3NW4A

Crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with gentisate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
363
structure length
363
Chain Sequence
KLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAAIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-Dioxygenase
publication title The salicylate 1,2-dioxygenase as a model for a conventional gentisate 1,2-dioxygenase: crystal structures of the G106A mutant and its adducts with gentisate and salicylate.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
total genus 102
structure length 363
sequence length 363
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nw4A01
3CLPA 1RUOA 3KMHA 2D40A 4BIFA 5I91A 3O14A 4Q0PA 1X82A 4LUKA 4J1WA 2IXLA 5I0UA 5JAXA 5LEJA 4MGYE 1RUNA 2UY8A 5KHGA 1ZX5A 5I8YA 1NYWA 3NVCA 1LB2A 5CVRA 3E5QA 4AVCA 2Y0OA 4HZFA 2QDRA 1UCXA 5BXXA 4ZU4A 3WW2A 2GU9A 2MPFA 4ORFA 3LA2A 4HSJA 3DV8A 4LEJA 3ZDSA 3VHRA 1UPIA 3RYRA 1DZRA 4Q0UA 2ZCWA 3C3VA 4PJYA 4MV2A 3H7YA 3E6BA 2F4PA 4F8AA 1VJ2A 3H3ZA 4A2UA 3U0ZA 1NE6A 3DN7A 5KHJA 1SFNA 1O3SA 3EJKA 3RYPA 3IIAA 3LA3A 4Z82A 2K9ZA 4LULA 1UIKA 2QNKA 4PIXA 1X8MA 2OA2A 3EQEA 5AVPA 2IXIA 1V70A 2N7GA 1CX4A 4R52A 1ZZ8A 4IEVA 5BPXA 2QVSB 2XKOA 2GH2A 4LA2A 5I93A 3RDIA 2H0VA 1UW8A 3G7DA 4Z07A 5EZWA 3SXWA 1DGRA 1ZZ7A 2Q0AA 3L2HA 1FI2A 5FLIA 3ELNA 4XFHA 2UYAA 3BPZA 3LOIA 3S7EA 1CGPA 5FCCA 5T3NA 2DCTA 1UD1A 4XFBA 4AQ6A 4XF9A 1NE4A 1O3RA 5BUVA 1YWKA 5JR7B 1ZZ9A 3I59A 3R6SA 4EV0A 1ZVFA 3BALA 3GBFA 3HT1A 3FZ3A 3HIFA 2O1QA 2E9QA 2B9UA 3CO2A 3D0JA 3NJZA 3RZZA 1IPKA 4I0AA 3NW4A 3RYKA 4AVBA 2P17A 3E6DA 1RC6A 3KSCA 1CAUA 4IEXA 5FPZA 3H8UA 4AXOA 4WBBA 3SCHA 1PMIA 5KHHA 4HBNA 4HN0A 1Y3TA 1EYBA 4LLOA 2IXJA 2XL9A 1PM7A 4IEUA 2EA7A 5LRRA 5FDBA 2B5HA 4IEWA 2XHKA 1I6XA 1J3QA 1ZRRA 2PQQA 3H3UA 4XETA 4EROA 2BYVE 1ZNPA 4MUVA 1RL3A 1O5LA 4I0BA 2QJVA 4UBHA 2FQPA 5JSOA 4HN1A 1RTVA 3LA7A 2GAUA 3FJSA 3SCGA 3IBMA 5FQ0B 1CAXB 2GC2A 3SHRA 4CYDA 4QGMA 2MHFA 3TNPB 3ACLA 1CAWA 3OTFA 3SCFA 5I0SA 4MH0E 4TLFA 3EHKA 1FT9A 1VR3A 2QCSB 1YLLA 3CF6E 2ETEA 4Q0VA 3ST7A 5HI0A 1WA4A 4GULA 4L11A 4WZCA 3HQXA 1H1MA 2PHDA 2GC0A 5I8SA 2OYZA 1ZREA 2PTMA 1LR5A 1OMIA 4JTNA 3SMHA 3IWZA 3OCPA 3N4MA 5I0RA 2B8MA 4XFAA 2GZWA 4I01A 3NL1A 2HJIA 2Z2SB 1O7FA 2UYBA 4XF0A 3UKTA 3MDPA 2ET1A 3MPBA 2IXCA 4IERA 4QMAA 1QXRA 5EFUA 3NKTA 4D7TA 1Y9QA 1ZRDA 1QY4A 1OD5A 4I09A 1XE7A 2MNGA 4O9EA 2PFWA 1O3QA 1YHFA 2IC1A 1DGWA 5LEKA 5KHKA 4Q29A 4YRDA 1J59A 2Q1ZB 1CAVB 5K8SA 2VECA 4XEZA 1J3RA 2V09A 3MYXA 5F1RA 3CEWA 3GYDA 1ZZCA 4EWDA 1WLTA 5J3UA 3TNQA 3B02A 4ZU5A 1JUHA 3H1MA 4UXAA 2GC1A 4QM9A 5JSRA 1EP0A 1Q43A 3OF1A 2CAVA 2EVXA 5KHIA 4LUMA 3EBRA 3H50A 3PNAA 4DINB 3HT2A 3LZZA 4L2NA 4AQ2A 1HW5A 4YYOA 4PIYA 3PVBB 1U12A 3OGJA 3FWEA 2CV6A 5FLHA 4EWAA 5FPXA 1O3TA 4JV4A 1X8EA 1YFXA 3WW3A 4MGZE 4IESA 5KBFA 4Q0SA 4XFIA 5FQ0A 1CAXA 4IEOA 5CADA 4KU8A 1ZRFA 4IEZA 2PYTA 4O9GA 5E16A 4QXKA 4FAGA 3KCCA 4Q0QA 5BY5A 3H1WA 3NSTA 3ETQA 2IXKA 3H1YA 2KXLA 4JTOA 2WFPA 4YARA 2FMYA 1J3PA 4B29A 4LA3A 4OFGA 4F7ZA 3FX3A 4I2OA 5JSPA 1GQGA 4E2QA 3DL3A 2OPKA 2VQAA 4NVPA 2ET7A 1YUDA 2XL7A 2H6BA 4RD7A 5J7MA 1Q3EA 1QWRA 2BEOA 1SEFA 3D0SA 1TQ5A 4KL1A 3E6CC 3UKNA 4K8FA 1OI6A 3WW4A 1NZCA 3E97A 3PLQA 3LAGA 4QX5A 1ZZBA 3IDBB 4HVOA 1J58A 4IEQA 4KU7A 4QGLA 1QXJA 2OZ6A 4FBFA 3I59B 2BNNA 3USSA 3I7DA 4JVAA 3QACA 3QOPA 4EWEA 5JCTA 1VP6A 4FT8A 5D1IA 2O8QA 4QM8A 1O5UA 4X6RB 1LRHA 2PAEA 2PAMA 4WVZA 1I5ZA 3RPQA 4KWLA 3IDCB 4H7LA 3M3IA 2D5FA 4META 1FXZA 1CAUB 2XKPA 5FLJA 1EY2A 5I0TA 1YFUA 2UY9A 4PIZA 2CGPA 3BCWA 4AVAA 2Q4SA 2ATFA 2XLFA 1OFNA 3FFQA 3S7IA 1IPJA 2CAUA 4BHPA 2I45A 2XLAA 4X6QB 4FAHA 1NXMA 4YNIA 3BU7A 2BNMA 1O4TA 4MX3A 2OZJA 4XFFA 4HSLA 1YFWA 1EPZA 1J1LA 1CAWB 1DZTA 4I3PA 3ES1A 3BB6A 5C8WA 3LWCA 3E5XA 2ZKLA 3MZHA 3H7JA 2BGCA 4P9GA 1H1IA 3FE5A 4MGKE 2PHLA 4IEPA 4MGIE 4QGNA 2VPVA 4OLLA 1SQ4A 4IEYA 3M70A 4E2SA 2Z69A 3EO6A 4HLTA 1ZZ6A 4UBGA 4J1XA 2Q30A 1XE8A 2H6CA 5CU1A 3E5UA 4ZU7A 3I54A 4KWJA 2EAAA 5LRSA 2K0GA 1UIJA 4XF1A 4YSFA 5E1RA 2IXHA 4I02A 4HVQA 5I8TA 4ONUA 3U11A 5C6CA 4BYYA 4N9HA 4XF4A 1WGPA 4MZUA 3CL1A 3H9AA 3WW1A 1RGSA 3ROUA 3D82A 4R8HA 3KGZA 1Q5OA 3ES4A 2XLGA 1YFYA 2GC3A 3JZVA 4XFCA 4N9IA 5BV6A 4HVRA 4IETA 4KWKA 3CJXA 1XRUA 4D7SA 1X7NA 3DKWA 4XF3A 3RNSA 4LTAA 3UKVA 1GQHA 2C0ZA 1ZRCA 1L3JA 2D93A 3FHIB 4E2GA 1G6NA 2BNOA 2WC2A 1LKNA 3KGLA 5J48A 3OD0A 2HKXA 1CAVA 3U10A 2XGXA 2D5HA 4HMZA 3S0MA 4BH9A 2PA7A 4XFGA 2PAKA
chains in the Genus database with same CATH superfamily
