3J7YJ

Structure of the large ribosomal subunit from human mitochondria
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
GVIRAIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDIKEGIPLPTKILVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEIARIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
J PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3j7yJ02
3.30.1550.10 Alpha Beta 2-Layer Sandwich Ribosomal protein L11, N-terminal domain Ribosomal protein L11/L12, N-terminal domain 3j7yJ01
1YJNI 3I56I 3G4SI 1YIJI 1MMSA 3PIPF 1S72I 3CMEI 1VQPI 5GAEJ 3CJTB 4IOCF 3CCEI 5JVGF 1VQ8I 3CCRI 1FOWA 3CCQI 5DM6F 1YITI 1WIBA 3J7YJ 3CCJI 2H8WA 1VQOI 2ZJRF 3CCUI 2FOWA 3CMAI 3CF5F 1FOXA 1YJ9I 1VQ9I 1VQ7I 1YJWI 3J7ZI 3CCMI 1VQ6I 2QA4I 3CC4I 3CCVI 2OTLI 1FOYA 3CC7I 1ACIA 3G6EI 1VQ4I 2QEXI 3CC2I 2OTJI 1VQMI 1YI2I 4IOAF 1VQNI 4UY8I 1YHQI 2E34A 2K3FA 1VQLI 1HC8A 3CCLI 3CD6I 1QA6A 2JQ7A 5GAHJ 2NXNB 3CJRB 4IO9F 2ZJQF 5DM7F 3CJQB 3EGVB 3CJSB 5GAGJ 1VQKI 3DLLF 2E36A 4V19K 3CCSI 1VQ5I 1Y39A 2E35A 2ZJPF 5GADJ 3I55I 3PIOF 3G71I
chains in the Genus database with same CATH superfamily
4X6AJ 1Z1DA 2LC2A 1DPUA 5LGTA 1PUFA 2Z2SB 3DBHB 2BVMA 1LE8B 3L2WA 1S72I 4BY7J 3B6CA 4ZYGA 3S17J 2KRHA 2IP2A 3HEFA 5IP9J 1CF7A 1QZZA 5K7ZA 4I01A 5F1RA 1GUUA 3B6AA 2P0WA 4H4KC 4O3MA 1YS7A 3BR0A 5CPRB 1XGNA 1HKSA 3GTPJ 1G59A 3H5NA 3S2DJ 4HQEA 1DDNA 2OQRA 3ZQ7A 2X4HA 4IRIA 4BHCA 4IF4A 1R00A 1K79A 5GP9A 1WIBA 5JI6A 3LWFA 3W6JB 1Q1VA 2IGMA 2CU7A 1IXRC 2VQCA 3VOEA 5J3LA 4U88A 1HOMA 4HLYA 4MHGA 2XKOA 4M3EA 1WQ2A 4JX4A 2DK8A 2DAOA 2QSHX 4KN4X 2HGCA 3TL4X 4LG0A 2MA3A 1FIPA 2M8EA 2JA6J 1TL8A 4B48A 1WH5A 1LDKB 1T08B 4OAZA 1O57A 4CCJA 1FTZA 4P96A 1D0YA 2VIXA 2VB6A 5FLXK 2ZKZA 2JA8J 2WAQA 2YX4A 2RGVA 3ZPLA 3DXJF 1GLNA 3VB2A 1FMVA 1SD7A 2JSCA 2X1DA 3SHFA 5M5YJ 3RZDJ 3H3UA 2VQLA 3FXQA 2QEXI 3OOUA 4YFKF 3EUHC 4RAFA 3PQKA 2LSOA 4V2FA 3EETA 4B09A 4DIQA 2X6XA 2FQ3A 5K7HA 4XR6A 3JRGA 1G3YA 2I5UA 1LVAA 3FMRA 5E8GA 4BQNA 2MH2A 1U5TA 3BT9A 2CH0A 2KPMA 1RR7A 3W3CA 1G8XA 2VT3A 2M7BA 1BL0A 2BY2A 3GTKJ 3CCLI 4OIQF 2VPLA 1IZ1A 1IN7A 2K4JA 4YFNF 1I3QJ 3K4CA 3FDYA 1JTXA 2KIMA 4IO9F 3T5XA 2CWEA 3K9TA 1Z7LA 2XPVA 1LFPA 2DI3A 5IT9Z 3ONQA 1LKXA 3BCBA 4KMFA 2COMA 4V2GA 3F0CA 4HDVA 3RI4A 3BPVA 2FX0A 2WC2A 4BY1J 2VOPA 3F22A 1XCVA 1A6IA 2ZXHA 3Q9SA 1MJAA 4N0BA 4AM3A 2UV1A 2EV0A 4U0YA 3D1NI 3I9V2 5EF6A 2CSOA 4IRGA 3CO6C 3Q0UA 2R7WA 1A04A 2BY1A 1YG2A 4Y4RA 1EKEA 2LRDA 4A3IJ 3GWZA 3JAMK 2HEOA 4XBFA 4BEHA 2IBDA 1R5GA 4TV7A 2F4MB 1WSUA 1MMSA 2LREA 3QYFA 2R5ZA 4PJNA 5DS9A 4DBQA 1JTYA 4L0ZB 2DMQA 1T38A 4KIBA 1RZ4A 3DU6A 4PJMA 3J81K 1TQIA 4Y3OA 4QSHA 4M74A 4M6YA 4ESFA 1A6QA 5A2QK 4FCYA 3OIQA 2RQPA 1VTNC 2CRGA 5ILSA 1SC7A 3IWZA 5FO5A 1FBSA 3L1PA 2HXOA 2JPBA 3CJNA 3ZMVA 1SVMA 4WCGA 1UELB 1B9MA 2XRLA 1RR8C 3PUFA 1S3JA 4I0AA 1YRNA 2YU9J 2L9VA 1PP7U 3RKWA 2EIMH 5D8KB 5CVUA 3DQVC 1G2HA 1B4AA 2HVRA 2NS0A 4C3HJ 2J5OA 4RS8A 3VSKA 4AWXB 5L3FA 3J7ZI 1J9IA 2ID6A 1K61A 1HKQA 1TWGJ 2QLZA 1AU7A 1QZYA 2CFXA 4MEXF 2DFFA 4MO7A 4RDUA 2OTJI 3RKXA 4AC0A 1VQMI 4HG2A 4YG2F 1AWCA 2FA5A 1JI8A 2V79A 4F91B 1TT0A 2Q0OA 2NVUB 4BXXJ 4XKWA 2HDDA 2DYRH 1EF4A 3QOPA 1ETVA 4MTEA 2A5WA 1TWCJ 2WTEA 4XLNF 5L3DA 5IYCJ 3JRCA 3CD6I 2WA0A 2W48A 3MEXA 2WY7Q 2JA2A 1PUFB 5FFZA 4KIFA 3GTLJ 3IC7A 2L2OA 5D6EA 2PG4A 5H6RA 1ORKA 4IEJA 5FKKA 3HSRA 5J6XA 1J0RA 4IHTA 3RPUA 1ZN2A 3WG7H 3OYHA 2YSRA 2IS2A 4FQGA 2NS7A 2DMNA 4G7ZF 1Y6IA 5BPIA 2VKVA 4Z2YA 4HF2A 3E7LA 3KP2A 2HTSA 3NQOA 4A0ZA 1IRXA 2FJ1A 4DGWB 1WZ2A 2M9HA 2BZTA 2BBYA 1B59A 3WG9A 5D5XB 4QTRA 3WE2A 4Y52J 1FNNA 1LDJA 1STZA 1U6GA 2HQAA 5K5OA 2XAGA 3CDLA 4ENMA 2DCEA 2TCTA 5M3MJ 4LG0B 1V54H 5F08A 1BJZA 1FZPB 5FGMA 4UB8C 2H6CA 1D3YA 2L9RA 2V7FA 1BW6A 1R5ID 1X58A 1SMYF 1AKHA 1IRFA 2D1VA 3BR5A 4HF1A 2P5LC 1LDDA 3KPHA 3ABMH 3K2AA 3CCEI 3MZYA 2OCEA 3W6KB 3G1OA 4KIGA 2VJIA 2ZFWA 2DODA 3QYBA 1FSEA 1XCBA 1FOWA 1YFHA 2QQ8A 4IL6C 2R7DA 4Q47A 2WAQN 3FKJA 2LOOA 5J4YA 4CGZA 1EH6A 4FT8A 1R1TA 4BS9A 3GTJJ 1U5TB 3E0JB 2R7FA 3OV8A 3B02A 2X0LA 4IHXA 5DUIA 4CYCA 3L2UA 2CUZA 1HF0A 3HHGA 3KYLA 2FSWA 4XOTA 3Q0VA 5KAIC 3CCUI 2K9LA 2ME0A 1UJ8A 3QU3A 1NK2P 2Y0SA 1XS9A 5EGOA 1V5EA 2XKPA 1W4MA 3RKQA 2HKXA 5C4JJ 3PNYA 3BG9A 3K4KA 4A6DA 4CCOA 3C2BA 1OQYA 3HG9A 5HDNA 2MC4A 2Z33A 2RQQA 1O3QA 3KEOA 3AL0C 3CP2A 2F5CA 1R5HA 3M8JA 1WI9A 2B7EA 3BROA 3EUKL 2BY0A 1S9HA 3MZ8A 1ETXA 4BDYA 2FRHA 3ASNH 2VKEA 4IOAF 1D1BA 1QBJA 3QPTA 2GA1A 1XTAA 2HDWA 2F2EA 4UB6C 1E3HA 2FMYA 3IUOA 4XLFA 3P5JA 4PZJA 4BEHB 1QA6A 3FMQA 3JSOA 1FJLA 4ZDOA 1YOVB 2R5ZB 3HOUJ 3V7CA 4I09A 1BW5A 2LDUA 1J5YA 3ZQFA 3OIOA 4E4HA 5DM7F 3KCCA 2KIQA 3BTJA 1MBGA 1IN4A 3TOAA 4EM1A 2QCOA 1Z7UA 2HPMA 1WFXA 3GEZA 3J80K 3LOCA 5KAFC 4XKBA 3TO6A 2ZNZA 5HS9A 1W5SA 1PUEE 1HCRA 5LFAA 3RDIA 3PJRA 1DP3A 4D7NA 4EJVA 2A05A 4NC8A 2P4WA 2HTJA 4UUSB 5M3FJ 4ZTJA 3RQIA 4RLQA 2EPFA 1R4NB 1UHWA 1YRNB 1Q1HA 4A3LJ 1T56A 2EFWA 1SFUA 3I59A 4PFPA 2JPCA 2JK3A 3VYTB 2AXTC 3S15J 1GDTA 4A3MJ 1IUFA 5EEHA 4QPQA 2VJ4A 4P9UA 1SFXA 3S14J 2BW3A 2F5FA 3EQLF 3F8BA 4U87A 2K85A 3OR2C 1IAWA 3ZMUA 4M9SA 1YIOA 2ZXWH 2R7UA 4XONA 4WWCA 2EV5A 1W7PB 3HTSB 3EDPA 5JVGF 3K4BA 3CCRI 1TWAJ 2ID3A 1MIJA 3DF8A 4B44A 2K02A 5D4RA 2FF4A 1B1BA 2GA2A 2K3PA 4HPQA 2PMZA 1ZGWA 2Y31A 2JMWA 3DWLE 2OUMA 3S1MJ 3K4JA 2WAEA 2V6EA 1HDDC 2E7WA 3DPLC 1UHSA 3GX4X 3H35A 1SVOA 2EBIA 4WXHA 1XDUA 3P9CA 3G1MA 1MSFC 1EA3A 3W2AA 1MJBA 1BI3A 3QQAA 4G6DA 5EEGA 1G4DA 1QVTA 2DT6A 1T6SA 3VDXA 2Q2EA 1RUOA 1GHCA 2W82A 2ZMEC 4MFDA 3C18A 3WGHA 4HNTA 1XGSA 1KU3A 3NWTA 4DZPA 4PK4A 4N9IA 4F7ZA 3WODF 2IEKA 2QGUA 3M1CA 5FFXA 2NRAC 2NS8A 2X6OA 1L0OC 2ISYA 4JBAA 1NG6A 5B5EC 1OR7C 2OZUA 2CUJA 2Z5UA 2PBIA 2MC3A 1KYWA 1WJEA 2ELHA 4F52A 1VQLI 3E97A 2LKXA 4BACA 1HSJA 2A5YB 3L09A 1LE8A 1F36A 3SFZA 3FBNB 2XF5A 3CCYA 1HBXG 1WKMA 2NXNB 4XOPA 5ICFA 4S0HB 1Z9CA 3K1PA 1V5GA 3GYHX 5J40A 4EATA 2VOOA 1XN7A 4E7JA 3EPZA 2GIVA 3EGVB 1RIOH 2CUEA 3A03A 4AD9A 4EQQA 2EFQA 5H2FC 2MD0A 3IRRA 5BNGA 3E3VA 2ACJA 2QVOA 3FXUA 4ESJA 2B63J 4XICA 4D9JA 4CYCB 5IOYA 1JJ6C 2XDVA 4GGGA 3K70D 5HS8A 2L01A 3K4LA 4AU7A 3A02A 4HEA2 3VYSB 5HVQC 4UUVA 4HSRA 4AIKA 5EGOB 3TP3A 1FWZA 5TISC 4U0VA 2H94A 4MGRA 1IJWC 1NK3P 3R4KA 1APLC 2ECBA 2FU4A 1YTYA 1E3OC 1ULYA 3S2WA 1W1WE 2LY2A 2FOKA 2Y0SN 3M8FA 4R1HA 3LA7A 1ZK8A 2JZYA 5D5UB 4OIOF 4FX4A 1VI0A 5CVVA 3BG5A 2LMDA 3OIPA 5CKTA 2KT0A 4KT5C 1OCOH 3E6CC 1F1ZA 4J00A 4W1UA 3WE3A 2K9NA 5IT3A 3OYEA 3M7GA 4C30A 3BG3A 2MYSA 