3AG1H

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 280 k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag1H00
3AG1H 3ASNH 2EIJH 5IY5H 3ABKH 3ABMH 1OCOH 1OCZH 2DYRH 2ZXWH 2Y69H 5B3SH 3AG3H 1V55H 2EIMH 2EIKH 2EINH 3AG4H 3ASOH 2EILH 1V54H 2OCCH 5B1AH 1OCCH 3ABLH 1OCRH 3AG2H 3X2QH 2DYSH 3WG7H 5B1BH
chains in the Genus database with same CATH superfamily
1XG1A 1WWXA 2NYXA 4G9YA 1MKMA 1KQ0A 4BKXA 3LSPA 4HLYA 3BJAA 2LKPA 5TJJA 4I02A 2W85A 2JSPA 3HOVJ 4I09A 5IT9Z 2ZJRF 2LY1A 2KRHA 3FXQA 4ITVA 4OOIA 2R7DA 3RZOJ 1MZBA 1FOKA 1Y8QB 4CSWA 3OL3A 4M72A 3I56I 1Y8RB 3D5RC 1LEBA 1B1BA 2V6CA 3JW4A 5F04A 1A36A 4E7JA 2HGCA 2M5WA 1WVRA 2E1CA 2WB1A 1J7KA 2KPMA 2M3AA 1IRZA 1Y39A 4IQJA 2DA4A 3CMEI 4E7ZA 1Y56A 1KONA 2OZ6A 3JAMK 2HU9A 3IV5A 1OISA 2IGNA 4C3HJ 4ENKA 1S29A 2XGEA 5HS7A 3KZYA 3BG5A 3ZQCA 3EETA 2WAEA 3KX2A 2DI3A 3OL4A 4MQVA 1LFBA 2WV0A 2YU3A 1S5LC 1R1VA 2P7VB 5H6QA 3CCEI 1XCBA 4BQNA 1ZGJA 1V4RA 2X85A 1T33A 1YIJI 4DQ2A 1R58A 3C7JA 4I01A 4MTDA 1WFXA 1T2KA 2ELHA 1K79A 1FBQA 4CCMA 2XB5A 2ZMEC 4HAMA 1U5TA 4J19A 5DCFA 5LEJA 4D7NA 1W5TA 1O3SA 3BJ6A 3JSOA 2W4SA 1MH3A 4X1EA 5LGNA 2VXZA 2CV0A 5DD4A 3WU0A 5ICEA 2CQXA 2UZKA 4EJWA 3A1YA 5HOOA 1MBEA 1W4MA 4ENNA 3ZGKA 2QSGX 2W7NA 1U8BA 2DT7B 3E5UA 2ID6A 1NK3P 2BE5F 3ZN1A 1AWCA 3LMMA 1UMQA 5C44J 3QYBA 1DP7P 5KK1A 2EQRA 4ZTFA 2L3DA 1ERDA 3DBLB 4Z6YA 4BHCA 3JRGA 3DXJF 1A5JA 2F4OB 4EMSA 3B73A 3S1RJ 5LD2C 2X6WA 3IRRA 1LQ1A 3I64A 2ADUA 2CUZA 3SZTA 3TDUC 5EDNA 2FU4A 3K70D 1BOBA 1OFCX 2P5KA 1G3WA 1F43A 3MKLA 3L1PA 4ANJA 2STWA 4D5FA 4DZJA 3LWFA 1G8XA 1JUSA 5GPAA 5K5QA 1D5YA 1N25A 1POGA 2XGXA 3GFJA 2FNAA 3UNGC 3OS1A 1VQ6I 4AVZA 3GFIA 5D4RA 3HTUA 2ZC2A 1Q1HA 3A0BC 3PNYA 3MKZA 2DBBA 3I4MJ 3V8JA 3HDDA 3HRUA 1YW8A 3LSIA 3L2VA 1I3QJ 3BLYA 4RLQA 1GXQA 5IOYA 4PJ0C 1HW2A 4JX5A 2XF6A 4M9SA 3KPHA 4ZH4F 3TOBA 5J1RA 1YRNB 1FTTA 3OY9A 3UR3C 4CH7A 4XRSA 1ZR4A 2H8WA 4V19K 3WTZA 2W82A 1ORKA 3H3UA 4HQMA 1YE9A 4XM3A 3D5SC 2QZ8A 2Y69H 5DUKA 3IKVA 4XKWA 4JYKA 4QPOA 5L3GA 2A69F 4PDKA 5GAGJ 3H3VK 3OYCA 5E3LA 4OAYA 3FISA 1K61A 2RNGA 2E1NA 3Q9SA 3TO6A 4ZDPA 4C3JJ 3PSFA 3T5XA 4IJAA 5EG0B 1YW9A 2CJJA 2DYSH 2VKVA 2ECBA 2NAZA 3CTAA 2Y30A 4PZJA 2Y31A 1LVAA 4CXFA 3DLLF 4OAZA 5D6FA 1W36D 1XDUA 2O8KA 4D1QA 1F5TA 4C2UA 2HQRA 2WBMA 2YUSA 4L9TA 1PVEA 3FF5A 5JLWA 2JA8J 5FFXA 5AONA 4ZYHA 4KT5C 4F91B 1I1GA 2LR8A 4LG3A 4D5CA 4EJVA 3E6BA 5FRMA 3HOUJ 4E7LA 2X1DA 1A35A 2JPCA 1IDYA 4HZFA 4L9VA 2BXYA 9ANTA 1E2XA 1K78A 1Z7UA 2LY2A 4IHXA 3KEYA 5E3NA 3W2VA 2GQQA 3DTEA 5DCMB 1YJWI 2AHQA 3HOTA 1XMXA 1CF7A 3GTKJ 4PSXA 3CO7C 1T39A 3OYFA 2R93J 3MWMA 5BS6A 3DTIA 3L2UA 4LD5A 2NS8A 2QSFX 2TCTA 3M7GA 3T8RA 1WSUA 1VQNI 5M5YJ 2CGPA 5CKTA 4OIPF 4NB5A 2WY8Q 5BQTA 1HBXG 3EUAA 2WY7Q 5HLHA 2MBFA 3HRTA 3BC8A 2NS7A 3K4JA 2E5ZA 1KGSA 2JUCA 2D1HA 3CZ6A 3I55I 2XGCA 3BDDA 5BOXA 1RETA 3KYDB 2R92J 4NC6A 3ZMUA 5A2QZ 1IF1A 3MKWB 4KDPA 2HVRA 1SD4A 5ICFA 2M30A 2XKOA 1FX7A 3CMYA 1TT0A 1X3ZB 4HA8A 2Y0SA 4IHSA 4X6AJ 2ISYA 3KLNA 2COBA 1E17A 1RRJA 4XICA 2XROA 2JA5J 2KT0A 1VQ4I 5TGTA 5EYRA 2X4HA 2K85A 1OCPA 3F0CA 2KL4A 4XKBA 5JVTA 3U21A 4G6QA 3TDZC 3IUOA 4IVNA 4F7ZA 1H88C 3ZMTA 1K4SA 4NBQA 2QQAA 1W5CC 1FOXA 2A6TA 3EUHC 4FASD 3FXOA 1ZELA 1Z6TA 2IS2A 3ABUA 3AG4H 1J5YA 3E6DA 2DMPA 5E3MA 5IP7J 1J0RA 3S16J 4NC8A 3FHNA 5FKNA 2FQ4A 1YO5C 3CJNA 4MFDA 4YEJA 1WKMA 2L4AA 4C30A 3DKXA 2FMYA 3GXOA 3N05A 4BU2A 5IYCJ 2Z33A 1G59A 5EZGA 3E0JB 4LG0B 4RGSA 4LITA 4DGWB 4ZYGA 2DLLA 2GZWA 3IWFA 4YFKF 1DP3A 1MBGA 1EH6A 1I6HJ 4A3DJ 3RPUD 3CUQA 2CQNA 2OUMA 5FKOA 3TW6A 2Y9ZA 2HDDA 3M1EA 2HXIA 3OS0A 2VQCA 2AO9A 1ONVA 3K1MA 3G4SI 4PGGA 4KIGA 3ZOBA 4ZZDA 2FBIA 1P7JA 2A5WA 2HOAA 3P9IA 2BYVE 3GTJJ 2V1NA 3M8JA 1X1DA 2E2JJ 4BHBA 2XAUA 1ON2A 4P9FA 4RGRA 4EQQA 3DFGA 2LBFB 1IN7A 5FLXK 4JX6A 2HFHA 2GWRA 1JXSA 2E34A 2XAQA 2ZBKA 3HIFA 1BBYA 1H8AC 1MMAA 2M8GX 3KE2A 3L9FA 1QBJA 1X4OA 2AXTC 2P6SA 4RMNA 3SEZA 4QIWN 3E5XA 2ACJA 2M1BA 4CCJA 3S1MJ 4HNUA 1IDZA 2VKHA 3ISPA 3ERED 4AVPA 4DYQA 1BJZA 2GM4A 1TWCJ 4UVCA 2DODA 3OYHA 2OJED 3WGHA 2HOEA 3JAMZ 5E79C 3GZ5A 3DTKA 3RKXA 2MFZA 3RPUA 1X3UA 1K6YA 4BEHA 3ABTA 1ITYA 4HBLA 2XAHA 3A4CA 1J09A 3TQNA 1ENHA 2BY0A 2OQGA 1ZLKA 4NHJA 3B6CA 2M4GA 1YS7A 4UB6C 1MGTA 1R1UA 4IKFA 1Z91A 1N77A 2DA5A 2MH2A 1Z1DA 4EM1A 1OYIA 1V5EA 3WHBA 3WTSC 4U0VA 4A3CJ 3CQZJ 3HC7A 3N4MA 2EV6A 4LB5A 1HW1A 1LDJA 2Y2ZA 4H0EA 3DP7A 3M8EA 2EZLA 5DUIA 1U6GA 2KMUA 3OYJA 5CQGA 1R36A 2K86A 1JT0A 2HVQA 2VASA 2VC0A 4KYWA 2CQQA 4PJLA 5GADJ 1I5ZA 2F5VA 1Y1VJ 3GUDA 4IEJA 2K4JA 3FMQA 5F0CA 3J7YJ 3M3YJ 4XSZF 1JKRC 2BHYA 3VDXA 5ED4A 5L3CA 1EF4A 2H27A 2L02A 3C2BA 3VYTB 1J75A 1WJCA 4P55A 3AFHA 2O3FA 3DF8A 4YIFA 4UY8I 5M5WJ 3EYIA 2L5QA 4WF2A 2I10A 4RB2C 4XN0A 2VJIA 4FQGA 3IH3A 1FLIA 1HKQA 4BY7J 3BPXA 1FY7A 2VQHA 5BMZA 1W0UA 1BI1A 2VPRA 3F72A 1DQUA 1XGOA 1YHQI 3GTQJ 2NVYJ 1RZ4A 1NG6A 2MC3A 4A3EJ 2V1UA 2A3SA 3E5QA 3KP2A 3PSIA 2QEXI 4IOCF 2DPUA 3GTMJ 5GP9A 2EH3A 2QKLB 3BCBA 3C3WA 2HWVA 3MVPA 4BYYA 2CRGA 4EGZA 1PP8F 2DMUA 2ID3A 4M3DA 5HS9A 4C2MJ 5E8GA 2DT5A 4BH9A 2JRMA 3GTOJ 1XMKA 3KP7A 2EJRA 2F6CA 3CP8A 3MZ8A 2JK3A 2IS4A 1PUFB 1K7AA 2Z1DA 1O3RA 2XPUA 3WE3A 3AL0C 1IXCA 2JZYA 3KP4A 2G0EA 1Z05A 4HNVA 4M6VA 4RB0A 4I76A 4C9YA 1R71A 1MSFC 1FWZA 1PYVA 2NVXJ 1KZHA 1FBUA 2ELKA 2HPIA 3S1NJ 1XGNA 2L9RA 2R7FA 1HSTA 2DXIA 2A68F 5CVIA 2M7AA 1YIOA 4G12A 4DOZA 2G9WA 1WQ2A 4BACA 1VQ9I 4LIVA 5L3FA 1O3TA 4UUSA 3HHGA 4CZZA 2NOGA 5LRSA 3I3LA 1ETOA 1XSXA 4II3A 4A3IJ 2PLYA 2GAUA 3PL8A 2W1OA 3A01B 4HX4A 2JVGA 1GVJA 2HQAA 1WRJA 3KYLA 1FSHA 3BG6A 2JUGA 2ICWG 4D7MA 5BPDA 3JRHA 2IBDA 2N8GA 3WGGA 5EEHA 5IYBJ 5E1XA 3MN2A 3GFLA 4ZDOA 2WA0A 4BHPA 5ERIA 3QWLA 2HYGD 5GTIC 4GYIA 5IPAA 2P4WA 1Z77A 1Z3YA 4A0XA 3MFKA 3FK6A 2M0CA 1VQ7I 2FSWA 1FIAA 3NRVA 4A93J 2E1MC 1L0OC 2EPFA 1FMVA 3EUKL 3B6AA 3VB2A 3WE2A 2LD5A 1SVOA 2RDPA 1OJLA 2CG4A 2OTJI 4A3MJ 1FC3A 4QLCU 1YS6A 4M9ZA 4J01A 4HNTA 1G4DA 2EWNA 2IS6A 3TOAA 4HX7A 4R8HA 5CVJA 3V42A 1D8KA 3BCAA 1UCRA 1HOMA 3BR6A 4NQWA 1REPC 2ZKZA 3NEUA 3HOWJ 1KA8A 2EINH 3I58A 3SZGA 3VSLA 3K4CA 4ABZA 2PMZN 5EZHA 2RV8A 2ZNZA 1MSEC 1ZLJA 4RAFA 1H0MA 3JRFA 4ZDLA 1ZRFA 3BG3A 1TNTA 4K2EA 1B8IA 1R4NB 2DU9A 2L2OA 2MD0A 2CU7A 2ZJPF 