4COYA

Crystal structure of epithelial adhesin 6 a domain (epa6a) from candida glabrata in complex with galb1-4glcnac
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
232
structure length
232
Chain Sequence
GWTDPTEFPLGCSPNVTTPKNGLSMELYSYDYLKSGSNPCWDAAYLDPNYPRTGYKSHRLLAKVENVAGNINFYYHAPMGCTSLFDTLPQAYNYRTPLTMTNFTMLLYGYFKPKVTGYHTFTISADDLLFVNFGAGNAFDCCKRESSADDFGNYQAYAVWGSQTAKDDLTVHLDAGLYYPIRIFFNNRDNDGALSLTLKTESDPNPVIDFSDYFYSFDDTKDGCPGLVSYDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPITHELIAL ADHESIN 6
publication title Structural Hotspots Determine Functional Diversity of the Candida Glabrata Epithelial Adhesin Family
pubmed doi rcsb
source organism Candida glabrata
molecule tags Cell adhesion
total genus 56
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4coyA00
5A3LA 2XJPA 4AHYA 4D3WA 4AI0A 2XJTA 4COUA 4COZA 4COYA 2XJVA 4LHNA 4GQ7A 4COWA 2XJUA 4AHXA 4AF9A 4ASLA 4AI1A 4AHWA 4A3XA 5A3MA 4LHLA 4AI3A 2XJSA 4CP2A 4AFAA 4AHZA 4AFBA 4CP1A 4AI2A 4AFCA 4COVA 4LHKA 2XJRA 4CP0A 2XJQA
chains in the Genus database with same CATH superfamily
4RQPA 2V5DA 2A75A 2BVBA 2PHDA 5DG1A 3KV4A 5FPVA 1DGRN 2CDPA 3PMSA 3W21A 3R6SA 4E4DX 1ZVFA 3DGTA 4U36A 3CJIB 2QJVA 1RB8G 4NO4A 4BK4A 1W2AX 1SDWA 2LTNA 4QU2A 1W2NA 2FBEA 3NSTA 2ERFA 4XFCA 4IEZA 5DDJ3 3CO2A 3S57A 1DYPA 5HCHA 5I8YA 1JHJA 2OZ6A 4J1WA 4ZZ5A 1RTVA 1ASJ3 5FYIA 5FXXA 4OHZA 3HN1A 4MH0E 2IXKA 2RE9A 4EV0A 3MIDA 3NW4A 1GZWA 4URTA 4M0HA 2BNMA 4FOYA 2Y6LA 1O3SA 2W46A 4QPWA 1QMJA 2MHFA 1V6JA 2VQTA 2WBKA 4ZS2A 3VBFA 2HWF2 5JVVA 3W20A 5FREA 3WHUA 3I97A 4LK7A 1REEA 2VL4A 3BYWA 3JU9A 5FZOB 3DYPA 4AFDA 2DCJA 1F9KA 1K12A 2Q8DA 3T08A 2G4IA 5ACA3 4C90A 2P4EA 4ONUA 4E27A 4QKDA 3T0BA 3AKTA 4DMIA 4LE3A 3O1TA 1PZ9A 1W8NA 2YU1A 3AXDA 4LOTA 3O1VA 3LEKA 1ZRDA 4M3CA 5FWEA 2D6OX 1HRV3 1ULFA 1IPKA 4XQWA 4XZPA 5IJRA 3AKPA 2HWB2 1QY4A 2MEV3 1F4AA 5T50A 2IC1A 4DUXA 1ND3A 2VMCA 1ULCA 4UAPA 5HCFA 4YGDA 5FMOS 1OPMA 1B35C 1LENA 1FMD1 3X29B 5LA9A 3IM0A 4AOCA 4UBHA 1Z7S1 1A8MA 3H3ZA 2ARBA 2IXCA 4AFMA 4AVVA 3VBOA 4OHVA 3W9AA 4FPHA 1PO11 3WDXA 2ET7A 5F5IA 4QX5A 4CXWA 4LA2A 3MICA 3POJA 3ZN6B 4BQXA 1FX5A 1NUKA 2WLQA 3O1MA 4S2DA 1PIV1 1QIQA 3EO6A 1U0AA 3NNJA 4FPJA 3WP3A 2CGPA 2FD8A 1EUUA 3DXTA 4MV2A 3O0VA 4OI4A 1HB4A 2FDIA 5LWBA 2JDMA 4P9XA 5FPLA 5C4WC 4YARA 5I91A 1LAJA 4IV3C 4RFRB 3RWKX 4WVMB 1ZBA3 3WQ0A 4A3ZA 1XQNA 3ACGA 5BNPB 1DFQA 4QDQA 2E53A 2FZ2A 2W47A 5C3QA 1GZTA 1T2XA 2DDUA 2R063 4RGAA 2OZJA 2VULA 3GXUA 4IERA 4Q5OA 5A33A 4A45A 5CFCA 1CN1A 2VQUA 5J1XA 2HWD3 1UZ0A 3N7LA 2VO5A 5CU1A 2JDUA 3WG4A 1VBD3 2W92A 4RS5A 1FPN3 5IWFA 4N53C 5JIUA 1URXA 2O0OA 3PVBB 2EXJA 3THTA 3ES4A 4BIFA 1IKPA 2ZJCA 3WLUA 4MYEA 4Z8BA 3HNMA 4ZXEA 2QCSB 4XVHA 4KU8A 4YW7A 3ME2A 4Q4Y3 4AI0A 4FPGA 5C5TA 3SHRA 3AMMA 4PT6A 1SBEA 4OI2A 3M3IA 1TMF3 1BZWA 2ZGMA 4TZDA 1Y4WA 2I45A 4QB6A 4QKBA 2WQ4A 1W99A 1J59A 3L2HA 3I2OA 3J7NA 3VBSA 5A7QA 5JXGA 1GBGA 1LOFC 1W3XA 4FPOB 4LTAA 4N53B 4YM2A 5IHRA 2K9ZA 3AKQA 2UURA 2EVXA 3WG2A 3ITQA 1MEC3 1X8MA 1ZX5A 4P9JA 4N9HA 1X8EA 3EQEA 4XDPA 4OCTA 1UIKA 3HIFA 3J9SA 2HKXA 4XUTA 1KQRA 3ETPA 4L2NA 5J48A 4NOTA 1NCRC 3OBTA 3INAA 2VPVA 2UWAA 2PHTA 2YFUA 2BQPA 3GBGA 1QJFA 2Q1FA 3KMHA 2JD4A 4QKNA 5J7MA 5JUVA 3H7YA 2HWE3 5LZ6A 2A5ZA 1QQP3 3ZXEA 3LCPA 3GZUC 5FYUA 2DBNA 4LBJA 5FP4A 5DG2A 5CG8A 5FZHA 3H1MA 4K20A 3EBRA 4WV8A 1QKQA 2RMU3 2JJ6A 1AL0G 3NAPA 4CCNA 1MS9A 1V9U2 3MI8A 1QJX2 2ZEYA 2VMGA 5T3NA 5DABA 4QGLA 3H7JA 2XMLA 1FXZA 1GNZA 1NCRB 1NZCA 2D93A 4OFGA 4QGMA 3IAQA 3CKHA 2XG3A 4A7ZA 4ZONA 3W5MA 4KBBA 1YIFA 1VP6A 4V2VA 1ZA7A 3WEZA 5FYYA 5E88A 5A6XA 4ORFA 1EAH2 5A3PA 1HIXA 1ND3C 2BWCA 1UIJA 3OBZA 5AFEA 1JZ4A 4Z2WA 1O5UA 3IPVA 3AZWA 4HLTA 5AVPA 3V56A 1VMHA 3ILRA 2R0HA 1FOD2 5FQ0A 4IUGA 2RS11 2VZPA 3RSJA 2VOWA 2R043 4M4PA 1HW5A 3PLQA 1V6NA 3URFA 3AZYA 3WCRA 5A7WB 5KR7A 1RVF1 1CESA 3NO8A 3DUIA 2D3SA 1W0NA 4IESA 2RDSA 3I54A 2EAAA 1JUHA 1YQ6A 4Y20A 2FZ1A 2P37A 5FKBA 3O7OA 2YBPA 5A3LA 2D97A 3U4SA 4HPKB 5E6HA 1BEV1 1XYOA 3VKLA 1XJAA 4BISA 3LD8A 5HCBA 1MVEA 1VBB3 1W2OA 3KV5A 3UJQA 1OOPB 1Q8OA 3K77A 4UFJA 3V64A 4CUAA 1WA4A 2R1DA 1I9RA 4FOQA 4ET7A 3DXUA 3BIEA 3OOXA 4JGYC 4AF9A 2GMPA 1J3QA 3OBAA 4YZ4A 3SC7X 2W3JA 1JTZX 1XYPA 2YFZA 1CX4A 1GANA 2WO2A 2WYSA 4NE9A 3SITA 1R082 3POIA 2WYFA 4IEVA 1H8VA 3WX5A 3KS7A 1OF4A 2XLGA 3AZXA 4WVVA 2W0XA 5FIXA 3THDA 1SPPA 4AAXA 3OPTA 1OLME 4QPIA 2RS32 4MGQA 4JGYB 3POYA 1W06A 1POV0 1LODA 3GHNA 3MW4A 3SCFA 5CISA 1QJY2 5FYTA 3GHMA 3I2IA 4LJHA 1HKDA 5JAXA 1NOVA 5KHIA 1DYOA 3E97A 2YPJA 4A3XA 1VBA2 2GDFA 1LOEA 1SBDA 2VOKA 3WT3A 5FTTC 5FLIA 1S2KA 2WA3A 4CCKA 3QOPA 4EN9B 4OLLA 3VHOA 2JDZA 1B09A 1DQ0A 1QNYA 2JKBA 4XE9A 5BNNA 5CEHA 1W6NA 1UMIA 5F3EA 5F8PA 1Y9QA 2ZMKA 1LNSA 4XFGA 2PAKA 1QJZA 4Q4W3 3RZGA 5GALA 1UOJA 3C7HA 4JRLA 4HVOA 1SMVA 4QQOA 5C3OA 2GAUA 3IDAA 4K7JA 1W6MA 1DBNA 4XIKA 1EV12 2DUPA 3H9AA 5FXWA 3WD5A 2JWPA 1RUD1 2Y34A 4AI1A 3NWKA 3NNLA 1GOHA 2QQKA 3UESA 2WS93 4GB33 4Q4V2 5GKAC 4ZXKA 1O4ZA 5FFOC 3ACLA 5FUNA 1HB2A 4GKYA 1VMJA 4B3NA 1XNDA 2D5HA 4CVUA 1IGOA 4AQTA 3H8XA 2VQ0A 1RUH2 3QLQA 3RRDA 4G3YC 2DVDA 3POWA 4Y1VA 5FZ4A 2DVBA 5LA1A 4D0QA 2X8KA 