3NW4A

Crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with gentisate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
363
structure length
363
Chain Sequence
b'KLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAAIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-Dioxygenase
publication title The salicylate 1,2-dioxygenase as a model for a conventional gentisate 1,2-dioxygenase: crystal structures of the G106A mutant and its adducts with gentisate and salicylate.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
total genus 102
structure length 363
sequence length 363
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nw4A01
3RNSA 1ZZ9A 1Q5OA 2Q4SA 3D0JA 4EWEA 1RC6A 1ZZ7A 3LA2A 3PVBB 4IEXA 2EA7A 2ATFA 5CU1A 2BGCA 4AXOA 3I59B 1PMIA 1XRUA 3U0ZA 3EJKA 3CEWA 4D7SA 5FLJA 1YUDA 5FLHA 4I0AA 4QM9A 1YHFA 4L11A 5I91A 4UXAA 2CGPA 5I8TA 2EVXA 3U11A 2VECA 1EYBA 2B9UA 3H8UA 5E16A 5J48A 3CL1A 5KHGA 3NVCA 4XETA 2DCTA 4BHPA 2GU9A 1VR3A 3L2HA 4I0BA 1DGRA 3CO2A 3FHIB 4LLOA 5I8YA 1Y3TA 4HVOA 1NE4A 2K9ZA 1U12A 1ZRRA 2Q1ZB 3FZ3A 4KL1A 4AVAA 3CF6E 3OTFA 1CX4A 4XF4A 1YFUA 2GZWA 1ZX5A 4N9IA 4JVAA 3BB6A 4PIYA 3H50A 4JTNA 1EP0A 2HJIA 2H0VA 3SCHA 5I0RA 1LR5A 5JR7B 1RUOA 2QDRA 3G7DA 2OZ6A 3EHKA 2PQQA 2EAAA 2K0GA 1OFNA 2VQAA 4UBGA 2FMYA 2KXLA 3MZHA 4J1WA 4QMAA 2UY9A 5KHHA 3EO6A 1J3RA 2XLGA 3H7YA 4I02A 3SCGA 2ETEA 3DL3A 3CJXA 2WFPA 3EQEA 1OI6A 4IETA 3M3IA 3H1WA 2CAVA 3PLQA 2B5HA 4LUMA 1L3JA 1ZZ8A 4ONUA 4R8HA 1CAXA 4K8FA 3GBFA 3HT1A 5F1RA 4QXKA 4Q0PA 1Q3EA 1UIJA 5BV6A 2OPKA 2C0ZA 2O8QA 1CAVB 4QM8A 1IPJA 5I93A 5JCTA 3EBRA 3I54A 4JV4A 1Q43A 1XE7A 2QNKA 3H9AA 3SMHA 3KMHA 4XFFA 5KHIA 3CLPA 1EY2A 2PTMA 4XFAA 1WLTA 2UYAA 4I3PA 3S7EA 3GYDA 4MV2A 2XLFA 3ES4A 5JSPA 1O5LA 3ES1A 3FX3A 4RD7A 3LA3A 4F7ZA 2PAEA 1RTVA 2ZCWA 4ZU5A 1CGPA 1O7FA 1WGPA 2QJVA 1UW8A 2IXHA 4XFIA 3ACLA 3RPQA 4I2OA 2BNNA 4AQ2A 4IEQA 4WZCA 5JSOA 1ZRCA 1YWKA 4EWAA 5C6CA 4MZUA 4IESA 5FLIA 1GQHA 3E5QA 3SHRA 3OCPA 1CAUB 2PFWA 1YLLA 4GULA 3UKNA 2GC3A 3ELNA 2Y0OA 5LEKA 5BXXA 4IEVA 4XF9A 1JUHA 1ZVFA 5FQ0A 4BIFA 4FAGA 1O3RA 1H1MA 3E6BA 3OGJA 4JTOA 1GQGA 3NSTA 3N4MA 1SQ4A 5J7MA 1QY4A 4MGKE 5JAXA 2O1QA 4B29A 4MH0E 1G6NA 4QX5A 3TNQA 3D0SA 2F4PA 4HN1A 4YSFA 1RUNA 4KU8A 1NZCA 2I45A 3LWCA 4FBFA 1YFYA 5J3UA 2CAUA 2XKOA 3LAGA 5KBFA 1J1LA 3NKTA 1CAWA 4BYYA 2E9QA 4IEWA 4QGLA 3R6SA 1UIKA 1PM7A 2GC0A 1Y9QA 4YARA 3I7DA 4X6RB 2BEOA 4IEUA 2FQPA 2MHFA 4HLTA 4AVBA 3IIAA 1X7NA 4KWKA 2BNMA 2QVSB 4XF0A 1VP6A 4YRDA 1J59A 2VPVA 1RGSA 3UKTA 1LKNA 1J3QA 3UKVA 4N9HA 2UY8A 4EV0A 4O9EA 3ST7A 4ZU7A 2IXCA 3IDBB 2D93A 2IXKA 3ROUA 1DZRA 3FE5A 4MX3A 3BPZA 5CADA 3I59A 3TNPB 2D5HA 1I6XA 3KSCA 1NYWA 3IDCB 1QXRA 2ET1A 5T3NA 4XEZA 1LB2A 3IBMA 5FPXA 3M70A 3B02A 3OD0A 3E5XA 3RYPA 2B8MA 5I0SA 4META 4OFGA 3O14A 1ZZCA 3FFQA 1NXMA 4HSJA 4BH9A 2XKPA 2UYBA 2XL9A 3LOIA 2XL7A 5JSRA 4E2GA 3H1MA 3E6DA 3E6CC 4ZU4A 4IERA 4YYOA 4LA2A 4P9GA 3H3ZA 4D7TA 4XFHA 1CAWB 1EPZA 1J58A 4EROA 5FDBA 3KCCA 3HQXA 3ZDSA 2OA2A 2WC2A 3E97A 3PNAA 4PIZA 3DV8A 4HMZA 1HW5A 4PJYA 5FCCA 3RDIA 1J3PA 2OZJA 4XFBA 3S7IA 2BNOA 1FT9A 2GH2A 2V09A 1O3TA 4FT8A 1QWRA 2PHDA 3BALA 2PAMA 4QGMA 3KGLA 3S0MA 3QACA 1IPKA 4LEJA 1UCXA 3FJSA 1FXZA 1CAXB 4Q0QA 4XF1A 5LEJA 4HVRA 5C8WA 2Z2SB 1VJ2A 2MNGA 2D5FA 3BU7A 1X82A 5D1IA 4E2QA 3NW4A 4IEZA 4KU7A 1QXJA 5I0TA 4AQ6A 5AVPA 4YNIA 4Z82A 5EZWA 4HSLA 4O9GA 1RL3A 4AVCA 5I0UA 4NVPA 3USSA 3WW3A 4MGYE 1CAVA 1H1IA 4R52A 3VHRA 3C3VA 4DINB 1ZZ6A 1O3QA 3H7JA 3MPBA 5FPZA 4HZFA 3HT2A 2D40A 5K8SA 2ET7A 1NE6A 2IXLA 2GC1A 2PA7A 4LUKA 4A2UA 3RYKA 3SCFA 3WW2A 3H1YA 1TQ5A 3OF1A 3IWZA 1LRHA 4TLFA 4KWLA 1ZNPA 2HKXA 1FI2A 3NJZA 3DKWA 1O5UA 2Z69A 2QCSB 2CV6A 4J1XA 4Q29A 5BPXA 1DZTA 4KWJA 3WW4A 4Q0SA 3RYRA 5BUVA 1XE8A 4X6QB 2XHKA 2MPFA 2GAUA 3E5UA 3QOPA 4IEPA 4IEYA 4LTAA 4LULA 4Q0UA 5E1RA 1I5ZA 4I09A 1YFXA 5HI0A 1OD5A 2Q0AA 4F8AA 1X8EA 2ZKLA 5FQ0B 2GC2A 1V70A 1ZREA 3ETQA 4UBHA 5KHKA 1CAUA 1DGWA 5LRSA 4XFGA 3HIFA 5LRRA 4I01A 2H6CA 2Q30A 2OYZA 3LZZA 4Q0VA 3U10A 4L2NA 3D82A 4WBBA 1SEFA 3BCWA 2PYTA 1X8MA 1ZRDA 4LA3A 3JZVA 3MYXA 1O3SA 4XFCA 1UD1A 2XLAA 4WVZA 4E2SA 4EWDA 3LA7A 3FWEA 4HBNA 2PHLA 4ORFA 5CVRA 4FAHA 3NL1A 4XF3A 2N7GA 2XGXA 4PIXA 3KGZA 4OLLA 4HN0A 3H3UA 1SFNA 4H7LA 4QGNA 1YFWA 4CYDA 5EFUA 2H6BA 1WA4A 4MGIE 4Z07A 2IXJA 2BYVE 5KHJA 2IXIA 3MDPA 2P17A 3RZZA 1O4TA 4IEOA 4MUVA 1ZZBA 1OMIA 1ZRFA 2PAKA 3SXWA 3WW1A 5I8SA 2IC1A 3DN7A 1UPIA 5BY5A 4HVQA 4MGZE
chains in the Genus database with same CATH superfamily
