4BL0B

Crystal structure of yeast bub3-bub1 bound to phospho-spc105
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
46
structure length
44
Chain Sequence
b'NNPVYKLINTRKPERIVFNFNLIYPENDEEFNTEEILAMIKGLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CELL CYCLE ARREST PROTEIN BUB3
publication title Bub3 Reads Phosphorylated Melt Repeats to Promote Spindle Assembly Checkpoint Signaling
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle
total genus 6
structure length 44
sequence length 46
chains with identical sequence E
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08171 Mad3_BUB1_II Mad3/BUB1 homology region 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2870 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bl0B00
4BL0B
chains in the Genus database with same CATH superfamily
2JRMA 3FM3A 1FNNA 2FX0A 1YJ9I 3CJRB 5GTHC 3TQNA 2LLKA 2IA0A 3HOUJ 3I3LA 1I6XA 1FYMA 1VQ8I 3VDXA 2PMHA 4BE0A 3CC4I 4N0BA 1MH4A 1HKTA 2V9PA 4N4OB 3HOXJ 4RBOA 2CQXA 5EEHA 4AVZA 3CUQC 1KA8A 2DBBA 2DPUA 1MBHA 2DTRA 4IXAA 3HXLA 1G59A 1F4KA 1NK3P 2HQNA 2XAHA 4ETSA 3NRVA 5M3FJ 3Q5FA 4XRMA 1ZKGA 1S7OA 2ADUA 1RZ4A 2KLOA 3KYCB 4NC6A 4OMYA 3R60A 1X1AA 4M3DA 2JVHA 4ESJA 2JMWA 4HNTA 4AIKA 3PUFA 1AA7A 3L09A 4PJNA 3CP2A 2L4AA 3ERMA 5CQGA 5J40A 1KU2A 5BS6A 3J80Z 3FXKA 1SVOA 3QPTA 3E5XA 3OY9A 4DJAA 1FSHA 4KIFA 2ZB9A 4KJZA 2KIUA 3N05A 2LK2A 4U0WA 1FIPA 2HOSA 3S16J 4BE1A 2BGCA 1H9TA 5L3FA 2M0CA 5TGTA 3E0JB 4DYQA 5E3LA 2XROA 1BC8C 3HOWJ 4IOCF 4N9IA 4HAMA 3F23A 4IL6C 2CGPA 5DCMB 2GA1A 3HKZA 2LY1A 4KFCA 4MQ9F 2EZLA 3KEYA 4EGYA 4XSZF 1ON1A 4P5OA 4EJTA 1ETYA 1B72A 5FD5A 2R7TA 3ZGKA 1QA6A 3QRFF 5FLXK 1VQ5I 4GFBA 3RQ4A 1GLNA 3EUHA 1PP8F 4XLPF 4BACA 3H3VK 3CMYA 3B6AA 4BE2A 1MMNA 2EZKA 3BG3A 1BI0A 4NBQA 3JSOA 2MLKA 3OIQA 3H9JA 1I1SA 2BXZA 2TRTA 2OZUA 5CVJA 2GOMA 2BZTA 2EINH 2QQAA 4C9YA 3LSKA 5FKKA 3OYKA 2KZVA 2ME0A 2QENA 3BR5A 5C3EJ 1MBEA 3OIPA 1T8IA 2YUSA 3BG9A 3GZ5A 1WHUA 1ZELA 2RVCA 3L2QA 1SMYF 5M3MJ 1U78A 2M34A 2VN2A 1MBFA 1TWAJ 3SQNA 4AUXA 1O57A 3LFUA 4II3A 4BYYA 3H5RA 5CVRA 1L0OC 1IV8A 2K86A 3AL0B 3LSIA 1UG0A 4HPQA 3HM5A 1GDTA 2E1MC 2VIXA 4OU0A 2CG4A 1H89C 3GTGJ 3BPXA 4UV8A 1UMQA 2E5ZA 2EIMH 3I4MJ 2QQ8A 2KFDA 3Q3SA 1TQIA 3PJRA 1R5GA 1UHWA 1MH3A 1YS7A 2LY9A 3K9TA 2DA7A 3IAM2 4U7DA 2DT7B 1F5TA 1T0FA 4HF1A 1HDDC 1IUYA 3HPHA 2F5FA 5ICFA 3KLOA 1E3HA 4E7IA 3CQZJ 3F8CA 2ZJ2A 4LJZF 3DP7A 1XS9A 3S2HJ 1RNLA 4LG0A 2X1DA 5JHFA 2ZXHA 2YU3A 3JTHA 3I0TA 2V79A 3OWTA 3QP5A 1LB2A 1ZREA 1GHCA 1JHHA 3HBLA 3RDIA 2Y0SN 2DK5A 4LGWA 4F93B 1MDMB 4IRIA 4HZFA 2O03A 2PMZN 1K7AA 4I98B 5HLIA 1YITI 2E7WA 1D0XA 4KT5C 2HQ5A 3C3WA 1B1BA 2R7QA 3WE3A 4KT6A 3JRGA 2VT3A 3BR2A 5F27A 2HOAA 4NC7A 3MQ0A 2AO9A 1JUMA 3CCMI 1LUJB 5EF6A 5C4JJ 1K4TA 5E1ZB 1FYKA 1M1EB 3H0GJ 5FO5A 1ZQ3P 2MH9A 3FXJA 4IPAA 3GO5A 2W24A 1A6IA 3DU5A 1YRNA 3BC8A 4DGWB 3OS1A 1UELB 3TOBA 2B63J 1WVRA 3GFJA 4E6KG 2FJ1A 2C6YA 4DQ2A 1O3QA 2NOGA 3GF2A 1YS6A 2OJED 2E1OA 3WTWC 3ZN1A 3RTRA 4OAYA 5BQTA 2FQ3A 2ZSIB 3PNVA 2EJRA 2L9VA 1R9TJ 5JLXA 5B1AH 2Y2ZA 1WWXA 2ZFWA 2RC4A 1QPMA 3GLXA 2I5UA 3ABKH 2V6CA 5CYVA 2K9SA 1TT0A 1HSTA 1W7PB 4NC8A 3DFGA 2YSRA 3LSTA 3A1YA 3OYDA 3Q9VA 3ZQIA 3HUGA 3GYHX 1SVMA 2W1OA 2HU9A 4XLHA 3BJAA 1TNSA 3U1KA 2OTLI 3W6VA 3JCUC 4UUVA 2L3DA 3BZKA 5D5WB 2R5ZB 4RMNA 2VODA 5JFRA 4A12A 3LA3A 3HSRA 4HLXA 4MLOA 3KZZA 1LJ9A 4B43A 2V26A 1YW8A 4O5VA 1TQPA 2H8RA 3N4MA 2DMUA 1D1BA 2HDCA 1NG7A 2L7FP 1SVLA 1VQMI 1DU0A 2A61A 1FBUA 1P4XA 2R7FA 2YU9J 4XKWA 3J7ZI 1R1UA 2FBKA 3C2GA 2IRFG 3MZ8A 3C2HA 2HKXA 3PFIA 3I54A 2PEXA 2D1HA 3S3OA 1FWZA 4KICA 4AC0A 1HCRA 2DYRH 1R22A 5CKTA 1OKRA 3S2WA 3FISA 2K40A 4JK1X 4V2GA 1OR7A 3L2CA 2LRDA 2EV0A 1RR8C 2VQCA 2CUFA 1JKQC 1LVKA 3VSKA 3CP8A 4XKCA 5D5XB 2X6XA 3V7RA 1FT9A 3BR1A 3LSJA 2M7BA 4BXUA 4AIHA 2IW5A 1IF1A 3K4NA 2LSOA 3DKWA 3HSEA 3EYIA 5K1YA 4X0GA 1Q1VA 4GCVA 2IS4A 3HHHA 2LP0A 4ASNA 1ZRCA 1BN5A 2K02A 4WCGA 2QM3A 3LL7A 2XIGA 4U88A 5FROA 3WGHA 2V6EA 4KDPA 5JVTA 1AKHB 5H6RA 4G6DA 2P7CB 2XV4S 2XASA 4L5JA 2PN6A 3VWBA 3GW2A 4AYBA 1FOYA 3E6MA 2R7DA 4KN4X 3T0YA 1SC7A 3JR9A 1WJFA 1QBJA 3JRFA 2VXDA 2DJNA 4OAZA 2MYSA 3C7JA 2NS7A 1BJAA 1TT5B 5ERIA 4G7ZF 1V5FA 1WKMA 2MGQA 2BEOA 2NNYA 4R1HA 5CQEA 3JTGA 4KN7X 1MIJA 2ZNZA 3S1MJ 2X6WA 2IEKA 3BWGA 2FQ4A 2BY1A 1QNTA 4HX4A 1J75A 1CGPA 5LFAA 1TZLA 4L5EA 5FKNA 2CH0A 2DA4A 4BAYA 1PVEA 2H6CA 5E1WA 5D8KB 2XUBA 4ESBA 2V9VA 2PFBA 2DA1A 2QWWA 2VKDA 3BJ6A 2BY2A 2QQBA 1Y56A 4M9SA 4PZJA 2MD5A 3K4MA 5LGTA 3PO2J 1ETKA 1R5ID 1ZH5A 3DLLF 1S6LA 4I02A 1XD7A 3SJMA 2X6YA 1TWFJ 2PQ8A 3CZ6A 2HVSA 3FXMA 1QO0D 2A6HF 2MABA 5J6XA 1I6HJ 1E3PA 2RN7A 4R8HA 3PNTA 4M6VA 5L3DA 1R1VA 1ZGJA 4I01A 4FETA 1LDJA 2KJBA 4HBLA 3FM5A 1ETWA 3SDBA 5LRRA 3ASOH 4G6TB 4UVAA 4LK0F 3GTKJ 4HDVA 4LLGF 4JP0A 4BJ5C 2ACJA 5DUIA 4M9XA 2DOFA 5IP7J 4Y17A 2KDZA 1MNDA 1X58A 1JGGA 2OBPA 2DAOA 4M3GA 2EILH 5F08A 1CQTA 3GEZA 1K78B 4NDLA 4GRIA 5K7ZA 3M8FA 3DQVC 2IBDA 1LVAA 1XDSA 1LE8B 1EF4A 1D0YA 2PMUA 1DGWY 2KZGA 1KONA 3HSFA 4L9NA 3GZ6A 2A69F 3CF5F 3V8JA 3HRSA 2R7WA 1YFHA 5HDNA 2P4WA 2HXIA 2LBFA 1U8RA 2LNBA 5KVRA 5FFXA 3TO7A 4G7OF 3ZR8X 1I5ZA 1MZBA 3BLYA 2FOKA 5DYMA 1WZ2A 1TLHB 2E19A 3HGGA 4II2A 1OCRH 1YIOA 2JUCA 6PAXA 2L7ZA 2CMPA 2ZC2A 4B09A 2P81A 1ZLKA 3AKZA 3HB9A 2VPRA 1V4RA 4D1QA 1ZAOA 1YHQI 1VQKI 2PLYA 2BHYA 1S7EA 2F5VA 1OYIA 2QGUA 3K70C 1IDYA 4PCQA 4XKVA 2Z2SB 4CYDA 3EPZA 1R49A 4LD5A 4KIGA 4NQWB 4XKBA 1FC3A 1XTAA 2ZXIA 3QWLA 3ZRGA 1OCPA 3HRUA 2EA2A 3DKYA 5K7HA 1MJBA 3NWSA 1XMXA 4ZH4F 3PM1A 3EDPA 3MVPA 3I9V2 4GXOA 3GZNB 5E18F 3QU6A 2HDWA 2IA1A 1WJEA 4BNCA 1BL0A 2W00A 3GTOJ 1ITYA 1S3JA 4U87A 3BJOA 3S8PA 2F4IA 2Y75A 1FX7A 3FF5A 4HYEA 2JA6J 1FTTA 4FX4A 1E17A 2NVQJ 2PBIA 4EJVA 1E0EA 2XSDC 4PGHA 2P6TA 1J7KA 2QZ8A 3WTVC 2KIFA 4CSWA 4PDKA 5EZGA 1Y6IA 2X48A 2IPQX 4HSTA 1HKSA 3BT9A 3CMAI 4G94A 5EEGA 5KNLA 3ZXSA 3F8FA 4KITB 2EFQA 3MAJA 3RPUA 5HDKA 4LIVA 2LY2A 1IRZA 2ME6A 3BG7A 1LFUP 3ZMTA 5KCMA 4EQQA 1TTYA 3S1QJ 2OPTA 2VC1A 4P9UA 1SD6A 3BCBA 3MN2A 4NUBA 1XSDA 2VE8A 1VQ9I 1MD0A 4Y15A 5J3LA 2HYJA 1S5LC 1TW3A 4A3EJ 4LMYA 4BH9A 5FKMA 2UXNA 1T95A 3VOEA 3HKZN 3GTJJ 5FRMA 2L01A 3BDDA 1X4OA 2M7AA 3O3KA 4JX6A 3R4KA 3V8LA 3SDGA 1LFPA 3KZYA 1XCVA 4IRHA 4JX5A 2P0WA 3GFLA 4CUGA 1I3QJ 5TJJA 5BOXA 1HA8A 2OCEA 1B4AA 3QOPA 1CF7B 1ENHA 2DU9A 3QPHA 4B8XA 1JTYA 4JQFA 3RYPA 5AIQA 4H4KC 3J7AO 1P6RA 4Q4ZF 4RAZA 2QSHX 5LHIA 3M4OJ 2DA5A 2XF5A 2DO7A 3OYBA 3U2RA 3LSRA 1F9NA 3SYTA 5IPAA 3AG1H 2Y9ZA 4YRVA 2XC7A 3PNYA 4KMFA 4RB0A 2IJLA 1ZR2A 4ZTJA 1X1PA 2YX7A 4LG3A 4RM3A 3RKYA 4KMUX 2STTA 1U8BA 2QQ9A 3P7NA 4ZYAA 1Y1WJ 2CS3A 5HNHA 4L0ZB 3BG6A 4IKFA 3FMRA 4Y4RA 1E2XA 5F04A 5D8LB 4U7BA 1JJ6C 1IZ1A 4ZDPA 3MZYA 2FA5A 3F3XA 3HYIA 2LTPA 2E2IJ 3E3VA 1A6QA 2ICWG 4V2FA 2F5CA 3BROA 1NG6A 1Z9CA 1A31A 1BIAA 3E6CC 3V4GA 2ZJPF 4CCKA 1J59A 2M8EA 2ZXWH 1BM9A 2YX4A 5A2QK 2VUMJ 3TW7A 2A05A 1LKXA 4CCOA 3MKWB 4LITA 2EQRA 2UUZA 1Z7UA 5F0CA 2F4OB 4X1EA 2E34A 2OZ6A 2R4GA 4DBQA 3H9GA 1TBXA 2Z9OA 2BV6A 3UR3C 4FASD 4WK8F 4C2MJ 2HNHA 3K4JA 3TP3A 4A2UA 1IRFA 3P5JA 4DZPA 5CVIA 4Y7NJ 1R23A 3K4BA 2VBYA 4XN3A 2DK8A 4ZTFA 4OINF 3E1SA 3TDZC 1SD7A 1GV5A 1APLC 4O3MA 3LFKA 3GTPJ 4M6XA 3PUBA 3KIOA 2D5VA 1TNTA 2FNAA 2W4SA 3IAS2 3ELKA 3WHBA 2MC3A 1X1BA 5E8GA 1AOYA 4RB2C 1WRJA 3U9GA 2ZJQF 1JXSA 4BEHA 2X6OA 1YJWI 2RAEA 3K2AA 2VI6A 3TO9A 2FOWA 3QOEA 5AIPA 1MNMC 1J09A 4ZDLA 3G71I 2OQGA 1D0ZA 3GBGA 3F9KA 4DYCA 5LHGA 1BR1A 2DQLA 2EA4A 2WAQA 2XKPA 4FT8A 2UV1A 2P8TA 1SFEA 4M3EA 1S9HA 3WU0A 4UUSA 