2NVXJ 2DA5A 2W24A 4ENNA 2BEOA 2V6CA 2JA7J 3F8CA 1I6HJ 3BG6A 1BC7C 2R4GA 1I1SA 3WTVC 2MSYA 2GOMA 5F0FA 4JQFA 2GXAA 5BOXA 5F0HA 4RAZA 3HGGA 4A5MA 2DBBA 3NWSA 4GYIA 2VBXA 3KLOA 5DD8A 2ELKA 2E1OA 4PCQA 5JHUA 3HDDA 3WU0A 5FLVA 5F0CA 5EEAA 2JSPA 2BV6A 4NQWB 2G0EA 5KNLA 1Y1WJ 3GTMJ 4E7IA 3BR3A 4P9FA 2W7NA 3OOPA 2XUBA 3ZMZA 1K78A 3WTUC 1YO5C 3AG2H 2K3FA 3H5RA 4IX7A 4JP0A 3GVAA 5C44J 2COBA 2DDBA 4LLNA 2ESHA 4PSXA 2Z99A 3HRSA 2DN0A 1U9NA 2X9DA 3P9KA 1S8NA 5EJCA 5ICGA 3S16J 2XASA 3FISA 3FHNA 1E2XA 4BYYA 1JE8A 1FBUA 2E71A 3KYDB 2F4IA 2XAUA 4LITA 2K9MA 4OAYA 2XROA 1R36A 4II3A 1V5FA 2VONA 4UHTA 4BU2A 1YQAA 4DJAA 3ZMDA 5HNHA 2E1MB 2R7VA 2CQQA 1Y0NA 5KCMA 5FRMA 3TKYA 2DFEA 1TQMA 1XC5A 2DLLA 2GWRA 2HS5A 2L02A 1JKOC 2ZJ2A 1LUJB 1R7JA 2E35A 1TWFJ 1S7AA 2L0KA 3PFYA 5HS7A 1X1PA 2PMZN 1RKTA 2HOEA 2NNYA 3RSNA 4NBQA 2G9WA 1R9TJ 1POGA 5GPCA 4LD5A 3R61A 3G4SI 1SFKA 2GBYA 3E6MA 2Q2EB 4GRIA 1I27A 3T8RA 1FSHA 2W4SA 5DYMA 2X85A 3F6OA 3LSTA 2LD5A 4ENKA 1UG0A 3MWMA 3DFGA 1R1VA 3BDDA 2CV1A 4I6ZA 4B8XA 2I10A 1TW3A 3J7AY 5CYVA 1I39A 2V1XA 1MMGA 3PSFA 1YITI 2R92J 1ZARA 1ZLJA 1XD7A 1B6AA 3BJOA 3I53A 2JWTA 4S05A 3JW4A 3ELKA 5DCMB 3K70C 3FBIB 1ZRCA 1MMAA 9ANTA 3H92A 2X6YA 4B4CA 3ZN1A 4B43A 4YIFA 4L5JA 1W0UA 3D0SA 3F8NA 5DEQA 1VFCA 3JCUC 4PJ0C 3F8MA 2VLAA 3BQYA 4CCMA 4BAYA 3BY6A 1QPMA 5FJ8J 2EZLA 1LB2A 3RZOJ 1ENHA 4M3DA 1RI7A 1X1BA 4BL0B 1HKTA 4EV0A 3A2KA 2CQNA 2XAHA 2CS3A 4RGXA 3RCOA 1R4MB 1VNDA 2CYYA 3BZ6A 1P9QC 1J7KA 1TC3C 3IHUA 4CSWA 4LB5A 2ADUA 1BI0A 2CQKA 4OMYA 4FE7A 5LGUA 2OA4A 5DCFA 2CMPA 5IYDJ 2XSJC 2H6BA 2GXGA 4G94A 3A01A 3JRHA 5K5RA 1SVLA 1JUSA 1FYKA 3MAJA 2UUZA 3V8KA 1KU2A 4YEJA 3HOTA 1SFOJ 1ZGJA 4N4OB 3DBRB 2R7TA 5GAGJ 4N4NB 2L7MP 3TEDA 3FX3A 1O7FA 4GDFA 5D5VB 2E36A 3ECOA 2QBYB 1K6OA 1QU3A 3H36A 2NOJB 3HM5A 4GXOA 1G6NA 1N25A 4I99C 3GLXA 2F4OB 3BLYA 2A68F 1XGOA 2M87A 2O8KA 4BHPA 1JJ8C 5HLIA 3PM1A 2DA6A 2O0YA 3FXJA 3IAS2 3F72A 2RVCA 2WBMA 3PFIA 4A3DJ 1K83J 5D6FA 1U3EM 2KKOA 3FKIJ 3PIPF 5ILUA 2F5VA 3CMEI 2EA4A 2RNJA 1H88C 2VASA 1RPWA 1FPQA 3ZN0A 3H9QA 2R0QC 1BI1A 1MSEC 2OC6A 3BWGA 4A0XA 4I0BA 4CUGA 1W5TA 2BXZA 3HC7A 4DW6A 3DV8A 4L5EA 1JKRC 4MNUA 2HDCA 4LLLA 2M45A 1BBYA 5IY5H 1K78B 3TGNA 3U21A 4G8XA 2XC7A 1LFUP 4Q4ZF 4XN0A 2ZJRF 1Z05A 5LGNA 1YX3A 1MBKA 4LOCA 2STTA 1XMAA 1IW7F 2OAZA 4IVNA 4JX5A 2X6WA 5ED4A 4FETA 3FXLA 4FTHA 3M3YJ 2W00A 2HFHA 4FHTA 1JKPC 1NHAA 2V9VA 2DOEA 3A0BC 3CCMI 5BPDA 3GFMA 2NYXA 2IRFG 1UG2A 5D8LB 1KA8A 1SAUA 1OPCA 3TP0A 1ONVA 1T39A 3AG1H 4UUSA 5K5QA 4EVIA 4BE1A 3C1DA 2HKOA 1TTYA 4CZZA 3QRFF 4NHJA 4RLFA 2IGNA 4ESBA 2BE5F 1YHQI 1X3UA 2XVCA 5CVRA 3ASOH 3IKVA 1IC8A 4K2EA 2X51A 1IF1A 3L00A 5IOZA 2L5QA 4KISA 2HU9A 2Y9YA 1FTTA 4P5OA 1GXPA 2NNNA 3Q5FA 4KNYA 2HQRA 2HQ5A 2RV8A 3A4CA 1IO2A 1K4SA 6PAXA 1W7PA 3HKZA 2EZIA 1OYWA 3DTKA 5JLWA 2KIUA 3L7WA 4AIDA 4BXUA 1P92A 2MABA 3LSMA 1KONA 1VQKI 1Z91A 2O9LA 1XB4A 3HBLA 1OKRA 2W1OA 3ML6A 4XKCA 5LRSA 4XKVA 5HNFA 2HZTA 2N8GA 4B3XA 3F21A 2R7RA 2OV7A 1Y39A 3DKXA 4EJWA 3S1QJ 1T0FC 2EZHA 5L3BA 2JUGA 3V7RA 3WTWC 4O6JA 5E3NA 5FKNA 1USTA 4HX8A 3NEUA 2EFNA 3H9JA 4NNJA 5EDNA 5E3MA 1FYLA 2DTRA 1H9GA 3I56I 2IGKA 1DU0A 2P7VB 1S6LA 1X4PA 1R71A 5ICCA 3TDZC 2CQXA 3GO5A 1OCCH 3HZJA 3LMMA 3VSLA 4I2OA 4UNOA 2K9QA 5ERIA 3S1RJ 2EIJH 2Z9OA 1SFEA 3HRUA 3SYTA 3TOBA 2W85A 3P7NA 3BTCA 2MH9A 1ETWA 1ETYA 3FM3A 1RNLA 4BE0A 2P5VA 1GVDA 2QSGX 2L7ZA 2LBFA 2R3SA 4M73A 4OMZA 3VPRA 5K7FA 4CHUA 3CCQI 3GTOJ 2LP0A 4HX7A 1RRJA 5EZGA 1S5LC 2KJCA 1XSXA 2KDZA 3CESA 3M4OJ 2DMPA 4RB1A 3GFIA 2FE3A 5AIPA 5DUKA 3OYIA 2W25A 4BUPA 3VFZA 1QQIA 5J8CA 4O5VA 1MH3A 2BVLA 2VQGA 3ZOBA 2P8TA 5F6FA 1ETQA 3A01B 3CUQC 3V7SA 1VQ7I 4RGUA 1OFCX 1Y8RB 3AFHA 1UHMA 4U0WA 1X1CA 4RB2C 3MKZA 2HVSA 2FEZA 1VQ6I 3QYEA 2I8DA 2KRFA 4HV6A 5FLXZ 2DMUA 3ZQIA 3HSFA 1ACIA 3CZ6A 3HXLA 1OCTC 1MNMC 3BJAA 2QQBA 4ZZLA 3AG3H 2VKHA 3HPHA 5CLSA 1J09A 2VC0A 4UV8A 5IPAA 3OS0A 1TP4A 2RREA 4G6TB 1GV2A 1Z3XA 1MBJA 2IS4A 1OLTA 3OYJA 2P6TA 2LTPA 4CO8A 5BMZA 2Y69H 2M30A 2QSFX 1KZHA 4XLCA 2E2HJ 2EQRA 1MJ9A 2IA2A 2A3SA 2JVHA 3G2BA 4CA0A 1EJ9A 2ZBKA 3RYPA 1TNTA 5DV5A 4U7DA 1ON2A 4F55A 3OYFA 1ZLKA 3SEQA 3KEYA 3QPSA 4F3QA 1LFBA 2KJBA 3T0YA 1Z0XA 3QAHA 1OCZH 3DLLF 4NDLA 3SDBA 2K5CA 1BM9A 1S7EA 4L0YB 2K27A 2PEXA 5J1YA 3JRBA 4U7BA 2A61A 1SMTA 1E0EA 2NVYJ 3E5UA 4LK0F 1ZTRA 3QODA 1T2KA 1Z67A 1BN5A 3LAPA 3LSJA 2DW4A 1WVRA 2OZ6A 5TJJA 3WGGA 3QPHA 3UKGA 3PO2J 2IS1A 2HVQA 3PNVA 3SZGA 2ZB9A 2KHMA 2WV0A 4LB6B 4QLCU 2M3AA 4FISA 5DTDA 1ZRFA 4QPOA 4M9ZA 2JT1A 1SAXA 4D5FA 1DU6A 1N77A 2UWMA 1HXDA 3J81Z 4NQWA 3IWFA 3G73A 5A2QZ 2PI0A 1T95A 4ZJZA 4HSTA 4HNUA 4JYKA 4DOZA 1JGGA 5CVIA 4I76A 3OY9A 2TDXA 3I54A 1WI3A 4RMNA 1KGSA 2FMLA 2PJRA 3CCJI 1D8KA 1EH8A 1TZLA 1ZAOA 4OWRB 3K69A 1JKQC 2R7QA 3FIWA 1D0ZA 2LY9A 1XG1A 1FOXA 3N05A 4C2UA 4E7HA 4EJTA 5GPAA 4HX4A 4ZTFA 1BC8C 1VQ9I 3JTHA 1Z21A 3LSIA 2KLOA 2LF7A 3L9FA 3MFKA 4XIDA 3CMMA 4P55A 4AYBA 3ZR8X 2XGCA 1P7IA 2BHYA 1R22A 3CCVI 2DA1A 2K40A 1WPKA 1DGWY 1HDPA 1HQCA 5CVJA 3HKZN 1MBFA 5KK1A 1TNSA 2KP6A 2ISZA 5LHHA 3K10A 3FK6A 3V8JA 4D1QA 1K7AA 2EH3A 1X2NA 1ZGAA 2UXXA 2HZDA 4BE2A 2OQGA 3ZCOA 1FX7A 1UFMA 4Y13A 1QVUA 3WHBA 2DXIA 4IHYA 2OD5A 4LJZF 4BBSJ 2LNBA 3DTEA 2AXLA 2VKDA 4M3BA 3KFWX 2OBPA 3OL4A 2E2IJ 3IAM2 2VE9A 2R5YA 5M5XJ 3K1MA 2LLKA 4XSXF 4IJAA 2GM4A 3CJRB 1H89C 2DQLA 3DEUA 3RKYA 1MNEA 3R60A 1RUNA 3TO7A 3BZKA 1O3SA 2QKMB 1O3TA 2ZXIA 1ZHFA 2H09A 2D5VA 3RYRA 3PQJA 2LFBA 4ZYAA 3O8GA 1OYIA 3FF5A 1P4AA 3L2CA 1OISA 2LBFB 2YR2A 3BCAA 4R8HA 4ON0A 5E3LA 2PLYA 2XRNA 4XRFA 3C2GA 3PO3J 3D5RC 1X4OA 5DCMA 5J4VA 1EH7A 3SXYA 4MTDA 2J5PA 5IP7J 1SANA 5FROA 3FMSA 4QWQA 2V9PA 4M71A 1XPXA 3ZQHA 1SD5A 3OYMA 4YIRX 1R49A 1JHFA 1EV7A 2XB0X 4C9YA 1LJ9A 2OU2A 5H6QA 3GTQJ 5E1ZB 1KYZA 3CJTB 1AA7A 3JRFA 2A6TA 4BNCA 1E3PA 2GQQA 3X2QH 3GZ5A 2XB5A 4KITB 2JVGA 3DP7A 2QQAA 4X1EA 1OJLA 3ZRGA 2ZSIB 5EG0B 2DQRA 2K7LA 3VYUB 4ABZA 3FXMA 2H27A 4HBLA 1LNWA 3AAFA 3TBIA 1AHDP 1VF9A 1XX5A 4QIWN 2QUFA 3GCMA 1ZG3A 2P6SA 2VBYA 4KFCA 4PSWA 5BS6A 3ZP5A 3GFJA 4OOIA 3DKWA 3E5QA 2FXAA 1QZEA 3KP6A 2VXDA 4EGYA 2R93J 4UUTA 2WB1A 4ZYHA 5HDKA 1W7PD 4WK8F 2R7SA 2EWNA 5FRNA 2QBYA 1VQ4I 2ECCA 3CC2I 5EYRA 2M0MA 2HPIA 4OINF 5LEJA 3KP5A 2ZC2A 3P9IA 3Q3SA 2EA2A 4HA8A 4J01A 2M0CA 5TGTA 2R7XA 1XGMA 4OU0A 4F93B 3RTRA 4XL9A 5LHIA 1IN5A 3BR6A 3HGYA 3ABTA 3LL7A 4AUXA 2OJED 4YFXF 2KFDA 2DA7A 3DEEA 3KZYA 3COAC 5E18F 3O6BB 3KP7A 2DA4A 4M6VA 3HSEA 2PX9A 4PUSA 2D45A 3RPUD 5IT9K 3PNTA 5CJ9A 