3AG1H

Bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at 280 k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine cytochrome c oxidase structures enable O2 reduction with minimization of reactive oxygens and provide a proton-pumping gate
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 25
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3ag1H00
5B1BH 1V55H 5IY5H 3X2QH 5B1AH 2EIKH 1OCRH 2EINH 2EILH 2ZXWH 3ABKH 2EIMH 3ABMH 3AG3H 5B3SH 1OCCH 1V54H 3AG4H 3AG1H 3AG2H 2DYRH 2DYSH 2OCCH 1OCOH 1OCZH 2EIJH 2Y69H 3ASOH 3WG7H 3ABLH 3ASNH
chains in the Genus database with same CATH superfamily
2X85A 2OC6A 4ENJA 2HYJA 1X3UA 2V1DA 4L9NA 2VJ5A 1I27A 5L3FA 3A0HC 1BI1A 1I5ZA 2MLKA 4CCLA 1Z9CA 1U2WA 2ZXWH 1FPQA 2CQ7A 4KMFA 2E1CA 1R5ID 1SD7A 1U5TA 1XMAA 2EB7A 2GLOA 5J1RA 3FMSA 1TC3C 4BQQA 1V4RA 3IV5A 2I8DA 4G8XA 4M72A 1LFUP 4CO8A 1JGGA 4E4HA 3HPGA 1YTYA 2QF7A 1SANA 3EUKL 3IRRA 2P6TA 5E3MA 2UXNA 5F64A 2XKPA 4CYCB 1AU7A 1REPC 3IUOA 4M6VA 3J7AY 2XGCA 2QSFX 4E7KA 2ZKZA 1WCMJ 5LHIA 1RUOA 2HOAA 2UUZA 5FLVA 2IVMA 1O3RA 2V26A 1B72B 3F8MA 1JHFA 3QAHA 3R0AA 1ZYRF 2NS7A 3CZ6A 2LKSA 1AOYA 5IT9Z 1MGTA 3GCMA 5FD6A 4JBAA 3HKZN 3MVPA 4HQMA 2Y31A 3QQAA 5D5XB 2B63J 2FUG2 4PSWA 1FY7A 3BT9A 3MKLA 2FF4A 3R0JA 3WTUC 2X9DA 5EDNA 4BXXJ 2VJ4A 1OYYA 4X1EA 1BI3A 3NAUA 4I2OA 4PJJA 1LPQA 4D5CA 2DA2A 3RKYA 1ZG5A 1RNLA 2FQ3A 1AKHB 5A2QK 3IWZA 1IN6A 2GQQA 5CQEA 3EQLF 4LB5A 4O3MA 4GDFA 5LHGA 4MTEA 2B9SA 2WY8Q 2MD0A 2Z16A 2J5OA 1WJEA 4JX5A 1YI2I 2K85A 2DA4A 4XLEA 5FKLA 5B5EC 3HOZJ 4E7HA 1IXCA 3C7JA 1D8JA 3GXOA 1AKHA 3G2BA 3Q9SA 3RQ4A 1E0EA 2BV6A 2KJBA 9ANTA 3PUBA 2VXZA 4AYBA 4L9JA 3JAMZ 4L9TA 1FP2A 2MFZA 4HA8A 2IS2A 4KDPA 2ZC2A 4A3KJ 3HGYA 2RREA 2QUFA 1B59A 1I50J 3SFIA 4XM3A 1JJ8C 5FKOA 2V9KA 3FK6A 3FXOA 2KPMA 3J7YJ 5IP7J 3OYNA 4L0YB 3W6JB 3E1SA 3MKZA 2XRLA 1UHMA 2KKOA 2ZSHB 1OCOH 5L3GA 5HOOA 2QBYB 2X4HA 3VB2A 1M1EB 1R4NB 3KLNA 1U78A 3FIWA 4D5FA 3GLXA 3E97A 4HF2A 2WAQA 1KA8A 1IDYA 4IOCF 2V4JC 3HB9A 3OIQA 4XL9A 4PFOA 3A0BC 1LUJB 5DCMB 1YO5C 4MO7A 4DZJA 3GUDA 1BM9A 1MSEC 3FM3A 4I0AA 1OLTA 3I4NJ 2W57A 4B44A 1TT0A 4UUSA 5JI6A 1EA3A 4QPOA 3BG7A 3ERMA 3A2KA 2XV4S 3GTPJ 4KMUX 5GP9A 2PLYA 3K10A 2J5PA 1SD6A 2NXNB 3A01A 2KRHA 2STTA 2A07F 2R7ZJ 4HSRA 4IEJA 3ZN1A 3H3VK 3S1MJ 3HRSA 2XPUA 2ISYA 1B8IB 2LY1A 2BBYA 2CW7A 4MGRA 3LFUA 2Q2EB 4P9UA 3I0TA 2JRMA 3ZQHA 2GA1A 3TMOA 1Z05A 5J6XA 1E3HA 1HF0A 4Y3OA 2FEZA 4ZYDA 2O6GE 3FHZA 2OJED 1TNSA 1ETWA 2K4JA 3M1CA 2Z9OA 3FMQA 1O4XA 3H0GJ 3W6VA 3CCRI 5CVRA 2NVTJ 1OPCA 1BI0A 2BY1A 1UB9A 3HRTA 4RAGA 4L18B 3E6DA 1S6LA 1YRNB 2VXDA 3AL0B 3I54A 1XCVA 2QA4I 1XGNA 4DBRA 1RESA 4GGGA 4E70A 4CYCA 3ELKA 4RB1A 2JZYA 3CMYA 2UZKA 4BDZA 2DYSH 1SAXA 2PBIA 5E1XA 4U88A 5GTIC 3OYGA 1XTAA 1LB2A 4HPQA 4FHTA 3CUQB 3DXJF 2ACJA 3I4PA 2P5VA 4BU2A 4KT6A 4HX8A 3HEFA 3BR6A 3RQIA 2HPIA 2GXAA 2IGNA 1UFMA 1ZARA 2EFQA 4C2UA 5K1YA 5E20A 2HR3A 3GWZA 1K61A 1S7EA 2IPQX 2K27A 2H8WA 2ZB9A 1OYIA 2A68F 4PJLA 2BE5F 4IHVA 1Y6IA 1U3EM 3UKGA 3ABUA 1MMAA 3Q9VA 1MZBA 5H20A 5FLXK 4ENNA 1I1SA 1SD4A 1Z77A 3G73A 1JTXA 1EH6A 2E34A 3OS1A 2JA2A 1J75A 3QU6A 2L01A 2K9NA 2ZMEB 3A02A 2DPDA 2K9LA 3U1DA 4BHCA 4NHJA 5K7HA 1IZ1A 4IQJA 5K7FA 2HZTA 3OOUA 2DCEA 5HLGA 5M3FJ 1QO0D 1RIOH 3N97A 1MD0A 2H6CA 2L02A 4A93J 5E8IA 4BQOA 1KZHA 2D1VA 3HSFA 4GCVA 2DDAA 2OZ6A 3HKZA 4HF1A 3SDBA 5CYVA 4KFCA 4A5NA 1MDMB 2AXTC 2Y0SN 4JK1X 1XGMA 3NQOA 1AWCA 1RI7A 2KIQA 3J81Z 2MSYA 4PJMA 5LD2C 2WAEA 1R23A 1NK3P 2JPCA 1MBEA 1POGA 2A69F 2Y75A 4ESJA 2JPBA 1XMXA 3OL4A 2WADA 1O3TA 2IXSA 3LSMA 5CJ9A 2OA4A 2DFHA 5E3OA 4M73A 2VQGA 2WTEA 3CF2A 1RPWA 2CQQA 2KIFA 1BIBA 2NNYA 2DT5A 1I6HJ 5EGOB 4WF2A 2BVMA 2OAZA 1GXQA 4M3BA 4IQ4A 4LIVA 2OUMA 2CQXA 3E3VA 1MBHA 1U8RA 1FYMA 1WHUA 5A2QZ 2WV1A 3TKYA 1VQ9I 3S17J 3DP7A 2FRHA 3FKJA 3SEQA 2EQRA 1XGOA 4UUTA 2R7RA 2R0QC 1OQYA 3H5NA 1S7AA 3V7RA 3GFJA 1OFCX 4Y33A 3R61A 2CUEA 2M45A 1W4MA 3TW6A 2GOMA 2XAUA 1OR7C 3K0LA 5EEHA 2CUFA 5GTHC 2BZTA 1OCPA 2GWRA 2E71A 1MJ9A 4BBSJ 2RDPA 1XG1A 2CFOA 3I59A 2PI0A 3KYLA 2XKOA 2RN7A 4XN3A 2RAEA 2HGCA 4YFXF 2Y30A 2K5CA 2OCEA 1IGNA 4C3IJ 2X51A 2P6SA 1OCRH 2EILH 5IYBJ 2MC3A 4JQFA 3ABKH 4HNUA 4Y15A 2CQNA 4I98B 5BMZA 2W85A 1IW7F 1GVDA 2HQNA 2H27A 2WB1A 3BR2A 3BC8A 5FFZA 1UJ8A 2O8XA 4ASNA 4BL0B 1X58A 2RVCA 1VQ5I 1USSA 5F1JA 3KP3A 3I71A 2VBYA 5CVIA 3MAJA 3K4BA 5M5WJ 3J7ZI 1CGPA 1GDTA 4I01A 4BQNA 2WB1N 3CCEI 2BOLA 1VQ7I 1FX7A 1HBXG 5TGTA 2LNBA 2L7MP 3C1DA 3Q5FA 5AIQA 4FETA 2QZ8A 4HNVA 2R5ZA 2DA6A 1BC7C 1F43A 3L9FA 3ABTA 5GADJ 2X48A 1S8NA 4BJTA 2A5YB 4B3AA 4A3EJ 3WGIA 4C9YA 3L2VA 2LYCA 2IA1A 1FIPA 3KP7A 5ILSA 3O3KA 2JVGA 2DA3A 2RQPA 2ECBA 1UMQA 3QU3A 1LVKA 1QZYA 4LK0F 2LF8A 3GTOJ 1ZRFA 1GHCA 1SMTA 2XPWA 3S2WA 3N05A 2XSJC 1H88C 1HW5A 1RETA 2EV0A 3M8EA 3PNTA 4OIRF 1SMYF 2BW3B 3BP8A 5DDGA 1ZN2A 5GPAA 1TWGJ 1PJRA 2PJRA 4NC6A 5TJJA 1XMKA 3JTHA 4ZYHA 4BY7J 3ABLH 2HU9A 3K70D 1XSDA 1K6OA 1IN5A 1JT0A 1J0RA 4XLHA 2H09A 5D4SA 3QP6A 4I6ZA 2F2EA 4CCMA 4CXFA 4L5JA 2JRTA 1BJAA 3JRAA 4Y4RA 2V79A 3VSLA 3ZMVA 2Z5UA 5ILUA 1MBJA 2H6BA 2OTJI 5CVVA 3V8JA 3QYEA 4B09A 2LR8A 4M6XA 4CCNA 3FX3A 2LBFA 2IW5A 2DJNA 3BCAA 4MNUA 3ZRGA 4UY8I 2HI3A 2V6CA 3D0SA 3KEOA 3GO5A 4LG0A 4GXOA 2LY9A 4ZYEA 3P9CA 3K1PA 4IHTA 4OIQF 2QGUA 3IKVA 5ICFA 2HYFA 1JUSA 3G1OA 1HQCA 1KYZA 2KL4A 5LGUA 4U0YA 2JUGA 4S04A 3M8FA 4RM2A 3RZDJ 4CCJA 3GTJJ 4KIFA 2CW8A 1MMSA 1Q1VA 2XUBA 3EYYA 2EV6A 1PP7U 3HRMA 4WWCA 4XRFA 4YIIA 3G3ZA 2HOTA 1WZ2A 2JTVA 1Y0UA 1R58A 3AG1H 3K2ZA 1K78A 2Y0SA 3IRQA 3RI4A 5FFXA 1LDJA 4S05A 2R5ZB 2HTJA 1YHQI 1QVTA 4P55A 2F5FA 3GTQJ 1IXSB 3BR3A 5D4RA 3OYCA 2VPLA 4BDYA 5C4XJ 2G9WA 3P7NA 3WE3A 1IF1A 3ZCOA 2O3FA 3AAFA 4GRIA 4XKWA 2TCTA 2O0YA 2PX9A 3D5RC 1AHDP 2X1EA 2VBZA 2O61A 1KU2A 3S8PA 3K4JA 4XRSA 3T8RA 3ZQ7A 1TT5B 4ZZDA 3JRFA 2HVSA 2JSPA 2L4MA 4EJWA 4KITB 1YIOA 1WJFA 2FU4A 4MEYF 1EH7A 1X2MA 4V2GA 1EJ9A 1ZELA 3ZMZA 4IRHA 1R7JA 3K2AA 2CYYA 4QPQA 4LLNA 1TW3A 2ZFWA 2DMUA 4H0EA 2MC4A 2Q0OA 3I9V2 3GFMA 3KFWX 3RKWA 2IP2A 3BR5A 3HHHA 3KIOA 5KAIC 3ZPLA 4LG3A 1I6XA 2M7AA 3HTUA 2R3SA 3JSOA 4UB8C 2R5YA 2QQBA 3FF5A 3TOAA 3HUGA 2ZMEA 4R1HA 1FOYA 2YU9J 2DLLA 2DA1A 3BOQA 3OS2A 3GZ6A 1K83J 1Z3YA 2PFBA 3F3XA 5LEJA 3LSPA 1HOMA 3H36A 