4BL0B

Crystal structure of yeast bub3-bub1 bound to phospho-spc105
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
44
Chain Sequence
NNPVYKLINTRKPERIVFNFNLIYPENDEEFNTEEILAMIKGLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords CELL CYCLE ARREST PROTEIN BUB3
publication title Bub3 Reads Phosphorylated Melt Repeats to Promote Spindle Assembly Checkpoint Signaling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 6
structure length 44
sequence length 46
chains with identical sequence E
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08171 Mad3_BUB1_II Mad3/BUB1 homology region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2870 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bl0B00
4BL0B
chains in the Genus database with same CATH superfamily
1DU6A 2V6CA 5CQGA 4E7IA 4GFBA 1ZRFA 1SFOJ 2COMA 1XCBA 4II2A 4HQEA 2M4KA 1OMIA 1TW3A 3H35A 2R7XA 1SVOA 2K86A 4U7BA 2IPQX 2QSGX 4A5MA 3SDBA 4BQQA 3DXJF 2VE8A 1T38A 3G1MA 4FASD 2EFQA 2P5VA 3KP3A 3S3NA 3CDHA 1FP1D 1OR7C 2IVMA 3VSLA 3CO6C 3F6VA 2CFOA 3IC7A 2DA6A 2IW5A 1UB9A 4KIBA 3D5RC 1HCRA 4YIFA 3CMAI 1CF7B 1P2FA 3L7WA 2HYJA 1A31A 5J40A 2EIMH 1A5JA 1VTNC 5E17F 3SZPA 2XPUA 2IEKA 3BP8A 1VQKI 2XAHA 2JVHA 3K69A 1OYWA 2A6TA 4C3HJ 4AM3A 2ZCWA 2HZTA 4O6JA 4Q5SF 3HTUA 3K1PA 4ZZDA 2LMDA 3E7LA 1XGMA 1K6OA 2QKLB 3KYDB 5IP7J 2STTA 3BR5A 3KEYA 5EEGA 5J4VA 3CMYA 3FWEA 4XLHA 1ZRDA 4CCKA 1Y39A 4X1EA 1FSHA 3KLNA 1WKMA 2RNGA 1X1CA 2OZUA 1IC8A 1IN6A 1T0FC 2K4BA 1FY7A 3G3ZA 4EJOA 3HOTA 2VBZA 3B6CA 3DCFA 1ZKGA 4IHTA 2HGCA 1BA5A 4HDVA 2OC6A 4H0EA 2HDDA 3S32A 1AWCA 2OD5A 2OTLI 4W1UA 4RB0A 3KP6A 2XUBA 3QOPA 4E7JA 1G6NA 3KFWX 3QPSA 5ICCA 1JJ8C 3DBHB 1U5TB 1X1DA 2FD5A 3IWFA 3RYPA 2L9NA 2MD0A 3WTTC 1W5SA 1I39A 4A3BJ 2CFXA 2EZHA 3I0TA 4I98B 3GEZA 1Z3YA 4B09A 2P6TA 1FYMA 4FE7A 4HLYA 2W57A 3B73A 3HEFA 4RGUA 4XLAA 3ABTA 1U3EM 4XM3A 1YRNA 2J5PA 2Q0OA 2DXIA 2A61A 1XGNA 1UG2A 1JT0A 4L18B 2PEXA 4OMZA 4P55A 1SAXA 1UFMA 4XLPF 1YIOA 2EILH 3PQJA 3HRMA 1QVUA 1R7JA 4EJVA 3EETA 2DJNA 2VLAA 2EH3A 2B0LA 2LY9A 4KITB 5FRNA 2GOMA 2KZGA 4WX9A 4BE1A 2DOEA 1YS6A 2CRGA 2Q8KA 1Z6TA 3FHZA 1HSJA 5JI6A 1LB2A 1HBXG 1LFBA 1Y0UA 1R9TJ 1YJ9I 1LUJB 1N78A 1OCRH 4GXOA 2NVQJ 3C2BA 2HOTA 2NOGA 4PSXA 2F4MB 1LQ1A 1OCOH 2M4GA 4CSWA 2DT7B 1WH5A 2G9WA 5D5UB 4LB6B 1O7FA 4M9XA 1P7IA 2FNPA 3PSIA 4MFEA 4UV8A 1OISA 5JR3A 1FYKA 3ELKA 3HXLA 3GZNB 2QCOA 3J80Z 1MSEC 4A69C 2EZKA 2XPVA 4CUGA 4UUSB 1ZR2A 4EGYA 3BG7A 5H6RA 1FLIA 2F2EA 4M3BA 5BOXA 3TL4X 1GDTA 3S1MJ 3GFMA 4RM2A 1UCRA 3VEPA 4KISA 2MH2A 2O61A 2QZ8A 3UKGA 4G6TB 4RGXA 2AQEA 3BY6A 2XGEA 3D5LA 3OY9A 1KU2A 4M6VA 3JCUC 2ESNA 1A6IA 4MO7A 4NB5A 1IRXA 1IXCA 1FOKA 4XK4A 2LF7A 2QWWA 4IOCF 1IZ1A 4CH7A 3ZQ7A 2VB6A 1TWAJ 3HBLA 1SD6A 1U9NA 2BY2A 5IY5H 2LREA 2JPBA 5DM6F 3A01A 3RKYA 2R5YB 5BMZA 2N8GA 2MC4A 1OJLA 3TO6A 5ILVA 3GZ6A 1T0FA 2QLZA 1T6SA 2FXAA 2FQ3A 2K02A 2RC4A 3LSHA 1U8BA 2R7ZJ 2LNBA 5M3MJ 2QYOA 1JHHA 4PJNA 2KIUA 5L3GA 5DCMA 1YTYA 1TZLA 1K78B 5HLTA 2GLOA 1A35A 4OMYA 3ERMA 1CQTA 1IUFA 3DTIA 1R58A 3ZQQA 4I09A 4GGGA 5HLIA 1HDDC 4LG0B 2JA6J 3BZKA 3C3WA 1VQ6I 3ROUA 3WU2C 1B1BA 4C2TA 1C0WA 2W82A 3HKZN 4LLLA 2DA2A 1W7PA 2YSRA 3QU3A 4R79A 2BV6A 5LGNA 1Y1VJ 1B8IA 4U0WA 3CC2I 3CQZJ 4AYBA 3MFKA 4Y15A 2Y69H 3ASOH 5JHUA 4HF2A 4U7DA 3BR1A 4XKBA 2HQ5A 3MZYA 3DPLC 4ZC3A 4HPQA 4ITVA 1P4AA 2LOOA 2VN2A 3BPXA 3V8LA 2D45A 2GA1A 3LA7A 3G1LA 3S1QJ 1MIJA 2HU9A 4ESBA 3CCQI 1TWGJ 4G9YA 1YITI 2V1DA 1ZTRA 2QQ9A 1U0JA 2LKPA 3S14J 1WI9A 2KT0A 5F08A 4DNCA 5D5VB 4CYDA 1W36D 3BLYA 3HOWJ 1F9NA 2PI0A 5GTIC 3LMMA 1Y8QB 1BIBA 3KYLA 1AOYA 4G12A 3AL0B 3F3XA 1GV5A 2IGMA 4IEJA 2ZFWA 3AG3H 1I50J 5CKTA 3RKWA 3R0AA 4FTHA 2HOEA 1ONVA 2F5EA 2A69F 3QPHA 4M71A 4OIOF 5F0FA 4ZJZA 5EG0A 3BR2A 3LSJA 4KJZA 3V8KA 2DPUA 1ETXA 1FT9A 2K7LA 3WE2A 2LKSA 3GO5A 1XD7A 2ELHA 1I27A 2W85A 3LOCA 3JRFA 3CJTB 1ETYA 3HPGA 4EEFG 1MZBA 4Q48A 2FMYA 3A0BC 3I53A 4YEJA 5E20A 1MW7A 3BZ6A 3AG4H 3NWSA 1ETOA 3PM1A 3ZP5A 2X9DA 5LEKA 1N25A 3KYCB 1F36A 3ZQHA 5KHDA 3F8NA 2FUG2 5E3MA 3P7NA 2TCTA 4M3FA 2HQNA 2OV7A 1XS9A 2IA2A 3C1DA 3QU6A 1ZGWA 2XGCA 4H4KC 4OAYA 1JUSA 1YYVA 4UNOA 4DJAA 4IF4A 5TJJA 2R7TA 2ICWG 4LIUA 3LQRA 2NRAC 3I4MJ 3HOSA 1WHUA 4E7HA 3HGGA 1JKRC 4A3MJ 3J7AO 2WB1A 3DKXA 1TQMA 1OLTA 2JUCA 4CDGA 1X1PA 2GOXB 5H20A 3F22A 3MZHA 3X2QH 2OZ6A 1DU0A 3J7AY 5J8FA 3EUAA 4MNUA 2K9LA 4I2OA 4HX7A 4HLXA 2XAUA 5ILUA 3RDIA 1MJBA 3OYGA 4A12A 3E0JB 4F7ZA 1F5TA 4XRSA 3DEEA 4CYCA 4Y52J 1MSFC 1E0EA 2FEZA 2L7ZA 2OUMA 2QEXI 1J75A 4A3FJ 2ID3A 2VQLA 2JVGA 1WZ2A 4AYBN 3DU6A 2R92J 3TP0A 2LY2A 2RKHA 3KLOA 3ZMUA 2YUSA 2EWNA 2CMPA 3ZXSA 3ZMSA 3L2QA 1OYIA 1Z77A 3C2GA 2E71A 1DP3A 1ZHFA 1MMGA 2DU9A 1J5YA 2QQBA 2J5OA 3HC7A 4LJZF 2X6OA 1PUFA 3TKYA 5D6EA 4F55A 1JKQC 3RPUA 1B9MA 5JLXA 2BXYA 3CO7C 1JKPC 2BBYA 3WTZA 5IP9J 2M0MA 3L2RA 2WV0A 2OCCH 1LNWA 2DQRA 4F92B 2LBFA 1OCPA 1USSA 3H36A 3CC7I 1O3RA 2EV5A 4YFXF 2M8EA 3IH2A 3QQAA 4C30A 2QQAA 2ZFUA 2YR2A 4C9YA 2KJBA 3VYUB 5FB2A 2MGQA 1O7LA 2BW3A 2V9PA 3DBLB 1WGXA 5L3FA 2DA4A 1MKMA 4RAFA 1K83J 3O8GA 5M3FJ 2A6HF 1RZ4A 3RIRA 3GF2A 1X1BA 3ZN0A 1ZN2A 4BUPA 3CJRB 3GX4X 2XV4S 4RB1A 2NNNA 2W84A 4BACA 1MBJA 4V2FA 3CMEI 2H6BA 5GPAA 5LGUA 4BBSJ 2F6CA 2DMUA 4BJ5C 4ZYEA 1IF1A 3CUQC 2L0KA 1KQ9A 5IYBJ 3L2UA 3DP7A 3K1NA 4RB3C 5LHIA 1FBQA 1GV2A 4CCJA 4D7MA 1AU7A 1ZREA 2L01A 4UVBA 2A6EF 1ZLKA 3HGYA 3BTIA 2QBYB 2KRCA 2M87A 2W25A 4L9JA 3Q3SA 2E1OA 4C2MJ 3BQZA 1LKXA 4XSZF 5E1XA 2CV1A 4S05A 2NVTJ 4FE4A 3SDGA 4XN3A 2GM4A 5JVGF 3VYSB 3K10A 2DN0A 1GVDA 5BS6A 1TNTA 4B8XA 1I3QJ 2HTJA 2M2EA 2DI3A 5E3NA 3I59B 5HS8A 3HUGA 5HLHA 3MKZA 3F23A 5DCFA 2M1BA 5DCMB 1W7PD 1BR4A 2F5CA 3PSFA 1QHHD 2EFNA 4ENMA 1SD7A 5D6FA 3RKXA 1U78A 4CCLA 1V54H 5L3BA 1VQMI 2HR3A 1R5HA 2RGVA 5KVRA 3LAPA 3P9IA 3L2VA 1B8IB 1N77A 4E6KG 4IRGA 3GTPJ 4RGRA 2NVYJ 3E6MA 1A6QA 2K27A 1BW5A 2CW8A 4GYIA 3HM5A 3S3OA 4M3GA 3R60A 2X0LA 4YELA 5FLXZ 5LEJA 3OYCA 2ME6A 3JRBA 3ZOBA 2NYXA 1WCMJ 5LHGA 2VC1A 3IL2A 4AU7A 1S3JA 1JTYA 2XAFA 4BH9A 2TRTA 3M8EA 4GRIA 5JHFA 2R7VA 1VZ0A 3G2BA 2DDAA 2ECBA 4IRHA 1T2KA 4DW6A 2ZC2A 3UR3C 3JREA 2AQFA 3ZMVA 2F5DA 3GTJJ 3VPRA 1PP7U 2ISZA 1TT5B 1KU3A 2M45A 3QODA 3NARA 2VASA 1TQIA 1BOBA 3BTLA 2D5VA 3G6EI 5J1RA 2B63J 2Z33A 2DO7A 1H9TA 2HYFA 1E3OC 2AXLA 4RLFA 5IT9Z 3O6BB 1GXQA 3R0JA 1IJWC 1B59A 2DFFA 1W36C 5J1YA 2JRTA 3BR3A 2V9VA 2QENA 4PK4A 4Z6YA 2VXDA 4OINF 2VJ5A 3OOUA 4B43A 2JUGA 1G2HA 3F8BA 2OA4A 2BVLA 2KIMA 4I02A 2W7NA 1TLHB 3SXYA 1M1EB 5F27A 1D8JA 1EV7A 4ENKA 1YX3A 3FMQA 4PJMA 2QUFA 1T56A 2EIJH 2FBHA 2E2JJ 5CQEA 2EFPA 2ZXJA 1Y0NA 4R1HA 1WQ2A 3MKWB 2K3FA 2IBDA 3FXLA 2FJ1A 2K85A 4XKVA 3PO2J 2JK3A 4OOIA 2D2WA 3MQ0A 1KYZA 1UZCA 3MD2A 3ZQLA 4XSXF 4P5OA 2DOFA 5CJ9A 4X0GA 3LSMA 5FJ8J 4A3EJ 3D1NI 4IXAA 2XRNA 2XKPA 2HFHA 3HTSB 3I9V2 3RYRA 1S7AA 3TBIA 2R93J 3ERED 3MWMA 2FA5A 4JX5A 1YW7A 2CJJA 1W0UA 1PDNC 5F1JA 1RC9A 1XMKA 3RSNA 2PFBA 3EDPA 3GBGA 1BI2A 4QPQA 4NUBA 3I71A 3LSKA 4CCMA 2M9HA 4XRFA 3RPUD 3FXKA 4KA4A 1ON1A 3HHGA 1E3HA 1JE8A 3O2PE 1AKHA 1UG0A 2VOPA 4XOTA 4P96A 1R1VA 5LGTA 3DLLF 1S5LC 4M73A 2FBIA 4EM2A 2QA4I 3DV8A 2FQ4A 3KE2A 5DUKA 1PUFB 5GPCA 4GCVA 5F04A 3K7AJ 3JAMK 2M3AA 1QPMA 2HQRA 4JQFA 4BS9A 3ZPLA 1B9NA 3JRGA 2LBFB 4RB2C 3WTYC 1WRJA 2GWRA 2C6YA 1MNEA 2VODA 4ZYAA 2E2HJ 2R5ZA 3A2KA 4FHTA 3D0SA 1MNMC 2KFDA 2KISA 3CF5F 4XMYA 3IWZA 1Z67A 1DPUA 1IXSB 5B1AH 4XICA 1I1SA 4J01A 1ZQ3P 5DYMA 3OSGA 4ABZA 4A2UA 1ZARA 1QNTA 5L3DA 5CVIA 1BI3A 3WE3A 1VQNI 1XSDA 4XLEA 4DIQA 2KL4A 4IKFA 1E17A 