1FP2A

Crystal structure analysis of isoflavone o-methyltransferase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
345
structure length
345
Chain Sequence
RKPSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIGNVRRLMRYLAHNGFFEIITKEEESYALTVASELLVRGSDLCLAPMVECVLDPTLSGSYHELKKWIYEEDLTLFGVTLGSGFWDFLDKNPEYNTSFNDAMASDSKLINLALRDCDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVIDKKKDENQVTQIKLLMDVNMACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ISOFLAVONE O-METHYLTRANSFERASE
publication title Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.
pubmed doi rcsb
source organism Medicago sativa
molecule tags Transferase
total genus 122
structure length 345
sequence length 345
ec nomenclature ec 2.1.1.150: Isoflavone 7-O-methyltransferase.
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fp2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1fp2A02
3IRRA 2JTVA 1ZRFA 4LLNA 4RB2C 3I53A 4ATNA 4CGZA 4BLWA 5EVJA 5GWXA 3T8RA 3HVIA 2YXLA 1T43A 3NVMB 1QAMA 4QQKA 4ZYGA 1Z6TA 1YFLA 5T67A 4F85A 2DULA 3HRSA 2M45A 4G8XA 3KZZA 5K0GA 1SD4A 1PP7U 2BH2A 1HSTA 1UCRA 2PWYA 1R18A 3ZMUA 1SUIA 2PXCA 1OMIA 2RGVA 3B89A 2DO7A 4PCAA 3LWFA 2R6ZA 1HNNA 4M9XA 1JG1A 1R22A 4YMGA 1DPRA 3FM3A 2XYQA 4AD9A 2ZCWA 3UFBA 4G6QA 3B5IA 1SMYF 5LQAA 2D45A 5HDKA 4EKIA 1XMAA 1L3BA 1NW3A 2BV6A 3ZN0A 3HVJA 4Y15A 1G55A 5EIWA 3QV2A 5E18F 1R5HA 3PX2A 3C7JA 4MIKA 3DH0A 4PONA 4BY9E 1UHMA 3S68A 4YUVA 4KICA 5D4SA 1G8AA 4QWQA 2JH8A 2G72A 5ICCA 3K69A 1BI2A 4NHJA 3HCFA 3BJAA 2RC4A 3K1PA 1KXZA 4M37A 2L02A 2D2WA 2DQLA 5DD4A 1X1BA 2NXJA 4QDJA 1ORHA 3DXYA 5CIYA 2H09A 3VSEA 3I59B 5D5XB 1HKQA 4P7GA 3WSTA 2ZLBA 3L2CA 2ZO4A 5D8KB 3HCDA 2K02A 3ZMSA 5EG5A 2FA5A 1NW5A 2HQRA 3ZPLA 4KIGA 3ERED 1W7PB 3UJ7A 1L1EA 2UXNA 1KU2A 3BWCA 2VC1A 2MC3A 2CL5A 2FNPA 2IT0A 4HRAA 4PNEA 4I0BA 4Q48A 2WA2A 3O7WA 5JI6A 3GX4X 1EV7A 2B0LA 2VE9A 2B2CA 2DK8A 5D5UB 2QRVB 1BIAA 3MZYA 3SM3A 5LQKA 3HYIA 1DP7P 4C04A 2RVCA 1IF1A 4ER7A 2O57A 4PYNA 2ERCA 4RX1A 3EDPA 3VB2A 2YXDA 3OE4A 2EB7A 4LFUA 2QLZA 2B25A 2ZXJA 4ETSA 3OFJA 5DM4A 3DMFA 3ELYA 3PT9A 2Z3YA 4M38A 4H0NA 4L18B 5HLHA 1YS7A 3M1EA 3A7EA 3NQOA 1Z9CA 2IBSA 4FS8A 3R6TA 1SFXA 5C9ZA 5E1DA 1HQCA 1Z7UA 1J5YA 1P1BA 2K4MA 1FP2A 4MWZA 2H6CA 2XAHA 3D5LA 2E5WA 2ZMEA 2MBFA 2ZIFA 3F8NA 1QZYA 1Y8CA 5CVJA 3E8SA 3ABTA 3C18A 4I2OA 2FOKA 1FBQA 2F2EA 1N7IA 3CDHA 1FT9A 3P9NA 5L3CA 3U9GA 5EGSA 1F1ZA 3PQKA 2VN2A 3AJDA 4PYJA 4P9FA 1F4KA 5CVRA 5JVTA 2AVNA 2CKDA 2HEOA 2NXNA 5FA5A 1I27A 1IRGA 3A25A 3UWPA 1CF7A 2BZGA 4HX8A 5BOXA 5KYGA 4RS8A 3T7RA 2W57A 2PMUA 3HM2A 2CSOA 3F8FA 1EJ6A 2VBZA 2OO3A 1IXRC 3F72A 3P8ZA 2PG4A 5BPIA 1JTFA 2HWKA 1YZ3A 3UJBA 1ZRDA 1P92A 5LLQA 1O3TA 1EAMA 3M4XA 3MQ0A 2C7RA 1KU9A 2AN4A 4FSDA 1X1AA 5BP7A 1VPTA 1AQJA 4ISCA 1UB9A 2OQRA 1JQ3A 3AXTA 3THSA 1FYKA 3P2EA 3U1DA 2E7WA 3G5TA 3UZUA 5DXJA 2PJDA 5FD5A 5DWQA 3R6SA 3Q5FA 2B9EA 5DTRA 2FSWA 1YTYA 4ZYDA 3AY0A 2GPYA 2LD4A 4O6JA 5K1YA 4E32A 4OX9Y 4U7TB 1AF7A 3P97A 4E33A 4KMFA 3SSNA 1QYRA 2TDXA 4M73A 3OCJA 5CVEA 3TKAA 3GGDA 2ACJA 3HTXA 3DF8A 4X41A 4AIJA 1YLFA 1KPGA 2Y1WA 3B02A 1R1VA 3LCCA 3E6CC 3OPNA 3RW9A 3WTXC 1QANA 2DAOA 2NAZA 1KQ9A 2WTEA 2PBFA 4OOIA 1UHWA 2EJTA 3UA4A 1FC3A 1K7AA 4TV7A 2GAUA 5C0OE 5M5BA 4Q4ZF 3LA7A 2P3LA 1OR8A 4ZYHA 5L3DA 5ILUA 4LWOA 4QVKA 3NDIA 2F5EA 3LFKA 2EG5A 1QO0D 5H6RA 5DTMA 4Y17A 3JTHA 4L9JA 4QQNA 2ZZNA 3BWMA 1IXKA 5J6XA 4AWXB 3U81A 2DK5A 3ZQ7A 1VBFA 3G88A 3E7PA 2XYVA 1Z05A 3TO7A 2ZULA 1EH7A 2KIFA 3L9FA 2OZUA 3RODA 2NXEA 3MAJA 4ESBA 4PYLA 1LJ9A 3LQRA 4HW0A 5HZMA 2O8XA 3TLJA 5DYMA 4UVAA 2ZBQA 3KQTA 3CLOA 1G6NA 3EVFA 4GYIA 2AXLA 1QPMA 4OIRF 4BYYA 1EJ0A 4HX7A 1R8YA 3TQSA 1RI7A 1G4DA 2EA2A 2GQQA 1L9KA 3TOSA 5FB2A 4IV0A 2ADUA 1ORIA 5HOOA 5FGMA 4ENKA 3BWBA 2DI3A 1IN6A 4KUMA 2JZYA 4XRFA 2QQBA 4BAYA 1SQFA 2LNBA 3R0JA 3VEPA 2OU2A 2I7CA 2IVMA 3BZBA 2EX4A 3MCZA 1WG8A 1XSDA 2HFHA 3VFZA 1M6YA 2G71A 1USSA 3CBGA 3P9IA 4BH9A 2PLYA 4CTJA 3EMBA 3FMRA 1ZLJA 4WXDA 1O3QA 1TLHB 5DX8A 3R0AA 5CVIA 5FCDA 1R58A 2JHPA 2VDUE 3KLOA 3DXJF 3ELWA 1DL5A 3R3HA 4M74A 4MTDA 1VE3A 4ER0A 1SMTA 1RUOA 1T98A 3A27A 4GOND 1Y0UA 2NYXA 4ZTBA 1HW1A 2LSOA 5LQJA 4ENMA 4ZZDA 1JHHA 2NNYA 4KNYA 3T0IA 3C3WA 3KPJA 3IEIA 2PT6A 3RJPA 3T0YA 4I98B 1FBSA 2XYRA 2VBWA 4CXFA 4CDGA 3TQNA 3BGDA 4HGZA 5LQNA 4L0YB 2AOTA 1DCTA 4YUZA 4XLNF 1TQIA 1G3YA 2GA1A 3H2BA 3FX3A 5CVDA 4L7VA 4BXUA 4M7RA 2FU4A 4RVDA 1Q0SA 4FX4A 1B1BA 4B09A 1BBYA 3TDUC 2UZ4A 2E1CA 3L00A 3R61A 5E17F 1HMYA 4PGGA 1RJDA 3TM5A 3PLAE 2GXBA 2ZSUA 2P6SA 2X0LA 4U88A 5FADA 1W5SA 4BP3A 1G60A 5HDNA 2RNJA 2W24A 5CYVA 4KFCA 2ZKZA 2JJQA 1YF3A 3CTAA 2ESNA 4EVIA 1KPIA 4V0RA 3G5LA 5F6FA 3J81Z 2HS5A 8MHTA 2OA4A 2BBYA 1L0OC 3CKKA 1AV6A 1LEBA 1RI5A 5DM0A 4IJAA 3TOAA 4RVHA 3JWHA 3FMSA 4MTEA 3D0SA 4C08A 4HLXA 4B17A 4HQEA 5LBQA 1FLIA 3NWEA 4L5IA 4IXAA 2EV6A 4WXCA 3GFLA 3LCVB 5E1XA 2R7FA 4ENNA 3EVBA 3LA3A 3ELUA 4RTOA 1WS6A 2A07F 4HGYA 3DEUA 3C3PA 4X63A 1C0WA 4OBWA 5EMKA 2WC2A 5BPDA 3IWZA 2FRXA 3SSMA 2FBKA 4XUEA 3T8TA 1YQAA 3HOTA 1LEAA 4HH4A 1D2HA 3FTFA 1YZHA 3JTGA 5EZSA 4HA8A 4K2EA 4LG0A 1R00A 2LF7A 2QM3A 3KP7A 1WY7A 2M87A 4M9SA 4RTNA 2VT3A 3KQOA 