3CUOA 4UV9A 2CUJA 1O7FA 2DA6A 2ZCWA 4I0BA 2IP2A 1NK2P 5LD2C 3X2QH 1Z3XA 3D1NI 1PJRA 1DDNA 3FK6A 4BS9A 1UHSA 1G6NA 2RNJA 2NVYJ 5FKOA 1ON2A 2RDPA 1PUFB 1IXRC 4RGSA 2LKXA 5K7FA 4XQFA 1QPIA 3IH2A 1DQUA 4PJMA 1VTNC 1BC7C 2HVQA 2TDXA 3L9FA 3H3ZA 5BNGA 3CTAA 1TC3C 1OQYA 1DU6A 2HZDA 3IP4B 3RKQA 3J7YJ 4D7MA 2VJ5A 3CD6I 2DFHA 5FLVA 3L7WA 3KP6A 3GX4X 3HL2A 3V7CA 4BUPA 1U9OA 2FBIA 2YPRA 1BBYA 2FBHA 1ZN2A 1U6GA 4XICA 4A69C 2R5YA 5LBQA 4ESFA 1BW5A 2WB1A 2DTZA 3GLLA 1YI2I 2KT0A 3QYEA 2WADA 3RCOA 3GTMJ 4I0AA 2DJIA 2ID3A 2BXYA 1WH7A 4OIRF 2FMLA 5DV5A 2JRTA 4JOMA 3DPLC 2FUG2 3S14J 2EFOA 4F92B 4Q5SF 1HLVA 3CMMA 1P4AA 2KJCA 2JZYA 3E5QA 1OCCH 2GA2A 5EDNA 1JKPC 2EZHA 1U5TA 2GZWA 2O7OA 4DIQA 1PUEE 3I53A 1P7JA 3HIFA 4G8XA 1OISA 4E70A 1HKQA 3BTCA 2OD5A 2QKLB 3J81K 3DPTA 3DU6A 3OYNA 3GVAA 2AQFA 1GVDA 2NS8A 3VFZA 1A36A 2VJ4A 3L2UA 4DBRA 2LF7A 4I09A 3F72A 3WU2C 3QPLA 1MDMA 3HRTA 2Y30A 3A01A 1OFCX 2G0EA 1F36A 1BJZA 3DBLB 2Y69H 2H6BA 1VQOI 5H20A 5IT3A 3RI4A 3AG4H 1ZLJA 5HOOA 1QVTA 1B6AA 3HEFA 3NARA 1T56A 1EH7A 4AWXB 4HSRA 3R0AA 4XOPA 1B72B 3ZMUA 5IP6A 4B48A 2KRFA 5E8IA 1EV7A 4OMZA 1JE8A 3F0CA 2HPMA 1ZHFA 1W5CC 1ODDA 1P7IA 3T8TA 2IAIA 3FHZA 1D8KA 1PYVA 3F22A 3IRQA 3ZMVA 4EEFG 1LFBA 2R3SA 4WXCA 5F0HA 3WGIA 5B1BH 1OJLA 4PSWA 5H2FC 1W0UA 1RKTA 2ZXJA 3DWLE 4A0YA 2W48A 4JYKA 2QBYA 4LLNA 3OV8A 4MHGA 3H5NA 2W7NA 2A6EF 3S1NJ 1D5YA 4AYBN 2KMUA 3ERED 4IF4A 4B4CA 4P1WA 4BQQA 1QQIA 2WC2A 3DLAA 4FQGA 2FXAA 1YW7A 2BW3B 2DN0A 2L4MA 3VYTB 4XL9A 1K79A 1QGPA 1YW9A 2A3SA 2RNGA 4A3MJ 1N78A 2VB6A 2EK5A 3LOCA 2VQGA 2EB7A 4HF0A 2GIVA 1Z3YA 2HFHA 3KZIC 5FJ8J 4B1RA 1MGTA 3EUKL 1FOXA 4PJJA 2KPMA 5FLXZ 3ZOBA 3K4KA 2KISA 3JRAA 1RRJA 3V42A 1XDUA 4I99C 3R6SA 2JPBA 3CUQA 3CC7I 2Z99A 5C4XJ 2D45A 2XAUA 4BQOA 5HLGA 4V19K 4MEYF 3O8GA 2ELKA 1LPQA 2AXTC 1YG2A 4BKXA 1Y0NA 3E5UA 3K2ZA 4EATA 1KQ0A 2DYSH 4A3KJ 3C18A 2CUEA 1VQ7I 1QRYA 2K9LA 1MSFC 2JA2A 2OV7A 2O0YA 4FE7A 1G4DA 2CFXA 4QPQA 1IW7F 3OYHA 3KP2A 3DBHB 3PQKA 5HVQC 2PJRA 2STWA 3IUOA 4ABZA 3O2PE 2CFOA 4LG0B 2FE3A 4ITVA 3KP5A 1QHGA 2ID6A 3KYLA 3JRHA 3FBNB 4UVBA 5KAFC 2IVMA 3UNGC 1IN6A 2OAZA 4I2OA 1FBQA 3CCYA 2R92J 2PG4A 2OCCH 2P5LC 1BR2A 1J5YA 2FF4A 4HRIA 4BBSJ 4BGDA 1G3YA 2DW4A 2VQHA 1Y0UA 5FRNA 2M45A 3P9IA 3H0DA 2LD5A 1X3WB 3BZ6A 1R7JA 1VQ4I 1JT6A 1B9MA 1Y39A 1HW2A 1VF9A 3GFMA 1ULYA 2A5YB 2EIKH 2V1UA 1Z77A 1UB9A 5L3GA 4CDGA 1IO2A 4RB3C 2LH9A 1IUFA 1IRXA 3K4LA 3K1PA 1YRNB 3AG2H 2K7LA 2O8KA 3WGGA 2GQQA 2WAEA 3TMOA 1S8NA 2BVMA 2M9HA 2RKHA 4XNFA 2DFIA 2XF7A 3IWZA 3F21A 3ISPA 1SMTA 3T1BA 1X1CA 2VPLA 3BTIA 1ONVA 2ESNA 4N4NB 5IOYA 1FLIA 4PJ0C 3VODA 2ZJRF 1UG2A 3SEQA 1K61A 2R7SA 3LSPA 2J5OA 4UY8I 4XRSA 4ZDOA 5GP9A 1LDKB 5CLSA 2M8GX 2RREA 4L5IA 5M5WJ 1SFOJ 5DEQA 2NYXA 1O3SA 3CLOA 2DXIA 4S04A 3RPUD 2IGOA 2XAJA 1SFUA 3H35A 1L3LA 3DKXA 1A35A 3O8HA 1MNEA 4RAYA 2JSCA 2CQQA 2V1XA 2DA2A 2PI0A 2CV2A 2DT6A 2EH3A 2OU2A 5EGOA 1YTYA 4DNCA 3BTLA 3G73A 3VYRB 5GAGJ 3ABLH 4RA2A 1N25A 2ZFUA 3G4SI 2P5VA 1XMKA 4OIQF 3KEOA 3PQJA 1USTA 3WU1B 3CCUI 3FMQA 5F1JA 3L2VA 4CICA 2LKPA 2ELJA 5B5EC 3OS2A 2KRCA 3OR2C 1F1ZA 1I50J 3MKZA 4UXNA 1U0JA 4RLFA 2NS0A 1XGOA 1ETXA 4Y33A 2LF8A 2E1CA 4UB8C 4XRFA 4N9HA 2EBIA 5ICEA 1P4WA 1OCTC 5IYDJ 4PJLA 3ZMDA 1J2XA 1R4NB 2G7HA 5E3NA 1R71A 1XMAA 4J19A 3OOUA 1F43A 1Z91A 1ACIA 1I27A 4BXFA 4IJAA 2G7UA 3MCZA 1S7AA 1Z05A 4LIUA 3G1MA 4A3CJ 3RZDJ 4NB5A 3TDUC 1X3ZB 2L5QA 2MW8A 3I59A 3LAJA 1T08B 2M2EA 3BG5A 4ENNA 2MBFA 3E97A 2IS1A 1ZGWA 3WHCA 3A2KA 3F8BA 3SZGA 1O3TA 2XGEA 3IH4A 2M4GA 4M9ZA 4E7ZA 1Z0XA 2W57A 3JAMK 1R58A 2OA4A 2XHKA 5DM6F 4C2TA 3ZCOA 1OLTA 1XN7A 4RGXA 4RGUA 3SFIA 4EM2A 1T39A 1W36D 2QCOA 4CO8A 3LSHA 1Y8RB 3FKIJ 2XSJC 2BY3A 1QHHD 1YE9A 1HQCA 2KHMA 4YIIA 2O61A 3HRMA 3I58A 4B3AA 4MQVA 1ZG5A 2FEZA 2WBMA 1KYWA 1KQ8A 2NVXJ 3QYFA 4OOIA 1BOAA 3CCQI 1JJ8C 3IKVA 3IKTA 3F6OA 5M5YJ 4ZYHA 5J47A 3S93A 2O6GE 2IXSA 4QPOA 3FX3A 5DM7F 2HGCA 2OQRA 1FEXA 1H0MA 1XX5A 2MA3A 4LB5A 2IGMA 3FXQA 5IOZA 3HTSB 4Q47A 2Q2EA 3GUDA 4AD9A 3PIPF 2JSPA 2HYGD 3SEZA 2JA8J 4ZZDA 2KQRA 1I1GA 2Y31A 2Z1DA 2K4BA 1W1WE 2LR8A 2XRNA 2VT2A 2K4JA 4PUSA 1AHDP 2BVLA 4D5FA 1W5SA 4HF2A 1R4MB 1MMSA 3ML6A 5K5QA 1JI8A 3ZQ7A 4Z6YA 2EV5A 3RSNA 2WY7Q 1T38A 1VQPI 5HS8A 2QSGX 4IHSA 3QYBA 2GOXB 1TW2A 2COBA 1DP7P 1GUUA 2LOOA 2EPFA 4KUMA 1WI9A 2LFBA 3W6JB 1HW5A 2K3FA 3NEUA 4C3HJ 2A07F 1OCZH 2CYYA 2VKEA 4YELA 3TGNA 2Z33A 4LOCA 1BR4A 1YX5A 4IHWA 5GPCA 4KIBA 3W2WA 4MTDA 4I76A 2ZMEB 3BOQA 3WG9A 5F0FA 1YIJI 1KZHA 2R7OA 5H6QA 4CHUA 1KU7A 4FCYA 3DTKA 1W0TA 2XRLA 3G3ZA 4HX7A 2NVTJ 4F55A 3PL8A 2DOAA 5HDGA 1YQAA 1SFXA 1QZEA 2XPUA 3HPGA 1RPWA 1WCMJ 1WJAA 3FKJA 3MMYB 1QZZA 2BY0A 1OYYA 3BCAA 3EQLF 5J1UA 5CVUA 1OCOH 5HS9A 2X85A 3FZVA 2IGKA 3IL2A 1ZRDA 1BI2A 5DD8A 1N75A 3QODA 3JRDA 4F3QA 1OMIA 2FRHA 4EM1A 2MH2A 3B6CA 5TRDA 5EG0A 5DUKA 2E2HJ 5JLWA 1ZARA 1SANA 1EKEA 1WI3A 2E1NA 1B8IB 1FTZA 2LBFB 2AXLA 1VNDA 4YEJA 1A04A 3QPSA 3U1DA 3P9KA 3JRCA 3TKYA 1R00A 1P92A 2HQAA 3S17J 1SD4A 3IH3A 4K2EA 3Q0UA 3JAMZ 4RLQA 4BY1J 2L9NA 2PX9A 2IS6A 3MZHA 2ISYA 3I64A 2WAQN 1IG7A 1O4XA 3OS0A 3OSFA 3BTJA 3JSPA 4IX7A 2NRAC 1X3UA 4BJ6C 4D9JA 2D1VA 1V5GA 4I6ZA 1IAWA 2EIJH 2ESHA 4RAFA 5J1YA 3BR0A 3UKGA 4KA4A 4J00A 3EUHC 1V3FA 4A3FJ 3FXLA 3KP4A 4XBFA 2XAFA 4XMYA 4IEJA 3T5XA 3WODF 1UAAA 4MFDA 1HF0A 2VJIA 2V1NA 4PSXA 2HYFA 5C44J 4ON0A 2H8WA 2JPCA 3V8KA 5IYBJ 4QTRA 1ZR4A 3GTQJ 1VI0A 3ECHA 2IS2A 2P5KA 3HGYA 4GDFA 2Q1ZB 3ROUA 1MJ9A 2E35A 2Q8KA 3J80K 4H0EA 5E17F 3WTTC 1WSUA 2WB1N 1K83J 3M1CA 1FMVA 4S0HB 4BQNA 4IHYA 2MLGA 3NQOA 2JA5J 1FPQA 4M73A 2VE9A 1SEUA 3FXRA 4BHPA 3KP3A 5FFZA 1C0WA 3CCRI 4MGRA 1Z6TA 4JX4A 4PGGA 1JKOC 5D6EA 2E2JJ 1T2KA 3W6KB 4IHTA 3OL4A 1U9NA 5J4YA 2HTSA 2RV8A 4CZCA 5LEKA 5DDGA 3VSLA 5IY5H 1GT0C 2ECBA 2DA3A 2GIZA 2QLZA 3GCMA 4ZYEA 2WY8Q 2MG4A 3KPHA 4E7LA 3ULQB 4CGZA 1JGSA 1G2HA 4GGGA 2HPIA 3LQQA 1MKMA 1W5TA 3FXUA 3S1RJ 4A3BJ 3ZPLA 1DUXC 1T0FC 3I71A 4HNVA 3S2DJ 2M30A 3DPUA 2E5NA 3KP7A 4M3FA 4C3IJ 2E60A 3CO6C 4AIJA 3H5AA 4FE4A 2X4HA 1FJLA 2HTJA 1HC8A 2Z16A 3A02A 3BZCA 2DMTA 3E7LA 2XDVA 1W7PD 3M8JA 1WJCA 4EVIA 3CJTB 3HC7A 1KGSA 1GXQA 2MC4A 2OF7A 1XGNA 4BHCA 4HLYA 1X2MA 1JT0A 3QU3A 2DT5A 2HWVA 2DPDA 4ZYGA 5BPDA 4A5NA 1MMGA 1HSJA 5DCMA 3CESA 4QSHA 1RC9A 3LA2A 4ZZLA 1JKRC 3V7SA 1YO5C 2FMYA 1MBJA 2DODA 1S29A 3HOSA 2HQRA 3ZN0A 5HS7A 3OYEA 2QEXI 2QUFA 2FD5A 4IHXA 2JA7J 3CJQB 1VQLI 3HZJA 3KE2A 5JHUA 3K7AJ 3A0BC 4XLFA 5TISC 2M1BA 5KAIC 2GWRA 2NAZA 4AVPA 4IO9F 1STZA 2IGNA 4WWCA 3OYFA 4PK4A 3RYRA 1G8XA 3BR3A 2V4JC 3RJPA 3RPQA 3M1EA 1MMDA 3DBRB 2HOEA 1FP1D 4CCLA 1W4MA 2ZNYA 4RAGA 2VQLA 1ZGAA 4RM2A 3TBIA 4CYCB 4CZZA 3WE2A 5D5VB 1EA3A 5EYRA 3K1NA 1GXPA 2OUMA 3HJEA 4NNJA 3KCCA 3S3MA 5E3OA 2P6SA 2K85A 2X9DA 1NH3A 2F5EA 1Q1HA 3KX2A 3R0JA 2KP6A 2OC6A 2JUGA 1IN8A 4F52A 3CCEI 4ZJZA 1SAXA 2HVRA 1AU7A 4XM3A 2R0QC 2ZO4A 1RIOH 3H3UA 3HHGA 4A93J 1ZYRF 3SZPA 3OOPA 3WTYC 1LEBA 5DS9A 4OIPF 1Y1VJ 2XF6A 2R7XA 3HTUA 2CSOA 5ICGA 4A3IJ 2VKVA 4WXDA 4A3DJ 1ETVA 1OYWA 1XSVA 3K6GA 4F91B 2VBZA 4EV0A 1RR7A 1Z1DA 1TWGJ 3CDIA 4XLNF 2JTVA 2ETHA 4FX0A 5LHHA 2X1EA 4YG2F 2QVOA 2QKMB 2CW0F 2ZBKA 5JVGF 1X1DA 4BEHB 1FOKA 4DZJA 3OYMA 3CJNA 3S15J 1VZ0A 2HS5A 4A5MA 1XG1A 2BYVE 3D5LA 1YYVA 2R7VA 3E6DA 1DPUA 1Z21A 5A2QZ 2X0LA 1X4PA 2L7KA 2WAFA 4UHTA 3A03A 4IQ4A 2DI3A 3IHUA 1J0RA 3QP6A 4HW0A 2B0LA 5D4RA 3L2RA 2H1LA 4L0YB 2K9MA 2VASA 4A6DA 4YFKF 4BU2A 1P2FA 4A3LJ 4UUSB 3OYGA 1OR7C 4A0XA 5D4SA 2VXZA 3I56I 1XCBA 1FSEA 2A6TA 2FU4A 3G1OA 3Q9SA 3OYCA 2XB0X 3LWFA 3I4NJ 4EGZA 1D8JA 