2ZJRF 2DK8A 4ON0A 3BG9A 2LG4A 3PNVA 4M6YA 3OYIA 1ETKA 3GFLA 3JW4A 3M07A 2V4JC 4O3MA 1Q1VA 3HHHA 5D8LB 1U2WA 2IA0A 2ZJQF 3BJ6A 2QGUA 2Y2ZA 3C2HA 1VQ7I 2X1EA 2L9RA 5F1RA 3HOVJ 2O8KA 2H1KA 1HC8A 1GVJA 2XSJC 3F21A 2NVXJ 4F3QA 2XASA 1TL8A 3ZMTA 1B72A 2E2IJ 2R4GA 2EZLA 3QP5A 4FQGA 2CGPA 3TMOA 4UHTA 5HS9A 5EDNA 2DLLA 3TOBA 2EV0A 2XPWA 1AA7A 3HUGB 5DV5A 1VF9A 3T1BA 3ECOA 3K2AA 3OYKA 4CXFA 1MBHA 3H3UA 4G6DA 1KYWA 4KICA 1JUPA 5EZGA 2CV2A 3KP5A 5FKNA 5EZHA 3S93A 1RKTA 1G4DA 3F8FA 3ZGKA 3KZZA 2A05A 2VQHA 3NAUA 4Z2YA 1ORKA 2XAQA 3HRUA 2E1NA 2IGNA 4CCOA 1HDPA 2FNAA 3TQNA 1KQ8A 2KPMA 2O9LA 5CLSA 4DGWB 3KIOA 2XROA 3R6SA 2ZKZA 2P5LC 2O6GE 4HV5A 3P9CA 3LA3A 3H5AA 4L5EA 2NOJB 2Z9OA 4UV9A 2LVSA 2FOWA 1SD4A 3OMYA 3LAJA 3SYTA 3HKZA 1KZHA 4I01A 3Q9VA 3OYNA 3H0GJ 2WC2A 2MG4A 3CDIA 1J2XA 5EEAA 3CP2A 2XF6A 4HNTA 5ICFA 3GLXA 4D0PA 1K61A 3TGNA 3CLOA 1X58A 1V3FA 3S2DJ 1D5VA 1P4WA 3OYEA 1D1AA 4IHYA 1YJWI 3ABLH 3FKJA 3DEUA 1R1UA 2K40A 2JZYA 4E7LA 2WWYA 2O3FA 1FBSA 4M9ZA 4NC8A 1OFCX 1YI2I 3O8HA 2HXIA 3FXMA 3VOEA 1G3WA 3WHBA 1W0TA 2VKEA 1DP7P 3LSIA 1LE8A 2A07F 1TT0A 2Q1ZB 1XPXA 4PSWA 1YG2A 2A68F 4ZTFA 2BY1A 3W6VA 3FIWA 5KK1A 2LKXA 3GW2A 3NRVA 4BL0B 5FFZA 4KIGA 1FBUA 3OOPA 1XMAA 2XB5A 3S16J 3CP8A 1IRGA 2R7SA 1XMXA 3T0YA 1O3SA 3LQQA 1P4XA 3SEQA 4QTRA 2PQ8A 3CUOA 2HI3A 2WY8Q 2W24A 2L9SA 2CQKA 3DF8A 4A3CJ 3MMYB 3CUQB 4RAYA 1HW2A 1Y8RB 4BHCA 3BC8A 2XGDA 2VPLA 1SFKA 4ASNA 4D5CA 2Z99A 1WH7A 2E35A 3EUHA 4IPAA 5J1UA 4KNYA 5J6XA 1R4NB 3ZMDA 2P7VB 2VXZA 4MLOA 2XF7A 2I8DA 2R7RA 3VB2A 4DYCA 4BJTA 3DWLE 3VYTB 3BCAA 4NNJA 5HNFA 2YPRA 1PP8F 4XKCA 3FX3A 2P7CB 1SVMA 4E4HA 1MMNA 3SZTA 1MBEA 1RI7A 2K3PA 1X1AA 5KNLA 4FX0A 4BDZA 1YJNI 2XIGA 2XGXA 4KDPA 1LDKB 3SEZA 2X51A 4RLQA 1OQYA 3K4KA 1BJAA 4PGHA 2R7DA 3A03A 3FXRA 1FZPB 3P9KA 1RUOA 1DGWY 2CU7A 2PJRA 1W4MA 4EJUA 3G4SI 4CCNA 3J7YJ 2Q2EA 4D9JA 2JA8J 4EM1A 3RTRA 3ZQFA 3E97A 5E18F 3DQVC 4BKXA 5E79C 2GIZA 1YW8A 5ED4A 2JTVA 3OL3A 1TWCJ 2D1HA 4ZH4F 2OPTA 1ZG5A 3MKLA 1X4PA 3E5QA 3MVPA 4W97A 1ZGJA 2HDWA 2KQRA 4HNUA 3CCEI 4MHGA 1YLFA 3EPZA 5LRSA 3NEUA 4G6QA 3I56I 4IHSA 4OU0A 1Z7LA 2CQQA 3WTXC 4ZTJA 1BC8C 4BQOA 3ZR8X 1APLC 2I10A 2OJED 3HRTA 4E7KA 1HLVA 1F4KA 4IRIA 3VDXA 3SFIA 1S9HA 3FK7A 5LLQA 2V79A 1X4OA 3JSOA 4BEHA 3GTOJ 5B1BH 3GCMA 4LLGF 3S2HJ 1P9QC 5JLWA 2HDCA 1RUNA 3GXOA 4L9VA 2JA7J 2L5QA 2E7WA 1FEXA 4RM3A 1XDSA 4UXNA 1R5GA 1S8NA 3CLQA 5KCMA 1JGSA 1SFXA 4DBQA 3BJOA 5FLMJ 1RR8C 2JRMA 3Q0VA 3Q9SA 1EH7A 3M8FA 2WA0A 4O5VA 4P9FA 2H27A 4RDUA 4RAZA 4XRSG 5KAFC 2HVSA 3T8TA 2LC2A 2NS7A 4DYRA 4L5IA 4XIDA 4Y17A 1JKOC 1HOMA 1WPKA 4B47A 2KJCA 1P92A 3HOYJ 2DA1A 3DLAA 2DODA 3BJAA 3HL2A 2ZXWH 3RKQA 2BE5F 3QYEA 1X2MA 3CCYA 1FP2A 4MIMA 4E7SA 2EBIA 4HQMA 2VI6A 2RN7A 4WXCA 2XDVA 2XKOA 2OQGA 1FIPA 1BOAA 1XGOA 3OL4A 3M3YJ 5FKMA 1S29A 2IGKA 1FNNA 5FKKA 3OWTA 3F0CA 3FXUA 2RAEA 4BY7J 3HOXJ 4IO9F 5AONA 2QQ8A 1LDJA 3AG2H 3RCOA 4RBOA 2DFEA 2JA5J 4HF1A 1R22A 1R00A 1MD0A 3QWLA 3FMSA 1IW7F 4Y13A 4UB8C 3V42A 1P7JA 1V4RA 4M3DA 2XRLA 1WI3A 2NNYA 4I0AA 2GAUA 1YRNB 4B44A 2DYRH 2MYSA 2XAGA 2ZSHB 3ISPA 4F91B 1WJDA 4RAGA 1SVLA 1Z0XA 3W3CA 5LD2C 2UV1A 3HJEA 2CO5A 3K4MA 2V26A 3C7JA 2B7EA 2QVOA 3BTCA 2HNHA 4HRIA 2WAQN 1D5YA 2DTRA 3CESA 4BDYA 2D1VA 3JR9A 4JOMA 3AKZA 3DEWA 1BC7C 3ZQIA 1IAWA 2KZVA 2LD5A 1Z91A 2BGCA 4CO8A 2VKHA 1QO0D 2BY0A 4BY1J 2VC0A 2P8TA 3S8PA 1BI0A 1D8KA 3OR1C 1REPC 1I6HJ 2ME0A 4HX8A 1FPQA 2YS9A 2ACJA 2HXOA 2YU3A 4FISA 4NHJA 3DU5A 5K7ZA 2ETHA 3R61A 2Y0SN 4OWRB 4N4NB 3WTUC 5FKLA 1W5TA 2IP2A 5D5XB 3EQLF 1L0OC 1X3UA 1WJFA 1OPCA 3W6KB 5EGOA 1U8RA 2ID6A 5A2QK 4HSTA 3CCRI 2X85A 4AIHA 1WFXA 1E3PA 4EATA 1BI1A 5D8KB 1FSEA 4OIPF 1IGNA 3BPVA 4XLFA 5IOYA 3TP3A 3TO7A 5CVRA 4BYYA 5C4XJ 1UHMA 2CUJA 1NK2P 4AWXB 3S17J 3J81K 4U87A 1MDMA 4HSRA 4CICA 1SD5A 1TBXA 1T98A 3V4GA 2R3SA 4Y7NJ 3OYAA 4E7ZA 1B4AA 4KIFA 3BCBA 4HV6A 4A0ZA 1YQAA 2F4OB 1SMTA 3G1OA 4HZFA 3FISA 1R49A 1QA6A 1J9IA 3OYHA 1WJ5A 2P6SA 2Z1DA 2RDPA 3A01B 1SANA 1IXRC 1F1ZA 3PFIA 2XC7A 1OCTC 4IHVA 2LK2A 2PMZN 2PMHA 5HDNA 1WWXA 3BDDA 2ISYA 2MFZA 4MQ9F 1CF7A 1YS7A 3HIFA 1FYLA 2RNJA 1RNLA 1K79A 3N97A 1I1GA 2V6EA 2EJRA 1SFUA 4KN7X 2HKOA 2P4WA 4LD5A 2K9SA 4X6AJ 5F0CA 2X6WA 2UZKA 3CJQB 2V1NA 1GUUA 5D5WB 2DMQA 2DQLA 2WTEA 2L7FP 2FF4A 2PJRB 2JQ7A 1Z05A 4N9IA 3H1CA 2ZO4A 2KDZA 1XSVA 2DT5A 2VJJA 5GAGJ 5E8GA 2O7OA 2Q2EB 4NQWA 4YIIA 1X3WB 3TO9A 1FOXA 1W7PB 4YRVA 3E6DA 2H6CA 1WVRA 5GTHC 2HOSA 1U9OA 1V5GA 3OYMA 3FM5A 3LFUA 5J47A 4BHPA 3ABKH 1ETVA 3DTEA 3BQYA 4XL9A 5C44J 2H09A 1MNDA 2EQRA 2R7UA 5K1YA 1UJ8A 2ADUA 2VQCA 3BTJA 1JUMA 4DYQA 3ZN1A 3V7CA 1U5TA 1R23A 2CWEA 2DK5A 3GTQJ 4K2EA 5HVQC 1QU3A 2LP0A 2DMNA 2EB7A 2V1UA 1IRFA 1A04A 3QPTA 2CW7A 3EYYA 1Y6IA 2M30A 2X1DA 3FDYA 1LFUP 3ESWB 3RPQA 4DZJA 1O3TA 1BJZA 4D1QA 1ETQA 2VBYA 5EEHA 4U0VA 1ZRCA 1K4TA 1SFEA 4HNVA 4BHBA 4BE2A 4B3XA 4BQNA 4HDUA 1ODDA 3OS2A 1VQLI 3I58A 4JX4A 2BXZA 2JJ7A 2GIVA 4WWCA 3PUFA 2IS2A 2H1LA 4N0BA 2ZJ2A 3R4KA 2STWA 1Y56A 2HTSA 5DTDA 1J7KA 1XSXA 1RETA 2GBYA 1ERDA 5DD8A 5EG0B 1QZYA 2WBMA 4ZDPA 3FXOA 2UXNA 5LHHA 5M5YJ 2UXXA 2QF7A 2GA2A 4BGDA 4E70A 3IRRA 1LJ9A 4PZJA 1K6YA 1YE9A 1ZGAA 1LVKA 2LH9A 2IXSA 1IDZA 4V19K 3LSTA 4ZYHA 1Y1WJ 1GT0C 1DQUA 2FOKA 4WCGA 3F6OA 3A1YA 1OKRA 3I55I 4ETSA 1LDDA 1HSTA 3JAMZ 4QSHA 1QBJA 1RESA 3OV8A 2AXTC 4UUSA 5DS9A 2E60A 5ERIA 4L9TA 3WHCA 3TDZC 3TW6A 1FOYA 4HX4A 1OCCH 4NBQA 1R36A 3G71I 3N4MA 2KIQA 3W2VA 1S7EA 4BNCA 1BBYA 4A0YA 3V8JA 2XHKA 2VBXA 3BG5A 3QYBA 4KT5C 4YIRX 4C3JJ 4WF2A 3HDDA 2V7FA 2X1CA 3MKYB 2K4JA 1IV6A 2CW0F 4YG2F 1LEAA 3ML6A 5FROA 2HOAA 3IP4B 3F8CA 3KCCA 4DZPA 3GZ5A 4WK8F 1T39A 2L2OA 2DBBA 3O3KA 4V2GA 3GTGJ 4XONA 1ZR4A 3FZVA 4CYCB 4IJAA 1D1CA 1EJ9A 2KHMA 1ZG1A 1TW2A 2MABA 4PFOA 2L9VA 1H0MA 3OR2C 2VE9A 2E1MC 3TEDA 4RGSA 1VI0A 4AC0A 1OYYA 3NWTA 3E5XA 5C4JJ 3S3MA 1R6RA 5D4SA 4RS8A 2PLYA 1I5ZA 2HZDA 4G94A 5ICGA 3PQKA 2JSPA 4PDKA 5ICEA 1G59A 1G3SA 1O57A 2BYVE 1MBFA 4ENNA 2KRHA 2O0YA 2EPFA 3GVAA 1IN7A 3H3VK 2OU2A 5FRMA 3C18A 4XBFA 4XR6A 4JBAA 2Y9ZA 2L7MP 1XX5A 3M1CA 3PIOF 1K78A 1FMVA 4EVIA 4EV0A 1RR7A 4LB5A 5TGTA 3EUKL 3E1SA 5EGOB 1FWZA 2DCEA 4LG0A 3KZIC 2COBA 3BR6A 5IP6A 3SHFA 4ZZLA 3GUDA 1VFCA 2I5UA 4ESFA 4PUSA 1MH4A 2BW3B 4EMSA 1EF4A 3CF2A 4I76A 3AAFA 2M8GX 3HB9A 2VPRA 5BPIA 1WJAA 1MDMB 3MZ8A 3QP6A 1FC3A 2YU9J 4IQ4A 5B5EC 2EV6A 5E3LA 4BXFA 3HPHA 5BQTA 1BL0A 3CC4I 5IPAA 1RPWA 2Z16A 2HYGD 2Y9YA 3HOUJ 2R7OA 4ENJA 2A5YB 3KP4A 1X3ZB 3COAC 1IN5A 4KFCA 3HZJA 2ECCA 5K7HA 3M4OJ 2EZIA 2KRFA 4I6ZA 3EUHC 1HKQA 3H5NA 3Q0UA 5IYDJ 2M0CA 4UB6C 2OAZA 3VODA 5L3CA 1SAUA 2VQGA 5DEQA 5ILSA 1XCVA 4IL6C 4LFUA 2LY1A 3LSRA 5CVVA 1DGRM 5HODA 3G73A 1FOWA 2CUZA 3BZCA 2Y31A 2BY3A 3PNTA 2EFOA 2IGOA 3VYRB 4JP0A 3H9QA 1BIAA 1ZELA 4M72A 3L9FA 3KETA 3PL8A 3ZQGA 2A3SA 1HF0A 3GMEA 4IZZA 5FLVA 4M9SA 4CGZA 2MD5A 3H92A 4WXDA 3RJPA 5FO5A 1X19A 2CS3A 3LA2A 1AHDP 1VQOI 3K4CA 1MH3A 1JTXA 2ZJPF 1I6XA 5GAEJ 2OBPA 3SQNA 4M3EA 3CCLI 1QQIA 1O4XA 1ZH5A 4NQWB 3ZCOA 4ZDOA 4UUTA 3I64A 3MEXA 1BM9A 3LL7A 4B48A 5K7FA 2AO9A 2RREA 3NQOA 4B4CA 1ZAOA 2L02A 1XTAA 4XN0A 2X6XA 3U1KA 1WJCA 2P0WA 3GTKJ 5EYRA 3L1PA 5H2FC 1A36A 4XNFA 1MMAA 1JI8A 4XOPA 1IDYA 4AVZA 3GTMJ 2E7XA 4OIQF 2Y30A 4RA2A 3KZYA 2DA3A 5J8CA 3GFJA 4BU2A 3CD6I 1MGTA 1QZEA 3HYIA 4B1RA 2CUFA 3CCMI 4LK0F 2VJ4A 1XN7A 2X4HA 2DFHA 3E3VA 1H9GA 1KA8A 1ULYA 2ZXHA 1WSUA 3HSEA 4PJ0C 2ZBKA 4HA8A 1LEBA 5JFRA 3VSKA 3PIPF 5DDGA 3K4LA 1TWFJ 2H8WA 2CYYA 4OIRF 4BXUA 4NC6A 4EM0B 5HOOA 4S04A 1XB4A 4N9HA 1H88C 1YOVB 2VKDA 1Z1DA 3FF5A 3K9TA 