4COYA

Crystal structure of epithelial adhesin 6 a domain (epa6a) from candida glabrata in complex with galb1-4glcnac
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
232
structure length
232
Chain Sequence
GWTDPTEFPLGCSPNVTTPKNGLSMELYSYDYLKSGSNPCWDAAYLDPNYPRTGYKSHRLLAKVENVAGNINFYYHAPMGCTSLFDTLPQAYNYRTPLTMTNFTMLLYGYFKPKVTGYHTFTISADDLLFVNFGAGNAFDCCKRESSADDFGNYQAYAVWGSQTAKDDLTVHLDAGLYYPIRIFFNNRDNDGALSLTLKTESDPNPVIDFSDYFYSFDDTKDGCPGLVSYDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords EPITHELIAL ADHESIN 6
publication title Structural Hotspots Determine Functional Diversity of the Candida Glabrata Epithelial Adhesin Family
pubmed doi rcsb
source organism Candida glabrata
total genus 56
structure length 232
sequence length 232
ec nomenclature
pdb deposition date 2014-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10528 GLEYA GLEYA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4coyA00
2XJPA 4COVA 4COZA 2XJVA 2XJQA 2XJSA 4GQ7A 4AI1A 5A3MA 2XJTA 4LHLA 4CP2A 4AHWA 4AFAA 5A3LA 4AI2A 2XJRA 2XJUA 4AFBA 4A3XA 4AF9A 4COYA 4AFCA 4CP1A 4AHZA 4AHXA 4COWA 4AHYA 4LHNA 4ASLA 4AI0A 4LHKA 4COUA 4CP0A 4AI3A 4D3WA
chains in the Genus database with same CATH superfamily
1JZ5A 1C5HA 1C57A 2GMEA 4NUBA 2D93A 3BYWA 1QEXA 2P17A 3R4SA 2YY1A 5FPXA 3POIA 1AR63 4R4XA 4CEWB 4QKBA 1DZQA 1MZEA 5IW0A 5LBCA 1NQDA 1CVNA 4Y5SA 3WF2A 2ETEA 3IB3A 1LJ7A 4GMP3 2HWF3 3A22A 1WGPA 2VVFA 4JKLA 1EAH2 2FMDA 2XUEA 2UWAA 1QOOA 2OPKA 4NROA 3S6PA 2OT7A 1JHJA 2WN3A 4WVMB 2WFPA 2ZABA 4CEWA 4MGKE 5J98B 3N9PA 1Q8QA 1VBD3 2OZJA 2DV9A 1IG0A 3ZYPA 5GZGA 3MUZ1 4A7YA 1DQ5A 4D3WA 2ZMNA 5LBEA 4Q4X1 2BU9A 4COZA 5EYYA 3ZFGA 1PM7A 3ZXJA 1U5YA 4WVMA 5JUVA 2GSYA 2VE1A 5FZFA 3RJRA 1UNBA 4ATEA 5I93A 4WVWA 2P6CA 1IKQA 2HEVF 1QJX2 3RQ0A 4RHV1 1FV3A 1O91A 4MOAA 1JYXA 4XHBA 4B8EA 5FMOL 3WW2A 3WR0A 4QWNA 1RUC1 3A7QA 4P9IA 1AR83 4Q5OA 1FPN3 4HK8A 2NYYA 4M3CB 1NXMA 4XJUA 5LRRA 1L7LA 5E16A 2WWJA 1OHFA 2XJPA 3GF6A 5FREA 3IDCB 1UZVA 2WO1A 4RR3C 4KU8A 5LK7B 4V2VA 1G9BA 4Y26A 2Y6KA 3BU0A 5JZGC 2B9VA 3RJ2X 2ORZA 5BNQA 5FY9A 5F8PA 3MIDA 5BNPA 4COYA 2W08A 4O61A 1Y7BA 4IE4A 1KJLA 2BBVA 2E7AA 3N35A 4Q4Y1 3ZSMA 5EJ3A 4OVEA 5AVPA 4ARXA 5FZ6A 2WS92 2RV9A 3HBZA 2D7FA 3LIHA 3PUHA 2A7AA 1DLCA 3JD71 2ZGLA 4QKNA 3A21A 3CBNA 3SHRA 1SLBA 5FV3A 5IATA 5IVEA 3GZUC 1W04A 2DTYA 1LU2A 4RQPA 3THCA 5JAXA 3C2UA 3GGLA 5I0TA 3AP4A 4MX3A 4LOSA 4A44A 1J59A 1EUTA 3UL2A 1WLWA 3T08A 4D0QA 4HOOA 5AVAA 4FAHA 1X9PA 4QDQA 4QPIC 2VU9A 4TXWA 3BTYA 3S7EA 1TMF3 4HVRA 4M4RA 3VHPA 2CU5A 2JDAA 4P9YA 4BQ2A 1D2SA 3ZXGA 5C3SA 4FPGA 1G7YA 3KV9A 4K3UA 3MZHA 2VQAA 4LBNA 5L7OA 1K5MA 1V6MA 3ZXEA 2GNTA 2WFF3 5JSOA 3GBGA 1AX0A 1DQ6A 2B39A 2GZWA 2V72A 3W21A 4WM7C 4E4HA 1VLNA 1X9TA 5LEKA 4XYXA 1QJU3 3VBFB 4GXLA 3CQOA 3WSOA 3GM8A 4XJ8A 4GWIA 5FUNA 3WUDA 2OX0A 4MLOA 1AR91 4XETA 2AGSA 4OI1A 2RR12 3BIWE 4UI9L 2QQKA 4PI2A 4JC1A 1ZYBA 1S0JA 3T0BA 3EO6A 1SCSA 4JGZC 4A3XA 2KD7A 1JYIA 4BLJA 4C0BA 1XSRA 3BOPA 1FT9A 1LENA 4K20A 3S7IA 4Y22B 5JVVA 2OZ6A 1TZOA 4FFIA 3VBFA 1VJ2A 3PDQA 4N53A 3JZVA 2XQXA 3ORJA 4OLLA 1VIWB 2XKOA 5CIRA 3TNQA 4ATFA 1FMD1 2PLV1 5C7GA 4FFHA 2VY0A 2B46X 2QUOA 2WNVC 5IVBA 4DXTA 2VXJA 4AEJA 4JRLA 4Y22A 4GH4A 4PF5A 4O9EA 4GWNA 4S2GA 1RUOA 4GQ7A 4HFSA 1C4RA 1PIV2 4JDMA 4ZXKA 2WBKA 1NZIA 1ZZ7A 1HJGA 2JDZA 1GNZA 2VMDA 2VQ0A 4AQSA 4EQVA 4F8AA 3TEYA 2JG9B 4I09A 2W94A 4YG3A 3KT7A 5D1IA 5EP9A 2H0BA 1P8JA 5BNPC 2WT0A 1NX9A 4KH9A 1ZREA 1OQEA 1R083 4XIKA 4M00A 4I0WB 4AR2A 1PM4A 4FPHA 5DG2A 5KHIA 1V6LA 3ZYHA 2HWD3 2YPDA 5JOYA 2CDOA 3LDKA 1EV11 2JG9A 3KV6A 3MV01 4JTOA 3ZSKA 3WY6A 3H8RA 2VC9A 4PDWB 1S0BA 3OGRA 5GALA 4XFHA 3VN4A 2YC4A 1AJKA 3VZJA 1ALYA 3IPVB 2CTVA 3MO4A 1CWPA 3GZEA 3USSA 2TBVA 3AC0A 4Y1UA 3MDPA 2A6XA 2NMOA 1KITA 3DPRC 1LOFA 3NV2A 4N8MA 4NR1A 1SLIA 1AR71 1BEV1 4QGMA 4AVSA 4Z8BA 3O1MA 5EZWA 2MNGA 3N7MA 4PDWA 4LORA 1U12A 2AACA 1NCRC 3JBG1 3NQHA 2WZEA 2OW4A 4HKOA 4AG4A 4BLIA 3N7KA 4YG0A 5I0UA 3IPVA 4JHZA 2PXJA 4KG8A 1H9WA 1RJ7A 1IZ3A 2OA2A 4N9IA 2W91A 5DG1A 5ANNA 1PVC1 2Q5TA 5LK5A 2PQSA 1ENXA 5A3NA 1UPSA 4OHWA 4C91A 2XMLA 1JI6A 4LBQD 2YBSA 4CP9B 3I3MA 3K3OA 1UYYA 4KWUA 5KHGA 4IV3B 1NG0A 4CUCA 4BB3A 2OQ7A 4BPZA 2W95A 2VUCA 1G6NA 4CU9A 1JMUB 2BGOA 4JTNA 4Y1XA 1CPNA 4L99A 2R041 1U5ZA 5FZLA 5FKBA 2XLFA 3K46A 2ZHNA 4CP9A 3E5XA 4EWEA 1BHGA 4IV3A 4H2AA 2EIGA 1ZVFA 1FOD3 1TME3 5FP4A 5A1AA 1JZ4A 1RUC2 4GIQA 4X8PA 4FTBA 5FZMA 5M0TA 5ACA2 3BPSA 2WWSA 1V0AA 2PAEA 4EN9B 3VDAA 4COUA 1ZRCA 3WVJA 1XU2A 3HR9A 3ST7A 1AJOA 1SZBA 2DUOA 3BCWA 3TBDA 5ABJA 2VOVA 1W6NA 2D6MA 3B5LB 3HOBA 1AZDA 3N7LA 2GP3A 1LOGA 1OQ1A 3FWEA 5FZEA 3ASIA 5C33A 4XBQA 1POV1 4M3CF 2DF7A 3RNSA 1SACA 5FUIA 4AEMA 5FYBA 3VDBA 2P1BA 1W6QA 3JQWA 4QB6A 5IVFA 3PLQA 2QQVA 4BCUA 2W47A 3M3OA 1AL22 1H4GA 2EIBA 1ND3C 3PHMA 5L19A 3RWNA 1NLSA 3P6BA 4R9CA 3O0VA 5CYYA 1V9U2 2W87A 5LW9A 4J25A 3NNGA 2VR4A 1NZCA 3BN6A 3U78A 3ZYJB 5JZGB 1N1SA 4QPGC 4YM2A 4DY3A 2WNOA 4K6BA 1GOFA 2W9XA 3SXWA 3ZXKA 2JECA 4YGEA 2K9ZA 1UX6A 5FPBA 2GMMA 1W0PA 2VOXA 4YGDA 1JUIA 4XFBA 5AC92 2QQUA 2YU2A 4NOTA 2ZX3A 1ENSA 2FDFA 2C24A 4D7SA 2CWMA 4PIZA 1ZZ8A 4RFRB 3U14A 5JZGA 4NIDA 