2GALA

Crystal structure of human galectin-7 in complex with galactose
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
b'VPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-7
publication title Structural basis for the recognition of carbohydrates by human galectin-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 29
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2galA00
2ZHKA 1QGLA 4XDQA 4P9WA 2CL2A 4F83A 2BQPA 2E51A 2R1BA 3IMNA 3QCWA 4DPNA 3IPVA 3AP5A 2D3SA 1I3HA 1ZA4A 2NP0A 1JN2P 5JOXA 1DYPA 3FLRA 3PVEA 4PBPA 4XJ9A 1UZYA 1N1VA 1C1LA 1VLNA 4KBBA 1AXKA 1WD4A 4R9BA 1MZ6A 3RMYA 3VKLA 1LCLA 1AX0A 1WUVA 2D7FA 2NM1A 1XQNA 1F9KA 3NV1A 2CY6A 3PVNA 1CR7A 1W6OB 2JE7A 3O0XA 5HCFA 1W6NA 1SLAA 1BYHA 1G9DA 5DUVA 4XXAA 4HANA 5AVAA 3ZYRA 4Q26A 2GMPA 4WVWA 4JC1A 1A8DA 3USUB 1LODA 3ZSMA 4DFSA 2D43A 1LHOA 2P2KA 5CNAA 4Z8BA 5CA6A 1LEDA 1DFQA 3POSA 2DV9A 4Q27A 3WV6A 2E7QA 2A7AA 2VH9A 2ES3A 4DQAA 4LBMA 4Y22B 1LHNA 3NV3A 1O4ZA 3AYCA 3JU9A 4U36A 1DZQA 3ZSLA 5KXCA 1V6KA 1F31A 3N7LA 3POWA 1PZ8A 5DZEA 4XJZA 1D0HA 3WG4A 1S0EA 2WT2A 1WCSA 1SLBA 5GZEA 4DRRA 2NMNA 3AZXA 3T1LA 3M3OA 1BQPA 1G8WA 3VKOA 1R1ZA 1GSLA 4WV8A 5GLVA 1S0BA 1DQ2A 1SBDA 1FX5A 2R0HA 4XE9A 2YV8A 2ZGTA 2E53A 4RA0A 1D2SA 3AXDA 4Y1UA 1ULEA 2OVUA 3CNAA 5KXBA 3AXEA 2ZABA 2ARXA 2ENRA 4Y1XA 2EXIA 3D5OA 3IM0A 4AGGA 4BPZA 2A6ZA 5IT6A 3M3CA 4ITCA 2ZZJA 3OJBA 3N7MA 2JKBA 1N1TA 3V0BA 2DU1A 3N7KA 3VKMA 2P3KA 4M3CE 1KITA 5T52A 5DZFA 5EWSA 1WW6A 2GNMA 2YROA 1H9WA 4FP2A 4XJAA 5E89A 5H9RA 1NLSA 3B00A 1HDKA 4YW1A 1LOFA 4YW4A 1FATA 1MS5A 1WD3A 3OY8A 1AX1A 3PMEA 4XXPA 1IS6A 4M01A 5FREA 4CRQA 4FOQA 4XHBA 5FRAA 3RSJA 1GKBA 1ULFA 3WNXA 3WDWA 1ONAA 3T1MA 3AP9A 1Z0HA 4Y20A 1ULDA 2C5DA 2V5YA 5T54A 4NOTA 2JDZA 1YXWA 4XILA 3M3EA 3N35A 4K21A 3MW2A 4K1YA 2EF6A 1URXA 3UL2A 1O4YA 3AYEA 3ZVXA 1KDKA 1W6QA 2A70A 2DUPA 1WBFA 1IKQA 2HYKA 1OKQA 1QDOA 4PBOA 3N3HA 2Z42A 2ZHLA 2C9AA 1LESA 3AFKA 3ILFA 5F9TA 3D4KA 2GMMA 2ZGMA 4M3CF 2AH2A 1N3OA 5DXDA 1EPWA 1HQWA 2CTVA 2YY1A 1UL9A 3ZXEA 1U0AA 3WG2A 3H0OA 3O0VA 4FPCA 2EIGA 4YG6A 3WDUA 4YM2A 3WVJA 4U2AA 5E8AA 1AXZA 1AJKA 5DG1A 5GALA 1C4RA 4FVVA 2DUOA 1AF9A 4PF5A 1OQ1A 2E6VA 1W6MB 1LOFC 1CPMA 4XIKA 3INAA 2VW2A 2NMOA 2P3JA 4UW4A 4XTPA 4K1ZA 2P34A 4BMEA 1S0GA 4YFZA 1IS4A 2DWRA 4AVTA 1TEIA 4AYUA 5CAZA 1WLDA 2ZMKA 3ATGA 3HR9A 1UN1A 3ZYPA 3MW4A 1DQ4A 4D69A 2DYCA 1SLCA 2P3IA 2A3XA 2D3PA 2PHXA 3HN1A 4XIOA 4YZ1A 1G9BA 2I2SA 2AUYA 3WCSA 2EALA 1VALA 1W6PB 2JJ6A 4GWMA 4LBQA 4GXLA 2DVAA 2D6MA 4IQPA 3N36A 3ZXJA 5JDBA 4AGVA 3FBYA 5EYXA 1BJQA 5CBLA 1OFSA 5LK5A 5GZFA 3RMXA 1QMJA 1V6IA 1N1SA 3VV1A 4ATEA 4BOWA 4YFWA 1Q8SA 1QOSA 2GN7A 2WLQA 1MACA 1PZ9A 2D6KA 3ASIA 5IK4A 4XBNA 4UW5A 3SISA 4K20A 2D6OX 3WDTA 2OUHA 4YLZA 3O0WA 1F5FA 4XHXA 4NO4A 1DBNA 2CWSA 1GBGA 2WT1A 1LHVA 2ZGLA 4H55A 2DVDA 3FLTA 1UAIA 4FPHA 2OUJA 3KM5A 3FUQA 4Q2FA 3UK9A 2ZGOA 3ILRA 4YZ4A 1PZ7A 2DU0A 4MYEA 4AGRA 4GKYA 1WW4A 3ZPYA 2GMEA 1W0OA 3OPZA 3IPVB 4FPKA 1QNWA 2ZGSA 4TYSA 3ZSKA 1YI7A 4UW6A 2NN8A 1LEMA 3C2UA 4UW3A 3WHUA 1RIRA 1I1EA 3AP7A 2WSUA 3POYA 3ZXFA 1CESA 1A3KA 3FUOA 2D6LX 3U4XA 1GZWA 3VUOA 3ILNA 5JOWA 3D6EA 3WHTA 1C1FA 2GALA 2PHTA 1N3PA 2NYYA 1Z78A 1BXHA 1BZWA 1QNYA 1W6NB 4PQ9A 3WDXA 1S0FA 3WZ1A 1JOJA 4OZXA 3R4SA 1KQRA 3IKWA 4I30A 2R1DA 5GLZA 2GDFA 2D44A 5KXDA 1MZ5A 1VIWB 1Q8OA 2VW1A 3W58A 2WNEA 5IK5A 1J1TA 1Q8PA 4Y26A 2RHPA 2A6WA 1SLIA 2H0BA 1QDCA 1KJLA 2FMDA 4YGEA 1S0CA 2VXRA 4FPEA 3GALA 3BOPA 2VW0A 4C1WA 1LHUA 1IKPA 1V6MA 2WQZC 3WUDA 5T5PA 4HL0A 2PHRA 1ENRA 4YM3A 1FV3A 1LULA 4ISQA 4FPGA 5HCAA 1ENQA 1G86A 1MS1A 1LGNA 1N3QA 1LU1A 4P9XA 4AVSA 2WKKA 2A3WA 3GNEA 2YZ4A 5DG2A 1G9FA 3HMYA 2CYFA 3V0AA 4Q1PA 1GICA 2WT0A 2UWCA 3M1HA 3V64A 3B3QE 1CIWA 4BLJA 1UPSA 3NV4A 1MS0A 3R05A 4FOYA 2WSVA 2D3RA 4Q8LA 1GV9A 1GNHA 1WLCA 1JXNA 2AR6A 2ZHNA 1SLLA 1UX6A 1QOTA 4M3CA 1HQLA 4LBJA 2TEPA 2A5ZA 1MS8A 1DYKA 4LBQD 1CVNA 1SCSA 2CNAA 2ZMNA 4YGDA 5E88A 3R4UA 5GLWA 3V0BB 2AYHA 1HKDA 1V00A 2VUAA 1JYIA 4R9AA 4W65A 5L73A 4YG3A 1VAVA 2ZGKA 1KRIA 1FNZA 3AZYA 5JOZA 5DZGA 2DVFA 4AWDA 2E7TA 3OY8B 2UWAA 4LBLA 3WG3A 4FPYA 3SNMA 1V6JA 1ZM1A 3T2TA 2A6YA 3AX4A 2PHFA 2EXHA 1N47A 4Y20B 3AJZA 2AREA 1CQ9A 2ZGUA 4XMIA 4WVVA 1GZCA 3WOGA 1LTEA 3M3QA 1KJRA 2ARBA 1H30A 1JUIA 1WW5A 5H9QA 5T55A 4WZFA 3SH5A 1SFYA 1W6QB 4JRAA 2DVBA 4GKXA 2XB6C 5H9SA 5JMCA 5DUXA 3AYDA 1SCRA 4FQ4A 4AVVA 3OGGA 4Y1VA 3V65A 4BM8A 1QU0A 3AP4A 3AZWA 4PCRA 4ZXKA 3ZXKA 1DLLA 2DURA 3SH4A 3ENRA 5JOYA 1QOOA 1HLCA 1KDMA 5T50A 1WBLA 1GNZA 3USUA 5GM0A 1Q8QA 2P37A 3LSDA 1JYCA 2ZGPA 3WDYA 1FAYA 1SLTA 2AGSA 3M2MA 2ZKNA 1LJ7A 5JVVA 2YXSA 4YGBA 2A6XA 4Y1YA 4Y22A 3WLUA 4ZKTB 5T5JA 4FPOB 2D6PA 4P14A 1G9CA 1MS4A 5EXOA 2PELA 2SBAA 3AZVA 1AZDA 1GLHA 5SV8A 2LTNA 2ZMLA 2JD4A 4BMBA 2GNDA 3PJQA 1ENSA 4FQZA 5IK8A 4XMAA 2R16A 5KXEA 1LENA 1C57A 1DGLA 2EAKA 3B69A 5IUQA 2ZAAA 1Q8VA 3OBRA 4LBQB 4YW5A 5H9PA 3LCPA 1SACA 1SBEA 5GLUA 3AP6A 1LOBA 3UJOA 1FYUA 3ZXLA 4Y1ZA 2ZBJA 3I4IA 2YMZA 3MEPA 1GANA 3N7JA 4XTMA 5EYYA 4R9CA 1DQ1A 3WG1A 4BLIA 5HCBA 1RINA 1S0IA 2A75A 3RG0A 3UJQA 2FHRA 4SLIA 1CONA 4M00A 