1QJU1

Human rhinovirus 16 coat protein in complex with antiviral compound vp61209
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
285
structure length
285
Chain Sequence
NPVERYVDEVLNEVLVVPNINQSHPTTSNAAPVLDAAETGHTNKIQPEDTIETRYVQSSQTLDEMSVESFLGRSGCIHESVLDIVDNYNDQSFTKWNINLQEMAQIRRKFEMFTYARFDSEITMVPSVAAKDGHIGHIVMQYMYVPPGAPIPTTRDDYAWQSGTNASVFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDTYKSRYGTVVTNDMGTLCSRIVTSEQLHKVKVVTRIYHKAKHTKAWCPRPPRAVQYSHTHTTNYKLSSEVHNDVAIRPRTNLTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN VP1
publication title Analysis of Three Structurally Related Antiviral Compounds in Complex with Human Rhinovirus 16
pubmed doi rcsb
molecule tags Virus
total genus 59
structure length 285
sequence length 285
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1qju100
1Z7S2 1FOD1 1RUG3 2R061 2R041 1RMU2 1PGW1 4AEDA 1ZBE2 1V9U2 1OPOA 3J8F1 1AR61 3CJIB 1B35B 3CJIC 1VBB1 1B35C 1FMD3 2MEV1 4CEWB 4WM8A 4CEWC 1BEV2 1EAH1 1FOD3 1QJX2 2R063 3HAGA 2R043 2WLPA 3DPRA 1AYM2 2VQ0A 1K5MA 1X33A 4FTEA 5BNPB 4QPIC 3J8F3 5BNPC 1AR63 1TMF2 4JGYB 1ND3C 5BNNB 1PO11 1X36A 4JGYC 5BNNC 1RB8G 1VBB3 1VBD1 1F8VA 2MEV3 5J96B 1EAH3 1RUI1 4PDWA 5DDJ1 3VBFB 2HWF2 3VBFC 1PO13 1QJZA 1HX6A 1COV2 1VBD3 5CFCB 1E57A 5CFCC 1R081 1R092 1RMU1 4QPGB 4RQPA 4JGZB 1RUI3 1VBA2 4QPGC 4JGZC 4CDUB 1VAKA 5DDJ3 4YVWA 1RVF2 5L7OA 4BCUA 4IV1A 1CJDA 2PLV1 5D8AA 2HWE2 1R083 1TME1 1RMU3 3ZFFA 2Y26A 5J98B 2RS31 1QJY1 3TN91 1RUE1 1RUJ2 1ND2A 2PLV3 3VBHA 5JZGB 4IV3B 1TME3 3ZFGA 3NAPA 5JZGC 4IV3C 4RS5B 4Q4V1 2RS33 1QJY3 1VRH1 1F2NA 1QQP2 4RS5C 1R1A2 2XBO1 5K0UB 2RS51 1VBC1 3VBOB 5K0UC 3TN93 1GFF2 1RUF1 4N53A 1OOPB 1RUE3 3VDDA 3VBUB 1AL22 3VBUC 3M8LA 2R072 1HRV2 2BUKA 4Q4V3 1PVC1 1VRH3 2TBVA 4GB31 4GH4B 2XBO3 3JBG2 2RS53 1VBC3 4GH4C 1RUF3 1IHMA 4CDXA 1A6CA 4AEDB 1SMVA 1RUC2 4AEDC 3LOBA 5C9AA 5ACA2 3VBSA 1PVC3 4GB33 1RUH2 1AR82 1BBT2 4WM8B 1AR92 2WFF2 4WM8C 2DF7A 3DPRB 1K5MB 1QJU2 2RR11 3DPRC 1AYN1 1K5MC 1NA1A 1EV12 1PIV2 1ASJ2 1PO21 4QPIB 1HXS2 1PGL2 1ND3B 1C8M2 4GMP1 2RMU1 1MEC2 2WS92 4PDWB 2RR13 4PDWC 1AYN3 1FPN2 1D4M1 1VBE1 2FZ2A 1PO23 2RS11 1MQTA 4Q4X1 4RHV1 1RHI2 4Z92B 5AC92 4CEYA 2HWD2 2ZAHA 4GMP3 2RMU3 4RQPB 4CDQA 2HWB1 4NWWA 4RQPC 2WZR1 1BMV1 4EJRA 1D4M3 1Z7S1 1DDLA 4YVWC 4Q4Y2 1RUH1 1VBE3 5L7OB 1ZBA2 5ABJC 1HQNA 1BBT1 5L7OC 2RS13 4IV1B 1ZBE1 3JD72 4Q4X3 4RFT0 4RHV3 5D8AB 4YVSA 1POV1 5CFDA 4IV1C 1NG0A 1V9U1 5D8AC 3ZFFB 3ZFFC 1QJU1 5ABJA 1M06G 2HWB3 2WZR3 2RM22 5BNOC 1HRI2 2ZTNA 4GMP0 1Z7S3 1BEV1 1RUH3 1QJX1 1NY72 1ND2B 1BBT3 2GH8A 1AR72 1AYM1 1ZBE3 1ND2C 3VBHB 1POV3 1H8TA 1V9U3 3VBHC 5BNOA 1C8M1 1TMF1 2WS91 3NAPB 4N43A 3ZFGC 3NAPC 1QJU3 1RUG2 2ZZQA 4Y5Z0 2FZ1A 4N53B 1BEV3 1QJX3 4N53C 3VDDB 4WM7C 1AYM3 3VDDC 2BBVA 4CDUA 1FMD2 2BFUS 1C8M3 2HWF1 1TMF3 2WS93 4FSJA 4WM7A 1FOD2 1POV0 2IZWA 2R062 1COV1 2R042 1PGW2 1R091 5A33B 1NCQA 3J8F2 1AR62 4CDXC 1VBA1 5C4WA 1VBB2 2MEV2 2HWF3 5FMOS 5C9AC 1NOVA 1RVF1 3VBSB 3VBRA 2RM21 1EAH2 1COV3 3VBSC 1VB4A 2HWE1 1R093 3FBMA 5A32A 1VBA3 1PO12 3ZFEA 3VBOA 1VBD2 1NA1B 1NCRA 1RVF3 3S6PA 1NA1C 1RUJ1 2RM23 4CDWA 1RUI2 4Q4W2 2HWE3 5DDJ2 5C8CA 1QQP1 1R1A1 2X5IA 1CD3G 4RR3A 1R082 1RUJ3 2QQPA 1MQTB 1MQTC 3JB4C 4CEYB 1AL21 2R071 1HRV1 4CEYC 2HWC2 4CDQB 1QQP3 4CDQC 1R1A3 3JBG1 1VB2A 2PLV2 1TME2 3IDEA 2BFUL 3CJIA 4YVSB 2RS32 1WCDJ 1B35A 1QJY2 5CFDB 1RUC1 4YVSC 5CFDC 1AL23 2R073 4CEWA 1HRV3 3TN92 5ACA1 4YVWB 5ABJB 1RUE2 3JBG3 1AR81 4QPIA 1AR91 2WFF1 5BNPA 2GSYA 1ND3A 4JGYA 4Q4W1 5BNNA 4Q4V2 5FMOL 1OHFA 1VRH2 1H8TB 1RUC3 5BNOB 2XBO2 2RS52 1VBC2 5FOJB 1H8TC 1EV11 5ACA3 4NWVA 4N43B 1PIV1 1RUF2 1ASJ1 1RUD2 4N43C 1AR83 1AR93 2WFF3 1HXS1 3VBFA 1PGL1 3ZFGB 1MEC1 4Q4W3 1PVC2 4GB32 2HWC1 1FPN1 4CDUC 5CFCA 1EV13 1PIV3 1ASJ3 4WM7B 4QPGA 4JGZA 4Y4YA 1RHI1 5AC91 1HXS3 2HWD1 5GKAC 1NCQB 4SBVA 1MEC3 1W39A 1NCQC 2BPA2 5C4WB 1AL0G 4FTSA 5C4WC 2HWC3 1FPN3 4Q4Y1 1ZBA1 3VBRB 4CDXB 3JD71 3VBRC 1RHI3 5AC93 2RR12 1AUYA 2HWD3 1AYN2 5C9AB 1BMV2 1C8NA 5A32B 3ZFEB 1PO22 3ZFEC 1HRI1 3VBOC 1NCRB 2WWSA 1RUD1 5JZGA 4IV3A 4Q4Y3 1NCRC 3JB8A 1NY71 1ZBA3 1OOPC 4CDWB 1AR71 2RMU2 4RS5A 3JD73 4CDWC 5K0UA 5C8CB 1D4M2 4FTBA 1OOPA 1RUG1 1VBE2 5C8CC 5LK7B 2X5IB 2RS12 4RR3B 1HRI3 4Q4X2 4RHV2 2X5IC 3VBUA 5A33A 4RR3C 1RUD3 2XPJA 1AR73 4LLFA 2HWB2 4GH4A 3ZXAC 2WZR2 1FMD1
chains in the Genus database with same CATH superfamily
