4DCKA

Crystal structure of the c-terminus of voltage-gated sodium channel in complex with fgf13 and cam
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
153
Chain Sequence
SVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRSLKHASFLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Ternary Complex of a NaV C-Terminal Domain, a Fibroblast Growth Factor Homologous Factor, and Calmodulin.
pubmed doi rcsb
molecule keywords Sodium channel protein type 5 subunit alpha
molecule tags Transport protein/signaling protein
source organism Homo sapiens
total genus 51
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2012-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 4dckA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 4dckA02
2FOTA 2JTTA 4FTGA 4YI8A 4YBHB 5DKNA 3TUYB 1IGVA 2BBNA 1A75A 3NSKA 2L2EA 1K9PA 5GQQC 2M29A 4MLWA 3EVVA 1DJYA 1G8IA 1KK8B 3GK4X 1EXRA 2E30A 1A29A 3OB2B 1RJVA 4I5NB 5HLOA 1RK9A 3DF0A 1OOJA 3I5HC 3BOWA 1WDCB 1NX3A 4MZKA 1QX7A 1UHIA 3BUXB 3CWGA 2KQ6A 4PHKA 1WRZA 2F3ZA 3KHEA 1JSAA 3PFVA 3A8RA 1EJ3A 1F4OA 1BR4B 2KGBC 5I2QA 1OE9B 1XFVO 2WCEA 1M45A 5HLVA 2COLB 1QX5B 1KQVA 2P6BB 3NSLA 2BBMA 3BUNB 4ZCUA 2M0RA 4GUKA 2CTNA 4MEWA 3NSOA 1KWOC 3LK1A 5FYXA 4CLNA 1B47A 4JPZB 2JT8A 4HREE 5CSNA 1PRWA 3BOWB 1OZOA 4PE4A 1OSAA 3I5GC 2LVKA 2K7DA 1UHHA 4I5JA 3VRRA 1YUSA 1SNLA 1ALWA 2MAZA 1EH2A 1F54A 1ZMZA 2KFFA 1SW8A 1JF0A 3GK1A 1FPWA 2BCXA 1C7WA 4AQIA 1SL8A 1LA3A 1VRKA 3NSIA 3O2PA 1H8BA 5DKQA 1OFCX 4ICBA 3SIAA 2JPTA 1JUOA 2LVJA 3O4YA 3IF7A 1BG1A 2JNXA 2E6WA 2MBXA 1JBAA 1MHOA 1S5GZ 2K7OA 2JZIA 1SCVA 2ZNEA 2KAXA 5JJGA 1G4YR 3SIBA 2ZRTA 1WLMA 1F70A 2JQ6A 4MRYA 1Y1UA 1L2OB 1WY9A 1J7PA 1XFZO 1GQMA 1YRUB 1XFYO 1F8HA 2K2AA 4PHMA 5IBWA 2M1KB 1OMRA 1Y6WA 4DS7A 1NX0A 2LAPA 2MA2A 1JWDA 2LVVA 4BY5A 3WHUB 1W7JB 2F2OA 1PALA 3IQQA 3LCPC 1J1DA 1OMVA 1CMGA 2BCAA 1B7TZ 3AAJA 2HETA 2RGIA 2JT0A 2LP2A 1WLZA 1RFJA 3EK8A 2I2RE 1SKTA 1YX7A 1MF8B 1Q80A 1UHNA 4JWQA 1DJZA 1EG3A 2VRGA 3SG7A 3SJSA 1YRTB 1IJ6A 3I5IB 4ORAB 1XFXO 4YGAA 1UURA 2PVBA 2Y1MA 1TOPA 4MZJA 4MSPA 4OCIA 1BR1B 1DF0A 2NCOA 4IL1A 5CSJA 3CR2A 3VRNA 1QASA 2EHBA 1WRLA 1MUXA 1S1EA 2JWWA 1B1GA 2KOTA 1AHRA 2L5XB 2KI4B 1N2DA 1CM1A 1SY9A 2ZN8A 3OB1B 1NWDA 4YGBB 1Y0VH 4YGEB 1FI5A 4WRIA 1NCYA 2PSRA 4M2PA 4DIRA 4WQ2A 1KSMA 2M9GA 2NZ0A 1S26D 4NDBA 3AAKA 3KO0A 2TN4A 2LHIA 2K2FA 2KGRA 1PSBA 2LE9B 1G33A 1KFUL 2JC2A 3EK4A 3K21A 4MN0A 1XO5A 4P5OE 1JC2A 1PVBA 1DF0B 1KK7Y 3CR4X 4PALA 4XYNA 2LLSA 3PM8A 2LC5A 4GGFC 1BOCA 3WXAA 2BL0B 2QACA 4BY4A 1DJIA 1QVIZ 1WRKA 1UP5A 1K96A 1CLMA 2BE4A 2M1UA 3F45A 1BLQA 1BF5A 1C07A 5ER4X 4DRWA 1BMOA 1D1OA 2JT3A 1HT9A 2SCPA 3LL8B 1IH0A 1CKKA 1GJYA 2LMTA 1XYDA 1B8RA 3EK7A 1A4PA 1M31A 5HKYA 1X02A 2WCBA 4PE7A 5I2OA 5KTYA 3TUYC 1TNPA 1EL4A 1W7IB 1DJXA 1YURA 3AKAA 1S36A 1U5IA 2OTGB 3BUMB 1KK8C 3MSEB 1J7OA 1TNQA 2PALA 2LLTA 5PALA 1WDCC 2LLUA 1SL9A 3DVEA 1J7RA 2KHNA 1J7QA 2KBMA 2ZFDA 3SG6A 1K90D 2O5GA 1A75B 3O6BA 2HQ8A 2KDHA 2OTGC 2IS9A 2KFGA 3JTDB 1KSOA 1B4CA 1J55A 1QX2A 2LUCA 2JRFA 2H61A 2PMYA 3DF0B 4PE1A 4QJ3B 2D8NA 2LNKA 4XJKA 2FJUB 1YR5A 4QJ4B 1PULA 3CR5X 1MWNA 2CXJA 1QLKA 2WORA 1RROA 5HKWA 4GNKB 1CMFA 1NP8A 1YX8A 2NXQA 2LP3A 3VGOA 1R6PA 3CLNA 4HRHA 2A4JA 3OX5A 3C1VA 2CNPA 5D7FA 2Y9YA 3RM1A 1K2HA 4PE0A 3M0WA 4E68A 4PHNA 1DGVA 1QIVA 2OS8B 3A4UB 4N5XA 2JXCA 1OQPA 1QLSA 1DT7B 2Q91A 1NCZA 2JULA 1YUTA 2L51A 2KI6C 3D0YA 4CFQA 4XJKB 1FBVA 2F2PA 1SR6B 2JNFA 4YI9A 1KFXL 1SCMB 1BT6A 3DD4A 2K61A 1DJWA 3GOFA 5F6TA 1OZSA 1S6IA 1N65A 1K94A 5CSIA 1IQ3A 1F4QA 3TZ1A 3PLFB 2I7AA 4N1GA 1L2OC 1UUSA 1XFWO 3JVTB 3DVKA 1IG5A 1NCXA 1CTRA 3DVMA 3GK2A 4PDZA 4MRXA 3PSRA 1XK4A 1YVLA 5G08A 1Y1AA 3SG2A 2DOQA 1KCYA 2F33A 1GGZA 1K8UA 5J3XA 4I5KA 1AVSA 1NYAA 3KPXA 3OX6A 3JVTC 3ICBA 4GAOA 1HQVA 1TCFA 3ZWHA 1PK0D 1LA0A 4M2OA 5ER5A 4L9MA 1SK6D 3D0YB 2ISDA 1JFKA 4CFRA 2EC6B 2MJWB 1QV0A 1CNPA 4DCKA 4WQ3A 2AUCA 3D10A 2L98A 4GGNA 2K8MB 3I5IC 4OR9B 5HKZA 2HPSA 1M39A 4FQOA 1CLBA 1SMGA 2I18A 1LKJA 1B8LA 1K9KA 1NUBA 1IJ5A 5B8IB 5BPJA 1NIWA 1YUUA 1CDNA 3VRPA 4A4BA 5HYDA 1F55A 2G2BA 4I5LB 4ORBB 2GV5A 1YVHA 1N0YA 1CLLA 4NQGA 3SG5A 2KI4C 1S6CA 3CGAA 2M49B 4MZLA 1J1EA 1QIWA 4YGCB 4N1FA 2QPTA 4Q04A 3I5FB 1QTXA 3ZNIA 1ZACA 1GGWA 3OHMB 2KNEA 5D69A 2EGDA 2KFHA 2KYFA 2MHHA 1MR8A 1FI6A 4MVFA 3QRXA 1RECA 5AANA 1EG4A 2KI6D 5AXIA 2ZKMX 3I5FC 3NXAA 1IRJA 3EKHA 1XA5A 1JFJA 5TNCA 5AFPA 3OP0A 1M63B 1A2XA 1NX1A 3FIAA 4AOMA 1CB1A 2BL0C 4UPGA 4YRUA 2HQWA 1E8AA 1NX2A 2KAVA 5CSFA 2BKIB 4D1EA 1TIZA 2WCFA 1K93D 1RWYA 1LVCD 1SBJA 4R1EA 2WNDA 2AMIA 1CFCA 1FF1A 1QXPA 2FCEA 2LV7A 1IQ5A 1OMDA 2FCDA 1PVAA 3TDIA 3I5HB 3BUWB 4PCWA 3PALA 3PATA 1UHKA 2O60A 4NDDA 3LLEA 4JQ0D 2BE6A 1KFUS 1CDPA 2M8UA 2M97A 4OV2A 3TDUA 3WHTB 1DVIA 2NCPA 1NSHA 1S5GY 1K95A 1IWQA 1KK7Z 4AQJA 2R2IA 2L4HA 1BODA 3KF9A 2I94A 4ETOA 1V1FA 5JOLA 2LCPA 4P2YB 2F3YA 3JTDC 4U8DA 1KWOB 1U5IB 4C0LA 1B8CA 3VRQA 2BCBA 3DVJA 2K7BA 3LK0A 5DKRA 2AAOA 3BQ3A 3CTNA 4M2QA 4USLA 3I5GB 2LVIA 2GGZA 1NPQA 2LUXA 4OKHA 1DGUA 2LHLA 3EVRA 1B7TY 1TN4A 3IQOA 3CZTX 1AUIB 2BECA 3SG4A 1H4BA 2F8PA 2K0JA 4OVNF 4CPVA 1XFUO 1CDMA 1S3PA 2CT9A 2CBLA 2JTZA 4PHJA 4GFTA 3VROA 3E3RA 2B1UA 3EVUA 1RTP1 2LMVA 1Y1XA 2OS8C 3FS7A 3KEVA 1TTXA 5K89A 1SRAA 1TCOB 2K7CA 4YGDB 5AERA 1M46A 4QJ5B 2KYCA 2Y1NA 4GPLB 1V1GA 1LINA 1TNXA 2H61C 1PSRA 1LXFC 3AKBA 2L50A 2LMUA 4CIDA 3HX4A 2MLEC 4HSZA 1S6JA 1SR6C 1SCMC 3FWCA 4MBEA 3RLZA 1MXEA 5I2LA 2Y4QA 2M3WA 2MLFC 2V53A 2ZNDA 2OPOA 3FWBA 4A4CA 4NDCA 3BYAA 2H2KA 1YTZC 3EKJA 1MQ1A 2M7LA 1ZOTB 1SPYA 1SL7A 1UWOA 4ORCB 1CFFA 1IKUA 3SG3A 4C0KA 1ZFSA 1CDLA 1QV1A 1B9AA 1CFDA 2WC8A 3BXKA 1A03A 3PN7B 2CCMA 1AJ5A 4HRGA 2JU0A 2Q4UA 2Y9ZA 1BJFA 1QVIY 2JOJA 2PRUA 2SASA 2EC6C 3CS1A 1ALVA 5CPVA 5AEQA 5I8NA 4GBAA 2JXLA 4GGFA 3PN7C 4F0ZB 1MXLC 2KQYA 1ODBA 1KFXS 1FW4A 1DJGA 1AJ4A 3BUOB 3HCMA 3O78A 1DMOA 1XK4C 1TNWA 3WNXB 1AP4A 1UHJA 2L4IA 4TNCA 2LM5A 2ZN9A 3TS5B 1JF2A 2M7NA 5KSZA 2G9BA 2GGMA 5KU1A 1K9UA 3TDZA 2KBIA 1QS7A 1CFPA 2L0PA 2NLNA 1KQMB 2MRDA 2WOSA 3TS5C 1BU3A 1SYMA 2HF5A 1C7VA 3H4SE 4C0JA 1F71A 1XVJA 1L7ZA 1KQMC 1QJTA 2Y5IA 1R2UA 2LANA 2BKHB 1QATA 1AK8A 2ZRSA 4DUQA 4ZCVA 1DTLA 1CM4A 2KAYA 1DJHA 1TRFA 2PASA 2KSPA 1ZUZA
chains in the Genus database with same CATH superfamily
4YBHB 5DKNA 3K5BA 3TUYB 1A75A 2OYHC 1LTJC 4BRYA 4CPGA 2QIWA 4D6TG 2KIKA 1TWOA 2E30A 2J58A 3OB2B 2FXMA 2OYIB 3DF0A 1SQPJ 2FYUG 1G2CB 1ZR4A 2GM4A 3RL0D 3BUXB 2KQ6A 5HL1A 3MUDA 1F4OA 1BR4B 1XFVO 5K5GB 1AVYA 1M45A 2COLB 1OOFA 2P6BB 2HR3A 1T14A 1KILE 4KT0J 3RK2B 4ZCUA 1NTZD 1N7LA 2CTNA 1KWOC 3LK1A 3KZIH 4CLNA 1YQ4C 2N1TD 1XFRA 3H6PA 3H25A 3I5GC 5FI7A 3H32B 1FU1A 2RMZA 3RGUA 2MAZA 4H44D 4XE5B 1SW8A 1FPWA 1URQA 2FYUK 3L75G 4ICBA 3SIAA 1JUOA 3L72E 3VN0A 1BG1A 3RK3B 2E6WA 1IFJA 1VQKP 1FJPA 2ZNEA 1OOHA 2E76D 2ZRTA 3MHVA 4MRYA 1L2OB 1XFZO 1XFYO 3Q5RA 2A06E 1KYOI 2QJPB 4PHMA 3SWFA 1OMRA 2WSCJ 5APYA 1L2PA 4C7RA 5AW6B 1W7JB 1JY3O 1B7TZ 1EQ7A 2RGIA 3PP5A 1SKTA 1YX7A 1N86A 1EG3A 5CCGC 1YRTB 1IJ6A 3I5IB 4ORAB 2I1JA 1UURA 1VF5B 2NCOA 5CSJA 3CR2A 2Q7CA 2WCHA 1WRLA 3LW5H 1S1EA 2JWWA 2L5XB 4YGBB 1CM1A 1SY9A 2ZN8A 3KPEA 1GDTA 4YGEB 4WRIA 2WSEJ 1LS8A 2P7JA 4FQTA 1YITP 4H0LC 1S26D 1SQQD 2LHIA 4XA4A 2K2FA 1NTZE 2A45H 1PSBA 2IDBA 1RF0C 1G33A 2FY8A 3EK4A 1USEA 1JY2P 1DF0B 1NYHA 5H2FE 3D75A 2LC5A 1N8RQ 4GGFC 4PV1D 1FAVA 2BL0B 2QACA 4UB6E 1DJIA 2WPVB 1WRKA 1UP5A 2QDIA 2M1UA 1BMOA 1J2JB 1A02J 3C8VA 3H1ID 1OVUA 3EK7A 5APSA 3B71A 1A4PA 1M31A 1L0LG 1JM0A 1BCCG 1PIXA 1S2EA 3TUYC 1TNPA 1W7IB 2IFNA 2H89C 2GUSA 3BUMB 2HFED 2KXPB 1DEBA 2HYNA 2OYIC 3CWBE 2XU6A 1SL9A 3DVEA 1RQVA 5KJ7A 3SG6A 1K90D 1H89A 1SQBG 1M57D 3A2AA 1OVRA 1B4CA 2JRFA 4L76A 2DW3A 4PE1A 3MP7B 3D74A 2R5BA 4KHXA 3RK2C 4QJ4B 3HTKB 1FS0E 3Q1MA 1MWNA 2CXJA 3M0DA 4PD4D 1NTMJ 2CPBA 4GNKB 1GU5A 3VGOA 1R6PA 4XFJA 1L0LK 2PGDA 1PFIA 3CMEP 5AVRB 4O9BA 1K2HA 4PE0A 3MTUE 4PHNA 2L2CA 1T2KC 3BRTB 2ZVNB 2H43A 1SQQE 1QLSA 2Q91A 2L51A 2WC6A 4JYCA 3D0YA 4CFQA 4GKGA 1SR6B 4KJMA 1KFXL 2A06G 1SQBK 2B88A 1DJWA 3GOFA 1YQ3C 1RF1B 3L70G 1KZUB 2I7AA 1L2OC 3JVTB 4OZDA 4PDZA 4MRXA 