2BOLA 2DDAA 2P81A 4RGSA 4KN7X 2PFBA 4PDKA 1AOYA 3LSPA 2E2JJ 4IHSA 3J80Z 1GVJA 3OSFA 4A3BJ 2KDOA 4RB3C 2CW0F 4WXCA 4A0YA 4OIPF 2TRTA 3FHZA 2XAFA 3HUGB 1JGSA 1T8IA 2PJRB 1F9NA 3I55I 3DCFA 1X19A 2FD5A 1U5TC 1HA8A 3PSIA 3S93A 5HLGA 2QWWA 1WCMJ 2IPQX 3RIRA 1U8RA 3ULQB 2LKSA 1P7JA 3IP4B 1FMWA 1MNDA 3K4NA 2FQ4A 5B1BH 5FKLA 2Q1ZB 1KQ9A 2X1EA 3S3OA 1F5TA 2XF7A 5AONA 4BHBA 4E70A 4JK1X 4UVAA 1SD4A 4G7HF 2IS6A 2HYFA 4IOCF 2AS5F 3OWTA 4BXFA 2JN6A 2V9KA 1MZBA 1R23A 2KRCA 2M34A 3BTIA 4BJTA 4M6XA 4LK1F 3HL2A 4L9VA 5H20A 2BY3A 3MKYB 2E7XA 4AYBN 3S32A 2CO5A 5C4XJ 4Y15A 3KIOA 4I7HA 1LPQA 5J1UA 4AVPA 1OR7A 1SD6A 3REOA 3H0GJ 2ZXJA 3MCZA 3ESWB 2KL4A 2H8WA 3ISPA 3M07A 4GO1A 1VQOI 1MMNA 1WJCA 5KHDA 3NRVA 1BOBA 4HV5A 4EGZA 2V26A 2R5YB 2MW8A 5FKOA 3LNQA 3S3MA 1ZKGA 3SQNA 4FASD 3OYNA 1YJ9I 4MLOA 3N4MA 1JUPA 5TRDA 1GXQA 4XMYA 5ILVA 2BGCA 3H3VK 4DYCA 3GZNB 3HIFA 3FXKA 3HOXJ 5CQEA 2OTLI 1JT0A 3MKLA 3S2HJ 3A0HC 3VODA 3R0AA 1OMIA 2CG4A 2L54A 3G6EI 5F04A 1ZQ3P 1YW7A 2RKHA 3ZMTA 4A3GJ 3ECHA 4MEYF 1YI2I 4IHVA 2ZFUA 2V1DA 2DFHA 1T33A 4XNFA 2ETHA 2KZVA 4RBOA 3I58A 1USSA 1HW1A 2KMUA 4XORA 1ZG5A 1XSDA 1BR2A 3UR3C 4CCKA 2VN2A 3TW6A 4Q48A 4L5IA 3WTSC 1TW2A 4BBRJ 1FY7A 1TQPA 3K6GA 4UXNA 1BA5A 4HAMA 4CCNA 3SFIA 1P2FA 2NAZA 2XF6A 3CJQB 2IJLA 2IA1A 3E1SA 3GXOA 2PMUA 3AL0B 1WRJA 3GMEA 1XMKA 4ZDPA 4CICA 4EJOA 2V1UA 4DYQA 1C0WA 4HYEA 4IHWA 2VXZA 1ZREA 2YU3A 4CDGA 5KVRA 3WU2C 3IRQA 3OYAA 1B8IA 1VQ5I 1B9NA 4KT6A 2E1NA 5JR3A 4MQ9F 1YS6A 1LEAA 3QWLA 3HOVJ 4ANJA 5LHGA 4XQFA 1I1GA 2XGXA 5JHFA 3G1LA 3I4MJ 2JRTA 2EK5A 4RB0A 1Z6RA 3OYCA 1W5CC 5B66C 1M1EB 5JVTA 3BR1A 4I98B 1YIJI 1D1AA 2FBHA 2K9SA 2R7ZJ 2VJJA 1D5VA 1L3LA 3BC8A 2K4BA 3LQRA 3U1KA 2V4JC 1I50J 3LSGA 1U0JA 4DBRA 1PYVA 5F27A 5HOOA 5FD5A 5E3OA 2GIZA 4XSZF 4Q5SF 4IZZA 3E6DA 1U2WA 3M8EA 2JRMA 3R0JA 3KZZA 3LSRA 1RKWA 2WB1N 2VQHA 3KYCB 3H0DA 2UZKA 3WGIA 1G3WA 2FBKA 2Y48A 1Y8QB 1U8BA 2DOAA 2EJRA 2M5WA 1FT9A 5IP6A 2L7KA 2JTVA 5FKMA 3OYKA 3QU6A 3ERED 5D4SA 1Z3YA 4HNVA 1Z77A 5LLQA 3GUDA 2HNHA 3TQNA 3S8PA 5HLTA 2X48A 4MQVA 3FXRA 1G3TA 4C2MJ 3U2RA 2CJJA 1QHHD 2O3FA 3S3NA 3EYIA 1K6YA 3CTAA 4PJJA 1FOYA 4IQ4A 3CO7C 2DPDA 4IQJA 5M5WJ 3QP6A 2VBZA 4MIMA 3BQZA 1H0MA 2LY1A 3ABLH 1QRYA 4EMSA 3RPQA 2LF8A 1VQNI 1MKMA 2L9SA 3J7AO 2QENA 4D5CA 2WAFA 1RETA 3BR2A 2JJ7A 5B1AH 1FLIA 2ME6A 4I02A 4J19A 3B73A 1TBXA 3IH4A 2LVSA 1FBQA 5GAHJ 3F3XA 3G3ZA 2Z16A 2VL8A 2HXIA 4CZCA 2Z3YA 4KJZA 3D5SC 4WF2A 3FZVA 2AO9A 3TDUC 2ZMEB 2ZJQF 3DPTA 1QNTA 4IKFA 3LA2A 3D5LA 3KP4A 4M3FA 4ITVA 2EB7A 1YYVA 1V3FA 2AQFA 3DPUA 1JHHA 1UMQA 4RM3A 1YLFA 1W36D 1SEUA 3SZTA 3ZXSA 3DBLB 1ETOA 1WGXA 2CFOA 4YRVA 3BTLA 4BKXA 1MDMA 3VWBA 4EJUA 2LK2A 2A07F 3HOYJ 3QPLA 3OYGA 1QGPA 1H9TA 3LA3A 1BR4A 3Q9VA 3U1DA 4CXFA 1MBEA 3L2RA 1A5JA 3I64A 5BQTA 2H8RA 4LMYA 3KLNA 4JOMA 4BGDA 3WTXC 1YX5A 1QHGA 5J8FA 4XM3A 5J1RA 2LYCA 3EUAA 3I0TA 5LEKA 1WJDA 3V4GA 3LFKA 3CF2A 3KP3A 5E79C 5L3EA 1TLHB 2F48A 2QF7A 3ZQQA 4ZYEA 5JLXA 3JTGA 1MH4A 4ENJA 1ZR4A 2HR3A 3HOWJ 5DM6F 3JRIA 4S04A 4E7LA 2ZO4A 1IV6A 1Y1VJ 3V8LA 1J75A 2IA0A 3ERMA 3MD2A 4XK4A 1X1AA 4NC6A 5F64A 1S7OA 3KE2A 5D5WB 2O7OA 4XLPF 1MMDA 3FWEA 2VE8A 4BQQA 2EFPA 5FD6A 4NUBA 4C3JJ 1HW5A 3EUHA 1ZR2A 3W6VA 2NVQJ 1FP1D 4JX6A 3W2VA 1CF7B 1ETKA 3I5UA 1TT5B 3R6SA 4HOBA 4HRIA 2E1MC 3LAJA 3OYBA 1B8IB 2VODA 3CLOA 1ON1A 2YPRA 1HSTA 4M72A 2L3DA 5FB2A 4G9YA 4OIRF 4UY8I 2A6HF 3HYIA 4KA4A 5E17F 2C6YA 4BJ5C 1NTCA 2VC1A 3U9GA 3HB9A 5C3EJ 2H1KA 2XV4S 1R6RA 1RC9A 1U78A 4KUMA 4YIIA 3CQZJ 1BI2A 2DT5A 2Y9ZA 2O03A 2VBWA 1IXCA 2XGDA 1PVEA 1FC3A 1NG7A 1WHUA 2CW8A 2DA3A 3F6VA 3C2HA 1H8AC 3SDGA 5HODA 4F92B 3UNGC 2DT7B 5EG0A 1V55H 2E5NA 3W2WA 3CMYA 1CGPA 2M1BA 3DEWA 2RDPA 2Y2ZA 3CDIA 3CLQA 3E5XA 4CCLA 2YS9A 1ZG1A 3GW2A 2RAEA 1FP2A 2OCCH 3DKYA 2VI6A 2GOXB 4IPAA 1WJAA 1YJNI 1CQTA 2XAJA 1F43A 3RQ4A 2EILH 2YUSA 3CP8A 3OS2A 2LH9A 4BJ6C 4A69C 3N97A 1UAAA 4ETSA 3GFLA 3CUOA 1QO0D 2YX7A 2CV0A 2E19A 4Y7NJ 2DO7A 4L18B 5JFRA 1R1UA 3ZGKA 5K1YA 4M9XA 4RAGA 5LRRA 3JSPA 1S29A 2WY8Q 2RNGA 2IAIA 3MMYB 1W36C 1D0XA 3M9AA 2XHKA 2ZNYA 5LBQA 3T1BA 3GTGJ 1LVKA 3GZ6A 1WWXA 2ESNA 1O4XA 2M8GX 3J7YJ 1IXSB 2GLOA 4II2A 1IDZA 2F5EA 3LSHA 2L4AA 3KZIC 3JAMZ 2FNPA 4NB5A 1XDSA 4A12A 1RESA 3CDHA 1DUXC 1K4TA 1G3SA 3ZQCA 2MLGA 3CMAI 4FX0A 2DTZA 1BOAA 1IGNA 2DMTA 3NARA 4XN3A 3JRAA 2IVMA 4PJLA 5DD4A 1P6RA 2HYGD 3LQQA 2F5DA 5HLHA 2UXNA 4LFUA 5F1JA 3QP5A 4ZYDA 1B72A 1BIBA 2O8XA 3CC7I 1A36A 2GXBA 2M2EA 3C7JA 4HF0A 3H1CA 3HUGA 1MDMB 2W57A 5GTHC 3HRTA 2GZWA 2FNAA 2HOAA 5E8IA 4UV9A 1LQ1A 3C3WA 4P1WA 4ZDLA 3IH3A 5LD2C 2XPWA 4WX9A 1T0FA 4A3CJ 2E34A 1VZ0A 2Z1DA 5AIQA 2L4MA 1UCRA 4BH9A 2JA5J 2E5ZA 2FUG2 4LGWA 4RAYA 5L3CA 2KISA 4KICA 1KU9A 4BQAA 1ZH5A 4YELA 3ZQGA 1KU7A 3A1YA 2DK5A 1ZRDA 1YW9A 4XLEA 1PP8F 3K7AJ 3OYDA 4PGGA 5EZHA 3CJSB 1NH3A 4Z6YA 2HQNA 1J2XA 1N78A 3MKWB 2VJ5A 2DYSH 3BP8A 4V19K 4AIHA 1ZYRF 4R79A 2STWA 2CQ7A 3V42A 2O5RA 4Y33A 2LG4A 4HW0A 2ELJA 3OYLA 3K0LA 1GV5A 2IT0A 4PGHA 2R7OA 3MZHA 2M4KA 2PN6A 4A6EA 4GYGA 2DFIA 1MBHA 4ASNA 2WWYA 2MD5A 3M1EA 1IG7A 2CW7A 4ZC3A 4E7SA 3CUQA 2MG4A 4FE4A 4EM0B 1I5ZA 1A35A 1Y56A 1I3AA 4HDUA 1VQPI 3MN2A 5GAEJ 1J59A 2P5KA 1F4KA 4Y17A 2EV6A 3HJEA 3I4NJ 3OR1C 2CV2A 4LIVA 3IL2A 4A2UA 3PUBA 2E1CA 2QYOA 1VQ8I 2PJPA 3DU5A 3ABKH 3HPGA 5E20A 3SZPA 1PJRA 1JT6A 1Z6TA 2AQEA 2WADA 1GT0C 4HQMA 2Q8KA 1FOKA 5ICEA 1WJBA 2ZCWA 2EFOA 2MFZA 3BZCA 3JR9A 3GBGA 3F9KA 1P4WA 1O7LA 3ZQLA 2JUCA 2BHZA 4AVZA 1KQ8A 3OMYA 4RA2A 1HW2A 3KETA 2FOWA 4DNCA 3JRDA 3BG7A 2Y30A 3CF5F 2WV1A 4UVCA 4XRSG 2DJNA 1LEBA 1W0TA 4A93J 2MLKA 4A3FJ 1DPRA 2VUMJ 1YJWI 3FK7A 2VT2A 1JXSA 1IV8A 1YW8A 4LLGF 3HTUA 1X1DA 1P4XA 2QA4I 2O6GE 2FBIA 2HI3A 1AKHB 1IUYA 4IRHA 3MVPA 2L9NA 1X2MA 1Y0UA 1R58A 1T98A 2D2WA 1IN6A 2A6EF 3F23A 1D8JA 4M3GA 4BDZA 1REPC 3E6BA 4L9JA 3I3LA 4D7MA 3BPXA 1DQUA 2GAUA 1X3ZB 2QZ8A 3FM5A 1DP7P 4WXDA 2DOFA 2XAQA 2XIGA 1MD0A 2EINH 3NAUA 3ZMSA 1HC8A 2B0LA 3AKZA 2DPUA 3SEZA 4KYWA 2JQ7A 4UVBA 3RJPA 3JREA 3F8FA 1I6XA 3GF2A 3HHHA 1E17A 2QKLB 4EEFG 1IN8A 3BOQA 2XPUA 3O2PE 4NC7A 3WHCA 2OF7A 4DQ2A 3ABUA 4A3JJ 1PDNC 3WTZA 2KZGA 2MGQA 2D1HA 2XSDC 2RN7A 2XGEA 3AG4H 3TO9A 4B47A 1IRZA 2LR8A 2HOSA 3WTYC 3LFUA 2O61A 3I4PA 1O3RA 2ZJPF 4XRSA 5FLMJ 1ERDA 4HLXA 1JUMA 3Q0WA 2G7UA 3TW7A 1OCPA 4LG3A 1UZCA 2KIFA 3HRMA 5HDGA 3TMOA 2VPRA 3O8HA 1FYMA 1DGRM 4IXAA 1A31A 4AIJA 1IDYA 3K2ZA 4G7OF 4RM2A 4ZZDA 1WJ5A 3HOZJ 3I71A 3OL3A 4A5NA 3LSKA 1B72B 4D0PA 2ICWG 1D5YA 2DU9A 1QPIA 2OPTA 4XLHA 