1A5JA

Chicken b-myb dna binding domain, repeat 2 and repeat3, nmr, 32 structures
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
GIPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSSWTEEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords B-MYB
publication title Solution structure of the B-Myb DNA-binding domain: a possible role for conformational instability of the protein in DNA binding and control of gene expression.
pubmed doi rcsb
source organism Gallus gallus
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 1998-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1a5jA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1a5jA02
2R5YB 1ZQ3P 1ETVA 4XRSG 2MSYA 2CQXA 1W0UA 2I10A 5F0FA 1Y1WJ 1YRNB 2OF7A 3BR3A 1Q1VA 4ABZA 2DJNA 2FD5A 4MIMA 3SJMA 1JGGA 4UUTA 3H3VK 2XB0X 3GTPJ 3HGYA 2CJJA 3B6CA 3QQAA 1MBGA 4IHVA 5FKNA 4AC0A 3S2DJ 2HOTA 1VF9A 2HI3A 2KDZA 4IHYA 3GTQJ 1DU6A 2ELKA 4A3FJ 5FKOA 3HB9A 1B8IA 1O4XA 2VKEA 3K2AA 5IP9J 3LSPA 2LTPA 4XIDA 1ETOA 1XG1A 1B8IB 1Z0XA 2DA2A 2FJ1A 3BT9A 5GPAA 2LD5A 2IAIA 5M3MJ 4A3MJ 3NARA 3IH4A 5JLXA 2DMQA 3CCYA 3GTLJ 4A3BJ 4BBSJ 3HKZN 1ZR4A 3W6VA 2WV1A 3LSJA 4FTHA 2HOSA 2OPTA 3ZOBA 1AHDP 1GDTA 4I76A 3SDGA 1JUPA 4Y52J 1MH4A 3F0CA 1IJWC 1ETWA 2L7FP 2JK3A 4DYQA 3D1NI 5C4XJ 3OIOA 5F0CA 1NK2P 4X1EA 4A69C 4GFBA 3GTGJ 1TWGJ 2XRLA 4J19A 1P7JA 4JX4A 2X6OA 1HDDC 2XSDC 2JA7J 4FE7A 3BTJA 3B6AA 3IH2A 2E1OA 5E3OA 4W1UA 2G0EA 1GV2A 1XC5A 1MBFA 1GV5A 2EZLA 4W97A 3RQIA 2XGEA 2ECCA 2DA7A 2ME0A 3TP0A 3JRDA 3RZDJ 2JA6J 4UUSA 1ZTRA 1FTZA 5IP6A 2HYJA 4A3EJ 4UUSB 1H8AC 1K83J 4JYKA 3Q0UA 5EYRA 3JRBA 3JRAA 3JRHA 2NS7A 1IDYA 1RKTA 2DA3A 4M6VA 3MVPA 2XPUA 2PMZN 4DYRA 4LOCA 5K7ZA 1CQTA 3GBGA 4A3CJ 1JUSA 4AYBN 4A93J 1OCTC 2XB5A 3GTMJ 2EBIA 2LKXA 5M3FJ 4M3BA 3A01A 1G2HA 1Z77A 3BTLA 3L1PA 3BR0A 5F04A 4D7NA 2CUEA 3UKGA 3A01B 1U8BA 1ZR2A 1HLVA 3S16J 2R5ZA 3TEDA 4QTRA 4A3GJ 3O8HA 4MLOA 1IUFA 2R5ZB 2AHQA 1MSEC 3TW7A 1JKOC 3NAUA 1H88C 4Y7NJ 1IDZA 4DZJA 2O8KA 3S17J 2NS8A 3ZQFA 1I6HJ 4M3FA 3OSGA 1VFCA 5EEAA 1ORKA 3HOXJ 4FCYA 3LOCA 4JX5A 1X2MA 1WPKA 1MH3A 2TRTA 3G1LA 5J1UA 1VNDA 2Y0SN 4BY7J 3S1QJ 4G12A 4A3DJ 2COBA 2RAEA 1ZKGA 4B1RA 2DN0A 5DTDA 1TWFJ 1K61A 1MBKA 3WHCA 1ETKA 4M3EA 3HM5A 3JR9A 2K9NA 1WCMJ 3HEFA 3SFIA 3S1MJ 4IHWA 3CMYA 5EF6A 3A03A 3GTOJ 3ZQGA 3FK7A 1WI3A 3JRCA 4XRMA 3A02A 1BJZA 3IV5A 1IC8A 2YU9J 2N8GA 1JKQC 2LFBA 3FKIJ 3JREA 1HDPA 3CDLA 1QRYA 2JWTA 1JTXA 2M34A 2VKVA 1TC3C 1JUMA 4D7MA 2X9DA 1POGA 1BL0A 2ID6A 1FJLA 2E2IJ 3Q3SA 2QF7A 2HDDA 3ZQCA 5E3MA 4BKXA 1ETQA 2W48A 3S15J 3FISA 2EZIA 1FIPA 3MN2A 1PUFA 3I4NJ 3H0GJ 1GVDA 3S14J 5E3LA 5IOZA 4B4CA 3ZQIA 2M9HA 4M3GA 3S1RJ 4MO7A 1PUFB 1NTCA 1HF0A 1WGXA 1GT0C 5EG0A 2JA8J 2K9SA 4BY1J 2CU7A 4M3DA 4A3KJ 5FLVA 2MW8A 5EDNA 1UG2A 4NDLA 4L5EA 5EG0B 1S7EA 2XGCA 5IYDJ 1WH5A 3BR2A 1T33A 2IEKA 2EZHA 1HCRA 3C2BA 9ANTA 1EF4A 2P81A 3S1NJ 3BQZA 1IV6A 2X48A 2H8RA 2ZB9A 1OJLA 4MFDA 3JRFA 1TWAJ 2JA5J 1WH7A 4V2FA 1OCPA 3TP3A 2R7ZJ 2EQRA 3HOWJ 1JT6A 2JMWA 5GP9A 1TWCJ 1APLC 2NVXJ 3HOVJ 1TWHJ 2LY9A 3LSRA 5J1RA 3OSFA 2D5VA 3BG3A 5C3EJ 2FQ4A 4IHXA 4XRSA 1OFCX 2CUFA 1UMQA 2DMTA 3M4OJ 5FKLA 1SANA 2ME6A 3PO2J 1DU0A 2QCOA 4A3IJ 3PM1A 1RPWA 2XGDA 3BTIA 1B72A 1RESA 2O9LA 3Q0WA 5JLWA 2R93J 3I4MJ 5F0HA 1U9NA 2LVSA 5IPAA 4DW6A 1T56A 4JX6A 1B72B 1JJ8C 4S0HB 1RR7A 1LFUP 3HGGA 4B3AA 3PO3J 3HBLA 5FJ8J 1ZK8A 2JN6A 1P7IA 2Y2ZA 1Y1VJ 4CYCA 5K7FA 1I50J 2XPVA 3LNQA 1IGNA 4EEFG 4XK4A 2TCTA 2Y30A 5C44J 1NK3P 4CYCB 1LFBA 2IBDA 2Y31A 2CRGA 3ZQLA 5FKKA 3Q0VA 4IEJA 5F27A 2YS9A 1FEXA 3QPSA 5EZGA 4DZPA 5J1YA 1ENHA 4A3JJ 1MSFC 1SFOJ 1GUUA 3OOUA 3JRGA 2DTZA 2YUSA 2WAQN 2HOAA 3CQZJ 1FIAA 5E3NA 4JP0A 3QPLA 4AUXA 1ETYA 1JJ6C 1D5YA 3HDDA 3S2HJ 2HQ5A 3HOUJ 4HNVA 2WB1N 2DMPA 1AU7A 2LR8A 1MNMC 3O8GA 2H1KA 2DMNA 3TW6A 2CQQA 1A5JA 1MBEA 3BG5A 3E7LA 3GTKJ 1IRZA 3G1OA 1LE8A 1RKWA 5EGOA 2Y9ZA 2NOGA 5FKMA 1LE8B 1JKPC 5IYBJ 3M3YJ 2Y9YA 1H89C 1F36A 3JRIA 5EGOB 1QPIA 2E2JJ 2E2HJ 1X2NA 3WHBA 5HODA 1VI0A 2VUMJ 2VI6A 1HOMA 1QVUA 3VPRA 4RBOA 1XS9A 5FLMJ 2MGQA 2L7ZA 3BR5A 3K7AJ 2L0KA 1BW6A 5DS9A 1BW5A 1MBHA 5F1JA 4FE4A 2M8GX 5M5YJ 2LLKA 2JJ7A 2GLOA 3IH3A 2DMUA 1FTTA 4XICA 5M5WJ 3HOYJ 3BR1A 2VPRA 2AO9A 4QSHA 1MBJA 2HXIA 5EZHA 2DA5A 3FIWA 3DEWA 2HXOA 3BQYA 2GM4A 1U78A 2K40A 3FK6A 1AKHA 1BA5A 4C3HJ 5F08A 5BNGA 2XPWA 2M0CA 4DYCA 1R9TJ 1AKHB 3RKQA 2R0QC 1ZGWA 3DCFA 4FISA 3RZOJ 1QVTA 2L9RA 2DA4A 2E19A 4QIWN 5IYCJ 1JTYA 2NVTJ 2FX0A 1E3OC 1ETXA 4D5CA 1RETA 2EZKA 3GTJJ 2NVQJ 3BG9A 5C4JJ 1F43A 1UHSA 2GBYA 2O7OA 5J3LA 1W0TA 4V2GA 2DA1A 2MG4A 4C2MJ 2EH3A 2NVYJ 1X58A 2LK2A 1I3QJ 3G1MA 1A6IA 1JKRC 3HOZJ 2K9QA 3MKLA 2ECBA 4X6AJ 2M2EA 3BTCA 2L7MP 4BXXJ 5M5XJ 2DA6A 4BBRJ 5IP7J 4A3LJ 3BR6A 2B63J 1IG7A 4D5FA 5IOYA 4I6ZA 5GPCA 1JT0A 4RDUA 5K7HA 2R5YA 2R92J 4C3JJ 1U9OA 2KT0A 2LP0A 3ZQHA 1ITYA 2ID3A 4C3IJ 3LSGA 1YRNA 4MFEA
chains in the Genus database with same CATH superfamily
1ETVA 3S3OA 2E34A 1FOXA 2OTLI 4FHTA 1XD7A 2GOMA 3KIOA 1SD5A 2CQXA 4XKBA 1T95A 2I10A 4XORA 4CUGA 1YRNB 3HPHA 2O5RA 4PK4A 1S3JA 2E60A 3ZMSA 4A0ZA 3SJMA 3MZHA 1JGGA 2ELHA 1YG2A 2QGUA 2XB0X 1LJ9A 4UY8I 4F7ZA 3M7GA 2E36A 2RN7A 4U87A 3SDBA 3VOEA 3S2DJ 2VQCA 3QOEA 2KDZA 3GTQJ 4IHYA 1U5TB 1IN6A 2F5CA 3C2HA 3KPHA 3E5XA 3LSIA 1G8XA 4A3FJ 1K4TA 1U0JA 1T8IA 2ZSIB 5KHDA 4XLCA 2GXGA 2W85A 2FJ1A 3AG3H 1KU2A 2PFBA 2IAIA 3MKWB 1S7OA 3AAFA 2Z16A 3IH4A 1LUJB 2VB6A 4PFPA 1ZARA 2KZGA 3CCYA 3DBHB 4A3BJ 1XDUA 4F52A 3EQLF 3W6VA 2V4JC 2WV1A 4FTHA 2HOSA 1AHDP 4MHGA 4KIGA 1J5YA 3R4KA 2M0MA 1QU3A 2F5FA 2P6SA 3SEQA 3F22A 1MH4A 2L7FP 2BV6A 2JK3A 4U0WA 1Y0NA 3AFHA 3OIOA 1ZLJA 4BGDA 2CMPA 3BZKA 2HEOA 4HX7A 4A69C 2ICWG 4GFBA 1TWGJ 2OU2A 3LFUA 2Z3YA 2BY3A 1Z3YA 2M4GA 3FHZA 4J19A 4JX4A 4ESBA 3GFLA 3IHUA 1Z1DA 2XSDC 3B6AA 5EEGA 1T6SA 2E1OA 1S6LA 3W3CA 1FNNA 3BDDA 2XV4S 3RPUA 2EWNA 3SZTA 3IL2A 2FNAA 4W97A 3RQIA 4YFKF 3QPHA 2XGEA 4XLEA 1BIAA 2FQ3A 3K70C 1XGNA 5BPIA 1K6OA 4CCJA 3ESWB 3JRDA 2JA6J 2IT0A 1FTZA 2ZJQF 4F91B 5IP6A 4GGGA 1IN5A 5K5OA 2ZMEB 2KMUA 1BR1A 2K5CA 2I8DA 3JRBA 1HW2A 3HUGA 3K70D 4NC8A 3CUQC 2NS7A 4KIFA 1D1CA 4FQGA 1ONVA 2PMZN 2VJ4A 4DYRA 4LOCA 1XSXA 1JUSA 4JK1X 4UXNA 1V54H 5HVQC 5LFAA 2DJIA 3OYNA 1MDMA 1OYWA 4XQFA 3WTUC 1VQKI 3CZ6A 1OCRH 4AWXB 1RI7A 2XB5A 2M30A 2P0WA 2LKXA 3CO6C 1IN7A 3GTMJ 4M3BA 4F92B 4M9ZA 2OV7A 1V4RA 2L3DA 3F8MA 4D7NA 4M72A 2WTEA 4HSRA 5ICGA 4N9HA 1ZR2A 1A36A 2H27A 2RVCA 4B09A 1FLIA 4II2A 2QM3A 3O8HA 1B6AA 5GAHJ 3CLOA 2HVSA 2P8TA 5TISC 1IDZA 3S17J 1D0YA 1B9NA 2K3PA 1XMAA 4GRIA 3HOXJ 4FCYA 1IN8A 3HHHA 2WBMA 1R22A 1X2MA 5E8GA 4UUVA 5K1YA 3G1LA 3VDXA 4YFXF 4BE0A 1F5TA 1UB9A 3H5NA 3CF5F 2Y0SN 4ANJA 3K4BA 4IHTA 3C18A 1MMAA 1T08B 1WJFA 3ZMVA 2F2EA 2LY2A 1YJNI 3WGIA 3ABLH 3BPXA 1FOWA 3WHCA 2M45A 3K1PA 5E18F 1ETKA 1DP3A 1FX7A 1W5SA 3JR9A 3FBIB 1X4OA 1Y0UA 4XM3A 1IRFA 5B3SH 1HSJA 2W00A 3I56I 3L2VA 3OMYA 4BL0B 1KA8A 3GTOJ 1RNLA 4M6YA 4HF0A 3K4CA 4IPAA 4RMNA 3ZMDA 2IS6A 1IN4A 2ELJA 1WJEA 4FX0A 3IV5A 5KK1A 4U7BA 1VQLI 3W2AA 3MAJA 4I09A 1UG0A 4L9TA 1YQAA 2M87A 2M34A 3J81K 3HRMA 3E6BA 1BBYA 1PYVA 2F48A 2X9DA 2B9SA 1LEAA 4HAMA 3BZCA 1H0MA 4E7JA 1E0EA 3KP5A 5E79C 2DFHA 3VWBA 2D45A 2CW7A 2HDDA 2W82A 1YFHA 5E3MA 2Q1ZB 2DU9A 5HDGA 3BPVA 2Z99A 3EYIA 3JTGA 3FM3A 4GO1A 2L2OA 1FIPA 3MN2A 4BS9A 1YYVA 2O3FA 2ZSHB 3KYCB 4YELA 4OIQF 2AQEA 4LLLA 1DGWY 2MABA 3FXMA 4BHCA 1N75A 1S8NA 1HF0A 1WGXA 3KCCA 5D6EA 2ZKZA 3OYLA 4Y3OA 1X3WB 4BY1J 3S2WA 1FY7A 3ABTA 2QQ8A 5FLVA 1PP7U 4DQ2A 4EJWA 4L5EA 1HW5A 3HRUA 3CLQA 2OC6A 2K27A 1R23A 3WTYC 1ON2A 3BR2A 3F72A 3MFKA 5K5RA 2IEKA 3ZMTA 5LHHA 3TKYA 4BDZA 3BZ6A 4NBQA 3CCQI 1IV6A 2BZTA 2X48A 1OJLA 4MFDA 2W24A 1FT9A 2QSFX 2PMHA 5AIQA 2A5YB 5D8LB 3J80K 2JA5J 1WH7A 3TP3A 3B73A 2KL4A 2DOEA 2IA0A 3X2QH 4F55A 2JMWA 5GP9A 1TWCJ 4PJMA 5FB2A 1H9TA 4RAGA 4AIHA 4CCLA 3I58A 3LA7A 5EJCA 4BE2A 3BLYA 3BG3A 5C3EJ 2R7DA 2Y69H 3P5JA 3V7RA 3G73A 4U0VA 4P96A 3MMYB 4MQVA 3WE3A 5J8FA 1W7PB 2G9WA 2V79A 2DYSH 4RB2C 2CW8A 1HKTA 2VC0A 4HOBA 1MD0A 1MJAA 1NH3A 2LDUA 3FXLA 4HF2A 2VQGA 5FKLA 2BXYA 2ME6A 3OYEA 2KHMA 3PO2J 4OU0A 3K4KA 4C2TA 3DPLC 2NOJB 4XLAA 1RPWA 3HC7A 1V3FA 1B72A 3BCAA 2GWRA 2R93J 1U9NA 1KQ0A 2Z2SB 4AVZA 1DP7P 2MC3A 3ASOH 3FXKA 1JJ8C 1XGMA 4NUBA 4RGUA 1R36A 3I5UA 3OYFA 2RV8A 4LB6B 1P7IA 3E6CC 5K7FA 1I50J 3Q9VA 3CCLI 2WAEA 2EFOA 2XDVA 4XK4A 2Y30A 5C44J 1LFBA 2HPMA 4FASD 4G6DA 5FLXZ 1MJBA 2GZWA 2JSPA 1SEUA 3DQVC 2QUFA 4A5NA 3AG2H 3TO7A 3QPSA 2X4HA 4M71A 3L2WA 2QBYA 4Q5SF 2V7FA 2W84A 2TDXA 2WAQN 4BQQA 2VLAA 4JP0A 3WTTC 2KIMA 4AUXA 1D5YA 2L9VA 3REOA 3R0AA 3S2HJ 3HOUJ 3FXQA 2W7NA 3KE2A 2COMA 3V8JA 1L3LA 3TW6A 2CQQA 3MCZA 2OQRA 1VQOI 4HDVA 2KRFA 5FROA 3C7JA 4R8HA 1SVOA 4IOAF 2ACJA 3G1OA 4DBRA 1I27A 4ITVA 3UR3C 2LBFA 4D9JA 5E1XA 