3ECHA 4N9HA 4IHSA 1G3WA 1F38A 1JQDA 5T64A 4IRIA 4JK1X 1XGSA 2UYHA 3FPJA 3FTCA 1I5ZA 5KVRA 2V1UA 1S8NA 5A2QK 3UJCA 3CC8A 4PYKA 5LQCA 4BNCA 3UJ8A 3N97A 2OAZA 3G7UA 2ADMA 3LX6A 2VDVE 1WRJA 2CWWA 2XBMA 3EEOA 1W5TA 5LGNA 3Q87B 4RB0A 2IPQX 3GYHX 4FHTA 1KHHA 1LQ1A 3EGEA 4DZRA 2F5FA 3ZMZA 3FUUA 3GVAA 3H92A 2ZFUA 2J5PA 4HYEA 1O7LA 2GIVA 2CQKA 1JXSA 2ZIEA 3BOQA 2PGXA 5ILVA 2EJRA 1ZG1A 2WWYA 4KIFA 4HF1A 2MD5A 2JH9A 4BP1A 1ON1A 3C3YA 3MHTA 2GA2A 1P39A 4JQFA 1FOKA 5E9WA 2PX4A 2P5KA 4I7HA 1P4AA 1T38A 1AOYA 2PKWA 5EKXA 1JSZA 2NP6A 1LDJA 3IRQA 2XAJA 2V7EA 4XCXA 1U6GA 3LPMA 3IC7A 5HDGA 5EPEA 2P8TA 2KIUA 1REPC 2QE6A 4OU0A 4RYLA 2Z5UA 3ANXA 3CJTA 1PUEE 2YPRA 1YW8A 2I62A 3CJNA 1Z3CA 4CWAA 3I9FA 5DUKA 2HTEA 4EV0A 2E1NA 4GO1A 3CUQA 3EUHA 1XGNA 5F2NA 3JSOA 1YW9A 3FUTA 5E1WA 4RSRA 5FHRA 2EFJA 3FXRA 1I1GA 3LDUA 4OIQF 1MKMA 2AOWA 3GRRA 3ME5A 1Z6RA 2HGCA 3H3ZA 2HTJA 3SXYA 2NNWB 3G2QA 5K0NA 2C7OA 4IKPA 3W6JB 2ZBKA 4A6DA 3HCCA 3M70A 3QPTA 3RKXA 4AZWA 2ISYA 2XIGA 3OFKA 3QP6A 1FX7A 3QOXA 1R7JA 2XAFA 3GIWA 1IXCA 1P6RA 4OA8A 1XD7A 2ZJ2A 4GEKA 3BKWA 1HKTA 4HAMA 3OZTA 2CW0F 3HHGA 2VS1A 1XJ5A 3K2ZA 3EVZA 3CUQC 3MZHA 4DKJA 1BHJA 3IHUA 4R8SA 3UJDA 1O3SA 1YYVA 3KCCA 3E3VA 5K0LA 1YFJA 3R24A 2H00A 5GP1A 4YMHA 3WTTC 3G8AA 1NW8A 4GBED 1R1UA 3HIFA 4DCGA 3KQVA 5F1RA 5HEKA 1D8KA 1EIZA 4HG2A 3CCFA 4CXMA 1VP9A 3GRVA 5EMLA 5GIPE 4E2YA 4X61A 3GFMA 3HCBA 2P6TA 4DQ0A 4MQ4A 3V7RA 2G70A 4Y13A 2NXCA 2XASA 2EK5A 4L9NA 2KKOA 4FGZA 4ER5A 5KVAA 5FLXK 2JHCA 3F22A 3GZ5A 5FLXZ 2PY6A 1B9NA 5LR6A 4IF4A 3SHFA 1VTNC 2P7IA 3BP8A 5L3GA 2EV0A 2Z6UA 3F8MA 3FUVA 3RYRA 1HW5A 3SVZA 3WU1B 3PB3A 3TRKA 2GS9A 1R6AA 3I0TA 1NW7A 3FUWA 5G02A 5FWDA 5LHHA 2PWPA 2BR4A 2RKHA 2XAQA 5E9JA 1HXDA 1B9MA 4CHUA 1U2WA 4HSGA 4YUYA 2QWWA 3LBYA 3HEMA 5DTQA 3DKWA 4MQ9F 1JR4A 5F2KA 4PINA 2ZWAA 1XN7A 2UXXA 4OIPF 2P40A 3C1DA 3KPUA 2DT5A 5JUWA 1TW3A 1YS6A 5CVVA 1WI9A 5EEHA 5LEJA 5TJJA 2P3OA 5DX1A 2ETHA 4EQZA 1IY9A 4A12A 1QZZA 3KLNA 3LSTA 3DQVC 2VONA 4YV0A 4HV6A 3EYIA 1I4WA 3KR9A 2LF8A 3T7TA 2OPBA 2NYUA 2FMLA 3DULA 4RV9A 2IGTA 1KIAA 1YG2A 3TOBA 4RGXA 3T7SA 1BC5A 1XSVA 4KRGA 2KJCA 3G89A 4PIMA 4BQAA 4KDPA 2UYCA 2P4WA 5HVQC 3KPWA 3ECOA 2DU9A 5DUIA 3FTDA 3HVKA 3WU0A 1ZYRF 2HYGD 5DCMA 2UYOA 3ELKA 2AN5A 1RI4A 4A0ZA 4CICA 4HF0A 4P7KA 2IA2A 1WWXA 2RDPA 3G2MA 2HYFA 4AIHA 3KP6A 2P1DA 3PS9A 2IH4A 5EKUA 3F3XA 4U0YA 3LDGA 3HSEA 3CJRA 2PVCA 2IFTA 5D4RA 3I71A 2KW5A 3GRZA 5HIKA 5C1IA 3L7WA 2B78A 4FX0A 2E7XA 3ZMVA 9MHTA 1BI0A 2VDWA 3GW2A 3I58A 3IWFA 5JR3A 5DRTA 2BM8A 3P71T 2P7VB 5E8GA 1PJZA 3GFIA 3KHKA 1M0EA 2XUBA 4OA5A 1OPCA 4CKCA 5KS2A 4LLGF 4BHPA 4DCMA 4FT2A 5F2OA 3CO6C 5FQNA 3CUOA 1KR5A 2OD5A 1VLMA 5HS7A 4I02A 4OIOF 4G7ZF 4HLYA 1TNTA 1ZAOA 2IA0A 4XUCA 1DUSA 5GM2A 3UA3A 1IRFA 5HS9A 1AWCA 4KVZA 1J59A 4GUAA 4RTQA 4FT8A 1O3RA 3HTUA 1F3LA 4KWCA 4OQEA 4LB6B 3WTWC 2UYQA 2EFOA 2JRTA 3M9AA 2K27A 2YXEA 2J5OA 3ML6A 4OMZA 4KYWA 5HIIA 4RGSA 1BI3A 1JE8A 4RGRA 3JWJA 1U5TA 2XGXA 1BC7C 2CFXA 3CJQA 2Y48A 3GWZA 3KPYA 1GXPA 1NKVA 1SFUA 1XDZA 1ZGJA 2PFBA 2YUIA 3R60A 3KQSA 4KMUX 2OB2A 1RJEA 5EEGA 2ZMEB 2GAFA 3P7NA 5FHQA 4IRHA 4LK1F 3MFKA 2M5WA 1KQ8A 4EJTA 3LCUA 3ELDA 3S2WA 2PT9A 2BYVE 5L3BA 2IH2A 4EJUA 2IBTA 2C7QA 5K0CA 1XGOA 4UVCA 5LRRA 3M6XA 5KQSA 1ZG3A 2V9VA 3G2PA 2X4HA 1FY7A 2FK8A 1KQ0A 5DM2A 4G56A 4LD5A 4AUKA 1X3UA 4RB1A 5DEQA 1CF7B 3I64A 3EEYA 3GF2A 3IHTA 1U5TC 3NEUA 1R74A 4E2ZA 1KPHA 3J7AO 2PMHA 4RAYA 2VP3A 4E30A 3JAMK 1XGMA 2FF4A 2VC0A 4EK9A 3E97A 3JAMZ 3EETA 2EFWA 3FPFA 4RTJA 5JHUA 3LBFA 5LGTA 1KP9A 3EPPA 2EFNA 4BHCA 5E1MA 1IN4A 1LNWA 4LLLA 1N7JA 3HRUA 5E1OA 3KQYA 4A6EA 5LQRA 5DV5A 2GLUA 1NV9A 3B73A 1CGPA 5LHGA 3LA2A 2PXAA 2PV0A 1R23A 1ULYA 2OZVA 4CTKA 3BGVA 2O6GE 4ER3A 3FUXA 4P7JA 2NNNA 3Q9SA 3I5UA 3N4MA 2JG3A 4WX9A 4FT4A 3ZMTA 4HC4A 3OE5A 4V0QA 1XCLA 1K79A 3E6DA 3TPZA 3FTEA 2M8EA 4EGZA 2GB4A 3DMHA 2PBIA 4MTLA 2G9WA 4RVGA 2QVOA 4CKBA 2F5CA 5D5WB 1BKYA 4IPAA 1S7OA 1BOAA 2RN7A 3MTEA 1K78A 3DFGA 3MWMA 1EQAA 4A0XA 2FK7A 2H27A 3PX3A 4UXNA 2QQ9A 1G8SA 1Q1HA 3J80Z 5H6QA 4DA4A 1XCVA 3RPUA 3TO6A 3AXSA 1RI3A 2F8LA 3FPHA 4UNOA 2WV0A 5K01A 3FM5A 3ZP5A 3RI4A 3FZGA 4PYMA 1SD6A 5IT9Z 3BWYA 4EM0B 2V6CA 1XCBA 5T6BA 1L3IA 4R79A 2L4AA 3O31A 4RVFA 4Y2HA 2HV9A 4ESJA 5D1HA 4MNUA 2HQNA 3M8EA 4LECA 4DF3A 2H1RA 2K7LA 1J0RA 3KEQA 3I54A 4Q5SF 3FF5A 3UJ6A 3VOEA 1D2GA 2RQPA 3GRUA 5K5QA 1XDSA 4HF2A 2FQ3A 3FXQA 3P9CA 1HBXG 1BOOA 4WWCA 1BJAA 4PCLA 4LB5A 4RTPA 3LGAA 4LJZF 1K6OA 2XHKA 1ZLKA 1D5VA 3HA7A 1BI1A 1P91A 1MJ9A 3MAGA 3M33A 4WCGA 4PYQA 4JBAA 3FMQA 3CVOA 1KU3A 4AZTA 3J81K 4R1HA 4A2UA 3EMDA 1NV8A 4Y30A 3TR6A 3FRIA 3I4PA 3RDIA 5J8CA 2L4MA 3KP2A 2ZNYA 2CMGA 4C03A 3KQPA 5DM1A 1KYZA 4LK0F 2AOUA 4OBXA 2A61A 2M30A 4RTSA 4YFKF 4AZVA 5LSAA 1IXSB 2V74B 5EMJA 3F8BA 1K78B 4HX4A 3LAJA 2AOXA 2ZW9A 5E8RA 2IH5A 3HSFA 3BWGA 1XDUA 3NVKI 4PDKA 5K0EA 2JHAA 4CKEA 3DXXA 1RIOH 5HS8A 2NRAC 4P55A 3QP5A 2W84A 5AIPA 2DPUA 4XSZF 2P5LC 2FYTA 3D2LA 3MGGA 5K0BA 3O4FA 1JG2A 4FR0A 2Z6QA 2P3QA 3SR4A 1LDKB 2KJBA 3GNLA 4ESFA 3MB5A 5DSXA 1L3LA 4EJVA 3FWEA 5FQOA 1G6Q1 2O03A 1PDNC 5IH3A 1MDMA 1GXQA 4HQMA 2AOTB 3F23A 2STTA 2NS0A 3K6RA 4KDRA 4G94A 2RV8A 