1ULYA 3BR2A 1ETYA 1MDMA 1P7IA 2LSOA 4ZTJA 2C6YA 3KCCA 4GFBA 1SD7A 4RAGA 3WTTC 4HV5A 2K9MA 5CVUA 4ETSA 1DPRA 5EGOA 1YW7A 4IHYA 2EA2A 3EYYA 4YIIA 2E36A 4ZJZA 2RGVA 2CV2A 2COMA 4M3BA 3Q0WA 2YX7A 2ZB9A 2BW3B 2DOFA 2OCEA 4B8XA 1YYVA 5GTHC 1E0EA 5J47A 1X1PA 2QKMB 4Y52J 3TO7A 2W25A 4B3AA 2VE9A 1FT9A 2K9NA 2LF8A 1VQKI 4E6KG 5K7ZA 1BW5A 2AQFA 1RUNA 1D0XA 5M5XJ 3J81K 3IH4A 1RPWA 1U5TC 2UXNA 3W3CA 4BS9A 1LKXA 1BW6A 5E1WA 4V2FA 2E1OA 2JWTA 2VOOA 1XCVA 1R1TA 2EV5A 4A5NA 2QENA 3T0YA 3W2AA 4S04A 3OYLA 4O5VA 1HLVA 3I54A 5F0FA 1QNTA 2IT0A 1E3HA 3HXLA 2G7UA 2ZNYA 4KMFA 2HQNA 2NVQJ 4FT8A 3L2WA 4L0YB 2KRCA 3BWGA 2M7BA 4Y4RA 2B7EA 3BQZA 2M4KA 3LSMA 3F9KA 2VBXA 3TW7A 4WK8F 3FXKA 5EJCA 3U1KA 5KVRA 4I7HA 4UNOA 4JOMA 1B72B 3PO2J 4MEXF 4Z2YA 3OMYA 4XRMA 3KP5A 1CGPA 2H94A 4CYDA 4C2TA 4PJJA 3VSKA 3I4NJ 5IP9J 4N0BA 4Y17A 3V7CA 2QVOA 2R5ZA 1OCCH 4CYCA 3D0SA 4WXCA 2AS5F 4UV9A 3K7AJ 4GO1A 4ESBA 4BDZA 1YQAA 5KNLA 5IY5H 3M07A 3PNVA 3HYIA 4XNFA 4WXDA 2W84A 2L01A 1G6NA 4XLNF 2QBYB 4BQOA 4EEFG 4YG2F 3FBIB 4AIHA 1RIOH 1HKTA 4Y33A 5HODA 5FLVA 3VEPA 3W6JB 3TO9A 1ZTRA 4GYGA 5DEQA 4Q4ZF 1GDTA 5IYDJ 1SC7A 2BY3A 2EZKA 1U3EM 5CVVA 4B4CA 2O9LA 2E7WA 1IW7F 1UHMA 2KJCA 5JR3A 2NNNA 4FX0A 2M45A 2NRAC 4EM2A 4MLOA 1S7OA 3CLQA 2IA1A 2VBWA 2GXAA 3JSPA 3F8MA 3RKQA 3K70C 3QYFA 3F22A 1D0ZA 2NXNB 1O57A 2Y9YA 3HJEA 4PCQA 3E7LA 2RQPA 3AKZA 2HTJA 2K3FA 4CUGA 1GT0C 1RKTA 4HPQA 1YX5A 1ODDA 3OV8A 4MNUA 4DJAA 4KN7X 4RGUA 3F8FA 4R1HA 4U7DA 1BC7C 4U0WA 3HG9A 3LSJA 5H2FC 3WTXC 2PI0A 1YX3A 1V3FA 3L7WA 1X58A 1S9HA 5B66C 1OMIA 1U2WA 2MLKA 2WC2A 4AU7A 2FA5A 2CUJA 1IRXA 3TKYA 1S7AA 3FXLA 3FM3A 3HOZJ 2PJPA 2LMDA 3CESA 5FD5A 4I2OA 3WG7H 4GCVA 3F8CA 1QRYA 4JP0A 3TMOA 3BR1A 3HM5A 3OYNA 4EJUA 2FD5A 5HDGA 5LHIA 1X2NA 1MIJA 2PN6A 1XB4A 3ABMH 3ERMA 2K9SA 3I53A 5BNGA 4YFXF 1I3AA 3H92A 2OD5A 3C2HA 3QPTA 5FKKA 4YFNF 5IP6A 5JHUA 4E7KA 2GXBA 2E5NA 1OQYA 3KYCB 2HQ5A 2RNJA 2O61A 1WJBA 1R5GA 1JE8A 2RKHA 3DCFA 2R4GA 4A0YA 1TWFJ 1GLNA 4B48A 2B9SA 1M1EB 1ZGWA 3ZMVA 2QQBA 1Y0NA 4MHGA 3O8HA 2Q1ZB 3RQ4A 1X3WB 2ZMEB 2KRFA 1RUOA 2LH9A 5FKLA 2E2IJ 3HRMA 3GTPJ 2BVLA 1W36C 3ZQFA 1SAXA 2JVHA 2WAQN 1SD5A 3DPTA 1FSEA 2HS5A 4P1WA 5CQEA 2ZXWH 4BJ5C 4HOBA 2ESHA 3I59B 2XVCA 2P81A 2FOWA 1LUJB 4A69C 3MEXA 3TL4X 5D5UB 2LYCA 3PIPF 2O6GE 3BTIA 3O8GA 4KISA 2EILH 2D45A 4A5MA 1D1CA 3SDBA 1A6QA 4EVIA 1RR7A 4L5IA 2ZXHA 2F5DA 3DPUA 5GAHJ 4P9UA 2CQ7A 2FNPA 2XASA 1YRNA 3NQOA 4BL0B 3M1CA 3VYRB 5EEAA 3S1QJ 3K4KA 3HEFA 2LP0A 2XKPA 4EJTA 4G7OF 3FMRA 1R5HA 3S8PA 1BL0A 1U78A 4JK1X 1Z0XA 3J80Z 2YS9A 1WPKA 3OYMA 4M71A 3PFYA 1AA7A 3JRDA 1IO2A 2LFBA 4XORA 4LB6B 2KDOA 2P8TA 3CDIA 2XIGA 3G71I 1MNDA 4D9JA 2ZXIA 3JREA 3ASNH 2I8DA 3RKWA 5EG0A 3GCMA 4XRSG 3ZQGA 3LFKA 3CUQC 2XB0X 2R5YB 3FMSA 4QWQA 1LDKB 4U87A 3CC7I 2V7FA 2GOXB 5H20A 3F3XA 3Q5FA 4PFPA 1JGGA 2KJBA 4KJZA 3OYKA 1ETWA 2FXAA 2LRDA 2OQRA 3T1BA 3G3ZA 1BR4A 3SHFA 2X51A 1TQMA 3LOCA 3J7AO 2DFIA 2XAJA 1H89C 2BV6A 1GVDA 3VWBA 4HF0A 2QQ9A 1IV6A 4FHTA 5F0HA 3MCZA 3SEQA 3NAUA 3RCOA 2Q0OA 2XPWA 3W6VA 2D1VA 4RLFA 3H5AA 4BAYA 3Q0VA 5EEGA 2KIFA 4A3FJ 2DA2A 3VYUB 2X6OA 3QU3A 5ILUA 5DCMA 1TQIA 3BY6A 5DS9A 2A5YB 4KNYA 2WADA 4E7HA 2IW5A 4J00A 5E8IA 1U9OA 3KZZA 2OCCH 4U88A 2KHMA 2XRNA 2HZTA 4BGDA 1A6IA 4M3EA 1C0WA 1D5VA 4PGHA 1I39A 4ESJA 1QO0D 2DQLA 1QHGA 1RR8C 3GVAA 3H0DA 3CCRI 3HUGB 4OIQF 4RGXA 3OIOA 4ON0A 2X6YA 1JHHA 4LK0F 3AG3H 4XBFA 3NWTA 4G7ZF 1KU3A 1OLTA 1R00A 4NUBA 1F4KA 2QQ8A 3HOXJ 2K7LA 4KT6A 3WTUC 3RPQA 2W00A 3GZNB 4GGGA 4M6XA 3VFZA 1V54H 3JTGA 4AYBN 4UUTA 2FJ1A 1MJAA 4E7IA 2YR2A 2YPRA 3E6CC 2P7CB 1UG2A 1XC5A 3BTLA 2DDAA 5JLXA 1OR7A 4GRIA 3H0GJ 2Z3YA 1G3YA 1MBKA 2EA4A 3OYBA 2UV1A 5FJ8J 2WWYA 3BPVA 1PDNC 1GHCA 4OIRF 5J4VA 2L4MA 4D0PA 3RKYA 2EIKH 1TC3C 1LVKA 3ZQIA 4XLCA 2EZHA 4BXUA 3ASOH 4HRIA 1SVMA 3HSFA 4UVBA 3E1SA 1BI0A 3KETA 2KZVA 2FE3A 4G94A 2EV0A 2Z5UA 4RM2A 2IA2A 1VF9A 5FO5A 5J8FA 3WGIA 3QOPA 1D1BA 1VQ8I 2EFNA 1R5ID 4LG0A 1OCZH 2DCEA 4F55A 2VOPA 3LAJA 1MJBA 4RAZA 2F48A 2AQEA 3C18A 5FLMJ 1APLC 1HC8A 3CC4I 1QQIA 3SFIA 3FIWA 1YFHA 1TLHB 3COAC 2ETHA 3KEQA 1ZRCA 2VB6A 2OF7A 2DQRA 3RSNA 1JT6A 4CCKA 1QZZA 4A2UA 4E70A 3DEWA 1F1ZA 3ESWB 2KIMA 3FXMA 3CCLI 2VBZA 4XIDA 4YRVA 5KCMA 3K4LA 1YTYA 2ECCA 1IN6A 2GOMA 2DJNA 2LBFA 2OBPA 1ZN2A 5HNHA 2QYOA 3ZQ7A 4ZZLA 5KHDA 3R0AA 1NK2P 3HKZN 5ILSA 3I5UA 1ZKGA 2RREA 2L0KA 2VIXA 3R6SA 4ESFA 4L9NA 2H8RA 1DU6A 4CCNA 2BGCA 1BR2A 3KZIC 3CCUI 1OYWA 5TRDA 3BR3A 3F6VA 3OIPA 1N78A 4A3BJ 5HDNA 3K69A 1T0FA 4Q48A 3GZ6A 2IRFG 2DTZA 2VJJA 4LIUA 2M9HA 4WXHA 2R7UA 1IV8A 1WHUA 2FF4A 3CCSI 1BR1A 4XSXF 4IPAA 5DTDA 3HOSA 2QUFA 3HL2A 4MFEA 2Q2EB 4UV8A 4ASNA 1T95A 4GDFA 2RVCA 2XV4S 2A6HF 1XSVA 3ZMZA 5M3FJ 1HCRA 1IUFA 4AD9A 3CF2A 3DBHB 1IRFA 1EA3A 2HNHA 1R7JA 1ZHFA 3S3MA 3Q0UA 1PJRA 4KN4X 2V4JC 3OOUA 5HDKA 3E6MA 3H1CA 4BE2A 5K7HA 1S8NA 3UKGA 3GEZA 3V8KA 2ME0A 3S93A 5J4YA 2VJ5A 1SFKA 3G1OA 5HNFA 5K1YA 2QLZA 4W97A 2E7XA 4Q47A 5ILVA 1JKOC 4WCGA 1V5FA 1B59A 4A3JJ 3DV8A 3V8LA 2ZO4A 2WTEA 1LNWA 2L7MP 1TWAJ 3EQLF 4E4HA 3HGGA 4XR6A 2G7HA 2PMUA 3A0HC 3BR0A 4IQ4A 1KU7A 3FXJA 4M6YA 3FWEA 2DOAA 2VN2A 3MQ0A 2M87A 3P9CA 3OWTA 2CUFA 3K4NA 1IRGA 4FX4A 2LOOA 1P4WA 3FK7A 3HOYJ 2CW7A 4KICA 5IOZA 2PBIA 2PX9A 2DO7A 2W48A 3QOEA 4XLEA 4F3QA 4KA4A 2STTA 1MH4A 1OKRA 1R22A 1HW5A 3BG7A 5M3MJ 2Z16A 4DYCA 4FISA 1Z21A 3OOPA 2A07F 1WH7A 1EH8A 4Y7NJ 3ABLH 4CDGA 1RI7A 2ZCWA 1JJ6C 1W7PB 1AHDP 3LSRA 2ZFUA 5J3LA 1LPQA 4LGWA 4LFUA 2CW8A 1IGNA 3BJOA 1Y0UA 2ZJQF 2DT6A 3R61A 2KIUA 2R7XA 1SANA 1VI0A 4IHWA 3RI4A 3ML6A 4UB8C 1J9IA 1UHWA 1PUFA 3CD6I 1XDSA 4GXOA 1TQPA 1S3JA 1WH5A 1B9MA 4BY1J 3F21A 2V9PA 2BVMA 2A61A 5CYVA 5HS8A 3GTLJ 2LVSA 4O3MA 1E3OC 3F8BA 4FETA 2KDZA 3SJMA 2KQRA 4N4OB 1W0TA 1JUPA 4DBRA 1MNEA 3WODF 3FM5A 1DU0A 2VE8A 1FEXA 1WJAA 3K0LA 5J40A 1T6SA 3PJRA 3SZPA 2HR3A 2CH0A 3QPLA 2HPMA 1U9NA 1RNLA 2PJRB 1J59A 1D8JA 1UELB 2XC7A 2PMZA 3SDGA 2GA2A 5HLTA 1DPUA 5H6RA 3H5NA 3KEOA 4MIMA 3A01A 1KU2A 2VQLA 1XGMA 1VNDA 2X1CA 4XKVA 4HSRA 2F4MB 3Q9VA 2K9LA 1JHFA 4IRHA 2O0YA 3BTJA 3OYEA 3D1NI 3P5JA 1DGWY 4S05A 4ZYAA 2BBYA 4RA2A 3ZP5A 3ZR8X 2HYJA 4DYRA 3AL0B 5TISC 3T8TA 3VYSB 3FKIJ 4HDUA 3BZKA 3CC2I 1ETKA 1SFOJ 3L09A 3G6EI 