1EPZA

Crystal structure of dtdp-6-deoxy-d-xylo-4-hexuloase 3,5-epimerase from methanobacterium thermoautotrophicum with bound ligand.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
183
structure length
183
Chain Sequence
EFRFIKTSLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEVRFVQDNESMSVRGVLRGLHFQREKPQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSDECIVNYKCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLIISEKDRNWKPLRENPVYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords DTDP-6-DEOXY-D-XYLO-4-HEXULOSE 3,5-EPIMERASE
publication title Crystal structure of dTDP-4-keto-6-deoxy-D-hexulose 3,5-epimerase from Methanobacterium thermoautotrophicum complexed with dTDP.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
total genus 42
structure length 183
sequence length 183
ec nomenclature ec 5.1.3.13: dTDP-4-dehydrorhamnose 3,5-epimerase.
pdb deposition date 2000-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1epzA00
3H1WA 5EZWA 3WW2A 3E5QA 2IXKA 2OYZA 4BHPA 3KSCA 1J3QA 4PJYA 5JR7B 3NSTA 3RPQA 1UD1A 5K8SA 2MHFA 2V09A 4I01A 4BH9A 1YFWA 1GQGA 2MPFA 1QXJA 4LA2A 2PQQA 4WVZA 3H8UA 4Q0PA 1UPIA 2QJVA 4IEWA 4L11A 4XEZA 4YYOA 2EA7A 4IEYA 1FI2A 3CEWA 3H3ZA 5BV6A 3S0MA 3SCHA 4MGYE 4J1XA 1YUDA 2Q0AA 2E9QA 4QMAA 3R6SA 1RL3A 2CV6A 1ZVFA 3M70A 3LAGA 4FT8A 3S7EA 1YFXA 4EV0A 3SXWA 1YFUA 2I45A 4Z82A 3RYPA 2GC1A 1O7FA 2D5FA 1CGPA 3FX3A 1CAUB 4WZCA 2QCSB 1WGPA 4IEVA 4KU7A 4EROA 4GULA 5JSRA 1DZRA 5JSPA 5JAXA 1EY2A 4LUKA 4XFGA 3E6BA 5I0UA 3FE5A 4XFBA 4I3PA 5I8YA 4N9IA 2CGPA 1X7NA 1ZZ8A 1CAWA 3OTFA 4FAGA 4UBGA 2XKOA 1J1LA 2ZKLA 4KWJA 1XE8A 4AVBA 1Y9QA 2XLFA 1EPZA 5JSOA 3IDCB 1HW5A 5KHJA 4LUMA 2PA7A 3BALA 1OD5A 1FT9A 3EO6A 3D82A 4OFGA 3N4MA 4MX3A 4Q29A 2K9ZA 3IBMA 3D0JA 4AXOA 3EHKA 3UKTA 3SCFA 2DCTA 2ATFA 2H6BA 5LRSA 1CAXB 4XF3A 1YLLA 3EJKA 3U10A 3KMHA 1NXMA 4HZFA 1O3TA 1O4TA 4XETA 1NYWA 3NL1A 4R52A 5KHHA 1IPKA 3VHRA 1ZRCA 3NKTA 3ACLA 3QACA 4IERA 4JV4A 3HIFA 3FWEA 4IEOA 4MGZE 4DINB 4AVAA 2IC1A 2GC2A 5J7MA 4H7LA 5FPZA 3MPBA 4ZU5A 3CLPA 3NVCA 5AVPA 4HLTA 1U12A 2GZWA 2HJIA 1LKNA 2BNNA 1O3RA 1Y3TA 2ET1A 2H0VA 3DN7A 4LA3A 5BY5A 1ZREA 4J1WA 2IXHA 2KXLA 3S7IA 1PMIA 5I8TA 4HN1A 3DKWA 1J59A 3NW4A 3OD0A 2PHDA 1SQ4A 2GAUA 4UXAA 5LEKA 3RDIA 4EWEA 3WW4A 4B29A 3LZZA 2VPVA 3NJZA 3HT1A 1NE6A 1X8EA 3M3IA 5I0TA 5FQ0A 2IXJA 1J3RA 5C6CA 4KWLA 1J3PA 2IXCA 5CADA 3I59B 3USSA 2ZCWA 1RC6A 3ES4A 1XE7A 4O9EA 2BGCA 2XL9A 2WFPA 3ZDSA 2UYAA 1NE4A 2CAVA 4PIYA 2PYTA 3SMHA 4BIFA 5E16A 4KL1A 4AVCA 1O5UA 1OMIA 1O5LA 3E97A 3H1YA 4EWDA 5BXXA 5CVRA 3H7YA 4HSJA 2ETEA 3TNPB 5D1IA 4PIZA 5KHGA 4XFCA 1DGRA 2XKPA 4E2QA 4ZU7A 4IEPA 4Q0QA 5FPXA 1X8MA 1OI6A 3FFQA 1DGWA 1OFNA 4XFIA 4N9HA 2GH2A 5I0RA 3EQEA 2UY8A 4D7TA 4KU8A 3WW1A 3C3VA 4ONUA 5I0SA 1O3SA 1CAVA 3I54A 2O8QA 4JTOA 2Y0OA 2GC0A 5I93A 4JTNA 1L3JA 3RYKA 4XF4A 5HI0A 4IEXA 2HKXA 1ZX5A 3D0SA 1VJ2A 1IPJA 3LOIA 2GC3A 4XF0A 2Q1ZB 2VECA 3MZHA 4Q0UA 3RZZA 4QX5A 3E6CC 3OF1A 5JCTA 2OA2A 1LB2A 1ZNPA 2Q4SA 4F8AA 2FQPA 4META 4XF9A 4XF1A 4K8FA 4UBHA 3KGZA 5T3NA 5FLIA 2FMYA 2PTMA 3BCWA 3O14A 4D7SA 1ZRDA 3H1MA 4KWKA 1Q43A 5C8WA 4IETA 3EBRA 4YNIA 4RD7A 2VQAA 1X82A 2D93A 2BNMA 5BPXA 2EAAA 1G6NA 1ZZCA 3ES1A 2F4PA 4I02A 1Q5OA 3RNSA 3B02A 4XFAA 2GU9A 2N7GA 3LWCA 2CAUA 1CAUA 4HVQA 4MUVA 3RYRA 1UW8A 5FCCA 2D40A 4HN0A 2XLGA 4EWAA 1J58A 3MDPA 3MYXA 4PIXA 5J3UA 1SFNA 2BNOA 1UIKA 3LA7A 3FZ3A 1VP6A 3CJXA 1FXZA 2PFWA 2XGXA 3G7DA 3HQXA 3LA3A 3CF6E 1QY4A 1CAWB 4LEJA 2WC2A 4IEUA 1RTVA 2PAEA 1WLTA 5J48A 2QDRA 3CL1A 4MH0E 3L2HA 2B9UA 3WW3A 3QOPA 2XLAA 3BB6A 4QGMA 1QXRA 2BYVE 3OCPA 3KGLA 1CAXA 3U0ZA 4MZUA 3BPZA 3E5XA 1I6XA 2UY9A 4WBBA 4MGIE 3E6DA 2Q30A 4LTAA 1EYBA 3ELNA 4E2SA 3JZVA 3UKVA 1LR5A 3SCGA 4XFFA 2OPKA 5LEJA 1RGSA 1ZRRA 4YSFA 1CX4A 2C0ZA 4O9GA 4HMZA 3BU7A 3DV8A 1ZZ6A 4QXKA 4Q0SA 2D5HA 1ZZ7A 1DZTA 2ET7A 4I0AA 3LA2A 5CU1A 2EVXA 4XFHA 3FHIB 2K0GA 5I91A 1XRUA 1YHFA 3PVBB 3E5UA 4QM9A 5KBFA 2UYBA 3H9AA 5KHKA 5F1RA 5EFUA 4QM8A 3CO2A 4X6QB 4ORFA 2B5HA 1ZZBA 4LLOA 5FLJA 3TNQA 4X6RB 4MV2A 1H1MA 3HT2A 3GYDA 3PLQA 3UKNA 4YRDA 2IXIA 1Q3EA 2PHLA 3I59A 1JUHA 4HSLA 5FQ0B 5LRRA 4ZU4A 4FAHA 4I0BA 5FDBA 2IXLA 2H6CA 2P17A 1RUNA 1LRHA 4MGKE 4BYYA 2QVSB 4IEZA 1NZCA 3ST7A 4Q0VA 4P9GA 4LULA 3DL3A 2BEOA 4Z07A 2QNKA 1UCXA 4FBFA 2Z69A 4JVAA 3I7DA 3IIAA 4HBNA 2Z2SB 1UIJA 1QWRA 2OZ6A 4QGNA 2MNGA 4IESA 4HVOA 4R8HA 1H1IA 5KHIA 2PAMA 5BUVA 1EP0A 3U11A 2XL7A 3H3UA 4CYDA 1O3QA 1SEFA 1WA4A 1V70A 4I09A 1ZRFA 3H7JA 1PM7A 2OZJA 4TLFA 4HVRA 3PNAA 2XHKA 3ETQA 3GBFA 3IWZA 5FLHA 4F7ZA 3FJSA 4IEQA 1VR3A 3KCCA 4QGLA 1CAVB 3OGJA 4NVPA 4OLLA 1I5ZA 5E1RA 1ZZ9A 1TQ5A 2O1QA 2PAKA 3SHRA 4AQ2A 1RUOA 4E2GA 4I2OA 1GQHA 1YFYA 1YWKA 2B8MA 3H50A 3ROUA 3IDBB 4L2NA 4YARA 4AQ6A 5I8SA 4A2UA
chains in the Genus database with same CATH superfamily