2G9FA 4RGGA 2QQNA 1BBT2 1O3RA 4BMEA 4MX3A 1W8WA 1R1A2 1NCQA 1AXYA 4DQAA 3O1OA 4LQRA 1PVC1 4HVRA 2W39A 1LECA 4Q0QA 3ZXLA 3J4UH 4P5YA 1POV3 4Q0SA 1S0JA 3GBFA 3KF5A 4R4ZA 4W6XA 4ZPIA 2UWCA 1UPSA 3GBWA 3HMYA 3ECQA 3T30A 5FO7B 1K5MB 2G19A 2WT0A 5C33A 2HWF3 2DVGA 3AP6A 4MGKE 4DEQA 4MVTA 3T1LA 2R49A 1OLMA 2O1QA 2RHPA 3LOIA 4HZFA 1GZ9A 2P3JA 1X9TA 3SISA 1VB4A 4B4RA 5L7OA 2D6LX 3H1WA 3GDBA 1IPSA 2Y6FA 1RUC2 1VRBA 3OGRA 4CP9B 2UYAA 1T6BX 1AL22 1O4TA 2VC9A 4OHWA 4WM8A 3I2JA 3KT1A 3I2GA 5IYYA 3D0JA 1ODNA 2HWB3 3IAPA 5T5LA 1O4YA 3KHCA 5A3MA 1YQCA 2R6QA 2W9XA 4LBQD 1SHWB 5FPUA 1G86A 3L9JT 4R9BA 2VMIA 4HG6B 1JHNA 2Y60A 3K4DA 1AYN2 4JC1A 4NRPA 4PIXA 1D4M2 1K3IA 4XFBA 3UETA 3VL8A 1JYTA 2C4XA 2EXHA 5IAVA 5I0RA 3WP5A 1QF3A 5A80A 3M3QA 4JHZA 3T2TA 1HRI1 3LA7A 4Q1RA 1WLWA 4MXWA 2VNVA 4Y3OA 5I0TA 4YW3A 4CDUA 3SKJE 1D4VB 2ZS6B 4GAZA 2HJIA 2UY8A 5LA2A 3ZYBA 2OXBA 3ES1A 5LK7B 1CZTA 4MUVA 4OYUA 4HXCA 2XLFA 5A7NA 1TME1 4CEYC 5IATA 5JI9A 2EIEA 2ZX4A 3M3OA 4NR1A 1ZBE2 1NLRA 3NNFA 1YHFA 4CDXC 1E5IA 4FO9A 4GXLA 1OH4A 4XXAA 5T5JA 1FV3A 3I3MA 3MFCA 5ACA2 1WMEA 4QM8A 3N36A 3VZMA 4XUNA 1ULPA 4WZCA 1QWRA 2HWC1 3AXEA 3P6BA 1JZ2A 2XJQA 3NVCA 1DZRA 1RUF1 4BQYA 5GZEA 3R0RA 4EZ4A 3VBUA 2ZAHA 3TNQA 1I3HA 1KXGA 2WNVA 4EN6B 5FY5A 1MS1A 4CEYB 2MEV2 3FX3A 3K75B 5IUQA 1UY3A 4CDXB 1J1LA 4I30A 4EROA 3FJSA 3LKJA 5KXEA 1F5JA 3LAGA 3KLSA 2FMYA 5FYHA 4AHWA 3VZLA 2ZTNA 2VZ3A 2W1UA 4YNIA 3IN9A 1DZTA 4HN1A 1UZWA 2R071 5IVBA 3ZYRA 4MLOA 1L3JA 5CYYA 1OPOA 1ACCA 1YCIA 3OSDA 2AZ5A 1O7FA 4PDWC 1X82A 4QPGA 2ZX2A 2A7AA 1ODMA 3WZ1A 2QQMA 3TOJA 1SCRA 1DGWX 1D2SA 4DRRA 4KMQA 5E8AA 2OVUA 3WNMA 3W59A 1UYYA 1W9FA 1AX1A 4GMP1 4IV1A 4XETA 5KWRA 2AC1A 4I0AA 2JIGA 1IQDC 4RSUA 5BXXA 4PI0A 4BYYA 2YC4A 3ZMOA 4EWDA 1S0CA 4IGQA 2WZR1 3PNAA 4AI9A 3BIWE 4C1XA 2C9KA 3FLTA 2J22A 4RGKA 3WV6A 2YZ4A 3HJRA 4PDWB 3ZSLA 1A3KA 2D7FA 2XH6A 3KM5A 4XMIA 3U1XA 5FWJA 4ZS3A 4PBPA 3GZEA 4Y24A 5BYNA 1XU1A 1RC6A 2X29A 1ZZ7A 1BK0A 2HWD2 1OXCA 4LO8A 1GQHA 3AMHA 3LIHA 2JB8A 2GP5A 3OPWA 5IK7A 3FMGA 1LHUA 4XJAA 1JZ7A 3VZJA 3S7EA 1V9U3 5LW9A 4JQTA 1QJX3 5FZKA 2A3YA 2Z5WA 4WM7A 3VKNA 1I5ZA 1G9AA 1REFA 4V1PA 4L97A 3JB4C 5FCCA 2KD7A 2PA7A 5F9TA 4AI3A 1CAVA 2PLV1 1DGLA 1WLCA 5IK5A 4S2GA 1RHI1 2MPFA 3J8F2 4L9BA 1NKGA 2EIDA 1RUE2 2WNUA 3PUAA 1AYM2 1SCSA 1ULDA 2DVAA 3MDPA 1EAH3 1L7LA 1LCLA 3U37A 4GWNA 2E9QA 1WW5A 2HYXA 5FLHA 2ES3A 1S55A 2XVLA 4A42A 1QXRA 3A4UA 4I02A 3Q8BA 1SG3A 2Q8CA 4FQZA 3WG1A 2VCAA 3I59B 3RQ0A 2KA3A 2LM3A 2OPWA 3JUUA 1UYZA 4X8NA 2Y33A 4BQ5A 1XNTA 5JPNB 3J7MA 5FOBB 4YRDA 5AC92 5F37A 4YZ5A 1W9YA 4IE0A 2HWE2 2LUWA 3ZN5A 1FYUA 1ZBA1 2WT2A 3ZR6A 1SACA 4K9SA 3TNPB 1ENSA 1YC61 3ZYJB 2JKXA 3O1UA 3USSA 1PX4A 2W1QA 3ZYHA 5FYCA 1OF3A 4B29A 4K1YA 2G9GA 5FXVA 1G6NA 1R1ZA 1GICA 5SV8A 1H1AA 3V0BA 4CYDA 1RUG1 4D3WA 1JYIA 4YVSC 4K8RB 2WNOA 4N43A 4BLJA 4ZU7A 3O0XA 3CNAA 5HXMA 4LHSA 3USUA 4LR4A 4A44A 1UZVA 2PHWA 3ACFA 2C1FA 1R083 2WNVC 4NMIA 2J1VA 1AR73 5J98B 4CXXA 5C8CB 3RPQA 2A1XA 1DGRA 1SDDB 2BVVA 2VAUA 3PTRB 5KXDA 2VNOA 4FVVA 4B4PA 1PVXA 3HT2A 3MV11 1BCXA 3GALA 3F95A 3N9OA 1GWLA 1C8M2 5L9BA 3E6BA 4RL7A 1H9WA 2RS33 1Q8SA 2YROA 5LB6A 2ZHKA 1RIRA 4I0BA 2EAKA 2OQ6A 4AAPA 1CAXB 1VALA 4OVEA 1UAIA 2SBAA 4YVSB 4YZ2A 4WVWA 1FATA 3OEBA 1LJ7A 1PZ7A 1ND2C 3AZVA 1QJY3 3ZYIB 3UV9A 1A78A 2D6NA 1C28A 1TE1B 1U5YA 2JG9C 5IT6A 4Z07A 4XABA 1UCXA 2B9VA 3PU3A 1H6YA 3VKMA 4BHPA 4CU8A 1VBA3 3RGBA 3RZMA 2WN3A 1F5FA 2X5IC 4AVAA 4XJ8A 5L36A 3TEYA 4JAAA 1G9FA 4YW6A 3OUHA 1QQP1 4LEJA 2WL1A 3KCCA 4RA0A 1S0EA 1RMU2 4ES8A 1DZQA 2HBUA 4TN7A 3OPZA 4YG6A 3WF2A 4YZ1A 4IEOA 1FI2A 2VU9A 5FZ8A 3VDDC 4F8AA 4LHKA 5I0SA 1JYCA 2Y0IA 2JG9B 3AL5A 3RYRA 2H0BA 1L7QA 4LBQA 3KCYA 3TEXA 4H14A 2AUYA 1UY1A 1EV13 4XCAA 2ZEWA 5EYXA 3WNKA 3ZFFA 3ZN6A 2GALA 2OS2A 3RVHA 1W8OA 2X5IB 4Y5Z0 5KHGA 3I3EA 4G4FA 1HQLA 2GMEA 4Q4V3 5ABJB 5D21A 1QHDA 4BQ2A 4UFIA 4PF1A 1YWKA 5FZCA 5BNOA 3VDDB 1H0BA 2XOMA 1RUH3 4BK5A 2A6VA 4PLNA 5EP9A 2QQJA 3WY6A 2CY6A 4ZZ8A 1AR82 1BBT3 5H9RA 1AJKA 3VDCA 4QX2A 1R1A3 2V4VA 5F3CA 4UOJA 4GKXA 4BQWA 4RFT0 4YGEA 1STMA 3ZXGA 1LULA 2PHRA 2ZABA 3B7MA 1GYKA 2WINB 3LQCA 3R4UA 2FHRA 4COUA 1LB2A 1SFPA 1VBC1 4LKSA 2C24A 3U75A 3RS6A 5B2GB 2FDGA 4FTSA 1GNHA 1N3OA 3WNNA 3NJVA 4ATEA 4XZUG 4Q4W2 3NRUA 4H7MA 1OFSA 5J09A 2R16A 1YFXA 1W8HA 3K4AA 3MPBA 3ZXAC 1TNFA 1NY71 4XJZA 1QJU3 2UYBA 2VQAA 3POBA 1H9PA 1OVSA 3BB6A 4NHYA 4Y4YA 5AFBA 2PN5A 3ZPYA 2NZ9A 4PBOA 1ST8A 1OSGA 1Z0HA 4PLMA 4GB32 1RUC3 2B9UA 4RR3C 5FZBA 3GCXA 3WDVA 4XJ9A 5HXVA 1O8PA 1MQTC 1AL23 1U5XA 1YFWA 4LKEA 1G9DA 1BVP1 4QX0A 4YG3A 5FPBA 2C9AA 2F17A 2WLPA 4XUOA 4BXFA 1MZ6A 1W6OB 4I2OA 4MHUA 4CTEA 5FKCA 2I74A 4XPVA 3RJ2X 4UT5A 1MS0A 4FQ4A 1UKGA 5FV3A 2OKXA 3B94A 2E33A 5FR3A 3LF7A 2CL2A 4K8FA 1AYN3 4YM1A 4XDQA 3E6DA 1D4M3 3V0AA 1JYNA 1VRH1 4Y22B 4YFZA 3VDBA 2XR4A 2EXKA 1CAUA 3DYMA 5FY9A 1AR61 4CU7A 1MQTB 2DUOA 2YBSA 3VBRA 3LWCA 5EJ1B 1Z7S2 1DQ5A 3VL9A 4DS0A 2BBAA 5FMOL 1XOYA 3KSCA 5A3UA 5K0UA 1PO12 2ZMNA 1SLCA 2V72A 3OYWA 1ZBE3 1J58A 4YPJA 4BPZA 4EWAA 2IFRA 1NX9A 5K7PA 2ZGTA 3ZMNA 5FYSA 4LLFA 1UZZA 3KF3A 4LOSA 2BWAA 2VUCA 1LHNA 1PIV2 3VV1A 2WR9A 4CA9A 4XEZA 4XBLA 