1A5JA

Chicken b-myb dna binding domain, repeat 2 and repeat3, nmr, 32 structures
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
GIPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSSWTEEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B-MYB
publication title Solution structure of the B-Myb DNA-binding domain: a possible role for conformational instability of the protein in DNA binding and control of gene expression.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Dna binding protein
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 1998-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1a5jA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1a5jA02
3G1OA 5IP9J 4I76A 4L5EA 2YU9J 3S17J 1DU0A 2E1OA 1LFUP 3SFIA 4DYQA 1P7JA 5GP9A 2JK3A 2AHQA 4A69C 1IJWC 1H8AC 1VNDA 3WHBA 3O8GA 4JP0A 1LFBA 3BQZA 3ZQFA 2ZB9A 2JJ7A 2NVYJ 2HXOA 2RAEA 2JA8J 2HOAA 5IYCJ 1LE8A 2NVQJ 1A6IA 2LK2A 5EF6A 2N8GA 2MW8A 1ETQA 3ZQHA 2OPTA 5K7FA 2AO9A 5C44J 1VI0A 2NVTJ 1ZK8A 5C4JJ 3S2HJ 2M8GX 2M9HA 1DU6A 3RZOJ 4AYBN 5IOZA 2HDDA 1ITYA 1ZKGA 3S1NJ 3BTCA 3BTJA 5J1RA 4IHXA 3S15J 3ZOBA 3S1QJ 5IP6A 3IH3A 1ZR2A 4XRSG 4W1UA 4M3GA 2JA5J 1ETYA 5M3FJ 2NS8A 2XSDC 1XS9A 5EDNA 1MH3A 2DA3A 2ECBA 2E19A 1NK2P 3HOXJ 4XK4A 3WHCA 4Y7NJ 3TEDA 2DA7A 2O9LA 2CQQA 3K7AJ 5E3NA 2DMPA 4CYCB 1U78A 4MIMA 1WGXA 4A3MJ 2TRTA 4BBRJ 4A3EJ 2CUFA 5K7ZA 4QIWN 5M5XJ 2R5YA 2M34A 3W6VA 2IBDA 2TCTA 4A3LJ 4FISA 3LSGA 3OSFA 1IUFA 1X2MA 2XPVA 1TWCJ 3HM5A 4CYCA 3DCFA 4NDLA 2E2HJ 3JRAA 1AKHA 4IHWA 1MBKA 4FCYA 1AHDP 2MG4A 4A3JJ 1B72A 4ABZA 1VF9A 3PO3J 4M3BA 5M5YJ 4D7MA 4DZPA 1JTYA 2O8KA 3GTLJ 2K9SA 2E2IJ 5HODA 2R0QC 5FKKA 1BW6A 3JRIA 4GFBA 2M0CA 2L7ZA 2DA5A 3RZDJ 1FIAA 2DA2A 1OJLA 2CRGA 3MVPA 5DS9A 1HF0A 1RETA 5F0FA 2XGDA 3JRHA 4C2MJ 5JLXA 2ME6A 2VKEA 5JLWA 2ID3A 3A01A 1JUPA 2LKXA 1P7IA 3FKIJ 1JT0A 4IHVA 5GPCA 3LSPA 1I3QJ 2GM4A 2Y2ZA 1A5JA 2EZLA 2JA7J 4A3CJ 1W0UA 4V2FA 4A3FJ 2WB1N 5E3LA 4AC0A 1QVTA 3BT9A 5FKOA 1XC5A 1Z77A 3ZQIA 5EGOA 4RDUA 1CQTA 1OFCX 1JKQC 2FD5A 1WH5A 3HOYJ 1G2HA 2L0KA 3LOCA 3BG3A 2ELKA 1GV2A 1OCPA 2HI3A 3VPRA 2HQ5A 1HCRA 2FQ4A 2NVXJ 3H0GJ 3LSRA 2EZKA 2VUMJ 3NARA 2DMNA 3TP0A 1H89C 1FEXA 1FTTA 2DJNA 3HOUJ 1ORKA 4BBSJ 2FX0A 2ME0A 2X9DA 1TWFJ 2VKVA 1TC3C 2DA1A 2B63J 2XB0X 3RQIA 3HGGA 5FLMJ 3BG9A 2EQRA 3GTQJ 3TW7A 5F0HA 2Y9YA 1NTCA 3SDGA 1F36A 2Y0SN 3GTMJ 1OCTC 1D5YA 3HKZN 2EBIA 1Z0XA 3QPSA 1PUFB 4C3IJ 2QCOA 3O8HA 1EF4A 4UUSB 3G1LA 5BNGA 1QPIA 2W48A 4J19A 4FE4A 2Y9ZA 4JYKA 3Q0WA 2JMWA 1TWHJ 4HNVA 1JT6A 1YRNB 5F04A 4B1RA 3L1PA 1O4XA 2XGCA 1ETKA 3A03A 2R5ZB 5FKMA 2MGQA 2HOSA 3S14J 4JX4A 2JN6A 5M3MJ 3IH2A 1ETVA 1MBFA 3GTGJ 3DEWA 2H8RA 1S7EA 2EZHA 4D5FA 1RPWA 3BTIA 5C4XJ 5EEAA 4MFEA 5F08A 1MBEA 1QVUA 3TW6A 5IYDJ 4XICA 1W0TA 2R93J 3OSGA 1IGNA 1BJZA 2LD5A 1T56A 1BL0A 5EG0B 2JA6J 4D7NA 3BTLA 2LFBA 3PM1A 3LNQA 1MSFC 2QF7A 4MLOA 5J1UA 1IV6A 3CCYA 2D5VA 3M4OJ 3S1RJ 1X2NA 2K40A 3HOVJ 2LR8A 2JWTA 3S16J 1MBGA 1ZTRA 1JUMA 3FISA 4B4CA 3HDDA 1VFCA 1MNMC 2K9QA 1ZQ3P 2YUSA 3BR5A 1RKWA 2E2JJ 3IV5A 3IH4A 1U9OA 1FIPA 4IEJA 2CUEA 5EZHA 4M3EA 2HOTA 4B3AA 5DTDA 3OOUA 4X1EA 2M2EA 1BW5A 3BR1A 1K83J 3Q0UA 4UUTA 1F43A 1UHSA 1I6HJ 1ETXA 3QQAA 2VI6A 2NS7A 3HOWJ 1JKOC 4M3FA 4JX6A 4A93J 2L7MP 2HXIA 2OF7A 2GLOA 2R92J 5EZGA 4LOCA 3H3VK 2H1KA 2GBYA 4I6ZA 4D5CA 3OIOA 4G12A 1TWGJ 2Y30A 3BR0A 4DYRA 4A3GJ 3MKLA 4FE7A 3Q0VA 2XPUA 3E7LA 3PO2J 3QPLA 4DZJA 1GV5A 2L9RA 3JRFA 5IYBJ 2CQXA 1GDTA 3JRBA 1ZGWA 3B6CA 2I10A 2DTZA 1RKTA 4EEFG 1JJ8C 1FTZA 2VPRA 2COBA 4XRMA 3CMYA 5C3EJ 1U9NA 1RESA 2K9NA 1IDYA 1LE8B 1WH7A 3I4MJ 2DA4A 3BR3A 2DMUA 1TWAJ 4C3JJ 1JKPC 5F1JA 3F0CA 1HDDC 1WCMJ 2FJ1A 2XGEA 3FK6A 5K7HA 3JRGA 2KDZA 4JX5A 5J1YA 1AU7A 4A3IJ 3A02A 2X6OA 3JRDA 3BR2A 3G1MA 1GUUA 2DA6A 4DW6A 3GTPJ 1B8IB 4S0HB 3BG5A 4QSHA 1X58A 4IHYA 3GTOJ 4M3DA 4FTHA 1MBJA 1Y1VJ 1PUFA 2XB5A 2MSYA 2LY9A 1XG1A 3D1NI 5FJ8J 1HLVA 1UMQA 1FJLA 4UUSA 2LTPA 1H88C 4BKXA 2L7FP 5E3MA 3ZQLA 1B8IA 1GT0C 4RBOA 1MSEC 1SANA 5E3OA 5IOYA 3GTJJ 1YRNA 4BY1J 2G0EA 4A3DJ 3JREA 4MO7A 1IC8A 3GTKJ 2R5ZA 4AUXA 2LLKA 3SJMA 2DMTA 2R5YB 3GBGA 3JRCA 4QTRA 2XRLA 4W97A 4X6AJ 1MH4A 3TP3A 3HOZJ 2LVSA 4A3KJ 5EYRA 1Y1WJ 2X48A 1E3OC 4MFDA 3CQZJ 3BQYA 5FKNA 1AKHB 1APLC 3K2AA 3HBLA 2CU7A 5GPAA 1MBHA 3BR6A 1JGGA 1B72B 2IEKA 1K61A 2ID6A 3ZQCA 4V2GA 2R7ZJ 2O7OA 3C2BA 5EG0A 1GVDA 1Q1VA 3B6AA 4XIDA 3HGYA 2WV1A 2NOGA 3FIWA 1ZR4A 9ANTA 2Y31A 3Q3SA 1QRYA 1JTXA 1ETOA 1JKRC 4BXXJ 3MN2A 4Y52J 2P81A 2ECCA 3RKQA 1SFOJ 2DMQA 2LP0A 1WPKA 1IRZA 1ENHA 4XRSA 4C3HJ 3JR9A 5FLVA 2IAIA 3A01B 3UKGA 2XPWA 1R9TJ 3S2DJ 1T33A 1UG2A 3ZQGA 3CDLA 3M3YJ 2EH3A 2CJJA 2HYJA 3LSJA 5F0CA 5F27A 1IG7A 5J3LA 1POGA 1ETWA 5M5WJ 5EGOB 1BA5A 1NK3P 2YS9A 4M6VA 2PMZN 3HEFA 3I4NJ 2EZIA 1HDPA 2WAQN 2DN0A 3S1MJ 4BY7J 5FKLA 3FK7A 1IDZA 1HOMA 4DYCA 1U8BA 1WI3A 2KT0A 3HB9A 1RR7A 4A3BJ 1JJ6C 1I50J 3NAUA 5IPAA 5IP7J 1JUSA
chains in the Genus database with same CATH superfamily
2ZJRF 4I76A 1Z1DA 4KMFA 3PQJA 2QLZA 2EJRA 3SFIA 4DYQA 1P7JA 2FU4A 4A5MA 5ILVA 2JK3A 3IWFA 2V1NA 2AHQA 2EV5A 1IJWC 2GA1A 5LRRA 1H8AC 1J7KA 3KP3A 1J59A 2ZMEA 3K1NA 1Z3YA 4U88A 4MQ9F 2CV2A 4NQWA 3I54A 2Z99A 4ESBA 1GVJA 1LE8A 4L9NA 2HZTA 1A6IA 4LLNA 3J81K 5DCFA 1XD7A 2BW3A 4LB6B 2WC2A 3A4CA 2MW8A 2CV1A 2K27A 2Y69H 2OPTA 5C44J 3MD2A 3RI4A 3GWZA 3CDHA 4XSXF 1FBQA 1WHUA 2M9HA 1DU6A 3AL0C 5IOZA 1ITYA 3H9GA 3P9KA 2Z1DA 2C6YA 3BTCA 2V1XA 4N0BA 3S15J 2M0MA 4KJZA 3HL2A 2GWRA 1F4KA 5IP6A 2JVGA 2F5FA 1ZR2A 3DBRB 3ML6A 1XGNA 1ETYA 1P9QC 4N9IA 3RPQA 5M3FJ 4XLNF 3K4MA 2XSDC 5CQGA 1T0FA 1RUNA 4KIFA 2ECBA 5L3FA 2FMLA 1NK2P 2X1DA 3MZ8A 3TEDA 4BGDA 3ZQQA 2X1CA 2JSCA 1G59A 4NNJA 2DMPA 4E7KA 1O7FA 4EJWA 3CUOA 1U78A 3EDPA 3ZMTA 2CFXA 2TRTA 1D3YA 4DQ2A 1LB2A 5CJ9A 4CH7A 3KX2A 1MKMA 1ON1A 3WU2C 3W6VA 4M72A 1IRFA 3BDDA 3LSGA 4PCQA 3ZGKA 1X2MA 1Z7LA 2IS1A 4FX0A 3HM5A 4CYCA 3DCFA 2E2HJ 3FXKA 5BS6A 3GF2A 3CCQI 3PQKA 1MBKA 4HBLA 3ZN0A 2O3FA 1A31A 3WTVC 3R0JA 4A3JJ 2IS2A 2NVUB 3PL8A 4ABZA 4DJAA 5CVJA 2A3SA 1U2WA 1X1PA 1LEAA 2VC0A 2O61A 1EH7A 1DUXC 4DOZA 4R8HA 5JFRA 3K1PA 2K9SA 2LG4A 1YS7A 2M3AA 3J7YJ 4U0WA 4ZJZA 2XROA 1K4SA 3RZDJ 1IF1A 2DA2A 3IL2A 2FQ3A 3BZKA 4B09A 1DP3A 3OYIA 4CA0A 3JRHA 2LC2A 2VKEA 5JLWA 2RVCA 1TW3A 2B7EA 1XN7A 2H6BA 1HBXG 2JA7J 2Q0OA 1W0UA 4BEHB 2WB1N 4HF1A 3FM3A 1CQTA 1QO0D 1Z77A 3E0JB 1EKEA 4YELA 1OFCX 2P5VA 2E7XA 3EUHA 2XDVA 5B5EC 1R1TA 1R4MB 1V5EA 1TP4A 5HDKA 3GLXA 3BG3A 1X1DA 2QA4I 4D0PA 5K5OA 2HQ5A 2R7UA 2PX9A 1HCRA 2NVXJ 2L9SA 2EZKA 2VUMJ 3TP0A 4CICA 2GQQA 2LOOA 3V7CA 3VYSB 1PP7U 1FTTA 4EJVA 2FX0A 4WK8F 3F23A 1TC3C 2DA1A 3FXUA 1FLIA 1XCVA 2EQRA 2P6TA 3ABTA 2E36A 1FOXA 1ZYRF 1K79A 4M74A 4XKCA 1F9NA 4DIQA 2CH0A 2DFIA 4P1WA 4Y3OA 2Y9YA 5LEKA 3RKYA 1NTCA 4HLYA 1F36A 2DW4A 2NXNB 2Y0SN 1FOKA 3GTMJ 3OYKA 2D45A 1IXSB 2BVMA 1KU9A 4FT8A 4FX4A 2V1DA 3H35A 3HKZN 2KRFA 3JSPA 1XGOA 4C2UA 3K4LA 1TBXA 3JCUC 1EF4A 2BV6A 1J75A 3HRTA 1BR4A 3E1SA 4AYBA 2Z33A 1GHCA 2RC4A 3PSIA 2W48A 1IW7F 2VXDA 2PJRB 1MW7A 2MBFA 2FNAA 2A5YB 2H94A 1TWHJ 1WJEA 1JT6A 4B1RA 1O4XA 5FRMA 2L01A 2Y48A 4LK1F 1ETKA 2DXIA 2R5ZB 4HZFA 4UVAA 1CGPA 1TNTA 1W7PD 2XVCA 5CPRB 2QQ9A 3F8NA 4YEJA 3IH2A 4HX8A 1MBFA 4HDVA 3DEWA 2BY1A 1BI2A 1S7EA 1XMXA 2EZHA 2HDCA 5KNLA 3TO7A 3C2HA 3KP6A 1S8NA 4HV6A 4PFOA 3BTIA 1MJAA 3TW6A 5IYDJ 3IWZA 3RKXA 3PIOF 3KLNA 3DKWA 4NHJA 1S7AA 3BTLA 3PM1A 1PUEE 1ODDA 3M4OJ 1SC7A 1X1AA 1SVOA 3HOVJ 4IF4A 4OWRB 3FXOA 1RR8C 1RC9A 3S16J 1IV8A 1MBGA 3P5JA 3WG7H 3C2GA 3S3NA 6PAXA 1QGPA 1Y0NA 1VFCA 2WA0A 1ZQ3P 4OIQF 2RNGA 5HLHA 5EJCA 3OYJA 2FEZA 3QP5A 2K9LA 2F5EA 3SQNA 2IJLA 3FXLA 1XSXA 4CYDA 3FBNB 3IV5A 1V5GA 3IHUA 2CO5A 2CUEA 2W4SA 5ICFA 3T1BA 5EZHA 2BOLA 2UXNA 2R7TA 4I09A 4YIFA 3VODA 4M3EA 4F93B 1T0FC 4B3AA 3KP4A 2V6CA 2WAFA 1SFUA 1MIJA 1SD6A 1Z9CA 3OOUA 1YTYA 4LK0F 1BW5A 4M6XA 4IO9F 1F43A 2RQPA 4XOPA 2HPIA 3R61A 3CC7I 2PEXA 4IVNA 2X51A 2FBHA 1PDNC 2IS6A 1YLFA 4H4KC 2L7MP 2HXIA 1P4WA 3RIRA 2VC1A 4YFKF 2GBYA 4KN4X 3F22A 3OIOA 1MD0A 4G12A 4DYRA 3COAC 3MKLA 1IN5A 4BEHA 2CWEA 4XLCA 2EK5A 2XPUA 5B3SH 3CCJI 3QPLA 2W25A 1Z05A 2VPLA 2V9VA 1Z91A 2E5NA 2Z3YA 3GVAA 3X2QH 5LHHA 3A0HC 1W36C 2QQ8A 3G4SI 1RKTA 3ELKA 2DU9A 5LEJA 4ZYDA 2VPRA 1Q1HA 5L3GA 2NS0A 4G7OF 2EA4A 2FMYA 2G7UA 1U9NA 3OOPA 4L9TA 1YE9A 2W1OA 2ZNZA 2RN7A 3VOEA 1ZARA 2DT7B 2KZVA 3ABMH 1WH7A 4XKWA 1YW7A 4XKBA 3K70D 1N78A 2GA2A 2LMDA 3GUDA 1TWAJ 2GOMA 4KYWA 4C3JJ 3O2PE 5F1JA 3ZR8X 4G6QA 3FK6A 2XGEA 2HYFA 3MKYB 1AU7A 4MEYF 3A02A 3JRDA 3GFJA 1YIOA 1GLNA 3G1MA 5J47A 2JPBA 1FSHA 1KQ8A 2V9PA 4DW6A 1I1SA 2VKDA 4RB2C 5DM6F 4HPQA 3WTTC 3KZYA 5D4SA 3BJAA 3PSFA 4QSHA 3OY9A 4IX7A 2PQ8A 4IHYA 4IKFA 3BROA 2EILH 4LD5A 2XF7A 1DDNA 2XB5A 1U3EM 2R7XA 4Z6YA 1XPXA 2LTPA 2QSHX 2G7HA 4L9VA 3WTSC 2PJRA 3W6KB 