1ZBA1 1KDMA 3ECQA 1O8SA 1PNGA 1NOVA 4BXSV 3AMNA 1FPN3 2JJ6A 4AGGA 2PN5A 2W95A 2HWC3 3W21A 2WN3A 4WV8A 1HN0A 1HJFA 4LE3A 3KSCA 1J3QA 2ES3A 3POFA 1FOD3 1WW7A 4PJYA 5JR7B 4CXYA 5A6QA 1C4RA 2YMZA 1W2AX 1WKYA 5CG8A 5EJ3A 4FI9A 4BH9A 3N7KA 4H2AA 4LBKA 3CKHA 1AL22 3NNMA 1HDKA 1RUJ3 2B45X 2XOMA 2F4LA 1S2KA 1YQCA 4AEMA 2PQQA 3ZYJB 2VO5A 2NZ9A 2WQ8A 2ZHKA 1W3XA 2C9AA 1W39A 2Y6HA 3KQRA 3O7OA 4XEZA 2XBO1 4UWDA 5A7SA 4Q4W2 2WNEA 1KGYA 5L7OB 2AH2A 1HRI2 1C8M2 2EA7A 1BK1A 4CDXC 1B35B 1H6XA 3I4IA 4BE3A 2PHRA 5DUVA 4IEYA 4BXFA 4LIVA 2OVUA 3H3ZA 5BV6A 4B7KA 4MGYE 4EE2A 1YUDA 4YW6A 1AXZA 5CFCA 5B4NA 4BJ0A 1VAMA 2CV6A 1Q8QA 2K2SA 1H30A 3LAGA 1AR93 3FN9A 3M70A 4FT8A 4IDZA 1UXZA 3ZYBA 4A2UA 1VLNA 3HVDA 2J1RA 1CZSA 2GDFA 2G9ZA 2X5IC 3W5MA 2D5FA 3GBWA 2YU1A 3RI9A 1WGPA 3V0AB 2BOIA 4L99A 1GNHA 2WLPA 3HOBA 5JSPA 2DVDA 4F3JA 4HPKA 2JKBA 3AZWA 1ONAA 2AC1A 2WA3A 4LUKA 4XFGA 1X36A 3AX4A 3E6BA 1RUH2 3IM0A 4RHV1 4BB3A 2CGPA 3HNBM 3VDAA 4C90A 3NQHA 5CFDB 1ZZ8A 3KT7A 5A3LA 1CAWA 2LROA 1OLRA 4QD2A 2JB4A 1ULCA 4UBGA 2CSGA 1TME1 4YZ1A 3L9JT 1MQTA 4KG0A 4DMIA 1C8NA 1U5IA 1Y9QA 5LY2A 4X8PA 5KHJA 2YZ4A 5C8CB 5CKMA 1RMU1 4YLZA 4COYA 2WS92 2XJVA 1NY71 5BNNA 5IAXA 1JMUB 4JGZB 4MX3A 2CY6A 1DQ6A 2GMPA 2VXRA 4YGEA 4YPJA 2MEV2 1GWKA 4QX7A 4FFHA 2OKXA 4FOWA 1T6GC 3D0JA 4GMP3 1GP5A 3UKTA 1VIWB 2DCTA 2VXJA 2H6BA 1UWWA 4L8QA 5KC5A 3GM8A 1MS5A 5J09A 3NV1A 2BFUS 3KLSA 3NWKA 3LPGA 3AYAA 1PX3A 3LF7A 2AENA 2VZPA 4BQ1A 1O3TA 1D7PM 4DOUA 4J6GA 1HB4A 3ME2A 2J1SA 2JDKA 4CCJA 3WG3A 5A32A 3QD6A 3U75A 5JPMB 1D4M3 3VDDC 3NKTA 1F2NA 3ACLA 2ARAA 4XABA 4DINB 3LB9A 4MGZE 4YM0A 1PM4A 2HWF2 4GJZA 3ZXEA 3D8CA 4AVAA 2Y8KA 4WM7B 3ZFFB 4BOWA 2YC4A 3OY8B 2VMCA 2GC2A 4XXAA 5J36A 5J7MA 2ZGMA 4H7LA 1BVP1 1AJOA 1LOBA 4C1XA 1FPN1 2RS53 2DU0A 4NRQA 5FPZA 3RFRA 1LENA 4CCDA 1W04A 3NVCA 5AVPA 2XJSA 5FMOL 1ND2C 1DLCA 3QLQA 1LKNA 1QMJA 2ZA9A 1Y3TA 1X33A 2ET1A 3DN7A 3LE0A 5BY5A 1ZREA 1N1TA 2DUOA 2JIJA 4J1WA 3S7IA 4NPMA 4FTSA 1BLZA 1PMIA 2AREA 1UY0A 5FPUA 1RUJ1 3OEBA 3AP9A 1KXGA 3WNNA 4OHYA 1E57A 5IW0A 1RHI3 1LHUA 4Q4Y1 5A7OA 4RQPA 5BNPA 1RINA 2R1BA 2W08A 3MBWA 5FZFA 2VW1A 2GAUA 1ENXA 4UXAA 4W6XA 2B39A 3RDIA 2LM3A 5LEKA 4MXWB 1G8WA 4EWEA 4FOQA 2WN2A 1WD3A 3WDTA 3PMSA 3FMGA 1IS4A 2DV9A 3PIJA 2VPVA 4N53C 1I1EA 1KRIA 4PDWB 3DYPA 2CDOA 3VZLA 3VBOB 3S5QA 5FQ0A 4UFJA 2IXJA 2VNOA 2L9LA 3OBAA 2RS33 3B94A 5F3GA 5A3TA 3GBGA 1LAJA 1CX1A 1EAH3 5ANNA 1W6PA 3ZFGB 1AR91 5T54A 3ES4A 1XE7A 3IPVB 2XL9A 2WFPA 3AP4A 2LTNA 3BTZA 3M3CA 2UYAA 2JB8A 3UK9A 3LD8A 2VBDA 3N9PA 4LO8A 5DZFA 1H6YA 4CUAA 1A78A 5JOZA 5DAPA 4EWDA 1O5UA 3ILNA 1O5LA 3OG2A 3ITQA 4GB31 4Q5OA 1FYUA 5CVRA 4HSJA 5BXXA 2PHWA 1WW4A 2VL4A 5A3PA 4PIZA 3JD73 1V6JA 4A42A 4GMP0 4XQ4A 2XKPA 4Q4V2 3SKJE 2LALA 3FUOA 4Q0QA 2ZGPA 2J1TA 3DCQA 2EXHA 3JBG2 4BDVB 3UETA 3NRUA 1GZWB 2PHTA 4CDXA 1OF4A 2YGLA 5FZEA 2CHHA 2WNUC 2PMWB 4N9HA 4JC1A 5DAQA 5FUIA 1CIYA 3ZSKA 2A5ZA 5FYBA 4FFFA 4LNVA 2D6PA 3EQEA 2VC9A 4FXGB 1WCQA 3K4ZA 4KU8A 2YY1A 3FHQA 4YW1A 2BGPA 4R4XA 2BERA 5I0SA 4ZPIA 1IGOA 5C5UA 2O8QA 1EV13 2HWE2 4XILA 1E5SA 1Z0HA 4P9JA 5I93A 4GMP1 4JTNA 2R49A 3WQBA 1ENRA 1L3JA 1LGNA 4HKWA 3EYPA 4GWIA 3POWA 2WRAA 1V00A 5IUQA 2JENA 3DPRB 3PUHA 4IEXA 2C4XA 4LK7A 1N1YA 5EP9A 2HKXA 4RGKA 5BNQA 2VOVA 5F5QA 1R083 3JQXA 1AR63 5AFBA 2GC3A 2RJKA 4XF0A 2BBVA 4M3CF 4A3ZA 5C71A 4Q0UA 1P8JA 1D4M1 1NLSA 5FYSA 4YFWA 3K2OA 4CP0A 5FP4A 4A7YA 3UGFA 2XVKA 3HQRA 1AYM3 5JCTA 5FZ4A 2IVIB 4OQ8A 3OJBA 4JGYB 2RS51 4CDWC 1OOPC 1ZNPA 2BVBA 1NCRC 2P3KA 3AP7A 3RSJA 2BFUL 4RGGA 4QXCA 3UGGA 4QQPA 2ZZQA 4D94A 1C5IA 4I3GA 4O65A 5T3NA 4A7KA 5FLIA 3BCWA 3W59A 2YU2A 1DYKA 1ZBE2 1B09A 5T5OA 4DRRA 2JD4A 5FXWA 4ZKTB 1DG6A 1RHI1 4IETA 2R16A 1B35A 3A0KA 2VQAA 4P02B 1N1SA 2HWD2 3D3AA 4IQPA 3T3YA 2D93A 1PMHX 4C8DA 4FPKA 4LXLA 4XDOA 5FKBA 2VVEA 2RMU1 3UGHA 4YW2A 5HBAA 3ZX7A 5GLUA 3T1LA 3FLTA 3LCPA 2I2SA 5F37A 1ZZCA 2JEMA 4YW3A 1WW5A 3RNSA 5F5AA 4INDA 2X53S 2GU9A 5JOYA 4QDQA 3GJBA 2RS31 3IDAA 3HEIA 4CPBA 4MUVA 2EIDA 5L9VA 1ND2A 1LTEA 4YVWC 3EXUA 4EWAA 3KV5A 4OZOA 1HXS2 4OQ9A 4AHZA 2RVAA 3MDPA 2HEYF 4BMBA 5IYYA 1DCSA 1SFNA 1UIKA 5IK8A 5LBBA 5DAXA 1S1AA 5FREA 1JHNA 1OURA 3KVAA 1CJPA 2AGSA 2RM23 1OUSA 5LA0A 4M0HA 4AW7A 2XXZA 3G7DA 3HQXA 4QX1A 2BUKA 4CCCA 2QKDA 4LJHA 5LBFA 4AVTA 3LA3A 2FMDA 4AFAA 4FPHA 4HT1T 4DRVA 2JX9A 4N53A 4BCUA 3F95A 3S6PA 1X9PA 4LITA 3T4VA 4MH0E 2O14A 1UN1A 5D8AB 2D3SA 5DQ0A 5LBEA 3SQOA 1H2MA 1QXRA 1HIXA 4MZUA 4LOTA 1I6XA 2B9VA 3OSDA 4AFBA 3NNFA 5ACA2 1JZ3A 1RUI2 3H8XA 1OF3A 5EPAA 1EV11 4JDOA 2Q30A 5DAWA 3THPA 1MEC3 1Q8PA 1VRH3 2GALA 5FY7A 4CP9B 2A3WA 4ASKA 2VCMA 1PO23 2AEYA 4DPNA 4AI1A 1RGSA 2VZSA 1ZRRA 2D6KA 4QKBA 4IUGA 3VZMA 2NQYA 4HMZA 1F31A 5LATA 2WLQA 3AMQA 1VBA2 3T0BA 4IGPA 2VCCA 3DV8A 3GXUA 3H8OA 2NN8A 1LGCA 3ZFFA 1AR61 1SLIA 2B42B 5FZ9A 1GOHA 4Q0SA 2D5HA 4XCBA 5GJ6A 1QXPA 2ET7A 4CE8A 2R041 1AF9A 1LECA 5FIXA 5JOXA 4UW6A 1PGSA 4ITCA 4ISRA 4ZXKA 1LU1A 4CPBD 4FFGA 2BDRA 4LORA 4E8DA 1HRV3 4TN7A 4RSUA 4XHXA 3HN1A 1AYM1 4XFHA 4FTEA 2CWMA 2G4IA 1VBE2 2K0GA 5I91A 1L7LA 4CU7A 2D6OX 1RUF3 3WXPA 1YHFA 3O1RA 2VQTA 3E5UA 3FLPA 1NQJA 4QM9A 3T08A 4NPRA 5KBFA 5JXJA 5IHRA 5CAZA 1NA1B 4E8CA 1QH6A 4BA6A 4CZSA 1UOJA 3CO2A 5JXIA 1DQ2A 3USUA 2DF7A 4ORFA 4NIIA 3E1F1 4PQ9A 2ZHLA 1XU2A 1YYNA 3T4HB 3I2OA 2WT1A 1O4ZA 4JZRA 4QKDA 3VD4A 1RUD2 3K46A 3OBRA 3VBOA 1H1MA 4AL9A 4UYBA 5AC92 3U4XA 3O0VA 1URXA 3TYJA 3K3OA 4AR2A 4KNCA 3WG1A 1Q3EA 5FZ1A 1O59A 2EIBA 1SZBA 5F6KA 4CDUB 3ZIWA 3KF5A 5LRRA 5GM0A 5EJ1B 