4WX9A 1JJ8C 1HQCA 4AIJA 1B8IB 1AKHB 3WTYC 2DTRA 2J5PA 3QPHA 1LE8B 1UB9A 2K4BA 2CS3A 1IN5A 2YSRA 5LBQA 4I6ZA 2QGUA 4XN3A 4BXFA 4LLNA 2DFEA 1FMWA 2OAZA 3GYHX 3FX3A 1FJLA 2DMTA 3OYGA 3F8NA 4A3KJ 2NVTJ 5LHGA 4PK4A 2M2EA 4CZCA 1USSA 3A2KA 1V55H 3M9AA 5LFAA 4BQAA 5D8LB 5A2QK 3JRCA 2OPTA 1GV5A 2BZTA 1IXRC 2MD5A 4OIOF 1UHSA 1HDPA 2NOJB 1JI8A 2QA4I 1OCRH 3H5RA 1IZ1A 2FQ3A 2PMHA 1FNNA 4HLXA 2NVUB 4HG2A 4KITB 4RS8A 3ULQB 4BXXJ 2E19A 1A04A 2EIJH 2F4IA 2DFHA 2WV1A 4HX8A 4V2GA 3RYRA 1YI2I 5L3DA 2JRTA 2TDXA 1R23A 5J1YA 1P92A 1GXPA 2A05A 2E1MB 5J1UA 1TWGJ 5K5RA 3DU6A 3H9JA 4OWRB 1BC8C 2RC4A 5D4SA 1N75A 1CQTA 1UFMA 5E17F 3IL2A 1DUXC 2OU2A 1IAWA 4Y3OA 4HF2A 3CJRB 5DV5A 1QZYA 4XMYA 1O7FA 3WG9A 3OYDA 1IN4A 5F27A 3W2WA 4CICA 3FDYA 2L7FP 2VT3A 2BW3A 1BM9A 3DPLC 3CCQI 1WZ2A 3RYPA 2R7VA 2FBKA 1P9QC 3DBRB 3ROUA 4IX7A 2GA1A 1MMGA 4CCLA 2VT2A 4XLHA 5CVRA 2XUBA 3S17J 4DIQA 3VOEA 4OMYA 1QU3A 3VPRA 5FLXZ 2KP6A 1ZREA 2VLAA 2MYSA 3BP8A 3MZHA 3BROA 3ELKA 4MEYF 1JTXA 3A02A 2H6BA 2XGDA 4XRFA 4MGRA 3C2GA 3JCUC 4QTRA 3REOA 4W1UA 1ZG1A 3LSGA 1KU9A 4G6DA 3H3ZA 4XLPF 1XN7A 1VQLI 2UXXA 5FD6A 3W6KB 2HXOA 2CMPA 5E18F 2VL8A 2XPVA 2M0MA 1L3LA 3C1DA 1ZRDA 1FYLA 1AU7A 1B72A 1EV7A 4B43A 1Y1WJ 2X0LA 4CCOA 3GMEA 4C3IJ 1SFXA 1NH3A 5B5EC 1U5TB 2RAEA 4I98B 4RB3C 2LG4A 3FXUA 3ZXSA 1P2FA 1WJDA 4A0ZA 1KYWA 3PQKA 3MMYB 1I50J 1X1AA 2E2HJ 2FEZA 2IA0A 2W57A 1YLFA 2IJLA 1ZR2A 5FGMA 3G1MA 2CFXA 5LGUA 2R7SA 3CLOA 1VTNC 4EV0A 2VC1A 1X2MA 1QPIA 2JMWA 2QBYA 5E20A 2V1DA 5CPRB 2BY2A 1FIPA 2DA7A 2EFPA 4RB1A 3TEDA 3CDHA 1T98A 4NDLA 3N97A 2JQ7A 1X19A 1LJ9A 3LSHA 2IVMA 2HDCA 1IUYA 3JR9A 3J7AY 4F93B 2CQKA 5D5XB 2GIZA 2R7QA 4LOCA 1Y6IA 1VQPI 2OTLI 5C4XJ 2WB1N 2H6CA 3KP6A 1H9TA 3KP3A 2H1KA 1O4XA 1FP1D 1X4PA 4JX4A 1RKWA 1BI3A 4LLGF 1ZH5A 1WJ5A 1NHAA 1G3TA 3GF2A 3R60A 4I99C 3TP3A 4QSHA 3ZRGA 1V5GA 1ZK8A 2O7OA 5FB2A 1MMDA 2B0LA 2LREA 3LA2A 1ZAOA 3X2QH 1HKSA 4A3GJ 1Z3XA 2BY1A 2WAQA 2PFBA 5BPIA 2D5VA 1T56A 1W1WE 4PSWA 2X1EA 1FP2A 1WI9A 4EM0B 3KIOA 1G3SA 1D1AA 3HPHA 4FTHA 3K2AA 2XRLA 3BQYA 1FBSA 1Z6RA 1H9GA 3H9QA 5E1ZB 1QVUA 3EDPA 4M3FA 5F1JA 4II2A 2DPDA 3K1NA 2JT1A 3BOQA 4KIBA 4N9IA 2LKXA 4EGYA 4ZYEA 3H9GA 3LQRA 2D2WA 1AOYA 1WJEA 4F92B 2GXGA 1D0YA 3IAM2 1WJFA 3L2RA 2KIQA 4XKCA 3CCJI 1TBXA 3HGYA 2MW8A 3FHZA 3CO6C 2IGOA 2VI6A 1EJ9A 2IP2A 3QODA 4PJMA 3HRSA 3OS2A 2HVSA 2BEOA 2L9VA 3ZQLA 2DYRH 1BA5A 4BE0A 4NNJA 4BQQA 1K83J 4UUVA 2R7RA 1XMAA 3BT9A 3WHCA 1B6AA 5F1RA 3RTRA 1SMTA 3U1DA 3R0JA 2Y48A 2R7WA 2F2EA 1FOYA 2MSYA 2L7ZA 2MA3A 6PAXA 1HF0A 1KQ9A 3G1LA 4M74A 4B47A 1OPCA 2VQGA 2R0QC 3RZDJ 2O5RA 3DKWA 2JSCA 1VQOI 2VXDA 2L9SA 4IRIA 2R3SA 4BJTA 2RQQA 3MD2A 3K4BA 3L00A 3K4MA 4XK4A 3LAPA 1BI2A 4JQFA 2ZMEA 3CCMI 2PEXA 4UXNA 5DD8A 4B44A 2ZXJA 1K6OA 1G2HA 5HLGA 1TWHJ 4DNCA 1VQMI 3SXYA 2NNYA 2DOEA 3IHUA 3I59A 5B1AH 1K78B 3PNTA 2AXLA 4L5JA 3HPGA 4HDVA 1CF7B 1OR7C 1IXSB 3KFWX 4M3GA 3IWZA 1FPQA 3CMMA 2IAIA 2JJ7A 3HSRA 2FBHA 2VPLA 2DK8A 3DLAA 1XPXA 1MBHA 1SD6A 1IN8A 2EZIA 3CUOA 4X0GA 2MC4A 4FCYA 2VBYA 2QWWA 3MZYA 2KISA 5HLIA 1YJ9I 1ZQ3P 5CLSA 1JKPC 1DDNA 3O2PE 4L0ZB 5K5OA 3GW2A 1P4AA 1JTYA 2Y0MA 4XLAA 2PQ8A 1XGSA 2P5VA 3GLXA 4RDUA 3E3VA 4N4NB 1VFCA 1I6XA 4LK1F 1FYMA 2L54A 3IRQA 4A6EA 4WWCA 4ENMA 5L3BA 2E60A 3HB9A 3OSFA 1F9NA 4DZPA 4AUXA 1S7EA 3BZ6A 3M8FA 3CF5F 4KFCA 2DA3A 1SVLA 3K2ZA 2XDVA 1D3YA 4AYBA 4EATA 1KYZA 4PFOA 2R5YA 3K9TA 5KAFC 2VKDA 3ECHA 4IZZA 1FZPB 4IHTA 2ESNA 3DKYA 4B3XA 1EKEA 1I1SA 3BG9A 2OA4A 3U2RA 3I4PA 3B02A 1UG0A 1FYKA 3I0TA 2MH9A 5KAIC 1RC9A 2BXZA 2VKEA 4AIDA 4IOAF 2MLGA 3P7NA 2VJ4A 4AC0A 2OV7A 4OMZA 1YG2A 1J2XA 5J8CA 4IL6C 3ABKH 1OCOH 5FROA 5D5VB 3SQNA 2QF7A 3WU2C 2DN0A 3PM1A 2GBYA 5F64A 2LDUA 3CJQB 2M34A 4N9HA 2XAFA 2JA2A 4MO7A 3LNQA 1NTCA 3O6BB 2CFOA 1T0FC 5DDGA 3PIOF 4PUSA 5FKMA 4DW6A 3J81Z 1QZEA 3DWLE 2MG4A 5LHHA 3CUQB 1U8RA 3QP6A 4P96A 1VQ5I 2HOSA 5K7FA 2YX4A 1T8IA 1ETQA 1RESA 1LEAA 1HSJA 4IRGA 1EH7A 2ELJA 2XAGA 3HUGA 5ICCA 2R7ZJ 3S3OA 1KQ8A 2LY9A 4O6JA 5DM7F 2Y0SN 4HSTA 2GIVA 1ZG5A 4IXAA 1JKQC 2F5FA 4U7BA 3TBIA 1ON1A 5F6FA 2ZJ2A 1B4AA 1O7LA 3WTVC 4YIRX 4NC7A 3RIRA 3WU1B 1MBJA 4IF4A 2MGQA 3HKZA 2CYYA 4L5EA 4KMUX 2GLOA 3V7RA 3ZQHA 4LJZF 3DQVC 1WCMJ 3A03A 1X1CA 4CA0A 1U0JA 1LFUP 4CO8A 1XX5A 3S14J 1MBFA 4S0HB 1BIAA 5D8KB 5GAEJ 2HI3A 2J5OA 3LA7A 3SYTA 1MMSA 4KIFA 5IT9K 4CGZA 3ZN0A 3R4KA 1R9TJ 1JGSA 3JRAA 5JHFA 3IAS2 2UUZA 4BEHB 4L18B 3QPSA 2CUEA 2KZGA 2LNBA 4BE1A 2Z99A 1I27A 3S2WA 4G6TB 2ZFWA 2IPQX 1E3PA 3CP2A 3K6GA 1P6RA 2OC6A 5E3OA 2K40A 5J6XA 1TZLA 4G7HF 2ZSIB 4R79A 2IEKA 3BTCA 3G73A 3ZPLA 3ONQA 3I71A 4XONA 2YU9J 3P9KA 4FE4A 1ZGAA 3DEUA 2X9DA 5D5WB 3PFIA 3LA3A 2HZDA 2XSDC 2XF5A 1USTA 2K3PA 2HOTA 2FUG2 1SAUA 2Q8KA 2OZUA 3DEEA 1BJAA 3ECOA 3IH2A 4YELA 3J7ZI 5AIPA 5LEKA 2CO5A 3EUHA 2R7TA 5B3SH 5IT3A 3U9GA 1LFPA 4XOPA 5EF6A 2EK5A 2HDWA 2E71A 2PG4A 2BOLA 2K9QA 4LLLA 1K4TA 1R4MB 3CCVI 2VONA 2V1XA 2V9KA 3JTHA 4BJ6C 1R6RA 3WTWC 3IKTA 3GLLA 4XLFA 3SFZA 2CV1A 1Z67A 2IXSA 2Y75A 1ZG3A 4IO9F 1FOWA 2QM3A 2FRHA 3RQIA 1TP4A 2DMQA 4HW0A 2LLKA 3LSKA 2ZSHB 2B63J 2IS1A 3RDIA 3BZCA 1A31A 3IC7A 4RM3A 4L9JA 2IGMA 2Q2EA 2BHZA 4IHVA 3PQJA 1LDDA 2HEOA 2QCOA 4BDYA 3H35A 4CHUA 3L2QA 1O3QA 2JA7J 3M4OJ 2WAFA 2V26A 3GFMA 4HV6A 3S32A 2Z9OA 3Q3SA 2V6EA 1X1BA 1SEUA 4OINF 1PP7U 1Z7LA 2CSOA 2K27A 1W7PD 2XF7A 1SFEA 1YOVB 3GX4X 2DA6A 2HKOA 1ETVA 1Z9CA 3S2DJ 3LSTA 4MTEA 4AWXB 2VUMJ 1TT5B 1HA8A 3L2CA 1Q1VA 3LL7A 1MD0A 3JRIA 1WI3A 3QYEA 3D5LA 2F5EA 3QAHA 4HYEA 3TGNA 1ZYRF 3GBGA 4UVAA 4RAYA 3EPZA 4UUSB 5B1BH 1OCTC 3PO3J 3V7SA 1MNMC 1R49A 1TW3A 2MABA 2F5CA 2H09A 2P6TA 4OU0A 3OSGA 4XOTA 4I0AA 5JFRA 1ETXA 1T08B 2LC2A 3HHHA 5D6EA 5HVQC 3ZCOA 3GTGJ 1QHHD 4B09A 2H1LA 1QPMA 3HTSB 4HEA2 5L3EA 3NARA 1FTZA 1S6LA 4Q5SF 2EFOA 2K02A 1BIBA 2O03A 4PJNA 3QP5A 2LKSA 3V4GA 2DA1A 2KKOA 2X6XA 5JVGF 1STZA 3G2BA 3KLOA 2LTPA 3NWSA 2A6EF 1W7PA 4RBOA 3PUBA 2VODA 2EB7A 4BBSJ 2L7KA 3I9V2 1XS9A 5FFZA 1W5SA 1XD7A 2HKXA 2EFWA 3JRBA 3F6OA 5FRNA 2CWEA 2JTVA 2JA6J 2P5LC 2DJIA 1IJWC 3CJTB 1XTAA 3FXRA 3AAFA 4E7SA 3MKYB 3O3KA 3MAJA 2NS0A 2KFDA 3J80K 3GWZA 3QU6A 4NQWB 3ZQQA 3AG1H 1P4XA 3LFUA 4QPQA 3FBNB 1F36A 4M73A 2CW0F 3DU5A 4HQEA 2I5UA 4AM3A 5LLQA 3GO5A 