1FP2A

Crystal structure analysis of isoflavone o-methyltransferase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
345
structure length
345
Chain Sequence
RKPSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIGNVRRLMRYLAHNGFFEIITKEEESYALTVASELLVRGSDLCLAPMVECVLDPTLSGSYHELKKWIYEEDLTLFGVTLGSGFWDFLDKNPEYNTSFNDAMASDSKLINLALRDCDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVIDKKKDENQVTQIKLLMDVNMACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.
pubmed doi rcsb
source organism Medicago sativa
molecule tags Transferase
molecule keywords ISOFLAVONE O-METHYLTRANSFERASE
total genus 122
structure length 345
sequence length 345
ec nomenclature ec 2.1.1.150: Isoflavone 7-O-methyltransferase.
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fp2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1fp2A02
3KQPA 4I7HA 3HVHA 1BI3A 4EQQA 4XCXA 4PDKA 3DXXA 1AWCA 2OA4A 3GRZA 4CTKA 3EVDA 1JG3A 3EEOA 1HKQA 3C3PA 1FC3A 2FMYA 3DXJF 3H2BA 5JI6A 4RV9A 3DH0A 1P92A 3UJ7A 3FMRA 1B4AA 3GRUA 5D8LB 2GXGA 2VOOA 1S6LA 3EVCA 4KIBA 1Z7UA 5FTWA 1T2KA 4TV7A 2QUFA 5FLXK 3GFLA 1N7IA 1K79A 2DI3A 3GLXA 2FBKA 1LDJA 1B9MA 5TRDA 1X1DA 3PVCA 4KW7A 2ZIGA 3KCCA 5D4SA 1TQPA 1U6GA 1KQ0A 2DTRA 4LK1F 4R8RA 5F64A 1IXCA 5BP7A 4PINA 1YS6A 1H1DA 3FTCA 4GYGA 5E20A 1YTYA 2XAHA 1IAWA 1PRYA 5BS6A 2E5WA 3LPMA 1G8AA 1HW5A 2PWYA 3CTAA 5B1SA 5F1RA 2ACJA 4IRIA 2WA2A 5K1YA 5GP1A 2XVAA 2STTA 1RI2A 2YXLA 1R1UA 5LHGA 3JWGA 4RGRA 4DCMA 1K78A 1KU7A 5IT3A 5DTMA 2A3SA 1R5GA 3R24A 3BY6A 3H3UA 3FMQA 5HLHA 2WWYA 4A6EA 4ER3A 3I0TA 3M9AA 4KWCA 4KMUX 4ISCA 3KETA 1Z3CA 1WZNA 3RKWA 2G7HA 3SXYA 1I4WA 2ZTHA 2LD4A 1WI9A 2QBYA 3P9CA 2BEOA 5DCMB 3SGLA 1MJFA 2NYUA 2X4HA 5E8RA 4WVLA 3SQNA 5CYVA 