4BPZA 5C3OA 4XJ8A 3VD9A 4RGKA 1O4ZA 1MS3A 2TEPA 3RJ2X 3LIGA 4A4AA 5FZ1A 1RUG3 3K3NA 3TEYA 3LPFA 5I0RA 1CQ9A 5FAXA 5GJ6A 5F32A 3AXDA 3LB9A 3MYXA 2AYHA 3SISA 1OC1A 1WD3A 2GMEA 2JXAA 2KR2A 3J8F1 4QB6A 3ON7A 1AR61 5CZKA 5F3IA 2J7MA 3TEZA 1UY0A 2ZGOA 1YJLA 5F8PA 2WINB 4B8EA 5FZIA 1B35C 3WVJA 1FMD3 4R9AA 2IXJA 2MEV1 5FPLA 1OQ1A 4BQWA 1C5IA 4L9BA 5FZHA 3WNNA 4KMQA 4BB3A 1H6YA 1KITA 2FHRA 2Z2SB 3J9SA 3PJQA 4IE5A 5LY1A 3VDAA 5KHGA 5C70A 3IDBB 2Q4SA 3I2FA 3WZ1A 1X33A 2VU9A 5A3TA 3WDTA 1PZ7A 3J8F3 3N4MA 1AR63 4JGYB 5BNNB 1HB1A 1GWLA 1MS9A 4QX2A 2EICA 1XQNA 5FDBA 1VBD1 4XF3A 1IKPA 2MEV3 3AJYA 4LXLA 1BJQA 2PHRA 2V73A 4XACA 2QCSB 4XBQA 4JRAA 1NX9A 4FPEA 2FMYA 1RUOA 2GAUA 5A6XA 4CE8A 5DDJ1 2VOVA 4A7YA 2PHUA 3VBFC 1YI7A 3USUB 4ASKA 1AXYA 4MUVA 2ZJCA 4IQPA 3MIGA 4DQAA 1VBD3 3AJZA 4NIGA 5E1RA 1QKQA 1FI2A 5FOBB 1ACCA 4BQYA 3GGLA 1RMU1 2VXRA 5A3WA 1DQ6A 1ZRIA 3NNLA 5APAA 3PNAA 4TN7A 5LZ6A 1WZXA 1C57A 2VE1A 2WSUA 1HN0A 4JGZB 3WNXA 4B7KA 5C3RA 1W03A 4QGMA 3WG4A 4CDUB 4MGKE 5DDJ3 1JU3A 4XZPA 3G6JB 3ST7A 3VKMA 1OKQA 1SBEA 1RVF2 2QBXA 5GZEA 1JOPA 4YM2A 3WP3A 2VW1A 3I3DA 4OLLA 2OX0A 3T2TA 1VE0A 2OT7A 4AFAA 3ACGA 2RDRA 4YW4A 4BLIA 5A3PA 2MNGA 4LBNA 1XNAA 3LOIA 3U4SA 3V65A 5F37A 1TME1 1XNCA 1RMU3 3N9QA 2DUPA 2JG8A 5H9SA 5J98B 5C3SA 3ITQA 1QJY1 1U5XA 4G3YC 4LPLA 4IEVA 2AH2A 5FXVA 5IK5A 1YC61 4FAGA 1JI6A 1QDOA 5FP4A 3FLRA 4QHBA 1VAMA 1QNYA 1MS0A 2VMCA 1OSGA 3BPZA 5FWEA 1UN1A 3S5QA 4AYUA 5IAVA 1WW6A 4FFFA 3RGBA 3WLUA 1SFPA 3AVRA 1TME3 4CPBD 3NAPA 3POFA 4GWIA 1HJGA 1QJY3 2EAAA 4UOJA 4URAA 1OLQA 1R1A2 3CKHA 4R52A 1KQRA 1VMHA 2AACA 5L9VA 4YW2A 1Z0HA 1RUF1 1QU0A 3KGLA 3J7LA 4NHYA 5G04L 3O0XA 3VDDA 1IQAA 3ACLA 3BCWA 4A44A 2W46A 4META 3VBUB 4JTOA 3U75A 2W5FA 3KV4A 4EROA 1UZVA 3M8LA 4QU1A 5FLHA 5FZMA 3QH6A 5HV0A 5JXHA 1APNA 5FZ7A 3CDZB 1ENRA 2DTWA 4COYA 1RUF3 4QGLA 3SQOA 4CDXA 5DN2A 4A7ZA 5JPNB 2XDVA 3LSEA 4EQVA 3ABZA 4E2QA 1TQ5A 1A6CA 2D6LX 3I2GA 4AI9A 2NN8A 3WV6A 1PGSA 3CF6E 4AEDC 4F8AA 1IS6A 1UKRA 3PJYA 5CKMA 2ZGMA 2VZUA 5IUQA 1G86A 4YW3A 2VZTA 4UFHA 5FWJA 3M3CA 4YZ1A 1RUNA 4P5YA 2LW8A 2JDUA 1Q3EA 3WNOA 1FATA 1G7YA 1AR92 4AAPA 1CGPA 4WM8C 5DZFA 2O1QA 3HPNA 3NNJA 4OI1A 3SCFA 5A7SA 4BH9A 3TOJA 2XB6C 1UXZA 3VHOA 3ZPOA 4XMAA 1K5MB 1QJU2 2W52A 3HNBM 1AYN1 5FLJA 2KD7A 4XZUG 5T52A 2WWUA 1LR5A 2Y6JA 3MUZ1 4XBNA 3ZYRA 1ULEA 4G9SB 3EO6A 3GCXA 4X6QB 3LKJA 4OUEA 4CU7A 2JG9C 3K3OA 2WFPA 1E5SA 1HLCA 3IN9A 1XNKA 4YPJA 4BE3A 5A3LA 2FDHA 1IG3A 1PGL2 4LIUA 1QH6A 1ND3B 1FX5A 3NV4A 5EYYA 1MEC2 4HSLA 4PDWB 5A7QA 1JW6A 3CQOA 4XUNA 4GJZA 4K40A 1PZ8A 1TVGA 1AYN3 1AJOA 3HBKA 1D4M1 4Y26A 4KH9A 3S7IA 2FZ2A 2PELA 4Y20B 4KGQA 2Y6HA 3WF2A 2VQUA 1EP0A 1SEFA 2WL1A 4N9IA 4Q4X1 3SHRA 3DGTA 2VCBA 4AG4A 1O3SA 4CEYA 1ZZ7A 5JSRA 2RV9A 4GWJA 2ZAHA 5CEHA 2XHNA 1V70A 1FNYA 2GC1A 2HWB1 4NWWA 1CIWA 3VKFC 1OA2A 5B4NA 3K4DA 1UIKA 5CVRA 5FXZA 2Z69A 4P9LA 3WSOA 4EJRA 1XYNA 2P3KA 3NJXA 3O7OA 1H4HA 1D4M3 2XJSA 3EBRA 5DG1A 2AR6A 2GN7A 4YVWC 4YW6A 4DEVA 3VZJA 1DDLA 1HQNA 2ZACA 4FAHA 4W6YA 1XNDA 4YVSA 3VKOA 1OURA 2DWRA 3CBNA 1UOJA 4Q4X3 1KGYA 1XRUA 3Q8CA 1GUIA 4DXSA 1XE7A 4W4ZA 3C2UA 3W5MA 2UYAA 2AENA 3JU9A 3ZFFC 2HWB3 5GZCA 1H2MA 2HJIA 2QQOA 4ZS3A 1AX1A 1J83A 4CUGA 2XLGA 1HRI2 3EXUA 5FY0A 2ZTNA 5I93A 4YGEA 5KXBA 2XQXA 4GAZA 5C33A 1MS4A 2J22A 4FVVA 1ND2B 2G19A 3NJZA 3ZX7A 3HQRA 4BM8A 2BWCA 1QOTA 3C7OA 2ZKNA 5BNOA 1C8M1 1OQEA 2JE7A 1WBLA 2WS91 2ZX0A 3S7EA 4OUSA 3IIIA 1PM4A 5DAVA 1I3HA 4BQ5A 1SFNA 3ZVXA 4Q0SA 1G8WA 1JOBA 4O9EA 3HN3A 2DCTA 3TEXA 1IS4A 2W0XA 4HK8A 1LKNA 1V00A 2DCYA 1K42A 2XKPA 3T2OA 4D0QA 4NR1A 4N53C 4QXCA 4WM7C 1FV3A 1HV0A 2JD4A 1SPPB 2WWJA 4FOQA 1C8M3 3OG2A 2QQVA 2W87A 4QQPA 2YXSA 2WS93 2ZMKA 5LRSA 5JLVA 2XR4A 3AB0A 3OBRA 2RJLA 1A3KA 5HV4A 4LBOA 1FOD2 4AI0A 4B4QA 4PQ9A 2R042 5FBJA 1D2SA 1GOGA 2BBAA 4CU9A 5JMOA 2ZABA 4R8HA 1W2NA 1LCLA 2W9XA 3MIHA 1NYWA 4GXLA 4IERA 4G4FA 1CWPA 4DFSA 1REFA 5LRRA 3GNEA 3KD4A 1VBB2 4IEZA 2VZOA 3ZSEA 4MG2A 4OZXA 3ZDSA 5FMOS 1W8HA 3LA3A 1RVF1 4Z1VA 1BHGA 1RINA 4Q0UA 2RM21 2VZSA 2ZA9A 5LA0A 4XAAA 4PT6A 4IE4A 3PUSA 4PI2A 1JZ8A 4OCTA 1LOAA 1S0FA 2VZ3A 4GULA 1W6MB 4D3WA 5I8TA 5G05L 2Y38A 4L0PA 1A34A 4BU2A 4ITCA 3LGRA 4PIZA 5C71A 2ZEWA 3VBOA 1ST8A 4HT1T 4KWLA 1H4GA 4TXWA 3Q8AA 3D0SA 3WP6A 1NA1B 1NCRA 1RVF3 2OYZA 3WDWA 1G9DA 2RM23 1SZBA 4O9GA 2VM9A 3M3IA 1JZ6A 1G9CA 1GP4A 3BALA 1BQPA 3MUY1 5LA1A 3PURA 3WEZA 3I59B 4XF0A 1F9KA 2P6CA 2ZEYA 1R1A1 1RJ8A 2OZ6A 2RVAA 4MGYE 4A6OA 3U14A 5DZEA 2ATFA 2FDJA 2CU5A 2VOXA 3H3ZA 4NHLA 2IWGB 2LROA 1R082 3T1MA 3O5SA 1EPWA 2A5ZA 3I7DA 2QQPA 4JDNA 3BIWE 1MQTB 3AZZA 1ZZ6A 2VGDA 2KM2A 1QY4A 1ZA4A 4DZGA 4LTAA 2AEZA 3N7KA 4P9IA 4QPYA 1TZOA 4OFGA 1P8JA 3TB0A 3ZXGA 3J7HA 2VECA 4CDQB 1WW5A 2WSVA 1U5ZA 4HL0A 3R0RA 4QDRA 1D2QA 1R1A3 3FX3A 2XL7A 1J3RA 4FO9A 2J1SA 2PLV2 2AZ5A 1EY2A 3GHMA 3MFAA 4Z8BA 3KV9A 2UU8A 4KBBA 4N7IA 4OMDA 1NXMA 2EALA 2RS32 2B9UA 4Y3OA 2Q8OA 3TRSB 4Q27A 4S2FA 2VBPA 5CFDC 1RL3A 5EZWA 1XOYA 2EXIA 3KV5A 3AKPA 5LASA 2WJSA 5FZ8A 4O61A 1RUE2 1S0JA 2E33A 3LA7A 4OYUA 1F5JA 2BWAA 3ILFA 4CCKA 1AR91 1CESA 2B45X 3AMPA 1UU4A 2DVAA 1RC6A 4JGYA 1UPIA 2QJVA 3VHNA 5BNNA 1N1YA 1OHFA 4P08A 2PN5A 5FMOL 2ZGUA 1H8TB 3JUUA 5LBEA 2XBO2 1VBC2 4OUMA 3DYMA 4KL1A 3X29B 2WO2A 2DFCA 4N43B 3VKNA 5F3GA 3OGSA 1MVEA 4BYYA 4K9SA 3KT4A 1FAYA 1LGBA 2VVDA 1WBFA 4HN0A 2J1VA 2E51A 2NP0A 1X50A 4ASMB 1HDKA 4RN5A 1LULA 5FZ0A 3MGUA 1AR93 1QEXA 2G1MA 2ZGLA 2VH9A 3MV11 3OEAA 2R16A 2P6HA 3T4VA 1PGL1 4IE6A 4NE9A 3T0AA 4EV0A 1MEC1 2OIIA 1GANA 1HKDA 2V72A 5EWSA 5H9PA 1H8VA 4GB32 3AP7A 1JYTA 5CU1A 2CHHA 1OUXA 2QE3A 2VVFA 3EYPA 2HWC1 3R4UA 1U5YA 3I2OA 1KDKA 1HIXA 4H14A 4KG0A 1DBNA 2VNRA 5GZGA 3ZYGA 2BRTA 3KZ4C 1UOBA 3ZPYA 1H9WA 3FL7A 3Q9OA 3KCCA 1LRHA 4JGZA 2V4AA 4XF1A 2JDHA 1ULOA 4JZRA 4AW7A 4JKMA 5BPXA 5KHJA 5LY2A 5BXXA 1WWYA 3N9LA 1NCQB 1WGPA 3IPVB 5GZFA 4SBVA 1MEC3 4PLOA 1H2NA 3IWZA 4ZU4A 4LQRA 5LB6A 1OVSA 2BPA2 1CZSA 