5B3SH 5J1RA 2CU7A 2BW3A 4JBAA 5F1RA 5BPIA 3HDDA 2W84A 2QSFX 4MO7A 1X2NA 4I7HA 1R6RA 5EEAA 2VOOA 2WV0A 2QA4I 3D5RC 1ZRFA 2BE5F 3VB2A 1KU9A 4G9YA 2CQNA 3KYDB 3ZQLA 3G6EI 3CF2A 4MFEA 3SHFA 2LREA 3BP8A 4RDUA 4L9TA 4CXFA 3TOAA 1VFCA 1Z6RA 3AAFA 2R5YB 1LDDA 4A0ZA 2AHQA 3Q0VA 2HOTA 1XGMA 1T98A 4EM0B 3G1LA 2NVUB 1IDZA 5GAEJ 4KYWA 3GMEA 4UNOA 2COMA 4XK4A 3RKXA 3ZP5A 4HA8A 1HW1A 1IN5A 1NHAA 1IN4A 2DMNA 2G9WA 2HXOA 3W3CA 4D7NA 3ONQA 5D5UB 1O7LA 4M3BA 1BI1A 4OIOF 4TV7A 4G6QA 1Y8QB 2LMDA 1EJ9A 1LNWA 1U5TB 2VONA 3SZTA 5LLQA 4RS8A 2XGDA 4PFOA 5EJCA 3A4CA 1W7PA 1I39A 3JW4A 1HBXG 3PSFA 2M87A 2L0KA 4DYRA 1V5EA 2DFEA 3HG9A 1XC5A 4KISA 3ABUA 2CUZA 3WTZA 2HZTA 2H09A 2CWEA 1WJDA 3LMMA 2CW7A 2R5ZA 3A01B 1RETA 4BHBA 1SD5A 2F6CA 5FD6A 5ILUA 3ECOA 3B73A 4FISA 4A3GJ 2M4KA 4P55A 3OMYA 3G2BA 4MTEA 4CH7A 2ZMEC 3FK7A 3MEXA 1POGA 4E4HA 1WFXA 1FIAA 3F6VA 2XGCA 1ZK8A 2XGXA 4M71A 4Q48A 1S72I 2HDDA 1QU3A 2R7ZJ 1D5VA 3WG7H 2L02A 2EFNA 3M9AA 1A5JA 4Y3OA 2XAGA 3GFIA 4UVCA 1UCRA 2GXAA 3OYLA 4M6YA 3HOZJ 2EFWA 2M3AA 2KRHA 3HOVJ 3FHNA 2R93J 2H1KA 2R7UA 1G3TA 2K5CA 3L00A 4AU7A 3J81Z 4XRSG 2OTJI 2RQPA 2QBYB 3MD2A 3PO3J 3OYAA 1RKWA 5EZHA 3CMEI 2XPVA 1FY7A 2L9RA 3H36A 3K69A 4Y52J 4WF2A 3MFKA 5LGNA 1IV6A 4XR6A 4L9JA 1RESA 2KIMA 3IRRA 2KKOA 2DMQA 3WTUC 4XLEA 4XORA 3AG3H 1FOWA 4M72A 4HX8A 3FBIB 2B9SA 3NWTA 4G7HF 1AKHA 1TWCJ 2E36A 3H92A 2O9LA 2ELHA 1EH6A 3DEWA 3SFZA 1WJ5A 4BJTA 4C2UA 4U0VA 1KQ9A 4C30A 3J7AY 2HKOA 3REOA 4QIWN 3H1CA 4X6AJ 3CUQB 1TWHJ 5M5XJ 1QZYA 4DOZA 3OSGA 4XIDA 2LDUA 1N77A 2K9NA 3A0HC 1MBGA 1I3AA 1MBKA 2H94A 3D5SC 3W2AA 3ABTA 1YOVB 2HR3A 4ZC3A 1H8AC 4IOAF 3DCFA 2AS5F 2UWMA 3L2WA 5GTIC 5KK1A 2PJRB 2XB5A 4FTHA 2RQQA 3HUGB 4EMSA 3LNQA 4A3JJ 1WJBA 2UXXA 3HOYJ 3ZMZA 3MWMA 1YJNI 3LA7A 4XSXF 2X1CA 3ZQQA 3LSGA 3C1DA 2VBXA 4HNUA 3B02A 1DP3A 2XKOA 5DD4A 1VQ6I 2EZIA 5L3EA 4WXHA 4W97A 1B9NA 2V7FA 5LRSA 4D0PA 5L3BA 2CJJA 5CPRB 5BMZA 4GO1A 4XLAA 3F8NA 4CCNA 3VYUB 4U0YA 3FIWA 2CQKA 1GVJA 2MSYA 3HOTA 4HDUA 2DOEA 2FSWA 4G12A 1IJWC 2Y0SA 3IC7A 4YIRX 2Q0OA 2Y9YA 2O8XA 2I10A 3C2BA 1WQ2A 4PFPA 4WX9A 2PMZA 4LB6B 2DMPA 3DEEA 3FXOA 2H27A 3F8MA 2F4MB 2L2OA 9ANTA 1ZG3A 1H9GA 1DGRM 2JJ7A 1UHMA 4LFUA 5IP9J 5JI6A 1E3OC 1TQMA 1Z7LA 2E71A 2ISZA 1K78A 2Y0MA 3WTXC 3TEDA 1D1AA 2FNPA 2LKSA 1R36A 4IHVA 1D1CA 1LE8A 2BBYA 2IA2A 3T8RA 2GXGA 5K5OA 4XN0A 1IN7A 5GADJ 5JR3A 2WA0A 3IV5A 2IT0A 2VKHA 3JRBA 1UJ8A 5F64A 5GPAA 2CV0A 4R79A 2CQ7A 4F7ZA 2BHZA 1RUNA 3CDLA 5D6FA 2VL8A 3GXOA 1LQ1A 2CV1A 2DFFA 3JRIA 3MKYB 2A5WA 1G3WA 2Z5UA 5F6FA 1U2WA 5FGMA 1BW6A 1T33A 2ZKZA 5EGOB 3COAC 3OL3A 3LSMA 5E20A 4L9VA 4Y13A 1MJAA 2E1MB 1EH8A 1XB4A 3BQYA 5KHDA 5E79C 5LGUA 4RB1A 1R5HA 1PP7U 4IZZA 2M0MA 3DTIA 1IRGA 3S32A 1USSA 1TL8A 3CDHA 4CCJA 1BOBA 2VC0A 2ZMEA 2KL4A 4NQWA 4YFNF 2EV6A 2DDAA 4BBRJ 3CCLI 3KLNA 4DW6A 2JK3A 2O3FA 4HQEA 1J9IA 1W36C 3D0SA 5E1XA 4NHJA 1REPC 2NXNB 3VPRA 1WPKA 1YX3A 1YLFA 3MKLA 4OWRB 2WV1A 4E7HA 1BIBA 1V55H 2AQEA 4MEXF 2P7VB 2RGVA 4UB6C 3TO6A 4ZYDA 3PIOF 2DDBA 2X51A 3CCVI 3EUAA 2L54A 2W85A 2VJJA 4LLLA 2Z3YA 5HNFA 1K4SA 2V9KA 3RZOJ 2GAUA 3ZQFA 2YS9A 3FMSA 3I59B 5ILSA 3I4PA 3NAUA 4AIDA 1B8IA 2LVSA 1DPRA 1T6SA 3KFWX 5CJ9A 4Z2YA 2XAQA 5ED4A 2JWTA 5HODA 3M07A 3K70D 2N8GA 5AONA 4ANJA 3K0LA 4QWQA 3DV8A 3K4CA 4B44A 1XPXA 5DTDA 2GM4A 2CO5A 4A6EA 1ETQA 3GTLJ 2R7RA 3BQZA 2UZKA 3ASNH 2DQRA 1LEAA 3DXJF 2HEOA 3ZQGA 3PSIA 1ZTRA 3CCSI 1JTXA 1BI3A 1ORKA 1D3YA 2ECCA 1ZG1A 5FLMJ 1FYLA 5J8FA 3K10A 4HOBA 4P96A 4MIMA 2NOJB 2VOPA 1UZCA 1ETOA 5HLTA 1HDPA 1WH5A 2I8DA 2A68F 3DF8A 3WTSC 5IT9K 1R1TA 1K6YA 4BDZA 3TL4X 2DLLA 2VLAA 1TP4A 4BY7J 1WGXA 3IWFA 4E7KA 3FWEA 2PJPA 1CF7A 2Q2EB 3OR1C 3FDYA 2EFPA 2K3PA 1FMWA 4EJUA 4S05A 1KYZA 3CCJI 1MSEC 2J5PA 5J4VA 2MD0A 3VEPA 1XSXA 4IRGA 4LK1F 1BA5A 2KIQA 3K1MA 3W2VA 3M7GA 3GWZA 1GV2A 5B66C 4W1UA 5FB2A 1XGSA 1Z67A 3LAPA 2CW8A 2JT1A 3VYSB 3AFHA 4RGRA 4BQAA 3JREA 3AL0C 3U21A 2VBWA 3QAHA 1FZPB 1KU3A 1B59A 1P9QC 4B47A 3P9CA 4CA0A 1MMAA 4KNYA 1G3SA 3QQAA 2O5RA 1VQNI 3ZQHA 3BR6A 1IC8A 1AWCA 4GYIA 4EJOA 2F5DA 2D2WA 3ABMH 4IQJA 3E6BA 3Q0WA 4HEA2 2XVCA 3M3YJ 3S3NA 4HV5A 5CVVA 3EETA 4XLCA 1U3EM 4EJWA 2F48A 5GAHJ 2QYOA 3OIOA 5E3MA 3CC2I 4XOTA 1ERDA 4HG2A 2K27A 3ZMSA 1U5TC 1V54H 1RI7A 1HXDA 2DCEA 2E7XA 4ENJA 1SAUA 2L9SA 2K9QA 4J01A 4BXXJ 1IXSB 4GYGA 5EG0B 1HOMA 4YFXF 1UFMA 3EYYA 4M74A 3ESWB 1PDNC 2KDOA 2BOLA 1H88C 3RIRA 2HI3A 5IYCJ 3DEUA 5FKLA 4E7SA 4L18B 5ICCA 2NNNA 4P9FA 3BY6A 2LYCA 2JVGA 1IXCA 3KEQA 3LQRA 3H9QA 5LEJA 5DCFA 3KETA 3OYIA 4BDYA 2GXBA 3DTEA 5J8CA 4UUTA 4BL0B 2WTEA 4AM3A 4ENMA 4MNUA 2GLOA 3OYJA 4HV6A 3R61A 4C3JJ 4D5CA 2ZSHB 2XPWA 2QF7A 1MW7A 3O6BB 1OPCA 2WWYA 1X19A 4O6JA 3TW6A 3M8EA 2MFZA 5HLHA 1JUSA 2Y48A 2JN6A 5K5RA 1NTCA 3BPVA 2V1DA 3RKWA 2EWNA 2W25A 4B3XA 1JUPA 4YIFA 3N97A 3CLQA 1O3RA 2F2EA 2CRGA 2W82A 4CYCA 2TCTA 5IT9Z 1QVUA 2B7EA 4ENKA 1JHFA 3I5UA 1SFKA 2LG4A 3RQIA 4QLCU 3L1PA 1IGNA 2LC2A 4HQMA 5L3CA 3CO7C 4IVNA 4CCMA 2JQ7A 1PUFA 2GBYA 1FBSA 4XONA 3I55I 2M5WA 4FHTA 3TP0A 1K6OA 4E7JA 2YR2A 3ZQCA 3SXYA 3PFYA 1RUOA 1FP2A 5ILVA 2L7MP
chains in the Genus database with same CATH topology
2CV2A 2DT6A 3CJRB 3NWSA 3W3CA 3ONQA 3I9V2 3VYRB 3I3LA 2HDWA 3VDXA 4BE0A 1WJEA 2ZFUA 4N4OB 2W00A 4PFOA 4U87A 3S8PA 3A4CA 4AVZA 2F4IA 3L2VA 2ELJA 3PSFA 1E0EA 3HXLA 3OS2A 1G59A 2KRCA 3OR2C 1V5EA 4CSWA 3MKZA 1U0JA 3HG9A 4RLFA 1Y6IA 4KISA 2CUZA 2KLOA 4Y33A 4HSTA 1X1AA 1WJDA 3LMMA 2CW7A 5KNLA 2JVHA 3ZXSA 4HNTA 4KITB 2F6CA 4PJLA 1AA7A 4LIVA 2LY2A 4PJNA 2M4KA 3BG7A 3CP2A 3OMYA 3G2BA 5CQGA 3OOUA 5KCMA 3OY9A 4CH7A 4DJAA 4E4HA 4BXFA 4KJZA 1WFXA 3N05A 3BCBA 4LIUA 4NUBA 4BE1A 1QU3A 5TGTA 3E0JB 2L5QA 4Y3OA 3OYLA 2IS1A 3HKZA 3A2KA 2M3AA 3SZGA 2KRHA 1T95A 2LY1A 3FHNA 5FRMA 1X4OA 2M7AA 2R7UA 2M4GA 4E7ZA 2K5CA 4AU7A 3KEYA 1LFPA 4C2TA 3ZCOA 3MD2A 2P0WA 1OLTA 4CUGA 1HA8A 3OYAA 4P5OA 2R7TA 1W36D 4JQFA 3LSHA 4H4KC 3ZGKA 2XSJC 1QHHD 1YE9A 2KHMA 2XF5A 3OYBA 3RQ4A 4XR6A 1GLNA 4BACA 2WBMA 3SYTA 4YRVA 3QYFA 2XC7A 3PNYA 1MMNA 4BE2A 4XLEA 4XORA 4ZTJA 3OIQA 3H9JA 3FBIB 4LG3A 3NWTA 3S93A 4RM3A 2IXSA 4QPOA 2GOMA 2IGMA 4BJTA 1WJ5A 4ZYAA 4C9YA 4C2UA 2CS3A 3LSKA 5HNHA 3OYKA 2KZVA 4C30A 3J7AY 3OIPA 3BG6A 4IKFA 4Y4RA 2JSPA 3SEZA 1ZELA 3L2QA 2KQRA 4DOZA 4U7BA 2Z1DA 3LFUA 4PUSA 4II3A 4ZDPA 1N77A 2BVLA 3H5RA 1JI8A 3D5SC 3RSNA 3W2AA 2WY7Q 1NG6A 3QYBA 4ZC3A 2GOXB 3AL0B 2LOOA 3LSIA 1UG0A 4CCKA 4HPQA 2UWMA 2E1MC 2VIXA 4YELA 3L2WA 1BR4A 1YX5A 3W2WA 1LKXA 4CCOA 2PJRB 3MKWB 4LITA 2UUZA 2RQQA 3HUGB 2E5ZA 2R7OA 1WJBA 2R4GA 4DBQA 3H9GA 3DTKA 3PJRA 3UR3C 2X1CA 3ZQQA 3LSGA 4F55A 4FASD 3PL8A 2DOAA 4HNUA 3IAM2 3HPGA 2HNHA 3K4JA 1WJAA 2DT7B 3FKJA 1DP3A 3MMYB 3HPHA 2V7FA 3K4BA 3BCAA 4E7IA 4XN3A 4ZTFA 5CPRB 3E1SA 2X85A 4XLAA 2IGKA 4CCNA 1N75A 3QODA 3VYUB 3PUBA 2X1DA 4F3QA 2W4SA 3HOTA 3IAS2 5JHFA 2ZXHA 3OWTA 1X1BA 2Y0SA 4F93B 4PFPA 4BEHA 2PMZA 2LBFB 4YEJA 3QOEA 1D0XA 2HQAA 3DEEA 1J09A 2L2OA 4ZDLA 2R7QA 4KT6A 1DGRM 1D0ZA 3GBGA 3F9KA 4RLQA 1Z7LA 1BR1A 2L9NA 2WAQA 2IS6A 2UV1A 4NC7A 1D1AA 1D1CA 1S9HA 3OS0A 4IX7A 2CUJA 4BJ6C 4XN0A 4D9JA 5LD2C 1Z3XA 2WA0A 2VKHA 3DU5A 1PJRA 1V5GA 4BS9A 2CV0A 4R79A 3BC8A 4DGWB 3OS1A 1UELB 4J00A 2VL8A 4E6KG 3EUHC 4XQFA 2CV1A 1DQUA 4PJMA 2HVQA 3MKYB 2A5WA 4XMYA 1UAAA 2VJIA 2V1NA 4PSXA 2HZDA 3IP4B 3OL3A 3LSMA 3RTRA 4OAYA 2VJ5A 2ZSIB 3PNVA 2E1MB 3HL2A 4BUPA 5KHDA 2IS2A 4IZZA 2M0MA 3DTIA 3S32A 2Q1ZB 1TT0A 4NC8A 4CCJA 1BOBA 2WB1A 3OYDA 3A1YA 2KL4A 3QYEA 2WADA 3RCOA 3M1CA 1FMVA 2DJIA 4BQNA 2W1OA 2HU9A 4XLHA 4JOMA 1W36C 3DPLC 2FUG2 4F92B 