3ZYRA 5KR7A 2WA3A 2RS12 1JOPA 1EPWA 4R9DA 3SH5A 5LRSA 1RHI1 4MADA 3VD7A 1X8MA 1JUHA 4UW4A 1VB2A 3AKQA 4DEQA 1RUG1 2YROA 1LGCA 2ZEZA 4FOVA 4QPIB 4AAPA 4LK6A 2RJKA 3P5BA 3S57A 2WLQA 3MLKA 3GYDA 2JXAA 5C3OA 2D44A 1W0NA 4D7YA 1QIQA 2O8QA 4WBBA 5FY0A 1OD5A 2VZSA 3O1SA 4AF9A 5KXBA 3VZOA 5F6KA 2WZR3 4E2GA 2EXJA 2OVUA 2A6VA 4HONA 4PCRA 3BKZA 4G3YC 3VKFC 1XNTA 1DIWA 1X50A 4AHZA 1M06G 3LOIA 3LOBA 1IG3A 5FYCA 3ZN5A 1COV1 3K4ZA 5EIYB 2JIGA 1FNZA 3WNOA 4IGQA 2QJVA 1VAVA 3ZKUA 4UF0B 1AYM3 3AYCA 1RVF3 2QQWA 1Q5OA 2ZKNA 3FLRA 3RRDA 5FCCA 5LA1A 4LO6B 3ZDVA 1VBE1 1DP0A 4JGZB 3TN93 4AI1A 4OQ8A 3MW3A 4AQ2A 4Q4V3 3A23A 3PUSA 4KQ7A 5FY7A 3MIHA 4IEZA 2VGDA 3WP3A 2VBBA 1OH3A 2Y6FA 1APNA 2ZZJA 2IXKA 2R072 1LB2A 4UF0A 3LE0A 1PO13 2E32A 2ZZQA 1LAJA 5G05L 2WNVB 3WDUA 2XH6A 3I2FA 4JGZA 1RUF1 2WNUC 5FBJA 5IVYA 4AW7A 1MZ5A 2WNEA 5LY2A 4BXFA 4GJZA 5IYYA 4A7KA 2HWE2 5D8AA 4YW3A 1UU5A 2P6HA 1REFA 3BOWA 1UY1A 3GHMA 4IXLA 1QNWA 2DTWA 4XQWA 3X29B 4YLZA 4BH9A 1OBNA 3VKOA 4QDSA 4OQ9A 1DHKB 3ZYIB 5AFBA 1R1A2 2VNGA 4LBJA 1NKGA 4XABA 1QQP3 2EA7A 2SLIA 5FZBA 4QX1A 1QJY1 2J22A 5BNPB 5FZ4A 3NAPB 3RZMA 2G9FA 4E4DX 4AK3A 3IAQA 5FMBA 4AFCA 1UIKA 1HB1A 1QNYA 1RUI3 2BFUL 3HN3A 3ACFA 3NNMA 4J1WA 3RZKA 2BGCA 4CYDA 4LXLA 5FYTA 5FZIA 4AYUA 5J96B 2PN5A 2XG3A 4LHSA 3AL5A 2DFCA 4IEUA 1YQ6A 4Q0VA 3WHTA 5HBAA 5FTTC 3APBA 3NAPA 5GZDA 2W46A 3UGFA 1VRH2 4R9BA 3P1IA 4R4ZA 3B7MA 2XOMA 4YNIA 3TYJA 1YJKA 5KC5A 3DPRB 2F6BA 4MXVA 2D3PA 1Z7S3 3ABZA 1PX4A 1OURA 4IE0A 1QDCA 1J3RA 1QXJA 4XJ9A 2VNRA 2DVAA 4AFAA 2WLPA 2E51A 1NCRB 3LEIA 4Y4RA 1UPIA 3B9CA 3D6EA 3IMMA 1LOCA 1XNKA 2HWC3 2HYXA 3VBHC 3I2OA 5LCWL 4QQLA 3C8XA 1LODA 1J83A 3O0WA 4LTAA 2RM21 2PHUA 4KG0A 4RYDA 2Q8CA 3AP9A 1DQ0A 5BNOC 2WZPP 1IQDC 2VOKA 3HEIA 2VG9A 3LDBA 5CB7A 2ZACA 1RGSA 1GWKA 1QDOA 3T2OA 5HPOA 1EUUA 3W5NA 3MPPG 3M3QA 1GZCA 1NYWA 2QFEA 4B29A 3LPFA 5FXZA 2GC3A 5IK8A 5ERLA 2RS33 1ULFA 4AHWA 3T2QA 3QOPA 2R30A 4N7IA 3LA2A 2BOIA 2VNVA 3RGBA 2P37A 4V2WA 4A3ZA 1I3HA 4AFDA 5FMOS 4JAAA 1B09A 1HKDA 2DVDA 5FPLA 1C8NA 3RYRA 4GALA 1YNAA 3MIGA 3DYPA 4XUPA 1AYN2 2A73B 5I8YA 3WINE 2RMU1 1OPOA 3WF0A 3ZPYA 3BU7A 1W3XA 5GLUA 4AAXA 4QXBA 2ID4A 1W8ZA 3M7AA 4F7ZA 1ZBA1 2XR4A 1G9AA 1ULGA 3DXUA 1VP6A 4OUEA 4QT6A 3PMEA 3ON7A 2ADDA 1CAXA 2HWB2 3WNPA 3WG2A 5C8CC 3E6BA 1YQ5A 2LALA 2VAUA 3L9JT 3AB0A 3HJRA 4UW6A 1OT5A 5DAWA 1ND3B 4ZXEA 3T1LA 4K7JA 5J1XA 1US3A 3RVHA 4RGGA 2Y0IA 1OC1A 1KFXL 1OPMA 2A1XA 1EAH1 1PZ9A 3VZKA 1AR62 1ND2C 2HYKA 1BBT2 1JZ7A 2ERFA 4QPGB 5EXOA 4WM8A 4ZPIA 4ONUA 2HWF2 3IT8A 4FFFA 2XBO2 2H0VA 3JB8A 3FLTA 1RUNA 3HT1A 4E8CA 2GN7A 3OY8B 3RSJA 1UF2C 2GC2A 1OD3A 2ZX2A 4GKXA 4OMCA 5A6YA 5I91A 5JLVA 3AJZA 3P3PA 4QPGA 1BZWA 1OXCA 1WLTA 2BQPA 2ZOEB 4AGRA 2G1MA 5A33B 4AFBA 1HB2A 4GKYA 3SCHA 3FN9A 4L11A 1QGLA 1W03A 5T5JA 1W06A 3POWA 3J7NA 3PVNA 3FL7A 3JQXA 1QJX1 2ATFA 4IEOA 4IV1C 4YFZA 3OY8A 1GU3A 3LB9A 3PU3A 1JODA 4Y4YA 1RJ8A 1COV2 4LPLA 1I1EA 1C8M1 1IQAA 5A33A 3RZLA 2VXRA 3N9LA 2BJSA 4MG2A 2DCYA 4DFSA 5HXVA 2WRAA 3ZOIA 5JR2A 1VBA3 1I5PA 1AR82 1HW5A 1YXWA 1FX5A 3USUA 3E1F1 1FNYA 3UK9A 3MLJA 1FMD3 1FPN2 2PLV3 1DGRN 3QH7A 3D0JA 1FV2A 1H0BA 1YRZA 1SPPA 2VTXA 4W6XA 1MS1A 1VBB3 5FMDA 2WO3A 1H1AA 5C9AA 2FD8A 2WC2A 2VZQA 4AEKA 3H8XA 4ZKTB 3I2GA 4E2SA 1S2KA 2DU1A 4MV2A 2CAUA 2R16A 4LIVA 2K46A 4I0AA 4ISRA 4B7EA 4FFGA 1KXGA 4XHXA 3LEMA 5A7SA 4B4QA 1GNHA 2BVVA 1GMMA 3RZGA 5FMCA 1RUH3 2FDHA 2RJLA 2ZAAA 4QGNA 2W3JA 3VKMA 4GWMA 2B5HA 3WP4A 5IAXA 3WF3A 4E8DA 1LHWA 1YIFA 2GMPA 1V6KA 4ZS2A 4HXCA 2VMIA 2EVXA 1OA3A 2WNUB 2LUWA 3MYXA 4QHZA 5F5CA 2XWBB 4YW4A 3MFCA 3L2HA 4NWWA 3VB9A 2Z69A 3I2JA 5EYXA 1UZZA 2ZS6B 2PHFA 3H1MA 2D3SA 2XB6C 1MVEA 4I01A 4QXKA 3AZZA 3PURA 5E89A 4B1LA 4OHVA 5JXGA 1GYKA 1TMF2 2Q1ZB 3IM0A 3CDZB 3S30A 1DQ2A 2MEV3 2ZHKA 2WT2A 3HN1A 4CDWC 4URTA 1XNDA 1W2TA 3J9SA 5FR3A 2BGPA 2YFUA 4RS5C 4W8JA 4BQ3A 4C90A 1X82A 4U2AA 5FY5A 1SDDB 2O0OA 1IS3A 3VD4A 2WFF2 1JYTA 3VZMA 3VDCA 2RR11 4ZU7A 2X10A 3AKSA 1QJU2 3CL1A 4BQWA 3VBRC 4CDQC 1DLLA 2QCSB 1HQWA 2WA4A 2WAOA 2W0XA 2YPJA 1STMA 1REDA 2QE3A 1ZRIA 1SEFA 2ZGSA 1FXZA 1GOHA 4S2HA 4BK4A 1ZZ6A 2Y64A 4LHKA 4IE5A 4KGGA 5BNNB 2WWUA 2IVJA 1VB4A 2B4KA 2ZXQA 4IE7A 4X6QB 4P9JA 4NO4A 4KI5M 4FTSA 2G4IA 3L2YA 5IVJA 5FPAA 1VBC3 3PJQA 2C9KA 3KF5A 3MFAA 4XF0A 2ZGUA 4KMQA 1PIV1 2Q0AA 5I0DA 5BNNA 4P08A 2RE9A 5BNOB 4BA6A 3POJA 3O1RA 2XQRA 3PUAA 1N1VA 2VCCA 1RUD1 3WD5A 1HV1A 1GNYA 1NLRA 4XDOA 1F15A 4FPEA 4AHXA 3HQUA 4Y5Z0 4YZ5A 2V4VA 1W9YA 5CBLA 1POV3 3M2MA 5FLJA 5CNAA 1C3HA 1FAYA 5BNOA 2DWRA 2RJ2A 5FWJA 3N9QA 1LRHA 1CR7A 4KU7A 1R082 4QX2A 1JZ3A 1J84A 2CSGA 5A7WB 3VDDA 5EJZB 4LOTA 4QHOA 1XQNA 4SBVA 5C4WA 3V0AB 2HWD2 4PIXA 3IDAA 3FJSA 3A0NA 2UWCA 1GZ9A 1WW7A 4EZ4A 3OYWB 2AREA 1TEIA 1SBFA 2BV4A 3ZMOA 1OSGA 2NMNA 5DAXA 5F9TA 1RUJ3 4HK9A 4YW5A 5T5OA 4HKLA 4Q4W3 4ISQA 5A7WA 1VAMA 5FLHA 2OYZA 2Q8EA 3O1PA 3V0AA 4AI0A 1ASJ3 1S0DA 1BYHA 2AENA 3G6JB 1OUXA 4NJ4A 3EQEA 3OYWA 5LA9A 2XUMA 4CEYC 4UT5A 4OFGA 2G19A 4XTPA 5C8CB 1UY2A 3T30A 1Y9MA 5APAA 3OGJA 1HQLA 2IZWA 5F3CA 3U11A 1D0HA 3C7EA 5JR7B 3T2TA 3VV1A 4CPBA 2A70A 4AEDB 4CU6A 1AX1A 5IFTA 1ND2B 5D2AA 2OKXA 1RUG3 4UFIA 4CUGA 2JG8B 1SFPA 1H1IA 2WABA 