4Y13A 4A12A 2EIMH 1UJ8A 1UZCA 1SFUA 4XQFA 2PJRA 3S2HJ 3FZVA 4JBAA 2R7OA 4EJOA 1DGRM 1T38A 3ZMDA 3TP0A 2P0WA 3HSEA 1ZARA 4XL9A 4AIKA 1HXDA 2JPBA 1TTYA 1OYYA 4KUMA 4MQ9F 4F52A 1MDMB 1ACIA 3LQQA 4P5OA 3CDLA 2LF7A 3CMAI 1GV2A 1S72I 3HZJA 1QGPA 2DW4A 5DM6F 2XHKA 2FMLA 3H36A 4I0BA 5EGOB 1QVTA 2V9VA 4H4KC 3OR1C 3CCYA 4U0YA 1WGXA 2X48A 3S15J 3RJPA 4TV7A 4A6DA 1IG7A 1MJ9A 4ENJA 2IGKA 2FOKA 2KLOA 3E97A 2QSHX 2ME6A 1LB2A 1JUMA 3AG2H 2DDBA 4FE7A 5C3EJ 1AKHA 4ZYDA 1VZ0A 1SMYF 2E35A 1GUUA 2EFQA 1LE8A 2ISZA 1MMNA 2DK5A 2TRTA 1UAAA 4A3LJ 3K10A 3PUFA 5DYMA 5GPCA 5ICGA 2JN6A 2V79A 3OR2C 4ZC3A 1TNSA 2XSJC 5C4JJ 3OYIA 2LK2A 1XSDA 5F08A 2FX0A 1HDDC 2EBIA 2UWMA 3VODA 1YJNI 3F23A 3FKJA 2M8EA 2DFFA 2HTSA 3ZMSA 4B1RA 4BUPA 2HYFA 1QA6A 3QQAA 4DBQA 5LGTA 4HF1A 1MW7A 3K1PA 1TL8A 2W24A 1YITI 4BNCA 2Z2SB 1PUEE 5AIQA 2L9NA 2K5CA 4LMYA 4BBRJ 5CJ9A 1BOAA 3OIQA 1NG7A 4M9XA 2R5ZB 2DMNA 4CYCB 3S3NA 4G8XA 2DAOA 1IC8A 1TW2A 1B9NA 3IP4B 4UHTA 2O8XA 3OYAA 4Y15A 3BR5A 2RN7A 1BN5A 5JI6A 5LRRA 3QRFF 3HBLA
chains in the Genus database with same CATH topology
3AG1H 3ASNH 2EIJH 5IY5H 3ABKH 3ABMH 1OCOH 1OCZH 2DYRH 2ZXWH 2Y69H 5B3SH 3AG3H 1V55H 2EIMH 2EIKH 2EINH 3AG4H 3ASOH 2EILH 1V54H 2OCCH 5B1AH 1OCCH 3ABLH 1OCRH 3AG2H 3X2QH 2DYSH 3WG7H 5B1BH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG1 H;  3ASN H;  2EIJ H;  5IY5 H;  3ABK H;  3ABM H;  1OCO H;  1OCZ H;  2DYR H;  2ZXW H;  2Y69 H;  5B3S H;  3AG3 H;  1V55 H;  2EIM H;  2EIK H;  2EIN H;  3AG4 H;  3ASO H;  2EIL H;  1V54 H;  2OCC H;  5B1A H;  1OCC H;  3ABL H;  1OCR H;  3AG2 H;  3X2Q H;  2DYS H;  3WG7 H;  5B1B H; 
#chains in the Genus database with same CATH topology
 1XG1 A;  1WWX A;  2NYX A;  4G9Y A;  1MKM A;  1KQ0 A;  4BKX A;  3LSP A;  4HLY A;  3BJA A;  2LKP A;  5TJJ A;  4I02 A;  2W85 A;  2JSP A;  3HOV J;  4I09 A;  5IT9 Z;  2ZJR F;  2LY1 A;  2KRH A;  3FXQ A;  4ITV A;  4OOI A;  2R7D A;  3RZO J;  1MZB A;  1FOK A;  1Y8Q B;  4CSW A;  3OL3 A;  4M72 A;  3I56 I;  1Y8R B;  3D5R C;  1LEB A;  1B1B A;  2V6C A;  3JW4 A;  5F04 A;  1A36 A;  4E7J A;  2HGC A;  2M5W A;  1WVR A;  2E1C A;  2WB1 A;  1J7K A;  2KPM A;  2M3A A;  1IRZ A;  1Y39 A;  4IQJ A;  2DA4 A;  3CME I;  4E7Z A;  1Y56 A;  1KON A;  2OZ6 A;  3JAM K;  2HU9 A;  3IV5 A;  1OIS A;  2IGN A;  4C3H J;  4ENK A;  1S29 A;  2XGE A;  5HS7 A;  3KZY A;  3BG5 A;  3ZQC A;  3EET A;  2WAE A;  3KX2 A;  2DI3 A;  3OL4 A;  4MQV A;  1LFB A;  2WV0 A;  2YU3 A;  1S5L C;  1R1V A;  2P7V B;  5H6Q A;  3CCE I;  1XCB A;  4BQN A;  1ZGJ A;  1V4R A;  2X85 A;  1T33 A;  1YIJ I;  4DQ2 A;  1R58 A;  3C7J A;  4I01 A;  4MTD A;  1WFX A;  1T2K A;  2ELH A;  1K79 A;  1FBQ A;  4CCM A;  2XB5 A;  2ZME C;  4HAM A;  1U5T A;  4J19 A;  5DCF A;  5LEJ A;  4D7N A;  1W5T A;  1O3S A;  3BJ6 A;  3JSO A;  2W4S A;  1MH3 A;  4X1E A;  5LGN A;  2VXZ A;  2CV0 A;  5DD4 A;  3WU0 A;  5ICE A;  2CQX A;  2UZK A;  4EJW A;  3A1Y A;  5HOO A;  1MBE A;  1W4M A;  4ENN A;  3ZGK A;  2QSG X;  2W7N A;  1U8B A;  2DT7 B;  3E5U A;  2ID6 A;  1NK3 P;  2BE5 F;  3ZN1 A;  1AWC A;  3LMM A;  1UMQ A;  5C44 J;  3QYB A;  1DP7 P;  5KK1 A;  2EQR A;  4ZTF A;  2L3D A;  1ERD A;  3DBL B;  4Z6Y A;  4BHC A;  3JRG A;  3DXJ F;  1A5J A;  2F4O B;  4EMS A;  3B73 A;  3S1R J;  5LD2 C;  2X6W A;  3IRR A;  1LQ1 A;  3I64 A;  2ADU A;  2CUZ A;  3SZT A;  3TDU C;  5EDN A;  2FU4 A;  3K70 D;  1BOB A;  1OFC X;  2P5K A;  1G3W A;  1F43 A;  3MKL A;  3L1P A;  4ANJ A;  2STW A;  4D5F A;  4DZJ A;  3LWF A;  1G8X A;  1JUS A;  5GPA A;  5K5Q A;  1D5Y A;  1N25 A;  1POG A;  2XGX A;  3GFJ A;  2FNA A;  3UNG C;  3OS1 A;  1VQ6 I;  4AVZ A;  3GFI A;  5D4R A;  3HTU A;  2ZC2 A;  1Q1H A;  3A0B C;  3PNY A;  3MKZ A;  2DBB A;  3I4M J;  3V8J A;  3HDD A;  3HRU A;  1YW8 A;  3LSI A;  3L2V A;  1I3Q J;  3BLY A;  4RLQ A;  1GXQ A;  5IOY A;  4PJ0 C;  1HW2 A;  4JX5 A;  2XF6 A;  4M9S A;  3KPH A;  4ZH4 F;  3TOB A;  5J1R A;  1YRN B;  1FTT A;  3OY9 A;  3UR3 C;  4CH7 A;  4XRS A;  1ZR4 A;  2H8W A;  4V19 K;  3WTZ A;  2W82 A;  1ORK A;  3H3U A;  4HQM A;  1YE9 A;  4XM3 A;  3D5S C;  2QZ8 A;  2Y69 H;  5DUK A;  3IKV A;  4XKW A;  4JYK A;  4QPO A;  5L3G A;  2A69 F;  4PDK A;  5GAG J;  3H3V K;  3OYC A;  5E3L A;  4OAY A;  3FIS A;  1K61 A;  2RNG A;  2E1N A;  3Q9S A;  3TO6 A;  4ZDP A;  4C3J J;  3PSF A;  3T5X A;  4IJA A;  5EG0 B;  1YW9 A;  2CJJ A;  2DYS H;  2VKV A;  2ECB A;  2NAZ A;  3CTA A;  2Y30 A;  4PZJ A;  2Y31 A;  1LVA A;  4CXF A;  3DLL F;  4OAZ A;  5D6F A;  1W36 D;  1XDU A;  2O8K A;  4D1Q A;  1F5T A;  4C2U A;  2HQR A;  2WBM A;  2YUS A;  4L9T A;  1PVE A;  3FF5 A;  5JLW A;  2JA8 J;  5FFX A;  5AON A;  4ZYH A;  4KT5 C;  4F91 B;  1I1G A;  2LR8 A;  4LG3 A;  4D5C A;  4EJV A;  3E6B A;  5FRM A;  3HOU J;  4E7L A;  2X1D A;  1A35 A;  2JPC A;  1IDY A;  4HZF A;  4L9V A;  2BXY A;  9ANT A;  1E2X A;  1K78 A;  1Z7U A;  2LY2 A;  4IHX A;  3KEY A;  5E3N A;  3W2V A;  2GQQ A;  3DTE A;  5DCM B;  1YJW I;  2AHQ A;  3HOT A;  1XMX A;  1CF7 A;  3GTK J;  4PSX A;  3CO7 C;  1T39 A;  3OYF A;  2R93 J;  3MWM A;  5BS6 A;  3DTI A;  3L2U A;  4LD5 A;  2NS8 A;  2QSF X;  2TCT A;  3M7G A;  3T8R A;  1WSU A;  1VQN I;  5M5Y J;  2CGP A;  5CKT A;  4OIP F;  4NB5 A;  2WY8 Q;  5BQT A;  1HBX G;  3EUA A;  2WY7 Q;  5HLH A;  2MBF A;  3HRT A;  3BC8 A;  2NS7 A;  3K4J A;  2E5Z A;  1KGS A;  2JUC A;  2D1H A;  3CZ6 A;  3I55 I;  2XGC A;  3BDD A;  5BOX A;  1RET A;  3KYD B;  2R92 J;  4NC6 A;  3ZMU A;  5A2Q Z;  1IF1 A;  3MKW B;  4KDP A;  2HVR A;  1SD4 A;  5ICF A;  2M30 A;  2XKO A;  1FX7 A;  3CMY A;  1TT0 A;  1X3Z B;  4HA8 A;  2Y0S A;  4IHS A;  4X6A J;  2ISY A;  3KLN A;  2COB A;  1E17 A;  1RRJ A;  4XIC A;  2XRO A;  2JA5 J;  2KT0 A;  1VQ4 I;  5TGT A;  5EYR A;  2X4H A;  2K85 A;  1OCP A;  3F0C A;  2KL4 A;  4XKB A;  5JVT A;  3U21 A;  4G6Q A;  3TDZ C;  3IUO A;  4IVN A;  4F7Z A;  1H88 C;  3ZMT A;  1K4S A;  4NBQ A;  2QQA A;  1W5C C;  1FOX A;  2A6T A;  3EUH C;  4FAS D;  3FXO A;  1ZEL A;  1Z6T A;  2IS2 A;  3ABU A;  3AG4 H;  1J5Y A;  3E6D A;  2DMP A;  5E3M A;  5IP7 J;  1J0R A;  3S16 J;  4NC8 A;  3FHN A;  5FKN A;  2FQ4 A;  1YO5 C;  3CJN A;  4MFD A;  4YEJ A;  1WKM A;  2L4A A;  4C30 A;  3DKX A;  