4RBOA 3S2WA 2A6HF 5BPDA 2DYSH 1UCRA 4IJAA 5E3OA 4B44A 3HC7A 4EVIA 3GTJJ 2R3SA 4BY1J 3M07A 4A3DJ 1QA6A 3HZJA 1B59A 2R5ZA 2HVQA 3U1DA 4D9JA 3SJMA 2L54A 1E3HA 3ABKH 3GBGA 4X0GA 2Z2SB 2DQLA 4W97A 3U1KA 1MH4A 2FBKA 2A61A 3HOZJ 5LLQA 1M1EB 2QENA 2IA1A 4HAMA 3GFIA 4ZYAA 4BDYA 4I99C 2LBFB 5BPIA 3CJRB 3OIQA 4RAZA 1KGSA 3N05A 2NNYA 2Q2EB 2CQNA 2JA2A 2OBPA 2ID6A 4V2GA 2O7OA 2HGCA 3C2BA 3QU6A 2LF7A 3I71A 3F8MA 2XAGA 1QBJA 2NOGA 2A6TA 4AU7A 2Y31A 3BOQA 5JHUA 2FNPA 3Q3SA 3CCMI 4IQJA 4XOTA 3L00A 1JTXA 4AIDA 1ETOA 3CUQB 4RM2A 1X3WB 1JKRC 4O3MA 3RKQA 1WJBA 2DMQA 1WPKA 1FZPB 1SFXA 1ENHA 4OIOF 1RIOH 2AQEA 4C3HJ 4XONA 3JR9A 1VQLI 3A01B 2HTSA 3ASOH 5DD4A 2YX4A 2XPWA 1R9TJ 2CW8A 2XKOA 1HW2A 4RB0A 4V19K 1R58A 1UG2A 3M3YJ 2EFNA 2CJJA 2HYJA 4OINF 1IG7A 5J3LA 5FO5A 3F3XA 5M5WJ 2XGXA 2DPUA 4B48A 2M4GA 4N4NB 3J80Z 1MNEA 4UV9A 5LHGA 1NK3P 1I1GA 2YS9A 5IT9K 2EZIA 2STTA 3KP7A 3UNGC 2KLOA 2DK5A 4BE1A 2PLYA 3FK7A 4KDPA 3O3KA 1HOMA 1WI3A 2ZFUA 1R5HA 1LDKB 2DOFA 2FE3A 2DYRH 1JJ6C 2HQNA 3GFMA 4LMYA 2ZMEB 1VQ6I 2CG4A 2L4MA 3L09A 2IGOA 3G1OA 2R7VA 3DBHB 3S17J 2DJIA 1ZRDA 2KDOA 2X0LA 5GP9A 2DOEA 4BHBA 4A69C 3CCUI 1VNDA 3WHBA 2VBZA 2I8DA 2MH9A 1IZ1A 2OJED 3DPUA 1LDDA 2LSOA 2HXOA 2RAEA 2JA8J 2HOAA 2NOJB 3OYDA 3GMEA 4UVBA 1YX5A 3NWSA 1HXDA 2CW7A 2N8GA 4HSRA 1ETQA 2LKPA 4F52A 3E5QA 2AO9A 4F55A 1VI0A 1OISA 1W36D 3ABLH 3HOTA 4BQQA 5FRNA 5L3BA 1OR7C 4NC6A 2M8GX 3HKZA 3RZOJ 4AYBN 5B66C 4KITB 2P7VB 4HX4A 2E71A 3BTJA 1UZCA 2BXYA 3ZOBA 1FP2A 2OQGA 3IH3A 4CZZA 3OYLA 1PP8F 3WTXC 5A2QZ 4M3GA 2R7WA 4AWXB 4RA2A 5E8IA 4BU2A 3QPHA 1MH3A 2DA3A 4LJZF 1KU3A 5HDGA 1LUJB 4UY8I 1X3ZB 3GZNB 4MNUA 4UV8A 2DA7A 4DBRA 1MZBA 4UNOA 4JQFA 3ULQB 5CQEA 3ZCOA 4CYCB 2ESNA 5HLGA 4B3XA 2R7FA 4E7HA 1WGXA 2CQ7A 1O3SA 3ESWB 1FYKA 4A3EJ 4BBRJ 2CFOA 3E5UA 4M71A 5J8CA 1MJBA 3LSIA 4QIWN 1FMVA 3W3CA 5M5XJ 1ZN2A 2XAUA 1UG0A 1ZREA 3OSFA 2RGVA 2FXAA 2HQRA 1T2KA 3K2ZA 4NDLA 3WU1B 2A05A 2DLLA 1ZAOA 4JK1X 1V54H 4FCYA 2DTRA 2IA0A 4E4HA 1PJRA 1Z67A 5JR3A 2Q2EA 1H0MA 1USSA 2Y0MA 1ZLJA 2BY3A 4ZDLA 2A69F 2VXZA 4D7MA 4R79A 4C30A 3ZMZA 4XLAA 3KZZA 1KYZA 3SZTA 2E34A 1TL8A 2O8KA 4I2OA 2GZWA 5GAHJ 3CUQA 2R0QC 2F4IA 2M0CA 2DA5A 4CSWA 1OJLA 2CRGA 1HF0A 2BBYA 5F0FA 2XGDA 1OYYA 3KEYA 3MAJA 3MKWB 4HEA2 4I01A 4C2MJ 3GYHX 5JLXA 4ZH4F 3CJQB 2VN2A 3A01A 2ID3A 3RJPA 3I64A 1P7IA 2IA2A 2RKHA 3FKIJ 3H1CA 2LDUA 4U87A 4XMYA 3LSPA 2G9WA 3D5SC 5KK1A 2ZC2A 4EV0A 1I3QJ 2STWA 2GM4A 2MABA 3WGGA 3EPZA 1D0ZA 2Y2ZA 1E3PA 2EZLA 1YS6A 2H1LA 2IGMA 4XLHA 3QU3A 2PG4A 4A3FJ 2K86A 4AC0A 2EA2A 1QVTA 3BT9A 1XC5A 3ZQIA 2A6EF 4RDUA 3J80K 1FOYA 2RQQA 1WH5A 1GXPA 4OIPF 1ACIA 2L0KA 3LOCA 2ELKA 2HI3A 3VPRA 2FOWA 5L3CA 5EEHA 2E35A 2FQ4A 3O6BB 4RGSA 4G8XA 3ZMUA 4IHTA 3B02A 3S8PA 3DLLF 1SD4A 3DKYA 1HQCA 1UJ8A 2ME0A 1TWFJ 2DFEA 2CS3A 3HSEA 3HGGA 5FLMJ 3BG9A 4MHGA 2P7CB 1STZA 3E3VA 1H9GA 1HKTA 2FUG2 4HOBA 4AVPA 2EPFA 3TW7A 4GO1A 2F5DA 4CCMA 2XASA 3VSKA 1FOWA 2VOPA 2EWNA 3SDGA 2EB7A 2BGCA 2BZTA 3GZ5A 4L9JA 5DDGA 1FYMA 1BOBA 1OPCA 1T6SA 3FMSA 2Q8KA 2XV4S 3IKVA 2EBIA 3K4KA 3EUKL 4A0YA 3OYNA 1PUFB 4IOAF 3S3OA 1P92A 3O8HA 4PSXA 2CUJA 3REOA 3V7SA 2GXGA 3BLYA 1QPIA 1Z6TA 1VZ0A 4XLFA 1BC8C 4J19A 5KAIC 3JTHA 4Q48A 4XM3A 2VE9A 4JOMA 4HNVA 3K1MA 2QZ8A 5F04A 2Z9OA 2HWVA 2E1NA 2KKOA 4KMUX 1BR1A 3MEXA 5LHIA 2J5OA 1D1CA 1S7OA 5FKMA 2DFFA 5EEGA 2HOSA 4YIRX 4JX4A 1ZGJA 4HV5A 5M3MJ 1WJDA 1YITI 4ESJA 3ABUA 4NC8A 4YIIA 2PJPA 1JHFA 3M8JA 3GTGJ 3GEZA 2ZO4A 2HS5A 3I53A 3GW2A 2QM3A 4KN7X 3WTZA 2M4KA 4IPAA 3IP4B 2E5ZA 3KETA 3LL7A 1MMGA 2EV6A 2KIUA 1MBEA 1QVUA 2D2WA 4XICA 3KZIC 3SZGA 2R93J 1LDJA 2OCCH 5EG0B 1KU2A 3BC8A 2HKOA 2JA6J 3A2KA 4BNCA 3W2AA 2QF7A 2D5VA 2KIFA 1RUOA 3MQ0A 3G2BA 2XHKA 1X2NA 2K40A 5DUKA 3OYEA 1WJFA 2LR8A 2JWTA 2KQRA 1XCBA 1ZTRA 1UFMA 1JUMA 4OU0A 1VQPI 2CSOA 2H09A 2K9QA 2HR3A 4DBQA 3LA2A 2UV1A 2YUSA 5IT3A 3BR5A 2HDWA 2P5LC 3GCMA 4IZZA 3VB2A 2H27A 3SXYA 3LSKA 4IEJA 2HOEA 4Y17A 4OOIA 3DBLB 4GYGA 4BH9A 2ELHA 3K4JA 4A0ZA 3RSNA 4XN3A 4P5OA 3OYFA 2HOTA 2MD5A 1ON2A 5JVGF 4PJ0C 4MQVA 2IGNA 2M2EA 3RTRA 4CUGA 4KFCA 4KA4A 3L7WA 2KPMA 1UHWA 1F1ZA 1UHSA 4KIBA 1I6HJ 2VI6A 3HOWJ 4S05A 3I59B 4M3FA 3IAS2 4A93J 1BIBA 4RAYA 5EZGA 4LLGF 3HXLA 1J0RA 5CVIA 4I6ZA 5DCMB 4D5CA 3P7NA 2VJ5A 2Y30A 4PJLA 1EV7A 4Q47A 5ERIA 4A3GJ 3VFZA 3Q0VA 4CZCA 1KONA 2NYXA 2NAZA 4PDKA 1G6NA 5IYBJ 2CQXA 3JRBA 3NRVA 1IUYA 3JTGA 3C7JA 3WE2A 1JJ8C 1B4AA 1YG2A 2CGPA 2BEOA 4U0YA 3FMQA 1U8RA 2VJ4A 2ZFWA 4I7HA 1SVLA 3DXJF 1RESA 5D6EA 2LREA 3B73A 4Y33A 1HSJA 3C18A 4FETA 2R7RA 4S04A 1V5FA 2DA4A 3LWFA 2DMUA 2IS4A 4G94A 3ECOA 4RGUA 1JKPC 3CC4I 5GTHC 3F0CA 4OAZA 2QBYB 2FJ1A 3CUQC 1L3LA 2X6OA 2QVOA 3OYGA 4IRIA 4XORA 2JT1A 3IAM2 1YIJI 3QAHA 1T39A 2MYSA 4GYIA 2DA6A 4XN0A 5GTIC 1OLTA 3AG4H 2GXAA 2HEOA 3GTPJ 1A6QA 3VSLA 4E7IA 1X58A 4Q4ZF 2EIMH 3H5AA 4IRGA 3ZN1A 1PUFA 2MSYA 2ICWG 1XG1A 1HLVA 5FJ8J 2W84A 1K6YA 3VDXA 3HPGA 2L7FP 2VOOA 3HUGB 1V55H 2EINH 5J4VA 2W85A 1KYWA 1SANA 3SEQA 2K7LA 1X1CA 4RS8A 2UUZA 5IOYA 2GXBA 3OYCA 3WGIA 2L9NA 1KQ9A 4MO7A 3I5UA 4IHSA 3PFYA 2ISZA 2ZMEC 2DMTA 3RDIA 4Y15A 4QTRA 2XRLA 3JRCA 3TP3A 2LVSA 4A3KJ 1MDMB 4OMZA 1E3OC 3CF5F 3HPHA 3DTKA 5HVQC 2DI3A 3BQYA 1APLC 2DO7A 3CMEI 4J01A 2M8EA 4MEXF 3CDIA 2VASA 3K6GA 3TO6A 1N75A 3RPUD 2VT2A 3FWEA 3HBLA 1B6AA 4QPQA 1MBHA 3QYFA 1IRXA 1R4NB 4EQQA 3NEUA 2IEKA 2YU3A 2GIZA 4AIHA 3PIPF 5FD5A 2QKMB 5EG0A 1GVDA 1QPMA 4XIDA 3T8TA 2AQFA 2WV1A 3FIWA 3HGYA 1FNNA 3ASNH 5FD6A 1NH3A 9ANTA 1TTYA 3PUBA 1QRYA 1R1UA 3J7AO 4HDUA 4RAFA 2KJBA 4BXXJ 4BJTA 3MN2A 4FASD 2P81A 4QLCU 4BQOA 4XNFA 1SFOJ 1Y8QB 2VL8A 2LP0A 1QZYA 3E6MA 4E7JA 1VTNC 2ADUA 3CC2I 3GZ6A 5FLVA 4BS9A 2P5KA 1FP1D 3F8CA 4BE0A 4D1QA 1G3TA 3UKGA 2VLAA 3E6CC 1E0EA 3DU6A 3S2DJ 1W7PB 2A5WA 3FXQA 4C2TA 1A04A 4HW0A 3ZQGA 2EV0A 3H0DA 1WQ2A 3CDLA 4CXFA 3DEEA 1K78B 3AL0B 5F0CA 2JRTA 2W24A 5F27A 3EETA 1S5LC 3GX4X 1G3YA 5EGOB 3DLAA 3SFZA 1WKMA 3RQ4A 1YHQI 3I4NJ 1QZZA 3PNTA 1WJ5A 2R4GA 1SFKA 1L0OC 3D0SA 2MLGA 3DTEA 1C0WA 2O6GE 3I59A 4R1HA 4HYEA 2KT0A 3DFGA 4N4OB 2QSGX 1RR7A 3D5RC 3G73A 1YFHA 3CZ6A 3NAUA 5LGUA 2L7KA 1ONVA 2P0WA 1JUSA 4RAGA 3LSHA 3OS0A 5DCMA 3KFWX 4F92B 2F5VA 4L5EA 3I58A 2E1OA 1MNDA 1LFUP 4ETSA 1QQIA 2FF4A 1RI7A 5B1AH 3DWLE 5CYVA 1ZGAA 1FX7A 2JPCA 2XAJA 1UB9A 3PNVA 1LFBA 3UR3C 4KICA 3ZQFA 3LAPA 2VODA 1EA3A 5KAFC 5TISC 5IYCJ 2YPRA 1R49A 1WFXA 3BG7A 4WXCA 1DGWY 4CCLA 5EF6A 1NG6A 3DQVC 1JI8A 3K69A 5F64A 5K7FA 2VE8A 3SHFA 2QBYA 3OWTA 1BI3A 1ZK8A 5C4JJ 2NVTJ 3SYTA 5J40A 2ZXJA 1QU3A 1ZLKA 4KISA 2HDDA 1MMNA 4EGZA 1ZKGA 3IUOA 1DQUA 1BR2A 5J1RA 2XRNA 4A12A 2VBWA 5E17F 2DCEA 2KL4A 2V79A 4OAYA 3EUHC 2AS5F 1RZ4A 3S1QJ 4XRSG 3QPTA 1I5ZA 2IT0A 3K0LA 2JA5J 3ISPA 3Q9VA 3V7RA 3DV8A 2W7NA 2NS8A 2OA4A 3E6DA 5TJJA 1XS9A 1U5TA 1PYVA 3KPHA 1KZHA 3MKZA 4CGZA 3V8KA 2E19A 4XQFA 3WE3A 3M8FA 4XK4A 3WHCA 4Y7NJ 5F6FA 5D4RA 3HUGA 3ERED 5LD2C 4KNYA 2JSPA 3K7AJ 3E6BA 5E3NA 1SFEA 2GOXB 2V26A 2VT3A 1RNLA 1HW5A 4MIMA 4GDFA 3IKTA 3OS2A 2CUFA 2WWYA 5K5QA 3KP2A 4FISA 1XGSA 4LG0A 4HA8A 3R6SA 1MDMA 5ED4A 3T8RA 1YQAA 3JRAA 1ZRCA 3FXMA 4HX7A 4A6DA 2W00A 3RKWA 1A36A 2IVMA 1AHDP 3P9IA 1XB4A 3FXRA 3R0AA 2MG4A 3N4MA 5E1WA 4A0XA 2H6CA 3RYPA 4ZYHA 2HVRA 3GXOA 2DODA 3F6OA 3U2RA 4DNCA 3C1DA 2M5WA 1XMAA 1IN6A 4LLLA 4DZPA 1JTYA 2ETHA 1X4OA 5HODA 4PUSA 1BW6A 4N9HA 5FKKA 3JRIA 4GFBA 2L7ZA 2ZSHB 1FIAA 3AG2H 2MD0A 5DS9A 1RETA 3AG1H 1TW2A 1MMSA 4EM2A 2OTJI 2Y75A 3Q9SA 2VQHA 1JUPA 3H9JA 1G4DA 2DQRA 1JT0A 4NBQA 2OTLI 5GPCA 3OL3A 1W7PA 2O5RA 2QYOA 4ZZDA 1A5JA 1K78A 4A3CJ 1F5TA 4V2FA 2EFWA 1EH8A 5E3LA 1Y8RB 5CLSA 1YYVA 5EGOA 5FKOA 2KHMA 1JKQC 3QWLA 3LMMA 2WAQA 1V4RA 3KP5A 4LG3A 2K02A 4PGHA 1BC7C 1R1VA 3MZHA 3CCSI 2VBXA 3H0GJ 4Y13A 3LSRA 3NARA 2DMNA 4PZJA 3W2WA 4L0ZB 3EQLF 2ACJA 2CMPA 4A2UA 2ZXIA 3DKXA 4ZDOA 2UXXA 1FEXA 4ZDPA 2X9DA 5E18F 2VKVA 3HTUA 1Z7UA 3NWTA 4LIVA 2B63J 2XB0X 3RQIA 3ZRGA 3TQNA 4UHTA 2NNNA 4E70A 1FPQA 3GTQJ 1X19A 5F0HA 1B9MA 5H6RA 3J81Z 2JQ7A 2J5PA 3CO6C 1D5VA 5D5VB 2ISYA 2KRCA 3F6VA 2RDPA 3K9TA 3TDUC 4ENNA 3T0YA 5FGMA 4RB1A 2YR2A 1WI9A 1USTA 2QSFX 2LNBA 4CCOA 5FLXZ 4WCGA 2HQAA 2VIXA 4C3IJ 2IRFG 2QGUA 4IL6C 1D8JA 2HFHA 1VQKI 2BE5F 3G1LA 2O8XA 4HG2A 5BNGA 4Z2YA 1FBUA 2VJIA 3HHHA 1LFPA 4FE4A 5ILSA 2Y9ZA 3Q0WA 4LIUA 3L1PA 1CF7B 2HTJA 4XBFA 1D1BA 2BYVE 5HNHA 1OYIA 3FHZA 1IXRC 3FHNA 3S14J 1VQNI 3GFLA 2OUMA 2R7SA 3I0TA 1R00A 2OZ6A 3LQQA 4BQAA 2R7QA 2ZJPF 2EIJH 5GADJ 2OC6A 2E1MB 3PFIA 4ZTJA 4HNUA 2LKSA 1WRJA 3NQOA 4XR6A 3FX3A 5C4XJ 3S32A 4MFEA 1YW9A 1V3FA 1OCOH 5F08A 3IRRA 2Z5UA 1W0TA 2PBIA 2QUFA 2VQCA 3OSGA 2HU9A 4L5IA 2LD5A 1IGNA 3BPVA 3DF8A 4D7NA 1R71A 2FRHA 1MSFC 1BI1A 5J1UA 1BJAA 1WSUA 4AVZA 3S1RJ 2HZDA 2X6WA 1T08B 2VB6A 4U7BA 1SD5A 1W1WE 3IRQA 2E60A 1LEBA 3LSTA 3WG9A 3HDDA 3BJ6A 4EMSA 3QRFF 4BYYA 2XAQA 