2BOIA

1.1a structure of chromobacterium violaceum lectin cv2l in complex with alpha-methyl-fucoside
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
113
structure length
113
Chain Sequence
b'AQQGVFTLPARINFGVTVLVNSAATQHVEIFVDNEPRAAFSGVGTGDNNLGTKVINSGSGNVRVQITANGRQSDLVSSQLVLANKLNLAVVGSEDGTDMDYNDSIVILNWPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CV-IIL LECTIN
publication title Unusual Entropy Driven Affinity of Chromobacter Violaceum Lectin Cv-Iil Towards Fucose and Mannose
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Lectin
total genus 24
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07472 PA-IIL Fucose-binding lectin II (PA-IIL)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.400 Mainly Beta Sandwich Jelly Rolls Calcium-mediated lectin 2boiA00
1OUXA 2BOJA 2JDPA 2JDMA 2XR4A 3DCQA 1GZTA 2JDNA 5D2AA 2VNVA 2JDHA 5A3OA 4UT5A 3ZDVA 4CE8A 5A6XA 5A6QA 2JDUA 5HCHA 1W8FA 2VUCA 1OVPA 1OXCA 1W8HA 2WR9A 1UZVA 2CHHA 1UQXA 1OUSA 2WRAA 2BOIA 5A70A 1OVSA 2JDYA 2VUDA 2BP6A 4AOCA 2JDKA 5A6ZA 1OURA 5A6YA 2BV4A
chains in the Genus database with same CATH superfamily
3D0SA 3MFCA 1RUC2 4Q0PA 3C7OA 4XJUA 3KVBA 5LCWL 4RHV2 5BNNC 4R9AA 4Y4RA 4NMIA 4PI2A 3URFA 3T1MA 1QQP1 2WNUB 4H7MA 4KWJA 3U78A 2YBKA 1ASJ1 5A3LA 4BXFA 4PJYA 2VW1A 3IDAA 2E31A 1WMDA 1AL21 1AR63 1QQP3 4Y5Z0 4YVSC 5ISLA 1FAYA 2WR9A 3NNFA 1PNFA 5F6LB 1ASJ3 2ZHKA 2P3KA 1AL23 2QQJA 2D6PA 1CESA 2BU9A 2VMGA 4HVOA 1CAXA 1GUIA 2JE7A 3B5LB 4QGLA 3AKPA 4ISQA 5FYIA 1JZ2A 5G05L 1ULFA 2NPIA 4XF3A 1PO21 3FWEA 3LFMA 1KXGA 4FPCA 4CEWC 1FXZA 1T2XA 1S0JA 3PVBB 3CNAA 1Y9GA 4W65A 3TN92 1Z7S2 4YM1A 4IUGA 1PO23 4CZSA 3BTZA 2EIDA 1OPOA 1YFWA 2ZGMA 4QPGB 4XQWA 3TEYA 4RR3C 1S2BA 4X6QB 3AX4A 3AXEA 5E88A 3IMMA 3LDBA 4OUMA 1IS3A 5FZCA 4CPBA 4NPMA 4I2OA 4LHNA 2FCUA 1SLCA 1KD7A 4OUSA 4UI9L 4YRDA 2P4EA 3RYRA 4KG8A 1H4HA 4XF1A 3ES1A 2VTXJ 3AL6A 1F8VA 2EIBA 5JOXA 4A6SA 3WVJA 1IG3A 1HX6A 3H1WA 5FUIA 2RV9A 4WBBA 3MZHA 1X50A 1HRV1 2J1VA 1IKQA 3C7HA 3BKZA 2VECA 1SFYA 4LBOA 2WABA 5K9YA 1WCQA 4KU8A 5FZ6A 5J96B 1REEA 4YM3A 1Q8OA 1RUG3 3R0RA 1TEIA 5J7MA 1URXA 2Q30A 1V00A 3O0VA 4MGIE 2W92A 3WHUA 2VCMA 5LA9A 4BMBA 2VUAA 3DPRC 4XQ4A 3ZFFB 1UOBA 1VALA 1W8NA 1OQ1A 2R062 2VZPA 3B7MA 3N35A 5FZAA 1R1A3 3H1YA 3APBA 4Q4W2 3IAQA 4XF4A 3THPA 3FHIB 1IZ3A 1MR5A 3EXUA 3BODA 2AACA 2K9ZA 5JZGB 1D4M3 1VAVA 2XVGA 3MIDA 3ZR6A 5IK8A 5JVVA 3ZXJA 1ULCA 5JXHA 4LITA 2AUYA 5FYVA 3I97A 1FX5A 2BFUL 3L9JT 4O9EA 1UYPA 1N1YA 4QU1A 1DG6A 1Y9QA 2D44A 3KMHA 4HXCA 4CP2A 3O1TA 4B3NA 3J7LA 3VDCA 1ZZ6A 1XSQA 1FV2A 2WL1A 2FBEA 4YZ1A 2XLGA 4UFKA 2CDPA 4X8PA 4FPKA 1UOFA 3WUDA 4CDQC 1RXGA 4J25A 1DZTA 1MS8A 2VO5A 2WKKA 4KL1A 1V6JA 1MS4A 1IHMA 1XXNA 4A7ZA 3C2UA 5FZ4A 3ZO0B 2WT1A 1FYUA 1DCSA 1XPWA 2CYFA 1OFSA 2RS52 3MPBA 3EJKA 3GZUC 4GD4A 4XDOA 5FPZA 5FY4A 1OD5A 1ZRDA 3WP6A 1SLLA 3DCQA 2ZGKA 3ZKYA 1I3HA 4HOOA 2W0XA 5FMBA 2J1UA 4AI9A 3N9NA 4FPGA 3POSA 2JE8A 1FMD2 2P5BA 1YJLA 2QQWA 1US2A 3IAPA 1HN1A 2XXZA 4XFAA 2C9KA 5KHKA 2GSYA 4RSUA 1JYTA 3MI8A 3U4XA 1O7FA 1VBA2 1GSLA 2VVFA 3ACLA 4YSFA 1OFNA 2WO1A 2ZGNA 4QQHA 2D6MA 3B00A 4QT6A 1KITA 4V2WA 2ZOEB 5DUXA 4R4XA 4XETA 4AAXA 4DPNA 5A6ZA 3LDRA 5BNPB 4GH4C 1ZRRA 1EPWA 3G7DA 1OC1A 3VBRC 3R05A 2ES3A 3S7IA 1YEWA 2RS12 5EJ3A 3WG4A 3WD5A 2F4LA 2HWB2 5AC91 3RJ2X 3W21A 3O0WA 2R042 4Q5OA 1YHFA 1BLZA 3GJBA 1W05A 4IV3A 5HCHA 2JWPA 1S0GA 4UW5A 4A42A 1H8VA 1VBD2 4LBMA 3KVAA 4D7SA 2XG3A 3WQ1A 5AC93 2XB6C 1SQ4A 4AHXA 5FQ0A 4BQ3A 3ZYFA 4NRPA 4KWUA 4GWIA 5FPLA 2QQNA 4QX0A 3ZPOA 4KGGA 2PHDA 3GJAA 5BNNA 4WVZA 3A7QA 5C5TA 1RUF3 4XJAA 2WAAA 2D93A 4YVWA 4DY3A 4CEYB 3QLQA 3IB3A 2DUQA 3M4FA 1KS4A 5FYMA 3RWNA 1LENA 1IOAA 1H8TC 2GMMA 4XUQA 2OVUA 3SEEA 5FP3A 1YI7A 4Z07A 5APAA 1G6NA 4MSVA 1IS4A 3I2GA 2I45A 4Y1VA 4YVSA 2NLRA 2WFF2 3CZUA 1TME3 4JGYB 1EAH2 3SMHA 3G6JB 3KD4A 2YFUA 4X8NA 3AMMA 3PNAA 3GGLA 5FZFA 5FKCA 4XJ9A 1F4AA 4XVHA 2VTXA 2Z42A 5T5OA 1N3OA 1W99A 3B9CA 1WA6X 3DYPA 4XJZA 4QX3A 3LPFA 5FPVA 5GZDA 3I3BA 3VL9A 1AYN2 4CEWA 4E2GA 1DF0A 3AM2A 1LOBA 3DXUA 4QQOA 2FDIA 1AX1A 3AYAA 2YROA 2XJPA 2PA7A 5FZEA 3WCRA 4XZPA 1OQDA 1W39A 4ZS2A 5C8WA 2LM3A 1PO11 2UYAA 2W47A 3LF7A 4RR3A 4UT5A 4GKYA 5I93A 1FPN3 1XNAA 3T2TA 1WD3A 4NVPA 5JR7B 1PO13 2QVSB 1PMJX 3WDVA 2AZ5A 1QXRA 2XMLA 2JG8C 3VKMA 2Z2SB 3LFIA 2E26A 2VTFA 4YW4A 3W59A 4AHZA 5FP4A 2VOKA 3JD71 1GWLA 1ENXA 5F3IA 2RHPA 1BKZA 2O1QA 2W52A 1QOSA 5FMDA 5IVBA 2G9GA 3VBSB 1RVF3 2LROA 5FY1A 2ZX0A 1OI6A 3WNNA 1W6OB 3JD73 1ZRIA 3PDQA 5F3GA 1COV1 1C3HA 1LOCA 2JKXA 4HG6B 5KR7A 5C8CB 4IERA 1NYWA 2GNDA 2GMPA 1E5HA 4K3UA 1RTVA 4E4DX 3MV11 1COV3 4RQPB 2HWD2 5FZOA 4QDQA 4LK6A 3OF1A 4Y22A 4IEPA 4D3WA 2QNKA 4C8DA 3DPRA 1XU1A 4UF0B 2E32A 4Z8BA 3WF1A 1G9DA 3PMSA 1PK6C 2WUHA 3VBUC 2W9XA 1QXJA 4RA0A 4JTNA 4CDXC 2E7TA 1PGL1 2WS92 2OX0A 1XB9A 3OPTA 4UFJA 3B69A 4K1YA 2W39A 5E6HA 3OPWA 3T2QA 5A7PA 4Q1PA 5DQ0A 1FATA 5HBAA 1H30A 5D8AB 5GM0A 1CD3G 1QDOA 2AR6A 2WNVB 2VNRA 3U14A 1CGPA 3FHQA 3I7DA 5KXBA 5FO9B 1LCLA 3MF6A 4P9XA 1EV11 1MS0A 2ADDA 3USUB 5FFOC 1BBT1 1VRH1 4D8MA 2JENA 2DURA 4EN8B 4EN6B 2HYKA 2AYHA 2OUHA 4BZ4A 2PAEA 3OGGA 5IAVA 5ABJC 2JICA 5F3CA 1EV13 4PF5A 4CDQA 3FFZA 1BBT3 1VRH3 3AMNA 4Y3OA 5F32A 2XWJB 3T30A 3UGHA 1SDWA 1YQ5A 2VULA 1O91A 3KQRA 1DIWA 3VBFB 3M1HA 4E2SA 3H7YA 2ZJCA 1N3PA 5A7OA 2QDNA 3DV8A 1G86A 3D4KA 3GHMA 1CR7A 3NNMA 2ZZQA 4NE9A 1Y9MA 1Q3EA 3AKSA 4P9WA 1T6BX 1G7YA 4AVVA 5CKQA 2BTVC 1H1IA 1XU2A 3L2YA 3OCPA 4YLZA 1A8DA 3ENRA 1AR91 2Q5TA 4MYEA 5A32A 4LORA 3ZN6B 5BNOC 1J58A 3VN4A 3K3OA 5FWJA 4QHZA 1J84A 4E4ZA 1PVC2 1AR93 1HDKA 1U0AA 3POWA 5GZGA 4NR1A 4RHV1 2IWGB 4FPHA 3IIIA 2A7AA 4P5HA 2E6VA 2CNAA 1RUJ2 1V6KA 2V09A 4GJZA 3O5SA 3PURA 1PMIA 4RHV3 2VW0A 1RITA 1DQ2A 2BOIA 1YRZA 4XXAA 3N36A 1J83A 4FOYA 1GWKA 4GH4A 3O1MA 2X5IC 1DGRN 3VBRA 2VMIA 3AKQA 4OI1A 3M70A 4JGZB 5K8SA 2OW4A 3O1SA 2BVBA 5IVYA 5IFPA 1OOPC 1WLTA 5K0UA 1W0OA 2GC2A 5L9BA 5FZ3A 1ASJ2 3MDPA 4S2FA 3SEPA 4D6QA 2VJXA 4I0BA 3WG2A 4NRQA 1AL22 1SBFA 3ZSKA 3LEGA 2XJRA 3GM8A 2H6CA 1NLQA 3HN1A 1WUVA 4WVVA 1WCUA 1YQ2A 2EAAA 1TNFA 2E53A 4I0AA 3HQXA 3TN91 3ZYIB 3I54A 1MS3A 2D3RA 1OLQA 3AXDA 4FOQA 1JUIA 1E5IA 3Q8CA 3ME2A 3WDTA 5E1RA 2RJLA 3TN93 1PO22 2BNMA 1FI2A 3B01A 1NZCA 2B4KA 1UN1A 2C4XA 2E51A 2D98A 4XUPA 4AZZA 4C1WA 4LBNA 3AZXA 2Z79A 3U07A 5IK4A 1H8TA 2BWCA 4N43C 4RFRB 4IETA 4AEJA 1O5UA 1WMFA 4K8RB 2RR11 1EUTA 1J59A 2WN2A 3U37A 3H0OA 2BYVE 4HKLA 4KBBA 1BMV1 4AI3A 2W91A 4EROA 3KCYA 5FUNA 3ILFA 5FMCA 4QM8A 1APNA 5SV5A 4CCKA 4LLFA 3NKGA 1LHNA 1UQXA 3MGUA 2ZHLA 2OKXA 1CWPA 4H2AA 1OVSA 3J9SA 2MEV1 1UYZA 3PTRB 4YW2A 3ITQA 1ULGA 3OOXA 4N53C 5CFDA 1HRV2 3VKLA 2N7GA 2HWC1 3GCWA 3UJOA 4DEVA 4AXOA 1R64A 2XKOA 4QPIB 1WCKA 1G9AA 2KA3A 1NCRC 1NX9A 4Q4W1 5FPXA 2KR2A 1GP6A 2HWC3 1DGWX 2VMFA 3O1RA 3DF0A 5IVFA 2B8MA 2FCVA 3I2DA 2BDRA 4Q4W3 4N8MA 3RZHA 3SCGA 2IXHA 1X9PA 2JG8A 5JSRA 3O1VA 1OQEA 4IL7A 3ZX7A 3R4UA 1RXFA 1OVPA 5FTTC 1QXPA 2JJ6A 2JXAA 5F37A 1IQDC 4LULA 3K51A 4CDWB 5I0TA 1S0EA 3MLLA 5FYSA 5DG2A 2DCYA 4ZS3A 3LEMA 5E8AA 1I9RA 1X9TA 3T09A 1WW7A 4ZPIA 2DFCA 1DBNA 2HKXA 4V1PA 5BNQA 4PIXA 1GNHA 4OQ9A 5ERLA 3WNKA 3FX3A 4QQ2A 1D7PM 1UY0A 5GZFA 3WW3A 3FLTA 3NV4A 3WW1A 3ZFGC 1NOVA 1KRIA 1XNBA 2OT7A 4B7KA 4HPKA 3H8RA 3IPVA 4XFFA 1PK6A 3OB8A 4YG6A 3VBUA 3FL7A 1GR3A 1ND2A 4R4ZA 2QQUA 5F39A 4DINB 4GMP1 3OY8A 3DXTA 3CJIB 4FFIA 1ZVFA 4XACA 2JKBA 5CAZA 1AXKA 4PDWA 2LRPA 3THDA 1SMVA 4K9SA 4OZXA 5FYHA 3VD9A 3M7AA 2P37A 1IS6A 2UY8A 2V4VA 3HN3A 4GMP3 4LHLA 4PLOA 5CKMA 5F2SA 4HLTA 3RYKA 4CCDA 4NJ4A 3HWJA 3C7EA 1Q8VA 2W3JA 1V6LA 2ARAA 2GN3A 5C9AB 1O59A 1JU3A 2RJ2A 4IEXA 4IEUA 5A7QA 2X09A 3ZIXA 4CP9B 4Q0UA 1HB3A 5FZDA 3U11A 4FAHA 3SH5A 3GXUA 4ES9A 4C0BA 4JCKA 1KFUL 4GA9A 4W50A 4AF9A 4QKNA 2JD9A 3I2KA 3JQWA 3RS6A 5FZGA 1E5SA 2RS13 2R041 2R0HA 4R9DA 2C9AA 4QB6A 1GBGA 3QD6A 5H9QA 3C7FA 3ZYHA 3CJXA 1Y43B 2MNGA 2R043 1HB2A 4NIHA 1QH7A 1PHMA 4M3CF 5BNOA 3ILNA 1VLNA 1W2NA 3I3EA 5A3WA 2ZGTA 1NCQB 4BE3A 1EY2A 1V6IA 2BEOA 1C28A 3PIGA 4UFLA 5A1LA 1BZWA 2UURA 4XAAA 2JDNA 2PHFA 1ENRA 4XURA 3FN9A 1GICA 3VZNA 3CIHA 1ZYBA 5EPAA 2CAVA 2Q1MA 1JOJA 2XJUA 2P6HA 3POBA 2FMYA 2QCSB 4BK4A 2R49A 1MVEA 1W0NA 1U12A 1UOJA 3MF9A 2VUCA 3AFGA 5FK8A 3VHOA 4MHUA 5C3OA 3NL1A 2ZGOA 2YU2A 4S2DA 4B4QA 2WFF1 2Q8OA 2ARBA 3AP6A 2Q0AA 4WVMA 5LK5A 3LCPA 3TNPB 3MYXA 4FBFA 4OHVA 1OOPA 3M3OA 3GCXA 2WFF3 4OUEA 4UYBA 5DZFA 1WMXA 2B9VA 3B94A 3JB8A 5FYBA 3VD3A 1UY3A 1RHI1 3VZLA 5JI9A 2D5FA 1V70A 1LHVA 3WF2A 4ZU7A 5SV8A 1VMJA 1QWRA 3WQ0A 3TEXA 3HAGA 3E6CC 2RDNA 1RHI3 4AFBA 1TG7A 1OSGA 