3NKGA 2H6CA 4UF0B 4BYYA 4MHRA 3B9IA 2QVSB 4BPZA 4FPOB 4IEZA 1OOPA 2WFF2 4CDQB 1NCRA 2LW8A 4DS0A 4Q0VA 3WVJA 5GLWA 2ZAAA 5A1LA 1AR73 1QJU2 1CJDA 5C9AB 1PGW2 4RA0A 1WMDA 2VMEA 3ABZA 1MZ5A 4DUXA 4AQTA 4IE0A 3AZYA 1MS0A 1GANA 1QOTA 4COUA 4B3NA 3I7DA 4QDRA 4N90A 3ZFEB 1SDWA 2ZEYA 4KQ7A 1AX2A 1W6OB 1AX0A 3OYWA 4XAEA 4UW4A 1BBT3 1YO8A 2FZ1A 1QDCA 4LHKA 3VN4A 3ZXDA 1PIV2 3INAA 4WVMA 1Q8OA 1OHFA 4RR3B 2XL7A 1PK6B 3HAGA 4TWTA 1PO13 2RHPA 2ADEA 5FJKA 1ZRFA 4K20A 4B7EA 5IVFA 1PM7A 2QQKA 3PNAA 5FZOB 5A33A 3IWZA 3BUCA 3WNPA 4E27A 4LKEA 2PLV3 5HCHA 3DPRA 3SEEA 4BWOA 3OGJA 4CCMA 3NO8A 4XDPA 5FAXA 1A34A 1JOBA 1S0FA 4OLLA 4YVWA 4KG8A 1K42A 1TQ5A 3CJIB 4AQ2A 1MEC1 2R062 1VRH1 2QQJA 4A3XA 2W91A 1F15A 4AI3A 5M0TA 5DUXA 3S57A 5A7PA 1PO21 4OI1A 1YWKA 4WM8B 3ROUA 3T30A 3IDBB 2H0BA 4XPVA 1LOFA 1YIFA 3PTRB 4JX0A 4L2NA 4A6OA 3VBSB 4LPLA 4AQ6A 5I8SA 1XJAA 3R4DB 1JYIA 5L73A 1XYPA 1K3IA 1M06G 2WNVB 4JGYA 1GNZA 1RUG2 3SH5A 1XNTA 1GP6A 4BHPA 2FDKA 2Y34A 3N7LA 5K8SA 1HRV1 1ASJ2 1UD1A 2IFRA 2MHFA 4N43B 3WCRA 4XTPA 1S2BA 2VD7A 4I01A 3ZDVA 5A70A 2ZEZA 1SLLA 3KV6A 1COV3 1UQXA 2R072 1BQPA 2VMDA 4FXKB 1YFWA 2JG8B 1RUF1 4Q8KA 3IAQA 1PVC1 2QQOA 2OUHA 4RFRB 1I3HA 3UJOA 4Y1VA 2V4VA 2R32A 5LY1A 1NAEA 1AL23 3VDCA 1KS4A 2WSUA 1UOGA 2E53A 4IEWA 1ZRIA 5FYVA 3A22A 3N7JA 4L11A 5LZ6A 1PGL2 5HV0A 4AFDA 2VCAA 3N7MA 4B4PA 2FDGA 1D2SA 4E4SA 2YUEA 2W5FA 1AYN2 4QPGB 1XBFA 3ZN6B 5DPNA 4Q4W3 1JZ7A 3SCHA 4M01A 1BEV3 1C8M3 1HRI3 3VKFC 2WZ8A 3WX5A 2WDBA 1DP0A 2E9QA 4MYEA 4JDNA 5IAVA 3R6SA 4XW3A 2DU1A 3GALA 1ZVFA 3S7EA 1YFXA 3HPNA 1VBC2 1YFUA 4Z82A 1Y9GA 4OUSA 3RYPA 1O7FA 2DUQA 5FOJB 3LPFA 3FX3A 2XHNA 2FHRA 1O8PA 2KM2A 2QCSB 4IEVA 4LBQD 2DCKA 2ZGTA 5F9TA 3WHUA 4OHXA 5LA1A 2V5DA 3KHCA 1SACA 2VU9A 5LB6A 1UKRA 2P3IA 1MQTC 1AR71 1JUIA 3KD4A 3FE5A 4XFBA 4NHKA 2DVGA 2HYXA 1HJGA 3RWKX 1U5YA 2J1AA 5FP3A 3TOJA 1W3VA 3UJQA 1W6NB 3DUIA 3MV01 1X7NA 4LBOA 5F6LB 5HXMA 2X09A 5ABJB 4C1WA 1OA2A 1RUH3 3B00A 3OTFA 4GKXA 5BNNC 2WT2A 3V0BB 5G04L 2XKOA 3R05A 4KWJA 3C7EA 3O1MA 3C7FA 1XE8A 1BBT1 1D0GA 4AVBA 4GXLA 4EN9B 4PQQA 1LU2A 4LO6B 5A7QA 4LUMA 3N9LA 1DQ5A 2PA7A 4Q1PA 1OD5A 1FT9A 1BZWA 1NCQC 3MLJA 5DDJ2 1QHDA 2WSVA 2DURA 4W6WA 3K77A 5FBJA 1S0JA 5FYZA 1AR81 2GP5A 3ZYIB 1SG3A 3ZXGA 1HV0A 1CAXB 1FMD2 2D97A 1YLLA 2PLV1 4V1PA 2WQ4A 5FYUA 5FZBA 5IVBA 1DGRN 3CU7A 3GDBA 3KMHA 1XNDA 3T1MA 4FOVA 5C4WB 3POIA 2ERFA 4XETA 3THTA 2RE9A 2DUPA 1NYWA 1R64A 4AEKA 1RMU3 2CGNA 2DVFA 3NNGA 4LR4A 3P3NA 1F9KA 1YI9A 3VHRA 4JV4A 4RS5B 1JOPA 4R4ZA 4LOSA 2FCVA 1T6BX 1QJZA 1MACA 3MPBA 3A7QA 4ZU5A 3O1OA 3RJRA 1H0BA 2HWF3 2ZJCA 4AGVA 2JDZA 2GZWA 2HJIA 4RQPC 5GZCA 3WDVA 1NA1A 2W94A 4DNYA 4GALA 2KXLA 1COV1 5JZGB 2W9XA 5IVVA 4LIUA 1JH5A 1ULFA 1US3A 1XXNA 4XJ8A 3LDKA 1SCRA 3AC0A 3DKWA 3NJYA 4SBVA 1J59A 3NW4A 1W6MB 3J26N 1CR7A 2B46X 3MLKA 2PHDA 3OD0A 5FYCA 1SQ4A 1AL21 5JIUA 5JXGA 2R6QA 3K3NA 5LASA 1H8VA 4WZFA 1QJY2 3DXUA 3LEMA 4TLGA 2FCTA 3B3QE 3GHNA 4EN0A 3P3PA 4XHBA 3NJXA 3FC0A 1NE6A 1X8EA 1UZ0A 1H8TB 3AJYA 3WNXA 2YBPA 2VTFA 3M3IA 4UW3A 4CDUA 1LHVA 5B4XA 4Q4W1 5C6CA 4JHTA 4NPLA 4CTEA 3TRSB 4CVUA 4UF0A 4W8JA 1BEV1 1C8M1 1HRI1 1J3PA 1JN2P 2BV4A 1VB4A 4NHXA 3PHMA 1Q8VA 2ZCWA 1RUE2 1RC6A 3J7NA 4P9IA 4NWVA 4Q1RA 1BK0A 4OMDA 4FP2A 4Q4Y3 3LDBA 1NE4A 3FLRA 3OOXA 2CAVA 1S55A 2P34A 4H7MA 4PIYA 4CEYB 5FO9B 2WWSA 5L9RA 5A7WA 4D0QA 1XSQA 4BIFA 3MICA 4QX3A 5TSWA 2NP0A 1MS1A 1UZYA 1JU3A 3H1YA 4J25A 5ISLA 3HR9A 2ORZA 4QKNA 4OHVA 1RJ7A 1WWYA 2P5BA 3ZSEA 4E2QA 3RMXA 4Z8BA 1JYXA 1YEWA 1F5FA 2XWBB 2ZKNA 3DKQA 1QNYA 1X8MA 3AMMA 4M3CE 4K7JA 3OGRA 4FTBA 2I74A 1PX4A 3GHMA 2XONA 3NV2A 1RUH1 4RR3A 5EWSA 2XWJB 1PK6A 1CZTA 5K0UB 3PU3A 5F3CA 4Q4V3 5KXBA 1X50A 1QU0A 5FKCA 1AZDA 5FZLA 1VMHA 3NMBA 3AFKA 2DVAA 2UY8A 3I3DA 4D7TA 3LIHA 3JBG3 4JQTA 4IL7A 1D0HA 4Y1YA 4D7YA 2BP6A 2OS2A 3ZSJA 3C3VA 1PZ7A 2VG9A 3POEA 4GB33 2Y0OA 4QPIB 3HBKA 1WW6A 2CL2A 4K21A 4M4RA 1IHMA 2D44A 2ZGNA 3K48A 4IV1B 4LO5B 2QZ2A 3POGA 3RYKA 3C7HA 2WS91 3J7MA 5GLZA 5HI0A 2MEV1 2HWE3 4FP3A 1A6CA 5JWPA 1BMV1 3OPWA 2VUAA 2W1SA 4R9CA 3VBSA 1POQA 1ZM1A 2ARBA 2Y60A 3D0SA 3LOIA 3WDWA 3PVNA 4FPFA 4B4RA 5E89A 4BMEA 2AZ5A 3ACIA 5T55A 3P1IA 3RZZA 4QX5A 2A6WA 1L7RA 2R1DA 4TZDA 1NG0A 2O8OA 5FXZA 1YQ8A 4XBQA 2WNOA 2Q8DA 2SLIA 4E4DX 2OA2A 5CZKA 1LB2A 4HKLA 2YBSA 3WQ1A 4OYUA 2ZGUA 4AVSA 2W0XA 5L7OC 1WCKA 2HWF1 3ZMOA 4B4QA 4GH4B 4XF1A 5IFTA 1NCQA 1ZYBA 1B35C 5EHDA 3RJ2X 3MV11 1BCXA 3KGZA 5FMBA 5KXEA 4CUCA 3VDBA 4FCAA 4TXWA 1UYXA 4AHXA 4CP2A 4D7SA 1ZRDA 2VM9A 4MLOA 2KR2A 2NMOA 2CTVA 2YROA 1UNBA 1JU4A 3VD5A 2VUDA 3AL5A 5C70A 4QPGA 2VZ3A 3ZYGA 1W2UA 3ZN6A 3A23A 3AKRA 3MW3A 3WP3A 1K12A 1V6OA 3KV9A 3KHBA 5FYMA 4CCNA 3TAYA 4D8MA 5IK5A 3GCWA 1QKQA 2VQ0A 1KJRA 1GQPA 4YVSB 3ZYPA 2OUJA 2AACA 1Y9MA 1H9PA 3IKWA 4D6SA 1Q5OA 2A73B 2QTWB 1GFF2 2IUWA 5DMYA 3W58A 2HWB2 5CFDC 4HVQA 4D6RA 2IZWA 4NRMA 1KEXA 4OCTA 5FCCA 2ZEWA 4HN0A 1SLCA 5K4LA 2EXIA 4YM2A 3J7HA 1H2LA 1ZA7A 2WBKA 4PIXA 2RS12 5J3UA 1IZ3A 1ENQA 2ZGRA 2VNRA 3TN92 5C8CC 1W6NA 1H9WA 2RMU3 1VP6A 3CNAA 3N9MA 2RR12 5ABJA 1FXZA 1HB1A 2K46A 3N3HA 4JGZC 4XMAA 3V0BA 2P3YA 3VBUB 4AEDB 2A1XA 3IAPA 4ZZ8A 2EIEA 1D4VB 3Q8FA 2BPA2 3C7OA 4XJZA 3WF1A 5KXDA 