4L5EA

Crystal structure of a. aeolicus ntrc1 dna binding domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
46
structure length
46
Chain Sequence
HKSIKEIEKEEIIKVLKEVNFNKKLASEILGIPLRTLYKRLKEYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Transcriptional regulator (NtrC family)
publication title Structure, function, and tethering of DNA-binding domains in sigma (54) transcriptional activators.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 17
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2013-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4l5eA00
1DU0A 2Y9ZA 1U8BA 4J19A 4DYRA 1QVUA 5C4JJ 3LSRA 2DMPA 2COBA 1AKHB 3OSFA 5IP7J 3S1QJ 4I6ZA 2NOGA 3MVPA 2MG4A 2ECCA 1E3OC 3CQZJ 4ABZA 2JN6A 1R9TJ 1JTYA 4V2GA 5FLMJ 2WAQN 1GV2A 4A3FJ 1MH4A 4JX5A 1I6HJ 2JMWA 2L7MP 3HM5A 2HXOA 1JUPA 2JK3A 1IV6A 1I50J 3G1OA 2FQ4A 1HF0A 3BR5A 1ORKA 3A01A 3NARA 2JJ7A 3HKZN 4I76A 2JWTA 3ZQLA 5K7HA 3E7LA 3O8GA 4BY1J 2ECBA 3JREA 2EQRA 1MBFA 2VI6A 1TWHJ 1MBKA 1T56A 5JLXA 4W97A 1JJ6C 4A3JJ 3S2DJ 3QPLA 1APLC 2NS7A 2CRGA 2FJ1A 2EZKA 4A3LJ 3TW7A 4FE7A 3S1MJ 1FTZA 5K7FA 1H8AC 5GP9A 1WI3A 4W1UA 2AHQA 2PMZN 4DYCA 1AU7A 1XC5A 1ZR4A 1BW5A 4DW6A 5EGOA 2HI3A 2TRTA 3RKQA 2G0EA 1P7JA 2XPVA 5J1RA 4C3HJ 3ZQCA 1O4XA 1ITYA 1BW6A 1QPIA 4GFBA 1U78A 2XPWA 3GTGJ 3BG3A 3K7AJ 4A3MJ 1ZGWA 1B72A 3OOUA 3ZQGA 3SFIA 2GLOA 2XPUA 4IHXA 3BG9A 4BBSJ 3IH2A 2OF7A 1QVTA 1FIAA 2TCTA 5IP9J 3PO3J 2X6OA 2MSYA 4JX6A 4AC0A 4HNVA 5IOYA 2GBYA 2CUFA 3HOYJ 2FX0A 2JA8J 1GV5A 4X1EA 2NVTJ 3LSJA 5BNGA 1Y1WJ 5E3LA 1IJWC 4L5EA 1H88C 1X2NA 1BL0A 9ANTA 3ZQHA 4DZJA 1VNDA 2R5ZB 1PUFA 2YU9J 3H0GJ 2DMNA 2R0QC 2Y0SN 4IHVA 1YRNA 1U9NA 4B4CA 2R7ZJ 2L0KA 2W48A 1ETQA 5IP6A 1H89C 1WH5A 4RDUA 3CDLA 1CQTA 1WPKA 3Q0VA 4MO7A 4AYBN 1P7IA 2VPRA 3BTCA 1I3QJ 1UG2A 3FKIJ 1JTXA 4UUSA 3S2HJ 2P81A 5EZGA 5C3EJ 5C4XJ 2DTZA 3TP3A 5FJ8J 2FD5A 3D1NI 3QPSA 3GBGA 5DS9A 3BR3A 2XRLA 2HYJA 3Q0UA 1F36A 5FKOA 1GUUA 3RZDJ 1IDYA 1LFBA 1MNMC 2ME6A 5M3FJ 3B6AA 2ID6A 3HOXJ 3FK7A 5F0HA 2EZLA 5F08A 2Y9YA 2K9NA 4BY7J 3JRDA 3C2BA 1VF9A 2LLKA 2LY9A 2YS9A 2DA5A 3A02A 2NVQJ 4XRSA 4EEFG 1X2MA 1AKHA 1UHSA 2H1KA 5M5WJ 4JP0A 2CUEA 5EYRA 1IUFA 2VUMJ 3NAUA 3HOZJ 2K40A 1VI0A 1HLVA 2LKXA 1RR7A 1JUSA 4CYCB 1IGNA 1G2HA 2QF7A 5K7ZA 4MFEA 3GTLJ 3JRFA 2WB1N 4XRSG 2X48A 1JGGA 2YUSA 2M2EA 3LSGA 3QQAA 5EG0B 1NK2P 4BBRJ 1W0UA 2R5YB 2JA5J 2E2JJ 2CQXA 3PO2J 3O8HA 1Z0XA 4D5FA 1GVDA 4JYKA 3WHCA 4FE4A 2GM4A 2EH3A 4JX4A 2XSDC 3JRIA 3TEDA 3HGGA 5IYBJ 3LNQA 1MBGA 2DA2A 1ZR2A 1SFOJ 2LVSA 1W0TA 3RZOJ 1HOMA 4A3IJ 4C3JJ 1A6IA 2JA7J 1ETXA 1MSFC 5F0FA 4QSHA 1LE8B 2KDZA 3GTPJ 3BR2A 2NVYJ 2O7OA 2VKVA 1QRYA 5EZHA 2R92J 4MLOA 3G1MA 2DN0A 2LD5A 2LTPA 4RBOA 4M6VA 4IHYA 3M4OJ 3TP0A 2EBIA 1NK3P 4XK4A 2L7ZA 3GTQJ 3LSPA 3JRHA 3HOUJ 3MN2A 1JKPC 2DJNA 1MH3A 2KT0A 1GT0C 2M0CA 5IPAA 2B63J 1K83J 1RKWA 3S16J 1ZQ3P 1D5YA 4FCYA 1B8IB 1TWCJ 2ZB9A 2HXIA 2CU7A 5GPCA 5IYCJ 2H8RA 1OCTC 5IOZA 1IG7A 3S14J 1BA5A 1DU6A 4A3GJ 1ZK8A 2LK2A 2HQ5A 4XIDA 1ENHA 2DMUA 1RPWA 2XGDA 2E19A 2ELKA 3BR1A 3JRGA 1OJLA 3BQYA 4M3BA 1JJ8C 3IH3A 1IDZA 4M3FA 4A3DJ 2DMTA 2R5ZA 1JT0A 2HOAA 4D5CA 2N8GA 5JLWA 4Y52J 1RETA 5J1UA 4Y7NJ 2MW8A 4A93J 4C3IJ 2K9SA 3OIOA 5E3MA 3SJMA 1JKQC 5F27A 3BR6A 1FEXA 5C44J 5E3NA 5F0CA 5FKLA 2IBDA 3B6CA 1POGA 2OPTA 3TW6A 1HCRA 3PM1A 3BQZA 1MBHA 5FLVA 1MBEA 1JT6A 1FIPA 3HEFA 5J1YA 2LR8A 1MSEC 3I4NJ 1RKTA 3JRAA 2WV1A 2Y2ZA 3WHBA 4A3CJ 3ZQIA 1TWAJ 2CJJA 1ETKA 1ETVA 4IHWA 3OSGA 2LP0A 5M5XJ 4B1RA 4BXXJ 1TC3C 2XGEA 4XRMA 4C2MJ 2E2HJ 2RAEA 1U9OA 3HBLA 3Q0WA 1JKRC 2E2IJ 2Y31A 3RQIA 2X9DA 3IH4A 4S0HB 1RESA 3S1RJ 2LFBA 5GPAA 5M3MJ 5FKNA 4UUTA 2XB0X 3A01B 1ZKGA 1Y1VJ 5EF6A 3JR9A 1A5JA 1WCMJ 2K9QA 4CYCA 3CCYA 4MIMA 3S15J 4AUXA 3GTOJ 4A3EJ 5EDNA 1EF4A 3JRBA 4QTRA 1Z77A 3BTIA 3F0CA 3S1NJ 1MBJA 2IEKA 2XGCA 1TWFJ 3HOWJ 1X58A 5EG0A 1Q1VA 2R93J 1IC8A 3GTKJ 2R5YA 2DMQA 2DA6A 3BT9A 1S7EA 2MGQA 1K61A 1UMQA 4FISA 3HDDA 4M3DA 3ZQFA 1OCPA 3CMYA 3H3VK 2D5VA 1SANA 4A69C 1FJLA 4BKXA 3S17J 5EGOB 2VKEA 3FK6A 1LE8A 4A3BJ 2DA7A 4DZPA 4XICA 3UKGA 2IAIA 2XB5A 2ID3A 5DTDA 2JA6J 2ME0A 2L7FP 2NS8A 5E3OA 3K2AA 4IEJA 4D7NA 2EZIA 2EZHA 1B72B 5F1JA 1XG1A 4M3EA 3A03A 3DCFA 3HB9A 4LOCA 4X6AJ 5EEAA 1T33A 3IV5A 1ETYA 3HOVJ 2Y30A 1B8IA 5FKKA 1WGXA 2E1OA 4D7MA 3BTLA 3FISA 3SDGA 5M5YJ 4FTHA 2M34A 1JKOC 2DA3A 3HGYA 3MKLA 3GTMJ 4G12A 1PUFB 2DA4A 1AHDP 2HOSA 3FIWA 4MFDA 3G1LA 3ZOBA 2HOTA 1HDDC 2HDDA 2QCOA 4NDLA 1NTCA 1ETWA 1VFCA 2O9LA 1FTTA 2AO9A 3Q3SA 5F04A 1YRNB 1ETOA 2O8KA 3I4MJ 5IYDJ 5J3LA 2M8GX 1WH7A 3BR0A 1IRZA 1XS9A 5HODA 1JUMA 3GTJJ 3BG5A 3LOCA 2I10A 1BJZA 1HDPA 2CQQA 4M3GA 4UUSB 4B3AA 1OFCX 3BTJA 5FKMA 4QIWN 3VPRA 3L1PA 3DEWA 1TWGJ 3JRCA 3W6VA 1ZTRA 1LFUP 2L9RA 4V2FA 2M9HA 1GDTA 4DYQA 3M3YJ 1F43A 2NVXJ 2DA1A 4A3KJ
chains in the Genus database with same CATH superfamily
2H1LA 1G6NA 3VODA 3GYHX 4ZJZA 3D0SA 4J19A 1R22A 2DQLA 2V9PA 2ZXWH 4XR6A 2DMPA 1SVLA 2CFOA 2VJ4A 1XDUA 5IP7J 2VBZA 4XM3A 2OD5A 1CF7A 4FETA 4ETSA 2EFNA 1PUEE 2CV0A 1XB4A 3H35A 3JTGA 1J09A 4A3FJ 4BDZA 2KIQA 3LSIA 4MGRA 2F48A 3PL8A 3OWTA 4JX5A 1YITI 1I6HJ 3CP2A 5CVJA 3WU0A 4RGRA 2CFXA 1IV6A 5K5QA 5K1YA 5L3BA 2FQ4A 1HF0A 4NUBA 3CC7I 4NQWA 3EDPA 3W2VA 3HKZN 4BAYA 4M9ZA 2ETHA 1F1ZA 2X51A 3AG4H 3E7LA 3L7WA 4BY1J 2ECBA 3LA3A 3CJRB 2RKHA 1CGPA 1IN6A 1U5TB 3GFMA 4HLYA 1YO5C 3MKZA 3S2DJ 3LMMA 4C2TA 2VJIA 4R8HA 4A5MA 4U87A 4XSZF 2WY8Q 1YW7A 3FDYA 4DBRA 2QQ9A 2CRGA 2DYSH 1U5TA 2F6CA 2QKMB 3U1DA 4MTDA 3TO6A 1WI3A 4XKWA 3SHFA 2AHQA 1AA7A 2VOPA 2Q2EA 1K6OA 1XC5A 2PMZA 3LSTA 4H4KC 1DPRA 1VQOI 1BW5A 4EMSA 2O8XA 4DW6A 2DDBA 3I58A 3ZQCA 4OINF 1DPUA 4XOPA 4G7ZF 3K4KA 1ZHFA 3BG3A 3DBRB 3K9TA 1WRJA 1SD7A 3V8JA 3HJEA 1B72A 3ZQGA 4OWRB 2XPUA 5FLXK 2EIKH 2FEZA 4QWQA 5LD2C 2UXNA 3PO3J 3BDDA 3NEUA 5CVUA 1OYYA 5L3GA 1VQ7I 1TQMA 2JRTA 3I3LA 4XN3A 3OS0A 2XV4S 5IY5H 1T95A 1Y6IA 1TNSA 1IN8A 3LSJA 4FASD 1SAUA 1QHGA 1W5SA 4LD5A 1BR4A 2AXTC 1BL0A 4A0YA 4ZTJA 4HG2A 1Z7LA 4DZJA 1VNDA 5J4YA 2E1NA 2XAJA 5EEHA 2YU9J 1FOXA 3E6DA 2M7BA 2ICWG 3JSOA 3H0GJ 2ESNA 5HDNA 2ZBKA 3IRQA 3K69A 2R0QC 1VQLI 2G7UA 1IN7A 4L9VA 5L3EA 2LRDA 4CSWA 2Y0SN 2CG4A 2Z9OA 1IN4A 3FXJA 1I1SA 1R5HA 1UJ8A 3RJPA 1YRNA 4B4CA 2R7ZJ 2EILH 2FXAA 2K86A 4FHTA 2P6TA 2Z2SB 4HW0A 2VOOA 3HG9A 3CDLA 1XDSA 3ULQB 4UNOA 4AYBN 2EK5A 5DEQA 1DDNA 1BIAA 4B3XA 2MH9A 4GYGA 3S2WA 2BHYA 3K10A 3I9V2 1D1BA 4BEHA 5FFXA 1UHWA 2OQGA 5DM6F 3TP3A 1VQ6I 3QPSA 2GA2A 2MD5A 1I5ZA 1R1UA 4IRGA 2V4JC 3A4CA 2DK5A 3Q0UA 1IDYA 5HLGA 2YX4A 1YOVB 2XF7A 3KP6A 1N77A 3B6AA 4RAFA 4ASNA 1B59A 3FK7A 2M3AA 3L2CA 5F08A 1BC8C 2KHMA 2QZ8A 4BY7J 3QRFF 2LLKA 3A02A 4HNUA 3MQ0A 1X2MA 2H1KA 4JP0A 1IUFA 2AXLA 1J2XA 3TL4X 4XORA 2FBIA 1XGSA 2K40A 1FOWA 1QZEA 2MLGA 4HX7A 5FD5A 4HQEA 4MEXF 1JUSA 2PFBA 2K3PA 3CP8A 1IGNA 2XRNA 4MFEA 2CGPA 1R58A 1KZHA 2WB1N 3LA2A 5JVGF 2LH9A 1M1EB 2X48A 5ICFA 1QGPA 5D8LB 2M2EA 3H0DA 3S3NA 1ZRCA 5DM7F 3F6OA 2HWVA 3PQJA 1IUYA 3CLQA 2QYOA 2R5YB 1XTAA 2QBYB 5EEGA 4O6JA 5LGUA 2MFZA 1X19A 2CWEA 3CTAA 4JYKA 4UVAA 4FE4A 4U0YA 2XSDC 3JRIA 2ZNYA 2QSGX 3MEXA 3DU5A 4LJZF 3ELKA 4M6XA 2DA2A 4WXDA 3AL0C 3IC7A 4XN0A 4BACA 2BXYA 3K1NA 4A3IJ 4F7ZA 5F0FA 4BHBA 4QSHA 3W3CA 3GTPJ 2RVCA 3OMYA 3N4MA 3HOSA 2QVOA 5L3DA 4MLOA 2W7NA 3G1MA 1SD6A 1FMVA 2LTPA 5DUIA 4RBOA 3HUGA 3W6KB 1IRGA 1U0JA 3CLOA 5E18F 3HRMA 3LSMA 5JVTA 1KQ0A 5J4VA 2B63J 4EJWA 1EA3A 1P2FA 1SD4A 2WV0A 2WY7Q 1S72I 5DD8A 5B1AH 4FCYA 3CMMA 2ZB9A 2OJED 3K1PA 1GVJA 3HSEA 5IOZA 2HPMA 1IG7A 4L5JA 4LK1F 3CCQI 3CUQA 3PIPF 2H6CA 2R7DA 1S5LC 4Q5SF 1W36C 1DU6A 2VT3A 4B47A 1U6GA 1LDJA 3IKTA 2LC2A 2E19A 2A6HF 3WGIA 1HSJA 2K5CA 4D0PA 5D5VB 1I27A 3BQYA 3OYHA 3DFGA 1G3SA 2BYVE 4M3BA 5DDGA 4A3DJ 2L5QA 4NC8A 3L00A 3PIOF 3COAC 4XL9A 2R5ZA 3HIFA 3KEQA 4WWCA 2OZUA 4I0BA 4U0WA 3K4CA 2RC4A 2HU9A 2N8GA 4KIGA 2M4KA 5L3CA 4Y52J 2W1OA 2IGMA 3L2RA 3M1EA 1STZA 1LQ1A 1OCOH 2PJRB 1ON1A 4HOBA 2HQNA 3EETA 1A04A 1DUXC 2XDVA 3FMSA 4E6KG 4BE0A 2F5DA 1Z3XA 5H6QA 4HX8A 2WTEA 4Z2YA 5KAIC 3L09A 5E3NA 1WJEA 1XPXA 4RB1A 1GLNA 5LLQA 5FKLA 3LAPA 1ERDA 4XBFA 2IBDA 3OYFA 1EJ9A 3B6CA 2OPTA 3P5JA 3M8EA 4C2UA 4PDKA 5ILSA 4BQQA 1V54H 4IRHA 4Q47A 2GZWA 1HCRA 3PM1A 1MBHA 4OOIA 2W4SA 2ZMEB 3E5QA 2ZO4A 5B5EC 3BG6A 1A6QA 3HTUA 3MKYB 2A68F 2MLKA 2Q8KA 4ENNA 3I4NJ 1VQNI 1RKTA 1N75A 1UZCA 5TGTA 1Q1HA 2P5VA 1UFMA 2JPCA 3WODF 2AQFA 3K4BA 3FKJA 5LEJA 2JT1A 2LP0A 4BXXJ 4XRMA 2E2HJ 3ASNH 4F93B 4KFCA 4KMFA 3M8FA 3KP4A 4OIOF 1Z6TA 3R0JA 1ZRFA 3O6BB 2Y31A 3ERMA 3QYFA 1IW7F 2X9DA 3B73A 1RESA 3GZ5A 3IAM2 3V7RA 3S1RJ 3S3OA 3OL3A 1JI8A 4HV6A 2ADUA 1Y56A 1Y1VJ 1ZKGA 4CCMA 1A5JA 1EH8A 1TBXA 3DF8A 1XSVA 3CF2A 3RDIA 4XMYA 1N78A 4XLNF 4L18B 4BE2A 4HAMA 2CQKA 4E7IA 1D1CA 4B44A 2BY3A 3H92A 3H1CA 1EF4A 3QODA 4G6QA 1Z77A 