5CADA 2Z4FA 5KXDA 1F35A 4XF0A 4DUXA 4HKWA 2J22A 4LJHA 4FFHA 1AJKA 3ZXFA 4BQ4A 4Y20A 1QF3A 1ZX5A 1LU1A 1NG0A 1YI9A 2P3JA 1OBNA 2ZX1A 4I3GA 1IPKA 3ZMOA 4YZ2A 2OZJA 2Q8CA 4WZCA 3VBOB 1HKDA 4K20A 2R32A 3VDDC 3JBG1 5F5AA 3VZKA 4K6BA 1K3IA 1POV3 5FKBA 1W28A 5C33A 4A4AA 4JKLA 4BPZA 2NM1A 2O8QA 5F5IA 1PO12 4Y5TA 2WZPP 3H8UA 3S57A 3JBG3 4SBVA 1CZTA 2NZ9A 5EJZB 1LRHA 1W8TA 1W9TA 4G9SB 4Z92B 4XXPA 4CCCA 2E63A 4F83A 2TUNA 4QXHA 4BQYA 1NLRA 1LECA 2RS31 3P5BA 2OPKA 1GQGA 4YG0A 4M3CB 1SPPA 3SHRA 3JD72 3VV1A 1WGPA 2BVVA 4JKMA 4KWKA 4CU6A 2RS33 4KQ7A 1E5RA 3O14A 1CAUB 4N53A 1WLWA 1OA4A 3HR9A 5FZ8A 3ZN4A 3CL1A 2EIEA 4QPGC 1COV2 1ND3A 1C1LA 2XGXA 1NCRA 2Q8EA 4CUBA 3I2FA 2Y60A 3I2HA 2WS91 4HMZA 4OLLA 4U2AA 2J1TA 2HBTA 1UNBA 1ENQA 3SCFA 3LSDA 2BFUS 2VNVA 1WCSA 3PVOA 3WDXA 4AEMA 5C5UA 3ACIA 2WS93 3RGBA 3PIJA 3KF5A 4XYXA 2P2KA 4IGPA 2Y6JA 4AI0A 1NKGA 5JAXA 4UAPA 1PGL2 1IPSA 3KQ4B 4DY5A 4FTBA 4XMIA 1BHGA 2WWSA 4UOJA 5FY5A 2VZQA 3BPSA 4XJ8A 3AB0A 4EYUA 3S30A 2Y8KA 4EZHA 1CAVB 1D0GA 2WA3A 1MS1A 3BN6A 5T5LA 3BVCA 1ULOA 3KZ4C 1EV12 5D21A 5FZLA 4MV2A 3IT8A 5LASA 3K3NA 4C0HA 1F9KA 2WA4A 1B09A 1HV1A 3ZFGA 3AP7A 1KJLA 3PUIA 1EYBA 3POJA 2VQTA 2WN3A 4UW6A 3W5MA 3VDAA 1ZA7A 3ZYGA 1JN2P 1KDMA 2YC2A 4WM8B 5DAWA 1XNKA 3AZZA 4LIUA 5EZWA 1UCXA 3ZSEA 2WYSA 5EJ1B 1JZ5A 4Q0QA 3T08A 2DVBA 3H9AA 1LR5A 4XDQA 1VAMA 1B35B 4IV3C 4RS5B 5A7WB 3VGIA 4MOAA 3NQHA 4HK9A 1ULDA 5FBZA 1AR92 1YCIA 3GNEA 5I8YA 2SBAA 4LA2A 2R7EB 3UT0A 5C3QA 1W3XA 4ITCA 4AI1A 3IWZA 3IKWA 1RUJ3 2J42A 3POGA 1AR82 4NUBA 2YY1A 4WM7B 4D6SA 4YVWC 4XTMA 1JHNA 4R9BA 4PI0A 1D2QA 1DHKB 4UW3A 2OQ7A 2GZWA 2YB7A 5LB6A 5DAPA 1JOPA 1UOGA 5IYYA 3H3UA 1MPXA 2X05A 4NIAA 3NAPA 1HQLA 3SH4A 2BJSA 3BTYA 4W6WA 5HCBA 1CJPA 4FFFA 4OYUA 3PTYA 1K42A 4RGGA 4IV1B 2VCCA 1QJX2 1W8WA 1GP5A 4QDRA 4A45A 2GAUA 4D94A 3UGFA 3POFA 2J1SA 3TOJA 1AX2A 5C70A 3B93A 1XYOA 1LGNA 5FJHA 2BRTA 5LWBA 4CP1A 3UKNA 1AZDA 3H50A 5AFBA 1S55A 1DZRA 4XBNA 4O9GA 1ULEA 4YZ3A 3B02A 5FPBA 5FZMA 3AYDA 3PMEA 1X8EA 2ORXA 4AR2A 4J1WA 3BCWA 1YQCA 4ZY9A 4AVTA 1O4TA 5A3NA 4KGQA 2XL7A 4MHRA 1UWWA 4HN1A 2WC2A 3WX5A 2VXJA 2A71A 4CU7A 2A70A 4AWDA 4FTEA 4GULA 3WG1A 4CVUA 2YFZA 1PGW1 4IEZA 5FP7A 2PAMA 2JEMA 2CGNA 2W46A 2RR12 3CU7A 1WMEA 3N3HA 1H0BA 1U5ZA 2PHRA 1BMV2 4O65A 3HNMA 3BB6A 2W87A 1W3VA 1EUUA 1I5PA 2V4AA 5IVCA 3O1OA 2K0GA 2YPJA 4XUOA 1HRV3 4Y4YA 2C1FA 3P3NA 2DTWA 2MEV2 5EHDA 4MGTA 1OF4A 1MZ6A 2R16A 1UMZA 2WNUA 3VDDA 3VZMA 2RE9A 3SKJE 4C90A 1YFXA 4MLOA 1UY2A 2WO2A 4YGEA 1HW5A 2DVAA 2HWC2 1OH3A 2PELA 3IM0A 3K4ZA 2D7FA 2J1EA 1ZZBA 1JS9A 5KXCA 1XSRA 5C4WB 2P34A 3OPZA 1XNDA 2RDRA 4G4FA 1SEFA 2JX9A 2E7AA 2J7MA 3J7MA 2ZKLA 2EA7A 3TEWA 3MUY1 1GNYA 2A75A 1RJ7A 4YGDA 1W6PB 3C7GA 3ZDVA 4LQRA 2QUOA 1HRI1 1V6OA 3WOGA 1W9FA 4BQXA 2NMOA 1ZNPA 2DU0A 5FPAA 3RMYA 3SQOA 2JB4A 2EXIA 3NV2A 1HB1A 4XC9A 1YFUA 1HRI3 4DFSA 4QPGA 1H1MA 1TZOA 4AK3A 3QBQA 4Y1XA 3KV4A 1ZZCA 2RM21 2XUEA 1UD1A 3JB4C 1LKNA 4BB3A 3I3QA 5CG8A 5IVVA 4ASLA 2HWF2 1R091 3SXWA 4J1XA 2RM23 2W94A 2X10A 4RGKA 4AGGA 3I2IA 1JW6A 2VMCA 1BVVA 1YQ8A 3QH6A 5F7UA 2EIGA 1ZRFA 2C26A 5DN2A 1HN0A 4NPRA 5KC6A 1R093 1YUDA 2FZ1A 3UNPA 5FV3A 4Y24A 3ACFA 3JZVA 1UXZA 4M4RA 3SNMA 2RJKA 1L7RA 4L92A 5CEHA 3O1UA 5FQ0B 4ET7A 3VBSC 2G9FA 1G8WA 2R1BA 3ZYBA 2ET1A 4YFWA 3CEWA 4P9IA 1DQ0A 1DYPA 1N1TA 3KT7A 3OGRA 1W9YA 3LA2A 2WT2A 3OSDA 1NE6A 1OMIA 3LQCA 1C57A 4GWJA 4CSWA 1ODNA 1LTEA 2W68A 4I30A 4EV0A 2BGPA 1QNWA 2IZWA 2K46A 3E97A 1JBCA 2A73B 3O7OA 4XFGA 1PIV1 1SHWB 4FQ4A 5FYTA 5GLWA 3ZFFA 4AEDB 1AVBA 1K5MB 3WQBA 4B1MA 3DN7A 4EN9B 3A21A 1H2NA 3KV6A 2ZGUA 4IEYA 2FHRA 4MX3A 2XWBB 5EV7A 3TBDA 1PIV3 4JDNA 5JXGA 4NWWA 4DO0A 5FUPA 5DDJ1 5K0UC 3ON7A 1P8JA 5LATA 4MADA 4TZDA 2AH2A 3AZWA 2AEZA 1ODMA 1CPNA 3FUOA 2VVDA 3AMQA 3GZEA 5DAXA 5DDJ3 3ZN5A 4F8AA 1A3KA 1X7NA 3AP9A 5JDBA 1C5HA 4XQDA 5FZ1A 4DXRA 2P6CA 2QBXA 3DYOA 4IEOA 2WSUA 3ZXKA 3NO8A 4PQQA 4QQPA 4LKSA 3VBFC 3WUCA 2VG9A 2J1RA 1U5XA 5LRSA 1NUKA 4LBLA 4XEZA 3GALA 4TSVA 3OBRA 2Y38A 5GLUA 5DZEA 1RGSA 1VBC1 3A0KA 4F7ZA 3Q8EA 1NT0A 3OYWB 4ZZ8A 3BOPA 1IKPA 5CU1A 3CKHA 3GBFA 3S6PA 1UAIA 2Y64A 1RUD1 1LEDA 2D40A 1W2AX 2IVIB 1MS5A 1VBC3 2A6ZA 2QZ2A 1LOGA 1RHI2 4URTA 3FMGA 4BXSV 1O4ZA 3POYA 4YZ5A 1IS5A 4BCUA 1RUD3 2DBIA 2GNTA 4ZONA 2WDBA 5CB7A 2VUJA 4JC1A 5HPOA 2WINB 2YHJA 3MFAA 1U5IA 4OQ8A 2JDMA 2PFWA 4W4ZA 5DUUA 5FDBA 4IGOA 1CAWB 4UFHA 2W1QA 5CFDC 1OHFA 3DPRB 4E4SA 4K1ZA 5BNPA 4YW7A 5CKNA 1O3RA 4B1LA 2ET7A 3ZPYA 4WVWA 5A33B 4MZUA 2CWMA 1VBB1 4JGZC 3WW4A 4DXTA 3OBAA 1W04A 2B5HA 5JR2A 3JBG2 1WLDA 3KSCA 3AFKA 5GLVA 4CXYA 1VE0A 2Y0IA 4EWAA 4W6XA 3R4SA 4CUCA 5DMYA 1BCXA 5KHIA 4RN5A 1DP0A 3F2ZA 4KH9A 4HVRA 2ZHMA 3ATGA 1LGCA 2XJTA 3A4UA 2ZACA 3LSEA 4KBZA 4QXCA 1OUXA 4XAEA 3T0BA 2ZCWA 4GJYA 4MH0E 2K2SA 2XLFA 4H7LA 1W9WA 4CDQB 1AXZA 3VZJA 5J09A 2RS32 2ZEXA 3RFRA 1JODA 5H9RA 2NYYA 4LT5A 5CFCC 3RVHA 4CEYA 1XNTA 3MIFA 5L9RA 3AP5A 2JDZA 1XRUA 2PN5A 5FYUA 4AQ2A 1FT9A 1OLME 3HNYM 4AW7A 2A6VA 4YFZA 1UW8A 1IGOA 3I49A 4JGYA 2ZMLA 1WLCA 4HK8A 5CISA 3ZXGA 1JI6A 1ND2C 1XC6A 2EAKA 2WQ4A 1LHOA 4LBQB 3A22A 4PDWC 4XFBA 4YG3A 5JIAA 3OD0A 1A34A 3WNMA 4JDMA 1W6MB 3VB9A 1GWMA 3IDEA 5FOJB 1A8MA 4FOWA 2VW2A 1RUE2 4LOTA 1JZ7A 4JVAA 3FUQA 4IE5A 1CVNA 1OH4A 2ZX4A 5JIUA 3BI3A 1NZIA 5B4XA 2B39A 3S5QA 2CGPA 5GKAC 4LTAA 1H6XA 1ALYA 3PUHA 3PUQA 5FXXA 2BGCA 2CWSA 5IFTA 4BOWA 4XFCA 4IE0A 5T52A 1K45A 3RWKX 5F9TA 3CHXA 3I59B 4G3YC 1QEXA 1W8UA 1DQ4A 2XKPA 2AEYA 2ZEWA 2ZGLA 4QKFA 4XFIA 3BIWE 4OI2A 5EIYB 1BJQA 5DABA 3VBSA 4NIGA 4FTSA 1SBDA 2F17A 4GXLA 1W6OA 1ZBE1 4DMIA 1RUNA 3WNLA 4LO7A 4Q29A 1AR81 5JWPA 2BGOA 1UU4A 1UF2C 4H3WA 2UU8A 1Z78A 3C8XA 4CCLA 1ZBE3 5F6KA 3LA3A 1AR83 4FAGA 2UY9A 1N47A 2KD7A 1QY4A 3FLPA 1W2TA 3V0BB 1CZSA 1VP6A 3NNLA 4UF0A 3THCA 4ONUA 1AR71 5JPMB 3BU7A 3POEA 2OQ6A 2JIJA 4M00A 3ZXEA 2WNOA 2JDAA 4TTGA 4DEQA 3WV6A 3CJIC 1QJU1 3HT2A 3NSTA 3LE0A 1QJX1 2JG9B 5D8AA 4BQ5A 1OLMA 4NRMA 1QJU3 2A3YA 2WNVA 4FVVA 5A3OA 3VBHC 1HXS1 2VU9A 1JZ3A 1QJX3 4K40A 3UESA 3USUA 2PXJA 4ZU4A 5DXDA 2Z69A 4XW3A 4JQTA 2DVFA 5EYYA 1XE7A 5GJ6A 4QX1A 4HZFA 1GLHA 2Y6FA 1MQTB 1RUOA 4LR4A 4CUGA 3N7LA 2YXSA 2IXKA 2RDQA 3A23A 2EICA 3NV3A 4CDUB 4FPFA 1SACA 3RZJA 5FLIA 4AOCA 4COWA 3VBFA 5IUQA 2IFWA 5LA1A 4MG2A 4QX5A 3ZMNA 4MXWB 4XMAA 3KCXA 2JG8B 2ZABA 1JYXA 4PT6A 1N3QA 1PZ9A 4A3ZA 1YWKA 2D6OX 3K4DA 4GKXA 4KG0A 4QGMA 4RL7A 3SITA 3TWIA 3LIHA 1V6NA 3ORJA 5HI0A 2HEVF 2IUWA 2RR13 3ZN6A 3ZXDA 1UZWA 1PGW2 3J8F1 4K7JA 4BWOA 4DIQA 4OVEA 4EJRA 1NCQC 1GMMA 2PAKA 1NQJA 1J3QA 4H14A 4PHZA 5CG9A 4P02B 4Z2WA 2BP6A 2JD4A 3RI9A 3ZFEC 4CP0A 3HVDA 3E5QA 3LGRA 5A7NA 3WHTA 2TNFA 3U1XA 2EVXA 1RMU1 3DGTA 1O3TA 3K75B 2MEV3 1W9SA 1TVGA 5T50A 2EXKA 3N9QA 1BXHA 4Y1ZA 1ND3C 3ZDSA 1MZFA 1PK6B 3BIEA 4E2QA 4CDXB 1RMU3 4JGZA 3QCWA 1W2UA 3WNXA 4CE8A 3WF0A 1I6XA 3RDIA 2DYCA 4UFMA 2HEYF 4O7XA 2C0ZA 4AEKA 3ZYRA 1ZBA1 5JLVA 2ZHNA 3TYJA 4LOSA 1W8FA 3KCCA 3TEZA 5C3PA 4NPLA 1ZBA3 4Q4X2 1GYKA 3DEMA 1R082 5J1XA 1LOFA 5FLHA 2JDKA 1CJDA 1W6QB 2ZA9A 1KEXA 1PVXA 1QIQA 2O0OA 1DQ5A 3MW3A 4AVBA 5ABJB 4XZUG 2WYFA 4EZ4A 1CIYA 1HRI2 3MIEA 5CFCA 1PMHX 3J7HA 1Q43A 1MEC1 4HFSA 3WR0A 2HWF1 3K77A 2W1SA 4AE2A 5K7PA 5CVRA 1TNRA 3OBZA 3ALQA 1MEC3 2HWF3 2RM22 3UKTA 3KV9A 2QFEA 4MGQA 2VZTA 5A1AA 2WZR2 5IW0A 4Q4V2 2D6LX 1R092 3NJYA 4LBQD 1XYPA 3H1MA 3BGAA 2Z5WA 3VUOA 3EQEA 2BERA 2UWBA 2WWJA 3QACA 1IQAA 4LO5B 5H9SA 3WF4A 1LESA 2BBVA 5L9VA 4FPLA 4HETA 1W6NB 1O4YA 1JYCA 2XR4A 2ERFA 3NRUA 4PF1A 4AFCA 5JMOA 4V2VA 5IVJA 2YMZA 2WWUA 1VB4A 2DU1A 2R072 3PU8A 2P3YA 2X5IB 3CQOA 4QPIA 4R8HA 5DG1A 1QH6A 3MBWA 1RC6A 5GZEA 3WP4A 1FNZA 2VM9A 1SLAA 4L11A 5FZHA 3ZXLA 1OOPB 5LBBA 2GC3A 2D97A 2ATFA 4PIYA 4A7KA 4BK5A 4LXLA 3ETQA 1OLRA 2QQOA 1PIV2 2EF6A 1CX1A 3BOWA 1NLSA 2C6SA 4LHSA 4DUWA 3NAPC 3MLJA 1OURA 5A6YA 5L7OB 5FRAA 4NHKA 2BQPA 1WKYA 4QKDA 3V56A 1IPJA 2JDPA 4CDWA 1ST8A 3ZLIA 1FNYA 1Y4WA 2CU5A 2VXRA 2WJSA 5DDJ2 5BUVA 1LU2A 3IDCB 2NQYA 2V5YA 4L8QA 4P9LA 3W20A 1JU4A 1POV0 2ZEZA 4P9YA 2VR4A 3VD7A 2HLEA 3HQRA 5LY2A 4CYDA 2D43A 4N43B 5GALA 1MS9A 1DYOA 1UZVA 1JYWA 4BU2A 5KXEA 2YC0A 2YBPA 4EWEA 1SLIA 4OI0A 4LO8A 2PYTA 1G9CA 1DDLA 3CJIA 1Y7BA 5F5CA 1RUI2 5IK5A 4IGQA 4PCRA 1W8ZA 3N7JA 1VRBA 4BISA 3S0MA 2I2SA 4Y5SA 3UGGA 4E4HA 4EWDA 3VBHA 1F31A 4RS5C 1B35C 2IC1A 3GBWA 4JV4A 1VBC2 1SPPB 3LD8A 4BJ0A 1SG3A 5C9AA 5I0RA 2G19A 5TSWA 3J7NA 3JCIA 2GP5A 4TN7A 3OGSA 3T0AA 1RUD2 4OMCA 3MIGA 4CP9A 1O3SA 3LZZA 3DECA 3GZAA 2OYZA 2VMEA 1Y3TA 5FP9A 5AFEA 2VOVA 4WM7C 2CAUA 2B42B 5EWSA 5GLTA 2GALA 5F2WA 3D3AA 3V0AA 3AL5A 1FV3A 2PHLA 3WSOA 4JX0A 4W6YA 