4I02A 4IRGA 3ZQLA 2WAFA 3SEZA 2GM4A 1ENHA 4BEHA 5DCMA 1YW9A 2W24A 3SJMA 5IT9K 1J9IA 5EG0B 2HQRA 2EH3A 3K4KA 2X6YA 5IYCJ 1HSJA 1XPXA 3M7GA 2CV1A 3V4GA 1LDKB 2FE3A 2C6YA 4KICA 4RB3C 1U0JA 1JI8A 4E7LA 3L09A 1K7AA 3SQNA 3LNQA 4L9VA 1MSFC 4Q48A 4XSZF 3CO6C 1ETVA 2Q1ZB 1ON2A 4UHTA 4BS9A 1SVLA 1OYWA 2KLOA 1UZCA 3PL8A 3WTVC 2VJJA 3GTMJ 3PQJA 1SEUA 3E5QA 1ZREA 3PJRA 5L3DA 5F1RA 2HDDA 3JTGA 1J09A 4AIJA 3DKWA 3FBIB 2ELKA 2CUZA 1YX5A 4BBRJ 5IP6A 2FMYA 4NC8A 3QODA 5HODA 4YIRX 3L2CA 3U21A 4AYBN 1HC8A 4HX7A 1ORKA 1J5YA 4U7DA 3CC2I 3KLOA 5J40A 1J59A 2FQ4A 3MWMA 2BEOA 5B1BH 2LBFB 1W0UA 3CJQB 1BN5A 2KHMA 2ZXHA 1LEBA 1T6SA 1SVOA 2JWTA 2VASA 3LA3A 5L3CA 2HOSA 4XLPF 4M3FA 1SVMA 1R1VA 2CJJA 2M30A 4ENKA 4O5VA 2LMDA 1BR2A 2MGQA 3U9GA 1BC8C 2NYXA 3K1MA 1VTNC 1B72A 4CUGA 4HV5A 2JSCA 4XLAA 3DU6A 2DYRH 2E2JJ 3HOUJ 3TQNA 2VQCA 3PSFA 3SFZA 4XOPA 5KHDA 1VQNI 5HLIA 3EETA 1ERDA 3IL2A 2LC2A 3TOBA 2GOXB 3OWTA 3BR1A 4ENMA 4LD5A 1T38A 3OYFA 4XKCA 2XHKA 4NC7A 4F52A 2E2IJ 3I4MJ 2FA5A 3H3ZA 1Z91A 2E35A 5HS7A 4W97A 4OIOF 2DQRA 4IJAA 5DD8A 5HDGA 3CCMI 1KU3A 2XC7A 2HXOA 1WGXA 5DTDA 2ZXIA 2OCCH 3IAS2 3BROA 1X19A 2PJRB 1U9NA 1I3AA 1JKPC 4LB6B 2E1NA 2LREA 3HC7A 3ESWB 1FOKA 4XICA 3DEEA 4QLCU 4IZZA 1XC5A 2VKVA 1JUMA 4KIBA 3GBGA 4PJ0C 1YITI 1RKWA 2AO9A 4EMSA 3OYHA 4M74A 4E7ZA 1YQAA 2ZO4A 3JSPA 4OWRB 4B4CA 4BUPA 2XROA 4BGDA 5CKTA 2L9VA 3C18A 1N75A 4ZYAA 5FJ8J 3DBHB 4HLYA 5EGOA 3NEUA 3AG2H 3OSGA 2LTPA 5K5RA 3EUHC 1Y8RB 2WC2A 3QPSA 4EJUA 2M0MA 1I1GA 4A5MA 1ZGWA 2ZJQF 2GIZA 4HEA2 1SAUA 5LGNA 5FD5A 2R7TA 3NRVA 3P9IA 3TL4X 1OKRA 2L7FP 3C2GA 3TDZC 3S1RJ 4BNCA 5B1AH 3RJPA 3LSTA 3RPUD 3KX2A 3S3NA 1SFKA 2FD5A 4GYIA 3JAMK 3HG9A 2B0LA 5B3SH 1WH7A 1SC7A 1XCBA 2IGKA 1Y0NA 3AG4H 1MW7A 2FNPA 1Y1WJ 5DEQA 2Z99A 2DAOA 3CCUI 3I59B 1O7LA 3M8JA 2L2OA 2VKHA 3KETA 2KQRA 4IHWA 2GXBA 2R7VA 5JLXA 2M8GX 1YW7A 4AVZA 3F72A 3FXLA 2OQGA 1V3FA 5EZGA 4G6DA 4B48A 2NVYJ 4NQWA 3S15J 3AFHA 1ZG3A 3WU0A 1B6AA 2VQHA 1MNMC 4HNTA 2DXIA 4R8HA 3LMMA 1UG0A 1Z0XA 4CDGA 1ETKA 1H9GA 5E3NA 1VZ0A 2YPRA 2BW3A 2W1OA 3U1KA 3F6OA 3ZQFA 2F4MB 2GAUA 1R1TA 3IHUA 3TBIA 2WY7Q 2LRDA 5L3BA 5FB2A 2M7BA 1YJWI 1ZGJA 3OY9A 1FBQA 2F5VA 4YRVA 2BHZA 3OL3A 1U5TB 1XSXA 1AA7A 5BNGA 1YOVB 2EJRA 4FT8A 1L0OC 2Y69H 1VQPI 3R60A 1GVJA 2OV7A 1BI2A 3IKTA 4FX4A 5LGTA 2R7WA 3JRIA 3OYEA 4OAZA 1P4WA 1HXDA 2OQRA 3JRGA 1JHHA 5ICGA 4CSWA 3F6VA 5K5QA 2QKLB 4KJZA 1ZG1A 2DOAA 2JA5J 3HOYJ 2I10A 2W00A 3NWSA 1RZ4A 3BG9A 5E3LA 1T2KA 3B73A 1P2FA 4A6EA 4KN4X 1DPUA 2WA0A 1MDMA 4N4NB 2L9RA 2R7FA 1U8BA 4IHSA 1GV2A 1IAWA 2DW4A 2X1DA 4F91B 4EGYA 3S16J 3B6CA 4L5IA 2E36A 2AQFA 1WKMA 2ESNA 4A0YA 3LAJA 2Y2ZA 1R4MB 3OOPA 1NG6A 3BG3A 5E18F 4GFBA 1DPRA 3BZCA 1IUFA 4QIWN 3L2QA 4AWXB 2P5KA 1QGPA 4D7NA 1HDDC 1QPMA 3ABMH 1Y1VJ 3Q0WA 3S1NJ 3RTRA 5M5XJ 2XVCA 3ERED 4DYQA 2RQQA 4OIPF 1ITYA 3MEXA 2LOOA 2CWEA 2NVXJ 2VOOA 2JJ7A 1TNTA 1IN7A 5CLSA 5J8FA 1A5JA 3HM5A 3CMAI 4UV8A 2DFIA 5FKNA 4ZDPA 3W6KB 4XN0A 4S0HB 3PIPF 4H4KC 1OCTC 3D5LA 2DMTA 1R1UA 3ECOA 2IGOA 4F92B 4M9SA 2K9MA 2QSHX 1G3TA 5TRDA 2MABA 3HL2A 1JXSA 3GW2A 3R6SA 5LEKA 3FXMA 5GPCA 4DIQA 4OAYA 4A3MJ 1R49A 2ECCA 3CJRB 4HV6A 5E79C 2KFDA 4EGZA 1B8IA 1ON1A 2A05A 5EEAA 2HKOA 4YG2F 2DTRA 2VL8A 3I58A 1R9TJ 1OMIA 1MIJA 4ESFA 4RS8A 4YFNF 4HBLA 4RDUA 2FSWA 3ZN0A 3HHGA 3QPHA 4II2A 1ZLJA 4FQGA 3QPTA 1P7JA 4G7OF 1P7IA 4E7SA 1BR4A 1MMDA 1RC9A 2V1XA 3BTJA 5JFRA 4OMZA 2PMZA 4BAYA 3FISA 4ABZA 2FMLA 5DUKA 5IT3A 2NRAC 5FO5A 2LG4A 3CLQA 4M9ZA 3PM1A 3LWFA 2STWA 3PNVA 1BR1A 3K6GA 5EF6A 3WG9A 4G12A 4O6JA 5HS8A 3ZOBA 2L9SA 2XPVA 1FT9A 1IN4A 1LFPA 2L0KA 5J8CA 4A3BJ 2Q8KA 3JRDA 1X3WB 4JP0A 3ZMUA 4A3IJ 1FC3A 1WJBA 5HS9A 5FRMA 2FBIA 2Z3YA 1B1BA 2E7XA 2XGXA 3EPZA 2KIMA 3I5UA 2R7UA 1R6RA 1XSVA 4IF4A 2W25A 1GT0C 4PK4A 1S5LC 1D5VA 4JX4A 1FTTA 4E7JA 5IPAA 2K9SA 3C2HA 5ED4A 1DU0A 2IS6A 3MZ8A 3OYJA 3KCCA 2RKHA 4EM1A 1B9MA 1B9NA 4R79A 4LJZF 1HW1A 3DEUA 3A01B 4W1UA 5DM7F 3I55I 1D1BA 1BW6A 4Z6YA 2DU9A 1F36A 2XIGA 4HDUA 2R7QA 4JYKA 3Q0UA 3IWFA 1KQ8A 4UXNA 3BTLA 1A04A 1FP1D 1ZTRA 4XKVA 1WJ5A 2EZKA 3G6EI 4AVPA 2CG4A 2Q2EA 1P9QC 2QQAA 1VNDA 3QOEA 4EV0A 2VJIA 1MNDA 1IUYA 2CS3A 2MH2A 1ONVA 3ZQQA 2FBKA 3K1NA 3FZVA 3WTXC 1MBFA 3HUGB 3ASOH 2NVQJ 5F04A 4WCGA 4RGUA 3M9AA 1DDNA 5IYDJ 3WU2C 2EA4A 2K3FA 5E17F 2FOWA 1P6RA 1XD7A 1FOWA 4GO1A 2EIKH 4EJOA 1Z67A 2F6CA 2ID3A 3WTTC 3HBLA 3CO7C 4IHYA 4BJ6C 4YIFA 1W7PA 2HDCA 4HOBA 4XBFA 3FKIJ 3ZMDA 4LIUA 2CV2A 1WWXA 5J3LA 3PIOF 4HRIA 3VODA 1TZLA 1J2XA 4KN7X 4WXDA 3F9KA 4BE0A 5J1UA 3ASNH 2ZNZA 1DQUA 1HSTA 2QCOA 3O6BB 1U5TC 3BPVA 1LEAA 3I64A 3HGGA 5LLQA 1SD5A 3KEYA 1W5TA 1QNTA 3RPUA 3FXKA 1BW5A 4A12A 2RGVA 4XIDA 4FISA 1VQ4I 1IRFA 4EJVA 2LVSA 3M1EA 1KU9A 3DWLE 2M9HA 3CCYA 4A0XA 2KJCA 1CQTA 4IRIA 2IGMA 1KGSA 1MMGA 3KZZA 4FX0A 2H94A 2CW0F 2E19A 1Z3XA 2K86A 3PO3J 4Q5SF 3ULQB 3A03A 4RAFA 4ON0A 2DMNA 4N0BA 2A6HF 3O8GA 4Y13A 5CVUA 4BXFA 4FCYA 3AL0C 3ZQCA 3CCLI 3DLAA 4XQFA 3KP2A 1R5GA 2HDWA 1L3LA 5E1ZB 2O7OA 4MTDA 1W0TA 2EINH 1Z7LA 2ELJA 2KISA 4RBOA 1W36D 3DBLB 4UB6C 2XF7A 4U0WA 3JREA 1N25A 5AIPA 5BOXA 2VB6A 3F8BA 2CV0A 3E6MA 1SFEA 1T95A 4BE1A 3B02A 3TP0A 3BCBA 2E2HJ 4DZPA 4N9HA 1QRYA 3CLOA 2MLGA 2YX7A 2MD5A 2PMUA 4UVBA 3VEPA 1MNEA 3CCSI 2OD5A 2RNJA 4ZJZA 4KYWA 3LA7A 4X6AJ 1TWCJ 2HFHA 2KDOA 2K40A 3CUOA 1C0WA 1CF7B 3K70C 1MBGA 1X1DA 1K4TA 4EJTA 3DLLF 1IN8A 3QP5A 5F0FA 2D45A 2KT0A 2GXGA 5C4JJ 3RIRA 2KP6A 2ISZA 3DV8A 2LD5A 1HKQA 3HYIA 4EATA 2ZNYA 1N78A 2ZFUA 1JJ6C 1HA8A 5GAHJ 1W36C 1BOAA 2M1BA 5H6QA 4XK4A 4XNFA 3WTSC 6PAXA 1JE8A 2M2EA 3LFKA 1H9TA 2ZBKA 2XASA 1S29A 1P92A 3BQZA 2IS1A 1YG2A 1BL0A 2F5EA 1PUFA 5CQGA 1FMWA 2LLKA 2KMUA 4NBQA 2IT0A 3HXLA 2ID6A 2P4WA 2EFPA 3BPXA 2XAFA 2W84A 3H5AA 1W1WE 3MCZA 3S2HJ 2E5ZA 3BWGA 4AM3A 4HYEA 3D5SC 3F23A 3DU5A 3ZQGA 3V7CA 3WGHA 2W48A 5BPDA 4RB2C 1QPIA 2F5DA 3P9KA 3ZMSA 3LSKA 4LOCA 4UVCA 1YFHA 4V19K 2ME0A 1G6NA 1S7OA 4ITVA 2VE8A 3DCFA 2BVLA 4V2FA 3SHFA 1W7PD 1FIAA 4BJ5C 1WH5A 1BBYA 2L4AA 2VI6A 2M0CA 2RC4A 2LH9A 1K79A 2VN2A 2EIJH 3KP4A 1MJAA 3RYPA 1IV6A 5ERIA 1X1AA 3DF8A 4M3DA 2M3AA 3SZGA 5LHHA 4CCOA 5K7ZA 1SFOJ 2VC1A 1FYLA 3HPHA 4BYYA 1HLVA 5J1YA 1LNWA 2EBIA 2O5RA 4OOIA 4XLFA 1ZR2A 4XMYA 4A6DA 3CP2A 3DKXA 3OYKA 1WPKA 2EA2A 1ZGAA 