3NW4A

Crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with gentisate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
363
structure length
363
Chain Sequence
KLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAAIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Gentisate 1,2-Dioxygenase
publication title The salicylate 1,2-dioxygenase as a model for a conventional gentisate 1,2-dioxygenase: crystal structures of the G106A mutant and its adducts with gentisate and salicylate.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
total genus 102
structure length 363
sequence length 363
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nw4A01
4OFGA 4XFAA 3CJXA 5FQ0A 3H1WA 4MGKE 3PVBB 2HKXA 4HZFA 1CAWA 4I0AA 1CAVB 5E1RA 3WW4A 4AVBA 4L11A 3H1YA 2WC2A 4UXAA 4A2UA 4IEPA 4F7ZA 5BY5A 4Q0UA 5LRSA 1CAVA 2EAAA 1JUHA 2PQQA 4META 2GC0A 2V09A 2OYZA 5KHJA 5JSRA 5I0RA 3KSCA 5FLHA 4ORFA 3DV8A 1CAUB 1ZZBA 4YARA 1UCXA 1WGPA 3ETQA 4HVQA 1O4TA 5C8WA 3EJKA 4XFCA 2K9ZA 1QXRA 2UYAA 3MZHA 1NXMA 3UKNA 4B29A 1DGRA 3EBRA 2XKOA 2HJIA 3FFQA 1CAUA 2BGCA 3BPZA 4AVAA 3FE5A 5JR7B 2PAMA 3KGZA 4IEUA 2XL9A 3B02A 1WLTA 1Y9QA 1RGSA 4HN0A 3FJSA 1J58A 4MGIE 1IPKA 4BYYA 1YHFA 5I91A 2PHDA 3E6BA 2PTMA 4IEXA 2Q0AA 4X6QB 2B5HA 4O9EA 2D40A 1XRUA 3U10A 1J3QA 3HIFA 2WFPA 3SCGA 3KCCA 3RNSA 3E6CC 4IERA 4KU7A 1GQHA 4XFGA 4JTOA 4XF0A 3I59B 4N9IA 3SXWA 3FHIB 2KXLA 1U12A 4XEZA 3OF1A 4XFHA 4I01A 1VJ2A 4AQ2A 3R6SA 5CU1A 2CAUA 5D1IA 4E2GA 4WBBA 1CGPA 5I0TA 2Z2SB 3U0ZA 3I59A 5LRRA 3ST7A 2PFWA 5BPXA 4IETA 4PIZA 2H6CA 4LLOA 1RC6A 3BB6A 2VQAA 3S0MA 5FLIA 4MH0E 4FT8A 4HSLA 1V70A 3SCFA 1CAXB 2IXHA 1LRHA 2OZJA 4AQ6A 4BIFA 4E2SA 1RUNA 2IXKA 1ZNPA 5I93A 1IPJA 4HSJA 3BALA 4Q0VA 4QGMA 4IEWA 4KWLA 1O7FA 2Y0OA 1CAXA 2OA2A 3CLPA 1X8EA 3KGLA 1LKNA 4J1XA 3NKTA 1J3RA 2QVSB 4ONUA 3CF6E 2QDRA 5AVPA 2IC1A 5BUVA 4Q0PA 5KHIA 1PM7A 3RYPA 2Q4SA 4FAGA 5E16A 4ZU4A 1L3JA 2QJVA 3C3VA 2UY9A 2GC1A 1EY2A 2OZ6A 2P17A 4FAHA 1RUOA 4WVZA 5FLJA 4PJYA 3ACLA 3FWEA 4QGNA 1UD1A 3D0JA 3KMHA 3S7IA 2ATFA 1ZVFA 1PMIA 3WW1A 4I2OA 5FPZA 2OPKA 2BYVE 3H9AA 4Q0QA 2CAVA 3E6DA 4AXOA 4L2NA 1Q3EA 1ZRDA 1J3PA 2GU9A 4F8AA 2FMYA 5KBFA 3VHRA 4NVPA 2FQPA 4N9HA 1H1MA 1TQ5A 2XL7A 1DGWA 1ZZ7A 4YSFA 1FXZA 4QM8A 5JSPA 2H0VA 4KWKA 3H50A 3RZZA 3H7YA 4LUKA 4MUVA 2IXCA 1UPIA 2CGPA 4D7SA 1YFYA 4PIYA 3LOIA 4JTNA 1YFWA 2BEOA 2XKPA 1QY4A 4MX3A 4Z07A 1CX4A 3FX3A 4QXKA 2GAUA 4QMAA 4KU8A 4QM9A 3IBMA 2K0GA 3H7JA 1O5LA 4LULA 2VPVA 2Z69A 5HI0A 4YRDA 3SCHA 3ES1A 2BNMA 1Q43A 4KL1A 1EP0A 1WA4A 1X7NA 3NSTA 3ELNA 4YYOA 4HMZA 3WW2A 3PNAA 1I5ZA 3O14A 5FCCA 1EPZA 3TNPB 2Q1ZB 3UKTA 3H1MA 4ZU5A 3QOPA 2BNOA 3QACA 4QGLA 2B9UA 4XFBA 2O8QA 1QWRA 4R8HA 4XETA 4LA3A 4UBGA 2XLAA 1FT9A 5I8SA 3L2HA 5FDBA 4XF1A 1ZRRA 2D5HA 1J59A 4OLLA 1NE4A 1SFNA 2DCTA 2IXIA 4MV2A 3IDBB 5KHGA 2O1QA 1ZZ9A 3NL1A 3LA2A 1YLLA 3IWZA 5KHHA 3I7DA 3MPBA 3E5XA 1ZRCA 5J3UA 3USSA 4EROA 3FZ3A 4EV0A 2CV6A 4BHPA 4BH9A 4QX5A 3EO6A 1O3QA 2EA7A 2UY8A 3D82A 2H6BA 4XFFA 4IESA 3DN7A 3RPQA 2PAKA 3GYDA 4LA2A 4EWDA 2QNKA 4Z82A 3DKWA 2ETEA 1X8MA 1O5UA 3BCWA 3WW3A 2C0ZA 3E97A 3OD0A 1DZTA 4LTAA 4EWAA 5I8TA 3M70A 4XF3A 3I54A 1RL3A 1FI2A 4P9GA 3H8UA 3RYKA 4JV4A 1YFUA 2XLFA 3D0SA 3NJZA 3HT1A 4LUMA 1I6XA 2UYBA 1G6NA 4Q0SA 4IEYA 3CEWA 2N7GA 4GULA 4AVCA 4IEVA 1OMIA 2PYTA 4WZCA 3RYRA 2ZCWA 5BV6A 2GH2A 2VECA 4O9GA 5K8SA 5J7MA 1O3RA 3ROUA 1VP6A 1UIKA 3PLQA 4EWEA 3MYXA 3NVCA 3RDIA 5JAXA 4X6RB 3SHRA 5CADA 3LA3A 1OI6A 5LEJA 3GBFA 5JSOA 2BNNA 2PAEA 3G7DA 1SQ4A 1DZRA 3ES4A 1RTVA 2IXLA 2XHKA 1UIJA 3LZZA 3LWCA 4E2QA 4UBHA 4DINB 2B8MA 3H3UA 3EHKA 3U11A 1YUDA 1XE8A 3CL1A 4JVAA 3DL3A 4MZUA 4IEZA 3CO2A 2PHLA 3LAGA 1J1LA 4I02A 3E5QA 5J48A 4I3PA 5F1RA 3MDPA 4XF9A 2MNGA 1LR5A 2Q30A 5T3NA 3OCPA 4I09A 5I0UA 3E5UA 1LB2A 2GC3A 5C6CA 4XFIA 1X82A 1XE7A 1Y3TA 5LEKA 1QXJA 5I8YA 1ZRFA 2GC2A 3EQEA 4K8FA 3HT2A 2D93A 2F4PA 1GQGA 2GZWA 1HW5A 4IEQA 3S7EA 5EZWA 4H7LA 2ZKLA 1O3TA 4MGYE 1YWKA 5CVRA 4FBFA 4YNIA 1UW8A 3HQXA 3LA7A 1EYBA 3OGJA 1NYWA 4KWJA 2XGXA 4HVOA 1VR3A 4CYDA 1O3SA 5FPXA 5KHKA 1H1IA 2MPFA 4XF4A 4HBNA 2I45A 4D7TA 1OFNA 2QCSB 2PA7A 4RD7A 3IIAA 1NZCA 5EFUA 1SEFA 2ET1A 4HLTA 1ZZCA 3TNQA 3BU7A 2ET7A 1YFXA 1ZX5A 3M3IA 4R52A 3ZDSA 1NE6A 2D5FA 4IEOA 3SMHA 2EVXA 4MGZE 2E9QA 4TLFA 1OD5A 3UKVA 3NW4A 4J1WA 1ZZ6A 2XLGA 4LEJA 1ZZ8A 4PIXA 5BXXA 5FQ0B 1Q5OA 3N4MA 2IXJA 4ZU7A 1ZREA 3IDCB 4HVRA 1CAWB 4HN1A 3H3ZA 3OTFA 3JZVA 5I0SA 4I0BA 5JCTA 2MHFA 4Q29A
chains in the Genus database with same CATH superfamily
