3J7YJ

Structure of the large ribosomal subunit from human mitochondria
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
GVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
total genus 29
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
J PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3j7yJ02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3j7yJ01
3G6EI 3DLLF 4IO9F 1Y39A 3CCRI 2E34A 5DM7F 1VQMI 1YJ9I 2JQ7A 3EGVB 3CF5F 3G4SI 3CJQB 4IOCF 1VQ8I 1VQKI 1YHQI 2QEXI 3CCJI 1VQOI 3CCMI 3J7YJ 2QA4I 2OTJI 2FOWA 2ZJRF 1YIJI 4IOAF 3G71I 1VQ9I 3CJSB 1ACIA 1VQ4I 3CD6I 3CCSI 5GADJ 1FOWA 1VQLI 3CMEI 1MMSA 3CC2I 1VQ5I 1YJWI 1YI2I 5JVGF 3CJTB 5DM6F 4UY8I 1WIBA 1VQ7I 1QA6A 5GAEJ 3PIOF 4V19K 3CJRB 1FOYA 1YITI 1S72I 3CMAI 5GAHJ 2NXNB 3CCQI 1VQPI 1YJNI 3I55I 3CCEI 3CCUI 2H8WA 1VQ6I 1VQNI 5GAGJ 2OTLI 3CC7I 2E35A 3J7ZI 2ZJQF 2E36A 2ZJPF 3I56I 3CCLI 2K3FA 1HC8A 1FOXA 3PIPF 3CC4I 3CCVI
chains in the Genus database with same CATH superfamily
4EMSA 4CA0A 2WB1N 4L9VA 1XGSA 1LKXA 2XAJA 1HW2A 3BTIA 3UNGC 1YO5C 1UG2A 4BNCA 2DT7B 1XD7A 2KIFA 1JJ8C 4HEA2 3HOTA 2YUSA 3CF5F 1HW1A 3GVAA 4D7MA 1GV2A 1Y1WJ 3HDDA 1ZK8A 1IXRC 2Y31A 2I5UA 1WJBA 3U2RA 4IL6C 3ZQGA 3E5XA 4NUBA 4LG0A 3AG4H 3DPTA 2XF7A 1VQOI 1BI0A 3J7YJ 3DQVC 2VOOA 3S17J 4A5NA 1SFKA 5K5QA 1BI2A 1D8JA 1SMYF 1FTTA 3RJPA 5JR3A 4FTHA 1ETWA 1WJCA 1N78A 3GTJJ 4W1UA 3QPLA 2EV0A 3G1LA 2HOTA 4EGYA 2P0WA 4EGZA 1N75A 2HKXA 4GO1A 1WJ5A 2FF4A 1HBXG 1Z3YA 2PMZA 5FROA 3A01A 3R60A 3CUQB 4PUSA 4E7HA 1OJLA 4QPOA 5BOXA 2NVQJ 2M8GX 1YRNB 3ERED 2P8TA 2RVCA 2VODA 5L3FA 1R4NB 5L3CA 1ON2A 4M9XA 4WK8F 2LMDA 3CLQA 1T0FA 5D4RA 4UUSA 3P9CA 3AL0C 1A04A 2RDPA 1FIAA 5FGMA 5GAHJ 4DBRA 2KPMA 2VXZA 3FXQA 2A5WA 2HYJA 2UXXA 3KZIC 4HQEA 3LAPA 5HDKA 1IUYA 2XPVA 1FBUA 2E7WA 3S1MJ 4CCLA 4BE2A 2BVLA 2VLAA 4NC8A 2YR2A 2XGDA 3J7ZI 4DZPA 1JKOC 1T8IA 1RNLA 3W6KB 1YE9A 2BYVE 4M6XA 3SHFA 2GXGA 4A6EA 2FBIA 2I10A 3V8LA 3ZXSA 1QRYA 1VNDA 3K70C 2FMLA 1LVAA 4MFEA 2K3PA 5LBQA 2QBYA 3TOAA 3DU6A 3SZTA 3ZCOA 1D5YA 2Z9OA 1RETA 4FQGA 5FLXK 2OV7A 4OMZA 2HNHA 3DBRB 2AS5F 4HF0A 2GWRA 1IXSB 2ZO4A 2F4MB 3OYGA 1FTZA 4IO9F 3S3OA 1R6RA 1B1BA 1W1WE 2A61A 1VFCA 3TP3A 4GCVA 3I4PA 1ULYA 3O3KA 1JGGA 3K10A 1ZELA 1H0MA 2O6GE 5ICCA 1TWAJ 4Q48A 4E7IA 3G4SI 5HNFA 4RM2A 2AXLA 1S9HA 1SVLA 1XCVA 1A36A 5LLQA 5HS7A 4HW0A 2PFBA 4AIHA 1ON1A 3M9AA 1WSUA 1EKEA 2QEXI 2DA1A 5GTHC 1D0XA 1G6NA 3F9KA 4BHBA 1JTYA 3JRDA 1A35A 5C4JJ 3KETA 1A31A 3JRHA 4LB6B 3BOQA 1LDJA 3D5RC 2NS0A 1IRFA 3HOSA 1S7OA 3GFLA 2F5DA 4XLAA 4I01A 4E70A 4X6AJ 2OAZA 5KCMA 3IWFA 4CGZA 1IN4A 1ZG1A 4LIVA 2GQQA 3FMQA 4LG0B 2AQEA 3BJAA 5IOZA 3OYCA 1MJBA 3GBGA 3REOA 4EQQA 3WTWC 2EK5A 4BJ5C 1SC7A 2ID3A 2WAEA 3NEUA 3J80K 1GT0C 1IJWC 4HA8A 3TDUC 2I8DA 4RB0A 5F1JA 4IXAA 4MHGA 2MLKA 2CQNA 1Y6IA 2HU9A 4U7DA 4AIKA 4D0PA 3ECHA 3A01B 4GGGA 1O3SA 4NC6A 2FOKA 3OYLA 4J00A 1KQ8A 1XMAA 4AYBN 1Z05A 2ZMEB 5HDNA 4NDLA 1YJNI 1W36C 2XASA 3SZPA 1ETXA 2DA3A 4P55A 1TL8A 3ZQHA 4TV7A 3TDZC 3CLOA 2EPFA 2QENA 1JUPA 3CQZJ 3E1SA 2HQ5A 2MC3A 4UUSB 2QM3A 2OTLI 2W82A 4KT6A 1K79A 2ZFWA 2DODA 2MH9A 2DBBA 5B66C 4Z6YA 4XRMA 2DPDA 2HWVA 5E1WA 5DEQA 3CCLI 4AVZA 1MBEA 4NC7A 3LOCA 4WCGA 1YX5A 4ANJA 2HDWA 3WODF 1F36A 4L9TA 4CYCB 2NVTJ 3IP4B 2O61A 9ANTA 3F8MA 4A3CJ 1DU6A 4PJLA 2R5ZA 2VB6A 1U2WA 5E3NA 4ENKA 1EH6A 3F8CA 2GZWA 1RC9A 1W5CC 3BJOA 2TRTA 3WGHA 4UHTA 4F3QA 4I02A 3MZYA 4DZJA 2E1CA 2ZCWA 3WTVC 4AVPA 3ABMH 1LB2A 2WB1A 1X1DA 2OJED 2X85A 4AD9A 2CW7A 3CJQB 5ILSA 3FXKA 3K2ZA 2FD5A 3I59A 2K86A 3T8TA 5IYCJ 3HJEA 3PM1A 4IOCF 2WADA 3N97A 3VYRB 2DTZA 2O03A 4AUXA 5BS6A 4O6JA 1TQIA 1B59A 4ZYDA 1V54H 1B9NA 1MSFC 2KIUA 3QODA 1T39A 5HOOA 3CCMI 3A02A 1QZYA 5J3LA 5JLXA 3KCCA 4E4HA 2CO5A 1FYKA 5HVQC 1GLNA 2ZJRF 5CVVA 2BE5F 1OCTC 1ZRDA 4FCYA 5IYDJ 3H5RA 1P92A 2FU4A 3PQJA 2IT0A 4BBSJ 3W2WA 2FE3A 5FB2A 2H09A 1IDZA 2CUZA 1QHGA 1OCPA 3C2BA 1W5SA 1YTYA 3EYIA 5IYBJ 1MBJA 1W4MA 2P81A 4PJMA 1X3ZB 3GTQJ 1LVKA 1SAUA 3OYJA 4CCKA 1LQ1A 2DOAA 2ELKA 2ZJ2A 1NHAA 3BR1A 1KZHA 3L2VA 4CZZA 3MKZA 1EV7A 3H35A 1E2XA 2X6OA 4O5VA 4P9FA 3DPLC 3DTIA 4Q4ZF 4KYWA 3HSFA 1JKRC 4BHCA 2QQAA 4HLXA 3AG2H 3K7AJ 3BTJA 4R8HA 1T2KA 2R7UA 2K85A 1G4DA 4PGHA 4B44A 2LDUA 1VQNI 1K6YA 1OQYA 1UB9A 2ISYA 1OFCX 4HNUA 4UV9A 3Q0VA 3A1YA 4B3AA 4BBRJ 2XAGA 1X2MA 4MTDA 3HUGA 2R7RA 2QGUA 5K7ZA 3IHUA 2HOAA 4DYRA 3I4MJ 1OR7C 3DBLB 3ZP5A 3GZ6A 3M07A 1X1AA 4WXDA 4EJVA 2LBFA 2VT2A 5EEAA 1N25A 2EBIA 2BW3A 4KDPA 3JTHA 4HF2A 3BROA 1OKRA 1W0TA 2LY9A 3IH4A 5EG0A 3OYMA 4HNVA 1T98A 1U0JA 1HKTA 2LFBA 1HDPA 3BPVA 3LSMA 3MN2A 2VJJA 4E7JA 4AM3A 2EQRA 1NK2P 3K4NA 5F08A 1H8AC 1YS6A 1RIOH 4A3KJ 2R5ZB 1O3TA 3UKGA 1MNMC 3M3YJ 3MKYB 5CLSA 4IQ4A 5CQEA 3M7GA 1J09A 4LLGF 2W85A 2DK8A 3AL0B 3COAC 1LNWA 1MGTA 4K2EA 4RBOA 4FX4A 2DFEA 1FOKA 2LF7A 1ZTRA 1FBQA 1WI9A 4B47A 1TWCJ 2HTJA 3FWEA 3HC7A 2P5LC 4ZDOA 2P4WA 4M72A 3KFWX 1FY7A 4CH7A 2D5VA 3I59B 5F1RA 5D5WB 2IS2A 2VBZA 3L2WA 4QSHA 2E2HJ 3HRSA 1QZZA 4HQMA 1G3YA 2ZKZA 5EZHA 5GADJ 5IT9K 3GZ5A 1ETVA 2FQ4A 3K4BA 1IV8A 2LSOA 1MMSA 2EFPA 3ZN1A 2L54A 1ZN2A 2XGXA 3KE2A 5DM6F 3Q9SA 2KMUA 5D5UB 3BG5A 4V19K 4D5CA 2EILH 2ZSHB 3MD2A 4N4OB 5FFZA 2EB7A 2KQRA 3MVPA 1ZKGA 3JREA 2LKSA 2W84A 3F21A 1XB4A 4DYCA 3GTOJ 4ZYEA 1FP2A 2JRTA 2NXNB 3BTCA 1ORKA 2EA2A 3ZMSA 3PNYA 3TKYA 2ESHA 4AYBA 3MEXA 1Z91A 1RR8C 1X58A 1WI3A 3PSIA 5KAIC 4PDKA 1BW5A 2E35A 3OL4A 1LEAA 2D1VA 2IBDA 5AIQA 3MZHA 2A05A 2QQ8A 4BKXA 3RPQA 1IUFA 3L9FA 2EZIA 1ETQA 3AFHA 1I3AA 4BQOA 3E6DA 3OYHA 5K7FA 4PK4A 3LNQA 1WKMA 1ZG5A 4J19A 4HAMA 3H3UA 5DCFA 3SFIA 1RZ4A 2XB5A 4XKBA 5FKLA 4OIRF 5EYRA 3TO6A 2STTA 2F5VA 3S3MA 3S15J 3FK7A 1UHSA 4BACA 2XPUA 4H0EA 3HUGB 1MH3A 2VQGA 4IVNA 2LTPA 3FXJA 4RGUA 1P7JA 3K70D 2TDXA 2WV0A 1ZLJA 2DN0A 3KZYA 4HX8A 2LBFB 2IA1A 2BW3B 3OYBA 1J2XA 4MIMA 5D5XB 4S04A 5A2QK 1ZQ3P 3I71A 4PGGA 3TQNA 2ZXWH 5EG0B 5FKOA 1EH7A 2VQCA 2XGEA 4U87A 4L0YB 3QP5A 3E3VA 2M34A 4I09A 4A0XA 1VQ8I 4CO8A 5J1UA 4IPAA 3KEYA 4HSTA 1WJEA 1RKWA 4B09A 2XRNA 1MD0A 1OR7A 3GMEA 4LK1F 2CUEA 2FNAA 2CSOA 1AHDP 2PMHA 1TP4A 2V9PA 4U0WA 3T1BA 1JE8A 3QYFA 3O2PE 2UWMA 3V8JA 1MZBA 3M8FA 3L2RA 2JVHA 3NQOA 4E7ZA 4A3IJ 2XAHA 3VB2A 5LGNA 2X1CA 4YEJA 1GXQA 4G94A 2EIKH 4JX5A 2R7DA 4M6VA 4B8XA 3OYNA 4GYGA 3E6MA 3W6VA 3C7JA 1X2NA 4I98B 4BXXJ 3GTKJ 1UFMA 3DP7A 3GUDA 3WHBA 5LHHA 1ETKA 1YOVB 1I5ZA 3WU2C 1WIBA 2FMYA 4CYDA 3DKXA 2QQBA 3TMOA 2MFZA 3S3NA 2ELJA 5CYVA 1S72I 4KUMA 1HCRA 1G2HA 3NARA 2Q2EA 