3NW4A

Crystal structure of salicylate 1,2-dioxygenase g106a mutant from pseudoaminobacter salicylatoxidans in complex with gentisate
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
363
structure length
363
Chain Sequence
KLDHESVTQAMQPKDTPELRALYKSFEEESIIPLWTQLGDLMPIHPKSKAVPHVWKWSTLLRLARKSGELVPVGRGGERRALGLANPGLGGNAYISPTMWAAIQYLGPRETAPEHRHSQNAFRFVVEGEGVWTVVNGDPVRMSRGDLLLTPGWCFHGHMNDTDQPMAWIDGLDIPFSQQMDVGFFEFGSDRVTDYATPNFSRGERLWCHPGLRPLSGLQNTVASPIGAYRWEFTDRALTEQLLLEDEGQPATVAPGHAAIRYVNPTTGGDVMPTLRCEFHRLRAGTETATRNEVGSTVFQVFEGAGAVVMNGETTKLEKGDMFVVPSWVPWSLQAETQFDLFRFSDAPIMEALSFMRTKIEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gentisate 1,2-Dioxygenase
publication title The salicylate 1,2-dioxygenase as a model for a conventional gentisate 1,2-dioxygenase: crystal structures of the G106A mutant and its adducts with gentisate and salicylate.
pubmed doi rcsb
source organism Pseudaminobacter salicylatoxidans
molecule tags Oxidoreductase
total genus 102
structure length 363
sequence length 363
ec nomenclature ec 1.13.11.4: Gentisate 1,2-dioxygenase.
pdb deposition date 2010-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07883 Cupin_2 Cupin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3nw4A01
3EQEA 1O5LA 2I45A 1O3TA 3PLQA 1YFYA 1NYWA 5FLHA 3LA7A 1VR3A 3H9AA 3ES1A 4JTNA 4QM9A 2D93A 1ZRCA 2CAVA 2Q1ZB 1I5ZA 3I7DA 2IXCA 2GH2A 4IERA 4X6QB 3SXWA 4LEJA 1RTVA 4ZU7A 3RYPA 2XGXA 5T3NA 4PIYA 5E16A 3KGLA 4IESA 4QX5A 3S7IA 3HQXA 1VP6A 2BYVE 2O1QA 3H50A 3NVCA 3UKTA 5J7MA 3O14A 4MZUA 1CAUA 4XFGA 2H6CA 2XL7A 4PIXA 3H7YA 3E5QA 2OZ6A 4Z82A 3U11A 4R52A 3I54A 4B29A 2F4PA 5I93A 3RYRA 3ACLA 4UXAA 1NE4A 3I59B 2WC2A 3D0JA 4GULA 4XFHA 3UKVA 3S0MA 1Q5OA 4PJYA 4N9IA 3IIAA 5FLIA 4EWDA 3M3IA 4Q0QA 2XLAA 3H3ZA 4JVAA 4D7TA 4A2UA 5F1RA 2GU9A 3H1WA 5BXXA 4XF4A 1YHFA 4LULA 5I8TA 4QMAA 3CO2A 1J3RA 2QDRA 2EA7A 2IC1A 1CAXB 1UD1A 2GZWA 3SCGA 5BPXA 5CADA 2MPFA 3CF6E 4FAHA 2P17A 1O3RA 2H0VA 4IEWA 3GYDA 4D7SA 2PQQA 3TNQA 3CEWA 4YSFA 2Q30A 3HT2A 2ZKLA 1J59A 3KSCA 2BNNA 2PHDA 1GQGA 3G7DA 2HJIA 4TLFA 1O3SA 1ZREA 2VQAA 2Z69A 4YRDA 1EP0A 3E5UA 1O5UA 2B5HA 3NJZA 4O9EA 2IXLA 2XKPA 3OCPA 1SQ4A 1X8EA 1ZZ7A 2VPVA 4HMZA 1X8MA 3IBMA 3QOPA 4I2OA 1YUDA 3QACA 2ZCWA 3N4MA 1VJ2A 1CX4A 2EVXA 3UKNA 5FQ0B 1RUOA 4XF0A 3FHIB 3SCHA 4Z07A 1CAVB 1YWKA 1LKNA 4META 2QVSB 2Q0AA 1LRHA 3CL1A 1CAXA 4FT8A 3FE5A 3FFQA 1UIJA 4MH0E 3R6SA 2GC1A 5JR7B 4BH9A 3USSA 4KU7A 4IEXA 2Z2SB 4EWEA 1FI2A 2C0ZA 2ATFA 3E6BA 4XEZA 4XFBA 3M70A 4BHPA 2HKXA 4KWLA 4BIFA 3S7EA 4Q0PA 4PIZA 4XETA 3KMHA 2B8MA 2K9ZA 3DKWA 2VECA 2B9UA 5FPXA 2BEOA 2PAKA 2PA7A 1ZRFA 4F7ZA 1UW8A 4N9HA 1ZZBA 1HW5A 3H8UA 1IPJA 3EHKA 1WGPA 3DL3A 1Y3TA 4LLOA 1J3PA 3SHRA 3MPBA 4NVPA 2WFPA 5KHIA 3NSTA 5I8YA 4EWAA 1WA4A 4AXOA 5AVPA 4MUVA 3C3VA 1ZZ6A 5FQ0A 3BCWA 5JSRA 4MX3A 1XE8A 1CAVA 4AVCA 1J3QA 4QGNA 3CLPA 4QGMA 4XFIA 3BPZA 1SEFA 3LAGA 4JV4A 1V70A 3OGJA 1Q3EA 1U12A 4WZCA 2FMYA 3RDIA 4HBNA 4XFAA 1FXZA 5FDBA 3H7JA 1WLTA 2XLGA 5D1IA 2GC2A 4HSJA 4R8HA 2OPKA 1RUNA 3NL1A 4Q0VA 4O9GA 3D82A 4UBGA 2IXHA 4I0BA 5E1RA 1UCXA 4IEZA 2D5HA 4ORFA 4ZU5A 5KHGA 3ES4A 3RZZA 5KHKA 2CV6A 3KGZA 4E2QA 4J1WA 4WBBA 1XRUA 3TNPB 2PAMA 2Q4SA 4KL1A 5LRSA 4EROA 2QCSB 1J1LA 1QY4A 3E97A 3NW4A 5LEKA 1XE7A 2PHLA 1RC6A 4LA3A 4YYOA 2QNKA 2D40A 1RL3A 3HT1A 4XF1A 4K8FA 1LB2A 1ZZ9A 2XLFA 2ET1A 2D5FA 4LUKA 4HLTA 5FCCA 5BUVA 1DGWA 3U10A 4LTAA 1DGRA 2PYTA 3EBRA 4QM8A 3RYKA 4MGYE 1DZTA 2H6BA 3SCFA 3LWCA 4I02A 2MHFA 5EFUA 4E2GA 1ZRDA 4MV2A 3GBFA 5I0UA 1CAWA 5FPZA 1QWRA 3ROUA 4HSLA 1PM7A 1IPKA 1Q43A 1O3QA 1JUHA 4I01A 5JAXA 3IDBB 3E6CC 4MGZE 4IEPA 5EZWA 4KWJA 1LR5A 4KU8A 2EAAA 1NZCA 3FJSA 5BY5A 4Q0UA 3MYXA 2UYBA 4HVRA 1RGSA 3EO6A 3FX3A 3RNSA 1YFUA 3OF1A 1GQHA 4OLLA 4EV0A 4ONUA 4IETA 5I0TA 1OMIA 4Q29A 1G6NA 4HZFA 4HN0A 4DINB 4YARA 1X7NA 3RPQA 1H1MA 2DCTA 2GC3A 3B02A 2IXKA 4LA2A 1UPIA 3E6DA 1O4TA 1SFNA 4L2NA 5FLJA 1ZZ8A 3IWZA 2Y0OA 3E5XA 3L2HA 3WW2A 1J58A 4P9GA 4AVAA 1I6XA 1O7FA 1ZVFA 3ST7A 5JSPA 3IDCB 1DZRA 4XFCA 5I0SA 1ZZCA 1YFWA 3ELNA 2XKOA 3ETQA 4IEYA 3KCCA 4QXKA 2XHKA 5BV6A 4F8AA 3EJKA 1TQ5A 1ZNPA 1OD5A 2OYZA 3H3UA 5CU1A 3MDPA 1EPZA 2MNGA 4LUMA 3BALA 4IEVA 4MGKE 3U0ZA 4RD7A 3WW1A 3HIFA 3BU7A 4H7LA 5I0RA 1CAWB 4KWKA 5JCTA 2QJVA 5J48A 4FAGA 4XF3A 3LOIA 2UY9A 2O8QA 1YLLA 4IEOA 3ZDSA 4AQ2A 5KHHA 5LEJA 2PTMA 4FBFA 3PVBB 4XFFA 4QGLA 3OTFA 1CGPA 4HVOA 2V09A 1OFNA 2IXJA 2PAEA 3FWEA 5LRRA 5I8SA 3JZVA 1EYBA 4L11A 2IXIA 2UY8A 4I3PA 1FT9A 4MGIE 3SMHA 2FQPA 3LA3A 1QXRA 4HVQA 3H1MA 4YNIA 2OA2A 4HN1A 1Y9QA 4OFGA 1X82A 4I09A 1L3JA 2PFWA 4JTOA 3LZZA 3WW3A 4J1XA 2OZJA 4ZU4A 4Q0SA 2ET7A 3BB6A 3OD0A 3PNAA 3VHRA 4X6RB 1OI6A 1QXJA 2CAUA 1YFXA 3DN7A 4CYDA 3DV8A 1H1IA 3FZ3A 1EY2A 4E2SA 5J3UA 2E9QA 3LA2A 4BYYA 5KBFA 3MZHA 2CGPA 5C8WA 3H1YA 2BGCA 3D0SA 1PMIA 3I59A 4IEUA 2UYAA 1ZX5A 5CVRA 3CJXA 1CAUB 5I91A 2ETEA 4IEQA 2GAUA 4XF9A 5C6CA 4UBHA 2N7GA 3NKTA 2XL9A 4I0AA 5JSOA 3WW4A 5HI0A 1UIKA 5KHJA 1ZRRA 2GC0A 4AQ6A 1NXMA 4AVBA 2BNOA 2KXLA 2BNMA 4WVZA 2K0GA 1NE6A 5K8SA
chains in the Genus database with same CATH superfamily