4OFGA 4GXLA 4W8JA 2JDPA 4TWTA 3WHUA 3WF0A 3CJIC 4HZFA 4DEVA 1CAWA 3GBWA 1LEMA 2VW1A 2D6MA 2Y34A 1C57A 4JRLA 4W65A 5J09A 5IVEA 1Z7S3 2LW8A 4TZDA 1ENRA 4XILA 4L11A 4P08A 3VBHC 4AW7A 1K42A 1GKBA 4J25A 2J1VA 2JJ6A 2WC2A 1W3XA 2WFF1 4IEPA 1XU1A 4IE4A 4UXAA 5D8AB 2JDMA 3T30A 4Q0UA 1W8WA 1KFUL 4GH4C 3IDAA 1R093 2IFWA 4GWJA 1DF0A 1QQP1 5FO9B 3B93A 2EAAA 4B7EA 5HV4A 4CP1A 5CISA 1GANA 5FBJA 4FOYA 4HOOA 3ZSLA 1N1SA 1W0OA 3POYA 3VGIA 3H8XA 4NIDA 2E31A 3BI3A 3WQBA 4EZHA 1S2BA 2Q8DA 3MUY1 4CDWC 2GC0A 4XC9A 2YDEA 5D8AA 5JSRA 1D0GA 4HPKA 5M0TA 1JYTA 4H7MA 2QQOA 2YHJA 2OPWA 3AZVA 1FV3A 4WM8A 1TMF3 2YXSA 4MYEA 5IFTA 1ZZBA 2HWE2 4JC1A 4MLOA 1LHUA 5L9VA 5K0UC 3VHNA 1Q8SA 4XFCA 5IVYA 3ZYHA 3R0RA 3WNLA 4AFBA 4CU7A 1VAKA 1S4CA 3GHNA 5EXOA 2XVGA 3FFQA 4BLIA 1H2KA 2HEWF 4NRMA 4ASKA 3B01A 3PHMA 4M00A 1GNHA 4D8MA 1YQ6A 2QQMA 1FMD2 2XL9A 4YW1A 5LA9A 5DZFA 3WF4A 3VKLA 1J58A 5FMBA 2DVBA 5T54A 4O61A 4QX8A 1IPKA 4P9LA 3WP6A 3ZXEA 2XXZA 5DDJ1 2YROA 1AYN1 1NY71 2ZEWA 2JG8B 2RHPA 4AF9A 2VZTA 2H0BA 2D40A 1RJ8A 2BRTA 4QKDA 4LHKA 1A6CA 3C8XA 3U10A 4BQ3A 2A71A 1ZYBA 1HIXA 3J9SA 4CA9A 4RS5C 3KT4A 3KZ4C 4IL7A 2HWE3 3RNSA 1HX6A 1CX1A 3AX4A 1GQHA 2VUCA 4KU7A 4XQWA 2YGLA 1N3QA 4BPZA 2RM23 4XF0A 3ZYJB 3M7AA 4CCEA 3FHIB 4S2DA 2FDGA 4NHXA 4IGOA 3WY6A 4P9IA 4C91A 4XFHA 4W50A 5K4LA 3CU7A 1F9KA 4XTPA 4LE3A 1GOHA 3VUOA 1G86A 1FMD3 1GWMA 3JB4C 3K3NA 5FZFA 1SFYA 3IN9A 3U0ZA 4C0HA 3ST7A 3JD72 1CONA 1G9BA 5C4WB 4LLOA 4IV3C 4JGZC 1UO9A 2VQAA 4FFHA 2NYYA 5FLIA 4MH0E 5DPNA 3VZMA 3A22A 3WQ0A 3VBSC 1SLBA 2GMPA 4XJ8A 4RA0A 1REFA 1W6MB 4XURA 3CJIB 2CDPA 1REDA 1ASJ2 2WYFA 5C4WA 1OVPA 2BVBA 1IPJA 2W47A 1GZTA 3FHQA 2WABA 4Z8BA 4QGMA 4M3CF 3IZOA 4KWLA 5DG1A 4FTSA 2JEMA 2P3JA 3RZKA 4ZPIA 2OA2A 3KGLA 4PQQA 3VBHB 1J3RA 1GUIA 1W6MA 1OOPB 5EJ1B 1XSQA 5FPAA 2W87A 3CJIA 2X10A 4ONUA 1F5FA 2Q5TA 1HN0A 2G19A 1AVBA 3AMPA 4COYA 3KQRA 2ZS6B 3MI8A 2HEYF 5BUVA 2DTWA 2RDSA 3RYPA 2HBTA 2Q4SA 1E5HA 5FJKA 3VBHA 3QH6A 1L3JA 1OOPA 3HVDA 3JD73 4PF1A 1ZA4A 1UY4A 1W04A 1EY2A 2D3SA 1S0CA 2GC1A 2BOJA 2RMU2 2VD7A 4GH4A 1TNFA 4XUOA 3VV1A 3WF1A 2RR12 3GJAA 4ZKTB 5AFBA 1PO23 4NN0A 3TBDA 4DMIA 2WT0A 1JW6A 2ARCA 1T6BX 5IVCA 3VZLA 2J1SA 3POSA 4UW3A 1GMMA 4BMEA 1TVGA 2EXIA 3D0JA 5GZEA 3GCWA 1ASJ3 1LGCA 1W06A 3Q8EA 4CDWA 3LD8A 4CE8A 4I2OA 2BYVE 2K2SA 1IHMA 1ONAA 1WA6X 2ZGQA 1N47A 3ZX7A 3HR9A 1DQ0A 5LA0A 4BZ4A 1KGYA 1TNRA 1V6LA 2RDQA 2WFF2 2WKKA 5K0UA 5CG9A 1QQP2 3RI9A 2MEV1 4YG3A 1W9FA 2GU9A 2QZ2A 1AHSA 5KBFA 3WINE 4NHYA 1UKGA 4L92A 3I3EA 3RS6A 2VG9A 4GKYA 3BTAA 3VD4A 3P1IA 4D94A 3IAQA 3ZDVA 1IS3A 2BJSA 3UETA 4YSFA 5JSPA 1WW7A 1AR93 3P5BA 3H7YA 2RR13 4LUKA 4OQ9A 1UPIA 2SLIA 2X09A 1YFWA 3O1UA 2OQ6A 3VD5A 2LROA 4MX3A 1D4VB 2CTVA 1POV1 1CX4A 1X50A 4JDNA 3UNPA 4CDQC 4QXKA 4QMAA 3LFIA 1SLCA 2FCVA 4QM9A 3AJYA 5K7PA 1TZOA 1VAMA 3IBMA 2J1AA 3PUQA 1FOD1 3AMNA 3MEPA 1K5JA 1XNTA 3QLQA 5C8CC 2JD9A 3PU8A 1K12A 2WFF3 5LW9A 2Z69A 1E5SA 4CUCA 1RUJ3 5HI0A 2BNMA 3J8F1 2VZ1A 1X7NA 1WLWA 4KL1A 4LIUA 2BGOA 1QQP3 3NSTA 4YGCA 4B3NA 1AL21 4LXLA 5DDJ2 3VBOB 1TG7A 2VQTA 1NY72 1GFF2 1NQDA 4GB33 4QB1A 2P3YA 3RJRA 2YBSA 3TNPB 3IMNA 1QNWA 3N7JA 4LKSA 1ZBA1 3H1MA 3VBSB 1XNBA 1XU2A 2DDUA 3QACA 2VUDA 2B9UA 3OBRA 4XFBA 5F6LB 3MIHA 2VTFA 5DAXA 4NHLA 1UOFA 4DXZA 4XETA 4EYUA 4PLOA 5FV3A 2XLAA 1CIYA 3M2MA 4AI2A 4IV3A 5A3LA 4QPWA 3OSDA 5F2SA 4FQZA 4CP9B 4M0NA 4HKOA 2BZDA 4OULA 4Q4W1 3VBSA 1QJY3 1W6OB 1WMFA 4YM3A 2WR9A 4XW3A 2DCTA 4GWIA 2ID4A 4FP2A 5FFOC 2BPA2 4MV2A 3FN9A 1SLLA 3FLTA 3WOGA 2O1QA 1SHWB 1DP0A 5F32A 2GN7A 5FY9A 3WHTA 2VQUA 4CP9A 3IPVA 2ES3A 4MGTA 4NRQA 1GZCA 1UOBA 1W6OA 1X33A 2P3KA 4FP3A 3ZXLA 2B9VA 4Z2AA 5DDJ3 2QQPA 1QH6A 4GWNA 5CKQA 2DBIA 2Q1FA 5FZ0A 3USSA 3RZGA 3FZ3A 1ULEA 1MZEA 1OT5A 2KM2A 3WLUA 1PMJX 1F15A 5B2GB 4ATFA 4XXAA 3D82A 1V9U1 1O4YA 3ILNA 4XFFA 2JDYA 4F83A 1FPN1 1HB3A 4Q26A 3NKGA 1QMJA 3DN7A 2JIGA 4AEJA 3BKZA 4UYBA 2WA3A 4UOJA 5E89A 2RS52 4QD2A 3PMEA 3O7OA 1O5UA 2JKBA 4UWDA 2C0ZA 3WW3A 3B00A 3PIGA 4FFGA 1YO8A 1W8OA 1C1LA 5I8TA 1OKOA 3M70A 3I54A 1RL3A 3SKVA 1GWKA 1FI2A 2JG9B 3H8UA 2B42B 3RGBA 3TWIA 3LPFA 2QQKA 5FO7B 4QKBA 3D0SA 3NJZA 3N9MA 5L7OC 4AI8A 4DXSA 1W6PB 4K6BA 1G6NA 3O0XA 1RVF1 3G6JB 4Q0SA 2P34A 3CEWA 2N7GA 4SLIA 3SLIA 4COUA 5KXEA 2JG9A 4BK5A 2RJ2A 3WDVA 1OMIA 1RINA 2HLEA 2XBO3 2FMDA 5BV6A 1JMUB 5FP9A 3U75A 1XC6A 4FFFA 2BUKA 3MBWA 4BQ4A 4UFHA 3VBFC 4UW6A 1W6PA 3OB8A 4AHXA 2D6PA 2ZGTA 3WXPA 3MIEA 3LE0A 2P37A 3AJZA 1IQAA 3MYXA 3RDIA 3CMGA 1DYPA 4IQPA 1QJFA 2RS53 2RVAA 3CNAA 5CADA 2EIBA 3LA3A 1S0JA 4DB5A 1DYOA 4GMP1 5C5UA 2MEV2 3BN6A 4LHLA 1H6XA 2O14A 3VN4A 4YVSB 2Y6HA 1GV9A 4CDXC 2RS33 2C1FA 2C9AA 1W8HA 4QU1A 2B8MA 3I97A 3H3UA 5D21A 3ON7A 3MO4A 4LKEA 2JDNA 3I3BA 1P8JA 1YUDA 4GALA 1XE8A 5JPNB 4URTA 5FMCA 3K3OA 3CL1A 5F6KA 3ZXGA 4QPGB 2BOIA 2IZWA 1AX1A 5J36A 5IVJA 3NV1A 2ZX2A 4D69A 4YVSA 4XDPA 4MZUA 5FZ9A 3BODA 5FP4A 3POFA 3O1SA 3LAGA 1WLCA 5LK5A 3JXSA 3K46A 5JIAA 1CJDA 1PZ8A 1VBD3 3AVSA 2ARBA 4QPGA 4UFKA 2YFZA 4DUWA 4FPCA 4V2WA 1XNAA 3AYEA 1BXHA 3E1F1 1ND2C 5CEHA 4QX7A 5CKNA 2WNVC 3J8F2 4AI9A 2VNVA 1VBA1 3VBRC 5GLWA 5I0UA 2X29A 2MEV3 1GZ9A 1AL22 3KS7A 2GC3A 4UFMA 2WAAA 2RJKA 4QXBA 1ZRFA 2EXHA 2J7MA 2VOKA 1ZBE3 3GM8A 3H3LA 1WCUA 3ZSJA 1VIWB 1GLHA 1UZWA 1LEDA 1VBB3 3HT2A 4CDUB 2D93A 1OQDA 2F4PA 1ZBA2 2GZWA 1S1AA 2VMCA 4NAOA 3TRSB 3UT0A 5CG8A 1EUTA 1ZA7A 4LK7A 5CFCB 3ZSMA 1GNZA 2WLQA 3CHXA 1QJX1 1NG0A 4QKFA 2JXAA 3SH5A 1UY0A 4IDZA 3VHOA 4YNIA 4FOQA 4CUAA 2R16A 2D97A 3AMHA 3LA7A 4NAMA 1POV3 1EYBA 3NNFA 3OGJA 4JKMA 2ZJCA 4Q4W2 4QX2A 3T0BA 2XGXA 2P4EA 3WF3A 5GZCA 4PI0A 5CFCA 4LJHA 4QHBA 3ZVXA 2QDNA 2WT1A 5C9AC 4JGYC 2OW4A 3O1PA 5ANQA 5JVVA 1XPWA 4XAAA 3OBAA 4JQRA 2VW2A 3N36A 5E8AA 4URAA 2CY6A 1AL23 2PA7A 4RD7A 3IIAA 