3IKVA 4KYWA 3WGIA 1MBGA 4HBLA 1H89C 1EH8A 4F52A 2RQPA 5D4RA 1UHWA 2MLGA 2CQ7A 3OYFA 3S1RJ 1ACIA 2ZXIA 2KDOA 2LLKA 2VOOA 1NG7A 3W2WA 2ZNZA 3W6JB 2X48A 1MJ9A 5IT3A 1X2NA 3OYBA 3IRQA 3HRSA 5K5QA 4IHXA 4HOBA 5TISC 1R1TA 1K7AA 4XORA 1DPRA 5CVUA 2VONA 1FTTA 5F0HA 3BT9A 3H9GA 1UELB 3IAS2 5IYCJ 3J7ZI 2HPIA 2L4MA 3I3LA 4LGWA 4KMUX 3CMMA 2PG4A 2ZB9A 3AG1H 1JJ6C 2AHQA 1OR7A 3QAHA 2DA5A 2PMUA 2EA2A 4BXXJ 4LG3A 2E36A 5HNHA 2Z3YA 2RQQA 4PJLA 3JSPA 4J00A 1N75A 4II3A 3WU0A 4GYGA 3OS1A 4MFDA 4EJTA 4CA0A 3OS0A 1WJBA 1J09A 1FMWA 1NH3A 2QSHX 3SJMA 1JGGA 3IHUA 5HDGA 2ZMEC 4J19A 1SMYF 1SEUA 3K6GA 2WY7Q 3M9AA 3WTSC 2IA1A 4A3IJ 2JA2A 4CZZA 4M6XA 2VKVA 5IOZA 4IHWA 1P6RA 1NG6A 5GAHJ 2KLOA 3GFIA 1KQ0A 1XG1A 1RRJA 1IUYA 1JHFA 4M74A 2VUMJ 4A6DA 1H8AC 2QBYA 1G3TA 3CDLA 3ECHA 5E8IA 3FXJA 1AKHB 2EK5A 5F6FA 3KP2A 2G7UA 4BBRJ 6PAXA 2F4IA 1R4MB 3AFHA 2E19A 1DUXC 1RKWA 4N4OB 2HS5A 3IUOA 1QZZA 3N05A 2O5RA 2ZSIB 5DUIA 1POGA 2W48A 3J80K 4MQVA 1F43A 1O3QA 3I59A 1U6GA 2UWMA 2LR8A 3P5JA 4ANJA 2WAQA 1WJEA 3FHNA 1Z7UA 4DOZA 4YFNF 3PNYA 3HOZJ 3UNGC 2MBFA 2R5ZB 3IH3A 1GXPA 5CVJA 2HPMA 1Z21A 1JT6A 4HW0A 2OTJI 1TQPA 1LVAA 4UY8I 3K2ZA 4XLNF 4BE0A 2DYSH 1D0YA 4Q47A 3E6BA 4Y33A 4NC7A 4XKWA 1MMSA 4LK1F 4D7NA 2DMPA 3DPTA 2YX7A 3DTKA 3FM3A 5E1ZB 2VBWA 3A02A 2Y0SA 3FK6A 5AIPA 2H8RA 5BNGA 2XVCA 2NS8A 3WTVC 2F5FA 2BOLA 1FTZA 4AD9A 2BHYA 4P9UA 2X6YA 3S15J 2BZTA 2R7FA 3KPHA 4UUVA 2HVRA 1UAAA 3JRDA 3KX2A 3K0LA 2ESHA 5J4YA 3LFKA 3BOQA 4HYEA 4ZYGA 4GDFA 3A0HC 2DFIA 4L5JA 4RMNA 3I5UA 5FGMA 4IX7A 2FRHA 1Z9CA 2NVUB 2JN6A 3QPLA 1D0ZA 5GADJ 1QVTA 1TWHJ 5CYVA 2BEOA 2K9QA 5TRDA 2OF7A 3GTLJ 1B72B 1R71A 2IT0A 4A3DJ 3OIOA 5B66C 2LRDA 1HXDA 5C3EJ 4XQFA 2ELKA 5GP9A 4QLCU 1BN5A 1E2XA 4JK1X 1USTA 3V7RA 1SC7A 3I4PA 3BG6A 3U21A 1FJLA 2FE3A 3B02A 4XRMA 4IQJA 2JMWA 1I3AA 4P1WA 2QM3A 2VL8A 3DKYA 4L0ZB 2F48A 2L54A 2PMZA 4LOCA 4LLNA 2KIFA 1W5CC 2EINH 1TP4A 4CZCA 3JTGA 1S7OA 5J3LA 4C2UA 3ONQA 1RIOH 2B9SA 3K70D 2QKMB 1XC5A 4AVPA 3JRCA 1MMDA 2F5VA 5A2QZ 1PJRA 1UMQA 2KKOA 4AUXA 3BG3A 3BROA 5KAIC 3T5XA 2H94A 2NXNB 1VNDA 2G7HA 2ZMEA 2MH9A 1KU7A 1IO2A 3W2AA 4HAMA 2BVMA 3CCJI 1ZK8A 4HG2A 3L00A 3J81Z 3FMRA 4PFPA 5EF6A 3VWBA 2R7QA 2W00A 2M7BA 4L0YB 2DT6A 3ZRGA 5M5XJ 3CCUI 2NAZA 1D1BA 2E1MB 1ETWA 2IJLA 2EIKH 3CTAA 2WAFA 2E1CA 1D3YA 1NTCA 1U5TC 4I0BA 1JXSA 4U88A 3F8MA 4DQ2A 3WODF 2GZWA 3OYJA 2DAOA 3MCZA 2DOAA 2WAEA 4MEXF 1FX7A 5H6QA 4NDLA 1IN4A 2CQNA 3SFZA 3JTHA 3BWGA 2CH0A 4PCQA 4IOAF 2TDXA 4AIJA 4B3AA 2MW8A 2L7KA 1EKEA 4BQAA 2DTZA 1LE8B 4S0HB 1BR2A 2LTPA 3RZOJ 2XSDC 1MBKA 3K4BA 3S2WA 4EJWA 1IN8A 2Z2SB 4KUMA 3BR0A 4GO1A 2LFBA 3PO3J 1QGPA 2PBIA 2G0EA 1IRZA 1QHGA 5FKOA 1QPIA 2L4AA 5DM7F 1T33A 3CCSI 1VQ9I 3ZMZA 5E3OA 4KMFA 2M7AA 4BJ6C 1D0XA 4IVNA 1CGPA 3TDUC 3LSGA 1XDUA 4FX4A 1W1WE 3REOA 4G7HF 3E5UA 1MJAA 1J59A 3L2WA 4JYKA 4Y3OA 3IH4A 3SZGA 4G7ZF 4YFKF 1STZA 3OIQA 1B6AA 1YFHA 1GLNA 1HKSA 2AS5F 3I54A 2IS4A 4LMYA 4MEYF 3HSRA 3T8RA 1YO5C 2KMUA 4MGRA 3OYLA 3WTWC 3Q5FA 1HW5A 4QWQA 1K4SA 3K4NA 3OYDA 3FKIJ 4UVAA 1YHQI 2RV8A 5FD5A 2XAJA 2CUEA 2PX9A 1R5ID 2MC3A 3U1DA 3LSPA 1VQPI 4EGZA 1G3YA 1OCZH 1LFPA 3FXQA 4A93J 5HDKA 2GXAA 2HQAA 2CG4A 2W4SA 3H5RA 4AIKA 1ZLJA 5CPRB 2FBKA 4LIVA 1PYVA 2MSYA 4WXHA 4A5NA 3E6CC 2IRFG 5E1WA 2YX4A 4JX6A 2M34A 1ZYRF 5FD6A 1KGSA 3IAM2 5B3SH 5HS7A 4D5FA 1V5FA 3OIPA 5AIQA 4FETA 2W1OA 4TV7A 2WB1N 2Y75A 1VQ8I 3K1MA 2K9NA 2GXGA 1EH6A 3F72A 4I99C 1HW1A 3DKWA 5BPDA 1DDNA 2LDUA 3KEQA 2VT3A 3CJNA 1NHAA 2FSWA 4L9NA 2XB0X 4Y4RA 3MN2A 2VT2A 3VFZA 3WGHA 1NK3P 1L3LA 4OAZA 5LBQA 4FCYA 3MAJA 4UVCA 2PJPA 2JPCA 1VQ4I 3KP7A 1Z6RA 3H9JA 3QYFA 2V1XA 4PJJA 3LNQA 4BEHB 3U2RA 3QOEA 3DPUA 3FBNB 5FFXA 4F93B 3ZQCA 3CZ6A 3L09A 4Q4ZF 1XGSA 2KP6A 4PGGA 4A0XA 4EQQA 4A3KJ 5LFAA 1V55H 1YX5A 3JRAA 1TC3C 4DBRA 3S1NJ 2WV1A 2EFWA 1T08B 1T8IA 2ELJA 2E5ZA 4A3LJ 2XF5A 5L3EA 2EA4A 1ENHA 3PUBA 2JSCA 5HLGA 3M7GA 3JRIA 2Z5UA 4AIDA 3WU1B 3WG9A 1Q1HA 4ZYDA 2R7WA 4R8HA 3DBRB 4XLCA 3WGGA 3RZDJ 2CQXA 3K4JA 4KN4X 3RQ4A 1GHCA 4MTDA 1TNSA 1HQCA 3GYHX 4A6EA 4CHUA 4FT8A 4KT6A 2RVCA 2MLKA 5DD4A 3HG9A 2CSOA 5M5WJ 3IV5A 2NS0A 3AL0C 4U0YA 2E5NA 3FBIB 3GLLA 3LWFA 2HKXA 3M8JA 1S72I 2LF8A 3EYIA 2WADA 2JT1A 1HKTA 3HSFA 3D5SC 4QIWN 3ABMH 2LSOA 2UUZA 2IS1A 2LYCA 4LITA 3KEOA 4C3IJ 1QRYA 3ABUA 4QPOA 2IAIA 3TOAA 1VQ5I 2OQRA 2VJIA 1BW6A 1Z3XA 5LRRA 2ZMEB 5FLXK 1G8XA 5F64A 2E34A 3PJRA 1V5EA 2HWVA 3CUQA 2ZNYA 3H3ZA 2JWTA 2P5KA 2DA7A 1ON2A 2K5CA 3QRFF 3WG7H 3K70C 2P81A 3I4NJ 3L2CA 2Y48A 2L3DA 4MTEA 2GXBA 3A4CA 3RI4A 4ZDLA 1IV8A 4HEA2 1S6LA 1T95A 2GQQA 1EA3A 2DDBA 2FX0A 3ASNH 1KONA 3F9KA 3OSFA 2R5YA 3M1EA 1LPQA 2V9KA 2Y0MA 3ULQB 1J0RA 2DW4A 3PFYA 1HA8A 2OCEA 4A3JJ 4A3GJ 1PVEA 3V7SA 9ANTA 3GWZA 3RQIA 2R0QC 1YW9A 1PUEE 3B6AA 5EJCA 4ESJA 5IT9K 3H0DA 2O03A 3IKTA 1ITYA 2IS6A 2O8XA 3CCVI 2HVQA 1UHSA 2FU4A 4G7OF 4BAYA 1KU9A 3DFGA 3U9GA 2DPDA 2BHZA 2K9MA 4I7HA 2DMTA 1YIJI 3Q0WA 2FMLA 4G8XA 1BR1A 1ZG3A 2DJIA 5K5RA 2M5WA 5JVTA 2PN6A 1IG7A 1FIAA 2MA3A 2CV0A 1TTYA 5K5OA 2QSFX 3TW7A 2A5WA 4HF0A 2VIXA 2HEOA 3JRHA
chains in the Genus database with same CATH topology
4E7IA 5CQGA 3RCOA 3H9GA 1UELB 3IAS2 4II2A 2HPIA 2M4KA 3I3LA 3H35A 3L2VA 2R7XA 1N77A 4E6KG 3CMMA 4U7BA 3SDBA 3V42A 4BQQA 2CW8A 4LG3A 3S3OA 4FASD 5HNHA 2RQQA 4YELA 4PJLA 4J00A 1N75A 4II3A 3OYCA 3OS1A 3S3NA 4B44A 2MYSA 4CA0A 3OS0A 1WJBA 1OR7C 2ZSHB 1J09A 1FMWA 3VSLA 4AU7A 4F91B 2CFOA 1WJDA 3W3CA 3D5RC 5LD2C 2UV1A 4GRIA 3K4MA 5JHFA 2R7VA 2V26A 1VZ0A 3K6GA 2WY7Q 3G2BA 2HNHA 4HRIA 3CESA 4BDYA 4JOMA 3UR3C 3AKZA 2JA2A 2AQFA 1NG6A 2KLOA 2JVHA 2KZVA 2VKHA 3QODA 2A6TA 2VASA 1BOBA 3S8PA 3OR1C 4RLFA 2QKLB 2F4IA 3AFHA 3DU5A 4N4OB 3IUOA 1W36C 3KEYA 2O5RA 2ZSIB 3N05A 4OWRB 4XLHA 4N4NB 4CCKA 4PK4A 2VXDA 4B43A 2VJ5A 3OOUA 2JUGA 2UWMA 2BVLA 4ANJA 1WJFA 2W7NA 2WAQA 2RNGA 1WJEA 3FHNA 1X1CA 4DOZA 3PNYA 1T0FC 3HOTA 3UNGC 4HSTA 1YX3A 2X85A 4PJMA 1WFXA 4EATA 2HPMA 1Z21A 5CQEA 2OC6A 3S32A 4XLFA 3MKWB 4BE0A 1D0YA 2CUJA 4E7JA 4Y33A 4NC7A 4XKWA 4U87A 4HSRA 3DPTA 3DTKA 4XKVA 1X1DA 2L9NA 2MD0A 2Y0SA 3OYAA 4E7ZA 4XORA 3BCBA 1Z3YA 3MD2A 4P5OA 2BOLA 4X0GA 4XLAA 3LSMA 2X6YA 4XM3A 3OYHA 1WJ5A 2DXIA 2HVRA 1UAAA 3KX2A 2Z1DA 3I9V2 3TBIA 2XC7A 2MFZA 4RMNA 4IX7A 3RSNA 2VLAA 1D0ZA 3GBGA 5FRNA 4QPQA 4KITB 2GOMA 2V6EA 4BE1A 4NUBA 3LSKA 4CCMA 2LRDA 3RPUD 2X6WA 4XQFA 1N78A 3CJQB 2V1NA 1UG0A 3BG6A 4PSXA 3U21A 2M4GA 4XOTA 4CSWA 2DT7B 4IQJA 3PSIA 4P1WA 3DKYA 2VL8A 2PMZA 3HXLA 2PJRB 2M3AA 4CZCA 2VJJA 4C2UA 2Q2EB 4JQFA 4BS9A 4CUGA 2LBFB 3ONQA 4YRVA 3K70D 2QKMB 3BG7A 1MNEA 1MMDA 4ZYAA 2F5VA 3A2KA 1PJRA 3TL4X 1V5GA 3OYMA 3LFUA 4RM2A 4KISA 3DTEA 4XL9A 1MNDA 4XMYA 4G6TB 3W2AA 2R7UA 2AQEA 2BVMA 4HG2A 2VQCA 3OY9A 3D5LA 4J01A 4PFPA 5HVQC 1QU3A 3VWBA 2R7QA 2W00A 2M7BA 2DT6A 1IRXA 3ZRGA 2CW7A 1D1BA 2E1MB 4XLEA 1Y6IA 2X1DA 3FDYA 4DIQA 2WAFA 2KL4A 4D1QA 4CH7A 4IKFA 2LG4A 3PNVA 2VB6A 3OYIA 4BE2A 2V4JC 4B3XA 4BQNA 3OYJA 2LREA 3OS2A 2DOAA 2WAEA 3C2HA 2CH0A 2MC4A 2X1EA 2IS2A 1Y56A 2XSJC 4F3QA 1ERDA 2R4GA 2WBMA 4ZDPA 3LSHA 2L7KA 3TMOA 4BGDA 1BR2A 4PJNA 3K4BA 1TZLA 1K6YA 1YE9A 2LH9A 1LVKA 1AA7A 2IXSA 2Z2SB 5HLTA 3HUGB 1DQUA 3A1YA 3DTIA 3ZQQA 3OYKA 1QHGA 4C2TA 2CV2A 2W82A 4R79A 2E60A 3S93A 2M7AA 3ZGKA 4BJ6C 4AYBA 1D0XA 2VQHA 3W2VA 3LSGA 2IGNA 4CCOA 2KPMA 4XKBA 3DPLC 3QYBA 4ZC3A 4DGWB 4HPQA 4Y3OA 3L2WA 3SZGA 2V7FA 4ITVA 2X1CA 3MKYB 3OIQA 2LOOA 1GLNA 2HU9A 5FROA 3IP4B 3H5AA 2IS4A 2NOJB 2L2OA 3OMYA 4XONA 3SYTA 3HKZA 2KMUA 3OYNA 3OYLA 1U0JA 3CP2A 2XF6A 4HNTA 3K4NA 1W36D 1D1CA 3BLYA 3OYDA 