3J7YJ

Structure of the large ribosomal subunit from human mitochondria
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
GVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
J PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3j7yJ02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3j7yJ01
3CJSB 3G6EI 3CCSI 2ZJQF 1Y39A 3CMAI 3CCUI 1VQPI 3CCEI 1VQ5I 5DM6F 4IO9F 2ZJRF 1FOWA 4IOAF 3CCJI 1VQ9I 1YI2I 5GADJ 3I56I 1YIJI 2H8WA 3CCRI 2OTLI 3CJTB 3J7ZI 4IOCF 3CF5F 1QA6A 1VQ7I 3CC2I 3CJRB 1VQLI 3CD6I 1YITI 2ZJPF 2E34A 3PIPF 1VQKI 2NXNB 1FOXA 1ACIA 3CCLI 1MMSA 3CCMI 1YHQI 2QA4I 2QEXI 5DM7F 1YJ9I 1YJWI 3PIOF 1VQ8I 3CC7I 5GAEJ 3CCQI 2K3FA 3I55I 1VQ4I 3CJQB 1YJNI 2OTJI 2E35A 3G4SI 1WIBA 2FOWA 3G71I 3CC4I 2JQ7A 3CCVI 5GAGJ 3J7YJ 1FOYA 3CMEI 1VQMI 4UY8I 1HC8A 1VQ6I 3DLLF 1VQOI 4V19K 5JVGF 5GAHJ 3EGVB 2E36A 1S72I 1VQNI
chains in the Genus database with same CATH superfamily
4PJ0C 1E3PA 2RQPA 4CGZA 4P5OA 1R4NB 2D45A 2R7UA 2OU2A 1Y1VJ 3I4NJ 3F72A 2ZJQF 1UHWA 5BPDA 1Y39A 4F92B 1VFCA 2X1DA 1CF7A 4A5MA 3FHZA 1U5TC 1K61A 1J9IA 3K9TA 4E7JA 1XN7A 2OA4A 2PMUA 2DQRA 2Q1ZB 2HYJA 3HPHA 3K4MA 2DBBA 5B66C 2IRFG 2KRFA 5FRNA 2F5VA 3ABUA 1BA5A 5FLXZ 3EYYA 3FMRA 2LG4A 1XB4A 4D0PA 5LGNA 1IRZA 2MA3A 2H27A 3CO7C 3CLQA 4XLAA 1FSEA 2HDCA 3ZPLA 1IRXA 2Y0MA 5EJCA 2Z99A 5CKTA 3U1KA 4LK1F 2JMWA 4HA8A 3L7WA 4CCMA 5B1AH 1MDMA 4G8XA 4EJOA 3B73A 1E3OC 4BNCA 1YTYA 3JRHA 1W7PA 2ELJA 4GRIA 3OSFA 4BQOA 2K5CA 4IRHA 1ZRFA 2E34A 3I3LA 1J59A 1WI9A 1V55H 3R6SA 3PIPF 2W48A 3H36A 4IZZA 1J09A 4ENNA 1ENHA 2CUEA 3A0HC 3CCLI 1FSHA 1DP7P 4G7OF 1ETVA 4LIVA 4DJAA 3Q0UA 2LLKA 2M8EA 2KT0A 3BCBA 2JZYA 2JA8J 1ZK8A 5J1UA 1H0MA 4EJVA 1W4MA 5E1WA 5FD6A 2O9LA 2VC1A 4OINF 4Y4RA 4WCGA 4D5FA 3U21A 2JSCA 3RZDJ 1O7LA 1RI7A 2DMPA 5KNLA 5IYCJ 1F1ZA 2A5WA 2V7FA 5CYVA 2R7XA 3PQJA 3GYHX 3SJMA 2E5ZA 1R71A 2ZXHA 2IJLA 1BJAA 2O8KA 3CLOA 2HKOA 1K79A 2PN6A 1P4WA 4QIWN 1UAAA 1D8JA 1RUNA 4XRSG 6PAXA 1MH3A 5DYMA 1AKHA 4EM2A 4MQVA 3ASOH 2QUFA 1WJEA 4UUSA 4XRFA 4KITB 2HXIA 5KAIC 5J40A 3T8RA 2O3FA 3GWZA 2H6CA 5HDKA 3KYCB 3X2QH 3LOCA 4BE1A 3KE2A 1RR7A 1XX5A 4HSTA 3E5XA 1MMAA 3WTYC 4NNJA 3QWLA 1VQNI 1FC3A 1OCZH 3BJ6A 3CMMA 4PFPA 4FISA 4GCVA 3KEQA 2XF6A 4ON0A 2TDXA 3RPQA 1E2XA 1IG7A 3P9CA 4NC8A 4X0GA 3V7RA 4J19A 1FIPA 1SD5A 2PX9A 4KT5C 1X4OA 4BE2A 2XAUA 3ERMA 5LRSA 4IQ4A 3V8LA 1QU3A 4BDZA 2UUZA 3DLAA 1OYYA 5A2QZ 3NAUA 5HODA 1Z6RA 2DMTA 2KZGA 4N4NB 2A68F 3OYLA 4IOAF 3UR3C 3S1RJ 1GXPA 1U2WA 1O7FA 3PFIA 4HEA2 3RQIA 1YYVA 3GTOJ 4Y13A 2ZMEC 3BCAA 4CSWA 3PNVA 4KNYA 1R1VA 1FOKA 4G6DA 4XRMA 3JRBA 2I10A 1WPKA 4XNFA 2DQLA 1G3TA 2YU9J 5JFRA 1JGGA 1ZARA 1TW2A 4A12A 1ETYA 1HF0A 3LQRA 2NS8A 2G7HA 1T38A 5EG0B 4P1WA 3LSHA 2VKHA 4LG0A 2RNJA 4RMNA 4BH9A 2ESNA 2Q0OA 1TQPA 1DPUA 3WE2A 2EB7A 2LKSA 3REOA 2IT0A 2J5OA 1YO5C 1R22A 3BR1A 3PL8A 5FFZA 3O2PE 4M3FA 4FX4A 4O3MA 2GXAA 1ZKGA 2DT5A 1DU0A 3KIOA 5M5WJ 1REPC 2CYYA 4L0ZB 5J6XA 1YW9A 1D8KA 1P2FA 2HEOA 1B8IB 3W2AA 2V1NA 3G73A 2XPUA 4DYCA 1XMAA 3VEPA 2MGQA 1JT0A 4ZDOA 2YS9A 3I55I 2V1XA 4I99C 2L9NA 1GLNA 3F6VA 3ZQGA 3O8GA 2O8XA 3M1CA 5J4VA 1LPQA 4I2OA 1IN8A 2VKVA 3C2GA 1JUSA 3KYDB 1FBUA 4EGZA 4XKWA 3ZN1A 5KVRA 1YIOA 1WIBA 3Q9VA 3VFZA 3CP8A 3CUQA 1IXCA 2PI0A 2M4KA 3CC4I 4E7SA 5BMZA 2VPRA 3C2BA 4BE0A 2EA2A 4FQGA 1JJ6C 4A3IJ 4IQJA 2DA5A 2FMLA 4FX0A 2P81A 3HOZJ 1IW7F 1X1BA 4G12A 4XN0A 1VQ6I 4UXNA 1R00A 3SDBA 3HKZN 4MTDA 2MLGA 2V4JC 3TEDA 4BEHA 3W6VA 1DQUA 4EVIA 5GAHJ 2R5YA 2IBDA 5LLQA 1JJ8C 1MBKA 2L2OA 2X6YA 5L3FA 3V7SA 3C3WA 5F27A 2DMUA 1U0JA 5LHGA 3D5RC 4DQ2A 1YFHA 2E19A 2K9MA 1X1CA 4AU7A 3DBRB 4Z6YA 3BP8A 4UUVA 4R8HA 1FNNA 3JRCA 4EEFG 3MQ0A 4UVAA 1QHGA 3VYTB 1FOWA 5HLTA 2PJPA 2KHMA 2M8GX 4QWQA 1HBXG 1B72A 2VQHA 2KIUA 3KLNA 5IYBJ 3HOUJ 1T8IA 2I5UA 2BV6A 3I56I 5HDGA 4LGWA 3BPVA 5E3LA 3R0JA 2IS4A 2R7RA 4BGDA 2FD5A 3SEQA 2IA0A 3ML6A 4IOCF 3DF8A 5D8KB 4RDUA 5K5OA 4HW0A 1QA6A 2B7EA 4YG2F 3R0AA 3RKXA 5IT9K 3LL7A 2WAQN 3M1EA 4XRSA 3HSEA 2NVYJ 4XLNF 2L3DA 1IXSB 3TP3A 2ZNZA 2L9RA 3MEXA 3OL4A 2DOAA 3SXYA 1MGTA 1QRYA 3EPZA 5EDNA 1K7AA 1ACIA 2F5EA 2MSYA 3I0TA 4PSXA 1ZH5A 3WE3A 4KICA 2LK2A 2LSOA 3FDYA 4CH7A 4B48A 1S29A 2RVCA 2CQQA 4NQWB 4B47A 3HG9A 3BWGA 3NQOA 3BJOA 1JHHA 4IHSA 2OV7A 4C3IJ 4BS9A 1WI3A 1D5YA 5FRMA 1R5HA 1ZTRA 3IAS2 3DKXA 3FXRA 4I0AA 3L2QA 3LSGA 3JR9A 4HDUA 3VYSB 2VKEA 3W6KB 3JSPA 1Y8RB 4BQAA 2EQRA 3OS0A 2HFHA 1O57A 3BG9A 4OWRB 4IHVA 3ASNH 2GOMA 2HQ5A 3FBIB 1UMQA 1IF1A 2PG4A 3TO6A 5GAGJ 2ISYA 5FD5A 4LLNA 2EZHA 2L01A 2OCEA 1TBXA 4Y15A 1FOYA 2AHQA 2Z2SB 1FP2A 2O5RA 3IH2A 3JAMK 3NWTA 4JBAA 1UG0A 4UV8A 5D6EA 3SZPA 3K10A 3ZXSA 2K86A 2Y0SN 3DPUA 3QYEA 1DU6A 4XN3A 4CO8A 5ICEA 2F2EA 4IF4A 4CCKA 3LSRA 3VYRB 4B3AA 2LH9A 4RAGA 3MCZA 3ZRGA 1XGMA 4S05A 3DTIA 2XKOA 3NWSA 4KN4X 3O6BB 1UB9A 5TISC 4A69C 2XB0X 3BY6A 1ERDA 3HOTA 3ZMDA 2MD0A 5F04A 2DFFA 4EM1A 2NRAC 2VQCA 5DM6F 2K9NA 3C7JA 4KMUX 4GYIA 2TCTA 2O6GE 5GTIC 2M2EA 1OR7A 4KUMA 5E3NA 3I54A 2R7DA 4IVNA 2JK3A 4UUTA 3WU1B 2QBYA 3WODF 1MBFA 2VODA 1X1AA 5BPIA 3TOBA 1X3UA 2CS3A 4EJTA 4F7ZA 1K78B 1LFPA 2OTLI 3K4NA 1R49A 3FK6A 3I59A 2AS5F 3MZ8A 3IAM2 2WB1A 4HX7A 4MTEA 1GVJA 2RKHA 1U5TB 5K7FA 2HNHA 4XLPF 2VIXA 1BIBA 2JT1A 2NAZA 4KDPA 1KU2A 2V9VA 1BW5A 3HSFA 2ZKZA 3OR1C 2GOXB 2HOAA 3S2HJ 5KK1A 2ETHA 1IZ1A 2LFBA 5M3MJ 2LDUA 4AD9A 3FXUA 2DTRA 2M87A 1OCRH 1J0RA 2VXDA 2Y30A 2KDZA 3L2RA 4L5JA 3CDHA 4UVBA 1HXDA 1TW3A 2HZDA 3L2CA 1KU7A 4M3DA 4HF2A 3E6DA 5EZHA 4C2MJ 3WTTC 3OYGA 4ASNA 4NHJA 2H94A 4Y7NJ 4D7NA 3TQNA 2R7WA 1IV8A 1FTTA 3U1DA 2NVQJ 2DA7A 5E18F 2X51A 3TW6A 2EIMH 3VSLA 2A6TA 4IHXA 4A0ZA 5D5UB 2EFPA 1N75A 1YG2A 5HNFA 1Y6IA 1WSUA 2K9QA 4Z2YA 1W5SA 4A3CJ 1ZLKA 3BOQA 4NB5A 5FFXA 3MFKA 3OS2A 3HRTA 4IXAA 2FBKA 5HLHA 2E1CA 1T33A 1IAWA 2X6WA 4UHTA 4ESJA 2OBPA 2A3SA 2ICWG 3S15J 2F4OB 1XD7A 1LNWA 1ZHFA 3OYEA 1RETA 1LDKB 3IRQA 2WAFA 3HSRA 2DOFA 2FXAA 2DCEA 4HNVA 2NYXA 3VOEA 1AHDP 2BZTA 2DW4A 4YIIA 4M6VA 2NNNA 4IL6C 3L09A 1BN5A 4V2FA 3S3NA 3VPRA 1OYIA 3TDUC 2YX7A 2UWMA 2KIQA 2ZB9A 4Q47A 5IOZA 3SDGA 4M6YA 1FY7A 3DU6A 3OYIA 3NRVA 5D4SA 2A6EF 1HSJA 3DTKA 2JPBA 4IRGA 5GPAA 1KYZA 2NS7A 3JSOA 4NBQA 1OLTA 5D5WB 4N4OB 5D6FA 1DUXC 3B6AA 1UELB 1NK2P 2FJ1A 1FP1D 4C2TA 2CO5A 3A0BC 3GBGA 5L3CA 2FA5A 3E1SA 4U7BA 5CVJA 3RYRA 2PLYA 3HTSB 3ZMVA 1SAXA 3CJTB 3R4KA 4JQFA 1MSFC 2VQLA 2ZXIA 2KRHA 3DFGA 2Z5UA 2W82A 1BI2A 2LBFB 2E60A 1MNDA 3GFLA 1MBEA 1VQ7I 3BT9A 4HX4A 4PK4A 1XDSA 3C18A 2COBA 3LFUA 