1AX2A 3QLQA 4FPJA 1LU2A 1MS9A 4XZPA 4FP3A 2AENA 4YM0A 1YO8A 2R0FA 2W68A 4FPLA 1JHNA 4RL7A 1LGCA 3MW3A 1V6OA 4XYXA 1LGBA 3FFZA 1FNYA 4ISRA 1UKGA 1DQ5A 2ZGNA 2ZA9A 1DIWA 1BKZA 4L8QA 4YM1A 2CWMA 4XBLA 2R49A 1G9AA 1LOAA 2ZACA 2JE9A 4CZSA 1UMZA 2EXJA 1MVEA 1N1YA 3Q9OA 2GN3A 4XJ8A 1V6LA 1LHWA 2A6VA 1V6NA 2GNTA 1ULCA 1WW7A 2OW4A 2PHWA 3O12A 1YRZA 2ZGRA 3VKNA 1ULGA 2PHUA 4YG0A 2W39A 1LOGA 3AK0A 5GZDA 3RQ0A 1IOAA 1LECA 1CN1A 2VU9A 3SLIA 2DVGA 1MVQA 1GZWB 1NXD1 1SBFA 4Y24A 3WCRA 1JBCA 2LALA 2GNBA 1S1AA 3DGTA 4GWNA 3O5SA 4XJUA 3NV2A 3RS6A 4BQ1A 3AZZA 4R9DA 1VAMA 1QKQA 2G4IA 4LBOA 4XJWA 5GJ6A 3AJYA 2DTWA 4LBKA 2DTYA 2UURA 3TAYA 3WDVA 1GYKA 4GA9A 2NZ9A 1IS5A 1B09A 4YW3A 1S0DA 4P9YA 2WJSA 4YZ2A 3I8TA 3VKFC 3RRDA 4YZ5A 4XBQA 1DQ6A 1IS3A 1Q56A 4FOVA 4FOWA 2ZHMA 1W6MA 4YGCA 1S0JA 3LSEA 5DUUA 3BODA 4DS0A 1APNA 1GZ9A 2KM2A 2A71A 1LOEA 2DUQA 4YZ3A 3W59A 1RITA 2VY0A 3ZSJA 2UU8A 3BIWE 3OYWA 5T5OA 2JECA 1Y7BA 2UWBA 1A78A 1FV2A 3B01A 3A4UA 3L2YA 3TB0A 4ASMB 3A0NA 1CPNA 5GZGA 3V0AB 3PVOA 3SITA 2SLIA 1MS3A 3MPPG 3FLPA 2W52A 3OBTA 4GALA 4C1XA 1W6PA 1AJOA 2V73A 2EXKA 2D6NA 4FPFA 1YYNA 1WLWA 3B9CA 3BTAA 5GZCA 2A3YA 3WUCA 2B7YA 5IK7A 4Q1RA 3APBA 5GLTA 4XOGA 2XG3A 5CB7A 3KQRA 3IN9A 4Q8KA 1YIFA 3JUUA 5F5QA 4DRVA 3AYAA 1DQ0A 4M3CB 1H9PA 1W6OA 1QF3A 1LOCA 2ERFA 1X50A 4TZDA 1G7YA 5BYNA 5JLVA 5T5LA 4LBNA 5DUWA 2W08A 4YW2A 3SH3A 4CTEA 1AXYA 3NWKA 1AVBA 2Q5TA 3DUIA 1MR5A 4JCKA 1UZZA 1W0PA 3OYWB 4ATFA 1DHKB 2ZGQA 1JW6A 1CJPA 3A0KA
chains in the Genus database with same CATH superfamily
3NAPC 1AR81 3CMGA 2ZHKA 4JVAA 5A3UA 1OLMA 5JCTA 4LHKA 5FPBA 3OGVA 2CL2A 4F83A 2RS13 3RZKA 1VBD3 3MO4A 3QCWA 3IPVA 2PMWB 5C9AC 2D3SA 2B39A 4LE3A 4JHZA 3IWZA 4MO3M 5FV3A 4EYUA 5JOXA 4XJ9A 1O3SA 1UZYA 3GDBA 1C1LA 4KG0A 2RS11 4RFRB 1AXKA 3OEAA 1VBD1 3LKJA 1AX0A 1WUVA 2D7FA 2K0GA 4HLTA 5FPLA 1UYPA 4D7SA 1XQNA 4WVMA 1F9KA 3POGA 1ZA7A 3NJYA 1FMD2 3O0XA 4HBNA 5HCFA 4E4ZA 1G9DA 5DUVA 3WF4A 3ZN6A 4QHOA 3CL1A 4HVOA 1NUKA 3K4ZA 1UXZA 2GMPA 4ZS3A 4AHWA 4JTOA 4BZ4A 3S57A 4MLOA 1AL22 1YLLA 2A1XA 4Q4Y2 4AI8A 3ZSMA 2VL4A 2D43A 4AXOA 1XNTA 3ACGA 4N9HA 5FZDA 1LEDA 2G1MA 1YQCA 2VAUA 4OULA 1IGOA 5CA6A 2E7QA 2A7AA 3NKGA 2VH9A 1EPZA 2ES3A 4S2DA 1XNKA 3S0MA 2WRAA 3H3ZA 2XH6A 3D0JA 4LBMA 1I6XA 3TBDA 1RVF3 1OH4A 1LHNA 3B94A 3NV3A 4OI0A 1O4ZA 1H6YA 1ZX5A 4U36A 3SC7X 3L9JT 4FAGA 3S30A 1NG0A 3EXUA 4RQPA 2E7AA 2JB4A 1RVF1 4JKLA 1S0EA 2QVSB 3MPBA 2NMNA 3AZXA 3M3OA 3JQXA 2HWD2 3VKOA 1R1ZA 3KHBA 2W5FA 4JGYA 1S0BA 2VCMA 2XUMA 1RUOA 5DAPA 4DUVA 5CFCA 3PUSA 1RUF2 3IAQA 2YV8A 1UOJA 2BTVC 3WP5A 3KCYA 3OPTA 4Y1UA 3ZIXA 2OVUA 3CNAA 3MLKA 3AXEA 5FZIA 4NIIA 2ARXA 4Y1XA 4DMIA 2WZR3 1PHMA 1UMHA 3IM0A 2VMDA 4QDRA 4AGGA 1J3RA 2YDEA 1IG0A 4BPZA 3H8XA 3M3CA 3N4MA 2PLV2 2VE1A 3OJBA 3RZLA 2AZ5A 3HT1A 1DLCA 3N7MA 3RGBA 4BQ5A 3V0BA 2VXJA 1NZIA 3N7KA 4QHZA 2P3KA 4H7MA 2DFCA 4QT6A 4V2WA 4AVAA 5DZFA 3W5MA 2WZR1 2YROA 3LPFA 1QJY2 1J84A 4XJAA 4QX3A 1W8FA 2IZWA 2VGDA 1PO12 4YW1A 5C5UA 2DCJA 4CP1A 1FATA 1MS5A 1WD3A 1O3QA 2HWC3 1E57A 4UF0A 3KD4A 4CRQA 3LEGA 5FXVA 3RSJA 1GKBA 2LW8A 1ULFA 3M8LA 3QH6A 3WNXA 4MGYE 4ES8A 1ONAA 1UYZA 4Y20A 2E31A 2C5DA 4BDVB 2HWC1 2DCZA 2JDZA 3AL6A 4O9EA 3VD9A 1UY2A 2BVVA 5I0SA 2EF6A 4Q0VA 2Y26A 1O4YA 2YC0A 3FE5A 4KWJA 3ZVXA 4BK4A 5KC6A 1UYYA 5FBZA 1JHJA 1W8OA 4AFDA 2A70A 3HBZA 3RDIA 3UGFA 1VBC2 3LWCA 1QDOA 4PBOA 3JBG3 4YVSC 3HVDA 2ZHLA 4NHLA 1UF2C 2QQWA 4E4HA 2GC2A 3D4KA 1CAVA 3LEIA 4LEJA 2AH2A 1EPWA 5FLIA 2XJVA 3RNSA 2G9FA 2QFEA 2QZ3A 3WG2A 4FPCA 2XOMA 2JDPA 5FKCA 1UZ0A 4AFMA 3JBG1 3ST7A 4ES9A 1PX4A 5IFPA 3AVSA 5DG1A 4QX5A 4FVVA 5LBBA 2XVLA 2CU5A 2J42A 4OUMA 4UF0B 1W6MB 3GZEA 1HB2A 1LOFC 2VZRA 1OOPA 2B5HA 1PMHX 4XIKA 2NMOA 4BMEA 2P34A 4OHVA 4AVTA 1TEIA 2XWBB 5CG8A 1XU2A 4ZONA 3WX5A 1OVPA 2J7MA 3GZAA 1QWRA 4K9SA 1WA4A 2J22A 4ZU5A 1DQ4A 2UY9A 3WINE 2DYCA 4TLGA 3BKZA 2D3PA 4AZZA 1O3TA 2W1QA 2VG9A 2RM22 3WCSA 1W6PB 2QQJA 2JJ6A 3FBMA 3LQCA 4GWMA 4LBQA 5FMOL 1TME2 2XL9A 3VHNA 4XF1A 2BYVE 4YNIA 2O0OA 4CDXA 3PTYA 4JTNA 5EYXA 1W2UA 3ES1A 5CBLA 2VMIA 3KMHA 4MGZE 4GH4C 5GZFA 4CCLA 1QMJA 1GOGA 4LHNA 3PMSA 1BCXA 3U10A 4CDWC 3OOXA 4NRMA 5AFEA 3E5QA 4L9BA 1FMD3 2D6KA 3NL1A 4CDUA 2ZXQA 4HMZA 1RC6A 1OOPB 5J09A 2D6OX 4H2AA 3O0WA 1F5FA 1OBNA 3PL0A 4Y33A 4AEDC 4NO4A 1DBNA 3JZVA 4DINB 5BNNA 4JQTA 1FMD1 4H55A 2DVDA 2L9LA 1AL23 4Q4Y3 5BPXA 5K0UC 4WM7A 2HLEA 2QDNA 1DZRA 2ZGOA 3ILRA 1TZOA 2DU0A 4MYEA 3BYWA 4GKYA 4B7EA 2W92A 3PJYA 3OPZA 4D6QA 3I49A 3VBHB 2D5HA 1AL21 1D2QA 4Q4Y1 2NN8A 3C2UA 3E6BA 1NOVA 4AVBA 4QQ2A 5LWBA 2WSUA 4L92A 4TXWA 1STMA 4EWEA 1DF0A 3U4XA 2PAMA 5IVJA 4P9IA 5JOWA 4ASLA 4YRDA 3OB8A 3LFIA 2ZX0A 1C1FA 1JUHA 4J1XA 4F8AA 1MZFA 5ABJC 2VNRA 1S0FA 4IXLA 4JGZA 3SQOA 2HWD3 2WWUA 3R4SA 3IKWA 4D6RA 3NRUA 3KV6A 2R1DA 5GLZA 1RUF3 2GC0A 2GDFA 3UV9A 5KXDA 4CCOA 1MZ5A 5FMDA 5C4WB 1RB8G 5KWRA 4KG8A 1Q8OA 1QQP2 2E9QA 3A21A 3ZFFC 1CX4A 1Q8PA 3J4UH 2W87A 4W8JA 3T2QA 2YBPA 4QAWA 2FMDA 1RUF1 5FOJB 4QWNA 2O8QA 3NSTA 2PLV3 5CU1A 1J83A 1HRV2 4R8HA 4NUBA 3RZJA 2VW0A 2LUWA 1V6MA 4JRLA 2EIEA 3LGRA 5TSWA 1AYM2 1LULA 4IEVA 1QJY3 3TN92 3I2OA 