4BQOA 2QQ9A 3DTIA 2HWVA 2A69F 3KX2A 4ZH4F 4LIUA 3WU1B 4H0EA 3FXOA 1MGTA 3IKTA 2Y75A 2AHQA 3IH2A 3KEQA 2E60A 2HOTA 3PL8A 4G12A 3S1NJ 3VYRB 2DA2A 2IXSA 2RC4A 5E1XA 4XRMA 1UB9A 2ZMEA 3I59B 4DZJA 2IW5A 3SJMA 4E7KA 1IRGA 1XSVA 4CYDA 3K4MA 3EYYA 5E1WA 2H1LA 3CC4I 1TWHJ 1X3WB 2BW3B 3H3ZA 2BYVE 3GLLA 3MQ0A 4PFOA 2M4GA 4B1RA 1OYYA 2QM3A 4B3AA 1D1CA 4L9NA 3O3KA 5DDGA 4C3IJ 1BR1A 2M7AA 4A3EJ 5IYBJ 5J47A 3WTTC 4RGRA 4G6QA 4GFBA 5L3GA 2MBFA 2V1NA 2G7HA 2CGPA 1N75A 1FIAA 2DJIA 4DYRA 2PMHA 1BIAA 1YE9A 2EZKA 4KMUX 1OCRH 4N9HA 4A3KJ 2BXYA 5CQGA 1V4RA 3CUQB 2L7FP 2B9SA 2K86A 2P7CB 1FEXA 3L2QA 4MFEA 4GCVA 4KDPA 2NOGA 2NVTJ 5GTIC 4CH7A 1KQ0A 4X0GA 2EIKH 3HOSA 1WH7A 1BJAA 5B3SH 3OSGA 3IV5A 3QOEA 1HLVA 3ROUA 4EM2A 3L2VA 3T8TA 3H9GA 1ITYA 1ZELA 4HZFA 4E6KG 2ZSHB 2W84A 1U9OA 3DLAA 4E7ZA 1WJFA 2CUFA 3CCSI 1MW7A 2F6CA 2IGOA 2PQ8A 3K1NA 3VEPA 3H5AA 2HYJA 4W97A 5GADJ 2Y0MA 1XMXA 4L9TA 4XLAA 3PIOF 3BJ6A 2KQRA 1ODDA 4C2TA 3G71I 3OS1A 2LKPA 2X1CA
chains in the Genus database with same CATH topology
1YJNI 3I56I 3G4SI 1YIJI 1MMSA 3PIPF 1S72I 3CMEI 1VQPI 5GAEJ 3CJTB 4IOCF 3CCEI 5JVGF 1VQ8I 3CCRI 1FOWA 3CCQI 5DM6F 1YITI 1WIBA 3J7YJ 3CCJI 2H8WA 1VQOI 2ZJRF 3CCUI 2FOWA 3CMAI 3CF5F 1FOXA 1YJ9I 1VQ9I 1VQ7I 1YJWI 3J7ZI 3CCMI 1VQ6I 2QA4I 3CC4I 3CCVI 2OTLI 1FOYA 3CC7I 1ACIA 3G6EI 1VQ4I 2QEXI 3CC2I 2OTJI 1VQMI 1YI2I 4IOAF 1VQNI 4UY8I 1YHQI 2E34A 2K3FA 1VQLI 1HC8A 3CCLI 3CD6I 1QA6A 2JQ7A 5GAHJ 2NXNB 3CJRB 4IO9F 2ZJQF 5DM7F 3CJQB 3EGVB 3CJSB 5GAGJ 1VQKI 3DLLF 2E36A 4V19K 3CCSI 1VQ5I 1Y39A 2E35A 2ZJPF 5GADJ 3I55I 3PIOF 3G71I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJN I;  3I56 I;  3G4S I;  1YIJ I;  1MMS A;  3PIP F;  1S72 I;  3CME I;  1VQP I;  5GAE J;  3CJT B;  4IOC F;  3CCE I;  5JVG F;  1VQ8 I;  3CCR I;  1FOW A;  3CCQ I;  5DM6 F;  1YIT I;  1WIB A;  3J7Y J;  3CCJ I;  2H8W A;  1VQO I;  2ZJR F;  3CCU I;  2FOW A;  3CMA I;  3CF5 F;  1FOX A;  1YJ9 I;  1VQ9 I;  1VQ7 I;  1YJW I;  3J7Z I;  3CCM I;  1VQ6 I;  2QA4 I;  3CC4 I;  3CCV I;  2OTL I;  1FOY A;  3CC7 I;  1ACI A;  3G6E I;  1VQ4 I;  2QEX I;  3CC2 I;  2OTJ I;  1VQM I;  1YI2 I;  4IOA F;  1VQN I;  4UY8 I;  1YHQ I;  2E34 A;  2K3F A;  1VQL I;  1HC8 A;  3CCL I;  3CD6 I;  1QA6 A;  2JQ7 A;  5GAH J;  2NXN B;  3CJR B;  4IO9 F;  2ZJQ F;  5DM7 F;  3CJQ B;  3EGV B;  3CJS B;  5GAG J;  1VQK I;  3DLL F;  2E36 A;  4V19 K;  3CCS I;  1VQ5 I;  1Y39 A;  2E35 A;  2ZJP F;  5GAD J;  3I55 I;  3PIO F;  3G71 I; 
#chains in the Genus database with same CATH topology
 4X6A J;  1Z1D A;  2LC2 A;  1DPU A;  5LGT A;  1PUF A;  2Z2S B;  3DBH B;  2BVM A;  1LE8 B;  3L2W A;  1S72 I;  4BY7 J;  3B6C A;  4ZYG A;  3S17 J;  2KRH A;  2IP2 A;  3HEF A;  5IP9 J;  1CF7 A;  1QZZ A;  5K7Z A;  4I01 A;  5F1R A;  1GUU A;  3B6A A;  2P0W A;  4H4K C;  4O3M A;  1YS7 A;  3BR0 A;  5CPR B;  1XGN A;  1HKS A;  3GTP J;  1G59 A;  3H5N A;  3S2D J;  4HQE A;  1DDN A;  2OQR A;  3ZQ7 A;  2X4H A;  4IRI A;  4BHC A;  4IF4 A;  1R00 A;  1K79 A;  5GP9 A;  1WIB A;  5JI6 A;  3LWF A;  3W6J B;  1Q1V A;  2IGM A;  2CU7 A;  1IXR C;  2VQC A;  3VOE A;  5J3L A;  4U88 A;  1HOM A;  4HLY A;  4MHG A;  2XKO A;  4M3E A;  1WQ2 A;  4JX4 A;  2DK8 A;  2DAO A;  2QSH X;  4KN4 X;  2HGC A;  3TL4 X;  4LG0 A;  2MA3 A;  1FIP A;  2M8E A;  2JA6 J;  1TL8 A;  4B48 A;  1WH5 A;  1LDK B;  1T08 B;  4OAZ A;  1O57 A;  4CCJ A;  1FTZ A;  4P96 A;  1D0Y A;  2VIX A;  2VB6 A;  5FLX K;  2ZKZ A;  2JA8 J;  2WAQ A;  2YX4 A;  2RGV A;  3ZPL A;  3DXJ F;  1GLN A;  3VB2 A;  1FMV A;  1SD7 A;  2JSC A;  2X1D A;  3SHF A;  5M5Y J;  3RZD J;  3H3U A;  2VQL A;  3FXQ A;  2QEX I;  3OOU A;  4YFK F;  3EUH C;  4RAF A;  3PQK A;  2LSO A;  4V2F A;  3EET A;  4B09 A;  4DIQ A;  2X6X A;  2FQ3 A;  5K7H A;  4XR6 A;  3JRG A;  1G3Y A;  2I5U A;  1LVA A;  3FMR A;  5E8G A;  4BQN A;  2MH2 A;  1U5T A;  3BT9 A;  2CH0 A;  2KPM A;  1RR7 A;  3W3C A;  1G8X A;  2VT3 A;  2M7B A;  1BL0 A;  2BY2 A;  3GTK J;  3CCL I;  4OIQ F;  2VPL A;  1IZ1 A;  1IN7 A;  2K4J A;  4YFN F;  1I3Q J;  3K4C A;  3FDY A;  1JTX A;  2KIM A;  4IO9 F;  3T5X A;  2CWE A;  3K9T A;  1Z7L A;  2XPV A;  1LFP A;  2DI3 A;  5IT9 Z;  3ONQ A;  1LKX A;  3BCB A;  4KMF A;  2COM A;  4V2G A;  3F0C A;  4HDV A;  3RI4 A;  3BPV A;  2FX0 A;  2WC2 A;  4BY1 J;  2VOP A;  3F22 A;  1XCV A;  1A6I A;  2ZXH A;  3Q9S A;  1MJA A;  4N0B A;  4AM3 A;  2UV1 A;  2EV0 A;  4U0Y A;  3D1N I;  3I9V 2;  5EF6 A;  2CSO A;  4IRG A;  3CO6 C;  3Q0U A;  2R7W A;  1A04 A;  2BY1 A;  1YG2 A;  4Y4R A;  1EKE A;  2LRD A;  4A3I J;  3GWZ A;  3JAM K;  2HEO A;  4XBF A;  4BEH A;  2IBD A;  1R5G A;  4TV7 A;  2F4M B;  1WSU A;  1MMS A;  2LRE A;  3QYF A;  2R5Z A;  4PJN A;  5DS9 A;  4DBQ A;  1JTY A;  4L0Z B;  2DMQ A;  1T38 A;  4KIB A;  1RZ4 A;  3DU6 A;  4PJM A;  3J81 K;  1TQI A;  4Y3O A;  4QSH A;  4M74 A;  4M6Y A;  4ESF A;  1A6Q A;  5A2Q K;  4FCY A;  3OIQ A;  2RQP A;  1VTN C;  2CRG A;  5ILS A;  1SC7 A;  3IWZ A;  5FO5 A;  1FBS A;  3L1P A;  2HXO A;  2JPB A;  3CJN A;  3ZMV A;  1SVM A;  4WCG A;  1UEL B;  1B9M A;  2XRL A;  1RR8 C;  3PUF A;  1S3J A;  4I0A A;  1YRN A;  2YU9 J;  2L9V A;  1PP7 U;  3RKW A;  2EIM H;  5D8K B;  5CVU A;  3DQV C;  1G2H A;  1B4A A;  2HVR A;  2NS0 A;  4C3H J;  2J5O A;  4RS8 A;  3VSK A;  4AWX B;  5L3F A;  3J7Z I;  1J9I A;  2ID6 A;  1K61 A;  1HKQ A;  1TWG J;  2QLZ A;  1AU7 A;  1QZY A;  2CFX A;  4MEX F;  2DFF A;  4MO7 A;  4RDU A;  2OTJ I;  3RKX A;  4AC0 A;  1VQM I;  4HG2 A;  4YG2 F;  1AWC A;  2FA5 A;  1JI8 A;  2V79 A;  4F91 B;  1TT0 A;  2Q0O A;  2NVU B;  4BXX J;  4XKW A;  2HDD A;  2DYR H;  1EF4 A;  3QOP A;  1ETV A;  4MTE A;  2A5W A;  1TWC J;  2WTE A;  4XLN F;  5L3D A;  5IYC J;  3JRC A;  3CD6 I;  2WA0 A;  2W48 A;  3MEX A;  2WY7 Q;  2JA2 A;  1PUF B;  5FFZ A;  4KIF A;  3GTL J;  3IC7 A;  2L2O A;  5D6E A;  2PG4 A;  5H6R A;  1ORK A;  4IEJ A;  5FKK A;  3HSR A;  5J6X A;  1J0R A;  4IHT A;  3RPU A;  1ZN2 A;  3WG7 H;  3OYH A;  2YSR A;  2IS2 A;  4FQG A;  2NS7 A;  2DMN A;  4G7Z F;  1Y6I A;  5BPI A;  2VKV A;  4Z2Y A;  4HF2 A;  3E7L A;  3KP2 A;  2HTS A;  3NQO A;  4A0Z A;  1IRX A;  2FJ1 A;  4DGW B;  1WZ2 A;  2M9H A;  2BZT A;  2BBY A;  1B59 A;  3WG9 A;  5D5X B;  4QTR A;  3WE2 A;  4Y52 J;  1FNN A;  1LDJ A;  1STZ A;  1U6G A;  2HQA A;  5K5O A;  2XAG A;  3CDL A;  4ENM A;  2DCE A;  2TCT A;  5M3M J;  4LG0 B;  1V54 H;  5F08 A;  1BJZ A;  1FZP B;  5FGM A;  4UB8 C;  2H6C A;  1D3Y A;  2L9R A;  2V7F A;  1BW6 A;  1R5I D;  1X58 