1A5JA

Chicken b-myb dna binding domain, repeat 2 and repeat3, nmr, 32 structures
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
GIPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSSWTEEEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the B-Myb DNA-binding domain: a possible role for conformational instability of the protein in DNA binding and control of gene expression.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Dna binding protein
molecule keywords B-MYB
total genus 21
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 1998-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1a5jA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1a5jA02
4M3EA 1ETVA 1FIAA 2HQ5A 4AYBN 3HOYJ 5E3NA 1LE8A 2H1KA 3DEWA 1AKHA 5FKOA 2EZLA 3FK7A 3W6VA 1X58A 3S15J 2ME6A 3S17J 1E3OC 1I6HJ 2CQQA 2LTPA 2YUSA 5GPAA 1QRYA 1K61A 2IAIA 3S16J 1I50J 2HOTA 4MFEA 2OF7A 3TW6A 4QSHA 2M8GX 1UMQA 4BY7J 1JTYA 1JUSA 3GTJJ 1H89C 4A3CJ 1ZKGA 3HOZJ 3TW7A 2NS8A 3BTLA 3BT9A 3MKLA 1R9TJ 2VKEA 1X2MA 4B4CA 2DA1A 5IP9J 1NTCA 5M5WJ 1YRNB 1TWGJ 4BBRJ 5E3LA 1JJ8C 5EG0B 1MBEA 2VKVA 3FK6A 3BG3A 3Q3SA 3PO2J 5J1UA 4MFDA 4V2FA 1RETA 3GTQJ 1TWFJ 3B6CA 4IEJA 3QQAA 5HODA 1BW5A 2MSYA 3UKGA 3IH4A 1IC8A 2ELKA 3I4MJ 2H8RA 2Y31A 2R5YA 2LP0A 3HM5A 3DCFA 2R0QC 1MH3A 1AHDP 1RESA 2ECBA 2XB0X 1B72A 3S1QJ 1O4XA 1GVDA 2VPRA 3GTMJ 2TCTA 2JWTA 4MLOA 3HGGA 1P7JA 5J1RA 2LR8A 3LSRA 2R93J 3GTKJ 3ZQFA 1ZQ3P 2NVTJ 1ZR4A 4D5FA 1LFUP 1WGXA 4M3DA 3BTJA 3L1PA 4Y7NJ 2DTZA 1F36A 3HOXJ 1WH5A 4NDLA 2GBYA 3LSGA 1APLC 3CCYA 3K7AJ 1SFOJ 2Y9YA 1U78A 3S2HJ 4M6VA 2E2JJ 4IHXA 3E7LA 5F08A 3JRAA 1JKRC 1PUFA 4L5EA 3LSPA 3BG9A 4S0HB 2EZIA 2DA2A 3BR1A 1JKQC 2QF7A 2DMUA 3JRGA 3GTPJ 5IOZA 5IYDJ 3BR3A 2HXIA 4X1EA 3ZQHA 2HI3A 3HOWJ 3M3YJ 1ETYA 2WV1A 5IP7J 1ETKA 1Y1VJ 5K7ZA 5M5YJ 2VI6A 2XPUA 2DMPA 2K9SA 3Q0WA 2FJ1A 3IH2A 5EG0A 1EF4A 4A3FJ 4XICA 4JP0A 4FCYA 1MBGA 3H0GJ 1X2NA 2I10A 1IJWC 1H88C 2LKXA 1XS9A 1JT0A 2DA7A 3S2DJ 1HCRA 5DTDA 2Y9ZA 4CYCA 3BR0A 1GUUA 2LK2A 4UUSB 1SANA 4M3BA 1LFBA 9ANTA 2K9NA 3FIWA 3SDGA 5IP6A 2XSDC 1A5JA 2LLKA 1IDZA 2RAEA 4A93J 1B8IA 1OCPA 5M5XJ 4D7NA 2R5ZB 2JA5J 1MBHA 1WPKA 4FE7A 1GV5A 3HEFA 3GTLJ 4XIDA 3BQZA 5J1YA 5FKKA 1JGGA 3HOVJ 4QTRA 2B63J 5EF6A 5EEAA 1QPIA 1F43A 1ZGWA 1Q1VA 1JT6A 3OIOA 1JUMA 1OFCX 1LE8B 1GDTA 2O8KA 2JK3A 1P7IA 3I4NJ 5F1JA 1T56A 3RZDJ 4BY1J 2JN6A 1GT0C 2COBA 1VNDA 2W48A 3JRBA 2XPWA 2Y0SN 2E2IJ 3S1NJ 4A69C 2K9QA 4BBSJ 2HDDA 4JX5A 3ZQCA 5IOYA 2ID3A 2JMWA 4RDUA 3QPSA 5FKNA 2JA8J 1RKWA 1ETOA 2L7FP 4JX6A 2JA7J 1RR7A 4D5CA 2DMTA 4UUSA 1BA5A 2DMNA 3JRDA 5EZGA 4I76A 5K7HA 4XK4A 3MN2A 1FTTA 1JTXA 2ID6A 3CDLA 3FISA 3NARA 5M3FJ 2LVSA 5F0HA 2FX0A 4X6AJ 2PMZN 2GM4A 3BR5A 1W0TA 1ETXA 2AHQA 3HBLA 3BQYA 5C44J 4DYRA 3S1MJ 1ENHA 2VUMJ 3LNQA 1GV2A 1WH7A 2L9RA 5JLXA 1HF0A 5F04A 2CUFA 2XGCA 3RKQA 5J3LA 1S7EA 2EBIA 2R5ZA 2MW8A 1U9NA 2Y2ZA 3LSJA 4GFBA 2DA4A 1BW6A 2ME0A 5E3OA 1DU0A 1BJZA 2XPVA 4B1RA 2YU9J 1HDDC 3G1MA 4HNVA 2NS7A 4DYCA 1OJLA 4RBOA 3C2BA 2M9HA 3K2AA 5FKMA 1WCMJ 4XRMA 1POGA 2XB5A 3HKZN 2LD5A 4FISA 2FQ4A 1WI3A 1Z77A 1I3QJ 1JKOC 2CJJA 1AU7A 1HDPA 5GPCA 1RKTA 3TEDA 3GBGA 1B8IB 4A3JJ 2R7ZJ 4C3HJ 1FEXA 4C3JJ 1IV6A 5C4JJ 2L0KA 1PUFB 2R5YB 5GP9A 1ETQA 4JX4A 2N8GA 2DA3A 5BNGA 5EGOB 4D7MA 2HXOA 1QVUA 1B72B 4W97A 3O8HA 4C2MJ 1RPWA 3G1LA 1JUPA 2WB1N 1W0UA 1VI0A 3Q0VA 3FKIJ 3ZOBA 4DYQA 2KT0A 3PM1A 3JRIA 1IG7A 1ETWA 1TWHJ 1ORKA 5DS9A 2YS9A 4A3EJ 2R92J 5IYCJ 1Y1WJ 2JA6J 3BR2A 4G12A 4M3FA 1HLVA 5JLWA 2L7ZA 1DU6A 4A3MJ 3S1RJ 5EZHA 2K40A 5EYRA 3GTOJ 5FLMJ 2M34A 2MGQA 1A6IA 3A01A 1FTZA 4V2GA 2X48A 5F27A 2NVYJ 2EQRA 3QPLA 4FE4A 3CQZJ 5IPAA 1MBKA 5FLVA 3BTCA 2CUEA 3TP3A 5FKLA 2WAQN 4XRSG 1OCTC 3HDDA 4BXXJ 3H3VK 4BKXA 5F0CA 2XRLA 2FD5A 1MBFA 3G1OA 1CQTA 3RZOJ 1K83J 1MSFC 1UG2A 2IBDA 2D5VA 1VFCA 1YRNA 3JREA 4C3IJ 2NVQJ 4EEFG 2EH3A 2L7MP 2M2EA 3ZQIA 4QIWN 2X9DA 5FJ8J 3SFIA 3OSGA 1D5YA 2DA5A 1FIPA 3HGYA 3A02A 1MH4A 1MSEC 3BTIA 4DW6A 3TP0A 5K7FA 5C3EJ 2ECCA 2JJ7A 3S14J 3BR6A 1NK2P 5C4XJ 4I6ZA 2HOAA 1TWAJ 2EZHA 3RQIA 4IHYA 4A3IJ 4DZPA 2E1OA 2KDZA 2G0EA 3PO3J 1U8BA 4A3BJ 2NVXJ 1IDYA 1AKHB 1H8AC 2IEKA 5M3MJ 1QVTA 3Q0UA 3D1NI 1XG1A 2CU7A 4B3AA 1HOMA 2CRGA 5EGOA 4CYCB 2E19A 4DZJA 3CMYA 4M3GA 4MIMA 3GTGJ 2MG4A 1MBJA 4FTHA 1JKPC 1IRZA 5F0FA 3JRHA 3NAUA 5IYBJ 1G2HA 3IH3A 1NK3P 4MO7A 2Y30A 3B6AA 1FJLA 4JYKA 1JJ6C 5EDNA 2ZB9A 2P81A 1ZR2A 1U9OA 2O9LA 4A3DJ 3A03A 3JR9A 4J19A 4W1UA 4XRSA 2X6OA 2XGEA 2DJNA 3HB9A 4UUTA 2NOGA 2LY9A 4A3LJ 3OOUA 3MVPA 3WHCA 1Z0XA 2QCOA 3SJMA 3IV5A 1BL0A 3O8GA 2E2HJ 4A3GJ 4AC0A 2LFBA 1T33A 4AUXA 2CQXA 3OSFA 3LOCA 2DN0A 1MNMC 2TRTA 2HOSA 3JRFA 1XC5A 1TC3C 1IUFA 2DMQA 5E3MA 2GLOA 1ITYA 1VF9A 3JRCA 3HOUJ 4A3KJ 3VPRA 2EZKA 3WHBA 3ZQLA 4LOCA 4Y52J 2AO9A 2O7OA 2OPTA 2XGDA 3M4OJ 1ZK8A 2M0CA 1IGNA 2HYJA 3ZQGA 4IHVA 4IHWA 3A01B 4ABZA 1TWCJ 1UHSA 3BG5A 2DA6A 3F0CA 1ZTRA
chains in the Genus database with same CATH superfamily
2JUGA 1FIAA 3IKTA 3OYKA 3F23A 1R4NB 3VYRB 2H1KA 3W2AA 3DEWA 4L5JA 1T8IA 5FKOA 2EZLA 3FK7A 2EK5A 4LLLA 1FLIA 3FHZA 2BHZA 2M5WA 1M1EB 2QEXI 3DKYA 5HOOA 4LJZF 1FPQA 1U0JA 4P55A 4OAZA 3DPLC 3JTGA 1QRYA 1KYZA 1GXQA 5ILUA 3HXLA 1DGWY 1P6RA 5EEGA 4XKVA 3S16J 2HOTA 2QSGX 3O3KA 3QOEA 3TW6A 4QSHA 2M8GX 1BI0A 1JTYA 1PP8F 4HRIA 3G2BA 1SAXA 2LOOA 2NS8A 3MKLA 2EV5A 1R9TJ 3GF2A 2HYGD 4B4CA 2E5ZA 1NTCA 4MHGA 4BXFA 1YRNB 3HYIA 5DCMA 1YHQI 1LKXA 4E70A 1T2KA 2LNBA 3W6KB 3GFIA 1G3SA 5L3BA 5LGUA 1CF7A 2YU3A 4II3A 3GTQJ 1ZGJA 3QP6A 2L9SA 4D1QA 3WTYC 3NWSA 1BW5A 2MFZA 2MC3A 2MSYA 2E1CA 2M4KA 3AG2H 2VOOA 4NQWA 3ZPLA 1VQNI 3IH4A 1KU9A 2IS2A 4WXDA 2H8RA 4UNOA 1HBXG 3ZMZA 2R5YA 3L9FA 2HEOA 2LP0A 2R0QC 3NWTA 3MFKA 3S1QJ 1O4XA 1RRJA 2CUJA 3JW4A 4UVCA 1P7JA 3K69A 4OIOF 4NHJA 3FX3A 5CKTA 3GTKJ 4GCVA 4U7BA 4IKFA 3F8NA 3CDHA 2LF8A 1VQKI 1AOYA 4D5FA 2PEXA 4AIHA 4AIKA 4X0GA 1LFUP 3BTJA 2E1MB 4PJMA 3KP7A 1TQMA 1F36A 4UVBA 3LSIA 1X4OA 2CQNA 2BY3A 1REPC 4RAYA 2M7AA 1SFEA 4DOZA 1MMSA 2UXNA 3CCYA 2R7WA 2KZGA 4E7IA 2DYRH 2GIVA 1SFOJ 2WB1A 2Y9YA 1IN4A 3LAPA 1U78A 2E2JJ 4BXUA 2ZCWA 2DJIA 1U2WA 3E0JB 3LL7A 3TOBA 4DIQA 3JTHA 2LMDA 4KMFA 4L5EA 1MMNA 2H94A 4S0HB 1FOYA 3TKYA 2EZIA 1X19A 1FOKA 4MTEA 5IYDJ 1O3SA 3GTPJ 5IOZA 3BR3A 2BVLA 2HXIA 4HZFA 2BV6A 2JPBA 3VODA 2HQNA 4XQFA 3M3YJ 1FSEA 2A6HF 2WV1A 2W1OA 1TT5B 2H09A 2HVSA 5FRNA 5M5YJ 1SC7A 1FYLA 2VI6A 2F5DA 1WJEA 5B1BH 1XGMA 4ZYDA 2XF7A 5EG0A 1EF4A 1TQIA 4XICA 1OR7C 2EV0A 2W00A 3HHGA 4G8XA 2XC7A 4UY8I 4FCYA 3E1SA 4U0YA 1D1BA 2FBHA 3CLOA 1MDMA 1HCRA 3I58A 5DTDA 3K4NA 4KN7X 5GAGJ 3BG6A 1ZREA 2K85A 3C3WA 2P4WA 4HLXA 4N4OB 1JHHA 4QPQA 4UV9A 4LGWA 5E8IA 3DBRB 3C2HA 2UUZA 4A93J 4D7NA 1MJ9A 3OS0A 1MBHA 4G6DA 1GV5A 1L0OC 2EIMH 3GTLJ 3ZP5A 4KICA 3RI4A 2GOMA 1KQ0A 1R71A 5FKKA 1T08B 3E6MA 4OWRB 2A07F 1XB4A 4QTRA 5EEAA 1QO0D 3TO6A 3M1CA 2HVRA 3W2WA 5FO5A 2RDPA 1A31A 2Z5UA 4BE0A 1GDTA 2IGMA 2JK3A 1P7IA 3ECOA 1R5HA 3F8FA 5D5XB 3I4NJ 1RNLA 1EH8A 3CC7I 2VBZA 3OYIA 1IZ1A 2IPQX 2P8TA 2PN6A 2DQLA 1BIBA 2Y0SN 1BM9A 5DUIA 3KIOA 3S3NA 5E17F 5JR3A 2CG4A 3ZQCA 4YFXF 4G7ZF 2IGKA 3K1PA 1MNDA 2AXLA 3LWFA 4QPOA 5FKNA 2JA8J 1BIAA 2JA7J 3H5RA 4B3XA 3K4CA 1RR7A 1K78B 3FBNB 3RSNA 2FA5A 2DMTA 4Y15A 1FBQA 4UHTA 5J6XA 1SMTA 2OZUA 1ZAOA 4LG0B 1ZGAA 3H36A 3MN2A 1FTTA 1JTXA 2ID6A 4I02A 2A3SA 4B8XA 2FX0A 3ABLH 4X6AJ 3WU2C 3CTAA 1O3TA 1H9TA 2EIJH 3F8BA 1O57A 1G3WA 3O2PE 5CJ9A 3CMEI 1UZCA 4LK0F 2CGPA 1YQAA 3OYJA 4LB6B 4L18B 1WH7A 2PG4A 1DPRA 5JLXA 1LB2A 5L3EA 4I0AA 3HL2A 2CUFA 3GLLA 2TDXA 1HSTA 4P5OA 2MW8A 1U9NA 1S9HA 3LSJA 4L0YB 2WY7Q 1K6YA 2DK8A 4OAYA 2F4OB 4Y3OA 1WKMA 2XPVA 4KNYA 2VASA 3G1MA 3SDBA 4CDGA 1R49A 1OJLA 1XDUA 1KQ8A 4RBOA 2P7VB 2BYVE 2XB5A 4XLEA 2WY8Q 4BQAA 3P5JA 2LD5A 5HNFA 4LLGF 4YIRX 3ERED 1RR8C 2K3PA 3JAMZ 5D5WB 2MYSA 2X1CA 3I55I 2E60A 4G6TB 4RB0A 3FXMA 4LB5A 3ZMDA 4PGGA 4ITVA 5TRDA 1A6QA 3OYFA 4PFOA 3BLYA 3OYEA 3PNTA 5CVJA 1ETQA 4JX4A 2N8GA 1TW2A 3R60A 2BBYA 4PGHA 3V4GA 4C2UA 4NC7A 3J7AO 1U3EM 2EV6A 2DT6A 1B72B 2CFOA 4XORA 1O7FA 4EJTA 4I0BA 4C2MJ 4ZDLA 2NNYA 1VTNC 2OJED 2WB1N 2HQRA 2EFNA 2QVOA 3RPUA 3Q0VA 2E1NA 4DYQA 4IJAA 5CVUA 3JRIA 2QKLB 4AVPA 1TWHJ 3V7RA 4UUVA 1V55H 5DDGA 2ZMEC 1F4KA 2JA6J 5IT9K 3ASNH 3K4LA 1E3HA 4B47A 3QU6A 1UG0A 3S1RJ 4HW0A 4AM3A 5DM7F 2P5KA 4RS8A 1VQ4I 2HTJA 4V2GA 2EA2A 1D1CA 3QPLA 4FE4A 4WCGA 4EJUA 3TP3A 4B09A 2HGCA 5FKLA 3PSIA 3W6JB 3ONQA 1TT0A 2IW5A 3WE3A 1CF7B 1UAAA 3HDDA 4BXXJ 3T0YA 5JI6A 3H3VK 3C1DA 3DBHB 5F0CA 2OAZA 2FD5A 1MBFA 3G1OA 1KU2A 2XAGA 3L00A 1CQTA 2DFIA 3RZOJ 2Y69H 3H9QA 3N97A 2IBDA 1MSFC 1MW7A 1P4AA 2O03A 2BZTA 2L7MP 4DBRA 2HPMA 1HA8A 3HOTA 1F5TA 2R4GA 3ULQB 5E1WA 3SQNA 3TP0A 1WI9A 5BPIA 3DKXA 4FT8A 2JJ7A 1QNTA 5CQGA 5H2FC 1NK2P 1TWAJ 2EZHA 2LREA 1VZ0A 4A3IJ 2E1OA 3CMMA 3A1YA 