3JUUA 5A3LA 2QQWA 2WZR3 1W6PA 4XBQA 2ZKNA 2MEV3 2YUEA 3QOPA 4QPIA 4GKXA 4JQRA 3CZJA 3B01A 1MS3A 4Y1VA 1I9RA 4HMZA 5GZCA 3AVSA 1PO23 5CFCB 4LHNA 1GQGA 3UKTA 3CBNA 4Q0QA 4MHUA 5CFDB 5JOZA 1NA1A 4YVWA 3VKNA 4GWJA 4ZXEA 4XZUG 3OUJA 3ZXFA 3POFA 3ELNA 2DVBA 3PJYA 2BBVA 3I2HA 3VD5A 5A6XA 4YGBA 1D0HA 3JD71 4YYOA 2YBSA 1JYCA 1VPHA 1R1A3 2HWE3 1ALYA 1H4GA 3MI8A 3ZFGC 2JDUA 2VMEA 1YFXA 3S0MA 1YQ8A 2DTYA 3NMBA 2WO1A 2AREA 2GALA 3RZJA 4J6GA 3RVHA 3RG0A 1NCRB 3DPRA 3Q8BA 2R042 3J8F2 4Y5Z0 1EAH3 4W6XA 3E6CC 2W95A 2CY6A 4IERA 4MO3M 4ASKA 4P9GA 2WABA 1XRUA 1JZ8A 2NPIA 3ZXGA 5FZCA 5B2GB 5FUPA 2GNTA 2HWD1 2ILMA 4PIXA 3J9SA 5CU1A 3VDDB 4B4RA 3R6SA 1OQ1A 2W1QA 5AC93 1BJQA 4RS5A 1OFNA 3ZFFB 4EJRA 5JOWA 1BK0A 3VBFA 1ULPA 4JV4A 1CESA 3ZIWA 5DZEA 5F5CA 2FDFA 2VZUA 3ZFGA 1HKDA 3VZNA 4AFMA 3GJAA 4YARA 4NIHA 1WCKA 5D1IA 4QU2A 4A3ZA 2YHJA 4NRMA 1ZRDA 2YGLA 4QQPA 4OFGA 3T1MA 4K1ZA 2DFCA 1FYUA 2DUOA 1UQXA 5FXXA 3WZ1A 1AR91 2HWC1 4W50A 5ERLA 5FMDA 5FZFA 4NHLA 3RQ0A 3WUCA 1OLME 2RS53 4R52A 1EAH2 2AUYA 1MZEA 2PAKA 4N8MA 4Y4RA 4C90A 1O3RA 1C8M1 1BBT3 2Q1ZB 3N9LA 4IXLA 4LKSA 3APBA 4PDWA 2NLRA 1NA1B 2DCKA 4P9LA 1RUJ2 1W6MA 3B7MA 4LE4A 4B1MA 4D7YA 5KXBA 4C0HA 3A0KA 4CU8A 4EN9B 1N1YA 3ZYRA 2O8OA 3NQHA 2IFWA 2ZX3A 4KBBA 2VNGA 2Y6KA 3JBG1 5IFTA 4JAAA 4PDWB 4LE3A 1WW6A 5FZIA 5FV3A 1ASJ3 4NWWA 2XQXA 1FATA 2Y6JA 4QKNA 3ACIA 4A6OA 1TZOA 4P9XA 1ZBE1 5C6CA 3I59B 1AR62 4OMCA 1R083 3Q8CA 4MGIE 2AH2A 1YI7A 1TME3 2ZEYA 3KWVA 1AXZA 2A1XA 1UKRA 2I07B 1PIV1 2VZSA 5T3NA 4P9WA 1NY72 4KWKA 4E4DX 1MS5A 5EYYA 4ISQA 4W6YA 2D7FA 1HRI1 2HBUA 1IHMA 4E4HA 1XC6A 5FZ6A 4UFHA 2BDRA 2RM23 1ND2C 2MEV2 1MACA 5EWSA 2D6NA 4JHTA 1SLBA 1Q8VA 1QJU1 1UYYA 4CCLA 5C9AA 4HETA 2WWSA 4GWNA 4NMIA 4Y1YA 1ZRFA 4P9YA 3VLBB 2CWMA 1UX7A 4AWDA 2W87A 5IFPA 4XUQA 1BEV2 4Y26A 1OKQA 3Q8AA 3SQOA 2NM1A 5FYMA 2Q1MA 4Q0UA 1F2NA 4YGEA 5GM0A 5EP9A 1QXRA 1F4AA 3J7NA 1H2NA 4HPKB 1X8MA 3QCWA 1QJU2 1D2QA 5FKBA 2UU8A 1SBEA 1W2AX 2Y38A 1LECA 4A4AA 1W2OA 5KXEA 1BEV1 4HN1A 3HNBM 1C8NA 3VHRA 3HNYM 5FYHA 4CRQA 4UW3A 3CHXA 2EA7A 5DN2A 4EWAA 2YC2A 3J4UH 3AMNA 3M2MA 1GNHA 3JQXA 5FLIA 3WNPA 1LRHA 4AHXA 4AG4A 2OX0A 3CU7A 1ND2B 2W0XA 5HV4A 1UY3A 3OPTA 3POEA 1X9TA 4H55A 3A23A 2Q4SA 5FR3A 1R1ZA 1ZZ8A 1F15A 1XSRA 3PUIA 2O1QA 4I3PA 4FCAA 1PNFA 5L36A 1PIV2 2OPWA 2E33A 2P1BA 5JSPA 5CYYA 1AR61 3ZSLA 1OA3A 3MZHA 1EP0A 3INAA 2B9UA 1D4VB 2PA7A 4HLTA 2FCTA 1NE6A 1NQDA 3BUCA 2XJSA 2R49A 2XKOA 4R9BA 5CKMA 1GNZA 4LK7A 1AF9A 1LULA 5L73A 1PX4A 1GR3A 1OUXA 4HN0A 4RA0A 5FRAA 4FQZA 4N43B 4CDUA 5LCWL 4GB31 