1DP7P 4ENMA 1X58A 4EATA 2R93J 1P6RA 2X4HA 3RYRA 5LHHA 1UMQA 1IXSB 1KU9A 2L2OA 2ZJ2A 1K4SA 1OCPA 4CHUA 2EV6A 1DGWY 4A69C 3KEYA 3RI4A 4IOAF 4UV9A 4LLNA 4EGZA 1P92A 1LE8A 2DA7A 4KN7X 2HEOA 4XICA 4EQQA 3DP7A 2ID3A 3KCCA 5DTDA 1FX7A 4C9YA 1YX5A 2A61A 4UHTA 5H2FC 2OZ6A 2A69F 4BQNA 1I6XA 2DDAA 1Z9CA 2FBHA 1WJ5A 3BG7A 1FBUA 3ZMVA 1K78A 3FXRA 2IS2A 3T5XA 1ETYA 1B8IA 4D7MA 4PSWA 4LMYA 2EWNA 5K5OA 2KIFA 3FZVA 3K0LA 2DA3A 5GAHJ 3J80Z 2QSHX 1WJCA 3MKLA 3T1BA 5F6FA 1AHDP 2IA1A 1S9HA 3ZOBA 4IPAA 2QCOA 2FNAA 4NDLA 1NTCA 2X0LA 3KEOA 2O8KA 5IYDJ 5JFRA 4HEA2 1GHCA 1WH7A 2XF6A 2VBYA 3Q9VA 3ASOH 5ILUA 5FROA 2K27A 4YEJA 4HPQA 3L2VA 4UUSB 3HC7A 2FE3A 2CUJA 2E1MC 4KYWA 3KYDB 5FKMA 2DOAA 3S3MA 1MJAA 3T8TA 4IX7A 5CQEA 3L1PA 3ML6A 3OR1C 3MFKA 4WCGA 4V2FA 3F6VA 3M3YJ 1F43A 1LDKB 5LHGA 1SD5A 4PSXA 3WTZA 1DU0A 2Y9ZA 4KIFA 1U8BA 5HDKA 4DYRA 3GZ6A 3CJNA 5HLIA 2UUZA 3AL0B 2D1VA 4XSXF 2COBA 2KFDA 2XAQA 5AONA 3GLXA 3P9CA 3C1DA 1R00A 4LIVA 3S1QJ 4I6ZA 3FM5A 2MG4A 2YR2A 2ECCA 4D9JA 5EJCA 1E3OC 3AAFA 4ABZA 5IT9Z 2JN6A 1R9TJ 2K9MA 4DOZA 3ABUA 2WAQN 3GFJA 2FBKA 3M7GA 1T6SA 2GA1A 2A5YB 4ZYAA 3CCRI 3C7JA 2ELHA 2L7MP 5ED4A 2HXOA 2JUCA 1MMAA 3LFKA 4BYYA 3K70D 1I50J 3G1OA 3GXOA 3CDIA 2DAOA 4UVBA 5A2QZ 1OKRA 3A01A 3NARA 2VPLA 1ODDA 5LGNA 4I76A 3G73A 2PEXA 5K7HA 3HKZA 4RLQA 3WTUC 1BR1A 1MDMA 5D8KB 3OIQA 2VI6A 2OQRA 4HV5A 1MBKA 4II3A 1OMIA 5JLXA 2P7CB 3T0YA 3H5RA 4A3JJ 3GVAA 2V6CA 3JTHA 1APLC 1Z21A 2E7XA 2VJ5A 2F5CA 3FXOA 2FJ1A 1MW7A 2EZKA 3F8FA 2PMHA 4A3LJ 3S1MJ 4I99C 3FXKA 2JSPA 4KMUX 4W1UA 3OV8A 2ISZA 2DJIA 1PJRA 1GXPA 4A2UA 4YIIA 2HI3A 1ITYA 1P7JA 2XPVA 4C3HJ 1LPQA 1MGTA 3SZTA 2R7RA 3ECHA 2ZFWA 2X6WA 2XPWA 3GTGJ 4ESBA 4ITVA 3I59B 2DFHA 2E60A 3MZ8A 3RKWA 3SYTA 1FT9A 2ZKZA 3RPUA 2J5OA 1ON2A 2GLOA 4IHXA 3IH2A 2CQNA 3A2KA 1T39A 2J5PA 5E1XA 5HS7A 4E7SA 2X6OA 3O3KA 2MSYA 4JX6A 2M87A 4AC0A 4HBLA 4HNVA 5JHUA 4BS9A 3HOYJ 4G6DA 2JA8J 5GTHC 3ESWB 1REPC 2CO5A 2R3SA 1X1DA 5DCMB 4IOCF 1IJWC 1LVAA 3QU3A 2BW3A 1X2NA 1DP3A 2M1BA 3ZMDA 1LDDA 2K3FA 1PUFA 3RSNA 1R23A 2LSOA 5DCMA 2MYSA 4CCNA 2R7QA 4Y33A 4M9XA 3OYIA 2E5NA 1U9NA 4XLCA 4XNFA 4RAGA 3HZJA 4GCVA 4ZDPA 1ETQA 3I71A 1WH5A 1MKMA 1ZG5A 1CQTA 2QENA 3K4LA 4MO7A 2VLAA 4S04A 2BY0A 2VPRA 1WJFA 4OMZA 3BTCA 4PFPA 1I3QJ 4AYBA 3FKIJ 4Q4ZF 2FMLA 2RGVA 1X4PA 2P81A 2OAZA 1FSHA 2RQPA 4OIPF 5LGTA 5C3EJ 5C4XJ 1WWXA 2DTZA 3LA7A 3R0AA 3D1NI 4DBQA 1B4AA 3FHNA 2OTJI 5GAEJ 2G7HA 2XRLA 5DS9A 1Y0UA 2HYJA 2DK8A 4EJOA 5KNLA 2XHKA 4EM2A 3RZDJ 4EM1A 1LFBA 2W84A 4AIKA 5M3FJ 4I02A 4Y3OA 2HVQA 1H9TA 1E2XA 3FF5A 2EZLA 2E1CA 3HOTA 1VF9A 4R1HA 3AFHA 4EJUA 3VSLA 1RI7A 4IHSA 5TRDA 5M5WJ 1W7PB 5EYRA 4RM3A 2VC1A 4N4NB 3J81Z 4BE1A 3NAUA 4QPOA 3DTEA 2LF7A 3BCBA 1BC7C 2DODA 2EB7A 5HOOA 1RR7A 1W7PA 2KZGA 3ZR8X 4CYCB 3UR3C 4EVIA 1RUOA 2QF7A 2WADA 4RB0A 2M5WA 3SEQA 4XRSG 1SFKA 2YUSA 5F1RA 2ZMEC 1XMKA 3QQAA 1TZLA 4XQFA 5EG0B 3OYJA 3FMRA 4NHJA 4ZDLA 2D1HA 2BEOA 3O8HA 3H36A 1GVDA 3WU1B 3WHCA 2HS5A 1VQ9I 2LMDA 2Y0MA 3MCZA 4OU0A 3BJ6A 1TL8A 1U3EM 2PBIA 1MBGA 4Y13A 3QWLA 4UV8A 1ZLJA 4C3JJ 1A6IA 1XMXA 3CZ6A 2HYFA 1MSFC 4RMNA 4Z6YA 2CYYA 4ANJA 2HVRA 5DD4A 2XAFA 4XRFA 1QRYA 2F5EA 2Z99A 4FT8A 4K2EA 3TDUC 1U2WA 1F5TA 5FGMA 3TO7A 1F9NA 2VKHA 4M6VA 2OTLI 4IHYA 4XK4A 1XN7A 3CCMI 1RC9A 2H09A 3GTQJ 3JRHA 2VXDA 1JKPC 4IKFA 2DJNA 2KT0A 1UB9A 2O5RA 4KUMA 2E1MB 1D5YA 1IN5A 3E6CC 2PG4A 4HLXA 2KJCA 4P96A 3CCJI 4O5VA 2CU7A 3PNTA 1QHHD 3S14J 1T38A 2O61A 4B48A 1OCZH 4OMYA 1BA5A 3VYUB 2FMYA 1W36D 3OOPA 4KITB 2QKLB 2VJJA 1ZK8A 2HQ5A 2KIMA 3GZNB 3M07A 3J80K 2IVMA 1RPWA 2NAZA 2XGDA 2KLOA 2KDOA 3V8LA 2HDWA 3DTIA 3NWSA 1IZ1A 3RPQA 3BZKA 2OV7A 3JRGA 2JPBA 3K4JA 5E20A 1IDZA 2R7TA 1O3QA 2ZXIA 1G3YA 1KGSA 3ISPA 4KT5C 4IQJA 2HOAA 2M8EA 4AVPA 3S93A 2LNBA 3CJQB 4Y17A 1X1PA 4Y7NJ 2E36A 4FX0A 4C3IJ 3RPUD 4HRIA 2K9SA 2L9VA 5E3MA 1MMSA 4YELA 3KP2A 2XGXA 5F27A 2DTRA 4PFOA 5H6RA 1HC8A 2GXAA 3HRSA 5JR3A 3IUOA 1OCCH 3PFYA 3TDZC 3GO5A 3VYRB 5C44J 5F0CA 1EH6A 1UHMA 2IS1A 3FXUA 4LIUA 1POGA 4L9TA 1KU2A 3LL7A 3FBNB 3CESA 5FLVA 2BGCA 3DKWA 5J47A 1JT6A 5K5RA 1ZAOA 3HEFA 1MSEC 3EYIA 5CVRA 2HOEA 4PGHA 1W1WE 2MC3A 4ZYGA 1VQPI 2DW4A 2K7LA 2DLLA 2YU3A 2NS0A 2PX9A 2KIUA 5D6EA 4C30A 3ZQIA 3IP4B 3BWGA 1ETVA 1S29A 2Y75A 3OSGA 2D45A 4JBAA 4B1RA 2KMUA 5GAGJ 2R7XA 5IT9K 4GRIA 2VQLA 3GMEA 4OAYA 3Q0WA 3NWTA 1J0RA 2AQEA 2DI3A 2I5UA 2E2IJ 1E3HA 3KPHA 2FNPA 4E7KA 2ELJA 2EPFA 4RGXA 3WGGA 2L9NA 1LFPA 1YW9A 2FSWA 1BI1A 2EIMH 3BCAA 5AIQA 4AUXA 3OYGA 4N9HA 3V7SA 5FB2A 5EDNA 1ZARA 2L4AA 1BBYA 1R5GA 2EIJH 3OY9A 3JRBA 3BTIA 1VQ4I 3D5RC 2OBPA 2XGCA 3K6GA 4ZH4F 1I1GA 2R5YA 1USSA 2DA6A 2DMQA 4XLEA 2QBYA 3CC2I 4CCKA 2HKXA 1T98A 2X85A 2XAGA 3HDDA 3ZQFA 1SFXA 3CMYA 3H3VK 1T8IA 2A05A 2W57A 1FJLA 4BKXA 5LRSA 5EGOB 1R1VA 1W7PD 3A0HC 4AWXB 2B7EA 1WHUA 3OYNA 2IAIA 2HGCA 2XB5A 2JA6J 1PP8F 2E5ZA 1SEUA 2UXXA 2LKSA 3OS1A 2BY1A 4HYEA 4IEJA 2EZHA 2RNGA 2X6YA 1QBJA 1NH3A 4YFXF 1XG1A 3PQKA 4ZYEA 3TGNA 3WTXC 2DXIA 3DCFA 3FHZA 2HDCA 1X1CA 4EJTA 4RA2A 1ZGJA 5D4RA 4IQ4A 3HOVJ 2Y30A 2LOOA 3T8RA 4ZDOA 2P4WA 3BTLA 3FISA 3SDGA 5M5YJ 1IXRC 4FTHA 3VWBA 1TQPA 4J01A 1YE9A 2M34A 2CW8A 1D5VA 2HZTA 1WSUA 1HSTA 4DIQA 4FQGA 4CDGA 2Y48A 2KRCA 4II2A 4BNCA 2A07F 2V1DA 3G3ZA 1V5EA 2A5WA 3FIWA 3DXJF 3G1LA 4F3QA 3WG9A 1SAXA 3ABLH 2W85A 3M9AA 4JQFA 1QU3A 1ETWA 2HFHA 2V26A 3GWZA 1VFCA 2DCEA 2O9LA 2EJRA 5CVVA 1XD7A 1S6LA 2IT0A 4GGGA 3J7ZI 2L7KA 4YG2F 1HW1A 4EM0B 1IRZA 5HODA 5KAFC 3DPTA 4O3MA 1B9NA 2FOKA 1R7JA 2ZXHA 2K02A 2RV8A 1FBSA 2PJRA 4BH9A 1K4TA 2LBFB 3P9KA 2JVGA 1AWCA 4HA8A 5FO5A 3OYKA 2NVUB 1OFCX 3EUHC 4QIWN 3WE2A 3ECOA 4Y4RA 4LLLA 2XROA 1D3YA 3L9FA 2M9HA 4DGWB 1GDTA 4DYQA 3ZQQA 3VOEA 3WTYC 3ZRGA 2DA1A 3E1SA 4A3KJ 1FC3A 2STTA 2GXBA 2ZMEA 4KJZA 4I0AA 4ESJA 4BJ6C 3LSRA 3DKXA 1GXQA 2ZJRF 3EUAA 5ICGA 1AKHB 2Z5UA 2DPUA 2IJLA 4WF2A 3F23A 3MVPA 5HS8A 1RIOH 3KLNA 4UB6C 3J81K 1OISA 4LB5A 2ZJQF 2CS3A 4OAZA 4P9UA 4YIRX 4I7HA 3DLLF 2WAQA 5E1ZB 1IRXA 4DJAA 1E17A 4B43A 1LB2A 2VQHA 3SZGA 4HDVA 3CCUI 1ORKA 4AIHA 3RKYA 1FPQA 2JWTA 3ZQLA 4HF2A 2QA4I 1P4AA 1Z7UA 2Z33A 3JREA 2EQRA 1MBFA 3JSPA 1HXDA 1TWHJ 3G4SI 1T56A 3MKWB 1A35A 1JJ6C 2P0WA 3QPLA 5GTIC 3CDHA 5E1WA 3N05A 4HSRA 2UZKA 2K85A 2IGOA 5TISC 3PSIA 3C3WA 5CPRB 2F4IA 4U0VA 5K7FA 1H8AC 2KL4A 2F5FA 4QLCU 3ZP5A 3K4NA 2JTVA 1OYIA 4DYCA 3V8KA 4UXNA 1AU7A 2XASA 1Z91A 2TRTA 4EJVA 2VE8A 2G0EA 3QOPA 5J1RA 1J75A 4PJMA 2P6SA 2KRHA 1BW6A 1QPIA 2F5VA 1U78A 2VBXA 2H94A 4A3MJ 1ZGWA 1X3UA 2L9SA 3OOUA 4I2OA 3SFIA 2W00A 3BG9A 1O3TA 4BBSJ 2OF7A 1QVTA 4P9FA 2AS5F 4LG3A 5IP9J 3E5XA 2M7AA 4F92B 1SVOA 2V9KA 2DOFA 2CUFA 2E71A 3SZPA 3LSHA 4LG0B 4G7OF 3F21A 2F4MB 2FX0A 1F4KA 2F4OB 1GV5A 4RM2A 3ABKH 1FZPB 1YHQI 4L5EA 1H88C 2MH2A 4H0EA 1ZREA 9ANTA 2RN7A 3OS2A 4L9NA 3VSKA 3E5UA 4HSTA 3VYTB 4M71A 1VQKI 2W24A 2DFFA 1T2KA 1VQ5I 4IHVA 3DTKA 2L0KA 4HNTA 5IP6A 3G71I 3TMOA 1YLFA 2DT6A 1D0ZA 2IPQX 2XIGA 3BY6A 3EPZA 4RDUA 3WU2C 2HPIA 2K4BA 3HRUA 2B0LA 3JCUC 2TDXA 3Q0VA 2HKOA 1MIJA 1P7IA 2R7VA 4RGUA 1HKTA 1UG2A 3WE3A 1JTXA 1MMGA 4UUSA 3RKXA 4A12A 2MBFA 1WZ2A 4PJLA 1Y0NA 4KT6A 1YJNI 3ZGKA 1Z05A 2JQ7A 3BR3A 4CZZA 2VODA 1DQUA 4RLFA 3W2WA 3M8JA 4NB5A 4CGZA 2YX7A 2Z1DA 1J59A 2O0YA 1GUUA 1FBQA 4LITA 2UV1A 3K4MA 5FKOA 3RTRA 4B09A 1YFHA 4A0XA 4CUGA 3HPGA 3PFIA 4LFUA 2ME6A 1R36A 4KIBA 4ZYDA 3VYSB 1W5CC 1X3ZB 5HS9A 5F0HA 2BVLA 2K9NA 2Y9YA 4YFNF 3JRDA 2EA4A 4JK1X 1FYLA 2YS9A 2NVQJ 3ZCOA 1NG6A 2HYGD 3WTVC 1UHSA 4F55A 2W82A 2VUMJ 2CW7A 1R71A 2IGNA 1ZG3A 2GQQA 1R4NB 3GW2A 4S05A 3HOZJ 3GLLA 3F72A 1VI0A 1HLVA 2A6TA 5FFZA 3WTTC 1ZYRF 2KRFA 2CH0A 3KX2A 2P8TA 3C18A 5FRNA 1OQYA 1G4DA 1BI2A 1QO0D 5K7ZA 1G2HA 1RRJA 3HXLA 4IHTA 3DEEA 1QZZA 2M4GA 1YJWI 4D1QA 2E35A 2P7VB 3DKYA 1NK2P 1TLHB 1Y8QB 2JA5J 2E2JJ 3U9GA 1Z0XA 2VXZA 3CUOA 3ABMH 2GM4A 3A0BC 4JX4A 1YS7A 5F64A 2KISA 2V1XA 3GFLA 5LRRA 3WG7H 2H8WA 4CICA 3HGGA 5IYBJ 2FQ3A 2ZNZA 4ZTFA 1ZR2A 3HTSB 2BBYA 2LVSA 3MD2A 1W0TA 1UAAA 4M6YA 3WGHA 3KYCB 4HQMA 4ESFA 5D4SA 1ETXA 2IS4A 1ACIA 1MMDA 1SVMA 3L2UA 2KDZA 2WWYA 1TNTA 2NVYJ 2O7OA 5ICEA 3KZZA 4KA4A 1MNEA 2R92J 1T0FC 3MZYA 1G3WA 1KYWA 4UUVA 1BN5A 5D5UB 2LD5A 2PI0A 4V19K 1KQ9A 3BJAA 3TP0A 3M4OJ 1NK3P 4PJ0C 2L7ZA 3OYEA 3BLYA 4M74A 3HOUJ 3MN2A 3I0TA 1MH3A 3BZ6A 1ZN2A 2M0CA 5CJ9A 5IPAA 1GT0C 3IWZA 4IVNA 2V79A 4BXFA 3S16J 1ZQ3P 3ROUA 3C2HA 2WBMA 3DBHB 3I59A 4EV0A 2L3DA 1G8XA 2GOXB 2M30A 3TO9A 5IYCJ 2H8RA 3U1KA 2D2WA 3PNVA 3GCMA 3IL2A 3QP6A 4YFKF 2K9LA 3H9GA 4MQ9F 4RB2C 4A3GJ 2LK2A 2DMUA 2ELKA 3BR1A 2WC2A 3KP7A 2WAEA 3KP5A 2FU4A 2IGKA 4E7LA 5BPIA 4RAZA 1JJ8C 2JVHA 2GWRA 2HNHA 3IH3A 1OYWA 3I53A 3DEUA 2Y0SA 2JUGA 2HQRA 4D5CA 4LK0F 5JLWA 1Z6RA 4CCJA 2NXNB 3F9KA 4G9YA 1ZLKA 3SJMA 1VTNC 4L0ZB 3JW4A 1R1TA 3DV8A 1QPMA 4A6DA 2M0MA 4BHCA 3MZHA 3FBIB 3L2WA 