1FP2A

Crystal structure analysis of isoflavone o-methyltransferase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
345
structure length
345
Chain Sequence
RKPSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIGNVRRLMRYLAHNGFFEIITKEEESYALTVASELLVRGSDLCLAPMVECVLDPTLSGSYHELKKWIYEEDLTLFGVTLGSGFWDFLDKNPEYNTSFNDAMASDSKLINLALRDCDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVIDKKKDENQVTQIKLLMDVNMACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ISOFLAVONE O-METHYLTRANSFERASE
publication title Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.
pubmed doi rcsb
source organism Medicago sativa
molecule tags Transferase
total genus 122
structure length 345
sequence length 345
ec nomenclature ec 2.1.1.150: Isoflavone 7-O-methyltransferase.
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fp2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1fp2A02
4WXHA 3EETA 3K0LA 4A12A 4HX4A 1HSTA 2Z6AA 2O0YA 2A5YB 2P7VB 2AOUB 4HX8A 5FD5A 4P96A 2QBYA 4B8XA 1QZYA 2FBIA 3NEUA 4OQEA 4F7ZA 1QBJA 3ME5A 4CKCA 4E2XA 3WSTA 3R0QA 4XUDA 3MTIA 5K01A 3RPQA 4FSDA 5GWXA 1NW3A 3FUTA 4ZH4F 4IV8A 4PYKA 2QRVB 3QOWA 3AXTA 3SSOA 3CLOA 2XYQA 3P8ZA 5LEJA 3PLAE 3BZ6A 1FPQA 4HDUA 3KP5A 3FX3A 3LECA 1Q1HA 5E1ZB 4RVFA 2FF4A 2JHPA 4XUEA 2MLGA 5C0OE 3KPJA 2M1BA 1VE3A 2DULA 1R58A 5E8JA 4Q4ZF 3E6MA 2ZFWA 5LRSA 1S29A 4JBAA 4M74A 3EVDA 3HA7A 2YUIA 1ON2A 2G7HA 1LEBA 3EEYA 4G6DA 1O3QA 3OFJA 2MLKA 2EWNA 4MQ9F 1PP7U 1YUBA 1QAQA 3A7EA 3HCAA 4R6XA 1SD6A 4GUAA 4BLWA 1B4AA 1D8KA 1U5TB 3VFZA 2D2WA 5FO5A 2K7LA 2GLUA 3LQQA 1SVUA 3CUOA 4DF3A 2PY6A 3T7SA 5GOZA 1XXLA 2C7RA 2ZSUA 3HOSA 1USTA 3SR4A 3TFWA 3KU1A 4PNEA 1W5TA 2JJQA 3J7AO 2BR4A 3F72A 1LDDA 5A2QK 1S6LA 1R22A 3TMAA 4FZVA 2DW4A 5L3GA 1MGTA 2JSCA 4Y13A 3VEPA 5BPIA 4MHTA 1TW3A 1HXDA 2ZFUA 1K7AA 4OMYA 1WG8A 4BLUA 2AVDA 2OXTA 3S2WA 2MH9A 2V74B 3OZRA 1O57A 1P1CA 5D8KB 4KNYA 5CJ9A 2PQ8A 1TNSA 4EMSA 1I1NA 2P4WA 2C6YA 2WWYA 4PYOA 4HLYA 2HTJA 2ZVJA 1XD7A 4I98B 5D4RA 4RSRA 3A7DA 1SUIA 1YLFA 4G7ZF 4S05A 1HQCA 4GF5A 4DZRA 2AS0A 4MQVA 2PX2A 4YG2F 3T5XA 3BPVA 4UUVA 4BYYA 4BHPA 4G56A 5DX1A 1TQPA 2PFBA 2XUBA 4LLNA 1IF1A 5DUIA 1KR5A 3C3WA 2CWWA 4E30A 3V8VA 4U7BA 1XN7A 2AOTB 3FTFA 2IIPA 5E8RA 2A68F 2VBZA 4HV6A 4TV7A 5BP7A 5EVJA 4ON0A 4AUKA 2B2CA 2BH2A 3E3VA 3C7JA 3BWMA 2VXZA 3M8EA 3VSEA 1YG2A 3MCZA 1EAMA 2FRHA 3I59B 5DCMB 3G73A 5EOVA 5ERIA 5EGSA 4ZYHA 2DI3A 2UZ4A 3TOSA 3CVOA 3MWMA 5E1DA 3FM5A 4HAMA 2AN5A 2UWMA 3VODA 3OCJA 3TR6A 2GB4A 1BOAA 4RGRA 3BWBA 4E2ZA 3GUDA 3IKTA 3A27A 1IW7F 3T8RA 3K69A 1MKMA 2MA3A 3K6RA 3RYRA 3MQ0A 1XCJA 1WXWA 4CO8A 3BT7A 2F5EA 1XJ5A 1YFHA 1FBUA 2OZUA 1REPC 5KVAA 1XGMA 2FPOA 2NNYA 4JQFA 1W4MA 4PONA 3FPFA 3KFWX 5C1IA 1SG9A 2BE5F 2Q2EA 5IT3A 3G5LA 3CGGA 4QVKA 1HKQA 5D1HA 2HKOA 2P41A 5HIKA 4HRAA 1LQ1A 3MZHA 2BM8A 3P71T 3ZN0A 3B02A 4P7JA 5K0LA 2Y1WA 4Q47A 3OE5A 3NVMB 1B9NA 4EJUA 1STZA 1L1EA 3LFKA 1WY7A 3AXSA 4AX8A 3I9FA 4HLXA 1SQFA 3NTVA 2G71A 4E70A 3FPJA 2IA2A 3G8AA 1JR4A 3F8NA 4ENKA 3BWGA 2ZBKA 4DA4A 2PX8A 2VC1A 2KRFA 5EEHA 4DQ2A 4N0BA 3EEOA 2XYRA 4RTQA 4I01A 3BWCA 4ETSA 2BM9A 1R1TA 2DLLA 3ELWA 2Z5UA 3G2QA 4FR0A 4FHTA 1Q0SA 1G6Q1 4GBED 3UJAA 1OR8A 5T64A 2FA5A 3QAHA 3KEQA 1TQMA 2NP7A 1W7PB 4GOOD 4AWXB 5EMJA 2VN2A 2HOEA 3HRUA 2CL5A 2UYCA 1T2KA 3IWFA 3Q9VA 2OO3A 3TM5A 4O5VA 2A14A 3N4MA 3LBFA 3UJDA 4RB3C 1K78A 1FOKA 3ELKA 5DTMA 4ENMA 1YS6A 3P9KA 5HDGA 1USSA 4HGZA 3FPGA 4HW0A 3T8TA 4MEXF 3MFKA 3FUXA 1MD0A 2IA0A 4UVCA 5HVQC 2PJDA 2A69F 2FBHA 3J80Z 2ZBQA 3EYYA 4UV9A 4NB5A 2K27A 2DK5A 2ZJ2A 4OA5A 3TOAA 1IUYA 4HTFB 2FQ3A 3KLOA 3H3ZA 4OIQF 5EIWA 2Q0OA 2YSRA 2P3QA 4HF0A 1XSDA 3BGDA 3GX4X 3CCFA 5LQNA 3CJTA 2E7WA 3LA3A 1KPHA 2PT9A 2IH4A 4HG2A 2OPBA 1XDSA 3T0YA 2HR1A 1J0RA 5CYVA 2ZW9A 4PYMA 5K0EA 1A04A 5IT9K 5E18F 4LWOA 4XCXA 1SMTA 4GOLD 1DPRA 2K86A 3GLXA 1LEAA 4AIHA 3O2PE 1QQIA 4ENNA 3W6KB 1VQ1A 4FS8A 2ZCJA 1IN4A 1AOYA 1RJEA 1KYZA 2XAJA 3MGGA 3G8BA 1BI3A 4M71A 5HS7A 3B7PA 3CUQC 3TQSA 1ON1A 2RGVA 1YS7A 1YW9A 4U7PB 1BKYA 4CKEA 5H6RA 2VOPA 3HVIA 2V79A 3SSNA 1HW1A 2ZKZA 1UB9A 3R6SA 3KQTA 1TTYA 5LR6A 1FBNA 2VC0A 3KP4A 2YX1A 3JAMK 3DULA 3D0SA 4GQBA 4CGZA 4DMGA 2QUFA 2F8LA 4JK1X 4QQKA 2YTZA 3KPUA 3ZMSA 3KHKA 3K9TA 4FSXA 2XIGA 2BEOA 3E23A 4XSXF 2ZBRA 3KEOA 1V4RA 5EG5A 3LA7A 2W57A 3HEMA 2EJRA 1VLMA 5LQRA 1YYVA 3RJPA 4MTDA 1GXPA 2FMLA 2JPBA 1YB2A 1FC3A 2OQGA 3U81A 2A3SA 4EM2A 2HEOA 4KDCA 4KVZA 1BC5A 2FYTA 3EVGA 3FUVA 2VDVE 1N7IA 5JUWA 2F5FA 5D1NA 2PXCA 3CJRA 4EM1A 2RC4A 4RTSA 5HS8A 3UJBA 1UWVA 2YU3A 4DCMA 5EC8A 1GHCA 5L3CA 3VYWA 1MDMB 5J8FA 4FX4A 5JI6A 5FQNA 1DL5A 1ZG3A 1ZYRF 3GGDA 4YIFA 3O3KA 4KN4X 1S7AA 2ZULA 2ISYA 2XROA 1YO5C 4OX9Y 5LGTA 2WTEA 1IY9A 4UOEA 5K5QA 4HOBA 2IDKA 3M8FA 3QV2A 1W7PD 5BMZA 3F21A 1BOOA 1KU2A 3GFLA 3DMHA 4MTEA 4L9JA 4G6QA 2KIMA 3F6VA 4M72A 2IVMA 3FUUA 1Z05A 4S04A 5LQUA 3M7GA 3ERCA 3I71A 2FBKA 2F5DA 4HC4A 1RIOH 1O9HA 2IA1A 3E7PA 2AVNA 2I7CA 3ZQ7A 3GU3A 5HIJA 4CKBA 1T38A 1J59A 3I0TA 2PV0A 5CVJA 2L4AA 1P2FA 5CVUA 4LGWA 3G7UA 3GDHA 2VDUE 2QLZA 2O61A 1FT9A 2NNNA 3RODA 3U9GA 2HQRA 1R7JA 4YUXA 2FEZA 3HVJA 2Z3YA 1X1BA 4EQZA 3P2EA 3FMQA 4CZZA 1Z1DA 5KK1A 