4IEWA 1AZDA 1ULEA 3H50A 5LBCA 1WMDA 3P3PA 5FK8A 1RJ8A 1U5IA 4LO6B 5DN2A 2VJXA 4OHYA 4S2FA 2Z42A 1PZ8A 2YC2A 3ABZA 2WWSA 4KU7A 3K2OA 5D8AA 2WS91 5FPAA 5FY0A 4AG4A 3K4ZA 4JKLA 5CZKA 3WP6A 4EJRA 3TEZA 3NKGA 4QX3A 2EALA 4QT6A 4QB2A 1OLRA 3EB7A 1S0FA 4GZ9A 4XXPA 3TYJA 3SNMA 2WZPP 1BMV2 4ZY9A 4ATFA 4TWTA 4DZGA 1OKQA 4AHXA 1V70A 4D6RA 4KGQA 4CCDA 1U5ZA 1LOBA 2DBIA 1X33A 3HBZA 1CR7A 1UZYA 2XDVA 3KT7A 3O14A 2IZWA 3VB9A 3ZVXA 4MGTA 2XONA 3DPRA 2BGPA 1W0OA 4P9LA 4QXHA 3MF6A 3WNXA 5J37A 3RZLA 1B35B 1ZZ8A 1OD5A 2X09A 1E5RA 1ZRIA 4A2UA 4W50A 2QDNA 4Z82A 4L0PA 1E57A 5FZ6A 3UGHA 1OHFA 4GH4C 3WSOA 1DDLA 2UWBA 4LUKA 2XB6C 5LY2A 3PUQA 3ZFGC 2UY9A 5T54A 3JBG2 3ZXKA 2BERA 4H7LA 4UF0A 3PUSA 1UQXA 2BGCA 1D0GA 1GOGA 2XHKA 2GN7A 3WQ7A 4DB5A 4MZUA 4CDWA 1PNFA 1XE7A 1AUYA 4Y33A 3H42B 4KI5M 3ZDSA 4CP2A 1XE0A 2JG8C 5HBAA 1F35A 1QH6A 1W9WA 4XF4A 2LW8A 4HK8A 1NYWA 4GH4B 3JB8A 4LXLA 5T55A 5FBZA 5B4XA 2D5FA 2D44A 2GC2A 4NWVA 2RDRA 3KVBA 1C57A 2GC3A 2W52A 4GIQA 4TLGA 5C4WB 3ZFGB 4IV3B 3LEGA 2J1UA 4IXLA 1AXZA 2GC0A 2VUAA 3BVCA 4NPMA 4BDVB 2FMDA 1KFUL 2VECA 2KXLA 4FT8A 4XF3A 5DUWA 2Y0OA 4UFHA 4RQPC 5JOZA 1OVPA 4XCBA 3J8F3 3MV01 2JG8B 4MGSA 4YW2A 1WCUA 1RUE3 2YUEA 1AYM3 1LHVA 4NAMA 3GJBA 1PK6A 3O12A 1VLNA 3LEMA 1POQA 4FI9A 1I6XA 2JDNA 3T2QA 3T3YA 3PJQA 1CONA 3IDBB 5ERLA 4H2AA 3NV4A 4R52A 4A7YA 2N7GA 5F3GA 3MYXA 4BM8A 5E89A 2E6VA 4NAOA 4Z1VA 4LE4A 4K6BA 2RM21 2ZCWA 1COV1 3FWEA 4KWUA 3DKWA 4ZU5A 4CDQA 2VG9A 4YLZA 4XF0A 5H9SA 3BOWA 4GWIA 2VBPA 3FL7A 4Y1ZA 4LK6A 4RQPB 5E16A 5AC93 4OUSA 4X6RB 5FUIA 1NA1A 4OULA 4YM0A 4E2GA 2XXZA 2XWJB 1UNBA 2RS12 3O5SA 4D6SA 5EPAA 2AH2A 4IE4A 3VKFC 4P5HA 3IDCB 2QQIA 3U0ZA 3VBFC 4P9YA 2RJ2A 2NYYA 1JYVA 2W1WA 5CFDA 4NIHA 4EN7B 5A1FA 1RVF2 3HWJA 3OY8A 4GULA 2DVFA 4KNCA 4MHRA 3D0SA 4LO4B 4NIIA 2X05A 4DPNA 3LOBA 3A21A 3GNEA 1W6QA 4W6WA 3D3AA 1BEV2 2JICA 4CU6A 3GM8A 1HN0A 4XJWA 3AMQA 4UI9L 2OA2A 3TEWA 2ZMLA 4HETA 1OUSA 1F31A 2W5FA 4I0WB 1GZWB 4UFKA 1VBE1 5DAQA 2CAVA 3OB8A 4SBVA 3WDWA 1WBFA 4YGBA 5I8TA 1G8WA 5HPOA 5IVEA 1VR3A 1WLDA 5BY5A 3VBFB 3VHRA 3BTAA 2BV4A 4CUBA 1JU4A 3IKWA 5JXIA 1C8M3 1WW6A 3PMEA 3FE5A 1K5MA 4A4AA 5GZCA 2HEVF 4KG0A 1UXXX 5A7SA 3S5QA 3M70A 1PHMA 4P02B 3VBOC 3J26N 5ISLA 2ADEA 4Q1PA 4Z92B 2ZACA 4QPYA 4W4ZA 5D1IA 1IQAA 2NMOA 2ZGQA 2QQVA 4F7ZA 4IEYA 4FTEA 2RR11 3M7AA 4M3CB 5FYVA 2BBVA 5JSOA 1VPHA 5L9VA 5LY1A 3M3EA 2RDNA 1ND3B 1SLIA 1W0PA 2DCYA 3CF6E 4B4QA 3GZTB 4I3PA 3WNOA 3Q8FA 4Q4X2 3KQRA 4BMBA 2IFWA 3IIIA 3AJZA 3J7HA 4BCUA 2CV6A 3ILNA 4ES9A 4KWJA 1HV1A 2XBO1 1W05A 2Y64A 1RMU3 2R7EB 3VBOB 5C3SA 1U12A 4LA3A 2D98A 5CKNA 3M8LA 2J1AA 4QX7A 3TWIA 1UMHA 3I3DA 2NN8A 4YFWA 1QDCA 1AR72 3Q9OA 4XF1A 3OD0A 5JOWA 4W65A 4CDWC 1XNCA 2P17A 5G04L 3I2KA 2FQPA 2VXJA 3NQHA 4Y26A 3Q8EA 5AVAA 5CFCC 2ZGOA 3ASIA 4RS5C 3AYCA 4GJYA 4COZA 2WKKA 1RUD2 1VJ2A 2TEPA 2GNTA 3DL3A 1KD7A 3AYEA 1XSQA 3QH6A 4PLOA 1E5SA 5JOYA 1JOJA 4W8JA 2Q4SA 3WDTA 5A7PA 3BUCA 1PX3A 5I0UA 2VM9A 3NL1A 3FBYA 4XILA 5HCAA 2A6ZA 4AYUA 4KWKA 1AR83 1EP0A 1FOD1 4MXVA 1RUJ1 1GR3A 1GP5A 4LHLA 4Q8LA 2SLIA 3E5XA 1SBFA 2ARXA 3JD71 3KZ4C 4QU1A 1J1TA 1D2QA 1JOPA 3GZAA 4CEWA 3POEA 1ZZ9A 5A33B 4FBFA 5CFCB 4Y1UA 3SQOA 1H8TA 2GH8A 5ANNA 3VBSC 1H30A 5FP9A 5HI0A 4RS5B 5DPNA 2E7QA 2GC1A 3E1F1 2IXHA 1PK6C 2ZAAA 4QGNA 1JH5A 1UD1A 1X50A 1PVC2 2VBDA 3B9CA 3OJBA 1YQ5A 3ZXJA 4MO3M 3ZR5A 4C0HA 2VH9A 4COYA 2JIJA 3BPZA 3HNBM 1APNA 2FDHA 3C7OA 3DV8A 1RL3A 5A3WA 4KG8A 2D6MA 2CGOA 3AYDA 1Q56A 3KQ4B 3WF3A 3AFKA 5CKQA 1GSLA 3VBSB 3WOGA 2B42B 4AHZA 4AR2A 1JOBA 3IZOA 3VZKA 1K42A 1QEXA 1UXZA 2PHUA 2WAOA 5EXOA 4AFCA 1W6PA 4JGZA 5J36A 4CP0A 3QH7A 3PUIA 1JU3A 3SKVA 2BEOA 3NAPC 2WA4A 1MS5A 4Q0VA 3LDBA 4AVCA 1FNYA 3NV2A 5DUVA 4ARXA 4K21A 5IVYA 5A32B 4JQRA 3RMYA 1PM4A 4WVZA 2DF7A 3ATGA 4YSFA 3OD4A 3MPPG 2FCUA 5L9RA 4J1XA 2NM1A 3FFZA 1S0BA 1HJGA 5GZGA 4EQVA 2VOVA 4KGGA 2QZ3A 1MACA 3ST7A 4BIOA 1NQJA 5C9AA 3FZ3A 2AGSA 4UW6A 2VW0A 2VVFA 4LORA 2VTXJ 1IPJA 1EUTA 1Z7S3 3RZKA 5FJHA 5I8SA 3BU0A 1CZSA 2JB4A 1VBA1 2WZEA 3AKSA 4DXTA 3NAPB 2OX0A 5FZ0A 5A1AA 3H8UA 3LPGA 2GU9A 1PO13 4I01A 3MLKA 2VUDA 4BQ4A 3VBHA 4MGIE 1JS9A 1QJU2 1GWMA 3RI8A 1NLQA 4AW7A 1XB9A 2ZX3A 3BN6A 1CD3G 1UL9A 3MO4A 1SQ4A 2BOJA 3S30A 3GJAA 3JQWA 3NJZA 2QBXA 4DY3A 1WBLA 4IE5A 1TME2 3AK0A 1X9PA 2XHNA 2OUJA 1PIV3 1IZ3A 3LIGA 4FCAA 3OF1A 2YGMA 2ADDA 1NXD1 4JDMA 5KC5A 4BOWA 2ZGNA 4Q0UA 3Q8AA 1CAWB 2DFBA 3S6PA 3IPVB 2FCTA 1BKZA 5FY8A 5FQ0B 3WR0A 1ENRA 3OGGA 1OA3A 5JI7A 5BV6A 1RUF2 3A0NA 2AENA 2DCZA 2PQQA 2WO3A 3CJXA 3CMGA 3ZFEA 2Q1MA 3E6CC 4OZOA 2XJPA 4XW3A 4UBGA 3MBWA 4Y20B 5TSWA 1KJLA 5JLVA 5FP3A 4AXOA 3O1SA 2RS51 2XJTA 3NJXA 3PDQA 4HK9A 4NROA 1WGPA 2XJVA 2WFF1 3ALQA 3TN92 4RHV1 5C8WA 4L8QA 5EJ3A 5FAXA 5LRRA 5FPXA 2JENA 3OGJA 3WQBA 2Z79A 3S7IA 4CE8A 2ZA9A 4QPIC 4N7IA 1KDMA 3AM2A 1I5PA 4AWDA 3F2ZA 3W5NA 4P08A 4D69A 4OMDA 1AR91 4CPBD 2GP3A 4B1LA 2TUNA 1W2TA 3MZHA 1RXFA 2PAMA 4LIVA 2K2SA 3HT1A 4COVA 3VD4A 1SLTA 4HKOA 1IS4A 1PO22 1REDA 4XHXA 4QKFA 1OC1A 5J3UA 4KL1A 4WZFA 1R092 3JBG3 4AK3A 4CRQA 1O91A 5GLUA 2NPIA 3U07A 4CEWC 1SPPB 1IHMA 3WUDA 3MHZA 5C8CA 4M4RA 4QPIB 2WZ8A 4XURA 5JMCA 4G9SB 5BNNC 4Q27A 2WZR2 3CU7A 