5DG1A 4XYXA 2ZGUA 1GNHA 3KM5A 3PLQA 1W6OB 1N1TA 4PBPA 1GP6A 5DAXA 2VXJA 3ZM8A 5E6HA 1VR3A 1UX7A 4ZS2A 4ATFA 3ES1A 4GB31 4CTEA 4CDUB 4QM9A 1RUC3 2EIBA 2X10A 4EN9B 1W03A 4C1WA 4LO7A 4QX1A 5FPLA 1I5ZA 4N7IA 2GH2A 2LS6A 3C7FA 4KGGA 1QH7A 3OPWA 4LEJA 1RTVA 4QKDA 4XOGA 5D8AC 4ZU7A 2XGXA 3I49A 3IAQA 4PIYA 1IQAA 1G8WA 1H8TA 1MVEA 3OBZA 2AACA 5CA6A 1WMDA 2BYVE 4MGQA 3ZXGA 1TE1B 1RHI2 2GMMA 5D2AA 4C0BA 2KD7A 5KXBA 5CFDB 3UKTA 1I5PA 1RUD2 5EJ3A 4COYA 2E51A 1CAUA 4QKNA 4NPLA 4UI9L 5K0UC 3VUOA 3VBUA 2ZGOA 1AVBA 4PIXA 1LGBA 3WNXA 3I2JA 2J1RA 1X9PA 3H7YA 4N90A 2HWB1 2HBUA 1IS3A 2JG9B 3W21A 1JYIA 1BMV1 1FOD3 1X50A 1AJOA 4R52A 1JUIA 3SISA 5C8CC 2WT2A 3PUSA 4XJ9A 1AR83 3ALQA 5FXZA 5ISLA 2X53S 4UXAA 4DUVA 1KJRA 1HRI1 3PUHA 5FY7A 1W6MA 1BEV1 1CESA 3I59B 1F5JA 5FZ0A 3UKVA 4LLFA 1RYYA 5CNAA 3PIGA 2CGNA 1FMD3 1GWKA 2R042 2QBXA 4N9IA 4ZZ8A 3AP9A 1K5MB 2VCCA 1NLQA 1B09A 3NAPC 4F83A 3H1WA 2B7YA 4P9IA 5BXXA 1EV12 5JZGC 5F3EA 2JG8C 1NZIA 1AYM1 2MEV2 5EP9A 5HCHA 3MIHA 5EJZB 1AL0G 4CE8A 4A3ZA 2DVAA 3LB9A 5EHDA 1QNWA 2QDRA 1D2SA 4HT1T 3L2YA 1K5JA 5FZLA 4E9KA 1J1TA 2JE7A 1RMU1 4JHTA 2R062 4GKYA 1GICA 3LSDA 2GZWA 4CEYB 2JE8A 3IT8A 3KVAA 4PBOA 2MPFA 4FAHA 2WNUC 2OPWA 3O0XA 3RSJA 5B2GB 4QPWA 1O3RA 1CVNA 1AR92 4MADA 2QFEA 3JQXA 2GDFA 1O6UA 4IV3C 1WA6X 4LBOA 4LNVA 5T50A 1R093 2Q8OA 4G3YC 3MHZA 4URAA 1E5HA 3OUHA 1W9WA 1F35A 1OKQA 1X33A 3I2HA 1J59A 1KEXA 2WWSA 4Q4X3 4RSUA 5FYUA 1GQGA 4TLFA 2ZX4A 3M3OA 2VQAA 1L7LA 2Z69A 4IL7A 2E32A 1PK6C 4B7EA 1POV1 4QX8A 3E5UA 4AHYA 1ZA7A 1OOPC 5C9AA 3B9IA 3OD4A 1NOVA 4JAAA 4RQPC 4NN0A 1UY2A 4S2GA 2EIGA 1R081 2VQTA 3LGRA 4WVWA 2XKPA 1TVGA 2OQ6A 1V9U2 4DY3A 5JXIA 2YC0A 1X8MA 1ULCA 5C7GA 2DVBA 1B35A 4AEDA 3QOPA 3A4UA 4I2OA 1PIV2 1VRH3 5A6QA 3N4MA 1VJ2A 1LGCA 1PO12 2KA3A 3DYOA 4FOYA 3AMHA 5CB7A 3SH4A 3WF2A 1CX4A 2WNVC 4XF0A 3SCHA 2WSVA 1M4WA 1AX2A 4OVEA 2J1AA 3CL1A 3ZN6A 1CAXA 4FT8A 5H9RA 2BUKA 3VKNA 3AL6A 1UIJA 1SPPB 4YGDA 3D4KA 5JR7B 5C70A 4TSVA 1QQP2 2XBO1 3V56A 1FI2A 3E6BA 5EXOA 2WLQA 3IB3A 3M70A 4ZHNA 4BHPA 5JPNB 1Q8PA 1D0HA 4KWLA 3BI3A 3PVNA 3LDKA 2QQIA 4CCDA 4MXWA 5F3IA 1Y43B 3SKVA 3MGUA 4AEMA 1QJFA 4EE2A 3T2PA 4PIZA 5GZEA 5FZGA 2ZHLA 1QJU1 1IZ3A 4GB32 3IM0A 4YM0A 4ARXA 3DKWA 3QLQA 4DPNA 5FPXA 2BEOA 2WZ8A 5JZGB 2VMDA 2UURA 4BIOA 3LIHA 1OXCA 3UJQA 1HW5A 1GR3A 2BPA2 3AMPA 4A7ZA 4XCBA 2UU8A 3EHKA 4D8MA 5F9TA 2VY0A 1Y3TA 1SBFA 2ZGTA 4RFRB 1H2MA 1YQ8A 5BYNA 4L99A 5ABJA 4CCOA 3Q8FA 3H0OA 4NVPA 2WFPA 4NMIA 3JB8A 3POFA 4UOJA 4E4ZA 2ZX2A 1HJGA 1GMMA 1LEMA 1JN2P 2W91A 1KS4A 2Y6KA 5FMOS 3I3MA 1V00A 2YFUA 1SCSA 3OBAA 3C7GA 3JBG1 1RHI3 2HWB2 4H55A 4GMP0 4CEWB 3FLPA 1EUTA 1BMV2 3BCWA 2ZGNA 1RUD3 3THTA 4QB1A 1BZWA 1OH3A 1TZOA 1XE8A 1XJAA 2VNVA 1YEWA 3H42B 4Y33A 5IWFA 3TEXA 3WNOA 4QGNA 3CLPA 1V6IA 4XFIA 1HRI2 1BEV2 4JV4A 3OGJA 1GOFA 1DLLA 1FATA 4CU9A 5CG9A 1W8FA 1GZCA 5FXXA 3RVHA 4FVVA 3O1RA 4FPEA 2VE1A 1MS3A 5E8AA 3LPFA 4V1PA 1HKDA 5HXVA 1WLTA 2I07B 1RXFA 4QPYA 3VN4A 5D1IA 4QHOA 2GC2A 4HSJA 1FYUA 1AYM2 4P14A 2VBBA 1UY3A 2R043 2ZKNA 5APAA 4HL0A 4P9XA 2R32A 3KQ4B 1JYWA 5F5CA 1AXKA 1MQTC 2VMGA 1F5FA 2IXHA 1IKPA 2R16A 2ZGKA 4I0BA 4N53B 5E1RA 4YVWB 1RMU2 2OUJA 3GGLA 2CTVA 3WDXA 3ZIXA 1XB9A 3ES4A 2MEV3 5KHGA 5EV7A 4NHLA 4CCJA 3PJQA 4IV1A 2CV6A 3ZIWA 2VBPA 4J1WA 5LW9A 1VMJA 1S0GA 1XRUA 4H2AA 1JMUB 3UGHA 4NIHA 2RV9A 2GNMA 3OGGA 3GZUC 5FZ4A 1QU0A 1S0BA 3SLIA 5IAXA 3GCWA 4BQXA 2Z42A 3AL5A 5LBBA 1CPNA 4QU1A 2VJXA 5FY0A 3W5MA 3U37A 4OHVA 1AR93 2GNTA 3VBSC 5LEKA 4IXLA 2DUOA 1F15A 4YYOA 1DYOA 3HT1A 2VD7A 4Y3OA 2P6CA 3W58A 2HWF1 1QDOA 3AFGA 4GH4B 1LCLA 4Y1VA 2VBDA 1E57A 1VMHA 1Y9MA 2OIIA 5FP7A 1R082 5BUVA 4LIUA 1DF0A 3U10A 1A8DA 1NLSA 3WX5A 3RFRA 4HANA 1E5RA 4ZPIA 3EBRA 5C8CB 1XXNA 2H6BA 2HWE1 3GXUA 3NKGA 2BJSA 4Y26A 1TMF1 2W2IA 3LWCA 3VZNA 4I02A 1BXHA 1W8UA 3WLUA 1HX6A 5EFUA 3VZOA 4E2GA 1H9WA 1ZRDA 1ST8A 3M8LA 4IGPA 4MV2A 4BJ0A 4ISQA 4CCEA 1UF2C 3FUOA 1GSLA 2V5YA 4R9BA 3O1UA 2BFUS 3TN91 2W46A 3PU3A 1QWRA 1ENRA 1H8TC 1PIV3 4YPJA 2E7QA 1VBC1 3V65A 3KHCA 1PO13 2VMEA 2XVKA 3K48A 2WN3A 2RMU1 5E88A 3VL9A 3ZFEB 2XBO2 3I8TA 3NMBA 4HG6B 5JAXA 2WZR1 4MO3M 4TN7A 3E6CC 4MGZE 4IEPA 3K2OA 5DG2A 3FJSA 4I0WB 1UAIA 4HVRA 1ZBE1 2ZGLA 1Y7BA 4J25A 1BVP1 3FN9A 3P6BA 1QQP3 3EO6A 1QJU2 5A80A 1F8VA 3FX3A 2Y6GA 3RNSA 1N3OA 3DKQA 4YLZA 4EV0A 4EN8B 5GLVA 1AR71 1G9BA 3WDVA 2P3KA 5I0TA 4X8NA 3UV9A 4BDVB 4CXXA 2VZTA 1T6GC 1NY71 2X8KA 3PTRB 3CBNA 3WP6A 3ACFA 4HN0A 5FBJA 2C24A 3BTYA 4GB33 3T4VA 3FHAA 4D7YA 4K21A 1H1MA 5GM0A 1R1A3 2DCTA 1W3VA 3NJYA 2BBAA 2IXKA 2PXJA 3EMRA 2RVAA 3PUAA 4LA2A 2P6HA 2LALA 2XWBB 4XUPA 5A1AA 4Y1UA 5DMYA 3TEWA 1AYN2 3E6DA 1W8OA 1O4TA 1MS9A 2QQVA 2VTXJ 5FLJA 4PDWB 2Q8EA 3MPPG 4QDSA 1JU3A 1ONAA 4FPCA 2BV4A 3OGSA 4WVMA 4LBQD 1J58A 2V73A 4MYEA 4DEVA 1GBGA 2W68A 1BCXA 3T3YA 4YFZA 5LWBA 4V2WA 3JBG2 4XJWA 1S0EA 1H6YA 1DZRA 2VUJA 3RZKA 3KHBA 3ELNA 3UESA 3KCCA 2XHKA 1C1FA 4F8AA 3EJKA 4N43B 1KGYA 1ND2A 2I2SA 5A32B 1NQJA 3KT7A 4KGQA 2HYKA 3MDPA 4QQLA 4PLOA 3VBRC 5HCBA 2Y0IA 1W06A 2HWB3 4JGYB 1Z78A 4HKOA 1VBD1 3D6EA 1LHVA 5L36A 3O1OA 3EXUA 1FOD1 2CNAA 2W95A 3CZJA 5FZ3A 5L9RA 2WNOA 5FRAA 5A7NA 4CU6A 5A70A 4MGKE 2NN8A 5FZ1A 3WW1A 1HRI3 5LB6A 1BEV3 1YQ6A 4NWWA 1CAWB 5IVEA 3FL7A 4OQ8A 2JDZA 3VBFB 1RJ8A 5C9AC 2CSGA 4JKKA 2W08A 3T30A 4RS5C 1FMD1 