5DZGA 2D5HA 3VL8A 3N9OA 4KBBA 5A7OA 5CFCC 2ZPXA 2ZTNA 1A8MA 1T6GC 2GC0A 2PA7A 1W9SA 3O14A 2OPWA 1C8M2 4LKSA 3WNLA 4UW5A 2TEPA 3BTXA 1DBNA 1W3VA 4AEDA 2JDUA 5ACA1 1HRV3 1ZBE2 4B7KA 2JG8A 2PHWA 3KVAA 3BI3A 1FOD2 1TME2 1E5HA 3GALA 4Q0PA 4AVAA 4DZGA 4LEJA 2AUYA 2ZHLA 5DUXA 4IV1B 2WQZC 4LIUA 3AMMA 3KHBA 3ZFEB 2DURA 2N7GA 3LSDA 4XVHA 3DYMA 3M4FA 3FHQA 1PZ8A 2J1AA 5A3WA 4M3CA 3EHKA 2E63A 2D3RA 2Y60A 4L8QA 1XYPA 1AUYA 4NRPA 3RI9A 3W5MA 5JOWA 1AL21 4KWKA 3V56A 1W8HA 2QQIA 4IV1A 2JJ6A 2PHXA 3CIHA 4CDXC 5FFOC 1UOFA 3ZFEA 3TEZA 4XF4A 3OUIA 2W2IA 1V9U1 4LKFA 3D82A 3UNPA 4HSLA 3AL6A 3WNNA 4G4FA 2XJQA 4I3GA 5EQUA 1W2OA 1UD1A 5IAVA 3WQ0A 4ET7A 1PGW2 1C1LA 1MEC3 1QH7A 2Y6LA 2DBNA 1JU4A 5FZ7A 4RFT0 4BISA 1UKRA 1RMU3 1AL0G 4CRQA 2NZ9A 4L2NA 5TSWA 2R063 3ZXLA 5AC91 5JMCA 1HLCA 5KXDA 3VKLA 3OD4A 5DABA 2A6ZA 1QJFA 2ZMLA 4YW7A 2DFBA 3V65A 1LGNA 2EXKA 3UJOA 1OLMA 4AI8A 2RS11 4XMAA 4FO9A 4AQ6A 2Y33A 1F9KA 3MV11 1JW6A 4AVCA 1Q8PA 4AWDA 3ACIA 2VPVA 2QTWB 5T52A 2VW0A 1XNCA 4DUVA 1PK6B 3KQ4B 3WDVA 4I3PA 1XYNA 4XUQA 3ES4A 5DDJ3 3PTYA 3RDIA 3VBOC 2NPIA 3O12A 4NE9A 4Q29A 4BQ5A 2P3YA 4FBFA 5J7MA 3U07A 4HG6B 1YHFA 2AEZA 2UU8A 2ZGKA 4YVSC 2WDBA 2JDYA 1ENQA 3ZXAC 1UYZA 1W9WA 1PK6A 4LQRA 4LR4A 5IK7A 1IPKA 4H55A 1AX2A 2EXIA 3QLQA 2BP6A 3ROUA 1C5IA 2UY9A 5BPXA 3M8LA 2DVGA 1XXNA 2WZR2 2E7TA 5CKQA 1LESA 5FO8B 1LTEA 5KHKA 3RPQA 3RG0A 4TTGA 1VMHA 3RMYA 2RG4A 3H50A 4MGZE 4AXOA 1OFSA 3LA7A 3VBRB 1MS4A 4XJZA 3ZXFA 4CDQB 2E7QA 1CIYA 1OOPB 1WW6A 2B42B 1V6OA 3FMGA 3NO8A 2VUDA 2VZVA 1H2NA 4ITCA 4QQOA 5IVVA 2XJUA 1RVF2 3KB5A 1W6PB 4WVZA 2R071 1LR5A 3TN92 1W90A 4JHTA 4Q4V2 1RUD2 3M1HA 1IGOA 3MEPA 3MHZA 1X7NA 3NNLA 5DAVA 1NXD1 2UWBA 3WQBA 3ITQA 4FI9A 4CDQA 1OOPA 1DYPA 3T0AA 1WBLA 2QQMA 2WSUA 3SQOA 3FLPA 4XTMA 1UYXA 1QJEA 1I5ZA 2K0GA 4M01A 1PO12 3DXTA 1OF4A 2GDFA 2HWE1 3I49A 3H1YA 3DF0A 4QDRA 2D6PA 3KV4A 4SLIA 3GCXA 5HV0A 5JMOA 1PMHX 4Q1RA 3RFRA 3RS6A 2G9ZA 3B00A 1O4TA 1R1A1 3T1MA 1AHSA 1H9PA 1QXPA 1H8TB 4MYEA 4MSVA 5F6LB 2PQQA 4ZZ5A 3AX4A 4YVWC 5FYZA 4Q2FA 5B4XA 4F83A 3WLUA 2E31A 5KXCA 1QQP2 4W65A 2DVBA 2JX9A 4XF3A 1PO23 2JDPA 3T4VA 3GZTB 4D6QA 1YUDA 3WG4A 1W6MB 3ZO0B 2KR2A 4OI4A 1WD3A 1HRI3 1H8TA 3FUOA 1W2UA 1ULEA 1UMIA 4IEXA 4DS0A 1E5IA 1Q8SA 1IS6A 4UFLA 3AXDA 1RUI2 3CHXA 1MR5A 2Y26A 3EMRA 1MS0A 3VBSC 3POSA 1J3QA 1PNGA 1VRH1 4V1PA 4X6RB 3U0ZA 3RZHA 3NRUA 3ZSEA 4FPKA 3CMGA 2VH9A 2VCBA 2JEMA 2A6WA 3ZR5A 1GP4A 1CAUB 2VMGA 1W6MA 3KCCA 4H7LA 3T4HB 1OQDA 1KDMA 1VMFA 4QM9A 2I2SA 1XE8A 1M4WA 4Q8KA 4Z82A 3K4AA 4B1MA 2QZ3A 2C0ZA 1X8EA 1Z7S2 2VULA 4UBGA 2BWAA 5CAZA 3ZM8A 4PJYA 4BXSV 2DCTA 1D4M3 3KSCA 1POQA 5FYUA 4EN0A 2W1WA 5FYYA 5FP3A 4UWDA 4RA0A 1NCQC 5K4LA 5LA0A 5CU1A 2HWC2 2P4EA 3DGTA 4BQXA 2AEYA 1YQ2A 2VVEA 4ZS3A 1U5XA 3I4IA 2J1EA 3J8F3 4IE6A 4NIAA 2I07B 1UY0A 2L9LA 1JYNA 1CAWB 2CHHA 2ZAHA 5FY1A 1YI7A 1W9FA 3AZWA 2EIDA 4PT6A 2XONA 5FZDA 2BZDA 1YQ8A 4FP3A 3QCWA 2E6VA 3HQRA 1HXS3 3KD4A 4KWJA 4XC9A 5FP8A 5KHHA 5A3LA 3S0MA 2Z42A 4CU8A 5B4NA 2BEOA 4IUGA 3R05A 2HH9A 2RS51 4B4RA 1WKYA 2RS32 4A7ZA 2V09A 4CCLA 5CADA 2D5FA 4XQDA 2FHRA 5FXWA 2NQYA 1AYN1 2IUWA 4H3WA 4GAZA 2PELA 4NN0A 4K40A 1QMJA 4IETA 3CEWA 4NHLA 5FP7A 4RR3B 5FZ1A 5FXVA 4CTEA 2C1FA 3NWKA 4Y5TA 5GLWA 3SC7X 3AMQA 3KVBA 4RL7A 3K4DA 4N7UA 3IN9A 4OUSA 5E1RA 4XFGA 2HWB1 2WS93 2XJRA 3FFZA 4CUBA 3W58A 4RR3A 4C8DA 2EXHA 4W4ZA 2Y6JA 4Q26A 4WV8A 5T3NA 2XGXA 1WCQA 3WOGA 4XUOA 1AR61 4B3NA 1PGL2 3URFA 2RDQA 1BBT1 5FJHA 5JIAA 2ZKLA 2XL7A 2ES3A 3P3NA 2OQ6A 1RUE3 3I2DA 4GMP1 5GLTA 2HWF1 1K45A 5T55A 2XBO1 3MIEA 1E5RA 3ACHA 2IVIB 1GQPA 4QX8A 1W8OA 2B7YA 4ASKA 3H9AA 5CG8A 1XB9A 2FMYA 2VCMA 5JXIA 1VBD1 1XRUA 2X5IC 4OYUA 4FQ4A 4DPNA 1BK1A 5J48A 4HT1T 2HBUA 1SLTA 1QWRA 4QPYA 3NV3A 4QPIA 1S2BA 3R4UA 4WM7B 1XPWA 3INAA 3WDTA 4INDA 1YYNA 4ASMB 2P2KA 3U4XA 5FP9A 1ACCA 4XCAA 1BMV2 4QX0A 1RL3A 3B69A 4JKMA 1RIRA 4XURA 4NRMA 3DKQA 2ZGNA 5J3UA 1UOBA 1UN1A 1XU1A 4YVSB 4COVA 3Q8FA 3BB6A 4EWAA 4DIQA 3AP6A 3DL3A 1AR81 2EF6A 4NVPA 4WM7A 1B35C 1QU0A 1LHNA 4LNVA 1FPN1 3E6DA 1YFYA 4MO3M 1CGPA 2HEWF 3U1XA 4DUXA 5KXEA 2JE9A 4NAMA 1VBA2 5C3RA 1H6XA 4META 4NHYA 5EFUA 4AL9A 4FPCA 2JE8A 1H2KA 5BV6A 1WMFA 4GB33 2W1SA 1Q8VA 3MW4A 5F5AA 5GLVA 4JRAA 1VBB2 5GZEA 1TQ5A 4XUNA 2JD9A 4LBMA 5DMYA 1W6OB 4QKDA 2OUHA 3E6CC 1TG7A 1R093 1SCRA 2E9QA 3AJYA 1S4CA 5JXHA 3WDWA 4LITA 1OKQA 1YQCA 2WNVA 3ILNA 5FO7B 3JXSA 4Z1VA 3GBFA 2RHPA 3LAGA 1RUH2 2YGLA 3U10A 2MHFA 1MVQA 1UO9A 1Y4WA 3KMHA 1HN1A 3OCPA 4RD7A 1S55A 3KCXA 5FY4A 5H9PA 1W99A 4DINB 3OPWA 3NMBA 1DF0A 1XYOA 4PF1A 1JYWA 4UBHA 5SV8A 3VKNA 1PZ7A 1UZYA 3ILRA 1U5IA 3VZNA 5FBZA 5EHDA 3MW2A 4EZHA 1OFNA 4XJWA 1WWYA 1TMF1 2ZGOA 4LBOA 5FZOB 1QHDA 4R9AA 1KGYA 1Q3EA 1S0FA 3FE5A 1CIWA 4CCEA 3OUJA 5GKAC 1YLLA 1A3KA 1XNBA 2VECA 2VOWA 2GP5A 3ZIWA 2ARAA 2H6CA 4YVWB 2EAAA 3FZ3A 4OZXA 5L9VA 1UMZA 4FXGB 1Y9QA 2WFF1 1UW8A 4H7MA 1BCXA 3GCWA 1SLAA 4CCJA 3ZKYA 3ACGA 2RDSA 5FZOA 1QJU1 1RB8G 1RYYA 2VUAA 4EYUA 3Q8CA 5CFDC 2R49A 1UZ0A 4Q4X3 3DPRA 2C6SA 4LBKA 1G86A 1NT0A 4YZ3A 4YW2A 5KWRA 4ORFA 3M3IA 4BU2A 1NCRA 3GXUA 4XIOA 1IS4A 3I54A 4BZ4A 3I2KA 4ZU4A 3MICA 5IWFA 3T3YA 3ATGA 3OBAA 4RHV3 4MXWB 3DN7A 4A2UA 1NE6A 5CZKA 