1Q43A 5AVAA 5FZ8A 3BVCA 3H7JA 1VR3A 1LTEA 4GH4B 3RWKX 2O8QA 4AI9A 1BBT2 4AI3A 3NJYA 4LMFA 3BB6A 1O4TA 1QJX2 1HRV3 1AJKA 2B45X 1POQA 2IZWA 4XBNA 1RUD3 2WA4A 4YRDA 3ZPOA 3MPBA 4XHBA 2EAAA 2YY1A 4A7ZA 2DVDA 1BVVA 1W9WA 4KH9A 1DF0A 1RXFA 1CAXB 1PZ9A 2CWSA 4DQAA 4IV1C 2ARBA 1GOFA 1P8JA 5FY0A 2FZ1A 3AP4A 4M0HA 2DCYA 1FNZA 2YXSA 4FFGA 1JYXA 2A6VA 3GM8A 2Y6LA 5L7OB 5F1RA 1W6NB 4LUKA 1U5YA 2WT0A 2X5IA 3GZAA 5IVVA 1Q8OA 2V4AA 1SLAA 4IE7A 4Y4YA 5JI7A 5KWRA 3Q9OA 1UZWA 3EXUA 5L19A 5DAQA 4NIIA 3ZPYA 4UFIA 5JDBA 1DQ6A 3BI3A 4IGQA 1HB3A 5CIRA 3PMSA 1Z0HA 4OHXA 1A78A 4XF0A 2ORZA 2DU1A 2VNVA 2E32A 3FMGA 4LO8A 3MPPG 5C4WA 3EJKA 1Y9QA 1UN1A 3IZOA 3ILNA 3H8OA 3WXPA 4P9IA 3KVAA 4XHXA 4W8JA 1GZCA 1R1A2 1YUDA 2HWE2 2EXIA 2R1DA 5FYYA 1KJLA 1QJZA 2DCTA 1SLCA 2GU9A 2W5FA 3K4AA 3MF6A 1LOGA 3WDXA 2BJSA 2VNOA 4CPBD 1Q5OA 3POGA 4DUWA 1V6NA 1R64A 2YV8A 4P9JA 1CPMA 5A7WB 3IPVB 3Q8EA 5BYNA 1JTZX 1QGLA 1US2A 1W8WA 2OPKA 3MF9A 4H14A 4JRLA 5ISLA 3NKGA 1PO22 4FPFA 3ZXLA 2VGDA 1UOFA 2VUAA 4R4XA 3KV6A 5JZGA 3PU3A 2VUCA 2RHPA 2CGPA 3I97A 5CFCC 1J3QA 1KQRA 2BNMA 1CONA 4FOQA 3RZZA 1MEC2 3U10A 4AHWA 2D3PA 2WR9A 4N53C 4XVHA 1HN1A 3WP6A 4E2SA 4BIFA 4QXHA 5JXGA 3DYPA 3VUOA 3TN92 1NZIA 3SCHA 1JUHA 4LHKA 5ANQA 5CG9A 4AVCA 2VMIA 3KLSA 3WNOA 4WM8C 4XUOA 5IW0A 2BGOA 4JGYA 2B46X 2QZ3A 4FTSA 4PF1A 3FX3A 5A3PA 3I2FA 3O7OA 2Y60A 3HIFA 4MGKE 1QNWA 1RUC1 1C3HA 2Z4FA 1PX3A 2XBO2 1V6JA 3MW3A 2XJRA 3PVBB 4QPYA 4GKYA 1AJOA 5F3GA 4XQDA 3VHOA 4CDWC 4NHYA 5BPXA 2J1UA 2RS13 2G4IA 1ZBA1 4IE0A 2A6YA 3OF1A 4BJ0A 2WWUA 2RS11 1J59A 3OOXA 5BNOC 1N1TA 3ZSMA 4Y20A 5FBZA 2WAOA 4NWVA 2QQPA 3A21A 4YGCA 2CAVA 1FNYA 4HT1T 1JZ7A 1UZZA 2EXKA 1W05A 2YPJA 3PJQA 4PLMA 2FDKA 2VUJA 4DY5A 4XAAA 1ZRIA 4R8HA 2LALA 2QUOA 1W9TA 5J96B 5LW9A 4N53B 4WVZA 4L97A 3ZXAC 5DDJ2 3VKLA 1BZWA 2R071 4UAPA 1CAUA 3N9QA 1LU2A 3OBZA 1B09A 2GNBA 4FXGB 4QXKA 3UGGA 2A73B 1QU0A 1X7NA 4BQYA 5F7UA 1G9AA 2ZZQA 3IPVA 2JG9A 3ENRA 2VAUA 4A44A 1W6MB 2QQOA 1J83A 2K9ZA 2WNUA 3EYPA 3WW4A 4CCJA 1ZBA2 5EHDA 2ZEXA 1MVQA 5EJZB 2R062 4NHMA 1PK6A 4LHLA 3AMHA 2IXKA 1J1TA 3OBAA 4FTEA 4BQ1A 4BM8A 1HRI3 3BODA 1CQ9A 3VBOB 2VMCA 1AYM2 1VAKA 1DFQA 4D0QA 4Q4X3 2BFUL 4M3CB 1Z7S3 5I0SA 5BNPA 2BVBA 2VTXJ 3V56A 1OQEA 3H8UA 2X10A 3T08A 2VBDA 3LA2A 4Q1PA 2QZ2A 2VUDA 2IVIB 5ABJA 1S1AA 2TEPA 2ZX2A 3MIGA 4XTPA 4ZZ8A 1EUTA 1ODMA 3RPQA 3LD8A 2PAEA 3D0SA 4WZCA 5C8WA 5FO9B 3V64A 3ST7A 4DRVA 2PHRA 1WGPA 2E7AA 3B9IA 1PO21 5T50A 4AF9A 3UNPA 4Q4Y1 3NWKA 1XYPA 4DB5A 5CADA 4ZU4A 2PTMA 5LZ6A 5K0UC 3PIJA 1VIWB 3I7DA 3WVJA 