1S7AA 5DCFA 3D5LA 1UG0A 3TW6A 1H0MA 3MAJA 4RGSA 1OLTA 3BQZA 1HW5A 1MBEA 3SQNA 3H3UA 1OR7C 2XF5A 1FIPA 2QSFX 4Q48A 5HVQC 1FLIA 3EUKL 5J1YA 1ZRDA 2LR8A 4E7HA 2HTJA 1FP1D 2XVCA 4I01A 4EGYA 1WFXA 2WV1A 2L54A 2MC4A 2Y2ZA 3WHBA 3DPUA 4XONA 1CF7B 1YX3A 3F8NA 4A3CJ 2Q1ZB 3V7CA 3OYBA 1P9QC 4MEYF 2CJJA 2P5LC 4ON0A 4KICA 2IA0A 2IP2A 4X0GA 1TC3C 2XGEA 3BC8A 2RAEA 3KZYA 4XKBA 4DQ2A 2DQRA 3GF2A 4PCQA 3HBLA 1JKRC 1FOYA 5ILVA 4AM3A 1S3JA 3IH4A 3CCLI 2LFBA 2RQQA 4ZC3A 5GPAA 4NQWB 4A6EA 2PLYA 4IZZA 2P5KA 4UUTA 1B9MA 3O2PE 5EF6A 3JR9A 1E3PA 1I39A 3LSKA 1X4OA 2WB1A 2JSCA 2K9QA 4CYCA 4E70A 2KJBA 3CCYA 3U2RA 3K70C 4MIMA 3S15J 2VQCA 4A3EJ 4AIJA 2B9SA 3ZMSA 2EA2A 3F0CA 2BXZA 2IEKA 1ZGAA 2X1EA 3I5UA 3HOWJ 4F91B 5ERIA 3QOEA 1Q1VA 5EG0A 2QGUA 3OYCA 1Y8RB 4XLHA 1FWZA 3KFWX 4E7ZA 4ZZLA 3F3XA 2VT2A 1S7EA 2MGQA 1K61A 3LQQA 3TQNA 2R7UA 4PK4A 5E17F 1RUNA 1MJ9A 4M3DA 3BZCA 1TTYA 2Q2EB 3LQRA 1Y39A 3WTWC 2D5VA 4PJNA 1SANA 3AG3H 5B66C 1IAWA 1KA8A 1BOBA 3GFIA 3S17J 4PZJA 1O7FA 2GAUA 2VKEA 3FK6A 5ICCA 1BI0A 1SMYF 5BPDA 2I8DA 1D1AA 2ME0A 2L7FP 2NS8A 5E3OA 4XLFA 4AD9A 1B72B 4KN4X 2NNNA 4YIFA 4IF4A 3A03A 2UWMA 1LEBA 2VQGA 1VQMI 4X6AJ 3K1MA 5JHFA 5EEAA 3IV5A 2VN2A 2E1OA 3HYIA 1YYVA 2FRHA 3I64A 5CVIA 3BROA 3V4GA 5E8IA 2HTSA 3CCSI 4RAYA 2ACJA 3GTMJ 1YQAA 2NRAC 1D8JA 3GEZA 1USTA 1P4WA 4G12A 5BQTA 1YTYA 1XSDA 1HBXG 3OYDA 2DA4A 2JRMA 2CSOA 1TW3A 4MFDA 2HOTA 1HDDC 1VQ8I 2HDDA 3RZOJ 3RCOA 3AG1H 2BHZA 4BUPA 1YRNB 1ETOA 3I4MJ 4UB8C 3F8CA 5J3LA 3AKZA 4U7DA 2VBWA 5IT3A 1TQIA 3FMQA 3GTJJ 1JE8A 2A3SA 3BG5A 4QPQA 1YG2A 3PJRA 4JOMA 2LDUA 2KQRA 2H27A 1BJZA 2CQQA 4M3GA 4PGGA 3TOBA 4BEHB 3R61A 3JAMZ 3BTJA 2BVMA 3L2QA 2QUFA 5TJJA 3DEWA 3JRCA 3H9JA 1ZTRA 3UNGC 1LFUP 1G59A 1IO2A 3W6VA 1MZBA 3ZMUA 2V1UA 2HR3A 3CO6C 4NBQA 2GIZA 1P4XA 5H20A 3QU6A 1QVUA 2EFPA 3PUFA 3QPTA 3REOA 5C4JJ 3IHUA 3CCEI 2QM3A 1LJ9A 1Z67A 2XKPA 5DV5A 1HA8A 2NOGA 4WXHA 2PN6A 3CQZJ 3SXYA 2HQAA 2Q0OA 4N4OB 1JTYA 3E3VA 4IRIA 4V2GA 3FXQA 3F8BA 3SDBA 4E4HA 5FLMJ 1GV2A 4LLGF 2O03A 4WK8F 4XKCA 3PNYA 1MH4A 2R7SA 3FM3A 2G9WA 2JMWA 3HM5A 1BIBA 4WX9A 1YS6A 4G6TB 3I4PA 1JUPA 5A2QK 4R79A 5LBQA 2JK3A 1DGRM 4HF1A 3A1YA 3QAHA 1T0FA 4J00A 3EQLF 3BR5A 3M1CA 2X1CA 1X1AA 2JJ7A 4WXCA 1LNWA 3BPXA 3O8GA 1I3AA 2XKOA 1WVRA 2MABA 2K4JA 4RS8A 1YI2I 1KONA 4W97A 2EV5A 2XSJC 4OIQF 1WKMA 3LFUA 5KVRA 1UCRA 2NS7A 5CKTA 2QEXI 2JA2A 3HSFA 3X2QH 2LG4A 3E97A 3TW7A 4FE7A 4BJ5C 1FTZA 2RNJA 4BQAA 2E34A 4CZCA 5GP9A 3QYBA 6PAXA 2PMZN 4IXAA 1OPCA 1O3RA 1ZR4A 1XX5A 3DWLE 3HUGB 2FA5A 3G2BA 2FUG2 1B6AA 3KLOA 5EGOA 3RKQA 1WJDA 2ZC2A 2JZYA 1O4XA 4MTEA 1YW8A 2LREA 1FP2A 4GDFA 1W4MA 4GFBA 3VB2A 2IXSA 4M9SA 3J7YJ 4MQVA 5HNFA 1HQCA 1BI3A 3K7AJ 4ZZDA 2KP6A 4M73A 2MD0A 5BOXA 4AU7A 2OCEA 2R4GA 5B3SH 2IRFG 3Q5FA 2R7FA 1FIAA 3CUQB 3P9IA 2TCTA 1E0EA 3KE2A 5IOYA 4XLPF 1WI9A 2GBYA 2Z16A 5B1BH 2Z3YA 1ZELA 4E7JA 5CQGA 1TT0A 2NVTJ 4X1EA 3NQOA 2CW0F 3GX4X 5BNGA 1Y1WJ 5E8GA 5E3LA 1XGMA 4P1WA 4BJTA 3KP3A 3ZQHA 1OR7A 2RDPA 2R5ZB 3ZPLA 1KYZA 3PUBA 2FF4A 3E6BA 4A0ZA 3BJOA 2DMNA 1RNLA 1YIJI 4LB6B 1BOAA 4KDPA 1PYVA 3VDXA 4BQOA 2EINH 2QWWA 1JXSA 1K6YA 4LGWA 4BGDA 2A6EF 1XCBA 3HRTA 5DYMA 3CD6I 4CXFA 3IAS2 2W48A 2EFWA 1LUJB 1H89C 3B02A 2C6YA 4KISA 2ZJPF 3CMEI 1WPKA 2OU2A 5D5WB 5J40A 4A5NA 5J6XA 1K79A 1TP4A 5LFAA 2FOWA 2LBFA 3S2HJ 1QA6A 5EZGA 4U88A 4G7HF 4P55A 2QQBA 3DQVC 5FJ8J 2FD5A 3GBGA 2DT7B 2DYRH 1EH7A 3CF5F 1HKQA 1XMAA 2NYXA 1F36A 1MMNA 2OUMA 2GOMA 3QYEA 1O7LA 1MNMC 1EV7A 3G6EI 1FY7A 2ID6A 4CH7A 2V7FA 3HOXJ 1NHAA 3TBIA 5BS6A 4ZYHA 3OSFA 3C2BA 2LY9A 2DA5A 1FOKA 4XRSA 4EEFG 1AKHA 3R6SA 3HL2A 2VASA 2CUEA 3CJTB 3I54A 2HZDA 3MMYB 3FXLA 1OCRH 4AVZA 3CCVI 1LEAA 3HPHA 2LKXA 2ZSIB 1AOYA 2X6XA 4BDYA 3BP8A 2PJPA 4XKVA 4NC6A 3GTLJ 3JRFA 4N0BA 3P7NA 3QPHA 2DO7A 2F2EA 4CCLA 1WQ2A 1JGGA 1N25A 2LY1A 5JI6A 1BJAA 3LSGA 4MNUA 1L3LA 1ONVA 3RYPA 4RB3C 1SFUA 1BM9A 4BBRJ 1H9GA 4U7BA 1W0UA 3OR2C 3E6MA 2CQXA 3PO2J 1PDNC 4D5FA 5FD6A 2CV2A 4FX4A 2XAHA 1KU3A 2EH3A 5DUKA 3TEDA 2KKOA 2CV1A 1QQIA 1X3WB 1FYMA 3KZIC 1O57A 3LNQA 4PUSA 1SFOJ 4CO8A 3DPLC 1V5GA 1HOMA 2JA7J 3BPVA 4Y15A 1LE8B 4OIRF 3BR2A 1UELB 2VKVA 2MA3A 5EZHA 3ZMTA 5L3FA 4HF0A 2DN0A 3BOQA 3HHHA 2EBIA 1PVEA 4CA0A 3ZXSA 3ZN1A 2E7WA 1IRFA 2VIXA 3LSPA 1TW2A 3ABTA 1LVKA 1KQ8A 1K78B 3J7AO 1A36A 1K83J 1RKWA 1SFEA 3EYYA 3S8PA 5FLXZ 3I56I 1B8IB 2VONA 1TWCJ 5CYVA 4UY8I 1ZH5A 1XCVA 2HXIA 5GPCA 3OYLA 1OCTC 1WJBA 1B1BA 3HSRA 1V5FA 3VFZA 1K7AA 1XSXA 5D5XB 4I98B 2EFQA 2XC7A 1V3FA 4M72A 3CMAI 1O3SA 1FSEA 1U5TC 1IF1A 4XIDA 1ENHA 2DFEA 2ZCWA 3AG2H 4LG0A 1R6RA 1Z3YA 2L4MA 4TV7A 3TOAA 3OYAA 2LY2A 2COMA 1OJLA 3E0JB 3S32A 4CCOA 2XAUA 4M3FA 1JGSA 1ULYA 2QQAA 2DMTA 3VEPA 3C2GA 3OIPA 4ENJA 2BZTA 1JT0A 3TKYA 2ZSHB 1RZ4A 3Q9SA 4G8XA 5KHDA 1D0XA 1RETA 5J1UA 2MW8A 3SFZA 4A93J 2DT5A 1FMWA 3H5AA 5J8FA 3OIOA 4GXOA 1NG7A 2LKPA 1JKQC 2IA2A 2VC0A 3BR6A 1FEXA 1R5ID 1WJAA 2PMUA 3JAMK 2CMPA 4HDUA 2STWA 2X1DA 2LF8A 1BR2A 2W25A 2EFOA 3RQ4A 4XLAA 5HLHA 1YIOA 5GADJ 4HZFA 1HKSA 4DNCA 3RIRA 1V4RA 1W5TA 1U8RA 2ZFUA 2GIVA 3JRAA 3KIOA 3IKVA 1MNDA 3K2ZA 4ENKA 3J7AY 4L9JA 3LWFA 3R60A 1TWAJ 1ETKA 1KU7A 5HDGA 5M5XJ 4IHWA 4C2MJ 5J8CA 3N97A 2H6BA 2DFIA 3W2AA 1D8KA 1U9OA 2L01A 3RQIA 4BXUA 4S0HB 1A31A 4L0YB 5M3MJ 3KYLA 5FKNA 1L0OC 2VB6A 4P5OA 3A01B 2XB0X 2EV0A 2OCCH 2PQ8A 1WCMJ 4BHPA 1MDMB 1SMTA 2BOLA 1X1BA 1VZ0A 3GTOJ 2R7WA 4QTRA 4G94A 3ONQA 3S1NJ 2VL8A 1D0YA 1MBJA 1TWFJ 3MWMA 4YRVA 2LYCA 1IC8A 3GTKJ 1J9IA 2ZXJA 2ISYA 3ZN0A 2IS6A 3BT9A 3HHGA 1QZYA 3ZQ7A 3FX3A 1MJBA 1TT5B 3D5SC 4FISA 2DOEA 2OC6A 2BY2A 2RREA 2VKDA 3F8MA 5LEKA 1XGNA 1YJ9I 1J7KA 4HX4A 2Y69H 4IJAA 2DPDA 1HW2A 5CLSA 4UVCA 1Z1DA 3SEZA 2V9VA 5FRMA 4A3BJ 1IXCA 4BU2A 2CQ7A 3FWEA 3R4KA 4DZPA 2QQ8A 2NNYA 1RR8C 3UKGA 3OL4A 3IRRA 4NC7A 5HNHA 3W6JB 2O3FA 4BL0B 2BV6A 1JHFA 5KCMA 3H5NA 3NRVA 4IL6C 2V1NA 3K2AA 4D7NA 4NNJA 2EZIA 2R7OA 4L5IA 3FXMA 2L02A 3PSFA 5F1JA 5KK1A 3CO7C 4M3EA 1MD0A 2YPRA 3HB9A 4LOCA 3CC4I 3H3ZA 3I55I 5D6FA 1T33A 3EUHA 1FYKA 4F52A 2OA4A 5FKKA 1WGXA 3ERED 1EKEA 5E79C 3U21A 1PP7U 1J5YA 2KPMA 1JKOC 2O6GE 3DU6A 2BW3B 3HGYA 1R4MB 3LAJA 4B8XA 4GYIA 2KZVA 1PUFB 4PJJA 2HOSA 1S8NA 4I09A 3ZMZA 2CUZA 2NOJB 1C0WA 1XGOA 1QNTA 3DLAA 3H9QA 3OYMA 3V42A 3WTSC 5BMZA 3QP5A 1JHHA 2AO9A 2BE5F 3Q3SA 4GO1A 1FTTA 1T08B 2M45A 2XUBA 2ESHA 3DBLB 3IWFA 5F04A 2HVSA 2M8GX 5HLTA 3BR0A 5AIPA 1LKXA 4IO9F 1XS9A 4AIDA 4XOTA 1JUMA 1V55H 4CYDA 3LOCA 2I10A 2YSRA 1G3TA 2DU9A 2GXGA 1ZG1A 1FNNA 4N9IA 1HDPA 5LHIA 1SC7A 2QLZA 3KETA 3CUQC 4B3AA 3F22A 2V6EA 3VPRA 4KNYA 4MHGA 1IV8A 1TWGJ 1S7OA 2WA0A 2L9RA 1R49A 2IW5A 2DBBA 3GUDA 2VE9A 2NVXJ 2WAFA
chains in the Genus database with same CATH topology
1DU0A 2Y9ZA 1U8BA 4J19A 4DYRA 1QVUA 5C4JJ 3LSRA 2DMPA 2COBA 1AKHB 3OSFA 5IP7J 3S1QJ 4I6ZA 2NOGA 3MVPA 2MG4A 2ECCA 1E3OC 3CQZJ 4ABZA 2JN6A 1R9TJ 1JTYA 4V2GA 5FLMJ 2WAQN 1GV2A 4A3FJ 1MH4A 4JX5A 1I6HJ 2JMWA 2L7MP 3HM5A 2HXOA 1JUPA 2JK3A 1IV6A 1I50J 3G1OA 2FQ4A 1HF0A 3BR5A 1ORKA 3A01A 3NARA 2JJ7A 3HKZN 4I76A 2JWTA 3ZQLA 5K7HA 3E7LA 3O8GA 4BY1J 2ECBA 3JREA 2EQRA 1MBFA 2VI6A 1TWHJ 1MBKA 1T56A 5JLXA 4W97A 1JJ6C 4A3JJ 3S2DJ 3QPLA 1APLC 2NS7A 2CRGA 2FJ1A 2EZKA 4A3LJ 3TW7A 4FE7A 3S1MJ 1FTZA 5K7FA 1H8AC 5GP9A 1WI3A 4W1UA 2AHQA 2PMZN 4DYCA 1AU7A 1XC5A 1ZR4A 1BW5A 4DW6A 5EGOA 2HI3A 2TRTA 3RKQA 2G0EA 1P7JA 2XPVA 5J1RA 4C3HJ 3ZQCA 1O4XA 1ITYA 1BW6A 1QPIA 4GFBA 1U78A 2XPWA 3GTGJ 3BG3A 3K7AJ 4A3MJ 1ZGWA 1B72A 3OOUA 3ZQGA 3SFIA 2GLOA 2XPUA 4IHXA 3BG9A 4BBSJ 3IH2A 2OF7A 1QVTA 1FIAA 2TCTA 5IP9J 3PO3J 2X6OA 2MSYA 4JX6A 4AC0A 4HNVA 5IOYA 2GBYA 2CUFA 3HOYJ 2FX0A 2JA8J 1GV5A 4X1EA 2NVTJ 3LSJA 5BNGA 1Y1WJ 5E3LA 1IJWC 4L5EA 1H88C 1X2NA 1BL0A 9ANTA 3ZQHA 4DZJA 1VNDA 2R5ZB 1PUFA 2YU9J 3H0GJ 2DMNA 2R0QC 2Y0SN 4IHVA 1YRNA 1U9NA 4B4CA 2R7ZJ 2L0KA 2W48A 1ETQA 5IP6A 1H89C 1WH5A 4RDUA 3CDLA 1CQTA 1WPKA 3Q0VA 4MO7A 4AYBN 1P7IA 2VPRA 3BTCA 1I3QJ 1UG2A 3FKIJ 1JTXA 4UUSA 3S2HJ 2P81A 5EZGA 5C3EJ 5C4XJ 2DTZA 3TP3A 5FJ8J 2FD5A 3D1NI 3QPSA 3GBGA 5DS9A 3BR3A 2XRLA 2HYJA 3Q0UA 1F36A 5FKOA 1GUUA 3RZDJ 1IDYA 1LFBA 1MNMC 2ME6A 5M3FJ 3B6AA 2ID6A 3HOXJ 3FK7A 5F0HA 2EZLA 5F08A 2Y9YA 2K9NA 4BY7J 3JRDA 3C2BA 1VF9A 2LLKA 2LY9A 2YS9A 2DA5A 3A02A 2NVQJ 4XRSA 4EEFG 1X2MA 1AKHA 1UHSA 2H1KA 5M5WJ 4JP0A 2CUEA 5EYRA 1IUFA 2VUMJ 3NAUA 3HOZJ 2K40A 1VI0A 1HLVA 2LKXA 1RR7A 1JUSA 4CYCB 1IGNA 1G2HA 2QF7A 5K7ZA 4MFEA 3GTLJ 3JRFA 2WB1N 4XRSG 2X48A 1JGGA 2YUSA 2M2EA 3LSGA 3QQAA 5EG0B 1NK2P 4BBRJ 1W0UA 2R5YB 2JA5J 2E2JJ 2CQXA 3PO2J 3O8HA 1Z0XA 4D5FA 1GVDA 4JYKA 3WHCA 4FE4A 2GM4A 2EH3A 4JX4A 2XSDC 3JRIA 3TEDA 3HGGA 5IYBJ 3LNQA 1MBGA 2DA2A 1ZR2A 1SFOJ 2LVSA 1W0TA 3RZOJ 1HOMA 4A3IJ 4C3JJ 1A6IA 2JA7J 1ETXA 1MSFC 5F0FA 4QSHA 1LE8B 2KDZA 3GTPJ 3BR2A 2NVYJ 2O7OA 2VKVA 1QRYA 5EZHA 2R92J 4MLOA 