3WXPA 3B01A 4ZXEA 5CISA 5C4WC 2A6VA 2HWC3 2ET7A 3CEWA 2XJTA 5KHIA 2VJXA 1WA6X 3M70A 3I97A 2Q8CA 3T0DA 1H0BA 4CDXB 4JRLA 1MZ6A 4NHXA 5EYXA 1KFXL 1LOFC 2Q0AA 3VBRC 4LKSA 4XHBA 4W50A 1AXKA 2GC0A 2QZ3A 4Y1ZA 3POBA 4UFKA 4K8RB 3V56A 1GYKA 1FYUA 5M0TA 2ZX2A 4BQXA 2E53A 3ZFEC 2WR9A 2YU1A 1HRI1 1QIQA 2X09A 4DIQA 1WW7A 3GCWA 5FZ9A 3L2YA 2DUOA 4NJ4A 3NNFA 4IE7A 1LOCA 1STMA 1UY3A 1PVXA 2D3SA 4MGZE 2RMU2 4XMIA 5IJRA 4X6RB 2OKXA 4CP0A 3E6BA 4XYXA 5AVPA 3WDVA 3RPQA 1A8MA 3IB3A 3MBWA 3JQWA 4OI4A 1BVP1 3SCGA 5C8CB 4O65A 1DQ1A 1O4YA 2YY1A 4PF5A 5GLZA 2N7GA 4FTBA 4JC1A 2D40A 2J1EA 3E5UA 4CRQA 5FLIA 2EA7A 1HRI3 2GALA 2DFBA 3VBUA 4HANA 1BK1A 3AL5A 2W1SA 4RR3C 3DV8A 4TYSA 2XPJA 5HXVA 3O1SA 2WN3A 3IM0A 4AQSA 5FUNA 4JQRA 1F4HA 1UQXA 1E5RA 4HG6B 4PI0A 4MGQA 1A78A 3D8CA 2BJSA 2PAEA 2RJKA 5JVVA 2BOIA 2H0BA 1DLLA 3KB5A 1S2BA 5JOXA 3WW4A 1H9PA 4JDOA 2I2SA 1FOD1 4XE9A 1YRZA 2R041 2DU1A 5T5OA 1RMU2 2QKDA 4K6BA 3RI9A 3N3HA 2UWAA 3PUQA 4PIXA 1POQA 4X8NA 3T30A 3WDUA 4AVBA 3TEWA 1IPKA 3WW3A 4AVTA 3W59A 5DZGA 2VNVA 1V6OA 1AX2A 1B35B 2CGNA 1S2EA 1VBB1 4K7JA 4E4HA 3WY6A 1DGRN 4XDQA 5BV6A 4D7SA 2EIGA 2DBIA 4XIOA 3N35A 3VGIA 1FOD3 1OUSA 2R043 2WLPA 4WV8A 3AXEA 1MS1A 4OQ8A 1MPXA 2QZ2A 4JAAA 1K5MA 1OFSA 3H1MA 4Z2WA 4QPIC 4NRQA 3O1RA 3QD6A 1V6MA 3U11A 3T3YA 5JPMB 1WLTA 1X36A 1VIWB 1VBB3 5CB7A 1XU2A 3GYDA 4ORFA 3ILRA 2FCVA 4HKWA 5CBLA 5J96B 4W8JA 4CCJA 4XEZA 1Y9MA 1W0OA 5A1AA 4MSVA 4NPRA 1OPMA 3I2KA 3M3EA 4PDWA 3K4AA 5FPAA 3AZXA 5CADA 3VBFB 2D5FA 3WF0A 1NLRA 3V0BB 2B39A 4ZS2A 1WMEA 3POSA 3NJVA 2VOWA 1WMFA 1W9FA 4A7KA 1H30A 1QJZA 2K46A 2PXJA 4Y20A 4FFHA 1DYOA 3SEEA 2CAVA 2J1UA 3H7YA 1E57A 2Y8KA 5FK8A 1ODNA 1SCSA 5CFCC 1R081 2ADEA 1IZ3A 1OLMA 1YIPA 2GNTA 4FI9A 1REDA 4YGBA 2E32A 4QPGC 2D5HA 4COUA 4LHNA 4PHZA 1VAKA 1MR5A 4HSJA 4MGIE 3H3LA 1VMFA 4D6SA 2QQJA 4IUGA 1JYCA 2VY0A 5FO8B 5IATA 4NAOA 3SMHA 3BYWA 2PLV1 2VR4A 2W3JA 4UW5A 2HWE2 3WD5A 5KHKA 1F4AA 1R083 2MHFA 3BGAA 3LIHA 3N9MA 4NRPA 3H3UA 2RS31 1Y7BA 1GU3A 2YPDA 1O6UA 3WF4A 5FO9B 4A42A 1UU5A 3M4FA 2A71A 4UWDA 2GMMA 5F5IA 4HK9A 4UBGA 1DGLA 3RYRA 1RUE1 1Y4WA 1ND2A 3L9JT 1I9RA 3UKVA 2XL9A 3ZR5A 3MO4A 2PLV3 2UY8A 1W8TA 2YFUA 1XE0A 2FMDA 3UV9A 3ZFGA 5C3QA 5JZGC 4IV3C 5JAXA 4WVVA 2RS33 3EB7A 3WX5A 1US2A 1MS5A 3ALQA 4PLNA 4RS5C 1IKQA 1OH4A 2XBO1 1PX3A 1VBC1 2VQAA 2XMLA 2YBKA 4P9XA 3VBOB 3W5NA 5K0UC 1UX6A 3TWIA 1JZ5A 4MGSA 1VLNA 1T6BX 2A6YA 1QXPA 1OOPB 1RUE3 1XPWA 1OF4A 3D6EA 2P34A 5FXWA 1YQCA 1CIYA 4XW3A 5J37A 1SPPA 4Q5OA 5FMBA 4TWTA 4YWAA 1HRV2 4D6QA 2BNNA 3IDCB 4GB31 2TBVA 4CP2A 4IEWA 2XBO3 1VBC3 3U1XA 4DRVA 4GH4C 4JHTA 1Q8SA 4M00A 3U0ZA 2C4XA 1PM7A 3RZZA 3K4ZA 4Y5SA 3FLTA 3ZYIB 4AEDB 2ZX4A 4GIQA 1JU4A 4D69A 1SMVA 1Q43A 3NRUA 1K5JA 5DABA 2H6BA 4FPHA 5L73A 1LNSA 1MVQA 2VUCA 3PUAA 3SH3A 1W0PA 4FPFA 5IVBA 5KC5A 1O91A 1I5PA 2A3WA 2HEVF 1LGCA 4GB33 3RDIA 4OMCA 3MW2A 4CU8A 5CKQA 4WM8B 1X9TA 4LIVA 1OVPA 3WUCA 3ZDVA 1W6MA 3LEIA 2QFEA 2BV4A 3CU7A 2VZ1A 4HBNA 3SCHA 1C28A 3ZR6A 4HVQA 1RXFA 4LO4B 3U07A 1YIFA 2VMGA 3ES1A 1PK6C 1ZA7A 2K0GA 2VTXA 4QXBA 4MO3M 4WVZA 3DPRC 5FV3A 3DYOA 1WLCA 3NWKA 3ACIA 1NA1A 1S0DA 2ENRA 4RL7A 2XJVA 4LUMA 2W91A 2GMPA 2HKXA 2VCCA 3ZYPA 3ETPA 3NO8A 1PZ9A 2JG9B 4YNIA 4WZCA 3KCXA 3MLKA 3ROUA 4CXXA 2V5YA 2YC4A 1UXXX 3MPBA 2C6SA 3FHQA 1DU3D 2G9FA 1C8M2 4GMP1 2RMU1 5F2WA 4AFMA 2XG3A 2NYYA 2WS92 2XJQA 3I59A 2ZGQA 2FD8A 2Z42A 3IT8A 2SBAA 4B29A 3ZXJA 2D6NA 5FZ3A 2JDAA 4XFGA 1PHMA 3WW2A 5A3NA 1FPN2 1W90A 3M3QA 4L99A 4NO4A 4A41A 1XB9A 1RJ7A 1O8SA 2VPVA 2VO5A 4GJYA 4B1LA 1MQTA 3P6BA 4BLJA 1WD4A 1XXNA 1VJ2A 2GN3A 3G7DA 5FZFA 2HWD2 1HQLA 1DQ5A 2CTVA 4MXWA 4B1MA 4GMP3 2RMU3 4WVMA 3N9OA 4CDQA 5JXIA 4RQPC 2ZGPA 4EE2A 4BIFA 3NJYA 4YARA 4DO0A 5LEKA 2BTVC 1BCXA 1RUH1 3RS6A 4Q29A 4DPNA 4KBZA 4XIKA 4E8DA 5L7OC 2ZMLA 4Y1XA 4LT5A 4P9GA 5LW9A 3ZN5A 2C1FA 4S2GA 3FHAA 4IV1C 1I1EA 5D8AC 2VL4A 5A7NA 2H0VA 3ZFFB 1W2AX 2CV6A 3HJRA 5FZDA 1IPJA 3T2QA 2XH6A 2D93A 1R1ZA 2OPWA 2WRAA 1UL9A 2ZS6B 3ATGA 2ET1A 4JKKA 4XJWA 2PHWA 3SEPA 4A3ZA 4EN7B 2RM22 1IQDC 4A3XA 2H6CA 3H8UA 5BNOC 2GC2A 1SLBA 4COVA 4GMP0 2DTYA 1X7NA 4BDVB 1RUH3 4CCCA 4V2VA 4I30A 3L2HA 3BU0A 1AX0A 1ZRDA 4Y5TA 4YZ3A 2QQUA 1H8TA 2ORZA 2RDQA 2ZEXA 4PJYA 5IW0A 3VBHC 2QDRA 5KXCA 3S57A 1GZ9A 4NN0A 3PU3A 4N43A 3LAGA 2WQ4A 4AVAA 5FMDA 4KU8A 4A6SA 2C9AA 5DG2A 2WO1A 3I2HA 4Z82A 3OYWB 2C5DA 4Y5Z0 1H1AA 1GKBA 3F95A 2WZEA 2ZX1A 2W1WA 4QQLA 3WNKA 4N53B 5GZDA 2HLEA 5FYCA 1S55A 1C3HA 5KC6A 4Q0QA 1IGOA 2ADDA 4QX0A 4YZ2A 2BBVA 4R4XA 2DYCA 2ERFA 4OHVA 2B7YA 3N36A 4FOYA 3EQEA 1UYPA 3K48A 3RVHA 4CXWA 2VW2A 3LDKA 4FSJA 3Q8FA 1W9YA 1MS8A 1QGLA 3DKWA 2R062 3GBFA 2IZWA 3H50A 4H55A 4YGCA 4AHYA 5C3PA 1JBCA 2XJPA 1UNBA 3I2JA 5H9QA 4AAXA 1WCQA 5F1RA 4FT8A 1LECA 1EYBA 1NCQA 3IPVA 1W2TA 5F6KA 1ALYA 1H2LA 2WAOA 5K4LA 1YNAA 1NLQA 5JOWA 1E5HA 1DGWX 2QVSB 5FZLA 2JDKA 5AFEA 2ZOEB 1S0GA 4FPYA 1NT0A 4XETA 3URFA 2GNMA 2JKXA 4MADA 5C9AC 3WQBA 2IVIB 5A70A 4YGDA 2CDOA 2E7QA 4HVOA 4UAPA 3VBSC 1OD5A 5FO7B 5FZOB 1XNBA 1YXWA 2HWE1 2R0FA 1CR7A 1RTVA 5JIUA 1GP6A 5DAQA 3SNMA 3RFRA 4BWOA 5FYSA 1PO12 4INDA 1YEWA 3RZMA 4OI2A 3POYA 1D0GA 3S30A 3RNSA 3AYEA 4FQZA 4P9YA 5FPZA 