1XB9A 4FFFA 2ZABA 4B7EA 4BIFA 1VB2A 3NNMA 3O14A 4ITCA 1ZRIA 2RDQA 1NCQA 4J1WA 4LHSA 4XQ4A 3MIBA 4DY5A 5DPNA 2JE9A 4ATEA 2JKBA 4RFT0 1PX3A 4DO0A 3ZVXA 1RUG2 2X5IA 5EYXA 5JVVA 3WDTA 5IK4A 3I97A 3ZKUA 2IFWA 3N9OA 3FBMA 1QDCA 1YXWA 2E26A 4XIOA 3ZIWA 1Q8QA 1V6NA 4OCTA 4HZFA 2EXKA 2JB8A 3WW2A 2WAAA 4XTPA 4ZU4A 4BWOA 4N53A 1VBD1 1PGW2 4QPIA 3K48A 1DQ0A 4AEDA 4FTEA 4UFKA 3V0AA 1NLQA 4JDNA 3VHRA 1UPIA 3D5OA 2GP5A 1DZRA 3FN9A 3RYRA 4CEWC 1A6CA 1HJFA 4WM8C 1S0BA 5FYYA 3X29B 1TMF3 1JZ4A 1D4M3 3C7OA 1VBE2 2XJTA 2E63A 5F3IA 3E6BA 5IVYA 1QJU1 4IL7A 4NIHA 3H3ZA 5DQ0A 3NNJA 1NE6A 1RXFA 3LDRA 4YLZA 5GKAC 2V73A 1SFNA 3LEMA 3EJKA 2KA3A 4FFGA 5A6XA 5CFDC 3IIAA 3LA3A 5HCBA 1CQ9A 4Z82A 4GB33 1VIWB 1JZ3A 1OSGA 1XYNA 1UIKA 1OOPA 4D6SA 2LUWA 3KVBA 4QX2A 4UFMA 5JOXA 4XW3A 4PIXA 1X8MA 1C28A 3TBDA 3EQEA 4PBPA 1CX4A 1AL23 4HL0A 4L0PA 3T2OA 4FXGB 5BPXA 5CBLA 2HWE3 1XJAA 3DPRC 3OY8A 4LA2A 2BVBA 2NMNA 4Q4V1 5C3OA 3VLBB 5FZFA 5BNQA 5EHDA 2HWB3 1UW8A 2BW8A 4QHBA 4S2FA 5EZWA 3K51A 1ZZ7A 1LU2A 3L2HA 3SISA 5FBJA 5C9AB 1ULFA 5F2SA 2WZR3 4XFHA 2UYAA 3BPZA 4BDVB 5DUVA 4BU2A 5T3NA 1JODA 1KS5A 1N1SA 1RMU3 5CB7A 4GIQA 1OVSA 1UD1A 4D3WA 2VUAA 5JOWA 3HEIA 1XXNA 2VUCA 1RUE2 4AI0A 2HWD1 1HB4A 2FMDA 4RQPA 1ZZ9A 1GZWB 2AUYA 3PJQA 5DAVA 3I2OA 1ASJ1 1JN2P 5BNPC 1STMA 1BLZA 5ABJB 1CX1A 1QNYA 1NCRC 2E9QA 2VMIA 3CO2A 4EZ4A 1GANA 3C7HA 3HNYM 1Q8SA 4I0AA 3T2QA 1JOJA 4RA0A 3DUIA 4JX0A 4Y5SA 5JWPA 3W58A 2WNOA 4BXFA 2DCYA 2AACA 2RS12 1CAUA 1O59A 4IEXA 5FZCA 3HN1A 5ANQA 4AXOA 2VZTA 4WBBA 2XQRA 4HBNA 4XYXA 2DTYA 2WYSA 4BB3A 1EYBA 1RUF3 2IXJA 1PM7A 2J1TA 2WR9A 1NXD1 2WRAA 3AL5A 1W6MB 2EA7A 1UZVA 1FAYA 1XU1A 2B5HA 3IKWA 1AR91 5LRRA 5FDBA 4P02B 4AGRA 1O6UA 1WZXA 4DQAA 4BK5A 4IEWA 1UZ0A 1ZRRA 3HPNA 1CVNA 2PQQA 5A32B 4AFBA 3NWKA 1OD3A 4AAXA 1O5LA 3IDEA 4GH4A 5DAXA 4CEYC 3I3EA 4XMAA 4HN1A 1MZ6A 4MXVA 2BGOA 1QJX3 3O1OA 3ITQA 3LA7A 4PI2A 1ZBE2 3H8OA 2W3JA 3JD72 3PUSA 1CAXB 3AJYA 3PVEA 5AC91 5C3RA 2WAOA 5KXEA 4XHBA 4BQYA 4Q4W1 2DVGA 3TNPB 3ACLA 1CAWA 1RUI2 3SCFA 4CEWB 4MH0E 4Y1UA 4NHLA 4BE3A 4LO7A 1MQTA 3AFGA 1TZOA 3WY6A 2QCSB 4B4RA 1W8WA 4MHUA 3ST7A 5HI0A 1NA1A 4N7IA 1OFSA 3WOGA 4AOCA 1H1MA 1BVP1 1Y9MA 4I30A 4KG0A 5I8SA 3RJRA 1K3IA 2OYZA 5CFDB 2WSUA 1Z7S1 5CKNA 5T5JA 3SMHA 4FOVA 4BLJA 4QPWA 3VBUA 5IAXA 2X8KA 3T09A 1W6QB 4UYBA 2DVFA 4YFWA 5FUIA 1RUD2 1IS3A 5JIUA 3AP5A 1UOJA 1GV9A 3B01A 1AR82 2DUPA 2RV9A 4XFAA 5I0RA 2CY6A 4RSUA 3NNGA 5LA0A 4GQ7A 2HJIA 2Z2SB 1N3OA 1REFA 4K40A 1W39A 1A8DA 2ZGMA 2UWAA 1GBGA 3UKTA 1DCSA 1VPHA 4E4ZA 4LIVA 2HBUA 1DU3D 4LBMA 4NE9A 3WV6A 2R073 1K45A 1LOFA 2IXCA 2R6QA 4XIKA 3F95A 1PO11 1RUC3 4BMEA 3AKTA 4ARXA 3ZIXA 1VE0A 5L9RA 2B4KA 3TN92 5DZFA 4AEMA 1R1A1 2WUHA 3D6EA 1AXYA 2R061 2WYFA 1K12A 3SQOA 5AFBA 2J1AA 4F3JA 3KLSA 1OD5A 1W99A 1OLQA 4JRLA 1JU4A 4RGKA 4DEQA 4YGDA 1GU3A 1YHFA 3K4DA 4QKNA 5EYYA 4FPOB 1GOHA 1ULCA 3N36A 5LEKA 5FZGA 4A3ZA 5A3NA 4INDA 1OLMA 3VZOA 2ZGUA 2V4VA 4YRDA 2EICA 2Q1ZB 5K8SA 4YVWC 1YRZA 1J3RA 3LEGA 1GOGA 1SLTA 3MYXA 4CRQA 1H2LA 3GYDA 3ORJA 2P37A 1W0PA 2ZJCA 3B94A 3FUQA 3USUA 1VMFA 5DDJ2 1PX4A 2C1FA 4NROA 3B02A 2I07B 2DBNA 1QQP2 4BK4A 5HXVA 2GC1A 1AX0A 1AJKA 3IIIA 4CUAA 3OF1A 4LUMA 4S2HA 5C3SA 2WSVA 4DINB 3B9IA 1JBCA 1GZCA 2ZMLA 2DURA 3K4AA 4MO3M 4XZPA 2G19A 2W1SA 4BCUA 2WN3A 4UFIA 3QH6A 3PVBB 2X5IB 4LBQD 2RR12 1UOFA 4BQ5A 1A8MA 2ARAA 4MXWB 4Q4V3 3ZXFA 1QNWA 1MACA 3B7MA 2VM9A 4K1ZA 5CNAA 1PGSA 3M3EA 1YFXA 1KGYA 5DZGA 5G04L 5GZCA 3HN3A 4N53B 2ZGNA 2VJXA 1GMMA 3GJBA 3HNMA 3LGRA 3NV3A 2Y6GA 3AKQA 1VRH2 3MIGA 4JKLA 5EXOA 4AEDB 3DGTA 3J7LA 5FQ0A 1ND3A 3V0BB 4YVSB 5CADA 4TLGA 3POJA 1ZRFA 4IEZA 4O9GA 5E16A 4QXKA 3NJVA 4KWUA 4RN5A 4YM1A 4HXCA 3WQ7A 3POIA 2BFUL 3NAPC 3O0VA 2HWD3 2QUOA 3H1WA 3NSTA 2A6YA 4GKXA 3WDYA 3WT3A 1OH3A 1O91A 5FZ0A 5FZ1A 4IQPA 5IVVA 2D6PA 3DCQA 1LHNA 3ZXGA 3ME2A 4F7ZA 1E57A 2W95A 4OUEA 4LKEA 4V2WA 3DYOA 4I2OA 4PBOA 5LW9A 1AF9A 1G8WA 1V6LA 2JENA 3DXTA 4N8MA 4NMIA 3K46A 3LE0A 4R9AA 4V2VA 2EXIA 1R081 5DN2A 3ALQA 3AC0A 4FOWA 1W03A 5J09A 4CTEA 3UETA 1SLAA 2VQAA 2YGMA 4RGGA 1V9U1 4NVPA 1ZA4A 1HRI1 2XH6A 1J1TA 5FP7A 2JECA 1GYKA 1MS8A 4IXLA 4C0HA 2BEOA 1G7YA 4FQZA 4QDRA 3J4UH 5FYZA 1W2UA 4KL1A 3UJQA 3A0NA 1JZ7A 4FFHA 4DRRA 3KT1A 5D8AA 3VBRA 3QCWA 3AM2A 1PO22 4PDWA 3E97A 4CDXC 3VBHC 1FPN2 1FOD1 4FPKA 2ZX0A 4E8CA 3LAGA 4QX5A 1AX1A 1F4AA 4AHZA 3P1IA 1D7PM 1RVF1 3N9QA 3KV9A 2OZ6A 5GZGA 1VBA2 5A3WA 3ZXJA 1HQNA 1GQPA 1SZBA 1HQWA 3H42B 4XJZA 4D7YA 1BHGA 2Y34A 1ZBA3 2FDKA 4J6GA 1VBC1 3RWKX 5ACA2 5EP9A 3QOPA 4EWEA 4IV3B 3BUCA 3VHNA 4BQXA 4JZRA 2Y64A 4Q4Y1 4N43C 3RG0A 1IS6A 1D4M2 1O5UA 5AC93 4W4ZA 4XUTA 3IZOA 4FCAA 1LODA 2WT0A 4XJ9A 5KXDA 1RB8G 5FO7B 3FLTA 3R0RA 1MEC3 1W0OA 5FZIA 2QQMA 3W20A 2PN5A 3K4ZA 2BOJA 4WVMA 5F5CA 2JDZA 3WQBA 4H7LA 1MS4A 3E1F1 2DFCA 2Z5WA 5JMCA 1FXZA 3FHAA 3O1SA 1XQNA 1CAUB 2E31A 1R1ZA 4YVWB 5I0TA 3UL2A 1PK6A 3AMMA 3VBSA 1JYWA 2UY9A 1Z7S3 1DGRN 1LCLA 5IYYA 3I2JA 4HKLA 1N47A 5A6YA 1OBNA 5FYUA 2ZKNA 2PHTA 5BNOC 4CDQA 1W6NA 2XLFA 4UT5A 1Q8OA 1K5MC 1OFNA 2HWB2 3G6JB 1AHSA 2WNVB 2ILMA 1UZZA 2Y33A 3CNAA 1EUTA 2Y60A 2DF7A 2WZR2 1AXKA 3KQRA 4ZS2A 3I49A 2BPA2 2WIIB 4QX0A 5A7SA 2A6XA 2YC2A 2VOVA 1JYCA 3OUJA 5JZGC 3WDWA 4FOYA 1WUVA 5LA1A 1H8TC 2MEV2 5BNNC 4FI9A 5GLUA 3U78A 4YW3A 4M3CF 4W50A 4HSLA 2PLV1 3WNOA 2Y26A 5C8CC 4QX1A 1CAWB 2RS51 3J8F1 1VBE3 4FVVA 4KGQA 5FFOC 1R092 5A1FA 1OPMA 3ES1A 3OOXA 2TNFA 2HWC2 2VZ1A 3CJIA 3E5XA 4QPGC 3V56A 3ZYGA 2R16A 4OI1A 4Y33A 5FAXA 1AR71 2XBO1 2ZX2A 3MFAA 1HXS1 5L7OB 5HCHA 3PVOA 1GR3A 3POSA 4P9GA 3LDBA 2AYHA 3U75A 3FE5A 2PHRA 3GHNA 4S2GA 3I8TA 5ERLA 2VPVA 3HQUA 4EJRA 3VBUB 3PIGA 1RUJ1 4OLLA 1SQ4A 1AYM2 2E51A 1OKOA 4IEYA 1YI7A 2Z69A 1OURA 4CPBA 4HLTA 2JG9A 1WLDA 2RJ2A 4J1XA 4YW6A 4Q4X1 4A41A 2Q30A 