3KCCA 3O6BB 2XVCA 3W6JB 5DSXA 1MJ9A 3HNRA 5E1OA 4PGGA 1R8YA 2BR3A 3G2PA 3M70A 1G60A 1IXKA 2GA9A 3S68A 3KZYA 2RVCA 4AZTA 5DM0A 3WG9A 5K03A 1ORIA 1WRJA 1R8XA 2PXAA 2QM3A 4EK9A 3BWYA 4EJOA 4QDJA 4CICA 5K05A 4LK0F 1WSUA 3VC1A 2HS5A 2Z9OA 2EJUA 2QQAA 3FYCA 4C4AA 3SXYA 1VP3A 4HQEA 2PLWA 3T7TA 4PWYA 2YXLA 2G9WA 4A0ZA 2GAFA 5FUBA 3R61A 4P5OA 5DXAA 4I7HA 3F3XA 1M6YA 3E05A 1E2XA 1SQGA 2YVLA 2XHKA 1Z3CA 1QZZA 5D6EA 3UZUA 5GIOE 2AOUA 3FRHA 2B25A 1HKTA 3KQSA 1G6NA 3LDGA 1BC7C 1Y8CA 1E17A 3DQVC 1TNTA 3ROUA 3GRZA 1TLHB 2XV4S 3NDIA 3IV6A 4WXDA 4FT8A 3ZMTA 3Q7EA 1SKMA 2NXNA 5H20A 2QRVA 1S7OA 3X0DA 1NKVA 1ORHA 1YQAA 4RAZA 4DNCA 2XAQA 2ONYA 4U0WA 3F4KA 2JHCA 2WA1A 3HCBA 4O6JA 1I1SA 4CYDA 3KPYA 4AZSA 3E6BA 1JHHA 1LDKB 2K4BA 4A5MA 1ZG5A 2FK7A 2VONA 4G9YA 1J7KA 4LJZF 1ZN2A 2CG4A 1IAWA 5E17F 1EH6A 1KU9A 3J81Z 2GZWA 2DBBA 4M9SA 3DMGA 4Y30A 2WK1A 1CF7B 2G8NA 4I09A 5CVEA 5E8GA 2CMHA 5L3DA 3BGIA 2ZZMA 3OV8A 4MIKA 3PFGA 1SD5A 5ICGA 2XAGA 3DP7A 1EJ0A 2YQZA 3MAJA 3JTHA 2V9VA 3KPVA 3MCTA 3K1PA 1JGSA 3B3GA 4HYEA 3CUQB 4KIFA 2YR2A 1U5TA 2IBTA 3T0IA 2OBPA 1DUSA 4DM3A 2ZMEB 2WA2A 3UJCA 4GXOA 4IJAA 3GFMA 4LLLA 4LLGF 1H0MA 4NECA 5ERGB 4L7VA 3DEUA 3K2ZA 3KQPA 3ISPA 4LG0B 3WU0A 1IZ1A 2JH9A 2L4MA 3DXZA 1T39A 2KJCA 2JT1A 3LDFA 3LPMA 2XBMA 4C07A 3HTXA 2YR0A 2BR5A 2UYOA 3R60A 4ESFA 4RB2C 4IWNA 2CFXA 5F6FA 4N9IA 3PQKA 1L9KA 3SGLA 2O57A 3L9FA 5DM2A 3EVBA 1GXQA 3KQWA 3HRMA 2PGXA 4PYJA 3OU2A 2TDXA 3HCCA 4YUYA 2YXDA 3C6MA 2FSWA 2XKPA 1AF7A 2BZGA 4I0BA 5FLXZ 1R18A 5LQJA 2W24A 1EH7A 4I2OA 4RTNA 4MNUA 4PIPA 4OBWA 5EPEA 3DV8A 1ZRDA 1XCLA 5EZSA 3ID6C 2OB1A 2O6GE 1Z6TA 4D0PA 5HFJA 3C0KA 3HCDA 5HZMA 4ESBA 4KRGA 5K0NA 1G3TA 1OPCA 2AOTA 2HQNA 4MWZA 1FYMA 2HMYB 2P7HA 1XDZA 5G02A 4X41A 4GYIA 4KICA 3DLCA 1HW2A 1N7JA 3A25A 2M45A 4WF2A 4A6DA 5DRYA 5EEGA 3I59A 5DCMA 1RI1A 3G2MA 2HKXA 1B42A 1NBHA 3V8KA 3KP2A 1P39A 1MZBA 3R0JA 1B1BA 5E20A 1JQDA 3I54A 2V7EA 4RTRA 2OAZA 1ZREA 7MHTA 4C03A 4DCGA 3M6XA 3ZN1A 2L54A 2H6BA 5FA8A 1HMYA 2IRFG 4RX1A 1OYIA 5DYMA 1RI5A 2P5VA 1I9GA 3M1EA 1QO0D 4G7HF 1M6EX 3VOEA 2NRAC 3E8SA 1UFKA 1JG1A 3KP3A 4IVNA 5H6QA 4E31A 3ULQB 3TRKA 3WTYC 1AV6A 4KMUX 4LMYA 5CVRA 1QNTA 1HKSA 4XSZF 2XYVA 2P5LC 2UXXA 3IWZA 3V7CA 3HRSA 2HNKA 3KP6A 2ZIGA 4RVHA 2Z6QA 3JTGA 3Q5FA 1B6AA 1LNWA 3MAGA 2H1RA 1O7FA 1LVAA 2P3LA 1SFEA 4FX0A 5IH3A 5AONA 3M9AA 2MD5A 5AIPA 2HYFA 4IHTA 2Y0MA 4RB1A 3V4GA 2OBFA 3L2CA 4WXCA 3KETA 3HOTA 1P4AA 3B5IA 3JWGA 2BYVE 4U7TB 3DKWA 3M4XA 2KKOA 5KYGA 5FD6A 2DO7A 2PI0A 3G89A 2XGXA 5ICFA 2O03A 3WGIA 4M9ZA 4UVAA 4EV0A 1V39A 1VP9A 2FK8A 1T0FA 3JW4A 2KIUA 3BGVA 3MQ2A 4LK1F 3OPNA 2NS0A 4PIMA 5LHHA 3V8LA 4HZFA 2W25A 4GOMD 1ZHFA 5CCXA 4PZJA 1W7PA 2XVAA 4MQ4A 4L9NA 1WXXA 1UHMA 4L5IA 2RDPA 2E1CA 4DKJA 4HSGA 2FE3A 1SAXA 1IN8A 3QPHA 3CDHA 2GH1A 2P40A 3SHFA 2B78A 5JVTA 1R6AA 3H3UA 5E1BA 2ZNZA 5LGUA 3WTWC 3HSFA 5JFRA 3BJAA 5DLYA 1P1BA 4GC5A 2OYRA 2HZTA 1WKMA 4GEKA 4XLPF 2IBSA 4P7FA 3NWEA 4HTFA 3KP7A 4RS8A 4BHCA 1PRYA 2JPCA 2NXJA 2DPUA 4P9UA 4IPAA 4OINF 1G3WA 4NHJA 4M7RA 5ILUA 1LJ9A 1INLA 1BI1A 5E9QA 3FUWA 1XMKA 3OZSA 5C9ZA 3UBTA 2EA2A 2CMGA 3SZTA 5LBQA 2MC3A 3TLJA 1QPMA 1U2WA 3O31A 2FOKA 2UXNA 1U3EM 3EGVA 1MJBA 1F9NA 2P5KA 4NQWA 1EIZA 3GZ6A 3DFGA 2XAHA 4G7OF 4L0YB 5DX8A 3QOXA 1FX7A 1P4XA 5HDNA 2VODA 2IH2A 1L3BA 5L3EA 4AD9A 3JWHA 2D1VA 4V0RA 1SD7A 3OFKA 4YV0A 3K1NA 1ZARA 4RWZA 5DWQA 1R23A 5K0FA 3SZPA 2IFTA 3E5QA 3WU1B 3OZTA 3B3FA 4PCQA 2IP2A 1JG2A 4U7DA 2CSOA 2H27A 4RVGA 3SM3A 2FXAA 1EV7A 2KIFA 3SQNA 4CXFA 2EV5A 3FPHA 4E32A 2PLYA 4O29A 5DTRA 2VT3A 5DDGA 4O3MA 3EVAA 3HCEA 4C08A 1RI2A 5HLIA 3LGAA 3ER9A 1BM9A 2BGCA 5HDKA 3LCUA 3UA4A 4HGYA 4R8HA 3R9XB 4YIIA 4F85A 3ZP5A 4MHGA 4YMGA 1PDNC 2XASA 4GYGA 5HS9A 1RJGA 3C6KA 5FQOA 2PWYA 4HBLA 2M8EA 2PX5A 2OKCA 2G7UA 1J75A 2Y75A 3BROA 1X1DA 4I0AA 2GA2A 3FMRA 3L8DA 1FBSA 1B9MA 3HIFA 4IKPA 3FTEA 1KPGA 4OU0A 5DX0A 1IRGA 2JHAA 1NW7A 3TGNA 4P9FA 1O3SA 1MDMA 4G8XA 4WVLA 2G72A 2P8TA 1XVAA 3TQNA 3EVEA 3UJ8A 4PYLA 5A2QZ 1DUXC 4ENJA 3WTVC 2ZCWA 3H92A 4UHTA 1F3LA 4X63A 3DR5A 3I64A 4OIOF 3UA3A 1BI0A 2NP6A 2P6TA 2GQQA 4CDGA 1S8NA 4ER5A 2FRXA 3BOQA 1YZ3A 1CGPA 3IYLW 2VE9A 3KQYA 3J81K 2O06A 4UV8A 4QLCU 2HWVA 1IM8A 5F2OA 5IKMA 3CTAA 5CVVA 1I5ZA 1XCBA 2H11A 3TOBA 1KXZA 4OOIA 3HVHA 4QTTB 2W85A 5D4SA 2GS9A 2P7CB 1HNNA 2H94A 4N9HA 1AQIA 1RUNA 2I6GA 4KMFA 2B0LA 2V1DA 4GGGA 4YMHA 2ZWVA 3LKZA 1VIDA 2M30A 3TKAA 3R0AA 4EVIA 1EJ6A 2Z33A 2P6SA 1U2ZA 2PBIA 1I4WA 2UYQA 3PQJA 4X61A 2YX7A 3D5LA 3PFIA 1IN7A 1OYYA 1SMYF 2D45A 1J2XA 1DPUA 3ZMZA 5D6FA 4QPNA 3L7WA 5DUKA 4UXNA 5F64A 4YV1A 1VBFA 2DPDA 5D5VB 2E1NA 4M73A 4QDKA 4KYWA 3LHDA 2IT0A 2AR0A 3IHUA 1P92A 5K5OA 4RVDA 2ZXJA 1XDUA 4E2YA 2P8JA 4RB0A 2B3TA 3RW9A 5HLHA 2O3FA 4FP9A 3BZBA 1ZGAA 4BNCA 1YFJA 4YUVA 5E9WA 5K8VA 3IEIA 3BP8A 3FYDA 2WC2A 4OBXA 3LX6A 3LQRA 3HHHA 3UJ9A 5DD4A 3Q87B 3AWIA 3COAC 3EGIA 2EFPA 1L3LA 2EX4A 2K02A 2QQ9A 5P8WA 2ADUA 1KQ8A 1SFUA 3CO6C 3BKXA 1D2CA 2B9EA 4LG1A 1U5TC 5B1SA 3SVZA 3H2BA 2RQPA 3GIWA 1KQ9A 5JHUA 3LBYA 1YW8A 1EG2A 4AIJA 6PAXA 3RKWA 5FADA 1AWCA 1UIRA 3WTSC 3K1MA 1OYWA 1XSXA 1S3JA 5K0CA 3E5XA 5BW4A 1FSHA 4KIBA 5HIMA 5E2BA 2HWKA 4OMZA 