4AHWA 5DMYA 5LCWL 4NPLA 2B9VA 3THTA 4AGGA 5JMCA 1W2UA 1RXGA 2P2KA 2ZCWA 1DG6A 5IT6A 2HWE3 3MIFA 5JXGA 4QKDA 3AMNA 2OQ7A 2Y34A 1ZNPA 1NLSA 3GM8A 5C8CA 2QQKA 4ZZ5A 1L7LA 4Y24A 4OULA 1ZZCA 4LBQB 1Q8PA 2F4PA 3ELNA 1OQDA 1CAXB 4AL9A 1HB4A 2XUMA 1JHNA 1SCRA 3Q8BA 4OHXA 2NPIA 2WLQA 5DUXA 5K8SA 4YFWA 1UY4A 3FC0A 1RYYA 1OD3A 3RZJA 4GD4A 3CHXA 4ONUA 3J4UH 1N1TA 4UW4A 5F2SA 1W04A 4ARXA 3JB4C 2VQTA 2Q5TA 2G9GA 2PAMA 3TBDA 3UGGA 1HRV1 2ID4A 3HBZA 2HWC2 3B9IA 3OJBA 4LEJA 1SFYA 3AC0A 2YBSA 1J58A 1YHFA 4SLIA 2ZHNA 4CYDA 2JDYA 2QQNA 1WA4A 1H6XA 2WIIB 4HVRA 4MXVA 4B7EA 2W39A 3KV6A 2WT2A 5D21A 5DPNA 4DUWA 3BOWA 5GALA 4Q8KA 3WUDA 1B35A 1WCDJ 5CFDB 1HV1A 4U2AA 3POGA 4NRMA 3POWA 3QH7A 4M3CB 2VBDA 2ARAA 3JZVA 3UL2A 1HRV3 3GDBA 1U5IA 3MIBA 3TN92 2WNUC 2D6KA 5GLVA 3OPZA 5ANQA 3FBYA 4OVEA 5ABJB 5FY4A 4QHOA 1O3QA 1AF9A 3EMRA 1V6NA 4P9JA 2BERA 4LITA 3D4KA 4COWA 3KWVA 3KQRA 1NE6A 4FPGA 4S2DA 3S5AA 2RDSA 4FFIA 2VD7A 3TAYA 4WBBA 1LEDA 1L7RA 2NQYA 4AEMA 5IVJA 4Q4V2 5CG8A 3OPTA 4FBFA 4N8MA 1VRH2 2GP5A 2WO3A 3RSJA 3UK9A 5IAXA 4Q8LA 5IK7A 4AVSA 2FDGA 3DEMA 4QDSA 1IS3A 1KS4A 1HB3A 1YO8A 3MLJA 4CVUA 1K45A 3D3AA 1WKYA 2BGCA 1SBFA 3ECQA 5JR7B 1DFQA 1UX7A 2BDRA 3ZKYA 1GMMA 3VBFA 3V0BA 4K3UA 3ZFGB 2F6BA 2VUAA 4N90A 1PMJX 1KDMA 5J48A 3AL6A 1W6NB 4XUQA 3E6DA 2XQRA 4XF4A 4CDUC 1FPN1 3KF3A 1ZRFA 3R05A 5EP9A 3VL8A 3APBA 1D4VB 1YQ8A 5FZBA 1UZZA 3AZYA 4HKOA 3AYCA 2BNMA 4U36A 4CCNA 2VOTA 1UYZA 1DIWA 4KGGA 4Y4YA 1UCXA 5I0DA 3NVCA 1BYHA 2HWD1 3O1OA 5GKAC 1TNFA 1Q5OA 2QQMA 1F35A 2BGPA 4V1PA 1AL0G 1OFNA 2WBKA 4UXAA 4AR2A 5C4WB 2E7AA 1UKGA 3NNGA 4LK7A 2GZWA 1ZZ8A 5IVYA 1FPN3 4E4SA 2P3IA 3RWKX 4E4DX 4XUOA 2A6XA 4IEYA 5ERLA 3VBRB 4D8MA 4QM9A 1DCSA 1VPHA 4R9DA 1NZCA 3AKRA 1QJEA 2RR12 2QTWB 2ZEZA 1AUYA 2VUJA 3LDRA 2HWD3 4D6RA 2BVBA 5FK7A 2FCUA 3AK0A 4AQTA 3DN7A 3ZFEB 3ZYJB 4MZUA 1PO22 3OY8A 4DY3A 3WNMA 2PAKA 3E5QA 3A22A 1RUD1 1CX4A 2Y6FA 3AKQA 2VAUA 1SLAA 4OHWA 1YQ2A 4Z07A 3WQ0A 4LO7A 2PMWB 4CDWC 1ULDA 4FCAA 3GALA 4QXHA 5HXMA 4XCAA 3PMSA 5GLTA 3CL1A 1D0HA 1OOPA 1C1FA 1O5LA 3PHMA 2HH9A 2JB4A 3WCSA 2RS12 3AFKA 1W8FA 4RR3B 4FFGA 4RHV2 2X5IC 2Y6GA 1W3XA 2YBPA 5A33A 2CGPA 2IC1A 1RUD3 2BP6A 3ZMOA 3GZAA 5CA6A 3VD3A 1YJKA 3FE5A 4HPKB 4QMAA 1CN1A 3UYJA 2CGOA 4EWDA 1UMZA 3A23A 1BMV2 2DVGA 4I0AA 2GNDA 1C5HA 1CVNA 5IVFA 1DP0A 1VAVA 2QDNA 1L3JA 2EIBA 3KLSA 4AFCA 2R061 3KVAA 2YROA 4XQ4A 5DUUA 4AI3A 1TNRA 2GC3A 4AEDA 1SHWB 1UW8A 1J59A 1Q8VA 1LJ7A 4XAEA 1MZEA 1AHSA 1V9U2 1XBFA 3A7QA 1OPOA 4ATEA 5FYIA 3AVSA 3LEMA 3ZMNA 3PTYA 5FKBA 2A1XA 4MXWB 5AVAA 5FP9A 2BZDA 1FXZA 3BN6A 4WVMB 3CJIC 3WG3A 2P3JA 3I8TA 5JOYA 1ZRRA 1DLCA 3ZN6B 1US3A 4EN0A 4WM8A 1W6PB 2ZGRA 3LE0A 3M1HA 4TLFA 4CEWC 1LESA 2X8KA 3LA2A 1BEV2 2ES3A 1QJX2 2EXKA 2R063 3HAGA 5DUVA 4LLOA 3VD7A 2W68A 2C24A 3WF1A 1LEMA 4CCLA 3KGZA 3T4HB 4FTEA 3PVEA 1SLCA 2O0OA 1XE8A 1W6OB 5BNPC 1TMF2 1URXA 1OH3A 3IAPA 1ND3C 2RHPA 1PO11 3NQHA 4L97A 1JZ3A 1CX1A 2JG9A 4Y1VA 2Z5WA 3DXUA 4UI9L 1F8VA 2DBNA 4LJHA 3NMBA 1LHNA 3P3NA 4PBPA 3I4IA 2QQIA 2IXIA 5F39A 2JENA 2XUEA 3I49A 4XILA 2FBEA 5FBZA 3GHNA 4NPMA 1PNFA 4LHLA 5K9YA 2HWF2 3WOGA 2XJUA 2B4KA 1GOHA 2DCJA 5FKCA 1PO13 2XJRA 5BNQA 1HX6A 5C5TA 1GQGA 2DVBA 2R49A 2VZVA 3BB6A 2ZMNA 5CFCB 4KQ7A 2WNVC 4L8QA 1W8OA 3UJQA 3NV2A 3NV1A 1WLDA 4P02B 4QPGB 2E9QA 2WQZC 4LNVA 3ZXKA 4UT5A 4YW5A 3UNPA 4C0BA 5GLWA 4COZA 4BIOA 1CZTA 2YB7A 4YVWA 2OA2A 4I09A 2JKBA 4QKFA 4FPKA 4BCUA 5FR3A 3BODA 1CJDA 5T5LA 1XJAA 3TYJA 1LHOA 5BY5A 1DHKB 3VZMA 3ZFFA 2UY9A 3RMYA 5FPXA 2ZX3A 2Y26A 3KQ4B 1JMUB 3VB9A 5JWPA 1RIRA 4YZ5A 1IPSA 2VCMA 3VHRA 3H1YA 1N3PA 1PNGA 2XWBB 3VZOA 3LD8A 1Y9QA 3TN91 4LOTA 3OBTA 2OUJA 3NNMA 3C7HA 4R4ZA 4AFBA 4DB5A 4R9CA 2O14A 4UBHA 1S4CA 4MVTA 4C90A 5T5JA 3O14A 4ZPIA 3WF3A 3AYDA 5FPUA 5JXJA 5LWBA 3OOXA 4CP9A 4IV3B 5JZGB 3N9NA 1AVBA 3T2PA 4IETA 3BVCA 4Q4V1 4RS5B 1O59A 3B02A 5CIRA 1VRH1 2GDFA 4XJ9A 1F2NA 3H42B 4I01A 3ZOIA 5K0UB 3K46A 4KU7A 3LCPA 3OYWA 4DMIA 3TN93 1GFF2 4LO6B 5LEJA 3HNMA 4N53A 2OXBA 4LBJA 4M3CF 4WZFA 1LENA 3OGJA 1XYOA 4DY5A 2R7EB 4XXAA 2HEYF 2IFRA 3OEBA 4A45A 1CAWB 2OW4A 4XBLA 5A7PA 4DINB 1GNZA 1AL22 4P14A 4ARYA 1DYKA 2R072 3RQ0A 2W92A 2HBUA 4S2HA 1S0IA 1GQPA 4Q4V3 4LBQD 1DQ2A 2Y33A 3AP4A 1VRH3 2W1QA 4GH4B 4Y4RA 2PFWA 3JBG2 1DZQA 4AK3A 3O1UA 5C6CA 2B42B 1VALA 2QNKA 4PQQA 3M7AA 1IHMA 3E5XA 4IEXA 4MH0E 1HJFA 4LBKA 3OD0A 3RZLA 1X82A 4M4RA 1H1IA 2JDNA 3NW4A 1UOFA 3POJA 4XDPA 1CJPA 5SV5A 3LEGA 2P37A 1TEIA 1HW5A 3LOBA 1GNHA 1NQJA 1V6IA 2JICA 1LU1A 2UURA 4IGQA 1CAUB 1WMXA 3AP5A 4KNCA 1WLWA 3VHPA 2YZ4A 3WG2A 1BKZA 2AUYA 1RUH2 3USSA 1AR82 2AC1A 3OGRA 3PVOA 5E16A 2W2IA 2X53S 3F2ZA 4NHMA 4XJZA 5FZOA 3VD5A 3VZKA 4AXOA 2WFF2 5HPOA 1ZYBA 1OF3A 5FJKA 3WNPA 1PK6B 3E97A 4CP1A 4QGNA 3DPRB 3SKJE 3VDCA 2RR11 4FTSA 2BNOA 5F5CA 1EV12 4IGPA 4OHYA 1PIV2 3IIAA 4GZ9A 3BTXA 4FQ4A 1PO21 5I0UA 4YSFA 4NIIA 5HCAA 5L19A 2FCTA 4NIHA 2QQLA 4QQHA 4ISRA 2PHFA 1SLTA 4XQWA 1JXNA 2K2SA 4QKNA 1W8UA 3IKWA 3ACFA 3EJKA 4LBQA 5DAPA 1CAXA 2RR13 4PIYA 2YG0A 3OPWA 1KEXA 1YQ6A 4YM3A 3LDBA 2YUEA 3AKSA 2NMNA 2ZGNA 1KXGA 4RA0A 2DCKA 1PO23 2RS11 3KSCA 4P9WA 4XTMA 1VMJA 3GBWA 4RHV1 2DVDA 5I0TA 1RHI2 1UZ0A 4Z2AA 