1OKRA 3PO3J 1U8BA 4I7HA 4XL9A 5CPRB 2J5PA 1XX5A 2HZDA 1X3UA 1R5GA 5HS8A 1F9NA 2QGUA 4RM3A 1EH7A 2FMLA 4Q47A 4EVIA 3I5UA 2XF5A 4I01A 4BDZA 2Y0SA 4B3AA 3CMAI 4A5MA 4AIJA 4M3GA 2GZWA 2UXXA 3J7AY 1WRJA 3GTGJ 1STZA 3EUHA 1ERDA 3ROUA 5F0FA 2VC1A 3KP2A 1HW2A 3B6AA 1FNNA 1PYVA 2ZB9A 2MABA 2V4JC 1Z91A 2G7UA 2M87A 3HTSB 3JR9A 3CCVI 4W1UA 1WHUA 1WJAA 4U88A 2CO5A 3WGHA 4IHSA 1G3TA 1Z0XA 2KPMA 4HV5A 2DU9A 3IV5A 3TOAA 2KZVA 3R0JA 1T33A 1B4AA 3HRSA 2EFOA 5TGTA 3LOCA 4CICA 3WU0A 3Q9VA 2M8EA 2DMQA 5BQTA 3J80K 4ZZDA 1ITYA 1TL8A 3K1MA 3HUGA 4A2UA 1VF9A 4CUGA 4CCNA 2P0WA 2GXBA 1Y8RB 2V1NA 3ZQLA 3E6DA 4Y52J 3GO5A 2O7OA 2XGDA 2IGOA 4CCKA 3M4OJ 4G7HF 1ZK8A 3CUQB 1TWCJ 1YS6A 5J4YA 3QPHA 3J81K 3WTVC 3EYIA 4AYBN 1XMKA 3HOYJ 5E3NA 4JOMA 2L02A 1J09A 2XV4S 3AG4H 1YYVA 1UHWA 3OS2A 2XASA 4E7LA 2OTJI 1X58A 2GWRA 3KETA 2QBYB 2CQQA 2LTPA 2YUSA 5GPAA 1BOBA 4KJZA 1B6AA 1K61A 4BUPA 2P5LC 2IAIA 2V79A 3H35A 4KISA 4MFEA 2XRNA 2OF7A 2KMUA 4RM2A 4HDVA 4BY7J 2HKOA 1JUSA 1IXCA 5K1YA 3GTJJ 1H89C 2R7RA 4A3CJ 1KGSA 2A6EF 3HOZJ 3PFIA 1IO2A 2VKEA 4PCQA 1LDDA 1W36C 3BJ6A 2YSRA 3FM5A 2UV1A 4M6YA 2CQ7A 2E1MC 2MD5A 1PVEA 2IS4A 1JJ8C 1FZPB 2XKOA 5EG0B 2VKVA 3FK6A 2MH2A 1ON1A 3BG3A 3BPXA 3HC7A 1TWFJ 1N77A 1D0XA 3B6CA 5LLQA 3LQRA 3WTTC 2CW7A 3CCMI 2ZXWH 1BI3A 3MKYB 1BJAA 3G73A 3OL4A 1DQUA 2JVHA 3M8EA 2ZKZA 1R1UA 3DCFA 2CUZA 3OR2C 1RESA 2ECBA 3A0HC 3DTEA 2JWTA 4XLNF 1WJCA 4N9HA 4Y13A 1I6XA 3IAM2 3K9TA 2XHKA 3V7CA 2M4GA 2UZKA 2PX9A 3CCJI 2Z2SB 1WGXA 2J5OA 1VQMI 2W7NA 5FLXZ 3I0TA 5ICGA 4EMSA 1MJAA 1HW5A 3HOXJ 1WH5A 4NDLA 3ZMVA 4F7ZA 2GBYA 5J47A 2JSCA 4PJLA 3COAC 3K7AJ 3MMYB 2FNAA 4HV6A 3M9AA 2H27A 1TZLA 2IRFG 3OR1C 4PJ0C 1WQ2A 2PFBA 2R7DA 4IHXA 2ADUA 4HEA2 1SVLA 2DFHA 3NQOA 4PJJA 1JKRC 1PUFA 2ZFUA 2XROA 3CP8A 1TNTA 4LG0A 3HPGA 3IL2A 2DA2A 2AQEA 4UB6C 3BR1A 2WBMA 2KL4A 2DMUA 3IKVA 5E20A 2VJ5A 3OYCA 5BPDA 1JKQC 3F9KA 3JCUC 3BJAA 1DGRM 3KP5A 4GRIA 1Z05A 2MC4A 3MCZA 1ETYA 1R6RA 3E5UA 5HS9A 5IP7J 2XF6A 1Y1VJ 5TJJA 2VB6A 2BY0A 1D8JA 1TW3A 4XOPA 2Y75A 3Q0WA 3IH2A 5FRMA 2HS5A 1W5TA 2FSWA 2RQQA 4A3FJ 1TLHB 2ZO4A 3QP5A 1FOWA 3ZMUA 4JP0A 3J80Z 1IN8A 1HQCA 1W5SA 4XLPF 1T0FA 1MBGA 3P9IA 1YX5A 1X2NA 3KFWX 2I10A 4Y33A 1IJWC 2IT0A 2KIUA 2LKXA 1YJ9I 2XAFA 1JT0A 3S2DJ 4JBAA 1SAUA 3R0AA 2VXZA 3OOPA 1GUUA 3P7NA 4UUSB 3L2WA 2VE9A 1LFBA 3FIWA 4B43A 3QOPA 2XSDC 2FEZA 2V9KA 1KU7A 4XN3A 2NXNB 1VQ8I 4LLNA 1A5JA 1MJBA 2KJCA 4EV0A 1OCPA 2K02A 4F3QA 2R5ZB 3QWLA 4FE7A 3WTSC 3I4PA 4NBQA 5KHDA 2BVMA 2VBWA 1P2FA 3LA2A 1ZELA 1F1ZA 1NH3A 2P6SA 2B63J 1V4RA 2XKPA 1XN7A 2VPLA 5HDGA 3RQ4A 4XR6A 2K86A 3OIOA 1J9IA 4BHPA 1OFCX 3QYFA 4N9IA 2LRDA 2WC2A 1T56A 4E7ZA 1XSVA 5HLGA 2VIXA 4IOCF 4FETA 3CUOA 5KCMA 4L0ZB 2COBA 1R7JA 1VNDA 2L3DA 4A0YA 3JRBA 5DUKA 2XPWA 2MD0A 3CF2A 1S72I 1Z67A 3DFGA 1WZ2A 3MAJA 5B66C 1E0EA 4A12A 3KEOA 4GO1A 1OPCA 3ISPA 3S2WA 2QLZA 3LSKA 5HNHA 1RKWA 5K5RA 1GXPA 2L7FP 1KZHA 2CSOA 1QZEA 2X6WA 1NHAA 4RA2A 4OIRF 1T39A 1OLTA 2ZNYA 1V3FA 4KT5C 4IX7A 3L2UA 5EZGA 1I1GA 3SZPA 2B9SA 5D8KB 4XK4A 3CDLA 4EGZA 1OCRH 3SEQA 3DKWA 3X2QH 2DTRA 2E71A 1T38A 1R1VA 2IVMA 2PMZN 3GCMA 3BR5A 4Z2YA 1W0TA 5KAIC 2Z33A 3BG7A 3V8LA 3BROA 4YFKF 2JT1A 1YJWI 2AHQA 2XUBA 3I3LA 4ZYEA 4F93B 5C44J 3GMEA 2YX7A 1JE8A 2V6CA 2VUMJ 3O6BB 4ENJA 1GV2A 2ESHA 4ANJA 1USSA 5EEHA 5LFAA 2HTSA 1X4PA 5F04A 4J00A 2W25A 1T98A 2FOKA 5J3LA 2KIFA 1S7EA 2EBIA 2R5ZA 3TL4X 5LD2C 1LEBA 1JHFA 4MQVA 3L2RA 3QRFF 3FDYA 4BDYA 2GA2A 4HQEA 1ZRCA 2M45A 4CCJA 4CCMA 4TV7A 1W5CC 2XGXA 1S7AA 4B1RA 5FB2A 1HDDC 3LA7A 3BDDA 4DYCA 2P6TA 1PDNC 3C2BA 5H6RA 2M9HA 4P96A 3K2AA 4XRMA 1EJ9A 3HKZN 3S32A 1JGSA 4GYGA 3FHNA 3F72A 4FX4A 2AS5F 2DDBA 2X85A 2JZYA 1W7PD 2CJJA 5D5VB 1I39A 4BHCA 2PJPA 1IXRC 4ASNA 5GPCA 3CJNA 1ACIA 3F8CA 1ZHFA 3GFLA 4QLCU 2F5FA 4A3JJ 4IQJA 1FEXA 4BH9A 3FXOA 1FSHA 2OCEA 1RIOH 5E1ZB 2KFDA 4U0VA 2WAEA 2L0KA 2R5YB 1BC7C 4XLCA 5HLIA 3G4SI 3AL0C 2QQAA 4HOBA 3GZ5A 4S05A 4EJWA 1RZ4A 2DOEA 4ESFA 3VOEA 2NVUB 2ELJA 2OCCH 5LHGA 3FKIJ 3MWMA 2IGNA 3EETA 4ZYAA 2KT0A 2JVGA 3RKYA 1DP7P 1IG7A 2BHYA 5DCMB 3GZ6A 1B59A 2X6XA 1ORKA 5DS9A 2Z99A 2G7HA 5IYCJ 3T8TA 2WA0A 2CV2A 2QENA 2HDWA 3ABKH 3D0SA 4M3FA 5JLWA 1R5ID 2L7ZA 3CJQB 1DU6A 2V26A 2O61A 2I5UA 3REOA 5EYRA 5LEKA 3A01A 4F52A 3KP6A 1I3AA 2Z16A 3KYLA 5F27A 3Q9SA 2NVYJ 3IC7A 3CQZJ 4L9NA 4RGUA 1MBKA 3OYHA 1WVRA 4O5VA 3VSLA 2CUEA 3K4MA 3L09A 1ZLKA 2WAQN 2K3FA 1B1BA 3GFMA 4BKXA 5IT9Z 4YG2F 1MIJA 1QZYA 2MBFA 4MTDA 3RYRA 3RKWA 2DLLA 1J59A 2D5VA 1Z21A 4LIUA 3JREA 4HLYA 4EEFG 2QWWA 2JSPA 1MNEA 3SFIA 3SZTA 3V8JA 3GFJA 2K4BA 4I2OA 1U6GA 4I98B 2LDUA 3VYSB 3K6GA 2L54A 2VQLA 2ECCA 2A61A 3NRVA 5B3SH 2E7WA 3E5XA 5ICCA 1GHCA 2HNHA 4I6ZA 3F6VA 3DEUA 5L3FA 1OR7A 1R22A 2VL8A 3GUDA 3DF8A 4KN4X 1G3YA 1S5LC 1ZRDA 2Z3YA 2KDZA 4IXAA 3EUHC 4HYEA 2NVXJ 3MZ8A 1IDYA 4CZCA 1Y8QB 1H8AC 3PQJA 2IEKA 3M8FA 1QVTA 2VONA 3Q0UA 3D1NI 4XRFA 1XG1A 2EINH 4BE2A 2F4IA 5GADJ 2OV7A 2VBYA 4UB8C 2E19A 4HBLA 4LD5A 3PQKA 4WXCA 3AAFA 1TTYA 2MG4A 5GTIC 1IRZA 1JKPC 3RPUD 1EH6A 3WE2A 3K4KA 3SHFA 4ZDPA 2KDOA 3VFZA 2HWVA 4MO7A 1H9GA 1KONA 2Y30A 3KP4A 5HVQC 4HX8A 4RAGA 4JYKA 1FJLA 2QM3A 1O3QA 4EM2A 1A35A 4PK4A 2NYXA 2O9LA 4A3DJ 1D1AA 5DEQA 5TISC 3A03A 2NRAC 3ZGKA 2X1EA 2VE8A 1XGSA 3OWTA 4ZJZA 5DV5A 4G9YA 5KK1A 3VEPA 3OYLA 4HF0A 3EUAA 5DCFA 3OOUA 1YIJI 4A3LJ 4U7DA 4HA8A 2QCOA 1MD0A 1JI8A 2VJIA 3O8GA 2CQKA 4A3GJ 1OYIA 2DN0A 3ASOH 1UHMA 2TRTA 2GXAA 3F6OA 5E3MA 2PJRA 3DU5A 1Y56A 3ZXSA 2Q0OA 3FMQA 1B9MA 1OCCH 1S29A 2PLYA 4PSXA 2Z9OA 1I1SA 3TGNA 3WHBA 4FQGA 3BOQA 5F64A 2JRTA 2FRHA 2M0CA 1IGNA 1QHGA 4L5IA 6PAXA 3ZQGA 4A0XA 3A01B 4RGXA 3UR3C 3BG5A 2DO7A 5FFXA 1ETVA 1XDSA 2HQ5A 3R4KA 4B48A 4CSWA 2EJRA 1LDKB 5L3GA 1LE8A 1IAWA 2ZC2A 2V1UA 4GXOA 2X1DA 3MEXA 2GIZA 5D8LB 3LFUA 3E97A 3S17J 3LMMA 1E3OC 4AWXB 4YRVA 3EDPA 3OIPA 1PUEE 3DP7A 4BNCA 1YS7A 4ZZLA 2L7KA 3CCLI 1R00A 4E7HA 1E2XA 2FU4A 1SMYF 4QWQA 1UMQA 1N25A 3K70C 4P9UA 3VWBA 4N4NB 2BXZA 4HDUA 2KISA 3P9CA 5AONA 1Z3YA 3BT9A 1X2MA 4HQMA 4IRIA 4BQOA 3ZN0A 2WWYA 4RB2C 2MLKA 3KPHA 1TWGJ 4BBRJ 3DXJF 3IUOA 5E3LA 1ZG1A 1DP3A 2XAHA 1HXDA 3MD2A 3I53A 4EJOA 4IF4A 1W4MA 2IA2A 5CVVA 2VN2A 3VYUB 4IHTA 4CXFA 4ON0A 2NNNA 3Q3SA 3GLXA 5J1UA 4A5NA 1T6SA 2K4JA 4IRGA 4V2FA 3L2QA 1IW7F 2LG4A 1LEAA 3CCRI 3EPZA 4IEJA 3QQAA 4GYIA 3A4CA 3BC8A 2BW3B 3FMRA 2HQAA 3R61A 4FX0A 1KQ9A 1VQ6I 2A68F 1RI7A 3K0LA 4LMYA 3TMOA 1IC8A 2ELKA 3OYDA 3I4MJ 3NEUA 2XVCA 4CO8A 2YR2A 3HM5A 4M74A 4L9JA 1B72A 1GVDA 5GTHC 1G59A 3H1CA 4MLOA 4F92B 2ISZA 2R93J 2IS1A 3LAJA 4XOTA 3CUQA 4RLQA 4XMYA 4M3DA 5K5QA 2F5CA 4IRHA 4RLFA 1HC8A 4Y7NJ 1V5FA 2QSHX 4BJ5C 5D4RA 2B7EA 5L3CA 3C2GA 4Y17A 2ZMEA 2PI0A 3A0BC 2ZJQF 1SEUA 4MNUA 1Y39A 1LFPA 2DI3A 3H9GA 3D5RC 1G6NA 2KQRA 2VQHA 3V8KA 1SD7A 1SD5A 1ZRFA 4Q4ZF 5F08A 1YFHA 3JRAA 1W7PA 1HKQA 3QYBA 1R1TA 3LSPA 1JXSA 2M3AA 2DT7B 5B1AH 1OYYA 3H0DA 3QODA 3HSFA 4WX9A 2ZSIB 1OISA 1YTYA 3WTXC 2QF7A 4X1EA 3ZQHA 3I64A 5HDNA 2VQGA 2QSFX 1N75A 1W7PB 1J0RA 1SD6A 2A69F 5DM6F 1SFUA 3RDIA 2RVCA 4N0BA 1ETKA 4DNCA 1VQ9I 3HRTA 2XPUA 2K9SA 4A0ZA 4MQ9F 2FJ1A 4XLAA 3B73A 4ENNA 3KYCB 2EWNA 4IOAF 1LQ1A 2OTLI 2A6TA 4XKWA 3HHHA 4BJTA 2XAQA 1D3YA 2GOXB 3DPTA 3H0GJ 4O6JA 1FYKA 5GAEJ 4U0WA 1J7KA 1IUYA 3HZJA 4FASD 3FXLA 2Y9ZA 2DXIA 2LK2A 2QA4I 2KLOA 3LSMA 4OINF 4ZTFA 1YG2A 2P5VA 4M3BA 4AD9A 3JAMK 3OYAA 3KEQA 2IA0A 5IP6A 2WTEA 4G94A 2LLKA 4XSXF 2RAEA 1IRXA 3GWZA 1B8IA 4R1HA 1QBJA 1Z3XA 1D0ZA 2JA5J 3HEFA 3HRUA 4NQWB 3ZCOA 2D1VA 5HLHA 3FXKA 4XIDA 2M30A 5AIQA 3EYYA 2O3FA 3BQZA 5J1YA 1MMAA 1X1AA 4RB1A 3BJOA 2RC4A 5EF6A 2EILH 1QPIA 1F43A 3BP8A 3RIRA 1ZGWA 1Q1VA 1JT6A 3ZQQA 2FQ3A 1JUMA 1YE9A 3N05A 2CV0A 3RZDJ 4IO9F 1GT0C 4Q48A 1TP4A 1FY7A 2O8XA 2W48A 4C2TA 2V1DA 3KCCA 1QQIA 2E2IJ 3PJRA 2HVQA 4A69C 1Z1DA 2E36A 1SVMA 1WJDA 3VB2A 2GXGA 2XIGA 4RDUA 3QPSA 1YIOA 2CW8A 4RAFA 3I71A 1K6OA 1GLNA 4EJVA 1Z9CA 2FMYA 4D5CA 4ZTJA 4UUSA 1FC3A 2H8WA 3SEZA 2DMNA 3JRDA 3KLOA 4I76A 3TO7A 3I56I 2KKOA 2L5QA 1S7OA 2ETHA 4XKBA 2ICWG 3J81Z 2OD5A 3NARA 2VJJA 3GVAA 5AIPA 5F0HA 2QKMB 2R7QA 2W57A 1RUNA 2GM4A 2KRCA 2EB7A 2QZ8A 5E8GA 5LEJA 1BI1A 2CH0A 3ZQ7A 3G3ZA 1WJ5A 4LFUA 3U9GA 1MZBA 1XMAA 1ZN2A 2Q1ZB 4DYRA 1FT9A 3S1MJ 2KHMA 1V54H 3P9KA 5K5OA 5HLTA 1XTAA 2OA4A 3E6BA 2XGCA 3FM3A 2K27A 1U5TB 1Y0NA 3ELKA 4B44A 3U1DA 1FX7A 4Q5SF 1BR2A 2DA4A 1BW6A 1X1PA 2COMA 2EIKH 2PJRB 5E3OA 1DU0A 5LRSA 1BJZA 4AYBA 3GW2A 3ABMH 3ZRGA 1V5EA 4ENKA 1YX3A 4V19K 2VT3A 2FE3A 1WCMJ 3CD6I 2H1LA 4JK1X 2L4AA 2VLAA 1X1DA 2FQ4A 2L9VA 1D8KA 3VYTB 4K2EA 1LVAA 4KT6A 1I3QJ 2KIQA 2R7OA 4JQFA 1Z7UA 1UELB 3CESA 3GZNB 1G4DA 1TNSA 2RQPA 1GVJA 1RKTA 3TEDA 4HF2A 4BEHA 4G6QA 3SZGA 2R7ZJ 4C3HJ 2QBYA 2I8DA 2R7XA 4ESJA 4C3JJ 3F21A 1IV6A 1LJ9A 2DAOA 2F2EA 2FOWA 2LBFA 2YX4A 2ZJ2A 5GP9A 4L9TA 2K5CA 4H4KC 1U8RA 5BNGA 