3NW4A

Crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with gentisate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
363
structure length
363
Chain Sequence
KLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAAIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The salicylate 1,2-dioxygenase as a model for a conventional gentisate 1,2-dioxygenase: crystal structures of the G106A mutant and its adducts with gentisate and salicylate.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
molecule keywords Gentisate 1,2-Dioxygenase
total genus 102
structure length 363
sequence length 363
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nw4A01
5LEJA 4MGKE 2XHKA 3CJXA 3SHRA 3D82A 2VECA 3L2HA 3U0ZA 4XETA 1UD1A 3RYPA 4QXKA 3KCCA 4OFGA 4PIZA 4DINB 3I54A 4L2NA 4WZCA 5J7MA 3TNPB 2QVSB 2FQPA 1NXMA 1G6NA 3BU7A 1ZX5A 5E1RA 2CGPA 4N9HA 3IDCB 2ET7A 3PVBB 5I0UA 1JUHA 5CU1A 4HN0A 3H8UA 1CAWA 1ZZCA 5BY5A 4N9IA 3PNAA 5EZWA 3JZVA 2Z69A 1UIJA 2O1QA 1J3QA 4MV2A 4KU7A 1UPIA 3S7IA 2H6CA 5I8SA 1L3JA 5KHIA 3U10A 1RUOA 3UKVA 4PJYA 4Z07A 3SCFA 3N4MA 1Y9QA 2O8QA 4HBNA 1UCXA 5JR7B 5I0SA 4O9GA 1IPJA 1PM7A 4P9GA 5KBFA 5I0RA 4HN1A 3SCGA 1NYWA 4PIXA 1LRHA 4XFIA 4YNIA 4HSLA 3QOPA 2QCSB 4F7ZA 3MPBA 3CL1A 4MGIE 1H1IA 2BNOA 2GAUA 5JSRA 2ET1A 4LUKA 1FI2A 4JV4A 3D0JA 3CO2A 4J1XA 1YFXA 2K0GA 3EHKA 2BEOA 3IWZA 3ELNA 4HLTA 1EPZA 4BYYA 1FXZA 4H7LA 4I01A 4YRDA 3S7EA 1YUDA 3UKNA 4FT8A 5BV6A 1WA4A 4XF1A 3ETQA 2VQAA 5LEKA 2XKOA 3M70A 4EROA 3SMHA 3LA2A 2BNMA 2K9ZA 1FT9A 1O3TA 4Q0PA 5K8SA 3PLQA 1CAUA 2ATFA 4ZU7A 1ZRCA 3H3ZA 2D5HA 5J48A 2OZJA 3OTFA 2BGCA 4R8HA 4GULA 4IEZA 3E6BA 4Q0QA 3LAGA 4Z82A 3HQXA 4YYOA 4FAGA 1OFNA 1YFWA 1UW8A 2PTMA 1I6XA 5KHJA 4XF3A 3WW3A 5D1IA 2BYVE 1NE4A 2IXJA 4HSJA 1TQ5A 3ACLA 2Q30A 4E2SA 1J3PA 1XRUA 3HT2A 4KWJA 3M3IA 4EWEA 4LLOA 2OZ6A 4HZFA 5LRRA 3WW4A 2HJIA 2Q4SA 3KGZA 5BXXA 1O3QA 2Z2SB 1SFNA 1ZZ6A 4XF9A 4LULA 3ST7A 1Q3EA 4FBFA 2ZKLA 3R6SA 1VJ2A 4IEUA 3OGJA 1CAVB 4I3PA 1WGPA 1VR3A 5C8WA 2GC1A 3RNSA 1PMIA 3EJKA 1O3RA 2FMYA 4IEXA 2VPVA 2N7GA 5BPXA 3LOIA 4XFGA 1YWKA 2XL7A 4MGYE 4NVPA 4IESA 4JVAA 2B5HA 4AVAA 1X82A 1NZCA 2EA7A 4Q0VA 4XFFA 1GQHA 4AQ6A 5E16A 3BCWA 4QM9A 4XFHA 1OMIA 3USSA 5KHHA 1EYBA 3BALA 2CAVA 4PIYA 2ETEA 2IXHA 4IEVA 4IEQA 2HKXA 2MPFA 1LR5A 1Y3TA 2WC2A 1CAXB 4QX5A 4Q0SA 1J58A 2IXLA 2F4PA 2UYAA 4HVQA 1EY2A 2PHLA 4UXAA 1IPKA 1QXRA 1QY4A 2OA2A 5JSPA 1QXJA 1ZZ7A 4D7SA 1YFUA 4F8AA 2Y0OA 4HVOA 5I8TA 3H50A 5J3UA 2Q1ZB 1RC6A 5FDBA 4I0AA 4D7TA 3EQEA 3SCHA 3NKTA 1ZZBA 1ZNPA 3FWEA 1CGPA 3H1WA 3IBMA 1LKNA 4X6QB 4IEPA 3RZZA 4ZU4A 4AXOA 4XF4A 1J1LA 1EP0A 1RGSA 5CVRA 1ZZ9A 4KU8A 5I0TA 2IXIA 3BPZA 3ES1A 3OD0A 1J59A 4I02A 2UYBA 2UY9A 1SEFA 3TNQA 4BIFA 3NL1A 1ZZ8A 4QGNA 5JCTA 2I45A 2GC2A 4EV0A 1YLLA 3G7DA 4QGLA 4RD7A 5JSOA 4KL1A 1V70A 4I09A 4I0BA 1ZVFA 3SXWA 3E97A 3FFQA 1X8MA 5FLIA 1O4TA 2XLAA 1NE6A 3MDPA 4FAHA 3WW1A 3KGLA 3E5QA 3GBFA 1X7NA 3WW2A 3O14A 5KHKA 3OCPA 3C3VA 3H1YA 4YARA 2CV6A 3KMHA 1CAXA 3LWCA 4AVCA 3H3UA 4BHPA 2QJVA 2PQQA 4OLLA 3CLPA 3E5UA 1DGWA 3RPQA 4EWAA 4YSFA 4LTAA 4WVZA 5C6CA 2BNNA 4XFCA 3DKWA 4O9EA 1ZRFA 4TLFA 1O3SA 1O5UA 3I59A 3MYXA 4HMZA 5FPZA 4E2QA 2H6BA 2OPKA 5LRSA 4CYDA 4IERA 4AQ2A 1DGRA 2PAMA 3ES4A 2WFPA 3ROUA 3MZHA 1CAUB 5CADA 3FE5A 3D0SA 3H9AA 4IEYA 4IEWA 1XE8A 1RL3A 3EBRA 5KHGA 1O7FA 2D5FA 2GU9A 3LA3A 5BUVA 2P17A 2Q0AA 3VHRA 1CAVA 3NW4A 2PYTA 4UBGA 4B29A 1HW5A 4ONUA 3ZDSA 4I2OA 3EO6A 3B02A 4WBBA 1QWRA 1RUNA 2V09A 2D40A 5T3NA 1SQ4A 3H1MA 2B9UA 2GC0A 3FX3A 2PAEA 2QDRA 4XF0A 2DCTA 4LEJA 4E2GA 5FQ0A 4AVBA 1OI6A 5FQ0B 4XFBA 4KWLA 1O5LA 2PA7A 5AVPA 2XLFA 5I91A 2IC1A 3FZ3A 5FPXA 2OYZA 2KXLA 4XEZA 2E9QA 4MZUA 3OF1A 2MNGA 2PAKA 5FLJA 1H1MA 3HIFA 2IXCA 4UBHA 1I5ZA 3E6CC 2D93A 1WLTA 3BB6A 5I8YA 2H0VA 4ZU5A 4BH9A 1ZRDA 1VP6A 3FJSA 3H7YA 2GC3A 4ORFA 3I7DA 1YHFA 1XE7A 1OD5A 4QMAA 3KSCA 4QGMA 5I93A 3CEWA 4MH0E 4IEOA 4A2UA 1Q5OA 1U12A 3I59B 3RDIA 4HVRA 1Q43A 2XLGA 1RTVA 4MX3A 4R52A 4XFAA 2GH2A 2UY8A 2XKPA 3U11A 1DZTA 3GYDA 5JAXA 4KWKA 3E6DA 1ZREA 4J1WA 3CF6E 4META 4X6RB 2XL9A 2XGXA 4Q29A 4EWDA 4LA2A 1CAWB 1CX4A 3E5XA 3HT1A 4LA3A 2CAUA 3DN7A 3NVCA 2PHDA 1J3RA 1UIKA 2EAAA 3LA7A 4MUVA 3NSTA 5F1RA 2EVXA 2MHFA 2IXKA 4JTOA 4Q0UA 3DV8A 3FHIB 4JTNA 1DZRA 3QACA 1GQGA 2B8MA 3RYRA 3DL3A 3NJZA 4LUMA 3RYKA 5FCCA 4QM8A 1ZRRA 5FLHA 2PFWA 2ZCWA 3LZZA 2C0ZA 1YFYA 1X8EA 2GZWA 2QNKA 4L11A 5EFUA 3UKTA 4K8FA 1LB2A 3H7JA 4IETA 3IIAA 4MGZE 3IDBB 5HI0A 3S0MA
chains in the Genus database with same CATH superfamily