5HCAA 3ZLIA 1ENQA 1MS1A 2VO5A 4IEZA 5FWEA 5I0UA 2PLV1 1N3QA 2ARCA 4IEWA 1PO13 3ZFEA 3WNNA 1OH3A 1VJ2A 3GNEA 5DG2A 1G9FA 1YIPA 4F3JA 3THPA 2WT0A 3M1HA 2Y0IA 1QJY1 4BLJA 3Q8BA 2BVBA 4JGZB 3U37A 3P6BA 3R05A 2XQRA 4FOYA 2WSVA 4CE8A 3LPGA 3WW1A 1UXXX 1GV9A 1DP0A 3I2DA 1GNHA 2AR6A 1F4HA 1IHMA 2VCBA 3URFA 1SLLA 1HQLA 2VOKA 4P5HA 2BNMA 3KV4A 1O91A 1VBC3 2O14A 3AMQA 1DYKA 4RHV2 4FT8A 3MDPA 2DF7A 1JZ4A 2JG9B 4YGDA 3R4UA 4LR4A 1V00A 2VUAA 4GWJA 4IW3A 1VAKA 1JYIA 4CCDA 3UETA 3KQ4B 4XFGA 2J1TA 1SQ4A 2QUOA 1VAVA 4PJYA 1VBC1 3U14A 5BNPC 5JOZA 5J37A 1KRIA 1D7PM 2RJKA 1PIV2 3ACFA 3OY8B 4OLLA 4IV3B 1ND2A 2C4XA 1UCXA 3SNMA 3POJA 5F39A 3AMMA 1ZM1A 3BVCA 4LKSA 2Y6GA 4CVUA 3UKVA 5IATA 4QDQA 3VBOA 1N47A 3E6CC 1S2EA 2AREA 1H2NA 5EQUA 1GZCA 1P8JA 2BFUL 1EAH2 3H1YA 1C5IA 3I59A 3JQWA 4QPGB 4Y3OA 4YARA 3QD6A 1W6QB 2KA3A 4JRAA 5JMCA 3H42B 4XCAA 5JWPA 2E33A 3OD4A 2XLGA 4D6SA 4CEWB 2RM23 3OGGA 1NE4A 1W3XA 4EN0A 2LRPA 1VBA2 4N43C 2VVDA 2ZCWA 3RI8A 1TME3 4PCRA 4ZXKA 2WC2A 3WNPA 3ZXKA 5IAVA 1DLLA 1OF4A 2DURA 3GHNA 3SH4A 4NIDA 5JOYA 5T50A 5C8CC 1UZWA 4NIGA 2RM21 4IE0A 1O7FA 1GNZA 2XLFA 4ZZ8A 2CGNA 2P37A 1XE8A 1W9FA 1TME1 2ZGPA 3ETQA 3WDYA 4DUWA 3KT7A 2AGSA 3WNMA 1ND2B 4X6QB 4IL7A 1AHSA 4PDWB 1DGRN 2A6XA 1CAUB 2IC1A 4JDOA 3Q8CA 4ZKTB 5T5JA 3T09A 4BA6A 2BFUS 2YPDA 1WCUA 2D6PA 2QKDA 2XHNA 4IV1C 3UESA 3WT3A 4BMBA 2GNDA 1W05A 4BHPA 1OVSA 5C3OA 2R16A 3VD5A 2YGMA 4OI4A 5LBCA 1A6CA 1RXFA 1PK6A 1LB2A 2H0VA 2Y0OA 4MVTA 5JIUA 5EPAA 1QJFA 1SBEA 1NA1B 1YQ5A 3VZNA 1CWPA 4HXCA 3VBFB 1POQA 1LOBA 1V0AA 2VD7A 3I3QA 3VBRB 3GBWA 1CZTA 2WYSA 3MEPA 4EWAA 5EYYA 4CDQA 1DQ1A 4BLIA 2AEYA 3DXUA 4NR1A 5FKBA 5L9BA 1S0IA 4NIHA 1VMFA 1V9U2 2PFWA 5F6LB 1MS9A 1XSRA 4YM0A 1REDA 1MZEA 4BWOA 2WNVC 3WNLA 3FFZA 4ISRA 3DV8A 1UKGA 4S2GA 2ZGNA 1QQP3 1BKZA 5D8AB 1G9AA 2ZACA 1RUD1 3O7OA 4IEYA 4Z07A 3RYPA 5L19A 4RYDA 3VL8A 4CZSA 2EXJA 2QQVA 4CEYA 4JDNA 4AEKA 4E8DA 1SG3A 3KVAA 1UPIA 2ZX3A 1HRV3 3LEMA 1ULCA 2OW4A 1QQP1 2PHWA 5DAXA 5CEHA 4TTGA 3OUJA 1AYM3 2YG0A 5IWFA 1HV1A 3TN93 3HD8B 1IOAA 1HRV1 2DVGA 1MVQA 3J8F2 3SLIA 4E8CA 4Y24A 3TYJA 4I0BA 1PVXA 4RS5B 2LALA 2D93A 3K4AA 5JMOA 5AC92 1JYNA 2O8OA 3AZZA 3CO2A 5A7QA 4W6YA 3SXWA 3TN91 5C5TA 1VAMA 2G4IA 3E1F1 5A7OA 4LBKA 5HBAA 5FZHA 5L9RA 4KGGA 5JXGA 3T08A 4CXWA 1TQ5A 1VMHA 5FMCA 3W9AA 2ADEA 1NLRA 2VNVA 1Q3EA 3WF3A 3D0SA 4O65A 1W06A 4YZ5A 4XBQA 1T6BX 4ZPIA 2OQ7A 2Q0AA 2X5IC 4B8EA 1XOYA 4META 1JZ6A 4RHV3 3BODA 3ZDSA 2VMHA 2BEOA 1M4WA 2RS52 4HKOA 3AFGA 4DS0A 1GZ9A 2R042 2A71A 4YZ3A 2OYZA 3W59A 3NAPA 1F2NA 3ZFGC 1PMIA 2PHLA 2XKOA 3X29B 3VDAA 2JECA 3PNAA 2IXIA 3E5XA 4WM8C 5B4NA 4RHV1 4RN5A 3LD8A 4CU7A 3C7FA 5C9AA 5LA0A 1PIV3 4QMAA 4BE3A 4DUXA 3V0AB 4Y4YA 1AL0G 5LA2A 4QB6A 4SBVA 3J9SA 2ORZA 4RR3B 5JUVA 4N53C 2RG4A 2WN2A 1WLWA 1PIV1 5GZCA 3WUCA 2B7YA 5FWJA 4Q1RA 4XF9A 4ZY9A 5GLTA 3HQRA 5EV7A 1EAH3 3ZIWA 4IE7A 5CB7A 1YIFA 2QCSB 1FPN1 5FZOB 1PM4A 4H3WA 4XEZA 2JD9A 4OHYA 2B46X 2V09A 2WWSA 1SDDB 1VB4A 3KT4A 3RFRA 3T3YA 5A1FA 4QM9A 1AR82 2P6CA 5EHDA 2XQXA 4DXRA 5T5LA 4LBNA 1EAH1 5BYNA 4UFHA 1H1IA 5JSOA 1VBA3 2P4EA 2ADDA 2Q5TA 4L2NA 1MR5A 4JZRA 3A7QA 4O7XA 3THCA 4NWVA 3AKRA 3UKNA 2ZGQA 1CJPA 3O1UA 1VBA1 3MIEA 2RS12 4NPMA 4P9WA 4PIXA 5FK8A 4AHZA 5IVCA 3BIEA 5JR7B 2R1BA 3IMNA 4DPNA 1C28A 1DGWX 5I0TA 1HN1A 4AF9A 2IFRA 1I3HA 4FFGA 3SMHA 2QQPA 2W0XA 2MHFA 3FLRA 1RL3A 3PVEA 3KCXA 1O5LA 4PT6A 3S7EA 1RUNA 5CKNA 2BJSA 3KVBA 3RMYA 3D82A 3J26N 2BGCA 4Z82A 3ZXDA 4OQ9A 3OCPA 1JH5A 3NV1A 3RZGA 1HRI2 3S5AA 5C8WA 2JE7A 4GAZA 5A6ZA 1W6NA 1SLAA 2FCTA 2WFF2 1CD3G 1BYHA 4KGQA 4OMDA 4Z2WA 1VRBA 4PIZA 4HANA 3H1MA 3ZYRA 1ZZ6A 3AMNA 1GP4A 5LASA 1EY2A 1WMEA 3QBQA 3ZYJB 4LITA 3MIDA 1LODA 4DFSA 1LHOA 3TWIA 4A7ZA 1W8UA 1A34A 1QJX2 5F7UA 3KF3A 2XJTA 5FUPA 4Z8BA 1DFQA 3MLLA 2DV9A 5CFDC 2OZ6A 3HIFA 4OI2A 4UXAA 1V9U3 3VDDB 1E5RA 1KS5A 5DAWA 1L7QA 3GM8A 4NPRA 2IXLA 3AYCA 5L7OB 1OFNA 1RUC2 2TUNA 2V4AA 3BPSA 4FO9A 4IEQA 1RUE2 3ZSLA 2J1UA 1V9U1 1V6KA 1F31A 1NXMA 1NLQA 1OT5A 2BOIA 2TBVA 3N7LA 3POWA 4UAPA 3CEWA 4XJZA 1D0HA 5DZEA 3HQUA 1JZ3A 1HX6A 2F6BA 5GZEA 4WBBA 5DMYA 4LE4A 3WXPA 4XFHA 4DEVA 1JOPA 1GSLA 3VB9A 3SEPA 1FX5A 4QB1A 2ZX2A 4JAAA 3VHOA 5JXJA 3HPNA 5KHHA 1ALYA 1WGPA 2ZGTA 4YYOA 4QKDA 4AAPA 2K2SA 3AXDA 3LEKA 1ULEA 2WNUC 5KXBA 3J8F3 5FP9A 2GP5A 2R6QA 4OUSA 4YVSA 4AFCA 2QQKA 5FLHA 3D5OA 4BH9A 3ZR6A 2A6ZA 4HONA 2YU2A 5AC93 1O6UA 3U4SA 4ITCA 5FDBA 2JX9A 5I93A 1JU4A 4LNVA 3J8F1 3VKMA 2VOVA 4M3CE 1KITA 5BUVA 5EWSA 1WW6A 2VOWA 1H9WA 1NKGA 1POV0 5AC91 2XPJA 4Y5Z0 4NHKA 3B00A 1SPPA 5LBFA 1LOFA 3CDZB 1J3PA 2XJSA 5FREA 1ULOA 4IEOA 4M01A 3NNLA 3RWKX 5FRAA 3FWEA 3MBWA 2RS53 4HVQA 1QJEA 2R043 5FUIA 1Z0HA 3ZN4A 2V5YA 1DYOA 4NOTA 3SHRA 1FI2A 1YXWA 3M3EA 5A7WB 3SCFA 4K21A 3MW2A 5IVBA 5DAQA 3AKPA 2WAAA 1GNYA 3AYEA 4LK7A 4EZHA 2RS51 3IMMA 1PO22 1KDKA 2PAEA 3NNJA 4LO5B 2R041 3EYPA 3TEWA 2Q1FA 4DIQA 2DUPA 5I0DA 4AE2A 2HEYF 5F2SA 4B4RA 3AB0A 2Z42A 3I7DA 4FSJA 4GH4A 4OHWA 1QH6A 3ROUA 3MF9A 4M3CF 2WQ4A 3ZXEA 3UT0A 3ZYBA 4BYYA 2TNFA 1UL9A 3JXSA 4A6SA 1QH7A 4CDWA 2EIGA 3WVJA 4CP2A 1J58A 4U2AA 4QX0A 1K5MC 1W9TA 5SV5A 