2QJPC 1AVOA 1SSEB 1GL2B 1GGZA 2IX7C 1K8UA 3VP9A 3Q5SA 3BFBA 1HQVA 2J5UA 1LA0A 3RL0B 2J59M 3H1LJ 1VQLP 5H2FH 3KHUA 1VPCA 1VQOP 2L98A 4GGNA 3I5IC 4FQOA 2K9JB 5BPJA 4UB6H 1B8LA 4HH2A 1VF5C 1X79B 4WBAA 4A4BA 3BCCG 3TNUA 2GV5A 2I8DA 1CLLA 3OA7A 1CSBA 3S9OA 2N1TB 1J1EA 3P7KA 2QPTA 4H44B 3TGUE 1D7MA 2MHHA 2ZXXA 2P58A 3EFFK 3L73J 2KI6D 5AXIA 5AVZB 3CI9A 3S0GA 3MGNA 1A2XA 1IFPA 2BL0C 4UPGA 4YRUA 1GZLA 1IZNB 4ZKPA 1DX7A 1TIZA 1K93D 1JTHB 2WNDA 2AMIA 4D6TJ 1FF1A 1IQ5A 1NTZK 1YJNP 3TDIA 1PGQA 4NPFX 2FYUJ 3W68A 1DIPA 3BVHA 3L71D 3PALA 5BU8B 2O60A 2E74B 1KFUS 2M8UA 2WWWA 4OV2A 3TDUA 3AEEC 1BODA 5APVA 1HJ0A 4WVZA 3CMAP 5JOLA 2LCPA 4P2YB 4K3AA 4U8DA 3DVJA 2K7BA 5DKRA 3BQ3A 4M2QA 2LVIA 2GGZA 4OKHA 3AEDC 3HRNA 3EVRA 1M8OB 1TN4A 1AUIB 5KTBA 1LT9B 3PLNA 1SQQG 4CPVA 4I6MC 3L75J 4EIJA 2CBLA 1Q86Q 2AXTE 4N6JA 3RL0g 3E3RA 3EVUA 2YNYA 3KEVA 4PV1B 5AERA 5APXA 4QJ5B 2KYCA 3QH9A 1TNXA 2H61C 3CCUP 1PSRA 1OX3A 2Q3EA 1KYOD 1KFNA 2N9BA 1SR6C 3FWCA 4MBEA 2FYNB 2JJLA 5KKZB 1RF1C 4GODA 2V7QJ 2OARA 2M3WA 2ZNDA 2V53A 3FWBA 4HJGH 4NDCA 5BU5A 1YTZC 2BNXA 3H1IG 1CZQA 1ZOTB 4ORCB 1IKUA 1ZFSA 1B9AA 4GOFA 3BXKA 1A03A 1SQQK 3CCVP 4HRGA 3RL0C 3VMZA 2B89A 4LGDE 2Y9ZA 1MFZA 1QVIY 4YXWH 3L71E 5I8NA 3AE1C 4JD9A 2JXLA 1ZV8A 1NHLA 3PN7C 3AE6C 4EI2A 3F5HA 3L36A 4EDFA 3CC7P 3BATA 5CMZA 5AVXB 1EXJA 1DJGA 3IAOA 3W67A 4ZNCA 3O78A 1FZAA 1DMOA 1EC5A 1TNWA 1UHJA 1DD3A 2QEVA 4JKTA 2WPRA 1GW4A 1M1JB 2AEJA 2WT7B 2M7NA 2N1TC 3P8CE 3E1IA 2G9BA 1Y9BA 3E1RA 3TDZA 4H44C 3LIEA 5GTIE 4TLFA 1KQMB 2WOSA 1HGVA 5AW8B 2O01H 1BGYG 3TS5C 1SYMA 1KORA 2NZ2A 1C7VA 1JCCA 3B4SA 2L5GB 1R5LA 3A0BE 1F71A 1FZEA 1XVJA 1T3JA 1QJTA 2LANA 2OYHB 2FFDA 1PPJD 2E76C 4ZCVA 3GG2A 1BDCA 2KAYA 3KO0A 2KSPA 3L4FA 1L0LJ 4IL6E 2YMKA 2FOTA 2JTTA 4FTGA 1BCCJ 3NSKA 1FZCA 1KYOE 3NMDA 2YMYA 3EVVA 1T8ZA 3GK4X 1EXRA 1A29A 1RJVA 1LP1B 2I1KA 1HVVA 3S4RA 3H1JE 3T97B 2KPHA 3BOWA 1IFNA 5AW3B 1WDCB 1NX3A 1CI6B 3H1HG 2AXTH 4DJGA 5B5EE 3CWGA 2K60A 4PHKA 1NOHA 1SQBJ 2E74C 2F3ZA 1K8AQ 1G1IA 1NH4A 3U1CA 5HLVA 1GD2E 3G6EP 3NSLA 3CXHI 4MN4C 2N9YB 2E75B 4Z1MH 4HREE 1SFCD 2W83C 1OZOA 1NTKD 5CCHC 2LVKA 1F54A 4IFFA 2YXQB 1LT1A 5CBOA 2BCXA 1C7WA 1SQVE 1N7SD 1LT9C 3NSIA 2ERBA 2KLDA 2ZT9B 5DKQA 1PL5A 3BRVB 3ITKA 2LVJA 3O4YA 1OXZA 3ZDMA 3DXLA 1GL2A 1MHOA 1KQGB 3NGVA 2JO1A 1NVOA 5AVVB 5JJGA 4PV1C 2KAXA 3L70J 1JOCA 1HF9A 3SIBA 5KAIE 3S0BA 2WPQA 1YRUB 3L47A 4U3FE 1SP4A 2FYNC 1Y6WA 5KKZC 2YGUA 1DELA 2OQQA 4B86A 3C1LA 3A7OA 3WHUB 2H8VA 1PPJE 3AEBC 3IQQA 1J1DA 3HE5B 2NPSD 1KILD 2BCAA 4C7NA 5AW0B 2ZXEB 3EK8A 1QGKB 5GTIH 4JWQA 3SG7A 1Q80A 3SJSA 4WY4B 1S9KE 1NKNA 1P84I 1L4AD 4OCIA 3A0BH 3A5TA 1ZN5A 3BCCJ 3GF7A 1MUXA 5E79E 2YO3A 1X0TA 2P71A 3USSA 1AHRA 1FJKA 3R2PA 2KP8A 1FI5A 2WQYC 3S0AA 4UB8E 2JKVA 4IL6H 3LIDA 4DIRA 4WQ2A 1KSMA 2NZ0A 1EZVG 3GF3A 1KYOH 3AAKA 1N73A 1PP9D 2IPPA 3M06A 3V2LA 2KGRA 1KQSO 2LE9B 1M1JC 3CCSP 3B5NB 1S5LE 2JC2A 1NU1D 3K21A 4MN0A 3JCUE 3OAKA 1PVBA 5B5EH 2QEBA 1KTMA 2LLSA 1HJBA 1BOCA 3WXAA 3OBVA 1H88A 1RE4A 1QVIZ 4EYYQ 1BDDA 1QWVA 1K96A 2Y0DA 1C07A 3AECC 1IJDB 5ER4X 4DRWA 2SCPA 1IH0A 1CKKA 2LMTA 3B7AA 3G71P 1B8RA 5HKYA 4PE7A 1EL4A 2MKVA 1AFOA 1OWAA 3AKAA 1ZLLA 2W27A 5AVYB 1A02F 4LLHA 1TNQA 5APUA 2PALA 3UIAA 4DZOA 1EDJA 5PALA 1WDCC 1J7RA 3HD7D 2O5GA 2XZRA 3BJHA 2WMMA 1RE3C 1QX2A 5KAIH 1L0NE 3V2NA 2KNCA 1RH5B 5AW9B 2E75C 1Y8AA 3CR5X 3FWLA 4K35A 1QLKA 1RROA 2BCCD 1NP8A 2LP3A 1K04A 3CLNA 3OX5A 2MJZA 2CNPA 5D7FA 2Y9YA 2O01N 1QX8A 1KN7A 1DGVA 1QIVA 2OS8B 2AXCA 4I1LA 4N5XA 1PP9E 2ZT9C 1MKMA 2KI6C 2QVAA 2IBZG 3AEFC 1NU1E 4XJKB 1FBVA 4YI9A 1SCMB 3DD4A 3TK1A 1OZSA 3V6IA 1S6IA 5E79H 2YKOA 1K94A 3CWBD 5CSIA 4DT0A 3PLFB 2YKPA 2W6JH 3PM2A 1UUSA 1YI2P 1XFWO 2KLEA 1JNMA 2KLVA 4UB8H 1KC8Q 3H1IJ 3AEAC 5KLVJ 3SG2A 1Y1AA 3D73A 3CPWO 5APWA 4I5KA 1AVSA 1NYAA 3PTZA 1S5LH 3L74E 1PK0D 3JCUH 4L9MA 1LJ2A 2EC6B 4A7PA 1SQPD 2KI7B 3D10A 4WY4C 2M3BA 3SWKA 2HPSA 1K9KA 1NUBA 5B8IB 1Z56A 4GIFA 2OTKE 3VRPA 1S3JA 4EOTA 1F55A 1SQXE 2G2BA 1EXIA 3Q8IA 3V2PA 3SS4A 3V2RA 4TT3H 1GU4A 3CGAA 1SFCB 3FXDA 2HODA 2M49B 5I94A 1QTXA 3GHGC 3IF4A 1NTKG 2OYHA 1LTJA 1GGWA 2KNEA 3FWNA 4N78D 1BGYJ 1PGPA 1N7SB 1MR8A 3QRXA 1RECA 2CPSA 3B5NC 2BCCE 2M5AB 2O3JA 2KSJA 4NPEA 1QEXA 2R3SA 1XA5A 3NTNA 1MZ9A 1KB9I 1XTGB 1N2DC 2A45G 5AW1B 2KAVA 1CI6A 1VL2A 4PT1A 1DH3A 1JY2O 1JMBA 1LVCD 1SBJA 3H1KE 2HPCB 2G8YA 1URQD 3I5HB 4PCWA 1KILB 2NPSB 3II6A 3H1HJ 3B86A 1NTKK 1PZQA 1UHKA 2BE6A 3M9HA 1YHQP 3GLMA 1CDPA 1BE3E 3DY9A 1L4AB 1DVIA 3AE3C 3CCLP 1HH0A 1IWQA 4AQJA 3CXHD 3CDNA 3V4WA 3TGUD 1DEKA 2I94A 2B87B 1PGJA 1V1FA 1KFMA 1OZHA 1GM0A 1GTWA 1SQPE 4BWNA 1B8CA 3VRQA 2BCBA 2AEFA 2YIUB 1NPQA 3L72G 2ZAEB 3IQOA 2ZFCA 3SFDC 2BECA 1OMIA 4OGQB 3S1KA 1XFUO 1CDMA 1S3PA 4YTPC 2CT9A 1GW3A 4GFTA 1T3UA 1NU1G 2LMVA 2OS8C 2PYQA 1TTXA 2K7CA 5CCGA 1NGMB 2Y1NA 4GPLB 3QMEA 4H13B 4N78E 1Q82Q 3CC4P 5DJUB 3HE5A 1LXFC 1FOSF 1SCMC 1DQEA 2Y4QA 4A4CA 2WSFH 2RH0A 1ZRTD 2QEHA 1UWOA 4C0KA 1P84D 3HUSB 3CD6P 2WC8A 2H7HA 1WMKA 1RF0A 3PN7B 2CCMA 1K73Q 1LTIC 3HD7B 2Q4UA 1NU1K 2W8ZA 2WVRA 2EC6C 5AEQA 4GBAA 4GGFA 1AQ5A 1Q90D 2KQYA 1NTZG 1MV8A 1KFXS 3P8MC 2ZYGA 3PJSK 2WCLA 1AJ4A 4RJTA 3CXHE 1XK4C 3WNXB 1AP4A 1OW8A 3JSVC 3CYZA 4TNCA 2B9BA 3TS5B 2ZYDA 1SFCC 2KUBA 1KV4A 1OW4A 5KU1A 2YKQA 3SS3A 1PGOA 1NTMD 5KJ7D 3V2QA 2MRDA 1JB0J 2O1JA 1N7SC 2E76B 2HF5A 2WCJA 2OYIA 1G2CA 1KD1Q 5DICA 1L7ZA 1R2UA 1AK8A 1RHZB 3KDPB 4R4LA 1CM4A 1JCDA 3SFEC 1DJHA 3CWBG 4YI8A 2BBNA 2E43A 1K9PA 5GQQC 4MLWA 1G8IA 2L91A 1KK8B 5AW5B 1RK9A 1OOJA 3I5HC 1OVVA 2NPSC 1KILC 1YTZI 3H32A 3CZ2A 4MZKA 1QX7A 2QG4A 2AEMA 1ZRTE 1JSAA 4IL6X 2KGBC 1L4AC 3H1LD 1P84E 3P8CD 2Y0CA 1OE9B 2WCEA 2LKMA 3O6QB 5AW7B 1QX5B 1KQVA 4HB1A 1LGHB 3BUNB 4HYTB 4BXLA 1IK7A 3WMM0 4GUKA 4MEWA 1U7MA 5APTA 5FYXA 4JPZB 3CCEP 1DC1A 2YIUC 3VOPA 1Q7YQ 1UHHA 3CZ0A 1YUSA 1EH2A 2K1AA 1IO4A 1JF0A 4AQIA 2JP3A 1LA3A 4OGQC 3O2PA 2JWDA 1OFCX 1VDFA 3L4AA 1VQ5P 4C46A 2C0XA 3IF7A 2JNXA 1JBAA 2MBXA 3NHTA 3MZWB 1NTME 2WSCH 2JZIA 3L73D 1WLMA 2JQ6A 3AE5C 3H1JD 4H13C 1Y1UA 2JDIH 4Y28J 4YXDC 3CXHH 5IBWA 2M1KB 2RN0A 4DS7A 3V4QA 1IIOA 2MA2A 1JWDA 2F2OA 1URQB 3PHLA 1PALA 2BEZF 3LCPC 3L35A 2KSEA 2HETA 1VQMP 3A3YB 2JT0A 2LP2A 1WLZA 1RFJA 2I2RE 2IZ0A 2FYUD 1UHNA 1DJZA 2VRGA 1QL1A 2BASA 3HUSC 2IYOA 1TOPA 2WSEH 3CX5I 3HD7C 1DF0A 4IL1A 3S0FA 4WWIA 1JMMA 1QASA 2EHBA 3TGUG 4U7JA 1SQVD 1B1GA 3N7HA 3ZWHA 2KI4B 1Y0VH 3H1LE 2PSRA 2OTLP 4W80A 3RK2D 1NTKJ 3O8ZA 4NDBA 3I56P 1ORGA 2TN4A 2C0WA 3LW5J 2G3AA 3EWKA 5M1BA 4U3FD 3AE8C 1XO5A 1JC2A 4W7ZA 1QVGO 4PALA 3PM8A 3L75D 2P10A 5B66E 5AVWB 1P84H 4BY4A 1CLMA 1BLQA 1BF5A 1QLED 3RK3D 2R32A 5KLIB 2KS1B 1W2BO 3VYIA 1YYCA 4YPCA 3LL8B 1S9KD 1S5LX 3OW2O 3EQ2A 3L73E 1X02A 2WCBA 5I2OA 2B87A 1DJXA 3HTKA 1S36A 1G1JA 1KK8C 1J7OA 2GUVA 3U1AA 3CABA 4ASVA 3PJIA 2KBMA 3D6ZA 2ZFDA 4D6TE 3B8EB 2KDHA 2OTGC 3CCMP 3VMAA 5AVUB 2QJKB 2IS9A 2FYUE 3FE9A 1GK6A 5APQA 3KXDA 1IFMA 2H61A 4QJ3B 2D8NA 2LNKA 3L72J 3SSUA 2FJUB 3RBZA 1PULA 1OOGA 3M0AA 1RF1A 2WORA 5HKWA 2GTEA 1CMFA 2NXQA 1YX8A 1LTSC 2OYOA 3C1VA 3RM1A 2IYPA 4E68A 3MIWA 4GT1A 1MUUA 1NKZB 1NTMG 1JEKA 4PD4I 2IZ1A 1YUTA 3Q5PA 2F2PA 2JNFA 3L37A 4JF7A 3N4XA 1KB9E 1IQ3A 3VP8A 2K9JA 1F4QA 3L75E 1EDIA 1X22A 4N1GA 2KB7P 1SLQA 1VQ8P 1IG5A 1NCXA 1CTRA 3DVMA 3GK2A 2LR2A 2Q3IA 3PSRA 1YVLA 3RK3E 2DOQA 1KCYA 3G3ZA 3L71G 1BCCD 1LTTC 5J3XA 3KPXA 3ICBA 4GAOA 1L0ND 1URQC 2N1TA 1YTZT 2FXPA 4M2OA 3D0YB 2ISDA 5L8RJ 4CFRA 2WC5A 4F7FA 1CNPA 2W6BA 1Q81Q 4WQ3A 1NTMK 2XNXA 2OGUA 1KQFB 2K8MB 5HKZA 1M39A 3B88A 5B66H 1NTZJ 1SMGA 2I18A 2P1JA 1IJ5A 1NIWA 4INXA 1YUUA 1CDNA 3F89A 1SVFA 3HE4B 3GHGB 4I5LB 1VQPP 4ORBB 2Z4EA 1YVHA 1R5SA 2UWJE 2KI4C 4KYNA 4MZLA 4YGCB 4L73A 4N1FA 1JUNA 1JTHA 1UIIA 3OHMB 1VQ4P 5D69A 3Q3DA 2H88C 2KYFA 1FI6A 2QSIA 5AANA 4M3LA 3U59A 3I5FC 1H0TB 2BEQD 3EKHA 2ZVOB 1JFJA 5TNCA 2K3RA 2KLUA 2R44A 1M63B 1NX1A 3E7KA 3FIAA 5KAFE 3L74D 3L73G 2HQWA 1NX2A 2XKMA 5CSFA 1J1EB 2BKIB 4D1EA 3BFAA 2K88A 3VB1A 3CWBJ 3H1JG 2WCFA 3CLQA 5KLIC 3ABVC 3R1PA 1U7JA 1QXPA 2LV7A 2PFXA 1OMDA 2SPZA 2QJYC 3BUWB 5CCHA 4IJ7A 2YXRB 1SQXD 3PATA 1HUCA 3SWYA 1GL2D 2ZYAA 2M97A 3NHIA 3WHTB 1LT9A 