5JMOA 2D6KA 2EF6A 1JYWA 2ZZJA 2Y6HA 2PMWB 2GN3A 4XYXA 2C5DA 4CUCA 2DU1A 2R0FA 3WP4A 3PU8A 4CCJA 2CTVA 3FLPA 2RG4A 3IBMA 5DDJ1 4LNVA 3AC0A 4X6QB 4BWOA 2ZXQA 1CZVA 3N9LA 4M00A 4NHMA 4IQPA 2XUMA 3LFIA 1G9BA 2XVGA 5BNNB 1ASJ1 3OCPA 1W6NB 2VXRA 1HB1A 3LSEA 5JCTA 4SLIA 4DRVA 4GD4A 1UYPA 4L11A 2YHJA 4MGYE 4P9WA 1H6XA 4LMFA 4AVBA 1HXS2 2WUHA 1BK1A 4UW4A 4ASLA 4V2WA 4YVWA 3RI9A 2IXJA 3UYJA 2A6WA 1W6MB 1RHI2 2XKOA 4NWWA 4AEDA 3DYOA 4URAA 3I2DA 1V6LA 4XDOA 1NCQC 2DCKA 1ZNPA 1WMXA 2O8OA 2D6PA 3HPNA 5JDBA 5ACA1 2E7TA 4NPRA 5C9AC 3T0AA 3SEEA 4JVAA 3T4VA 5KXCA 3WG3A 2WRAA 3RDIA 2VCBA 5FJKA 3U14A 3HVDA 4EYUA 2RS13 2GH2A 1H2LA 2A3WA 2ZHNA 4JDNA 4PHZA 5ABJA 3AP9A 2B5HA 3PJYA 1HQNA 1HRV1 1FNZA 1EPWA 2QVSB 2RVAA 3M2MA 1XBFA 4IW3A 2MEV1 5HV4A 1RVF3 5DAVA 1HV0A 1LU1A 1HB3A 3RJRA 3MLLA 3LDRA 4N90A 3ZOIA 4ASKA 1NCQB 5F39A 1UKRA 3KVAA 5JZGA 5L7OC 2I07B 4XAEA 1BEV3 1NZIA 1PGW1 1W90A 2LROA 4YZ3A 1RXGA 5JSPA 2WAAA 4WM8C 3THCA 1VB2A 1GQGA 2YBKA 4BLIA 4YM3A 3DCQA 3DKQA 4K1ZA 1UU5A 2PTMA 1RUG2 3SH4A 3MF9A 5BUVA 1F8VA 1UW8A 2CU5A 4YG0A 2Y38A 1OLQA 3KWVA 2VMEA 1MS3A 4Y5SA 1UWWA 5LEKA 1W8UA 1CPNA 5LRSA 5L7OB 2OUHA 2AEZA 2QDRA 1US3A 3MIFA 4LO5B 1YQ2A 3ZDVA 3NNMA 5CG9A 4W6YA 5DZEA 3K3NA 1QU0A 4WM8B 2Q8EA 3HN3A 4CDUC 1W9TA 3UK9A 2XJSA 4DY5A 3CLPA 5IVJA 3LB9A 2WQ8A 1Q8QA 4FOVA 2XLAA 5ANQA 2Y8KA 1TEIA 3C3VA 4FAHA 2A71A 2AYHA 2R061 1DCSA 1C3HA 3M4FA 4Q4X3 3ZYGA 3IMNA 2A73B 2J42A 5F5QA 4QX1A 4R9CA 2PAEA 3CJIA 5FYBA 2Y6KA 4TSVA 3W58A 1H4HA 2HWD1 1VBD1 1FPN1 4UXAA 4MXWB 3APBA 3OG2A 4CDUB 4K40A 1RUI2 2NQYA 2VNGA 5FZGA 3VBUC 2TBVA 4N8MA 1FT9A 4EZHA 1Y9MA 1O59A 2ZGPA 2CAUA 5CB7A 3PVEA 4Q4Y1 4P14A 1XC6A 2LRPA 4XACA 5FY4A 2ENRA 1DF0A 1N1TA 3CDZB 1KDKA 2YPDA 3G6JB 5FZMA 1TMF1 3VD7A 4BQ1A 4BB3A 2VY0A 4QQHA 4QMAA 4RD7A 3ZN4A 3J8F1 2ZGKA 1JBCA 1F2NA 4R4XA 5FP7A 3RZHA 1O8SA 5FP8A 5JWPA 1Y7BA 5FZOA 1RUD3 4A7KA 3A22A 2JECA 5C70A 2D3PA 3DECA 1XNKA 4EE2A 5FOJB 1G7YA 1MEC1 1F4HA 3VBUB 4E4SA 2WNVB 3KGZA 4HANA 4QPGC 3T2OA 4C1WA 2Y6GA 3EHKA 1J84A 4O9GA 4XIOA 3NJYA 5APAA 2VW1A 2X10A 2HWE1 4IDZA 1AF9A 2JDAA 4IV1C 3RZJA 1UN1A 2BJSA 4INDA 2ETEA 4PI2A 4XOGA 1E5HA 5DZFA 2ORXA 4E8CA 5C3PA 1LOGA 1ND2B 1PVC3 2RMU1 2J7MA 4NRQA 2BYVE 3EYPA 1VAKA 2IUWA 1VBC2 2KR2A 4QPGB 1GUIA 2LALA 4NHKA 4DXSA 1C1FA 4IETA 5GM0A 5A70A 3BALA 1GOFA 3G7DA 1G9CA 3TB0A 2JD9A 1QOSA 3IDEA 3MEPA 4QAWA 1QNWA 5B4NA 4IV1B 1GP6A 3UKTA 1LR5A 2OPKA 2IXIA 4QD2A 2DTWA 1UU6A 1YO8A 5LASA 2Q1ZB 2CHHA 5C6CA 3AVRA 3B01A 3LGRA 2PHFA 2D43A 4FP2A 1BVVA 4S2HA 4RN5A 1OD3A 3N7KA 4LKDA 1BHGA 4WM7C 3WHTA 2ZEXA 2KM2A 2ZKLA 2G1MA 3VZNA 3WQ1A 2WT1A 1C8NA 1NT0A 4JDOA 2R041 4WVMA 5F6KA 1N1VA 2E63A 4META 3VKOA 5BNPA 3OUIA 3BCWA 4JTOA 4Z2AA 2WNUC 3CIHA 2A6XA 4ZKTB 1QOTA 3MW3A 3LDKA 3ACHA 1IS6A 2V09A 4IEPA 2BPA2 1XNBA 3TBDA 1VRH2 2QZ2A 1JUIA 4O65A 3LA2A 4WM7B 4QQLA 3ZSJA 5LA0A 2V4AA 1AR62 1CJPA 1VBB1 4C91A 5A6ZA 2C0ZA 3WW4A 3HNYM 2WWJA 1S4CA 1SLAA 4IEXA 5JR2A 2JEMA 3T2PA 1CAVB 1XNAA 3K46A 3LE0A 2RJKA 1TME3 2BFUS 4AEKA 1CIYA 1SFYA 3LA3A 4C8DA 1M4WA 2WNUB 4E9KA 1HQWA 3L2YA 4A6OA 5FZEA 3O0WA 2E7AA 1K5JA 5FLJA 3C7EA 1QXJA 3ACIA 5F6LB 5GLVA 5IW0A 1GLHA 4E8DA 3H8OA 1CJDA 5GLTA 4N53A 4Q2FA 3OGVA 4MSVA 2P5BA 3MUY1 3D5OA 3BI3A 4ARYA 5HV0A 1RUF3 4I09A 4CCOA 5IFPA 2O8QA 3ZLIA 4OQ8A 5H9PA 3ZIWA 4ASMB 1UPIA 2VR4A 4N43C 4HOOA 2VZTA 2RV9A 4DINB 2W94A 5FZAA 5FBJA 3MIGA 1LGNA 2PELA 4RR3B 1FMD2 4AEMA 3T0DA 1UOBA 2IVIB 1V6KA 4HFSA 1X36A 4B7KA 1AR81 1DQ1A 5EYYA 3S5AA 3TN93 4CXYA 3PIGA 1LOFA 1YQ8A 2B7YA 3A0KA 4XBQA 4YW5A 1SLLA 3WW3A 2ZOEB 4D7SA 3AKRA 2R073 3V0BB 2HBTA 1YRZA 3E5UA 2CYFA 3FUOA 4N43B 1W8FA 3AP7A 5CKMA 3IIAA 1BLZA 2JX9A 1LOAA 3TRSB 4DEVA 5F7UA 3BTXA 3USUB 1NCRA 4Q4W1 2VW2A 1PO23 2R1BA 3WF1A 4XUPA 3ENRA 1NLSA 5LBBA 1KS5A 1N3QA 1R093 3AMNA 3PHMA 4GMP3 1TQ5A 4LBOA 4QHZA 1UMZA 3HAGA 3N9NA 4XJUA 2VGDA 3RNSA 3WVJA 2OT7A 1ENXA 1FV2A 1N1SA 1PGL1 2PHLA 1J3RA 2WZR3 4AQSA 4GB31 5FK7A 3HOBA 1LU2A 1W9SA 4JV4A 3RYKA 1ZM1A 2YB7A 5GZDA 1SZBA 2QQLA 2BW8A 3WCSA 2AEYA 4QXCA 5JXJA 2GMMA 5A7WA 3SCHA 4DXRA 3BTYA 3FHIB 2NLRA 5F5AA 1H4GA 3ZFFC 1W2UA 1DLCA 4LPLA 4TYSA 4XFFA 3AL6A 4CP1A 4OI0A 1AX2A 2PYTA 4HPKA 3GGLA 2K0GA 1OURA 4X8PA 1YUDA 2ZEZA 2FDKA 2WJSA 1JMUB 4QDSA 1POV1 1QGLA 5EIYB 2JDYA 5BNOC 4TXWA 4JKKA 1OOPA 4FPLA 2JE8A 1WMFA 2WDBA 5FMCA 1F15A 1H2NA 3POSA 4HKWA 1HXS3 4O9EA 2A6YA 3WF0A 2GNDA 4CCLA 2PLV3 2GSYA 4LBQB 2HWF1 3C8XA 2W91A 1YFUA 1RHI3 4FPYA 4LHNA 3UGGA 2VCMA 3V65A 2GNMA 3ZFFB 4QM9A 1QOOA 3NNGA 3RZZA 1UO9A 2JDPA 2WO7A 1JN2P 1VAMA 5T5OA 3D8CA 5BNPC 3VUOA 4BZ4A 3PL0A 2WO1A 2JDKA 1WD3A 5T5PA 1MZEA 3J7LA 2VTXA 3ZKYA 2ZGRA 5IVCA 4MOAA 3U11A 2VE1A 5BNOB 2P2KA 3EXUA 5JIAA 4CCCA 2RM22 3RWNA 1COV2 1I1EA 2QE3A 3THPA 3SH5A 3KV9A 1W28A 2HWB1 2ZKNA 3IMMA 1HN1A 4JGYA 4NHXA 2C6SA 2UU8A 4M0NA 2JDHA 3I2FA 3I2HA 5E1RA 1PMHX 3U78A 4AGGA 4KWLA 1TVGA 3CL1A 2Q5TA 4FFIA 1T6GC 2VCCA 3LPFA 1Y9GA 1BMV1 1YFYA 5A1LA 4FFFA 4DOUA 2P6CA 3T4HB 1S0DA 3LFMA 1GWKA 2CWSA 2ZGSA 2B45X 2Z4FA 4CUGA 3QD6A 1RUG3 2E31A 1ONAA 1OH3A 3B02A 5CBLA 1WZXA 3GYDA 2ZGLA 3AJYA 1VBE2 2B4KA 2D40A 2G9ZA 1RUOA 4JZRA 1RJ7A 1DYKA 3HQRA 4E4HA 3C2UA 1UF2C 2GNBA 2Q8OA 