3AG1H

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 280 k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag1H00
2DYRH 5B3SH 1OCRH 3ASNH 3ABKH 2OCCH 5IY5H 2EINH 2EIKH 1V54H 2Y69H 2ZXWH 3AG3H 3AG4H 1OCZH 3AG2H 2DYSH 2EIMH 5B1AH 1OCOH 1V55H 2EIJH 5B1BH 3ASOH 3X2QH 3AG1H 3WG7H 2EILH 3ABLH 3ABMH 1OCCH
chains in the Genus database with same CATH superfamily
1AKHA 1SMYF 1E2XA 3R61A 1XD7A 2ZXJA 3LAJA 1HF0A 3VYRB 1Y1WJ 2E60A 2WADA 3MAJA 5F04A 1MGTA 2XF7A 2RDPA 1DPUA 3K4NA 4DGWB 4YFNF 3MQ0A 3FBIB 1AHDP 4XRSA 2JMWA 2EZIA 5JHFA 3CD6I 3BTLA 4A3BJ 4UUVA 3BPXA 3KYCB 3OSFA 2A68F 1DGRM 1MJBA 1P4XA 4AUXA 4Y3OA 4HW0A 5CKTA 2NNNA 2OJED 4M6VA 4YRVA 4BS9A 1P2FA 4UVAA 1HA8A 3GZ5A 2ZSHB 2HWVA 2CS3A 2MG4A 4ENKA 3L2CA 1W36D 1DU0A 2L2OA 3JCUC 4CZZA 4RB0A 5HLGA 4A3FJ 5LRRA 4UUSB 2V1DA 3EUHA 1QBJA 3S14J 3KP7A 4LLLA 1D5YA 1N25A 3QOEA 5CJ9A 1W7PD 4N0BA 2LLKA 1X1BA 5J47A 3J7ZI 1Z3YA 2A5WA 2M34A 2QM3A 3U21A 3GFIA 2GA1A 5EEGA 5ICCA 1X1AA 3H36A 1LNWA 2HQRA 3K4KA 3HRMA 1PUFA 4K2EA 4U88A 2DTZA 1XC5A 2Z9OA 2HVRA 1WVRA 2VOOA 1PDNC 2CW0F 2QBYB 4C30A 1TQIA 4BKXA 2OA4A 2K9NA 2MLKA 4DBQA 3HSRA 2LF8A 5HS7A 3TP3A 1FP2A 2JJ7A 3W3CA 3W6JB 1WRJA 1WI3A 1VTNC 3PL8A 2Y30A 4EMSA 2G7HA 3Q0UA 4IXAA 2Q1ZB 1Z9CA 3AKZA 4ABZA 3MKLA 2EJRA 5GTIC 1VFCA 1JUMA 3RPUA 3O6BB 3X2QH 4Y7NJ 1YJ9I 5GP9A 3ZMVA 4EGZA 2H27A 4LFUA 4B47A 3WE3A 2BY2A 4II3A 1G8XA 3FBNB 4GYGA 3EUKL 1I5ZA 1QZZA 1OPCA 1XSVA 3DBLB 4HV6A 5BPDA 2WWYA 1VQ6I 2QEXI 4Z2YA 1R00A 1HOMA 1D8KA 3E97A 5HNFA 2CQNA 2E71A 3QP6A 4XKCA 5CVIA 2MH2A 4I0AA 3DCFA 3RKQA 5IPAA 3SEQA 1N77A 3H3ZA 2K9LA 2VBYA 2VKDA 5LEKA 1IUYA 4LITA 2LKSA 2GXGA 2ZMEB 1JE8A 4ESJA 5E79C 3S3NA 4RBOA 1HQCA 2IW5A 2V4JC 5J8CA 3HOZJ 2EIKH 2IP2A 2M87A 2QQBA 3IAM2 2DW4A 5EEHA 2RGVA 3M8JA 5L3FA 3TMOA 3ZQQA 1MNEA 4J00A 4C3IJ 1FBUA 3P5JA 3G4SI 4NUBA 1A35A 2CO5A 2R4GA 1F1ZA 2K9QA 2JPBA 3FX3A 4EM2A 4LIVA 5EZHA 1MMSA 1ZG1A 2M3AA 5J3LA 2WTEA 4LIUA 1FC3A 3BR0A 4HV5A 4CICA 2DMPA 3N97A 2YX4A 3N4MA 1BC7C 2IXSA 3DKYA 3K2AA 2IS6A 2VQHA 3AG3H 3CF2A 4HQMA 4A5NA 4BAYA 2R7UA 2XSDC 4OMYA 5FRMA 1ZARA 4XRFA 4ZJZA 3FIWA 1IN7A 2JQ7A 1KQ8A 1V55H 3E0JB 3JW4A 4NC8A 3RSNA 4FT8A 4XRMA 3AFHA 4BEHB 2FQ3A 5E3LA 1VQNI 4EEFG 4OAYA 3LFKA 6PAXA 4RA2A 1D0ZA 4RM3A 1KQ0A 1W7PA 2M7AA 2DU9A 4LLNA 3JRHA 5FB2A 2R0QC 3KLOA 4IKFA 1WQ2A 4DW6A 3GZ6A 1WHUA 3N05A 4Q5SF 3U1KA 2TDXA 1OR7C 1M1EB 1LKXA 3DEWA 3DTEA 4H4KC 2LBFA 5GAGJ 3BOQA 4ANJA 5K7HA 5C4JJ 3KETA 2HYGD 2NS8A 3P9CA 4HYEA 1REPC 4LOCA 3I4PA 1EF4A 4IZZA 1MDMA 3HUGA 2XAQA 4HX8A 2NNYA 5E3MA 5DCMB 2W1OA 1KZHA 2HDCA 1NTCA 2E5NA 3B6CA 3E6DA 1Z0XA 3G3ZA 1BOAA 2I5UA 4MEYF 2F48A 1Y1VJ 3SJMA 1CF7A 1VF9A 2YS9A 1BI0A 2UWMA 5LFAA 3S15J 2BVMA 3BCAA 3PQJA 1BW5A 4ZZDA 2FMLA 5FKMA 3ZQLA 3EDPA 1LE8B 4U87A 4MFDA 1KU9A 3E5QA 1JUSA 1RIOH 3ZPLA 5GAHJ 4L0ZB 4O3MA 2PEXA 5LGUA 3FDYA 3S1MJ 3M1EA 1IZ1A 1BIBA 1XX5A 2QQ9A 3M8FA 3F21A 4LMYA 1TW3A 3DTIA 3F3XA 2OD5A 5FLXZ 2KIMA 3F8MA 3JAMZ 2XUBA 2HQNA 4F55A 1QNTA 1T0FA 3CCVI 4ZTJA 4Y13A 4HX7A 3TEDA 4AVPA 2PFBA 1VQPI 1UAAA 1ZGJA 3ZQFA 4XMYA 3HOTA 3GUDA 3WU2C 1FT9A 2W24A 1T8IA 2CGPA 4RGUA 2F5DA 3RQ4A 4E7SA 1WH5A 3E5XA 3BQYA 1KU2A 3S1NJ 4R1HA 2QVOA 1FYLA 5CYVA 3K70C 1WPKA 3M07A 1A36A 4RDUA 3T0YA 2FU4A 3LSTA 4BXXJ 4Q47A 2EV5A 3BR6A 2A61A 2M9HA 1V5GA 1ZHFA 1VI0A 4IRHA 1GXQA 1G3YA 2VONA 2JVHA 4BHCA 2L7KA 4XKVA 1MD0A 4L9NA 1MZBA 2PX9A 5HLHA 4CXFA 1Y0NA 3CMAI 1X3UA 1X4PA 3LSMA 1S3JA 2E1MB 3HHHA 4CCMA 2L7MP 3RZDJ 4OIQF 5AIPA 2L0KA 2VPLA 4C3JJ 2BY0A 1T33A 1A6IA 2XKPA 4A6EA 3PIOF 3RI4A 2WAFA 4MFEA 5B1AH 3JSPA 4HF2A 4GXOA 3SXYA 2Y9YA 2Y48A 4S0HB 2HKOA 3C18A 3G1MA 3I0TA 1MJ9A 2E7WA 3K1NA 4MTEA 2AHQA 5IOZA 4IO9F 1NHAA 4X0GA 2EILH 5FLXK 4DBRA 1LB2A 2K86A 3C2GA 4L9TA 2VN2A 2O6GE 1ACIA 1LDDA 1T08B 1UJ8A 4IJAA 1PUFB 1SVLA 1P7JA 4KIFA 1W5SA 3BLYA 4IVNA 3O8HA 3WHBA 2FUG2 1V5FA 4D5FA 2VBWA 2XSJC 3FXUA 4IF4A 2AS5F 1HXDA 5FD5A 1N78A 1KYZA 2PJPA 5JVGF 3ASOH 2LR8A 2FXAA 1B9NA 2FBIA 3MWMA 1XSDA 4A3DJ 5A2QK 1IUFA 4M9SA 4E7KA 2N8GA 1S29A 2XIGA 4RGXA 4YIIA 1YG2A 1R71A 1G6NA 1ZLJA 2HPIA 1U6GA 3V8LA 4HQEA 3HKZA 4F3QA 5IYCJ 4ZYHA 3MKZA 1K79A 3I54A 3DV8A 5M5WJ 3HDDA 1VQLI 1UG2A 1K6YA 1TBXA 2DBBA 3HRTA 1MMNA 3F23A 2NOGA 3BDDA 5F1JA 4KT6A 4BJTA 4P9FA 3CJQB 2HQ5A 4A3LJ 2BVLA 4M3GA 1VQKI 3H35A 2M1BA 1WWXA 4UUSA 2IEKA 4HX4A 4AWXB 1JXSA 1QA6A 1BC8C 1XTAA 5F1RA 3HJEA 3BZ6A 4PDKA 3VFZA 4I6ZA 2NS0A 2QCOA 4CHUA 2R92J 5IP7J 1J9IA 1TWCJ 2R7ZJ 3PSFA 2QBYA 2LG4A 4KIBA 2F2EA 4BACA 3PNVA 5ED4A 2XF6A 3ULQB 4JOMA 3ZOBA 5CQGA 1FIAA 3PFYA 2Z3YA 1FYKA 1XPXA 2IGOA 1FLIA 3ZMDA 3FHZA 1VQ8I 3RIRA 2ME0A 2DFIA 3VYSB 4PK4A 4P96A 4EM1A 1ZRCA 2CW8A 1BIAA 1ZK8A 3L00A 4BU2A 4BE2A 4C9YA 4U0YA 3BJOA 2V1XA 1UHWA 2DFEA 4MO7A 5HVQC 1B72B 2L9SA 5M3FJ 2NXNB 1D5VA 4ZDLA 3IRQA 2R7TA 2H94A 4D1QA 4IHVA 3OYAA 5LRSA 1STZA 2DA1A 1SFKA 2RQPA 1FOWA 3JTHA 3GXOA 2QKLB 2E5ZA 2XB5A 3B73A 4RS8A 2KIQA 5HS8A 3BG3A 3LA3A 1OYWA 2BGCA 3GVAA 2EIMH 2OAZA 1XN7A 1I3QJ 3V42A 2KRCA 2ZMEA 4XQFA 2HEOA 4RB2C 1T56A 3V8JA 3PSIA 1P7IA 2LSOA 2MGQA 3FKIJ 3HRUA 3IC7A 4G12A 4I2OA 1HBXG 3WTVC 2L02A 1I50J 4B3AA 3VWBA 2RC4A 4BQQA 1IGNA 5EJCA 2D1HA 2DOAA 2WA0A 3LMMA 2KDZA 3RTRA 3KEOA 1WJFA 2PLYA 4YIFA 3EQLF 1YX3A 3AG4H 3ESWB 5FJ8J 5TRDA 3DF8A 1XGOA 2COBA 2F4MB 3BR5A 1X1CA 3DPUA 2P6SA 3WTYC 2CV0A 1Z21A 2DT5A 2IS1A 1PYVA 3KZZA 3IH4A 4HNUA 3W2AA 1ZKGA 4S05A 1B8IB 5ICFA 1TC3C 4N4OB 2E2HJ 2EA4A 1ZQ3P 4C2UA 3D1NI 3K2ZA 4A3IJ 2FF4A 1MSFC 3DEEA 5E3NA 5KVRA 5K5RA 1SD5A 2VJIA 2DMQA 2RAEA 2X51A 3BCBA 4BEHA 1FP1D 2ZB9A 2JA6J 3TOBA 1S7OA 3SFZA 2Z16A 4W1UA 4G7HF 3KP5A 2W00A 3BJ6A 1UHMA 2WB1N 1R7JA 4MEXF 2WY8Q 3T5XA 5KAFC 4XN0A 5JLXA 2L54A 4I09A 2IRFG 5J8FA 5DS9A 2XAGA 3QPSA 5JR3A 2V79A 3ONQA 1AA7A 3FXMA 2Q8KA 5AONA 1DDNA 2CSOA 4CCKA 2HS5A 1FIPA 2QF7A 3K1MA 1XGSA 2STTA 4YFKF 1GVJA 5DEQA 3OYIA 3H1CA 2VQLA 4R8HA 3WU0A 2CQ7A 4A12A 5LGTA 2MA3A 4CGZA 5DCMA 1MMDA 1FEXA 1XDUA 2RQQA 3ROUA 4MHGA 3GO5A 1FOXA 2R7WA 1SC7A 3QRFF 4ETSA 1TP4A 2PMZA 2BY3A 1HDDC 3KPHA 2K4JA 2G7UA 4BHPA 4ZYEA 1X2MA 3K10A 4Y52J 1LE8A 2DODA 2WY7Q 2KDOA 3A0HC 3H92A 2NVTJ 3CMEI 1JJ8C 3CC2I 3TW6A 1R58A 1HLVA 2HYJA 1R23A 3ZGKA 3RJPA 5J4YA 5H6RA 4ZYDA 4P55A 1U9NA 4LB6B 4FE7A 