3F21A 3I59A 2HDCA 4PDKA 1Z6RA 3QAHA 4DOZA 2JA2A 4HF1A 1JKPC 3CCSI 1OISA 4BAYA 1UELB 3JRIA 4ESFA 4P1WA 1LNWA 2E2HJ 2IS1A 1W5CC 2E1NA 1HQCA 2VI6A 3GF2A 3ABKH 4RS8A 4RBOA 4G94A 1V55H 5TJJA 2Y48A 1BW6A 1MBHA 4NQWB 4EQQA 5M5YJ 4HNTA 4RLQA 5KNLA 5BOXA 3FXJA 1I39A 4I99C 1ODDA 3ABUA 1QPMA 2LF8A 4CICA 4EATA 1P4WA 3BR1A 2VPRA 5B5EC 4QSHA 5J4YA 1X1CA 1MBJA 5HDKA 2VT3A 2ZJ2A 2DODA 5EZHA 2DA5A 4XLNF 2HXOA 1WWXA 4HQEA 2GM4A 3PSIA 4OAZA 2JUCA 3WTSC 1P4AA 5LBQA 3FDYA 2WB1A 1G3YA 1R9TJ 2VN2A 4OOIA 2M1BA 3H9JA 4UVCA 5IT9Z 1O7LA 3F8FA 5L3DA 2L9RA 3GZ5A 4XOPA 4ETSA 5LGNA 2XROA 2ZNZA 2UV1A 4BYYA 2K02A 1JI8A 2DK8A 2FX0A 3KEYA 1RETA 3L2UA 2ZJRF 3GWZA 3C1DA 5JR3A 4OMYA 3CO7C 1UHSA 3K2ZA 1YJ9I 3KZIC 3HKZA 3GLLA 3EDPA 2HOEA 2X1CA 3BG7A 4LMYA 5J3LA 5DCMA 3QU6A 1IV8A 4DBQA 2DQRA 3FXUA 2M3AA 1W0TA 4PSXA 2MH2A 5D6FA 4L9JA 4V19K 2LK2A 1I3QJ 2AQFA 1A6IA 1F9NA 3MQ0A 3F6OA 4XSZF 2K9QA 2ECBA 2V1DA 4YFNF 1QQIA 3K4MA 2L7MP 2M4KA 1MMNA 3GCMA 5CVJA 5M5XJ 2VBWA 4BXXJ 5HS9A 4RB3C 2M7AA 3P7NA 4IOCF 2CH0A 4MEXF 4IQJA 2DOFA 5K7HA 4C3JJ 2KT0A 2LP0A 3ZQHA 2ID3A 4C3IJ 2Q2EA 1E3PA 2HTJA 2CQKA 3GFIA 4L0ZB 5ICEA 5ILVA 1NG6A 4S0HB 3M8JA 1DUXC 3TO9A 4XRSG 4AIJA 1R6RA 1BR4A 4LK1F 1W0UA 1ZHFA 3G71I 2QZ8A 4TV7A 2CFOA 2DJNA 2VJIA 2HQRA 2EB7A 3GTPJ 3CESA 1R7JA 2QKLB 3B6CA 4BU2A 3QQAA 3QYBA 5TRDA 2HOTA 2HI3A 1DU6A 1FBQA 2BY1A 4NNJA 4EJOA 2X1EA 3LSPA 1VZ0A 2LTPA 1USSA 2L9SA 2V9KA 1B8IB 4P9UA 1Z0XA 4XN3A 2D1HA 2H09A 3OYIA 4J00A 3CCRI 5GPAA 3CUQA 3E0JB 4RAZA 1LDDA 3ML6A 1EA3A 2PJRA 1I6XA 3W6JB 4ASNA 1MJ9A 2DT5A 1KU7A 4BBSJ 4IKFA 4GCVA 2EK5A 1ZR4A 4BQAA 3LFKA 5JHUA 3JCUC 2OPTA 1LKXA 1YX5A 3AG4H 4ZZLA 5GTHC 2YX7A 2H6CA 3F0CA 4Y52J 1IJWC 1ETWA 3D1NI 5C4XJ 2EA4A 3AL0C 3I9V2 3WU0A 3V7SA 3D5RC 2JTVA 1YTYA 4O3MA 2A6TA 3DU6A 1JE8A 1TZLA 1R5GA 3K69A 4KN7X 4LLGF 5LHIA 5LEKA 3ZMZA 4BHBA 3OYAA 1FMVA 2X6OA 3E97A 4CCNA 1NG7A 3SEZA 1IF1A 3BTJA 1Z3XA 4W1UA 4LJZF 4FX4A 1GV2A 3I55I 2W57A 3D5LA 3OYDA 2OZUA 2L02A 3HG9A 2R7WA 2X1DA 2QEXI 1R49A 1OR7C 4ZC3A 3D0SA 1GXQA 2BBYA 2CG4A 1WZ2A 2R7UA 4BACA 4ENJA 4PJNA 2VPLA 4AVPA 4KITB 2OBPA 4UUSA 4WXCA 3BWGA 4CXFA 4CH7A 1XCBA 4G7ZF 3JAMK 2XF6A 2I5UA 1ON1A 5D5VB 3TOAA 4A2UA 3EUKL 3HL2A 1KYWA 1WJAA 4Q4ZF 1CF7B 3JRAA 3HTUA 1X3ZB 3JRHA 1WRJA 1RRJA 2ZC2A 1U2WA 3K10A 2XPUA 1CQTA 4A3CJ 1Y39A 2V6EA 2XIGA 1QGPA 3I0TA 5J6XA 4X0GA 1RIOH 3HRTA 3CCMI 4B44A 1G3SA 5M3FJ 2GOXB 1Z77A 1XN7A 3OY9A 2YU3A 3IWZA 3A01B 3MEXA 5D5WB 1V5GA 4PGGA 3S16J 2R5ZA 3PQKA 1U8RA 3L2RA 3KZZA 4A3GJ 1Y56A 3OIQA 1UFMA 2KRCA 4ENNA 2V6CA 1JKOC 3IP4B 1P6RA 2WY7Q 3GLXA 3NAUA 4XMYA 1H88C 4XR6A 4DZJA 1SFEA 2HNHA 4P9FA 5EEAA 4CGZA 1ZH5A 4C2UA 4JX5A 3C2GA 1E2XA 2FUG2 1MGTA 3H9GA 4IJAA 1LVKA 1N25A 1WPKA 4ZDPA 1IUYA 2B0LA 4R79A 1MIJA 2LYCA 2WAFA 3JW4A 5FFZA 2R7SA 3IKTA 1VNDA 1ZAOA 3DTKA 4GYIA 3CC7I 3NWTA 2IRFG 2XVCA 3S1QJ 4G12A 3KEOA 4HV6A 4HV5A 4B1RA 3OOPA 2L7KA 2ZMEC 1MBKA 2J5OA 2LREA 2ZXIA 4UB6C 2R3SA 1FBSA 3OL4A 3R60A 3QODA 1BR2A 2WC2A 1XGOA 2NXNB 3D5SC 4BJTA 1X1DA 3RIRA 5FO5A 3CMEI 4M3EA 2R7QA 2LSOA 1J9IA 2DDBA 5DDGA 3QP5A 3HEFA 3LA3A 3SFIA 1ZG5A 3S1MJ 4IHWA 1K78B 5F6FA 3A03A 3IKVA 5IY5H 1QA6A 3PJRA 3ZQGA 5JVTA 2E5ZA 4B8XA 4XRMA 2FF4A 1IC8A 2YU9J 4A93J 1CGPA 5J40A 2N8GA 1JKQC 1TBXA 3U9GA 1UHWA 1X4PA 5JVGF 1QZEA 1KQ9A 2R7RA 1HDPA 1SC7A 3CDLA 1QRYA 1NHAA 1JTXA 2PQ8A 2VKVA 1SD6A 2K9MA 2XKOA 2E1CA 1WQ2A 2XAQA 4D7MA 2AS5F 1QZYA 4JOMA 4HDUA 2E2IJ 3Q3SA 1OCCH 2QF7A 4KMUX 3OYCA 3M9AA 3NWSA 3ZQCA 2R7OA 1MKMA 4BKXA 1BOBA 1K6YA 3OR2C 3S15J 2IVMA 3LSTA 3HHGA 1PUFA 2AXTC 2DT7B 1XCVA 3K4LA 3H0GJ 1GVDA 1P2FA 4IRHA 3S14J 3JSPA 5IOZA 4B4CA 3ZQIA 3RYPA 3HOSA 5L3CA 2M9HA 4M3GA 3PFIA 4MO7A 1GT0C 3W6KB 5EG0A 2JA8J 2K9SA 3RDIA 3C3WA 4M3DA 4ZTFA 4HLYA 2CV2A 1SVLA 4MQ9F 2EFWA 1ACIA 1BC7C 1UG2A 4NDLA 4WWCA 1S7EA 2VE8A 1Y8RB 4OMZA 3R61A 1A35A 2K7LA 3TGNA 3J81Z 5CVIA 1T33A 2BY0A 3ONQA 3MZYA 3C2BA 4QPOA 1EF4A 1T98A 1WJ5A 3J7AO 1Z6TA 1M1EB 3JRFA 1TWAJ 2ESHA 2OTJI 1TLHB 3F8CA 4E7ZA 2NYXA 3BOQA 3PNVA 1ZN2A 2ZO4A 1LDKB 4LITA 1APLC 3HOVJ 2UUZA 3H3UA 1U6GA 2LY9A 3OSFA 5J1RA 1F1ZA 2FQ4A 2K85A 4LD5A 1B1BA 1FP1D 1TNTA 5ILSA 3FXRA 4BH9A 2HVRA 4HG2A 1OKRA 5BMZA 1UMQA 3OR1C 3M4OJ 1SANA 1DU0A 3FBNB 2CS3A 2QCOA 3L09A 4A0XA 4A3IJ 3I53A 5ERIA 2M7BA 1FYKA 2XGDA 3LQQA 1WKMA 1S72I 2YSRA 1O3TA 2HKOA 1T56A 2ETHA 3VSLA 2QYOA 5B66C 3J80Z 4BQNA 1SD7A 1AWCA 3HGGA 4B3AA 3PO3J 4KIBA 3RSNA 2D1VA 3HBLA 1ZK8A 2JN6A 4KUMA 1L0OC 3H9QA 2EV6A 4N0BA 2XPVA 1D0XA 1MMGA 3K0LA 4O5VA 4EEFG 1I1GA 2RREA 1NK3P 4CYCB 2IBDA 3FM5A 5LRSA 1ZG3A 2X6XA 3ZQLA 2VL8A 3DKYA 4IF4A 5FKKA 1X1AA 2WADA 3Q0VA 5CVRA 4LIUA 5F27A 2YS9A 1FEXA 4LG0A 5J1YA 1D3YA 1ENHA 1MSFC 2OCEA 3OOUA 2L5QA 2YUSA 2CV1A 3WG9A 2OUMA 3RQ4A 5E3NA 3HDDA 4MTEA 3ZXSA 2WB1N 2UXNA 4CA0A 2DMPA 1AU7A 1MNMC 3O8GA 2DMNA 1WFXA 3OS0A 1FP2A 2K4BA 3F23A 3BG5A 1HBXG 2VC1A 4UB8C 1ZRFA 3MKZA 5EGOA 1BI2A 3J7AY 2L4AA 2MH9A 2NOGA 2QENA 4MNUA 4N4OB 2Y9ZA 2IPQX 3LMMA 4FT8A 1EJ9A 5FKMA 1LE8B 5FRNA 3H3ZA 3UNGC 2Y9YA 3A1YA 1R58A 3KLOA 4Y17A 4ZH4F 2E2JJ 2PLYA 2VQHA 2ZNYA 4E7HA 3N4MA 1SMYF 2Y0MA 1W7PD 2H94A 2VUMJ 1UCRA 3S3MA 4XKVA 1C0WA 4Z6YA 1XS9A 4A0YA 3ZRGA 4A12A 3DWLE 4BJ5C 1W1WE 3SFZA 4LFUA 2L7ZA 3BR5A 5DS9A 3L00A 4JBAA 3I71A 4C30A 2V1XA 5E1ZB 3PNYA 2M8GX 2XAJA 4P5OA 5HNHA 4Q47A 4U0YA 2KFDA 2STWA 3IH3A 2DMUA 3PQJA 1Z9CA 2RKHA 4XICA 2GIZA 5LD2C 1EKEA 2VBZA 1HA8A 3WU1B 3BQYA 4ON0A 1IXRC 2IGNA 4RM3A 1BN5A 1AKHA 2X6WA 5BNGA 4FETA 1QZZA 2BW3B 3A2KA 4F93B 4DYCA 2LKPA 2V26A 3BY6A 4CYDA 1ZGWA 3DCFA 2F4OB 4FISA 2XAUA 2B7EA 2DA4A 4M73A 4G6QA 2ZXWH 4E6KG 1JGSA 1IW7F 3DFGA 3DTEA 1ETXA 3ZR8X 4D5CA 2ADUA 2DAOA 2QLZA 2WA0A 3GYHX 3DXJF 3HXLA 4RA2A 1UHMA 2NVQJ 3BG9A 4YIRX 3TO6A 3RI4A 2K9LA 3VYTB 5JHFA 5DUKA 3SZPA 2D2WA 3U21A 4Y15A 3IAM2 2O0YA 2VOPA 1O7FA 2DPDA 2MG4A 5AONA 3DF8A 4C2MJ 2EH3A 2NVYJ 1X58A 2FSWA 4WCGA 4IX7A 3IUOA 2IGOA 3LSKA 1JKRC 3DP7A 4E70A 3MKLA 3T8TA 2M2EA 3BTCA 3ULQB 1KQ8A 4BBRJ 2JVHA 1ERDA 1O57A 2VE9A 5CVVA 1R00A 3BR6A 5BPDA 2B63J 3E5UA 5AIPA 3G3ZA 2XSJC 4RDUA 2R92J 2A61A 1XGSA 4ZYHA 3IRRA 3K1MA 1T38A 2A68F 1X1PA 3VEPA 2GAUA 5D5XB 1O3RA 1PVEA 1YRNA 2R5YB 3TL4X 1ZQ3P 2PI0A 3AG1H 3F8BA 3PSFA 1HC8A 2DDAA 5D4SA 4G6TB 2MSYA 5E8IA 4E7IA 1FYLA 1Y1WJ 2OF7A 1SFUA 2A3SA 2FD5A 4MIMA 4UUTA 1OR7A 3H3VK 2F5DA 1WI9A 1U5TA 2M5WA 4YIIA 4IHVA 5FD6A 3QOPA 1R5HA 4HEA2 1DPRA 1VF9A 2IGKA 3HB9A 3G6EI 2NNNA 2EFPA 1O4XA 1BI1A 3K2AA 5IP9J 1D1BA 5HLGA 4XIDA 1LPQA 3GW2A 2DA2A 2BGCA 4G7HF 1G6NA 2PMZA 3TDZC 2DT6A 2EINH 2LD5A 4A3MJ 3MZ8A 3NARA 1ZGAA 4KT5C 4XLPF 1N77A 4M9SA 2NNYA 4GXOA 1R71A 2BEOA 3H0DA 2DMQA 1W4MA 2FMYA 3ZQ7A 1R5ID 4XSXF 4B3XA 2O8XA 2EIJH 3LSJA 5H6QA 5L3FA 5LLQA 3ZOBA 4AIKA 1FMWA 4I76A 3SDGA 1JUPA 1S5LC 4JQFA 5CQEA 3J7ZI 2VBXA 2VXDA 3V8KA 5IT3A 3BC8A 2V1NA 3P9KA 2IS2A 5F0CA 5DYMA 1NK2P 4X1EA 2V9VA 2STTA 4YEJA 1D0ZA 2H6BA 2O61A 2R7XA 3P9CA 2XRLA 2E71A 3CJRB 4QPQA 1P7JA 2BHZA 4ZYGA 1A04A 1S9HA 1RUOA 1HDDC 4PUSA 4EJUA 3IH2A 1E17A 2W4SA 1MBFA 2CSOA 1N78A 1GV5A 1VQ9I 2EZLA 4II3A 2ESNA 3LL7A 2KQRA 1YOVB 4EV0A 4BE1A 2A5WA 2MBFA 5L3GA 5CVUA 5E1WA 3M1EA 2DA7A 1U3EM 2MD0A 5L3BA 2ME0A 4XL9A 3GXOA 3TP0A 2EV5A 2ZMEA 1TQPA 4I01A 4DNCA 2GA1A 3KZYA 2HYJA 4R1HA 1STZA 4L0YB 1ZG1A 2DQLA 1MNEA 2PJPA 4HLXA 4HSTA 1K83J 4JYKA 3WTVC 1E3HA 2HPIA 1IRGA 5EEHA 4KN4X 1MW7A 4I7HA 3MVPA 3RPQA 2KRHA 2QQAA 1G3WA 3HUGB 2HFHA 5K7ZA 3H5RA 3KX2A 1PP8F 4KT6A 3FXOA 1V5FA 5J47A 4OIPF 1XSVA 2XUBA 1J09A 2EBIA 3G2BA 3U1KA 2XC7A 1MDMB 1G2HA 4L18B 1W36D 3L1PA 2LNBA 5F04A 1XMKA 2MC4A 3CMAI 1U8BA 1HLVA 2KIQA 4YG2F 1IO2A 2Y75A 3GFMA 1RR8C 3MWMA 3VODA 5B1AH 4QTRA 2GQQA 3TEDA 4RB1A 3MD2A 3RKXA 2PBIA 4MLOA 1IUFA 1T0FC 3JAMZ 1TQMA 2AHQA 3SZGA 1MSEC 3ERMA 1VTNC 1VQPI 3A0BC 2LKSA 2O8KA 1I6HJ 4M3FA 3OSGA 1A31A 1VFCA 2FE3A 3S8PA 1FOYA 1ORKA 2QVOA 4HYEA 4IHSA 4PJLA 1G4DA 3LOCA 4BEHA 1RUNA 2QQBA 1FWZA 1MH3A 2TRTA 2FOWA 2QSHX 3O3KA 4M9XA 5J1UA 3HOTA 3CCVI 1Z91A 2EIMH 4Y33A 4PCQA 4A3DJ 2COBA 2RAEA 1ZKGA 4NHJA 5F64A 1TWFJ 3IWFA 4NC6A 4IVNA 5HDNA 2DI3A 4CCMA 1MMDA 2LF7A 3DKWA 2V1UA 3SQNA 1RC9A 3DKXA 1YJWI 4AYBA 3HM5A 4G8XA 2VONA 5L3EA 2CW0F 3ZMUA 3I54A 1WCMJ 4QLCU 3LAJA 3ERED 1I5ZA 3HYIA 2CV0A 2KLOA 1B59A 3EYYA 5HS8A 2HWVA 2XAGA 3OV8A 1D1AA 3FK7A 4E7SA 1WI3A 3A4CA 3JRCA 3GUDA 1BJZA 4UVBA 2ZJPF 3CUOA 5K5QA 4BUPA 2BXZA 3GZNB 3VYSB 2CUJA 1DPUA 2EV0A 3Q9SA 2EFNA 4RAYA 2IW5A 1W5TA 1TC3C 1JUMA 2IP2A 1POGA 5KVRA 1BL0A 2ID6A 1FJLA 1KGSA 3IC7A 3KP2A 4WXHA 4PZJA 1XSDA 1QHHD 1BI3A 2VJ5A 2X51A 3R0JA 3RJPA 5GTIC 1ETQA 2W48A 1X1BA 2OAZA 3FISA 4P55A 4KJZA 1YIJI 2KDOA 2EZIA 3H92A 2LY1A 2NVUB 2HYFA 5FRMA 3DLLF 3G4SI 1R4NB 3S1RJ 1NTCA 1U5TC 2R4GA 2HTSA 2JSCA 5J8CA 4ESJA 2CU7A 4A3KJ 2EILH 5HOOA 3FMSA 2VT2A 1SAXA 4XBFA 2VASA 2XGCA 3VB2A 4B48A 2HZTA 3GO5A 2HDWA 1HCRA 