5EGOB 4CA0A 4ENMA 4D7MA 2HXOA 1DUXC 4W97A 3M8JA 5H20A 2W4SA 2X51A 3O8HA 1Z6TA 1IV8A 1RPWA 2ZFWA 3F22A 4G7OF 3G1LA 4MEYF 1W0UA 2CYYA 2O6GE 2JQ7A 4IQ4A 5E79C 3ZOBA 1J5YA 4OMYA 1YW8A 3QAHA 3PM1A 4OOIA 5CQEA 4A3EJ 3VSKA 1Y1WJ 4EM0B 3BR2A 3H5NA 1HW1A 1XD7A 3AG3H 1BR4A 3GXOA 2QQBA 5EZHA 2K40A 4AVZA 4HNTA 3GTOJ 5FLMJ 4BQNA 2IS6A 3S3OA 1A6IA 2DFFA 2P7CB 2R7VA 2OZ6A 4OU0A 3I59A 3H3ZA 2K7LA 5F6FA 2JTVA 5ILVA 5LRRA 4OMZA 2LKPA 2AXTC 2ESNA 4NB5A 3CJRB 4XRSG 5JVTA 3QU3A 1OCTC 3SFZA 4ETSA 1BI2A 4XKCA 4E4HA 3M7GA 1R4MB 2O5RA 4BAYA 2V9PA 4HG2A 1FYMA 4LIVA 1K83J 2IJLA 3BCBA 1UG2A 5FROA 1VFCA 3HOSA 1YRNA 4C3IJ 2DK5A 2NVQJ 2EH3A 4KIFA 1XSDA 1H0MA 3ZQIA 2HZTA 4QIWN 2ACJA 2X9DA 2C6YA 2DDAA 1IN6A 2JRMA 2X4HA 3E5QA 3W3CA 5FJ8J 3OSGA 1D5YA 1HKTA 1S6LA 4OIQF 4HX4A 3OL3A 3DEEA 3EQLF 1FIPA 5CVIA 5F1RA 3A02A 1MSEC 3HSEA 3BTIA 5K7FA 5C3EJ 4M73A 2OUMA 3CC2I 5ICEA 3BZKA 3S14J 3BR6A 1FBUA 1K7AA 4DGWB 3CJTB 4PDKA 2A5WA 2DPUA 4IHYA 4BGDA 4Z6YA 2FF4A 1X1CA 2DQRA 4DZPA 3A2KA 2VBXA 4WXHA 4I99C 2ZNZA 5JFRA 2Q2EA 2FBIA 4A3BJ 4IPAA 2QQ8A 4KIGA 3BZCA 2STWA 3E6CC 3WG7H 3KEYA 3HPHA 4BHBA 5M3MJ 3GYHX 2CU7A 5J40A 2DW4A 3PSFA 4FHTA 2CRGA 2X6YA 2Q8KA 4CYCB 1HOMA 2ZBKA 4DZJA 2L9NA 1TQPA 4MIMA 1E17A 3DTKA 4NUBA 4E7SA 3K1NA 4FTHA 1R23A 1LVKA 2DOAA 2LF7A 3GEZA 5IYBJ 4BE1A 2NAZA 4BL0B 1NK3P 1R36A 4R79A 2HU9A 2VQCA 1P92A 1ZG5A 5EDNA 1XCBA 2P81A 2PQ8A 2ZXIA 3OV8A 3RTRA 1U9OA 1XSXA 1L3LA 1OMIA 2M7BA 2WAFA 3DBLB 5FD6A 1UB9A 4CH7A 2X6OA 3D5SC 2XGEA 3HB9A 5CYVA 2LY2A 2NOGA 3BWGA 3IRRA 1RUOA 2BGCA 5D6EA 2LY9A 5LBQA 4DJAA 3WHCA 2V6EA 3H3UA 2GA1A 3WGGA 2HYFA 3HKZA 4AC0A 2E2HJ 1O7LA 2LFBA 4ZDOA 3HTUA 1MNMC 4WK8F 3JRFA 5E1XA 1XMXA 3LQQA 1IN7A 5HS7A 3FXJA 3U2RA 3IAS2 3WTUC 3LA3A 3JRCA 1N78A 2ISYA 2FBKA 3HUGB 3OY9A 4LOCA 2EA4A 2OPTA 3CLQA 2DODA 1I27A 2F5VA 2W84A 3MKZA 4E7KA 4IHVA 4IHWA 3K2ZA 2KRFA 4ZC3A 3TDZC 4ABZA 2RKHA 2DA6A 2E7XA 2VODA 1ZTRA 2XDVA 1IXSB 1SFXA 1HKSA 4M3EA 3V42A 3DU6A 2QUFA 3BY6A 2L01A 2JA2A 2H6BA 1AKHA 1MKMA 1ZYRF 2YPRA 1LPQA 3W6VA 2M0MA 5FLXK 3AL0B 1DPUA 3S15J 2ME6A 4KA4A 2IA1A 1I6HJ 1PJRA 2HOEA 4BEHB 2QYOA 2X0LA 5CVRA 1FP2A 1I50J 5D6FA 4XBFA 3PFYA 5LHIA 1BOAA 5B5EC 1ZG3A 2VC0A 2Z1DA 2PMUA 1ZKGA 3VDXA 3TW7A 2A5YB 3BTLA 2DPDA 5J8FA 2DA1A 4L9VA 5IP9J 4PSWA 5M5WJ 1I5ZA 4KIBA 4NNJA 4H0EA 3TDUC 1XGNA 2HKXA 1MBEA 2IP2A 2VT2A 4XN0A 4CZZA 3KZZA 3PO2J 1YJNI 4MFDA 1RETA 3HIFA 4E6KG 3ZN1A 3AKZA 3CC4I 4IVNA 5HODA 1BR1A 2E35A 1YW9A 3TBIA 3M1EA 4WF2A 4BYYA 3UKGA 1OYWA 2GQQA 2WAQA 1YO5C 2B0LA 3ZR8X 2Y31A 4F91B 1Y6IA 1OCOH 4EQQA 3CP2A 1MH3A 3R6SA 1AHDP 2XB0X 2G9WA 5FFZA 1S3JA 4CYDA 2VPRA 3W2VA 4CCOA 3GTMJ 2TCTA 2VKDA 5J1RA 3HGGA 4RGSA 4M9SA 1PP7U 3RJPA 3CF5F 3JSOA 2LR8A 3LSRA 1S8NA 2W82A 2XAJA 3ZQFA 1ZQ3P 2NVTJ 1ZR4A 2BE5F 5J8CA 1ON2A 3BCAA 5J4VA 3AFHA 3QPTA 3L1PA 2BOLA 2DTZA 2D2WA 1EKEA 1WJBA 2Y0MA 1K78A 3LSGA 2RNGA 5ILSA 1RC9A 2OQGA 1APLC 3SYTA 3WTZA 1AWCA 2K9MA 3S2HJ 3I54A 4NC8A 4M6VA 1QU3A 1DDNA 2HPIA 3ABTA 3E7LA 4XM3A 2ELHA 3BG9A 4LK1F 5JVGF 4MEXF 4YIIA 5LGNA 1A04A 3JRGA 2Q2EB 1SD4A 2EPFA 3S93A 3G71I 2HI3A 5L3DA 4HNUA 1V5GA 2JPCA 2W85A 3HOWJ 3WU1B 1NG7A 3RPQA 3F3XA 4A6DA 5K7ZA 4RMNA 3PL8A 5ED4A 2HFHA 2DMPA 2JUCA 1Q1HA 4M9XA 3SXYA 4F55A 3KYDB 1IF1A 3IWFA 3OYNA 3T1BA 2MH9A 3G6EI 3BZ6A 3I9V2 1H88C 1XS9A 2DA7A 4XLFA 1TBXA 2DT5A 2KP6A 4AIDA 5KVRA 4CYCA 3BR0A 3ML6A 2WADA 4C9YA 2BY1A 1SANA 2OC6A 3DPUA 2K9NA 9ANTA 2F48A 2EFPA 3SDGA 4DBQA 2D45A 2L4MA 3QYEA 3WG9A 4WWCA 3ECHA 1IDZA 4CGZA 5IT3A 5M5XJ 2LYCA 3B02A 1WPKA 5H6QA 4YIFA 4KFCA 3CO6C 1FMVA 2MA3A 3WTWC 1D0YA 2ZXHA 2KRHA 3I59B 4NC6A 4LG3A 1JGGA 3HOVJ 2F6CA 1WWXA 1K79A 2ZMEB 2DFEA 5LGTA 3F8MA 1E3PA 4M6XA 2CFXA 3OYBA 5IY5H 2VKHA 4D0PA 1LE8B 2O8KA 3LSTA 5F1JA 4ZYGA 4BY1J 1VQLI 2JN6A 3ESWB 3KE2A 3CCEI 2LSOA 1P4WA 4PFPA 3OIQA 1NG6A 3S1NJ 4HX7A 1WSUA 3FBIB 2K9QA 4BBSJ 1P4XA 2HDDA 4JX5A 3ZMSA 5IOYA 4M72A 2ID3A 2JMWA 5DD8A 1ONVA 3S3MA 2V1XA 4BU2A 3CUQC 1ETOA 1YLFA 4JX6A 4U87A 1USTA 4PZJA 4O3MA 1C0WA 1QPMA 4KITB 5A2QZ 2CMPA 2WV0A 2BY2A 3KZYA 4BJ6C 1YW7A 1BA5A 3HG9A 5DYMA 5K7HA 3Q5FA 3IWZA 1WFXA 5KNLA 3C7JA 2BXYA 3FISA 3D5LA 2KIMA 3L2CA 5M3FJ 2LVSA 2VJ4A 3J7ZI 2QQ9A 3RKXA 3CCUI 1UCRA 1VQ7I 3JSPA 1ETXA 4YEJA 2ZJPF 3MZHA 3DLLF 1IN5A 3HBLA 1YI2I 3BQYA 5CLSA 3FXUA 4KMUX 1ENHA 2R3SA 3FXQA 3WODF 3LNQA 2XSJC 2L9RA 2RGVA 1HF0A 2HR3A 3RKQA 2DOFA 1OQYA 1T95A 3HSRA 3K4BA 2Y2ZA 4GFBA 3PUBA 3L7WA 1B9NA 2R7TA 4IL6C 4HSRA 3HRMA 2ME0A 1MMGA 2FUG2 2W24A 3DLAA 5FGMA 3CCQI 2YU9J 1YOVB 4ZH4F 3J7YJ 4EGYA 4HNVA 2NS7A 2LBFB 5BMZA 3LSHA 3DTIA 2KJBA 4ZYHA 1U5TA 2F4MB 5D4SA 3IRQA 4OIPF 5FKMA 1POGA 4PJNA 2ZXJA 1BC8C 1SVOA 4EM1A 4Y4RA 4R8HA 4FISA 3CCSI 1WI3A 3L2VA 1Z77A 5ERIA 1JKOC 4MGRA 1IRFA 1AU7A 3FKJA 1HDPA 2NS0A 1FMWA 2FNPA 1VQPI 3GBGA 4IZZA 4UV8A 2PMZA 2RREA 3RCOA 1B8IB 5DD4A 3FXRA 2CV1A 4DQ2A 2LH9A 5C4JJ 3OYGA 1XGOA 2ZSHB 3FWEA 1UFMA 4ESBA 1PUFB 5KAFC 3M07A 3DV8A 2DA3A 1ZARA 3KLNA 3PNYA 4XONA 1MDMB 1MMDA 1X3WB 4XLHA 1D5VA 1QVUA 2BW3A 2MLGA 2OU2A 2PMHA 3FZVA 1Z7LA 3T8RA 1W36D 2LC2A 2ZJRF 4HPQA 4M9ZA 1JUPA 3TO9A 1BBYA 4CCLA 1J75A 1XPXA 1VI0A 2VXDA 5ICFA 3MQ0A 1ETWA 4J01A 2EFQA 1FBSA 2YS9A 3PNVA 2M1BA 2R92J 3KZIC 1MGTA 2DYSH 4P1WA 4C30A 4G12A 1YITI 1HLVA 1G8XA 4A3MJ 4GGGA 3TQNA 2LY1A 2M34A 2MGQA 3H92A 3DQVC 1FTZA 2CS3A 3MKWB 1AA7A 2X48A 3GX4X 1LNWA 2RNJA 2EQRA 1VQOI 1R58A 3K10A 5IPAA 1IRGA 3CZ6A 1OCZH 1FP1D 1Y0UA 3BTCA 5FLVA 1O3RA 3IHUA 5FD5A 5JHUA 4YFNF 3UNGC 2VOPA 4RGRA 3PIPF 2XRLA 1KYWA 1K4TA 3LFKA 2D1HA 4KDPA 1LDJA 3AG1H 4BQQA 3CO7C 4UVAA 3RYPA 4AU7A 1X1BA 2M2EA 4GDFA 3WGIA 4P9FA 2LKSA 3BPVA 1EV7A 4E7JA 2DA5A 3HGYA 1MH4A 4HF1A 2STTA 4DW6A 2K9LA 1ULYA 2HDCA 3HJEA 1KA8A 4D9JA 4EATA 1X3ZB 2GAUA 3IP4B 5C4XJ 2HOAA 4M71A 3RQIA 5BS6A 2DCEA 3ABUA 3CDIA 2R7FA 4S04A 5E18F 2OQRA 2PBIA 1ZLJA 2G0EA 5D5UB 1KU3A 4BS9A 3OYMA 4I09A 2EFWA 1QGPA 2AQFA 3FF5A 1AKHB 2R7UA 1P9QC 1Z6RA 2NOJB 3H5AA 4LITA 3PUFA 1HSJA 5EGOA 3H9JA 3ZMTA 3CMYA 1LUJB 1MBJA 3EUKL 1QZZA 2DBBA 3JRHA 3NAUA 2V9VA 1G2HA 3IH3A 1ZH5A 1QHHD 1UJ8A 2OBPA 1W1WE 2F5EA 2V7FA 4II2A 3U1KA 4PUSA 1JJ6C 2A05A 1QA6A 1ZR2A 5GAHJ 2BEOA 3OMYA 1CGPA 3K70D 1U5TC 4J19A 2O0YA 3ERMA 4XRSA 1XCVA 3V7SA 3T5XA 4UUTA 2DJNA 3MZYA 1WJFA 4HSTA 1ODDA 3U21A 1BN5A 4KUMA 2IXSA 4CHUA 3MVPA 5LHHA 2E34A 3SJMA 1BL0A 3KP3A 3K4JA 2CWEA 4XNFA 1FOXA 4AUXA 2CQXA 5HDKA 3OSFA 3N4MA 5BOXA 2HOSA 2Y48A 1XC5A 2FXAA 3E3VA 1TC3C 5EJCA 3S8PA 4RB3C 1IUFA 1J2XA 3PIOF 2H6CA 1T0FC 1VQ5I 1FWZA 2CW0F 4UXNA 3KX2A 2GLOA 3FMSA 1K4SA 2RN7A 1SFKA 2UWMA 4A6EA 2RV8A 2XAUA 3DWLE 3C18A 4BACA 3HOUJ 3OS1A 4A3KJ 5A2QK 4YELA 3VPRA 2EZKA 1EA3A 2AO9A 2L2OA 4XSZF 2R7SA 2HYJA 4HAMA 1A36A 2E5NA 4KYWA 4RAZA 1UHSA 5JHFA 3F0CA
chains in the Genus database with same CATH topology
4M3EA 1ETVA 1FIAA 2HQ5A 4AYBN 3HOYJ 5E3NA 1LE8A 2H1KA 3DEWA 1AKHA 5FKOA 2EZLA 3FK7A 3W6VA 1X58A 3S15J 2ME6A 3S17J 1E3OC 1I6HJ 2CQQA 2LTPA 2YUSA 5GPAA 1QRYA 1K61A 2IAIA 3S16J 1I50J 2HOTA 4MFEA 2OF7A 3TW6A 4QSHA 2M8GX 1UMQA 4BY7J 1JTYA 1JUSA 3GTJJ 1H89C 4A3CJ 1ZKGA 3HOZJ 3TW7A 2NS8A 3BTLA 3BT9A 3MKLA 1R9TJ 2VKEA 1X2MA 4B4CA 2DA1A 5IP9J 1NTCA 5M5WJ 1YRNB 1TWGJ 4BBRJ 5E3LA 1JJ8C 5EG0B 1MBEA 2VKVA 3FK6A 3BG3A 3Q3SA 3PO2J 5J1UA 4MFDA 4V2FA 1RETA 3GTQJ 1TWFJ 3B6CA 4IEJA 3QQAA 5HODA 1BW5A 2MSYA 3UKGA 3IH4A 1IC8A 2ELKA 3I4MJ 2H8RA 2Y31A 2R5YA 2LP0A 3HM5A 3DCFA 2R0QC 1MH3A 1AHDP 1RESA 2ECBA 2XB0X 1B72A 3S1QJ 1O4XA 1GVDA 2VPRA 3GTMJ 2TCTA 2JWTA 4MLOA 3HGGA 1P7JA 5J1RA 2LR8A 3LSRA 2R93J 3GTKJ 3ZQFA 1ZQ3P 2NVTJ 1ZR4A 4D5FA 1LFUP 1WGXA 4M3DA 3BTJA 3L1PA 4Y7NJ 2DTZA 1F36A 3HOXJ 1WH5A 4NDLA 2GBYA 3LSGA 1APLC 3CCYA 3K7AJ 1SFOJ 2Y9YA 1U78A 3S2HJ 4M6VA 2E2JJ 4IHXA 3E7LA 5F08A 3JRAA 1JKRC 1PUFA 4L5EA 3LSPA 3BG9A 4S0HB 2EZIA 2DA2A 3BR1A 1JKQC 2QF7A 2DMUA 3JRGA 3GTPJ 5IOZA 5IYDJ 3BR3A 2HXIA 4X1EA 3ZQHA 2HI3A 3HOWJ 3M3YJ 1ETYA 2WV1A 5IP7J 1ETKA 1Y1VJ 5K7ZA 5M5YJ 2VI6A 2XPUA 2DMPA 2K9SA 3Q0WA 2FJ1A 3IH2A 5EG0A 1EF4A 4A3FJ 4XICA 4JP0A 4FCYA 1MBGA 3H0GJ 1X2NA 2I10A 1IJWC 1H88C 2LKXA 1XS9A 1JT0A 2DA7A 3S2DJ 1HCRA 5DTDA 2Y9ZA 4CYCA 3BR0A 1GUUA 2LK2A 4UUSB 1SANA 4M3BA 1LFBA 9ANTA 2K9NA 3FIWA 3SDGA 5IP6A 2XSDC 1A5JA 2LLKA 1IDZA 2RAEA 4A93J 1B8IA 1OCPA 5M5XJ 4D7NA 2R5ZB 2JA5J 1MBHA 1WPKA 4FE7A 1GV5A 3HEFA 3GTLJ 4XIDA 3BQZA 5J1YA 5FKKA 1JGGA 3HOVJ 4QTRA 2B63J 5EF6A 5EEAA 1QPIA 1F43A 1ZGWA 1Q1VA 1JT6A 3OIOA 1JUMA 1OFCX 1LE8B 1GDTA 2O8KA 2JK3A 1P7IA 3I4NJ 5F1JA 1T56A 3RZDJ 4BY1J 2JN6A 1GT0C 2COBA 1VNDA 2W48A 3JRBA 2XPWA 2Y0SN 2E2IJ 3S1NJ 4A69C 2K9QA 4BBSJ 2HDDA 4JX5A 3ZQCA 5IOYA 2ID3A 2JMWA 4RDUA 3QPSA 5FKNA 2JA8J 1RKWA 1ETOA 2L7FP 4JX6A 2JA7J 1RR7A 4D5CA 2DMTA 4UUSA 1BA5A 2DMNA 3JRDA 5EZGA 4I76A 5K7HA 4XK4A 3MN2A 1FTTA 1JTXA 2ID6A 3CDLA 3FISA 3NARA 5M3FJ 2LVSA 5F0HA 2FX0A 4X6AJ 2PMZN 