3G1MA 2DN0A 2LD5A 2LTPA 4RBOA 4M6VA 4IHYA 3M4OJ 3TP0A 2EBIA 1NK3P 4XK4A 2L7ZA 3GTQJ 3LSPA 3JRHA 3HOUJ 3MN2A 1JKPC 2DJNA 1MH3A 2KT0A 1GT0C 2M0CA 5IPAA 2B63J 1K83J 1RKWA 3S16J 1ZQ3P 1D5YA 4FCYA 1B8IB 1TWCJ 2ZB9A 2HXIA 2CU7A 5GPCA 5IYCJ 2H8RA 1OCTC 5IOZA 1IG7A 3S14J 1BA5A 1DU6A 4A3GJ 1ZK8A 2LK2A 2HQ5A 4XIDA 1ENHA 2DMUA 1RPWA 2XGDA 2E19A 2ELKA 3BR1A 3JRGA 1OJLA 3BQYA 4M3BA 1JJ8C 3IH3A 1IDZA 4M3FA 4A3DJ 2DMTA 2R5ZA 1JT0A 2HOAA 4D5CA 2N8GA 5JLWA 4Y52J 1RETA 5J1UA 4Y7NJ 2MW8A 4A93J 4C3IJ 2K9SA 3OIOA 5E3MA 3SJMA 1JKQC 5F27A 3BR6A 1FEXA 5C44J 5E3NA 5F0CA 5FKLA 2IBDA 3B6CA 1POGA 2OPTA 3TW6A 1HCRA 3PM1A 3BQZA 1MBHA 5FLVA 1MBEA 1JT6A 1FIPA 3HEFA 5J1YA 2LR8A 1MSEC 3I4NJ 1RKTA 3JRAA 2WV1A 2Y2ZA 3WHBA 4A3CJ 3ZQIA 1TWAJ 2CJJA 1ETKA 1ETVA 4IHWA 3OSGA 2LP0A 5M5XJ 4B1RA 4BXXJ 1TC3C 2XGEA 4XRMA 4C2MJ 2E2HJ 2RAEA 1U9OA 3HBLA 3Q0WA 1JKRC 2E2IJ 2Y31A 3RQIA 2X9DA 3IH4A 4S0HB 1RESA 3S1RJ 2LFBA 5GPAA 5M3MJ 5FKNA 4UUTA 2XB0X 3A01B 1ZKGA 1Y1VJ 5EF6A 3JR9A 1A5JA 1WCMJ 2K9QA 4CYCA 3CCYA 4MIMA 3S15J 4AUXA 3GTOJ 4A3EJ 5EDNA 1EF4A 3JRBA 4QTRA 1Z77A 3BTIA 3F0CA 3S1NJ 1MBJA 2IEKA 2XGCA 1TWFJ 3HOWJ 1X58A 5EG0A 1Q1VA 2R93J 1IC8A 3GTKJ 2R5YA 2DMQA 2DA6A 3BT9A 1S7EA 2MGQA 1K61A 1UMQA 4FISA 3HDDA 4M3DA 3ZQFA 1OCPA 3CMYA 3H3VK 2D5VA 1SANA 4A69C 1FJLA 4BKXA 3S17J 5EGOB 2VKEA 3FK6A 1LE8A 4A3BJ 2DA7A 4DZPA 4XICA 3UKGA 2IAIA 2XB5A 2ID3A 5DTDA 2JA6J 2ME0A 2L7FP 2NS8A 5E3OA 3K2AA 4IEJA 4D7NA 2EZIA 2EZHA 1B72B 5F1JA 1XG1A 4M3EA 3A03A 3DCFA 3HB9A 4LOCA 4X6AJ 5EEAA 1T33A 3IV5A 1ETYA 3HOVJ 2Y30A 1B8IA 5FKKA 1WGXA 2E1OA 4D7MA 3BTLA 3FISA 3SDGA 5M5YJ 4FTHA 2M34A 1JKOC 2DA3A 3HGYA 3MKLA 3GTMJ 4G12A 1PUFB 2DA4A 1AHDP 2HOSA 3FIWA 4MFDA 3G1LA 3ZOBA 2HOTA 1HDDC 2HDDA 2QCOA 4NDLA 1NTCA 1ETWA 1VFCA 2O9LA 1FTTA 2AO9A 3Q3SA 5F04A 1YRNB 1ETOA 2O8KA 3I4MJ 5IYDJ 5J3LA 2M8GX 1WH7A 3BR0A 1IRZA 1XS9A 5HODA 1JUMA 3GTJJ 3BG5A 3LOCA 2I10A 1BJZA 1HDPA 2CQQA 4M3GA 4UUSB 4B3AA 1OFCX 3BTJA 5FKMA 4QIWN 3VPRA 3L1PA 3DEWA 1TWGJ 3JRCA 3W6VA 1ZTRA 1LFUP 2L9RA 4V2FA 2M9HA 1GDTA 4DYQA 3M3YJ 1F43A 2NVXJ 2DA1A 4A3KJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DU0 A;  2Y9Z A;  1U8B A;  4J19 A;  4DYR A;  1QVU A;  5C4J J;  3LSR A;  2DMP A;  2COB A;  1AKH B;  3OSF A;  5IP7 J;  3S1Q J;  4I6Z A;  2NOG A;  3MVP A;  2MG4 A;  2ECC A;  1E3O C;  3CQZ J;  4ABZ A;  2JN6 A;  1R9T J;  1JTY A;  4V2G A;  5FLM J;  2WAQ N;  1GV2 A;  4A3F J;  1MH4 A;  4JX5 A;  1I6H J;  2JMW A;  2L7M P;  3HM5 A;  2HXO A;  1JUP A;  2JK3 A;  1IV6 A;  1I50 J;  3G1O A;  2FQ4 A;  1HF0 A;  3BR5 A;  1ORK A;  3A01 A;  3NAR A;  2JJ7 A;  3HKZ N;  4I76 A;  2JWT A;  3ZQL A;  5K7H A;  3E7L A;  3O8G A;  4BY1 J;  2ECB A;  3JRE A;  2EQR A;  1MBF A;  2VI6 A;  1TWH J;  1MBK A;  1T56 A;  5JLX A;  4W97 A;  1JJ6 C;  4A3J J;  3S2D J;  3QPL A;  1APL C;  2NS7 A;  2CRG A;  2FJ1 A;  2EZK A;  4A3L J;  3TW7 A;  4FE7 A;  3S1M J;  1FTZ A;  5K7F A;  1H8A C;  5GP9 A;  1WI3 A;  4W1U A;  2AHQ A;  2PMZ N;  4DYC A;  1AU7 A;  1XC5 A;  1ZR4 A;  1BW5 A;  4DW6 A;  5EGO A;  2HI3 A;  2TRT A;  3RKQ A;  2G0E A;  1P7J A;  2XPV A;  5J1R A;  4C3H J;  3ZQC A;  1O4X A;  1ITY A;  1BW6 A;  1QPI A;  4GFB A;  1U78 A;  2XPW A;  3GTG J;  3BG3 A;  3K7A J;  4A3M J;  1ZGW A;  1B72 A;  3OOU A;  3ZQG A;  3SFI A;  2GLO A;  2XPU A;  4IHX A;  3BG9 A;  4BBS J;  3IH2 A;  2OF7 A;  1QVT A;  1FIA A;  2TCT A;  5IP9 J;  3PO3 J;  2X6O A;  2MSY A;  4JX6 A;  4AC0 A;  4HNV A;  5IOY A;  2GBY A;  2CUF A;  3HOY J;  2FX0 A;  2JA8 J;  1GV5 A;  4X1E A;  2NVT J;  3LSJ A;  5BNG A;  1Y1W J;  5E3L A;  1IJW C;  4L5E A;  1H88 C;  1X2N A;  1BL0 A;  9ANT A;  3ZQH A;  4DZJ A;  1VND A;  2R5Z B;  1PUF A;  2YU9 J;  3H0G J;  2DMN A;  2R0Q C;  2Y0S N;  4IHV A;  1YRN A;  1U9N A;  4B4C A;  2R7Z J;  2L0K A;  2W48 A;  1ETQ A;  5IP6 A;  1H89 C;  1WH5 A;  4RDU A;  3CDL A;  1CQT A;  1WPK A;  3Q0V A;  4MO7 A;  4AYB N;  1P7I A;  2VPR A;  3BTC A;  1I3Q J;  1UG2 A;  3FKI J;  1JTX A;  4UUS A;  3S2H J;  2P81 A;  5EZG A;  5C3E J;  5C4X J;  2DTZ A;  3TP3 A;  5FJ8 J;  2FD5 A;  3D1N I;  3QPS A;  3GBG A;  5DS9 A;  3BR3 A;  2XRL A;  2HYJ A;  3Q0U A;  1F36 A;  5FKO A;  1GUU A;  3RZD J;  1IDY A;  1LFB A;  1MNM C;  2ME6 A;  5M3F J;  3B6A A;  2ID6 A;  3HOX J;  3FK7 A;  5F0H A;  2EZL A;  5F08 A;  2Y9Y A;  2K9N A;  4BY7 J;  3JRD A;  3C2B A;  1VF9 A;  2LLK A;  2LY9 A;  2YS9 A;  2DA5 A;  3A02 A;  2NVQ J;  4XRS A;  4EEF G;  1X2M A;  1AKH A;  1UHS A;  2H1K A;  5M5W J;  4JP0 A;  2CUE A;  5EYR A;  1IUF A;  2VUM J;  3NAU A;  3HOZ J;  2K40 A;  1VI0 A;  1HLV A;  2LKX A;  1RR7 A;  1JUS A;  4CYC B;  1IGN A;  1G2H A;  2QF7 A;  5K7Z A;  4MFE A;  3GTL J;  3JRF A;  2WB1 N;  4XRS G;  2X48 A;  1JGG A;  2YUS A;  2M2E A;  3LSG A;  3QQA A;  5EG0 B;  1NK2 P;  4BBR J;  1W0U A;  2R5Y B;  2JA5 J;  2E2J J;  2CQX A;  3PO2 J;  3O8H A;  1Z0X A;  4D5F A;  1GVD A;  4JYK A;  3WHC A;  4FE4 A;  2GM4 A;  2EH3 A;  4JX4 A;  2XSD C;  3JRI A;  3TED A;  3HGG A;  5IYB J;  3LNQ A;  1MBG A;  2DA2 A;  1ZR2 A;  1SFO J;  2LVS A;  1W0T A;  3RZO J;  1HOM A;  4A3I J;  4C3J J;  1A6I A;  2JA7 J;  1ETX A;  1MSF C;  5F0F A;  4QSH A;  1LE8 B;  2KDZ A;  3GTP J;  3BR2 A;  2NVY J;  2O7O A;  2VKV A;  1QRY A;  5EZH A;  2R92 J;  4MLO A;  3G1M A;  2DN0 A;  2LD5 A;  2LTP A;  4RBO A;  4M6V A;  4IHY A;  3M4O J;  3TP0 A;  2EBI A;  1NK3 P;  4XK4 A;  2L7Z A;  3GTQ J;  3LSP A;  3JRH A;  3HOU J;  3MN2 A;  1JKP C;  2DJN A;  1MH3 A;  2KT0 A;  1GT0 C;  2M0C A;  5IPA A;  2B63 J;  1K83 J;  1RKW A;  3S16 J;  1ZQ3 P;  1D5Y A;  4FCY A;  1B8I B;  1TWC J;  2ZB9 A;  2HXI A;  2CU7 A;  5GPC A;  5IYC J;  2H8R A;  1OCT C;  5IOZ A;  1IG7 A;  3S14 J;  1BA5 A;  1DU6 A;  4A3G J;  1ZK8 A;  2LK2 A;  2HQ5 A;  4XID A;  1ENH A;  2DMU A;  1RPW A;  2XGD A;  2E19 A;  2ELK A;  3BR1 A;  3JRG A;  1OJL A;  3BQY A;  4M3B A;  1JJ8 C;  3IH3 A;  1IDZ A;  4M3F A;  4A3D J;  2DMT A;  2R5Z A;  1JT0 A;  2HOA A;  4D5C A;  2N8G A;  5JLW A;  4Y52 J;  1RET A;  5J1U A;  4Y7N J;  2MW8 A;  4A93 J;  4C3I J;  2K9S A;  3OIO A;  5E3M A;  3SJM A;  1JKQ C;  5F27 A;  3BR6 A;  1FEX A;  5C44 J;  5E3N A;  5F0C A;  5FKL A;  2IBD A;  3B6C A;  1POG A;  2OPT A;  3TW6 A;  1HCR A;  3PM1 A;  3BQZ A;  1MBH A;  5FLV A;  1MBE A;  1JT6 A;  1FIP A;  3HEF A;  5J1Y A;  2LR8 A;  1MSE C;  3I4N J;  1RKT A;  3JRA A;  2WV1 A;  2Y2Z A;  3WHB A;  4A3C J;  3ZQI A;  1TWA J;  2CJJ A;  1ETK A;  1ETV A;  4IHW A;  3OSG A;  2LP0 A;  5M5X J;  4B1R A;  4BXX J;  1TC3 C;  2XGE A;  4XRM A;  4C2M J;  2E2H J;  2RAE A;  1U9O A;  3HBL A;  3Q0W A;  1JKR C;  2E2I J;  2Y31 A;  3RQI A;  2X9D A;  3IH4 A;  4S0H B;  1RES A;  3S1R J;  2LFB A;  5GPA A;  5M3M J;  5FKN A;  4UUT A;  2XB0 X;  3A01 B;  1ZKG A;  1Y1V J;  5EF6 A;  3JR9 A;  1A5J A;  1WCM J;  2K9Q A;  4CYC A;  3CCY A;  4MIM A;  3S15 J;  4AUX A;  3GTO J;  4A3E J;  5EDN A;  1EF4 A;  3JRB A;  4QTR A;  1Z77 A;  3BTI A;  3F0C A;  3S1N J;  1MBJ A;  2IEK A;  2XGC A;  1TWF J;  3HOW J;  1X58 A;  5EG0 A;  1Q1V A;  2R93 J;  1IC8 A;  3GTK J;  2R5Y A;  2DMQ A;  2DA6 A;  3BT9 A;  1S7E A;  2MGQ A;  1K61 A;  1UMQ A;  4FIS A;  3HDD A;  4M3D A;  3ZQF A;  1OCP A;  3CMY A;  3H3V K;  2D5V A;  1SAN A;  4A69 C;  1FJL A;  4BKX A;  3S17 J;  5EGO B;  2VKE A;  3FK6 A;  1LE8 A;  4A3B J;  2DA7 A;  4DZP A;  4XIC A;  3UKG A;  2IAI A;  2XB5 A;  2ID3 A;  5DTD A;  2JA6 J;  2ME0 A;  2L7F P;  2NS8 A;  5E3O A;  3K2A A;  4IEJ A;  4D7N A;  2EZI A;  2EZH A;  1B72 B;  5F1J A;  1XG1 A;  4M3E A;  3A03 A;  3DCF A;  3HB9 A;  4LOC A;  4X6A J;  5EEA A;  1T33 A;  3IV5 A;  1ETY A;  3HOV J;  2Y30 A;  1B8I A;  5FKK A;  1WGX A;  2E1O A;  4D7M A;  3BTL A;  3FIS A;  3SDG A;  5M5Y J;  4FTH A;  2M34 A;  1JKO C;  2DA3 A;  3HGY A;  3MKL A;  3GTM J;  4G12 A;  1PUF B;  2DA4 A;  1AHD P;  2HOS A;  3FIW A;  4MFD A;  3G1L A;  3ZOB A;  2HOT A;  1HDD C;  2HDD A;  2QCO A;  4NDL A;  1NTC A;  1ETW A;  1VFC A;  2O9L A;  1FTT A;  2AO9 A;  3Q3S A;  5F04 A;  1YRN B;  1ETO A;  2O8K A;  3I4M J;  5IYD J;  5J3L A;  2M8G X;  1WH7 A;  3BR0 A;  1IRZ A;  1XS9 A;  5HOD A;  1JUM A;  3GTJ J;  3BG5 A;  3LOC A;  2I10 A;  1BJZ A;  1HDP A;  2CQQ A;  4M3G A;  4UUS B;  4B3A A;  1OFC X;  3BTJ A;  5FKM A;  4QIW N;  3VPR A;  3L1P A;  3DEW A;  1TWG J;  3JRC A;  3W6V A;  1ZTR A;  1LFU P;  2L9R A;  4V2F A;  2M9H A;  1GDT A;  4DYQ A;  3M3Y J;  1F43 A;  2NVX J;  2DA1 A;  4A3K J; 
#chains in the Genus database with same CATH topology