2FMY A;  3GXO A;  3N05 A;  4BU2 A;  5IYC J;  2Z33 A;  1G59 A;  5EZG A;  3E0J B;  4LG0 B;  4RGS A;  4LIT A;  4DGW B;  4ZYG A;  2DLL A;  2GZW A;  3IWF A;  4YFK F;  1DP3 A;  1MBG A;  1EH6 A;  1I6H J;  4A3D J;  3RPU D;  3CUQ A;  2CQN A;  2OUM A;  5FKO A;  3TW6 A;  2Y9Z A;  2HDD A;  3M1E A;  2HXI A;  3OS0 A;  2VQC A;  2AO9 A;  1ONV A;  3K1M A;  3G4S I;  4PGG A;  4KIG A;  3ZOB A;  4ZZD A;  2FBI A;  1P7J A;  2A5W A;  2HOA A;  3P9I A;  2BYV E;  3GTJ J;  2V1N A;  3M8J A;  1X1D A;  2E2J J;  4BHB A;  2XAU A;  1ON2 A;  4P9F A;  4RGR A;  4EQQ A;  3DFG A;  2LBF B;  1IN7 A;  5FLX K;  4JX6 A;  2HFH A;  2GWR A;  1JXS A;  2E34 A;  2XAQ A;  2ZBK A;  3HIF A;  1BBY A;  1H8A C;  1MMA A;  2M8G X;  3KE2 A;  3L9F A;  1QBJ A;  1X4O A;  2AXT C;  2P6S A;  4RMN A;  3SEZ A;  4QIW N;  3E5X A;  2ACJ A;  2M1B A;  4CCJ A;  3S1M J;  4HNU A;  1IDZ A;  2VKH A;  3ISP A;  3ERE D;  4AVP A;  4DYQ A;  1BJZ A;  2GM4 A;  1TWC J;  4UVC A;  2DOD A;  3OYH A;  2OJE D;  3WGH A;  2HOE A;  3JAM Z;  5E79 C;  3GZ5 A;  3DTK A;  3RKX A;  2MFZ A;  3RPU A;  1X3U A;  1K6Y A;  4BEH A;  3ABT A;  1ITY A;  4HBL A;  2XAH A;  3A4C A;  1J09 A;  3TQN A;  1ENH A;  2BY0 A;  2OQG A;  1ZLK A;  4NHJ A;  3B6C A;  2M4G A;  1YS7 A;  4UB6 C;  1MGT A;  1R1U A;  4IKF A;  1Z91 A;  1N77 A;  2DA5 A;  2MH2 A;  1Z1D A;  4EM1 A;  1OYI A;  1V5E A;  3WHB A;  3WTS C;  4U0V A;  4A3C J;  3CQZ J;  3HC7 A;  3N4M A;  2EV6 A;  4LB5 A;  1HW1 A;  1LDJ A;  2Y2Z A;  4H0E A;  3DP7 A;  3M8E A;  2EZL A;  5DUI A;  1U6G A;  2KMU A;  3OYJ A;  5CQG A;  1R36 A;  2K86 A;  1JT0 A;  2HVQ A;  2VAS A;  2VC0 A;  4KYW A;  2CQQ A;  4PJL A;  5GAD J;  1I5Z A;  2F5V A;  1Y1V J;  3GUD A;  4IEJ A;  2K4J A;  3FMQ A;  5F0C A;  3J7Y J;  3M3Y J;  4XSZ F;  1JKR C;  2BHY A;  3VDX A;  5ED4 A;  5L3C A;  1EF4 A;  2H27 A;  2L02 A;  3C2B A;  3VYT B;  1J75 A;  1WJC A;  4P55 A;  3AFH A;  2O3F A;  3DF8 A;  4YIF A;  4UY8 I;  5M5W J;  3EYI A;  2L5Q A;  4WF2 A;  2I10 A;  4RB2 C;  4XN0 A;  2VJI A;  4FQG A;  3IH3 A;  1FLI A;  1HKQ A;  4BY7 J;  3BPX A;  1FY7 A;  2VQH A;  5BMZ A;  1W0U A;  1BI1 A;  2VPR A;  3F72 A;  1DQU A;  1XGO A;  1YHQ I;  3GTQ J;  2NVY J;  1RZ4 A;  1NG6 A;  2MC3 A;  4A3E J;  2V1U A;  2A3S A;  3E5Q A;  3KP2 A;  3PSI A;  2QEX I;  4IOC F;  2DPU A;  3GTM J;  5GP9 A;  2EH3 A;  2QKL B;  3BCB A;  3C3W A;  2HWV A;  3MVP A;  4BYY A;  2CRG A;  4EGZ A;  1PP8 F;  2DMU A;  2ID3 A;  4M3D A;  5HS9 A;  4C2M J;  5E8G A;  2DT5 A;  4BH9 A;  2JRM A;  3GTO J;  1XMK A;  3KP7 A;  2EJR A;  2F6C A;  3CP8 A;  3MZ8 A;  2JK3 A;  2IS4 A;  1PUF B;  1K7A A;  2Z1D A;  1O3R A;  2XPU A;  3WE3 A;  3AL0 C;  1IXC A;  2JZY A;  3KP4 A;  2G0E A;  1Z05 A;  4HNV A;  4M6V A;  4RB0 A;  4I76 A;  4C9Y A;  1R71 A;  1MSF C;  1FWZ A;  1PYV A;  2NVX J;  1KZH A;  1FBU A;  2ELK A;  2HPI A;  3S1N J;  1XGN A;  2L9R A;  2R7F A;  1HST A;  2DXI A;  2A68 F;  5CVI A;  2M7A A;  1YIO A;  4G12 A;  4DOZ A;  2G9W A;  1WQ2 A;  4BAC A;  1VQ9 I;  4LIV A;  5L3F A;  1O3T A;  4UUS A;  3HHG A;  4CZZ A;  2NOG A;  5LRS A;  3I3L A;  1ETO A;  1XSX A;  4II3 A;  4A3I J;  2PLY A;  2GAU A;  3PL8 A;  2W1O A;  3A01 B;  4HX4 A;  2JVG A;  1GVJ A;  2HQA A;  1WRJ A;  3KYL A;  1FSH A;  3BG6 A;  2JUG A;  2ICW G;  4D7M A;  5BPD A;  3JRH A;  2IBD A;  2N8G A;  3WGG A;  5EEH A;  5IYB J;  5E1X A;  3MN2 A;  3GFL A;  4ZDO A;  2WA0 A;  4BHP A;  5ERI A;  3QWL A;  2HYG D;  5GTI C;  4GYI A;  5IPA A;  2P4W A;  1Z77 A;  1Z3Y A;  4A0X A;  3MFK A;  3FK6 A;  2M0C A;  1VQ7 I;  2FSW A;  1FIA A;  3NRV A;  4A93 J;  2E1M C;  1L0O C;  2EPF A;  1FMV A;  3EUK L;  3B6A A;  3VB2 A;  3WE2 A;  2LD5 A;  1SVO A;  2RDP A;  1OJL A;  2CG4 A;  2OTJ I;  4A3M J;  1FC3 A;  4QLC U;  1YS6 A;  4M9Z A;  4J01 A;  4HNT A;  1G4D A;  2EWN A;  2IS6 A;  3TOA A;  4HX7 A;  4R8H A;  5CVJ A;  3V42 A;  1D8K A;  3BCA A;  1UCR A;  1HOM A;  3BR6 A;  4NQW A;  1REP C;  2ZKZ A;  3NEU A;  3HOW J;  1KA8 A;  2EIN H;  3I58 A;  3SZG A;  3VSL A;  3K4C A;  4ABZ A;  2PMZ N;  5EZH A;  2RV8 A;  2ZNZ A;  1MSE C;  1ZLJ A;  4RAF A;  1H0M A;  3JRF A;  4ZDL A;  1ZRF A;  3BG3 A;  1TNT A;  4K2E A;  1B8I A;  1R4N B;  2DU9 A;  2L2O A;  2MD0 A;  2CU7 A;  2ZJP F;  1ULY A;  3BR2 A;  1ETY A;  1MDM A;  1P7I A;  2LSO A;  4ZTJ A;  2C6Y A;  3KCC A;  4GFB A;  1SD7 A;  4RAG A;  3WTT C;  4HV5 A;  2K9M A;  5CVU A;  4ETS A;  1DPR A;  5EGO A;  1YW7 A;  4IHY A;  2EA2 A;  3EYY A;  4YII A;  2E36 A;  4ZJZ A;  2RGV A;  2CV2 A;  2COM A;  4M3B A;  3Q0W A;  2YX7 A;  2ZB9 A;  2BW3 B;  2DOF A;  2OCE A;  4B8X A;  1YYV A;  5GTH C;  1E0E A;  5J47 A;  1X1P A;  2QKM B;  4Y52 J;  3TO7 A;  2W25 A;  4B3A A;  2VE9 A;  1FT9 A;  2K9N A;  2LF8 A;  1VQK I;  4E6K G;  5K7Z A;  1BW5 A;  2AQF A;  1RUN A;  1D0X A;  5M5X J;  3J81 K;  3IH4 A;  1RPW A;  1U5T C;  2UXN A;  3W3C A;  4BS9 A;  1LKX A;  1BW6 A;  5E1W A;  4V2F A;  2E1O A;  2JWT A;  2VOO A;  1XCV A;  1R1T A;  2EV5 A;  4A5N A;  2QEN A;  3T0Y A;  3W2A A;  4S04 A;  3OYL A;  4O5V A;  1HLV A;  3I54 A;  5F0F A;  1QNT A;  2IT0 A;  1E3H A;  3HXL A;  2G7U A;  2ZNY A;  4KMF A;  2HQN A;  2NVQ J;  4FT8 A;  3L2W A;  4L0Y B;  2KRC A;  3BWG A;  2M7B A;  4Y4R A;  2B7E A;  3BQZ A;  2M4K A;  3LSM A;  3F9K A;  2VBX A;  3TW7 A;  4WK8 F;  3FXK A;  5EJC A;  3U1K A;  5KVR A;  4I7H A;  4UNO A;  4JOM A;  1B72 B;  3PO2 J;  4MEX F;  4Z2Y A;  3OMY A;  4XRM A;  3KP5 A;  1CGP A;  2H94 A;  4CYD A;  4C2T A;  4PJJ A;  3VSK A;  3I4N J;  5IP9 J;  4N0B A;  4Y17 A;  3V7C A;  2QVO A;  2R5Z A;  1OCC H;  4CYC A;  3D0S A;  4WXC A;  2AS5 F;  4UV9 A;  3K7A J;  4GO1 A;  4ESB A;  4BDZ A;  1YQA A;  5KNL A;  5IY5 H;  3M07 A;  3PNV A;  3HYI A;  4XNF A;  4WXD A;  2W84 A;  2L01 A;  1G6N A;  4XLN F;  2QBY B;  4BQO A;  4EEF G;  4YG2 F;  3FBI B;  4AIH A;  1RIO H;  1HKT A;  4Y33 A;  5HOD A;  5FLV A;  3VEP A;  3W6J B;  3TO9 A;  1ZTR A;  4GYG A;  5DEQ A;  4Q4Z F;  1GDT A;  5IYD J;  1SC7 A;  2BY3 A;  2EZK A;  1U3E M;  5CVV A;  4B4C A;  2O9L A;  2E7W A;  1IW7 F;  1UHM A;  2KJC A;  5JR3 A;  2NNN A;  4FX0 A;  2M45 A;  2NRA C;  4EM2 A;  4MLO A;  1S7O A;  3CLQ A;  2IA1 A;  2VBW A;  2GXA A;  3JSP A;  3F8M A;  3RKQ A;  3K70 C;  