3LEMA 2DYCA 2IVJA 1OLMA 3KV6A 3WXPA 4FTBA 4SBVA 1D4M1 5D8AA 1GNHA 3BPSA 3L2HA 5DAXA 2F6BA 3U75A 4HKWA 4AR2A 4PIZA 1AR81 1LESA 5LBFA 4UOJA 3I54A 4E4SA 1MEC2 4DUVA 5J7MA 3JBG2 3GCWA 4UI9L 3VZNA 1QJU2 4QU1A 2VXRA 1RB8G 2J1SA 2G9GA 1VBE1 4LBNA 3GZEA 1R082 1MZ5A 1L7QA 1NXMA 1PHMA 1VLNA 2W95A 3ZDVA 4B7EA 2A70A 2RDNA 2WDBA 3FMGA 2ET7A 1HRV2 2QQUA 3N36A 3ZKUA 4TN7A 1YQCA 4B4RA 4QB2A 1Z7S2 1R092 1WKYA 5DZFA 1HDKA 4HKLA 5A7WB 2QQNA 4CP9A 5FYTA 1UPIA 5A7OA 2ERFA 3RG0A 5JOWA 2E6VA 2G4IA 3ZIXA 1ZA4A 1GWLA 4K7JA 4Z92B 3OGVA 4QKNA 4AF9A 5KHIA 1W0PA 4Y24A 1RUOA 3UKVA 4PJYA 3ZR6A 1R1A1 5FZ8A 5C7GA 2C9AA 2W3JA 3LEGA 4PBPA 1NKGA 1JW6A 3N4MA 2E32A 1AL23 2W92A 3ZYRA 1KJRA 1DCSA 5ABJA 5I0SA 4M3CB 5FREA 1SDDB 1PNFA 3VLBB 4YFZA 1IPJA 1C5HA 4QX0A 1LHUA 4HN1A 3EMRA 1POV0 4XFIA 4YNIA 1RUI1 3L9JT 4HSLA 4F7ZA 1PGW1 5FZ6A 3O1OA 2NN8A 1GKBA 1C8M3 2JKXA 4Q4W3 2ZGKA 3MF6A 2ET1A 1HRI2 1MS3A 1FI2A 1YQ8A 3B93A 4XUTA 4XQWA 4NUBA 4J1XA 1YFXA 3U07A 3C8XA 3USUB 3WQ7A 3ZSEA 3IWZA 1W05A 2BEOA 2VBPA 4LO5B 5SV8A 3UV9A 1TME3 4RQPB 3THTA 2PLV1 4FTEA 4LO8A 2Q1MA 2YHJA 1S0DA 4IE5A 3I2DA 3IMNA 3S7EA 1UKGA 2VZSA 3UKNA 1PGSA 1WW6A 2EALA 3PU3A 2YROA 4Q4X2 5GLWA 1SBFA 2VOTA 3M70A 3QH7A 2JG9A 5FK8A 2W47A 5LA1A 5A3PA 3ZFFA 1FT9A 2C4XA 3WNMA 4DQAA 4Z2AA 5K8SA 3JBG3 2ATFA 4ZU7A 3GZUC 3VD7A 1CD3G 4Y20A 5BNNB 3AB0A 5IFPA 3OTFA 2WYFA 4XIKA 1GFF2 5FJHA 2A7AA 3B00A 4GULA 4Q0QA 3E6BA 4BIOA 3WF3A 4CP1A 4NN0A 2VM9A 1T6BX 2VULA 1KFUL 2QQWA 1UZZA 3C7FA 2WUHA 2VW0A 2IWGB 2VTFA 2O14A 3N3HA 2RV9A 3J7HA 4QKFA 3S5QA 5KHJA 2JD9A 2VL4A 2DFBA 1DP0A 2JDMA 1MQTC 2XJRA 3MW4A 5D1IA 3ORJA 3UGGA 5CFDB 3ZXEA 2DDUA 4HSJA 4JHTA 1MS8A 3ZYBA 1NQJA 2Q30A 3S6PA 3ZN5A 1W6QA 3PHMA 4LBMA 1XRUA 3N7MA 1AR73 1HXS3 2Y64A 4JQTA 4N43A 4W6WA 3M3IA 4E8DA 1AXZA 4AAPA 2OQ7A 3C7GA 1Y43B 1D0GA 1XYOA 4AEDC 4BDVB 1QDCA 3ZYJB 5FXZA 3ZXAC 2HJIA 4DOUA 3TN93 4G3YC 5FUNA 1ZZ6A 2ZGLA 4XF9A 3KHCA 3LEKA 1RUG3 1Q3EA 1AL21 1X9TA 3A0KA 2NM1A 1W6NA 1VJ2A 5IK8A 4K9SA 4NR1A 3N7LA 5HXVA 1K3IA 2YZ4A 1AR82 4DNYA 3MIHA 5A7SA 1C8NA 1GP6A 4L9BA 1VR3A 2ZZJA 2B42B 4FPKA 5GZEA 5JXJA 3W21A 2BBVA 4ZKTB 1PMIA 2FBEA 3BKZA 1C8M2 1F8VA 3ZN6B 2VW2A 1D0HA 2VNGA 1X33A 4IEXA 2VPVA 3C7OA 1LOCA 1SFPA 1BK0A 1COV3 2EXIA 2N7GA 2VMGA 3LOIA 4LO6B 3RMXA 3BTXA 2YC0A 1RUE1 2VUCA 3HEIA 4XUOA 1POV3 3UK9A 3NMBA 2XL7A 1OF3A 1W0OA 4JVAA 2WN3A 2HWC1 5F3IA 1BEV2 3AX4A 4S2FA 4OULA 1VBA1 4YVSC 4AL9A 4CEWC 5JMCA 1W8WA 2A71A 2YFZA 5D8AB 5F9TA 5JOYA 1K12A 2W1WA 3DYPA 1YI9A 3B9IA 4XFHA 3USSA 1EYBA 3BALA 1OOPC 1OVPA 3AP7A 2MPFA 2VZQA 3MW3A 1S2KA 3RJ2X 5LZ6A 1CAXB 1Q8QA 1W9WA 1XNAA 4CDUB 3WDUA 4Q4V3 1OHFA 5FY4A 4F83A 4LIUA 4QX5A 4PI2A 5T55A 2JB8A 4Q2FA 4RS5B 2KM2A 4QPIB 2YBSA 5FO7B 2UYAA 2H0BA 4Y1XA 3LGRA 1L7LA 3DXTA 1UX6A 2PHLA 4O7XA 1QY4A 1S0CA 3TRSB 4YFWA 5D21A 1AJOA 4W6YA 5IVBA 2MEV1 1YFUA 1AHSA 1OA4A 2Y0OA 4HT1T 4QPGC 4WM7A 5BNPC 4LMFA 1BMV1 1UF2C 3PUHA 3I2JA 4RFRB 4AI0A 5J3UA 2Q1ZB 1RC6A 2RS13 1DYOA 5FYBA 1EUUA 1QOSA 3ACIA 4B8EA 1JYIA 4I0AA 4D7TA 1K5MB 3SCHA 4YGDA 4CDQB 2J22A 3CZUA 2BP6A 3IIIA 3K4ZA 5E6HA 4Q4Y1 4PQ9A 4BU2A 2NMNA 5FZHA 3IBMA 1LKNA 4XDOA 4IEPA 3RZZA 1UOFA 5EYYA 1CZSA 2ORZA 1EP0A 2PLV3 2EAKA 2D3SA 4EZHA 1J84A 2IXIA 5FP4A 5SV5A 1SACA 4TWTA 1AX1A 2UYBA 2Y6KA 3ACHA 2ZBJA 3I2IA 3KT1A 4M4PA 4XUPA 1VMHA 1SEFA 2WNVB 4FOQA 2V73A 3UNPA 5HCHA 1UY2A 4Y22A 1ZZ8A 2HWD3 4QGNA 5AVAA 4LKEA 5JCTA 1AX2A 1BBT3 2ID4A 5GZDA 1Q8PA 4UT5A 4HL0A 2GC2A 3WOGA 3AVRA 5C3QA 1YLLA 4RD7A 1IG3A 3RI8A 1LNSA 2JECA 2ZMLA 4CXYA 3ZSJA 5G05L 3U78A 4BA6A 4I0BA 4DRVA 5A80A 1UYZA 3HPNA 1NY72 3PU8A 4W65A 1POV1 4M0HA 4RGKA 4AGRA 5J98B 4P9LA 3GHMA 3MLLA 3WW1A 3H0OA 4FTSA 4NOTA 1PIV1 1RXFA 2WQ8A 4C0BA 3E5QA 5DG1A 3MPPG 3ECQA 3IPVA 1VBB1 4NPMA 4XQ4A 4LHSA 5FZAA 3VKMA 5FYYA 4Q26A 3DCQA 3KS7A 3SLIA 5FZEA 1JYCA 5FXWA 1JS9A 4L99A 1VE0A 3ZIWA 1AXYA 5C3SA 2JB4A 1APNA 2CNAA 3VBSC 5BNNC 3AXDA 2ZEXA 4AFAA 4BMEA 1A8MA 3KMHA 2LS6A 1SPPB 1CAXA 2Z4FA 4GJYA 2GNMA 4FPOB 4MHUA 4UW4A 4CCNA 4AVCA 4DY3A 3OBAA 4SLIA 4GAZA 2QJVA 5HBAA 1XNTA 5ACA3 2OVUA 3RPQA 2WNVC 3MFAA 2ARAA 3NNJA 2C9KA 4KGQA 2WBKA 3LE0A 5CFCB 2D6LX 5EJ1B 3H42B 1REFA 1UAIA 4YGCA 4AGGA 5CFDC 4TZDA 3BUCA 2DVFA 3Q8EA 4HMZA 1ASJ2 2WWUA 2YGLA 4E2QA 2FCVA 2UWBA 2XUEA 4IERA 5FPVA 4AQ2A 3I3EA 3M2MA 2RS53 1PMHX 4DY5A 2WFPA 5FYSA 1BZWA 3WUDA 1Y9GA 3ROUA 3VKLA 5DZGA 1QJEA 4H55A 4U2AA 5CG8A 4P9IA 3WP3A 1HRV1 3M3EA 3WDWA 1XE8A 5KR7A 4YVSA 4AHZA 5KHGA 1Z78A 2FDGA 2D5FA 1ACCA 2PLV2 4JGZA 1XNKA 3ZFEA 5BUVA 5JZGB 2P17A 2Q0AA 4A45A 1HJFA 3M4FA 1F2NA 2CGNA 2GALA 5FPLA 4AOCA 1FV3A 5K9YA 2PYTA 2VOKA 2EIGA 2DU1A 4QPWA 4R9AA 4EN9B 4B29A 3WP6A 3LCPA 1N3OA 1ULEA 4P9XA 4Y33A 4BXSV 3N9LA 1PZ9A 1QOOA 3B02A 2PHWA 1GZTA 1MVQA 4QQ2A 5A3OA 2G9ZA 4FFGA 2HBTA 5FZ3A 2D40A 3HN3A 1SQ4A 2QQPA 4MGTA 4A6OA 1AF9A 4LLFA 4NMIA 1MS4A 2B9UA 2D3RA 2WO7A 2GC0A 2JE7A 4HPKB 1W03A 3R4UA 1K5MA 2PAEA 1FNZA 1QJX2 2DUPA 2SBAA 3APBA 4XTPA 1V9U3 1DBNA 4HONA 1V0AA 4CCKA 5DAVA 2EIBA 3WG3A 1Q8OA 2EIDA 2EICA 4ISQA 4R9CA 4AVBA 3B69A 4H2AA 2OS2A 1OKOA 4Y3OA 5F39A 1W2TA 3GZTB 3V56A 5I91A 3WG2A 2LROA 4OYUA 4CEYA 2YMZA 1RUH1 3J7LA 5FPXA 2FHRA 2P1BA 2KXLA 4XEZA 5C8CA 3GNEA 2ZXQA 3SNMA 3FN9A 3MUZ1 5C5TA 1CPNA 2RMU3 2CU5A 4LBJA 2IXCA 3I97A 1NAEA 3BB6A 3RZLA 3WF1A 5B4XA 1VAKA 1Y7BA 4RL7A 3VB9A 2W08A 1VRH1 1VP6A 2W9XA 3H7YA 2GC3A 5DDJ2 2YYOA 3AK0A 4ORFA 1IOAA 1UY0A 1YHFA 2RDRA 4LHKA 4V1PA 4Q4Y3 4KQ7A 5EIYB 2XQRA 1OD5A 3N9NA 1VAMA 2E51A 1U5IA 4Q4X1 1SDWA 1MPXA 3LPGA 5T52A 2ZHNA 4QGMA 2WYSA 5ABJC 1CIYA 3MGUA 2CWMA 3TWIA 1K42A 2WNUC 3SITA 4CUAA 2Y6GA 4URAA 4GH4C 3B01A 2BWAA 4MSVA 5CKQA 5DUVA 1WWYA 4WM8B 2ZGQA 3V0AA 2ZX4A 2ZTNA 4XJ9A 2P34A 2K2SA 2RR11 1D4M2 3MW2A 4HKOA 5GALA 5M0TA 3RZJA 2XLGA 1RTVA 4LR4A 1W0NA 3WHUA 