3CF6E 1KFUL 2E7QA 5FY0A 1DQ4A 1CONA 2HWC2 5LK5A 3S30A 1GR3A 2WC2A 3KS7A 2PAEA 3KCXA 5FV3A 5J98B 5T5PA 1FAYA 4Q4V1 1FOD2 2Z79A 2A3XA 2W46A 2B9UA 4YZ4A 4L92A 3KB5A 3QOPA 4KGQA 4BISA 3JBG1 4Z2WA 1CAXA 3KGLA 1GP4A 1BVVA 3VHPA 5FWJA 1RUJ2 2UY9A 1MZ6A 3E6DA 4MGIE 2XQXA 3ZFFC 3PURA 2YPJA 4WM7C 3FBMA 3SEPA 1LR5A 4PHZA 5ACA3 2HH9A 3B93A 2OW4A 4XCAA 1RUI3 2RJLA 2DCJA 3UL2A 1CX4A 2HWE1 4QB1A 3SKVA 3WNLA 4O9GA 5KWRA 5FTTC 3J7LA 5F3EA 3BU7A 5CG9A 2VMGA 3BOPA 1ZZ6A 4RS5A 3VB9A 5C3PA 3OPZA 5CB7A 1ZZ7A 3KVBA 4LLFA 1QJEA 5CBLA 1GICA 3WLUA 1YC61 3OD4A 3TBDA 1V6IA 1VBA3 4L9BA 1MPXA 1HKDA 2R0FA 2Y33A 1W6QA 2W1UA 3B7MA 5CU1A 4FPJA 5HCBA 4DXTA 2WZEA 3KM5A 1OH3A 3HWJA 4AF9A 4LE4A 3WT3A 3WG2A 3CZUA 5L9BA 4QX0A 2JG9B 2JDUA 1MS4A 4L97A 3DXTA 4PDWC 1W6MA 4SLIA 1VBE3 3LQCA 4OI0A 2DYCA 4QM8A 4JKMA 3T2QA 3VBOC 1IKQA 4NR1A 5F2WA 5FK8A 5T5LA 4XE9A 1PZ9A 1JW6A 2ZACA 3MF9A 2HYKA 2JDHA 2R043 3PJQA 4MHUA 4PF5A 3R4UA 4FQZA 2DCZA 4N7UA 2XJRA 4YZ3A 5FLJA 3TNQA 2XJUA 3ZFGC 5EJZB 2VAUA 4ZY9A 1RJ8A 3HT2A 2BOJA 1ZBE1 3GZTB 5FYTA 1OUXA 3OGVA 4COVA 1J84A 3UKNA 4YRDA 5CIRA 2IXIA 4LKDA 4Y5Z0 4MGTA 2PHLA 4HL0A 1UU6A 2HWD1 5AC93 4HSLA 4A7ZA 1DBNA 3MEPA 4ZU4A 2P17A 4GD4A 4QT6A 3MW2A 2Q8CA 4MGKE 4XQWA 3SLIA 5L7OA 2W39A 2BJSA 1BKZA 4H55A 1YQ5A 4XBLA 5H9QA 1UAIA 3DL3A 3ILFA 4K9SA 1OQDA 2WZR2 5FZ0A 3ZYFA 1IS3A 3CQOA 5IK4A 3ILRA 2V73A 4NROA 1W28A 4XZPA 5FXXA 4DZGA 1JS9A 2EALA 2QQWA 4K1YA 4CCKA 1JTZX 2C24A 1HXS1 2A6ZA 2ZEXA 2Z2SB 1UIJA 1W99A 1QWRA 1GZCA 4AFMA 4QGNA 5K0UA 2XH6A 3JU9A 3I8TA 2OT7A 3VKNA 4CXXA 3SISA 3ETPA 4IESA 4HVOA 2XR4A 4NO4A 1H1IA 2BRTA 4YGCA 4CEWB 3AKPA 2JDNA 5CEHA 3V0AA 4P00B 5FOBB 2DDUA 5FFOC 1S2EA 5BUVA 3VBHB 3HMYA 1EP0A 3DPRC 3ZOIA 1WA4A 5DZGA 3JUUA 1V70A 1IG0A 1OLMA 1R092 2PHUA 4QPIA 5HXVA 4BQYA 3I3MA 4E4HA 4TLFA 4HVRA 4IV1A 1IKPA 1PIV3 2XHKA 3ETQA 5FLHA 3WP4A 4F7ZA 1G9BA 3FJSA 4IEQA 4EJRA 3AL6A 5CFDA 2R30A 1REEA 3KCCA 4B1MA 1CAVB 1LOFC 3I2DA 3OUJA 4IV3B 1I5ZA 2ZX0A 1ZZ9A 1XOYA 1DYPA 2PAKA 3M7AA 3SHRA 1RVF2 4BQ5A 4E2GA 1RUOA 4I2OA 1QQP2 3O12A 4XJ9A 5ACA1 2UURA 4JGYC 2BVVA 2XDVA 1RUI1 3N9NA 2B8MA 5C8CA 3H50A 4M0NA 5D2AA 5A7NA 3U1XA 1MS3A 1V6MA 3UT0A 3LOBA 2VZTA 4AZZA 3WF2A 2RDNA 3W9AA 4JGZA 1ULDA 1CQ9A 2VOXA 3WW2A 3Q9OA 2JD9A 3AZZA 3WSOA 4DO0A 3S5AA 4FPGA 2IXKA 4UFHA 3SH4A 5CISA 1IS5A 2VZRA 1WA6X 3AVRA 3O1PA 2YG0A 4N7IA 3RZMA 1VBA1 3CMGA 1UMIA 4Q8LA 5DUUA 3MHZA 3TEZA 1EAH2 3RPQA 3AYEA 4CP1A 1JBCA 3JQWA 2V09A 2IVJA 2Y0IA 5FMDA 1DYOA 1W8WA 2JE7A 3AK0A 4A4AA 2ZZJA 2GNBA 4MVTA 5AFEA 5BNOB 2XQRA 4UAPA 2JE8A 2MPFA 5BYNA 1ASJ3 1QXJA 2BTVC 4YW7A 3J8F2 5FUNA 4LA2A 5DZEA 2OXBA 2Z42A 4WVZA 4BK4A 1VBE1 1V0AA 1Z7S2 2G9FA 3H8UA 4Q0PA 2CGOA 1W90A 2D3RA 3LFMA 2W2IA 2GNMA 3OY8A 3GZUC 4WM7A 2VW2A 3JD72 3A0NA 1SFPA 1K5MB 4NOTA 4EYUA 3SH3A 4UFMA 3VD7A 4QX2A 3AXEA 5C3OA 3VL8A 2W3JA 3PJYA 2P2KA 1FI2A 5FPLA 3R4SA 3ZR5A 2DBNA 3AB0A 4J1XA 1PVC3 2V4AA 4Z1VA 4Y4RA 2HEVF 1AYN3 1S0DA 5GLVA 1RUD1 3M3EA 3ZIXA 4D3WA 4EV0A 5AC91 3SXWA 2I45A 4PCRA 4ZS2A 3AZVA 1CPMA 2VH9A 3UV9A 3ZKYA 4EN6B 4PI2A 4MXWA 1DZRA 1PVXA 1YXWA 3IIIA 4CCOA 1LHWA 1VBC3 1AXYA 1EY2A 3J4UH 3VZJA 3TEWA 1W2NA 4UW5A 4C0HA 3FHAA 4CXWA 4PDWA 1SBEA 1W9SA 1BHGA 3RRDA 4AEDA 2P1BA 4M3CB 5D8AC 4I3PA 3VBRB 2OX0A 2VMFA 1R082 2WFF1 5GZGA 2B7YA 5EIYB 4HK9A 5C33A 4YW4A 5FWEA 1FNYA 2E63A 5L19A 1W9TA 5JR2A 1GSLA 1A8MA 1PGW1 1J1LA 3I3QA 3ZFGA 4BQ4A 1Q8SA 1N3PA 4ES9A 3IPVA 5JDBA 1ND3B 2XLFA 1ODMA 1PZ8A 2XPJA 1G86A 3VV1A 3H3LA 1IQDC 2J22A 1H4GA 5FPBA 3WOGA 2JIGA 3GZAA 1QDOA 3D82A 3Q8CA 4OFGA 1JZ8A 4UT5A 3RZGA 4IW3A 1TMF2 1BJQA 4DIQA 1W2TA 1VBB3 2J1EA 5FP9A 4MSVA 3MF6A 4AXOA 3TEYA 3EHKA 1PIV1 3O1SA 4YGDA 1NUKA 4DXSA 4XF3A 5E6HA 3EJKA 1OD3A 1DGWX 5LK7B 2VTXJ 1HB2A 2QDNA 4JQRA 5I0DA 1GZWA 3AJZA 2ZGLA 1QNWA 1NXMA 4HZFA 4QPYA 4FOYA 1FMD3 2QQUA 4IGQA 3PU8A 1IQAA 4FVVA 3AMHA 4Q4X2 4QU2A 2UWAA 3GZEA 4KH9A 3VZKA 3NL1A 4R52A 4Y1XA 5KHHA 1W8UA 2QZ3A 1LEMA 1IPKA 5C7GA 1ZRCA 3QACA 4XJAA 5FY1A 3VBFB 2R061 1LGBA 3FWEA 2A70A 3KT1A 4IEOA 3APBA 3KZ4C 1NA1C 2IC1A 4BIOA 1AR83 2BWCA 4JKLA 5CKQA 3VZNA 1G9CA 2J1UA 4HLTA 3ASIA 1TG7A 3DECA 1U12A 2RJ2A 4YWAA 4NIGA 3AKQA 3T0AA 4KWUA 3WQ0A 4PT6A 2ADDA 4P08A 4OUEA 2R7EB 5CFCB 5I8TA 4PI0A 1XU1A 1W8ZA 1DGLA 3JB4C 3HN3A 4HN1A 1ASJ1 1TZOA 5FZAA 3WNMA 1H2NA 4BQ2A 3BI3A 3LSEA 1W0NA 3D4KA 2DFCA 2RM22 4HANA 3WY6A 4CDUC 1EPWA 1N47A 4DY3A 1H2KA 1GU3A 2WT0A 3WW4A 3VGIA 5A3WA 1RYYA 3DEMA 4HPKB 3ZSLA 3NJZA 4ATEA 4CDQC 4EQVA 3HT1A 4E9KA 1REDA 1H4HA 3IT8A 1LEDA 5CKNA 2JDPA 1GWMA 1C3HA 1LOAA 2VTXA 1QJY3 3DGTA 3CZJA 5CA6A 3M3QA 5C9AC 1PGL1 1DF0A 4DY5A 1V9U2 5KC6A 2AEZA 2G1MA 2IXCA 1GMMA 2QUOA 5DG1A 5CADA 2XMLA 1AYN1 3I59B 4Y1UA 3ZFEC 2D43A 3BIEA 2WINB 3WHTA 5DN2A 1DZQA 3ATGA 4FO9A 4YZ2A 3HNMA 2IFWA 2WUHA 3M3OA 3ZDSA 5F39A 2ZMLA 1MEC2 1RXFA 2ZGQA 2PYTA 2G9GA 2XJQA 1DIWA 1FV2A 3N9QA 1RUE3 2VULA 1V6NA 1DHKB 1VBC1 1REFA 4KL1A 4OI2A 4OULA 4RR3C 1YJLA 5DG2A 4ZS3A 1OMIA 1PK6C 1XNBA 5EV7A 3LKJA 3H7YA 2ETEA 1YIPA 5IVJA 1DGRA 3BVCA 4QHOA 4DB5A 5FZIA 4YG0A 1APNA 4LBQB 4IEPA 1LESA 3RQ0A 1DLLA 3VLBB 4CEWA 5FPXA 1DGWA 3BTAA 1OFNA 3VBHA 2FD8A 3FFZA 3ZXFA 4NHYA 1GOGA 2WR9A 2GH2A 3CJIC 1STMA 4LBLA 1HRV2 5H9SA 2I07B 