1NZCA 2ET1A 1Z7S1 2R6QA 1GOGA 2GNDA 3B9CA 1XSRA 3NAPC 4KGQA 4RYDA 3RMYA 3BU7A 5FP7A 3LSDA 2ZAAA 2ET7A 3TNQA 4AGVA 3K48A 2XJVA 2IUWA 4QDQA 2VBDA 1R091 3Q8FA 3JCIA 3ZFGB 1CWPA 4BCUA 4IEOA 2EVXA 3EMRA 3J7LA 4LQRA 5A6ZA 1F4AA 3WVJA 1AUYA 3UKVA 4HG6B 5JMCA 2XLGA 5AC91 4FTBA 1HJGA 1UU6A 1EPWA 4WM7C 2XOMA 3ZFGA 4LKDA 1CVNA 3QH7A 1BK1A 1TMF1 1H4HA 3N7LA 3N4MA 2PHUA 5C3OA 3AC0A 2KD7A 4HVRA 1KDKA 4AEDC 2ZGKA 3C7OA 5AVAA 5I0SA 4OI0A 2ZGRA 1NUKA 5FR3A 3D5OA 1RMU2 3HNMA 4XFAA 4NROA 3H1WA 3M3EA 4MGKE 2FCUA 1RVF2 2C26A 3LKJA 3PVBB 2HKXA 3RFRA 1CAVB 3AZXA 4DS0A 1POQA 1NZIA 2A73B 4XCAA 3VKMA 4XDOA 3AK0A 1AXYA 2WRAA 5FXVA 5BY5A 3K75B 3I4IA 3OBTA 4CTEA 1CAVA 5LRSA 2W0XA 3VDBA 5HBAA 5BNOC 2D43A 1JUHA 3FLPA 4HANA 4A6SA 2QUOA 2WBKA 5IUQA 4META 3V65A 1DFQA 1ND2B 3MIDA 2V4AA 2CL2A 2WNVB 3A21A 4LBMA 3AYDA 3GALA 1WW4A 2WO1A 1XNCA 4N7UA 4QDRA 4Y5SA 3VBRB 5IYYA 3HBKA 3MF6A 1MQTB 3KSCA 1UQXA 3TEYA 3OGGA 1REEA 2B46X 2RM21 1XB9A 3DV8A 2YC4A 3UGGA 1CAUB 1E5RA 2WSVA 1LHOA 4RR3C 1RMU3 5JLVA 3ZM8A 1UCXA 4IE7A 1DQ2A 1WUVA 3HN3A 4HVQA 1ND2A 4XOGA 5C8WA 2WNVA 1RVF3 2R1DA 3BOWA 3EJKA 3W20A 3VBRA 4FSJA 5FYTA 5IAXA 1QXRA 3MZHA 3H8RA 5HCBA 2OS2A 1MQTA 2R30A 1BYHA 4ET7A 1FMD1 3EBRA 3AFKA 2EF6A 4PI2A 2XKOA 4Q4Y3 1NLRA 2R7EB 1CAUA 2BGCA 3N9OA 3AZYA 1EV11 1RUI3 3ABZA 3FE5A 3WX5A 4AVAA 3RZMA 3IDEA 2XG3A 1DZQA 4GJZA 4IEUA 4XBNA 1UOGA 4NPMA 3SH4A 1WLTA 1D2QA 1EUUA 2VZPA 1R1ZA 1V6KA 3FJSA 3BGAA 3VD9A 2LS6A 5EP9A 4E4SA 4DY3A 3V0AB 4BYYA 3LDBA 1YHFA 3E6BA 2PTMA 1VBA2 5FUIA 5C9AB 2Q0AA 3MUZ1 4H3WA 1JYNA 4WZFA 5SV8A 4ASMB 4X6QB 2WO2A 1W3VA 2ORXA 5JZGC 1QHDA 3VDDC 1XRUA 3WDXA 3HIFA 3PVOA 3HBZA 3X29B 5IK7A 1O4ZA 1U5IA 4GA9A 5FZLA 4AQTA 3V0AA 1Z78A 3KCCA 1JYIA 1KJRA 2CGNA 5JI7A 5C9AA 4JGYA 5FXXA 4A41A 1NT0A 1IOAA 1ZRIA 2VNRA 1JN2P 1LOFC 2Y33A 1LOBA 2VCCA 4FPYA 3ZN6B 4DO0A 2VAUA 1GQPA 1QJX2 2XH6A 4N43C 2EIDA 1LGNA 5CB7A 3WG2A 2VZ3A 1VJ2A 2IWGB 4LNVA 4X8PA 3R6SA 4GJYA 2OUJA 2CAUA 2WQ4A 4CU9A 1PO21 3ZN6A 1N1VA 1B09A 5KR7A 3AP6A 4M3CE 3RRDA 2ORZA 5LRRA 4A44A 5E6HA 3LIGA 4W6XA 2D6NA 4AI3A 3U37A 3OPTA 4QX0A 1VB2A 1UU5A 4K9SA 2ZBJA 4RN5A 1VBA3 3WNPA 1AXZA 2L9LA 5F3CA 1ASJ1 1ULDA 1WMEA 1Y43B 1US2A 3DYPA 4K40A 4PQ9A 5L36A 5F37A 5EYYA 1SG3A 1CAXB 1Z7S2 2XJUA 4FO9A 4LBQD 4E2SA 3WNMA 3T2OA 5I93A 3KVAA 4HXCA 1LHWA 4FXGB 1R092 1UL9A 1VPHA 4ZY9A 1O7FA 4NIIA 3FUQA 5FMOL 1IG3A 1CAXA 1CQ9A 4AHWA 4NJ4A 4AHZA 3IM0A 4NWWA 3NKTA 5AC92 1VMHA 4MOAA 1F35A 1OQEA 2DCYA 1AR91 2J1RA 3O1TA 2WT2A 2ADEA 1CIWA 1F5JA 1LU1A 1XOYA 3ITQA 3SEPA 5DG2A 1W8FA 4BK4A 5C3SA 1PNGA 1SCSA 1GSLA 5CNAA 4ZU4A 1RUD3 4NWVA 2FCTA 3UGFA 4COVA 2D7FA 4AEMA 4E27A 1HQNA 1PMHX 1AR83 5LASA 1KDMA 1SMVA 4AK3A 4NO4A 3HOBA 5JXGA 4QGNA 1GOFA 1UD1A 2BFUS 3KMHA 2DBNA 3S7IA 2ATFA 4FPOB 1A8MA 1JOBA 1RUJ1 1JZ3A 2WZEA 4BISA 4HPKB 3IB3A 4HKLA 2EAKA 4WM8B 2RJLA 4Q0QA 4CEYC 3OD4A 1UMIA 2ZTNA 3GCXA 2WSUA 4GB31 3Q8CA 3KT1A 4LHSA 3PJQA 5AC93 1W8UA 5FP3A 1VMJA 4P5HA 4DY5A 1OVSA 4LOSA 3ZN5A 1OHFA 4A42A 1UOJA 5T5JA 4BLJA 4XDQA 2E7TA 2FQPA 1BJQA 3B69A 4P00B 1JZ6A 5EIYB 4RQPB 2W3JA 2G4IA 1DGWA 1ZZ7A 1MS1A 2EXKA 2XL7A 4OUMA 1NCQB 4KWKA 2RM22 3H50A 3RZZA 1N3OA 2VZSA 3EB7A 1B35C 4MUVA 2BWAA 4DEQA 3THCA 1QJY1 1HV1A 1YI7A 3LEIA 1AJOA 4Q1RA 2WZR3 4JTNA 2B45X 1AX2A 2VVFA 1LU2A 2XKPA 2LUWA 1QY4A 5FYCA 4Y33A 4RQPA 4Z07A 4XBLA 5ISLA 3IT8A 4JAAA 3FX3A 1NCQA 5EV7A 2TEPA 1V6MA 5FZHA 4YM0A 3VDDA 3ZXKA 5JZGA 1AR63 4N43B 2C24A 5FZOB 5EJ3A 1EV12 2TNFA 3IAPA 2V5YA 2XQRA 1OC1A 1HQLA 4CUGA 3ZIWA 1V6OA 2BTVC 1WCSA 1YJKA 3EXUA 1BKZA 4N43A 4HMZA 5FZOA 1OUSA 3PNAA 1I5ZA 3LDKA 3O14A 5IK8A 2D6LX 4K21A 5FY5A 2J22A 3NV4A 3ZXJA 5JDBA 3I3MA 5FKCA 1EPZA 4AWDA 4OMDA 3NQHA 4PBOA 4Y1YA 3UV9A 3MFCA 1JZ4A 2XHNA 2R0FA 4QX3A 1SPPB 3O12A 2PHXA 2XVLA 3QOPA 1UZ0A 3MV11 4L97A 4QGLA 2ZZQA 5F5CA 3PUSA 4NIAA 3HQRA 3LQCA 2HBUA 4R8HA 3DCQA 2E26A 1C5IA 4UBGA 5CZKA 1W8TA 3OPWA 2BWCA 1ZRRA 2VL4A 1SDWA 4CP2A 1V6NA 4COWA 2XWJB 3WUCA 1T6GC 1SPPA 5KC5A 3MW2A 2A3WA 4FPJA 3A0NA 2UURA 2ZKNA 1M4WA 3SH3A 5FWJA 1OA3A 2QE3A 1EV13 4K1ZA 2IXIA 4IE6A 4V1PA 5F9TA 2NPIA 1HB1A 5LWBA 3JBG1 1W0NA 4OHWA 1PO22 2V5DA 1QOTA 5IWFA 4XTMA 1HQWA 1PGW1 1H2NA 2O0OA 4BJ0A 2OVUA 1UYPA 2XBO1 1H4GA 1QJU3 5KHHA 3I7DA 3GZEA 5T5PA 1VBE1 4AFAA 3E5XA 1F8VA 4P9YA 4NUBA 4P02B 5F5AA 4DRRA 4R4ZA 2Y6FA 1NAEA 4R9DA 1FYUA 4AVVA 4QQLA 4SBVA 1PK6C 4QX5A 4U2AA 3TEXA 1XJAA 1VB4A 2E51A 4K8RB 4XCBA 2RS51 2EA7A 2UY8A 5FYMA 4CPBD 4AVTA 3OUIA 5A3UA 3POIA 1SBEA 4IESA 5FZ1A 3B9IA 2PAKA 2WN2A 4N8MA 4IW3A 4GH4B 3GYDA 2GNBA 2QNKA 1W03A 1OUXA 2BP6A 2ERFA 2Z5WA 3DKWA 4S2GA 4Z82A 5FPBA 5ABJC 2YBPA 1V6IA 1X8MA 4CEYB 2RS31 3BCWA 1EAH2 4C90A 3E97A 2ZGSA 2AEYA 3J26N 5JUVA 1S55A 1SLAA 2EIGA 5F2WA 4CDWB 1AR92 1CD3G 3W21A 1KFXL 1YIFA 2DUOA 3Q9OA 1ENQA 2VOXA 4LO4B 2DVDA 2ZX3A 1KRIA 1YI9A 1HKDA 2WNOA 4CEYA 1AF9A 1JS9A 1WW6A 4KQ7A 5K0UB 1OSGA 1SLIA 3ZFEC 4KH9A 4LBOA 3ZYPA 1LOCA 4AVCA 1XQNA 1D0HA 3AYAA 4JKKA 4N7IA 5SV5A 1VBD1 3M1HA 1B35B 4Q4X3 4WZCA 5FZIA 4EQVA 3AKSA 2GH2A 2HYXA 3MW4A 5L73A 3RVHA 3LF7A 5K8SA 4RHV3 4LPLA 5J7MA 1UY1A 1RUJ2 1WCKA 1O3RA 5J37A 1VP6A 2XQXA 3USUB 2BVVA 3MFAA 3KHBA 3FBMA 3PLQA 