5KR7A 1IZ3A 1SPPB 3D8CA 4NAMA 5GALA 3H3LA 4CCJA 3PIGA 4PF5A 4AEDA 3CJIB 4GMP0 5J3UA 1CPMA 3LE0A 5FY1A 1O5UA 1S0GA 3EMRA 5FAXA 5K0UA 4MXWB 2R072 3DKQA 1CAXB 4Z2AA 3HR9A 2G19A 4LA2A 3F95A 4A3ZA 3JB4C 1X9TA 3NNFA 3OUHA 4D69A 5JZGC 2JENA 3Q8EA 2B42B 4D94A 2W2IA 3LFMA 3VBSC 5FIXA 3HN1A 2BGOA 4XIOA 3VD4A 4AEJA 4YZ1A 5JPNB 2Y6LA 2Y33A 2DBNA 2EALA 4FCAA 4LA3A 1W04A 4BIFA 2FCVA 3OGJA 4GXLA 3HJRA 2D6MA 1EV12 5JDBA 3UYJA 5KHIA 3UGHA 5A80A 3FBYA 1NCQB 2QDRA 2Z5WA 5DQ0A 5ABJA 2P6HA 4A4AA 4J25A 1CAWA 4XUOA 3RMXA 4AQ6A 1NCRC 3RZHA 4BOWA 3SCGA 4YFWA 1Q8SA 4OQ8A 1MQTA 1HRI3 1DZTA 2D97A 2Y38A 3AM2A 3GGLA 4LIVA 1WWYA 4H14A 2QQLA 2QQMA 2WFF3 4XBNA 2ZEZA 4UW5A 4D0QA 4DNYA 5IK4A 5LRSA 5FY0A 4BXFA 4QB2A 3ZFFA 1B35B 1RJ7A 4QX7A 2BZDA 1HRI1 4BK5A 5FY5A 1OQEA 2ZGLA 4KNCA 3VZOA 1UAIA 2WFF1 2OUJA 4HVRA 3ZMOA 1OPOA 3KM5A 4L0PA 4YZ4A 1QJX3 1I5PA 4RFT0 4AGRA 1NX9A 3ZPYA 2BUKA 1W0OA 3IPVB 1QNWA 1FXZA 5FZ6A 4PHZA 3J7NA 4EN9B 3POBA 1RIRA 2V4VA 4BQWA 2KXLA 3OG2A 1I1EA 5LEKA 1QJX1 1RUC3 4TLFA 1GR3A 2EICA 4COUA 1RUE3 2D6LX 4LO8A 5IVFA 3JD72 1GZWA 1UD1A 1ZZ7A 4YVWC 4WVMB 3OBAA 1UW8A 4OCTA 1TMF2 2PHTA 1MQTB 1BZWA 2OQ6A 2VOXA 1RUC1 2JDNA 2BU9A 1RUE1 3ZN6B 2OXBA 1KQRA 4MH0E 4C0BA 1XPWA 2XONA 4E2SA 4MV2A 3BB6A 4I0WB 2C0ZA 2XJUA 4N90A 5HV4A 2VBDA 3K4DA 1REEA 1OF3A 2X05A 2WNEA 5LZ6A 4I02A 5I8YA 2GP3A 4Y26A 2OX0A 4UBHA 4DY3A 4F7ZA 2VCAA 2ARAA 2DBIA 1QDCA 1KJLA 4XFIA 4Y5SA 2X10A 3LIHA 4YGEA 2FD8A 3K75B 2BPA2 2VXRA 4IEXA 4FAHA 1IKPA 2WQZC 3H3UA 2GAUA 3DPRC 1E5IA 1YFXA 3P5BA 4JDMA 1NY72 1RHI2 1U5ZA 1ST8A 4FPGA 4UI9L 2JE8A 3E97A 4X8NA 4RQPB 1Y43B 4LHSA 2A3WA 4XF0A 2C9KA 2YZ4A 3HMYA 3PUIA 4R4ZA 1W8NA 1BEV2 1GICA 1VBB3 2UWCA 5BNOC 1UPSA 4JKMA 3TNQA 5LCWL 1MS0A 2HBUA 2JDAA 2X53S 4JGYB 4FFIA 4BCUA 1D4M2 5CFCB 3T4VA 3AMPA 5C3QA 2C6SA 1VBB1 3OD0A 3ZXGA 1WCQA 2YFZA 4KBZA 2LROA 5JXIA 5IVYA 1JI6A 1PO23 4XF3A 3O1RA 4A41A 2OA2A 1QOTA 4M3CA 4N43A 2QJVA 3PU8A 2TEPA 2YBKA 2ZTNA 4KMQA 4LBQD 5JSPA 1CVNA 4URTA 2HWB2 5GLWA 5LATA 3V0BB 2FDKA 2AYHA 1HKDA 1NZCA 3VZJA 4E2QA 1PO21 4QXKA 1GQGA 2YYOA 3BTYA 3SKVA 2W94A 5ERLA 1CIYA 2VOTA 2VVFA 1KD7A 3DEMA 5DZGA 5D2AA 3QH7A 2E7TA 2UWAA 1W8TA 1O8PA 5E16A 2JG8A 3A23A 3I3BA 4FPYA 2XLAA 2IFWA 3PURA 4IV1A 2PQQA 3RI9A 5KHGA 2A6YA 1DCSA 2VVEA 4GZ9A 4Y5TA 2PHFA 1ULPA 4Y20B 5C70A 3AJZA 2R073 1CQ9A 4H7LA 2PXJA 2XXZA 1KJRA 4PI2A 1ZBE2 4L99A 4WZFA 3SH5A 2EVXA 1SFYA 2JKXA 1V70A 5H9SA 4GKXA 4KH9A 3PUHA 3WNKA 4CCEA 2R071 5DUXA 1UX7A 4DY5A 2YU1A 1KXGA 3P3NA 5EJZB 1QHDA 3V65A 3FMGA 4W4ZA 4AVVA 3JCIA 4BM8A 4AHXA 1CAVB 1PGL1 5LA9A 5FQ0A 2FDIA 5K8SA 1EV13 3NJXA 2MPFA 1ZRCA 3ENRA 3K3NA 1WCKA 5A1LA 5D1IA 4ARXA 3USUA 5JSRA 4IETA 3I2JA 5A3LA 5A3OA 3V56A 1H1AA 1EV11 1FAYA 4DXSA 2JG8B 5CKQA 3WF2A 4AI0A 2WNVA 3AKQA 1RMU2 5AVPA 3OF1A 4EROA 2ZKNA 2ATFA 3CQOA 4LKDA 4ET7A 4QQHA 2YXSA 4YGBA 4Y22A 4Y1YA 4TN7A 2JEMA 2FQPA 3ZKUA 3KZ4C 5LB6A 2SBAA 5SV8A 4TWTA 3PUQA 2JD4A 3VL9A 4IEUA 3PJQA 1ENSA 4FQZA 4QKNA 2QE3A 3WSOA 2JDHA 1ASJ2 5KXEA 5FMOS 4YPJA 1VRH2 3FX3A 4NROA 1CX1A 5IUQA 3BU0A 4GD4A 1X7NA 3OBRA 4LBQB 4YW5A 3LCPA 5I0RA 3KS7A 5FQ0B 4CDXB 4DB5A 3EJKA 3HAGA 4M0NA 1ENXA 4OMCA 3N9MA 1FYUA 1RTVA 3ZXLA 2ZBJA 3I4IA 2VR4A 3JD73 1UOGA 5HCBA 1TMF3 4CDUB 3GYDA 1CONA 1RUD2 4M00A 1AX2A 4FPJA 4CYDA 1YFYA 5KBFA 1W9YA 3JD71 2ET1A 3M7AA 4RL7A 3DECA 1LGCA 4CCKA 5BNNB 4AHYA 1YHFA 4N9IA 1FNYA 1TMF1 1HB3A 2X5IA 1DIWA 3H50A 4L8QA 4XBLA 4WM7B 3P3PA 2PHDA 5FYVA 5GKAC 4I3GA 4R4XA 1YNAA 1RUI2 2XJRA 1HXS2 5A70A 2B4KA 3MIBA 3ZFGA 3U07A 3ES4A 2BWAA 1VPHA 1Y9MA 3O12A 4AQ2A 4E2GA 1YRZA 4WM8A 2W39A 1RHI3 3AK0A 5IYYA 3RQ0A 4B3NA 2VU9A 1CN1A 3WD5A 2BERA 2B9UA 2WIIB 4IDZA 1SBFA 4IERA 4K8RB 4N53A 4CP9A 1BEV3 2V72A 3O5SA 1NY71 1IQAA 4GWNA 1RHI1 2GZWA 4XJUA 3RS6A 4R9DA 5GJ6A 1QKQA 4CSWA 1SEFA 5A7NA 3AJYA 2UURA 1D4M3 1OURA 1E5HA 1ZRIA 1GYKA 5J48A 1BEV1 2NZ9A 3MUY1 4YW3A 3MI8A 4QXHA 3GZTB 1UY3A 3GBGA 3ITQA 2WJSA 4P9YA 4RD7A 2C1FA 3RRDA 1CZSA 1D4M1 2W95A 5CG9A 4FOVA 4FOWA 2ZHMA 4ORFA 1AR72 4FXGB 2HWB3 1AR92 1W99A 5J7MA 4AAXA 2DUQA 1YFWA 3IZOA 2UU8A 2JICA 3BIWE 2YHJA 3ZMNA 2WYFA 5T5OA 1L7RA 2C26A 2RJLA 1KEXA 1A78A 1FV2A 3L2YA 3TB0A 2H6BA 3ZFEB 3CKHA 1R64A 2HWB1 4AR2A 1SFPA 1OPMA 3PVOA 1Q43A 2P5BA 4OHZA 4CCCA 1FPN2 4UFJA 3IBMA 3FLPA 3MPPG 2IVJA 2BRTA 2EXKA 2D6NA 1X8MA 4FPFA 5FZFA 1KS4A 2A3YA 3FHAA 4P5YA 3APBA 4MGKE 2HWF2 1H8TA 3FFQA 5HXVA 1ZBE3 3IN9A 4Q8KA 5FO9B 4ARYA 1DQ0A 2CAVA 1H9PA 1W6OA 5FLJA 2ZX1A 3H1WA 4HN0A 2ERFA 3TNPB 3B93A 5FYMA 1X50A 4MGSA 4QX2A 4XUQA 5JLVA 3M4FA 2J1RA 3SH3A 1AXYA 1ZBE1 1YQ6A 3QACA 1AVBA 2QNKA 3RJRA 3KF5A 5BXXA 4ATFA 5CIRA 1DHKB 2VM9A 1K42A 2VMGA 2W47A 5CFDA 3A0KA 1IPJA 1ZZBA 3I2HA 3N9LA 4GWIA 5A33A 1QGLA 1VB2A 4GMP3 2E51A 2QQIA 1J3QA 2W1SA 3D3AA 4DOUA 1RMU3 2BOJA 3AP5A 1IG3A 4CP0A 1ZA4A 3EB7A 2X09A 2NP0A 3G7DA 3VBOB 4Q29A 4PBPA 1UIKA 5FZ4A 1AYN1 1N1VA 2AEZA 3ZYGA 1JZ7A 4GMP1 3I59B 3ON7A 4R9BA 3VKLA 1RMU1 1LCLA 1H8TB 2EA7A 4MSVA 1RUH2 2NM1A 3LA2A 4LOSA 4GIQA 5CISA 1S2KA 2XGXA 1ASJ3 3PVNA 3C7GA 3H8UA 1W6OB 2CSGA 4IGQA 4UFLA 4BB3A 5IHRA 1VRH3 4LO4B 5CZKA 2VTFA 4OFGA 1SMVA 3RZMA 4JKKA 4LO7A 