2GM4A 3BR5A 1W0TA 1ETXA 2AHQA 3HBLA 3BQYA 5C44J 4DYRA 3S1MJ 1ENHA 2VUMJ 3LNQA 1GV2A 1WH7A 2L9RA 5JLXA 1HF0A 5F04A 2CUFA 2XGCA 3RKQA 5J3LA 1S7EA 2EBIA 2R5ZA 2MW8A 1U9NA 2Y2ZA 3LSJA 4GFBA 2DA4A 1BW6A 2ME0A 5E3OA 1DU0A 1BJZA 2XPVA 4B1RA 2YU9J 1HDDC 3G1MA 4HNVA 2NS7A 4DYCA 1OJLA 4RBOA 3C2BA 2M9HA 3K2AA 5FKMA 1WCMJ 4XRMA 1POGA 2XB5A 3HKZN 2LD5A 4FISA 2FQ4A 1WI3A 1Z77A 1I3QJ 1JKOC 2CJJA 1AU7A 1HDPA 5GPCA 1RKTA 3TEDA 3GBGA 1B8IB 4A3JJ 2R7ZJ 4C3HJ 1FEXA 4C3JJ 1IV6A 5C4JJ 2L0KA 1PUFB 2R5YB 5GP9A 1ETQA 4JX4A 2N8GA 2DA3A 5BNGA 5EGOB 4D7MA 2HXOA 1QVUA 1B72B 4W97A 3O8HA 4C2MJ 1RPWA 3G1LA 1JUPA 2WB1N 1W0UA 1VI0A 3Q0VA 3FKIJ 3ZOBA 4DYQA 2KT0A 3PM1A 3JRIA 1IG7A 1ETWA 1TWHJ 1ORKA 5DS9A 2YS9A 4A3EJ 2R92J 5IYCJ 1Y1WJ 2JA6J 3BR2A 4G12A 4M3FA 1HLVA 5JLWA 2L7ZA 1DU6A 4A3MJ 3S1RJ 5EZHA 2K40A 5EYRA 3GTOJ 5FLMJ 2M34A 2MGQA 1A6IA 3A01A 1FTZA 4V2GA 2X48A 5F27A 2NVYJ 2EQRA 3QPLA 4FE4A 3CQZJ 5IPAA 1MBKA 5FLVA 3BTCA 2CUEA 3TP3A 5FKLA 2WAQN 4XRSG 1OCTC 3HDDA 4BXXJ 3H3VK 4BKXA 5F0CA 2XRLA 2FD5A 1MBFA 3G1OA 1CQTA 3RZOJ 1K83J 1MSFC 1UG2A 2IBDA 2D5VA 1VFCA 1YRNA 3JREA 4C3IJ 2NVQJ 4EEFG 2EH3A 2L7MP 2M2EA 3ZQIA 4QIWN 2X9DA 5FJ8J 3SFIA 3OSGA 1D5YA 2DA5A 1FIPA 3HGYA 3A02A 1MH4A 1MSEC 3BTIA 4DW6A 3TP0A 5K7FA 5C3EJ 2ECCA 2JJ7A 3S14J 3BR6A 1NK2P 5C4XJ 4I6ZA 2HOAA 1TWAJ 2EZHA 3RQIA 4IHYA 4A3IJ 4DZPA 2E1OA 2KDZA 2G0EA 3PO3J 1U8BA 4A3BJ 2NVXJ 1IDYA 1AKHB 1H8AC 2IEKA 5M3MJ 1QVTA 3Q0UA 3D1NI 1XG1A 2CU7A 4B3AA 1HOMA 2CRGA 5EGOA 4CYCB 2E19A 4DZJA 3CMYA 4M3GA 4MIMA 3GTGJ 2MG4A 1MBJA 4FTHA 1JKPC 1IRZA 5F0FA 3JRHA 3NAUA 5IYBJ 1G2HA 3IH3A 1NK3P 4MO7A 2Y30A 3B6AA 1FJLA 4JYKA 1JJ6C 5EDNA 2ZB9A 2P81A 1ZR2A 1U9OA 2O9LA 4A3DJ 3A03A 3JR9A 4J19A 4W1UA 4XRSA 2X6OA 2XGEA 2DJNA 3HB9A 4UUTA 2NOGA 2LY9A 4A3LJ 3OOUA 3MVPA 3WHCA 1Z0XA 2QCOA 3SJMA 3IV5A 1BL0A 3O8GA 2E2HJ 4A3GJ 4AC0A 2LFBA 1T33A 4AUXA 2CQXA 3OSFA 3LOCA 2DN0A 1MNMC 2TRTA 2HOSA 3JRFA 1XC5A 1TC3C 1IUFA 2DMQA 5E3MA 2GLOA 1ITYA 1VF9A 3JRCA 3HOUJ 4A3KJ 3VPRA 2EZKA 3WHBA 3ZQLA 4LOCA 4Y52J 2AO9A 2O7OA 2OPTA 2XGDA 3M4OJ 1ZK8A 2M0CA 1IGNA 2HYJA 3ZQGA 4IHVA 4IHWA 3A01B 4ABZA 1TWCJ 1UHSA 3BG5A 2DA6A 3F0CA 1ZTRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3E A;  1ETV A;  1FIA A;  2HQ5 A;  4AYB N;  3HOY J;  5E3N A;  1LE8 A;  2H1K A;  3DEW A;  1AKH A;  5FKO A;  2EZL A;  3FK7 A;  3W6V A;  1X58 A;  3S15 J;  2ME6 A;  3S17 J;  1E3O C;  1I6H J;  2CQQ A;  2LTP A;  2YUS A;  5GPA A;  1QRY A;  1K61 A;  2IAI A;  3S16 J;  1I50 J;  2HOT A;  4MFE A;  2OF7 A;  3TW6 A;  4QSH A;  2M8G X;  1UMQ A;  4BY7 J;  1JTY A;  1JUS A;  3GTJ J;  1H89 C;  4A3C J;  1ZKG A;  3HOZ J;  3TW7 A;  2NS8 A;  3BTL A;  3BT9 A;  3MKL A;  1R9T J;  2VKE A;  1X2M A;  4B4C A;  2DA1 A;  5IP9 J;  1NTC A;  5M5W J;  1YRN B;  1TWG J;  4BBR J;  5E3L A;  1JJ8 C;  5EG0 B;  1MBE A;  2VKV A;  3FK6 A;  3BG3 A;  3Q3S A;  3PO2 J;  5J1U A;  4MFD A;  4V2F A;  1RET A;  3GTQ J;  1TWF J;  3B6C A;  4IEJ A;  3QQA A;  5HOD A;  1BW5 A;  2MSY A;  3UKG A;  3IH4 A;  1IC8 A;  2ELK A;  3I4M J;  2H8R A;  2Y31 A;  2R5Y A;  2LP0 A;  3HM5 A;  3DCF A;  2R0Q C;  1MH3 A;  1AHD P;  1RES A;  2ECB A;  2XB0 X;  1B72 A;  3S1Q J;  1O4X A;  1GVD A;  2VPR A;  3GTM J;  2TCT A;  2JWT A;  4MLO A;  3HGG A;  1P7J A;  5J1R A;  2LR8 A;  3LSR A;  2R93 J;  3GTK J;  3ZQF A;  1ZQ3 P;  2NVT J;  1ZR4 A;  4D5F A;  1LFU P;  1WGX A;  4M3D A;  3BTJ A;  3L1P A;  4Y7N J;  2DTZ A;  1F36 A;  3HOX J;  1WH5 A;  4NDL A;  2GBY A;  3LSG A;  1APL C;  3CCY A;  3K7A J;  1SFO J;  2Y9Y A;  1U78 A;  3S2H J;  4M6V A;  2E2J J;  4IHX A;  3E7L A;  5F08 A;  3JRA A;  1JKR C;  1PUF A;  4L5E A;  3LSP A;  3BG9 A;  4S0H B;  2EZI A;  2DA2 A;  3BR1 A;  1JKQ C;  2QF7 A;  2DMU A;  3JRG A;  3GTP J;  5IOZ A;  5IYD J;  3BR3 A;  2HXI A;  4X1E A;  3ZQH A;  2HI3 A;  3HOW J;  3M3Y J;  1ETY A;  2WV1 A;  5IP7 J;  1ETK A;  1Y1V J;  5K7Z A;  5M5Y J;  2VI6 A;  2XPU A;  2DMP A;  2K9S A;  3Q0W A;  2FJ1 A;  3IH2 A;  5EG0 A;  1EF4 A;  4A3F J;  4XIC A;  4JP0 A;  4FCY A;  1MBG A;  3H0G J;  1X2N A;  2I10 A;  1IJW C;  1H88 C;  2LKX A;  1XS9 A;  1JT0 A;  2DA7 A;  3S2D J;  1HCR A;  5DTD A;  2Y9Z A;  4CYC A;  3BR0 A;  1GUU A;  2LK2 A;  4UUS B;  1SAN A;  4M3B A;  1LFB A;  9ANT A;  2K9N A;  3FIW A;  3SDG A;  5IP6 A;  2XSD C;  1A5J A;  2LLK A;  1IDZ A;  2RAE A;  4A93 J;  1B8I A;  1OCP A;  5M5X J;  4D7N A;  2R5Z B;  2JA5 J;  1MBH A;  1WPK A;  4FE7 A;  1GV5 A;  3HEF A;  3GTL J;  4XID A;  3BQZ A;  5J1Y A;  5FKK A;  1JGG A;  3HOV J;  4QTR A;  2B63 J;  5EF6 A;  5EEA A;  1QPI A;  1F43 A;  1ZGW A;  1Q1V A;  1JT6 A;  3OIO A;  1JUM A;  1OFC X;  1LE8 B;  1GDT A;  2O8K A;  2JK3 A;  1P7I A;  3I4N J;  5F1J A;  1T56 A;  3RZD J;  4BY1 J;  2JN6 A;  1GT0 C;  2COB A;  1VND A;  2W48 A;  3JRB A;  2XPW A;  2Y0S N;  2E2I J;  3S1N J;  4A69 C;  2K9Q A;  4BBS J;  2HDD A;  4JX5 A;  3ZQC A;  5IOY A;  2ID3 A;  2JMW A;  4RDU A;  3QPS A;  5FKN A;  2JA8 J;  1RKW A;  1ETO A;  2L7F P;  4JX6 A;  2JA7 J;  1RR7 A;  4D5C A;  2DMT A;  4UUS A;  1BA5 A;  2DMN A;  3JRD A;  5EZG A;  4I76 A;  5K7H A;  4XK4 A;  3MN2 A;  1FTT A;  1JTX A;  2ID6 A;  3CDL A;  3FIS A;  3NAR A;  5M3F J;  2LVS A;  5F0H A;  2FX0 A;  4X6A J;  2PMZ N;  2GM4 A;  3BR5 A;  1W0T A;  1ETX A;  2AHQ A;  3HBL A;  3BQY A;  5C44 J;  4DYR A;  3S1M J;  1ENH A;  2VUM J;  3LNQ A;  1GV2 A;  1WH7 A;  2L9R A;  5JLX A;  1HF0 A;  5F04 A;  2CUF A;  2XGC A;  3RKQ A;  5J3L A;  1S7E A;  2EBI A;  2R5Z A;  2MW8 A;  1U9N A;  2Y2Z A;  3LSJ A;  4GFB A;  2DA4 A;  1BW6 A;  2ME0 A;  5E3O A;  1DU0 A;  1BJZ A;  2XPV A;  4B1R A;  2YU9 J;  1HDD C;  3G1M A;  4HNV A;  2NS7 A;  4DYC A;  1OJL A;  4RBO A;  3C2B A;  2M9H A;  3K2A A;  5FKM A;  1WCM J;  4XRM A;  1POG A;  2XB5 A;  3HKZ N;  2LD5 A;  4FIS A;  2FQ4 A;  1WI3 A;  1Z77 A;  1I3Q J;  1JKO C;  2CJJ A;  1AU7 A;  1HDP A;  5GPC A;  1RKT A;  3TED A;  3GBG A;  1B8I B;  4A3J J;  2R7Z J;  4C3H J;  1FEX A;  4C3J J;  1IV6 A;  5C4J J;  2L0K A;  1PUF B;  2R5Y B;  5GP9 A;  1ETQ A;  4JX4 A;  2N8G A;  2DA3 A;  5BNG A;  5EGO B;  4D7M A;  2HXO A;  1QVU A;  1B72 B;  4W97 A;  3O8H A;  4C2M J;  1RPW A;  3G1L A;  1JUP A;  2WB1 N;  1W0U A;  1VI0 A;  3Q0V A;  3FKI J;  3ZOB A;  4DYQ A;  2KT0 A;  3PM1 A;  3JRI A;  1IG7 A;  1ETW A;  1TWH J;  1ORK A;  5DS9 A;  2YS9 A;  4A3E J;  2R92 J;  5IYC J;  1Y1W J;  2JA6 J;  3BR2 A;  4G12 A;  4M3F A;  1HLV A;  5JLW A;  2L7Z A;  1DU6 A;  4A3M J;  3S1R J;  5EZH A;  2K40 A;  5EYR A;  3GTO J;  5FLM J;  2M34 A;  2MGQ A;  1A6I A;  3A01 A;  1FTZ A;  4V2G A;  2X48 A;  5F27 A;  2NVY J;  2EQR A;  3QPL A;  4FE4 A;  3CQZ J;  5IPA A;  1MBK A;  5FLV A;  3BTC A;  2CUE A;  3TP3 A;  5FKL A;  2WAQ N;  4XRS G;  1OCT C;  3HDD A;  4BXX J;  3H3V K;  4BKX A;  5F0C A;  2XRL A;  2FD5 A;  1MBF A;  3G1O A;  1CQT A;  3RZO J;  1K83 J;  1MSF C;  1UG2 A;  2IBD A;  2D5V A;  1VFC A;  1YRN A;  3JRE A;  4C3I J;  2NVQ J;  4EEF G;  2EH3 A;  2L7M P;  2M2E A;  3ZQI A;  4QIW N;  2X9D A;  5FJ8 J;  3SFI A;  3OSG A;  1D5Y A;  2DA5 A;  1FIP A;  3HGY A;  3A02 A;  1MH4 A;  1MSE C;  3BTI A;  4DW6 A;  3TP0 A;  5K7F A;  5C3E J;  2ECC A;  2JJ7 A;  3S14 J;  3BR6 A;  1NK2 P;  5C4X J;  4I6Z A;  2HOA A;  1TWA J;  2EZH A;  3RQI A;  4IHY A;  4A3I J;  4DZP A;  2E1O A;  2KDZ A;  2G0E A;  3PO3 J;  1U8B A;  4A3B J;  2NVX J;  1IDY A;  1AKH B;  1H8A C;  2IEK A;  5M3M J;  1QVT A;  3Q0U A;  3D1N I;  1XG1 A;  2CU7 A;  4B3A A;  1HOM A;  2CRG A;  5EGO A;  4CYC B;  2E19 A;  4DZJ A;  3CMY A;  4M3G A;  4MIM A;  3GTG J;  2MG4 A;  1MBJ A;  4FTH A;  1JKP C;  1IRZ A;  5F0F A;  3JRH A;  3NAU A;  5IYB J;  1G2H A;  3IH3 A;  1NK3 P;  4MO7 A;  2Y30 A;  3B6A A;  1FJL A;  4JYK A;  1JJ6 C;  5EDN A;  2ZB9 A;  2P81 A;  1ZR2 A;  1U9O A;  2O9L A;  4A3D J;  3A03 A;  3JR9 A;  4J19 A;  4W1U A;  4XRS A;  2X6O A;  2XGE A;  2DJN A;  3HB9 A;  4UUT A;  2NOG A;  2LY9 A;  4A3L J;  3OOU A;  3MVP A;  3WHC A;  1Z0X A;  2QCO A;  3SJM A;  3IV5 A;  1BL0 A;  3O8G A;  2E2H J;  4A3G J;  4AC0 A;  2LFB A;  1T33 A;  4AUX A;  2CQX A;  3OSF A;  3LOC A;  2DN0 A;  1MNM C;  2TRT A;  2HOS A;  3JRF A;  1XC5 A;  1TC3 C;  1IUF A;  2DMQ A;  5E3M A;  2GLO A;  1ITY A;  1VF9 A;  3JRC A;  3HOU J;  4A3K J;  3VPR A;  2EZK A;  3WHB A;  3ZQL A;  4LOC A;  4Y52 J;  2AO9 A;  2O7O A;  2OPT A;  2XGD A;  3M4O J;  1ZK8 A;  2M0C A;  1IGN A;  2HYJ A;  3ZQG A;  4IHV A;  4IHW A;  3A01 B;  4ABZ A;  1TWC J;  1UHS A;  3BG5 A;  2DA6 A;  3F0C A;  1ZTR A; 
#chains in the Genus database with same CATH topology