4RMNA 3CMMA 1YX3A 4OWRB 4E7HA 2AQEA 3OL4A 4MLOA 4B43A 4DIQA 4CZCA 2X51A 2V26A 3EUAA 3VSLA 2QKLB 2VJJA 5HNFA 3DPTA 2WY8Q 1D1BA 3DU6A 3OYNA 4E7LA 2AQFA 2V9KA 1NG7A 2VJ4A 2HPIA 3L2UA 4DBRA 4XKWA 1T0FC 3C2GA 3C2HA 3DPUA 2E5NA 2E60A 3S3OA 3H5AA 3K70D 4ANJA 2Z16A 5CKTA 3K4CA 4B44A 5HOOA 2XDVA 2LRDA 3M8JA 2VQCA 2R7RA 1WJCA 1LVKA 3VSKA 3CP8A 4HSRA 4XKCA 3HC7A 2X6XA 4XOPA 2M7BA 2MC4A 4B48A 3PSIA 2HPMA 3K4NA 4X0GA 1PYVA 1MMGA 3CESA 3K10A 2IS4A 2NOJB 5HLTA 2I8DA 3HOSA 4PSWA 3OYEA 3LL7A 3CJQB 5FROA 2V6EA 3DWLE 1K6YA 4BDZA 3TL4X 2VLAA 4XLFA 3H5NA 4E7KA 3VWBA 4AYBA 2W7NA 2IGNA 3OYFA 2KMUA 4PK4A 1G8XA 4P1WA 2Q2EB 4BQQA 2V4JC 3OR1C 1WJFA 3DLAA 2K3PA 1FMWA 3FDYA 2VXDA 4OAZA 2MYSA 2MD0A 2BW3B 1MMDA 3VYTB 4XL9A 4CCLA 1V5FA 2VQLA 2RNGA 1N78A 4RM2A 3TBIA 2VB6A 5CQEA 3W2VA 1EA3A 2VQGA 2X6WA 2OUMA 4NNJA 1Z3YA 3S3MA 3EUKL 2CW8A 5LFAA 1TZLA 4PJJA 3VYSB 3AFHA 2KPMA 3AL0C 2CH0A 3K4KA 3U21A 3KX2A 3V42A 2KP6A 2OC6A 2JUGA 1P9QC 4F52A 4B47A 4CA0A 1MMAA 4ZJZA 2VKDA 2HVRA 2XAUA 4BQOA 2O5RA 1Y56A 4XM3A 4IQJA 3K4MA 4HEA2 4EATA 2XF6A 2R7XA 3S3NA 2X6YA 2K9LA 4XLCA 3K6GA 2JA2A 4F91B 3CZ6A 2OV7A 4XOTA 2HVSA 1ERDA 4HG2A 4QPQA 2MABA 3OYHA 5HVQC 2PJRA 3PNTA 3IUOA 2X1EA 2DCEA 2CFOA 1SAUA 2L9SA 4FETA 4J01A 2QKMB 4ITVA 3SDBA 1QHGA 4G6TB 2KDOA 3KYLA 1X1DA 3FBNB 2BOLA 4BEHB 3UNGC 3OYMA 1VZ0A 1BR2A 3D5LA 4HRIA 4BJ5C 2R7VA 1Z21A 4BGDA 1X4PA 2L7KA 2WAFA 1MNDA 2VQHA 4IQ4A 4E7SA 5FRNA 3H0DA 3L2RA 2K9MA 2VASA 2LYCA 2JVGA 4GRIA 4BU2A 3DQVC 3H9QA 4BDYA 3OYIA 1D0YA 3OYGA 1OR7C 1DGWY 1KONA 2VXZA 3DTEA 4BL0B 2R7WA 2A6TA 3OYJA 2LH9A 3OYCA 1IRXA 3K4LA 2ZSHB 2LBFA 1MW7A 1X19A 2WAEA 3TMOA 2MFZA 2BVMA 4XNFA 2XF7A 2BW3A 3ZR8X 4B3XA 3BLYA 1X1CA 2W82A 1R6RA 4II2A 2VPLA 4N4NB 3D5RC 1SFKA 2CMPA 2LG4A 3SEQA 3AKZA 2R7SA 4D1QA 2LC2A 3CF2A 4ZDOA 2LREA 1LDKB 2F5VA 4CCMA 3K70C 2RREA 4XONA 4XKVA 2Z2SB 2DXIA 3EPZA 2IGOA 3RPUD 4NQWB 3H35A 4XKBA 3DKXA 4E7JA 1MNEA 2ZXIA 3ZRGA 3PFYA 3DKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BL0 B; 
#chains in the Genus database with same CATH topology
 2JRM A;  3FM3 A;  1FNN A;  2FX0 A;  1YJ9 I;  3CJR B;  5GTH C;  3TQN A;  2LLK A;  2IA0 A;  3HOU J;  3I3L A;  1I6X A;  1FYM A;  1VQ8 I;  3VDX A;  2PMH A;  4BE0 A;  3CC4 I;  4N0B A;  1MH4 A;  1HKT A;  2V9P A;  4N4O B;  3HOX J;  4RBO A;  2CQX A;  5EEH A;  4AVZ A;  3CUQ C;  1KA8 A;  2DBB A;  2DPU A;  1MBH A;  2DTR A;  4IXA A;  3HXL A;  1G59 A;  1F4K A;  1NK3 P;  2HQN A;  2XAH A;  4ETS A;  3NRV A;  5M3F J;  3Q5F A;  4XRM A;  1ZKG A;  1S7O A;  2ADU A;  1RZ4 A;  2KLO A;  3KYC B;  4NC6 A;  4OMY A;  3R60 A;  1X1A A;  4M3D A;  2JVH A;  4ESJ A;  2JMW A;  4HNT A;  4AIK A;  3PUF A;  1AA7 A;  3L09 A;  4PJN A;  3CP2 A;  2L4A A;  3ERM A;  5CQG A;  5J40 A;  1KU2 A;  5BS6 A;  3J80 Z;  3FXK A;  1SVO A;  3QPT A;  3E5X A;  3OY9 A;  4DJA A;  1FSH A;  4KIF A;  2ZB9 A;  4KJZ A;  2KIU A;  3N05 A;  2LK2 A;  4U0W A;  1FIP A;  2HOS A;  3S16 J;  4BE1 A;  2BGC A;  1H9T A;  5L3F A;  2M0C A;  5TGT A;  3E0J B;  4DYQ A;  5E3L A;  2XRO A;  1BC8 C;  3HOW J;  4IOC F;  4N9I A;  4HAM A;  3F23 A;  4IL6 C;  2CGP A;  5DCM B;  2GA1 A;  3HKZ A;  2LY1 A;  4KFC A;  4MQ9 F;  2EZL A;  3KEY A;  4EGY A;  4XSZ F;  1ON1 A;  4P5O A;  4EJT A;  1ETY A;  1B72 A;  5FD5 A;  2R7T A;  3ZGK A;  1QA6 A;  3QRF F;  5FLX K;  1VQ5 I;  4GFB A;  3RQ4 A;  1GLN A;  3EUH A;  1PP8 F;  4XLP F;  4BAC A;  3H3V K;  3CMY A;  3B6A A;  4BE2 A;  1MMN A;  2EZK A;  3BG3 A;  1BI0 A;  4NBQ A;  3JSO A;  2MLK A;  3OIQ A;  3H9J A;  1I1S A;  2BXZ A;  2TRT A;  2OZU A;  5CVJ A;  2GOM A;  2BZT A;  2EIN H;  2QQA A;  4C9Y A;  3LSK A;  5FKK A;  3OYK A;  2KZV A;  2ME0 A;  2QEN A;  3BR5 A;  5C3E J;  1MBE A;  3OIP A;  1T8I A;  2YUS A;  3BG9 A;  3GZ5 A;  1WHU A;  1ZEL A;  2RVC A;  3L2Q A;  1SMY F;  5M3M J;  1U78 A;  2M34 A;  2VN2 A;  1MBF A;  1TWA J;  3SQN A;  4AUX A;  1O57 A;  3LFU A;  4II3 A;  4BYY A;  3H5R A;  5CVR A;  1L0O C;  1IV8 A;  2K86 A;  3AL0 B;  3LSI A;  1UG0 A;  4HPQ A;  3HM5 A;  1GDT A;  2E1M C;  2VIX A;  4OU0 A;  2CG4 A;  1H89 C;  3GTG J;  3BPX A;  4UV8 A;  1UMQ A;  2E5Z A;  2EIM H;  3I4M J;  2QQ8 A;  2KFD A;  3Q3S A;  1TQI A;  3PJR A;  1R5G A;  1UHW A;  1MH3 A;  1YS7 A;  2LY9 A;  3K9T A;  2DA7 A;  3IAM 2;  4U7D A;  2DT7 B;  1F5T A;  1T0F A;  4HF1 A;  1HDD C;  1IUY A;  3HPH A;  2F5F A;  5ICF A;  3KLO A;  1E3H A;  4E7I A;  3CQZ J;  3F8C A;  2ZJ2 A;  4LJZ F;  3DP7 A;  1XS9 A;  3S2H J;  1RNL A;  4LG0 A;  2X1D A;  5JHF A;  2ZXH A;  2YU3 A;  3JTH A;  3I0T A;  2V79 A;  3OWT A;  3QP5 A;  1LB2 A;  1ZRE A;  1GHC A;  1JHH A;  3HBL A;  3RDI A;  2Y0S N;  2DK5 A;  4LGW A;  4F93 B;  1MDM B;  4IRI A;  4HZF A;  2O03 A;  2PMZ N;  1K7A A;  4I98 B;  5HLI A;  1YIT I;  2E7W A;  1D0X A;  4KT5 C;  2HQ5 A;  3C3W A;  1B1B A;  2R7Q A;  3WE3 A;  4KT6 A;  3JRG A;  2VT3 A;  3BR2 A;  5F27 A;  2HOA A;  4NC7 A;  3MQ0 A;  2AO9 A;  1JUM A;  3CCM I;  1LUJ B;  5EF6 A;  5C4J J;  1K4T A;  5E1Z B;  1FYK A;  1M1E B;  3H0G J;  5FO5 A;  1ZQ3 P;  2MH9 A;  3FXJ A;  4IPA A;  3GO5 A;  2W24 A;  1A6I A;  3DU5 A;  1YRN A;  3BC8 A;  4DGW B;  3OS1 A;  1UEL B;  3TOB A;  2B63 J;  1WVR A;  3GFJ A;  4E6K G;  2FJ1 A;  2C6Y A;  4DQ2 A;  1O3Q A;  2NOG A;  3GF2 A;  1YS6 A;  2OJE D;  2E1O A;  3WTW C;  3ZN1 A;  3RTR A;  4OAY A;  5BQT A;  2FQ3 A;  2ZSI B;  3PNV A;  2EJR A;  2L9V A;  1R9T J;  5JLX A;  5B1A H;  2Y2Z A;  1WWX A;  2ZFW A;  2RC4 A;  1QPM A;  3GLX A;  2I5U A;  3ABK H;  2V6C A;  5CYV A;  2K9S A;  1TT0 A;  1HST A;  1W7P B;  4NC8 A;  3DFG A;  2YSR A;  3LST A;  3A1Y A;  3OYD A;  3Q9V A;  3ZQI A;  3HUG A;  3GYH X;  1SVM A;  2W1O A;  2HU9 A;  4XLH A;  3BJA A;  1TNS A;  3U1K A;  2OTL I;  3W6V A;  3JCU C;  4UUV A;  2L3D A;  3BZK A;  5D5W B;  2R5Z B;  4RMN A;  2VOD A;  5JFR A;  4A12 A;  3LA3 A;  3HSR A;  4HLX A;  4MLO A;  3KZZ A;  1LJ9 A;  4B43 A;  2V26 A;  1YW8 A;  4O5V A;  1TQP A;  2H8R A;  3N4M A;  2DMU A;  1D1B A;  2HDC A;  1NG7 A;  2L7F P;  1SVL A;  1VQM I;  1DU0 A;  2A61 A;  1FBU A;  1P4X A;  2R7F A;  2YU9 J;  4XKW A;  3J7Z I;  1R1U A;  2FBK A;  3C2G A;  2IRF G;  3MZ8 A;  3C2H A;  2HKX A;  3PFI A;  3I54 A;  2PEX A;  2D1H A;  3S3O A;  1FWZ A;  4KIC A;  4AC0 A;  1HCR A;  2DYR H;  1R22 A;  5CKT A;  1OKR A;  3S2W A;  3FIS A;  2K40 A;  4JK1 X;  4V2G A;  1OR7 A;  3L2C A;  2LRD A;  2EV0 A;  1RR8 C;  2VQC A;  2CUF A;  1JKQ C;  1LVK A;  3VSK A;  3CP8 A;  4XKC A;  5D5X B;  2X6X A;  3V7R A;  1FT9 A;  3BR1 A;  3LSJ A;  2M7B A;  4BXU A;  4AIH A;  2IW5 A;  1IF1 A;  3K4N A;  2LSO A;  3DKW A;  3HSE A;  3EYI A;  5K1Y A;  4X0G A;  1Q1V A;  4GCV A;  2IS4 A;  3HHH A;  2LP0 A;  4ASN A;  1ZRC A;  1BN5 A;  2K02 A;  4WCG A;  2QM3 A;  3LL7 A;  2XIG A;  4U88 A;  5FRO A;  3WGH A;  2V6E A;  4KDP A;  5JVT A;  1AKH B;  5H6R A;  4G6D A;  2P7C B;  2XV4 S;  2XAS A;  4L5J A;  2PN6 A;  3VWB A;  3GW2 A;  4AYB A;  1FOY A;  3E6M A;  2R7D A;  4KN4 X;  3T0Y A;  1SC7 A;  3JR9 A;  1WJF A;  1QBJ A;  3JRF A;  2VXD A;  2DJN A;  4OAZ A;  2MYS A;  3C7J A;  2NS7 A;  1BJA A;  1TT5 B;  5ERI A;  4G7Z F;  1V5F A;  1WKM A;  2MGQ A;  2BEO A;  2NNY A;  4R1H A;  5CQE A;  3JTG A;  4KN7 X;  1MIJ A;  2ZNZ A;  3S1M J;  2X6W A;  2IEK A;  3BWG A;  2FQ4 A;  2BY1 A;  1QNT A;  4HX4 A;  1J75 A;  1CGP A;  5LFA A;  1TZL A;  4L5E A;  5FKN A;  2CH0 A;  2DA4 A;  4BAY A;  1PVE A;  2H6C A;  5E1W A;  5D8K B;  2XUB A;  4ESB A;  2V9V A;  2PFB A;  2DA1 A;  2QWW A;  2VKD A;  3BJ6 A;  2BY2 A;  2QQB A;  1Y56 A;  