2BWAA 4EZHA 3WDVA 4NMIA 3D0JA 2Q4SA 5E6HA 1RITA 1RC6A 4PCRA 3LA2A 4CPBD 1ULFA 3VL8A 4DS0A 1SFYA 2A6YA 3HNYM 1Q8OA 5C8CA 2EA7A 1WCKA 3MLKA 5ERLA 1FMD2 3KV4A 1IPSA 3OPZA 4AXOA 1KJRA 2R071 2WNOA 3I59B 3NV4A 2VUDA 1XRUA 4UW3A 2ZEYA 2IUWA 4X8NA 1XBFA 3VBHB 4CA9A 2LS6A 1DGLA 4IXLA 3K3OA 5FLJA 4D69A 4FOYA 1BBT2 4QM9A 1WKYA 4LE4A 1ZBA2 4UFMA 1UKRA 4YZ4A 4DQAA 4NHKA 4UXAA 3I8TA 1YQ8A 5DABA 1S0FA 1QJX3 4LBQA 1ZYBA 5I8TA 2D6OX 3OBAA 2VECA 4FPGA 1EYBA 2WN3A 5E16A 2PHRA 3HPNA 4QHOA 1JU3A 1COV3 4CEYA 4Z2WA 1WBLA 3KWVA 1UNBA 1XNAA 2JXAA 4CDWC 4YGCA 3TWIA 1C8M3 1FOD3 1IGOA 2ZJCA 5JR2A 1PGSA 3UGFA 4DO0A 3WP5A 2WWSA 1VRH2 5FFOC 3PU8A 4YW1A 3BTZA 3RS6A 2YU2A 1RUC2 1VE0A 4HVOA 3S57A 2K9ZA 1TVGA 3CF6E 2RS51 3I2JA 4NPMA 3H0OA 1RUJ2 3AYEA 4FPLA 5FOBB 4JGYB 1GZWA 2DVGA 2JDYA 3ORJA 4JVAA 4QQPA 2G9FA 2FCUA 5FZFA 5L73A 4RS5B 3J8F3 2VO5A 3NO8A 1A8DA 2JDMA 4JTNA 5LB6A 1W8NA 1AJOA 4Y20B 2A6ZA 3THDA 1QIQA 4BK5A 2VNGA 3PURA 4DUXA 5B2GB 2RE9A 1AX1A 3HWJA 3U78A 2BV4A 3SH3A 5C4WB 1CPMA 3U14A 2EAAA 2DUOA 1LECA 1HB1A 2VOVA 1SLBA 1YI7A 2DU1A 2CGOA 2KXLA 3N7MA 3MLLA 3N9LA 5E88A 2WFF2 3EO6A 1J3RA 1F5JA 1NLSA 2J1UA 2XLGA 4I02A 4B7KA 3MFAA 5LZ6A 4JDOA 5EPAA 2MEV1 2ETEA 3SKJE 5FY9A 2PHFA 3LDRA 2C26A 4BQYA 1D4M1 4J6GA 4YG6A 5C8CB 2WAOA 2WJSA 1OI6A 5HI0A 4EN0A 2WT0A 3PMSA 1W2TA 2B5HA 2VCBA 3PLQA 3APBA 4ASLA 1S0DA 2Q5TA 2E6VA 4AW7A 1ZZ8A 3PUQA 4R8HA 4G3YC 5I0DA 3A22A 2JE7A 3PTYA 4RQPB 4UT5A 4LK6A 1OD3A 3Q8BA 4FVVA 4LPLA 1PHMA 3HT1A 1O91A 2LTNA 5F1RA 2R041 4W8JA 5JXJA 2EIEA 3VUOA 1WUVA 2VZPA 3RFRA 2AYHA 5FK7A 3DF0A 3JD71 4P9IA 3KB5A 4B4QA 4IGOA 1RMU2 5CNAA 4L92A 4A41A 3ZXAC 5FRAA 3AZYA 4UOJA 5I93A 1H9WA 3ZXLA 3I54A 3T09A 1GICA 3POEA 4I3GA 3TAYA 1Q43A 1XE7A 3N3HA 4A3ZA 3ILFA 3VZLA 3SITA 5JOZA 4DUVA 3CLPA 1UO9A 2PTMA 4YPJA 4YM3A 4AI9A 3WG3A 2GN7A 2VVEA 3RMXA 4XFAA 1WLTA 3KVAA 4YM1A 3T0BA 1W6PA 1A8MA 4I3PA 4JGYC 3S7EA 4Z1VA 4BE3A 2E53A 2XLFA 4A4AA 1OQDA 1JOPA 3QCWA 3LB9A 2DFCA 3GZAA 4OHWA 1O5LA 1H8TC 1LGCA 5F3GA 2LM3A 5JSPA 3WF0A 5JPNB 3J8F2 3NQHA 1OH3A 2W5FA 2JB4A 3LA3A 5FZ7A 2JICA 2PAEA 3TB0A 2XUMA 5CG9A 1XYOA 3I2IA 2KM2A 1E5IA 2FDFA 1ND3C 2WO2A 3RZKA 4WVVA 4YZ3A 3VB9A 1CGPA 5C4WC 2OX0A 1YCIA 5KXCA 1OC1A 1L7QA 2HYXA 4ZONA 4YW2A 4CCKA 1WW6A 1UZ0A 1VLNA 1C28A 2XWJB 1NCRA 2YHJA 1APNA 4YFWA 1K42A 4P08A 1OT5A 3AKTA 2XBO3 5H9SA 5A33B 2DV9A 5ACA1 5JSOA 1F8VA 1YWKA 2YMZA 2R7EB 5EJ1B 2HYKA 4K40A 4XJZA 1RJ7A 4IESA 3SNMA 2B46X 4DPNA 3TEWA 3IDEA 4M0NA 1W28A 2E26A 5C8CC 1WD4A 1W8HA 2IVIB 1HRI2 3CJIB 1IZ3A 3POSA 3OCPA 1CAUB 4BQ1A 4RFT0 4O61A 4XHXA 2XWBB 5BXXA 4IEVA 4XF9A 4GB33 4JKKA 2H0BA 5FV3A 1POV1 4KWUA 3W21A 1CONA 1BEV3 2Y64A 4RQPC 3CNAA 1LHWA 1DFQA 1TME1 4ZXEA 2PLV2 4FOWA 3AL6A 4OZOA 4FPEA 4PF1A 5FZIA 4CDXB 1KFXL 1S55A 5IVCA 1A6CA 2QBXA 3OGJA 1JUIA 1EAH1 2C6SA 3NSTA 4LIVA 4OMCA 2Z4FA 4CEYC 2ZAHA 3GZTB 1LHOA 1OLRA 1OLME 3VGIA 5FREA 5L7OA 4Z92B 5K4LA 2Y0IA 1XC6A 1DIWA 1G6NA 4QX5A 1ZBE1 4IQPA 4E4ZA 5DMYA 4AI1A 3HOBA 2ZOEB 1IS5A 2F4PA 4YSFA 1PIV1 4CXYA 4KU8A 3VD5A 2NMNA 4EJRA 4MXWB 4AQTA 2I45A 1C1FA 1T2XA 5J3UA 2CAUA 2XKOA 2J1EA 1W0NA 1J1LA 2X8KA 3IPVB 5CFDA 1VB2A 1PGW2 3TN93 1CWPA 5T5LA 2QQWA 1CAWA 4M3CB 4P9YA 2JECA 4R9CA 4CXXA 3AMMA 1P8JA 1Y9GA 1AR71 4LOTA 1VAKA 3ZFGB 4GJZA 1N1SA 3SEPA 1PM4A 1W6NB 1H9PA 2GC0A 1HB4A 1Y9QA 4HXCA 2D3RA 4S2GA 5DAVA 1L7RA 1S0IA 1RUE1 3J7MA 2BEOA 3T08A 4ATEA 4URTA 2IZWA 1WA6X 4HLTA 4L0PA 4QB6A 1SHWB 3IIAA 4A44A 1NCRB 4KG8A 4COZA 3BUCA 3ATGA 2X09A 2ZGTA 3BIWE 4AE2A 3N7LA 2QVSB 4XF0A 5F5CA 1VP6A 4CCMA 2VPVA 4A6SA 1RGSA 3MW3A 4BOWA 1LESA 3WQ0A 3BU0A 1J3QA 3I3QA 4A45A 5D8AA 4C1WA 5A3PA 4GWNA 3WR0A 2UY8A 2NZ9A 1IKQA 4EV0A 3VKLA 3VBRB 5LA1A 5GZCA 3JB8A 4PT6A 2D97A 2IFWA 1ENRA 2I2SA 3BPZA 3KHBA 2I74A 1BEV2 4H7MA 4PI0A 5GZFA 4FTBA 2GNBA 3NV2A 1OA3A 1ULEA 3C7HA 2AC1A 3KSCA 4OZXA 1OKQA 2HWD3 1LOAA 2D98A 3C7OA 3LSDA 5IFPA 1JBCA 4IUGA 3BODA 3WF3A 4IDZA 2ET1A 3ZYBA 2D6LX 1FNZA 2RHPA 3FN9A 1UZZA 4HG6B 4QX7A 4W6WA 3VDCA 3M70A 4NIAA 3E5XA 4HK9A 2WZR3 2EIDA 4GALA 1EV12 3DPRB 2A3YA 1UMIA 1WCDJ 4META 5IWFA 4FPFA 1S0BA 1Z7S1 4QAWA 1ZZCA 3AZWA 1KGYA 4C0HA 4IV3A 3WXPA 4BH9A 2UYBA 4RN5A 1GUIA 5LK5A 3ZM8A 4X8PA 4CUGA 1D0GA 1REEA 5JSRA 3ZYPA 1MS5A 4Y4YA 1PO21 5H9RA 4BQXA 4YYOA 3KT4A 4LA2A 1JYTA 1DQ2A 1UU5A 3AFKA 3KV5A 3C7EA 5CKMA 1Y4WA 4UFIA 5IK8A 3BGAA 1CAWB 1J58A 3NNLA 2YGLA 2QQVA 2OPWA 3QD6A 5DUUA 2XJRA 3SKVA 1CN1A 4XJ9A 1TMF2 3HQXA 4SLIA 2OA2A 2WC2A 2ZHKA 3PNAA 2NN8A 1KS5A 3LD8A 3CMGA 4YVWB 2JG8B 5FCCA 3S30A 2P3JA 4YG0A 2XPJA 1ENXA 1NCRC 2E32A 3AJYA 1UX7A 3LPFA 3BKZA 4AGRA 4BQ5A 2XXZA 1VB4A 4CTEA 1XSQA 3ZR6A 3OUJA 1FT9A 2EICA 2R072 3N9QA 1G9BA 2V09A 1O3TA 4OULA 2RJLA 1UU4A 2BGOA 3FMGA 4FT8A 1UYXA 4RHV3 1IS6A 1QWRA 1R1ZA 1RJ8A 5IK5A 4QGMA 4UFJA 3VBRC 5IYYA 1G9AA 2ZMNA 2QQIA 4H3WA 4GWIA 3RQ0A 2ZKNA 3M8LA 1MZFA 4XQDA 3WG2A 4XC9A 1SLIA 1GMMA 1DYPA 2ERFA 4LIUA 3ZFFB 1AR91 3FLTA 5AC91 5C8WA 3MV01 5IAVA 2VM9A 1JYWA 4GMP1 2D5FA 2HWD2 1SMVA 2RS13 1IQAA 1PMJX 4AI0A 2JD4A 4FPCA 2VOTA 2YXSA 1BXHA 1GP6A 3O1UA 1QXJA 4CZSA 1TE1B 5J98B 1HV0A 4XDPA 5DG2A 5JI7A 4YNIA 5A6ZA 3O1RA 1SBEA 3PU3A 1ACCA 1GWMA 1W3VA 3B9CA 3AP7A 4P9WA 3DPRC 1STMA 3PIGA 2ZGOA 3UJOA 5L7OC 3VDDB 2GDFA 4NVPA 2IWGB 3A0KA 5F2WA 2VOKA 3WDYA 1GZCA 2RDSA 1JZ5A 1XE0A 3IAPA 4XJ8A 1R64A 1H1IA 4R52A 1RUI1 2CGNA 3B00A 3SLIA 2WABA 3HVDA 1O3QA 4UWDA 3HBZA 1XSRA 1J83A 2YBSA 3FBMA 5K8SA 1IQDC 1K5MB 1SFPA 2XDVA 1C4RA 5A3UA 4R4ZA 1F4AA 4N7IA 4AGVA 2D6KA 3RI8A 4QHZA 4XHBA 4Q4Y1 3SCFA 1UQXA 1RHI1 3WY6A 5FYYA 4QKFA 3OF1A 4N8MA 2WN2A 3TOJA 1LRHA 2WR9A 5LATA 2HKXA 1F5FA 1S0JA 1WD3A 4CCOA 3DKWA 4QPGA 1W03A 3ZDVA 3HNMA 1HXS1 4D6SA 2UWBA 2Z69A 2MEV2 2NPIA 3ZSEA 2HWC1 4D94A 5F37A 1QDCA 4JQTA 2P3YA 1D4M2 4OUSA 3RYRA 4BDVB 4M4PA 4C1XA 