3QYF A;  3F22 A;  1D0Z A;  2NXN B;  1O57 A;  2Y9Y A;  3HJE A;  4PCQ A;  3E7L A;  2RQP A;  3AKZ A;  2HTJ A;  2K3F A;  4CUG A;  1GT0 C;  1RKT A;  4HPQ A;  1YX5 A;  1ODD A;  3OV8 A;  4MNU A;  4DJA A;  4KN7 X;  4RGU A;  3F8F A;  4R1H A;  4U7D A;  1BC7 C;  4U0W A;  3HG9 A;  3LSJ A;  5H2F C;  3WTX C;  2PI0 A;  1YX3 A;  1V3F A;  3L7W A;  1X58 A;  1S9H A;  5B66 C;  1OMI A;  1U2W A;  2MLK A;  2WC2 A;  4AU7 A;  2FA5 A;  2CUJ A;  1IRX A;  3TKY A;  1S7A A;  3FXL A;  3FM3 A;  3HOZ J;  2PJP A;  2LMD A;  3CES A;  5FD5 A;  4I2O A;  3WG7 H;  4GCV A;  3F8C A;  1QRY A;  4JP0 A;  3TMO A;  3BR1 A;  3HM5 A;  3OYN A;  4EJU A;  2FD5 A;  5HDG A;  5LHI A;  1X2N A;  1MIJ A;  2PN6 A;  1XB4 A;  3ABM H;  3ERM A;  2K9S A;  3I53 A;  5BNG A;  4YFX F;  1I3A A;  3H92 A;  2OD5 A;  3C2H A;  3QPT A;  5FKK A;  4YFN F;  5IP6 A;  5JHU A;  4E7K A;  2GXB A;  2E5N A;  1OQY A;  3KYC B;  2HQ5 A;  2RNJ A;  2O61 A;  1WJB A;  1R5G A;  1JE8 A;  2RKH A;  3DCF A;  2R4G A;  4A0Y A;  1TWF J;  1GLN A;  4B48 A;  2B9S A;  1M1E B;  1ZGW A;  3ZMV A;  2QQB A;  1Y0N A;  4MHG A;  3O8H A;  2Q1Z B;  3RQ4 A;  1X3W B;  2ZME B;  2KRF A;  1RUO A;  2LH9 A;  5FKL A;  2E2I J;  3HRM A;  3GTP J;  2BVL A;  1W36 C;  3ZQF A;  1SAX A;  2JVH A;  2WAQ N;  1SD5 A;  3DPT A;  1FSE A;  2HS5 A;  4P1W A;  5CQE A;  2ZXW H;  4BJ5 C;  4HOB A;  2ESH A;  3I59 B;  2XVC A;  2P81 A;  2FOW A;  1LUJ B;  4A69 C;  3MEX A;  3TL4 X;  5D5U B;  2LYC A;  3PIP F;  2O6G E;  3BTI A;  3O8G A;  4KIS A;  2EIL H;  2D45 A;  4A5M A;  1D1C A;  3SDB A;  1A6Q A;  4EVI A;  1RR7 A;  4L5I A;  2ZXH A;  2F5D A;  3DPU A;  5GAH J;  4P9U A;  2CQ7 A;  2FNP A;  2XAS A;  1YRN A;  3NQO A;  4BL0 B;  3M1C A;  3VYR B;  5EEA A;  3S1Q J;  3K4K A;  3HEF A;  2LP0 A;  2XKP A;  4EJT A;  4G7O F;  3FMR A;  1R5H A;  3S8P A;  1BL0 A;  1U78 A;  4JK1 X;  1Z0X A;  3J80 Z;  2YS9 A;  1WPK A;  3OYM A;  4M71 A;  3PFY A;  1AA7 A;  3JRD A;  1IO2 A;  2LFB A;  4XOR A;  4LB6 B;  2KDO A;  2P8T A;  3CDI A;  2XIG A;  3G71 I;  1MND A;  4D9J A;  2ZXI A;  3JRE A;  3ASN H;  2I8D A;  3RKW A;  5EG0 A;  3GCM A;  4XRS G;  3ZQG A;  3LFK A;  3CUQ C;  2XB0 X;  2R5Y B;  3FMS A;  4QWQ A;  1LDK B;  4U87 A;  3CC7 I;  2V7F A;  2GOX B;  5H20 A;  3F3X A;  3Q5F A;  4PFP A;  1JGG A;  2KJB A;  4KJZ A;  3OYK A;  1ETW A;  2FXA A;  2LRD A;  2OQR A;  3T1B A;  3G3Z A;  1BR4 A;  3SHF A;  2X51 A;  1TQM A;  3LOC A;  3J7A O;  2DFI A;  2XAJ A;  1H89 C;  2BV6 A;  1GVD A;  3VWB A;  4HF0 A;  2QQ9 A;  1IV6 A;  4FHT A;  5F0H A;  3MCZ A;  3SEQ A;  3NAU A;  3RCO A;  2Q0O A;  2XPW A;  3W6V A;  2D1V A;  4RLF A;  3H5A A;  4BAY A;  3Q0V A;  5EEG A;  2KIF A;  4A3F J;  2DA2 A;  3VYU B;  2X6O A;  3QU3 A;  5ILU A;  5DCM A;  1TQI A;  3BY6 A;  5DS9 A;  2A5Y B;  4KNY A;  2WAD A;  4E7H A;  2IW5 A;  4J00 A;  5E8I A;  1U9O A;  3KZZ A;  2OCC H;  4U88 A;  2KHM A;  2XRN A;  2HZT A;  4BGD A;  1A6I A;  4M3E A;  1C0W A;  1D5V A;  4PGH A;  1I39 A;  4ESJ A;  1QO0 D;  2DQL A;  1QHG A;  1RR8 C;  3GVA A;  3H0D A;  3CCR I;  3HUG B;  4OIQ F;  4RGX A;  3OIO A;  4ON0 A;  2X6Y A;  1JHH A;  4LK0 F;  3AG3 H;  4XBF A;  3NWT A;  4G7Z F;  1KU3 A;  1OLT A;  1R00 A;  4NUB A;  1F4K A;  2QQ8 A;  3HOX J;  2K7L A;  4KT6 A;  3WTU C;  3RPQ A;  2W00 A;  3GZN B;  4GGG A;  4M6X A;  3VFZ A;  1V54 H;  3JTG A;  4AYB N;  4UUT A;  2FJ1 A;  1MJA A;  4E7I A;  2YR2 A;  2YPR A;  3E6C C;  2P7C B;  1UG2 A;  1XC5 A;  3BTL A;  2DDA A;  5JLX A;  1OR7 A;  4GRI A;  3H0G J;  2Z3Y A;  1G3Y A;  1MBK A;  2EA4 A;  3OYB A;  2UV1 A;  5FJ8 J;  2WWY A;  3BPV A;  1PDN C;  1GHC A;  4OIR F;  5J4V A;  2L4M A;  4D0P A;  3RKY A;  2EIK H;  1TC3 C;  1LVK A;  3ZQI A;  4XLC A;  2EZH A;  4BXU A;  3ASO H;  4HRI A;  1SVM A;  3HSF A;  4UVB A;  3E1S A;  1BI0 A;  3KET A;  2KZV A;  2FE3 A;  4G94 A;  2EV0 A;  2Z5U A;  4RM2 A;  2IA2 A;  1VF9 A;  5FO5 A;  5J8F A;  3WGI A;  3QOP A;  1D1B A;  1VQ8 I;  2EFN A;  1R5I D;  4LG0 A;  1OCZ H;  2DCE A;  4F55 A;  2VOP A;  3LAJ A;  1MJB A;  4RAZ A;  2F48 A;  2AQE A;  3C18 A;  5FLM J;  1APL C;  1HC8 A;  3CC4 I;  1QQI A;  3SFI A;  3FIW A;  1YFH A;  1TLH B;  3COA C;  2ETH A;  3KEQ A;  1ZRC A;  2VB6 A;  2OF7 A;  2DQR A;  3RSN A;  1JT6 A;  4CCK A;  1QZZ A;  4A2U A;  4E70 A;  3DEW A;  1F1Z A;  3ESW B;  2KIM A;  3FXM A;  3CCL I;  2VBZ A;  4XID A;  4YRV A;  5KCM A;  3K4L A;  1YTY A;  2ECC A;  1IN6 A;  2GOM A;  2DJN A;  2LBF A;  2OBP A;  1ZN2 A;  5HNH A;  2QYO A;  3ZQ7 A;  4ZZL A;  5KHD A;  3R0A A;  1NK2 P;  3HKZ N;  5ILS A;  3I5U A;  1ZKG A;  2RRE A;  2L0K A;  2VIX A;  3R6S A;  4ESF A;  4L9N A;  2H8R A;  1DU6 A;  4CCN A;  2BGC A;  1BR2 A;  3KZI C;  3CCU I;  1OYW A;  5TRD A;  3BR3 A;  3F6V A;  3OIP A;  1N78 A;  4A3B J;  5HDN A;  3K69 A;  1T0F A;  4Q48 A;  3GZ6 A;  2IRF G;  2DTZ A;  2VJJ A;  4LIU A;  2M9H A;  4WXH A;  2R7U A;  1IV8 A;  1WHU A;  2FF4 A;  3CCS I;  1BR1 A;  4XSX F;  4IPA A;  5DTD A;  3HOS A;  2QUF A;  3HL2 A;  4MFE A;  2Q2E B;  4UV8 A;  4ASN A;  1T95 A;  4GDF A;  2RVC A;  2XV4 S;  2A6H F;  1XSV A;  3ZMZ A;  5M3F J;  1HCR A;  1IUF A;  4AD9 A;  3CF2 A;  3DBH B;  1IRF A;  1EA3 A;  2HNH A;  1R7J A;  1ZHF A;  3S3M A;  3Q0U A;  1PJR A;  4KN4 X;  2V4J C;  3OOU A;  5HDK A;  3E6M A;  3H1C A;  4BE2 A;  5K7H A;  1S8N A;  3UKG A;  3GEZ A;  3V8K A;  2ME0 A;  3S93 A;  5J4Y A;  2VJ5 A;  1SFK A;  3G1O A;  5HNF A;  5K1Y A;  2QLZ A;  4W97 A;  2E7X A;  4Q47 A;  5ILV A;  1JKO C;  4WCG A;  1V5F A;  1B59 A;  4A3J J;  3DV8 A;  3V8L A;  2ZO4 A;  2WTE A;  1LNW A;  2L7M P;  1TWA J;  3EQL F;  4E4H A;  3HGG A;  4XR6 A;  2G7H A;  2PMU A;  3A0H C;  3BR0 A;  4IQ4 A;  1KU7 A;  3FXJ A;  4M6Y A;  3FWE A;  2DOA A;  2VN2 A;  3MQ0 A;  2M87 A;  3P9C A;  3OWT A;  2CUF A;  3K4N A;  1IRG A;  4FX4 A;  2LOO A;  1P4W A;  3FK7 A;  3HOY J;  2CW7 A;  4KIC A;  5IOZ A;  2PBI A;  2PX9 A;  2DO7 A;  2W48 A;  3QOE A;  4XLE A;  4F3Q A;  4KA4 A;  2STT A;  1MH4 A;  1OKR A;  1R22 A;  1HW5 A;  3BG7 A;  5M3M J;  2Z16 A;  4DYC A;  4FIS A;  1Z21 A;  3OOP A;  2A07 F;  1WH7 A;  1EH8 A;  4Y7N J;  3ABL H;  4CDG A;  1RI7 A;  2ZCW A;  1JJ6 C;  1W7P B;  1AHD P;  3LSR A;  2ZFU A;  5J3L A;  1LPQ A;  4LGW A;  