2OQGA 3G3ZA 2MLGA 3F23A 2F5CA 3T5XA 3B02A 4BEHA 3FXUA 3OL3A 3I5UA 4NNJA 2QSHX 3K4LA 4ZZDA 1J59A 1PVEA 1J75A 3DEWA 2DFIA 3S93A 4DYQA 2NVXJ 2PJRA 2F6CA 4IQJA 2QKLB 2R0QC 2M8EA 4ENMA 2A5YB 2DYRH 5DTDA 4XONA 1QNTA 2HPIA 2IXSA 4AU7A 1IG7A 1Q1VA 1MMAA 2E19A 4OINF 1YW9A 1C0WA 3IV5A 2Q8KA 4E6KG 5IP7J 1W36D 1UAAA 2WAQN 3RQ4A 2R7VA 4RB2C 2IA0A 2AHQA 1YX3A 5J40A 1T95A 3OV8A 1BW6A 4IF4A 1R4MB 1APLC 4EEFG 2ETHA 5BPIA 4D1QA 4A5MA 5HLTA 3R4KA 2DJIA 3G6EI 1VZ0A 3DLLF 2O9LA 4BQQA 2XF5A 3GWZA 4ZYGA 3H92A 4HG2A 2DW4A 5CPRB 3ABTA 2VBXA 2DA7A 2K7LA 2TCTA 1Y0NA 2DMQA 2EZKA 5F0FA 1SFEA 2VBWA 3TW6A 2RKHA 3EETA 4GYIA 2MABA 1W0UA 1HSTA 3A03A 4XKVA 1M1EB 2LG4A 2LH9A 3PUBA 2O8KA 1L3LA 2DAOA 2L9NA 1REPC 1XDUA 2IW5A 4V2FA 2UXNA 5H6RA 1H89C 2Y0SA 4F7ZA 2Z1DA 1PDNC 1X4OA 3AG1H 2VKDA 2R7WA 3R61A 2R5YA 3FHNA 2YU3A 4J01A 5D8LB 1FYMA 3ZN0A 1YIJI 3G71I 4BE1A 3OOUA 2LK2A 3BR6A 2NVYJ 5E20A 3IKVA 2L3DA 1BIBA 5EGOB 1O4XA 5EDNA 2LNBA 4CUGA 4ZDLA 3C18A 1FOWA 3L09A 3K2AA 1K4SA 2K4JA 3TO9A 5FRMA 3K4CA 3VSKA 3JRGA 2LREA 3E97A 3KYCB 3FM5A 1N77A 3JRFA 4OU0A 3JSPA 4F55A 1DUXC 3EYYA 2CS3A 3IAS2 3GO5A 1GHCA 1T6SA 1ZARA 3C2GA 4AC0A 4FETA 1KYWA 2PQ8A 1QQIA 2YX7A 2XV4S 3M4OJ 1P4AA 5CJ9A 3HL2A 3DXJF 4E7LA 4LFUA 4MO7A 1JJ6C 1F43A 3I55I 3ABKH 3AKZA 1KGSA 3K1NA 4G6TB 3OYAA 4CZCA 3N4MA 3BP8A 1B6AA 5M3MJ 4E7KA 2OUMA 2EIMH 1S7AA 1OYWA 1SVMA 2J5PA 1UCRA 1UELB 2IS6A 5EZGA 1TLHB 2QKMB 2Q2EB 4LOCA 5LGUA 2Y2ZA 5HNHA 4MNUA 4YG2F 3EQLF 2Y75A 2JTVA 3TOBA 5HLIA 2K3FA 2DA2A 3S1NJ 4OAZA 3PFIA 2F5FA 2PJRB 1HC8A 5ILUA 3FHZA 1Z3XA 2X4HA 5AIPA 2X6YA 3MKWB 3W3CA 3WGIA 1U9NA 2IRFG 4Y15A 1FNNA 5F6FA 5J4VA 4L18B 3S1RJ 1P6RA 2M5WA 1P7IA 3HOYJ 4IHTA 1ZGJA 1PJRA 3KP3A 3ZMTA 1X1BA 4P1WA 3BY6A 4PFPA 1FWZA 1E0EA 5DUIA 2JUGA 2VQHA 5FO5A 3SEZA 3MFKA 5LHIA 4FT8A 4M3EA 4HDVA 1JT6A 2LD5A 1B72A 5CVIA 4BHPA 5E3LA 3OSGA 3HOXJ 3SFZA 2WY7Q 4XQFA 3HPHA 3C3WA 3MQ0A 2IVMA 4HYEA 2G7HA 4LIUA 4EJOA 5IY5H 2QZ8A 1X1CA 1YHQI 4MQ9F 5GP9A 2EV5A 5HS9A 3HGGA 3ASOH 3LQQA 1CQTA 2DMUA 4ASNA 1ZR4A 3EPZA 3ISPA 3V42A 4YIFA 2HVQA 2PBIA 4RAYA 1J7KA 1STZA 2K4BA 2CQXA 2EZHA 1I27A 2GOMA 4IJAA 1OPCA 2E71A 2WBMA 5GPCA 3OYFA 1I39A 3OMYA 3H0DA 1JT0A 2VKHA 3ZRGA 1VQLI 2VOPA 2MH2A 3J81Z 1AKHA 3F3XA 3D1NI 2ADUA 2HEOA 2VT3A 2EH3A 4OWRB 4HBLA 2JA6J 1J5YA 1V4RA 2ZXIA 1YJWI 1S8NA 1MIJA 2QVOA 4IRIA 3FX3A 3C2HA 3HPGA 4UY8I 1USSA 1ZYRF 4HX4A 3B73A 1LE8A 1KONA 4O3MA 1XPXA 1PYVA 4N9HA 1SD4A 2E1OA 4HDUA 2KJCA 1KQ0A 2XRLA 4HSRA 3PO2J 3QPHA 1L0OC 3CMAI 2OZ6A 3T0YA 4OMYA 1IF1A 4P9UA 2NS8A 1MSEC 3FMRA 4IHYA 3HRTA 3AAFA 1TWFJ 1U5TA 2NOJB 3P9KA 3TW7A 3VYUB 3TP0A 5GTIC 3CCUI 1D1CA 2H8WA 4S0HB 1KYZA 1LFUP 1IZ1A 1MMDA 1VI0A 2M9HA 3H1CA 5HLGA 2R7SA 2J5OA 4JK1X 1BN5A 1IN7A 5DYMA 4G12A 4BY1J 1UHMA 2WY8Q 3LA3A 5AONA 4HX7A 4A69C 4BQNA 4ZTJA 2O5RA 4JOMA 2W7NA 4ZJZA 3BZ6A 1E17A 2WAQA 4LJZF 5M5WJ 3I64A 1QVUA 3JW4A 3LQRA 1WVRA 3QPTA 3SEQA 5DDGA 2KL4A 2VJ5A 2VC0A 3FBNB 3H5AA 4RMNA 1W5TA 3JAMK 3DPUA 3JRCA 2CV1A 2DPUA 3N05A 4DGWB 3HOVJ 2GBYA 2Q0OA 1JI8A 2VPRA 2LR8A 2VBYA 3I58A 3P7NA 4HPQA 2OQRA 2DLLA 2ISZA 3OSFA 2XB0X 4A3DJ 1TW3A 3OYDA 1TTYA 1FIPA 1S7EA 3CO6C 2A3SA 4XN3A 2JQ7A 3I4NJ 1TT5B 2D45A 2HZTA 2OZUA 2VJ4A 5JVTA 5JI6A 1U8RA 1PP8F 4UVCA 2KZGA 2JA5J 1Q1HA 2KLOA 5ICFA 5CVUA 3KP6A 3QYEA 4F52A 1AWCA 1K7AA 2DO7A 4BH9A 2P7CB 1VQKI 1LPQA 1V55H 3HOWJ 2Y9ZA 4XRFA 1B72B 2G0EA 5KK1A 3EUAA 4L9JA 2L7MP 1SEUA 2AO9A 2O8XA 5D6FA 4KMUX 5CQGA 4RAFA 2QBYB 4IHSA 1FJLA 2V79A 1YLFA 2DOFA 3BQYA 3DCFA 4Y52J 3M8JA 3HSRA 1VQ4I 4MEYF 3RDIA 2HVRA 1PUEE 3ZQIA 3HB9A 1GDTA 3LSRA 1AU7A 1P4WA 2E5NA 1TWHJ 4A3FJ 4YFKF 2KRFA 3QOEA 2PLYA 1U8BA 3E0JB 1A6IA 3JR9A 3GLLA 2ELHA 4A3GJ 3K69A 4CCMA 1R5GA 1HXDA 1FZPB 3PIOF 2IJLA 3W6JB 3R0JA 1FOYA 5KHDA 1MNDA 1W7PA 1MNEA 3H9QA 5FLXZ 3DU5A 2BVMA 2HPMA 4DW6A 1HA8A 1AKHB 2KZVA 3WG9A 4DJAA 2R93J 2JMWA 2LLKA 3KIOA 3A2KA 4KFCA 3EUKL 3WTZA 3ZGKA 1A6QA 4EM1A 1Z9CA 1YQAA 5JHUA 5L3DA 3GTLJ 1OYYA 3CC7I 2WTEA 3IL2A 3HBLA 1I3QJ 4D7NA 2KRCA 3SDGA 2XIGA 3OOPA 2DMNA 2EFQA 1U5TB 2JRMA 4PJ0C 4R79A 2X1DA 1R71A 3QU3A 2CJJA 3CDLA 1IRGA 2NNNA 3ABLH 3K6GA 5J8FA 2DFFA 3I9V2 3RZOJ 2PJPA 4P5OA 5JHFA 4U0YA 2BXYA 5D4SA 4QTRA 3X2QH 2JN6A 3RYRA 3KX2A 5M3FJ 5C44J 4HRIA 2RNGA 1KU2A 4NB5A 3HXLA 3KLNA 1BJAA 1BM9A 4Y4RA 3QOPA 2MGQA 1U3EM 3J80Z 3S2DJ 1GUUA 3WTTC 3IKTA 2DDBA 1HF0A 3M1EA 5EEGA 2KP6A 1YFHA 2Y30A 2Y0MA 4KA4A 2X51A 1RR7A 2NAZA 3ZQCA 2IP2A 2OPTA 2KHMA 5EEHA 2IGOA 3IWZA 4ESFA 1ZH5A 1ZLKA 3HOUJ 3MMYB 3ZMDA 4IOAF 3HKZN 4UXNA 2FBHA 3OYEA 4A0YA 3U9GA 3GF2A 2VE9A 1XDSA 4EJUA 3E5QA 4F91B 3F72A 5F64A 2B0LA 4ABZA 3G73A 5M5XJ 2BZTA 2XGCA 4M9SA 2DI3A 2JPCA 4BYYA 1BR2A 2QUFA 4XNFA 1E3OC 4IRGA 3SYTA 1RKTA 1UHWA 2HVSA 2RNJA 1OLTA 4GXOA 4LD5A 2ZSIB 4RA2A 3O6BB 2HOEA 3CJRB 3CTAA 1R58A 3KEOA 3LFKA 1V3FA 1D1AA 1QO0D 2CMPA 3LSIA 3PQKA 3FKJA 2ME0A 3CCQI 1DPUA 4I7HA 2PI0A 1E3PA 4LGWA 2HXIA 1TW2A 4QPQA 3ZQFA 2WV1A 2CW0F 1G3SA 2L4MA 1WJAA 4EM2A 5E79C 2H94A 1Z0XA 4ZYAA 4XLPF 2V9KA 3CDHA 2YSRA 5CKTA 5HLHA 2QSGX 2JA8J 2JZYA 3S2HJ 4C2MJ 2BGCA 2ZJQF 1ENHA 2CFOA 3DF8A 2ZJPF 3K4MA 1F9NA 1FSEA 2MA3A 1WCMJ 2BEOA 2HDDA 4CICA 4AIJA 2V1NA 1MH4A 1IO2A 3K4JA 3KEQA 4M73A 3LWFA 1EJ9A 1Z7UA 2QCOA 4U88A 4PSWA 1K83J 1MW7A 1JHFA 2K02A 1WRJA 2KDZA 4KITB 4ENNA 5FLMJ 2ACJA 2L0KA 2PX9A 2W1OA 4RGRA 3O8HA 1IC8A 1Y8QB 1GVJA 2LP0A 4KISA 2HR3A 4CXFA 1WWXA 2E34A 3ESWB 1P9QC 1R1TA 1U9OA 2M4GA 3FKIJ 4XKWA 1RRJA 2WWYA 2IGNA 2VKEA 2L01A 5B1BH 1BA5A 4Y13A 2XAQA 4DIQA 4FX0A 2PMZN 1GV5A 2HTSA 2JA7J 1SVOA 3V8KA 4NBQA 5FFXA 3DKWA 4FASD 2GM4A 4EM0B 2YS9A 2EJRA 1MBFA 4FE7A 2H8RA 1K78A 4BY7J 5FRNA 1T33A 3PSFA 1POGA 1R9TJ 3LAJA 3VPRA 3RKWA 1Y0UA 1U6GA 1W7PD 2W00A 1XSDA 1R36A 2M7AA 3KP5A 2IEKA 2K5CA 5FKMA 3RPUA 2QWWA 3E6BA 2KKOA 5H20A 2DA5A 4ITVA 2W48A 5ICGA 3S2WA 1KA8A 5L3BA 1LDDA 2MD5A 3IRQA 2ZBKA 3IH3A 3BR5A 1R5HA 2BY2A 3HSEA 3LMMA 1T56A 2OD5A 2EZLA 2HDCA 4NHJA 4X0GA 4Q5SF 3V7RA 2NS7A 3ZOBA 2Y9YA 4LITA 1YITI 3OS1A 2CQ7A 4GFBA 4G8XA 4KIFA 3KYLA 4WWCA 3Q9VA 2FX0A 1XSVA 2M45A 3GXOA 3HTUA 2W25A 2Y69H 4LG3A 4CDGA 3LA7A 1BC7C 3W2AA 1IN5A 3U21A 1HDDC 3ZQ7A 4P96A 5HODA 2F4OB 5J1YA 2NYXA 1KU7A 2KDOA 3PUFA 4LK0F 3BG6A 1OCRH 2LKPA 3GFJA 1TZLA 5IP6A 5BMZA 3WTUC 3LFUA 1LFBA 1IAWA 1JGSA 1V5FA 2VIXA 3VFZA 2E36A 2H1LA 3LL7A 2F2EA 1ODDA 3CZ6A 4MLOA 2ZMEC 3KP4A 2L7FP 2RN7A 4UVAA 5F0CA 4HF1A 3H3VK 1TNSA 2Z16A 2MBFA 1MJAA 2O0YA 4Y33A 3ZMUA 2GOXB 2PEXA 2V6CA 3DTEA 3F8NA 4LLLA 4F93B 3CC4I 1Y1VJ 1BBYA 