1JTFA 5EQJB 5DXJA 2AN3A 3FZGA 4X60A 3FWEA 5ILSA 1Z9CA 2HTSA 2I62A 2J5PA 3IKVA 2A07F 4M36A 4RYLA 1CF7A 3T7RA 4CWAA 3GNLA 2KW5A 1LDJA 2HV9A 1WS6A 3B3JA 5DRTA 3BKWA 5J6XA 3HYIA 1ONVA 2L01A 3WE3A 2AOWA 1ZGJA 4WWCA 1YZHA 2ADMA 3ELDA 5GIPE 4ZYGA 4P58A 1HW5A 3QU6A 2XKOA 2PBFA 4GCVA 3F8CA 5MHTA 3TO6A 2C7QA 4V0QA 3CUQA 2GPYA 1PUEE 2IGTA 5E1MA 1YW7A 5EZQA 1ODDA 3DOUA 1DDNA 2ZMEA 1Z91A 3PTAA 3NJRA 4QPPA 1SUSA 3I53A 3NDJA 4IXAA 2ERCA 1R00A 4LG0A 2PSSA 2CYYA 3BJOA 4MTLA 1F38A 2ZTHA 3R3HA 2DPMA 3HHGA 2Z99A 3FF5A 4ZZLA 5FFXA 5E1WA 2BBYA 4RTOA 4U88A 2PMUA 1BJAA 3T1BA 3F23A 3LL7A 2YPRA 4IRIA 4A6EA 3DH0A 1U8RA 2ZZNA 3P97A 5IT9Z 1Z6RA 2V6CA 3LA2A 1YFLA 3N97A 1D5VA 4BY9E 3KLNA 3FMSA 1NW5A 2DU9A 2C7OA 1IXSB 5ICCA 1ZAOA 2CKDA 3HSRA 5KS2A 3RKXA 2OB2A 5F2KA 3UJ6A 2DTRA 3DF8A 4ESJA 3M6UA 3IHTA 5JR3A 2X0LA 3LCVB 1BI2A 3SXJA 5DV5A 2GA1A 4K6MA 3MB5A 2QENA 4QQNA 5E2AA 3RKYA 1O3TA 4HA8A 3I58A 1QANA 3HA3A 3LCCA 1IXRC 2ESNA 5TRDA 4GC9A 2Q41A 4A0XA 4R79A 2VZ9A 1N2XA 4ZZDA 3HCFA 4P7GA 3JAMZ 5FHQA 10MHA 4HF1A 1JTEA 3PFHA 4AIKA 2PVCA 2UZKA 1RNLA 3EQLF 3FTDA 5FULA 1TPYA 3GW2A 1K79A 2FCAA 1VPTA 1XGSA 3QOPA 3SMQA 2A6HF 3HA5A 5K0BA 2EFWA 4YFNF 3C3YA 1PP8F 5HIIA 5BS6A 4GO1A 3GFJA 3IRQA 4M9XA 4ER7A 5LHGA 1ZQ9A 2LD4A 1NE2A 1BHJA 2CWEA 1O3RA 3KQOA 1Y0UA 1H9TA 2DAOA 4RAYA 3F8BA 5BQTA 5GM1A 1UFMA 8MHTA 5E9JA 3PT9A 4HF2A 2IW5A 1MJAA 3C18A 3MEXA 4P7KA 4F84A 4H0EA 1X1AA 3WTZA 3DTNA 4PINA 1R5HA 5FGMA 5J8CA 2J5OA 5CUQA 3CC8A 1XTPA 3GVAA 4XRFA 1XB4A 3A26A 3GRYA 5U4XA 2RKHA 1R5GA 2VBYA 2EFJA 1NHAA 3J80K 3OU6A 1FY7A 4ER6A 2Z6UA 4A5NA 3G2OA 1FNNA 2AOXA 4YV2A 4RV9A 4PDKA 5HOOA 2QE6A 4BHBA 4EJTA 1DCTA 2D1HA 2VE8A 1B59A 4L9VA 1QYRA 1R74A 5GM2A 5LEKA 4L5JA 2FNAA 2H00A 4M37A 1IN5A 1V3FA 1LB2A 2EFQA 3F8MA 4KT5C 1O7LA 3WODF 4QVGA 3TO7A 1NV9A 4LECA 3KKZA 4DQ0A 5AIQA 3KQQA 4C06A 3REOA 2QBYB 2GXGA 2EFOA 3KR1A 2ESRA 1FP1D 3ANXA 1K6OA 4PCLA 5T67A 2NAZA 3M6WA 4OIRF 5EKXA 3GRUA 2ORED 1UCRA 5KQRA 1J9IA 3LAJA 2FNPA 2QY6A 2XRNA 1JSZA 4KN7X 4YFKF 2AOVA 3TKYA 1X19A 1XMAA 3L09A 2YXEA 3KQVA 3GYHX 1ZRFA 2HTEA 3EGEA 4IF4A 5CD1A 1YTYA 4FGZA 1MHTA 3ZMDA 1GVJA 3FXUA 5DSTA 1F1ZA 3Q9SA 4IRHA 3BDDA 3R6TA 2O05A 2P3OA 5EIFA 1ZH5A 4BP3A 5DD8A 2N47A 2FU4A 1XGOA 1NT2A 3SX0A 3MZYA 5LQCA 9MHTA 1D8JA 2EV0A 3P9CA 2QYOA 4PYQA 1D2HA 3KQMA 4H0NA 2DQRA 2OZVA 4B17A 2DFIA 4U0VA 2PXXA 2G1PA 1JSXA 3PVCA 5H02A 3QPTA 4KUMA 2LDUA 3M33A 3D2LA 1NV8A 3AY0A 2R7FA 1KPIA 1KHHA 4Q48A 4OA8A 4OQDA 1P91A 3GEZA 4KFCA 4M6XA 5KVRA 5ED4A 4ZTBA 1ZG1A 2QZ8A 2IH5A 2HGCA 4ISCA 5D5XB 3WGGA 4CXMA 4Y15A 2PJPA 2NYXA 1H1DA 4R8RA 3THRA 3DXYA 5DT2A 1FBQA 1VL5A 3JSPA 4ER3A 3FHZA 2MH2A 3FM3A 2FMYA 3FXRA 4P55A 3GRVA 4HV5A 2AXLA 2CGPA 2LF8A 2ZLBA 3TPZA 1T43A 3DMFA 2M87A 4AZWA 5LSAA 4YUWA 2JG3A 1RI4A 2QQBA 3CJQA 2I9KA 1F4KA 5LQKA 1YIOA 4RGXA 3WTUC 4KA4A 3F22A 2EG5A 3MERA 2M5WA 4QTUB 2GAUA 3DUWA 3WGHA 4M6YA 2PKWA 4HX7A 1G4DA 3G3ZA 4L9TA 5CVIA 4PCAA 3E6DA 4BAYA 1I1GA 4CTJA 3O7WA 4EGYA 1X3UA 4RGUA 4XLNF 3EMDA 1H9GA 4RTJA 2EK5A 3U2RA 2JZYA 1RZ4A 2ZIEA 3MHTA 1BIBA 1G8SA 3DLIA 1JG4A 3P2IA 1I27A 2LSOA 3O4FA 3NRVA 1JHFA 3I5UA 3V7SA 4BP1A 4C04A 1WWXA 2OD5A 2A61A 4BH9A 2NXCA 2P1DA 3LSTA 1C0WA 4RTLA 5F2NA 4G94A 2Q8KA 3B73A 2ACJA 4L0ZB 2K4MA 4AZVA 5KQSA 1R1VA 4AVPA 2ELHA 3GZ5A 3G5TA 2EFNA 2WV0A 2W84A 1D3YA 2ETHA 1WZNA 3G88A 1JQEA 2OU2A 3OOPA 2O0LA 1QAOA 5EHGA 4KDPA 5LHIA 2ISZA 3WTXC 3HUGA 4EM0B 1RUOA 2MBFA 5DM1A 2RNJA 3VB2A 4RTPA 1VTNC 2DK8A 4RTMA 4X1OA 3JWJA 3TM4A 2ZIFA 3ZMUA 2O8XA 3ORHA 4CHUA 4BQAA 5FCDA 3ECHA 4R6WA 1OR7A 5EMMA 1TBXA 1XGNA 2ZZKA 4MGRA 3THSA 1RI7A 2XAFA 3OE4A 4F86A 1SD4A 3SSMA 3DXJF 5M5BA 3EVFA 4I02A 5E8IA 3IL2A 3RIEA 3ERED 1L0OC 5CCBA 3GXOA 3LWFA 4FT4A 2GXBA 2O07A 5HOQA 3PX3A 1G38A 4FT2A 2GWRA 5LGNA 2R6ZA 4B09A 1HBXG 4ZYDA 2EA4A 1G3SA 5D5WB 1JXSA 4WX9A 1NBIA 2CO5A 1FWZA 3EVZA 4HDVA 2PWPA 1P4WA 3FTCA 2VBXA 2RN7A 4WCGA 1KP9A 3QP5A 2V1XA 2H09A 3RTRA 3HM2A 1NW6A 1KU3A 2R7DA 5DEQA 1KGSA 3AJDA 3HTUA 5K0JA 2CW0F 5E1XA 1PJZA 3K0BA 2EJTA 5F1RA 3KR2A 4RGSA 1DP7P 1L3IA 1KQ0A 4M38A 2DT5A 1KA8A 1OMIA 5DCFA 1XCVA 1K78B 4C05A 3VC2A 4RTKA 4Q5SF 3ELUA 5LLQA 2ZBPA 1ULYA 1O54A 5D5UB 5D8LB 1J5YA 1FSEA 5DPMA 5FFZA 3CJNA 3F6OA 2EV6A 4MEYF 1F5TA 5HEKA 1X1CA 3LDUA 2NNWB 4LB6B 5CIYA 3QU3A 4ER0A 2YX4A 1ZKDA 3KR9A 3U1DA 4IRGA 2VBWA 2LKPA 1FLIA 3BUSA 4R05A 2PEXA 2H6CA 1RJFA 3DPTA 1FP2A 3KPWA 5DTQA 3C3PA 2UYHA 2OZ6A 3DPLC 4BLVA 1UHWA 3GWZA 4U0YA 5K0GA 2Y1XA 3QRFF 1SFXA 2IPQX 5FB2A 1KU7A 2R3SA 3ML6A 3E97A 2AS5F 3HSEA 4XUCA 4LFUA 4LWPA 3FZVA 2L3DA 5K1YA 3BPXA 5ILVA 2E5WA 1JG3A 4IHSA 5CM2Z 1W5SA 1XSVA 3IRRA 1O9GA 5FLXK 1D2GA 4ZYEA 4K2EA 1KIAA 2ONZA 2A6EF 2PMHA 3NQOA 3FXQA 4A2UA 4EJWA 3EPPA 2RV8A 3BY6A 4ASNA 3LKDA 2STWA 5BPDA 2C7PA 3ER8A 1T98A 2VS1A 3P7NA 3F8FA 3ABTA 4KWCA 5EHIA 3JSOA 5GINE 3E5UA 2AN4A 1WI9A 3TDZC 4HQMA 3GRRA 3L00A 2GIVA 3ELYA 4GOND 2JRTA 4ATNA 2IPXA 5T6BA 3UFBA 3TDUC 2CQKA 2LNBA 3LAPA 5FHRA 1EH8A 3QP6A 2OA4A 4CTKA 3P9NA 5FA5A 1T6SA 3CKKA 3HRTA 4UNOA 3EYIA 4PYNA 2PT6A 3DXXA 3NVKI 1G3YA 2QVOA 4YFXF 3WE2A 2DQLA 3SFZA 3NMUF 3NW9A 1WQ2A 5BOXA 2PN6A 3V97A 2ZO4A 2HR3A 4EKGA 3V7RA 2ZNYA 1R36A 2FHPA 2STTA 2IDJA 