3VPRA 1BJZA 4I0BA 1ZRDA 3K4BA 1FMVA 1J75A 3S8PA 4I02A 2PI0A 4A3JJ 1Y56A 1ERDA 1U8BA 3ZN1A 2CH0A 2O5RA 4C2TA 2OV7A 2RKHA 1LEBA 4ZZLA 2D5VA 3CMMA 1YRNB 3EUHC 2OF7A 1SANA 3JRIA 4G94A 2GM4A 2F6CA 5C44J 2PJRB 3FXJA 2K40A 3FF5A 5FD6A 2IA2A 3LA7A 1IF1A 2DXIA 4M73A 3A1YA 3CCQI 3HOYJ 2IVMA 4XLAA 3OYFA 1OCPA 2BW3B 2NVYJ 1WJEA 2E34A 1KQ9A 1OMIA 1ORKA 2ADUA 1S72I 3G1LA 4G6DA 1XCBA 2P6TA 2Q0OA 2TCTA 4XSZF 1ZG3A 2L9RA 1RETA 3QPLA 3QYFA 3CC7I 3K4JA 4BY7J 3TQNA 1XCVA 3ERMA 2EV6A 4C3HJ 1BI3A 2FBKA 3CJTB 3ABTA 4HSRA 1F4KA 2K02A 5IY5H 5TGTA 1BBYA 3L2QA 3OOUA 2LKXA 5IT9K 4CSWA 3MKYB 3E6BA 4ESFA 2CG4A 4CYCB 2Z33A 3LFUA 2IBDA 1YFHA 1O3TA 2DFFA 4BJ6C 4BBSJ 3ABUA 2PMHA 1Z7LA 3WU1B 3GFLA 2XRNA 4JQFA 1OQYA 4XIDA 2GLOA 5B66C 3CCSI 2Y0SA 5HLIA 1SVMA 1O7FA 2DCEA 2DA7A 4PJJA 4DYRA 4BDZA 2O7OA 3CDLA 3IUOA 3MCZA 2F5EA 2LH9A 3CJNA 2GIVA 4IOCF 3HZJA 1KONA 4Z6YA 1FSEA 2JK3A 5HNHA 2IT0A 1IDZA 1JTXA 2IPQX 1W5CC 2JUGA 5D5WB 2ECCA 5K1YA 3KP4A 4IL6C 2AQEA 4CH7A 1RR7A 2E7XA 3RPQA 3GTOJ 3ABMH 4E7HA 1XGNA 1Q1HA 4BBRJ 3OMYA 5TJJA 4EJUA 2DJNA 1P4AA 4XOTA 3VODA 4FCYA 2YPRA 1TNSA 1YJNI 2XGEA 5D5UB 1ENHA 2J5PA 2GAUA 2JVGA 4CO8A 3GLXA 4A0XA 5HOOA 1U0JA 4EJTA 1QVUA 3RKWA 1A31A 1DGWY 5DYMA 1ZR4A 4MLOA 1JTYA 3LWFA 2ZNZA 2ID6A 2ZJRF 4XSXF 1MNDA 1O3SA 1SMTA 4RAYA 3OS1A 3P7NA 3I55I 1O3QA 4XICA 1JKOC 1YX5A 4M71A 5CVUA 2KJBA 4IHWA 3HXLA 5DD4A 2V9KA 4A3EJ 2F5FA 4KUMA 2AXTC 5J1RA 1SFEA 1YIJI 1W36C 3U2RA 3V4GA 1I6XA 1QHHD 2M5WA 3F9KA 1JGGA 2ELJA 1KU7A 2OTJI 3CESA 5EZGA 4A3MJ 1IRZA 1S8NA 2L01A 3VSLA 1S9HA 3BR2A 3L1PA 1W1WE 4YEJA 4NQWB 4EQQA 1OJLA 3CP2A 2QA4I 3F22A 4RB1A 1E3PA 5ILVA 3WTWC 1JT6A 1Z7UA 1U5TB 4X1EA 1IJWC 4M3BA 2EWNA 3PO2J 1WGXA 2YU3A 2BY1A 4QIWN 4PSWA 3OR2C 1H89C 4B43A 3J81Z 4H0EA 5F08A 5E3OA 1GUUA 4ITVA 3S2WA 2XAHA 1BI2A 3DQVC 2CFOA 4NC7A 3OOPA 1MBJA 4DQ2A 1RZ4A 1QPMA 1B4AA 1R5ID 3HGGA 3QU3A 3FWEA 4UB6C 3OS0A 3CQZJ 4L0YB 4UB8C 5GPAA 1Z77A 1Y8QB 4DNCA 4B1RA 3GTQJ 2CYYA 3BG6A 2Y75A 1QHGA 4F91B 4U7DA 5E8GA 3VOEA 5D8LB 4JK1X 4IQ4A 1U3EM 3QAHA 5GADJ 5F64A 1ETYA 1ZGWA 4JP0A 2K85A 3NRVA 3NWTA 3GTKJ 1YHQI 4C2MJ 2A05A 3KE2A 4BUPA 4E7LA 2DA4A 3DTKA 4HBLA 3S2DJ 2A6TA 1HW1A 2IAIA 5ICEA 4BH9A 4IHSA 3J7AO 3Q0WA 3CUOA 1B72A 4BYYA 5CPRB 4KMUX 3L2WA 3E6CC 2COMA 1J5YA 1ZN2A 1T0FC 1XMXA 2V6CA 3WTXC 5BPIA 3ZRGA 4UNOA 5CVRA 2HVSA 5FKOA 4OIOF 1Z6TA 3JSOA 2LNBA 1CQTA 5EDNA 3ECHA 4I01A 1GHCA 1UB9A 4IOAF 2JT1A 2YSRA 2A69F 3BZCA 4L5EA 2KJCA 4KJZA 3F8CA 2DQRA 2X6OA 3RDIA 1IAWA 3Q0VA 3DBHB 2X6XA 4B09A 1DPRA 4AIHA 4KIGA 4AYBA 4R79A 5H2FC 4NB5A 3WODF 3COAC 4XL9A 3V7CA 3BROA 3LNQA 4AVZA 1K6OA 4Y33A 3MEXA 2PMUA 5B3SH 3J81K 3UKGA 2I10A 2XVCA 2VC0A 4TV7A 1LUJB 3I53A 1QO0D 2DFHA 2JWTA 2VKVA 2W82A 2ME6A 3OYEA 1X19A 2MBFA 1FYMA 2Q2EB 5FGMA 2IJLA 2DDBA 3HRSA 4OIRF 2Y2ZA 2MSYA 2O61A 1B8IA 3BTCA 5LLQA 1R1VA 1SD7A 1SAUA 4BXFA 1U8RA 2P5KA 2CFXA 3BP8A 1FX7A 5LEJA 2DYRH 4CCJA 1BN5A 1OCRH 2HVQA 2X4HA 3GF2A 1GLNA 1R4NB 2JA2A 1H88C 2G0EA 3LQRA 4I98B 3QYEA 2LD5A 4MGRA 3ZQ7A 3M8EA 2KISA 2W4SA 4MIMA 3KIOA 2UXNA 2E1CA 4EJOA 2VC1A 3ERED 1IV8A 4L9JA 1G2HA 2NRAC 1OYYA 2V1NA 2VL8A 4D7MA 2VKHA 5KAIC 3LSRA 1D1CA 2STWA 3F6VA 4A3GJ 2FOWA 1EH6A 5L3BA 1O57A 4JX5A 1I1SA 2XB0X 2EFPA 2W7NA 2Y9ZA 1K83J 4AM3A 3IH2A 1HSJA 1HKSA 4QPOA 5A2QZ 1O4XA 4HNVA 1IG7A 1OCZH 3KLNA 4ESBA 2X9DA 5D5VB 3H9QA 1KA8A 1TLHB 3SHFA 3TP0A 5H20A 1FJLA 2CUFA 4LG3A 3RYPA 4KDPA 1TZLA 4WXCA 5GAEJ 5DM7F 3QP5A 2F4IA 2K7LA 2CQXA 4PGHA 4EGYA 3BY6A 3REOA 4FX4A 2O03A 1PUEE 3K0LA 2LY9A 5E1XA 1NG7A 4UY8I 2Y69H 1ETXA 2ZXWH 3WTUC 2WAQN 2Z99A 2EFOA 4PJMA 4F92B 5D4RA 1HKQA 5CVVA 3F0CA 3H3UA 2FBHA 4Q48A 2MLGA 1G3SA 1POGA 1OYIA 2DT6A 5FKLA 2VBXA 2ELHA 3QYBA 3TO7A 1YRNA 1FWZA 3GZNB 4N9HA 2M45A 4HDUA 2L3DA 3RYRA 1OISA 2EZKA 2F4OB 2KIFA 2X0LA 1O3RA 3D5SC 1Z1DA 2HDDA 5L3EA 2PJRA 5EGOB 3G2BA 2OTLI 4E7ZA 3LA2A 3ECOA 1H0MA 2R7FA 3ZMSA 3HOVJ 2WC2A 4KITB 5E20A 3WE2A 1X3WB 2BW3A 2KLOA 4ZDOA 1D0YA 1SFOJ 2KZGA 5J4VA 4XBFA 2CV2A 4KYWA 4XKBA 2Z5UA 4ENJA 2VJ5A 2XDVA 2DYSH 3CLOA 3VB2A 2GXAA 3JRGA 5K7FA 2X1EA 3CCEI 1MBFA 5JLWA 2E36A 1T39A 4V2FA 2FEZA 2XAUA 4XK4A 5KNLA 3BQZA 2VUMJ 2CUJA 2M4GA 3GTLJ 1E17A 4M9XA 1RKWA 4WWCA 4WK8F 1TNTA 3HTUA 2FQ4A 3KZYA 1DP3A 4J01A 4DZJA 4MTDA 4CYCA 2H8RA 1WJCA 1VZ0A 3GW2A 2OUMA 3OY9A 4BL0B 4A2UA 4KISA 3DFGA 2OQGA 2MD5A 3L2UA 1WCMJ 2BYVE 2X6WA 3HBLA 4BQOA 2D2WA 2KKOA 4GYIA 1LFPA 2K3FA 2W25A 4IX7A 4ON0A 2DMNA 4O6JA 5K5QA 1SEUA 1WH7A 4YELA 1JKRC 3HOWJ 3GWZA 3O3KA 2LF7A 5CLSA 1K7AA 1YQAA 3KX2A 2KHMA 2L4MA 1OFCX 2ZMEC 3E7LA 4AC0A 1BI1A 2VODA 4F7ZA 1YW9A 1IRFA 5HDNA 3PJRA 3R6SA 4B44A 1R5HA 3GCMA 1NK2P 4DIQA 1VNDA 2VOPA 4RAZA 4HG2A 4RGSA 2QKMB 1R1UA 1OCCH 2EK5A 3GTMJ 1MKMA 2W85A 2P8TA 2BXZA 2ZCWA 2R7DA 2P4WA 2HOAA 2IA0A 2D1VA 3JRFA 1HSTA 2D45A 1C0WA 1JI8A 3D5LA 1AWCA 3G71I 4ASNA 1LQ1A 1ZH5A 2HOTA 1X1DA 3C7JA 5ICGA 4GRIA 5BMZA 3E3VA 2DLLA 2ZJ2A 2XASA 3R4KA 1ON1A 2BZTA 5HDGA 2PN6A 2XC7A 3JRDA 3QWLA 4FETA 5EG0B 1T98A 1SD6A 2L9VA 4BQAA 1R36A 1APLC 4LK0F 1MSEC 2KZVA 1PJRA 2P5LC 5J40A 3IWFA 2RNJA 2GOXB 4ENMA 1Z67A 4JX4A 3T8RA 3CP8A 2E2IJ 2AQFA 4B48A 1A5JA 3S2HJ 2V26A 1BJAA 3DKXA 3HC7A 1F36A 5E18F 1IN8A 2XPVA 3K4CA 3FXLA 3OL3A 1ON2A 4X6AJ 2H1KA 4BHBA 5IYBJ 1FZPB 4IRGA 4NQWA 2VT3A 2V7FA 1Y6IA 5FRNA 3HEFA 3SDGA 4IHYA 3M1CA 1U5TA 5L3DA 3GYHX 1I1GA 4HLYA 2Y31A 1D3YA 5TISC 2ZKZA 5IP9J 1OCTC 5FLVA 3CUQB 4CZCA 3SZPA 4LB5A 3EYIA 2VJ4A 4B4CA 5EF6A 2HOEA 3BC8A 3LQQA 2AXLA 2JA5J 1R4MB 5LGNA 3OYGA 1T38A 1LVAA 1R5GA 2K9MA 2OZ6A 2IS4A 2BXYA 1XGMA 3ZR8X 3LSGA 1B6AA 1V5EA 3KP6A 3T8TA 2QLZA 2FJ1A 2YX7A 2JRTA 3CCMI 2C6YA 1QPIA 2ELKA 1FOKA 3F8NA 3PQKA 1D1BA 5EEAA 2OC6A 4LLGF 5D6EA 5BOXA 1CGPA 4MQVA 1ETOA 5C4XJ 4KA4A 2O3FA 2QQ8A 1G3TA 4GGGA 3BG5A 3FXRA 3SZGA 1X4OA 3RQIA 2KRFA 3ZCOA 3UR3C 2FSWA 2UUZA 2ZO4A 3PUFA 2VJJA 5D6FA 4HEA2 4KT5C 2JA7J 1D1AA 4OU0A 4HDVA 3SFIA 3TKYA 2ISYA 4DJAA 2LKPA 2H6BA 4KFCA 3B02A 4B3XA 1UMQA 2R7XA 3IP4B 4GDFA 1MW7A 2M0CA 3JRCA 1IRXA 5KK1A 3HPHA 1JT0A 1ZAOA 1XMAA 4D5CA 5E17F 1TT0A 2K9SA 1IN4A 3RKXA 1EKEA 1K78A 1BL0A 1IO2A 4OMZA 1D0XA 3GFMA 1KU3A 1FOYA 2XAJA 5HS9A 4EJVA 1XG1A 4YFXF 2HZTA 4O5VA 3JREA 1GV2A 2NYXA 3CCUI 1A6QA 5IT9Z 1TQPA 1P6RA 3TBIA 5C3EJ 