3D6EA 5A32B 2YFZA 3WW1A 3ZLIA 4C91A 1RUF2 4EN7B 2VZOA 1J1TA 1DFQA 1POV3 4R9AA 1VBD2 1CVNA 4WM8C 1O3SA 4QHBA 3OEAA 1CAVA 3HNYM 1NKGA 2CNAA 3I54A 3RVHA 3VBSC 4KBBA 1RIRA 1VBB1 2GC0A 1XNAA 4P9YA 2YDEA 2P37A 4QB6A 5JXHA 1XQNA 4H3WA 4P9LA 4V2VA 2WNVC 4XF4A 3MFCA 1W8HA 5DDJ1 5FRAA 5G05L 2GSYA 3ZO0B 1WMEA 1I5PA 2GH8A 3VKLA 3ZVXA 2HEWF 1TVGA 1ZX5A 5HCFA 4N43C 3KCYA 4IGOA 4JRAA 1VJ2A 1FMD1 3U14A 5D8AA 5J37A 2Q1ZB 2JG8C 5E88A 3T2PA 5K7PA 4A45A 5FZ7A 5FUPA 4K6BA 1K5JA 5D21A 5T52A 2D6MA 5BNPB 3J9SA 1MVQA 4LT5A 4HOOA 1M4WA 1JI6A 1S0BA 1F4HA 2CYFA 3M8LA 2QQPA 3BTYA 3GCXA 1ENSA 3ZKUA 3PIGA 4CP9A 1OPOA 1OA4A 2WS93 1R1A2 3K4AA 4YM3A 4Y20B 2EXKA 2YC2A 2Q4SA 4CU8A 4GWNA 4V2WA 4F8AA 2FQPA 2FDHA 1YQ2A 1QEXA 2MEV3 1ZA4A 2VGDA 4XF9A 4K8FA 2OIIA 4XUQA 5LBCA 2ZHMA 2ENRA 4QPGC 3PL0A 1GNYA 4UBHA 1HN1A 2BW8A 2FMYA 1SLBA 3NNLA 1UF2C 1NXD1 4AI9A 3IMNA 3LGRA 1XPWA 2W1QA 2ZGOA 2X29A 3SNMA 4FPYA 3VHNA 2P6HA 4KWKA 1W6PB 1Q43A 1YQ6A 2A6VA 5C8WA 2ARXA 3Q8EA 4AEJA 4NAMA 4YNIA 4AWDA 5JZGC 2V72A 2J7MA 1RUC2 1ALYA 1GUIA 1C57A 1WCUA 5BPXA 4NE9A 2DFBA 4GZ9A 2ZABA 2Q1FA 5FZKA 4LKSA 2VQUA 1MVEA 4F83A 5LWBA 4X8NA 3ES1A 2F4PA 4I02A 3T2OA 3VHOA 1UYYA 4TTGA 2XB6C 1PO12 3B02A 1QJY1 3PUQA 1CESA 3LWCA 2CAUA 2OQ7A 3RMYA 2VBBA 2ORXA 2JXAA 4LKFA 5ABJC 1UW8A 4CDXB 4BU2A 5HCAA 5GKAC 4MG2A 1LOGA 3G6JB 5JUVA 4RGAA 1J58A 1JOJA 1W8NA 2HBUA 5DUWA 1JYNA 3MYXA 3P6BA 4H14A 1WBLA 2WAOA 2X10A 3F2ZA 3LA7A 4KMQA 1RUE1 1POV0 2VUJA 3CJXA 5IATA 2X5IB 2FCUA 2VJXA 3RI8A 1MS8A 3IB3A 4MADA 4U36A 1ND3A 3ZN5A 1KJLA 4ASLA 1QJX2 1W8FA 3RWNA 1VAKA 4DUVA 3C2UA 2A6YA 3AFGA 3TEXA 3ZXAC 1QY4A 3KT4A 2WJSA 4QU1A 4CDQA 1JZ5A 1Y7BA 1RTVA 5J48A 2YC0A 2FZ2A 4LBNA 4FPCA 3L2HA 3NAPB 4Z2AA 5C9AA 5C4WC 5SV8A 2XLAA 2JDAA 3BB6A 4QGMA 1COV2 2BYVE 4JCKA 1OFSA 1JYCA 1WLDA 3AXDA 5IJRA 1POV1 3I3EA 4ARYA 3NJVA 3BN6A 4ZONA 3ZFEA 4LTAA 1W6OA 2VUCA 4R9DA 2D6NA 2PXJA 4RS5C 3ELNA 4E2SA 1OXCA 1TE1B 3BODA 2A3YA 2YYOA 3UKVA 2P3JA 3ZXLA 1JZ4A 1J83A 3I2IA 1ZBA2 3URFA 4AHWA 2FBEA 3SCGA 1GV9A 5LEJA 2B4KA 3ON7A 2RDRA 2ZOEB 2C0ZA 1MS9A 4QPWA 2UWCA 1CD3G 3VBFA 1SBDA 4NIDA 4DXZA 1JYVA 1IPSA 2D6LX 2WL1A 4QXKA 3AKTA 1OPMA 3LDRA 4GIQA 2ID4A 1DZTA 4LHNA 3WD5A 1ACCA 3WQ7A 3JCIA 5FZOA 4BM8A 1GOFA 1KQRA 3O5SA 4YGBA 1GKBA 1PNFA 1BEV2 1UOFA 3LA2A 3V64A 4W65A 1LULA 4S2HA 1OQEA 2J42A 2EVXA 2W68A 5FPAA 1E5IA 3CJIA 3T2TA 4YM1A 4COWA 1D2QA 4IE6A 1SPPB 3PVBB 1NX9A 3X29B 3VDDB 2XBO2 4WM8A 3H0OA 5APAA 5LW9A 2UYBA 3H9AA 4FQ4A 5F1RA 1H8TC 5FYYA 5KHKA 4HXCA 1UY1A 4OUMA 3BIWE 3KV4A 4X6QB 3RS6A 3M1HA 4Q2FA 4QAWA 3OGSA 1E5RA 2WNVA 3NNJA 4UFIA 1UU5A 5A6ZA 3RZJA 1AX1A 1ND2B 2GMEA 1LOCA 4LLOA 5JMCA 3WINE 3O0XA 1SLTA 1I9RA 4N43A 4QXHA 4X6RB 3ZSMA 4B1LA 1W8OA 3NAPC 3GYDA 2TUNA 4HETA 3PLQA 4CEYC 4L0PA 2JG8A 5FK7A 1JZ6A 3JB8A 3WDXA 4ATFA 3I59A 4O7XA 2RG4A 5FY8A 4LK6A 1JUHA 1JHJA 3Q8AA 3O1VA 4S2GA 2JDMA 1RUNA 2QBXA 4FAHA 4GKYA 2ZS6B 3MIEA 1AUYA 4I0BA 4CCEA 1LRHA 4RHV2 5FDBA 1LHOA 2Z4FA 2W52A 3I2GA 3PDQA 5AVAA 2WWJA 4N53B 2BWAA 1QOSA 3ST7A 3HBZA 1OVPA 2XUMA 1SMVA 2LUWA 1VPHA 3I2JA 5F3IA 2Q1MA 1SFYA 2HWB1 4LULA 1BMV2 2BEOA 1TME2 1SHWB 1ZBE3 2QNKA 4Y4YA 2QQLA 4PBPA 4I0WB 4LBQA 4DEVA 1UCXA 3TWIA 1Q56A 1V6LA 2GNDA 4CCLA 4G4FA 3IIAA 1KS5A 1RMU2 4HBNA 3C7GA 1XNCA 4AI8A 1CN1A 5IK7A 4UFKA 2EAKA 2OZ6A 2Y38A 2HWD3 1NY72 2ZGSA 3BYWA 2RS11 2MNGA 2WZR3 4QPIC 1BXHA 5GLTA 3TN91 4IV1C 5KHIA 2PAMA 2RR11 3M2MA 4BK5A 2F6BA 2C9KA 4K40A 2TBVA 3Q8BA 3U11A 3WP6A 3M4FA 1JYWA 3H3UA 1O3QA 1SEFA 3OBTA 3BKZA 4BQ3A 1BYHA 1XNKA 3I97A 4AE2A 4ET7A 1S0GA 5DAVA 3H7JA 1ULPA 2HLEA 3GBFA 3MIFA 2HWC1 1A3KA 3I3BA 1X9TA 1VR3A 2YHJA 2VZQA 1OKQA 5H9PA 1JYTA 1WMFA 4WVVA 1FOD1 3SC7X 1R093 1HXS3 2YFUA 2WNUB 1QH7A 4A44A 5F2SA 3GJAA 1YFYA 4AG4A 5J96B 2UU8A 3THCA 3WDUA 1FX5A 1FPN2 1SLAA 4GH4C 4YARA 1RVF3 2J1VA 4XVHA 3FL7A 1QQP3 4G3YC 5DABA 3ZYHA 3H1WA 5EZWA 3USUB 4ZZ5A 4Z92B 1UX6A 3E5QA 4I30A 4AI0A 1CPNA 3ACFA 2Y6KA 4Y20A 5FYHA 2OYZA 1S0EA 2ZAHA 1UZZA 3NSTA 3N36A 5JI7A 3RZLA 4Q4Y2 4IE4A 5KXCA 1VALA 2E7AA 1IG3A 1Y43B 2ZX4A 5C4WA 5JLVA 1OC1A 3WNKA 1GQGA 1HX6A 3AZXA 2PHXA 4KBZA 3ZXKA 4QHZA 4YVSC 1JXNA 1AL0G 3OUIA 4OVEA 5GZDA 3LFIA 2JE9A 1VE0A 2GMMA 5FZHA 1UPIA 2QJVA 2E31A 5SV5A 3UNPA 1WBFA 3POJA 4CDWB 1SDDB 1OOPB 3J8F3 4P5YA 1NCRB 1MR5A 4CU9A 4WVWA 5IFPA 2GN3A 2E51A 2HBTA 4YYOA 1YJKA 1Z7S3 2PQSA 5FJHA 4AI2A 4B8EA 3ACGA 2ZHNA 1AJKA 1LCLA 2ZBJA 3WG4A 1AR92 1WCDJ 3DYOA 1UL9A 3MO4A 3CEWA 4NMIA 2ZPXA 5FZMA 3THDA 5C3SA 3S0MA 5EXOA 2D98A 3BPSA 5JZGA 3ALQA 2Q0AA 3DYMA 1AXKA 2E26A 1RITA 2JICA 3LEIA 4QMAA 1RL3A 3LEKA 4NJ4A 1KITA 1TNFA 1UY2A 4YW5A 1NLQA 2Q5TA 5CNAA 2WA4A 3OYWB 4NRPA 2VOWA 3VBUC 4AEDC 1GWLA 3ZXJA 2GC1A 4NWWA 4GB32 1CGPA 2JWPA 1GZ9A 2EXJA 1CAUB 4BLJA 4WZCA 4KU7A 4GAZA 3WNOA 4EROA 3BOWA 4GULA 5A3MA 5JSRA 3GNEA 3POSA 3PUAA 4WVMB 4QWNA 1DQ1A 4LO7A 5JAXA 3UYJA 1U0AA 5FY5A 2YXSA 1PMJX 3QBQA 4Y22B 1WLWA 2JKXA 4Q27A 4URTA 2X5IA 1H8TA 3NV4A 5I0UA 3LIGA 5A33B 1W9YA 5I8YA 2P4EA 4N9IA 1GZTA 1OKOA 1V6KA 2VR4A 3VUOA 2VMIA 3KQ4B 1A8DA 5EYXA 4W4ZA 1C28A 2DBIA 2Z5WA 4XC9A 4PBOA 4E4ZA 1RUD3 5T50A 4FAGA 4YVWB 2O0OA 2ZKLA 4S2FA 2WZR1 1C5HA 3NAPA 1EPZA 3GF6A 3H42B 1HW5A 3IDCB 1WUVA 4D69A 5JSOA 