4BQYA 2W52A 3IDEA 2WO2A 1DGRN 1XYNA 4IV3A 4Q5OA 3NNFA 2XKPA 3ALQA 2DTWA 3KV5A 1OH4A 4UW5A 3U11A 4E27A 1W06A 4M4RA 4OI4A 5IFTA 1IGOA 2LTNA 5ANQA 4JQRA 2YB7A 5IK7A 3E6DA 3NO8A 1EAH1 4J1WA 3CF6E 1H8TA 3POWA 2XGXA 1C1LA 2Y0IA 4EWDA 1WCUA 1CAWB 3VBSA 4AEJA 1CX4A 1G9DA 2R6QA 3AYDA 3E5XA 4NHLA 1DZQA 4COWA 4ARYA 3A23A 5EXOA 1PGL1 3VD9A 3RZHA 1REDA 1ZBA3 2CAUA 2FMDA 4TXWA 3DN7A 1RIRA 5EYXA 1UIKA 3LA7A 3P6BA 1NOVA 1JYTA 4A3XA 2XR4A 4OI1A 4IQPA 3R4DB 5F1RA 4XYXA 2X8KA 2IXKA 4AVTA 2QQMA 4LOSA 4Q0UA 1Q56A 3DV8A 3T1MA 3CNAA 2BPA2 1ULGA 3Q8AA 3BOWA 4FPYA 1WCSA 1UNBA 1UY3A 2B8MA 2PN5A 2VZ1A 4FQZA 3T1LA 4JDOA 1ULPA 3DL3A 3RYKA 4CU8A 3ZM8A 2ZHMA 1W39A 3DKQA 1OUXA 4LKSA 5ACA1 1OURA 5EP9A 3WV6A 1MZEA 1F9KA 2C0ZA 2GZWA 3ZFEC 3B7MA 4BQXA 5AC93 4HETA 1HQNA 4L11A 4CU6A 1ENRA 1E5IA 4UYBA 1QJX3 3TN91 2ZX1A 3V64A 3C7HA 4N7UA 3UGHA 5FZIA 4QHZA 1RUD2 3OEBA 1S0FA 2BW8A 2PHFA 3OGSA 4QXBA 4ZZ5A 3VBRA 1I5PA 2AEZA 4AFCA 1VBC1 1UD1A 3RZGA 3KCCA 1W6QB 1LEDA 2ZAHA 2R0FA 2CYFA 3PVEA 3KT4A 3VHNA 2Y6LA 3ZYFA 3DPRA 3QD6A 4XC9A 2QVSB 4DIQA 4Z8BA 5BNQA 2Q1FA 1ZX5A 2JIGA 4AHWA 3N9OA 1PK6C 4MVTA 4N9HA 3T3YA 4RS5A 1YQ2A 3IDCB 1GU3A 4GD4A 5I0UA 5T5JA 5LW9A 1QOTA 2WZR1 4ATEA 5IYYA 1GOGA 2XBO3 3VDDA 3WDVA 3ON7A 2WT2A 5DXDA 1ZZCA 4Z2WA 5BY5A 2OX0A 3J4UH 4XZPA 3JZVA 2Z69A 1JZ7A 5JMOA 1GV9A 2VH9A 1J3QA 4MV2A 2AC1A 1DFQA 2DUOA 4GXLA 4QHOA 1N1YA 5IJRA 2RHPA 2XVGA 2HYXA 2ZAAA 1SHWB 3JB4C 3S7IA 4AAXA 5GLUA 2OXBA 2R072 2AYHA 4OUEA 1UKRA 1Z7S3 5FV3A 5FZBA 5I8SA 3RS6A 2VQTA 3Q8BA 4JHZA 1WD4A 2HH9A 2UU8A 4N8MA 2R042 4Z07A 3SCFA 1XSQA 4BJ0A 2O8QA 4OI2A 4OHZA 1E5HA 5BNOA 1UU6A 2ARCA 2CWSA 4HBNA 1UMIA 1UO9A 5E8AA 5F2WA 4KH9A 4B4QA 4DEQA 2NPIA 2YV8A 4XAAA 1HJGA 1XNCA 4QB1A 2ZX3A 2ES3A 5B4NA 1W6PB 3SCGA 1Q8SA 5J96B 1JOJA 1VRH2 4MG2A 3IAQA 2W2IA 3MPBA 2J1EA 4NIGA 3CL1A 2YBKA 2BNOA 2GAUA 1GZWB 5JSRA 3TYJA 4LUKA 4DMIA 4JV4A 1F4AA 2ADEA 3D0JA 1HRI1 4ZXKA 3RGBA 4XJWA 5IHRA 3PL0A 4BOWA 4HLTA 1EPZA 3O12A 1IS5A 2UURA 3S57A 2P3KA 2TNFA 4I01A 5CA6A 4RQPA 4XILA 4YRDA 3WQBA 4JRLA 5IVJA 1VBE2 3TEYA 1WBLA 2D43A 4FT8A 4WVVA 4ZHNA 2OKXA 2QE3A 1WLWA 1BCXA 3SISA 5JIAA 4NE9A 1QKQA 3SQOA 4BK4A 4FFIA 2WRAA 4XAEA 3VKNA 3WX5A 3SMHA 1AX0A 3LA2A 1RJ7A 1W6PA 2K9ZA 4UWDA 4XHXA 4Q0PA 3U37A 2PHUA 3H3ZA 4P02B 3LEIA 4L0PA 1JMUB 5FIXA 2BGOA 1MZ6A 4DUWA 2I74A 3P1IA 2E7TA 4IGPA 4P9YA 5FBZA 4JGYA 3VBUA 1H2KA 2CY6A 4XBLA 4QQHA 4JZRA 4Y26A 4S2DA 1UW8A 2PTMA 1I6XA 1HV1A 2R32A 2D98A 3MUY1 4NIHA 2HWF3 4XHBA 1KEXA 2BYVE 1G9AA 2IXJA 2BOJA 1Z7S1 4YW6A 5HXMA 1OLQA 2XJVA 3T0DA 3C2UA 3T08A 4CCMA 1Y4WA 3FBYA 1J3PA 3KQ4B 3HT2A 2P2KA 4KWJA 3WQ0A 4CP9B 4YM0A 5F8PA 2OUJA 2WFF2 1ULCA 5FYIA 4LLOA 4AQTA 3O1RA 2G9FA 4GB31 5A7PA 1WLCA 1NLSA 3ASIA 2W0XA 3AM2A 5FK7A 5IVFA 3KGZA 3NAPB 4K40A 5A32B 1PM4A 1SFNA 4NJ4A 4IV1B 1RUF1 3INAA 1S1AA 4LULA 4N7IA 4X8NA 3SEPA 4Y1UA 3VZMA 4FBFA 3R6SA 5C71A 4RGAA 3ME2A 4GWIA 2VCMA 3WVJA 3MO4A 2WNVA 2R1DA 1S0JA 1AUYA 1PO21 2PHTA 3ZXKA 1O4YA 1XE0A 2P37A 2WAAA 4ET7A 1G9BA 3KV9A 3RNSA 5JLVA 3ITQA 3VZKA 1JH5A 1O3RA 5KXCA 5C9AC 2ZABA 3AJZA 1ENSA 2VC9A 2FMYA 3MLJA 2IFRA 3M7AA 4V2VA 2QQIA 3J7NA 1HN1A 3POFA 4YVWA 4XFGA 3HN1A 1YWKA 2XQXA 1GZCA 4MGYE 4C1XA 4IESA 2O0OA 2B5HA 4AVAA 4IE0A 5JZGC 2XBO1 1OLME 4Q0VA 2YXSA 3HAGA 1GP4A 4YW7A 3ACFA 1PVXA 1M4WA 2LM3A 3D5OA 4P08A 4QM9A 4K1ZA 2CAVA 4C0HA 2CTVA 1QJZA 4CEYB 4IEVA 1KS5A 3HJRA 2HKXA 3KV4A 1QQP3 1RUJ2 4PLMA 1Y3TA 2WC2A 2RVAA 4KI5M 3OSDA 2J1TA 1T2XA 1E5RA 4AEDB 3N35A 1W3VA 4IV3B 2IUWA 4Q0SA 4AFBA 1O8SA 1UL9A 2IXLA 1QJY1 1YC61 2F4PA 2WNOA 1PIV3 3RVHA 2QQKA 2A6VA 1RUF3 3GM8A 1RUC1 3UYJA 1IPKA 1QXRA 4COVA 3VHOA 2VMIA 1NLRA 2Z5WA 3SKVA 3JCIA 1OBNA 1DQ6A 1ZBE1 4RGGA 2WZPP 1V6NA 3SH5A 3VL9A 1QXJA 4F8AA 1HQWA 4AYUA 4HVOA 5FZ1A 3H50A 2RS31 2WR9A 1JZ3A 3OBRA 3EQEA 3M1HA 2A75A 2WZEA 5FKBA 1AYN3 4OZXA 5C8CC 4UFMA 1COV1 3NKTA 1ZZBA 3EXUA 2J1VA 2RM22 2VXJA 3H1WA 4OZOA 2TUNA 1F15A 4XXAA 3WDYA 4COYA 3ILFA 3B3QE 4V2WA 5CB7A 3RRDA 5FY9A 2QQOA 2ZX2A 1EAH2 2RDSA 4KU8A 5CYYA 2ZEZA 3BPZA 3OD0A 5A1LA 4WV8A 3ZSLA 4BQWA 1U0AA 3NNLA 2RJLA 4I02A 2Y6JA 1X9PA 2UY9A 5GKAC 5IVVA 2J42A 2WNUB 4CDXB 1UZVA 1NG0A 1ZBA1 1LAJA 2YC2A 5JSOA 5FZKA 1R081 1WW7A 1MVEA 2I2SA 2UWAA 5LATA 5A6XA 1V70A 2DFCA 3NV4A 1JYNA 2EXJA 2WL1A 3T0AA 4CA9A 1ZBE3 2HWB2 2B7YA 4HANA 5EJ3A 2NMOA 3A0NA 3SXWA 5GZCA 1CWPA 3E97A 3FFQA 3IKWA 2HWD2 3AXEA 1O4TA 2ARXA 2OQ6A 5A1FA 3JXSA 3MDPA 3OUJA 3VZLA 4BWOA 3GBWA 4ZY9A 4EN7B 3W5MA 4DUXA 2LRPA 4D6SA 1X7NA 5C8CB 1W8NA 1W8TA 3DYOA 3OCPA 3MBWA 3P3NA 4FVVA 4JC1A 4DB5A 3H1YA 3LD8A 2R073 3AKPA 1WLDA 1RUJ1 5FZGA 1MQTB 4YARA 1GLHA 3HBKA 1SBEA 3AVSA 3H3UA 4JGZC 1RVF2 5FUIA 3ZPYA 4OLLA 4AG4A 1AR61 3QLQA 4HOOA 4XDPA 4YW3A 4K6BA 4FCAA 2RS52 1QJX1 2DCKA 2RJ2A 2VMHA 2XDVA 4EWAA 1IQDC 1NCQB 2VAUA 3ATGA 2BU9A 1VBC2 3NQHA 4N53A 4WVZA 1H9PA 5AC91 5C6CA 3O0VA 4N53B 5FMOS 4TLFA 2A1XA 5F6KA 1O3SA 3WHTA 5FPZA 5FZFA 1DGRA 2PAMA 1AYM2 2RE9A 1GANA 4YG0A 5A3TA 5KWRA 4JKLA 1ND3A 2QQVA 3DXUA 4ARXA 3PUIA 4CDWB 5EV7A 1W6OB 2Z42A 1ND3B 3S30A 2JE9A 1GMMA 4FOVA 1PX3A 3H9AA 1BJQA 2Y34A 1MACA 2JDYA 3J26N 3HOBA 5JZGA 1RL3A 5FPAA 2GNTA 1O7FA 2GU9A 3LA3A 