A;  1SMY F;  1AKH A;  1IRF A;  2D1V A;  3BR5 A;  4HF1 A;  2P5L C;  1LDD A;  3KPH A;  3ABM H;  3K2A A;  3CCE I;  3MZY A;  2OCE A;  3W6K B;  3G1O A;  4KIG A;  2VJI A;  2ZFW A;  2DOD A;  3QYB A;  1FSE A;  1XCB A;  1FOW A;  1YFH A;  2QQ8 A;  4IL6 C;  2R7D A;  4Q47 A;  2WAQ N;  3FKJ A;  2LOO A;  5J4Y A;  4CGZ A;  1EH6 A;  4FT8 A;  1R1T A;  4BS9 A;  3GTJ J;  1U5T B;  3E0J B;  2R7F A;  3OV8 A;  3B02 A;  2X0L A;  4IHX A;  5DUI A;  4CYC A;  3L2U A;  2CUZ A;  1HF0 A;  3HHG A;  3KYL A;  2FSW A;  4XOT A;  3Q0V A;  5KAI C;  3CCU I;  2K9L A;  2ME0 A;  1UJ8 A;  3QU3 A;  1NK2 P;  2Y0S A;  1XS9 A;  5EGO A;  1V5E A;  2XKP A;  1W4M A;  3RKQ A;  2HKX A;  5C4J J;  3PNY A;  3BG9 A;  3K4K A;  4A6D A;  4CCO A;  3C2B A;  1OQY A;  3HG9 A;  5HDN A;  2MC4 A;  2Z33 A;  2RQQ A;  1O3Q A;  3KEO A;  3AL0 C;  3CP2 A;  2F5C A;  1R5H A;  3M8J A;  1WI9 A;  2B7E A;  3BRO A;  3EUK L;  2BY0 A;  1S9H A;  3MZ8 A;  1ETX A;  4BDY A;  2FRH A;  3ASN H;  2VKE A;  4IOA F;  1D1B A;  1QBJ A;  3QPT A;  2GA1 A;  1XTA A;  2HDW A;  2F2E A;  4UB6 C;  1E3H A;  2FMY A;  3IUO A;  4XLF A;  3P5J A;  4PZJ A;  4BEH B;  1QA6 A;  3FMQ A;  3JSO A;  1FJL A;  4ZDO A;  1YOV B;  2R5Z B;  3HOU J;  3V7C A;  4I09 A;  1BW5 A;  2LDU A;  1J5Y A;  3ZQF A;  3OIO A;  4E4H A;  5DM7 F;  3KCC A;  2KIQ A;  3BTJ A;  1MBG A;  1IN4 A;  3TOA A;  4EM1 A;  2QCO A;  1Z7U A;  2HPM A;  1WFX A;  3GEZ A;  3J80 K;  3LOC A;  5KAF C;  4XKB A;  3TO6 A;  2ZNZ A;  5HS9 A;  1W5S A;  1PUE E;  1HCR A;  5LFA A;  3RDI A;  3PJR A;  1DP3 A;  4D7N A;  4EJV A;  2A05 A;  4NC8 A;  2P4W A;  2HTJ A;  4UUS B;  5M3F J;  4ZTJ A;  3RQI A;  4RLQ A;  2EPF A;  1R4N B;  1UHW A;  1YRN B;  1Q1H A;  4A3L J;  1T56 A;  2EFW A;  1SFU A;  3I59 A;  4PFP A;  2JPC A;  2JK3 A;  3VYT B;  2AXT C;  3S15 J;  1GDT A;  4A3M J;  1IUF A;  5EEH A;  4QPQ A;  2VJ4 A;  4P9U A;  1SFX A;  3S14 J;  2BW3 A;  2F5F A;  3EQL F;  3F8B A;  4U87 A;  2K85 A;  3OR2 C;  1IAW A;  3ZMU A;  4M9S A;  1YIO A;  2ZXW H;  2R7U A;  4XON A;  4WWC A;  2EV5 A;  1W7P B;  3HTS B;  3EDP A;  5JVG F;  3K4B A;  3CCR I;  1TWA J;  2ID3 A;  1MIJ A;  3DF8 A;  4B44 A;  2K02 A;  5D4R A;  2FF4 A;  1B1B A;  2GA2 A;  2K3P A;  4HPQ A;  2PMZ A;  1ZGW A;  2Y31 A;  2JMW A;  3DWL E;  2OUM A;  3S1M J;  3K4J A;  2WAE A;  2V6E A;  1HDD C;  2E7W A;  3DPL C;  1UHS A;  3GX4 X;  3H35 A;  1SVO A;  2EBI A;  4WXH A;  1XDU A;  3P9C A;  3G1M A;  1MSF C;  1EA3 A;  3W2A A;  1MJB A;  1BI3 A;  3QQA A;  4G6D A;  5EEG A;  1G4D A;  1QVT A;  2DT6 A;  1T6S A;  3VDX A;  2Q2E A;  1RUO A;  1GHC A;  2W82 A;  2ZME C;  4MFD A;  3C18 A;  3WGH A;  4HNT A;  1XGS A;  1KU3 A;  3NWT A;  4DZP A;  4PK4 A;  4N9I A;  4F7Z A;  3WOD F;  2IEK A;  2QGU A;  3M1C A;  5FFX A;  2NRA C;  2NS8 A;  2X6O A;  1L0O C;  2ISY A;  4JBA A;  1NG6 A;  5B5E C;  1OR7 C;  2OZU A;  2CUJ A;  2Z5U A;  2PBI A;  2MC3 A;  1KYW A;  1WJE A;  2ELH A;  4F52 A;  1VQL I;  3E97 A;  2LKX A;  4BAC A;  1HSJ A;  2A5Y B;  3L09 A;  1LE8 A;  1F36 A;  3SFZ A;  3FBN B;  2XF5 A;  3CCY A;  1HBX G;  1WKM A;  2NXN B;  4XOP A;  5ICF A;  4S0H B;  1Z9C A;  3K1P A;  1V5G A;  3GYH X;  5J40 A;  4EAT A;  2VOO A;  1XN7 A;  4E7J A;  3EPZ A;  2GIV A;  3EGV B;  1RIO H;  2CUE A;  3A03 A;  4AD9 A;  4EQQ A;  2EFQ A;  5H2F C;  2MD0 A;  3IRR A;  5BNG A;  3E3V A;  2ACJ A;  2QVO A;  3FXU A;  4ESJ A;  2B63 J;  4XIC A;  4D9J A;  4CYC B;  5IOY A;  1JJ6 C;  2XDV A;  4GGG A;  3K70 D;  5HS8 A;  2L01 A;  3K4L A;  4AU7 A;  3A02 A;  4HEA 2;  3VYS B;  5HVQ C;  4UUV A;  4HSR A;  4AIK A;  5EGO B;  3TP3 A;  1FWZ A;  5TIS C;  4U0V A;  2H94 A;  4MGR A;  1IJW C;  1NK3 P;  3R4K A;  1APL C;  2ECB A;  2FU4 A;  1YTY A;  1E3O C;  1ULY A;  3S2W A;  1W1W E;  2LY2 A;  2FOK A;  2Y0S N;  3M8F A;  4R1H A;  3LA7 A;  1ZK8 A;  2JZY A;  5D5U B;  4OIO F;  4FX4 A;  1VI0 A;  5CVV A;  3BG5 A;  2LMD A;  3OIP A;  5CKT A;  2KT0 A;  4KT5 C;  1OCO H;  3E6C C;  1F1Z A;  4J00 A;  4W1U A;  3WE3 A;  2K9N A;  5IT3 A;  3OYE A;  3M7G A;  4C30 A;  3BG3 A;  2MYS A;  2NVX J;  2DA5 A;  2W24 A;  4ENN A;  2BEO A;  2V6C A;  2JA7 J;  3F8C A;  1I6H J;  3BG6 A;  1BC7 C;  2R4G A;  1I1S A;  3WTV C;  2MSY A;  2GOM A;  5F0F A;  4JQF A;  2GXA A;  5BOX A;  5F0H A;  4RAZ A;  3HGG A;  4A5M A;  2DBB A;  3NWS A;  4GYI A;  2VBX A;  3KLO A;  5DD8 A;  2ELK A;  2E1O A;  4PCQ A;  5JHU A;  3HDD A;  3WU0 A;  5FLV A;  5F0C A;  5EEA A;  2JSP A;  2BV6 A;  4NQW B;  2G0E A;  5KNL A;  1Y1W J;  3GTM J;  4E7I A;  3BR3 A;  4P9F A;  2W7N A;  3OOP A;  2XUB A;  3ZMZ A;  1K78 A;  3WTU C;  1YO5 C;  3AG2 H;  2K3F A;  3H5R A;  4IX7 A;  4JP0 A;  3GVA A;  5C44 J;  2COB A;  2DDB A;  4LLN A;  2ESH A;  4PSX A;  2Z99 A;  3HRS A;  2DN0 A;  1U9N A;  2X9D A;  3P9K A;  1S8N A;  5EJC A;  5ICG A;  3S16 J;  2XAS A;  3FIS A;  3FHN A;  1E2X A;  4BYY A;  1JE8 A;  1FBU A;  2E71 A;  3KYD B;  2F4I A;  2XAU A;  4LIT A;  2K9M A;  4OAY A;  2XRO A;  1R36 A;  4II3 A;  1V5F A;  2VON A;  4UHT A;  4BU2 A;  1YQA A;  4DJA A;  3ZMD A;  5HNH A;  2E1M B;  2R7V A;  2CQQ A;  1Y0N A;  5KCM A;  5FRM A;  3TKY A;  2DFE A;  1TQM A;  1XC5 A;  2DLL A;  2GWR A;  2HS5 A;  2L02 A;  1JKO C;  2ZJ2 A;  1LUJ B;  1R7J A;  2E35 A;  1TWF J;  1S7A A;  2L0K A;  3PFY A;  5HS7 A;  1X1P A;  2PMZ N;  1RKT A;  2HOE A;  2NNY A;  3RSN A;  4NBQ A;  2G9W A;  1R9T J;  1POG A;  5GPC A;  4LD5 A;  3R61 A;  3G4S I;  1SFK A;  2GBY A;  3E6M A;  2Q2E B;  4GRI A;  1I27 A;  3T8R A;  1FSH A;  2W4S A;  5DYM A;  2X85 A;  3F6O A;  3LST A;  2LD5 A;  4ENK A;  1UG0 A;  3MWM A;  3DFG A;  1R1V A;  3BDD A;  2CV1 A;  4I6Z A;  4B8X A;  2I10 A;  1TW3 A;  3J7A Y;  5CYV A;  1I39 A;  2V1X A;  1MMG A;  3PSF A;  1YIT I;  2R92 J;  1ZAR A;  1ZLJ A;  1XD7 A;  1B6A A;  3BJO A;  3I53 A;  2JWT A;  4S05 A;  3JW4 A;  3ELK A;  5DCM B;  3K70 C;  3FBI B;  1ZRC A;  1MMA A;  9ANT A;  3H92 A;  2X6Y A;  4B4C A;  3ZN1 A;  4B43 A;  4YIF A;  4L5J A;  1W0U A;  3D0S A;  3F8N A;  5DEQ A;  1VFC A;  3JCU C;  4PJ0 C;  3F8M A;  2VLA A;  3BQY A;  4CCM A;  4BAY A;  3BY6 A;  1QPM A;  5FJ8 J;  2EZL A;  1LB2 A;  3RZO J;  1ENH A;  4M3D A;  1RI7 A;  1X1B A;  4BL0 B;  1HKT A;  4EV0 A;  3A2K A;  2CQN A;  2XAH A;  2CS3 A;  4RGX A;  3RCO A;  1R4M B;  1VND A;  2CYY A;  3BZ6 A;  1P9Q C;  1J7K A;  1TC3 C;  3IHU A;  4CSW A;  4LB5 A;  2ADU A;  1BI0 A;  2CQK A;  4OMY A;  4FE7 A;  5LGU A;  2OA4 A;  5DCF A;  2CMP A;  5IYD J;  2XSJ C;  2H6B A;  2GXG A;  4G94 A;  3A01 A;  