3ZSLA 5FZKA 4IEOA 4OHYA 3VZLA 2EXKA 3BKZA 2YB7A 1AR63 1RVF1 1NG0A 2XJQA 1VPHA 2G19A 4YW2A 2FDGA 1OA2A 3MIDA 3PVBB 1K3IA 1AYM3 4UWDA 4XFFA 5D8AA 3OTFA 1CGPA 1JZ4A 1B35C 3HMYA 3BOPA 3OEAA 4AEDC 2JEMA 1MPXA 4MOAA 4YZ2A 1RMU3 4N8MA 5M0TA 3RZMA 5FP3A 3WD5A 3FLRA 4AGVA 2RDNA 1H4HA 5IW0A 2C26A 2QQWA 5K0UA 3DYMA 2QE3A 2YXSA 2VZVA 2UY8A 5FXWA 1BQPA 1FT9A 2B4KA 4MGIE 2XH6A 2JD9A 1Y4WA 4EN6B 3RZJA 1QXRA 2WS91 1GU3A 2WAAA 3H1MA 2HWF2 5JOYA 3J7NA 2VOTA 3TEZA 4EN0A 3VB9A 4Q4X1 2W52A 3NNFA 3KLSA 3LZZA 3WW3A 3LCPA 3VZJA 3ZXJA 1POV3 3FC0A 2HWE2 3OD0A 5CIRA 4QX0A 1TMF2 3PNAA 4LR4A 5A7WB 4M3CB 5FZ8A 1PVXA 3ZVXA 3QCWA 1QXJA 2DDUA 4Y5TA 2ZGSA 3AB0A 4JGZB 5IVJA 2WA3A 1Q56A 2EXHA 2VZRA 3MV11 3R4SA 4YZ5A 3BVCA 1HV1A 1XU2A 4XBNA 2CHHA 3DV8A 2JD4A 2PHUA 5GZFA 3ZXLA 1H1IA 5T52A 3HBKA 3VKOA 4QX7A 3FZ3A 2JG8A 3MFCA 5ACA1 3IIIA 3TN92 2JG9A 3AKQA 4XC9A 4D6QA 3ZYHA 3NV3A 4E2SA 1SBEA 4KH9A 5FKCA 4BU2A 1QJX1 1DQ1A 3R0RA 1VAVA 1VBC2 5FZBA 1VRH1 1UPSA 3H1YA 5LY1A 5ABJC 5FYSA 2BGCA 1C1LA 5HXMA 2RMU2 2VO5A 1YI7A 5FIXA 1RUI1 3I59A 2UYAA 1W0PA 4RN5A 4MHRA 1O8PA 2WZR2 4AFMA 2AYHA 4FFIA 3WR0A 4C8DA 2WNUA 4J6GA 4UFKA 1HB3A 2CGOA 5FYMA 5K9YA 4LPLA 4QDRA 4AYUA 4AI0A 1W39A 4P08A 2O14A 3UK9A 1ZBE2 1GV9A 1OHFA 4UBHA 3MV01 2N7GA 4K1ZA 5F2SA 1TME2 4I0AA 5FY8A 2GSYA 4YWAA 3MW4A 4LO5B 2BOJA 4ASKA 1AR72 2YUEA 2ZMNA 2ZPXA 4P00B 2Z5WA 2QTWB 4RA0A 5DPNA 5L9VA 2FDIA 2JE9A 1NY72 3HR9A 3MUZ1 1NXMA 1OOPA 2W39A 3IDEA 1VALA 4LBQB 4BQ4A 1LNSA 2KXLA 2BNMA 4CEYA 4EZHA 1MZEA 2K0GA 4RQPA 3EQEA 5JPMB 1WW4A 5FP8A 4YM2A 1VIWB 4CU8A 1NYWA 2A6XA 4RR3B 4PQQA 1JYXA 1H0BA 1C4RA 1RUE1 3T0BA 3KCXA 1QDCA 4A4AA 2JWPA 4JTNA 3T09A 3ILFA 5DQ0A 1N1VA 5EWSA 2ORZA 5L7OB 1QEXA 2CAVA 2Q1ZB 3DPRB 4BQ2A 4NWVA 1DU3D 1ZM1A 4JDNA 1QOSA 4QXBA 1MS4A 3WQ0A 4YG0A 4X6QB 1BBT1 2VUCA 2P3JA 3NNJA 4QPGB 3RYPA 4IV1C 2CU5A 3MFAA 5T3NA 4A7YA 3MIGA 2WSUA 4YW6A 4IESA 3BGAA 1NCQC 2QUOA 3AYAA 1CN1A 3DXTA 3JBG3 3IN9A 2O1QA 1VBD2 4PI0A 3V0AB 3AMMA 3MLLA 2JDKA 3NVCA 2WA4A 1FOD2 2Y8KA 2VW0A 3O5SA 1N47A 3HPNA 4RL7A 4FPKA 3ZR6A 1F4HA 1YJKA 5FZ7A 3E5QA 1S0IA 1JZ7A 2OZ6A 2ZABA 5FYYA 3U11A 1FMD2 3MI8A 4UFLA 3AZWA 2ES3A 3ON7A 4UYBA 3AXEA 3RYRA 2R6QA 1RVF2 4AQTA 3PJYA 3ZR5A 2XUMA 2WC2A 1SDDB 3D0JA 5FTTC 3GZTB 2BDRA 4BMEA 2P3YA 3S0MA 4EWDA 5DZFA 3M3EA 3V64A 3VGIA 3H3ZA 1PNFA 5C3OA 4D7TA 4IE0A 5F1RA 1LULA 2AUYA 3ZXFA 5A3TA 2VMCA 2XQXA 4Q8LA 5LBCA 3S5QA 1XNKA 3VDDB 3IMMA 4LULA 2VOWA 3LSEA 3PVEA 1HDKA 3CO2A 2RE9A 3HWJA 5JXGA 1DCSA 4CDWB 4W4ZA 3S57A 5EYYA 1JZ3A 2EA7A 3I4IA 1UY4A 1DZQA 2ZAAA 5DZGA 1KD7A 1WBFA 3VBOA 1LJ7A 2JIGA 4ZY9A 2WS92 2BZDA 2SLIA 2V4VA 2Y64A 5CADA 3CF6E 1PVC3 3ZYPA 5T5OA 1WWYA 2QZ3A 2AR6A 3EYPA 4Q4X2 4IEWA 4OULA 3GYDA 3RI8A 4ATEA 5AFEA 4CXWA 4B1MA 1DYKA 4OMCA 5F5IA 1A8MA 2BP6A 2WBKA 1W3XA 2EF6A 5CFCB 1V6OA 4ZZ5A 4Y1YA 1DHKB 4AI9A 3KSCA 4CPBA 2BNNA 2PHDA 4XAEA 2E26A 2XOMA 4U36A 3VD7A 3ACGA 4YRDA 2OKXA 1PGL1 1WUVA 1W9FA 2PLV3 1FNZA 2HWE3 3P5BA 2WZPP 3DCQA 1W9SA 1TMF3 2A3XA 2WFF1 4MVTA 5ACA2 2QZ2A 4QHBA 4BK4A 4LHNA 1QJX2 1JYVA 1MS1A 1BVVA 3GJAA 1MQTA 1VRH2 3KV4A 3NV1A 2AENA 1SLBA 3O7OA 2WIIB 4OUMA 5D21A 1OA3A 3WF4A 4DB5A 1ZZ7A 1RUI2 3HVDA 1CX1A 4MGTA 3WDUA 1BYHA 4HMZA 5F37A 3TN93 2RDSA 1WMFA 4UW3A 1YUDA 1VBC3 3WUDA 3QACA 1MZ5A 4AFAA 5CZKA 2RMU3 1OC1A 5J98B 2H0BA 2WT0A 1CAVB 5LK5A 3NNMA 1LKNA 3POJA 3ZOIA 2DU0A 3TB0A 4CDXB 1ND2C 1BJQA 4XJUA 2EAKA 2YZ4A 2HWC1 3FE5A 3FFQA 1ZBE3 4HXCA 2A6VA 3WP3A 4DIQA 2Z2SB 3ZKYA 4EWEA 1S1AA 4XFBA 4QAWA 4O65A 5FZOA 1KS5A 2HEWF 2LUWA 1WW7A 4YW1A 2VCBA 1AR73 3S7EA 1DQ6A 1KJLA 4Q0PA 1C8NA 1LU2A 2RG4A 1WD3A 2Y26A 1HLCA 3CJIC 3CIHA 5SV5A 4BISA 3WDTA 1RUE2 1YIFA 5DDJ1 5JI9A 2K9ZA 4Q1PA 5F6KA 1F31A 1BKZA 2BU9A 3RQ0A 4GAZA 4IW3A 2B9UA 3FLTA 1M06G 1R1A1 2PA7A 2BTVC 3N9MA 4GALA 3MLKA 4F7ZA 4WM7B 4CP0A 4UFIA 4XJAA 1ZYBA 3ZKUA 1BBT2 5K4LA 3OYWB 1WGPA 4XURA 4WV8A 2JIJA 1TNFA 1J84A 1XYNA 5IFPA 5HV4A 5GLWA 3WNMA 5KWRA 4IE5A 2RDRA 3LE0A 2QQUA 3HD8B 3NSTA 1UKRA 3VBHB 5BNNA 1C5HA 4CDUC 2SBAA 1Q8VA 3ASIA 1HXS1 4UF0A 2VZQA 1ULDA 1U0AA 2GMPA 1T2XA 4MUVA 2BBVA 5KR7A 1ZZ6A 3POIA 2Q8DA 2B9VA 4BXSV 4Y5Z0 1VBD3 5FQ0A 4ASLA 3M3CA 4MX3A 1E5SA 2X5IB 1CR7A 4OI1A 4AVCA 2YC2A 1J3QA 1W8NA 4QGMA 5C4WA 3GNEA 3LDBA 3NJVA 2WNEA 4FP3A 3ZFEA 3DUIA 1SLTA 2NM1A 1NA1B 1Q3EA 1U12A 2RS11 1XPWA 3RDIA 4HBNA 4XFAA 2Y38A 1F9KA 1RVF3 1AR61 2D3PA 3H7JA 4TZDA 3ZMNA 3K3NA 4JRLA 4JHZA 4LHLA 2JG9C 2OPKA 1OUXA 1RUNA 4LHSA 3WHUA 3NL1A 4FPGA 3AKRA 4LJHA 4UBGA 1V6NA 3GBGA 4WZFA 4BB3A 4QB6A 3MF9A 1UCXA 1LESA 1W6NB 4DNYA 4ZU5A 1AL21 1JXNA 3I3BA 5FKBA 3GM8A 5FMBA 1W9TA 5FZAA 5KHKA 4UFMA 2D6NA 4H3WA 2E7TA 2LROA 1WCKA 4RYDA 4WBBA 1WCUA 1PMHX 4XHXA 3A0KA 2A5ZA 4IV3B 4FPFA 5JVVA 3VBRA 2NMOA 2WS93 4KL1A 5FBZA 3KS7A 3ZDVA 5C3QA 3BUCA 2DF7A 2R49A 4BMBA 3I2OA 1A34A 5GZCA 5K7PA 1G9AA 1J1LA 2W9XA 1SZBA 2IVJA 1COV1 2XUEA 1UMZA 2GN3A 4LITA 2YHJA 3NW4A 3DYPA 2BQPA 1PK6B 1RC6A 2XXZA 3DEMA 4CP1A 4OCTA 1PGL2 1W8HA 2QNKA 1RL3A 3RJRA 3ZYJB 3FUQA 4K8FA 4XF1A 5F6LB 1LB2A 1EUUA 2VTFA 1ZZ9A 2WFF2 4OZOA 4XCAA 5FPVA 3LDRA 2D5FA 3J26N 4LUKA 4RS5A 3VDCA 4NROA 4XVHA 2DCZA 1DGWA 3LEMA 3MW2A 5CKQA 5GLUA 5C3SA 2YGLA 3P1IA 2B39A 5IVCA 4LTAA 1G9DA 1W0OA 2OS2A 2PYTA 4B4QA 3ZSKA 1DZTA 