 2JUG A;  1FIA A;  3IKT A;  3OYK A;  3F23 A;  1R4N B;  3VYR B;  2H1K A;  3W2A A;  3DEW A;  4L5J A;  1T8I A;  5FKO A;  2EZL A;  3FK7 A;  2EK5 A;  4LLL A;  1FLI A;  3FHZ A;  2BHZ A;  2M5W A;  1M1E B;  2QEX I;  3DKY A;  5HOO A;  4LJZ F;  1FPQ A;  1U0J A;  4P55 A;  4OAZ A;  3DPL C;  3JTG A;  1QRY A;  1KYZ A;  1GXQ A;  5ILU A;  3HXL A;  1DGW Y;  1P6R A;  5EEG A;  4XKV A;  3S16 J;  2HOT A;  2QSG X;  3O3K A;  3QOE A;  3TW6 A;  4QSH A;  2M8G X;  1BI0 A;  1JTY A;  1PP8 F;  4HRI A;  3G2B A;  1SAX A;  2LOO A;  2NS8 A;  3MKL A;  2EV5 A;  1R9T J;  3GF2 A;  2HYG D;  4B4C A;  2E5Z A;  1NTC A;  4MHG A;  4BXF A;  1YRN B;  3HYI A;  5DCM A;  1YHQ I;  1LKX A;  4E70 A;  1T2K A;  2LNB A;  3W6K B;  3GFI A;  1G3S A;  5L3B A;  5LGU A;  1CF7 A;  2YU3 A;  4II3 A;  3GTQ J;  1ZGJ A;  3QP6 A;  2L9S A;  4D1Q A;  3WTY C;  3NWS A;  1BW5 A;  2MFZ A;  2MC3 A;  2MSY A;  2E1C A;  2M4K A;  3AG2 H;  2VOO A;  4NQW A;  3ZPL A;  1VQN I;  3IH4 A;  1KU9 A;  2IS2 A;  4WXD A;  2H8R A;  4UNO A;  1HBX G;  3ZMZ A;  2R5Y A;  3L9F A;  2HEO A;  2LP0 A;  2R0Q C;  3NWT A;  3MFK A;  3S1Q J;  1O4X A;  1RRJ A;  2CUJ A;  3JW4 A;  4UVC A;  1P7J A;  3K69 A;  4OIO F;  4NHJ A;  3FX3 A;  5CKT A;  3GTK J;  4GCV A;  4U7B A;  4IKF A;  3F8N A;  3CDH A;  2LF8 A;  1VQK I;  1AOY A;  4D5F A;  2PEX A;  4AIH A;  4AIK A;  4X0G A;  1LFU P;  3BTJ A;  2E1M B;  4PJM A;  3KP7 A;  1TQM A;  1F36 A;  4UVB A;  3LSI A;  1X4O A;  2CQN A;  2BY3 A;  1REP C;  4RAY A;  2M7A A;  1SFE A;  4DOZ A;  1MMS A;  2UXN A;  3CCY A;  2R7W A;  2KZG A;  4E7I A;  2DYR H;  2GIV A;  1SFO J;  2WB1 A;  2Y9Y A;  1IN4 A;  3LAP A;  1U78 A;  2E2J J;  4BXU A;  2ZCW A;  2DJI A;  1U2W A;  3E0J B;  3LL7 A;  3TOB A;  4DIQ A;  3JTH A;  2LMD A;  4KMF A;  4L5E A;  1MMN A;  2H94 A;  4S0H B;  1FOY A;  3TKY A;  2EZI A;  1X19 A;  1FOK A;  4MTE A;  5IYD J;  1O3S A;  3GTP J;  5IOZ A;  3BR3 A;  2BVL A;  2HXI A;  4HZF A;  2BV6 A;  2JPB A;  3VOD A;  2HQN A;  4XQF A;  3M3Y J;  1FSE A;  2A6H F;  2WV1 A;  2W1O A;  1TT5 B;  2H09 A;  2HVS A;  5FRN A;  5M5Y J;  1SC7 A;  1FYL A;  2VI6 A;  2F5D A;  1WJE A;  5B1B H;  1XGM A;  4ZYD A;  2XF7 A;  5EG0 A;  1EF4 A;  1TQI A;  4XIC A;  1OR7 C;  2EV0 A;  2W00 A;  3HHG A;  4G8X A;  2XC7 A;  4UY8 I;  4FCY A;  3E1S A;  4U0Y A;  1D1B A;  2FBH A;  3CLO A;  1MDM A;  1HCR A;  3I58 A;  5DTD A;  3K4N A;  4KN7 X;  5GAG J;  3BG6 A;  1ZRE A;  2K85 A;  3C3W A;  2P4W A;  4HLX A;  4N4O B;  1JHH A;  4QPQ A;  4UV9 A;  4LGW A;  5E8I A;  3DBR B;  3C2H A;  2UUZ A;  4A93 J;  4D7N A;  1MJ9 A;  3OS0 A;  1MBH A;  4G6D A;  1GV5 A;  1L0O C;  2EIM H;  3GTL J;  3ZP5 A;  4KIC A;  3RI4 A;  2GOM A;  1KQ0 A;  1R71 A;  5FKK A;  1T08 B;  3E6M A;  4OWR B;  2A07 F;  1XB4 A;  4QTR A;  5EEA A;  1QO0 D;  3TO6 A;  3M1C A;  2HVR A;  3W2W A;  5FO5 A;  2RDP A;  1A31 A;  2Z5U A;  4BE0 A;  1GDT A;  2IGM A;  2JK3 A;  1P7I A;  3ECO A;  1R5H A;  3F8F A;  5D5X B;  3I4N J;  1RNL A;  1EH8 A;  3CC7 I;  2VBZ A;  3OYI A;  1IZ1 A;  2IPQ X;  2P8T A;  2PN6 A;  2DQL A;  1BIB A;  2Y0S N;  1BM9 A;  5DUI A;  3KIO A;  3S3N A;  5E17 F;  5JR3 A;  2CG4 A;  3ZQC A;  4YFX F;  4G7Z F;  2IGK A;  3K1P A;  1MND A;  2AXL A;  3LWF A;  4QPO A;  5FKN A;  2JA8 J;  1BIA A;  2JA7 J;  3H5R A;  4B3X A;  3K4C A;  1RR7 A;  1K78 B;  3FBN B;  3RSN A;  2FA5 A;  2DMT A;  4Y15 A;  1FBQ A;  4UHT A;  5J6X A;  1SMT A;  2OZU A;  1ZAO A;  4LG0 B;  1ZGA A;  3H36 A;  3MN2 A;  1FTT A;  1JTX A;  2ID6 A;  4I02 A;  2A3S A;  4B8X A;  2FX0 A;  3ABL H;  4X6A J;  3WU2 C;  3CTA A;  1O3T A;  1H9T A;  2EIJ H;  3F8B A;  1O57 A;  1G3W A;  3O2P E;  5CJ9 A;  3CME I;  1UZC A;  4LK0 F;  2CGP A;  1YQA A;  3OYJ A;  4LB6 B;  4L18 B;  1WH7 A;  2PG4 A;  1DPR A;  5JLX A;  1LB2 A;  5L3E A;  4I0A A;  3HL2 A;  2CUF A;  3GLL A;  2TDX A;  1HST A;  4P5O A;  2MW8 A;  1U9N A;  1S9H A;  3LSJ A;  4L0Y B;  2WY7 Q;  1K6Y A;  2DK8 A;  4OAY A;  2F4O B;  4Y3O A;  1WKM A;  2XPV A;  4KNY A;  2VAS A;  3G1M A;  3SDB A;  4CDG A;  1R49 A;  1OJL A;  1XDU A;  1KQ8 A;  4RBO A;  2P7V B;  2BYV E;  2XB5 A;  4XLE A;  2WY8 Q;  4BQA A;  3P5J A;  2LD5 A;  5HNF A;  4LLG F;  4YIR X;  3ERE D;  1RR8 C;  2K3P A;  3JAM Z;  5D5W B;  2MYS A;  2X1C A;  3I55 I;  2E60 A;  4G6T B;  4RB0 A;  3FXM A;  4LB5 A;  3ZMD A;  4PGG A;  4ITV A;  5TRD A;  1A6Q A;  3OYF A;  4PFO A;  3BLY A;  3OYE A;  3PNT A;  5CVJ A;  1ETQ A;  4JX4 A;  2N8G A;  1TW2 A;  3R60 A;  2BBY A;  4PGH A;  3V4G A;  4C2U A;  4NC7 A;  3J7A O;  1U3E M;  2EV6 A;  2DT6 A;  1B72 B;  2CFO A;  4XOR A;  1O7F A;  4EJT A;  4I0B A;  4C2M J;  4ZDL A;  2NNY A;  1VTN C;  2OJE D;  2WB1 N;  2HQR A;  2EFN A;  2QVO A;  3RPU A;  3Q0V A;  2E1N A;  4DYQ A;  4IJA A;  5CVU A;  3JRI A;  2QKL B;  4AVP A;  1TWH J;  3V7R A;  4UUV A;  1V55 H;  5DDG A;  2ZME C;  1F4K A;  2JA6 J;  5IT9 K;  3ASN H;  3K4L A;  1E3H A;  4B47 A;  3QU6 A;  1UG0 A;  3S1R J;  4HW0 A;  4AM3 A;  5DM7 F;  2P5K A;  4RS8 A;  1VQ4 I;  2HTJ A;  4V2G A;  2EA2 A;  1D1C A;  3QPL A;  4FE4 A;  4WCG A;  4EJU A;  3TP3 A;  4B09 A;  2HGC A;  5FKL A;  3PSI A;  3W6J B;  3ONQ A;  1TT0 A;  2IW5 A;  3WE3 A;  1CF7 B;  1UAA A;  3HDD A;  4BXX J;  3T0Y A;  5JI6 A;  3H3V K;  3C1D A;  3DBH B;  5F0C A;  2OAZ A;  2FD5 A;  1MBF A;  3G1O A;  1KU2 A;  2XAG A;  3L00 A;  1CQT A;  2DFI A;  3RZO J;  2Y69 H;  3H9Q A;  3N97 A;  2IBD A;  1MSF C;  1MW7 A;  1P4A A;  2O03 A;  2BZT A;  2L7M P;  4DBR A;  2HPM A;  1HA8 A;  3HOT A;  1F5T A;  2R4G A;  3ULQ B;  5E1W A;  3SQN A;  3TP0 A;  1WI9 A;  5BPI A;  3DKX A;  4FT8 A;  2JJ7 A;  1QNT A;  5CQG A;  5H2F C;  1NK2 P;  1TWA J;  2EZH A;  2LRE A;  1VZ0 A;  4A3I J;  2E1O A;  3CMM A;  3A1Y A;  1OKR A;  3PO3 J;  1U8B A;  4I7H A;  4XL9 A;  5CPR B;  2J5P A;  1XX5 A;  2HZD A;  1X3U A;  1R5G A;  5HS8 A;  1F9N A;  2QGU A;  4RM3 A;  1EH7 A;  2FML A;  4Q47 A;  4EVI A;  3I5U A;  2XF5 A;  4I01 A;  4BDZ A;  2Y0S A;  4B3A A;  3CMA I;  4A5M A;  4AIJ A;  4M3G A;  2GZW A;  2UXX A;  3J7A Y;  1WRJ A;  3GTG J;  1STZ A;  3EUH A;  1ERD A;  3ROU A;  5F0F A;  2VC1 A;  3KP2 A;  1HW2 A;  3B6A A;  1FNN A;  1PYV A;  2ZB9 A;  2MAB A;  2V4J C;  1Z91 A;  2G7U A;  2M87 A;  3HTS B;  3JR9 A;  3CCV I;  4W1U A;  1WHU A;  1WJA A;  4U88 A;  2CO5 A;  3WGH A;  4IHS A;  1G3T A;  1Z0X A;  2KPM A;  4HV5 A;  2DU9 A;  3IV5 A;  3TOA A;  2KZV A;  3R0J A;  1T33 A;  1B4A A;  3HRS A;  2EFO A;  5TGT A;  3LOC A;  4CIC A;  3WU0 A;  3Q9V A;  2M8E A;  2DMQ A;  5BQT A;  3J80 K;  4ZZD A;  1ITY A;  1TL8 A;  3K1M A;  3HUG A;  4A2U A;  1VF9 A;  4CUG A;  4CCN A;  2P0W A;  2GXB A;  1Y8R B;  2V1N A;  3ZQL A;  3E6D A;  4Y52 J;  3GO5 A;  2O7O A;  2XGD A;  2IGO A;  4CCK A;  3M4O J;  4G7H F;  1ZK8 A;  3CUQ B;  1TWC J;  1YS6 A;  5J4Y A;  3QPH A;  3J81 K;  3WTV C;  3EYI A;  4AYB N;  1XMK A;  3HOY J;  5E3N A;  4JOM A;  2L02 A;  1J09 A;  2XV4 S;  3AG4 H;  1YYV A;  1UHW A;  3OS2 A;  2XAS A;  4E7L A;  2OTJ I;  1X58 A;  2GWR A;  3KET A;  2QBY B;  2CQQ A;  2LTP A;  2YUS A;  5GPA A;  1BOB A;  4KJZ A;  1B6A A;  1K61 A;  4BUP A;  2P5L C;  2IAI A;  2V79 A;  3H35 A;  4KIS A;  4MFE A;  2XRN A;  2OF7 A;  2KMU A;  4RM2 A;  4HDV A;  4BY7 J;  2HKO A;  1JUS A;  1IXC A;  5K1Y A;  3GTJ J;  1H89 C;  2R7R A;  4A3C J;  1KGS A;  2A6E F;  3HOZ J;  3PFI A;  1IO2 A;  2VKE A;  4PCQ A;  1LDD A;  1W36 C;  3BJ6 A;  2YSR A;  3FM5 A;  2UV1 A;  4M6Y A;  2CQ7 A;  2E1M C;  2MD5 A;  1PVE A;  2IS4 A;  1JJ8 C;  1FZP B;  2XKO A;  5EG0 B;  2VKV A;  3FK6 A;  2MH2 A;  1ON1 A;  3BG3 A;  3BPX A;  3HC7 A;  1TWF J;  1N77 A;  1D0X A;  3B6C A;  5LLQ A;  3LQR A;  3WTT C;  2CW7 A;  3CCM I;  2ZXW H;  1BI3 A;  3MKY B;  1BJA A;  3G73 A;  3OL4 A;  1DQU A;  2JVH A;  3M8E A;  2ZKZ A;  1R1U A;  3DCF A;  2CUZ A;  3OR2 C;  1RES A;  2ECB A;  3A0H C;  3DTE A;  2JWT A;  4XLN F;  1WJC A;  4N9H A;  4Y13 A;  1I6X A;  3IAM 2;  3K9T A;  2XHK A;  3V7C A;  2M4G A;  2UZK A;  2PX9 A;  3CCJ I;  2Z2S B;  1WGX A;  2J5O A;  1VQM I;  2W7N A;  5FLX Z;  3I0T A;  5ICG A;  4EMS A;  1MJA A;  1HW5 A;  3HOX J;  1WH5 A;  4NDL A;  3ZMV A;  4F7Z A;  2GBY A;  5J47 A;  2JSC A;  4PJL A;  3COA C;  3K7A J;  3MMY B;  2FNA A;  4HV6 A;  3M9A A;  2H27 A;  1TZL A;  2IRF G;  3OR1 C;  4PJ0 C;  1WQ2 A;  2PFB A;  2R7D A;  4IHX A;  2ADU A;  4HEA 2;  1SVL A;  2DFH A;  3NQO A;  4PJJ A;  1JKR C;  1PUF A;  2ZFU A;  2XRO A;  3CP8 A;  1TNT A;  4LG0 A;  3HPG A;  3IL2 A;  2DA2 A;  2AQE A;  4UB6 C;  3BR1 A;  2WBM A;  2KL4 A;  2DMU A;  3IKV A;  5E20 A;  2VJ5 A;  3OYC A;  5BPD A;  1JKQ C;  3F9K A;  3JCU C;  3BJA A;  1DGR M;  3KP5 A;  4GRI A;  1Z05 A;  2MC4 A;  3MCZ A;  1ETY A;  1R6R A;  3E5U A;  5HS9 A;  5IP7 J;  2XF6 A;  1Y1V J;  5TJJ A;  2VB6 A;  2BY0 A;  1D8J A;  1TW3 A;  4XOP A;  2Y75 A;  3Q0W A;  3IH2 A;  5FRM A;  2HS5 A;  1W5T A;  2FSW A;  2RQQ A;  4A3F J;  1TLH B;  2ZO4 A;  3QP5 A;  1FOW A;  3ZMU A;  4JP0 A;  3J80 Z;  1IN8 A;  1HQC A;  1W5S A;  4XLP F;  1T0F A;  1MBG A;  