2YY1A 4AE2A 4H55A 1IG0A 2VZOA 2DV9A 4CZSA 5F2SA 3QACA 4XC9A 1GQPA 2ILMA 3VBRC 3M3CA 3JBG1 1AXKA 2EICA 3VD5A 5CAZA 3ZYPA 1PMJX 2Q30A 5FMDA 2YDEA 3LZZA 4QHBA 5K0UC 1VMFA 1WWYA 1KEXA 2CGNA 3EJKA 1OMIA 4FPCA 4LITA 4CCMA 2VBBA 4AFBA 1LGCA 5CVRA 1JZ5A 3V0AB 2RR12 4JTNA 3AVSA 2BUKA 2XL7A 4QXKA 2WN2A 1UY0A 3ZX7A 5A32A 3I3QA 3TAYA 4IGPA 5C71A 1CAUB 5DXDA 4BU2A 3SLIA 2YV8A 2BNNA 2BOIA 3VBRB 4PQQA 1RUI3 2QTWB 5BNQA 3FFQA 4Y5TA 4AEJA 2XBO2 2QNKA 1MS4A 3LEIA 3SMHA 5K0UB 4L99A 1P8JA 4IE7A 2FDJA 4QB1A 1JW6A 3OYWB 5D8AC 4XQDA 2VOTA 1YI9A 4A41A 3N3HA 3VN4A 1VIWB 1LEDA 3UKNA 1LESA 3MUZ1 2JE7A 1K45A 5KHKA 2YMZA 1W04A 3AX4A 3HEIA 3I7DA 3PURA 1MS8A 4NJ4A 4Q0PA 1TZOA 5EWSA 1QH7A 1JXNA 5F5CA 1LRHA 2CSGA 2OYZA 3VHNA 2Y26A 4ZHNA 3ORJA 3I49A 1A34A 5A6YA 1XE8A 4IEQA 4J25A 5F2WA 2DCTA 4AZZA 2B39A 3FC0A 4CP9A 3DPRC 4AHYA 4P00B 1XPWA 5D8AB 4EN8B 1PMIA 1AVBA 1CAWA 4OHXA 4GQ7A 1OOPC 1RUJ2 2VOXA 3GCWA 4R8HA 4MADA 3JD72 5FZ1A 2JXAA 4E2SA 5D2AA 1UY2A 4QQPA 2E32A 4QWNA 1V6MA 1UX7A 1HDKA 1V9U1 2FCVA 1NG0A 4P9IA 1QJX1 1S2BA 1VBC3 1CQ9A 1ULGA 2CNAA 2VZSA 4ISQA 4XFIA 3O1RA 3DPRB 4COWA 1SFNA 5FUPA 1ULOA 3WNLA 4NIGA 3KCXA 4L92A 3JXSA 4BE3A 1MPXA 5KXBA 1UX6A 1A8DA 2ZHLA 2NP0A 3JCIA 1IG3A 1NXMA 3OGSA 4EN0A 5A3NA 1EAH1 3O1PA 5FZ7A 3MIHA 2BU9A 1DIWA 3ETQA 4UF0B 1QDOA 2QQWA 3RYPA 1MZFA 4BH9A 5H9QA 3UL2A 4LUMA 4LLOA 4NIAA 4CDWB 1OBNA 3PUHA 2ZBJA 3K48A 5I93A 1S2EA 4GA9A 4J6GA 4F3JA 2C26A 4CEYA 5FY1A 5L73A 2R32A 1CIWA 4E2QA 1LTEA 3ZIXA 4CDXA 4B7EA 3AP4A 1NE6A 5EFUA 2XQXA 5GJ6A 2DURA 4UW3A 2I2SA 1VRH3 3H0OA 3WINE 1N3PA 3C7FA 4AVTA 3ROUA 4Q4X1 2F4PA 1AR63 4DUVA 3ZSMA 5KBFA 5FYZA 4R9AA 1YI7A 3POFA 2YU2A 4GJZA 1AX0A 1DHKB 1UOFA 5CIRA 3WXPA 4CDQC 1RINA 5EZWA 5FO9B 4QXBA 3K3OA 2F4LA 3VD3A 4YYOA 1NA1C 1OI6A 5FZ3A 1GP4A 5FPZA 1WKYA 2XKPA 3DF0A 2W08A 3WDYA 1JI6A 1R081 1PK6B 2WQZC 3R4SA 1AR71 2J1RA 4FP3A 5CFDC 4QQ2A 4QHOA 3NMBA 4D6QA 2P6HA 4BJ0A 5C7GA 4JKMA 1DGWA 2B8MA 2PHXA 3RFRA 1DQ4A 2RS31 1PGSA 4FPEA 5K9YA 1ZRFA 4CDQB 1ALYA 5FO8B 2HLEA 2IXLA 2ORZA 4DNYA 1Y43B 1NA1B 2Q0AA 3M1HA 3MGUA 4PDWA 3ZPOA 1QJY1 1O3TA 1FMD3 1OA4A 5JOXA 1XU2A 1N47A 4XQ4A 3KT4A 1YJLA 2P3IA 2B46X 2XGXA 2IWGB 2XVKA 4HBNA 4NUBA 4OUEA 1TNRA 2BP6A 4KH9A 5CFDB 5FDBA 1NAEA 1OT5A 1Y3TA 3OY8B 3P3NA 5BPXA 3UT0A 3VLBB 3CBNA 3B69A 5DQ0A 1AJOA 2W95A 1HRI2 1K5MC 5K4LA 1W6QB 2RS52 1ZZ6A 2WC2A 1JODA 4XHBA 3HBKA 3SCGA 5A3TA 2PFWA 5IK4A 2WFF2 4FTBA 3FN9A 4HMZA 4RHV2 1EPZA 1UY4A 4Q26A 1YEWA 3FHQA 3BPSA 2P3KA 4NIDA 2DUQA 3MLJA 1C4RA 3BU7A 4XFAA 3MIBA 2GZWA 3FLRA 3PTYA 2XJUA 1XYNA 4HSJA 1BJQA 3ZYFA 4XBNA 1JZ6A 1AR92 1EV11 1KFXL 2PQSA 2F6BA 2R30A 3AP5A 4KQ7A 4LBLA 5C3RA 4CU9A 5EHDA 5F3IA 5LATA 2HWC2 3N9MA 4Q4V1 3B93A 2VZUA 4PF5A 4BXSV 1IOAA 2QFEA 2BTVC 1HX6A 2EIGA 2AREA 3B5LB 1GFF2 2VZ1A 1UYXA 3CHXA 4JHTA 4D8MA 4FXKB 1DQ6A 3I59A 3B9IA 1RUH1 5JR7B 4XFHA 4B1MA 1O5LA 1ZZCA 4NHLA 3N7JA 1KRIA 1DP0A 1HJFA 2J1SA 4AL9A 1XXNA 4LO7A 3PVOA 2JE9A 1BBT1 1QXPA 1RYYA 1BQPA 3OTFA 4GALA 3POGA 1R1A1 3D6EA 1LHWA 4HN0A 5DAXA 5F1RA 2BGOA 4XUQA 5GZFA 3WW1A 3CZUA 5LK5A 2ZX0A 2R072 2ATFA 3AYAA 5JXHA 4AI2A 3JQXA 3WUCA 5DDJ2 5GLWA 3VZOA 1GKBA 1WLTA 4YW4A 4MG2A 4F83A 3MIEA 1CGPA 3WW2A 1ASJ2 3QBQA 4RYDA 4XMAA 2ZHMA 1H1MA 1QJU1 4UFMA 3MW2A 5A3OA 4FAGA 1JYXA 1ZREA 2QQUA 2EIBA 1ZA4A 1WCKA 3FHAA 4M3CF 1DU3D 5SV5A 4XTMA 1IS5A 1H8TC 1H1IA 1DQ2A 3DN7A 1BYHA 4AI8A 1BXHA 1KGYA 1Q8VA 1YNAA 1RUC1 3I8TA 5LBEA 3UKVA 1AL21 2K46A 2RM23 3N7MA 1COV3 1ZRCA 3C7GA 4KBZA 1WCDJ 3H1YA 1S0GA 4LBKA 1CAXA 2WABA 2AACA 2QUOA 4YVSA 2DYCA 1DLLA 1V0AA 2QQPA 5DZGA 4BA6A 5FZIA 5FMBA 4OI1A 3E5QA 2OIIA 3AZZA 3A23A 1AYN1 4CEWB 1D4M1 1HRV2 4ITCA 4NVPA 4TLFA 4EWEA 5M0TA 1DG6A 1H8TB 1ZRRA 4XAAA 4ZU4A 2H0VA 2QKDA 2XWBB 5KHJA 2D3RA 4IL7A 1L7RA 4D7YA 4K3UA 3R05A 2P1BA 3N9PA 4JGZC 5KHHA 3NV1A 3QCWA 2AR6A 1EYBA 2NMNA 2WSVA 3TN91 4B8EA 1RITA 1C5IA 1PGW2 1W03A 2ARAA 1HLCA 2PLV2 3DEMA 4CSWA 1XRUA 1ND2A 1ZBE1 3N35A 1VBE3 1W8ZA 1W39A 4FFHA 4IEUA 4AFAA 1GNYA 4Y4RA 2JG9A 2YG0A 3K51A 3P1IA 1OFNA 5FY7A 2HH9A 2Z69A 4LBNA 2H6CA 3IT8A 2E26A 4NRMA 2ZGUA 1WCSA 4YWAA 2YYOA 2HEYF 2X5IA 5F32A 4LBMA 1MVQA 1PO21 4FOWA 1W6PB 1PNGA 2TNFA 1C5HA 2VZRA 4JGZB 1R091 4DO0A 1LGBA 2EXIA 5EV7A 3CZJA 5C5UA 1KITA 2O14A 2XPJA 3VHPA 2WFPA 1WW4A 2XUEA 1GZCA 1VE0A 4QDRA 3VBHC 1O3QA 3VDDA 1OQDA 2HYKA 2RR13 2ZX1A 2ARCA 2J1EA 2W1SA 4OZXA 3WDUA 1JZ3A 1ZBA2 5FZ9A 1O6UA 1GU3A 3A7QA 5C9AB 4PJYA 1J3PA 3RMXA 2VVEA 1ZZBA 2R062 4FPFA 1GV9A 3OEAA 3T09A 4Q8KA 3S0MA 2VUJA 4HVQA 1WW7A 5FRAA 2W2IA 2XBO3 1AHSA 5G05L 3R4DB 1CVNA 4O7XA 5DUUA 5LBFA 1VBD2 2WWUA 2VZQA 1FPN2 5DMYA 3H3UA 4MGZE 3UJOA 3VBHB 4UFLA 2P34A 3BODA 4R9DA 4FSJA 3ZXFA 4WBBA 3ZFEC 4IGOA 2FDFA 5J96B 4Q4Y2 1S1AA 1YJKA 4PIYA 1MZ5A 1HXS1 1H2MA 2DTYA 3ILFA 5L19A 1TMF2 2J1TA 1RGSA 3P5BA 1OA2A 3FUQA 4ISRA 3LSDA 5CA6A 2W87A 4Y1YA 1X7NA 5FZDA 3ZKUA 3AB0A 1D0HA 3HD8B 3IB3A 3ZO0B 1LEMA 5GLZA 2VMHA 1V6OA 2ID4A 5KC6A 1UOGA 1MEC2 5FZLA 1WCQA 3GF6A 1QJEA 1W6OA 3ZFEB 1RUNA 2CWMA 3CEWA 3AMPA 4FXGB 1FOD3 2LS6A 3CQOA 1RUJ3 4QX8A 4AQ2A 4OQ9A 4PIZA 2E51A 3JD73 4E4ZA 3KV6A 1PM7A 3NKTA 4LKFA 5DUXA 4HONA 1V00A 4UWDA 4GWJA 4Y22A 1US2A 3D4KA 3PIJA 1QQP2 