4AYBA 4ZYDA 4MHGA 1PYVA 1ZYRF 3HJEA 2ADUA 3F22A 2WY8Q 3QODA 1I3AA 4HV5A 3ULQB 3WGGA 3MN2A 2ZMEB 2IAIA 3KETA 2BVLA 2PFBA 2VQGA 2NXNB 4U0YA 2CRGA 2AXLA 1MNEA 2AQFA 4AIDA 2QA4I 2K9SA 1D3YA 3MAJA 4XOPA 1ZGAA 1SVMA 4KIGA 3RDIA 2DJNA 2F5DA 3E7LA 1SMTA 2GWRA 2JVGA 2AO9A 4HSRA 2Y9ZA 2KMUA 2MFZA 2MBFA 2PBIA 4NUBA 3ZQLA 3COAC 3KYLA 3LSMA 3HOWJ 1KQ0A 2DN0A 1MJ9A 4ENMA 2UXNA 3U2RA 3OYHA 5C4JJ 1GV5A 3FZVA 3IL2A 3QPTA 4RAYA 1YJNI 5FLVA 2DA3A 2R0QC 5CVRA 4PJNA 1Z7UA 2M7AA 4C9YA 3S2DJ 3ABMH 1FTZA 3TW7A 4MGRA 1TWAJ 1LJ9A 2EZKA 1L3LA 1D0YA 1TWGJ 4HYEA 4W1UA 1ZRDA 2HVQA 3ZQHA 5F08A 3P9KA 3VODA 1X3ZB 5C44J 4ABZA 3HB9A 2LY1A 4BXUA 3H92A 4YIRX 3LNQA 1ITYA 2VC0A 3IKVA 3ZP5A 1R9TJ 1NG6A 2HI3A 3CTAA 2FF4A 1NG7A 3Q3SA 1MIJA 4ZC3A 1W1WE 2VPLA 2EA4A 4I02A 1G3YA 1BL0A 3M9AA 2W25A 1W7PD 2W4SA 1IDYA 3GXOA 3KP7A 3A01B 4FCYA 2GM4A 1UHSA 2PMZN 4LB5A 3DPTA 4L9TA 4FT8A 1W36C 3BTIA 5F0CA 2FMYA 2CMPA 2L7KA 2VBWA 2L7FP 2JUCA 1I3QJ 5GADJ 1JI8A 2B9SA 4XKBA 1XC5A 1MMGA 1X2NA 2LTPA 1XGSA 1PUFB 3GLLA 1FZPB 3D5SC 1HDPA 4PGGA 3PUBA 1VTNC 3L9FA 2G0EA 3MZYA 5FKOA 5EG0A 1OCOH 2Y31A 4CZZA 4XQFA 1JXSA 1GVDA 2XIGA 3BTLA 5C3EJ 4JX4A 3BDDA 2EPFA 2HDWA 2TRTA 2VBZA 1UFMA 4XLEA 2XASA 2V6EA 4U87A 4DW6A 1VQLI 2XRNA 2K3PA 3SQNA 3MVPA 5FO5A 2DYSH 1R23A 3T0YA 1ETKA 3RYPA 3S3MA 4P9FA 4HQEA 2XB5A 2EV5A 1FYLA 5HLIA 4ZYGA 5KHDA 1T0FC 3GW2A 3K69A 1BM9A 1B8IA 2BY2A 3DKWA 3BTJA 3FKIJ 1XCVA 2KRCA 3CC7I 1S8NA 2VJIA 1E17A 1HQCA 2HPIA 3K6GA 3IUOA 4M72A 1GXQA 3HOYJ 1ULYA 1A04A 2CFOA 2R7SA 1TT0A 3ERED 3BR2A 3OIPA 5DUIA 4CYDA 1FMWA 1S6LA 3OYAA 3FISA 2BE5F 3OIQA 1AU7A 4YFXF 2OAZA 2DTZA 2RAEA 3QU3A 3PO2J 2JVHA 4ZH4F 2IGMA 2QZ8A 2HXOA 4HNTA 2O61A 3CMEI 1IUFA 1MZBA 3ZCOA 5F1JA 4RGUA 1SFOJ 3AL0C 2L0KA 3RKYA 4QLCU 5LFAA 4Q5SF 3K4LA 2OUMA 4XKCA 4DNCA 2O0YA 4B3XA 3FWEA 2KJCA 2L02A 2MC4A 4G94A 2LRDA 3N4MA 2OQRA 4BL0B 3HEFA 4OAZA 3G6EI 3ZGKA 3CCUI 2P7VB 3JRFA 1PP8F 3N05A 1USTA 2F5FA 4EJWA 1EA3A 3H3VK 2ZJRF 4MFEA 3OYNA 2OF7A 1L0OC 5JLWA 1XDUA 3K4KA 1BI1A 1Z3XA 1WGXA 2QYOA 4BHCA 3RKWA 2V9KA 4B8XA 4PJMA 4QPQA 3OS1A 3VWBA 5B1BH 2NOGA 2XRLA 2QCOA 1BOBA 3Q9SA 1U8RA 2DOEA 3J81Z 3SFZA 1ZN2A 5E20A 1FJLA 4G9YA 2M9HA 2HOEA 4AIJA 1NTCA 5M5YJ 3WTZA 2VKDA 1JE8A 3D5LA 4MO7A 1R4MB 4CCOA 2QSGX 2VBYA 3AG3H 2W24A 4E4HA 1TC3C 2M45A 1TNTA 4U0VA 4RLFA 3EDPA 2MW8A 2XROA 3AG1H 3K1NA 2QWWA 1J75A 3BR3A 3PNTA 3M07A 2ACJA 4NQWA 3IRRA 1I1GA 4CUGA 1YHQI 5IP7J 4M3BA 1A35A 1BOAA 1XSXA 2IVMA 1I50J 2ID6A 4CA0A 1UG2A 4XKVA 5BQTA 1O4XA 4OMYA 2DU9A 1D5VA 3MKZA 3W2WA 2HPMA 2NS0A 1VQ8I 1SEUA 2VN2A 2QGUA 4NC6A 2HVSA 4H4KC 5CVUA 4HF1A 3WHCA 2ZXWH 1X4PA 3LSKA 4PJLA 1OCCH 3TP0A 1H89C 4IJAA 4CHUA 4A2UA 2GIVA 1H8AC 5BS6A 4Y3OA 1P9QC 4HOBA 5K1YA 2IW5A 3G4SI 4BU2A 4MLOA 3HGGA 3RQ4A 2HOTA 2R7ZJ 1Z0XA 4LITA 3I71A 1GT0C 4ANJA 2OCCH 3BZKA 4EQQA 1SFKA 1UJ8A 2EILH 2JRMA 2FEZA 1XCBA 2IA2A 5TGTA 3J80K 3MKWB 1QVUA 1LEAA 2XVCA 5E79C 1R5ID 1G59A 1H9TA 3J7AY 4GFBA 3GTQJ 3HUGB 1IDZA 2K27A 3IH3A 4P55A 2NVUB 3ZQIA 4LOCA 2CWEA 4UVCA 4KIFA 4ZJZA 3FHNA 3TDZC 2DXIA 2HOSA 3BJAA 4R1HA 3CMAI 2L9SA 2HQRA 3MMYB 4RM2A 2ZFWA 4MEYF 3L2VA 3NEUA 3WTSC 3JRIA 4PDKA 4DBQA 1BR2A 4N0BA 1T6SA 5FKNA 3WTXC 3PSIA 3M4OJ 1Z6TA 3HZJA 2CJJA 4XLFA 2OZ6A 5EYRA 1K78A 4Y52J 2KPMA 2KDOA 3BROA 3CCJI 3KP4A 3OYJA 1YRNB 3EUKL 2O7OA 3EETA 3V4GA 1ZGJA 1U5TA 3AG4H 3OYCA 4XR6A 3O3KA 2F6CA 3F23A 2ZSIB 1MJBA 2OQGA 4HG2A 3I5UA 2QKMB 4ZTFA 2BHYA 4WXHA 1WJCA 2ESHA 3CC2I 1FEXA 4YELA 1IO2A 2MABA 4OAYA 1RKWA 2IA1A 1IV6A 3RTRA 2P8TA 2R5ZA 1HSTA 1XGNA 3W2VA 1G8XA 2PEXA 3LWFA 4WXCA 1RUOA 2LNBA 2C6YA 2EH3A 5DTDA 3ZMZA 3KLOA 4ZZLA 2CQXA 2QQ9A 2DAOA 2M3AA 4AWXB 1GDTA 2DO7A 1SD6A 3H1CA 3W6JB 3IC7A 1MJAA 2CSOA 1HKQA 1JT6A 3E6BA 1TQIA 5CQGA 1VNDA 2MC3A 1TQMA 3VSKA 3CF2A 1D1AA 5KAFC 5IPAA 3GTMJ 1WKMA 1R5GA 3K2ZA 3ELKA 4GXOA 4ESFA 5D4RA 3EQLF 1BI3A 3BR6A 4JP0A 3DBHB 1PUEE 1XGOA 4A3JJ 1PJRA 3QYBA 4A3DJ 4HQMA 3WU0A 1ODDA 1S9HA 4A3GJ 3AFHA 4G7ZF 1LEBA 1E3HA 4PZJA 2R7OA 3G2BA 5M5XJ 4S0HB 3ESWB 4OIQF 1MH4A 2LKXA 5K5QA 2BXYA 1JKPC 3PQKA 4XK4A 4O5VA 3ZN0A 4AVPA 1QBJA 3IH4A 1KYWA 1S7AA 2XF5A 3KZIC 3SYTA 1U6GA 2QLZA 1WJAA 3DLLF 3B02A 4V19K 1MD0A 2G9WA 4WX9A 2GA1A 2P6TA 4AM3A 1YX3A 2KISA 4L9JA 4P9UA 4DYQA 3EUHC 1O3SA 5DCMB 2BEOA 2EFNA 2VB6A 3H35A 4XLHA 4JK1X 2CQNA 3C1DA 1I6XA 2CV0A 4JX5A 3JTGA 1LQ1A 2RDPA 2Z3YA 4XL9A 1AA7A 1ON1A 2RGVA 2PQ8A 1SAUA 2HS5A 1H88C 1UHMA 2VT2A 2M5WA 3H0GJ 3QPLA 4HNUA 1HKSA 4PGHA 1K4TA 2VJ5A 2BHZA 1N77A 2F4IA 3OY9A 3BQZA 1EF4A 3T1BA 2LBFA 4ZTJA 1IXRC 2IP2A 4B1RA 4BQQA 1Z7LA 2CQ7A 4HDVA 3W3CA 2V26A 2JA6J 1TT5B 3CF5F 4HBLA 4Q4ZF 1S7OA 1WRJA 4Y17A 3CJRB 3GCMA 4JYKA 2ZMEA 1XSVA 1V54H 4MQ9F 5IY5H 3FXMA 4D1QA 4H0EA 2WTEA 2NOJB 4M71A 3LA2A 2OD5A 4GYGA 4LFUA 1XTAA 5CLSA 3IKTA 1P7IA 2H1LA 2P7CB 2L54A 2OZUA 1M1EB 1FOXA 2YSRA 1YW8A 2CG4A 2BVMA 4M9XA 2QEXI 3BG7A 3S32A 3PM1A 1KZHA 3QP6A 2R3SA 3KP2A 4M3GA 4BHBA 2K02A 2DI3A 2VL8A 3PIOF 1WHUA 1JUPA 3CMYA 1KU3A 3SFIA 2V9PA 1F9NA 2IPQX 3S3OA 4WF2A 1KGSA 2YUSA 3TL4X 3CDLA 5J1RA 3DEEA 3BC8A 2KL4A 1Y0NA 1JKOC 1QNTA 1E0EA 4UNOA 2IS2A 2A69F 3PSFA 1W5CC 2L9VA 1FBQA 3F3XA 4F91B 4OOIA 3S1QJ 4LIUA 2HQAA 3FMSA 2ZSHB 3K4BA 1A5JA 3DQVC 4C3JJ 1BC8C 1G3SA 3VYUB 1RPWA 3DP7A 5JHFA 3EYIA 4KMFA 3E5UA 3KEOA 1T39A 3CQZJ 1HA8A 5K7HA 1P4AA 4FETA 5J47A 5K5RA 3D1NI 2MH9A 5IP6A 4I76A 4I98B 1OISA 1P7JA 1G6NA 5ILSA 2STWA 4LD5A 3OV8A 5AIQA 2CH0A 3K70C 4CZCA 2JA7J 3A01A 2K85A 3OL3A 2Y69H 3L1PA 4FASD 1XMKA 3B6CA 2WAEA 1IJWC 3DV8A 1BR1A 1WJDA 1LE8B 3DCFA 3FXOA 1APLC 3RZOJ 3AL0B 1C0WA 4OIPF 3OOUA 1U9OA 3RPUA 4E7ZA 3K2AA 1J5YA 1SVLA 2KFDA 1K4SA 4BBRJ 1SD7A 5D5VB 1PUFA 3J81K 5BNGA 1R1UA 3J80Z 4XIDA 1GUUA 2Q2EB 4II2A 1I1SA 4UB8C 3I53A 4A6EA 1MMNA 2WBMA 1X1PA 3AG2H 4DGWB 4BY7J 1FBSA 4OIRF 3QP5A 4BJ5C 4WWCA 5HVQC 1V5FA 2VUMJ 2ECBA 2W84A 3H9JA 4HPQA 4ZYHA 4I6ZA 1K6OA 1IUYA 1D0ZA 4TV7A 1Y1WJ 3CJNA 2DA4A 2IEKA 1HDDC 1TWFJ 1T98A 4J01A 1ETXA 5CVIA 2P4WA 4A3FJ 1TLHB 1P4XA 2CGPA 2V1UA 1QZYA 1Y8QB 3LSJA 5LEJA 2QM3A 3BR5A 2Z9OA 2GXGA 1ZG5A 2JUGA 2HTSA 1STZA 5EZGA 2FNAA 3QAHA 3FXKA 3L2UA 3LAJA 3M8EA 1FLIA 1OCTC 1EKEA 4KYWA 4B09A 1Y0UA 5ED4A 5EEHA 2LR8A 3H3ZA 4C30A 3T5XA 1VQ4I 2N8GA 3Q5FA 3DEWA 4A3KJ 2W7NA 2QSFX 2E35A 1DP3A 1ZRCA 5L3GA 3CESA 1PDNC 2IGOA 3G71I 4WXDA 1FIAA 3F8MA 2JQ7A 1FX7A 2MLKA 1A36A 4I7HA 2A6HF 5TRDA 1QPIA 3I4PA 3LAPA 3TOAA 5B5EC 4XICA 2ZO4A 2DMNA 4P96A 1JTYA 3DPLC 1MSEC 2WADA 4S04A 2CW7A 2R7QA 2D1HA 5J3LA 1H9GA 2NNYA 1HLVA 