1WLCA 3FC0A 1WCUA 5A7OA 2BGPA 1Y7BA 1ULCA 1OFSA 5FZOA 1RUF1 2UYAA 5FYUA 4I01A 5HXVA 2E6VA 3K2OA 2WNOA 3LFMA 4E27A 5FUNA 4LHSA 1RUF3 4QPWA 4NRQA 2XJVA 3R4UA 2JDAA 4TN7A 4E4ZA 2WS91 3USSA 4H7MA 3N7LA 4HFSA 2DVGA 3CIHA 1SBFA 1DP0A 3VZLA 4P5HA 4ZPIA 2F4LA 3ZX7A 5DAVA 1Q3EA 2YG0A 3AJYA 1YXWA 4QDSA 2ZHLA 3J7MA 2C4XA 2CV6A 3TNPB 4AR2A 1JN2P 2QDRA 2RVAA 4CDWB 4BQ2A 4AAPA 3WX5A 4YM2A 1JU3A 4E2QA 5HCAA 4LBNA 1JYIA 3CO2A 2LRPA 3EO6A 3AKPA 3LF7A 1WW7A 2F4PA 4WM7A 2WDBA 1QJEA 2VOTA 4OHWA 1GMMA 3VBSA 2YU2A 4CEYA 1H6XA 4BPZA 4HVOA 4CU7A 3PUAA 1LCLA 4GB33 2EIGA 3ACGA 5LY2A 1J58A 4FFFA 1HQNA 4ZHNA 1PMJX 2VVEA 4QAWA 4NAOA 4RR3A 1OKOA 5FZHA 3ZN6B 4JTNA 4BIOA 2XHKA 1ENQA 4U36A 5EYXA 3UGHA 4B29A 3J26N 4XMIA 1W04A 2QQLA 2ZA9A 4KQ7A 3E5UA 2JECA 1W8TA 4YVSA 5A33A 3VBFC 2DBIA 2GC2A 4CDXC 2OXBA 3B69A 1GANA 1OPMA 4XW3A 4GB32 3UETA 4O9GA 1S0IA 3LB9A 3VBSC 3ACHA 3WW3A 4OI4A 4TZDA 1YQ6A 4A6SA 5E1RA 2RS31 4XJZA 1U5XA 1UZ0A 3MO4A 1WZXA 5C3PA 3LIGA 1FV3A 3LFIA 1UMIA 4NOTA 1R082 1JU4A 3USUB 3U4SA 1GICA 1OBNA 2PAMA 2VMGA 3AYCA 1ENRA 4KU8A 3ZFFC 2HWF1 5LA1A 4CZSA 1JODA 5FXZA 4QKFA 5KXDA 1TEIA 1O7FA 1PMIA 3B00A 1PNGA 1DHKB 3RGBA 1DYOA 5FZAA 3AXDA 1D4M2 2JG8A 5FOJB 1GLHA 4XXAA 3I3BA 2Y6GA 4YM1A 3H3LA 3UGFA 3ZYJB 3T3YA 3VV1A 2XUMA 3ZSEA 4JCKA 1BK1A 5FZ9A 1GZ9A 2OZ6A 3N9NA 2DVAA 4ASMB 1FT9A 1GBGA 2V5YA 1UIKA 2PHFA 1UYPA 2MPFA 2VG9A 3POIA 4FPCA 5E89A 3VZMA 3GJBA 4CVUA 1LENA 1HQWA 3UJOA 2ES3A 1SDWA 1UMZA 1NA1C 2CL2A 2GMPA 2JKXA 4O9EA 5FYSA 1T2XA 4CP9B 5DMYA 4Q4X2 3A4UA 5C33A 1CZTA 1NAEA 3POJA 3AP9A 3DYMA 4FPHA 1MVEA 2XOMA 4MGTA 2V73A 4XF1A 1JOJA 1OF3A 2WN3A 1COV2 1H9WA 3OCPA 2C5DA 4C91A 1TQ5A 1QJY2 4FPOB 1IG3A 1SPPA 4K8RB 1LOFA 1PO13 1WMXA 1YHFA 4SLIA 2HWB3 5FKCA 4C0BA 4EWEA 2JE9A 3IDCB 3IMMA 2D5FA 3NNGA 4HVRA 2YGMA 4XE9A 1NCQB 4XBLA 4X6QB 3VBHC 3AFKA 3AYEA 5GLUA 4MXWA 1OSGA 3W20A 4CYDA 4YM3A 2B7YA 5IAVA 4AGVA 3SMHA 1OUSA 1RIRA 3I3DA 1K5MA 5SV5A 1L7LA 1GKBA 1MS9A 2MEV1 4LBQA 4NE9A 1XYNA 2A6WA 1LU1A 4I02A 4S2FA 1D4M1 3T09A 3HQRA 1MZFA 5I0TA 1MR5A 4BOWA 4Z1VA 1B35C 3M7AA 2ZGOA 2ZGUA 3FZ3A 1TE1B 4K20A 3M8LA 1POV0 2DV9A 3JBG2 4WM8B 4LIVA 4XCAA 3MV11 2QQVA 3ZYPA 3AZXA 4YVWB 3SH4A 1RVF2 3VGIA 3UKVA 1IKQA 5JIUA 1H0BA 1O5LA 2Q8EA 1JZ6A 3KV9A 1G7YA 2EIBA 5GLVA 2BQPA 3J7HA 4NN0A 5JOYA 2HKXA 5G04L 1UD1A 4OUEA 4URTA 1HJGA 4QB2A 3VKMA 4D7TA 3PVNA 4E9KA 1E5IA 1EAH1 4TLGA 2GSYA 2A70A 1W99A 5I0RA 1E57A 3WNKA 2UYBA 4CDXA 1J3RA 3KHBA 2YROA 4CCKA 1SFPA 3WQ7A 1APNA 3N7JA 1YQCA 4LKDA 5C4WB 3O1SA 1RUG1 4CCDA 4E8DA 2DCJA 1COV1 3JZVA 1UY4A 