3AAFA 1KYWA 5GP1A 4LD5A 4IV0A 1I6XA 4E33A 4EJVA 3TO9A 3HTSB 3GFIA 1G55A 3RIRA 5ICEA 2ZWAA 4LB5A 1IN6A 3JWIA 2V1UA 1YF3A 3A4TA 1NW8A 4Y17A 1ZLJA 3PS9A 5FWDA 5BXYA 1OKRA 2LF7A 2BV6A 5EKUA 1TW2A 1U6GA 1U78A 2PG4A 3RYPA 1QGPA 3GO4A 1FYLA 1ZLKA 4Y2HA 2P7IA 4EQQA 5L3FA 1FYKA 2NYUA 3R4KA 4EGZA 2PX4A 4QWQA 3PB3A 4HH4A 1HSJA 3CO7C 3GF2A 2IJLA 4EKIA 3IC7A 1RJDA 3P2KA 4OIPF 3FPEA 4KW7A 2HYGD 3KE2A 4POOA 2HFHA 2K4JA 3BXOA 2X4HA 3HVKA 1AQJA 1L3CA 3RDIA 3M6VA 3NWBA 5FTWA 4YUZA 4A0YA 4WK8F 5CVDA 1FJXA 2JH8A 2Y48A 3FRIA 5LRRA 1BBYA 2F5CA 3EUHA 2EB7A 5BW5A 4KIGA 3C1DA 1ZRCA 3GCZA 3R24A 3EDPA 3GO5A 2VP3A 5LQAA 4E2WA 1P6RA 2KJBA 3PX2A 5TJJA 3P9IA 3WTTC 3UJ7A 2ESHA 1JQ3A 3HP7A 5K09A 5DM4A 1EQAA 1IXCA 3MTEA 1R1UA 3EVCA 5EMKA 3KR0A 3OU7A 2L02A 3ZMVA 2VDWA 3BJ6A 3KZZA 3V8JA 1TQIA 5EMLA 2VOOA 1RI3A 2NXEA 3ECOA 4R1HA 2VT2A 1FZPB 2OY0A 4JXJA 2COMA 2F2EA 4Z2YA 3RPUA 4UVBA 5K5RA 3UWPA 4PGHA 5L3BA 2QWWA 3GJYA 4R8SA 4KDRA 4L18B 5HILA 3CBGA 5FWAA 2P35A 1IRFA 1BN5A 1BC8C 1BIAA 3ABUA 1M0EA 3I4PA 3EMBA 1QAMA 3B89A 1Q0TA 2XVMA 1MJFA 4XBFA 3RI4A 2G70A 2E7XA 2OQRA 1G8AA 4PYIA 1JE8A 5HLGA 1Z7UA 2HDCA 2JTVA 3ZPLA 2AZTA 4BXUA 5CLSA 3E6CC
chains in the Genus database with same CATH superfamily
5TLSA 4Y6LA 1BYIA 1T0FC 3OWXA 5L4SA 1BAPA 4L3VA 2QX6A 5DASA 3VU9B 1FDRA 3ZWBA 1KF0A 4L8VA 4HUJA 1LJUA 1FDWA 3P2OA 3AXTA 1UR5A 2W83A 1FPQA 1OXMA 4CMEA 4HDUA 3KP5A 3LECA 3M6LA 5BN5B 1R5OA 1T9CA 4NF2A 2B6HA 2V9CA 1UBOS 1YOVB 3HOXJ 1J0CA 2RJOA 4MRSA 3PUZA 1E20A 3HA7A 1GARA 2MLKA 1PP7U 2I29A 4DZJA 4Q7KA 4BGEA 5DMHA 1B4AA 1H2EA 2DU8A 5HRUA 3VFZA 2X86A 1JT9A 1VGQA 2XOKD 4GG1A 4DSZA 2R751 1T9DA 1EP2B 1BH6A 1LDDA 4C0LA 1OXUA 2IA5A 1KJYA 1Q11A 5NLLA 1ZELA 5L3GA 2I3BA 2YHBA 3O82A 4GLJA 4M7OA 4QSMA 3RT1A 1O57A 5BORA 5CJ9A 3FVVA 1JA1A 1I1NA 3JQ7A 1VHDA 4OXQA 4DAOA 4C0HA 2ZVJA 3OO1A 3OZXA 2QPTA 4MQVA 4G63A 1OI3A 2A2ZA 1EP9A 5K6AC 2PFBA 2QUZA 4LYFA 5LJLA 3ZDBA 2PD4A 5F76A 1SQSA 2DR2A 3NDRA 1IM5A 1CEYA 1MQAA 4TV7A 4ICIA 1QV9A 3L3BA 3E3VA 3VRHA 3TZ6A 4R8LA 1N3BA 1WMEA 4NLLA 1QTNA 3IVGA 4G5RA 3VPAA 1P7IA 3DNFA 3SXPA 4GDMA 1N6OA 1IW7F 2JJMA 4EMBA 4RPIA 3GMIA 1CF9A 4RDXA 1FBUA 5AOAA 3OS2A 3D6MA 2EF0A 5J59A 4R2XA 4GVLA 5EE9A 5EP3A 5JE8A 1VFCA 4ZXPA 1EUZA 2P41A 6YASA 4FC7A 4YEDA 4M8KA 1RC1A 1YTUA 1DKRA 1UFVA 4AX8A 1ZSYA 2ZJBA 1OIWA 3FPJA 2VSFA 1O95C 2X77A 2UXCB 3OR2C 3AY3A 1QKIA 2JGJA 1UMBA 2VC1A 4G1CA 4JI0B 5JZ9A 3VJMA 1WBJB 4BKPA 2RNGA 5CFRA 4FHDA 5AIAA 4B7UA 1TTHA 1SUDA 5I6DA 4W1QA 2CL5A 2HIHA 4FMDF 3F6RA 3N4MA 2JFOA 4Q7MB 4RPGA 3JYPA 4WI1A 4AJEA 4FOPA 1Z2DA 1NUHA 2Q8PA 1YQDA 3ZUGA 2AN1A 2DK5A 5FRNA 2A0YA 3OCXA 4GKAA 3DPIA 3I1YA 3H3ZA 5EIWA 1NBOA 3BC8A 1E3SA 3D6TB 4Q7EA 3LL4A 3CJTA 4B8WA 3JQGA 1KPHA 2ME6A 2IYAA 1SU6A 1VMAA 2PVSA 1EB9A 5CK5A 1J0RA 1N2OA 3PXCX 3LXXA 5AVKA 5E18F 4FBMA 3RRMA 3C3CA 4B7XA 5EJ2A 3FPLA 2Y77A 2X9DA 3EDYA 1L5VA 4LF4B 3IH5A 1IN4A 1SXPA 4YCDA 4YQFA 1KYZA 4E6KG 3DCIA 4AY4A 3UB2A 4BGUA 1ON1A 1M73E 5A3RA 2I34A 1XD9A 4RF2A 1UB9A 5IYCJ 4MYDA 5G1PA 3E7LA 2G09A 1LUAA 3JAMK 1MRNA 4AMBA 4F3KA 1JZQA 3B6ZA 4DYVA 1J20A 3CINA 4OHFA 1NW9B 4JLOA 2BHRA 2C9DA 4BXOA 2X1DA 4XSXF 1TD9A 3WLEA 5LLSA 3HXQA 2HRBA 1C4XA 2P9TA 4BKXA 1P4SA 2FDCA 2H1SA 3KAJA 4OAOA 3SBOA 3WIDA 4A3CJ 3FUVA 3ZHOA 4CLXA 2IYXA 5I9IA 1RIIA 4W1SA 1BN6A 3OQJA 5L3CA 1MDMB 1N8SA 2VDOB 3LGSA 3NHLA 2NQ2C 1ELOA 1AU7A 5LWQA 3AEXA 1E99A 4KFTA 4KPEC 1MW7A 4DR6B 1GUUA 3A0RB 3QXSA 5EJ4A 1DC3A 4AZ0A 3FUUA 1G9XA 5LQUA 2YMMA 3L9XA 2JUGA 4DUYB 3DE2X 4XTRA 2F5DA 5A6VA 1DWQA 4D9KA 3P0RA 1K83J 3ADKA 3BDAA 3JYHA 1G63A 4KZPA 1FUIA 1JKRC 1WWKA 4NESA 1PJRA 3ICQB 3PICA 2DLDA 1QQ5A 1K5DA 1E1CA 3SM9A 3G9UA 2XVCA 2A88A 3PRJA 5JWHA 1G5RA 1ID8A 1QH8B 2V4MA 1G3IA 2BR3A 3LUJA 3WG9A 1FDIA 5G4KA 4UM9D 1WSUA 1L7AA 2DLCX 4KPUB 4P5OA 5IKEA 3E05A 2RI1A 1QZZA 5GIOE 3DKVA 3MT7A 5DT9A 3JV7A 4XKWA 1E17A 1F0PA 1RQLA 4J29A 3PVSA 3T5MA 1A4RA 5ALSA 5K3FB 3D81A 1STOA 2H2GA 3SLRA 1PR5A 4MIOA 3AP1A 1DHRA 3RUFA 3OL4A 1WW8A 3CV3A 1QDUA 1KO8A 2P2SA 3SEQA 5EKDA 5HS4A 5KYTA 4NBLA 4EELA 5C46F 3PWZA 3T7IA 3K8ZA 4HUQB 3KPVA 3V8NA 5KU7A 4GX5A 2MR5A 3B3GA 2AW3A 1PJAA 3NJ4A 5HCIA 2JCYA 4O1IA 3T0IA 4ZVRA 2NTNA 1K8QA 2A0UA 3U9LA 2G07A 4PR0A 3V7FA 3K2ZA 4BYGA 5GQSA 1DPFA 1CNEA 3PEEA 1D5CA 1KHTA 1DFIA 1J09A 4CKXA 3LPDA 2IPLA 2L9RA 2TDXA 1JHRA 4REQA 1M2NA 4JBHA 3E03A 4TWRA 1YT5A 1OLXA 2XWJI 1EQ2A 1M66A 4D0SA 1R18A 2VZ0A 4RTNA 3UKGA 3DV8A 2EZ4A 4KBFA 1LCIA 3N53A 4RK5A 3R4VA 3THXA 1E9DA 5CXXA 2XVXA 4XLAA 2ASVA 2O7RA 4DIEA 2VC2B 4IKEA 4RUKA 4U39A 4Q4JB 3DOFA 3W6ZA 1E63A 3KJHA 1W0JD 3W2FA 2OUIA 4ZYVA 1JHYA 3M6MD 4NYJQ 3QVOA 1PG5A 5ENDA 3CIOA 4OL0A 5LC1A 1HMYA 4UZSA 2WUDA 4X45A 2WVGA 3QUTA 1YE8A 4G7HF 1ZOPA 5ER6A 4GRIA 1A6IA 3GQBA 1MR3F 1MB3A 1AUXA 1G20E 2IZ0A 1A5AB 2PKEA 4DW6A 3UFXB 4LTNA 2VKDA 1CLEA 1U0RA 5KTNA 1XSEA 5ALTA 1H3EA 4KTTE 4LHZA 2VTKA 4NCXA 1HDCA 4OAQA 5D7BA 2FZCA 3L2CA 2B63J 4L0QA 4QGFA 3QUCA 2J0VA 2WI8A 5BMVB 2Y05A 1FSFA 2WABA 3OT1A 1ZUWA 2CHVA 1SHJA 4LJKA 1R6TA 1U5AA 4GM1A 2JAXA 3T3PB 5H83A 4HYQA 4UCQA 2V7TA 4EV0A 1T0FA 3BCAA 2ZRJA 1WUTA 2CDNA 2O6LA 1BRMA 3LNTA 2M2EA 4NZPA 1SB8A 2RDPA 1X8JA 4HDOB 3BTVA 1SZDA 2LBFB 