2ZMKA 2X5IC 2KR2A 5JAXA 3ZYBA 1B35A 1GP6A 2BGPA 1W6NA 1VBC3 3D8CA 3WG3A 2WWJA 1ZBE1 3O0WA 1DDLA 2E53A 2BDRA 3PIJA 1IQDC 1OLRA 4GB32 5K9YA 1EAH3 2HWB2 4ZONA 2QQIA 5LEJA 3GBFA 1O91A 4UFIA 2PAEA 2Y26A 1VBB1 4JDOA 4C1WA 4IE5A 3INAA 1GYKA 2E63A 3LB9A 4M4PA 1S0IA 5KXBA 1FV2A 3BTZA 4MHRA 1RTVA 4MHUA 3USUA 2YG0A 3U14A 3RZHA 1LNSA 4UFJA 5IK5A 3ZSKA 2YV8A 3F2ZA 2FDKA 5FXZA 3ZYGA 2XJPA 4RS5B 4DINB 4E2QA 4YM1A 3PJYA 4TSVA 3EHKA 1PX4A 1H8TC 5JOZA 2P3IA 4NPLA 5FYUA 5GKAC 2DWRA 3DL3A 1QJY2 4Y5TA 3OUJA 2PMWB 2AZ5A 3K4DA 1QEXA 4RS5A 4Y1XA 3CO2A 2PHLA 2YY1A 4IGQA 4TN7A 4Z2WA 1J1LA 5FYSA 1W2AX 4I3PA 4R9AA 1HB4A 1PZ9A 3GXUA 1J1TA 1AJKA 2A3YA 5FPUA 4G4FA 5F1RA 5KXDA 5DAVA 3POWA 4XF9A 2MNGA 1BMV1 2DTYA 5A6YA 1LR5A 3UJQA 4LE4A 4PDWC 2WA4A 3C7EA 1WKYA 2HWB3 2GMEA 4IV3B 4JGZB 5T3NA 5BNNC 1RUH1 5LBCA 2HWD1 3WNOA 1LB2A 3KV4A 1HRI3 3OGRA 4XFIA 5C6CA 5F7UA 1XE7A 2VCMA 4IUGA 3IMMA 4OI2A 5FOJB 2W39A 4K8FA 4LHNA 1Y9GA 1YQ2A 4EN0A 4Q8LA 1DGRN 1OH4A 4LBJA 4HT1T 1GQGA 3FFZA 3R4SA 2BW8A 4JGZA 4TLGA 1HW5A 1PK6B 4Y20B 3S7EA 3ZR6A 1H2LA 1CESA 1IGOA 1WBFA 2QQVA 5L19A 3AXDA 3IPVB 2ZKLA 4EE2A 3MW3A 3OBZA 2NLRA 4ZXEA 1GWLA 4MGYE 5A3TA 4W6WA 5CVRA 3VZKA 3WEZA 4FBFA 5CFDC 2VGDA 5C71A 5ABJB 5FAXA 1G9CA 2FBEA 4KG0A 4HVOA 2JENA 1CR7A 1PK6A 2A6YA 2WZ8A 4Y20A 5I8SA 5HCFA 1WBLA 2JECA 2TBVA 3GJBA 3I2IA 2ZXQA 4IGPA 5DAPA 1DQ6A 3W58A 4XZPA 2FDJA 3VD7A 5KHKA 4FPHA 3JBG2 1SDDB 2I45A 2VZVA 3CZUA 4HBNA 4Q4V3 5JXHA 3BIEA 2Q1MA 3S30A 4IV1C 1PGW2 4CCKA 5ABJA 2XBO2 4D7TA 3PTYA 1GP4A 1ZM1A 2QCSB 5EFUA 1VBE2 3WDYA 5G05L 2XJTA 3FMGA 1FNZA 1Q56A 4HLTA 3BUCA 4XE9A 5FKBA 4YZ3A 3ZFEB 4BQ5A 1ODMA 5JWPA 5FK8A 1SBFA 3CZJA 1OF4A 1NE6A 4R52A 5HCHA 4L9BA 3DKQA 4XQDA 3SMHA 4NRPA 5BNPC 4TLFA 1CPNA 1AR73 1UZVA 4LBQB 4MGZE 3PUAA 4OCTA 3H42B 4LT5A 4J1WA 2VMEA 1BEV3 1ZZ6A 2ZEZA 3ZFEA 3V0BB 3NJYA 3N35A 1T2XA 4CCDA 3WG4A 4P9WA 1CZVA 2RS32 5DN2A 4AI1A 4XHBA 5T5OA 1W99A 2Z79A 1QDOA 3ORJA 1Q5OA 4LBQA 2NP0A 1RMU1 4ZU7A 1W2NA 1ZREA 4P9XA 3S57A 5A3WA 4OUSA 2VMDA 2A6XA 3JZVA 1MVEA 3V0BA 2PHWA 3JBG3 4HK9A 3NNLA 1W9YA 3BOPA 4HKWA 4A6OA 3P3NA 1OLME 3IIIA 4FTEA 4Q4Y1 2CGOA 2W9XA 3CJXA 3LEKA 1VBE3 5CA6A 3FC0A 1FAYA 1DGWX 3GZUC 4QXCA 1RUI1 2QQNA 4IXLA 2YMZA 4LMFA 4YW5A 3KV9A 1WD4A 4I0AA 4AFDA 3DF0A 1AX0A 1VBD2 5GJ6A 1GBGA 2GH8A 4JKLA 4FXKB 4CDQB 1TEIA 2EXJA 2P6HA 4P14A 4AVBA 3BU0A 1C8M3 4D6RA 5C8CB 3C2UA 4CXYA 3H1YA 5C3RA 3DXUA 1H8TA 2A7AA 4M01A 4A2UA 3ME2A 3AZWA 4DXRA 1VALA 3DEMA 3MIBA 5FZMA 1R1A1 5C7GA 1HB2A 3I2GA 3NNJA 1MPXA 4XAEA 1ZBE2 3ENRA 4CDQA 5GALA 1LTEA 5FRAA 1OA2A 4XIKA 3RWNA 1RIRA 1E57A 2WS91 1VBB2 4PDWB 5C8CA 3WDWA 1ENXA 1PGSA 3BTYA 3O1VA 1JU4A 1PO11 3J7NA 4CCJA 5KHJA 2VOTA 4XUTA 3LFMA 2VOWA 4JHZA 2W91A 1O8PA 4ORFA 3RQ0A 2WIIB 5GM0A 4DIQA 3M3QA 4DUVA 4AAPA 4XXPA 1DBNA 4NR1A 3BPSA 5JR2A 2P1BA 4GMP0 1WGPA 4PDWA 4QDSA 5DUUA 5BNNA 2K9ZA 2AGSA 1HDKA 2UYAA 1UY3A 4X8NA 1NXMA 1DGRA 2HJIA 5A7WB 3M3OA 5C3QA 2JDKA 1HJFA 3I2OA 3BPZA 3JUUA 5CIRA 5F8PA 5CFDB 3U4XA 3ZR5A 1RUC3 3A0KA 4ASLA 3A7QA 5F3IA 3B02A 2Y60A 1RB8G 1Y9QA 3OJBA 4HN0A 4QX1A 1BMV2 2HH9A 4MGIE 1ND3C 2WQZC 5LA1A 3N7KA 4KMQA 3KM5A 1N3PA 4LKFA 2VMFA 2YFUA 5A7WA 2PHDA 3B3QE 4BOWA 4KBBA 5I91A 3T3YA 1RUH2 2HWD2 3DXTA 5CFDA 4IV1B 3HQUA 4L0PA 2VZOA 3VD3A 4B4PA 1YYNA 5JXJA 3P3PA 2XUEA 4UI9L 2DCKA 4IE0A 3SCGA 3TN93 2W1QA 1VRBA 5H9PA 2B39A 4IERA 5L9RA 3W59A 1RXFA 4LO8A 4YFZA 4XFGA 1WCQA 4IV1A 3LPGA 4K1YA 5EHDA 2F4LA 2CNAA 3SXWA 3H0OA 4TYSA 4A45A 2HWC1 3O0VA 4DPNA 3WZ1A 3K51A 3PL0A 4I01A 2EICA 4CRQA 1R083 5FO8B 1RUD1 3TEZA 1N1YA 2VZRA 3ECQA 3DYOA 5D1IA 4E2GA 1PX3A 4MXVA 4WBBA 1CGPA 3WR0A 5T50A 4BE3A 3TOJA 1Y4WA 1AR81 4QB2A 5L7OB 5HPOA 1ULGA 2PFWA 2A75A 1E5IA 4IETA 3ASIA 1UYZA 4PIZA 5A6XA 2H6CA 2AR6A 2XVKA 1RC6A 1RUH3 2HWD3 2W94A 3S0MA 3DPRC 4HSLA 4Y5Z0 3SCFA 4LORA 2FDIA 2PN5A 2DYCA 2NMNA 1APNA 2IXHA 4WV8A 2GALA 1Q8QA 2OZJA 4AQ6A 2ZGUA 1OF3A 4PT6A 2OXBA 4PLNA 3MLJA 2IXKA 2LALA 1AYM3 3OEBA 1W6QA 1ZNPA 4NPRA 5L7OA 3ZXAC 3VBFB 4QQ2A 1COV3 1DQ1A 1SCRA 1QJZA 3JQWA 1BVVA 3AXEA 3DUIA 1NOVA 3BALA 4HSJA 1IS6A 4Q0VA 4IEWA 1CZTA 3WF2A 1QH7A 1H2MA 3MV01 3AVRA 2V73A 2ZHMA 1LKNA 2G9ZA 1NA1C 4J1XA 3WD5A 4QQOA 1C3HA 1ULPA 5I0DA 3VBFA 2Y6GA 5GZGA 3T1LA 2PQSA 5IATA 1H9WA 5T5LA 3CF6E 2FDFA 4KBZA 2QDRA 5AVPA 2R043 2F6BA 2IC1A 1XYPA 2GSYA 2WINB 4QKNA 4Q0PA 5FYVA 2PLV3 5GLUA 2VVEA 3D4KA 4CDXB 2VMIA 2DUPA 3VLBB 2WZR1 1GICA 3N9QA 5E16A 4CPBA 1H9PA 2YBKA 1OPMA 2UY9A 3VBUC 1VAVA 3H8OA 3PMSA 2OZ6A 1W9TA 4Q1PA 2P17A 3AKRA 4YZ2A 3W5MA 5FP8A 3THTA 3ZSEA 3S5AA 3WP5A 1RUOA 4Q4Y2 2DCZA 3NMBA 4WVZA 2BV4A 3MF9A 2YPDA 4PJYA 4CDXA 1AR61 5EYXA 4Z92B 1WWYA 4QQPA 1RUI2 5EQUA 2JWPA 3URFA 4GKXA 1PVC2 2JDHA 1DG6A 3ACLA 4OHYA 2WWUA 1PGL1 4JDMA 1L7QA 4KI5M 5ERLA 3WCSA 5FPZA 3RSJA 4I30A 5J96B 2RDNA 2VQ0A 2ZZJA 2RS11 4D7YA 1KS5A 1MZFA 4ZZ8A 2HYKA 3E6DA 4AXOA 3RMXA 1O59A 4L2NA 2W1UA 1R1A2 2ZGPA 4B8EA 4B4QA 1W05A 3VKOA 1J3PA 4PLMA 4AOCA 1WZXA 4AG4A 2O8OA 1UPSA 3K77A 2WS92 4N53C 4XIOA 3S5QA 3ZYRA 3ACHA 2J1TA 4UFLA 4BM8A 1LOGA 1NCRC 1PO12 1S2KA 3J7MA 3OOXA 4N9HA 1H1MA 1RUF3 1TQ5A 1CJPA 1FXZA 2H0VA 4AI0A 1IS5A 1BLZA 3T4VA 2IXCA 2YU2A 3HNYM 3A23A 