4YLZA 4FPCA 5T3NA 4UW6A 4XOGA 4D7TA 5J7MA 1YUDA 1JZ7A 2QUOA 1ULFA 4RQPB 3RI8A 3AZWA 2ZGTA 3NKGA 1BMV1 4PF1A 3ZYFA 3PU8A 5L7OB 4BZ4A 3H8RA 2ZHKA 1BBT1 3I3EA 2RS13 4ZY9A 4IV1B 3JD72 3GF6A 3PIGA 4RHV3 5CFDA 5D8AB 5A1FA 1POV1 4MV2A 2WABA 1V9U1 4Y1UA 3DCQA 4M3CA 1GP5A 4JHZA 4MGTA 3FN9A 4XF9A 1SDWA 5TSWA 3SH4A 4I2OA 5ABJA 1Y3TA 2JG8C 1Y9GA 2VG9A 1M06G 1JUHA 4I0WB 4EWEA 5I8SA 5HCBA 2JIGA 3SXWA 4CTEA 4V2WA 4JDMA 1R64A 4CA9A 1BEV1 2PHLA 1QJX1 1QNWA 3T08A 5IFPA 4RGAA 2L9LA 1BBT3 1AJKA 1AR72 1W0NA 2WT1A 5HI0A 1V6JA 3VBHB 1ZM1A 4AGRA 1POV3 5T5PA 1V9U3 4URTA 2HBTA 2ARXA 3SC7X 1TMF1 4Q0PA 1I5ZA 1W9SA 4QM8A 1HQWA 4J1WA 1UD1A 2IVJA 1UY1A 3NAPC 3THCA 5IHRA 2TNFA 3OTFA 3B69A 1ZZBA 3OY8B 4XTPA 4IEPA 2FZ1A 4ZXKA 5FYZA 3SITA 3MI8A 4GA9A 1BEV3 4OQ9A 1PMIA 1QJX3 4O7XA 4LKDA 4YZ4A 2NMOA 3AKTA 5FY7A 1W05A 1W6NA 1LODA 3VDDC 1GSLA 4YYOA 1UZYA 3B3QE 4QX5A 1CZVA 3UKTA 4QB1A 5EPAA 4ZU7A 2HWF1 1TMF3 2WYFA 3KMHA 1ZREA 2WNEA 3K75B 3FFZA 4YG6A 4AFDA 1POV0 3WG1A 2YDEA 5J3UA 5JSOA 3U37A 1PGW2 4DUVA 4YFZA 1G9BA 5A7WA 1LHWA 1VP6A 5A33B 4CCDA 1OA4A 1YWKA 4CDXC 3U4XA 4CCMA 5HCFA 2IXCA 1D7PM 5FJHA 5C4WA 2XOMA 2XVGA 2ZHLA 4PLMA 3I2DA 4XJAA 2OVUA 3GJBA 3N7MA 4CU6A 1XSRA 2HWF3 3CMGA 3MLLA 1NOVA 3O1MA 3VBSB 1LOFA 3VBRA 5DQ0A 1EAH2 2GP3A 2JX9A 4Q1RA 1VB4A 3UESA 2CL2A 1JYIA 2LALA 1UZWA 3BKZA 5F3CA 1GZWB 3POEA 4XVHA 3VUOA 2WUHA 4IW3A 1GICA 2Q1MA 3ZYHA 3HIFA 2VUDA 3ZFEA 1F15A 4AI2A 1JYVA 4AQ6A 3BOPA 3UETA 1W8NA 3N9PA 5KWRA 2WDBA 2WYSA 2PQSA 2UWBA 5FYTA 3WT3A 4E9KA 4FP3A 5E88A 3LFIA 2ZZJA 1RUI2 1UYYA 5C8WA 1DZRA 1VRBA 3A0NA 4QWNA 3H1WA 4LR4A 5FYBA 2GH2A 1GR3A 2XVLA 4BQ1A 1LHUA 1ENSA 1LHVA 1XC6A 3HN1A 5D1IA 4AEJA 5EQUA 1CD3G 4RR3A 2Q8DA 3EHKA 1QOSA 4B4PA 1W2OA 1PMHX 1ODMA 1WUVA 5FUIA 3AP6A 3P5BA 5L36A 4I3PA 2J1RA 4FPOB 4P5HA 4ZZ8A 1JYWA 3W58A 3J26N 4HETA 3WW1A 3FLPA 4HPKA 3IMNA 3H8OA 2VZRA 2K9ZA 4XJUA 1AL21 1YFUA 2R071 3GZEA 4MX3A 4CEYC 3B93A 2EIDA 4UFIA 1NZIA 3JBG1 2BQPA 3OBAA 3IMMA 1GZTA 3PUIA 5A6ZA 1QXRA 3NSTA 5A3UA 1QHDA 2OUHA 4AE2A 2ZBJA 1DQ0A 4QDQA 3B7MA 2Q8EA 3E6CC 5E8AA 3BIEA 3IDEA 4FPLA 4QAWA 3U10A 4C91A 4K20A 4ASLA 5JDBA 2J42A 5IFTA 4NOTA 1UWWA 3I3BA 2FDIA 1W8ZA 4OHZA 4YVSC 4JQTA 1JYNA 3T09A 1AL23 2CDPA 3ZN6A 2WNUB 2R073 3FHIB 5LBFA 5FYUA 1W6PA 1E5IA 3INAA 4YVWB 2C0ZA 4AI8A 2D3RA 2JE8A 3JBG3 1AR81 4CUCA 1WW4A 2VMEA 3LWCA 1OMIA 2W08A 4QPIA 3SKVA 3VDBA 2IUWA 5EJZB 2WFF1 3LPGA 1QXJA 2GSYA 3T0BA 1IS5A 1W6OA 2JEMA 2VULA 2W1UA 3RZKA 4XFFA 2D98A 5A6QA 3DUIA 4Q4W1 4UF0A 4LK6A 4DUXA 2PYTA 2NZ9A 3PIJA 5F3EA 2RS52 5FOJB 4MYEA 4QU2A 1YFYA 4XPVA 3WP4A 1EV11 2EXHA 1GOFA 4I02A 5JCTA 1PIV1 2JDPA 5F5QA 1QOOA 1UPSA 3VKLA 1DF0A 1RUD2 1BLZA 1AR83 1Z78A 1YFXA 4C0HA 5GM0A 4EN9B 2CAUA 2DURA 4K21A 1OI6A 4DS0A 2WFF3 4E27A 2D44A 3LSDA 4CP9B 1YLLA 2JB8A 4KWUA 1UYXA 3B9CA 4Q4W3 4IL7A 2VOKA 5FZCA 1ZRCA 1PVC2 2RJ2A 4W65A 2XGXA 3ACHA 3UJOA 2WO7A 5FRAA 2DCZA 3GXUA 2WQ8A 5A7OA 1EV13 5CFCA 4RGGA 1PIV3 3WDYA 3BPSA 1WCUA 4UYBA 1YFWA 4QQ2A 4WM7B 5FP3A 3DF0A 4QPGA 2WAAA 1RHI1 3O0VA 1N47A 2I45A 2AEYA 3NL1A 3R6SA 1A8DA 2Y0OA 2C9KA 1W39A 4YRDA 4LUKA 5FYVA 3O1PA 2BGOA 4QHZA 3OGGA 4CSWA 4BJ0A 3QACA 1O3RA 1DQ4A 4E2GA 3WHTA 1ULPA 2LRPA 1CPNA 2O8OA 1OXCA 3J7MA 1LTEA 4AZZA 2YGLA 2JIJA 2VMIA 2UWCA 3JD71 5DAWA 5KR7A 2E26A 4BMEA 1RHI3 4IEOA 5A1LA 2ZGSA 1EPZA 1JZ4A 1YQ5A 1YCIA 4EN8B 3AMHA 4FXKB 1TE1B 3P1IA 3KHCA 5A32B 2VZPA 4HMZA 2VTXJ 4JKLA 3VBOC 5FZ6A 4DRRA 1IOAA 1ENXA 2EAKA 1NQDA 4EN6B 1K3IA 5T50A 1O5UA 4IV3A 1NCRC 4XUTA 5JZGA 1OOPC 1QMJA 4CDWB 1AR71 5FPBA 5FZ4A 4RS5A 5LBBA 3JD73 4BOWA 3RZGA 4ZU5A 4BK5A 5K0UA 3AMQA 2WA4A 2PTMA 1BK0A 4LORA 2CSGA 4AF9A 4XUPA 2Y0IA 5FP8A 4RD7A 2C26A 4XFCA 4WVWA 1VBE2 5LK7B 3RRDA 2X5IB 2RG4A 5IWFA 4K8FA 1GQHA 1W6QB 2R32A 3OBZA 1CAWA 5F9TA 1N1SA 1Q8OA 2BW8A 2YFZA 4QX3A 2FDKA 1LOGA 4GKYA 2XXZA 1AR73 4LLFA 3KVBA 4L92A 1VR3A 2XWJB 4W6XA 4GH4A 2WZR2 1KJRA 3H9AA 4BA6A 2HYKA 1O8PA 1W06A 1Z7S2 2LUWA 4AVVA 4EZHA 2CWMA 3DXTA 3RYKA 3JCIA 1W99A 2VC9A 4NAMA 1PGW1 1ZBE2 2VZQA 5DAXA 4YW1A 4NIDA 3ZXEA 1WCSA 1OA3A 3ZIWA 3WDXA 2AGSA 2ZHMA 4QX1A 4CPBA 2D43A 3CJIB 1FV2A 1CAUA 3D5OA 3OGVA 4FOVA 3PVBB 4Y22B 3D82A 1GNYA 1Q8QA 2IXKA 2XLFA 3A21A 3H7JA 4AQ2A 5KXDA 2EVXA 3HNYM 4CEWB 1JS9A 4DXRA 3KM5A 1EAH1 4Y33A 2GNBA 4HONA 1PK6A 5FIXA 2R1BA 3ZXDA 3DPRA 3HD8B 2XONA 1AYM2 2VQ0A 5BNPB 3W9AA 5L9BA 1J1LA 3Q8EA 3V0AB 2YU2A 3RYPA 4I0BA 1REEA 1YYNA 3M3OA 1S0EA 1XYPA 4JGYC 5D2AA 4ES9A 3K51A 5FQ0B 1UAIA 4JTNA 5BNNC 1RB8G 2UYBA 2G4IA 4C1WA 5DUWA 3ZKUA 3H8XA 4H2AA 1AZDA 2A6WA 3MF6A 1U0AA 1DZTA 3BTYA 1EAH3 3LQCA 3ZSKA 1GV9A 4AEKA 1SQ4A 1RUI1 2BU9A 3UGFA 1S1AA 4ISQA 3MEPA 4X8PA 4F7ZA 1LGNA 4H3WA 4YM0A 3MHZA 5FFOC 1SG3A 2LM3A 2DV9A 4NHKA 1CAVB 3JXSA 5ISLA 1W3VA 3WR0A 2Y60A 1OT5A 4UFMA 4LKFA 4HKLA 3TNQA 2WNVB 1COV2 4PBOA 4JCKA 1SDDB 3J7NA 3GJAA 4BK4A 2CYFA 1R092 4XFHA 4L2NA 3WCRA 3NKTA 2EIEA 2JDZA 4RQPA 1RUI3 4ZONA 3ETQA 1VBA2 2WZ8A 4JGZC 4CXYA 4H7MA 5CKNA 4UFLA 2XVKA 4J25A 4MHUA 1J3PA 1W28A 3FUQA 3ZSJA 2G9ZA 5L7OA 1GLHA 1Y43B 4IV1A 4LHSA 1YI9A 4P00B 5D8AA 5FREA 2PHXA 1ULGA 5A7WB 2R1DA 3C7EA 5L9RA 2KXLA 2JE9A 2WKKA 3PDQA 1BZWA 4KG8A 3HOBA 3WP5A 2WNOA 3PTRB 2VMFA 4LE4A 