2WNUC 5LK7B 2XJQA 2GC1A 2CSGA 4CUAA 4UFIA 2NN8A 2ZX3A 1NAEA 2WSVA 4SLIA 2ZPXA 1AF9A 3H7JA 1BVP1 4BM8A 1VBB2 3N4MA 1X8MA 3VHPA 4P5YA 1WWYA 2R1DA 2WO7A 4D69A 1GOHA 3CMGA 1NCQA 2YG0A 3ZSLA 3GHNA 3I3MA 4ARXA 4NO4A 1K12A 2ARXA 4Q1RA 3AZVA 1UYXA 3EO6A 5FZIA 1CN1A 4FPJA 1D4VB 3ZFEA 3TNQA 1GZWB 1YXWA 2CGOA 1POQA 1NA1B 2WIIB 1WW6A 4XIKA 3B3QE 1H9PA 1CX4A 4LLOA 1UY4A 2Y6GA 3SCHA 4LKEA 2F4PA 4KWLA 3CLPA 1QHDA 2YPDA 1W8OA 4XFHA 4ZHNA 3M2MA 1HIXA 2VE1A 5JUVA 2IFRA 1QJY1 3KGZA 5FIXA 3RJRA 2OIIA 2WZ8A 1C4RA 2ZXQA 1UU6A 2FDHA 1AXYA 3VL8A 4ASMB 1UPIA 1ZZ9A 1RUE1 1DGRA 1RYYA 2VGDA 1QJY3 3HEIA 1ZZ7A 3ETPA 1L7QA 3HIFA 2H6BA 1OUSA 1H9WA 2VOWA 4YARA 1JHJA 1RUE3 3AMHA 2VNGA 5CZKA 2WLQA 4B4PA 3PVEA 5FWEA 2XOMA 3BTXA 2Y6HA 2YC4A 3VBOA 4AFMA 3JUUA 4LKFA 4LUKA 1S2KA 4CU8A 1UU5A 2BUKA 3D5OA 3IN9A 4XHXA 3ZFFC 3DYMA 5C4WC 2MHFA 3NMBA 3H3ZA 1DLCA 1XQNA 2H0BA 1JZ8A 3WLUA 3LAGA 5FZ9A 4CXWA 2FDJA 4QWNA 5JZGC 2RVAA 2RMU1 1CAXB 2V73A 3CDZB 3I2JA 3KT1A 1KQRA 2VBDA 5AVPA 4Q0VA 5FXWA 1GOFA 1F5FA 2ZZJA 1AUYA 2WZEA 3HBZA 4M3CA 1S2EA 5I0UA 4Q26A 1ENSA 2PLV1 3DUIA 1C5IA 2X53S 3KT4A 5JSPA 4QX2A 1CAUA 4GIQA 4RGAA 1ZBE2 1F15A 2PLV3 4XCAA 1UL9A 2ARCA 1E57A 5D2AA 4BIOA 3T1LA 4OULA 1L7LA 1W06A 2Y0OA 4JRLA 5I8TA 5A6XA 1TQ5A 4TWTA 1ULPA 2P17A 5ACA1 2A3XA 2JB8A 3EHKA 1PX4A 4JHZA 3NJXA 4COUA 3WEZA 1AR72 2I74A 2XVLA 1LAJA 4LKDA 3FC0A 2CHHA 5ACA3 2P1BA 4JZRA 3VKOA 4TLGA 4M0HA 5C3SA 3L2HA 2VZSA 3T2OA 5E89A 1QJU2 2XBO2 3BALA 5LA2A 3A0NA 2VZ1A 4YW5A 3C3VA 5J36A 4XTPA 3UKVA 1QJZA 1XE8A 2IXIA 5FO8B 1S0BA 2W2IA 3LEKA 1CAVA 3WW2A 3HD8B 4ATEA 1HXS2 5A7SA 5FAXA 4CXXA 2OS2A 1AR61 2OUJA 3UETA 3R4DB 3VDDB 5J3UA 1NY71 1VJ2A 2VVEA 1VR3A 2D3SA 4AEDC 4MVTA 5BNPC 5JOZA 2WFPA 3LEIA 1OA3A 1K5MC 3PUSA 3AKRA 3H8XA 2UWAA 1EPZA 1BEV1 1ZM1A 4WM8A 3WY6A 1OF3A 4AHWA 3B9IA 4CTEA 2VBPA 4M01A 1S0IA 5ANQA 1H2LA 4LNVA 4AYUA 1BEV3 1KJRA 3GYDA 1AHSA 2WAOA 1H1AA 2CDOA 4LE3A 1LODA 3WDYA 4RS5A 1B35A 1UZ0A 2F6BA 5HCFA 5A7WA 4C1XA 2GN7A 2CL2A 4COVA 3WNOA 4ATFA 5KWRA 3LIGA 1GOGA 2YZ4A 3J8F2 4OHXA 3W9AA 2VZOA 5F8PA 5GLZA 5I0DA 2Y6LA 3INAA 4FXGB 2V72A 2PHXA 3JXSA 4WM7A 5IHRA 5E16A 3I4IA 1VBE2 2XQXA 3RZMA 4CEYC 3HOBA 3RRDA 3IDBB 5JPNB 4JHTA 4QHBA 2YGMA 3LPGA 3MUZ1 4QDSA 4CCNA 4YM2A 1RMU2 3S5AA 3WP3A 1UZZA 1IG0A 1UZYA 1MACA 3IIAA 1XE0A 1J3PA 1H2KA 2AC1A 4ARYA 1YIFA 5IAXA 2ZGQA 4JGYC 4EQVA 3U0ZA 1JYNA 4QQLA 1KFXL 3AZYA 1WA4A 3AKTA 4Q4X1 5FYYA 1R081 5HV4A 2GH2A 4IV1A 4FT8A 4DXSA 4LPLA 1RUG1 2QJVA 5BY5A 5IATA 4DXZA 3I3DA 1ZBA2 3NW4A 4Q4X3 5LW9A 1QNYA 2JDHA 1R083 4IE7A 4YM0A 2IVJA 5FMOL 2Y26A 1KDKA 4P14A 4WV8A 1YQ6A 2FZ2A 1LB2A 1V9U1 5F5QA 1R1A1 4FO9A 4LEJA 5LBFA 1GNZA 3WG3A 1GANA 5DUWA 5FY9A 3GZTB 3PLQA 3T0DA 2GP3A 4TLFA 3MEPA 3OTFA 2YUEA 1V9U3 4LE4A 5L36A 5JSOA 1D4M1 4FI9A 1W0PA 2QQKA 2WZR1 4Q4V1 1MEC2 3KWVA 3NJZA 2R0FA 3HT1A 2YU1A 4AQTA 4DB5A 4NAOA 4NHLA 2WZR3 2E33A 3ELNA 4N9IA 4Q4V3 4AQ6A 4J6GA 4IV3B 4XF9A 2O8OA 3RZZA 2XHNA 4LMFA 2W1WA 2XL9A 3QH7A 3WNPA 5AVAA 1AL0G 1OT5A 4IDZA 2NMNA 4DNYA 4A44A 4U36A 4AI8A 2A5ZA 3WXPA 2R071 1JZ6A 1YO8A 1RB8G 4COYA 1W90A 5BNNB 3Q8AA 5M0TA 3OGVA 5C8CC 4Q4Y1 4YGCA 4YVWB 2R073 1LOAA 4COZA 3CZJA 1A78A 2PMWB 5LEKA 4RQPC 1RIRA 3T4HB 1BK1A 2BV4A 2W5FA 2ZBJA 3GF6A 4Q4Y3 2UYBA 4XUTA 5IK7A 2YV8A 4JDOA 4OMDA 5C4WA 2AREA 4XIOA 4YVSB 3WP5A 1NQDA 3ZIWA 1D0HA 4ORFA 3CF6E 3NJVA 1WBFA 1KGYA 2O14A 3WDWA 4O61A 4YW1A 5BV6A 2W1UA 4FXKB 4JKKA 4XE9A 4Y33A 3DKWA 4FPYA 3H3LA 1BYHA 5JZGA 1X36A 1W6PA 1ACCA 4GWMA 2AENA 5D8AC 3UL2A 1JYIA 2WNVC 2BNOA 2DF7A 3VZOA 3W5NA 3TRSB 4MXVA 1WCDJ 4CEWB 2X29A 2B45X 3KLSA 4FPEA 4HBNA 4L9BA 4XOGA 2OXBA 4FFGA 1HV0A 4GAZA 1Z0HA 1PM4A 2R6QA 4JAAA 2A3WA 1T6GC 3WCSA 2WLPA 4B4RA 5EYXA 4CCEA 1ZRCA 1ZREA 4NIIA 2W08A 4RR3B 3KF3A 1ONAA 3PJQA 5FYCA 1UX6A 4CPBD 2MPFA 4ZKTB 1RUI1 3LOIA 2IXLA 4AVSA 4Q8KA 1DQ1A 2ZX2A 5IJRA 4Q0SA 2DUPA 2TBVA 4GB31 1RUI3 1C8M1 2HYXA 1QOTA 2P3IA 5LEJA 4QPYA 4CA9A 2FDFA 2VQ0A 1F4HA 2VOXA 2WO3A 4GB33 4Z1VA 4IEWA 1RUF1 3SC7X 1M06G 1C8M3 4Y1UA 1GKBA 5FJKA 4H55A 2QQMA 5I8SA 5B2GB 1SBEA 3MV01 1ZZ8A 3ZM8A 1S4CA 2XQRA 3X29B 4UBGA 1MZEA 1Q8PA 2VQAA 2DFBA 5FO7B 1NXD1 3M3QA 2KXLA 1TME1 1GZTA 5FZOB 4QM9A 1WBLA 3M3CA 4Y22B 4QGNA 4AEDA 4CCMA 3AC0A 3AYCA 4PBPA 5J48A 4LUMA 1K5MA 2QQLA 4NAMA 4QB2A 3ZSMA 3MIBA 4IE6A 3NNGA 1LHUA 2LUWA 2H0VA 4QXBA 5CYYA 2ZAHA 3V64A 5T3NA 4ZXKA 5J37A 1UY1A 1UXXX 3E6BA 4MGSA 4N9HA 4I09A 5FK7A 1JMUB 2JG9C 1VBB3 2ID4A 3Q8BA 3U75A 3PUAA 4NWVA 3E5UA 4UBHA 1EP0A 3ZSJA 2G9ZA 4URAA 3NV1A 1JYVA 2Q1FA 3PL0A 4IEQA 5BXXA 3RNSA 2D3PA 5CBLA 2EXJA 1LOFC 1MQTC 4A41A 3GDBA 1FPN1 1UYYA 4CDUC 4ES8A 2XVKA 3KV5A 3VKNA 4QKBA 3AJYA 2IXCA 1RUH1 1U5YA 3Q9OA 2OPWA 3HMYA 3MPPG 4QX7A 4BQ1A 4AAPA 4NROA 1RUH3 1SFNA 4IEVA 3N9LA 1RVF1 4AVCA 4CCOA 5CNAA 1WD4A 3OYWA 4HN0A 1QGLA 1OKQA 5A32B 5A3MA 2VCBA 2FMDA 2PTMA 1TMF1 1X82A 1JOBA 1LULA 1QJY2 1GZCA 4S2HA 1FOD1 3BU0A 1RJ8A 4BQ2A 4ZXEA 1QOOA 2DBNA 1PZ7A 2ETEA 3MW2A 3PVNA 1TMF3 2L9LA 1FOD3 4BLJA 4QX8A 1CAWA 1GZ9A 1H4GA 3IMNA 2E9QA 1C8NA 1GP4A 4YWAA 3S7EA 1KS5A 4L97A 2EXHA 4GH4B 2LALA 2G4IA 2ENRA 4GALA 4QPIC 5A33A 3VBRB 5C7GA 2R30A 2BWAA 4XDPA 1DGLA 1YLLA 2LS6A 2ZGRA 1M4WA 4TXWA 2PHWA 1OKOA 3WZ1A 3UK9A 5HV0A 5K0UB 2IXJA 4HSJA 2VAUA 3N9OA 4IQPA 1YJKA 3AVRA 4ZZ5A 1Q56A 2JIGA 2VC9A 1A6CA 3N7MA 1US3A 4OHYA 3ES4A 1WW4A 4BIFA 2XUMA 4CDWC 1AYM1 4OFGA 5H9PA 1O8PA 4QU2A 3ACGA 3T4VA 2QQIA 2B7YA 1CPMA 2RMU2 4KI5M 3OBTA 2HWE2 4HT1T 5DUVA 4E8DA 2JDUA 1CZVA 1DFQA 2I07B 2VPVA 1AYM3 2E7QA 2UWCA 5C8CA 5CIRA 1NXMA 5FBJA 2A6YA 2PLV2 1RINA 1BK0A 1XOYA 2DCKA 4RQPA 3HNBM 2VUDA 1W03A 3ZOIA 1H8TB 3K46A 5FZ7A 4NHXA 1OA2A 4N7UA 3WDUA 1JTZX 1BQPA 2OZ6A 4A7YA 3RMXA 3MICA 4KNCA 3VHRA 3NKTA 1J1LA 3OG2A 4A6OA 4M0NA 2Y6KA 2XBO1 1AR73 4EN7B 4LBQA 1VMHA 5EFUA 4DRRA 4Q8LA 5ACA2 1RUC1 3VLBB 2DCJA 1C1FA 3PHMA 2XBO3 1W6MA 3RI8A 2VZUA 1UO9A 4HONA 4OI4A 5KHGA 1RUC3 3DL3A 4YGBA 3ROUA 4I0WB 4XCBA 4BHPA 5C9AC 1G9BA 3LKJA 4W8JA 3VD5A 2D6KA 3WT3A 3QOPA 5CFDB 1HXS3 3ZXAC 2BZDA 3USSA 4FPOB 1F5JA 3MLKA 2EALA 1Q8SA 1V6MA 2HH9A 4TYSA 1UPSA 5G04L 3E6DA 1CONA 2FD8A 5I0SA 3U10A 1HJGA 2ZEYA 4AQSA 1QQP2 1AJOA 3KB5A 1AR62 4OHWA 3I59A 4FCAA 1NY72 5HXVA 4B29A 1G9FA 4LBJA 3I8TA 2Q1ZB 3OUIA 1BEV2 3FHAA 5L7OC 1REDA 1S0DA 1NE4A 2BBAA 1Z7S1 2V5DA 2C5DA 4QMAA 3D8CA 2CY6A 1LJ7A 4XJWA 4CCJA 1Z7S3 3J8F3 1SLBA 3OUHA 3RG0A 5CFCB 1VBE1 4BYYA 3F95A 4DS0A 3LB9A 1GQPA 4HL0A 4BH9A 3M8LA 4YW6A 2D6NA 2XPJA 4PLMA 3N9MA 3V0BA 4F3JA 1XBFA 2DCZA 1VBE3 3OGJA 4EE2A 2ZMNA 3EYPA 1WZXA 2DDUA 1CQ9A 4HPKB 3RYPA 4A2UA 3IPVB 1X33A 4YNIA 5BPXA 1AX0A 1DU3D 4KMQA 4XBQA 3VBUB 5LY1A 4BLIA 1ND2B 5LBCA 1LOEA 2PQQA 3OY8B 2BW8A 2VL4A 4GMP0 5FZKA 4FSJA 1HJFA 1QJFA 3N7KA 4PDWB 1QU0A 1SCRA 2JG9A 4N90A 5FP8A 2VMDA 5JMCA 4LO6B 3IBMA 1Q8QA 4PQ9A 3ZYPA 3ZR5A 3P3PA 2XH6A 5LRRA 4YYOA 1YYNA 3VD4A 3RQ0A 3V65A 5FY7A 1MQTA 1N1VA 5LA0A 3LWCA 1RUG2 1VB2A 2D5HA 4L2NA 3ZKUA 2PHTA 3OEAA 4UW4A 2ILMA 4MUVA 2KM2A 4CDUA 2R061 2GH8A 3D82A 2PHUA 5KHHA 2W95A 5T55A 4BMEA 4DUVA 5C71A 3OEBA 4DQAA 3AK0A 4FQZA 4EN0A 2GNBA 5J98B 1V9U2 1S0FA 2R063 3VBOC 1R1A2 5BYNA 5ANNA 4MXWA 1VIWB 5HCAA 4Y1YA 4D7YA 5DZGA 1Q5OA 4MGYE 4D7TA 1D4M2 5T5PA 1YNAA 2VOTA 1DQ6A 5DPNA 4BQWA 3RZKA 2WRAA 3ACHA 3BPZA 3OD4A 2DVDA 3NNJA 4AHYA 5BNOB 3DKQA 1O6UA 2VY0A 3MIHA 3FJSA 4FOVA 4P9GA 4FP2A 2VCAA 3K48A 2CTVA 5F3EA 3RSJA 5C6CA 2WT0A 1RL3A 4LBKA 3TAYA 1XJAA 3T3YA 3LOBA 4N7IA 1UMHA 1QJEA 3BTAA 4XABA 2A1XA 1LGBA 3AJZA 5LBEA 1STMA 5A80A 4LA3A 1NA1C 3FE5A 3U4SA 3WF3A 2RS51 5I91A 3K4AA 4NHMA 1LHWA 1GU3A 4CRQA 3LA7A 3AYEA 3WINE 2VQUA 2RS53 4WVMB 4CDXA 4Q4Y2 5JOWA 5JI7A 1FMD1 5FY8A 5KC5A 2B46X 1O8SA 2ZS6B 1YFYA 2G1MA 3KS7A 4D0QA 2DV9A 4MGZE 1VBA1 1FMD3 3E1F1 3VBHB 4C91A 1J3RA 1XYNA 2J1AA 2QE3A 3PU3A 4I02A 5FXZA 3MW4A 4Q2FA 4R9CA 5L19A 1REFA 5T5JA 3AVSA 2A6WA 2YGLA 1HLCA 1VBA3 3J26N 1H2MA 4B8EA 5KHJA 1OPMA 1W6QA 3CBNA 2WQZC 5ABJA 1GFF2 4Y20B 2ZGPA 3T2PA 4HSLA 5A3UA 4MO3M 1R1ZA 3V0AB 2RS11 3J4UH 4PLNA 5FZ0A 2XDVA 1UIJA 3SH3A 1SLTA 1I1EA 1N1SA 1PM7A 5F1RA 5EXOA 2HWB1 2LTNA 4IXLA 3POIA 5A1FA 3ST7A 5IT6A 4XBLA 2YDEA 3HQUA 4HKOA 5IWFA 3ZYJB 3M3EA 5FXVA 5A70A 4NIDA 3HJRA 1MVQA 1GV9A 3JQXA 1O5LA 1VBD1 2Q4SA 4B7EA 2HWB3 4IE4A 4K21A 5JCTA 4YPJA 4WM8C 1UKGA 4K8FA 3N9PA 2FCTA 3P1IA 2VBBA 4I3PA 1JUHA 1VBD3 4I01A 5AC92 4L0PA 2QTWB 4GB32 2QKDA 2ZAAA 3BYWA 1DZQA 4HANA 1C8M2 2WBKA 2ZTNA 4META 4PIZA 4XILA 1PX3A 1W6NA 3ZFEB 5FCCA 3M3IA 5A3TA 4LHKA 3KM5A 3RPQA 1VMFA 1RUF2 3IZOA 4N53B 2ADEA 3E5XA 3O0XA 4OZOA 2X5IA 4Z82A 1OXCA 2ORZA 4MGKE 4WZFA 1ND3B 5FZBA 4QHOA 1EAH1 1NCRB 4IESA 2QZ3A 1YC61 4JQRA 