2KD7A 3M4FA 2MPFA 3WLUA 1W04A 3AVSA 5CFCA 4IEPA 1REDA 4Q0UA 2Q8DA 5C3OA 1AR63 1I5ZA 1NA1A 5D8AC 1YFXA 2A75A 3UGGA 2ES3A 3PJYA 4IE0A 4Y5Z0 4D6RA 3BTAA 2AR6A 3N9MA 2JENA 5FZ6A 1WW5A 1V70A 2R042 3OEAA 5LY2A 3ZFFC 3MBWA 4FFGA 4XFGA 3RJRA 4ZS2A 3KHCA 4IL7A 3JD72 4I01A 1FPN1 2LUWA 3GALA 2HBUA 5B4XA 1M06G 1RVF3 3CU7A 3U10A 4W50A 3JXSA 4LT5A 3WHTA 4DXRA 2WUHA 2A3XA 1YJKA 3ZYHA 3W59A 4IGQA 2HWF1 4AAXA 1US3A 1QH6A 1LOEA 4PLOA 4O7XA 5LWBA 3LDKA 4LA3A 3B7MA 1ZRDA 4Y26A 3O1OA 2WINB 2ZGRA 1Z78A 3RMYA 1OURA 4XW3A 3WF2A 4CDQA 3ALQA 2VJXA 2YY1A 2CSGA 3KV6A 3LA7A 4KMQA 4S2FA 5A7NA 1QJEA 4YLZA 1OQEA 5HCAA 1W06A 1JYIA 4Q8LA 3J9SA 4HBNA 4IV3C 1W8FA 3E1F1 2VBDA 1PO13 4QPYA 4JHZA 4FAHA 5GJ6A 4Z2AA 3CZUA 1XPWA 3NL1A 2RMU3 4NJ4A 5FYMA 3RRDA 2K2SA 4AFBA 4YZ1A 1BHGA 1W6OB 2XGXA 3KGZA 2P1BA 4TLGA 1GU3A 3H3UA 2BFUS 5APAA 1SFNA 2VMEA 3KZ4C 5EYYA 1SLAA 5CB7A 4CXWA 4Y5SA 5DZGA 1KITA 1YFWA 5IVFA 2WNVB 1JYNA 1VBD1 2RR11 2W39A 4CYDA 2H6BA 1OKOA 2BOJA 5BNPA 4MGIE 5ABJB 3GDBA 4Z07A 2G1MA 1ZA4A 1D2SA 2IXIA 2Y6GA 2ZMKA 3J7LA 1N1VA 4JC1A 4PBOA 4WM7A 4XQWA 1W8OA 1GOHA 2V4VA 3RZZA 2PHUA 4QPGB 5BNNA 1UOFA 1LOBA 3LKJA 5ANQA 2CWSA 4IW3A 3D3AA 5KXEA 4CDUA 1ZRFA 1FV3A 3ILNA 3SXWA 1YRZA 4NUBA 5FZDA 1UWWA 2C24A 3I97A 2GMPA 2XQXA 4QXHA 5DDJ3 5BY5A 1NY71 3IM0A 3KLSA 1RUF3 2VZ3A 2WO7A 5L9RA 5KC6A 4BQ3A 2XJQA 2HLEA 4UFHA 4EWEA 4JHTA 2A70A 1UMZA 3OY8A 3PVNA 4O65A 4GH4B 2YU1A 2VGDA 2ATFA 1PZ9A 1NG0A 2YBKA 3AXDA 1AUYA 3RZJA 3VD3A 2WQZC 1SDWA 4XQ4A 3K77A 2FZ2A 3B69A 3U75A 4XVHA 2HEVF 1EAH2 2BUKA 1RVF2 2W94A 4I0AA 1ND2B 2GN3A 3ABZA 4XIKA 4L11A 5BNOA 2HWE3 2GNDA 3POWA 3WHUA 1ZBE2 1W6MA 2XH6A 3P6BA 4RGAA 3U11A 2ZAAA 5GLUA 3AXEA 3IMNA 3WNNA 3CL1A 1O6UA 5TSWA 2FBEA 1PIV2 3B01A 3ZLIA 5FO7B 2JWPA 5KHGA 4XETA 2DCTA 2Z42A 5FMOL 1ODNA 4XZPA 1QJU3 2W1QA 3V0BB 2PXJA 3L2HA 4I0BA 4WM8B 3IKWA 3POBA 1NQJA 1PO12 1DGRA 4XUQA 1V9U3 3ASIA 3B9IA 5FBJA 4AI3A 3CO2A 4UAPA 3PUAA 1QF3A 1AR72 1MS8A 2ARAA 2DFBA 4NIHA 5L36A 1NE4A 2DYCA 1U12A 1ZRRA 4KL1A 2X53S 3VZKA 3HQUA 4DEVA 2IVJA 1BK0A 2K46A 1LEMA 3GBWA 4XDOA 1DU3D 3VV1A 4LHLA 4BZ4A 2GZWA 4XABA 4QD2A 1ZX5A 1RUE2 4CU8A 2JDUA 2UWAA 2BVVA 4OHYA 4LKDA 5ABJC 5FKCA 2Y33A 3K3NA 2DU0A 3H50A 4INDA 5BNPB 3SCHA 2QQMA 4QPGC 5M0TA 2WAAA 2WYSA 3ZXJA 1JH5A 1JZ8A 2WS91 3OBZA 1ST8A 4QDQA 4GKXA 4LQRA 1YXWA 1PVC3 3G7DA 5BNNB 1NLQA 2PQQA 4LXLA 1YYNA 2D3SA 3M3CA 4QB2A 5E89A 4Y1XA 2VQAA 1ENQA 1C57A 2FMYA 1RUF2 4DUWA 4J1WA 5CFCC 1Y43B 1ZRIA 5FXWA 3H7YA 1NA1C 3TEZA 2JDHA 1FMD3 3ZYFA 5DUXA 1S0EA 1O8SA 2DCYA 3ZR5A 5KC5A 3AZXA 1W9TA 1RYYA 1SLCA 3OY8B 4K8RB 3WP4A 2ZEWA 3LFIA 3EQEA 2A6XA 2WBKA 2Y6JA 5T55A 1VAVA 2R16A 4IV1A 5FZLA 3M3IA 4KQ7A 3GXUA 2G19A 3K2OA 3T1MA 1BBT3 1XNDA 1YO8A 1ZBA3 2O8OA 3DECA 1JS9A 3I3BA 4Q4V1 1ND2C 4ONUA 4D7YA 2FCVA 1CAXA 4UW5A 3MV11 4AEJA 3BOPA 1OF4A 2Y6KA 2ZHNA 5JLVA 1S2KA 1KS4A 2JKBA 4QXKA 4Q0PA 2JX9A 1LJ7A 4P9LA 3O0WA 1Q3EA 1RUD1 1UIJA 1W6MB 2W46A 1F31A 2OPKA 5BV6A 2ZEZA 3WINE 1WMFA 2C0ZA 4NN0A 1CZTA 2O8QA 3VD4A 3USUA 1UY2A 4CDQC 1IPJA 1OUSA 1PO22 3OOXA 1JZ7A 4H55A 3FL7A 2WYFA 1VRH3 4FXKB 1KD7A 2J1AA 4NHMA 1V9U2 2J7MA 3DEMA 5F8PA 4GB31 4ARYA 1RUC3 4M4RA 1JODA 3KMHA 5FK8A 2JJ6A 2XOMA 5F3EA 3IDAA 5EQUA 1RUJ3 3OPTA 1LOCA 5G04L 3MW4A 3ZN5A 4LKFA 3PVEA 3GYDA 2EXKA 4K1YA 3V64A 4FPYA 5C70A 3ES1A 1Q56A 4LR4A 5IHRA 5BNPC 3POGA 3WF4A 2Q8OA 2ZEXA 3ZPOA 5JWPA 3T4VA 3ZN6A 2SLIA 4A3XA 5BNQA 4WM7C 4EYUA 4OI0A 5K0UA 5JMCA 5GZGA 1H4HA 2VZQA 3L2YA 2ZCWA 2QFEA 4ZU5A 5BNNC 2OVUA 2VQTA 1PGL2 1GOGA 3IB3A 1WGPA 2F6BA 4AHWA 4YGEA 1QOTA 1UW8A 1VBE2 2DCJA 1UXXX 2IXHA 2D6PA 4XFIA 5GKAC 4E4SA 2WFF3 4I2OA 2BNNA 1G9DA 4TN7A 5FY7A 4IEQA 4QKNA 4WZCA 3AKPA 4CEWA 3ACHA 3I2GA 2A3WA 2A6WA 4MZUA 4XCBA 3WUCA 4MGTA 3KM5A 1AR92 4JZRA 3ZXGA 5AC92 3VLBB 2ZGMA 4AL9A 5T5OA 2BW8A 3SHRA 3R0RA 1ULCA 2BJSA 2GC3A 2W08A 3CIHA 3ELNA 4AI8A 4ASKA 2D7FA 4LKSA 1OVPA 3RZHA 1VBA1 4ZS3A 3ZFEA 1JUHA 1GSLA 4QXCA 2VTXJ 4B7EA 3FUQA 1ZVFA 3MIFA 4IE4A 5C3SA 5FTTC 1BKZA 3GCXA 5FQ0A 3JBG1 5A1AA 1YIPA 4BIFA 4FAGA 4AAPA 4DEQA 4IE5A 4QKBA 2WNEA 4MG2A 1Q8QA 3AMHA 1RIRA 2HEYF 1DQ5A 1KFUL 3E6BA 1RUI2 2V4AA 2XVLA 1GQGA 3HAGA 1RMU3 3LE0A 4AEDB 1HQWA 1SQ4A 5FXXA 1X36A 1I3HA 3ZOIA 1NUKA 3ECQA 5CEHA 1QY4A 4MGKE 5J7MA 3QBQA 2VOWA 5JAXA 1M4WA 1QNYA 1XU2A 4NWWA 1AL21 4U2AA 4MH0E 5A3TA 5SV5A 3VBUA 4Q4Y2 1YQCA 5GLZA 3AMPA 4CP9B 2E7AA 1RUNA 2J42A 3C7FA 3BI3A 2ORZA 3LWCA 4GXLA 4COVA 1ALYA 1H8TB 3M3QA 4Q4W1 5FZAA 2DF7A 1YFYA 4PQ9A 4LO7A 5CKQA 5FZ1A 1HXS2 5FXZA 2P4EA 2JKXA 3A4UA 2RV9A 3L9JT 3AMQA 3NKTA 2HWC2 1D2QA 4BYYA 1F2NA 1ND3B 5A6XA 4QGLA 1UIKA 4OMDA 3WV6A 1LHNA 2YPDA 2YC0A 3OJBA 3WVJA 2RDRA 3VD9A 1CVNA 1OA4A 4JRAA 4YARA 3MIDA 2YFUA 4B3NA 2WLPA 4BM8A 4K20A 3EYPA 4IEUA 1PVXA 4F83A 4LK7A 5ISLA 2WDBA 4XYXA 3U4SA 1XYNA 4LBMA 5FP4A 1X7NA 2BNMA 3PHMA 2WWUA 3GJAA 4CEWB 5C71A 1GLHA 2W92A 1HRI3 2WA3A 1A3KA 4OYUA 2ZACA 1RXFA 2J1TA 5J09A 3UKVA 4XJAA 1FPN2 4NOTA 5HCHA 4N53A 2AACA 3ST7A 4P9XA 4ZU7A 3S5AA 2ADEA 5FYBA 5A80A 5A32A 2EAKA 1QH7A 2QKDA 1GP5A 2ZPXA 2HWF2 1TZOA 1QU0A 3ROUA 4BIOA 3UESA 4LJHA 4MX3A 1QJY3 4Q4X1 5FR3A 5CAZA 1AF9A 2PLV3 2WO3A 4LBQB 5SV8A 3TNPB 1F35A 3ACFA 