1IN4A 3G1MA 3HDDA 2XSDC 2F48A 2E36A 2RNGA 2DA1A 3HKZA 4RGXA 3ABTA 1IC8A 5DV5A 3CJSB 2EWNA 4IEJA 2X6OA 4L9VA 4EV0A 2LYCA 3GTPJ 2VONA 3EUAA 3C2HA 1SC7A 2D5VA 1A6IA 2XAQA 3PFYA 3PO3J 3VB2A 4EM0B 4O6JA 2H1KA 3J7AO 4PCQA 3I64A 4RGRA 4IO9F 2BW3B 2DYRH 2LF7A 5CVVA 4HZFA 3MZHA 2DT7B 4ZDLA 2BY1A 4XOTA 1JKQC 2DPDA 2VE9A 2FUG2 3HL2A 4ENJA 2STTA 1FWZA 4X6AJ 4M6XA 4MFDA 2VOOA 1YOVB 3S93A 1FYKA 4L18B 4RB1A 4ZYAA 4RBOA 3FXLA 1F36A 3E5QA 1Z3YA 4ETSA 3LSTA 2PMHA 1G3WA 4U88A 2FE3A 2FBIA 3PJRA 3F6OA 3K4JA 2K7LA 5EEGA 4LK0F 1WH7A 3FM5A 2CFXA 3S1MJ 1XSDA 4A3LJ 1N78A 4CXFA 4BACA 3OWTA 2WAQA 1VQKI 3BG5A 5H6RA 2LVSA 2RN7A 5M3FJ 2DFIA 5JR3A 1WH5A 4M74A 1U3EM 1KONA 4KT6A 4HRIA 4ESBA 3H0DA 1X19A 5FKKA 4XORA 3RSNA 1JKRC 2XPVA 1T56A 4BJ6C 5DM7F 2K9LA 4PFOA 3HXLA 3JW4A 3U9GA 3FBNB 4IHYA 3M8JA 2X48A 5DS9A 2VI6A 2IS6A 2Y2ZA 3NARA 2JN6A 3CUQC 2B0LA 2JRTA 2COMA 4N9HA 3M3YJ 4PUSA 5LGTA 2K3FA 1SD4A 2Y48A 5JHUA 2BYVE 3R60A 5HDNA 3ZOBA 4F55A 4HX8A 2XGEA 2LD5A 2ZBKA 2R4GA 4OIOF 2FU4A 1T95A 1ZAOA 2JA2A 2DA2A 3G1LA 4N9IA 4BHPA 2R93J 4QTRA 4RAZA 3S14J 3D0SA 4E6KG 3RJPA 3GFIA 3ECHA 1RRJA 3V7CA 1V5GA 1IRFA 3JTHA 3QQAA 2BY3A 4BXXJ 2K4BA 3FXJA 2DA6A 4XBFA 1O3RA 4LG3A 3FK7A 3HUGA 3RKQA 1K6YA 4LLLA 2O03A 3BG6A 1D1CA 3I4MJ 2E2HJ 2HVRA 2JWTA 3KPHA 2X1CA 3GO5A 4KISA 1IN7A 5FKMA 1ETWA 3KZZA 4RAFA 1RIOH 2G7UA 5DCFA 1MKMA 2Y0SA 1S72I 1LFBA 4IPAA 3CCYA 4U7DA 2VLAA 3ABLH 2X9DA 2JTVA 2HTJA 3KCCA 1LKXA 4BKXA 1XMXA 3L00A 3E97A 5JLXA 4FE4A 4BBSJ 2FBHA 3DEUA 2KIFA 3FMQA 1YRNA 5E1ZB 5EGOB 3KFWX 5FKLA 1S7EA 2PJRB 4M9ZA 1BC7C 2X1EA 2E2JJ 4ZZDA 1VQ9I 1YI2I 2RC4A 3H5NA 3KZYA 5F1RA 2DMQA 1FYMA 4K2EA 5E1XA 4D9JA 1JTXA 2EV0A 2LP0A 2BBYA 4EGYA 3HRUA 3QPSA 1ZR4A 2WB1N 4GO1A 3HTUA 4AUXA 2EIKH 2B63J 2D1VA 2X85A 1GV2A 3CP2A 2UXXA 3E0JB 3A2KA 4G7HF 2CQKA 4HLXA 4CYCB 2JSPA 2HR3A 3F8NA 2LC2A 5FROA 4YFNF 2GIZA 2IGKA 4ENKA 1QGPA 1BJZA 1ON2A 2F5CA 1MBHA 1Z67A 3WTUC 3LSPA 5DEQA 3OYFA 2LF8A 4BUPA 5TJJA 1OKRA 2K40A 9ANTA 2FQ4A 1UCRA 4E7KA 3MD2A 1ZG1A 2HDDA 5J8FA 1WJFA 1TP4A 3H3UA 4RLQA 5GAEJ 2M0CA 3SZGA 2E71A 3BTCA 4LB6B 1TZLA 5L3EA 4IX7A 2KLOA 5FB2A 1Z21A 2KQRA 2HYGD 2XDVA 2E1NA 1HW2A 5IP9J 3OYDA 4MIMA 2E1MC 5LHIA 1YE9A 1X2MA 2KKOA 1TNSA 1HCRA 3ZMTA 1PVEA 1W36D 1G4DA 3GTGJ 3P7NA 2IXSA 2Z16A 4RB2C 4KA4A 1P6RA 4IHTA 4KJZA 3JRGA 4EMSA 2X6XA 1ETOA 1R58A 3TBIA 1SVOA 4JOMA 1VQMI 2CV2A 1W0TA 2VJ4A 4FTHA 3ECOA 5CJ9A 1R7JA 2AQEA 2F4MB 2V6CA 2LKPA 5DCMA 3DBLB 3TGNA 2R92J 3KP6A 3VDXA 1OR7C 4HLYA 1IN5A 3ZQFA 5LD2C 2ZC2A 1G2HA 1YX5A 4MNUA 4PJJA 4EJUA 2R7VA 1X3WB 2GA2A 4HV6A 4DOZA 1K83J 1HW5A 3FXQA 1LDJA 4CCLA 3ZQ7A 4W97A 3M8FA 3DU5A 1XG1A 1VQ5I 3WG9A 2A5YB 2YR2A 4CDGA 3G3ZA 1CF7B 2LREA 5DD4A 1RR8C 5AIPA 1J2XA 1BIAA 1WVRA 1DGWY 5DUKA 4QPOA 3ONQA 4DZJA 3F9KA 1OYWA 2CU7A 2DDAA 2VT3A 2MD5A 1A6QA 1I27A 1LVAA 4C3HJ 1BBYA 1WJ5A 3J7ZI 3I9V2 2UZKA 2LY9A 2XPWA 1B4AA 3V8KA 4FE7A 2DDBA 4AYBN 4EATA 5HS9A 3WGHA 4A6DA 3GLXA 4DIQA 1SFEA 3G1OA 2E5NA 4BJTA 3T8TA 4KIBA 2E7XA 1MMDA 2P6SA 1S5LC 2K4JA 4A5NA 5E3OA 1KQ8A 1YITI 5DD8A 1MDMB 3GMEA 3O8HA 4IKFA 1ZR2A 1W7PB 1NK3P 2RV8A 3GZ6A 3DWLE 2EBIA 3PNYA 3FX3A 3CO6C 3MKLA 2XKPA 4M9SA 2HWVA 3CCMI 3HOSA 3ROUA 4GGGA 3S8PA 3N97A 3H5RA 5L3DA 3E6CC 2Y9YA 2GZWA 1YJ9I 2XF7A 2FNPA 3K0LA 2KP6A 5JI6A 3ZQCA 1Z91A 4BQNA 5DDGA 2FOKA 3CCQI 3DTEA 3BPXA 1O3QA 4GDFA 3QOEA 4I0BA 3CUOA 3GZ5A 3K1MA 5E8IA 1IRGA 1IGNA 2L4MA 5IOYA 1T0FA 1DGRM 4DZPA 3GZNB 4B4CA 3OIOA 3CJQB 3GVAA 3QOPA 3FM3A 2GLOA 3GTJJ 5F0FA 1WFXA 2HGCA 4D7MA 5LEKA 2DPUA 1KQ9A 2GAUA 5HS7A 3CCVI 2VE8A 5J1YA 2DT6A 2CUZA 1Z9CA 2IGNA 2XAJA 3KP3A 1YS6A 3A02A 3JCUC 2R7FA 3H5AA 2XGXA 2YX4A 1AKHB 1NH3A 2W57A 4UUSB 1HKTA 1VQOI 2V1DA 3RCOA 5D5XB 2VJJA 3QYFA 2A07F 3F8CA 1W0UA 3A1YA 3S1NJ 3KX2A 4A3BJ 3MKYB 5BOXA 1LE8A 4A93J 3A4CA 2DODA 3OR2C 5KCMA 2ME0A 3BQYA 3OSGA 2EINH 1R1TA 4OU0A 1VQPI 2M30A 5C4XJ 1TWHJ 4Y33A 5LGUA 3Q0VA 1F43A 1QQIA 3WHBA 1P92A 2W1OA 1Z05A 1S3JA 1FPQA 4G6TB 3F21A 2Q2EA 2MYSA 1OFCX 3BLYA 3ZMSA 1YW7A 5EEAA 2PMZA 5E8GA 2DLLA 2KIMA 4AIHA 2GXBA 4RB3C 3GTLJ 5LBQA 2A05A 3IWZA 2VXZA 2H8WA 2ZNYA 1V5EA 2XC7A 4CICA 3CCRI 3TMOA 1T2KA 2FQ3A 2L7ZA 2QQBA 5D8LB 1QVTA 3QPHA 1WWXA 3E6MA 5LHHA 2DK8A 3DXJF 2OJED 1ONVA 3ISPA 3TKYA 1LDDA 2P5VA 5EF6A 3CD6I 2FRHA 2ZJ2A 4F52A 2ZJPF 3IV5A 1FMVA 2QQAA 4B43A 5H20A 1W5TA 1EH8A 1MW7A 4XSXF 5F64A 4LG0B 2EZIA 1I39A 2ELHA 4D5CA 1B9MA 4RA2A 2I8DA 3SHFA 5ILVA 1GHCA 3A03A 2OC6A 3AKZA 5F6FA 5ICGA 3HPGA 4BDYA 1V3FA 5FJ8J 2YPRA 3ZR8X 5F0HA 5L3BA 2WWYA 4UB6C 3V8JA 1EV7A 5LRRA 1Q1HA 2XAGA 3M7GA 1QO0D 2EZLA 2ZCWA 4E7HA 1B6AA 1TTYA 3F8BA 2XV4S 1EH7A 2Y75A 1RC9A 2CW0F 4J00A 1WZ2A 4E7LA 1B59A 4C2UA 3FKJA 5CPRB 2VASA 2HQNA 1USSA 3JREA 2P5KA 3QRFF 2E1OA 2EK5A 4YRVA 2X4HA 1OCPA 4YEJA 2H8RA 3CUQB 3ZQQA 5HOOA 3J7YJ 3HRMA 1ZQ3P 4IHWA 5FLXK 5ERIA 1LFUP 3RPUD 1KA8A 4BAYA 3GFMA 3H9GA 4XLCA 4XM3A 5HS8A 1SANA 5AONA 1Q1VA 1WCMJ 2ID3A 1ETQA 5JVGF 4RB0A 3ABKH 3HYIA 2BOLA 2WC2A 1N25A 4A3MJ 1J7KA 2DFHA 2DK5A 2H6BA 4HF0A 4M73A 1RKTA 1IN6A 5H2FC 3CDIA 1RNLA 4BYYA 3LA7A 2QKLB 2EFWA 1RZ4A 5E17F 3IHUA 3R61A 4BEHB 2NVXJ 4MEXF 3GUDA 2R5YB 4CCNA 3BR0A 3CCSI 2ZFUA 2BW3A 2GBYA 4Q48A 4FHTA 4CCJA 1A31A 1F4KA 1LB2A 2Z33A 3CCEI 3JRDA 2E7WA 3HHHA 3IP4B 4F93B 3HRSA 2JPCA 3L2WA 2HU9A 3HGYA 3S17J 1SFXA 3GF2A 5E3MA 4UV9A 5J4YA 1WQ2A 1OQYA 4X1EA 1SMYF 1I5ZA 2M7BA 5ICCA 1B9NA 3F0CA 2R5ZB 4YFKF 4L0YB 1B72B 1ORKA 3FIWA 3WU2C 3I58A 1CQTA 1YQAA 2JJ7A 1I6HJ 2XAHA 4ZDPA 2E2IJ 1Z1DA 1ZG3A 2V79A 3UNGC 2FSWA 2GQQA 2OPTA 1MBGA 1XPXA 3LQQA 2BXZA 4A0YA 1R6RA 1YLFA 5B3SH 2HKXA 1B1BA 3S16J 4L5IA 2ELKA 4A0XA 1JHFA 3HM5A 2EIJH 1VZ0A 5H6QA 1NHAA 2P5LC 1Y56A 1T08B 3K1PA 4L9NA 5GP9A 5ILUA 3WGIA 5CQEA 2ME6A 3BZCA 2KJBA 2ZXJA 3S2WA 1YJWI 2WV0A 2M1BA 1BI0A 1D0XA 2HYFA 1OPCA 3MWMA 4R79A 4LLGF 4KN7X 3AAFA 3P5JA 2CV1A 1QHHD 3WG7H 1CGPA 2Z1DA 1EH6A 3LSIA 1O3TA 4DYRA 2OTJI 2QVOA 1BR4A 2DFEA 2H09A 2XUBA 2YU3A 3WTWC 1XS9A 1V4RA 4F3QA 2FOWA 4BY1J 2A61A 2NVTJ 1AWCA 4WK8F 4AIKA 4JX6A 4BXFA 5A2QK 3BG3A 2LY2A 3GFJA 1TL8A 1D1BA 2W85A 2EJRA 3SZTA 4UY8I 2MG4A 4XMYA 1HC8A 3OYKA 3P9IA 1X1DA 2E1MB 4E70A 2LMDA 1ZREA 3RIRA 4XSZF 3ZMUA 3EGVB 3KP5A 3QU6A 1Z77A 1QZEA 4RS8A 1F5TA 4XONA 2IS1A 3HBLA 1BW6A 4ZYEA 1LUJB 4II3A 5J8CA 4HAMA 4RM3A 2RQQA 2ISZA 3K7AJ 5GPCA 2L4AA 5EGOA 1U78A 3OOPA 2PJRA 4ITVA 1UZCA 2UV1A 3E3VA 4G6QA 4IRIA 3EUHA 4B44A 4AC0A 5JVTA 3BZ6A 5FGMA 2AXTC 4I01A 3GTKJ 2QENA 1JGSA 1OMIA 2P0WA 3HOVJ 5HLGA 1YIJI 1ZGWA 2QBYB 3HIFA 2RREA 1OJLA 3HOXJ 1KU9A 2XSJC 4M3EA 3TO9A 3WTVC 3OYBA 1DDNA 3TO7A 4A3EJ 1LVKA 3I59B 4CYCA 3LA3A 3CZ6A 2W00A 4LMYA 2QSHX 3Q0WA 2D2WA 5GTHC 1QPMA 1RESA 4KFCA 5IT9Z 2R7TA 1ZELA 1YS7A 5ICFA 2EV6A 2MH2A 4I09A 4L5EA 5IT3A 2WA0A 1MMSA 3F8FA 3OMYA 4V2GA 1MNMC 1TWCJ 2M0MA 2WV1A 3LFKA 2LOOA 1R36A 1JUMA 2EFQA 5HNHA 1FT9A 3IWFA 2HZTA 5FLMJ 2M4GA 3K4CA 2KZVA 1U8BA 2QF7A 3PUFA 4NC7A 3GEZA 2XHKA 1QZZA 1VI0A 3K70D 2L7MP 2WY7Q 2JA5J 3LMMA 2M34A 3UKGA 2EFOA 1MBJA 3DKYA 5K7ZA 1PP7U 2Q8KA 4YIFA 4QSHA 1HOMA 2CUFA 2VOPA 2ECCA 1VF9A 2X0LA 2J5PA 4DBRA 1X58A 2FX0A 1AOYA 2CW8A 4RGSA 2BY0A 5IYDJ 4NDLA 3H9QA 2XGDA 2XGCA 1DPRA 1ZLJA 3SEZA 2XAFA 3HC7A 3FF5A 4AVZA 1WJBA 2BGCA 2CUJA 2QQ8A 3V42A 4OMZA 2DJIA 2VBXA 3JRAA 1EJ9A 4PSWA 2L5QA 4U0WA 4E7IA 3HHGA 3JAMZ 3RI4A 3GX4X 4LJZF 3OYMA 1POGA 1U9NA 1HW1A 1SFUA 3KEYA