5T4BA 5LGUA 4YASA 3RREA 5JFRA 4TS1A 4P7FA 1UPXA 1PRYA 2JPCA 3CW9A 3BWDD 4JC4A 3HB4X 4WW0A 2E7ZA 4JVLA 5E9QA 1RM4A 3H3XA 4XKJA 1YD7A 3ZWWA 3IPLA 2P5KA 4NQWA 4AW9A 5TX7A 3RWBA 1QHXA 4OFZA 2RE8A 5JXGA 3ROKA 1U8YA 1S6YA 4KK3A 1UBMS 2WWTA 2IP2A 4WLEA 2WV1A 2EV5A 4E32A 2CXOA 2PU5A 5J1YA 1REQB 4JLSA 3QLVC 4LGVA 1D0SA 2BFCB 1XRPA 1OCOH 4I55B 5TY0A 1PAUA 3SBEA 5CH8A 4IDOA 3EEBA 3I2JA 1PDNC 3PXBA 3A9TA 5IS2A 5FEUA 5K6AA 3GLHA 4UNSA 1ETVA 2OKCA 1AMOA 4PC3A 4B46A 2OLJA 1JH8A 2DFTA 2W4SA 1KZ4A 5AVXA 3CLTC 2UUCB 4I1YA 3GTLJ 1NTOA 1XVAA 4EPVA 1C0EA 3OTHA 3WTVC 4X63A 3GUYA 2Z16A 4ESHA 2CUKA 5DU2A 3CTAA 2GX6A 1I5ZA 3ZEIA 3CP2A 2BUBA 1RDFA 4FE7A 4MWDA 2W85A 3JYNA 4N5LA 5AW0A 2P7CB 1G18A 1ONNA 1D09A 1JT0A 3N05A 3OJFA 4A8TA 3KVOA 1QCCA 3I01A 5HDBB 3QU4A 2GAAA 1EJ6A 3ZHRA 1I4WA 2I33A 2YX7A 1E4EA 5DULA 2ZYIA 1O95A 2CJWA 4PJMA 1ZL0A 2P65A 4ND3A 1DNPA 5D5VB 4GEGA 1IHDA 5K7SA 2OXFA 4RVDA 2C4WA 4HX5A 2XF7A 4DNQA 5M3BA 2H3EA 3EPLA 2IWHA 5FI3A 1SK8A 1RYHA 4ZPJA 1DC8A 4ML3A 1G8HA 1MXHA 1F20A 3SHVA 3UUFA 2ELKA 1ULHA 5I7WA 1XTBA 1ZINA 5BRAA 4BACA 4KHPB 3FJYA 1KQ8A 1LDGA 3I0ZA 2H0AA 5B1SA 4I6EA 3Q1LA 5F0CA 1CY6A 2IYVA 2VDJA 3RKWA 4JC8A 3K1MA 4TVKA 4GYJA 4G9BA 3E9QA 4KIBA 1JTFA 4LK3A 1TM2A 2C4KA 2I62A 1I1HA 3MN2A 2E2HJ 3L0CA 5CX4A 4ISBA 1XCMA 1DQNA 2Q3EA 2F9FA 4P58A 1Z7WA 3T9DA 3QU6A 1XTKA 3U37A 4EY3A 2C7QA 2YVKA 2QVGA 1B72B 2VPWA 4JBWA 5K3AA 4O08A 3AESB 1LWNA 4JVNA 121PA 3OAAA 1EZ4A 1Z8HA 2BKVA 4C7BA 1S2MA 1X13A 1FMWA 3A6DA 5L51A 4F52A 3WGOA 2WHXA 2BBYA 4IJWA 4GNRA 4A3BJ 4NAVA 4DLZA 4CIAA 6AT1A 3RASA 4HAWA 2DODA 3SF8A 1BROA 1LH0A 1Q16A 4U7GA 4YP9A 1JMYA 2FQQA 4I1VA 3RKXA 1IRIA 3UJ6A 3F5SA 4FHEA 5EP4A 2V6GA 4BIMA 1V8FA 3LOCA 3PRYA 4NU5A 3K9WA 4XASA 5EIOA 3I58A 3HA3A 4N39A 1L7DA 1TCCA 1GG2A 4II2A 5JT1A 2Q41A 1ZJ5A 1W8DA 4G4GA 5H3LA 4XRRA 3ZHTA 1GAXA 1TZMA 3EGDB 3H86A 3HJTA 1L5ZA 5BN4A 1UJ4A 3O4HA 4WXRA 1PFYA 2PWZA 1PP8F 1FNDA 1LX7A 4EUFA 3IE1A 2GA8A 2IIBA 1MC5A 5EZGA 3MN1A 2C97A 9LDTA 2Z3ZA 2DAOA 2F1RA 2HZ7A 3PT9A 3VSAA 1SVIA 2IV3A 1WB4A 1ZNXA 3MRTA 4JEUA 4RLFA 2CVFA 1ZM4A 3JTMA 1S3SA 4IIVA 1Q74A 1EGMB 2NT3A 3QQ5A 4QOJA 2DMQA 5BSMA 3MXTA 3KL4A 3MQFA 4BMDA 3WMWA 1GDHA 3OPQA 4OLJA 3PF9A 1SU4A 5HOOA 4EJTA 4K46A 2D1HA 1V71A 2B8TA 1O6GA 1Q7TA 3ON5A 5ALRA 1JB1A 2HWYA 3GG2A 5EJGA 2DERA 2R6FA 3IEPA 1NV9A 2LW7A 2ZUVA 1P2SA 4BUZA 3QPVA 3ESYA 4EYOA 1ICIA 2BCJQ 4E7LA 3KR1A 3K09C 1OFGA 1O03A 1PV2A 1NKTA 1KEEA 2QM7A 3I2HA 1O7JA 4HN4B 5C53B 1UCRA 2BFBB 2PZ8A 1B6SA 1A8PA 1ZJ6A 1UELB 4E5DA 4Q6BA 2HO4A 4EJ0A 4FGZA 3ZWYA 4PZYA 3I4LA 1KZ7B 4CLOB 1TTTA 4NFHA 1FDTA 1HMPA 2D0DA 3W6NA 2JFQA 4YJ3B 1A1VA 3DQZA 2ET6A 3JQBC 1W1UA 4ZDWA 2LDUA 4YC7A 5FLEX 2FPRA 4NABA 2OBNA 2FH5B 3L2VA 3L0SA 3N6XA 5FUQA 1TEVA 5FOSA 1E4OA 3F73A 3KD3A 4Y15A 4FPXA 2O59A 4AUEA 1NY5A 3WS7A 1OY1A 2CGPA 4ND2A 1LK0A 1E0SA 5JZOA 3U3ZA 3CJQA 1Z12A 3W5IA 1QBKC 1R9GA 2J9RA 4RJJA 1PL7A 1PNVA 1DBRA 2JSPA 3Q3SA 3DB2A 1R0KA 3TL2A 2QAGB 3U2RA 2ZIEA 1G8SA 1JKJB 3WYDA 3O4FA 3RAFC 3LQ1A 3NRVA 1E6UA 4ZYWA 4ENUA 3AB7A 1MO5A 2ZI5A 3HZZA 1H2XA 5CDHA 4EB8A 2P1DA 3KEGA 4QOHA 4DMRA 2BD0A 2LPMA 3GWGA 2W84A 2ETHA 3ZWDA 3ZWCA 4ETIA 5AESA 1BWSA 1KORA 4Q4DA 5JVDB 4XONA 1CJUC 2DFDA 2J6IA 1UFQA 2IYUA 5E7IA 3OKPA 3RTBA 2O8XA 1OXSC 4CHUA 1X7ZB 1DFGA 4JB8A 3QNMA 4B3HA 3QTTA 3TL6A 2RC6A 4LNUA 4MS3A 4QWMA 1AJEA 5KREA 1BOBA 1Z8FA 3FTCA 2CYBA 3RBVA 2VBXA 3DR3A 2CYAA 4KIWA 3NFYA 4YMTA 3PNKA 2W00A 1EVYA 1KZ1A 4ZEWA 1Z5UA 2I3AA 4HFRA 3R5HA 3JQFC 1TA0A 1V4NA 3TLGB 3CISA 5IOYA 1W93A 3D6UA 3HOWJ 2GCIA 1F5SA 4Q1DA 5BSRA 4DKXA 3AR5A 3G49A 3IS3A 3AONB 1FJ2A 4DJEC 2WJGA 1UHWA 1NQTA 2C5LA 2Y1XA 4FINA 3PLRA 3ML6A 3ZG6A 1JMKC 3HUTA 1P0CA 3Q0WA 3Q88A 1JG3A 5CM2Z 1JFTA 4J0IA 1L5NA 1FFEA 4KNVA 3LTEA 2WC1A 3COSA 2REBA 4NIMA 1BDJA 1ULSA 4ZYTA 2YU9J 3PGVA 1QHFA 3PKJA 4PZEA 4R3NA 1SR8A 1S7EA 2DLNA 2JRTA 4FJ0A 4CM5A 5LPNA 4UEQA 3TDUC 3QSGA 1LLUA 5DGHA 2I3DA 3BXEA 1I01A 3HRTA 2QD5A 4EJSC 1UMDA 2V7UA 5THQA 4HAYA 1GTMA 2DA4A 2VF2A 2PN6A 1PGNA 2ZIVB 2HR3A 2ZNYA 4HXGA 1XDWA 4LD5A 1YI8A 4BJ5C 1K06A 4TMTA 4UDNA 2PSJA 1E66A 5C18A 3OG9A 3RIRA 1BVUA 1VNDA 4TOIA 1NA5A 3JWIA 1YCHA 3MGKA 3OYLA 2V65A 2ZKLA 1QGPA 4X00A 4KAFA 1HDYA 2QMOA 3THWA 3LT4A 1XD2A 3B2EA 4XIYA 1JEEA 1K8RA 5AUOB 5EZYB 3ONWA 3HVKA 3REGA 1L3CA 2C5HA 1QZ3A 3FRIA 2BFNA 4ND7A 1VC2A 3C1DA 1E1YA 4E12A 1G66A 5LQAA 2C5GA 4DPLA 3FDXA 2I6UA 3RIXA 2QI9C 3KR0A 1IMJA 2L02A 4S0XA 1TQIA 3DAHA 1XZFA 4BRSA 3WJ7A 5C44J 4CL3A 5LXTA 4IH4A 4YJFA 1USIA 4JX4A 4KDRA 1E2QA 1EX6A 1KOGA 4YRGA 1TU4A 2P35A 4KQ9A 4K87A 3F3KA 2XUZA 2JGIA 3EMBA 2V4UA 2IYOA 4IDAA 3HYLA 4PYIA 3MKZA 1GL9B 1JDZA 1O94C 2GM3A 3WHIA 2BY2A 2VLBA 2AOUB 1ZD8A 2POQX 3NEUA 4CKCA 3MTIA 4MFDA 1QRTA 4IRXA 5GWXA 1NW3A 1VJCA 1U2QA 2GZSA 3BJEA 4QIWN 1S3FA 2E1MC 5IDWA 5AOCA 2QLMA 3RIYA 1II0A 1NQUA 5KTKA 2PBZA 1G3MA 4G8JA 3JYOA 3ACCA 5C0OE 1OGIA 2CLHB 2R5ZA 1JHZA 3K0CC 4Q4ZF 1JGTA 2HU2A 5K3OA 5BV2P 3Q85A 1LBQA 3NWOA 3GAMA 1QMGA 1SC7A 1QAQA 3A7EA 4QU8A 2C8JA 3CF5F 3MFYA 1SU8A 2GO7A 2K7LA 5M29A 3RSOA 1EVLA 1CQIA 4QLAA 2PY6A 2BKAA 3S7TA 4FOLA 3WGMA 1ZH2A 2BEUB 2FSPA 3HPRA 1T1JA 4Y3OA 4PTZA 4M6WA 3B36A 2IGBA 4EHNA 1MGTA 