3P9I A;  1YX5 A;  1X2N A;  3KFW X;  2I10 A;  4Y33 A;  1IJW C;  2IT0 A;  2KIU A;  2LKX A;  1YJ9 I;  2XAF A;  1JT0 A;  3S2D J;  4JBA A;  1SAU A;  3R0A A;  2VXZ A;  3OOP A;  1GUU A;  3P7N A;  4UUS B;  3L2W A;  2VE9 A;  1LFB A;  3FIW A;  4B43 A;  3QOP A;  2XSD C;  2FEZ A;  2V9K A;  1KU7 A;  4XN3 A;  2NXN B;  1VQ8 I;  4LLN A;  1A5J A;  1MJB A;  2KJC A;  4EV0 A;  1OCP A;  2K02 A;  4F3Q A;  2R5Z B;  3QWL A;  4FE7 A;  3WTS C;  3I4P A;  4NBQ A;  5KHD A;  2BVM A;  2VBW A;  1P2F A;  3LA2 A;  1ZEL A;  1F1Z A;  1NH3 A;  2P6S A;  2B63 J;  1V4R A;  2XKP A;  1XN7 A;  2VPL A;  5HDG A;  3RQ4 A;  4XR6 A;  2K86 A;  3OIO A;  1J9I A;  4BHP A;  1OFC X;  3QYF A;  4N9I A;  2LRD A;  2WC2 A;  1T56 A;  4E7Z A;  1XSV A;  5HLG A;  2VIX A;  4IOC F;  4FET A;  3CUO A;  5KCM A;  4L0Z B;  2COB A;  1R7J A;  1VND A;  2L3D A;  4A0Y A;  3JRB A;  5DUK A;  2XPW A;  2MD0 A;  3CF2 A;  1S72 I;  1Z67 A;  3DFG A;  1WZ2 A;  3MAJ A;  5B66 C;  1E0E A;  4A12 A;  3KEO A;  4GO1 A;  1OPC A;  3ISP A;  3S2W A;  2QLZ A;  3LSK A;  5HNH A;  1RKW A;  5K5R A;  1GXP A;  2L7F P;  1KZH A;  2CSO A;  1QZE A;  2X6W A;  1NHA A;  4RA2 A;  4OIR F;  1T39 A;  1OLT A;  2ZNY A;  1V3F A;  4KT5 C;  4IX7 A;  3L2U A;  5EZG A;  1I1G A;  3SZP A;  2B9S A;  5D8K B;  4XK4 A;  3CDL A;  4EGZ A;  1OCR H;  3SEQ A;  3DKW A;  3X2Q H;  2DTR A;  2E71 A;  1T38 A;  1R1V A;  2IVM A;  2PMZ N;  3GCM A;  3BR5 A;  4Z2Y A;  1W0T A;  5KAI C;  2Z33 A;  3BG7 A;  3V8L A;  3BRO A;  4YFK F;  2JT1 A;  1YJW I;  2AHQ A;  2XUB A;  3I3L A;  4ZYE A;  4F93 B;  5C44 J;  3GME A;  2YX7 A;  1JE8 A;  2V6C A;  2VUM J;  3O6B B;  4ENJ A;  1GV2 A;  2ESH A;  4ANJ A;  1USS A;  5EEH A;  5LFA A;  2HTS A;  1X4P A;  5F04 A;  4J00 A;  2W25 A;  1T98 A;  2FOK A;  5J3L A;  2KIF A;  1S7E A;  2EBI A;  2R5Z A;  3TL4 X;  5LD2 C;  1LEB A;  1JHF A;  4MQV A;  3L2R A;  3QRF F;  3FDY A;  4BDY A;  2GA2 A;  4HQE A;  1ZRC A;  2M45 A;  4CCJ A;  4CCM A;  4TV7 A;  1W5C C;  2XGX A;  1S7A A;  4B1R A;  5FB2 A;  1HDD C;  3LA7 A;  3BDD A;  4DYC A;  2P6T A;  1PDN C;  3C2B A;  5H6R A;  2M9H A;  4P96 A;  3K2A A;  4XRM A;  1EJ9 A;  3HKZ N;  3S32 A;  1JGS A;  4GYG A;  3FHN A;  3F72 A;  4FX4 A;  2AS5 F;  2DDB A;  2X85 A;  2JZY A;  1W7P D;  2CJJ A;  5D5V B;  1I39 A;  4BHC A;  2PJP A;  1IXR C;  4ASN A;  5GPC A;  3CJN A;  1ACI A;  3F8C A;  1ZHF A;  3GFL A;  4QLC U;  2F5F A;  4A3J J;  4IQJ A;  1FEX A;  4BH9 A;  3FXO A;  1FSH A;  2OCE A;  1RIO H;  5E1Z B;  2KFD A;  4U0V A;  2WAE A;  2L0K A;  2R5Y B;  1BC7 C;  4XLC A;  5HLI A;  3G4S I;  3AL0 C;  2QQA A;  4HOB A;  3GZ5 A;  4S05 A;  4EJW A;  1RZ4 A;  2DOE A;  4ESF A;  3VOE A;  2NVU B;  2ELJ A;  2OCC H;  5LHG A;  3FKI J;  3MWM A;  2IGN A;  3EET A;  4ZYA A;  2KT0 A;  2JVG A;  3RKY A;  1DP7 P;  1IG7 A;  2BHY A;  5DCM B;  3GZ6 A;  1B59 A;  2X6X A;  1ORK A;  5DS9 A;  2Z99 A;  2G7H A;  5IYC J;  3T8T A;  2WA0 A;  2CV2 A;  2QEN A;  2HDW A;  3ABK H;  3D0S A;  4M3F A;  5JLW A;  1R5I D;  2L7Z A;  3CJQ B;  1DU6 A;  2V26 A;  2O61 A;  2I5U A;  3REO A;  5EYR A;  5LEK A;  3A01 A;  4F52 A;  3KP6 A;  1I3A A;  2Z16 A;  3KYL A;  5F27 A;  3Q9S A;  2NVY J;  3IC7 A;  3CQZ J;  4L9N A;  4RGU A;  1MBK A;  3OYH A;  1WVR A;  4O5V A;  3VSL A;  2CUE A;  3K4M A;  3L09 A;  1ZLK A;  2WAQ N;  2K3F A;  1B1B A;  3GFM A;  4BKX A;  5IT9 Z;  4YG2 F;  1MIJ A;  1QZY A;  2MBF A;  4MTD A;  3RYR A;  3RKW A;  2DLL A;  1J59 A;  2D5V A;  1Z21 A;  4LIU A;  3JRE A;  4HLY A;  4EEF G;  2QWW A;  2JSP A;  1MNE A;  3SFI A;  3SZT A;  3V8J A;  3GFJ A;  2K4B A;  4I2O A;  1U6G A;  4I98 B;  2LDU A;  3VYS B;  3K6G A;  2L54 A;  2VQL A;  2ECC A;  2A61 A;  3NRV A;  5B3S H;  2E7W A;  3E5X A;  5ICC A;  1GHC A;  2HNH A;  4I6Z A;  3F6V A;  3DEU A;  5L3F A;  1OR7 A;  1R22 A;  2VL8 A;  3GUD A;  3DF8 A;  4KN4 X;  1G3Y A;  1S5L C;  1ZRD A;  2Z3Y A;  2KDZ A;  4IXA A;  3EUH C;  4HYE A;  2NVX J;  3MZ8 A;  1IDY A;  4CZC A;  1Y8Q B;  1H8A C;  3PQJ A;  2IEK A;  3M8F A;  1QVT A;  2VON A;  3Q0U A;  3D1N I;  4XRF A;  1XG1 A;  2EIN H;  4BE2 A;  2F4I A;  5GAD J;  2OV7 A;  2VBY A;  4UB8 C;  2E19 A;  4HBL A;  4LD5 A;  3PQK A;  4WXC A;  3AAF A;  1TTY A;  2MG4 A;  5GTI C;  1IRZ A;  1JKP C;  3RPU D;  1EH6 A;  3WE2 A;  3K4K A;  3SHF A;  4ZDP A;  2KDO A;  3VFZ A;  2HWV A;  4MO7 A;  1H9G A;  1KON A;  2Y30 A;  3KP4 A;  5HVQ C;  4HX8 A;  4RAG A;  4JYK A;  1FJL A;  2QM3 A;  1O3Q A;  4EM2 A;  1A35 A;  4PK4 A;  2NYX A;  2O9L A;  4A3D J;  1D1A A;  5DEQ A;  5TIS C;  3A03 A;  2NRA C;  3ZGK A;  2X1E A;  2VE8 A;  1XGS A;  3OWT A;  4ZJZ A;  5DV5 A;  4G9Y A;  5KK1 A;  3VEP A;  3OYL A;  4HF0 A;  3EUA A;  5DCF A;  3OOU A;  1YIJ I;  4A3L J;  4U7D A;  4HA8 A;  2QCO A;  1MD0 A;  1JI8 A;  2VJI A;  3O8G A;  2CQK A;  4A3G J;  1OYI A;  2DN0 A;  3ASO H;  1UHM A;  2TRT A;  2GXA A;  3F6O A;  5E3M A;  2PJR A;  3DU5 A;  1Y56 A;  3ZXS A;  2Q0O A;  3FMQ A;  1B9M A;  1OCC H;  1S29 A;  2PLY A;  4PSX A;  2Z9O A;  1I1S A;  3TGN A;  3WHB A;  4FQG A;  3BOQ A;  5F64 A;  2JRT A;  2FRH A;  2M0C A;  1IGN A;  1QHG A;  4L5I A;  6PAX A;  3ZQG A;  4A0X A;  3A01 B;  4RGX A;  3UR3 C;  3BG5 A;  2DO7 A;  5FFX A;  1ETV A;  1XDS A;  2HQ5 A;  3R4K A;  4B48 A;  4CSW A;  2EJR A;  1LDK B;  5L3G A;  1LE8 A;  1IAW A;  2ZC2 A;  2V1U A;  4GXO A;  2X1D A;  3MEX A;  2GIZ A;  5D8L B;  3LFU A;  3E97 A;  3S17 J;  3LMM A;  1E3O C;  4AWX B;  4YRV A;  3EDP A;  3OIP A;  1PUE E;  3DP7 A;  4BNC A;  1YS7 A;  4ZZL A;  2L7K A;  3CCL I;  1R00 A;  4E7H A;  1E2X A;  2FU4 A;  1SMY F;  4QWQ A;  1UMQ A;  1N25 A;  3K70 C;  4P9U A;  3VWB A;  4N4N B;  2BXZ A;  4HDU A;  2KIS A;  3P9C A;  5AON A;  1Z3Y A;  3BT9 A;  1X2M A;  4HQM A;  4IRI A;  4BQO A;  3ZN0 A;  2WWY A;  4RB2 C;  2MLK A;  3KPH A;  1TWG J;  4BBR J;  3DXJ F;  3IUO A;  5E3L A;  1ZG1 A;  1DP3 A;  2XAH A;  1HXD A;  3MD2 A;  3I53 A;  4EJO A;  4IF4 A;  1W4M A;  2IA2 A;  5CVV A;  2VN2 A;  3VYU B;  4IHT A;  4CXF A;  4ON0 A;  2NNN A;  3Q3S A;  3GLX A;  5J1U A;  4A5N A;  1T6S A;  2K4J A;  4IRG A;  4V2F A;  3L2Q A;  1IW7 F;  2LG4 A;  1LEA A;  3CCR I;  3EPZ A;  4IEJ A;  3QQA A;  4GYI A;  3A4C A;  3BC8 A;  2BW3 B;  3FMR A;  2HQA A;  3R61 A;  4FX0 A;  1KQ9 A;  1VQ6 I;  2A68 F;  1RI7 A;  3K0L A;  4LMY A;  3TMO A;  1IC8 A;  2ELK A;  3OYD A;  3I4M J;  3NEU A;  2XVC A;  4CO8 A;  2YR2 A;  3HM5 A;  4M74 A;  4L9J A;  1B72 A;  1GVD A;  5GTH C;  1G59 A;  3H1C A;  4MLO A;  4F92 B;  2ISZ A;  2R93 J;  2IS1 A;  3LAJ A;  4XOT A;  3CUQ A;  4RLQ A;  4XMY A;  4M3D A;  5K5Q A;  2F5C A;  4IRH A;  4RLF A;  1HC8 A;  4Y7N J;  1V5F A;  2QSH X;  4BJ5 C;  5D4R A;  2B7E A;  5L3C A;  3C2G A;  4Y17 A;  2ZME A;  2PI0 A;  3A0B C;  2ZJQ F;  1SEU A;  4MNU A;  1Y39 A;  1LFP A;  2DI3 A;  3H9G A;  3D5R C;  1G6N A;  2KQR A;  2VQH A;  3V8K A;  1SD7 A;  1SD5 A;  1ZRF A;  4Q4Z F;  5F08 A;  1YFH A;  3JRA A;  1W7P A;  1HKQ A;  3QYB A;  1R1T A;  3LSP A;  1JXS A;  2M3A A;  2DT7 B;  5B1A H;  1OYY A;  3H0D A;  3QOD A;  3HSF A;  4WX9 A;  2ZSI B;  1OIS A;  1YTY A;  3WTX C;  2QF7 A;  4X1E A;  3ZQH A;  3I64 A;  5HDN A;  2VQG A;  2QSF X;  1N75 A;  1W7P B;  1J0R A;  1SD6 A;  2A69 F;  5DM6 F;  1SFU A;  3RDI A;  2RVC A;  4N0B A;  1ETK A;  4DNC A;  1VQ9 I;  3HRT A;  2XPU A;  2K9S A;  4A0Z A;  4MQ9 F;  2FJ1 A;  4XLA A;  3B73 A;  4ENN A;  3KYC B;  2EWN A;  4IOA F;  1LQ1 A;  2OTL I;  2A6T A;  4XKW A;  3HHH A;  4BJT A;  2XAQ A;  1D3Y A;  2GOX B;  3DPT A;  3H0G J;  4O6J A;  1FYK A;  5GAE J;  4U0W A;  1J7K A;  1IUY A;  3HZJ A;  4FAS D;  3FXL A;  2Y9Z A;  2DXI A;  2LK2 A;  2QA4 I;  2KLO A;  3LSM A;  4OIN F;  4ZTF A;  1YG2 A;  2P5V A;  4M3B A;  4AD9 A;  3JAM K;  3OYA A;  3KEQ A;  2IA0 A;  5IP6 A;  2WTE A;  4G94 A;  2LLK A;  4XSX F;  2RAE A;  1IRX A;  3GWZ A;  1B8I A;  4R1H A;  1QBJ A;  1Z3X A;  1D0Z A;  2JA5 J;  3HEF A;  3HRU A;  4NQW B;  3ZCO A;  2D1V A;  5HLH A;  3FXK A;  4XID A;  2M30 A;  5AIQ A;  3EYY A;  2O3F A;  3BQZ A;  5J1Y A;  1MMA A;  1X1A A;  4RB1 A;  3BJO A;  2RC4 A;  5EF6 A;  2EIL H;  1QPI A;  1F43 A;  3BP8 A;  3RIR A;  1ZGW A;  1Q1V A;  1JT6 A;  3ZQQ A;  2FQ3 A;  1JUM A;  1YE9 A;  3N05 A;  2CV0 A;  3RZD J;  4IO9 F;  1GT0 C;  4Q48 A;  1TP4 A;  1FY7 A;  2O8X A;  2W48 A;  4C2T A;  2V1D A;  3KCC A;  1QQI A;  2E2I J;  3PJR A;  2HVQ A;  4A69 C;  1Z1D A;  2E36 A;  1SVM A;  1WJD A;  3VB2 A;  2GXG A;  2XIG A;  4RDU A;  3QPS A;  1YIO A;  2CW8 A;  4RAF A;  3I71 A;  1K6O A;  1GLN A;  4EJV A;  1Z9C A;  2FMY A;  4D5C A;  4ZTJ A;  4UUS A;  1FC3 A;  2H8W A;  3SEZ A;  2DMN A;  3JRD A;  3KLO A;  4I76 A;  3TO7 A;  3I56 I;  2KKO A;  2L5Q A;  1S7O A;  2ETH A;  4XKB A;  2ICW G;  3J81 Z;  2OD5 A;  3NAR A;  2VJJ A;  3GVA A;  5AIP A;  5F0H A;  2QKM B;  2R7Q A;  