2YPDA 4HBNA 1OC1A 1WCSA 2RM21 3VDCA 3EBRA 4IEXA 2ZXQA 1QJU3 3LKJA 4CP0A 1SLTA 1LGNA 2QDNA 3PUQA 1FOD2 4KWLA 3PDQA 4MZUA 3KCCA 1HW5A 1PGW2 4XJ9A 1DLCA 1Z7S1 1VALA 4JKLA 2TUNA 4M4RA 3WEZA 5F8PA 4DY3A 4YFZA 1EV11 3E6DA 4KG0A 1CIYA 2PQSA 2NYYA 4UT5A 5JR7B 3WY6A 4CDUC 3FLPA 3SXWA 1DQ0A 1AYN3 5C7GA 1KS4A 4DPNA 4Q0PA 3CNAA 3LWCA 1OH4A 3ZYGA 1UNBA 1DU3D 4MHRA 1VP6A 5C5TA 2XJQA 4MXWB 1OA4A 2P3IA 1H8TA 3MW2A 3V0AB 1OD5A 1OLRA 2XH6A 4XJUA 4PT6A 5FXWA 3TB0A 2MHFA 4XPVA 4DMIA 2H0BA 2RR11 2HWF2 3FJSA 1NE4A 4RGKA 1DZRA 3GBWA 1GWKA 3GCWA 2YDEA 2CDPA 2RS32 3WG2A 3Q8FA 5D8AA 2VM9A 4IEPA 4XACA 4OQ9A 3TNQA 2VMDA 1TMF3 3JB4C 2QE3A 4GIQA 4F3JA 4Q2FA 1DYPA 4LO4B 3TOJA 3QBQA 4Q4Y2 2W46A 4W65A 5FREA 3K4ZA 5EIYB 3W21A 3OBRA 3VHPA 3ZMNA 3ACFA 4Q4W3 1CX4A 1BQPA 2YZ4A 2PFWA 4KL1A 1W28A 2B9VA 2Y6HA 3B94A 3ECQA 5CBLA 2XQRA 3K51A 4QGNA 4FBFA 4MV2A 3GF6A 4NRPA 4UFLA 4CDQA 1ZRCA 3O1RA 3G6JB 1C5IA 3DF0A 4CCMA 1PO12 3MDPA 3RSJA 5C8CB 1SHWB 2DURA 2ZABA 3GBGA 1QXPA 3X29B 4CE8A 2VO5A 4M0NA 4AQ2A 4GULA 3LSEA 2DFBA 3H9AA 3KS7A 5AC92 1K12A 3ZM8A 4N9IA 3A0NA 3D82A 2VBBA 1ZBA3 3BIWE 5FP9A 1QNYA 1TG7A 5F39A 1VBD3 4IEVA 4H2AA 2BWCA 4DZGA 3NSTA 3OB8A 1GSLA 3NL1A 3VN4A 1W90A 1IS4A 1J3PA 3BALA 3QD6A 2P6HA 1OPOA 3PIGA 2ZGQA 2PHLA 3U78A 1PM7A 5JSOA 5EJ1B 2VOWA 2ZCWA 2ZGTA 5DDJ3 1UCXA 5ABJC 4M3CF 2WSUA 5D8AC 5A32B 2HEWF 5A6ZA 1E5HA 4AEKA 1C1LA 3AP6A 1BXHA 4XMAA 1JH5A 4FPGA 5T5OA 4AHYA 2VJXA 1AL23 4ZU7A 4HONA 3AB0A 3CDZB 5FCCA 4I09A 3C7HA 5A80A 1O91A 2YC0A 2JX9A 4ES8A 1DDLA 2WFF2 2HBTA 2ET1A 2C1FA 2Y64A 3U11A 2RS12 4CDUB 4LXLA 1TME1 2ZGRA 4CUCA 3KZ4C 1SFYA 3CL1A 1A3KA 4K3UA 2NP0A 1AL0G 4BQ3A 4JC1A 2AEZA 2L9LA 5IATA 4S2HA 1F8VA 3MYXA 2W3JA 1S0EA 2GH8A 2JD9A 4F8AA 5J3UA 4L9BA 2XKPA 3ROUA 2JG9C 2WC2A 3WG1A 4NO4A 5CZKA 1SG3A 2TBVA 3HEIA 1LEMA 4FPEA 5LBBA 2ZBJA 5IVBA 1NXMA 3CJIA 1WBLA 2BYVE 3U1XA 1BMV2 4YLZA 3HT1A 3WV6A 1WKYA 2BFUS 4O61A 2Q30A 5IT6A 1GP6A 1REEA 2VTXA 3S30A 2A6ZA 5I8SA 1JHJA 3ZXEA 1ZZ7A 1R092 3NAPC 3I54A 4QDRA 5DUVA 1QH6A 1UU5A 4JGZC 4ORFA 4AI8A 5JXJA 1ODNA 3O14A 4LK6A 3BKZA 2WYFA 1CAWA 1ZX5A 2D98A 3N9OA 3OUHA 4M01A 1K3IA 3HBKA 2HEVF 3WD5A 4AEDC 4ARYA 2GC3A 1YNAA 4RHV1 4CUBA 2WFF3 1CJPA 2A6XA 4AXOA 5DG1A 3DCQA 3O1PA 5H9RA 4A42A 4ZY9A 2RMU1 4CXWA 2JDKA 2Z5WA 1KGYA 5JCTA
chains in the Genus database with same CATH topology