1L0LE 1NSHA 1S5GY 1BCCE 1RY3A 1H8AA 2R2IA 3B6XA 1FZGA 1ZMEC 4R4MA 2KYVA 2QJKC 3FX0A 1SS1A 1U5IB 3FE6A 1KB9H 2M0BA 4ZMDA 1SQVG 1SQQJ 3BCCD 3CTNA 1MFTA 2LUXA 1SQBE 1FE6A 1Z4HA 1OW6A 3CZTX 3SG4A 1HTLC 2K0JA 4OVNF 1EZVI 1XTCC 2JTZA 2D2CD 1LNQA 5KJ7C 3H1KD 3VROA 4U3FG 2B1UA 2HLOA 2V7QH 3FS7A 2JR8A 1SRAA 1TCOB 4YGDB 1JY3P 3SS5A 1V1GA 1LINA 4OH8B 1PPJG 3V5BA 3HX4A 2MLEC 4HSZA 2C9LY 2VRSA 3JC22 2PQLA 1MXEA 3RLZA 1BE3D 1FDIA 3D6YA 3M0DC 2OPOA 1SQVK 3BYAA 2H2KA 1YBKA 2V4HA 1CW5A 1MQ1A 1SPYA 1CFFA 3I55P 3L70E 3SG3A 1CDLA 1LTGC 3WU2E 1M1JA 3WUUA 2WT7A 3CX5D 1NWQA 1W5CE 2JU0A 1AQTA 1BJFA 4HKZH 2SASA 3CS1A 1AJYA 2E74D 5CPVA 1OIPA 3TGUJ 2M3EA 2QEOA 3PH0A 5KAFH 1ODBA 1FW4A 1U57A 3BUOB 3HCMA 2K9YA 1JO5A 2HG5D 3CZ1A 5AVQB 2LM5A 1FDOA 3TSIA 1JF2A 5CCHD 2GGMA 1K9UA 2KS1A 3BCCE 1S1CX 3P32A 3RZSA 2KBIA 5CJ0A 1CFPA 2L0PA 1VQ7P 2QM8A 1LP1A 2P70A 3IVTA 3T97A 3H4SE 3C9IA 3AE9C 2BKHB 1QATA 2ZRSA 1IK9A 1DTLA 1RE3A 2O01J 3VMXA 2IBZI 1TRFA 4L75A 3PRJA 1J1EC 2JWAA 1LTBC 1IGVA 2L2EA 3K1EA 2M29A 2KK7A 1DJYA 2QA4P 1USDA 1W2EA 4I5NB 5HLOA 5KLVD 5BVZA 5GTHE 4Y99B 2JEEA 4WB4A 1L0NG 1UHIA 3VTPC 1WRZA 1M56D 3KHEA 3S0DA 2FXOA 1OW7A 2FFDB 2KZIA 2XDJA 3PFVA 3A8RA 1EJ3A 5I2QA 3QWOC 1YJ9P 1E5WA 1FBMA 3CX5E 2BBMA 1FC2C 4ZKUA 1FZCB 2M0RA 3NSOA 2PP6A 1B47A 2JT8A 5CSNA 1PRWA 1PP9G 3BOWB 4PE4A 1X9VA 1OSAA 3EFGA 1W9ZA 2K7DA 4I5JA 3VRRA 1IC2A 1SNLA 1ALWA 5FI6A 4JYBA 5AW2B 1ZMZA 2KFFA 4GDOA 4W7YA 3GK1A 3UNWA 1SL8A 3WU2H 1VRKA 1H8BA 4RO0A 1DD4A 2JPTA 1L0NK 1DEEG 1BGYD 1VQ9P 1NAYA 3NXSA 1S5GZ 2K7OA 1SCVA 4WY4A 1G4YR 1F70A 2E42A 3DYEA 1WY9A 1J7PA 1GQMA 3FGAD 5AW4B 3RK3C 1F8HA 3L74G 2K2AA 3BASA 3KYQA 2QEXP 2A45I 1KMIZ 3L71J 1NX0A 2LAPA 3TYYA 2LVVA 4BY5A 5FI2A 3BFHA 2BAPA 1OMVA 1CMGA 1TUJA 3AAJA 2Z5HA 3HE4A 3GHGA 2QE7H 3FXEA 1MF8B 4PJ0E 1SQXG 4IOIH 3FE8A 3H1HD 4YGAA 1XFXO 3B5NA 2PVBA 2Y1MA 4MSPA 4MZJA 2PAJA 1BR1B 1IFIA 3CL3D 3H1IE 2E5YA 5KLVE 4INWA 3RBXA 2LXCB 1QVFO 3VRNA 1BSNA 2KOTA 1N2DA 3CCRP 3OB1B 1NWDA 1FZBA 1J1DB 1NCYA 1H0TA 4C7NB 2BCCG 4M2PA 5EL2A 3AEGC 1BSHA 2OTJP 2E75D 2M9GA 2WSSH 1KFUL 5GTHH 4P5OE 2D2CB 1C3YA 3OJAB 1KK7Y 3CR4X 2Z5IA 4XYNA 1SQXK 3H1KG 4PD4E 2ZT9D 1LWUB 1ZXGA 3OGNA 2BE4A 3H1JJ 3F45A 1T6AA 3CX5H 1D1OA 1FZFA 1R8EA 2JT3A 1FDMA 1HT9A 1BGYE 1N73B 1GJYA 5TISE 1BE3G 3GW6A 1XYDA 2WCMA 3A0HE 5KTYA 4I7ZB 2RKLA 1UIXA 1YURA 1U5IA 2OTGB 3MSEB 5CCGD 4IFMA 3KQGA 1SQPG 2LLTA 2LLUA 4Y99C 1J7QA 2KHNA 1WRGA 2L5YA 1IFDA 3O6BA 1A75B 2HQ8A 5TJHA 4JBZA 4WY4D 4BRYB 2FFDC 2KFGA 3JTDB 1KSOA 2WCKA 1J55A 2LUCA 1SQVJ 2PMYA 3H1HE 3DF0B 2FBWC 4XJKA 1FZCC 4H0LD 1YR5A 3AE4C 3O4XA 2Q5UA 3IN6A 1EZVD 4HRHA 2A4JA 2H8PD 3D70A 3L4LA 4U3FJ 3M0WA 4GOEA 5AVTB 1ZW0A 3A4UB 4PJ0H 2W6AA 2JPOA 5CBNA 2JXCA 1OQPA 1DT7B 1SQPK 3B5ND 1NCZA 2JULA 2Y0EA 1Y47A 4L74A 3WUTA 2KNCB 1BT6A 1ZP0C 2K61A 5F6TA 1N65A 3TZ1A 3DVKA 2KOGA 1VQ6P 1C3ZA 4D6TD 1HBWA 1XK4A 3DZTA 5G08A 2F33A 1JY3N 3OX6A 3JVTC 1SFCA 1TCFA 1K9MQ 5ER5A 2ZJSE 4AUWA 1SK6D 3Q2YA 5KLVG 1JFKA 2MJWB 1GL2C 3NFQA 3CCQP 1QV0A 4DCKA 3M9QA 2AUCA 1YIJP 4OR9B 1N7SA 1CLBA 4PD4H 1LKJA 2K37A 1EDKA 3R1OA 2M5AA 1AV1A 1Z2CB 5HYDA 1P28A 4DOJA 1N0YA 1WT6A 4NQGA 3UO9A 3M91A 5TISH 3SG5A 1S6CA 1J1DC 1QIWA 2POHA 3A0HH 4Q04A 3IR9A 3I5FB 3ZNIA 2GA1A 1ZACA 4RESB 2P2UA 3R1VA 4QMAA 3CC2P 2HPCA 1KB9D 2EGDA 2KFHA 1T2KD 3D71A 4MVFA 3S0EA 2O1KA 1E79H 1Q2NA 1EG4A 1KILA 2NPSA 4N3YB 2D2CC 1M1KQ 2ZKMX 1OOIX 3NXAA 1IRJA 1EZVE 5KLVK 3GMAA 5AFPA 3OP0A 2CK3H 4AOMA 1L4AA 2IBZD 1CB1A 1GK4A 1LWUC 2NRGA 2HODB 2QJYB 1PV3A 1E8AA 1RWYA 1LTJB 3R4YA 4R1EA 1N73C 1CFCA 2FCEA 2R3CA 2FCDA 3D76A 1PVAA 1JY2N 1EDLA 5CHXA 2E5TA 1L0NJ 4I7ZC 3EG5B 4NDDA 3LLEA 4JQ0D 2FYZA 1S72P 1TUZA 2NCPA 1RE4C 2FKWB 1K95A 1KK7Z 2Q6QA 1ZOYC 1VF5D 2L4HA 3CCJP 3D78A 2FJYA 3KF9A 4ETOA 1QL2A 5CJ4A 2F3YA 3JTDC 2WPSA 1KWOB 4C0LA 3LK0A 2AAOA 1PP9J 2Q1KA 4USLA 3I5GB 2LXBA 2M8RA 1DGUA 2LHLA 1NU1J 1S4XA 1B7TY 4I2LC 3VMYA 3MUDC 1H4BA 2F8PA 5AVSB 3R72A 4PHJA 3AE2C 3M9BA 2Q9IA 1RTP1 1Y1XA 3AE7C 5K89A 3HUSA 1M46A 5D3OA 1FOSE 2WZ7A 4LC1A 1NO4A 3AKBA 2L50A 2LMUA 4CIDA 1RQUA 3HD7A 3L74J 1S6JA 4IFDK 4ASWA 2YO2A 3N7NA 5I2LA 1GMJA 2MLFC 1L0LD 3KZIE 3TF5A 3EKJA 2IBZE 2WITA 3IFMA 2M7LA 2QM7A 3B87A 1AA0A 1SL7A 1HGZA 1K05A 5EFWB 1QV1A 1SQXJ 1CFDA 3D77A 1AJ5A 4AQRD 1SQBD 2ITAA 2WSFJ 3H1LG 3MD0A 2JOJA 2PRUA 3I5CA 1M90Q 1ALVA 2XV5A 1ZR2A 1TU3F 2W90A 4AYCA 4F0ZB 1MXLC 2BCCJ 4OWFA 4NPDA 5DJTB 4H0LB 2L4IA 2KZJA 3TDKA 2ZN9A 1LWUA 2R5DA 2PRRA 3L72D 4RKUJ 3G4SP 5KSZA 3G9RA 2C9NY 5C39A 1NAFA 1LTAC 2IFMA 1QS7A 1YJWP 2NLNA 3TNUB 3H1KJ 1VQNP 1BU3A 4OGQD 2A06D 2XNDH 2QRXA 2P67A 1NTKE 1X8YA 4C0JA 3L70D 1KQLA 1KQMC 2Y5IA 1NJIQ 3WUVA 4DUQA 4H13D 1BE3J 2WTYA 1HWTC 2PASA 1M7LA 3O6QA 1ZUZA
chains in the Genus database with same CATH topology
2FOTA 2JTTA 4FTGA 4YI8A 4YBHB 5DKNA 3TUYB 1IGVA 2BBNA 1A75A 3NSKA 2L2EA 1K9PA 5GQQC 2M29A 4MLWA 3EVVA 1DJYA 1G8IA 1KK8B 3GK4X 1EXRA 2E30A 1A29A 3OB2B 1RJVA 4I5NB 5HLOA 1RK9A 3DF0A 1OOJA 3I5HC 3BOWA 1WDCB 1NX3A 4MZKA 1QX7A 1UHIA 3BUXB 3CWGA 2KQ6A 4PHKA 1WRZA 2F3ZA 3KHEA 1JSAA 3PFVA 3A8RA 1EJ3A 1F4OA 1BR4B 2KGBC 5I2QA 1OE9B 1XFVO 2WCEA 1M45A 5HLVA 2COLB 1QX5B 1KQVA 2P6BB 3NSLA 2BBMA 3BUNB 4ZCUA 2M0RA 4GUKA 2CTNA 4MEWA 3NSOA 1KWOC 3LK1A 5FYXA 4CLNA 1B47A 4JPZB 2JT8A 4HREE 5CSNA 1PRWA 3BOWB 1OZOA 4PE4A 1OSAA 3I5GC 2LVKA 2K7DA 1UHHA 4I5JA 3VRRA 1YUSA 1SNLA 1ALWA 2MAZA 1EH2A 1F54A 1ZMZA 2KFFA 1SW8A 1JF0A 3GK1A 1FPWA 2BCXA 1C7WA 4AQIA 1SL8A 1LA3A 1VRKA 3NSIA 3O2PA 1H8BA 5DKQA 1OFCX 4ICBA 3SIAA 2JPTA 1JUOA 2LVJA 3O4YA 3IF7A 1BG1A 2JNXA 2E6WA 2MBXA 1JBAA 1MHOA 1S5GZ 2K7OA 2JZIA 1SCVA 2ZNEA 2KAXA 5JJGA 1G4YR 3SIBA 2ZRTA 1WLMA 1F70A 2JQ6A 4MRYA 1Y1UA 1L2OB 1WY9A 1J7PA 1XFZO 1GQMA 1YRUB 1XFYO 1F8HA 2K2AA 4PHMA 5IBWA 2M1KB 1OMRA 1Y6WA 4DS7A 1NX0A 2LAPA 2MA2A 1JWDA 2LVVA 4BY5A 3WHUB 1W7JB 2F2OA 1PALA 3IQQA 3LCPC 1J1DA 1OMVA 1CMGA 2BCAA 1B7TZ 3AAJA 2HETA 2RGIA 2JT0A 2LP2A 1WLZA 1RFJA 3EK8A 2I2RE 1SKTA 1YX7A 1MF8B 1Q80A 1UHNA 4JWQA 1DJZA 1EG3A 2VRGA 3SG7A 3SJSA 1YRTB 1IJ6A 3I5IB 4ORAB 1XFXO 4YGAA 1UURA 2PVBA 2Y1MA 1TOPA 4MZJA 4MSPA 4OCIA 1BR1B 1DF0A 2NCOA 4IL1A 5CSJA 3CR2A 3VRNA 1QASA 2EHBA 1WRLA 1MUXA 1S1EA 2JWWA 1B1GA 2KOTA 1AHRA 2L5XB 2KI4B 1N2DA 1CM1A 1SY9A 2ZN8A 3OB1B 1NWDA 4YGBB 1Y0VH 4YGEB 1FI5A 4WRIA 1NCYA 2PSRA 4M2PA 4DIRA 4WQ2A 1KSMA 2M9GA 2NZ0A 1S26D 4NDBA 3AAKA 3KO0A 2TN4A 2LHIA 2K2FA 2KGRA 1PSBA 2LE9B 1G33A 1KFUL 2JC2A 3EK4A 3K21A 4MN0A 1XO5A 4P5OE 1JC2A 1PVBA 1DF0B 1KK7Y 3CR4X 4PALA 4XYNA 2LLSA 3PM8A 2LC5A 4GGFC 1BOCA 3WXAA 2BL0B 2QACA 4BY4A 1DJIA 1QVIZ 1WRKA 1UP5A 1K96A 1CLMA 2BE4A 2M1UA 3F45A 1BLQA 1BF5A 1C07A 5ER4X 4DRWA 1BMOA 1D1OA 2JT3A 1HT9A 2SCPA 3LL8B 1IH0A 1CKKA 1GJYA 2LMTA 1XYDA 1B8RA 3EK7A 1A4PA 1M31A 5HKYA 1X02A 2WCBA 4PE7A 5I2OA 5KTYA 3TUYC 1TNPA 1EL4A 1W7IB 1DJXA 1YURA 3AKAA 1S36A 1U5IA 2OTGB 3BUMB 1KK8C 3MSEB 1J7OA 1TNQA 2PALA 2LLTA 5PALA 1WDCC 2LLUA 1SL9A 3DVEA 1J7RA 2KHNA 1J7QA 2KBMA 2ZFDA 3SG6A 1K90D 2O5GA 1A75B 3O6BA 2HQ8A 2KDHA 2OTGC 2IS9A 2KFGA 3JTDB 1KSOA 1B4CA 1J55A 1QX2A 2LUCA 2JRFA 2H61A 2PMYA 3DF0B 4PE1A 4QJ3B 2D8NA 2LNKA 4XJKA 2FJUB 1YR5A 4QJ4B 1PULA 3CR5X 1MWNA 2CXJA 1QLKA 2WORA 1RROA 5HKWA 4GNKB 1CMFA 1NP8A 1YX8A 2NXQA 2LP3A 3VGOA 1R6PA 3CLNA 4HRHA 2A4JA 3OX5A 3C1VA 2CNPA 5D7FA 2Y9YA 3RM1A 1K2HA 4PE0A 3M0WA 4E68A 4PHNA 1DGVA 1QIVA 2OS8B 3A4UB 4N5XA 2JXCA 1OQPA 1QLSA 1DT7B 2Q91A 1NCZA 2JULA 1YUTA 2L51A 2KI6C 3D0YA 4CFQA 4XJKB 1FBVA 2F2PA 1SR6B 2JNFA 4YI9A 1KFXL 1SCMB 1BT6A 3DD4A 2K61A 1DJWA 3GOFA 5F6TA 1OZSA 1S6IA 1N65A 1K94A 5CSIA 1IQ3A 1F4QA 3TZ1A 3PLFB 2I7AA 4N1GA 1L2OC 1UUSA 1XFWO 3JVTB 3DVKA 1IG5A 1NCXA 1CTRA 3DVMA 3GK2A 4PDZA 4MRXA 3PSRA 1XK4A 1YVLA 5G08A 1Y1AA 3SG2A 2DOQA 1KCYA 2F33A 1GGZA 1K8UA 5J3XA 4I5KA 1AVSA 1NYAA 3KPXA 3OX6A 3JVTC 3ICBA 4GAOA 1HQVA 1TCFA 3ZWHA 1PK0D 1LA0A 4M2OA 5ER5A 4L9MA 1SK6D 3D0YB 2ISDA 1JFKA 4CFRA 2EC6B 2MJWB 1QV0A 1CNPA 4DCKA 4WQ3A 2AUCA 3D10A 2L98A 4GGNA 2K8MB 3I5IC 4OR9B 5HKZA 2HPSA 1M39A 4FQOA 1CLBA 1SMGA 2I18A 1LKJA 1B8LA 1K9KA 1NUBA 1IJ5A 5B8IB 5BPJA 1NIWA 1YUUA 1CDNA 3VRPA 4A4BA 5HYDA 1F55A 2G2BA 4I5LB 4ORBB 2GV5A 1YVHA 1N0YA 