2W57 A;  1RUN A;  2GM4 A;  2KRC A;  2EB7 A;  2QZ8 A;  5E8G A;  5LEJ A;  1BI1 A;  2CH0 A;  3ZQ7 A;  3G3Z A;  1WJ5 A;  4LFU A;  3U9G A;  1MZB A;  1XMA A;  1ZN2 A;  2Q1Z B;  4DYR A;  1FT9 A;  3S1M J;  2KHM A;  1V54 H;  3P9K A;  5K5O A;  5HLT A;  1XTA A;  2OA4 A;  3E6B A;  2XGC A;  3FM3 A;  2K27 A;  1U5T B;  1Y0N A;  3ELK A;  4B44 A;  3U1D A;  1FX7 A;  4Q5S F;  1BR2 A;  2DA4 A;  1BW6 A;  1X1P A;  2COM A;  2EIK H;  2PJR B;  5E3O A;  1DU0 A;  5LRS A;  1BJZ A;  4AYB A;  3GW2 A;  3ABM H;  3ZRG A;  1V5E A;  4ENK A;  1YX3 A;  4V19 K;  2VT3 A;  2FE3 A;  1WCM J;  3CD6 I;  2H1L A;  4JK1 X;  2L4A A;  2VLA A;  1X1D A;  2FQ4 A;  2L9V A;  1D8K A;  3VYT B;  4K2E A;  1LVA A;  4KT6 A;  1I3Q J;  2KIQ A;  2R7O A;  4JQF A;  1Z7U A;  1UEL B;  3CES A;  3GZN B;  1G4D A;  1TNS A;  2RQP A;  1GVJ A;  1RKT A;  3TED A;  4HF2 A;  4BEH A;  4G6Q A;  3SZG A;  2R7Z J;  4C3H J;  2QBY A;  2I8D A;  2R7X A;  4ESJ A;  4C3J J;  3F21 A;  1IV6 A;  1LJ9 A;  2DAO A;  2F2E A;  2FOW A;  2LBF A;  2YX4 A;  2ZJ2 A;  5GP9 A;  4L9T A;  2K5C A;  4H4K C;  1U8R A;  5BNG A;  5EGO B;  4CA0 A;  4ENM A;  4D7M A;  2HXO A;  1DUX C;  4W97 A;  3M8J A;  5H20 A;  2W4S A;  2X51 A;  3O8H A;  1Z6T A;  1IV8 A;  1RPW A;  2ZFW A;  3F22 A;  4G7O F;  3G1L A;  4MEY F;  1W0U A;  2CYY A;  2O6G E;  2JQ7 A;  4IQ4 A;  5E79 C;  3ZOB A;  1J5Y A;  4OMY A;  1YW8 A;  3QAH A;  3PM1 A;  4OOI A;  5CQE A;  4A3E J;  3VSK A;  1Y1W J;  4EM0 B;  3BR2 A;  3H5N A;  1HW1 A;  1XD7 A;  3AG3 H;  1BR4 A;  3GXO A;  2QQB A;  5EZH A;  2K40 A;  4AVZ A;  4HNT A;  3GTO J;  5FLM J;  4BQN A;  2IS6 A;  3S3O A;  1A6I A;  2DFF A;  2P7C B;  2R7V A;  2OZ6 A;  4OU0 A;  3I59 A;  3H3Z A;  2K7L A;  5F6F A;  2JTV A;  5ILV A;  5LRR A;  4OMZ A;  2LKP A;  2AXT C;  2ESN A;  4NB5 A;  3CJR B;  4XRS G;  5JVT A;  3QU3 A;  1OCT C;  3SFZ A;  4ETS A;  1BI2 A;  4XKC A;  4E4H A;  3M7G A;  1R4M B;  2O5R A;  4BAY A;  2V9P A;  4HG2 A;  1FYM A;  4LIV A;  1K83 J;  2IJL A;  3BCB A;  1UG2 A;  5FRO A;  1VFC A;  3HOS A;  1YRN A;  4C3I J;  2DK5 A;  2NVQ J;  2EH3 A;  4KIF A;  1XSD A;  1H0M A;  3ZQI A;  2HZT A;  4QIW N;  2ACJ A;  2X9D A;  2C6Y A;  2DDA A;  1IN6 A;  2JRM A;  2X4H A;  3E5Q A;  3W3C A;  5FJ8 J;  3OSG A;  1D5Y A;  1HKT A;  1S6L A;  4OIQ F;  4HX4 A;  3OL3 A;  3DEE A;  3EQL F;  1FIP A;  5CVI A;  5F1R A;  3A02 A;  1MSE C;  3HSE A;  3BTI A;  5K7F A;  5C3E J;  4M73 A;  2OUM A;  3CC2 I;  5ICE A;  3BZK A;  3S14 J;  3BR6 A;  1FBU A;  1K7A A;  4DGW B;  3CJT B;  4PDK A;  2A5W A;  2DPU A;  4IHY A;  4BGD A;  4Z6Y A;  2FF4 A;  1X1C A;  2DQR A;  4DZP A;  3A2K A;  2VBX A;  4WXH A;  4I99 C;  2ZNZ A;  5JFR A;  2Q2E A;  2FBI A;  4A3B J;  4IPA A;  2QQ8 A;  4KIG A;  3BZC A;  2STW A;  3E6C C;  3WG7 H;  3KEY A;  3HPH A;  4BHB A;  5M3M J;  3GYH X;  2CU7 A;  5J40 A;  2DW4 A;  3PSF A;  4FHT A;  2CRG A;  2X6Y A;  2Q8K A;  4CYC B;  1HOM A;  2ZBK A;  4DZJ A;  2L9N A;  1TQP A;  4MIM A;  1E17 A;  3DTK A;  4NUB A;  4E7S A;  3K1N A;  4FTH A;  1R23 A;  1LVK A;  2DOA A;  2LF7 A;  3GEZ A;  5IYB J;  4BE1 A;  2NAZ A;  4BL0 B;  1NK3 P;  1R36 A;  4R79 A;  2HU9 A;  2VQC A;  1P92 A;  1ZG5 A;  5EDN A;  1XCB A;  2P81 A;  2PQ8 A;  2ZXI A;  3OV8 A;  3RTR A;  1U9O A;  1XSX A;  1L3L A;  1OMI A;  2M7B A;  2WAF A;  3DBL B;  5FD6 A;  1UB9 A;  4CH7 A;  2X6O A;  3D5S C;  2XGE A;  3HB9 A;  5CYV A;  2LY2 A;  2NOG A;  3BWG A;  3IRR A;  1RUO A;  2BGC A;  5D6E A;  2LY9 A;  5LBQ A;  4DJA A;  3WHC A;  2V6E A;  3H3U A;  2GA1 A;  3WGG A;  2HYF A;  3HKZ A;  4AC0 A;  2E2H J;  1O7L A;  2LFB A;  4ZDO A;  3HTU A;  1MNM C;  4WK8 F;  3JRF A;  5E1X A;  1XMX A;  3LQQ A;  1IN7 A;  5HS7 A;  3FXJ A;  3U2R A;  3IAS 2;  3WTU C;  3LA3 A;  3JRC A;  1N78 A;  2ISY A;  2FBK A;  3HUG B;  3OY9 A;  4LOC A;  2EA4 A;  2OPT A;  3CLQ A;  2DOD A;  1I27 A;  2F5V A;  2W84 A;  3MKZ A;  4E7K A;  4IHV A;  4IHW A;  3K2Z A;  2KRF A;  4ZC3 A;  3TDZ C;  4ABZ A;  2RKH A;  2DA6 A;  2E7X A;  2VOD A;  1ZTR A;  2XDV A;  1IXS B;  1SFX A;  1HKS A;  4M3E A;  3V42 A;  3DU6 A;  2QUF A;  3BY6 A;  2L01 A;  2JA2 A;  2H6B A;  1AKH A;  1MKM A;  1ZYR F;  2YPR A;  1LPQ A;  3W6V A;  2M0M A;  5FLX K;  3AL0 B;  1DPU A;  3S15 J;  2ME6 A;  4KA4 A;  2IA1 A;  1I6H J;  1PJR A;  2HOE A;  4BEH B;  2QYO A;  2X0L A;  5CVR A;  1FP2 A;  1I50 J;  5D6F A;  4XBF A;  3PFY A;  5LHI A;  1BOA A;  5B5E C;  1ZG3 A;  2VC0 A;  2Z1D A;  2PMU A;  1ZKG A;  3VDX A;  3TW7 A;  2A5Y B;  3BTL A;  2DPD A;  5J8F A;  2DA1 A;  4L9V A;  5IP9 J;  4PSW A;  5M5W J;  1I5Z A;  4KIB A;  4NNJ A;  4H0E A;  3TDU C;  1XGN A;  2HKX A;  1MBE A;  2IP2 A;  2VT2 A;  4XN0 A;  4CZZ A;  3KZZ A;  3PO2 J;  1YJN I;  4MFD A;  1RET A;  3HIF A;  4E6K G;  3ZN1 A;  3AKZ A;  3CC4 I;  4IVN A;  5HOD A;  1BR1 A;  2E35 A;  1YW9 A;  3TBI A;  3M1E A;  4WF2 A;  4BYY A;  3UKG A;  1OYW A;  2GQQ A;  2WAQ A;  1YO5 C;  2B0L A;  3ZR8 X;  2Y31 A;  4F91 B;  1Y6I A;  1OCO H;  4EQQ A;  3CP2 A;  1MH3 A;  3R6S A;  1AHD P;  2XB0 X;  2G9W A;  5FFZ A;  1S3J A;  4CYD A;  2VPR A;  3W2V A;  4CCO A;  3GTM J;  2TCT A;  2VKD A;  5J1R A;  3HGG A;  4RGS A;  4M9S A;  1PP7 U;  3RJP A;  3CF5 F;  3JSO A;  2LR8 A;  3LSR A;  1S8N A;  2W82 A;  2XAJ A;  3ZQF A;  1ZQ3 P;  2NVT J;  1ZR4 A;  2BE5 F;  5J8C A;  1ON2 A;  3BCA A;  5J4V A;  3AFH A;  3QPT A;  3L1P A;  2BOL A;  2DTZ A;  2D2W A;  1EKE A;  1WJB A;  2Y0M A;  1K78 A;  3LSG A;  2RNG A;  5ILS A;  1RC9 A;  2OQG A;  1APL C;  3SYT A;  3WTZ A;  1AWC A;  2K9M A;  3S2H J;  3I54 A;  4NC8 A;  4M6V A;  1QU3 A;  1DDN A;  2HPI A;  3ABT A;  3E7L A;  4XM3 A;  2ELH A;  3BG9 A;  4LK1 F;  5JVG F;  4MEX F;  4YII A;  5LGN A;  1A04 A;  3JRG A;  2Q2E B;  1SD4 A;  2EPF A;  3S93 A;  3G71 I;  2HI3 A;  5L3D A;  4HNU A;  1V5G A;  2JPC A;  2W85 A;  3HOW J;  3WU1 B;  1NG7 A;  3RPQ A;  3F3X A;  4A6D A;  5K7Z A;  4RMN A;  3PL8 A;  5ED4 A;  2HFH A;  2DMP A;  2JUC A;  1Q1H A;  4M9X A;  3SXY A;  4F55 A;  3KYD B;  1IF1 A;  3IWF A;  3OYN A;  3T1B A;  2MH9 A;  3G6E I;  3BZ6 A;  3I9V 2;  1H88 C;  1XS9 A;  2DA7 A;  4XLF A;  1TBX A;  2DT5 A;  2KP6 A;  4AID A;  5KVR A;  4CYC A;  3BR0 A;  3ML6 A;  2WAD A;  4C9Y A;  2BY1 A;  1SAN A;  2OC6 A;  3DPU A;  2K9N A;  9ANT A;  2F48 A;  2EFP A;  3SDG A;  4DBQ A;  2D45 A;  2L4M A;  3QYE A;  3WG9 A;  4WWC A;  3ECH A;  1IDZ A;  4CGZ A;  5IT3 A;  5M5X J;  2LYC A;  3B02 A;  1WPK A;  5H6Q A;  4YIF A;  4KFC A;  3CO6 C;  1FMV A;  2MA3 A;  3WTW C;  1D0Y A;  2ZXH A;  2KRH A;  3I59 B;  4NC6 A;  4LG3 A;  1JGG A;  3HOV J;  2F6C A;  1WWX A;  1K79 A;  2ZME B;  2DFE A;  5LGT A;  3F8M A;  1E3P A;  4M6X A;  2CFX A;  3OYB A;  5IY5 H;  2VKH A;  4D0P A;  1LE8 B;  2O8K A;  3LST A;  5F1J A;  4ZYG A;  4BY1 J;  1VQL I;  2JN6 A;  3ESW B;  3KE2 A;  3CCE I;  2LSO A;  1P4W A;  4PFP A;  3OIQ A;  1NG6 A;  3S1N J;  4HX7 A;  1WSU A;  3FBI B;  2K9Q A;  4BBS J;  1P4X A;  2HDD A;  4JX5 A;  3ZMS A;  5IOY A;  4M72 A;  2ID3 A;  2JMW A;  5DD8 A;  1ONV A;  3S3M A;  2V1X A;  4BU2 A;  3CUQ C;  1ETO A;  1YLF A;  4JX6 A;  4U87 A;  1UST A;  4PZJ A;  4O3M A;  1C0W A;  1QPM A;  4KIT B;  5A2Q Z;  2CMP A;  2WV0 A;  2BY2 A;  3KZY A;  4BJ6 C;  1YW7 A;  1BA5 A;  3HG9 A;  5DYM A;  5K7H A;  3Q5F A;  3IWZ A;  1WFX A;  5KNL A;  3C7J A;  2BXY A;  3FIS A;  3D5L A;  2KIM A;  3L2C A;  5M3F J;  2LVS A;  2VJ4 A;  3J7Z I;  2QQ9 A;  3RKX A;  3CCU I;  1UCR A;  1VQ7 I;  3JSP A;  1ETX A;  4YEJ A;  2ZJP F;  3MZH A;  3DLL F;  1IN5 A;  3HBL A;  1YI2 I;  3BQY A;  5CLS A;  3FXU A;  4KMU X;  1ENH A;  2R3S A;  3FXQ A;  3WOD F;  3LNQ A;  2XSJ C;  2L9R A;  2RGV A;  1HF0 A;  2HR3 A;  3RKQ A;  2DOF A;  1OQY A;  1T95 A;  3HSR A;  3K4B A;  2Y2Z A;  4GFB A;  3PUB A;  3L7W A;  1B9N A;  2R7T A;  4IL6 C;  4HSR A;  3HRM A;  2ME0 A;  1MMG A;  2FUG 2;  2W24 A;  3DLA A;  5FGM A;  3CCQ I;  2YU9 J;  1YOV B;  4ZH4 F;  3J7Y J;  4EGY A;  4HNV A;  2NS7 A;  2LBF B;  5BMZ A;  3LSH A;  3DTI A;  2KJB A;  4ZYH A;  1U5T A;  2F4M B;  5D4S A;  3IRQ A;  4OIP F;  5FKM A;  1POG A;  4PJN A;  2ZXJ A;  1BC8 C;  1SVO A;  4EM1 A;  4Y4R A;  4R8H A;  4FIS A;  3CCS I;  1WI3 A;  3L2V A;  1Z77 A;  5ERI A;  1JKO C;  4MGR A;  1IRF A;  1AU7 A;  3FKJ A;  1HDP A;  2NS0 A;  1FMW A;  2FNP A;  1VQP I;  3GBG A;  4IZZ A;  4UV8 A;  2PMZ A;  2RRE A;  3RCO A;  1B8I B;  5DD4 A;  3FXR A;  2CV1 A;  4DQ2 A;  2LH9 A;  5C4J J;  3OYG A;  1XGO A;  2ZSH B;  3FWE A;  1UFM A;  4ESB A;  1PUF B;  5KAF C;  3M07 A;  3DV8 A;  2DA3 A;  1ZAR A;  3KLN A;  3PNY A;  4XON A;  1MDM B;  1MMD A;  1X3W B;  4XLH A;  1D5V A;  1QVU A;  2BW3 A;  2MLG A;  2OU2 A;  2PMH A;  3FZV A;  1Z7L A;  3T8R A;  1W36 D;  2LC2 A;  2ZJR F;  4HPQ A;  4M9Z A;  1JUP A;  3TO9 A;  1BBY A;  4CCL A;  1J75 A;  1XPX A;  1VI0 A;  