 2H1L A;  1G6N A;  3VOD A;  3GYH X;  4ZJZ A;  3D0S A;  4J19 A;  1R22 A;  2DQL A;  2V9P A;  2ZXW H;  4XR6 A;  2DMP A;  1SVL A;  2CFO A;  2VJ4 A;  1XDU A;  5IP7 J;  2VBZ A;  4XM3 A;  2OD5 A;  1CF7 A;  4FET A;  4ETS A;  2EFN A;  1PUE E;  2CV0 A;  1XB4 A;  3H35 A;  3JTG A;  1J09 A;  4A3F J;  4BDZ A;  2KIQ A;  3LSI A;  4MGR A;  2F48 A;  3PL8 A;  3OWT A;  4JX5 A;  1YIT I;  1I6H J;  3CP2 A;  5CVJ A;  3WU0 A;  4RGR A;  2CFX A;  1IV6 A;  5K5Q A;  5K1Y A;  5L3B A;  2FQ4 A;  1HF0 A;  4NUB A;  3CC7 I;  4NQW A;  3EDP A;  3W2V A;  3HKZ N;  4BAY A;  4M9Z A;  2ETH A;  1F1Z A;  2X51 A;  3AG4 H;  3E7L A;  3L7W A;  4BY1 J;  2ECB A;  3LA3 A;  3CJR B;  2RKH A;  1CGP A;  1IN6 A;  1U5T B;  3GFM A;  4HLY A;  1YO5 C;  3MKZ A;  3S2D J;  3LMM A;  4C2T A;  2VJI A;  4R8H A;  4A5M A;  4U87 A;  4XSZ F;  2WY8 Q;  1YW7 A;  3FDY A;  4DBR A;  2QQ9 A;  2CRG A;  2DYS H;  1U5T A;  2F6C A;  2QKM B;  3U1D A;  4MTD A;  3TO6 A;  1WI3 A;  4XKW A;  3SHF A;  2AHQ A;  1AA7 A;  2VOP A;  2Q2E A;  1K6O A;  1XC5 A;  2PMZ A;  3LST A;  4H4K C;  1DPR A;  1VQO I;  1BW5 A;  4EMS A;  2O8X A;  4DW6 A;  2DDB A;  3I58 A;  3ZQC A;  4OIN F;  1DPU A;  4XOP A;  4G7Z F;  3K4K A;  1ZHF A;  3BG3 A;  3DBR B;  3K9T A;  1WRJ A;  1SD7 A;  3V8J A;  3HJE A;  1B72 A;  3ZQG A;  4OWR B;  2XPU A;  5FLX K;  2EIK H;  2FEZ A;  4QWQ A;  5LD2 C;  2UXN A;  3PO3 J;  3BDD A;  3NEU A;  5CVU A;  1OYY A;  5L3G A;  1VQ7 I;  1TQM A;  2JRT A;  3I3L A;  4XN3 A;  3OS0 A;  2XV4 S;  5IY5 H;  1T95 A;  1Y6I A;  1TNS A;  1IN8 A;  3LSJ A;  4FAS D;  1SAU A;  1QHG A;  1W5S A;  4LD5 A;  1BR4 A;  2AXT C;  1BL0 A;  4A0Y A;  4ZTJ A;  4HG2 A;  1Z7L A;  4DZJ A;  1VND A;  5J4Y A;  2E1N A;  2XAJ A;  5EEH A;  2YU9 J;  1FOX A;  3E6D A;  2M7B A;  2ICW G;  3JSO A;  3H0G J;  2ESN A;  5HDN A;  2ZBK A;  3IRQ A;  3K69 A;  2R0Q C;  1VQL I;  2G7U A;  1IN7 A;  4L9V A;  5L3E A;  2LRD A;  4CSW A;  2Y0S N;  2CG4 A;  2Z9O A;  1IN4 A;  3FXJ A;  1I1S A;  1R5H A;  1UJ8 A;  3RJP A;  1YRN A;  4B4C A;  2R7Z J;  2EIL H;  2FXA A;  2K86 A;  4FHT A;  2P6T A;  2Z2S B;  4HW0 A;  2VOO A;  3HG9 A;  3CDL A;  1XDS A;  3ULQ B;  4UNO A;  4AYB N;  2EK5 A;  5DEQ A;  1DDN A;  1BIA A;  4B3X A;  2MH9 A;  4GYG A;  3S2W A;  2BHY A;  3K10 A;  3I9V 2;  1D1B A;  4BEH A;  5FFX A;  1UHW A;  2OQG A;  5DM6 F;  3TP3 A;  1VQ6 I;  3QPS A;  2GA2 A;  2MD5 A;  1I5Z A;  1R1U A;  4IRG A;  2V4J C;  3A4C A;  2DK5 A;  3Q0U A;  1IDY A;  5HLG A;  2YX4 A;  1YOV B;  2XF7 A;  3KP6 A;  1N77 A;  3B6A A;  4RAF A;  4ASN A;  1B59 A;  3FK7 A;  2M3A A;  3L2C A;  5F08 A;  1BC8 C;  2KHM A;  2QZ8 A;  4BY7 J;  3QRF F;  2LLK A;  3A02 A;  4HNU A;  3MQ0 A;  1X2M A;  2H1K A;  4JP0 A;  1IUF A;  2AXL A;  1J2X A;  3TL4 X;  4XOR A;  2FBI A;  1XGS A;  2K40 A;  1FOW A;  1QZE A;  2MLG A;  4HX7 A;  5FD5 A;  4HQE A;  4MEX F;  1JUS A;  2PFB A;  2K3P A;  3CP8 A;  1IGN A;  2XRN A;  4MFE A;  2CGP A;  1R58 A;  1KZH A;  2WB1 N;  3LA2 A;  5JVG F;  2LH9 A;  1M1E B;  2X48 A;  5ICF A;  1QGP A;  5D8L B;  2M2E A;  3H0D A;  3S3N A;  1ZRC A;  5DM7 F;  3F6O A;  2HWV A;  3PQJ A;  1IUY A;  3CLQ A;  2QYO A;  2R5Y B;  1XTA A;  2QBY B;  5EEG A;  4O6J A;  5LGU A;  2MFZ A;  1X19 A;  2CWE A;  3CTA A;  4JYK A;  4UVA A;  4FE4 A;  4U0Y A;  2XSD C;  3JRI A;  2ZNY A;  2QSG X;  3MEX A;  3DU5 A;  4LJZ F;  3ELK A;  4M6X A;  2DA2 A;  4WXD A;  3AL0 C;  3IC7 A;  4XN0 A;  4BAC A;  2BXY A;  3K1N A;  4A3I J;  4F7Z A;  5F0F A;  4BHB A;  4QSH A;  3W3C A;  3GTP J;  2RVC A;  3OMY A;  3N4M A;  3HOS A;  2QVO A;  5L3D A;  4MLO A;  2W7N A;  3G1M A;  1SD6 A;  1FMV A;  2LTP A;  5DUI A;  4RBO A;  3HUG A;  3W6K B;  1IRG A;  1U0J A;  3CLO A;  5E18 F;  3HRM A;  3LSM A;  5JVT A;  1KQ0 A;  5J4V A;  2B63 J;  4EJW A;  1EA3 A;  1P2F A;  1SD4 A;  2WV0 A;  2WY7 Q;  1S72 I;  5DD8 A;  5B1A H;  4FCY A;  3CMM A;  2ZB9 A;  2OJE D;  3K1P A;  1GVJ A;  3HSE A;  5IOZ A;  2HPM A;  1IG7 A;  4L5J A;  4LK1 F;  3CCQ I;  3CUQ A;  3PIP F;  2H6C A;  2R7D A;  1S5L C;  4Q5S F;  1W36 C;  1DU6 A;  2VT3 A;  4B47 A;  1U6G A;  1LDJ A;  3IKT A;  2LC2 A;  2E19 A;  2A6H F;  3WGI A;  1HSJ A;  2K5C A;  4D0P A;  5D5V B;  1I27 A;  3BQY A;  3OYH A;  3DFG A;  1G3S A;  2BYV E;  4M3B A;  5DDG A;  4A3D J;  2L5Q A;  4NC8 A;  3L00 A;  3PIO F;  3COA C;  4XL9 A;  2R5Z A;  3HIF A;  3KEQ A;  4WWC A;  2OZU A;  4I0B A;  4U0W A;  3K4C A;  2RC4 A;  2HU9 A;  2N8G A;  4KIG A;  2M4K A;  5L3C A;  4Y52 J;  2W1O A;  2IGM A;  3L2R A;  3M1E A;  1STZ A;  1LQ1 A;  1OCO H;  2PJR B;  1ON1 A;  4HOB A;  2HQN A;  3EET A;  1A04 A;  1DUX C;  2XDV A;  3FMS A;  4E6K G;  4BE0 A;  2F5D A;  1Z3X A;  5H6Q A;  4HX8 A;  2WTE A;  4Z2Y A;  5KAI C;  3L09 A;  5E3N A;  1WJE A;  1XPX A;  4RB1 A;  1GLN A;  5LLQ A;  5FKL A;  3LAP A;  1ERD A;  4XBF A;  2IBD A;  3OYF A;  1EJ9 A;  3B6C A;  2OPT A;  3P5J A;  3M8E A;  4C2U A;  4PDK A;  5ILS A;  4BQQ A;  1V54 H;  4IRH A;  4Q47 A;  2GZW A;  1HCR A;  3PM1 A;  1MBH A;  4OOI A;  2W4S A;  2ZME B;  3E5Q A;  2ZO4 A;  5B5E C;  3BG6 A;  1A6Q A;  3HTU A;  3MKY B;  2A68 F;  2MLK A;  2Q8K A;  4ENN A;  3I4N J;  1VQN I;  1RKT A;  1N75 A;  1UZC A;  5TGT A;  1Q1H A;  2P5V A;  1UFM A;  2JPC A;  3WOD F;  2AQF A;  3K4B A;  3FKJ A;  5LEJ A;  2JT1 A;  2LP0 A;  4BXX J;  4XRM A;  2E2H J;  3ASN H;  4F93 B;  4KFC A;  4KMF A;  3M8F A;  3KP4 A;  4OIO F;  1Z6T A;  3R0J A;  1ZRF A;  3O6B B;  2Y31 A;  3ERM A;  3QYF A;  1IW7 F;  2X9D A;  3B73 A;  1RES A;  3GZ5 A;  3IAM 2;  3V7R A;  3S1R J;  3S3O A;  3OL3 A;  1JI8 A;  4HV6 A;  2ADU A;  1Y56 A;  1Y1V J;  1ZKG A;  4CCM A;  1A5J A;  1EH8 A;  1TBX A;  3DF8 A;  1XSV A;  3CF2 A;  3RDI A;  4XMY A;  1N78 A;  4XLN F;  4L18 B;  4BE2 A;  4HAM A;  2CQK A;  4E7I A;  1D1C A;  4B44 A;  2BY3 A;  3H92 A;  3H1C A;  1EF4 A;  3QOD A;  4G6Q A;  1Z77 A;  1DP7 P;  4ENM A;  1X58 A;  4EAT A;  2R93 J;  1P6R A;  2X4H A;  3RYR A;  5LHH A;  1UMQ A;  1IXS B;  1KU9 A;  2L2O A;  2ZJ2 A;  1K4S A;  1OCP A;  4CHU A;  2EV6 A;  1DGW Y;  4A69 C;  3KEY A;  3RI4 A;  4IOA F;  4UV9 A;  4LLN A;  4EGZ A;  1P92 A;  1LE8 A;  2DA7 A;  4KN7 X;  2HEO A;  4XIC A;  4EQQ A;  3DP7 A;  2ID3 A;  3KCC A;  5DTD A;  1FX7 A;  4C9Y A;  1YX5 A;  2A61 A;  4UHT A;  5H2F C;  2OZ6 A;  2A69 F;  4BQN A;  1I6X A;  2DDA A;  1Z9C A;  2FBH A;  1WJ5 A;  3BG7 A;  1FBU A;  3ZMV A;  1K78 A;  3FXR A;  2IS2 A;  3T5X A;  1ETY A;  1B8I A;  4D7M A;  4PSW A;  4LMY A;  2EWN A;  5K5O A;  2KIF A;  3FZV A;  3K0L A;  2DA3 A;  5GAH J;  3J80 Z;  2QSH X;  1WJC A;  3MKL A;  3T1B A;  5F6F A;  1AHD P;  2IA1 A;  1S9H A;  3ZOB A;  4IPA A;  2QCO A;  2FNA A;  4NDL A;  1NTC A;  2X0L A;  3KEO A;  2O8K A;  5IYD J;  5JFR A;  4HEA 2;  1GHC A;  1WH7 A;  2XF6 A;  2VBY A;  3Q9V A;  3ASO H;  5ILU A;  5FRO A;  2K27 A;  4YEJ A;  4HPQ A;  3L2V A;  4UUS B;  3HC7 A;  2FE3 A;  2CUJ A;  2E1M C;  4KYW A;  3KYD B;  5FKM A;  2DOA A;  3S3M A;  1MJA A;  3T8T A;  4IX7 A;  5CQE A;  3L1P A;  3ML6 A;  3OR1 C;  3MFK A;  4WCG A;  4V2F A;  3F6V A;  3M3Y J;  1F43 A;  1LDK B;  5LHG A;  1SD5 A;  4PSX A;  3WTZ A;  1DU0 A;  2Y9Z A;  4KIF A;  1U8B A;  5HDK A;  4DYR A;  3GZ6 A;  3CJN A;  5HLI A;  2UUZ A;  3AL0 B;  2D1V A;  4XSX F;  2COB A;  2KFD A;  2XAQ A;  5AON A;  3GLX A;  3P9C A;  3C1D A;  1R00 A;  4LIV A;  3S1Q J;  4I6Z A;  3FM5 A;  2MG4 A;  2YR2 A;  2ECC A;  4D9J A;  5EJC A;  1E3O C;  3AAF A;  4ABZ A;  5IT9 Z;  2JN6 A;  1R9T J;  2K9M A;  4DOZ A;  3ABU A;  2WAQ N;  3GFJ A;  2FBK A;  3M7G A;  1T6S A;  2GA1 A;  2A5Y B;  4ZYA A;  3CCR I;  3C7J A;  2ELH A;  2L7M P;  5ED4 A;  2HXO A;  2JUC A;  1MMA A;  3LFK A;  4BYY A;  3K70 D;  1I50 J;  3G1O A;  3GXO A;  3CDI A;  2DAO A;  4UVB A;  5A2Q Z;  1OKR A;  3A01 A;  3NAR A;  2VPL A;  1ODD A;  5LGN A;  4I76 A;  3G73 A;  2PEX A;  5K7H A;  3HKZ A;  4RLQ A;  3WTU C;  1BR1 A;  1MDM A;  5D8K B;  3OIQ A;  2VI6 A;  2OQR A;  4HV5 A;  1MBK A;  4II3 A;  1OMI A;  5JLX A;  2P7C B;  3T0Y A;  3H5R A;  4A3J J;  3GVA A;  2V6C A;  3JTH A;  1APL C;  1Z21 A;  2E7X A;  2VJ5 A;  2F5C A;  3FXO A;  2FJ1 A;  1MW7 A;  2EZK A;  3F8F A;  2PMH A;  4A3L J;  3S1M J;  4I99 C;  3FXK A;  2JSP A;  4KMU X;  4W1U A;  3OV8 A;  2ISZ A;  2DJI A;  1PJR A;  1GXP A;  4A2U A;  4YII A;  2HI3 A;  1ITY A;  1P7J A;  2XPV A;  4C3H J;  1LPQ A;  1MGT A;  3SZT A;  2R7R A;  3ECH A;  2ZFW A;  2X6W A;  2XPW A;  3GTG J;  4ESB A;  4ITV A;  3I59 B;  2DFH A;  2E60 A;  3MZ8 A;  3RKW A;  3SYT A;  1FT9 A;  2ZKZ A;  3RPU A;  2J5O A;  1ON2 A;  2GLO A;  4IHX A;  3IH2 A;  2CQN A;  3A2K A;  1T39 A;  2J5P A;  5E1X A;  5HS7 A;  4E7S A;  2X6O A;  3O3K A;  2MSY A;  4JX6 A;  2M87 A;  4AC0 A;  4HBL A;  4HNV A;  5JHU A;  4BS9 A;  3HOY J;  4G6D A;  2JA8 J;  5GTH C;  3ESW B;  1REP C;  2CO5 A;  2R3S A;  1X1D A;  5DCM B;  4IOC F;  1IJW C;  1LVA A;  3QU3 A;  2BW3 A;  1X2N A;  1DP3 A;  2M1B A;  3ZMD A;  1LDD A;  2K3F A;  1PUF A;  3RSN A;  1R23 A;  2LSO A;  5DCM A;  2MYS A;  4CCN A;  2R7Q A;  4Y33 A;  4M9X A;  3OYI A;  2E5N