2ZHKA 5ACA3 1WCDJ 4K3UA 1QJX3 4QXHA 2MHFA 3NV4A 4LBMA 3OSDA 4WM8B 1UYYA 2IFRA 2WNVB 1RUI3 1CAWA 5FZDA 1US3A 1D0GA 3A0NA 2GMEA 3QH7A 2ERFA 3GJBA 3Q9OA 4DXRA 4HSLA 1GZ9A 1JU4A 1IPKA 2WKKA 4XUTA 4CUBA 5CKNA 1OURA 2HWC2 3ZYBA 4IGOA 3CQOA 4QQ2A 5IHRA 4CDQA 3KV5A 3N7LA 1IG3A 4AHXA 4BZ4A 1HV0A 2A6ZA 2VNRA 2JKBA 1RUF1 2EAAA 1NUKA 1VBE1 3AP6A 3DF0A 5BY5A 4PLNA 2OQ7A 4JX0A 2UYBA 3VKLA 2CY6A 2NPIA 1PGW1 5DDJ2 4QX3A 4AEJA 2WDBA 1HB2A 2UWBA 3A21A 4PQ9A 2ID4A 3BODA 5FZIA 4RGKA 5CKMA 1GQHA 1R1A2 3TYJA 3ZLIA 2BWAA 1C3HA 2XWJB 4DY5A 3AP4A 5FR3A 3THDA 1HN0A 4ONUA 3WV6A 2DWRA 4H14A 3MIEA 3WG4A 4AI2A 4Q29A 2R0FA 1HRV3 1RUE3 3LQCA 4L92A 4QKFA 5A7QA 4HZFA 1GKBA 4C0HA 1PM4A 5A3LA 3CZUA 3LEKA 2EXIA 1X7NA 3RPQA 1ZA4A 3T1MA 1STMA 1F2NA 3B02A 4IDZA 1POV0 4LBLA 4Q1RA 4Y4YA 4D94A 5J1XA 1APNA 1BBT3 1N1YA 4QXCA 4FQ4A 2VZOA 3IWZA 1XNCA 1CIYA 1HXS2 2Y0OA 3E5XA 3OY8A 3L2HA 3WW2A 1RUJ1 4AL9A 4B7KA 3FHQA 4DQAA 4AVAA 1I6XA 3A7QA 4KBBA 2W3JA 3VBOC 2HWD1 4UW6A 3ST7A 4RGAA 1POQA 3U75A 5J09A 4UFJA 1OT5A 5JSPA 4BK5A 2Q1FA 4PF1A 3ETQA 1YXWA 1DG6A 2Y34A 2PQSA 4SBVA 4XIOA 2DUQA 1OD5A 3SH3A 4EJRA 4FXKB 3H3UA 2YG0A 4Y20B 3B5LB 1SFYA 4FOVA 3IPVB 5JI7A 2XJVA 4GJZA 2L9LA 2CWMA 3AZVA 3BALA 4Q26A 5FY4A 2A6WA 1V6JA 2RS12 4IEVA 4YVSB 1JZ2A 2CDOA 4D69A 3QD6A 4HKLA 4LIVA 1I9RA 1OLME 2YROA 1GWLA 1WLDA 3HIFA 1UYXA 1ENQA 4H7LA 2VCAA 5JXHA 1AR62 3OBRA 2DFBA 3TOJA 5JCTA 5J48A 1ENXA 3ZN4A 4AGGA 4CEWC 2KM2A 4NHXA 5FOBB 4AAPA 2G1MA 3AKSA 2LW8A 3OOXA 3ZDSA 4ES9A 3AJZA 1YQ2A 5BNPA 5BNOA 4LOTA 2PTMA 3B9CA 3IKWA 2JDMA 3OPTA 3LFIA 5A3UA 5IK4A 1AL22 1LOFC 4OUSA 4QGLA 4LBQA 4OUEA 3I2GA 3VHNA 2V09A 2NZ9A 3UL2A 1NCQA 1FPN1 2PAEA 3PURA 4Q4Y3 2DCKA 4A6SA 4FTEA 2A1XA 5HPOA 2DTWA 2JX9A 4E27A 3F2ZA 5HCAA 4CU7A 1QMJA 1KRIA 3AZZA 1PVC1 2A73B 1COV2 1QJZA 1UOJA 1ZBA1 4QHZA 4XUQA 3DPRA 4XACA 2FQPA 2JICA 2Y6HA 4HPKA 5J36A 3N9OA 1JZ8A 2B45X 4DEQA 2OA2A 2JXAA 2UWCA 4OFGA 5JR2A 4QPGA 3WT3A 5FZHA 1TEIA 2YYOA 1L3JA 3RS6A 5EYXA 5A6YA 3OJBA 4ZU4A 5GJ6A 1FX5A 4Q0SA 3U14A 2PLV1 3RRDA 3V0AA 2WFF3 3WVJA 2DVDA 5GLTA 1NXD1 3VHRA 4Q2FA 1OI6A 4QD2A 1DQ2A 2XQRA 4V2VA 3ZFFA 4Y1ZA 2TEPA 1MVQA 3NO8A 3PMEA 4HFSA 4X8PA 4NRPA 3ZFGA 3Q8AA 1JYCA 1VB4A 4U2AA 1UOFA 2JDHA 3Q8EA 4NHKA 4GH4C 2VZUA 2JB4A 2A75A 1UXXX 4R9DA 3WF0A 1H8TB 5FUNA 5E89A 4AVTA 4IE6A 4B1LA 3GZEA 3D0SA 1VLNA 5DUUA 1VMFA 1L7QA 1CZSA 1ZX5A 4A44A 5CVRA 3HNMA 3CJXA 5BNNC 1CAUB 3X29B 3WNLA 5DAWA 4JQRA 2W94A 1DBNA 4IEQA 3APBA 3VBUB 4QPIA 1RUF2 2J7MA 1VBE2 4W65A 5ANQA 5C6CA 5FAXA 2TNFA 2HWC3 2DUPA 4COWA 2QDNA 1PGW2 5FY9A 5C5UA 1UU4A 2VUAA 3NKTA 4LE3A 3QH6A 4LKFA 2DBIA 1GQPA 4D0QA 1MR5A 4L0PA 2FZ2A 1R64A 2BGOA 5C4WC 1QJEA 1UIKA 3FMGA 1ZRRA 2GC0A 1W6MB 5KC6A 4KG0A 1WZXA 2GNDA 4XE9A 5DDJ3 3ZFEC 1TG7A 2RM21 4NIAA 4XW3A 3P3PA 2NP0A 2BNOA 4XUNA 1NE6A 1HQWA 4P02B 1GZTA 5K8SA 1XSQA 2Q1MA 3ZSEA 2VUDA 2XHNA 2I45A 1OF4A 1ULEA 1OPOA 2VMFA 2VZ3A 5FLHA 1ND3A 3HQRA 1S0CA 1CQ9A 1OVPA 2D43A 5CFCA 1W6QB 3Q8CA 1KDMA 2D93A 1OQ1A 4COZA 1XNAA 1RUJ2 4I30A 1ZRCA 1MACA 5F5QA 2HWD2 2ARBA 3C7HA 5FREA 1W8ZA 4NUBA 5DUXA 3ZPOA 3AP5A 4MXVA 1HXS3 1P8JA 3AZYA 1ASJ1 1WCSA 3S7IA 1A3KA 1JI6A 2NMNA 3T4HB 3AM2A 3BOWA 2WWJA 4PDWC 1UZYA 1X9TA 3I2KA 4NHYA 2XONA 1SFPA 4R4ZA 4XFGA 2J1UA 3O1MA 4XTPA 2XL7A 4BQ5A 5CAZA 3CJIA 2BVVA 2XJRA 3AMQA 3UYJA 2FHRA 3B3QE 5C9AB 1WCQA 3PIJA 5F7UA 1WW5A 2RS13 4OYUA 3AX4A 1S2KA 4M4PA 2KR2A 4BXFA 4N43C 4B29A 5I93A 2XR4A 2BERA 4BWOA 4FTBA 3MICA 5F3GA 1PO21 4QQHA 4XFHA 5B4XA 3IMNA 4UW4A 3MLJA 4JGYC 2ZS6B 1PZ9A 2VAUA 4Y22A 4LE4A 4PJYA 1B35B 3WY6A 4AEDB 3U78A 2CDPA 3M3IA 3OPZA 5G05L 2F6BA 4JVAA 3N3HA 4AW7A 4OHXA 5FO7B 1KQRA 1FPN2 1OVSA 3PVOA 1W6OA 1GZWB 3AXDA 4XF4A 1LHWA 5CBLA 4HETA 2WL1A 3S6PA 1AL23 4QMAA 3VBFC 3ZPYA 3DXUA 3R4UA 4CEYC 1J3RA 1ULPA 4JCKA 4XBQA 4AGRA 1PVC2 4CDUA 1H4GA 2EIEA 3BTXA 4WVVA 1AF9A 1ZBA2 1CAXB 4NRQA 4QQOA 5FUIA 3ZN6B 4BLIA 5CG8A 1UQXA 2PELA 4WM7A 1UD1A 4NIIA 1DLCA 4CDQC 4Q4W1 4CRQA 5FZEA 2P17A 2Y60A 5IVYA 1COV3 2H0VA 4MXWB 3KZ4C 5A7OA 2PQQA 4D7SA 4NAMA 4S2HA 5J96B 4NE9A 3O1SA 1LODA 3RWKX 1EAH1 1KITA 3KCYA 1N3PA 1UOGA 3J7MA 2ZOEB 4YW5A 1RINA 3VD3A 3TNQA 2PLV2 3CEWA 2HBTA 2OX0A 2E53A 2G9FA 3HT2A 5CFDA 3VBHA 2C6SA 2ZKLA 4XJZA 1IS5A 5T54A 3W59A 4AEKA 1CJPA 5EPAA 2ZJCA 3VDBA 3G7DA 1CZTA 2D6MA 3BU0A 2AEYA 1O3SA 1ZREA 4XZPA 1W05A 1W04A 1W90A 1EP0A 2FCVA 5LBEA 3RWNA 5A3MA 2J1VA 5IK5A 1A78A 2B5HA 4LHKA 4Q4V1 3NJZA 4O9EA 2VG9A 1H8VA 4GWMA 2X5IA 5FMCA 2IXLA 3PUIA 2RS51 3OEBA 1U5XA 5ABJB 3OBTA 3OCPA 1G86A 2OW4A 5FV3A 2ARXA 2P3IA 4A3XA 3ZYGA 1JZ5A 3AK0A 4NPRA 3IBMA 4XQ4A 4GA9A 3U07A 1S4CA 2VU9A 3PMSA 2R0HA 4JGZC 1DQ4A 4XABA 1K5MA 1DGLA 2D6OX 1UKGA 2ZCWA 5EJ1B 4XXPA 2DV9A 1J83A 3K77A 4XBLA 4FPHA 3SEPA 3WSOA 3FHIB 3O1VA 3O1TA 1MZ6A 3M2MA 1RUOA 4Z07A 1YWKA 2ZGPA 3WOGA 1OLQA 3C7EA 2QVSB 2Q0AA 1LRHA 5A3OA 1RUF3 4LKDA 1VBE3 2QQJA 2NQYA 5HCFA 3IZOA 1NX9A 3OGVA 3R6SA 4K9SA 2GC1A 4C1XA 1V0AA 2RM22 3RJ2X 3URFA 3USSA 2GP3A 4KU7A 4IEXA 1SHWB 3ZXKA 1GP5A 1W2UA 2ATFA 1RUH1 2C0ZA 2WWUA 4KI5M 4UW5A 4YGCA 5GKAC 3R4DB 3H8XA 1YQCA 2HKXA 5LK7B 5FO8B 5IVBA 1O4ZA 2R071 1JH5A 2J42A 2W1QA 2AC1A 1GNZA 1HRV1 4AFDA 3KMHA 1JOPA 1ULGA 2WO7A 5FK7A 3AVRA 1SLCA 2QQOA 4YZ1A 2PAKA 2VOVA 1I3HA 1L7RA 