4OI4A 1RUF2 2VZRA 1W3VA 3AK0A 2WN2A 3BGAA 4XBLA 5CU1A 2VR4A 4PQ9A 4YW4A 2C24A 2GNDA 2RM21 2RMU1 3BU0A 4C1WA 3OBRA 4AI3A 3AYCA 3TOJA 2GP3A 4UW5A 3KV4A 3ZPOA 5LRSA 1L7LA 1TNRA 2DV9A 2EXJA 1RUE3 3LSEA 1GLHA 2W1WA 3ZFEB 4CXXA 4DB5A 4HVQA 4UW3A 2JD4A 4ONUA 1C4RA 1AR62 3ZYIB 3I2KA 3VUOA 3CQOA 3U37A 5FYBA 3KHBA 1RJ8A 4CDUC 1YNAA 2WL1A 5IFTA 4YZ4A 3MUZ1 1BMV2 1F9KA 1MZFA 5J37A 1RGSA 2QFEA 5J96B 1EV12 2BWAA 2P3YA 1MS1A 1MZEA 3KGZA 2DVDA 1B35B 3HJRA 3FL7A 4N43B 1APNA 2ARXA 2RDSA 4AG4A 2WO3A 4IETA 4NWVA 3VBOA 3WF0A 1JOPA 1E5RA 3NMBA 1RHI2 3ZFFA 3WUCA 1DP0A 4NPRA 4D7SA 5F7UA 3RNSA 5IVJA 1HRI3 1MPXA 5B4NA 4QX8A 1GQHA 2C0ZA 4E2GA 2BNOA 4LBKA 4H7MA 5FOJB 3KGLA 4NRMA 5J48A 3CBNA 2VZVA 3OPZA 4XUPA 3AZVA 4B4PA 1W8NA 4AFDA 4NR1A 1WCSA 2VBPA 4XFGA 2PAKA 5GALA 1KITA 4W65A 4QHOA 4RR3C 1D4VB 2HEYF 3CLPA 2D40A 1GP5A 4LOSA 4BISA 2WFF1 1MVQA 1RIRA 2IXLA 5K0UA 5F3CA 2ZGOA 3ZYJB 1DQ4A 5I0UA 2D3RA 1SHWB 1VBD2 5LEJA 1QJZA 5KXCA 1DG6A 3AP7A 3F2ZA 4LBJA 2J1SA 1UYYA 4MGYE 3JD73 3WDUA 4AVTA 2CU5A 1VBC3 2I74A 2CGNA 1ZX5A 4AL9A 4P08A 5I8YA 1SFPA 1T6BX 3AP6A 2AGSA 3W5MA 1H8TB 1RUI3 2WA4A 3E5QA 2VOKA 4GD4A 2Y0OA 2QDRA 5AVAA 1UY4A 5IHRA 1TNFA 1NY71 3RZLA 2GU9A 4R4XA 5C8CB 1QJU2 1OHFA 1OA3A 2SLIA 4HSJA 5LBCA 4M00A 3THPA 2Q8CA 1LU1A 4XAEA 4D69A 3N9NA 4LEJA 4DUVA 5LB6A 4QPGB 5FZ8A 4N90A 3IAPA 3SH4A 3B00A 2WNUA 5GZEA 1FATA 4AQSA 3FHQA 1POQA 3H7YA 4WVWA 2F4PA 1OF4A 3KF3A 5E6HA 3POEA 4A2UA 1UY0A 1NAEA 5D8AB 3DN7A 5KHJA 2VMDA 4FP2A 3ZXEA 3RYPA 4XZUG 4Z2WA 3RMYA 1W6OA 4ISQA 4WM7A 1WBFA 4LULA 3M2MA 1TG7A 1WLCA 4OHVA 4Q4V2 4D6RA 4AWDA 3UNPA 2VMHA 3D3AA 1X9TA 4DPNA 2QNKA 2RS31 2PHWA 2GNMA 1HQLA 5AVPA 1PVXA 2IXIA 1V70A 2N7GA 3BYWA 4QU2A 4Q8KA 3S57A 1KJRA 1ZZ8A 3B93A 4XJUA 4AHYA 4R9DA 5JXHA 2SBAA 2XKOA 2GH2A 4RL7A 4X8NA 3MICA 4COVA 2UWCA 2DU0A 5I93A 4Y22A 3T0BA 3ZR5A 2HWD2 2J22A 3ZSEA 3WNNA 4Y1XA 3O1VA 3G7DA 4G3YC 3SXWA 2PLV3 2FBEA 5FP4A 2J1UA 1LAJA 1ASJ2 3BOWA 4NPMA 2VE1A 4QPYA 1N1VA 5A70A 1JS9A 1CGPA 4WVVA 2DCTA 4WVMB 3T0AA 3O1RA 1A34A 3N7LA 3U4XA 2L9LA 2Y6JA 4IW3A 3GJAA 1LGBA 1WW7A 4SBVA 3TYJA 1HXS3 3OBAA 4LBQA 1N1YA 2ZGPA 5JR7B 1A3KA 3I59A 1AL0G 4A45A 2JDAA 2Z79A 4XHXA 1T6GC 3LD8A 4ZHNA 3GBFA 3FZ3A 4JGYA 5E8AA 2B9UA 3QH7A 3N3HA 3ZMNA 2FD8A 3W59A 4CDQB 1SCSA 1W6NB 5KXBA 4XABA 2P2KA 4RHV1 1WCQA 2A71A 1C3HA 4CU7A 5C9AC 3N7KA 1EAH1 2RR13 4JKKA 4YWAA 3R05A 4OZXA 3SKJE 2EAKA 2VCMA 3IPVA 2V5DA 4LPLA 4AVBA 4WM8A 5T5PA 2JEMA 2RM23 2RMU3 2VCCA 1DLCA 2CSGA 1VRH3 5HBAA 4YFZA 4NAMA 4KQ7A 3WQ0A 2UURA 1ND2B 5FPZA 2ZMNA 4LHKA 5C4WA 2DCKA 5KC5A 1PMIA 5KHHA 4HN0A 5ABJC 3JQWA 1Y3TA 3UV9A 1H8VA 3IDAA 4UW4A 3RI9A 2VZSA 3WCRA 5CG9A 3D8CA 1BBT1 1ONAA 1UY2A 1QKQA 5AC92 3T1LA 4BA6A 3LFIA 1J3QA 5DUUA 3CZJA 1LOBA 2J1RA 3H3UA 1URXA 4PCRA 4Q4W2 3ZXAC 4JDOA 4LNVA 4FQ4A 2FQPA 5FZAA 3VDDB 3ZFGB 3DPRA 2FDIA 3WDXA 4Q1RA 1UYZA 5A33B 1YIFA 3J26N 1RTVA 1CIWA 1ULPA 4NRQA 2YGLA 4W8JA 2GAUA 3FJSA 1DFQA 4UF0A 1QDOA 3IBMA 3VL8A 2GC2A 4XQDA 2EIEA 3SHRA 4CYDA 2J7MA 1Z7S2 4KH9A 1FT9A 1VR3A 2X53S 3OUIA 1LHOA 4G4FA 1CN1A 1S2KA 2OX0A 3U4SA 3KZ4C 4UOJA 4E27A 1PO23 4WZCA 1FPN3 1GZTA 2D6MA 2W68A 3AB0A 1UU5A 3KVAA 2NM1A 4C0BA 5LY1A 3PJYA 2ZHLA 1S1AA 1LR5A 5T5LA 1OMIA 1NCRA 4JTNA 2B42B 1VBA3 1SMVA 5JLVA 2WFF3 1PO12 1C8NA 5JOYA 5IVBA 5IK7A 4YM3A 3N4MA 4Y5TA 1W2NA 2GZWA 2NZ9A 4AHWA 5ACA3 1QOTA 1R1A2 4YPJA 2R062 4D6QA 1C5IA 4FO9A 4XF0A 3ZSMA 5FO9B 4L92A 3WINE 4P5HA 1WCUA 2CTVA 5FYSA 1ENSA 2ZEZA 4Q5OA 2A7AA 3GBWA 5EIYB 5EFUA 2XJSA 4K20A 2ARCA 2BV4A 2PXJA 3PUAA 3ZFFB 1P8JA 2J42A 1XNDA 5A7WB 5E88A 2XVKA 1FV2A 1ZRDA 1QY4A 2W94A 4K9SA 1IKQA 1RYYA 1XU2A 2VXJA 2YBSA 2XQXA 4O9EA 4YZ5A 4IE4A 2VOTA 2IC1A 5CISA 1REDA 2DFBA 4XDPA 4OHXA 2WWUA 4H14A 3EYPA 2H0BA 3V64A 3QD6A 5KHKA 4CEYA 4IGOA 1JTZX 1WA6X 1XPWA 4XEZA 4NIDA 5C5TA 2R1BA 2W46A 3ATGA 1F31A 2HEWF 5F8PA 4IV1B 4MG2A 4Y4RA 1VAMA 5LA9A 4CCDA 4JHTA 1JUHA 2NYYA 3T08A 1LNSA 1PVC1 4EQVA 5K0UB 3GDBA 2RS33 2CAVA 4RS5B 3LB9A 1ZA7A 4L8QA 3ZN6B 4L97A 4LK7A 2MEV3 3LIHA 5K7PA 3AZZA 1KS4A 4YYOA 2FZ1A 3NV4A 5F9TA 4MLOA 1UO9A 2CV6A 5T5OA 3RJ2X 4A7YA 1R093 3BTAA 4JV4A 5LK7B 4A44A 4GAZA 2B39A 2HWC3 5FZOB 3WR0A 1LHVA 1OA4A 5DAWA 4GWNA 1MS3A 4Q0SA 4TYSA 5F2WA 3IB3A 1V6OA 1U5IA 1UX7A 3NKGA 4KU8A 1QU0A 2E53A 1NCQC 1V6KA 4FAGA 4Q0QA 3TRSB 2C4XA 2C6SA 3FFZA 1DLLA 5JR2A 3WX5A 1R082 2KXLA 3MEPA 5FYHA 1HN1A 4YW2A 3C7GA 4JTOA 1AYM3 2FMYA 2X5IC 1J3PA 1BCXA 4GJYA 1IGOA 1QGLA 1LULA 1QJFA 1V9U2 1HRI2 4LJHA 4LR4A 3S5AA 3FX3A 4NPLA 4XCBA 1GQGA 5JSPA 1W6OB 3M3QA 4E2QA 3ZYPA 2AH2A 2AR6A 2RDRA 3M3OA 3N9LA 4LE3A 4M3CB 4N53C 2D44A 4RHV3 3B69A 4ZXEA 1GWMA 2W91A 2NPIA 3PTRB 2B9VA 4AEDC 3HQRA 4QDSA 2ERFA 5FZKA 4YVSC 4U36A 1FMD1 1FOD2 1EUUA 2ET7A 5H9QA 1Y4WA 1YUDA 5CEHA 2JDMA 4TTGA 2VMFA 4HFSA 1RVF2 1JYVA 1Q3EA 1AR63 2CYFA 4YZ2A 4CCLA 1TQ5A 3AMNA 3UYJA 3C8XA 1NUKA 4K8FA 5FY8A 1OI6A 3UGFA 1SFYA 3BTZA 3WW4A 3C7EA 5FXWA 3AZWA 2FHRA 3OPWA 2P4EA 1V6IA 1VBC2 2WZEA 4FPHA 1G9FA 3VHPA 4KBBA 4CP1A 2VTFA 1EV13 4IGQA 1OOPC 3N7MA 2LTNA 4HVOA 3T2PA 3VBFA 1GWLA 3NV1A 1J58A 1LHUA 4IEQA 2JKXA 4Q4Y2 1RUH1 3K3OA 5CYYA 2AREA 2QQJA 4OUMA 4A3XA 1SCRA 1QXJA 2IVIB 2ADDA 