1CLLA 4NQGA 3SG5A 2KI4C 1S6CA 3CGAA 2M49B 4MZLA 1J1EA 1QIWA 4YGCB 4N1FA 2QPTA 4Q04A 3I5FB 1QTXA 3ZNIA 1ZACA 1GGWA 3OHMB 2KNEA 5D69A 2EGDA 2KFHA 2KYFA 2MHHA 1MR8A 1FI6A 4MVFA 3QRXA 1RECA 5AANA 1EG4A 2KI6D 5AXIA 2ZKMX 3I5FC 3NXAA 1IRJA 3EKHA 1XA5A 1JFJA 5TNCA 5AFPA 3OP0A 1M63B 1A2XA 1NX1A 3FIAA 4AOMA 1CB1A 2BL0C 4UPGA 4YRUA 2HQWA 1E8AA 1NX2A 2KAVA 5CSFA 2BKIB 4D1EA 1TIZA 2WCFA 1K93D 1RWYA 1LVCD 1SBJA 4R1EA 2WNDA 2AMIA 1CFCA 1FF1A 1QXPA 2FCEA 2LV7A 1IQ5A 1OMDA 2FCDA 1PVAA 3TDIA 3I5HB 3BUWB 4PCWA 3PALA 3PATA 1UHKA 2O60A 4NDDA 3LLEA 4JQ0D 2BE6A 1KFUS 1CDPA 2M8UA 2M97A 4OV2A 3TDUA 3WHTB 1DVIA 2NCPA 1NSHA 1S5GY 1K95A 1IWQA 1KK7Z 4AQJA 2R2IA 2L4HA 1BODA 3KF9A 2I94A 4ETOA 1V1FA 5JOLA 2LCPA 4P2YB 2F3YA 3JTDC 4U8DA 1KWOB 1U5IB 4C0LA 1B8CA 3VRQA 2BCBA 3DVJA 2K7BA 3LK0A 5DKRA 2AAOA 3BQ3A 3CTNA 4M2QA 4USLA 3I5GB 2LVIA 2GGZA 1NPQA 2LUXA 4OKHA 1DGUA 2LHLA 3EVRA 1B7TY 1TN4A 3IQOA 3CZTX 1AUIB 2BECA 3SG4A 1H4BA 2F8PA 2K0JA 4OVNF 4CPVA 1XFUO 1CDMA 1S3PA 2CT9A 2CBLA 2JTZA 4PHJA 4GFTA 3VROA 3E3RA 2B1UA 3EVUA 1RTP1 2LMVA 1Y1XA 2OS8C 3FS7A 3KEVA 1TTXA 5K89A 1SRAA 1TCOB 2K7CA 4YGDB 5AERA 1M46A 4QJ5B 2KYCA 2Y1NA 4GPLB 1V1GA 1LINA 1TNXA 2H61C 1PSRA 1LXFC 3AKBA 2L50A 2LMUA 4CIDA 3HX4A 2MLEC 4HSZA 1S6JA 1SR6C 1SCMC 3FWCA 4MBEA 3RLZA 1MXEA 5I2LA 2Y4QA 2M3WA 2MLFC 2V53A 2ZNDA 2OPOA 3FWBA 4A4CA 4NDCA 3BYAA 2H2KA 1YTZC 3EKJA 1MQ1A 2M7LA 1ZOTB 1SPYA 1SL7A 1UWOA 4ORCB 1CFFA 1IKUA 3SG3A 4C0KA 1ZFSA 1CDLA 1QV1A 1B9AA 1CFDA 2WC8A 3BXKA 1A03A 3PN7B 2CCMA 1AJ5A 4HRGA 2JU0A 2Q4UA 2Y9ZA 1BJFA 1QVIY 2JOJA 2PRUA 2SASA 2EC6C 3CS1A 1ALVA 5CPVA 5AEQA 5I8NA 4GBAA 2JXLA 4GGFA 3PN7C 4F0ZB 1MXLC 2KQYA 1ODBA 1KFXS 1FW4A 1DJGA 1AJ4A 3BUOB 3HCMA 3O78A 1DMOA 1XK4C 1TNWA 3WNXB 1AP4A 1UHJA 2L4IA 4TNCA 2LM5A 2ZN9A 3TS5B 1JF2A 2M7NA 5KSZA 2G9BA 2GGMA 5KU1A 1K9UA 3TDZA 2KBIA 1QS7A 1CFPA 2L0PA 2NLNA 1KQMB 2MRDA 2WOSA 3TS5C 1BU3A 1SYMA 2HF5A 1C7VA 3H4SE 4C0JA 1F71A 1XVJA 1L7ZA 1KQMC 1QJTA 2Y5IA 1R2UA 2LANA 2BKHB 1QATA 1AK8A 2ZRSA 4DUQA 4ZCVA 1DTLA 1CM4A 2KAYA 1DJHA 1TRFA 2PASA 2KSPA 1ZUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOT A;  2JTT A;  4FTG A;  4YI8 A;  4YBH B;  5DKN A;  3TUY B;  1IGV A;  2BBN A;  1A75 A;  3NSK A;  2L2E A;  1K9P A;  5GQQ C;  2M29 A;  4MLW A;  3EVV A;  1DJY A;  1G8I A;  1KK8 B;  3GK4 X;  1EXR A;  2E30 A;  1A29 A;  3OB2 B;  1RJV A;  4I5N B;  5HLO A;  1RK9 A;  3DF0 A;  1OOJ A;  3I5H C;  3BOW A;  1WDC B;  1NX3 A;  4MZK A;  1QX7 A;  1UHI A;  3BUX B;  3CWG A;  2KQ6 A;  4PHK A;  1WRZ A;  2F3Z A;  3KHE A;  1JSA A;  3PFV A;  3A8R A;  1EJ3 A;  1F4O A;  1BR4 B;  2KGB C;  5I2Q A;  1OE9 B;  1XFV O;  2WCE A;  1M45 A;  5HLV A;  2COL B;  1QX5 B;  1KQV A;  2P6B B;  3NSL A;  2BBM A;  3BUN B;  4ZCU A;  2M0R A;  4GUK A;  2CTN A;  4MEW A;  3NSO A;  1KWO C;  3LK1 A;  5FYX A;  4CLN A;  1B47 A;  4JPZ B;  2JT8 A;  4HRE E;  5CSN A;  1PRW A;  3BOW B;  1OZO A;  4PE4 A;  1OSA A;  3I5G C;  2LVK A;  2K7D A;  1UHH A;  4I5J A;  3VRR A;  1YUS A;  1SNL A;  1ALW A;  2MAZ A;  1EH2 A;  1F54 A;  1ZMZ A;  2KFF A;  1SW8 A;  1JF0 A;  3GK1 A;  1FPW A;  2BCX A;  1C7W A;  4AQI A;  1SL8 A;  1LA3 A;  1VRK A;  3NSI A;  3O2P A;  1H8B A;  5DKQ A;  1OFC X;  4ICB A;  3SIA A;  2JPT A;  1JUO A;  2LVJ A;  3O4Y A;  3IF7 A;  1BG1 A;  2JNX A;  2E6W A;  2MBX A;  1JBA A;  1MHO A;  1S5G Z;  2K7O A;  2JZI A;  1SCV A;  2ZNE A;  2KAX A;  5JJG A;  1G4Y R;  3SIB A;  2ZRT A;  1WLM A;  1F70 A;  2JQ6 A;  4MRY A;  1Y1U A;  1L2O B;  1WY9 A;  1J7P A;  1XFZ O;  1GQM A;  1YRU B;  1XFY O;  1F8H A;  2K2A A;  4PHM A;  5IBW A;  2M1K B;  1OMR A;  1Y6W A;  4DS7 A;  1NX0 A;  2LAP A;  2MA2 A;  1JWD A;  2LVV A;  4BY5 A;  3WHU B;  1W7J B;  2F2O A;  1PAL A;  3IQQ A;  3LCP C;  1J1D A;  1OMV A;  1CMG A;  2BCA A;  1B7T Z;  3AAJ A;  2HET A;  2RGI A;  2JT0 A;  2LP2 A;  1WLZ A;  1RFJ A;  3EK8 A;  2I2R E;  1SKT A;  1YX7 A;  1MF8 B;  1Q80 A;  1UHN A;  4JWQ A;  1DJZ A;  1EG3 A;  2VRG A;  3SG7 A;  3SJS A;  1YRT B;  1IJ6 A;  3I5I B;  4ORA B;  1XFX O;  4YGA A;  1UUR A;  2PVB A;  2Y1M A;  1TOP A;  4MZJ A;  4MSP A;  4OCI A;  1BR1 B;  1DF0 A;  2NCO A;  4IL1 A;  5CSJ A;  3CR2 A;  3VRN A;  1QAS A;  2EHB A;  1WRL A;  1MUX A;  1S1E A;  2JWW A;  1B1G A;  2KOT A;  1AHR A;  2L5X B;  2KI4 B;  1N2D A;  1CM1 A;  1SY9 A;  2ZN8 A;  3OB1 B;  1NWD A;  4YGB B;  1Y0V H;  4YGE B;  1FI5 A;  4WRI A;  1NCY A;  2PSR A;  4M2P A;  4DIR A;  4WQ2 A;  1KSM A;  2M9G A;  2NZ0 A;  1S26 D;  4NDB A;  3AAK A;  3KO0 A;  2TN4 A;  2LHI A;  2K2F A;  2KGR A;  1PSB A;  2LE9 B;  1G33 A;  1KFU L;  2JC2 A;  3EK4 A;  3K21 A;  4MN0 A;  1XO5 A;  4P5O E;  1JC2 A;  1PVB A;  1DF0 B;  1KK7 Y;  3CR4 X;  4PAL A;  4XYN A;  2LLS A;  3PM8 A;  2LC5 A;  4GGF C;  1BOC A;  3WXA A;  2BL0 B;  2QAC A;  4BY4 A;  1DJI A;  1QVI Z;  1WRK A;  1UP5 A;  1K96 A;  1CLM A;  2BE4 A;  2M1U A;  3F45 A;  1BLQ A;  1BF5 A;  1C07 A;  5ER4 X;  4DRW A;  1BMO A;  1D1O A;  2JT3 A;  1HT9 A;  2SCP A;  3LL8 B;  1IH0 A;  1CKK A;  1GJY A;  2LMT A;  1XYD A;  1B8R A;  3EK7 A;  1A4P A;  1M31 A;  5HKY A;  1X02 A;  2WCB A;  4PE7 A;  5I2O A;  5KTY A;  3TUY C;  1TNP A;  1EL4 A;  1W7I B;  1DJX A;  1YUR A;  3AKA A;  1S36 A;  1U5I A;  2OTG B;  3BUM B;  1KK8 C;  3MSE B;  1J7O A;  1TNQ A;  2PAL A;  2LLT A;  5PAL A;  1WDC C;  2LLU A;  1SL9 A;  3DVE A;  1J7R A;  2KHN A;  1J7Q A;  2KBM A;  2ZFD A;  3SG6 A;  1K90 D;  2O5G A;  1A75 B;  3O6B A;  2HQ8 A;  2KDH A;  2OTG C;  2IS9 A;  2KFG A;  3JTD B;  1KSO A;  1B4C A;  1J55 A;  1QX2 A;  2LUC A;  2JRF A;  2H61 A;  2PMY A;  3DF0 B;  4PE1 A;  4QJ3 B;  2D8N A;  2LNK A;  4XJK A;  2FJU B;  1YR5 A;  4QJ4 B;  1PUL A;  3CR5 X;  1MWN A;  2CXJ A;  1QLK A;  2WOR A;  1RRO A;  5HKW A;  4GNK B;  1CMF A;  1NP8 A;  1YX8 A;  2NXQ A;  2LP3 A;  3VGO A;  1R6P A;  3CLN A;  4HRH A;  2A4J A;  3OX5 A;  3C1V A;  2CNP A;  5D7F A;  2Y9Y A;  3RM1 A;  1K2H A;  4PE0 A;  3M0W A;  4E68 A;  4PHN A;  1DGV A;  1QIV A;  2OS8 B;  3A4U B;  4N5X A;  2JXC A;  1OQP A;  1QLS A;  1DT7 B;  2Q91 A;  1NCZ A;  2JUL A;  1YUT A;  2L51 A;  2KI6 C;  3D0Y A;  4CFQ A;  4XJK B;  1FBV A;  2F2P A;  1SR6 B;  2JNF A;  4YI9 A;  1KFX L;  1SCM B;  1BT6 A;  3DD4 A;  2K61 A;  1DJW A;  3GOF A;  5F6T A;  1OZS A;  1S6I A;  1N65 A;  1K94 A;  5CSI A;  1IQ3 A;  1F4Q A;  3TZ1 A;  3PLF B;  2I7A A;  4N1G A;  1L2O C;  1UUS A;  1XFW O;  3JVT B;  3DVK A;  1IG5 A;  1NCX A;  1CTR A;  3DVM A;  3GK2 A;  4PDZ A;  4MRX A;  3PSR A;  1XK4 A;  1YVL A;  5G08 A;  1Y1A A;  3SG2 A;  2DOQ A;  1KCY A;  2F33 A;  1GGZ A;  1K8U A;  5J3X A;  4I5K A;  1AVS A;  1NYA A;  3KPX A;  3OX6 A;  3JVT C;  3ICB A;  4GAO A;  1HQV A;  1TCF A;  3ZWH A;  1PK0 D;  1LA0 A;  4M2O A;  5ER5 A;  4L9M A;  1SK6 D;  3D0Y B;  2ISD A;  1JFK A;  4CFR A;  2EC6 B;  2MJW B;  1QV0 A;  1CNP A;  4DCK A;  4WQ3 A;  2AUC A;  3D10 A;  2L98 A;  4GGN A;  2K8M B;  3I5I C;  4OR9 B;  5HKZ A;  2HPS A;  1M39 A;  4FQO A;  1CLB A;  1SMG A;  2I18 A;  1LKJ A;  1B8L A;  1K9K A;  1NUB A;  1IJ5 A;  5B8I B;  5BPJ A;  1NIW A;  1YUU A;  1CDN A;  3VRP A;  4A4B A;  5HYD A;  1F55 A;  2G2B A;  4I5L B;  4ORB B;  2GV5 A;  1YVH A;  1N0Y A;  1CLL A;  4NQG A;  3SG5 A;  2KI4 C;  1S6C A;  3CGA A;  2M49 B;  4MZL A;  1J1E A;  1QIW A;  4YGC B;  4N1F A;  2QPT A;  4Q04 A;  3I5F B;  1QTX A;  3ZNI A;  1ZAC A;  1GGW A;  3OHM B;  2KNE A;  5D69 A;  2EGD A;  2KFH A;  2KYF A;  2MHH A;  1MR8 A;  1FI6 A;  4MVF A;  3QRX A;  1REC A;  5AAN A;  1EG4 A;  2KI6 D;  5AXI A;  2ZKM X;  3I5F C;  3NXA A;  1IRJ A;  3EKH A;  1XA5 A;  1JFJ A;  5TNC A;  5AFP A;  3OP0 A;  1M63 B;  1A2X A;  1NX1 A;  3FIA A;  4AOM A;  1CB1 A;  2BL0 C;  4UPG A;  4YRU A;  2HQW A;  1E8A A;  1NX2 A;  2KAV A;  5CSF A;  2BKI B;  4D1E A;  1TIZ A;  2WCF A;  1K93 D;  1RWY A;  1LVC D;  1SBJ A;  4R1E A;  2WND A;  2AMI A;  1CFC A;  1FF1 A;  1QXP A;  2FCE A;  2LV7 A;  1IQ5 A;  1OMD A;  2FCD A;  1PVA A;  3TDI A;  3I5H B;  3BUW B;  4PCW A;  3PAL A;  3PAT A;  1UHK A;  2O60 A;  4NDD A;  3LLE A;  4JQ0 D;  2BE6 A;  1KFU S;  1CDP A;  2M8U A;  2M97 A;  4OV2 A;  3TDU A;  3WHT B;  1DVI A;  2NCP A;  