4OCTA 2JDYA 4UXAA 4AL9A 1SZBA 2XONA 5K4LA 4AVAA 5FY0A 1VAKA 1TME2 3FFQA 4M4PA 4OHZA 1EAH3 2VD7A 2VNOA 3MHZA 5LZ6A 5IVEA 1F2NA 3UYJA 3WQ7A 5CA6A 4R52A 4M3CE 3VKFC 2DTYA 2WNEA 4E8CA 3SISA 1AYN1 5L7OA 4QB1A 3AP4A 3TB0A 1O3QA 4INDA 5L73A 3FBYA 2ZKNA 4NHYA 4RYDA 4YZ4A 2DCTA 4IV1C 2YBSA 3I2OA 2Q8DA 1AYN3 2GDFA 1WW5A 5A6QA 2FQPA 4BA6A 2A6XA 1SCSA 3ZVXA 3O1PA 1POV1 3BUCA 1UX7A 2XJSA 2GU9A 2BNNA 4DZGA 2CV6A 2FDGA 1SFPA 3ABZA 2GMEA 2RG4A 4N43A 3O12A 3GBGA 2XJVA 2GC0A 1UKRA 1FPN2 4P08A 3ZFGB 1QMJA 5FPUA 3ECQA 2GNMA 1RUH2 1PNGA 2X8KA 1OD3A 4JRAA 5D1IA 5FYZA 1D2SA 1UIKA 2HBUA 4QXKA 3HBKA 4XPVA 2QQPA 3OUJA 4UWDA 4Z2AA 4Q27A 3SLIA 4D6RA 5A3PA 4E27A 5B4NA 1GQHA 5FLJA 2HEWF 5FMOS 4CU9A 2VH9A 4BDVB 1W2OA 3HPNA 1K5JA 1S1AA 3NVCA 1RVF2 3OJBA 4LK7A 5KBFA 3EBRA 2XLAA 1DLLA 1DGWA 4L99A 4KU7A 1W8HA 3K2OA 3LDKA 1ZA4A 4NOTA 2HWD1 4QD2A 2YYOA 5DAQA 3FBMA 1PZ8A 3W58A 2VZRA 4GWNA 4S2GA 1TMF2 3EMRA 2RDSA 3FZ3A 4IW3A 1FOD2 1YIPA 3D0JA 2HWD3 2HJIA 2VZVA 4A3XA 2FDKA 4QPWA 4AI2A 5DAVA 2TEPA 1S0CA 2BOJA 3KGLA 1JH5A 1I5ZA 4RFT0 5FREA 3RZGA 4ZU5A 4DRVA 1H6YA 3PJYA 3R6SA 1HQNA 4Y26A 1VPHA 5HXMA 2ZMKA 5T54A 4AGRA 5GZCA 3NAPB 3SKVA 4ASKA 2BPA2 1V0AA 3ILRA 3UJQA 5EP9A 3ASIA 4E9KA 4DOUA 2NP0A 3VDBA 1QKQA 1UMIA 2HWE1 2JECA 3NWKA 3P6BA 3H42B 2OA2A 1DYKA 1XNCA 2WQ8A 3D6EA 3FLRA 1GZWA 3KHCA 2JE9A 4ISRA 2QDRA 1BBT2 1VRH2 2HWE3 2RMU3 2VZ3A 3CO2A 1NA1A 2LW8A 1CIWA 2XHKA 4GQ7A 1AYM2 5EQUA 4XUNA 2QQVA 5JXIA 3JU9A 3KHBA 4QAWA 4P00B 1LNSA 4NN0A 3Q8FA 4AGVA 4LO4B 5JOYA 2AGSA 2Y33A 4LIVA 1JXNA 2C24A 1L3JA 2ZGSA 3EB7A 4X6RB 3UV9A 4GZ9A 2PQSA 4HVQA 1JZ4A 1HQWA 2SLIA 4P9JA 2DVGA 2B9UA 3THTA 1SDDB 4RD7A 1PVC1 3VHNA 4AFDA 3H8OA 4JTOA 4AG4A 2Y34A 4PBOA 3AMPA 1QDCA 4AFAA 5FOBB 1PGSA 4YW3A 1RUJ1 1PVC3 2DUOA 3MO4A 1J1TA 4FP3A 5FR3A 2VMHA 5JXJA 1HB4A 2DWRA 1TE1B 4XHBA 3RZLA 1LEMA 5C3RA 1MZ5A
chains in the Genus database with same CATH topology
1OUXA 2BOJA 2JDPA 2JDMA 2XR4A 3DCQA 1GZTA 2JDNA 5D2AA 2VNVA 2JDHA 5A3OA 4UT5A 3ZDVA 4CE8A 5A6XA 5A6QA 2JDUA 5HCHA 1W8FA 2VUCA 1OVPA 1OXCA 1W8HA 2WR9A 1UZVA 2CHHA 1UQXA 1OUSA 2WRAA 2BOIA 5A70A 1OVSA 2JDYA 2VUDA 2BP6A 4AOCA 2JDKA 5A6ZA 1OURA 5A6YA 2BV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUX A;  2BOJ A;  2JDP A;  2JDM A;  2XR4 A;  3DCQ A;  1GZT A;  2JDN A;  5D2A A;  2VNV A;  2JDH A;  5A3O A;  4UT5 A;  3ZDV A;  4CE8 A;  5A6X A;  5A6Q A;  2JDU A;  5HCH A;  1W8F A;  2VUC A;  1OVP A;  1OXC A;  1W8H A;  2WR9 A;  1UZV A;  2CHH A;  1UQX A;  1OUS A;  2WRA A;  2BOI A;  5A70 A;  1OVS A;  2JDY A;  2VUD A;  2BP6 A;  4AOC A;  2JDK A;  5A6Z A;  1OUR A;  5A6Y A;  2BV4 A; 
#chains in the Genus database with same CATH topology
 3D0S A;  3MFC A;  1RUC 2;  4Q0P A;  3C7O A;  4XJU A;  3KVB A;  5LCW L;  4RHV 2;  5BNN C;  4R9A A;  4Y4R A;  4NMI A;  4PI2 A;  3URF A;  3T1M A;  1QQP 1;  2WNU B;  4H7M A;  4KWJ A;  3U78 A;  2YBK A;  1ASJ 1;  5A3L A;  4BXF A;  4PJY A;  2VW1 A;  3IDA A;  2E31 A;  1WMD A;  1AL2 1;  1AR6 3;  1QQP 3;  4Y5Z 0;  4YVS C;  5ISL A;  1FAY A;  2WR9 A;  3NNF A;  1PNF A;  5F6L B;  1ASJ 3;  2ZHK A;  2P3K A;  1AL2 3;  2QQJ A;  2D6P A;  1CES A;  2BU9 A;  2VMG A;  4HVO A;  1CAX A;  1GUI A;  2JE7 A;  3B5L B;  4QGL A;  3AKP A;  4ISQ A;  5FYI A;  1JZ2 A;  5G05 L;  1ULF A;  2NPI A;  4XF3 A;  1PO2 1;  3FWE A;  3LFM A;  1KXG A;  4FPC A;  4CEW C;  1FXZ A;  1T2X A;  1S0J A;  3PVB B;  3CNA A;  1Y9G A;  4W65 A;  3TN9 2;  1Z7S 2;  4YM1 A;  4IUG A;  1PO2 3;  4CZS A;  3BTZ A;  2EID A;  1OPO A;  1YFW A;  2ZGM A;  4QPG B;  4XQW A;  3TEY A;  4RR3 C;  1S2B A;  4X6Q B;  3AX4 A;  3AXE A;  5E88 A;  3IMM A;  3LDB A;  4OUM A;  1IS3 A;  5FZC A;  4CPB A;  4NPM A;  4I2O A;  4LHN A;  2FCU A;  1SLC A;  1KD7 A;  4OUS A;  4UI9 L;  4YRD A;  2P4E A;  3RYR A;  4KG8 A;  1H4H A;  4XF1 A;  3ES1 A;  2VTX J;  3AL6 A;  1F8V A;  2EIB A;  5JOX A;  4A6S A;  3WVJ A;  1IG3 A;  1HX6 A;  3H1W A;  5FUI A;  2RV9 A;  4WBB A;  3MZH A;  1X50 A;  1HRV 1;  2J1V A;  1IKQ A;  3C7H A;  3BKZ A;  2VEC A;  1SFY A;  4LBO A;  2WAB A;  5K9Y A;  1WCQ A;  4KU8 A;  5FZ6 A;  5J96 B;  1REE A;  4YM3 A;  1Q8O A;  1RUG 3;  3R0R A;  1TEI A;  5J7M A;  1URX A;  2Q30 A;  1V00 A;  3O0V A;  4MGI E;  2W92 A;  3WHU A;  2VCM A;  5LA9 A;  4BMB A;  2VUA A;  3DPR C;  4XQ4 A;  3ZFF B;  1UOB A;  1VAL A;  1W8N A;  1OQ1 A;  2R06 2;  2VZP A;  3B7M A;  3N35 A;  5FZA A;  1R1A 3;  3H1Y A;  3APB A;  4Q4W 2;  3IAQ A;  4XF4 A;  3THP A;  3FHI B;  1IZ3 A;  1MR5 A;  3EXU A;  3BOD A;  2AAC A;  2K9Z A;  5JZG B;  1D4M 3;  1VAV A;  2XVG A;  3MID A;  3ZR6 A;  5IK8 A;  5JVV A;  3ZXJ A;  1ULC A;  5JXH A;  4LIT A;  2AUY A;  5FYV A;  3I97 A;  1FX5 A;  2BFU L;  3L9J T;  4O9E A;  1UYP A;  1N1Y A;  4QU1 A;  1DG6 A;  1Y9Q A;  2D44 A;  3KMH A;  4HXC A;  4CP2 A;  3O1T A;  4B3N A;  3J7L A;  3VDC A;  1ZZ6 A;  1XSQ A;  1FV2 A;  2WL1 A;  2FBE A;  4YZ1 A;  2XLG A;  4UFK A;  2CDP A;  4X8P A;  4FPK A;  1UOF A;  3WUD A;  4CDQ C;  1RXG A;  4J25 A;  1DZT A;  1MS8 A;  2VO5 A;  2WKK A;  4KL1 A;  1V6J A;  1MS4 A;  1IHM A;  1XXN A;  4A7Z A;  3C2U A;  5FZ4 A;  3ZO0 B;  2WT1 A;  1FYU A;  1DCS A;  1XPW A;  2CYF A;  1OFS A;  2RS5 2;  3MPB A;  3EJK A;  3GZU C;  4GD4 A;  4XDO A;  5FPZ A;  5FY4 A;  1OD5 A;  1ZRD A;  3WP6 A;  1SLL A;  3DCQ A;  2ZGK A;  3ZKY A;  1I3H A;  4HOO A;  2W0X A;  5FMB A;  2J1U A;  4AI9 A;  3N9N A;  4FPG A;  3POS A;  2JE8 A;  1FMD 2;  2P5B A;  1YJL A;  2QQW A;  1US2 A;  3IAP A;  1HN1 A;  2XXZ A;  4XFA A;  2C9K A;  5KHK A;  2GSY A;  4RSU A;  1JYT A;  3MI8 A;  3U4X A;  1O7F A;  1VBA 2;  1GSL A;  2VVF A;  3ACL A;  4YSF A;  1OFN A;  2WO1 A;  2ZGN A;  4QQH A;  2D6M A;  3B00 A;  4QT6 A;  1KIT A;  4V2W A;  2ZOE B;  5DUX A;  4R4X A;  4XET A;  4AAX A;  4DPN A;  5A6Z A;  3LDR A;  5BNP B;  4GH4 C;  1ZRR A;  1EPW A;  3G7D A;  1OC1 A;  3VBR C;  3R05 A;  2ES3 A;  3S7I A;  1YEW A;  2RS1 2;  5EJ3 A;  3WG4 A;  3WD5 A;  2F4L A;  2HWB 2;  5AC9 1;  3RJ2 X;  3W21 A;  3O0W A;  2R04 2;  4Q5O A;  1YHF A;  1BLZ A;  3GJB A;  1W05 A;  4IV3 A;  5HCH A;  2JWP A;  1S0G A;  4UW5 A;  4A42 A;  1H8V A;  1VBD 2;  4LBM A;  3KVA A;  4D7S A;  2XG3 A;  3WQ1 A;  5AC9 3;  2XB6 C;  1SQ4 A;  4AHX A;  5FQ0 A;  4BQ3 A;  3ZYF A;  4NRP A;  4KWU A;  4GWI A;  5FPL A;  2QQN A;  4QX0 A;  3ZPO A;  4KGG A;  2PHD A;  3GJA A;  5BNN A;  4WVZ A;  3A7Q A;  5C5T A;  1RUF 3;  4XJA A;  2WAA A;  2D93 A;  4YVW A;  4DY3 A;  4CEY B;  3QLQ A;  3IB3 A;  2DUQ A;  3M4F A;  1KS4 A;  5FYM A;  3RWN A;  1LEN A;  1IOA A;  1H8T C;  2GMM A;  4XUQ A;  2OVU A;  3SEE A;  5FP3 A;  1YI7 A;  4Z07 A;  5APA A;  1G6N A;  4MSV A;  1IS4 A;  3I2G A;  2I45 A;  4Y1V A;  4YVS A;  2NLR A;  2WFF 2;  3CZU A;  1TME 3;  4JGY B;  1EAH 2;  3SMH A;  3G6J B;  3KD4 A;  2YFU A;  4X8N A;  3AMM A;  3PNA A;  3GGL A;  5FZF A;  5FKC A;  4XJ9 A;  1F4A A;  4XVH A;  2VTX A;  2Z42 A;  5T5O A;  1N3O A;  1W99 A;  3B9C A;  1WA6 X;  3DYP A;  4XJZ A;  4QX3 A;  3LPF A;  5FPV A;  5GZD A;  3I3B A;  3VL9 A;  1AYN 2;  4CEW A;  4E2G A;  1DF0 A;  3AM2 A;  1LOB A;  3DXU A;  4QQO A;  2FDI A;  1AX1 A;  3AYA A;  2YRO A;  2XJP A;  2PA7 A;  5FZE A;  3WCR A;  4XZP A;  1OQD A;  1W39 A;  4ZS2 A;  5C8W A;  2LM3 A;  1PO1 1;  2UYA A;  2W47 A;  3LF7 A;  4RR3 A;  4UT5 A;  4GKY A;  5I93 A;  1FPN 3;  1XNA A;  3T2T A;  1WD3 A;  4NVP A;  5JR7 B;  1PO1 3;  2QVS B;  1PMJ X;  3WDV A;  2AZ5 A;  1QXR A;  2XML A;  2JG8 C;  3VKM A;  2Z2S B;  3LFI A;  2E26 A;  2VTF A;  4YW4 A;  3W59 A;  4AHZ A;  5FP4 A;  2VOK A;  3JD7 1;  1GWL A;  1ENX A;  5F3I A;  2RHP A;  1BKZ A;  2O1Q A;  2W52 A;  1QOS A;  5FMD A;  5IVB A;  2G9G A;  3VBS B;  1RVF 3;  2LRO A;  5FY1 A;  2ZX0 A;  1OI6 A;  3WNN A;  1W6O B;  3JD7 3;  1ZRI A;  3PDQ A;  5F3G A;  1COV 1;  1C3H A;  1LOC A;  2JKX A;  4HG6 B;  5KR7 A;  5C8C B;  4IER A;  1NYW A;  2GND A;  2GMP A;  1E5H A;  4K3U A;  1RTV A;  4E4D X;  3MV1 1;  1COV 3;  4RQP B;  2HWD 2;  5FZO A;  4QDQ A;  4LK6 A;  3OF1 A;  4Y22 A;  4IEP A;  4D3W A;  2QNK A;  4C8D A;  3DPR A;  1XU1 A;  4UF0 B;  2E32 A;  4Z8B A;  3WF1 A;  1G9D A;  3PMS A;  1PK6 C;  2WUH A;  3VBU C;  2W9X A;  1QXJ A;  4RA0 A;  4JTN A;  4CDX C;  2E7T A;  1PGL 1;  2WS9 2;  2OX0 A;  1XB9 A;  3OPT A;  4UFJ A;  3B69 A;  4K1Y A;  2W39 A;  5E6H A;  3OPW A;  3T2Q A;  5A7P A;  4Q1P A;  5DQ0 A;  1FAT A;  5HBA A;  1H30 A;  5D8A B;  5GM0 A;  1CD3 G;  1QDO A;  2AR6 A;  2WNV B;  2VNR A;  3U14 A;  1CGP A;  3FHQ A;  3I7D A;  5KXB A;  5FO9 B;  1LCL A;  3MF6 A;  4P9X A;  1EV1 1;  1MS0 A;  2ADD A;  3USU B;  5FFO C;  1BBT 