4H3WA 5IAXA 5A6QA 4RR3A 3AFGA 2L9LA 1MQTA 2WIIB 4Q29A 5C8CC 2WNEA 3HQUA 2RMU2 1EY2A 2XJRA 2V73A 3OUJA 1RUE1 3KB5A 5IVVA 1AYM1 2VNRA 2VMDA 3N9QA 4XTPA 3BTZA 4U2AA 3ZSEA 2WSUA 3I3BA 1N1YA 2BNOA 2DWRA 3KHBA 5JPMB 2HEWF 3BOPA 1MR5A 4NPLA 1Q43A 3WNPA 4AVSA 1M06G 1CWPA 1NE4A 1YXWA 4PQ9A 1WUVA 2VZVA 2X53S 4BQ3A 1XSRA 5DAPA 3UNPA 1CX1A 1KJRA 2EA7A 4Y1XA 4PCRA 1CPMA 1J83A 4N7UA 1ZYBA 1H2KA 4JCKA 5AC91 2VMFA 3B3QE 5CNAA 1SEFA 3UGFA 2XQRA 2R042 2RDQA 1W3VA 3B00A 4D94A 5FXZA 1OKOA 4YVWC 3U10A 5LCWL 4XF9A 5EJZB 4AEDC 3BKZA 3HR9A 4AGRA 4LULA 4FPKA 2QQOA 2V5YA 1JZ8A 1C1LA 3SXWA 3RG0A 2DFCA 4CCEA 3N4MA 1GMMA 3VD9A 3H8RA 2IVJA 2VTFA 5T52A 1VBB2 1NY72 4NN0A 1RUI1 5ABJC 1Z78A 1B35A 2YC0A 1NQDA 2CDOA 4N9IA 4AGVA 1R64A 2W68A 1Q3EA 3SH3A 4LIUA 4GWMA 4YVWB 1V6IA 2BZDA 4AQ6A 4AEDB 1YYNA 2ZZQA 2MNGA 1SLBA 4HSLA 4A6SA 1C8M1 4DIQA 2YXSA 4IE6A 2PXJA 1WA6X 1OQ1A 2XL9A 4I3GA 2BFUL 5JZGC 5JSRA 4OUMA 3NV3A 4UW5A 1FAYA 4CPBA 4M01A 5EQUA 2DU0A 3FBMA 5I0DA 5IFTA 1S0IA 1YLLA 3D82A 1YIPA 3ON7A 1ENQA 1OQEA 5FZFA 4YW1A 4LT5A 3U4XA 4DFSA 1WD4A 4HT1T 5A7OA 4DUWA 1D7PM 3KGLA 2OW4A 3ELNA 2RJLA 4GMP0 3WF4A 3ZXDA 3Q8CA 5FYMA 4GH4A 2ET1A 1UU4A 3PVNA 1HRI3 3ZSKA 2YGLA 2Z2SB 3VDAA 2RS53 2ZPXA 4M3CE 5JZGB 5C4WA 4YGCA 3ZFGA 4IV3A 2WFF3 3JZVA 4RHV3 3I4IA 1RMU1 1LHOA 2A3XA 2H6BA 4JX0A 4D7TA 1TG7A 2BDRA 3KD4A 2VD7A 3SEPA 2BRTA 1IKQA 5LEJA 1W8TA 3EMRA 4HKLA 1LOCA 4O61A 4OMCA 1OUXA 1AR93 2JG8A 3MFAA 3T1MA 4DXZA 4FFGA 1Q5OA 3VGIA 5CADA 3OBRA 2HWC3 1A6CA 4JRAA 2OQ7A 3CJIC 5K8SA 3BGAA 3HQXA 1LKNA 3ZM8A 5IVFA 3H3LA 1Q8PA 4UYBA 1IS3A 1KS4A 4HL0A 5IK8A 2P3YA 2Y6JA 5DAWA 2A70A 4TTGA 3IWZA 1PGL2 2VVDA 4P9GA 1VAVA 4C0BA 2WS92
chains in the Genus database with same CATH topology
4RQPA 2A75A 2BVBA 2PHDA 5DG1A 1DGRN 3PMSA 3R6SA 4E4DX 1ZVFA 3DGTA 4U36A 3CJIB 2QJVA 1RB8G 4NO4A 1SDWA 2LTNA 4QU2A 2FBEA 3NSTA 2ERFA 4XFCA 4IEZA 5DDJ3 3CO2A 1DYPA 5I8YA 2OZ6A 4J1WA 1RTVA 1ASJ3 4OHZA 3HN1A 4MH0E 2IXKA 2RE9A 4EV0A 3MIDA 3NW4A 1GZWA 4URTA 4M0HA 2BNMA 4FOYA 1O3SA 1QMJA 2MHFA 1V6JA 3VBFA 2HWF2 5JVVA 5FREA 3WHUA 1REEA 3JU9A 4AFDA 2DCJA 1F9KA 2G4IA 5ACA3 4C90A 4ONUA 4E27A 3AKTA 4DMIA 4LE3A 1PZ9A 3AXDA 1ZRDA 4M3CA 2D6OX 1HRV3 1ULFA 1IPKA 4XQWA 4XZPA 3AKPA 2HWB2 1QY4A 2MEV3 5T50A 2IC1A 1ND3A 1ULCA 5HCFA 4YGDA 5FMOS 1OPMA 1B35C 1LENA 1FMD1 3X29B 3IM0A 4UBHA 1Z7S1 1A8MA 3H3ZA 2ARBA 2IXCA 4AFMA 4AVVA 3VBOA 4OHVA 3W9AA 4FPHA 1PO11 3WDXA 2ET7A 4QX5A 4LA2A 3MICA 3ZN6B 1FX5A 2WLQA 4S2DA 1PIV1 3EO6A 1U0AA 4FPJA 2CGPA 3WP3A 4MV2A 3O0VA 4OI4A 4P9XA 5C4WC 4YARA 5I91A 4IV3C 3WQ0A 4WVMB 1ZBA3 1XQNA 5BNPB 1DFQA 2E53A 2FZ2A 2R063 4RGAA 2OZJA 2VULA 4IERA 5A33A 5CFCA 1CN1A 2HWD3 3N7LA 5CU1A 3WG4A 1VBD3 4RS5A 1FPN3 4N53C 5JIUA 1URXA 2O0OA 3PVBB 2EXJA 3THTA 3ES4A 4BIFA 1IKPA 2ZJCA 3WLUA 4MYEA 4Z8BA 2QCSB 4KU8A 3ME2A 4Q4Y3 4AI0A 4FPGA 3SHRA 3AMMA 1SBEA 4OI2A 3M3IA 1TMF3 1BZWA 2ZGMA 4TZDA 2I45A 1J59A 2WQ4A 3L2HA 3VBSA 1GBGA 1LOFC 4FPOB 4LTAA 4N53B 4YM2A 2K9ZA 3AKQA 2UURA 2EVXA 3WG2A 1MEC3 1X8MA 1ZX5A 4P9JA 4N9HA 1X8EA 3EQEA 1UIKA 3HIFA 3J9SA 2HKXA 1KQRA 4L2NA 5J48A 4NOTA 1NCRC 3OBTA 3INAA 2VPVA 2UWAA 2PHTA 3GBGA 2BQPA 3KMHA 2JD4A 5J7MA 3H7YA 2HWE3 2A5ZA 1QQP3 3ZXEA 3LCPA 3GZUC 4LBJA 5DG2A 5CG8A 3H1MA 4K20A 3EBRA 4WV8A 1QKQA 2RMU3 2JJ6A 1AL0G 3NAPA 1MS9A 1V9U2 3MI8A 1QJX2 2VMGA 5T3NA 4QGLA 3H7JA 1FXZA 1GNZA 1NCRB 1NZCA 2D93A 4OFGA 4QGMA 2XG3A 4A7ZA 4KBBA 1YIFA 1VP6A 5E88A 4ORFA 1EAH2 1HIXA 1ND3C 2BWCA 1UIJA 5AFEA 4Z2WA 1O5UA 3IPVA 3AZWA 4HLTA 5AVPA 3V56A 3ILRA 2R0HA 1FOD2 5FQ0A 2RS11 3RSJA 2VOWA 2R043 1HW5A 3PLQA 1V6NA 3URFA 3AZYA 3WCRA 1RVF1 1CESA 3NO8A 3DUIA 2D3SA 4IESA 3I54A 2EAAA 1JUHA 4Y20A 2FZ1A 2P37A 3O7OA 5A3LA 2D97A 4HPKB 1BEV1 1XYOA 3VKLA 5HCBA 1MVEA 1VBB3 3UJQA 1OOPB 1Q8OA 3V64A 1WA4A 2R1DA 1I9RA 4FOQA 4JGYC 4AF9A 2GMPA 1J3QA 4YZ4A 1JTZX 1XYPA 1CX4A 1GANA 3SITA 1R082 4IEVA 1H8VA 3WX5A 3KS7A 4WVVA 2XLGA 3AZXA 2W0XA 4QPIA 2RS32 4JGYB 3POYA 1POV0 1LODA 3GHNA 3MW4A 3SCFA 1QJY2 3GHMA 5JAXA 5KHIA 1HKDA 1NOVA 3E97A 2YPJA 4A3XA 1VBA2 2GDFA 1LOEA 1SBDA 2VOKA 3WT3A 5FTTC 5FLIA 1S2KA 2WA3A 3QOPA 4EN9B 4OLLA 3VHOA 2JDZA 1B09A 1DQ0A 1QNYA 2JKBA 4XE9A 5BNNA 1W6NA 1Y9QA 2ZMKA 4XFGA 2PAKA 1QJZA 4Q4W3 5GALA 4JRLA 4HVOA 1SMVA 4QQOA 2GAUA 4XIKA 4K7JA 1W6MA 1DBNA 3WD5A 1EV12 2DUPA 3H9AA 1RUD1 4AI1A 3NWKA 2WS93 4GB33 4Q4V2 5GKAC 4ZXKA 1O4ZA 5FFOC 3ACLA 4GKYA 4B3NA 1XNDA 2D5HA 1IGOA 4AQTA 2VQ0A 1RUH2 3QLQA 3RRDA 4G3YC 2DVDA 3POWA 4Y1VA 2DVBA 2X8KA 2G9FA 4RGGA 1BBT2 1O3RA 4BMEA 4MX3A 1R1A2 1NCQA 1AXYA 4DQAA 1PVC1 4HVRA 2W39A 1LECA 4Q0QA 3ZXLA 3J4UH 1POV3 4Q0SA 1S0JA 3GBFA 4R4ZA 4W6XA 2UWCA 1UPSA 3GBWA 3HMYA 3ECQA 5FO7B 1K5MB 2WT0A 5C33A 2HWF3 2DVGA 3AP6A 4MGKE 4MVTA 3T1LA 2R49A 2O1QA 2RHPA 4HZFA 3LOIA 1GZ9A 2P3JA 3SISA 1VB4A 4B4RA 5L7OA 2D6LX 3H1WA 1RUC2 2UYAA 1AL22 1O4TA 4OHWA 4WM8A 3KT1A 3D0JA 2HWB3 5T5LA 1O4YA 5A3MA 2R6QA 4LBQD 1G86A 3L9JT 4R9BA 2VMIA 1JHNA 4ZKTB 4PIXA 1AYN2 4JC1A 1D4M2 4XFBA 3VL8A 2EXHA 5I0RA 3WP5A 1QF3A 3M3QA 3T2TA 1HRI1 3LA7A 4Q1RA 1WLWA 4MXWA 5I0TA 4YW3A 4CDUA 1D4VB 2ZS6B 2HJIA 2UY8A 5LK7B 3ES1A 4MUVA 2XLFA 4CEYC 1TME1 5JI9A 2ZX4A 3M3OA 4NR1A 1ZBE2 1NLRA 1YHFA 