3U37A 4CEYA 2BU9A 3BALA 1OT5A 1ULGA 1UZWA 5F32A 3VKMA 1VB2A 3POYA 3EO6A 4OHWA 3N4MA 1XE0A 3ZN4A 4FFIA 4Q29A 1U5XA 2K9ZA 1XB9A 1XYNA 1G9FA 3IBMA 4KI5M 3SCFA 3MFAA 2ATFA 2AR6A 1MZEA 4YZ5A 2WFF3 2XJPA 5LRSA 4BLIA 2VZ1A 1GBGA 5B2GB 1W2OA 1TMF3 3U10A 1R091 2XVGA 1D4M2 2KD7A 2W1WA 2YV8A 1QF3A 1QJU3 3A21A 4MOAA 1YCIA 2XUEA 5FZ6A 5GZFA 5FZDA 3CBNA 3T0DA 1UZVA 1O4TA 5FZGA 1SBFA 1KFXL 2VVFA 4GWJA 2SBAA 4PLNA 4W6YA 2XJTA 5KR7A 1MZFA 4HG6B 3VL9A 2RS52 5FO8B 1UYPA 2JG9C 4IERA 4QDSA 1RVF1 3HIFA 4N8MA 3ZPOA 5FR3A 1QQP1 4XBNA 5JOWA 4Q4X3 2C5DA 4HKOA 1WD4A 3MI8A 1DU3D 4Y33A 5ANQA 5FZCA 3WEZA 5FY9A 4EZHA 2Y6GA 3EMRA 3MUY1 3VZOA 1SPPA 3CLPA 5C3RA 3ZPYA 1IS6A 1HV1A 3VDDA 1DQ0A 3VD3A 3ZR6A 1S4CA 2BNNA 1GYKA 2C26A 5A3OA 1O3RA 4Q26A 1RHI2 2H0VA 4LA3A 4AGRA 2Y6FA 1CIWA 2IXHA 1RXGA 4AOCA 4DUWA 1IOAA 1EAH1 2QFEA 4QB2A 2WAAA 2RMU2 1SCSA 4M4PA 2BZDA 2R063 3WUCA 4C0BA 1HB3A 5FBZA 1OVSA 5IVEA 1HLCA 3D5OA 2ZTNA 5E8AA 4A6SA 1YNAA 2D7FA 1TEIA 2VMHA 1W9FA 3J8F1 4B29A 3ENRA 4LQRA 2RS32 3LZZA 3SITA 4XACA 4FSJA 1Z7S1 5FMCA 3U07A 1EUUA 1QOOA 4GH4A 2LRPA 1UU4A 4LBMA 3JD71 5I0TA 4AAPA 1J3RA 2CU5A 4KWLA 1RUG3 2ZMKA 4K1ZA 1UXXX 5A80A 1W06A 1WCSA 3I2HA 3BTXA 2ARCA 2TEPA 2G19A 3IDEA 3JXSA 3USSA 3H8RA 3MIGA 5IWFA 1N1VA 2ZMNA 4QQ2A 3PUSA 1H1AA 2R073 2BGCA 4O9EA 1V9U3 1LODA 3RZHA 3W5NA 4CEWC 1S0IA 4NHLA 3SMHA 2Y6LA 3VBHC 5E16A 1WMXA 1O4YA 3MIHA 5IVYA 4AVCA 5LA2A 3E97A 4YVSA 3PTYA 4D6QA 3TNPB 2FDFA 5D1IA 4G9SB 5KHGA 4XFCA 4M00A 5F5IA 4CSWA 1CWPA 4ZU7A 1XSRA 1K45A 1OLME 2WO3A 2BBAA 1OI6A 3FFQA 2PHFA 4OHZA 2QQMA 3C8XA 4XFIA 1QGLA 4IV3C 3OGGA 4XUTA 5T5JA 4AK3A 5A6XA 1G9AA 2A71A 1R081 3PUIA 5I0RA 2VCBA 3QH7A 1EV12 1R1ZA 4XIOA 3OBZA 4XMIA 3U4SA 2FDJA 2RV9A 1KDKA 4NIHA 2WO1A 2JDYA 2AYHA 2D3PA 2Y6JA 4ONUA 4NUBA 1GLHA 4XXPA 4MO3M 2WNUA 3UESA 1HQWA 2VVDA 4JTOA 2VBPA 1Y4WA 1UOBA 3V56A 3V65A 3VBUA 2ZX1A 4AHYA 3VKOA 4BQXA 3P5BA 2A75A 5IT6A 2DCYA 1AR62 1VBD3 5JIAA 4P5HA 3IZOA 2R042 1O6UA 1TMF1 3ZM8A 1W8TA 3I2FA 1QJU1 5K9YA 4XUOA 1LHNA 1EUTA 3MPPG 4PF1A 1IPJA 5A6YA 5A3UA 4JAAA 5L36A 2VECA 3AP5A 3MZHA 1AYM2 4LHSA 1OQ1A 4ES8A 4YG3A 1ST8A 3AMPA 5BNOC 4RFT0 2E6VA 4GWMA 4XOGA 3O1TA 3POBA 3WCSA 4HONA 3E6CC 4Q4X1 3OF1A 3K75B 1OLQA 3B01A 5C5TA 1S0CA 3W20A 1F8VA 2VW0A 1G9DA 3RG0A 1K5MC 2A6XA 5FY4A 5DDJ3 3WF3A 4META 4Y26A 5C3QA 4GJYA 2JECA 3K51A 1W05A 3N35A 2YGMA 5EYYA 1FNZA 2W87A 2NM1A 2NYYA 1ULOA 2C1FA 3HQUA 2IWGB 4JHZA 2PTMA 1R1A3 3O14A 4URAA 4Y24A 1RB8G 4CDWA 3CHXA 1JODA 5JMOA 3H1MA 2RDSA 3HD8B 1Z78A 4MGSA 3MW4A 3EBRA 4DXRA 5LCWL 4RD7A 1U5ZA 1UY3A 1HQNA 4QQOA 1X82A 3AP6A 3WP5A 3T09A 2FDIA 5A7WB 2BNMA 2VY0A 4KGGA 2EAAA 3EB7A 2RM21 1G6NA 2DTWA 3AYCA 4HFSA 2ZXQA 2JG9A 1FATA 2CDPA 4P9WA 2CWSA 1RUC3 2VE1A 2ZX2A 4OMCA 4XFAA 4GA9A 2N7GA 5F8PA 2YPDA 1RUG1 4UFLA 3VBRC 4UI9L 1CAUA 4XURA 5HPOA 3QCWA 1UYZA 4U2AA 3RYRA 4P14A 4S2DA 3WZ1A 2D40A 3WV6A 2XLGA 4ARXA 1NQDA 2R071 3CDZB 2WWUA 4Y22A 5K0UC 1V9U1 3LEGA 1NT0A 4FPLA 1ND3C 2VZUA 3LSDA 3WR0A 4AFCA 5F7UA 2BNOA 2VOTA 4PLOA 1G7YA 5ERLA 3FZ3A 2VNGA 5FPVA 3MIDA 5DXDA 1OA3A 2PFWA 1KD7A 2XGXA 2C6SA 4QXBA 2GNTA 4R9BA 4Y1ZA 4MGQA 3ORJA 4XIKA 3PVEA 3I2KA 3FUQA 3O1UA 3R0RA 1LJ7A 5FXVA 3IN9A 4QX8A 1CAWB 4QKFA 4LEJA 4ZHNA 4IEUA 5JVVA 3IMMA 3U78A 1WLTA 1MQTB 2QDRA 1WLCA 3CL1A 2WIIB 1QJX3 2P6CA 1UPSA 2TNFA 5A1FA 3OPTA 4Y3OA 3KF3A 3WW3A 1W03A 4CUBA 4TYSA 1VRH2 3OCPA 2ILMA 3WUDA 3PMEA 3U0ZA 4EZ4A 3WF0A 1VRBA 2NMNA 3BPZA 3E5XA 2WZPP 5BNNB 3I49A 1PO22 2GP3A 2VZVA 3PVOA 4WBBA 3VBFC 2Q8EA 4O61A 3DF0A 1W9WA 2BQPA 5A1AA 1EYBA 4JKKA 2E32A 3JZVA 3OUHA 4CUGA 4LO4B 2V5YA 1VBD1 2OPWA 1QIQA 4NAOA 4XFFA 2OPKA 5F5CA 5FP7A 1UKGA 1NCQB 4YSFA 4DEQA 3NV3A 3ZMNA 1OBNA 4QQHA 1LNSA 1NZIA 2DTYA 1PHMA 5FP8A 3AYDA 1DDLA 1ZBA3 1F5JA 2VNVA 3FBYA 2WYSA 1ODNA 5CFCC 2RDQA 4JDMA 4PLMA 1NLRA 3AM2A 2Y26A 4I0AA 4Y5SA 3K4DA 4ZXEA 1PVC2 1VMJA 2NLRA 1HQLA 4XJUA 4YFZA 4IV3A 4EN8B 3B69A 1JZ2A 3B5LB 4GQ7A 5J1XA 1OSGA 2BGOA 4XYXA 3HJRA 3FHIB 1XRUA 4RL7A 3VD9A 1YRZA 2DWRA 1E5HA 2OQ6A 3KWVA 3GGLA 4AYUA 3MLLA 1FV3A 2WYFA 4LHLA 1YI7A 4QQLA 5FO7B 4DQAA 4XUNA 5JPNB 4XDQA 5EFUA 5IVCA 1L7QA 1R1A1 4LMFA 4XZUG 1O91A 2ZGKA 2EF6A 2EICA 1CZVA 2XBO3 3O0WA 2B5HA 4AQSA 1LOEA 2YB7A 4A41A 4IE5A 2W92A 2WKKA 2Q8OA 1ZZBA 2QQNA 3MGUA 4RQPB 5LA9A 4OI4A 4IXLA 3BU0A 3B9CA 2ZX3A 4MV2A 3L2YA 4BQWA 4DFSA 4NHMA 5EQUA 3ZYRA 1W0PA 3WF4A 5BNOA 1UY4A 1WZXA 2LS6A 1OH4A 1N3QA 3OB8A 2R0HA 4RYDA 1RUC1 5FQ0B 3CIHA 4ASMB 4FPEA 4IE7A 2XG3A 2WO7A 4K8RB 2IXLA 1VBB2 4OZXA 1AR72 2QQVA 3MUZ1 4LBJA 1K5MA 1NZCA 4CA9A 1QJFA 4NN0A 2XVLA 1AHSA 2QQIA 1PO11 2EIGA 2X05A 5HV4A 5GALA 2GN7A 4P9GA 4RHV3 4JRLA 1VMFA 2YBKA 1XYOA 4Z07A 1UMHA 1BBT2 4FBFA 2Z69A 5FZ8A 1AVBA 1C1LA 4UOJA 4JVAA 2X8KA 1XC6A 3WDYA 4MXVA 3ACHA 2Y64A 3QH6A 1TME3 4AVVA 1TNRA 2PELA 5FZ3A 4AAXA 4R8HA 2E33A 5CYYA 4TSVA 4BZ4A 4XUPA 1UMZA 1AR82 2A7AA 3A4UA 3MIBA 3RGBA 2QE3A 2WABA 4CYDA 5JI9A 4COZA 5GZEA 2PLV2 4W50A 4XAAA 1US2A 5A3NA 1QJX1 4I09A 1UO9A 2OZJA 2HWB3 5H9RA 2F17A 4HK8A 4M3CA 5FYIA 3VBRA 4XQDA 1N3OA 4XTMA 1UX7A 2AUYA 4RN5A 5FMOS 1T2XA 3AVSA 1W6QB 2DVBA 4QGLA 5BNPC 2VOKA 2W47A 2WQZC 4NVPA 4CRQA 5E1RA 1ULEA 2O1QA 2RS13 4K3UA 3RZKA 1C1FA 3BGAA 4YG6A 4CU6A 3TN93 4ISQA 2KA3A 1GQHA 4NIAA 2NPIA 3TB0A 2RR13 1F4AA 3AKSA 1F35A 2WO2A 2UWBA 4P9XA 3N9OA 4Y5TA 4XJWA 1W0OA 1VAVA 2E7TA