3SZPA 2ZBKA 1YI2I 1EH6A 4XLPF 3GLLA 4XRFA 3BP8A 3HSRA 2QWWA 2ZJQF 5ICGA 5ICEA 3IH4A 1U9OA 3F8FA 1FIPA 1OKRA 3H3UA 1XSVA 1UELB 4UXNA 4G6TB 3AAFA 5KHDA 1R5GA 4HSTA 2QQAA 1UHMA 1S3JA 1D8KA 3ZMSA 1D0YA 1HSTA 5D8LB 4I98B 3Q0UA 4UUTA 2IW5A 1TZLA 1ETXA 5E8GA 5AIPA 3GO5A 3CTAA 2KP6A 3TO9A 1MGTA 3H9QA 4JX6A 4XL9A 1NG7A 3N97A 2GLOA 2R92J 2KISA 3TL4X 2LY2A 3F9KA 4LOCA 5LFAA 4U7DA 2MLKA 1DPRA 2H1KA 4YRVA 3CCEI 4HF0A 4G7HF 3HRMA 2X6XA 3VYRB 3HRSA 3DPLC 2BXZA 4FE7A 4XKVA 4OIRF 3E7LA 3PO2J 4DZJA 1GV5A 2L9RA 4ESFA 4F7ZA 3MWMA 1Z21A 3B6CA 5ICCA 2RNJA 3DPTA 5LGTA 2I10A 3ZQ7A 1FTZA 2COBA 4KIGA 1T95A 4KUMA 4BHPA 4ON0A 3Q5FA 3EYYA 1LVAA 1IDYA 1MMAA 4RB3C 2KZGA 3ZMVA 4B47A 2M45A 2LF8A 3HRUA 3I4MJ 3BR3A 5HS8A 3RYRA 1HDDC 1PVEA 3C3WA 5K7HA 3JRGA 2KDZA 4L5JA 2VONA 1J5YA 5BOXA 1AOYA 2EIKH 1WZ2A 3M1CA 5ILUA 3OIPA 3BR2A 3OR1C 4I02A 4AIKA 1T98A 3VYUB 2IP2A 1X4PA 4DGWB 4P96A 4ENKA 1I3AA 3V8JA 4G9YA 4KT5C 1BBYA 1P4AA 1YJNI 4S0HB 3BG5A 5KVRA 2HYGD 4LGWA 3W6JB 4E7SA 1VQ8I 1MBJA 4BQNA 3E5XA 2JTVA 3E97A 2DT5A 5FLXK 2LY9A 1SAUA 3D1NI 3HJEA 1WWXA 5A2QK 2V6EA 1B8IA 3ZQLA 2P4WA 3WTUC 3MFKA 1O3QA 1MSEC 2FOKA 2OV7A 4BAYA 4RLQA 4UVCA 1XGMA 1CF7A 2G0EA 3G3ZA 4IXAA 1IC8A 2BHYA 3WTWC 4AUXA 2R5YB 1S72I 2XF5A 4XLEA 2ZNYA 3FDYA 4M9XA 1DGRM 5DD8A 1Y1WJ 2X48A 2K4JA 4MFDA 1VQMI 3ECHA 3H3ZA 2F2EA 3KLOA 1AKHB 2M87A 5FROA 3VWBA 5DEQA 1LKXA 1QHHD 1O7LA 3S3MA 2LH9A 3FXJA 3AFHA 3K2AA 5L3DA 3CO7C 1H9TA 2CU7A 1G3WA 3BR6A 1JGGA 1B72B 1K61A 1W5SA 5DUIA 3ZQCA 1VQOI 1D1AA 3B6AA 3D5LA 4RMNA 3TKYA 2XAHA 5D5UB 3OR2C 2PMUA 1ZR4A 4J00A 2X6YA 4C9YA 4ZTFA 1W5TA 5D8KB 3BPXA 4BJ5C 2ECCA 2XSJC 1QNTA 3DTIA 2R7DA 3M9AA 4II2A 4MGRA 2DAOA 2IAIA 2K4BA 3LAJA 2L4AA 3CESA 1HKSA 1TT0A 2KIQA 1TLHB 3CJNA 5HS7A 4B8XA 1ZG5A 4BL0B 4GXOA 3LSMA 3LSJA 2AXLA 1SAXA 2DK8A 2W57A 4CHUA 1VQ9I 1ETWA 2DFHA 4O6JA 1JE8A 1IAWA 1TQPA 3G6EI 2F48A 2WAQN 1B1BA 1XTAA 2DN0A 3BZ6A 4BY7J 5FKLA 3V8LA 1U8BA 1ZHFA 2XUBA 4RLFA 2F4MB 4WXHA 4Y4RA 4L0YB 5IP7J 3K70C 4QWQA 3EUAA 5IP9J 2YU9J 2XIGA 2VBYA 1DU0A 1R23A 4EJUA 5BQTA 4MTDA 4P9FA 1W4MA 1FWZA 1G3SA 3KEOA 2L5QA 5H20A 4HLXA 3U9GA 2P8TA 2ZJ2A 5HLIA 2HPMA 3FM5A 3SEZA 3O8GA 4JP0A 2JRMA 3BQZA 2ZB9A 2JJ7A 2NVYJ 2VQGA 1WJAA 3ERMA 3QOEA 3HHGA 3ROUA 2NVQJ 2RV8A 3HIFA 2LK2A 4YFNF 2B0LA 2JZYA 3CLOA 3ZQHA 2KMUA 1ZELA 3JAMZ 1P2FA 1B9NA 3AG3H 3OV8A 1ZG3A 4WX9A 4PJMA 3CCRI 2M1BA 3S2HJ 1U6GA 1XDSA 2RREA 3HOSA 3M8EA 3BCBA 4ZC3A 1HW1A 1U5TB 3S1NJ 2EFOA 3OYAA 3TDZC 4IHXA 3J7AY 5F1RA 2F5CA 4ITVA 5J6XA 2XKPA 1OMIA 4W1UA 5H6QA 5E79C 2PMHA 2CQKA 4EM0B 3J7ZI 5EDNA 1G8XA 3TGNA 3U21A 4EGYA 3CCVI 3F8BA 4M73A 1J2XA 3HOXJ 2EFPA 5CKTA 5J8FA 2O9LA 4LG0B 2CQQA 5H2FC 3MZYA 3TOBA 4II3A 2A07F 1DPUA 4A3MJ 2K85A 2ZCWA 2O0YA 4ASNA 1IRGA 4WXDA 5K7ZA 3W2VA 1Y0UA 2OCEA 2R5YA 2M34A 2IBDA 2TCTA 2MH2A 4A3LJ 1BIAA 1IUFA 2BY0A 2XPVA 3OYHA 1J9IA 1TWCJ 5AIQA 3KYDB 1HC8A 1T8IA 3L2WA 1R36A 1AKHA 4FHTA 4IHWA 1FSEA 2MFZA 3AKZA 2W82A 2LYCA 5AONA 1WVRA 2L02A 3CMMA 2X4HA 1AWCA 2JVHA 2F4OB 5GAGJ 5J4YA 1B72A 2YSRA 2CV0A 3MMYB 4M6YA 1QZEA 1VF9A 3VEPA 1E2XA 4M9SA 3PO3J 1NHAA 4M3BA 5BMZA 3LA7A 5M5YJ 1FYLA 1IXCA 2KJCA 3BWGA 3V42A 3GTLJ 2OD5A 1XMKA 3ZXSA 2E2IJ 5DYMA 2QEXI 5D5XB 1R6RA 1ERDA 3QODA 2XC7A 1J09A 3MVPA 3BG6A 4O5VA 2WADA 4U0VA 4HNTA 3M7GA 4G7ZF 3QYBA 3ONQA 3WGHA 1RRJA 2ME6A 3HTSB 1E17A 2LKXA 1Y6IA 4IHVA 4GRIA 2QQBA 1OR7A 4HF2A 5HOOA 5HS9A 1FMWA 4HQMA 5IT9Z 5FFZA 5CVRA 5TGTA 5JI6A 2DBBA 5E1XA 5LBQA 1D0XA 2E1MC 2ZSIB 5IY5H 2PMZA 2FD5A 4RGRA 1ZG1A 3HOYJ 4BHCA 1G2HA 1DP7P 1I6XA 3F21A 2VKHA 1S29A 5D5WB 2XF6A 1GV2A 1OCPA 3I9V2 3LQRA 5LGNA 3L2QA 2M30A 4PK4A 1BN5A 1O3RA 1AA7A 3PUFA 3OL4A 2PI0A 5KCMA 4ZYGA 2K3FA 1H89C 2DJNA 5D6FA 1ORKA 3TOAA 1YJWI 4I0BA 3HOUJ 4BBSJ 1P4XA 2B9SA 4BJ6C 1HA8A 4CCJA 2DPDA 2E1CA 2JUGA 4BXUA 2IGKA 1S6LA 3DU5A 5E1ZB 5K1YA 3QYEA 3DP7A 4IRHA 2A68F 3A0BC 3OYBA 2K3PA 5FB2A 2DDBA 1JGSA 1OCTC 4UUVA 3P9CA 1D5YA 3CJTB 1Z0XA 3QPSA 3QP6A 3JAMK 2FA5A 2IPQX 2QCOA 4YG2F 2LRDA 5K5RA 3CP2A 4UUSB 1XX5A 3MCZA 3CMAI 1UAAA 5FFXA 4FQGA 1SD7A 4JYKA 1GXQA 5CVUA 2JMWA 4PFPA 1YRNB 1FBSA 2V9KA 3SDBA 2XGCA 3A03A 3KCCA 3H92A 1VQ4I 3JW4A 1A35A 1WJCA 1LQ1A 2MGQA 4NC7A 3CF2A 4MTEA 1FC3A 1X1BA 3BJOA 2JN6A 5LRSA 2OAZA 1ETVA 2H8RA 2L3DA 3L2UA 2BY2A 1T38A 1SVMA 4D5FA 3K4BA 3M1EA 1P6RA 1BI0A 3HSFA 1RPWA 2WV0A 4EATA 4K2EA 1XSDA 1IN7A 5EEAA 1K7AA 3K4CA 2DDAA 5DM7F 1TT5B 4PJNA 1BJZA 1FT9A 1T56A 1Y56A 1BL0A 3FKJA 4GGGA 2R7OA 1I39A 2LFBA 3LNQA 4HQEA 4MLOA 1IV6A 3CCYA 4BACA 1JHHA 5JHFA 1YJ9I 1VQ7I 1ZH5A 5L3EA 2DT6A 1IN8A 4A6EA 4H0EA 4AD9A 2GAUA 5CVVA 1MJ9A 1JXSA 3FISA 3KYLA 4B4CA 2KRHA 2M7AA 3DEUA 1MNMC 3H5NA 4JBAA 4CO8A 3OYMA 4BDZA 3F72A 2BHZA 4LITA 1RKWA 2E2JJ 3R4KA 3T5XA 3JSOA 2GIVA 3VYTB 1YO5C 2UWMA 1TNSA 4E7ZA 2K5CA 1KU7A 2KFDA 3KE2A 5DTDA 4X1EA 3ZP5A 2F6CA 5HNFA 1XDUA 2V1UA 2MC3A 1ZRFA 2I5UA 2ZXHA 3BR1A 1K83J 4UB8C 1OCCH 2CUZA 5E20A 3RCOA 4ZYEA 3QQAA 2MA3A 2NS7A 2X85A 3BY6A 1JKOC 4TV7A 5HLTA 3A1YA 5DV5A 2UZKA 1R5ID 3KEQA 2OF7A 2JUCA 1OQYA 3H3VK 1SMTA 4OMYA 4NUBA 1HKQA 3HG9A 3IC7A 4PJJA 2NRAC 2WBMA 2YX7A 1TWGJ 1K6OA 3BR0A 4LB5A 2VJJA 2WB1A 2VQLA 3G71I 2O03A 1R22A 4P9UA 3JRFA 1YX3A 1R7JA 2EFQA 1GDTA 1ZGWA 2L9VA 2WAEA 2ESHA 1LVKA 2XAFA 2MC4A 3RPUA 4I0AA 4P55A 3V4GA 4IQ4A 2DTZA 4EEFG 4XRMA 3CMYA 4PGGA 4RM3A 1ULYA 2OZUA 5C3EJ 3ZPLA 4NQWB 2K9NA 4EM1A 2ELJA 1LE8B 3CP8A 2PFBA 4CCNA 4CDGA 2BW3B 3QOPA 1O3TA 5GAEJ 5HDNA 1WCMJ 2LY1A 4JX5A 5J1YA 5B1BH 4A3IJ 2OU2A 3I3LA 4HRIA 3H36A 4E6KG 1SEUA 1U0JA 2WTEA 2HVSA 1GUUA 4BXFA 2Y0SA 2ZXWH 3I55I 1B8IB 2ZKZA 3BZCA 3CD6I 3GTOJ 3OMYA 4M3DA 4FTHA 4RGXA 3HYIA 2P6SA 1Y1VJ 3LFUA 5TRDA 1N77A 4ENMA 4CCKA 1KA8A 2KIMA 1I27A 4A5NA 2Z16A 3K4NA 1UMQA 4XSZF 3WU0A 1FJLA 4UUSA 1KQ0A 1H88C 4BKXA 5E3MA 4BE2A 1O57A 1GT0C 2E7WA 3FF5A 1IO2A 1FY7A 4ANJA 2CYYA 5JVTA 3PNYA 3FZVA 1YRNA 4PSWA 2H8WA 1QHGA 1YW8A 3JREA 2AXTC 1EJ9A 3GTKJ 2X1EA 2LLKA 3L2VA 4B43A 2V7FA 3I56I 3L2CA 4LFUA 4X6AJ 3R60A 5EYRA 4AIJA 4F3QA 1LNWA 1LJ9A 1S9HA 2FSWA 1BOAA 3CQZJ 3FBIB 5FKNA 2WY7Q 1VQ5I 1SMYF 2HNHA 3L2RA 4L18B 1IN4A 2PN6A 1OCRH 1Z6RA 5GPAA 3OS1A 3H5RA 2FBIA 2OQRA 2BVLA 2K9MA 2D1HA 2M7BA 2R7ZJ 1Q1VA 1OYWA 4GCVA 3LA3A 2WY8Q 2LBFA 4NB5A 3FMRA 3KIOA 2L2OA 4AM3A 4YFXF 4EJTA 4BUPA 4ZZLA 3LFKA 4Y52J 3L9FA 1U5TC 2QKLB 1IRZA 2Q1ZB 4XRSA 3KYCB 4WWCA 4WF2A 1TQMA 2COMA 4E7LA 1N25A 3WTYC 4Q5SF 3BCAA 1W5CC 2CW0F 1T33A 2HKXA 1K4TA 1REPC 4QPOA 2EH3A 1BM9A 2DOAA 3I4PA 3K10A 1POGA 1YOVB 2TDXA 1LPQA 4ENJA 3WODF 3S93A 1BA5A 3EYIA 3PJRA 4G6DA 1Z3XA 4KT6A 4M6VA 2PMZN 3HEFA 3CLQA 1HDPA 3CCLI 1Y39A 1MMDA 3S1MJ 1OCZH 1IDZA 1TQIA 4DYCA 4EJOA 4F91B 2D1VA 3ZMDA 4UB6C 2V4JC 3HB9A 1X3UA 4A3BJ 2IXSA 4IOCF 1I50J 3TBIA 5IPAA 3TMOA 4M9ZA
chains in the Genus database with same CATH topology
3G1OA 5IP9J 4I76A 4L5EA 2YU9J 3S17J 1DU0A 2E1OA 1LFUP 3SFIA 4DYQA 1P7JA 5GP9A 2JK3A 2AHQA 4A69C 1IJWC 1H8AC 1VNDA 3WHBA 3O8GA 4JP0A 1LFBA 3BQZA 3ZQFA 2ZB9A 2JJ7A 2NVYJ 2HXOA 2RAEA 2JA8J 2HOAA 5IYCJ 1LE8A 2NVQJ 1A6IA 2LK2A 5EF6A 2N8GA 2MW8A 1ETQA 3ZQHA 2OPTA 5K7FA 2AO9A 5C44J 1VI0A 2NVTJ 1ZK8A 5C4JJ 3S2HJ 2M8GX 2M9HA 1DU6A 3RZOJ 4AYBN 5IOZA 2HDDA 1ITYA 1ZKGA 3S1NJ 3BTCA 3BTJA 5J1RA 4IHXA 3S15J 3ZOBA 3S1QJ 5IP6A 3IH3A 1ZR2A 4XRSG 4W1UA 4M3GA 2JA5J 1ETYA 5M3FJ 2NS8A 2XSDC 1XS9A 5EDNA 1MH3A 2DA3A 2ECBA 2E19A 1NK2P 3HOXJ 4XK4A 3WHCA 4Y7NJ 3TEDA 2DA7A 2O9LA 2CQQA 3K7AJ 5E3NA 2DMPA 4CYCB 1U78A 4MIMA 1WGXA 4A3MJ 2TRTA 4BBRJ 4A3EJ 2CUFA 5K7ZA 4QIWN 5M5XJ 2R5YA 2M34A 3W6VA 2IBDA 2TCTA 4A3LJ 4FISA 3LSGA 3OSFA 1IUFA 1X2MA 2XPVA 1TWCJ 3HM5A 4CYCA 3DCFA 4NDLA 2E2HJ 3JRAA 1AKHA 4IHWA 1MBKA 4FCYA 1AHDP 2MG4A 4A3JJ 1B72A 4ABZA 1VF9A 3PO3J 4M3BA 5M5YJ 4D7MA 4DZPA 1JTYA 2O8KA 3GTLJ 2K9SA 2E2IJ 5HODA 2R0QC 5FKKA 1BW6A 3JRIA 4GFBA 2M0CA 2L7ZA 2DA5A 3RZDJ 1FIAA 2DA2A 1OJLA 2CRGA 3MVPA 5DS9A 1HF0A 1RETA 5F0FA 2XGDA 3JRHA 4C2MJ 5JLXA 2ME6A 2VKEA 5JLWA 2ID3A 3A01A 1JUPA 2LKXA 1P7IA 3FKIJ 1JT0A 4IHVA 5GPCA 3LSPA 1I3QJ 2GM4A 2Y2ZA 1A5JA 2EZLA 2JA7J 4A3CJ 1W0UA 4V2FA 4A3FJ 2WB1N 5E3LA 4AC0A 1QVTA 3BT9A 5FKOA 1XC5A 1Z77A 3ZQIA 5EGOA 4RDUA 1CQTA 1OFCX 1JKQC 2FD5A 1WH5A 3HOYJ 1G2HA 2L0KA 3LOCA 3BG3A 2ELKA 1GV2A 1OCPA 2HI3A 3VPRA 2HQ5A 1HCRA 2FQ4A 2NVXJ 3H0GJ 3LSRA 2EZKA 2VUMJ 3NARA 2DMNA 3TP0A 1H89C 1FEXA 1FTTA 2DJNA 3HOUJ 1ORKA 4BBSJ 2FX0A 2ME0A 2X9DA 1TWFJ 2VKVA 1TC3C 2DA1A 2B63J 2XB0X 3RQIA 3HGGA 5FLMJ 3BG9A 2EQRA 3GTQJ 3TW7A 5F0HA 2Y9YA 1NTCA 3SDGA 1F36A 2Y0SN 3GTMJ 1OCTC 1D5YA 3HKZN 2EBIA 1Z0XA 3QPSA 1PUFB 4C3IJ 2QCOA 3O8HA 1EF4A 4UUSB 3G1LA 5BNGA 1QPIA 2W48A 4J19A 4FE4A 2Y9ZA 4JYKA 3Q0WA 2JMWA 1TWHJ 4HNVA 1JT6A 1YRNB 5F04A 4B1RA 3L1PA 1O4XA 2XGCA 1ETKA 3A03A 2R5ZB 5FKMA 2MGQA 2HOSA 3S14J 4JX4A 2JN6A 5M3MJ 3IH2A 1ETVA 1MBFA 3GTGJ 3DEWA 2H8RA 1S7EA 2EZHA 4D5FA 1RPWA 3BTIA 