2HQNA 1T0FC 1IRXA 1FMVA 2NVUB 4XBFA 4RLQA 4OIOF 4N4NB 1IGNA 1LDKB 2X6WA 2O3FA 3QPSA 2PN6A 5F27A 1OCCH 3TEDA 3HIFA 1MBGA 1P2FA 1I1GA 3GFIA 3C1DA 5DD4A 5IT9Z 2L9RA 3FXLA 1G3TA 3BR0A 3BG3A 1IDYA 1VF9A 4MFDA 4XLNF 2OA4A 1WHUA 1YW8A 3H36A 5CVRA 5LGTA 1XMXA 3EGVB 3WE3A 4UNOA 2H27A 5CVJA 2L2OA 2MG4A 4UUVA 4IHXA 4CSWA 4WX9A 1J0RA 5FD6A 2HOSA 3HYIA 3OS2A 1ZGAA 1OYIA 1R22A 4ENJA 2KISA 3FM3A 4WXCA 2RGVA 4HLYA 2ZXJA 1TNTA 3P9IA 2QA4I 2YU9J 1TC3C 1NH3A 4GDFA 2DTRA 1UZCA 2EA4A 3ZQQA 4EV0A 4L5JA 4EVIA 3OS0A 4M3BA 3ASNH 3K4KA 2K27A 3V4GA 2WC2A 2X9DA 3BDDA 2R7XA 5TRDA 3HKZA 1X19A 3EDPA 4PCQA 5FKKA 2XAUA 4C9YA 4IHWA 4DOZA 2V1XA 1G3WA 1FEXA 3CUOA 1WZ2A 3OR2C 5B5EC 5J47A 1ITYA 2YX4A 1B8IA 3BCAA 3ONQA 4H4KC 2OC6A 1XGOA 5FKNA 2VUMJ 1S5LC 4M3FA 1FMWA 2ID6A 3OWTA 4C3IJ 2V7FA 4JYKA 4XKCA 3KPHA 3BR3A 2H1KA 4A93J 4FE4A 1Z6RA 2GAUA 4I0BA 1MJ9A 4RAZA 4JX6A 1JKQC 1XGMA 1TWGJ 2CQKA 4KMFA 2STWA 3HOZJ 1HSJA 2E1MC 5A2QZ 2DDAA 4I2OA 3IRRA 3RIRA 2EIJH 2JK3A 2B63J 3I53A 3K1MA 1TT0A 2XSDC 3A0HC 2KJBA 1Z77A 3FIWA 1ETOA 1XG1A 4KICA 3BLYA 2ECCA 3VDXA 3HM5A 3HG9A 4A3LJ 2KIQA 1I50J 2X0LA 3G1MA 2EINH 2KIMA 3RI4A 2NRAC 3VWBA 3ZPLA 2MSYA 2LF8A 1PUFA 2CUFA 2M3AA 3PJRA 2RV8A 2R3SA 1D3YA 2P5VA 4HV6A 4XORA 3MAJA 1U78A 5BQTA 3F22A 3PO3J 4Y3OA 2KFDA 4MTEA 2BY0A 5L3EA 2JSCA 3FF5A 2PMUA 4IHVA 3U1KA 5E1ZB 5E1XA 1BR1A 2JJ7A 1IRZA 4BEHB 4OIPF 3BCBA 3PL8A 1BOBA 3CMYA 2ICWG 1F1ZA 2VASA 1JTXA 1O3RA 1D5VA 4M9ZA 2OCCH 2JWTA 4BAYA 4MEXF 1G59A 3RPUD 4BDYA 4BDZA 2E60A 2QSFX 3BTLA 2O7OA 3GW2A 4G6DA 5DUKA 1PP7U 1LJ9A 3T8RA 5BNGA 2E5ZA 3HTSB 2ZMEA 4ZTFA 2GIVA 1F5TA 1GVDA 5C4XJ 3TBIA 2Y48A 3VYTB 3R0AA 1E3HA 2HI3A 1LFPA 2DMTA 2K9SA 1BC8C 4XICA 4PJJA 1I6XA 1FC3A 2OU2A 5LEJA 3DKYA 4JQFA 1B9MA 1R1VA 2R7ZJ 2XF6A 3CD6I 3GCMA 4UVBA 4D9JA 2AQFA 5HDGA 1Z7LA 2GIZA 4C2TA 4MGRA 3HRMA 1OCZH 4ZYHA 4KIGA 2RQPA 4BJTA 3BG7A 2N8GA 4L0ZB 4MQVA 3QAHA 2WA0A 4CYCA 2HZDA 1I6HJ 1R1UA 2XKOA 4U7BA 2D1HA 3KP7A 1G8XA 2ME6A 1YI2I 5JVGF 2XKPA 3ZR8X 2HFHA 4ZC3A 2M7BA 2DT6A 1TQPA 3PFYA 3Q3SA 3P5JA 4XM3A 4JX4A 2M1BA 2VKVA 4ZH4F 5LHGA 2JPBA 5H2FC 4HOBA 5LFAA 3FMSA 4NQWA 3ZQLA 1V5GA 2M2EA 4PSXA 4CCJA 4A3MJ 1CF7A 4L5IA 2QYOA 2L02A 4A12A 3E7LA 1B8IB 2F48A 1H88C 4V2GA 3CCEI 1ERDA 3S16J 4M3DA 3TGNA 5JFRA 2R5YB 3LSHA 2CV2A 1VQ6I 3QU6A 3VSLA 3L1PA 2VN2A 3GFMA 5K7HA 3EUHC 4XMYA 2Z3YA 2JA2A 4XOTA 3HEFA 4WF2A 2FRHA 3I56I 4KNYA 4RB3C 4XN0A 1RUNA 1J9IA 1R5ID 3LSKA 3ZMVA 2ZNZA 3GX4X 2GA1A 2K9LA 1LEBA 2ZC2A 2X6XA 5LEKA 2QF7A 4LB5A 4XLCA 4M74A 3F6OA 4EATA 2DOEA 2M30A 3FXRA 5J4YA 1UJ8A 1FP1D 4A0ZA 2A6EF 3JCUC 4FHTA 5GPAA 2VQLA 4RS8A 2COBA 1RUOA 2P6SA 1R49A 2V26A 4XRSG 1MMGA 2HYGD 1VQMI 1TQMA 4B4CA 2DQLA 1PUFB 3FZVA 3B6CA 4QWQA 4C30A 3KLOA 5TGTA 4CCNA 3HGYA 2VE8A 2ZXHA 2D2WA 2M0MA 2CFXA 2ZNYA 4YELA 3JTGA 5FLVA 2L9VA 3JSOA 3I0TA 5E17F 4A2UA 3U1DA 3Q5FA 2DQRA 3VYSB 2CUJA 1WFXA 1O3QA 2MW8A 1RPWA 2RQQA 2RREA 1QGPA 4KIBA 2F5EA 3BT9A 5BPDA 2IGKA 3OYIA 2ZB9A 1XGNA 5D8KB 4L5EA 2HQAA 5LRSA 3QYBA 3S32A 1WPKA 2FXAA 3BZKA 4XL9A 4DNCA 3I3LA 2HQRA 3PNVA 4PFOA 4KJZA 2EWNA 3IC7A 1YG2A 4HZFA 1OMIA 3ABUA 3FDYA 3OIPA 2FNPA 2K9NA 3Q0WA 3BZCA 4ETSA 2MYSA 3CMEI 3NWTA 4G6QA 3MKLA 2HXOA 1DP3A 2G9WA 4RM3A 3WHCA 1FYLA 1JXSA 2BY3A 2R4GA 3BPXA 1VQ7I 2A6HF 2HS5A 4G9YA 2L9SA 4BJ6C 2IGMA 5HS8A 2BY1A 1Z1DA 1SFUA 4OIQF 2A68F 4HNTA 1XMKA 2CW8A 3RKXA 4XRSA 1X3WB 1DGWY 3E5UA 2CRGA 4L9NA 5F04A 3O8GA 1ZAOA 3RYPA 4A6DA 5DCMA 5KAFC 4II2A 2CU7A 3KYDB 3NAUA 1DP7P 3DV8A 4UUTA 3AG3H 3SXYA 2EFWA 3IUOA 4NQWB 5JLWA 3W2VA 1CF7B 1NK3P 2LKXA 5FJ8J 1IN8A 4BQAA 4AWXB 2DA4A 2IPQX 1RESA 2R7OA 1ETYA 1T38A 1S3JA 2CYYA 3S1QJ 2CWEA 3D5LA 4DBQA 1MDMA 1ZREA 1HLVA 2W4SA 1JKPC 3SDBA 1LE8B 3GYHX 1YW7A 5TJJA 2ESNA 5IPAA 1DPRA 3H9JA 3L00A 5DD8A 4S05A 5E3MA 2E7XA 4QIWN 1Y39A 2HGCA 1VTNC 2V1UA 4I0AA 1D0ZA 3OIOA 2VJIA 1V5EA 2VL8A 4B48A 3DBHB 4M3GA 3CMMA 1Y8RB 1AOYA 3QWLA 3ECOA 3DLAA 1HW5A 4JBAA 4RAGA 4B3XA 3EUHA 2DCEA 2OF7A 3H0GJ 5DV5A 3QQAA 1YIOA 2IS1A 3HHHA 3HHGA 1MBKA 5B1AH 5DS9A 2VI6A 4YIIA 2H6CA 2WAFA 4G7HF 3JRBA 1R23A 2E1MB 4A3EJ 3ZMZA 4IEJA 1XS9A 1X3UA 3DEUA 4XLFA 3R6SA 2OTJI 3V7CA 3V7SA 5FD5A 3DWLE 4CHUA 2FOWA 1IV6A 5IOYA 4OAYA 4G7ZF 2P6TA 3BC8A 3S14J 4C2UA 1ZR2A 1R00A 1QHHD 4XSZF 2V6EA 4EJWA 3H3ZA 3CC2I 2XROA 1VQ5I 3K9TA 3L7WA 3FISA 1YS7A 2UZKA 2IAIA 2G7UA 5K5OA 5M5YJ 1QA6A 4Z2YA 1MBHA 2XPWA 3JAMZ 4XLEA 2VXDA 2LOOA 3BQZA 3LSTA 1S29A 1VQPI 3RQIA 3K1PA 4OOIA 4XLHA 1D0YA 1B4AA 1BI3A 1WH5A 2V1DA 3QP6A 5L3GA 3NWSA 2MD0A 1BOAA 2E2IJ 2K9QA 3CESA 5J1RA 2HYFA 3FBIB 1Z67A 5ICEA 1KQ9A 2NOGA 3A0BC 2FA5A 5D6EA 5TISC 3WGGA 4KN4X 1OISA 3L2UA 2OCEA 5F0HA 2ECBA 3NRVA 2EFNA 2LRDA 1FX7A 1WJFA 3ELKA 1A5JA 4XK4A 4IRHA 5DCMB 3JRAA 2GA2A 2R7QA 3PIPF 1RI7A 1K61A 2X48A 2DK5A 3F8BA 4BXFA 2A69F 4RB1A 3CUQC 4UV8A 2JSPA 4DQ2A 3OR1C 1UMQA 2Y0SN 3CP2A 3OY9A 1XC5A 2CG4A 3LSGA 4E7SA 5IP9J 1EF4A 3WG7H 1W7PB 2Q1ZB 2BHYA 2R7FA 4C3HJ 3HZJA 1HKSA 2BOLA 3ML6A 5E18F 3TL4X 2FJ1A 1DGRM 5K5RA 2BBYA 2QLZA 1MDMB 2CGPA 2BXZA 3G2BA 3D0SA 3I54A 2JVGA 1YJ9I 1HKQA 3H5NA 3VEPA 3S8PA 3L2CA 3QRFF 1AA7A 2Z5UA 2DMPA 2XSJC 3CP8A 3DTKA 3RKQA 4JP0A 3UR3C 4XR6A 2F4IA 1HOMA 4G7OF 3CCJI 4BS9A 3J7AO 3WTYC 2LY2A 1BL0A 3RSNA 2LVSA 3WTXC 3CJNA 5K1YA 1VQ9I 1ACIA 1D8KA 2V4JC 2EV6A 5B3SH 2Z33A 1MMNA 2L4AA 4C3JJ 4IKFA 1QPMA 3CO7C 3CCSI 1K6OA 4ON0A 1BJZA 2NNYA 5ED4A 1BIAA 3BWGA 2BHZA 2MC4A 3OIQA 1XCBA 2E2JJ 2W57A 2CV0A 5D5VB 2DYSH 3MWMA 1ZG3A 3GEZA 4N9IA 1HQCA 4I76A 4I99C 4PJNA 5J6XA 2AXTC 4W97A 1SFOJ 2LC2A 1SD6A 1USTA 3HRUA 2Z99A 4UB8C 5GAEJ 1JUMA 2XVCA 4B43A 3WU1B 2VC1A 1XTAA 3FXOA 1YYVA 1F4KA 1CGPA 3SJMA 1SD5A 1QPIA 2XDVA 1H9TA 2KT0A 4AIDA 1WH7A 1Y56A 2JT1A 1R7JA 4IX7A 2W24A 4RLFA 5E3OA 4II3A 4M6YA 1D1BA 2M87A 4UB6C 5ILVA 2R7TA 1EA3A 5GAGJ 4R1HA 5EF6A 3G1OA 4IZZA 1ZRFA 4B1RA 5LRRA 3J7AY 2XHKA 3L2QA 1ZRCA 1QZEA 3BG9A 4F92B 2JUCA 2LY1A 1QBJA 3CDIA 1OCOH 1FOXA 1KU9A 1WJDA 4X1EA 2FEZA 3MCZA 2A07F 4BU2A 4YRVA 5H6QA 3CCVI 2CH0A 5E8IA 3WTSC 5EGOA 2FQ3A 2Z2SB 3RKYA 2VONA 3CCYA 1H9GA 2B9SA 2EFOA 2P5KA 3SZGA 3PNTA 1ZHFA 1IXCA 2OBPA 3CCRI 3ROUA 1MKMA 3CF2A 3VOEA 1SANA 5DM7F 3LA2A 4XOPA 2YPRA 3M1CA 3TO7A 2IS4A 3FK6A 3BR2A 3F6VA 3F0CA 1JHHA 1FBSA 3B6AA 4LLNA 5KNLA 1I1SA 3IH2A 2RAEA 3GLXA 1O57A 2BV6A 3E6CC 2E1NA 1FPQA 1SFXA 4BGDA 2COMA 4U0VA 1XSXA 4BL0B 2UUZA 4QLCU 1O7FA 3KP2A 4A3BJ 4FISA 3JRIA 1ZGWA 3GTPJ 2UV1A 2R92J 3K0LA 2L7ZA 4D5FA 4ZZLA 1NG6A 4YFXF 4RGSA 1WQ2A 2FSWA 1X4PA 3KZZA 4Y7NJ 4Y17A 1QU3A 3CUQA 1ONVA 1XX5A 1NG7A 2VPLA 3CJSB 1DDNA 5LD2C 2P7VB 1K4TA 5EJCA 1GXPA 4GRIA 2M0CA 1YRNA 5J8CA 5IT3A 2XAFA 3FXMA 2GLOA 2X1EA 3RCOA 1DU0A 5C3EJ 2QQ9A 2K40A 1IN6A 3LSPA 4PZJA 1FSHA 1WGXA 4ZDPA 2DU9A 3WU0A 1SAXA 1QVTA 4XIDA 1SD7A 3OYKA 2K9MA 2DXIA 1DQUA 5ERIA 2L7KA 3BJ6A 3CJTB 1FT9A 4EJTA 4YFNF 6PAXA 1FLIA 2C6YA 3Q0UA 4HV5A 1SMTA 2DFHA 1KU3A 3GTGJ 1EH8A 2B7EA 2H6BA 4KT5C 1IW7F 2V9VA 3M8EA 2M4KA 1Z6TA 4WXHA 1XN7A 4Q47A 1BR4A 2FBKA 4A3JJ 1LUJB 2HKOA 3DEEA 4YIRX 3ERMA 2XC7A 1K78B 1T08B 3RTRA 1NTCA 5E8GA 4M71A 3GTMJ 4CCOA 1O7LA 1BI1A 3D5SC 4XSXF 2DT5A 2XUBA 2PG4A 3GZNB 2GXAA 3WE2A 4ESBA 4ESJA 3A4CA 2GXBA 1Z21A 3J81K 2IA2A 1TBXA 3LSJA 4RGXA 4BE0A 2KRHA 2ZFUA 4BUPA 1P4XA 3VODA 2FUG2 2DJNA 4N0BA 4KN7X 1UG0A 2DA6A 2RC4A 5KVRA 2LYCA 3SQNA 4RDUA 1S6LA 1JUSA 3F8FA 3H9GA 3IAM2 3ULQB 3DFGA 3RZDJ 1X1PA 4LMYA 2CQQA 4BXUA 3MZ8A 4I6ZA 1U5TC 2A6TA 2L5QA