2VXD A;  5ICF A;  3MQ0 A;  1ETW A;  4J01 A;  2EFQ A;  1FBS A;  2YS9 A;  3PNV A;  2M1B A;  2R92 J;  3KZI C;  1MGT A;  2DYS H;  4P1W A;  4C30 A;  4G12 A;  1YIT I;  1HLV A;  1G8X A;  4A3M J;  4GGG A;  3TQN A;  2LY1 A;  2M34 A;  2MGQ A;  3H92 A;  3DQV C;  1FTZ A;  2CS3 A;  3MKW B;  1AA7 A;  2X48 A;  3GX4 X;  1LNW A;  2RNJ A;  2EQR A;  1VQO I;  1R58 A;  3K10 A;  5IPA A;  1IRG A;  3CZ6 A;  1OCZ H;  1FP1 D;  1Y0U A;  3BTC A;  5FLV A;  1O3R A;  3IHU A;  5FD5 A;  5JHU A;  4YFN F;  3UNG C;  2VOP A;  4RGR A;  3PIP F;  2XRL A;  1KYW A;  1K4T A;  3LFK A;  2D1H A;  4KDP A;  1LDJ A;  3AG1 H;  4BQQ A;  3CO7 C;  4UVA A;  3RYP A;  4AU7 A;  1X1B A;  2M2E A;  4GDF A;  3WGI A;  4P9F A;  2LKS A;  3BPV A;  1EV7 A;  4E7J A;  2DA5 A;  3HGY A;  1MH4 A;  4HF1 A;  2STT A;  4DW6 A;  2K9L A;  1ULY A;  2HDC A;  3HJE A;  1KA8 A;  4D9J A;  4EAT A;  1X3Z B;  2GAU A;  3IP4 B;  5C4X J;  2HOA A;  4M71 A;  3RQI A;  5BS6 A;  2DCE A;  3ABU A;  3CDI A;  2R7F A;  4S04 A;  5E18 F;  2OQR A;  2PBI A;  1ZLJ A;  2G0E A;  5D5U B;  1KU3 A;  4BS9 A;  3OYM A;  4I09 A;  2EFW A;  1QGP A;  2AQF A;  3FF5 A;  1AKH B;  2R7U A;  1P9Q C;  1Z6R A;  2NOJ B;  3H5A A;  4LIT A;  3PUF A;  1HSJ A;  5EGO A;  3H9J A;  3ZMT A;  3CMY A;  1LUJ B;  1MBJ A;  3EUK L;  1QZZ A;  2DBB A;  3JRH A;  3NAU A;  2V9V A;  1G2H A;  3IH3 A;  1ZH5 A;  1QHH D;  1UJ8 A;  2OBP A;  1W1W E;  2F5E A;  2V7F A;  4II2 A;  3U1K A;  4PUS A;  1JJ6 C;  2A05 A;  1QA6 A;  1ZR2 A;  5GAH J;  2BEO A;  3OMY A;  1CGP A;  3K70 D;  1U5T C;  4J19 A;  2O0Y A;  3ERM A;  4XRS A;  1XCV A;  3V7S A;  3T5X A;  4UUT A;  2DJN A;  3MZY A;  1WJF A;  4HST A;  1ODD A;  3U21 A;  1BN5 A;  4KUM A;  2IXS A;  4CHU A;  3MVP A;  5LHH A;  2E34 A;  3SJM A;  1BL0 A;  3KP3 A;  3K4J A;  2CWE A;  4XNF A;  1FOX A;  4AUX A;  2CQX A;  5HDK A;  3OSF A;  3N4M A;  5BOX A;  2HOS A;  2Y48 A;  1XC5 A;  2FXA A;  3E3V A;  1TC3 C;  5EJC A;  3S8P A;  4RB3 C;  1IUF A;  1J2X A;  3PIO F;  2H6C A;  1T0F C;  1VQ5 I;  1FWZ A;  2CW0 F;  4UXN A;  3KX2 A;  2GLO A;  3FMS A;  1K4S A;  2RN7 A;  1SFK A;  2UWM A;  4A6E A;  2RV8 A;  2XAU A;  3DWL E;  3C18 A;  4BAC A;  3HOU J;  3OS1 A;  4A3K J;  5A2Q K;  4YEL A;  3VPR A;  2EZK A;  1EA3 A;  2AO9 A;  2L2O A;  4XSZ F;  2R7S A;  2HYJ A;  4HAM A;  1A36 A;  2E5N A;  4KYW A;  4RAZ A;  1UHS A;  5JHF A;  3F0C A; 
#chains in the Genus database with same CATH homology
 4M3E A;  1ETV A;  1FIA A;  2HQ5 A;  4AYB N;  3HOY J;  5E3N A;  1LE8 A;  2H1K A;  3DEW A;  1AKH A;  5FKO A;  2EZL A;  3FK7 A;  3W6V A;  1X58 A;  3S15 J;  2ME6 A;  3S17 J;  1E3O C;  1I6H J;  2CQQ A;  2LTP A;  2YUS A;  5GPA A;  1QRY A;  1K61 A;  2IAI A;  3S16 J;  1I50 J;  2HOT A;  4MFE A;  2OF7 A;  3TW6 A;  4QSH A;  2M8G X;  1UMQ A;  4BY7 J;  1JTY A;  1JUS A;  3GTJ J;  1H89 C;  4A3C J;  1ZKG A;  3HOZ J;  3TW7 A;  2NS8 A;  3BTL A;  3BT9 A;  3MKL A;  1R9T J;  2VKE A;  1X2M A;  4B4C A;  2DA1 A;  5IP9 J;  1NTC A;  5M5W J;  1YRN B;  1TWG J;  4BBR J;  5E3L A;  1JJ8 C;  5EG0 B;  1MBE A;  2VKV A;  3FK6 A;  3BG3 A;  3Q3S A;  3PO2 J;  5J1U A;  4MFD A;  4V2F A;  1RET A;  3GTQ J;  1TWF J;  3B6C A;  4IEJ A;  3QQA A;  5HOD A;  1BW5 A;  2MSY A;  3UKG A;  3IH4 A;  1IC8 A;  2ELK A;  3I4M J;  2H8R A;  2Y31 A;  2R5Y A;  2LP0 A;  3HM5 A;  3DCF A;  2R0Q C;  1MH3 A;  1AHD P;  1RES A;  2ECB A;  2XB0 X;  1B72 A;  3S1Q J;  1O4X A;  1GVD A;  2VPR A;  3GTM J;  2TCT A;  2JWT A;  4MLO A;  3HGG A;  1P7J A;  5J1R A;  2LR8 A;  3LSR A;  2R93 J;  3GTK J;  3ZQF A;  1ZQ3 P;  2NVT J;  1ZR4 A;  4D5F A;  1LFU P;  1WGX A;  4M3D A;  3BTJ A;  3L1P A;  4Y7N J;  2DTZ A;  1F36 A;  3HOX J;  1WH5 A;  4NDL A;  2GBY A;  3LSG A;  1APL C;  3CCY A;  3K7A J;  1SFO J;  2Y9Y A;  1U78 A;  3S2H J;  4M6V A;  2E2J J;  4IHX A;  3E7L A;  5F08 A;  3JRA A;  1JKR C;  1PUF A;  4L5E A;  3LSP A;  3BG9 A;  4S0H B;  2EZI A;  2DA2 A;  3BR1 A;  1JKQ C;  2QF7 A;  2DMU A;  3JRG A;  3GTP J;  5IOZ A;  5IYD J;  3BR3 A;  2HXI A;  4X1E A;  3ZQH A;  2HI3 A;  3HOW J;  3M3Y J;  1ETY A;  2WV1 A;  5IP7 J;  1ETK A;  1Y1V J;  5K7Z A;  5M5Y J;  2VI6 A;  2XPU A;  2DMP A;  2K9S A;  3Q0W A;  2FJ1 A;  3IH2 A;  5EG0 A;  1EF4 A;  4A3F J;  4XIC A;  4JP0 A;  4FCY A;  1MBG A;  3H0G J;  1X2N A;  2I10 A;  1IJW C;  1H88 C;  2LKX A;  1XS9 A;  1JT0 A;  2DA7 A;  3S2D J;  1HCR A;  5DTD A;  2Y9Z A;  4CYC A;  3BR0 A;  1GUU A;  2LK2 A;  4UUS B;  1SAN A;  4M3B A;  1LFB A;  9ANT A;  2K9N A;  3FIW A;  3SDG A;  5IP6 A;  2XSD C;  1A5J A;  2LLK A;  1IDZ A;  2RAE A;  4A93 J;  1B8I A;  1OCP A;  5M5X J;  4D7N A;  2R5Z B;  2JA5 J;  1MBH A;  1WPK A;  4FE7 A;  1GV5 A;  3HEF A;  3GTL J;  4XID A;  3BQZ A;  5J1Y A;  5FKK A;  1JGG A;  3HOV J;  4QTR A;  2B63 J;  5EF6 A;  5EEA A;  1QPI A;  1F43 A;  1ZGW A;  1Q1V A;  1JT6 A;  3OIO A;  1JUM A;  1OFC X;  1LE8 B;  1GDT A;  2O8K A;  2JK3 A;  1P7I A;  3I4N J;  5F1J A;  1T56 A;  3RZD J;  4BY1 J;  2JN6 A;  1GT0 C;  2COB A;  1VND A;  2W48 A;  3JRB A;  2XPW A;  2Y0S N;  2E2I J;  3S1N J;  4A69 C;  2K9Q A;  4BBS J;  2HDD A;  4JX5 A;  3ZQC A;  5IOY A;  2ID3 A;  2JMW A;  4RDU A;  3QPS A;  5FKN A;  2JA8 J;  1RKW A;  1ETO A;  2L7F P;  4JX6 A;  2JA7 J;  1RR7 A;  4D5C A;  2DMT A;  4UUS A;  1BA5 A;  2DMN A;  3JRD A;  5EZG A;  4I76 A;  5K7H A;  4XK4 A;  3MN2 A;  1FTT A;  1JTX A;  2ID6 A;  3CDL A;  3FIS A;  3NAR A;  5M3F J;  2LVS A;  5F0H A;  2FX0 A;  4X6A J;  2PMZ N;  2GM4 A;  3BR5 A;  1W0T A;  1ETX A;  2AHQ A;  3HBL A;  3BQY A;  5C44 J;  4DYR A;  3S1M J;  1ENH A;  2VUM J;  3LNQ A;  1GV2 A;  1WH7 A;  2L9R A;  5JLX A;  1HF0 A;  5F04 A;  2CUF A;  2XGC A;  3RKQ A;  5J3L A;  1S7E A;  2EBI A;  2R5Z A;  2MW8 A;  1U9N A;  2Y2Z A;  3LSJ A;  4GFB A;  2DA4 A;  1BW6 A;  2ME0 A;  5E3O A;  1DU0 A;  1BJZ A;  2XPV A;  4B1R A;  2YU9 J;  1HDD C;  3G1M A;  4HNV A;  2NS7 A;  4DYC A;  1OJL A;  4RBO A;  3C2B A;  2M9H A;  3K2A A;  5FKM A;  1WCM J;  4XRM A;  1POG A;  2XB5 A;  3HKZ N;  2LD5 A;  4FIS A;  2FQ4 A;  1WI3 A;  1Z77 A;  1I3Q J;  1JKO C;  2CJJ A;  1AU7 A;  1HDP A;  5GPC A;  1RKT A;  3TED A;  3GBG A;  1B8I B;  4A3J J;  2R7Z J;  4C3H J;  1FEX A;  4C3J J;  1IV6 A;  5C4J J;  2L0K A;  1PUF B;  2R5Y B;  5GP9 A;  1ETQ A;  4JX4 A;  2N8G A;  2DA3 A;  5BNG A;  5EGO B;  4D7M A;  2HXO A;  1QVU A;  1B72 B;  4W97 A;  3O8H A;  4C2M J;  1RPW A;  3G1L A;  1JUP A;  2WB1 N;  1W0U A;  1VI0 A;  3Q0V A;  3FKI J;  3ZOB A;  4DYQ A;  2KT0 A;  3PM1 A;  3JRI A;  1IG7 A;  1ETW A;  1TWH J;  1ORK A;  5DS9 A;  2YS9 A;  4A3E J;  2R92 J;  5IYC J;  1Y1W J;  2JA6 J;  3BR2 A;  4G12 A;  4M3F A;  1HLV A;  5JLW A;  2L7Z A;  1DU6 A;  4A3M J;  3S1R J;  5EZH A;  2K40 A;  5EYR A;  3GTO J;  5FLM J;  2M34 A;  2MGQ A;  1A6I A;  3A01 A;  1FTZ A;  4V2G A;  2X48 A;  5F27 A;  2NVY J;  2EQR A;  3QPL A;  4FE4 A;  3CQZ J;  5IPA A;  1MBK A;  5FLV A;  3BTC A;  2CUE A;  3TP3 A;  5FKL A;  2WAQ N;  4XRS G;  1OCT C;  3HDD A;  4BXX J;  3H3V K;  4BKX A;  5F0C A;  2XRL A;  2FD5 A;  1MBF A;  3G1O A;  1CQT A;  3RZO J;  1K83 J;  1MSF C;  1UG2 A;  2IBD A;  2D5V A;  1VFC A;  1YRN A;  3JRE A;  4C3I J;  2NVQ J;  4EEF G;  2EH3 A;  2L7M P;  2M2E A;  3ZQI A;  4QIW N;  2X9D A;  5FJ8 J;  3SFI A;  3OSG A;  1D5Y A;  2DA5 A;  1FIP A;  3HGY A;  3A02 A;  1MH4 A;  1MSE C;  3BTI A;  4DW6 A;  3TP0 A;  5K7F A;  5C3E J;  2ECC A;  2JJ7 A;  3S14 J;  3BR6 A;  1NK2 P;  5C4X J;  4I6Z A;  2HOA A;  1TWA J;  2EZH A;  3RQI A;  4IHY A;  4A3I J;  4DZP A;  2E1O A;  2KDZ A;  2G0E A;  3PO3 J;  1U8B A;  4A3B J;  2NVX J;  1IDY A;  1AKH B;  1H8A C;  2IEK A;  5M3M J;  1QVT A;  3Q0U A;  3D1N I;  1XG1 A;  2CU7 A;  4B3A A;  1HOM A;  2CRG A;  5EGO A;  4CYC B;  2E19 A;  4DZJ A;  3CMY A;  4M3G A;  4MIM A;  3GTG J;  2MG4 A;  1MBJ A;  4FTH A;  1JKP C;  1IRZ A;  5F0F A;  3JRH A;  3NAU A;  5IYB J;  1G2H A;  3IH3 A;  1NK3 P;  4MO7 A;  2Y30 A;  3B6A A;  1FJL A;  4JYK A;  1JJ6 C;  5EDN A;  2ZB9 A;  2P81 A;  1ZR2 A;  1U9O A;  2O9L A;  4A3D J;  3A03 A;  3JR9 A;  4J19 A;  4W1U A;  4XRS A;  2X6O A;  2XGE A;  2DJN A;  3HB9 A;  4UUT A;  2NOG A;  2LY9 A;  4A3L J;  3OOU A;  3MVP A;  3WHC A;  1Z0X A;  2QCO A;  3SJM A;  3IV5 A;  1BL0 A;  3O8G A;  2E2H J;  4A3G J;  4AC0 A;  2LFB A;  1T33 A;  4AUX A;  2CQX A;  3OSF A;  3LOC A;  2DN0 A;  1MNM C;  2TRT A;  2HOS A;  3JRF A;  1XC5 A;  1TC3 C;  1IUF A;  2DMQ A;  5E3M A;  2GLO A;  1ITY A;  1VF9 A;  3JRC A;  3HOU J;  4A3K J;  3VPR A;  2EZK A;  3WHB A;  3ZQL A;  4LOC A;  4Y52 J;  2AO9 A;  2O7O A;  2OPT A;  2XGD A;  3M4O J;  1ZK8 A;  2M0C A;  1IGN A;  2HYJ A;  3ZQG A;  4IHV A;  4IHW A;  3A01 B;  4ABZ A;  1TWC J;  1UHS A;  3BG5 A;  2DA6 A;  3F0C A;  1ZTR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...