5KHJA 1JOBA 2VL4A 5FYMA 1CAVB 3NVCA 5E6HA 5HCBA 1RUC3 5LEJA 2X05A 5I0SA 1V70A 2B9UA 1TE1B 2B45X 2IC1A 5T5LA 4I2OA 1S0IA 1POV0 2GN3A 2ORXA 3AM2A 1LHUA 3ZFFC 1VBC2 2RS52 3O5SA 1SFNA 4P14A 1JS9A 3PJYA 5I8TA 4PHZA 4MXWA 2WUHA 2TUNA 1TNRA 1WD4A 3G7DA 4XXAA 3PIJA 3U37A 2XXZA 2AH2A 5FOBB 2Q4SA 4QQHA 4P9WA 2ADEA 1YC61 3OB8A 3PVBB 2J7MA 3KQRA 5DUUA 4S2DA 2R1DA 3I3EA 4QX7A 5L36A 1QF3A 4FPFA 4YZ4A 4BQYA 1T2XA 1R081 4Q4Y3 4OHXA 5FXXA 1K12A 3OOXA 5SV5A 4D7TA 3SKJE 4XFFA 1LGBA 3AZVA 2QBXA 1LKNA 3AYAA 5A32B 3HMYA 2HWD1 3OPTA 4PQQA 4BIFA 1GBGA 3BIEA 1I9RA 4RGKA 3JD73 4FSJA 2YC2A 3WW1A 1CJDA 3H3ZA 4IEYA 4FOWA 1NUKA 2JDNA 3Q8EA 3W59A 2GH2A 4N9HA 2WO2A 3F2ZA 1UL9A 1UU4A 2X8KA 4JX0A 2ZGPA 2WAAA 1OKOA 3ZFGC 2BWCA 3HNMA 3BGAA 2P3IA 3ME2A 5FO9B 1RUJ2 1YFWA 1ND3A 4KWLA 3RMXA 3UETA 3OJBA 4Q4W2 3ZLIA 2OXBA 3AVSA 2P3JA 1JZ6A 3ZX7A 1ASJ2 1GUIA 2FQPA 5FKCA 4DRRA 1JN2P 3J4UH 4Z92B 1VBD2 3AK0A 2V5DA 3ZN4A 5A1LA 3NW4A 4C1XA 5C3QA 5H9QA 4LKEA 4ARYA 3PUQA 1YCIA 1N3PA 2VUJA 4YPJA 4AFMA 1KJRA 2JDKA 4KBZA 3ZXDA 3CJXA 1AR93 3GBWA 3HT2A 3KGZA 2WN2A 3I8TA 1D0GA 3D4KA 4K1YA 4Q8LA 3FBYA 1OA4A 1W9TA 1DQ1A 4D6RA 5L9RA 4HSJA 3LWCA 2WYFA 4K1ZA 4PLOA 3VGIA 4A45A 1ZBE1 4J6GA 2X5IB 3AZXA 5IFPA 4XFIA 1KRIA 1Z78A 1FOD1 1TME1 1RITA 2UY8A 2VZRA 5A3MA 2YFZA 5F3IA 2YXSA 2JE7A 1SFYA 3DV8A 3NL1A 4XEZA 5FIXA 1HRV2 1DZTA 1N3OA 3IZOA 3J26N 2JB8A 4RGAA 4XBNA 2Y38A 1GZWB 1WUVA 5BYNA 1F4HA 3SLIA 2BDRA 3WW3A 4J1XA 2V4AA 5L73A 2VTXJ 4AVBA 3SMHA 3THPA 2HKXA 4RQPC 3DKWA 1LULA 1N1TA 1L3JA 4W6WA 5FY8A 1YFXA 2Y6HA 2PHRA 4PBOA 5F37A 4HETA 5A6XA 1B35B 1U0AA 3JU9A 1H4HA 3FC0A 2W5FA 2CV6A 1ZRDA 3NKTA 2A3XA 2F4PA 3GJBA 3N7JA 1JTZX 2XJSA 1OH4A 3I3QA 2J1VA 5F3EA 3GJAA 1GWLA 2IFRA 1A34A 1X33A 1JOJA 1PGW1 3VD9A 5FPZA 1HDKA 5LATA 4I30A 5DXDA 1CD3G 4FTEA 5JXJA 1B35A 2IXLA 5L7OC 1EV13 1K5MC 2QDNA 3NV1A 1MEC2 3Q8BA 4HANA 2V73A 1YFUA 4NIIA 1O8SA 3I7DA 4XFCA 4Z2AA 4LHNA 4XACA 1R1A3 1RMU2 1V6NA 4NHMA 3A4UA 2EIEA 2R062 5JPMB 2PFWA 1KD7A 4BHPA 2P3KA 2WNUA 3OBTA 4ZONA 1BLZA 1H8VA 1GP6A 1BEV3 1AR73 1XE7A 3CO2A 1IHMA 3PMSA 4QXHA 5FYVA 3JBG3 3VZLA 5C3PA 1CX1A 4AVVA 1PMJX 1WCUA 2BOJA 4UFMA 2E33A 3VBFC 5D21A 1RXGA 4A6OA 4N53C 1ZNPA 2VQTA 5F2WA 4MH0E 2Z5WA 1PVC3 2R0FA 4HLTA 4ZHNA 5FQ0B 5DDJ2 4E9KA 1VPHA 3EB7A 1C1FA 1O59A 4BIOA 1JHNA 3IIIA 1T6BX 2XLAA 4RSUA 4DRVA 5A3UA 2C5DA 4QKFA 5JIUA 4P9GA 2VTFA 4GH4C 1W0OA 4LKDA 4R8HA 2WZR1 1FI2A 3AYEA 5CISA 5FQ0A 2R043 3HVDA 2XJVA 3CZUA 2JENA 3LSEA 4RN5A 5JCTA 2ZEWA 2CDPA 2P34A 3VBHB 1G9CA 5AFEA 3NNJA 1FATA 5CFDB 1SBDA 4IEPA 3PVEA 4XE9A 1UOGA 5E8AA 4KL1A 1RVF1 3LFIA 5DAQA 4D69A 1IPSA 1EY2A 3FHIB 3TN91 2PYTA 4CE8A 4P9LA 2C9AA 4Q4V1 2YYOA 4A6SA 3CJIC 3VBHA 3H1WA 2O8OA 3S5QA 1OVSA 2P5BA 1S0GA 4XJAA 1H2MA 3IMNA 1LU1A 1HIXA 3NJVA 4K8RB 1O7FA 2A5ZA 2Z2SB 2WT1A 3LGRA 2FDGA 2ARXA 4TZDA 1C28A 1PO11 3TOJA 5ANQA 4FPJA 4FPLA 1WLCA 1CPMA 1LOFC 4P5YA 1CJPA 1W28A 4UAPA 2GNMA 3WT3A 4PDWC 4Z07A 4AQTA 4XAAA 1RXFA 4N43C 1LHOA 5CG9A 4LT5A 4LA2A 1WCDJ 4A42A 3OEAA 4URAA 1KS4A 1UX7A 3SEPA 1WMEA 2GH8A 4C0HA 4MZUA 1F4AA 4LE3A 1LOBA 1QQP1 2YB7A 3I59B 4OUMA 3LEKA 3LF7A 4P9XA 3VBUC 1BXHA 1EP0A 4AHYA 2DCJA 4CSWA 4FAGA 2HWB3 2DUQA 1YJLA 5T50A 2WR9A 4HKWA 2QKDA 1YWKA 4QB1A 1RUI1 5HCFA 1DG6A 1PO22 1NE4A 2AC1A 3AKTA 1XC6A 3HAGA 1HRI2 4XF1A 3WV6A 3I59A 1V00A 2OUJA 1ENRA 2ZGRA 3AMNA 1RHI3 1W8UA 1HJFA 1BBT3 5GJ6A 4PBPA 2ARCA 3D8CA 4IV3C 4LO4B 4NPLA 4YG6A 3D0SA 4AZZA 5IK4A 1DU3D 2XBO3 2BBAA 5C8CA 4L92A 1E5SA 3ZFGB 2F17A 1Z7S1 4Z2WA 1OMIA 4KNCA 1DGLA 1NY72 1JZ2A 2LTNA 3HQXA 1UXXX 4YSFA 3V64A 1BJQA 3ZDSA 1UZWA 5F7UA 5ABJC 4CXXA 4IEVA 5BUVA 1R64A 2HWC1 5F39A 1ND2A 4HL0A 1LNSA 2FCTA 1ZRRA 1D4M2 1LECA 1QJZA 3CU7A 4XCBA 1W2AX 2R7EB 3R6SA 3VHOA 3WF1A 3PNAA 3ZN6B 4QU1A 3H0OA 2O14A 1XJAA 3IBMA 4CPBD 1XNAA 1LEDA 2VMCA 2VBPA 3BPZA 3JUUA 4UXAA 1COV3 3W9AA 3J8F2 3AKPA 3JB4C 5JI9A 3K77A 2BPA2 3LKJA 3UV9A 4M3CE 1O3SA 2VZ1A 2SBAA 5FRAA 1OF3A 5CKMA 3ZN6A 2RS31 4TLGA 1HXS2 4TWTA 3SH3A 1VBE3 1KDKA 4DB5A 4KGQA 4LBLA 2CY6A 2QVSB 3HNYM 3IWZA 2VMFA 3SH4A 4XZPA 2IXCA 1DGRA 4BE3A 5A3TA 2YZ4A 3OF1A 5EV7A 2BTVC 4NWVA 5JPNB 5FYHA 4FOQA 4UFKA 4ZU5A 3TEXA 2WYSA 3CLPA 3TEWA 4L97A 3NJYA 3SKVA 3RYPA 3ZSLA 3SCFA 4CZSA 2VQUA 2JKXA 5FK7A 2XJTA 1RUF3 2LROA 5JWPA 1MQTC 4A41A 2ILMA 4QX5A 3PTRB 4JDOA 4M0NA 4AI9A 1TVGA 4CU7A 4LO8A 4Q0SA 2ZGQA 1J1TA 4QU2A 4RQPB 1MZ6A 2WQ8A 3NNFA 4XQ4A 4K8FA 5B2GB 4GA9A 2PHLA 5LBFA 4OI2A 4HVQA 1VMJA 1OLME 3OBRA 4BMEA 2PAKA 3H3LA 2Z79A 5JOZA 2XDVA 3SCGA 2QQJA 1PGL1 4FPYA 3WP6A 1QJY3 1NLQA 2Y0OA 3B01A 2QQLA 2VW1A 3EJKA 2A3YA 3K3NA 2FDKA 2Q1FA 2VZPA 5FZ8A 3MLLA 3PU8A 5GZCA 1NQJA 5F3GA 5A80A 3WUCA 1HB3A 1CESA 4PQ9A 1K5MB 2XVKA 1RUE2 3WNKA 5L7OB 3H7YA 1ODMA 3K75B 3WZ1A 1K3IA 5DUWA 5A7PA 4TLFA 1W8NA 3DUIA 4W50A 4NAOA 2BFUS 3FX3A 5JDBA 4HZFA 1L7RA 3IKWA 4LMFA 5G04L 2IWGB 3NJZA 4M4PA 4CDWB 3NJXA 3MIBA 4RS5B 3AP5A 3MUY1 3MPBA 5FYIA 3ZR6A 2YG0A 3FHAA 5EJ1B 4QQPA 1BMV1 3IDEA 1X36A 4JVAA 4N53B 1GP5A 2W1QA 5A3OA 5KC6A 4BDVB 5K8SA 3ACLA 3GNEA 1W39A 2GALA 3R4DB 3PL0A 5GZFA 2RM23 4JDNA 2JB4A 3WP5A 3B93A 4CDWA 2W1UA 3ETQA 4A4AA 5IT6A 4RS5A 3WCSA 5FK8A 3HIFA 1UY4A 1GSLA 2YBPA 4S2FA 1AYM2 1ULCA 2PHDA 