1ASJ1 5FZLA 3ORJA 4FI9A 4JC1A 5DABA 4LLFA 5I8TA 4N7IA 1VRH1 2WNOA 4P08A 3WW2A 2WAOA 2P2KA 4K7JA 3QOPA 5CNAA 1UWWA 5A7PA 4BQYA 4Q27A 5JPMB 5CVRA 4HPKA 3ZYHA 3DYOA 2QBXA 1RUD3 4BISA 4Z92B 4HSJA 4FTSA 1OI6A 3HNMA 3JB8A 3VBHC 4NE9A 1WZXA 3WQ1A 5EZWA 1W0NA 3C7EA 3RYRA 1PZ8A 4Q0UA 3RZZA 2CGOA 4E4DX 1JYWA 4B4PA 1RUI3 4BQ4A 1HXS3 2WT2A 2FMYA 5B4XA 3VD3A 3T1LA 3KGLA 1PK6B 2WBKA 1XYNA 5C6CA 5GLVA 1MPXA 1IQDC 3HN3A 4NAOA 4XF4A 4A2UA 1DQ2A 1SBDA 3DL3A 4LLOA 2R0HA 4I3PA 1RUI1 4E4SA 1HXS1 3IAPA 4RA0A 1D2SA 3VDBA 1PMJX 4Q5OA 5FZ1A 1PVC2 5L36A 1H2MA 1UZVA 2ENRA 4AI1A 3GBFA 3PDQA 4CDQB 4GULA 5C4WC 5A3MA 3AC0A 5F2WA 5A6YA 4AFBA 1PNFA 2ZZJA 4A44A 4HPKB 5L9VA 2JKBA 1L7LA 2DU1A 2I45A 1PX3A 3ECQA 1K5MA 3POFA 5FYBA 4PLOA 2B9VA 3WR0A 2FDJA 4AL9A 1RGSA 4FP2A 5E89A 4LKFA 5FYIA 1NLSA 2ET7A 3LOIA 5JAXA 5ANNA 4Q0SA 5LY2A 4MX3A 1U5YA 4YW4A 3HOBA 4JX0A 4XXPA 3CF6E 2VMEA 4CEYB 2Q1MA 1AR73 3TRSB 4C91A 2JDYA 4LOTA 4QPIA 4EQVA 3WDWA 1AR93 3PLQA 2ZEWA 3AP9A 5FZ9A 2YC2A 3K77A 1UOBA 4G3YC 3VBSA 3N35A 4JGZC 1AR71 4CCNA 2DCKA 3FL7A 5F5AA 1HQNA 4PLMA 1Y4WA 4QD2A 1AR91 1R092 2D40A 2FCUA 1WMDA 2VQAA 3MLJA 3THTA 4UWDA 5IW0A 1WBFA 1IKQA 2HYKA 4B29A 1OKQA 1FPN3 4J1WA 5JR2A 5FP3A 2A73B 5F9TA 3AFKA 3ILFA 2FDFA 1NCRA 2YUEA 3PU3A 4V2VA 2YY1A 1ZVFA 2JG9C 2HWF3 3WDUA 4YM2A 5E8AA 1AJKA 3B5LB 2VQUA 2DUOA 2WZEA 1AF9A 4R52A 1HN0A 4NMIA 3MV11 3SCHA 2HWF1 3ZO0B 1HJGA 5K7PA 2CAUA 4QPIB 4YFZA 4RGGA 4IV3C 3NAPB 1IS4A 2DWRA 4P9GA 4COWA 5AFBA 1JYTA 3T2PA 4QQOA 1DGRA 2ZMKA 3ATGA 5DAVA 5A32A 1UN1A 3MW4A 3KHCA 4G4FA 2RS32 5C9AB 1W9WA 1Q5OA 1Z7S3 2P3IA 5FZGA 1SDWA 2A3XA 1MEC2 2UY8A 1H6XA 1RJ8A 1XNDA 4DO0A 2JIGA 2QQOA 3IDBB 2VZ1A 4QPGC 3H8OA 2FDGA 1VR3A 5FPZA 2I2SA 1VALA 1ZZCA 1GOHA 4S2HA 3ZR5A 2DVAA 1US3A 1Z7S1 4IQPA 3I97A 4YVWA 2PAKA 4CEWC 4HSLA 5FZ3A 2V5DA 1BJQA 2VECA 1OFSA 3O14A 2H6CA 5FR3A 1ACCA 1RUH3 1F35A 1V6IA 4ATEA 1N1SA 3VV1A 1QOSA 2GN7A 2WLQA 4LT5A 2HKXA 4MUVA 2QTWB 2Q4SA 3DCQA 3ME2A 3ETPA 2CDOA 2PA7A 1S55A 3OEBA 1S2BA 3WDTA 2OUHA 1RUH1 3BALA 4I01A 1K45A 4YLZA 5C7GA 5J96B 1ND3C 3BTZA 5F5IA 1Y9GA 1ZZ9A 2DCYA 1QY4A 1GBGA 2WT1A 4PDWC 3I2GA 1LHVA 1QXJA 2ID4A 2QQUA 3CIHA 4AK3A 3T2OA 2GH2A 1X36A 2BV4A 4Q2FA 4PIYA 3UK9A 1PZ7A 3O1VA 3DPRA 5FP7A 1JZ2A 1UO9A 2PTMA 2RMU3 2ZGSA 4TYSA 1YI7A 2VQTA 3WQ7A 4UW6A 1JU3A 5HI0A 3J7LA 1GQPA 3CBNA 4BQ2A 3AP7A 3POYA 3ZXFA 4D7YA 1CESA 4XQDA 1WMXA 2VBPA 4O9GA 4CUCA 4XZUG 1OLQA 3S7IA 2RMU1 3VD7A 5BNOA 4A3XA 1NA1C 2Q8DA 1OLRA 2R32A 2XMLA 3D6EA 3WHTA 3VBFC 4QX8A 1O4TA 4XFFA 2GALA 4PQ9A 3VBRC 1BXHA 1QNYA 1W6NB 4HOOA 5FZ0A 1F4AA 3WDXA 3WZ1A 1W9SA 2E26A 2VNOA 4OZXA 1X82A 3MGUA 2R062 3B7MA 4I30A 4NHMA 2D44A 2JDKA 1UYXA 4KI5M 1DDLA 3WQ0A 3HNYM 1VIWB 3W58A 2VW1A 3OGSA 2PQSA 1J1TA 1PVC3 2WWJA 5IK5A 3CU7A 3I3DA 2A6WA 1SLIA 1X8EA 1CZVA 5B2GB 4W6XA 5D8AC 1S0CA 4FPEA 3GALA 2AACA 3WEZA 4C1WA 2OKXA 3VBUC 1PVC1 5EFUA 4BQ3A 1BHGA 1ENRA 2EAAA 3K46A 4ISQA 2VUDA 1G86A 3TEXA 2HWE2 1KFXL 1LGNA 2WKKA 2XKPA 1VBB2 4QGLA 2CYFA 2RR12 4HG6B 4Q1PA 3VDCA 5IAXA 3V64A 3BUCA 3GHMA 1CIWA 4LUKA 4JQRA 2GC1A 3NV4A 4RS5C 2F4PA 3LAGA 4HT1T 4XABA 1A8MA 4COZA 1F5JA 3WNOA 1SFNA 1WLCA 5DDJ2 1JYVA 3KLSA 2WO2A 4OHXA 4YVSB 4CXXA 1R093 4CA9A 1HIXA 4LBJA 5EJ3A 2A5ZA 2KR2A 1MS8A 2ZMNA 3I3EA 5E88A 3K2OA 3VZLA 5FYYA 3PIJA 4AOCA 1YJKA 2GC3A 1R091 4YW6A 5L73A 5FCCA 5HCHA 1C3HA 1FNZA 5LEJA 2DVFA 1C8NA 1UIJA 4RGKA 4P02B 4ZU4A 2Q8CA 5I91A 3MF6A 1OHFA 1WMFA 1BK0A 2CV6A 3POEA 3R6SA 3LB9A 3IIIA 3T2TA 3AX4A 5J36A 1U5XA 2OT7A 2ZGUA 2ZAHA 4XMIA 4RR3C 1LTEA 3M3QA 4Y4RA 4HZFA 1H30A 3U11A 1PGL2 2RS33 5H9QA 1COV2 2XVKA 5T55A 4EWDA 4CXYA 1ZBA2 2P17A 4ZS2A 1MEC3 3CJXA 2DVBA 1OSGA 4A7KA 5F37A 4EN6B 2Y6JA 3AYDA 2FZ1A 3FZ3A 1SCRA 4V1PA 4FQ4A 4MADA 4LJHA 2J1VA 2WO7A 1I5ZA 1ZYBA 2RS31 3UNPA 4GH4B 3AP4A 3AZWA 4KU7A 3BTXA 1MEC1 2D5FA 1JZ5A 4Z1VA 4CDWB 1QOOA 1HLCA 2R30A 1EUTA 5CYYA 3FHIB 5FUNA 1OA4A 2BP6A 5GM0A 1Q8QA 3WF0A 3LSDA 3UKTA 1RUG2 4AEDB 1GP5A 1SLTA 4OZOA 5LBEA 4XDOA 4LQRA 3T0BA 3O1OA 2GU9A 5JVVA 1PGW2 1UY4A 2VZTA 3ZKYA 3VLBB 4B4QA 5K0UB 4FPOB 3T30A 1G9CA 4YW7A 5FY4A 5EXOA 2PELA 1UMIA 4WVZA 4PF1A 4ZZ5A 1FOD2 1GLHA 5C3PA 3LA3A 2LTNA 4PQQA 4EV0A 5T3NA 2WN3A 3LOBA 2VC9A 5EP9A 1XBFA 3GF6A 3G6JB 4XMAA 5C3RA 3POIA 4QPYA 3AKTA 5LRRA 1LENA 4EE2A 1C57A 1DGLA 4RGAA 2VULA 4I09A 1ZZ8A 2EAKA 2JWPA 2PYTA 2ZAAA 5FOBB 4K40A 1H1MA 4HN1A 5H9PA 1SACA 2ILMA 3E5UA 3KV5A 5F1RA 5GLUA 1NYWA 3U0ZA 2GSYA 3IDAA 5ABJB 4GJZA 4Y1ZA 4CUBA 1CAWB 1DU3D 4QGNA 4I0AA 5J1XA 3N7JA 4XTMA 2VNGA 3IT8A 5KHKA 5IVVA 2Y34A 2IXHA 1RINA 3UJQA 1YQ2A 3QLQA 4XZPA 1NAEA 3PTRB 1XB9A 2R063 2VZSA 1Y3TA 4FPLA 1JHNA 3ZFFB 3MW3A 5FYCA 3VDDC 1LGBA 2D98A 3L2HA 1PM7A 4INDA 2ZA9A 4NJ4A 4YM1A 3K51A 2JDUA 1YEWA 2R49A 1WA6X 2RDNA 3ZN5A 4NHXA 2JB8A 2JE9A 1C8M3 4KWLA 1QJZA 4A6OA 4PLNA 5L7OC 2R061 3KGZA 1OD5A 1NE6A 1W90A 1N1YA 2WUHA 3Q9OA 2GN3A 4FFFA 1V6LA 1LHWA 1V6NA 5BNPA 1WW7A 5FZCA 2ZGRA 3VKNA 2PHUA 1C8M1 4QU1A 1LOGA 2XWJB 4IE6A 5GZDA 2BDRA 3KCCA 1YUDA 4A7YA 2HWE3 1LECA 1NXD1 1GZWB 5F3IA 3WF1A 1XJAA 3WCRA 1HV0A 1JBCA 1CJDA 1E5SA 1JOBA 2RR13 3MFCA 4L97A 4DXZA 2FZ2A 4IE4A 1RUJ2 