3QU6A 3M1EA 5ED4A 4FT2A 2V1XA 3PFIA 2IJLA 4AZVA 4EM1A 2H6BA 2FNAA 2HKXA 3KPWA 3SSOA 3TO6A 5EEHA 1T98A 3DMHA 3DULA 3ABUA 2F5CA 1BJAA 3GJYA 3OCJA 1JSXA 4BXUA 2R6ZA 4LGWA 5HVQC 1J7KA 3U2RA 2PQ8A 3UJBA 2ADUA 5E2BA 3WE3A 2UXXA 3DLIA 1PP7U 5HZMA 4DA4A 3C18A 5F2OA 3SX0A 2EFJA 1FNNA 1XCLA 1NV9A 2OQGA 4LLGF 3CUQC 1P1BA 1YIOA 3U1DA 4GOLD 4P96A 4QQNA 1ZG3A 4HF0A 3R9XB 1AOYA 3DFGA 2NAZA 3G2OA 4BYYA 1R5HA 1BI0A 2ZO4A 1D2CA 2HQNA 2HZTA 5EMJA 3G8AA 3D0SA 1FSHA 1EG2A 5HLGA 1LJ9A 3TMAA 3RTRA 1G4DA 5JR3A 5H6QA 1NE2A 4MHTA 5EIWA 2ZBPA 1G3TA 4M9ZA 5LRRA 4EJVA 5LEKA 2QY6A 5JUWA 1QNTA 3R60A 1NW7A 2PN6A 4HV5A 2JH9A 2DU9A 3AXTA 4OX9Y 1UIRA 5EKUA 2GA1A 3NWEA 3VC1A 4E70A 1FP2A 1O9HA 3K1PA 2PLWA 2P41A 3SHFA 2FRXA 4KDPA 3VB2A 2OXTA 1BC8C 4E2ZA 5KVRA 3WSTA 2M87A 1JQ3A 1ON2A 5LQCA 2KW5A 5K0BA 1J9IA 1FYLA 1STZA 1L3BA 5K0JA 1F3LA 4RTMA 5J8FA 4N9HA 4Y17A 3EVZA 4P7FA 4WCGA 1USTA 2DPUA 2HMYB 3SSMA 4DMGA 2IA0A 5DXAA 10MHA 5MHTA 2IT0A 2B9EA 5FUBA 1SD4A 4KT5C 2FEZA 2JG3A 3UZUA 1W7PB 2KJCA 1EIZA 3VC2A 1SQFA 1WXWA 3LCVB 5F2KA 4XLNF 1L1EA 1BOAA 4ER6A 3NJRA 2A14A 5FHRA 4CYDA 3B73A 2XHKA 1X19A 2ZZMA 2NNWB 4OIRF 3ZMSA 1G38A 1EQAA 3AWIA 2V1DA 2HYFA 4HF1A 3FXUA 3BGDA 2H6CA 2EFNA 3ER9A 4OMZA 3VFZA 5J8CA 4WXHA 4ETSA 1EJ0A 3CO6C 2AS0A 4ZTBA 1AV6A 1BI2A 1TW3A 4A12A 2UZ4A 5HIJA 3WODF 4MQVA 1HSJA 5ICEA 4PYIA 3D5LA 1KYZA 2R7FA 4UUVA 3G7UA 3LBYA 4RVFA 4Y15A 3T7TA 5E9QA 3BKWA 3PLAE 4XLPF 2EB7A 2K7LA 4UV8A 1DCTA 2FXAA 3CGGA 4HX8A 5GM2A 4OU0A 2Q2EA 5LQKA 2P4WA 4AD9A 4IHTA 1B59A 2LNBA 2ELHA 1L9KA 4CDGA 3DMGA 2BR4A 2PX2A 4L5IA 4ASNA 3AXSA 3HCDA 4HG2A 2DLLA 3EGEA 2BR3A 3GXOA 4PYNA 4QLCU 1VP3A 4IV0A 3KR1A 5CCXA 1V4RA 2EFWA 1BKYA 5EPEA 4KIGA 4A0ZA 2IA1A 1E2XA 3TO7A 2N47A 3M6UA 3FUVA 5E1DA 