2CW7A 3CF5F 2DPDA 2OPTA 2Z2SB 3D5RC 2P0WA 1VQ4I 4A0YA 1ZLKA 2YR2A 1J7KA 3K4MA 2X1CA 1RRJA 4HSTA 4LJZF 4P1WA 2EINH 3WTTC 2Q2EA 3ML6A 3S1RJ 1EJ9A 2E1MC 2QSHX 2JRMA 1S6LA 1WJBA 1R6RA 5LHHA 3JRBA 1MNMC 1RESA 2CV1A 4Y17A 3ZMZA 1DUXC 3CCRI 1ZYRF 1BR4A 2ISZA 3GTPJ 4JBAA 3VYUB 2OZUA 2QZ8A 3K9TA 3W6KB 3CCJI 1DQUA 2GWRA 5JFRA 3FHNA 3I5UA 4KMFA 3ELKA 5J1YA 3RPUD 4UHTA 4YG2F 3A01B 3PFIA 2VLAA 3MZHA 4CYDA 4PJ0C 1PP8F 1F5TA 1K61A 2LYCA 4PZJA 2VPRA 3WG9A 2DN0A 4FQGA 1A04A 1IV6A 5EYRA 3CJRB 1IXSB 4N9IA 4QSHA 5IT3A 3DU5A 2B9SA 2CUEA 1Z91A 3R60A 2LTPA 4BE1A 5LD2C 3I4NJ 2DPUA 1HW2A 1FTZA 1SFUA 1OLTA 1S7EA 1YTYA 3WGGA 2LMDA 2CWEA 2DO7A 2LFBA 4XONA 1E3HA 3KP2A 1SVOA 2HYFA 1IRGA 3WTZA 2FMYA 3TGNA 3LAPA 2VE9A 2FRHA 2MFZA 2DA3A 2XAFA 4DYCA 4IQJA 4HF1A 3PIPF 1TWHJ 1VQOI 2KL4A 3HGYA 4PGGA 3C2BA 2JTVA 2XROA 3L2VA 1W4MA 3VDXA 4XLFA 2OBPA 1D8JA 1YIOA 1JKQC 3OIPA 4KNYA 3TO9A 1UG0A 2M8EA 3LSKA 1LPQA 3KP3A 3QOPA 3OS2A 2HZDA 1P4WA 4V2GA 3FM5A 1YYVA 2M4KA 4QPQA 3MN2A 1I3AA 3DPTA 3SDBA 4UV9A 3F72A 4BY1J 1JUPA 1PP7U 4AIKA 2EFNA 4CA0A 2A07F 5M5XJ 3WGHA 2WV1A 4Y4RA 2KQRA 1W0UA 2E19A 4DYQA 2R5ZB 2HDWA 1AOYA 1SD4A 3IHUA 4HPQA 2DK5A 2DAOA 1L3LA 2VQGA 2CU7A 3OIOA 3SEZA 5BS6A 5EGOA 2X6YA 2IA1A 1X58A 1YS7A 3CDIA 1UHSA 1ZTRA 3HOXJ 3M3YJ 4RMNA 1YITI 2ZFUA 5FKKA 1P92A 3E1SA 3HKZN 4ZYAA 5FO5A 2XKOA 3HM5A 4QLCU 1IC8A 2E1NA 1FTTA 3LSHA 5L3GA 1QRYA 2XGCA 3OYLA 2HPMA 4A6DA 2QQAA 4A93J 3OSGA 3KYLA 4BQNA 3NWSA 4CCLA 4XKWA 1SFXA 4A0ZA 1MH4A 1TWGJ 1WJDA 4WCGA 3IAS2 2OCEA 3BTIA 1MBKA 2LC2A 4WX9A 1RI7A 2QYOA 1YE9A 4ZC3A 4RGRA 5E1ZB 3U1DA 2R5YB 2XHKA 4FTHA 4HAMA 1ZG5A 3L09A 1EH7A 1TWAJ 1WJAA 3BR1A 2QSFX 4IRIA 1B59A 2DT7B 2ETHA 4PSXA 3Q9VA 4ZTFA 2LDUA 2EPFA 3EETA 4PFPA 1JJ6C 1ZRFA 2YU9J 3V7SA 1QVTA 3CCLI 3FXOA 1XSXA 4FE4A 4XR6A 2VT2A 4L9VA 1XDSA 3FK6A 3S3OA 2VASA 2XGXA 3J80Z 3MKWB 4UV8A 3S3MA 3ASNH 3T1BA 1QU3A 2X1DA 1TTYA 1W0TA 3CUQC 1G4DA 2E35A 5B5EC 3FMSA 4LG0B 3OV8A 3JR9A 4MNUA 2L5QA 2HU9A 2ZXHA 4RLQA 3WGIA 1FMWA 2V9PA 1WZ2A 1R9TJ 1B9MA 1JGSA 2ZXIA 5IOYA 2W57A 2A6HF 4OWRB 4ZDPA 4V19K 1UCRA 4BE0A 2V1UA 1IXCA 1N75A 4HLXA 4XLHA 1USSA 2ZJPF 1FBSA 1XB4A 2NVUB 5DDGA 2DK8A 3AL0B 3LSJA 1G59A 1B1BA 1JHFA 2KT0A 3IWZA 3QU6A 2BBYA 2CJJA 4G6QA 2VI6A 5EG0A 2ESHA 2DA2A 1S7AA 4JX6A 2RNGA 1MBGA 1Y39A 3H3VK 3W2VA 1HKTA 4D0PA 5LBQA 3J7YJ 5GTHC 4M6YA 3S32A 3VYTB 3HIFA 3CMYA 3IL2A 4BJ5C 3BR3A 4JYKA 2GXBA 1MMAA 2WBMA 1MJAA 2R7RA 2RN7A 1L0OC 3A4CA 3MMYB 3RCOA 3CTAA 4I99C 5HLTA 1S5LC 1ETVA 2ZFWA 3I59B 1XMKA 4G8XA 2EZHA 3VEPA 1AU7A 2H1LA 3I4MJ 1Y8RB 3DEUA 2R7OA 1F43A 2GOMA 2K3PA 3ZMUA 2H8WA 2VQCA 3ZP5A 3CUQA 4RAGA 4DZPA 4IHTA 5F0FA 5IYDJ 3OR1C 1WFXA 5AIQA 5ILSA 3J80K 1GXPA 1K78B 9ANTA 2B63J 2UXXA 2DTRA 1F9NA 5JI6A 3S16J 5M3MJ 4NDLA 2HFHA 3A2KA 5K7ZA 4BDYA 3P9KA 1LJ9A 5F27A 5BQTA 2UZKA 2PG4A 1HW5A 3ABKH 2QWWA 3V7RA 1I6HJ 3FXKA 2EFQA 3AAFA 2V9VA 1ETWA 3I56I 2BE5F 2HKXA 2K5CA 2LVSA 2K4BA 2VKEA 1J0RA 2XPWA 3LOCA 2ZSIB 3RKYA 1ETKA 2J5OA 1LDKB 2DOFA 3JTGA 1QQIA 1WKMA 1JKPC 3F8FA 2H09A 1BR1A 3AG1H 2BHZA 3WG7H 5ILUA 4QTRA 1VQ5I 2NVXJ 3W2WA 4EM0B 2WB1A 5LHGA 3K70D 2DMTA 3BPVA 1EV7A 1OKRA 2KMUA 5LHIA 1H9GA 4XORA 3L7WA 3HSEA 3HOSA 1XS9A 1T6SA 4E7JA 2IGNA 1ETQA 3DU6A 3OL4A 1GT0C 3ISPA 2GQQA 4L5IA 3VSKA 4FISA 5DM6F 3IKVA 1IDYA 2PMZN 2HGCA 3LL7A 3FMRA 2GBYA 3S93A 3HOUJ 2W48A 4XLEA 4GCVA 1R22A 1FY7A 1QGPA 5KCMA 2ZNYA 4HA8A 1MMGA 1Y0UA 1FBQA 3QQAA 2M7BA 2OCCH 2CRGA 4UVCA 1HDPA 2GIZA 5L3CA 5FFZA 3HTSB 4A69C 4YIRX 1VQMI 4UUTA 1OR7A 3OYCA 1OCOH 1MBHA 5DTDA 3I64A 2XGDA 3K1PA 2R7QA 3R0JA 1Q1VA 4AIDA 3C1DA 2MC3A 1EA3A 1TW2A 4OIPF 1GDTA 3MZYA 3GTJJ 5F0HA 1BOBA 2GZWA 3C3WA 1G3WA 3TO6A 2P7CB 1USTA 3H5RA 4HRIA 2I8DA 1AKHB 4FASD 2HQAA 3OYKA 2VB6A 2QENA 4PFOA 2K27A 4N4NB 4RLFA 4XLNF 1V4RA 4FHTA 3TDUC 4UXNA 1U9OA 3CCYA 4L18B 4F93B 2F5CA 3V8KA 4I76A 2R3SA 3BG7A 2XV4S 1VQ9I 5FFXA 3A01A 2HXIA 3DXJF 3NQOA 4LD5A 1IN5A 3BTJA 3FZVA 3OWTA 2B7EA 1RKTA 2TRTA 2M30A 1TL8A 5J6XA 3PNTA 1IN6A 3I71A 3ZN0A 1V54H 1RR8C 1K4SA 1NK3P 4S04A 4D9JA 1FNNA 1YLFA 2E2JJ 3AG2H 1O7LA 2M8GX 2RREA 3CLQA 5E8IA 4G7ZF 1H8AC 1ULYA 4RB3C 2CQQA 1QZEA 2VIXA 3MVPA 2WV0A 1EH8A 2Y0SN 3ABLH 2EQRA 3JAMK 2HI3A 4NC6A 2EZLA 3WTSC 2EBIA 2ACJA 2M0MA 4Y15A 1YI2I 3ZQIA 4A3KJ 4NBQA 3ZQGA 4HNTA 5FLMJ 2X85A 4GFBA 4RM2A 3K6GA 4OINF 1HCRA 5D8KB 4M72A 2EH3A 3WHCA 2DJIA 1NH3A 1X3ZB 4CCNA 1RPWA 5FROA 3PNYA 2ECBA 5DUKA 4E6KG 3J7AY 2AO9A 2DI3A 3FM3A 2H6CA 1R1TA 2HTJA 3G1OA 4ENNA 3UNGC 2PBIA 1YO5C 3KFWX 3L9FA 3QPTA 2A3SA 2JZYA 4HZFA 2FA5A 1LFBA 2FNPA 3H0DA 2WAEA 1HC8A 1DP7P 5H6QA 2FNAA 2M2EA 4PJLA 2R5ZA 4II2A 1VQ7I 5DV5A 1FPQA 3BZKA 2NAZA 3G73A 3SYTA 1RNLA 4A3CJ 1U5TC 3MZ8A 3C2HA 5DUIA 2R93J 3GLLA 5CVJA 1RUNA 4XN3A 3I3LA 3O2PE 3FKJA 4G9YA 1E3OC 3IV5A 3DLLF 5D4SA 3F8BA 5JVTA 1GVDA 2ID3A 3A03A 3Q9SA 1J09A 5CQEA 4MQ9F 2VBZA 3MD2A 1U78A 3GFJA 1Z3XA 4QWQA 2B0LA 4KN4X 2ICWG 5DD8A 3GBGA 2W84A 1KGSA 2BHYA 3AL0C 3QODA 3EPZA 4A5MA 3S1QJ 2XF5A 2FD5A 2EB7A 3GX4X 2LREA 1FSHA 2IGMA 2L7ZA 1ZELA 2FOKA 3H0GJ 1Z05A 3DPLC 4HOBA 2LOOA 4E7IA 3ZXSA 3G6EI 2P7VB 2R5YA 4ZYGA 3OYDA 1K4TA 2XPUA 3DBRB 1WJ5A 1ZGAA 2ZC2A 4U7BA 4D7NA 3NARA 1UFMA 2ESNA 3HB9A 3KZIC 1R49A 5K5OA 3FISA 3GTGJ 2YUSA 3S17J 2Z1DA 2CQKA 4OOIA 1J59A 2LRDA 4CDGA 3K69A 4L5JA 3KCCA 1X1PA 2JUCA 2DA5A 4Q4ZF 3OYJA 4RAFA 3SZTA 2O9LA 4BNCA 3BT9A 3R0AA 3K7AJ 3KEYA 2OQRA 2CUZA 3D0SA 1YOVB 3HYIA 5JHUA 4M6XA 2VE8A 2GA2A 2MH9A 5BNGA 5D5XB 2DMUA 4EVIA 4IEJA 3P9IA 3H5AA 2A6EF 1BW6A 3HG9A 5DCFA 2RVCA 4LG0A 4XLPF 3IKTA 4E70A 3PUBA 2R7SA 1I39A 3NAUA 4FX0A 4GO1A 3I9V2 3H5NA 1LVKA 3OIQA 1E0EA 2O0YA 1W7PB 3GMEA 1MIJA 4IHXA 2BOLA 1NG6A 2BV6A 2G9WA 3CZ6A 2PQ8A 4OAZA 1ITYA 2LBFB 4BXUA 2O8KA 3OYMA 3KYDB 4W97A 2Y0MA 2P81A 2KP6A 1BA5A 1H9TA 2DDAA 2O8XA 3DLAA 1MDMB 3HUGB 2MC4A 4F52A 3RZOJ 3EUAA 1RUOA 1IW7F 2IGKA 2DA6A 1QZYA 2V6EA 1KYWA 4XLCA 2JA8J 2BEOA 4HF0A 3H9GA 4KICA 2NVQJ 4EJWA 1LDJA 1RC9A 1T2KA 1LEAA 2KIUA 2JSPA 4EV0A 1JHHA 2HXOA 1ODDA 4P5OA 1CF7B 1ZREA 2JN6A 3DP7A 3TW7A 2UV1A 3CDHA 4AYBN 2XRLA 5HODA 2MW8A 4AU7A 1P9QC 1BR2A 4M3FA 4DOZA 1TT5B 2LP0A 2X48A 3BWGA 1I27A 3EYYA 4G6TB 4LK1F 3KEQA 3I59A 3Q5FA 4IPAA 2RV8A 4I7HA 3CC4I 3A0BC 4J19A 4M9ZA 2ZBKA 3QPHA 