2KHMA 3LMMA 2MABA 4PFOA 3OYEA 1D1AA 3KYLA 3OR2C 3FKJA 3AL0B 1LFPA 2E1MC 2IGMA 2HQAA 3NWTA 4E7LA 3S3MA 1R6RA 5CKTA 2W4SA 3H5RA 2HZDA 5CPRB 2JSPA 1PYVA 4LIVA 4NC8A 1G59A 4ZJZA 4KJZA 2KRHA 3IAM2 3LSIA 1V5FA 5FRMA 3OIPA 1TT0A 2Q1ZB 4XR6A 4FETA 2W1OA 4PSWA 4ZTFA 3M1CA 3HPGA 4YEJA 1FMVA 1MW7A 5TGTA 3NWSA 3EUKL 3E1SA 4BL0B 2DCEA 5KHDA 2FUG2 4Y4RA 2OV7A 3CP8A 2R7SA 4PUSA 2BW3B 4H4KC 4OAYA 3CF2A 3SEQA 4DJAA 4OAZA 2WY8Q 2R7TA 2L9SA 4LIUA 1WJAA 3MMYB 3H9JA 3HOSA 4E7HA 3QYFA 4IQ4A 4PJJA 4BEHB 3BC8A 2WB1A 3DKXA 3QOEA 3DPUA 1OLTA 3FBNB 4BXFA 4F93B 2VPLA 3HPHA 3CZ6A 2GOXB 1SFKA 2KP6A 3J7AY 2Z16A 5LFAA 3EUAA 1YX5A 2K9LA 4DBRA 2R7OA 2XAUA 2VXZA 4MLOA 3OYGA 2ELJA 2XF7A 2I8DA 3E0JB 2R7RA 2E5ZA 2XF5A 4BJTA 3DWLE 3DEEA 3VYTB 3BCAA 4NNJA 5HNFA 3EUHC 3PUBA 3H5NA 1E0EA 2OUMA 4XKCA 2VQLA 2JVGA 4E4HA 1MMNA 3DU6A 2R7WA 4XLCA 2K3PA 1X1AA 1SAUA 2VQGA 5KNLA 2LY2A 4BDZA 3K4JA 3RQ4A 2LY1A 3ZXSA 2CMPA 1DGRM 1LDKB 3SEZA 2X51A 3L2QA 2CUZA 4RLQA 3C2GA 4KT6A 3K4KA 1DP3A 3PNTA 1MMGA 2IGOA 3HG9A 3VYRB 3HC7A 3H9QA 1ZELA 3PL8A 4F55A 4IZZA 3AL0C 3FBIB 2E5NA 1DGWY 3M8JA 2PJRA 1X19A 2M0MA 2CS3A 2WADA 4CCNA 4D9JA 3L2RA 3RTRA 3K4CA 4F92B 3D5SC 2LBFA 3DQVC 2UUZA 2IS1A 4NQWB 3ZCOA 4ZDOA 4B48A 3OL3A 3LL7A 2LYCA 4LITA 2RREA 4XN0A 2X6XA 1X4PA 4QPOA 4C30A 4C9YA 2HDWA 1WJCA 2KQRA 2ZFUA 4HNUA 2VJIA 2P0WA 3VYUB 1Z3XA 3EPZA 4XNFA 1MMAA 2BW3A 1JI8A 1Z7LA 4XOPA 1G8XA 4AVZA 4ZTJA 4BQOA 3ZR8X 1X1BA 4E7KA 4BUPA 3PJRA 1V5EA 3CJRB 3VDXA 1S9HA 1X4OA 4BU2A 2K5CA 4BEHA 4BACA 3K70C 1P9QC 2VJ4A 2F6CA 2L5QA 3A4CA 4BJ5C 2ZXHA 4ZDLA 4HEA2 4RM3A 1T95A 1EA3A 3L2UA 1KONA 3F9KA 5KCMA 4DBQA 2V9KA 4CCJA 3VSKA 3K4LA 2WA0A 5HOOA 3PFYA 1HA8A 2VKDA 2KRCA 2HVSA 2LC2A 1LKXA 2CV1A 3H0DA 4F52A 4B47A 2IS6A 2HVQA 3OYFA 2ZXIA 2KDOA 3DLAA 4XN3A 3HL2A 3VYSB 1NG7A 3K10A 3W2WA 3QYEA 2K9MA 3OYBA 4E7SA 3MKZA 1BR1A 2DJIA 1BR4A 2XDVA 3PSFA 1QHHD 3OL4A 2CV0A 2IGKA 3OWTA 2A5WA 2VIXA 4CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BL0 B; 
#chains in the Genus database with same CATH topology
 1DU6 A;  2V6C A;  5CQG A;  4E7I A;  4GFB A;  1ZRF A;  1SFO J;  2COM A;  1XCB A;  4II2 A;  4HQE A;  2M4K A;  1OMI A;  1TW3 A;  3H35 A;  2R7X A;  1SVO A;  2K86 A;  4U7B A;  2IPQ X;  2QSG X;  4A5M A;  3SDB A;  4BQQ A;  3DXJ F;  2VE8 A;  1T38 A;  3G1M A;  4FAS D;  2EFQ A;  2P5V A;  3KP3 A;  3S3N A;  3CDH A;  1FP1 D;  1OR7 C;  2IVM A;  3VSL A;  3CO6 C;  3F6V A;  2CFO A;  3IC7 A;  2DA6 A;  2IW5 A;  1UB9 A;  4KIB A;  3D5R C;  1HCR A;  4YIF A;  3CMA I;  1CF7 B;  1P2F A;  3L7W A;  2HYJ A;  1A31 A;  5J40 A;  2EIM H;  1A5J A;  1VTN C;  5E17 F;  3SZP A;  2XPU A;  2IEK A;  3BP8 A;  1VQK I;  2XAH A;  2JVH A;  3K69 A;  1OYW A;  2A6T A;  4C3H J;  4AM3 A;  2ZCW A;  2HZT A;  4O6J A;  4Q5S F;  3HTU A;  3K1P A;  4ZZD A;  2LMD A;  3E7L A;  1XGM A;  1K6O A;  2QKL B;  3KYD B;  5IP7 J;  2STT A;  3BR5 A;  3KEY A;  5EEG A;  5J4V A;  3CMY A;  3FWE A;  4XLH A;  1ZRD A;  4CCK A;  1Y39 A;  4X1E A;  1FSH A;  3KLN A;  1WKM A;  2RNG A;  1X1C A;  2OZU A;  1IC8 A;  1IN6 A;  1T0F C;  2K4B A;  1FY7 A;  3G3Z A;  4EJO A;  3HOT A;  2VBZ A;  3B6C A;  3DCF A;  1ZKG A;  4IHT A;  2HGC A;  1BA5 A;  4HDV A;  2OC6 A;  4H0E A;  2HDD A;  3S32 A;  1AWC A;  2OD5 A;  2OTL I;  4W1U A;  4RB0 A;  3KP6 A;  2XUB A;  3QOP A;  4E7J A;  1G6N A;  3KFW X;  3QPS A;  5ICC A;  1JJ8 C;  3DBH B;  1U5T B;  1X1D A;  2FD5 A;  3IWF A;  3RYP A;  2L9N A;  2MD0 A;  3WTT C;  1W5S A;  1I39 A;  4A3B J;  2CFX A;  2EZH A;  3I0T A;  4I98 B;  3GEZ A;  1Z3Y A;  4B09 A;  2P6T A;  1FYM A;  4FE7 A;  4HLY A;  2W57 A;  3B73 A;  3HEF A;  4RGU A;  4XLA A;  3ABT A;  1U3E M;  4XM3 A;  1YRN A;  2J5P A;  2Q0O A;  2DXI A;  2A61 A;  1XGN A;  1UG2 A;  1JT0 A;  4L18 B;  2PEX A;  4OMZ A;  4P55 A;  1SAX A;  1UFM A;  4XLP F;  1YIO A;  2EIL H;  3PQJ A;  3HRM A;  1QVU A;  1R7J A;  4EJV A;  3EET A;  2DJN A;  2VLA A;  2EH3 A;  2B0L A;  2LY9 A;  4KIT B;  5FRN A;  2GOM A;  2KZG A;  4WX9 A;  4BE1 A;  2DOE A;  1YS6 A;  2CRG A;  2Q8K A;  1Z6T A;  3FHZ A;  1HSJ A;  5JI6 A;  1LB2 A;  1HBX G;  1LFB A;  1Y0U A;  1R9T J;  1YJ9 I;  1LUJ B;  1N78 A;  1OCR H;  4GXO A;  2NVQ J;  3C2B A;  2HOT A;  2NOG A;  4PSX A;  2F4M B;  1LQ1 A;  1OCO H;  2M4G A;  4CSW A;  2DT7 B;  1WH5 A;  2G9W A;  5D5U B;  4LB6 B;  1O7F A;  4M9X A;  1P7I A;  2FNP A;  3PSI A;  4MFE A;  4UV8 A;  1OIS A;  5JR3 A;  1FYK A;  3ELK A;  3HXL A;  3GZN B;  2QCO A;  3J80 Z;  1MSE C;  4A69 C;  2EZK A;  2XPV A;  4CUG A;  4UUS B;  1ZR2 A;  4EGY A;  3BG7 A;  5H6R A;  1FLI A;  2F2E A;  4M3B A;  5BOX A;  3TL4 X;  1GDT A;  3S1M J;  3GFM A;  4RM2 A;  1UCR A;  3VEP A;  4KIS A;  2MH2 A;  2O61 A;  2QZ8 A;  3UKG A;  4G6T B;  4RGX A;  2AQE A;  3BY6 A;  2XGE A;  3D5L A;  3OY9 A;  1KU2 A;  4M6V A;  3JCU C;  2ESN A;  1A6I A;  4MO7 A;  4NB5 A;  1IRX A;  1IXC A;  1FOK A;  4XK4 A;  2LF7 A;  2QWW A;  4IOC F;  1IZ1 A;  4CH7 A;  3ZQ7 A;  2VB6 A;  1TWA J;  3HBL A;  1SD6 A;  1U9N A;  2BY2 A;  5IY5 H;  2LRE A;  2JPB A;  5DM6 F;  3A01 A;  3RKY A;  2R5Y B;  5BMZ A;  2N8G A;  2MC4 A;  1OJL A;  3TO6 A;  5ILV A;  3GZ6 A;  1T0F A;  2QLZ A;  1T6S A;  2FXA A;  2FQ3 A;  2K02 A;  2RC4 A;  3LSH A;  1U8B A;  2R7Z J;  2LNB A;  5M3M J;  2QYO A;  1JHH A;  4PJN A;  2KIU A;  5L3G A;  5DCM A;  1YTY A;  1TZL A;  1K78 B;  5HLT A;  2GLO A;  1A35 A;  4OMY A;  3ERM A;  1CQT A;  1IUF A;  3DTI A;  1R58 A;  3ZQQ A;  4I09 A;  4GGG A;  5HLI A;  1HDD C;  4LG0 B;  2JA6 J;  3BZK A;  3C3W A;  1VQ6 I;  3ROU A;  3WU2 C;  1B1B A;  4C2T A;  1C0W A;  2W82 A;  3HKZ N;  4LLL A;  2DA2 A;  1W7P A;  2YSR A;  3QU3 A;  4R79 A;  2BV6 A;  5LGN A;  1Y1V J;  1B8I A;  4U0W A;  3CC2 I;  3CQZ J;  4AYB A;  3MFK A;  4Y15 A;  2Y69 H;  3ASO H;  5JHU A;  4HF2 A;  4U7D A;  3BR1 A;  4XKB A;  2HQ5 A;  3MZY A;  3DPL C;  4ZC3 A;  4HPQ A;  4ITV A;  1P4A A;  2LOO A;  2VN2 A;  3BPX A;  3V8L A;  2D45 A;  2GA1 A;  3LA7 A;  3G1L A;  3S1Q J;  1MIJ A;  2HU9 A;  4ESB A;  3CCQ I;  1TWG J;  4G9Y A;  1YIT I;  2V1D A;  1ZTR A;  2QQ9 A;  1U0J A;  2LKP A;  3S14 J;  1WI9 A;  2KT0 A;  5F08 A;  4DNC A;  5D5V B;  4CYD A;  1W36 D;  3BLY A;  3HOW J;  1F9N A;  2PI0 A;  5GTI C;  3LMM A;  1Y8Q B;  1BIB A;  3KYL A;  1AOY A;  4G12 A;  3AL0 B;  3F3X A;  1GV5 A;  2IGM A;  4IEJ A;  2ZFW A;  3AG3 H;  1I50 J;  5CKT A;  3RKW A;  3R0A A;  4FTH A;  2HOE A;  1ONV A;  2F5E A;  2A69 F;  3QPH A;  4M71 A;  4OIO F;  5F0F A;  4ZJZ A;  5EG0 A;  3BR2 A;  3LSJ A;  4KJZ A;  3V8K A;  2DPU A;  1ETX A;  1FT9 A;  2K7L A;  3WE2 A;  2LKS A;  3GO5 A;  1XD7 A;  2ELH A;  1I27 A;  2W85 A;  3LOC A;  3JRF A;  3CJT B;  1ETY A;  3HPG A;  4EEF G;  1MZB A;  4Q48 A;  2FMY A;  3A0B C;  3I53 A;  4YEJ A;  5E20 A;  1MW7 A;  3BZ6 A;  3AG4 H;  3NWS A;  1ETO A;  3PM1 A;  3ZP5 A;  2X9D A;  5LEK A;  1N25 A;  3KYC B;  1F36 A;  3ZQH A;  5KHD A;  3F8N A;  2FUG 2;  5E3M A;  3P7N A;  2TCT A;  4M3F A;  2HQN A;  2OV7 A;  1XS9 A;  2IA2 A;  3C1D A;  3QU6 A;  1ZGW A;  2XGC A;  4H4K C;  4OAY A;  1JUS A;  1YYV A;  4UNO A;  4DJA A;  4IF4 A;  5TJJ A;  2R7T A;  2ICW G;  4LIU A;  3LQR A;  2NRA C;  3I4M J;  3HOS A;  1WHU A;  4E7H A;  3HGG A;  1JKR C;  4A3M J;  3J7A O;  2WB1 A;  3DKX A;  1TQM A;  1OLT A;  2JUC A;  4CDG A;  1X1P A;  2GOX B;  5H20 A;  3F22 A;  3MZH A;  3X2Q H;  2OZ6 A;  1DU0 A;  3J7A Y;  5J8F A;  3EUA A;  4MNU A;  2K9L A;  4I2O A;  4HX7 A;  4HLX A;  2XAU A;  5ILU A;  3RDI A;  1MJB A;  3OYG A;  4A12 A;  3E0J B;  4F7Z A;  1F5T A;  