2PHXA

Pterocarpus angolensis lectin (pal) in complex with man-5
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
240
structure length
240
Chain Sequence
EDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSPLSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTVKWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Lectin
publication title How a plant lectin recognizes high mannose oligosaccharides
pubmed doi rcsb
total genus 55
structure length 240
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00139 Lectin_legB Legume lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2phxA00
4Z8BA 4JC1A 1JXNA 2D3SA 5H9PA 1KJRA 3RSJA 5E89A 1JBCA 4U36A 1DZQA 1LESA 3SH5A 3ZYPA 1G9CA 2PELA 2DTWA 2AENA 4LBQB 1H30A 1LOFA 2PHXA 3LSEA 3POSA 4PBOA 5GZFA 3ZYRA 1G9BA 3TB0A 4RL7A 2GDFA 2ZHLA 2ZMNA 4P9XA 2D6MA 3OYWA 5H9SA 2EIGA 4AVVA 1MZ5A 3AP9A 3V65A 1EPWA 2WLQA 3AX4A 4Y26A 3ASIA 4UW6A 4FPKA 5JOZA 2RHPA 1N1SA 2P3JA 1JYIA 3KQRA 2UWBA 2ZGOA 3FLPA 2ZGQA 1OKQA 1LENA 1I3HA 3USUA 5GLVA 1WW5A 2YV8A 2UWCA 1N3OA 2GN7A 1AXYA 3WV6A 1BXHA 1GICA 2ZA9A 2ZBJA 5CB7A 3AP6A 3V64A 1SLIA 1C4RA 5T5LA 1DQ0A 3DGTA 3V0BA 4DS0A 4ZKTB 3SITA 4Y20B 1I1EA 4LBKA 5GALA 2E53A 2ZGNA 4XIOA 2CTVA 1KJLA 4W65A 3ZSLA 1SCRA 1LOGA 1N1TA 2R1DA 2NYYA 1LHVA 3AYCA 4Q2FA 5IK4A 1Q56A 1XQNA 2OVUA 3ZPYA 1LGBA 4FPCA 3UK9A 3R4SA 4BMEA 3ILFA 2AREA 1WD3A 5IT6A 2A71A 2D44A 1W6MB 4GKXA 2YROA 4GA9A 2D6NA 5AVAA 4WZFA 1GZWB 2CL2A 3WOGA 3W58A 1WBFA 3JUUA 4K1YA 4XTPA 1ENRA 1CN1A 1G9FA 1Q8QA 1GLHA 3B3QE 4HL0A 3ZXKA 2VXRA 2TEPA 3BOPA 1IS5A 2ZZJA 3A0KA 1JUIA 1V6LA 2R49A 2A6VA 2UWAA 3MW4A 2E6VA 2ZAAA 3M3CA 1FAYA 1V6JA 2EAKA 2ZGSA 2BQPA 2DVFA 2ZGUA 1JYCA 1W6QA 3DUIA 1VAMA 2GMMA 2CWSA 3SNMA 4Q8LA 3OJBA 4H55A 5IUQA 4WV8A 1DYPA 2D6KA 1AZDA 1UZZA 1S0JA 3AYDA 1HQWA 4FPGA 1C57A 4LBJA 4Y1UA 4YGDA 4BM8A 1UL9A 4YG3A 3RRDA 3IKWA 2A6XA 2A6ZA 5E8AA 4C1WA 4XIKA 2GALA 4YW4A 4XMAA 3B00A 1LJ7A 4YFWA 5BYNA 1W0PA 4Q1PA 2EXJA 4P9YA 2ERFA 2ARXA 3WCSA 1WLDA 3ZXJA 1GV9A 1QMJA 1WD4A 2YMZA 4FOVA 4XYXA 1W6PA 1CONA 1PZ9A 1N1YA 4FPYA 5DUVA 1MS4A 3ZSKA 4YZ5A 5H9QA 1DFQA 1VAVA 4XHXA 4YW2A 1IS4A 1W6OB 1D0HA 3PVEA 1WW7A 3A4UA 3I4IA 3ZSMA 2WT1A 1KQRA 2AGSA 3AP5A 5T5OA 4D69A 4Y1VA 4LBMA 1SFYA 1GNHA 2DV9A 4YW3A 4BLJA 1UAIA 1WW4A 2CY6A 3B69A 4XOGA 5T55A 2JECA 2JE7A 4XJWA 1IS3A 1G8WA 1VLNA 1FYUA 2DVDA 5CBLA 1LEDA 1D2SA 1Q8PA 3INAA 3MW3A 1R1ZA 1YI7A 3OGGA 3T2TA 5T50A 1W0OA 3KM5A 1DIWA 4FPEA 1BJQA 1SLTA 1LEMA 1DBNA 1W6NB 4IQPA 1AXKA 1QGLA 1OFSA 1RINA 2DU0A 3OY8B 5F5QA 3V0AB 2ZGKA 4GXLA 1BYHA 3AYEA 3RG0A 3ZXFA 2WJSA 3B01A 2G4IA 2DUOA 5JMCA 4R9DA 1UKGA 3AK0A 4LBLA 2UU8A 3H0OA 3WUDA 2GMPA 5GZDA 3VKFC 1Y7BA 4AVTA 4ASMB 2KM2A 5F9TA 4XJ9A 1Z78A 3AP4A 4XTMA 4TZDA 3AJYA 5GLUA 1UMZA 4R9AA 3WVJA 5E88A 3RMXA 5JDBA 2W39A 1S0GA 1MS9A 2AH2A 3NV4A 4YLZA 5KXDA 1IKQA 1QDCA 1LODA 3WDXA 3WDWA 1KITA 2R16A 2Z42A 4FPHA 5HCFA 4ITCA 1A3KA 3IPVB 3UL2A 4FQZA 4AYUA 1URXA 4K20A 3OYWB 4XXAA 2H0BA 1QOTA 3WG3A 4XBNA 1UX6A 5KXEA 1PZ8A 4XMIA 4K21A 3WDYA 3AYAA 2XG3A 2JKBA 2LALA 4GWNA 3RMYA 4YZ1A 1AXZA 4LBQA 1IS6A 2ZABA 1LU1A 3FUQA 2AUYA 4XBQA 5LK5A 4FPOB 3WG2A 1KDMA 1TEIA 2WSUA 3USUB 4XXPA 1BKZA 3AXDA 2PHUA 2ZGRA 1SLLA 2PHRA 2WT2A 3B9CA 1PZ7A 1ULEA 1AX1A 1V00A 2OUHA 3QCWA 5GLTA 1SLAA 4YGEA 1QKQA 4FOYA 2P3IA 1DHKB 1WLCA 1WW6A 4ISRA 1V6MA 2NZ9A 4PQ9A 4TYSA 1AF9A 1DQ6A 2A75A 1SBEA 4Q1RA 2EXHA 4YM1A 3BTAA 4AGRA 1DQ2A 1UZYA 4M3CA 3FUOA 5HCAA 3PMEA 1N3QA 1VIWB 2A6YA 5DG2A 2C9AA 2VW1A 1YIFA 1V6KA 2WQZC 4LBOA 2D6LX 4L8QA 2R1BA 3VV1A 4FP3A 2C5DA 2VU9A 4Y20A 3NWKA 1CIWA 2ZGPA 1MZ6A 2NMNA 2R0HA 1LGNA 3T1LA 3AZYA 3D5OA 4PBPA 3WHTA 4DRVA 2D6PA 3JU9A 2VW2A 2SBAA 1S0EA 4Y24A 2FHRA 3M3EA 4XZPA 3O12A 4AVSA 1CJPA 3ZVXA 1JHNA 1C1LA 1N3PA 1N1VA 1S0IA 4XILA 3LCPA 5GLWA 4YGBA 5KXCA 4XJZA 1QOSA 1A78A 1F5FA 1CPMA 1GZWA 3LSDA 3A0NA 2VUAA 5CNAA 5GZEA 1DLLA 2PHTA 1CVNA 5DXDA 4LBNA 3T1MA 4FQ4A 3Q9OA 1X50A 1H9PA 1LTEA 1RIRA 4XJAA 4FVVA 4YW1A 4Q27A 5DZEA 1CQ9A 3IM0A 1GZCA 2E51A 2FMDA 3W59A 1Q8SA 3VKOA 3HMYA 1ZM1A 1NLSA 1J1TA 5DZGA 1O4ZA 4DQAA 1LGCA 3GNEA 4AWDA 1JW6A 3FLTA 2JE9A 5DUXA 3C2UA 1MVQA 3UJOA 4DFSA 2ZMKA 1LOBA 2GN3A 3NV2A 2A3WA 5GZGA 1SBFA 3VKLA 2R0FA 2VW0A 2DYCA 3POYA 4YM0A 3UJQA 3M2MA 2E7QA 1LHOA 1GSLA 2NMOA 5T5PA 2GNMA 1JN2P 1UN1A 1V6OA 2PHWA 1QU0A 5JOYA 1QNWA 3N7LA 3GALA 3M3OA 2ZHMA 3U4XA 1DQ1A 1HLCA 1AJOA 2GNTA 1SLBA 2A3YA 2A5ZA 5GLZA 2JD4A 1GANA 2CYFA 4XHBA 2D3RA 1SBDA 3N7MA 2EALA 1HQLA 3AP7A 4KBBA 1QOOA 2P34A 1GKBA 2DWRA 1GNZA 5EWSA 2LTNA 4XJ8A 1SLCA 3ZSJA 3N3HA 2NN8A 1ENSA 2DURA 2B7YA 3AJZA 1A8DA 5DZFA 4Y1ZA 1AJKA 2V5YA 3N36A 3FLRA 3WHUA 1IKPA 3ZXEA 1LHNA 3O5SA 3FBYA 1H9WA 1APNA 1MS5A 4XJUA 2E7TA 1LCLA 1AVBA 1QF3A 3AZWA 4Y1XA 1HDKA 1Q8VA 4FOWA 2HYKA 1W6NA 2ZHNA 3WDUA 1BZWA 1LOEA 2DTYA 3OY8A 3R4UA 3V0AA 2OW4A 5IK8A 4BLIA 1MVEA 2AYHA 3L2YA 1IOAA 3NV3A 2GMEA 2NP0A 3OBTA 4Y22A 3CNAA 5HCBA 3QLQA 3SLIA 2Q5TA 2VY0A 3WZ1A 2PHFA 3BIWE 3TAYA 1LU2A 4R9CA 4CRQA 2ARBA 2CNAA 5JLVA 1RITA 5JOWA 1WLWA 2A3XA 1LOFC 5L73A 5DG1A 2A6WA 2YY1A 1MS1A 1WBLA 3PVOA 2WKKA 3PVNA 4YW5A 1S0CA 4FPLA 4GKYA 5T5JA 3IPVA 5EXOA 2ZGMA 