5C4XJ 5EEAA 4MFEA 5F08A 1MBEA 1QVUA 3TW6A 5IYDJ 4XICA 1W0TA 2R93J 3OSGA 1IGNA 1BJZA 2LD5A 1T56A 1BL0A 5EG0B 2JA6J 4D7NA 3BTLA 2LFBA 3PM1A 3LNQA 1MSFC 2QF7A 4MLOA 5J1UA 1IV6A 3CCYA 2D5VA 3M4OJ 3S1RJ 1X2NA 2K40A 3HOVJ 2LR8A 2JWTA 3S16J 1MBGA 1ZTRA 1JUMA 3FISA 4B4CA 3HDDA 1VFCA 1MNMC 2K9QA 1ZQ3P 2YUSA 3BR5A 1RKWA 2E2JJ 3IV5A 3IH4A 1U9OA 1FIPA 4IEJA 2CUEA 5EZHA 4M3EA 2HOTA 4B3AA 5DTDA 3OOUA 4X1EA 2M2EA 1BW5A 3BR1A 1K83J 3Q0UA 4UUTA 1F43A 1UHSA 1I6HJ 1ETXA 3QQAA 2VI6A 2NS7A 3HOWJ 1JKOC 4M3FA 4JX6A 4A93J 2L7MP 2HXIA 2OF7A 2GLOA 2R92J 5EZGA 4LOCA 3H3VK 2H1KA 2GBYA 4I6ZA 4D5CA 3OIOA 4G12A 1TWGJ 2Y30A 3BR0A 4DYRA 4A3GJ 3MKLA 4FE7A 3Q0VA 2XPUA 3E7LA 3PO2J 3QPLA 4DZJA 1GV5A 2L9RA 3JRFA 5IYBJ 2CQXA 1GDTA 3JRBA 1ZGWA 3B6CA 2I10A 2DTZA 1RKTA 4EEFG 1JJ8C 1FTZA 2VPRA 2COBA 4XRMA 3CMYA 5C3EJ 1U9NA 1RESA 2K9NA 1IDYA 1LE8B 1WH7A 3I4MJ 2DA4A 3BR3A 2DMUA 1TWAJ 4C3JJ 1JKPC 5F1JA 3F0CA 1HDDC 1WCMJ 2FJ1A 2XGEA 3FK6A 5K7HA 3JRGA 2KDZA 4JX5A 5J1YA 1AU7A 4A3IJ 3A02A 2X6OA 3JRDA 3BR2A 3G1MA 1GUUA 2DA6A 4DW6A 3GTPJ 1B8IB 4S0HB 3BG5A 4QSHA 1X58A 4IHYA 3GTOJ 4M3DA 4FTHA 1MBJA 1Y1VJ 1PUFA 2XB5A 2MSYA 2LY9A 1XG1A 3D1NI 5FJ8J 1HLVA 1UMQA 1FJLA 4UUSA 2LTPA 1H88C 4BKXA 2L7FP 5E3MA 3ZQLA 1B8IA 1GT0C 4RBOA 1MSEC 1SANA 5E3OA 5IOYA 3GTJJ 1YRNA 4BY1J 2G0EA 4A3DJ 3JREA 4MO7A 1IC8A 3GTKJ 2R5ZA 4AUXA 2LLKA 3SJMA 2DMTA 2R5YB 3GBGA 3JRCA 4QTRA 2XRLA 4W97A 4X6AJ 1MH4A 3TP3A 3HOZJ 2LVSA 4A3KJ 5EYRA 1Y1WJ 2X48A 1E3OC 4MFDA 3CQZJ 3BQYA 5FKNA 1AKHB 1APLC 3K2AA 3HBLA 2CU7A 5GPAA 1MBHA 3BR6A 1JGGA 1B72B 2IEKA 1K61A 2ID6A 3ZQCA 4V2GA 2R7ZJ 2O7OA 3C2BA 5EG0A 1GVDA 1Q1VA 3B6AA 4XIDA 3HGYA 2WV1A 2NOGA 3FIWA 1ZR4A 9ANTA 2Y31A 3Q3SA 1QRYA 1JTXA 1ETOA 1JKRC 4BXXJ 3MN2A 4Y52J 2P81A 2ECCA 3RKQA 1SFOJ 2DMQA 2LP0A 1WPKA 1IRZA 1ENHA 4XRSA 4C3HJ 3JR9A 5FLVA 2IAIA 3A01B 3UKGA 2XPWA 1R9TJ 3S2DJ 1T33A 1UG2A 3ZQGA 3CDLA 3M3YJ 2EH3A 2CJJA 2HYJA 3LSJA 5F0CA 5F27A 1IG7A 5J3LA 1POGA 1ETWA 5M5WJ 5EGOB 1BA5A 1NK3P 2YS9A 4M6VA 2PMZN 3HEFA 3I4NJ 2EZIA 1HDPA 2WAQN 2DN0A 3S1MJ 4BY7J 5FKLA 3FK7A 1IDZA 1HOMA 4DYCA 1U8BA 1WI3A 2KT0A 3HB9A 1RR7A 4A3BJ 1JJ6C 1I50J 3NAUA 5IPAA 5IP7J 1JUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1O A;  5IP9 J;  4I76 A;  4L5E A;  2YU9 J;  3S17 J;  1DU0 A;  2E1O A;  1LFU P;  3SFI A;  4DYQ A;  1P7J A;  5GP9 A;  2JK3 A;  2AHQ A;  4A69 C;  1IJW C;  1H8A C;  1VND A;  3WHB A;  3O8G A;  4JP0 A;  1LFB A;  3BQZ A;  3ZQF A;  2ZB9 A;  2JJ7 A;  2NVY J;  2HXO A;  2RAE A;  2JA8 J;  2HOA A;  5IYC J;  1LE8 A;  2NVQ J;  1A6I A;  2LK2 A;  5EF6 A;  2N8G A;  2MW8 A;  1ETQ A;  3ZQH A;  2OPT A;  5K7F A;  2AO9 A;  5C44 J;  1VI0 A;  2NVT J;  1ZK8 A;  5C4J J;  3S2H J;  2M8G X;  2M9H A;  1DU6 A;  3RZO J;  4AYB N;  5IOZ A;  2HDD A;  1ITY A;  1ZKG A;  3S1N J;  3BTC A;  3BTJ A;  5J1R A;  4IHX A;  3S15 J;  3ZOB A;  3S1Q J;  5IP6 A;  3IH3 A;  1ZR2 A;  4XRS G;  4W1U A;  4M3G A;  2JA5 J;  1ETY A;  5M3F J;  2NS8 A;  2XSD C;  1XS9 A;  5EDN A;  1MH3 A;  2DA3 A;  2ECB A;  2E19 A;  1NK2 P;  3HOX J;  4XK4 A;  3WHC A;  4Y7N J;  3TED A;  2DA7 A;  2O9L A;  2CQQ A;  3K7A J;  5E3N A;  2DMP A;  4CYC B;  1U78 A;  4MIM A;  1WGX A;  4A3M J;  2TRT A;  4BBR J;  4A3E J;  2CUF A;  5K7Z A;  4QIW N;  5M5X J;  2R5Y A;  2M34 A;  3W6V A;  2IBD A;  2TCT A;  4A3L J;  4FIS A;  3LSG A;  3OSF A;  1IUF A;  1X2M A;  2XPV A;  1TWC J;  3HM5 A;  4CYC A;  3DCF A;  4NDL A;  2E2H J;  3JRA A;  1AKH A;  4IHW A;  1MBK A;  4FCY A;  1AHD P;  2MG4 A;  4A3J J;  1B72 A;  4ABZ A;  1VF9 A;  3PO3 J;  4M3B A;  5M5Y J;  4D7M A;  4DZP A;  1JTY A;  2O8K A;  3GTL J;  2K9S A;  2E2I J;  5HOD A;  2R0Q C;  5FKK A;  1BW6 A;  3JRI A;  4GFB A;  2M0C A;  2L7Z A;  2DA5 A;  3RZD J;  1FIA A;  2DA2 A;  1OJL A;  2CRG A;  3MVP A;  5DS9 A;  1HF0 A;  1RET A;  5F0F A;  2XGD A;  3JRH A;  4C2M J;  5JLX A;  2ME6 A;  2VKE A;  5JLW A;  2ID3 A;  3A01 A;  1JUP A;  2LKX A;  1P7I A;  3FKI J;  1JT0 A;  4IHV A;  5GPC A;  3LSP A;  1I3Q J;  2GM4 A;  2Y2Z A;  1A5J A;  2EZL A;  2JA7 J;  4A3C J;  1W0U A;  4V2F A;  4A3F J;  2WB1 N;  5E3L A;  4AC0 A;  1QVT A;  3BT9 A;  5FKO A;  1XC5 A;  1Z77 A;  3ZQI A;  5EGO A;  4RDU A;  1CQT A;  1OFC X;  1JKQ C;  2FD5 A;  1WH5 A;  3HOY J;  1G2H A;  2L0K A;  3LOC A;  3BG3 A;  2ELK A;  1GV2 A;  1OCP A;  2HI3 A;  3VPR A;  2HQ5 A;  1HCR A;  2FQ4 A;  2NVX J;  3H0G J;  3LSR A;  2EZK A;  2VUM J;  3NAR A;  2DMN A;  3TP0 A;  1H89 C;  1FEX A;  1FTT A;  2DJN A;  3HOU J;  1ORK A;  4BBS J;  2FX0 A;  2ME0 A;  2X9D A;  1TWF J;  2VKV A;  1TC3 C;  2DA1 A;  2B63 J;  2XB0 X;  3RQI A;  3HGG A;  5FLM J;  3BG9 A;  2EQR A;  3GTQ J;  3TW7 A;  5F0H A;  2Y9Y A;  1NTC A;  3SDG A;  1F36 A;  2Y0S N;  3GTM J;  1OCT C;  1D5Y A;  3HKZ N;  2EBI A;  1Z0X A;  3QPS A;  1PUF B;  4C3I J;  2QCO A;  3O8H A;  1EF4 A;  4UUS B;  3G1L A;  5BNG A;  1QPI A;  2W48 A;  4J19 A;  4FE4 A;  2Y9Z A;  4JYK A;  3Q0W A;  2JMW A;  1TWH J;  4HNV A;  1JT6 A;  1YRN B;  5F04 A;  4B1R A;  3L1P A;  1O4X A;  2XGC A;  1ETK A;  3A03 A;  2R5Z B;  5FKM A;  2MGQ A;  2HOS A;  3S14 J;  4JX4 A;  2JN6 A;  5M3M J;  3IH2 A;  1ETV A;  1MBF A;  3GTG J;  3DEW A;  2H8R A;  1S7E A;  2EZH A;  4D5F A;  1RPW A;  3BTI A;  5C4X J;  5EEA A;  4MFE A;  5F08 A;  1MBE A;  1QVU A;  3TW6 A;  5IYD J;  4XIC A;  1W0T A;  2R93 J;  3OSG A;  1IGN A;  1BJZ A;  2LD5 A;  1T56 A;  1BL0 A;  5EG0 B;  2JA6 J;  4D7N A;  3BTL A;  2LFB A;  3PM1 A;  3LNQ A;  1MSF C;  2QF7 A;  4MLO A;  5J1U A;  1IV6 A;  3CCY A;  2D5V A;  3M4O J;  3S1R J;  1X2N A;  2K40 A;  3HOV J;  2LR8 A;  2JWT A;  3S16 J;  1MBG A;  1ZTR A;  1JUM A;  3FIS A;  4B4C A;  3HDD A;  1VFC A;  1MNM C;  2K9Q A;  1ZQ3 P;  2YUS A;  3BR5 A;  1RKW A;  2E2J J;  3IV5 A;  3IH4 A;  1U9O A;  1FIP A;  4IEJ A;  2CUE A;  5EZH A;  4M3E A;  2HOT A;  4B3A A;  5DTD A;  3OOU A;  4X1E A;  2M2E A;  1BW5 A;  3BR1 A;  1K83 J;  3Q0U A;  4UUT A;  1F43 A;  1UHS A;  1I6H J;  1ETX A;  3QQA A;  2VI6 A;  2NS7 A;  3HOW J;  1JKO C;  4M3F A;  4JX6 A;  4A93 J;  2L7M P;  2HXI A;  2OF7 A;  2GLO A;  2R92 J;  5EZG A;  4LOC A;  3H3V K;  2H1K A;  2GBY A;  4I6Z A;  4D5C A;  3OIO A;  4G12 A;  1TWG J;  2Y30 A;  3BR0 A;  4DYR A;  4A3G J;  3MKL A;  4FE7 A;  3Q0V A;  2XPU A;  3E7L A;  3PO2 J;  3QPL A;  4DZJ A;  1GV5 A;  2L9R A;  3JRF A;  5IYB J;  2CQX A;  1GDT A;  3JRB A;  1ZGW A;  3B6C A;  2I10 A;  2DTZ A;  1RKT A;  4EEF G;  1JJ8 C;  1FTZ A;  2VPR A;  2COB A;  4XRM A;  3CMY A;  5C3E J;  1U9N A;  1RES A;  2K9N A;  1IDY A;  1LE8 B;  1WH7 A;  3I4M J;  2DA4 A;  3BR3 A;  2DMU A;  1TWA J;  4C3J J;  1JKP C;  5F1J A;  3F0C A;  1HDD C;  1WCM J;  2FJ1 A;  2XGE A;  3FK6 A;  5K7H A;  3JRG A;  2KDZ A;  4JX5 A;  5J1Y A;  1AU7 A;  4A3I J;  3A02 A;  2X6O A;  3JRD A;  3BR2 A;  3G1M A;  1GUU A;  2DA6 A;  4DW6 A;  3GTP J;  1B8I B;  4S0H B;  3BG5 A;  4QSH A;  1X58 A;  4IHY A;  3GTO J;  4M3D A;  4FTH A;  1MBJ A;  1Y1V J;  1PUF A;  2XB5 A;  2MSY A;  2LY9 A;  1XG1 A;  3D1N I;  5FJ8 J;  1HLV A;  1UMQ A;  1FJL A;  4UUS A;  2LTP A;  1H88 C;  4BKX A;  2L7F P;  5E3M A;  3ZQL A;  1B8I A;  1GT0 C;  4RBO A;  1MSE C;  1SAN A;  5E3O A;  5IOY A;  3GTJ J;  1YRN A;  4BY1 J;  2G0E A;  4A3D J;  3JRE A;  4MO7 A;  1IC8 A;  3GTK J;  2R5Z A;  4AUX A;  2LLK A;  3SJM A;  2DMT A;  2R5Y B;  3GBG A;  3JRC A;  4QTR A;  2XRL A;  4W97 A;  4X6A J;  1MH4 A;  3TP3 A;  3HOZ J;  2LVS A;  4A3K J;  5EYR A;  1Y1W J;  2X48 A;  1E3O C;  4MFD A;  3CQZ J;  3BQY A;  5FKN A;  1AKH B;  1APL C;  3K2A A;  3HBL A;  2CU7 A;  5GPA A;  1MBH A;  3BR6 A;  1JGG A;  1B72 B;  2IEK A;  1K61 A;  2ID6 A;  3ZQC A;  4V2G A;  2R7Z J;  2O7O A;  3C2B A;  5EG0 A;  1GVD A;  1Q1V A;  3B6A A;  4XID A;  3HGY A;  2WV1 A;  2NOG A;  3FIW A;  1ZR4 A;  9ANT A;  2Y31 A;  3Q3S A;  1QRY A;  1JTX A;  1ETO A;  1JKR C;  4BXX J;  3MN2 A;  4Y52 J;  2P81 A;  2ECC A;  3RKQ A;  1SFO J;  2DMQ A;  2LP0 A;  1WPK A;  1IRZ A;  1ENH A;  4XRS A;  4C3H J;  3JR9 A;  5FLV A;  2IAI A;  3A01 B;  3UKG A;  2XPW A;  1R9T J;  3S2D J;  1T33 A;  1UG2 A;  3ZQG A;  3CDL A;  3M3Y J;  2EH3 A;  2CJJ A;  2HYJ A;  3LSJ A;  5F0C A;  5F27 A;  1IG7 A;  5J3L A;  1POG A;  1ETW A;  5M5W J;  5EGO B;  1BA5 A;  1NK3 P;  2YS9 A;  4M6V A;  2PMZ N;  3HEF A;  3I4N J;  2EZI A;  1HDP A;  2WAQ N;  2DN0 A;  3S1M J;  4BY7 J;  5FKL A;  3FK7 A;  1IDZ A;  1HOM A;  4DYC A;  1U8B A;  1WI3 A;  2KT0 A;  3HB9 A;  1RR7 A;  4A3B J;  1JJ6 C;  1I50 J;  3NAU A;  5IPA A;  5IP7 J;  1JUS A; 
#chains in the Genus database with same CATH topology