chains in the Genus database with same CATH topology
3G6EI 3DLLF 4IO9F 1Y39A 3CCRI 2E34A 5DM7F 1VQMI 1YJ9I 2JQ7A 3EGVB 3CF5F 3G4SI 3CJQB 4IOCF 1VQ8I 1VQKI 1YHQI 2QEXI 3CCJI 1VQOI 3CCMI 3J7YJ 2QA4I 2OTJI 2FOWA 2ZJRF 1YIJI 4IOAF 3G71I 1VQ9I 3CJSB 1ACIA 1VQ4I 3CD6I 3CCSI 5GADJ 1FOWA 1VQLI 3CMEI 1MMSA 3CC2I 1VQ5I 1YJWI 1YI2I 5JVGF 3CJTB 5DM6F 4UY8I 1WIBA 1VQ7I 1QA6A 5GAEJ 3PIOF 4V19K 3CJRB 1FOYA 1YITI 1S72I 3CMAI 5GAHJ 2NXNB 3CCQI 1VQPI 1YJNI 3I55I 3CCEI 3CCUI 2H8WA 1VQ6I 1VQNI 5GAGJ 2OTLI 3CC7I 2E35A 3J7ZI 2ZJQF 2E36A 2ZJPF 3I56I 3CCLI 2K3FA 1HC8A 1FOXA 3PIPF 3CC4I 3CCVI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E I;  3DLL F;  4IO9 F;  1Y39 A;  3CCR I;  2E34 A;  5DM7 F;  1VQM I;  1YJ9 I;  2JQ7 A;  3EGV B;  3CF5 F;  3G4S I;  3CJQ B;  4IOC F;  1VQ8 I;  1VQK I;  1YHQ I;  2QEX I;  3CCJ I;  1VQO I;  3CCM I;  3J7Y J;  2QA4 I;  2OTJ I;  2FOW A;  2ZJR F;  1YIJ I;  4IOA F;  3G71 I;  1VQ9 I;  3CJS B;  1ACI A;  1VQ4 I;  3CD6 I;  3CCS I;  5GAD J;  1FOW A;  1VQL I;  3CME I;  1MMS A;  3CC2 I;  1VQ5 I;  1YJW I;  1YI2 I;  5JVG F;  3CJT B;  5DM6 F;  4UY8 I;  1WIB A;  1VQ7 I;  1QA6 A;  5GAE J;  3PIO F;  4V19 K;  3CJR B;  1FOY A;  1YIT I;  1S72 I;  3CMA I;  5GAH J;  2NXN B;  3CCQ I;  1VQP I;  1YJN I;  3I55 I;  3CCE I;  3CCU I;  2H8W A;  1VQ6 I;  1VQN I;  5GAG J;  2OTL I;  3CC7 I;  2E35 A;  3J7Z I;  2ZJQ F;  2E36 A;  2ZJP F;  3I56 I;  3CCL I;  2K3F A;  1HC8 A;  1FOX A;  3PIP F;  3CC4 I;  3CCV I; 
#chains in the Genus database with same CATH topology
 4EMS A;  4CA0 A;  2WB1 N;  4L9V A;  1XGS A;  1LKX A;  2XAJ A;  1HW2 A;  3BTI A;  3UNG C;  1YO5 C;  1UG2 A;  4BNC A;  2DT7 B;  1XD7 A;  2KIF A;  1JJ8 C;  4HEA 2;  3HOT A;  2YUS A;  3CF5 F;  1HW1 A;  3GVA A;  4D7M A;  1GV2 A;  1Y1W J;  3HDD A;  1ZK8 A;  1IXR C;  2Y31 A;  2I5U A;  1WJB A;  3U2R A;  4IL6 C;  3ZQG A;  3E5X A;  4NUB A;  4LG0 A;  3AG4 H;  3DPT A;  2XF7 A;  1VQO I;  1BI0 A;  3J7Y J;  3DQV C;  2VOO A;  3S17 J;  4A5N A;  1SFK A;  5K5Q A;  1BI2 A;  1D8J A;  1SMY F;  1FTT A;  3RJP A;  5JR3 A;  4FTH A;  1ETW A;  1WJC A;  1N78 A;  3GTJ J;  4W1U A;  3QPL A;  2EV0 A;  3G1L A;  2HOT A;  4EGY A;  2P0W A;  4EGZ A;  1N75 A;  2HKX A;  4GO1 A;  1WJ5 A;  2FF4 A;  1HBX G;  1Z3Y A;  2PMZ A;  5FRO A;  3A01 A;  3R60 A;  3CUQ B;  4PUS A;  4E7H A;  1OJL A;  4QPO A;  5BOX A;  2NVQ J;  2M8G X;  1YRN B;  3ERE D;  2P8T A;  2RVC A;  2VOD A;  5L3F A;  1R4N B;  5L3C A;  1ON2 A;  4M9X A;  4WK8 F;  2LMD A;  3CLQ A;  1T0F A;  5D4R A;  4UUS A;  3P9C A;  3AL0 C;  1A04 A;  2RDP A;  1FIA A;  5FGM A;  5GAH J;  4DBR A;  2KPM A;  2VXZ A;  3FXQ A;  2A5W A;  2HYJ A;  2UXX A;  3KZI C;  4HQE A;  3LAP A;  5HDK A;  1IUY A;  2XPV A;  1FBU A;  2E7W A;  3S1M J;  4CCL A;  4BE2 A;  2BVL A;  2VLA A;  4NC8 A;  2YR2 A;  2XGD A;  3J7Z I;  4DZP A;  1JKO C;  1T8I A;  1RNL A;  3W6K B;  1YE9 A;  2BYV E;  4M6X A;  3SHF A;  2GXG A;  4A6E A;  2FBI A;  2I10 A;  3V8L A;  3ZXS A;  1QRY A;  1VND A;  3K70 C;  2FML A;  1LVA A;  4MFE A;  2K3P A;  5LBQ A;  2QBY A;  3TOA A;  3DU6 A;  3SZT A;  3ZCO A;  1D5Y A;  2Z9O A;  1RET A;  4FQG A;  5FLX K;  2OV7 A;  4OMZ A;  2HNH A;  3DBR B;  2AS5 F;  4HF0 A;  2GWR A;  1IXS B;  2ZO4 A;  2F4M B;  3OYG A;  1FTZ A;  4IO9 F;  3S3O A;  1R6R A;  1B1B A;  1W1W E;  2A61 A;  1VFC A;  3TP3 A;  4GCV A;  3I4P A;  1ULY A;  3O3K A;  1JGG A;  3K10 A;  1ZEL A;  1H0M A;  2O6G E;  5ICC A;  1TWA J;  4Q48 A;  4E7I A;  3G4S I;  5HNF A;  4RM2 A;  2AXL A;  1S9H A;  1SVL A;  1XCV A;  1A36 A;  5LLQ A;  5HS7 A;  4HW0 A;  2PFB A;  4AIH A;  1ON1 A;  3M9A A;  1WSU A;  1EKE A;  2QEX I;  2DA1 A;  5GTH C;  1D0X A;  1G6N A;  3F9K A;  4BHB A;  1JTY A;  3JRD A;  1A35 A;  5C4J J;  3KET A;  1A31 A;  3JRH A;  4LB6 B;  3BOQ A;  1LDJ A;  3D5R C;  2NS0 A;  1IRF A;  3HOS A;  1S7O A;  3GFL A;  2F5D A;  4XLA A;  4I01 A;  4E70 A;  4X6A J;  2OAZ A;  5KCM A;  3IWF A;  4CGZ A;  1IN4 A;  1ZG1 A;  4LIV A;  2GQQ A;  3FMQ A;  4LG0 B;  2AQE A;  3BJA A;  5IOZ A;  3OYC A;  1MJB A;  3GBG A;  3REO A;  4EQQ A;  3WTW C;  2EK5 A;  4BJ5 C;  1SC7 A;  2ID3 A;  2WAE A;  3NEU A;  3J80 K;  1GT0 C;  1IJW C;  4HA8 A;  3TDU C;  2I8D A;  4RB0 A;  5F1J A;  4IXA A;  4MHG A;  2MLK A;  2CQN A;  1Y6I A;  2HU9 A;  4U7D A;  4AIK A;  4D0P A;  3ECH A;  3A01 B;  4GGG A;  1O3S A;  4NC6 A;  2FOK A;  3OYL A;  4J00 A;  1KQ8 A;  1XMA A;  4AYB N;  1Z05 A;  2ZME B;  5HDN A;  4NDL A;  1YJN I;  1W36 C;  2XAS A;  3SZP A;  1ETX A;  2DA3 A;  4P55 A;  1TL8 A;  3ZQH A;  4TV7 A;  3TDZ C;  3CLO A;  2EPF A;  2QEN A;  1JUP A;  3CQZ J;  3E1S A;  2HQ5 A;  2MC3 A;  4UUS B;  2QM3 A;  2OTL I;  2W82 A;  4KT6 A;  1K79 A;  2ZFW A;  2DOD A;  2MH9 A;  2DBB A;  5B66 C;  4Z6Y A;  4XRM A;  2DPD A;  2HWV A;  5E1W A;  5DEQ A;  3CCL I;  4AVZ A;  1MBE A;  4NC7 A;  3LOC A;  4WCG A;  1YX5 A;  4ANJ A;  2HDW A;  3WOD F;  1F36 A;  4L9T A;  4CYC B;  2NVT J;  3IP4 B;  2O61 A;  9ANT A;  3F8M A;  4A3C J;  1DU6 A;  4PJL A;  2R5Z A;  2VB6 A;  1U2W A;  5E3N A;  4ENK A;  1EH6 A;  3F8C A;  2GZW A;  1RC9 A;  1W5C C;  3BJO A;  2TRT A;  3WGH A;  4UHT A;  4F3Q A;  4I02 A;  3MZY A;  4DZJ A;  2E1C A;  2ZCW A;  3WTV C;  4AVP A;  3ABM H;  1LB2 A;  2WB1 A;  1X1D A;  2OJE D;  2X85 A;  4AD9 A;  2CW7 A;  3CJQ B;  5ILS A;  3FXK A;  3K2Z A;  2FD5 A;  3I59 A;  2K86 A;  3T8T A;  5IYC J;  3HJE A;  3PM1 A;  4IOC F;  2WAD A;  3N97 A;  3VYR B;  2DTZ A;  2O03 A;  4AUX A;  5BS6 A;  4O6J A;  1TQI A;  1B59 A;  4ZYD A;  1V54 H;  1B9N A;  1MSF C;  2KIU A;  3QOD