4SLIA 3O0WA 3AZZA 1V6IA 4K1ZA 1MS0A 4M01A 3ZXLA 1G9AA 3V0BB 4JRAA 1FV3A 3AFKA 5IK7A 3HN1A 1F31A 4YM2A 4BPZA 4DRRA 2W52A 4C1XA 4NOTA 1FATA 4M3CB 2D7FA 4YFZA 1FNZA 1LHUA 3WUCA 1FV2A 5DUWA 1WCSA 1DYKA 2JJ6A 2P37A 1ONAA 2ZKNA 1CESA 3N35A 3D4KA 4PF5A 1HKDA 5KXBA 5FRAA 1ULDA 1ENQA 3M3QA 2DUPA 4I30A 2P3KA 5GZCA 4MYEA 1LULA 5JOXA 1YYNA 2A70A 2WT0A 5CA6A 1F9KA 3NV1A 2ZMLA 1MS8A 4U2AA 4ATFA 4UW4A 3N7KA 1S1AA 1S0FA 2EXKA 1S0DA 4PCRA 1GYKA 1W6MA 1DQ4A 3O0VA 4Q26A 2ES3A 3SH3A 4GWMA 2AR6A 3VKMA 3ILNA 4XBLA 1CR7A 3WCRA 4FPJA 1W6QB 1LOCA 4ZXKA 3AZXA 4P9WA 5GM0A 1DGLA 3POWA 2V73A 3MW2A 4M00A 3HR9A 2ZACA 5EYYA 2EF6A 3WG1A 1ZA4A 3RS6A 4CZSA 2CWMA 2DVBA 4M3CF 1OQ1A 4GALA 3WLUA 4CTEA 4UW3A 4YM3A 1ULFA 1YRZA 1AX2A 2A7AA 3MPPG 1GBGA 1G7YA 1VALA 1JOJA 5H9RA 4FPFA 3OPZA 1KRIA 4OZXA 1V6NA 3IN9A 4HANA 4RA0A 3ENRA 1SCSA 4FP2A 5GJ6A 5T52A 3MEPA 3WDVA 1W6PB 2I2SA 2NM1A 2UURA 3AXEA 3BODA 3I8TA 3N7JA 3O0XA 4YGCA 2P2KA 1LHWA 4YG0A 4M3CE 3RQ0A 4Q8KA 2JDZA 1B09A 1FX5A 4DPNA 2ZGLA 3SISA 1ULGA 1LOAA 4LBQD 1U0AA 4R9BA 1O4YA 4AGVA 4BQ1A 1ULCA 2W08A 4ATEA 4WVVA 4P14A 1QDOA 1BQPA 3WNXA 1KDKA 2GNDA 3IMNA 1LECA 1W6OA 2W68A 1CPNA 2GNBA 4YZ2A 4FOQA 2SLIA 3APBA 3SH4A 3WG4A 1DQ5A 1MR5A 4ISQA 3WDTA 1NXD1 2WNEA 2OUJA 1FNYA 5JVVA 2ZGTA 4Y1YA 1AX0A 4YG6A 2YXSA 5FREA 3VKNA 1YO8A 1GZ9A 3R05A 4YZ3A 4BOWA 1SACA 2EXIA 2VH9A 1Q8OA 1UPSA 4WVWA 4XDQA 2ZHKA 5SV8A 2DUQA 1S0BA 1Z0HA 2ENRA 2XB6C 4BMBA 1G9DA 2DU1A 4JCKA 2D3PA 1MACA 2YZ4A 3D6EA 5DUUA 1YXWA 5T54A 2DVGA 1MS3A 2D43A 2DVAA 3FFZA 4F83A 1N47A 2D6OX 5CAZA 3ILRA 4YZ4A 3M1HA 3AZVA 1G86A 5IK5A 1WUVA 3ATGA 4AGGA 3PJQA 3OBRA 4XE9A 1C1FA 3VUOA 1QNYA 4Y22B 4NO4A 4UW5A 2WSVA 5EYXA
chains in the Genus database with same CATH superfamily
2Q1MA 2ZAHA 4Z8BA 5FPLA 2D3SA 4XUQA 3ZFGB 3KHBA 3GHMA 1ZA7A 2DCKA 2QDNA 3MYXA 1LESA 3HBZA 2OYZA 3ZYPA 3FHIB 5KHKA 2DTWA 1PHMA 4IEQA 4LBQB 3LSEA 4PBOA 3PTYA 1W06A 5FY5A 1G9BA 3KVBA 1EY2A 1QJU3 4P9XA 3OYWA 1W03A 4AVVA 1UOJA 1OF3A 1MZ5A 3J8F3 3JD73 1AR83 2FCVA 4Q5OA 1QY4A 2XKPA 1OUSA 1VBD3 4LE4A 2JEMA 3ASIA 4IE4A 4FPKA 1BHGA 4IGPA 2UWBA 3GDBA 3WD5A 1B35B 1W3VA 2B39A 1OKQA 2ZGQA 4YVSB 4EZHA 5LW9A 1I3HA 3USUA 3D0JA 4I02A 2QVSB 4ARYA 2CAUA 3LQCA 1N3OA 4CSWA 2VNGA 5DQ0A 5A6ZA 2WC2A 1LKNA 1RUG2 1DQ0A 2WUHA 4XCAA 4Z2WA 2W1QA 4JV4A 3UKTA 3DV8A 1HXS3 4XIOA 4EWDA 3Q8AA 2CTVA 1K5MB 2JB4A 3JQXA 2QQPA 4OHVA 2PYTA 1U5ZA 5BNNA 2RJKA 4RS5A 1XQNA 4MXVA 4CP9B 1LGBA 3AFGA 3GCWA 3CO2A 2FMYA 1ND3C 5IT6A 3QH7A 5LBEA 2R071 3ZXDA 4BU2A 3HPNA 1W6MB 3ORJA 5J36A 4GKXA 3AMHA 4AHYA 2YROA 4G3YC 3TNQA 4DXSA 1GZWB 2CL2A 3WOGA 5IVEA 4K1YA 1ENRA 2VBDA 2JB8A 2XUMA 4CXXA 2XQRA 5BNPC 2JIJA 3WF0A 2W1UA 1ZREA 1C8M3 1XBFA 5I8TA 2ZEWA 2E6VA 3LEGA 3M3CA 5FPZA 2ZX1A 4CCKA 4QM8A 2VZQA 2XWJB 2BQPA 2DVFA 3D8CA 1YC61 4NPRA 1RUD2 5AC92 3N9LA 4XF4A 3ZN6B 3OJBA 5IUQA 4WV8A 4YNIA 3RVHA 4GB32 3AYDA 5F1RA 1PM7A 1UL9A 4S2FA 3IAPA 2LS6A 2VULA 3RRDA 3IKWA 3VBFB 4EE2A 4XFGA 3PLQA 3T3YA 1LJ7A 2VVFA 4YFWA 2BGCA 1QJY3 2KR2A 4P9YA 5DAVA 3DYPA 1XB9A 3N9MA 2ERFA 5CFDC 2ARXA 1L7LA 3PUSA 1GV9A 4QKDA 1DZRA 1QMJA 3N9QA 2UY8A 1ZX5A 4FOVA 1W6PA 1CONA 3VBSB 1ZBA3 5DUVA 1GFF2 4EJRA 4MLOA 1JU3A 4NE9A 4W6XA 3QOPA 3VDDB 4ET7A 3QBQA 1RUI3 5F3IA 5ABJC 4XHXA 5JXIA 3S7EA 3QACA 1W6OB 3H9AA 2WFPA 2DCJA 4LHLA 3VD7A 4MG2A 5FPBA 5FZAA 4XUNA 3FE5A 3HT1A 3AP5A 1O8SA 4JZRA 4Y1VA 4CDUB 2DV9A 3SCFA 4YW3A 4YVWA 1WW4A 3B69A 4XOGA 4MHUA 2W47A 4RD7A 2JECA 4AI8A 5JWPA 1J3RA 5CBLA 3SMHA 1UMHA 1D0GA 4HLTA 4WM7B 1WGPA 1WZXA 2BPA2 5ACA1 1BJQA 1IZ3A 1TME3 1SLTA 1VAKA 2H6CA 3WF1A 1DBNA 1AXKA 1OFSA 1UY0A 1I6XA 5FK7A 2ET1A 4N8MA 3RG0A 1I5PA 2WJSA 2XVLA 4UF0B 2VMGA 3HWJA 3FHQA 2G4IA 2DUOA 2K46A 2DFCA 5A1LA 5C9AB 3NJZA 4OI2A 4R9DA 3FX3A 4LBLA 2WFF3 4RGAA 1JZ4A 3O1PA 3H0OA 4D0QA 1YFUA 4L97A 1AL21 4NMIA 1P8JA 1AYM1 1XNTA 3LB9A 3FBMA 4ASMB 1Z78A 3FL7A 1RB8G 5GLUA 1UMZA 3K3OA 3RMXA 5EHDA 1T2XA 2W39A 4YLZA 4BXSV 2WAAA 1JH5A 2MEV1 2QCSB 1LODA 3F95A 2W95A 4IEXA 4AQ2A 2WO7A 1VBA3 2PTMA 1JTZX 4AEKA 1E5IA 5HCFA 1A3KA 3UL2A 4CCJA 2K9ZA 5ISLA 5BNOA 1PX4A 2EVXA 2KD7A 3OYWB 2H0BA 4XXAA 5KXEA 1CAWB 4OHYA 5EFUA 3I2DA 4GWNA 4OCTA 1IS6A 2HJIA 3PL0A 3U14A 3MV11 1V9U3 3HQXA 3ACFA 3USUB 4XXPA 1WCKA 3AXDA 2FCUA 1SLLA 4WVMB 2WT2A 5HV4A 5I93A 2EAAA 2WZEA 1PMIA 4H3WA 4AI0A 2YPJA 1JYVA 4YGEA 3O1RA 1UW8A 4MGIE 4NHXA 2W94A 3TEYA 1UIJA 2NZ9A 5F32A 3FWEA 4CDXA 2A75A 3OTFA 3LF7A 2EXHA 2IXJA 3JBG2 3WW3A 2PHLA 1UZYA 3PURA 4D6RA 5J37A 3FUOA 2VECA 1NLQA 2CGNA 4FFFA 1N3QA 5CKQA 1VIWB 4RS5B 2HWD2 2VW1A 2JICA 3UT0A 1V6KA 2WQZC 4H14A 3ZX7A 2Y0OA 1VBE2 3VV1A 4FP3A 1ND3A 4IEZA 2ZGPA 4OQ9A 1MZ6A 2NMNA 2R0HA 3ZMOA 1D4M3 5FZCA 1QH7A 3WHTA 1E5SA 1XNBA 3IIIA 3JU9A 1SEFA 4HG6B 1UZ0A 2C1FA 4AZZA 3ITQA 1H1MA 2J1VA 1AL0G 1NY71 1W2UA 1RMU2 2FHRA 3M3EA 3O1UA 5FUIA 1BBT1 3FJSA 1JHNA 2GU9A 2VMEA 4O65A 3BGAA 2X5IC 2Y60A 4HZFA 3WNNA 1PVC3 4XILA 3R6SA 3LCPA 4HETA 4O9GA 4KGQA 2WQ4A 3RFRA 4CUGA 3OPTA 1QHDA 4XJZA 2HWE2 1C5IA 1REFA 2HEVF 4D8MA 1DU3D 1BMV2 2VUAA 4OMCA 5GZEA 4MV2A 3AKSA 3J8F2 3JD72 3NNMA 1AR82 4E2QA 3ZPOA 4DUVA 1PIV3 5DXDA 1VBD2 1NCRC 3T1MA 3IBMA 4FQ4A 5CADA 3Q9OA 4TLGA 