2JXAA 1ULFA 4FQ4A 4YNIA 4B7KA 1CN1A 2IXIA 4DOUA 4L8QA 3AKQA 1C4RA 1UZYA 1RMU2 1YRZA 4AFDA 4B4PA 2WNVC 3ATGA 4AEJA 2F6BA 4GQ7A 4TWTA 3P3PA 1BKZA 3M3IA 2IXJA 3GYDA 3O12A 1AVBA 3PVOA 1NCRA 4KG8A 4AGRA 5KHKA 3O0VA 1K5MB 4C1WA 4RS5B 5GALA 2PQQA 3LOBA 3AFGA 4PIZA 3SISA 3WCSA 1S55A 1SMVA 2C9AA 1L3JA 4XFFA 1LOBA 4D7SA 1ULGA 2R073 5K0UA 1KS5A 4AVSA 4XF9A 3MIEA 3IDBB 1DGRN 4KGQA 1OOPC 4XDQA 1NXD1 2WQ4A 1NLSA 1VBD2 1Q8PA 2PYTA 1F5JA 4XJWA 4BLJA 3WG4A 1FOD1 1YI9A 2WA3A 4GMP3 3W58A 1AZDA 3B3QE 5JPMB 2A5ZA 1QOTA 2E63A 2NN8A 4RS5C 1WLWA 3IKWA 5GZEA 1W2UA 3MIDA 1S0DA 1YFYA 4FPYA 5IK7A 2R30A 1GZWB 4QGMA 3TYJA 2VQ0A 5T52A 5K7PA 2WZR1 1DGWX 4UW5A 3VBRC 2X53S 1WUVA 4LUMA 5K8SA 2R6QA 4FTBA 4C1XA 5DXDA 4GWMA 4E2GA 2DUQA 4I3GA 3OGJA 1WLTA 1RUH2 4A3XA 5FQ0A 3KD4A 3VBFB 2A7AA 4IESA 1SCSA 4WM8A 2PLV3 2A75A 4B7EA 5FPXA 2XJUA 4Q1RA 3WDTA 3KSCA 3DGTA 1KDKA 4AQSA 3FWEA 2AZ5A 4XZPA 1AX1A 3URFA 2YYOA 1UKGA 2D44A 4AVAA 3LAGA 1CVNA 1QQP3 3RRDA 1BYHA 1DQ5A 1HQLA 3D5OA 2OIIA 1YYNA 5FLJA 1MZ6A 5I8TA 1N1SA 1S0JA 3PVEA 1W6QA 3WOGA 4AVTA 4QPIB 2Z69A 4K21A 2GMEA 1RINA 3M3OA 1CIWA 3M3QA 4Y22B 3KCYA 3KMHA 3WW2A 1QQP2 2RJKA 2UWBA 2V09A 2DF7A 4MGZE 1WA4A 1V6LA 1RVF3 1VB4A 3CJIB 3L2YA 4RL7A 2JG8B 4I0AA 5BNOA 1AR93 1UU4A 3CEWA 1YIPA 3HQXA 1DQ1A 3C3VA 3WP4A 1RGSA 1G8WA 1QKQA 4HKOA 1MQTC 1MS0A 5JMCA 1CD3G 2PELA 1RUI3 4OHZA 5BY5A 1AHSA 2XVKA 1W6NA 1AXYA 4WVWA 1DZQA 4IV3A 4WV8A 1V9U3 1ZM1A 2BNOA 2E7TA 4R4ZA 1ND3C 3WR0A 4B3NA 4IV1B 2GC1A 1AR81 1FPN3 1VBA3 3WHTA 1AR72 1PVC1 4XILA 1AR83 5A33B 1V70A 5FAXA 5F5QA 4COYA 5A32A 3FLRA 2PHUA 4IL7A 4LEJA 2NQYA 2CNAA 2GNMA 1KITA 2DWRA 1CPNA 2DU0A 5D8AB 4Y1UA 3LZZA 3DUIA 3JB8A 4N43A 4LNVA 3WDVA 4FPLA 3ZYIB 1PZ7A 5ACA1 4WZFA 5TSWA 5A3MA 5J09A 1QMJA 5GZGA 4OHYA 2HJIA 4XIOA 2HWD2 2PHDA 3O0WA 3IDEA 2XWJB 1LOAA 4AVVA 2IFRA 3MLKA 4LBKA 3VBRA 1V6MA 2PHTA 1LODA 1ND3B 3H1YA 1G9BA 3AYDA 5ACA2 4Q4V3 5KC5A 1ENSA 4RR3B 1QJY3 2WSVA 4AI2A 3RJ2X 1A8MA 1HRI2 4M3CA 5FLHA 1WW5A 4FAHA 4AEMA 1TMF2 1XNCA 3BCWA 4YG6A 3SH3A 4OUSA 4RQPC 4RSUA 1CAUB 1AX0A 4K8FA 1IPKA 2E7QA 1YFWA 2RS33 3AZVA 5JOXA 4Z92B 3JD72 5H9SA 4QPGA 2AR6A 3R4SA 4K7JA 5C8CA 2IXCA 3WP3A 1R081 3POYA 2Z42A 1O3QA 1CGPA 1RUH1 3IBMA 4JGZB 1PIV3 2VNRA 4X8NA 3HT2A 4OLLA 3MGUA 1GFF2 4YZ4A 4GALA 3ZMOA 1WD4A 2WINB 4LA2A 2WZR2 1QXJA 4L99A 4AEDB 1C8M2 2P34A 3MICA 4HSJA 2VECA 4K6BA 1TNFA 1NZCA 3AZWA 1LGBA 2D3RA 2ZMKA 4Y20B 1AR92 5C9AB 2A71A 3FUOA 4FXKB 2VULA 1ZRRA 2Y26A 3U07A 1DYKA 1VBE1 1DIWA 5J36A 2ZACA 3ZXDA 4DRRA 1SFNA 4FOYA 3RI9A 3MLLA 3BTAA 1U12A 1R093 4PDWC 4DINB 2QNKA 5J98B 1VBD1 1ONAA 1VB2A 5DZGA 5HCBA 4I0BA 2ATFA 4XTMA 1UW8A 3ZSJA 2DUPA 4CYDA 5IK5A 1XNDA 4JRAA 3TRSB 1VRH1 2WNUB 4H7LA 3H3UA 2DYCA 1HDKA 4J1WA 1I1EA 1RUE2 4YW5A 1N1VA 3DL3A 