1A34A 1W8OA 4KWUA 1FMD2 1WW5A 5HV4A 5IUQA 2G19A 3WQ1A 1CAVA 4OHVA 3PJQA 1F5JA 4YZ1A 4LBQA 3RFRA 2VBBA 1SLIA 4B3NA 4WM8C 1VBD2 2XOMA 1NX9A 3VV1A 2B9VA 4OVEA 5F5IA 5HCBA 4AFMA 1WCDJ 3EO6A 4I2OA 1W8ZA 1YYNA 3DF0A 1OQEA 1HB2A 1TMF2 3ENRA 1W6MA 1R1A3 4BK5A 4P5HA 4B7KA 2AREA 5FZ4A 4OHXA 5L9RA 3WCRA 1L7RA 3FX3A 2FD8A 1CZTA 3DGTA 5FYCA 2QDRA 2W39A 4XF0A 3V65A 3K48A 2B46X 5L73A 5C4WA 5FQ0A 1CQ9A 5FYHA 2EF6A 4D69A 2XJQA 4AVSA 2WO3A 4LBOA 4QPGA 3MIBA 2ZGOA 4KWLA 1O5LA 2TBVA 5AVPA 4ZXEA 3ZSMA 1HN0A 4BQ5A 1LOEA 2R071 2X5IC 4A7ZA 4KBZA 4CDWC 3CU7A 3PTYA 2IC1A 2ZACA 1LOBA 3FZ3A 3HNYM 1VB2A 2OYZA 3BI3A 1HRV3 1QXPA 2W68A 3OF1A 3WP4A 4FPGA 2VVEA 4MXWB 4CPBD 3B9CA 2ZMNA 1NCRA 5CIRA 5FLJA 5BNPB 2VNOA 5CKNA 2VMEA 5A3MA 3H8OA 1DQ1A 4IV3C 3MV11 1PO13 1I5ZA 4ITCA 5I8YA 1SCSA 1XPWA 1U5ZA 1D2QA 1ZRDA 1K5MC 3FJSA 3WP5A 1DG6A 4PF5A 3GJBA 1BVP1 1XE7A 3ZFGA 4Q1RA 2EXHA 2J1RA 2ZGTA 3J8F1 4QMAA 3JD73 1D4M3 3HNBM 5BNOC 3H8XA 5I93A 1I9RA 2BDRA 3PMSA 4FOYA 4IEOA 4MH0E 1Q5OA 1U12A 3TEZA 2Y6FA 3HBZA 1QJFA 3I59B 1BBT1 5F2SA 2OW4A 1OOPB 1XU2A 4O65A 5FZ7A 2WINB 1S2EA 4K1YA 2DCYA 4HVRA 1PZ7A 3WLUA 1C28A 4GKYA 1VMFA 3NJYA 2IZWA 1RUD1 2XJTA 3DPRB 4MX3A 2PELA 3OUIA 5G04L 1JZ2A 4YM3A 1N1SA 2QQLA 4L97A 4AVVA 1EPWA 3POSA 1DQ0A 2BOIA 2VZTA 2WSUA 5EJZB 3GYDA 3CDZB 2XUMA 3F2ZA 3VHPA 1QGLA 3RJRA 5JAXA 1LEMA 5EQUA 4C91A 5AFBA 1ODMA 4IDZA 3CJIA 1VBC3 4JX0A 4META 2AUYA 2XL9A 2HWF1 4J6GA 1RINA 4X6RB 2DU0A 2WQZC 2VOXA 2YPDA 3CJIB 2DTYA 4BMBA 5CISA 1UOJA 2B39A 4PDWA 2OIIA 4CDXC 5ERLA 3HT1A 5FZ0A 5FZ9A 3O1PA 4XJ8A 2WNUA 3WF4A 3NVCA 3IB3A 4CDQC 1J3RA 1QJY2 2VBDA 1F31A 1PIV2 2EAAA 3KF5A 4MUVA 2WZR3 4HPKA 3AMHA 4Q4X3 3K46A 3CKHA 4K8RB 3POBA 2VZRA 3HQRA 1ZRFA 2TEPA 4JTOA 1ZYBA 5A32A 1MS0A 3I4IA 1UMZA 1ULFA 1IS4A 3M8LA 3J8F3 4BLIA 4LHNA 4CCDA 4L92A 4D7YA 4HG6B 2JG9B 3NJZA 4OUMA 1QEXA 2ZZQA 5DAPA 5FCCA 4QM8A 2RS51 3ABZA 2YY1A 3DPRC 1SLTA 1S0GA 4YG3A 4E4ZA 3T4HB 2Z79A 1W04A 4LK6A 4TYSA 5FY8A 5JXGA 4FPEA 2GP5A 5FMOL 1ND2A 1YFYA 4GMP3 5FFOC 4Q4W2 1EV12 1FYUA 1P8JA 5A6YA 3UKTA 1LB2A 2HWC3 1G7YA 3H7JA 2VY0A 1UN1A 4A44A 3IDBB 5LY1A 2WT1A 1V6MA 1R1A2 4R9DA 4RR3A 4YM1A 3KCYA 4MGKE 2XHKA 4AI9A 3CJXA 2ZGMA 3SHRA 3D82A 3A7QA 3HMYA 5CFCA 4XETA 4IGOA 4AHXA 2YU1A 3RYPA 4QXKA 1TNFA 2A5ZA 4HXCA 4A3ZA 1S0BA 1ZRIA 4OFGA 3VN4A 1ODNA 2R16A 1QH6A 2ZGSA 3CMGA 3KHBA 2R7EB 4L2NA 1FMD1 2P6CA 3FLPA 4WZCA 3SEEA 4OI0A 1BBT2 1MR5A 1YJLA 4MGSA 4LNVA 1C8M1 2CDPA 1VBD1 3WF2A 4AW7A 4B1LA 3BIEA 5C4WC 3BU7A 4H14A 1H6XA 1SPPA 3N9QA 5JXIA 4QXCA 5E1RA 2CGPA 1C1FA 4TTGA 3OJBA 5FP3A 3TBDA 5H9PA 1PGL2 3W5NA 2VGDA 1RMU2 4OMCA 4R9BA 4RFT0 3JUUA 5CU1A 4RHV3 1QDOA 4HN0A 1Y9MA 1GOHA 1XBFA 4YG6A 1CAWA 1XNBA 4WVWA 2I07B 1W99A 4PDWB 2DWRA 1N47A 3PNAA 1SZBA 2VVDA 3ZXFA 1W6MB 3PVNA 2HWB1 3VBRC 2VUDA 2WNEA 3FBMA 1LODA 1D7PM 2GMPA 1C5IA 1CPMA 1O91A 2ZHLA 1PO11 3AC0A 4GB32 3UGFA 5JDBA 3LQCA 1L3JA 2GP3A 1N1TA 1I1EA 3BOPA 5A7NA 3T2OA 5FZOB 2J1AA 3ZYPA 3LDBA 5D2AA 4UFIA 4YW5A 2LW8A 2P3IA 4BISA 4A4AA 4QDQA 1F5FA 4K20A 5JR7B 3JQXA 3UJQA 4XE9A 4O9GA 4AWDA 3RZKA 3Q8FA 1GWMA 1PM7A 5KBFA 2WS91 2C1FA 1NA1A 4FP3A 1FATA 2AACA 4UAPA 3URFA 1NYWA 1LRHA 4URTA 1A6CA 2DBIA 3DYMA 3PTRB 4WM7C 5C3OA 5K0UB 4NAOA 3BYWA 4CSWA 4QXHA 1AJKA 1ZM1A 3NAPC 4LXLA 2VR4A 3AFGA 2GN3A 4MGIE 5L19A 1H1IA 1W8UA 1IS6A 2VD7A 3NNGA 1W8FA 2K0GA 3THDA 3EHKA 4HK9A 5J37A 4YVWB 3ELNA 5FZLA 1VRH3 2OPWA 4LORA 1JZ4A 1FXZA 4H7LA 1A3KA 1NUKA 1V6IA 1JZ6A 5BNOB 1YUDA 2GDFA 1PGW2 1WA4A 3NRUA 4XF1A 1MS5A 2RMU2 4CUCA 5C9AB 3ETQA 5L7OC 3U4XA 3G6JB 4NRMA 1DLCA 2XKOA 3MV01 1V6KA 3I3BA 2VZUA 1FOD1 4PBOA 3AL6A 4EROA 5KXDA 1ENXA 4QDSA 1H30A 1GBGA 2BNMA 4N43C 3D6EA 1AYM3 2HWD1 1RITA 2BRTA 2L9LA 3PLQA 1H4GA 1CAUA 2BZDA 4GWMA 1E5SA 3DUIA 2WLQA 5DUXA 2FDFA 5GZGA 1NT0A 2OZJA 4D3WA 4XZUG 2BGCA 1R083 4LIVA 4HFSA 3WNKA 4R8HA 3NAPA 3R4SA 4IEZA 2FCTA 1XB9A 3LAGA 4RHV1 3JD71 4Z82A 4YYOA 5FYUA 4AI1A 2V5YA 3SKJE 4ASLA 4EQVA 1LOGA 4FAGA 1OFNA 3WG1A 5K0UC 3MIFA 1YFWA 1AR93 3AMMA 5IW0A 2P6HA 1PZ8A 2RS32 3ETPA 1CESA 4RQPC 2B4KA 4WZFA 5BYNA 5C9AA 1TQ5A 1TG7A 3AKSA 3ACLA 1GZ9A 4F3JA 1CIWA 2VO5A 1OT5A 2Q5TA 4YVWC 2JENA 1RUC2 2A3XA 5CG9A 5HPOA 3I8TA 2HEVF 3OBTA 3POYA 5FY1A 4EWEA 4CPBA 4Y5Z0 1IG0A 4HZFA 3D4KA 3WW4A 3PIJA 3VL8A 1DLLA 4EZ4A 5F3GA 1RYYA 1V6JA 2VQUA 3OGGA 2XPJA 4CU9A 3WSOA 2KR2A 1MEC3 2ZKLA 3ZFEB 4IEUA 1H6YA 1GP5A 3OGJA 4FOWA 2WFF3 1E57A 4I3PA 5CEHA 2PXJA 4N53C 3LKJA 2YC4A 1BEV1 4UFLA 1WGPA 3W9AA 1O8PA 5C8WA 2GC1A 5DPNA 2ILMA 3POJA 4M3CF 5J36A 2QZ3A 3VBFB 3EJKA 2KA3A 4ZZ8A 5TSWA 5JI7A 2R49A 4EYUA 1W2NA 1ND3C 5JOZA 3ZN6A 5F6LB 5BPXA 3FHAA 1C3HA 2PHRA 4Q8KA 1UX7A 5GLZA 4OQ8A 3KD4A 2FCUA 1VPHA 3IN9A 3M3QA 3VDDC 3K4AA 1A78A 5LWBA 4IE7A 1NZCA 5F5QA 2EA7A 2EIEA 3T0BA 3OPZA 4XFFA 4JKMA 2A6ZA 2NYYA 1GQHA 2ZKNA 4H3WA 4XQDA 3W59A 3JD72 3CBNA 3PJYA 4AQ6A 4CE8A 3I2FA 5IAVA 5KHHA 5C33A 4PIYA 3F95A 2ETEA 5H9SA 4WM8A 1CJPA 4XBNA 1LHOA 3D3AA 2Y6HA 1LR5A 2QFEA 4Y20B 5DABA 1B09A 4JAAA 1VBB3 4LE4A 2ZA9A 1BMV2 2WZR2 3AP4A 4N90A 2HWE1 2QQJA 3VZJA 4CDUA 1JOBA 5KC6A 3V0BB 1V6LA 3VD3A 1ZBA2 1J58A 4XUQA 5F37A 2BV4A 3WNNA 5A1AA 3CQOA 1RHI1 1UMHA 2VOVA 2QBXA 2W87A 