1RUJ2 1Q56A 2A3XA 3UGHA 5LK5A 5JI7A 1UOGA 3VBHA 4LBMA 2ZKLA 4LA3A 5FZAA 1F31A 2A73B 3WINE 5BYNA 4C8DA 3I3MA 2QQWA 4IESA 2VXJA 1MZ5A 4RSUA 5I8YA 4GWMA 2NLRA 3VD4A 1QQP2 3FZ3A 2X29A 2RS51 5FYYA 2JECA 4AGVA 2V5DA 4JVAA 3QLQA 4DOUA 4EZ4A 5IVCA 1HN1A 4UW3A 1WMDA 3KF5A 2OS2A 1UF2C 3R4DB 3VL9A 2VBBA 4TSVA 5FYMA 3OUHA 5J09A 3AFGA 3VBUC 3FFQA 3U78A 1DGRA 3KHBA 3I2IA 4XFAA 2BUKA 2OZJA 5FP7A 3UKNA 4LO8A 2B46X 1PVC1 2O8QA 1J84A 3RJRA 3CIHA 2RS53 4IE0A 4QX8A 4DXZA 3MPPG 4I3GA 4K1ZA 2VVEA 4PCRA 4F83A 1SBDA 4GKXA 3WHUA 1O3TA 4AWDA 1B09A 1T6GC 1RUC2 5FY8A 2I07B 5C9AA 1NUKA 4CCOA 5EXOA 5FZKA 3KT7A 3FWEA 2Q1FA 2VW0A 5ACA2 4HOOA 4Q2FA 5JIAA 5BUVA 3JQXA 4BXSV 3VBSA 1PVC3 3HVDA 4HXCA 3C8XA 1KJLA 3BU7A 3I3QA 3MFCA 2IXHA 1NXD1 2Y64A 1BBT2 5EV7A 2E63A 2YHJA 4DNYA 4DXTA 1X8EA 4QQOA 3B00A 4IEQA 1GZWA 2YV8A 3IAQA 3ES4A 4ES8A 1W9TA 4J6GA 2DF7A 3FUOA 5H9RA 5A3MA 1CPMA 3HQXA 1N3OA 1FNZA 4KWKA 1K5MC 4EWAA 5EFUA 3RWNA 3AMMA 3CZUA 4W6WA 1ASJ2 5CYYA 4M0NA 3KT1A 1C1LA 1NE4A 4JV4A 4CCEA 1G9AA 4TZDA 1BVVA 2Q30A 1X9PA 4FXGB 3DYPA 4BQ4A 5FPVA 1G6NA 1QF3A 4QPIB 4YG3A 3AX4A 1W9WA 2E7TA 4M0HA 1HXS2 3PVNA 3AP9A 2SLIA 3MW4A 2MPFA 3A4UA 4UF0B 4ATFA 3OUIA 3IBMA 3P3PA 4PDWC 3CJXA 5SV8A 2LTNA 3T1LA 1JYXA 1QJFA 4BMBA 1VBE1 1V6KA 2EF6A 2A6ZA 5HCHA 5IVEA 2AREA 1ONAA 1MACA 1SLIA 2LS6A 3WNLA 5AC92 3VN4A 2PHTA 4Z92B 1JH5A 1QH7A 2TUNA 2BYVE 4FOWA 5J1XA 3M2MA 4KWJA 4RYDA 2HYXA 5J36A 2VMDA 4LBLA 2VCAA 1SACA 3DL3A 4XC9A 3ZSMA 2WZR1 4JX0A 2A75A 4A2UA 5E6HA 3K77A 1W8WA 2Q1ZB 1Z7S1 4GWNA 4Q4Y2 1VBE3 2XHKA 3WQ1A 1JODA 1ZBA2 2OPKA 2YGMA 5ABJC 1GWKA 1ZBE1 4BQ2A 4RFT0 5I91A 1NG0A 3N7JA 2RE9A 2WNUA 3CZJA 4FP2A 2JG8B 2VTFA 3AM2A 1BXHA 5DXDA 1QJU1 1M4WA 1PX4A 2X05A 3O1VA 3GZTB 2WZR3 3CO2A 3QCWA 4XDOA 1Z7S3 4N7UA 2KA3A 4Q26A 4LA2A 1NY72 3NV3A 2GH8A 4XFIA 1UU6A 1AYM1 1ZBE3 1ND2C 4MHRA 1GZCA 5FY9A 2Y6KA 3NAPB 1UMHA 3USUA 2ARBA 4XHXA 3ZFGC 1QJU3 3ZYBA 1K12A 1RUG2 3PLQA 4E8CA 1ZVFA 2ZZQA 4B3NA 3ZN4A 4B4RA 5KXEA 3LF7A 5JR2A 5I0SA 2V4VA 1CONA 1KFUL 3BTAA 1NKGA 1AXZA 1T2XA 5IK4A 3VDDB 5JSPA 1TG7A 3O0WA 4QPWA 1AYM3 1UY2A 3N7LA 2D97A 2ILMA 3VV1A 1KD7A 5B4XA 4XQDA 4CDUA 4EYUA 5CG9A 1FMD2 2BFUS 3ILNA 5F6LB 5KHHA 2HEWF 1V6LA 5LA2A 3C7GA 4WM7A 5FZGA 1COV1 5F7UA 2JDMA 1R091 4FPJA 4XCBA 4DEQA 3V64A 4XXPA 3HT2A 3J8F2 1JHJA 1LOBA 4YM1A 3RG0A 3THDA 3AYAA 3B94A 3O12A 1AR62 1VBA1 4YW7A 2A7AA 2BVVA 2CNAA 4MOAA 4ZHNA 1ENQA 3HEIA 5EJ3A 3O1TA 1HB2A 2YC0A 2MEV2 4NMIA 5E89A 5EJ1B 4BHPA 1QWRA 2CY6A 4QXKA 4LULA 4AVCA 1COV3 1F5FA 4N9HA 4Q0VA 5EHDA 1OLME 5LBCA 4R9BA 3UT0A 1R093 3C7FA 3FBMA 5FYHA 4TTGA 4M3CE 5A32A 1VBA3 4AI1A 1H1MA 4TLGA 2ARCA 3BUCA 1VBD2 3PL0A 4Y1YA 4MLOA 1G9FA 1LU2A 4LHKA 1KS5A 3S6PA 4AHXA 3B5LB 1NA1C 1RUJ1 2ZGKA 4KI5M 4NUBA 4CDWA 4GALA 1SLLA 5FUPA 4ET7A 5FXXA 1KRIA 1FT9A 5T54A 4Q4W2 4CZSA 1JTZX 1O4TA 3C3VA 2EXJA 5DDJ2 2YC2A 1S0BA 1LOEA 2P5BA 3ASIA 3BI3A 4UFJA 5CAZA 1UO9A 1QQP1 2BEOA 2X5IA 3MIDA 3BTZA 2W94A 1W6QA 2V09A 2DU0A 3KCYA 2XKOA 4BQ3A 1N1VA 1RUJ3 3IZOA 4M01A 3E1F1 2B5HA 1GBGA 3K2OA 4L11A 1MZFA 2VNOA 4AHZA 5FTTC 1MQTC 1O7FA 3PUHA 4XABA 5LA9A 4CEYB 5B2GB 1DGWA 5JOZA 1L7QA 1JOJA 3H0OA 2YMZA 1QQP3 4HFSA 4CDQC 4E2SA 3HR9A 3SLIA 5HBAA 1VB2A 3FJSA 3MZHA 3HT1A 3AZVA 3HMYA 3OB8A 4H7LA 1TME2 4D7YA 2DVFA 2J1AA 2BFUL 3CJIA 3OCPA 4NROA 4YVSB 1UMIA 5FY1A 3TNPB 1QJY2 4Y22A 5C5UA 1IG0A 1RUC1 5JI9A 3MICA 3QBQA 3ZO0B 1QDCA 4GQ7A 2FDFA 4CUAA 4CEWA 4YG0A 5ACA1 5K7PA 1GWMA 2IXLA 3POIA 1JZ2A 2ORXA 2WT0A 5LATA 4IGOA 1ZX5A 2D3PA 5BNPA 3GBGA 4BISA 1ND3A 3SH5A 3V0AA 1OBNA 3CNAA 4HZFA 5T55A 1RUC3 2BOJA 2ZXQA 1ULCA 5BNOB 5FQ0A 3ME2A 1H8TC 5A6YA 4QKBA 4NWVA 3VZLA 2W95A 5ACA3 1RUF2 4J1XA 1ASJ1 3ZLIA 2E31A 4N43C 2ZAAA 2I74A 4RFRB 4QB2A 5FY5A 2VNGA 5IK8A 2WA3A 3RMXA 5CNAA 2X10A 3A0KA 4E4ZA 2PA7A 5C7GA 1HXS1 1EUUA 1CAVA 1V0AA 1H2KA 2ETEA 4LKEA 2Y6LA 3CLPA 2R0HA 3ORJA 4F3JA 5IYYA 2A3YA 3GZUC 3D0JA 1DYPA 3ZIXA 2WNVA 3S0MA 2VMHA 2OQ6A 1ZZ9A 2CWSA 2XLAA 4QD2A 3OUJA 2F4LA 1ASJ3 3HQUA 1RGSA 3LEKA 1N3QA 3PMEA 5AFBA 1C4RA 4HN1A 3ZXFA 4OI0A 5AC91 2P17A 1HXS3 2A70A 1X8MA 4LOSA 2P3YA 1J3QA 5A80A 3VLBB 2B8MA 3OD4A 1NCQC 1UIJA 2YPJA 2GU9A 3OF1A 4NVPA 1OLRA 1XSQA 2J1TA 3MF9A 5A3OA 2P4EA 4OZOA 2Z4FA 2ZPXA 4Q4Y1 4C1XA 4CUBA 1ZBA1 3W21A 4Q1PA 3LZZA 3VZNA 5FCCA 4IEUA 4LE3A 3W20A 3QOPA 4IDZA 3RZHA 5AC93 2FQPA 3MV01 4XFBA 3LFMA 5C9AB 1AYN2 4D94A 5JUVA 1C8NA 2DUQA 4QX7A 2JD9A 4K1YA 2JJ6A 3DKQA 2Z79A 2WZPP 3WQ7A 4NIAA 2D6MA 3DECA 3ZXLA 1NCRB 2WWSA 5GLUA 1JUIA 2DDUA 3ZSLA 4Q4Y3 1I6XA 3JB8A 1NY71 1ZBA3 1S0CA 1LAJA 2F17A 4BXFA 4AOCA 1LB2A 2WN2A 4LMFA 2R6QA 2PQQA 2D6PA 1RITA 2NM1A 1XU1A 3HWJA 3I54A 4ZKTB 3R4SA 1EUTA 3OSDA 2IFWA 2YYOA 2D6OX 1D4M2 2P1BA 1WCKA 1NAEA 2WC2A 4XURA 1RUG1 5FMCA 5C8CC 2JWPA 2R30A 5ANNA 5KBFA 4HLTA 1U12A 3MIEA 2PHDA 4Q4X2 5IVVA 1J1TA 3IDAA 3MDPA 1JN2P 4IXLA 3ENRA 1XNTA 4QT6A 2D7FA 3MW3A 3ZM8A 5FZEA 1S2KA 5F5AA 3THPA 1OKOA 2RDNA 2E6VA 4LO5B 3KS7A 2HWB2 2W47A 3FMGA 3ZXAC 5EIYB 1FMD1 4M4PA
chains in the Genus database with same CATH topology