1;  1VRH 1;  4D8M A;  2JEN A;  2DUR A;  4EN8 B;  4EN6 B;  2HYK A;  2AYH A;  2OUH A;  4BZ4 A;  2PAE A;  3OGG A;  5IAV A;  5ABJ C;  2JIC A;  5F3C A;  1EV1 3;  4PF5 A;  4CDQ A;  3FFZ A;  1BBT 3;  1VRH 3;  3AMN A;  4Y3O A;  5F32 A;  2XWJ B;  3T30 A;  3UGH A;  1SDW A;  1YQ5 A;  2VUL A;  1O91 A;  3KQR A;  1DIW A;  3VBF B;  3M1H A;  4E2S A;  3H7Y A;  2ZJC A;  1N3P A;  5A7O A;  2QDN A;  3DV8 A;  1G86 A;  3D4K A;  3GHM A;  1CR7 A;  3NNM A;  2ZZQ A;  4NE9 A;  1Y9M A;  1Q3E A;  3AKS A;  4P9W A;  1T6B X;  1G7Y A;  4AVV A;  5CKQ A;  2BTV C;  1H1I A;  1XU2 A;  3L2Y A;  3OCP A;  4YLZ A;  1A8D A;  3ENR A;  1AR9 1;  2Q5T A;  4MYE A;  5A32 A;  4LOR A;  3ZN6 B;  5BNO C;  1J58 A;  3VN4 A;  3K3O A;  5FWJ A;  4QHZ A;  1J84 A;  4E4Z A;  1PVC 2;  1AR9 3;  1HDK A;  1U0A A;  3POW A;  5GZG A;  4NR1 A;  4RHV 1;  2IWG B;  4FPH A;  3III A;  2A7A A;  4P5H A;  2E6V A;  2CNA A;  1RUJ 2;  1V6K A;  2V09 A;  4GJZ A;  3O5S A;  3PUR A;  1PMI A;  4RHV 3;  2VW0 A;  1RIT A;  1DQ2 A;  2BOI A;  1YRZ A;  4XXA A;  3N36 A;  1J83 A;  4FOY A;  1GWK A;  4GH4 A;  3O1M A;  2X5I C;  1DGR N;  3VBR A;  2VMI A;  3AKQ A;  4OI1 A;  3M70 A;  4JGZ B;  5K8S A;  2OW4 A;  3O1S A;  2BVB A;  5IVY A;  5IFP A;  1OOP C;  1WLT A;  5K0U A;  1W0O A;  2GC2 A;  5L9B A;  5FZ3 A;  1ASJ 2;  3MDP A;  4S2F A;  3SEP A;  4D6Q A;  2VJX A;  4I0B A;  3WG2 A;  4NRQ A;  1AL2 2;  1SBF A;  3ZSK A;  3LEG A;  2XJR A;  3GM8 A;  2H6C A;  1NLQ A;  3HN1 A;  1WUV A;  4WVV A;  1WCU A;  1YQ2 A;  2EAA A;  1TNF A;  2E53 A;  4I0A A;  3HQX A;  3TN9 1;  3ZYI B;  3I54 A;  1MS3 A;  2D3R A;  1OLQ A;  3AXD A;  4FOQ A;  1JUI A;  1E5I A;  3Q8C A;  3ME2 A;  3WDT A;  5E1R A;  2RJL A;  3TN9 3;  1PO2 2;  2BNM A;  1FI2 A;  3B01 A;  1NZC A;  2B4K A;  1UN1 A;  2C4X A;  2E51 A;  2D98 A;  4XUP A;  4AZZ A;  4C1W A;  4LBN A;  3AZX A;  2Z79 A;  3U07 A;  5IK4 A;  1H8T A;  2BWC A;  4N43 C;  4RFR B;  4IET A;  4AEJ A;  1O5U A;  1WMF A;  4K8R B;  2RR1 1;  1EUT A;  1J59 A;  2WN2 A;  3U37 A;  3H0O A;  2BYV E;  4HKL A;  4KBB A;  1BMV 1;  4AI3 A;  2W91 A;  4ERO A;  3KCY A;  5FUN A;  3ILF A;  5FMC A;  4QM8 A;  1APN A;  5SV5 A;  4CCK A;  4LLF A;  3NKG A;  1LHN A;  1UQX A;  3MGU A;  2ZHL A;  2OKX A;  1CWP A;  4H2A A;  1OVS A;  3J9S A;  2MEV 1;  1UYZ A;  3PTR B;  4YW2 A;  3ITQ A;  1ULG A;  3OOX A;  4N53 C;  5CFD A;  1HRV 2;  3VKL A;  2N7G A;  2HWC 1;  3GCW A;  3UJO A;  4DEV A;  4AXO A;  1R64 A;  2XKO A;  4QPI B;  1WCK A;  1G9A A;  2KA3 A;  1NCR C;  1NX9 A;  4Q4W 1;  5FPX A;  2KR2 A;  1GP6 A;  2HWC 3;  1DGW X;  2VMF A;  3O1R A;  3DF0 A;  5IVF A;  2B8M A;  2FCV A;  3I2D A;  2BDR A;  4Q4W 3;  4N8M A;  3RZH A;  3SCG A;  2IXH A;  1X9P A;  2JG8 A;  5JSR A;  3O1V A;  1OQE A;  4IL7 A;  3ZX7 A;  3R4U A;  1RXF A;  1OVP A;  5FTT C;  1QXP A;  2JJ6 A;  2JXA A;  5F37 A;  1IQD C;  4LUL A;  3K51 A;  4CDW B;  5I0T A;  1S0E A;  3MLL A;  5FYS A;  5DG2 A;  2DCY A;  4ZS3 A;  3LEM A;  5E8A A;  1I9R A;  1X9T A;  3T09 A;  1WW7 A;  4ZPI A;  2DFC A;  1DBN A;  2HKX A;  4V1P A;  5BNQ A;  4PIX A;  1GNH A;  4OQ9 A;  5ERL A;  3WNK A;  3FX3 A;  4QQ2 A;  1D7P M;  1UY0 A;  5GZF A;  3WW3 A;  3FLT A;  3NV4 A;  3WW1 A;  3ZFG C;  1NOV A;  1KRI A;  1XNB A;  2OT7 A;  4B7K A;  4HPK A;  3H8R A;  3IPV A;  4XFF A;  1PK6 A;  3OB8 A;  4YG6 A;  3VBU A;  3FL7 A;  1GR3 A;  1ND2 A;  4R4Z A;  2QQU A;  5F39 A;  4DIN B;  4GMP 1;  3OY8 A;  3DXT A;  3CJI B;  4FFI A;  1ZVF A;  4XAC A;  2JKB A;  5CAZ A;  1AXK A;  4PDW A;  2LRP A;  3THD A;  1SMV A;  4K9S A;  4OZX A;  5FYH A;  3VD9 A;  3M7A A;  2P37 A;  1IS6 A;  2UY8 A;  2V4V A;  3HN3 A;  4GMP 3;  4LHL A;  4PLO A;  5CKM A;  5F2S A;  4HLT A;  3RYK A;  4CCD A;  4NJ4 A;  3HWJ A;  3C7E A;  1Q8V A;  2W3J A;  1V6L A;  2ARA A;  2GN3 A;  5C9A B;  1O59 A;  1JU3 A;  2RJ2 A;  4IEX A;  4IEU A;  5A7Q A;  2X09 A;  3ZIX A;  4CP9 B;  4Q0U A;  1HB3 A;  5FZD A;  3U11 A;  4FAH A;  3SH5 A;  3GXU A;  4ES9 A;  4C0B A;  4JCK A;  1KFU L;  4GA9 A;  4W50 A;  4AF9 A;  4QKN A;  2JD9 A;  3I2K A;  3JQW A;  3RS6 A;  5FZG A;  1E5S A;  2RS1 3;  2R04 1;  2R0H A;  4R9D A;  2C9A A;  4QB6 A;  1GBG A;  3QD6 A;  5H9Q A;  3C7F A;  3ZYH A;  3CJX A;  1Y43 B;  2MNG A;  2R04 3;  1HB2 A;  4NIH A;  1QH7 A;  1PHM A;  4M3C F;  5BNO A;  3ILN A;  1VLN A;  1W2N A;  3I3E A;  5A3W A;  2ZGT A;  1NCQ B;  4BE3 A;  1EY2 A;  1V6I A;  2BEO A;  1C28 A;  3PIG A;  4UFL A;  5A1L A;  1BZW A;  2UUR A;  4XAA A;  2JDN A;  2PHF A;  1ENR A;  4XUR A;  3FN9 A;  1GIC A;  3VZN A;  3CIH A;  1ZYB A;  5EPA A;  2CAV A;  2Q1M A;  1JOJ A;  2XJU A;  2P6H A;  3POB A;  2FMY A;  2QCS B;  4BK4 A;  2R49 A;  1MVE A;  1W0N A;  1U12 A;  1UOJ A;  3MF9 A;  2VUC A;  3AFG A;  5FK8 A;  3VHO A;  4MHU A;  5C3O A;  3NL1 A;  2ZGO A;  2YU2 A;  4S2D A;  4B4Q A;  2WFF 1;  2Q8O A;  2ARB A;  3AP6 A;  2Q0A A;  4WVM A;  5LK5 A;  3LCP A;  3TNP B;  3MYX A;  4FBF A;  4OHV A;  1OOP A;  3M3O A;  3GCX A;  2WFF 3;  4OUE A;  4UYB A;  5DZF A;  1WMX A;  2B9V A;  3B94 A;  3JB8 A;  5FYB A;  3VD3 A;  1UY3 A;  1RHI 1;  3VZL A;  5JI9 A;  2D5F A;  1V70 A;  1LHV A;  3WF2 A;  4ZU7 A;  5SV8 A;  1VMJ A;  1QWR A;  3WQ0 A;  3TEX A;  3HAG A;  3E6C C;  2RDN A;  1RHI 3;  4AFB A;  1TG7 A;  1OSG A;  5CAD A;  2Z4F A;  5KXD A;  1F35 A;  4XF0 A;  4DUX A;  4HKW A;  2J22 A;  4LJH A;  4FFH A;  1AJK A;  3ZXF A;  4BQ4 A;  4Y20 A;  1QF3 A;  1ZX5 A;  1LU1 A;  1NG0 A;  1YI9 A;  2P3J A;  1OBN A;  2ZX1 A;  4I3G A;  1IPK A;  3ZMO A;  4YZ2 A;  2OZJ A;  2Q8C A;  4WZC A;  3VBO B;  1HKD A;  4K20 A;  2R32 A;  3VDD C;  3JBG 1;  5F5A A;  3VZK A;  4K6B A;  1K3I A;  1POV 3;  5FKB A;  1W28 A;  5C33 A;  4A4A A;  4JKL A;  4BPZ A;  2NM1 A;  2O8Q A;  5F5I A;  1PO1 2;  4Y5T A;  2WZP P;  3H8U A;  3S57 A;  3JBG 3;  4SBV A;  1CZT A;  2NZ9 A;  5EJZ B;  1LRH A;  1W8T A;  1W9T A;  4G9S B;  4Z92 B;  4XXP A;  4CCC A;  2E63 A;  4F83 A;  2TUN A;  4QXH A;  4BQY A;  1NLR A;  1LEC A;  2RS3 1;  3P5B A;  2OPK A;  1GQG A;  4YG0 A;  4M3C B;  1SPP A;  3SHR A;  3JD7 2;  3VV1 A;  1WGP A;  2BVV A;  4JKM A;  4KWK A;  4CU6 A;  2RS3 3;  4KQ7 A;  1E5R A;  3O14 A;  1CAU B;  4N53 A;  1WLW A;  1OA4 A;  3HR9 A;  5FZ8 A;  3ZN4 A;  3CL1 A;  2EIE A;  4QPG C;  1COV 2;  1ND3 A;  1C1L A;  2XGX A;  1NCR A;  2Q8E A;  4CUB A;  3I2F A;  2Y60 A;  3I2H A;  2WS9 1;  4HMZ A;  4OLL A;  4U2A A;  2J1T A;  2HBT A;  1UNB A;  1ENQ A;  3SCF A;  3LSD A;  2BFU S;  2VNV A;  1WCS A;  3PVO A;  3WDX A;  4AEM A;  5C5U A;  3ACI A;  2WS9 3;  3RGB A;  3PIJ A;  3KF5 A;  4XYX A;  2P2K A;  4IGP A;  2Y6J A;  4AI0 A;  1NKG A;  5JAX A;  4UAP A;  1PGL 2;  1IPS A;  3KQ4 B;  4DY5 A;  4FTB A;  4XMI A;  1BHG A;  2WWS A;  4UOJ A;  5FY5 A;  2VZQ A;  3BPS A;  4XJ8 A;  3AB0 A;  4EYU A;  3S30 A;  2Y8K A;  4EZH A;  1CAV B;  1D0G A;  2WA3 A;  1MS1 A;  3BN6 A;  5T5L A;  3BVC A;  1ULO A;  3KZ4 C;  1EV1 2;  5D21 A;  5FZL A;  4MV2 A;  3IT8 A;  5LAS A;  3K3N A;  4C0H A;  1F9K A;  2WA4 A;  1B09 A;  1HV1 A;  3ZFG A;  3AP7 A;  1KJL A;  3PUI A;  1EYB A;  3POJ A;  2VQT A;  2WN3 A;  4UW6 A;  3W5M A;  3VDA A;  1ZA7 A;  3ZYG A;  1JN2 P;  1KDM A;  2YC2 A;  4WM8 B;  5DAW A;  1XNK A;  3AZZ A;  4LIU A;  5EZW A;  1UCX A;  3ZSE A;  2WYS A;  5EJ1 B;  1JZ5 A;  4Q0Q A;  3T08 A;  2DVB A;  3H9A A;  1LR5 A;  4XDQ A;  1VAM A;  1B35 B;  4IV3 C;  4RS5 B;  5A7W B;  3VGI A;  4MOA A;  3NQH A;  4HK9 A;  1ULD A;  5FBZ A;  1AR9 2;  1YCI A;  3GNE A;  5I8Y A;  2SBA A;  4LA2 A;  2R7E B;  3UT0 A;  5C3Q A;  1W3X A;  4ITC A;  4AI1 A;  3IWZ A;  3IKW A;  1RUJ 3;  2J42 A;  3POG A;  1AR8 2;  4NUB A;  2YY1 A;  4WM7 B;  4D6S A;  4YVW C;  4XTM A;  1JHN A;  4R9B A;  4PI0 A;  1D2Q A;  1DHK B;  4UW3 A;  2OQ7 A;  2GZW A;  2YB7 A;  5LB6 A;  5DAP A;  1JOP A;  1UOG A;  5IYY A;  3H3U A;  1MPX A;  2X05 A;  4NIA A;  3NAP A;  1HQL A;  3SH4 A;  2BJS A;  3BTY A;  4W6W A;  5HCB A;  1CJP A;  4FFF A;  4OYU A;  3PTY A;  1K42 A;  4RGG A;  4IV1 B;  2VCC A;  1QJX 2;  1W8W A;  1GP5 A;  4QDR A;  4A45 A;  2GAU A;  4D94 A;  3UGF A;  3POF A;  2J1S A;  3TOJ A;  1AX2 A;  5C70 A;  3B93 A;  1XYO A;  1LGN A;  5FJH A;  2BRT A;  5LWB A;  4CP1 A;  3UKN A;  1AZD A;  3H50 A;  5AFB A;  1S55 A;  1DZR A;  4XBN A;  4O9G A;  1ULE A;  4YZ3 A;  3B02 A;  5FPB A;  5FZM A;  3AYD A;  3PME A;  1X8E A;  2ORX A;  4AR2 A;  4J1W A;  3BCW A;  1YQC A;  4ZY9 A;  4AVT A;  1O4T A;  5A3N A;  4KGQ A;  2XL7 A;  4MHR A;  1UWW A;  4HN1 A;  2WC2 A;  3WX5 A;  2VXJ A;  2A71 A;  4CU7 A;  2A70 A;  4AWD A;  4FTE A;  4GUL A;  3WG1 A;  4CVU A;  2YFZ A;  1PGW 1;  4IEZ A;  5FP7 