 2ZJR F;  4I76 A;  1Z1D A;  4KMF A;  3PQJ A;  2QLZ A;  2EJR A;  3SFI A;  4DYQ A;  1P7J A;  2FU4 A;  4A5M A;  5ILV A;  2JK3 A;  3IWF A;  2V1N A;  2AHQ A;  2EV5 A;  1IJW C;  2GA1 A;  5LRR A;  1H8A C;  1J7K A;  3KP3 A;  1J59 A;  2ZME A;  3K1N A;  1Z3Y A;  4U88 A;  4MQ9 F;  2CV2 A;  4NQW A;  3I54 A;  2Z99 A;  4ESB A;  1GVJ A;  1LE8 A;  4L9N A;  2HZT A;  1A6I A;  4LLN A;  3J81 K;  5DCF A;  1XD7 A;  2BW3 A;  4LB6 B;  2WC2 A;  3A4C A;  2MW8 A;  2CV1 A;  2K27 A;  2Y69 H;  2OPT A;  5C44 J;  3MD2 A;  3RI4 A;  3GWZ A;  3CDH A;  4XSX F;  1FBQ A;  1WHU A;  2M9H A;  1DU6 A;  3AL0 C;  5IOZ A;  1ITY A;  3H9G A;  3P9K A;  2Z1D A;  2C6Y A;  3BTC A;  2V1X A;  4N0B A;  3S15 J;  2M0M A;  4KJZ A;  3HL2 A;  2GWR A;  1F4K A;  5IP6 A;  2JVG A;  2F5F A;  1ZR2 A;  3DBR B;  3ML6 A;  1XGN A;  1ETY A;  1P9Q C;  4N9I A;  3RPQ A;  5M3F J;  4XLN F;  3K4M A;  2XSD C;  5CQG A;  1T0F A;  1RUN A;  4KIF A;  2ECB A;  5L3F A;  2FML A;  1NK2 P;  2X1D A;  3MZ8 A;  3TED A;  4BGD A;  3ZQQ A;  2X1C A;  2JSC A;  1G59 A;  4NNJ A;  2DMP A;  4E7K A;  1O7F A;  4EJW A;  3CUO A;  1U78 A;  3EDP A;  3ZMT A;  2CFX A;  2TRT A;  1D3Y A;  4DQ2 A;  1LB2 A;  5CJ9 A;  4CH7 A;  3KX2 A;  1MKM A;  1ON1 A;  3WU2 C;  3W6V A;  4M72 A;  1IRF A;  3BDD A;  3LSG A;  4PCQ A;  3ZGK A;  1X2M A;  1Z7L A;  2IS1 A;  4FX0 A;  3HM5 A;  4CYC A;  3DCF A;  2E2H J;  3FXK A;  5BS6 A;  3GF2 A;  3CCQ I;  3PQK A;  1MBK A;  4HBL A;  3ZN0 A;  2O3F A;  1A31 A;  3WTV C;  3R0J A;  4A3J J;  2IS2 A;  2NVU B;  3PL8 A;  4ABZ A;  4DJA A;  5CVJ A;  2A3S A;  1U2W A;  1X1P A;  1LEA A;  2VC0 A;  2O61 A;  1EH7 A;  1DUX C;  4DOZ A;  4R8H A;  5JFR A;  3K1P A;  2K9S A;  2LG4 A;  1YS7 A;  2M3A A;  3J7Y J;  4U0W A;  4ZJZ A;  2XRO A;  1K4S A;  3RZD J;  1IF1 A;  2DA2 A;  3IL2 A;  2FQ3 A;  3BZK A;  4B09 A;  1DP3 A;  3OYI A;  4CA0 A;  3JRH A;  2LC2 A;  2VKE A;  5JLW A;  2RVC A;  1TW3 A;  2B7E A;  1XN7 A;  2H6B A;  1HBX G;  2JA7 J;  2Q0O A;  1W0U A;  4BEH B;  2WB1 N;  4HF1 A;  3FM3 A;  1CQT A;  1QO0 D;  1Z77 A;  3E0J B;  1EKE A;  4YEL A;  1OFC X;  2P5V A;  2E7X A;  3EUH A;  2XDV A;  5B5E C;  1R1T A;  1R4M B;  1V5E A;  1TP4 A;  5HDK A;  3GLX A;  3BG3 A;  1X1D A;  2QA4 I;  4D0P A;  5K5O A;  2HQ5 A;  2R7U A;  2PX9 A;  1HCR A;  2NVX J;  2L9S A;  2EZK A;  2VUM J;  3TP0 A;  4CIC A;  2GQQ A;  2LOO A;  3V7C A;  3VYS B;  1PP7 U;  1FTT A;  4EJV A;  2FX0 A;  4WK8 F;  3F23 A;  1TC3 C;  2DA1 A;  3FXU A;  1FLI A;  1XCV A;  2EQR A;  2P6T A;  3ABT A;  2E36 A;  1FOX A;  1ZYR F;  1K79 A;  4M74 A;  4XKC A;  1F9N A;  4DIQ A;  2CH0 A;  2DFI A;  4P1W A;  4Y3O A;  2Y9Y A;  5LEK A;  3RKY A;  1NTC A;  4HLY A;  1F36 A;  2DW4 A;  2NXN B;  2Y0S N;  1FOK A;  3GTM J;  3OYK A;  2D45 A;  1IXS B;  2BVM A;  1KU9 A;  4FT8 A;  4FX4 A;  2V1D A;  3H35 A;  3HKZ N;  2KRF A;  3JSP A;  1XGO A;  4C2U A;  3K4L A;  1TBX A;  3JCU C;  1EF4 A;  2BV6 A;  1J75 A;  3HRT A;  1BR4 A;  3E1S A;  4AYB A;  2Z33 A;  1GHC A;  2RC4 A;  3PSI A;  2W48 A;  1IW7 F;  2VXD A;  2PJR B;  1MW7 A;  2MBF A;  2FNA A;  2A5Y B;  2H94 A;  1TWH J;  1WJE A;  1JT6 A;  4B1R A;  1O4X A;  5FRM A;  2L01 A;  2Y48 A;  4LK1 F;  1ETK A;  2DXI A;  2R5Z B;  4HZF A;  4UVA A;  1CGP A;  1TNT A;  1W7P D;  2XVC A;  5CPR B;  2QQ9 A;  3F8N A;  4YEJ A;  3IH2 A;  4HX8 A;  1MBF A;  4HDV A;  3DEW A;  2BY1 A;  1BI2 A;  1S7E A;  1XMX A;  2EZH A;  2HDC A;  5KNL A;  3TO7 A;  3C2H A;  3KP6 A;  1S8N A;  4HV6 A;  4PFO A;  3BTI A;  1MJA A;  3TW6 A;  5IYD J;  3IWZ A;  3RKX A;  3PIO F;  3KLN A;  3DKW A;  4NHJ A;  1S7A A;  3BTL A;  3PM1 A;  1PUE E;  1ODD A;  3M4O J;  1SC7 A;  1X1A A;  1SVO A;  3HOV J;  4IF4 A;  4OWR B;  3FXO A;  1RR8 C;  1RC9 A;  3S16 J;  1IV8 A;  1MBG A;  3P5J A;  3WG7 H;  3C2G A;  3S3N A;  6PAX A;  1QGP A;  1Y0N A;  1VFC A;  2WA0 A;  1ZQ3 P;  4OIQ F;  2RNG A;  5HLH A;  5EJC A;  3OYJ A;  2FEZ A;  3QP5 A;  2K9L A;  2F5E A;  3SQN A;  2IJL A;  3FXL A;  1XSX A;  4CYD A;  3FBN B;  3IV5 A;  1V5G A;  3IHU A;  2CO5 A;  2CUE A;  2W4S A;  5ICF A;  3T1B A;  5EZH A;  2BOL A;  2UXN A;  2R7T A;  4I09 A;  4YIF A;  3VOD A;  4M3E A;  4F93 B;  1T0F C;  4B3A A;  3KP4 A;  2V6C A;  2WAF A;  1SFU A;  1MIJ A;  1SD6 A;  1Z9C A;  3OOU A;  1YTY A;  4LK0 F;  1BW5 A;  4M6X A;  4IO9 F;  1F43 A;  2RQP A;  4XOP A;  2HPI A;  3R61 A;  3CC7 I;  2PEX A;  4IVN A;  2X51 A;  2FBH A;  1PDN C;  2IS6 A;  1YLF A;  4H4K C;  2L7M P;  2HXI A;  1P4W A;  3RIR A;  2VC1 A;  4YFK F;  2GBY A;  4KN4 X;  3F22 A;  3OIO A;  1MD0 A;  4G12 A;  4DYR A;  3COA C;  3MKL A;  1IN5 A;  4BEH A;  2CWE A;  4XLC A;  2EK5 A;  2XPU A;  5B3S H;  3CCJ I;  3QPL A;  2W25 A;  1Z05 A;  2VPL A;  2V9V A;  1Z91 A;  2E5N A;  2Z3Y A;  3GVA A;  3X2Q H;  5LHH A;  3A0H C;  1W36 C;  2QQ8 A;  3G4S I;  1RKT A;  3ELK A;  2DU9 A;  5LEJ A;  4ZYD A;  2VPR A;  1Q1H A;  5L3G A;  2NS0 A;  4G7O F;  2EA4 A;  2FMY A;  2G7U A;  1U9N A;  3OOP A;  4L9T A;  1YE9 A;  2W1O A;  2ZNZ A;  2RN7 A;  3VOE A;  1ZAR A;  2DT7 B;  2KZV A;  3ABM H;  1WH7 A;  4XKW A;  1YW7 A;  4XKB A;  3K70 D;  1N78 A;  2GA2 A;  2LMD A;  3GUD A;  1TWA J;  2GOM A;  4KYW A;  4C3J J;  3O2P E;  5F1J A;  3ZR8 X;  4G6Q A;  3FK6 A;  2XGE A;  2HYF A;  3MKY B;  1AU7 A;  4MEY F;  3A02 A;  3JRD A;  3GFJ A;  1YIO A;  1GLN A;  3G1M A;  5J47 A;  2JPB A;  1FSH A;  1KQ8 A;  2V9P A;  4DW6 A;  1I1S A;  2VKD A;  4RB2 C;  5DM6 F;  4HPQ A;  3WTT C;  3KZY A;  5D4S A;  3BJA A;  3PSF A;  4QSH A;  3OY9 A;  4IX7 A;  2PQ8 A;  4IHY A;  4IKF A;  3BRO A;  2EIL H;  4LD5 A;  2XF7 A;  1DDN A;  2XB5 A;  1U3E M;  2R7X A;  4Z6Y A;  1XPX A;  2LTP A;  2QSH X;  2G7H A;  4L9V A;  3WTS C;  2PJR A;  3W6K B;  4RBO A;  3S2W A;  2A6H F;  5BPD A;  2DYS H;  1UCR A;  4IJA A;  5E3O A;  4B44 A;  3HC7 A;  4EVI A;  3GTJ J;  2R3S A;  4BY1 J;  3M07 A;  4A3D J;  1QA6 A;  3HZJ A;  1B59 A;  2R5Z A;  2HVQ A;  3U1D A;  4D9J A;  3SJM A;  2L54 A;  1E3H A;  3ABK H;  3GBG A;  4X0G A;  2Z2S B;  2DQL A;  4W97 A;  3U1K A;  1MH4 A;  2FBK A;  2A61 A;  3HOZ J;  5LLQ A;  1M1E B;  2QEN A;  2IA1 A;  4HAM A;  3GFI A;  4ZYA A;  4BDY A;  4I99 C;  2LBF B;  5BPI A;  3CJR B;  3OIQ A;  4RAZ A;  1KGS A;  3N05 A;  2NNY A;  2Q2E B;  2CQN A;  2JA2 A;  2OBP A;  2ID6 A;  4V2G A;  2O7O A;  2HGC A;  3C2B A;  3QU6 A;  2LF7 A;  3I71 A;  3F8M A;  2XAG A;  1QBJ A;  2NOG A;  2A6T A;  4AU7 A;  2Y31 A;  3BOQ A;  5JHU A;  2FNP A;  3Q3S A;  3CCM I;  4IQJ A;  4XOT A;  3L00 A;  1JTX A;  4AID A;  1ETO A;  3CUQ B;  4RM2 A;  1X3W B;  1JKR C;  4O3M A;  3RKQ A;  1WJB A;  2DMQ A;  1WPK A;  1FZP B;  1SFX A;  1ENH A;  4OIO F;  1RIO H;  2AQE A;  4C3H J;  4XON A;  3JR9 A;  1VQL I;  3A01 B;  2HTS A;  3ASO H;  5DD4 A;  2YX4 A;  2XPW A;  1R9T J;  2CW8 A;  2XKO A;  1HW2 A;  4RB0 A;  4V19 K;  1R58 A;  1UG2 A;  3M3Y J;  2EFN A;  2CJJ A;  2HYJ A;  4OIN F;  1IG7 A;  5J3L A;  5FO5 A;  3F3X A;  5M5W J;  2XGX A;  2DPU A;  4B48 A;  2M4G A;  4N4N B;  3J80 Z;  1MNE A;  4UV9 A;  5LHG A;  1NK3 P;  1I1G A;  2YS9 A;  5IT9 K;  2EZI A;  2STT A;  3KP7 A;  3UNG C;  2KLO A;  2DK5 A;  4BE1 A;  2PLY A;  3FK7 A;  4KDP A;  3O3K A;  1HOM A;  1WI3 A;  2ZFU A;  1R5H A;  1LDK B;  2DOF A;  2FE3 A;  2DYR H;  1JJ6 C;  2HQN A;  3GFM A;  4LMY A;  2ZME B;  1VQ6 I;  2CG4 A;  2L4M A;  3L09 A;  2IGO A;  3G1O A;  2R7V A;  3DBH B;  3S17 J;  2DJI A;  1ZRD A;  2KDO A;  2X0L A;  5GP9 A;  2DOE A;  4BHB A;  4A69 C;  3CCU I;  1VND A;  3WHB A;  2VBZ A;  2I8D A;  2MH9 A;  1IZ1 A;  2OJE D;  3DPU A;  1LDD A;  2LSO A;  2HXO A;  2RAE A;  2JA8 J;  2HOA A;  2NOJ B;  3OYD A;  3GME A;  4UVB A;  1YX5 A;  3NWS A;  1HXD A;  2CW7 A;  2N8G A;  4HSR A;  1ETQ A;  2LKP A;  4F52 A;  3E5Q A;  2AO9 A;  4F55 A;  1VI0 A;  1OIS A;  1W36 D;  3ABL H;  3HOT A;  4BQQ A;  5FRN A;  5L3B A;  1OR7 C;  4NC6 A;  2M8G X;  3HKZ A;  3RZO J;  4AYB N;  5B66 C;  4KIT B;  2P7V B;  4HX4 A;  2E71 A;  3BTJ A;  1UZC A;  2BXY A;  3ZOB A;  1FP2 A;  2OQG A;  3IH3 A;  4CZZ A;  3OYL A;  1PP8 F;  3WTX C;  5A2Q Z;  4M3G A;  2R7W A;  4AWX B;  4RA2 A;  5E8I A;  4BU2 A;  3QPH A;  1MH3 A;  2DA3 A;  4LJZ F;  1KU3 A;  5HDG A;  1LUJ B;  4UY8 I;  1X3Z B;  3GZN B;  4MNU A;  4UV8 A;  2DA7 A;  4DBR A;  1MZB A;  4UNO A;  4JQF A;  3ULQ B;  5CQE A;  3ZCO A;  4CYC B;  2ESN A;  5HLG A;  4B3X A;  2R7F A;  4E7H A;  1WGX A;  2CQ7 A;  1O3S A;  3ESW B;  1FYK A;  4A3E J;  4BBR J;  2CFO A;  3E5U A;  4M71 A;  5J8C A;  1MJB A;  3LSI A;  4QIW N;  1FMV A;  3W3C A;  5M5X J;  1ZN2 A;  2XAU A;  1UG0 A;  1ZRE A;  3OSF A;  2RGV A;  2FXA A;  2HQR A;  1T2K A;  3K2Z A;  4NDL A;  3WU1 B;  2A05 A;  2DLL A;  1ZAO A;  4JK1 X;  1V54 H;  4FCY A;  2DTR A;  2IA0 A;  4E4H A;  1PJR A;  1Z67 A;  5JR3 A;  2Q2E A;  1H0M A;  1USS A;  2Y0M A;  1ZLJ A;  2BY3 A;  4ZDL A;  2A69 F;  2VXZ A;  4D7M A;  4R79 A;  4C30 A;  3ZMZ A;  4XLA A;  3KZZ A;  1KYZ A;  3SZT A;  2E34 A;  1TL8 A;  2O8K A;  4I2O A;  2GZW A;  5GAH J;  3CUQ A;  2R0Q C;  2F4I A;  