3SNMA 2YMZA 3VHNA 4QD2A 1W0PA 1Y3TA 4NVPA 5CNAA 4MLOA 2ZGLA 4I30A 2SLIA 3AMPA 5JSRA 4XFCA 1CR7A 4OI2A 3HN1A 1O4ZA 3W9AA 1S0GA 4ZU5A 3KCXA 2CGOA 4PBPA 5DUUA 2CYFA 3OTFA 4QQ2A 4Z2WA 1XE8A 1FI2A 1RUJ3 4LULA 1POV1 3FUQA 4KWJA 1RUF2 5L7OC 1MS8A 3H1WA 5E8AA 5BNQA 2RMU2 4EN0A 1WCDJ 2ZGSA 5HI0A 2PLV1 5GZFA 3MIFA 5BNNA 2X29A 3ZFEA 3VBRB 1DQ2A 3D4KA 4XIKA 1ZNPA 4MUVA 3RMXA 2EF6A 5K0UB 1DBNA 2ZTNA 3QLQA 4ITCA 2XBO1 5CFDC 3G7DA 3NVCA 1H2MA 4XOGA 4BYYA 3OBTA 4LBJA 4UW4A 2R1BA 1RL3A 1V6IA 4QHBA 5LRSA 5FO8B 2RMU3 3LCPA 5FMOL 4Q29A 2FBEA 4G4FA 1IQAA 4YVWC 5F6LB 1D0GA 2IXHA 4AFAA 1HRV2 3AJZA 4BH9A 1UAIA 2BVVA 1F9KA 2ZMLA 1ULDA 2R072 4FO9A 4AEDA 4YZ2A 2BPA2 1MZ5A 1QOSA 4HZFA 3WDUA 3GALA 5IK8A 3VL8A 2E9QA 4FAGA 1SACA 3CJXA 3I8TA 2GAUA 1I6XA 3R05A 5EFUA 2VMHA 3RYPA 1G6NA 5DDJ1 2WLQA 4QGLA 4PIYA 2HEYF 4Q8KA 1R1A1 2HWE1 3RI8A 1V9U2 1VBC2 4XFAA 1CAVA 2BEOA 4GA9A 1RUC2 5GLTA 1AL21 3ACLA 1RUE3 1JUIA 1BCXA 1NOVA 4DXZA 2ARXA 1KXGA 2VW1A 2VVDA 3HR9A 4Q0VA 1LOFC 3AKRA 3QH6A 3FBMA 2GNDA 3N7MA 1M06G 3POWA 4YZ1A 3AP7A 1H4HA 1PGW1 5CA6A 1CJDA 2A3YA 4LBLA 2RE9A 1REDA 3NKTA 3USUA 1PVXA 4YZ3A 1K5MC 5KHJA 4CEYB 2ZHNA 3TN91 5DG2A 3E6BA 3U0ZA 2EVXA 2O0OA 3NV1A 3TN93 4I0WB 4MX3A 4YM0A 1UIJA 3OD4A 2RS51 3IIAA 3RWNA 4ZKTB 4ES9A 1J1LA 1GZWA 1NQJA 1BBT1 1EPZA 1UU6A 4COWA 2EXJA 2Q0AA 1H9PA 4YG0A 2I45A 3UL2A 1WMDA 1N3QA 4LA3A 2E51A 2LTNA 3RS6A 2ZJCA 3WUDA 1H2KA 5AFEA 3KQRA 2GN3A 1KFXL 4OHVA 3OYWB 5CVRA 4COZA 5BNNC 1WD3A 2RR13 1LB2A 1ASJ2 1CAVB 1ZBE3 1ZZCA 4N53A 1W0OA 3M70A 4WVVA 1LESA 1JBCA 3OY8A 1MQTA 4HK8A 4FT8A 1IPJA 1S0BA 4G3YC 1TMF1 1NCQC 4COVA 1H1IA 4N90A 3VBHB 4XYXA 2GN7A 3AZZA 3D6EA 4UBHA 4N9HA 2WJSA 4R9CA 1IOAA 4ISRA 2VH9A 4Y22A 2BUKA 3QACA 3RYRA 3LGRA 1RJ7A 1Z7S2 2HWB2 4L2NA 2D93A 1W6QB 4H3WA 1VBE3 1VBB2 1PHMA 1EPWA 3WINE 5FOBB 5BNNB 2P37A 2EAKA 5FO7B 1VBE2 3ASIA 3GNEA 1DGWA 5JVVA 1FMD1 5GKAC 1RITA 5KHGA 1AR73 3KGLA 5BNPC 5JZGC 1NCRC 1QH7A 4Y1XA 2W52A 1RUD2 3N35A 2ZOEB 3HMYA 4CP2A 1Z78A 1QJX3 2WFPA 1H1MA 1NLRA 1G9FA 1Q8SA 3MFAA 2JICA 2VQAA 3ALQA 4ATEA 2JG9B 1PK6C 2VOVA 1RUI2 3AZYA 1V00A 3W59A 3VBUA 1PVC2 4CEYC 3DV8A 1NCQA 5JIAA 2HWF3 2KM2A 3LOIA 4JVAA 1SLLA 3RNSA 3D8CA 4K9SA 5I91A 5CAZA 4QX5A 1EYBA 2GMMA 3GZTB 5LEJA 1U5ZA 4EV0A 5EZWA 4YW2A 3N4MA 5LK7B 3QH7A 1DZTA 5DUWA 1Y43B 3V65A 1ULEA 1G9CA 5LEKA 3GZUC 4XJAA 1MQTB 5H9PA 3ZFFA 2A3WA 3SHRA 3AP5A 1NYWA 4BCUA 1YO8A 4E4SA 2ETEA 3B02A 1FMD2 4AYUA 4F83A 1DGLA 2VW0A 4Q4V1 2X8KA 1QJY1 4LBOA 2HYKA 2VOKA 2ZHMA 3ME2A 4HSLA 2IC1A 5J37A 5I93A 2HWB1 1RHI1 4N7UA 4OUMA 2JDZA 