5LGTA 2VKHA 1Y8QB 3VYUB 2LOOA 2WV0A 2BYVE 2P81A 3S1NJ 3BQZA 1MNDA 3SYTA 2ZB9A 2WY8Q 4HQMA 2F6CA 2A05A 2KP6A 5DCFA 2R7ZJ 2IS4A 2EQRA 1Z05A 2LG4A 1JT6A 1BIBA 3OIPA 2YPRA 1TT5B 1W7PA 5CJ9A 4HZFA 4WK8F 3LSRA 4H0EA 2D5VA 3I4PA 4IL6C 1WHUA 1V5EA 3U2RA 3CP8A 2CGPA 4IHXA 4U7DA 3BP8A 4XOTA 2A6HF 3KFWX 2OQGA 1PUEE 3COAC 1UZCA 1TNSA 3HTSB 1B9MA 3ABMH 3KP6A 1IXCA 2E1MB 2E35A 4YIFA 1YO5C 1UAAA 3LQRA 4ZDLA 5DD8A 1RESA 2O9LA 5JLWA 3H35A 4IZZA 2QWWA 1IXSB 1LVAA 1PJRA 3EUAA 2LVSA 1B72B 3HSFA 1RR7A 1J0RA 3FWEA 4S04A 1VQMI 1LFUP 4HA8A 3Q5FA 1LFPA 1XMXA 3TQNA 5FJ8J 3AL0B 2Y2ZA 1TL8A 1FSEA 3LNQA 1Z7LA 1IGNA 4PJJA 3FHNA 1ZLKA 5A2QK 2TCTA 3I3LA 5D5UB 1AOYA 1XX5A 3IRQA 2Y31A 3CJQB 3E6MA 4F3QA 3GFJA 1J2XA 2KJCA 2FOKA 4IEJA 2GA2A 4QWQA 4A3JJ 4OWRB 3ELKA 5JI6A 1SFOJ 3JRGA 2DK5A 1TW2A 1QNTA 4WXDA 1DQUA 2DFFA 3QPLA 1R4MB 4XLFA 3JTHA 1JJ6C 2QBYB 4S05A 1A6QA 4N4NB 3QYFA 4MEYF 4G7OF 3M07A 2NRAC 2E7XA 2BE5F 2ZXHA 2XHKA 2DFEA 4LLNA 4UV9A 1KU9A 5GAGJ 3M8EA 3S93A 3QRFF 2CYYA 3ECOA 2XRNA 5IYBJ 3VFZA 2GXAA 3M3YJ 2LBFB 1H89C 2X6YA 1F36A 3K9TA 1QPIA 1YX3A 3I59B 3V4GA 3L2QA 4PSWA 1ZRCA 1VI0A 5ED4A 3KETA 3CCUI 1HOMA 4RAFA 2DOAA 5DV5A 4NQWA 3CJTB 5FLMJ 4HW0A 3PIPF 1SAUA 3K7AJ 1BW5A 1JXSA 1BI0A 2RNGA 3GEZA 4FE4A 3V7CA 3ROUA 1VQ5I 4MGRA 4CZCA 1FBUA 2JRTA 2GLOA 1MMSA 4IO9F 3WTXC 5E17F 3DV8A 1SVMA 3KP3A 5M5WJ 3HOYJ 1KU3A 1G59A 2VOOA 1BC8C 2AO9A 4WX9A 3CDIA 4LK0F 3V42A 5D8KB 3FIWA 3DEWA 3FK6A 2VBYA 1BA5A 4C3HJ 3DBRB 4L9VA 1AA7A 2P6TA 5LHGA 2MLKA 4D1QA 3KP7A 1X3UA 3RKQA 2R0QC 3DBLB 3FF5A 3T5XA 4B47A 3NEUA 1QVTA 5LGUA 5HNFA 1EH6A 2E19A 5IYCJ 3OL3A 4UV8A 1HW1A 4ZYDA 1E3OC 3F8NA 3HIFA 1LEBA 3TOBA 1Z67A 1BJAA 4L9NA 1Y6IA 4HBLA 3HJEA 4Y4RA 5C4JJ 1P92A 5CLSA 2VXZA 2GBYA 1YW8A 4UVAA 3ZGKA 3KYLA 2O7OA 1XB4A 2JQ7A 2EIKH 4KNYA 1FSHA 2XF7A 4MTDA 1HKQA 2DA1A 3F6VA 3G1MA 5DCMB 4DGWB 2FBIA 4PJ0C 1PDNC 2VJJA 3FMRA 4OIOF 1XDSA 1GHCA 3EUHC 3WU2C 1VQ7I 4A3LJ 1R1VA 3QPTA 5GAEJ 4D5FA 5HLHA 2KKOA 2P4WA 5GPCA 3LA2A 5HLIA 1U9OA 2LMDA 1DDNA 1J59A 4G9YA 1VQ8I 2X85A 3LWFA 2KZVA 1WSUA 2R7FA 5ILUA 2F5EA 5DM7F 4KMFA 2JRMA 2Q2EB 3OYJA 5F0FA 2OD5A 3BR3A 1Q1VA 3RTRA 4ABZA 3CF2A 2P5VA 3KLNA 1GVJA 2CJJA 3HGYA 1R1UA 3H36A 5F1RA 5KAFC 1ZRDA 1MBGA 3BJOA 2XASA 1Z7UA 5FKNA 4AC0A 1QO0D 2HKXA 3HPGA 4AIDA 4BEHB 1I3AA 2ELKA 5FKOA 1B8IA 3MKYB 4DIQA 2VKEA 2EJRA 1ZGJA 5FFXA 1ETOA 1XG1A 1OPCA 3O6BB 4XONA 3BT9A 2XAFA 5M3MJ 3OYKA 4O6JA 5DUIA 2XGXA 3ZQQA 3CUQB 3GVAA 3CDHA 3RKWA 1T39A 4IRIA 5JLXA 3GTLJ 2PJRB 3HKZN 3SHFA 1OCOH 3GMEA 2XF5A 3EETA 1IRXA 1GDTA 4A6DA 2PMUA 4HPQA 2CO5A 2Z5UA 4EJVA 1OYIA 5DD4A 4RGRA 1XPXA 4DYQA 2RGVA 3ZN0A 3JSOA 1K7AA 1EH8A 3GTGJ 1T0FA 2FBHA 1FYMA 2EA2A 1YITI 1GLNA 4I0AA 5CKTA 2PN6A 2FXAA 4EJTA 3OYBA 3PFYA 1LB2A 2KIUA 3DPUA 4FE7A 4EM0B 1K4SA 2JA7J 4OIRF 5E3OA 2Z33A 3O2PE 1T2KA 3ASNH 2G0EA 5E20A 5J4VA 3M8FA 1XC5A 2L01A 1J7KA 4AD9A 4K2EA 2JPCA 2P7CB 4U88A 4HX4A 3RYRA 2RQPA 2IGMA 4OINF 3WGHA 3OYGA 3M1CA 2ZBKA 3CCEI 3B02A 2YX4A 1SMTA 4RLFA 2ECCA 3OYMA 1USTA 4RM2A 3S3NA 3RZDJ 1YW7A 4BQOA 3CJNA 1ZTRA 2X0LA 1VQNI 1P9QC 2JZYA 3WTWC 4A3EJ 1CF7A 2MA3A 2G7UA 3DEEA 2DPUA 4UUSB 2DO7A 1H8AC 1WJDA 3Q0UA 5EYRA 4ZYAA 1VQ4I 3FX3A 5D4RA 4I98B 3CC2I 1IDYA 1RKTA 2DA3A 3NRVA 4M6VA 4NC7A 2VQLA 1KYZA 2L9NA 3K1NA 1BM9A 3FZVA 1REPC 1B4AA 3GBGA 1ZELA 3DEUA 4AYBN 4A5MA 1F4KA 5TGTA 1GXPA 4ZZDA 2UXXA 3A0HC 4LIVA 1OCTC 4GYGA 3PIOF 2E7WA 3A01A 3BTLA 3H5AA 4CZZA 3BR0A 1HSTA 3CP2A 4CO8A 2F4MB 2CUEA 3UKGA 2Z1DA 1VQ6I 4ENKA 4HRIA 5H6RA 2R5ZB 2HS5A 2CQNA 2HZDA 3TW7A 2RC4A 3N97A 1OMIA 1TT0A 3TDUC 1H9GA 2C6YA 5FD5A 2CUZA 2IXSA 2HGCA 5ICFA 4Y7NJ 2IA2A 2NS8A 2FU4A 3ZQFA 5HLTA 2UZKA 4A6EA 4L5JA 4RGXA 3VYRB 4CDGA 3ZPLA 1WVRA 2ZXJA 2CWEA 4BJ6C 4Q48A 4ZDOA 3LSMA 4UNOA 3BG6A 3K4NA 3KP4A 4HNUA 3LSHA 3L7WA 1OQYA 2RNJA 4BDYA 3HSEA 4CSWA 4BY7J 2FEZA 3AKZA 2R7TA 1ZYRF 5KAIC 2DN0A 2Q8KA 4H4KC 5DTDA 2P5LC 1K61A 3WODF 3L2CA 3RPUD 4IXAA 2WWYA 3ZN1A 2AXLA 1YW9A 5CQGA 4CCKA 2FRHA 2OZ6A 4ZJZA 2KPMA 3DU5A 3NQOA 1K78A 3WGGA 3E1SA 2NS0A 2BY2A 2Z9OA 2K9NA 2FNPA 2QQ9A 3CMYA 5EF6A 3BCBA 1FPQA 2BVMA 3H1CA 5KCMA 2KJBA 2A69F 1YS7A 3DTIA 3WE2A 3TMOA 3A02A 1KZHA 2ZFWA 3L9FA 4Y13A 2LFBA 3FKIJ 3OYHA 3JREA 1YE9A 1SFKA 2IJLA 3ZP5A 3ISPA 4NB5A 4PFOA 2JWTA 3CMMA 4ENMA 2QSGX 4I02A 2VKDA 1S7AA 3GX4X 2O03A 3F3XA 4EM1A 4DJAA 4D0PA 5HS7A 2DCEA 3K6GA 5BS6A 4KISA 2Q0OA 1R1TA 4KICA 4IQ4A 1SD4A 2R7VA 3I4NJ 4Z2YA 4YRVA 1YI2I 2Y0SA 1ULYA 5E3LA 2E5NA 4ZTJA 2EPFA 4GDFA 2HQAA 4CCOA 5DM6F 1PUFB 2IA1A 4EVIA 2K4JA 5JFRA 3KYDB 4E7LA 1D5VA 2DTRA 2MW8A 2EFQA 5EDNA 2LRDA 1BOAA 1TP4A 5EG0B 1HXDA 3SXYA 4WF2A 2CFXA 2FMLA 4HX8A 5IYDJ 1WH5A 3W2WA 5GADJ 4EGZA 2EZHA 2W25A 3RKYA 6PAXA 9ANTA 2DFIA 3OWTA 1W36C 2H8RA 3E3VA 3WTZA 2PX9A 1IAWA 4V2FA 3DPTA 1OCPA 4IRGA 1JHHA 1J75A 1X19A 3HOWJ 4EMSA 1OLTA 5B1BH 2ISZA 2NVXJ 2JPBA 1HKSA 1TWHJ 1TTYA 1WJCA 2MFZA 2JVGA 4LB5A 4BXFA 4RB0A 2DBBA 2NAZA 5LRRA 2DW4A 5ICCA 4XRSA 1OFCX 2JT1A 5FLXK 2HVQA 3FKJA 2HQNA 2L54A 2CUFA 2H8WA 3DLAA 2F5VA 3RCOA 2DMTA 2A07F 4B43A 5DEQA 1TW3A 4M74A 1EV7A 2HYGD 1LDJA 4XRFA 3PM1A 2CQ7A 2MLGA 3BTIA 4KA4A 3Q0WA 3I4MJ 2XAHA 2L4MA 5F0HA 1UJ8A 4N9IA 3R6SA 2YR2A 2F4IA 3PL8A 2ZCWA 3TBIA 4DW6A 5H2FC 5IPAA 4EGYA 4JX6A 1ZREA 2OCCH 2FBKA 3IAS2 3QP6A 2DLLA 5CPRB 3ZCOA 4KDPA 3N05A 2KISA 2KIFA 2HR3A 3T0YA 1Y1VJ 4CYCA 2VODA 2JUGA 1FC3A 3ECHA 2FA5A 4KYWA 3OS1A 1D8JA 3HRSA 2CRGA 3F9KA 2DXIA 1D8KA 2PEXA 5EZGA 4DZPA 1OYYA 1SFXA 3GZ6A 1GUUA 2DTZA 4EM2A 3QYEA 3E6DA 3CQZJ 2HOAA 1RZ4A 4LG0B 1FIAA 4J01A 1OCZH 4L5IA 2RQQA 1ETYA 4AU7A 2HQ5A 4HNVA 2V9PA 1EH7A 5LEJA 2HU9A 2H1KA 2UWMA 2LR8A 2ZFUA 4CHUA 2J5PA 2MD5A 1A5JA 1MBEA 3GTKJ 3E7LA 1QHGA 3CTAA 1IRZA 4BXUA 1LE8A 3E5QA 2BVLA 1RKWA 5BQTA 2E1MC 2P7VB 2DYRH 3HZJA 5A2QZ 3T8RA 4XKWA 5EGOB 4BHPA 4XNFA 1YHQI 4XKCA 3V8LA 2H1LA 1I1SA 1X2NA 2W1OA 3CCJI 3WHBA 4XLHA 3WG7H 5HODA 4LGWA 5IT9K 3BJAA 1O3QA 1QVUA 3VPRA 2QA4I 3PUFA 4LG3A 3EUHA 1MZBA 3P9IA 2MGQA 4ZYEA 3BJ6A 4XN0A 3LAPA 1K79A 2L0KA 2G7HA 3CC4I 2BOLA 5F1JA 2LLKA 3T1BA 2JJ7A 2ISYA 3KEQA 2LH9A 1Q1HA 1FTTA 1QBJA 4PGHA 2OJED 5CYVA 1S29A 2HXIA 4KFCA 1YIOA 1LQ1A 2BW3A 4I2OA 4E4HA 1U78A 2K40A 3I64A 1XTAA 2WAQA 5F08A 1P4XA 3VSKA 1TQIA 2XPWA 2XKPA 3PNTA 3QU3A 5FGMA 2M0CA 3FMQA 1IZ1A 1AKHB 3BROA 1JHFA 2BHYA 3RZOJ 3CD6I 4AM3A 2A6EF 4QIWN 1JTYA 2LC2A 2NVTJ 3EPZA 5H20A 1DGRM 3J7YJ 4C9YA 4I0BA 2EZKA 1FOKA 4UHTA 3HSRA 3GTJJ 1F43A 2OA4A 1YS6A 3PUBA 3S32A 1G3TA 2O6GE 2RDPA 4V2GA 4E7KA 2K3FA 4M6XA 3K4JA 1KONA 3HOZJ 3W2VA 1FZPB 4OAYA 1YLFA 4X6AJ 3QWLA 2MYSA 4BNCA 2DA6A 4RGSA 2VIXA 5IP7J 3OS2A 2GXBA 1IG7A 3U1DA 5IOYA 4I6ZA 1Z21A 1WJBA 1O3SA 1JT0A 2K86A 2R5YA 1ITYA 2P5KA 2M8EA 2PG4A 2QKMB 3LSGA 2GIVA 4MFEA
chains in the Genus database with same CATH topology
2R5YB 1ZQ3P 1ETVA 4XRSG 2MSYA 2CQXA 1W0UA 2I10A 5F0FA 1Y1WJ 1YRNB 2OF7A 3BR3A 1Q1VA 4ABZA 2DJNA 2FD5A 4MIMA 3SJMA 1JGGA 4UUTA 3H3VK 2XB0X 3GTPJ 3HGYA 2CJJA 3B6CA 3QQAA 1MBGA 4IHVA 5FKNA 4AC0A 3S2DJ 2HOTA 1VF9A 2HI3A 2KDZA 4IHYA 3GTQJ 1DU6A 2ELKA 4A3FJ 5FKOA 3HB9A 1B8IA 1O4XA 2VKEA 3K2AA 5IP9J 3LSPA 2LTPA 4XIDA 1ETOA 1XG1A 1B8IB 1Z0XA 2DA2A 2FJ1A 3BT9A 5GPAA 2LD5A 2IAIA 5M3MJ 4A3MJ 3NARA 3IH4A 5JLXA 2DMQA 3CCYA 3GTLJ 4A3BJ 4BBSJ 3HKZN 1ZR4A 3W6VA 2WV1A 3LSJA 4FTHA 2HOSA 2OPTA 3ZOBA 1AHDP 1GDTA 4I76A 3SDGA 1JUPA 4Y52J 1MH4A 3F0CA 1IJWC 1ETWA 2L7FP 2JK3A 4DYQA 3D1NI 5C4XJ 3OIOA 5F0CA 1NK2P 4X1EA 4A69C 4GFBA 3GTGJ 1TWGJ 2XRLA 4J19A 1P7JA 4JX4A 2X6OA 1HDDC 2XSDC 2JA7J 4FE7A 3BTJA 3B6AA 3IH2A 2E1OA 5E3OA 4W1UA 2G0EA 1GV2A 1XC5A 1MBFA 1GV5A 2EZLA 4W97A 3RQIA 2XGEA 2ECCA 2DA7A 2ME0A 3TP0A 3JRDA 3RZDJ 2JA6J 4UUSA 1ZTRA 1FTZA 5IP6A 2HYJA 4A3EJ 4UUSB 1H8AC 1K83J 4JYKA 3Q0UA 5EYRA 3JRBA 3JRAA 3JRHA 2NS7A 1IDYA 1RKTA 2DA3A 4M6VA 3MVPA 2XPUA 2PMZN 4DYRA 4LOCA 5K7ZA 1CQTA 3GBGA 4A3CJ 1JUSA 4AYBN 4A93J 1OCTC 2XB5A 3GTMJ 2EBIA 2LKXA 5M3FJ 4M3BA 3A01A 1G2HA 1Z77A 3BTLA 3L1PA 3BR0A 5F04A 4D7NA 2CUEA 3UKGA 3A01B 1U8BA 1ZR2A 1HLVA 3S16J 2R5ZA 3TEDA 4QTRA 4A3GJ 3O8HA 4MLOA 1IUFA 2R5ZB 2AHQA 1MSEC 3TW7A 1JKOC 3NAUA 1H88C 4Y7NJ 1IDZA 4DZJA 2O8KA 3S17J 2NS8A 3ZQFA 1I6HJ 4M3FA 3OSGA 1VFCA 5EEAA 1ORKA 3HOXJ 4FCYA 3LOCA 4JX5A 1X2MA 1WPKA 1MH3A 2TRTA 3G1LA 5J1UA 1VNDA 2Y0SN 4BY7J 3S1QJ 4G12A 4A3DJ 2COBA 2RAEA 1ZKGA 4B1RA 2DN0A 5DTDA 1TWFJ 1K61A 1MBKA 3WHCA 1ETKA 4M3EA 3HM5A 3JR9A 2K9NA 1WCMJ 3HEFA 3SFIA 3S1MJ 4IHWA 3CMYA 5EF6A 3A03A 3GTOJ 3ZQGA 3FK7A 1WI3A 3JRCA 4XRMA 3A02A 1BJZA 3IV5A 1IC8A 2YU9J 2N8GA 1JKQC 2LFBA 3FKIJ 3JREA 1HDPA 3CDLA 1QRYA 2JWTA 1JTXA 2M34A 2VKVA 1TC3C 1JUMA 4D7MA 2X9DA 1POGA 1BL0A 2ID6A 1FJLA 2E2IJ 3Q3SA 2QF7A 2HDDA 3ZQCA 5E3MA 4BKXA 1ETQA 2W48A 3S15J 3FISA 2EZIA 1FIPA 3MN2A 1PUFA 3I4NJ 3H0GJ 1GVDA 3S14J 5E3LA 5IOZA 4B4CA 3ZQIA 2M9HA 4M3GA 3S1RJ 4MO7A 1PUFB 1NTCA 1HF0A 