A;  2PAM A;  2JEM A;  2CGN A;  2W46 A;  2RR1 2;  3CU7 A;  1WME A;  3N3H A;  1H0B A;  1U5Z A;  2PHR A;  1BMV 2;  4O65 A;  3HNM A;  3BB6 A;  2W87 A;  1W3V A;  1EUU A;  1I5P A;  2V4A A;  5IVC A;  3O1O A;  2K0G A;  2YPJ A;  4XUO A;  1HRV 3;  4Y4Y A;  2C1F A;  3P3N A;  2DTW A;  2MEV 2;  5EHD A;  4MGT A;  1OF4 A;  1MZ6 A;  2R16 A;  1UMZ A;  2WNU A;  3VDD A;  3VZM A;  2RE9 A;  3SKJ E;  4C90 A;  1YFX A;  4MLO A;  1UY2 A;  2WO2 A;  4YGE A;  1HW5 A;  2DVA A;  2HWC 2;  1OH3 A;  2PEL A;  3IM0 A;  3K4Z A;  2D7F A;  2J1E A;  1ZZB A;  1JS9 A;  5KXC A;  1XSR A;  5C4W B;  2P34 A;  3OPZ A;  1XND A;  2RDR A;  4G4F A;  1SEF A;  2JX9 A;  2E7A A;  2J7M A;  3J7M A;  2ZKL A;  2EA7 A;  3TEW A;  3MUY 1;  1GNY A;  2A75 A;  1RJ7 A;  4YGD A;  1W6P B;  3C7G A;  3ZDV A;  4LQR A;  2QUO A;  1HRI 1;  1V6O A;  3WOG A;  1W9F A;  4BQX A;  2NMO A;  1ZNP A;  2DU0 A;  5FPA A;  3RMY A;  3SQO A;  2JB4 A;  2EXI A;  3NV2 A;  1HB1 A;  4XC9 A;  1YFU A;  1HRI 3;  4DFS A;  4QPG A;  1H1M A;  1TZO A;  4AK3 A;  3QBQ A;  4Y1X A;  3KV4 A;  1ZZC A;  2RM2 1;  2XUE A;  1UD1 A;  3JB4 C;  1LKN A;  4BB3 A;  3I3Q A;  5CG8 A;  5IVV A;  4ASL A;  2HWF 2;  1R09 1;  3SXW A;  4J1X A;  2RM2 3;  2W94 A;  2X10 A;  4RGK A;  4AGG A;  3I2I A;  1JW6 A;  2VMC A;  1BVV A;  1YQ8 A;  3QH6 A;  5F7U A;  2EIG A;  1ZRF A;  2C26 A;  5DN2 A;  1HN0 A;  4NPR A;  5KC6 A;  1R09 3;  1YUD A;  2FZ1 A;  3UNP A;  5FV3 A;  4Y24 A;  3ACF A;  3JZV A;  1UXZ A;  4M4R A;  3SNM A;  2RJK A;  1L7R A;  4L92 A;  5CEH A;  3O1U A;  5FQ0 B;  4ET7 A;  3VBS C;  2G9F A;  1G8W A;  2R1B A;  3ZYB A;  2ET1 A;  4YFW A;  3CEW A;  4P9I A;  1DQ0 A;  1DYP A;  1N1T A;  3KT7 A;  3OGR A;  1W9Y A;  3LA2 A;  2WT2 A;  3OSD A;  1NE6 A;  1OMI A;  3LQC A;  1C57 A;  4GWJ A;  4CSW A;  1ODN A;  1LTE A;  2W68 A;  4I30 A;  4EV0 A;  2BGP A;  1QNW A;  2IZW A;  2K46 A;  3E97 A;  1JBC A;  2A73 B;  3O7O A;  4XFG A;  1PIV 1;  1SHW B;  4FQ4 A;  5FYT A;  5GLW A;  3ZFF A;  4AED B;  1AVB A;  1K5M B;  3WQB A;  4B1M A;  3DN7 A;  4EN9 B;  3A21 A;  1H2N A;  3KV6 A;  2ZGU A;  4IEY A;  2FHR A;  4MX3 A;  2XWB B;  5EV7 A;  3TBD A;  1PIV 3;  4JDN A;  5JXG A;  4NWW A;  4DO0 A;  5FUP A;  5DDJ 1;  5K0U C;  3ON7 A;  1P8J A;  5LAT A;  4MAD A;  4TZD A;  2AH2 A;  3AZW A;  2AEZ A;  1ODM A;  1CPN A;  3FUO A;  2VVD A;  3AMQ A;  3GZE A;  5DAX A;  5DDJ 3;  3ZN5 A;  4F8A A;  1A3K A;  1X7N A;  3AP9 A;  5JDB A;  1C5H A;  4XQD A;  5FZ1 A;  4DXR A;  2P6C A;  2QBX A;  3DYO A;  4IEO A;  2WSU A;  3ZXK A;  3NO8 A;  4PQQ A;  4QQP A;  4LKS A;  3VBF C;  3WUC A;  2VG9 A;  2J1R A;  1U5X A;  5LRS A;  1NUK A;  4LBL A;  4XEZ A;  3GAL A;  4TSV A;  3OBR A;  2Y38 A;  5GLU A;  5DZE A;  1RGS A;  1VBC 1;  3A0K A;  4F7Z A;  3Q8E A;  1NT0 A;  3OYW B;  4ZZ8 A;  3BOP A;  1IKP A;  5CU1 A;  3CKH A;  3GBF A;  3S6P A;  1UAI A;  2Y64 A;  1RUD 1;  1LED A;  2D40 A;  1W2A X;  2IVI B;  1MS5 A;  1VBC 3;  2A6Z A;  2QZ2 A;  1LOG A;  1RHI 2;  4URT A;  3FMG A;  4BXS V;  1O4Z A;  3POY A;  4YZ5 A;  1IS5 A;  4BCU A;  1RUD 3;  2DBI A;  2GNT A;  4ZON A;  2WDB A;  5CB7 A;  2VUJ A;  4JC1 A;  5HPO A;  2WIN B;  2YHJ A;  3MFA A;  1U5I A;  4OQ8 A;  2JDM A;  2PFW A;  4W4Z A;  5DUU A;  5FDB A;  4IGO A;  1CAW B;  4UFH A;  2W1Q A;  5CFD C;  1OHF A;  3DPR B;  4E4S A;  4K1Z A;  5BNP A;  4YW7 A;  5CKN A;  1O3R A;  4B1L A;  2ET7 A;  3ZPY A;  4WVW A;  5A33 B;  4MZU A;  2CWM A;  1VBB 1;  4JGZ C;  3WW4 A;  4DXT A;  3OBA A;  1W04 A;  2B5H A;  5JR2 A;  3JBG 2;  1WLD A;  3KSC A;  3AFK A;  5GLV A;  4CXY A;  1VE0 A;  2Y0I A;  4EWA A;  4W6X A;  3R4S A;  4CUC A;  5DMY A;  1BCX A;  5KHI A;  4RN5 A;  1DP0 A;  3F2Z A;  4KH9 A;  4HVR A;  2ZHM A;  3ATG A;  1LGC A;  2XJT A;  3A4U A;  2ZAC A;  3LSE A;  4KBZ A;  4QXC A;  1OUX A;  4XAE A;  3T0B A;  2ZCW A;  4GJY A;  4MH0 E;  2K2S A;  2XLF A;  4H7L A;  1W9W A;  4CDQ B;  1AXZ A;  3VZJ A;  5J09 A;  2RS3 2;  2ZEX A;  3RFR A;  1JOD A;  5H9R A;  2NYY A;  4LT5 A;  5CFC C;  3RVH A;  4CEY A;  1XNT A;  3MIF A;  5L9R A;  3AP5 A;  2JDZ A;  1XRU A;  2PN5 A;  5FYU A;  4AQ2 A;  1FT9 A;  1OLM E;  3HNY M;  4AW7 A;  2A6V A;  4YFZ A;  1UW8 A;  1IGO A;  3I49 A;  4JGY A;  2ZML A;  1WLC A;  4HK8 A;  5CIS A;  3ZXG A;  1JI6 A;  1ND2 C;  1XC6 A;  2EAK A;  2WQ4 A;  1LHO A;  4LBQ B;  3A22 A;  4PDW C;  4XFB A;  4YG3 A;  5JIA A;  3OD0 A;  1A34 A;  3WNM A;  4JDM A;  1W6M B;  3VB9 A;  1GWM A;  3IDE A;  5FOJ B;  1A8M A;  4FOW A;  2VW2 A;  1RUE 2;  4LOT A;  1JZ7 A;  4JVA A;  3FUQ A;  4IE5 A;  1CVN A;  1OH4 A;  2ZX4 A;  5JIU A;  3BI3 A;  1NZI A;  5B4X A;  2B39 A;  3S5Q A;  2CGP A;  5GKA C;  4LTA A;  1H6X A;  1ALY A;  3PUH A;  3PUQ A;  5FXX A;  2BGC A;  2CWS A;  5IFT A;  4BOW A;  4XFC A;  4IE0 A;  5T52 A;  1K45 A;  3RWK X;  5F9T A;  3CHX A;  3I59 B;  4G3Y C;  1QEX A;  1W8U A;  1DQ4 A;  2XKP A;  2AEY A;  2ZEW A;  2ZGL A;  4QKF A;  4XFI A;  3BIW E;  4OI2 A;  5EIY B;  1BJQ A;  5DAB A;  3VBS A;  4NIG A;  4FTS A;  1SBD A;  2F17 A;  4GXL A;  1W6O A;  1ZBE 1;  4DMI A;  1RUN A;  3WNL A;  4LO7 A;  4Q29 A;  1AR8 1;  5JWP A;  2BGO A;  1UU4 A;  1UF2 C;  4H3W A;  2UU8 A;  1Z78 A;  3C8X A;  4CCL A;  1ZBE 3;  5F6K A;  3LA3 A;  1AR8 3;  4FAG A;  2UY9 A;  1N47 A;  2KD7 A;  1QY4 A;  3FLP A;  1W2T A;  3V0B B;  1CZS A;  1VP6 A;  3NNL A;  4UF0 A;  3THC A;  4ONU A;  1AR7 1;  5JPM B;  3BU7 A;  3POE A;  2OQ6 A;  2JIJ A;  4M00 A;  3ZXE A;  2WNO A;  2JDA A;  4TTG A;  4DEQ A;  3WV6 A;  3CJI C;  1QJU 1;  3HT2 A;  3NST A;  3LE0 A;  1QJX 1;  2JG9 B;  5D8A A;  4BQ5 A;  1OLM A;  4NRM A;  1QJU 3;  2A3Y A;  2WNV A;  4FVV A;  5A3O A;  3VBH C;  1HXS 1;  2VU9 A;  1JZ3 A;  1QJX 3;  4K40 A;  3UES A;  3USU A;  2PXJ A;  4ZU4 A;  5DXD A;  2Z69 A;  4XW3 A;  4JQT A;  2DVF A;  5EYY A;  1XE7 A;  5GJ6 A;  4QX1 A;  4HZF A;  1GLH A;  2Y6F A;  1MQT B;  1RUO A;  4LR4 A;  4CUG A;  3N7L A;  2YXS A;  2IXK A;  2RDQ A;  3A23 A;  2EIC A;  3NV3 A;  4CDU B;  4FPF A;  1SAC A;  3RZJ A;  5FLI A;  4AOC A;  4COW A;  3VBF A;  5IUQ A;  2IFW A;  5LA1 A;  4MG2 A;  4QX5 A;  3ZMN A;  4MXW B;  4XMA A;  3KCX A;  2JG8 B;  2ZAB A;  1JYX A;  4PT6 A;  1N3Q A;  1PZ9 A;  4A3Z A;  1YWK A;  2D6O X;  3K4D A;  4GKX A;  4KG0 A;  4QGM A;  4RL7 A;  3SIT A;  3TWI A;  3LIH A;  1V6N A;  3ORJ A;  5HI0 A;  2HEV F;  2IUW A;  2RR1 3;  3ZN6 A;  3ZXD A;  1UZW A;  1PGW 2;  3J8F 1;  4K7J A;  4BWO A;  4DIQ A;  4OVE A;  4EJR A;  1NCQ C;  1GMM A;  2PAK A;  1NQJ A;  1J3Q A;  4H14 A;  4PHZ A;  5CG9 A;  4P02 B;  4Z2W A;  2BP6 A;  2JD4 A;  3RI9 A;  3ZFE C;  4CP0 A;  3HVD A;  3E5Q A;  3LGR A;  5A7N A;  3WHT A;  2TNF A;  3U1X A;  2EVX A;  1RMU 1;  3DGT A;  1O3T A;  3K75 B;  2MEV 3;  1W9S A;  1TVG A;  5T50 A;  2EXK A;  3N9Q A;  1BXH A;  4Y1Z A;  1ND3 C;  3ZDS A;  1MZF A;  1PK6 B;  3BIE A;  4E2Q A;  4CDX B;  1RMU 3;  4JGZ A;  3QCW A;  1W2U A;  3WNX A;  4CE8 A;  3WF0 A;  1I6X A;  3RDI A;  2DYC A;  4UFM A;  2HEY F;  4O7X A;  2C0Z A;  4AEK A;  3ZYR A;  1ZBA 1;  5JLV A;  2ZHN A;  3TYJ A;  4LOS A;  1W8F A;  3KCC A;  3TEZ A;  5C3P A;  4NPL A;  1ZBA 3;  4Q4X 2;  1GYK A;  3DEM A;  1R08 2;  5J1X A;  1LOF A;  5FLH A;  2JDK A;  1CJD A;  1W6Q B;  2ZA9 A;  1KEX A;  1PVX A;  1QIQ A;  2O0O A;  1DQ5 A;  3MW3 A;  4AVB A;  5ABJ B;  4XZU G;  2WYF A;  4EZ4 A;  1CIY A;  1HRI 2;  3MIE A;  5CFC A;  1PMH X;  3J7H A;  1Q43 A;  1MEC 1;  4HFS A;  3WR0 A;  2HWF 1;  3K77 A;  2W1S A;  4AE2 A;  5K7P A;  5CVR A;  1TNR A;  3OBZ A;  3ALQ A;  1MEC 3;  2HWF 3;  2RM2 2;  3UKT A;  3KV9 A;  2QFE A;  4MGQ A;  2VZT A;  5A1A A;  2WZR 2;  5IW0 A;  4Q4V 2;  2D6L X;  1R09 2;  3NJY A;  4LBQ D;  1XYP A;  3H1M A;  3BGA A;  2Z5W A;  3VUO A;  3EQE A;  2BER A;  2UWB A;  2WWJ A;  3QAC A;  1IQA A;  4LO5 B;  5H9S A;  3WF4 A;  1LES A;  2BBV A;  5L9V A;  4FPL A;  4HET A;  1W6N B;  1O4Y A;  1JYC A;  2XR4 A;  2ERF A;  3NRU A;  4PF1 A;  4AFC A;  5JMO A;  4V2V A;  5IVJ A;  2YMZ A;  2WWU A;  1VB4 A;  2DU1 A;  2R07 2;  3PU8 A;  2P3Y A;  2X5I B;  3CQO A;  4QPI A;  4R8H A;  5DG1 A;  1QH6 A;  3MBW A;  1RC6 A;  5GZE A;  3WP4 A;  1FNZ A;  2VM9 A;  1SLA A;  4L11 A;  5FZH A;  3ZXL A;  1OOP B;  5LBB A;  2GC3 A;  2D97 A;  2ATF A;  4PIY A;  4A7K A;  4BK5 A;  4LXL A;  3ETQ A;  1OLR A;  2QQO A;  1PIV 2;  2EF6 A;  1CX1 A;  3BOW A;  1NLS A;  2C6S A;  4LHS A;  4DUW A;  3NAP C;  3MLJ A;  1OUR A;  5A6Y A;  5L7O B;  5FRA A;  4NHK A;  2BQP A;  1WKY A;  4QKD A;  3V56 A;  1IPJ A;  2JDP A;  4CDW A;  1ST8 A;  3ZLI A;  1FNY A;  1Y4W A;  2CU5 A;  2VXR A;  2WJS A;  5DDJ 2;  5BUV A;  1LU2 A;  3IDC B;  2NQY A;  