4B8XA 1YW8A 1BM9A 1T95A 3E6MA 3HSFA 1GV5A 3M9AA 2A5YB 2L4AA 3DKWA 4WXHA 3Q3SA 1J2XA 2VXDA 3IRRA 1LFUP 2QUFA 3M4OJ 3BJAA 3FMQA 4XM3A 5ERIA 2LY2A 4WXDA 5KHDA 3TDZC 1WSUA 2NOJB 2OU2A 4CUGA 3E5UA 1MBEA 4KN7X 4P9UA 4ZH4F 2L7FP 2F5VA 3FK7A 1YW7A 4PUSA 2EFWA 3CO6C 3FXQA 3PO3J 4LGWA 2L9NA 3BG9A 5E1WA 2KFDA 3K4LA 2IS2A 4XRSG 1IXRC 3I58A 3ZQCA 3LSIA 1ZR2A 2MD0A 2EIJH 2FX0A 2NS7A 2CMPA 2LK2A 3HHGA 1U2WA 3SQNA 3LSPA 3JRAA 4CCOA 4NHJA 3IH3A 3TOAA 2JSCA 3W6VA 4BGDA 2ZJQF 1UELB 1MH3A 1PVEA 3NEUA 3MFKA 2HTSA 4EATA 3DWLE 3CO7C 1W5TA 3O8GA 4WF2A 4AIJA 2QSGX 2R7VA 3B6AA 1YS6A 3A02A 2FE3A 2EV0A 5F0CA 5B1BH 4E4HA 4XNFA 1TQMA 3GEZA 1TWFJ 3OYNA 2LY1A 2MYSA 3HL2A 1YJWI 2HR3A 2MABA 4M74A 1X2NA 3ZQHA 1ONVA 3ZMTA 2JPCA 1SAXA 5F6FA 3U9GA 3L2RA 3F6OA 1V3FA 4NNJA 1UZCA 3H9JA 4PCQA 4G7OF 5M5YJ 2HOSA 4U0VA 4UVBA 4AD9A 3TL4X 3OYHA 2KPMA 5J1UA 2EA2A 2HNHA 2QGUA 3OYBA 2DOEA 5HDKA 2WAQA 3PM1A 5GPCA 2P5VA 2VXZA 3HPGA 1DU6A 1WI9A 5FKNA 3M7GA 5IP6A 4XOPA 2E1OA 4U0WA 2KRHA 2DQLA 1Z6RA 4M3DA 4PJNA 4M3EA
chains in the Genus database with same CATH topology
2DYRH 5B3SH 1OCRH 3ASNH 3ABKH 2OCCH 5IY5H 2EINH 2EIKH 1V54H 2Y69H 2ZXWH 3AG3H 3AG4H 1OCZH 3AG2H 2DYSH 2EIMH 5B1AH 1OCOH 1V55H 2EIJH 5B1BH 3ASOH 3X2QH 3AG1H 3WG7H 2EILH 3ABLH 3ABMH 1OCCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYR H;  5B3S H;  1OCR H;  3ASN H;  3ABK H;  2OCC H;  5IY5 H;  2EIN H;  2EIK H;  1V54 H;  2Y69 H;  2ZXW H;  3AG3 H;  3AG4 H;  1OCZ H;  3AG2 H;  2DYS H;  2EIM H;  5B1A H;  1OCO H;  1V55 H;  2EIJ H;  5B1B H;  3ASO H;  3X2Q H;  3AG1 H;  3WG7 H;  2EIL H;  3ABL H;  3ABM H;  1OCC H; 
#chains in the Genus database with same CATH topology
 1AKH A;  1SMY F;  1E2X A;  3R61 A;  1XD7 A;  2ZXJ A;  3LAJ A;  1HF0 A;  3VYR B;  1Y1W J;  2E60 A;  2WAD A;  3MAJ A;  5F04 A;  1MGT A;  2XF7 A;  2RDP A;  1DPU A;  3K4N A;  4DGW B;  4YFN F;  3MQ0 A;  3FBI B;  1AHD P;  4XRS A;  2JMW A;  2EZI A;  5JHF A;  3CD6 I;  3BTL A;  4A3B J;  4UUV A;  3BPX A;  3KYC B;  3OSF A;  2A68 F;  1DGR M;  1MJB A;  1P4X A;  4AUX A;  4Y3O A;  4HW0 A;  5CKT A;  2NNN A;  2OJE D;  4M6V A;  4YRV A;  4BS9 A;  1P2F A;  4UVA A;  1HA8 A;  3GZ5 A;  2ZSH B;  2HWV A;  2CS3 A;  2MG4 A;  4ENK A;  3L2C A;  1W36 D;  1DU0 A;  2L2O A;  3JCU C;  4CZZ A;  4RB0 A;  5HLG A;  4A3F J;  5LRR A;  4UUS B;  2V1D A;  3EUH A;  1QBJ A;  3S14 J;  3KP7 A;  4LLL A;  1D5Y A;  1N25 A;  3QOE A;  5CJ9 A;  1W7P D;  4N0B A;  2LLK A;  1X1B A;  5J47 A;  3J7Z I;  1Z3Y A;  2A5W A;  2M34 A;  2QM3 A;  3U21 A;  3GFI A;  2GA1 A;  5EEG A;  5ICC A;  1X1A A;  3H36 A;  1LNW A;  2HQR A;  3K4K A;  3HRM A;  1PUF A;  4K2E A;  4U88 A;  2DTZ A;  1XC5 A;  2Z9O A;  2HVR A;  1WVR A;  2VOO A;  1PDN C;  2CW0 F;  2QBY B;  4C30 A;  1TQI A;  4BKX A;  2OA4 A;  2K9N A;  2MLK A;  4DBQ A;  3HSR A;  2LF8 A;  5HS7 A;  3TP3 A;  1FP2 A;  2JJ7 A;  3W3C A;  3W6J B;  1WRJ A;  1WI3 A;  1VTN C;  3PL8 A;  2Y30 A;  4EMS A;  2G7H A;  3Q0U A;  4IXA A;  2Q1Z B;  1Z9C A;  3AKZ A;  4ABZ A;  3MKL A;  2EJR A;  5GTI C;  1VFC A;  1JUM A;  3RPU A;  3O6B B;  3X2Q H;  4Y7N J;  1YJ9 I;  5GP9 A;  3ZMV A;  4EGZ A;  2H27 A;  4LFU A;  4B47 A;  3WE3 A;  2BY2 A;  4II3 A;  1G8X A;  3FBN B;  4GYG A;  3EUK L;  1I5Z A;  1QZZ A;  1OPC A;  1XSV A;  3DBL B;  4HV6 A;  5BPD A;  2WWY A;  1VQ6 I;  2QEX I;  4Z2Y A;  1R00 A;  1HOM A;  1D8K A;  3E97 A;  5HNF A;  2CQN A;  2E71 A;  3QP6 A;  4XKC A;  5CVI A;  2MH2 A;  4I0A A;  3DCF A;  3RKQ A;  5IPA A;  3SEQ A;  1N77 A;  3H3Z A;  2K9L A;  2VBY A;  2VKD A;  5LEK A;  1IUY A;  4LIT A;  2LKS A;  2GXG A;  2ZME B;  1JE8 A;  4ESJ A;  5E79 C;  3S3N A;  4RBO A;  1HQC A;  2IW5 A;  2V4J C;  5J8C A;  3HOZ J;  2EIK H;  2IP2 A;  2M87 A;  2QQB A;  3IAM 2;  2DW4 A;  5EEH A;  2RGV A;  3M8J A;  5L3F A;  3TMO A;  3ZQQ A;  1MNE A;  4J00 A;  4C3I J;  1FBU A;  3P5J A;  3G4S I;  4NUB A;  1A35 A;  2CO5 A;  2R4G A;  1F1Z A;  2K9Q A;  2JPB A;  3FX3 A;  4EM2 A;  4LIV A;  5EZH A;  1MMS A;  1ZG1 A;  2M3A A;  5J3L A;  2WTE A;  4LIU A;  1FC3 A;  3BR0 A;  4HV5 A;  4CIC A;  2DMP A;  3N97 A;  2YX4 A;  3N4M A;  1BC7 C;  2IXS A;  3DKY A;  3K2A A;  2IS6 A;  2VQH A;  3AG3 H;  3CF2 A;  4HQM A;  4A5N A;  4BAY A;  2R7U A;  2XSD C;  4OMY A;  5FRM A;  1ZAR A;  4XRF A;  4ZJZ A;  3FIW A;  1IN7 A;  2JQ7 A;  1KQ8 A;  1V55 H;  3E0J B;  3JW4 A;  4NC8 A;  3RSN A;  4FT8 A;  4XRM A;  3AFH A;  4BEH B;  2FQ3 A;  5E3L A;  1VQN I;  4EEF G;  4OAY A;  3LFK A;  6PAX A;  4RA2 A;  1D0Z A;  4RM3 A;  1KQ0 A;  1W7P A;  2M7A A;  2DU9 A;  4LLN A;  3JRH A;  5FB2 A;  2R0Q C;  3KLO A;  4IKF A;  1WQ2 A;  4DW6 A;  3GZ6 A;  1WHU A;  3N05 A;  4Q5S F;  3U1K A;  2TDX A;  1OR7 C;  1M1E B;  1LKX A;  3DEW A;  3DTE A;  4H4K C;  2LBF A;  5GAG J;  3BOQ A;  4ANJ A;  5K7H A;  5C4J J;  3KET A;  2HYG D;  2NS8 A;  3P9C A;  4HYE A;  1REP C;  4LOC A;  3I4P A;  1EF4 A;  4IZZ A;  1MDM A;  3HUG A;  2XAQ A;  4HX8 A;  2NNY A;  5E3M A;  5DCM B;  2W1O A;  1KZH A;  2HDC A;  1NTC A;  2E5N A;  3B6C A;  3E6D A;  1Z0X A;  3G3Z A;  1BOA A;  2I5U A;  4MEY F;  2F48 A;  1Y1V J;  3SJM A;  1CF7 A;  1VF9 A;  2YS9 A;  1BI0 A;  2UWM A;  5LFA A;  3S15 J;  2BVM A;  3BCA A;  3PQJ A;  1BW5 A;  4ZZD A;  2FML A;  5FKM A;  3ZQL A;  3EDP A;  1LE8 B;  4U87 A;  4MFD A;  1KU9 A;  3E5Q A;  1JUS A;  1RIO H;  3ZPL A;  5GAH J;  4L0Z B;  4O3M A;  2PEX A;  5LGU A;  3FDY A;  3S1M J;  3M1E A;  1IZ1 A;  1BIB A;  1XX5 A;  2QQ9 A;  3M8F A;  3F21 A;  4LMY A;  1TW3 A;  3DTI A;  3F3X A;  2OD5 A;  5FLX Z;  2KIM A;  3F8M A;  3JAM Z;  2XUB A;  2HQN A;  4F55 A;  1QNT A;  1T0F A;  3CCV I;  4ZTJ A;  4Y13 A;  4HX7 A;  3TED A;  4AVP A;  2PFB A;  1VQP I;  1UAA A;  1ZGJ A;  3ZQF A;  4XMY A;  3HOT A;  3GUD A;  3WU2 C;  1FT9 A;  2W24 A;  1T8I A;  2CGP A;  4RGU A;  2F5D A;  3RQ4 A;  4E7S A;  1WH5 A;  3E5X A;  3BQY A;  1KU2 A;  3S1N J;  4R1H A;  2QVO A;  1FYL A;  5CYV A;  3K70 C;  1WPK A;  3M07 A;  1A36 A;  4RDU A;  3T0Y A;  2FU4 A;  3LST A;  4BXX J;  4Q47 A;  2EV5 A;  3BR6 A;  2A61 A;  2M9H A;  1V5G A;  1ZHF A;  1VI0 A;  4IRH A;  1GXQ A;  1G3Y A;  2VON A;  2JVH A;  4BHC A;  2L7K A;  4XKV A;  1MD0 A;  4L9N A;  1MZB A;  