1NSH A;  1S5G Y;  1K95 A;  1IWQ A;  1KK7 Z;  4AQJ A;  2R2I A;  2L4H A;  1BOD A;  3KF9 A;  2I94 A;  4ETO A;  1V1F A;  5JOL A;  2LCP A;  4P2Y B;  2F3Y A;  3JTD C;  4U8D A;  1KWO B;  1U5I B;  4C0L A;  1B8C A;  3VRQ A;  2BCB A;  3DVJ A;  2K7B A;  3LK0 A;  5DKR A;  2AAO A;  3BQ3 A;  3CTN A;  4M2Q A;  4USL A;  3I5G B;  2LVI A;  2GGZ A;  1NPQ A;  2LUX A;  4OKH A;  1DGU A;  2LHL A;  3EVR A;  1B7T Y;  1TN4 A;  3IQO A;  3CZT X;  1AUI B;  2BEC A;  3SG4 A;  1H4B A;  2F8P A;  2K0J A;  4OVN F;  4CPV A;  1XFU O;  1CDM A;  1S3P A;  2CT9 A;  2CBL A;  2JTZ A;  4PHJ A;  4GFT A;  3VRO A;  3E3R A;  2B1U A;  3EVU A;  1RTP 1;  2LMV A;  1Y1X A;  2OS8 C;  3FS7 A;  3KEV A;  1TTX A;  5K89 A;  1SRA A;  1TCO B;  2K7C A;  4YGD B;  5AER A;  1M46 A;  4QJ5 B;  2KYC A;  2Y1N A;  4GPL B;  1V1G A;  1LIN A;  1TNX A;  2H61 C;  1PSR A;  1LXF C;  3AKB A;  2L50 A;  2LMU A;  4CID A;  3HX4 A;  2MLE C;  4HSZ A;  1S6J A;  1SR6 C;  1SCM C;  3FWC A;  4MBE A;  3RLZ A;  1MXE A;  5I2L A;  2Y4Q A;  2M3W A;  2MLF C;  2V53 A;  2ZND A;  2OPO A;  3FWB A;  4A4C A;  4NDC A;  3BYA A;  2H2K A;  1YTZ C;  3EKJ A;  1MQ1 A;  2M7L A;  1ZOT B;  1SPY A;  1SL7 A;  1UWO A;  4ORC B;  1CFF A;  1IKU A;  3SG3 A;  4C0K A;  1ZFS A;  1CDL A;  1QV1 A;  1B9A A;  1CFD A;  2WC8 A;  3BXK A;  1A03 A;  3PN7 B;  2CCM A;  1AJ5 A;  4HRG A;  2JU0 A;  2Q4U A;  2Y9Z A;  1BJF A;  1QVI Y;  2JOJ A;  2PRU A;  2SAS A;  2EC6 C;  3CS1 A;  1ALV A;  5CPV A;  5AEQ A;  5I8N A;  4GBA A;  2JXL A;  4GGF A;  3PN7 C;  4F0Z B;  1MXL C;  2KQY A;  1ODB A;  1KFX S;  1FW4 A;  1DJG A;  1AJ4 A;  3BUO B;  3HCM A;  3O78 A;  1DMO A;  1XK4 C;  1TNW A;  3WNX B;  1AP4 A;  1UHJ A;  2L4I A;  4TNC A;  2LM5 A;  2ZN9 A;  3TS5 B;  1JF2 A;  2M7N A;  5KSZ A;  2G9B A;  2GGM A;  5KU1 A;  1K9U A;  3TDZ A;  2KBI A;  1QS7 A;  1CFP A;  2L0P A;  2NLN A;  1KQM B;  2MRD A;  2WOS A;  3TS5 C;  1BU3 A;  1SYM A;  2HF5 A;  1C7V A;  3H4S E;  4C0J A;  1F71 A;  1XVJ A;  1L7Z A;  1KQM C;  1QJT A;  2Y5I A;  1R2U A;  2LAN A;  2BKH B;  1QAT A;  1AK8 A;  2ZRS A;  4DUQ A;  4ZCV A;  1DTL A;  1CM4 A;  2KAY A;  1DJH A;  1TRF A;  2PAS A;  2KSP A;  1ZUZ A; 
#chains in the Genus database with same CATH topology
 4YBH B;  5DKN A;  3K5B A;  3TUY B;  1A75 A;  2OYH C;  1LTJ C;  4BRY A;  4CPG A;  2QIW A;  4D6T G;  2KIK A;  1TWO A;  2E30 A;  2J58 A;  3OB2 B;  2FXM A;  2OYI B;  3DF0 A;  1SQP J;  2FYU G;  1G2C B;  1ZR4 A;  2GM4 A;  3RL0 D;  3BUX B;  2KQ6 A;  5HL1 A;  3MUD A;  1F4O A;  1BR4 B;  1XFV O;  5K5G B;  1AVY A;  1M45 A;  2COL B;  1OOF A;  2P6B B;  2HR3 A;  1T14 A;  1KIL E;  4KT0 J;  3RK2 B;  4ZCU A;  1NTZ D;  1N7L A;  2CTN A;  1KWO C;  3LK1 A;  3KZI H;  4CLN A;  1YQ4 C;  2N1T D;  1XFR A;  3H6P A;  3H25 A;  3I5G C;  5FI7 A;  3H32 B;  1FU1 A;  2RMZ A;  3RGU A;  2MAZ A;  4H44 D;  4XE5 B;  1SW8 A;  1FPW A;  1URQ A;  2FYU K;  3L75 G;  4ICB A;  3SIA A;  1JUO A;  3L72 E;  3VN0 A;  1BG1 A;  3RK3 B;  2E6W A;  1IFJ A;  1VQK P;  1FJP A;  2ZNE A;  1OOH A;  2E76 D;  2ZRT A;  3MHV A;  4MRY A;  1L2O B;  1XFZ O;  1XFY O;  3Q5R A;  2A06 E;  1KYO I;  2QJP B;  4PHM A;  3SWF A;  1OMR A;  2WSC J;  5APY A;  1L2P A;  4C7R A;  5AW6 B;  1W7J B;  1JY3 O;  1B7T Z;  1EQ7 A;  2RGI A;  3PP5 A;  1SKT A;  1YX7 A;  1N86 A;  1EG3 A;  5CCG C;  1YRT B;  1IJ6 A;  3I5I B;  4ORA B;  2I1J A;  1UUR A;  1VF5 B;  2NCO A;  5CSJ A;  3CR2 A;  2Q7C A;  2WCH A;  1WRL A;  3LW5 H;  1S1E A;  2JWW A;  2L5X B;  4YGB B;  1CM1 A;  1SY9 A;  2ZN8 A;  3KPE A;  1GDT A;  4YGE B;  4WRI A;  2WSE J;  1LS8 A;  2P7J A;  4FQT A;  1YIT P;  4H0L C;  1S26 D;  1SQQ D;  2LHI A;  4XA4 A;  2K2F A;  1NTZ E;  2A45 H;  1PSB A;  2IDB A;  1RF0 C;  1G33 A;  2FY8 A;  3EK4 A;  1USE A;  1JY2 P;  1DF0 B;  1NYH A;  5H2F E;  3D75 A;  2LC5 A;  1N8R Q;  4GGF C;  4PV1 D;  1FAV A;  2BL0 B;  2QAC A;  4UB6 E;  1DJI A;  2WPV B;  1WRK A;  1UP5 A;  2QDI A;  2M1U A;  1BMO A;  1J2J B;  1A02 J;  3C8V A;  3H1I D;  1OVU A;  3EK7 A;  5APS A;  3B71 A;  1A4P A;  1M31 A;  1L0L G;  1JM0 A;  1BCC G;  1PIX A;  1S2E A;  3TUY C;  1TNP A;  1W7I B;  2IFN A;  2H89 C;  2GUS A;  3BUM B;  2HFE D;  2KXP B;  1DEB A;  2HYN A;  2OYI C;  3CWB E;  2XU6 A;  1SL9 A;  3DVE A;  1RQV A;  5KJ7 A;  3SG6 A;  1K90 D;  1H89 A;  1SQB G;  1M57 D;  3A2A A;  1OVR A;  1B4C A;  2JRF A;  4L76 A;  2DW3 A;  4PE1 A;  3MP7 B;  3D74 A;  2R5B A;  4KHX A;  3RK2 C;  4QJ4 B;  3HTK B;  1FS0 E;  3Q1M A;  1MWN A;  2CXJ A;  3M0D A;  4PD4 D;  1NTM J;  2CPB A;  4GNK B;  1GU5 A;  3VGO A;  1R6P A;  4XFJ A;  1L0L K;  2PGD A;  1PFI A;  3CME P;  5AVR B;  4O9B A;  1K2H A;  4PE0 A;  3MTU E;  4PHN A;  2L2C A;  1T2K C;  3BRT B;  2ZVN B;  2H43 A;  1SQQ E;  1QLS A;  2Q91 A;  2L51 A;  2WC6 A;  4JYC A;  3D0Y A;  4CFQ A;  4GKG A;  1SR6 B;  4KJM A;  1KFX L;  2A06 G;  1SQB K;  2B88 A;  1DJW A;  3GOF A;  1YQ3 C;  1RF1 B;  3L70 G;  1KZU B;  2I7A A;  1L2O C;  3JVT B;  4OZD A;  4PDZ A;  4MRX A;  2QJP C;  1AVO A;  1SSE B;  1GL2 B;  1GGZ A;  2IX7 C;  1K8U A;  3VP9 A;  3Q5S A;  3BFB A;  1HQV A;  2J5U A;  1LA0 A;  3RL0 B;  2J59 M;  3H1L J;  1VQL P;  5H2F H;  3KHU A;  1VPC A;  1VQO P;  2L98 A;  4GGN A;  3I5I C;  4FQO A;  2K9J B;  5BPJ A;  4UB6 H;  1B8L A;  4HH2 A;  1VF5 C;  1X79 B;  4WBA A;  4A4B A;  3BCC G;  3TNU A;  2GV5 A;  2I8D A;  1CLL A;  3OA7 A;  1CSB A;  3S9O A;  2N1T B;  1J1E A;  3P7K A;  2QPT A;  4H44 B;  3TGU E;  1D7M A;  2MHH A;  2ZXX A;  2P58 A;  3EFF K;  3L73 J;  2KI6 D;  5AXI A;  5AVZ B;  3CI9 A;  3S0G A;  3MGN A;  1A2X A;  1IFP A;  2BL0 C;  4UPG A;  4YRU A;  1GZL A;  1IZN B;  4ZKP A;  1DX7 A;  1TIZ A;  1K93 D;  1JTH B;  2WND A;  2AMI A;  4D6T J;  1FF1 A;  1IQ5 A;  1NTZ K;  1YJN P;  3TDI A;  1PGQ A;  4NPF X;  2FYU J;  3W68 A;  1DIP A;  3BVH A;  3L71 D;  3PAL A;  5BU8 B;  2O60 A;  2E74 B;  1KFU S;  2M8U A;  2WWW A;  4OV2 A;  3TDU A;  3AEE C;  1BOD A;  5APV A;  1HJ0 A;  4WVZ A;  3CMA P;  5JOL A;  2LCP A;  4P2Y B;  4K3A A;  4U8D A;  3DVJ A;  2K7B A;  5DKR A;  3BQ3 A;  4M2Q A;  2LVI A;  2GGZ A;  4OKH A;  3AED C;  3HRN A;  3EVR A;  1M8O B;  1TN4 A;  1AUI B;  5KTB A;  1LT9 B;  3PLN A;  1SQQ G;  4CPV A;  4I6M C;  3L75 J;  4EIJ A;  2CBL A;  1Q86 Q;  2AXT E;  4N6J A;  3RL0 g;  3E3R A;  3EVU A;  2YNY A;  3KEV A;  4PV1 B;  5AER A;  5APX A;  4QJ5 B;  2KYC A;  3QH9 A;  1TNX A;  2H61 C;  3CCU P;  1PSR A;  1OX3 A;  2Q3E A;  1KYO D;  1KFN A;  2N9B A;  1SR6 C;  3FWC A;  4MBE A;  2FYN B;  2JJL A;  5KKZ B;  1RF1 C;  4GOD A;  2V7Q J;  2OAR A;  2M3W A;  2ZND A;  2V53 A;  3FWB A;  4HJG H;  4NDC A;  5BU5 A;  1YTZ C;  2BNX A;  3H1I G;  1CZQ A;  1ZOT B;  4ORC B;  1IKU A;  1ZFS A;  1B9A A;  4GOF A;  3BXK A;  1A03 A;  1SQQ K;  3CCV P;  4HRG A;  3RL0 C;  3VMZ A;  2B89 A;  4LGD E;  2Y9Z A;  1MFZ A;  1QVI Y;  4YXW H;  3L71 E;  5I8N A;  3AE1 C;  4JD9 A;  2JXL A;  1ZV8 A;  1NHL A;  3PN7 C;  3AE6 C;  4EI2 A;  3F5H A;  3L36 A;  4EDF A;  3CC7 P;  3BAT A;  5CMZ A;  5AVX B;  1EXJ A;  1DJG A;  3IAO A;  3W67 A;  4ZNC A;  3O78 A;  1FZA A;  1DMO A;  1EC5 A;  1TNW A;  1UHJ A;  1DD3 A;  2QEV A;  4JKT A;  2WPR A;  1GW4 A;  1M1J B;  2AEJ A;  2WT7 B;  2M7N A;  2N1T C;  3P8C E;  3E1I A;  2G9B A;  1Y9B A;  3E1R A;  3TDZ A;  4H44 C;  3LIE A;  5GTI E;  4TLF A;  1KQM B;  2WOS A;  1HGV A;  5AW8 B;  2O01 H;  1BGY G;  3TS5 C;  1SYM A;  1KOR A;  2NZ2 A;  1C7V A;  1JCC A;  3B4S A;  2L5G B;  1R5L A;  3A0B E;  1F71 A;  1FZE A;  1XVJ A;  1T3J A;  1QJT A;  2LAN A;  2OYH B;  2FFD A;  1PPJ D;  2E76 C;  4ZCV A;  3GG2 A;  1BDC A;  2KAY A;  3KO0 A;  2KSP A;  3L4F A;  1L0L J;  4IL6 E;  2YMK A;  2FOT A;  2JTT A;  4FTG A;  1BCC J;  3NSK A;  1FZC A;  1KYO E;  3NMD A;  2YMY A;  3EVV A;  1T8Z A;  3GK4 X;  1EXR A;  1A29 A;  1RJV A;  1LP1 B;  2I1K A;  1HVV A;  3S4R A;  3H1J E;  3T97 B;  2KPH A;  3BOW A;  1IFN A;  5AW3 B;  1WDC B;  1NX3 A;  1CI6 B;  3H1H G;  2AXT H;  4DJG A;  5B5E E;  3CWG A;  2K60 A;  4PHK A;  1NOH A;  1SQB J;  2E74 C;  2F3Z A;  1K8A Q;  1G1I A;  1NH4 A;  3U1C A;  5HLV A;  1GD2 E;  3G6E P;  3NSL A;  3CXH I;  4MN4 C;  2N9Y B;  2E75 B;  4Z1M H;  4HRE