4E8CA 3TBDA 2A5ZA 1I6XA 5LBBA 1C3HA 4AF9A 1OLQA 4JQRA 4CEYB 4AEDC 1XXNA 1V6JA 3IBMA 4BPZA 5HCFA 1QEXA 1SLLA 2BFUL 2YC2A 3B02A 4IE6A 4HPKA 2BBAA 4BU2A 1CZSA 2RJ2A 4LITA 3RYPA 2R061 2B8MA 3UK9A 2Q1FA 2D6MA 4COWA 4PDWA 2V5YA 4A42A 2ZX4A 1Q8PA 4XZUG 3VBUB 4AHXA 4N43A 1VBD2 2RR12 2XKPA 3LOIA 1BCXA 2XL9A 5FP8A 5J37A 2B45X 5HV0A 5CISA 4E2GA 1GZWB 1LU2A 5AVAA 5F6KA 5LA9A 3ZX7A 3E6CC 1AHSA 4ZU4A 3WT3A 5IK7A 1UY3A 4AWDA 2FD8A 4P5HA 4BB3A 1ONAA 2EXJA 1WW7A 2FDJA 5C5TA 3AFGA 2CU5A 4D7TA 1FX5A 5KXDA 1W8WA 4FP3A 5A3MA 1AR82 3LDBA 1PK6A 3VL9A 3LEIA 1X33A 3I2DA 5LY1A 3AM2A 1NY72 3E97A 3N9NA 5FYCA 2FDIA 2BZDA 3WCRA 1DCSA 3LIGA 3SEEA 4DXZA 1G9FA 1V6KA 3AK0A 3RDIA 3ITQA 1ULGA 1ENSA 3S7IA 4A7ZA 2B39A 5A6QA 4CEWC 3P5BA 4U36A 1GP4A 4Q8KA 4OVEA 1ASJ3 2R32A 2YFZA 1DBNA 1HN1A 4XXPA 2G9GA 2XHNA 3AKQA 3BALA 2IFRA 2PAMA 3MUZ1 3Q8FA 3WNKA 2VMFA 2YPJA 3VZOA 3KGLA 3ZXDA 3KT7A 2XJTA 5KR7A 3G6JB 3MLJA 4LEJA 5FY5A 5A32B 4CCNA 1QJY2 1U5IA 5G05L 4Q0QA 3ZFEC 1MS4A 4Q26A 5FYSA 5L9VA 2KA3A 2Z2SB 1VMJA 1RB8G 1YJLA 2MNGA 5AFEA 5F9TA 3AP6A 1X82A 3WDTA 4V2WA 2LW8A 4DZGA 1LAJA 4QU1A 3NW4A 3AYCA 1B35A 2PELA 4I30A 4B1MA 5FZHA 1W0OA 3NV3A 5AVPA 5FUIA 1BVVA 3MFCA 3O1SA 2FDHA 1EV13 4IGPA 1MZ5A 4FPKA 4L8QA 1HB2A 4AVTA 4EN6B 4O9GA 2ZX1A 4JDMA 1VBC1 4AVCA 4PI2A 2JIGA 3VBOA 4PDWB 1J1TA 2XONA 3VBUC 4GQ7A 1CAVA 2C9KA 4ZZ8A 3C3VA 3AYDA 1W6PB 1ZZ6A 3AZVA 3WNXA 5K9YA 3WG4A 3MPBA 2ZHLA 2CNAA 1IHMA 2GP3A 2RS31 4YW3A 2HWB1 2WO1A 2WT1A 4YW5A 4ET7A 2VC9A 1W0PA 5FMOS 3HT2A 2D40A 1CIWA 5FZKA 4XUOA 3ZMNA 2WS92 4HKWA 5EJ3A 1R091 2E63A 3M2MA 4BJ0A 3C2UA 4JRLA 1TMF3 1WWYA 3OGSA 1TQ5A 3EXUA 1AYM1 1YNAA 3BOWA 3V65A 3HQRA 3D8CA 3BTXA 3NJVA 3AVRA 2YBPA 5GZEA 1RUG1 3HBKA 4KWLA 4MXVA 5LBCA 2VQ0A 2WSVA 5FKBA 1DP0A 2NQYA 4D8MA 4MGSA 2CV6A 2W52A 5K7PA 3MO4A 4Q29A 1DZTA 1VALA 5EXOA 1EPWA 4Q0SA 1VBB1 2R073 1W90A 2W0XA 3QH7A 1ASJ2 1AYN1 1LENA 2CDPA 2YC4A 1DQ0A 2GAUA 3UETA 4W4ZA 1QQP1 4IEYA 4LTAA 2VUJA 2WQ4A 2E7QA 4Q4V2 1OD5A 4RA0A 5DAPA 3GJBA 4OI2A 2D6NA 4W65A 1Y9MA 4UBHA 1RUD2 3AC0A 4QT6A 2VH9A 2Y34A 4M00A 1AL0G 2Q30A 1QHDA 3LZZA 4PHZA 1XYPA 4L2NA 5FJHA 5JMOA 4AQSA 1AJKA 1WMEA 5FPUA 4YG3A 5L7OB 3I4IA 3JZVA 4EN8B 1UYZA 3I3DA 1MEC1 2RS53 2DTWA 4C8DA 4WVZA 3KCYA 1UZYA 2B4KA 1NAEA 4PDWC 4NO4A 5F32A 1HRV1 5E8AA 1W99A 3FWEA 4MVTA 1IS3A 1JU4A 3VBOB 2EXHA 2QQNA 3A0NA 2P3KA 3M3EA 1MQTA 4Y1ZA 5C7GA 3M7AA 5A3WA 1JYXA 2ZX3A 5CVRA 2QQLA 3JUUA 4OCTA 5CFDB 4CUCA 4XF3A 4GD4A 3MUY1 1ULDA 4PIXA 4OLLA 1W2AX 1KRIA 5JI9A 1JYCA 1T6BX 2VU9A 4QGNA 2P6CA 3BVCA 1JZ3A 1WA4A 1PK6C 1Q8VA 5FZGA 3RZGA 1DZQA 1OH4A 4KH9A 3H8XA 2BYVE 1KJLA 2MEV3 3MDPA 2P17A 2BRTA 3KT1A 4R4XA 3IMMA 2BQPA 4Q27A 5FPVA 1EUUA 3J26N 1D4M3 1ZZBA 1W2NA 4MYEA 5A3NA 4M0HA 5FP9A 4E27A 2V72A 1XOYA 3WW1A 5IVBA 4Y5TA 3W5MA 1GFF2 2RM21 1IOAA 5D8AB 4MGZE 1VBA2 2V5DA 3SH5A 2VMHA 5HXVA 4Y3OA 5A7WA 3IIIA 3RNSA 5JOWA 4ZPIA 1ZZ9A 2VAUA 4KBZA 4K21A 2VE1A 3WNPA 3KD4A 3JBG2 3URFA 2R043 4Z8BA 3LEMA 5IVVA 1BMV1 1S2EA 3THPA 5CU1A 1QJFA 3K4ZA 5C3RA 2AGSA 3V0AA 2YGMA 1CIYA 2J22A 3FUOA 3JD73 4EZ4A 2NP0A 2GH8A 3O1VA 3EJKA 4D0QA 1OVSA 1J84A 1CD3G 1UL9A 3HEIA 2JE8A 4MADA 5FLHA 1U5YA 1UU6A 4CCCA 3PUHA 1LHVA 1AL22 3VHOA 3GGLA 1NLRA 3IZOA 4FPHA 1URXA 3WDWA 5LASA 4BXFA 2JD9A 2RS52 3VZNA 4YWAA 1OA2A 2Y26A 4FQZA 3VBFA 5C33A 1U0AA 2YYOA 3NNMA 4BHPA 4LOSA 2OT7A 3GHNA 1VAMA 4IV3B 4N7UA 4Q4W2 3VBOC 2BP6A 3ZIWA 3SQOA 2VOXA 4QQ2A 3MICA 3WD5A 3O1MA 3TRSB 1MQTB 4Y4RA 3GBGA 5CFDC 4PF5A 4CPBA 4LLOA 3NMBA 1C5HA 2Q1ZB 3FZ3A 1KDKA 1XNCA 3IN9A 1C1LA 3LEKA 1CX4A 1X9TA 3OTFA 3ZXFA 1V6IA 3K48A 1TEIA 3AYAA 4N9IA 1YI9A 2NLRA 4WZFA 4GZ9A 5ACA3 3GZUC 2EXIA 1POQA 3FLPA 2VCCA 1DGRN 2R30A 2DVAA 2ZTNA 1HX6A 2J1RA 2GNTA 4L9BA 4NRPA 2FDGA 1EP0A 5I0RA 3NKGA 4N90A 4MHUA 3VHPA 3O0VA 1R081 1POV0 1JW6A 1KDMA 4JKMA 1UN1A 2OZ6A 1UZWA 3EHKA 3OYWA 4CSWA 5KWRA 4XTPA 4XURA 1OFNA 2VR4A 2X10A 2V73A 1MZEA 3HD8B 4UBGA 4W6XA 1O8PA 1POV3 5L19A 1LULA 5KHHA 3RSJA 5CKNA 3N7KA 1RUH1 3ILRA 4DB5A 3VDAA 1R1A1 3A23A 1W39A 2W3JA 3SCGA 5JOYA 4Y1YA 2BGPA 1TME3 2Q8EA 5J36A 1V6NA 3DL3A 5H9PA 3CJXA 2QQOA 2WFPA 2VW0A 1PZ8A 1EAH3 4IETA 1NCQA 1CQ9A 4K3UA 1QXPA 3HN3A 3V0AB 5FY0A 3WQ1A 4AGGA 1QOSA 2XQRA 3PUSA 1YC61 1HQLA 2Y6LA 2E31A 1CJPA 2R062 4K8FA 4NPLA 2GMEA 1ZBE3 1G86A 3LIHA 1H2MA 4BCUA 4CP2A 2JDNA 4ISRA 4B4PA 1PIV3 1N1YA 4DRRA 2YV8A 2GNMA 3DUIA 4QPIA 4CUBA 3WQ7A 2QQUA 1SBFA 4QM8A 3WDXA 5JCTA 1H6YA 4CRQA 1UXZA 4JV4A 2L9LA 1Q8SA 3MHZA 1AR73 1MQTC 2QNKA 3H9AA 3SMHA 4XFFA 3I2FA 1EY2A 1QJX1 3AKRA 3ON7A 3RZMA 2VBBA 4WVMA 5IW0A 1OQ1A 5T54A 2P6HA 1NQDA 3ZYGA 2VL4A 1RUE3 2UYAA 5FBZA 1LOGA 3LEGA 2XJPA 4MV2A 1COV1 4LBOA 5L9BA 4YZ2A 4QX3A 3OD4A 5F3IA 1C8M1 3FX3A 1FOD1 1OOPA 1HB3A 5AFBA 4FOQA 3A21A 5HV4A 1FV2A 3BTYA 4F7ZA 2GALA 2FCTA 1HJGA 1RTVA 3FHAA 1CX1A 1VPHA 4J25A 3JQWA 3WZ1A 1DDLA 1UOJA 4UW6A 2QQKA 5FZMA 1SBDA 2DURA 4DY3A 5CFCB 3ACLA 2ZX2A 1GV9A 3AZZA 1NA1B 2XUEA 4AQ2A 2OS2A 2W68A 1H0BA 4P02B 3J8F1 3R4UA 5C6CA 3AP4A 5IVEA 1TME2 4LO5B 4L99A 5FLIA 4JDNA 2QZ2A 4PLMA 5T52A 2VNVA 2BU9A 4E8DA 4DMIA 3E5QA 2I07B 2WZ8A 1CPNA 1PMHX 3KF5A 3P3NA 4GULA 4P5YA 5FZ3A 3KQRA 3NV1A 4I0WB 1NCQB 