2V5Y A;  4L8Q A;  4P9L A;  3W20 A;  1JU4 A;  1POV 0;  2ZEZ A;  4P9Y A;  2VR4 A;  3VD7 A;  2HLE A;  3HQR A;  5LY2 A;  4CYD A;  2D43 A;  4N43 B;  5GAL A;  1MS9 A;  1DYO A;  1UZV A;  1JYW A;  4BU2 A;  5KXE A;  2YC0 A;  2YBP A;  4EWE A;  1SLI A;  4OI0 A;  4LO8 A;  2PYT A;  1G9C A;  1DDL A;  3CJI A;  1Y7B A;  5F5C A;  1RUI 2;  5IK5 A;  4IGQ A;  4PCR A;  1W8Z A;  3N7J A;  1VRB A;  4BIS A;  3S0M A;  2I2S A;  4Y5S A;  3UGG A;  4E4H A;  4EWD A;  3VBH A;  1F31 A;  4RS5 C;  1B35 C;  2IC1 A;  3GBW A;  4JV4 A;  1VBC 2;  1SPP B;  3LD8 A;  4BJ0 A;  1SG3 A;  5C9A A;  5I0R A;  2G19 A;  5TSW A;  3J7N A;  3JCI A;  2GP5 A;  4TN7 A;  3OGS A;  3T0A A;  1RUD 2;  4OMC A;  3MIG A;  4CP9 A;  1O3S A;  3LZZ A;  3DEC A;  3GZA A;  2OYZ A;  2VME A;  1Y3T A;  5FP9 A;  5AFE A;  2VOV A;  4WM7 C;  2CAU A;  2B42 B;  5EWS A;  5GLT A;  2GAL A;  5F2W A;  3D3A A;  3V0A A;  3AL5 A;  1FV3 A;  2PHL A;  3WSO A;  4JX0 A;  4W6Y A;  2WNU C;  5LK7 B;  2XJQ A;  2GC1 A;  2CSG A;  4CUA A;  4UFI A;  2NN8 A;  2ZX3 A;  1NAE A;  2WSV A;  4SLI A;  2ZPX A;  1AF9 A;  3H7J A;  1BVP 1;  4BM8 A;  1VBB 2;  3N4M A;  1X8M A;  3VHP A;  4P5Y A;  1WWY A;  2R1D A;  2WO7 A;  4D69 A;  1GOH A;  3CMG A;  1NCQ A;  2YG0 A;  3ZSL A;  3GHN A;  3I3M A;  4ARX A;  4NO4 A;  1K12 A;  2ARX A;  4Q1R A;  3AZV A;  1UYX A;  3EO6 A;  5FZI A;  1CN1 A;  4FPJ A;  1D4V B;  3ZFE A;  3TNQ A;  1GZW B;  1YXW A;  2CGO A;  1POQ A;  1NA1 B;  2WII B;  1WW6 A;  4XIK A;  3B3Q E;  1H9P A;  1CX4 A;  4LLO A;  1UY4 A;  2Y6G A;  3SCH A;  4LKE A;  2F4P A;  4KWL A;  3CLP A;  1QHD A;  2YPD A;  1W8O A;  4XFH A;  4ZHN A;  3M2M A;  1HIX A;  2VE1 A;  5JUV A;  2IFR A;  1QJY 1;  3KGZ A;  5FIX A;  3RJR A;  2OII A;  2WZ8 A;  1C4R A;  2ZXQ A;  1UU6 A;  2FDH A;  1AXY A;  3VL8 A;  4ASM B;  1UPI A;  1ZZ9 A;  1RUE 1;  1DGR A;  1RYY A;  2VGD A;  1QJY 3;  3HEI A;  1ZZ7 A;  3ETP A;  1L7Q A;  3HIF A;  2H6B A;  1OUS A;  1H9W A;  2VOW A;  4YAR A;  1JHJ A;  1RUE 3;  3AMH A;  2VNG A;  5CZK A;  2WLQ A;  4B4P A;  3PVE A;  5FWE A;  2XOM A;  3BTX A;  2Y6H A;  2YC4 A;  3VBO A;  4AFM A;  3JUU A;  4LKF A;  4LUK A;  1S2K A;  4CU8 A;  1UU5 A;  2BUK A;  3D5O A;  3IN9 A;  4XHX A;  3ZFF C;  3DYM A;  5C4W C;  2MHF A;  3NMB A;  3H3Z A;  1DLC A;  1XQN A;  2H0B A;  1JZ8 A;  3WLU A;  3LAG A;  5FZ9 A;  4CXW A;  2FDJ A;  4QWN A;  5JZG C;  2RVA A;  2RMU 1;  1CAX B;  2V73 A;  3CDZ B;  3I2J A;  3KT1 A;  1KQR A;  2VBD A;  5AVP A;  4Q0V A;  5FXW A;  1GOF A;  1F5F A;  2ZZJ A;  1AUY A;  2WZE A;  3HBZ A;  4M3C A;  1S2E A;  5I0U A;  4Q26 A;  1ENS A;  2PLV 1;  3DUI A;  1C5I A;  2X53 S;  3KT4 A;  5JSP A;  4QX2 A;  1CAU A;  4GIQ A;  4RGA A;  1ZBE 2;  1F15 A;  2PLV 3;  4XCA A;  1UL9 A;  2ARC A;  1E57 A;  5D2A A;  4BIO A;  3T1L A;  4OUL A;  1L7L A;  1W06 A;  2Y0O A;  4JRL A;  5I8T A;  5A6X A;  1TQ5 A;  4TWT A;  1ULP A;  2P17 A;  5ACA 1;  2A3X A;  2JB8 A;  3EHK A;  1PX4 A;  4JHZ A;  3NJX A;  4COU A;  3WEZ A;  1AR7 2;  2I74 A;  2XVL A;  1LAJ A;  4LKD A;  3FC0 A;  2CHH A;  5ACA 3;  2P1B A;  4JZR A;  3VKO A;  4TLG A;  4M0H A;  5C3S A;  3L2H A;  2VZS A;  3T2O A;  5E89 A;  1QJU 2;  2XBO 2;  3BAL A;  5LA2 A;  3A0N A;  2VZ1 A;  4YW5 A;  3C3V A;  5J36 A;  4XTP A;  3UKV A;  1QJZ A;  1XE8 A;  2IXI A;  5FO8 B;  1S0B A;  2W2I A;  3LEK A;  1CAV A;  3WW2 A;  3HD8 B;  4ATE A;  1HXS 2;  5A7S A;  5FAX A;  4CXX A;  2OS2 A;  1AR6 1;  2OUJ A;  3UET A;  3R4D B;  3VDD B;  5J3U A;  1NY7 1;  1VJ2 A;  2VVE A;  1VR3 A;  2D3S A;  4AED C;  4MVT A;  5BNP C;  5JOZ A;  2WFP A;  3LEI A;  1OA3 A;  1K5M C;  3PUS A;  3AKR A;  3H8X A;  2UWA A;  1EPZ A;  1BEV 1;  1ZM1 A;  4WM8 A;  3WY6 A;  1OF3 A;  4AHW A;  3B9I A;  4CTE A;  2VBP A;  4M01 A;  1S0I A;  5ANQ A;  1H2L A;  4LNV A;  4AYU A;  1BEV 3;  1KJR A;  3GYD A;  1AHS A;  2WAO A;  1H1A A;  2CDO A;  4LE3 A;  1LOD A;  3WDY A;  4RS5 A;  1B35 A;  1UZ0 A;  2F6B A;  5HCF A;  5A7W A;  4C1X A;  2GN7 A;  2CL2 A;  4COV A;  3WNO A;  4ATF A;  5KWR A;  3LIG A;  1GOG A;  2YZ4 A;  3J8F 2;  4OHX A;  3W9A A;  2VZO A;  5F8P A;  5GLZ A;  5I0D A;  2Y6L A;  3INA A;  4FXG B;  2V72 A;  2PHX A;  3JXS A;  4WM7 A;  5IHR A;  5E16 A;  3I4I A;  1VBE 2;  2XQX A;  3RZM A;  4CEY C;  3HOB A;  3RRD A;  3IDB B;  5JPN B;  4JHT A;  4QHB A;  2YGM A;  3LPG A;  3MUZ 1;  4QDS A;  4CCN A;  4YM2 A;  1RMU 2;  3S5A A;  3WP3 A;  1UZZ A;  1IG0 A;  1UZY A;  1MAC A;  3IIA A;  1XE0 A;  1J3P A;  1H2K A;  2AC1 A;  4ARY A;  1YIF A;  5IAX A;  2ZGQ A;  4JGY C;  4EQV A;  3U0Z A;  1JYN A;  4QQL A;  1KFX L;  3AZY A;  1WA4 A;  3AKT A;  4Q4X 1;  5FYY A;  1R08 1;  5HV4 A;  2GH2 A;  4IV1 A;  4FT8 A;  4DXS A;  4LPL A;  1RUG 1;  2QJV A;  5BY5 A;  5IAT A;  4DXZ A;  3I3D A;  1ZBA 2;  3NW4 A;  4Q4X 3;  5LW9 A;  1QNY A;  2JDH A;  1R08 3;  4IE7 A;  4YM0 A;  2IVJ A;  5FMO L;  2Y26 A;  1KDK A;  4P14 A;  4WV8 A;  1YQ6 A;  2FZ2 A;  1LB2 A;  1V9U 1;  5F5Q A;  1R1A 1;  4FO9 A;  4LEJ A;  5LBF A;  1GNZ A;  3WG3 A;  1GAN A;  5DUW A;  5FY9 A;  3GZT B;  3PLQ A;  3T0D A;  2GP3 A;  4TLF A;  3MEP A;  3OTF A;  2YUE A;  1V9U 3;  4LE4 A;  5L36 A;  5JSO A;  1D4M 1;  4FI9 A;  1W0P A;  2QQK A;  2WZR 1;  4Q4V 1;  1MEC 2;  3KWV A;  3NJZ A;  2R0F A;  3HT1 A;  2YU1 A;  4AQT A;  4DB5 A;  4NAO A;  4NHL A;  2WZR 3;  2E33 A;  3ELN A;  4N9I A;  4Q4V 3;  4AQ6 A;  4J6G A;  4IV3 B;  4XF9 A;  2O8O A;  3RZZ A;  2XHN A;  4LMF A;  2W1W A;  2XL9 A;  3QH7 A;  3WNP A;  5AVA A;  1AL0 G;  1OT5 A;  4IDZ A;  2NMN A;  4DNY A;  4A44 A;  4U36 A;  4AI8 A;  2A5Z A;  3WXP A;  2R07 1;  1JZ6 A;  1YO8 A;  1RB8 G;  4COY A;  1W90 A;  5BNN B;  3Q8A A;  5M0T A;  3OGV A;  5C8C C;  4Q4Y 1;  4YGC A;  4YVW B;  2R07 3;  1LOA A;  4COZ A;  3CZJ A;  1A78 A;  2PMW B;  5LEK A;  4RQP C;  1RIR A;  3T4H B;  1BK1 A;  2BV4 A;  2W5F A;  2ZBJ A;  3GF6 A;  4Q4Y 3;  2UYB A;  4XUT A;  5IK7 A;  2YV8 A;  4JDO A;  4OMD A;  5C4W A;  2ARE A;  4XIO A;  4YVS B;  3WP5 A;  1NQD A;  3ZIW A;  1D0H A;  4ORF A;  3CF6 E;  3NJV A;  1WBF A;  1KGY A;  2O14 A;  3WDW A;  4O61 A;  4YW1 A;  5BV6 A;  2W1U A;  4FXK B;  4JKK A;  4XE9 A;  4Y33 A;  3DKW A;  4FPY A;  3H3L A;  1BYH A;  5JZG A;  1X36 A;  1W6P A;  1ACC A;  4GWM A;  2AEN A;  5D8A C;  3UL2 A;  1JYI A;  2WNV C;  2BNO A;  2DF7 A;  3VZO A;  3W5N A;  3TRS B;  4MXV A;  1WCD J;  4CEW B;  2X29 A;  2B45 X;  3KLS A;  4FPE A;  4HBN A;  4L9B A;  4XOG A;  2OXB A;  4FFG A;  1HV0 A;  4GAZ A;  1Z0H A;  1PM4 A;  2R6Q A;  4JAA A;  2A3W A;  1T6G C;  3WCS A;  2WLP A;  4B4R A;  5EYX A;  4CCE A;  1ZRC A;  1ZRE A;  4NII A;  2W08 A;  4RR3 B;  3KF3 A;  1ONA A;  3PJQ A;  5FYC A;  1UX6 A;  4CPB D;  2MPF A;  4ZKT B;  1RUI 1;  3LOI A;  2IXL A;  4AVS A;  4Q8K A;  1DQ1 A;  2ZX2 A;  5IJR A;  4Q0S A;  2DUP A;  2TBV A;  4GB3 1;  1RUI 3;  1C8M 1;  2HYX A;  1QOT A;  2P3I A;  5LEJ A;  4QPY A;  4CA9 A;  2FDF A;  2VQ0 A;  1F4H A;  2VOX A;  2WO3 A;  4GB3 3;  4Z1V A;  4IEW A;  1RUF 1;  3SC7 X;  1M06 G;  1C8M 3;  4Y1U A;  1GKB A;  5FJK A;  4H55 A;  2QQM A;  5I8S A;  5B2G B;  1SBE A;  3MV0 1;  1ZZ8 A;  3ZM8 A;  1S4C A;  2XQR A;  3X29 B;  4UBG A;  1MZE A;  1Q8P A;  2VQA A;  2DFB A;  5FO7 B;  1NXD 1;  3M3Q A;  2KXL A;  1TME 1;  1GZT A;  5FZO B;  4QM9 A;  1WBL A;  3M3C A;  4Y22 B;  4QGN A;  4AED A;  4CCM A;  3AC0 A;  3AYC A;  4PBP A;  5J48 A;  4LUM A;  1K5M A;  2QQL A;  4NAM A;  4QB2 A;  3ZSM A;  3MIB A;  4IE6 A;  3NNG A;  1LHU A;  2LUW A;  2H0V A;  4QXB A;  5CYY A;  2ZAH A;  3V64 A;  5T3N A;  4ZXK A;  5J37 A;  1UY1 A;  1UXX X;  3E6B A;  4MGS A;  4N9H A;  4I09 A;  5FK7 A;  1JMU B;  2JG9 C;  1VBB 3;  2ID4 A;  3Q8B A;  3U75 A;  3PUA A;  4NWV A;  3E5U A;  4UBH A;  1EP0 A;  3ZSJ A;  2G9Z A;  4URA A;  3NV1 A;  1JYV A;  2Q1F A;  3PL0 A;  4IEQ A;  5BXX A;  3RNS A;  2D3P A;  5CBL A;  2EXJ A;  1LOF C;  1MQT C;  4A41 A;  3GDB A;  1FPN 1;  1UYY A;  4CDU C;  4ES8 A;  2XVK A;  3KV5 A;  3VKN A;  4QKB A;  3AJY A;  2IXC A;  1RUH 1;  1U5Y A;  3Q9O A;  2OPW A;  3HMY A;  3MPP G;  4QX7 A;  4BQ1 A;  4AAP A;  4NRO A;  1RUH 3;  1SFN A;  4IEV A;  3N9L A;  1RVF 1;  4AVC A;  4CCO A;  5CNA A;  1WD4 A;  3OYW A;  4HN0 A;  1QGL A;  1OKQ A;  5A32 B;  5A3M A;  2VCB A;  2FMD A;  2PTM A;  1TMF 1;  1X82 A;  1JOB A;  1LUL A;  1QJY 2;  1GZC A;  4S2H A;  1FOD 1;  3BU0 A;  1RJ8 A;  4BQ2 A;  4ZXE A;  1QOO A;  2DBN A;  1PZ7 A;  2ETE A;  3MW2 A;  3PVN A;  1TMF 3;  2L9L A;  1FOD 3;  4BLJ A;  4QX8 A;  1CAW A;  1GZ9 A;  1H4G A;  3IMN A;  2E9Q A;  1C8N A;  1GP4 A;  4YWA A;  3S7E A;  1KS5 A;  4L97 A;  2EXH A;  4GH4 B;  2LAL A;  2G4I A;  2ENR