1SLBA 1DZQA 1ENXA 1GICA 2C5DA 3I59B 1OH4A 2BNNA 2GNTA 1HJGA 3I7DA 3J7NA 4M0NA 4JVAA 2YFZA 1RHI3 4JGYB 3QACA 4GWMA 5TSWA 3VHOA 5ISLA 5A3PA 1U0AA 1ZYBA 4ZZ8A 4AFCA 4AHXA 4FT8A 5D1IA 3ZO0B 1AYN1 2O8QA 1HRV1 2ZGLA 4W6YA 5FPLA 2JDKA 2DVBA 4WVZA 3MLLA 2NLRA 2JXAA 3Q8AA 2TUNA 1LHWA 1QOOA 3NAPA 3LF7A 4AE2A 4YW1A 4META 1V6JA 1AZDA 3AJZA 3VZKA 5F6KA 4JGZA 3NNLA 2XKPA 2C9KA 2WWJA 5C4WB 1AVBA 1ENQA 1E5IA 3BTYA 2ZS6B 5L19A 5IK8A 2CGPA 2VGDA 4IV3C 4QQLA 4CP9A 5JPMB 3RVHA 1VBD3 1JH5A 4AW7A 4AVAA 3MLJA 1IZ3A 2C26A 1SLLA 3DEMA 3OBTA 1F2NA 3UK9A 2UWBA 2Y38A 1UOGA 3O5SA 1RUG1 4C8DA 2PLV2 2CAUA 3RMXA 2RS52 2LS6A 3J8F2 2WWSA 2JDPA 5F5QA 1CIYA 2R041 1QJU3 4LLFA 4XXPA 4X6QB 5DUXA 3MIDA 2A3YA 1LJ7A 4ISRA 3V65A 4NHYA 4LMFA 2LW8A 1AR72 2XBO2 5FK8A 1HXS2 1CJDA 1O4TA 2X10A 4MX3A 2OZJA 4XFFA 1HB1A 5F5IA 2BBVA 4WZFA 5JIAA 1NCQB 2EALA 1WMEA 1HIXA 5FPBA 1QHDA 1RUJ2 1FNYA 5C8WA 3LWCA 5F3EA 3RI8A 2JIGA 4A4AA 4JAAA 2WNVC 4FPFA 4DRVA 3O1PA 2Q8DA 4LXLA 4GH4C 2OQ6A 2VULA 2VMEA 3T2TA 4Q4X2 2D6KA 2YPJA 4DXSA 3KS7A 3PMSA 4MGKE 1DDLA 1UF2C 3SEEA 3A0KA 1CJPA 2RM22 2RMU2 4PLMA 4NHKA 3TEZA 4RFRB 1XOYA 2NN8A 4CCJA 4QPIB 1PVC3 3M70A 3V0AB 3S30A 3PUHA 4UBGA 5FJHA 4LBNA 1M4WA 2LROA 4I0WB 1XE8A 2H6CA 3OB8A 5HCFA 4K21A 3BN6A 3E5UA 3QLQA 1UU4A 1Z78A 2GN7A 3K3NA 5L7OC 1EPWA 1ASJ3 1PM4A 2BTVC 2VNGA 3I54A 3THDA 4DY3A 4A6OA 3I3DA 1VMJA 2EAAA 2QQWA 1DHKB 5EJ3A 2K0GA 1UIJA 3M1HA 2OIIA 5E1RA 2IXHA 2W1QA 3VBUC 4JDMA 2CDPA 1OOPB 3AXEA 2E7AA 3M8LA 5FKCA 5A7PA 5I8TA 2TBVA 1OLRA 5C6CA 4MADA 4BYYA 3GHMA 4HG6B 1K5MA 5DXDA 5LA2A 4URAA 4XF4A 1J83A 3O1MA 3CL1A 4XACA 5LATA 3H9AA 5FV3A 1BQPA 3O0WA 3ROUA 3P5BA 4OVEA 4C90A 5B2GB 3OY8B 2D98A 5IATA 1UMHA 1PMJX 2JJ6A 3AMHA 1XYOA 1LOFC 1NT0A 4LK6A 4CA9A 5FZLA 2XLGA 5LZ6A 3VD9A 2GC3A 5JZGA 5FY7A 5BV6A 3RZKA 1AR93 2WO2A 3ZFEC 2Y0IA 4ZS3A 1RINA 3A21A 1UNBA 4LTAA 3H8RA 4NHXA 1VAVA 1UY1A 3CU7A 5LASA 3UKVA 3WP3A 4RQPB 2BWCA 2D93A 3FHIB 1G6NA 5FXZA 1UPSA 2WFF2 2WABA 2A1XA 3AXDA 2RDNA 4TWTA 5FMBA 5B4XA 1I3HA 3AKRA 1B35C 3M3CA 1CAVA 1X36A 3DKQA 1CD3G 4L99A 5FZ4A 2BOIA 3U10A 4HK8A 5C5UA 4HMZA 4IGPA 2WBKA 4LQRA 1BK1A 4QAWA 2GMEA 1JW6A 2W1UA 3OYWA 4Q4W3 1GP6A 3KMHA 5JI9A 4MOAA 2E6VA 1RUH3 3R4DB 4EE2A 4TN7A 1H2NA 1NY72 3RZJA 2CL2A 1DQ1A 2VAUA 2ORXA 2JDYA 3MIEA 5JAXA 1BEV1 1QEXA 4JQRA 5FPAA 3DYPA 3ZXKA 2HBTA 2UY8A 3IMMA 5A7NA 1RUNA 2P3IA 4LO4B 2NMOA 1HLCA 2WT1A 3NVCA 1LB2A 5FYCA 3OGRA 1V00A 2VW2A 3D4KA 5FY4A 3MPPG 2O8OA 2Y8KA 2WLQA 1AYN3 3WF2A 3VZLA 4BXSV 1HRV3 1GNYA 4P00B 5BXXA 2ZOEB 2MPFA 1UU6A 3LA2A 1DYPA 5LBEA 3RSJA 2WQ4A 4BIOA 5FIXA 1C8M1 2KD7A 3CHXA 1QIQA 3DECA 3O0XA 1GSLA 3VDBA 4GH4B 1HN0A 2PELA 5H9RA 2FDJA 4NUBA 1S0EA 1NKGA 2W2IA 1OKQA 2R32A 2RS32 4N7UA 4F8AA 2ARBA 1VJ2A 1PO13 3GZAA 3VV1A 4GMP1 3U0ZA 1W8ZA 1O3SA 3VB9A 1R1A3 4ZXKA 2R063 4CU6A 1UN1A 2VW0A 1YIPA 2P6HA 4QXBA 4MGSA 3POYA 2IUWA 1VAKA 2QDNA 1OA2A 1H30A 3LSDA 1MQTB 3LEKA 1GWKA 2ADEA 2OA2A 1BVVA 3VD3A 4FTBA 2R043 1NA1B 1KQRA 4OMCA 3ZXLA 5IVCA 3AYAA 4FSJA 5LY2A 1BZWA 4Y20A 1H4GA 2ZZJA 2WT2A 5D8AC 4Z07A 1XE0A 4ASKA 2Q0AA 2ZX3A 1IG3A 3ELNA 4RR3A 5FCCA 1DBNA 2JWPA 5FXXA 4PLOA 1D0HA 5F6LB 5CFCA 1NE4A 3ZYRA 1LENA 2DYCA 1XNKA 1O3RA 3B9CA 1LOCA 4RHV2 3JXSA 2ZZQA 4IE0A 4JGZB 3CZUA 3H0OA 1EAH2 4QXHA 1Q8VA 3R6SA 2HWF1 1S0GA 3Q8FA 2BERA 3N35A 4LE4A 3WDVA 1ZVFA 4QDQA 1F15A 1FNZA 2QQVA 4QD2A 3HT1A 1GZ9A 4Y1YA 5FOBB 3HIFA 5FRAA 1TME1 4QKDA 3VZNA 3RZZA 4P9YA 1IPKA 3UGHA 1PIV1 1CWPA 1JUIA 3MW3A 5A7OA 4XUNA 4CDWA 5A1LA 3M7AA 5L36A 2A75A 1SBDA 4OHWA 4JKMA 5IAVA 3T4HB 3NW4A 2D3SA 2FCTA 3RYKA 2P17A 4FXKB 4URTA 1AUYA 5FBZA 3URFA 3E6DA 3HMYA 1RC6A 4OI0A 3AX4A 4BPZA 3MIFA 1O8SA 4UFLA 3W21A 3T4VA 5G05L 1BBT2 1WW4A 1VBB1 4QB1A 5FZ7A 2Y6HA 1WW5A 3H8UA 2BDRA 2JDHA 3SCHA 3USUB 1GUIA 4QWNA 2VY0A 2IZWA 4EYUA 3GM8A 4LKDA 2XL9A 4LLOA 4XJWA 4CSWA 4E8DA 2QKDA 1O4YA 1R083 4YG0A 4CDQC 2VVDA 4OMDA 4YG6A 4GWJA 1V9U3 2IVJA 1POV1 3BOPA 4HANA 5FP9A 2PHFA 5GZDA 1I6XA 1W9TA 2P6CA 4EROA 2BYVE 4MUVA 2XONA 4AI1A 1RL3A 1WMXA 3P3PA 1WD4A 4XPVA 3PUIA 2OT7A 3W9AA 2VVFA 3TEXA 1ND2C 2VZPA 3J9SA 4P9JA 3JBG1 2WO7A 5JPNB 2QQIA 4LO5B 3I2FA 1FOD3 1C57A 2WS91 1ND3B 2W47A 5FQ0B 4DXTA 4EZHA 4D94A 1XC6A 4JCKA 3MGUA 1XNTA 1RVF3 1W9WA 1HKDA 3VDCA 1PZ8A 3IT8A 4QKBA 3MUY1 5DAQA 5I0SA 1MS5A 2FCVA 4QHZA 1KFXL 3MW2A 1G9BA 2V72A 1X33A 4CCEA 2P34A 4XUQA 1LEMA 3CF6E 2ETEA 5GZFA 4DIQA 1SG3A 3INAA 3WG2A 4GULA 4MGQA 5SV8A 1OVPA 5JI7A 3B5LB 5AFEA 3VDDC 3ZFGC 5FTTC 4Q4Y3 4HPKA 1ALYA 2PTMA 1ZREA 2CWSA 5K4LA 3LQCA 3WF4A 1DGLA 1LTEA 4K8RB 3WG1A 1TVGA 5A3MA 3IWZA 1SDWA 4A7KA 3CMGA 3PHMA 3WSOA 4PQQA 1CZSA 2ZEWA 4BQ2A 4UW6A 3NL1A 4H3WA 1O7FA 2UYBA 3AL6A 3MW4A 4JQTA 3AP4A 4BQ3A 1TMF1 1G9DA 4V1PA 2A6ZA 5LCWL 3C2UA 2JG8A 4M4RA 1GZWA 4IERA 3ETPA 4QMAA 2ZPXA 4TXWA 3VBRB 1PNGA 3KF5A 2VTXA 1T2XA 4PDWB 5ABJA 4LHNA 5CKMA 1X50A 3CIHA 1JZ6A 4GB31 1Y9QA 2ENRA 2W87A 2HYKA 3I3BA 5L9VA 2P1BA 3ILRA 5KWRA 1LESA 2WNEA 4I09A 4IE5A 3CDZB 1XE7A 2MNGA 3WF3A 3ZR6A 2KR2A 2ZGKA 4ET7A 5CZKA 1PGL1 1CONA 3M4FA 4GZ9A 1DGWA 5F3GA 1PVC2 1AL21 3PUQA 4Q29A 3KV5A 1YQ6A 4NIAA 1J59A 1CAVB 3SITA 2VECA 1GNZA 4GMP3 4HOOA 2HWE1 5E89A 5FYVA 