2HMYB 3HA3A 3KR2A 2VOOA 1FBNA 2IW5A 3IV6A 4RTRA 1YIOA 3P9KA 2C7PA 4P58A 2BR3A 4N0BA 3DLCA 3SGLA 3DPLC 2G7HA 1JTEA 4P96A 2CG4A 1JG3A 2DFIA 5AIQA 2FNAA 2VOPA 5DCFA 4M72A 3QU6A 1UIRA 3OZRA 3FHZA 3RTRA 2WA1A 3TGNA 4E31A 1H9GA 3IYLW 1VP3A 2O0LA 3DTNA 3V7SA 4XLPF 3K0BA 2N47A 4YIIA 4A0YA 1USTA 1ZN2A 2Q8KA 2FRHA 5K03A 1V4RA 2PX5A 1FNNA 1D3YA 4WXHA 2Z99A 1G38A 1QQIA 4R05A 3GZ6A 1MZBA 1R5GA 1Q0TA 2R3SA 1U78A 1DPUA 4G7OF 1PRYA 4A5MA 4P7FA 5LGUA 1WSUA 2IRFG 4YIFA 3BXOA 3EYYA 4UHTA 2ESHA 1GHCA 2PEXA 3JWIA 2ESRA 4GF5A 1U8RA 1D2CA 1B59A 4RAZA 2YX4A 1ZG5A 2P5VA 10MHA 2CWEA 4Q47A 4R8HA 1EG2A 4XUDA 2OKCA 2ZBPA 4GOMD 4KT5C 2W85A 1S6LA 6PAXA 1PP8F 2VT2A 2FMYA 4PCQA 1W7PD 4AVPA 3KU1A 4O3MA 3TDZC 1LVAA 4U0WA 3BJ6A 4IRGA 3E6BA 3F8CA 5JFRA 2EJUA 4PYIA 1O57A 4QTTB 4G9YA 1WQ2A 1YO5C 3GUDA 2DLLA 5ED4A 5EZQA 4LG0B 1VIDA 4BLUA 1I1SA 5FA8A 2IJLA 3MERA 3NWBA 2Z33A 2QYOA 1QBJA 3ISPA 3KFWX 2XKPA 5KK1A 3COAC 1IN7A 1IAWA 2ZZMA 4G7HF 2ZZKA 4C4AA 1OKRA 3BY6A 2QBYA 3WE2A 4QLCU 1V39A 2XVMA 3DP7A 4QPNA 3FRHA 1FYMA 5CUQA 1QAOA 4A5NA 1H1DA 2OBPA 3JW4A 2FBIA 2O0YA 2O3FA 3BDDA 3C6MA 2QUFA 2QRVA 1YUBA 2M1BA 1GVJA 2VODA 1SG9A 3EVCA 1MD0A 2I6GA 4GCVA 1NE2A 1W4MA 4IWNA 3BZ6A 1INLA 2IPXA 2P35A 3RYPA 3LDFA 3O2PE 4L5JA 3LKDA 1P4XA 3KR0A 3F4KA 3TMAA 1MJAA 5ERIA 1OR7A 2FBHA 3RPQA 2FXAA 3SMQA 1R36A 1RNLA 4M36A 2XV4S 2WK1A 4RTLA 3P2KA 4EM2A 2GA9A 4EGYA 3A4TA 3NW9A 3KEOA 4HTFA 2YVLA 3ABUA 3E5UA 1MGTA 5K0JA 1IN8A 1XSXA 1O54A 4DM3A 2EFPA 5DLYA 4MHGA 5LHIA 2EV5A 5BW5A 2AOVA 4R6WA 2D1HA 3V97A 3G2OA 5ILSA 3WODF 4KIBA 3A7DA 4GYGA 4Z2YA 1XB4A 5FD6A 1WKMA 1ZKDA 1F9NA 4GQBA 2V79A 2ZNZA 2PX8A 3HCAA 3O3KA 1O9GA 1IM8A 3KQMA 4MEYF 4QDKA 3WTVC 3FYCA 3REOA 3E5XA 1J2XA 5HIMA 3RIRA 5EC8A 2FHPA 5H20A 2V1XA 2A5YB 1LB2A 5E2AA 1RZ4A 5FFXA 3GO5A 2PXXA 3CUQB 4XSXF 4RB3C 3OU7A 5P8WA 1ONVA 2H6BA 3WGIA 4P9UA 1TQMA 1B4AA 5GIOE 5CCXA 5E1BA 1V3FA 3DXZA 1JHFA 4P5OA 4H0EA 1B42A 1X1CA 4D0PA 3WGGA 3ZN1A 1M6EX 3V7CA 3LL7A 1S7AA 5EMMA 2G1PA 1JG4A 3DR5A 2QBYB 4JXJA 4YUXA 1XCJA 4EQQA 2AZTA 2K4BA 1F5TA 3T1BA 3IKVA 2DTRA 3G3ZA 3PFGA 1UFMA 2O61A 5HFJA 1J75A 2BE5F 4UV8A 3CO7C 4GOLD 1I9GA 4EJOA 3V8VA 1JGSA 1T0FA 1UFKA 3E05A 3VODA 3K1NA 1HKSA 2OQGA 4WF2A 2L01A 5EOVA 4LG1A 2LDUA 3EVEA 2NP7A 2IP2A 4RTMA 3M6WA 1SQGA 2HKOA 4HOBA 2A69F 4YG2F 2OB1A 3RKYA 4N9IA 1FSEA 4FP9A 4HTFB 3KP3A 4HZFA 1A04A 1B6AA 1SAXA 4UV9A 2ONYA 3UJAA 4XBFA 1TW2A 1U2ZA 2ZIGA 4PYOA 2QY6A 3LQQA 4C05A 4NECA 4KN7X 1IZ1A 3K0LA 3DLIA 4YFNF 1MJFA 3C6KA 1X1DA 5E2BA 3KQWA 4CYDA 3P2IA 3E6MA 5K05A 1R8XA 3OU2A 4K6MA 1G3TA 1XVAA 4PIPA 1SUSA 3WGHA 3M6UA 3R9XB 1IW7F 4LGWA 3EVDA 3UBTA 1XTPA 1FJXA 2JT1A 2DPMA 4AZSA 2Y1XA 1FSHA 5GINE 1RI1A 1T2KA 4E2XA 4M6YA 2ZCJA 1G3SA 4M9ZA 2BM9A 4KW7A 2QQAA 1O9HA 4X60A 3JSPA 2MH2A 3BJOA 2HDCA 2XVAA 2ZVJA 4YUWA 1TQPA 3QU3A 2O07A 2GH1A 3HRMA 4RTKA 1STZA 1XXLA 2VXZA 3BPXA 5D5VB 3ER8A 2B3TA 3HRTA 1TPYA 1ZH5A 5EHGA 2G8NA 5HOQA 3WG9A 1TBXA 2V1DA 1Z1DA 5EHIA 3PQJA 3EVGA 3SXJA 1Z91A 7MHTA 3HVHA 5BMZA 4MGRA 2KIMA 5D1NA 3GLXA 3B3JA 2IDKA 5DDGA 3DOUA 4POOA 4C07A 3A26A 3F6VA 3E23A 1QGPA 2L54A 1J7KA 4UUVA 1OYWA 3OV8A 5MHTA 2F5DA 3FXUA 3V8KA 2C6YA 5DCMB 2JPBA 4S04A 1RUNA 2MA3A 3HNRA 2YQZA 4F7ZA 3IL2A 5CD1A 1SKMA 3ORHA 4PGHA 1FZPB 3EVAA 5E20A 4EMSA 3OZSA 4QVGA 4ZYEA 2BGCA 2OZ6A 2ZFWA 5IT3A 2HR1A 1KGSA 5CLSA 5L3EA 3RIEA 3FPEA 4AIKA 4QTUB 2PLWA 3FPGA 4ON0A 1DUXC 2XROA 5FTWA 3SSOA 3DMGA 1TNSA 5DSTA 4GC9A 3B3GA 3B7PA 2BR5A 3GO4A 4MEXF 1ZREA 4S05A 5E8JA 5IKMA 5GM1A 1IUYA 5ICEA 5E1ZB 3ULQB 5HLIA 3BGIA 4MQVA 4HDVA 3EQLF 3W6KB 5FFZA 2PJPA 3MQ2A 1FYLA 2DQRA 1RJFA 3M7GA 1RI2A 2HR3A 3HOSA 3WTZA 4LMYA 1KA8A 4M6XA 1HW2A 3Q9VA 2XAGA 3LECA 2Z6AA 4OMYA 3L09A 1TTYA 4CZZA 3RKWA 2HKXA 3DUWA 1SD5A 5CCBA 2Q2EA 2EFQA 4CO8A 3H3UA 4DMGA 3TM4A 1XMKA 3QOPA 4M71A 2Q41A 1SFEA 4IHTA 3DPTA 3GCZA 2O05A 3KR1A 3AWIA 3KKZA 1LDDA 1FPQA 5BS6A 5J8FA 2AR0A 3B3FA 5LQUA 4I01A 1U5TB 3OU6A 3Q7EA 2I9KA 3KE2A 3QRFF 3J80K 2VBYA 5HILA 2A6HF 1EH6A 2AN3A 2L3DA 2HZTA 2IA1A 2GWRA 1KU7A 2YSRA 4BHBA 3NJRA 1L3CA 2XKOA 4KN4X 2YU3A 4BLVA 1I6XA 4L9TA 2DBBA 1P1CA 1FWZA 5IT9K 3GEZA 3MTIA 2FPOA 3THRA 3G8BA 2AS5F 4YFXF 3F21A 1NW6A 4FZVA 2OXTA 3NRVA 4R6XA 3ERCA 3KZYA 4L9VA 3MCTA 1BIBA 2FEZA 4L0ZB 2MLKA 3WTYC 3O6BB 3R4KA 2ISZA 5K5RA 3EGIA 2P8JA 4X1OA 4ZZLA 4C06A 2W25A 4R8RA 3DV8A 2EWNA 1ZRCA 5EQJB 5AONA 5FUBA 1OYYA 5FO5A 1ODDA 2DPDA 3ZMDA 1IN5A 5L3FA 2A3SA 4O29A 2G7UA 1NT2A 2K4JA 3BKXA 4UOEA 5U4XA 5ICGA 5DXAA 5GOZA 4MHTA 4U7BA 3ID6C 1S3JA 4F86A 2KRFA 2K86A 2LKPA 4IVNA 4O5VA 3FZVA 2YTZA 3GFJA 3IKTA 1VQ1A 3ER9A 1ON2A 5BXYA 5EIFA 5ICFA 2MH9A 3WE3A 3EGVA 3UJ9A 4RWZA 2PQ8A 4FSXA 3K1MA 4IV8A 4ASNA 1AQIA 2IIPA 3PTAA 1NBHA 1BM9A 3LAPA 2FCAA 3HA5A 1QNTA 4EJWA 1E17A 1WZNA 5K09A 2YX1A 2P7CB 1QAQA 3BUSA 3R0QA 1MJBA 2JSCA 1D8JA 2P41A 3U2RA 2A14A 2P7HA 1ZGAA 4OQDA 3GJYA 2CYYA 3PFHA 4YV2A 4G6DA 3TFWA 2PX2A 3GRYA 1E2XA 3M8FA 4E2WA 2YR2A 3VC2A 1YW7A 5F64A 2XRNA 2VZ9A 2STWA 2A6EF 3HP7A 4F84A 5LRSA 3WTUC 4U7DA 1SVUA 5DT2A 4HBLA 2EA4A 4KA4A 5BQTA 5CM2Z 2A68F 3SQNA 1ZHFA 5H02A 2OY0A 1NBIA 1SD7A 2HOEA 3SFZA 4PWYA 3BPVA 3HUGA 3GU3A 5K5OA 2PSSA 3JWGA 1NHAA 4RGUA 5D6EA 2QENA 