4YM3A 4Q0QA 4GH4B 2PAMA 2PTMA 3MGUA 4FOYA 4EWDA 1US2A 3M70A 1VBA1 2NLRA 1ONAA 3ZYFA 1JBCA 3DEMA 4CP1A 1W8FA 5D8AC 3OEBA 4Y1ZA 1HQNA 5F5QA 1SQ4A 4CDUC 3VBRA 2QNKA 4ASLA 5IHRA 1VBB1 1CZVA 1QKQA 4M0HA 1QY4A 4OHZA 4UYBA 5J36A 4NPMA 4CP0A 5ISLA 5LBBA 3S5AA 4NIHA 4NMIA 3ZIXA 4GB32 1WCKA 4F3JA 1W6PA 3TRSB 1CQ9A 1WA4A 2ZEYA 4HMZA 4PLMA 3WNMA 2X53S 3KM5A 3FBMA 4QXCA 2OS2A 1GR3A 4NIGA 3AFGA 2J1TA 4P02B 3BALA 3Q9OA 1NA1C 4WVVA 1MS5A 2RMU3 2VMHA 2YGMA 2RDRA 3K51A 3UT0A 1RUH1 3CJIB 1R092 3QACA 4K9SA 5JI7A 1BKZA 4FVVA 4MGQA 4YGCA 4MGYE 5BXXA 2CGPA 2F4LA 4IEQA 4LBQB 1ZBA3 3Q8AA 2VZTA 1DYKA 4CCOA 4GJYA 1PGSA 3NAPC 1MS8A 2VW2A 4FT8A 5IJRA 4C1WA 2W92A 3LQCA 3TNPB 3LA3A 2WJSA 4TYSA 1DYOA 2PMWB 4YRDA 1TNFA 2IXIA 2WIIB 3ELNA 4QAWA 5H9SA 4AOCA 1UYPA 3W20A 3O0XA 1MZFA 3CJIA 1DGWA 2ET7A 2IXHA 2EICA 4LBQA 4JQRA 4N43B 1WCSA 2ZX1A 4XFAA 4D94A 2ARBA 1EAH3 4O7XA 3TWIA 3J7MA 3UGHA 3VLBB 2UYBA 1F2NA 2MEV1 2NP0A 3I2IA 4XZUG 4P5HA 4BQ4A 1W05A 4MGIE 4LA3A 3VBUB 3N9MA 1IOAA 5A7NA 4PIYA 2J42A 1YO8A 2UYAA 4XDQA 3C7GA 2I45A 2Q1MA 4N43A 1ULDA 3J7LA 4QMAA 5L9BA 2WINB 4CEYB 2G9GA 1OLQA 3RZZA 5JOXA 5FPVA 3BVCA 1CAUA 3ILFA 1JZ8A 1UU6A 3VBUA 2JD4A 4CCCA 4Y20B 3EYPA 3A0KA 2JICA 4IEWA 4O9GA 4Q4X2 4EE2A 1VE0A 2WKKA 4XXPA 1QJX3 4CEYA 4Q27A 3AZYA 5BY5A 5EWSA 4CVUA 2ZX0A 4XBLA 1JYVA 1G8WA 5FZ3A 2CL2A 1C8M3 5FDBA 3SITA 1UQXA 5CFCB 4DMIA 4Y20A 4RHV2 4CCMA 4YARA 2D6NA 1RINA 1XE0A 1ZBE3 1W6NB 2JWPA 1VBC1 5ABJB 4Y1YA 1CAWA 3B94A 2KA3A 2KXLA 2VM9A 1Y3TA 4IGPA 3HNBM 4QPWA 2DUPA 5FZ9A 4HPKB 4JV4A 4YFWA 3VHRA 4YYOA 1W6QB 5LB6A 3LCPA 5CFCA 1F35A 3THDA 4IW3A 3TAYA 3WDYA 3CNAA 3I3DA 5CVRA 4E4SA 1Q8OA 3GZAA 3K2OA 2CAVA 1AXKA 2W52A 3H3UA 1O4YA 2ZHMA 3H7JA 4D8MA 4E27A 4HPKA 3UKVA 1J3PA 1GWMA 5C71A 1ZRFA 2NN8A 5A70A 4GD4A 4WM8C 4Y24A 4Q4Y2 4LJHA 4JGYC 4CDXB 4AGGA 4Y1VA 2XPJA 4HVOA 1ULPA 3LZZA 3KHCA 4H14A 4ES9A 2ZX4A 3JD72 2LS6A 2UURA 1HN0A 1RTVA 4WZFA 3WEZA 3KV5A 2YMZA 1MQTB 3UESA 1BVVA 3C7HA 1RUJ1 4XUTA 1LHVA 1S1AA 2XWJB 5DZFA 3KF3A 4Q4W1 4CDXA 3NKGA 1ST8A 4JCKA 2BYVE 2R32A 2YHJA 1ASJ1 2Z4FA 4PI0A 1SHWB 2ZBJA 1YIPA 1QOSA 1F5FA 4YZ2A 2JDHA 1MQTA 3KCYA 2PHTA 1URXA 3ES1A 3FUQA 1H6YA 1OUSA 1DCSA 5A1FA 5F2SA 3LDRA 3WG3A 1NOVA 1WZXA 2RR13 3OTFA 3IAPA 3T09A 3VBOB 3WHUA 2VO5A 3E97A 1ZZCA 1XSQA 2XVLA 2Q8OA 1AR92 4DUWA 3O1OA 4XDPA 4BM8A 5C9AC 4YWAA 4QHBA 3AMPA 4IDZA 5HV4A 1AF9A 1HRV1 1KQRA 1HB4A 2C26A 3POFA 3VBOA 3VHNA 5K7PA 1A8DA 1GFF2 2DYCA 2X09A 3I2HA 3N9NA 5DPNA 1FMD2 2PLV2 4YVSA 2E26A 4CCNA 2A71A 2EAKA 1YEWA 3J7HA 4UFJA 4OMDA 5IK5A 3WNXA 4XAEA 4IERA 1H2LA 2QQNA 2FBEA 2ZGMA 4IL7A 1PIV3 2XLGA 1SLLA 2D98A 3O7OA 4BK5A 1DDLA 1V6IA 4GWJA 4R52A 3WQ7A 2VOTA 3KT1A 3LD8A 4DOUA 3LFMA 3H8UA 5DAPA 1ULOA 2D6KA 1XOYA 2Y8KA 3U4SA 2VZOA 1RUD3 4LHLA 4W6YA 1F8VA 4LO5B 4QX3A 1O3QA 5D8AB 2OIIA 3N36A 2B8MA 5KBFA 4CDUB 3POGA 4QGLA 1N3QA 3ZYBA 5CEHA 5A6QA 1CONA 1W6OA 2YUEA 1WMDA 3CF6E 3HPNA 3KZ4C 3NSTA 3OGVA 3QD6A 4IQPA 1OLRA 2VMEA 4MHRA 2QDRA 4XW3A 5C5TA 1MEC1 3I3BA 5A3PA 1ZZ9A 1F31A 3N4MA 3B9IA 1H1MA 4P00B 3H8OA 1WBFA 3GHNA 1WA6X 1OI6A 1SG3A 2AZ5A 1RMU1 2A3WA 3B02A 5FZGA 1EV12 1AVBA 2CGNA 2R061 3THTA 4BYYA 4CDUA 1PX3A 1D2QA 3OD0A 4E2QA 1LOEA 4YM0A 1NA1B 1N1YA 3UGGA 1WLDA 5F5IA 4OHYA 4GZ9A 3MF9A 2FDJA 1QOTA 2Y6GA 5LY1A 1Z0HA 3AP7A 5EPAA 1PNFA 2AYHA 4CP2A 4B4PA 4BMBA 2MEV2 2RVAA 4FCAA 2BW8A 2XL9A 3ETPA 1LEMA 2FCUA 1AR72 1BEV2 5K9YA 3O1UA 2J1RA 2LRPA 2J1SA 3ALQA 5DN2A 3DCQA 1O5LA 3JBG2 1NA1A 3KT4A 5DDJ1 1KEXA 3C3VA 1DGWX 2WQ4A 5DQ0A 4EROA 4Q1PA 5HCHA 1UIJA 2GAUA 2BNOA 2R6QA 4YVWA 3VBSB 1PVC2 5DZEA 1UAIA 1FYUA 3KLSA 1Q43A 4LK7A 5FZHA 4DEVA 1GICA 2ZA9A 1REEA 2CGOA 1G9DA 1R1ZA 5BNNC 3WDXA 1VAKA 2O1QA 3LEGA 3CZJA 4CUAA 1D4VB 4UW3A 3RYKA 4LLOA 3VBSA 4AI2A 1CZSA 3POBA 2XHNA 3WCRA 3O1TA 2R042 3UYJA 2NM1A 2XKPA 5LA2A 5ACA3 5F1RA 3LPGA 3D5OA 4TSVA 4D6SA 1NCQB 2HLEA 4TN7A 1L7QA 3IIAA 2VBDA 5FZKA 2YBKA 1SBEA 3D3AA 5K0UC 1PVXA 1O5UA 4XPVA 3T2PA 3ZYGA 4E4ZA 4HBNA 1CAVA 2WL1A 1BQPA 3EXUA 1EPZA 3NV4A 4QD2A 3VDDC 3WW4A 1IPJA 1W2NA 4HN1A 2HEYF 4EN8B 1V6JA 5C4WC 4YM1A 1NCQA 1SDWA 4LE4A 3OG2A 3SEEA 2IXJA 4BJ0A 1E57A 3BUCA 2BVBA 3SISA 2ZEXA 1AL23 4UFHA 3ZVXA 1JU3A 3R0RA 1QH6A 1GQHA 2WSVA 3MBWA 4MGSA 2BUKA 2FZ2A 2R1BA 1VR3A 1V9U3 4OCTA 4QM8A 1LCLA 5DUVA 4DO0A 2IFWA 2GU9A 3QH6A 4OZOA 4EN7B 4CEWC 5C8WA 4LUKA 1CAXB 2C4XA 4YW6A 2A75A 2VCAA 4AGVA 4COWA 4ES8A 4DNYA 5JSPA 4XOGA 1ZA4A 4MVTA 3M3CA 5A32A 4GMP0 2EALA 2VD7A 5AC93 2QQPA 2VZUA 5F32A 3ZSJA 4I02A 2JDMA 1PO21 3JCIA 1NAEA 4WM8B 2RS13 1HRI1 3M3EA 4BWOA 4JGYB 3WG1A 4ZZ8A 4DXZA 2XHKA 3U75A 4QQ2A 1K42A 3VD3A 5FWEA 3F95A 3WQ1A 3POYA 5LASA 2DCZA 4AEDC 3LIGA 4NHKA 1W8TA 2DBIA 1ZX5A 2Q8DA 1RHI2 4L0PA 4EV0A 1EYBA 5HI0A 2JKBA 2RDNA 3BTZA 1HX6A 2JG8C 2XVGA 2GC1A 4G9SB 2BNNA 1PHMA 3AFKA 3UKTA 1NY71 4JGYA 1RUG2 1F5JA 2ET1A 3ENRA 3OUHA 2D6LX 3VL9A 3HBKA 1WMXA 1AXYA 2VJXA 2D43A 1MS9A 1VRBA 4CA9A 5LZ6A 1D4M1 1UMHA 2HJIA 3AXEA 3AVRA 3POEA 1O3RA 2WZ8A 4FXKB 2DDUA 1MPXA 4I0BA 3UJQA 2VNOA 4L9BA 2CNAA 4CCDA 2DVFA 4QB2A 3VD5A 3J8F1 5IUQA 3MIFA 4LULA 2FDIA 2HBTA 3ZFEC 5HCAA 5FPUA 3USUB 1N47A 2X5IA 3MI8A 1JYCA 3HWJA 1HXS1 1GZTA 1SPPB 3RZJA 3KWVA 3OBZA 1DFQA 1W8WA 5C9AB 1S0CA 3OGSA 3AMHA 1JXNA 1GZWA 3KGLA 1BK0A 4XILA 5I8SA 5FZ0A 1VBE2 2R073 2X29A 3C7OA 3I97A 5FAXA 4DXSA 4FQZA 5J09A 2W68A 1RC6A 4NRQA 1ZA7A 3PUIA 4JQTA 3WX5A 2LM3A 4UOJA 4BOWA 1J58A 3SNMA 2YC0A 4X8NA 5FYSA 5IVCA 1K5JA 3IDBB 1LOAA 4IESA 2V5YA 3BODA 1GOGA 3HD8B 4N90A 2HWE3 5I0RA 1UKGA 3PIGA 5E88A 1RUF2 4JKKA 2VZ3A 1IS5A 3AYDA 1O6UA 1GLHA 2CWSA 2FZ1A 1MACA 2AR6A 2GNDA 2WS91 3B3QE 4FP2A 4BQ1A 1S2EA 3GDBA 1OA2A 1VALA 1UY3A 5GLZA 1YI9A 5HXMA 3EBRA 5H9RA 2K2SA 3VUOA 2CYFA 3CKHA 3H42B 4AI3A 4DY5A 4MHUA 1GQGA 3FFQA 1I6XA 3OSDA 1G9FA 1PK6C 1QJY2 4U36A 4YZ1A 1O3TA 4LO7A 2VVDA 1RUE1 1CZTA 3QBQA 5FZAA 4AE2A 1QXRA 2E53A 2R0HA 1Y9GA 3RI8A 1H30A 3ECQA 2ZCWA 1J1LA 2YU1A 3DYOA 2QQOA 1VRH3 2D6OX 2Q30A 2WO7A 3OPZA 4MGTA 2ENRA 1HV0A 2JIJA 4MUVA 1Q56A 1CN1A 2GNBA 3MF6A 2TNFA 3UKNA 3V0BB 3N3HA 2D97A 4K21A 4PLNA 2H6BA 4DQAA 2BERA 3E5UA 2J1UA 4YGBA 1DZRA 1GKBA 1WW5A 2Y34A 2LW8A 4GULA 4NHXA 2A6YA 2ZMKA 1OVPA 3BTAA 3PVOA 5GM0A 2I74A 1S0EA 3KS7A 4LUMA 4CXWA 2DU0A 4Y3OA 3V0BA 4XMIA 3E5QA 4EN6B 1OOPC 1AYM1 2QZ2A 4DXRA 1BVP1 4XF9A 4NPRA 2RM22 4OULA 3WXPA 3T0DA 2YDEA 1KS5A 3WF4A 4Y33A 1CX4A 5A6ZA 3OGGA 3O1VA 3DECA 5T5PA 1Y43B 2JG9C 5FLIA 3ZPOA 1DQ4A 2FCVA 5CA6A 2ZJCA 5JSRA 5FUPA 4HN0A 4O65A 1UWWA 4ZY9A 5CFDA 5FJKA 4OI0A 1KFUL 3ZMNA 1GANA 5A7QA 2RS53 2W39A 3C7FA 4GB31 1SMVA 3TB0A 4CCKA 4AVTA 3ZFFB 5FZCA 4WZCA 5FOJB 2BNMA 1MS3A 1A78A 1UXZA 3RWKX 1PMIA 1JH5A 1ODNA 1ZM1A 2YV8A 4CXYA 5K0UB 1AYN3 1GV9A 2KM2A 1SLCA 4EJRA 1WW4A 1D7PM 1UCXA 1O4ZA 1R091 5LWBA 1H8TC 3AKRA 1ZZBA 4LLFA 5C6CA 5C70A 3K48A 3VDDB 5J37A 4IGOA 2DCKA 2D40A 3ZFFA 5C4WB 2RMU2 4YW1A 1XBFA 1IKPA 2BRTA 2MPFA 5K0UA 5C5UA 4FPOB 1AXZA 1ZBA2 4JZRA 1UOJA 5CKNA 5T54A 1O8PA 4Q0UA 1A6CA 2ZGTA
chains in the Genus database with same CATH topology
1C5HA 1C57A 2GMEA 2D93A 2P17A 3R4SA 2YY1A 1AR63 4R4XA 4CEWB 1DZQA 1MZEA 1NQDA 1CVNA 2ETEA 4GMP3 1LJ7A 2HWF3 1WGPA 2VVFA 1EAH2 2FMDA 2UWAA 1QOOA 2OPKA 3S6PA 4WVMB 2WFPA 2ZABA 4CEWA 4MGKE 5J98B 1Q8QA 1VBD3 2OZJA 2DV9A 3ZYPA 5GZGA 4A7YA 1DQ5A 4D3WA 2ZMNA 4Q4X1 4COZA 5EYYA 3ZFGA 1PM7A 3ZXJA 1U5YA 4WVMA 2GSYA 3RJRA 5I93A 4ATEA 4WVWA 1IKQA 2HEVF 1QJX2 3RQ0A 4RHV1 1FV3A 1O91A 4XHBA 4B8EA 5FMOL 3WW2A 3WR0A 1RUC1 4P9IA 1AR83 1FPN3 4HK8A 2NYYA 4M3CB 1NXMA 4XJUA 5LRRA 5E16A 2XJPA 1OHFA 3GF6A 5FREA 3IDCB 4RR3C 4KU8A 5LK7B 1G9BA 4Y26A 5JZGC 3RJ2X 5BNQA 3MIDA 4COYA 2W08A 1Y7BA 1KJLA 2BBVA 2E7AA 3N35A 4Q4Y1 3ZSMA 5EJ3A 4OVEA 5AVPA 2WS92 3HBZA 2D7FA 2A7AA 3JD71 3SHRA 2ZGLA 1SLBA 3GZUC 2DTYA 1LU2A 4RQPA 5JAXA 3C2UA 5I0TA 3AP4A 4MX3A 1J59A 3UL2A 1WLWA 5AVAA 4FAHA 4QPIC 2VU9A 3S7EA 1TMF3 4HVRA 3VHPA 4P9YA 1D2SA 3ZXGA 4FPGA 1G7YA 4K3UA 3MZHA 2VQAA 4LBNA 5L7OA 1K5MA 1V6MA 3ZXEA 2GNTA 2WFF3 5JSOA 3GBGA 1AX0A 1DQ6A 2B39A 2GZWA 4WM7C 1VLNA 5LEKA 4XYXA 1QJU3 3VBFB 4GXLA 4XJ8A 3WUDA 4MLOA 1AR91 4XETA 2AGSA 4OI1A 2RR12 3BIWE 4JC1A 1ZYBA 1S0JA 3EO6A 1SCSA 4JGZC 4A3XA 1JYIA 4BLJA 4C0BA 3BOPA 1FT9A 1LENA 4K20A 3S7IA 4Y22B 5JVVA 2OZ6A 3VBFA 1VJ2A 4N53A 3JZVA 3TNQA 4ATFA 4OLLA 1VIWB 2XKOA 5CIRA 1FMD1 2PLV1 2VY0A 2B46X 2QUOA 2WNVC 4AEJA 4JRLA 4Y22A 4GH4A 4PF5A 4O9EA 4GWNA 4S2GA 1RUOA 4GQ7A 4HFSA 1C4RA 1PIV2 4JDMA 4ZXKA 1ZZ7A 4F8AA 2VQ0A 2JDZA 1GNZA 4AQSA 2JG9B 4I09A 4YG3A 3KT7A 5D1IA 2H0BA 5BNPC 2WT0A 4KH9A 1ZREA 1OQEA 1R083 4XIKA 4M00A 4I0WB 4FPHA 5DG2A 5KHIA 1V6LA 2HWD3 5JOYA 1EV11 2JG9A 3ZSKA 4JTOA 3WY6A 4PDWB 1S0BA 5GALA 4XFHA 3VN4A 1AJKA 3VZJA 1ALYA 3IPVB 2CTVA 3USSA 2TBVA 4Y1UA 3MDPA 2A6XA 2NMOA 1KITA 3DPRC 1LOFA 3NV2A 4NR1A 4AVSA 1SLIA 1AR71 1BEV1 4QGMA 4Z8BA 5EZWA 2MNGA 3N7MA 4PDWA 1U12A 3JBG1 1NCRC 4AG4A 4BLIA 4HKOA 2OW4A 3N7KA 4YG0A 5I0UA 3IPVA 4KG8A 1H9WA 1RJ7A 1IZ3A 2OA2A 4N9IA 5DG1A 5LK5A 1PVC1 2Q5TA 1ENXA 1UPSA 4OHWA 4C91A 4LBQD 5KHGA 4IV3B 1NG0A 4BPZA 1G6NA 4JTNA 4Y1XA 1CPNA 4L99A 2R041 1U5ZA 2XLFA 2ZHNA 4EWEA 3E5XA 4IV3A 2EIGA 1ZVFA 1FOD3 1TME3 1RUC2 4GIQA 4X8PA 4FTBA 5ACA2 2WWSA 2PAEA 4EN9B 4COUA 1ZRCA 3WVJA 1XU2A 3HR9A 3ST7A 1AJOA 2DUOA 3BCWA 3TBDA 5ABJA 2VOVA 1W6NA 2D6MA 3B5LB 3N7LA 1AZDA 1LOGA 1OQ1A 3FWEA 5C33A 3ASIA 4XBQA 1POV1 4M3CF 2DF7A 3RNSA 1SACA 4AEMA 1W6QA 3JQWA 3PLQA 4BCUA 3M3OA 1AL22 1H4GA 1ND3C 3PHMA 5L19A 3RWNA 1NLSA 4R9CA 3O0VA 1V9U2 1NZCA 3ZYJB 5JZGB 1N1SA 4QPGC 4YM2A 4DY3A 4K6BA 3SXWA 3ZXKA 2JECA 4YGEA 2K9ZA 1UX6A 2GMMA 1W0PA 2VOXA 4YGDA 1JUIA 4XFBA 5AC92 4NOTA 2ZX3A 1ENSA 4D7SA 2CWMA 4PIZA 1ZZ8A 5JZGA 3ZYRA 2WA3A 2RS12 1EPWA 4R9DA 3SH5A 5LRSA 1RHI1 1X8MA 1JUHA 4UW4A 1VB2A 3AKQA 1RUG1 2YROA 1LGCA 4FOVA 4QPIB 2RJKA 2WLQA 3MLKA 3GYDA 2JXAA 2D44A 4D7YA 2O8QA 4WBBA 1OD5A 4AF9A 5KXBA 3VZOA 5F6KA 2WZR3 4E2GA 2EXJA 2OVUA 2A6VA 4PCRA 4G3YC 3VKFC 1DIWA 1X50A 4AHZA 1M06G 3LOIA 3LOBA 3ZN5A 1COV1 1FNZA 2QJVA 1VAVA 1AYM3 3AYCA 1RVF3 1Q5OA 2ZKNA 3FLRA 3RRDA 5FCCA 4LO6B 1VBE1 4AI1A 4JGZB 3TN93 3MW3A 4AQ2A 4Q4V3 4KQ7A 3MIHA 4IEZA 2VGDA 3WP3A 1APNA 2ZZJA 2IXKA 2R072 1LB2A 1PO13 2ZZQA 2WNVB 3WDUA 2XH6A 4JGZA 4AW7A 1RUF1 2WNUC 1MZ5A 2WNEA 4A7KA 2HWE2 5D8AA 4YW3A 1UU5A 1REFA 3BOWA 3GHMA 4IXLA 1QNWA 2DTWA 4XQWA 3X29B 4YLZA 4BH9A 3VKOA 1DHKB 3ZYIB 5AFBA 1R1A2 2VNGA 4LBJA 1QQP3 2EA7A 2SLIA 1QJY1 5BNPB 3NAPB 2G9FA 4E4DX 4AK3A 4AFCA 1UIKA 1QNYA 