2KIUA 3T5XA 2VBXA 5L3EA 1R22A 4I09A 4P9FA 2VBWA 3KP5A 3PNYA 4YEJA 4B43A 4MIMA 1LFBA 2AHQA 1Z6RA 1VQ8I 1UHWA 3OS0A 2QWWA 3MQ0A 4RLFA 3HOSA 1FLIA 1OJLA 2RNGA 1T39A 5BS6A 2CRGA 3GFIA 2E5NA 2FX0A 2IJLA 1H8AC 2VLAA 4LLLA 1IJWC 2R7SA 3VOEA 2F4OB 5F0HA 1Q1HA 1J7KA 2DI3A 3FXJA 1S72I 2XAQA 2LKPA 2NOGA 1IV8A 1W7PB 1TWHJ 3K9TA 1UG2A 3PO2J 4FE7A 1LE8A 1BIAA 3L2RA 1Z6TA 3HJEA 4IO9F 1H0MA 1PVEA 5LBQA 1MJBA 4P1WA 2ZXJA 4U0VA 1SFUA 1ACIA 1G4DA 2XAJA 1I39A 2L5QA 3K4CA 3G4SI 3PFIA 2EFWA 2H1KA 4MLOA 3HSEA 1ZHFA 2X6OA 2N8GA 3LQQA 4Q4ZF 4J01A 3RZOJ 3I3LA 3QWLA 2QENA 4A3LJ 1LVAA 3H35A 1E3PA 2YUSA 3ECHA 1ETQA 2DOFA 3I53A 4CA0A 1LDDA 3L2WA 4RM3A 3VFZA 2DFEA 3S1QJ 3OYMA 2WAQN 2EFOA 4RGRA 3LSRA 1YJ9I 1OISA 3DPTA 3OMYA 2YU3A 3W2WA 3VYUB 4PUSA 4LFUA 4RAZA 5D5UB 3GTGJ 1BJZA 3VYRB 2JT1A 1R71A 2P8TA 1QVUA 2DK5A 2IEKA 2CFXA 3WHCA 1TWAJ 3RKQA 2V6EA 2NS0A 3GZNB 1MMNA 2DN0A 2I5UA 3M07A 4EEFG 3HOVJ 1VI0A 3SZPA 3V42A 3I56I 1ZH5A 3BJAA 5LRSA 4IKFA 3CUQC 1I3QJ 2JUCA 3DBRB 4P5OA 2EWNA 3K7AJ 2MYSA 1TQMA 2Z1DA 2LP0A 3TDUC 3MD2A 4B1RA 4PCQA 3CMEI 2BHYA 1D0YA 4XSXF 3V8KA 2K02A 1IG7A 1VF9A 1OR7A 2NAZA 2H1LA 4HSTA 4D1QA 2E1MC 2JMWA 3K4MA 5EEGA 1A6QA 1TQPA 3LSGA 2G7UA 3T8TA 2Y0MA 2E1OA 2DA5A 2TRTA 2HQAA 3TO9A 1ETOA 4ETSA 1BOBA 1EH8A 2NS8A 4IVNA 3X2QH 4ZZLA 5DUIA 5ILVA 1A6IA 3JRHA 2R4GA 2K9QA 3LSIA 2D5VA 2EIMH 3SYTA 4EQQA 3WTWC 2TDXA 2P7VB 5KAFC 4RGXA 4HQEA 3MZYA 3CMMA 1FSEA 5EYRA 3ZMTA 4BHPA 5FGMA 3A1YA 3FBNB 4KUMA 1V5EA 4G7ZF 3H92A 3WG7H 3OV8A 3IH3A 1ZAOA 2HQ5A 4RAYA 4A3GJ 4YELA 3WE2A 5DD4A 2EPFA 3TO7A 3UR3C 2QM3A 4B47A 4LG0B 3ONQA 4AIHA 4Y17A 3ZP5A 3S3MA 2EZLA 2XGDA 1LJ9A 4KNYA 1IRZA 1YYVA 4BY1J 3H9QA 1D5YA 5M3MJ 3L00A 3EYIA 4PJNA 1F9NA 2CSOA 2PJPA 5JVTA 3VYSB 4A2UA 3MZHA 1TL8A 2HTSA 5EG0A 5GAGJ 4U7BA 2IA0A 3DTIA 1G2HA 1A35A 2IA2A 5TISC 3HOWJ 4DJAA 4HX4A 5EJCA 4A3JJ 2ETHA 5KK1A 4MFEA 4NNJA 3CESA 1ETXA 4IXAA 2W82A 5JR3A 3F22A 4P96A 1OCCH 4AC0A 1TTYA 4LMYA 2L3DA 4AUXA 3HOXJ 2VIXA 3DEWA 3E7LA 4MFDA 1WFXA 3BDDA 3S14J 4BH9A 3LOCA 3CDHA 2GBYA 5M5YJ 2CGPA 4A3CJ 2PQ8A 3EDPA 4ZTFA 3VDXA 3J80K 2R7OA 3V7SA 2YX4A 2DJIA 3DFGA 4CH7A 1T33A 2XAGA 3WHBA 1K4SA 1LE8B 3CCQI 2VE9A 2V7FA 3FHNA 2AXLA 3LSHA 1XS9A 1UELB 4MHGA 2OBPA 4ZC3A 1NK2P 3ISPA 4IL6C 1HW2A 1U9OA 2UWMA 2XGEA 2OTLI 2GZWA 2LDUA 2WWYA 4AU7A 2DPUA 1YRNA 1JUPA 3GMEA 4JX6A 5DS9A 2UXXA 1FNNA 3QRFF 3MFKA 4DBQA 2HVRA 1KU7A 2AQEA 3LAPA 2EZIA 1X3ZB 1FYKA 3OIOA 4DYCA 1K78B 1EKEA 1ODDA 2R5YB 2EZHA 2A6EF 2FBHA 3G1MA 1RR7A 3KEQA 4XRSG 1Z7UA 4EM2A 3CJTB 4WXHA 2O8KA 2JA7J 1FJLA 3FXQA 2D1HA 2HXIA 4I0BA 2E7WA 1V54H 2HVQA 3FWEA 4KA4A 4M3EA 3SXYA 3FDYA 4QTRA 3COAC 5FLXZ 3FK7A 2MBFA 1DUXC 2DK8A 1ZRDA 5FROA 3J80Z 3DKYA 2BYVE 1JKRC 1TP4A 4XOTA 4IOAF 3UNGC 3GFLA 4QWQA 1T08B 5IOYA 3FMRA 2Y9YA 4HF0A 1Y39A 1O3SA 1WSUA 2CUJA 2VQLA 3CCJI 3GLLA 1RR8C 5HNFA 4DW6A 2M34A 5HDKA 5LFAA 2UV1A 3T0YA 1A31A 1WI9A 1JGSA 2XSDC 3GYHX 3OIPA 3DTEA 4UNOA 3RCOA 1WQ2A 2DQLA 1STZA 2M5WA 1D8KA 2O03A 1ZQ3P 1ZR4A 3OR2C 3S3OA 1VQKI 2L9NA 1GUUA 4Y7NJ 5KVRA 3PFYA 3QYBA 2BGCA 2BY2A 1R36A 1B4AA 3S93A 2X6XA 3H9JA 1X4PA 5C3EJ 3WTZA 2COMA 3O2PE 5BPIA 1WJDA 2DO7A 5D6FA 2JVHA 3KYCB 4BXUA 2JA6J 3JR9A 1JTYA 4F93B 2CQKA 3GTKJ 1MH4A 4J19A 2DMQA 2LK2A 1D3YA 5J4VA 3HOTA 3ROUA 1P4AA 3N4MA 1T98A 3BJOA 2ZCWA 2R7DA 2DDBA 4TV7A 2X6WA 4NDLA 5F27A 5F0CA 1E2XA 3BG5A 3KYDB 4RB0A 4CGZA 1IDZA 2G0EA 3KP6A 1KYWA 2VT3A 3KZIC 1S9HA 3BTIA 2BXZA 1DGRM 5HNHA 4ZYGA 1G3YA 1GV5A 1MKMA 1W5SA 1YS7A 2BY0A 3FXUA 4NB5A 4BE2A 5FKKA 4E6KG 2B7EA 5FLMJ 1DGWY 3V8LA 2M8EA 3MKYB 4G7HF 2G7HA 4Y52J 4I76A 3CTAA 2LSOA 3LL7A 4XKBA 3OYAA 4IHXA 4A3DJ 4NUBA 2YR2A 2WBMA 3SZTA 4CHUA 2ELHA 2ZJPF 4D9JA 4G94A 3H3UA 2X0LA 5CVJA 2E1MB 2HWVA 3AG3H 1XB4A 1R00A 2ZMEC 3ZXSA 1PUFB 5B66C 3W3CA 4MQVA 2LKXA 4MQ9F 4UVAA 2K4BA 3KPHA 3L2UA 1VQLI 2H8RA 1RKTA 3U2RA 1ETYA 2JA8J 3LSJA 3BJ6A 2HS5A 3CUQA 2XF5A 3AKZA 4OINF 2QSGX 2QEXI 1QZZA 2IRFG 2EV5A 2OPTA 2A61A 4C3HJ 1LQ1A 2KRFA 3CP8A 1DU6A 5GAEJ 4PDKA 2CMPA 4CCKA 1Z21A 2CO5A 3MN2A 1WI3A 3WTYC 4F55A 2HPMA 2ZSIB 1G59A 1OCZH 3HZJA 2GA2A 2Z33A 4HAMA 2JN6A 5IP9J 3NARA 4RGSA 2VPRA 5C44J 4PZJA 4M9XA 5J47A 4ZTJA 2X1CA 3Q3SA 1TBXA 2YS9A 4KT5C 1HKTA 3BQYA 1Y8QB 2FNAA 3BY6A 2DBBA 3VPRA 4M3GA 2P5LC 2Y9ZA 4U87A 4KIGA 1YW8A 3BTCA 2VOPA 1O3QA 2F4IA 1XN7A 4L0ZB 3K4LA 2L54A 1FOXA 3P5JA 3E6BA 3BG6A 1IXRC 2ME6A 3J7AO 2ZJRF 2PEXA 4C2MJ 2F5CA 1IO2A 2BXYA 1FMVA 1S3JA 4F7ZA 2P0WA 3ZR8X 4N4OB 3NWTA 5D8LB 2IAIA 3BZKA 3JRBA 4BQAA 5DYMA 1VFCA 5D8KB 1XDSA 1YJNI 2V1NA 4HG2A 1WRJA 3GVAA 4LGWA 4BACA 4A0ZA 1ZRCA 1FEXA 5H2FC 2DODA 3E6CC 2O9LA 3C2BA 3A4CA 2XF6A 2DMPA 4HW0A 5DV5A 4UUSB 4RLQA 4YFKF 3DTKA 3S32A 1XDUA 3DPLC 4XLNF 1VQ6I 2DT7B 1QBJA 3CJNA 3HSRA 5F6FA 1U6GA 2MH9A 3F8CA 3W2VA 1BA5A 3DPUA 4CYDA 4A3FJ 3K69A 3HIFA 3VYTB 1XGSA 4C3JJ 1VQOI 3G1LA 2OU2A 3OYIA 2V9VA 1O7FA 3HDDA 2YSRA 1F4KA 4C2TA 4C30A 3F21A 1JKOC 1IRGA 5DCFA 2MA3A 1TQIA 2QQ8A 3BLYA 4EM0B 1P4XA 1D0XA 2ESHA 2JK3A 5H6RA 4XR6A 3JW4A 3LQRA 2PMHA 2K7LA 2L7KA 3F0CA 5HVQC 1X1BA 3CCVI 4X0GA 3TGNA 2WV0A 3E0JB 4EVIA 2M87A 3MKWB 1NG7A 4E7IA 3TP3A 2OF7A 3GZ5A 1T56A 3J81K 3QPLA 2HNHA 1QA6A 2KZVA 2RV8A 4Q47A 2GIVA 5E1WA 3RPQA 4HLXA 1X1CA 1MBKA 5BQTA 2A5WA 3IC7A 1X2NA 4KISA 4BKXA 1D0ZA 4XRMA 1FBSA 3VWBA 1QQIA 1TWFJ 3CD6I 1JKQC 2DA7A 1YIJI 2PMZN 3GX4X 2KRCA 3L7WA 3ML6A 1TW2A 1XX5A 4PGHA 2R7XA 2R92J 5ICEA 4PFPA 3M3YJ 1UHSA 3CDLA 1FBUA 3EUHA 1QHGA 1YS6A 4DGWB 4UUVA 3E5UA 1V5GA 3BZ6A 4QSHA 5K5OA 1G3WA 1E17A 1NH3A 2XB0X 1KQ0A 4FE4A 3TEDA 1YE9A 1ZLKA 3H5RA 5EZHA 3CF5F 1E3OC 1F5TA 1W5CC 2NNNA 1WVRA 3FXRA 2QBYA 2V9PA 1YX3A 2DT6A 4WX9A 4FASD 2K3PA 1QHHD 4D0PA 1HKSA 2EK5A 2QVOA 3B6AA 3PSIA 2NVUB 3BR0A 1G3SA 1ULYA 4RMNA 1T0FA 2CU7A 3RDIA 2E60A 3GTLJ 1HDPA 2VUMJ 2P81A 5KNLA 3RKXA 5KCMA 1FTZA 2A3SA 2COBA 5J4YA 4K2EA 3IP4B 2L7ZA 1FSHA 2AS5F 4M6YA 3H9GA 3ZGKA 3VSKA 2QYOA 5JVGF 3QOPA 5LRRA 3OYBA 1T0FC 3EUAA 4DNCA 2QQ9A 1F1ZA 2HZDA 4LK1F 3QYFA 4ESBA 3D1NI 4L5EA 2KDZA 1DP7P 3JCUC 4B8XA 1NTCA 3KE2A 3HRUA 5IOZA 5AONA 2F48A 2OZUA 5HLHA 2HYGD 2MW8A 3S2DJ 1IRXA 3R4KA 1EF4A 1HCRA 1CF7A 1PDNC 2VONA 1H89C 2QLZA 3CC4I 4IX7A 3LA2A 2BY3A 2V1UA 1A36A 1FWZA 2M4KA 4ZDOA 1QU3A 3REOA 3Q0VA 1T8IA 1Y56A 4D7MA 3WU1B 3T1BA 3IH4A 1V5FA 