2Y60A 4NRQA 2HWE1 4LBOA 1W28A 3DN7A 2K9ZA 3NNMA 4KWKA 1XNBA 2DTWA 2DTYA 5FO7B 1OUXA 3TAYA 4QDSA 3Q8AA 4GQ7A 3WQBA 2RR11 4GA9A 4I2OA 1B09A 1HB4A 5BNQA 5DDJ3 2IXCA 4YZ2A 4D3WA 2XHKA 5CKMA 2W9XA 3I8TA 3VKFC 1PNGA 4XVHA 1QXRA 4YGCA 1W6MA 4E9KA 2VJXA 3HEIA 3H8RA 3HQXA 5C8CA 4KL1A 2XJPA 5DDJ1 2VTXA 2B45X 5BNPB 4NIAA 2KM2A 5JXHA 4OUEA 1RITA 2ZKLA 3ZSJA 2AC1A 2O1QA 3GXUA 4MG2A 1Y7BA 2UWBA 1K3IA 4AQSA 2BWCA 2WR9A 2X8KA 2RVAA 1HJFA 4MGQA 4KWUA 3A0NA 5FK7A 1CPNA 5FZAA 1OD3A 3MV01 4GJYA 4N7UA 3KV9A 3MICA 2SLIA 3SITA 1LAJA 3BGAA 1AR62 3T0DA 2N7GA 1JYXA 2Y64A 2VCCA 1TG7A 1AJOA 1W6PA 2ZJCA 4G9SB 5FY7A 4ZU7A 1YYNA 3B9CA 3BTAA 2P3YA 1W2NA 4FFHA 3TOJA 1EYBA 4IGPA 4CU9A 5FPXA 1G6NA 2XG3A 5C33A 3B9IA 1COV3 2YFUA 3JUUA 2XL7A 1R1A2 1ZBA3 2F17A 4IESA 4M3CB 3LDBA 4N43B 4HKLA 5JI9A 4KQ7A 3R4DB 3NJVA 2J1SA 3LA7A 5FTTC 3I3MA 4TZDA 4FXKB 5FXXA 5DUWA 2W08A 5FP8A 3OTFA 4CTEA 2IXJA 1YWKA 5C8CB 1COV1 2W3JA 2IVIB 3DYPA 4UYBA 1ZBA1 3CJIC 2XUEA 4MXVA 1SHWB 5FZBA 5J98B 4JCKA 1UZZA 2ETEA 1JW6A 2K46A 2Q8EA 4QGMA 1GU3A 1AYN2 4XFCA 4XDQA 3RWNA 5FZMA 1RUG3 4LORA 2BQPA 4UFKA 3CZUA 4MOAA 4IV1B 4AEMA 3VBHA 1JN2P 1DYPA 1ZRDA 2ZZQA 4Q0QA 1ODNA 1VLNA 4HFSA 4KBBA 1RUG1 2XJQA 1Y9QA 1WD4A 1UOFA 1MZ6A 2Q8OA 1FOD3 1NQDA 4OI1A 3WP4A 1W2OA 3ZPOA 3U1XA 1PGW1 1UKRA 3MYXA 4AI3A 5EJ1B 1NCQC 5CADA 3O1MA 2CY6A 1CR7A 4J6GA 4NPLA 2IUWA 2WA3A 1FOD1 4LXLA 4XXAA 5AVAA 1J59A 5APAA 1OUSA 3O1TA 2VTXJ 4Q26A 2XVGA 4N8MA 2ZEYA 1UQXA 2E63A 5C4WA 4WVWA 5M0TA 1A8DA 5EIYB 1QEXA 1W2AX 3USUB 1W03A 1T2XA 3MFAA 1B35C 2E32A 4XFBA 4IEPA 5FYSA 4P00B 3N9OA 3POSA 3OSDA 3W21A 3WV6A 2WNVB 3LZZA 3MIHA 4XACA 1GMMA 4DQAA 2BNNA 4LPLA 4Y22B 1XNAA 1XSQA 4FTEA 3LF7A 2OPWA 3I2FA 2OIIA 1QIQA 2Z69A 3JU9A 4BJ0A 1DZQA 3C3VA 1DG6A 5KXCA 1H0BA 1DGWA 1K5JA 4COVA 3WG4A 5JI7A 5I8SA 1EUUA 1WCSA 1SLBA 4DRRA 3WP6A 3K48A 1D4VB 1BQPA 3B02A 1XYPA 3DXTA 1G8WA 1I9RA 2XBO2 4WV8A 3NJZA 5FZKA 5K4LA 3GJAA 1H2LA 4ZXEA 1F15A 3AL5A 5A7SA 4BXSV 1MQTC 4LUMA 5A1AA 4XE9A 5BV6A 3ZOIA 1UY1A 2E53A 4C8DA 3FC0A 4LULA 5JIAA 4XPVA 2ZABA 1C5HA 1OA2A 2HWD1 5FYUA 2WA4A 2EXIA 4AI9A 3IB3A 1LR5A 5IT6A 3HT2A 3T0AA 4CCMA 1XE0A 2HEWF 5ISLA 1RUJ3 4UFIA 1N1TA 2JG9A 3CZJA 4EZ4A 5T52A 5A6QA 1JODA 2GNMA 5H9RA 5E6HA 1JMUB 1M06G 2X5IB 2XR4A 5FY9A 1HDKA 3CHXA 1RUJ1 4E27A 1U12A 1QJU2 5K9YA 2RDRA 3OY8A 3PMEA 1AX1A 3J7HA 1IS6A 4NWWA 4LTAA 2VBBA 4IV3A 4FOQA 4XHBA 4XUPA 2EIDA 3ZFGB 4PI0A 4RQPC 1O8SA 3AKSA 2BNOA 2Y8KA 1PGSA 3M70A 4WM8B 1WLTA 3T1MA 2OS2A 4OYUA 5F3GA 1POV3 1ULDA 1PO11 3SEEA 5T54A 3AVRA 3BPZA 4XILA 4K1YA 2ZPXA 4QPGA 1URXA 4JGYC 2HEVF 4UT5A 3UL2A 4AW7A 5A3PA 4YWAA 5CFCC 4MGTA 3RVHA 1W6QA 4N53B 5ACA2 2NPIA 1POV1 3NQHA 4CP9B 2W1WA 2JXAA 1AR63 2YBSA 3N9PA 1UY0A 2Z2SB 4QXCA 3N3HA 4CEWA 2LM3A 1CGPA 2C9AA 1LESA 1GFF2 4HETA 5G04L 2GMMA 2ZGMA 4KU8A 3P1IA 1N3OA 2HYXA 2CTVA 1HQWA 4Q4V2 5DXDA 4D8MA 2IXKA 1U0AA 3H0OA 2JDMA 3O0VA 1X9PA 4YG6A 3WW3A 1AR61 3I2IA 1AXZA 1YQ8A 3WP3A 1R1A3 4COYA 1X33A 1C4RA 3NW4A 2X29A 1J1LA 3WW4A 1OQ1A 2E6VA 2Q1ZB 1ND3A 3DF0A 4ONUA 4Q4X2 2ZEXA 4PDWA 3INAA 4QQPA 2VW2A 2P3JA 4UW4A 4XTPA 3BCWA 1XNCA 4K1ZA 1CAUA 2WZ8A 1R1A1 3PHMA 4AYUA 5A3WA 5A6XA 3W5NA 5CAZA 4XCBA 1WLDA 2W46A 4Q4W2 4P9JA 3ZYPA 1Z7S2 1SLCA 1AYN3 3ZDVA 5E1RA 2PHXA 2VZQA 2IWGB 5HXMA 3SKJE 2RDSA 3I2KA 1G9BA 2AUYA 2QZ2A 1GWMA 2WABA 3I54A 4JV4A 4CUAA 2I07B 2VMFA 1UU4A 1UU5A 1NA1A 1ZRRA 2Z79A 3N36A 4XW3A 3ZXJA 4WZCA 2R7EB 4AGVA 4XETA 3KB5A 2VUJA 3VBFA 3OPWA 4EJRA 2BBAA 4EN8B 3VBRA 3VZMA 5LK5A 1HW5A 2RV9A 4B1LA 2XDVA 4IUGA 4QKFA 5F3CA 1JS9A 1MACA 1PZ9A 1YI9A 3ASIA 2DCTA 2FBEA 1ND3B 3A22A 3SISA 2WNUA 2RDQA 4K20A 1W8WA 1YC61 4LHLA 5F32A 5KC5A 4XHXA 2JG8C 1FT9A 2CWSA 3RYKA 2ORXA 3O1SA 1OOPC 4EN7B 3GCXA 3FLTA 5CFDB 1R082 4FPHA 5D8AA 5A33B 3FUQA 1GUIA 4BIOA 1RXGA 3VBUA 1ZNPA 1WW4A 3DYMA 2GMEA 3J7MA 2RMU2 5FPUA 4LK6A 3T4HB 4FPKA 3BI3A 3PVBB 1OXCA 3ZSKA 3O1PA 5IVEA 1H4GA 1LEMA 4UW3A 2WZPP 3WHUA 1H4HA 2J1AA 4GB32 1GP6A 4XURA 5FP4A 1A3KA 3BOWA 2NLRA 3FUOA 4TSVA 4XQ4A 5FZ8A 4W50A 1REFA 2VZUA 3EHKA 3VUOA 3ILNA 4RS5A 4CDXC 4C0HA 2GH8A 2WS92 3CLPA 1N3PA 2NYYA 1Z78A 5FXZA 4BQXA 2XBO3 1JOJA 4QPWA 2HH9A 2WNUB 4M0HA 1XC6A 3UGGA 2CHHA 2VQ0A 1W8HA 4CDUC 3ACLA 3Q8FA 1BK1A 5C3SA 2Y6KA 2BBVA 2P1BA 4S2FA 2XBO1 3H7JA 5HPOA 5BNNC 2RHPA 1L3JA 3S5QA 2H0BA 3VBUB 4LMFA 1US2A 4WM7C 3BOPA 4XUNA 1LHUA 3ELNA 3WUDA 4XFAA 3U75A 5T5PA 4HL0A 1JTZX 2PHRA 4X6RB 4YM3A 5HV0A 1FV3A 3EQEA 4B7KA 4XDPA 5DN2A 4NHYA 3NNGA 1XRUA 4QKBA 4W6WA 1KGYA 1W8ZA 4UOJA 1LU1A 1QXPA 1QJU3 4P9XA 4AG4A 1XXNA 2ZS6B 4UBGA 4AVSA 4LKEA 3NKTA 3V0AA 3ZXAC 2Q30A 3B3QE 1TE1B 1AYM1 3ACHA 1VBE2 1WKYA 2W1UA 1VE0A 5JZGA 4L11A 5F8PA 4RR3A 4D7TA 1QJU1 3EBRA 5FJHA 3GJBA 3ZX7A 2D3RA 4Q8LA 3ZYFA 2MEV2 4RSUA 4XAEA 1JXNA 2BW8A 1BMV2 2Y6FA 5FZOA 1W39A 2ZHNA 1AUYA 1UX6A 5ACA3 2YGLA 3VHRA 4JHTA 2FDHA 1W2TA 3C7HA 1SZBA 2G9ZA 4HK8A 3VHPA 1UU6A 3MIGA 1SCSA 2CNAA 4MHUA 3HWJA 3HNBM 1K5MB 2LS6A 4Q4V3 5FZEA 2B8MA 4R9AA 4W65A 5ACA1 4YG3A 2ZGKA 2WQ8A 3AZYA 4AWDA 3PUAA 2VZ3A 4LBLA 1W3VA 3WG3A 1NT0A 5FXWA 1BBT2 4Q4V1 1V6JA 3OBZA 4Q4X3 3ZFEC 3N9QA 4CPBD 2I74A 3KT1A 1RYYA 5C71A 