4XRS A;  3DEE A;  4CYC A;  4Y52 J;  1MSF C;  1E0E A;  2FEZ A;  2L7Z A;  2OUM A;  2QEX I;  1J75 A;  4A3F J;  2ID3 A;  2VQL A;  2JVG A;  1WZ2 A;  4AYB N;  3DU6 A;  2R92 J;  3TP0 A;  2LY2 A;  2RKH A;  3KLO A;  3ZMU A;  2YUS A;  2EWN A;  2CMP A;  3ZXS A;  3ZMS A;  3L2Q A;  1OYI A;  1Z77 A;  3C2G A;  2E71 A;  1DP3 A;  1ZHF A;  1MMG A;  2DU9 A;  1J5Y A;  2QQB A;  2J5O A;  3HC7 A;  4LJZ F;  2X6O A;  1PUF A;  3TKY A;  5D6E A;  4F55 A;  1JKQ C;  3RPU A;  1B9M A;  5JLX A;  2BXY A;  3CO7 C;  1JKP C;  2BBY A;  3WTZ A;  5IP9 J;  2M0M A;  3L2R A;  2WV0 A;  2OCC H;  1LNW A;  2DQR A;  4F92 B;  2LBF A;  1OCP A;  1USS A;  3H36 A;  3CC7 I;  1O3R A;  2EV5 A;  4YFX F;  2M8E A;  3IH2 A;  3QQA A;  4C30 A;  2QQA A;  2ZFU A;  2YR2 A;  4C9Y A;  2KJB A;  3VYU B;  5FB2 A;  2MGQ A;  1O7L A;  2BW3 A;  2V9P A;  3DBL B;  1WGX A;  5L3F A;  2DA4 A;  1MKM A;  4RAF A;  1K83 J;  3O8G A;  5M3F J;  2A6H F;  1RZ4 A;  3RIR A;  3GF2 A;  1X1B A;  3ZN0 A;  1ZN2 A;  4BUP A;  3CJR B;  3GX4 X;  2XV4 S;  4RB1 A;  2NNN A;  2W84 A;  4BAC A;  1MBJ A;  4V2F A;  3CME I;  2H6B A;  5GPA A;  5LGU A;  4BBS J;  2F6C A;  2DMU A;  4BJ5 C;  4ZYE A;  1IF1 A;  3CUQ C;  2L0K A;  1KQ9 A;  5IYB J;  3L2U A;  3DP7 A;  3K1N A;  4RB3 C;  5LHI A;  1FBQ A;  1GV2 A;  4CCJ A;  4D7M A;  1AU7 A;  1ZRE A;  2L01 A;  4UVB A;  2A6E F;  1ZLK A;  3HGY A;  3BTI A;  2QBY B;  2KRC A;  2M87 A;  2W25 A;  4L9J A;  3Q3S A;  2E1O A;  4C2M J;  3BQZ A;  1LKX A;  4XSZ F;  5E1X A;  2CV1 A;  4S05 A;  2NVT J;  4FE4 A;  3SDG A;  4XN3 A;  2GM4 A;  5JVG F;  3VYS B;  3K10 A;  2DN0 A;  1GVD A;  5BS6 A;  1TNT A;  4B8X A;  1I3Q J;  2HTJ A;  2M2E A;  2DI3 A;  5E3N A;  3I59 B;  5HS8 A;  3HUG A;  5HLH A;  3MKZ A;  3F23 A;  5DCF A;  2M1B A;  5DCM B;  1W7P D;  1BR4 A;  2F5C A;  3PSF A;  1QHH D;  2EFN A;  4ENM A;  1SD7 A;  5D6F A;  3RKX A;  1U78 A;  4CCL A;  1V54 H;  5L3B A;  1VQM I;  2HR3 A;  1R5H A;  2RGV A;  5KVR A;  3LAP A;  3P9I A;  3L2V A;  1B8I B;  1N77 A;  4E6K G;  4IRG A;  3GTP J;  4RGR A;  2NVY J;  3E6M A;  1A6Q A;  2K27 A;  1BW5 A;  2CW8 A;  4GYI A;  3HM5 A;  3S3O A;  4M3G A;  3R60 A;  2X0L A;  4YEL A;  5FLX Z;  5LEJ A;  3OYC A;  2ME6 A;  3JRB A;  3ZOB A;  2NYX A;  1WCM J;  5LHG A;  2VC1 A;  3IL2 A;  4AU7 A;  1S3J A;  1JTY A;  2XAF A;  4BH9 A;  2TRT A;  3M8E A;  4GRI A;  5JHF A;  2R7V A;  1VZ0 A;  3G2B A;  2DDA A;  2ECB A;  4IRH A;  1T2K A;  4DW6 A;  2ZC2 A;  3UR3 C;  3JRE A;  2AQF A;  3ZMV A;  2F5D A;  3GTJ J;  3VPR A;  1PP7 U;  2ISZ A;  1TT5 B;  1KU3 A;  2M45 A;  3QOD A;  3NAR A;  2VAS A;  1TQI A;  1BOB A;  3BTL A;  2D5V A;  3G6E I;  5J1R A;  2B63 J;  2Z33 A;  2DO7 A;  1H9T A;  2HYF A;  1E3O C;  2AXL A;  4RLF A;  5IT9 Z;  3O6B B;  1GXQ A;  3R0J A;  1IJW C;  1B59 A;  2DFF A;  1W36 C;  5J1Y A;  2JRT A;  3BR3 A;  2V9V A;  2QEN A;  4PK4 A;  4Z6Y A;  2VXD A;  4OIN F;  2VJ5 A;  3OOU A;  4B43 A;  2JUG A;  1G2H A;  3F8B A;  2OA4 A;  2BVL A;  2KIM A;  4I02 A;  2W7N A;  1TLH B;  3SXY A;  1M1E B;  5F27 A;  1D8J A;  1EV7 A;  4ENK A;  1YX3 A;  3FMQ A;  4PJM A;  2QUF A;  1T56 A;  2EIJ H;  2FBH A;  2E2J J;  5CQE A;  2EFP A;  2ZXJ A;  1Y0N A;  4R1H A;  1WQ2 A;  3MKW B;  2K3F A;  2IBD A;  3FXL A;  2FJ1 A;  2K85 A;  4XKV A;  3PO2 J;  2JK3 A;  4OOI A;  2D2W A;  3MQ0 A;  1KYZ A;  1UZC A;  3MD2 A;  3ZQL A;  4XSX F;  4P5O A;  2DOF A;  5CJ9 A;  4X0G A;  3LSM A;  5FJ8 J;  4A3E J;  3D1N I;  4IXA A;  2XRN A;  2XKP A;  2HFH A;  3HTS B;  3I9V 2;  3RYR A;  1S7A A;  3TBI A;  2R93 J;  3ERE D;  3MWM A;  2FA5 A;  4JX5 A;  1YW7 A;  2CJJ A;  1W0U A;  1PDN C;  5F1J A;  1RC9 A;  1XMK A;  3RSN A;  2PFB A;  3EDP A;  3GBG A;  1BI2 A;  4QPQ A;  4NUB A;  3I71 A;  3LSK A;  4CCM A;  2M9H A;  4XRF A;  3RPU D;  3FXK A;  4KA4 A;  1ON1 A;  3HHG A;  1E3H A;  1JE8 A;  3O2P E;  1AKH A;  1UG0 A;  2VOP A;  4XOT A;  4P96 A;  1R1V A;  5LGT A;  3DLL F;  1S5L C;  4M73 A;  2FBI A;  4EM2 A;  2QA4 I;  3DV8 A;  2FQ4 A;  3KE2 A;  5DUK A;  1PUF B;  5GPC A;  4GCV A;  5F04 A;  3K7A J;  3JAM K;  2M3A A;  1QPM A;  2HQR A;  4JQF A;  4BS9 A;  3ZPL A;  1B9N A;  3JRG A;  2LBF B;  4RB2 C;  3WTY C;  1WRJ A;  2GWR A;  2C6Y A;  1MNE A;  2VOD A;  4ZYA A;  2E2H J;  2R5Z A;  3A2K A;  4FHT A;  3D0S A;  1MNM C;  2KFD A;  2KIS A;  3CF5 F;  4XMY A;  3IWZ A;  1Z67 A;  1DPU A;  1IXS B;  5B1A H;  4XIC A;  1I1S A;  4J01 A;  1ZQ3 P;  5DYM A;  3OSG A;  4ABZ A;  4A2U A;  1ZAR A;  1QNT A;  5L3D A;  5CVI A;  1BI3 A;  3WE3 A;  1VQN I;  1XSD A;  4XLE A;  4DIQ A;  2KL4 A;  4IKF A;  1E17 A;  2ZJR F;  2DK8 A;  4ON0 A;  3BG9 A;  2LG4 A;  3PNV A;  4M6Y A;  3OYI A;  1ETK A;  3GFL A;  3JW4 A;  3M07 A;  2V4J C;  4O3M A;  1Q1V A;  3HHH A;  5D8L B;  1U2W A;  2IA0 A;  2ZJQ F;  3BJ6 A;  2QGU A;  2Y2Z A;  3C2H A;  1VQ7 I;  2X1E A;  2L9R A;  5F1R A;  3HOV J;  2O8K A;  2H1K A;  1HC8 A;  1GVJ A;  2XSJ C;  3F21 A;  2NVX J;  4F3Q A;  2XAS A;  1TL8 A;  3ZMT A;  1B72 A;  2E2I J;  2R4G A;  2EZL A;  3QP5 A;  4FQG A;  2CGP A;  3TMO A;  4UHT A;  5HS9 A;  5EDN A;  2DLL A;  3TOB A;  2EV0 A;  2XPW A;  1AA7 A;  3HUG B;  5DV5 A;  1VF9 A;  3T1B A;  3ECO A;  3K2A A;  3OYK A;  4CXF A;  1MBH A;  3H3U A;  4G6D A;  1KYW A;  4KIC A;  1JUP A;  5EZG A;  2CV2 A;  3KP5 A;  5FKN A;  5EZH A;  3S93 A;  1RKT A;  1G4D A;  3F8F A;  3ZGK A;  3KZZ A;  2A05 A;  2VQH A;  3NAU A;  4Z2Y A;  1ORK A;  2XAQ A;  3HRU A;  2E1N A;  2IGN A;  4CCO A;  1HDP A;  2FNA A;  3TQN A;  1KQ8 A;  2KPM A;  2O9L A;  5CLS A;  4DGW B;  3KIO A;  2XRO A;  3R6S A;  2ZKZ A;  2P5L C;  2O6G E;  4HV5 A;  3P9C A;  3LA3 A;  3H5A A;  4L5E A;  2NOJ B;  2Z9O A;  4UV9 A;  2LVS A;  2FOW A;  1SD4 A;  3OMY A;  3LAJ A;  3SYT A;  3HKZ A;  1KZH A;  4I01 A;  3Q9V A;  3OYN A;  3H0G J;  2WC2 A;  2MG4 A;  3CDI A;  1J2X A;  5EEA A;  3CP2 A;  2XF6 A;  4HNT A;  5ICF A;  3GLX A;  4D0P A;  1K61 A;  3TGN A;  3CLO A;  1X58 A;  1V3F A;  3S2D J;  1D5V A;  1P4W A;  3OYE A;  1D1A A;  4IHY A;  1YJW I;  3ABL H;  3FKJ A;  3DEU A;  1R1U A;  2K40 A;  2JZY A;  4E7L A;  2WWY A;  2O3F A;  1FBS A;  4M9Z A;  4NC8 A;  1OFC X;  1YI2 I;  3O8H A;  2HXI A;  3FXM A;  3VOE A;  1G3W A;  3WHB A;  1W0T A;  2VKE A;  1DP7 P;  3LSI A;  1LE8 A;  2A07 F;  1TT0 A;  2Q1Z B;  1XPX A;  4PSW A;  1YG2 A;  2A68 F;  4ZTF A;  2BY1 A;  3W6V A;  3FIW A;  5KK1 A;  2LKX A;  3GW2 A;  3NRV A;  4BL0 B;  5FFZ A;  4KIG A;  1FBU A;  3OOP A;  1XMA A;  2XB5 A;  3S16 J;  3CP8 A;  1IRG A;  2R7S A;  1XMX A;  3T0Y A;  1O3S A;  3LQQ A;  1P4X A;  3SEQ A;  4QTR A;  2PQ8 A;  3CUO A;  2HI3 A;  2WY8 Q;  2W24 A;  2L9S A;  2CQK A;  3DF8 A;  4A3C J;  3MMY B;  3CUQ B;  4RAY A;  1HW2 A;  1Y8R B;  4BHC A;  3BC8 A;  2XGD A;  2VPL A;  1SFK A;  4ASN A;  4D5C A;  2Z99 A;  1WH7 A;  2E35 A;  3EUH A;  4IPA A;  5J1U A;  4KNY A;  5J6X A;  1R4N B;  3ZMD A;  2P7V B;  2VXZ A;  4MLO A;  2XF7 A;  2I8D A;  2R7R A;  3VB2 A;  4DYC A;  4BJT A;  3DWL E;  3VYT B;  3BCA A;  4NNJ A;  5HNF A;  2YPR A;  1PP8 F;  4XKC A;  3FX3 A;  2P7C B;  1SVM A;  4E4H A;  1MMN A;  3SZT A;  1MBE A;  1RI7 A;  2K3P A;  1X1A A;  5KNL A;  4FX0 A;  4BDZ A;  1YJN I;  2XIG A;  2XGX A;  4KDP A;  1LDK B;  3SEZ A;  2X51 A;  4RLQ A;  1OQY A;  3K4K A;  1BJA A;  4PGH A;  2R7D A;  3A03 A;  3FXR A;  1FZP B;  3P9K A;  1RUO A;  1DGW Y;  2CU7 A;  2PJR A;  1W4M A;  4EJU A;  3G4S I;  4CCN A;  3J7Y J;  2Q2E A;  4D9J A;  2JA8 J;  4EM1 A;  3RTR A;  3ZQF A;  3E97 A;  5E18 F;  3DQV C;  4BKX A;  5E79 C;  2GIZ A;  1YW8 A;  5ED4 A;  