2PX9 A;  5HLH A;  4CXF A;  1Y0N A;  3CMA I;  1X3U A;  1X4P A;  3LSM A;  1S3J A;  2E1M B;  3HHH A;  4CCM A;  2L7M P;  3RZD J;  4OIQ F;  5AIP A;  2L0K A;  2VPL A;  4C3J J;  2BY0 A;  1T33 A;  1A6I A;  2XKP A;  4A6E A;  3PIO F;  3RI4 A;  2WAF A;  4MFE A;  5B1A H;  3JSP A;  4HF2 A;  4GXO A;  3SXY A;  2Y9Y A;  2Y48 A;  4S0H B;  2HKO A;  3C18 A;  3G1M A;  3I0T A;  1MJ9 A;  2E7W A;  3K1N A;  4MTE A;  2AHQ A;  5IOZ A;  4IO9 F;  1NHA A;  4X0G A;  2EIL H;  5FLX K;  4DBR A;  1LB2 A;  2K86 A;  3C2G A;  4L9T A;  2VN2 A;  2O6G E;  1ACI A;  1LDD A;  1T08 B;  1UJ8 A;  4IJA A;  1PUF B;  1SVL A;  1P7J A;  4KIF A;  1W5S A;  3BLY A;  4IVN A;  3O8H A;  3WHB A;  2FUG 2;  1V5F A;  4D5F A;  2VBW A;  2XSJ C;  3FXU A;  4IF4 A;  2AS5 F;  1HXD A;  5FD5 A;  1N78 A;  1KYZ A;  2PJP A;  5JVG F;  3ASO H;  2LR8 A;  2FXA A;  1B9N A;  2FBI A;  3MWM A;  1XSD A;  4A3D J;  5A2Q K;  1IUF A;  4M9S A;  4E7K A;  2N8G A;  1S29 A;  2XIG A;  4RGX A;  4YII A;  1YG2 A;  1R71 A;  1G6N A;  1ZLJ A;  2HPI A;  1U6G A;  3V8L A;  4HQE A;  3HKZ A;  4F3Q A;  5IYC J;  4ZYH A;  3MKZ A;  1K79 A;  3I54 A;  3DV8 A;  5M5W J;  3HDD A;  1VQL I;  1UG2 A;  1K6Y A;  1TBX A;  2DBB A;  3HRT A;  1MMN A;  3F23 A;  2NOG A;  3BDD A;  5F1J A;  4KT6 A;  4BJT A;  4P9F A;  3CJQ B;  2HQ5 A;  4A3L J;  2BVL A;  4M3G A;  1VQK I;  3H35 A;  2M1B A;  1WWX A;  4UUS A;  2IEK A;  4HX4 A;  4AWX B;  1JXS A;  1QA6 A;  1BC8 C;  1XTA A;  5F1R A;  3HJE A;  3BZ6 A;  4PDK A;  3VFZ A;  4I6Z A;  2NS0 A;  2QCO A;  4CHU A;  2R92 J;  5IP7 J;  1J9I A;  1TWC J;  2R7Z J;  3PSF A;  2QBY A;  2LG4 A;  4KIB A;  2F2E A;  4BAC A;  3PNV A;  5ED4 A;  2XF6 A;  3ULQ B;  4JOM A;  3ZOB A;  5CQG A;  1FIA A;  3PFY A;  2Z3Y A;  1FYK A;  1XPX A;  2IGO A;  1FLI A;  3ZMD A;  3FHZ A;  1VQ8 I;  3RIR A;  2ME0 A;  2DFI A;  3VYS B;  4PK4 A;  4P96 A;  4EM1 A;  1ZRC A;  2CW8 A;  1BIA A;  1ZK8 A;  3L00 A;  4BU2 A;  4BE2 A;  4C9Y A;  4U0Y A;  3BJO A;  2V1X A;  1UHW A;  2DFE A;  4MO7 A;  5HVQ C;  1B72 B;  2L9S A;  5M3F J;  2NXN B;  1D5V A;  4ZDL A;  3IRQ A;  2R7T A;  2H94 A;  4D1Q A;  4IHV A;  3OYA A;  5LRS A;  1STZ A;  2DA1 A;  1SFK A;  2RQP A;  1FOW A;  3JTH A;  3GXO A;  2QKL B;  2E5Z A;  2XB5 A;  3B73 A;  4RS8 A;  2KIQ A;  5HS8 A;  3BG3 A;  3LA3 A;  1OYW A;  2BGC A;  3GVA A;  2EIM H;  2OAZ A;  1XN7 A;  1I3Q J;  3V42 A;  2KRC A;  2ZME A;  4XQF A;  2HEO A;  4RB2 C;  1T56 A;  3V8J A;  3PSI A;  1P7I A;  2LSO A;  2MGQ A;  3FKI J;  3HRU A;  3IC7 A;  4G12 A;  4I2O A;  1HBX G;  3WTV C;  2L02 A;  1I50 J;  4B3A A;  3VWB A;  2RC4 A;  4BQQ A;  1IGN A;  5EJC A;  2D1H A;  2DOA A;  2WA0 A;  3LMM A;  2KDZ A;  3RTR A;  3KEO A;  1WJF A;  2PLY A;  4YIF A;  3EQL F;  1YX3 A;  3AG4 H;  3ESW B;  5FJ8 J;  5TRD A;  3DF8 A;  1XGO A;  2COB A;  2F4M B;  3BR5 A;  1X1C A;  3DPU A;  2P6S A;  3WTY C;  2CV0 A;  1Z21 A;  2DT5 A;  2IS1 A;  1PYV A;  3KZZ A;  3IH4 A;  4HNU A;  3W2A A;  1ZKG A;  4S05 A;  1B8I B;  5ICF A;  1TC3 C;  4N4O B;  2E2H J;  2EA4 A;  1ZQ3 P;  4C2U A;  3D1N I;  3K2Z A;  4A3I J;  2FF4 A;  1MSF C;  3DEE A;  5E3N A;  5KVR A;  5K5R A;  1SD5 A;  2VJI A;  2DMQ A;  2RAE A;  2X51 A;  3BCB A;  4BEH A;  1FP1 D;  2ZB9 A;  2JA6 J;  3TOB A;  1S7O A;  3SFZ A;  2Z16 A;  4W1U A;  4G7H F;  3KP5 A;  2W00 A;  3BJ6 A;  1UHM A;  2WB1 N;  1R7J A;  4MEX F;  2WY8 Q;  3T5X A;  5KAF C;  4XN0 A;  5JLX A;  2L54 A;  4I09 A;  2IRF G;  5J8F A;  5DS9 A;  2XAG A;  3QPS A;  5JR3 A;  2V79 A;  3ONQ A;  1AA7 A;  3FXM A;  2Q8K A;  5AON A;  1DDN A;  2CSO A;  4CCK A;  2HS5 A;  1FIP A;  2QF7 A;  3K1M A;  1XGS A;  2STT A;  4YFK F;  1GVJ A;  5DEQ A;  3OYI A;  3H1C A;  2VQL A;  4R8H A;  3WU0 A;  2CQ7 A;  4A12 A;  5LGT A;  2MA3 A;  4CGZ A;  5DCM A;  1MMD A;  1FEX A;  1XDU A;  2RQQ A;  3ROU A;  4MHG A;  3GO5 A;  1FOX A;  2R7W A;  1SC7 A;  3QRF F;  4ETS A;  1TP4 A;  2PMZ A;  2BY3 A;  1HDD C;  3KPH A;  2K4J A;  2G7U A;  4BHP A;  4ZYE A;  1X2M A;  3K10 A;  4Y52 J;  1LE8 A;  2DOD A;  2WY7 Q;  2KDO A;  3A0H C;  3H92 A;  2NVT J;  3CME I;  1JJ8 C;  3CC2 I;  3TW6 A;  1R58 A;  1HLV A;  2HYJ A;  1R23 A;  3ZGK A;  3RJP A;  5J4Y A;  5H6R A;  4ZYD A;  4P55 A;  1U9N A;  4LB6 B;  4FE7 A;  3VPR A;  1BJZ A;  4I0B A;  1ZRD A;  3K4B A;  1FMV A;  1J75 A;  3S8P A;  4I02 A;  2PI0 A;  4A3J J;  1Y56 A;  1ERD A;  1U8B A;  3ZN1 A;  2CH0 A;  2O5R A;  4C2T A;  2OV7 A;  2RKH A;  1LEB A;  4ZZL A;  2D5V A;  3CMM A;  1YRN B;  3EUH C;  2OF7 A;  1SAN A;  3JRI A;  4G94 A;  2GM4 A;  2F6C A;  5C44 J;  2PJR B;  3FXJ A;  2K40 A;  3FF5 A;  5FD6 A;  2IA2 A;  3LA7 A;  1IF1 A;  2DXI A;  4M73 A;  3A1Y A;  3CCQ I;  3HOY J;  2IVM A;  4XLA A;  3OYF A;  1OCP A;  2BW3 B;  2NVY J;  1WJE A;  2E34 A;  1KQ9 A;  1OMI A;  1ORK A;  2ADU A;  1S72 I;  3G1L A;  4G6D A;  1XCB A;  2P6T A;  2Q0O A;  2TCT A;  4XSZ F;  1ZG3 A;  2L9R A;  1RET A;  3QPL A;  3QYF A;  3CC7 I;  3K4J A;  4BY7 J;  3TQN A;  1XCV A;  3ERM A;  2EV6 A;  4C3H J;  1BI3 A;  2FBK A;  3CJT B;  3ABT A;  4HSR A;  1F4K A;  2K02 A;  5IY5 H;  5TGT A;  1BBY A;  3L2Q A;  3OOU A;  2LKX A;  5IT9 K;  4CSW A;  3MKY B;  3E6B A;  4ESF A;  2CG4 A;  4CYC B;  2Z33 A;  3LFU A;  2IBD A;  1YFH A;  1O3T A;  2DFF A;  4BJ6 C;  4BBS J;  3ABU A;  2PMH A;  1Z7L A;  3WU1 B;  3GFL A;  2XRN A;  4JQF A;  1OQY A;  4XID A;  2GLO A;  5B66 C;  3CCS I;  2Y0S A;  5HLI A;  1SVM A;  1O7F A;  2DCE A;  2DA7 A;  4PJJ A;  4DYR A;  4BDZ A;  2O7O A;  3CDL A;  3IUO A;  3MCZ A;  2F5E A;  2LH9 A;  3CJN A;  2GIV A;  4IOC F;  3HZJ A;  1KON A;  4Z6Y A;  1FSE A;  2JK3 A;  5HNH A;  2IT0 A;  1IDZ A;  1JTX A;  2IPQ X;  1W5C C;  2JUG A;  5D5W B;  2ECC A;  5K1Y A;  3KP4 A;  4IL6 C;  2AQE A;  4CH7 A;  1RR7 A;  2E7X A;  3RPQ A;  3GTO J;  3ABM H;  4E7H A;  1XGN A;  1Q1H A;  4BBR J;  3OMY A;  5TJJ A;  4EJU A;  2DJN A;  1P4A A;  4XOT A;  3VOD A;  4FCY A;  2YPR A;  1TNS A;  1YJN I;  2XGE A;  5D5U B;  1ENH A;  2J5P A;  2GAU A;  2JVG A;  4CO8 A;  3GLX A;  4A0X A;  5HOO A;  1U0J A;  4EJT A;  1QVU A;  3RKW A;  1A31 A;  1DGW Y;  5DYM A;  1ZR4 A;  4MLO A;  1JTY A;  3LWF A;  2ZNZ A;  2ID6 A;  2ZJR F;  4XSX F;  1MND A;  1O3S A;  1SMT A;  4RAY A;  3OS1 A;  