4BPZA 4XJ8A 1O4ZA 1MS3A 2TEPA 3RJ2X 1RUG3 5I0RA 1CQ9A 5FAXA 5GJ6A 3AXDA 3LB9A 3MYXA 2AYHA 3SISA 1WD3A 2GMEA 2JXAA 3J8F1 1AR61 2ZGOA 1YJLA 2WINB 4B8EA 1B35C 3WVJA 1FMD3 4R9AA 2IXJA 2MEV1 1OQ1A 1C5IA 4L9BA 1KITA 2FHRA 3J9SA 2Z2SB 3PJQA 5KHGA 3IDBB 2Q4SA 3WZ1A 1X33A 2VU9A 3WDTA 1PZ7A 3J8F3 3N4MA 1AR63 4JGYB 5BNNB 1MS9A 5FDBA 1XQNA 1VBD1 4XF3A 1IKPA 2MEV3 3AJYA 1BJQA 2PHRA 2V73A 2QCSB 4XBQA 4JRAA 4FPEA 2FMYA 1RUOA 2GAUA 5DDJ1 2VOVA 4A7YA 2PHUA 3VBFC 1YI7A 3USUB 1AXYA 4MUVA 2ZJCA 4IQPA 3MIGA 4DQAA 1VBD3 3AJZA 5E1RA 1QKQA 1FI2A 5FOBB 1RMU1 2VXRA 1DQ6A 3PNAA 1C57A 4JGZB 2WSUA 3WNXA 4B7KA 4QGMA 3WG4A 4CDUB 4MGKE 5DDJ3 4XZPA 3G6JB 3ST7A 3VKMA 1OKQA 1SBEA 1RVF2 5GZEA 3WP3A 4YM2A 2VW1A 4OLLA 3T2TA 4AFAA 4YW4A 4BLIA 2MNGA 4LBNA 3LOIA 3V65A 1TME1 1XNCA 1RMU3 2DUPA 2JG8A 5H9SA 5J98B 1QJY1 1U5XA 4G3YC 4IEVA 2AH2A 5IK5A 4FAGA 1QDOA 3FLRA 4QHBA 1VAMA 1QNYA 1MS0A 4AYUA 1OSGA 3BPZA 1UN1A 1WW6A 3WLUA 1TME3 3NAPA 1QJY3 2EAAA 1OLQA 1R1A2 4R52A 1KQRA 4YW2A 1Z0HA 1RUF1 1QU0A 3KGLA 3O0XA 3VDDA 1IQAA 3ACLA 3BCWA 4META 3VBUB 4JTOA 4EROA 3M8LA 5FLHA 3QH6A 1APNA 1ENRA 2DTWA 4COYA 1RUF3 4QGLA 4CDXA 5JPNB 4A7ZA 3LSEA 4E2QA 1TQ5A 1A6CA 2D6LX 2NN8A 3WV6A 1PGSA 3CF6E 4AEDC 4F8AA 1IS6A 1UKRA 3PJYA 2ZGMA 5IUQA 1G86A 4YW3A 1RUNA 3M3CA 4YZ1A 1Q3EA 1FATA 1G7YA 1AR92 1CGPA 4WM8C 5DZFA 2O1QA 4OI1A 3SCFA 4BH9A 3TOJA 2XB6C 3VHOA 4XMAA 1K5MB 1QJU2 2W52A 1AYN1 5FLJA 3ZYRA 5T52A 1LR5A 4XBNA 1ULEA 4G9SB 3EO6A 4X6QB 3LKJA 2JG9C 2WFPA 1HLCA 3IN9A 5A3LA 1XNKA 4BE3A 1PGL2 1QH6A 1ND3B 1FX5A 3NV4A 5EYYA 1MEC2 4HSLA 4PDWB 1JW6A 4K40A 1PZ8A 1AYN3 1AJOA 1D4M1 4Y26A 4KH9A 3S7IA 2FZ2A 2PELA 4Y20B 4KGQA 2WL1A 1EP0A 1SEFA 4N9IA 4Q4X1 3SHRA 3DGTA 4AG4A 1O3SA 4CEYA 1ZZ7A 5JSRA 2ZAHA 1V70A 1FNYA 2GC1A 2HWB1 4NWWA 1CIWA 3VKFC 1OA2A 1UIKA 5CVRA 2Z69A 4P9LA 4EJRA 1XYNA 2P3KA 3O7OA 1H4HA 1D4M3 2XJSA 3EBRA 5DG1A 2AR6A 2GN7A 4YVWC 1DDLA 3VZJA 1HQNA 2ZACA 4FAHA 4W6YA 1XNDA 4YVSA 3VKOA 2DWRA 4Q4X3 1XRUA 1XE7A 3C2UA 2UYAA 2AENA 3JU9A 3ZFFC 2HWB3 5GZCA 1H2MA 2HJIA 1AX1A 2XLGA 1HRI2 3EXUA 2ZTNA 5I93A 4YGEA 5KXBA 5C33A 1MS4A 4FVVA 1ND2B 3NJZA 3ZX7A 4BM8A 2BWCA 1QOTA 2ZKNA 5BNOA 1C8M1 1OQEA 2JE7A 1WBLA 2WS91 2ZX0A 3S7EA 4OUSA 1I3HA 1SFNA 3ZVXA 4Q0SA 1G8WA 4O9EA 2DCTA 1IS4A 2W0XA 4HK8A 1LKNA 1V00A 2DCYA 2XKPA 4NR1A 4N53C 4WM7C 1FV3A 1HV0A 2JD4A 4FOQA 1C8M3 4QQPA 2YXSA 2WS93 2ZMKA 5LRSA 5JLVA 3AB0A 3OBRA 2RJLA 1A3KA 4LBOA 1FOD2 4AI0A 4B4QA 4PQ9A 2R042 1D2SA 2ZABA 4R8HA 1LCLA 4GXLA 3MIHA 1NYWA 4IERA 4G4FA 4DFSA 1REFA 5LRRA 3GNEA 3KD4A 1VBB2 4IEZA 3ZSEA 4OZXA 3ZDSA 5FMOS 4Z1VA 3LA3A 1RVF1 1RINA 4Q0UA 2RM21 2ZA9A 1LOAA 1S0FA 4GULA 1W6MB 4D3WA 5I8TA 2Y38A 4ITCA 3LGRA 4PIZA 3VBOA 4HT1T 4KWLA 1H4GA 3WP6A 3D0SA 1NA1B 1NCRA 1RVF3 2OYZA 3WDWA 1G9DA 2RM23 4O9GA 3M3IA 1G9CA 3BALA 1BQPA 3I59B 4XF0A 1F9KA 1R1A1 1RJ8A 2OZ6A 4MGYE 5DZEA 2ATFA 3H3ZA 4NHLA 2VOXA 2IWGB 1R082 3T1MA 3O5SA 1EPWA 2A5ZA 3I7DA 2QQPA 4JDNA 3BIWE 1MQTB 3AZZA 1ZZ6A 2VGDA 2KM2A 1QY4A 1ZA4A 4DZGA 4LTAA 3N7KA 4P9IA 4QPYA 4OFGA 3TB0A 3ZXGA 2VECA 4CDQB 1WW5A 2WSVA 1U5ZA 4HL0A 3R0RA 1D2QA 1R1A3 3FX3A 2XL7A 1J3RA 4FO9A 2PLV2 2AZ5A 1EY2A 3GHMA 3MFAA 4Z8BA 2UU8A 4KBBA 4N7IA 1NXMA 2EALA 2RS32 2B9UA 2Q8OA 3TRSB 4Q27A 4S2FA 5CFDC 1RL3A 5EZWA 2EXIA 3AKPA 2WJSA 1RUE2 1S0JA 3LA7A 1F5JA 2BWAA 3ILFA 1AR91 1CESA 2B45X 3AMPA 1UU4A 2DVAA 1RC6A 4JGYA 1UPIA 2QJVA 3VHNA 5BNNA 1N1YA 1OHFA 5FMOL 2PN5A 2ZGUA 1H8TB 3JUUA 2XBO2 1VBC2 4OUMA 4KL1A 3X29B 3VKNA 2DFCA 4N43B 1MVEA 4BYYA 4K9SA 3KT4A 1FAYA 2VVDA 1LGBA 1WBFA 4HN0A 2E51A 2NP0A 1X50A 4ASMB 1HDKA 1LULA 3MGUA 1AR93 2ZGLA 2VH9A 1PGL1 2R16A 4EV0A 1MEC1 2OIIA 1GANA 1HKDA 5EWSA 5H9PA 1H8VA 4GB32 3AP7A 5CU1A 2QE3A 2VVFA 3R4UA 2HWC1 1U5YA 1KDKA 1HIXA 4H14A 4KG0A 1DBNA 2VNRA 5GZGA 3ZYGA 3KZ4C 3ZPYA 1H9WA 3Q9OA 3KCCA 1LRHA 4JGZA 4XF1A 4AW7A 5BPXA 5KHJA 5BXXA 1NCQB 1WGPA 3IPVB 5GZFA 4SBVA 1MEC3 4PLOA 1H2NA 3IWZA 4ZU4A 2BPA2 3WXPA 3B01A 5C4WC 2A6VA 2HWC3 2ET7A 3CEWA 2XJTA 5KHIA 3M70A 1H0BA 4CDXB 4JRLA 1MZ6A 5EYXA 1KFXL 1LOFC 2Q0AA 3VBRC 4XHBA 1AXKA 2GC0A 2QZ3A 4Y1ZA 3V56A 1GYKA 1FYUA 2ZX2A 2E53A 3ZFEC 1HRI1 1WW7A 3L2YA 2DUOA 1LOCA 2D3SA 1PVXA 4MGZE 2RMU2 4XMIA 4X6RB 4CP0A 3E6BA 4XYXA 5AVPA 3WDVA 3RPQA 1A8MA 3JQWA 4OI4A 1BVP1 3SCGA 5C8CB 5GLZA 2YY1A 1DQ1A 1O4YA 4PF5A 4FTBA 2N7GA 4JC1A 2D40A 3E5UA 4CRQA 5FLIA 2EA7A 1HRI3 2GALA 2DFBA 3VBUA 4HANA 1BK1A 4TYSA 4RR3C 3DV8A 2XPJA 5HXVA 3IM0A 4AQSA 4JQRA 1A78A 3D8CA 2RJKA 2PAEA 5JVVA 2H0BA 1DLLA 3KB5A 1S2BA 5JOXA 3WW4A 1H9PA 4JDOA 2I2SA 1FOD1 4XE9A 1YRZA 2R041 2DU1A 5T5OA 1RMU2 2QKDA 4K6BA 3RI9A 3N3HA 2UWAA 4PIXA 4AVBA 4X8NA 3WDUA 1IPKA 3WW3A 4AVTA 3W59A 5DZGA 1V6OA 1AX2A 1B35B 2CGNA 1VBB1 4K7JA 3WY6A 1DGRN 4XDQA 5BV6A 4D7SA 2EIGA 4XIOA 3VGIA 3N35A 1FOD3 2R043 2WLPA 4WV8A 3AXEA 1MS1A 2QZ2A 4JAAA 1K5MA 1OFSA 3H1MA 4Z2WA 4QPIC 3QD6A 1V6MA 3U11A 5JPMB 1WLTA 1X36A 1VIWB 1VBB3 5CB7A 1XU2A 3GYDA 4ORFA 3ILRA 4HKWA 5CBLA 5J96B 4XEZA 1W0OA 4MSVA 4NPRA 1OPMA 3M3EA 4PDWA 3AZXA 5CADA 3VBFB 2D5FA 1NLRA 3V0BB 2B39A 1WMEA 3POSA 2VOWA 1WMFA 4A7KA 1H30A 1QJZA 4Y20A 2CAVA 3H7YA 1E57A 5CFCC 1SCSA 1R081 1IZ3A 1YIPA 2GNTA 1REDA 4YGBA 4QPGC 2D5HA 4COUA 4LHNA 1VAKA 1MR5A 4HSJA 4MGIE 1JYCA 2VY0A 5FO8B 3SMHA 2PLV1 4UW5A 2HWE2 3WD5A 5KHKA 1R083 2MHFA 3H3UA 2RS31 1Y7BA 5FO9B 1UU5A 3M4FA 2A71A 