A;  1T39 A;  5HOO A;  3CCM I;  3A02 A;  1QZY A;  5J3L A;  5JLX A;  3KCC A;  4E4H A;  2CO5 A;  1FYK A;  5HVQ C;  1GLN A;  2ZJR F;  5CVV A;  2BE5 F;  1OCT C;  1ZRD A;  4FCY A;  5IYD J;  3H5R A;  1P92 A;  2FU4 A;  3PQJ A;  2IT0 A;  4BBS J;  3W2W A;  2FE3 A;  5FB2 A;  2H09 A;  1IDZ A;  2CUZ A;  1QHG A;  1OCP A;  3C2B A;  1W5S A;  1YTY A;  3EYI A;  5IYB J;  1MBJ A;  1W4M A;  2P81 A;  4PJM A;  1X3Z B;  3GTQ J;  1LVK A;  1SAU A;  3OYJ A;  4CCK A;  1LQ1 A;  2DOA A;  2ELK A;  2ZJ2 A;  1NHA A;  3BR1 A;  1KZH A;  3L2V A;  4CZZ A;  3MKZ A;  1EV7 A;  3H35 A;  1E2X A;  2X6O A;  4O5V A;  4P9F A;  3DPL C;  3DTI A;  4Q4Z F;  4KYW A;  3HSF A;  1JKR C;  4BHC A;  2QQA A;  4HLX A;  3AG2 H;  3K7A J;  3BTJ A;  4R8H A;  1T2K A;  2R7U A;  2K85 A;  1G4D A;  4PGH A;  4B44 A;  2LDU A;  1VQN I;  1K6Y A;  1OQY A;  1UB9 A;  2ISY A;  1OFC X;  4HNU A;  4UV9 A;  3Q0V A;  3A1Y A;  4B3A A;  4BBR J;  2XAG A;  1X2M A;  4MTD A;  3HUG A;  2R7R A;  2QGU A;  5K7Z A;  3IHU A;  2HOA A;  4DYR A;  3I4M J;  1OR7 C;  3DBL B;  3ZP5 A;  3GZ6 A;  3M07 A;  1X1A A;  4WXD A;  4EJV A;  2LBF A;  2VT2 A;  5EEA A;  1N25 A;  2EBI A;  2BW3 A;  4KDP A;  3JTH A;  4HF2 A;  3BRO A;  1OKR A;  1W0T A;  2LY9 A;  3IH4 A;  5EG0 A;  3OYM A;  4HNV A;  1T98 A;  1U0J A;  1HKT A;  2LFB A;  1HDP A;  3BPV A;  3LSM A;  3MN2 A;  2VJJ A;  4E7J A;  4AM3 A;  2EQR A;  1NK2 P;  3K4N A;  5F08 A;  1H8A C;  1YS6 A;  1RIO H;  4A3K J;  2R5Z B;  1O3T A;  3UKG A;  1MNM C;  3M3Y J;  3MKY B;  5CLS A;  4IQ4 A;  5CQE A;  3M7G A;  1J09 A;  4LLG F;  2W85 A;  2DK8 A;  3AL0 B;  3COA C;  1LNW A;  1MGT A;  4K2E A;  4RBO A;  4FX4 A;  2DFE A;  1FOK A;  2LF7 A;  1ZTR A;  1FBQ A;  1WI9 A;  4B47 A;  1TWC J;  2HTJ A;  3FWE A;  3HC7 A;  2P5L C;  4ZDO A;  2P4W A;  4M72 A;  3KFW X;  1FY7 A;  4CH7 A;  2D5V A;  3I59 B;  5F1R A;  5D5W B;  2IS2 A;  2VBZ A;  3L2W A;  4QSH A;  2E2H J;  3HRS A;  1QZZ A;  4HQM A;  1G3Y A;  2ZKZ A;  5EZH A;  5GAD J;  5IT9 K;  3GZ5 A;  1ETV A;  2FQ4 A;  3K4B A;  1IV8 A;  2LSO A;  1MMS A;  2EFP A;  3ZN1 A;  2L54 A;  1ZN2 A;  2XGX A;  3KE2 A;  5DM6 F;  3Q9S A;  2KMU A;  5D5U B;  3BG5 A;  4V19 K;  4D5C A;  2EIL H;  2ZSH B;  3MD2 A;  4N4O B;  5FFZ A;  2EB7 A;  2KQR A;  3MVP A;  1ZKG A;  3JRE A;  2LKS A;  2W84 A;  3F21 A;  1XB4 A;  4DYC A;  3GTO J;  4ZYE A;  1FP2 A;  2JRT A;  2NXN B;  3BTC A;  1ORK A;  2EA2 A;  3ZMS A;  3PNY A;  3TKY A;  2ESH A;  4AYB A;  3MEX A;  1Z91 A;  1RR8 C;  1X58 A;  1WI3 A;  3PSI A;  5KAI C;  4PDK A;  1BW5 A;  2E35 A;  3OL4 A;  1LEA A;  2D1V A;  2IBD A;  5AIQ A;  3MZH A;  2A05 A;  2QQ8 A;  4BKX A;  3RPQ A;  1IUF A;  3L9F A;  2EZI A;  1ETQ A;  3AFH A;  1I3A A;  4BQO A;  3E6D A;  3OYH A;  5K7F A;  4PK4 A;  3LNQ A;  1WKM A;  1ZG5 A;  4J19 A;  4HAM A;  3H3U A;  5DCF A;  3SFI A;  1RZ4 A;  2XB5 A;  4XKB A;  5FKL A;  4OIR F;  5EYR A;  3TO6 A;  2STT A;  2F5V A;  3S3M A;  3S15 J;  3FK7 A;  1UHS A;  4BAC A;  2XPU A;  4H0E A;  3HUG B;  1MH3 A;  2VQG A;  4IVN A;  2LTP A;  3FXJ A;  4RGU A;  1P7J A;  3K70 D;  2TDX A;  2WV0 A;  1ZLJ A;  2DN0 A;  3KZY A;  4HX8 A;  2LBF B;  2IA1 A;  2BW3 B;  3OYB A;  1J2X A;  4MIM A;  5D5X B;  4S04 A;  5A2Q K;  1ZQ3 P;  3I71 A;  4PGG A;  3TQN A;  2ZXW H;  5EG0 B;  5FKO A;  1EH7 A;  2VQC A;  2XGE A;  4U87 A;  4L0Y B;  3QP5 A;  3E3V A;  2M34 A;  4I09 A;  4A0X A;  1VQ8 I;  4CO8 A;  5J1U A;  4IPA A;  3KEY A;  4HST A;  1WJE A;  1RKW A;  4B09 A;  2XRN A;  1MD0 A;  1OR7 A;  3GME A;  4LK1 F;  2CUE A;  2FNA A;  2CSO A;  1AHD P;  2PMH A;  1TP4 A;  2V9P A;  4U0W A;  3T1B A;  1JE8 A;  3QYF A;  3O2P E;  2UWM A;  3V8J A;  1MZB A;  3M8F A;  3L2R A;  2JVH A;  3NQO A;  4E7Z A;  4A3I J;  2XAH A;  3VB2 A;  5LGN A;  2X1C A;  4YEJ A;  1GXQ A;  4G94 A;  2EIK H;  4JX5 A;  2R7D A;  4M6V A;  4B8X A;  3OYN A;  4GYG A;  3E6M A;  3W6V A;  3C7J A;  1X2N A;  4I98 B;  4BXX J;  3GTK J;  1UFM A;  3DP7 A;  3GUD A;  3WHB A;  5LHH A;  1ETK A;  1YOV B;  1I5Z A;  3WU2 C;  1WIB A;  2FMY A;  4CYD A;  3DKX A;  2QQB A;  3TMO A;  2MFZ A;  3S3N A;  2ELJ A;  5CYV A;  1S72 I;  4KUM A;  1HCR A;  1G2H A;  3NAR A;  2Q2E A;  2OQG A;  3G3Z A;  2MLG A;  3F23 A;  2F5C A;  3T5X A;  3B02 A;  4BEH A;  3FXU A;  3OL3 A;  3I5U A;  4NNJ A;  2QSH X;  3K4L A;  4ZZD A;  1J59 A;  1PVE A;  1J75 A;  3DEW A;  2DFI A;  3S93 A;  4DYQ A;  2NVX J;  2PJR A;  2F6C A;  4IQJ A;  2QKL B;  2R0Q C;  2M8E A;  4ENM A;  2A5Y B;  2DYR H;  5DTD A;  4XON A;  1QNT A;  2HPI A;  2IXS A;  4AU7 A;  1IG7 A;  1Q1V A;  1MMA A;  2E19 A;  4OIN F;  1YW9 A;  1C0W A;  3IV5 A;  2Q8K A;  4E6K G;  5IP7 J;  1W36 D;  1UAA A;  2WAQ N;  3RQ4 A;  2R7V A;  4RB2 C;  2IA0 A;  2AHQ A;  1YX3 A;  5J40 A;  1T95 A;  3OV8 A;  1BW6 A;  4IF4 A;  1R4M B;  1APL C;  4EEF G;  2ETH A;  5BPI A;  4D1Q A;  4A5M A;  5HLT A;  3R4K A;  2DJI A;  3G6E I;  1VZ0 A;  3DLL F;  2O9L A;  4BQQ A;  2XF5 A;  3GWZ A;  4ZYG A;  3H92 A;  4HG2 A;  2DW4 A;  5CPR B;  3ABT A;  2VBX A;  2DA7 A;  2K7L A;  2TCT A;  1Y0N A;  2DMQ A;  2EZK A;  5F0F A;  1SFE A;  2VBW A;  3TW6 A;  2RKH A;  3EET A;  4GYI A;  2MAB A;  1W0U A;  1HST A;  3A03 A;  4XKV A;  1M1E B;  2LG4 A;  2LH9 A;  3PUB A;  2O8K A;  1L3L A;  2DAO A;  2L9N A;  1REP C;  1XDU A;  2IW5 A;  4V2F A;  2UXN A;  5H6R A;  1H89 C;  2Y0S A;  4F7Z A;  2Z1D A;  1PDN C;  1X4O A;  3AG1 H;  2VKD A;  2R7W A;  3R61 A;  2R5Y A;  3FHN A;  2YU3 A;  4J01 A;  5D8L B;  1FYM A;  3ZN0 A;  1YIJ I;  3G71 I;  4BE1 A;  3OOU A;  2LK2 A;  3BR6 A;  2NVY J;  5E20 A;  3IKV A;  2L3D A;  1BIB A;  5EGO B;  1O4X A;  5EDN A;  2LNB A;  4CUG A;  4ZDL A;  3C18 A;  1FOW A;  3L09 A;  3K2A A;  1K4S A;  2K4J A;  3TO9 A;  5FRM A;  3K4C A;  3VSK A;  3JRG A;  2LRE A;  3E97 A;  3KYC B;  3FM5 A;  1N77 A;  3JRF A;  4OU0 A;  3JSP A;  4F55 A;  1DUX C;  3EYY A;  2CS3 A;  3IAS 2;  3GO5 A;  1GHC A;  1T6S A;  1ZAR A;  3C2G A;  4AC0 A;  4FET A;  1KYW A;  2PQ8 A;  1QQI A;  2YX7 A;  2XV4 S;  3M4O J;  1P4A A;  5CJ9 A;  3HL2 A;  3DXJ F;  4E7L A;  4LFU A;  4MO7 A;  1JJ6 C;  1F43 A;  3I55 I;  3ABK H;  3AKZ A;  1KGS A;  3K1N A;  4G6T B;  3OYA A;  4CZC A;  3N4M A;  3BP8 A;  1B6A A;  5M3M J;  4E7K A;  2OUM A;  2EIM H;  1S7A A;  1OYW A;  1SVM A;  2J5P A;  1UCR A;  1UEL B;  2IS6 A;  5EZG A;  1TLH B;  2QKM B;  2Q2E B;  4LOC A;  5LGU A;  2Y2Z A;  5HNH A;  4MNU A;  4YG2 F;  3EQL F;  2Y75 A;  2JTV A;  3TOB A;  5HLI A;  2K3F A;  2DA2 A;  3S1N J;  4OAZ A;  3PFI A;  2F5F A;  2PJR B;  1HC8 A;  5ILU A;  3FHZ A;  1Z3X A;  2X4H A;  5AIP A;  2X6Y A;  3MKW B;  3W3C A;  3WGI A;  1U9N A;  2IRF G;  4Y15 A;  1FNN A;  5F6F A;  5J4V A;  4L18 B;  3S1R J;  1P6R A;  2M5W A;  1P7I A;  3HOY J;  4IHT A;  1ZGJ A;  1PJR A;  3KP3 A;  3ZMT A;  1X1B A;  4P1W A;  3BY6 A;  4PFP A;  1FWZ A;  1E0E A;  5DUI A;  2JUG A;  2VQH A;  5FO5 A;  3SEZ A;  3MFK A;  5LHI A;  4FT8 A;  4M3E A;  4HDV A;  1JT6 A;  2LD5 A;  1B72 A;  5CVI A;  4BHP A;  5E3L A;  3OSG A;  3HOX J;  3SFZ A;  2WY7 Q;  4XQF A;  3HPH A;  3C3W A;  3MQ0 A;  2IVM A;  4HYE A;  2G7H A;  4LIU A;  4EJO A;  5IY5 H;  2QZ8 A;  1X1C A;  1YHQ I;  4MQ9 F;  5GP9 A;  2EV5 A;  5HS9 A;  3HGG A;  3ASO H;  3LQQ A;  1CQT A;  2DMU A;  4ASN A;  1ZR4 A;  3EPZ A;  3ISP A;  3V42 A;  4YIF A;  2HVQ A;  2PBI A;  4RAY A;  1J7K A;  1STZ A;  2K4B A;  2CQX A;  2EZH A;  1I27 A;  2GOM A;  4IJA A;  1OPC A;  2E71 A;  2WBM A;  5GPC A;  3OYF A;  1I39 A;  3OMY A;  3H0D A;  1JT0 A;  2VKH A;  3ZRG A;  1VQL I;  2VOP A;  2MH2 A;  3J81 Z;  1AKH A;  3F3X A;  3D1N I;  2ADU A;  2HEO A;  2VT3 A;  2EH3 A;  4OWR B;  4HBL A;  2JA6 J;  1J5Y A;  1V4R A;  2ZXI A;  1YJW I;  1S8N A;  1MIJ A;  2QVO A;  4IRI A;  3FX3 A;  3C2H A;  3HPG A;  4UY8 I;  1USS A;  1ZYR F;  4HX4 A;  3B73 A;  1LE8 A;  1KON A;  4O3M A;  1XPX A;  1PYV A;  4N9H A;  1SD4 A;  2E1O A;  4HDU A;  2KJC A;  1KQ0 A;  2XRL A;  4HSR A;  3PO2 J;  3QPH A;  1L0O C;  3CMA I;  2OZ6 A;  3T0Y A;  4OMY A;  1IF1 A;  4P9U A;  2NS8 A;  1MSE C;  3FMR A;  4IHY A;  3HRT A;  3AAF A;  1TWF J;  1U5T A;  2NOJ B;  3P9K A;  3TW7 A;  3VYU B;  3TP0 A;  5GTI C;  3CCU I;  1D1C A;  2H8W A;  4S0H B;  1KYZ A;  1LFU P;  1IZ1 A;  1MMD A;  1VI0 A;  2M9H A;  3H1C A;  5HLG A;  2R7S A;  2J5O A;  4JK1 X;  1BN5 A;  1IN7 A;  5DYM A;  4G12 A;  4BY1 J;  1UHM A;  2WY8 Q;  3LA3 A;  5AON A;  4HX7 A;  4A69 C;  4BQN A;  4ZTJ A;  2O5R A;  4JOM A;  2W7N A;  4ZJZ A;  3BZ6 A;  1E17 A;  2WAQ A;  4LJZ F;  5M5W J;  3I64 A;  1QVU A;  3JW4 A;  3LQR A;  1WVR A;  3QPT A;  3SEQ A;  5DDG A;  2KL4 A;  2VJ5 A;  2VC0 A;  3FBN B;  3H5A A;  4RMN A;  1W5T A;  3JAM K;  3DPU A;  3JRC A;  2CV1 A;  2DPU A;  3N05 A;  4DGW B;  3HOV J;  2GBY A;  2Q0O A;  1JI8 A;  2VPR A;  2LR8 A;  2VBY A;  3I58 A;  3P7N A;  4HPQ A;  2OQR A;  2DLL A;  2ISZ A;  3OSF A;  2XB0 X;  4A3D J;  1TW3 A;  3OYD A;  1TTY A;  1FIP A;  1S7E A;  3CO6 C;  2A3S A;  4XN3 A;  2JQ7 A;  3I4N J;  1TT5 B;  2D45 A;  2HZT A;  2OZU A;  2VJ4 A;  5JVT A;  5JI6 A;  1U8R A;  1PP8 F;  4UVC A;  2KZG A;  2JA5 J;  1Q1H A;  2KLO A;  5ICF A;  5CVU A;  3KP6 A;  3QYE A;  4F52 A;  1AWC A;  1K7A A;  2DO7 A;  4BH9 A;  2P7C B;  1VQK I;  1LPQ A;  1V55 H;  3HOW J;  2Y9Z A;  4XRF A;  1B72 B;  2G0E A;  5KK1 A;  3EUA A;  4L9J A;  2L7M P;  1SEU A;  2AO9 A;  2O8X A;  5D6F A;  4KMU X;  5CQG A;  4RAF A;  2QBY B;  4IHS A;  1FJL A;  2V79 A;  1YLF A;  2DOF A;  3BQY A;  3DCF A;  4Y52 J;  3M8J A;  3HSR A;  1VQ4 I;  4MEY F;  3RDI A;  2HVR A;  1PUE E;  3ZQI A;  3HB9 A;  1GDT A;  3LSR A;  1AU7 A;  1P4W A;  2E5N A;  1TWH J;  4A3F J;  4YFK F;  2KRF A;  3QOE A;  2PLY A;  1U8B A;  3E0J B;  1A6I A;  3JR9 A;  3GLL A;  2ELH A;  4A3G J;  3K69 A;  4CCM A;  1R5G A;  1HXD A;  1FZP B;  3PIO F;  2IJL A;  3W6J B;  3R0J A;  1FOY A;  5KHD A;  1MND A;  1W7P A;  1MNE A;  3H9Q A;  5FLX Z;  3DU5 A;  2BVM A;  2HPM A;  4DW6 A;  1HA8 A;  1AKH B;  2KZV A;  3WG9 A;  4DJA A;  2R93 J;  2JMW A;  2LLK A;  3KIO A;  3A2K A;  4KFC A;  3EUK L;  3WTZ A;  3ZGK A;  1A6Q A;  4EM1 A;  1Z9C A;  1YQA A;  5JHU A;  5L3D A;  3GTL J;  1OYY A;  3CC7 I;  2WTE A;  3IL2 A;  3HBL A;  1I3Q J;  4D7N A;  2KRC A;  3SDG A;  2XIG A;  3OOP A;  2DMN A;  2EFQ A;  1U5T B;  2JRM A;  4PJ0 C;  4R79 A;  2X1D A;  1R71 A;  3QU3 A;  2CJJ A;  3CDL A;  1IRG A;  2NNN A;  3ABL H;  3K6G A;  5J8F A;  2DFF A;  3I9V 2;  3RZO J;  2PJP A;  4P5O A;  5JHF A;  4U0Y A;  2BXY A;  5D4S A;  4QTR A;  3X2Q H;  2JN6 A;  3RYR A;  3KX2 A;  5M3F J;  5C44 J;  4HRI A;  2RNG A;  1KU2 A;  4NB5 A;  3HXL A;  3KLN A;  1BJA A;  1BM9 A;  4Y4R A;  3QOP A;  2MGQ A;  1U3E M;  3J80 Z;  3S2D J;  1GUU A;  3WTT C;  3IKT A;  2DDB A;  1HF0 A;  3M1E A;  5EEG A;  2KP6 A;  1YFH A;  2Y30 A;  2Y0M A;  4KA4 A;  2X51 A;  1RR7 A;  2NAZ A;  3ZQC A;  2IP2 A;  2OPT A;  2KHM A;  5EEH A;  2IGO A;  3IWZ A;  4ESF A;  1ZH5 A;  1ZLK A;  3HOU J;  3MMY B;  3ZMD A;  4IOA F;  3HKZ N;  4UXN A;  2FBH A;  3OYE A;  4A0Y A;  3U9G A;  3GF2 A;  2VE9 A;  1XDS A;  4EJU A;  3E5Q A;  4F91 B;  3F72 A;  5F64 A;  2B0L A;  4ABZ A;  3G73 A;  5M5X J;  2BZT A;  2XGC A;  4M9S A;  2DI3 A;  2JPC A;  4BYY A;  1BR2 A;  2QUF A;  4XNF A;  1E3O C;  4IRG A;  3SYT A;  1RKT A;  1UHW A;  2HVS A;  2RNJ A;  1OLT A;  4GXO A;  4LD5 A;  2ZSI B;  4RA2 A;  3O6B B;  2HOE A;  3CJR B;  3CTA A;  1R58 A;  3KEO A;  3LFK A;  1V3F A;  1D1A A;  1QO0 D;  2CMP A;  3LSI A;  3PQK A;  3FKJ A;  2ME0 A;  3CCQ I;  1DPU A;  4I7H A;  2PI0 A;  1E3P A;  4LGW A;  2HXI A;  1TW2 A;  4QPQ A;  3ZQF A;  2WV1 A;  2CW0 F;  1G3S A;  2L4M A;  1WJA A;  4EM2 A;  5E79 C;  2H94 A;  1Z0X A;  4ZYA A;  4XLP F;  2V9K A;  3CDH A;  2YSR A;  5CKT A;  5HLH A;  2QSG X;  2JA8 J;  2JZY A;  3S2H J;  4C2M J;  2BGC A;  2ZJQ F;  1ENH A;  2CFO A;  3DF8 A;  2ZJP F;  3K4M A;  1F9N A;  1FSE A;  2MA3 A;  1WCM J;  2BEO A;  2HDD A;  4CIC A;  4AIJ A;  2V1N A;  1MH4 A;  1IO2 A;  3K4J A;  3KEQ A;  4M73 A;  3LWF A;  1EJ9 A;  1Z7U A;  2QCO A;  4U88 A;  4PSW A;  1K83 J;  1MW7 A;  1JHF A;  2K02 A;  1WRJ A;  2KDZ A;  4KIT B;  4ENN A;  5FLM J;  2ACJ A;  2L0K A;  2PX9 A;  2W1O A;  4RGR A;  3O8H A;  1IC8 A;  1Y8Q B;  1GVJ A;  2LP0 A;  4KIS A;  2HR3 A;  4CXF A;  1WWX A;  2E34 A;  3ESW B;  1P9Q C;  1R1T A;  1U9O A;  2M4G A;  3FKI J;  4XKW A;  1RRJ A;  2WWY A;  2IGN A;  2VKE A;  2L01 A;  5B1B H;  1BA5 A;  4Y13 A;  2XAQ A;  4DIQ A;  4FX0 A;  2PMZ N;  1GV5 A;  2HTS A;  2JA7 J;  1SVO A;  3V8K A;  4NBQ A;  5FFX A;  3DKW A;  4FAS D;  2GM4 A;  4EM0 B;  2YS9 A;  2EJR A;  1MBF A;  4FE7 A;  2H8R A;  1K78 A;  4BY7 J;  5FRN A;  1T33 A;  3PSF A;  1POG A;  1R9T J;  3LAJ A;  3VPR A;  3RKW A;  1Y0U A;  1U6G A;  1W7P D;  2W00 A;  1XSD A;  1R36 A;  2M7A A;  3KP5 A;  2IEK A;  2K5C A;  5FKM A;  3RPU A;  2QWW A;  3E6B A;  2KKO A;  5H20 A;  2DA5 A;  4ITV A;  2W48 A;  5ICG A;  3S2W A;  1KA8 A;  5L3B A;  1LDD A;  2MD5 A;  3IRQ A;  2ZBK A;  3IH3 A;  3BR5 A;  