4AL9A 3BTXA 4D7SA 4PIYA 3LOIA 2W68A 2XWBB 1X36A 4XQ4A 2BEOA 1PVC3 1U5ZA 2HWF1 5LZ6A 1KITA 1MEC2 3R05A 4XVHA 1VRH3 3AMMA 4YW7A 1DLCA 1UX7A 1RHI3 2VJXA 5FIXA 2CWSA 1QJU1 2WQ8A 3GHMA 3M4FA 4K20A 4D6SA 3H7JA 1O5LA 5D2AA 5LBEA 3U78A 4GQ7A 4JGYB 2XB6C 4FCAA 4YRDA 1URXA 1R1A3 5GLZA 3O1RA 4M0HA 1Q8PA 4UF0B 2ZMLA 1SBDA 5FZDA 1JOPA 1QF3A 4YYOA 3ZYIB 4D3WA 1PM4A 3WW2A 3NAPB 2WS93 4RGGA 2R32A 5KWRA 2Y6LA 1HXS3 5F3GA 5HV0A 2D98A 1PO13 2J1EA 3THPA 3ZO0B 4YWAA 1QOOA 2IVJA 3EYPA 3AKTA 5A3OA 4UF0A 4YZ4A 1NLSA 2DU1A 2LM3A 2WJSA 3ACGA 4RGAA 3C7HA 3UESA 3CBNA 1QWRA 4LBLA 1Y7BA 3NAPA 2QQJA 4OI4A 5B4NA 1RUE3 2YYOA 1W2OA 5L9BA 4XJ9A 2VNOA 3KF5A 1S0DA 5FDBA 4XF1A 1MEC3 3DPRA 4WM7B 2VXRA 1XE0A 1ODNA 2UU8A 2HWC2 2R0HA 1YNAA 4OLLA 1NE4A 1UX6A 1MZ5A 2NN8A 2B4KA 1SFNA 2R063 4ISRA 4COZA 1RUD2 1RITA 4LK6A 3MLLA 1UYXA 4AEDB 1AL0G 2VMGA 1WLDA 3S6PA 3O5SA 4WM7A 1ZZ9A 1AR82 2R073 5BYNA 4Q4X1 1YLLA 2Q8CA 4Y24A 3IWZA 5B4XA 1JXNA 3MPBA 4J6GA 2OT7A 5J3UA 4RHV1 1HV0A 4EROA 1VMFA 2JDAA 1PIV2 2JG8C 2OX0A 2ZGNA 2DCJA 3Q8BA 5F3EA 2CV6A 5A80A 3SKJE 4AEDA 5FY7A 1YQCA 1STMA 1W90A 4NHMA 4PHZA 4BHPA 1RYYA 3HAGA 3N7MA 3VB9A 2GN3A 5HCAA 1HLCA 5H9RA 1DQ4A 1VBC1 5DABA 2H6BA 1QXPA 2C4XA 1EAH1 2W52A 3AB0A 3FUOA 2AEZA 3RPQA 1V6JA 2HEVF 2VCAA 4C8DA 4EWDA 4FPEA 4ES8A 1LHNA 5BNOB 2K46A 2J1UA 2HWC3 5FZ7A 3T2TA 3OD0A 5LY1A 1DZTA 4LTAA 5LA2A 3LDRA 2KA3A 1JTZX 3ZPOA 3BYWA 4OVEA 4P9GA 3RYKA 3N9LA 4JV4A 1YFUA 3C7FA 4B7KA 2XLFA 2VMHA 1S0BA 5FTTC 3MPPG 5BNOA 4ES9A 2WZR2 3WNNA 1BBT3 3HT1A 4RR3B 1N1TA 3RZLA 3WT3A 1U5YA 2UYBA 1NCRB 1YIPA 4LO7A 5C4WC 4UAPA 2FZ2A 4IEYA 4GULA 1PIV3 2Q8EA 1RUG2 1AR62 2ZCWA 4FOVA 1JBCA 4N53A 3HNBM 1PGL2 4RR3A 3TYJA 2ZACA 1KXGA 1NCRA 2BBAA 3T1MA 2HWB1 3ROUA 4R9CA 4KNCA 1UIKA 4EWEA 2RS12 4BQ2A 1HRI1 4X6RB 3SHRA 1QIQA 4RL7A 4N90A 1UZZA 3VZJA 5GZFA 4FQ4A 4EN6B 2FD8A 4MXWB 1OOPC 4QQHA 5G04L 4W4ZA 5JSOA 4AE2A 4E4HA 3G7DA 1C8NA 1DZRA 3ES4A 2EIEA 1LHVA 1GZWB 2IXLA 2XJRA 3VDDB 5JZGB 2CSGA 1UIJA 1CPMA 1UN1A 2AYHA 4BWOA 2VH9A 3LWCA 2ADDA 3OEAA 4AYUA 1W8ZA 2ENRA 3WQ1A 3AKQA 1JZ5A 1YC61 2ZA9A 2AENA 3N9PA 2YU1A 4MXWA 2A3XA 2W46A 1ALYA 3PVEA 3WP4A 1JYVA 1GZWA 5IAVA 1LESA 2PHRA 1RUG3 1BK0A 1FNYA 4XACA 4E8CA 2WNEA 2HWF2 4A7ZA 3FLRA 4RFT0 3ZMNA 4Z1VA 1DHKB 5FZEA 4YGEA 1JZ2A 3WP3A 5J48A 3KV6A 4ATEA 4YW3A 4Q4V1 1JH5A 1HN1A 3HD8B 1KJLA 3POJA 1LOFA 5FZ6A 2ZAHA 1UNBA 1X9TA 1I5PA 2SBAA 4OHVA 1QJU2 3BIWE 2RS13 4NMIA 5F39A 2E6VA 3KLSA 2Y38A 3FBYA 2NZ9A 5A7NA 3A4UA 2C5DA 1IKPA 4LO5B 4LO6B 2BFUL 1XBFA 4I09A 4XJZA 3RG0A 2ZABA 3AZZA 3ZXDA 3UGHA 3AFGA 1R64A 3ACIA 3E5UA 3VZOA 3T4HB 2VCBA 1YRZA 2RDRA 1KEXA 1QXJA 4F3JA 5H9QA 3AP4A 3EQEA 1AR71 2VBBA 1Y9MA 3NRUA 1I3HA 1G9DA 2W92A 1BEV1 1XYOA 5A7OA 4FFIA 3GGLA 1YQ5A 5IJRA 1F31A 4U36A 2YC2A 5EZWA 1NQJA 1ULCA 5A7PA 4ITCA 2ZGLA 1YWKA 5FYYA 1D4M2 3Q8AA 4CXXA 4ZS2A 2HWF3 1KS4A 3FL7A 2JG8A 1MZ6A 4MSVA 4XMIA 3UYJA 4CCMA 4KWJA 1VR3A 3T2QA 1VLNA 3LEGA 3ZLIA 1BCXA 2ZPXA 2YZ4A 3AM2A 5LK7B 1O3SA 2QFEA 5FPXA 3K2OA 5DZGA 1C4RA 2DV9A 2MPFA 1QOSA 1YCIA 5F5QA 3ACFA 4H2AA 2X8KA 4YLZA 4Q4X2 5FY1A 5FYIA 1K5MC 4XPVA 1MACA 1OFNA 4KGGA 1WCDJ 2X53S 4QPYA 4BQYA 3GZTB 5LBFA 1XXNA 1SEFA 4NOTA 4XJWA 4YPJA 5GLVA 1C8M1 4RHV2 3VBOC 4DUXA 4I0WB 2XONA 3D3AA 3L2YA 1A34A 5FREA 1YFXA 2I07B 4PF5A 5CYYA 4LIVA 1ZX5A 3LSEA 1FX5A 3ZXFA 1MS3A 3ZDSA 4L99A 2GP3A 2XMLA 1VBC2 3B7MA 4XYXA 4A3XA 3O1OA 1PHMA 1OPOA 3I2JA 3CKHA 4HONA 3QCWA 3OUHA 4MGQA 2V4VA 3RJ2X 2CU5A 2WYSA 1D4M3 3PVNA 4QPIC 4LEJA 4DOUA 1ZZ8A 4PIXA 1QDCA 2OQ7A 2VTXJ 5BXXA 3V64A 1QKQA 3POEA 3SQOA 5FQ0B 4BIOA 3ZOIA 1DGLA 2YB7A 2BBVA 2C9KA 2IXJA 1W2TA 2F17A 1JUIA 2YGMA 3BVCA 5DQ0A 3HWJA 1G7YA 1PNFA 2D44A 5KXCA 1SFPA 2EALA 3ATGA 1NX9A 5JCTA 2W5FA 2E7AA 3N3HA 1VE0A 2ZGOA 2MHFA 3PUHA 1W6NB 1ST8A 2DFCA 5FQ0A 3WDTA 4ZHNA 3U4SA 1TME2 2VBPA 5FYHA 3K4AA 4BQWA 1AXKA 1RUC1 2ZEYA 4Y1UA 2OKXA 5A6QA 2ZMNA 2BQPA 1LENA 2E33A 5E1RA 2AC1A 5F5IA 3WSOA 4YFWA 3WW4A 4WVMB 3ZN4A 4CVUA 2RV9A 3I2KA 2A1XA 3M8LA 1G9FA 1GU3A 3MIGA 4F7ZA 5FUPA 2ZX4A 4XBQA 1PVXA 2JICA 4B4RA 2WDBA 1HRI2 3HJRA 4LITA 1X9PA 1HRV1 3OG2A 4E8DA 2Y64A 1I9RA 2PQQA 4WVMA 3KQ4B 2NQYA 3VKFC 3TN91 4EN7B 5FYBA 3GBGA 3B94A 5DAQA 5ACA1 2OYZA 2V09A 4BMBA 2JG9C 5I0RA 2JD4A 5FXWA 5FLHA 1YJLA 1XYNA 4M3CB 4XMAA 3MGUA 2ZGMA 4G9SB 4L8QA 4AFMA 1JODA 3RZJA 3ZKUA 4YARA 5A1FA 3ETQA 3NNGA 3UJOA 1O4TA 1R081 1TME3 2JKXA 4PBPA 2PXJA 4JCKA 1ULFA 2RMU3 5JOYA 3L9JT 4GWMA 1BHGA 3UKNA 4B29A 3ALQA 4M3CA 2VVDA 3KT7A 1RXGA 4C1XA 1DU3D 3KHCA 4YVWC 5JR7B 2PAMA 3KGZA 1Q8VA 4Q4V2 4MVTA 1POV0 2FZ1A 1UY2A 1RGSA 3KV5A 1OH3A 2G1MA 2RG4A 4XJAA 5A1AA 4JX0A 3C7GA 5T52A 3T0AA 2DU0A 4OQ8A 3GZAA 5JXIA 1LODA 1BVP1 4IEXA 1AYM1 1UF2C 1SLTA 4Y4YA 4ARYA 3O1MA 5H9SA 2GMMA 2VU9A 1COV1 2B5HA 4O9EA 4E9KA 3J7HA 1K5MB 4K3UA 1IPSA 4YVSC 1J3QA 1AR72 5FZBA 2WFPA 1AYN2 5FYZA 1LGBA 2A5ZA 1DQ5A 1BEV2 1LOAA 5J1XA 3E6CC 1L7RA 2CHHA 5FY8A 1L7LA 2JIJA 2WO3A 5KC6A 3VL8A 4QPGC 2R041 1K5MA 4JTOA 3I59B 4N9IA 2RE9A 4RFRB 4BA6A 1S0GA 2PHTA 2KXLA 2PLV1 4OI1A 3VBOA 1U12A 1S2EA 4XEZA 4QAWA 2VW0A 1LJ7A 3OF1A 3P6BA 4E4DX 3ZIXA 1DYKA 4AQ2A 3MLKA 1ACCA 3DGTA 4QPIB 3R4DB 5CU1A 1H6YA 5I0TA 