4HZFA 4RA2A 3FM5A 1VQMI 1D1AA 1FZPB 2W7NA 1X1PA 4G6TB 3H1CA 3E5XA 2LF7A 2XB5A 1KONA 5JHUA 4I7HA 4F3QA 1ZK8A 2HOEA 2XDVA 4PGGA 1SFXA 2QKMB 1PYVA 1APLC 2ADUA 4XONA 3PUFA 4XORA 1IC8A 2EFNA 2Z2SB 4FTHA 1KQ9A 5JHFA 2D2WA 3PQKA 4DQ2A 3ZQIA 5D5VB 3GF2A 5CPRB 2VKDA 5E8GA 2R93J 3SDGA 3KZYA 5DM6F 4IPAA 5FKMA 1O57A 2PN6A 3RYRA 1D1CA 5ICCA 3F8NA 1UCRA 1WJCA 3L1PA 2KZGA 1RRJA 4NQWB 2Y48A 4BEHB 4WK8F 2XAHA 5D5WB 1WJAA 4GYGA 3WODF 4G6QA 4PSXA 2ICWG 1QZEA 1GXPA 1R5HA 4WXCA 3K4NA 3M4OJ 2XRNA 4M71A 2PG4A 4UV9A 1Z1DA 2DFFA 3TW7A 2VC0A 2P7CB 1UAAA 2M4GA 1JT6A 2VKEA 2W4SA 4B3XA 2LY2A 4DYRA 5HDNA 1EV7A 2FOKA 4MEXF 2CH0A 3OR1C 4LITA 2DOEA 4G9YA 1TLHB 3OYDA 3JRCA 3CC7I 1K6YA 2FXAA 3WGGA 4AIDA 4HDVA 3GEZA 3CDIA 5D6EA 4XLCA 3CQZJ 2VODA 1PP8F 2NOJB 4CZZA 3MMYB 3HTSB 2FJ1A 4N9IA 3H0DA 1G8XA 3OSFA 1LKXA 1V55H 5IY5H 5F08A 1NHAA 2VT2A 5JLWA 5FRNA 2ZJ2A 2LFBA 5HLTA 1N77A 4OU0A 1PUEE 1MH3A 2DTZA 3C3WA 4ZDLA 2MG4A 4J00A 1GLNA 1YLFA 3TO6A 4JOMA 2HEOA 1X4OA 1USTA 3F8FA 4ZH4F 1RUNA 4ANJA 4Z2YA 3IAM2 4DOZA 3DQVC 4BHBA 2A6TA 4AIKA 2HKXA 4A69C 3G71I 2IS4A 1DP3A 3O8HA 4CICA 2JQ7A 3W2AA 3RSNA 2IBDA 4OMYA 4LLGF 3OYLA 4AD9A 4II3A 1ZKGA 4CZCA 4I99C 3IH2A
chains in the Genus database with same CATH topology
5B1BH 1V55H 5IY5H 3X2QH 5B1AH 2EIKH 1OCRH 2EINH 2EILH 2ZXWH 3ABKH 2EIMH 3ABMH 3AG3H 5B3SH 1OCCH 1V54H 3AG4H 3AG1H 3AG2H 2DYRH 2DYSH 2OCCH 1OCOH 1OCZH 2EIJH 2Y69H 3ASOH 3WG7H 3ABLH 3ASNH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1B H;  1V55 H;  5IY5 H;  3X2Q H;  5B1A H;  2EIK H;  1OCR H;  2EIN H;  2EIL H;  2ZXW H;  3ABK H;  2EIM H;  3ABM H;  3AG3 H;  5B3S H;  1OCC H;  1V54 H;  3AG4 H;  3AG1 H;  3AG2 H;  2DYR H;  2DYS H;  2OCC H;  1OCO H;  1OCZ H;  2EIJ H;  2Y69 H;  3ASO H;  3WG7 H;  3ABL H;  3ASN H; 
#chains in the Genus database with same CATH topology
 2X85 A;  2OC6 A;  4ENJ A;  2HYJ A;  1X3U A;  2V1D A;  4L9N A;  2VJ5 A;  1I27 A;  5L3F A;  3A0H C;  1BI1 A;  1I5Z A;  2MLK A;  4CCL A;  1Z9C A;  1U2W A;  2ZXW H;  1FPQ A;  2CQ7 A;  4KMF A;  2E1C A;  1R5I D;  1SD7 A;  1U5T A;  1XMA A;  2EB7 A;  2GLO A;  5J1R A;  3FMS A;  1TC3 C;  4BQQ A;  1V4R A;  3IV5 A;  2I8D A;  4G8X A;  4M72 A;  1LFU P;  4CO8 A;  1JGG A;  4E4H A;  3HPG A;  1YTY A;  2QF7 A;  1SAN A;  3EUK L;  3IRR A;  2P6T A;  5E3M A;  2UXN A;  5F64 A;  2XKP A;  4CYC B;  1AU7 A;  1REP C;  3IUO A;  4M6V A;  3J7A Y;  2XGC A;  2QSF X;  4E7K A;  2ZKZ A;  1WCM J;  5LHI A;  1RUO A;  2HOA A;  2UUZ A;  5FLV A;  2IVM A;  1O3R A;  2V26 A;  1B72 B;  3F8M A;  1JHF A;  3QAH A;  3R0A A;  1ZYR F;  2NS7 A;  3CZ6 A;  2LKS A;  1AOY A;  5IT9 Z;  1MGT A;  3GCM A;  5FD6 A;  4JBA A;  3HKZ N;  3MVP A;  4HQM A;  2Y31 A;  3QQA A;  5D5X B;  2B63 J;  2FUG 2;  4PSW A;  1FY7 A;  3BT9 A;  3MKL A;  2FF4 A;  3R0J A;  3WTU C;  2X9D A;  5EDN A;  4BXX J;  2VJ4 A;  1OYY A;  4X1E A;  1BI3 A;  3NAU A;  4I2O A;  4PJJ A;  1LPQ A;  4D5C A;  2DA2 A;  3RKY A;  1ZG5 A;  1RNL A;  2FQ3 A;  1AKH B;  5A2Q K;  3IWZ A;  1IN6 A;  2GQQ A;  5CQE A;  3EQL F;  4LB5 A;  4O3M A;  4GDF A;  5LHG A;  4MTE A;  2B9S A;  2WY8 Q;  2MD0 A;  2Z16 A;  2J5O A;  1WJE A;  4JX5 A;  1YI2 I;  2K85 A;  2DA4 A;  4XLE A;  5FKL A;  5B5E C;  3HOZ J;  4E7H A;  1IXC A;  3C7J A;  1D8J A;  3GXO A;  1AKH A;  3G2B A;  3Q9S A;  3RQ4 A;  1E0E A;  2BV6 A;  2KJB A;  9ANT A;  3PUB A;  2VXZ A;  4AYB A;  4L9J A;  3JAM Z;  4L9T A;  1FP2 A;  2MFZ A;  4HA8 A;  2IS2 A;  4KDP A;  2ZC2 A;  4A3K J;  3HGY A;  2RRE A;  2QUF A;  1B59 A;  1I50 J;  3SFI A;  4XM3 A;  1JJ8 C;  5FKO A;  2V9K A;  3FK6 A;  3FXO A;  2KPM A;  3J7Y J;  5IP7 J;  3OYN A;  4L0Y B;  3W6J B;  3E1S A;  3MKZ A;  2XRL A;  1UHM A;  2KKO A;  2ZSH B;  1OCO H;  5L3G A;  5HOO A;  2QBY B;  2X4H A;  3VB2 A;  1M1E B;  1R4N B;  3KLN A;  1U78 A;  3FIW A;  4D5F A;  3GLX A;  3E97 A;  4HF2 A;  2WAQ A;  1KA8 A;  1IDY A;  4IOC F;  2V4J C;  3HB9 A;  3OIQ A;  4XL9 A;  4PFO A;  3A0B C;  1LUJ B;  5DCM B;  1YO5 C;  4MO7 A;  4DZJ A;  3GUD A;  1BM9 A;  1MSE C;  3FM3 A;  4I0A A;  1OLT A;  3I4N J;  2W57 A;  4B44 A;  1TT0 A;  4UUS A;  5JI6 A;  1EA3 A;  4QPO A;  3BG7 A;  3ERM A;  3A2K A;  2XV4 S;  3GTP J;  4KMU X;  5GP9 A;  2PLY A;  3K10 A;  2J5P A;  1SD6 A;  2NXN B;  3A01 A;  2KRH A;  2STT A;  2A07 F;  2R7Z J;  4HSR A;  4IEJ A;  3ZN1 A;  3H3V K;  3S1M J;  3HRS A;  2XPU A;  2ISY A;  1B8I B;  2LY1 A;  2BBY A;  2CW7 A;  4MGR A;  3LFU A;  2Q2E B;  4P9U A;  3I0T A;  2JRM A;  3ZQH A;  2GA1 A;  3TMO A;  1Z05 A;  5J6X A;  1E3H A;  1HF0 A;  4Y3O A;  2FEZ A;  4ZYD A;  2O6G E;  3FHZ A;  2OJE D;  1TNS A;  1ETW A;  2K4J A;  3M1C A;  2Z9O A;  3FMQ A;  1O4X A;  3H0G J;  3W6V A;  3CCR I;  5CVR A;  2NVT J;  1OPC A;  1BI0 A;  2BY1 A;  1UB9 A;  3HRT A;  4RAG A;  4L18 B;  3E6D A;  1S6L A;  1YRN B;  2VXD A;  3AL0 B;  3I54 A;  1XCV A;  2QA4 I;  1XGN A;  4DBR A;  1RES A;  4GGG A;  4E70 A;  4CYC A;  3ELK A;  4RB1 A;  2JZY A;  3CMY A;  2UZK A;  4BDZ A;  2DYS H;  1SAX A;  2PBI A;  5E1X A;  4U88 A;  5GTI C;  3OYG A;  1XTA A;  1LB2 A;  4HPQ A;  4FHT A;  3CUQ B;  3DXJ F;  2ACJ A;  3I4P A;  2P5V A;  4BU2 A;  4KT6 A;  4HX8 A;  3HEF A;  3BR6 A;  3RQI A;  2HPI A;  2GXA A;  2IGN A;  1UFM A;  1ZAR A;  2EFQ A;  4C2U A;  5K1Y A;  5E20 A;  2HR3 A;  3GWZ A;  1K61 A;  1S7E A;  2IPQ X;  2K27 A;  2H8W A;  2ZB9 A;  1OYI A;  2A68 F;  4PJL A;  2BE5 F;  4IHV A;  1Y6I A;  1U3E M;  3UKG A;  3ABU A;  1MMA A;  3Q9V A;  1MZB A;  5H20 A;  5FLX K;  4ENN A;  1I1S A;  1SD4 A;  1Z77 A;  3G73 A;  1JTX A;  1EH6 A;  2E34 A;  3OS1 A;  2JA2 A;  1J75 A;  3QU6 A;  2L01 A;  2K9N A;  2ZME B;  3A02 A;  2DPD A;  2K9L A;  3U1D A;  4BHC A;  4NHJ A;  5K7H A;  1IZ1 A;  4IQJ A;  5K7F A;  2HZT A;  3OOU A;  2DCE A;  5HLG A;  5M3F J;  1QO0 D;  1RIO H;  3N97 A;  1MD0 A;  2H6C A;  2L02 A;  4A93 J;  5E8I A;  4BQO A;  1KZH A;  2D1V A;  3HSF A;  4GCV A;  2DDA A;  2OZ6 A;  3HKZ A;  4HF1 A;  3SDB A;  5CYV A;  4KFC A;  4A5N A;  1MDM B;  2AXT C;  2Y0S N;  4JK1 X;  1XGM A;  3NQO A;  1AWC A;  1RI7 A;  2KIQ A;  3J81 Z;  2MSY A;  4PJM A;  5LD2 C;  2WAE A;  1R23 A;  1NK3 P;  2JPC A;  1MBE A;  1POG A;  2A69 F;  2Y75 A;  4ESJ A;  2JPB A;  1XMX A;  3OL4 A;  2WAD