2V4AA 2HEYF 3MF9A 2X53S 4YW1A 3E5QA 4Q27A 5DZEA 4N43C 2QZ3A 3BPSA 3GBWA 3BB6A 5E6HA 3IM0A 1GZCA 2E51A 1RGSA 3VLBB 2WO1A 1M4WA 3DPRC 1ZM1A 1RHI3 5FLJA 4TLFA 4CU8A 4HPKB 5KWRA 5CFDA 5DZGA 2FDJA 3GNEA 2OA2A 5J48A 5FZ4A 4KWUA 3OEBA 3THDA 2A3WA 3F2ZA 5CISA 2IXKA 3H1MA 1HXS2 2R0FA 1BVP1 4KGGA 4BQ2A 4XABA 5T5PA 3OBZA 3WNMA 5ABJA 5DAPA 1V6OA 2Q1FA 5JOYA 1QU0A 2ZZQA 3N7LA 3UETA 1W9FA 2VC9A 1ZRCA 1DQ1A 1RUG1 1SHWB 2GNTA 1G6NA 2IFRA 1OQDA 2A3YA 5GLZA 2JD4A 1JODA 3QH6A 2XLFA 2D3RA 5HCHA 1JOPA 4P9LA 5LY1A 4BXFA 2ZKLA 5A7OA 3N7MA 3LEMA 1DLCA 3BU7A 5A3TA 2HBUA 2OKXA 5C7GA 4Y3OA 2P34A 5I0UA 1QWRA 1C8M2 1OD3A 3NW4A 4LOSA 4BK5A 1W9WA 3H1YA 3RJ2X 3ZSJA 2V4VA 2NN8A 5FLHA 2WINB 3IZOA 3O1MA 2BBAA 3DCQA 2V5YA 4AF9A 2X29A 1IKPA 4XFHA 3SHRA 4BCUA 2WNVB 2L9LA 4IV3B 4XJUA 1MS5A 5JR7B 1OLRA 1IGOA 3TWIA 1U5XA 4PF1A 2YDEA 3E97A 3QD6A 1LOEA 3ZXAC 3K48A 5A3LA 1ALYA 5C8CB 3V0AA 2BWCA 1MVEA 4OVEA 4RSUA 1IOAA 4E9KA 3P6BA 3CNAA 4QB6A 2EIBA 1QJY2 1RUD1 5J3UA 3WZ1A 2XBO1 4OI0A 1LU2A 4QQOA 5JOWA 2ARBA 1NX9A 2BERA 4GB31 3OF1A 1ZBA2 2A3XA 2ILMA 2ZS6B 1QXPA 1GU3A 4QT6A 3CLPA 4MGTA 2YY1A 5FZ8A 1RUI2 2VGDA 2WKKA 5ANNA 3PVNA 4JGYC 3ZIWA 4D94A 1S0CA 1KFUL 5T5JA 1QEXA 1OOPA 4RFT0 2FDHA 3ZM8A 2WNUA 4SLIA 5FY8A 3VZMA 1V6IA 4K1ZA 2YYOA 4IEOA 4M01A 5A3NA 2HH9A 1O3QA 4JRAA 1FV3A 3AFKA 2Q8DA 2ZJCA 3EJKA 1F31A 4YM2A 2VNVA 3AKRA 1XE8A 4V2VA 3C7GA 4C1XA 1CAUA 3CU7A 4Q4V3 2IXLA 3GHNA 1TME2 2VTFA 4YFZA 1FNZA 4MGYE 3PUHA 1FXZA 5J98B 5DUWA 2VOXA 4CP0A 5TSWA 2P37A 2VBPA 1ONAA 3VHNA 2R6QA 1UY1A 5FZMA 1ZZ9A 3CKHA 1ZRFA 1Y9MA 2WFF2 4CVUA 1ND3B 2DUPA 3PDQA 2VOTA 5A32A 2W92A 5L7OB 3JB8A 2KXLA 5C3SA 3H50A 4WM8B 2MPFA 5FDBA 2OX0A 5F7UA 5FJKA 1YYNA 4PIYA 1F9KA 1RUE2 3J7HA 2LROA 4U2AA 3PU3A 2RJ2A 1SDWA 4META 1S1AA 1S0FA 3O7OA 5DN2A 5BNPB 3O1TA 3NQHA 4NIAA 2IUWA 4CU9A 3THPA 4K40A 1O5LA 1W8TA 4XBLA 4BA6A 1VBA2 1JHJA 1CAXB 4ZXKA 5BUVA 3NKTA 4GMP3 4URTA 2EICA 1DGLA 2VMCA 3FC0A 4YW6A 5A1AA 2Z5WA 3TOJA 4I2OA 4ES8A 2X09A 1NCRA 4CZSA 5A7WB 2GH2A 3GM8A 3TEXA 4GALA 2V5DA 2OZJA 1V9U2 2YHJA 2A7AA 3MPPG 4N43A 4UXAA 1JOJA 1OT5A 1S2KA 5FAXA 4OZXA 3OGVA 2FDGA 4BQ4A 4HANA 1QQP1 3DPRA 3KV9A 3DECA 4IGOA 4LKEA 1W2NA 4RA0A 1YCIA 3MEPA 2NM1A 2ORXA 5CFDB 3I8TA 3NSTA 4MXWB 3D3AA 4YGCA 1IQDC 2BBVA 1GMMA 3NJXA 3OUIA 4FCAA 1B09A 5LY2A 4DPNA 1S4CA 2ZGLA 2NQYA 3H3LA 1H4GA 1LOAA 4LBQD 1Y3TA 2RM23 3VDCA 1K3IA 1ULCA 2W08A 2JG8A 4X6RB 2QNKA 1J1LA 3SEEA 1BQPA 3VHOA 3WNXA 1XPWA 1QXJA 3JBG1 3OGRA 5D8AC 2GNBA 1UYZA 5LATA 4BDVB 1OURA 2YBKA 3B02A 1H0BA 1NXD1 1BVVA 1W9SA 5FBJA 3VZKA 4YG6A 1X8EA 3L2HA 3MFCA 2YXSA 1NXMA 2YPDA 1GZ9A 2PLV2 3HT2A 1VBE1 3Q8CA 3A21A 4OI1A 1WCUA 3USSA 2EXIA 4LO8A 4WVWA 2J42A 2XL9A 5SV8A 1XE0A 1UF2C 3O1SA 2Q30A 4OUMA 3RZMA 1JS9A 1S0BA 2ENRA 4CDQA 4JCKA 4XDPA 4F3JA 5G04L 3U07A 1RMU1 4NWVA 4HBNA 1AYN2 2UYBA 1MS3A 2D43A 4LO4B 2QQMA 1N47A 2WAOA 1M06G 5DABA 3ZYIB 2WR9A 2BP6A 1VRH1 3AZVA 3M1HA 3W20A 4AXOA 2HWE1 1W28A 2WO3A 1ZRDA 3PJQA 2OPWA 3DXTA 3HJRA 4UOJA 5B4XA 5I0TA 4WBBA 1SPPA 2R063 2P4EA 3E1F1 3K4DA 3J8F1 4BJ0A 1RHI2 1AR81 1RXGA 1W8UA 2HYXA 4JC1A 2VD7A 3E6BA 3VBHB 3RSJA 3EMRA 4U36A 1XYPA 1G9CA 4HKOA 2PELA 2AENA 1WCDJ 2PHXA 3ZYRA 4DO0A 5DDJ3 3OD0A 1D7PM 2ZHLA 4MSVA 2YB7A 5JIAA 4QXBA 2EIGA 4JGYA 1SFPA 3AP9A 5FZGA 3AKTA 2YBSA 1VJ2A 1O6UA 4NRQA 4Y26A 3LFMA 4DY5A 2P3JA 1JYIA 3KQRA 3POJA 2ZGOA 1HXS1 3FLPA 4ZZ8A 1LENA 4HT1T 3MO4A 5GLVA 2Y0IA 3P3PA 1UCXA 2RS52 3AB0A 3WV6A 1BXHA 1OVSA 3MIFA 2ZA9A 5CZKA 5C4WC 5CB7A 2JDAA 3KCCA 3V64A 5JZGC 4QQ2A 5HXMA 5A80A 4DS0A 4ZKTB 4Y20B 4Q0VA 5FP3A 1PGL2 2FQPA 5FMOL 4HKWA 3T0AA 1KJLA 4W65A 4LHNA 1SCRA 2BOJA 4QU2A 1UY3A 1GR3A 4I3GA 5A3UA 2B9VA 4Q2FA 1UY2A 3KSCA 5EJ1B 5FZIA 5D1IA 1C8M1 1DG6A 4FPCA 1DYOA 1MZEA 3UK9A 4BMEA 4MGZE 3ILFA 1WD3A 3V56A 4QHBA 5F8PA 4NVPA 2XJVA 4QDQA 5FZLA 2X5IB 2WZ8A 4WZFA 4A2UA 1W8FA 4MX3A 4XTPA 3WF3A 3PNAA 1JUHA 1ZZ6A 3R0RA 1G9FA 1YFYA 4Z07A 3H8XA 1GLHA 4EV0A 1ASJ3 4HK9A 3B3QE 4P9JA 4DMIA 3ZYBA 4E4HA 4QMAA 3MICA 4GD4A 4YARA 2VQAA 3JXSA 1UY4A 3MW4A 2HWF3 5LK7B 1Q43A 1UOBA 2VZPA 4CCNA 1V6JA 1ODMA 2JXAA 4C91A 1JYCA 3DUIA 1K42A 4Q8LA 3GBGA 3ZKYA 1YQCA 2VMHA 4NHKA 1PO13 5FV3A 3LPFA 3HNMA 1DYPA 1EV12 1AZDA 1UZZA 1S0JA 1VRBA 1ZBA1 3NNGA 4LBJA 4COVA 3MZHA 4COUA 5I0SA 1XU1A 4FFHA 1YQ8A 4W4ZA 1RUI1 2A6XA 2A6ZA 4C1WA 2WWSA 4XIKA 1W8WA 2GALA 3RZKA 1U5YA 3T08A 2NLRA 4P9IA 2P6HA 2VTXA 3HOBA 3I2HA 1WLDA 5JPMB 2BFUS 3GZAA 4EN9B 2W3JA 2XLAA 3AM2A 4PIXA 1N1YA 3ZSKA 1MS4A 5CIRA 3SCHA 3U0ZA 1POV3 3UV9A 4BHPA 1VAVA 5JCTA 4QHOA 3H3ZA 1IS4A 1S55A 3PVEA 3WSOA 1JMUB 4M0NA 1SG3A 3MLKA 4QPGC 5D8AA 4CUCA 2WT1A 3LIHA 1TME1 4AAXA 1KQRA 3T4HB 5A7NA 4XDQA 2GP5A 2I07B 3NL1A 1GOGA 5A7QA 2HWC3 1JI6A 2Z2SB 4Z2AA 1H1IA 2O8OA 1SFYA 1GNHA 3RDIA 4B29A 4BLJA 2O14A 2OS2A 5JSOA 4EZ4A 2JG9C 2JE7A 2WFF1 1J3QA 4MVTA 1FYUA 2OQ7A 1IG3A 2GZWA 1Q8PA 2HLEA 4MADA 1EAH3 3MW3A 4KWJA 2RV9A 3ZLIA 1QJX3 1YI7A 3OGGA 4AI3A 5JXHA 2ZEYA 4DXRA 1DIWA 5CVRA 1U12A 2PFWA 4AHZA 1RUE1 1PO22 1W6NB 2R7EB 2DU0A 3OY8B 4JDMA 5F3EA 4CEWA 4EWAA 4UT5A 3ZXFA 3B01A 2E63A 1VBA1 2VCCA 3BALA 1WMXA 4AL9A 3AK0A 4D3WA 4CXYA 1ZRRA 2UU8A 4PDWB 3GBFA 1DDLA 1SPPB 2RDQA 5JPNB 4DRVA 2VQUA 1H2KA 1AR73 5F9TA 2VVDA 3AP4A 3LEIA 4TZDA 3AJYA 5E88A 1HRI3 2XMLA 5KR7A 1S0GA 5CFCC 3LKJA 3UGFA 5KXDA 1AR93 1IKQA 3PMSA 4KG8A 4ZONA 4ASKA 3WDXA 3EXUA 3MHZA 5BNOC 4UI9L 1RUH3 1V9U1 2ZPXA 4QGMA 5APAA 3WQ1A 2R16A 2QJVA 3ACHA 3TN93 4ITCA 3IPVB 2O8QA 2QQNA 4KMQA 3VZLA 1URXA 1LNSA 4YPJA 1YHFA 2WS93 1WWYA 3ES4A 5IAVA 3U4SA 4DZGA 5A33B 1PMHX 4ONUA 3AMNA 1RUJ2 1RUC3 2WZR2 3RJRA 3BIEA 3AYAA 4CEYA 1OA4A 4AK3A 2W0XA 5FK8A 1KXGA 2ZABA 3FUQA 3H7YA 1NUKA 3PUIA 4XBQA 5LK5A 4FPOB 3WG2A 3RZLA 1BKZA 2ZGRA 4UFJA 2DFBA 3B9CA 1ULEA 1DP0A 3QCWA 5IFPA 4CDXC 2XPJA 3IAQA 4ZU5A 2GP3A 4FOYA 3WP4A 4JVAA 4ISRA 2YC0A 1WW6A 5F5AA 1V6MA 5C4WA 1O3RA 1FPN3 1DQ6A 4LPLA 5B2GB 2E31A 1O4TA 5FY7A 1SBEA 5JZGA 3SKVA 1Z7S3 1R093 4AGRA 3KF3A 2ADEA 1YI9A 4LIVA 5FPAA 1RJ8A 2A6YA 3VDAA 4BQ5A 5DG2A 1UOGA 2C9AA 4CCMA 1O5UA 5LBBA 2VZUA 4HSJA 2PLV1 5EV7A 5LA9A 3O1VA 3M8LA 4PT6A 5BY5A 1CX1A 1EPZA 3UGHA 3K46A 1YIPA 3NWKA 4Y4RA 4AEMA 5IHRA 3T1LA 2R062 3AMQA 4AFAA 4PBPA 2Y38A 5LRSA 5IVFA 2R043 4I01A 4H7LA 2XJSA 2Y33A 3ZYJB 3ABZA 5K7PA 1AYN1 4NHLA 4UFKA 5FKBA 5KHIA 4AVSA 2YG0A 5HBAA 1CJPA 3ZVXA 4GMP0 1C1LA 1N3PA 1N1VA 4QD2A 1XNCA 1HIXA 1KFXL 1PM4A 4OMDA 5DDJ2 1HB4A 1MQTC 3H7JA 2Y6GA 3K51A 5JI9A 4EYUA 3BOWA 4ZZ5A 1W2OA 1RHI1 3KV5A 3CJIA 1DLLA 5FMOS 2ETEA 1CVNA 4L2NA 4OHZA 3LDBA 3EQEA 4QX3A 2Y6JA 4V1PA 2ZX4A 2O1QA 4JDNA 2BTVC 5IK5A 4XJAA 4FVVA 5ANQA 3GZEA 3KVAA 3MIGA 2XGXA 3MV01 1Q8SA 4P5YA 4IE7A 4Z82A 3HMYA 2Y8KA 4CU6A 1OLME 3I2IA 2VUJA 1QJEA 3A22A 4LHKA 1O4ZA 5EJZB 1UOFA 1JW6A 5DUXA 1MVQA 1LOBA 4M0HA 4RGKA 2GN3A 4LJHA 4UFMA 4PLNA 5FYIA 4AVCA 1SBFA 3VKLA 4CCCA 3POYA 3UJQA 5JXGA 2O0OA 4OLLA 4QGLA 1C28A 2W91A 5FO9B 2RS51 1OQEA 4P08A 4QPGA 1QNWA 1S2BA 2VMFA 4JRLA 2RS33 5CKMA 2NPIA 1Y43B 3CIHA 1SLBA 3C7EA 1NA1B 4JGZC 2A5ZA 3EHKA 4MO3M 5IVYA 1PGL1 1GANA 2CYFA 4ZU7A 4XHBA 2QKDA 5E1RA 1SBDA 2GC1A 2JG9A 2EALA 3VBUC 5FYUA 1ASJ2 1HQLA 3AP7A 1QOOA 4MZUA 4BQXA 1GKBA 2DWRA 2YU1A 5EWSA 1CAVA 1JOBA 4Z92B 2Z4FA 3K3NA 3T0BA 2WWUA 2BNOA 3AJZA 3H8UA 4Q4Y2 4QPYA 4P5HA 1A8DA 4TWTA 3ZMNA 4D7YA 1AJKA 4FSJA 3FLRA 2ZX3A 3WQBA 1RTVA 3O5SA 4QB2A 5I0DA 1F5JA 2BU9A 4KNCA 3TRSB 4D7SA 1PO12 1AVBA 1D2QA 1QF3A 1UO9A 1Q8VA 3AZWA 3EO6A 4Y1XA 5E16A 2HYKA 5FYZA 3WDUA 3ZDSA 2DTYA 3NJYA 1HN0A 5FXZA 3P3NA 3FHAA 4XVHA 3R4UA 4OQ8A 2LRPA 5IK8A 3WEZA 3NV3A 2Y64A 5CFCA 5FWJA 1MPXA 3OBTA 2OPKA 3HNYM 2VY0A 2QQVA 2C6SA 1ND2C 4Y5SA 1W05A 3LOBA 4IDZA 4CRQA 5L9BA 4XUTA 3HEIA 1CX4A 1EV11 3TBDA 5JMOA 4AI2A 2VVEA 3KV4A 4XEZA 3VDBA 3THTA 5FZDA 1LOFC 3LAGA 5DG1A 3MLJA 4Z1VA 2Y34A 1JYXA 3BUCA 2Y6HA 1OOPC 4J6GA 2JIGA 2WNUC 2ZCWA 3I97A 2E7AA 4GKYA 4QAWA 1VBC3 1VBB3 1PGW2 4HSLA 1MS0A 4KBZA 3ZXLA 1G9AA 2IC1A 3NAPC 1WKYA 3FMGA 4BPZA 3OG2A 4IV1C 2W52A 5FZOA 4DRRA 3H3UA 1EAH2 1QJX2 5SV5A 1R64A 2ARAA 5BNNB 4QX8A 4FAHA 2YC2A 1LHUA 1RVF2 3WUCA 3AVRA 4CDWC 1GQHA 4BK4A 2E33A 2JJ6A 4XDOA 1ZBE1 4AFBA 1REEA 2QZ2A 3RWNA 3WP6A 2JDPA 3RNSA 2WDBA 1RC6A 3D4KA 1FOD2 1ULDA 2W1WA 3W5MA 3M3QA 4NRMA 4A7YA 2AEZA 2C0ZA 4I30A 4XFFA 4COYA 1GOHA 2BUKA 2PHDA 3AMMA 1PO21 2WT0A 5EJ3A 1HRI2 3NV1A 4ATFA 2BW8A 1HX6A 1MS8A 4UW4A 4DINB 5DPNA 4TTGA 1AR92 4KWKA 4PCRA 3DYMA 5FO8B 3EYPA 5FMBA 3MF6A 4K9SA 3P5BA 4A42A 2XWBB 3VBOC 2Q8EA 1QJU2 4ZXEA 3E6DA 1PK6C 5J1XA 4JHTA 4I0WB 4N53A 1LOCA 5FMDA 3ZFEC 1MQTA 1NOVA 2C4XA 4GJYA 4GZ9A 4P9WA 4XCBA 2JKXA 2J1SA 2VAUA 5GM0A 4XF1A 3T4VA 4M00A 1HB3A 1QJZA 5A3OA 1RUC2 1XYOA 1ZA4A 1JYNA 1UWWA 3KWVA 4RYDA 2BWAA 4M3CF 1ZNPA 3D0SA 5G05L 4UW3A 1ULFA 1YRZA 5C8WA 2XHKA 1OXCA 1DGRN 2VMIA 5J96B 1VALA 1G7YA 5H9RA 5HI0A 2VG9A 3OPZA 3DF0A 3I2JA 4OYUA 5K0UC 2KA3A 1V6NA 1OH3A 1EUTA 1RUJ1 1W6PB 2I2SA 2WZR1 3L9JT 3Q8FA 4HONA 4N9HA 4P00B 4FXGB 3KB5A 1Z7S2 1R092 4JHZA 2JDZA 5FY9A 3RQ0A 5C5UA 1XNDA 1F35A 2IZWA 5FYTA 4XQDA 3N4MA 2B46X 5JI7A 2JG8C 3CQOA 4A3XA 1POV0 4QXHA 2CDOA 3KCXA 2AEYA 3PUAA 4QPGB 3NJVA 1LR5A 4LUMA 4UBHA 5HV0A 5FQ0A 2W1SA 4YVWB 3H8OA 3E5XA 2G19A 3FZ3A 2B8MA 4JGZA 4LKDA 4YZ2A 2BNNA 5FYMA 2BRTA 2SLIA 3APBA 4CCLA 5K9YA 5KBFA 3WDTA 1KS4A 2R042 1HRV3 2WNEA 4PLMA 5C3PA 5JVVA 2CDPA 4Y1YA 4RQPC 3VBUA 3NVCA 2ORZA 3ON7A 3SXWA 2BYVE 5FREA 3J9SA 3VKNA 4DUXA 1CAVB 3PVBB 4CDQC 2MHFA 4I09A 4OHWA 2YGLA 2R061 4RGGA 3KCYA 4MH0E 3KMHA 4L11A 4BMBA 2D3PA 1MACA 2YZ4A 3CMGA 5FLIA 1YXWA 1ACCA 2PAEA 2WABA 1GQPA 2DVGA 4HKLA 3FFZA 2DVAA 3POFA 2QDRA 5CYYA 4BQWA 5LWBA 1CZVA 3ILRA 4QPIC 5DDJ1 5FBZA 3PJYA 1G86A 4GH4A 1S2EA 1WUVA 3U78A 5AC91 3AKPA 2ATFA 4XE9A 4XW3A 4XC9A 5CFCB 3ZR6A 2FZ2A 2DDUA 3AL5A 1JXNA 5BNOB 5H9PA 4Q0PA 4Q4X3 1FT9A 1ND2A 2PAMA 4N7UA 4Q29A 3T30A 1NE6A 4DXTA 2ZEZA 3MUY1 5L9VA 3I3BA 3ETQA 5FZHA 2F4PA 2PQSA 5A3PA 1H30A 1LOFA 5GZFA 5F3CA 1UZWA 3CF6E 2GDFA 4RL7A 4WVZA 4XF3A 4LKFA 2ZMNA 3VHPA 1OH4A 1W8ZA 2D6MA 5F39A 5J09A 1NG0A 3S5AA 3V65A 1EPWA 2VQTA 2RS32 1AL23 3C7OA 3J7LA 1AHSA 3KGZA 4UW6A 3DXUA 3VZNA 3J4UH 1W04A 2RHPA 1N1SA 4J1XA 5JOZA 4EN0A 5FWEA 4CDXB 2FD8A 2QQIA 2B45X 2CHHA 2HBTA 2VE1A 2X10A 3ACGA 2EA7A 3NAPA 4CPBD 3X29B 1UZVA 2B5HA 4XFCA 2VZ1A 1RXFA 3OEAA 5FZOB 5FXWA 4IV1A 2CSGA 3E5UA 4IE5A 1YFXA 4A7KA 3HQUA 1K12A 4KH9A 2ZBJA 5KC5A 3IDBB 2RMU3 