1WGXA 1GT0C 5EG0A 2JA8J 2K9SA 4BY1J 2CU7A 4M3DA 4A3KJ 5FLVA 2MW8A 5EDNA 1UG2A 4NDLA 4L5EA 5EG0B 1S7EA 2XGCA 5IYDJ 1WH5A 3BR2A 1T33A 2IEKA 2EZHA 1HCRA 3C2BA 9ANTA 1EF4A 2P81A 3S1NJ 3BQZA 1IV6A 2X48A 2H8RA 2ZB9A 1OJLA 4MFDA 3JRFA 1TWAJ 2JA5J 1WH7A 4V2FA 1OCPA 3TP3A 2R7ZJ 2EQRA 3HOWJ 1JT6A 2JMWA 5GP9A 1TWCJ 1APLC 2NVXJ 3HOVJ 1TWHJ 2LY9A 3LSRA 5J1RA 3OSFA 2D5VA 3BG3A 5C3EJ 2FQ4A 4IHXA 4XRSA 1OFCX 2CUFA 1UMQA 2DMTA 3M4OJ 5FKLA 1SANA 2ME6A 3PO2J 1DU0A 2QCOA 4A3IJ 3PM1A 1RPWA 2XGDA 3BTIA 1B72A 1RESA 2O9LA 3Q0WA 5JLWA 2R93J 3I4MJ 5F0HA 1U9NA 2LVSA 5IPAA 4DW6A 1T56A 4JX6A 1B72B 1JJ8C 4S0HB 1RR7A 1LFUP 3HGGA 4B3AA 3PO3J 3HBLA 5FJ8J 1ZK8A 2JN6A 1P7IA 2Y2ZA 1Y1VJ 4CYCA 5K7FA 1I50J 2XPVA 3LNQA 1IGNA 4EEFG 4XK4A 2TCTA 2Y30A 5C44J 1NK3P 4CYCB 1LFBA 2IBDA 2Y31A 2CRGA 3ZQLA 5FKKA 3Q0VA 4IEJA 5F27A 2YS9A 1FEXA 3QPSA 5EZGA 4DZPA 5J1YA 1ENHA 4A3JJ 1MSFC 1SFOJ 1GUUA 3OOUA 3JRGA 2DTZA 2YUSA 2WAQN 2HOAA 3CQZJ 1FIAA 5E3NA 4JP0A 3QPLA 4AUXA 1ETYA 1JJ6C 1D5YA 3HDDA 3S2HJ 2HQ5A 3HOUJ 4HNVA 2WB1N 2DMPA 1AU7A 2LR8A 1MNMC 3O8GA 2H1KA 2DMNA 3TW6A 2CQQA 1A5JA 1MBEA 3BG5A 3E7LA 3GTKJ 1IRZA 3G1OA 1LE8A 1RKWA 5EGOA 2Y9ZA 2NOGA 5FKMA 1LE8B 1JKPC 5IYBJ 3M3YJ 2Y9YA 1H89C 1F36A 3JRIA 5EGOB 1QPIA 2E2JJ 2E2HJ 1X2NA 3WHBA 5HODA 1VI0A 2VUMJ 2VI6A 1HOMA 1QVUA 3VPRA 4RBOA 1XS9A 5FLMJ 2MGQA 2L7ZA 3BR5A 3K7AJ 2L0KA 1BW6A 5DS9A 1BW5A 1MBHA 5F1JA 4FE4A 2M8GX 5M5YJ 2LLKA 2JJ7A 2GLOA 3IH3A 2DMUA 1FTTA 4XICA 5M5WJ 3HOYJ 3BR1A 2VPRA 2AO9A 4QSHA 1MBJA 2HXIA 5EZHA 2DA5A 3FIWA 3DEWA 2HXOA 3BQYA 2GM4A 1U78A 2K40A 3FK6A 1AKHA 1BA5A 4C3HJ 5F08A 5BNGA 2XPWA 2M0CA 4DYCA 1R9TJ 1AKHB 3RKQA 2R0QC 1ZGWA 3DCFA 4FISA 3RZOJ 1QVTA 2L9RA 2DA4A 2E19A 4QIWN 5IYCJ 1JTYA 2NVTJ 2FX0A 1E3OC 1ETXA 4D5CA 1RETA 2EZKA 3GTJJ 2NVQJ 3BG9A 5C4JJ 1F43A 1UHSA 2GBYA 2O7OA 5J3LA 1W0TA 4V2GA 2DA1A 2MG4A 4C2MJ 2EH3A 2NVYJ 1X58A 2LK2A 1I3QJ 3G1MA 1A6IA 1JKRC 3HOZJ 2K9QA 3MKLA 2ECBA 4X6AJ 2M2EA 3BTCA 2L7MP 4BXXJ 5M5XJ 2DA6A 4BBRJ 5IP7J 4A3LJ 3BR6A 2B63J 1IG7A 4D5FA 5IOYA 4I6ZA 5GPCA 1JT0A 4RDUA 5K7HA 2R5YA 2R92J 4C3JJ 1U9OA 2KT0A 2LP0A 3ZQHA 1ITYA 2ID3A 4C3IJ 3LSGA 1YRNA 4MFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5Y B;  1ZQ3 P;  1ETV A;  4XRS G;  2MSY A;  2CQX A;  1W0U A;  2I10 A;  5F0F A;  1Y1W J;  1YRN B;  2OF7 A;  3BR3 A;  1Q1V A;  4ABZ A;  2DJN A;  2FD5 A;  4MIM A;  3SJM A;  1JGG A;  4UUT A;  3H3V K;  2XB0 X;  3GTP J;  3HGY A;  2CJJ A;  3B6C A;  3QQA A;  1MBG A;  4IHV A;  5FKN A;  4AC0 A;  3S2D J;  2HOT A;  1VF9 A;  2HI3 A;  2KDZ A;  4IHY A;  3GTQ J;  1DU6 A;  2ELK A;  4A3F J;  5FKO A;  3HB9 A;  1B8I A;  1O4X A;  2VKE A;  3K2A A;  5IP9 J;  3LSP A;  2LTP A;  4XID A;  1ETO A;  1XG1 A;  1B8I B;  1Z0X A;  2DA2 A;  2FJ1 A;  3BT9 A;  5GPA A;  2LD5 A;  2IAI A;  5M3M J;  4A3M J;  3NAR A;  3IH4 A;  5JLX A;  2DMQ A;  3CCY A;  3GTL J;  4A3B J;  4BBS J;  3HKZ N;  1ZR4 A;  3W6V A;  2WV1 A;  3LSJ A;  4FTH A;  2HOS A;  2OPT A;  3ZOB A;  1AHD P;  1GDT A;  4I76 A;  3SDG A;  1JUP A;  4Y52 J;  1MH4 A;  3F0C A;  1IJW C;  1ETW A;  2L7F P;  2JK3 A;  4DYQ A;  3D1N I;  5C4X J;  3OIO A;  5F0C A;  1NK2 P;  4X1E A;  4A69 C;  4GFB A;  3GTG J;  1TWG J;  2XRL A;  4J19 A;  1P7J A;  4JX4 A;  2X6O A;  1HDD C;  2XSD C;  2JA7 J;  4FE7 A;  3BTJ A;  3B6A A;  3IH2 A;  2E1O A;  5E3O A;  4W1U A;  2G0E A;  1GV2 A;  1XC5 A;  1MBF A;  1GV5 A;  2EZL A;  4W97 A;  3RQI A;  2XGE A;  2ECC A;  2DA7 A;  2ME0 A;  3TP0 A;  3JRD A;  3RZD J;  2JA6 J;  4UUS A;  1ZTR A;  1FTZ A;  5IP6 A;  2HYJ A;  4A3E J;  4UUS B;  1H8A C;  1K83 J;  4JYK A;  3Q0U A;  5EYR A;  3JRB A;  3JRA A;  3JRH A;  2NS7 A;  1IDY A;  1RKT A;  2DA3 A;  4M6V A;  3MVP A;  2XPU A;  2PMZ N;  4DYR A;  4LOC A;  5K7Z A;  1CQT A;  3GBG A;  4A3C J;  1JUS A;  4AYB N;  4A93 J;  1OCT C;  2XB5 A;  3GTM J;  2EBI A;  2LKX A;  5M3F J;  4M3B A;  3A01 A;  1G2H A;  1Z77 A;  3BTL A;  3L1P A;  3BR0 A;  5F04 A;  4D7N A;  2CUE A;  3UKG A;  3A01 B;  1U8B A;  1ZR2 A;  1HLV A;  3S16 J;  2R5Z A;  3TED A;  4QTR A;  4A3G J;  3O8H A;  4MLO A;  1IUF A;  2R5Z B;  2AHQ A;  1MSE C;  3TW7 A;  1JKO C;  3NAU A;  1H88 C;  4Y7N J;  1IDZ A;  4DZJ A;  2O8K A;  3S17 J;  2NS8 A;  3ZQF A;  1I6H J;  4M3F A;  3OSG A;  1VFC A;  5EEA A;  1ORK A;  3HOX J;  4FCY A;  3LOC A;  4JX5 A;  1X2M A;  1WPK A;  1MH3 A;  2TRT A;  3G1L A;  5J1U A;  1VND A;  2Y0S N;  4BY7 J;  3S1Q J;  4G12 A;  4A3D J;  2COB A;  2RAE A;  1ZKG A;  4B1R A;  2DN0 A;  5DTD A;  1TWF J;  1K61 A;  1MBK A;  3WHC A;  1ETK A;  4M3E A;  3HM5 A;  3JR9 A;  2K9N A;  1WCM J;  3HEF A;  3SFI A;  3S1M J;  4IHW A;  3CMY A;  5EF6 A;  3A03 A;  3GTO J;  3ZQG A;  3FK7 A;  1WI3 A;  3JRC A;  4XRM A;  3A02 A;  1BJZ A;  3IV5 A;  1IC8 A;  2YU9 J;  2N8G A;  1JKQ C;  2LFB A;  3FKI J;  3JRE A;  1HDP A;  3CDL A;  1QRY A;  2JWT A;  1JTX A;  2M34 A;  2VKV A;  1TC3 C;  1JUM A;  4D7M A;  2X9D A;  1POG A;  1BL0 A;  2ID6 A;  1FJL A;  2E2I J;  3Q3S A;  2QF7 A;  2HDD A;  3ZQC A;  5E3M A;  4BKX A;  1ETQ A;  2W48 A;  3S15 J;  3FIS A;  2EZI A;  1FIP A;  3MN2 A;  1PUF A;  3I4N J;  3H0G J;  1GVD A;  3S14 J;  5E3L A;  5IOZ A;  4B4C A;  3ZQI A;  2M9H A;  4M3G A;  3S1R J;  4MO7 A;  1PUF B;  1NTC A;  1HF0 A;  1WGX A;  1GT0 C;  5EG0 A;  2JA8 J;  2K9S A;  4BY1 J;  2CU7 A;  4M3D A;  4A3K J;  5FLV A;  2MW8 A;  5EDN A;  1UG2 A;  4NDL A;  4L5E A;  5EG0 B;  1S7E A;  2XGC A;  5IYD J;  1WH5 A;  3BR2 A;  1T33 A;  2IEK A;  2EZH A;  1HCR A;  3C2B A;  9ANT A;  1EF4 A;  2P81 A;  3S1N J;  3BQZ A;  1IV6 A;  2X48 A;  2H8R A;  2ZB9 A;  1OJL A;  4MFD A;  3JRF A;  1TWA J;  2JA5 J;  1WH7 A;  4V2F A;  1OCP A;  3TP3 A;  2R7Z J;  2EQR A;  3HOW J;  1JT6 A;  2JMW A;  5GP9 A;  1TWC J;  1APL C;  2NVX J;  3HOV J;  1TWH J;  2LY9 A;  3LSR A;  5J1R A;  3OSF A;  2D5V A;  3BG3 A;  5C3E J;  2FQ4 A;  4IHX A;  4XRS A;  1OFC X;  2CUF A;  1UMQ A;  2DMT A;  3M4O J;  5FKL A;  1SAN A;  2ME6 A;  3PO2 J;  1DU0 A;  2QCO A;  4A3I J;  3PM1 A;  1RPW A;  2XGD A;  3BTI A;  1B72 A;  1RES A;  2O9L A;  3Q0W A;  5JLW A;  2R93 J;  3I4M J;  5F0H A;  1U9N A;  2LVS A;  5IPA A;  4DW6 A;  1T56 A;  4JX6 A;  1B72 B;  1JJ8 C;  4S0H B;  1RR7 A;  1LFU P;  3HGG A;  4B3A A;  3PO3 J;  3HBL A;  5FJ8 J;  1ZK8 A;  2JN6 A;  1P7I A;  2Y2Z A;  1Y1V J;  4CYC A;  5K7F A;  1I50 J;  2XPV A;  3LNQ A;  1IGN A;  4EEF G;  4XK4 A;  2TCT A;  2Y30 A;  5C44 J;  1NK3 P;  4CYC B;  1LFB A;  2IBD A;  2Y31 A;  2CRG A;  3ZQL A;  5FKK A;  3Q0V A;  4IEJ A;  5F27 A;  2YS9 A;  1FEX A;  3QPS A;  5EZG A;  4DZP A;  5J1Y A;  1ENH A;  4A3J J;  1MSF C;  1SFO J;  1GUU A;  3OOU A;  3JRG A;  2DTZ A;  2YUS A;  2WAQ N;  2HOA A;  3CQZ J;  1FIA A;  5E3N A;  4JP0 A;  3QPL A;  4AUX A;  1ETY A;  1JJ6 C;  1D5Y A;  3HDD A;  3S2H J;  2HQ5 A;  3HOU J;  4HNV A;  2WB1 N;  2DMP A;  1AU7 A;  2LR8 A;  1MNM C;  3O8G A;  2H1K A;  2DMN A;  3TW6 A;  2CQQ A;  1A5J A;  1MBE A;  3BG5 A;  3E7L A;  3GTK J;  1IRZ A;  3G1O A;  1LE8 A;  1RKW A;  5EGO A;  2Y9Z A;  2NOG A;  5FKM A;  1LE8 B;  1JKP C;  5IYB J;  3M3Y J;  2Y9Y A;  1H89 C;  1F36 A;  3JRI A;  5EGO B;  1QPI A;  2E2J J;  2E2H J;  1X2N A;  3WHB A;  5HOD A;  1VI0 A;  2VUM J;  2VI6 A;  1HOM A;  1QVU A;  3VPR A;  4RBO A;  1XS9 A;  5FLM J;  2MGQ A;  2L7Z A;  3BR5 A;  3K7A J;  2L0K A;  1BW6 A;  5DS9 A;  1BW5 A;  1MBH A;  5F1J A;  4FE4 A;  2M8G X;  5M5Y J;  2LLK A;  2JJ7 A;  2GLO A;  3IH3 A;  2DMU A;  1FTT A;  4XIC A;  5M5W J;  3HOY J;  3BR1 A;  2VPR A;  2AO9 A;  4QSH A;  1MBJ A;  2HXI A;  5EZH A;  2DA5 A;  3FIW A;  3DEW A;  2HXO A;  3BQY A;  2GM4 A;  1U78 A;  2K40 A;  3FK6 A;  1AKH A;  1BA5 A;  4C3H J;  5F08 A;  5BNG A;  2XPW A;  2M0C A;  4DYC A;  1R9T J;  1AKH B;  3RKQ A;  2R0Q C;  1ZGW A;  3DCF A;  4FIS A;  3RZO J;  1QVT A;  2L9R A;  2DA4 A;  2E19 A;  4QIW N;  5IYC J;  1JTY A;  2NVT J;  2FX0 A;  1E3O C;  1ETX A;  4D5C A;  1RET A;  2EZK A;  3GTJ J;  2NVQ J;  3BG9 A;  5C4J J;  1F43 A;  1UHS A;  2GBY A;  2O7O A;  5J3L A;  1W0T A;  4V2G A;  2DA1 A;  2MG4 A;  4C2M J;  2EH3 A;  2NVY J;  1X58 A;  2LK2 A;  1I3Q J;  3G1M A;  1A6I A;  1JKR C;  3HOZ J;  2K9Q A;  3MKL A;  2ECB A;  4X6A J;  2M2E A;  3BTC A;  2L7M P;  4BXX J;  5M5X J;  2DA6 A;  4BBR J;  5IP7 J;  4A3L J;  3BR6 A;  2B63 J;  1IG7 A;  4D5F A;  5IOY A;  4I6Z A;  5GPC A;  1JT0 A;  4RDU A;  5K7H A;  2R5Y A;  2R92 J;  4C3J J;  1U9O A;  2KT0 A;  2LP0 A;  3ZQH A;  1ITY A;  2ID3 A;  4C3I J;  3LSG A;  1YRN A;  4MFE A; 
#chains in the Genus database with same CATH topology