2OBFA 2HWVA 3QPHA 3FYDA 1JQEA 4DNCA 1FBUA 4UVBA 2OYRA 1X19A 1JSXA 4NB5A 3F6OA 3ROUA 4HDUA 1N2XA 3WTSC 2HTSA 3MEXA 2O06A 4QPPA 3OOPA 3KETA 3PFIA 5HLGA 5B1SA 2ELHA 4GC5A 3HHHA 2Z9OA 3LKZA 3GXOA 5CJ9A 1VL5A 1P4WA 1UWVA 1R1TA 2CMHA 5DX0A 1T39A 2AS0A 1P2FA 2UWMA 2VBXA 2R7DA 4OINF 2ORED 4U7PB 3G73A 1BN5A 3HTSB 1MHTA 5TRDA 3TO9A 3SZPA 2PI0A 4GOOD 5DRYA 2FE3A 1HSJA 2ZWVA 4B8XA 1RJGA 4ER6A 5D8LB 1OYIA 2COMA 5HIJA 1EH8A 4ENJA 3BT7A 3T5XA 2MLGA 5K0FA 2Q0OA 3AAFA 3X0DA 3M6VA 2ZTHA 3GDHA 4DQ2A 1T6SA 1ZARA 1S29A 5DPMA 2BEOA 5K8VA 4YV1A 2CGPA 4EKGA 4WVLA 2CO5A 2GXGA 3KQQA 5A2QZ 3QOWA 2ZBRA 5D6FA 4AX8A 4I0AA 2H11A 3VYWA 1ZQ9A 4HV5A 2ONZA 3V4GA 3NMUF 2AVDA 3LHDA 4WK8F 5DD8A 3KP5A 3TKYA 2AOUB 1H9TA 1YFHA 5FWAA 4PZJA 1BC8C 2D1VA 2UZKA 5CVUA 4I09A 3PVCA 5ERGB 1WXXA 4LWPA 3SX0A 4NQWA 1O7FA 3K9TA 3KPVA 3BROA 5FULA 1J9IA 2VE8A 2PN6A 2QZ8A 1FP1D 3CGGA 3HSRA 4U0VA 1DDNA 3L8DA 3V8LA 2YR0A 2H94A 2GZWA 3I59A 2Y0MA 5BW4A 5E8IA 3NDJA 2JPCA 2XVCA 2Y75A 4GGGA 3E5QA 2HNKA 2DW4A 1H0MA 5LEKA 1MDMB 4KDCA 3QAHA 4EM1A 1KYWA 4ZH4F 1W7PA 3SZTA 1I1NA 1YB2A 5E9QA 3VC1A 1WXWA 3C0KA 3KP4A 3V8JA 4GXOA 2IDJA 2YX7A 1U3EM 3NTVA 5KQRA 3HCEA 4E70A
chains in the Genus database with same CATH superfamily
1F12A 2JTVA 4RIGA 3RUPA 3PG5A 1Z6TA 4E6PA 5AUNB 3LY8A 1W30A 4B6OA 4B87A 1U2SA 1FYWA 4IZ6A 4NHEA 4I50B 4F92B 3MTBA 3R8CA 1U8BA 2Y05A 5THQA 3EUHC 4A8JC 2PKXA 2XUGA 1L3BA 3COWA 4KOAA 1SB8A 3ZGXA 4J4TA 4FQ7A 2YFHA 1PZEA 3OSGA 2V5AA 2OQ2A 4RK1A 1ONOA 4MINA 4OJTA 4BVGA 2YZGA 3DE6X 1ZI6A 3K1PA 2RC4A 2G5PA 3BTOA 5FBVB 4BNTA 2XQJA 2K9NA 3D8BA 3AWDA 4GZLA 1FOXA 4ZQFA 1FDWA 1FTNA 4WNIA 2YN2A 1WH7A 2HNBA 5A9SB 1ZGWA 4ZJUA 2HV8A 3I34X 1KU2A 4OFXA 3W3ZB 4YAGA 2CRGA 2R44A 2J9ZB 1RSZA 3TTVA 4U3JA 3NOVA 1TTHA 1EV7A 4LDZA 2VE9A 2HIMA 4RNCA 4V2IA 1YQWA 5E3NA 4PYNA 4FHGA 1XWIA 2LV8A 3Q0TA 5ALQA 4BKMA 4Z7JA 3T6KA 4KVGA 1ZMRA 4AKGA 5DM4A 1DMRA 1VFPA 2BXZA 1YS7A 2P78A 5DULA 5LZ2A 1E0KA 1KYYA 3R40A 3QA9A 5C9ZA 4IKOA 4KREA 1OWMA 1P1BA 3QKRA 2JVIA 1FP2A 3D5LA 4F1WA 5L6LB 4NBQA 3FETA 3QKUA 4BFZA 5ILOA 2ZC2A 1EP3B 2QP4A 2PL3A 4D0GA 4IY1A 1E1QD 3DEIA 1QRYA 1P7PA 4CLOB 2CN1A 2AVNA 1HM5A 4C7JA 4DEYA 4LIPD 3PUVA 4I9UA 4WKBA 4I36A 2WB1A 3F72A 1WLSA 3TNFA 4Z1MD 3EXEB 1T9ZA 2HWKA 2IC5A 4ND8B 4F97A 4U7FA 5JJCA 2FSPA 4IO9F 3O1LA 3K71B 1GRQA 2X86A 2JFOA 4GG1A 1MNDA 4EHNA 3D3NA 1H94A 4TQ9A 3ZK8A 2IXEA 5KAMA 4JBHA 1X7WB 3LTNC 1KO4A 2QAGC 2UAGA 3RUCA 2F55A 4JX6A 1F0KA 4CEIA 1CFZA 3FUCA 1V6CA 1W46A 3ETGA 2PS9A 4QG7A 2ECPA 4UTOA 5M5BA 1A6QA 5ILUA 3GLHA 4Y17A 2JAHA 3EW7A 4AWXB 3QVOA 4FFRA 4D96A 1P2UA 1DZ3A 5KC8A 1P31A 3GZJA 3OIFA 3NONA 2QUAA 4B81A 2Y3IA 4BJHB 4Q02A 2KSQA 2ZDHA 3IXLA 3MLEA 4Q7KA 2B1JA 3OCYA 1YA4A 3U60B 4YR7A 4LX8A 3BBPA 4D7AA 1BU8A 1NH3A 2DLDA 2QQBA 1NRJB 3VTKA 3R0JA 1NR1A 4CM8B 4GE3A 5IJZA 1Q0HA 2W6PA 3MGAA 4TTIA 3AHEA 4BJ5C 3ZGZA 3D6FA 2G71A 3CBGA 7MDHA 2XMGA 3H87A 4BH9A 3OM9A 3C1UA 4GBGA 3ZCOA 2RGNC 1N5LA 4TTVA 3SKYA 4QVIA 5EQTA 2FWNA 4F11A 5SY6A 4EZEA 4D81A 1FUUA 3MLBA 1Q1ZA 3E9CA 1GAXA 2QVYX 4JOCA 2GJ9A 4BCCA 2AOTA 1BXZA 1Q0QA 1ZUD1 2GUWA 4JT2A 2AMFA 1H4TA 2OHXA 4AVYA 2VF4X 5J59A 2WQ7A 1GY8A 2RE8A 3QXJA 4R9UC 4B09A 3CDIA 5IT9A 4XYLA 2W82A 4PGGA 4MI9A 1SULA 1JPUA 2GXBA 2B5OA 1W5SA 1G60A 1I5EA 1LBEA 1R4NB 2M1XA 3E9NA 5SZHB 3FGNA 4BX0A 4Q7EA 1E1NA 3GC6A 2Y8EA 4TS9A 4QUKA 4H3VA 2ZBVA 5AI8A 3ISTA 4O4LA 1HR0B 5EKDA 1CNFA 1U9CA 4MTEA 4C08A 2ZJ5A 3AVUA 4HLXA 4BNLA 4ENNA 1T5HX 2QKLB 4RIIA 2WC2A 3IWZA 3MXTA 1X13A 3A2KA 3VA7A 3QTLA 1JBKA 2ERXA 3HUTA 5IAOA 5KREA 1BL0A 3UAZA 1D1PA 1R12A 1WMAA 1EUDA 1RKUA 5BN4B 1CQXA 1CJKC 1T4CA 1LDBA 5KVRA 5AXDA 1YI1A 5KBYA 3E58A 2VDVE 1ZH0A 3Q87B 1YBFA 2DQYA 3RHTA 1UODA 1SKQA 3PP8A 2R8RA 4ZOQI 3L7CA 4B80A 3FUUA 3H8JA 1O6BA 2GO1A 2K3FA 2FQXA 2GA2A 1NUAA 1YFZA 3DYBA 5FT9A 1DJQA 4I9FA 2Y0CA 4CUJA 2O9JA 4D74A 3RLIA 2XAJA 4GGPA 4A93J 1RKBA 3DW3X 3ZDQA 3GOQA 2DGDA 1VXRA 3ACBA 4AT1A 2R7OA 4OO3A 1CUYA 3O8BA 4EELA 3LWZA 4K05A 1FBTA 3EUHA 1I32A 4UMVA 1KZ1A 3FDYA 3FXRA 2EHJA 3FNHA 1OLUA 4ZV7A 2O9LA 2HGCA 3JQ7A 2HTJA 2LWIA 4KHZA 4ZMBA 4DPLA 4JJEA 3H84A 2Z5VA 2V03A 4PE5B 3HCCA 4M6VA 3QPTA 4Q1DA 3C7TA 2Q9AA 5KDOA 4PZ9A 1E6KA 3FCSB 2Q8QA 3M0EA 5SYNA 3CUQC 4WIAA 3WVNA 3DHWC 4G4IA 5AVYA 3HRKA 3IHUA 4NBUA 2DQKA 3ER6A 3SC3A 2NM0A 4A3BJ 4UUAA 1B41A 4YDSA 3F3MA 4KFUA 2D1YA 1R15A 1ZINA 3ABRB 1ZM3A 2NADA 3D8UA 1AK2A 2HBQA 3V7RA 1YGYA 5B4VA 4YRQA 1I6KA 4XXHA 5DNAA 4OLHA 3SM9A 1LZLA 1D4OA 1R6AA 1E3JA 3JARB 1MQSA 2FFBA 1E1KA 2SCUA 3TL3A 1K6IA 4BU1A 4JBYA 3RVRA 2OEPA 2ZAMA 4HSGA 2QWWA 2ZRPA 1XZCA 1JR4A 1V1MB 3TNLA 4OIPF 1G8XA 4O02B 2W2MA 1T4BA 4HEQA 5TQJA 3A1DA 3U4HA 4JD5A 5TPWB 3DQVC 4M87A 3KR9A 4D9GA 3RREA 2GPBA 1LDEA 2WSYB 3ZGYA 1ADGA 4ARVA 5EHNA 4PIMA 3ZHZA 1QM5A 1MSEC 4JP1A 3KB6A 5FA6A 2ZSHB 3OCCA 2GXAA 3WU0A 4BHTA 3KZMA 4A0ZA 4DDHA 3GG2A 2RDPA 3ROFA 5ESXA 5JU6A 2I6UA 2AXQA 3KP6A 1MBFA 5A04A 1GTVA 2YVKA 3AR3A 2HQ1A 2IFTA 1JT0A 1P0MA 4LMPA 3QUTA 5C1IA 3O9VA 2X2FA 9MHTA 4ZVSA 4DLZA 3IWFA 5JR3A 2AFIA 1O9BA 3DFFA 4P53A 1X86B 3V8NA 4HAZA 4GMXA 4BHPA 3Q88A 1UDXA 4BEBA 1KR5A 1ACLA 1XC5A 2P90A 3GRPA 1DEOA 1PZGA 2I6TA 3K1TA 4OGGA 2VKEA 1NVVR 2B8WA 