A;  1O3T A;  2IXS A;  3LSM A;  5CJ9 A;  2OA4 A;  2DFH A;  5E3O A;  4M73 A;  2VQG A;  2WTE A;  3CF2 A;  1RPW A;  2CQQ A;  2KIF A;  1BIB A;  2NNY A;  2DT5 A;  1I6H J;  5EGO B;  4WF2 A;  2BVM A;  2OAZ A;  1GXQ A;  4M3B A;  4IQ4 A;  4LIV A;  2OUM A;  2CQX A;  3E3V A;  1MBH A;  1U8R A;  1FYM A;  1WHU A;  5A2Q Z;  2WV1 A;  3TKY A;  1VQ9 I;  3S17 J;  3DP7 A;  2FRH A;  3FKJ A;  3SEQ A;  2EQR A;  1XGO A;  4UUT A;  2R7R A;  2R0Q C;  1OQY A;  3H5N A;  1S7A A;  3V7R A;  3GFJ A;  1OFC X;  4Y33 A;  3R61 A;  2CUE A;  2M45 A;  1W4M A;  3TW6 A;  2GOM A;  2XAU A;  1OR7 C;  3K0L A;  5EEH A;  2CUF A;  5GTH C;  2BZT A;  1OCP A;  2GWR A;  2E71 A;  1MJ9 A;  4BBS J;  2RDP A;  1XG1 A;  2CFO A;  3I59 A;  2PI0 A;  3KYL A;  2XKO A;  2RN7 A;  4XN3 A;  2RAE A;  2HGC A;  4YFX F;  2Y30 A;  2K5C A;  2OCE A;  1IGN A;  4C3I J;  2X51 A;  2P6S A;  1OCR H;  2EIL H;  5IYB J;  2MC3 A;  4JQF A;  3ABK H;  4HNU A;  4Y15 A;  2CQN A;  4I98 B;  5BMZ A;  2W85 A;  1IW7 F;  1GVD A;  2HQN A;  2H27 A;  2WB1 A;  3BR2 A;  3BC8 A;  5FFZ A;  1UJ8 A;  2O8X A;  4ASN A;  4BL0 B;  1X58 A;  2RVC A;  1VQ5 I;  1USS A;  5F1J A;  3KP3 A;  3I71 A;  2VBY A;  5CVI A;  3MAJ A;  3K4B A;  5M5W J;  3J7Z I;  1CGP A;  1GDT A;  4I01 A;  4BQN A;  2WB1 N;  3CCE I;  2BOL A;  1VQ7 I;  1FX7 A;  1HBX G;  5TGT A;  2LNB A;  2L7M P;  3C1D A;  3Q5F A;  5AIQ A;  4FET A;  2QZ8 A;  4HNV A;  2R5Z A;  2DA6 A;  1BC7 C;  1F43 A;  3L9F A;  3ABT A;  5GAD J;  2X48 A;  1S8N A;  4BJT A;  2A5Y B;  4B3A A;  4A3E J;  3WGI A;  4C9Y A;  3L2V A;  2LYC A;  2IA1 A;  1FIP A;  3KP7 A;  5ILS A;  3O3K A;  2JVG A;  2DA3 A;  2RQP A;  2ECB A;  1UMQ A;  3QU3 A;  1LVK A;  1QZY A;  4LK0 F;  2LF8 A;  3GTO J;  1ZRF A;  1GHC A;  1SMT A;  2XPW A;  3S2W A;  3N05 A;  2XSJ C;  1H88 C;  1HW5 A;  1RET A;  2EV0 A;  3M8E A;  3PNT A;  4OIR F;  1SMY F;  2BW3 B;  3BP8 A;  5DDG A;  1ZN2 A;  5GPA A;  1TWG J;  1PJR A;  2PJR A;  4NC6 A;  5TJJ A;  1XMK A;  3JTH A;  4ZYH A;  4BY7 J;  3ABL H;  2HU9 A;  3K70 D;  1XSD A;  1K6O A;  1IN5 A;  1JT0 A;  1J0R A;  4XLH A;  2H09 A;  5D4S A;  3QP6 A;  4I6Z A;  2F2E A;  4CCM A;  4CXF A;  4L5J A;  2JRT A;  1BJA A;  3JRA A;  4Y4R A;  2V79 A;  3VSL A;  3ZMV A;  2Z5U A;  5ILU A;  1MBJ A;  2H6B A;  2OTJ I;  5CVV A;  3V8J A;  3QYE A;  4B09 A;  2LR8 A;  4M6X A;  4CCN A;  3FX3 A;  2LBF A;  2IW5 A;  2DJN A;  3BCA A;  4MNU A;  3ZRG A;  4UY8 I;  2HI3 A;  2V6C A;  3D0S A;  3KEO A;  3GO5 A;  4LG0 A;  4GXO A;  2LY9 A;  4ZYE A;  3P9C A;  3K1P A;  4IHT A;  4OIQ F;  2QGU A;  3IKV A;  5ICF A;  2HYF A;  1JUS A;  3G1O A;  1HQC A;  1KYZ A;  2KL4 A;  5LGU A;  4U0Y A;  2JUG A;  4S04 A;  3M8F A;  4RM2 A;  3RZD J;  4CCJ A;  3GTJ J;  4KIF A;  2CW8 A;  1MMS A;  1Q1V A;  2XUB A;  3EYY A;  2EV6 A;  1PP7 U;  3HRM A;  4WWC A;  4XRF A;  4YII A;  3G3Z A;  2HOT A;  1WZ2 A;  2JTV A;  1Y0U A;  1R58 A;  3AG1 H;  3K2Z A;  1K78 A;  2Y0S A;  3IRQ A;  3RI4 A;  5FFX A;  1LDJ A;  4S05 A;  2R5Z B;  2HTJ A;  1YHQ I;  1QVT A;  4P55 A;  2F5F A;  3GTQ J;  1IXS B;  3BR3 A;  5D4R A;  3OYC A;  2VPL A;  4BDY A;  5C4X J;  2G9W A;  3P7N A;  3WE3 A;  1IF1 A;  3ZCO A;  2O3F A;  3AAF A;  4GRI A;  4XKW A;  2TCT A;  2O0Y A;  2PX9 A;  3D5R C;  1AHD P;  2X1E A;  2VBZ A;  2O61 A;  1KU2 A;  3S8P A;  3K4J A;  4XRS A;  3T8R A;  3ZQ7 A;  1TT5 B;  4ZZD A;  3JRF A;  2HVS A;  2JSP A;  2L4M A;  4EJW A;  4KIT B;  1YIO A;  1WJF A;  2FU4 A;  4MEY F;  1EH7 A;  1X2M A;  4V2G A;  1EJ9 A;  1ZEL A;  3ZMZ A;  4IRH A;  1R7J A;  3K2A A;  2CYY A;  4QPQ A;  4LLN A;  1TW3 A;  2ZFW A;  2DMU A;  4H0E A;  2MC4 A;  2Q0O A;  3I9V 2;  3GFM A;  3KFW X;  3RKW A;  2IP2 A;  3BR5 A;  3HHH A;  3KIO A;  5KAI C;  3ZPL A;  4LG3 A;  1I6X A;  2M7A A;  3HTU A;  2R3S A;  3JSO A;  4UB8 C;  2R5Y A;  2QQB A;  3FF5 A;  3TOA A;  3HUG A;  2ZME A;  4R1H A;  1FOY A;  2YU9 J;  2DLL A;  2DA1 A;  3BOQ A;  3OS2 A;  3GZ6 A;  1K83 J;  1Z3Y A;  2PFB A;  3F3X A;  5LEJ A;  3LSP A;  1HOM A;  3H36 A;  4I02 A;  4IRG A;  3ZQL A;  2WAF A;  3SEZ A;  2GM4 A;  1ENH A;  4BEH A;  5DCM A;  1YW9 A;  2W24 A;  3SJM A;  5IT9 K;  1J9I A;  5EG0 B;  2HQR A;  2EH3 A;  3K4K A;  2X6Y A;  5IYC J;  1HSJ A;  1XPX A;  3M7G A;  2CV1 A;  3V4G A;  1LDK B;  2FE3 A;  2C6Y A;  4KIC A;  4RB3 C;  1U0J A;  1JI8 A;  4E7L A;  3L09 A;  1K7A A;  3SQN A;  3LNQ A;  4L9V A;  1MSF C;  4Q48 A;  4XSZ F;  3CO6 C;  1ETV A;  2Q1Z B;  1ON2 A;  4UHT A;  4BS9 A;  1SVL A;  1OYW A;  2KLO A;  1UZC A;  3PL8 A;  3WTV C;  2VJJ A;  3GTM J;  3PQJ A;  1SEU A;  3E5Q A;  1ZRE A;  3PJR A;  5L3D A;  5F1R A;  2HDD A;  3JTG A;  1J09 A;  4AIJ A;  3DKW A;  3FBI B;  2ELK A;  2CUZ A;  1YX5 A;  4BBR J;  5IP6 A;  2FMY A;  4NC8 A;  3QOD A;  5HOD A;  4YIR X;  3L2C A;  3U21 A;  4AYB N;  1HC8 A;  4HX7 A;  1ORK A;  1J5Y A;  4U7D A;  3CC2 I;  3KLO A;  5J40 A;  1J59 A;  2FQ4 A;  3MWM A;  2BEO A;  5B1B H;  2LBF B;  1W0U A;  3CJQ B;  1BN5 A;  2KHM A;  2ZXH A;  1LEB A;  1T6S A;  1SVO A;  2JWT A;  2VAS A;  3LA3 A;  5L3C A;  2HOS A;  4XLP F;  4M3F A;  1SVM A;  1R1V A;  2CJJ A;  2M30 A;  4ENK A;  4O5V A;  2LMD A;  1BR2 A;  2MGQ A;  3U9G A;  1BC8 C;  2NYX A;  3K1M A;  1VTN C;  1B72 A;  4CUG A;  4HV5 A;  2JSC A;  4XLA A;  3DU6 A;  2DYR H;  2E2J J;  3HOU J;  3TQN A;  2VQC A;  3PSF A;  3SFZ A;  4XOP A;  5KHD A;  1VQN I;  5HLI A;  3EET A;  1ERD A;  3IL2 A;  2LC2 A;  3TOB A;  2GOX B;  3OWT A;  3BR1 A;  4ENM A;  4LD5 A;  1T38 A;  3OYF A;  4XKC A;  2XHK A;  4NC7 A;  4F52 A;  2E2I J;  3I4M J;  2FA5 A;  3H3Z A;  1Z91 A;  2E35 A;  5HS7 A;  4W97 A;  4OIO F;  2DQR A;  4IJA A;  5DD8 A;  5HDG A;  3CCM I;  1KU3 A;  2XC7 A;  2HXO A;  1WGX A;  5DTD A;  2ZXI A;  2OCC H;  3IAS 2;  3BRO A;  1X19 A;  2PJR B;  1U9N A;  1I3A A;  1JKP C;  4LB6 B;  2E1N A;  2LRE A;  3HC7 A;  3ESW B;  1FOK A;  4XIC A;  3DEE A;  4QLC U;  4IZZ A;  1XC5 A;  2VKV A;  1JUM A;  4KIB A;  3GBG A;  4PJ0 C;  1YIT I;  1RKW A;  2AO9 A;  4EMS A;  3OYH A;  4M74 A;  4E7Z A;  1YQA A;  2ZO4 A;  3JSP A;  4OWR B;  4B4C A;  4BUP A;  2XRO A;  4BGD A;  5CKT A;  2L9V A;  3C18 A;  1N75 A;  4ZYA A;  5FJ8 J;  3DBH B;  4HLY A;  5EGO A;  3NEU A;  3AG2 H;  3OSG A;  2LTP A;  5K5R A;  3EUH C;  1Y8R B;  