1K12A 3H7YA 1EP0A 1OLME 5JZGB 3OUIA 2EXHA 2CDPA 3VZKA 1U5IA 3VN4A 3VBSB 4WVVA 4M4RA 3WOGA 4Q4W3 4CUGA 2ARBA 4Q4X1 1JUIA 3M3IA 1WW5A 2J1EA 4XC9A 1JZ8A 1O59A 2EIBA 3ZSEA 4NN0A 2NQYA 2XB6C 3BU7A 1D0GA 4BU2A 2WO3A 5G05L 1OQDA 4DEQA 4MZUA 4Q4W1 4Y1VA 1KFUL 3WY6A 5FY8A 1QU0A 4X8PA 1NCRB 4NRPA 4QU2A 3NO8A 2WFPA 1KDMA 1S4CA 1WBLA 3KWVA 4XAAA 3THDA 3ACIA 1JYCA 1TNFA 1VBD2 3C7OA 3M2MA 1LKNA 3LIGA 3VDDA 5DPNA 3AMHA 1LJ7A 5IFTA 2PN5A 1H8VA 3WLUA 4CPBA 1ND2C 2G9GA 4P14A 1MS4A 4K3UA 5L7OA 1O3RA 1VMJA 1LNSA 5A32B 5F6KA 1LRHA 1AZDA 3AZVA 3E6DA 1R083 2ZMLA 4K6BA 3VBOC 4CU6A 3EO6A 4MGIE 5IK8A 3MZHA 4FTBA 3GZUC 1GZTA 4CU8A 2WL1A 1H8TC 3B69A 1WCDJ 4QQLA 1Q8VA 5FFOC 1R081 1F8VA 3ALQA 2W91A 2WDBA 3H9AA 4YVWB 4GB33 3HBKA 2VZVA 5F5CA 3AP6A 3UJOA 4K8FA 2YMZA 3GCWA 4QM8A 1ODMA 1GANA 1HB1A 5FPAA 4YSFA 2CGPA 4QXBA 3FN9A 4R9CA 3WG1A 2WS93 2UYAA 2YB7A 4GB31 2A75A 3RG0A 2FHRA 4SLIA 5FYHA 3ABZA 1LU2A 4FP3A 2OPKA 3VGIA 2AENA 1XU1A 1RVF2 2VMCA 1YO8A 2R0FA 2W68A 1V6OA 4NVPA 4XYXA 1UNBA 2WS91 4HKWA 4URAA 1DQ5A 5FYTA 4FBFA 3USSA 5F3EA 4DXTA 2CWMA 1C8M2 2F4LA 1LOAA 2Y6HA 5FJKA 4AI2A 1UMZA 1BVP1 1OC1A 1MVEA 1NQJA 2ZX4A 3DPRB 4A42A 2YPJA 2RJ2A 2A6VA 4XJ8A 5FYZA 5A3NA 3FJSA 4QHBA 2GNTA 1TVGA 3ZYIB 2RE9A 1ULGA 1XE7A 2UYBA 3R0RA 3U78A 2C24A 5FZ7A 4C90A 4YG0A 4ASKA 1PK6C 4AQTA 5A3TA 5A7WA 1YFUA 3IDEA 4O61A 5LA1A 2DDUA 3NMBA 1H2KA 5BNOB 3RJ2X 1XYOA 4LIUA 2GNBA 2WZR2 1S1AA 3DGTA 1BLZA 5FPVA 3NV2A 4BQ1A 1OKOA 1BVVA 1VBE3 1GQHA 3MHZA 2WO1A 2JIJA 1OA3A 4P9LA 4M4PA 4XJWA 4CDQC 2HJIA 4MHRA 4Q0PA 3WDVA 2QQNA 1IS5A 1OMIA 2MEV3 1S0DA 2VUCA 5LW9A 1T6GC 3TEZA 4HK9A 1VBE1 5LY1A 1GWKA 1GWLA 4UFMA 3LDRA 5FMBA 4AFAA 2HWC2 1DQ6A 4A45A 1IS3A 1Q56A 2ZOEB 3CJIA 3C8XA 5DUUA 3RPQA 1S0JA 1TNRA 1YJLA 3LSEA 2MEV1 4B1MA 4XUTA 1APNA 1BMV1 3LDKA 4CEYC 3NVCA 1LOEA 2WLPA 5IJRA 2VY0A 4MXWA 3OYWA 5FO8B 5KHJA 1CAXA 4AVCA 2HBTA 2Z4FA 4IGOA 3B01A 4QX1A 3A4UA 3ZM8A 4ASMB 3DKWA 3N9NA 4ZHNA 1IPKA 3OGRA 5GZGA 2BGPA 4OVEA 1BBT3 3F2ZA 3MIFA 2DFBA 3BN6A 4XQWA 3S6PA 1ZREA 1MS3A 3JBG2 2W52A 3OBTA 3FHQA 3MUZ1 2V73A 4GALA 4C1XA 5LK7B 2MNGA 5IK7A 2OZJA 5BY5A 2KD7A 2VPVA 1NCQA 1BBT1 5D21A 3IDCB 4XOGA 2WINB 3KQRA 5F5QA 4DRVA 2YC4A 4LO6B 3W20A 3AYAA 3TEYA 3IIAA 1QF3A 1LOCA 1VP6A 1G7YA 1AR83 2VZOA 4YW2A 3NWKA 5ANQA 3DUIA 3K3OA 1B35A 1IPSA 4DZGA 4IE5A 3OYWB 1W0PA 1GOFA 2VZPA 1YCIA 5FBJA 1ZRFA 4QPIC 3KSCA
chains in the Genus database with same CATH topology
3NAPC 1AR81 5JCTA 2ZHKA 4JVAA 4LHKA 2CL2A 4F83A 2RS13 1VBD3 3QCWA 3IPVA 5C9AC 2D3SA 2B39A 4LE3A 3IWZA 5JOXA 4XJ9A 1O3SA 1UZYA 1C1LA 4KG0A 2RS11 1AXKA 1VBD1 3LKJA 1AX0A 1WUVA 2D7FA 2K0GA 4HLTA 4D7SA 1XQNA 4WVMA 1F9KA 1FMD2 3O0XA 4HBNA 5HCFA 4E4ZA 1G9DA 5DUVA 3ZN6A 3CL1A 4HVOA 2GMPA 4AHWA 4BZ4A 4JTOA 4MLOA 1AL22 1YLLA 4Q4Y2 4AI8A 3ZSMA 4AXOA 2D43A 4N9HA 5CA6A 1LEDA 4OULA 1IGOA 2E7QA 2A7AA 3NKGA 2VH9A 1EPZA 2ES3A 4S2DA 1XNKA 3S0MA 3H3ZA 2XH6A 3D0JA 4LBMA 1I6XA 3TBDA 1RVF3 3B94A 1LHNA 3NV3A 4OI0A 1O4ZA 1ZX5A 4U36A 3L9JT 4FAGA 3S30A 1NG0A 3EXUA 4RQPA 2E7AA 1RVF1 1S0EA 2QVSB 3MPBA 2NMNA 3AZXA 3M3OA 3JQXA 2HWD2 3VKOA 1R1ZA 4JGYA 1S0BA 2XUMA 1RUOA 5CFCA 1RUF2 2YV8A 3WP5A 2BTVC 3KCYA 4Y1UA 3ZIXA 2OVUA 3CNAA 3MLKA 3AXEA 2ARXA 4Y1XA 4DMIA 2WZR3 1PHMA 3IM0A 4AGGA 4BPZA 1J3RA 2YDEA 3N4MA 3M3CA 2PLV2 3OJBA 2AZ5A 3HT1A 3N7MA 3V0BA 4AVAA 3N7KA 4QT6A 2P3KA 4H7MA 2DFCA 5DZFA 2WZR1 2YROA 1QJY2 4XJAA 2IZWA 2VGDA 1PO12 4YW1A 2DCJA 4CP1A 1FATA 1MS5A 1WD3A 1O3QA 2HWC3 1E57A 4CRQA 3KD4A 3RSJA 1GKBA 1ULFA 3M8LA 3QH6A 3WNXA 4MGYE 4ES8A 1ONAA 4Y20A 2C5DA 2HWC1 2DCZA 2JDZA 4O9EA 2BVVA 5I0SA 2EF6A 4Q0VA 2Y26A 1O4YA 2YC0A 3FE5A 4KWJA 3ZVXA 5KC6A 5FBZA 4AFDA 2A70A 3HBZA 3RDIA 1VBC2 3LWCA 1QDOA 4PBOA 3JBG3 4YVSC 2ZHLA 4NHLA 1UF2C 2GC2A 3D4KA 1CAVA 4LEJA 2AH2A 1EPWA 5FLIA 2XJVA 3RNSA 2G9FA 2QFEA 2QZ3A 3WG2A 4FPCA 4ES9A 4AFMA 3JBG1 3ST7A 5DG1A 4QX5A 4FVVA 2XVLA 4OUMA 1W6MB 1LOFC 1OOPA 2B5HA 4XIKA 2NMOA 4BMEA 2P34A 4OHVA 4AVTA 1TEIA 2XWBB 5CG8A 1XU2A 3WX5A 3GZAA 4ZU5A 4K9SA 1QWRA 3WINE 1WA4A 1DQ4A 2UY9A 2DYCA 2D3PA 1O3TA 2VG9A 2RM22 3WCSA 1W6PB 2JJ6A 3FBMA 4GWMA 5FMOL 4LBQA 1TME2 2XL9A 3VHNA 4XF1A 2BYVE 4YNIA 2O0OA 4CDXA 3PTYA 4JTNA 5EYXA 1W2UA 3ES1A 5CBLA 2VMIA 3KMHA 4MGZE 4GH4C 5GZFA 1QMJA 4LHNA 3PMSA 1BCXA 3U10A 4CDWC 5AFEA 3E5QA 4L9BA 1FMD3 2D6KA 3NL1A 4CDUA 4HMZA 1RC6A 1OOPB 5J09A 2D6OX 3O0WA 1F5FA 4AEDC 4DINB 4NO4A 1DBNA 3JZVA 5BNNA 1FMD1 4H55A 2DVDA 1AL23 4Q4Y3 5BPXA 5K0UC 4WM7A 2QDNA 1DZRA 2ZGOA 3ILRA 2DU0A 4MYEA 4GKYA 4B7EA 3PJYA 3OPZA 3VBHB 2D5HA 1AL21 1D2QA 4Q4Y1 2NN8A 3C2UA 3E6BA 1NOVA 4AVBA 4QQ2A 2WSUA 4L92A 4EWEA 1DF0A 3U4XA 2PAMA 4P9IA 5JOWA 4ASLA 4YRDA 5ABJC 2ZX0A 1C1FA 1JUHA 4J1XA 4F8AA 1MZFA 2VNRA 1S0FA 4IXLA 4JGZA 2HWD3 3R4SA 3IKWA 2R1DA 5GLZA 1RUF3 2GC0A 2GDFA 3UV9A 5KXDA 1MZ5A 5C4WB 1RB8G 5KWRA 4KG8A 1Q8OA 1QQP2 2E9QA 3ZFFC 1CX4A 1Q8PA 3J4UH 2FMDA 1RUF1 5FOJB 2O8QA 3NSTA 2PLV3 5CU1A 1HRV2 4R8HA 2VW0A 2LUWA 1V6MA 4JRLA 3LGRA 5TSWA 1AYM2 1LULA 4IEVA 1QJY3 3TN92 5HCAA 1ENQA 1MS1A 4IEZA 5I0UA 2PLV1 1N3QA 4IEWA 1PO13 3ZFEA 1VJ2A 3GNEA 5DG2A 1G9FA 1YIPA 4F3JA 3THPA 2WT0A 3M1HA 