 1ETV A;  3S3O A;  2E34 A;  1FOX A;  2OTL I;  4FHT A;  1XD7 A;  2GOM A;  3KIO A;  1SD5 A;  2CQX A;  4XKB A;  1T95 A;  2I10 A;  4XOR A;  4CUG A;  1YRN B;  3HPH A;  2O5R A;  4PK4 A;  1S3J A;  2E60 A;  3ZMS A;  4A0Z A;  3SJM A;  3MZH A;  1JGG A;  2ELH A;  1YG2 A;  2QGU A;  2XB0 X;  1LJ9 A;  4UY8 I;  4F7Z A;  3M7G A;  2E36 A;  2RN7 A;  4U87 A;  3SDB A;  3VOE A;  3S2D J;  2VQC A;  3QOE A;  2KDZ A;  3GTQ J;  4IHY A;  1U5T B;  1IN6 A;  2F5C A;  3C2H A;  3KPH A;  3E5X A;  3LSI A;  1G8X A;  4A3F J;  1K4T A;  1U0J A;  1T8I A;  2ZSI B;  5KHD A;  4XLC A;  2GXG A;  2W85 A;  2FJ1 A;  3AG3 H;  1KU2 A;  2PFB A;  2IAI A;  3MKW B;  1S7O A;  3AAF A;  2Z16 A;  3IH4 A;  1LUJ B;  2VB6 A;  4PFP A;  1ZAR A;  2KZG A;  3CCY A;  3DBH B;  4A3B J;  1XDU A;  4F52 A;  3EQL F;  3W6V A;  2V4J C;  2WV1 A;  4FTH A;  2HOS A;  1AHD P;  4MHG A;  4KIG A;  1J5Y A;  3R4K A;  2M0M A;  1QU3 A;  2F5F A;  2P6S A;  3SEQ A;  3F22 A;  1MH4 A;  2L7F P;  2BV6 A;  2JK3 A;  4U0W A;  1Y0N A;  3AFH A;  3OIO A;  1ZLJ A;  4BGD A;  2CMP A;  3BZK A;  2HEO A;  4HX7 A;  4A69 C;  2ICW G;  4GFB A;  1TWG J;  2OU2 A;  3LFU A;  2Z3Y A;  2BY3 A;  1Z3Y A;  2M4G A;  3FHZ A;  4J19 A;  4JX4 A;  4ESB A;  3GFL A;  3IHU A;  1Z1D A;  2XSD C;  3B6A A;  5EEG A;  1T6S A;  2E1O A;  1S6L A;  3W3C A;  1FNN A;  3BDD A;  2XV4 S;  3RPU A;  2EWN A;  3SZT A;  3IL2 A;  2FNA A;  4W97 A;  3RQI A;  4YFK F;  3QPH A;  2XGE A;  4XLE A;  1BIA A;  2FQ3 A;  3K70 C;  1XGN A;  5BPI A;  1K6O A;  4CCJ A;  3ESW B;  3JRD A;  2JA6 J;  2IT0 A;  1FTZ A;  2ZJQ F;  4F91 B;  5IP6 A;  4GGG A;  1IN5 A;  5K5O A;  2ZME B;  2KMU A;  1BR1 A;  2K5C A;  2I8D A;  3JRB A;  1HW2 A;  3HUG A;  3K70 D;  4NC8 A;  3CUQ C;  2NS7 A;  4KIF A;  1D1C A;  4FQG A;  1ONV A;  2PMZ N;  2VJ4 A;  4DYR A;  4LOC A;  1XSX A;  1JUS A;  4JK1 X;  4UXN A;  1V54 H;  5HVQ C;  5LFA A;  2DJI A;  3OYN A;  1MDM A;  1OYW A;  4XQF A;  3WTU C;  1VQK I;  3CZ6 A;  1OCR H;  4AWX B;  1RI7 A;  2XB5 A;  2M30 A;  2P0W A;  2LKX A;  3CO6 C;  1IN7 A;  3GTM J;  4M3B A;  4F92 B;  4M9Z A;  2OV7 A;  1V4R A;  2L3D A;  3F8M A;  4D7N A;  4M72 A;  2WTE A;  4HSR A;  5ICG A;  4N9H A;  1ZR2 A;  1A36 A;  2H27 A;  2RVC A;  4B09 A;  1FLI A;  4II2 A;  2QM3 A;  3O8H A;  1B6A A;  5GAH J;  3CLO A;  2HVS A;  2P8T A;  5TIS C;  1IDZ A;  3S17 J;  1D0Y A;  1B9N A;  2K3P A;  1XMA A;  4GRI A;  3HOX J;  4FCY A;  1IN8 A;  3HHH A;  2WBM A;  1R22 A;  1X2M A;  5E8G A;  4UUV A;  5K1Y A;  3G1L A;  3VDX A;  4YFX F;  4BE0 A;  1F5T A;  1UB9 A;  3H5N A;  3CF5 F;  2Y0S N;  4ANJ A;  3K4B A;  4IHT A;  3C18 A;  1MMA A;  1T08 B;  1WJF A;  3ZMV A;  2F2E A;  2LY2 A;  1YJN I;  3WGI A;  3ABL H;  3BPX A;  1FOW A;  3WHC A;  2M45 A;  3K1P A;  5E18 F;  1ETK A;  1DP3 A;  1FX7 A;  1W5S A;  3JR9 A;  3FBI B;  1X4O A;  1Y0U A;  4XM3 A;  1IRF A;  5B3S H;  1HSJ A;  2W00 A;  3I56 I;  3L2V A;  3OMY A;  4BL0 B;  1KA8 A;  3GTO J;  1RNL A;  4M6Y A;  4HF0 A;  3K4C A;  4IPA A;  4RMN A;  3ZMD A;  2IS6 A;  1IN4 A;  2ELJ A;  1WJE A;  4FX0 A;  3IV5 A;  5KK1 A;  4U7B A;  1VQL I;  3W2A A;  3MAJ A;  4I09 A;  1UG0 A;  4L9T A;  1YQA A;  2M87 A;  2M34 A;  3J81 K;  3HRM A;  3E6B A;  1BBY A;  1PYV A;  2F48 A;  2X9D A;  2B9S A;  1LEA A;  4HAM A;  3BZC A;  1H0M A;  4E7J A;  1E0E A;  3KP5 A;  5E79 C;  2DFH A;  3VWB A;  2D45 A;  2CW7 A;  2HDD A;  2W82 A;  1YFH A;  5E3M A;  2Q1Z B;  2DU9 A;  5HDG A;  3BPV A;  2Z99 A;  3EYI A;  3JTG A;  3FM3 A;  4GO1 A;  2L2O A;  1FIP A;  3MN2 A;  4BS9 A;  1YYV A;  2O3F A;  2ZSH B;  3KYC B;  4YEL A;  4OIQ F;  2AQE A;  4LLL A;  1DGW Y;  2MAB A;  3FXM A;  4BHC A;  1N75 A;  1S8N A;  1HF0 A;  1WGX A;  3KCC A;  5D6E A;  2ZKZ A;  3OYL A;  4Y3O A;  1X3W B;  4BY1 J;  3S2W A;  1FY7 A;  3ABT A;  2QQ8 A;  5FLV A;  1PP7 U;  4DQ2 A;  4EJW A;  4L5E A;  1HW5 A;  3HRU A;  3CLQ A;  2OC6 A;  2K27 A;  1R23 A;  3WTY C;  1ON2 A;  3BR2 A;  3F72 A;  3MFK A;  5K5R A;  2IEK A;  3ZMT A;  5LHH A;  3TKY A;  4BDZ A;  3BZ6 A;  4NBQ A;  3CCQ I;  1IV6 A;  2BZT A;  2X48 A;  1OJL A;  4MFD A;  2W24 A;  1FT9 A;  2QSF X;  2PMH A;  5AIQ A;  2A5Y B;  5D8L B;  3J80 K;  2JA5 J;  1WH7 A;  3TP3 A;  3B73 A;  2KL4 A;  2DOE A;  2IA0 A;  3X2Q H;  4F55 A;  2JMW A;  5GP9 A;  1TWC J;  4PJM A;  5FB2 A;  1H9T A;  4RAG A;  4AIH A;  4CCL A;  3I58 A;  3LA7 A;  5EJC A;  4BE2 A;  3BLY A;  3BG3 A;  5C3E J;  2R7D A;  2Y69 H;  3P5J A;  3V7R A;  3G73 A;  4U0V A;  4P96 A;  3MMY B;  4MQV A;  3WE3 A;  5J8F A;  1W7P B;  2G9W A;  2V79 A;  2DYS H;  4RB2 C;  2CW8 A;  1HKT A;  2VC0 A;  4HOB A;  1MD0 A;  1MJA A;  1NH3 A;  2LDU A;  3FXL A;  4HF2 A;  2VQG A;  5FKL A;  2BXY A;  2ME6 A;  3OYE A;  2KHM A;  3PO2 J;  4OU0 A;  3K4K A;  4C2T A;  3DPL C;  2NOJ B;  4XLA A;  1RPW A;  3HC7 A;  1V3F A;  1B72 A;  3BCA A;  2GWR A;  2R93 J;  1U9N A;  1KQ0 A;  2Z2S B;  4AVZ A;  1DP7 P;  2MC3 A;  3ASO H;  3FXK A;  1JJ8 C;  1XGM A;  4NUB A;  4RGU A;  1R36 A;  3I5U A;  3OYF A;  2RV8 A;  4LB6 B;  1P7I A;  3E6C C;  5K7F A;  1I50 J;  3Q9V A;  3CCL I;  2WAE A;  2EFO A;  2XDV A;  4XK4 A;  2Y30 A;  5C44 J;  1LFB A;  2HPM A;  4FAS D;  4G6D A;  5FLX Z;  1MJB A;  2GZW A;  2JSP A;  1SEU A;  3DQV C;  2QUF A;  4A5N A;  3AG2 H;  3TO7 A;  3QPS A;  2X4H A;  4M71 A;  3L2W A;  2QBY A;  4Q5S F;  2V7F A;  2W84 A;  2TDX A;  2WAQ N;  4BQQ A;  2VLA A;  4JP0 A;  3WTT C;  2KIM A;  4AUX A;  1D5Y A;  2L9V A;  3REO A;  3R0A A;  3S2H J;  3HOU J;  3FXQ A;  2W7N A;  3KE2 A;  2COM A;  3V8J A;  1L3L A;  3TW6 A;  2CQQ A;  3MCZ A;  2OQR A;  1VQO I;  4HDV A;  2KRF A;  5FRO A;  3C7J A;  4R8H A;  1SVO A;  4IOA F;  2ACJ A;  3G1O A;  4DBR A;  1I27 A;  4ITV A;  3UR3 C;  2LBF A;  4D9J A;  5E1X A;  3F21 A;  3I59 A;  2HDC A;  4PDK A;  1Z6R A;  3QAH A;  4DOZ A;  2JA2 A;  4HF1 A;  1JKP C;  3CCS I;  1OIS A;  4BAY A;  1UEL B;  3JRI A;  4ESF A;  4P1W A;  1LNW A;  2E2H J;  2IS1 A;  1W5C C;  2E1N A;  1HQC A;  2VI6 A;  3GF2 A;  3ABK H;  4RS8 A;  4RBO A;  4G94 A;  1V55 H;  5TJJ A;  2Y48 A;  1BW6 A;  1MBH A;  4NQW B;  4EQQ A;  5M5Y J;  4HNT A;  4RLQ A;  5KNL A;  5BOX A;  3FXJ A;  1I39 A;  4I99 C;  1ODD A;  3ABU A;  1QPM A;  2LF8 A;  4CIC A;  4EAT A;  1P4W A;  3BR1 A;  2VPR A;  5B5E C;  4QSH A;  5J4Y A;  1X1C A;  1MBJ A;  5HDK A;  2VT3 A;  2ZJ2 A;  2DOD A;  5EZH A;  2DA5 A;  4XLN F;  2HXO A;  1WWX A;  4HQE A;  2GM4 A;  3PSI A;  4OAZ A;  2JUC A;  3WTS C;  1P4A A;  5LBQ A;  3FDY A;  2WB1 A;  1G3Y A;  1R9T J;  2VN2 A;  4OOI A;  2M1B A;  3H9J A;  4UVC A;  5IT9 Z;  1O7L A;  3F8F A;  5L3D A;  2L9R A;  3GZ5 A;  4XOP A;  4ETS A;  5LGN A;  2XRO A;  2ZNZ A;  2UV1 A;  4BYY A;  2K02 A;  1JI8 A;  2DK8 A;  2FX0 A;  3KEY A;  1RET A;  3L2U A;  2ZJR F;  3GWZ A;  3C1D A;  5JR3 A;  4OMY A;  3CO7 C;  1UHS A;  3K2Z A;  1YJ9 I;  3KZI C;  3HKZ A;  3GLL A;  3EDP A;  2HOE A;  2X1C A;  3BG7 A;  4LMY A;  5J3L A;  5DCM A;  3QU6 A;  1IV8 A;  4DBQ A;  2DQR A;  3FXU A;  2M3A A;  1W0T A;  4PSX A;  2MH2 A;  5D6F A;  4L9J A;  4V19 K;  2LK2 A;  1I3Q J;  2AQF A;  1A6I A;  1F9N A;  3MQ0 A;  3F6O A;  4XSZ F;  2K9Q A;  2ECB A;  2V1D A;  4YFN F;  1QQI A;  3K4M A;  2L7M P;  2M4K A;  1MMN A;  3GCM A;  5CVJ A;  5M5X J;  2VBW A;  4BXX J;  5HS9 A;  4RB3 C;  2M7A A;  3P7N A;  4IOC F;  2CH0 A;  4MEX F;  4IQJ A;  2DOF A;  5K7H A;  4C3J J;  2KT0 A;  2LP0 A;  3ZQH A;  2ID3 A;  4C3I J;  2Q2E A;  1E3P A;  2HTJ A;  2CQK A;  3GFI A;  4L0Z B;  5ICE A;  5ILV A;  1NG6 A;  4S0H B;  3M8J A;  1DUX C;  3TO9 A;  4XRS G;  4AIJ A;  1R6R A;  1BR4 A;  4LK1 F;  1W0U A;  1ZHF A;  3G71 I;  2QZ8 A;  4TV7 A;  2CFO A;  2DJN A;  2VJI A;  2HQR A;  2EB7 A;  3GTP J;  3CES A;  1R7J A;  2QKL B;  3B6C A;  4BU2 A;  3QQA A;  3QYB A;  5TRD A;  2HOT A;  2HI3 A;  1DU6 A;  1FBQ A;  2BY1 A;  4NNJ A;  4EJO A;  2X1E A;  3LSP A;  1VZ0 A;  2LTP A;  1USS A;  2L9S A;  2V9K A;  1B8I B;  4P9U A;  1Z0X A;  4XN3 A;  2D1H A;  2H09 A;  3OYI A;  4J00 A;  3CCR I;  5GPA A;  3CUQ A;  3E0J B;  4RAZ A;  1LDD A;  3ML6 A;  1EA3 A;  2PJR A;  1I6X A;  3W6J B;  4ASN A;  1MJ9 A;  2DT5 A;  1KU7 A;  4BBS J;  4IKF A;  4GCV A;  2EK5 A;  1ZR4 A;  4BQA A;  3LFK A;  5JHU A;  3JCU C;  2OPT A;  1LKX A;  1YX5 A;  3AG4 H;  4ZZL A;  5GTH C;  2YX7 A;  2H6C A;  3F0C A;  4Y52 J;  1IJW C;  1ETW A;  3D1N I;  5C4X J;  2EA4 A;  3AL0 C;  3I9V 2;  3WU0 A;  3V7S A;  3D5R C;  2JTV A;  1YTY A;  4O3M A;  2A6T A;  3DU6 A;  1JE8 A;  1TZL A;  1R5G A;  3K69 A;  4KN7 X;  4LLG F;  5LHI A;  5LEK A;  3ZMZ A;  4BHB A;  3OYA A;  1FMV A;  2X6O A;  3E97 A;  4CCN A;  1NG7 A;  3SEZ A;  1IF1 A;  3BTJ A;  1Z3X A;  4W1U A;  4LJZ F;  4FX4 A;  1GV2 A;  3I55 I;  2W57 A;  3D5L A;  3OYD A;  2OZU A;  2L02 A;  3HG9 A;  2R7W A;  2X1D A;  2QEX I;  1R49 A;  1OR7 C;  4ZC3 A;  3D0S A;  1GXQ A;  2BBY A;  2CG4 A;  1WZ2 A;  2R7U A;  4BAC A;  4ENJ A;  4PJN A;  2VPL A;  4AVP A;  4KIT B;  2OBP A;  4UUS A;  4WXC A;  3BWG A;  4CXF A;  4CH7 A;  1XCB A;  4G7Z F;  3JAM K;  2XF6 A;  