4R9DA 3KGZA 3N3HA 4AI0A 3JCIA 4RHV3 4HVQA 4BWOA 4FP3A 1RUNA 2D6MA 3N36A 1D2SA 3VZOA 1RUH3 1LHOA 3DPRB 1RUC3 1XNBA 2QJVA 1RVF1 1XU1A 1QY4A 1H30A 1NY71 3BU7A 4Q8LA 3K48A 4EROA 1OOPB 1YLLA 1PZ8A 4Q26A 3WHUA 1O3SA 5C8CC 4YGDA 4MSVA 1YJLA 1FXZA 3CF6E 4K40A 3IWZA 2R0FA 4RR3C 3JD73 2Z2SB 1ZZ6A 4LO6B 2JD4A 2OUHA 3ZXJA 4IEOA 1GYKA 1RUI1 4MVTA 1KDMA 1IS6A 3AKTA 5KHIA 1IZ3A 3FFQA 5LK5A 3EHKA 3FE5A 2ZX0A 3CLPA 3OY8B 3WCRA 2D5HA 1DLLA 4EWDA 2EXHA 3M4FA 3DPRC 1ZZBA 3TBDA 5BXXA 2GH2A 2HWD3 2R32A 5E88A 1B35B 2ZHKA 3FFZA 5AVPA 3VL9A 4NR1A 2WLPA 3ZIXA 4CEWB 4SBVA 3KT7A 3ZFEC 5H9QA 1H8VA 1S2KA 1YWKA 2UY8A 2PHWA 4Q4X1 3B9CA 2R063 3FHIB 2XLGA 4META 5FFOC 4N43C 1H8TB 3V0AA 2ZX1A 4NHKA 2VW2A 3ZVXA 3OGGA 1NG0A 1HXS1 1S0FA 4RD7A 2QFEA 4DNYA 2R041 3IMNA 3GBFA 3J8F1 3JQWA 1AYN1 1ENXA 4XFGA 3JU9A 3U4XA 2R043 3J8F3 3OD0A 4HPKA 2JE7A 4LBQD 3ES1A 1X36A 3TAYA 3VDDC 4J1XA 4Q4Y3 3AMQA 4KNCA 2WIIB 3NO8A 4QM8A 1WMFA 4XQ4A 3I59A 4FP2A 2WS92 1ASJ1 4BLIA 2XJPA 4D3WA 4Q0SA 1FAYA 4YVSC 4AW7A 5KHHA 4GH4A 5FTTC 1FPN1 1VBA1 3KB5A 2AGSA 1MS4A 3EQEA 4CEWC 3P3NA 1HV0A 1B35A 1QHDA 3UK9A 5JAXA 4HANA 2W39A 3E5QA 3RMYA 4BA6A 4BMEA 4AFBA 2XBO3 4CDXB 2ZX4A 1XNKA 1YJKA 4WVMB 2W68A 4Q4W1 3VBSB 5AFBA 2D6LX 3FBYA 4TSVA 2ERFA 1WBFA 2TNFA 4RHV2 2WNVB 4LTAA 4JGYC 3IN9A 2BNNA 1AX2A 2JKBA 4CDQB 1UF2C 2I2SA 1N3PA 5HCFA 4IEUA 4INDA 5LRRA 2WNEA 1I5ZA 4AGGA 1YCIA 2D97A 3R4DB 1I3HA 4HKLA 3O5SA 2EALA 3BPZA 1OI6A 1TME2 3NJZA 4Y24A 2ET7A 1HX6A 2JENA 5K9YA 5FQ0B 1VRH3 1PGSA 2PLV2 4XFHA 4FOVA 3S6PA 4Y1ZA 1REFA 4IEYA 2BGCA 1AL22 1QWRA 1C8M3 4IV3C 2NMOA 3ZN5A 3BOWA 4OI1A 3PHMA 5GZDA 1YFUA 2K2SA 1H2LA 4QQOA 4JGYB 2B5HA 1M4WA 5JI9A 2KA3A 4LR4A 3VBHA 2XLAA 1H8TC 2A3XA 1FX5A 2D6KA 5BNPB 1V6OA 1CAWB 2LUWA 2P3KA 4QPGB 3MFCA 3GHNA 3OPZA 2UWAA 4WVMA 4CP1A 1POV3 1VAMA 4L92A 1PK6B 1SQ4A 2ZGPA 1KJRA 4NPRA 5AC91 4P14A 4L11A 5ACA3 1W6OB 2IWGB 3RDIA 1YIFA 3POSA 1LGCA 4M00A 3O0XA 2XLFA 3WP5A 4RFT0 3AKSA 5T54A 3M1HA 3ILFA 4LT5A 2XVGA 3MW4A 2WKKA 1W6PB 1AYM3 4Q4W2 5GJ6A 3ZDSA 1MEC1 3GHMA 5FDBA 4S2DA 1PO11 3N7KA 2QCSB 4GH4C 3RJRA 2B8MA 2WFF1 4ZXKA 3V0BA 1ND3A 2PN5A 4QMAA 1DGRA 4XETA 3M3CA 1RTVA 2R0HA 2UWCA 2XPJA 3UKNA 4YSFA 4CDQC 4AVBA 1LHVA 2X5IB 4I2OA 2BWAA 3WLUA 5J48A 1D4M3 4CTEA 1N3OA 1U5IA 4QQLA 2ENRA 1IKPA 1AYN2 1OHFA 1OLQA 5GLZA 5CFDA 2AYHA 4LO5B 2P2KA 2RR12 4W6WA 1HXS2 4X6RB 2CAUA 2H6BA 4A2UA 1OQDA 1EV12 2B39A 1V6KA 2B42B 1ZYBA 1LOEA 4AHZA 1Q8QA 4PLNA 2Q8OA 2JJ6A 4PQ9A 1RUE1 3VKOA 2FHRA 4LLOA 2NMNA 3PLQA 3BOPA 3VZKA 5CFCA 5T5LA 4HK9A 1HIXA 1BEV3 4XF4A 