4FP9A 5CM2Z 1XGMA 4E30A 5K5QA 1ULYA 3G2QA 5GIOE 1IUYA 5K09A 7MHTA 4YIFA 5IT9K 3UJ8A 2QQ9A 3BZ6A 1ZRDA 3E8SA 2YR0A 4RWZA 4ZZLA 2VT3A 5TJJA 4Q4ZF 2HKOA 1SD6A 4ZZDA 1XSDA 3OZRA 4FHTA 2H94A 4PGGA 4ER7A 1P1CA 2O61A 1SUIA 3TM5A 5D8KB 2PT6A 5DTQA 1YFHA 3ZPLA 3FXQA 2DAOA 3CO7C 2V7EA 1FWZA 4GO1A 1LEAA 3E3VA 3BWMA 3HVKA 2UYOA 3EVFA 3BWGA 2A5YB 1PUEE 3R4KA 4AIJA 1OYYA 3FPJA 3SM3A 2EV0A 4GBED 4S05A 2ZVJA 3V8JA 5FFZA 4HRAA 4LECA 3F23A 4O6JA 3F8NA 5CUQA 2GAFA 3FUXA 3V8LA 3WU1B 4GUAA 5DYMA 5ERGB 2IH4A 1O3SA 4P9FA 3IEIA 3WG9A 2MH9A 4C05A 3IC7A 4IHSA 3TR6A 2ZLBA 1ZRFA 3P71T 1R23A 3V7CA 1P91A 5FFXA 2PV0A 1FPQA 4RTRA 1DDNA 4A5NA 1XDZA 2LDUA 3TOBA 4HX4A 4E2WA 4UVBA 4A6DA 2DO7A 1HNNA 5LQAA 1QBJA 4LMYA 3V7RA 2P6SA 3TKYA 1FYKA 5FADA 2CL5A 4FR0A 5HEKA 2C7OA 2F8LA 3C6KA 4HF2A 1U5TC 1BIAA 3LCUA 2RGVA 5E8JA 1SG9A 2QQAA 5FA5A 4BLWA 1P2FA 3P2KA 4RAYA 1MJBA 4U88A 4MNUA 3UBTA 2HEOA 4EJWA 4MTEA 2VZ9A 1XN7A 2YX1A 3DLCA 2GA2A 2EJTA 3TKAA 1I9GA 1HKSA 4E2XA 2PWPA 1BN5A 3K9TA 2OB1A 1D5VA 2FYTA 3ML6A 2OKCA 1ZAOA 2Y0MA 3FHZA 3TOAA 2O3FA 2IBTA 4AX8A 2IRFG 4RTPA 2NP6A 3WU0A 3IHUA 2DT5A 2DPDA 4RB2C 1O3RA 3PX3A 1HSTA 1C0WA 3T5XA 2HV9A 5E9JA 4HOBA 5JFRA 3QU3A 1BC5A 3TFWA 4X61A 1QYRA 1GHCA 4E2YA 5C9ZA 5DUIA 3DPTA 3P2EA 4IXAA 4WK8F 2FA5A 1TNSA 4LB6B 2AOTA 3T0IA 1IN7A 1FYMA 2ZBKA 3ZMTA 4NQWA 1IY9A 3CKKA 2Z6AA 1UHWA 2ZXJA 5JVTA 4LJZF 2VODA 3OZSA 3EYYA 5KS2A 5IT9Z 3IRRA 2RC4A 4LK0F 2ZBQA 4KMFA 4FS8A 3V7SA 3ANXA 1DPUA 1XDUA 2EFOA 5LGNA 3THRA 2VDWA 4G94A 2P5VA 3HTSB 2D1HA 1XSXA 3A4TA 5E1WA 2PSSA 4S04A 3E05A 2XIGA 5EG5A 1X1BA 4RTNA 4I2OA 4AVPA 3I59B 5U4XA 4M6YA 2H09A 3F3XA 3NEUA 5L3FA 1B9NA 2W57A 4WF2A 5D1HA 3HM2A 4PYOA 4RB3C 4ER5A 1L3IA 3P97A 4ATNA 3RI4A 1K6OA 3EVEA 1DUSA 1RI4A 4LG0A 