4M9S A;  4PZJ A;  2MD5 A;  3K4M A;  5LGT A;  3PO2 J;  1ETK A;  1R5I D;  1ZH5 A;  3DLL F;  1S6L A;  4I02 A;  1XD7 A;  3SJM A;  2X6Y A;  1TWF J;  2PQ8 A;  3CZ6 A;  2HVS A;  3FXM A;  1QO0 D;  2A6H F;  2MAB A;  5J6X A;  1I6H J;  1E3P A;  2RN7 A;  4R8H A;  3PNT A;  4M6V A;  5L3D A;  1R1V A;  1ZGJ A;  4I01 A;  4FET A;  1LDJ A;  2KJB A;  4HBL A;  3FM5 A;  1ETW A;  3SDB A;  5LRR A;  3ASO H;  4G6T B;  4UVA A;  4LK0 F;  3GTK J;  4HDV A;  4LLG F;  4JP0 A;  4BJ5 C;  2ACJ A;  5DUI A;  4M9X A;  2DOF A;  5IP7 J;  4Y17 A;  2KDZ A;  1MND A;  1X58 A;  1JGG A;  2OBP A;  2DAO A;  4M3G A;  2EIL H;  5F08 A;  1CQT A;  3GEZ A;  1K78 B;  4NDL A;  4GRI A;  5K7Z A;  3M8F A;  3DQV C;  2IBD A;  1LVA A;  1XDS A;  1LE8 B;  1EF4 A;  1D0Y A;  2PMU A;  1DGW Y;  2KZG A;  1KON A;  3HSF A;  4L9N A;  3GZ6 A;  2A69 F;  3CF5 F;  3V8J A;  3HRS A;  2R7W A;  1YFH A;  5HDN A;  2P4W A;  2HXI A;  2LBF A;  1U8R A;  2LNB A;  5KVR A;  5FFX A;  3TO7 A;  4G7O F;  3ZR8 X;  1I5Z A;  1MZB A;  3BLY A;  2FOK A;  5DYM A;  1WZ2 A;  1TLH B;  2E19 A;  3HGG A;  4II2 A;  1OCR H;  1YIO A;  2JUC A;  6PAX A;  2L7Z A;  2CMP A;  2ZC2 A;  4B09 A;  2P81 A;  1ZLK A;  3AKZ A;  3HB9 A;  2VPR A;  1V4R A;  4D1Q A;  1ZAO A;  1YHQ I;  1VQK I;  2PLY A;  2BHY A;  1S7E A;  2F5V A;  1OYI A;  2QGU A;  3K70 C;  1IDY A;  4PCQ A;  4XKV A;  2Z2S B;  4CYD A;  3EPZ A;  1R49 A;  4LD5 A;  4KIG A;  4NQW B;  4XKB A;  1FC3 A;  1XTA A;  2ZXI A;  3QWL A;  3ZRG A;  1OCP A;  3HRU A;  2EA2 A;  3DKY A;  5K7H A;  1MJB A;  3NWS A;  1XMX A;  4ZH4 F;  3PM1 A;  3EDP A;  3MVP A;  3I9V 2;  4GXO A;  3GZN B;  5E18 F;  3QU6 A;  2HDW A;  2IA1 A;  1WJE A;  4BNC A;  1BL0 A;  2W00 A;  3GTO J;  1ITY A;  1S3J A;  4U87 A;  3BJO A;  3S8P A;  2F4I A;  2Y75 A;  1FX7 A;  3FF5 A;  4HYE A;  2JA6 J;  1FTT A;  4FX4 A;  1E17 A;  2NVQ J;  2PBI A;  4EJV A;  1E0E A;  2XSD C;  4PGH A;  2P6T A;  1J7K A;  2QZ8 A;  3WTV C;  2KIF A;  4CSW A;  4PDK A;  5EZG A;  1Y6I A;  2X48 A;  2IPQ X;  4HST A;  1HKS A;  3BT9 A;  3CMA I;  4G94 A;  5EEG A;  5KNL A;  3ZXS A;  3F8F A;  4KIT B;  2EFQ A;  3MAJ A;  3RPU A;  5HDK A;  4LIV A;  2LY2 A;  1IRZ A;  2ME6 A;  3BG7 A;  1LFU P;  3ZMT A;  5KCM A;  4EQQ A;  1TTY A;  3S1Q J;  2OPT A;  2VC1 A;  4P9U A;  1SD6 A;  3BCB A;  3MN2 A;  4NUB A;  1XSD A;  2VE8 A;  1VQ9 I;  1MD0 A;  4Y15 A;  5J3L A;  2HYJ A;  1S5L C;  1TW3 A;  4A3E J;  4LMY A;  4BH9 A;  5FKM A;  2UXN A;  1T95 A;  3VOE A;  3HKZ N;  3GTJ J;  5FRM A;  2L01 A;  3BDD A;  1X4O A;  2M7A A;  3O3K A;  4JX6 A;  3R4K A;  3V8L A;  3SDG A;  1LFP A;  3KZY A;  1XCV A;  4IRH A;  4JX5 A;  2P0W A;  3GFL A;  4CUG A;  1I3Q J;  5TJJ A;  5BOX A;  1HA8 A;  2OCE A;  1B4A A;  3QOP A;  1CF7 B;  1ENH A;  2DU9 A;  3QPH A;  4B8X A;  1JTY A;  4JQF A;  3RYP A;  5AIQ A;  4H4K C;  3J7A O;  1P6R A;  4Q4Z F;  4RAZ A;  2QSH X;  5LHI A;  3M4O J;  2DA5 A;  2XF5 A;  2DO7 A;  3OYB A;  3U2R A;  3LSR A;  1F9N A;  3SYT A;  5IPA A;  3AG1 H;  2Y9Z A;  4YRV A;  2XC7 A;  3PNY A;  4KMF A;  4RB0 A;  2IJL A;  1ZR2 A;  4ZTJ A;  1X1P A;  2YX7 A;  4LG3 A;  4RM3 A;  3RKY A;  4KMU X;  2STT A;  1U8B A;  2QQ9 A;  3P7N A;  4ZYA A;  1Y1W J;  2CS3 A;  5HNH A;  4L0Z B;  3BG6 A;  4IKF A;  3FMR A;  4Y4R A;  1E2X A;  5F04 A;  5D8L B;  4U7B A;  1JJ6 C;  1IZ1 A;  4ZDP A;  3MZY A;  2FA5 A;  3F3X A;  3HYI A;  2LTP A;  2E2I J;  3E3V A;  1A6Q A;  2ICW G;  4V2F A;  2F5C A;  3BRO A;  1NG6 A;  1Z9C A;  1A31 A;  1BIA A;  3E6C C;  3V4G A;  2ZJP F;  4CCK A;  1J59 A;  2M8E A;  2ZXW H;  1BM9 A;  2YX4 A;  5A2Q K;  2VUM J;  3TW7 A;  2A05 A;  1LKX A;  4CCO A;  3MKW B;  4LIT A;  2EQR A;  2UUZ A;  1Z7U A;  5F0C A;  2F4O B;  4X1E A;  2E34 A;  2OZ6 A;  2R4G A;  4DBQ A;  3H9G A;  1TBX A;  2Z9O A;  2BV6 A;  3UR3 C;  4FAS D;  4WK8 F;  4C2M J;  2HNH A;  3K4J A;  3TP3 A;  4A2U A;  1IRF A;  3P5J A;  4DZP A;  5CVI A;  4Y7N J;  1R23 A;  3K4B A;  2VBY A;  4XN3 A;  2DK8 A;  4ZTF A;  4OIN F;  3E1S A;  3TDZ C;  1SD7 A;  1GV5 A;  1APL C;  4O3M A;  3LFK A;  3GTP J;  4M6X A;  3PUB A;  3KIO A;  2D5V A;  1TNT A;  2FNA A;  2W4S A;  3IAS 2;  3ELK A;  3WHB A;  2MC3 A;  1X1B A;  5E8G A;  1AOY A;  4RB2 C;  1WRJ A;  3U9G A;  2ZJQ F;  1JXS A;  4BEH A;  2X6O A;  1YJW I;  2RAE A;  3K2A A;  2VI6 A;  3TO9 A;  2FOW A;  3QOE A;  5AIP A;  1MNM C;  1J09 A;  4ZDL A;  3G71 I;  2OQG A;  1D0Z A;  3GBG A;  3F9K A;  4DYC A;  5LHG A;  1BR1 A;  2DQL A;  2EA4 A;  2WAQ A;  2XKP A;  4FT8 A;  2UV1 A;  2P8T A;  1SFE A;  4M3E A;  1S9H A;  3WU0 A;  4UUS A;  3CUO A;  4UV9 A;  2CUJ A;  1O7F A;  2DA6 A;  2ZCW A;  4I0B A;  2IP2 A;  1NK2 P;  5LD2 C;  3X2Q H;  1Z3X A;  3D1N I;  1PJR A;  1DDN A;  3FK6 A;  4BS9 A;  1UHS A;  1G6N A;  2RNJ A;  2NVY J;  5FKO A;  1ON2 A;  2RDP A;  1PUF B;  1IXR C;  4RGS A;  2LKX A;  5K7F A;  4XQF A;  1QPI A;  3IH2 A;  1DQU A;  4PJM A;  1VTN C;  1BC7 C;  2HVQ A;  2TDX A;  3L9F A;  3H3Z A;  5BNG A;  3CTA A;  1TC3 C;  1OQY A;  1DU6 A;  2HZD A;  3IP4 B;  3RKQ A;  3J7Y J;  4D7M A;  2VJ5 A;  3CD6 I;  2DFH A;  5FLV A;  3L7W A;  3KP6 A;  3GX4 X;  3HL2 A;  3V7C A;  4BUP A;  1U9O A;  2FBI A;  2YPR A;  1BBY A;  2FBH A;  1ZN2 A;  1U6G A;  4XIC A;  4A69 C;  2R5Y A;  5LBQ A;  4ESF A;  1BW5 A;  2WB1 A;  2DTZ A;  3GLL A;  1YI2 I;  2KT0 A;  3QYE A;  2WAD A;  3RCO A;  3GTM J;  4I0A A;  2DJI A;  2ID3 A;  2BXY A;  1WH7 A;  4OIR F;  2FML A;  5DV5 A;  2JRT A;  4JOM A;  3DPL C;  2FUG 2;  3S14 J;  2EFO A;  4F92 B;  4Q5S F;  1HLV A;  3CMM A;  1P4A A;  2KJC A;  2JZY A;  3E5Q A;  1OCC H;  2GA2 A;  5EDN A;  1JKP C;  2EZH A;  1U5T A;  2GZW A;  2O7O A;  4DIQ A;  1PUE E;  3I53 A;  1P7J A;  3HIF A;  4G8X A;  1OIS A;  4E70 A;  1HKQ A;  3BTC A;  2OD5 A;  2QKL B;  3J81 K;  3DPT A;  3DU6 A;  3OYN A;  3GVA A;  2AQF A;  1GVD A;  2NS8 A;  3VFZ A;  1A36 A;  2VJ4 A;  3L2U A;  4DBR A;  2LF7 A;  4I09 A;  3F72 A;  3WU2 C;  3QPL A;  1MDM A;  3HRT A;  2Y30 A;  3A01 A;  1OFC X;  2G0E A;  1F36 A;  1BJZ A;  3DBL B;  2Y69 H;  2H6B A;  1VQO I;  5H20 A;  5IT3 A;  3RI4 A;  3AG4 H;  1ZLJ A;  5HOO A;  1QVT A;  1B6A A;  3HEF A;  3NAR A;  1T56 A;  1EH7 A;  4AWX B;  4HSR A;  3R0A A;  4XOP A;  1B72 B;  3ZMU A;  5IP6 A;  4B48 A;  2KRF A;  5E8I A;  1EV7 A;  4OMZ A;  1JE8 A;  3F0C A;  2HPM A;  1ZHF A;  1W5C C;  1ODD A;  1P7I A;  3T8T A;  2IAI A;  3FHZ A;  1D8K A;  1PYV A;  3F22 A;  3IRQ A;  3ZMV A;  4EEF G;  1LFB A;  2R3S A;  4WXC A;  5F0H A;  3WGI A;  5B1B H;  1OJL A;  4PSW A;  5H2F C;  1W0U A;  1RKT A;  2ZXJ A;  3DWL E;  4A0Y A;  2W48 A;  4JYK A;  2QBY A;  4LLN A;  3OV8 A;  4MHG A;  3H5N A;  2W7N A;  2A6E F;  3S1N J;  1D5Y A;  4AYB N;  2KMU A;  3ERE D;  4IF4 A;  4B4C A;  4P1W A;  4BQQ A;  1QQI A;  2WC2 A;  3DLA A;  4FQG A;  2FXA A;  1YW7 A;  2BW3 B;  2DN0 A;  2L4M A;  3VYT B;  4XL9 A;  1K79 A;  1QGP A;  1YW9 A;  2A3S A;  2RNG A;  4A3M J;  1N78 A;  2VB6 A;  2EK5 A;  3LOC A;  2VQG A;  2EB7 A;  4HF0 A;  2GIV A;  1Z3Y A;  2HFH A;  3KZI C;  5FJ8 J;  4B1R A;  1MGT A;  3EUK L;  1FOX A;  4PJJ A;  2KPM A;  5FLX Z;  3ZOB A;  3K4K A;  2KIS A;  3JRA A;  1RRJ A;  3V42 A;  1XDU A;  4I99 C;  3R6S A;  2JPB A;  3CUQ A;  3CC7 I;  2Z99 A;  5C4X J;  2D45 A;  2XAU A;  4BQO A;  5HLG A;  4V19 K;  4MEY F;  3O8G A;  2ELK A;  1LPQ A;  2AXT C;  1YG2 A;  4BKX A;  1Y0N A;  3E5U A;  3K2Z A;  4EAT A;  1KQ0 A;  2DYS H;  4A3K J;  3C18 A;  2CUE A;  1VQ7 I;  1QRY A;  2K9L A;  1MSF C;  2JA2 A;  2OV7 A;  2O0Y A;  4FE7 A;  1G4D A;  2CFX A;  4QPQ A;  1IW7 F;  3OYH A;  