2RG4A 2ZZJA 3CHXA 4UFLA 2JDZA 2B9VA 5FZBA 1LU1A 1F9KA 2R6QA 1LEDA 1Z7S3 5FZ4A 3U37A 3AL5A 2DUQA 2QQJA 1E5RA 4R9BA 1FAYA 5CBLA 4JTOA 3VBFC 4CDQB 2EALA 1MS0A 1PO23 2F17A 1N47A 4ATFA 4QQLA 5FMDA 2VVFA 2RS32 2HWB2 1SPPA 5FPLA 4Y24A 1PZ7A 2O1QA 2VZRA 3NAPA 2BPA2 4MHRA 2DTYA 1R092 3D0SA 3T0DA 5FYVA 5IK4A 2Y38A 4QU2A 5LK7B 4HN1A 3VHNA 4CDWA 1AYM2 5CYYA 4FCAA 1DF0A 1GYKA 1RUG2 2VCMA 3ZMOA 1G8WA 2TUNA 4FBFA 5FZEA 5KBFA 4NIDA 4HFSA 1HJFA 1A78A 1DQ1A 5DAQA 2JE9A 1OUXA 3ZO0B 4WM7B 4OI1A 1BJQA 2E9QA 4IEWA 2UURA 4UF0A 3R6SA 2ZMLA 1D4VB 1AYN2 4TYSA 1PM7A 2PHTA 3NNFA 4CDUB 1QQP2 1VBE3 4P9JA 2WNUA 3U4XA 4AR2A 5D2AA 1X9PA 4X6RB 4A6OA 3NWKA 3K51A 4UYBA 1SACA 2ARBA 1PGW1 2D44A 5F7UA 1GQPA 1AR93 5AC93 2QQPA 1MVEA 5FO9B 1J59A 2JG9A 5FIXA 3UKTA 1LKNA 5JOXA 2VZTA 4N9HA 1LGBA 1Z0HA 4O9EA 4E9KA 2UU8A 1EUTA 1NCQC 2IXCA 3IDBB 2GMMA 2D93A 2VMIA 2X29A 1XQNA 4HETA 4ZXKA 4YVSA 2PHWA 2XBO1 3NJXA 5BNOB 5CADA 1Z7S2 2VUAA 4BWOA 1MEC2 3I59A 3Q9OA 3EMRA 1S4CA 1NYWA 1RUI3 2W2IA 3VBHA 2O0OA 4MSVA 4XXAA 3IDCB 1LODA 2CL2A 2CDOA 3A7QA 4QPIC 2VW2A 1HQNA 1SLTA 5D21A 3B94A 1VMHA 5A7QA 3H3LA 5I0SA 4R9DA 4Q4Y3 4M3CF 3OEBA 1RHI3 1BEV1 3K75B 1W8TA 1AXYA 4CCJA 3O14A 4DY5A 4E4DX 3WNOA 3FFQA 1DYKA 2E7TA 1BVP1 2WIIB 3CBNA 3Q8CA 5HPOA 1NXMA 2CY6A 2J1SA 2OQ6A 5F6LB 5GM0A 5LA2A 2DBIA 2XL7A 5FYZA 1W05A 3LQCA 5GLVA 5A1LA 2JDAA 2NYYA 3HR9A 1HXS3 2HBTA 2HWC3 3O5SA 4LBJA 5BYNA 5C3QA 2BDRA 5FY4A 2D43A 1NXD1 2CWMA 5B4NA 3OGRA 4QB1A 2BTVC 4Q2FA 4XTMA 4K6BA 5T5PA 2BERA 2OXBA 3ZPYA 4CDUC 3PVOA 1BQPA 2RM22 2FHRA 1GANA 5FDBA 4UF0B 2X05A 2Y60A 3KCCA 4LLFA 4Y1UA 4R9AA 2JDKA 1XNBA 4RS5A 2ZGQA 3DV8A 4HMZA 1HW5A 3POFA 3Q8AA 4LORA 4PJYA 2OZJA 4XFBA 2ILMA 4Y20A 3ZKYA 1CJDA 1O59A 3WF1A 3TN91 1OSGA 1QKQA 1BMV2 2R1DA 3O7OA 5EP9A 1FPN3 3MF9A 3PJQA 4ITCA 4P00B 5JIAA 1QJZA 1WLCA 5F39A 3RVHA 1MVQA 2PHDA 4YW6A 2Z5WA 4IV1B 1JZ6A 1HKDA 1WZXA 2HWF3 3JB4C 4JGZA 4GKYA 4OUMA 3T4HB 3I49A 3QACA 4W6YA 5EIYB 3FJSA 3FHQA 3KV9A 1FXZA 5BNOC 1CAXB 1ODMA 1VIWB 3AX4A 3HJRA 5DN2A 5FMCA 4YVSB 1UMHA 1UKGA 4HVRA 5LEJA 1VJ2A 2P2KA 1JOBA 5DQ0A 4ZHNA 3BU7A 3PL0A 1WLWA 4DOUA 3PUIA 4E2QA 3ZVXA 4IEZA 1CR7A 1AX0A 4KU7A 2ZS6B 3ZYJB 5I0TA 2J1VA 3USUB 4AQ6A 4JCKA 4RQPA 2VD7A 1JI6A 1GNHA 2NM1A 3JCIA 5FZ8A 1WBFA 4YFZA 1C5IA 2ZGPA 4HSLA 1S1AA 1RHI2 3BPSA 3USSA 3NAPC 2Q1MA 4CCEA 1YQ6A 1VBD3 2EIBA 2RR13 3THCA 3U1XA 4CCDA 4MGYE 1D7PM 1JHJA 1UY1A 4GWMA 2RJKA 2HWD1 4QQOA 3VHRA 4DINB 3H7JA 4TXWA 2VUCA 3D6EA 1XU1A 1US2A 4HZFA 4JX0A 1UYYA 1NE6A 5DUWA 5FWJA 4OQ8A 2RDQA 1JHNA 4COUA 3OSDA 2WZR1 2GC1A 2C1FA 1R082 2PA7A 4XAAA 2ARCA 4NRQA 1AR83 3ZN6B 1TNRA 3RYKA 3PTRB 4OUEA 5FYHA 3WW2A 2W1WA 5K0UB 1AXZA 2G4IA 3VN4A 5GALA 4QKDA 1YIFA 1LCLA 2A73B 3OPWA 5DZEA 1ZNPA 2RVAA 2ZGNA 2WNUC 1RUH2 1SDDB 5A6YA 3U07A 1TNFA 4OHXA 1O5UA 1R1A2 4NHLA 4NPRA 3R4SA 4ISQA 4J1XA 5BPXA 3MF6A 1W9YA 4KWJA 1MACA 3WW4A 4XBNA 3UJQA 5BUVA 1AVBA 3VKNA 4X6QB 1LNSA 2E51A 3LGRA 3Q8EA 1XNTA 2VZOA 3QOPA 2JG9C 4AI2A 3D4KA 3KVBA 4LULA 4RYDA 4IV1C 5E1RA 1WW4A 5EJZB 1H30A 2VMDA 2Q0AA 5A33A 4XE9A 4F8AA 1X8EA 1XNKA 2ZKLA 1GNZA 1V6OA 3ZFEB 2VULA 4JGZB 2SBAA 5FQ0B 1ZREA 4YVSC 3TEXA 3ETQA 3CJIA 3POJA 4CU9A 1CAUA 1GZTA 1OHFA 3DYMA 5T5JA 1V6MA 5LRRA 5HBAA 2GSYA 2XR4A 4UI9L 1GNYA 3OGVA 2OYZA 1HV1A 3VBHC 4HOOA 4QDRA 4RHV1 4ES8A 3OBRA 1DG6A 1JZ4A 1DYOA 1YEWA 1UY4A 4WBBA 1MZ6A 1SEFA 4WVWA 2PYTA 1X8MA 3WG1A 2W1SA 3I2KA 1QJX2 1GZ9A 4CDXA 2BVBA 2ZHMA 4XFCA 1ZA7A 2YZ4A 4LHKA 2XLAA 3RG0A 2XJSA 4XAEA 3H42B 4E2SA 1V6LA 3T2QA 3GNEA 1H2KA 1S0GA 1COV2 1BLZA 3F95A 2RS11 1TG7A 1SCSA 4EE2A 4S2HA 1CZVA 4LNVA 1C8M2 1FOD2 2PHLA 4Q1PA 5LCWL 1NZIA 4ORFA 3DXTA 5FYUA 4CU7A 1YQ5A 4AZZA 1JYVA 2WS93 4HKOA 3UGHA 1SCRA 4HN0A 4H7LA 1B09A 3VZJA 4FSJA 1PNFA 2FZ1A 4XBLA 5K0UC 4MXWA 5EYXA 2YB7A 5IVYA 3OB8A 1SG3A 1O4ZA 3WNLA 5JIUA 5EFUA 1JMUB 3IPVA 1PNGA 1IKPA 1V00A 2W91A 1RINA 4M3CA 2R0FA 3ZIXA 1DQ4A 3POYA 4RS5C 5IUQA 5HCBA 4MUVA 3ZFGA 3ZSMA 1OMIA 1W6NA 2PAKA 2VVDA 4BXSV 5FUPA 5LBEA 3TEYA 1UY0A 1WCUA 4B4RA 4OHVA 1H8VA 1W9WA 1UPIA 2IC1A 2EIGA 3DN7A 4Q4V3 3VBSA 4HVQA 3INAA 4N53B 2P3IA 1RXGA 4FTEA 1Q5OA 2WKKA 1ZZ7A 3PVBB 4IEXA 4H2AA 4BLIA 4JGZC 2P34A 2QZ3A 5A1FA 1JN2P 1FYUA 1RUD3 2DBNA 4XACA 3LSEA 2BGCA 5FZOA 1KQRA 4WV8A 5FZ0A 1PMIA 2WT2A 3U0ZA 5F3CA 4QPWA 3VBRA 3CEWA 4D7SA 3WEZA 1YUDA 3VZMA 1GKBA 5JZGA 1AR61 1YHFA 5I91A 5IVJA 4Q5OA 2CGPA 4HPKB 1NX9A 1IG3A 3CKHA 2EVXA 2RDNA 5FYIA 3RI9A 2B9UA 1WMXA 3H8UA 5J48A 3W20A 4QX2A 3LF7A 4KGQA 3NVCA 1XB9A 1H2LA 2GU9A 2AEYA 1BZWA 4N43B 1VR3A 5GLTA 4B1LA 2DVDA 5A7OA 3MI8A 1RVF1 4BMEA 3FFZA 3DPRA 2DCZA 3FHIB 2W87A 5I8YA 3O12A 3WX5A 1VRBA 3HN1A 4MO3M 2ID4A 1Y3TA 4YM2A 4CE8A 2CYFA 2QDNA 3NNGA 4FI9A 4AVAA 1N3QA 1CESA 1DQ6A 4NRMA 1NKGA 4XF4A 1MS9A 1PK6B 1QDOA 1YFUA 2ZXQA 3BB6A 4PIYA 4NWVA 3JQXA 3UYJA 2XVGA 3B3QE 4DNYA 1QGLA 1UAIA 2HJIA 1PO11 2H0VA 2VZ1A 1VMFA 1N3OA 4G9SB 1LR5A 2VQUA 4LKEA 2A1XA 4RGKA 2RMU1 2ARXA 5JR7B 4AHYA 4QQHA 4XILA 1LB2A 3NNJA 1GOFA 2QDRA 1RUOA 1PX4A 3VKMA 4AFDA 4V1PA 5FYTA 3WUDA 4C90A 2K0GA 4DIQA 2BBVA 1VBA3 2A6VA 4YVWA 2TBVA 2JG8A 4N53C 2OUHA 3MGUA 3MZHA 4QMAA 2UY9A 2KR2A 4OQ9A 3VBSB 1U5XA 3JBG3 5FZCA 