1KIAA 1L3LA 3C3YA 4R05A 1KPGA 4C4AA 2VBXA 4XUEA 1ZREA 6PAXA 4Q5SF 1UHMA 1ZLJA 3ELYA 1SD7A 3T8TA 3I9FA 1S7OA 3LBFA 2QLZA 4R1HA 4EJOA 2VP3A 4I09A 4EK9A 3HOTA 3OU6A 5M5BA 4OIQF 2VC1A 4L9TA 2C7RA 2PEXA 2EG5A 1F9NA 3UA3A 2E1CA 3FPEA 4HDVA 4Q48A 3QP5A 2V1UA 2P3LA 1TBXA 3WTSC 3E6BA 2FSWA 3KPYA 1KPIA 2GA9A 1JE8A 1R7JA 3V97A 4G6QA 2P40A 2QRVA 4YV1A 4AIKA 4O3MA 3M8FA 4QWQA 4IPAA 3QPHA 1SKMA 1R1TA 4QPPA 1G8SA 1WRJA 2DFIA 5GINE 2IPXA 1PP8F 2VXZA 2W25A 3NQOA 1O7LA 5CD1A 5BW4A 4G7OF 4E33A 5BXYA 3TO9A 2RNJA 3B02A 4KDRA 4RVGA 5EHGA 3QPTA 2ZJ2A 3B3JA 2NXCA 3I59A 1DP7P 4LLLA 3I54A 2L4MA 1JG2A 2E1NA 4KIFA 3GGDA 3QP6A 3R0AA 5FD5A 3CDHA 2IFTA 4YFNF 1SAXA 3S68A 5DUKA 4M74A 3CVOA 3LHDA 5F6FA 5T6BA 4KICA 3KLOA 2OAZA 3TGNA 3FZVA 4YV0A 5K01A 4XUCA 4F7ZA 3O6BB 3IWFA 1JR4A 1VQ1A 5F2NA 2G72A 4FZVA 3M6VA 3G88A 2BGCA 1XJ5A 2ZBRA 1TNTA 3Q7EA 3J81K 2CW0F 3C1DA 1R74A 2VS1A 4RTOA 2P35A 1JQEA 2FOKA 1FBNA 2M45A 2Z99A 5DV5A 2G8NA 1QO0D 1VP9A 1F5TA 3E97A 3GU3A 3DUWA 3JAMK 4P9UA 2DPMA 2BM9A 3GIWA 1G3YA 2AN4A 1G60A 4YIIA 1S29A 1Z1DA 3CBGA 3O4FA 4CKEA 1ZARA 5HDKA 3W6JB 4PCAA 1KU9A 3DPLC 2I62A 3KQOA 4IJAA 1TPYA 1RUOA 1X3UA 3C7JA 3FXRA 2FBIA 2HQRA 2GLUA 3BUSA 2CMGA 2PXCA 1G3WA 1KQ9A 2O0YA 2DULA 3ELWA 3V8KA 4X41A 5CVVA 5K0LA 3AY0A 3R3HA 4I01A 2JJQA 1X1CA 3JWJA 3CUOA 5D5WB 1U5TA 3LAJA 1R18A 5JHUA 1FSEA 3OE5A 3GX4X 1NW5A 2Z3YA 5HS8A 3T1BA 2BE5F 2GXBA 5EZQA 5K0FA 3TRKA 2ISYA 5ILSA 4GXOA 1XVAA 2O05A 2YXDA 2QRVB 3OZTA 1EV7A 2GWRA 3GZ5A 4NHJA 2MA3A 4BH9A 4AZSA 4HTFA 1XXLA 2UYQA 3FTFA 3ORHA 2ADMA 2MD5A 4WWCA 1UCRA 5D5UB 3FUUA 3HTUA 4H0NA 1LDKB 3HSFA 2QVOA 5HILA 2PBFA 1G6Q1 2E7WA 2OBPA 2O03A 1YZHA 3KU1A 5HIMA 1IN5A 2EA2A 5L3GA 2GH1A 2VONA 2NYXA 2XYQA 4UHTA 3GF2A 4ENNA 4G7HF 3Q9VA 