2M0C A;  2DA5 A;  4CSW A;  1OJL A;  2CRG A;  1HF0 A;  2BBY A;  5F0F A;  2XGD A;  1OYY A;  3KEY A;  3MAJ A;  3MKW B;  4HEA 2;  4I01 A;  4C2M J;  3GYH X;  5JLX A;  4ZH4 F;  3CJQ B;  2VN2 A;  3A01 A;  2ID3 A;  3RJP A;  3I64 A;  1P7I A;  2IA2 A;  2RKH A;  3FKI J;  3H1C A;  2LDU A;  4U87 A;  4XMY A;  3LSP A;  2G9W A;  3D5S C;  5KK1 A;  2ZC2 A;  4EV0 A;  1I3Q J;  2STW A;  2GM4 A;  2MAB A;  3WGG A;  3EPZ A;  1D0Z A;  2Y2Z A;  1E3P A;  2EZL A;  1YS6 A;  2H1L A;  2IGM A;  4XLH A;  3QU3 A;  2PG4 A;  4A3F J;  2K86 A;  4AC0 A;  2EA2 A;  1QVT A;  3BT9 A;  1XC5 A;  3ZQI A;  2A6E F;  4RDU A;  3J80 K;  1FOY A;  2RQQ A;  1WH5 A;  1GXP A;  4OIP F;  1ACI A;  2L0K A;  3LOC A;  2ELK A;  2HI3 A;  3VPR A;  2FOW A;  5L3C A;  5EEH A;  2E35 A;  2FQ4 A;  3O6B B;  4RGS A;  4G8X A;  3ZMU A;  4IHT A;  3B02 A;  3S8P A;  3DLL F;  1SD4 A;  3DKY A;  1HQC A;  1UJ8 A;  2ME0 A;  1TWF J;  2DFE A;  2CS3 A;  3HSE A;  3HGG A;  5FLM J;  3BG9 A;  4MHG A;  2P7C B;  1STZ A;  3E3V A;  1H9G A;  1HKT A;  2FUG 2;  4HOB A;  4AVP A;  2EPF A;  3TW7 A;  4GO1 A;  2F5D A;  4CCM A;  2XAS A;  3VSK A;  1FOW A;  2VOP A;  2EWN A;  3SDG A;  2EB7 A;  2BGC A;  2BZT A;  3GZ5 A;  4L9J A;  5DDG A;  1FYM A;  1BOB A;  1OPC A;  1T6S A;  3FMS A;  2Q8K A;  2XV4 S;  3IKV A;  2EBI A;  3K4K A;  3EUK L;  4A0Y A;  3OYN A;  1PUF B;  4IOA F;  3S3O A;  1P92 A;  3O8H A;  4PSX A;  2CUJ A;  3REO A;  3V7S A;  2GXG A;  3BLY A;  1QPI A;  1Z6T A;  1VZ0 A;  4XLF A;  1BC8 C;  4J19 A;  5KAI C;  3JTH A;  4Q48 A;  4XM3 A;  2VE9 A;  4JOM A;  4HNV A;  3K1M A;  2QZ8 A;  5F04 A;  2Z9O A;  2HWV A;  2E1N A;  2KKO A;  4KMU X;  1BR1 A;  3MEX A;  5LHI A;  2J5O A;  1D1C A;  1S7O A;  5FKM A;  2DFF A;  5EEG A;  2HOS A;  4YIR X;  4JX4 A;  1ZGJ A;  4HV5 A;  5M3M J;  1WJD A;  1YIT I;  4ESJ A;  3ABU A;  4NC8 A;  4YII A;  2PJP A;  1JHF A;  3M8J A;  3GTG J;  3GEZ A;  2ZO4 A;  2HS5 A;  3I53 A;  3GW2 A;  2QM3 A;  4KN7 X;  3WTZ A;  2M4K A;  4IPA A;  3IP4 B;  2E5Z A;  3KET A;  3LL7 A;  1MMG A;  2EV6 A;  2KIU A;  1MBE A;  1QVU A;  2D2W A;  4XIC A;  3KZI C;  3SZG A;  2R93 J;  1LDJ A;  2OCC H;  5EG0 B;  1KU2 A;  3BC8 A;  2HKO A;  2JA6 J;  3A2K A;  4BNC A;  3W2A A;  2QF7 A;  2D5V A;  2KIF A;  1RUO A;  3MQ0 A;  3G2B A;  2XHK A;  1X2N A;  2K40 A;  5DUK A;  3OYE A;  1WJF A;  2LR8 A;  2JWT A;  2KQR A;  1XCB A;  1ZTR A;  1UFM A;  1JUM A;  4OU0 A;  1VQP I;  2CSO A;  2H09 A;  2K9Q A;  2HR3 A;  4DBQ A;  3LA2 A;  2UV1 A;  2YUS A;  5IT3 A;  3BR5 A;  2HDW A;  2P5L C;  3GCM A;  4IZZ A;  3VB2 A;  2H27 A;  3SXY A;  3LSK A;  4IEJ A;  2HOE A;  4Y17 A;  4OOI A;  3DBL B;  4GYG A;  4BH9 A;  2ELH A;  3K4J A;  4A0Z A;  3RSN A;  4XN3 A;  4P5O A;  3OYF A;  2HOT A;  2MD5 A;  1ON2 A;  5JVG F;  4PJ0 C;  4MQV A;  2IGN A;  2M2E A;  3RTR A;  4CUG A;  4KFC A;  4KA4 A;  3L7W A;  2KPM A;  1UHW A;  1F1Z A;  1UHS A;  4KIB A;  1I6H J;  2VI6 A;  3HOW J;  4S05 A;  3I59 B;  4M3F A;  3IAS 2;  4A93 J;  1BIB A;  4RAY A;  5EZG A;  4LLG F;  3HXL A;  1J0R A;  5CVI A;  4I6Z A;  5DCM B;  4D5C A;  3P7N A;  2VJ5 A;  2Y30 A;  4PJL A;  1EV7 A;  4Q47 A;  5ERI A;  4A3G J;  3VFZ A;  3Q0V A;  4CZC A;  1KON A;  2NYX A;  2NAZ A;  4PDK A;  1G6N A;  5IYB J;  2CQX A;  3JRB A;  3NRV A;  1IUY A;  3JTG A;  3C7J A;  3WE2 A;  1JJ8 C;  1B4A A;  1YG2 A;  2CGP A;  2BEO A;  4U0Y A;  3FMQ A;  1U8R A;  2VJ4 A;  2ZFW A;  4I7H A;  1SVL A;  3DXJ F;  1RES A;  5D6E A;  2LRE A;  3B73 A;  4Y33 A;  1HSJ A;  3C18 A;  4FET A;  2R7R A;  4S04 A;  1V5F A;  2DA4 A;  3LWF A;  2DMU A;  2IS4 A;  4G94 A;  3ECO A;  4RGU A;  1JKP C;  3CC4 I;  5GTH C;  3F0C A;  4OAZ A;  2QBY B;  2FJ1 A;  3CUQ C;  1L3L A;  2X6O A;  2QVO A;  3OYG A;  4IRI A;  4XOR A;  2JT1 A;  3IAM 2;  1YIJ I;  3QAH A;  1T39 A;  2MYS A;  4GYI A;  2DA6 A;  4XN0 A;  5GTI C;  1OLT A;  3AG4 H;  2GXA A;  2HEO A;  3GTP J;  1A6Q A;  3VSL A;  4E7I A;  1X58 A;  4Q4Z F;  2EIM H;  3H5A A;  4IRG A;  3ZN1 A;  1PUF A;  2MSY A;  2ICW G;  1XG1 A;  1HLV A;  5FJ8 J;  2W84 A;  1K6Y A;  3VDX A;  3HPG A;  2L7F P;  2VOO A;  3HUG B;  1V55 H;  2EIN H;  5J4V A;  2W85 A;  1KYW A;  1SAN A;  3SEQ A;  2K7L A;  1X1C A;  4RS8 A;  2UUZ A;  5IOY A;  2GXB A;  3OYC A;  3WGI A;  2L9N A;  1KQ9 A;  4MO7 A;  3I5U A;  4IHS A;  3PFY A;  2ISZ A;  2ZME C;  2DMT A;  3RDI A;  4Y15 A;  4QTR A;  2XRL A;  3JRC A;  3TP3 A;  2LVS A;  4A3K J;  1MDM B;  4OMZ A;  1E3O C;  3CF5 F;  3HPH A;  3DTK A;  5HVQ C;  2DI3 A;  3BQY A;  1APL C;  2DO7 A;  3CME I;  4J01 A;  2M8E A;  4MEX F;  3CDI A;  2VAS A;  3K6G A;  3TO6 A;  1N75 A;  3RPU D;  2VT2 A;  3FWE A;  3HBL A;  1B6A A;  4QPQ A;  1MBH A;  3QYF A;  1IRX A;  1R4N B;  4EQQ A;  3NEU A;  2IEK A;  2YU3 A;  2GIZ A;  4AIH A;  3PIP F;  5FD5 A;  2QKM B;  5EG0 A;  1GVD A;  1QPM A;  4XID A;  3T8T A;  2AQF A;  2WV1 A;  3FIW A;  3HGY A;  1FNN A;  3ASN H;  5FD6 A;  1NH3 A;  9ANT A;  1TTY A;  3PUB A;  1QRY A;  1R1U A;  3J7A O;  4HDU A;  4RAF A;  2KJB A;  4BXX J;  4BJT A;  3MN2 A;  4FAS D;  2P81 A;  4QLC U;  4BQO A;  4XNF A;  1SFO J;  1Y8Q B;  2VL8 A;  2LP0 A;  1QZY A;  3E6M A;  4E7J A;  1VTN C;  2ADU A;  3CC2 I;  3GZ6 A;  5FLV A;  4BS9 A;  2P5K A;  1FP1 D;  3F8C A;  4BE0 A;  4D1Q A;  1G3T A;  3UKG A;  2VLA A;  3E6C C;  1E0E A;  3DU6 A;  3S2D J;  1W7P B;  2A5W A;  3FXQ A;  4C2T A;  1A04 A;  4HW0 A;  3ZQG A;  2EV0 A;  3H0D A;  1WQ2 A;  3CDL A;  4CXF A;  3DEE A;  1K78 B;  3AL0 B;  5F0C A;  2JRT A;  2W24 A;  5F27 A;  3EET A;  1S5L C;  3GX4 X;  1G3Y A;  5EGO B;  3DLA A;  3SFZ A;  1WKM A;  3RQ4 A;  1YHQ I;  3I4N J;  1QZZ A;  3PNT A;  1WJ5 A;  2R4G A;  1SFK A;  1L0O C;  3D0S A;  2MLG A;  3DTE A;  1C0W A;  2O6G E;  3I59 A;  4R1H A;  4HYE A;  2KT0 A;  3DFG A;  4N4O B;  2QSG X;  1RR7 A;  3D5R C;  3G73 A;  1YFH A;  3CZ6 A;  3NAU A;  5LGU A;  2L7K A;  1ONV A;  2P0W A;  1JUS A;  4RAG A;  3LSH A;  3OS0 A;  5DCM A;  3KFW X;  4F92 B;  2F5V A;  4L5E A;  3I58 A;  2E1O A;  1MND A;  1LFU P;  4ETS A;  1QQI A;  2FF4 A;  1RI7 A;  5B1A H;  3DWL E;  5CYV A;  1ZGA A;  1FX7 A;  2JPC A;  2XAJ A;  1UB9 A;  3PNV A;  1LFB A;  3UR3 C;  4KIC A;  3ZQF A;  3LAP A;  2VOD A;  1EA3 A;  5KAF C;  5TIS C;  5IYC J;  2YPR A;  1R49 A;  1WFX A;  3BG7 A;  4WXC A;  1DGW Y;  4CCL A;  5EF6 A;  1NG6 A;  3DQV C;  1JI8 A;  3K69 A;  5F64 A;  5K7F A;  2VE8 A;  3SHF A;  2QBY A;  3OWT A;  1BI3 A;  1ZK8 A;  5C4J J;  2NVT J;  3SYT A;  5J40 A;  2ZXJ A;  1QU3 A;  1ZLK A;  4KIS A;  2HDD A;  1MMN A;  4EGZ A;  1ZKG A;  3IUO A;  1DQU A;  1BR2 A;  5J1R A;  2XRN A;  4A12 A;  2VBW A;  5E17 F;  2DCE A;  2KL4 A;  2V79 A;  4OAY A;  3EUH C;  2AS5 F;  1RZ4 A;  3S1Q J;  4XRS G;  3QPT A;  1I5Z A;  2IT0 A;  3K0L A;  2JA5 J;  3ISP A;  3Q9V A;  3V7R A;  3DV8 A;  2W7N A;  2NS8 A;  2OA4 A;  3E6D A;  5TJJ A;  1XS9 A;  1U5T A;  1PYV A;  3KPH A;  1KZH A;  3MKZ A;  4CGZ A;  3V8K A;  2E19 A;  4XQF A;  3WE3 A;  3M8F A;  4XK4 A;  3WHC A;  4Y7N J;  5F6F A;  5D4R A;  3HUG A;  3ERE D;  5LD2 C;  4KNY A;  2JSP A;  3K7A J;  3E6B A;  5E3N A;  1SFE A;  2GOX B;  2V26 A;  2VT3 A;  1RNL A;  1HW5 A;  4MIM A;  4GDF A;  3IKT A;  3OS2 A;  2CUF A;  2WWY A;  5K5Q A;  3KP2 A;  4FIS A;  1XGS A;  4LG0 A;  4HA8 A;  3R6S A;  1MDM A;  5ED4 A;  3T8R A;  1YQA A;  3JRA A;  1ZRC A;  3FXM A;  4HX7 A;  4A6D A;  2W00 A;  3RKW A;  1A36 A;  2IVM A;  1AHD P;  3P9I A;  1XB4 A;  3FXR A;  3R0A A;  2MG4 A;  3N4M A;  5E1W A;  4A0X A;  2H6C A;  3RYP A;  4ZYH A;  2HVR A;  3GXO A;  2DOD A;  3F6O A;  3U2R A;  4DNC A;  3C1D A;  2M5W A;  1XMA A;  1IN6 A;  4LLL A;  4DZP A;  1JTY A;  2ETH A;  1X4O A;  5HOD A;  4PUS A;  1BW6 A;  4N9H A;  5FKK A;  3JRI A;  4GFB A;  2L7Z A;  2ZSH B;  1FIA A;  3AG2 H;  2MD0 A;  5DS9 A;  1RET A;  3AG1 H;  1TW2 A;  1MMS A;  4EM2 A;  2OTJ I;  2Y75 A;  3Q9S A;  2VQH A;  1JUP A;  3H9J A;  1G4D A;  2DQR A;  1JT0 A;  4NBQ A;  2OTL I;  5GPC A;  3OL3 A;  1W7P A;  2O5R A;  2QYO A;  4ZZD A;  1A5J A;  1K78 A;  4A3C J;  1F5T A;  4V2F A;  2EFW A;  1EH8 A;  5E3L A;  1Y8R B;  5CLS A;  1YYV A;  5EGO A;  5FKO A;  2KHM A;  1JKQ C;  3QWL A;  3LMM A;  2WAQ A;  1V4R A;  3KP5 A;  4LG3 A;  2K02 A;  4PGH A;  1BC7 C;  1R1V A;  3MZH A;  3CCS I;  2VBX A;  3H0G J;  4Y13 A;  3LSR A;  3NAR A;  2DMN A;  4PZJ A;  3W2W A;  4L0Z B;  3EQL F;  2ACJ A;  2CMP A;  4A2U A;  2ZXI A;  3DKX A;  4ZDO A;  2UXX A;  1FEX A;  4ZDP A;  2X9D A;  5E18 F;  2VKV A;  3HTU A;  1Z7U A;  3NWT A;  4LIV A;  2B63 J;  2XB0 X;  3RQI A;  3ZRG A;  3TQN A;  4UHT A;  2NNN A;  4E70 A;  1FPQ A;  3GTQ J;  1X19 A;  5F0H A;  1B9M A;  5H6R A;  3J81 Z;  2JQ7 A;  2J5P A;  3CO6 C;  1D5V A;  5D5V B;  2ISY A;  2KRC A;  3F6V A;  2RDP A;  3K9T A;  3TDU C;  4ENN A;  3T0Y A;  5FGM A;  4RB1 A;  2YR2 A;  