1RUI3 2BFUL 4J1WA 2BGCA 4CYDA 5J96B 4AYUA 2PN5A 2XG3A 2DFCA 4IEUA 4Q0VA 3WHTA 5HBAA 5FTTC 3APBA 3NAPA 5GZDA 1VRH2 4R9BA 4R4ZA 3B7MA 4YNIA 3TYJA 1YJKA 5KC5A 3DPRB 2F6BA 4MXVA 2D3PA 1Z7S3 4XJ9A 1QDCA 1J3RA 1QXJA 2VNRA 2DVAA 4AFAA 2WLPA 2E51A 1NCRB 1UPIA 3B9CA 3D6EA 3VBHC 1LOCA 1XNKA 2HWC3 4QQLA 3O0WA 1LODA 4LTAA 2RM21 2PHUA 4KG0A 3AP9A 1DQ0A 5BNOC 2WZPP 2VOKA 2VG9A 5CB7A 2ZACA 1RGSA 1QDOA 3MPPG 3M3QA 1GZCA 1NYWA 2QFEA 4B29A 2GC3A 5IK8A 2RS33 1ULFA 4AHWA 3QOPA 2R30A 4N7IA 3LA2A 2P37A 1I3HA 4AFDA 5FMOS 4JAAA 1B09A 1HKDA 2DVDA 1C8NA 3RYRA 4GALA 1YNAA 3MIGA 1AYN2 2A73B 5I8YA 3WINE 2RMU1 1OPOA 3ZPYA 3BU7A 5GLUA 3M7AA 4F7ZA 1ZBA1 1G9AA 1ULGA 1VP6A 4QT6A 3PMEA 1CAXA 2HWB2 3WG2A 5C8CC 3E6BA 2LALA 3L9JT 3AB0A 4UW6A 1ND3B 3T1LA 4K7JA 4RGGA 2Y0IA 1KFXL 1OPMA 1AR62 1EAH1 1PZ9A 3VZKA 1ND2C 2HYKA 1BBT2 2ERFA 4QPGB 5EXOA 4WM8A 4ONUA 2HWF2 3IT8A 2XBO2 2H0VA 3JB8A 3FLTA 1RUNA 3HT1A 2GN7A 3OY8B 3RSJA 1UF2C 2GC2A 2ZX2A 4GKXA 5I91A 5JLVA 3AJZA 3P3PA 4QPGA 1BZWA 2BQPA 1WLTA 4AGRA 2ZOEB 5A33B 4AFBA 4GKYA 3SCHA 4L11A 1QGLA 5T5JA 3POWA 4IV1C 3PVNA 3JQXA 1QJX1 2ATFA 4IEOA 4YFZA 3OY8A 3LB9A 4Y4YA 1RJ8A 1COV2 1I1EA 1C8M1 1IQAA 5A33A 2VXRA 2DCYA 4DFSA 5HXVA 1VBA3 1AR82 1HW5A 1YXWA 1FX5A 3USUA 1FNYA 3UK9A 3MLJA 1FMD3 1FPN2 2PLV3 1DGRN 3QH7A 3D0JA 1FV2A 1H0BA 1YRZA 4W6XA 1MS1A 1VBB3 1H1AA 5C9AA 2WC2A 4AEKA 4ZKTB 4E2SA 1S2KA 2DU1A 4MV2A 2CAUA 2R16A 4ISRA 4I0AA 4B7EA 1KXGA 4XHXA 4B4QA 1GNHA 2BVVA 1RUH3 2RJLA 2ZAAA 4QGNA 3VKMA 4GWMA 2B5HA 3WP4A 1LHWA 1YIFA 2GMPA 1V6KA 2VMIA 2EVXA 1OA3A 2WNUB 2LUWA 3MYXA 4YW4A 2XWBB 3MFCA 3L2HA 4NWWA 2Z69A 5EYXA 1UZZA 2ZS6B 2PHFA 3H1MA 2D3SA 2XB6C 1MVEA 4I01A 4QXKA 3AZZA 5E89A 4OHVA 1GYKA 1TMF2 2Q1ZB 3IM0A 3S30A 1DQ2A 2MEV3 2ZHKA 2WT2A 3HN1A 4CDWC 4URTA 1XNDA 3J9SA 4RS5C 4C90A 1X82A 4U2AA 2O0OA 1IS3A 2WFF2 3VZMA 2RR11 4ZU7A 3AKSA 1QJU2 3CL1A 3VBRC 4CDQC 1DLLA 2QCSB 1HQWA 2WA4A 2YPJA 2W0XA 1REDA 2QE3A 1SEFA 2ZGSA 1FXZA 4S2HA 1ZZ6A 4LHKA 4KGGA 5BNNB 1VB4A 4X6QB 4P9JA 4NO4A 4FTSA 2G4IA 3L2YA 1VBC3 3PJQA 3MFAA 4XF0A 2ZGUA 1PIV1 2Q0AA 5BNNA 2RE9A 5BNOB 4BA6A 1N1VA 1RUD1 3WD5A 1HV1A 1NLRA 4AHXA 4FPEA 4Y5Z0 4YZ5A 5CBLA 1POV3 3M2MA 5FLJA 5CNAA 1C3HA 1FAYA 5BNOA 2DWRA 1LRHA 1CR7A 4KU7A 1R082 3VDDA 1XQNA 4SBVA 5C4WA 3V0AB 2HWD2 4PIXA 3FJSA 3A0NA 2UWCA 1GZ9A 1WW7A 3OYWB 2AREA 1TEIA 1SBFA 3ZMOA 1OSGA 2NMNA 5F9TA 1RUJ3 4HK9A 4YW5A 5T5OA 4HKLA 4Q4W3 4ISQA 1VAMA 5FLHA 2OYZA 3V0AA 4AI0A 1ASJ3 1S0DA 1BYHA 2AENA 3G6JB 4CEYC 3EQEA 3OYWA 2XUMA 4OFGA 4XTPA 5C8CB 3OGJA 1HQLA 2IZWA 3U11A 1D0HA 5JR7B 3T2TA 3VV1A 2A70A 4AEDB 1AX1A 1ND2B 1RUG3 2JG8B 5DZGA 1H1IA 3VL8A 2D5HA 4KBBA 5CFCC 2ZPXA 2ZTNA 1A8MA 1T6GC 2GC0A 2PA7A 3O14A 1C8M2 4UW5A 2TEPA 1DBNA 4AEDA 5ACA1 1HRV3 1ZBE2 4B7KA 2JG8A 2PHWA 1FOD2 1TME2 3GALA 4Q0PA 4AVAA 4DZGA 4LEJA 2AUYA 2ZHLA 5DUXA 4IV1B 2WQZC 3AMMA 3ZFEB 2DURA 2N7GA 3LSDA 3M4FA 1PZ8A 4M3CA 3EHKA 2E63A 2D3RA 4L8QA 1XYPA 1AUYA 3RI9A 5JOWA 1AL21 4KWKA 3V56A 4IV1A 2JJ6A 2PHXA 4CDXC 5FFOC 3ZFEA 4XF4A 1V9U1 3D82A 4HSLA 4G4FA 2XJQA 4I3GA 3WQ0A 1UD1A 1PGW2 1C1LA 1MEC3 1QH7A 4RFT0 1UKRA 1RMU3 1AL0G 4CRQA 2NZ9A 4L2NA 5TSWA 2R063 3ZXLA 5AC91 5JMCA 1HLCA 5KXDA 3VKLA 3OD4A 2A6ZA 2ZMLA 3V65A 2DFBA 1LGNA 2EXKA 3UJOA 4AI8A 2RS11 4XMAA 4FO9A 4AQ6A 1F9KA 1JW6A 4AVCA 1Q8PA 4AWDA 2VPVA 5T52A 2VW0A 1XNCA 1PK6B 3WDVA 4I3PA 1XYNA 3ES4A 5DDJ3 3PTYA 3RDIA 3VBOC 2NPIA 3O12A 4Q29A 5J7MA 3U07A 1YHFA 2UU8A 2ZGKA 4YVSC 1ENQA 3ZXAC 4LR4A 1PK6A 5IK7A 1IPKA 4H55A 1AX2A 2EXIA 3QLQA 3ROUA 1C5IA 2UY9A 5BPXA 3M8LA 2DVGA 1XXNA 2WZR2 2E7TA 1LESA 5FO8B 1LTEA 5KHKA 3RPQA 3RG0A 3RMYA 3H50A 4MGZE 4AXOA 1OFSA 3LA7A 3VBRB 1MS4A 4XJZA 3ZXFA 4CDQB 2E7QA 1OOPB 1WW6A 2B42B 1V6OA 3FMGA 3NO8A 4ITCA 4QQOA 1H2NA 2XJUA 1RVF2 3KB5A 1W6PB 4WVZA 2R071 1LR5A 3TN92 4Q4V2 1RUD2 3M1HA 1IGOA 3MEPA 1X7NA 1NXD1 2UWBA 4CDQA 1OOPA 1DYPA 1WBLA 2WSUA 3FLPA 4XTMA 2K0GA 1I5ZA 4M01A 1PO12 2GDFA 2HWE1 3H1YA 3DF0A 2D6PA 4SLIA 4Q1RA 3RS6A 3B00A 1O4TA 1R1A1 3T1MA 1AHSA 1H9PA 1QXPA 1H8TB 4MYEA 4MSVA 5F6LB 2PQQA 3AX4A 4YVWC 4Q2FA 4F83A 3WLUA 5KXCA 1QQP2 4W65A 2DVBA 2JX9A 4XF3A 1PO23 3GZTB 1YUDA 3WG4A 1W6MB 3ZO0B 4OI4A 1WD3A 1HRI3 1H8TA 3FUOA 1W2UA 1ULEA 4DS0A 4IEXA 1Q8SA 1IS6A 3AXDA 1RUI2 1MR5A 2Y26A 1MS0A 3VBSC 3POSA 1J3QA 1PNGA 1VRH1 4V1PA 4X6RB 3U0ZA 3ZSEA 4FPKA 2VH9A 2JEMA 2A6WA 1CAUB 2VMGA 1W6MA 3KCCA 4H7LA 1OQDA 1KDMA 4QM9A 2I2SA 1XE8A 1M4WA 4Q8KA 4Z82A 2QZ3A 1X8EA 2VULA 1Z7S2 2C0ZA 4UBGA 2BWAA 5CAZA 4PJYA 4EN0A 2DCTA 1D4M3 3KSCA 4RA0A 1NCQC 5CU1A 2HWC2 3DGTA 2VVEA 1U5XA 3I4IA 3J8F3 2I07B 1CAWB 2ZAHA 1YI7A 3AZWA 4FP3A 3QCWA 2E6VA 1HXS3 3KD4A 4KWJA 5KHHA 5A3LA 3S0MA 2Z42A 2BEOA 3R05A 2RS51 4B4RA 2RS32 4A7ZA 2V09A 5CADA 2D5FA 4XQDA 2FHRA 2NQYA 1AYN1 4H3WA 2PELA 4NN0A 4K40A 1QMJA 4IETA 3CEWA 4NHLA 4CTEA 4RR3B 2C1FA 3NWKA 5GLWA 3AMQA 4RL7A 4N7UA 3IN9A 4OUSA 5E1RA 4XFGA 2HWB1 2WS93 2XJRA 3FFZA 3W58A 4RR3A 2EXHA 4Q26A 4WV8A 5T3NA 2XGXA 3WOGA 1AR61 4B3NA 1PGL2 3URFA 1BBT1 5JIAA 2ZKLA 2XL7A 2ES3A 3P3NA 4GMP1 1RUE3 3I2DA 5GLTA 2HWF1 5T55A 2XBO1 3MIEA 2B7YA 3H9AA 5CG8A 2FMYA 1VBD1 1XRUA 2X5IC 4FQ4A 4DPNA 1BK1A 5J48A 4HT1T 1SLTA 1QWRA 4QPYA 3NV3A 4QPIA 1S2BA 3R4UA 4WM7B 3INAA 