2WC2 A;  3QPS A;  4EJU A;  2M0M A;  1I1G A;  4A5M A;  1ZGW A;  2ZJQ F;  2GIZ A;  4HEA 2;  1SAU A;  5LGN A;  5FD5 A;  2R7T A;  3NRV A;  3P9I A;  3TL4 X;  1OKR A;  2L7F P;  3C2G A;  3TDZ C;  3S1R J;  4BNC A;  5B1A H;  3RJP A;  3LST A;  3RPU D;  3KX2 A;  3S3N A;  1SFK A;  2FD5 A;  4GYI A;  3JAM K;  3HG9 A;  2B0L A;  5B3S H;  1WH7 A;  1SC7 A;  1XCB A;  2IGK A;  1Y0N A;  3AG4 H;  1MW7 A;  2FNP A;  1Y1W J;  5DEQ A;  2Z99 A;  2DAO A;  3CCU I;  3I59 B;  1O7L A;  3M8J A;  2L2O A;  2VKH A;  3KET A;  2KQR A;  4IHW A;  2GXB A;  2R7V A;  5JLX A;  2M8G X;  1YW7 A;  4AVZ A;  3F72 A;  3FXL A;  2OQG A;  1V3F A;  5EZG A;  4G6D A;  4B48 A;  2NVY J;  4NQW A;  3S15 J;  3AFH A;  1ZG3 A;  3WU0 A;  1B6A A;  2VQH A;  1MNM C;  4HNT A;  2DXI A;  4R8H A;  3LMM A;  1UG0 A;  1Z0X A;  4CDG A;  1ETK A;  1H9G A;  5E3N A;  1VZ0 A;  2YPR A;  2BW3 A;  2W1O A;  3U1K A;  3F6O A;  3ZQF A;  2F4M B;  2GAU A;  1R1T A;  3IHU A;  3TBI A;  2WY7 Q;  2LRD A;  5L3B A;  5FB2 A;  2M7B A;  1YJW I;  1ZGJ A;  3OY9 A;  1FBQ A;  2F5V A;  4YRV A;  2BHZ A;  3OL3 A;  1U5T B;  1XSX A;  1AA7 A;  5BNG A;  1YOV B;  2EJR A;  4FT8 A;  1L0O C;  2Y69 H;  1VQP I;  3R60 A;  1GVJ A;  2OV7 A;  1BI2 A;  3IKT A;  4FX4 A;  5LGT A;  2R7W A;  3JRI A;  3OYE A;  4OAZ A;  1P4W A;  1HXD A;  2OQR A;  3JRG A;  1JHH A;  5ICG A;  4CSW A;  3F6V A;  5K5Q A;  2QKL B;  4KJZ A;  1ZG1 A;  2DOA A;  2JA5 J;  3HOY J;  2I10 A;  2W00 A;  3NWS A;  1RZ4 A;  3BG9 A;  5E3L A;  1T2K A;  3B73 A;  1P2F A;  4A6E A;  4KN4 X;  1DPU A;  2WA0 A;  1MDM A;  4N4N B;  2L9R A;  2R7F A;  1U8B A;  4IHS A;  1GV2 A;  1IAW A;  2DW4 A;  2X1D A;  4F91 B;  4EGY A;  3S16 J;  3B6C A;  4L5I A;  2E36 A;  2AQF A;  1WKM A;  2ESN A;  4A0Y A;  3LAJ A;  2Y2Z A;  1R4M B;  3OOP A;  1NG6 A;  3BG3 A;  5E18 F;  4GFB A;  1DPR A;  3BZC A;  1IUF A;  4QIW N;  3L2Q A;  4AWX B;  2P5K A;  1QGP A;  4D7N A;  1HDD C;  1QPM A;  3ABM H;  1Y1V J;  3Q0W A;  3S1N J;  3RTR A;  5M5X J;  2XVC A;  3ERE D;  4DYQ A;  2RQQ A;  4OIP F;  1ITY A;  3MEX A;  2LOO A;  2CWE A;  2NVX J;  2VOO A;  2JJ7 A;  1TNT A;  1IN7 A;  5CLS A;  5J8F A;  1A5J A;  3HM5 A;  3CMA I;  4UV8 A;  2DFI A;  5FKN A;  4ZDP A;  3W6K B;  4XN0 A;  4S0H B;  3PIP F;  4H4K C;  1OCT C;  3D5L A;  2DMT A;  1R1U A;  3ECO A;  2IGO A;  4F92 B;  4M9S A;  2K9M A;  2QSH X;  1G3T A;  5TRD A;  2MAB A;  3HL2 A;  1JXS A;  3GW2 A;  3R6S A;  5LEK A;  3FXM A;  5GPC A;  4DIQ A;  4OAY A;  4A3M J;  1R49 A;  2ECC A;  3CJR B;  4HV6 A;  5E79 C;  2KFD A;  4EGZ A;  1B8I A;  1ON1 A;  2A05 A;  5EEA A;  2HKO A;  4YG2 F;  2DTR A;  2VL8 A;  3I58 A;  1R9T J;  1OMI A;  1MIJ A;  4ESF A;  4RS8 A;  4YFN F;  4HBL A;  4RDU A;  2FSW A;  3ZN0 A;  3HHG A;  3QPH A;  4II2 A;  1ZLJ A;  4FQG A;  3QPT A;  1P7J A;  4G7O F;  1P7I A;  4E7S A;  1BR4 A;  1MMD A;  1RC9 A;  2V1X A;  3BTJ A;  5JFR A;  4OMZ A;  2PMZ A;  4BAY A;  3FIS A;  4ABZ A;  2FML A;  5DUK A;  5IT3 A;  2NRA C;  5FO5 A;  2LG4 A;  3CLQ A;  4M9Z A;  3PM1 A;  3LWF A;  2STW A;  3PNV A;  1BR1 A;  3K6G A;  5EF6 A;  3WG9 A;  4G12 A;  4O6J A;  5HS8 A;  3ZOB A;  2L9S A;  2XPV A;  1FT9 A;  1IN4 A;  1LFP A;  2L0K A;  5J8C A;  4A3B J;  2Q8K A;  3JRD A;  1X3W B;  4JP0 A;  3ZMU A;  4A3I J;  1FC3 A;  1WJB A;  5HS9 A;  5FRM A;  2FBI A;  2Z3Y A;  1B1B A;  2E7X A;  2XGX A;  3EPZ A;  2KIM A;  3I5U A;  2R7U A;  1R6R A;  1XSV A;  4IF4 A;  2W25 A;  1GT0 C;  4PK4 A;  1S5L C;  1D5V A;  4JX4 A;  1FTT A;  4E7J A;  5IPA A;  2K9S A;  3C2H A;  5ED4 A;  1DU0 A;  2IS6 A;  3MZ8 A;  3OYJ A;  3KCC A;  2RKH A;  4EM1 A;  1B9M A;  1B9N A;  4R79 A;  4LJZ F;  1HW1 A;  3DEU A;  3A01 B;  4W1U A;  5DM7 F;  3I55 I;  1D1B A;  1BW6 A;  4Z6Y A;  2DU9 A;  1F36 A;  2XIG A;  4HDU A;  2R7Q A;  4JYK A;  3Q0U A;  3IWF A;  1KQ8 A;  4UXN A;  3BTL A;  1A04 A;  1FP1 D;  1ZTR A;  4XKV A;  1WJ5 A;  2EZK A;  3G6E I;  4AVP A;  2CG4 A;  2Q2E A;  1P9Q C;  2QQA A;  1VND A;  3QOE A;  4EV0 A;  2VJI A;  1MND A;  1IUY A;  2CS3 A;  2MH2 A;  1ONV A;  3ZQQ A;  2FBK A;  3K1N A;  3FZV A;  3WTX C;  1MBF A;  3HUG B;  3ASO H;  2NVQ J;  5F04 A;  4WCG A;  4RGU A;  3M9A A;  1DDN A;  5IYD J;  3WU2 C;  2EA4 A;  2K3F A;  5E17 F;  2FOW A;  1P6R A;  1XD7 A;  1FOW A;  4GO1 A;  2EIK H;  4EJO A;  1Z67 A;  2F6C A;  2ID3 A;  3WTT C;  3HBL A;  3CO7 C;  4IHY A;  4BJ6 C;  4YIF A;  1W7P A;  2HDC A;  4HOB A;  4XBF A;  3FKI J;  3ZMD A;  4LIU A;  2CV2 A;  1WWX A;  5J3L A;  3PIO F;  4HRI A;  3VOD A;  1TZL A;  1J2X A;  4KN7 X;  4WXD A;  3F9K A;  4BE0 A;  5J1U A;  3ASN H;  2ZNZ A;  1DQU A;  1HST A;  2QCO A;  3O6B B;  1U5T C;  3BPV A;  1LEA A;  3I64 A;  3HGG A;  5LLQ A;  1SD5 A;  3KEY A;  1W5T A;  1QNT A;  3RPU A;  3FXK A;  1BW5 A;  4A12 A;  2RGV A;  4XID A;  4FIS A;  1VQ4 I;  1IRF A;  4EJV A;  2LVS A;  3M1E A;  1KU9 A;  3DWL E;  2M9H A;  3CCY A;  4A0X A;  2KJC A;  1CQT A;  4IRI A;  2IGM A;  1KGS A;  1MMG A;  3KZZ A;  4FX0 A;  2H94 A;  2CW0 F;  2E19 A;  1Z3X A;  2K86 A;  3PO3 J;  4Q5S F;  3ULQ B;  3A03 A;  4RAF A;  4ON0 A;  2DMN A;  4N0B A;  2A6H F;  3O8G A;  4Y13 A;  5CVU A;  4BXF A;  4FCY A;  3AL0 C;  3ZQC A;  3CCL I;  3DLA A;  4XQF A;  3KP2 A;  1R5G A;  2HDW A;  1L3L A;  5E1Z B;  2O7O A;  4MTD A;  1W0T A;  2EIN H;  1Z7L A;  2ELJ A;  2KIS A;  4RBO A;  1W36 D;  3DBL B;  4UB6 C;  2XF7 A;  4U0W A;  3JRE A;  1N25 A;  5AIP A;  5BOX A;  2VB6 A;  3F8B A;  2CV0 A;  3E6M A;  1SFE A;  1T95 A;  4BE1 A;  3B02 A;  3TP0 A;  3BCB A;  2E2H J;  4DZP A;  4N9H A;  1QRY A;  3CLO A;  2MLG A;  2YX7 A;  2MD5 A;  2PMU A;  4UVB A;  3VEP A;  1MNE A;  3CCS I;  2OD5 A;  2RNJ A;  4ZJZ A;  4KYW A;  3LA7 A;  4X6A J;  1TWC J;  2HFH A;  2KDO A;  2K40 A;  3CUO A;  1C0W A;  1CF7 B;  3K70 C;  1MBG A;  1X1D A;  1K4T A;  4EJT A;  3DLL F;  1IN8 A;  3QP5 A;  5F0F A;  2D45 A;  2KT0 A;  2GXG A;  5C4J J;  3RIR A;  2KP6 A;  2ISZ A;  3DV8 A;  2LD5 A;  1HKQ A;  3HYI A;  4EAT A;  2ZNY A;  1N78 A;  2ZFU A;  1JJ6 C;  1HA8 A;  5GAH J;  1W36 C;  1BOA A;  2M1B A;  5H6Q A;  4XK4 A;  4XNF A;  3WTS C;  6PAX A;  1JE8 A;  2M2E A;  3LFK A;  1H9T A;  2ZBK A;  2XAS A;  1S29 A;  1P92 A;  3BQZ A;  2IS1 A;  1YG2 A;  1BL0 A;  2F5E A;  1PUF A;  5CQG A;  1FMW A;  