2OB2A 3BDDA 2ESNA 4O29A 4QVKA 3BZBA 1ZLKA 1U5TB 4IVNA 1I5ZA 2Q0OA 2FCAA 4C04A 3QAHA 4U0VA 5BW5A 1G6NA 2K4JA 3IKTA 4ESBA 3MZHA 3E7PA 5DCFA 1YUBA 4PNEA 2RDPA 4M37A 1P4AA 2PG4A 2QBYB 4KFCA 4YFKF 2DK8A 5K0CA 3BJOA 1KGSA 3OU7A 5H6RA 5DX1A 3IWZA 3L9FA 2UYHA 5EMMA 1IXRC 2J5OA 4JBAA 1ORHA 4MGRA 4DKJA 3COAC 3PT9A 4GCVA 5KYGA 2AOVA 3GFJA 3HIFA 2I6GA 2YXEA 3M6XA 1JTEA 4HW0A 4RAZA 3PS9A 1YW9A 2WA1A 3NWBA 2D45A 2FU4A 3R0JA 1IF1A 1N7JA 5GOZA 3WTYC 5CIYA 1TQIA 1DUXC 2HYGD 4U0WA 2AOXA 4OMYA 3F6VA 1LEBA 2GB4A 2AOTB 4OA5A 4ON0A 4AIHA 1W4MA 2NNYA 3GEZA 4A2UA 2AVNA 3LSTA 2H27A 3GCZA 2EWNA 3EDPA 4KDCA 1IXKA 3R6SA 1LB2A 3TM4A 4MTDA 3LWFA 2C7PA 5DRTA 4GGGA 3M6WA 3K0LA 1S3JA 4HZFA 4U7DA 2XKPA 5D5XB 2ETHA 3F8FA 3J7AO 3A26A 2AZTA 2JRTA 5FA8A 2A61A 2ZFWA 5FD6A 3SVZA 4U7TB 2O07A 4D0PA 4EV0A 2PJPA 3T0YA 4KN4X 2XROA 2L02A 2ZIFA 4K6MA 4RS8A 3FTDA 3KQQA 4KRGA 4HH4A 3CLOA 5D5VB 3IV6A 5FQNA 3G89A 3R61A 2RKHA 2L4AA 1J0RA 1RNLA 2W84A 3WTWC 4PYJA 1KPHA 3LDUA 3AAFA 3LAPA 3ZMZA 1JXSA 4IKPA 3F8BA 5CLSA 2DQLA 3O7WA 5EZSA 5E1BA 4I02A 3ME5A 4BHCA 1Q0SA 1OKRA 2FF4A 4EMSA 2ISZA 3B3GA 4G56A 5DPMA 3MQ0A 2TDXA 3PQKA 3GUDA 2NP7A 3UJ9A 2CQKA 3T7SA 1CF7A 3AJDA 4YUZA 4LD5A 4NECA 2C7QA 4AZTA 1EH6A 3EMDA 4R6XA 3P2IA 4FT8A 4GC5A 3HHGA 4X63A 2CSOA 4GOMD 4BQAA 3BP8A 3PB3A 2VT2A 2HDCA 4L18B 2YVLA 2ONZA 2G7UA 4EJUA 3OFJA 3K69A 2JHPA 4KN7X 3NVMB 1YW8A 1G3SA 4M7RA 1R36A 1O3QA 5DX0A 3GYHX 1P6RA 1H9TA 3HRSA 2ZZKA 1YO5C 5K5OA 3KP2A 4YUXA 3LDGA 3C0KA 3RPQA 1MHTA 4K2EA 2OY0A 2O6GE 3I58A 2F5EA 1ZYRF 1D2GA 1ZGAA 2ZWAA 2GS9A 4EVIA 1INLA 1KQ8A 3EQLF 2ERCA 1OYWA 1NBHA 2JT1A 5FULA 2L54A 3TDZC 3KZYA 2CWWA 2AVDA 2VOPA 1L0OC 3ZMUA 2YPRA 3EMBA 5L3EA 5DD4A 2JH8A 3K0BA 2QYOA 1IN8A 4RTKA 1O3TA 3BOQA 3MTIA 4EM2A 