3JRH A;  5K5R A;  1SVL A;  1JUS A;  1FYK A;  3MAJ A;  2UUZ A;  3V8K A;  1KU2 A;  4YEJ A;  3HOT A;  1SFO J;  1ZGJ A;  4N4O B;  3DBR B;  2R7T A;  5GAG J;  4N4N B;  2L7M P;  3TED A;  3FX3 A;  1O7F A;  4GDF A;  5D5V B;  2E36 A;  3ECO A;  2QBY B;  1K6O A;  1QU3 A;  3H36 A;  2NOJ B;  3HM5 A;  4GXO A;  1G6N A;  1N25 A;  4I99 C;  3GLX A;  2F4O B;  3BLY A;  2A68 F;  1XGO A;  2M87 A;  2O8K A;  4BHP A;  1JJ8 C;  5HLI A;  3PM1 A;  2DA6 A;  2O0Y A;  3FXJ A;  3IAS 2;  3F72 A;  2RVC A;  2WBM A;  3PFI A;  4A3D J;  1K83 J;  5D6F A;  1U3E M;  2KKO A;  3FKI J;  3PIP F;  5ILU A;  2F5V A;  3CME I;  2EA4 A;  2RNJ A;  1H88 C;  2VAS A;  1RPW A;  1FPQ A;  3ZN0 A;  3H9Q A;  2R0Q C;  1BI1 A;  1MSE C;  2OC6 A;  3BWG A;  4A0X A;  4I0B A;  4CUG A;  1W5T A;  2BXZ A;  3HC7 A;  4DW6 A;  3DV8 A;  4L5E A;  1JKR C;  4MNU A;  2HDC A;  4LLL A;  2M45 A;  1BBY A;  5IY5 H;  1K78 B;  3TGN A;  3U21 A;  4G8X A;  2XC7 A;  1LFU P;  4Q4Z F;  4XN0 A;  2ZJR F;  1Z05 A;  5LGN A;  1YX3 A;  1MBK A;  4LOC A;  2STT A;  1XMA A;  1IW7 F;  2OAZ A;  4IVN A;  4JX5 A;  2X6W A;  5ED4 A;  4FET A;  3FXL A;  4FTH A;  3M3Y J;  2W00 A;  2HFH A;  4FHT A;  1JKP C;  1NHA A;  2V9V A;  2DOE A;  3A0B C;  3CCM I;  5BPD A;  3GFM A;  2NYX A;  2IRF G;  1UG2 A;  5D8L B;  1KA8 A;  1SAU A;  1OPC A;  3TP0 A;  1ONV A;  1T39 A;  3AG1 H;  4UUS A;  5K5Q A;  4EVI A;  4BE1 A;  3C1D A;  2HKO A;  1TTY A;  4CZZ A;  3QRF F;  4NHJ A;  4RLF A;  2IGN A;  4ESB A;  2BE5 F;  1YHQ I;  1X3U A;  2XVC A;  5CVR A;  3ASO H;  3IKV A;  1IC8 A;  4K2E A;  2X51 A;  1IF1 A;  3L00 A;  5IOZ A;  2L5Q A;  4KIS A;  2HU9 A;  2Y9Y A;  1FTT A;  4P5O A;  1GXP A;  2NNN A;  3Q5F A;  4KNY A;  2HQR A;  2HQ5 A;  2RV8 A;  3A4C A;  1IO2 A;  1K4S A;  6PAX A;  1W7P A;  3HKZ A;  2EZI A;  1OYW A;  3DTK A;  5JLW A;  2KIU A;  3L7W A;  4AID A;  4BXU A;  1P92 A;  2MAB A;  3LSM A;  1KON A;  1VQK I;  1Z91 A;  2O9L A;  1XB4 A;  3HBL A;  1OKR A;  2W1O A;  3ML6 A;  4XKC A;  5LRS A;  4XKV A;  5HNF A;  2HZT A;  2N8G A;  4B3X A;  3F21 A;  2R7R A;  2OV7 A;  1Y39 A;  3DKX A;  4EJW A;  3S1Q J;  1T0F C;  2EZH A;  5L3B A;  2JUG A;  3V7R A;  3WTW C;  4O6J A;  5E3N A;  5FKN A;  1UST A;  4HX8 A;  3NEU A;  2EFN A;  3H9J A;  4NNJ A;  5EDN A;  5E3M A;  1FYL A;  2DTR A;  1H9G A;  3I56 I;  2IGK A;  1DU0 A;  2P7V B;  1S6L A;  1X4P A;  1R71 A;  5ICC A;  3TDZ C;  2CQX A;  3GO5 A;  1OCC H;  3HZJ A;  3LMM A;  3VSL A;  4I2O A;  4UNO A;  2K9Q A;  5ERI A;  3S1R J;  2EIJ H;  2Z9O A;  1SFE A;  3HRU A;  3SYT A;  3TOB A;  2W85 A;  3P7N A;  3BTC A;  2MH9 A;  1ETW A;  1ETY A;  3FM3 A;  1RNL A;  4BE0 A;  2P5V A;  1GVD A;  2QSG X;  2L7Z A;  2LBF A;  2R3S A;  4M73 A;  4OMZ A;  3VPR A;  5K7F A;  4CHU A;  3CCQ I;  3GTO J;  2LP0 A;  4HX7 A;  1RRJ A;  5EZG A;  1S5L C;  2KJC A;  1XSX A;  2KDZ A;  3CES A;  3M4O J;  2DMP A;  4RB1 A;  3GFI A;  2FE3 A;  5AIP A;  5DUK A;  3OYI A;  2W25 A;  4BUP A;  3VFZ A;  1QQI A;  5J8C A;  4O5V A;  1MH3 A;  2BVL A;  2VQG A;  3ZOB A;  2P8T A;  5F6F A;  1ETQ A;  3A01 B;  3CUQ C;  3V7S A;  1VQ7 I;  4RGU A;  1OFC X;  1Y8R B;  3AFH A;  1UHM A;  4U0W A;  1X1C A;  4RB2 C;  3MKZ A;  2HVS A;  2FEZ A;  1VQ6 I;  3QYE A;  2I8D A;  2KRF A;  4HV6 A;  5FLX Z;  2DMU A;  3ZQI A;  3HSF A;  1ACI A;  3CZ6 A;  3HXL A;  1OCT C;  1MNM C;  3BJA A;  2QQB A;  4ZZL A;  3AG3 H;  2VKH A;  3HPH A;  5CLS A;  1J09 A;  2VC0 A;  4UV8 A;  5IPA A;  3OS0 A;  1TP4 A;  2RRE A;  4G6T B;  1GV2 A;  1Z3X A;  1MBJ A;  2IS4 A;  1OLT A;  3OYJ A;  2P6T A;  2LTP A;  4CO8 A;  5BMZ A;  2Y69 H;  2M30 A;  2QSF X;  1KZH A;  4XLC A;  2E2H J;  2EQR A;  1MJ9 A;  2IA2 A;  2A3S A;  2JVH A;  3G2B A;  4CA0 A;  1EJ9 A;  2ZBK A;  3RYP A;  1TNT A;  5DV5 A;  4U7D A;  1ON2 A;  4F55 A;  3OYF A;  1ZLK A;  3SEQ A;  3KEY A;  3QPS A;  4F3Q A;  1LFB A;  2KJB A;  3T0Y A;  1Z0X A;  3QAH A;  1OCZ H;  3DLL F;  4NDL A;  3SDB A;  2K5C A;  1BM9 A;  1S7E A;  4L0Y B;  2K27 A;  2PEX A;  5J1Y A;  3JRB A;  4U7B A;  2A61 A;  1SMT A;  1E0E A;  2NVY J;  3E5U A;  4LK0 F;  1ZTR A;  3QOD A;  1T2K A;  1Z67 A;  1BN5 A;  3LAP A;  3LSJ A;  2DW4 A;  1WVR A;  2OZ6 A;  5TJJ A;  3WGG A;  3QPH A;  3UKG A;  3PO2 J;  2IS1 A;  2HVQ A;  3PNV A;  3SZG A;  2ZB9 A;  2KHM A;  2WV0 A;  4LB6 B;  4QLC U;  2M3A A;  4FIS A;  5DTD A;  1ZRF A;  4QPO A;  4M9Z A;  2JT1 A;  1SAX A;  4D5F A;  1DU6 A;  1N77 A;  2UWM A;  1HXD A;  3J81 Z;  4NQW A;  3IWF A;  3G73 A;  5A2Q Z;  2PI0 A;  1T95 A;  4ZJZ A;  4HST A;  4HNU A;  4JYK A;  4DOZ A;  1JGG A;  5CVI A;  4I76 A;  3OY9 A;  2TDX A;  3I54 A;  1WI3 A;  4RMN A;  1KGS A;  2FML A;  2PJR A;  3CCJ I;  1D8K A;  1EH8 A;  1TZL A;  1ZAO A;  4OWR B;  3K69 A;  1JKQ C;  2R7Q A;  3FIW A;  1D0Z A;  2LY9 A;  1XG1 A;  1FOX A;  3N05 A;  4C2U A;  4E7H A;  4EJT A;  5GPA A;  4HX4 A;  4ZTF A;  1BC8 C;  1VQ9 I;  3JTH A;  1Z21 A;  3LSI A;  2KLO A;  2LF7 A;  3L9F A;  3MFK A;  4XID A;  3CMM A;  4P55 A;  4AYB A;  3ZR8 X;  2XGC A;  1P7I A;  2BHY A;  1R22 A;  3CCV I;  2DA1 A;  2K40 A;  1WPK A;  1DGW Y;  1HDP A;  1HQC A;  5CVJ A;  3HKZ N;  1MBF A;  5KK1 A;  1TNS A;  2KP6 A;  2ISZ A;  5LHH A;  3K10 A;  3FK6 A;  3V8J A;  4D1Q A;  1K7A A;  2EH3 A;  1X2N A;  1ZGA A;  2UXX A;  2HZD A;  4BE2 A;  2OQG A;  3ZCO A;  1FX7 A;  1UFM A;  4Y13 A;  1QVU A;  3WHB A;  2DXI A;  4IHY A;  2OD5 A;  4LJZ F;  4BBS J;  2LNB A;  3DTE A;  2AXL A;  2VKD A;  4M3B A;  3KFW X;  2OBP A;  3OL4 A;  2E2I J;  3IAM 2;  2VE9 A;  2R5Y A;  5M5X J;  3K1M A;  2LLK A;  4XSX F;  4IJA A;  2GM4 A;  3CJR B;  1H89 C;  2DQL A;  3DEU A;  3RKY A;  1MNE A;  3R60 A;  1RUN A;  3TO7 A;  3BZK A;  1O3S A;  2QKM B;  1O3T A;  2ZXI A;  1ZHF A;  2H09 A;  2D5V A;  3RYR A;  3PQJ A;  2LFB A;  4ZYA A;  3O8G A;  1OYI A;  3FF5 A;  1P4A A;  3L2C A;  1OIS A;  2LBF B;  2YR2 A;  3BCA A;  4R8H A;  4ON0 A;  5E3L A;  2PLY A;  2XRN A;  4XRF A;  3C2G A;  3PO3 J;  3D5R C;  1X4O A;  5DCM A;  5J4V A;  1EH7 A;  3SXY A;  4MTD A;  2J5P A;  5IP7 J;  1SAN A;  5FRO A;  3FMS A;  4QWQ A;  2V9P A;  4M71 A;  1XPX A;  3ZQH A;  1SD5 A;  3OYM A;  4YIR X;  1R49 A;  1JHF A;  1EV7 A;  2XB0 X;  4C9Y A;  1LJ9 A;  2OU2 A;  5H6Q A;  3GTQ J;  5E1Z B;  1KYZ A;  3CJT B;  1AA7 A;  3JRF A;  2A6T A;  4BNC A;  1E3P A;  2GQQ A;  3X2Q H;  3GZ5 A;  2XB5 A;  4KIT B;  2JVG A;  3DP7 A;  2QQA A;  4X1E A;  1OJL A;  3ZRG A;  2ZSI B;  5EG0 B;  2DQR A;  2K7L A;  3VYU B;  4ABZ A;  3FXM A;  2H27 A;  4HBL A;  1LNW A;  3AAF