4C0BA 4CDWA 4UWDA 5T5LA 2RE9A 3V0BA 5F6KA 1NZCA 3SITA 3HD8B 1I1EA 5KHHA 2X8KA 4AVAA 1VMFA 1UXXX 2E53A 2ZGNA 3FFQA 4Y33A 1LOGA 3DL3A 2NYYA 3AYCA 4PLOA 1EP0A 4IW3A 5T3NA 5IK4A 1Q56A 2YFUA 1UNBA 1WMDA 2WQ8A 4M4PA 4C0HA 4DB5A 3AMPA 3R4SA 4Q4Y1 5ERLA 1T6BX 2A71A 2D44A 1NKGA 5FZ9A 1HJFA 4R52A 3M4FA 2HWB3 4LO6B 1YUDA 3LA2A 3OOXA 3K75B 5AVAA 1O3SA 3GJAA 3VBOA 2AACA 1WBFA 3JUUA 1PK6A 3KGLA 2XQXA 4DIQA 1MQTB 3GGLA 1IQAA 1CN1A 2PN5A 4QHZA 3ZFEA 4HL0A 3ZXKA 1K5JA 2TEPA 2WRAA 3BOPA 1IS5A 2ZZJA 2R49A 3LOIA 2A6VA 2UWAA 4KL1A 2ZAAA 3U37A 2EAKA 3UESA 2ZGSA 3S6PA 1CWPA 2ZXQA 2ZGUA 1W6QA 1YLLA 2YUEA 1YWKA 3ALQA 1VBB2 1OSGA 1VBC2 2CWSA 3GF6A 4EROA 3M7AA 2N7GA 3I59A 1RUOA 1DF0A 2RR13 4H55A 4QU1A 4XFBA 4IEWA 1CIYA 5DAXA 5K0UA 4TN7A 1HQWA 1C57A 4Y1UA 4B1MA 1GUIA 3H42B 3PTRB 3LGRA 1HN1A 1BBT3 5E8AA 4QM9A 1ZZCA 3WNKA 2QUOA 2JWPA 5BYNA 5ABJB 1EYBA 2EXJA 4Q1PA 5EPAA 4QX2A 1PGW1 1SMVA 1WMEA 3TEWA 2RVAA 3UGGA 3KS7A 4YZ5A 1PZ9A 1J58A 4FPYA 1ZZ8A 1ENXA 4GIQA 5FQ0B 3U10A 4CPBA 1D4M2 2F4LA 5LA1A 1FI2A 5CU1A 4QGNA 1EAH1 3C7FA 4YW2A 1QJX1 4JGZB 4OI4A 1D0HA 1WW7A 2WIIB 3I4IA 2B42B 3ZSMA 4B4RA 1AUYA 2HWD1 3RPQA 1RVF1 5DMYA 2AGSA 4MHRA 2G9FA 4OULA 3ZFFC 4DOUA 3VUOA 2BEOA 3LDKA 1ULPA 4D69A 2P5BA 1PVC2 3WF4A 4XURA 4RQPA 1UAIA 2XJUA 5T55A 1FOD1 5CG9A 1DGWX 4B4QA 4AEDC 4AHXA 1VLNA 1LEDA 2JE8A 1XOYA 1PIV2 1R1ZA 4QX1A 5T50A 1W0OA 4CEWC 4FPEA 4J25A 3MPBA 1HRI1 3AL6A 3WT3A 4CDUC 4JDOA 4ASLA 1QGLA 1RINA 5AVPA 4PIZA 1ZRIA 2ID4A 2ZGKA 4GXLA 4B1LA 3V0AB 2FDFA 1BYHA 1RYYA 2XHNA 4K3UA 2FDKA 1QJU1 2GSYA 1BMV1 1HJGA 1TQ5A 4WM7C 3PU8A 3JB4C 3JD71 4QPIA 1VBD1 4LXLA 5GZDA 2BVVA 3VKFC 4AVTA 4XJ9A 1PNGA 3WVJA 4R9AA 3RYKA 1JZ2A 5FZ7A 3J7NA 3W21A 2AH2A 3IMMA 5C9AC 3KT1A 3O14A 2VCBA 1QDCA 3KD4A 1GWKA 4FI9A 3Q8BA 2OXBA 4XFIA 2GC0A 5FUPA 4FFGA 1GWLA 3GJBA 4FPHA 4MGSA 4FQZA 4AYUA 4X6QB 1OOPB 2VOKA 4K20A 4M4RA 1SFNA 2BGOA 2WNUB 4CEYC 1UX6A 3ZFGA 1PZ8A 3DKWA 2VOWA 4XMIA 2K2SA 4IEUA 4XPVA 4BISA 4ZHNA 1MEC3 1Z7S1 1R091 1AXZA 4LBQA 5FPVA 3CL1A 2AUYA 3HBKA 1CAUB 1KDMA 1QXRA 4I0BA 1OA2A 3WNPA 2IFWA 2ET7A 1HRV2 4ZPIA 3ZIXA 4IV1B 2PHRA 1PZ7A 5GLTA 3VD5A 1V00A 4PI0A 1AR63 2XBO3 4LEJA 1SLAA 1DHKB 4A44A 4PQ9A 4JX0A 1HB1A 4TYSA 1AF9A 4GB33 4AVBA 4CDWB 2EIDA 2IXHA 4B8EA 4XFAA 3S7IA 3IT8A 1B35A 2BVBA 4YVSA 3ZN4A 3BTAA 5A32B 4FBFA 1DQ2A 4IXLA 3S30A 1H8TC 2R041 3ACLA 4IERA 3PMEA 3SC7X 4XAEA 4COZA 5DAWA 2TUNA 1O7FA 1XYNA 2I45A 1OBNA 2Q8CA 1RUF3 2QE3A 3I3QA 3HIFA 4LBOA 2D6LX 4L8QA 2R1BA 3R4DB 4L9BA 2RS13 4E8CA 1CIWA 4QQPA 4R4ZA 3AZYA 4OFGA 2V72A 2D6PA 3ELNA 4KU7A 4UAPA 4Q4X2 2SBAA 1S0EA 3ZFEB 4XZUG 4LK6A 4Y24A 4CP9A 4XZPA 3O12A 1NCRB 4L92A 5BV6A 4ES9A 1S0IA 2ZX2A 3UKVA 5HPOA 1UXZA 2MNGA 3CJIC 1QJY1 5KXCA 1YEWA 1QOSA 5KHJA 4N43B 1A78A 4C90A 1F5FA 1CPMA 1GZWA 1KEXA 1WMFA 3A0NA 3LSDA 5CNAA 4F8AA 4CU7A 4SBVA 5FUNA 1CGPA 1RUNA 3N9NA 5FOJB 3I59B 3DPRB 4LBNA 4AFMA 2YBPA 4HFSA 1X50A 2J1RA 5K0UB 1H9PA 1LTEA 1MZFA 1RIRA 1ZYBA 2VZVA 1CQ9A 2P3YA 4Q4V2 1C5HA 2FMDA 1O91A 1ZZBA 4BQYA 3HAGA 1DZTA 1ULOA 1VP6A 3ZN6A 2BJSA 2Q1ZB 1UYPA 1NLSA 1J1TA 3SEPA 2RS31 2ZX0A 1F8VA 4INDA 4DQAA 1LGCA 2RMU2 2JG8B 3ST7A 4AWDA 1X33A 2JE9A 3CHXA 4DFSA 2CU5A 2RDRA 3K4ZA 3NV2A 5GZGA 3VBFA 3O1OA 3KF5A 4MOAA 2VW0A 4YM0A 2DYCA 3VB9A 5AFBA 1JYTA 1DCSA 1R1A3 2E7QA 2J1UA 5FTTC 4GAZA 3BTZA 5FY4A 1UN1A 5FYVA 3U4XA 3GALA 3M3OA 2ZHMA 5JIUA 3KHCA 4QPWA 4NWWA 4NUBA 5FPXA 2PXJA 4LITA 3I7DA 3ZFFA 1HLCA 1AJOA 1X8MA 4NR1A 2BZDA 5FZ3A 3VBSA 1QQP3 4RQPB 3KQ4B 2W87A 3AC0A 3EB7A 4NRPA 5JXJA 2HWB2 1FMD3 1F4AA 4GWJA 3VDDA 4CDQB 1XXNA 2K0GA 4NIGA 4COWA 4LT5A 4AEDA 4ZY9A 3UNPA 4AQTA 5IATA 4MUVA 3WR0A 4QQHA 4Y5Z0 2LTNA 4XJ8A 4LLFA 3N3HA 4K8FA 4CDUA 1C3HA 2DURA 4S2DA 1PX3A 5DZFA 2JDMA 2VZSA 4LK7A 3N36A 1W9TA 4HN1A 5FYSA 3WHUA 3ZXEA 1LHNA 2QQOA 4TXWA 4GJZA 2YFZA 4LULA 4WM7A 5BXXA 2RR12 1H9WA 1APNA 2E7TA 1SDDB 2DBNA 5A6XA 1BLZA 1HDKA 1H6YA 4BIOA 5L19A 3A7QA 4LA2A 1HQNA 2OW4A 1BBT2 2J1EA 3L2YA 4BLIA 5A1FA 4NJ4A 4UF0A 5C9AA 2NP0A 5F6LB 1VBE3 3BTXA 3ROUA 3QLQA 3SLIA 1F2NA 2Q5TA 1VBB1 4UFLA 2RM22 4I3PA 4JGYB 3BIWE 4LQRA 3TAYA 2AC1A 2CNAA 1RITA 2DCZA 2BNMA 1O8PA 4DNYA 3VBRC 3I54A 4A45A 1TVGA 5C8CC 2BOIA 4ARXA 1WLWA 5FY1A 1RMU3 5FPUA 5C70A 4CCDA 1MS1A 4A7ZA 5C71A 3PVOA 5D21A 3WQ7A 5LB6A 4N90A 2G9ZA 1VRH3 2HWE3 2VQ0A 4PJYA 1R083 3VL8A 1V0AA 3WINE 3EBRA 2OIIA 3N9OA 2VR4A 5J7MA 5EP9A 2VPVA 1CAWA 5IK7A 1D4M1 1H2MA 4RFRB 3HN1A 2JD9A 4XF0A 5C33A 3T0DA 3OGJA 5FFOC 4NOTA 4QB1A 4ZS3A 1W8HA 2D7FA 4LOTA 3LZZA 4WVMA 1JZ8A 1H8TA 5B4NA 3POBA 4NPMA 1PVC1 2XOMA 3B94A 2GC2A 2VNRA 5A7SA 2ZKNA 1CESA 4X8PA 2ADDA 4PF5A 3A23A 4BH9A 1OMIA 5F5CA 1ENQA 5LEKA 3IB3A 2WZPP 1PIV1 2EIEA 4LO5B 4IE0A 5GZCA 1QJFA 2XJPA 5FXVA 5JOXA 2A70A 5CA6A 1COV3 4UFIA 3C7HA 1HW5A 4N53C 2EXKA 1S0DA 1GYKA 2IVIB 1DQ4A 1XSRA 3G6JB 2ES3A 1X7NA 5L7OC 2AR6A 1Y9QA 4LIUA 3ILNA 3WCRA 1CR7A 1UIKA 4FPJA 3PUQA 3TNPB 1LAJA 1XJAA 4LHSA 4WM8C 3SKJE 3MUZ1 4QX0A 4BQ3A 3RWKX 1JU4A 4QX5A 5BNQA 2V73A 3HR9A 1ZVFA 2ZACA 5FJHA 4CUAA 5FP9A 5L9RA 4B3NA 3RS6A 2Q0AA 1X36A 2CWMA 1MEC2 2TBVA 3ZYGA 3I3MA 3WLUA 2VOVA 1NCQC 2XH6A 2G1MA 3HN3A 2VCAA 1O59A 2WNOA 4GULA 4RHV3 1KRIA 