1D2QA 5KC6A 2VNOA 3LOBA 1HV0A 1S0JA 4EN8B 2V09A 5GLTA 5F1RA 2Q5TA 3CEWA 3HD8B 1ZZCA 4XMIA 3RZMA 3ZSLA 3VD5A 4EWDA 2E32A 5J3UA 2EIDA 4OYUA 2CWMA 3TNQA 2RS53 3J8F3 3ZFFC 4ZU5A 4CCKA 2A5ZA 4CCOA 4ZZ5A 4QB2A 4DUWA 2YC4A 1MS9A 1W6MA 1EP0A 1MVEA 1Q43A 3UJOA 2XJVA 1RMU1 4OQ9A 4KI5M 1D2SA 1N3PA 2E7TA 1KDMA 2WZ8A 3EBRA 2D3PA 4XC9A 4L2NA 1PZ7A 3LZZA 4RYDA 1AR73 1HW5A 2VMCA 2XBO3 3NRUA 4IE6A 4NJ4A 2Q8OA 4AQ2A 4B7KA 1XNBA 5A32A 1U12A 1PK6B 2XXZA 3OGJA 3VBSB 3FWEA 4ATFA 2HH9A 2XJPA 4LT5A 3LPGA 5FLHA 4AVVA 1OPOA 4EWAA 4OQ8A 2BGPA 1X8EA 2OW4A 3LIGA 3Q9OA 4YG3A 1RUJ3 4MGZE 3SKVA 4NRPA 3WW3A 1QF3A 4AEKA 1LEDA 4IV1C 3P3NA 2VQUA 4IESA 5FP8A 4AI2A 1CAXA 4LO6B 4DS0A 4Q4X3 2PYTA 2VH9A 1RJ7A 2YBPA 5K0UC 2W08A 4Y1ZA 3ZSKA 5EJZB 2VW1A 4RS5C 4CEWA 1DQ5A 5BY5A 3U07A 3WNPA 4Q27A 1UMIA 3H1YA 4B1MA 1A78A 1W3XA 1AR92 3ZMOA 2WFPA 4YARA 1JZ8A 5GLVA 4B29A 1FMD2 1UAIA 2YYOA 5C70A 1SACA 1IOAA 4OFGA 1PZ9A 2B7YA 2ORZA 3GF6A 3WLUA 2X29A 2KM2A 3AMQA 2WLPA 5CFDA 4XDQA 3WVJA 3VKFC 3DL3A 2R49A 4ES8A 1OQ1A 1W6QA 3CJIB 1ULEA 4Y5Z0 2OPKA 4AZZA 1MZ5A 1YQ2A 1H9PA 4BQ4A 4Z92B 1NX9A 1US2A 5F32A 2XL7A 2H6BA 4RD7A 3TWIA 4M4PA 2FZ2A 5J7MA 2TEPA 2VZUA 1RUH2 1UZWA 1UYPA 1W8TA 2ZX1A 1FV3A 1VBB3 1QWRA 3D0SA 1SEFA 4GJZA 1DIWA 5A80A 1UKRA 3E6CC 4CP2A 2G9FA 4M01A 2JE7A 2VXRA 1QJX1 2VQ0A 3S6PA 1NQJA 1JXNA 4CUGA 1NZCA 1O8PA 3I2DA 3I2GA 4ARYA 3Q8EA 1N3QA 2K46A 3FLPA 3PLQA 1IQAA 1CPNA 2JG9B 1ZZBA 5FUPA 1F5FA 5CFCB 1VLNA 4KU7A 2OQ7A 3ZXDA 1AYN2 2VNRA 1HRV2 3JUUA 4LIUA 1IKPA 1XYPA 5IFPA 2W39A 5FZHA 2D7FA 3L2YA 1UXZA 4MYEA 4OUSA 4P5YA 3USSA 4FP3A 3AKSA 4O65A 4LKFA 4YGEA 1LGNA 1UOBA 1COV1 3JBG3 2Z4FA 5LBBA 5BNPA 3POGA 3OG2A 4AQTA 2EIGA 1H2MA 4COWA 2QQUA 5CKQA 4CDWB 1CZVA 1LRHA 1NLRA 2PAEA 3RGBA 3OJBA 3ZN5A 5A3TA 5EWSA 4HKOA 3O7OA 4CU9A 4FPJA 3PIJA 3ZLIA 1UMZA 2R7EB 1I5ZA 5FMOS 3H3LA 4PT6A 3IDCB 4YW5A 3M3IA 3C7FA 1WW6A 3NQHA 1N1TA 3ZDVA 1HX6A 3ECQA 3MFCA 4DFSA 4NWWA 1H0BA 4BJ0A 2JD9A 4H55A 2QQLA 4NIGA 1SPPA 1YFUA 2BU9A 4MXWA 1W9YA 2R071 2G9ZA 4JGYC 2VTXJ 3ABZA 3ILFA 3PTYA 4UFHA 3LKJA 3WHTA 5F37A 2VU9A 1VALA 1RUC1 2R042 3BCWA 4FPGA 3VBOB 1YJKA 1XSRA 3EXUA 4OHYA 2Q4SA 4OI2A 2ATFA 5FO8B 3AZYA 2IFRA 3PU3A 4W6XA 3N9PA 3S7IA 3WF1A 4YVSA 3V0BA 1GP4A 4RGAA 1HB3A 4BHPA 2CDOA 2LALA 5DABA 2LM3A 2BVVA 2X09A 2XLAA 2A3WA 4NO4A 2BP6A 5JMOA 1IS5A 5C4WC 3ACHA 2GSYA 2XWBB 3RFRA 3RWNA 4A7ZA 3DYMA 3BU7A 3IMNA 3PDQA 1F8VA 3UESA 5DAPA 3BPSA 2Y6KA 5A3OA 1EPZA 5GLWA 1H6XA 5HCAA 5A7QA 4B1LA 2OVUA 2W0XA 4I3PA 3BB6A 5EQUA 5DG1A 2XPJA 3PURA 1S55A 4HONA 3ON7A 4AF9A 2XVGA 4M3CE 4ES9A 3MZHA 2AENA 4MSVA 3W5NA 3H7JA 3ENRA 3DF0A 4XJ8A 4HPKB 1W2AX 5J98B 5C3PA 4QGNA 3IN9A 4FPCA 4Z8BA 5L9BA 2J1EA 1WCDJ 4K3UA 3WP5A 3HAGA 4BQ1A 1NQDA 1UKGA 3PU8A 4E2SA 1W90A 5T55A 2DTWA 2CNAA 2ZGRA 4CPBD 2AC1A 2ZGQA 1UXXX 2WNUB 1W6PA 2DCZA 3AYEA 1JOBA 3AZXA 1QJY1 2JG8B 2DWRA 1YQ5A 4ZONA 4ZU7A 3KT7A 4FFIA 5FP3A 1SBEA 3THCA 4KWJA 2ZAHA 4IV3A 1YYNA 4WM7B 4XF1A 4D0QA 3MBWA 3WQ1A 4DZGA 4I02A 4QX7A 1EAH3 1SBFA 2F6BA 4P9XA 5FZBA 4QPIC 4CCNA 4N9HA 4QXCA 1ULDA 2DVAA 3TB0A 3HBKA 3N9MA 2QE3A 1HV1A 1WGPA 3FBYA 3Q8BA 4MZUA 4Q26A 5FKBA 4DNYA 4HT1T 4DOUA 4YZ1A 1X9PA 3T0DA 1TEIA 3WW1A 2VBDA 5K9YA 4ZPIA 5DUWA 4R8HA 1S4CA 4Y22B 2GNBA 3ES4A 4YVWA 3VKNA 4ASLA 3K2OA 4R4ZA 2CGOA 3SH5A 3JU9A 1U5XA 4XFCA 4Y1VA 1KRIA 3WNKA 1V0AA 3GALA 4N9IA 5IJRA 4HVRA 4KWKA 2YPDA 4B3NA 1ODNA 4AYUA 2Y6LA 1BBT3 3POWA 3OGSA 1KD7A 4COZA 3JQXA 4BQWA 3GZEA 3JB8A 1KFUL 2E33A 3HVDA 3OGVA 4LBQB 1FX5A 1WLWA 1ZRCA 3KM5A 1Q56A 1RITA 5D21A 2ID4A 2WNVA 3APBA 1WMFA 4Q8LA 5FZDA 3BTXA 1BYHA 2AEYA 5H9SA 4YGBA 4KG8A 2YB7A 2X05A 2QQNA 3K77A 1E5HA 1ZBA1 3H8XA 1BEV2 4PHZA 2DUOA 4B4QA 5HV4A 2D5HA 3IM0A 4CXWA 4BH9A 2PA7A 2GH8A 1SLCA 5T50A 4B8EA 1LOGA 2XHNA 1RUOA 1US3A 1QJEA 2OPWA 5I91A 3UGGA 4IUGA 2WA3A 1S2EA 4FPLA 1X82A 4Q0PA 3IPVB 4LUKA 5CIRA 4XDOA 2YXSA 1MEC1 2GMMA 1IS4A 5FYTA 4WM8B 1UY3A 4AEJA 3PVNA 3A23A 2VNVA 1C1FA 4RQPC 1BXHA 1C8M2 1OUXA 2FCUA 1W9FA 5FMDA 4LORA 5CAZA 5KHGA 3ZSJA 5L7OA 3KHCA 1COV3 1NYWA 2G9GA 3GGLA 3BI3A 1WD3A 5CVRA 2GN3A 4UWDA 4LHLA 1W2OA 5FPVA 2ZHKA 5FZ3A 3UT0A 3BODA 4AVCA 1W28A 3KCYA 5FWEA 1UCXA 2OXBA 2P5BA 4G9SB 3RZGA 4ORFA 2P3KA 4K7JA 2VO5A 3DV8A 2RE9A 4XOGA 2A6WA 3ZX7A 4LITA 5EV7A 3ZDSA 1U5YA 1JZ5A 3VKMA 5FUNA 3GZUC 5JUVA 3HR9A 2VOXA 5HPOA 3I2HA 4Q0UA 3OGGA 1E5SA 4U2AA 1WBLA 2VG9A 2OKXA 4C1XA 2ZCWA 5A6QA 3C3VA 4PJYA 4MV2A 4XURA 3WNLA 2ZA9A 2WQ8A 3DPRB 3OEBA 2Z42A 4I3GA 3THTA 3NJYA 3QBQA 4LBOA 4AR2A 1PGW1 4UF0B 5DZEA 2VZOA 4FPYA 2O14A 3OUHA 4AGGA 4F83A 2K9ZA 1F5JA 1ZM1A 3GZTB 3VBHA 4CDXA 5HXMA 2ZEXA 3ZFEA 5M0TA 2JDNA 1LOEA 1VBE1 2B46X 4R9CA 1OT5A 1W04A 4XJAA 1QMJA 4UI9L 3GCWA 2BZDA 2ZHNA 1ST8A 4R52A 5DMYA 4MHRA 4IEVA 4BM8A 2QVSB 1ACCA 5J36A 4AAPA 1Q8PA 4NHMA 1F4HA 2W92A 2EF6A 3VDAA 5BNPB 1B35A 3RDIA 3I3MA 1NCRB 2H0VA 1VMHA 1MS0A 2ZTNA 2YY1A 4CU8A 2HWF2 2R0HA 2EXHA 4N43A 4CCCA 1DGRA 5FLIA 3ZM8A 1FI2A 3I3QA 4Y26A 3VL9A 3LOIA 4Y4YA 3S7EA 3TAYA 3VBFC 2FDHA 2VUJA 5IWFA 4GA9A 4QU1A 4XFBA 2WDBA 4AQ6A 4XF9A 1TME2 3VN4A 1MQTC 3ZOIA 5BUVA 5LWBA 1PIV2 1DYOA 4COUA 4P9WA 2YUEA 1YWKA 1QH7A 3KQ4B 5JXIA 1NA1C 4EV0A 1SPPB 