2HN9A 3HTUA 3HUEA 2OWEA 1QVAA 4CIVA 5AKJA 1RQPA 3KYLA 3BE5A 3P2YA 4U63A 2EFOA 1P1JA 5HIIA 3ZQGA 4FDLA 3BBLA 2JLUA 2WY2D 3FSJX 2JIZA 1QG6A 1ZUWA 3K6KA 3PPYA 1G8KA 4HWTA 4AD8A 1QG0A 1XTTA 4NSNA 2HRZA 2BFDA 3CUWA 1TCBA 1QJ4A 2WILA 2C04A 4HTAA 2W2KA 2RGXA 3G82C 2I1WA 1YL6A 3R77A 4AULA 1KQ0A 4G9EA 1U5TC 1OBHA 4NATA 4RC9A 1DRKA 1PQYA 3JAMZ 1Z2DA 3SG0A 3KAPA 4JU8A 1EFCA 2C83A 2PSHA 5BV8A 4CKCB 1XTKA 2DSTA 2O2EA 5KYVA 3MFQA 4NMWA 1LVGA 5ES3A 4TQUS 3VJRA 4QATA 3DDUA 2GYWA 3ZMTA 5JFGA 1TK9A 1M34B 5KSPA 4EGZA 2QUBA 1BKYA 2X15A 2VJNA 1WMEA 3SE7A 4XTRA 1MB0A 3DFGA 5H6QA 3CR7A 5JXWA 5LKAA 1QU3A 4FFBA 4UJ5A 4CR6A 1G7SA 4B33A 5AW3A 5T6BA 3R5HA 4GT1A 1KL7A 4DYVA 4YLYA 5F21A 2YN0A 3B2NA 4Q19A 2MT9A 2ODNA 3KEQA 2WZBA 4E5DA 8ATCA 1RXSA 4HF2A 4MR7B 1E3EA 2XNKA 1IM5A 2PBZA 4NOJA 4P4LA 1RT9A 1GTJ1 2BE7A 4AKTA 1HL7A 2KBEA 1PT9A 1ISRA 3OZIA 3JYLA 4PJJA 4R1HA 1IZYA 4XKCA 2Z08A 4IIHA 1P7ZA 1A82A 4KRFA 3KSMA 2XUQA 5KYXA 4JEUA 3DC7A 3LPLA 3JQAD 3Q0UA 3OSFA 5EINA 1NVUQ 1XDUA 4RQBA 2IK8A 1PS9A 3CZCA 2L0KA 1UKCA 3TSAA 4EBBA 2QL9A 2P5LC 1YC2A 4HH0A 1KKUA 2C5FA 3OYDA 2Z6QA 2P3QA 1MDBA 5HPYB 2KJBA 2H8WA 1YDMA 3A1UA 4URHA 3T1QA 2VOOA 3GT4A 4WT7A 3VZBA 4J3FA 4P58A 1ZD3A 1TRHA 4AY5A 4BRSA 1X14A 4FN5A 4Y2QA 2CG4A 1XEAA 3DF9A 4M72A 3SHTA 3PRKE 2VPTA 4LJKA 1SVWA 2KLHA 5CR9A 3G7SA 3AHIA 1I7LA 5K03A 3IR6A 1V11A 3RC2A 1QIDA 4L1KA 3Q0EA 4V3CA 5A2GA 2QSGX 2BCEA 4HEA1 4XX0B 1R5GA 2ZK7A 2R3SA 5EESA 3IJPA 3RUFA 1VMKA 4P7FA 2X6RA 2IRFG 5EG0A 4BGEA 2KQUA 4O5AA 1U7UA 2B4QA 3O03A 2LK2A 4KR0A 4YJ2B 4IZIA 1QB8A 3ESRA 1S6LA 2O0HA 1ZJ4A 3OY2A 2J3HA 3KU1A 4BNWA 1EK2A 1WSWA 3DAOA 1T0HB 5CPFA 4P82A 1UDAA 1UWKA 4QTTB 1ZMXA 2VQLA 2D0OB 4Y9SA 3KQUA 4RY0A 2A5FA 1VOTA 4CMIA 2BY0A 3BY6A 5MFZA 1FW6A 4JI6B 1JIVA 3FRHA 2H1HA 4P9NA 4O4HB 2C8VA 3IIKA 4B0OA 4CYCA 2CNBA 3ETDA 5F1KA 3GPDG 4YAIA 2J59A 4G86A 2AFHE 4GCVA 4AYXA 2QM8A 3MTQA 1P4XA 3J7TA 1S8OA 1KS9A 3MT8A 1C3JA 1ZCJA 1OFHA 3DOEA 4LY6A 4BV8A 3A4TA 2D0PB 3FWNA 2GCNA 1RKVA 1FX1A 5KYWA 1PWYE 2WJJA 5A3QA 3TQCA 1LCIA 4LYDA 2EV5A 4QELA 1OU4A 3A7DA 5KCMA 2PX8A 3NV9A 1SAYA 5IABA 4MEYF 1CV2A 4MRPA 3IEKA 3ZNQA 1VB3A 5ESWA 1W85A 2YYSA 5ESRA 5LOVB 1TRKA 5HF5A 1K7SN 1TQMA 4QAJA 3CLVA 1R5OA 5EYRA 4DIOA 3WGGA 1D5WA 3CMYA 1L4HA 3OD1A 5A62A 4XJSA 2BCJQ 2QTHA 3V46A 3EXG2 4PANA 1HFEL 2VH5R 4NV1A 4WA8A 3S1LA 4GOLD 2VF7A 2K9QA 4KKXB 5L7YA 2LG4A 2R1UA 2OQGA 1LBQA 4GP7A 3ZVLA 1KIMA 1SXGA 2C2YA 4HFNA 1KR2A 4MP8A 3FI9A 5JXGA 5EE0A 4JLDA 2ZRQA 3DHNA 3UHPA 2EYUA 1M2WA 4TV9B 1UADA 3D7SA 1LX7A 3EC7A 1FSEA 1RZUA 1AKMA 2BHRA 4KMSA 1EDOA 2O2SA 3GFQA 1DAMA 2LKXA 3DLIA 1A0OA 1T0FC 4LV5B 4FEYA 5L3SA 1TGYA 2DBVO 1WRBA 4GL4A 4CBVA 4INJA 1YDEA 1DSSG 2JT1A 1IV6A 2FTKE 4XLZA 1YCGA 3OG9A 3GT3A 4V0NA 3LSGA 5D3MB 1VKOA 3EARA 1CVRA 2BISA 1K0UA 1O9HA 3O2SB 4IINA 4J7AA 1FFHA 4EJFA 5JSYA 2GAAA 2VHEA 3V9PA 1TBXA 3T8YA 1ES9A 2BTQA 4RPHA 1N36B 4UC0A 4D0SA 3MZ8A 4K1XA 2BMVA 2RHCA 1US8B 1SK9A 3QG1A 2R1ZA 4I55F 2H1OA 4DILA 5HGJA 1P6UA 1HCRA 1RM4A 3OIUA 5FTNA 3NTUA 5BYBA 1I0ZA 1C8BA 2Z2KA 5LLDA 1B8IA 2YCBA 2FDRA 3DB1A 1TM7E 2GVDC 5FJJA 2IXSA 2P11A 3CVUA 3O92A 3MJTA 2VHXA 2PSEA 3HM5A 1PT8A 5BN3A 5JQWA 1ZJWA 1TZMA 1JDBB 3LY9A 2VYQA 1RMYA 4CUZA 1XKQA 4C20A 2UYGA 2PJPA 4BTLA 4BB5A 5DVZA 4WLEA 2VJMB 4MVJP 2G80A 3F8TA 3PE3A 1B2LA 1E9DA 3BFJA 3RKWA 3D3EA 1MZPA 1SD5A 2EFQA 3FSGD 3GGPA 5ED0A 3G9ZA 2OV8A 4IHTA 3CW2A 5FF9A 3C5EA 2HYDA 3C8HA 1DG9A 2WP8J 1B8VA 3OU6A 3OIQA 3J80K 1IZ9A 2VBYA 4KLNA 2L3DA 2Q6LA 2XKOA 3R09A 5A02A 2R2GA 1RBZA 2L82A 4S2EA 4N6GA 2BPOA 4E07A 3EY9A 3I1JA 3CC4I 2HZBA 2MLKA 2MD0A 2WPDD 1FZTA 2KL4A 5BMVF 4JC5A 3WE7A 2O5CA 4NZNA 3IMCA 1Q17A 3AVPA 4TQAA 2R6JA 4LJ9A 3GCXA 4F4FA 4H3KB 1VQ1A 1QFXA 5AICA 3R3VA 3C24A 5K7FA 1TWAJ 1T9HA 5ICFA 2MH9A 3RBZA 4EY5A 1OCCH 1G2OA 5B12A 3LAPA 2BIFA 2YX1A 4EGCB 3VZDA 2QUHA 4OQDA 3OECA 4TTRA 1M7BA 2PX2A 4D9BA 1QGYA 2GKOA 4BVJA 4Q05A 3TX2A 3QPSA 4U7DA 1OI4A 4KA4A 4P4GA 2PGJA 3N8GA 1KSFX 2LY9A 5JVDA 1ETYA 1RYZA 2QN8A 2TMGA 1G4AE 2NO1A 1PFWA 3ROGA 1JHPA 4HJXA 3P19A 3F6OA 3NHKA 2QSYA 2P0WA 3NYWA 3KETA 4B84A 3CO5A 2WA0A 1JKFA 1U7DA 5GAEJ 5HLGA 1WF3A 4DMRA 1U2RA 1SM4A 5ECGC 4J75A 4QOEA 4QXOA 1UWVA 3ENZA 4M1SA 2W37A 5J9FA 2AC2A 2FPKA 2BGIA 3O3OB 1TLFA 1Z08A 4X1IA 3IUJA 2KRHA 3UOAB 2E1MC 4XLEA 4IJUA 3BT7A 3T5XA 2X4DA 3TLEA 1RMTA 4J1TA 5CFPA 1L5MA 4ZYZA 3TE6A 3GMDA 5ALPA 3VAZA 3A01A 1QDEA 4KV7A 3TXYA 5CHEA 5DGCA 4GVPA 2XYGA 2AVDA 3IOCA 2ZB3A 4IIDA 1DQYA 5FWAA 3GNQA 1WXDA 3PVCA 5JCPA 4LWPA 4FU0A 3I37X 2C3PA 2PMBA 2F67A 3LAWA 5C53B 3AVQA 2CGEA 1KZYC 3I4FA 1I4OA 4DBRA 1OAOA 4EEZA 1A7AA 2JI4A 1NSTA 2YVAA 2V6EA 1Z5UA 3OUUA 1OD6A 2BHSA 4NESA 3I5XA 1KYWA 4IYRA 3SJ7A 2J8ZA 2R7SA 1XU7A 3HEBA 1LFPA 2R8EA 2W4SA 4NP6A 3E0QA 4WGFA 1JEDA 4L9RA 3K92A 3ZDCA 1R5HA 1TQ8A 2L2OA 1Q7TA 4ISBA 4DA6A 3T8RA 4BUPA 2LP0A 1R7RA 4GNKA 3HYSA 3IOBA 3CXRA 1KS2A 4RA6A 3RIMA 1V16A 3SQWA 5KDLA 5GMOA 5C52B 1E3PA 4QO8A 2GCIA 3SS7X 4IO1A 1VGVA 5DKFA 3ZXXA 3HJBA 2P9BA 1FTTA 1MVOA 5BPFA 2ZJZA 2D45A 4ZAYA 4FFNA 1NW3A 1IONA 5NLLA 1ESCA 5E18F 2LBFB 1HGXA 4PQEA 2ZREA 4RK6A 1KMCA 4N48A 2ZYTX 3BJAA 4PGFA 2DQLA 3QMMA 3WFJA 2VHWA 1DQSA 1UBEA 3CW8X 