4LFU A;  2CW8 A;  1IGN A;  3BJO A;  1Y0U A;  2ZJQ F;  2DT6 A;  3R61 A;  2KIU A;  2R7X A;  1SAN A;  1VI0 A;  4IHW A;  3RI4 A;  3ML6 A;  4UB8 C;  1J9I A;  1UHW A;  1PUF A;  3CD6 I;  1XDS A;  4GXO A;  1TQP A;  1S3J A;  1WH5 A;  1B9M A;  4BY1 J;  3F21 A;  2V9P A;  2BVM A;  2A61 A;  5CYV A;  5HS8 A;  3GTL J;  2LVS A;  4O3M A;  1E3O C;  3F8B A;  4FET A;  2KDZ A;  3SJM A;  2KQR A;  4N4O B;  1W0T A;  1JUP A;  4DBR A;  1MNE A;  3WOD F;  3FM5 A;  1DU0 A;  2VE8 A;  1FEX A;  1WJA A;  3K0L A;  5J40 A;  1T6S A;  3PJR A;  3SZP A;  2HR3 A;  2CH0 A;  3QPL A;  2HPM A;  1U9N A;  1RNL A;  2PJR B;  1J59 A;  1D8J A;  1UEL B;  2XC7 A;  2PMZ A;  3SDG A;  2GA2 A;  5HLT A;  1DPU A;  5H6R A;  3H5N A;  3KEO A;  4MIM A;  3A01 A;  1KU2 A;  2VQL A;  1XGM A;  1VND A;  2X1C A;  4XKV A;  4HSR A;  2F4M B;  3Q9V A;  2K9L A;  1JHF A;  4IRH A;  2O0Y A;  3BTJ A;  3OYE A;  3D1N I;  3P5J A;  1DGW Y;  4S05 A;  4ZYA A;  2BBY A;  4RA2 A;  3ZP5 A;  3ZR8 X;  2HYJ A;  4DYR A;  3AL0 B;  5TIS C;  3T8T A;  3VYS B;  3FKI J;  4HDU A;  3BZK A;  3CC2 I;  1ETK A;  1SFO J;  3L09 A;  3G6E I;  4WX9 A;  1JJ8 C;  1HQC A;  4AIJ A;  1B8I B;  1AKH B;  3WTY C;  2DTR A;  2J5P A;  3QPH A;  1LE8 B;  1UB9 A;  2K4B A;  2CS3 A;  1IN5 A;  2YSR A;  5LBQ A;  4I6Z A;  2QGU A;  4XN3 A;  4BXF A;  4LLN A;  2DFE A;  1FMW A;  2OAZ A;  3GYH X;  3FX3 A;  1FJL A;  2DMT A;  3OYG A;  3F8N A;  4A3K J;  2NVT J;  5LHG A;  4PK4 A;  2M2E A;  4CZC A;  1USS A;  3A2K A;  1V55 H;  3M9A A;  5LFA A;  4BQA A;  5D8L B;  5A2Q K;  3JRC A;  2OPT A;  1GV5 A;  2BZT A;  1IXR C;  2MD5 A;  4OIO F;  1UHS A;  1HDP A;  2NOJ B;  1JI8 A;  2QA4 I;  1OCR H;  3H5R A;  1IZ1 A;  2FQ3 A;  2PMH A;  1FNN A;  4HLX A;  2NVU B;  4HG2 A;  4KIT B;  4RS8 A;  3ULQ B;  4BXX J;  2E19 A;  1A04 A;  2EIJ H;  2F4I A;  2DFH A;  2WV1 A;  4HX8 A;  4V2G A;  3RYR A;  1YI2 I;  5L3D A;  2JRT A;  2TDX A;  1R23 A;  5J1Y A;  1P92 A;  1GXP A;  2A05 A;  2E1M B;  5J1U A;  1TWG J;  5K5R A;  3DU6 A;  3H9J A;  4OWR B;  1BC8 C;  2RC4 A;  5D4S A;  1N75 A;  1CQT A;  1UFM A;  5E17 F;  3IL2 A;  1DUX C;  2OU2 A;  1IAW A;  4Y3O A;  4HF2 A;  3CJR B;  5DV5 A;  1QZY A;  4XMY A;  1O7F A;  3WG9 A;  3OYD A;  1IN4 A;  5F27 A;  3W2W A;  4CIC A;  3FDY A;  2L7F P;  2VT3 A;  2BW3 A;  1BM9 A;  3DPL C;  3CCQ I;  1WZ2 A;  3RYP A;  2R7V A;  2FBK A;  1P9Q C;  3DBR B;  3ROU A;  4IX7 A;  2GA1 A;  1MMG A;  4CCL A;  2VT2 A;  4XLH A;  5CVR A;  2XUB A;  3S17 J;  4DIQ A;  3VOE A;  4OMY A;  1QU3 A;  3VPR A;  5FLX Z;  2KP6 A;  1ZRE A;  2VLA A;  2MYS A;  3BP8 A;  3MZH A;  3BRO A;  3ELK A;  4MEY F;  1JTX A;  3A02 A;  2H6B A;  2XGD A;  4XRF A;  4MGR A;  3C2G A;  3JCU C;  4QTR A;  3REO A;  4W1U A;  1ZG1 A;  3LSG A;  1KU9 A;  4G6D A;  3H3Z A;  4XLP F;  1XN7 A;  1VQL I;  2UXX A;  5FD6 A;  3W6K B;  2HXO A;  2CMP A;  5E18 F;  2VL8 A;  2XPV A;  2M0M A;  1L3L A;  3C1D A;  1ZRD A;  1FYL A;  1AU7 A;  1B72 A;  1EV7 A;  4B43 A;  1Y1W J;  2X0L A;  4CCO A;  3GME A;  4C3I J;  1SFX A;  1NH3 A;  5B5E C;  1U5T B;  2RAE A;  4I98 B;  4RB3 C;  2LG4 A;  3FXU A;  3ZXS A;  1P2F A;  1WJD A;  4A0Z A;  1KYW A;  3PQK A;  3MMY B;  1I50 J;  1X1A A;  2E2H J;  2FEZ A;  2IA0 A;  2W57 A;  1YLF A;  2IJL A;  1ZR2 A;  5FGM A;  3G1M A;  2CFX A;  5LGU A;  2R7S A;  3CLO A;  1VTN C;  4EV0 A;  2VC1 A;  1X2M A;  1QPI A;  2JMW A;  2QBY A;  5E20 A;  2V1D A;  5CPR B;  2BY2 A;  1FIP A;  2DA7 A;  2EFP A;  4RB1 A;  3TED A;  3CDH A;  1T98 A;  4NDL A;  3N97 A;  2JQ7 A;  1X19 A;  1LJ9 A;  3LSH A;  2IVM A;  2HDC A;  1IUY A;  3JR9 A;  3J7A Y;  4F93 B;  2CQK A;  5D5X B;  2GIZ A;  2R7Q A;  4LOC A;  1Y6I A;  1VQP I;  2OTL I;  5C4X J;  2WB1 N;  2H6C A;  3KP6 A;  1H9T A;  3KP3 A;  2H1K A;  1O4X A;  1FP1 D;  1X4P A;  4JX4 A;  1RKW A;  1BI3 A;  4LLG F;  1ZH5 A;  1WJ5 A;  1NHA A;  1G3T A;  3GF2 A;  3R60 A;  4I99 C;  3TP3 A;  4QSH A;  3ZRG A;  1V5G A;  1ZK8 A;  2O7O A;  5FB2 A;  1MMD A;  2B0L A;  2LRE A;  3LA2 A;  1ZAO A;  3X2Q H;  1HKS A;  4A3G J;  1Z3X A;  2BY1 A;  2WAQ A;  2PFB A;  5BPI A;  2D5V A;  1T56 A;  1W1W E;  4PSW A;  2X1E A;  1FP2 A;  1WI9 A;  4EM0 B;  3KIO A;  1G3S A;  1D1A A;  3HPH A;  4FTH A;  3K2A A;  2XRL A;  3BQY A;  1FBS A;  1Z6R A;  1H9G A;  3H9Q A;  5E1Z B;  1QVU A;  3EDP A;  4M3F A;  5F1J A;  4II2 A;  2DPD A;  3K1N A;  2JT1 A;  3BOQ A;  4KIB A;  4N9I A;  2LKX A;  4EGY A;  4ZYE A;  3H9G A;  3LQR A;  2D2W A;  1AOY A;  1WJE A;  4F92 B;  2GXG A;  1D0Y A;  3IAM 2;  1WJF A;  3L2R A;  2KIQ A;  4XKC A;  3CCJ I;  1TBX A;  3HGY A;  2MW8 A;  3FHZ A;  3CO6 C;  2IGO A;  2VI6 A;  1EJ9 A;  2IP2 A;  3QOD A;  4PJM A;  3HRS A;  3OS2 A;  2HVS A;  2BEO A;  2L9V A;  3ZQL A;  2DYR H;  1BA5 A;  4BE0 A;  4NNJ A;  4BQQ A;  1K83 J;  4UUV A;  2R7R A;  1XMA A;  3BT9 A;  3WHC A;  1B6A A;  5F1R A;  3RTR A;  1SMT A;  3U1D A;  3R0J A;  2Y48 A;  2R7W A;  2F2E A;  1FOY A;  2MSY A;  2L7Z A;  2MA3 A;  6PAX A;  1HF0 A;  1KQ9 A;  3G1L A;  4M74 A;  4B47 A;  1OPC A;  2VQG A;  2R0Q C;  3RZD J;  2O5R A;  3DKW A;  2JSC A;  1VQO I;  2VXD A;  2L9S A;  4IRI A;  2R3S A;  4BJT A;  2RQQ A;  3MD2 A;  3K4B A;  3L00 A;  3K4M A;  4XK4 A;  3LAP A;  1BI2 A;  4JQF A;  2ZME A;  3CCM I;  2PEX A;  4UXN A;  5DD8 A;  4B44 A;  2ZXJ A;  1K6O A;  1G2H A;  5HLG A;  1TWH J;  4DNC A;  1VQM I;  3SXY A;  2NNY A;  2DOE A;  3IHU A;  3I59 A;  5B1A H;  1K78 B;  3PNT A;  2AXL A;  4L5J A;  3HPG A;  4HDV A;  1CF7 B;  1OR7 C;  1IXS B;  3KFW X;  4M3G A;  3IWZ A;  1FPQ A;  3CMM A;  2IAI A;  2JJ7 A;  3HSR A;  2FBH A;  2VPL A;  2DK8 A;  3DLA A;  1XPX A;  1MBH A;  1SD6 A;  1IN8 A;  2EZI A;  3CUO A;  4X0G A;  2MC4 A;  4FCY A;  2VBY A;  2QWW A;  3MZY A;  2KIS A;  5HLI A;  1YJ9 I;  1ZQ3 P;  5CLS A;  1JKP C;  1DDN A;  3O2P E;  4L0Z B;  5K5O A;  3GW2 A;  1P4A A;  1JTY A;  2Y0M A;  4XLA A;  2PQ8 A;  1XGS A;  2P5V A;  3GLX A;  4RDU A;  3E3V A;  4N4N B;  1VFC A;  1I6X A;  4LK1 F;  1FYM A;  2L54 A;  3IRQ A;  4A6E A;  4WWC A;  4ENM A;  5L3B A;  2E60 A;  3HB9 A;  3OSF A;  1F9N A;  4DZP A;  4AUX A;  1S7E A;  3BZ6 A;  3M8F A;  3CF5 F;  4KFC A;  2DA3 A;  1SVL A;  3K2Z A;  2XDV A;  1D3Y A;  4AYB A;  4EAT A;  1KYZ A;  