4QT6A 3BALA 1OF3A 3VZJA 2G1MA 1JMUB 2YC0A 2C9AA 2Q1FA 2O1QA 3FC0A 3WP6A 3WNMA 3D0JA 3NJZA 4XBNA 1QOSA 2RJKA 1KDKA 1VBB2 1RUE1 3LEIA 5BNOA 3WEZA 4IE7A 1W8HA 3GNEA 1U5ZA 4P14A 2R30A 1QJY3 2XDVA 2RHPA 3AKPA 3HNBM 3LPFA 4JGZC 1C5HA 4CEYB 4E9KA 3KSCA 1I5PA 3I2IA 3SC7X 2JIJA 2EIBA 3EMRA 3WG4A 2V4AA 3IAQA 1H8TA 2JICA 1KXGA 1ULGA 1OQDA 1S0FA 5BNNA 1UYXA 3WP4A 4IEUA 5J1XA 4AI9A 1YQCA 4Q2FA 5C8CA 2BRTA 3JBG2 2QQOA 3R4UA 1FMD3 2XB6C 2RS11 2WS92 4KMQA 4QPGA 4AI8A 2XHKA 4P9LA 4XETA 5EJ1B 1ZNPA 5LBFA 1UQXA 2O0OA 2VOWA 4I0BA 2QJVA 3AMPA 4UBHA 2Q1MA 1VB4A 1XNAA 5JSOA 1W8OA 5C3QA 1DQ6A 5C33A 1JZ2A 3LCPA 3RQ0A 3OBZA 4E4DX 2XJRA 3SCGA 3T3YA 3WXPA 4QGMA 2MHFA 5FZ9A 4YM0A 2DCJA 3ASIA 3OTFA 3MLKA 1W6PB 4TLFA 4HETA 1GKBA 2XJQA 4D8MA 1WWYA 3EHKA 4QX3A 1SLIA 2VCBA 1H2KA 2Q8EA 5FR3A 1YLLA 3SEPA 2YU2A 4Q0VA 2R0FA 1WA4A 3A7QA 1ZBE1 4L11A 1UZYA 3HQXA 2W9XA 2E7QA 2XVLA 3JD71 1IHMA 2YFUA 2ZX4A 2PHDA 3MHZA 2GC0A 4W6WA 5FWJA 5JOZA 3O1TA 3Q8CA 1TMF2 1W05A 1RUI1 1JU3A 3FUOA 1PHMA 2VL4A 2DBIA 1ND3C 3OCPA 4GWIA 1RXGA 3N7JA 5IUQA 3SH3A 2WZPP 2QBXA 5GM0A 2B8MA 1PMHX 3K75B 4CDUA 2RG4A 2PMWB 4I01A 4ZY9A 2FDFA 4CZSA 4GB32 2WQZC 5FMOL 5IVEA 3ZKYA 2OUHA 4EN0A 2YU1A 3MDPA 2ET1A 4P9IA 3MPBA 1PGL2 1JHJA 3A22A 1QXRA 1RUD1 3NJXA 4CE8A 1AL22 3NKTA 1AR81 5ANNA 2HWE2 2XWJB 3VBFB 2W52A 4D7TA 1O4ZA 2FDGA 2ZGSA 3OPTA 1W8FA 4Q1PA 1RUG3 2PFWA 5SV5A 2XG3A 1O3QA 3POFA 4NN0A 2JE8A 4QQ2A 1XBFA 3ZYBA 1DYKA 1H6YA 1RMU2 5FY0A 3TN91 5C71A 2YG0A 3TEWA 1IPSA 4YGCA 4TZDA 2WINB 2VQTA 1G9CA 3O1UA 1ND2A 2XUMA 3PL0A 3VBRC 1H9WA 4J25A 1WLTA 1OLME 4PDWC 1HB2A 4R9BA 3H1MA 4UXAA 4BZ4A 4QM9A 5JSRA 4XUOA 2PHUA 4PF1A 4AGVA 2EVXA 1NG0A 1AJOA 2XMLA 3NAPB 1PNFA 5KHIA 4FTSA 3H50A 3PNAA 1C1LA 3HT2A 4QB6A 3PMEA 4K1YA 3NNFA 3MV01 4PIYA 5KR7A 2ES3A 5A3UA 5BYNA 2LRPA 4C91A 5DDJ1 2WO1A 4XILA 4K6BA 1JHNA 4BOWA 4Z2AA 5FPXA 1K42A 2P3JA 1QQP1 4CP9B 3VDDA 1O3TA 2D97A 3ZFGA 3VD4A 5IW0A 2YZ4A 1AX2A 5A33A 4Y3OA 3R4SA 3L9JT 2XJUA 1YC61 1YI9A 5KBFA 1DGWX 4UAPA 1LECA 1TE1B 4XFIA 1W06A 4IEOA 3MF9A 4GKYA 1LGCA 2RR11 3AVRA 3S5QA 3FLRA 1YJLA 3KCCA 2J1VA 4EN6B 3ETQA 1WKYA 2HEVF 1YCIA 2IXKA 3VKLA 1IG0A 3LFMA 1UL9A 1PK6C 2D6NA 3VBSC 2XOMA 1VRH1 1ULOA 2QZ3A 3AFKA 2D6OX 4LA3A 4BMBA 2PHXA 3KV6A 3EB7A 4O7XA 1Y9GA 3AYDA 1CR7A 4GALA 4CDXB 3VBHB 4E4SA 2K2SA 2YMZA 5H9PA 3ZYFA 4CVUA 1D0GA 1QJX2 2A6VA 4Y24A 5LK5A 4JRAA 2BBAA 3O12A 1UWWA 3SLIA 4KGGA 1W9SA 2YV8A 3HOBA 1SDDB 5C7GA 5FPUA 4AK3A 1S0DA 3MF6A 1JYXA 3JB4C 2G4IA 3UKNA 5FJKA 1F35A 4A6SA 2VVEA 3T30A 4L9BA 4XCAA 5FZ6A 4XE9A 4NAOA 3ZN4A 5I0DA 1QH6A 2ZAAA 1REEA 2Y6FA 5FREA 5HV0A 1COV2 1GOFA 3MIHA 1NLSA 3IDBB 5A7WA 4XVHA 2RS13 4XXAA 4HKWA 1BK0A 4QGLA 3KT4A 3OSDA 1KJLA 2YROA 3CJIC 2ZACA 2QTWB 4CUBA 3AP9A 4FBFA 4QQHA 2QQKA 1CPMA 3KB5A 1XSQA 1M06G 4QKFA 2DUQA 1PO21 2DDUA 1KEXA 1FPN1 3I4IA 2B45X 3RS6A 5JCTA 5FXVA 1VP6A 3B3QE 1W0NA 4ZKTB 4PI0A 4KBZA 4QM8A 5FYIA 3VKOA 3ZPYA 4X6RB 4IV1A 5BNOB 3KD4A 1VBA1 3BIWE 2R072 5F5AA 2PAMA 1K5MB 1OUSA 2ZEYA 2JG9C 2ZXQA 5C9AA 5FZMA 1JYNA 1RUC2 3MV11 5CFCC 3WCSA 3WUDA 1ODMA 3RPQA 1I1EA 4KWLA 1BEV3 4RS5A 4COYA 2D5FA 5FY9A 5ACA1 3ZN6A 5APAA 3HBZA 4AFAA 3WD5A 1ZBE3 4GXLA 5FLJA 1V6MA 1D4M1 1EY2A 4FPEA 1UX6A 1QXPA 4GMP0 3WNXA 1S0CA 4LKSA 5JZGB 2RJLA 4PIZA 4LO8A 4AFMA 5T52A 5JXJA 2GALA 5BNNB 2QZ2A 3DXUA 4QQOA 2OUJA 1WMDA 4JHZA 4EN9B 1JYTA 5FZOA 1H1AA 4NOTA 4CDWC 5EPAA 3WG3A 1C8M3 5FY5A 3ACFA 3MO4A 3FFQA 2JX9A 1IPJA 4O61A 4PLNA 2HLEA 1OC1A 4HK9A 4KNCA 1NZIA 4DEVA 2JDUA 1L7RA 4XTMA 1H4HA 5L73A 3RZHA 2I45A 2VUDA 3MI8A 4YW7A 3HWJA 1W8UA 1Z0HA 4YZ3A 4FAHA 1NXMA 4YNIA 4A42A 2BUKA 1RUD3 1AR83 2VD7A 2BNMA 2VZQA 2RVAA 4OZOA 4XQWA 4YM2A 2QQPA 2ZGTA 1G86A 2HWB1 3OYWB 5GJ6A 4PF5A 4UFJA 3VBOC 5A1AA 1YFWA 1WCKA 2D6LX 1J1LA 4M3CA 2A70A 2YBKA 1ENRA 1Y43B 2WZR1 4QQPA 1OXCA 2HYXA 2NQYA 1J84A 1S0IA 4EN7B 1DZTA 1GNHA 4S2DA 5FMCA 3P6BA 2GMPA 2ZKLA 1JI6A 5IT6A 5FZEA 2DU1A 4DXRA 2AEZA 3TN93 2MEV1 1G9AA 1B09A 2BGCA 4LBLA 1H1IA 5GLZA 4NIIA 2R1DA 3TEYA 4CP0A 1MR5A 1FYUA 2PHLA 4MGTA 3J7HA 4IEPA 4MGIE 1QJY2 1R091 2UU8A 3SNMA 2VMGA 1R64A 4CXYA 2OS2A 3NO8A 3BKZA 2HWC1 1DF0A 4SLIA 1JYIA 1BKZA 1XNCA 2BFUS 2NP0A 3EO6A 3KWVA 4CDUB 1ZZ6A 1YEWA 3OD4A 5FYMA 5A6ZA 5CG8A 1VRBA 3JCIA 1YQ8A 1I9RA 4M0HA 3WHUA 4AVSA 4OHZA 2YHJA 2HWF3 5DDJ3 4LOTA 4X8PA 5FY1A 4DXZA 1QQP3 1L7QA 1AYM1 4WV8A 2A3XA 5T54A 4H2AA 1TME3 2VC9A 4YSFA 1CESA 2ZBJA 5JDBA 1NOVA 2YDEA 1PIV3 4ASMB 1W2TA 1YO8A 5JXGA 3ACIA 1RUF1 2CHHA 3RRDA 3U11A 3WZ1A 3ZYHA 3U14A 2BJSA 1POV0 2JB4A 2VZ3A 3POBA 1IQDC 1S2BA 2PQSA 4Z1VA 3T1MA 2V5YA 4XAAA 2WNUC 4JC1A 3VZMA 3LDKA 1AXZA 5FK7A 4BLIA 3D82A 4OULA 5IK5A 3ILNA 3AVSA 4TSVA 2JG8C 4Y20B 1CZTA 3U1XA 1Q5OA 4CUCA 2XR4A 4XBQA 1AR61 1YFYA 2VCAA 3JZVA 4IDZA 1K5JA 4CCMA 5DG2A 2GDFA 4E4HA 2F17A 1LOAA 4FOQA 4WM7C 4RR3B 2D43A 1BMV1 2ZHMA 1DQ2A 1Y7BA 1ZBA2 3A4UA 1OQEA 3BVCA 3CJXA 3J7MA 3GCXA 3VD7A 1EV11 1XRUA 1X7NA 1POV3 3DKWA 4XF3A 3FMGA 2BQPA 4DUXA 3OEAA 5IVFA 3KCXA 3GXUA 2W5FA 3NV2A 1L3JA 1BJQA 3CKHA 2WKKA 3BIEA 1GFF2 2WC2A 1MEC2 2WJSA 3GBGA 2ZMKA 1LKNA 2I2SA 2F4LA 2A73B 3OD0A 2HKXA 4MVTA 5CA6A 5D2AA 1HDKA 1RHI1 3ACGA 2XGXA 3VGIA 3S0MA 2WS93 2XUEA 5A3LA 5F39A 2AZ5A 2VBBA 2IWGB 4DMIA