2X7XA 1MMGA 2CNLA 1WB9A 1FJLA 1Z5GA 2K02A 1HFKA 1RDFA 4OY3A 3TIIA 3ZPLA 2GZMA 4MS3B 2NU9B 4QXMA 4HRAA 4DV5B 1UFVA 2FF5A 1OFUA 3L7LA 3O7WA 3UV7A 2PZLA 2WG0A 3HJNA 3OZEA 3KE8A 1A4RA 2QRVB 3MZYA 1V7CA 1RWBA 4RX1A 3W1EA 2C1XA 2P30A 4JS0A 4LGMA 4AY6A 4L18B 4CKZA 2WTBA 3IIJA 1PW5A 3FCOA 2GRAA 5EP3A 1D2RA 2OV1A 1UXIA 4G5XA 4TLAA 4FHFA 4CV2A 1ZI8A 4WNAB 3DU5A 2D1SA 4DNQA 1FQKA 2A9KA 2JJ2A 2QU8A 2FOKA 2WINI 3FMGA 5JRZA 4DBLE 2FQ4A 4A23A 1ZBQA 1G3RA 5CDFA 4GX0A 4FC7A 3UAGA 3FDZA 3BXXA 5ULLA 1IHUA 4M0LA 2VBZA 1NKSA 4P7BA 1Z5ZA 1EVEA 3VX3A 2ZUDA 2GK7A 3S2YA 3SJZA 1TWFJ 2HB6A 4J7XA 5BP7A 4PBTA 3A28A 2DMTA 1NUHA 1KQFA 2XBLA 2EFEB 4GMKA 2E7WA 4XVHA 4FISA 4D42A 3E1KA 3VVLA 4RVNA 2P2SA 3SSNA 2QJRA 3B51X 1PGOA 4BRZA 3GGDA 1ZD9A 2KI5A 4J6EA 4X41A 4ZYAA 3WIDA 2HQAA 5F08A 2VSOA 2FWAA 4RABA 2RJ3A 3NHJA 3UCEA 1Z2OX 1UK7A 1GPBA 4OLFA 4WACA 2HEGA 1FC3A 4IIJF 3LCJA 2C2HA 3O1JC 2GNAA 4DDMA 1E1YA 2R5ZB 3B9QA 4EI8A 5J6XA 4OYLA 1B8NA 1TIKA 4XTCS 4OATA 4LPKA 2YWRA 1BU5A 2BFEB 4ZVUA 1Y3AA 2GZAA 3U1VA 1OH7A 2QYTA 3R1IA 4GPTA 1RAFA 3C3BA 2GQQA 1T56A 1EVZA 1VQMI 4KUMA 3KT8A 3U16A 1LLQA 4BAYA 3D4PA 4KGDA 3MJSA 1NM5C 1DFIA 3B2EA 3ZHCA 5KDDA 5I45A 3EHDA 1ZGZA 3GBPA 2IVMA 1L7AA 2WMOB 3IVMA 1N5MA 3GFTA 2DHDA 3U49A 1YL7A 1BW6A 4PG8A 3O83A 1V9LA 3SF8A 4BZXA 1HE8B 1X7YA 4BEVA 4LDPA 3A2LA 2Q9CA 2IYAA 3S3NA 3PF9A 3G8CA 2IZ7A 3URMA 4QOFA 5IVIA 1LFDB 5IJ0B 5MDHA 4TTTS 2BV3A 2CT8A 1ZRNA 2FVXA 3DNPA 1JJIA 3QIAA 3UK1A 5T4EA 1DDOA 1E92A 2VC2B 5IUJC 2R5NA 4KCGA 5TXGA 3GCDA 1MVLA 4NNOA 2B6HA 5JNTA 1VPDA 4XSHA 1E3LA 1HZZA 4V39A 2O8EB 3A9CA 3H2BA 3CZ4A 1V1JA 2N0SA 4WTOA 4DG9A 2BGNA 3NIWA 2CXHA 1BEUB 1ZCAA 3T9FA 4EUEA 1RAEA 4PJLA 5BN1A 4EVIA 1ABBA 3NORA 3T5AA 5C18A 1H8EA 4IJMA 3RUHA 1I7NA 4CSWA 1DMSA 3SYRA 3IBGA 1T5LA 4JMPA 1NATA 4UAVA 3I2JA 1DAPA 1M2VB 3NWEA 5K3CA 2OO7A 2BI8A 1PJQA 4NY1A 1AXEA 3HFGA 4CQNA 2FWJA 2BYTA 5LDDC 5B1HA 3LHFA 4GGMX 3CBQA 3A4IA 3NHPA 3WXMA 1XK7A 2HPAA 1R00A 3KP7A 2G5GX 3KQOA 2QTCA 1ZA2A 2VNKA 3G49A 2FN9A 2G36A 2FR8A 5M29A 3GHHA 4ZVVA 5A4FS 3GY0A 3NWTA 2C0CA 4UDXX 2ZI9A 3ZDEA 2OAZA 3PUYA 5LGNA 2VPZA 4LWQA 5HF6A 1AS0A 5IM4A 1R4MB 3EPRA 1KEUA 3UXMA 1A7KA 1WXIA 1JPVA 4WBNB 1JXOA 1YQQA 4XRSG 1J1ZA 4DMKA 2MYTA 1S7CA 3BMOA 3DL7A 4FGSA 2MD5A 3D43A 2HJ9A 1A5TA 4W82A 3RFXA 1N8SA 4M8KA 2PZEA 2PKWA 1R0KA 4FKZA 3RG8A 1Z63A 1KRXA 3LOUA 4OU0A 1S4MA 2VPPA 2X0IA 5AXBA 1Z3CA 7AT1A 3RC1A 4DLRA 3M5DA 4S1WA 3EIOA 4PAOA 4NZPA 3UWDA 4J1SA 4QDUA 1F1BA 5CH3A 1TVKB 1O6CA 2DKFA 2VPWA 1ZGBA 3VNRA 4BDYA 1OCZH 4ALNA 3E2MA 1C9MA 3ET5A 4QC2A 5CB4F 5HUJA 3U4DA 3L8MA 1YS9A 3OZTA 6CHYA 2VS1A 1N7GA 3EVZA 1YJAA 3STVA 1M8GA 1UDWA 4YAWA 5GP1A 5CLLA 4EW6A 3NUZA 4URFA 3KQVA 2VJPA 3KJFA 4D80A 2DN0A 4I4LA 3V1YA 1VP9A 5LMNB 3ZEIA 1ISSA 1I1QB 3G0IA 3DTYA 3HKEB 3QUAA 4C3JJ 1U0GA 4P54A 1LU9A 5J2UB 5L45A 3X44A 1X1EA 2LGJA 3AY3A 5FLXZ 3B5JA 2XLBA 2HRBA 3W5IA 2WFLB 1WHTB 4DCUA 4PX9A 2JIDA 1XN7A 1HC8A 4PHFA 2JCSA 1EDBA 1WI9A 3DV2A 4EY3A 2CHVA 3LDAA 2UUAB 3MN1A 1Y9JA 2YNMD 3U4AA 4Y9DA 4RULA 2I0FA 3NP9A 1NJGA 1E2PA 4MYSA 4LUCA 4XM2A 3ESDA 3JASA 5COQA 5JAIA 4KRGA 1XMIA 1G21B 5ITSA 2DTZA 2PR7A 2ZIUB 4Z7OB 1DP3A 4MLOA 4FZJA 3UMJA 3ELKA 1UDBA 3U17A 4C5AA 5DT9A 2C59A 2HQOA 4W5WA 3WLLA 2IH4A 4ZI7A 2XGMA 4Y2SA 4XZ3A 2Z6VA 4C1BA 1N1MA 2E60A 4EZIA 2JA7J 5E8GA 1SXJA 3BR6A 3NYQA 2O23A 2HX1A 5DLQC 3JAKA 1XXHA 3WRXC 3RSQA 1Z0DA 4XM3A 3MMZA 1E98A 2EFGA 1ZAOA 2UZ1B 3L1KA 2Z57A 1H3EA 1UJNA 4LJSA 5DYIA 1BN6A 4U5XA 3P45A 3UK6A 2BGJA 2FETA 1UKYA 1CEYA 4H0FA 2IEZA 2YL2A 3L2VA 1PNRA 2QA4I 3G02A 4QUDA 5ENDA 4IDPA 2ATXA 3B48A 5KQSA 3B6JA 2CH0A 2X4HA 1FY7A 3NFYA 2WFAA 1TU3A 5KOHB 3QOEA 3EETA 5DCWA 1A9TA 3QYEA 2CYBA 5KTNA 3OFND 4A6EA 4QBIA 5LHGA 2PV0A 4R2IA 1ULYA 5AI0A 1BXRA 1TFRA 1VJDA 1QVUA 2VQDA 1TUEA 2IV7A 1TJ4A 5A6VA 3KYCA 3OE5A 3RPUD 4V0QA 1IY1A 4EUFA 4WADA 4F45A 1JQKA 5CT6A 3W4JA 4L0DA 4XJTA 1WF6A 2QVOA 3WTCA 4PLTA 4L6AA 3HR4A 1W1WE 5D85A 3FR7A 2WSSA 2HDDA 3MTEA 4TT8A 4DA4A 1YQTA 4L07A 1RI3A 3FPHA 1YTUA 2WG2A 4ENRA 5DB4A 5ITWA 1N3BA 3U3RA 2C2OA 3FA2A 4ZHSA 3SR3A 4MQFB 3A03A 3ZC3A 2CXNA 3DWLE 2VYVA 3PYXA 1KJNA 1XDSA 3WWEA 1ZUIA 3E22B 1BOOA 4YRPA 1Y4DE 3MWGA 1KJQA 4YK7A 4YALA 2PUCA 1L5FA 1AXGA 2Q28A 1ZAKA 1KBQA 4L95C 3RLFA 3OZGA 2JFUA 4UVHA 3K4QA 5D84A 3VKGA 4JI8B 1KU3A 1IC6A 2YZ7A 3B9PA 3KQLA 4KH1A 4LXGA 3DBHA 4YACA 4MPJA 2Q2OA 2HYIC 2L4MA 4DVJA 2CMGA 3RABA 4YFKF 2YHIB 4GS5A 2XB0X 3GDOA 1BIFA 2PAAA 2MABA 3ECSA 1OGYA 3OS1A 2VP0A 5LDHA 2COBA 2DFKB 4NYMQ 5JLJA 3WNCA 3MGGA 4DV1B 2WUWE 5KJ6A 4WOCA 3WDMA 2XF7A 3LRPA 1LDKB 3MJHA 2HA2A 4QYXA 2X19A 2FG5A 1IC8A 3N76A 5DYNA 3A1CA 1A97A 2OHVA 1Q95A 3OMXA 4NARA 4TMXA 1DXYA 3GROA 4LYAA 3QU6A 5IFKA 4BQRA 1FNBA 4F2GA 5HYVA 1H9GA 2G40A 3LXUX 3EJ6A 2ACWA 4V02A 3CONA 4ZPJA 2QVLA 4QO7A 3IR7A 5LP6C 2PZMA 1UBFA 1NDQA 4KGXA 4KR3A 2B1GA 2IOHA 3H75A 2ESRA 2WD8A 4BP9A 3MIIA 4F8EA 1UK6A 3WLPA 3VDNB 2DWOA 2TMDA 1L1RA 4OP2A 3OURA 2YMMA 2O8DA 1ZW6A 4IDAA 3TDZC 1MXHA 3I0NA 4DG5A 3IP3A 4KSCA 5ED4A 5JT1A 4LMRA 3SLKA 3RDPA 2WF9A 1ZVJA 1IN7A 4P81A 1V39A 4R2JA 1MUUA 1ZEMA 2OGUA 2HXIA 2MMGA 4B6PA 1SMKA 2GD1O 1CUZA 2PUVA 1XAJA 2VODA 1EGAA 2R25B 3OEWA 