4OZXA 2Z2SB 2WNUC 3I59A 3WNXA 2DURA 4JZRA 5BPXA 2WN3A 3ETPA 3OPZA 5DUVA 3DECA 2G9GA 2Y0IA 3BB6A 5FBZA 5TSWA 4OUEA 4QPIA 2DUQA 4BDVB 4FT8A 1V70A 3NO8A 2QQWA 2WWSA 2VZUA 4YGBA 5FZGA 1C8M2 1JYCA 1LRHA 4BIFA 3KB5A 1RUNA 3VDAA 1AYN3 3NNMA 3HMYA 5DAWA 2WUHA 4K7JA 4CDUC 2DVAA 4A4AA 4MGSA 4Y26A 5FZ4A 4OHXA 1W39A 1FATA 2QTWB 2X5IB 4YW2A 5CFCC 1G9AA 4Y1ZA 2Y0OA 1OKQA 3CLPA 1JI6A 1AZDA 1X8EA 4Y22B 5FZCA 3I2FA 3I3QA 5IT6A 3APBA 2DFBA 1JOJA 2QVSB 1LECA 5DUWA 3PURA 2WZPP 1JHJA 3I8TA 4LLFA 1RUF1 2XJSA 5JOXA 3OYWB 4RGKA 2VXJA 4XUQA 1K45A 1QNYA 5A7SA 2X5IA 4CCNA 5KHIA 3AP5A 1PM7A 1U5XA 4FAGA 5IVVA 4Y22A 4Y4RA 5LB6A 1J83A 1H8TB 2QJVA 3C3VA 1PVC1 4OZOA 2XJQA 1VRH1 3NWKA 4AEKA 4NE9A 4AFCA 3PU3A 4FAHA 4GAZA 3OYWA 5FZKA 5FLJA 1WW5A 1RHI1 4YG6A 2VUAA 3OY8B 3R4UA 4B1MA 2R49A 3J4UH 4AGRA 3FWEA 4A7YA 1RJ7A 5CKMA 3SEEA 4D0QA 2DVFA 5T55A 1QGLA 1RUC2 2D3RA 1ZVFA 1PMIA 2I74A 3WW1A 1YEWA 4MADA 4Q8KA 2OPKA 4ISQA 3H9AA 1SZBA 2LTNA 3POBA 3ZFGC 4CCOA 4Y3OA 4INDA 2CAVA 4YVWB 5C3PA 2QZ3A 3OY8A 2VNGA 3AL6A 3AL5A 4H14A 1OXCA 1HXS1 2VZQA 3NV3A 3LGRA 5J98B 1Q3EA 2ZHKA 3HEIA 4CDUA 3F95A 1DIWA 5BNNB 1HRV2 4QHZA 4W6YA 1K3IA 4WVVA 2D6OX 4HK8A 4F8AA 1ZRDA 3SITA 4NHKA 2FMYA 3THDA 3WNKA 1JYXA 4NIHA 3QBQA 4Y1VA 3VHRA 1C1FA 2XDVA 2UWCA 3TN92 1GR3A 3LEMA 4DQAA 4YM2A 4NVPA 2OUHA 3NV2A 5LATA 4YVWA 4ZZ5A 1I1EA 4OYUA 4B1LA 5A3NA 5ACA2 1RUE1 2FDHA 3B5LB 2I2SA 4JQTA 2CYFA 4QU2A 3VL9A 4QM8A 1KD7A 4S2FA 1MEC1 1NKGA 2A70A 2CGPA 1OFSA 2UWAA 1YFYA 4O65A 2DF7A 4JRAA 2R061 1R082 1UWWA 4JHTA 2CDOA 2QBXA 5FPLA 4CCCA 2QQUA 4CXWA 2B7YA 2FHRA 5CBLA 3KD4A 4EZ4A 3POGA 2P2KA 2GAUA 3AKPA 4KU8A 5HXMA 1W9WA 2R071 2Y6JA 4E4ZA 5C70A 2AUYA 2GP5A 1D2SA 3AYCA 2K0GA 2ZHNA 3DYMA 1NLQA 3KF3A 4HETA 5FMDA 4O7XA 3T09A 5DMYA 4S2HA 2BERA 4LULA 3WDUA 2VPVA 1MR5A 3SCHA 3SISA 2A6ZA 2A6VA 3ES1A 1Q43A 3VHPA 1EP0A 1WA4A 2AACA 1HRV3 5ANNA 4YZ5A 3ELNA 1JYWA 2PELA 1FOD2 2WNUB 2JE9A 3GNEA 3ZMOA 5DZEA 1AYM2 2Z42A 3WV6A 1GP5A 1UXZA 4CEWC 3GF6A 5FCCA 5JIUA 3U1XA 1OD3A 5FJHA 4BXSV 1COV2 1QJEA 5ACA3 5CAZA 3HN1A 2Q1ZB 3UKTA 1MQTC 4ZU5A 3ILFA 4ZXKA 5LBBA 2E32A 2BNOA 5BNPB 2ZX0A 3M3CA 1YXWA 2WNUA 2O8QA 1Z0HA 2J42A 2C6SA 4TXWA 3WCRA 3LIHA 2AREA 2XPJA 2CWMA 4LA3A 2JDUA 2V72A 1LAJA 3NJXA 1FT9A 4Q2FA 4XUNA 1MS5A 2VR4A 4ZS3A 3L2HA 2R042 4WVWA 4XJUA 2D5HA 2YUEA 4DZGA 4CU6A 3ZKYA 1F2NA 2IVIB 2PLV2 2YPJA 4R9BA 1J59A 5FZAA 5JOWA 4FOWA 5GLTA 5BNPA 2D3PA 1BBT1 1DCSA 1W6QB 2XR4A 5AFEA 4HFSA 2JE7A 4I3GA 3IDBB 2ZEXA 5IVFA 1YQ8A 3KVBA 5KHGA 3ZYFA 1PIV1 3MHZA 3NL1A 3LA2A 1W2UA 1FOD3 3I2HA 1OLQA 4FVVA 4DNYA 2WLPA 1ZRCA 4QHOA 4BXFA 4FPGA 4BB3A 4EV0A 3I49A 3J8F3 4NIGA 3UK9A 1Q8OA 4BH9A 1UAIA 3EO6A 1NXD1 3I3DA 3MIFA 1O3QA 5IK4A 2ZHLA 2P5BA 2QQLA 4RSUA 4AAXA 5EJZB 2JDZA 3QD6A 1MS9A 5FUNA 4PCRA 2VC9A 5JI9A 1MVQA 4FPKA 4LA2A 1ZBA3 3SNMA 1UU4A 1S0EA 3UL2A 1O6UA 2ETEA 1H1AA 5IFPA 1V9U2 4MO3M 1FPN2 2DVGA 4CU8A 3KWVA 1RUF2 5IW0A 3VDCA 3ZPYA 1W0PA 4EWAA 4XF3A 2QKDA 1OA4A 5A33B 5FOBB 5FWEA 3VZNA 1O8SA 4TTGA 5FZ8A 4Q4W3 1US3A 5APAA 5A1LA 2E7QA 5A3MA 4LBKA 2Z4FA 4CSWA 1RUG1 4LUMA 1I6XA 1U0AA 2YC0A 4UT5A 4MG2A 3OGSA 5JMOA 3ZFFC 1VRH2 2AH2A 5A33A 1LULA 4IEVA 4EJRA 3W5NA 1PZ7A 1JU3A 4V2VA 1RHI2 2PYTA 3RYRA 4YGDA 4EN8B 2JB8A 2VECA 4O9GA 3JB8A 4GZ9A 1SACA 2VY0A 3RWKX 3PDQA 1D7PM 3VKNA 2XUMA 5EWSA 3LCPA 1V00A 3CIHA 1H8VA 2Q8OA 3NVCA 4AVSA 1W9SA 1V0AA 4XUPA 1TE1B 4P9JA 4DRVA 3I2DA 1ND3B 3AMQA 2GDFA 3CDZB 1V9U3 1UXXX 2LRPA 1C5HA 1FPN3 1HXS2 1MS4A 1OI6A 2ARAA 2BU9A 2VUJA 3N9NA 2BNNA 3HPNA 5FPVA 4EN9B 1SQ4A 1OQ1A 5A7QA 1JHNA 4G3YC 5FY4A 5GZDA 1XNKA 4FPLA 5A32B 4OHZA 1M06G 1CN1A 4AGGA 2XHKA 1JZ8A 1KQRA 4ARXA 3LZZA 4QT6A 3SC7X 1UYYA 2JB4A 4XZUG 1BQPA 4CEWB 4UBHA 1ND3A 2VM9A 2WAOA 5E88A 1RUE2 4YG0A 3T08A 5FY0A 1A8DA 2Y6KA 3U11A 1C28A 2HWE1 5JPMB 3T2PA 1JZ7A 4CZSA 4JVAA 2Y8KA 3MICA 2WL1A 2GNTA 4YW4A 5FK7A 4QXHA 5A32A 3D6EA 1S0FA 3AP7A 2PHFA 2OIIA 5IVBA 2R062 3PTRB 4CEWA 1CZSA 4IEZA 4A3ZA 2R1BA 4AZZA 2WO7A 4I02A 3E5QA 5C33A 5LCWL 1IKQA 3PUIA 4Q27A 5D8AC 4HL0A 4CCLA 4LBNA 2R072 4QB6A 4H55A 4UW4A 3MDPA 4WM8C 1MS8A 1IZ3A 4AQSA 5A70A 4QWNA 2Q30A 2JX9A 3OCPA 3WG1A 4DFSA 3OGVA 3TAYA 3DPRB 4P5YA 2VULA 4FI9A 4D6QA 5FMOS 1X82A 1Y3TA 2VE1A 4UW5A 4YZ1A 5I8YA 5LEKA 1OURA 1G8WA 2GC2A 1A78A 4XABA 2NMOA 4CUBA 5DXDA 1WD3A 4DXTA 4BQXA 4GMP3 4GD4A 4RQPC 1J84A 5LY2A 1D4M1 2W95A 5DUXA 4IEQA 5A3PA 1NCQC 4BU2A 2ILMA 2NM1A 2UWBA 2W1WA 4GIQA 4H7LA 4BQ1A 1NA1B 1O3TA 2W08A 3WQ7A 3LOBA 1UKRA 2A6WA 2JE8A 2G9FA 1UW8A 3HQXA 4FPFA 4LR4A 1IS4A 1NYWA 3V56A 4CP0A 4CYDA 5EPAA 1BBT2 1OLMA 2W1SA 3W9AA 1WMDA 4AR2A 1IG0A 1NA1A 1H1IA 1WMXA 3K4ZA 3JD71 4XF4A 3VBUB 3TB0A 1UMZA 4Q5OA 3KCXA 1XNDA 2VO5A 4YW6A 2VOVA 2D6KA 1ULOA 1W28A 3ILRA 1H30A 3CQOA 1MS0A 1ZZCA 5C5TA 2W2IA 3TEWA 4KWUA 3ZFFB 1UMHA 2ZX1A 3U07A 1A3KA 3VBUA 3M3IA 1DLLA 3JQXA 2IFRA 3IKWA 3T0DA 2D5FA 4OMCA 2E9QA 1OD5A 2ARXA 2P6CA 3AP9A 4KG8A 3NW4A 1QU0A 3WUDA 3ZFFA 3GDBA 3KCYA 5HXVA 1ENSA 2TUNA 1GNYA 1LOEA 4LOTA 2X05A 1H0BA 4N53B 3RI8A 2ZOEB 1QJX3 5FZ3A 3JU9A 3FHAA 4AHYA 3NJVA 3IDCB 4XHXA 1CAWB 4HN1A 1W8NA 3H3ZA 1LCLA 3OTFA 4A7KA 1UZYA 1TME1 4C0BA 5BNQA 5IHRA 4I0BA 2RMU1 1OBNA 4M4RA 2GNMA 2VTXA 4R4XA 1TMF2 2RR11 1BZWA 4Q29A 1F4HA