A;  3TBI A;  1AHD P;  1VF9 A;  1XX5 A;  4QIW N;  2QUF A;  3GCM A;  1ZG3 A;  2P6S A;  2VBY A;  4KFC A;  4PSW A;  5BS6 A;  3ZP5 A;  3GFJ A;  4OOI A;  3DKW A;  3E5Q A;  2FXA A;  1QZE A;  3KP6 A;  2VXD A;  4EGY A;  2R93 J;  4UUT A;  2WB1 A;  4ZYH A;  5HDK A;  1W7P D;  4WK8 F;  2R7S A;  2EWN A;  5FRN A;  2QBY A;  1VQ4 I;  2ECC A;  3CC2 I;  5EYR A;  2M0M A;  2HPI A;  4OIN F;  5LEJ A;  3KP5 A;  2ZC2 A;  3P9I A;  3Q3S A;  2EA2 A;  4HA8 A;  4J01 A;  2M0C A;  5TGT A;  2R7X A;  1XGM A;  4OU0 A;  4F93 B;  3RTR A;  4XL9 A;  5LHI A;  1IN5 A;  3BR6 A;  3HGY A;  3ABT A;  3LL7 A;  4AUX A;  2OJE D;  4YFX F;  2KFD A;  2DA7 A;  3DEE A;  3KZY A;  3COA C;  5E18 F;  3O6B B;  3KP7 A;  2DA4 A;  4M6V A;  3HSE A;  2PX9 A;  4PUS A;  2D45 A;  3RPU D;  5IT9 K;  3PNT A;  5CJ9 A;  2BOL A;  2DDA A;  2P81 A;  4RGS A;  4KN7 X;  2PFB A;  4PDK A;  1AOY A;  3LSP A;  2E2J J;  4IHS A;  3J80 Z;  1GVJ A;  3OSF A;  4A3B J;  2KDO A;  4RB3 C;  2CW0 F;  4WXC A;  4A0Y A;  4OIP F;  2TRT A;  3FHZ A;  2XAF A;  3HUG B;  1JGS A;  1T8I A;  2PJR B;  1F9N A;  3I55 I;  3DCF A;  1X19 A;  2FD5 A;  1U5T C;  1HA8 A;  3PSI A;  3S93 A;  5HLG A;  2QWW A;  1WCM J;  2IPQ X;  3RIR A;  1U8R A;  3ULQ B;  2LKS A;  1P7J A;  3IP4 B;  1FMW A;  1MND A;  3K4N A;  2FQ4 A;  5B1B H;  5FKL A;  2Q1Z B;  1KQ9 A;  2X1E A;  3S3O A;  1F5T A;  2XF7 A;  5AON A;  4BHB A;  4E70 A;  4JK1 X;  4UVA A;  1SD4 A;  4G7H F;  2IS6 A;  2HYF A;  4IOC F;  2AS5 F;  3OWT A;  4BXF A;  2JN6 A;  2V9K A;  1MZB A;  1R23 A;  2KRC A;  2M34 A;  3BTI A;  4BJT A;  4M6X A;  4LK1 F;  3HL2 A;  4L9V A;  5H20 A;  2BY3 A;  3MKY B;  2E7X A;  4AYB N;  3S32 A;  2CO5 A;  5C4X J;  4Y15 A;  3KIO A;  4I7H A;  1LPQ A;  5J1U A;  4AVP A;  1OR7 A;  1SD6 A;  3REO A;  3H0G J;  2ZXJ A;  3MCZ A;  3ESW B;  2KL4 A;  2H8W A;  3ISP A;  3M07 A;  4GO1 A;  1VQO I;  1MMN A;  1WJC A;  5KHD A;  3NRV A;  1BOB A;  4HV5 A;  4EGZ A;  2V26 A;  2R5Y B;  2MW8 A;  5FKO A;  3LNQ A;  3S3M A;  1ZKG A;  3SQN A;  4FAS D;  3OYN A;  1YJ9 I;  4MLO A;  3N4M A;  1JUP A;  5TRD A;  1GXQ A;  4XMY A;  5ILV A;  2BGC A;  3H3V K;  4DYC A;  3GZN B;  3HIF A;  3FXK A;  3HOX J;  5CQE A;  2OTL I;  1JT0 A;  3MKL A;  3S2H J;  3A0H C;  3VOD A;  3R0A A;  1OMI A;  2CG4 A;  2L54 A;  3G6E I;  5F04 A;  1ZQ3 P;  1YW7 A;  2RKH A;  3ZMT A;  4A3G J;  3ECH A;  4MEY F;  1YI2 I;  4IHV A;  2ZFU A;  2V1D A;  2DFH A;  1T33 A;  4XNF A;  2ETH A;  2KZV A;  4RBO A;  3I58 A;  1USS A;  1HW1 A;  2KMU A;  4XOR A;  1ZG5 A;  1XSD A;  1BR2 A;  3UR3 C;  4CCK A;  2VN2 A;  3TW6 A;  4Q48 A;  4L5I A;  3WTS C;  1TW2 A;  4BBR J;  1FY7 A;  1TQP A;  3K6G A;  4UXN A;  1BA5 A;  4HAM A;  4CCN A;  3SFI A;  1P2F A;  2NAZ A;  2XF6 A;  3CJQ B;  2IJL A;  2IA1 A;  3E1S A;  3GXO A;  2PMU A;  3AL0 B;  1WRJ A;  3GME A;  1XMK A;  4ZDP A;  4CIC A;  4EJO A;  2V1U A;  4DYQ A;  1C0W A;  4HYE A;  4IHW A;  2VXZ A;  1ZRE A;  2YU3 A;  4CDG A;  5KVR A;  3WU2 C;  3IRQ A;  3OYA A;  1B8I A;  1VQ5 I;  1B9N A;  4KT6 A;  2E1N A;  5JR3 A;  4MQ9 F;  1YS6 A;  1LEA A;  3QWL A;  3HOV J;  4ANJ A;  5LHG A;  4XQF A;  1I1G A;  2XGX A;  5JHF A;  3G1L A;  3I4M J;  2JRT A;  2EK5 A;  4RB0 A;  1Z6R A;  3OYC A;  1W5C C;  5B66 C;  1M1E B;  5JVT A;  3BR1 A;  4I98 B;  1YIJ I;  1D1A A;  2FBH A;  2K9S A;  2R7Z J;  2VJJ A;  1D5V A;  1L3L A;  3BC8 A;  2K4B A;  3LQR A;  3U1K A;  2V4J C;  1I50 J;  3LSG A;  1U0J A;  4DBR A;  1PYV A;  5F27 A;  5HOO A;  5FD5 A;  5E3O A;  2GIZ A;  4XSZ F;  4Q5S F;  4IZZ A;  3E6D A;  1U2W A;  3M8E A;  2JRM A;  3R0J A;  3KZZ A;  3LSR A;  1RKW A;  2WB1 N;  2VQH A;  3KYC B;  3H0D A;  2UZK A;  3WGI A;  1G3W A;  2FBK A;  2Y48 A;  1Y8Q B;  1U8B A;  2DOA A;  2EJR A;  2M5W A;  1FT9 A;  5IP6 A;  2L7K A;  2JTV A;  5FKM A;  3OYK A;  3QU6 A;  3ERE D;  5D4S A;  1Z3Y A;  4HNV A;  1Z77 A;  5LLQ A;  3GUD A;  2HNH A;  3TQN A;  3S8P A;  5HLT A;  2X48 A;  4MQV A;  3FXR A;  1G3T A;  4C2M J;  3U2R A;  2CJJ A;  1QHH D;  2O3F A;  3S3N A;  3EYI A;  1K6Y A;  3CTA A;  4PJJ A;  1FOY A;  4IQ4 A;  3CO7 C;  2DPD A;  4IQJ A;  5M5W J;  3QP6 A;  2VBZ A;  4MIM A;  3BQZ A;  1H0M A;  2LY1 A;  3ABL H;  1QRY A;  4EMS A;  3RPQ A;  2LF8 A;  1VQN I;  1MKM A;  2L9S A;  3J7A O;  2QEN A;  4D5C A;  2WAF A;  1RET A;  3BR2 A;  2JJ7 A;  5B1A H;  1FLI A;  2ME6 A;  4I02 A;  4J19 A;  3B73 A;  1TBX A;  3IH4 A;  2LVS A;  1FBQ A;  5GAH J;  3F3X A;  3G3Z A;  2Z16 A;  2VL8 A;  2HXI A;  4CZC A;  2Z3Y A;  4KJZ A;  3D5S C;  4WF2 A;  3FZV A;  2AO9 A;  3TDU C;  2ZME B;  2ZJQ F;  3DPT A;  1QNT A;  4IKF A;  3LA2 A;  3D5L A;  3KP4 A;  4M3F A;  4ITV A;  2EB7 A;  1YYV A;  1V3F A;  2AQF A;  3DPU A;  1JHH A;  1UMQ A;  4RM3 A;  1YLF A;  1W36 D;  1SEU A;  3SZT A;  3ZXS A;  3DBL B;  1ETO A;  1WGX A;  2CFO A;  4YRV A;  3BTL A;  4BKX A;  1MDM A;  3VWB A;  4EJU A;  2LK2 A;  2A07 F;  3HOY J;  3QPL A;  3OYG A;  1QGP A;  1H9T A;  3LA3 A;  1BR4 A;  3Q9V A;  3U1D A;  4CXF A;  1MBE A;  3L2R A;  1A5J A;  3I64 A;  5BQT A;  2H8R A;  4LMY A;  3KLN A;  4JOM A;  4BGD A;  3WTX C;  1YX5 A;  1QHG A;  5J8F A;  4XM3 A;  5J1R A;  2LYC A;  3EUA A;  3I0T A;  5LEK A;  1WJD A;  3V4G A;  3LFK A;  3CF2 A;  3KP3 A;  5E79 C;  5L3E A;  1TLH B;  2F48 A;  2QF7 A;  3ZQQ A;  4ZYE A;  5JLX A;  3JTG A;  1MH4 A;  4ENJ A;  1ZR4 A;  2HR3 A;  3HOW J;  5DM6 F;  3JRI A;  4S04 A;  4E7L A;  2ZO4 A;  1IV6 A;  1Y1V J;  3V8L A;  1J75 A;  2IA0 A;  3ERM A;  3MD2 A;  4XK4 A;  1X1A A;  4NC6 A;  5F64 A;  1S7O A;  3KE2 A;  5D5W B;  2O7O A;  4XLP F;  1MMD A;  3FWE A;  2VE8 A;  4BQQ A;  2EFP A;  5FD6 A;  4NUB A;  4C3J J;  1HW5 A;  3EUH A;  1ZR2 A;  3W6V A;  2NVQ J;  1FP1 D;  4JX6 A;  3W2V A;  1CF7 B;  1ETK A;  3I5U A;  1TT5 B;  3R6S A;  4HOB A;  4HRI A;  2E1M C;  3LAJ A;  3OYB A;  1B8I B;  2VOD A;  3CLO A;  1ON1 A;  2YPR A;  1HST A;  4M72 A;  2L3D A;  5FB2 A;  4G9Y A;  4OIR F;  4UY8 I;  2A6H F;  3HYI A;  4KA4 A;  5E17 F;  2C6Y A;  4BJ5 C;  1NTC A;  2VC1 A;  3U9G A;  3HB9 A;  5C3E J;  2H1K A;  2XV4 S;  1R6R A;  1RC9 A;  1U78 A;  4KUM A;  4YII A;  3CQZ J;  1BI2 A;  2DT5 A;  2Y9Z A;  2O03 A;  2VBW A;  1IXC A;  2XGD A;  1PVE A;  1FC3 A;  1NG7 A;  1WHU A;  2CW8 A;  2DA3 A;  3F6V A;  3C2H A;  1H8A C;  3SDG A;  5HOD A;  4F92 B;  3UNG C;  2DT7 B;  5EG0 A;  1V55 H;  2E5N A;  3W2W A;  3CMY A;  1CGP A;  2M1B A;  3DEW A;  2RDP A;  2Y2Z A;  3CDI A;  3CLQ A;  3E5X A;  4CCL A;  2YS9 A;  1ZG1 A;  3GW2 A;  2RAE A;  1FP2 A;  2OCC