chains in the Genus database with same CATH topology
1ZBA1 1KDMA 3ECQA 1PNGA 1NOVA 3AMNA 1FPN3 2JJ6A 4AGGA 2PN5A 2HWC3 4WV8A 4LE3A 3KSCA 1J3QA 2ES3A 1FOD3 1WW7A 4PJYA 5JR7B 1C4RA 2YMZA 5CG8A 5EJ3A 4BH9A 3N7KA 4LBKA 1AL22 1HDKA 1RUJ3 2B45X 1S2KA 4AEMA 2PQQA 3ZYJB 2NZ9A 2ZHKA 2C9AA 1W39A 3KQRA 3O7OA 4XEZA 2XBO1 4Q4W2 2WNEA 5L7OB 2AH2A 1HRI2 1C8M2 2EA7A 1BK1A 4CDXC 1B35B 3I4IA 4BE3A 2PHRA 5DUVA 4IEYA 2OVUA 3H3ZA 5BV6A 4B7KA 4MGYE 1YUDA 5CFCA 1AXZA 1VAMA 2CV6A 1Q8QA 2K2SA 1H30A 3LAGA 1AR93 3M70A 4FT8A 4A2UA 1VLNA 2GDFA 2X5IC 2D5FA 3GBWA 3RI9A 1WGPA 3V0AB 4L99A 1GNHA 2WLPA 5JSPA 2DVDA 4F3JA 4HPKA 2JKBA 3AZWA 1ONAA 2WA3A 4LUKA 4XFGA 1X36A 3AX4A 3E6BA 1RUH2 3IM0A 4RHV1 2CGPA 4C90A 5CFDB 1ZZ8A 3KT7A 5A3LA 1CAWA 4QD2A 1OLRA 1ULCA 4UBGA 1TME1 4YZ1A 3L9JT 1MQTA 4KG0A 4DMIA 1C8NA 1U5IA 1Y9QA 4X8PA 5KHJA 2YZ4A 5C8CB 4YLZA 1RMU1 4COYA 2WS92 2XJVA 1NY71 5BNNA 4JGZB 4MX3A 2CY6A 1DQ6A 2GMPA 2VXRA 4YGEA 2MEV2 4FOWA 1T6GC 3D0JA 4GMP3 3UKTA 1VIWB 2DCTA 2H6BA 4L8QA 5KC5A 1MS5A 5J09A 3NV1A 2BFUS 3KLSA 3NWKA 3AYAA 2AENA 4BQ1A 1O3TA 4DOUA 4J6GA 3ME2A 3WG3A 5A32A 3QD6A 5JPMB 1D4M3 3VDDC 3NKTA 1F2NA 3ACLA 4DINB 3LB9A 4MGZE 4YM0A 2HWF2 3ZXEA 4AVAA 3D8CA 4BOWA 3ZFFB 4WM7B 5J36A 3OY8B 2GC2A 4XXAA 5J7MA 2ZGMA 4H7LA 1BVP1 1AJOA 1LOBA 4C1XA 1FPN1 2RS53 2DU0A 5FPZA 1LENA 3NVCA 5AVPA 2XJSA 5FMOL 1ND2C 3QLQA 1LKNA 1QMJA 2ZA9A 1Y3TA 1X33A 2ET1A 3DN7A 5BY5A 1ZREA 1N1TA 2DUOA 4J1WA 3S7IA 4FTSA 1PMIA 2AREA 1RUJ1 3AP9A 1KXGA 1E57A 1RHI3 1LHUA 4Q4Y1 5BNPA 4RQPA 1RINA 2R1BA 2W08A 2VW1A 2GAUA 1ENXA 4UXAA 4W6XA 2B39A 3RDIA 2LM3A 5LEKA 4MXWB 1G8WA 4EWEA 4FOQA 3WDTA 1WD3A 3PMSA 3FMGA 1IS4A 2DV9A 4N53C 2VPVA 1I1EA 1KRIA 4PDWB 3VZLA 3VBOB 5FQ0A 2IXJA 2VNOA 2RS33 3B94A 3GBGA 1EAH3 1W6PA 3ZFGB 1AR91 5T54A 3ES4A 1XE7A 3IPVB 2XL9A 2WFPA 3AP4A 2LTNA 3M3CA 2UYAA 3UK9A 5DZFA 4LO8A 1A78A 5JOZA 4EWDA 1O5UA 3ILNA 1O5LA 4GB31 5BXXA 1FYUA 5CVRA 4HSJA 2PHWA 1WW4A 4PIZA 3JD73 1V6JA 4GMP0 4XQ4A 2XKPA 4Q4V2 2LALA 3FUOA 4Q0QA 2ZGPA 2EXHA 3JBG2 1GZWB 2PHTA 4CDXA 2YGLA 2WNUC 4N9HA 4JC1A 3ZSKA 2A5ZA 4LNVA 2D6PA 3EQEA 4FXGB 4KU8A 2YY1A 4YW1A 4R4XA 5I0SA 1IGOA 2O8QA 1EV13 2HWE2 4XILA 1Z0HA 4P9JA 5I93A 4GMP1 4JTNA 2R49A 1ENRA 1L3JA 1LGNA 4HKWA 3POWA 5IUQA 1V00A 2JENA 3DPRB 4IEXA 1N1YA 2HKXA 5BNQA 2VOVA 5F5QA 1R083 3JQXA 1AR63 5AFBA 2GC3A 2RJKA 4XF0A 2BBVA 4M3CF 4Q0UA 1D4M1 1NLSA 4YFWA 4CP0A 4A7YA 2XVKA 1AYM3 5JCTA 3OJBA 4JGYB 2RS51 4CDWC 1OOPC 1ZNPA 2BVBA 1NCRC 2P3KA 3AP7A 3RSJA 2BFUL 4RGGA 4QQPA 2ZZQA 4D94A 1C5IA 4I3GA 5T3NA 4A7KA 5FLIA 3BCWA 3W59A 1DYKA 1ZBE2 1B09A 5T5OA 4DRRA 2JD4A 4ZKTB 1DG6A 1RHI1 4IETA 2R16A 1B35A 3A0KA 2VQAA 1N1SA 2HWD2 4IQPA 2D93A 4FPKA 2VVEA 2RMU1 4YW2A 5HBAA 3ZX7A 5GLUA 3T1LA 3FLTA 3LCPA 2I2SA 1ZZCA 2JEMA 4YW3A 1WW5A 3RNSA 4INDA 2X53S 2GU9A 5JOYA 2RS31 4MUVA 1ND2A 1LTEA 4YVWC 3EXUA 4EWAA 4BMBA 1HXS2 4AHZA 3MDPA 2HEYF 1SFNA 1UIKA 5IK8A 1S1AA 5FREA 1JHNA 1CJPA 2AGSA 2RM23 4M0HA 4AW7A 3G7DA 3HQXA 2BUKA 2QKDA 4AVTA 3LA3A 2FMDA 4AFAA 4FPHA 4HT1T 4DRVA 2JX9A 4N53A 4BCUA 3S6PA 4MH0E 1UN1A 5D8AB 2D3SA 1H2MA 1QXRA 1HIXA 4MZUA 1I6XA 5ACA2 4AFBA 1RUI2 1EV11 4JDOA 2Q30A 3THPA 1MEC3 1Q8PA 1VRH3 2GALA 2A3WA 1PO23 4DPNA 4AI1A 1RGSA 1ZRRA 2D6KA 3VZMA 2NQYA 4HMZA 1F31A 2WLQA 3AMQA 1VBA2 3DV8A 2NN8A 1LGCA 3ZFFA 1AR61 1SLIA 2B42B 4Q0SA 2D5HA 5GJ6A 1QXPA 2ET7A 2R041 1AF9A 1LECA 5JOXA 4UW6A 1PGSA 4ITCA 4ISRA 4ZXKA 1LU1A 1HRV3 4RSUA 4XHXA 3HN1A 1AYM1 4XFHA 4FTEA 2CWMA 2G4IA 1VBE2 2K0GA 5I91A 2D6OX 1RUF3 3WXPA 1YHFA 3FLPA 3E5UA 1NQJA 4QM9A 4NPRA 5KBFA 5CAZA 1NA1B 1QH6A 4BA6A 4CZSA 3CO2A 1DQ2A 3USUA 2DF7A 4ORFA 4PQ9A 2ZHLA 1XU2A 1YYNA 2WT1A 1O4ZA 1RUD2 3OBRA 3VBOA 1H1MA 5AC92 3U4XA 3O0VA 1URXA 3TYJA 4KNCA 3WG1A 1Q3EA 5F6KA 4CDUB 3ZIWA 5LRRA 5GM0A 3NKGA 2H6CA 4BYYA 4BPZA 3B9IA 2QVSB 4FPOB 4IEZA 1OOPA 2WFF2 4CDQB 1NCRA 4DS0A 4Q0VA 3WVJA 5GLWA 2ZAAA 1AR73 1QJU2 1CJDA 5C9AB 1PGW2 4RA0A 1WMDA 1MZ5A 4AQTA 3AZYA 1MS0A 1GANA 1QOTA 4COUA 4B3NA 3I7DA 3ZFEB 4N90A 1SDWA 4KQ7A 1AX2A 1W6OB 1AX0A 3OYWA 4UW4A 1BBT3 1YO8A 2FZ1A 1QDCA 4LHKA 3VN4A 3ZXDA 1PIV2 3INAA 4WVMA 1Q8OA 1OHFA 4RR3B 2XL7A 1PK6B 3HAGA 4TWTA 1PO13 2RHPA 1ZRFA 4K20A 4B7EA 1PM7A 3PNAA 5A33A 3IWZA 4E27A 2PLV3 3DPRA 4BWOA 3OGJA 3NO8A 5FAXA 4OLLA 1S0FA 4YVWA 4KG8A 1TQ5A 3CJIB 4AQ2A 1MEC1 2R062 1VRH1 4A3XA 4AI3A 5DUXA 1PO21 4OI1A 1YWKA 4WM8B 3ROUA 3IDBB 2H0BA 4XPVA 1LOFA 1YIFA 4L2NA 3VBSB 4AQ6A 5I8SA 3R4DB 1JYIA 5L73A 1XYPA 1M06G 2WNVB 4JGYA 1GNZA 1RUG2 3SH5A 4BHPA 3N7LA 5K8SA 1HRV1 1ASJ2 1UD1A 2IFRA 2MHFA 4N43B 3WCRA 4XTPA 1S2BA 4I01A 1SLLA 4FXKB 1COV3 2R072 1BQPA 1YFWA 2JG8B 1RUF1 4Q8KA 1PVC1 2OUHA 1I3HA 3UJOA 4Y1VA 2R32A 1AL23 1KS4A 2WSUA 2E53A 4IEWA 3N7JA 4L11A 1PGL2 4AFDA 3N7MA 4B4PA 1D2SA 2YUEA 1AYN2 4QPGB 3ZN6B 4Q4W3 3SCHA 4M01A 1BEV3 1C8M3 1HRI3 3VKFC 3WX5A 2E9QA 4MYEA 4JDNA 3R6SA 4XW3A 2DU1A 3GALA 1ZVFA 3S7EA 1YFXA 1VBC2 1YFUA 4Z82A 4OUSA 3RYPA 1O7FA 2DUQA 5FOJB 3FX3A 2FHRA 2KM2A 2QCSB 4IEVA 4LBQD 2DCKA 2ZGTA 5F9TA 3WHUA 4OHXA 1SACA 2VU9A 1UKRA 2P3IA 1MQTC 1AR71 1JUIA 3KD4A 3FE5A 