A;  4GAL A;  4QPI C;  5A33 A;  3VBR B;  5C7G A;  2R30 A;  2BWA A;  4XDP A;  1DGL A;  1YLL A;  2LS6 A;  2ZGR A;  1M4W A;  4TXW A;  2PHW A;  1OKO A;  3WZ1 A;  3UK9 A;  5HV0 A;  5K0U B;  2IXJ A;  4HSJ A;  2VAU A;  3N9O A;  4IQP A;  1YJK A;  3AVR A;  4ZZ5 A;  1Q56 A;  2JIG A;  2VC9 A;  1A6C A;  3N7M A;  1US3 A;  4OHY A;  3ES4 A;  1WW4 A;  4BIF A;  2XUM A;  4CDW C;  1AYM 1;  4OFG A;  5H9P A;  1O8P A;  4QU2 A;  3ACG A;  3T4V A;  2QQI A;  2B7Y A;  1CPM A;  2RMU 2;  4KI5 M;  3OBT A;  2HWE 2;  4HT1 T;  5DUV A;  4E8D A;  2JDU A;  1CZV A;  1DFQ A;  2I07 B;  2VPV A;  1AYM 3;  2E7Q A;  2UWC A;  5C8C A;  5CIR A;  1NXM A;  5FBJ A;  2A6Y A;  2PLV 2;  1RIN A;  1BK0 A;  1XOY A;  2DCK A;  4RQP A;  3HNB M;  2VUD A;  1W03 A;  3ZOI A;  1H8T B;  3K46 A;  5FZ7 A;  4NHX A;  1OA2 A;  4N7U A;  3WDU A;  1JTZ X;  1BQP A;  2OZ6 A;  4A7Y A;  3RMX A;  3MIC A;  4KNC A;  3VHR A;  3NKT A;  1J1L A;  3OG2 A;  4A6O A;  4M0N A;  2Y6K A;  2XBO 1;  1AR7 3;  4EN7 B;  4LBQ A;  1VMH A;  5EFU A;  4DRR A;  4Q8L A;  5ACA 2;  1RUC 1;  3VLB B;  2DCJ A;  1C1F A;  3PHM A;  2XBO 3;  1W6M A;  3RI8 A;  2VZU A;  1UO9 A;  4HON A;  4OI4 A;  5KHG A;  1RUC 3;  3DL3 A;  4YGB A;  3ROU A;  4I0W B;  4XCB A;  4BHP A;  5C9A C;  1G9B A;  3LKJ A;  4W8J A;  3VD5 A;  2D6K A;  3WT3 A;  3QOP A;  5CFD B;  1HXS 3;  3ZXA C;  2BZD A;  3USS A;  4FPO B;  1F5J A;  3MLK A;  2EAL A;  1Q8S A;  1V6M A;  2HH9 A;  4TYS A;  1UPS A;  5G04 L;  3E6D A;  1CON A;  2FD8 A;  5I0S A;  3U10 A;  1HJG A;  2ZEY A;  4AQS A;  1QQP 2;  1AJO A;  3KB5 A;  1AR6 2;  4OHW A;  3I59 A;  4FCA A;  1NY7 2;  5HXV A;  4B29 A;  1G9F A;  4LBJ A;  3I8T A;  2Q1Z B;  3OUI A;  1BEV 2;  3FHA A;  5L7O C;  1RED A;  1S0D A;  1NE4 A;  2BBA A;  1Z7S 1;  2V5D A;  2C5D A;  4QMA A;  3D8C A;  2CY6 A;  1LJ7 A;  4XJW A;  4CCJ A;  1Z7S 3;  3J8F 3;  1SLB A;  3OUH A;  3RG0 A;  5CFC B;  1VBE 1;  4BYY A;  3F95 A;  4DS0 A;  3LB9 A;  1GQP A;  4HL0 A;  4BH9 A;  3M8L A;  4YW6 A;  2D6N A;  2XPJ A;  4PLM A;  3N9M A;  3V0B A;  4F3J A;  1XBF A;  2DCZ A;  1VBE 3;  3OGJ A;  4EE2 A;  2ZMN A;  3EYP A;  1WZX A;  2DDU A;  1CQ9 A;  4HPK B;  3RYP A;  4A2U A;  3IPV B;  1X33 A;  4YNI A;  5BPX A;  1AX0 A;  1DU3 D;  4KMQ A;  4XBQ A;  3VBU B;  5LY1 A;  4BLI A;  1ND2 B;  5LBC A;  1LOE A;  2PQQ A;  3OY8 B;  2BW8 A;  2VL4 A;  4GMP 0;  5FZK A;  4FSJ A;  1HJF A;  1QJF A;  3N7K A;  4PDW B;  1QU0 A;  1SCR A;  2JG9 A;  4N90 A;  5FP8 A;  2VMD A;  5JMC A;  4LO6 B;  3IBM A;  1Q8Q A;  4PQ9 A;  3ZYP A;  3ZR5 A;  3P3P A;  2XH6 A;  5LRR A;  4YYO A;  1YYN A;  3VD4 A;  3RQ0 A;  3V65 A;  5FY7 A;  1MQT A;  1N1V A;  5LA0 A;  3LWC A;  1RUG 2;  1VB2 A;  2D5H A;  4L2N A;  3ZKU A;  2PHT A;  3OEA A;  4UW4 A;  2ILM A;  4MUV A;  2KM2 A;  4CDU A;  2R06 1;  2GH8 A;  3D82 A;  2PHU A;  5KHH A;  2W95 A;  5T55 A;  4BME A;  4DUV A;  5C71 A;  3OEB A;  4DQA A;  3AK0 A;  4FQZ A;  4EN0 A;  2GNB A;  5J98 B;  1V9U 2;  1S0F A;  2R06 3;  3VBO C;  1R1A 2;  5BYN A;  5ANN A;  4MXW A;  1VIW B;  5HCA A;  4Y1Y A;  4D7Y A;  5DZG A;  1Q5O A;  4MGY E;  4D7T A;  1D4M 2;  5T5P A;  1YNA A;  2VOT A;  1DQ6 A;  5DPN A;  4BQW A;  3RZK A;  2WRA A;  3ACH A;  3BPZ A;  3OD4 A;  2DVD A;  3NNJ A;  4AHY A;  5BNO B;  3DKQ A;  1O6U A;  2VY0 A;  3MIH A;  3FJS A;  4FOV A;  4P9G A;  4FP2 A;  2VCA A;  3K48 A;  2CTV A;  5F3E A;  3RSJ A;  5C6C A;  2WT0 A;  1RL3 A;  4LBK A;  3TAY A;  1XJA A;  3T3Y A;  3LOB A;  4N7I A;  1UMH A;  1QJE A;  3BTA A;  4XAB A;  2A1X A;  1LGB A;  3AJZ A;  5LBE A;  1STM A;  5A80 A;  4LA3 A;  1NA1 C;  3FE5 A;  3U4S A;  3WF3 A;  2RS5 1;  5I91 A;  3K4A A;  4NHM A;  1LHW A;  1GU3 A;  4CRQ A;  3LA7 A;  3AYE A;  3WIN E;  2VQU A;  2RS5 3;  4WVM B;  4CDX A;  4Q4Y 2;  5JOW A;  5JI7 A;  1FMD 1;  5FY8 A;  5KC5 A;  2B46 X;  1O8S A;  2ZS6 B;  1YFY A;  2G1M A;  3KS7 A;  4D0Q A;  2DV9 A;  4MGZ E;  1VBA 1;  1FMD 3;  3E1F 1;  3VBH B;  4C91 A;  1J3R A;  1XYN A;  2J1A A;  2QE3 A;  3PU3 A;  4I02 A;  5FXZ A;  3MW4 A;  4Q2F A;  4R9C A;  5L19 A;  1REF A;  5T5J A;  3AVS A;  2A6W A;  2YGL A;  1HLC A;  1VBA 3;  3J26 N;  1H2M A;  4B8E A;  5KHJ A;  1OPM A;  1W6Q A;  3CBN A;  2WQZ C;  5ABJ A;  1GFF 2;  4Y20 B;  2ZGP A;  3T2P A;  4HSL A;  5A3U A;  4MO3 M;  1R1Z A;  3V0A B;  2RS1 1;  3J4U H;  4PLN A;  5FZ0 A;  2XDV A;  1UIJ A;  3SH3 A;  1SLT A;  1I1E A;  1N1S A;  1PM7 A;  5F1R A;  5EXO A;  2HWB 1;  2LTN A;  4IXL A;  3POI A;  5A1F A;  3ST7 A;  5IT6 A;  4XBL A;  2YDE A;  3HQU A;  4HKO A;  5IWF A;  3ZYJ B;  3M3E A;  5FXV A;  5A70 A;  4NID A;  3HJR A;  1MVQ A;  1GV9 A;  3JQX A;  1O5L A;  1VBD 1;  2Q4S A;  4B7E A;  2HWB 3;  4IE4 A;  4K21 A;  5JCT A;  4YPJ A;  4WM8 C;  1UKG A;  4K8F A;  3N9P A;  2FCT A;  3P1I A;  2VBB A;  4I3P A;  1JUH A;  1VBD 3;  4I01 A;  5AC9 2;  4L0P A;  2QTW B;  4GB3 2;  2QKD A;  2ZAA A;  3BYW A;  1DZQ A;  4HAN A;  1C8M 2;  2WBK A;  2ZTN A;  4MET A;  4PIZ A;  4XIL A;  1PX3 A;  1W6N A;  3ZFE B;  5FCC A;  3M3I A;  5A3T A;  4LHK A;  3KM5 A;  3RPQ A;  1VMF A;  1RUF 2;  3IZO A;  4N53 B;  2ADE A;  3E5X A;  3O0X A;  4OZO A;  2X5I A;  4Z82 A;  1OXC A;  2ORZ A;  4MGK E;  4WZF A;  1ND3 B;  5FZB A;  4QHO A;  1EAH 1;  1NCR B;  4IES A;  2QZ3 A;  1YC6 1;  4JQR A;  4OCT A;  2JDY A;  4UXA A;  4AL9 A;  1SZB A;  2XON A;  5K4L A;  4AVA A;  5FY0 A;  1VAK A;  1TME 2;  3FFQ A;  4M4P A;  4OHZ A;  1EAH 3;  2VD7 A;  2VNO A;  3MHZ A;  5LZ6 A;  5IVE A;  1F2N A;  3UYJ A;  3WQ7 A;  5CA6 A;  4R52 A;  4M3C E;  3VKF C;  2DTY A;  2WNE A;  4E8C A;  3SIS A;  1AYN 1;  5L7O A;  4QB1 A;  3AP4 A;  3TB0 A;  1O3Q A;  4IND A;  5L73 A;  3FBY A;  2ZKN A;  4NHY A;  4RYD A;  4YZ4 A;  2DCT A;  4IV1 C;  2YBS A;  3I2O A;  2Q8D A;  1AYN 3;  2GDF A;  1WW5 A;  5A6Q A;  2FQP A;  4BA6 A;  2A6X A;  1SCS A;  3ZVX A;  3O1P A;  1POV 1;  3BUC A;  1UX7 A;  2XJS A;  2GU9 A;  2BNN A;  4DZG A;  2CV6 A;  2FDG A;  1SFP A;  3ABZ A;  2GME A;  2RG4 A;  4N43 A;  3O12 A;  3GBG A;  2XJV A;  2GC0 A;  1UKR A;  1FPN 2;  4P08 A;  3ZFG B;  1QMJ A;  5FPU A;  3ECQ A;  2GNM A;  1RUH 2;  1PNG A;  2X8K A;  1OD3 A;  4JRA A;  5D1I A;  5FYZ A;  1D2S A;  1UIK A;  2HBU A;  4QXK A;  3HBK A;  4XPV A;  2QQP A;  3OUJ A;  4UWD A;  4Z2A A;  4Q27 A;  3SLI A;  4D6R A;  5A3P A;  4E27 A;  5B4N A;  1GQH A;  5FLJ A;  2HEW F;  5FMO S;  4CU9 A;  2VH9 A;  4BDV B;  1W2O A;  3HPN A;  1K5J A;  1S1A A;  3NVC A;  1RVF 2;  3OJB A;  4LK7 A;  5KBF A;  3EBR A;  2XLA A;  1DLL A;  1DGW A;  4L99 A;  4KU7 A;  1W8H A;  3K2O A;  3LDK A;  1ZA4 A;  4NOT A;  2HWD 1;  4QD2 A;  2YYO A;  5DAQ A;  3FBM A;  1PZ8 A;  3W58 A;  2VZR A;  4GWN A;  4S2G A;  1TMF 2;  3EMR A;  2RDS A;  3FZ3 A;  4IW3 A;  1FOD 2;  1YIP A;  3D0J A;  2HWD 3;  2HJI A;  2VZV A;  4A3X A;  2FDK A;  4QPW A;  4AI2 A;  5DAV A;  2TEP A;  1S0C A;  2BOJ A;  3KGL A;  1JH5 A;  1I5Z A;  4RFT 0;  5FRE A;  3RZG A;  4ZU5 A;  4DRV A;  1H6Y A;  3PJY A;  3R6S A;  1HQN A;  4Y26 A;  1VPH A;  5HXM A;  2ZMK A;  5T54 A;  4AGR A;  5GZC A;  3NAP B;  3SKV A;  4ASK A;  2BPA 2;  1V0A A;  3ILR A;  3UJQ A;  5EP9 A;  3ASI A;  4E9K A;  4DOU A;  2NP0 A;  3VDB A;  1QKQ A;  1UMI A;  2HWE 1;  2JEC A;  3NWK A;  3P6B A;  3H42 B;  2OA2 A;  1DYK A;  1XNC A;  2WQ8 A;  3D6E A;  3FLR A;  1GZW A;  3KHC A;  2JE9 A;  4ISR A;  2QDR A;  1BBT 2;  1VRH 2;  2HWE 3;  2RMU 3;  2VZ3 A;  3CO2 A;  1NA1 A;  2LW8 A;  1CIW A;  2XHK A;  4GQ7 A;  1AYM 2;  5EQU A;  4XUN A;  2QQV A;  5JXI A;  3JU9 A;  3KHB A;  4QAW A;  4P00 B;  1LNS A;  4NN0 A;  3Q8F A;  4AGV A;  4LO4 B;  5JOY A;  2AGS A;  2Y33 A;  4LIV A;  1JXN A;  2C24 A;  1L3J A;  2ZGS A;  3EB7 A;  4X6R B;  3UV9 A;  4GZ9 A;  2PQS A;  4HVQ A;  1JZ4 A;  1HQW A;  2SLI A;  4P9J A;  2DVG A;  2B9U A;  3THT A;  1SDD B;  4RD7 A;  1PVC 1;  3VHN A;  4AFD A;  3H8O A;  4JTO A;  4AG4 A;  2Y34 A;  4PBO A;  3AMP A;  1QDC A;  4AFA A;  5FOB B;  1PGS A;  4YW3 A;  1RUJ 1;  1PVC 3;  2DUO A;  3MO4 A;  1J1T A;  4FP3 A;  5FR3 A;  2VMH A;  5JXJ A;  1HB4 A;  2DWR A;  1TE1 B;  4XHB A;  3RZL A;  1LEM A;  5C3R A;  1MZ5 A; 
#chains in the Genus database with same CATH homology
 1OUX A;  2BOJ A;  2JDP A;  2JDM A;  2XR4 A;  3DCQ A;  1GZT A;  2JDN A;  5D2A A;  2VNV A;  2JDH A;  5A3O A;  4UT5 A;  3ZDV A;  4CE8 A;  5A6X A;  5A6Q A;  2JDU A;  5HCH A;  1W8F A;  2VUC A;  1OVP A;  1OXC A;  1W8H A;  2WR9 A;  1UZV A;  2CHH A;  1UQX A;  1OUS A;  2WRA A;  2BOI A;  5A70 A;  1OVS A;  2JDY A;  2VUD A;  2BP6 A;  4AOC A;  2JDK A;  5A6Z A;  1OUR A;  5A6Y A;  2BV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...