E;  1SFC D;  2W83 C;  1OZO A;  1NTK D;  5CCH C;  2LVK A;  1F54 A;  4IFF A;  2YXQ B;  1LT1 A;  5CBO A;  2BCX A;  1C7W A;  1SQV E;  1N7S D;  1LT9 C;  3NSI A;  2ERB A;  2KLD A;  2ZT9 B;  5DKQ A;  1PL5 A;  3BRV B;  3ITK A;  2LVJ A;  3O4Y A;  1OXZ A;  3ZDM A;  3DXL A;  1GL2 A;  1MHO A;  1KQG B;  3NGV A;  2JO1 A;  1NVO A;  5AVV B;  5JJG A;  4PV1 C;  2KAX A;  3L70 J;  1JOC A;  1HF9 A;  3SIB A;  5KAI E;  3S0B A;  2WPQ A;  1YRU B;  3L47 A;  4U3F E;  1SP4 A;  2FYN C;  1Y6W A;  5KKZ C;  2YGU A;  1DEL A;  2OQQ A;  4B86 A;  3C1L A;  3A7O A;  3WHU B;  2H8V A;  1PPJ E;  3AEB C;  3IQQ A;  1J1D A;  3HE5 B;  2NPS D;  1KIL D;  2BCA A;  4C7N A;  5AW0 B;  2ZXE B;  3EK8 A;  1QGK B;  5GTI H;  4JWQ A;  3SG7 A;  1Q80 A;  3SJS A;  4WY4 B;  1S9K E;  1NKN A;  1P84 I;  1L4A D;  4OCI A;  3A0B H;  3A5T A;  1ZN5 A;  3BCC J;  3GF7 A;  1MUX A;  5E79 E;  2YO3 A;  1X0T A;  2P71 A;  3USS A;  1AHR A;  1FJK A;  3R2P A;  2KP8 A;  1FI5 A;  2WQY C;  3S0A A;  4UB8 E;  2JKV A;  4IL6 H;  3LID A;  4DIR A;  4WQ2 A;  1KSM A;  2NZ0 A;  1EZV G;  3GF3 A;  1KYO H;  3AAK A;  1N73 A;  1PP9 D;  2IPP A;  3M06 A;  3V2L A;  2KGR A;  1KQS O;  2LE9 B;  1M1J C;  3CCS P;  3B5N B;  1S5L E;  2JC2 A;  1NU1 D;  3K21 A;  4MN0 A;  3JCU E;  3OAK A;  1PVB A;  5B5E H;  2QEB A;  1KTM A;  2LLS A;  1HJB A;  1BOC A;  3WXA A;  3OBV A;  1H88 A;  1RE4 A;  1QVI Z;  4EYY Q;  1BDD A;  1QWV A;  1K96 A;  2Y0D A;  1C07 A;  3AEC C;  1IJD B;  5ER4 X;  4DRW A;  2SCP A;  1IH0 A;  1CKK A;  2LMT A;  3B7A A;  3G71 P;  1B8R A;  5HKY A;  4PE7 A;  1EL4 A;  2MKV A;  1AFO A;  1OWA A;  3AKA A;  1ZLL A;  2W27 A;  5AVY B;  1A02 F;  4LLH A;  1TNQ A;  5APU A;  2PAL A;  3UIA A;  4DZO A;  1EDJ A;  5PAL A;  1WDC C;  1J7R A;  3HD7 D;  2O5G A;  2XZR A;  3BJH A;  2WMM A;  1RE3 C;  1QX2 A;  5KAI H;  1L0N E;  3V2N A;  2KNC A;  1RH5 B;  5AW9 B;  2E75 C;  1Y8A A;  3CR5 X;  3FWL A;  4K35 A;  1QLK A;  1RRO A;  2BCC D;  1NP8 A;  2LP3 A;  1K04 A;  3CLN A;  3OX5 A;  2MJZ A;  2CNP A;  5D7F A;  2Y9Y A;  2O01 N;  1QX8 A;  1KN7 A;  1DGV A;  1QIV A;  2OS8 B;  2AXC A;  4I1L A;  4N5X A;  1PP9 E;  2ZT9 C;  1MKM A;  2KI6 C;  2QVA A;  2IBZ G;  3AEF C;  1NU1 E;  4XJK B;  1FBV A;  4YI9 A;  1SCM B;  3DD4 A;  3TK1 A;  1OZS A;  3V6I A;  1S6I A;  5E79 H;  2YKO A;  1K94 A;  3CWB D;  5CSI A;  4DT0 A;  3PLF B;  2YKP A;  2W6J H;  3PM2 A;  1UUS A;  1YI2 P;  1XFW O;  2KLE A;  1JNM A;  2KLV A;  4UB8 H;  1KC8 Q;  3H1I J;  3AEA C;  5KLV J;  3SG2 A;  1Y1A A;  3D73 A;  3CPW O;  5APW A;  4I5K A;  1AVS A;  1NYA A;  3PTZ A;  1S5L H;  3L74 E;  1PK0 D;  3JCU H;  4L9M A;  1LJ2 A;  2EC6 B;  4A7P A;  1SQP D;  2KI7 B;  3D10 A;  4WY4 C;  2M3B A;  3SWK A;  2HPS A;  1K9K A;  1NUB A;  5B8I B;  1Z56 A;  4GIF A;  2OTK E;  3VRP A;  1S3J A;  4EOT A;  1F55 A;  1SQX E;  2G2B A;  1EXI A;  3Q8I A;  3V2P A;  3SS4 A;  3V2R A;  4TT3 H;  1GU4 A;  3CGA A;  1SFC B;  3FXD A;  2HOD A;  2M49 B;  5I94 A;  1QTX A;  3GHG C;  3IF4 A;  1NTK G;  2OYH A;  1LTJ A;  1GGW A;  2KNE A;  3FWN A;  4N78 D;  1BGY J;  1PGP A;  1N7S B;  1MR8 A;  3QRX A;  1REC A;  2CPS A;  3B5N C;  2BCC E;  2M5A B;  2O3J A;  2KSJ A;  4NPE A;  1QEX A;  2R3S A;  1XA5 A;  3NTN A;  1MZ9 A;  1KB9 I;  1XTG B;  1N2D C;  2A45 G;  5AW1 B;  2KAV A;  1CI6 A;  1VL2 A;  4PT1 A;  1DH3 A;  1JY2 O;  1JMB A;  1LVC D;  1SBJ A;  3H1K E;  2HPC B;  2G8Y A;  1URQ D;  3I5H B;  4PCW A;  1KIL B;  2NPS B;  3II6 A;  3H1H J;  3B86 A;  1NTK K;  1PZQ A;  1UHK A;  2BE6 A;  3M9H A;  1YHQ P;  3GLM A;  1CDP A;  1BE3 E;  3DY9 A;  1L4A B;  1DVI A;  3AE3 C;  3CCL P;  1HH0 A;  1IWQ A;  4AQJ A;  3CXH D;  3CDN A;  3V4W A;  3TGU D;  1DEK A;  2I94 A;  2B87 B;  1PGJ A;  1V1F A;  1KFM A;  1OZH A;  1GM0 A;  1GTW A;  1SQP E;  4BWN A;  1B8C A;  3VRQ A;  2BCB A;  2AEF A;  2YIU B;  1NPQ A;  3L72 G;  2ZAE B;  3IQO A;  2ZFC A;  3SFD C;  2BEC A;  1OMI A;  4OGQ B;  3S1K A;  1XFU O;  1CDM A;  1S3P A;  4YTP C;  2CT9 A;  1GW3 A;  4GFT A;  1T3U A;  1NU1 G;  2LMV A;  2OS8 C;  2PYQ A;  1TTX A;  2K7C A;  5CCG A;  1NGM B;  2Y1N A;  4GPL B;  3QME A;  4H13 B;  4N78 E;  1Q82 Q;  3CC4 P;  5DJU B;  3HE5 A;  1LXF C;  1FOS F;  1SCM C;  1DQE A;  2Y4Q A;  4A4C A;  2WSF H;  2RH0 A;  1ZRT D;  2QEH A;  1UWO A;  4C0K A;  1P84 D;  3HUS B;  3CD6 P;  2WC8 A;  2H7H A;  1WMK A;  1RF0 A;  3PN7 B;  2CCM A;  1K73 Q;  1LTI C;  3HD7 B;  2Q4U A;  1NU1 K;  2W8Z A;  2WVR A;  2EC6 C;  5AEQ A;  4GBA A;  4GGF A;  1AQ5 A;  1Q90 D;  2KQY A;  1NTZ G;  1MV8 A;  1KFX S;  3P8M C;  2ZYG A;  3PJS K;  2WCL A;  1AJ4 A;  4RJT A;  3CXH E;  1XK4 C;  3WNX B;  1AP4 A;  1OW8 A;  3JSV C;  3CYZ A;  4TNC A;  2B9B A;  3TS5 B;  2ZYD A;  1SFC C;  2KUB A;  1KV4 A;  1OW4 A;  5KU1 A;  2YKQ A;  3SS3 A;  1PGO A;  1NTM D;  5KJ7 D;  3V2Q A;  2MRD A;  1JB0 J;  2O1J A;  1N7S C;  2E76 B;  2HF5 A;  2WCJ A;  2OYI A;  1G2C A;  1KD1 Q;  5DIC A;  1L7Z A;  1R2U A;  1AK8 A;  1RHZ B;  3KDP B;  4R4L A;  1CM4 A;  1JCD A;  3SFE C;  1DJH A;  3CWB G;  4YI8 A;  2BBN A;  2E43 A;  1K9P A;  5GQQ C;  4MLW A;  1G8I A;  2L91 A;  1KK8 B;  5AW5 B;  1RK9 A;  1OOJ A;  3I5H C;  1OVV A;  2NPS C;  1KIL C;  1YTZ I;  3H32 A;  3CZ2 A;  4MZK A;  1QX7 A;  2QG4 A;  2AEM A;  1ZRT E;  1JSA A;  4IL6 X;  2KGB C;  1L4A C;  3H1L D;  1P84 E;  3P8C D;  2Y0C A;  1OE9 B;  2WCE A;  2LKM A;  3O6Q B;  5AW7 B;  1QX5 B;  1KQV A;  4HB1 A;  1LGH B;  3BUN B;  4HYT B;  4BXL A;  1IK7 A;  3WMM 0;  4GUK A;  4MEW A;  1U7M A;  5APT A;  5FYX A;  4JPZ B;  3CCE P;  1DC1 A;  2YIU C;  3VOP A;  1Q7Y Q;  1UHH A;  3CZ0 A;  1YUS A;  1EH2 A;  2K1A A;  1IO4 A;  1JF0 A;  4AQI A;  2JP3 A;  1LA3 A;  4OGQ C;  3O2P A;  2JWD A;  1OFC X;  1VDF A;  3L4A A;  1VQ5 P;  4C46 A;  2C0X A;  3IF7 A;  2JNX A;  1JBA A;  2MBX A;  3NHT A;  3MZW B;  1NTM E;  2WSC H;  2JZI A;  3L73 D;  1WLM A;  2JQ6 A;  3AE5 C;  3H1J D;  4H13 C;  1Y1U A;  2JDI H;  4Y28 J;  4YXD C;  3CXH H;  5IBW A;  2M1K B;  2RN0 A;  4DS7 A;  3V4Q A;  1IIO A;  2MA2 A;  1JWD A;  2F2O A;  1URQ B;  3PHL A;  1PAL A;  2BEZ F;  3LCP C;  3L35 A;  2KSE A;  2HET A;  1VQM P;  3A3Y B;  2JT0 A;  2LP2 A;  1WLZ A;  1RFJ A;  2I2R E;  2IZ0 A;  2FYU D;  1UHN A;  1DJZ A;  2VRG A;  1QL1 A;  2BAS A;  3HUS C;  2IYO A;  1TOP A;  2WSE H;  3CX5 I;  3HD7 C;  1DF0 A;  4IL1 A;  3S0F A;  4WWI A;  1JMM A;  1QAS A;  2EHB A;  3TGU G;  4U7J A;  1SQV D;  1B1G A;  3N7H A;  3ZWH A;  2KI4 B;  1Y0V H;  3H1L E;  2PSR A;  2OTL P;  4W80 A;  3RK2 D;  1NTK J;  3O8Z A;  4NDB A;  3I56 P;  1ORG A;  2TN4 A;  2C0W A;  3LW5 J;  2G3A A;  3EWK A;  5M1B A;  4U3F D;  3AE8 C;  1XO5 A;  1JC2 A;  4W7Z A;  1QVG O;  4PAL A;  3PM8 A;  3L75 D;  2P10 A;  5B66 E;  5AVW B;  1P84 H;  4BY4 A;  1CLM A;  1BLQ A;  1BF5 A;  1QLE D;  3RK3 D;  2R32 A;  5KLI B;  2KS1 B;  1W2B O;  3VYI A;  1YYC A;  4YPC A;  3LL8 B;  1S9K D;  1S5L X;  3OW2 O;  3EQ2 A;  3L73 E;  1X02 A;  2WCB A;  5I2O A;  2B87 A;  1DJX A;  3HTK A;  1S36 A;  1G1J A;  1KK8 C;  1J7O A;  2GUV A;  3U1A A;  3CAB A;  4ASV A;  3PJI A;  2KBM A;  3D6Z A;  2ZFD A;  4D6T E;  3B8E B;  2KDH A;  2OTG C;  3CCM P;  3VMA A;  5AVU B;  2QJK B;  2IS9 A;  2FYU E;  3FE9 A;  1GK6 A;  5APQ A;  3KXD A;  1IFM A;  2H61 A;  4QJ3 B;  2D8N A;  2LNK A;  3L72 J;  3SSU A;  2FJU B;  3RBZ A;  1PUL A;  1OOG A;  3M0A A;  1RF1 A;  2WOR A;  5HKW A;  2GTE A;  1CMF A;  2NXQ A;  1YX8 A;  1LTS C;  2OYO A;  3C1V A;  3RM1 A;  2IYP A;  4E68 A;  3MIW A;  4GT1 A;  1MUU A;  1NKZ B;  1NTM G;  1JEK A;  4PD4 I;  2IZ1 A;  1YUT A;  3Q5P A;  2F2P A;  2JNF A;  3L37 A;  4JF7 A;  3N4X A;  1KB9 E;  1IQ3 A;  3VP8 A;  2K9J A;  1F4Q A;  3L75 E;  1EDI A;  1X22 A;  4N1G A;  2KB7 P;  1SLQ A;  1VQ8 P;  1IG5 A;  1NCX A;  1CTR A;  3DVM A;  3GK2 A;  2LR2 A;  2Q3I A;  3PSR A;  1YVL A;  3RK3 E;  2DOQ A;  1KCY A;  3G3Z A;  3L71 G;  1BCC D;  1LTT C;  5J3X A;  3KPX A;  3ICB A;  4GAO A;  1L0N D;  1URQ C;  2N1T A;  1YTZ T;  2FXP A;  4M2O A;  3D0Y B;  2ISD A;  5L8R J;  4CFR A;  2WC5 A;  4F7F A;  1CNP A;  2W6B A;  1Q81 Q;  4WQ3 A;  1NTM K;  2XNX A;  2OGU A;  1KQF B;  2K8M B;  5HKZ A;  1M39 A;  3B88 A;  5B66 H;  1NTZ J;  1SMG A;  2I18 A;  2P1J A;  1IJ5 A;  1NIW A;  4INX A;  1YUU A;  1CDN A;  3F89 A;  1SVF A;  3HE4 B;  3GHG B;  4I5L B;  1VQP P;  4ORB B;  2Z4E A;  1YVH A;  1R5S A;  2UWJ E;  2KI4 C;  4KYN A;  4MZL A;  4YGC B;  4L73 A;  4N1F A;  1JUN A;  1JTH A;  1UII A;  3OHM B;  1VQ4 P;  5D69 A;  3Q3D A;  2H88 C;  2KYF A;  1FI6 A;  2QSI A;  5AAN A;  4M3L A;  3U59 A;  3I5F C;  1H0T B;  2BEQ D;  3EKH A;  2ZVO B;  1JFJ A;  5TNC A;  2K3R A;  2KLU A;  2R44 A;  1M63 B;  1NX1 A;  3E7K A;  3FIA A;  5KAF E;  3L74 D;  3L73 G;  2HQW A;  1NX2 A;  2XKM A;  5CSF A;  1J1E B;  2BKI B;  4D1E A;  3BFA A;  2K88 A;  3VB1 A;  3CWB J;  3H1J G;  2WCF A;  3CLQ A;  5KLI C;  3ABV C;  3R1P A;  1U7J A;  1QXP A;  2LV7 A;  2PFX A;  1OMD A;  2SPZ A;  2QJY C;  3BUW B;  5CCH A;  4IJ7 A;  2YXR B;  1SQX D;  3PAT A;  1HUC A;  3SWY A;  1GL2 D;  2ZYA A;  2M97 A;  3NHI A;  3WHT B;  1LT9 A;  1L0L E;  1NSH A;  1S5G Y;  1BCC E;  1RY3 A;  1H8A A;  2R2I A;  3B6X A;  1FZG A;  1ZME C;  4R4M A;  2KYV A;  2QJK C;  3FX0 A;  1SS1 A;  1U5I B;  3FE6 A;  1KB9 H;  2M0B A;  4ZMD A;  1SQV G;  1SQQ J;  3BCC D;  3CTN A;  1MFT A;  2LUX A;  1SQB E;  1FE6 A;  1Z4H A;  1OW6 A;  3CZT X;  3SG4 A;  1HTL C;  2K0J A;  4OVN F;  1EZV I;  1XTC C;  2JTZ A;  2D2C D;  1LNQ A;  5KJ7 C;  3H1K D;  3VRO A;  4U3F G;  2B1U A;  2HLO A;  2V7Q H;  3FS7 A;  2JR8 A;  1SRA A;  1TCO B;  4YGD B;  1JY3 P;  3SS5 A;  1V1G A;  1LIN A;  4OH8 B;  1PPJ G;  3V5B A;  3HX4 A;  2MLE C;  4HSZ A;  2C9L Y;  2VRS A;  3JC2 2;  2PQL A;  1MXE A;  3RLZ A;  1BE3 D;  1FDI A;  3D6Y A;  3M0D C;  2OPO A;  1SQV K;  3BYA A;  2H2K A;  1YBK A;  2V4H A;  1CW5 A;  1MQ1 A;  1SPY A;  1CFF A;  3I55 P;  3L70 E;  3SG3 A;  1CDL A;  1LTG C;  3WU2 E;  1M1J A;  3WUU A;  2WT7 A;  3CX5 D;  1NWQ A;  1W5C E;  2JU0 A;  1AQT A;  1BJF A;  4HKZ H;  2SAS A;  3CS1 A;  1AJY A;  2E74 D;  5CPV A;  1OIP A;  3TGU J;  2M3E A;  2QEO A;  3PH0 A;  5KAF H;  1ODB A;  1FW4 A;  1U57 A;  3BUO B;  3HCM A;  2K9Y A;  1JO5 A;  2HG5 D;  3CZ1 A;  5AVQ B;  2LM5 A;  1FDO A;  3TSI A;  1JF2 A;  5CCH D;  2GGM A;  1K9U A;  2KS1 A;  3BCC E;  1S1C X;  3P32 A;  3RZS A;  2KBI A;  5CJ0 A;  1CFP A;  2L0P A;  1VQ7 P;  2QM8 A;  1LP1 A;  2P70 A;  3IVT A;  3T97 A;  3H4S E;  3C9I A;  3AE9 C;  2BKH B;  1QAT A;  2ZRS A;  1IK9 A;  1DTL A;  1RE3 A;  2O01 J;  3VMX A;  2IBZ I;  1TRF A;  4L75 A;  3PRJ A;  1J1E C;  2JWA A;  1LTB C;  1IGV A;  2L2E A;  3K1E A;  2M29 A;  2KK7 A;  1DJY A;  2QA4 P;  1USD A;  1W2E A;  4I5N B;  5HLO A;  5KLV D;  5BVZ A;  5GTH E;  4Y99 B;  2JEE A;  4WB4 A;  1L0N G;  1UHI A;  3VTP C;  1WRZ A;  1M56 D;  3KHE A;  3S0D A;  2FXO A;  1OW7 A;  2FFD B;  2KZI A;  2XDJ A;  3PFV A;  3A8R A;  1EJ3 A;  5I2Q A;  3QWO C;  1YJ9 P;  1E5W A;  1FBM A;  3CX5 E;  2BBM A;  1FC2 C;  4ZKU A;  1FZC B;  2M0R A;  3NSO A;  2PP6 A;  1B47 A;  2JT8 A;  5CSN A;  1PRW A;  1PP9 G;  3BOW B;  4PE4 A;  1X9V A;  1OSA A;  3EFG A;  1W9Z A;  2K7D A;  4I5J A;  3VRR A;  1IC2 A;  1SNL A;  1ALW A;  5FI6 A;  4JYB A;  5AW2 B;  1ZMZ A;  2KFF A;  4GDO A;  4W7Y A;  3GK1 A;  3UNW A;  1SL8 A;  3WU2 H;  1VRK A;  1H8B A;  4RO0 A;  1DD4 A;  2JPT A;  1L0N K;  1DEE G;  1BGY D;  1VQ9 P;  1NAY A;  3NXS A;  1S5G Z;  2K7O A;  1SCV A;  4WY4 A;  1G4Y R;  1F70 A;  2E42 A;  3DYE A;  1WY9 A;  1J7P A;  1GQM A;  3FGA D;  5AW4 B;  3RK3 C;  1F8H A;  3L74 G;  2K2A A;  3BAS A;  3KYQ A;  2QEX P;  2A45 I;  1KMI Z;  3L71 J;  1NX0 A;  2LAP A;  3TYY A;  2LVV A;  4BY5 A;  5FI2 A;  3BFH A;  2BAP A;  1OMV A;  1CMG A;  1TUJ A;  3AAJ A;  2Z5H A;  3HE4 A;  3GHG A;  2QE7 H;  3FXE A;  1MF8 B;  4PJ0 E;  1SQX G;  4IOI H;  3FE8 A;  3H1H D;  4YGA A;  1XFX O;  3B5N A;  2PVB A;  2Y1M A;  4MSP A;  4MZJ A;  2PAJ A;  1BR1 B;  1IFI A;  3CL3 D;  3H1I E;  2E5Y A;  5KLV E;  4INW A;  3RBX A;  2LXC B;  1QVF O;  3VRN A;  1BSN A;  2KOT A;  1N2D A;  3CCR P;  3OB1 B;  1NWD A;  1FZB A;  1J1D B;  1NCY A;  1H0T A;  4C7N B;  2BCC G;  4M2P A;  5EL2 A;  3AEG C;  1BSH A;  2OTJ P;  2E75 D;  2M9G A;  2WSS H;  1KFU L;  5GTH H;  4P5O E;  2D2C B;  1C3Y A;  3OJA B;  1KK7 Y;  3CR4 X;  2Z5I A;  4XYN A;  1SQX K;  3H1K G;  4PD4 E;  2ZT9 D;  1LWU B;  1ZXG A;  3OGN A;  2BE4 A;  3H1J J;  3F45 A;  1T6A A;  3CX5 H;  1D1O A;  1FZF A;  1R8E A;  2JT3 A;  1FDM A;  1HT9 A;  1BGY E;  1N73 B;  1GJY A;  5TIS E;  1BE3 G;  3GW6 A;  1XYD A;  2WCM A;  3A0H E;  5KTY A;  4I7Z B;  2RKL A;  1UIX A;  1YUR A;  1U5I A;  2OTG B;  3MSE B;  5CCG D;  4IFM A;  3KQG A;  1SQP G;  2LLT A;  2LLU A;  4Y99 C;  1J7Q A;  2KHN A;  1WRG A;  2L5Y A;  1IFD A;  3O6B A;  1A75 B;  2HQ8 A;  5TJH A;  4JBZ A;  4WY4 D;  4BRY B;  2FFD C;  2KFG A;  3JTD B;  1KSO A;  2WCK A;  1J55 A;  2LUC A;  1SQV J;  2PMY A;  3H1H E;  3DF0 B;  2FBW C;  4XJK A;  1FZC C;  4H0L D;  1YR5 A;  3AE4 C;  3O4X A;  2Q5U A;  3IN6 A;  1EZV D;  4HRH A;  2A4J A;  2H8P D;  3D70 A;  3L4L A;  4U3F J;  3M0W A;  4GOE A;  5AVT B;  1ZW0 A;  3A4U B;  4PJ0 H;  2W6A A;  2JPO A;  5CBN A;  2JXC A;  1OQP A;  1DT7 B;  1SQP K;  3B5N D;  1NCZ A;  2JUL A;  2Y0E A;  1Y47 A;  4L74 A;  3WUT A;  2KNC B;  1BT6 A;  1ZP0 C;  2K61 A;  5F6T A;  1N65 A;  3TZ1 A;  3DVK A;  2KOG A;  1VQ6 P;  1C3Z A;  4D6T D;  1HBW A;  1XK4 A;  3DZT A;  5G08 A;  2F33 A;  1JY3 N;  3OX6 A;  3JVT C;  1SFC A;  1TCF A;  1K9M Q;  5ER5 A;  2ZJS E;  4AUW A;  1SK6 D;  3Q2Y A;  5KLV G;  1JFK A;  2MJW B;  1GL2 C;  3NFQ A;  3CCQ P;  1QV0 A;  4DCK A;  3M9Q A;  2AUC A;  1YIJ P;  4OR9 B;  1N7S A;  1CLB A;  4PD4 H;  1LKJ A;  2K37 A;  1EDK A;  3R1O A;  2M5A A;  1AV1 A;  1Z2C B;  5HYD A;  1P28 A;  4DOJ A;  1N0Y A;  1WT6 A;  4NQG A;  3UO9 A;  3M91 A;  5TIS H;  3SG5 A;  1S6C A;  1J1D C;  1QIW A;  2POH A;  3A0H H;  4Q04 A;  3IR9 A;  3I5F B;  3ZNI A;  2GA1 A;  1ZAC A;  4RES B;  2P2U A;  3R1V A;  4QMA A;  3CC2 P;  2HPC A;  1KB9 D;  2EGD A;  2KFH A;  1T2K D;  3D71 A;  4MVF A;  3S0E A;  2O1K A;  1E79 H;  1Q2N A;  1EG4 A;  1KIL A;  2NPS A;  4N3Y B;  2D2C C;  1M1K Q;  2ZKM X;  1OOI X;  3NXA A;  1IRJ A;  1EZV E;  5KLV K;  3GMA A;  5AFP A;  3OP0 A;  2CK3 H;  4AOM A;  1L4A A;  2IBZ D;  1CB1 A;  1GK4 A;  1LWU C;  2NRG A;  2HOD B;  2QJY B;  1PV3 A;  1E8A A;  1RWY A;  1LTJ B;  3R4Y A;  4R1E A;  1N73 C;  1CFC A;  2FCE A;  2R3C A;  2FCD A;  3D76 A;  1PVA A;  1JY2 N;  1EDL A;  5CHX A;  2E5T A;  1L0N J;  4I7Z C;  3EG5 B;  4NDD A;  3LLE A;  4JQ0 D;  2FYZ A;  1S72 P;  1TUZ A;  2NCP A;  1RE4 C;  2FKW B;  1K95 A;  1KK7 Z;  2Q6Q A;  1ZOY C;  1VF5 D;  2L4H A;  3CCJ P;  3D78 A;  2FJY A;  3KF9 A;  4ETO A;  1QL2 A;  5CJ4 A;  2F3Y A;  3JTD C;  2WPS A;  1KWO B;  4C0L A;  3LK0 A;  2AAO A;  1PP9 J;  2Q1K A;  4USL A;  3I5G B;  2LXB A;  2M8R A;  1DGU A;  2LHL A;  1NU1 J;  1S4X A;  1B7T Y;  4I2L C;  3VMY A;  3MUD C;  1H4B A;  2F8P A;  5AVS B;  3R72 A;  4PHJ A;  3AE2 C;  3M9B A;  2Q9I A;  1RTP 1;  1Y1X A;  3AE7 C;  5K89 A;  3HUS A;  1M46 A;  5D3O A;  1FOS E;  2WZ7 A;  4LC1 A;  1NO4 A;  3AKB A;  2L50 A;  2LMU A;  4CID A;  1RQU A;  3HD7 A;  3L74 J;  1S6J A;  4IFD K;  4ASW A;  2YO2 A;  3N7N A;  5I2L A;  1GMJ A;  2MLF C;  1L0L D;  3KZI E;  3TF5 A;  3EKJ A;  2IBZ E;  2WIT A;  3IFM A;  2M7L A;  2QM7 A;  3B87 A;  1AA0 A;  1SL7 A;  1HGZ A;  1K05 A;  5EFW B;  1QV1 A;  1SQX J;  1CFD A;  3D77 A;  1AJ5 A;  4AQR D;  1SQB D;  2ITA A;  2WSF J;  3H1L G;  3MD0 A;  2JOJ A;  2PRU A;  3I5C A;  1M90 Q;  1ALV A;  2XV5 A;  1ZR2 A;  1TU3 F;  2W90 A;  4AYC A;  4F0Z B;  1MXL C;  2BCC J;  4OWF A;  4NPD A;  5DJT B;  4H0L B;  2L4I A;  2KZJ A;  3TDK A;  2ZN9 A;  1LWU A;  2R5D A;  2PRR A;  3L72 D;  4RKU J;  3G4S P;  5KSZ A;  3G9R A;  2C9N Y;  5C39 A;  1NAF A;  1LTA C;  2IFM A;  1QS7 A;  1YJW P;  2NLN A;  3TNU B;  3H1K J;  1VQN P;  1BU3 A;  4OGQ D;  2A06 D;  2XND H;  2QRX A;  2P67 A;  1NTK E;  1X8Y A;  4C0J A;  3L70 D;  1KQL A;  1KQM C;  2Y5I A;  1NJI Q;  3WUV A;  4DUQ A;  4H13 D;  1BE3 J;  2WTY A;  1HWT C;  2PAS A;  1M7L A;  3O6Q A;  1ZUZ A; 
#chains in the Genus database with same CATH homology