2I5U A;  1ON1 A;  5D5V B;  3TOA A;  4A2U A;  3EUK L;  3HL2 A;  1KYW A;  1WJA A;  4Q4Z F;  1CF7 B;  3JRA A;  3HTU A;  1X3Z B;  3JRH A;  1WRJ A;  1RRJ A;  2ZC2 A;  1U2W A;  3K10 A;  2XPU A;  1CQT A;  4A3C J;  1Y39 A;  2V6E A;  2XIG A;  1QGP A;  3I0T A;  5J6X A;  4X0G A;  1RIO H;  3HRT A;  3CCM I;  4B44 A;  1G3S A;  5M3F J;  2GOX B;  1Z77 A;  1XN7 A;  3OY9 A;  2YU3 A;  3IWZ A;  3A01 B;  3MEX A;  5D5W B;  1V5G A;  4PGG A;  3S16 J;  2R5Z A;  3PQK A;  1U8R A;  3L2R A;  3KZZ A;  4A3G J;  1Y56 A;  3OIQ A;  1UFM A;  2KRC A;  4ENN A;  2V6C A;  1JKO C;  3IP4 B;  1P6R A;  2WY7 Q;  3GLX A;  3NAU A;  4XMY A;  1H88 C;  4XR6 A;  4DZJ A;  1SFE A;  2HNH A;  4P9F A;  5EEA A;  4CGZ A;  1ZH5 A;  4C2U A;  4JX5 A;  3C2G A;  1E2X A;  2FUG 2;  1MGT A;  3H9G A;  4IJA A;  1LVK A;  1N25 A;  1WPK A;  4ZDP A;  1IUY A;  2B0L A;  4R79 A;  1MIJ A;  2LYC A;  2WAF A;  3JW4 A;  5FFZ A;  2R7S A;  3IKT A;  1VND A;  1ZAO A;  3DTK A;  4GYI A;  3CC7 I;  3NWT A;  2IRF G;  2XVC A;  3S1Q J;  4G12 A;  3KEO A;  4HV6 A;  4HV5 A;  4B1R A;  3OOP A;  2L7K A;  2ZME C;  1MBK A;  2J5O A;  2LRE A;  2ZXI A;  4UB6 C;  2R3S A;  1FBS A;  3OL4 A;  3R60 A;  3QOD A;  1BR2 A;  2WC2 A;  1XGO A;  2NXN B;  3D5S C;  4BJT A;  1X1D A;  3RIR A;  5FO5 A;  3CME I;  4M3E A;  2R7Q A;  2LSO A;  1J9I A;  2DDB A;  5DDG A;  3QP5 A;  3HEF A;  3LA3 A;  3SFI A;  1ZG5 A;  3S1M J;  4IHW A;  1K78 B;  5F6F A;  3A03 A;  3IKV A;  5IY5 H;  1QA6 A;  3PJR A;  3ZQG A;  5JVT A;  2E5Z A;  4B8X A;  4XRM A;  2FF4 A;  1IC8 A;  2YU9 J;  4A93 J;  1CGP A;  5J40 A;  2N8G A;  1JKQ C;  1TBX A;  3U9G A;  1UHW A;  1X4P A;  5JVG F;  1QZE A;  1KQ9 A;  2R7R A;  1HDP A;  1SC7 A;  3CDL A;  1QRY A;  1NHA A;  1JTX A;  2PQ8 A;  2VKV A;  1SD6 A;  2K9M A;  2XKO A;  2E1C A;  1WQ2 A;  2XAQ A;  4D7M A;  2AS5 F;  1QZY A;  4JOM A;  4HDU A;  2E2I J;  3Q3S A;  1OCC H;  2QF7 A;  4KMU X;  3OYC A;  3M9A A;  3NWS A;  3ZQC A;  2R7O A;  1MKM A;  4BKX A;  1BOB A;  1K6Y A;  3OR2 C;  3S15 J;  2IVM A;  3LST A;  3HHG A;  1PUF A;  2AXT C;  2DT7 B;  1XCV A;  3K4L A;  3H0G J;  1GVD A;  1P2F A;  4IRH A;  3S14 J;  3JSP A;  5IOZ A;  4B4C A;  3ZQI A;  3RYP A;  3HOS A;  5L3C A;  2M9H A;  4M3G A;  3PFI A;  4MO7 A;  1GT0 C;  3W6K B;  5EG0 A;  2JA8 J;  2K9S A;  3RDI A;  3C3W A;  4M3D A;  4ZTF A;  4HLY A;  2CV2 A;  1SVL A;  4MQ9 F;  2EFW A;  1ACI A;  1BC7 C;  1UG2 A;  4NDL A;  4WWC A;  1S7E A;  2VE8 A;  1Y8R B;  4OMZ A;  3R61 A;  1A35 A;  2K7L A;  3TGN A;  3J81 Z;  5CVI A;  1T33 A;  2BY0 A;  3ONQ A;  3MZY A;  3C2B A;  4QPO A;  1EF4 A;  1T98 A;  1WJ5 A;  3J7A O;  1Z6T A;  1M1E B;  3JRF A;  1TWA J;  2ESH A;  2OTJ I;  1TLH B;  3F8C A;  4E7Z A;  2NYX A;  3BOQ A;  3PNV A;  1ZN2 A;  2ZO4 A;  1LDK B;  4LIT A;  1APL C;  3HOV J;  2UUZ A;  3H3U A;  1U6G A;  2LY9 A;  3OSF A;  5J1R A;  1F1Z A;  2FQ4 A;  2K85 A;  4LD5 A;  1B1B A;  1FP1 D;  1TNT A;  5ILS A;  3FXR A;  4BH9 A;  2HVR A;  4HG2 A;  1OKR A;  5BMZ A;  1UMQ A;  3OR1 C;  3M4O J;  1SAN A;  1DU0 A;  3FBN B;  2CS3 A;  2QCO A;  3L09 A;  4A0X A;  4A3I J;  3I53 A;  5ERI A;  2M7B A;  1FYK A;  2XGD A;  3LQQ A;  1WKM A;  1S72 I;  2YSR A;  1O3T A;  2HKO A;  1T56 A;  2ETH A;  3VSL A;  2QYO A;  5B66 C;  3J80 Z;  4BQN A;  1SD7 A;  1AWC A;  3HGG A;  4B3A A;  3PO3 J;  4KIB A;  3RSN A;  2D1V A;  3HBL A;  1ZK8 A;  2JN6 A;  4KUM A;  1L0O C;  3H9Q A;  2EV6 A;  4N0B A;  2XPV A;  1D0X A;  1MMG A;  3K0L A;  4O5V A;  4EEF G;  1I1G A;  2RRE A;  1NK3 P;  4CYC B;  2IBD A;  3FM5 A;  5LRS A;  1ZG3 A;  2X6X A;  3ZQL A;  2VL8 A;  3DKY A;  4IF4 A;  5FKK A;  1X1A A;  2WAD A;  3Q0V A;  5CVR A;  4LIU A;  5F27 A;  2YS9 A;  1FEX A;  4LG0 A;  5J1Y A;  1D3Y A;  1ENH A;  1MSF C;  2OCE A;  3OOU A;  2L5Q A;  2YUS A;  2CV1 A;  3WG9 A;  2OUM A;  3RQ4 A;  5E3N A;  3HDD A;  4MTE A;  3ZXS A;  2WB1 N;  2UXN A;  4CA0 A;  2DMP A;  1AU7 A;  1MNM C;  3O8G A;  2DMN A;  1WFX A;  3OS0 A;  1FP2 A;  2K4B A;  3F23 A;  3BG5 A;  1HBX G;  2VC1 A;  4UB8 C;  1ZRF A;  3MKZ A;  5EGO A;  1BI2 A;  3J7A Y;  2L4A A;  2MH9 A;  2NOG A;  2QEN A;  4MNU A;  4N4O B;  2Y9Z A;  2IPQ X;  3LMM A;  4FT8 A;  1EJ9 A;  5FKM A;  1LE8 B;  5FRN A;  3H3Z A;  3UNG C;  2Y9Y A;  3A1Y A;  1R58 A;  3KLO A;  4Y17 A;  4ZH4 F;  2E2J J;  2PLY A;  2VQH A;  2ZNY A;  4E7H A;  3N4M A;  1SMY F;  2Y0M A;  1W7P D;  2H94 A;  2VUM J;  1UCR A;  3S3M A;  4XKV A;  1C0W A;  4Z6Y A;  1XS9 A;  4A0Y A;  3ZRG A;  4A12 A;  3DWL E;  4BJ5 C;  1W1W E;  3SFZ A;  4LFU A;  2L7Z A;  3BR5 A;  5DS9 A;  3L00 A;  4JBA A;  3I71 A;  4C30 A;  2V1X A;  5E1Z B;  3PNY A;  2M8G X;  2XAJ A;  4P5O A;  5HNH A;  4Q47 A;  4U0Y A;  2KFD A;  2STW A;  3IH3 A;  2DMU A;  3PQJ A;  1Z9C A;  2RKH A;  4XIC A;  2GIZ A;  5LD2 C;  1EKE A;  2VBZ A;  1HA8 A;  3WU1 B;  3BQY A;  4ON0 A;  1IXR C;  2IGN A;  4RM3 A;  1BN5 A;  1AKH A;  2X6W A;  5BNG A;  4FET A;  1QZZ A;  2BW3 B;  3A2K A;  4F93 B;  4DYC A;  2LKP A;  2V26 A;  3BY6 A;  4CYD A;  1ZGW A;  3DCF A;  2F4O B;  4FIS A;  2XAU A;  2B7E A;  2DA4 A;  4M73 A;  4G6Q A;  2ZXW H;  4E6K G;  1JGS A;  1IW7 F;  3DFG A;  3DTE A;  1ETX A;  3ZR8 X;  4D5C A;  2ADU A;  2DAO A;  2QLZ A;  2WA0 A;  3GYH X;  3DXJ F;  3HXL A;  4RA2 A;  1UHM A;  2NVQ J;  3BG9 A;  4YIR X;  3TO6 A;  3RI4 A;  2K9L A;  3VYT B;  5JHF A;  5DUK A;  3SZP A;  2D2W A;  3U21 A;  4Y15 A;  3IAM 2;  2O0Y A;  2VOP A;  1O7F A;  2DPD A;  2MG4 A;  5AON A;  3DF8 A;  4C2M J;  2EH3 A;  2NVY J;  1X58 A;  2FSW A;  4WCG A;  4IX7 A;  3IUO A;  2IGO A;  3LSK A;  1JKR C;  3DP7 A;  4E70 A;  3MKL A;  3T8T A;  2M2E A;  3BTC A;  3ULQ B;  1KQ8 A;  4BBR J;  2JVH A;  1ERD A;  1O57 A;  2VE9 A;  5CVV A;  1R00 A;  3BR6 A;  5BPD A;  2B63 J;  3E5U A;  5AIP A;  3G3Z A;  2XSJ C;  4RDU A;  2R92 J;  2A61 A;  1XGS A;  4ZYH A;  3IRR A;  3K1M A;  1T38 A;  2A68 F;  1X1P A;  3VEP A;  2GAU A;  5D5X B;  1O3R A;  1PVE A;  1YRN A;  2R5Y B;  3TL4 X;  1ZQ3 P;  2PI0 A;  3AG1 H;  3F8B A;  3PSF A;  1HC8 A;  2DDA A;  5D4S A;  4G6T B;  2MSY A;  5E8I A;  4E7I A;  1FYL A;  1Y1W J;  2OF7 A;  1SFU A;  2A3S A;  2FD5 A;  4MIM A;  4UUT A;  1OR7 A;  3H3V K;  2F5D A;  1WI9 A;  1U5T A;  2M5W A;  4YII A;  4IHV A;  5FD6 A;  3QOP A;  1R5H A;  4HEA 2;  1DPR A;  1VF9 A;  2IGK A;  3HB9 A;  3G6E I;  2NNN A;  2EFP A;  1O4X A;  1BI1 A;  3K2A A;  5IP9 J;  1D1B A;  5HLG A;  4XID A;  1LPQ A;  3GW2 A;  2DA2 A;  2BGC A;  4G7H F;  1G6N A;  2PMZ A;  3TDZ C;  2DT6 A;  2EIN H;  2LD5 A;  4A3M J;  3MZ8 A;  3NAR A;  1ZGA A;  4KT5 C;  4XLP F;  1N77 A;  4M9S A;  2NNY A;  4GXO A;  1R71 A;  2BEO A;  3H0D A;  2DMQ A;  1W4M A;  2FMY A;  3ZQ7 A;  1R5I D;  4XSX F;  4B3X A;  2O8X A;  2EIJ H;  3LSJ A;  5H6Q A;  5L3F A;  5LLQ A;  3ZOB A;  4AIK A;  1FMW A;  4I76 A;  3SDG A;  1JUP A;  1S5L C;  4JQF A;  5CQE A;  3J7Z I;  2VBX A;  2VXD A;  3V8K A;  5IT3 A;  3BC8 A;  2V1N A;  3P9K A;  2IS2 A;  5F0C A;  5DYM A;  1NK2 P;  4X1E A;  2V9V A;  2STT A;  4YEJ A;  1D0Z A;  2H6B A;  2O61 A;  2R7X A;  3P9C A;  2XRL A;  2E71 A;  3CJR B;  4QPQ A;  1P7J A;  2BHZ A;  4ZYG A;  1A04 A;  1S9H A;  1RUO A;  1HDD C;  4PUS A;  4EJU A;  3IH2 A;  1E17 A;  2W4S A;  1MBF A;  2CSO A;  1N78 A;  1GV5 A;  1VQ9 I;  2EZL A;  4II3 A;  2ESN A;  3LL7 A;  2KQR A;  1YOV B;  4EV0 A;  4BE1 A;  2A5W A;  2MBF A;  5L3G A;  5CVU A;  5E1W A;  3M1E A;  2DA7 A;  1U3E M;  2MD0 A;  5L3B A;  2ME0 A;  4XL9 A;  3GXO A;  3TP0 A;  2EV5 A;  2ZME A;  1TQP A;  4I01 A;  4DNC A;  2GA1 A;  3KZY A;  2HYJ A;  4R1H A;  1STZ A;  4L0Y B;  1ZG1 A;  2DQL A;  1MNE A;  2PJP A;  4HLX A;  4HST A;  1K83 J;  4JYK A;  3WTV C;  1E3H A;  2HPI A;  1IRG A;  5EEH A;  4KN4 X;  1MW7 A;  4I7H A;  3MVP A;  3RPQ A;  2KRH A;  2QQA A;  1G3W A;  3HUG B;  2HFH A;  5K7Z A;  3H5R A;  3KX2 A;  1PP8 F;  4KT6 A;  3FXO A;  1V5F A;  5J47 A;  4OIP F;  1XSV A;  2XUB A;  1J09 A;  2EBI A;  3G2B A;  3U1K A;  2XC7 A;  1MDM B;  1G2H A;  4L18 B;  1W36 D;  3L1P A;  2LNB A;  5F04 A;  1XMK A;  2MC4 A;  3CMA I;  1U8B A;  1HLV A;  2KIQ A;  4YG2 F;  1IO2 A;  2Y75 A;  3GFM A;  1RR8 C;  3MWM A;  3VOD A;  5B1A H;  4QTR A;  2GQQ A;  3TED A;  4RB1 A;  3MD2 A;  3RKX A;  2PBI A;  4MLO A;  1IUF A;  1T0F C;  3JAM Z;  1TQM A;  2AHQ A;  3SZG A;  1MSE C;  3ERM A;  1VTN C;  1VQP I;  3A0B C;  2LKS A;  2O8K A;  1I6H J;  4M3F A;  3OSG A;  1A31 A;  1VFC A;  2FE3 A;  3S8P A;  1FOY A;  1ORK A;  2QVO A;  4HYE A;  4IHS A;  4PJL A;  1G4D A;  3LOC A;  4BEH A;  1RUN A;  2QQB A;  1FWZ A;  1MH3 A;  2TRT A;  2FOW A;  2QSH X;  3O3K A;  4M9X A;  5J1U A;  3HOT A;  3CCV I;  1Z91 A;  2EIM H;  4Y33 A;  4PCQ A;  4A3D J;  2COB A;  2RAE A;  1ZKG A;  4NHJ A;  5F64 A;  1TWF J;  3IWF A;  4NC6 A;  4IVN A;  5HDN A;  2DI3 A;  4CCM A;  1MMD