2XVLA 3MIHA 1RC6A 4IQPA 1OMIA 3T1LA 2BW8A 4JDOA 4EN8B 2QKDA 2UURA 3KT1A 1QDCA 3I4IA 1QJX1 1LHWA 1AUYA 4FVVA 1A6CA 1FOD3 3KM5A 4GMP1 4QPGC 2ZZJA 2WZPP 3TWIA 4YW3A 1RJ8A 2RM22 4MYEA 4PLOA 1VBC3 2FQPA 3AX4A 5L7OA 4LBMA 5I8YA 4A7YA 1WLDA 2VPVA 2GC0A 4AI1A 1ND2A 3UV9A 2BTVC 4PCRA 4S2GA 2XG3A 1AR63 4WBBA 1HXS3 5T5JA 4IEZA 2G9FA 2VOXA 3THTA 2NZ9A 1IS3A 2H6CA 1QOOA 3ZFEB 1C1FA 1RUOA 3L9JT 1SBDA 3V0BB 4M3CE 2XJTA 3VBUC 3ZN4A 1RUJ1 1XQNA 4XF3A 1BVP1 4AFCA 3WQ0A 1XYOA 3JBG3 1G86A 1RUD1 1GQHA 1O5UA 3FLTA 2VY0A 5HBAA 3HWJA 1O4YA 5GLWA 5BNOB 1RHI2 1RUG3 3NV4A 4FPKA 4XXPA 1COV3 3SLIA 2WT1A 1QQP1 2MNGA 1VBB3 4JDNA 1RHI3 1RUG2 4UW6A 4OVEA 4Q4V2 5J7MA 1VBB1 3M3EA 5JLVA 3KT4A 4TLFA 5KXCA 2QVSB 2W08A 2CGNA 1HLCA 3HBZA 4QM9A 2XGXA 4QQHA 3VBUB 2Q5TA 1UPSA 2G9GA 4GXLA 4QT6A 1VAVA 5BV6A 4YW4A 1LR5A 1JHNA 1W6OA 3ZFGB 5I0UA 2D6OX 3L2HA 2FMDA 2Z79A 3I2DA 1SLIA 3VBOC 3WQ1A 2JEMA 1AR71 1ZBE2 4AQTA 4UXAA 2DVFA 4LO7A 1AR82 4RGAA 1OOPA 1XU2A 2K0GA 4ASLA 5E16A 3NV2A 4IETA 5F6KA 3E5XA 3NAPB 2E53A 3RYKA 4XFBA 4F7ZA 2WL1A 3VDDA 5T5PA 1F5FA 4XEZA 5DZFA 3MIBA 3DN7A 2AENA 1X50A 2DCZA 2N7GA 4AK3A 4GMP0 1DQ4A 5ABJB 1DG6A 2HWC2 1KRIA 1JW6A 3ES4A 3NAPA 1EY2A 5CB7A 1ZA4A 4JGZA 1T6GC 3OJBA 1G9DA 4LLFA 3B93A 2ZAAA 3ZXKA 3WDYA 1C28A 1N47A 2IXLA 4K1YA 3SH5A 4R9AA 1HV1A 2ZAHA 2ZGMA 4B8EA 1IS5A 2XWBB 2LM3A 3SITA 1X8EA 1VLNA 3AMMA 4G9SB 1FMD3 2HWC3 4MH0E 1LOCA 4X8PA 4A7KA 4Z8BA 1JXNA 4YZ5A 3NV3A 2UY9A 2WNVA 1UX6A 1UPIA 2OVUA 1ZVFA 5FPZA 5SV8A 4COUA 2RJLA 2Y0OA 4AE2A 4D69A 2XB6C 3WT3A 4DFSA 2FZ2A 3PMEA 3D0JA 1WMEA 1WW4A 2ZGKA 4YFWA 5F9TA 4OZXA 2OUJA 2I74A 5C4WC 2OZJA 1V9U1 3AM2A 5FMOS 2ZGNA 1PGL2 3S7EA 1X33A 1OA2A 5JPNB 2D3SA 3ETQA 4HL0A 3SCGA 4EN7B 1PVC3 4RGGA 4N7IA 1LHNA 3E97A 4MXVA 4UBGA 4YW1A 2WS93 2SBAA 1KD7A 3DKWA 5IK4A 1H1AA 4DS0A 5DUXA 3SCFA 4XQWA 4KGGA 3IT8A 4XJ8A 1A8DA 2VXRA 5JWPA 1KFUL 4U2AA 1O3TA 2Y0IA 1QF3A 2JG8C 4V1PA 4Z07A 3NW4A 4BZ4A 2D6PA 2RS52 1Q56A 4IV1A 1IGOA 5EV7A 3ZO0B 5JZGB 4PF5A 4PBOA 4RQPB 1X82A 3MLJA 2VVFA 4LBQB 2OW4A 3PNAA 3UJQA 1XXNA 2GZWA 1LJ7A 1ZZ9A 4FSJA 2X5IC 4PJYA 1S2BA 4IEQA 1SCRA 2ZMNA 1R091 4TYSA 4XFIA 4AQ6A 4YVSB 5EJ3A 1MS1A 2D40A 2OYZA 1XE7A 3B5LB 4CEWA 2CTVA 1LKNA 3AK0A 2R16A 3ZN6A 3OYWA 1RB8G 3H7YA 4CDWA 1BMV1 3R0RA 3AYAA 1C5HA 4ONUA 2OA2A 4KU7A 5IUQA 1LEDA 1AXKA 3H3ZA 2R061 1VBC1 5T55A 2P17A 2GDFA 4Z82A 1S0CA 5EXOA 4JTOA 3ILRA 3IM0A 5KC6A 3C2UA 1U0AA 4WM7C 3LA7A 3S7IA 3HD8B 3AXEA 4BHPA 4OI0A 1FPN2 1VBA2 4QPIC 1F31A 2PHXA 4BE3A 2XL7A 2KXLA 1PGL1 3ZSKA 3VKFC 3WDWA 2WNUC 3H1MA 1RMU1 2D43A