3KP2 A;  3DBH B;  3PQK A;  5HVQ C;  2PJR A;  2STW A;  3IUO A;  4ABZ A;  3O2P E;  2CFO A;  4LG0 B;  2FE3 A;  4ITV A;  3KP5 A;  1QHG A;  2ID6 A;  3KYL A;  3JRH A;  3FBN B;  4UVB A;  5KAF C;  2IVM A;  3UNG C;  1IN6 A;  2OAZ A;  4I2O A;  1FBQ A;  3CCY A;  2R92 J;  2PG4 A;  2OCC H;  2P5L C;  1BR2 A;  1J5Y A;  2FF4 A;  4HRI A;  4BBS J;  4BGD A;  1G3Y A;  2DW4 A;  2VQH A;  1Y0U A;  5FRN A;  2M45 A;  3P9I A;  3H0D A;  2LD5 A;  1X3W B;  3BZ6 A;  1R7J A;  1VQ4 I;  1JT6 A;  1B9M A;  1Y39 A;  1HW2 A;  1VF9 A;  3GFM A;  1ULY A;  2A5Y B;  2EIK H;  2V1U A;  1Z77 A;  1UB9 A;  5L3G A;  4CDG A;  1IO2 A;  4RB3 C;  2LH9 A;  1IUF A;  1IRX A;  3K4L A;  3K1P A;  1YRN B;  3AG2 H;  2K7L A;  2O8K A;  3WGG A;  2GQQ A;  2WAE A;  3TMO A;  1S8N A;  2BVM A;  2M9H A;  2RKH A;  4XNF A;  2DFI A;  2XF7 A;  3IWZ A;  3F21 A;  3ISP A;  1SMT A;  3T1B A;  1X1C A;  2VPL A;  3BTI A;  1ONV A;  2ESN A;  4N4N B;  5IOY A;  1FLI A;  4PJ0 C;  3VOD A;  2ZJR F;  1UG2 A;  3SEQ A;  1K61 A;  2R7S A;  3LSP A;  2J5O A;  4UY8 I;  4XRS A;  4ZDO A;  5GP9 A;  1LDK B;  5CLS A;  2M8G X;  2RRE A;  4L5I A;  5M5W J;  1SFO J;  5DEQ A;  2NYX A;  1O3S A;  3CLO A;  2DXI A;  4S04 A;  3RPU D;  2IGO A;  2XAJ A;  1SFU A;  3H35 A;  1L3L A;  3DKX A;  1A35 A;  3O8H A;  1MNE A;  4RAY A;  2JSC A;  2CQQ A;  2V1X A;  2DA2 A;  2PI0 A;  2CV2 A;  2DT6 A;  2EH3 A;  2OU2 A;  5EGO A;  1YTY A;  4DNC A;  3BTL A;  3G73 A;  3VYR B;  5GAG J;  3ABL H;  4RA2 A;  1N25 A;  2ZFU A;  3G4S I;  2P5V A;  1XMK A;  4OIQ F;  3KEO A;  3PQJ A;  1UST A;  3WU1 B;  3CCU I;  3FMQ A;  5F1J A;  3L2V A;  4CIC A;  2LKP A;  2ELJ A;  5B5E C;  3OS2 A;  2KRC A;  3OR2 C;  1F1Z A;  1I50 J;  3MKZ A;  4UXN A;  1U0J A;  4RLF A;  2NS0 A;  1XGO A;  1ETX A;  4Y33 A;  2LF8 A;  2E1C A;  4UB8 C;  4XRF A;  4N9H A;  2EBI A;  5ICE A;  1P4W A;  1OCT C;  5IYD J;  4PJL A;  3ZMD A;  1J2X A;  1R4N B;  2G7H A;  5E3N A;  1R71 A;  1XMA A;  4J19 A;  3OOU A;  1F43 A;  1Z91 A;  1ACI A;  1I27 A;  4BXF A;  4IJA A;  2G7U A;  3MCZ A;  1S7A A;  1Z05 A;  4LIU A;  3G1M A;  4A3C J;  3RZD J;  4NB5 A;  3TDU C;  1X3Z B;  2L5Q A;  2MW8 A;  3I59 A;  3LAJ A;  1T08 B;  2M2E A;  3BG5 A;  4ENN A;  2MBF A;  3E97 A;  2IS1 A;  1ZGW A;  3WHC A;  3A2K A;  3F8B A;  3SZG A;  1O3T A;  2XGE A;  3IH4 A;  2M4G A;  4M9Z A;  4E7Z A;  1Z0X A;  2W57 A;  3JAM K;  1R58 A;  2OA4 A;  2XHK A;  5DM6 F;  4C2T A;  3ZCO A;  1OLT A;  1XN7 A;  4RGX A;  4RGU A;  3SFI A;  4EM2 A;  1T39 A;  1W36 D;  2QCO A;  4CO8 A;  3LSH A;  1Y8R B;  3FKI J;  2XSJ C;  2BY3 A;  1QHH D;  1YE9 A;  1HQC A;  2KHM A;  4YII A;  2O61 A;  3HRM A;  3I58 A;  4B3A A;  4MQV A;  1ZG5 A;  2FEZ A;  2WBM A;  1KYW A;  1KQ8 A;  2NVX J;  3QYF A;  4OOI A;  1BOA A;  3CCQ I;  1JJ8 C;  3IKV A;  3IKT A;  3F6O A;  5M5Y J;  4ZYH A;  5J47 A;  3S93 A;  2O6G E;  2IXS A;  4QPO A;  3FX3 A;  5DM7 F;  2HGC A;  2OQR A;  1FEX A;  1H0M A;  1XX5 A;  2MA3 A;  4LB5 A;  2IGM A;  3FXQ A;  5IOZ A;  3HTS B;  4Q47 A;  2Q2E A;  3GUD A;  4AD9 A;  3PIP F;  2JSP A;  2HYG D;  3SEZ A;  2JA8 J;  4ZZD A;  2KQR A;  1I1G A;  2Y31 A;  2Z1D A;  2K4B A;  1W1W E;  2LR8 A;  2XRN A;  2VT2 A;  2K4J A;  4PUS A;  1AHD P;  2BVL A;  4D5F A;  1W5S A;  4HF2 A;  1R4M B;  1MMS A;  3ML6 A;  5K5Q A;  1JI8 A;  3ZQ7 A;  4Z6Y A;  2EV5 A;  3RSN A;  2WY7 Q;  1T38 A;  1VQP I;  5HS8 A;  2QSG X;  4IHS A;  3QYB A;  2GOX B;  1TW2 A;  2COB A;  1DP7 P;  1GUU A;  2LOO A;  2EPF A;  4KUM A;  1WI9 A;  2LFB A;  3W6J B;  1HW5 A;  2K3F A;  3NEU A;  4C3H J;  2A07 F;  1OCZ H;  2CYY A;  2VKE A;  4YEL A;  3TGN A;  2Z33 A;  4LOC A;  1BR4 A;  1YX5 A;  4IHW A;  5GPC A;  4KIB A;  3W2W A;  4MTD A;  4I76 A;  2ZME B;  3BOQ A;  3WG9 A;  5F0F A;  1YIJ I;  1KZH A;  2R7O A;  5H6Q A;  4CHU A;  1KU7 A;  4FCY A;  3DTK A;  1W0T A;  2XRL A;  3G3Z A;  4HX7 A;  2NVT J;  4F55 A;  3PL8 A;  2DOA A;  5HDG A;  1YQA A;  1SFX A;  1QZE A;  2XPU A;  3HPG A;  1RPW A;  1WCM J;  1WJA A;  3FKJ A;  3MMY B;  1QZZ A;  2BY0 A;  1OYY A;  3BCA A;  3EQL F;  5J1U A;  5CVU A;  1OCO H;  5HS9 A;  2X85 A;  3FZV A;  2IGK A;  3IL2 A;  1ZRD A;  1BI2 A;  5DD8 A;  1N75 A;  3QOD A;  3JRD A;  4F3Q A;  1OMI A;  2FRH A;  4EM1 A;  2MH2 A;  3B6C A;  5TRD A;  5EG0 A;  5DUK A;  2E2H J;  5JLW A;  1ZAR A;  1SAN A;  1EKE A;  1WI3 A;  2E1N A;  1B8I B;  1FTZ A;  2LBF B;  2AXL A;  1VND A;  4YEJ A;  1A04 A;  3QPS A;  3U1D A;  3P9K A;  3JRC A;  3TKY A;  1R00 A;  1P92 A;  2HQA A;  3S17 J;  1SD4 A;  3IH3 A;  4K2E A;  3Q0U A;  3JAM Z;  4RLQ A;  4BY1 J;  2L9N A;  2PX9 A;  2IS6 A;  3MZH A;  2ISY A;  3I64 A;  2WAQ N;  1IG7 A;  1O4X A;  3OS0 A;  3OSF A;  3BTJ A;  3JSP A;  4IX7 A;  2NRA C;  1X3U A;  4BJ6 C;  4D9J A;  2D1V A;  1V5G A;  4I6Z A;  1IAW A;  2EIJ H;  2ESH A;  4RAF A;  5J1Y A;  3BR0 A;  3UKG A;  4KA4 A;  4J00 A;  3EUH C;  1V3F A;  4A3F J;  3FXL A;  3KP4 A;  4XBF A;  2XAF A;  4XMY A;  4IEJ A;  3T5X A;  3WOD F;  1UAA A;  4MFD A;  1HF0 A;  2VJI A;  2V1N A;  4PSX A;  2HYF A;  5C44 J;  4ON0 A;  2H8W A;  2JPC A;  3V8K A;  5IYB J;  4QTR A;  1ZR4 A;  3GTQ J;  1VI0 A;  3ECH A;  2IS2 A;  2P5K A;  3HGY A;  4GDF A;  2Q1Z B;  3ROU A;  1MJ9 A;  2E35 A;  2Q8K A;  3J80 K;  4H0E A;  5E17 F;  3WTT C;  1WSU A;  2WB1 N;  1K83 J;  3M1C A;  1FMV A;  4S0H B;  4BQN A;  4IHY A;  2MLG A;  3NQO A;  2JA5 J;  1FPQ A;  4M73 A;  2VE9 A;  1SEU A;  3FXR A;  4BHP A;  3KP3 A;  5FFZ A;  1C0W A;  3CCR I;  4MGR A;  1Z6T A;  4JX4 A;  4PGG A;  1JKO C;  5D6E A;  2E2J J;  1T2K A;  3W6K B;  4IHT A;  3OL4 A;  1U9N A;  5J4Y A;  2HTS A;  2RV8 A;  4CZC A;  5LEK A;  5DDG A;  3VSL A;  5IY5 H;  1GT0 C;  2ECB A;  2DA3 A;  2GIZ A;  2QLZ A;  3GCM A;  4ZYE A;  2WY8 Q;  2MG4 A;  3KPH A;  4E7L A;  3ULQ B;  4CGZ A;  1JGS A;  1G2H A;  4GGG A;  2HPI A;  3LQQ A;  1MKM A;  1W5T A;  3FXU A;  3S1R J;  4A3B J;  3ZPL A;  1DUX C;  1T0F C;  3I71 A;  4HNV A;  3S2D J;  2M30 A;  3DPU A;  2E5N A;  3KP7 A;  4M3F A;  4C3I J;  2E60 A;  3CO6 C;  4AIJ A;  3H5A A;  4FE4 A;  2X4H A;  1FJL A;  2HTJ A;  1HC8 A;  2Z16 A;  3A02 A;  3BZC A;  2DMT A;  3E7L A;  2XDV A;  1W7P D;  3M8J A;  1WJC A;  4EVI A;  3CJT B;  3HC7 A;  1KGS A;  1GXQ A;  2MC4 A;  2OF7 A;  1XGN A;  4BHC A;  4HLY A;  1X2M A;  1JT0 A;  3QU3 A;  2DT5 A;  2HWV A;  2DPD A;  4ZYG A;  5BPD A;  4A5N A;  1MMG A;  1HSJ A;  5DCM A;  3CES A;  4QSH A;  1RC9 A;  3LA2 A;  4ZZL A;  1JKR C;  3V7S A;  1YO5 C;  2FMY A;  1MBJ A;  2DOD A;  1S29 A;  3HOS A;  2HQR A;  3ZN0 A;  5HS7 A;  3OYE A;  2QEX I;  2QUF A;  2FD5 A;  4IHX A;  2JA7 J;  3CJQ B;  1VQL I;  3HZJ A;  3KE2 A;  5JHU A;  3K7A J;  3A0B C;  4XLF A;  5TIS C;  2M1B A;  5KAI C;  2GWR A;  2NAZ A;  4AVP A;  4IO9 F;  1STZ A;  2IGN A;  4WWC A;  3OYF A;  4PK4 A;  3RYR A;  1G8X A;  3BR3 A;  2V4J C;  3RJP A;  3RPQ A;  3M1E A;  1MMD A;  3DBR B;  2HOE A;  1FP1 D;  4CCL A;  1W4M A;  2ZNY A;  4RAG A;  2VQL A;  1ZGA A;  4RM2 A;  3TBI A;  4CYC B;  4CZZ A;  3WE2 A;  5D5V B;  1EA3 A;  5EYR A;  3K1N A;  1GXP A;  2OUM A;  3HJE A;  4NNJ A;  3KCC A;  3S3M A;  5E3O A;  2P6S A;  2K85 A;  2X9D A;  1NH3 A;  2F5E A;  1Q1H A;  3KX2 A;  3R0J A;  2KP6 A;  2OC6 A;  2JUG A;  1IN8 A;  4F52 A;  3CCE I;  4ZJZ A;  1SAX A;  2HVR A;  1AU7 A;  4XM3 A;  2R0Q C;  2ZO4 A;  1RIO H;  3H3U A;  3HHG A;  4A93 J;  1ZYR F;  3SZP A;  3OOP A;  3WTY C;  1LEB A;  5DS9 A;  4OIP F;  1Y1V J;  2XF6 A;  2R7X A;  3HTU A;  2CSO A;  5ICG A;  4A3I J;  2VKV A;  4WXD A;  4A3D J;  1ETV A;  1OYW A;  1XSV A;  3K6G