1R5H A;  2BY2 A;  3HSE A;  3LMM A;  1T56 A;  2OD5 A;  2EZL A;  2HDC A;  4NHJ A;  4X0G A;  4Q5S F;  3V7R A;  2NS7 A;  3ZOB A;  2Y9Y A;  4LIT A;  1YIT I;  3OS1 A;  2CQ7 A;  4GFB A;  4G8X A;  4KIF A;  3KYL A;  4WWC A;  3Q9V A;  2FX0 A;  1XSV A;  2M45 A;  3GXO A;  3HTU A;  2W25 A;  2Y69 H;  4LG3 A;  4CDG A;  3LA7 A;  1BC7 C;  3W2A A;  1IN5 A;  3U21 A;  1HDD C;  3ZQ7 A;  4P96 A;  5HOD A;  2F4O B;  5J1Y A;  2NYX A;  1KU7 A;  2KDO A;  3PUF A;  4LK0 F;  3BG6 A;  1OCR H;  2LKP A;  3GFJ A;  1TZL A;  5IP6 A;  5BMZ A;  3WTU C;  3LFU A;  1LFB A;  1IAW A;  1JGS A;  1V5F A;  2VIX A;  3VFZ A;  2E36 A;  2H1L A;  3LL7 A;  2F2E A;  1ODD A;  3CZ6 A;  4MLO A;  2ZME C;  3KP4 A;  2L7F P;  2RN7 A;  4UVA A;  5F0C A;  4HF1 A;  3H3V K;  1TNS A;  2Z16 A;  2MBF A;  1MJA A;  2O0Y A;  4Y33 A;  3ZMU A;  2GOX B;  2PEX A;  2V6C A;  3DTE A;  3F8N A;  4LLL A;  4F93 B;  3CC4 I;  1Y1V J;  1BBY A;  2HQN A;  1T0F C;  1IRX A;  1FMV A;  2NVU B;  4XBF A;  4RLQ A;  4OIO F;  4N4N B;  1IGN A;  1LDK B;  2X6W A;  2O3F A;  3QPS A;  2PN6 A;  5F27 A;  1OCC H;  3TED A;  3HIF A;  1MBG A;  1P2F A;  1I1G A;  3GFI A;  3C1D A;  5DD4 A;  5IT9 Z;  2L9R A;  3FXL A;  1G3T A;  3BR0 A;  3BG3 A;  1IDY A;  1VF9 A;  4MFD A;  4XLN F;  2OA4 A;  1WHU A;  1YW8 A;  3H36 A;  5CVR A;  5LGT A;  1XMX A;  3EGV B;  3WE3 A;  4UNO A;  2H27 A;  5CVJ A;  2L2O A;  2MG4 A;  4UUV A;  4IHX A;  4CSW A;  4WX9 A;  1J0R A;  5FD6 A;  2HOS A;  3HYI A;  3OS2 A;  1ZGA A;  1OYI A;  1R22 A;  4ENJ A;  2KIS A;  3FM3 A;  4WXC A;  2RGV A;  4HLY A;  2ZXJ A;  1TNT A;  3P9I A;  2QA4 I;  2YU9 J;  1TC3 C;  1NH3 A;  4GDF A;  2DTR A;  1UZC A;  2EA4 A;  3ZQQ A;  4EV0 A;  4L5J A;  4EVI A;  3OS0 A;  4M3B A;  3ASN H;  3K4K A;  2K27 A;  3V4G A;  2WC2 A;  2X9D A;  3BDD A;  2R7X A;  5TRD A;  3HKZ A;  1X19 A;  3EDP A;  4PCQ A;  5FKK A;  2XAU A;  4C9Y A;  4IHW A;  4DOZ A;  2V1X A;  1G3W A;  1FEX A;  3CUO A;  1WZ2 A;  3OR2 C;  5B5E C;  5J47 A;  1ITY A;  2YX4 A;  1B8I A;  3BCA A;  3ONQ A;  4H4K C;  2OC6 A;  1XGO A;  5FKN A;  2VUM J;  1S5L C;  4M3F A;  1FMW A;  2ID6 A;  3OWT A;  4C3I J;  2V7F A;  4JYK A;  4XKC A;  3KPH A;  3BR3 A;  2H1K A;  4A93 J;  4FE4 A;  1Z6R A;  2GAU A;  4I0B A;  1MJ9 A;  4RAZ A;  4JX6 A;  1JKQ C;  1XGM A;  1TWG J;  2CQK A;  4KMF A;  2STW A;  3HOZ J;  1HSJ A;  2E1M C;  5A2Q Z;  2DDA A;  4I2O A;  3IRR A;  3RIR A;  2EIJ H;  2JK3 A;  2B63 J;  3I53 A;  3K1M A;  1TT0 A;  2XSD C;  3A0H C;  2KJB A;  1Z77 A;  3FIW A;  1ETO A;  1XG1 A;  4KIC A;  3BLY A;  2ECC A;  3VDX A;  3HM5 A;  3HG9 A;  4A3L J;  2KIQ A;  1I50 J;  2X0L A;  3G1M A;  2EIN H;  2KIM A;  3RI4 A;  2NRA C;  3VWB A;  3ZPL A;  2MSY A;  2LF8 A;  1PUF A;  2CUF A;  2M3A A;  3PJR A;  2RV8 A;  2R3S A;  1D3Y A;  2P5V A;  4HV6 A;  4XOR A;  3MAJ A;  1U78 A;  5BQT A;  3F22 A;  3PO3 J;  4Y3O A;  2KFD A;  4MTE A;  2BY0 A;  5L3E A;  2JSC A;  3FF5 A;  2PMU A;  4IHV A;  3U1K A;  5E1Z B;  5E1X A;  1BR1 A;  2JJ7 A;  1IRZ A;  4BEH B;  4OIP F;  3BCB A;  3PL8 A;  1BOB A;  3CMY A;  2ICW G;  1F1Z A;  2VAS A;  1JTX A;  1O3R A;  1D5V A;  4M9Z A;  2OCC H;  2JWT A;  4BAY A;  4MEX F;  1G59 A;  3RPU D;  4BDY A;  4BDZ A;  2E60 A;  2QSF X;  3BTL A;  2O7O A;  3GW2 A;  4G6D A;  5DUK A;  1PP7 U;  1LJ9 A;  3T8R A;  5BNG A;  2E5Z A;  3HTS B;  2ZME A;  4ZTF A;  2GIV A;  1F5T A;  1GVD A;  5C4X J;  3TBI A;  2Y48 A;  3VYT B;  3R0A A;  1E3H A;  2HI3 A;  1LFP A;  2DMT A;  2K9S A;  1BC8 C;  4XIC A;  4PJJ A;  1I6X A;  1FC3 A;  2OU2 A;  5LEJ A;  3DKY A;  4JQF A;  1B9M A;  1R1V A;  2R7Z J;  2XF6 A;  3CD6 I;  3GCM A;  4UVB A;  4D9J A;  2AQF A;  5HDG A;  1Z7L A;  2GIZ A;  4C2T A;  4MGR A;  3HRM A;  1OCZ H;  4ZYH A;  4KIG A;  2RQP A;  4BJT A;  3BG7 A;  2N8G A;  4L0Z B;  4MQV A;  3QAH A;  2WA0 A;  4CYC A;  2HZD A;  1I6H J;  1R1U A;  2XKO A;  4U7B A;  2D1H A;  3KP7 A;  1G8X A;  2ME6 A;  1YI2 I;  5JVG F;  2XKP A;  3ZR8 X;  2HFH A;  4ZC3 A;  2M7B A;  2DT6 A;  1TQP A;  3PFY A;  3Q3S A;  3P5J A;  4XM3 A;  4JX4 A;  2M1B A;  2VKV A;  4ZH4 F;  5LHG A;  2JPB A;  5H2F C;  4HOB A;  5LFA A;  3FMS A;  4NQW A;  3ZQL A;  1V5G A;  2M2E A;  4PSX A;  4CCJ A;  4A3M J;  1CF7 A;  4L5I A;  2QYO A;  2L02 A;  4A12 A;  3E7L A;  1B8I B;  2F48 A;  1H88 C;  4V2G A;  3CCE I;  1ERD A;  3S16 J;  4M3D A;  3TGN A;  5JFR A;  2R5Y B;  3LSH A;  2CV2 A;  1VQ6 I;  3QU6 A;  3VSL A;  3L1P A;  2VN2 A;  3GFM A;  5K7H A;  3EUH C;  4XMY A;  2Z3Y A;  2JA2 A;  4XOT A;  3HEF A;  4WF2 A;  2FRH A;  3I56 I;  4KNY A;  4RB3 C;  4XN0 A;  1RUN A;  1J9I A;  1R5I D;  3LSK A;  3ZMV A;  2ZNZ A;  3GX4 X;  2GA1 A;  2K9L A;  1LEB A;  2ZC2 A;  2X6X A;  5LEK A;  2QF7 A;  4LB5 A;  4XLC A;  4M74 A;  3F6O A;  4EAT A;  2DOE A;  2M30 A;  3FXR A;  5J4Y A;  1UJ8 A;  1FP1 D;  4A0Z A;  2A6E F;  3JCU C;  4FHT A;  5GPA A;  2VQL A;  4RS8 A;  2COB A;  1RUO A;  2P6S A;  1R49 A;  2V26 A;  4XRS G;  1MMG A;  2HYG D;  1VQM I;  1TQM A;  4B4C A;  2DQL A;  1PUF B;  3FZV A;  3B6C A;  4QWQ A;  4C30 A;  3KLO A;  5TGT A;  4CCN A;  3HGY A;  2VE8 A;  2ZXH A;  2D2W A;  2M0M A;  2CFX A;  2ZNY A;  4YEL A;  3JTG A;  5FLV A;  2L9V A;  3JSO A;  3I0T A;  5E17 F;  4A2U A;  3U1D A;  3Q5F A;  2DQR A;  3VYS B;  2CUJ A;  1WFX A;  1O3Q A;  2MW8 A;  1RPW A;  2RQQ A;  2RRE A;  1QGP A;  4KIB A;  2F5E A;  3BT9 A;  5BPD A;  2IGK A;  3OYI A;  2ZB9 A;  1XGN A;  5D8K B;  4L5E A;  2HQA A;  5LRS A;  3QYB A;  3S32 A;  1WPK A;  2FXA A;  3BZK A;  4XL9 A;  4DNC A;  3I3L A;  2HQR A;  3PNV A;  4PFO A;  4KJZ A;  2EWN A;  3IC7 A;  1YG2 A;  4HZF A;  1OMI A;  3ABU A;  3FDY A;  3OIP A;  2FNP A;  2K9N A;  3Q0W A;  3BZC A;  4ETS A;  2MYS A;  3CME I;  3NWT A;  4G6Q A;  3MKL A;  2HXO A;  1DP3 A;  2G9W A;  4RM3 A;  3WHC A;  1FYL A;  1JXS A;  2BY3 A;  2R4G A;  3BPX A;  1VQ7 I;  2A6H F;  2HS5 A;  4G9Y A;  2L9S A;  4BJ6 C;  2IGM A;  5HS8 A;  2BY1 A;  1Z1D A;  1SFU A;  4OIQ F;  2A68 F;  4HNT A;  1XMK A;  2CW8 A;  3RKX A;  4XRS A;  1X3W B;  1DGW Y;  3E5U A;  2CRG A;  4L9N A;  5F04 A;  3O8G A;  1ZAO A;  3RYP A;  4A6D A;  5DCM A;  5KAF C;  4II2 A;  2CU7 A;  3KYD B;  3NAU A;  1DP7 P;  3DV8 A;  4UUT A;  3AG3 H;  3SXY A;  2EFW A;  3IUO A;  4NQW B;  5JLW A;  3W2V A;  1CF7 B;  1NK3 P;  2LKX A;  5FJ8 J;  1IN8 A;  4BQA A;  4AWX B;  2DA4 A;  2IPQ X;  1RES A;  2R7O A;  1ETY A;  1T38 A;  1S3J A;  2CYY A;  3S1Q J;  2CWE A;  3D5L A;  4DBQ A;  1MDM A;  1ZRE A;  1HLV A;  2W4S A;  1JKP