A;  2LF7 A;  3DKW A;  2V1U A;  3SQN A;  1RC9 A;  3DKX A;  1YJW I;  4AYB A;  3HM5 A;  4G8X A;  2VON A;  5L3E A;  2CW0 F;  3ZMU A;  3I54 A;  1WCM J;  4QLC U;  3LAJ A;  3ERE D;  1I5Z A;  3HYI A;  2CV0 A;  2KLO A;  1B59 A;  3EYY A;  5HS8 A;  2HWV A;  2XAG A;  3OV8 A;  1D1A A;  3FK7 A;  4E7S A;  1WI3 A;  3A4C A;  3JRC A;  3GUD A;  1BJZ A;  4UVB A;  2ZJP F;  3CUO A;  5K5Q A;  4BUP A;  2BXZ A;  3GZN B;  3VYS B;  2CUJ A;  1DPU A;  2EV0 A;  3Q9S A;  2EFN A;  4RAY A;  2IW5 A;  1W5T A;  1TC3 C;  1JUM A;  2IP2 A;  1POG A;  5KVR A;  1BL0 A;  2ID6 A;  1FJL A;  1KGS A;  3IC7 A;  3KP2 A;  4WXH A;  4PZJ A;  1XSD A;  1QHH D;  1BI3 A;  2VJ5 A;  2X51 A;  3R0J A;  3RJP A;  5GTI C;  1ETQ A;  2W48 A;  1X1B A;  2OAZ A;  3FIS A;  4P55 A;  4KJZ A;  1YIJ I;  2KDO A;  2EZI A;  3H92 A;  2LY1 A;  2NVU B;  2HYF A;  5FRM A;  3DLL F;  3G4S I;  1R4N B;  3S1R J;  1NTC A;  1U5T C;  2R4G A;  2HTS A;  2JSC A;  5J8C A;  4ESJ A;  2CU7 A;  4A3K J;  2EIL H;  5HOO A;  3FMS A;  2VT2 A;  1SAX A;  4XBF A;  2VAS A;  2XGC A;  3VB2 A;  4B48 A;  2HZT A;  3GO5 A;  2HDW A;  1HCR A;  5LGT A;  2VKH A;  1Y8Q B;  3VYU B;  2LOO A;  2WV0 A;  2BYV E;  2P81 A;  3S1N J;  3BQZ A;  1MND A;  3SYT A;  2ZB9 A;  2WY8 Q;  4HQM A;  2F6C A;  2A05 A;  2KP6 A;  5DCF A;  2R7Z J;  2IS4 A;  2EQR A;  1Z05 A;  2LG4 A;  1JT6 A;  1BIB A;  3OIP A;  2YPR A;  1TT5 B;  1W7P A;  5CJ9 A;  4HZF A;  4WK8 F;  3LSR A;  4H0E A;  2D5V A;  3I4P A;  4IL6 C;  1WHU A;  1V5E A;  3U2R A;  3CP8 A;  2CGP A;  4IHX A;  4U7D A;  3BP8 A;  4XOT A;  2A6H F;  3KFW X;  2OQG A;  1PUE E;  3COA C;  1UZC A;  1TNS A;  3HTS B;  1B9M A;  3ABM H;  3KP6 A;  1IXC A;  2E1M B;  2E35 A;  4YIF A;  1YO5 C;  1UAA A;  3LQR A;  4ZDL A;  5DD8 A;  1RES A;  2O9L A;  5JLW A;  3H35 A;  4IZZ A;  2QWW A;  1IXS B;  1LVA A;  1PJR A;  3EUA A;  2LVS A;  1B72 B;  3HSF A;  1RR7 A;  1J0R A;  3FWE A;  4S04 A;  1VQM I;  1LFU P;  4HA8 A;  3Q5F A;  1LFP A;  1XMX A;  3TQN A;  5FJ8 J;  3AL0 B;  2Y2Z A;  1TL8 A;  1FSE A;  3LNQ A;  1Z7L A;  1IGN A;  4PJJ A;  3FHN A;  1ZLK A;  5A2Q K;  2TCT A;  3I3L A;  5D5U B;  1AOY A;  1XX5 A;  3IRQ A;  2Y31 A;  3CJQ B;  3E6M A;  4F3Q A;  3GFJ A;  1J2X A;  2KJC A;  2FOK A;  4IEJ A;  2GA2 A;  4QWQ A;  4A3J J;  4OWR B;  3ELK A;  5JI6 A;  1SFO J;  3JRG A;  2DK5 A;  1TW2 A;  1QNT A;  4WXD A;  1DQU A;  2DFF A;  3QPL A;  1R4M B;  4XLF A;  3JTH A;  1JJ6 C;  2QBY B;  4S05 A;  1A6Q A;  4N4N B;  3QYF A;  4MEY F;  4G7O F;  3M07 A;  2NRA C;  2E7X A;  2BE5 F;  2ZXH A;  2XHK A;  2DFE A;  4LLN A;  4UV9 A;  1KU9 A;  5GAG J;  3M8E A;  3S93 A;  3QRF F;  2CYY A;  3ECO A;  2XRN A;  5IYB J;  3VFZ A;  2GXA A;  3M3Y J;  2LBF B;  1H89 C;  2X6Y A;  1F36 A;  3K9T A;  1QPI A;  1YX3 A;  3I59 B;  3V4G A;  3L2Q A;  4PSW A;  1ZRC A;  1VI0 A;  5ED4 A;  3KET A;  3CCU I;  1HOM A;  4RAF A;  2DOA A;  5DV5 A;  4NQW A;  3CJT B;  5FLM J;  4HW0 A;  3PIP F;  1SAU A;  3K7A J;  1BW5 A;  1JXS A;  1BI0 A;  2RNG A;  3GEZ A;  4FE4 A;  3V7C A;  3ROU A;  1VQ5 I;  4MGR A;  4CZC A;  1FBU A;  2JRT A;  2GLO A;  1MMS A;  4IO9 F;  3WTX C;  5E17 F;  3DV8 A;  1SVM A;  3KP3 A;  5M5W J;  3HOY J;  1KU3 A;  1G59 A;  2VOO A;  1BC8 C;  2AO9 A;  4WX9 A;  3CDI A;  4LK0 F;  3V42 A;  5D8K B;  3FIW A;  3DEW A;  3FK6 A;  2VBY A;  1BA5 A;  4C3H J;  3DBR B;  4L9V A;  1AA7 A;  2P6T A;  5LHG A;  2MLK A;  4D1Q A;  3KP7 A;  1X3U A;  3RKQ A;  2R0Q C;  3DBL B;  3FF5 A;  3T5X A;  4B47 A;  3NEU A;  1QVT A;  5LGU A;  5HNF A;  1EH6 A;  2E19 A;  5IYC J;  3OL3 A;  4UV8 A;  1HW1 A;  4ZYD A;  1E3O C;  3F8N A;  3HIF A;  1LEB A;  3TOB A;  1Z67 A;  1BJA A;  4L9N A;  1Y6I A;  4HBL A;  3HJE A;  4Y4R A;  5C4J J;  1P92 A;  5CLS A;  2VXZ A;  2GBY A;  1YW8 A;  4UVA A;  3ZGK A;  3KYL A;  2O7O A;  1XB4 A;  2JQ7 A;  2EIK H;  4KNY A;  1FSH A;  2XF7 A;  4MTD A;  1HKQ A;  2DA1 A;  3F6V A;  3G1M A;  5DCM B;  4DGW B;  2FBI A;  4PJ0 C;  1PDN C;  2VJJ A;  3FMR A;  4OIO F;  1XDS A;  1GHC A;  3EUH C;  3WU2 C;  1VQ7 I;  4A3L J;  1R1V A;  3QPT A;  5GAE J;  4D5F A;  5HLH A;  2KKO A;  2P4W A;  5GPC A;  3LA2 A;  5HLI A;  1U9O A;  2LMD A;  1DDN A;  1J59 A;  4G9Y A;  1VQ8 I;  2X85 A;  3LWF A;  2KZV A;  1WSU A;  2R7F A;  5ILU A;  2F5E A;  5DM7 F;  4KMF A;  2JRM A;  2Q2E B;  3OYJ A;  5F0F A;  2OD5 A;  3BR3 A;  1Q1V A;  3RTR A;  4ABZ A;  3CF2 A;  2P5V A;  3KLN A;  1GVJ A;  2CJJ A;  3HGY A;  1R1U A;  3H36 A;  5F1R A;  5KAF C;  1ZRD A;  1MBG A;  3BJO A;  2XAS A;  1Z7U A;  5FKN A;  4AC0 A;  1QO0 D;  2HKX A;  3HPG A;  4AID A;  4BEH B;  1I3A A;  2ELK A;  5FKO A;  1B8I A;  3MKY B;  4DIQ A;  2VKE A;  2EJR A;  1ZGJ A;  5FFX A;  1ETO A;  1XG1 A;  1OPC A;  3O6B B;  4XON A;  3BT9 A;  2XAF A;  5M3M J;  3OYK A;  4O6J A;  5DUI A;  2XGX A;  3ZQQ A;  3CUQ B;  3GVA A;  3CDH A;  3RKW A;  1T39 A;  4IRI A;  5JLX A;  3GTL J;  2PJR B;  3HKZ N;  3SHF A;  1OCO H;  3GME A;  2XF5 A;  3EET A;  1IRX A;  1GDT A;  4A6D A;  2PMU A;  4HPQ A;  2CO5 A;  2Z5U A;  4EJV A;  1OYI A;  5DD4 A;  4RGR A;  1XPX A;  4DYQ A;  2RGV A;  3ZN0 A;  3JSO A;  1K7A A;  1EH8 A;  3GTG J;  1T0F A;  2FBH A;  1FYM A;  2EA2 A;  1YIT I;  1GLN A;  4I0A A;  5CKT A;  2PN6 A;  2FXA A;  4EJT A;  3OYB A;  3PFY A;  1LB2 A;  2KIU A;  3DPU A;  4FE7 A;  4EM0 B;  1K4S A;  2JA7 J;  4OIR F;  5E3O A;  2Z33 A;  3O2P E;  1T2K A;  3ASN H;  2G0E A;  5E20 A;  5J4V A;  3M8F A;  1XC5 A;  2L01 A;  1J7K A;  4AD9 A;  4K2E A;  2JPC A;  2P7C B;  4U88 A;  4HX4 A;  3RYR A;  2RQP A;  2IGM A;  4OIN F;  3WGH A;  3OYG A;  3M1C A;  2ZBK A;  3CCE I;  3B02 A;  2YX4 A;  1SMT A;  4RLF A;  2ECC A;  3OYM A;  1UST A;  4RM2 A;  3S3N A;  3RZD J;  1YW7 A;  4BQO A;  3CJN A;  1ZTR A;  2X0L A;  1VQN I;  1P9Q C;  2JZY A;  3WTW C;  4A3E J;  1CF7 A;  2MA3 A;  2G7U A;  3DEE A;  2DPU A;  4UUS B;  2DO7 A;  1H8A C;  1WJD A;  3Q0U A;  5EYR A;  4ZYA A;  1VQ4 I;  3FX3 A;  5D4R A;  4I98 B;  3CC2 I;  1IDY A;  1RKT A;  2DA3 A;  3NRV A;  4M6V A;  4NC7 A;  2VQL A;  1KYZ A;  2L9N A;  3K1N A;  1BM9 A;  3FZV A;  1REP C;  1B4A A;  3GBG A;  1ZEL A;  3DEU A;  4AYB N;  4A5M A;  1F4K A;  5TGT A;  1GXP A;  4ZZD A;  2UXX A;  3A0H C;  4LIV A;  1OCT C;  4GYG A;  3PIO F;  2E7W A;  3A01 A;  3BTL A;  3H5A A;  4CZZ A;  3BR0 A;  1HST A;  3CP2 A;  4CO8 A;  2F4M B;  2CUE A;  3UKG A;  2Z1D A;  1VQ6 I;  4ENK A;  4HRI A;  5H6R A;  2R5Z B;  2HS5 A;  2CQN A;  2HZD A;  3TW7 A;  2RC4 A;  3N97 A;  1OMI A;  1TT0 A;  3TDU C;  1H9G A;  2C6Y A;  5FD5 A;  2CUZ A;  2IXS A;  2HGC A;  5ICF A;  4Y7N J;  2IA2 A;  2NS8 A;  2FU4 A;  3ZQF A;  5HLT A;  2UZK A;  4A6E A;  4L5J A;  4RGX A;  3VYR B;  4CDG A;  3ZPL A;  1WVR A;  2ZXJ A;  2CWE A;  4BJ6 C;  4Q48 A;  4ZDO A;  3LSM A;  4UNO A;  3BG6 A;  3K4N A;  3KP4 A;  4HNU A;  3LSH A;  3L7W A;  1OQY A;  2RNJ A;  4BDY A;  3HSE A;  4CSW A;  4BY7 J;  2FEZ A;  3AKZ A;  2R7T A;  1ZYR F;  5KAI C;  2DN0 A;  2Q8K A;  4H4K C;  5DTD A;  2P5L C;  1K61 A;  3WOD F;  3L2C A;  3RPU D;  4IXA A;  2WWY A;  3ZN1 A;  2AXL A;  1YW9 A;  5CQG A;  4CCK A;  2FRH A;  2OZ6 A;  4ZJZ A;  2KPM A;  3DU5 A;  3NQO A;  1K78 A;  3WGG A;  3E1S A;  2NS0 A;  2BY2 A;  2Z9O A;  2K9N A;  2FNP A;  2QQ9 A;  3CMY A;  5EF6 A;  3BCB A;  1FPQ A;  2BVM A;  3H1C A;  5KCM A;  2KJB A;  2A69 F;  1YS7 A;  3DTI A;  3WE2 A;  3TMO A;  3A02 A;  1KZH A;  2ZFW A;  3L9F A;  4Y13 A;  2LFB A;  3FKI J;  3OYH A;  3JRE A;  1YE9 A;  1SFK A;  2IJL A;  3ZP5 A;  3ISP A;  4NB5 A;  4PFO A;  2JWT A;  3CMM A;  4ENM A;  2QSG X;  4I02 A;  2VKD A;  1S7A A;  3GX4 X;  2O03 A;  3F3X A;  4EM1 A;  4DJA A;  4D0P A;  5HS7 A;  2DCE A;  3K6G A;  5BS6 A;  4KIS A;  2Q0O A;  1R1T A;  4KIC A;  4IQ4 A;  1SD4 A;  2R7V A;  3I4N J;  4Z2Y A;  4YRV A;  1YI2 I;  2Y0S A;  1ULY A;  5E3L A;  2E5N A;  4ZTJ A;  2EPF A;  4GDF A;  2HQA A;  4CCO A;  5DM6 F;  1PUF B;  2IA1 A;  4EVI A;  2K4J A;  5JFR A;  3KYD B;  4E7L A;  1D5V A;  2DTR A;  2MW8 A;  2EFQ A;  5EDN A;  2LRD A;  1BOA A;  1TP4 A;  5EG0 B;  1HXD A;  3SXY A;  4WF2 A;  2CFX A;  2FML A;  4HX8 A;  5IYD J;  1WH5 A;  3W2W A;  5GAD J;  4EGZ A;  2EZH A;  2W25 A;  3RKY A;  6PAX A;  9ANT A;  2DFI A;  3OWT A;  1W36 C;  2H8R A;  3E3V A;  3WTZ A;  2PX9 A;  1IAW A;  4V2F A;  3DPT A;  1OCP A;  4IRG A;  1JHH A;  1J75 A;  1X19 A;  3HOW J;  4EMS A;  1OLT A;  5B1B H;  2ISZ A;  2NVX J;  2JPB A;  1HKS A;  1TWH J;  1TTY A;  1WJC A;  2MFZ A;  2JVG A;  4LB5 A;  4BXF A;  4RB0 A;  2DBB A;  2NAZ A;  5LRR A;  2DW4 A;  5ICC A;  4XRS A;  1OFC X;  2JT1 A;  5FLX K;  2HVQ A;  3FKJ A;  2HQN A;  2L54 A;  2CUF A;  2H8W A;  3DLA A;  2F5V A;  3RCO A;  2DMT A;  2A07 F;  4B43 A;  5DEQ A;  1TW3 A;  4M74 A;  1EV7 A;  2HYG D;  1LDJ A;  4XRF A;  3PM1 A;  2CQ7 A;  2MLG A;  3BTI A;  