A;  1U9N A;  4XLC A;  4XNF A;  4RAG A;  3HZJ A;  4GCV A;  4ZDP A;  1ETQ A;  3I71 A;  1WH5 A;  1MKM A;  1ZG5 A;  1CQT A;  2QEN A;  3K4L A;  4MO7 A;  2VLA A;  4S04 A;  2BY0 A;  2VPR A;  1WJF A;  4OMZ A;  3BTC A;  4PFP A;  1I3Q J;  4AYB A;  3FKI J;  4Q4Z F;  2FML A;  2RGV A;  1X4P A;  2P81 A;  2OAZ A;  1FSH A;  2RQP A;  4OIP F;  5LGT A;  5C3E J;  5C4X J;  1WWX A;  2DTZ A;  3LA7 A;  3R0A A;  3D1N I;  4DBQ A;  1B4A A;  3FHN A;  2OTJ I;  5GAE J;  2G7H A;  2XRL A;  5DS9 A;  1Y0U A;  2HYJ A;  2DK8 A;  4EJO A;  5KNL A;  2XHK A;  4EM2 A;  3RZD J;  4EM1 A;  1LFB A;  2W84 A;  4AIK A;  5M3F J;  4I02 A;  4Y3O A;  2HVQ A;  1H9T A;  1E2X A;  3FF5 A;  2EZL A;  2E1C A;  3HOT A;  1VF9 A;  4R1H A;  3AFH A;  4EJU A;  3VSL A;  1RI7 A;  4IHS A;  5TRD A;  5M5W J;  1W7P B;  5EYR A;  4RM3 A;  2VC1 A;  4N4N B;  3J81 Z;  4BE1 A;  3NAU A;  4QPO A;  3DTE A;  2LF7 A;  3BCB A;  1BC7 C;  2DOD A;  2EB7 A;  5HOO A;  1RR7 A;  1W7P A;  2KZG A;  3ZR8 X;  4CYC B;  3UR3 C;  4EVI A;  1RUO A;  2QF7 A;  2WAD A;  4RB0 A;  2M5W A;  3SEQ A;  4XRS G;  1SFK A;  2YUS A;  5F1R A;  2ZME C;  1XMK A;  3QQA A;  1TZL A;  4XQF A;  5EG0 B;  3OYJ A;  3FMR A;  4NHJ A;  4ZDL A;  2D1H A;  2BEO A;  3O8H A;  3H36 A;  1GVD A;  3WU1 B;  3WHC A;  2HS5 A;  1VQ9 I;  2LMD A;  2Y0M A;  3MCZ A;  4OU0 A;  3BJ6 A;  1TL8 A;  1U3E M;  2PBI A;  1MBG A;  4Y13 A;  3QWL A;  4UV8 A;  1ZLJ A;  4C3J J;  1A6I A;  1XMX A;  3CZ6 A;  2HYF A;  1MSF C;  4RMN A;  4Z6Y A;  2CYY A;  4ANJ A;  2HVR A;  5DD4 A;  2XAF A;  4XRF A;  1QRY A;  2F5E A;  2Z99 A;  4FT8 A;  4K2E A;  3TDU C;  1U2W A;  1F5T A;  5FGM A;  3TO7 A;  1F9N A;  2VKH A;  4M6V A;  2OTL I;  4IHY A;  4XK4 A;  1XN7 A;  3CCM I;  1RC9 A;  2H09 A;  3GTQ J;  3JRH A;  2VXD A;  1JKP C;  4IKF A;  2DJN A;  2KT0 A;  1UB9 A;  2O5R A;  4KUM A;  2E1M B;  1D5Y A;  1IN5 A;  3E6C C;  2PG4 A;  4HLX A;  2KJC A;  4P96 A;  3CCJ I;  4O5V A;  2CU7 A;  3PNT A;  1QHH D;  3S14 J;  1T38 A;  2O61 A;  4B48 A;  1OCZ H;  4OMY A;  1BA5 A;  3VYU B;  2FMY A;  1W36 D;  3OOP A;  4KIT B;  2QKL B;  2VJJ A;  1ZK8 A;  2HQ5 A;  2KIM A;  3GZN B;  3M07 A;  3J80 K;  2IVM A;  1RPW A;  2NAZ A;  2XGD A;  2KLO A;  2KDO A;  3V8L A;  2HDW A;  3DTI A;  3NWS A;  1IZ1 A;  3RPQ A;  3BZK A;  2OV7 A;  3JRG A;  2JPB A;  3K4J A;  5E20 A;  1IDZ A;  2R7T A;  1O3Q A;  2ZXI A;  1G3Y A;  1KGS A;  3ISP A;  4KT5 C;  4IQJ A;  2HOA A;  2M8E A;  4AVP A;  3S93 A;  2LNB A;  3CJQ B;  4Y17 A;  1X1P A;  4Y7N J;  2E36 A;  4FX0 A;  4C3I J;  3RPU D;  4HRI A;  2K9S A;  2L9V A;  5E3M A;  1MMS A;  4YEL A;  3KP2 A;  2XGX A;  5F27 A;  2DTR A;  4PFO A;  5H6R A;  1HC8 A;  2GXA A;  3HRS A;  5JR3 A;  3IUO A;  1OCC H;  3PFY A;  3TDZ C;  3GO5 A;  3VYR B;  5C44 J;  5F0C A;  1EH6 A;  1UHM A;  2IS1 A;  3FXU A;  4LIU A;  1POG A;  4L9T A;  1KU2 A;  3LL7 A;  3FBN B;  3CES A;  5FLV A;  2BGC A;  3DKW A;  5J47 A;  1JT6 A;  5K5R A;  1ZAO A;  3HEF A;  1MSE C;  3EYI A;  5CVR A;  2HOE A;  4PGH A;  1W1W E;  2MC3 A;  4ZYG A;  1VQP I;  2DW4 A;  2K7L A;  2DLL A;  2YU3 A;  2NS0 A;  2PX9 A;  2KIU A;  5D6E A;  4C30 A;  3ZQI A;  3IP4 B;  3BWG A;  1ETV A;  1S29 A;  2Y75 A;  3OSG A;  2D45 A;  4JBA A;  4B1R A;  2KMU A;  5GAG J;  2R7X A;  5IT9 K;  4GRI A;  2VQL A;  3GME A;  4OAY A;  3Q0W A;  3NWT A;  1J0R A;  2AQE A;  2DI3 A;  2I5U A;  2E2I J;  1E3H A;  3KPH A;  2FNP A;  4E7K A;  2ELJ A;  2EPF A;  4RGX A;  3WGG A;  2L9N A;  1LFP A;  1YW9 A;  2FSW A;  1BI1 A;  2EIM H;  3BCA A;  5AIQ A;  4AUX A;  3OYG A;  4N9H A;  3V7S A;  5FB2 A;  5EDN A;  1ZAR A;  2L4A A;  1BBY A;  1R5G A;  2EIJ H;  3OY9 A;  3JRB A;  3BTI A;  1VQ4 I;  3D5R C;  2OBP A;  2XGC A;  3K6G A;  4ZH4 F;  1I1G A;  2R5Y A;  1USS A;  2DA6 A;  2DMQ A;  4XLE A;  2QBY A;  3CC2 I;  4CCK A;  2HKX A;  1T98 A;  2X85 A;  2XAG A;  3HDD A;  3ZQF A;  1SFX A;  3CMY A;  3H3V K;  1T8I A;  2A05 A;  2W57 A;  1FJL A;  4BKX A;  5LRS A;  5EGO B;  1R1V A;  1W7P D;  3A0H C;  4AWX B;  2B7E A;  1WHU A;  3OYN A;  2IAI A;  2HGC A;  2XB5 A;  2JA6 J;  1PP8 F;  2E5Z A;  1SEU A;  2UXX A;  2LKS A;  3OS1 A;  2BY1 A;  4HYE A;  4IEJ A;  2EZH A;  2RNG A;  2X6Y A;  1QBJ A;  1NH3 A;  4YFX F;  1XG1 A;  3PQK A;  4ZYE A;  3TGN A;  3WTX C;  2DXI A;  3DCF A;  3FHZ A;  2HDC A;  1X1C A;  4EJT A;  4RA2 A;  1ZGJ A;  5D4R A;  4IQ4 A;  3HOV J;  2Y30 A;  2LOO A;  3T8R A;  4ZDO A;  2P4W A;  3BTL A;  3FIS A;  3SDG A;  5M5Y J;  1IXR C;  4FTH A;  3VWB A;  1TQP A;  4J01 A;  1YE9 A;  2M34 A;  2CW8 A;  1D5V A;  2HZT A;  1WSU A;  1HST A;  4DIQ A;  4FQG A;  4CDG A;  2Y48 A;  2KRC A;  4II2 A;  4BNC A;  2A07 F;  2V1D A;  3G3Z A;  1V5E A;  2A5W A;  3FIW A;  3DXJ F;  3G1L A;  4F3Q A;  3WG9 A;  1SAX A;  3ABL H;  2W85 A;  3M9A A;  4JQF A;  1QU3 A;  1ETW A;  2HFH A;  2V26 A;  3GWZ A;  1VFC A;  2DCE A;  2O9L A;  2EJR A;  5CVV A;  1XD7 A;  1S6L A;  2IT0 A;  4GGG A;  3J7Z I;  2L7K A;  4YG2 F;  1HW1 A;  4EM0 B;  1IRZ A;  5HOD A;  5KAF C;  3DPT A;  4O3M A;  1B9N A;  2FOK A;  1R7J A;  2ZXH A;  2K02 A;  2RV8 A;  1FBS A;  2PJR A;  4BH9 A;  1K4T A;  2LBF B;  3P9K A;  2JVG A;  1AWC A;  4HA8 A;  5FO5 A;  3OYK A;  2NVU B;  1OFC X;  3EUH C;  4QIW N;  3WE2 A;  3ECO A;  4Y4R A;  4LLL A;  2XRO A;  1D3Y A;  3L9F A;  2M9H A;  4DGW B;  1GDT A;  4DYQ A;  3ZQQ A;  3VOE A;  3WTY C;  3ZRG A;  2DA1 A;  3E1S A;  4A3K J;  1FC3 A;  2STT A;  2GXB A;  2ZME A;  4KJZ A;  4I0A A;  4ESJ A;  4BJ6 C;  3LSR A;  3DKX A;  1GXQ A;  2ZJR F;  3EUA A;  5ICG A;  1AKH B;  2Z5U A;  2DPU A;  2IJL A;  4WF2 A;  3F23 A;  3MVP A;  5HS8 A;  1RIO H;  3KLN A;  4UB6 C;  3J81 K;  1OIS A;  4LB5 A;  2ZJQ F;  2CS3 A;  4OAZ A;  4P9U A;  4YIR X;  4I7H A;  3DLL F;  2WAQ A;  5E1Z B;  1IRX A;  4DJA A;  1E17 A;  4B43 A;  1LB2 A;  2VQH A;  3SZG A;  4HDV A;  3CCU I;  1ORK A;  4AIH A;  3RKY A;  1FPQ A;  2JWT A;  3ZQL A;  4HF2 A;  2QA4 I;  1P4A A;  1Z7U A;  2Z33 A;  3JRE A;  2EQR A;  1MBF A;  3JSP A;  1HXD A;  1TWH J;  3G4S I;  1T56 A;  3MKW B;  1A35 A;  1JJ6 C;  2P0W A;  3QPL A;  5GTI C;  3CDH A;  5E1W A;  3N05 A;  4HSR A;  2UZK A;  2K85 A;  2IGO A;  5TIS C;  3PSI A;  3C3W A;  5CPR B;  2F4I A;  4U0V A;  5K7F A;  1H8A C;  2KL4 A;  2F5F A;  4QLC U;  3ZP5 A;  3K4N A;  2JTV A;  1OYI A;  4DYC A;  3V8K A;  4UXN A;  1AU7 A;  2XAS A;  1Z91 A;  2TRT A;  4EJV A;  2VE8 A;  2G0E A;  3QOP A;  5J1R A;  1J75 A;  4PJM A;  2P6S A;  2KRH A;  1BW6 A;  1QPI A;  2F5V A;  1U78 A;  2VBX A;  2H94 A;  4A3M J;  1ZGW A;  1X3U A;  2L9S A;  3OOU A;  4I2O A;  3SFI A;  2W00 A;  3BG9 A;  1O3T A;  4BBS J;  2OF7 A;  1QVT A;  4P9F A;  2AS5 F;  4LG3 A;  5IP9 J;  3E5X A;  2M7A A;  4F92 B;  1SVO A;  2V9K A;  2DOF A;  2CUF A;  2E71 A;  3SZP A;  3LSH A;  4LG0 B;  4G7O F;  3F21 A;  2F4M B;  2FX0 A;  1F4K A;  2F4O B;  1GV5 A;  4RM2 A;  3ABK H;  1FZP B;  1YHQ I;  4L5E A;  1H88 C;  2MH2 A;  4H0E A;  1ZRE A;  9ANT A;  2RN7 A;  3OS2 A;  4L9N A;  3VSK A;  3E5U A;  4HST A;  3VYT B;  4M71 A;  1VQK I;  2W24 A;  2DFF A;  1T2K A;  1VQ5 I;  4IHV A;  3DTK A;  2L0K A;  4HNT A;  5IP6 A;  3G71 I;  3TMO A;  1YLF A;  2DT6 A;  1D0Z A;  2IPQ X;  2XIG A;  3BY6 A;  3EPZ A;  4RDU A;  3WU2 C;  2HPI A;  2K4B A;  3HRU A;  2B0L A;  3JCU C;  2TDX A;  3Q0V A;  2HKO A;  1MIJ A;  1P7I A;  2R7V A;  4RGU A;  1HKT A;  1UG2 A;  3WE3 A;  1JTX A;  1MMG A;  4UUS A;  3RKX A;  4A12 A;  2MBF A;  1WZ2 A;  4PJL A;  1Y0N A;  4KT6 A;  1YJN I;  3ZGK A;  1Z05 A;  2JQ7 A;  3BR3 A;  4CZZ A;  2VOD A;  1DQU A;  4RLF A;  3W2W A;  3M8J A;  4NB5 A;  4CGZ A;  2YX7 A;  2Z1D A;  1J59 A;  2O0Y A;  1GUU A;  1FBQ A;  4LIT A;  2UV1 A;  3K4M A;  5FKO A;  3RTR A;  4B09 A;  1YFH A;  4A0X A;  4CUG A;  3HPG A;  3PFI A;  4LFU A;  2ME6 A;  1R36 A;  4KIB A;  4ZYD A;  3VYS B;  1W5C C;  1X3Z B;  5HS9 A;  5F0H A;  2BVL A;  2K9N A;  2Y9Y A;  4YFN F;  3JRD A;  2EA4 A;  4JK1 X;  1FYL A;  2YS9 A;  2NVQ J;  3ZCO A;  1NG6 A;  2HYG D;  3WTV C;  1UHS A;  4F55 A;  2W82 A;  2VUM J;  2CW7 A;  1R71 A;  2IGN A;  1ZG3 A;  2GQQ A;  1R4N B;  3GW2 A;  4S05 A;  3HOZ J;  3GLL A;  3F72 A;  1VI0 A;  1HLV A;  2A6T A;  5FFZ A;  3WTT C;  1ZYR F;  2KRF A;  2CH0 A;  3KX2 A;  2P8T A;  3C18 A;  5FRN A;  1OQY A;  1G4D A;  1BI2 A;  1QO0 D;  5K7Z A;  1G2H A;  1RRJ A;  3HXL A;  4IHT A;  3DEE A;  1QZZ A;  2M4G A;  1YJW I;  4D1Q A;  2E35 A;  2P7V B;  3DKY A;  1NK2 P;  1TLH B;  1Y8Q B;  2JA5 J;  2E2J J;  3U9G A;  1Z0X A;  2VXZ A;  3CUO A;  3ABM H;  2GM4 A;  3A0B C;  4JX4 A;  1YS7 A;  5F64 A;  2KIS A;  2V1X A;  3GFL A;  5LRR A;  3WG7 H;  2H8W A;  4CIC A;  3HGG A;  5IYB J;  2FQ3 A;  2ZNZ A;  4ZTF A;  1ZR2 A;  3HTS B;  2BBY A;  2LVS A;  3MD2 A;  1W0T A;  1UAA A;  4M6Y A;  3WGH A;  3KYC B;  4HQM A;  4ESF A;  