2YGMA 2WA4A 2ZPXA 3AMPA 3OPTA 5FO9B 2X29A 5IATA 3A21A 2OA2A 3L2YA 4QPYA 4YLZA 3SC7X 4YZ4A 1QF3A 1UZWA 2BUKA 4D7SA 3VDBA 1YRZA 4KNCA 3GJAA 4JKKA 1W9YA 2R043 4COZA 2X10A 4BB3A 5I8TA 3OYWB 5A6QA 4FO9A 2YBPA 3GALA 1ONAA 1TEIA 4UW6A 5F3EA 1BXHA 1JN2P 3WCSA 1RUF2 1CX1A 4X8PA 4YZ2A 3PDQA 4AFDA 3WD5A 1Z0HA 4LO7A 4BLJA 3FWEA 3I3QA 5LBBA 3TN92 4X6QB 1RHI3 3WF0A 1J1LA 4KBBA 5C70A 5C3RA 3AP9A 4DS0A 1SLCA 2JDPA 2VTXJ 3ES1A 1A8DA 4QPIC 3J7MA 1STMA 1WCQA 2HEYF 4LOTA 1OPMA 3J8F2 3VZOA 2X09A 1AR92 2RS11 4BIFA 4WM7B 3TEXA 4LKFA 1QJU3 1YQ6A 4ES9A 1G86A 2WS93 1WZXA 3A22A 1ST8A 3G7DA 2YUEA 2A3YA 4KL1A 1VMJA 3ILNA 4M01A 4NRQA 2SLIA 4QX3A 4I09A 4AEKA 2RR12 4QU2A 1PX4A 1ZVFA 1V9U2 1LCLA 1FV2A 1QMJA 1UU4A 2GN7A 4PF1A 4MO3M 5FLIA 2DBNA 1QHDA 4LE3A 2D6NA 5A3UA 2VUJA 4FAHA 5FR3A 4IV1A 4IW3A 1GOFA 1RJ8A 5LA0A 1EV13 4I0WB 4LITA 2JDKA 4M3CA 1DGLA 3D8CA 2XBO2 4WVMB 3WW2A 3O14A 5KHKA 4XJAA 5FY5A 1AR83 3LFIA 1JODA 1FPN3 1G9CA 1S0EA 2R30A 2ZGPA 4K3UA 4DO0A 5FPUA 4W6XA 1OC1A 2CV6A 1M06G 3LWCA 2QTWB 4W50A 4UF0A 4ZONA 2PQQA 4JGYB 1O6UA 1LJ7A 3VBUB 3E5UA 4AE2A 1CN1A 1HLCA 3U4SA 2ZGNA 2QUOA 4BE3A 5E88A 4CZSA 3UESA 4YSFA 4LTAA 2ZS6B 3AZWA 1GNYA 1XJAA 2BNNA 2ORXA 3DKWA 4L8QA 2RM21 4O9EA 1FNYA 4IUGA 4DPNA 1JHNA 4CTEA 2JDHA 1O5UA 3MYXA 4IV1C 2H6BA 1H0BA 2OPKA 5LRSA 4CYDA 2DV9A 2D6MA 4WVMA 4E9KA 1REEA 3VDCA 3GBGA 5A6ZA 3ZLIA 3POIA 1R64A 1CAUB 1DYKA 5CADA 3V0AB 1AYN1 2JE8A 1RUG1 2AENA 3MI8A 5BNNA 3ACGA 4Q27A 2PQSA 1DGWX 3MICA 5IVYA 4CEWA 3EBRA 3WNOA 1ND2C 4P9JA 1LOAA 1W6NB 4ZPIA 3RWKX 5LASA 4D6QA 2GH8A 2X5IA 3VHRA 1F4HA 4BXFA 2D3PA 1W28A 1SG3A 1HW5A 4YWAA 5L9VA 4ONUA 4LBQB 1AR71 1HXS1 4QQOA 2WSVA 1SLAA 4WBBA 1QWRA 3VBFC 3FC0A 2E7AA 3OPWA 4C90A 2RS12 4C1WA 4Y22B 2BJSA 3USUA 4TLGA 5K4LA 4Y1YA 1AL0G 4RHV2 1XOYA 2VZOA 1LHNA 2VZPA 2DCZA 4IGQA 3ZPOA 3BODA 1YO8A 2DCTA 3I2KA 5FZCA 4LEJA 4Q4V1 5C5UA 2DF7A 4E2GA 3WUCA 5FOJB 1OUSA 2YU2A 1OI6A 4XFBA 3PIGA 1ASJ1 2PA7A 3KB5A 1WMXA 1G8WA 2GMMA 3WG4A 1BK1A 1PO12 1VAVA 2R041 2FZ1A 2OUHA 3HQUA 4PCRA 2WJSA 4OQ9A 3GZAA 3HD8B 1VRBA 1HQLA 1KS4A 4YW2A 2E9QA 3AYAA 2HYKA 4MZUA 1WMEA 3FLRA 5A33B 2PAKA 2VE1A 1ND2B 5JXHA 1OSGA 3V0BA 3VBFA 1BHGA 1XYPA 5FZDA 2V5DA 4E4HA 1Q8VA 1C57A 3WDXA 1VB4A 3K51A 2H0VA 1US3A 1RXGA 3KM5A 4BH9A 1TME1 4GWJA 3I7DA 2W91A 2WABA 1AYN2 4Y5SA 3LDKA 1HB1A 2VMDA 4JDNA 1GICA 2Y26A 3HNMA 4ZS3A 4XABA 1CZVA 3CEWA 4M00A 3P3PA 3MLKA 4A2UA 1OF4A 3K75B 1OVSA 3J9SA 2W1QA 3NV1A 1V6OA 3EYPA 3PUQA 4KG8A 1RUI3 1S0IA 4CEYC 1O59A 4CDQA 4EN0A 2JDZA 3RDIA 3ZOIA 5FUPA 1KD7A 2RS33 3N9MA 3JB8A 4LHLA 1ULDA 2E26A 3AZYA 1NCRC 4IE4A 5T5LA 5JUVA 5L36A 2AEYA 3K77A 3ZMOA 4Q8LA 3ZKYA 1FPN2 4QX1A 1RUC3 2CSGA 1HX6A 1MS1A 2C24A 2V4AA 3Q9OA 4OHWA 2W1UA 1CR7A 2X5IB 5DMYA 1DQ4A 3KZ4C 4KWKA 1ZREA 3GDBA 4IXLA 4Q29A 1KJLA 1W2AX 2WZ8A 3DECA 5IVEA 5K7PA 2JDAA 3EB7A 3RQ0A 4YM2A 5B2GB 2CDOA 4N43B 1RMU1 5LA2A 4EN6B 4LA3A 3BN6A 1C4RA 4XBQA 1DU3D 1HIXA 4GH4A 3VKFC 3PVOA 3LFMA 5A3NA 5DN2A 2PHDA 5L9BA 1ENQA 4JRAA 1BYHA 1R091 3AP5A 3NV2A 3I49A 4HK8A 1YEWA 1OD3A 2DURA 2EVXA 1GQPA 2A6XA 3N7KA 4FI9A 4H7MA 5E89A 3T2QA 4AQSA 4YVSB 3ZYHA 4CUBA 1VBE3 4JTNA 3THPA 1H8VA 1DZRA 2DUQA 5D8AC 5H9RA 3QACA 4Y4RA 5F3CA 4YPJA 3RYRA 4AI8A 5JPMB 4E8CA 1LHWA 1IKQA 3LPFA 2HWB3 3IPVB 1BEV3 1ZRRA 1O4ZA 1H8TC 1WMFA 5FLHA 5DDJ1 1DHKB 2PFWA 1W3XA 4LBLA 3LZZA 3BU0A 3TB0A 4S2HA 4RS5C 1X8EA 3OY8A 3AFKA 3BGAA 1KITA 2ZJCA 2ZX0A 5EFUA 4AI3A 3O5SA 2R0HA 1N1VA 4K8FA 2E7QA 2W94A 2Y60A 1WBFA 5IK4A 4PLOA 2XJSA 1UYPA 1KGYA 3B5LB 3K3NA 2ZGUA 1FX5A 5HI0A 4O61A 5LEJA 1EAH3 4RR3B 4QPGB 1BKZA 2QZ2A 4QX7A 5FYZA 1YIFA 1JTZX 1TMF1 2VECA 3U0ZA 1W2UA 1VBA2 1TE1B 2Y8KA 5GZFA 2HWC2 5FTTC 4DINB 2R061 4QT6A 4I30A 5IAXA 3NJXA 5FRAA 1QQP1 4INDA 3K3OA 3ZVXA 3AL5A 3LSEA 5FKCA 5A33A 3TNPB 3VBOC 3C7EA 2FQPA 3WZ1A 3H8RA 2RG4A 4GMP0 4BPZA 3S5AA 2FDKA 1G6NA 4ISRA 2VW1A 1B35B 5APAA 4JGZB 4EN8B 4D0QA 1PVC3 5JPNB 1QIQA 3PVBB 1JUHA 1NY71 2ADDA 3AKTA 4DRRA 4KGGA 5FJKA 2P3YA 4MLOA 2NQYA 4YW4A 4JCKA 1NCQC 2ARBA 3UJOA 5ISLA 2JKBA 3H8UA 5EPAA 1IHMA 3FLTA 1JZ8A 5T54A 5AFEA 1IS3A 2MEV3 4N9IA 5EZWA 4XVHA 1OA2A 4DXTA 3ZN4A 1UZ0A 1J83A 4AI2A 2JICA 3MEPA 1UIJA 2O1QA 4KU7A 4NROA 3RSJA 1DF0A 2YPJA 1W9FA 2A6YA 5JVVA 5JOXA 4KMQA 3KVBA 1RMU3 1OOPA 2WS92 4FPHA 2H6CA 3OUHA 2F4LA 2QDNA 4NHMA 1XU1A 2P5BA 1POQA 1IZ3A 4NWWA 4RN5A 1MS9A 5FP7A 5LA9A 3U10A 5IVCA 3GCXA 3BVCA 3M3CA 4DXSA 2IVIB 1RVF3 1W8HA 5FZOA 1Y9QA 2PMWB 5HCAA 1X36A 3IMMA 3ZSKA 1NZIA 1UCXA 5FP9A 4A7YA 1JYWA 2XJPA 3T4VA 1OQ1A 2CGOA 4P9GA 3THCA 1QNWA 4RA0A 4LQRA 5I0RA 1OKQA 4UW3A 5HV0A 3BTAA 4PIXA 3QOPA 1OQDA 2AZ5A 2QCSB 1TME2 4YZ3A 5BNPA 2Q8EA 5FZMA 3VBSB 1UQXA 2GNDA 3WEZA 4QX2A 5A7WA 1GZWA 4FSJA 3RWNA 4GZ9A 3W58A 2C5DA 3O1SA 2FDHA 1JOPA 4S2GA 1S55A 2BFUS 3CO2A 3BTYA 2R063 1J1TA 2VU9A 2WWSA 4DXRA 3ZYIB 2XVKA 3ZR5A 1H1AA 2XWJB 3AYEA 3K4DA 1GNZA 4EJRA 1UU5A 3HVDA 4BYYA 1HB4A 2E63A 1RUD3 3I2OA 4CCCA 2GNBA 1KRIA 2E33A 2RDQA 3ZFGB 5BV6A 3T2PA 4PDWC 5FYVA 1PMJX 4U36A 2VQAA 1GWKA 5LEKA 2RR13 3WT3A 3VBRB 5FP8A 1W2OA 4XMIA 5KC5A 3I3MA 1O3TA 5FMBA 1JHJA 1ZRCA 2HWE2 2D5HA 3AKQA 1U5YA 5LK5A 5J48A 3UETA 3KT7A 3VBHB 1NCRB 1SMVA 