5JOXA 4D6SA 4W50A 1MS8A 1K45A 2ARAA 5BNPC 5BNOC 3LEGA 1ZZBA 2VGDA 3OB8A 4CA9A 3W5NA 4Q5OA 4G4FA 3I3QA 3WDYA 1DQ0A 3V0BA 2D98A 4LLOA 4AFBA 1ASJ2 1RUJ3 3KV9A 1US2A 3BIWE 1W8WA 3SHRA 2HWD3 3MPBA 4ASMB 3HAGA 1VBB1 2VZSA 4B4RA 5T5JA 5I8YA 1FNYA 1PHMA 1PX3A 3C7OA 2FCUA 2F4LA 4AXOA 1LHOA 1SACA 3Q8BA 4YG3A 3T08A 4Y24A 4DXTA 2ARCA 3DPRC 1QJY1 3D5OA 1RUG3 1W0NA 3C3VA 4P9LA 3RMYA 2O0OA 1Z7S1 1OQEA 3P3NA 4IE4A 1H2KA 4AVSA 4QPGC 5KXEA 4ET7A 3CMGA 3N9PA 1JZ6A 4NJ4A 1PMJX 2ZX1A 4QQPA 5GALA 2YY1A 2IUWA 1IG0A 4XDQA 1PO22 4CSWA 4SLIA 3KF5A 1SPPA 1NCRB 3GBWA 3THPA 1OUSA 4M3CF 1OPMA 1IS4A 1OH4A 3ZFFC 1UU5A 4GJYA 4P9JA 2GP5A 2W1SA 2VW1A 5F2WA 5C5TA 1W2OA 1R1ZA 4BOWA 4CCCA 4ES8A 3ZFGC 2BWCA 2XLGA 3K4ZA 1AXYA 4R8HA 2J1SA 3BIEA 2PN5A 4Q0VA 2PHTA 3MIBA 4E4DX 3D82A 2YFZA 1FPN3 4Q4Y1 1JYNA 2DYCA 5LATA 1XU1A 4IEZA 2WLPA 3B7MA 1UY0A 4LK6A 1XNTA 4ORFA 4Q4W2 4XIKA 2WN2A 4KQ7A 5T55A 3RZZA 1GUIA 1C8M1 3KGZA 2JDAA 2Y6JA 5ANNA 1LOAA 2CWSA 4FQZA 4QPIC 4AE2A 5JXJA 1ZBA3 2JDPA 1XOYA 5FY1A 4DMIA 1EAH2 2A7AA 2B46X 1UOBA 2Q4SA 1EV11 2VQ0A 4FPOB 4DZGA 3VDDC 1SG3A 3ORJA 1LOBA 5LRSA 4AR2A 1UNBA 4EROA 3DGTA 2QCSB 5A3WA 4NPMA 1QY4A 4AOCA 3SNMA 3ZYIB 3E97A 2ZEYA 5AVAA 1XE7A 4D6RA 4BQ3A 4DO0A 2VMHA 4LA3A 2D40A 4CCKA 3KQRA 4CZSA 2HYXA 3JXSA 4ZONA 3VZMA 4CEWA 2VM9A 3WG2A 2ET1A 1Q8OA 4NO4A 4Q4V2 5FMOL 5FJHA 2WRAA 2RS52 3S30A 1GP4A 3KT1A 4C91A 4Y20A 3HOBA 5DUWA 3RYKA 1ND3C 3IPVA 3SCFA 1LOFA 4LO4B 3I3EA 5CFCC 4LBJA 3PTYA 4WVMB 4K1YA 2XPJA 2XB6C 1YCIA 4TTGA 1LHNA 2DCYA 2I74A 5C71A 2VH9A 1FV2A 2X05A 2TBVA 3N7MA 1PM7A 5DABA 1S2BA 1DYPA 3N7KA 2WABA 4N53A 4OHWA 4OMDA 4YVWA 3R05A 1O3QA 1K12A 3ILRA 4K40A 5FZFA 3TBDA 4I01A 2BW8A 3ILNA 1RUH2 5FYHA 2HLEA 1SLLA 2AH2A 3IDBB 3M7AA 4INDA 5LZ6A 4FI9A 5EZWA 4I3GA 1VAKA 3ZMOA 1LR5A 2R072 1WLWA 4HOOA 3HNYM 5FPBA 4Q0UA 2D6KA 2YPDA 3MYXA 4EN7B 1HRV2 3LPGA 3NNGA 2RM23 1Q8QA 3KT4A 5FYIA 3POSA 3RG0A 2WZEA 4ISRA 1YFUA 3U1XA 4NIGA 4OLLA 3WINE 2LRPA 1W28A 4FFHA 4LMFA 3I97A 1OMIA 5HV0A 1PNGA 4OI2A 1G6NA 1CONA 2VQUA 3CHXA 3ZXDA 3ZYRA 1SDWA 4CCNA 1JW6A 5D8AB 4DINB 1H9PA 4GH4A 4RHV1 3RZLA 3KD4A 2D6LX 1C5IA 1D2QA 3JUUA 4AHZA 4DRRA 2YGMA 1REDA 1VBB2 1D7PM 4L8QA 5C8CA 1SFNA 3ECQA 2IFWA 2D97A 3O0WA 3RGBA 3ZSJA 5KXCA 5K0UB 1ASJ3 2Z4FA 4P9WA 4P9GA 5I0DA 1O7FA 5EQUA 1QJY2 3UNPA 4WM7C 1URXA 5A1FA 4QWNA 2VTXA 4UFHA 2WUHA 4LXLA 1H2NA 3I2FA 1Z7S2 1ZZCA 4XFCA 5CEHA 2XKOA 1JYTA 1LTEA 4PI2A 4FP2A 3J7HA 1TQ5A 1ZNPA 3KVBA 2OYZA 1QOTA 4NR1A 1VB2A 3VD9A 2D6PA 3SKJE 2MNGA 2BFUL 2C9AA 5DAVA 5LASA 1UYPA 3WEZA 5AFBA 2ZGMA 2PHFA 5CFDC 3KV6A 3VBHC 5FZCA 3BYWA 5KXDA 3L9JT 5A33B 3B93A 1G7YA 3NAPB 3U0ZA 1AX0A 5IUQA 1OFSA 1RXGA 3BU7A 5I0RA 1PO23 4M0NA 1U5ZA 1ALYA 4RGGA 2JG8B 3UGGA 4B4PA 1UZWA 4AI3A 3ZN5A 1UXZA 4PHZA 4XF3A 3LOIA 1HQNA 4S2DA 1KFXL 2RHPA 3USUB 4FAGA 5GZGA 2UY9A 2O8QA 1S2EA 1UMHA 2X5IC 3GF6A 5LA0A 4KMQA 1O8SA 2ADEA 3RMXA 4BPZA 2V4AA 4Q4Y2 4BM8A 4CPBD 1OBNA 4FBFA 2QQLA 5JIUA 3W9AA 5JWPA 2WNUB 1NA1C 3LFMA 5IAVA 5F39A 3WF3A 1C8M2 2P4EA 4HVOA 1CZVA 1K5MC 2D3SA 1OFNA 3JCIA 2IXJA 1OF3A 5FZ6A 4MLOA 4EZ4A 4Q4W3 3POYA 4H7MA 2LTNA 5F3CA 2QQPA 4PDWA 1W6QA 1EYBA 2C4XA 2J1EA 2GH8A 4L11A 3J8F3 4I3PA 5HBAA 1CIWA 5B4NA 1EAH3 1VBA1 1XBFA 3IDAA 4GQ7A 4KG8A 4XMAA 3SMHA 3LA3A 4DFSA 4EYUA 1OOPB 5T5LA 2BOIA 4QKBA 4QT6A 5T5PA 4E8DA 1Y9QA 4RQPB 4JDOA 3ZYFA 1LU1A 4I09A 4N43A 3HJRA 2VNGA 2PFWA 2P5BA 4LBKA 3WP4A 4A6OA 5A32A 4Y4RA 2EALA 4J1XA 1HN1A 1LENA 3RZHA 1KFUL 2RS31 3OUIA 2ET7A 4JGYA 5LA9A 5LA1A 4NIDA 2VXRA 4Q4V3 4AI8A 3T0AA 2DVGA 1WD4A 3DN7A 2RS53 3JB4C 5FYZA 2LM3A 2JECA 4CYDA 4YZ3A 3NRUA 2Y6FA 1UZ0A 1U5IA 4YM1A 5DN2A 1IOAA 3IAPA 5FZMA 1UX6A 1YJLA 5IJRA 5F8PA 1EY2A 3VBFA 3MF6A 4HK9A 5J3UA 2E9QA 3LA2A 4BYYA 1H2LA 2WQ4A 3N9NA 4HONA 1W6PB 3VDAA 4B3NA 2WO2A 1PMIA 4FFFA 4FOQA 2OXBA 4FPYA 2W1UA 5L73A 4GMP1 5I91A 4LBNA 2AZ5A 2GAUA 2A71A 3ATGA 2ZXQA 4XDOA 4DOUA 4FFGA 1H6XA 4WM8C 1GZWA 4P9YA 3VHPA 4EQVA 1D4M1 2HEYF 1RUH3 5FP9A 4PLMA 5JSOA 3VL8A 1DGRN 4CUGA 1OLRA 1OA4A 3TWIA 2PHXA 1LEDA 2BVBA 3WW4A 2FD8A 2R073 4JZRA 5JMCA 3VZKA 1T6BX 1JS9A 1NQDA 5FYTA 1F4AA 2W92A 2FCTA 2GNBA 3HN3A 4RHV2 1JTZX 3K46A 3AJYA 4AK3A 4C90A 4BE3A 2RR11 1O5LA 2ZBJA 1O3TA 2PMWB 1YFYA 4CUCA 3LEIA 1JHJA 1PZ8A 2OT7A 2P2KA 3LA7A 3B69A 2WYSA 3H9AA 1AZDA 4W8JA 1KXGA 3KWVA 5A7WA 3O0VA 5FFOC 4M3CA 4GD4A 5LA2A 4JGZA 1DQ5A 3D3AA 3WDWA 2YDEA 1YO8A 3VBOB 2GN7A 3I7DA 3VKFC 2IXCA 1SBDA 1VBB3 3B94A 4IERA 1RJ7A 3SXWA 1G9CA 1V6KA 5LBFA 2W47A 1QIQA 2XJTA 3B00A 5E16A 3KGLA 2R1BA 4FTSA 4W6YA 3SQOA 2E31A 4QX5A 1QJY3 3VHOA 1W2TA 2ZA9A 2ZHNA 1VP6A 3HQXA 1RUG1 2XDVA 4GWNA 1AYN1 5FUPA 4CP9B 5J37A 1UY1A 4NOTA 1Z7S3 3H50A 4URTA 5J7MA 3LKJA 3O14A 2Z79A 4MZUA 3INAA 1LOEA 2W0XA 2H6CA 4A7KA 4K8RB 3AYCA 3MO4A 2QQKA 1NAEA 2VULA 4Z82A 5H9QA 5FXVA 3UETA 4A45A 1XNBA 2XVLA 4R4XA 3I54A 4L97A 3VV1A 1MQTB 2F4PA 3GHNA 4FPLA 4XHBA 2VVEA 3ACLA 5A3NA 1OSGA 4ITCA 3T2TA 4BQYA 5IK7A 4XDPA 3JD71 3T0DA 1NE4A 4GULA 1NT0A 3N9QA 2D44A 4Z92B 2XG3A 1Q5OA 4W6WA 1W2AX 3IIAA 1PX4A 5FLIA 4Q0QA 4YVSC 2XLAA 2FDJA 5AC91 4AG4A 4YFWA 3WQ1A 3HEIA 1XSRA 2ZZQA 5TSWA 2GU9A 3WNKA 4A2UA 4BQWA 3PUQA 2WQZC 3O1PA 5CYYA 3AC0A 5A1LA 4RR3A 1O91A 2XMLA 1YHFA 1XYPA 5I8TA 3M3QA 1FV3A 3K4AA 3RI9A 