3P7N A;  3I55 I;  1O3Q A;  4XIC A;  1JKO C;  1YX5 A;  4M71 A;  5CVU A;  2KJB A;  4IHW A;  3HXL A;  5DD4 A;  2V9K A;  4A3E J;  2F5F A;  4KUM A;  2AXT C;  5J1R A;  1SFE A;  1YIJ I;  1W36 C;  3U2R A;  3V4G A;  1I6X A;  1QHH D;  2M5W A;  3F9K A;  1JGG A;  2ELJ A;  1KU7 A;  2OTJ I;  3CES A;  5EZG A;  4A3M J;  1IRZ A;  1S8N A;  2L01 A;  3VSL A;  1S9H A;  3BR2 A;  3L1P A;  1W1W E;  4YEJ A;  4NQW B;  4EQQ A;  1OJL A;  3CP2 A;  2QA4 I;  3F22 A;  4RB1 A;  1E3P A;  5ILV A;  3WTW C;  1JT6 A;  1Z7U A;  1U5T B;  4X1E A;  1IJW C;  4M3B A;  2EWN A;  3PO2 J;  1WGX A;  2YU3 A;  2BY1 A;  4QIW N;  4PSW A;  3OR2 C;  1H89 C;  4B43 A;  3J81 Z;  4H0E A;  5F08 A;  5E3O A;  1GUU A;  4ITV A;  3S2W A;  2XAH A;  1BI2 A;  3DQV C;  2CFO A;  4NC7 A;  3OOP A;  1MBJ A;  4DQ2 A;  1RZ4 A;  1QPM A;  1B4A A;  1R5I D;  3HGG A;  3QU3 A;  3FWE A;  4UB6 C;  3OS0 A;  3CQZ J;  4L0Y B;  4UB8 C;  5GPA A;  1Z77 A;  1Y8Q B;  4DNC A;  4B1R A;  3GTQ J;  2CYY A;  3BG6 A;  2Y75 A;  1QHG A;  4F91 B;  4U7D A;  5E8G A;  3VOE A;  5D8L B;  4JK1 X;  4IQ4 A;  1U3E M;  3QAH A;  5GAD J;  5F64 A;  1ETY A;  1ZGW A;  4JP0 A;  2K85 A;  3NRV A;  3NWT A;  3GTK J;  1YHQ I;  4C2M J;  2A05 A;  3KE2 A;  4BUP A;  4E7L A;  2DA4 A;  3DTK A;  4HBL A;  3S2D J;  2A6T A;  1HW1 A;  2IAI A;  5ICE A;  4BH9 A;  4IHS A;  3J7A O;  3Q0W A;  3CUO A;  1B72 A;  4BYY A;  5CPR B;  4KMU X;  3L2W A;  3E6C C;  2COM A;  1J5Y A;  1ZN2 A;  1T0F C;  1XMX A;  2V6C A;  3WTX C;  5BPI A;  3ZRG A;  4UNO A;  5CVR A;  2HVS A;  5FKO A;  4OIO F;  1Z6T A;  3JSO A;  2LNB A;  1CQT A;  5EDN A;  3ECH A;  4I01 A;  1GHC A;  1UB9 A;  4IOA F;  2JT1 A;  2YSR A;  2A69 F;  3BZC A;  4L5E A;  2KJC A;  4KJZ A;  3F8C A;  2DQR A;  2X6O A;  3RDI A;  1IAW A;  3Q0V A;  3DBH B;  2X6X A;  4B09 A;  1DPR A;  4AIH A;  4KIG A;  4AYB A;  4R79 A;  5H2F C;  4NB5 A;  3WOD F;  3COA C;  4XL9 A;  3V7C A;  3BRO A;  3LNQ A;  4AVZ A;  1K6O A;  4Y33 A;  3MEX A;  2PMU A;  5B3S H;  3J81 K;  3UKG A;  2I10 A;  2XVC A;  2VC0 A;  4TV7 A;  1LUJ B;  3I53 A;  1QO0 D;  2DFH A;  2JWT A;  2VKV A;  2W82 A;  2ME6 A;  3OYE A;  1X19 A;  2MBF A;  1FYM A;  2Q2E B;  5FGM A;  2IJL A;  2DDB A;  3HRS A;  4OIR F;  2Y2Z A;  2MSY A;  2O61 A;  1B8I A;  3BTC A;  5LLQ A;  1R1V A;  1SD7 A;  1SAU A;  4BXF A;  1U8R A;  2P5K A;  2CFX A;  3BP8 A;  1FX7 A;  5LEJ A;  2DYR H;  4CCJ A;  1BN5 A;  1OCR H;  2HVQ A;  2X4H A;  3GF2 A;  1GLN A;  1R4N B;  2JA2 A;  1H88 C;  2G0E A;  3LQR A;  4I98 B;  3QYE A;  2LD5 A;  4MGR A;  3ZQ7 A;  3M8E A;  2KIS A;  2W4S A;  4MIM A;  3KIO A;  2UXN A;  2E1C A;  4EJO A;  2VC1 A;  3ERE D;  1IV8 A;  4L9J A;  1G2H A;  2NRA C;  1OYY A;  2V1N A;  2VL8 A;  4D7M A;  2VKH A;  5KAI C;  3LSR A;  1D1C A;  2STW A;  3F6V A;  4A3G J;  2FOW A;  1EH6 A;  5L3B A;  1O57 A;  4JX5 A;  1I1S A;  2XB0 X;  2EFP A;  2W7N A;  2Y9Z A;  1K83 J;  4AM3 A;  3IH2 A;  1HSJ A;  1HKS A;  4QPO A;  5A2Q Z;  1O4X A;  4HNV A;  1IG7 A;  1OCZ H;  3KLN A;  4ESB A;  2X9D A;  5D5V B;  3H9Q A;  1KA8 A;  1TLH B;  3SHF A;  3TP0 A;  5H20 A;  1FJL A;  2CUF A;  4LG3 A;  3RYP A;  4KDP A;  1TZL A;  4WXC A;  5GAE J;  5DM7 F;  3QP5 A;  2F4I A;  2K7L A;  2CQX A;  4PGH A;  4EGY A;  3BY6 A;  3REO A;  4FX4 A;  2O03 A;  1PUE E;  3K0L A;  2LY9 A;  5E1X A;  1NG7 A;  4UY8 I;  2Y69 H;  1ETX A;  2ZXW H;  3WTU C;  2WAQ N;  2Z99 A;  2EFO A;  4PJM A;  4F92 B;  5D4R A;  1HKQ A;  5CVV A;  3F0C A;  3H3U A;  2FBH A;  4Q48 A;  2MLG A;  1G3S A;  1POG A;  1OYI A;  2DT6 A;  5FKL A;  2VBX A;  2ELH A;  3QYB A;  3TO7 A;  1YRN A;  1FWZ A;  3GZN B;  4N9H A;  2M45 A;  4HDU A;  2L3D A;  3RYR A;  1OIS A;  2EZK A;  2F4O B;  2KIF A;  2X0L A;  1O3R A;  3D5S C;  1Z1D A;  2HDD A;  5L3E A;  2PJR A;  5EGO B;  3G2B A;  2OTL I;  4E7Z A;  3LA2 A;  3ECO A;  1H0M A;  2R7F A;  3ZMS A;  3HOV J;  2WC2 A;  4KIT B;  5E20 A;  3WE2 A;  1X3W B;  2BW3 A;  2KLO A;  4ZDO A;  1D0Y A;  1SFO J;  2KZG A;  5J4V A;  4XBF A;  2CV2 A;  4KYW A;  4XKB A;  2Z5U A;  4ENJ A;  2VJ5 A;  2XDV A;  2DYS H;  3CLO A;  3VB2 A;  2GXA A;  3JRG A;  5K7F A;  2X1E A;  3CCE I;  1MBF A;  5JLW A;  2E36 A;  1T39 A;  4V2F A;  2FEZ A;  2XAU A;  4XK4 A;  5KNL A;  3BQZ A;  2VUM J;  2CUJ A;  2M4G A;  3GTL J;  1E17 A;  4M9X A;  1RKW A;  4WWC A;  4WK8 F;  1TNT A;  3HTU A;  2FQ4 A;  3KZY A;  1DP3 A;  4J01 A;  4DZJ A;  4MTD A;  4CYC A;  2H8R A;  1WJC A;  1VZ0 A;  3GW2 A;  2OUM A;  3OY9 A;  4BL0 B;  4A2U A;  4KIS A;  3DFG A;  2OQG A;  2MD5 A;  3L2U A;  1WCM J;  2BYV E;  2X6W A;  3HBL A;  4BQO A;  2D2W A;  2KKO A;  4GYI A;  1LFP A;  2K3F A;  2W25 A;  4IX7 A;  4ON0 A;  2DMN A;  4O6J A;  5K5Q A;  1SEU A;  1WH7 A;  4YEL A;  1JKR C;  3HOW J;  3GWZ A;  3O3K A;  2LF7 A;  5CLS A;  1K7A A;  1YQA A;  3KX2 A;  2KHM A;  2L4M A;  1OFC X;  2ZME C;  3E7L A;  4AC0 A;  1BI1 A;  2VOD A;  4F7Z A;  1YW9 A;  1IRF A;  5HDN A;  3PJR A;  3R6S A;  4B44 A;  1R5H A;  3GCM A;  1NK2 P;  4DIQ A;  1VND A;  2VOP A;  4RAZ A;  4HG2 A;  4RGS A;  2QKM B;  1R1U A;  1OCC H;  2EK5 A;  3GTM J;  1MKM A;  2W85 A;  2P8T A;  2BXZ A;  2ZCW A;  2R7D A;  2P4W A;  2HOA A;  2IA0 A;  2D1V A;  3JRF A;  1HST A;  2D45 A;  1C0W A;  1JI8 A;  3D5L A;  1AWC A;  3G71 I;  4ASN A;  1LQ1 A;  1ZH5 A;  2HOT A;  1X1D A;  3C7J A;  5ICG A;  4GRI A;  5BMZ A;  3E3V A;  2DLL A;  2ZJ2 A;  2XAS A;  3R4K A;  1ON1 A;  2BZT A;  5HDG A;  2PN6 A;  2XC7 A;  3JRD A;  3QWL A;  4FET A;  5EG0 B;  1T98 A;  1SD6 A;  2L9V A;  4BQA A;  1R36 A;  1APL C;  4LK0 F;  1MSE C;  2KZV A;  1PJR A;  2P5L C;  5J40 A;  3IWF A;  2RNJ A;  2GOX B;  4ENM A;  1Z67 A;  4JX4 A;  3T8R A;  3CP8 A;  2E2I J;  2AQF A;  4B48 A;  1A5J A;  3S2H J;  2V26 A;  1BJA A;  3DKX A;  3HC7 A;  1F36 A;  5E18 F;  1IN8 A;  2XPV A;  3K4C A;  3FXL A;  3OL3 A;  1ON2 A;  4X6A J;  2H1K A;  4BHB A;  5IYB J;  1FZP B;  4IRG A;  4NQW A;  2VT3 A;  2V7F A;  1Y6I A;  5FRN A;  3HEF A;  3SDG A;  4IHY A;  3M1C A;  1U5T A;  5L3D A;  3GYH X;  1I1G A;  4HLY A;  2Y31 A;  1D3Y A;  5TIS C;  2ZKZ A;  5IP9 J;  1OCT C;  5FLV A;  3CUQ B;  4CZC A;  3SZP A;  4LB5 A;  3EYI A;  2VJ4 A;  4B4C A;  5EF6 A;  2HOE A;  3BC8 A;  3LQQ A;  2AXL A;  2JA5 J;  