C;  3SDB A;  1LE8 B;  3GYH X;  1YW7 A;  5TJJ A;  2ESN A;  5IPA A;  1DPR A;  3H9J A;  3L00 A;  5DD8 A;  4S05 A;  5E3M A;  2E7X A;  4QIW N;  1Y39 A;  2HGC A;  1VTN C;  2V1U A;  4I0A A;  1D0Z A;  3OIO A;  2VJI A;  1V5E A;  2VL8 A;  4B48 A;  3DBH B;  4M3G A;  3CMM A;  1Y8R B;  1AOY A;  3QWL A;  3ECO A;  3DLA A;  1HW5 A;  4JBA A;  4RAG A;  4B3X A;  3EUH A;  2DCE A;  2OF7 A;  3H0G J;  5DV5 A;  3QQA A;  1YIO A;  2IS1 A;  3HHH A;  3HHG A;  1MBK A;  5B1A H;  5DS9 A;  2VI6 A;  4YII A;  2H6C A;  2WAF A;  4G7H F;  3JRB A;  1R23 A;  2E1M B;  4A3E J;  3ZMZ A;  4IEJ A;  1XS9 A;  1X3U A;  3DEU A;  4XLF A;  3R6S A;  2OTJ I;  3V7C A;  3V7S A;  5FD5 A;  3DWL E;  4CHU A;  2FOW A;  1IV6 A;  5IOY A;  4OAY A;  4G7Z F;  2P6T A;  3BC8 A;  3S14 J;  4C2U A;  1ZR2 A;  1R00 A;  1QHH D;  4XSZ F;  2V6E A;  4EJW A;  3H3Z A;  3CC2 I;  2XRO A;  1VQ5 I;  3K9T A;  3L7W A;  3FIS A;  1YS7 A;  2UZK A;  2IAI A;  2G7U A;  5K5O A;  5M5Y J;  1QA6 A;  4Z2Y A;  1MBH A;  2XPW A;  3JAM Z;  4XLE A;  2VXD A;  2LOO A;  3BQZ A;  3LST A;  1S29 A;  1VQP I;  3RQI A;  3K1P A;  4OOI A;  4XLH A;  1D0Y A;  1B4A A;  1BI3 A;  1WH5 A;  2V1D A;  3QP6 A;  5L3G A;  3NWS A;  2MD0 A;  1BOA A;  2E2I J;  2K9Q A;  3CES A;  5J1R A;  2HYF A;  3FBI B;  1Z67 A;  5ICE A;  1KQ9 A;  2NOG A;  3A0B C;  2FA5 A;  5D6E A;  5TIS C;  3WGG A;  4KN4 X;  1OIS A;  3L2U A;  2OCE A;  5F0H A;  2ECB A;  3NRV A;  2EFN A;  2LRD A;  1FX7 A;  1WJF A;  3ELK A;  1A5J A;  4XK4 A;  4IRH A;  5DCM B;  3JRA A;  2GA2 A;  2R7Q A;  3PIP F;  1RI7 A;  1K61 A;  2X48 A;  2DK5 A;  3F8B A;  4BXF A;  2A69 F;  4RB1 A;  3CUQ C;  4UV8 A;  2JSP A;  4DQ2 A;  3OR1 C;  1UMQ A;  2Y0S N;  3CP2 A;  3OY9 A;  1XC5 A;  2CG4 A;  3LSG A;  4E7S A;  5IP9 J;  1EF4 A;  3WG7 H;  1W7P B;  2Q1Z B;  2BHY A;  2R7F A;  4C3H J;  3HZJ A;  1HKS A;  2BOL A;  3ML6 A;  5E18 F;  3TL4 X;  2FJ1 A;  1DGR M;  5K5R A;  2BBY A;  2QLZ A;  1MDM B;  2CGP A;  2BXZ A;  3G2B A;  3D0S A;  3I54 A;  2JVG A;  1YJ9 I;  1HKQ A;  3H5N A;  3VEP A;  3S8P A;  3L2C A;  3QRF F;  1AA7 A;  2Z5U A;  2DMP A;  2XSJ C;  3CP8 A;  3DTK A;  3RKQ A;  4JP0 A;  3UR3 C;  4XR6 A;  2F4I A;  1HOM A;  4G7O F;  3CCJ I;  4BS9 A;  3J7A O;  3WTY C;  2LY2 A;  1BL0 A;  3RSN A;  2LVS A;  3WTX C;  3CJN A;  5K1Y A;  1VQ9 I;  1ACI A;  1D8K A;  2V4J C;  2EV6 A;  5B3S H;  2Z33 A;  1MMN A;  2L4A A;  4C3J J;  4IKF A;  1QPM A;  3CO7 C;  3CCS I;  1K6O A;  4ON0 A;  1BJZ A;  2NNY A;  5ED4 A;  1BIA A;  3BWG A;  2BHZ A;  2MC4 A;  3OIQ A;  1XCB A;  2E2J J;  2W57 A;  2CV0 A;  5D5V B;  2DYS H;  3MWM A;  1ZG3 A;  3GEZ A;  4N9I A;  1HQC A;  4I76 A;  4I99 C;  4PJN A;  5J6X A;  2AXT C;  4W97 A;  1SFO J;  2LC2 A;  1SD6 A;  1UST A;  3HRU A;  2Z99 A;  4UB8 C;  5GAE J;  1JUM A;  2XVC A;  4B43 A;  3WU1 B;  2VC1 A;  1XTA A;  3FXO A;  1YYV A;  1F4K A;  1CGP A;  3SJM A;  1SD5 A;  1QPI A;  2XDV A;  1H9T A;  2KT0 A;  4AID A;  1WH7 A;  1Y56 A;  2JT1 A;  1R7J A;  4IX7 A;  2W24 A;  4RLF A;  5E3O A;  4II3 A;  4M6Y A;  1D1B A;  2M87 A;  4UB6 C;  5ILV A;  2R7T A;  1EA3 A;  5GAG J;  4R1H A;  5EF6 A;  3G1O A;  4IZZ A;  1ZRF A;  4B1R A;  5LRR A;  3J7A Y;  2XHK A;  3L2Q A;  1ZRC A;  1QZE A;  3BG9 A;  4F92 B;  2JUC A;  2LY1 A;  1QBJ A;  3CDI A;  1OCO H;  1FOX A;  1KU9 A;  1WJD A;  4X1E A;  2FEZ A;  3MCZ A;  2A07 F;  4BU2 A;  4YRV A;  5H6Q A;  3CCV I;  2CH0 A;  5E8I A;  3WTS C;  5EGO A;  2FQ3 A;  2Z2S B;  3RKY A;  2VON A;  3CCY A;  1H9G A;  2B9S A;  2EFO A;  2P5K A;  3SZG A;  3PNT A;  1ZHF A;  1IXC A;  2OBP A;  3CCR I;  3ROU A;  1MKM A;  3CF2 A;  3VOE A;  1SAN A;  5DM7 F;  3LA2 A;  4XOP A;  2YPR A;  3M1C A;  3TO7 A;  2IS4 A;  3FK6 A;  3BR2 A;  3F6V A;  3F0C A;  1JHH A;  1FBS A;  3B6A A;  4LLN A;  5KNL A;  1I1S A;  3IH2 A;  2RAE A;  3GLX A;  1O57 A;  2BV6 A;  3E6C C;  2E1N A;  1FPQ A;  1SFX A;  4BGD A;  2COM A;  4U0V A;  1XSX A;  4BL0 B;  2UUZ A;  4QLC U;  1O7F A;  3KP2 A;  4A3B J;  4FIS A;  3JRI A;  1ZGW A;  3GTP J;  2UV1 A;  2R92 J;  3K0L A;  2L7Z A;  4D5F A;  4ZZL A;  1NG6 A;  4YFX F;  4RGS A;  1WQ2 A;  2FSW A;  1X4P A;  3KZZ A;  4Y7N J;  4Y17 A;  1QU3 A;  3CUQ A;  1ONV A;  1XX5 A;  1NG7 A;  2VPL A;  3CJS B;  1DDN A;  5LD2 C;  2P7V B;  1K4T A;  5EJC A;  1GXP A;  4GRI A;  2M0C A;  1YRN A;  5J8C A;  5IT3 A;  2XAF A;  3FXM A;  2GLO A;  2X1E A;  3RCO A;  1DU0 A;  5C3E J;  2QQ9 A;  2K40 A;  1IN6 A;  3LSP A;  4PZJ A;  1FSH A;  1WGX A;  4ZDP A;  2DU9 A;  3WU0 A;  1SAX A;  1QVT A;  4XID A;  1SD7 A;  3OYK A;  2K9M A;  2DXI A;  1DQU A;  5ERI A;  2L7K A;  3BJ6 A;  3CJT B;  1FT9 A;  4EJT A;  4YFN F;  6PAX A;  1FLI A;  2C6Y A;  3Q0U A;  4HV5 A;  1SMT A;  2DFH A;  1KU3 A;  3GTG J;  1EH8 A;  2B7E A;  2H6B A;  4KT5 C;  1IW7 F;  2V9V A;  3M8E A;  2M4K A;  1Z6T A;  4WXH A;  1XN7 A;  4Q47 A;  1BR4 A;  2FBK A;  4A3J J;  1LUJ B;  2HKO A;  3DEE A;  4YIR X;  3ERM A;  2XC7 A;  1K78 B;  1T08 B;  3RTR A;  1NTC A;  5E8G A;  4M71 A;  3GTM J;  4CCO A;  1O7L A;  1BI1 A;  3D5S C;  4XSX F;  2DT5 A;  2XUB A;  2PG4 A;  3GZN B;  2GXA A;  3WE2 A;  4ESB A;  4ESJ A;  3A4C A;  2GXB A;  1Z21 A;  3J81 K;  2IA2 A;  1TBX A;  3LSJ A;  4RGX A;  4BE0 A;  2KRH A;  2ZFU A;  4BUP A;  1P4X A;  3VOD A;  2FUG 2;  2DJN A;  4N0B A;  4KN7 X;  1UG0 A;  2DA6 A;  2RC4 A;  5KVR A;  2LYC A;  3SQN A;  4RDU A;  1S6L A;  1JUS A;  3F8F A;  3H9G A;  3IAM 2;  3ULQ B;  3DFG A;  3RZD J;  1X1P A;  4LMY A;  2CQQ A;  4BXU A;  3MZ8 A;  4I6Z A;  1U5T C;  2A6T A;  2L5Q A; 
#chains in the Genus database with same CATH homology
 3G6E I;  3DLL F;  4IO9 F;  1Y39 A;  3CCR I;  2E34 A;  5DM7 F;  1VQM I;  1YJ9 I;  2JQ7 A;  3EGV B;  3CF5 F;  3G4S I;  3CJQ B;  4IOC F;  1VQ8 I;  1VQK I;  1YHQ I;  2QEX I;  3CCJ I;  1VQO I;  3CCM I;  3J7Y J;  2QA4 I;  2OTJ I;  2FOW A;  2ZJR F;  1YIJ I;  4IOA F;  3G71 I;  1VQ9 I;  3CJS B;  1ACI A;  1VQ4 I;  3CD6 I;  3CCS I;  5GAD J;  1FOW A;  1VQL I;  3CME I;  1MMS A;  3CC2 I;  1VQ5 I;  1YJW I;  1YI2 I;  5JVG F;  3CJT B;  5DM6 F;  4UY8 I;  1WIB A;  1VQ7 I;  1QA6 A;  5GAE J;  3PIO F;  4V19 K;  3CJR B;  1FOY A;  1YIT I;  1S72 I;  3CMA I;  5GAH J;  2NXN B;  3CCQ I;  1VQP I;  1YJN I;  3I55 I;  3CCE I;  3CCU I;  2H8W A;  1VQ6 I;  1VQN I;  5GAG J;  2OTL I;  3CC7 I;  2E35 A;  3J7Z I;  2ZJQ F;  2E36 A;  2ZJP F;  3I56 I;  3CCL I;  2K3F A;  1HC8 A;  1FOX A;  3PIP F;  3CC4 I;  3CCV I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...