4AFCA 3POEA 4RFT0 2WYFA 4GZ9A 1C8M3 1SLIA 3AKPA 1MEC1 3VBSB 2ZMKA 2F17A 2IC1A 2NLRA 2VOXA 3WQ7A 5L7OA 2FDFA 1GWMA 1VBA2 4N53C 2JDUA 3WQBA 3WG1A 1EV13 4YVWC 1N3QA 1QGLA 5FK8A 3SITA 4LO8A 2VC9A 2Q8CA 4COUA 2E33A 2DTYA 2YV8A 2G4IA 5BPXA 3SCGA 5DAPA 1HQLA 1QXPA 5FZOB 5JUVA 2WR9A 4F3JA 2HH9A 4YW7A 4AHWA 4DXZA 1GLHA 5IT6A 1BHGA 2A3WA 2EIDA 3PDQA 2Y6LA 1DIWA 4JKMA 2R063 4A42A 2RS32 4JDMA 5DAQA 4QU2A 4YSFA 2UWAA 3KB5A 5FPAA 2FDKA 2Q30A 4HKWA 2DURA 3HN1A 4LO6B 4L9BA 4TWTA 2HJIA 3MBWA 2VZPA 3WXPA 4B8EA 3WG3A 1UYZA 1GOGA 3C8XA 2YBSA 1C57A 1ULFA 3NJXA 1O5UA 1H1AA 2NYYA 3ACHA 4TXWA 2DVFA 3K75B 1MZFA 3FFZA 3O12A 3F95A 2R1DA 1EPWA 1SQ4A 1QHDA 1X8EA 3VLBB 2VVDA 5BNQA 4CUAA 2C5DA 2VPVA 1G9FA 3D8CA 3GHMA 1HB4A 4LKEA 1NCRA 4ZS3A 5LY2A 3WCRA 1S55A 3WNPA 5BNNB 1LAJA 4YGBA 4UF0B 1S0JA 3H3LA 4YW3A 4AQSA 1V9U3 1XE0A 4FSJA 1RIRA 4KNCA 4MSVA 1QH6A 2EVXA 3EB7A 3UKNA 5FQ0B 3VDDA 4XXAA 2EXJA 1D4M2 1W9YA 2ZHMA 4XMIA 1NKGA 2DBNA 2P34A 4META 2Q5TA 4LKSA 4CDWA 5A6XA 5C4WB 3WF1A 1LGNA 1YNAA 4MGSA 1WMXA 4KBZA 4XPVA 2PHWA 4MH0E 4YGEA 4BH9A 2JKXA 5GZDA 4TLGA 1REFA 1X36A 4XEZA 2E6VA 3BPSA 3NQHA 4GIQA 3CKHA 1QF3A 3OUJA 1WLCA 5IATA 2RR12 2YC4A 3VBUC 4BIFA 4KWUA 5FYBA 1AJKA 1QNYA 1JODA 3PL0A 4XZUG 4G9SB 5L19A 1AX1A 1N1SA 4K20A 2B8MA 4XETA 3B01A 4OI0A 2JDYA 4UAPA 1YIPA 3NNLA 3N9LA 1TME1 2VECA 4RHV3 5FYVA 1HB1A 3WHTA 1ZRFA 1UW8A 4N9HA 4P5YA 1D4VB 3ABZA 1LHUA 4JC1A 3H8UA 2FMDA 1IPJA 4BCUA 4R9AA 3DL3A 1RUC1 2D3RA 1REEA 4XJ8A 1UU6A 5F5AA 3LD8A 1J3PA 5LCWL 2X09A 1NLRA 1RUG2 3VBRB 3UJOA 2BGPA 1BK1A 5KHIA 1AUYA 2VL4A 1SMVA 4EWAA 3UGFA 1WA4A 3TAYA 5DXDA 3T2OA 5AVPA 2ZTNA 2P1BA 2P37A 3ZSMA 1YC61 4M01A 1GOHA 5IVVA 4M4RA 3T1LA 3VD4A 1ODMA 5JSRA 3HQUA 4RS5B 1CAVA 2DCJA 3TRSB 4CDXA 4E4SA 2RDQA 5FPUA 1GNYA 3NWKA 2JB8A 4AZZA 3BPZA 1JOBA 1SEFA 3JD72 3LAGA 1WKYA 1V6MA 1V70A 1WMEA 1RB8G 4NHMA 3MW3A 2RJLA 2XJPA 5AC92 4WZCA 1TNRA 2FMYA 3ZX7A 1AR81 1FXZA 3CNAA 4FXGB 3SEEA 5FDBA 2FDHA 3I3DA 4Q8KA 2E63A 3NV2A 2V72A 4S2FA 1GYKA 4Z2AA 3ETPA 1IPSA 2CYFA 2JDNA 4OZXA 1XC6A 3AFKA 2GALA 2ORXA 1MEC2 4O9GA 4XAAA 1DGWX 4M00A 4AI1A 4AWDA 3N7JA 2C1FA 2DFCA 2D5HA 2K46A 4CDQB 1HJFA 2W1WA 5EIYB 5IK8A 5IYYA 4JQTA 3OYWA 4Y5SA 3WCSA 3ITQA 2ZEZA 4E2QA 3WP5A 5DZEA 5DUVA 1KDKA 5JIAA 3J8F1 3TNPB 2FBEA 1VBA3 4GWJA 2PAMA 1CD3G 5C33A 2YU1A 4TYSA 4XQDA 1OD3A 3VKMA 1VAMA 2JENA 2ENRA 2J1TA 3MIFA 3WUCA 3SH5A 4CCMA 2YBKA 3AVSA 3RZGA 3FBMA 2ZX3A 2AEZA 2O8OA 2X29A 1CJDA 2VR4A 3J9SA 2PHLA 5JOWA 3OG2A 3U4XA 4FPJA 2RS33 4NAOA 1OKOA 4YM3A 5JLVA 1R091 1ODNA 3ZXAC 2XLFA 4UT5A 2VNOA 4HLTA 3E1F1 3GZAA 5FCCA 4W6XA 2EICA 4LQRA 2V5DA 1S0DA 2IZWA 5FZ9A 5SV8A 4OQ9A 5CISA 2FZ1A 1IKQA 1DGRA 4QM8A 1WBLA 4MGYE 1BK0A 4P5HA 2QQMA 3JQWA 2A3YA 1NA1A 3OY8B 1R083 2VVFA 5A33A 4OI4A 3WZ1A 4ZXKA 1JHNA 1K42A 3NAPA 1VE0A 4MG2A 3GBFA 5FJKA 2ZACA 5I0UA 3AP7A 1IS6A 5FPZA 1CWPA 1YYNA 2WINB 2YU2A 4GKXA 5JZGA 2OVUA 3AZXA 2YMZA 2ZEWA 4YZ4A 3WNNA 2R30A 4GMP3 3USUA 3POWA 3ROUA 3THCA 1W2NA 3ME2A 1C28A 1H30A 3MEPA 1Z0HA 3J4UH 4CCLA 1Q43A 1JUHA 3I2IA 1W6NA 4CP2A 3SC7X 1D4M3 3C2UA 4IUGA 4E8CA 4N7UA 1I1EA 1SCRA 3HNBM 2VZ1A 2WO1A 4M3CE 1OQDA 4Y1XA 4KWJA 4KU8A 4Q27A 1NZCA 4K6BA 5FOJB 4IV3A 4BQ1A 2CL2A 1QKQA 2XBO3 1RGSA 1JOJA 4CVUA 3OGRA 1ULOA 3CU7A 4M0HA 3OF1A 3FBYA 1IHMA 2RR13 4K7JA 1CPMA 5BNPB 4LT5A 5BNOB 4IETA 3G6JB 1ZRIA 2K2SA 1PK6A 3UT0A 2ZEXA 3BTAA 1IQDC 5F32A 5FO9B 1FAYA 1QJU3 2VOKA 3LOBA 4YARA 4IV1B 3VD5A 1RUC2 4XQWA 2GC3A 5IVFA 1NCQB 4QB2A 1QOOA 4FCAA 1UPIA 4RR3C 2QQNA 1W8TA 2ZX0A 4L2NA 4GXLA 1O4YA 3QBQA 2XVGA 4ZXEA 4BA6A 1ZZ8A 2ILMA 5FWEA 3K4DA 5L7OC 3U4SA 5FMDA 3ACIA 3N35A 3GALA 4PT6A 3I2DA 4NRMA 4WM8A 1AYN3 1ZVFA 5FY5A 4HPKB 2WNVA 3IDCB 4DXSA 5I0SA 4IEYA 1YFWA 5JMOA 3H8OA 4QXKA 1XQNA 3KF3A 4GWIA 2W5FA 3M1HA 5ERLA 2AGSA 5BV6A 4DUXA 5KC5A 2HEVF 1MS0A 1Q8SA 1W99A 2WJSA 3K51A 5CU1A 1EPZA 1V6LA 5A3PA 1W6PA 2TUNA 1RHI1 4LUMA 3BN6A 2RJKA 3LF7A 1RUD1 2XJSA 2OUHA 1YQ5A 3ZFFB 1AHSA 1AR82 4RD7A 3ZO0B 2QKDA 1IGOA 1UMIA 3JD73 5A7PA 3ZFGB 4AAXA 4KWKA 5FP4A 2QJVA 5A6ZA 3GDBA 4XILA 4AF9A 5AC93 1A6CA 2Y33A 1YLLA 2BRTA 1RITA 4AQ2A 4PF5A 5KHHA 1GFF2 2ZZJA 5LEJA 4COVA 2WAOA 2A70A 3AYDA 1NCRC 3M4FA 3ENRA 4IGQA 4DUWA 1HIXA 2R041 4YG6A 3K3OA 1MEC3 1VRBA 4QPIB 4JRAA 4Z1VA 4Z8BA 5FWJA 3W20A 3J8F2 4HK8A 4YW4A 3T2QA 1E5IA 3FWEA 4JKLA 5LRRA 4CXYA 3ZXEA 4O61A 2G9ZA 1UZVA 2MEV1 5I8SA 2R7EB 3JZVA 4QX2A 4CDWC 5IFTA 3MUY1 1XNDA 3PHMA 2IXIA 1OLMA 5A7SA 3V0BB 2R061 1S0FA 1O59A 5FYCA 1R092 1XYOA 3GCXA 4YNIA 4E4HA 4HVQA 5JOZA 4HN1A 1U5YA 3AKTA 2ZGQA 2PHRA 1X82A 4ARYA 4LK7A 1UWWA 3TEYA 1AR91 2JJ6A 2VCMA 4JTOA 4XUOA 3PU8A 2VMIA 2OZJA 3N36A 4CP9A 4ZKTB 5C3RA 1ACCA 1ND3B 1YI9A 3BB6A 2HWF3 2RJ2A 1DP0A 3J7LA 1JBCA 3LIGA 4LOSA 5L9BA 4DRVA 2J22A 2B42B 4X6RB 4YVSA 2YBPA 2CAUA 1YFXA 4IE7A 1BLZA 3POGA 1Y9GA 2IVIB 3H8RA 4FOWA 1AXZA 3JU9A 1MS5A 4FO9A 3AYEA 1LOCA 2VW2A 1LOGA 3AMNA 2WT1A 3S5AA 5GLZA 1ND2B 2E7AA 3POBA 5KBFA 3MZHA 2CGPA 5C8WA 1V9U1 5JDBA 5H9SA 3CDZB 4O7XA 5H9PA 2XJUA 4IEUA 1UN1A 4R9CA 2ADDA 5G04L 1SLAA 4PCRA 3A23A 2AREA 1GANA 2ETEA 4Z2WA 1UL9A 1PIV1 4XF9A 2YPJA 2IWGB 3CJIB 1ENSA 1DDLA 1PZ7A 1PO11 4A41A 2WO3A 1DFQA 2G9GA 2W87A 1LECA 2XL9A 1UZZA 3HBZA 2WZR3 4QDQA 4D3WA 3BTZA 2C9KA 2ZAHA 4XTMA 1YRZA 1PGSA 4OHZA 4BLJA 4CDXC 2D7FA 2ZMLA 3A22A 3VBSA 5HI0A 3DECA 2WQ8A 4MHUA 5KHJA 4AQ6A 1UO9A 2ZGRA 2DU1A 4IQPA 1WW6A 4AVVA 5C3PA 4AVBA 1QQP1 4Y22B 4DS0A 2A6YA 1TME3 4WVZA 4LORA