chains in the Genus database with same CATH topology
3CJSB 3G6EI 3CCSI 2ZJQF 1Y39A 3CMAI 3CCUI 1VQPI 3CCEI 1VQ5I 5DM6F 4IO9F 2ZJRF 1FOWA 4IOAF 3CCJI 1VQ9I 1YI2I 5GADJ 3I56I 1YIJI 2H8WA 3CCRI 2OTLI 3CJTB 3J7ZI 4IOCF 3CF5F 1QA6A 1VQ7I 3CC2I 3CJRB 1VQLI 3CD6I 1YITI 2ZJPF 2E34A 3PIPF 1VQKI 2NXNB 1FOXA 1ACIA 3CCLI 1MMSA 3CCMI 1YHQI 2QA4I 2QEXI 5DM7F 1YJ9I 1YJWI 3PIOF 1VQ8I 3CC7I 5GAEJ 3CCQI 2K3FA 3I55I 1VQ4I 3CJQB 1YJNI 2OTJI 2E35A 3G4SI 1WIBA 2FOWA 3G71I 3CC4I 2JQ7A 3CCVI 5GAGJ 3J7YJ 1FOYA 3CMEI 1VQMI 4UY8I 1HC8A 1VQ6I 3DLLF 1VQOI 4V19K 5JVGF 5GAHJ 3EGVB 2E36A 1S72I 1VQNI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJS B;  3G6E I;  3CCS I;  2ZJQ F;  1Y39 A;  3CMA I;  3CCU I;  1VQP I;  3CCE I;  1VQ5 I;  5DM6 F;  4IO9 F;  2ZJR F;  1FOW A;  4IOA F;  3CCJ I;  1VQ9 I;  1YI2 I;  5GAD J;  3I56 I;  1YIJ I;  2H8W A;  3CCR I;  2OTL I;  3CJT B;  3J7Z I;  4IOC F;  3CF5 F;  1QA6 A;  1VQ7 I;  3CC2 I;  3CJR B;  1VQL I;  3CD6 I;  1YIT I;  2ZJP F;  2E34 A;  3PIP F;  1VQK I;  2NXN B;  1FOX A;  1ACI A;  3CCL I;  1MMS A;  3CCM I;  1YHQ I;  2QA4 I;  2QEX I;  5DM7 F;  1YJ9 I;  1YJW I;  3PIO F;  1VQ8 I;  3CC7 I;  5GAE J;  3CCQ I;  2K3F A;  3I55 I;  1VQ4 I;  3CJQ B;  1YJN I;  2OTJ I;  2E35 A;  3G4S I;  1WIB A;  2FOW A;  3G71 I;  3CC4 I;  2JQ7 A;  3CCV I;  5GAG J;  3J7Y J;  1FOY A;  3CME I;  1VQM I;  4UY8 I;  1HC8 A;  1VQ6 I;  3DLL F;  1VQO I;  4V19 K;  5JVG F;  5GAH J;  3EGV B;  2E36 A;  1S72 I;  1VQN I; 
#chains in the Genus database with same CATH topology
 4PJ0 C;  1E3P A;  2RQP A;  4CGZ A;  4P5O A;  1R4N B;  2D45 A;  2R7U A;  2OU2 A;  1Y1V J;  3I4N J;  3F72 A;  2ZJQ F;  1UHW A;  5BPD A;  1Y39 A;  4F92 B;  1VFC A;  2X1D A;  1CF7 A;  4A5M A;  3FHZ A;  1U5T C;  1K61 A;  1J9I A;  3K9T A;  4E7J A;  1XN7 A;  2OA4 A;  2PMU A;  2DQR A;  2Q1Z B;  2HYJ A;  3HPH A;  3K4M A;  2DBB A;  5B66 C;  2IRF G;  2KRF A;  5FRN A;  2F5V A;  3ABU A;  1BA5 A;  5FLX Z;  3EYY A;  3FMR A;  2LG4 A;  1XB4 A;  4D0P A;  5LGN A;  1IRZ A;  2MA3 A;  2H27 A;  3CO7 C;  3CLQ A;  4XLA A;  1FSE A;  2HDC A;  3ZPL A;  1IRX A;  2Y0M A;  5EJC A;  2Z99 A;  5CKT A;  3U1K A;  4LK1 F;  2JMW A;  4HA8 A;  3L7W A;  4CCM A;  5B1A H;  1MDM A;  4G8X A;  4EJO A;  3B73 A;  1E3O C;  4BNC A;  1YTY A;  3JRH A;  1W7P A;  2ELJ A;  4GRI A;  3OSF A;  4BQO A;  2K5C A;  4IRH A;  1ZRF A;  2E34 A;  3I3L A;  1J59 A;  1WI9 A;  1V55 H;  3R6S A;  3PIP F;  2W48 A;  3H36 A;  4IZZ A;  1J09 A;  4ENN A;  1ENH A;  2CUE A;  3A0H C;  3CCL I;  1FSH A;  1DP7 P;  4G7O F;  1ETV A;  4LIV A;  4DJA A;  3Q0U A;  2LLK A;  2M8E A;  2KT0 A;  3BCB A;  2JZY A;  2JA8 J;  1ZK8 A;  5J1U A;  1H0M A;  4EJV A;  1W4M A;  5E1W A;  5FD6 A;  2O9L A;  2VC1 A;  4OIN F;  4Y4R A;  4WCG A;  4D5F A;  3U21 A;  2JSC A;  3RZD J;  1O7L A;  1RI7 A;  2DMP A;  5KNL A;  5IYC J;  1F1Z A;  2A5W A;  2V7F A;  5CYV A;  2R7X A;  3PQJ A;  3GYH X;  3SJM A;  2E5Z A;  1R71 A;  2ZXH A;  2IJL A;  1BJA A;  2O8K A;  3CLO A;  2HKO A;  1K79 A;  2PN6 A;  1P4W A;  4QIW N;  1UAA A;  1D8J A;  1RUN A;  4XRS G;  6PAX A;  1MH3 A;  5DYM A;  1AKH A;  4EM2 A;  4MQV A;  3ASO H;  2QUF A;  1WJE A;  4UUS A;  4XRF A;  4KIT B;  2HXI A;  5KAI C;  5J40 A;  3T8R A;  2O3F A;  3GWZ A;  2H6C A;  5HDK A;  3KYC B;  3X2Q H;  3LOC A;  4BE1 A;  3KE2 A;  1RR7 A;  1XX5 A;  4HST A;  3E5X A;  1MMA A;  3WTY C;  4NNJ A;  3QWL A;  1VQN I;  1FC3 A;  1OCZ H;  3BJ6 A;  3CMM A;  4PFP A;  4FIS A;  4GCV A;  3KEQ A;  2XF6 A;  4ON0 A;  2TDX A;  3RPQ A;  1E2X A;  1IG7 A;  3P9C A;  4NC8 A;  4X0G A;  3V7R A;  4J19 A;  1FIP A;  1SD5 A;  2PX9 A;  4KT5 C;  1X4O A;  4BE2 A;  2XAU A;  3ERM A;  5LRS A;  4IQ4 A;  3V8L A;  1QU3 A;  4BDZ A;  2UUZ A;  3DLA A;  1OYY A;  5A2Q Z;  3NAU A;  5HOD A;  1Z6R A;  2DMT A;  2KZG A;  4N4N B;  2A68 F;  3OYL A;  4IOA F;  3UR3 C;  3S1R J;  1GXP A;  1U2W A;  1O7F A;  3PFI A;  4HEA 2;  3RQI A;  1YYV A;  3GTO J;  4Y13 A;  2ZME C;  3BCA A;  4CSW A;  3PNV A;  4KNY A;  1R1V A;  1FOK A;  4G6D A;  4XRM A;  3JRB A;  2I10 A;  1WPK A;  4XNF A;  2DQL A;  1G3T A;  2YU9 J;  5JFR A;  1JGG A;  1ZAR A;  1TW2 A;  4A12 A;  1ETY A;  1HF0 A;  3LQR A;  2NS8 A;  2G7H A;  1T38 A;  5EG0 B;  4P1W A;  3LSH A;  2VKH A;  4LG0 A;  2RNJ A;  4RMN A;  4BH9 A;  2ESN A;  2Q0O A;  1TQP A;  1DPU A;  3WE2 A;  2EB7 A;  2LKS A;  3REO A;  2IT0 A;  2J5O A;  1YO5 C;  1R22 A;  3BR1 A;  3PL8 A;  5FFZ A;  3O2P E;  4M3F A;  4FX4 A;  4O3M A;  2GXA A;  1ZKG A;  2DT5 A;  1DU0 A;  3KIO A;  5M5W J;  1REP C;  2CYY A;  4L0Z B;  5J6X A;  1YW9 A;  1D8K A;  1P2F A;  2HEO A;  1B8I B;  3W2A A;  2V1N A;  3G73 A;  2XPU A;  4DYC A;  1XMA A;  3VEP A;  2MGQ A;  1JT0 A;  4ZDO A;  2YS9 A;  3I55 I;  2V1X A;  4I99 C;  2L9N A;  1GLN A;  3F6V A;  3ZQG A;  3O8G A;  2O8X A;  3M1C A;  5J4V A;  1LPQ A;  4I2O A;  1IN8 A;  2VKV A;  3C2G A;  1JUS A;  3KYD B;  1FBU A;  4EGZ A;  4XKW A;  3ZN1 A;  5KVR A;  1YIO A;  1WIB A;  3Q9V A;  3VFZ A;  3CP8 A;  3CUQ A;  1IXC A;  2PI0 A;  2M4K A;  3CC4 I;  4E7S A;  5BMZ A;  2VPR A;  3C2B A;  4BE0 A;  2EA2 A;  4FQG A;  1JJ6 C;  4A3I J;  4IQJ A;  2DA5 A;  2FML A;  4FX0 A;  2P81 A;  3HOZ J;  1IW7 F;  1X1B A;  4G12 A;  4XN0 A;  1VQ6 I;  4UXN A;  1R00 A;  3SDB A;  3HKZ N;  4MTD A;  2MLG A;  2V4J C;  3TED A;  4BEH A;  3W6V A;  1DQU A;  4EVI A;  5GAH J;  2R5Y A;  2IBD A;  5LLQ A;  1JJ8 C;  1MBK A;  2L2O A;  2X6Y A;  5L3F A;  3V7S A;  3C3W A;  5F27 A;  2DMU A;  1U0J A;  5LHG A;  3D5R C;  4DQ2 A;  1YFH A;  2E19 A;  2K9M A;  1X1C A;  4AU7 A;  3DBR B;  4Z6Y A;  3BP8 A;  