A;  4F91 B;  2VBZ A;  4EV0 A;  1RR7 A;  1Z1D A;  1TWG J;  3CDI A;  4XLN F;  2JTV A;  2ETH A;  4FX0 A;  5LHH A;  2X1E A;  4YG2 F;  2QVO A;  2QKM B;  2CW0 F;  2ZBK A;  5JVG F;  1X1D A;  4BEH B;  1FOK A;  4DZJ A;  3OYM A;  3CJN A;  3S15 J;  1VZ0 A;  2HS5 A;  4A5M A;  1XG1 A;  2BYV E;  3D5L A;  1YYV A;  2R7V A;  3E6D A;  1DPU A;  1Z21 A;  5A2Q Z;  2X0L A;  1X4P A;  2L7K A;  2WAF A;  4UHT A;  3A03 A;  4IQ4 A;  2DI3 A;  3IHU A;  1J0R A;  3QP6 A;  4HW0 A;  2B0L A;  5D4R A;  3L2R A;  2H1L A;  4L0Y B;  2K9M A;  2VAS A;  4A6D A;  4YFK F;  4BU2 A;  1P2F A;  4A3L J;  4UUS B;  3OYG A;  1OR7 C;  4A0X A;  5D4S A;  2VXZ A;  3I56 I;  1XCB A;  1FSE A;  2A6T A;  2FU4 A;  3G1O A;  3Q9S A;  3OYC A;  2XB0 X;  3LWF A;  3I4N J;  4EGZ A;  1D8J A;  5B3S H;  5J1R A;  2CU7 A;  2BW3 A;  4JBA A;  5F1R A;  5BPI A;  3HDD A;  2W84 A;  2QSF X;  4MO7 A;  1X2N A;  4I7H A;  1R6R A;  5EEA A;  2VOO A;  2WV0 A;  2QA4 I;  3D5R C;  1ZRF A;  2BE5 F;  3VB2 A;  1KU9 A;  4G9Y A;  2CQN A;  3KYD B;  3ZQL A;  3G6E I;  3CF2 A;  4MFE A;  3SHF A;  2LRE A;  3BP8 A;  4RDU A;  4L9T A;  4CXF A;  3TOA A;  1VFC A;  1Z6R A;  3AAF A;  2R5Y B;  1LDD A;  4A0Z A;  2AHQ A;  3Q0V A;  2HOT A;  1XGM A;  1T98 A;  4EM0 B;  3G1L A;  2NVU B;  1IDZ A;  5GAE J;  4KYW A;  3GME A;  4UNO A;  2COM A;  4XK4 A;  3RKX A;  3ZP5 A;  4HA8 A;  1HW1 A;  1IN5 A;  1NHA A;  1IN4 A;  2DMN A;  2G9W A;  2HXO A;  3W3C A;  4D7N A;  3ONQ A;  5D5U B;  1O7L A;  4M3B A;  1BI1 A;  4OIO F;  4TV7 A;  4G6Q A;  1Y8Q B;  2LMD A;  1EJ9 A;  1LNW A;  1U5T B;  2VON A;  3SZT A;  5LLQ A;  4RS8 A;  2XGD A;  4PFO A;  5EJC A;  3A4C A;  1W7P A;  1I39 A;  3JW4 A;  1HBX G;  3PSF A;  2M87 A;  2L0K A;  4DYR A;  1V5E A;  2DFE A;  3HG9 A;  1XC5 A;  4KIS A;  3ABU A;  2CUZ A;  3WTZ A;  2HZT A;  2H09 A;  2CWE A;  1WJD A;  3LMM A;  2CW7 A;  2R5Z A;  3A01 B;  1RET A;  4BHB A;  1SD5 A;  2F6C A;  5FD6 A;  5ILU A;  3ECO A;  3B73 A;  4FIS A;  4A3G J;  2M4K A;  4P55 A;  3OMY A;  3G2B A;  4MTE A;  4CH7 A;  2ZME C;  3FK7 A;  3MEX A;  1POG A;  4E4H A;  1WFX A;  1FIA A;  3F6V A;  2XGC A;  1ZK8 A;  2XGX A;  4M71 A;  4Q48 A;  1S72 I;  2HDD A;  1QU3 A;  2R7Z J;  1D5V A;  3WG7 H;  2L02 A;  2EFN A;  3M9A A;  1A5J A;  4Y3O A;  2XAG A;  3GFI A;  4UVC A;  1UCR A;  2GXA A;  3OYL A;  4M6Y A;  3HOZ J;  2EFW A;  2M3A A;  2KRH A;  3HOV J;  3FHN A;  2R93 J;  2H1K A;  2R7U A;  1G3T A;  2K5C A;  3L00 A;  4AU7 A;  3J81 Z;  4XRS G;  2OTJ I;  2RQP A;  2QBY B;  3MD2 A;  3PO3 J;  3OYA A;  1RKW A;  5EZH A;  3CME I;  2XPV A;  1FY7 A;  2L9R A;  3H36 A;  3K69 A;  4Y52 J;  4WF2 A;  3MFK A;  5LGN A;  1IV6 A;  4XR6 A;  4L9J A;  1RES A;  2KIM A;  3IRR A;  2KKO A;  2DMQ A;  3WTU C;  4XLE A;  4XOR A;  3AG3 H;  1FOW A;  4M72 A;  4HX8 A;  3FBI B;  2B9S A;  3NWT A;  4G7H F;  1AKH A;  1TWC J;  2E36 A;  3H92 A;  2O9L A;  2ELH A;  1EH6 A;  3DEW A;  3SFZ A;  1WJ5 A;  4BJT A;  4C2U A;  4U0V A;  1KQ9 A;  4C30 A;  3J7A Y;  2HKO A;  3REO A;  4QIW N;  3H1C A;  4X6A J;  3CUQ B;  1TWH J;  5M5X J;  1QZY A;  4DOZ A;  3OSG A;  4XID A;  2LDU A;  1N77 A;  2K9N A;  3A0H C;  1MBG A;  1I3A A;  1MBK A;  2H94 A;  3D5S C;  3W2A A;  3ABT A;  1YOV B;  2HR3 A;  4ZC3 A;  1H8A C;  4IOA F;  3DCF A;  2AS5 F;  2UWM A;  3L2W A;  5GTI C;  5KK1 A;  2PJR B;  2XB5 A;  4FTH A;  2RQQ A;  3HUG B;  4EMS A;  3LNQ A;  4A3J J;  1WJB A;  2UXX A;  3HOY J;  3ZMZ A;  3MWM A;  1YJN I;  3LA7 A;  4XSX F;  2X1C A;  3ZQQ A;  3LSG A;  3C1D A;  2VBX A;  4HNU A;  3B02 A;  1DP3 A;  2XKO A;  5DD4 A;  1VQ6 I;  2EZI A;  5L3E A;  4WXH A;  4W97 A;  1B9N A;  2V7F A;  5LRS A;  4D0P A;  5L3B A;  2CJJ A;  5CPR B;  5BMZ A;  4GO1 A;  4XLA A;  3F8N A;  4CCN A;  3VYU B;  4U0Y A;  3FIW A;  2CQK A;  1GVJ A;  2MSY A;  3HOT A;  4HDU A;  2DOE A;  2FSW A;  4G12 A;  1IJW C;  2Y0S A;  3IC7 A;  4YIR X;  2Q0O A;  2Y9Y A;  2O8X A;  2I10 A;  3C2B A;  1WQ2 A;  4PFP A;  4WX9 A;  2PMZ A;  4LB6 B;  2DMP A;  3DEE A;  3FXO A;  2H27 A;  3F8M A;  2F4M B;  2L2O A;  9ANT A;  1ZG3 A;  1H9G A;  1DGR M;  2JJ7 A;  1UHM A;  4LFU A;  5IP9 J;  5JI6 A;  1E3O C;  1TQM A;  1Z7L A;  2E71 A;  2ISZ A;  1K78 A;  2Y0M A;  3WTX C;  3TED A;  1D1A A;  2FNP A;  2LKS A;  1R36 A;  4IHV A;  1D1C A;  1LE8 A;  2BBY A;  2IA2 A;  3T8R A;  2GXG A;  5K5O A;  4XN0 A;  1IN7 A;  5GAD J;  5JR3 A;  2WA0 A;  3IV5 A;  2IT0 A;  2VKH A;  3JRB A;  1UJ8 A;  5F64 A;  5GPA A;  2CV0 A;  4R79 A;  2CQ7 A;  4F7Z A;  2BHZ A;  1RUN A;  3CDL A;  5D6F A;  2VL8 A;  3GXO A;  1LQ1 A;  2CV1 A;  2DFF A;  3JRI A;  3MKY B;  2A5W A;  1G3W A;  2Z5U A;  5F6F A;  1U2W A;  5FGM A;  1BW6 A;  1T33 A;  2ZKZ A;  5EGO B;  3COA C;  3OL3 A;  3LSM A;  5E20 A;  4L9V A;  4Y13 A;  1MJA A;  2E1M B;  1EH8 A;  1XB4 A;  3BQY A;  5KHD A;  5E79 C;  5LGU A;  4RB1 A;  1R5H A;  1PP7 U;  4IZZ A;  2M0M A;  3DTI A;  1IRG A;  3S32 A;  1USS A;  1TL8 A;  3CDH A;  4CCJ A;  1BOB A;  2VC0 A;  2ZME A;  2KL4 A;  4NQW A;  4YFN F;  2EV6 A;  2DDA A;  4BBR J;  3CCL I;  3KLN A;  4DW6 A;  2JK3 A;  2O3F A;  4HQE A;  1J9I A;  1W36 C;  3D0S A;  5E1X A;  4NHJ A;  1REP C;  2NXN B;  3VPR A;  1WPK A;  1YX3 A;  1YLF A;  3MKL A;  4OWR B;  2WV1 A;  4E7H A;  1BIB A;  1V55 H;  2AQE A;  4MEX F;  2P7V B;  2RGV A;  4UB6 C;  3TO6 A;  4ZYD A;  3PIO F;  2DDB A;  2X51 A;  3CCV I;  3EUA A;  2L54 A;  2W85 A;  2VJJ A;  4LLL A;  2Z3Y A;  5HNF A;  1K4S A;  2V9K A;  3RZO J;  2GAU A;  3ZQF A;  2YS9 A;  3FMS A;  3I59 B;  5ILS A;  3I4P A;  3NAU A;  4AID A;  1B8I A;  2LVS A;  1DPR A;  1T6S A;  3KFW X;  5CJ9 A;  4Z2Y A;  2XAQ A;  5ED4 A;  2JWT A;  5HOD A;  3M07 A;  3K70 D;  2N8G A;  5AON A;  4ANJ A;  3K0L A;  4QWQ A;  3DV8 A;  3K4C A;  4B44 A;  1XPX A;  5DTD A;  2GM4 A;  2CO5 A;  4A6E A;  1ETQ A;  3GTL J;  2R7R A;  3BQZ A;  2UZK A;  3ASN H;  2DQR A;  1LEA A;  3DXJ F;  2HEO A;  3ZQG A;  3PSI A;  1ZTR A;  3CCS I;  1JTX A;  1BI3 A;  1ORK A;  1D3Y A;  2ECC A;  1ZG1 A;  5FLM J;  1FYL A;  5J8F A;  3K10 A;  4HOB A;  4P96 A;  4MIM A;  2NOJ B;  2VOP A;  1UZC A;  1ETO A;  5HLT A;  1HDP A;  1WH5 A;  2I8D A;  2A68 F;  3DF8 A;  3WTS C;  5IT9 K;  1R1T A;  1K6Y A;  4BDZ A;  3TL4 X;  2DLL A;  2VLA A;  1TP4 A;  4BY7 J;  1WGX A;  3IWF A;  4E7K A;  3FWE A;  2PJP A;  1CF7 A;  2Q2E B;  3OR1 C;  3FDY A;  2EFP A;  2K3P A;  1FMW A;  4EJU A;  4S05 A;  1KYZ A;  3CCJ I;  1MSE C;  2J5P A;  5J4V A;  2MD0 A;  3VEP A;  1XSX A;  4IRG A;  4LK1 F;  1BA5 A;  2KIQ A;  3K1M A;  3W2V A;  3M7G A;  3GWZ A;  1GV2 A;  5B66 C;  4W1U A;  5FB2 A;  1XGS A;  1Z67 A;  3LAP A;  2CW8 A;  2JT1 A;  3VYS B;  3AFH A;  4RGR A;  4BQA A;  3JRE A;  3AL0 C;  3U21 A;  2VBW A;  3QAH A;  1FZP B;  1KU3 A;  1B59 A;  1P9Q C;  4B47 A;  3P9C A;  4CA0 A;  1MMA A;  4KNY A;  1G3S A;  3QQA A;  2O5R A;  1VQN I;  3ZQH A;  3BR6 A;  1IC8 A;  1AWC A;  4GYI A;  4EJO A;  2F5D A;  2D2W A;  3ABM H;  4IQJ A;  3E6B A;  3Q0W A;  4HEA 2;  2XVC A;  3M3Y J;  3S3N A;  4HV5 A;  5CVV A;  3EET A;  4XLC A;  1U3E M;  4EJW A;  2F48 A;  5GAH J;  2QYO A;  3OIO A;  5E3M A;  3CC2 I;  4XOT A;  1ERD A;  4HG2 A;  2K27 A;  3ZMS A;  1U5T C;  1V54 H;  1RI7 A;  1HXD A;  2DCE A;  2E7X A;  4ENJ A;  1SAU A;  2L9S A;  2K9Q A;  4J01 A;  4BXX J;  1IXS B;  4GYG A;  5EG0 B;  1HOM A;  4YFX F;  1UFM A;  3EYY A;  4M74 A;  3ESW B;  1PDN C;  2KDO A;  2BOL A;  1H88 C;  3RIR A;  2HI3 A;  5IYC J;  3DEU A;  5FKL A;  4E7S A;  4L18 B;  5ICC A;  2NNN A;  4P9F A;  3BY6 A;  2LYC A;  2JVG A;  1IXC A;  3KEQ A;  3LQR A;  3H9Q A;  5LEJ A;  5DCF A;  3KET A;  3OYI A;  4BDY A;  2GXB A;  3DTE A;  5J8C A;  4UUT A;  4BL0 B;  2WTE A;  4AM3 A;  4ENM A;  4MNU A;  2GLO A;  3OYJ A;  4HV6 A;  3R61 A;  4C3J J;  4D5C A;  2ZSH B;  2XPW A;  2QF7 A;  1MW7 A;  3O6B B;  1OPC A;  2WWY A;  1X19 A;  4O6J A;  3TW6 A;  3M8E A;  2MFZ A;  5HLH A;  1JUS A;  2Y48 A;  2JN6 A;  5K5R A;  1NTC A;  3BPV A;  2V1D A;  3RKW A;  2EWN A;  2W25 A;  4B3X A;  1JUP A;  4YIF A;  3N97 A;  3CLQ A;  1O3R A;  2F2E A;  2CRG A;  2W82 A;  4CYC A;  2TCT A;  5IT9 Z;  1QVU A;  2B7E A;  4ENK A;  1JHF A;  3I5U A;  1SFK A;  2LG4 A;  3RQI A;  4QLC U;  3L1P A;  1IGN A;  2LC2 A;  4HQM A;  5L3C A;  3CO7 C;  4IVN A;  4CCM A;  2JQ7 A;  1PUF A;  2GBY A;  1FBS A;  4XON A;  3I55 I;  2M5W A;  4FHT A;  3TP0 A;  1K6O A;  4E7J A;  2YR2 A;  3ZQC A;  3SXY A;  3PFY A;  1RUO A;  1FP2 A;  5ILV A;  2L7M P; 