chains in the Genus database with same CATH topology
4OFGA 4GXLA 3WHUA 4TWTA 3CJIC 4HZFA 1CAWA 3GBWA 1LEMA 2VW1A 2D6MA 4JRLA 1C57A 4W65A 5J09A 1Z7S3 4TZDA 1ENRA 4XILA 4L11A 3VBHC 4AW7A 1GKBA 2JJ6A 2WC2A 4UXAA 2WFF1 4IEPA 1XU1A 5K7PA 5D8AB 4Q0UA 1KFUL 4GH4C 1R093 2IFWA 1DF0A 1QQP1 5FO9B 3B93A 2EAAA 4B7EA 4CP1A 1GANA 4FOYA 3ZSLA 1N1SA 1W0OA 3POYA 3VGIA 1S2BA 4CDWC 2GC0A 5D8AA 2YDEA 5JSRA 1D0GA 4HPKA 4H7MA 2YHJA 3AZVA 1FV3A 4WM8A 1TMF3 2YXSA 4MYEA 1ZZBA 2HWE2 4JC1A 4MLOA 1LHUA 5K0UC 3VHNA 1Q8SA 4XFCA 3R0RA 4AFBA 1VAKA 3GHNA 5EXOA 2XVGA 3FFQA 4BLIA 1H2KA 2HEWF 3B01A 3PHMA 4M00A 1GNHA 1FMD2 2XL9A 4YW1A 5DZFA 3VKLA 1J58A 5T54A 2DVBA 1IPKA 4P9LA 3WP6A 5DDJ1 2YROA 1AYN1 1NY71 2JG8B 2RHPA 4AF9A 2H0BA 2D40A 1RJ8A 4LHKA 1A6CA 3U10A 2A71A 1ZYBA 1HIXA 3J9SA 4RS5C 3KT4A 3KZ4C 4IL7A 2HWE3 3RNSA 1HX6A 3AX4A 1GQHA 4KU7A 4XQWA 2YGLA 1N3QA 4BPZA 2RM23 4XF0A 3ZYJB 3M7AA 3FHIB 4S2DA 3WY6A 4P9IA 4C91A 4XFHA 3CU7A 1F9KA 4XTPA 4LE3A 3VUOA 1G86A 1FMD3 3JB4C 1SFYA 3IN9A 3U0ZA 4C0HA 3ST7A 3JD72 1CONA 1G9BA 5C4WB 4LLOA 4IV3C 4JGZC 2VQAA 2NYYA 5FLIA 4MH0E 3VZMA 3WQ0A 3VBSC 1SLBA 2GMPA 4XJ8A 4RA0A 1REFA 1W6MB 3CJIB 1REDA 1ASJ2 5C4WA 2BVBA 1IPJA 4Z8BA 4QGMA 4M3CF 4KWLA 4FTSA 5DG1A 2JEMA 2P3JA 2OA2A 3KGLA 3VBHB 1J3RA 1W6MA 1OOPB 3CJIA 4ONUA 1F5FA 2Q5TA 1AVBA 3AMPA 4COYA 3KQRA 2ZS6B 3MI8A 2HEYF 5BUVA 2DTWA 3RYPA 2Q4SA 3VBHA 3QH6A 1L3JA 1OOPA 3JD73 1ZA4A 2RMU2 2GC1A 1EY2A 2D3SA 1S0CA 3ZXEA 4A7ZA 4GH4A 3VV1A 5AFBA 1TNFA 4ZKTB 5JOXA 2RR12 1PO23 4NN0A 3TBDA 4DMIA 2WT0A 1JW6A 3VZLA 3POSA 4UW3A 4BMEA 2EXIA 3D0JA 5GZEA 1ASJ3 1LGCA 4CDWA 4I2OA 2BYVE 2K2SA 1IHMA 1ONAA 2ZGQA 1N47A 3ZX7A 3HR9A 1DQ0A 4BZ4A 1TNRA 1V6LA 2WFF2 2WKKA 5K0UA 5CG9A 1QQP2 3RI9A 2MEV1 4YG3A 2GU9A 2QZ2A 1AHSA 5KBFA 3WINE 1UKGA 4L92A 3RS6A 2VG9A 4GKYA 3BTAA 4D94A 1IS3A 4YSFA 5JSPA 1WW7A 1AR93 3H7YA 2RR13 4LUKA 1UPIA 2SLIA 1YFWA 4MX3A 1D4VB 2CTVA 1POV1 1CX4A 1X50A 4JDNA 4CDQC 4QXKA 4QMAA 1SLCA 4QM9A 3AJYA 1VAMA 3IBMA 1FOD1 3AMNA 3MEPA 3QLQA 5C8CC 2WFF3 2Z69A 5HI0A 1RUJ3 2BNMA 3J8F1 4KL1A 1WLWA 1X7NA 3NSTA 1QQP3 4B3NA 4YGCA 1AL21 5DDJ2 3VBOB 1NY72 1GFF2 1NQDA 4GB33 3RJRA 3TNPB 3IMNA 1QNWA 3N7JA 1ZBA1 3H1MA 3VBSB 1XNBA 1XU2A 3QACA 2B9UA 3OBRA 4XFBA 5F6LB 3MIHA 4NHLA 4DXZA 4XETA 4PLOA 4AI2A 2XLAA 3M2MA 4IV3A 5A3LA 4FQZA 4M0NA 4HKOA 4OULA 4Q4W1 3VBSA 1QJY3 1W6OB 1WMFA 4YM3A 4XW3A 2DCTA 4FP2A 5FFOC 2BPA2 4MV2A 1SLLA 3FLTA 3WOGA 2O1QA 2GN7A 3WHTA 3IPVA 2ES3A 3ZXLA 1GZCA 1W6OA 1X33A 2P3KA 4FP3A 2QQPA 5DDJ3 1QH6A 4GWNA 3USSA 3FZ3A 1ULEA 1MZEA 2KM2A 3WLUA 5B2GB 4ATFA 4XXAA 3D82A 1V9U1 1O4YA 3ILNA 4XFFA 4F83A 1FPN1 4AEJA 4Q26A 3NKGA 1QMJA 3DN7A 2WA3A 5E89A 2RS52 4QD2A 3PMEA 3O7OA 1O5UA 2JKBA 3WW3A 2C0ZA 3B00A 1YO8A 1C1LA 5I8TA 3M70A 3I54A 1RL3A 1FI2A 2JG9B 3H8UA 2B42B 3TWIA 5FO7B 3D0SA 3NJZA 5L7OC 4AI8A 1W6PB 4K6BA 1G6NA 3O0XA 1RVF1 3G6JB 4Q0SA 2P34A 3CEWA 2N7GA 4SLIA 3SLIA 4COUA 5KXEA 2JG9A 3WDVA 1OMIA 1RINA 2XBO3 5BV6A 2FMDA 2BUKA 3VBFC 4UW6A 1W6PA 4AHXA 2D6PA 2ZGTA 3WXPA 3MIEA 2P37A 3AJZA 1IQAA 3MYXA 3RDIA 1DYPA 4IQPA 2RS53 3CNAA 5CADA 3LA3A 1S0JA 4DB5A 4GMP1 2MEV2 4LHLA 3VN4A 4YVSB 1GV9A 4CDXC 2RS33 2C1FA 2C9AA 2B8MA 3H3UA 4GALA 1YUDA 1XE8A 5JPNB 4URTA 3CL1A 5F6KA 3ZXGA 4QPGB 2IZWA 1AX1A 5J36A 3NV1A 2ZX2A 4D69A 4YVSA 4MZUA 3BODA 3LAGA 1WLCA 5LK5A 5JIAA 1CJDA 1PZ8A 1VBD3 2ARBA 4QPGA 4FPCA 3AYEA 1BXHA 1ND2C 2WNVC 3J8F2 1VBA1 3VBRC 5GLWA 5I0UA 2X29A 2MEV3 1GZ9A 1AL22 3KS7A 2GC3A 2RJKA 1ZRFA 2EXHA 2VOKA 1ZBE3 3ZSJA 1VIWB 1GLHA 1VBB3 1LEDA 3HT2A 4CDUB 2D93A 1OQDA 1ZBA2 2F4PA 1S1AA 2GZWA 3TRSB 5CG8A 5CFCB 3ZSMA 1GNZA 2WLQA 1QJX1 1NG0A 3SH5A 2JXAA 3VHOA 4YNIA 4FOQA 2R16A 2D97A 3AMHA 3LA7A 4CDUA 1POV3 1EYBA 4Q4W2 3OGJA 2ZJCA 2XGXA 5GZCA 5CFCA 4QHBA 3ZVXA 2QDNA 2WT1A 5C9AC 4JGYC 2OW4A 5JVVA 4JQRA 2VW2A 3N36A 5E8AA 2CY6A 1AL23 2PA7A 4RD7A 3IIAA 1NZCA 2ET1A 1Z7S1 2R6QA 2GNDA 3B9CA 3NAPC 4KGQA 3TNQA 3RMYA 3BU7A 3LSDA 2ZAAA 2ET7A 4AGVA 3K48A 2XJVA 1R091 3ZFGB 3JCIA 4BCUA 4IEOA 2EVXA 3WVJA 1AUYA 3UKVA 5JMCA 2XLGA 5AC91 4FTBA 1UU6A 1EPWA 4WM7C 3ZFGA 1CVNA 3QH7A 1BK1A 1TMF1 1H4HA 3N7LA 3N4MA 2PHUA 4HVRA 1KDKA 4AEDC 2ZGKA 5AVAA 5I0SA 4OI0A 2ZGRA 3D5OA 1RMU2 4XFAA 3H1WA 3M3EA 4MGKE 1RVF2 3LKJA 3PVBB 2HKXA 1CAVB 3AZXA 4DS0A 2A73B 3VKMA 3AK0A 1AXYA 5BY5A 3OBTA 3I4IA 4CTEA 5LRSA 1CAVA 2W0XA 5HBAA 5BNOC 2D43A 1JUHA 3FLPA 4HANA 2QUOA 5IUQA 4META 3V65A 1DFQA 1ND2B 3MIDA 2WNVB 2CL2A 4LBMA 3AYDA 3GALA 1WW4A 3VBRB 1XNCA 4N7UA 3MF6A 1MQTB 3KSCA 3OGGA 1REEA 2B46X 2RM21 3DV8A 1CAUB 2WSVA 1LHOA 4RR3C 1RMU3 5JLVA 1UCXA 1DQ2A 1WUVA 4HVQA 1ND2A 4XOGA 5C8WA 2WNVA 1RVF3 2R1DA 3BOWA 3EJKA 4FSJA 3VBRA 1QXRA 3MZHA 5HCBA 1MQTA 2R30A 1BYHA 1FMD1 3EBRA 3AFKA 2EF6A 4Q4Y3 2XKOA 1NLRA 1CAUA 2BGCA 4AVAA 3AZYA 1EV11 1RUI3 3FE5A 3WX5A 3IDEA 2XG3A 1DZQA 4IEUA 4XBNA 3SH4A 1WLTA 1D2QA 1R1ZA 1V6KA 3FJSA 4E4SA 4DY3A 3V0AB 4BYYA 1YHFA 3E6BA 2PTMA 1VBA2 5C9AB 2Q0AA 4H3WA 4WZFA 5SV8A 4ASMB 4X6QB 5JZGC 1QHDA 3VDDC 1XRUA 3WDXA 3HIFA 3PVOA 3HBZA 3X29B 5IK7A 1O4ZA 1U5IA 4GA9A 4AQTA 3V0AA 1Z78A 3KCCA 1JYIA 1KJRA 2CGNA 5JI7A 5C9AA 4JGYA 