1R4M B;  5LGN A;  3OYG A;  1T38 A;  1LVA A;  1R5G A;  2K9M A;  2OZ6 A;  2IS4 A;  2BXY A;  1XGM A;  3ZR8 X;  3LSG A;  1B6A A;  1V5E A;  3KP6 A;  3T8T A;  2QLZ A;  2FJ1 A;  2YX7 A;  2JRT A;  3CCM I;  2C6Y A;  1QPI A;  2ELK A;  1FOK A;  3F8N A;  3PQK A;  1D1B A;  5EEA A;  2OC6 A;  4LLG F;  5D6E A;  5BOX A;  1CGP A;  4MQV A;  1ETO A;  5C4X J;  4KA4 A;  2O3F A;  2QQ8 A;  1G3T A;  4GGG A;  3BG5 A;  3FXR A;  3SZG A;  1X4O A;  3RQI A;  2KRF A;  3ZCO A;  3UR3 C;  2FSW A;  2UUZ A;  2ZO4 A;  3PUF A;  2VJJ A;  5D6F A;  4HEA 2;  4KT5 C;  2JA7 J;  1D1A A;  4OU0 A;  4HDV A;  3SFI A;  3TKY A;  2ISY A;  4DJA A;  2LKP A;  2H6B A;  4KFC A;  3B02 A;  4B3X A;  1UMQ A;  2R7X A;  3IP4 B;  4GDF A;  1MW7 A;  2M0C A;  3JRC A;  1IRX A;  5KK1 A;  3HPH A;  1JT0 A;  1ZAO A;  1XMA A;  4D5C A;  5E17 F;  1TT0 A;  2K9S A;  1IN4 A;  3RKX A;  1EKE A;  1K78 A;  1BL0 A;  1IO2 A;  4OMZ A;  1D0X A;  3GFM A;  1KU3 A;  1FOY A;  2XAJ A;  5HS9 A;  4EJV A;  1XG1 A;  4YFX F;  2HZT A;  4O5V A;  3JRE A;  1GV2 A;  2NYX A;  3CCU I;  1A6Q A;  5IT9 Z;  1TQP A;  1P6R A;  3TBI A;  5C3E J;  2CW7 A;  3CF5 F;  2DPD A;  2OPT A;  2Z2S B;  3D5R C;  2P0W A;  1VQ4 I;  4A0Y A;  1ZLK A;  2YR2 A;  1J7K A;  3K4M A;  2X1C A;  1RRJ A;  4HST A;  4LJZ F;  4P1W A;  2EIN H;  3WTT C;  2Q2E A;  3ML6 A;  3S1R J;  1EJ9 A;  2E1M C;  2QSH X;  2JRM A;  1S6L A;  1WJB A;  1R6R A;  5LHH A;  3JRB A;  1MNM C;  1RES A;  2CV1 A;  4Y17 A;  3ZMZ A;  1DUX C;  3CCR I;  1ZYR F;  1BR4 A;  2ISZ A;  3GTP J;  4JBA A;  3VYU B;  2OZU A;  2QZ8 A;  3K9T A;  3W6K B;  3CCJ I;  1DQU A;  2GWR A;  5JFR A;  3FHN A;  3I5U A;  4KMF A;  3ELK A;  5J1Y A;  3RPU D;  4UHT A;  4YG2 F;  3A01 B;  3PFI A;  2VLA A;  3MZH A;  4CYD A;  4PJ0 C;  1PP8 F;  1F5T A;  1K61 A;  2LYC A;  4PZJ A;  2VPR A;  3WG9 A;  2DN0 A;  4FQG A;  1A04 A;  1IV6 A;  5EYR A;  3CJR B;  1IXS B;  4N9I A;  4QSH A;  5IT3 A;  3DU5 A;  2B9S A;  2CUE A;  1Z91 A;  3R60 A;  2LTP A;  4BE1 A;  5LD2 C;  3I4N J;  2DPU A;  1HW2 A;  1FTZ A;  1SFU A;  1OLT A;  1S7E A;  1YTY A;  3WGG A;  2LMD A;  2CWE A;  2DO7 A;  2LFB A;  4XON A;  1E3H A;  3KP2 A;  1SVO A;  2HYF A;  1IRG A;  3WTZ A;  2FMY A;  3TGN A;  3LAP A;  2VE9 A;  2FRH A;  2MFZ A;  2DA3 A;  2XAF A;  4DYC A;  4IQJ A;  4HF1 A;  3PIP F;  1TWH J;  1VQO I;  2KL4 A;  3HGY A;  4PGG A;  3C2B A;  2JTV A;  2XRO A;  3L2V A;  1W4M A;  3VDX A;  4XLF A;  2OBP A;  1D8J A;  1YIO A;  1JKQ C;  3OIP A;  4KNY A;  3TO9 A;  1UG0 A;  2M8E A;  3LSK A;  1LPQ A;  3KP3 A;  3QOP A;  3OS2 A;  2HZD A;  1P4W A;  4V2G A;  3FM5 A;  1YYV A;  2M4K A;  4QPQ A;  3MN2 A;  1I3A A;  3DPT A;  3SDB A;  4UV9 A;  3F72 A;  4BY1 J;  1JUP A;  1PP7 U;  4AIK A;  2EFN A;  4CA0 A;  2A07 F;  5M5X J;  3WGH A;  2WV1 A;  4Y4R A;  2KQR A;  1W0U A;  2E19 A;  4DYQ A;  2R5Z B;  2HDW A;  1AOY A;  1SD4 A;  3IHU A;  4HPQ A;  2DK5 A;  2DAO A;  1L3L A;  2VQG A;  2CU7 A;  3OIO A;  3SEZ A;  5BS6 A;  5EGO A;  2X6Y A;  2IA1 A;  1X58 A;  1YS7 A;  3CDI A;  1UHS A;  1ZTR A;  3HOX J;  3M3Y J;  4RMN A;  1YIT I;  2ZFU A;  5FKK A;  1P92 A;  3E1S A;  3HKZ N;  4ZYA A;  5FO5 A;  2XKO A;  3HM5 A;  4QLC U;  1IC8 A;  2E1N A;  1FTT A;  3LSH A;  5L3G A;  1QRY A;  2XGC A;  3OYL A;  2HPM A;  4A6D A;  2QQA A;  4A93 J;  3OSG A;  3KYL A;  4BQN A;  3NWS A;  4CCL A;  4XKW A;  1SFX A;  4A0Z A;  1MH4 A;  1TWG J;  1WJD A;  4WCG A;  3IAS 2;  2OCE A;  3BTI A;  1MBK A;  2LC2 A;  4WX9 A;  1RI7 A;  2QYO A;  1YE9 A;  4ZC3 A;  4RGR A;  5E1Z B;  3U1D A;  2R5Y B;  2XHK A;  4FTH A;  4HAM A;  1ZG5 A;  3L09 A;  1EH7 A;  1TWA J;  1WJA A;  3BR1 A;  2QSF X;  4IRI A;  1B59 A;  2DT7 B;  2ETH A;  4PSX A;  3Q9V A;  4ZTF A;  2LDU A;  2EPF A;  3EET A;  4PFP A;  1JJ6 C;  1ZRF A;  2YU9 J;  3V7S A;  1QVT A;  3CCL I;  3FXO A;  1XSX A;  4FE4 A;  4XR6 A;  2VT2 A;  4L9V A;  1XDS A;  3FK6 A;  3S3O A;  2VAS A;  2XGX A;  3J80 Z;  3MKW B;  4UV8 A;  3S3M A;  3ASN H;  3T1B A;  1QU3 A;  2X1D A;  1TTY A;  1W0T A;  3CUQ C;  1G4D A;  2E35 A;  5B5E C;  3FMS A;  4LG0 B;  3OV8 A;  3JR9 A;  4MNU A;  2L5Q A;  2HU9 A;  2ZXH A;  4RLQ A;  3WGI A;  1FMW A;  2V9P A;  1WZ2 A;  1R9T J;  1B9M A;  1JGS A;  2ZXI A;  5IOY A;  2W57 A;  2A6H F;  4OWR B;  4ZDP A;  4V19 K;  1UCR A;  4BE0 A;  2V1U A;  1IXC A;  1N75 A;  4HLX A;  4XLH A;  1USS A;  2ZJP F;  1FBS A;  1XB4 A;  2NVU B;  5DDG A;  2DK8 A;  3AL0 B;  3LSJ A;  1G59 A;  1B1B A;  1JHF A;  2KT0 A;  3IWZ A;  3QU6 A;  2BBY A;  2CJJ A;  4G6Q A;  2VI6 A;  5EG0 A;  2ESH A;  2DA2 A;  1S7A A;  4JX6 A;  2RNG A;  1MBG A;  1Y39 A;  3H3V K;  3W2V A;  1HKT A;  4D0P A;  5LBQ A;  3J7Y J;  5GTH C;  4M6Y A;  3S32 A;  3VYT B;  3HIF A;  3CMY A;  3IL2 A;  4BJ5 C;  3BR3 A;  4JYK A;  2GXB A;  1MMA A;  2WBM A;  1MJA A;  2R7R A;  2RN7 A;  1L0O C;  3A4C A;  3MMY B;  3RCO A;  3CTA A;  4I99 C;  5HLT A;  1S5L C;  1ETV A;  2ZFW A;  3I59 B;  1XMK A;  4G8X A;  2EZH A;  3VEP A;  1AU7 A;  2H1L A;  3I4M J;  1Y8R B;  3DEU A;  2R7O A;  1F43 A;  2GOM A;  2K3P A;  3ZMU A;  2H8W A;  2VQC A;  3ZP5 A;  3CUQ A;  4RAG A;  4DZP A;  4IHT A;  5F0F A;  5IYD J;  3OR1 C;  1WFX A;  5AIQ A;  5ILS A;  3J80 K;  1GXP A;  1K78 B;  9ANT A;  2B63 J;  2UXX A;  2DTR A;  1F9N A;  5JI6 A;  3S16 J;  5M3M J;  4NDL A;  2HFH A;  3A2K A;  5K7Z A;  4BDY A;  3P9K A;  1LJ9 A;  5F27 A;  5BQT A;  2UZK A;  2PG4 A;  1HW5 A;  3ABK H;  2QWW A;  3V7R A;  1I6H J;  3FXK A;  2EFQ A;  3AAF A;  2V9V A;  1ETW A;  3I56 I;  2BE5 F;  2HKX A;  2K5C A;  2LVS A;  2K4B A;  2VKE A;  1J0R A;  2XPW A;  3LOC A;  2ZSI B;  3RKY A;  1ETK A;  2J5O A;  1LDK B;  2DOF A;  3JTG A;  1QQI A;  1WKM A;  1JKP C;  3F8F A;  2H09 A;  1BR1 A;  3AG1 H;  2BHZ A;  3WG7 H;  5ILU A;  4QTR A;  1VQ5 I;  2NVX J;  3W2W A;  4EM0 B;  2WB1 A;  5LHG A;  3K70 D;  2DMT A;  3BPV A;  1EV7 A;  1OKR A;  2KMU A;  5LHI A;  1H9G A;  4XOR A;  3L7W A;  3HSE A;  3HOS A;  1XS9 A;  1T6S A;  4E7J A;  2IGN A;  1ETQ A;  3DU6 A;  3OL4 A;  1GT0 C;  3ISP A;  2GQQ A;  4L5I A;  3VSK A;  4FIS A;  5DM6 F;  3IKV A;  1IDY A;  2PMZ N;  2HGC A;  3LL7 A;  3FMR A;  2GBY A;  3S93 A;  3HOU J;  2W48 A;  4XLE A;  4GCV A;  1R22 A;  1FY7 A;  1QGP A;  5KCM A;  