4UUV A;  4R8H A;  1FNN A;  3JRC A;  4EEF G;  3MQ0 A;  4UVA A;  1QHG A;  3VYT B;  1FOW A;  5HLT A;  2PJP A;  2KHM A;  2M8G X;  4QWQ A;  1HBX G;  1B72 A;  2VQH A;  2KIU A;  3KLN A;  5IYB J;  3HOU J;  1T8I A;  2I5U A;  2BV6 A;  3I56 I;  5HDG A;  4LGW A;  3BPV A;  5E3L A;  3R0J A;  2IS4 A;  2R7R A;  4BGD A;  2FD5 A;  3SEQ A;  2IA0 A;  3ML6 A;  4IOC F;  3DF8 A;  5D8K B;  4RDU A;  5K5O A;  4HW0 A;  1QA6 A;  2B7E A;  4YG2 F;  3R0A A;  3RKX A;  5IT9 K;  3LL7 A;  2WAQ N;  3M1E A;  4XRS A;  3HSE A;  2NVY J;  4XLN F;  2L3D A;  1IXS B;  3TP3 A;  2ZNZ A;  2L9R A;  3MEX A;  3OL4 A;  2DOA A;  3SXY A;  1MGT A;  1QRY A;  3EPZ A;  5EDN A;  1K7A A;  1ACI A;  2F5E A;  2MSY A;  3I0T A;  4PSX A;  1ZH5 A;  3WE3 A;  4KIC A;  2LK2 A;  2LSO A;  3FDY A;  4CH7 A;  4B48 A;  1S29 A;  2RVC A;  2CQQ A;  4NQW B;  4B47 A;  3HG9 A;  3BWG A;  3NQO A;  3BJO A;  1JHH A;  4IHS A;  2OV7 A;  4C3I J;  4BS9 A;  1WI3 A;  1D5Y A;  5FRM A;  1R5H A;  1ZTR A;  3IAS 2;  3DKX A;  3FXR A;  4I0A A;  3L2Q A;  3LSG A;  3JR9 A;  4HDU A;  3VYS B;  2VKE A;  3W6K B;  3JSP A;  1Y8R B;  4BQA A;  2EQR A;  3OS0 A;  2HFH A;  1O57 A;  3BG9 A;  4OWR B;  4IHV A;  3ASN H;  2GOM A;  2HQ5 A;  3FBI B;  1UMQ A;  1IF1 A;  2PG4 A;  3TO6 A;  5GAG J;  2ISY A;  5FD5 A;  4LLN A;  2EZH A;  2L01 A;  2OCE A;  1TBX A;  4Y15 A;  1FOY A;  2AHQ A;  2Z2S B;  1FP2 A;  2O5R A;  3IH2 A;  3JAM K;  3NWT A;  4JBA A;  1UG0 A;  4UV8 A;  5D6E A;  3SZP A;  3K10 A;  3ZXS A;  2K86 A;  2Y0S N;  3DPU A;  3QYE A;  1DU6 A;  4XN3 A;  4CO8 A;  5ICE A;  2F2E A;  4IF4 A;  4CCK A;  3LSR A;  3VYR B;  4B3A A;  2LH9 A;  4RAG A;  3MCZ A;  3ZRG A;  1XGM A;  4S05 A;  3DTI A;  2XKO A;  3NWS A;  4KN4 X;  3O6B B;  1UB9 A;  5TIS C;  4A69 C;  2XB0 X;  3BY6 A;  1ERD A;  3HOT A;  3ZMD A;  2MD0 A;  5F04 A;  2DFF A;  4EM1 A;  2NRA C;  2VQC A;  5DM6 F;  2K9N A;  3C7J A;  4KMU X;  4GYI A;  2TCT A;  2O6G E;  5GTI C;  2M2E A;  1OR7 A;  4KUM A;  5E3N A;  3I54 A;  2R7D A;  4IVN A;  2JK3 A;  4UUT A;  3WU1 B;  2QBY A;  3WOD F;  1MBF A;  2VOD A;  1X1A A;  5BPI A;  3TOB A;  1X3U A;  2CS3 A;  4EJT A;  4F7Z A;  1K78 B;  1LFP A;  2OTL I;  3K4N A;  1R49 A;  3FK6 A;  3I59 A;  2AS5 F;  3MZ8 A;  3IAM 2;  2WB1 A;  4HX7 A;  4MTE A;  1GVJ A;  2RKH A;  1U5T B;  5K7F A;  2HNH A;  4XLP F;  2VIX A;  1BIB A;  2JT1 A;  2NAZ A;  4KDP A;  1KU2 A;  2V9V A;  1BW5 A;  3HSF A;  2ZKZ A;  3OR1 C;  2GOX B;  2HOA A;  3S2H J;  5KK1 A;  2ETH A;  1IZ1 A;  2LFB A;  5M3M J;  2LDU A;  4AD9 A;  3FXU A;  2DTR A;  2M87 A;  1OCR H;  1J0R A;  2VXD A;  2Y30 A;  2KDZ A;  3L2R A;  4L5J A;  3CDH A;  4UVB A;  1HXD A;  1TW3 A;  2HZD A;  3L2C A;  1KU7 A;  4M3D A;  4HF2 A;  3E6D A;  5EZH A;  4C2M J;  3WTT C;  3OYG A;  4ASN A;  4NHJ A;  2H94 A;  4Y7N J;  4D7N A;  3TQN A;  2R7W A;  1IV8 A;  1FTT A;  3U1D A;  2NVQ J;  2DA7 A;  5E18 F;  2X51 A;  3TW6 A;  2EIM H;  3VSL A;  2A6T A;  4IHX A;  4A0Z A;  5D5U B;  2EFP A;  1N75 A;  1YG2 A;  5HNF A;  1Y6I A;  1WSU A;  2K9Q A;  4Z2Y A;  1W5S A;  4A3C J;  1ZLK A;  3BOQ A;  4NB5 A;  5FFX A;  3MFK A;  3OS2 A;  3HRT A;  4IXA A;  2FBK A;  5HLH A;  2E1C A;  1T33 A;  1IAW A;  2X6W A;  4UHT A;  4ESJ A;  2OBP A;  2A3S A;  2ICW G;  3S15 J;  2F4O B;  1XD7 A;  1LNW A;  1ZHF A;  3OYE A;  1RET A;  1LDK B;  3IRQ A;  2WAF A;  3HSR A;  2DOF A;  2FXA A;  2DCE A;  4HNV A;  2NYX A;  3VOE A;  1AHD P;  2BZT A;  2DW4 A;  4YII A;  4M6V A;  2NNN A;  4IL6 C;  3L09 A;  1BN5 A;  4V2F A;  3S3N A;  3VPR A;  1OYI A;  3TDU C;  2YX7 A;  2UWM A;  2KIQ A;  2ZB9 A;  4Q47 A;  5IOZ A;  3SDG A;  4M6Y A;  1FY7 A;  3DU6 A;  3OYI A;  3NRV A;  5D4S A;  2A6E F;  1HSJ A;  3DTK A;  2JPB A;  4IRG A;  5GPA A;  1KYZ A;  2NS7 A;  3JSO A;  4NBQ A;  1OLT A;  5D5W B;  4N4O B;  5D6F A;  1DUX C;  3B6A A;  1UEL B;  1NK2 P;  2FJ1 A;  1FP1 D;  4C2T A;  2CO5 A;  3A0B C;  3GBG A;  5L3C A;  2FA5 A;  3E1S A;  4U7B A;  5CVJ A;  3RYR A;  2PLY A;  3HTS B;  3ZMV A;  1SAX A;  3CJT B;  3R4K A;  4JQF A;  1MSF C;  2VQL A;  2ZXI A;  2KRH A;  3DFG A;  2Z5U A;  2W82 A;  1BI2 A;  2LBF B;  2E60 A;  1MND A;  3GFL A;  1MBE A;  1VQ7 I;  3BT9 A;  4HX4 A;  4PK4 A;  1XDS A;  3C18 A;  2COB A;  3LFU A;  4AYB A;  4ZYD A;  4MHG A;  1PYV A;  1ZYR F;  3HJE A;  2ADU A;  3F22 A;  2WY8 Q;  3QOD A;  1I3A A;  4HV5 A;  3ULQ B;  3WGG A;  3MN2 A;  2ZME B;  2IAI A;  3KET A;  2BVL A;  2PFB A;  2VQG A;  2NXN B;  4U0Y A;  2CRG A;  2AXL A;  1MNE A;  2AQF A;  4AID A;  2QA4 I;  2K9S A;  1D3Y A;  3MAJ A;  4XOP A;  1ZGA A;  1SVM A;  4KIG A;  3RDI A;  2DJN A;  2F5D A;  3E7L A;  1SMT A;  2GWR A;  2JVG A;  2AO9 A;  4HSR A;  2Y9Z A;  2KMU A;  2MFZ A;  2MBF A;  2PBI A;  4NUB A;  3ZQL A;  3COA C;  3KYL A;  3LSM A;  3HOW J;  1KQ0 A;  2DN0 A;  1MJ9 A;  4ENM A;  2UXN A;  3U2R A;  3OYH A;  5C4J J;  1GV5 A;  3FZV A;  3IL2 A;  3QPT A;  4RAY A;  1YJN I;  5FLV A;  2DA3 A;  2R0Q C;  5CVR A;  4PJN A;  1Z7U A;  2M7A A;  4C9Y A;  3S2D J;  3ABM H;  1FTZ A;  3TW7 A;  4MGR A;  1TWA J;  1LJ9 A;  2EZK A;  1L3L A;  1D0Y A;  1TWG J;  4HYE A;  4W1U A;  1ZRD A;  2HVQ A;  3ZQH A;  5F08 A;  3P9K A;  3VOD A;  1X3Z B;  5C44 J;  4ABZ A;  3HB9 A;  2LY1 A;  4BXU A;  3H92 A;  4YIR X;  3LNQ A;  1ITY A;  2VC0 A;  3IKV A;  3ZP5 A;  1R9T J;  1NG6 A;  2HI3 A;  3CTA A;  2FF4 A;  1NG7 A;  3Q3S A;  1MIJ A;  4ZC3 A;  1W1W E;  2VPL A;  2EA4 A;  4I02 A;  1G3Y A;  1BL0 A;  3M9A A;  2W25 A;  1W7P D;  2W4S A;  1IDY A;  3GXO A;  3KP7 A;  3A01 B;  4FCY A;  2GM4 A;  1UHS A;  2PMZ N;  4LB5 A;  3DPT A;  4L9T A;  4FT8 A;  1W36 C;  3BTI A;  5F0C A;  2FMY A;  2CMP A;  2L7K A;  2VBW A;  2L7F P;  2JUC A;  1I3Q J;  5GAD J;  1JI8 A;  2B9S A;  4XKB A;  1XC5 A;  1MMG A;  1X2N A;  2LTP A;  1XGS A;  1PUF B;  3GLL A;  1FZP B;  3D5S C;  1HDP A;  4PGG A;  3PUB A;  1VTN C;  3L9F A;  2G0E A;  3MZY A;  5FKO A;  5EG0 A;  1OCO H;  2Y31 A;  4CZZ A;  4XQF A;  1JXS A;  1GVD A;  2XIG A;  3BTL A;  5C3E J;  4JX4 A;  3BDD A;  2EPF A;  2HDW A;  2TRT A;  2VBZ A;  1UFM A;  4XLE A;  2XAS A;  2V6E A;  4U87 A;  4DW6 A;  1VQL I;  2XRN A;  2K3P A;  3SQN A;  3MVP A;  5FO5 A;  2DYS H;  1R23 A;  3T0Y A;  1ETK A;  3RYP A;  3S3M A;  4P9F A;  4HQE A;  2XB5 A;  2EV5 A;  1FYL A;  5HLI A;  4ZYG A;  5KHD A;  1T0F C;  3GW2 A;  3K69 A;  1BM9 A;  1B8I A;  2BY2 A;  3DKW A;  3BTJ A;  3FKI J;  1XCV A;  2KRC A;  3CC7 I;  1S8N A;  2VJI A;  1E17 A;  1HQC A;  2HPI A;  3K6G A;  3IUO