1IOAA 2VNRA 1JN2P 1LOFC 1LOBA 4FPYA 3ZN6B 1QJX2 2XH6A 4N43C 1LGNA 5CB7A 3WG2A 1VJ2A 2IWGB 4LNVA 4X8PA 3R6SA 2OUJA 2CAUA 2WQ4A 1PO21 3ZN6A 1N1VA 1B09A 3AP6A 4M3CE 3RRDA 5LRRA 4W6XA 2D6NA 4AI3A 1VB2A 1UU5A 4K9SA 2ZBJA 1VBA3 1AXZA 1ASJ1 1ULDA 1WMEA 1Y43B 4PQ9A 5L36A 5EYYA 4FO9A 1CAXB 1Z7S2 2XJUA 4LBQD 4E2SA 5I93A 1LHWA 4FXGB 1R092 1UL9A 1O7FA 3FUQA 5FMOL 1CAXA 1CQ9A 4AHWA 4AHZA 3IM0A 4NWWA 3NKTA 5AC92 1OQEA 2DCYA 1AR91 2WT2A 1CIWA 1F5JA 1LU1A 5DG2A 1PNGA 1SCSA 1GSLA 5CNAA 4ZU4A 1RUD3 4NWVA 4COVA 2D7FA 4AEMA 4E27A 1HQNA 1AR83 1KDMA 1SMVA 4AK3A 4NO4A 4QGNA 1UD1A 2BFUS 3KMHA 3S7IA 2ATFA 4FPOB 1A8MA 1RUJ1 4HPKB 4HKLA 2EAKA 4WM8B 2RJLA 4Q0QA 4CEYC 3OD4A 2ZTNA 2WSUA 4GB31 5AC93 3KT1A 3PJQA 4P5HA 4DY5A 3ZN5A 1OHFA 5T5JA 4BLJA 4XDQA 2E7TA 2FQPA 1BJQA 3B69A 4RQPB 2G4IA 2XL7A 1DGWA 1MS1A 1ZZ7A 2EXKA 4OUMA 1NCQB 4KWKA 2RM22 3H50A 3RZZA 1N3OA 4MUVA 1B35C 2BWAA 1QJY1 1HV1A 1YI7A 4Q1RA 1AJOA 2WZR3 4JTNA 2B45X 1AX2A 2VVFA 1LU2A 2XKPA 2LUWA 1QY4A 4RQPA 4Z07A 4XBLA 3IT8A 4JAAA 3FX3A 1NCQA 5EV7A 2TEPA 1V6MA 3VDDA 4YM0A 3ZXKA 5JZGA 1AR63 4N43B 5EJ3A 1EV12 2TNFA 2V5YA 1HQLA 3ZIWA 1V6OA 2BTVC 1WCSA 1YJKA 3EXUA 1BKZA 4N43A 4HMZA 3PNAA 1I5ZA 3O14A 5IK8A 2D6LX 4K21A 3ZXJA 3NV4A 5JDBA 1EPZA 4AWDA 4Y1YA 4PBOA 3UV9A 3MFCA 2R0FA 3O12A 2PHXA 2XVLA 3QOPA 4L97A 4QGLA 2ZZQA 4R8HA 1C5IA 4UBGA 2BWCA 1ZRRA 4CP2A 1SDWA 1V6NA 4COWA 2XWJB 3WUCA 1T6GC 5KC5A 3MW2A 2A3WA 4FPJA 3A0NA 2UURA 2ZKNA 1M4WA 3SH3A 1OA3A 2QE3A 1EV13 4K1ZA 2IXIA 4V1PA 5F9TA 2NPIA 3JBG1 4OHWA 1PO22 1QOTA 4XTMA 1HQWA 1PGW1 1H2NA 2O0OA 2OVUA 2XBO1 1H4GA 1QJU3 5KHHA 3I7DA 5T5PA 1VBE1 4AFAA 3E5XA 1F8VA 4P9YA 4DRRA 4R4ZA 4R9DA 1FYUA 4AVVA 4QQLA 4SBVA 1PK6C 4QX5A 4U2AA 1VB4A 2E51A 2RS51 2EA7A 2UY8A 4AVTA 1SBEA 4IESA 3B9IA 2PAKA 4GH4B 3GYDA 2GNBA 2QNKA 2ERFA 4S2GA 2Z5WA 3DKWA 4Z82A 5ABJC 1V6IA 1X8MA 4CEYB 2RS31 3BCWA 1EAH2 4C90A 3E97A 2ZGSA 3J26N 1S55A 1SLAA 2EIGA 4CDWB 1AR92 1CD3G 1KFXL 1YIFA 2DUOA 3Q9OA 1ENQA 2VOXA 4LO4B 2DVDA 2ZX3A 1KRIA 1YI9A 1HKDA 4CEYA 1AF9A 1WW6A 4KQ7A 5K0UB 1OSGA 1SLIA 3ZFEC 4KH9A 4LBOA 3ZYPA 1LOCA 4AVCA 1XQNA 1D0HA 3AYAA 5SV5A 4N7IA 1VBD1 3M1HA 1B35B 4Q4X3 4WZCA 3AKSA 2GH2A 3MW4A 5L73A 5K8SA 4RHV3 5J7MA 1O3RA 1RUJ2 1WCKA 5J37A 1VP6A 3USUB 2BVVA 3MFAA 3FBMA 3PLQA 2ZMKA 2X5IC 5JAXA 1B35A 1W6NA 1VBC3 3D8CA 3WG3A 1ZBE1 3O0WA 1DDLA 2E53A 5K9YA 1OLRA 4GB32 1EAH3 2HWB2 5LEJA 3GBFA 1O91A 2PAEA 2Y26A 1VBB1 4JDOA 4C1WA 3INAA 1GYKA 2E63A 3LB9A 5KXBA 1S0IA 1FV2A 3USUA 1RTVA 5IK5A 3ZSKA 2YV8A 3ZYGA 2XJPA 4RS5B 4DINB 4E2QA 4YM1A 3PJYA 4TSVA 3EHKA 5JOZA 1H8TC 2P3IA 5GKAC 2DWRA 3DL3A 1QJY2 2AZ5A 4RS5A 4Y1XA 3CO2A 2PHLA 2YY1A 4Z2WA 1J1LA 4I3PA 4R9AA 1PZ9A 1J1TA 1AJKA 2A3YA 4G4FA 5F1RA 5KXDA 3POWA 4XF9A 2MNGA 1BMV1 2DTYA 1LR5A 3UJQA 4LE4A 4PDWC 2WA4A 5T3NA 2HWB3 4IV3B 2GMEA 4JGZB 5BNNC 1RUH1 2HWD1 1LB2A 1HRI3 5C6CA 4XFIA 1XE7A 4OI2A 5FOJB 2W39A 4K8FA 4LHNA 4EN0A 4Q8LA 1DGRN 4LBJA 4HT1T 1GQGA 3FFZA 3R4SA 2BW8A 4JGZA 4Y20B 1HW5A 1PK6B 3S7EA 1H2LA 1CESA 1IGOA 1WBFA 5L19A 3AXDA 3IPVB 2ZKLA 3MW3A 2NLRA 4MGYE 4W6WA 5CVRA 3VZKA 4FBFA 5CFDC 2VGDA 5ABJB 5FAXA 1G9CA 2FBEA 4KG0A 4HVOA 2JENA 1CR7A 1PK6A 2A6YA 4Y20A 5HCFA 1WBLA 2JECA 2TBVA 3W58A 1DQ6A 4XZPA 5KHKA 4FPHA 3JBG2 4HBNA 2I45A 4Q4V3 2Q1MA 3S30A 4IV1C 1PGW2 5ABJA 2XBO2 4D7TA 3PTYA 1ZM1A 2QCSB 5EFUA 1VBE2 3WDYA 2XJTA 3FMGA 1FNZA 1Q56A 4HLTA 4XE9A 4YZ3A 3ZFEB 5JWPA 1SBFA 4R52A 1NE6A 4L9BA 4XQDA 3SMHA 5BNPC 4TLFA 1CPNA 1AR73 4LBQB 4MGZE 4LT5A 4J1WA 1BEV3 1ZZ6A 3V0BB 3ZFEA 3N35A 3WG4A 4P9WA 2RS32 4AI1A 4XHBA 5T5OA 2Z79A 1QDOA 1Q5OA 4LBQA 2NP0A 1RMU1 4ZU7A 1ZREA 4P9XA 4OUSA 2A6XA 3JZVA 1MVEA 3V0BA 2PHWA 3JBG3 4HK9A 3BOPA 4HKWA 3P3NA 4FTEA 4Q4Y1 2CGOA 3CJXA 1VBE3 5CA6A 3FC0A 1FAYA 1DGWX 3GZUC 1RUI1 4IXLA 2YMZA 4YW5A 1WD4A 4I0AA 4AFDA 3DF0A 1AX0A 1VBD2 5GJ6A 1GBGA 2GH8A 4CDQB 4FXKB 1TEIA 2EXJA 4P14A 4AVBA 1C8M3 5C8CB 3C2UA 3H1YA 4M01A 1H8TA 2A7AA 4A2UA 3ME2A 3AZWA 1VALA 3MIBA 1R1A1 4CDQA 1ZBE2 3ENRA 5GALA 1LTEA 5FRAA 1OA2A 4XIKA 3RWNA 1RIRA 1E57A 2WS91 1VBB2 4PDWB 5C8CA 3WDWA 1ENXA 1PGSA 1PO11 5KHJA 2VOWA 4ORFA 3RQ0A 2WIIB 5GM0A 3M3QA 4XXPA 1DBNA 4NR1A 4GMP0 1WGPA 4PDWA 5DUUA 5BNNA 2K9ZA 2AGSA 1HDKA 2UYAA 4X8NA 1NXMA 1DGRA 2HJIA 3M3OA 3BPZA 3JUUA 5CIRA 5CFDB 3U4XA 1RUC3 3A0KA 4ASLA 3B02A 1RB8G 1Y9QA 3OJBA 4HN0A 1BMV2 4MGIE 1ND3C 2WQZC 3N7KA 3KM5A 1N3PA 4BOWA 2PHDA 3B3QE 5I91A 4KBBA 1RUH2 2HWD2 5CFDA 4IV1B 4B4PA 1YYNA 3P3PA 2DCKA 3SCGA 3TN93 5H9PA 2B39A 4IERA 3W59A 4LO8A 4YFZA 4XFGA 4IV1A 4K1YA 2CNAA 3SXWA 3H0OA 4TYSA 2HWC1 3O0VA 4DPNA 3WZ1A 3K51A 4I01A 4CRQA 1R083 5FO8B 1RUD1 1N1YA 3ECQA 5D1IA 4E2GA 4WBBA 4MXVA 1CGPA 3WR0A 5T50A 4BE3A 3TOJA 1AR81 5L7OB 1ULGA 2PFWA 2A75A 4IETA 3ASIA 4PIZA 2H6CA 2AR6A 2XVKA 1RC6A 1RUH3 2HWD3 3S0MA 3DPRC 4HSLA 4Y5Z0 3SCFA 2PN5A 2DYCA 2NMNA 1APNA 2IXHA 4WV8A 2GALA 1Q8QA 2OZJA 4AQ6A 2ZGUA 4PLNA 5L7OA 3MLJA 2IXKA 2LALA 1AYM3 4NPRA 1W6QA 1ZNPA 3ZXAC 3VBFB 4QQ2A 1COV3 1DQ1A 1SCRA 1QJZA 3JQWA 1BVVA 3AXEA 3DUIA 1NOVA 3BALA 4HSJA 1IS6A 4Q0VA 4IEWA 1QH7A 1H2MA 2V73A 2ZHMA 1LKNA 4J1XA 1NA1C 3WD5A 4QQOA 1C3HA 3VBFA 5GZGA 3T1LA 1H9WA 5T5LA 3CF6E 2QDRA 5AVPA 2R043