chains in the Genus database with same CATH topology
5DG1A 4XYXA 2ZGUA 1GNHA 3KM5A 3PLQA 1W6OB 1N1TA 4PBPA 4ATFA 1VR3A 4CTEA 3ES1A 4GB31 4CDUB 4QM9A 1RUC3 4EN9B 4C1WA 4LO7A 1I5ZA 4N7IA 2GH2A 4KGGA 1QH7A 5D8AC 4LEJA 1RTVA 4XOGA 4ZU7A 2XGXA 4PIYA 1IQAA 1G8WA 1H8TA 1MVEA 5CA6A 1WMDA 2BYVE 3ZXGA 1TE1B 1RHI2 2GMMA 4C0BA 5KXBA 5CFDB 3UKTA 1RUD2 5EJ3A 4COYA 2E51A 1CAUA 5K0UC 3VUOA 3VBUA 2ZGOA 1AVBA 4PIXA 1LGBA 3WNXA 3H7YA 4N90A 2HWB1 1BMV1 1IS3A 2JG9B 1JYIA 1FOD3 1X50A 1AJOA 4R52A 1JUIA 3SISA 2WT2A 4XJ9A 1AR83 3ALQA 2X53S 4UXAA 1KJRA 1HRI1 1W6MA 1BEV1 1CESA 3I59B 1F5JA 3UKVA 4LLFA 5CNAA 2CGNA 1FMD3 2R042 4N9IA 3AP9A 1K5MB 1B09A 3NAPC 4F83A 3H1WA 2B7YA 4P9IA 5BXXA 1EV12 5JZGC 2JG8C 1AYM1 2MEV2 3MIHA 1AL0G 2DVAA 3LB9A 1QNWA 2QDRA 1D2SA 4HT1T 3L2YA 4E9KA 1J1TA 2JE7A 1RMU1 2R062 4GKYA 1GICA 3LSDA 2GZWA 4CEYB 4PBOA 3IT8A 2MPFA 4FAHA 2WNUC 3RSJA 3O0XA 5B2GB 1O3RA 1CVNA 1AR92 2QFEA 3JQXA 2GDFA 4IV3C 4LBOA 4LNVA 5T50A 1R093 2Q8OA 4G3YC 1X33A 1OKQA 1J59A 2WWSA 4Q4X3 4RSUA 1GQGA 4TLFA 2ZX4A 3M3OA 2VQAA 2Z69A 4IL7A 1PK6C 4B7EA 1POV1 3E5UA 4AHYA 1OOPC 5C9AA 3B9IA 3OD4A 1NOVA 4JAAA 4RQPC 4NN0A 4S2GA 2EIGA 1R081 3LGRA 4WVWA 2XKPA 1V9U2 4DY3A 2YC0A 1X8MA 1ULCA 2DVBA 1B35A 4AEDA 3QOPA 3A4UA 4I2OA 1PIV2 1VRH3 3N4MA 1VJ2A 1LGCA 1PO12 2KA3A 4FOYA 5CB7A 3AMHA 3SH4A 1CX4A 2WNVC 4XF0A 3SCHA 2WSVA 1M4WA 1AX2A 4OVEA 3CL1A 3ZN6A 1CAXA 4FT8A 5H9RA 2BUKA 3VKNA 1UIJA 4YGDA 3D4KA 5JR7B 4TSVA 1QQP2 2XBO1 3V56A 1FI2A 3E6BA 5EXOA 2WLQA 3M70A 4BHPA 5JPNB 1Q8PA 1D0HA 4KWLA 3PVNA 4MXWA 1Y43B 3MGUA 4AEMA 4PIZA 5GZEA 2ZHLA 1QJU1 1IZ3A 4GB32 3IM0A 4YM0A 4DPNA 3DKWA 3QLQA 5FPXA 2BEOA 2UURA 3UJQA 1HW5A 1GR3A 2BPA2 3AMPA 4A7ZA 2UU8A 3EHKA 5F9TA 2VY0A 1Y3TA 1SBFA 2ZGTA 1H2MA 5BYNA 4L99A 5ABJA 3H0OA 4NVPA 2WFPA 3JB8A 4E4ZA 2ZX2A 1LEMA 1JN2P 1KS4A 5FMOS 1V00A 1SCSA 3JBG1 1RHI3 2HWB2 4H55A 4GMP0 4CEWB 3FLPA 1BMV2 3BCWA 2ZGNA 1RUD3 3THTA 1BZWA 1XE8A 4QGNA 3CLPA 1V6IA 4XFIA 1HRI2 1BEV2 4JV4A 3OGJA 1DLLA 1FATA 5CG9A 1GZCA 4FVVA 4FPEA 1MS3A 5E8AA 4V1PA 1HKDA 5HXVA 1WLTA 2I07B 4QPYA 3VN4A 5D1IA 2GC2A 4HSJA 1FYUA 1AYM2 4P14A 2ZKNA 2R043 4HL0A 4P9XA 2R32A 1AXKA 1MQTC 2VMGA 1F5FA 2IXHA 1IKPA 2R16A 2ZGKA 4I0BA 4N53B 5E1RA 4YVWB 1RMU2 2OUJA 2CTVA 3WDXA 3ZIXA 5KHGA 3ES4A 2MEV3 5EV7A 4NHLA 3PJQA 4IV1A 2CV6A 3ZIWA 4J1WA 1S0GA 1XRUA 2GNMA 3OGGA 3GZUC 1QU0A 1S0BA 3SLIA 2Z42A 1CPNA 4OHVA 1AR93 2GNTA 3VBSC 5LEKA 4IXLA 2DUOA 4YYOA 3HT1A 3W58A 2HWF1 1QDOA 3AFGA 4GH4B 1LCLA 4Y1VA 1E57A 2OIIA 1R082 5BUVA 1DF0A 3U10A 1A8DA 1NLSA 3WX5A 4HANA 3EBRA 5C8CB 1XXNA 2H6BA 2HWE1 3NKGA 4Y26A 1TMF1 3LWCA 3VZNA 4I02A 1BXHA 3WLUA 1HX6A 5EFUA 3VZOA 4E2GA 1H9WA 1ZRDA 3M8LA 4MV2A 4ISQA 1UF2C 3FUOA 1GSLA 2V5YA 4R9BA 2BFUS 3TN91 1QWRA 1ENRA 1H8TC 1PIV3 3V65A 2E7QA 1VBC1 1PO13 2XVKA 3K48A 3ZFEB 2RMU1 5E88A 3VL9A 2XBO2 3I8TA 5JAXA 2WZR1 3E6CC 4MGZE 4IEPA 5DG2A 3FJSA 4I0WB 1UAIA 4HVRA 1ZBE1 2ZGLA 1Y7BA 1BVP1 1QQP3 3EO6A 1QJU2 1F8VA 3FX3A 3RNSA 1N3OA 4YLZA 4EV0A 4EN8B 5GLVA 1AR71 1G9BA 3WDVA 2P3KA 5I0TA 4X8NA 3UV9A 3V0BA 2X8KA 1T6GC 1NY71 3WP6A 4HN0A 4GB33 4D7YA 4K21A 1H1MA 5GM0A 1R1A3 2DCTA 2IXKA 4LA2A 2LALA 2XWBB 4Y1UA 1AYN2 3E6DA 1O4TA 1MS9A 5FLJA 4PDWB 3MPPG 1ONAA 4FPCA 4WVMA 4LBQD 1J58A 2V73A 4MYEA 1GBGA 2W68A 1BCXA 4YFZA 4XJWA 3JBG2 1S0EA 1DZRA 2VUJA 3ELNA 3KCCA 2XHKA 1C1FA 4F8AA 3EJKA 4N43B 1ND2A 2I2SA 5A32B 1NQJA 3KT7A 4KGQA 2HYKA 3MDPA 4QQLA 4PLOA 3VBRC 5HCBA 2Y0IA 2HWB3 4JGYB 1Z78A 4HKOA 1VBD1 3D6EA 1LHVA 5L36A 3EXUA 1FOD1 2CNAA 5FRAA 4MGKE 2NN8A 3WW1A 1HRI3 1BEV3 4NWWA 1CAWB 2JDZA 3VBFB 1RJ8A 5C9AC 2W08A 4RS5C 1FMD1 3ZSLA 4IEOA 4OHYA 3VZLA 2EXKA 1AR63 1RVF1 1NG0A 2XJQA 4YW2A 1OA2A 3MIDA 3PVBB 1AYM3 4XFFA 5D8AA 3OTFA 1CGPA 1B35C 3HMYA 3BOPA 4AEDC 2JEMA 4YZ2A 1RMU3 3WD5A 3FLRA 4AGVA 1H4HA 5K0UA 2QE3A 2YXSA 2UY8A 1BQPA 1FT9A 4MGIE 2XH6A 1QXRA 2WS91 3H1MA 2HWF2 5JOYA 4EN0A 4Q4X1 2W52A 3KLSA 3LZZA 3WW3A 3LCPA 3VZJA 3ZXJA 1POV3 3FC0A 2HWE2 3OD0A 5CIRA 1TMF2 3PNAA 4LR4A 4M3CB 1PVXA 3QCWA 1QXJA 2ZGSA 3AB0A 4JGZB 2WA3A 1Q56A 2EXHA 3R4SA 4YZ5A 1HV1A 1XU2A 4XBNA 3DV8A 2JD4A 2PHUA 5GZFA 3ZXLA 1H1IA 5T52A 3VKOA 3FZ3A 2JG8A 3MFCA 5ACA1 3TN92 2JG9A 3AKQA 4E2SA 3NV3A 1SBEA 4KH9A 1QJX1 1DQ1A 3R0RA 1VAVA 1VBC2 1VRH1 1UPSA 3H1YA 5ABJC 2BGCA 1C1LA 2RMU2 1YI7A 1RUI1 3I59A 2UYAA 1W0PA 2WZR2 4AFMA 2AYHA 3WR0A 2WNUA 4J6GA 2CGOA 5K9YA 4AYUA 4AI0A 1W39A 3UK9A 1ZBE2 1GV9A 1OHFA 4UBHA 2N7GA 4K1ZA 1TME2 4I0AA 2GSYA 3MW4A 4LO5B 1AR72 2YUEA 2ZMNA 2ZPXA 2Z5WA 4RA0A 2JE9A 1NY72 3HR9A 1NXMA 1OOPA 2W39A 3IDEA 1VALA 4LBQB 4CEYA 2KXLA 2BNMA 1MZEA 2K0GA 4RQPA 3EQEA 5JPMB 1WW4A 4YM2A 1VIWB 1NYWA 2A6XA 4RR3B 1H0BA 1C4RA 1RUE1 3KCXA 1QDCA 4JTNA 3ILFA 1N1VA 5EWSA 5L7OB 2CAVA 2Q1ZB 3DPRB 4NWVA 1DU3D 1ZM1A 4JDNA 1QOSA 1MS4A 3WQ0A 4YG0A 4X6QB 1BBT1 2P3JA 4QPGB 3RYPA 4IV1C 5T3NA 3MFAA 4A7YA 3MIGA 2WSUA 4IESA 1NCQC 2QUOA 3AYAA 1CN1A 3JBG3 3IN9A 2O1QA 1VBD2 3V0AB 3AMMA 3MLLA 3NVCA 2WA4A 1FOD2 2VW0A 3O5SA 1N47A 4RL7A 4FPKA 1YJKA 3E5QA 1S0IA 2OZ6A 2ZABA 3U11A 1FMD2 