A;  4M72 A;  1GXQ A;  3HOY J;  1ULY A;  1A04 A;  2CFO A;  2R7S A;  1TT0 A;  3ERE D;  3BR2 A;  3OIP A;  5DUI A;  4CYD A;  1FMW A;  1S6L A;  3OYA A;  3FIS A;  2BE5 F;  3OIQ A;  1AU7 A;  4YFX F;  2OAZ A;  2DTZ A;  2RAE A;  3QU3 A;  3PO2 J;  2JVH A;  4ZH4 F;  2IGM A;  2QZ8 A;  2HXO A;  4HNT A;  2O61 A;  3CME I;  1IUF A;  1MZB A;  3ZCO A;  5F1J A;  4RGU A;  1SFO J;  3AL0 C;  2L0K A;  3RKY A;  4QLC U;  5LFA A;  4Q5S F;  3K4L A;  2OUM A;  4XKC A;  4DNC A;  2O0Y A;  4B3X A;  3FWE A;  2KJC A;  2L02 A;  2MC4 A;  4G94 A;  2LRD A;  3N4M A;  2OQR A;  4BL0 B;  3HEF A;  4OAZ A;  3G6E I;  3ZGK A;  3CCU I;  2P7V B;  3JRF A;  1PP8 F;  3N05 A;  1UST A;  2F5F A;  4EJW A;  1EA3 A;  3H3V K;  2ZJR F;  4MFE A;  3OYN A;  2OF7 A;  1L0O C;  5JLW A;  1XDU A;  3K4K A;  1BI1 A;  1Z3X A;  1WGX A;  2QYO A;  4BHC A;  3RKW A;  2V9K A;  4B8X A;  4PJM A;  4QPQ A;  3OS1 A;  3VWB A;  5B1B H;  2NOG A;  2XRL A;  2QCO A;  1BOB A;  3Q9S A;  1U8R A;  2DOE A;  3J81 Z;  3SFZ A;  1ZN2 A;  5E20 A;  1FJL A;  4G9Y A;  2M9H A;  2HOE A;  4AIJ A;  1NTC A;  5M5Y J;  3WTZ A;  2VKD A;  1JE8 A;  3D5L A;  4MO7 A;  1R4M B;  4CCO A;  2QSG X;  2VBY A;  3AG3 H;  2W24 A;  4E4H A;  1TC3 C;  2M45 A;  1TNT A;  4U0V A;  4RLF A;  3EDP A;  2MW8 A;  2XRO A;  3AG1 H;  3K1N A;  2QWW A;  1J75 A;  3BR3 A;  3PNT A;  3M07 A;  2ACJ A;  4NQW A;  3IRR A;  1I1G A;  4CUG A;  1YHQ I;  5IP7 J;  4M3B A;  1A35 A;  1BOA A;  1XSX A;  2IVM A;  1I50 J;  2ID6 A;  4CA0 A;  1UG2 A;  4XKV A;  5BQT A;  1O4X A;  4OMY A;  2DU9 A;  1D5V A;  3MKZ A;  3W2W A;  2HPM A;  2NS0 A;  1VQ8 I;  1SEU A;  2VN2 A;  2QGU A;  4NC6 A;  2HVS A;  4H4K C;  5CVU A;  4HF1 A;  3WHC A;  2ZXW H;  1X4P A;  3LSK A;  4PJL A;  1OCC H;  3TP0 A;  1H89 C;  4IJA A;  4CHU A;  4A2U A;  2GIV A;  1H8A C;  5BS6 A;  4Y3O A;  1P9Q C;  4HOB A;  5K1Y A;  2IW5 A;  3G4S I;  4BU2 A;  4MLO A;  3HGG A;  3RQ4 A;  2HOT A;  2R7Z J;  1Z0X A;  4LIT A;  3I71 A;  1GT0 C;  4ANJ A;  2OCC H;  3BZK A;  4EQQ A;  1SFK A;  1UJ8 A;  2EIL H;  2JRM A;  2FEZ A;  1XCB A;  2IA2 A;  5TGT A;  3J80 K;  3MKW B;  1QVU A;  1LEA A;  2XVC A;  5E79 C;  1R5I D;  1G59 A;  1H9T A;  3J7A Y;  4GFB A;  3GTQ J;  3HUG B;  1IDZ A;  2K27 A;  3IH3 A;  4P55 A;  2NVU B;  3ZQI A;  4LOC A;  2CWE A;  4UVC A;  4KIF A;  4ZJZ A;  3FHN A;  3TDZ C;  2DXI A;  2HOS A;  3BJA A;  4R1H A;  3CMA I;  2L9S A;  2HQR A;  3MMY B;  4RM2 A;  2ZFW A;  4MEY F;  3L2V A;  3NEU A;  3WTS C;  3JRI A;  4PDK A;  4DBQ A;  1BR2 A;  4N0B A;  1T6S A;  5FKN A;  3WTX C;  3PSI A;  3M4O J;  1Z6T A;  3HZJ A;  2CJJ A;  4XLF A;  2OZ6 A;  5EYR A;  1K78 A;  4Y52 J;  2KPM A;  2KDO A;  3BRO A;  3CCJ I;  3KP4 A;  3OYJ A;  1YRN B;  3EUK L;  2O7O A;  3EET A;  3V4G A;  1ZGJ A;  1U5T A;  3AG4 H;  3OYC A;  4XR6 A;  3O3K A;  2F6C A;  3F23 A;  2ZSI B;  1MJB A;  2OQG A;  4HG2 A;  3I5U A;  2QKM B;  4ZTF A;  2BHY A;  4WXH A;  1WJC A;  2ESH A;  3CC2 I;  1FEX A;  4YEL A;  1IO2 A;  2MAB A;  4OAY A;  1RKW A;  2IA1 A;  1IV6 A;  3RTR A;  2P8T A;  2R5Z A;  1HST A;  1XGN A;  3W2V A;  1G8X A;  2PEX A;  3LWF A;  4WXC A;  1RUO A;  2LNB A;  2C6Y A;  2EH3 A;  5DTD A;  3ZMZ A;  3KLO A;  4ZZL A;  2CQX A;  2QQ9 A;  2DAO A;  2M3A A;  4AWX B;  1GDT A;  2DO7 A;  1SD6 A;  3H1C A;  3W6J B;  3IC7 A;  1MJA A;  2CSO A;  1HKQ A;  1JT6 A;  3E6B A;  1TQI A;  5CQG A;  1VND A;  2MC3 A;  1TQM A;  3VSK A;  3CF2 A;  1D1A A;  5KAF C;  5IPA A;  3GTM J;  1WKM A;  1R5G A;  3K2Z A;  3ELK A;  4GXO A;  4ESF A;  5D4R A;  3EQL F;  1BI3 A;  3BR6 A;  4JP0 A;  3DBH B;  1PUE E;  1XGO A;  4A3J J;  1PJR A;  3QYB A;  4A3D J;  4HQM A;  3WU0 A;  1ODD A;  1S9H A;  4A3G J;  3AFH A;  4G7Z F;  1LEB A;  1E3H A;  4PZJ A;  2R7O A;  3G2B A;  5M5X J;  4S0H B;  3ESW B;  4OIQ F;  1MH4 A;  2LKX A;  5K5Q A;  2BXY A;  1JKP C;  3PQK A;  4XK4 A;  4O5V A;  3ZN0 A;  4AVP A;  1QBJ A;  3IH4 A;  1KYW A;  1S7A A;  2XF5 A;  3KZI C;  3SYT A;  1U6G A;  2QLZ A;  1WJA A;  3DLL F;  3B02 A;  4V19 K;  1MD0 A;  2G9W A;  4WX9 A;  2GA1 A;  2P6T A;  4AM3 A;  1YX3 A;  2KIS A;  4L9J A;  4P9U A;  4DYQ A;  3EUH C;  1O3S A;  5DCM B;  2BEO A;  2EFN A;  2VB6 A;  3H35 A;  4XLH A;  4JK1 X;  2CQN A;  3C1D A;  1I6X A;  2CV0 A;  4JX5 A;  3JTG A;  1LQ1 A;  2RDP A;  2Z3Y A;  4XL9 A;  1AA7 A;  1ON1 A;  2RGV A;  2PQ8 A;  1SAU A;  2HS5 A;  1H88 C;  1UHM A;  2VT2 A;  2M5W A;  3H0G J;  3QPL A;  4HNU A;  1HKS A;  4PGH A;  1K4T A;  2VJ5 A;  2BHZ A;  1N77 A;  2F4I A;  3OY9 A;  3BQZ A;  1EF4 A;  3T1B A;  2LBF A;  4ZTJ A;  1IXR C;  2IP2 A;  4B1R A;  4BQQ A;  1Z7L A;  2CQ7 A;  4HDV A;  3W3C A;  2V26 A;  2JA6 J;  1TT5 B;  3CF5 F;  4HBL A;  4Q4Z F;  1S7O A;  1WRJ A;  4Y17 A;  3CJR B;  3GCM A;  4JYK A;  2ZME A;  1XSV A;  1V54 H;  4MQ9 F;  5IY5 H;  3FXM A;  4D1Q A;  4H0E A;  2WTE A;  2NOJ B;  4M71 A;  3LA2 A;  2OD5 A;  4GYG A;  4LFU A;  1XTA A;  5CLS A;  3IKT A;  1P7I A;  2H1L A;  2P7C B;  2L54 A;  2OZU A;  1M1E B;  1FOX A;  2YSR A;  1YW8 A;  2CG4 A;  2BVM A;  4M9X A;  2QEX I;  3BG7 A;  3S32 A;  3PM1 A;  1KZH A;  3QP6 A;  2R3S A;  3KP2 A;  4M3G A;  4BHB A;  2K02 A;  2DI3 A;  2VL8 A;  3PIO F;  1WHU A;  1JUP A;  3CMY A;  1KU3 A;  3SFI A;  2V9P A;  1F9N A;  2IPQ X;  3S3O A;  4WF2 A;  1KGS A;  2YUS A;  3TL4 X;  3CDL A;  5J1R A;  3DEE A;  3BC8 A;  2KL4 A;  1Y0N A;  1JKO C;  1QNT A;  1E0E A;  4UNO A;  2IS2 A;  2A69 F;  3PSF A;  1W5C C;  2L9V A;  1FBQ A;  3F3X A;  4F91 B;  4OOI A;  3S1Q J;  4LIU A;  2HQA A;  3FMS A;  2ZSH B;  3K4B A;  1A5J A;  3DQV C;  4C3J J;  1BC8 C;  1G3S A;  3VYU B;  1RPW A;  3DP7 A;  5JHF A;  3EYI A;  4KMF A;  3E5U A;  3KEO A;  1T39 A;  3CQZ J;  1HA8 A;  5K7H A;  1P4A A;  4FET A;  5J47 A;  5K5R A;  3D1N I;  2MH9 A;  5IP6 A;  4I76 A;  4I98 B;  1OIS A;  1P7J A;  1G6N A;  5ILS A;  2STW A;  4LD5 A;  3OV8 A;  5AIQ A;  2CH0 A;  3K70 C;  4CZC A;  2JA7 J;  3A01 A;  2K85 A;  3OL3 A;  2Y69 H;  3L1P A;  4FAS D;  1XMK A;  3B6C A;  2WAE A;  1IJW C;  3DV8 A;  1BR1 A;  1WJD A;  1LE8 B;  3DCF A;  3FXO A;  1APL C;  3RZO J;  3AL0 B;  1C0W A;  4OIP F;  3OOU A;  1U9O A;  3RPU A;  4E7Z A;  3K2A A;  1J5Y A;  1SVL A;  2KFD A;  1K4S A;  4BBR J;  1SD7 A;  5D5V B;  1PUF A;  3J81 K;  5BNG A;  1R1U A;  3J80 Z;  4XID A;  1GUU A;  2Q2E B;  4II2 A;  1I1S A;  4UB8 C;  3I53 A;  4A6E A;  1MMN A;  2WBM A;  1X1P A;  3AG2 H;  4DGW B;  4BY7 J;  1FBS A;  4OIR F;  3QP5 A;  4BJ5 C;  4WWC A;  5HVQ C;  1V5F A;  