5D4S A;  1ETX A;  2IS4 A;  1ACI A;  1MMD A;  1SVM A;  3L2U A;  2KDZ A;  2WWY A;  1TNT A;  2NVY J;  2O7O A;  5ICE A;  3KZZ A;  4KA4 A;  1MNE A;  2R92 J;  1T0F C;  3MZY A;  1G3W A;  1KYW A;  4UUV A;  1BN5 A;  5D5U B;  2LD5 A;  2PI0 A;  4V19 K;  1KQ9 A;  3BJA A;  3TP0 A;  3M4O J;  1NK3 P;  4PJ0 C;  2L7Z A;  3OYE A;  3BLY A;  4M74 A;  3HOU J;  3MN2 A;  3I0T A;  1MH3 A;  3BZ6 A;  1ZN2 A;  2M0C A;  5CJ9 A;  5IPA A;  1GT0 C;  3IWZ A;  4IVN A;  2V79 A;  4BXF A;  3S16 J;  1ZQ3 P;  3ROU A;  3C2H A;  2WBM A;  3DBH B;  3I59 A;  4EV0 A;  2L3D A;  1G8X A;  2GOX B;  2M30 A;  3TO9 A;  5IYC J;  2H8R A;  3U1K A;  2D2W A;  3PNV A;  3GCM A;  3IL2 A;  3QP6 A;  4YFK F;  2K9L A;  3H9G A;  4MQ9 F;  4RB2 C;  4A3G J;  2LK2 A;  2DMU A;  2ELK A;  3BR1 A;  2WC2 A;  3KP7 A;  2WAE A;  3KP5 A;  2FU4 A;  2IGK A;  4E7L A;  5BPI A;  4RAZ A;  1JJ8 C;  2JVH A;  2GWR A;  2HNH A;  3IH3 A;  1OYW A;  3I53 A;  3DEU A;  2Y0S A;  2JUG A;  2HQR A;  4D5C A;  4LK0 F;  5JLW A;  1Z6R A;  4CCJ A;  2NXN B;  3F9K A;  4G9Y A;  1ZLK A;  3SJM A;  1VTN C;  4L0Z B;  3JW4 A;  1R1T A;  3DV8 A;  1QPM A;  4A6D A;  2M0M A;  4BHC A;  3MZH A;  3FBI B;  3L2W A;  1S7A A;  5DCF A;  3D5L A;  1UG0 A;  3TW6 A;  1H0M A;  3MAJ A;  4RGS A;  1OLT A;  3BQZ A;  1HW5 A;  1MBE A;  3SQN A;  3H3U A;  1OR7 C;  2XF5 A;  1FIP A;  2QSF X;  4Q48 A;  5HVQ C;  1FLI A;  3EUK L;  5J1Y A;  1ZRD A;  2LR8 A;  4E7H A;  2HTJ A;  1FP1 D;  2XVC A;  4I01 A;  4EGY A;  1WFX A;  2WV1 A;  2L54 A;  2MC4 A;  2Y2Z A;  3WHB A;  3DPU A;  4XON A;  1CF7 B;  1YX3 A;  3F8N A;  4A3C J;  2Q1Z B;  3V7C A;  3OYB A;  1P9Q C;  4MEY F;  2CJJ A;  2P5L C;  4ON0 A;  4KIC A;  2IA0 A;  2IP2 A;  4X0G A;  1TC3 C;  2XGE A;  3BC8 A;  2RAE A;  3KZY A;  4XKB A;  4DQ2 A;  2DQR A;  3GF2 A;  4PCQ A;  3HBL A;  1JKR C;  1FOY A;  5ILV A;  4AM3 A;  1S3J A;  3IH4 A;  3CCL I;  2LFB A;  2RQQ A;  4ZC3 A;  5GPA A;  4NQW B;  4A6E A;  2PLY A;  4IZZ A;  2P5K A;  4UUT A;  1B9M A;  3O2P E;  5EF6 A;  3JR9 A;  1E3P A;  1I39 A;  3LSK A;  1X4O A;  2WB1 A;  2JSC A;  2K9Q A;  4CYC A;  4E70 A;  2KJB A;  3CCY A;  3U2R A;  3K70 C;  4MIM A;  3S15 J;  2VQC A;  4A3E J;  4AIJ A;  2B9S A;  3ZMS A;  2EA2 A;  3F0C A;  2BXZ A;  2IEK A;  1ZGA A;  2X1E A;  3I5U A;  3HOW J;  4F91 B;  5ERI A;  3QOE A;  1Q1V A;  5EG0 A;  2QGU A;  3OYC A;  1Y8R B;  4XLH A;  1FWZ A;  3KFW X;  4E7Z A;  4ZZL A;  3F3X A;  2VT2 A;  1S7E A;  2MGQ A;  1K61 A;  3LQQ A;  3TQN A;  2R7U A;  4PK4 A;  5E17 F;  1RUN A;  1MJ9 A;  4M3D A;  3BZC A;  1TTY A;  2Q2E B;  3LQR A;  1Y39 A;  3WTW C;  2D5V A;  4PJN A;  1SAN A;  3AG3 H;  5B66 C;  1IAW A;  1KA8 A;  1BOB A;  3GFI A;  3S17 J;  4PZJ A;  1O7F A;  2GAU A;  2VKE A;  3FK6 A;  5ICC A;  1BI0 A;  1SMY F;  5BPD A;  2I8D A;  1D1A A;  2ME0 A;  2L7F P;  2NS8 A;  5E3O A;  4XLF A;  4AD9 A;  1B72 B;  4KN4 X;  2NNN A;  4YIF A;  4IF4 A;  3A03 A;  2UWM A;  1LEB A;  2VQG A;  1VQM I;  4X6A J;  3K1M A;  5JHF A;  5EEA A;  3IV5 A;  2VN2 A;  2E1O A;  3HYI A;  1YYV A;  2FRH A;  3I64 A;  5CVI A;  3BRO A;  3V4G A;  5E8I A;  2HTS A;  3CCS I;  4RAY A;  2ACJ A;  3GTM J;  1YQA A;  2NRA C;  1D8J A;  3GEZ A;  1UST A;  1P4W A;  4G12 A;  5BQT A;  1YTY A;  1XSD A;  1HBX G;  3OYD A;  2DA4 A;  2JRM A;  2CSO A;  1TW3 A;  4MFD A;  2HOT A;  1HDD C;  1VQ8 I;  2HDD A;  3RZO J;  3RCO A;  3AG1 H;  2BHZ A;  4BUP A;  1YRN B;  1ETO A;  3I4M J;  4UB8 C;  3F8C A;  5J3L A;  3AKZ A;  4U7D A;  2VBW A;  5IT3 A;  1TQI A;  3FMQ A;  3GTJ J;  1JE8 A;  2A3S A;  3BG5 A;  4QPQ A;  1YG2 A;  3PJR A;  4JOM A;  2LDU A;  2KQR A;  2H27 A;  1BJZ A;  2CQQ A;  4M3G A;  4PGG A;  3TOB A;  4BEH B;  3R61 A;  3JAM Z;  3BTJ A;  2BVM A;  3L2Q A;  2QUF A;  5TJJ A;  3DEW A;  3JRC A;  3H9J A;  1ZTR A;  3UNG C;  1LFU P;  1G59 A;  1IO2 A;  3W6V A;  1MZB A;  3ZMU A;  2V1U A;  2HR3 A;  3CO6 C;  4NBQ A;  2GIZ A;  1P4X A;  5H20 A;  3QU6 A;  1QVU A;  2EFP A;  3PUF A;  3QPT A;  3REO A;  5C4J J;  3IHU A;  3CCE I;  2QM3 A;  1LJ9 A;  1Z67 A;  2XKP A;  5DV5 A;  1HA8 A;  2NOG A;  4WXH A;  2PN6 A;  3CQZ J;  3SXY A;  2HQA A;  2Q0O A;  4N4O B;  1JTY A;  3E3V A;  4IRI A;  4V2G A;  3FXQ A;  3F8B A;  3SDB A;  4E4H A;  5FLM J;  1GV2 A;  4LLG F;  2O03 A;  4WK8 F;  4XKC A;  3PNY A;  1MH4 A;  2R7S A;  3FM3 A;  2G9W A;  2JMW A;  3HM5 A;  1BIB A;  4WX9 A;  1YS6 A;  4G6T B;  3I4P A;  1JUP A;  5A2Q K;  4R79 A;  5LBQ A;  2JK3 A;  1DGR M;  4HF1 A;  3A1Y A;  3QAH A;  1T0F A;  4J00 A;  3EQL F;  3BR5 A;  3M1C A;  2X1C A;  1X1A A;  2JJ7 A;  4WXC A;  1LNW A;  3BPX A;  3O8G A;  1I3A A;  2XKO A;  1WVR A;  2MAB A;  2K4J A;  4RS8 A;  1YI2 I;  1KON A;  4W97 A;  2EV5 A;  2XSJ C;  4OIQ F;  1WKM A;  3LFU A;  5KVR A;  1UCR A;  2NS7 A;  5CKT A;  2QEX I;  2JA2 A;  3HSF A;  3X2Q H;  2LG4 A;  3E97 A;  3TW7 A;  4FE7 A;  4BJ5 C;  1FTZ A;  2RNJ A;  4BQA A;  2E34 A;  4CZC A;  5GP9 A;  3QYB A;  6PAX A;  2PMZ N;  4IXA A;  1OPC A;  1O3R A;  1ZR4 A;  1XX5 A;  3DWL E;  3HUG B;  2FA5 A;  3G2B A;  2FUG 2;  1B6A A;  3KLO A;  5EGO A;  3RKQ A;  1WJD A;  2ZC2 A;  2JZY A;  1O4X A;  4MTE A;  1YW8 A;  2LRE A;  1FP2 A;  4GDF A;  1W4M A;  4GFB A;  3VB2 A;  2IXS A;  4M9S A;  3J7Y J;  4MQV A;  5HNF A;  1HQC A;  1BI3 A;  3K7A J;  4ZZD A;  2KP6 A;  4M73 A;  2MD0 A;  5BOX A;  4AU7 A;  2OCE A;  2R4G A;  5B3S H;  2IRF G;  3Q5F A;  2R7F A;  1FIA A;  3CUQ B;  3P9I A;  2TCT A;  1E0E A;  3KE2 A;  5IOY A;  4XLP F;  1WI9 A;  2GBY A;  2Z16 A;  5B1B H;  2Z3Y A;  1ZEL A;  4E7J A;  5CQG A;  1TT0 A;  2NVT J;  4X1E A;  3NQO A;  2CW0 F;  3GX4 X;  5BNG A;  1Y1W J;  5E8G A;  5E3L A;  1XGM A;  4P1W A;  4BJT A;  3KP3 A;  3ZQH A;  1OR7 A;  2RDP A;  2R5Z B;  3ZPL A;  1KYZ A;  3PUB A;  2FF4 A;  3E6B A;  4A0Z A;  3BJO A;  2DMN A;  1RNL A;  1YIJ I;  4LB6 B;  1BOA A;  4KDP A;  1PYV A;  3VDX A;  4BQO A;  2EIN H;  2QWW A;  1JXS A;  1K6Y A;  4LGW A;  4BGD A;  2A6E F;  1XCB A;  3HRT A;  5DYM A;  3CD6 I;  4CXF A;  3IAS 2;  2W48 A;  2EFW A;  1LUJ B;  1H89 C;  3B02 A;  2C6Y A;  4KIS A;  2ZJP F;  3CME I;  1WPK A;  2OU2 A;  5D5W B;  5J40 A;  4A5N A;  5J6X A;  1K79 A;  1TP4 A;  5LFA A;  2FOW A;  2LBF A;  3S2H J;  1QA6 A;  5EZG A;  4U88 A;  4G7H F;  4P55 A;  2QQB A;  3DQV C;  5FJ8 J;  2FD5 A;  3GBG A;  2DT7 B;  2DYR H;  1EH7 A;  3CF5 F;  1HKQ A;  1XMA A;  2NYX A;  1F36 A;  1MMN A;  2OUM A;  2GOM A;  3QYE A;  1O7L A;  1MNM C;  1EV7 A;  3G6E I;  1FY7 A;  2ID6 A;  4CH7 A;  2V7F A;  3HOX J;  1NHA A;  3TBI A;  5BS6 A;  4ZYH A;  3OSF A;  3C2B A;  2LY9 A;  2DA5 A;  1FOK A;  4XRS A;  4EEF G;  1AKH A;  3R6S A;  3HL2 A;  2VAS A;  2CUE A;  3CJT B;  3I54 A;  2HZD A;  3MMY B;  3FXL A;  1OCR H;  4AVZ A;  3CCV I;  1LEA A;  3HPH A;  2LKX A;  2ZSI B;  1AOY A;  2X6X A;  4BDY A;  3BP8 A;  2PJP A;  4XKV A;  4NC6 A;  3GTL J;  3JRF A;  4N0B A;  3P7N A;  3QPH A;  2DO7 A;  2F2E A;  4CCL A;  1WQ2 A;  1JGG A;  1N25 A;  2LY1 A;  5JI6 A;  1BJA A;  3LSG A;  4MNU A;  1L3L A;  1ONV A;  3RYP A;  4RB3 C;  1SFU A;  1BM9 A;  4BBR J;  1H9G A;  4U7B A;  1W0U A;  3OR2 C;  3E6M A;  2CQX A;  3PO2 J;  1PDN C;  4D5F A;  5FD6 A;  2CV2 A;  4FX4 A;  2XAH A;  1KU3 A;  2EH3 A;  5DUK A;  3TED A;  2KKO A;  2CV1 A;  1QQI A;  1X3W B;  1FYM A;  3KZI C;  1O57 A;  3LNQ A;  4PUS A;  1SFO J;  4CO8 A;  3DPL C;  1V5G A;  1HOM A;  2JA7 J;  3BPV A;  4Y15 A;  1LE8 B;  4OIR F;  3BR2 A;  1UEL B;  2VKV A;  2MA3 A;  5EZH A;  3ZMT A;  5L3F A;  4HF0 A;  2DN0 A;  3BOQ A;  3HHH A;  2EBI A;  1PVE A;  4CA0 A;  3ZXS A;  3ZN1 A;  2E7W A;  1IRF A;  2VIX A;  3LSP A;  1TW2 A;  3ABT A;  1LVK A;  1KQ8 A;  1K78 B;  3J7A O;  1A36 A;  1K83 J;  1RKW A;  1SFE A;  3EYY A;  3S8P A;  5FLX Z;  3I56 I;  1B8I B;  2VON A;  1TWC J;  5CYV A;  4UY8 I;  1ZH5 A;  1XCV A;  2HXI A;  5GPC A;  3OYL A;  1OCT C;  1WJB A;  1B1B A;  3HSR A;  1V5F A;  3VFZ A;  1K7A A;  1XSX A;  5D5X B;  4I98 B;  2EFQ A;  2XC7 A;  1V3F A;  4M72 A;  3CMA I;  1O3S A;  1FSE A;  1U5T C;  1IF1 A;  4XID A;  1ENH A;  2DFE A;  2ZCW A;  3AG2 H;  4LG0 A;  1R6R A;  1Z3Y A;  2L4M A;  4TV7 A;  3TOA A;  3OYA A;  2LY2 A;  2COM A;  1OJL A;  3E0J B;  3S32 A;  4CCO A;  2XAU A;  4M3F A;  1JGS A;  1ULY A;  2QQA A;  2DMT A;  3VEP A;  3C2G A;  3OIP A;  4ENJ A;  2BZT A;  1JT0 A;  3TKY A;  2ZSH B;  1RZ4 A;  3Q9S A;  4G8X A;  5KHD A;  1D0X A;  1RET A;  5J1U A;  2MW8 A;  3SFZ A;  4A93 J;  2DT5 A;  1FMW A;  3H5A A;  5J8F A;  3OIO A;  4GXO A;  1NG7 A;  2LKP A;  1JKQ C;  2IA2 A;  2VC0 A;  3BR6 A;  1FEX A;  1R5I D;  1WJA A;  2PMU A;  3JAM K;  2CMP A;  4HDU A;  2STW A;  2X1D A;  2LF8 A;  1BR2 A;  2W25 A;  2EFO A;  3RQ4 A;  4XLA A;  5HLH A;  1YIO A;  5GAD J;  4HZF A;  1HKS A;  4DNC A;  3RIR A;  1V4R A;  1W5T A;  1U8R A;  2ZFU A;  2GIV A;  3JRA A;  3KIO A;  3IKV A;  1MND A;  3K2Z A;  4ENK A;  3J7A Y;  4L9J A;  3LWF A;  3R60 A;  1TWA J;  1ETK A;  1KU7 A;  5HDG A;  5M5X J;  4IHW A;  4C2M J;  5J8C A;  3N97 A;  2H6B A;  2DFI A;  3W2A A;  1D8K A;  1U9O A;  2L01 A;  3RQI A;  4BXU A;  4S0H B;  1A31 A;  4L0Y B;  5M3M J;  3KYL A;  5FKN A;  1L0O C;  2VB6 A;  4P5O A;  3A01 B;  2XB0 X;  2EV0 A;  2OCC H;  2PQ8 A;  1WCM J;  4BHP A;  1MDM B;  1SMT A;  2BOL A;  1X1B A;  1VZ0 A;  3GTO J;  2R7W A;  4QTR A;  4G94 A;  3ONQ A;  3S1N J;  2VL8 A;  1D0Y A;  1MBJ A;  1TWF J;  3MWM A;  4YRV A;  2LYC A;  1IC8 A;  3GTK J;  1J9I A;  2ZXJ A;  2ISY A;  3ZN0 A;  2IS6 A;  3BT9 A;  3HHG A;  1QZY A;  3ZQ7 A;  3FX3 A;  1MJB A;  1TT5 B;  3D5S C;  4FIS A;  2DOE A;  2OC6 A;  2BY2 A;  2RRE A;  2VKD A;  3F8M A;  5LEK A;  1XGN A;  1YJ9 I;  1J7K A;  4HX4 A;  2Y69 H;  4IJA A;  2DPD A;  1HW2 A;  5CLS A;  4UVC A;  1Z1D A;  3SEZ A;  2V9V A;  5FRM A;  4A3B J;  1IXC A;  4BU2 A;  2CQ7 A;  3FWE A;  3R4K A;  4DZP A;  2QQ8 A;  2NNY A;  1RR8 C;  3UKG A;  3OL4 A;  3IRR A;  4NC7 A;  5HNH A;  3W6J B;  2O3F A;  4BL0 B;  2BV6 A;  1JHF A;  5KCM A;  3H5N A;  3NRV A;  4IL6 C;  2V1N A;  3K2A A;  4D7N A;  4NNJ A;  2EZI A;  2R7O A;  4L5I A;  3FXM A;  2L02 A;  3PSF A;  5F1J A;  5KK1 A;  3CO7 C;  4M3E A;  1MD0 A;  2YPR A;  3HB9 A;  4LOC A;  3CC4 I;  3H3Z A;  3I55 I;  5D6F A;  1T33 A;  3EUH A;  1FYK A;  4F52 A;  2OA4 A;  5FKK A;  1WGX A;  3ERE D;  1EKE A;  5E79 C;  3U21 A;  1PP7 U;  1J5Y A;  2KPM A;  1JKO C;  2O6G E;  3DU6 A;  2BW3 B;  3HGY A;  1R4M B;  3LAJ A;  4B8X A;  4GYI A;  2KZV A;  1PUF B;  4PJJ A;  2HOS A;  1S8N A;  4I09 A;  3ZMZ A;  2CUZ A;  2NOJ B;  1C0W A;  1XGO A;  1QNT A;  3DLA A;  3H9Q A;  3OYM A;  3V42 A;  3WTS C;  5BMZ A;  3QP5 A;  1JHH A;  2AO9 A;  2BE5 F;  3Q3S A;  4GO1 A;  1FTT A;  1T08 B;  2M45 A;  2XUB A;  2ESH A;  3DBL B;  3IWF A;  5F04 A;  2HVS A;  2M8G X;  5HLT A;  3BR0 A;  5AIP A;  1LKX A;  4IO9 F;  1XS9 A;  4AID A;  4XOT A;  1JUM A;  1V55 H;  4CYD A;  3LOC A;  2I10 A;  2YSR A;  1G3T A;  2DU9 A;  2GXG A;  1ZG1 A;  1FNN A;  4N9I A;  1HDP A;  5LHI A;  1SC7 A;  2QLZ A;  3KET A;  3CUQ C;  4B3A A;  3F22 A;  2V6E A;  3VPR A;  4KNY A;  4MHG A;  1IV8 A;  1TWG J;  1S7O A;  2WA0 A;  2L9R A;  1R49 A;  2IW5 A;  2DBB A;  3GUD A;  2VE9 A;  2NVX J;  2WAF A; 
#chains in the Genus database with same CATH homology
 1DU0 A;  2Y9Z A;  1U8B A;  4J19 A;  4DYR A;  1QVU A;  5C4J J;  3LSR A;  2DMP A;  2COB A;  1AKH B;  3OSF A;  5IP7 J;  3S1Q J;  4I6Z A;  2NOG A;  3MVP A;  2MG4 A;  2ECC A;  1E3O C;  3CQZ J;  4ABZ A;  2JN6 A;  1R9T J;  1JTY A;  4V2G A;  5FLM J;  2WAQ N;  1GV2 A;  4A3F J;  1MH4 A;  4JX5 A;  1I6H J;  2JMW A;  2L7M P;  3HM5 A;  2HXO A;  1JUP A;  2JK3 A;  1IV6 A;  1I50 J;  3G1O A;  2FQ4 A;  1HF0 A;  3BR5 A;  1ORK A;  3A01 A;  3NAR A;  2JJ7 A;  3HKZ N;  4I76 A;  2JWT A;  3ZQL A;  5K7H A;  3E7L A;  3O8G A;  4BY1 J;  2ECB A;  3JRE A;  2EQR A;  1MBF A;  2VI6 A;  1TWH J;  1MBK A;  1T56 A;  5JLX A;  4W97 A;  1JJ6 C;  4A3J J;  3S2D J;  3QPL A;  1APL C;  2NS7 A;  2CRG A;  2FJ1 A;  2EZK A;  4A3L J;  3TW7 A;  4FE7 A;  3S1M J;  1FTZ A;  5K7F A;  1H8A C;  5GP9 A;  1WI3 A;  4W1U A;  2AHQ A;  2PMZ N;  4DYC A;  1AU7 A;  1XC5 A;  1ZR4 A;  1BW5 A;  4DW6 A;  5EGO A;  2HI3 A;  2TRT A;  3RKQ A;  2G0E A;  1P7J A;  2XPV A;  5J1R A;  4C3H J;  3ZQC A;  1O4X A;  1ITY A;  1BW6 A;  1QPI A;  4GFB A;  1U78 A;  2XPW A;  3GTG J;  3BG3 A;  3K7A J;  4A3M J;  1ZGW A;  1B72 A;  3OOU A;  3ZQG A;  3SFI A;  2GLO A;  2XPU A;  4IHX A;  3BG9 A;  4BBS J;  3IH2 A;  2OF7 A;  1QVT A;  1FIA A;  2TCT A;  5IP9 J;  3PO3 J;  2X6O A;  2MSY A;  4JX6 A;  4AC0 A;  4HNV A;  5IOY A;  2GBY A;  2CUF A;  3HOY J;  2FX0 A;  2JA8 J;  1GV5 A;  4X1E A;  2NVT J;  3LSJ A;  5BNG A;  1Y1W J;  5E3L A;  1IJW C;  4L5E A;  1H88 C;  1X2N A;  1BL0 A;  9ANT A;  3ZQH A;  4DZJ A;  1VND A;  2R5Z B;  1PUF A;  2YU9 J;  3H0G J;  2DMN A;  2R0Q C;  2Y0S N;  4IHV A;  1YRN A;  1U9N A;  4B4C A;  2R7Z J;  2L0K A;  2W48 A;  1ETQ A;  5IP6 A;  1H89 C;  1WH5 A;  4RDU A;  3CDL A;  1CQT A;  1WPK A;  3Q0V A;  4MO7 A;  4AYB N;  1P7I A;  2VPR A;  3BTC A;  1I3Q J;  1UG2 A;  3FKI J;  1JTX A;  4UUS A;  3S2H J;  2P81 A;  5EZG A;  5C3E J;  5C4X J;  2DTZ A;  3TP3 A;  5FJ8 J;  2FD5 A;  3D1N I;  3QPS A;  3GBG A;  5DS9 A;  3BR3 A;  2XRL A;  2HYJ A;  3Q0U A;  1F36 A;  5FKO A;  1GUU A;  3RZD J;  1IDY A;  1LFB A;  1MNM C;  2ME6 A;  5M3F J;  3B6A A;  2ID6 A;  3HOX J;  3FK7 A;  5F0H A;  2EZL A;  5F08 A;  2Y9Y A;  2K9N A;  4BY7 J;  3JRD A;  3C2B A;  1VF9 A;  2LLK A;  2LY9 A;  2YS9 A;  2DA5 A;  3A02 A;  2NVQ J;  4XRS A;  4EEF G;  1X2M A;  1AKH A;  1UHS A;  2H1K A;  5M5W J;  4JP0 A;  2CUE A;  5EYR A;  1IUF A;  2VUM J;  3NAU A;  3HOZ J;  2K40 A;  1VI0 A;  1HLV A;  2LKX A;  1RR7 A;  1JUS A;  4CYC B;  1IGN A;  1G2H A;  2QF7 A;  5K7Z A;  4MFE A;  3GTL J;  3JRF A;  2WB1 N;  4XRS G;  2X48 A;  1JGG A;  2YUS A;  2M2E A;  3LSG A;  3QQA A;  5EG0 B;  1NK2 P;  4BBR J;  1W0U A;  2R5Y B;  2JA5 J;  2E2J J;  2CQX A;  3PO2 J;  3O8H A;  1Z0X A;  4D5F A;  1GVD A;  4JYK A;  3WHC A;  4FE4 A;  2GM4 A;  2EH3 A;  4JX4 A;  2XSD C;  3JRI A;  3TED A;  3HGG A;  5IYB J;  3LNQ A;  1MBG A;  2DA2 A;  1ZR2 A;  1SFO J;  2LVS A;  1W0T A;  3RZO J;  1HOM A;  4A3I J;  4C3J J;  1A6I A;  2JA7 J;  1ETX A;  1MSF C;  5F0F A;  4QSH A;  1LE8 B;  2KDZ A;  3GTP J;  3BR2 A;  2NVY J;  2O7O A;  2VKV A;  1QRY A;  5EZH A;  2R92 J;  4MLO A;  3G1M A;  2DN0 A;  2LD5 A;  2LTP A;  4RBO A;  4M6V A;  4IHY A;  3M4O J;  3TP0 A;  2EBI A;  1NK3 P;  4XK4 A;  2L7Z A;  3GTQ J;  3LSP A;  3JRH A;  3HOU J;  3MN2 A;  1JKP C;  2DJN A;  1MH3 A;  2KT0 A;  1GT0 C;  2M0C A;  5IPA A;  2B63 J;  1K83 J;  1RKW A;  3S16 J;  1ZQ3 P;  1D5Y A;  4FCY A;  1B8I B;  1TWC J;  2ZB9 A;  2HXI A;  2CU7 A;  5GPC A;  5IYC J;  2H8R A;  1OCT C;  5IOZ A;  1IG7 A;  3S14 J;  1BA5 A;  1DU6 A;  4A3G J;  1ZK8 A;  2LK2 A;  2HQ5 A;  4XID A;  1ENH A;  2DMU A;  1RPW A;  2XGD A;  2E19 A;  2ELK A;  3BR1 A;  3JRG A;  1OJL A;  3BQY A;  4M3B A;  1JJ8 C;  3IH3 A;  1IDZ A;  4M3F A;  4A3D J;  2DMT A;  2R5Z A;  1JT0 A;  2HOA A;  4D5C A;  2N8G A;  5JLW A;  4Y52 J;  1RET A;  5J1U A;  4Y7N J;  2MW8 A;  4A93 J;  4C3I J;  2K9S A;  3OIO A;  5E3M A;  3SJM A;  1JKQ C;  5F27 A;  3BR6 A;  1FEX A;  5C44 J;  5E3N A;  5F0C A;  5FKL A;  2IBD A;  3B6C A;  1POG A;  2OPT A;  3TW6 A;  1HCR A;  3PM1 A;  3BQZ A;  1MBH A;  5FLV A;  1MBE A;  1JT6 A;  1FIP A;  3HEF A;  5J1Y A;  2LR8 A;  1MSE C;  3I4N J;  1RKT A;  3JRA A;  2WV1 A;  2Y2Z A;  3WHB A;  4A3C J;  3ZQI A;  1TWA J;  2CJJ A;  1ETK A;  1ETV A;  4IHW A;  3OSG A;  2LP0 A;  5M5X J;  4B1R A;  4BXX J;  1TC3 C;  2XGE A;  4XRM A;  4C2M J;  2E2H J;  2RAE A;  1U9O A;  3HBL A;  3Q0W A;  1JKR C;  2E2I J;  2Y31 A;  3RQI A;  2X9D A;  3IH4 A;  4S0H B;  1RES A;  3S1R J;  2LFB A;  5GPA A;  5M3M J;  5FKN A;  4UUT A;  2XB0 X;  3A01 B;  1ZKG A;  1Y1V J;  5EF6 A;  3JR9 A;  1A5J A;  1WCM J;  2K9Q A;  4CYC A;  3CCY A;  4MIM A;  3S15 J;  4AUX A;  3GTO J;  4A3E J;  5EDN A;  1EF4 A;  3JRB A;  4QTR A;  1Z77 A;  3BTI A;  3F0C A;  3S1N J;  1MBJ A;  2IEK A;  2XGC A;  1TWF J;  3HOW J;  1X58 A;  5EG0 A;  1Q1V A;  2R93 J;  1IC8 A;  3GTK J;  2R5Y A;  2DMQ A;  2DA6 A;  3BT9 A;  1S7E A;  2MGQ A;  1K61 A;  1UMQ A;  4FIS A;  3HDD A;  4M3D A;  3ZQF A;  1OCP A;  3CMY A;  3H3V K;  2D5V A;  1SAN A;  4A69 C;  1FJL A;  4BKX A;  3S17 J;  5EGO B;  2VKE A;  3FK6 A;  1LE8 A;  4A3B J;  2DA7 A;  4DZP A;  4XIC A;  3UKG A;  2IAI A;  2XB5 A;  2ID3 A;  5DTD A;  2JA6 J;  2ME0 A;  2L7F P;  2NS8 A;  5E3O A;  3K2A A;  4IEJ A;  4D7N A;  2EZI A;  2EZH A;  1B72 B;  5F1J A;  1XG1 A;  4M3E A;  3A03 A;  3DCF A;  3HB9 A;  4LOC A;  4X6A J;  5EEA A;  1T33 A;  3IV5 A;  1ETY A;  3HOV J;  2Y30 A;  1B8I A;  5FKK A;  1WGX A;  2E1O A;  4D7M A;  3BTL A;  3FIS A;  3SDG A;  5M5Y J;  4FTH A;  2M34 A;  1JKO C;  2DA3 A;  3HGY A;  3MKL A;  3GTM J;  4G12 A;  1PUF B;  2DA4 A;  1AHD P;  2HOS A;  3FIW A;  4MFD A;  3G1L A;  3ZOB A;  2HOT A;  1HDD C;  2HDD A;  2QCO A;  4NDL A;  1NTC A;  1ETW A;  1VFC A;  2O9L A;  1FTT A;  2AO9 A;  3Q3S A;  5F04 A;  1YRN B;  1ETO A;  2O8K A;  3I4M J;  5IYD J;  5J3L A;  2M8G X;  1WH7 A;  3BR0 A;  1IRZ A;  1XS9 A;  5HOD A;  1JUM A;  3GTJ J;  3BG5 A;  3LOC A;  2I10 A;  1BJZ A;  1HDP A;  2CQQ A;  4M3G A;  4UUS B;  4B3A A;  1OFC X;  3BTJ A;  5FKM A;  4QIW N;  3VPR A;  3L1P A;  3DEW A;  1TWG J;  3JRC A;  3W6V A;  1ZTR A;  1LFU P;  2L9R A;  4V2F A;  2M9H A;  1GDT A;  4DYQ A;  3M3Y J;  1F43 A;  2NVX J;  2DA1 A;  4A3K J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...