 2FOT A;  2JTT A;  4FTG A;  4YI8 A;  4YBH B;  5DKN A;  3TUY B;  1IGV A;  2BBN A;  1A75 A;  3NSK A;  2L2E A;  1K9P A;  5GQQ C;  2M29 A;  4MLW A;  3EVV A;  1DJY A;  1G8I A;  1KK8 B;  3GK4 X;  1EXR A;  2E30 A;  1A29 A;  3OB2 B;  1RJV A;  4I5N B;  5HLO A;  1RK9 A;  3DF0 A;  1OOJ A;  3I5H C;  3BOW A;  1WDC B;  1NX3 A;  4MZK A;  1QX7 A;  1UHI A;  3BUX B;  3CWG A;  2KQ6 A;  4PHK A;  1WRZ A;  2F3Z A;  3KHE A;  1JSA A;  3PFV A;  3A8R A;  1EJ3 A;  1F4O A;  1BR4 B;  2KGB C;  5I2Q A;  1OE9 B;  1XFV O;  2WCE A;  1M45 A;  5HLV A;  2COL B;  1QX5 B;  1KQV A;  2P6B B;  3NSL A;  2BBM A;  3BUN B;  4ZCU A;  2M0R A;  4GUK A;  2CTN A;  4MEW A;  3NSO A;  1KWO C;  3LK1 A;  5FYX A;  4CLN A;  1B47 A;  4JPZ B;  2JT8 A;  4HRE E;  5CSN A;  1PRW A;  3BOW B;  1OZO A;  4PE4 A;  1OSA A;  3I5G C;  2LVK A;  2K7D A;  1UHH A;  4I5J A;  3VRR A;  1YUS A;  1SNL A;  1ALW A;  2MAZ A;  1EH2 A;  1F54 A;  1ZMZ A;  2KFF A;  1SW8 A;  1JF0 A;  3GK1 A;  1FPW A;  2BCX A;  1C7W A;  4AQI A;  1SL8 A;  1LA3 A;  1VRK A;  3NSI A;  3O2P A;  1H8B A;  5DKQ A;  1OFC X;  4ICB A;  3SIA A;  2JPT A;  1JUO A;  2LVJ A;  3O4Y A;  3IF7 A;  1BG1 A;  2JNX A;  2E6W A;  2MBX A;  1JBA A;  1MHO A;  1S5G Z;  2K7O A;  2JZI A;  1SCV A;  2ZNE A;  2KAX A;  5JJG A;  1G4Y R;  3SIB A;  2ZRT A;  1WLM A;  1F70 A;  2JQ6 A;  4MRY A;  1Y1U A;  1L2O B;  1WY9 A;  1J7P A;  1XFZ O;  1GQM A;  1YRU B;  1XFY O;  1F8H A;  2K2A A;  4PHM A;  5IBW A;  2M1K B;  1OMR A;  1Y6W A;  4DS7 A;  1NX0 A;  2LAP A;  2MA2 A;  1JWD A;  2LVV A;  4BY5 A;  3WHU B;  1W7J B;  2F2O A;  1PAL A;  3IQQ A;  3LCP C;  1J1D A;  1OMV A;  1CMG A;  2BCA A;  1B7T Z;  3AAJ A;  2HET A;  2RGI A;  2JT0 A;  2LP2 A;  1WLZ A;  1RFJ A;  3EK8 A;  2I2R E;  1SKT A;  1YX7 A;  1MF8 B;  1Q80 A;  1UHN A;  4JWQ A;  1DJZ A;  1EG3 A;  2VRG A;  3SG7 A;  3SJS A;  1YRT B;  1IJ6 A;  3I5I B;  4ORA B;  1XFX O;  4YGA A;  1UUR A;  2PVB A;  2Y1M A;  1TOP A;  4MZJ A;  4MSP A;  4OCI A;  1BR1 B;  1DF0 A;  2NCO A;  4IL1 A;  5CSJ A;  3CR2 A;  3VRN A;  1QAS A;  2EHB A;  1WRL A;  1MUX A;  1S1E A;  2JWW A;  1B1G A;  2KOT A;  1AHR A;  2L5X B;  2KI4 B;  1N2D A;  1CM1 A;  1SY9 A;  2ZN8 A;  3OB1 B;  1NWD A;  4YGB B;  1Y0V H;  4YGE B;  1FI5 A;  4WRI A;  1NCY A;  2PSR A;  4M2P A;  4DIR A;  4WQ2 A;  1KSM A;  2M9G A;  2NZ0 A;  1S26 D;  4NDB A;  3AAK A;  3KO0 A;  2TN4 A;  2LHI A;  2K2F A;  2KGR A;  1PSB A;  2LE9 B;  1G33 A;  1KFU L;  2JC2 A;  3EK4 A;  3K21 A;  4MN0 A;  1XO5 A;  4P5O E;  1JC2 A;  1PVB A;  1DF0 B;  1KK7 Y;  3CR4 X;  4PAL A;  4XYN A;  2LLS A;  3PM8 A;  2LC5 A;  4GGF C;  1BOC A;  3WXA A;  2BL0 B;  2QAC A;  4BY4 A;  1DJI A;  1QVI Z;  1WRK A;  1UP5 A;  1K96 A;  1CLM A;  2BE4 A;  2M1U A;  3F45 A;  1BLQ A;  1BF5 A;  1C07 A;  5ER4 X;  4DRW A;  1BMO A;  1D1O A;  2JT3 A;  1HT9 A;  2SCP A;  3LL8 B;  1IH0 A;  1CKK A;  1GJY A;  2LMT A;  1XYD A;  1B8R A;  3EK7 A;  1A4P A;  1M31 A;  5HKY A;  1X02 A;  2WCB A;  4PE7 A;  5I2O A;  5KTY A;  3TUY C;  1TNP A;  1EL4 A;  1W7I B;  1DJX A;  1YUR A;  3AKA A;  1S36 A;  1U5I A;  2OTG B;  3BUM B;  1KK8 C;  3MSE B;  1J7O A;  1TNQ A;  2PAL A;  2LLT A;  5PAL A;  1WDC C;  2LLU A;  1SL9 A;  3DVE A;  1J7R A;  2KHN A;  1J7Q A;  2KBM A;  2ZFD A;  3SG6 A;  1K90 D;  2O5G A;  1A75 B;  3O6B A;  2HQ8 A;  2KDH A;  2OTG C;  2IS9 A;  2KFG A;  3JTD B;  1KSO A;  1B4C A;  1J55 A;  1QX2 A;  2LUC A;  2JRF A;  2H61 A;  2PMY A;  3DF0 B;  4PE1 A;  4QJ3 B;  2D8N A;  2LNK A;  4XJK A;  2FJU B;  1YR5 A;  4QJ4 B;  1PUL A;  3CR5 X;  1MWN A;  2CXJ A;  1QLK A;  2WOR A;  1RRO A;  5HKW A;  4GNK B;  1CMF A;  1NP8 A;  1YX8 A;  2NXQ A;  2LP3 A;  3VGO A;  1R6P A;  3CLN A;  4HRH A;  2A4J A;  3OX5 A;  3C1V A;  2CNP A;  5D7F A;  2Y9Y A;  3RM1 A;  1K2H A;  4PE0 A;  3M0W A;  4E68 A;  4PHN A;  1DGV A;  1QIV A;  2OS8 B;  3A4U B;  4N5X A;  2JXC A;  1OQP A;  1QLS A;  1DT7 B;  2Q91 A;  1NCZ A;  2JUL A;  1YUT A;  2L51 A;  2KI6 C;  3D0Y A;  4CFQ A;  4XJK B;  1FBV A;  2F2P A;  1SR6 B;  2JNF A;  4YI9 A;  1KFX L;  1SCM B;  1BT6 A;  3DD4 A;  2K61 A;  1DJW A;  3GOF A;  5F6T A;  1OZS A;  1S6I A;  1N65 A;  1K94 A;  5CSI A;  1IQ3 A;  1F4Q A;  3TZ1 A;  3PLF B;  2I7A A;  4N1G A;  1L2O C;  1UUS A;  1XFW O;  3JVT B;  3DVK A;  1IG5 A;  1NCX A;  1CTR A;  3DVM A;  3GK2 A;  4PDZ A;  4MRX A;  3PSR A;  1XK4 A;  1YVL A;  5G08 A;  1Y1A A;  3SG2 A;  2DOQ A;  1KCY A;  2F33 A;  1GGZ A;  1K8U A;  5J3X A;  4I5K A;  1AVS A;  1NYA A;  3KPX A;  3OX6 A;  3JVT C;  3ICB A;  4GAO A;  1HQV A;  1TCF A;  3ZWH A;  1PK0 D;  1LA0 A;  4M2O A;  5ER5 A;  4L9M A;  1SK6 D;  3D0Y B;  2ISD A;  1JFK A;  4CFR A;  2EC6 B;  2MJW B;  1QV0 A;  1CNP A;  4DCK A;  4WQ3 A;  2AUC A;  3D10 A;  2L98 A;  4GGN A;  2K8M B;  3I5I C;  4OR9 B;  5HKZ A;  2HPS A;  1M39 A;  4FQO A;  1CLB A;  1SMG A;  2I18 A;  1LKJ A;  1B8L A;  1K9K A;  1NUB A;  1IJ5 A;  5B8I B;  5BPJ A;  1NIW A;  1YUU A;  1CDN A;  3VRP A;  4A4B A;  5HYD A;  1F55 A;  2G2B A;  4I5L B;  4ORB B;  2GV5 A;  1YVH A;  1N0Y A;  1CLL A;  4NQG A;  3SG5 A;  2KI4 C;  1S6C A;  3CGA A;  2M49 B;  4MZL A;  1J1E A;  1QIW A;  4YGC B;  4N1F A;  2QPT A;  4Q04 A;  3I5F B;  1QTX A;  3ZNI A;  1ZAC A;  1GGW A;  3OHM B;  2KNE A;  5D69 A;  2EGD A;  2KFH A;  2KYF A;  2MHH A;  1MR8 A;  1FI6 A;  4MVF A;  3QRX A;  1REC A;  5AAN A;  1EG4 A;  2KI6 D;  5AXI A;  2ZKM X;  3I5F C;  3NXA A;  1IRJ A;  3EKH A;  1XA5 A;  1JFJ A;  5TNC A;  5AFP A;  3OP0 A;  1M63 B;  1A2X A;  1NX1 A;  3FIA A;  4AOM A;  1CB1 A;  2BL0 C;  4UPG A;  4YRU A;  2HQW A;  1E8A A;  1NX2 A;  2KAV A;  5CSF A;  2BKI B;  4D1E A;  1TIZ A;  2WCF A;  1K93 D;  1RWY A;  1LVC D;  1SBJ A;  4R1E A;  2WND A;  2AMI A;  1CFC A;  1FF1 A;  1QXP A;  2FCE A;  2LV7 A;  1IQ5 A;  1OMD A;  2FCD A;  1PVA A;  3TDI A;  3I5H B;  3BUW B;  4PCW A;  3PAL A;  3PAT A;  1UHK A;  2O60 A;  4NDD A;  3LLE A;  4JQ0 D;  2BE6 A;  1KFU S;  1CDP A;  2M8U A;  2M97 A;  4OV2 A;  3TDU A;  3WHT B;  1DVI A;  2NCP A;  1NSH A;  1S5G Y;  1K95 A;  1IWQ A;  1KK7 Z;  4AQJ A;  2R2I A;  2L4H A;  1BOD A;  3KF9 A;  2I94 A;  4ETO A;  1V1F A;  5JOL A;  2LCP A;  4P2Y B;  2F3Y A;  3JTD C;  4U8D A;  1KWO B;  1U5I B;  4C0L A;  1B8C A;  3VRQ A;  2BCB A;  3DVJ A;  2K7B A;  3LK0 A;  5DKR A;  2AAO A;  3BQ3 A;  3CTN A;  4M2Q A;  4USL A;  3I5G B;  2LVI A;  2GGZ A;  1NPQ A;  2LUX A;  4OKH A;  1DGU A;  2LHL A;  3EVR A;  1B7T Y;  1TN4 A;  3IQO A;  3CZT X;  1AUI B;  2BEC A;  3SG4 A;  1H4B A;  2F8P A;  2K0J A;  4OVN F;  4CPV A;  1XFU O;  1CDM A;  1S3P A;  2CT9 A;  2CBL A;  2JTZ A;  4PHJ A;  4GFT A;  3VRO A;  3E3R A;  2B1U A;  3EVU A;  1RTP 1;  2LMV A;  1Y1X A;  2OS8 C;  3FS7 A;  3KEV A;  1TTX A;  5K89 A;  1SRA A;  1TCO B;  2K7C A;  4YGD B;  5AER A;  1M46 A;  4QJ5 B;  2KYC A;  2Y1N A;  4GPL B;  1V1G A;  1LIN A;  1TNX A;  2H61 C;  1PSR A;  1LXF C;  3AKB A;  2L50 A;  2LMU A;  4CID A;  3HX4 A;  2MLE C;  4HSZ A;  1S6J A;  1SR6 C;  1SCM C;  3FWC A;  4MBE A;  3RLZ A;  1MXE A;  5I2L A;  2Y4Q A;  2M3W A;  2MLF C;  2V53 A;  2ZND A;  2OPO A;  3FWB A;  4A4C A;  4NDC A;  3BYA A;  2H2K A;  1YTZ C;  3EKJ A;  1MQ1 A;  2M7L A;  1ZOT B;  1SPY A;  1SL7 A;  1UWO A;  4ORC B;  1CFF A;  1IKU A;  3SG3 A;  4C0K A;  1ZFS A;  1CDL A;  1QV1 A;  1B9A A;  1CFD A;  2WC8 A;  3BXK A;  1A03 A;  3PN7 B;  2CCM A;  1AJ5 A;  4HRG A;  2JU0 A;  2Q4U A;  2Y9Z A;  1BJF A;  1QVI Y;  2JOJ A;  2PRU A;  2SAS A;  2EC6 C;  3CS1 A;  1ALV A;  5CPV A;  5AEQ A;  5I8N A;  4GBA A;  2JXL A;  4GGF A;  3PN7 C;  4F0Z B;  1MXL C;  2KQY A;  1ODB A;  1KFX S;  1FW4 A;  1DJG A;  1AJ4 A;  3BUO B;  3HCM A;  3O78 A;  1DMO A;  1XK4 C;  1TNW A;  3WNX B;  1AP4 A;  1UHJ A;  2L4I A;  4TNC A;  2LM5 A;  2ZN9 A;  3TS5 B;  1JF2 A;  2M7N A;  5KSZ A;  2G9B A;  2GGM A;  5KU1 A;  1K9U A;  3TDZ A;  2KBI A;  1QS7 A;  1CFP A;  2L0P A;  2NLN A;  1KQM B;  2MRD A;  2WOS A;  3TS5 C;  1BU3 A;  1SYM A;  2HF5 A;  1C7V A;  3H4S E;  4C0J A;  1F71 A;  1XVJ A;  1L7Z A;  1KQM C;  1QJT A;  2Y5I A;  1R2U A;  2LAN A;  2BKH B;  1QAT A;  1AK8 A;  2ZRS A;  4DUQ A;  4ZCV A;  1DTL A;  1CM4 A;  2KAY A;  1DJH A;  1TRF A;  2PAS A;  2KSP A;  1ZUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...