3PIGA 1BCXA 3BTYA 1AR62 4CXWA 5IAXA 2XBO2 3IDCB 3IN9A 4YWAA 3ENRA 1SCSA 4FP2A 5GJ6A 3ETPA 5T52A 2UURA 1NQJA 2Z69A 1E57A 3BODA 5F2WA 2AZ5A 1LHWA 1YJKA 2PQQA 2QQUA 4Q8KA 1XC6A 1TMF3 3SISA 5D8AB 1HRV1 4HMZA 2DCYA 1A8MA 1ULGA 4RN5A 4Q0SA 1U0AA 4R9BA 3RZJA 5A3MA 5IVJA 2HKXA 1O4YA 4AGVA 4HPKA 4Y5TA 4BQ1A 2J7MA 1RUF2 1XNKA 4E4ZA 4V2WA 2OQ6A 4NIIA 4P14A 3ZFFB 1JZ6A 2P6CA 2RS12 3ZR5A 1OHFA 3IDAA 4CCEA 3IIAA 1KDKA 2GNDA 2R30A 1LECA 2W68A 3M3IA 4AAPA 4FOQA 1BEV3 2VM9A 2IXIA 3LDRA 2JDYA 3WG4A 1DQ5A 1MR5A 3OB8A 4D6SA 5LEJA 1J83A 3B93A 4AEDB 4N7IA 2OUJA 2XLGA 4D7TA 4JKLA 2LW8A 1EUUA 2HWF2 4CEWB 1NE4A 1OC1A 1YO8A 3K4AA 2VO5A 4BOWA 2FCTA 2JDNA 2VH9A 2VNOA 4CCOA 2GAUA 1Z0HA 2WBKA 1E5HA 1HV1A 5EZWA 2XB6C 1G9DA 5HXVA 1A6CA 2DU1A 3NRUA 4Q4X1 3GCXA 3IWZA 3KT7A 4NROA 3D6EA 3VD4A 5T54A 2FZ1A 1PMJX 4GH4C 4NHYA 3WY6A 2IWGB 2D6OX 2D5FA 4LE3A 1UU4A 4YZ4A 3KZ4C 4UYBA 3ATGA 3MIDA 4Q4W3 3OBRA 2E9QA 1C1FA 5FZEA 4AGGA 4AQSA 4IUGA 4UW5A 5EYXA 4OUEA 2WNVA 1D4VB 3THCA 4IV3A 3JZVA 2Q8OA 1L7RA 3UYJA 2DCTA 2XR4A 2F6BA 4FTSA 1KJRA 1SZBA 5E89A 1JBCA 3K77A 1DZQA 4JKKA 5FIXA 1RUE3 3SH5A 3VBRA 2J22A 3POGA 4CEYB 2ZOEB 5C8CA 4Q4V1 1OPMA 3POSA 3UKNA 1R1A2 3BCWA 3LA7A 3TB0A 4LORA 3JCIA 4HK8A 1W39A 5H9SA 2HWC2 3DKQA 4HXCA 4W6YA 2C24A 1CZSA 1J3PA 3VBHC 4NAMA 2QQKA 1W0NA 2RMU1 4LTAA 2WLQA 3AX4A 5BPXA 1W8OA 1QQP2 5C4WB 3T2QA 1FMD2 2RDSA 4UBGA 5JZGB 1Y4WA 1DGRA 3OCPA 3N9PA 3CDZB 3NMBA 5FZFA 3VD9A 2OT7A 4QKFA 1WW5A 3RYRA 1XU2A 2B4KA 2UWCA 2YV8A 3MLLA 3VZOA 4IGQA 2GN7A 1AXYA 4JQRA 1H8TB 3MGUA 1GICA 4EWEA 5I0RA 3AP6A 1SLIA 1C4RA 2YU2A 5EIYB 3DGTA 4FTBA 3I3EA 2CAVA 2HWB1 1W90A 3LPGA 4GMP1 4LBKA 4K8RB 2QQWA 1UYYA 1NLRA 5FKCA 5GALA 3MFAA 3ZDVA 3ZSLA 1AR72 3W5NA 1W9YA 1N1TA 1UMIA 2R1DA 4E27A 1LHVA 4JTOA 2I74A 1C8NA 5IYYA 1NQDA 2OVUA 3ZPYA 5IWFA 2XL7A 5FO7B 1IHMA 1I5ZA 3RGBA 2AREA 1RUH2 1IPJA 2VBBA 5IVCA 3TN92 4GA9A 2D6NA 1YQ2A 3RYPA 4JQTA 2WS92 5L7OA 4XQ4A 3CJIB 4KI5M 3W58A 2RR11 4LA3A 2VXJA 1WCQA 5I91A 1W2TA 1Q8QA 2ZEXA 3MBWA 4WM8A 2VXRA 4HN0A 1W2AX 1GP6A 2QQJA 3HNBM 3LFIA 1YNAA 1ST8A 3A0KA 1JUIA 1V6LA 5BNPA 4FXKB 3RZGA 2R073 1FAYA 2PLV3 4LKSA 4R8HA 4RR3C 5IFTA 3MDPA 1CAXA 1VRH2 2RM21 3MIHA 3B5LB 1NCQA 1VAMA 2GMMA 1R082 3SNMA 1UD1A 2QQLA 3POIA 1JZ5A 1WA4A 3RZHA 3CEWA 5JSPA 1FPN2 2D6KA 4LNVA 4YGDA 5LBCA 2C26A 4FPGA 4BM8A 2D40A 1AYN3 1UU6A 5A7WA 4YG3A 4D6QA 1OFNA 1E5RA 1H4HA 2WA4A 4YW4A 1W3XA 4XMAA 1HB2A 3B00A 3LE0A 2VMDA 1U5IA 4IEPA 1W0PA 2RJLA 4S2GA 1VB4A 3WCSA 1NAEA 3ZXJA 2H6BA 3E6CC 3ACIA 4FFIA 2JDKA 2WLPA 5LA0A 2XUEA 1WD4A 2YMZA 4PQQA 4XYXA 2QBXA 5D2AA 5IVVA 4MXWA 4QQLA 5H9QA 3C3VA 2E32A 3NKGA 4IEYA 5FYBA 1DFQA 5FZBA 2VUCA 4JAAA 4UFHA 2JG9B 1GNYA 5DAQA 3SCGA 3A4UA 4XQWA 1OKOA 4WZCA 5A3WA 2IVJA 2WO2A 5IW0A 1COV2 2CGOA 2CV6A 5T5OA 3BKZA 4LBMA 5FYYA 4KWLA 5FR3A 2CY6A 1Y9GA 4QDRA 4JKMA 1KS5A 3DYOA 4HOOA 4XJWA 1IS3A 1G8WA 4B4PA 2DVDA 1UPIA 1D2SA 3INAA 1H2NA 4XUPA 3AVSA 3T2TA 3KM5A 4TSVA 4O9EA 1LEMA 1Q3EA 3RI9A 4IQPA 4NIHA 4XETA 5F5QA 2UYAA 2RS53 1UKRA 2W5FA 3DN7A 3SQOA 3AYEA 3OGSA 3H8RA 3MIBA 3BPZA 5JMCA 2FDIA 1UKGA 4RHV2 1F4HA 1US2A 4BB3A 4C8DA 1RL3A 2JENA 3WUDA 2GMPA 1IG0A 1OI6A 2WYSA 4A4AA 1BK1A 1Y7BA 3TEZA 1IPSA 2KM2A 5I8SA 4XTMA 4NAOA 5FY0A 5ACA3 4IEVA 2P17A 5EQUA 5JDBA 5L36A 1MS9A 3NV4A 4O61A 1MEC1 5LCWL 2G9GA 3VBRB 3T2PA 1TMF2 3H1WA 4PDWC 3WDWA 1OPOA 1KITA 4DXZA 1OLQA 2Z42A 3IDEA 3RZZA 3ZFGC 1VB2A 1AR61 1STMA 4N9IA 3WG3A 1QOTA 1AYM3 4XBNA 3AKQA 3VBHA 1TNFA 4K21A 3WDYA 1GOFA 2Y6FA 4XUOA 1JZ7A 2XG3A 2XXZA 4QXKA 4E4DX 2JKBA 2LALA 3RMYA 3B7MA 4OUSA 5FP4A 4YZ1A 2RDNA 5C3QA 1LU1A 1GP4A 2MEV3 1BEV2 2WA3A 3HQRA 1SQ4A 5FZ0A 5AFEA 4E2SA 1TEIA 2WSUA 5JAXA 1IPKA 1VMHA 2PHUA 5LRRA 4Q0UA 3D82A 3NO8A 3WW4A 4EQVA 1AX1A 5A70A 2OUHA 3CBNA 1RUF1 1QKQA 1LB2A 1B35C 2P3IA 1WLCA 4YVSC 5FZ1A 2QFEA 4KG0A 2RS11 1UU5A 1EV13 4HVRA 2VCMA 3BI3A 4Q1RA 3PIJA 4OZOA 4YM1A 3NNLA 1ASJ1 4M3CA 4XACA 3VN4A 5LBFA 4FT8A 5HCAA 5FZKA 3ZSEA 2LUWA 4E2GA 2VZ3A 4AOCA 2HWF1 1OA3A 1YIFA 1YFWA 4AQ6A 1QH6A 1K5MC 3M70A 4A6SA 2C5DA 2VU9A 4Y20A 2R32A 4Q4W2 1LGNA 1POQA 1CD3G 4N53B 4W50A 3D5OA 3URFA 5LA2A 1L7QA 2C9KA 1PO11 4NHMA 2VW2A 3BN6A 3U1XA 1CJDA 1XE7A 4LO7A 3LD8A 4B7KA 5FZ6A 5I8YA 3POEA 1I9RA 3WNLA 3MI8A 3G7DA 5GLWA 4AE2A 4CP1A 1ZBE3 2CGPA 4YGBA 4FO9A 2X5IA 4AEJA 5KHGA 1UQXA 4QX7A 1CZTA 4RR3A 1VMJA 1NCQB 4ZS2A 1J59A 2A1XA 4H2AA 5F5IA 4EN7B 1YQ5A 2PHTA 2W9XA 1V70A 1POV1 1XNAA 1X9PA 2XDVA 1PO23 5GKAC 2D93A 1XRUA 1H6XA 4QKBA 3VZJA 3W9AA 1R1A1 2Q4SA 1W8NA 3WP3A 3W59A 4EN8B 4FTEA 4YYOA 1OD5A 2HWC1 3VKOA 3B9IA 4FAGA 1JYWA 1REDA 2VJXA 2A73B 5JSRA 4CE8A 5FXXA 3S5QA 3OSDA 3ES1A 3VBFC 3GXUA 1VPHA 3OPWA 3ZOIA 3FLTA 1WA6X 4LUKA 3C2UA 3UJOA 1QIQA 3ME2A 1FMD1 2ZMKA 3I2FA 4DY3A 4CA9A 2D97A 1UYXA 2J1AA 4A41A 3M2MA 1LHOA 1GSLA 2NMOA 3NNJA 4CUBA 4AI9A 3ZO0B 2GNMA 1HV0A 1JN2P 3VBSC 2JDHA 2PHWA 3VBUB 5A6QA 2WN3A 2Y26A 3JQWA 4QXCA 4AW7A 5CEHA 5F37A 1DGWA 2Y6KA 3VDDC 3HVDA 1VE0A 3U11A 1X82A 1K45A 4LLOA 2BGPA 4XF9A 1RUJ3 2WZR3 3WW2A 2F17A 4QDSA 1JZ3A 4W6WA 2PAKA 1AR71 1TE1B 5JR2A 3OUJA 4B7EA 5A6YA 3OUHA 1GWMA 4KBBA 5LZ6A 1A34A 1AR91 1GNZA 2W2IA 4GQ7A 4HVOA 3GZUC 