chains in the Genus database with same CATH topology
2ZABA 4B7EA 4BIFA 1VB2A 3O14A 4ITCA 4XQ4A 4DY5A 1NCQA 4J1WA 3MIBA 2JE9A 4ATEA 2JKBA 4RFT0 3ZVXA 1RUG2 2X5IA 5EYXA 5JVVA 3WDTA 5IK4A 2IFWA 3FBMA 1QDCA 1YXWA 4XIOA 3ZIWA 1Q8QA 1V6NA 4HZFA 2EXKA 3WW2A 4BWOA 4XTPA 4ZU4A 4N53A 1VBD1 1PGW2 4QPIA 3K48A 1DQ0A 4AEDA 4FTEA 3V0AA 4JDNA 3VHRA 1UPIA 3D5OA 3RYRA 1DZRA 4CEWC 1A6CA 4WM8C 1S0BA 3X29B 1TMF3 1D4M3 1VBE2 2XJTA 2E63A 3E6BA 1QJU1 4IL7A 3H3ZA 1NE6A 4YLZA 5GKAC 2V73A 1SFNA 5CFDC 3EJKA 2KA3A 3IIAA 3LA3A 5HCBA 1CQ9A 4Z82A 4GB33 1VIWB 1OSGA 1XYNA 1UIKA 1OOPA 2LUWA 5JOXA 4XW3A 4PIXA 1X8MA 1C28A 3TBDA 3EQEA 4PBPA 1CX4A 1AL23 4HL0A 4FXGB 5BPXA 5CBLA 2HWE3 3DPRC 3OY8A 4LA2A 2BVBA 2NMNA 4Q4V1 3VLBB 5BNQA 2HWB3 1UW8A 2BW8A 4QHBA 4S2FA 5EZWA 3K51A 1ZZ7A 1LU2A 3L2HA 3SISA 5C9AB 1ULFA 2WZR3 4XFHA 2UYAA 3BPZA 5DUVA 5T3NA 1KS5A 1N1SA 1RMU3 5CB7A 4GIQA 1UD1A 4D3WA 2VUAA 5JOWA 1XXNA 1RUE2 4AI0A 2HWD1 2FMDA 4RQPA 1ZZ9A 1GZWB 2AUYA 3PJQA 1ASJ1 1JN2P 5BNPC 5ABJB 1QNYA 1NCRC 2E9QA 2VMIA 3CO2A 1GANA 1Q8SA 4I0AA 1JOJA 4RA0A 3DUIA 5JWPA 3W58A 2DCYA 2RS12 1CAUA 4IEXA 3HN1A 4AXOA 4WBBA 4HBNA 4XYXA 2DTYA 1EYBA 1RUF3 2IXJA 1PM7A 1NXD1 1W6MB 2EA7A 3IKWA 1FAYA 1XU1A 2B5HA 5LRRA 1AR91 5FDBA 4AGRA 4DQAA 4IEWA 1ZRRA 1CVNA 2PQQA 5A32B 4AFBA 3NWKA 1O5LA 3IDEA 4GH4A 4CEYC 4XMAA 4HN1A 1MZ6A 4MXVA 1QJX3 3LA7A 1ZBE2 3JD72 3PVEA 1CAXB 3AJYA 5AC91 5KXEA 4XHBA 4Q4W1 2DVGA 3TNPB 3ACLA 1CAWA 1RUI2 3SCFA 4CEWB 4MH0E 4Y1UA 4NHLA 4BE3A 4LO7A 1MQTA 3AFGA 3WY6A 2QCSB 4B4RA 3ST7A 5HI0A 1NA1A 4N7IA 1OFSA 3WOGA 1H1MA 1BVP1 4I30A 4KG0A 5I8SA 3RJRA 2OYZA 5CFDB 2WSUA 1Z7S1 5T5JA 3SMHA 4FOVA 4BLJA 3VBUA 2X8KA 1W6QB 2DVFA 4YFWA 5JIUA 1RUD2 1IS3A 3AP5A 1GV9A 3B01A 1AR82 2DUPA 4XFAA 5I0RA 2CY6A 4RSUA 4GQ7A 2HJIA 2Z2SB 1N3OA 1REFA 4K40A 1W39A 1A8DA 2ZGMA 2UWAA 1GBGA 3UKTA 4E4ZA 4LBMA 1DU3D 3WV6A 2R073 1LOFA 2IXCA 2R6QA 4XIKA 1PO11 1RUC3 4BMEA 3AKTA 3ZIXA 3TN92 5DZFA 4AEMA 1R1A1 3D6EA 1AXYA 2R061 5AFBA 4F3JA 3KLSA 1OD5A 1OLQA 4JRLA 4YGDA 1YHFA 5EYYA 4FPOB 1ULCA 3N36A 5LEKA 4INDA 3VZOA 2ZGUA 4YRDA 2Q1ZB 5K8SA 4YVWC 1YRZA 1J3RA 1SLTA 3MYXA 4CRQA 1H2LA 3GYDA 2P37A 1W0PA 2ZJCA 3B94A 3FUQA 3USUA 5DDJ2 2C1FA 3B02A 2I07B 1QQP2 5HXVA 2GC1A 1AX0A 1AJKA 3OF1A 4LUMA 4S2HA 2WSVA 4DINB 3B9IA 1JBCA 1GZCA 2ZMLA 2DURA 4XZPA 4BCUA 3QH6A 3PVBB 2X5IB 4LBQD 2RR12 1A8MA 4MXWB 4Q4V3 3ZXFA 1QNWA 1MACA 3B7MA 4K1ZA 5CNAA 1PGSA 3M3EA 1YFXA 5DZGA 5GZCA 4N53B 2ZGNA 3LGRA 3NV3A 3AKQA 1VRH2 3MIGA 5EXOA 4AEDB 3DGTA 5FQ0A 1ND3A 3V0BB 4YVSB 5CADA 1ZRFA 4IEZA 4O9GA 5E16A 4QXKA 4YM1A 3WQ7A 2BFUL 3NAPC 3O0VA 2HWD3 2QUOA 3H1WA 3NSTA 2A6YA 4GKXA 3WDYA 3WT3A 1O91A 4IQPA 2D6PA 1LHNA 3ZXGA 3ME2A 4F7ZA 1E57A 4I2OA 4PBOA 1AF9A 1G8WA 1V6LA 2JENA 4R9AA 2EXIA 1R081 3ALQA 4FOWA 5J09A 4CTEA 1SLAA 2VQAA 2YGMA 4RGGA 1V9U1 4NVPA 1HRI1 1ZA4A 2XH6A 1J1TA 2JECA 1GYKA 1MS8A 4IXLA 4C0HA 2BEOA 1G7YA 4FQZA 3J4UH 1W2UA 4KL1A 3UJQA 3A0NA 4DRRA 3KT1A 5D8AA 3VBRA 3QCWA 3AM2A 1PO22 4PDWA 3E97A 4CDXC 3VBHC 1FPN2 1FOD1 4FPKA 2ZX0A 3LAGA 4QX5A 1AX1A 4AHZA 1RVF1 2OZ6A 5GZGA 1VBA2 3ZXJA 1HQNA 1HQWA 4XJZA 4D7YA 1ZBA3 4J6GA 1VBC1 5ACA2 3QOPA 4EWEA 4IV3B 3VHNA 4Q4Y1 4N43C 3RG0A 1IS6A 1D4M2 1O5UA 5AC93 4FCAA 4XJ9A 1LODA 2WT0A 5KXDA 1RB8G 5FO7B 3FLTA 3R0RA 1MEC3 1W0OA 2PN5A 4WVMA 2JDZA 4H7LA 1MS4A 2DFCA 2Z5WA 5JMCA 1FXZA 1XQNA 1CAUB 1R1ZA 4YVWB 5I0TA 3UL2A 1PK6A 3AMMA 3VBSA 2UY9A 1Z7S3 1DGRN 1LCLA 4HKLA 1N47A 2ZKNA 2PHTA 5BNOC 4CDQA 1W6NA 2XLFA 1Q8OA 1K5MC 1OFNA 2HWB2 3G6JB 1AHSA 2WNVB 2ILMA 1UZZA 3CNAA 2DF7A 2WZR2 1AXKA 3KQRA 2BPA2 2WIIB 2A6XA 2VOVA 1JYCA 5JZGC 3WDWA 4FOYA 1WUVA 1H8TC 2MEV2 5BNNC 5GLUA 4YW3A 4M3CF 4HSLA 2PLV1 5C8CC 2Y26A 1CAWB 2RS51 3J8F1 1VBE3 4FVVA 4KGQA 5FFOC 1R092 1OPMA 3ES1A 2TNFA 2HWC2 3CJIA 4QPGC 3E5XA 3V56A 2R16A 4OI1A 5FAXA 1AR71 2XBO1 2ZX2A 3MFAA 1HXS1 5L7OB 3PVOA 1GR3A 3POSA 4P9GA 2AYHA 3FE5A 2PHRA 3GHNA 4S2GA 3I8TA 2VPVA 4EJRA 3VBUB 1RUJ1 4OLLA 1SQ4A 1AYM2 2E51A 4IEYA 1YI7A 2Z69A 4HLTA 2JG9A 1WLDA 4J1XA 4Q4X1 2Q30A 4OI4A 1RUF2 3AK0A 5CU1A 4YW4A 4XBLA 4PQ9A 2GNDA 2RM21 2RMU1 4C1WA 3OBRA 4AI3A 3AYCA 3TOJA 4UW5A 5LRSA 1TNRA 2DV9A 1RUE3 2EXJA 3LSEA 1GLHA 3ZFEB 4HVQA 1AR62 4DB5A 5IK7A 4UW3A 2JD4A 4ONUA 1C4RA 3ZYIB 3VUOA 1RJ8A 4CDUC 1YNAA 2WL1A 4YZ4A 1BMV2 1F9KA 1MZFA 5J37A 1RGSA 2QFEA 5J96B 1EV12 2BWAA 1MS1A 1MZEA 3KGZA 2DVDA 1B35B 4N43B 1APNA 2ARXA 4IETA 4NWVA 3VBOA 3ZFFA 1RHI2 3WUCA 4NPRA 4D7SA 3RNSA 1HRI3 1GQHA 2C0ZA 4E2GA 2BNOA 4LBKA 4H7MA 5FOJB 3KGLA 5J48A 3OPZA 3AZVA 4B4PA 4AFDA 4NR1A 1WCSA 4XFGA 2PAKA 5GALA 1KITA 4W65A 4RR3C 1D4VB 2HEYF 3CLPA 2D40A 2WFF1 1MVQA 1RIRA 2IXLA 5K0UA 2ZGOA 3ZYJB 1DQ4A 5I0UA 2D3RA 1VBD2 5LEJA 1QJZA 5KXCA 1DG6A 3AP7A 4LBJA 4MGYE 3JD73 3WDUA 4AVTA 2I74A 1VBC3 2CGNA 1ZX5A 5I8YA 3AP6A 2AGSA 1H8TB 1RUI3 2WA4A 3E5QA 2VOKA 2Y0OA 2QDRA 5AVAA 1TNFA 1NY71 2GU9A 4R4XA 5C8CB 1QJU2 1OHFA 1OA3A 2SLIA 4HSJA 4M00A 3THPA 4D69A 1LU1A 4LEJA 4QPGB 4N90A 3SH4A 3B00A 2WNUA 5GZEA 1FATA 4AQSA 3H7YA 4WVWA 2F4PA 4A2UA 5D8AB 3DN7A 5KHJA 4FP2A 3ZXEA 3RYPA 4Z2WA 3RMYA 1W6OA 4ISQA 4WM7A 1WBFA 4LULA 3M2MA 4OHVA 