2LLK A;  2KMU A;  4NBQ A;  2IT0 A;  3HXL A;  2ID6 A;  2P4W A;  2EFP A;  3BPX A;  2XAF A;  2W84 A;  3H5A A;  1W1W E;  3MCZ A;  3S2H J;  2E5Z A;  3BWG A;  4AM3 A;  4HYE A;  3D5S C;  3F23 A;  3DU5 A;  3ZQG A;  3V7C A;  3WGH A;  2W48 A;  5BPD A;  4RB2 C;  1QPI A;  2F5D A;  3P9K A;  3ZMS A;  3LSK A;  4LOC A;  4UVC A;  1YFH A;  4V19 K;  2ME0 A;  1G6N A;  1S7O A;  4ITV A;  2VE8 A;  3DCF A;  2BVL A;  4V2F A;  3SHF A;  1W7P D;  1FIA A;  4BJ5 C;  1WH5 A;  1BBY A;  2L4A A;  2VI6 A;  2M0C A;  2RC4 A;  2LH9 A;  1K79 A;  2VN2 A;  2EIJ H;  3KP4 A;  1MJA A;  3RYP A;  1IV6 A;  5ERI A;  1X1A A;  3DF8 A;  4M3D A;  2M3A A;  3SZG A;  5LHH A;  4CCO A;  5K7Z A;  1SFO J;  2VC1 A;  1FYL A;  3HPH A;  4BYY A;  1HLV A;  5J1Y A;  1LNW A;  2EBI A;  2O5R A;  4OOI A;  4XLF A;  1ZR2 A;  4XMY A;  4A6D A;  3CP2 A;  3DKX A;  3OYK A;  1WPK A;  2EA2 A;  1ZGA A;  2KIU A;  3T5X A;  2VBX A;  5L3E A;  1R22 A;  4I09 A;  4P9F A;  2VBW A;  3KP5 A;  3PNY A;  4YEJ A;  4B43 A;  4MIM A;  1LFB A;  2AHQ A;  1Z6R A;  1VQ8 I;  1UHW A;  3OS0 A;  2QWW A;  3MQ0 A;  4RLF A;  3HOS A;  1FLI A;  1OJL A;  2RNG A;  1T39 A;  5BS6 A;  2CRG A;  3GFI A;  2E5N A;  2FX0 A;  2IJL A;  1H8A C;  2VLA A;  4LLL A;  1IJW C;  2R7S A;  3VOE A;  2F4O B;  5F0H A;  1Q1H A;  1J7K A;  2DI3 A;  3FXJ A;  1S72 I;  2XAQ A;  2LKP A;  2NOG A;  1IV8 A;  1W7P B;  1TWH J;  3K9T A;  1UG2 A;  3PO2 J;  4FE7 A;  1LE8 A;  1BIA A;  3L2R A;  1Z6T A;  3HJE A;  4IO9 F;  1H0M A;  1PVE A;  5LBQ A;  1MJB A;  4P1W A;  2ZXJ A;  4U0V A;  1SFU A;  1ACI A;  1G4D A;  2XAJ A;  1I39 A;  2L5Q A;  3K4C A;  3G4S I;  3PFI A;  2EFW A;  2H1K A;  4MLO A;  3HSE A;  1ZHF A;  2X6O A;  2N8G A;  3LQQ A;  4Q4Z F;  4J01 A;  3RZO J;  3I3L A;  3QWL A;  2QEN A;  4A3L J;  1LVA A;  3H35 A;  1E3P A;  2YUS A;  3ECH A;  1ETQ A;  2DOF A;  3I53 A;  4CA0 A;  1LDD A;  3L2W A;  4RM3 A;  3VFZ A;  2DFE A;  3S1Q J;  3OYM A;  2WAQ N;  2EFO A;  4RGR A;  3LSR A;  1YJ9 I;  1OIS A;  3DPT A;  3OMY A;  2YU3 A;  3W2W A;  3VYU B;  4PUS A;  4LFU A;  4RAZ A;  5D5U B;  3GTG J;  1BJZ A;  3VYR B;  2JT1 A;  1R71 A;  2P8T A;  1QVU A;  2DK5 A;  2IEK A;  2CFX A;  3WHC A;  1TWA J;  3RKQ A;  2V6E A;  2NS0 A;  3GZN B;  1MMN A;  2DN0 A;  2I5U A;  3M07 A;  4EEF G;  3HOV J;  1VI0 A;  3SZP A;  3V42 A;  3I56 I;  1ZH5 A;  3BJA A;  5LRS A;  4IKF A;  3CUQ C;  1I3Q J;  2JUC A;  3DBR B;  4P5O A;  2EWN A;  3K7A J;  2MYS A;  1TQM A;  2Z1D A;  2LP0 A;  3TDU C;  3MD2 A;  4B1R A;  4PCQ A;  3CME I;  2BHY A;  1D0Y A;  4XSX F;  3V8K A;  2K02 A;  1IG7 A;  1VF9 A;  1OR7 A;  2NAZ A;  2H1L A;  4HST A;  4D1Q A;  2E1M C;  2JMW A;  3K4M A;  5EEG A;  1A6Q A;  1TQP A;  3LSG A;  2G7U A;  3T8T A;  2Y0M A;  2E1O A;  2DA5 A;  2TRT A;  2HQA A;  3TO9 A;  1ETO A;  4ETS A;  1BOB A;  1EH8 A;  2NS8 A;  4IVN A;  3X2Q H;  4ZZL A;  5DUI A;  5ILV A;  1A6I A;  3JRH A;  2R4G A;  2K9Q A;  3LSI A;  2D5V A;  2EIM H;  3SYT A;  4EQQ A;  3WTW C;  2TDX A;  2P7V B;  5KAF C;  4RGX A;  4HQE A;  3MZY A;  3CMM A;  1FSE A;  5EYR A;  3ZMT A;  4BHP A;  5FGM A;  3A1Y A;  3FBN B;  4KUM A;  1V5E A;  4G7Z F;  3H92 A;  3WG7 H;  3OV8 A;  3IH3 A;  1ZAO A;  2HQ5 A;  4RAY A;  4A3G J;  4YEL A;  3WE2 A;  5DD4 A;  2EPF A;  3TO7 A;  3UR3 C;  2QM3 A;  4B47 A;  4LG0 B;  3ONQ A;  4AIH A;  4Y17 A;  3ZP5 A;  3S3M A;  2EZL A;  2XGD A;  1LJ9 A;  4KNY A;  1IRZ A;  1YYV A;  4BY1 J;  3H9Q A;  1D5Y A;  5M3M J;  3L00 A;  3EYI A;  4PJN A;  1F9N A;  2CSO A;  2PJP A;  5JVT A;  3VYS B;  4A2U A;  3MZH A;  1TL8 A;  2HTS A;  5EG0 A;  5GAG J;  4U7B A;  2IA0 A;  3DTI A;  1G2H A;  1A35 A;  2IA2 A;  5TIS C;  3HOW J;  4DJA A;  4HX4 A;  5EJC A;  4A3J J;  2ETH A;  5KK1 A;  4MFE A;  4NNJ A;  3CES A;  1ETX A;  4IXA A;  2W82 A;  5JR3 A;  3F22 A;  4P96 A;  1OCC H;  4AC0 A;  1TTY A;  4LMY A;  2L3D A;  4AUX A;  3HOX J;  2VIX A;  3DEW A;  3E7L A;  4MFD A;  1WFX A;  3BDD A;  3S14 J;  4BH9 A;  3LOC A;  3CDH A;  2GBY A;  5M5Y J;  2CGP A;  4A3C J;  2PQ8 A;  3EDP A;  4ZTF A;  3VDX A;  3J80 K;  2R7O A;  3V7S A;  2YX4 A;  2DJI A;  3DFG A;  4CH7 A;  1T33 A;  2XAG A;  3WHB A;  1K4S A;  1LE8 B;  3CCQ I;  2VE9 A;  2V7F A;  3FHN A;  2AXL A;  3LSH A;  1XS9 A;  1UEL B;  4MHG A;  2OBP A;  4ZC3 A;  1NK2 P;  3ISP A;  4IL6 C;  1HW2 A;  1U9O A;  2UWM A;  2XGE A;  2OTL I;  2GZW A;  2LDU A;  2WWY A;  4AU7 A;  2DPU A;  1YRN A;  1JUP A;  3GME A;  4JX6 A;  5DS9 A;  2UXX A;  1FNN A;  3QRF F;  3MFK A;  4DBQ A;  2HVR A;  1KU7 A;  2AQE A;  3LAP A;  2EZI A;  1X3Z B;  1FYK A;  3OIO A;  4DYC A;  1K78 B;  1EKE A;  1ODD A;  2R5Y B;  2EZH A;  2A6E F;  2FBH A;  3G1M A;  1RR7 A;  3KEQ A;  4XRS G;  1Z7U A;  4EM2 A;  3CJT B;  4WXH A;  2O8K A;  2JA7 J;  1FJL A;  3FXQ A;  2D1H A;  2HXI A;  4I0B A;  2E7W A;  1V54 H;  2HVQ A;  3FWE A;  4KA4 A;  4M3E A;  3SXY A;  3FDY A;  4QTR A;  3COA C;  5FLX Z;  3FK7 A;  2MBF A;  1DUX C;  2DK8 A;  1ZRD A;  5FRO A;  3J80 Z;  3DKY A;  2BYV E;  1JKR C;  1TP4 A;  4XOT A;  4IOA F;  3UNG C;  3GFL A;  4QWQ A;  1T08 B;  5IOY A;  3FMR A;  2Y9Y A;  4HF0 A;  1Y39 A;  1O3S A;  1WSU A;  2CUJ A;  2VQL A;  3CCJ I;  3GLL A;  1RR8 C;  5HNF A;  4DW6 A;  2M34 A;  5HDK A;  5LFA A;  2UV1 A;  3T0Y A;  1A31 A;  1WI9 A;  1JGS A;  2XSD C;  3GYH X;  3OIP A;  3DTE A;  4UNO A;  3RCO A;  1WQ2 A;  2DQL A;  1STZ A;  2M5W A;  1D8K A;  2O03 A;  1ZQ3 P;  1ZR4 A;  3OR2 C;  3S3O A;  1VQK I;  2L9N A;  1GUU A;  4Y7N J;  5KVR A;  3PFY A;  3QYB A;  2BGC A;  2BY2 A;  1R36 A;  1B4A A;  3S93 A;  2X6X A;  3H9J A;  1X4P A;  5C3E J;  3WTZ A;  2COM A;  3O2P E;  5BPI A;  1WJD A;  2DO7 A;  5D6F A;  2JVH A;  3KYC B;  4BXU A;  2JA6 J;  3JR9 A;  1JTY A;  4F93 B;  2CQK A;  3GTK J;  1MH4 A;  4J19 A;  2DMQ A;  2LK2 A;  1D3Y A;  5J4V A;  3HOT A;  3ROU A;  1P4A A;  3N4M A;  1T98 A;  3BJO A;  2ZCW A;  2R7D A;  2DDB A;  4TV7 A;  2X6W A;  4NDL A;  5F27 A;  5F0C A;  1E2X A;  3BG5 A;  3KYD B;  4RB0 A;  4CGZ A;  1IDZ A;  2G0E A;  3KP6 A;  1KYW A;  2VT3 A;  3KZI C;  1S9H A;  3BTI A;  2BXZ A;  1DGR M;  5HNH A;  4ZYG A;  1G3Y A;  1GV5 A;  1MKM A;  1W5S A;  1YS7 A;  2BY0 A;  3FXU A;  4NB5 A;  4BE2 A;  5FKK A;  4E6K G;  2B7E A;  5FLM J;  1DGW Y;  3V8L A;  2M8E A;  3MKY