2XBO2 3AP9A 3K4AA 3VDBA 4SBVA 3NJYA 5J96B 3MIHA 4QWNA 4YM0A 4PQQA 5JDBA 3W5NA 2P5BA 4HKLA 2Y6FA 3CJIC 5FZOB 3H1WA 1YQ2A 2CAVA 3T3YA 1K3IA 1PGL1 5DDJ1 4LUMA 4EN7B 1B35B 1L3JA 1RUF1 1AL23 4LHSA 5A7SA 4GB32 5KXBA 2DVBA 3WDUA 4HONA 3I2HA 5JZGB 3GBFA 1NOVA 2TEPA 3ZFFA 3ZSKA 2XVKA 2BWCA 1UZVA 3BIEA 2WQ8A 5F2SA 4LBLA 3B5LB 3KS7A 3V56A 5ACA2 4AEMA 3WSOA 2OUJA 5GZDA 4ZY9A 4CDXC 2ORXA 4KNCA 4MOAA 4Q4W3 5IATA 3C7GA 4N43C 1CAVB 5EHDA 3BN6A 4BK4A 2W1UA 4K7JA 3EBRA 3AP5A 3SC7X 2ZGKA 2E33A 1DGWX 3HNBM 3DYOA 3K46A 3M3OA 4DRVA 2YROA 5A3OA 3VDDA 3DKQA 1ZM1A 5KHIA 2HWE1 4XMAA 2VNRA 1K5JA 2ZX0A 3DGTA 3LFMA 4KBBA 3T2PA 3ACIA 2Y8KA 1UPSA 2WRAA 1JZ2A 4QHBA 4ZZ5A 3OUHA 3EB7A 2VNOA 2C5DA 5JVVA 3ES4A 2PN5A 1N3PA 2VTXA 4RL7A 1LOFA 1QJU1 2LALA 2G9ZA 4LBQD 4RD7A 1K5MA 1F15A 2CHHA 4HL0A 4FFFA 3TN92 3GZEA 4PLNA 1V9U1 3FBYA 2VG9A 4RGGA 3ZFGC 1O7FA 1HLCA 4MLOA 1HDKA 4D3WA 2QJVA 4JAAA 3WCSA 2VZUA 1N1TA 3TYJA 1KXGA 1SZBA 3RPQA 2AENA 3VBSC 4MGQA 4Q4X3 4H14A 4CP1A 4EWAA 5IT6A 5FP7A 3GM8A 3KF3A 3H8OA 5CG8A 1ZRCA 3MW2A 4QDSA 1GWKA 2XG3A 4NAMA 4EN9B 4QXBA 1GQHA 4FFHA 4GAZA 4L97A 2PFWA 4YGDA 1YLLA 1PVC1 3R4DB 3DXUA 4LO8A 4XMIA 3UKNA 5IFTA 2Y0OA 5LEKA 3ZYIB 1VBE1 2QUOA 1HN0A 3KCXA 4ES9A 1B35C 2R063 1A34A 1OF3A 4C0BA 5JZGC 3R05A 5F5AA 4DFSA 2UWCA 3HMYA 4BLJA 2ZBJA 1FMD1 1O3RA 2WZPP 1H1MA 2HH9A 1W2UA 5FY8A 5LA0A 4LE3A 3N4MA 1REFA 4LO4B 4FO9A 1UX6A 2WZEA 1DLCA 2XJUA 4EQVA 1BBT1 1ZBA1 4B29A 3N9PA 2WZR2 1S0CA 2ZA9A 3TNQA 3SISA 2PMWB 1FATA 5DXDA 2VXRA 1W9FA 2DWRA 2Q8CA 1NZCA 3T2OA 3O1PA 2QE3A 2EF6A 3LAGA 1AZDA 1UF2C 3RWNA 2VZVA 3J7HA 2B42B 4XIOA 4Y22A 1W6OA 4GIQA 3F2ZA 5FPAA 1VRH1 4GWJA 3ACGA 2ZZQA 2NMOA 1RUC1 3DCQA 4M3CE 4XPVA 4URAA 5JXGA 2WNVA 1AX2A 4IE7A 1RUJ1 4CP0A 5ABJA 3I7DA 1ULOA 1LTEA 4DXTA 2VW1A 5JPMB 4FPOB 2FQPA 2MHFA 2JB8A 4RSUA 4AVBA 3T30A 4Q4X2 4YVWC 2JG8C 5A7WB 1WLDA 3T2TA 4NHYA 1H2NA 1MR5A 4Y1VA 4KWKA 4PBPA 2CTVA 4YRDA 4TSVA 5LBFA 2VXJA 4E4HA 4YGBA 3T1LA 3K4DA 2AEZA 1IS4A 2GP5A 4UFKA 3X29B 4AEKA 4D6QA 4RHV2 3D5OA 2IXKA 1I9RA 2WFF1 4GH4A 4JKLA 1DZRA 4QX8A 3THTA 4NIGA 3FE5A 3OBTA 3O0XA 4LBKA 1VBC3 4XUPA 4XJUA 2AH2A 1W6QA 4RFRB 5J1XA 2ZABA 2D5HA 3S6PA 4BA6A 3FC0A 3B93A 4V2VA 5EWSA 1BK1A 1DLLA 3VBFB 4AVSA 4S2DA 5FZ9A 4AHZA 2DUPA 1QXRA 2RS12 2B7YA 3ZSLA 2JDPA 2RS33 3N9OA 2HWB3 4XEZA 4NAOA 1ND2A 2WLQA 5T3NA 3I3EA 5C9AA 5FPXA 4TTGA 3OD0A 4FTSA 3P1IA 5DAXA 3UNPA 4ASMB 1KEXA 1D0HA 1OBNA 1OFSA 1R093 3OGGA 2FDKA 2VCAA 2C4XA 4OFGA 1AYM3 2C9AA 2JIJA 4LBNA 3VDDC 1UOBA 1RUG3 4HSJA 4CCLA 5JUVA 3V0BA 2A7AA 4A7KA 1MS1A 2W9XA 3ETPA 4WM8A 3H1MA 4YW7A 3ZSJA 3E6DA 1RMU1 4KI5M 2DCKA 4BISA 3P3PA 4IERA 3ZXKA 2AZ5A 3DYPA 4TWTA 3GHMA 5FPBA 2VTFA 3MIEA 1BYHA 1VBB3 4P9GA 1LOFC 3MEPA 1K5MC 3H3ZA 1AYN3 2WWJA 4Y22B 4NIIA 4XFHA 1EPZA 3RWKX 4XDQA 5A3LA 5CIRA 1QQP3 4EROA 1WCQA 2DVFA 3W58A 1QNWA 2O14A 3ZDSA 2R1BA 3OYWB 4PIZA 1LHUA 3GF6A 2VBPA 4YZ5A 4AFAA 3WQBA 4RR3A 4COYA 1J3PA 3VD7A 3PDQA 2VY0A 4HANA 3RGBA 2BNOA 3AB0A 4AFMA 4K9SA 4LHNA 1X50A 3ME2A 3W9AA 3WP6A 4TZDA 2GH2A 3OG2A 4UW4A 3UV9A 4G4FA 1GR3A 1I5PA 1K12A 2X5IA 1AR81 5C3PA 5IJRA 5A70A 1NT0A 3IT8A 2WSUA 4K1ZA 2VMCA 1F4HA 5JXHA 1AR62 5CA6A 4HT1T 5FJKA 3WNMA 3S0MA 2Z79A 5FP3A 3PIJA 1IPKA 2WL1A 5JXIA 1UCXA 2XJVA 4LO6B 1OXCA 5IAXA 1W9SA 1MEC3 4DXSA 1VBC2 4XUNA 1UOGA 5F5QA 2PQSA 4XF1A 4GA9A 4XJWA 1HRV3 2R0HA 2YDEA 4M01A 1W6QB 4BQ4A 3O1TA 1HRI1 5D1IA 2FMDA 4LMFA 4QPIB 4XCAA 3NRUA 1G7YA 5C9AB 3WOGA 4QX0A 1IG0A 1WCSA 4BMBA 3I2OA 3RJ2X 4Z82A 5EZWA 4FQ4A 1RL3A 1QJY1 5I0UA 1W8UA 2PLV1 3QLQA 4FFIA 3WW3A 4WVMB 1JTZX 4C91A 2OQ7A 3C8XA 4AVVA 2WA4A 2W47A 5CZKA 1GBGA 3CZJA 5FPZA 3T0AA 3H8RA 3OUIA 2W95A 3BYWA 5DPNA 5EV7A 3S5QA 1WMDA 2AUYA 3RZLA 1OOPB 2ET7A 2P37A 2LRPA 1VBB2 1DHKB 2IXLA 3SH4A 2RMU2 4AYUA 4OHZA 4LUKA 4A2UA 1W3XA 3UT0A 1E5SA 4FXGB 3N35A 2RM23 4QX1A 4KG0A 3H1YA 1W2OA 5FY1A 4A7YA 3IWZA 2TNFA 2D3PA 2LROA 2WNVC 3CQOA 4GMP0 4TLFA 1PX3A 1FI2A 3N7JA 1H4GA 3NJZA 3UL2A 4GJYA 1G9CA 1E5HA 3FLRA 2QCSB 3AMNA 2OKXA 3AKSA 5DZFA 4RR3B 1U5ZA 3WP3A 4CUAA 4GMP3 1AXKA 1XE8A 2XHKA 4F3JA 1L7LA 5H9QA 3E5UA 2BOIA 3J4UH 4AK3A 4B8EA 2YUEA 3J7NA 4I09A 2X5IB 3PMEA 4KGGA 4NR1A 5DDJ2 3LCPA 2Y6HA 5GLWA 5A7PA 5DAWA 3ZKUA 2XB6C 1S2BA 3M1HA 2F4LA 2JEMA 4AG4A 4BQ2A 4Q1RA 3I3MA 1H1AA 4FPJA 4HK8A 4NHXA 3AJZA 4GH4C 5F5IA 2GC2A 3MPPG 5DG1A 5KHKA 4XBQA 1DGWA 1HRV2 1OPOA 1Y7BA 5LRSA 2ZGLA 3HIFA 1ASJ1 4XUTA 3IAQA 3VKOA 2H6CA 1OPMA 2QTWB 3LPGA 4NE9A 4Q0VA 3N36A 1UYPA 1W8ZA 3D82A 5HXMA 5C9AC 5FMBA 3BCWA 1SPPB 3ZXEA 1JXNA 4FOVA 2OIIA 2HWE2 2OW4A 2ZGSA 3MYXA 1QOOA 3NAPB 4BQWA 1UD1A 2XMLA 1O3SA 1OLMA 5FXVA 3JU9A 4AEDA 4CU6A 4EWDA 1I1EA 2AREA 4CDWB 2HEWF 3CDZB 1ULPA 5C5UA 4CVUA 1C8NA 1QJU2 2VMGA 5FO8B 3QH6A 3ENRA 1K45A 1E57A 4NROA 4WM8C 4YW4A 2PHXA 2ENRA 1OOPC 4Y33A 1R083 2N7GA 1H6XA 4AFCA 1FNYA 1EV11 2A71A 5DUVA 1QMJA 2R49A 4FP2A 4CP9A 4JGYA 4XOGA 4P14A 3KQ4B 1T6GC 3VKFC 1O4YA 1H8TA 2ZGUA 3LOBA 1LGNA 2WNUB 1RUH3 1V0AA 1R1A3 2IXJA 5KHJA 5LW9A 5T50A 4ARXA 5FAXA 5FUNA 1HIXA 1O4TA 1ND3A 2DDUA 4IEOA 3MIBA 4RR3C 1MPXA 5FWEA 5C4WA 5FOJB 5ANNA 1GWLA 3ZN4A 1JOJA 2VZSA 4AOCA 2JG9B 3MIGA 3ZYRA 2ADDA 1PVC2 5I8SA 3POIA 1TMF1 4OI4A 1MS3A 4ZKTB 2YG0A 2X5IC 3GCWA 1XJAA