3LDFA 3ZYCA 1NLZA 2OK7A 1ILWA 4L08A 2AXTC 3GRFA 4JX8A 4M36A 5B58C 1TU4A 3CC2I 3VO1A 4AF6A 3QFRA 1RQNA 4LRTB 2R2AA 1XN1A 3CZ9A 3KKKA 1OE0A 5DLYA 2POCA 3F9RA 3NBAA 4DLKA 2LZ0A 5THKA 2PRIA 1SIWA 5IM5A 3EDOA 3CJTB 1TTPB 1Y63A 2RHJA 1JJ7A 2P1RA 2YV3A 4IDBA 3VSBA 1EBFA 3OHSX 1IWBB 2NTNA 2O59A 3OU7A 4F4HA 4BEHB 7REQA 4PK4A 4P5OA 4M76B 3RO7A 1B42A 5CFQA 2E5NA 2QW0X 3OQIA 2G1PA 5TQ2B 4FE3A 3MPOA 3HFRA 2F5VA 3VXKA 1NT4A 3HP4A 4ES6A 1U1GA 1QGDA 3PQ8A 4EYQA 3DD5A 4DYDA 1MBJA 2QVBA 2X5NA 1VL2A 1UFKA 1N25A 1JUPA 5EXDA 1SKYE 1NQWA 4U7HA 1SXQA 3RKYA 4FP9A 5HRAA 4YWHA 1ENOA 4N0PA 1U2ZA 1QH1A 1T3HA 3D1JA 3EDYA 5CB6A 3W34A 3DVSX 2WB2A 5IANA 5IC5A 4ZHQA 3TZEA 2VDKB 1M1XB 3GVPA 121PA 5JBIA 3FPCA 3CF2A 1UDCA 4EOGA 3ZI4A 1FFEA 1U9JA 2P2YA 2D0IA 3Q5DA 3BJOA 1P4GA 3EGDA 2WWWA 3H2HA 1YQEA 4EY4A 3OLQA 3NAUA 2G06A 4JFRA 3OWHA 4NCAA 4NEGA 1ZM2A 3GA0A 2OAP1 1THTA 2QD4A 5JZMA 2C3OA 1IOVA 4DT1B 4AZ0A 4C2UA 4DIMA 5MHTA 4Z99A 2QN9A 1GCOA 3LLSA 3OZSA 1E6WA 1R5BA 3D54D 4Q3OA 2R8BA 3E3AA 3B7PA 3D6JA 5BSHA 1X7GA 4MYUA 1YXMA 1CUUA 5KOIA 4C4TA 2OKGA 2ORWA 3EDMA 8LDHA 1PTJA 3IERA 1TYBE 1XCGB 2DQRA 4JLMA 1LLCA 4ZQEA 2LPMA 1VIMA 3N7AA 4HAOA 4AJPA 1QQBA 3LECA 3IT2A 2VSQA 2NU7A 2O6HA 1QTIA 4U2KA 4ACAA 1R4ZA 3F90A 3IBSA 4I08A 3UGQA 1HE3A 3TM4A 2QZZA 2G77B 1Q92A 1HDZA 1UR5A 3NHRA 1H93A 3AOGA 3TOCA 3IJEB 4LYJA 3O8GA 1B8UA 2ZUSA 1ODTC 5CBPA 3QKSB 3EZFA 4DBZA 4NOKA 3BA6A 2XIQA 1NPDA 2ZJ3A 1F4PA 1K88A 1FSFA 1V7ZA 4NICA 1XPJA 2HMUA 4NLLA 3F0CA 1C0KA 3CH5A 2PMZA 2IVZA 4M0MA 3BQ9A 3WTYC 3EFEA 4C06A 4MMYB 3ZS8A 2W7NA 3AG5A 4YECA 1G2HA 3H35A 1D07A 3LSIA 2YWEA 4MXDA 2RJOA 3TSCA 1VQLI 4Z3OA 1NMZA 2WADA 1L2TA 5BNIA 1FFXA 2MSNA 1TKBA 4ROTA 3MWEA 2IYRA 1BM9A 1XG5A 8ADHA 1TM5E 2IX3A 1YDHA 2DFEA 4GDFA 4NV0A 4C88A 4D3SA 2LYCA 2TSYB 1D8JA 1KHTA 5JCOC 1QH9A 1UBJS 1AGXA 4N5LA 4IJVA 3W2GA 3CPSA 4F84A 1D03A 5BR1A 1AMOA 1BNCA 4N76A 5DW3A 1GO2A 4HADA 2ABWA 3DAPA 1NI3A 2F3SA 3HJAA 3U3XA 3WSVA 3U3JA 4UU8A 1FBUA 1MAWA 2O06A 1XEXB 3OF2A 3H2GA 3V55A 2Q1UA 3O0DA 3GJQA 4Q3KA 3VMMA 2ZAGA 4X64B 2WKSA 4D0NA 1P4WA 1UXHA 5J43A 3RWOA 2A0UA 3KLMX 2X8WA 1T39A 3CQZJ 3T52A 3AH8A 2ORED 3A32A 3HNOA 3LY5A 3CURA 3LRXA 2WAXA 1D4ZA 4XB1A 1EH8A 1JMKC 5DLDA 4IEFB 4K9RA 3K4NA 1PR4A 2H29A 3ZU3A 1K4TA 3GLGE 1T6SA 4YV1A 4OREX 4E11A 1Y8ZA 4GKKB 5DHFA 1Z5WA 4HV5A 2WJAA 3ZY3A 3OTHA 5TNXA 1IBKB 3OIPA 1TZJA 5TLSA 1WXXA 4UJ3A 2G25A 4X85A 1UF9A 3A2NA 2X6OA 1ZL2A 4ODIA 2ILVA 1BZYA 5KSZA 3BGOS 4PZ0A 3GAZA 4LDQA 3HSRA 2F9FA 5HDBB 1CG6A 2QG6A 3H8WA 4CZCA 4CCWA 1NUQA 4JA0A 4I9HA 2QX4A 1E1RA 2GZWA 3EAFA 5CT8A 1RZRA 2OLKA 3H1TA 5JCZA 2F43A 1D9XA 3THXA 3I9V1 3PLNA 1KFBB 3GA5A 3LNTA 4KDCA 4FIZA 1T9GS 5CA0F 3G6WA 1EUYA 1FYFA 1I1NA 1TVEA 5FI3A 4KMRA 4NE7A 1UEIA 2VP6A 5C7IO 2EU8A 1GG8A 4A8JA 3KPHA 1T43A 3H5OA 2HCJB 2RGEA 2Y4NA 1IK4A 1A98A 1OXTA 4PFQA 4X1YB 2BEVA 1I3NA 3KZZA 3A37A 1XTSA 3TR0A 4C4XA 1MC1A 3OCVA 3ZMUA 5FPTA 2YU9J 4ZDJA 1YJBA 3FK7A 1P7CA 2XHEA 4M9XA 2SKCA 1F6DA 4U2CA 1XYVA 4EB3A 3D9QX 2CVQA 1M76A 3PKIA 3JRFA 4A9AA 3D31A 2BV6A 3ZN0A 1SHTX 5A71A 3PTLA 4ZRMA 3WMWA 1XEFA 1W0JA 3BTJA 1EFDN 4Q9NA 1ZJZA 4O5OA 5C3MA 4PONA 3A9TA 3LYAA 1V8PA 2BFCA 4LF6B 1AMUA 3QVWA 1YVDA 4M37A 1TKRA 3NPMA 1ZLYA 2BFWA 3PTZA 4ZIRA 3OPMA 3ENKA 2NT4A 2DOFA 4ZEOA 3QE2A 2HGSA 2D2FA 2X41A 2C5BA 4AF8A 2IYLD 1TC2A 2Q4BA 3KHTA 2CYCA 1L1EA 2APJA 1N4AA 4BEJA 4OXRA 5DH9A 3AINA 1R6UA 1PNOA 4XVCA 3S5UA 3A6PC 5EP2A 3JYHA 4UASA 1XD8A 4BJ1A 2DWPA 1E2JA 3MCAA 1ZH2A 4LXHA 3WNBA 1XQWA 2JLQA 2C9OA 1PSZA 4EA6A 4ETSA 3AY6A 1SD2A 3KM0A 2QTAA 1JFFA 1CYEA 1F8YA 3UTDA 2XF2A 1NMQA 3WL4A 1A8PA 4MYCA 2XZOA 2XUFA 4GBMA 1UMDA 4WJKB 1TUBA 4Y2GA 2YW2A 1XVVA 2BHTA 1J9EA 3DZBA 3EWIA 1XZBA 4F3QA 3PDJA 4I1VA 4L72A 4EVQA 3G2LA 1I27A 5JOQA 3LO8A 3QYFA 4MVYA 2J3EA 2O54A 1ANKA 2QAGA 3RC8A 1IEQA 1JTFA 3SN6A 1JKPC 2ZMEC 3K0HA 1JDTA 3M4XA 4R2HA 5HZHA 4QSHA 5FPQA 1XK6A 1YULA 5TQ0A 4ISCA 2OQRA 3JR7A 3AP1A 1E59A 4Z0NA 4PM4A 4A8TA 2A59A 2JKZA 4MGYR 1TKAA 4XOTA 3PNPA 4M73A 3OCJA 2Y9ZA 3E9YA 2WFZA 1RXWA 2F64A 2Y1WA 2I6SA 3IVXA 1Y3BE 3ZQCA 3OPNA 2MYPA 2PBFA 2PSFA 2EJTA 4D5FA 3DVLA 1P9OA 4Q4ZF 2I76A 2Q5FA 4V38A 3IUYA 3HC7A 5H6RA 5AKIA 4DCOA 4XGIA 4UUOA 1N6RA 4OHUA 1YACA 1E1CB 5TS3A 1ZUNA 3RODA 1S2DA 2OG1A 3O75A 4O4JF 2NXNB 5FX2A 4CM9D 5JI3E 3CVWA 4BJ5A 2ZBQA 1G6NA 2B1RA 1U8AA 2ACVA 1V8ZA 4JNCA 5JO0A 3N58A 2RGNA 1NVAA 3OF3A 4LXXA 1QFMA 3WO1A 1KI2A 2XTAA 2NSLA 2XE8A 4A3LJ 1LKZA 1MP0A 4D6PA 1XU9A 4U0KA 2Q6VA 1M6YA 2H16A 3JRIA 4BNNA 2JA1A 3PGXA 2AA3A 4ZP1A 1TLHB 3P96A 2VDUE 2O2YA 4JMLA 4LY3A 4HDMB 2G9ZA 2Y9YA 2QTNA 1ZITA 3T99A 4DJTA 4YO8A 3T0YA 1N9GB 2QTVA 3KOUA 4I98B 2R97A 4CDGA 2P67A 1EZZA 3EVTA 4DS3A 1P7IA 2XZDA 1J8QA 4TWRA 2HNHA 1FXSA 2FPUA 5AHOA 4M7RA 5DNDA 1Q0SA 2QQ5A 4FW9A 4EB8A 4N65A 1DC4A 4RVCA 3OPYB 3L43A 3OJFA 2X0LA 4NU6A 1G7TA 2ZJ1A 2YV5A 2GM9A 2RIRA 3TDNA 3T61A 1J07A 3M1LA 2YJ3A 1QK5A 1XD9A 3WDSA 4RAOA 3LSJA 4IJAA 5I7OA 5ICMA 1EXMA 2QD1A 3WKEA 5AUOB 4N0DA 1PK8A 1HK7A 2QGZA 1ESZA 1BEEA 1E2MA 2L42A 2DOAA 3LA3A 1ZK1A 4TSRA 3DEUA 3C3PA 1IRZA 3PX7A 5BPDA 1X42A 5C1OA 4Y0AA 4XWTA 1VE1A 4BBPA 3H1AA 3K0KA 4P3KA 4L27A 4HA8A 4W1RA 5BVGB 1RC8A 3QPLA 4KPYA 