1IJFA 3KKQA 2O1EA 1T34A 2PJRB 3CX7A 4G9EA 2C9YA 4YRDA 4OKNA 1W49A 2HW8A 2K87A 2ZSHB 4LRSB 2Y3IA 3PDWA 2O8BA 2NZUG 5E8RA 4MROA 4LV5B 3TAHA 2I78A 1XB2A 1RXVA 2I4OA 4PS1A 4JBGA 2JGAA 3C7JA 2OC6A 3M8EA 3G73A 4PZAA 2BFAA 2EQAA 3MWMA 1A9QA 4ZTZB 3VODA 3OCJA 2GB4A 4RGRA 4E2ZA 2VJLA 1HQKA 2PL9A 1JRLA 1P80A 4MX8A 4IPTA 3NS7A 1MKMA 4DV3B 4BBPA 2TS1A 2LVBA 5AVZA 1F7UA 1PFGA 2V8BA 2DH6A 2WAOA 4KPGA 4L15A 2HA2A 3IP3A 4P34A 3WHKA 3N3AC 2NSHA 3B5EA 1OC4A 4XNFA 5KNCA 2ZCUA 1QRAA 1XR3A 4YMVA 1WY7A 3AXSA 13PKA 5CDGA 2HD4A 4LGCA 1PT8A 3OKFA 3OQHA 2IOYA 1TDJA 4DQ2A 3RPEA 3GYGA 1O5IA 3NUQA 1KEPA 4PFSA 1EUCB 1WDLA 4QLBA 4JOSA 5T64A 2YY7A 3RC2A 3K09A 3ZQFA 4RS4A 1SOMA 2VN2A 4XRSA 4WA7A 1A9SA 3ONVA 1VLJA 2KPMA 1R9TJ 3F96A 5JS2A 1RD4A 3TNYA 1HBJA 2BSQA 5B2ZA 5M5XJ 3PNYA 2NVYJ 4KMMA 4FFVA 3MFKA 2L17A 4L8GA 5G0UA 1GPWB 1JU3A 3GLUA 3MBKA 2CYCA 3VKUA 1RZUA 2QT0A 3WRWA 3E35A 1S2IA 5A5GA 4OIQF 3K0EA 2R7ZJ 4G1VA 3RFVA 2P3QA 1V4BA 3W4KA 1Y8QA 2JCVA 2YYSA 4IHYA 4BZQA 4YCJA 1TKCA 4AY2A 3L4BC 1XDSA 5J4KA 3U17A 1PG2A 3JQBA 5EIBD 2VHZA 4MPJA 3SJAA 4YREA 2WZQA 4AIHA 2XGDA 1QIFA 4LEIA 2H1OA 1VBNA 1MVOA 4DWJA 3PM1A 3TTWA 2TYSB 3K15A 2RGVA 3R41A 3VHXB 1PS9A 2ZMEC 2AW5A 1W5FA 1XC7A 1JQKA 4E7IA 2ZKZA 2XA1A 3BJMA 5D87A 4CL0A 3KPUA 3KHKA 5AVRA 1Z75A 1EPUA 3KSRA 3R9IA 4H0FA 1GTSA 4EM6A 4HNTA 5LQRA 1QRSA 4V0SA 2R7RA 3AWDA 3FPCA 2G1AA 5HKKA 4R9NA 1A71A 1PR2A 5WRFA 5D1NA 2C3OA 4QBIA 3F9CA 4DANA 3W1WA 4TRNA 2YICA 1H0HA 1MDFA 1KAGA 4E7JA 4FMCB 1T8IA 1N6PA 5CDFA 2IDKA 3D1JA 1XROA 1BOOA 1IV8A 4RM3A 3F6VA 4M72A 4NMXB 1Y4AE 3P20A 5GAEJ 3MPOA 2I80A 2VO1A 1QONA 1WPQA 2ODBA 1ZU4A 9ABPA 1EFVA 4O3FA 4PK4A 4MIYA 3GFQA 2K40A 4LVCA 1M34E 2ECBA 1D4FA 4CF7A 4QUEA 2J6CA 2VDUE 4PXSA 1IBLB 2O61A 4H0CA 3HVJA 1GPMA 5KPDA 4JP8A 3FMQA 5HE9A 5A7FA 1YDWA 1YMQA 3HRHA 4MS4B 1TMYA 5JSUA 4ZA2A 3I8SA 1W7AA 3M70A 3KZYA 5DM0A 4DLSA 1ORIA 5JS6A 1WRJA 3HKCA 2PXAA 4QJ5A 3GLGB 1LEHA 2EIJH 1XRJA 4L0CA 1VXOA 2FMUA 2J3MA 3JQFA 4C4AA 2ZRHA 4DCPA 2UVPB 5C52B 1F51E 3SZUA 3NOOA 5TNXA 1PZNA 1QZTA 4R1QA 3ABOB 5FNVA 1E2XA 3EB9A 2JJ1D 3COPA 3FRHA 2PH7A 3ZU2A 1HKTA 2Q99A 1BC7C 2FLVA 4LV8B 1L8OA 3GRZA 4I50F 1TAGA 3I9LA 2NXNA 1OCRH 2BYTA 4YWHA 2LG4A 5A9SB 5LDGA 1NKVA 4ZV9A 1NSTA 4JJFA 2AG0A 4G0PA 4GBJA 5BT8A 2V0CA 4QYWA 1ZG5A 4MDFA 1OBFO 4V0OA 4EB0A 4HNAA 1MZVA 4HB2A 2OZKA 3EVTA 2Z6VA 1D1QA 3DMGA 1RR7A 5DCYA 4B3SB 2H2DA 1FXSA 5KNDH 1E3DA 3BGIA 4WKBA 2ELJA 1TIKA 2HAEA 1ECGA 4TMKA 1GUYA 1XNJA 3H9BA 3K35A 1PEAA 1ZNYA 1Z7YA 2YQZA 1HFJA 2AXEA 3LX8A 1QIGA 3EC2A 2JCXA 4DQVA 1VGRA 4M3EA 1T2VA 3RF7A 4WLFA 4NZMA 1U5TA 1C50A 1U7UA 2OBPA 1DUSA 2HPVA 1UDAA 4DLBA 3GH1A 5ERGB 1N9GA 1W96A 4HLDA 3KQPA 3MLAA 4H4EA 4EJSA 4Z6YA 1NP3A 1SBHA 1W8IA 2CLEB 3KQNA 4MQFB 1KY3A 2UYOA 4ZJPA 1PZHA 1H4QA 3MUFA 4YJHB 4JA2A 2VATA 4BJ5A 1W2GA 4C0WA 1JJFA 2FWAA 2BZGA 2E5FA 3QVVA 3W6PA 2ZYAA 4Q05A 1KJIA 2II6A 3IOCA 2VEOA 3SFVA 4D0PA 2W6IA 3C0KA 2GPJA 4XJSA 2HQNA 3IOBA 3MT8A 3VR4D 4LF9B 4DMFA 1EA7A 1GUFA 4TUYF 2UZ3A 3F5FA 3ECSA 3J7TA 2ERYA 3S1AA 3M6XA 1I5RA 2G1KA 3LE8A 3NZEA 2NW6A 1B1AA 4GI5A 4LQ4A 1I1OA 1LRLA 4L27A 4ESVA 1YFZA 1JHMA 4D3DA 4FFRA 2HNAA 1CUBA 1NC1A 4CM6A 1RCFA 4XK4A 3CR3C 4P7BA 1KA9H 3BDIA 2XCQA 2ZVDA 1A7KA 3MUOA 1N1MA 2YZMA 2IYEA 4UMVA 1NI3A 4V0ME 3KIPA 1GVHA 3DPUA 2O03A 2I55A 1VP9A 4W99A 3BSYA 2QRMA 4HZFA 4GOMD 4CLEA 4L95C 2IXGA 4ZARA 1F6WA 1H66A 4KGDA 1Y7TA 2COUA 2F59A 4DEVA 4KAAA 4UUQA 1GOTA 1RAAA 4JGBA 4LCBA 4URHA 4P3KA 3UXYA 2JL1A 4XFKA 2OKGA 3CW2A 5DLYA 2G77B 3K0CA 2DH5A 2GETA 2I67A 3TOZA 3ZLVA 2NXJA 1BI1A 4S1OA 2GLXA 2VP6A 4DRXA 4AB1A 2I2AA 3JAKB 5F78A 4MTCA 3PHJA 3X2EA 4B44A 1B2LA 3EGVA 4QNNA 1GU0A 3E82A 4ZGBA 3OSUA 5BUZA 5JBNA 1SD7A 4QARA 4MUHA 4UUAA 3HU3A 2XMBA 1V9SA 2XC7A 4LK2A 3SM3A 1ZBDA 4AJNA 4C4PA 2X6RA 5GADJ 2ATXA 2VT3A 4PANA 1NY6A 5IZCC 5E6RA 2GNOA 1I4EB 1RI2A 1J2UA 1NUTA 4JI4B 4F72A 4ZZ0A 1U81A 1GGVA 4C22A 2AQ8A 4OH1A 2BTOA 3RYTC 4M8IA 2ZE8A 4OLBA 4M0EA 2VBFA 1DJMA 1AK9A 4BFZA 5DEIA 3MZ8A 3T99A 4ZOCA 2EFCB 1FU7A 4UUSA 4Z7QB 3DEWA 4WVLA 2G72A 2P8TA 3PEWA 2BGLA 4P4SB 5BWBA 5IAOA 1Y82A 3PBKA 4D9CA 4HWKA 3KBOA 3AR9A 3BOQA 5L40A 2C1XA 3PUYA 1SQ6A 3IYLW 2Y1CA 4KC0A 1RP1A 2GZMA 2WUGA 4HEA2 1K8YB 3K70D 2OSVA 4IOCF 2XMCA 2A7QA 3HVHA 4AC0A 5SV2A 4DC1A 4K9DA 4YJ2B 1ZM3A 3LHIA 2Z5LA 2A67A 4BVFA 1JLSA 1EKEA 4GGMX 3JQCA 5TGDA 3B70A 2P6SA 4HDNB 2EFYA 2UYQA 4X61A 1B41A 3GLRA 1OYYA 2R60A 3SYNA 3RFXA 3AUJB 3U40A 1JI0A 4S1WA 3L2QA 3KSMA 4ARIA 1IN1A 2LWIA 4HFJA 1NPTO 1JI3A 2XNJA 5IX8A 1JIUA 4RB0A 4HX9A 2ACKA 4BNCA 4B4DA 3L93A 1AKWA 2BCEA 4YUVA 1WUYA 4YVFA 3IEIA 4PVDA 5D7NA 3PSFA 2J5QA 4BP8A 3QE3A 4MAFA 3HHHA 1OI2A 4CM1A 4P98A 4WK6A 2LVSA 5IYZB 4X1KA 1C2TA 3OOWA 5FBHA 4AF7A 2GPBA 3M5DA 1V8OA 3LSKA 1B74A 3PI6A 4GOXA 2PPVA 3DZ8A 4S3MA 4I14A 3U5TA 2F4OB 3LBYA 3BK7A 1WSWA 2RGRA 5A2GA 3ZZ1A 2X9LA 4KKXB 1FMTA 1PR9A 2VXCA 2WYUA 3L4BA 1YX5A 4NU6A 2A9KA 2BL4A 1OILA 1QG2A 4HWOA 2X3FA 1RWXA 4UHCA 2FKNA 4G2TA 4HK4A 3HYIA 3WE3A 2FN3A 4ZYGA 2IDMA 1CNMA 5AH0A 1JHXA 1IEWA 2OCXA 1A1SA 3A4LA 5ADHA 1YWGO 4M0DA 4ZZIA 5E1MA 1X39A 1H88C 2ZMEA 3AKCA 1V7ZA 3PTAA 3PFNA 5HPYB 3KTOA 2XZPA 5AJZA 5A1JA 4B3CA 1CQXA 