chains in the Genus database with same CATH topology
2BWAA 3WDVA 3D0JA 2Q4SA 1RITA 1RC6A 4PCRA 3LA2A 1ULFA 3VL8A 4DS0A 1SFYA 2A6YA 5C8CA 1Q8OA 2EA7A 1WCKA 3MLKA 1FMD2 3OPZA 4AXOA 1KJRA 2R071 3I59B 3NV4A 1XRUA 4UW3A 4X8NA 3VBHB 1DGLA 4IXLA 5FLJA 4D69A 4FOYA 1BBT2 4QM9A 4LE4A 1ZBA2 1UKRA 4YZ4A 4DQAA 4NHKA 4UXAA 3I8TA 1S0FA 1QJX3 4LBQA 1ZYBA 5I8TA 2D6OX 2VECA 4FPGA 1EYBA 5E16A 2PHRA 1COV3 4CEYA 4Z2WA 1WBLA 2JXAA 4CDWC 4YGCA 3TWIA 1C8M3 1FOD3 1IGOA 2ZJCA 1PGSA 3WP5A 2WWSA 1VRH2 5FFOC 4YW1A 3RS6A 1RUC2 4HVOA 2K9ZA 3CF6E 2RS51 3H0OA 1RUJ2 3AYEA 4FPLA 5FOBB 4JGYB 1GZWA 2DVGA 4JVAA 4QQPA 2G9FA 5L73A 4RS5B 3J8F3 3NO8A 1A8DA 4JTNA 1AJOA 4Y20B 2A6ZA 2VNGA 5B2GB 2RE9A 1AX1A 3HWJA 5C4WB 3SH3A 1CPMA 2EAAA 2DUOA 1LECA 2VOVA 3N7MA 1SLBA 1YI7A 2DU1A 2CGOA 2KXLA 5E88A 3MLLA 2WFF2 3EO6A 1J3RA 1F5JA 1NLSA 2XLGA 4B7KA 4I02A 3MFAA 4JDOA 2MEV1 2ETEA 2PHFA 1D4M1 4J6GA 4YG6A 5C8CB 2WJSA 1OI6A 4EN0A 2WT0A 3PMSA 3PLQA 2B5HA 3APBA 4ASLA 1S0DA 2Q5TA 2E6VA 4AW7A 1ZZ8A 4R8HA 4G3YC 4RQPB 2JE7A 3PTYA 4FVVA 1PHMA 3HT1A 1O91A 2LTNA 5F1RA 2R041 3VUOA 1WUVA 2AYHA 3DF0A 3JD71 4P9IA 3KB5A 4B4QA 5CNAA 1RMU2 5I93A 4L92A 3ZXAC 5FRAA 3AZYA 1H9WA 3ZXLA 3I54A 1GICA 4I3GA 3TAYA 1Q43A 1XE7A 3N3HA 3ILFA 3VZLA 3SITA 5JOZA 3CLPA 2PTMA 4YM3A 3WG3A 2GN7A 2VVEA 3RMXA 4XFAA 1WLTA 4YM1A 1W6PA 1A8MA 4I3PA 4JGYC 3S7EA 4Z1VA 4BE3A 2E53A 2XLFA 1OQDA 3QCWA 4OHWA 3LB9A 2DFCA 3GZAA 5JSPA 1O5LA 1H8TC 1LGCA 5JPNB 2LM3A 3J8F2 3LA3A 2JICA 2PAEA 3TB0A 2XUMA 5CG9A 1XYOA 2KM2A 1ND3C 4WVVA 4YZ3A 1CGPA 5C4WC 5KXCA 1YCIA 4YW2A 1WW6A 1VLNA 1C28A 2XWJB 1NCRA 2YHJA 1APNA 4YFWA 3AKTA 2XBO3 5H9SA 5A33B 2DV9A 5ACA1 5JSOA 1F8VA 1YWKA 2YMZA 2HYKA 4K40A 4XJZA 1RJ7A 4IESA 3SNMA 2B46X 4DPNA 3IDEA 4M0NA 5C8CC 1WD4A 3CJIB 1HRI2 3POSA 1IZ3A 3OCPA 1CAUB 4BQ1A 4RFT0 4XHXA 2XWBB 5BXXA 4IEVA 4XF9A 4GB33 2H0BA 1POV1 1CONA 1BEV3 4RQPC 3CNAA 1LHWA 1DFQA 1TME1 2PLV2 4FOWA 4FPEA 4CDXB 1KFXL 1S55A 1A6CA 3OGJA 1JUIA 1EAH1 3NSTA 4CEYC 2ZAHA 3GZTB 1LHOA 1OLRA 3VGIA 5FREA 5L7OA 4Z92B 2Y0IA 1DIWA 1G6NA 4QX5A 1ZBE1 4IQPA 4E4ZA 4AI1A 2ZOEB 1IS5A 2F4PA 4YSFA 1PIV1 4KU8A 4EJRA 2NMNA 4MXWB 4AQTA 2I45A 1C1FA 5J3UA 2CAUA 2XKOA 3IPVB 5CFDA 1J1LA 2X8KA 1VB2A 1PGW2 3TN93 5T5LA 1CAWA 4M3CB 4P9YA 2JECA 4R9CA 3AMMA 1AR71 1VAKA 3ZFGB 1N1SA 1W6NB 1H9PA 2GC0A 1Y9QA 4S2GA 2D3RA 1S0IA 1RUE1 2BEOA 4ATEA 4URTA 2IZWA 4HLTA 3IIAA 1NCRB 4KG8A 4COZA 3ATGA 2ZGTA 3BIWE 4AE2A 3N7LA 2QVSB 4XF0A 1VP6A 2VPVA 1RGSA 3MW3A 4BOWA 1LESA 3WQ0A 1J3QA 5D8AA 4C1WA 4GWNA 3WR0A 2UY8A 2NZ9A 1IKQA 4EV0A 3VKLA 3VBRB 5GZCA 3JB8A 2D97A 2IFWA 1ENRA 2I2SA 3BPZA 4H7MA 2I74A 1BEV2 5GZFA 4FTBA 2GNBA 3NV2A 1OA3A 1ULEA 4OZXA 3KSCA 1OKQA 2HWD3 1LOAA 2D98A 3LSDA 1JBCA 3BODA 2ET1A 2D6LX 1FNZA 2RHPA 1UZZA 4W6WA 3M70A 3E5XA 4HK9A 2WZR3 4GALA 1EV12 3DPRB 2A3YA 1WCDJ 4META 4FPFA 1S0BA 1Z7S1 1ZZCA 3AZWA 4C0HA 4IV3A 3WXPA 4BH9A 2UYBA 5LK5A 4X8PA 5JSRA 1D0GA 1REEA 1MS5A 4Y4YA 1PO21 5H9RA 4YYOA 3KT4A 4LA2A 1DQ2A 1UU5A 3AFKA 5IK8A 1CAWB 1J58A 2YGLA 3QD6A 5DUUA 2XJRA 1CN1A 4XJ9A 1TMF2 3HQXA 4SLIA 2OA2A 2WC2A 2ZHKA 3PNAA 2NN8A 1KS5A 4YVWB 2JG8B 5FCCA 3S30A 2P3JA 4YG0A 2XPJA 1ENXA 1NCRC 3AJYA 4AGRA 1VB4A 4CTEA 1FT9A 2R072 1G9BA 2V09A 1O3TA 4OULA 2RJLA 1UU4A 4FT8A 3FMGA 4RHV3 1IS6A 1QWRA 1R1ZA 1RJ8A 5IK5A 4QGMA 3VBRC 1G9AA 2ZMNA 4H3WA 3RQ0A 2ZKNA 3M8LA 1MZFA 4XQDA 3WG2A 1SLIA 1DYPA 2ERFA 3ZFFB 1AR91 3FLTA 5AC91 5C8WA 4GMP1 2D5FA 2HWD2 1SMVA 2RS13 1IQAA 4AI0A 2JD4A 4FPCA 2YXSA 1BXHA 1QXJA 4CZSA 1TE1B 5J98B 1HV0A 5DG2A 5JI7A 4YNIA 1SBEA 4P9WA 3B9CA 3AP7A 5L7OC 3DPRC 3UJOA 2ZGOA 3VDDB 2GDFA 4NVPA 2IWGB 3A0KA 3WDYA 2VOKA 1GZCA 4XJ8A 1H1IA 4R52A 1RUI1 2CGNA 3B00A 3SLIA 1O3QA 3HBZA 3FBMA 5K8SA 1K5MB 1C4RA 4R4ZA 4N7IA 4AGVA 2D6KA 3RI8A 4XHBA 4Q4Y1 3SCFA 3WY6A 1RHI1 3OF1A 3TOJA 1LRHA 1F5FA 1S0JA 1WD3A 2HKXA 3DKWA 4QPGA 1HXS1 2UWBA 2Z69A 2MEV2 2NPIA 3ZSEA 2HWC1 4D94A 1QDCA 1D4M2 4OUSA 3RYRA 4C1XA 3M4FA 2MPFA 3WLUA 5CFCA 4IEPA 1REDA 4Q0UA 1AR63 1I5ZA 1NA1A 5D8AC 1YFXA 2A75A 2ES3A 3PJYA 4Y5Z0 3BTAA 2AR6A 2JENA 1WW5A 1V70A 2R042 3ZFFC 4XFGA 3RJRA 4IL7A 3JD72 4I01A 1FPN1 2LUWA 3GALA 1M06G 1RVF3 3CU7A 3U10A 4LT5A 3WHTA 2A3XA 1YJKA 3W59A 2HWF1 1QH6A 1LOEA 4PLOA 1ZRDA 4LA3A 3B7MA 4Y26A 2WINB 2ZGRA 1Z78A 3RMYA 4XW3A 4CDQA 3ALQA 2YY1A 3LA7A 5HCAA 4S2FA 4YLZA 1OQEA 1JYIA 4Q8LA 3J9SA 4HBNA 4IV3C 1PO13 4QPYA 4FAHA 5GJ6A 3NL1A 2RMU3 4AFBA 4YZ1A 3RRDA 2K2SA 2XGXA 1W6OB 3KGZA 5EYYA 3H3UA 2BFUS 1SFNA 3KZ4C 1SLAA 5CB7A 5DZGA 1KITA 1YFWA 2WNVB 1VBD1 2RR11 2W39A 4CYDA 2H6BA 5BNPA 4MGIE 5ABJB 4Z07A 2ZMKA 1ZA4A 1D2SA 2IXIA 4PBOA 3ZYPA 4XQWA 1N1VA 4JC1A 4WM7A 3RZZA 2PHUA 4QPGB 5BNNA 1LOBA 3LKJA 5KXEA 2CWSA 4CDUA 1ZRFA 1FV3A 3ILNA 3SXWA 1YRZA 2GMPA 5DDJ3 5BY5A 1NY71 3IM0A 3KLSA 1RUF3 5KC6A 2XJQA 4EWEA 2A70A 1UMZA 3OY8A 3PVNA 4GH4B 2VGDA 2ATFA 1PZ9A 1NG0A 3AXDA 1AUYA 2WQZC 1SDWA 4XQ4A 2FZ2A 3B69A 2HEVF 1EAH2 2BUKA 1RVF2 4I0AA 1ND2B 2GN3A 4XIKA 4L11A 5BNOA 2HWE3 2GNDA 3POWA 3WHUA 1ZBE2 1W6MA 2XH6A 4RGAA 3U11A 2ZAAA 5GLUA 3AXEA 3IMNA 3CL1A 5TSWA 2FBEA 1PIV2 3B01A 5FO7B 5KHGA 4XETA 2DCTA 2Z42A 5FMOL 4XZPA 