4XFBA 4NHKA 2DVGA 3TOJA 1U5YA 3UJQA 1W6NB 3DUIA 1X7NA 4LBOA 5F6LB 5ABJB 4C1WA 1OA2A 1RUH3 3B00A 3OTFA 4GKXA 5BNNC 2WT2A 3V0BB 2XKOA 3R05A 4KWJA 1XE8A 1BBT1 1D0GA 4AVBA 4GXLA 4EN9B 1LU2A 4LO6B 4LUMA 1DQ5A 2PA7A 4Q1PA 1OD5A 1FT9A 1BZWA 1NCQC 3MLJA 5DDJ2 1QHDA 2WSVA 2DURA 4W6WA 1S0JA 1AR81 3ZYIB 3ZXGA 1HV0A 1CAXB 1FMD2 2D97A 1YLLA 2PLV1 4V1PA 2WQ4A 1DGRN 3CU7A 3KMHA 1XNDA 3T1MA 4FOVA 5C4WB 2ERFA 4XETA 3THTA 2RE9A 2DUPA 1NYWA 4AEKA 1RMU3 2CGNA 2DVFA 4LR4A 3P3NA 1F9KA 1YI9A 3VHRA 4JV4A 4RS5B 4R4ZA 1QJZA 1MACA 3MPBA 4ZU5A 3RJRA 1H0BA 2HWF3 2ZJCA 4AGVA 2JDZA 2GZWA 2HJIA 4RQPC 5GZCA 3WDVA 1NA1A 4DNYA 4GALA 2KXLA 1COV1 5JZGB 1JH5A 1ULFA 1XXNA 4XJ8A 1SCRA 3DKWA 1J59A 4SBVA 3NW4A 1W6MB 3J26N 1CR7A 2B46X 3MLKA 2PHDA 3OD0A 4E4SA 1SQ4A 1AL21 5JIUA 2R6QA 1H8VA 4WZFA 1QJY2 3B3QE 3GHNA 4EN0A 3P3PA 4XHBA 3FC0A 1NE6A 1X8EA 1H8TB 3AJYA 3WNXA 3M3IA 4UW3A 4CDUA 1LHVA 5C6CA 4Q4W1 4CTEA 3TRSB 1BEV1 1C8M1 1HRI1 1J3PA 1JN2P 1VB4A 3PHMA 1Q8VA 2ZCWA 1RUE2 1RC6A 4P9IA 4Q4Y3 4NWVA 4Q1RA 4FP2A 1NE4A 3FLRA 2CAVA 1S55A 2P34A 4H7MA 4PIYA 4CEYB 5FO9B 2WWSA 4BIFA 3MICA 5TSWA 2NP0A 1MS1A 1UZYA 3H1YA 3HR9A 4OHVA 1RJ7A 3ZSEA 4Z8BA 4E2QA 3RMXA 1F5FA 2XWBB 2ZKNA 1QNYA 1X8MA 3AMMA 4M3CE 4K7JA 4FTBA 2I74A 3NV2A 3GHMA 5EWSA 4RR3A 1RUH1 2XWJB 1PK6A 5K0UB 4Q4V3 5KXBA 1X50A 1QU0A 1AZDA 3AFKA 2DVAA 2UY8A 4D7TA 3JBG3 4IL7A 1D0HA 4Y1YA 4D7YA 3ZSJA 3C3VA 1PZ7A 2VG9A 4GB33 2Y0OA 4QPIB 1WW6A 2CL2A 4K21A 1IHMA 2D44A 2ZGNA 3K48A 4IV1B 4LO5B 2QZ2A 3RYKA 2WS91 5GLZA 5HI0A 2MEV1 2HWE3 4FP3A 1A6CA 5JWPA 1BMV1 2VUAA 4R9CA 3VBSA 2ARBA 1ZM1A 3D0SA 3LOIA 3WDWA 3PVNA 4FPFA 4B4RA 5E89A 4BMEA 2AZ5A 5T55A 3RZZA 4QX5A 2A6WA 2R1DA 4TZDA 1NG0A 2O8OA 4XBQA 2SLIA 4E4DX 2OA2A 1LB2A 4HKLA 3WQ1A 2ZGUA 4AVSA 2W0XA 5L7OC 1WCKA 2HWF1 3ZMOA 4B4QA 4GH4B 4XF1A 1NCQA 1ZYBA 1B35C 3RJ2X 1BCXA 3KGZA 5KXEA 4FCAA 4AHXA 4CP2A 4D7SA 1ZRDA 4MLOA 2NMOA 2YROA 2CTVA 4QPGA 3ZYGA 1W2UA 3ZN6A 3AKRA 3MW3A 3WP3A 1V6OA 3TAYA 5IK5A 1QKQA 2VQ0A 1KJRA 4YVSB 3ZYPA 2OUJA 1H9PA 3IKWA 1Q5OA 2A73B 1GFF2 3W58A 2HWB2 5CFDC 4HVQA 2IZWA 5FCCA 4HN0A 1SLCA 2EXIA 4YM2A 1H2LA 4PIXA 5J3UA 2RS12 1IZ3A 1ENQA 2ZGRA 2VNRA 3TN92 5C8CC 1W6NA 1H9WA 2RMU3 1VP6A 3CNAA 2RR12 5ABJA 1FXZA 4JGZC 3N3HA 4XMAA 3V0BA 3VBUB 4AEDB 1D4VB 2BPA2 4XJZA 5KXDA 3CF6E 1KFUL 2E7QA 1DQ4A 1CONA 2HWC2 5LK5A 3S30A 1GR3A 2WC2A 3KS7A 2PAEA 3KCXA 5J98B 5T5PA 1FAYA 4Q4V1 1FOD2 2Z79A 2A3XA 2B9UA 4YZ4A 4L92A 3KB5A 3QOPA 4KGQA 3JBG1 4Z2WA 1CAXA 3KGLA 1BVVA 3VHPA 1RUJ2 2UY9A 1MZ6A 3E6DA 4MGIE 3ZFFC 4WM7C 2YPJA 3FBMA 1LR5A 5ACA3 3B93A 2OW4A 1RUI3 2RJLA 2DCJA 3UL2A 1CX4A 2HWE1 5KWRA 4O9GA 5FTTC 3BU7A 5CG9A 2VMGA 3BOPA 1ZZ6A 4RS5A 3OPZA 5CB7A 1ZZ7A 4LLFA 5CBLA 1GICA 3WLUA 3OD4A 3TBDA 1V6IA 1VBA3 4L9BA 1HKDA 2R0FA 1W6QA 3B7MA 5CU1A 4FPJA 5HCBA 3KM5A 3HWJA 4AF9A 4LE4A 3WT3A 3WG2A 2JG9B 1MS4A 4L97A 4PDWC 1W6MA 4SLIA 1VBE3 4OI0A 2DYCA 4QM8A 3VBOC 1IKQA 4NR1A 5T5LA 4XE9A 1PZ9A 1JW6A 2ZACA 3MF9A 2HYKA 2R043 3PJQA 4PF5A 3R4UA 4FQZA 2DCZA 4N7UA 2XJRA 4YZ3A 5FLJA 3TNQA 2XJUA 3ZFGC 1RJ8A 3HT2A 1ZBE1 3GZTB 4COVA 3UKNA 4YRDA 5CIRA 2IXIA 4Y5Z0 2PHLA 4HL0A 1UU6A 2HWD1 5AC93 4HSLA 4A7ZA 1DBNA 3MEPA 4ZU4A 2P17A 4QT6A 3MW2A 4MGKE 4XQWA 3SLIA 5L7OA 2W39A 1BKZA 4H55A 4XBLA 5H9QA 1UAIA 3DL3A 3ILFA 4K9SA 1OQDA 2WZR2 1IS3A 5IK4A 3ILRA 2V73A 4XZPA 4DZGA 2EALA 4K1YA 1JTZX 1HXS1 2A6ZA 2Z2SB 1UIJA 1QWRA 1GZCA 4AFMA 4QGNA 5K0UA 2XH6A 3JU9A 3I8TA 3VKNA 3SISA 4NO4A 4IESA 4HVOA 1H1IA 4YGCA 4CEWB 3AKPA 3V0AA 5FOBB 5FFOC 5BUVA 3VBHB 3HMYA 1EP0A 3DPRC 1WA4A 5DZGA 3JUUA 1V70A 1R092 4QPIA 2PHUA 5HXVA 4TLFA 4HVRA 4IV1A 1IKPA 1PIV3 2XHKA 3ETQA 5FLHA 3WP4A 4F7ZA 1G9BA 3FJSA 4IEQA 4EJRA 5CFDA 2R30A 1REEA 3KCCA 1CAVB 1LOFC 3I2DA 4IV3B 1I5ZA 2ZX0A 1ZZ9A 2PAKA 1DYPA 3M7AA 3SHRA 1RVF2 4E2GA 1RUOA 4I2OA 1QQP2 3O12A 4XJ9A 5ACA1 2UURA 4JGYC 2BVVA 1RUI1 2B8MA 5C8CA 3H50A 4M0NA 1MS3A 1V6MA 3LOBA 3W9AA 4JGZA 1ULDA 1CQ9A 2VOXA 3WW2A 3Q9OA 3AZZA 4FPGA 2IXKA 3SH4A 1IS5A 4N7IA 1VBA1 4Q8LA 5DUUA 1EAH2 3RPQA 3AYEA 4CP1A 1JBCA 3JQWA 2V09A 2Y0IA 2JE7A 3AK0A 2ZZJA 2GNBA 4MVTA 5AFEA 5BNOB 2MPFA 5BYNA 1ASJ3 1QXJA 2BTVC 3J8F2 4LA2A 5DZEA 2Z42A 4WVZA 1VBE1 1Z7S2 2G9FA 3H8UA 4Q0PA 2CGOA 2D3RA 4WM7A 2GNMA 3OY8A 3GZUC 2VW2A 3JD72 3A0NA 1K5MB 4NOTA 3SH3A 3AXEA 3VL8A 3PJYA 2P2KA 1FI2A 3R4SA 3AB0A 4J1XA 1PVC3 4Z1VA 2HEVF 1AYN3 1S0DA 5GLVA 1RUD1 3M3EA 3ZIXA 4D3WA 4EV0A 5AC91 3SXWA 2I45A 4PCRA 3AZVA 1CPMA 2VH9A 3UV9A 4EN6B 4MXWA 1DZRA 1PVXA 1YXWA 1LHWA 1VBC3 1AXYA 1EY2A 3J4UH 3VZJA 4UW5A 4C0HA 4PDWA 1SBEA 4AEDA 3RRDA 4M3CB 5D8AC 4I3PA 3VBRB 1R082 2WFF1 5GZGA 2B7YA 4HK9A 5C33A 4YW4A 1FNYA 2E63A 5L19A 1GSLA 1A8MA 1PGW1 1J1LA 3ZFGA 1Q8SA 1N3PA 4ES9A 3IPVA 5JDBA 1ND3B 2XLFA 1PZ8A 2XPJA 1G86A 3VV1A 1H4GA 3WOGA 3GZAA 1QDOA 3D82A 4OFGA 1TMF2 1BJQA 1VBB3 4MSVA 3MF6A 4AXOA 3EHKA 1PIV1 4YGDA 4XF3A 3EJKA 1DGWX 5LK7B 4JQRA 2QDNA 1GZWA 3AJZA 2ZGLA 1QNWA 1NXMA 4HZFA 4QPYA 4FOYA 1FMD3 1IQAA 4FVVA 3AMHA 4Q4X2 4QU2A 2UWAA 4KH9A 3VZKA 3NL1A 4R52A 4Y1XA 5KHHA 2QZ3A 1LEMA 1IPKA 1ZRCA 3QACA 4XJAA 3VBFB 2R061 1LGBA 3FWEA 2A70A 3KT1A 4IEOA 3APBA 3KZ4C 1NA1C 2IC1A 4BIOA 1AR83 2BWCA 3VZNA 1G9CA 4HLTA 3ASIA 1U12A 3AKQA 3WQ0A 5CFCB 5I8TA