3WDTA 4INDA 1YYNA 4ASMB 2P2KA 3U4XA 1BMV2 1RL3A 3B69A 1RIRA 5J3UA 2ZGNA 1XU1A 1UN1A 4YVSB 4COVA 4EWAA 3BB6A 3AP6A 3DL3A 1AR81 2EF6A 4NVPA 4WM7A 1B35C 1QU0A 1LHNA 4LNVA 1FPN1 3E6DA 1YFYA 1CGPA 2HEWF 5KXEA 2JE9A 1VBA2 4META 5EFUA 4FPCA 1H2KA 5BV6A 1WMFA 4GB33 1Q8VA 3MW4A 5GLVA 4JRAA 1VBB2 5GZEA 1TQ5A 4LBMA 1W6OB 2OUHA 3E6CC 1R093 1SCRA 2E9QA 3AJYA 3WDWA 1OKQA 2WNVA 3ILNA 5FO7B 4Z1VA 3GBFA 2RHPA 3LAGA 1RUH2 2YGLA 3U10A 2MHFA 1MVQA 3KMHA 3OCPA 4RD7A 1S55A 3KCXA 5H9PA 4DINB 1DF0A 1XYOA 4UBHA 5SV8A 3VKNA 1PZ7A 1UZYA 3ILRA 1U5IA 3VZNA 5FBZA 3MW2A 1OFNA 4XJWA 1TMF1 2ZGOA 4LBOA 5BNPA 1QHDA 4R9AA 1Q3EA 1S0FA 3FE5A 1CIWA 5GKAC 1YLLA 1A3KA 1XNBA 2VECA 2VOWA 3ZIWA 2H6CA 4YVWB 2EAAA 3FZ3A 4OZXA 1UMZA 4FXGB 1Y9QA 2WFF1 1UW8A 4H7MA 1BCXA 1SLAA 1QJU1 1RB8G 2VUAA 5CFDC 2R49A 4Q4X3 3DPRA 4LBKA 4YW2A 1G86A 4YZ3A 5KWRA 4ORFA 3M3IA 1NCRA 4XIOA 1IS4A 3I54A 4BZ4A 4ZU4A 3MICA 3ATGA 4RHV3 4MXWB 3DN7A 4A2UA 1NE6A 5KHJA 5HCBA 1CAVB 3NVCA 5LEJA 1RUC3 5I0SA 1V70A 2B9UA 1TE1B 2B45X 2IC1A 5T5LA 1S0IA 1POV0 2GN3A 3AM2A 3ZFFC 1LHUA 1VBC2 2RS52 3O5SA 1SFNA 4P14A 3PJYA 5I8TA 4MXWA 2TUNA 1TNRA 1WD4A 3G7DA 4XXAA 2AH2A 5FOBB 4QQHA 4P9WA 3PVBB 3KQRA 5DUUA 4S2DA 2R1DA 5L36A 1QF3A 4FPFA 4YZ4A 1R081 4Q4Y3 4OHXA 4D7TA 5SV5A 4XFFA 1LGBA 3AZVA 5A32B 1LKNA 3AYAA 4BIFA 3HMYA 2HWD1 1GBGA 1I9RA 3JD73 4FSJA 3WW1A 1CJDA 3H3ZA 4IEYA 4FOWA 3W59A 2GH2A 4N9HA 1UL9A 1UU4A 2X8KA 2ZGPA 3ZFGC 2BWCA 2P3IA 3ME2A 5FO9B 1RUJ2 1YFWA 1ND3A 4KWLA 3RMXA 3OJBA 4Q4W2 2P3JA 3ZX7A 1ASJ2 2FQPA 4DRRA 1JN2P 3J4UH 4Z92B 1VBD2 3AK0A 3ZN4A 3NW4A 4C1XA 5H9QA 1YCIA 1N3PA 2VUJA 4AFMA 1KJRA 3ZXDA 3CJXA 1AR93 3GBWA 3HT2A 3KGZA 3I8TA 1D0GA 3D4KA 4K1YA 4Q8LA 3FBYA 1OA4A 1DQ1A 4HSJA 3LWCA 4K1ZA 4PLOA 3VGIA 1ZBE1 4J6GA 2X5IB 3AZXA 4XFIA 1KRIA 1Z78A 1FOD1 1TME1 1RITA 2UY8A 5A3MA 2YXSA 2JE7A 1SFYA 3DV8A 3NL1A 4XEZA 1HRV2 1DZTA 1N3OA 3J26N 4RGAA 4XBNA 2Y38A 1GZWB 1WUVA 5BYNA 3SLIA 3WW3A 4J1XA 5L73A 4AVBA 3SMHA 3THPA 2HKXA 4RQPC 3DKWA 1LULA 1N1TA 1L3JA 4W6WA 1YFXA 2PHRA 4PBOA 4HETA 1B35B 1U0AA 3JU9A 1H4HA 3FC0A 2CV6A 1ZRDA 3NKTA 2A3XA 2F4PA 3N7JA 1JTZX 2XJSA 2IFRA 1X33A 1JOJA 1PGW1 5FPZA 1HDKA 4I30A 5DXDA 1CD3G 4FTEA 1B35A 2IXLA 5L7OC 1EV13 1K5MC 2QDNA 3NV1A 1MEC2 4HANA 2V73A 1YFUA 3I7DA 4XFCA 4LHNA 1R1A3 1RMU2 1V6NA 4NHMA 3A4UA 2R062 5JPMB 2PFWA 1KD7A 4BHPA 2P3KA 2WNUA 3OBTA 1H8VA 1BEV3 1AR73 1XE7A 3CO2A 1IHMA 3PMSA 3VZLA 3JBG3 4AVVA 3VBFC 4N53C 1ZNPA 4MH0E 2Z5WA 1PVC3 2R0FA 4HLTA 5FQ0B 5DDJ2 4E9KA 1C1FA 4BIOA 1JHNA 4RSUA 2XLAA 4DRVA 2C5DA 5JIUA 4P9GA 4GH4C 1W0OA 4R8HA 2WZR1 1FI2A 3AYEA 5FQ0A 2R043 2XJVA 2JENA 3LSEA 5JCTA 3VBHB 2P34A 1G9CA 5AFEA 1FATA 5CFDB 1SBDA 4IEPA 3PVEA 4XE9A 5E8AA 4KL1A 1RVF1 4D69A 3FHIB 1EY2A 3TN91 2PYTA 4P9LA 2C9AA 4Q4V1 2YYOA 3CJIC 3VBHA 3H1WA 2O8OA 4XJAA 1S0GA 1H2MA 3IMNA 1LU1A 1HIXA 5FPXA 1O7FA 2A5ZA 2Z2SB 2WT1A 3LGRA 2ARXA 4TZDA 1C28A 1PO11 3TOJA 4FPJA 4FPLA 1WLCA 1CPMA 1LOFC 1CJPA 2GNMA 3WT3A 4PDWC 4Z07A 4AQTA 4N43C 1LHOA 5CG9A 4LT5A 4LA2A 1WCDJ 1KS4A 1WMEA 2GH8A 4C0HA 4MZUA 4LE3A 1LOBA 1QQP1 3I59B 4OUMA 3VBUC 4AHYA 4P9XA 1BXHA 1EP0A 2DCJA 4FAGA 2HWB3 2DUQA 1YJLA 5T50A 4HKWA 2QKDA 1YWKA 1RUI1 5HCFA 1DG6A 1PO22 1NE4A 3AKTA 3WV6A 3HAGA 1HRI2 4XF1A 3I59A 1V00A 2OUJA 1ENRA 2ZGRA 3AMNA 1RHI3 4FBFA 1BBT3 5GJ6A 4PBPA 3D8CA 4IV3C 4LO4B 4YG6A 3D0SA 5IK4A 1DU3D 2XBO3 5C8CA 4L92A 3ZFGB 1Z7S1 4Z2WA 1OMIA 4KNCA 1DGLA 1NY72 2LTNA 3HQXA 4YSFA 3V64A 1BJQA 3ZDSA 5ABJC 4IEVA 5BUVA 2HWC1 1ND2A 4HL0A 1ZRRA 1D4M2 1LECA 1QJZA 3CU7A 3VHOA 3R6SA 3PNAA 3ZN6B 3H0OA 3IBMA 1LEDA 3BPZA 3JUUA 4UXAA 1COV3 3W9AA 3J8F2 3AKPA 3JB4C 5JI9A 2BPA2 3LKJA 3UV9A 4M3CE 1O3SA 2SBAA 5FRAA 3ZN6A 2RS31 4TWTA 1HXS2 3SH3A 4DB5A 1VBE3 1KDKA 4KGQA 4LBLA 2CY6A 2QVSB 3IWZA 3SH4A 4XZPA 2IXCA 1DGRA 4BE3A 2YZ4A 3OF1A 5EV7A 2BTVC 4NWVA 5JPNB 4FOQA 4ZU5A 3CLPA 4L97A 4CZSA 3RYPA 3ZSLA 3SCFA 2XJTA 1RUF3 5JWPA 1MQTC 2ILMA 4QX5A 4JDOA 4M0NA 4LO8A 4Q0SA 2ZGQA 1J1TA 4QU2A 4RQPB 1MZ6A 4XQ4A 4K8FA 5B2GB 4GA9A 2PHLA 4HVQA 4OI2A 3OBRA 4BMEA 2PAKA 2Z79A 5JOZA 3SCGA 1PGL1 4FPYA 3WP6A 1QJY3 2Y0OA 3B01A 2VW1A 3EJKA 2A3YA 3MLLA 5GZCA 1NQJA 3WUCA 1CESA 4PQ9A 1K5MB 2XVKA 1RUE2 5L7OB 3H7YA 3WZ1A 5DUWA 4TLFA 3DUIA 2BFUS 3FX3A 5JDBA 4HZFA 3IKWA 2IWGB 3NJZA 4CDWB 3MIBA 4RS5B 3AP5A 3MPBA 4QQPA 1BMV1 3IDEA 1X36A 4JVAA 4N53B 5KC6A 5K8SA 3ACLA 3GNEA 1W39A 2GALA 3R4DB 5GZFA 2RM23 4JDNA 3WP5A 3B93A 4CDWA 3ETQA 5IT6A 4RS5A 3WCSA 3HIFA 1GSLA 4S2FA 1AYM2 1ULCA 2PHDA 4YM3A 4Q0QA 4GH4B 2PAMA 2PTMA 3MGUA 4FOYA 4EWDA 3M70A 1VBA1 2NLRA 1ONAA 4CP1A 1JBCA 5D8AC 4Y1ZA 1HQNA 5F5QA 1SQ4A 4CDUC 3VBRA 2QNKA 4ASLA 1VBB1 1QKQA 4M0HA 1QY4A 4OHZA 5J36A 4CP0A 3ZIXA 4GB32 1WCKA 4F3JA 1W6PA 3TRSB 1CQ9A 1WA4A 4HMZA 4PLMA 4I2OA 2X53S 3KM5A 3FBMA 1GR3A 3AFGA 3BALA 3Q9OA 1NA1C 4WVVA 1MS5A 2RMU3 2VMHA 2YGMA 3K51A 1RUH1 3CJIB 1R092 3QACA 4K9SA 5JI7A 1BKZA 4FVVA 4YGCA 5BXXA 4MGYE 2CGPA 4IEQA 4LBQB 1ZBA3 1DYKA 1PGSA 3NAPC 1MS8A 2VW2A 4FT8A 4C1WA 3TNPB 3LA3A 2WJSA 4TYSA 4YRDA 1TNFA 2IXIA 2WIIB 3ELNA 5H9SA 3O0XA 1MZFA 3CJIA 1DGWA 2ET7A 2IXHA 4LBQA 4JQRA 4N43B 1WCSA 2ZX1A 4XFAA 4D94A 2ARBA 1EAH3 3TWIA 3VLBB 2NP0A 2UYBA 1F2NA 2MEV1 4P5HA 4MGIE 4LA3A 3VBU