4S2HA 3WNOA 1NA1C 2H0VA 1Q5OA 1SLCA 4P9GA 4X8NA 4BYYA 1RUH1 4E4SA 4CP2A 1ENSA 1RUG3 2B7YA 2R072 1PNFA 2LM3A 3GZTB 1NYWA 4GH4B 4Y1ZA 3TN91 3KLSA 4DUWA 3I49A 2WS91 4LMFA 3FBYA 1NZIA 3U75A 1RUC1 1LCLA 1ND2B 5KC6A 4FOWA 2BV4A 3WQ0A 2ZHNA 1W6NA 1BZWA 1LRHA 2RG4A 3FN9A 3OY8A 3I3DA 2VUDA 2IXCA 2XVKA 4H7MA 3T2OA 4LR4A 2AYHA 2GMEA 3WXPA 4ZU4A 4Y22A 3Q8EA 1OUXA 5HCBA 2OZ6A 2PHFA 1X9TA 1R081 4PDWA 5F2SA 5K4LA 1OF4A 2P1BA 4MGKE 4R9CA 5FYHA 2BFUL 5JLVA 1FPN1 1US3A 3TYJA 2GC3A 2PMWB 2VZOA 2XJTA 3K2OA 3LA3A 5FCCA 3J26N 5L73A 3CZUA 3MIEA 2A6WA 1O3TA 3NAPB 5FP7A 4R4XA 1WBLA 2WYFA 4BE3A 1NT0A 2J1TA 4G9SB 3CJXA 4ORFA 4YW5A 2ZTNA 4IL7A 4AFDA 1RUD3 4KU8A 4FPLA 5AC93 3IPVA 5EXOA 2ZGMA 3BYWA 3O0WA 2BDRA 2WWJA 3AZZA 4KQ7A 5A33A 3V0BB 5IJRA 2YC4A 4F7ZA 2YGMA 4NIDA 5F3GA 3ZKUA 2JX9A 2Y6LA 4BIFA 5C3RA 5C3OA 2X05A 1FATA 1OVPA 4M3CB 5FYCA 4E8DA 3RI8A 1COV1 4AR2A 2FBEA 1FV2A 2XONA 1WCSA 3I2KA 1H1AA 1DYKA 1PGSA 2XVGA 1OLMA 2W46A 2QTWB 3N35A 3I2GA 1HKDA 5KXBA 5FRAA 1T6GC 4IETA 5FP8A 3ZXGA 3WW1A 3NNFA 1TNRA 4EN6B 1XSQA 4YSFA 1K5MA 1KGYA 4Y4YA 4CYDA 4DEVA 1RJ7A 4O7XA 4Q0QA 1BK0A 4RS5C 3VBOB 1PK6B 2P3KA 4J1WA 4MYEA 4JTNA 1KD7A 1LULA 5C5TA 4YW7A 1VR3A 5ACA2 4W8JA 2ZMLA 3N7KA 1J84A 1H2LA 3T09A 3VGIA 1W6MA 3O0VA 4Q26A 3SH3A 4GWMA 3OBAA 3VKMA 5FOBB 4RHV1 1W6QB 1ODNA 3LEKA 3AZXA 3P1IA 1F15A 3ZYHA 4L99A 1AL22 4RR3B 4MGQA 1GZTA 1AYM2 3ZN5A 3POWA 3MW2A 5EYYA 2EF6A 2V09A 4YRDA 3WG1A 4BWOA 4QWNA 2UY9A 2DVBA 4NPLA 2PA7A 1OQ1A 1TMF1 1W99A 2VZRA 2MEV2 4CTEA 4YM3A 2WN2A 4Q4Y3 4QKNA 1AX2A 3VL9A 1GBGA 3CZJA 3J7MA 4FPFA 4AFCA 4IE6A 5CKNA 2D5HA 4URAA 2E26A 1L3JA 2WL1A 3GYDA 3WDVA 3N7JA 2XJQA 3AXEA 3O0XA 2GH8A 2P2KA 4YG0A 4BZ4A 4OHXA 4M3CE 1BEV1 1FX5A 2XKOA 3KV6A 1YJLA 5M0TA 3KT4A 3OD4A 2JDUA 4AI1A 2VL4A 4IESA 3C8XA 4L0PA 3WP5A 5BNNC 1TG7A 5IVBA 4ATEA 4WVVA 4K7JA 4A3ZA 5A7PA 4P02B 1YQ6A 1GQGA 2B9UA 5LASA 1QDOA 5K8SA 3IMNA 1W6OA 1CPNA 3LWCA 3SH4A 4G4FA 2Z79A 4ISQA 3I2OA 4A6OA 1FNYA 2ZGTA 3WX5A 1AX0A 4YVWC 1H8VA 4AHWA 4K6BA 2ARCA 3R05A 1PVXA 1TZOA 2XJRA 4YZ3A 4GWIA 3WF2A 1SACA 3BVCA 1NA1A 1ZBE2 3LIGA 4PHZA 1Q8OA 1UPSA 2D98A 3DEMA 2ZHKA 3PHMA 4Q4W1 2DUQA 3VHRA 3S57A 2HEWF 4QPIB 3JBG3 4DEQA 3ECQA 2DF7A 5FMCA 4HVQA 1UX7A 5JUVA 5DUUA 2VTXJ 4XAAA 1NY72 3BU0A 5CG8A 3S0MA 2HWD3 1GP5A 4I0AA 1RVF3 4F83A 4PI2A 5CAZA 2WNVC 1ZZ7A 2DBIA 4IV3C 4NN0A 5C6CA 3ZYFA 1VBC1 3VD3A 2VZTA 1QNYA 4Y22B 4NO4A 1FOD3 2TNFA 4AG4A 2WSVA 1WLTA
chains in the Genus database with same CATH topology
2Q1MA 2ZAHA 4Z8BA 2D3SA 3ZFGB 3GHMA 2DCKA 2QDNA 3MYXA 1LESA 3HBZA 2OYZA 3ZYPA 3FHIB 5KHKA 2DTWA 1PHMA 4IEQA 4LBQB 3LSEA 4PBOA 3PTYA 1G9BA 1EY2A 1QJU3 4P9XA 3OYWA 4AVVA 1MZ5A 3J8F3 3JD73 1AR83 1QY4A 2XKPA 4LE4A 1VBD3 2JEMA 3ASIA 4FPKA 2UWBA 3WD5A 1B35B 2B39A 2ZGQA 1OKQA 4YVSB 1I3HA 3USUA 3D0JA 4I02A 2QVSB 2CAUA 1N3OA 2VNGA 2WC2A 1LKNA 1RUG2 1DQ0A 4Z2WA 4JV4A 3UKTA 3DV8A 1HXS3 4XIOA 4EWDA 2QQPA 2CTVA 1K5MB 3JQXA 4OHVA 2PYTA 1U5ZA 5BNNA 2RJKA 4RS5A 1XQNA 4MXVA 1LGBA 3AFGA 3CO2A 2FMYA 1ND3C 5IT6A 3QH7A 3ZXDA 2R071 1W6MB 5J36A 4GKXA 3AMHA 4AHYA 2YROA 4G3YC 3TNQA 1GZWB 2CL2A 3WOGA 4K1YA 1ENRA 2XUMA 5BNPC 1ZREA 1C8M3 5I8TA 2E6VA 3M3CA 5FPZA 2ZX1A 4QM8A 2XWJB 2BQPA 2DVFA 3D8CA 4NPRA 1RUD2 5AC92 4XF4A 3ZN6B 3OJBA 5IUQA 4WV8A 4YNIA 4GB32 3AYDA 5F1RA 1PM7A 1UL9A 4S2FA 2VULA 3RRDA 3IKWA 3VBFB 4XFGA 3PLQA 1LJ7A 2VVFA 4YFWA 2BGCA 1QJY3 4P9YA 5CFDC 2ERFA 2ARXA 1GV9A 1DZRA 1QMJA 2UY8A 1ZX5A 4FOVA 1W6PA 1CONA 3VBSB 1ZBA3 5DUVA 1GFF2 4EJRA 4MLOA 4W6XA 3QOPA 3VDDB 3QBQA 1RUI3 5ABJC 4XHXA 3S7EA 3QACA 1W6OB 3H9AA 2WFPA 2DCJA 4LHLA 3FE5A 3HT1A 3AP5A 4Y1VA 4CDUB 2DV9A 3SCFA 4YW3A 4YVWA 1WW4A 3B69A 4XOGA 5JWPA 4RD7A 2JECA 4AI8A 1J3RA 5CBLA 3SMHA 1D0GA 4HLTA 4WM7B 1WGPA 2BPA2 5ACA1 1BJQA 1IZ3A 1TME3 1SLTA 1VAKA 2H6CA 1DBNA 1AXKA 1OFSA 1I6XA 2ET1A 3RG0A 2WJSA 2XVLA 2VMGA 3HWJA 5C9AB 2G4IA 2DUOA 2DFCA 3NJZA 4OI2A 4R9DA 3FX3A 4LBLA 2WFF3 4RGAA 3H0OA 1YFUA 4L97A 1AL21 1AYM1 3LB9A 3FBMA 4ASMB 1Z78A 1RB8G 5GLUA 1UMZA 3RMXA 2W39A 4YLZA 1JH5A 2MEV1 2QCSB 1LODA 4IEXA 4AQ2A 1VBA3 2PTMA 1JTZX 4AEKA 5HCFA 3UL2A 1A3KA 2K9ZA 5BNOA 2EVXA 3OYWB 4XXAA 2H0BA 5KXEA 1CAWB 4OHYA 5EFUA 3I2DA 4GWNA 1IS6A 2HJIA 1V9U3 3HQXA 3USUB 4XXPA 1WCKA 3AXDA 1SLLA 4WVMB 2WT2A 5I93A 2EAAA 1PMIA 4H3WA 4AI0A 2YPJA 4YGEA 1UW8A 4MGIE 1UIJA 2NZ9A 3FWEA 4CDXA 2A75A 3OTFA 2EXHA 2IXJA 3JBG2 3WW3A 2PHLA 1UZYA 5J37A 3FUOA 2VECA 2CGNA 1N3QA 1VIWB 4RS5B 2HWD2 2VW1A 2JICA 1V6KA 2WQZC 4H14A 3ZX7A 2Y0OA 1VBE2 3VV1A 4FP3A 1ND3A 4IEZA 2ZGPA 3ZMOA 1MZ6A 2NMNA 2R0HA 1D4M3 1QH7A 3WHTA 4DRVA 1XNBA 3JU9A 1SEFA 2C1FA 1H1MA 1AL0G 1NY71 1W2UA 1RMU2 2FHRA 3M3EA 1BBT1 3FJSA 1JHNA 2GU9A 2X5IC 4HZFA 1PVC3 4XILA 3R6SA 3LCPA 4HETA 4O9GA 4KGQA 2WQ4A 1QHDA 4XJZA 2HWE2 1C5IA 1REFA 2HEVF 1DU3D 1BMV2 2VUAA 5GZEA 4MV2A 3AKSA 3J8F2 3JD72 4E2QA 1AR82 1PIV3 5DXDA 1VBD2 1NCRC 3T1MA 3IBMA 4FQ4A 5CADA 3Q9OA 2HEYF 3MF9A 2X53S 4YW1A 3E5QA 4Q27A 5DZEA 4N43C 2QZ3A 3GBWA 3BB6A 3IM0A 1GZCA 2E51A 1RGSA 3VLBB 1M4WA 3DPRC 1ZM1A 1RHI3 5FLJA 4TLFA 4HPKB 5KWRA 5CFDA 5DZGA 3GNEA 2OA2A 5J48A 2A3WA 2IXKA 3H1MA 1HXS2 2R0FA 1BVP1 4KGGA 5T5PA 5ABJA 1V6OA 5JOYA 