2XXAB 1ULBA 1MIOA 3CE9A 4TL6A 1KAHA 3T1BA 2Q6LA 1RP7A 3KJIA 1DEHA 5DBOA 3TEDA 2C2OA 1RAFA 4ZYAA 3ETNA 5F2KA 4Y9TA 3LUPA 1ORVA 2AX3A 2NUBA 1TZKA 3O8HA 2YY5A 4HA8A 2XDAA 4Y2RA 3GLVA 2JBAA 3LCCA 2P4EA 1IEVA 1QA6A 1R10A 2JF0A 4ZZ1A 4EGAA 2WP8J 4Y6GB 3WYGA 3OZ7A 3IR6A 5FULA 3BAFA 2CN1A 3M8JA 2JFBA 3KXKA 3C3YA 5JAHA 3KSDO 4GO1A 1YJNI 4B3XA 4JC5A 3OQNA 1CKEA 4B4VA 4ZI7B 4OQQA 3IMKA 3BR1A 4LVNA 3OJLA 3ZVMA 4M8LA 5JBQA 3PPVA 1S5LC 4XKVA 1X1AA 1LF0A 4EY7A 2J5OA 2Y0DA 4QDZA 4H16A 1JLKA 5FWNA 4CFYA 3U48A 2QR5A 5F9HA 2V7PA 2JGMA 4ZDPA 4A8JC 1ZSVA 2OHGA 1G5PA 4D41A 4GE3A 1LE8A 1Q1BA 3I1FA 4RV5A 4DLPA 2JHFA 3DL2A 3UXHA 4DIFA 2FX3A 2C5EA 4K03A 2NSDA 2F62A 5GPBA 3QFHA 3MWFA 2PZBA 5EE1A 1MOSA 4FMDB 5EVCA 3WLOA 5SZHB 2K9SA 1JNXX 3QUBA 1SRQA 3B9BA 3GXBA 3EQ2A 3WLIA 3HEFA 2FLKA 4D4HA 1U7XA 4LJSA 2PUVA 4EYKA 1OLSB 3VNVA 1VCOA 2X9VA 4TYQA 3MJFA 5EKXA 2WM8A 1WZEA 5JC8A 5C1OA 3K2BA 5LMZA 4DV0B 5KTMA 1C7IA 2PN1A 1PV1A 1AC5A 4IGAA 1H2BA 2K6GA 4I08A 1UOOA 2HK9A 3MCWA 5TS3A 5FKJA 1RBZA 3GZNA 4RPLA 2N47A 4RGQA 2B82A 1PN3A 2G08A 4RJKA 2DFIA 1QLJA 5B64A 2PXXA 4Y6PA 3EGXB 4TTPA 4Q34A 4D9FA 2PMWB 4BN0A 5C8YA 1NJ6A 5H02A 1Z0AA 4UOZA 1NV8A 5I7EA 3AY0A 4G0MA 1KWGA 1XCOA 2F3PA 1NI5A 1CERA 4H15A 3BCSA 2C9CA 5BNIA 3FB4A 1SKAA 4QJ3A 1KU0A 5F27A 3TRHA 4HVCA 4HOYA 3N2YA 1BU8A 1KTIA 2AXLA 4D98A 3G85A 5ECGC 3ACDA 4JYBA 3F22A 1IQ0A 1Y37A 2YZGA 3P94A 1W4CA 2H17A 2YY6A 4QJ4A 4GR4A 3RV4A 1T4CB 5AVQA 3HA2A 1DARA 1JIIA 3FOCA 2J9FA 2R1TB 3MHTA 3DLIA 1I4OA 4ZOAA 1QRYA 1MBGA 3H9QA 2LSOA 2QRLA 1AUPA 2ZOSA 1JEYA 3V7SA 3VOAA 5AI9A 3BHNA 4PPFA 3PCRB 3OWHA 5KQSA 3CKMA 4F11A 3ESCA 3B3AA 3VR6H 2GBLC 4BO8A 3IOMA 5D5QA 4R83A 1YHZA 1ZUD1 2WKWA 1GPLA 4NJMA 3PTLA 1PJ3A 2VQ6A 5DM1A 3F6CA 3UAYA 5HNKA 1V6AA 2IODA 1T2DA 1GNVA 3SDZA 2COKA 2WHPB 3EVFA 3O4IA 3SR3A 3IL2A 1KAMA 3IKLA 3F97A 2HIMA 1R0BA 2AKYA 2IZOA 1JJVA 1H05A 1VKRA 3HS3A 1G38A 3IT1A 1E7MA 5LGNA 2JK3A 4CRWB 4KSYA 4WFQA 3QPDA 1IZ8A 1TJYA 3NP9A 4HDVA 2PWPA 3PC2A 1PVVA 5A05A 3CZQA 1A96A 3PJDA 4BHTA 1QM5A 4LBVA 2FWBA 1S5PA 2FFQA 2ZXFA 4U0JA 1W52X 1Y89A 3D7RA 2QSGX 4ZU6X 5ES3A 4DR2B 3CF0A 4ZVQA 5FFZA 1BXKA 3MGAA 1H23A 3NVDA 4LB6B 1QIEA 2WMOB 3JD0A 3MRVA 4CYCA 2A9JA 1Q20A 3UMRA 4HNSA 5IWAB 3QK7A 1PSDA 5J58A 4ECAA 5CGQB 2CJFA 1JSRA 1MOQA 3OS1A 4RK4A 1FU8A 5COBA 1Z4PX 4UAGA 1TVEA 3FZVA 1J5PA 5AKXA 4CPDA 5LUBA 2YQ5A 4K2EA 3GJ5A 3U4HA 4X8MA 3E22A 1OZGA 1YJ5A 1T98A 5IZCA 4B43A 4RSHA 4DNPA 1L6IA 3SE0A 1RPWA 5YASA 4EKDA 1RCUA 3H2JA 2OMKA 3JSOA 1WJAA 3V3KA 2X1VA 2CCGA 4G1EB 1KK3A 1FMCA 2JMWA 3QE4A 3ZNOA 1ENPA 3KYBA 4CKEB 2GDJA 5T6BA 1OH7A 5FLKA 3UTDA 1DQUA 1GO2A 5C7LO 2PT6A 1GADO 4XIGS 4QXPA 5IKXA 4M1EA 1NUPA 2R6R1 1SC3A 1KYWA 2COBA 4XSHA 3JALA 2JLWA 2J3JA 1T0HB 3K4CA 1Y6RA 4N49A 2OV1A 4LB5A 2HADA 3A4TA 4Y17A 3IQWA 3HOUJ 4R9UC 3JY6A 5HXAA 3TNDA 1GRQA 3MMZA 2VYND 3CONA 1K89A 2PMDA 3HZHA 3S6JA 1KYQA 1XJQA 2R8EA 3NEPX 1Z0DA 3BIXA 3GCWA 4Q4AA 3ETCA 1N2EA 1UMQA 1DELA 2PPLA 2X6WA 2PGJA 5CVDA 1IHPA 1H22A 1EFRA 5BW5A 3USZA 5U4QA 3NYIA 5JFTA 4PQGA 3WTTC 5F77A 2FGKA 3OFND 3JZMA 1NRIA 3MTEA 1R6XA 5GPCA 3EVCA 5F08A 4J0QA 5ARDA 4POAA 4TV9B 1IPFA 2WZBA 1JTYA 4BTEA 3QH4A 4WPGA 2XVYA 2EP8A 3D8UA 4PXYA 4UVBA 4NFSA 4DYDA 5L95A 5IC4A 2A5JA 4DT1A 4M0KA 5SZIA 5JQGA 3CLSD 2BE9A 2QUIA 4U2BA 4ESOA 2E7XA 3HUFA 5CYPA 3I4CA 2YZ7A 1EK1A 1NFFA 2PANA 3INYA 3M5CA 5DWDA 4O5OA 2LP4Y 1NVDA 1Q1ZA 4HX4A 3F7NA 2M98A 1D6JA 1EXVA 1YGPA 1C41A 4X7BA 2ZUBA 1NDHA 3WLTA 1RESA 2VXOA 2QRVB 4DNOA 1XDBA 4OXXA 2WILA 3QOWA 2VCEA 1Y9EA 2Z9CA 3CCCA 1EK6A 2ZK7A 3GVHA 2H07A 4OMUA 4D3YA 5A2QA 2ACEA 3ZE6A 2QQ5A 1M2HA 1JU4A 4O4LA 2MLGA 2BHTA 1XNQB 5K45A 4C5AA 4ZOLA 3LUDA 4PGAA 4DEYA 1S29A 2CFIA 2DBRA 2R5FA 3BFJA 2KMLA 5CMLA 1I3QJ 1CUAA 2R7XA 2EWNA 4BE1A 2CVZA 2XDYA 2V26A 2PFGA 3CPSA 3UC9A 2RGUA 3IBFA 2CBGA 5DWVA 2Y2ZA 3DVAB 2AFIB 3KU1A 2Q9CA 3QE0A 4BDTA 3JTEA 1KL7A 1NX6A 1H0RA 1ZI9A 2P6RA 1PZGA 4OMYA 1YZGA 1TA9A 4MVJA 5AM2A 3GGSA 4FKZA 1P1CA 1IJEA 4FTWA 4NHOA 2PQ8A 3UVEA 1DIAA 3MQ4A 1GTVA 4KIUA 4JVOA 4Q16A 2DY0A 2HTJA 4FNGA 4XMYA 3T94A 1HDGO 3MKYB 5AW2A 2H8GA 2PX2A 5IT5A 1V11B 3S3OA 5JLWA 2FV8A 3P9ZA 5JZVA 1A4IA 3KV1A 4E30A 3WMEA 4KO1S 4KLRA 4BASA 2B2CA 4RGYA 4I4CA 3OCWA 5JYEA 1QOZA 3K9NA 2J09A 3U7HB 3CVOA 3I2YX 2ZP1A 1BOAA 1Q0PA 4EGCB 3CE6A 3S1SA 1WQ1R 5FWYA 4TMZA 5JW6A 4CQMB 5L6MB 3WLKX 4JI8B 3K6RA 2OZPA 1E2HA 3TIXB 1WXWA 2JKYA 1HNZB 2DA3A 2C04A 4J0EA 3WGNA 3HBJA 4CQNA 1U0GA 4OOEA 2BHLA 5THKA 2Q2EA 2Q1WA 1AKMA 3T3HA 3ZN0A 3LBIA 4A8JA 2QN2A 4YAIA 1FS4A 1NN3A 4M2LA 1Q7GA 4YIKA 3FCCA 2YWDA 3EXIA 1G21A 1ZK2A 1GGJA 1NQXA 3GB9A 2B4AA 2ZE5A 3LSIA 1NP6A 2VPLA 1NVAA 2XYRA 4C7MA 1OW3B 2D5CA 1FW8A 4EWLA 1OR8A 3D3QA 4UBOA 5C35A 2R5YB 2IPMA 2HOEA 5EJIA 2AC2A 3AHGA 3AMVA 4Q1AA 1IG0A 1Y33E 2GSWA 4YHHB 3A02A 4BNVA 1PEDA 2IK8A 4K0KB 3A05A 2WIKA 4NB5A 1Z88A 2ES4A 4M1KA 4YO8A 5FTKA 2O2JA 4QJBA 1WUJS 2YSRA 2GZHA 1VLHA 1JUMA 2ISCA 4LY0A 3F6YA 3F0TA 1AKNA 1HLFA 5LQNA 2E7WA 3HNPA 4N3NA 3RIGA 3S29A 2PUDA 1T8PA 5C8DA 4YYZA 3PRHA 3BR5A 1MAAA 4FD3A 1Q5PA 2WDPA 5ECDA 4H3KB 5AI4A 2FP4B 9LDBA 2P6MA 1F48A 1R6RA 2BHZA 2MYSA 1QP4A 4P0QB 4N12A 4M71A 2M9HA 1W46A 4U7PB 5I8PA 3T1YB 