1QJU3 3V0BB 3L2HA 4I0BA 4WM8B 3IKWA 1NQJA 1PO12 1DGRA 1V9U3 3ASIA 3B9IA 4AI3A 3CO2A 1QF3A 1AR72 1MS8A 2DFBA 5L36A 1NE4A 2DYCA 1U12A 1ZRRA 4KL1A 2X53S 3VZKA 1LEMA 3GBWA 1DU3D 3VV1A 4LHLA 4BZ4A 2GZWA 4QD2A 1ZX5A 1RUE2 4OHYA 2UWAA 2BVVA 5ABJC 2DU0A 3H50A 4INDA 5BNPB 3SCHA 4QPGC 3ZXJA 1JH5A 2WS91 4GKXA 5BNNB 1YXWA 1PVC3 3G7DA 2PQQA 1YYNA 2D3SA 3M3CA 5E89A 4Y1XA 2VQAA 1ENQA 1C57A 2FMYA 1RUF2 4J1WA 5CFCC 1Y43B 3H7YA 1NA1C 1FMD3 5DUXA 1S0EA 2DCYA 5KC5A 3AZXA 1SLCA 3OY8B 3WP4A 3EQEA 2A6XA 5T55A 1VAVA 2R16A 4IV1A 3M3IA 4KQ7A 3T1MA 1BBT3 1XNDA 1YO8A 1ZBA3 2O8OA 4Q4V1 4D7YA 1ND2C 4ONUA 1CAXA 4UW5A 4AEJA 3BOPA 2ZHNA 1S2KA 1KS4A 2JKBA 4QXKA 4Q0PA 2JX9A 1LJ7A 4P9LA 3O0WA 1Q3EA 1RUD1 1UIJA 1W6MB 5BV6A 1F31A 2OPKA 3WINE 1WMFA 2C0ZA 4NN0A 2O8QA 3USUA 4CDQC 1IPJA 1PO22 4H55A 4FXKB 1VRH3 1KD7A 4NHMA 1V9U2 4GB31 1RUC3 3KMHA 2JJ6A 1RUJ3 1LOCA 3MW4A 3ZN5A 3PVEA 3GYDA 2EXKA 4K1YA 3V64A 4FPYA 3ES1A 1Q56A 4LR4A 5BNPC 2Q8OA 5JWPA 3ZN6A 2SLIA 4A3XA 5BNQA 4WM7C 4OI0A 5K0UA 5JMCA 5GZGA 1H4HA 3L2YA 2ZCWA 2QFEA 4ZU5A 5BNNC 2OVUA 1WGPA 2F6BA 4AHWA 4YGEA 1QOTA 1UW8A 1VBE2 2DCJA 2IXHA 4XFIA 2D6PA 5GKAC 4E4SA 2WFF3 4I2OA 2BNNA 1G9DA 4IEQA 4WZCA 3AKPA 4CEWA 2A3WA 2A6WA 4MZUA 3WUCA 3KM5A 1AR92 3ZXGA 5AC92 3VLBB 2ZGMA 5T5OA 2BW8A 3SHRA 3R0RA 1ULCA 4AI8A 2GC3A 2W08A 3ELNA 2D7FA 1VBA1 3ZFEA 1JUHA 1GSLA 4B7EA 3FUQA 1ZVFA 3MIFA 5FQ0A 5FTTC 1BKZA 3JBG1 1YIPA 4BIFA 4FAGA 2WNEA 1Q8QA 3AMHA 1RIRA 2HEYF 1DQ5A 1KFUL 3E6BA 1RUI2 2XVLA 1GQGA 3HAGA 1RMU3 4AEDB 1HQWA 1SQ4A 1X36A 1I3HA 5J7MA 3ECQA 1QY4A 4MGKE 5JAXA 3QBQA 2VOWA 1M4WA 1QNYA 1XU2A 4NWWA 1AL21 4U2AA 4MH0E 5SV5A 3VBUA 4Q4Y2 5GLZA 3AMPA 2E7AA 1RUNA 3LWCA 4GXLA 4COVA 1ALYA 1H8TB 3M3QA 4Q4W1 2DF7A 1YFYA 4PQ9A 4LO7A 1HXS2 3A4UA 3L9JT 3AMQA 3NKTA 2HWC2 1D2QA 4BYYA 1F2NA 1ND3B 4QGLA 1UIKA 3WV6A 1LHNA 2YC0A 3OJBA 3WVJA 1CVNA 1OA4A 4JRAA 4YARA 3MIDA 4B3NA 2WLPA 4BM8A 4K20A 4IEUA 1PVXA 4F83A 4XYXA 1XYNA 4LBMA 1X7NA 2BNMA 3PHMA 4CEWB 1GLHA 1HRI3 2WA3A 1A3KA 2ZACA 5J09A 3UKVA 4XJAA 1FPN2 4NOTA 4N53A 3ST7A 4P9XA 4ZU7A 5A32A 2EAKA 1QH7A 2QKDA 2ZPXA 2HWF2 1QU0A 3ROUA 4BIOA 4MX3A 1QJY3 4Q4X1 5CAZA 1AF9A 2PLV3 4LBQB 5SV8A 3TNPB 3TBDA 2A5ZA 1I6XA 1C3HA 4AF9A 1OLQA 4JQRA 4CEYB 4AEDC 1XXNA 1V6JA 3IBMA 4BPZA 5HCFA 1SLLA 3B02A 2BFUL 4HPKA 3RYPA 2R061 2B8MA 3UK9A 2D6MA 4COWA 4PDWA 2V5YA 2ZX4A 1Q8PA 3VBUB 4AHXA 4N43A 1VBD2 2RR12 2XKPA 3LOIA 1BCXA 2XL9A 5J37A 2B45X 4E2GA 1GZWB 1LU2A 5AVAA 5F6KA 3ZX7A 3E6CC 1AHSA 4ZU4A 3WT3A 5IK7A 4AWDA 4P5HA 1ONAA 2EXJA 1WW7A 3AFGA 4D7TA 1FX5A 5KXDA 4FP3A 5A3MA 1AR82 1PK6A 3VL9A 1X33A 3I2DA 3AM2A 1NY72 3E97A 3WCRA 4DXZA 1G9FA 1V6KA 3AK0A 3RDIA 1ULGA 1ENSA 3S7IA 4A7ZA 2B39A 4CEWC 4Q8KA 4U36A 4OVEA 1ASJ3 2R32A 1DBNA 4XXPA 2G9GA 3AKQA 3BALA 2IFRA 2PAMA 2YPJA 3VZOA 3KGLA 3ZXDA 3KT7A 2XJTA 3G6JB 3MLJA 4LEJA 5A32B 1QJY2 1U5IA 3ZFEC 4Q0QA 1MS4A 4Q26A 2KA3A 2Z2SB 1RB8G 1YJLA 2MNGA 5AFEA 5F9TA 3AP6A 1X82A 3WDTA 4DZGA 3NW4A 3AYCA 1B35A 2PELA 4I30A 1W0OA 3NV3A 5AVPA 1BVVA 3MFCA 1EV13 1MZ5A 4FPKA 4L8QA 4AVTA 4EN6B 4O9GA 2ZX1A 4JDMA 1VBC1 4AVCA 3VBOA 4PDWB 1J1TA 3VBUC 4GQ7A 1CAVA 3C3VA 3AYDA 1W6PB 1ZZ6A 3AZVA 3WNXA 3WG4A 3MPBA 2ZHLA 2CNAA 1IHMA 4YW3A 2RS31 4DRRA 2HWB1 4YW5A 2WT1A 5FMOS 1W0PA 3HT2A 2D40A 1CIWA 3ZMNA 2WS92 4HKWA 5EJ3A 1R091 2E63A 3M2MA 3C2UA 4JRLA 1TMF3 1TQ5A 3EXUA 1AYM1 1YNAA 3BOWA 3V65A 3D8CA 5GZEA 1RUG1 4KWLA 4MXVA 2VQ0A 2WSVA 2NQYA 2CV6A 2W52A 5K7PA 4Q29A 1DZTA 1VALA 5EXOA 1EPWA 4Q0SA 1VBB1 2R073 2W0XA 3QH7A 1ASJ2 1AYN1 1LENA 1DQ0A 2GAUA 1QQP1 4IEYA 4LTAA 2VUJA 2WQ4A 2E7QA 4Q4V2 1OD5A 4RA0A 4OI2A 2D6NA 4W65A 4UBHA 1RUD2 4QT6A 2VH9A 4M00A 1AL0G 2Q30A 1QHDA 3LZZA 1XYPA 4L2NA 4AQSA 1AJKA 1WMEA 4YG3A 5L7OB 3I4IA 3JZVA 4EN8B 1MEC1 2RS53 2DTWA 4WVZA 3KCYA 1UZYA 4PDWC 4NO4A 1HRV1 5E8AA 3FWEA 4MVTA 1IS3A 3VBOB 5K9YA 2EXHA 3A0NA 3M3EA 2P3KA 4Y1ZA 1MQTA 3M7AA 2ZX3A 5CVRA 3JUUA 5CFDB 4XF3A 1ULDA 4PIXA 4OLLA 1KRIA 5JI9A 1JYCA 2VU9A 4QGNA 1WA4A 1PK6C 1Q8VA 1DZQA 4KH9A 2BYVE 1KJLA 2MEV3 3MDPA 2P17A 3KT1A 4R4XA 4Q27A 2BQPA 3J26N 1D4M3 1ZZBA 4MYEA 4M0HA 4E27A 3WW1A 1GFF2 2RM21 1IOAA 5D8AB 4MGZE 1VBA2 3SH5A 2VMHA 5HXVA 5JOWA 3RNSA 1ZZ9A 4K21A 3KD4A 3JBG2 3URFA 2R043 4Z8BA 1BMV1 3THPA 5CU1A 2AGSA 3V0AA 2YGMA 3JD73 2NP0A 3FUOA 2GH8A 3EJKA 1CD3G 1UL9A 5FLHA 1U5YA 1UU6A 1LHVA 1AL22 3VHOA 1NLRA 4FPHA 1URXA 3WDWA 2RS52 3VZNA 1OA2A 2Y26A 4FQZA 3VBFA 5C33A 1U0AA 2YYOA 4BHPA 3GHNA 1VAMA 4IV3B 4N7UA 4Q4W2 3VBOC 3ZIWA 2VOXA 4QQ2A 3MICA 3WD5A 3TRSB 1MQTB 5CFDC 3GBGA 4PF5A 4LLOA 1C5HA 2Q1ZB 3FZ3A 1KDKA 1XNCA 3IN9A 1C1LA 3OTFA 1CX4A 3ZXFA 1V6IA 3K48A 1TEIA 3AYAA 4N9IA 1YI9A 2NLRA 4WZFA 5ACA3 3GZUC 2EXIA 3FLPA 1DGRN 2R30A 2DVAA 2ZTNA 1HX6A 4L9BA 2GNTA 1EP0A 5I0RA 3NKGA 4N90A 3VHPA 3O0VA 1R081 1POV0 1JW6A 1KDMA 1UN1A 2OZ6A 3EHKA 3OYWA 5KWRA 4XTPA 1OFNA 2V73A 1MZEA 3HD8B 4UBGA 4W6XA 1POV3 5L19A 1LULA 5KHHA 3RSJA 3N7KA 1RUH1 3ILRA 4DB5A 1R1A1 1W39A 3SCGA 5JOYA 4Y1YA 1TME3 5J36A 1V6NA 3DL3A 5H9PA 3CJXA 2WFPA 2VW0A 1PZ8A 1EAH3 4IETA 1NCQA 1CQ9A 4K3UA 1QXPA 3V0AB 3WQ1A 4AGGA 1QOSA 1HQLA 1CJPA 2R062 4K8FA 2GMEA 1ZBE3 1G86A 1H2MA 4BCUA 4CP2A 4ISRA 4B4PA 1PIV3