2JTV A;  3OL3 A;  1TWC J;  2D1H A;  4ZH4 F;  2OPT A;  1ZG5 A;  3MKL A;  1X4P A;  3E5Q A;  3MVP A;  4W97 A;  1ZGJ A;  2HDW A;  2KQR A;  4HNU A;  3CCE I;  4MHG A;  1YLF A;  3EPZ A;  5LRS A;  3NEU A;  4G6Q A;  3I56 I;  4IHS A;  4OU0 A;  1Z7L A;  2CQQ A;  3WTX C;  4ZTJ A;  1BC8 C;  4BQO A;  3ZR8 X;  1APL C;  2I10 A;  2OJE D;  3HRT A;  4E7K A;  1HLV A;  1F4K A;  4IRI A;  3VDX A;  3SFI A;  1S9H A;  3FK7 A;  5LLQ A;  2V79 A;  1X4O A;  3JSO A;  4BEH A;  3GTO J;  5B1B H;  3GCM A;  4LLG F;  3S2H J;  1P9Q C;  5JLW A;  2HDC A;  1RUN A;  3GXO A;  4L9V A;  2JA7 J;  2L5Q A;  2E7W A;  1FEX A;  4RM3 A;  1XDS A;  4UXN A;  1R5G A;  1S8N A;  3CLQ A;  5KCM A;  1JGS A;  1SFX A;  4DBQ A;  3BJO A;  5FLM J;  1RR8 C;  2JRM A;  3Q0V A;  3Q9S A;  1EH7 A;  3M8F A;  2WA0 A;  4O5V A;  4P9F A;  2H27 A;  4RDU A;  4RAZ A;  4XRS G;  5KAF C;  2HVS A;  3T8T A;  2LC2 A;  2NS7 A;  4DYR A;  4L5I A;  4XID A;  4Y17 A;  1JKO C;  1HOM A;  1WPK A;  4B47 A;  2KJC A;  1P92 A;  3HOY J;  2DA1 A;  3DLA A;  2DOD A;  3BJA A;  3HL2 A;  2ZXW H;  3RKQ A;  2BE5 F;  3QYE A;  1X2M A;  3CCY A;  1FP2 A;  4MIM A;  4E7S A;  2EBI A;  4HQM A;  2VI6 A;  2RN7 A;  4WXC A;  2XDV A;  2XKO A;  2OQG A;  1FIP A;  1BOA A;  1XGO A;  3OL4 A;  3M3Y J;  5FKM A;  1S29 A;  2IGK A;  1FNN A;  5FKK A;  3OWT A;  3F0C A;  3FXU A;  2RAE A;  4BY7 J;  3HOX J;  4IO9 F;  5AON A;  2QQ8 A;  1LDJ A;  3AG2 H;  3RCO A;  4RBO A;  2DFE A;  2JA5 J;  4HF1 A;  1R22 A;  1R00 A;  1MD0 A;  3QWL A;  3FMS A;  1IW7 F;  4Y13 A;  4UB8 C;  3V42 A;  1P7J A;  1V4R A;  4M3D A;  2XRL A;  1WI3 A;  2NNY A;  4I0A A;  2GAU A;  1YRN B;  4B44 A;  2DYR H;  2MYS A;  2XAG A;  2ZSH B;  3ISP A;  4F91 B;  1WJD A;  4RAG A;  1SVL A;  1Z0X A;  3W3C A;  5LD2 C;  2UV1 A;  3HJE A;  2CO5 A;  3K4M A;  2V26 A;  3C7J A;  2B7E A;  2QVO A;  3BTC A;  2HNH A;  4HRI A;  2WAQ N;  1D5Y A;  2DTR A;  3CES A;  4BDY A;  2D1V A;  3JR9 A;  4JOM A;  3AKZ A;  3DEW A;  1BC7 C;  3ZQI A;  1IAW A;  2KZV A;  2LD5 A;  1Z91 A;  2BGC A;  4CO8 A;  2VKH A;  1QO0 D;  2BY0 A;  4BY1 J;  2VC0 A;  2P8T A;  3S8P A;  1BI0 A;  1D8K A;  3OR1 C;  1REP C;  1I6H J;  2ME0 A;  4HX8 A;  1FPQ A;  2YS9 A;  2ACJ A;  2HXO A;  2YU3 A;  4FIS A;  4NHJ A;  3DU5 A;  5K7Z A;  2ETH A;  3R61 A;  2Y0S N;  4OWR B;  4N4N B;  3WTU C;  5FKL A;  1W5T A;  2IP2 A;  5D5X B;  3EQL F;  1L0O C;  1X3U A;  1WJF A;  1OPC A;  3W6K B;  5EGO A;  1U8R A;  2ID6 A;  5A2Q K;  4HST A;  3CCR I;  2X85 A;  4AIH A;  1WFX A;  1E3P A;  4EAT A;  1BI1 A;  5D8K B;  1FSE A;  4OIP F;  1IGN A;  3BPV A;  4XLF A;  5IOY A;  3TP3 A;  3TO7 A;  5CVR A;  4BYY A;  5C4X J;  1UHM A;  2CUJ A;  1NK2 P;  4AWX B;  3S17 J;  3J81 K;  4U87 A;  1MDM A;  4HSR A;  4CIC A;  1SD5 A;  1TBX A;  1T98 A;  3V4G A;  2R3S A;  4Y7N J;  3OYA A;  4E7Z A;  1B4A A;  4KIF A;  3BCB A;  4HV6 A;  4A0Z A;  1YQA A;  2F4O B;  1SMT A;  3G1O A;  4HZF A;  3FIS A;  1R49 A;  1QA6 A;  1J9I A;  3OYH A;  1WJ5 A;  2P6S A;  2Z1D A;  2RDP A;  3A01 B;  1SAN A;  1IXR C;  1F1Z A;  3PFI A;  2XC7 A;  1OCT C;  4IHV A;  2LK2 A;  2PMZ N;  2PMH A;  5HDN A;  1WWX A;  3BDD A;  2ISY A;  2MFZ A;  4MQ9 F;  1CF7 A;  1YS7 A;  3HIF A;  1FYL A;  2RNJ A;  1RNL A;  1K79 A;  3N97 A;  1I1G A;  2V6E A;  2EJR A;  1SFU A;  4KN7 X;  2HKO A;  2P4W A;  4LD5 A;  2K9S A;  4X6A J;  5F0C A;  2X6W A;  2UZK A;  3CJQ B;  2V1N A;  1GUU A;  5D5W B;  2DMQ A;  2DQL A;  2WTE A;  2L7F P;  2FF4 A;  2PJR B;  2JQ7 A;  1Z05 A;  4N9I A;  3H1C A;  2ZO4 A;  2KDZ A;  1XSV A;  2DT5 A;  2VJJ A;  5GAG J;  5E8G A;  2O7O A;  2Q2E B;  4NQW A;  4YII A;  1X3W B;  3TO9 A;  1FOX A;  1W7P B;  4YRV A;  3E6D A;  2H6C A;  1WVR A;  5GTH C;  2HOS A;  1U9O A;  1V5G A;  3OYM A;  3FM5 A;  3LFU A;  5J47 A;  4BHP A;  3ABK H;  1ETV A;  3DTE A;  3BQY A;  4XL9 A;  5C44 J;  2H09 A;  1MND A;  2EQR A;  2R7U A;  5K1Y A;  1UJ8 A;  2ADU A;  2VQC A;  3BTJ A;  1JUM A;  4DYQ A;  3ZN1 A;  3V7C A;  1U5T A;  1R23 A;  2CWE A;  2DK5 A;  3GTQ J;  4K2E A;  5HVQ C;  1QU3 A;  2LP0 A;  2DMN A;  2EB7 A;  2V1U A;  1IRF A;  1A04 A;  3QPT A;  2CW7 A;  3EYY A;  1Y6I A;  2M30 A;  2X1D A;  3FDY A;  1LFU P;  3ESW B;  3RPQ A;  4DZJ A;  1O3T A;  1BJZ A;  4D1Q A;  1ETQ A;  2VBY A;  5EEH A;  4U0V A;  1ZRC A;  1K4T A;  1SFE A;  4HNV A;  4BHB A;  4BE2 A;  4B3X A;  4BQN A;  4HDU A;  1ODD A;  3OS2 A;  1VQL I;  3I58 A;  4JX4 A;  2BXZ A;  2JJ7 A;  2GIV A;  4WWC A;  3PUF A;  2IS2 A;  2H1L A;  4N0B A;  2ZJ2 A;  3R4K A;  2STW A;  1Y56 A;  2HTS A;  5DTD A;  1J7K A;  1XSX A;  1RET A;  2GBY A;  1ERD A;  5DD8 A;  5EG0 B;  1QZY A;  2WBM A;  4ZDP A;  3FXO A;  2UXN A;  5LHH A;  5M5Y J;  2UXX A;  2QF7 A;  2GA2 A;  4BGD A;  4E70 A;  3IRR A;  1LJ9 A;  4PZJ A;  1K6Y A;  1YE9 A;  1ZGA A;  1LVK A;  2LH9 A;  2IXS A;  1IDZ A;  4V19 K;  3LST A;  4ZYH A;  1Y1W J;  1GT0 C;  1DQU A;  2FOK A;  4WCG A;  3F6O A;  3A1Y A;  1OKR A;  3I55 I;  4ETS A;  1LDD A;  1HST A;  3JAM Z;  4QSH A;  1QBJ A;  1RES A;  3OV8 A;  2AXT C;  4UUS A;  5DS9 A;  2E60 A;  5ERI A;  4L9T A;  3WHC A;  3TDZ C;  3TW6 A;  1FOY A;  4HX4 A;  1OCC H;  4NBQ A;  1R36 A;  3G71 I;  3N4M A;  2KIQ A;  3W2V A;  1S7E A;  4BNC A;  1BBY A;  4A0Y A;  3V8J A;  2XHK A;  2VBX A;  3BG5 A;  3QYB A;  4KT5 C;  4YIR X;  4C3J J;  4WF2 A;  3HDD A;  2V7F A;  2X1C A;  3MKY B;  2K4J A;  1IV6 A;  2CW0 F;  4YG2 F;  1LEA A;  3ML6 A;  5FRO A;  2HOA A;  3IP4 B;  3F8C A;  3KCC A;  4DZP A;  3GZ5 A;  4WK8 F;  1T39 A;  2L2O A;  2DBB A;  3O3K A;  4V2G A;  3GTG J;  4XON A;  1ZR4 A;  3FZV A;  4CYC B;  4IJA A;  1D1C A;  1EJ9 A;  2KHM A;  1ZG1 A;  1TW2 A;  2MAB A;  4PFO A;  2L9V A;  1H0M A;  3OR2 C;  2VE9 A;  2E1M C;  3TED A;  4RGS A;  1VI0 A;  4AC0 A;  1OYY A;  3NWT A;  3E5X A;  5C4J J;  3S3M A;  1R6R A;  5D4S A;  4RS8 A;  2PLY A;  1I5Z A;  2HZD A;  4G94 A;  5ICG A;  3PQK A;  2JSP A;  4PDK A;  5ICE A;  1G59 A;  1G3S A;  1O57 A;  2BYV E;  1MBF A;  4ENN A;  2KRH A;  2O0Y A;  2EPF A;  3GVA A;  1IN7 A;  3H3V K;  2OU2 A;  5FRM A;  3C18 A;  4XBF A;  4XR6 A;  4JBA A;  2Y9Z A;  2L7M P;  1XX5 A;  3M1C A;  3PIO F;  1K78 A;  1FMV A;  4EVI A;  4EV0 A;  1RR7 A;  4LB5 A;  5TGT A;  3EUK L;  3E1S A;  5EGO B;  1FWZ A;  2DCE A;  4LG0 A;  3KZI C;  2COB A;  3BR6 A;  5IP6 A;  3SHF A;  4ZZL A;  3GUD A;  1VFC A;  2I5U A;  4ESF A;  4PUS A;  1MH4 A;  2BW3 B;  4EMS A;  1EF4 A;  3CF2 A;  4I76 A;  3AAF A;  2M8G X;  3HB9 A;  2VPR A;  5BPI A;  1WJA A;  1MDM B;  3MZ8 A;  3QP6 A;  1FC3 A;  2YU9 J;  4IQ4 A;  5B5E C;  2EV6 A;  5E3L A;  4BXF A;  3HPH A;  5BQT A;  1BL0 A;  3CC4 I;  5IPA A;  1RPW A;  2Z16 A;  2HYG D;  2Y9Y A;  3HOU J;  2R7O A;  4ENJ A;  2A5Y B;  3KP4 A;  1X3Z B;  3COA C;  1IN5 A;  4KFC A;  3HZJ A;  2ECC A;  5K7H A;  3M4O J;  2EZI A;  2KRF A;  4I6Z A;  3EUH C;  1HKQ A;  3H5N A;  3Q0U A;  5IYD J;  2M0C A;  4UB6 C;  2OAZ A;  3VOD A;  5L3C A;  1SAU A;  2VQG A;  5DEQ A;  5ILS A;  1XCV A;  4IL6 C;  4LFU A;  2LY1 A;  3LSR A;  5CVV A;  1DGR M;  5HOD A;  3G73 A;  1FOW A;  2CUZ A;  3BZC A;  2Y31 A;  2BY3 A;  3PNT A;  2EFO A;  2IGO A;  3VYR B;  4JP0 A;  3H9Q A;  1BIA A;  1ZEL A;  4M72 A;  3L9F A;  3KET A;  3PL8 A;  3ZQG A;  2A3S A;  1HF0 A;  3GME A;  4IZZ A;  5FLV A;  4M9S A;  4CGZ A;  2MD5 A;  3H92 A;  4WXD A;  3RJP A;  5FO5 A;  1X19 A;  2CS3 A;  3LA2 A;  1AHD P;  1VQO I;  3K4C A;  1MH3 A;  1JTX A;  2ZJP F;  1I6X A;  5GAE J;  2OBP A;  3SQN A;  4M3E A;  3CCL I;  1QQI A;  1O4X A;  1ZH5 A;  4NQW B;  3ZCO A;  4ZDO A;  4UUT