1WI9 A;  1UST A;  2QSF X;  2LNB A;  4CCO A;  5FLX Z;  4WCG A;  2HQA A;  2VIX A;  4C3I J;  2IRF G;  2QGU A;  4IL6 C;  1D8J A;  2HFH A;  1VQK I;  2BE5 F;  3G1L A;  2O8X A;  4HG2 A;  5BNG A;  4Z2Y A;  1FBU A;  2VJI A;  3HHH A;  1LFP A;  4FE4 A;  5ILS A;  2Y9Z A;  3Q0W A;  4LIU A;  3L1P A;  1CF7 B;  2HTJ A;  4XBF A;  1D1B A;  2BYV E;  5HNH A;  1OYI A;  3FHZ A;  1IXR C;  3FHN A;  3S14 J;  1VQN I;  3GFL A;  2OUM A;  2R7S A;  3I0T A;  1R00 A;  2OZ6 A;  3LQQ A;  4BQA A;  2R7Q A;  2ZJP F;  2EIJ H;  5GAD J;  2OC6 A;  2E1M B;  3PFI A;  4ZTJ A;  4HNU A;  2LKS A;  1WRJ A;  3NQO A;  4XR6 A;  3FX3 A;  5C4X J;  3S32 A;  4MFE A;  1YW9 A;  1V3F A;  1OCO H;  5F08 A;  3IRR A;  2Z5U A;  1W0T A;  2PBI A;  2QUF A;  2VQC A;  3OSG A;  2HU9 A;  4L5I A;  2LD5 A;  1IGN A;  3BPV A;  3DF8 A;  4D7N A;  1R71 A;  2FRH A;  1MSF C;  1BI1 A;  5J1U A;  1BJA A;  1WSU A;  4AVZ A;  3S1R J;  2HZD A;  2X6W A;  1T08 B;  2VB6 A;  4U7B A;  1SD5 A;  1W1W E;  3IRQ A;  2E60 A;  1LEB A;  3LST A;  3WG9 A;  3HDD A;  3BJ6 A;  4EMS A;  3QRF F;  4BYY A;  2XAQ A;  3SZP A;  2ZBK A;  1YI2 I;  1EH6 A;  4XLP F;  3GLL A;  4XRF A;  3BP8 A;  3HSR A;  2QWW A;  2ZJQ F;  5ICG A;  5ICE A;  3IH4 A;  1U9O A;  3F8F A;  1FIP A;  1OKR A;  3H3U A;  1XSV A;  1UEL B;  4UXN A;  4G6T B;  3AAF A;  5KHD A;  1R5G A;  4HST A;  2QQA A;  1UHM A;  1S3J A;  1D8K A;  3ZMS A;  1D0Y A;  1HST A;  5D8L B;  4I98 B;  3Q0U A;  4UUT A;  2IW5 A;  1TZL A;  1ETX A;  5E8G A;  5AIP A;  3GO5 A;  3CTA A;  2KP6 A;  3TO9 A;  1MGT A;  3H9Q A;  4JX6 A;  4XL9 A;  1NG7 A;  3N97 A;  2GLO A;  2R92 J;  2KIS A;  3TL4 X;  2LY2 A;  3F9K A;  4LOC A;  5LFA A;  4U7D A;  2MLK A;  1DPR A;  2H1K A;  4YRV A;  3CCE I;  4HF0 A;  4G7H F;  3HRM A;  2X6X A;  3VYR B;  3HRS A;  3DPL C;  2BXZ A;  4FE7 A;  4XKV A;  4OIR F;  3E7L A;  3PO2 J;  4DZJ A;  1GV5 A;  2L9R A;  4ESF A;  4F7Z A;  3MWM A;  1Z21 A;  3B6C A;  5ICC A;  2RNJ A;  3DPT A;  5LGT A;  2I10 A;  3ZQ7 A;  1FTZ A;  2COB A;  4KIG A;  1T95 A;  4KUM A;  4BHP A;  4ON0 A;  3Q5F A;  3EYY A;  1LVA A;  1IDY A;  1MMA A;  4RB3 C;  2KZG A;  3ZMV A;  4B47 A;  2M45 A;  2LF8 A;  3HRU A;  3I4M J;  3BR3 A;  5HS8 A;  3RYR A;  1HDD C;  1PVE A;  3C3W A;  5K7H A;  3JRG A;  2KDZ A;  4L5J A;  2VON A;  1J5Y A;  5BOX A;  1AOY A;  2EIK H;  1WZ2 A;  3M1C A;  5ILU A;  3OIP A;  3BR2 A;  3OR1 C;  4I02 A;  4AIK A;  1T98 A;  3VYU B;  2IP2 A;  1X4P A;  4DGW B;  4P96 A;  4ENK A;  1I3A A;  3V8J A;  4G9Y A;  4KT5 C;  1BBY A;  1P4A A;  1YJN I;  4S0H B;  3BG5 A;  5KVR A;  2HYG D;  4LGW A;  3W6J B;  4E7S A;  1VQ8 I;  1MBJ A;  4BQN A;  3E5X A;  2JTV A;  3E97 A;  2DT5 A;  5FLX K;  2LY9 A;  1SAU A;  3D1N I;  3HJE A;  1WWX A;  5A2Q K;  2V6E A;  1B8I A;  3ZQL A;  2P4W A;  3WTU C;  3MFK A;  1O3Q A;  1MSE C;  2FOK A;  2OV7 A;  4BAY A;  4RLQ A;  4UVC A;  1XGM A;  1CF7 A;  2G0E A;  3G3Z A;  4IXA A;  1IC8 A;  2BHY A;  3WTW C;  4AUX A;  2R5Y B;  1S72 I;  2XF5 A;  4XLE A;  2ZNY A;  3FDY A;  4M9X A;  1DGR M;  5DD8 A;  1Y1W J;  2X48 A;  2K4J A;  4MFD A;  1VQM I;  3ECH A;  3H3Z A;  2F2E A;  3KLO A;  1AKH B;  2M87 A;  5FRO A;  3VWB A;  5DEQ A;  1LKX A;  1QHH D;  1O7L A;  3S3M A;  2LH9 A;  3FXJ A;  3AFH A;  3K2A A;  5L3D A;  3CO7 C;  1H9T A;  2CU7 A;  1G3W A;  3BR6 A;  1JGG A;  1B72 B;  1K61 A;  1W5S A;  5DUI A;  3ZQC A;  1VQO I;  1D1A A;  3B6A A;  3D5L A;  4RMN A;  3TKY A;  2XAH A;  5D5U B;  3OR2 C;  2PMU A;  1ZR4 A;  4J00 A;  2X6Y A;  4C9Y A;  4ZTF A;  1W5T A;  5D8K B;  3BPX A;  4BJ5 C;  2ECC A;  2XSJ C;  1QNT A;  3DTI A;  2R7D A;  3M9A A;  4II2 A;  4MGR A;  2DAO A;  2IAI A;  2K4B A;  3LAJ A;  2L4A A;  3CES A;  1HKS A;  1TT0 A;  2KIQ A;  1TLH B;  3CJN A;  5HS7 A;  4B8X A;  1ZG5 A;  4BL0 B;  4GXO A;  3LSM A;  3LSJ A;  2AXL A;  1SAX A;  2DK8 A;  2W57 A;  4CHU A;  1VQ9 I;  1ETW A;  2DFH A;  4O6J A;  1JE8 A;  1IAW A;  1TQP A;  3G6E I;  2F48 A;  2WAQ N;  1B1B A;  1XTA A;  2DN0 A;  3BZ6 A;  4BY7 J;  5FKL A;  3V8L A;  1U8B A;  1ZHF A;  2XUB A;  4RLF A;  2F4M B;  4WXH A;  4Y4R A;  4L0Y B;  5IP7 J;  3K70 C;  4QWQ A;  3EUA A;  5IP9 J;  2YU9 J;  2XIG A;  2VBY A;  1DU0 A;  1R23 A;  4EJU A;  5BQT A;  4MTD A;  4P9F A;  1W4M A;  1FWZ A;  1G3S A;  3KEO A;  2L5Q A;  5H20 A;  4HLX A;  3U9G A;  2P8T A;  2ZJ2 A;  5HLI A;  2HPM A;  3FM5 A;  3SEZ A;  3O8G A;  4JP0 A;  2JRM A;  3BQZ A;  2ZB9 A;  2JJ7 A;  2NVY J;  2VQG A;  1WJA A;  3ERM A;  3QOE A;  3HHG A;  3ROU A;  2NVQ J;  2RV8 A;  3HIF A;  2LK2 A;  4YFN F;  2B0L A;  2JZY A;  3CLO A;  3ZQH A;  2KMU A;  1ZEL A;  3JAM Z;  1P2F A;  1B9N A;  3AG3 H;  3OV8 A;  1ZG3 A;  4WX9 A;  4PJM A;  3CCR I;  2M1B A;  3S2H J;  1U6G A;  1XDS A;  2RRE A;  3HOS A;  3M8E A;  3BCB A;  4ZC3 A;  1HW1 A;  1U5T B;  3S1N J;  2EFO A;  3OYA A;  3TDZ C;  4IHX A;  3J7A Y;  5F1R A;  2F5C A;  4ITV A;  5J6X A;  2XKP A;  1OMI A;  4W1U A;  5H6Q A;  5E79 C;  2PMH A;  2CQK A;  4EM0 B;  3J7Z I;  5EDN A;  1G8X A;  3TGN A;  3U21 A;  4EGY A;  3CCV I;  3F8B A;  4M73 A;  1J2X A;  3HOX J;  2EFP A;  5CKT A;  5J8F A;  2O9L A;  4LG0 B;  2CQQ A;  5H2F C;  3MZY A;  3TOB A;  4II3 A;  2A07 F;  1DPU A;  4A3M J;  2K85 A;  2ZCW A;  2O0Y A;  4ASN A;  1IRG A;  4WXD A;  5K7Z A;  3W2V A;  1Y0U A;  2OCE A;  2R5Y A;  2M34 A;  2IBD A;  2TCT A;  2MH2 A;  4A3L J;  1BIA A;  1IUF A;  2BY0 A;  2XPV A;  3OYH A;  1J9I A;  1TWC J;  5AIQ A;  3KYD B;  1HC8 A;  1T8I A;  3L2W A;  1R36 A;  1AKH A;  4FHT A;  4IHW A;  1FSE A;  2MFZ A;  3AKZ A;  2W82 A;  2LYC A;  5AON A;  1WVR A;  2L02 A;  3CMM A;  2X4H A;  1AWC A;  2JVH A;  2F4O B;  5GAG J;  5J4Y A;  1B72 A;  2YSR A;  2CV0 A;  3MMY B;  4M6Y A;  1QZE A;  1VF9 A;  3VEP A;  1E2X A;  4M9S A;  3PO3 J;  1NHA A;  4M3B A;  5BMZ A;  3LA7 A;  5M5Y J;  1FYL A;  1IXC A;  2KJC A;  3BWG A;  3V42 A;  3GTL J;  2OD5 A;  1XMK A;  3ZXS A;  2E2I J;  5DYM A;  2QEX I;  5D5X B;  1R6R A;  1ERD A;  3QOD A;  2XC7 A;  1J09 A;  3MVP A;  3BG6 A;  4O5V A;  2WAD A;  4U0V A;  4HNT A;  3M7G A;  4G7Z F;  3QYB A;  3ONQ A;  3WGH A;  1RRJ A;  2ME6 A;  3HTS B;  1E17 A;  2LKX A;  1Y6I A;  4IHV A;  4GRI A;  2QQB A;  1OR7 A;  4HF2 A;  5HOO A;  5HS9 A;  1FMW A;  4HQM A;  5IT9 Z;  5FFZ A;  5CVR A;  5TGT A;  5JI6 A;  2DBB A;  5E1X A;  5LBQ A;  1D0X A;  2E1M C;  2ZSI B;  5IY5 H;  2PMZ A;  2FD5 A;  4RGR A;  1ZG1 A;  3HOY J;  4BHC A;  1G2H A;  1DP7 P;  1I6X A;  3F21 A;  2VKH A;  1S29 A;  5D5W B;  2XF6 A;  1GV2 A;  1OCP A;  3I9V 2;  3LQR A;  5LGN A;  3L2Q A;  2M30 A;  4PK4 A;  1BN5 A;  1O3R A;  1AA7 A;  3PUF A;  3OL4 A;  2PI0 A;  5KCM A;  4ZYG A;  2K3F A;  1H89 C;  2DJN A;  5D6F A;  1ORK A;  3TOA A;  1YJW I;  4I0B A;  3HOU J;  4BBS J;  1P4X A;  2B9S A;  4BJ6 C;  1HA8 A;  4CCJ A;  2DPD A;  2E1C A;  2JUG A;  4BXU A;  2IGK A;  1S6L A;  3DU5 A;  5E1Z B;  5K1Y A;  3QYE A;  3DP7 A;  4IRH A;  2A68 F;  3A0B C;  3OYB A;  2K3P A;  5FB2 A;  2DDB A;  1JGS A;  1OCT C;  4UUV A;  3P9C A;  1D5Y A;  3CJT B;  1Z0X A;  3QPS A;  3QP6 A;  3JAM K;  2FA5 A;  2IPQ X;  2QCO A;  4YG2 F;  2LRD A;  5K5R A;  3CP2 A;  4UUS B;  1XX5 A;  3MCZ A;  3CMA I;  1UAA A;  5FFX A;  4FQG A;  1SD7 A;  4JYK A;  1GXQ A;  5CVU A;  2JMW A;  4PFP A;  1YRN B;  1FBS A;  2V9K A;  3SDB A;  2XGC A;  3A03 A;  3KCC A;  3H92 A;  1VQ4 I;  3JW4 A;  1A35 A;  1WJC A;  1LQ1 A;  2MGQ A;  4NC7 A;  3CF2 A;  4MTE A;  1FC3 A;  1X1B A;  3BJO A;  2JN6 A;  5LRS A;  2OAZ A;  1ETV A;  2H8R A;  2L3D A;  3L2U A;  2BY2 A;  1T38 A;  1SVM A;  4D5F A;  3K4B A;  3M1E A;  1P6R A;  1BI0 A;  3HSF A;  1RPW A;  2WV0 A;  4EAT A;  4K2E A;  1XSD A;  1IN7 A;  5EEA A;  1K7A A;  3K4C A;  2DDA A;  5DM7 F;  1TT5 B;  4PJN A;  1BJZ A;  1FT9 A;  1T56 A;  1Y56 A;  1BL0 A;  3FKJ A;  4GGG A;  2R7O A;  1I39 A;  2LFB A;  3LNQ A;  4HQE A;  4MLO A;  1IV6 A;  3CCY A;  4BAC A;  1JHH A;  5JHF A;  1YJ9 I;  1VQ7 I;  1ZH5 A;  5L3E A;  2DT6 A;  1IN8 A;  4A6E A;  4H0E A;  4AD9 A;  2GAU A;  5CVV A;  1MJ9 A;  1JXS A;  3FIS A;  3KYL A;  4B4C A;  2KRH A;  2M7A A;  3DEU A;  1MNM C;  3H5N A;  4JBA A;  4CO8 A;  3OYM A;  4BDZ A;  3F72 A;  2BHZ A;  4LIT A;  1RKW A;  2E2J J;  3R4K A;  3T5X A;  3JSO A;  2GIV A;  3VYT B;  1YO5 C;  2UWM A;  1TNS A;  4E7Z A;  2K5C A;  1KU7 A;  2KFD A;  3KE2 A;  5DTD A;  4X1E A;  3ZP5 A;  2F6C A;  5HNF A;  1XDU A;  2V1U A;  2MC3 A;  1ZRF A;  2I5U A;  2ZXH A;  3BR1 A;  1K83 J;  4UB8 C;  1OCC H;  2CUZ A;  5E20 A;  3RCO A;  4ZYE A;  3QQA A;  2MA3 A;  2NS7 A;  2X85 A;  3BY6 A;  1JKO C;  4TV7 A;  5HLT A;  3A1Y A;  5DV5 A;  2UZK A;  1R5I D;  3KEQ A;  2OF7 A;  2JUC A;  1OQY A;  3H3V K;  1SMT A;  4OMY A;  4NUB A;  1HKQ A;  3HG9 A;  3IC7 A;  4PJJ A;  2NRA C;  2WBM A;  2YX7 A;  1TWG J;  1K6O A;  3BR0 A;  4LB5 A;  2VJJ A;  2WB1 A;  2VQL A;  3G71 I;  2O03 A;  1R22 A;  4P9U A;  3JRF A;  1YX3 A;  1R7J A;  2EFQ A;  1GDT A;  1ZGW A;  2L9V A;  2WAE A;  2ESH A;  1LVK A;  2XAF A;  2MC4 A;  3RPU A;  4I0A A;  4P55 A;  3V4G A;  4IQ4 A;  2DTZ A;  4EEF G;  4XRM A;  3CMY A;  4PGG A;  4RM3 A;  1ULY A;  2OZU A;  5C3E J;  3ZPL A;  4NQW B;  2K9N A;  4EM1 A;  2ELJ A;  1LE8 B;  3CP8 A;  2PFB A;  4CCN A;  4CDG A;  2BW3 B;  3QOP A;  1O3T A;  5GAE J;  5HDN A;  1WCM J;  2LY1 A;  4JX5 A;  5J1Y A;  5B1B H;  4A3I J;  2OU2 A;  3I3L A;  4HRI A;  3H36 A;  4E6K G;  1SEU A;  1U0J A;  2WTE A;  2HVS A;  1GUU A;  4BXF A;  2Y0S A;  2ZXW H;  3I55 I;  1B8I B;  2ZKZ A;  3BZC A;  3CD6 I;  3GTO J;  3OMY A;  4M3D A;  4FTH A;  4RGX A;  3HYI A;  2P6S A;  1Y1V J;  3LFU A;  5TRD A;  1N77 A;  4ENM A;  4CCK A;  1KA8 A;  2KIM A;  1I27 A;  4A5N A;  2Z16 A;  3K4N A;  1UMQ A;  4XSZ F;  3WU0 A;  1FJL A;  4UUS A;  1KQ0 A;  1H88 C;  4BKX A;  5E3M A;  4BE2 A;  1O57 A;  1GT0 C;  2E7W A;  3FF5 A;  1IO2 A;  1FY7 A;  4ANJ A;  2CYY A;  5JVT A;  3PNY A;  3FZV A;  1YRN A;  4PSW A;  2H8W A;  1QHG A;  1YW8 A;  3JRE A;  2AXT C;  1EJ9 A;  3GTK J;  2X1E A;  2LLK A;  3L2V A;  4B43 A;  2V7F A;  3I56 I;  3L2C A;  4LFU A;  4X6A J;  3R60 A;  5EYR A;  4AIJ A;  4F3Q A;  1LNW A;  1LJ9 A;  1S9H A;  2FSW A;  1BOA A;  3CQZ J;  3FBI B;  5FKN A;  2WY7 Q;  1VQ5 I;  1SMY F;  2HNH A;  3L2R A;  4L18 B;  1IN4 A;  2PN6 A;  1OCR H;  1Z6R A;  5GPA A;  3OS1 A;  3H5R A;  2FBI A;  2OQR A;  2BVL A;  2K9M A;  2D1H A;  2M7B A;  2R7Z J;  1Q1V A;  1OYW A;  4GCV A;  3LA3 A;  2WY8 Q;  2LBF A;  4NB5 A;  3FMR A;  3KIO A;  2L2O A;  4AM3 A;  4YFX F;  4EJT A;  4BUP A;  4ZZL A;  3LFK A;  4Y52 J;  3L9F A;  1U5T C;  2QKL B;  1IRZ A;  2Q1Z B;  4XRS A;  3KYC B;  4WWC A;  4WF2 A;  1TQM A;  2COM A;  4E7L A;  1N25 A;  3WTY C;  4Q5S F;  3BCA A;  1W5C C;  2CW0 F;  1T33 A;  2HKX A;  1K4T A;  1REP C;  4QPO A;  2EH3 A;  1BM9 A;  2DOA A;  3I4P A;  3K10 A;  1POG A;  1YOV B;  2TDX A;  1LPQ A;  4ENJ A;  3WOD F;  3S93 A;  1BA5 A;  3EYI A;  3PJR A;  4G6D A;  1Z3X A;  4KT6 A;  4M6V A;  2PMZ N;  3HEF A;  3CLQ A;  1HDP A;  3CCL I;  1Y39 A;  1MMD A;  3S1M J;  1OCZ H;  1IDZ A;  1TQI A;  4DYC A;  4EJO A;  4F91 B;  2D1V A;  3ZMD A;  4UB6 C;  2V4J C;  3HB9 A;  1X3U A;  4A3B J;  2IXS A;  4IOC F;  1I50 J;  3TBI A;  5IPA A;  3TMO A;  4M9Z A; 
#chains in the Genus database with same CATH homology
 3G1O A;  5IP9 J;  4I76 A;  4L5E A;  2YU9 J;  3S17 J;  1DU0 A;  2E1O A;  1LFU P;  3SFI A;  4DYQ A;  1P7J A;  5GP9 A;  2JK3 A;  2AHQ A;  4A69 C;  1IJW C;  1H8A C;  1VND A;  3WHB A;  3O8G A;  4JP0 A;  1LFB A;  3BQZ A;  3ZQF A;  2ZB9 A;  2JJ7 A;  2NVY J;  2HXO A;  2RAE A;  2JA8 J;  2HOA A;  5IYC J;  1LE8 A;  2NVQ J;  1A6I A;  2LK2 A;  5EF6 A;  2N8G A;  2MW8 A;  1ETQ A;  3ZQH A;  2OPT A;  5K7F A;  2AO9 A;  5C44 J;  1VI0 A;  2NVT J;  1ZK8 A;  5C4J J;  3S2H J;  2M8G X;  2M9H A;  1DU6 A;  3RZO J;  4AYB N;  5IOZ A;  2HDD A;  1ITY A;  1ZKG A;  3S1N J;  3BTC A;  3BTJ A;  5J1R A;  4IHX A;  3S15 J;  3ZOB A;  3S1Q J;  5IP6 A;  3IH3 A;  1ZR2 A;  4XRS G;  4W1U A;  4M3G A;  2JA5 J;  1ETY A;  5M3F J;  2NS8 A;  2XSD C;  1XS9 A;  5EDN A;  1MH3 A;  2DA3 A;  2ECB A;  2E19 A;  1NK2 P;  3HOX J;  4XK4 A;  3WHC A;  4Y7N J;  3TED A;  2DA7 A;  2O9L A;  2CQQ A;  3K7A J;  5E3N A;  2DMP A;  4CYC B;  1U78 A;  4MIM A;  1WGX A;  4A3M J;  2TRT A;  4BBR J;  4A3E J;  2CUF A;  5K7Z A;  4QIW N;  5M5X J;  2R5Y A;  2M34 A;  3W6V A;  2IBD A;  2TCT A;  4A3L J;  4FIS A;  3LSG A;  3OSF A;  1IUF A;  1X2M A;  2XPV A;  1TWC J;  3HM5 A;  4CYC A;  3DCF A;  4NDL A;  2E2H J;  3JRA A;  1AKH A;  4IHW A;  1MBK A;  4FCY A;  1AHD P;  2MG4 A;  4A3J J;  1B72 A;  4ABZ A;  1VF9 A;  3PO3 J;  4M3B A;  5M5Y J;  4D7M A;  4DZP A;  1JTY A;  2O8K A;  3GTL J;  2K9S A;  2E2I J;  5HOD A;  2R0Q C;  5FKK A;  1BW6 A;  3JRI A;  4GFB A;  2M0C A;  2L7Z A;  2DA5 A;  3RZD J;  1FIA A;  2DA2 A;  1OJL A;  2CRG A;  3MVP A;  5DS9 A;  1HF0 A;  1RET A;  5F0F A;  2XGD A;  3JRH A;  4C2M J;  5JLX A;  2ME6 A;  2VKE A;  5JLW A;  2ID3 A;  3A01 A;  1JUP A;  2LKX A;  1P7I A;  3FKI J;  1JT0 A;  4IHV A;  5GPC A;  3LSP A;  1I3Q J;  2GM4 A;  2Y2Z A;  1A5J A;  2EZL A;  2JA7 J;  4A3C J;  1W0U A;  4V2F A;  4A3F J;  2WB1 N;  5E3L A;  4AC0 A;  1QVT A;  3BT9 A;  5FKO A;  1XC5 A;  1Z77 A;  3ZQI A;  5EGO A;  4RDU A;  1CQT A;  1OFC X;  1JKQ C;  2FD5 A;  1WH5 A;  3HOY J;  1G2H A;  2L0K A;  3LOC A;  3BG3 A;  2ELK A;  1GV2 A;  1OCP A;  2HI3 A;  3VPR A;  2HQ5 A;  1HCR A;  2FQ4 A;  2NVX J;  3H0G J;  3LSR A;  2EZK A;  2VUM J;  3NAR A;  2DMN A;  3TP0 A;  1H89 C;  1FEX A;  1FTT A;  2DJN A;  3HOU J;  1ORK A;  4BBS J;  2FX0 A;  2ME0 A;  2X9D A;  1TWF J;  2VKV A;  1TC3 C;  2DA1 A;  2B63 J;  2XB0 X;  3RQI A;  3HGG A;  5FLM J;  3BG9 A;  2EQR A;  3GTQ J;  3TW7 A;  5F0H A;  2Y9Y A;  1NTC A;  3SDG A;  1F36 A;  2Y0S N;  3GTM J;  1OCT C;  1D5Y A;  3HKZ N;  2EBI A;  1Z0X A;  3QPS A;  1PUF B;  4C3I J;  2QCO A;  3O8H A;  1EF4 A;  4UUS B;  3G1L A;  5BNG A;  1QPI A;  2W48 A;  4J19 A;  4FE4 A;  2Y9Z A;  4JYK A;  3Q0W A;  2JMW A;  1TWH J;  4HNV A;  1JT6 A;  1YRN B;  5F04 A;  4B1R A;  3L1P A;  1O4X A;  2XGC A;  1ETK A;  3A03 A;  2R5Z B;  5FKM A;  2MGQ A;  2HOS A;  3S14 J;  4JX4 A;  2JN6 A;  5M3M J;  3IH2 A;  1ETV A;  1MBF A;  3GTG J;  3DEW A;  2H8R A;  1S7E A;  2EZH A;  4D5F A;  1RPW A;  3BTI A;  5C4X J;  5EEA A;  4MFE A;  5F08 A;  1MBE A;  1QVU A;  3TW6 A;  5IYD J;  4XIC A;  1W0T A;  2R93 J;  3OSG A;  1IGN A;  1BJZ A;  2LD5 A;  1T56 A;  1BL0 A;  5EG0 B;  2JA6 J;  4D7N A;  3BTL A;  2LFB A;  3PM1 A;  3LNQ A;  1MSF C;  2QF7 A;  4MLO A;  5J1U A;  1IV6 A;  3CCY A;  2D5V A;  3M4O J;  3S1R J;  1X2N A;  2K40 A;  3HOV J;  2LR8 A;  2JWT A;  3S16 J;  1MBG A;  1ZTR A;  1JUM A;  3FIS A;  4B4C A;  3HDD A;  1VFC A;  1MNM C;  2K9Q A;  1ZQ3 P;  2YUS A;  3BR5 A;  1RKW A;  2E2J J;  3IV5 A;  3IH4 A;  1U9O A;  1FIP A;  4IEJ A;  2CUE A;  5EZH A;  4M3E A;  2HOT A;  4B3A A;  5DTD A;  3OOU A;  4X1E A;  2M2E A;  1BW5 A;  3BR1 A;  1K83 J;  3Q0U A;  4UUT A;  1F43 A;  1UHS A;  1I6H J;  1ETX A;  3QQA A;  2VI6 A;  2NS7 A;  3HOW J;  1JKO C;  4M3F A;  4JX6 A;  4A93 J;  2L7M P;  2HXI A;  2OF7 A;  2GLO A;  2R92 J;  5EZG A;  4LOC A;  3H3V K;  2H1K A;  2GBY A;  4I6Z A;  4D5C A;  3OIO A;  4G12 A;  1TWG J;  2Y30 A;  3BR0 A;  4DYR A;  4A3G J;  3MKL A;  4FE7 A;  3Q0V A;  2XPU A;  3E7L A;  3PO2 J;  3QPL A;  4DZJ A;  1GV5 A;  2L9R A;  3JRF A;  5IYB J;  2CQX A;  1GDT A;  3JRB A;  1ZGW A;  3B6C A;  2I10 A;  2DTZ A;  1RKT A;  4EEF G;  1JJ8 C;  1FTZ A;  2VPR A;  2COB A;  4XRM A;  3CMY A;  5C3E J;  1U9N A;  1RES A;  2K9N A;  1IDY A;  1LE8 B;  1WH7 A;  3I4M J;  2DA4 A;  3BR3 A;  2DMU A;  1TWA J;  4C3J J;  1JKP C;  5F1J A;  3F0C A;  1HDD C;  1WCM J;  2FJ1 A;  2XGE A;  3FK6 A;  5K7H A;  3JRG A;  2KDZ A;  4JX5 A;  5J1Y A;  1AU7 A;  4A3I J;  3A02 A;  2X6O A;  3JRD A;  3BR2 A;  3G1M A;  1GUU A;  2DA6 A;  4DW6 A;  3GTP J;  1B8I B;  4S0H B;  3BG5 A;  4QSH A;  1X58 A;  4IHY A;  3GTO J;  4M3D A;  4FTH A;  1MBJ A;  1Y1V J;  1PUF A;  2XB5 A;  2MSY A;  2LY9 A;  1XG1 A;  3D1N I;  5FJ8 J;  1HLV A;  1UMQ A;  1FJL A;  4UUS A;  2LTP A;  1H88 C;  4BKX A;  2L7F P;  5E3M A;  3ZQL A;  1B8I A;  1GT0 C;  4RBO A;  1MSE C;  1SAN A;  5E3O A;  5IOY A;  3GTJ J;  1YRN A;  4BY1 J;  2G0E A;  4A3D J;  3JRE A;  4MO7 A;  1IC8 A;  3GTK J;  2R5Z A;  4AUX A;  2LLK A;  3SJM A;  2DMT A;  2R5Y B;  3GBG A;  3JRC A;  4QTR A;  2XRL A;  4W97 A;  4X6A J;  1MH4 A;  3TP3 A;  3HOZ J;  2LVS A;  4A3K J;  5EYR A;  1Y1W J;  2X48 A;  1E3O C;  4MFD A;  3CQZ J;  3BQY A;  5FKN A;  1AKH B;  1APL C;  3K2A A;  3HBL A;  2CU7 A;  5GPA A;  1MBH A;  3BR6 A;  1JGG A;  1B72 B;  2IEK A;  1K61 A;  2ID6 A;  3ZQC A;  4V2G A;  2R7Z J;  2O7O A;  3C2B A;  5EG0 A;  1GVD A;  1Q1V A;  3B6A A;  4XID A;  3HGY A;  2WV1 A;  2NOG A;  3FIW A;  1ZR4 A;  9ANT A;  2Y31 A;  3Q3S A;  1QRY A;  1JTX A;  1ETO A;  1JKR C;  4BXX J;  3MN2 A;  4Y52 J;  2P81 A;  2ECC A;  3RKQ A;  1SFO J;  2DMQ A;  2LP0 A;  1WPK A;  1IRZ A;  1ENH A;  4XRS A;  4C3H J;  3JR9 A;  5FLV A;  2IAI A;  3A01 B;  3UKG A;  2XPW A;  1R9T J;  3S2D J;  1T33 A;  1UG2 A;  3ZQG A;  3CDL A;  3M3Y J;  2EH3 A;  2CJJ A;  2HYJ A;  3LSJ A;  5F0C A;  5F27 A;  1IG7 A;  5J3L A;  1POG A;  1ETW A;  5M5W J;  5EGO B;  1BA5 A;  1NK3 P;  2YS9 A;  4M6V A;  2PMZ N;  3HEF A;  3I4N J;  2EZI A;  1HDP A;  2WAQ N;  2DN0 A;  3S1M J;  4BY7 J;  5FKL A;  3FK7 A;  1IDZ A;  1HOM A;  4DYC A;  1U8B A;  1WI3 A;  2KT0 A;  3HB9 A;  1RR7 A;  4A3B J;  1JJ6 C;  1I50 J;  3NAU A;  5IPA A;  5IP7 J;  1JUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...