4CDXC 4FO9A 4GXLA 4XXAA 5T5JA 1FV3A 3MFCA 5ACA2 1WMEA 4QM8A 3N36A 3VZMA 4WZCA 1QWRA 2HWC1 3AXEA 2XJQA 3NVCA 1DZRA 1RUF1 5GZEA 3R0RA 3VBUA 2ZAHA 3TNQA 1I3HA 1KXGA 2WNVA 4EN6B 1MS1A 4CEYB 2MEV2 3FX3A 5IUQA 4CDXB 1J1LA 4I30A 4EROA 3FJSA 3LKJA 5KXEA 1F5JA 3LAGA 3KLSA 2FMYA 4AHWA 3VZLA 2ZTNA 4YNIA 3IN9A 1DZTA 4HN1A 2R071 3ZYRA 4MLOA 1L3JA 1OPOA 1YCIA 2AZ5A 1O7FA 4PDWC 1X82A 4QPGA 2ZX2A 2A7AA 3WZ1A 3TOJA 1SCRA 1DGWX 1D2SA 4DRRA 5E8AA 2OVUA 3W59A 4GMP1 1AX1A 4IV1A 4XETA 5KWRA 4I0AA 4RSUA 5BXXA 4BYYA 3ZMOA 4EWDA 1S0CA 2WZR1 3PNAA 3BIWE 4C1XA 3FLTA 3WV6A 2YZ4A 4PDWB 3ZSLA 1A3KA 2D7FA 2XH6A 3KM5A 4XMIA 4PBPA 4Y24A 5BYNA 1XU1A 1RC6A 2X29A 1ZZ7A 2HWD2 4LO8A 1GQHA 3AMHA 5IK7A 3FMGA 1LHUA 4XJAA 3VZJA 3S7EA 1V9U3 1QJX3 2A3YA 2Z5WA 4WM7A 3VKNA 1I5ZA 1G9AA 1REFA 4V1PA 4L97A 3JB4C 5FCCA 5F9TA 2PA7A 4AI3A 1CAVA 2PLV1 1DGLA 1WLCA 5IK5A 4S2GA 1RHI1 2MPFA 3J8F2 4L9BA 1RUE2 2WNUA 1AYM2 1SCSA 1ULDA 2DVAA 3MDPA 1EAH3 1LCLA 4GWNA 2E9QA 1WW5A 5FLHA 2ES3A 1S55A 2XVLA 1QXRA 3A4UA 4I02A 4FQZA 3WG1A 3I59B 3RQ0A 2KA3A 2LM3A 3JUUA 4X8NA 5JPNB 5FOBB 4YRDA 5AC92 4YZ5A 2HWE2 2LUWA 3ZN5A 1FYUA 1ZBA1 2WT2A 1SACA 4K9SA 3TNPB 1ENSA 3ZYJB 3USSA 4B29A 4K1YA 2G9GA 1G6NA 1R1ZA 1GICA 5SV8A 1H1AA 3V0BA 4CYDA 1RUG1 4D3WA 1JYIA 4YVSC 4N43A 4BLJA 4ZU7A 3O0XA 3CNAA 3USUA 4LR4A 2PHWA 2C1FA 1R083 2WNVC 1AR73 5J98B 5C8CB 3RPQA 2BVVA 1DGRA 5KXDA 2VNOA 4FVVA 4B4PA 1PVXA 3HT2A 1BCXA 3GALA 1C8M2 3E6BA 4RL7A 1H9WA 2RS33 1Q8SA 2YROA 2ZHKA 1RIRA 4I0BA 2EAKA 1CAXB 1VALA 4OVEA 1UAIA 2SBAA 4YVSB 4YZ2A 4WVWA 1FATA 1LJ7A 1PZ7A 1ND2C 3AZVA 1QJY3 3ZYIB 3UV9A 1A78A 2D6NA 1C28A 1TE1B 1U5YA 2JG9C 5IT6A 4Z07A 1UCXA 3VKMA 4BHPA 1VBA3 1F5FA 2X5IC 4AVAA 4XJ8A 5L36A 4JAAA 1G9FA 1QQP1 4LEJA 2WL1A 3KCCA 4RA0A 1S0EA 1RMU2 4ES8A 1DZQA 4YG6A 3OPZA 4YZ1A 4IEOA 1FI2A 2VU9A 3VDDC 4F8AA 4LHKA 5I0SA 1JYCA 2Y0IA 2JG9B 3RYRA 2H0BA 4LBQA 3KCYA 4H14A 2AUYA 1EV13 3ZFFA 5EYXA 3ZN6A 5KHGA 2GALA 2X5IB 4Y5Z0 4G4FA 1HQLA 2GMEA 4Q4V3 5ABJB 1QHDA 1YWKA 5BNOA 3VDDB 1H0BA 1RUH3 2A6VA 4PLNA 3WY6A 2CY6A 1AR82 1BBT3 5H9RA 1AJKA 1R1A3 4GKXA 4RFT0 4YGEA 3ZXGA 1LULA 2PHRA 2ZABA 3B7MA 1GYKA 2WINB 3R4UA 1LB2A 2FHRA 4COUA 1VBC1 3RS6A 5B2GB 1GNHA 1N3OA 4ATEA 4Q4W2 4H7MA 1OFSA 5J09A 2R16A 1YFXA 3MPBA 3ZXAC 1TNFA 1NY71 4XJZA 1QJU3 2UYBA 2VQAA 1H9PA 4Y4YA 3BB6A 5AFBA 2PN5A 3ZPYA 2NZ9A 4PBOA 1OSGA 1Z0HA 4PLMA 4GB32 1RUC3 2B9UA 4RR3C 3WDVA 4XJ9A 5HXVA 1MQTC 1AL23 1U5XA 1YFWA 1G9DA 1BVP1 4YG3A 2C9AA 2WLPA 1MZ6A 1W6OB 4I2OA 4CTEA 3RJ2X 2I74A 4XPVA 1MS0A 4FQ4A 1UKGA 3B94A 2CL2A 4K8FA 1AYN3 4YM1A 4XDQA 3E6DA 1D4M3 3V0AA 1VRH1 4Y22B 4YFZA 2EXKA 1CAUA 1AR61 1MQTB 2DUOA 3VBRA 3LWCA 1Z7S2 1DQ5A 3VL9A 4DS0A 5FMOL 3KSCA 5K0UA 1PO12 2ZMNA 1SLCA 3OYWA 1ZBE3 1J58A 4BPZA 4EWAA 2IFRA 5K7PA 2ZGTA 3ZMNA 4LLFA 1UZZA 2BWAA 1LHNA 1PIV2 3VV1A 4XEZA 4XBLA 4IEWA 1AZDA 1ULEA 3H50A 1WMDA 3P3PA 1RJ8A 1U5IA 4LO6B 4OHYA 4S2FA 2Z42A 1PZ8A 2WWSA 4KU7A 5D8AA 4AG4A 2WS91 3WP6A 4EJRA 3NKGA 2EALA 4QT6A 1OLRA 1S0FA 4XXPA 3TYJA 3SNMA 2WZPP 1BMV2 4ATFA 4TWTA 4DZGA 1OKQA 4AHXA 1V70A 4KGQA 1U5ZA 1LOBA 1X33A 3HBZA 1CR7A 1UZYA 3KT7A 3O14A 2IZWA 3ZVXA 3DPRA 5J37A 1W0OA 4P9LA 3MF6A 3WNXA 1B35B 1ZZ8A 1OD5A 4A2UA 2QDNA 4Z82A 1E57A 1OHFA 4GH4C 1DDLA 2UWBA 4LUKA 2XB6C 3ZFGC 2UY9A 5T54A 3JBG2 3ZXKA 4H7LA 2BGCA 1D0GA 2XHKA 2GN7A 3WQ7A 4DB5A 4MZUA 4CDWA 1PNFA 1XE7A 1AUYA 3ZDSA 4CP2A 2JG8C 5HBAA 1QH6A 4XF4A 4HK8A 1NYWA 4GH4B 3JB8A 5T55A 5FBZA 2D5FA 2D44A 2GC2A 4NWVA 1C57A 2GC3A 2W52A 4GIQA 5C4WB 3ZFGB 4IV3B 4IXLA 1AXZA 2GC0A 2VUAA 2FMDA 1KFUL 2VECA 2KXLA 4FT8A 4XF3A 5DUWA 2Y0OA 4RQPC 5JOZA 3J8F3 2JG8B 4YW2A 1RUE3 2YUEA 1AYM3 1LHVA 1PK6A 3O12A 1VLNA 1I6XA 3PJQA 1CONA 3IDBB 3NV4A 4R52A 4A7YA 2N7GA 3MYXA 4BM8A 5E89A 2E6VA 4Z1VA 4LE4A 4K6BA 2RM21 2ZCWA 1COV1 3FWEA 4ZU5A 3DKWA 4CDQA 2VG9A 4YLZA 4XF0A 5H9SA 3BOWA 4Y1ZA 4RQPB 5E16A 5AC93 4OUSA 4X6RB 4E2GA 1NA1A 4OULA 4YM0A 2XWJB 2RS12 3O5SA 2AH2A 3VKFC 4P5HA 3IDCB 3U0ZA 3VBFC 4P9YA 2NYYA 5CFDA 4EN7B 1RVF2 3HWJA 3OY8A 4GULA 2DVFA 4KNCA 4DPNA 3D0SA 4LO4B 3LOBA 3GNEA 1W6QA 4W6WA 1BEV2 2JICA 4XJWA 3AMQA 2OA2A 2ZMLA 4HETA 4BMBA 1F31A 4FTSA 4I0WB 1GZWB 3WDWA 1VBE1 2CAVA 4SBVA 5I8TA 1WBFA 4YGBA 1G8WA 1VR3A 1WLDA 5BY5A 3VBFB 3VHRA 3BTAA 3IKWA 1C8M3 1WW6A 3PMEA 3FE5A 1K5MA 5GZCA 2HEVF 4KG0A 3M70A 1PHMA 3VBOC 3J26N 4Z92B 4Q1PA 2ZACA 4QPYA 5D1IA 1IQAA 2NMOA 2ZGQA 4IEYA 4FTEA 2RR11 3M7AA 4M3CB 2BBVA 5JSOA 3M3EA 3CF6E 1ND3B 1SLIA 1W0PA 2DCYA 4B4QA 3GZTB 4I3PA 4Q4X2 3KQRA 2IFWA 3AJZA 4BCUA 2CV6A 3ILNA 4ES9A 4KWJA 1HV1A 2XBO1 3VBOB 1RMU3 1U12A 4LA3A 2D98A 3M8LA 3TWIA 2NN8A 4YFWA 1QDCA 1AR72 3Q9OA 4XF1A 3OD0A 5JOWA 4W65A 4CDWC 1XNCA 2P17A 5AVAA 2FQPA 4Y26A 5CFCC 2ZGOA 3ASIA 4RS5C 3AYCA 4COZA 2WKKA 1RUD2 1VJ2A 2TEPA 2GNTA 3DL3A 1KD7A 3AYEA 3QH6A 4PLOA 5JOYA 1JOJA 2Q4SA 3WDTA 5I0UA 5HCAA 3NL1A 3FBYA 4XILA 2A6ZA 4AYUA 4KWKA 1AR83 1EP0A 1FOD1 4MXVA 1RUJ1 1GR3A 4LHLA 4Q8LA 2SLIA 3E5XA 1SBFA 2ARXA 3JD71 3KZ4C 1J1TA 1D2QA 3GZAA 4CEWA 5A33B 1ZZ9A 5CFCB 4FBFA 4Y1UA 1H8TA 2GH8A 3VBSC 1H30A 5HI0A 4RS5B 2E7QA 2GC1A 2IXHA 1PK6C 2ZAAA 4QGNA 1JH5A 1UD1A 1X50A 1PVC2 3B9CA 4F7ZA 3OJBA 3ZXJA 4C0HA 2VH9A 4COYA 3BPZA 