2Y0IA 1QJY1 4BLJA 2BVBA 4JGZB 3R05A 4FOYA 2WSVA 3WW1A 1GV9A 3I2DA 1GNHA 2AR6A 1IHMA 3URFA 1SLLA 1HQLA 2VOKA 4P5HA 2BNMA 1O91A 1VBC3 3AMQA 1DYKA 4RHV2 4FT8A 3MDPA 2DF7A 2JG9B 4YGDA 3R4UA 4LR4A 1V00A 2VUAA 1VAKA 1JYIA 4XFGA 2QUOA 1SQ4A 4PJYA 1VAVA 1KRIA 1VBC1 5BNPC 5JOZA 5J37A 2RJKA 1PIV2 3OY8B 4OLLA 4IV3B 1ND2A 1UCXA 3SNMA 3AMMA 1ZM1A 3UKVA 3VBOA 1N47A 3E6CC 2AREA 1H2NA 1GZCA 3I59A 2BFUL 1EAH2 3H1YA 1C5IA 3JQWA 4QPGB 4YARA 3QD6A 1W6QB 2KA3A 4JRAA 5JMCA 5JWPA 3OD4A 2XLGA 4CEWB 2RM23 3OGGA 1NE4A 4EN0A 1VBA2 4N43C 2VVDA 2ZCWA 3RI8A 1TME3 4PCRA 4ZXKA 2WC2A 3ZXKA 1DLLA 2DURA 3GHNA 3SH4A 5JOYA 5T50A 5C8CC 2RM21 1O7FA 1GNZA 2XLFA 2CGNA 2P37A 1XE8A 1TME1 2ZGPA 3ETQA 3WDYA 3KT7A 2AGSA 1ND2B 4X6QB 4IL7A 1AHSA 4PDWB 1DGRN 2A6XA 1CAUB 2IC1A 4JDOA 4ZKTB 5T5JA 4BA6A 2BFUS 2D6PA 2QKDA 4IV1C 3WT3A 4BMBA 2GNDA 4BHPA 2R16A 2YGMA 4OI4A 1A6CA 1PK6A 1LB2A 2H0VA 2Y0OA 4MVTA 5JIUA 1SBEA 1NA1B 3VZNA 3VBFB 1LOBA 3VBRB 3GBWA 3MEPA 4EWAA 5EYYA 4CDQA 1DQ1A 4BLIA 4NR1A 1S0IA 1V9U2 2PFWA 5F6LB 1MS9A 4YM0A 1REDA 1MZEA 4BWOA 2WNVC 3FFZA 4ISRA 3DV8A 1UKGA 4S2GA 2ZGNA 1QQP3 1BKZA 5D8AB 1G9AA 2ZACA 1RUD1 3O7OA 4IEYA 4Z07A 3RYPA 5L19A 3VL8A 4CZSA 2EXJA 4CEYA 4JDNA 4AEKA 1UPIA 2ZX3A 1HRV3 1ULCA 2OW4A 1QQP1 2PHWA 1AYM3 1HV1A 3TN93 3HD8B 1IOAA 1HRV1 2DVGA 1MVQA 3J8F2 3SLIA 4Y24A 3TYJA 4I0BA 1PVXA 4RS5B 2LALA 2D93A 5AC92 2O8OA 3AZZA 3CO2A 3SXWA 4W6YA 3TN91 1VAMA 2G4IA 4LBKA 5HBAA 4KGGA 1TQ5A 3W9AA 1NLRA 1Q3EA 3D0SA 4YZ5A 4XBQA 4B8EA 2Q0AA 2X5IC 4META 4RHV3 3BODA 3ZDSA 2VMHA 2BEOA 1M4WA 2RS52 4HKOA 3AFGA 4DS0A 1GZ9A 2R042 2A71A 4YZ3A 2OYZA 3W59A 3NAPA 1F2NA 3ZFGC 1PMIA 2PHLA 2XKOA 3X29B 2JECA 3PNAA 2IXIA 3E5XA 4WM8C 4RHV1 5C9AA 1PIV3 4QMAA 4BE3A 3V0AB 4Y4YA 1AL0G 4SBVA 3J9SA 4RR3B 4N53C 1WLWA 1PIV1 5GZCA 3WUCA 2B7YA 4Q1RA 4XF9A 5GLTA 5EV7A 1EAH3 3ZIWA 5CB7A 1YIFA 2QCSB 1FPN1 4H3WA 4XEZA 4OHYA 2B46X 2V09A 2WWSA 1VB4A 3KT4A 4QM9A 1AR82 5BYNA 5JSOA 5T5LA 4LBNA 1EAH1 1H1IA 1VBA3 2Q5TA 4L2NA 1MR5A 4NWVA 3AKRA 3UKNA 2ZGQA 1CJPA 1VBA1 3MIEA 2RS12 4P9WA 4PIXA 4AHZA 5JR7B 2R1BA 3IMNA 4DPNA 1C28A 1DGWX 5I0TA 4AF9A 2IFRA 1I3HA 3SMHA 2QQPA 2W0XA 2MHFA 3FLRA 1RL3A 3PVEA 3KCXA 1O5LA 3S7EA 1RUNA 3RMYA 3D82A 3J26N 2BGCA 4Z82A 3ZXDA 3OCPA 1JH5A 3NV1A 1HRI2 5C8WA 2JE7A 1W6NA 1SLAA 2WFF2 4KGQA 1CD3G 1BYHA 4Z2WA 4PIZA 4HANA 3H1MA 3ZYRA 1ZZ6A 3AMNA 1EY2A 1WMEA 3QBQA 3ZYJB 3MIDA 1LODA 4DFSA 1LHOA 3TWIA 4A7ZA 1QJX2 4Z8BA 2XJTA 1DFQA 3MLLA 2DV9A 5CFDC 2OZ6A 3HIFA 4OI2A 4UXAA 1V9U3 3VDDB 1KS5A 4NPRA 2IXLA 3AYCA 5L7OB 1OFNA 1RUC2 2TUNA 4IEQA 4FO9A 3ZSLA 1RUE2 1V9U1 1V6KA 1F31A 1NXMA 3N7LA 2TBVA 3POWA 5DZEA 3CEWA 4XJZA 1D0HA 1HX6A 2F6BA 5GZEA 4WBBA 4LE4A 3WXPA 4XFHA 1GSLA 1FX5A 2ZX2A 4JAAA 3VHOA 5KHHA 1ALYA 1WGPA 2ZGTA 4YYOA 2K2SA 3AXDA 1ULEA 2WNUC 5KXBA 3J8F3 2R6QA 4OUSA 4YVSA 4AFCA 5FLHA 3D5OA 4BH9A 2A6ZA 5AC93 4ITCA 5FDBA 2JX9A 5I93A 4LNVA 3J8F1 3VKMA 2VOVA 4M3CE 1KITA 5BUVA 5EWSA 1WW6A 2VOWA 1H9WA 1POV0 5AC91 2XPJA 4Y5Z0 4NHKA 3B00A 1LOFA 1J3PA 2XJSA 5FREA 4IEOA 4M01A 5FRAA 3FWEA 2RS53 4HVQA 2R043 1Z0HA 3ZN4A 2V5YA 3SHRA 4NOTA 1FI2A 1YXWA 3M3EA 3SCFA 4K21A 3MW2A 3AKPA 3AYEA 2RS51 1PO22 1KDKA 2PAEA 4LO5B 2R041 2DUPA 4AE2A 2HEYF 4FSJA 4B4RA 3AB0A 2Z42A 3I7DA 4GH4A 4OHWA 1QH6A 3ROUA 3MF9A 4M3CF 2WQ4A 3ZXEA 4BYYA 2TNFA 1UL9A 1QH7A 4CDWA 2EIGA 3WVJA 4CP2A 1J58A 4U2AA 5SV5A 1K5MC 1IZ3A 3D8CA 5GALA 4PF5A 4AEDA 3CJIB 4GMP0 5J3UA 1CPMA 1O5UA 1S0GA 5FAXA 5K0UA 4MXWB 2R072 1CAXB 3HR9A 4LA2A 3JB4C 5JZGC 4D69A 2JENA 2B42B 4D94A 3VBSC 3HN1A 4XIOA 4AEJA 4YZ1A 5JPNB 4FCAA 2EALA 4BIFA 4LA3A 3OGJA 4GXLA 2D6MA 1EV12 5JDBA 5KHIA 3FBYA 1NCQB 2QDRA 2Z5WA 5ABJA 1CAWA 3RMXA 4AQ6A 1NCRC 4BOWA 3SCGA 4YFWA 1Q8SA 1MQTA 1HRI3 1DZTA 2D97A 2Y38A 3AM2A 4H14A 5IK4A 2WFF3 4XBNA 4DNYA 5LRSA 4UW5A 3ZFFA 1B35B 1RJ7A 1HRI1 1OQEA 2ZGLA 4KNCA 3VZOA 1UAIA 2WFF1 2OUJA 4HVRA 3ZMOA 1OPOA 3KM5A 4YZ4A 1QJX3 4RFT0 4AGRA 3ZPYA 2BUKA 1W0OA 3IPVB 1QNWA 1FXZA 4EN9B 1RIRA 1I1EA 2KXLA 5LEKA 1QJX1 1RUC3 4TLFA 1GR3A 4COUA 1RUE3 2D6LX 4LO8A 3JD72 1GZWA 1UD1A 1ZZ7A 4YVWC 4WVMB 1UW8A 1TMF2 2PHTA 1MQTB 1BZWA 2VOXA 1RUC1 1RUE1 3ZN6B 1KQRA 4MH0E 4C0BA 4E2SA 4MV2A 3BB6A 4I0WB 2C0ZA 2XJUA 4N90A 1REEA 2WNEA 4I02A 5I8YA 4Y26A 4UBHA 4DY3A 4F7ZA 1QDCA 1KJLA 4XFIA 4YGEA 2BPA2 2VXRA 4IEXA 4FAHA 1IKPA 2WQZC 3H3UA 2GAUA 3DPRC 1YFXA 4JDMA 1NY72 1RHI2 1U5ZA 4FPGA 3E97A 4X8NA 4RQPB 1Y43B 4XF0A 2A3WA 2YZ4A 3HMYA 4R4ZA 1BEV2 1GICA 1VBB3 2UWCA 5BNOC 1UPSA 3TNQA 1MS0A 2X53S 4JGYB 4BCUA 1D4M2 5CFCB 3AMPA 1VBB1 3OD0A 3ZXGA 1PO23 4XF3A 2OA2A 1QOTA 4M3CA 4N43A 2QJVA 2TEPA 2ZTNA 4LBQD 5JSPA 1CVNA 4URTA 2HWB2 5GLWA 3V0BB 2AYHA 1HKDA 1NZCA 3VZJA 4E2QA 1PO21 4QXKA 1GQGA 2YYOA 5DZGA 2VVFA 1KD7A 3QH7A 2E7TA 2UWAA 5E16A 2JG8A 4FPYA 2XLAA 2IFWA 4IV1A 2PQQA 3RI9A 5KHGA 2A6YA 2VVEA 2PHFA 4Y20B 3AJZA 2R073 1CQ9A 4H7LA 1KJRA 1ZBE2 4L99A 4WZFA 3SH5A 2EVXA 1SFYA 1V70A 5H9SA 4GKXA 4KH9A 2R071 5DUXA 4DY5A 4AVVA 1KXGA 3P3NA 1QHDA 3V65A 3FMGA 3JCIA 4BM8A 4AHXA 1CAVB 1PGL1 5FQ0A 5K8SA 1EV13 2MPFA 1ZRCA 3ENRA 1WCKA 5D1IA 3USUA 5JSRA 4IETA 5A3LA 3V56A 1H1AA 1EV11 1FAYA 2JG8B 4AI0A