4ZI2A 3WL4A 5C8VA 3RUDA 2OR3A 2PA0A 2QUFA 4U2EA 4FUQA 4QQKA 1NR5A 4KH0A 5D5HA 2BEOA 3AC0A 3RYHB 3SFIA 2ZBRA 5EG5A 3WB9A 3C6YA 1UHSA 3BTIA 3PSIA 1OHHD 3EODA 4BNXA 4PSVA 1HE1C 3A1UA 4HP8A 4D9JA 5IW8A 1P5ZB 1VRCA 4IIFA 5EC8A 1H5QA 2FUG2 3D54D 5BPHA 3PXAA 1L8QA 4MAMA 4YDRA 4YIFA 4M0UA 3SLGA 4O4JF 1ZKGA 1J4AA 5LGTA 1LUJB 4UOEA 2GBLA 2HM7A 3H8SA 5GVSA 1MX5A 1Y5MA 1MH3A 3FZYA 3GFLA 1QFZA 2UDPA 4EW1A 2IVMA 3E2MA 1S3GA 2FMIA 3W6UA 4U5XA 3ZI0A 4RVCA 2A9FA 2X4LA 1O9HA 5KDLA 5IKOA 4RFSB 3AJ8A 3LHFA 2L4AA 2IQIA 4LGWA 4OD0A 3IAS2 3G7UA 5KWSA 1MD9A 1YV9A 1RIFA 4FHCA 5E4TA 3IPXA 5HDQA 2G67A 2W8ZA 4IQ0A 2Z2YA 3MKLA 4WRRA 3O6BB 5LD2B 2V4ZA 1A8IA 4FFLA 1NTCA 2R86A 4F9FA 1TLTA 3T95A 1IXKA 2RVCA 5AHRA 1KH2A 1TVCA 1GV0A 2YS6A 4EEFG 3WYBA 1QQ7A 3TRDA 4HQEA 1H8EA 4I1RA 1GKKA 3LW8A 3ET5A 3SIRA 5E3HA 3A3OA 4KNWA 4LXTA 1DTEA 1WE2A 4FX2A 4I1UA 4MCAA 5F73A 3S17J 3W3AH 4A0RA 2B25A 1G7RA 4M1YA 1G6NA 2ZPUA 1GG5A 3EUFA 3L4EA 3EDMA 5JZBA 3BCUA 3IV6A 1VF9A 1FNCA 2DTDA 4FT8A 4NMLA 4UHEA 4BO3A 3J81k 2AZDA 5H20A 1WKBA 3B1WA 2JHCA 1Z16A 3GTMJ 1MX3A 4IHKA 2B1RA 1JHHA 4J2HA 2K4BA 2WKRA 3IUSA 3QWIA 2KZGA 4IOLA 1EH6A 5DGIA 4QE3A 2BZ0A 2DWQA 4I09A 5CURA 5E8GA 2YJGA 4A93J 4R31A 3IB6A 4DDUA 2PNFA 3EW7A 3RK1A 2O8CA 1GPBA 1QPZA 4ERXA 1CWUA 5LDDC 1JGSA 2DA7A 4HPWA 4CM4A 3CD6I 2HPIA 2J3QA 1UBGA 2QLTA 4XQEA 1Z56C 5JNRA 1ZM7A 1OWMA 3OPMA 1JLLA 1CG6A 2I87A 1HQYE 1RKTA 4TMXA 4LG0B 3GGCA 4W5OA 5JPIA 4C07A 1I3LA 3L49A 1ZGCA 1FTWA 1BHO1 4G1BA 2FY8A 3OZVA 1GXQA 3TZCA 5AYVA 2NYVA 2GIZA 3WLJA 1JEOA 1E58A 3LVFO 5JNVA 3UMJA 3C6MA 3K92A 5H1YA 3E9CA 5IAGA 4UVIA 4BLSA 4UBIA 3RE1A 1Z6TA 3GFTA 2ZRIA 4M99A 1G3TA 1XDZA 1E2UA 3LBAA 2HLNA 3BSFA 1ECBA 3OWTA 3ZU4A 3IC5A 3MT0A 3RYCA 1ODKA 2HKXA 2LYCA 4JROA 3K5WA 1UK9A 4Q66C 5BSEA 3CN9A 4HHEA 4PXAA 1RI5A 5J1SB 3PUFA 3JRWA 1M6EX 1ZIOA 2RK6A 4CCOA 3CM0A 4JB0A 4IVNA 3DM9B 1CJKC 1EJBA 1AV6A 4KMUX 3QPLA 4JHLA 3ITDA 2IQ5A 1W35A 1VYHA 3RHSA 2ZAOA 5IH3A 5EWMB 1B76A 4IHTA 1QQ6A 2VPRA 1KKLA 1B43A 4WXCA 1RKVA 3M3HA 3S3TA 4WLNA 4MW6A 3RQ4A 1FU4A 4YR7A 3KSBC 3RU9A 3PGJA 3QRWA 3RWMB 3G89A 3DBLB 4UVAA 3D3WB 2NS0A 4BL0B 4PZJA 2NTJA 4L9NA 4TL8A 1YACA 4IQFA 3HACA 4UUMA 2NLOA 2NV0A 2NVXJ 1I7NA 1GN8A 3SHFA 3FYUB 4Y2GA 1T1EA 1JE1A 3SIPA 4D5FA 4P5DA 2PM8A 2CQXA 4CF4A 2XCRB 4XIDA 4MWSA 3SYMA 4D7MA 5LXTF 1Z33A 4RMHA 4RJTA 5HBRA 3T4XA 2FRDA 3BB1A 3FMPB 1PGJA 1XRRA 1GYQA 2GM5A 2OGZA 2X76A 2B94A 1ORTA 3R5SA 5A6SB 2ZSKA 1NNEA 3JARB 3TLJA 3M0EA 2H0RA 1C7FA 2N1MA 4CQJA 1QH1A 4CM8B 5LMNB 4L0YB 1U1IA 1MV5A 2XQGA 1NXSA 2NU8A 4XIJA 3GVPA 3CCMI 1W1IA 1R23A 4LCEA 4PUSA 2GYYA 5JYCA 5JSHA 4RVGA 3TE6A 1PP4A 4CXFA 4F3RA 3RCBA 1DXQA 3LPAA 5KJCA 2QRZA 4J00A 1TPZA 1VMKA 2O6HA 2EZHA 1P73A 2J9YB 1DJLA 1W36D 5KKCA 4G0ZA 3ZP5A 4EB6B 1C1YA 2XASA 4MVJG 1Z2AA 4RZHA 5JLXA 4FDMA 5FI0B 3S8MA 3L8DA 2ZXEA 1ECJA 4PYRA 5J2UF 2AT1A 4OU0A 1RTKA 1Z17A 2VPPA 1NW7A 4U00A 1JEQB 4YN3A 4G8XA 3FNHA 3SQDA 3FNFA 2X8AA 2ZC2A 1MBEA 1DX9A 2VE9A 2GASA 3STUA 4Y98A 3FF4A 1IM8A 5C34B 3KJEA 4OJNA 1A8SA 1XCBA 1FTTA 3AYZB 2P4QA 4M49A 2ZBDA 3QU7A 4X6AJ 1JUDA 4BDZA 2V3WA 2GS9A 1AQIA 2VK2A 2VA8A 1TVKB 3WL5A 5TEVA 5T4FA 1K9SA 1COWA 4S1TA 3HOYJ 3I1IA 2JASA 3TKAA 1M0WA 2HO5A 3IPCA 5FYQA 1Y6JA 2GXQA 1MJGA 2XBUA 3BXXA 1WMFA 1U0SY 1ESEA 5IARA 2QVCA 3GNQA 1MIJA 3LHDA 4QELA 5E6SB 3LXMA 2IXFA 4PCUA 4MHOA 3W06A 1ZGAA 3EWAA 4A5SA 2W11A 2WAMA 3IQIX 1E0KA 3R8XA 4KQ1A 3EGIA 2FR8C 1FZTA 4PO9A 2DPXA 2ZSBA 4YIHA 3CLRD 4CEHA 4Q9DA 4ZIRB 4XB6B 2ZYSA 2IEYA 5AXDA 1AH2A 1LPBB 1U5TC 2JIPA 4OQLA 4TV8F 2P90A 3R3JA 1HG0A 3CWQA 4KP7A 1CRZA 2DFKB 1U8BA 5L4LA 4C2AA 2KRHA 5SYNA 1HZZC 4TYNA 4PFKA 1J2JA 4WXYB 5I7VA 1ZW6A 2A07F 4P4GA 4CWAA 1ONVA 3KP1A 3W5SA 1ORRA 1HW5A 2R6GA 1Y1QA 3HZJA 2R65A 3F8CA 1OAOC 2CZCA 3AR8A 2X0JA 3DNMA 4TQGA 4WY5A 5EZQA 1CJVC 1GILA 3LPCA 4OU4A 2NADA 4BFCA 2PT5A 2GAIA 2Q3CA 2BIFA 2ERCA 2CUJA 3H13A 4ZHQB 1E7YA 4YRQA 2VUIB 3MBOA 1ZHOA 1CS0A 3O8BA 4YAOA 5BQ5A 3GCDA 4MW5A 3PNBA 3W2VA 1KQGA 1XQYA 1NYTA 3ZNNA 2F1JA 3GFPA 2JFPA 1JKPC 5IT9Z 1OZ0A 2C2BA 3U7IA 2WYVA 5JALA 4DZPA 4HGPA 2VSXA 5GTHC 2Z04A 2AJLI 2DU9A 1ZAOA 2ZJQF 4D92A 2DTRA 3SXJA 4LGYA 3HUEA 1XCGB 2QENA 3K1TA 1Z0UA 1WKVA 1U0FA 5ARBA 4JYAB 2YL2A 4EG8A 1RQ7A 4Q9IA 1Y9DA 2X1LA 1FXWA 3AKZA 4WOPA 2XNDA 3H1GA 3QOPA 1IC8A 1BEZA 1T13A 4YFNF 4O2AA 1CE8A 4WCVA 2ZBFA 4KR6A 2CU7A 2FPIB 2P4SA 1OQYA 1ZQ9A 3ZK8A 1IYZA 4HZUB 3BRQA 7YASA 2FX2A 3KQOA 3ZKAA 2H4JA 1H9TA 1G8PA 1J23A 2YRXA 4GZLA 4B0PA 1VSBA 3HOZJ 1Y8RA 1UDWA 1M72A 1P3DA 2VBYA 2FOWA 1NHAA 3CG4A 1M6WA 1UXOA 4E1VA 4CEIA 3CZCA 3BB3A 1GAQA 1LPOA 4NJEB 2P81A 5AQ1A 1R74A 3WIUA 3MJ4A 3KJGA 4RV4A 4AMZA 3JZIA 2N3ZA 4KO4S 2O48X 3H97A 4GP6A 3WJ2A 5L8VA 4ZVOA 1TL7C 3L7CA 3KSAC 4Q7LA 5B5EC 4KR0A 3HJNA 4RIIA 3P9SA 1CULC 2MIIA 1IG3A 1L4MA 1E3WB 2BGGA 4CG2A 1X19A 3GYHX 1L5LA 4IF4A 5FWXB 1ACLA 1JG6A 2J08A 3C1TA 4MP6A 1SN7A 2DYSH 2WSSA 2RKOA 2J1LA 4BP3A 2ZB9A 1LTKA 1NLUA 3SX0A 3F2VA 1D2HA 2ZKIA 1J49A 2PUTA 2E4YA 4IX7A 2LH9A 1NX9A 3HJBA 4HO1X 3D4OA 1P18A 3FOBA 2RK4A 1ZVQA 1EQUA 4OQDA 5KVRA 2XIJA 3OZIA 5FTLA 4LC1A 5IP9J 4OX9B 1X2EA 3DDOA 3MTBA 1H1DA 1DQYA 3TL4X 1B6RA 1LC0A 4AIRA 3GRVA 3DA8A 2LF8A