4PFO A;  2R5Y A;  3K9T A;  5KAF C;  2VKD A;  3ECH A;  4IZZ A;  1FZP B;  4IHT A;  2ESN A;  3DKY A;  4B3X A;  1EKE A;  1I1S A;  3BG9 A;  2OA4 A;  3U2R A;  3I4P A;  3B02 A;  1UG0 A;  1FYK A;  3I0T A;  2MH9 A;  5KAI C;  1RC9 A;  2BXZ A;  2VKE A;  4AID A;  4IOA F;  2MLG A;  3P7N A;  2VJ4 A;  4AC0 A;  2OV7 A;  4OMZ A;  1YG2 A;  1J2X A;  5J8C A;  4IL6 C;  3ABK H;  1OCO H;  5FRO A;  5D5V B;  3SQN A;  2QF7 A;  3WU2 C;  2DN0 A;  3PM1 A;  2GBY A;  5F64 A;  2LDU A;  3CJQ B;  2M34 A;  4N9H A;  2XAF A;  2JA2 A;  4MO7 A;  3LNQ A;  1NTC A;  3O6B B;  2CFO A;  1T0F C;  5DDG A;  3PIO F;  4PUS A;  5FKM A;  4DW6 A;  3J81 Z;  1QZE A;  3DWL E;  2MG4 A;  5LHH A;  3CUQ B;  1U8R A;  3QP6 A;  4P96 A;  1VQ5 I;  2HOS A;  5K7F A;  2YX4 A;  1T8I A;  1ETQ A;  1RES A;  1LEA A;  1HSJ A;  4IRG A;  1EH7 A;  2ELJ A;  2XAG A;  3HUG A;  5ICC A;  2R7Z J;  3S3O A;  1KQ8 A;  2LY9 A;  4O6J A;  5DM7 F;  2Y0S N;  4HST A;  2GIV A;  1ZG5 A;  4IXA A;  1JKQ C;  2F5F A;  4U7B A;  3TBI A;  1ON1 A;  5F6F A;  2ZJ2 A;  1B4A A;  1O7L A;  3WTV C;  4YIR X;  4NC7 A;  3RIR A;  3WU1 B;  1MBJ A;  4IF4 A;  2MGQ A;  3HKZ A;  2CYY A;  4L5E A;  4KMU X;  2GLO A;  3V7R A;  3ZQH A;  4LJZ F;  3DQV C;  1WCM J;  3A03 A;  1X1C A;  4CA0 A;  1U0J A;  1LFU P;  4CO8 A;  1XX5 A;  3S14 J;  1MBF A;  4S0H B;  1BIA A;  5D8K B;  5GAE J;  2HI3 A;  2J5O A;  3LA7 A;  3SYT A;  1MMS A;  4KIF A;  5IT9 K;  4CGZ A;  3ZN0 A;  3R4K A;  1R9T J;  1JGS A;  3JRA A;  5JHF A;  3IAS 2;  2UUZ A;  4BEH B;  4L18 B;  3QPS A;  2CUE A;  2KZG A;  2LNB A;  4BE1 A;  2Z99 A;  1I27 A;  3S2W A;  4G6T B;  2ZFW A;  2IPQ X;  1E3P A;  3CP2 A;  3K6G A;  1P6R A;  2OC6 A;  5E3O A;  2K40 A;  5J6X A;  1TZL A;  4G7H F;  2ZSI B;  4R79 A;  2IEK A;  3BTC A;  3G73 A;  3ZPL A;  3ONQ A;  3I71 A;  4XON A;  2YU9 J;  3P9K A;  4FE4 A;  1ZGA A;  3DEU A;  2X9D A;  5D5W B;  3PFI A;  3LA3 A;  2HZD A;  2XSD C;  2XF5 A;  1UST A;  2K3P A;  2HOT A;  2FUG 2;  1SAU A;  2Q8K A;  2OZU A;  3DEE A;  1BJA A;  3ECO A;  3IH2 A;  4YEL A;  3J7Z I;  5AIP A;  5LEK A;  2CO5 A;  3EUH A;  2R7T A;  5B3S H;  5IT3 A;  3U9G A;  1LFP A;  4XOP A;  5EF6 A;  2EK5 A;  2HDW A;  2E71 A;  2PG4 A;  2BOL A;  2K9Q A;  4LLL A;  1K4T A;  1R4M B;  3CCV I;  2VON A;  2V1X A;  2V9K A;  3JTH A;  4BJ6 C;  1R6R A;  3WTW C;  3IKT A;  3GLL A;  4XLF A;  3SFZ A;  2CV1 A;  1Z67 A;  2IXS A;  2Y75 A;  1ZG3 A;  4IO9 F;  1FOW A;  2QM3 A;  2FRH A;  3RQI A;  1TP4 A;  2DMQ A;  4HW0 A;  2LLK A;  3LSK A;  2ZSH B;  2B63 J;  2IS1 A;  3RDI A;  3BZC A;  1A31 A;  3IC7 A;  4RM3 A;  4L9J A;  2IGM A;  2Q2E A;  2BHZ A;  4IHV A;  3PQJ A;  1LDD A;  2HEO A;  2QCO A;  4BDY A;  3H35 A;  4CHU A;  3L2Q A;  1O3Q A;  2JA7 J;  3M4O J;  2WAF A;  2V26 A;  3GFM A;  4HV6 A;  3S32 A;  2Z9O A;  3Q3S A;  2V6E A;  1X1B A;  1SEU A;  4OIN F;  1PP7 U;  1Z7L A;  2CSO A;  2K27 A;  1W7P D;  2XF7 A;  1SFE A;  1YOV B;  3GX4 X;  2DA6 A;  2HKO A;  1ETV A;  1Z9C A;  3S2D J;  3LST A;  4MTE A;  4AWX B;  2VUM J;  1TT5 B;  1HA8 A;  3L2C A;  1Q1V A;  3LL7 A;  1MD0 A;  3JRI A;  1WI3 A;  3QYE A;  3D5L A;  2F5E A;  3QAH A;  4HYE A;  3TGN A;  1ZYR F;  3GBG A;  4UVA A;  4RAY A;  3EPZ A;  4UUS B;  5B1B H;  1OCT C;  3PO3 J;  3V7S A;  1MNM C;  1R49 A;  1TW3 A;  2MAB A;  2F5C A;  2H09 A;  2P6T A;  4OU0 A;  3OSG A;  4XOT A;  4I0A A;  5JFR A;  1ETX A;  1T08 B;  2LC2 A;  3HHH A;  5D6E A;  5HVQ C;  3ZCO A;  3GTG J;  1QHH D;  4B09 A;  2H1L A;  1QPM A;  3HTS B;  4HEA 2;  5L3E A;  3NAR A;  1FTZ A;  1S6L A;  4Q5S F;  2EFO A;  2K02 A;  1BIB A;  2O03 A;  4PJN A;  3QP5 A;  2LKS A;  3V4G A;  2DA1 A;  2KKO A;  2X6X A;  5JVG F;  1STZ A;  3G2B A;  3KLO A;  2LTP A;  3NWS A;  2A6E F;  1W7P A;  4RBO A;  3PUB A;  2VOD A;  2EB7 A;  4BBS J;  2L7K A;  3I9V 2;  1XS9 A;  5FFZ A;  1W5S A;  1XD7 A;  2HKX A;  2EFW A;  3JRB A;  3F6O A;  5FRN A;  2CWE A;  2JTV A;  2JA6 J;  2P5L C;  2DJI A;  1IJW C;  3CJT B;  1XTA A;  3FXR A;  3AAF A;  4E7S A;  3MKY B;  3O3K A;  3MAJ A;  2NS0 A;  2KFD A;  3J80 K;  3GWZ A;  3QU6 A;  4NQW B;  3ZQQ A;  3AG1 H;  1P4X A;  3LFU A;  4QPQ A;  3FBN B;  1F36 A;  4M73 A;  2CW0 F;  3DU5 A;  4HQE A;  2I5U A;  4AM3 A;  5LLQ A;  3GO5 A;  4Y13 A;  4A12 A;  2EIM H;  1UJ8 A;  1UZC A;  1SFU A;  4XQF A;  2PJR A;  3S2H J;  3FZV A;  4JBA A;  2R7O A;  4EJO A;  1DGR M;  1T38 A;  3ZMD A;  3TP0 A;  2P0W A;  3HSE A;  1ZAR A;  4XL9 A;  4AIK A;  1HXD A;  2JPB A;  1TTY A;  1OYY A;  4KUM A;  4MQ9 F;  4F52 A;  1MDM B;  1ACI A;  3LQQ A;  4P5O A;  3CDL A;  2LF7 A;  3CMA I;  1GV2 A;  1S72 I;  3HZJ A;  1QGP A;  2DW4 A;  5DM6 F;  2XHK A;  2FML A;  3H36 A;  4I0B A;  5EGO B;  1QVT A;  2V9V A;  4H4K C;  3OR1 C;  3CCY A;  4U0Y A;  1WGX A;  2X48 A;  3S15 J;  3RJP A;  4TV7 A;  4A6D A;  1IG7 A;  1MJ9 A;  4ENJ A;  2IGK A;  2FOK A;  2KLO A;  3E97 A;  2QSH X;  2ME6 A;  1LB2 A;  1JUM A;  3AG2 H;  2DDB A;  4FE7 A;  5C3E J;  1AKH A;  4ZYD A;  1VZ0 A;  1SMY F;  2E35 A;  1GUU A;  2EFQ A;  1LE8 A;  2ISZ A;  1MMN A;  2DK5 A;  2TRT A;  1UAA A;  4A3L J;  3K10 A;  3PUF A;  5DYM A;  5GPC A;  5ICG A;  2JN6 A;  2V79 A;  3OR2 C;  4ZC3 A;  1TNS A;  2XSJ C;  5C4J J;  3OYI A;  2LK2 A;  1XSD A;  5F08 A;  2FX0 A;  1HDD C;  2EBI A;  2UWM A;  3VOD A;  1YJN I;  3F23 A;  3FKJ A;  2M8E A;  2DFF A;  2HTS A;  3ZMS A;  4B1R A;  4BUP A;  2HYF A;  1QA6 A;  3QQA A;  4DBQ A;  5LGT A;  4HF1 A;  1MW7 A;  3K1P A;  1TL8 A;  2W24 A;  1YIT I;  4BNC A;  2Z2S B;  1PUE E;  5AIQ A;  2L9N A;  2K5C A;  4LMY A;  4BBR J;  5CJ9 A;  1BOA A;  3OIQ A;  1NG7 A;  4M9X A;  2R5Z B;  2DMN A;  4CYC B;  3S3N A;  4G8X A;  2DAO A;  1IC8 A;  1TW2 A;  1B9N A;  3IP4 B;  4UHT A;  2O8X A;  3OYA A;  4Y15 A;  3BR5 A;  2RN7 A;  1BN5 A;  5JI6 A;  5LRR A;  3QRF F;  3HBL A; 
#chains in the Genus database with same CATH homology
 3AG1 H;  3ASN H;  2EIJ H;  5IY5 H;  3ABK H;  3ABM H;  1OCO H;  1OCZ H;  2DYR H;  2ZXW H;  2Y69 H;  5B3S H;  3AG3 H;  1V55 H;  2EIM H;  2EIK H;  2EIN H;  3AG4 H;  3ASO H;  2EIL H;  1V54 H;  2OCC H;  5B1A H;  1OCC H;  3ABL H;  1OCR H;  3AG2 H;  3X2Q H;  2DYS H;  3WG7 H;  5B1B H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...