2VUM J;  2ECB A;  2W84 A;  3H9J A;  4HPQ A;  4ZYH A;  4I6Z A;  1K6O A;  1IUY A;  1D0Z A;  4TV7 A;  1Y1W J;  3CJN A;  2DA4 A;  2IEK A;  1HDD C;  1TWF J;  1T98 A;  4J01 A;  1ETX A;  5CVI A;  2P4W A;  4A3F J;  1TLH B;  1P4X A;  2CGP A;  2V1U A;  1QZY A;  1Y8Q B;  3LSJ A;  5LEJ A;  2QM3 A;  3BR5 A;  2Z9O A;  2GXG A;  1ZG5 A;  2JUG A;  2HTS A;  1STZ A;  5EZG A;  2FNA A;  3QAH A;  3FXK A;  3L2U A;  3LAJ A;  3M8E A;  1FLI A;  1OCT C;  1EKE A;  4KYW A;  4B09 A;  1Y0U A;  5ED4 A;  5EEH A;  2LR8 A;  3H3Z A;  4C30 A;  3T5X A;  1VQ4 I;  2N8G A;  3Q5F A;  3DEW A;  4A3K J;  2W7N A;  2QSF X;  2E35 A;  1DP3 A;  1ZRC A;  5L3G A;  3CES A;  1PDN C;  2IGO A;  3G71 I;  4WXD A;  1FIA A;  3F8M A;  2JQ7 A;  1FX7 A;  2MLK A;  1A36 A;  4I7H A;  2A6H F;  5TRD A;  1QPI A;  3I4P A;  3LAP A;  3TOA A;  5B5E C;  4XIC A;  2ZO4 A;  2DMN A;  4P96 A;  1JTY A;  3DPL C;  1MSE C;  2WAD A;  4S04 A;  2CW7 A;  2R7Q A;  2D1H A;  5J3L A;  1H9G A;  2NNY A;  1HLV A;  1IN4 A;  3G1M A;  3HDD A;  2XSD C;  2F48 A;  2E36 A;  2RNG A;  2DA1 A;  3HKZ A;  4RGX A;  3ABT A;  1IC8 A;  5DV5 A;  3CJS B;  2EWN A;  4IEJ A;  2X6O A;  4L9V A;  4EV0 A;  2LYC A;  3GTP J;  2VON A;  3EUA A;  3C2H A;  1SC7 A;  2D5V A;  1A6I A;  2XAQ A;  3PFY A;  3PO3 J;  3VB2 A;  4EM0 B;  4O6J A;  2H1K A;  3J7A O;  4PCQ A;  3I64 A;  4RGR A;  4IO9 F;  2BW3 B;  2DYR H;  2LF7 A;  5CVV A;  4HZF A;  3MZH A;  2DT7 B;  4ZDL A;  2BY1 A;  4XOT A;  1JKQ C;  2DPD A;  2VE9 A;  2FUG 2;  3HL2 A;  4ENJ A;  2STT A;  1FWZ A;  4X6A J;  4M6X A;  4MFD A;  2VOO A;  1YOV B;  3S93 A;  1FYK A;  4L18 B;  4RB1 A;  4ZYA A;  4RBO A;  3FXL A;  1F36 A;  3E5Q A;  1Z3Y A;  4ETS A;  3LST A;  2PMH A;  1G3W A;  4U88 A;  2FE3 A;  2FBI A;  3PJR A;  3F6O A;  3K4J A;  2K7L A;  5EEG A;  4LK0 F;  1WH7 A;  3FM5 A;  2CFX A;  3S1M J;  1XSD A;  4A3L J;  1N78 A;  4CXF A;  4BAC A;  3OWT A;  2WAQ A;  1VQK I;  3BG5 A;  5H6R A;  2LVS A;  2RN7 A;  5M3F J;  2DFI A;  5JR3 A;  1WH5 A;  4M74 A;  1U3E M;  1KON A;  4KT6 A;  4HRI A;  4ESB A;  3H0D A;  1X19 A;  5FKK A;  4XOR A;  3RSN A;  1JKR C;  2XPV A;  1T56 A;  4BJ6 C;  5DM7 F;  2K9L A;  4PFO A;  3HXL A;  3JW4 A;  3U9G A;  3FBN B;  4IHY A;  3M8J A;  2X48 A;  5DS9 A;  2VI6 A;  2IS6 A;  2Y2Z A;  3NAR A;  2JN6 A;  3CUQ C;  2B0L A;  2JRT A;  2COM A;  4N9H A;  3M3Y J;  4PUS A;  5LGT A;  2K3F A;  1SD4 A;  2Y48 A;  5JHU A;  2BYV E;  3R60 A;  5HDN A;  3ZOB A;  4F55 A;  4HX8 A;  2XGE A;  2LD5 A;  2ZBK A;  2R4G A;  4OIO F;  2FU4 A;  1T95 A;  1ZAO A;  2JA2 A;  2DA2 A;  3G1L A;  4N9I A;  4BHP A;  2R93 J;  4QTR A;  4RAZ A;  3S14 J;  3D0S A;  4E6K G;  3RJP A;  3GFI A;  3ECH A;  1RRJ A;  3V7C A;  1V5G A;  1IRF A;  3JTH A;  3QQA A;  2BY3 A;  4BXX J;  2K4B A;  3FXJ A;  2DA6 A;  4XBF A;  1O3R A;  4LG3 A;  3FK7 A;  3HUG A;  3RKQ A;  1K6Y A;  4LLL A;  2O03 A;  3BG6 A;  1D1C A;  3I4M J;  2E2H J;  2HVR A;  2JWT A;  3KPH A;  2X1C A;  3GO5 A;  4KIS A;  1IN7 A;  5FKM A;  1ETW A;  3KZZ A;  4RAF A;  1RIO H;  2G7U A;  5DCF A;  1MKM A;  2Y0S A;  1S72 I;  1LFB A;  4IPA A;  3CCY A;  4U7D A;  2VLA A;  3ABL H;  2X9D A;  2JTV A;  2HTJ A;  3KCC A;  1LKX A;  4BKX A;  1XMX A;  3L00 A;  3E97 A;  5JLX A;  4FE4 A;  4BBS J;  2FBH A;  3DEU A;  2KIF A;  3FMQ A;  1YRN A;  5E1Z B;  5EGO B;  3KFW X;  5FKL A;  1S7E A;  2PJR B;  4M9Z A;  1BC7 C;  2X1E A;  2E2J J;  4ZZD A;  1VQ9 I;  1YI2 I;  2RC4 A;  3H5N A;  3KZY A;  5F1R A;  2DMQ A;  1FYM A;  4K2E A;  5E1X A;  4D9J A;  1JTX A;  2EV0 A;  2LP0 A;  2BBY A;  4EGY A;  3HRU A;  3QPS A;  1ZR4 A;  2WB1 N;  4GO1 A;  3HTU A;  4AUX A;  2EIK H;  2B63 J;  2D1V A;  2X85 A;  1GV2 A;  3CP2 A;  2UXX A;  3E0J B;  3A2K A;  4G7H F;  2CQK A;  4HLX A;  4CYC B;  2JSP A;  2HR3 A;  3F8N A;  2LC2 A;  5FRO A;  4YFN F;  2GIZ A;  2IGK A;  4ENK A;  1QGP A;  1BJZ A;  1ON2 A;  2F5C A;  1MBH A;  1Z67 A;  3WTU C;  3LSP A;  5DEQ A;  3OYF A;  2LF8 A;  4BUP A;  5TJJ A;  1OKR A;  2K40 A;  9ANT A;  2FQ4 A;  1UCR A;  4E7K A;  3MD2 A;  1ZG1 A;  2HDD A;  5J8F A;  1WJF A;  1TP4 A;  3H3U A;  4RLQ A;  5GAE J;  2M0C A;  3SZG A;  2E71 A;  3BTC A;  4LB6 B;  1TZL A;  5L3E A;  4IX7 A;  2KLO A;  5FB2 A;  1Z21 A;  2KQR A;  2HYG D;  2XDV A;  2E1N A;  1HW2 A;  5IP9 J;  3OYD A;  4MIM A;  2E1M C;  5LHI A;  1YE9 A;  1X2M A;  2KKO A;  1TNS A;  1HCR A;  3ZMT A;  1PVE A;  1W36 D;  1G4D A;  3GTG J;  3P7N A;  2IXS A;  2Z16 A;  4RB2 C;  4KA4 A;  1P6R A;  4IHT A;  4KJZ A;  3JRG A;  4EMS A;  2X6X A;  1ETO A;  1R58 A;  3TBI A;  1SVO A;  4JOM A;  1VQM I;  2CV2 A;  1W0T A;  2VJ4 A;  4FTH A;  3ECO A;  5CJ9 A;  1R7J A;  2AQE A;  2F4M B;  2V6C A;  2LKP A;  5DCM A;  3DBL B;  3TGN A;  2R92 J;  3KP6 A;  3VDX A;  1OR7 C;  4HLY A;  1IN5 A;  3ZQF A;  5LD2 C;  2ZC2 A;  1G2H A;  1YX5 A;  4MNU A;  4PJJ A;  4EJU A;  2R7V A;  1X3W B;  2GA2 A;  4HV6 A;  4DOZ A;  1K83 J;  1HW5 A;  3FXQ A;  1LDJ A;  4CCL A;  3ZQ7 A;  4W97 A;  3M8F A;  3DU5 A;  1XG1 A;  1VQ5 I;  3WG9 A;  2A5Y B;  2YR2 A;  4CDG A;  3G3Z A;  1CF7 B;  2LRE A;  5DD4 A;  1RR8 C;  5AIP A;  1J2X A;  1BIA A;  1WVR A;  1DGW Y;  5DUK A;  4QPO A;  3ONQ A;  4DZJ A;  3F9K A;  1OYW A;  2CU7 A;  2DDA A;  2VT3 A;  2MD5 A;  1A6Q A;  1I27 A;  1LVA A;  4C3H J;  1BBY A;  1WJ5 A;  3J7Z I;  3I9V 2;  2UZK A;  2LY9 A;  2XPW A;  1B4A A;  3V8K A;  4FE7 A;  2DDB A;  4AYB N;  4EAT A;  5HS9 A;  3WGH A;  4A6D A;  3GLX A;  4DIQ A;  1SFE A;  3G1O A;  2E5N A;  4BJT A;  3T8T A;  4KIB A;  2E7X A;  1MMD A;  2P6S A;  1S5L C;  2K4J A;  4A5N A;  5E3O A;  1KQ8 A;  1YIT I;  5DD8 A;  1MDM B;  3GME A;  3O8H A;  4IKF A;  1ZR2 A;  1W7P B;  1NK3 P;  2RV8 A;  3GZ6 A;  3DWL E;  2EBI A;  3PNY A;  3FX3 A;  3CO6 C;  3MKL A;  2XKP A;  4M9S A;  2HWV A;  3CCM I;  3HOS A;  3ROU A;  4GGG A;  3S8P A;  3N97 A;  3H5R A;  5L3D A;  3E6C C;  2Y9Y A;  2GZW A;  1YJ9 I;  2XF7 A;  2FNP A;  3K0L A;  2KP6 A;  5JI6 A;  3ZQC A;  1Z91 A;  4BQN A;  5DDG A;  2FOK A;  3CCQ I;  3DTE A;  3BPX A;  1O3Q A;  4GDF A;  3QOE A;  4I0B A;  3CUO A;  3GZ5 A;  3K1M A;  5E8I A;  1IRG A;  1IGN A;  2L4M A;  5IOY A;  1T0F A;  1DGR M;  4DZP A;  3GZN B;  4B4C A;  3OIO A;  3CJQ B;  3GVA A;  3QOP A;  3FM3 A;  2GLO A;  3GTJ J;  5F0F A;  1WFX A;  2HGC A;  4D7M A;  5LEK A;  2DPU A;  1KQ9 A;  2GAU A;  5HS7 A;  3CCV I;  2VE8 A;  5J1Y A;  2DT6 A;  2CUZ A;  1Z9C A;  2IGN A;  2XAJ A;  3KP3 A;  1YS6 A;  3A02 A;  3JCU C;  2R7F A;  3H5A A;  2XGX