A;  3I64 A;  3MEX A;  1BM9 A;  3LL7 A;  4B48 A;  5K7F A;  2AO9 A;  2RRE A;  3NQO A;  4B4C A;  1ZAO A;  2L02 A;  1XTA A;  4XN0 A;  2X6X A;  3U1K A;  1WJC A;  2P0W A;  3GTK J;  5EYR A;  3L1P A;  5H2F C;  1A36 A;  4XNF A;  1MMA A;  1JI8 A;  4XOP A;  1IDY A;  4AVZ A;  3GTM J;  2E7X A;  4OIQ F;  2Y30 A;  4RA2 A;  3KZY A;  2DA3 A;  5J8C A;  3GFJ A;  4BU2 A;  3CD6 I;  1MGT A;  1QZE A;  3HYI A;  4B1R A;  2CUF A;  3CCM I;  4LK0 F;  2VJ4 A;  1XN7 A;  2X4H A;  2DFH A;  3E3V A;  1H9G A;  1KA8 A;  1ULY A;  2ZXH A;  1WSU A;  3HSE A;  4PJ0 C;  2ZBK A;  4HA8 A;  1LEB A;  5JFR A;  3VSK A;  3PIP F;  5DDG A;  3K4L A;  1TWF J;  2H8W A;  2CYY A;  4OIR F;  4BXU A;  4NC6 A;  4EM0 B;  5HOO A;  4S04 A;  1XB4 A;  4N9H A;  1H88 C;  1YOV B;  2VKD A;  1Z1D A;  3FF5 A;  3K9T A;  3IKV A;  4KYW A;  3WGI A;  1MBG A;  4HBL A;  1H89 C;  1EH8 A;  4F52 A;  2RQP A;  5D4R A;  1UHW A;  2MLG A;  2CQ7 A;  3OYF A;  3S1R J;  1ACI A;  2ZXI A;  2KDO A;  2LLK A;  2VOO A;  1NG7 A;  3W2W A;  2ZNZ A;  3W6J B;  2X48 A;  1MJ9 A;  5IT3 A;  1X2N A;  3OYB A;  3IRQ A;  3HRS A;  5K5Q A;  4IHX A;  4HOB A;  5TIS C;  1R1T A;  1K7A A;  4XOR A;  1DPR A;  5CVU A;  2VON A;  1FTT A;  5F0H A;  3BT9 A;  3H9G A;  1UEL B;  3IAS 2;  5IYC J;  3J7Z I;  2HPI A;  2L4M A;  3I3L A;  4LGW A;  4KMU X;  3CMM A;  2PG4 A;  2ZB9 A;  3AG1 H;  1JJ6 C;  2AHQ A;  1OR7 A;  3QAH A;  2DA5 A;  2PMU A;  2EA2 A;  4BXX J;  4LG3 A;  2E36 A;  5HNH A;  2Z3Y A;  2RQQ A;  4PJL A;  3JSP A;  4J00 A;  1N75 A;  4II3 A;  3WU0 A;  4GYG A;  3OS1 A;  4MFD A;  4EJT A;  4CA0 A;  3OS0 A;  1WJB A;  1J09 A;  1FMW A;  1NH3 A;  2QSH X;  3SJM A;  1JGG A;  3IHU A;  5HDG A;  2ZME C;  4J19 A;  1SMY F;  1SEU A;  3K6G A;  2WY7 Q;  3M9A A;  3WTS C;  2IA1 A;  4A3I J;  2JA2 A;  4CZZ A;  4M6X A;  2VKV A;  5IOZ A;  4IHW A;  1P6R A;  1NG6 A;  5GAH J;  2KLO A;  3GFI A;  1KQ0 A;  1XG1 A;  1RRJ A;  1IUY A;  1JHF A;  4M74 A;  2VUM J;  4A6D A;  1H8A C;  2QBY A;  1G3T A;  3CDL A;  3ECH A;  5E8I A;  3FXJ A;  1AKH B;  2EK5 A;  5F6F A;  3KP2 A;  2G7U A;  4BBR J;  6PAX A;  2F4I A;  1R4M B;  3AFH A;  2E19 A;  1DUX C;  1RKW A;  4N4O B;  2HS5 A;  3IUO A;  1QZZ A;  3N05 A;  2O5R A;  2ZSI B;  5DUI A;  1POG A;  2W48 A;  3J80 K;  4MQV A;  1F43 A;  1O3Q A;  3I59 A;  1U6G A;  2UWM A;  2LR8 A;  3P5J A;  4ANJ A;  2WAQ A;  1WJE A;  3FHN A;  1Z7U A;  4DOZ A;  4YFN F;  3PNY A;  3HOZ J;  3UNG C;  2MBF A;  2R5Z B;  3IH3 A;  1GXP A;  5CVJ A;  2HPM A;  1Z21 A;  1JT6 A;  4HW0 A;  2OTJ I;  1TQP A;  1LVA A;  4UY8 I;  3K2Z A;  4XLN F;  4BE0 A;  2DYS H;  1D0Y A;  4Q47 A;  3E6B A;  4Y33 A;  4NC7 A;  4XKW A;  1MMS A;  4LK1 F;  4D7N A;  2DMP A;  3DPT A;  2YX7 A;  3DTK A;  3FM3 A;  5E1Z B;  2VBW A;  3A02 A;  2Y0S A;  3FK6 A;  5AIP A;  2H8R A;  5BNG A;  2XVC A;  2NS8 A;  3WTV C;  2F5F A;  2BOL A;  1FTZ A;  4AD9 A;  2BHY A;  4P9U A;  2X6Y A;  3S15 J;  2BZT A;  2R7F A;  3KPH A;  4UUV A;  2HVR A;  1UAA A;  3JRD A;  3KX2 A;  3K0L A;  2ESH A;  5J4Y A;  3LFK A;  3BOQ A;  4HYE A;  4ZYG A;  4GDF A;  3A0H C;  2DFI A;  4L5J A;  4RMN A;  3I5U A;  5FGM A;  4IX7 A;  2FRH A;  1Z9C A;  2NVU B;  2JN6 A;  3QPL A;  1D0Z A;  5GAD J;  1QVT A;  1TWH J;  5CYV A;  2BEO A;  2K9Q A;  5TRD A;  2OF7 A;  3GTL J;  1B72 B;  1R71 A;  2IT0 A;  4A3D J;  3OIO A;  5B66 C;  2LRD A;  1HXD A;  5C3E J;  4XQF A;  2ELK A;  5GP9 A;  4QLC U;  1BN5 A;  1E2X A;  4JK1 X;  1UST A;  3V7R A;  1SC7 A;  3I4P A;  3BG6 A;  3U21 A;  1FJL A;  2FE3 A;  3B02 A;  4XRM A;  4IQJ A;  2JMW A;  1I3A A;  4P1W A;  2QM3 A;  2VL8 A;  3DKY A;  4L0Z B;  2F48 A;  2L54 A;  2PMZ A;  4LOC A;  4LLN A;  2KIF A;  1W5C C;  2EIN H;  1TP4 A;  4CZC A;  3JTG A;  1S7O A;  5J3L A;  4C2U A;  3ONQ A;  1RIO H;  2B9S A;  3K70 D;  2QKM B;  1XC5 A;  4AVP A;  3JRC A;  1MMD A;  2F5V A;  5A2Q Z;  1PJR A;  1UMQ A;  2KKO A;  4AUX A;  3BG3 A;  3BRO A;  5KAI C;  3T5X A;  2H94 A;  2NXN B;  1VND A;  2G7H A;  2ZME A;  2MH9 A;  1KU7 A;  1IO2 A;  3W2A A;  4HAM A;  2BVM A;  3CCJ I;  1ZK8 A;  4HG2 A;  3L00 A;  3J81 Z;  3FMR A;  4PFP A;  5EF6 A;  3VWB A;  2R7Q A;  2W00 A;  2M7B A;  4L0Y B;  2DT6 A;  3ZRG A;  5M5X J;  3CCU I;  2NAZ A;  1D1B A;  2E1M B;  1ETW A;  2IJL A;  2EIK H;  3CTA A;  2WAF A;  2E1C A;  1D3Y A;  1NTC A;  1U5T C;  4I0B A;  1JXS A;  4U88 A;  3F8M A;  4DQ2 A;  3WOD F;  2GZW A;  3OYJ A;  2DAO A;  3MCZ A;  2DOA A;  2WAE A;  4MEX F;  1FX7 A;  5H6Q A;  4NDL A;  1IN4 A;  2CQN A;  3SFZ A;  3JTH A;  3BWG A;  2CH0 A;  4PCQ A;  4IOA F;  2TDX A;  4AIJ A;  4B3A A;  2MW8 A;  2L7K A;  1EKE A;  4BQA A;  2DTZ A;  1LE8 B;  4S0H B;  1BR2 A;  2LTP A;  3RZO J;  2XSD C;  1MBK A;  3K4B A;  3S2W A;  4EJW A;  1IN8 A;  2Z2S B;  4KUM A;  3BR0 A;  4GO1 A;  2LFB A;  3PO3 J;  1QGP A;  2PBI A;  2G0E A;  1IRZ A;  1QHG A;  5FKO A;  1QPI A;  2L4A A;  5DM7 F;  1T33 A;  3CCS I;  1VQ9 I;  3ZMZ A;  5E3O A;  4KMF A;  2M7A A;  4BJ6 C;  1D0X A;  4IVN A;  1CGP A;  3TDU C;  3LSG A;  1XDU A;  4FX4 A;  1W1W E;  3REO A;  4G7H F;  3E5U A;  1MJA A;  1J59 A;  3L2W A;  4JYK A;  4Y3O A;  3IH4 A;  3SZG A;  4G7Z F;  4YFK F;  1STZ A;  3OIQ A;  1B6A A;  1YFH A;  1GLN A;  1HKS A;  2AS5 F;  3I54 A;  2IS4 A;  4LMY A;  4MEY F;  3HSR A;  3T8R A;  1YO5 C;  2KMU A;  4MGR A;  3OYL A;  3WTW C;  3Q5F A;  1HW5 A;  4QWQ A;  1K4S A;  3K4N A;  3OYD A;  3FKI J;  4UVA A;  1YHQ I;  2RV8 A;  5FD5 A;  2XAJ A;  2CUE A;  2PX9 A;  1R5I D;  2MC3 A;  3U1D A;  3LSP A;  1VQP I;  4EGZ A;  1G3Y A;  1OCZ H;  1LFP A;  3FXQ A;  4A93 J;  5HDK A;  2GXA A;  2HQA A;  2CG4 A;  2W4S A;  3H5R A;  4AIK A;  1ZLJ A;  5CPR B;  2FBK A;  4LIV A;  1PYV A;  2MSY A;  4WXH A;  4A5N A;  3E6C C;  2IRF G;  5E1W A;  2YX4 A;  4JX6 A;  2M34 A;  1ZYR F;  5FD6 A;  1KGS A;  3IAM 2;  5B3S H;  5HS7 A;  4D5F A;  1V5F A;  3OIP A;  5AIQ A;  4FET A;  2W1O A;  4TV7 A;  2WB1 N;  2Y75 A;  1VQ8 I;  3K1M A;  2K9N A;  2GXG A;  1EH6 A;  3F72 A;  4I99 C;  1HW1 A;  3DKW A;  5BPD A;  1DDN A;  2LDU A;  3KEQ A;  2VT3 A;  3CJN A;  1NHA A;  2FSW A;  4L9N A;  2XB0 X;  4Y4R A;  3MN2 A;  2VT2 A;  3VFZ A;  3WGH A;  1NK3 P;  1L3L A;  4OAZ A;  5LBQ A;  4FCY A;  3MAJ A;  4UVC A;  2PJP A;  2JPC A;  1VQ4 I;  3KP7 A;  1Z6R A;  3H9J A;  3QYF A;  2V1X A;  4PJJ A;  3LNQ A;  4BEH B;  3U2R A;  3QOE A;  3DPU A;  3FBN B;  5FFX A;  4F93 B;  3ZQC A;  3CZ6 A;  3L09 A;  4Q4Z F;  1XGS A;  2KP6 A;  4PGG A;  4A0X A;  4EQQ A;  4A3K J;  5LFA A;  1V55 H;  1YX5 A;  3JRA A;  1TC3 C;  4DBR A;  3S1N J;  2WV1 A;  2EFW A;  1T08 B;  1T8I A;  2ELJ A;  2E5Z A;  4A3L J;  2XF5 A;  5L3E A;  2EA4 A;  1ENH A;  3PUB A;  2JSC A;  5HLG A;  3M7G A;  3JRI A;  2Z5U A;  4AID A;  3WU1 B;  3WG9 A;  1Q1H A;  4ZYD A;  2R7W A;  4R8H A;  3DBR B;  4XLC A;  3WGG A;  3RZD J;  2CQX A;  3K4J A;  4KN4 X;  3RQ4 A;  1GHC A;  4MTD A;  1TNS A;  1HQC A;  3GYH X;  4A6E A;  4CHU A;  4FT8 A;  4KT6 A;  2RVC A;  2MLK A;  5DD4 A;  3HG9 A;  2CSO A;  5M5W J;  3IV5 A;  2NS0 A;  3AL0 C;  4U0Y A;  2E5N A;  3FBI B;  3GLL A;  3LWF A;  2HKX A;  3M8J A;  1S72 I;  2LF8 A;  3EYI A;  2WAD A;  2JT1 A;  1HKT A;  3HSF A;  3D5S C;  4QIW N;  3ABM H;  2LSO A;  2UUZ A;  2IS1 A;  2LYC A;  4LIT A;  3KEO A;  4C3I J;  1QRY A;  3ABU A;  4QPO A;  2IAI A;  3TOA A;  1VQ5 I;  2OQR A;  2VJI A;  1BW6 A;  1Z3X A;  5LRR A;  2ZME B;  5FLX K;  1G8X A;  5F64 A;  2E34 A;  3PJR A;  1V5E A;  2HWV A;  3CUQ A;  2ZNY A;  3H3Z A;  2JWT A;  2P5K A;  2DA7 A;  1ON2 A;  2K5C A;  3QRF F;  3WG7 H;  3K70 C;  2P81 A;  3I4N J;  3L2C A;  2Y48 A;  2L3D A;  4MTE A;  2GXB A;  3A4C A;  3RI4 A;  4ZDL A;  1IV8 A;  4HEA 2;  1S6L A;  1T95 A;  2GQQ A;  1EA3 A;  2DDB A;  2FX0 A;  3ASN H;  1KON A;  3F9K A;  3OSF A;  2R5Y A;  3M1E A;  1LPQ A;  2V9K A;  2Y0M A;  3ULQ B;  1J0R A;  2DW4 A;  3PFY A;  1HA8 A;  2OCE A;  4A3J J;  4A3G J;  1PVE A;  3V7S A;  9ANT A;  3GWZ A;  3RQI A;  2R0Q C;  1YW9 A;  1PUE E;  3B6A A;  5EJC A;  4ESJ A;  5IT9 K;  3H0D A;  2O03 A;  3IKT A;  1ITY A;  2IS6 A;  2O8X A;  3CCV I;  2HVQ A;  1UHS A;  2FU4 A;  4G7O F;  4BAY A;  1KU9 A;  3DFG A;  3U9G A;  2DPD A;  2BHZ A;  2K9M A;  4I7H A;  2DMT A;  1YIJ I;  3Q0W A;  2FML A;  4G8X A;  1BR1 A;  1ZG3 A;  2DJI A;  5K5R A;  2M5W A;  5JVT A;  2PN6 A;  1IG7 A;  1FIA A;  2MA3 A;  2CV0 A;  1TTY A;  5K5O A;  2QSF X;  3TW7 A;  2A5W A;  4HF0 A;  2VIX A;  2HEO A;  3JRH A; 