1QU0A 2ZZQA 3N7LA 1ZRCA 1DQ1A 1RUG1 2GNTA 1G6NA 2IFRA 1OQDA 2A3YA 5GLZA 2JD4A 3QH6A 2XLFA 2D3RA 4P9LA 2ZKLA 3N7MA 3BU7A 2P34A 5I0UA 1QWRA 1C8M2 3NW4A 3H1YA 3RJ2X 3ZSJA 2NN8A 5FLHA 2WINB 2V5YA 4AF9A 2X29A 1IKPA 4XFHA 3SHRA 4BCUA 2WNVB 4IV3B 4XJUA 1MS5A 5JR7B 1OLRA 1IGOA 3TWIA 1U5XA 2YDEA 3E97A 3QD6A 1LOEA 3ZXAC 3K48A 5A3LA 1ALYA 5C8CB 3V0AA 2BWCA 1MVEA 4OVEA 4RSUA 1IOAA 4E9KA 3CNAA 1QJY2 1RUD1 5J3UA 3WZ1A 2XBO1 4OI0A 1LU2A 4QQOA 5JOWA 2ARBA 4GB31 3OF1A 1ZBA2 2A3XA 2ILMA 2ZS6B 1QXPA 4QT6A 3CLPA 2YY1A 1RUI2 2VGDA 2WKKA 3PVNA 4JGYC 3ZIWA 4D94A 1S0CA 1KFUL 5T5JA 1OOPA 4RFT0 2WNUA 4SLIA 3VZMA 1O3QA 1V6IA 4K1ZA 2YYOA 4IEOA 4M01A 4JRAA 1FV3A 3AFKA 2ZJCA 3EJKA 1F31A 4YM2A 3AKRA 1XE8A 4C1XA 1CAUA 3CU7A 4Q4V3 2IXLA 3GHNA 1TME2 4YFZA 1FNZA 4MGYE 1FXZA 5J98B 5DUWA 2VOXA 4CP0A 5TSWA 2P37A 3VHNA 1ONAA 2R6QA 1ZZ9A 1ZRFA 2WFF2 1ND3B 2DUPA 5L7OB 5A32A 3JB8A 2KXLA 3H50A 4WM8B 2MPFA 5FDBA 1YYNA 4PIYA 1F9KA 1RUE2 4U2AA 1SDWA 4META 1S1AA 1S0FA 3O7OA 5BNPB 3THPA 4K40A 1O5LA 4XBLA 4BA6A 1VBA2 1CAXB 4ZXKA 5BUVA 3NKTA 4GMP3 4URTA 1DGLA 3FC0A 2Z5WA 3TOJA 4I2OA 4ES8A 1NCRA 4CZSA 2GH2A 4GALA 2OZJA 1V9U2 2YHJA 2A7AA 3MPPG 4N43A 4UXAA 1JOJA 5FAXA 1S2KA 4OZXA 4HANA 1QQP1 3DPRA 4RA0A 1YCIA 3MEPA 2NM1A 5CFDB 3I8TA 3NSTA 4MXWB 4YGCA 2BBVA 4FCAA 1B09A 4DPNA 2ZGLA 2NQYA 1H4GA 1LOAA 4LBQD 1Y3TA 2RM23 1ULCA 2W08A 2JG8A 4X6RB 2QNKA 1J1LA 1BQPA 3VHOA 3WNXA 1QXJA 3JBG1 5D8AC 2GNBA 3B02A 1H0BA 1NXD1 1BVVA 3VZKA 4YG6A 1X8EA 3L2HA 3MFCA 2YXSA 1NXMA 1GZ9A 2PLV2 3HT2A 1VBE1 4OI1A 3USSA 2EXIA 4LO8A 4WVWA 2XL9A 5SV8A 1UF2C 2Q30A 4OUMA 1S0BA 2ENRA 4CDQA 4JCKA 4F3JA 3U07A 1RMU1 4NWVA 4HBNA 1AYN2 2UYBA 1MS3A 2D43A 4LO4B 1N47A 1M06G 3ZYIB 3M1HA 1VRH1 3AZVA 4AXOA 1ZRDA 2HWE1 3PJQA 4E4DX 3VUOA 5I0TA 4WBBA 2R063 3J8F1 1RHI2 1AR81 4JC1A 3E6BA 3VBHB 3RSJA 4U36A 1XYPA 1G9CA 4HKOA 2PELA 2AENA 1WCDJ 2PHXA 3ZYRA 5DDJ3 3OD0A 4MSVA 2ZHLA 5JIAA 2EIGA 4JGYA 3AP9A 3AKTA 1VJ2A 4Y26A 4DY5A 2P3JA 1JYIA 3KQRA 2ZGOA 1HXS1 3FLPA 1LENA 4HT1T 5GLVA 2Y0IA 3P3PA 1UCXA 2RS52 3AB0A 3WV6A 1BXHA 3MIFA 5C4WC 2ZA9A 5CB7A 3KCCA 3V64A 5JZGC 4QQ2A 4DS0A 4ZKTB 1PGL2 4Y20B 4Q0VA 2FQPA 5FMOL 4HKWA 1KJLA 4W65A 4LHNA 1SCRA 4QU2A 1GR3A 4I3GA 4Q2FA 3KSCA 5D1IA 1C8M1 1DG6A 4FPCA 1MZEA 3UK9A 4BMEA 4MGZE 3ILFA 1WD3A 3V56A 4QHBA 4NVPA 2XJVA 2X5IB 4WZFA 4A2UA 4MX3A 4XTPA 3PNAA 1JUHA 1ZZ6A 3R0RA 1G9FA 1YFYA 4Z07A 1GLHA 4EV0A 1ASJ3 4HK9A 3B3QE 4P9JA 4DMIA 4QMAA 3MICA 4YARA 2VQAA 3MW4A 2HWF3 5LK7B 1Q43A 1V6JA 2JXAA 4C91A 1JYCA 3DUIA 4Q8LA 3GBGA 2VMHA 4NHKA 1PO13 1DYPA 1EV12 1AZDA 1UZZA 1S0JA 1ZBA1 4LBJA 4COVA 3MZHA 4COUA 5I0SA 1XU1A 1RUI1 2A6XA 2A6ZA 4C1WA 2WWSA 4XIKA 2GALA 1U5YA 2NLRA 4P9IA 1WLDA 5JPMB 2BFUS 3GZAA 4EN9B 2XLAA 3AM2A 4PIXA 1N1YA 3ZSKA 1MS4A 5CIRA 3SCHA 3U0ZA 1POV3 3UV9A 4BHPA 1VAVA 5JCTA 3H3ZA 1IS4A 1S55A 3PVEA 4QPGC 4M0NA 3MLKA 5D8AA 2WT1A 1TME1 1KQRA 2I07B 3NL1A 2HWC3 2Z2SB 1H1IA 2O8OA 1SFYA 1GNHA 3RDIA 4B29A 4BLJA 5JSOA 2JG9C 2JE7A 2WFF1 1J3QA 4MVTA 1FYUA 2GZWA 1Q8PA 1EAH3 3MW3A 4KWJA 4AI3A 1QJX3 1YI7A 3OGGA 1DIWA 5CVRA 2PFWA 1U12A 4AHZA 1RUE1 1PO22 1W6NB 2DU0A 3OY8B 4JDMA 4CEWA 4EWAA 3ZXFA 3B01A 2E63A 1VBA1 3BALA 4D3WA 3AK0A 1ZRRA 2UU8A 4PDWB 3GBFA 1DDLA 5JPNB 1H2KA 1AR73 5F9TA 2VVDA 3AP4A 4TZDA 3AJYA 5E88A 1HRI3 1S0GA 5CFCC 3LKJA 5KXDA 1AR93 1IKQA 3PMSA 4KG8A 3WDXA 3EXUA 5BNOC 1RUH3 1V9U1 2ZPXA 4QGMA 3WQ1A 2R16A 2QJVA 3TN93 4ITCA 3IPVB 2O8QA 3VZLA 1URXA 1YHFA 2WS93 3ES4A 5A33B 4DZGA 4ONUA 3AMNA 1RUJ2 1RUC3 2WZR2 3RJRA 3AYAA 4CEYA 1OA4A 4AK3A 2W0XA 1KXGA 2ZABA 3FUQA 3H7YA 4XBQA 5LK5A 4FPOB 3WG2A 1BKZA 2ZGRA 2DFBA 3B9CA 1ULEA 3QCWA 2XPJA 4CDXC 4ZU5A 4FOYA 3WP4A 4JVAA 4ISRA 2YC0A 1WW6A 1V6MA 5C4WA 1O3RA 1FPN3 1DQ6A 5B2GB 1O4TA 1SBEA 5JZGA 1Z7S3 1R093 4AGRA 1YI9A 1RJ8A 2A6YA 5DG2A 2C9AA 1O5UA 4HSJA 2PLV1 5EV7A 3M8LA 5BY5A 1EPZA 1YIPA 3NWKA 4AEMA 3T1LA 2R062 3AMQA 4AFAA 4PBPA 2Y38A 5LRSA 2R043 4I01A 4H7LA 2XJSA 3ZYJB 5K7PA 5KHIA 1AYN1 4NHLA 4AVSA 5HBAA 1CJPA 3ZVXA 4GMP0 1C1LA 1N3PA 1N1VA 4QD2A 1XNCA 1HIXA 1KFXL 5DDJ2 1MQTC 3H7JA 3K51A 5JI9A 3BOWA 1RHI1 3CJIA 1DLLA 2ETEA 1CVNA 4L2NA 4OHZA 4V1PA 3EQEA 2ZX4A 2O1QA 4JDNA 2BTVC 4XJAA 4FVVA 3MIGA 2XGXA 1Q8SA 4Z82A 3HMYA 2VUJA 4LHKA 1O4ZA 1JW6A 5DUXA 1MVQA 1LOBA 4M0HA 2GN3A 4AVCA 4PLNA 1SBFA 3VKLA 3POYA 3UJQA 2O0OA 4OLLA 4QGLA 1C28A 5FO9B 2RS51 1OQEA 4QPGA 1QNWA 1S2BA 4JRLA 2RS33 2NPIA 1Y43B 1SLBA 4JGZC 1NA1B 1PGL1 2A5ZA 3EHKA 1GANA 2CYFA 4ZU7A 4XHBA 2QKDA 5E1RA 1SBDA 2GC1A 2JG9A 2EALA 3VBUC 1ASJ2 1HQLA 3AP7A 1QOOA 4MZUA 1GKBA 2DWRA 5EWSA 1CAVA 4Z92B 2BNOA 3AJZA 3H8UA 4Q4Y2 4QPYA 4P5HA 1A8DA 4TWTA 3ZMNA 4D7YA 1AJKA 4FSJA 3FLRA 2ZX3A 1RTVA 3O5SA 1F5JA 4KNCA 3TRSB 4D7SA 1PO12 1AVBA 1D2QA 1QF3A 3AZWA 1Q8VA 3EO6A 4Y1XA 5E16A 2HYKA 3ZDSA 3WDUA 2DTYA 3P3NA 3R4UA 5IK8A 3NV3A 5CFCA 3OBTA 2OPKA 2VY0A 1ND2C 3LOBA 4CRQA 1CX4A 1EV11 3TBDA 4AI2A 2VVEA 4XEZA 3THTA 1LOFC 3LAGA 5DG1A 3MLJA 4Z1VA 1OOPC 4J6GA 2ZCWA 2WNUC 2E7AA 4GKYA 1VBC3 1VBB3 1PGW2 4HSLA 1MS0A 3ZXLA 1G9AA 2IC1A 3NAPC 3FMGA 4BPZA 4DRRA 4IV1C 2W52A 3H3UA 1EAH2 1QJX2 5SV5A 5BNNB 4FAHA 1LHUA 1RVF2 3WUCA 4CDWC 1GQHA 2JJ6A 1ZBE1 4AFBA 1REEA