A;  2YX4 A;  1AKH B;  1NH3 A;  2W57 A;  4UUS B;  1HKT A;  1VQO I;  2V1D A;  3RCO A;  5D5X B;  2VJJ A;  3QYF A;  2A07 F;  3F8C A;  1W0U A;  3A1Y A;  3S1N J;  3KX2 A;  4A3B J;  3MKY B;  5BOX A;  1LE8 A;  4A93 J;  3A4C A;  2DOD A;  3OR2 C;  5KCM A;  2ME0 A;  3BQY A;  3OSG A;  2EIN H;  1R1T A;  4OU0 A;  1VQP I;  2M30 A;  5C4X J;  1TWH J;  4Y33 A;  5LGU A;  3Q0V A;  1F43 A;  1QQI A;  3WHB A;  1P92 A;  2W1O A;  1Z05 A;  1S3J A;  1FPQ A;  4G6T B;  3F21 A;  2Q2E A;  2MYS A;  1OFC X;  3BLY A;  3ZMS A;  1YW7 A;  5EEA A;  2PMZ A;  5E8G A;  2DLL A;  2KIM A;  4AIH A;  2GXB A;  4RB3 C;  3GTL J;  5LBQ A;  2A05 A;  3IWZ A;  2VXZ A;  2H8W A;  2ZNY A;  1V5E A;  2XC7 A;  4CIC A;  3CCR I;  3TMO A;  1T2K A;  2FQ3 A;  2L7Z A;  2QQB A;  5D8L B;  1QVT A;  3QPH A;  1WWX A;  3E6M A;  5LHH A;  2DK8 A;  3DXJ F;  2OJE D;  1ONV A;  3ISP A;  3TKY A;  1LDD A;  2P5V A;  5EF6 A;  3CD6 I;  2FRH A;  2ZJ2 A;  4F52 A;  2ZJP F;  3IV5 A;  1FMV A;  2QQA A;  4B43 A;  5H20 A;  1W5T A;  1EH8 A;  1MW7 A;  4XSX F;  5F64 A;  4LG0 B;  2EZI A;  1I39 A;  2ELH A;  4D5C A;  1B9M A;  4RA2 A;  2I8D A;  3SHF A;  5ILV A;  1GHC A;  3A03 A;  2OC6 A;  3AKZ A;  5F6F A;  5ICG A;  3HPG A;  4BDY A;  1V3F A;  5FJ8 J;  2YPR A;  3ZR8 X;  5F0H A;  5L3B A;  2WWY A;  4UB6 C;  3V8J A;  1EV7 A;  5LRR A;  1Q1H A;  2XAG A;  3M7G A;  1QO0 D;  2EZL A;  2ZCW A;  4E7H A;  1B6A A;  1TTY A;  3F8B A;  2XV4 S;  1EH7 A;  2Y75 A;  1RC9 A;  2CW0 F;  4J00 A;  1WZ2 A;  4E7L A;  1B59 A;  4C2U A;  3FKJ A;  5CPR B;  2VAS A;  2HQN A;  1USS A;  3JRE A;  2P5K A;  3QRF F;  2E1O A;  2EK5 A;  4YRV A;  2X4H A;  1OCP A;  4YEJ A;  2H8R A;  3CUQ B;  3ZQQ A;  5HOO A;  3J7Y J;  3HRM A;  1ZQ3 P;  4IHW A;  5FLX K;  5ERI A;  1LFU P;  3RPU D;  1KA8 A;  4BAY A;  3GFM A;  3H9G A;  4XLC A;  4XM3 A;  5HS8 A;  1SAN A;  5AON A;  1Q1V A;  1WCM J;  2ID3 A;  1ETQ A;  5JVG F;  4RB0 A;  3ABK H;  3HYI A;  2BOL A;  2WC2 A;  1N25 A;  4A3M J;  1J7K A;  2DFH A;  2DK5 A;  2H6B A;  4HF0 A;  4M73 A;  1RKT A;  1IN6 A;  5H2F C;  3CDI A;  1RNL A;  4BYY A;  3LA7 A;  2QKL B;  2EFW A;  1RZ4 A;  5E17 F;  3IHU A;  3R61 A;  4BEH B;  2NVX J;  4MEX F;  3GUD A;  2R5Y B;  4CCN A;  3BR0 A;  3CCS I;  2ZFU A;  2BW3 A;  2GBY A;  4Q48 A;  4FHT A;  4CCJ A;  1A31 A;  1F4K A;  1LB2 A;  2Z33 A;  3CCE I;  3JRD A;  2E7W A;  3HHH A;  3IP4 B;  4F93 B;  3HRS A;  2JPC A;  3L2W A;  2HU9 A;  3HGY A;  3S17 J;  1SFX A;  3GF2 A;  5E3M A;  4UV9 A;  5J4Y A;  1WQ2 A;  1OQY A;  4X1E A;  1SMY F;  1I5Z A;  2M7B A;  5ICC A;  1B9N A;  3F0C A;  2R5Z B;  4YFK F;  4L0Y B;  1B72 B;  1ORK A;  3FIW A;  3WU2 C;  3I58 A;  1CQT A;  1YQA A;  2JJ7 A;  1I6H J;  2XAH A;  4ZDP A;  2E2I J;  1Z1D A;  1ZG3 A;  2V79 A;  3UNG C;  2FSW A;  2GQQ A;  2OPT A;  1MBG A;  1XPX A;  3LQQ A;  2BXZ A;  4A0Y A;  1R6R A;  1YLF A;  5B3S H;  2HKX A;  1B1B A;  3S16 J;  4L5I A;  2ELK A;  4A0X A;  1JHF A;  3HM5 A;  2EIJ H;  1VZ0 A;  5H6Q A;  1NHA A;  2P5L C;  1Y56 A;  1T08 B;  3K1P A;  4L9N A;  5GP9 A;  5ILU A;  3WGI A;  5CQE A;  2ME6 A;  3BZC A;  2KJB A;  2ZXJ A;  3S2W A;  1YJW I;  2WV0 A;  2M1B A;  1BI0 A;  1D0X A;  2HYF A;  1OPC A;  3MWM A;  4R79 A;  4LLG F;  4KN7 X;  3AAF A;  3P5J A;  2CV1 A;  1QHH D;  3WG7 H;  1CGP A;  2Z1D A;  1EH6 A;  3LSI A;  1O3T A;  4DYR A;  2OTJ I;  2QVO A;  1BR4 A;  2DFE A;  2H09 A;  2XUB A;  2YU3 A;  3WTW C;  1XS9 A;  1V4R A;  4F3Q A;  2FOW A;  4BY1 J;  2A61 A;  2NVT J;  1AWC A;  4WK8 F;  4AIK A;  4JX6 A;  4BXF A;  5A2Q K;  3BG3 A;  2LY2 A;  3GFJ A;  1TL8 A;  1D1B A;  2W85 A;  2EJR A;  3SZT A;  4UY8 I;  2MG4 A;  4XMY A;  1HC8 A;  3OYK A;  3P9I A;  1X1D A;  2E1M B;  4E70 A;  2LMD A;  1ZRE A;  3RIR A;  4XSZ F;  3ZMU A;  3EGV B;  3KP5 A;  3QU6 A;  1Z77 A;  1QZE A;  4RS8 A;  1F5T A;  4XON A;  2IS1 A;  3HBL A;  1BW6 A;  4ZYE A;  1LUJ B;  4II3 A;  5J8C A;  4HAM A;  4RM3 A;  2RQQ A;  2ISZ A;  3K7A J;  5GPC A;  2L4A A;  5EGO A;  1U78 A;  3OOP A;  2PJR A;  4ITV A;  1UZC A;  2UV1 A;  3E3V A;  4G6Q A;  4IRI A;  3EUH A;  4B44 A;  4AC0 A;  5JVT A;  3BZ6 A;  5FGM A;  2AXT C;  4I01 A;  3GTK J;  2QEN A;  1JGS A;  1OMI A;  2P0W A;  3HOV J;  5HLG A;  1YIJ I;  1ZGW A;  2QBY B;  3HIF A;  2RRE A;  1OJL A;  3HOX J;  1KU9 A;  2XSJ C;  4M3E A;  3TO9 A;  3WTV C;  3OYB A;  1DDN A;  3TO7 A;  4A3E J;  1LVK A;  3I59 B;  4CYC A;  3LA3 A;  3CZ6 A;  2W00 A;  4LMY A;  2QSH X;  3Q0W A;  2D2W A;  5GTH C;  1QPM A;  1RES A;  4KFC A;  5IT9 Z;  2R7T A;  1ZEL A;  1YS7 A;  5ICF A;  2EV6 A;  2MH2 A;  4I09 A;  4L5E A;  5IT3 A;  2WA0 A;  1MMS A;  3F8F A;  3OMY A;  4V2G A;  1MNM C;  1TWC J;  2M0M A;  2WV1 A;  3LFK A;  2LOO A;  1R36 A;  1JUM A;  2EFQ A;  5HNH A;  1FT9 A;  3IWF A;  2HZT A;  5FLM J;  2M4G A;  3K4C A;  2KZV A;  1U8B A;  2QF7 A;  3PUF A;  4NC7 A;  3GEZ A;  2XHK A;  1QZZ A;  1VI0 A;  3K70 D;  2L7M P;  2WY7 Q;  2JA5 J;  3LMM A;  2M34 A;  3UKG A;  2EFO A;  1MBJ A;  3DKY A;  5K7Z A;  1PP7 U;  2Q8K A;  4YIF A;  4QSH A;  1HOM A;  2CUF A;  2VOP A;  2ECC A;  1VF9 A;  2X0L A;  2J5P A;  4DBR A;  1X58 A;  2FX0 A;  1AOY A;  2CW8 A;  4RGS A;  2BY0 A;  5IYD J;  4NDL A;  3H9Q A;  2XGD A;  2XGC A;  1DPR A;  1ZLJ A;  3SEZ A;  2XAF A;  3HC7 A;  3FF5 A;  4AVZ A;  1WJB A;  2BGC A;  2CUJ A;  2QQ8 A;  3V42 A;  4OMZ A;  2DJI A;  2VBX A;  3JRA A;  1EJ9 A;  4PSW A;  2L5Q A;  4U0W A;  4E7I A;  3HHG A;  3JAM Z;  3RI4 A;  3GX4 X;  4LJZ F;  3OYM A;  1POG A;  1U9N A;  1HW1 A;  1SFU A;  3KEY A; 
#chains in the Genus database with same CATH homology
 3CJS B;  3G6E I;  3CCS I;  2ZJQ F;  1Y39 A;  3CMA I;  3CCU I;  1VQP I;  3CCE I;  1VQ5 I;  5DM6 F;  4IO9 F;  2ZJR F;  1FOW A;  4IOA F;  3CCJ I;  1VQ9 I;  1YI2 I;  5GAD J;  3I56 I;  1YIJ I;  2H8W A;  3CCR I;  2OTL I;  3CJT B;  3J7Z I;  4IOC F;  3CF5 F;  1QA6 A;  1VQ7 I;  3CC2 I;  3CJR B;  1VQL I;  3CD6 I;  1YIT I;  2ZJP F;  2E34 A;  3PIP F;  1VQK I;  2NXN B;  1FOX A;  1ACI A;  3CCL I;  1MMS A;  3CCM I;  1YHQ I;  2QA4 I;  2QEX I;  5DM7 F;  1YJ9 I;  1YJW I;  3PIO F;  1VQ8 I;  3CC7 I;  5GAE J;  3CCQ I;  2K3F A;  3I55 I;  1VQ4 I;  3CJQ B;  1YJN I;  2OTJ I;  2E35 A;  3G4S I;  1WIB A;  2FOW A;  3G71 I;  3CC4 I;  2JQ7 A;  3CCV I;  5GAG J;  3J7Y J;  1FOY A;  3CME I;  1VQM I;  4UY8 I;  1HC8 A;  1VQ6 I;  3DLL F;  1VQO I;  4V19 K;  5JVG F;  5GAH J;  3EGV B;  2E36 A;  1S72 I;  1VQN I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...