2ZNY A;  4HA8 A;  1MMG A;  1Y0U A;  1FBQ A;  3QQA A;  2M7B A;  2OCC H;  2CRG A;  4UVC A;  1HDP A;  2GIZ A;  5L3C A;  5FFZ A;  3HTS B;  4A69 C;  4YIR X;  1VQM I;  4UUT A;  1OR7 A;  3OYC A;  1OCO H;  1MBH A;  5DTD A;  3I64 A;  2XGD A;  3K1P A;  2R7Q A;  3R0J A;  1Q1V A;  4AID A;  3C1D A;  2MC3 A;  1EA3 A;  1TW2 A;  4OIP F;  1GDT A;  3MZY A;  3GTJ J;  5F0H A;  1BOB A;  2GZW A;  3C3W A;  1G3W A;  3TO6 A;  2P7C B;  1UST A;  3H5R A;  4HRI A;  2I8D A;  1AKH B;  4FAS D;  2HQA A;  3OYK A;  2VB6 A;  2QEN A;  4PFO A;  2K27 A;  4N4N B;  4RLF A;  4XLN F;  1V4R A;  4FHT A;  3TDU C;  4UXN A;  1U9O A;  3CCY A;  4L18 B;  4F93 B;  2F5C A;  3V8K A;  4I76 A;  2R3S A;  3BG7 A;  2XV4 S;  1VQ9 I;  5FFX A;  3A01 A;  2HXI A;  3DXJ F;  3NQO A;  4LD5 A;  1IN5 A;  3BTJ A;  3FZV A;  3OWT A;  2B7E A;  1RKT A;  2TRT A;  2M30 A;  1TL8 A;  5J6X A;  3PNT A;  1IN6 A;  3I71 A;  3ZN0 A;  1V54 H;  1RR8 C;  1K4S A;  1NK3 P;  4S04 A;  4D9J A;  1FNN A;  1YLF A;  2E2J J;  3AG2 H;  1O7L A;  2M8G X;  2RRE A;  3CLQ A;  5E8I A;  4G7Z F;  1H8A C;  1ULY A;  4RB3 C;  2CQQ A;  1QZE A;  2VIX A;  3MVP A;  2WV0 A;  1EH8 A;  2Y0S N;  3ABL H;  2EQR A;  3JAM K;  2HI3 A;  4NC6 A;  2EZL A;  3WTS C;  2EBI A;  2ACJ A;  2M0M A;  4Y15 A;  1YI2 I;  3ZQI A;  4A3K J;  4NBQ A;  3ZQG A;  4HNT A;  5FLM J;  2X85 A;  4GFB A;  4RM2 A;  3K6G A;  4OIN F;  1HCR A;  5D8K B;  4M72 A;  2EH3 A;  3WHC A;  2DJI A;  1NH3 A;  1X3Z B;  4CCN A;  1RPW A;  5FRO A;  3PNY A;  2ECB A;  5DUK A;  4E6K G;  3J7A Y;  2AO9 A;  2DI3 A;  3FM3 A;  2H6C A;  1R1T A;  2HTJ A;  3G1O A;  4ENN A;  3UNG C;  2PBI A;  1YO5 C;  3KFW X;  3L9F A;  3QPT A;  2A3S A;  2JZY A;  4HZF A;  2FA5 A;  1LFB A;  2FNP A;  3H0D A;  2WAE A;  1HC8 A;  1DP7 P;  5H6Q A;  2FNA A;  2M2E A;  4PJL A;  2R5Z A;  4II2 A;  1VQ7 I;  5DV5 A;  1FPQ A;  3BZK A;  2NAZ A;  3G73 A;  3SYT A;  1RNL A;  4A3C J;  1U5T C;  3MZ8 A;  3C2H A;  5DUI A;  2R93 J;  3GLL A;  5CVJ A;  1RUN A;  4XN3 A;  3I3L A;  3O2P E;  3FKJ A;  4G9Y A;  1E3O C;  3IV5 A;  3DLL F;  5D4S A;  3F8B A;  5JVT A;  1GVD A;  2ID3 A;  3A03 A;  3Q9S A;  1J09 A;  5CQE A;  4MQ9 F;  2VBZ A;  3MD2 A;  1U78 A;  3GFJ A;  1Z3X A;  4QWQ A;  2B0L A;  4KN4 X;  2ICW G;  5DD8 A;  3GBG A;  2W84 A;  1KGS A;  2BHY A;  3AL0 C;  3QOD A;  3EPZ A;  4A5M A;  3S1Q J;  2XF5 A;  2FD5 A;  2EB7 A;  3GX4 X;  2LRE A;  1FSH A;  2IGM A;  2L7Z A;  1ZEL A;  2FOK A;  3H0G J;  1Z05 A;  3DPL C;  4HOB A;  2LOO A;  4E7I A;  3ZXS A;  3G6E I;  2P7V B;  2R5Y A;  4ZYG A;  3OYD A;  1K4T A;  2XPU A;  3DBR B;  1WJ5 A;  1ZGA A;  2ZC2 A;  4U7B A;  4D7N A;  3NAR A;  1UFM A;  2ESN A;  3HB9 A;  3KZI C;  1R49 A;  5K5O A;  3FIS A;  3GTG J;  2YUS A;  3S17 J;  2Z1D A;  2CQK A;  4OOI A;  1J59 A;  2LRD A;  4CDG A;  3K69 A;  4L5J A;  3KCC A;  1X1P A;  2JUC A;  2DA5 A;  4Q4Z F;  3OYJ A;  4RAF A;  3SZT A;  2O9L A;  4BNC A;  3BT9 A;  3R0A A;  3K7A J;  3KEY A;  2OQR A;  2CUZ A;  3D0S A;  1YOV B;  3HYI A;  5JHU A;  4M6X A;  2VE8 A;  2GA2 A;  2MH9 A;  5BNG A;  5D5X B;  2DMU A;  4EVI A;  4IEJ A;  3P9I A;  3H5A A;  2A6E F;  1BW6 A;  3HG9 A;  5DCF A;  2RVC A;  4LG0 A;  4XLP F;  3IKT A;  4E70 A;  3PUB A;  2R7S A;  1I39 A;  3NAU A;  4FX0 A;  4GO1 A;  3I9V 2;  3H5N A;  1LVK A;  3OIQ A;  1E0E A;  2O0Y A;  1W7P B;  3GME A;  1MIJ A;  4IHX A;  2BOL A;  1NG6 A;  2BV6 A;  2G9W A;  3CZ6 A;  2PQ8 A;  4OAZ A;  1ITY A;  2LBF B;  4BXU A;  2O8K A;  3OYM A;  3KYD B;  4W97 A;  2Y0M A;  2P81 A;  2KP6 A;  1BA5 A;  1H9T A;  2DDA A;  2O8X A;  3DLA A;  1MDM B;  3HUG B;  2MC4 A;  4F52 A;  3RZO J;  3EUA A;  1RUO A;  1IW7 F;  2IGK A;  2DA6 A;  1QZY A;  2V6E A;  1KYW A;  4XLC A;  2JA8 J;  2BEO A;  4HF0 A;  3H9G A;  4KIC A;  2NVQ J;  4EJW A;  1LDJ A;  1RC9 A;  1T2K A;  1LEA A;  2KIU A;  2JSP A;  4EV0 A;  1JHH A;  2HXO A;  1ODD A;  4P5O A;  1CF7 B;  1ZRE A;  2JN6 A;  3DP7 A;  3TW7 A;  2UV1 A;  3CDH A;  4AYB N;  2XRL A;  5HOD A;  2MW8 A;  4AU7 A;  1P9Q C;  1BR2 A;  4M3F A;  4DOZ A;  1TT5 B;  2LP0 A;  2X48 A;  3BWG A;  1I27 A;  3EYY A;  4G6T B;  4LK1 F;  3KEQ A;  3I59 A;  3Q5F A;  4IPA A;  2RV8 A;  4I7H A;  3CC4 I;  3A0B C;  4J19 A;  4M9Z A;  2ZBK A;  3QPH A;  4B8X A;  1YW8 A;  1BM9 A;  1T95 A;  3E6M A;  3HSF A;  1GV5 A;  3M9A A;  2A5Y B;  2L4A A;  3DKW A;  4WXH A;  3Q3S A;  1J2X A;  2VXD A;  3IRR A;  1LFU P;  2QUF A;  3M4O J;  3BJA A;  3FMQ A;  4XM3 A;  5ERI A;  2LY2 A;  4WXD A;  5KHD A;  3TDZ C;  1WSU A;  2NOJ B;  2OU2 A;  4CUG A;  3E5U A;  1MBE A;  4KN7 X;  4P9U A;  4ZH4 F;  2L7F P;  2F5V A;  3FK7 A;  1YW7 A;  4PUS A;  2EFW A;  3CO6 C;  3FXQ A;  3PO3 J;  4LGW A;  2L9N A;  3BG9 A;  5E1W A;  2KFD A;  3K4L A;  2IS2 A;  4XRS G;  1IXR C;  3I58 A;  3ZQC A;  3LSI A;  1ZR2 A;  2MD0 A;  2EIJ H;  2FX0 A;  2NS7 A;  2CMP A;  2LK2 A;  3HHG A;  1U2W A;  3SQN A;  3LSP A;  3JRA A;  4CCO A;  4NHJ A;  3IH3 A;  3TOA A;  2JSC A;  3W6V A;  4BGD A;  2ZJQ F;  1UEL B;  1MH3 A;  1PVE A;  3NEU A;  3MFK A;  2HTS A;  4EAT A;  3DWL E;  3CO7 C;  1W5T A;  3O8G A;  4WF2 A;  4AIJ A;  2QSG X;  2R7V A;  3B6A A;  1YS6 A;  3A02 A;  2FE3 A;  2EV0 A;  5F0C A;  5B1B H;  4E4H A;  4XNF A;  1TQM A;  3GEZ A;  1TWF J;  3OYN A;  2LY1 A;  2MYS A;  3HL2 A;  1YJW I;  2HR3 A;  2MAB A;  4M74 A;  1X2N A;  3ZQH A;  1ONV A;  3ZMT A;  2JPC A;  1SAX A;  5F6F A;  3U9G A;  3L2R A;  3F6O A;  1V3F A;  4NNJ A;  1UZC A;  3H9J A;  4PCQ A;  4G7O F;  5M5Y J;  2HOS A;  4U0V A;  4UVB A;  4AD9 A;  3TL4 X;  3OYH A;  2KPM A;  5J1U A;  2EA2 A;  2HNH A;  2QGU A;  3OYB A;  2DOE A;  5HDK A;  2WAQ A;  3PM1 A;  5GPC A;  2P5V A;  2VXZ A;  3HPG A;  1DU6 A;  1WI9 A;  5FKN A;  3M7G A;  5IP6 A;  4XOP A;  2E1O A;  4U0W A;  2KRH A;  2DQL A;  1Z6R A;  4M3D A;  4PJN A;  4M3E A; 
#chains in the Genus database with same CATH homology
 2DYR H;  5B3S H;  1OCR H;  3ASN H;  3ABK H;  2OCC H;  5IY5 H;  2EIN H;  2EIK H;  1V54 H;  2Y69 H;  2ZXW H;  3AG3 H;  3AG4 H;  1OCZ H;  3AG2 H;  2DYS H;  2EIM H;  5B1A H;  1OCO H;  1V55 H;  2EIJ H;  5B1B H;  3ASO H;  3X2Q H;  3AG1 H;  3WG7 H;  2EIL H;  3ABL H;  3ABM H;  1OCC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...