#chains in the Genus database with same CATH homology
 4E7I A;  5CQG A;  3RCO A;  3H9G A;  1UEL B;  3IAS 2;  4II2 A;  2HPI A;  2M4K A;  3I3L A;  3H35 A;  3L2V A;  2R7X A;  1N77 A;  4E6K G;  3CMM A;  4U7B A;  3SDB A;  3V42 A;  4BQQ A;  2CW8 A;  4LG3 A;  3S3O A;  4FAS D;  5HNH A;  2RQQ A;  4YEL A;  4PJL A;  4J00 A;  1N75 A;  4II3 A;  3OYC A;  3OS1 A;  3S3N A;  4B44 A;  2MYS A;  4CA0 A;  3OS0 A;  1WJB A;  1OR7 C;  2ZSH B;  1J09 A;  1FMW A;  3VSL A;  4AU7 A;  4F91 B;  2CFO A;  1WJD A;  3W3C A;  3D5R C;  5LD2 C;  2UV1 A;  4GRI A;  3K4M A;  5JHF A;  2R7V A;  2V26 A;  1VZ0 A;  3K6G A;  2WY7 Q;  3G2B A;  2HNH A;  4HRI A;  3CES A;  4BDY A;  4JOM A;  3UR3 C;  3AKZ A;  2JA2 A;  2AQF A;  1NG6 A;  2KLO A;  2JVH A;  2KZV A;  2VKH A;  3QOD A;  2A6T A;  2VAS A;  1BOB A;  3S8P A;  3OR1 C;  4RLF A;  2QKL B;  2F4I A;  3AFH A;  3DU5 A;  4N4O B;  3IUO A;  1W36 C;  3KEY A;  2O5R A;  2ZSI B;  3N05 A;  4OWR B;  4XLH A;  4N4N B;  4CCK A;  4PK4 A;  2VXD A;  4B43 A;  2VJ5 A;  3OOU A;  2JUG A;  2UWM A;  2BVL A;  4ANJ A;  1WJF A;  2W7N A;  2WAQ A;  2RNG A;  1WJE A;  3FHN A;  1X1C A;  4DOZ A;  3PNY A;  1T0F C;  3HOT A;  3UNG C;  4HST A;  1YX3 A;  2X85 A;  4PJM A;  1WFX A;  4EAT A;  2HPM A;  1Z21 A;  5CQE A;  2OC6 A;  3S32 A;  4XLF A;  3MKW B;  4BE0 A;  1D0Y A;  2CUJ A;  4E7J A;  4Y33 A;  4NC7 A;  4XKW A;  4U87 A;  4HSR A;  3DPT A;  3DTK A;  4XKV A;  1X1D A;  2L9N A;  2MD0 A;  2Y0S A;  3OYA A;  4E7Z A;  4XOR A;  3BCB A;  1Z3Y A;  3MD2 A;  4P5O A;  2BOL A;  4X0G A;  4XLA A;  3LSM A;  2X6Y A;  4XM3 A;  3OYH A;  1WJ5 A;  2DXI A;  2HVR A;  1UAA A;  3KX2 A;  2Z1D A;  3I9V 2;  3TBI A;  2XC7 A;  2MFZ A;  4RMN A;  4IX7 A;  3RSN A;  2VLA A;  1D0Z A;  3GBG A;  5FRN A;  4QPQ A;  4KIT B;  2GOM A;  2V6E A;  4BE1 A;  4NUB A;  3LSK A;  4CCM A;  2LRD A;  3RPU D;  2X6W A;  4XQF A;  1N78 A;  3CJQ B;  2V1N A;  1UG0 A;  3BG6 A;  4PSX A;  3U21 A;  2M4G A;  4XOT A;  4CSW A;  2DT7 B;  4IQJ A;  3PSI A;  4P1W A;  3DKY A;  2VL8 A;  2PMZ A;  3HXL A;  2PJR B;  2M3A A;  4CZC A;  2VJJ A;  4C2U A;  2Q2E B;  4JQF A;  4BS9 A;  4CUG A;  2LBF B;  3ONQ A;  4YRV A;  3K70 D;  2QKM B;  3BG7 A;  1MNE A;  1MMD A;  4ZYA A;  2F5V A;  3A2K A;  1PJR A;  3TL4 X;  1V5G A;  3OYM A;  3LFU A;  4RM2 A;  4KIS A;  3DTE A;  4XL9 A;  1MND A;  4XMY A;  4G6T B;  3W2A A;  2R7U A;  2AQE A;  2BVM A;  4HG2 A;  2VQC A;  3OY9 A;  3D5L A;  4J01 A;  4PFP A;  5HVQ C;  1QU3 A;  3VWB A;  2R7Q A;  2W00 A;  2M7B A;  2DT6 A;  1IRX A;  3ZRG A;  2CW7 A;  1D1B A;  2E1M B;  4XLE A;  1Y6I A;  2X1D A;  3FDY A;  4DIQ A;  2WAF A;  2KL4 A;  4D1Q A;  4CH7 A;  4IKF A;  2LG4 A;  3PNV A;  2VB6 A;  3OYI A;  4BE2 A;  2V4J C;  4B3X A;  4BQN A;  3OYJ A;  2LRE A;  3OS2 A;  2DOA A;  2WAE A;  3C2H A;  2CH0 A;  2MC4 A;  2X1E A;  2IS2 A;  1Y56 A;  2XSJ C;  4F3Q A;  1ERD A;  2R4G A;  2WBM A;  4ZDP A;  3LSH A;  2L7K A;  3TMO A;  4BGD A;  1BR2 A;  4PJN A;  3K4B A;  1TZL A;  1K6Y A;  1YE9 A;  2LH9 A;  1LVK A;  1AA7 A;  2IXS A;  2Z2S B;  5HLT A;  3HUG B;  1DQU A;  3A1Y A;  3DTI A;  3ZQQ A;  3OYK A;  1QHG A;  4C2T A;  2CV2 A;  2W82 A;  4R79 A;  2E60 A;  3S93 A;  2M7A A;  3ZGK A;  4BJ6 C;  4AYB A;  1D0X A;  2VQH A;  3W2V A;  3LSG A;  2IGN A;  4CCO A;  2KPM A;  4XKB A;  3DPL C;  3QYB A;  4ZC3 A;  4DGW B;  4HPQ A;  4Y3O A;  3L2W A;  3SZG A;  2V7F A;  4ITV A;  2X1C A;  3MKY B;  3OIQ A;  2LOO A;  1GLN A;  2HU9 A;  5FRO A;  3IP4 B;  3H5A A;  2IS4 A;  2NOJ B;  2L2O A;  3OMY A;  4XON A;  3SYT A;  3HKZ A;  2KMU A;  3OYN A;  3OYL A;  1U0J A;  3CP2 A;  2XF6 A;  4HNT A;  3K4N A;  1W36 D;  1D1C A;  3BLY A;  3OYD A;  2KHM A;  3LMM A;  2MAB A;  4PFO A;  3OYE A;  1D1A A;  3KYL A;  3OR2 C;  3FKJ A;  3AL0 B;  1LFP A;  2E1M C;  2IGM A;  2HQA A;  3NWT A;  4E7L A;  3S3M A;  1R6R A;  5CKT A;  2W4S A;  3H5R A;  2HZD A;  5CPR B;  2JSP A;  1PYV A;  4LIV A;  4NC8 A;  1G59 A;  4ZJZ A;  4KJZ A;  2KRH A;  3IAM 2;  3LSI A;  1V5F A;  5FRM A;  3OIP A;  1TT0 A;  2Q1Z B;  4XR6 A;  4FET A;  2W1O A;  4PSW A;  4ZTF A;  3M1C A;  3HPG A;  4YEJ A;  1FMV A;  1MW7 A;  5TGT A;  3NWS A;  3EUK L;  3E1S A;  4BL0 B;  2DCE A;  5KHD A;  2FUG 2;  4Y4R A;  2OV7 A;  3CP8 A;  2R7S A;  4PUS A;  2BW3 B;  4H4K C;  4OAY A;  3CF2 A;  3SEQ A;  4DJA A;  4OAZ A;  2WY8 Q;  2R7T A;  2L9S A;  4LIU A;  1WJA A;  3MMY B;  3H9J A;  3HOS A;  4E7H A;  3QYF A;  4IQ4 A;  4PJJ A;  4BEH B;  3BC8 A;  2WB1 A;  3DKX A;  3QOE A;  3DPU A;  1OLT A;  3FBN B;  4BXF A;  4F93 B;  2VPL A;  3HPH A;  3CZ6 A;  2GOX B;  1SFK A;  2KP6 A;  3J7A Y;  2Z16 A;  5LFA A;  3EUA A;  1YX5 A;  2K9L A;  4DBR A;  2R7O A;  2XAU A;  2VXZ A;  4MLO A;  3OYG A;  2ELJ A;  2XF7 A;  2I8D A;  3E0J B;  2R7R A;  2E5Z A;  2XF5 A;  4BJT A;  3DWL E;  3DEE A;  3VYT B;  3BCA A;  4NNJ A;  5HNF A;  3EUH C;  3PUB A;  3H5N A;  1E0E A;  2OUM A;  4XKC A;  2VQL A;  2JVG A;  4E4H A;  1MMN A;  3DU6 A;  2R7W A;  4XLC A;  2K3P A;  1X1A A;  1SAU A;  2VQG A;  5KNL A;  2LY2 A;  4BDZ A;  3K4J A;  3RQ4 A;  2LY1 A;  3ZXS A;  2CMP A;  1DGR M;  1LDK B;  3SEZ A;  2X51 A;  3L2Q A;  2CUZ A;  4RLQ A;  3C2G A;  4KT6 A;  3K4K A;  1DP3 A;  3PNT A;  1MMG A;  2IGO A;  3HG9 A;  3VYR B;  3HC7 A;  3H9Q A;  1ZEL A;  3PL8 A;  4F55 A;  4IZZ A;  3AL0 C;  3FBI B;  2E5N A;  1DGW Y;  3M8J A;  2PJR A;  1X19 A;  2M0M A;  2CS3 A;  2WAD A;  4CCN A;  4D9J A;  3L2R A;  3RTR A;  3K4C A;  4F92 B;  3D5S C;  2LBF A;  3DQV C;  2UUZ A;  2IS1 A;  4NQW B;  3ZCO A;  4ZDO A;  4B48 A;  3OL3 A;  3LL7 A;  2LYC A;  4LIT A;  2RRE A;  4XN0 A;  2X6X A;  1X4P A;  4QPO A;  4C30 A;  4C9Y A;  2HDW A;  1WJC A;  2KQR A;  2ZFU A;  4HNU A;  2VJI A;  2P0W A;  3VYU B;  1Z3X A;  3EPZ A;  4XNF A;  1MMA A;  2BW3 A;  1JI8 A;  1Z7L A;  4XOP A;  1G8X A;  4AVZ A;  4ZTJ A;  4BQO A;  3ZR8 X;  1X1B A;  4E7K A;  4BUP A;  3PJR A;  1V5E A;  3CJR B;  3VDX A;  1S9H A;  1X4O A;  4BU2 A;  2K5C A;  4BEH A;  4BAC A;  3K70 C;  1P9Q C;  2VJ4 A;  2F6C A;  2L5Q A;  3A4C A;  4BJ5 C;  2ZXH A;  4ZDL A;  4HEA 2;  4RM3 A;  1T95 A;  1EA3 A;  3L2U A;  1KON A;  3F9K A;  5KCM A;  4DBQ A;  2V9K A;  4CCJ A;  3VSK A;  3K4L A;  2WA0 A;  5HOO A;  3PFY A;  1HA8 A;  2VKD A;  2KRC A;  2HVS A;  2LC2 A;  1LKX A;  2CV1 A;  3H0D A;  4F52 A;  4B47 A;  2IS6 A;  2HVQ A;  3OYF A;  2ZXI A;  2KDO A;  3DLA A;  4XN3 A;  3HL2 A;  3VYS B;  1NG7 A;  3K10 A;  3W2W A;  3QYE A;  2K9M A;  3OYB A;  4E7S A;  3MKZ A;  1BR1 A;  2DJI A;  1BR4 A;  2XDV A;  3PSF A;  1QHH D;  3OL4 A;  2CV0 A;  2IGK A;  3OWT A;  2A5W A;  2VIX A;  4CCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...