2GMMA 4HK9A 4UBGA 1DGLA 3RYRA 1RUE1 1ND2A 3L9JT 1I9RA 3UKVA 2XL9A 2PLV3 2UY8A 2FMDA 3UV9A 3ZFGA 5JZGC 4IV3C 5JAXA 4WVVA 2RS33 3WX5A 1MS5A 3ALQA 4PLNA 4RS5C 1IKQA 2XBO1 1VBC1 2VQAA 3VBOB 4P9XA 5K0UC 1UX6A 3TWIA 1VLNA 2A6YA 1QXPA 1OOPB 1RUE3 3D6EA 2P34A 4XW3A 5J37A 4TWTA 1HRV2 2BNNA 3IDCB 4GB31 2TBVA 4CP2A 4IEWA 2XBO3 1VBC3 4DRVA 4GH4C 4M00A 1Q8SA 3U0ZA 1PM7A 3RZZA 3FLTA 3ZYIB 4AEDB 2ZX4A 4GIQA 4D69A 1SMVA 1Q43A 2H6BA 4FPHA 5L73A 1MVQA 3SH3A 1W0PA 4FPFA 5KC5A 1O91A 2A3WA 3RDIA 2HEVF 1LGCA 4GB33 3MW2A 4WM8B 3WUCA 1W6MA 2QFEA 3CU7A 4HBNA 3SCHA 4HVQA 1C28A 4LO4B 3U07A 1YIFA 2VMGA 3ES1A 1PK6C 2K0GA 4WVZA 3DPRC 1WLCA 3NWKA 1NA1A 1S0DA 2ENRA 4RL7A 2XJVA 4LUMA 3ZYPA 2GMPA 2HKXA 3NO8A 1PZ9A 2JG9B 4YNIA 4WZCA 3KCXA 3MLKA 3ROUA 2V5YA 3MPBA 1DU3D 2G9FA 1C8M2 4GMP1 2RMU1 4AFMA 2XG3A 2NYYA 2WS92 2XJQA 3I59A 2ZGQA 2Z42A 3IT8A 2SBAA 4B29A 3ZXJA 2D6NA 4XFGA 1PHMA 3WW2A 1FPN2 3M3QA 4L99A 4NO4A 1RJ7A 2VPVA 1MQTA 4BLJA 1WD4A 1XXNA 1VJ2A 2GN3A 3G7DA 2HWD2 1HQLA 1DQ5A 2CTVA 4MXWA 4GMP3 2RMU3 4WVMA 4CDQA 4RQPC 2ZGPA 4BIFA 4YARA 5LEKA 2BTVC 1BCXA 1RUH1 3RS6A 4Q29A 4DPNA 4XIKA 4LT5A 5L7OC 2ZMLA 4Y1XA 4P9GA 3ZN5A 2C1FA 4S2GA 4IV1C 1I1EA 5D8AC 2H0VA 3ZFFB 2CV6A 1IPJA 2XH6A 2D93A 1R1ZA 2ZS6B 3ATGA 1UL9A 4XJWA 2ET1A 4EN7B 2PHWA 2RM22 4A3XA 2H6CA 3H8UA 5BNOC 2GC2A 1SLBA 4COVA 4GMP0 2DTYA 1X7NA 1RUH3 4I30A 3L2HA 1AX0A 1ZRDA 4YZ3A 1H8TA 5KXCA 4PJYA 3VBHC 2QDRA 1GZ9A 4NN0A 4N43A 3LAGA 2WQ4A 4AVAA 4KU8A 2C9AA 5DG2A 4Z82A 3OYWB 2C5DA 4Y5Z0 1H1AA 1GKBA 2ZX1A 4QQLA 4N53B 5GZDA 1S55A 1C3HA 5KC6A 4Q0QA 1IGOA 2BBVA 4YZ2A 4R4XA 2DYCA 2ERFA 4OHVA 2B7YA 3N36A 4FOYA 3EQEA 3K48A 4FSJA 2VW2A 1MS8A 1QGLA 3DKWA 2R062 3GBFA 2IZWA 3H50A 4H55A 4YGCA 4AHYA 1JBCA 2XJPA 5H9QA 5F1RA 4FT8A 1LECA 1EYBA 1NCQA 3IPVA 5F6KA 1ALYA 1H2LA 5JOWA 4OI0A 1YNAA 2QVSB 1DGWX 5AFEA 2ZOEB 1S0GA 4FPYA 4XETA 3URFA 2GNMA 5C9AC 4YGDA 2E7QA 4HVOA 3VBSC 1OD5A 5FO7B 1XNBA 1YXWA 2HWE1 2R0FA 1CR7A 1RTVA 5JIUA 3SNMA 4BWOA 1PO12 4INDA 4OI2A 3POYA 1D0GA 3S30A 3RNSA 3AYEA 4FQZA 4P9YA 5FPZA 4AHWA 3THTA 4AGGA 5JMCA 1W2UA 2P2KA 2ZCWA 1DG6A 5IT6A 2HWE3 3MIFA 3AMNA 1ZNPA 1NLSA 5C8CA 4Y24A 4OULA 1ZZCA 4LBQB 1Q8PA 2F4PA 3ELNA 1OQDA 1CAXB 4OHXA 2XUMA 1JHNA 1SCRA 2NPIA 2WLQA 5DUXA 5K8SA 4YFWA 3FC0A 4ONUA 3J4UH 1N1TA 4UW4A 3JB4C 2Q5TA 2G9GA 2PAMA 3TBDA 1HRV1 3HBZA 2HWC2 3B9IA 3OJBA 4LEJA 1SFYA 1J58A 1YHFA 4SLIA 2ZHNA 4CYDA 4HVRA 2WIIB 1WA4A 4MXVA 4B7EA 2W39A 2WT2A 3BOWA 5GALA 4Q8KA 3WUDA 1B35A 1WCDJ 5CFDB 1HV1A 4U2AA 3POWA 3QH7A 4M3CB 3JZVA 3UL2A 1HRV3 3TN92 1U5IA 3MIBA 2WNUC 2D6KA 5GLVA 3OPZA 3FBYA 4OVEA 5ABJB 1O3QA 1AF9A 1V6NA 4P9JA 3D4KA 4COWA 3KQRA 1NE6A 4FPGA 4S2DA 3TAYA 4WBBA 1LEDA 4AEMA 2NQYA 5CG8A 4Q4V2 4FBFA 1VRH2 3UK9A 3RSJA 4Q8LA 5IK7A 4AVSA 1IS3A 1KS4A 1YO8A 3MLJA 2BGCA 1SBFA 3ECQA 5JR7B 1DFQA 3VBFA 3V0BA 4K3UA 3ZFGB 2F6BA 2VUAA 4N90A 1KDMA 5J48A 1W6NB 3E6DA 4XF4A 4CDUC 1FPN1 1ZRFA 3R05A 3VL8A 3APBA 1D4VB 1UZZA 3AZYA 4HKOA 3AYCA 2BNMA 4U36A 1DIWA 4KGGA 4Y4YA 1UCXA 3NVCA 1BYHA 2HWD1 5GKAC 1TNFA 1Q5OA 4V1PA 1AL0G 1OFNA 4UXAA 5C4WB 4FTSA 2E7AA 1UKGA 4E4SA 2GZWA 1ZZ8A 1FPN3 2P3IA 4E4DX 2A6XA 4IEYA 3VBRB 4QM9A 4R9DA 1NZCA 3AKRA 2RR12 1AUYA 2VUJA 2HWD3 2BVBA 3AK0A 4AQTA 3DN7A 3ZFEB 3ZYJB 4MZUA 1PO22 3OY8A 4DY3A 2PAKA 3E5QA 1RUD1 1CX4A 3AKQA 1SLAA 4OHWA 4Z07A 3WQ0A 4LO7A 4CDWC 1ULDA 4FCAA 3GALA 3PMSA 5GLTA 3CL1A 1D0HA 1OOPA 1C1FA 1O5LA 3PHMA 3WCSA 2RS12 3AFKA 4RR3B 4RHV2 2X5IC 2CGPA 5A33A 2IC1A 1RUD3 3ZMOA 3GZAA 5CA6A 1YJKA 3FE5A 4HPKB 4QMAA 1CN1A 4EWDA 2CGOA 1UMZA 1BMV2 2DVGA 4I0AA 2GNDA 1C5HA 1CVNA 1VAVA 2QDNA 1L3JA 3KLSA 4AFCA 2R061 2YROA 4XQ4A 5DUUA 4AI3A 1TNRA 2GC3A 4AEDA 1UW8A 1J59A 1Q8VA 1LJ7A 1MZEA 1AHSA 1V9U2 1OPOA 4ATEA 3ZMNA 3PTYA 4MXWB 5AVAA 3WG3A 1FXZA 4WVMB 3CJIC 2P3JA 3I8TA 5JOYA 1ZRRA 3ZN6B 4EN0A 4WM8A 1W6PB 2ZGRA 3M1HA 4TLFA 4CEWC 1LESA 2X8KA 3LA2A 1BEV2 2ES3A 1QJX2 2EXKA 2R063 3HAGA 5DUVA 4LLOA 2W68A 1LEMA 3KGZA 4FTEA 3PVEA 1SLCA 2O0OA 1XE8A 1W6OB 5BNPC 1TMF2 1URXA 1ND3C 2RHPA 1PO11 4L97A 2JG9A 4Y1VA 2Z5WA 1F8VA 1LHNA 3P3NA 4PBPA 3I4IA 2IXIA 2JENA 4XILA 2FBEA 5FBZA 3GHNA 1PNFA 4LHLA 5K9YA 2HWF2 3WOGA 2XJUA 2DCJA 1PO13 2XJRA 5BNQA 1HX6A 1GQGA 2DVBA 2R49A 3BB6A 2ZMNA 5CFCB 4KQ7A 2WNVC 4L8QA 3UJQA 3NV2A 3NV1A 1WLDA 4QPGB 2E9QA 2WQZC 4LNVA 3ZXKA 4YW5A 4C0BA 5GLWA 4COZA 4BIOA 4YVWA 2OA2A 4I09A 2JKBA 4FPKA 4BCUA 3BODA 1CJDA 5T5LA 3TYJA 1LHOA 5BY5A 1DHKB 3VZMA 3ZFFA 2UY9A 3RMYA 5FPXA 2ZX3A 2Y26A 5JWPA 1RIRA 4YZ5A 3VHRA 3H1YA 1N3PA 1PNGA 2XWBB 3VZOA 1Y9QA 3TN91 3OBTA 2OUJA 4R4ZA 4AFBA 4DB5A 4R9CA 4UBHA 4MVTA 4C90A 5T5JA 3O14A 3AYDA 5JZGB 4IV3B 1AVBA 4IETA 4RS5B 4Q4V1 3B02A 5CIRA 1VRH1 2GDFA 4XJ9A 1F2NA 4I01A 5K0UB 4KU7A 3LCPA 3OYWA 4DMIA 3TN93 1GFF2 4LO6B 5LEJA 4N53A 4M3CF 4LBJA 4WZFA 1LENA 3OGJA 1XYOA 4DY5A 4XXAA 2HEYF 2IFRA 1CAWB 2OW4A 4XBLA 4DINB 1GNZA 1AL22 4P14A 1DYKA 2R072 3RQ0A 4S2HA 1S0IA 4Q4V3 4LBQD 1DQ2A 3AP4A 1VRH3 4GH4B 2PFWA 3JBG2 1DZQA 4AK3A 5C6CA 2B42B 1VALA 2QNKA 3M7AA 1IHMA 3E5XA 4IEXA 4MH0E 4LBKA 3OD0A 1X82A 1H1IA 3NW4A 1CJPA 5SV5A 2P37A 1TEIA 1HW5A 3LOBA 1GNHA 1NQJA 1V6IA 2JICA 1LU1A 2UURA 1CAUB 3AP5A 4KNCA 1WLWA 3VHPA 2YZ4A 3WG2A