3MI8A 3AZWA 2ES3A 3AXEA 3RYRA 2R6QA 1RVF2 4AQTA 3PJYA 2XUMA 2WC2A 3D0JA 5FTTC 3GZTB 4BMEA 3S0MA 4EWDA 5DZFA 3M3EA 3V64A 3VGIA 3H3ZA 1PNFA 4D7TA 5F1RA 1LULA 2AUYA 3ZXFA 4Q8LA 1XNKA 3VDDB 4LULA 2VOWA 3LSEA 3PVEA 1HDKA 3CO2A 2RE9A 3HWJA 4CDWB 5EYYA 2EA7A 3I4IA 1DZQA 2ZAAA 5DZGA 1KD7A 1WBFA 3VBOA 1LJ7A 2WS92 2SLIA 5CADA 3CF6E 1PVC3 3ZYPA 5T5OA 3RI8A 2QZ3A 2AR6A 4Q4X2 5AFEA 4IEWA 4OULA 3GYDA 4ATEA 1DYKA 1A8MA 2EF6A 5CFCB 1V6OA 4Y1YA 1DHKB 3KSCA 2BNNA 2PHDA 4U36A 4YRDA 1PGL1 1WUVA 2PLV3 1FNZA 2HWE3 2WZPP 4MVTA 5ACA2 1TMF3 2A3XA 2WFF1 2QZ2A 4QHBA 4LHNA 1QJX2 1MS1A 1BVVA 1MQTA 1VRH2 3NV1A 3O7OA 2AENA 1SLBA 4OUMA 2WIIB 4DB5A 1OA3A 1ZZ7A 1RUI2 3WDUA 1BYHA 4HMZA 3TN93 1WMFA 4UW3A 1YUDA 1VBC3 3WUDA 3QACA 1MZ5A 4AFAA 2RMU3 5J98B 2H0BA 2WT0A 1CAVB 5LK5A 1LKNA 2DU0A 3TB0A 4CDXB 1ND2C 1BJQA 4XJUA 2EAKA 2YZ4A 2HWC1 3FE5A 3FFQA 1ZBE3 2A6VA 3WP3A 2Z2SB 4EWEA 1S1AA 4XFBA 1KS5A 2HEWF 2LUWA 1WW7A 4YW1A 1AR73 3S7EA 1DQ6A 1KJLA 4Q0PA 1C8NA 1LU2A 3CJIC 1WD3A 2Y26A 1HLCA 5SV5A 3WDTA 1RUE2 1YIFA 5DDJ1 5JI9A 2K9ZA 4Q1PA 5F6KA 1F31A 1BKZA 3RQ0A 2B9UA 3FLTA 1M06G 1R1A1 2PA7A 2BTVC 4GALA 4F7ZA 3MLKA 4WM7B 4CP0A 4XJAA 1ZYBA 1BBT2 3OYWB 1WGPA 4WV8A 1TNFA 1XYNA 5GLWA 5KWRA 3HD8B 3NSTA 1UKRA 3VBHB 5BNNA 1C5HA 4CDUC 2SBAA 1Q8VA 3ASIA 1HXS1 1ULDA 1U0AA 2GMPA 4MUVA 2BBVA 1ZZ6A 4Y5Z0 1VBD3 5FQ0A 4ASLA 3M3CA 4MX3A 2X5IB 1CR7A 4OI1A 4AVCA 1J3QA 4QGMA 5C4WA 3GNEA 2WNEA 4FP3A 3ZFEA 3DUIA 1SLTA 2NM1A 1NA1B 1Q3EA 1U12A 2RS11 3RDIA 4HBNA 4XFAA 2Y38A 1F9KA 1RVF3 1AR61 2D3PA 3H7JA 4TZDA 3ZMNA 4JRLA 4LHLA 2JG9C 2OPKA 1RUNA 3WHUA 3NL1A 4FPGA 3AKRA 4UBGA 1V6NA 3GBGA 4WZFA 3MF9A 1UCXA 1LESA 1W6NB 4DNYA 4ZU5A 1AL21 1JXNA 5KHKA 2D6NA 4H3WA 2E7TA 1WCKA 4WBBA 4XHXA 3A0KA 2A5ZA 4IV3B 4FPFA 5JVVA 3VBRA 2NMOA 2WS93 4KL1A 5FBZA 3KS7A 2DF7A 2R49A 4BMBA 5GZCA 5K7PA 1G9AA 1J1LA 1COV1 1UMZA 2GN3A 2YHJA 3NW4A 2BQPA 1PK6B 1RC6A 4CP1A 1PGL2 2QNKA 1RL3A 3RJRA 3ZYJB 3FUQA 4K8FA 4XF1A 5F6LB 1LB2A 2WFF2 1ZZ9A 4CEYC 2D5FA 3J26N 4LUKA 4RS5A 2DCZA 1DGWA 3MW2A 5GLUA 2YGLA 2B39A 1G9DA 4LTAA 1W0OA 2PYTA 4B4QA 3ZSKA 1DZTA 2ZHKA 5ACA3 1WCDJ 4K3UA 1QJX3 2MHFA 3NV4A 4LBMA 4WM8B 2IFRA 2WNVB 1RUI3 1CAWA 1D0GA 3A0NA 2GMEA 3QH7A 2ERFA 3Q9OA 4HSLA 1GZ9A 2WKKA 1IPKA 2HWC2 4QQ2A 4CDQA 3N7LA 4AHXA 4BZ4A 1HV0A 2A6ZA 2VNRA 2JKBA 1RUF1 2EAAA 1VBE1 3AP6A 3DF0A 5BY5A 4PLNA 2UYBA 3VKLA 2CY6A 2NPIA 1PGW1 5DDJ2 4AEJA 2UWBA 4PQ9A 3BODA 1GQHA 1R1A2 3TYJA 2BWAA 1C3HA 2XWJB 4DY5A 3AP4A 3WV6A 4ONUA 2DWRA 4H14A 3MIEA 3WG4A 4AI2A 4Q29A 2R0FA 1HRV3 1RUE3 4L92A 4C0HA 4HZFA 1GKBA 5A3LA 2EXIA 1X7NA 3RPQA 1ZA4A 3T1MA 1F2NA 3B02A 1POV0 4LBLA 4Q1RA 4Y4YA 4D94A 1APNA 1BBT3 1N1YA 4FQ4A 3IWZA 1XNCA 2Y0OA 1HXS2 3E5XA 3OY8A 4B7KA 3L2HA 3WW2A 1RUJ1 4DQAA 4EN6B 4AVAA 1I6XA 4KBBA 3VBOC 2HWD1 4UW6A 3ST7A 4RGAA 5JSPA 5J09A 3ETQA 1YXWA 1DG6A 4SBVA 4XIOA 2DUQA 1OD5A 3SH3A 4EJRA 4FXKB 3H3UA 4Y20B 3B5LB 1SFYA 4FOVA 3IPVB 5JI7A 2XJVA 3BALA 2CWMA 3AZVA 4Q26A 2A6WA 1V6JA 2RS12 4IEVA 4YVSB 4D69A 3QD6A 4HKLA 1I9RA 2YROA 1WLDA 1AR62 3HIFA 4H7LA 1ENQA 3OBRA 2DFBA 3TOJA 5JCTA 5J48A 1ENXA 3ZN4A 4AGGA 4CEWC 2KM2A 5FOBB 3AKSA 3ZDSA 4ES9A 3AJZA 5BNPA 5BNOA 2PTMA 3B9CA 3IKWA 5IK4A 1AL22 1LOFC 4OUSA 4QGLA 4LBQA 3VHNA 2V09A 2NZ9A 3UL2A 1NCQA 1FPN1 2PAEA 4Q4Y3 2DCKA 4FTEA 2DTWA 2JX9A 4E27A 5HCAA 1QMJA 1KRIA 3AZZA 1PVC1 2A73B 1COV2 1QJZA 1ZBA1 3DPRA 2FQPA 2JICA 5J36A 4HPKA 2B45X 2OA2A 2JXAA 2UWCA 4OFGA 4QPGA 3WT3A 1TEIA 2YYOA 1L3JA 3RS6A 5EYXA 3OJBA 4ZU4A 5GJ6A 1FX5A 4Q0SA 2PLV1 3RRDA 3V0AA 2WFF3 3WVJA 2DVDA 5GLTA 1NXD1 3VHRA 4Q2FA 1OI6A 4QD2A 1DQ2A 3ZFFA 4Y1ZA 2TEPA 1MVQA 3NO8A 3PMEA 4HFSA 4X8PA 3ZFGA 1JYCA 1VB4A 4U2AA 4NHKA 4GH4C 2A75A 4R9DA 1H8TB 5E89A 4AVTA 3D0SA 1VLNA 5DUUA 1ZX5A 5BNNC 5CVRA 3CJXA 1CAUB 3X29B 4JQRA 1DBNA 4IEQA 3APBA 3VBUB 4QPIA 1RUF2 4W65A 1VBE2 5C6CA 5FAXA 2TNFA 2HWC3 2DUPA 4COWA 2QDNA 1PGW2 1UU4A 2VUAA 3NKTA 4LE3A 3QH6A 1MR5A 2FZ2A 5C4WC 1UIKA 3FMGA 1ZRRA 2GC0A 1W6MB 5KC6A 4KG0A 2GNDA 4XE9A 5DDJ3 3ZFEC 2RM21 4XW3A 3P3PA 2NP0A 2BNOA 1NE6A 1HQWA 5K8SA 2Q1MA 3ZSEA 2I45A 1ULEA 1OPOA 5FLHA 1ND3A 1S0CA 1CQ9A 2D43A 5CFCA 1W6QB 1KDMA 2D93A 1OQ1A 4COZA 4I30A 1RUJ2 1ZRCA 1MACA 5F5QA 2HWD2 2ARBA 5FREA 5DUXA 3AP5A 4MXVA 1HXS3 3AZYA 1ASJ1 1WCSA 3S7IA 1A3KA 2NMNA 3AM2A 3BOWA 4PDWC 1UZYA 4R4ZA 4XFGA 4XTPA 2XL7A 5CAZA 3CJIA 2BVVA 2XJRA 3AMQA 2FHRA 3B3QE 5C9AB 1WW5A 2RS13 3AX4A 1S2KA 4N43C 4B29A 5I93A 4BWOA 4FTBA 3MICA 1PO21 4QQHA 4XFHA 3IMNA 4UW4A 3MLJA 4JGYC 2ZS6B 1PZ9A 4Y22A 4LE4A 4PJYA 1B35B 3WY6A 4AEDB 3M3IA 3OPZA 2F6BA 4JVAA 3N3HA 4AW7A 4OHXA 5FO7B 1KQRA 1FPN2 3PVOA 1W6OA 1GZWB 3AXDA 4XF4A 1LHWA 5CBLA 4HETA 2WL1A 3S6PA 1AL23 4QMAA 3VBFC 3ZPYA 3R4UA 1J3RA 4JCKA 4XBQA 4AGRA 1PVC2 4CDUA 1H4GA 4WVVA 1AF9A 1ZBA2 1CAXB 3ZN6B 4QQOA 4BLIA 5CG8A 2PELA 4WM7A 1UD1A 4CDQC 4Q4W1 4CRQA 2P17A 1COV3 2H0VA 4MXWB 3KZ4C 4D7SA 2PQQA 5J96B 4S2HA 1LODA 1EAH1 1KITA 3KCYA 1N3PA 2ZOEB 4YW5A 1RINA 3TNQA 2PLV2 3CEWA 2E53A 2G9FA 3HT2A 5CFDA 3VBHA 2ZKLA 5T54A 4XJZA 1IS5A 3W59A 4AEKA 1CJPA 2ZJCA 3G7DA 2D6MA 1O3SA 1ZREA 4XZPA 5IK5A 1EP0A 3RWNA 5A3MA 1A78A 2B5HA 4LHKA 4Q4V1 3NJZA 4O9EA 2VG9A 1H8VA 4GWMA 2X5IA 2IXLA 2RS51 1U5XA 5ABJB 3OBTA 3OCPA 1G86A 2OW4A 2ARXA 2P3IA 4A3XA