1APNA 3DV8A 1RL3A 4KG8A 2D6MA 2CGOA 3AYDA 1Q56A 3AFKA 3WOGA 1GSLA 3VBSB 4AHZA 2B42B 3VZKA 5EXOA 2PHUA 4AFCA 5J36A 1W6PA 4JGZA 4CP0A 3QH7A 2BEOA 3NAPC 2WA4A 1MS5A 4Q0VA 4AVCA 1FNYA 3NV2A 5DUVA 4K21A 5A32B 4JQRA 3RMYA 4WVZA 2DF7A 3ATGA 4YSFA 3OD4A 3MPPG 4J1XA 2NM1A 3FFZA 1S0BA 5GZGA 2VOVA 4KGGA 2QZ3A 1MACA 3ST7A 4BIOA 1NQJA 5C9AA 3FZ3A 2AGSA 4UW6A 2VW0A 2VVFA 1IPJA 1Z7S3 5I8SA 1VBA1 3AKSA 3NAPB 3H8UA 2GU9A 1PO13 4I01A 3MLKA 3VBHA 4MGIE 1QJU2 3RI8A 4AW7A 2ZX3A 1CD3G 1UL9A 1SQ4A 3S30A 3JQWA 3NJZA 4DY3A 1WBLA 1TME2 3AK0A 2OUJA 1PIV3 1IZ3A 4FCAA 3OF1A 2YGMA 4JDMA 1NXD1 5KC5A 4BOWA 2ZGNA 4Q0UA 1CAWB 2DFBA 3S6PA 3IPVB 1BKZA 5FQ0B 3WR0A 1ENRA 3OGGA 1OA3A 5JI7A 5BV6A 1RUF2 3A0NA 2AENA 2DCZA 2PQQA 3CJXA 3ZFEA 2Q1MA 3E6CC 2XJPA 4XW3A 4UBGA 4Y20B 5TSWA 1KJLA 5JLVA 4AXOA 2RS51 2XJTA 4HK9A 1WGPA 2XJVA 2WFF1 3ALQA 3TN92 4RHV1 5C8WA 4L8QA 5EJ3A 5FAXA 5LRRA 5FPXA 2JENA 3OGJA 2Z79A 3S7IA 2ZA9A 4QPIC 4N7IA 1KDMA 3AM2A 4AWDA 4D69A 1AR91 2TUNA 3MZHA 2PAMA 2K2SA 3HT1A 4COVA 1SLTA 4HKOA 1IS4A 1PO22 1REDA 4XHXA 5J3UA 4KL1A 4WZFA 1R092 3JBG3 4AK3A 4CRQA 1O91A 5GLUA 2NPIA 3U07A 4CEWC 1IHMA 3WUDA 5C8CA 4QPIB 5JMCA 4G9SB 5BNNC 4Q27A 2WZR2 3CU7A 2D6KA 2EF6A 2ZZJA 2GN3A 4XYXA 2C5DA 2DU1A 2R0FA 3WP4A 2CTVA 3FLPA 3IBMA 5DDJ1 4LNVA 4X6QB 4BWOA 4M00A 4NHMA 4IQPA 2XUMA 1G9BA 2XVGA 5BNNB 1ASJ1 3OCPA 1W6NB 2VXRA 3LSEA 5JCTA 4SLIA 4DRVA 4L11A 2YHJA 4MGYE 4P9WA 4AVBA 1HXS2 4UW4A 1BK1A 4ASLA 3RI9A 4YVWA 2IXJA 2A6WA 1W6MB 1RHI2 2XKOA 4NWWA 4AEDA 3I2DA 1V6LA 1NCQC 2DCKA 1ZNPA 2O8OA 2D6PA 5JDBA 5ACA1 2E7TA 4NPRA 5C9AC 4JVAA 5KXCA 3WG3A 3RDIA 2RS13 2GH2A 1H2LA 2A3WA 2ZHNA 4JDNA 5ABJA 3AP9A 2B5HA 3PJYA 1HQNA 1HRV1 1FNZA 1EPWA 2QVSB 3M2MA 2MEV1 1RVF3 1HV0A 1LU1A 3RJRA 3MLLA 4N90A 1NCQB 1UKRA 5JZGA 5L7OC 2I07B 1BEV3 1PGW1 5JSPA 4YZ3A 4WM8C 1VB2A 1GQGA 4BLIA 4YM3A 4K1ZA 1UU5A 2PTMA 1RUG2 3SH4A 3MF9A 5BUVA 1F8VA 1UW8A 4YG0A 2Y38A 1OLQA 1MS3A 5LEKA 1CPNA 5LRSA 5L7OB 2OUHA 2QDRA 3MIFA 4LO5B 5CG9A 4W6YA 5DZEA 1QU0A 4WM8B 4CDUC 3UK9A 2XJSA 4DY5A 3CLPA 3LB9A 1Q8QA 4FOVA 2XLAA 1TEIA 3C3VA 4FAHA 2A71A 2AYHA 2R061 1C3HA 3M4FA 4Q4X3 3ZYGA 3IMNA 2A73B 5F5QA 4R9CA 2PAEA 3CJIA 4TSVA 3W58A 1H4HA 2HWD1 1VBD1 1FPN1 4UXAA 4MXWB 3APBA 4CDUB 4K40A 1RUI2 2NQYA 2VNGA 3VBUC 2TBVA 1FT9A 2ZGPA 2CAUA 5CB7A 3PVEA 4Q4Y1 4P14A 2ENRA 1DF0A 1N1TA 4BQ1A 1KDKA 3G6JB 1TMF1 2VY0A 4QQHA 4QMAA 4RD7A 3ZN4A 3J8F1 2ZGKA 1JBCA 1F2NA 4R4XA 5JWPA 1Y7BA 1RUD3 4A7KA 2JECA 2D3PA 1XNKA 5FOJB 1G7YA 1MEC1 3VBUB 4E4SA 2WNVB 3KGZA 4HANA 4QPGC 4C1WA 3EHKA 4O9GA 4XIOA 2VW1A 2HWE1 1AF9A 4IV1C 1UN1A 4INDA 2ETEA 4XOGA 5DZFA 1LOGA 1ND2B 1PVC3 2RMU1 2BYVE 1VAKA 1VBC2 4QPGB 2LALA 4NHKA 1C1FA 4IETA 5GM0A 3BALA 3G7DA 1G9CA 3TB0A 3IDEA 1QOSA 3MEPA 1QNWA 4IV1B 3UKTA 1LR5A 2OPKA 2IXIA 4QD2A 2DTWA 1UU6A 1YO8A 2Q1ZB 5C6CA 3B01A 3LGRA 2PHFA 2D43A 4FP2A 1BVVA 4S2HA 3N7KA 4WM7C 3WHTA 2ZKLA 2KM2A 3VZNA 3WQ1A 2WT1A 1C8NA 4JDOA 2R041 4WVMA 5F6KA 1N1VA 2E63A 4META 3VKOA 5BNPA 3BCWA 4JTOA 2WNUC 2A6XA 1QOTA 3MW3A 1IS6A 2V09A 4IEPA 2BPA2 1XNBA 3TBDA 1VRH2 2QZ2A 1JUIA 3LA2A 4WM7B 4QQLA 3ZSJA 1AR62 1CJPA 1VBB1 4C91A 2C0ZA 3WW4A 1SLAA 4IEXA 2JEMA 1CAVB 2RJKA 1TME3 2BFUS 4AEKA 1SFYA 3LA3A 1M4WA 2WNUB 4E9KA 1HQWA 3L2YA 3O0WA 2E7AA 5FLJA 1QXJA 5F6LB 5GLVA 1GLHA 1CJDA 5GLTA 4N53A 4Q2FA 4MSVA 3D5OA 1RUF3 4I09A 2O8QA 5H9PA 3ZIWA 4ASMB 1UPIA 4N43C 4DINB 3MIGA 1LGNA 2PELA 4RR3B 1FMD2 4AEMA 4HFSA 1V6KA 4B7KA 1X36A 1AR81 1DQ1A 5EYYA 3TN93 1LOFA 2B7YA 3A0KA 4XBQA 4YW5A 1SLLA 3WW3A 2ZOEB 4D7SA 3AKRA 2R073 3V0BB 1YRZA 3E5UA 2CYFA 3FUOA 4N43B 3AP7A 3IIAA 3TRSB 2JX9A 1LOAA 3USUB 1NCRA 4Q4W1 2VW2A 1PO23 2R1BA 3ENRA 1NLSA 1KS5A 1N3QA 1R093 3AMNA 3PHMA 4GMP3 1TQ5A 4LBOA 1UMZA 3HAGA 4XJUA 2VGDA 3RNSA 3WVJA 1ENXA 1FV2A 1N1SA 1PGL1 2PHLA 1J3RA 2WZR3 4AQSA 4GB31 1LU2A 4JV4A 3RYKA 1ZM1A 5GZDA 2BW8A 3WCSA 2GMMA 3SCHA 3FHIB 2NLRA 1H4GA 3ZFFC 1W2UA 4TYSA 4XFFA 4CP1A 4OI0A 1AX2A 2PYTA 4HPKA 2K0GA 4X8PA 1YUDA 2WJSA 1POV1 1QGLA 5BNOC 1OOPA 4FPLA 1WMFA 1H2NA 3POSA 4HKWA 4O9EA 1HXS3 2A6YA 2GNDA 2PLV3 2GSYA 4LBQB 2HWF1 1YFUA 1RHI3 4FPYA 4LHNA 3V65A 2GNMA 3ZFFB 4QM9A 1QOOA 3RZZA 1JN2P 1VAMA 5T5OA 3D8CA 5BNPC 3VUOA 4BZ4A 1WD3A 5T5PA 1MZEA 2ZGRA 3U11A 5BNOB 2P2KA 3EXUA 5JIAA 2RM22 3RWNA 1COV2 1I1EA 2QE3A 3THPA 3SH5A 2HWB1 2ZKNA 4JGYA 2UU8A 4M0NA 5E1RA 4AGGA 4KWLA 3CL1A 2Q5TA 1T6GC 1BMV1 1YFYA 4DOUA 1S0DA 2CWSA 2ZGSA 2B45X 3QD6A 1RUG3 1ONAA 3B02A 5CBLA 3GYDA 2ZGLA 3AJYA 1VBE2 2D40A 1RUOA 1RJ7A 1DYKA 3C2UA 1UF2C 2GNBA 2Q8OA 2YY1A 4AE2A 4H55A 2DV9A 4CZSA 3QACA 3VBRC 2ILMA 3M3CA 3JBG1 1AXKA 5CAZA 3ZYPA 2Q30A 2YDEA 3LZZA 4QHBA 5K0UC 2CGNA 3EJKA 1OMIA 4FPCA 4AFBA 1LGCA 5CVRA 3V0AB 2RR12 4JTNA 2BUKA 2XL7A 4QXKA 5A32A 3ZX7A 3TAYA 1CAUB 5DXDA 3SLIA 2YV8A 2BNNA 3VBRB 1RUI3 5BNQA 3FFQA 4AEJA 2XBO2 2QNKA 1MS4A 3SMHA 5K0UB 4L99A 1JW6A 3OYWB 5D8AC 4XQDA 1YI9A 3N3HA 3VN4A 1VIWB 1LEDA 3UKNA 1LESA 2JE7A 5KHKA 2YMZA 3AX4A 3I7DA 5EWSA 1MS8A 4Q0PA 2OYZA 1QH7A 1JXNA 1LRHA 3VHNA 2Y26A 1XE8A 4IEQA 2DCTA 2B39A 3FC0A 3DPRC 4AHYA 5D8AB 4EN8B 1PMIA 1AVBA 1CAWA 4OHXA 4GQ7A 1OOPC 1RUJ2 2VOXA 4R8HA 3JD72 2JXAA 4E2SA 4QQPA 1V6MA 1HDKA 1V9U1 1NG0A 4P9IA 1QJX1