#chains in the Genus database with same CATH homology
 2CV2 A;  2DT6 A;  3CJR B;  3NWS A;  3W3C A;  3ONQ A;  3I9V 2;  3VYR B;  3I3L A;  2HDW A;  3VDX A;  4BE0 A;  1WJE A;  2ZFU A;  4N4O B;  2W00 A;  4PFO A;  4U87 A;  3S8P A;  3A4C A;  4AVZ A;  2F4I A;  3L2V A;  2ELJ A;  3PSF A;  1E0E A;  3HXL A;  3OS2 A;  1G59 A;  2KRC A;  3OR2 C;  1V5E A;  4CSW A;  3MKZ A;  1U0J A;  3HG9 A;  4RLF A;  1Y6I A;  4KIS A;  2CUZ A;  2KLO A;  4Y33 A;  4HST A;  1X1A A;  1WJD A;  3LMM A;  2CW7 A;  5KNL A;  2JVH A;  3ZXS A;  4HNT A;  4KIT B;  2F6C A;  4PJL A;  1AA7 A;  4LIV A;  2LY2 A;  4PJN A;  2M4K A;  3BG7 A;  3CP2 A;  3OMY A;  3G2B A;  5CQG A;  3OOU A;  5KCM A;  3OY9 A;  4CH7 A;  4DJA A;  4E4H A;  4BXF A;  4KJZ A;  1WFX A;  3N05 A;  3BCB A;  4LIU A;  4NUB A;  4BE1 A;  1QU3 A;  5TGT A;  3E0J B;  2L5Q A;  4Y3O A;  3OYL A;  2IS1 A;  3HKZ A;  3A2K A;  2M3A A;  3SZG A;  2KRH A;  1T95 A;  2LY1 A;  3FHN A;  5FRM A;  1X4O A;  2M7A A;  2R7U A;  2M4G A;  4E7Z A;  2K5C A;  4AU7 A;  3KEY A;  1LFP A;  4C2T A;  3ZCO A;  3MD2 A;  2P0W A;  1OLT A;  4CUG A;  1HA8 A;  3OYA A;  4P5O A;  2R7T A;  1W36 D;  4JQF A;  3LSH A;  4H4K C;  3ZGK A;  2XSJ C;  1QHH D;  1YE9 A;  2KHM A;  2XF5 A;  3OYB A;  3RQ4 A;  4XR6 A;  1GLN A;  4BAC A;  2WBM A;  3SYT A;  4YRV A;  3QYF A;  2XC7 A;  3PNY A;  1MMN A;  4BE2 A;  4XLE A;  4XOR A;  4ZTJ A;  3OIQ A;  3H9J A;  3FBI B;  4LG3 A;  3NWT A;  3S93 A;  4RM3 A;  2IXS A;  4QPO A;  2GOM A;  2IGM A;  4BJT A;  1WJ5 A;  4ZYA A;  4C9Y A;  4C2U A;  2CS3 A;  3LSK A;  5HNH A;  3OYK A;  2KZV A;  4C30 A;  3J7A Y;  3OIP A;  3BG6 A;  4IKF A;  4Y4R A;  2JSP A;  3SEZ A;  1ZEL A;  3L2Q A;  2KQR A;  4DOZ A;  4U7B A;  2Z1D A;  3LFU A;  4PUS A;  4II3 A;  4ZDP A;  1N77 A;  2BVL A;  3H5R A;  1JI8 A;  3D5S C;  3RSN A;  3W2A A;  2WY7 Q;  1NG6 A;  3QYB A;  4ZC3 A;  2GOX B;  3AL0 B;  2LOO A;  3LSI A;  1UG0 A;  4CCK A;  4HPQ A;  2UWM A;  2E1M C;  2VIX A;  4YEL A;  3L2W A;  1BR4 A;  1YX5 A;  3W2W A;  1LKX A;  4CCO A;  2PJR B;  3MKW B;  4LIT A;  2UUZ A;  2RQQ A;  3HUG B;  2E5Z A;  2R7O A;  1WJB A;  2R4G A;  4DBQ A;  3H9G A;  3DTK A;  3PJR A;  3UR3 C;  2X1C A;  3ZQQ A;  3LSG A;  4F55 A;  4FAS D;  3PL8 A;  2DOA A;  4HNU A;  3IAM 2;  3HPG A;  2HNH A;  3K4J A;  1WJA A;  2DT7 B;  3FKJ A;  1DP3 A;  3MMY B;  3HPH A;  2V7F A;  3K4B A;  3BCA A;  4E7I A;  4XN3 A;  4ZTF A;  5CPR B;  3E1S A;  2X85 A;  4XLA A;  2IGK A;  4CCN A;  1N75 A;  3QOD A;  3VYU B;  3PUB A;  2X1D A;  4F3Q A;  2W4S A;  3HOT A;  3IAS 2;  5JHF A;  2ZXH A;  3OWT A;  1X1B A;  2Y0S A;  4F93 B;  4PFP A;  4BEH A;  2PMZ A;  2LBF B;  4YEJ A;  3QOE A;  1D0X A;  2HQA A;  3DEE A;  1J09 A;  2L2O A;  4ZDL A;  2R7Q A;  4KT6 A;  1DGR M;  1D0Z A;  3GBG A;  3F9K A;  4RLQ A;  1Z7L A;  1BR1 A;  2L9N A;  2WAQ A;  2IS6 A;  2UV1 A;  4NC7 A;  1D1A A;  1D1C A;  1S9H A;  3OS0 A;  4IX7 A;  2CUJ A;  4BJ6 C;  4XN0 A;  4D9J A;  5LD2 C;  1Z3X A;  2WA0 A;  2VKH A;  3DU5 A;  1PJR A;  1V5G A;  4BS9 A;  2CV0 A;  4R79 A;  3BC8 A;  4DGW B;  3OS1 A;  1UEL B;  4J00 A;  2VL8 A;  4E6K G;  3EUH C;  4XQF A;  2CV1 A;  1DQU A;  4PJM A;  2HVQ A;  3MKY B;  2A5W A;  4XMY A;  1UAA A;  2VJI A;  2V1N A;  4PSX A;  2HZD A;  3IP4 B;  3OL3 A;  3LSM A;  3RTR A;  4OAY A;  2VJ5 A;  2ZSI B;  3PNV A;  2E1M B;  3HL2 A;  4BUP A;  5KHD A;  2IS2 A;  4IZZ A;  2M0M A;  3DTI A;  3S32 A;  2Q1Z B;  1TT0 A;  4NC8 A;  4CCJ A;  1BOB A;  2WB1 A;  3OYD A;  3A1Y A;  2KL4 A;  3QYE A;  2WAD A;  3RCO A;  3M1C A;  1FMV A;  2DJI A;  4BQN A;  2W1O A;  2HU9 A;  4XLH A;  4JOM A;  1W36 C;  3DPL C;  2FUG 2;  4F92 B;  4RMN A;  3CMM A;  1YX3 A;  4OWR B;  4E7H A;  2AQE A;  3OL4 A;  4MLO A;  4B43 A;  4DIQ A;  4CZC A;  2X51 A;  2V26 A;  3EUA A;  3VSL A;  2QKL B;  2VJJ A;  5HNF A;  3DPT A;  2WY8 Q;  1D1B A;  3DU6 A;  3OYN A;  4E7L A;  2AQF A;  2V9K A;  1NG7 A;  2VJ4 A;  2HPI A;  3L2U A;  4DBR A;  4XKW A;  1T0F C;  3C2G A;  3C2H A;  3DPU A;  2E5N A;  2E60 A;  3S3O A;  3H5A A;  3K70 D;  4ANJ A;  2Z16 A;  5CKT A;  3K4C A;  4B44 A;  5HOO A;  2XDV A;  2LRD A;  3M8J A;  2VQC A;  2R7R A;  1WJC A;  1LVK A;  3VSK A;  3CP8 A;  4HSR A;  4XKC A;  3HC7 A;  2X6X A;  4XOP A;  2M7B A;  2MC4 A;  4B48 A;  3PSI A;  2HPM A;  3K4N A;  4X0G A;  1PYV A;  1MMG A;  3CES A;  3K10 A;  2IS4 A;  2NOJ B;  5HLT A;  2I8D A;  3HOS A;  4PSW A;  3OYE A;  3LL7 A;  3CJQ B;  5FRO A;  2V6E A;  3DWL E;  1K6Y A;  4BDZ A;  3TL4 X;  2VLA A;  4XLF A;  3H5N A;  4E7K A;  3VWB A;  4AYB A;  2W7N A;  2IGN A;  3OYF A;  2KMU A;  4PK4 A;  1G8X A;  4P1W A;  2Q2E B;  4BQQ A;  2V4J C;  3OR1 C;  1WJF A;  3DLA A;  2K3P A;  1FMW A;  3FDY A;  2VXD A;  4OAZ A;  2MYS A;  2MD0 A;  2BW3 B;  1MMD A;  3VYT B;  4XL9 A;  4CCL A;  1V5F A;  2VQL A;  2RNG A;  1N78 A;  4RM2 A;  3TBI A;  2VB6 A;  5CQE A;  3W2V A;  1EA3 A;  2VQG A;  2X6W A;  2OUM A;  4NNJ A;  1Z3Y A;  3S3M A;  3EUK L;  2CW8 A;  5LFA A;  1TZL A;  4PJJ A;  3VYS B;  3AFH A;  2KPM A;  3AL0 C;  2CH0 A;  3K4K A;  3U21 A;  3KX2 A;  3V42 A;  2KP6 A;  2OC6 A;  2JUG A;  1P9Q C;  4F52 A;  4B47 A;  4CA0 A;  1MMA A;  4ZJZ A;  2VKD A;  2HVR A;  2XAU A;  4BQO A;  2O5R A;  1Y56 A;  4XM3 A;  4IQJ A;  3K4M A;  4HEA 2;  4EAT A;  2XF6 A;  2R7X A;  3S3N A;  2X6Y A;  2K9L A;  4XLC A;  3K6G A;  2JA2 A;  4F91 B;  3CZ6 A;  2OV7 A;  4XOT A;  2HVS A;  1ERD A;  4HG2 A;  4QPQ A;  2MAB A;  3OYH A;  5HVQ C;  2PJR A;  3PNT A;  3IUO A;  2X1E A;  2DCE A;  2CFO A;  1SAU A;  2L9S A;  4FET A;  4J01 A;  2QKM B;  4ITV A;  3SDB A;  1QHG A;  4G6T B;  2KDO A;  3KYL A;  1X1D A;  3FBN B;  2BOL A;  4BEH B;  3UNG C;  3OYM A;  1VZ0 A;  1BR2 A;  3D5L A;  4HRI A;  4BJ5 C;  2R7V A;  1Z21 A;  4BGD A;  1X4P A;  2L7K A;  2WAF A;  1MND A;  2VQH A;  4IQ4 A;  4E7S A;  5FRN A;  3H0D A;  3L2R A;  2K9M A;  2VAS A;  2LYC A;  2JVG A;  4GRI A;  4BU2 A;  3DQV C;  3H9Q A;  4BDY A;  3OYI A;  1D0Y A;  3OYG A;  1OR7 C;  1DGW Y;  1KON A;  2VXZ A;  3DTE A;  4BL0 B;  2R7W A;  2A6T A;  3OYJ A;  2LH9 A;  3OYC A;  1IRX A;  3K4L A;  2ZSH B;  2LBF A;  1MW7 A;  1X19 A;  2WAE A;  3TMO A;  2MFZ A;  2BVM A;  4XNF A;  2XF7 A;  2BW3 A;  3ZR8 X;  4B3X A;  3BLY A;  1X1C A;  2W82 A;  1R6R A;  4II2 A;  2VPL A;  4N4N B;  3D5R C;  1SFK A;  2CMP A;  2LG4 A;  3SEQ A;  3AKZ A;  2R7S A;  4D1Q A;  2LC2 A;  3CF2 A;  4ZDO A;  2LRE A;  1LDK B;  2F5V A;  4CCM A;  3K70 C;  2RRE A;  4XON A;  4XKV A;  2Z2S B;  2DXI A;  3EPZ A;  2IGO A;  3RPU D;  4NQW B;  3H35 A;  4XKB A;  3DKX A;  4E7J A;  1MNE A;  2ZXI A;  3ZRG A;  3PFY A;  3DKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...