1IKPA 2XJUA 1EUTA 3O1MA 4CCOA 2NLRA 4UF0B 3HQXA 1XSRA 3FUOA 5LBCA 4P14A 4BQ2A 2NZ9A 4FPJA 1WUVA 4BCUA 2A6WA 5ANNA 3ZO0B 3IM0A 1QJY3 2JXAA 3ZMNA 3QBQA 3WDTA 3T2TA 5CZKA 4XF3A 2VCBA 1LGBA 4QAWA 1LECA 3WW3A 1W90A 3VD5A 1NE4A 1YQ5A 4CP2A 4LJHA 1LGNA 1W6OA 5ACA2 4XURA 2AGSA 4E2SA 2DVGA 2JEMA 4R4XA 3O0XA 1LTEA 2JG9C 4OMDA 2P4EA 1ZBE2 1DYPA 3ZFFC 1JZ5A 2OZ6A 2R1BA 4MOAA 5FBJA 2D7FA 5GLVA 1OLRA 4B1MA 1N3QA 5LRRA 1QU0A 4XTMA 2Q4SA 1OXCA 2BVVA 5BXXA 1O3QA 2Z2SB 3OB8A 1XQNA 4TSVA 2JX9A 1AR63 4YGEA 4DFSA 3PUSA 5IT6A 4KG0A 3ST7A 1PVC2 4AHYA 3AYCA 2JG8A 3WR0A 4BQ1A 1JYXA 3GGLA 4P00B 1PO22 1DQ2A 1CAVB 1MZFA 2XVLA 5DG2A 5FOBB 3POEA 4CRQA 4R4ZA 2XONA 5K0UA 2XB6C 2BVBA 1H2MA 1H8TB 1SLBA 1NA1B 1CONA 3KF3A 3I2HA 2XH6A 1MQTA 4YW1A 1F35A 2C26A 4XUNA 4MADA 3RI9A 4PQQA 2RJKA 4XJZA 1YIPA 3QH6A 1PNGA 3LOBA 1PK6A 1H4HA 2VTXA 1RUE2 3PMEA 3OOXA 3T09A 4QKBA 1DQ5A 3IDAA 4PT6A 4ES8A 4NVPA 5JIUA 4BQ4A 2VZVA 1RUH3 1ULOA 1X82A 3I2GA 2VCAA 3AZXA 4ASMB 1VBB2 2Y38A 5A7QA 4BQ3A 5IK5A 5ABJB 2FZ2A 1HV0A 1VIWB 3O1TA 2JIJA 5E16A 5T50A 2F17A 3BCWA 4DEVA 1GSLA 4DXZA 1OMIA 1YI7A 5FO8B 3AZVA 2IXHA 1U5XA 1WW4A 4IEQA 1IQAA 2J7MA 2Q8CA 1V9U1 3TEWA 4Q1PA 3P5BA 4CCLA 2VUAA 1HB3A 2JDUA 5GLTA 4PI0A 5FXVA 5FYMA 4NWVA 2VG9A 4NAMA 2W1SA 1IPSA 4UFHA 5F7UA 1FMD3 4HVQA 1KDMA 3U14A 1EY2A 2HEWF 4QPIA 1TMF3 3FUQA 4UXAA 3ZXLA 4I3GA 3ILRA 5H9QA 1AZDA 1UXZA 1NA1C 4M0NA 5A70A 2VNRA 2YG0A 4BZ4A 5JSPA 4XDQA 1NLQA 5FAXA 1ZZ7A 5FMCA 5A3LA 5F5AA 4GQ7A 3K2OA 1AL22 4LK7A 1KXGA 1LU2A 5FDBA 3LSDA 1OA3A 2VQ0A 3BIWE 2CL2A 2C6SA 2VMCA 2W5FA 2D97A 3VD4A 3FFZA 4Q4Y2 5AC92 1K5JA 1XC6A 1ZNPA 1CGPA 1FPN1 3B94A 4LO4B 4NO4A 3ZXDA 5C4WB 4A42A 4D94A 5CNAA 4ZU4A 4AXOA 4RSUA 4XF4A 2ZHKA 5FWJA 3GHNA 1RVF1 2WO1A 3NNMA 1KFXL 1GR3A 1AR72 1RGSA 1ZZ9A 2XWBB 4FP2A 5CVRA 5I0TA 2VOWA 1HRI3 1FOD2 2JG8B 3AP6A 1J59A 3RZMA 4Y1VA 3TNQA 2WQ4A 1AXKA 2XMLA 4MXWA 2EXKA 1V00A 3NL1A 1LHVA 2X53S 1YJKA 4IL7A 2I45A 1OFSA 4EV0A 2A3WA 3LB9A 4QGLA 1SFYA 2ZEWA 3OBZA 2AR6A 4ASKA 5T5PA 4XPVA 3NKGA 5FY0A 1QNYA 5J1XA 2D44A 1X8MA 2WT0A 3FHQA 3HWJA 2XLAA 2J1UA 1NE6A 4G9SB 4QX8A 3IT8A 3AMNA 1T6GC 1R1ZA 2BGPA 3KGLA 4GA9A 4OCTA 3GBFA 1UOGA 3KQRA 3N7JA 3POGA 4FFHA 2WAOA 3CHXA 4CVUA 1URXA 4PLNA 2XXZA 3C3VA 4FPLA 3O7OA 1D2SA 3ZYGA 4AEDA 3VBHC 4XOGA 4CDXA 4NPRA 4XCAA 5LK7B 1B35A 1KDKA 1ZA7A 2UWCA 1TZOA 1D4VB 4GMP1 2PHXA 4BHPA 1AYM1 1ASJ3 1CVNA 3WNXA 3M3OA 3CLPA 3OGRA 1W9TA 3PURA 2JG8C 1DGWA 5DZEA 1UOBA 3JU9A 4A41A 4AEMA 1JXNA 4XJUA 1JBCA 2YFUA 5GM0A 4D8MA 2X05A 2E31A 1EV11 4QB6A 4XFCA 3I3DA 4FPFA 3OYWA 5CAZA 1US2A 5I0DA 5L7OB 1JU3A 3I59A 3WINE 2BWCA 2MEV2 3VDAA 3ZX7A 4CP0A 4QQLA 1H9WA 3ES4A 4CCJA 3VGIA 3AKRA 4AK3A 3LIGA 3WNLA 1YNAA 3ZFFB 4EE2A 1CJDA 3R05A 3MZHA 4Y1ZA 4G4FA 3FE5A 3D0SA 1X50A 3QCWA 2D6PA 4IEYA 2HLEA 3VBHA 2VNVA 3HR9A 3IAPA 3H3LA 1LU1A 4IEWA 4C8DA 1LOFA 4COUA 2WFF1 2DVAA 4MGQA 2DCJA 4LKDA 3PUAA 4CEWB 5J09A 1VBA3 1MEC1 1YCIA 3AJYA 5IWFA 2HBUA 3NW4A 5A3WA 4FXGB 3SH3A 4UBGA 1UZYA 2ZMKA 2VJXA 4IE6A 1LGCA 4RR3C 1BQPA 3MHZA 1UYYA 3ZDSA 5FY7A 2YDEA 5CFDA 4NHKA 4AZZA 5JR2A 2V09A 1RUNA 2LUWA 1K45A 1BVVA 4ZS2A 1GYKA 3N9PA 5T3NA 3FL7A 1PK6B 4BM8A 4CDUC 2VZ3A 3KCXA 3H1MA 3CZJA 4YGBA 2BBAA 3LF7A 2O8OA 1JI6A 2BERA 3O1UA 4GKXA 2RM23 3E1F1 4GWNA 2OT7A 5FMDA 4XXPA 1SLLA 3MF9A 3CIHA 3DEMA 4GJZA 4Q4V2 5DAWA 4CCEA 3AZZA 5FQ0B 2Q8DA 2D6OX 2IFWA 3VKOA 1QH7A 1UPSA 2BQPA 4XW3A 4QKDA 2XLFA 4FPCA 1H2LA 5HCFA 5KXBA 1LENA 5CBLA 1LULA 1OPOA 4NIAA 5JWPA 5DDJ3 3TAYA 5DUWA 2KD7A 2MNGA 2P3JA 1H1MA 3O0WA 5DUUA 2DVBA 2HWE3 3HIFA 1UY4A 4P5YA 3MIGA 5LY2A 1FOD3 4UBHA 3E6CC 2D93A 2G1MA 1WLTA 5FPBA 1WD3A 4B4PA 4M3CE 4QQPA 3GXUA 1OH3A 2GSYA 4ZU5A 4NPLA 4FFFA 4DZGA 5EHDA 1RUI2 4FQ4A 1TNRA 3VDDB 3CJIC 3ZXJA 1AR91 3O1VA 1R093 1WMDA 2QKDA 1XXNA 2FDJA 1RUG2 4GALA 4AGVA 3KSCA 3OG2A 2Q8OA 3X29B 2JWPA 2Y33A 3WNPA 1BLZA 2WKKA 3UL2A 4W4ZA 1VALA 4CXWA 4NIDA 2V72A 4MYEA 2WIIB 4QWNA 4Z1VA 3Q8CA 1W9SA 2R062 3R0RA 1QJU1 2D6KA 3SH4A 4CDWA 4NHYA 1DIWA 2VMFA 3JBG1 2JDNA 2VCCA 5C3PA 5FXXA 4PHZA 1UYXA 4UFKA 5KXEA 4XACA 2HWF2 1G9FA 1FAYA 3MIDA 3LDRA 1Q43A 4FXKB 4R52A 2ZEYA 3W20A 4XFAA 1COV2 2GH2A 2UY8A 3TOJA 2VVFA 1GUIA 4QD2A 4XCBA 5CKMA 1DZTA 1SCRA 1N3PA 2WLPA 4ATFA 1XNDA 4D6RA 1KQRA 2K46A 3A4UA 4E4DX 5F32A 2NP0A 2WWJA 1ALYA 1PO23 2A73B 3KWVA 3ZFGC 1UXXX 3T30A 4CXXA 3UT0A 2JD4A 1WCKA 4JDMA 4NRPA 3NJVA 4A7KA 2RMU1 4W8JA 4LA2A 3VBOB 1JYVA 2GMEA 2FDIA 5EWSA 5L7OA 2BTVC 5DAQA 5LBEA 4J25A 1B35C 2B45X 3JQWA 3RMYA 2LALA 4LPLA 3WY6A 4OHYA 2AH2A 1H2NA 4GB33 1NQDA 5LCWL 1AVBA 2V4VA 4MHRA 2XHNA 3AMQA 3NSTA 1RHI2 1PVC1 2E53A 2MHFA 4XMAA 5F5CA 5FWEA 4NIIA 4LBQD 3OD4A 4CUGA 3LIHA 4CU7A 2ENRA 3FHIB 3KVAA 2ZGRA 3GF6A 3MIEA 5CFCC 1RUE3 1GQGA 4JGYC 3VBUC 4RYDA 3U1XA 3BTZA 1HKDA 3NWKA 4LUMA 4MXVA 4YZ5A 1UY1A 4LT5A 1S2BA 1TVGA 2W46A 1VBD3 5LB6A 1YXWA 4GIQA 4A6SA 1RUH2 1WA6X 4OUSA 4Y4YA 2XG3A 3VBOA 3ZXGA 5JI9A 5GJ6A 1AR62 3IZOA 2ZCWA 3NV3A 3OEAA 2WA3A 2DVDA 3VUOA 4UFJA 4Q4W1 1LOFC 5T5OA 4K21A 4LBKA 1I3HA 2WN2A 4QDRA 2CHHA 4GH4B 2QNKA 1UWWA 2ZOEB 3OY8B 2BFUL 1QQP2 1RUJ3 1JU4A 1JUIA 4NHXA 4Y5TA 1NCQA 5DQ0A 4QHBA 4IETA 1SBDA 3IIAA 3MFCA 4MGZE 1HXS2 4XIOA 2JJ6A 3KLSA 1NXD1 4P9WA 3S0MA 1S4CA 1DDLA