1WLCA 4Q4V2 4AWDA 2VMHA 4DPNA 2QNKA 2RS31 2PHWA 2GNMA 1HQLA 5AVPA 1PVXA 2IXIA 1V70A 2N7GA 4Q8KA 4QU2A 1KJRA 1ZZ8A 3B93A 4XJUA 4AHYA 4R9DA 2SBAA 2XKOA 2GH2A 4RL7A 4X8NA 3MICA 4COVA 2UWCA 2DU0A 5I93A 4Y22A 2HWD2 3ZSEA 4Y1XA 3G7DA 4G3YC 3SXWA 2PLV3 2FBEA 1ASJ2 3BOWA 4QPYA 1CGPA 1N1VA 4WVVA 2DCTA 4WVMB 3N7LA 3U4XA 1LGBA 1WW7A 4SBVA 3TYJA 1HXS3 4LBQA 1N1YA 2ZGPA 5JR7B 1A3KA 3I59A 1AL0G 2Z79A 4XHXA 1T6GC 3GBFA 3FZ3A 4JGYA 5E8AA 2B9UA 3QH7A 3N3HA 3ZMNA 3W59A 4CDQB 1SCSA 1W6NB 5KXBA 2P2KA 4RHV1 2A71A 1C3HA 5C9AC 3N7KA 1EAH1 2RR13 3R05A 4OZXA 2EAKA 3IPVA 4AVBA 4WM8A 5T5PA 2JEMA 2RM23 2RMU3 1VRH3 5HBAA 4YFZA 4KQ7A 3WQ0A 2UURA 1ND2B 5FPZA 2ZMNA 4LHKA 5C4WA 2DCKA 5KC5A 1PMIA 5KHHA 4HN0A 5ABJC 3JQWA 1Y3TA 3UV9A 1H8VA 4UW4A 3RI9A 3WCRA 5CG9A 3D8CA 1BBT1 1ONAA 1QKQA 5AC92 3T1LA 4BA6A 1J3QA 5DUUA 1LOBA 3H3UA 4PCRA 1URXA 4Q4W2 3ZXAC 4JDOA 4LNVA 4FQ4A 2FQPA 3VDDB 3ZFGB 3DPRA 3WDXA 4Q1RA 5A33B 1YIFA 3J26N 1RTVA 1CIWA 2YGLA 2GAUA 3FJSA 1DFQA 1QDOA 3IBMA 3VL8A 2GC2A 4XQDA 3SHRA 4CYDA 1Z7S2 4KH9A 1FT9A 1VR3A 2X53S 4G4FA 1LHOA 1CN1A 1S2KA 3KZ4C 4E27A 1PO23 4WZCA 1FPN3 2D6MA 2W68A 3AB0A 1UU5A 4C0BA 2NM1A 3PJYA 2ZHLA 1S1AA 1LR5A 5T5LA 1OMIA 1NCRA 4JTNA 2B42B 1VBA3 1SMVA 5JLVA 2WFF3 1PO12 1C8NA 5JOYA 4YM3A 3N4MA 2GZWA 4AHWA 2NZ9A 5ACA3 1QOTA 1R1A2 2R062 1C5IA 4FO9A 4XF0A 3ZSMA 5FO9B 4L92A 3WINE 4P5HA 2CTVA 1ENSA 2A7AA 3GBWA 5EFUA 2XJSA 4K20A 3ZFFB 1XNDA 5E88A 2XVKA 1FV2A 1ZRDA 1QY4A 4K9SA 1IKQA 1XU2A 4O9EA 4YZ5A 2IC1A 1REDA 2DFBA 4OHXA 4H14A 3V64A 2H0BA 5KHKA 3QD6A 4CEYA 1JTZX 4XEZA 2R1BA 3ATGA 1F31A 2HEWF 4IV1B 1VAMA 1JUHA 2NYYA 1PVC1 5K0UB 2RS33 2CAVA 4RS5B 3LB9A 4L8QA 3ZN6B 4L97A 2MEV3 5K7PA 3AZZA 1KS4A 4YYOA 2FZ1A 3NV4A 5F9TA 4MLOA 2CV6A 5T5OA 3RJ2X 4A7YA 1R093 3BTAA 4JV4A 5LK7B 2B39A 2HWC3 3WR0A 1LHVA 1OA4A 4GWNA 1MS3A 4Q0SA 4TYSA 1V6OA 1U5IA 3NKGA 4KU8A 1QU0A 2E53A 1NCQC 1V6KA 4FAGA 4Q0QA 3TRSB 3FFZA 1DLLA 3WX5A 1R082 2KXLA 3MEPA 4YW2A 4JTOA 1AYM3 2FMYA 2X5IC 1J3PA 1BCXA 1IGOA 1QGLA 1LULA 1V9U2 1HRI2 4LR4A 3FX3A 5JSPA 1GQGA 1W6OB 3M3QA 4E2QA 3ZYPA 2AH2A 2AR6A 3M3OA 4LE3A 4N53C 4RHV3 4M3CB 2D44A 3B69A 2NPIA 4AEDC 2ERFA 4YVSC 4U36A 1FMD1 1FOD2 2ET7A 5H9QA 1YUDA 4HFSA 1RVF2 1Q3EA 1AR63 2CYFA 4YZ2A 1TQ5A 3AMNA 4K8FA 1OI6A 1SFYA 3WW4A 3AZWA 2FHRA 4CP1A 1V6IA 1VBC2 4FPHA 1G9FA 3VHPA 4KBBA 1EV13 1OOPC 3N7MA 2LTNA 4HVOA 3VBFA 5CA6A 3NV1A 1J58A 1LHUA 4IEQA 4Q4Y2 1RUH1 2AREA 4OUMA 4A3XA 1SCRA 1QXJA 1SLBA 1DZQA 1ENXA 1GICA 2C5DA 3I59B 2BNNA 2GNTA 3I7DA 4M0NA 4JVAA 1RHI3 4JGYB 3QACA 4GWMA 5TSWA 3VHOA 1U0AA 1ZYBA 4AFCA 4AHXA 4FT8A 5D1IA 3ZO0B 1AYN1 2O8QA 1HRV1 2ZGLA 4W6YA 2DVBA 4WVZA 3MLLA 2NLRA 2JXAA 2TUNA 1LHWA 1QOOA 3NAPA 4AE2A 4YW1A 4META 1V6JA 1AZDA 3AJZA 3VZKA 5F6KA 4JGZA 2XKPA 5C4WB 1AVBA 1ENQA 2ZS6B 5L19A 5IK8A 2CGPA 2VGDA 4IV3C 4QQLA 5JPMB 1VBD3 1JH5A 4AW7A 4AVAA 3MLJA 1IZ3A 1SLLA 3OBTA 1F2NA 3UK9A 2UWBA 2Y38A 3O5SA 1RUG1 2PLV2 2CAUA 3RMXA 2RS52 3J8F2 2WWSA 5F5QA 2R041 1QJU3 4LLFA 4XXPA 4X6QB 5DUXA 3MIDA 2A3YA 1LJ7A 4ISRA 3V65A 1AR72 2XBO2 1HXS2 1CJDA 1O4TA 4MX3A 2OZJA 4XFFA 2BBVA 4WZFA 5JIAA 1NCQB 2EALA 1WMEA 1HIXA 1QHDA 1RUJ2 1FNYA 5C8WA 3LWCA 3RI8A 4JAAA 2WNVC 4FPFA 4DRVA 4GH4C 2VULA 3T2TA 4Q4X2 2D6KA 2YPJA 3KS7A 3PMSA 4MGKE 1DDLA 1UF2C 3A0KA 1CJPA 2RM22 2RMU2 4PLMA 4NHKA 2NN8A 4QPIB 1PVC3 3M70A 3V0AB 3S30A 4UBGA 4LBNA 1M4WA 4I0WB 1XE8A 2H6CA 5HCFA 4K21A 3E5UA 3QLQA 1UU4A 1Z78A 2GN7A 5L7OC 1EPWA 1ASJ3 2VNGA 2BTVC 3I54A 4DY3A 2EAAA 1DHKB 5EJ3A 2K0GA 1UIJA 3M1HA 2OIIA 5E1RA 2IXHA 3VBUC 4JDMA 1OOPB 3AXEA 2E7AA 3M8LA 5I8TA 2TBVA 1OLRA 5C6CA 4BYYA 3GHMA 5DXDA 1K5MA 4XF4A 3CL1A 3H9AA 1BQPA 3O0WA 3ROUA 4C90A 4OVEA 5B2GB 3OY8B 2D98A 2JJ6A 3AMHA 1XYOA 1LOFC 2XLGA 2GC3A 5JZGA 5BV6A 1AR93 3ZFEC 2Y0IA 1RINA 4LTAA 3UKVA 1VAVA 3CU7A 3WP3A 4RQPB 2BWCA 2D93A 3FHIB 1G6NA 1UPSA 2WFF2 3AXDA 4TWTA 1I3HA 3AKRA 1B35C 3M3CA 1CAVA 1X36A 4L99A 1CD3G 3U10A 4HK8A 4HMZA 1BK1A 2GMEA 1JW6A 3OYWA 4Q4W3 3KMHA 5JI9A 2E6VA 1RUH3 3R4DB 1H2NA 1NY72 2CL2A 1DQ1A 3MIEA 5JAXA 1BEV1 4JQRA 3ZXKA 1RUNA 2UY8A 2P3IA 4LO4B 2NMOA 1HLCA 2WT1A 3NVCA 1LB2A 1V00A 2VW2A 3D4KA 3MPPG 2O8OA 2WLQA 1AYN3 3VZLA 1HRV3 5BXXA 2ZOEB 2MPFA 1UU6A 3LA2A 1DYPA 3RSJA 2WQ4A 4BIOA 1C8M1 3O0XA 1GSLA 4GH4B 2PELA 5H9RA 1S0EA 1OKQA 2R32A 2RS32 4N7UA 4F8AA 2ARBA 1VJ2A 1PO13 3GZAA 3VV1A 4GMP1 3U0ZA 1O3SA 1R1A3 4ZXKA 2R063 1UN1A 2VW0A 1YIPA 3POYA 1VAKA 2QDNA 1OA2A 1H30A 3LSDA 1MQTB 2OA2A 1BVVA 4FTBA 2R043 1NA1B 1KQRA 3ZXLA 3AYAA 4FSJA 1BZWA 4Y20A 1H4GA 2ZZJA 2WT2A 5D8AC 4Z07A 2Q0AA 2ZX3A 3ELNA 4RR3A 5FCCA 1DBNA 4PLOA 1D0HA 5F6LB 5CFCA 1NE4A 3ZYRA 1LENA 2DYCA 1XNKA 1O3RA 3B9CA 1LOCA 4RHV2 2ZZQA 4JGZB 3H0OA 1EAH2 1Q8VA 3R6SA 2HWF1 1S0GA 3WDVA 3N35A 4LE4A 1ZVFA 1FNZA 4QD2A 3HT1A 1GZ9A 4Y1YA 5FOBB 3HIFA 5FRAA 1TME1 3VZNA 3RZZA 4P9YA 1IPKA 1PIV1 1JUIA 3MW3A 4CDWA 3M7AA 5L36A 2A75A 1SBDA 4OHWA 3NW4A 2D3SA 3RYKA 2P17A 4FXKB 4URTA 1AUYA 5FBZA 3URFA 3E6DA 3HMYA 1RC6A 4OI0A 3AX4A 4BPZA 3MIFA 1BBT2 1WW4A 1VBB1 1WW5A 3H8UA 3SCHA 3USUB 2VY0A 2IZWA 4LLOA 4XJWA 2XL9A 2QKDA 1O4YA 1R083 4YG0A 4CDQC 2VVDA 4YG6A 1V9U3 4HANA 1POV1 3BOPA 5GZDA 2PHFA 1I6XA 4EROA