1GOTA 4JI4B 1P29A 5T64A 3MWFA 2QZJA 1BE8A 4P0TA 1IIRA 2FPWA 3UY4A 3FTCA 1A69A 2VRNA 3G7UA 4B40A 1NMEA 1EAYA 4TWZA 1OUMA 1T6ZA 1QWOA 4Y1GA 4EL5A 3AZOA 4QDZA 1HURA 2VKVA 1P2TA 4BLTA 3OAAD 3KD2A 3NC4A 2DTEA 4QPCA 1L7BA 4U2FA 2ZUCA 2ZIEA 5ILVA 4HF1A 1JL3A 2ZSEA 4BP1A 4C4RA 4TGLA 4LY9A 3MHTA 2Y68A 2H8KA 3U39A 3WV4A 4I7HA 5EKXA 4EFLA 4C0XA 4J90A 1XRMA 3DTTA 1REQA 3LPMA 4U8HA 5LQMA 2P8TA 1H6AA 1PVDA 3PV0A 2XWQA 4M7PA 2YPRA 4OMCA 1QUFA 1PQPA 5CD9A 4EUSA 1F2UA 1F0PA 3I9FA 3V7YA 3CUQA 4RE6A 1VGRA 2XCUA 3TLZA 2NUPA 1DPGA 3K94A 2A5GA 3LT0A 3ME5A 4QXQA 4KR7A 2JD2A 1IBSA 3KOWA 3GDGA 4FFSA 1QB7A 4MI6A 1LJUA 3LUPA 2XIGA 2QRLA 1GP2A 3GUHA 4YRFA 1YYVA 1E3DA 1YFJA 2G9NA 2H00A 3B8EA 2BBTA 3BSYA 5EJ2A 3O91A 2HF2A 2F17A 3I3SR 3AM5A 5DBGA 1OWOA 3DEKA 1K27A 3ET4A 4DC1A 5EHXA 1D1AA 3LX5A 4Z1OA 4ZFNA 2PY6A 2WWXA 3N75A 2VTKA 5AW2A 4RM2A 2ATIA 5AKXA 3TRKA 4KVFA 3EFOB 4BL0B 3NO4A 5HE8A 1NNUA 4BNGA 2CLSA 3D5TA 3AHHA 1U2WA 3ZWVA 1QGUA 1PI3A 1L4GA 4KQIA 3CMEI 1LK7A 3WLMA 5AKGA 5CVCA 3KPUA 1GYRA 5CKTA 5I6DA 1KMIY 2GJ4A 5BUSA 2Q21A 1OT5A 3H5IA 2WTNA 4AROA 3A3OA 3DULA 4Q37A 1XCPA 4RV9A 2PRJA 4ZAWA 4DDWA 3KEYA 5HVQC 4YLEA 5JYEA 5DUIA 4HNTA 4FFDA 4RCVA 4CICA 5L51A 1WWXA 4YJGB 1NP6A 4D3ZA 2CCJA 3A9VA 1NDUA 3I9NA 5EKUA 4V0LA 5EJ9A 2PVCA 5WRFA 2CUFA 3WKAA 1G2PA 4MGHA 3E1SA 5FFNA 3GFIA 2OXEA 1KI7A 4CNQA 2XUBA 5A05A 1Z0FA 3WJ2A 1Q6YA 4DCMA 3R20A 2YOFA 4W8HA 4QXAA 3BSWA 1EWRA 3PWKA 5EJ4A 1U8ZA 3E3NA 3UA3A 1HORA 4CDNA 3U5ZB 1F8UA 2FUEA 2OD9A 4OIFA 1Y9EA 1GRNA 3DJFA 1U5TA 5C7YA 3TRIA 4D9EA 4WZBE 1SFUA 1XDZA 3QKRB 2JVGA 1DS6A 2LUOA 1PKEA 2I34A 5ESDA 1E0DA 1JHQA 5FI1B 1PVOA 1BKDR 2Y1LA 1UG0A 3SEZA 1R9MA 5IN5A 4DV7B 5BWBA 4ETIA 3G9QA 3UMYA 2QQ8A 2IOQA 1HL3A 4F46A 3VNBA 1K7XB 3DL4A 4AUKA 2NYAA 2P2GA 5C4JJ 1GNRA 3IVGA 1CJVC 3HBAA 1YRBA 2OCPA 2A2ZA 1OFIA 3HZRA 2EFWA 1ORRA 3I42A 2EFNA 3EEFA 4CT5A 2B9SA 3SYKA 3KQYA 4PN3A 2WF7A 4O2BA 5CW1A 3R5XA 5BN5B 1IEWA 3QX9A 1M0TA 4ARBA 4CTKA 3NKFA 1Y98A 3FUXA 4HNAB 4FYWA 1LW6E 1C1DA 1MG0A 2JS7A 3WKCA 2AHRA 1E6LA 2QIOA 3NHWA 2GB4A 2JMWA 1G19A 3PE6A 1QNFA 1SHKA 1K78A 3G1WA 5JAUA 1GNLA 3KLPX 2WY8Q 2LR8A 4Y1EA 4XIIA 4ENSA 3AXSA 3RARA 2F8LA 3GLHB 2W22A 2P9YA 2XMPA 2FJ1A 3KZIC 3BWYA 4NENA 1WDLA 3D7LA 3DYIA 3RIYA 2FWIA 1LLUA 3V4PB 1QHGA 5KVCA 3VDMA 5CT9A 1Y37A 5KJCA 3WMEA 1TYDE 1NWCA 5EZ5A 3DTKA 4HDRA 2Q6TA 2IW1A 3HVUA 3K72B 2NTJA 4IQJA 3ZWWA 3WLIA 1A72A 2Q3EA 1CJSA 3L3BA 5CHYA 4PVDA 5ALDA 3GVXA 1LDYA 4HQOA 2X1DA 1D4FA 4AWAA 4P3PA 1XZNA 2JGIA 2C5HA 1I6HJ 3O95A 1NXVA 1QVRA 1E96A 4M1OA 3H04A 3R8XA 4RTSA 3JZMA 1CDEA 1HLVA 3WFIA 3QUSA 2P9CA 3LAJA 1TEXA 3MS4A 5HS8A 4IVRA 1GSHA 4F9GA 4B75A 3D6VA 4C43A 4ZAVA 2E1RA 1E9RA 1NJFA 3TNDA 3TTYA 4YGYA 4PFJA 2R7UA 2AOTB 3F23A 3LT1A 4IHAA 3CNHA 3P9YA 3ZGOA 3NAGA 4GWKA 1OROA 3SS9X 5KHAA 4HNGA 2G7MC 1FFYA 3IYLW 2QB5A 4M46A 4Z3KA 4XLPF 4XR6A 2DP4E 1U2GC 2N47A 2RK3A 2RSLA 3GFFA 1AGYA 4PWZA 4C0KA 4WK6A 1HT3A 2JAPA 1CIVA 1QPIA 3LPDA 1G38A 2R5FA 4RH1A 4O4LB 4ZXFA 1ISFA 4UHTA 4OB6A 1OIVA 4GF5A 1JQJC 2VRCA 4Q47A 3C2QA 4YPFA 2ZXHA 3L04A 1UMBB 4RA2A 2ENUA 3M3DA 4RF3A 5L9AA 5AUPB 3LQ1A 4DCNA 5CLGA 4L02A 1ETHA 4V0MA 2CV2A 1ZK3A 3CF0A 13PKA 2FJUA 1UOOA 1XKTA 4Y3OA 1Y1LA 4F96A 3G0DA 3DLAA 2ZZKA 1T4CB 4TV8F 2AE2A 5CUQA 1UMCB 1O8CA 2NVUA 3FHLA 2JN6A 4DLSA 1LSJA 4COKA 4AJJA 3NB0A 1E9CA 3R3JA 3R6LA 3OOWA 5FKJA 2V7WA 3WHBA 1SG9A 3KNZA 2AI3A 3RYPA 2XAUA 2FPMA 4F4JA 1GAQA 1X7ZA 1WZ2A 2JRCA 1R36A 1CB7A 2XV4S 2VJIA 2DLNA 1Z2AA 5IY5H 2HMVA 2DPXA 5K0JA 2I8AA 3J7YJ 4LQDA 2GZDA 3OOYA 1GG5A 1CLUA 5BW5A 4AJIA 1E69A 3WODF 3PKJA 3VH2A 5AVQA 1U99A 3O3KA 2ZE7A 2HMTA 3WTVC 1CEEA 1G9XA 1G4HA 3E5XA 2DWCA 2YWFA 4J4HA 5FFXA 4RB3C 2HYJA 2GBLC 1JVNA 2B98A 2QI9C 3WGLA 1XX5A 1OLUB 5JROA 3BM5A 4HEHA 2EARA 2QP3A 3D8SA 2OHHA 2QTRA 4LMAA 2X4LA 1M1YA 1ND5A 2X9NA 3RS2A 3RWBA 4R1TA 1Z38A 2X0FA 4MX8A 1T0FA 1FUYB 2XB9A 2BJWA 1KYXA 4UNPA 2RMKA 5KJEA 3D8TA 1P6QA 1XL1A 4KQ6A 4J0KA 3TKLA 4CE6A 4HOBA 4QM6A 2FI1A 4LZZA 4DR3B 3TINA 3AI1A 3MOIA 3PFBA 2XDAA 4RPKA 3UJAA 3FFXA 2HIAA 2GK6A 2CSUA 2COEA 1A6IA 3K0LA 5KJFA 1MJFA 2HVSA 3BX1A 1AH2A 1FMJA 5KWSA 4LNUA 1GNVA 1HX7A 3MYRA 4XWWA 2NACA 4K6MA 1G3TA 2R60A 3WWOA 4TMZA 4TXHA 1GRRA 2BKEA 1YR1A 4ED9A 2IHTA 2RH5A 1JB1A 4B46A 5IUKC 4IDNA 3EUFA 2SCUB 1B0AA 2BJVA 3Q7QA 3A36A 1FMLA 3VSKA 2Q5EA 1VL6A 3W6ZA 4RCZA 2FLKA 5HXAA 2ZVJA 4KLAA 3AGQA 2C5EA 2ZAIA 1XXLA 4P3XA 3HJTA 1HSOA 4FTHA 4BRUA 4JUBA 3BIJA 4G63A 2BT4A 1JPJA 1A31A 1X74A 1JUMA 5J4KA 4HQRA 2OECA 2PKRA 4C07A 1QXSA 4B6EA 4OKSA 2AUNA 2XODA 3PGVA 3N9IA 2X48A 4NJOA 4BX3A 4U0JA 1UP6A 4H6XA 1NUPA 3F5DA 3DF7A 4KXLA 2Y0DA 3PL8A 1EX7A 1H2XA 3R5JA 3FPEA 4BMSA 4PX3A 3QQ5A 3OUTA 4QTUB 3TBKA 3M6LA 3DZGA 1ZREA 5E8JA 1G20B 1CUAA 3QUBA 3ED1A 3R7WA 5I7RA 2AFIB 1WDMA 2PT5A 3BGIA 4DBQA 4G26A 4N8EA 4UDYX 2QRKA 1P4HA 2XVXA 1WPRA 3D6TB 5J5CA 4IO0A 3DAYA 3DUWA 5CCBA 1XZQA 3FSRA 3G1LA 1NRWA 4XGNA 4UCFA 3H3UA 4DMGA 1GZDA 3WYAA 4CLDA 4FCWA 4ICIA 3QU2A 4L2IB 2HDNB 4EG3A 4XN0A 3KQNA 4PXYA 2FFRA 5I7FA 2IA1A 2G67A 2DDBA 4KXVA 3SIXA 2BFDB 3EG5A 2VYFA 3V4OA 1Y6QA 3NJ4A 2R92J 4YFXF 1XP8A 3TTXA 2W2KB 2R7TA 4EX6A 3P4UA 1NYQA 2P0AA 3G17A 2PUEA 3DHEA