chains in the Genus database with same CATH topology
2DYCA 3WXPA 4FTBA 4SBVA 1D4M1 5D8AA 1GNHA 3L2HA 2F6BA 4HKWA 4PIZA 1AR81 1LESA 3I54A 4E4SA 1MEC2 5J7MA 3JBG2 3VZNA 1QJU2 2VXRA 1RB8G 2G9GA 1VBE1 4LBNA 1R082 1MZ5A 1PHMA 1NXMA 1VLNA 4B7EA 2A70A 3FMGA 2ET7A 1HRV2 3N36A 4B4RA 1Z7S2 1R092 5DZFA 1HDKA 4HKLA 1UPIA 2ERFA 3RG0A 5JOWA 2E6VA 2G4IA 3ZIXA 1ZA4A 4K7JA 4Z92B 4AF9A 5KHIA 1W0PA 4Y24A 1RUOA 3UKVA 4PJYA 1R1A1 2C9AA 4PBPA 1JW6A 3N4MA 1AL23 3ZYRA 1KJRA 5ABJA 5I0SA 4M3CB 5FREA 1PNFA 3VLBB 4YFZA 1IPJA 1C5HA 1LHUA 4HN1A 4XFIA 1POV0 4YNIA 1RUI1 3L9JT 4HSLA 4F7ZA 1PGW1 2NN8A 1GKBA 1C8M3 4Q4W3 2ZGKA 3MF6A 2ET1A 1HRI2 1MS3A 1FI2A 3B93A 3U07A 4XQWA 3USUB 4J1XA 1YFXA 3WQ7A 3ZSEA 4AFDA 3IWZA 2BEOA 4LO5B 5SV8A 3UV9A 1TME3 4RQPB 3THTA 2PLV1 4FTEA 4LO8A 2Q1MA 2YHJA 1S0DA 3I2DA 3IMNA 3S7EA 1UKGA 3UKNA 1PGSA 1WW6A 2EALA 2YROA 4Q4X2 5GLWA 1SBFA 3M70A 3QH7A 2JG9A 3ZFFA 1FT9A 4DQAA 5K8SA 3JBG3 2ATFA 4ZU7A 3GZUC 1CD3G 4Y20A 5BNNB 3AB0A 3OTFA 4XIKA 1GFF2 2A7AA 3B00A 4GULA 4Q0QA 3E6BA 4BIOA 4CP1A 4NN0A 2VULA 1KFUL 1UZZA 2VW0A 2IWGB 3N3HA 5KHJA 2DFBA 1MQTC 2XJRA 3MW4A 5D1IA 5CFDB 3ZXEA 4HSJA 1MS8A 1NQJA 2Q30A 3S6PA 3ZN5A 1W6QA 3PHMA 4LBMA 1XRUA 3N7MA 1AR73 1HXS3 4N43A 4W6WA 3M3IA 1AXZA 1Y43B 1D0GA 1XYOA 4AEDC 1QDCA 3ZYJB 3ZXAC 2HJIA 4DOUA 3TN93 4G3YC 1ZZ6A 2ZGLA 4XF9A 1RUG3 1Q3EA 1AL21 3A0KA 2NM1A 1W6NA 1VJ2A 5IK8A 4K9SA 4NR1A 3N7LA 5HXVA 2YZ4A 1AR82 4DNYA 3MIHA 1C8NA 4L9BA 1VR3A 2ZZJA 2B42B 4FPKA 5GZEA 2BBVA 4ZKTB 1PMIA 2FBEA 1C8M2 1F8VA 3ZN6B 2VW2A 1D0HA 2VNGA 1X33A 4IEXA 2VPVA 1LOCA 2N7GA 1COV3 2VMGA 2EXIA 4LO6B 3RMXA 3LOIA 2YC0A 1RUE1 3UK9A 1POV3 2XL7A 1W0OA 4JVAA 2HWC1 1BEV2 3AX4A 4S2FA 4OULA 1VBA1 4YVSC 4CEWC 5JMCA 2A71A 5D8AB 5F9TA 5JOYA 1YI9A 3B9IA 4XFHA 3USSA 1EYBA 3BALA 1OOPC 3AP7A 2MPFA 3MW3A 1S2KA 3RJ2X 1CAXB 1Q8QA 4CDUB 3WDUA 4Q4V3 1OHFA 4F83A 4QX5A 5T55A 4Q2FA 4RS5B 2KM2A 4QPIB 5FO7B 2UYAA 2H0BA 4Y1XA 3LGRA 1UX6A 2PHLA 1QY4A 1S0CA 3TRSB 4YFWA 1AJOA 4W6YA 2MEV1 1YFUA 1AHSA 1OA4A 2Y0OA 4HT1T 4QPGC 4WM7A 5BNPC 1BMV1 1UF2C 4AI0A 5J3UA 2Q1ZB 1RC6A 2RS13 4B8EA 1QOSA 1JYIA 4I0AA 4D7TA 1K5MB 3SCHA 4YGDA 4CDQB 4Q4Y1 4PQ9A 2NMNA 3IBMA 1LKNA 3RZZA 4IEPA 5EYYA 1EP0A 2PLV3 2EAKA 2D3SA 2IXIA 5SV5A 1SACA 4TWTA 1AX1A 2UYBA 2ZBJA 3KT1A 1SEFA 2WNVB 4FOQA 2V73A 4Y22A 1ZZ8A 2HWD3 4QGNA 5AVAA 5JCTA 1AX2A 1BBT3 5GZDA 1Q8PA 4HL0A 2GC2A 3WOGA 1YLLA 4RD7A 3RI8A 2JECA 2ZMLA 3ZSJA 4DRVA 4BA6A 4I0BA 4W65A 1NY72 1POV1 4M0HA 4AGRA 5J98B 4P9LA 3GHMA 3MLLA 3WW1A 3H0OA 4FTSA 4NOTA 1PIV1 4C0BA 3E5QA 5DG1A 3MPPG 3ECQA 3IPVA 1VBB1 4XQ4A 3VKMA 4Q26A 3KS7A 3SLIA 1JYCA 4L99A 3ZIWA 1AXYA 1APNA 2CNAA 3VBSC 5BNNC 3AXDA 4AFAA 4BMEA 1A8MA 3KMHA 4AWDA 1CAXA 2GNMA 4FPOB 4UW4A 4AVCA 4DY3A 4SLIA 5HBAA 2QJVA 5ACA3 2OVUA 3RPQA 2WNVC 3MFAA 4KGQA 5CFCB 2D6LX 1ZRFA 5CFDC 1REFA 1UAIA 4YGCA 4AGGA 4TZDA 2DVFA 4HMZA 4E2QA 1ASJ2 2YGLA 2UWBA 4IERA 4AQ2A 3M2MA 2RS53 4DY5A 2WFPA 1BZWA 3WUDA 3ROUA 3VKLA 5DZGA 4U2AA 4H55A 5CG8A 4P9IA 3WP3A 1HRV1 3M3EA 3WDWA 1XE8A 4YVSA 4AHZA 5KHGA 1Z78A 2D5FA 2PLV2 5BUVA 4JGZA 1XNKA 3ZFEA 5JZGB 2P17A 2Q0AA 3M4FA 1F2NA 2CGNA 2GALA 1FV3A 5K9YA 2PYTA 2VOKA 2EIGA 2DU1A 4R9AA 4EN9B 4B29A 3WP6A 3LCPA 1N3OA 1ULEA 4P9XA 1PZ9A 1QOOA 3B02A 2PHWA 1MVQA 4QQ2A 2D40A 1SQ4A 2QQPA 1AF9A 4LLFA 1MS4A 2B9UA 2D3RA 2GC0A 2JE7A 4HPKB 3R4UA 1K5MA 2PAEA 1FNZA 1QJX2 2DUPA 2SBAA 3APBA 4XTPA 1V9U3 1DBNA 3WG3A 1Q8OA 4ISQA 4R9CA 4AVBA 3B69A 3GZTB 3V56A 5I91A 3WG2A 4CEYA 2YMZA 1RUH1 5FPXA 2FHRA 2KXLA 4XEZA 5C8CA 3GNEA 3SNMA 1CPNA 2RMU3 4LBJA 2IXCA 3BB6A 1VAKA 1Y7BA 4RL7A 2W08A 1VRH1 1VP6A 3H7YA 2GC3A 5DDJ2 2YYOA 3AK0A 4ORFA 1IOAA 1YHFA 4LHKA 4V1PA 4Q4Y3 4KQ7A 1OD5A 4Q4X1 1VAMA 2E51A 1U5IA 5T52A 1SDWA 2ZHNA 4QGMA 5ABJC 3MGUA 2CWMA 3TWIA 2WNUC 3SITA 4GH4C 3B01A 2BWAA 4MSVA 5DUVA 4WM8B 3V0AA 2ZGQA 2ZX4A 2ZTNA 4XJ9A 2P34A 2K2SA 2RR11 1D4M2 3MW2A 4HKOA 5GALA 2XLGA 1RTVA 4LR4A 3WHUA 2W52A 3IDEA 1DGRN 1XYNA 4IV3A 2XKPA 3ALQA 2DTWA 4UW5A 3U11A 4E27A 4OI4A 1IGOA 2LTNA 4JQRA 5IK7A 3E6DA 3NO8A 1EAH1 4J1WA 3CF6E 1H8TA 3POWA 2XGXA 1C1LA 2Y0IA 4EWDA 1CAWB 3VBSA 4AEJA 1CX4A 1G9DA 2R6QA 3AYDA 3E5XA 4NHLA 1DZQA 4COWA 5EXOA 1PGL1 1REDA 1ZBA3 2CAUA 2FMDA 3DN7A 1RIRA 5EYXA 1UIKA 3LA7A 1NOVA 4A3XA 4OI1A 4IQPA 3R4DB 5F1RA 4XYXA 2X8KA 2IXKA 4AVTA 4Q0UA 1Q56A 3DV8A 3T1MA 3CNAA 2BPA2 1ULGA 3BOWA 4FPYA 1WCSA 2B8MA 2PN5A 4FQZA 3T1LA 4JDOA 3DL3A 3RYKA 2ZHMA 1W39A 5ACA1 3WV6A 1MZEA 1F9KA 2C0ZA 2GZWA 3ZFEC 3B7MA 5AC93 4HETA 1HQNA 4L11A 1ENRA 1QJX3 3TN91 2ZX1A 3V64A 4N7UA 1RUD2 1S0FA 2BW8A 2PHFA 3VBRA 4AFCA 1VBC1 1UD1A 3KCCA 1W6QB 1LEDA 2ZAHA 2R0FA 2CYFA 3PVEA 3KT4A 3VHNA 3DPRA 3QD6A 2QVSB 4Z8BA 5BNQA 1ZX5A 4AHWA 1PK6C 4MVTA 4N9HA 4RS5A 3IDCB 5I0UA 5T5JA 1QOTA 2WZR1 4ATEA 2XBO3 3VDDA 3WDVA 2WT2A 5DXDA 1ZZCA 4Z2WA 5BY5A 3J4UH 4XZPA 3JZVA 2Z69A 1GV9A 2VH9A 1J3QA 4MV2A 4GXLA 1DFQA 2DUOA 1N1YA 2RHPA 2XVGA 2ZAAA 3JB4C 3S7IA 5GLUA 2R072 2AYHA 5I8SA 1UKRA 1Z7S3 3RS6A 1WD4A 2UU8A 2R042 4Z07A 3SCFA 2O8QA 4OI2A 4OHZA 5BNOA 1UU6A 2CWSA 4HBNA 5E8AA 4B4QA 4KH9A 2NPIA 2YV8A 1XNCA 2ZX3A 2ES3A 1W6PB 3SCGA 1Q8SA 