H;  3DKY A;  2VI6 A;  2GOX B;  4IPA A;  1WJA A;  1YJN I;  1CQT A;  2XAJ A;  1F43 A;  3RQ4 A;  2EIL H;  2YUS A;  3CP8 A;  3OS2 A;  2LH9 A;  4BJ6 C;  4A69 C;  3N97 A;  1UAA A;  4ETS A;  3GFL A;  3CUO A;  1QO0 D;  2YX7 A;  2CV0 A;  2E19 A;  4Y7N J;  2DO7 A;  4L18 B;  5JFR A;  1R1U A;  3ZGK A;  5K1Y A;  4M9X A;  4RAG A;  5LRR A;  3JSP A;  1S29 A;  2WY8 Q;  2RNG A;  2IAI A;  3MMY B;  1W36 C;  1D0X A;  3M9A A;  2XHK A;  2ZNY A;  5LBQ A;  3T1B A;  3GTG J;  1LVK A;  3GZ6 A;  1WWX A;  2ESN A;  1O4X A;  2M8G X;  3J7Y J;  1IXS B;  2GLO A;  4II2 A;  1IDZ A;  2F5E A;  3LSH A;  2L4A A;  3KZI C;  3JAM Z;  2FNP A;  4NB5 A;  1XDS A;  4A12 A;  1RES A;  3CDH A;  1DUX C;  1K4T A;  1G3S A;  3ZQC A;  2MLG A;  3CMA I;  4FX0 A;  2DTZ A;  1BOA A;  1IGN A;  2DMT A;  3NAR A;  4XN3 A;  3JRA A;  2IVM A;  4PJL A;  5DD4 A;  1P6R A;  2HYG D;  3LQQ A;  2F5D A;  5HLH A;  2UXN A;  4LFU A;  5F1J A;  3QP5 A;  4ZYD A;  1B72 A;  1BIB A;  2O8X A;  3CC7 I;  1A36 A;  2GXB A;  2M2E A;  3C7J A;  4HF0 A;  3H1C A;  3HUG A;  1MDM B;  2W57 A;  5GTH C;  3HRT A;  2GZW A;  2FNA A;  2HOA A;  5E8I A;  4UV9 A;  1LQ1 A;  3C3W A;  4P1W A;  4ZDL A;  3IH3 A;  5LD2 C;  2XPW A;  4WX9 A;  1T0F A;  4A3C J;  2E34 A;  1VZ0 A;  2Z1D A;  5AIQ A;  2L4M A;  1UCR A;  4BH9 A;  2JA5 J;  2E5Z A;  2FUG 2;  4LGW A;  4RAY A;  5L3C A;  2KIS A;  4KIC A;  1KU9 A;  4BQA A;  1ZH5 A;  4YEL A;  3ZQG A;  1KU7 A;  3A1Y A;  2DK5 A;  1ZRD A;  1YW9 A;  4XLE A;  1PP8 F;  3K7A J;  3OYD A;  4PGG A;  5EZH A;  3CJS B;  1NH3 A;  4Z6Y A;  2HQN A;  1J2X A;  1N78 A;  3MKW B;  2VJ5 A;  2DYS H;  3BP8 A;  4V19 K;  4AIH A;  1ZYR F;  4R79 A;  2STW A;  2CQ7 A;  3V42 A;  2O5R A;  4Y33 A;  2LG4 A;  4HW0 A;  2ELJ A;  3OYL A;  3K0L A;  1GV5 A;  2IT0 A;  4PGH A;  2R7O A;  3MZH A;  2M4K A;  2PN6 A;  4A6E A;  4GYG A;  2DFI A;  1MBH A;  4ASN A;  2WWY A;  2MD5 A;  3M1E A;  1IG7 A;  2CW7 A;  4ZC3 A;  4E7S A;  3CUQ A;  2MG4 A;  4FE4 A;  4EM0 B;  1I5Z A;  1A35 A;  1Y56 A;  1I3A A;  4HDU A;  1VQP I;  3MN2 A;  5GAE J;  1J59 A;  2P5K A;  1F4K A;  4Y17 A;  2EV6 A;  3HJE A;  3I4N J;  3OR1 C;  2CV2 A;  4LIV A;  3IL2 A;  4A2U A;  3PUB A;  2E1C A;  2QYO A;  1VQ8 I;  2PJP A;  3DU5 A;  3ABK H;  3HPG A;  5E20 A;  3SZP A;  1PJR A;  1JT6 A;  1Z6T A;  2AQE A;  2WAD A;  1GT0 C;  4HQM A;  2Q8K A;  1FOK A;  5ICE A;  1WJB A;  2ZCW A;  2EFO A;  2MFZ A;  3BZC A;  3JR9 A;  3GBG A;  3F9K A;  1P4W A;  1O7L A;  3ZQL A;  2JUC A;  2BHZ A;  4AVZ A;  1KQ8 A;  3OMY A;  4RA2 A;  1HW2 A;  3KET A;  2FOW A;  4DNC A;  3JRD A;  3BG7 A;  2Y30 A;  3CF5 F;  2WV1 A;  4UVC A;  4XRS G;  2DJN A;  1LEB A;  1W0T A;  4A93 J;  2MLK A;  4A3F J;  1DPR A;  2VUM J;  1YJW I;  3FK7 A;  2VT2 A;  1JXS A;  1IV8 A;  1YW8 A;  4LLG F;  3HTU A;  1X1D A;  1P4X A;  2QA4 I;  2O6G E;  2FBI A;  2HI3 A;  1AKH B;  1IUY A;  4IRH A;  3MVP A;  2L9N A;  1X2M A;  1Y0U A;  1R58 A;  1T98 A;  2D2W A;  1IN6 A;  2A6E F;  3F23 A;  1D8J A;  4M3G A;  4BDZ A;  1REP C;  3E6B A;  4L9J A;  3I3L A;  4D7M A;  3BPX A;  1DQU A;  2GAU A;  1X3Z B;  2QZ8 A;  3FM5 A;  1DP7 P;  4WXD A;  2DOF A;  2XAQ A;  2XIG A;  1MD0 A;  2EIN H;  3NAU A;  3ZMS A;  1HC8 A;  2B0L A;  3AKZ A;  2DPU A;  3SEZ A;  4KYW A;  2JQ7 A;  4UVB A;  3RJP A;  3JRE A;  3F8F A;  1I6X A;  3GF2 A;  3HHH A;  1E17 A;  2QKL B;  4EEF G;  1IN8 A;  3BOQ A;  2XPU A;  3O2P E;  4NC7 A;  3WHC A;  2OF7 A;  4DQ2 A;  3ABU A;  4A3J J;  1PDN C;  3WTZ A;  2KZG A;  2MGQ A;  2D1H A;  2XSD C;  2RN7 A;  2XGE A;  3AG4 H;  3TO9 A;  4B47 A;  1IRZ A;  2LR8 A;  2HOS A;  3WTY C;  3LFU A;  2O61 A;  3I4P A;  1O3R A;  2ZJP F;  4XRS A;  5FLM J;  1ERD A;  4HLX A;  1JUM A;  3Q0W A;  2G7U A;  3TW7 A;  1OCP A;  4LG3 A;  1UZC A;  2KIF A;  3HRM A;  5HDG A;  3TMO A;  2VPR A;  3O8H A;  1FYM A;  1DGR M;  4IXA A;  1A31 A;  4AIJ A;  1IDY A;  3K2Z A;  4G7O F;  4RM2 A;  4ZZD A;  1WJ5 A;  3HOZ J;  3I71 A;  3OL3 A;  4A5N A;  3LSK A;  1B72 B;  4D0P A;  2ICW G;  1D5Y A;  2DU9 A;  1QPI A;  2OPT A;  4XLH A;  4BQO A;  2QQ9 A;  3DTI A;  2HWV A;  2A69 F;  3KX2 A;  4ZH4 F;  4LIU A;  3WU1 B;  4H0E A;  3FXO A;  1MGT A;  3IKT A;  2Y75 A;  2AHQ A;  3IH2 A;  3KEQ A;  2E60 A;  2HOT A;  3PL8 A;  4G12 A;  3S1N J;  3VYR B;  2DA2 A;  2IXS A;  2RC4 A;  5E1X A;  4XRM A;  1UB9 A;  2ZME A;  3I59 B;  4DZJ A;  2IW5 A;  3SJM A;  4E7K A;  1IRG A;  1XSV A;  4CYD A;  3K4M A;  3EYY A;  5E1W A;  2H1L A;  3CC4 I;  1TWH J;  1X3W B;  2BW3 B;  3H3Z A;  2BYV E;  3GLL A;  3MQ0 A;  4PFO A;  2M4G A;  4B1R A;  1OYY A;  2QM3 A;  4B3A A;  1D1C A;  4L9N A;  3O3K A;  5DDG A;  4C3I J;  1BR1 A;  2M7A A;  4A3E J;  5IYB J;  5J47 A;  3WTT C;  4RGR A;  4G6Q A;  4GFB A;  5L3G A;  2MBF A;  2V1N A;  2G7H A;  2CGP A;  1N75 A;  1FIA A;  2DJI A;  4DYR A;  2PMH A;  1BIA A;  1YE9 A;  2EZK A;  4KMU X;  1OCR H;  4N9H A;  4A3K J;  2BXY A;  5CQG A;  1V4R A;  3CUQ B;  2L7F P;  2B9S A;  2K86 A;  2P7C B;  1FEX A;  3L2Q A;  4MFE A;  4GCV A;  4KDP A;  2NOG A;  2NVT J;  5GTI C;  4CH7 A;  1KQ0 A;  4X0G A;  2EIK H;  3HOS A;  1WH7 A;  1BJA A;  5B3S H;  3OSG A;  3IV5 A;  3QOE A;  1HLV A;  3ROU A;  4EM2 A;  3L2V A;  3T8T A;  3H9G A;  1ITY A;  1ZEL A;  4HZF A;  4E6K G;  2ZSH B;  2W84 A;  1U9O A;  3DLA A;  4E7Z A;  1WJF A;  2CUF A;  3CCS I;  1MW7 A;  2F6C A;  2IGO A;  2PQ8 A;  3K1N A;  3VEP A;  3H5A A;  2HYJ A;  4W97 A;  5GAD J;  2Y0M A;  1XMX A;  4L9T A;  4XLA A;  3PIO F;  3BJ6 A;  2KQR A;  1ODD A;  4C2T A;  3G71 I;  3OS1 A;  2LKP A;  2X1C A; 
#chains in the Genus database with same CATH homology
 1YJN I;  3I56 I;  3G4S I;  1YIJ I;  1MMS A;  3PIP F;  1S72 I;  3CME I;  1VQP I;  5GAE J;  3CJT B;  4IOC F;  3CCE I;  5JVG F;  1VQ8 I;  3CCR I;  1FOW A;  3CCQ I;  5DM6 F;  1YIT I;  1WIB A;  3J7Y J;  3CCJ I;  2H8W A;  1VQO I;  2ZJR F;  3CCU I;  2FOW A;  3CMA I;  3CF5 F;  1FOX A;  1YJ9 I;  1VQ9 I;  1VQ7 I;  1YJW I;  3J7Z I;  3CCM I;  1VQ6 I;  2QA4 I;  3CC4 I;  3CCV I;  2OTL I;  1FOY A;  3CC7 I;  1ACI A;  3G6E I;  1VQ4 I;  2QEX I;  3CC2 I;  2OTJ I;  1VQM I;  1YI2 I;  4IOA F;  1VQN I;  4UY8 I;  1YHQ I;  2E34 A;  2K3F A;  1VQL I;  1HC8 A;  3CCL I;  3CD6 I;  1QA6 A;  2JQ7 A;  5GAH J;  2NXN B;  3CJR B;  4IO9 F;  2ZJQ F;  5DM7 F;  3CJQ B;  3EGV B;  3CJS B;  5GAG J;  1VQK I;  3DLL F;  2E36 A;  4V19 K;  3CCS I;  1VQ5 I;  1Y39 A;  2E35 A;  2ZJP F;  5GAD J;  3I55 I;  3PIO F;  3G71 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...