B;  4G7H F;  2G7H A;  4Y52 J;  4I76 A;  3CTA A;  2LSO A;  3LL7 A;  4XKB A;  3OYA A;  4IHX A;  4A3D J;  4NUB A;  2YR2 A;  2WBM A;  3SZT A;  4CHU A;  2ELH A;  2ZJP F;  4D9J A;  4G94 A;  3H3U A;  2X0L A;  5CVJ A;  2E1M B;  2HWV A;  3AG3 H;  1XB4 A;  1R00 A;  2ZME C;  3ZXS A;  1PUF B;  5B66 C;  3W3C A;  4MQV A;  2LKX A;  4MQ9 F;  4UVA A;  2K4B A;  3KPH A;  3L2U A;  1VQL I;  2H8R A;  1RKT A;  3U2R A;  1ETY A;  2JA8 J;  3LSJ A;  3BJ6 A;  2HS5 A;  3CUQ A;  2XF5 A;  3AKZ A;  4OIN F;  2QSG X;  2QEX I;  1QZZ A;  2IRF G;  2EV5 A;  2OPT A;  2A61 A;  4C3H J;  1LQ1 A;  2KRF A;  3CP8 A;  1DU6 A;  5GAE J;  4PDK A;  2CMP A;  4CCK A;  1Z21 A;  2CO5 A;  3MN2 A;  1WI3 A;  3WTY C;  4F55 A;  2HPM A;  2ZSI B;  1G59 A;  1OCZ H;  3HZJ A;  2GA2 A;  2Z33 A;  4HAM A;  2JN6 A;  5IP9 J;  3NAR A;  4RGS A;  2VPR A;  5C44 J;  4PZJ A;  4M9X A;  5J47 A;  4ZTJ A;  2X1C A;  3Q3S A;  1TBX A;  2YS9 A;  4KT5 C;  1HKT A;  3BQY A;  1Y8Q B;  2FNA A;  3BY6 A;  2DBB A;  3VPR A;  4M3G A;  2P5L C;  2Y9Z A;  4U87 A;  4KIG A;  1YW8 A;  3BTC A;  2VOP A;  1O3Q A;  2F4I A;  1XN7 A;  4L0Z B;  3K4L A;  2L54 A;  1FOX A;  3P5J A;  3E6B A;  3BG6 A;  1IXR C;  2ME6 A;  3J7A O;  2ZJR F;  2PEX A;  4C2M J;  2F5C A;  1IO2 A;  2BXY A;  1FMV A;  1S3J A;  4F7Z A;  2P0W A;  3ZR8 X;  4N4O B;  3NWT A;  5D8L B;  2IAI A;  3BZK A;  3JRB A;  4BQA A;  5DYM A;  1VFC A;  5D8K B;  1XDS A;  1YJN I;  2V1N A;  4HG2 A;  1WRJ A;  3GVA A;  4LGW A;  4BAC A;  4A0Z A;  1ZRC A;  1FEX A;  5H2F C;  2DOD A;  3E6C C;  2O9L A;  3C2B A;  3A4C A;  2XF6 A;  2DMP A;  4HW0 A;  5DV5 A;  4UUS B;  4RLQ A;  4YFK F;  3DTK A;  3S32 A;  1XDU A;  3DPL C;  4XLN F;  1VQ6 I;  2DT7 B;  1QBJ A;  3CJN A;  3HSR A;  5F6F A;  1U6G A;  2MH9 A;  3F8C A;  3W2V A;  1BA5 A;  3DPU A;  4CYD A;  4A3F J;  3K69 A;  3HIF A;  3VYT B;  1XGS A;  4C3J J;  1VQO I;  3G1L A;  2OU2 A;  3OYI A;  2V9V A;  1O7F A;  3HDD A;  2YSR A;  1F4K A;  4C2T A;  4C30 A;  3F21 A;  1JKO C;  1IRG A;  5DCF A;  2MA3 A;  1TQI A;  2QQ8 A;  3BLY A;  4EM0 B;  1P4X A;  1D0X A;  2ESH A;  2JK3 A;  5H6R A;  4XR6 A;  3JW4 A;  3LQR A;  2PMH A;  2K7L A;  2L7K A;  3F0C A;  5HVQ C;  1X1B A;  3CCV I;  4X0G A;  3TGN A;  2WV0 A;  3E0J B;  4EVI A;  2M87 A;  3MKW B;  1NG7 A;  4E7I A;  3TP3 A;  2OF7 A;  3GZ5 A;  1T56 A;  3J81 K;  3QPL A;  2HNH A;  1QA6 A;  2KZV A;  2RV8 A;  4Q47 A;  2GIV A;  5E1W A;  3RPQ A;  4HLX A;  1X1C A;  1MBK A;  5BQT A;  2A5W A;  3IC7 A;  1X2N A;  4KIS A;  4BKX A;  1D0Z A;  4XRM A;  1FBS A;  3VWB A;  1QQI A;  1TWF J;  3CD6 I;  1JKQ C;  2DA7 A;  1YIJ I;  2PMZ N;  3GX4 X;  2KRC A;  3L7W A;  3ML6 A;  1TW2 A;  1XX5 A;  4PGH A;  2R7X A;  2R92 J;  5ICE A;  4PFP A;  3M3Y J;  1UHS A;  3CDL A;  1FBU A;  3EUH A;  1QHG A;  1YS6 A;  4DGW B;  4UUV A;  3E5U A;  1V5G A;  3BZ6 A;  4QSH A;  5K5O A;  1G3W A;  1E17 A;  1NH3 A;  2XB0 X;  1KQ0 A;  4FE4 A;  3TED A;  1YE9 A;  1ZLK A;  3H5R A;  5EZH A;  3CF5 F;  1E3O C;  1F5T A;  1W5C C;  2NNN A;  1WVR A;  3FXR A;  2QBY A;  2V9P A;  1YX3 A;  2DT6 A;  4WX9 A;  4FAS D;  2K3P A;  1QHH D;  4D0P A;  1HKS A;  2EK5 A;  2QVO A;  3B6A A;  3PSI A;  2NVU B;  3BR0 A;  1G3S A;  1ULY A;  4RMN A;  1T0F A;  2CU7 A;  3RDI A;  2E60 A;  3GTL J;  1HDP A;  2VUM J;  2P81 A;  5KNL A;  3RKX A;  5KCM A;  1FTZ A;  2A3S A;  2COB A;  5J4Y A;  4K2E A;  3IP4 B;  2L7Z A;  1FSH A;  2AS5 F;  4M6Y A;  3H9G A;  3ZGK A;  3VSK A;  2QYO A;  5JVG F;  3QOP A;  5LRR A;  3OYB A;  1T0F C;  3EUA A;  4DNC A;  2QQ9 A;  1F1Z A;  2HZD A;  4LK1 F;  3QYF A;  4ESB A;  3D1N I;  4L5E A;  2KDZ A;  1DP7 P;  3JCU C;  4B8X A;  1NTC A;  3KE2 A;  3HRU A;  5IOZ A;  5AON A;  2F48 A;  2OZU A;  5HLH A;  2HYG D;  2MW8 A;  3S2D J;  1IRX A;  3R4K A;  1EF4 A;  1HCR A;  1CF7 A;  1PDN C;  2VON A;  1H89 C;  2QLZ A;  3CC4 I;  4IX7 A;  3LA2 A;  2BY3 A;  2V1U A;  1A36 A;  1FWZ A;  2M4K A;  4ZDO A;  1QU3 A;  3REO A;  3Q0V A;  1T8I A;  1Y56 A;  4D7M A;  3WU1 B;  3T1B A;  3IH4 A;  1V5F A;  4HZF A;  4RA2 A;  3FM5 A;  1VQM I;  1D1A A;  1FZP B;  2W7N A;  1X1P A;  4G6T B;  3H1C A;  3E5X A;  2LF7 A;  2XB5 A;  1KON A;  5JHU A;  4I7H A;  4F3Q A;  1ZK8 A;  2HOE A;  2XDV A;  4PGG A;  1SFX A;  2QKM B;  1PYV A;  1APL C;  2ADU A;  4XON A;  3PUF A;  4XOR A;  1IC8 A;  2EFN A;  2Z2S B;  4FTH A;  1KQ9 A;  5JHF A;  2D2W A;  3PQK A;  4DQ2 A;  3ZQI A;  5D5V B;  3GF2 A;  5CPR B;  2VKD A;  5E8G A;  2R93 J;  3SDG A;  3KZY A;  5DM6 F;  4IPA A;  5FKM A;  1O57 A;  2PN6 A;  3RYR A;  1D1C A;  5ICC A;  3F8N A;  1UCR A;  1WJC A;  3L1P A;  2KZG A;  1RRJ A;  4NQW B;  2Y48 A;  4BEH B;  4WK8 F;  2XAH A;  5D5W B;  1WJA A;  4GYG A;  3WOD F;  4G6Q A;  4PSX A;  2ICW G;  1QZE A;  1GXP A;  1R5H A;  4WXC A;  3K4N A;  3M4O J;  2XRN A;  4M71 A;  2PG4 A;  4UV9 A;  1Z1D A;  2DFF A;  3TW7 A;  2VC0 A;  2P7C B;  1UAA A;  2M4G A;  1JT6 A;  2VKE A;  2W4S A;  4B3X A;  2LY2 A;  4DYR A;  5HDN A;  1EV7 A;  2FOK A;  4MEX F;  2CH0 A;  3OR1 C;  4LIT A;  2DOE A;  4G9Y A;  1TLH B;  3OYD A;  3JRC A;  3CC7 I;  1K6Y A;  2FXA A;  3WGG A;  4AID A;  4HDV A;  3GEZ A;  3CDI A;  5D6E A;  4XLC A;  3CQZ J;  2VOD A;  1PP8 F;  2NOJ B;  4CZZ A;  3MMY B;  3HTS B;  2FJ1 A;  4N9I A;  3H0D A;  1G8X A;  3OSF A;  1LKX A;  1V55 H;  5IY5 H;  5F08 A;  1NHA A;  2VT2 A;  5JLW A;  5FRN A;  2ZJ2 A;  2LFB A;  5HLT A;  1N77 A;  4OU0 A;  1PUE E;  1MH3 A;  2DTZ A;  3C3W A;  4ZDL A;  2MG4 A;  4J00 A;  1GLN A;  1YLF A;  3TO6 A;  4JOM A;  2HEO A;  1X4O A;  1UST A;  3F8F A;  4ZH4 F;  1RUN A;  4ANJ A;  4Z2Y A;  3IAM 2;  4DOZ A;  3DQV C;  4BHB A;  2A6T A;  4AIK A;  2HKX A;  4A69 C;  3G71 I;  2IS4 A;  1DP3 A;  3O8H A;  4CIC A;  2JQ7 A;  3W2A A;  3RSN A;  2IBD A;  4OMY A;  4LLG F;  3OYL A;  4AD9 A;  4II3 A;  1ZKG A;  4CZC A;  4I99 C;  3IH2 A; 
#chains in the Genus database with same CATH homology
 5B1B H;  1V55 H;  5IY5 H;  3X2Q H;  5B1A H;  2EIK H;  1OCR H;  2EIN H;  2EIL H;  2ZXW H;  3ABK H;  2EIM H;  3ABM H;  3AG3 H;  5B3S H;  1OCC H;  1V54 H;  3AG4 H;  3AG1 H;  3AG2 H;  2DYR H;  2DYS H;  2OCC H;  1OCO H;  1OCZ H;  2EIJ H;  2Y69 H;  3ASO H;  3WG7 H;  3ABL H;  3ASN H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...