5J96B 1JOJA 1VRH2 3MPBA 3CL1A 2BNOA 2GAUA 1GZWB 5JSRA 3TYJA 4LUKA 4DMIA 4JV4A 3D0JA 1HRI1 4ZXKA 4XJWA 4BOWA 4HLTA 1EPZA 3O12A 1IS5A 2UURA 2P3KA 2TNFA 4I01A 5CA6A 4RQPA 4XILA 4YRDA 4JRLA 1VBE2 1WBLA 2D43A 4FT8A 4WVVA 2QE3A 1WLWA 1BCXA 3SISA 5JIAA 1QKQA 3VKNA 3WX5A 3SMHA 1AX0A 3LA2A 1RJ7A 1W6PA 2K9ZA 4XHXA 4Q0PA 2PHUA 3H3ZA 1MZ6A 2I74A 2E7TA 4P9YA 5FBZA 4JGYA 3VBUA 1H2KA 2CY6A 4XBLA 4QQHA 4Y26A 4S2DA 1UW8A 2PTMA 1I6XA 1HV1A 2R32A 2D98A 2HWF3 4XHBA 2BYVE 1G9AA 2IXJA 1Z7S1 1OLQA 2XJVA 3C2UA 3FBYA 1J3PA 3HT2A 2P2KA 4KWJA 3WQ0A 4YM0A 2OUJA 2WFF2 1ULCA 4AQTA 4LLOA 2G9FA 4GB31 1WLCA 1NLSA 3ASIA 2W0XA 3AM2A 3KGZA 3NAPB 4K40A 5A32B 1SFNA 4IV1B 1RUF1 3INAA 1S1AA 4LULA 4N7IA 4X8NA 3VZMA 4Y1UA 4FBFA 3R6SA 4RGAA 3ME2A 3WVJA 2WNVA 2R1DA 1S0JA 1AUYA 1PO21 2PHTA 3ZXKA 1O4YA 2P37A 1G9BA 3RNSA 5JLVA 3VZKA 1JH5A 1O3RA 5KXCA 5C9AC 2ZABA 3AJZA 1ENSA 2FMYA 3MLJA 2IFRA 3M7AA 4YVWA 4XFGA 3HN1A 1YWKA 1GZCA 4MGYE 4C1XA 4IESA 2O0OA 2B5HA 4AVAA 5JZGC 2XBO1 4Q0VA 2YXSA 3HAGA 1PVXA 1M4WA 2LM3A 3D5OA 4QM9A 4K1ZA 2CAVA 4C0HA 2CTVA 1QJZA 4CEYB 4IEVA 1KS5A 2HKXA 1QQP3 1RUJ2 4PLMA 1Y3TA 2WC2A 4AEDB 3N35A 4IV3B 4Q0SA 4AFBA 1UL9A 2IXLA 1QJY1 2F4PA 1PIV3 2A6VA 1RUF3 1RUC1 1IPKA 1QXRA 4COVA 3VHOA 2VMIA 1NLRA 2Z5WA 3JCIA 1DQ6A 1ZBE1 4RGGA 2WZPP 1V6NA 3SH5A 3VL9A 1QXJA 4F8AA 1HQWA 4AYUA 4HVOA 3H50A 2RS31 3OBRA 3EQEA 3M1HA 2A75A 1AYN3 4OZXA 5C8CC 1COV1 3NKTA 1ZZBA 3EXUA 2RM22 3H1WA 2TUNA 4XXAA 3WDYA 4COYA 3ILFA 3B3QE 5CB7A 3RRDA 2ZX2A 1EAH2 4KU8A 3BPZA 3OD0A 4WV8A 3ZSLA 1U0AA 4I02A 2RJLA 2UY9A 5GKAC 2WNUB 4CDXB 1NG0A 1ZBA1 5JSOA 2UWAA 1R081 1MVEA 1WW7A 2I2SA 1V70A 2DFCA 3NV4A 2EXJA 2WL1A 1ZBE3 2HWB2 2B7YA 4HANA 5EJ3A 2NMOA 3A0NA 3SXWA 5GZCA 3E97A 3FFQA 3IKWA 2HWD2 3AXEA 1O4TA 2ARXA 3MDPA 3VZLA 4BWOA 3GBWA 4EN7B 1X7NA 5C8CB 3OCPA 3P3NA 4DB5A 4FVVA 4JC1A 3H1YA 2R073 3AKPA 1WLDA 1RUJ1 4YARA 1MQTB 1GLHA 1SBEA 4JGZC 3H3UA 1RVF2 3ZPYA 4OLLA 4AG4A 1AR61 3QLQA 4YW3A 4K6BA 4FCAA 2RS52 1QJX1 2DCKA 2VMHA 4EWAA 4N53A 1NCQB 3ATGA 4WVZA 5AC91 1VBC2 5C6CA 1H9PA 3O0VA 4N53B 5FMOS 4TLFA 5F6KA 1O3SA 3WHTA 5FPZA 1DGRA 2PAMA 1AYM2 2RE9A 1GANA 4YG0A 5KWRA 1ND3A 4CDWB 5EV7A 1W6OB 2Z42A 1ND3B 3S30A 2JE9A 4FOVA 3H9AA 1BJQA 1MACA 3J26N 5JZGA 1RL3A 2GNTA 1O7FA 2GU9A 3LA3A 1FMD2 1WW5A 5IUQA 3WQ1A 1CAVA 4OHVA 3PJQA 1F5JA 4YZ1A 4LBQA 1SLIA 4B3NA 4WM8C 1VBD2 3VV1A 4AFMA 4OVEA 5HCBA 4I2OA 1WCDJ 3EO6A 1YYNA 3DF0A 1OQEA 1TMF2 3ENRA 1W6MA 1R1A3 4P5HA 4B7KA 2AREA 4OHXA 3WCRA 3FX3A 3DGTA 2QDRA 2W39A 4XF0A 3V65A 3K48A 2B46X 5L73A 5C4WA 5FQ0A 1CQ9A 2EF6A 4D69A 2XJQA 4AVSA 4LBOA 4QPGA 3MIBA 2ZGOA 4KWLA 1O5LA 2TBVA 5AVPA 3ZSMA 1LOEA 2R071 2X5IC 4A7ZA 4CDWC 3CU7A 3PTYA 2IC1A 2ZACA 1LOBA 3FZ3A 1VB2A 2OYZA 1HRV3 1QXPA 2W68A 3OF1A 3WP4A 4FPGA 2VVEA 4MXWB 3B9CA 2ZMNA 1NCRA 5CIRA 5FLJA 5BNPB 2VNOA 5A3MA 1DQ1A 4IV3C 1PO13 1I5ZA 4ITCA 5I8YA 1SCSA 1U5ZA 1D2QA 1ZRDA 1K5MC 3FJSA 3WP5A 1DG6A 4PF5A 1BVP1 1XE7A 3ZFGA 4Q1RA 2EXHA 2ZGTA 3J8F1 4QMAA 3JD73 1D4M3 5BNOC 5I93A 1I9RA 3PMSA 4MH0E 4FOYA 4IEOA 1Q5OA 1U12A 3HBZA 3I59B 1BBT1 2OW4A 1OOPB 1XU2A 2WINB 4K1YA 3WLUA 2DCYA 4HVRA 1PZ7A 1C28A 4GKYA 2IZWA 1RUD1 2XJTA 3DPRB 4MX3A 2PELA 4YM3A 1N1SA 4L97A 4AVVA 1EPWA 3POSA 1DQ0A 2WSUA 3GYDA 2XUMA 3VHPA 1QGLA 3RJRA 5JAXA 1LEMA 4C91A 5AFBA 4NWWA 3CJIA 1VBC3 4META 4X6RB 2AUYA 2XL9A 2HWF1 4J6GA 1RINA 2DU0A 2WQZC 2VOXA 3CJIB 4BMBA 2DTYA 2B39A 4PDWA 2OIIA 4CDXC 3HT1A 4XJ8A 2WNUA 3NVCA 4CDQC 1J3RA 1QJY2 1F31A 1PIV2 2EAAA 4MUVA 2WZR3 4HPKA 3AMHA 4Q4X3 2TEPA 4JTOA 1ZYBA 5A32A 1MS0A 3I4IA 1UMZA 1ULFA 1IS4A 3M8LA 3J8F3 4BLIA 4LHNA 4L92A 4D7YA 2JG9B 3NJZA 4OUMA 2ZZQA 5FCCA 4QM8A 2RS51 2YY1A 3DPRC 1SLTA 1S0GA 4YG3A 4E4ZA 2Z79A 4TYSA 4FPEA 5FMOL 1ND2A 1YFYA 4GMP3 5FFOC 4Q4W2 1EV12 1FYUA 3UKTA 1LB2A 2HWC3 1G7YA 3H7JA 2VY0A 1UN1A 3IDBB 2WT1A 1V6MA 1R1A2 4R9DA 4RR3A 4YM1A 3KCYA 4MGKE 2XHKA 3CJXA 2ZGMA 3SHRA 3D82A 3HMYA 5CFCA 4XETA 4AHXA 3RYPA 4QXKA 1TNFA 2A5ZA 1S0BA 4OFGA 3VN4A 2R16A 1QH6A 2ZGSA 4L2NA 1FMD1 3FLPA 4WZCA 4OI0A 1BBT2 1MR5A 1YJLA 4LNVA 1C8M1 4AW7A 1VBD1 5C4WC 3BU7A 4H14A 5E1RA 2CGPA 1C1FA 3OJBA 3TBDA 5H9PA 1PGL2 2VGDA 1RMU2 4R9BA 4RFT0 3JUUA 5CU1A 4RHV3 1QDOA 4HN0A 4YG6A 1CAWA 1XNBA 4WVWA 2I07B 4PDWB 2DWRA 1N47A 3PNAA 2VVDA 3ZXFA 1W6MB 3PVNA 2HWB1 3VBRC 2WNEA 3FBMA 1LODA 2GMPA 1C5IA 1CPMA 1O91A 2ZHLA 1PO11 4GB32 5JDBA 1L3JA 1N1TA 1I1EA 3BOPA 3ZYPA 4YW5A 2P3IA 1F5FA 4K20A 5JR7B 3JQXA 3UJQA 4XE9A 4O9GA 1PM7A 5KBFA 2WS91 2C1FA 1NA1A 4FP3A 1FATA 3URFA 1NYWA 1LRHA 4URTA 1A6CA 4WM7C 5K0UB 1AJKA 1ZM1A 3NAPC 3AFGA 2GN3A 4MGIE 5L19A 1H1IA 1IS6A 2K0GA 3EHKA 4HK9A 5J37A 4YVWB 3ELNA 1VRH3 1FXZA 4H7LA 1A3KA 1V6IA 5BNOB 1YUDA 2GDFA 1PGW2 1WA4A 5L7OC 4XF1A 1MS5A 2RMU2 5C9AB 3ETQA 3U4XA 3G6JB 2XKOA 1V6KA 5KXDA 1FOD1 4PBOA 4EROA 1ENXA 1H30A 1GBGA 2BNMA 4N43C 3D6EA 1AYM3 2HWD1 1RITA 4GWMA 3PLQA 1H4GA 1CAUA 5DUXA 3DUIA 2WLQA 5GZGA 2OZJA 4D3WA 2BGCA 1R083 4HFSA 4R8HA 3NAPA 3R4SA 4IEZA 3LAGA 4RHV1 3JD71 4Z82A 4YYOA 4AI1A 2V5YA 4ASLA 1LOGA 4FAGA 1OFNA 3WG1A 5K0UC 3MIFA 1YFWA 1AR93 3AMMA 1PZ8A 2RS32 1CESA 4RQPC 4WZFA 5BYNA 5C9AA 1TQ5A 3AKSA 3ACLA 1GZ9A 4F3JA 1CIWA 2Q5TA 4YVWC 2JENA