4KA4 A;  3Q0W A;  3I4M J;  2XAH A;  2L4M A;  5F0H A;  1UJ8 A;  4N9I A;  3R6S A;  2YR2 A;  2F4I A;  3PL8 A;  2ZCW A;  3TBI A;  4DW6 A;  5H2F C;  5IPA A;  4EGY A;  4JX6 A;  1ZRE A;  2OCC H;  2FBK A;  3IAS 2;  3QP6 A;  2DLL A;  5CPR B;  3ZCO A;  4KDP A;  3N05 A;  2KIS A;  2KIF A;  2HR3 A;  3T0Y A;  1Y1V J;  4CYC A;  2VOD A;  2JUG A;  1FC3 A;  3ECH A;  2FA5 A;  4KYW A;  3OS1 A;  1D8J A;  3HRS A;  2CRG A;  3F9K A;  2DXI A;  1D8K A;  2PEX A;  5EZG A;  4DZP A;  1OYY A;  1SFX A;  3GZ6 A;  1GUU A;  2DTZ A;  4EM2 A;  3QYE A;  3E6D A;  3CQZ J;  2HOA A;  1RZ4 A;  4LG0 B;  1FIA A;  4J01 A;  1OCZ H;  4L5I A;  2RQQ A;  1ETY A;  4AU7 A;  2HQ5 A;  4HNV A;  2V9P A;  1EH7 A;  5LEJ A;  2HU9 A;  2H1K A;  2UWM A;  2LR8 A;  2ZFU A;  4CHU A;  2J5P A;  2MD5 A;  1A5J A;  1MBE A;  3GTK J;  3E7L A;  1QHG A;  3CTA A;  1IRZ A;  4BXU A;  1LE8 A;  3E5Q A;  2BVL A;  1RKW A;  5BQT A;  2E1M C;  2P7V B;  2DYR H;  3HZJ A;  5A2Q Z;  3T8R A;  4XKW A;  5EGO B;  4BHP A;  4XNF A;  1YHQ I;  4XKC A;  3V8L A;  2H1L A;  1I1S A;  1X2N A;  2W1O A;  3CCJ I;  3WHB A;  4XLH A;  3WG7 H;  5HOD A;  4LGW A;  5IT9 K;  3BJA A;  1O3Q A;  1QVU A;  3VPR A;  2QA4 I;  3PUF A;  4LG3 A;  3EUH A;  1MZB A;  3P9I A;  2MGQ A;  4ZYE A;  3BJ6 A;  4XN0 A;  3LAP A;  1K79 A;  2L0K A;  2G7H A;  3CC4 I;  2BOL A;  5F1J A;  2LLK A;  3T1B A;  2JJ7 A;  2ISY A;  3KEQ A;  2LH9 A;  1Q1H A;  1FTT A;  1QBJ A;  4PGH A;  2OJE D;  5CYV A;  1S29 A;  2HXI A;  4KFC A;  1YIO A;  1LQ1 A;  2BW3 A;  4I2O A;  4E4H A;  1U78 A;  2K40 A;  3I64 A;  1XTA A;  2WAQ A;  5F08 A;  1P4X A;  3VSK A;  1TQI A;  2XPW A;  2XKP A;  3PNT A;  3QU3 A;  5FGM A;  2M0C A;  3FMQ A;  1IZ1 A;  1AKH B;  3BRO A;  1JHF A;  2BHY A;  3RZO J;  3CD6 I;  4AM3 A;  2A6E F;  4QIW N;  1JTY A;  2LC2 A;  2NVT J;  3EPZ A;  5H20 A;  1DGR M;  3J7Y J;  4C9Y A;  4I0B A;  2EZK A;  1FOK A;  4UHT A;  3HSR A;  3GTJ J;  1F43 A;  2OA4 A;  1YS6 A;  3PUB A;  3S32 A;  1G3T A;  2O6G E;  2RDP A;  4V2G A;  4E7K A;  2K3F A;  4M6X A;  3K4J A;  1KON A;  3HOZ J;  3W2V A;  1FZP B;  4OAY A;  1YLF A;  4X6A J;  3QWL A;  2MYS A;  4BNC A;  2DA6 A;  4RGS A;  2VIX A;  5IP7 J;  3OS2 A;  2GXB A;  1IG7 A;  3U1D A;  5IOY A;  4I6Z A;  1Z21 A;  1WJB A;  1O3S A;  1JT0 A;  2K86 A;  2R5Y A;  1ITY A;  2P5K A;  2M8E A;  2PG4 A;  2QKM B;  3LSG A;  2GIV A;  4MFE A; 
#chains in the Genus database with same CATH homology
 2R5Y B;  1ZQ3 P;  1ETV A;  4XRS G;  2MSY A;  2CQX A;  1W0U A;  2I10 A;  5F0F A;  1Y1W J;  1YRN B;  2OF7 A;  3BR3 A;  1Q1V A;  4ABZ A;  2DJN A;  2FD5 A;  4MIM A;  3SJM A;  1JGG A;  4UUT A;  3H3V K;  2XB0 X;  3GTP J;  3HGY A;  2CJJ A;  3B6C A;  3QQA A;  1MBG A;  4IHV A;  5FKN A;  4AC0 A;  3S2D J;  2HOT A;  1VF9 A;  2HI3 A;  2KDZ A;  4IHY A;  3GTQ J;  1DU6 A;  2ELK A;  4A3F J;  5FKO A;  3HB9 A;  1B8I A;  1O4X A;  2VKE A;  3K2A A;  5IP9 J;  3LSP A;  2LTP A;  4XID A;  1ETO A;  1XG1 A;  1B8I B;  1Z0X A;  2DA2 A;  2FJ1 A;  3BT9 A;  5GPA A;  2LD5 A;  2IAI A;  5M3M J;  4A3M J;  3NAR A;  3IH4 A;  5JLX A;  2DMQ A;  3CCY A;  3GTL J;  4A3B J;  4BBS J;  3HKZ N;  1ZR4 A;  3W6V A;  2WV1 A;  3LSJ A;  4FTH A;  2HOS A;  2OPT A;  3ZOB A;  1AHD P;  1GDT A;  4I76 A;  3SDG A;  1JUP A;  4Y52 J;  1MH4 A;  3F0C A;  1IJW C;  1ETW A;  2L7F P;  2JK3 A;  4DYQ A;  3D1N I;  5C4X J;  3OIO A;  5F0C A;  1NK2 P;  4X1E A;  4A69 C;  4GFB A;  3GTG J;  1TWG J;  2XRL A;  4J19 A;  1P7J A;  4JX4 A;  2X6O A;  1HDD C;  2XSD C;  2JA7 J;  4FE7 A;  3BTJ A;  3B6A A;  3IH2 A;  2E1O A;  5E3O A;  4W1U A;  2G0E A;  1GV2 A;  1XC5 A;  1MBF A;  1GV5 A;  2EZL A;  4W97 A;  3RQI A;  2XGE A;  2ECC A;  2DA7 A;  2ME0 A;  3TP0 A;  3JRD A;  3RZD J;  2JA6 J;  4UUS A;  1ZTR A;  1FTZ A;  5IP6 A;  2HYJ A;  4A3E J;  4UUS B;  1H8A C;  1K83 J;  4JYK A;  3Q0U A;  5EYR A;  3JRB A;  3JRA A;  3JRH A;  2NS7 A;  1IDY A;  1RKT A;  2DA3 A;  4M6V A;  3MVP A;  2XPU A;  2PMZ N;  4DYR A;  4LOC A;  5K7Z A;  1CQT A;  3GBG A;  4A3C J;  1JUS A;  4AYB N;  4A93 J;  1OCT C;  2XB5 A;  3GTM J;  2EBI A;  2LKX A;  5M3F J;  4M3B A;  3A01 A;  1G2H A;  1Z77 A;  3BTL A;  3L1P A;  3BR0 A;  5F04 A;  4D7N A;  2CUE A;  3UKG A;  3A01 B;  1U8B A;  1ZR2 A;  1HLV A;  3S16 J;  2R5Z A;  3TED A;  4QTR A;  4A3G J;  3O8H A;  4MLO A;  1IUF A;  2R5Z B;  2AHQ A;  1MSE C;  3TW7 A;  1JKO C;  3NAU A;  1H88 C;  4Y7N J;  1IDZ A;  4DZJ A;  2O8K A;  3S17 J;  2NS8 A;  3ZQF A;  1I6H J;  4M3F A;  3OSG A;  1VFC A;  5EEA A;  1ORK A;  3HOX J;  4FCY A;  3LOC A;  4JX5 A;  1X2M A;  1WPK A;  1MH3 A;  2TRT A;  3G1L A;  5J1U A;  1VND A;  2Y0S N;  4BY7 J;  3S1Q J;  4G12 A;  4A3D J;  2COB A;  2RAE A;  1ZKG A;  4B1R A;  2DN0 A;  5DTD A;  1TWF J;  1K61 A;  1MBK A;  3WHC A;  1ETK A;  4M3E A;  3HM5 A;  3JR9 A;  2K9N A;  1WCM J;  3HEF A;  3SFI A;  3S1M J;  4IHW A;  3CMY A;  5EF6 A;  3A03 A;  3GTO J;  3ZQG A;  3FK7 A;  1WI3 A;  3JRC A;  4XRM A;  3A02 A;  1BJZ A;  3IV5 A;  1IC8 A;  2YU9 J;  2N8G A;  1JKQ C;  2LFB A;  3FKI J;  3JRE A;  1HDP A;  3CDL A;  1QRY A;  2JWT A;  1JTX A;  2M34 A;  2VKV A;  1TC3 C;  1JUM A;  4D7M A;  2X9D A;  1POG A;  1BL0 A;  2ID6 A;  1FJL A;  2E2I J;  3Q3S A;  2QF7 A;  2HDD A;  3ZQC A;  5E3M A;  4BKX A;  1ETQ A;  2W48 A;  3S15 J;  3FIS A;  2EZI A;  1FIP A;  3MN2 A;  1PUF A;  3I4N J;  3H0G J;  1GVD A;  3S14 J;  5E3L A;  5IOZ A;  4B4C A;  3ZQI A;  2M9H A;  4M3G A;  3S1R J;  4MO7 A;  1PUF B;  1NTC A;  1HF0 A;  1WGX A;  1GT0 C;  5EG0 A;  2JA8 J;  2K9S A;  4BY1 J;  2CU7 A;  4M3D A;  4A3K J;  5FLV A;  2MW8 A;  5EDN A;  1UG2 A;  4NDL A;  4L5E A;  5EG0 B;  1S7E A;  2XGC A;  5IYD J;  1WH5 A;  3BR2 A;  1T33 A;  2IEK A;  2EZH A;  1HCR A;  3C2B A;  9ANT A;  1EF4 A;  2P81 A;  3S1N J;  3BQZ A;  1IV6 A;  2X48 A;  2H8R A;  2ZB9 A;  1OJL A;  4MFD A;  3JRF A;  1TWA J;  2JA5 J;  1WH7 A;  4V2F A;  1OCP A;  3TP3 A;  2R7Z J;  2EQR A;  3HOW J;  1JT6 A;  2JMW A;  5GP9 A;  1TWC J;  1APL C;  2NVX J;  3HOV J;  1TWH J;  2LY9 A;  3LSR A;  5J1R A;  3OSF A;  2D5V A;  3BG3 A;  5C3E J;  2FQ4 A;  4IHX A;  4XRS A;  1OFC X;  2CUF A;  1UMQ A;  2DMT A;  3M4O J;  5FKL A;  1SAN A;  2ME6 A;  3PO2 J;  1DU0 A;  2QCO A;  4A3I J;  3PM1 A;  1RPW A;  2XGD A;  3BTI A;  1B72 A;  1RES A;  2O9L A;  3Q0W A;  5JLW A;  2R93 J;  3I4M J;  5F0H A;  1U9N A;  2LVS A;  5IPA A;  4DW6 A;  1T56 A;  4JX6 A;  1B72 B;  1JJ8 C;  4S0H B;  1RR7 A;  1LFU P;  3HGG A;  4B3A A;  3PO3 J;  3HBL A;  5FJ8 J;  1ZK8 A;  2JN6 A;  1P7I A;  2Y2Z A;  1Y1V J;  4CYC A;  5K7F A;  1I50 J;  2XPV A;  3LNQ A;  1IGN A;  4EEF G;  4XK4 A;  2TCT A;  2Y30 A;  5C44 J;  1NK3 P;  4CYC B;  1LFB A;  2IBD A;  2Y31 A;  2CRG A;  3ZQL A;  5FKK A;  3Q0V A;  4IEJ A;  5F27 A;  2YS9 A;  1FEX A;  3QPS A;  5EZG A;  4DZP A;  5J1Y A;  1ENH A;  4A3J J;  1MSF C;  1SFO J;  1GUU A;  3OOU A;  3JRG A;  2DTZ A;  2YUS A;  2WAQ N;  2HOA A;  3CQZ J;  1FIA A;  5E3N A;  4JP0 A;  3QPL A;  4AUX A;  1ETY A;  1JJ6 C;  1D5Y A;  3HDD A;  3S2H J;  2HQ5 A;  3HOU J;  4HNV A;  2WB1 N;  2DMP A;  1AU7 A;  2LR8 A;  1MNM C;  3O8G A;  2H1K A;  2DMN A;  3TW6 A;  2CQQ A;  1A5J A;  1MBE A;  3BG5 A;  3E7L A;  3GTK J;  1IRZ A;  3G1O A;  1LE8 A;  1RKW A;  5EGO A;  2Y9Z A;  2NOG A;  5FKM A;  1LE8 B;  1JKP C;  5IYB J;  3M3Y J;  2Y9Y A;  1H89 C;  1F36 A;  3JRI A;  5EGO B;  1QPI A;  2E2J J;  2E2H J;  1X2N A;  3WHB A;  5HOD A;  1VI0 A;  2VUM J;  2VI6 A;  1HOM A;  1QVU A;  3VPR A;  4RBO A;  1XS9 A;  5FLM J;  2MGQ A;  2L7Z A;  3BR5 A;  3K7A J;  2L0K A;  1BW6 A;  5DS9 A;  1BW5 A;  1MBH A;  5F1J A;  4FE4 A;  2M8G X;  5M5Y J;  2LLK A;  2JJ7 A;  2GLO A;  3IH3 A;  2DMU A;  1FTT A;  4XIC A;  5M5W J;  3HOY J;  3BR1 A;  2VPR A;  2AO9 A;  4QSH A;  1MBJ A;  2HXI A;  5EZH A;  2DA5 A;  3FIW A;  3DEW A;  2HXO A;  3BQY A;  2GM4 A;  1U78 A;  2K40 A;  3FK6 A;  1AKH A;  1BA5 A;  4C3H J;  5F08 A;  5BNG A;  2XPW A;  2M0C A;  4DYC A;  1R9T J;  1AKH B;  3RKQ A;  2R0Q C;  1ZGW A;  3DCF A;  4FIS A;  3RZO J;  1QVT A;  2L9R A;  2DA4 A;  2E19 A;  4QIW N;  5IYC J;  1JTY A;  2NVT J;  2FX0 A;  1E3O C;  1ETX A;  4D5C A;  1RET A;  2EZK A;  3GTJ J;  2NVQ J;  3BG9 A;  5C4J J;  1F43 A;  1UHS A;  2GBY A;  2O7O A;  5J3L A;  1W0T A;  4V2G A;  2DA1 A;  2MG4 A;  4C2M J;  2EH3 A;  2NVY J;  1X58 A;  2LK2 A;  1I3Q J;  3G1M A;  1A6I A;  1JKR C;  3HOZ J;  2K9Q A;  3MKL A;  2ECB A;  4X6A J;  2M2E A;  3BTC A;  2L7M P;  4BXX J;  5M5X J;  2DA6 A;  4BBR J;  5IP7 J;  4A3L J;  3BR6 A;  2B63 J;  1IG7 A;  4D5F A;  5IOY A;  4I6Z A;  5GPC A;  1JT0 A;  4RDU A;  5K7H A;  2R5Y A;  2R92 J;  4C3J J;  1U9O A;  2KT0 A;  2LP0 A;  3ZQH A;  1ITY A;  2ID3 A;  4C3I J;  3LSG A;  1YRN A;  4MFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...