2CYYA 2EV6A 1JGSA 4HGYA 5FHQA 1Y0UA 3M33A 2EA4A 4HDUA 3NTVA 4O5VA 1OMIA 3EGIA 3LKZA 5E1OA 4HA8A 2PGXA 1EJ6A 4CKBA 1REPC 3OE4A 2COMA 4MWZA 5GWXA 2LKPA 3UWPA 4IRGA 3FPFA 3HRTA 3SR4A 5DLYA 3CJTA 2Q8KA 5IH3A 3CUQB 2KJBA 5K0NA 4MEYF 2FBHA 3MAJA 2BR5A 3BT7A 4KYWA 1AQJA 2G70A 2EK5A 3T8RA 3BWBA 4ENMA 1RI1A 3UA4A 3O3KA 4OIOF 1G55A 3OFKA 3EEYA 1RJEA 2ESHA 3JTHA 1K78B 5KQSA 5DDGA 1Y8CA 3LA2A 5KQRA 1R6AA 2XASA 2W85A 3HRUA 2DK5A 2NXJA 4V0RA 3TOSA 3G73A 2BYVE 1QAQA 2PVCA 1IN6A 3JSOA 1RI7A 2HNKA 2G1PA 3IHTA 1QZYA 3HCFA 1B42A 1QPMA 3ULQB 5FO5A 3HNRA 2IH5A 2QWWA 1SMYF 1YFJA 1QAMA 1FBSA 2A6HF 3TLJA 2K4BA 4PIMA 4H0EA 3R6TA 4FSXA 1T38A 2YX7A 4DM3A 1FBUA 2XUBA 2B0LA 3FWEA 1BBYA 3KP6A 4CXFA 1MDMA 4M36A 3A7EA 4OA8A 2K86A 5HIKA 2OD5A 2YR2A 3FX3A 2GIVA 4HYEA 4F84A 3P9IA 3FUWA 4MHGA 1UFMA 2HOEA 5HLIA 3GNLA 2STWA 4HLYA 1D8JA 4OBWA 4PWYA 1RZ4A 4IV8A 4ZYEA 5LEJA 1VE3A 5DM2A 1WSUA 2IDKA 1BC7C 3EPPA 1SFXA 3A27A 4Y13A 2XYRA 2PMUA 1X1AA 1OYIA 3ROUA 3K1MA 4L0ZB 1XGSA 1J2XA 4HC4A 2GQQA 2YU3A 1NV8A 3M4XA 5K5RA 3KKZA 4R8SA 3BJ6A 2VBZA 3EVBA 1D2HA 1WS6A 2YUIA 3N97A 3K2ZA 1GVJA 5LQNA 2PKWA 3KP4A 2IIPA 3O2PE 3KE2A 5FQOA 3KZZA 3LQQA 3GRYA 4PYKA 1MJ9A 5BPDA 1JQDA 4RYLA 3C3WA 3BJAA 5L3BA 4RTJA 3Q87B 4P55A 2L01A 2PY6A 3DTNA 3EGVA 2ZIEA 3HA3A 3DV8A 5K8VA 2F2EA 2NXEA 2QM3A 3KPUA 2EFPA 3QV2A 3HP7A 3H92A 4PCQA 2UYCA 1MGTA 2P7VB 2CO5A 1KR5A 5GIPE 3FF5A 4KVZA 4P58A 2YSRA 4B17A 2I9KA 1B1BA 2KIFA 2HS5A 3FRIA 2G9WA 2AOUB 3G8BA 3CJRA 3NDIA 1F1ZA 2IVMA 4A0YA 3SSNA 5FGMA 2D1VA 3KP7A 2B2CA 1FZPB 2FE3A 4I0BA 4LWOA 3WTUC 4UXNA 2BZGA 3GW2A 4FX0A 4GOOD 1MDMB 3JSPA 2P6TA 2Z6UA 4MQ4A 3I71A 3OU2A 1OR7A 3LA7A 3R0QA 1XCBA 5DM4A 1ZRCA 4AZWA 3FYDA 2P7HA 1GXPA 3MFKA 2IH2A 2XRNA 1YG2A 4L9NA 1R8YA 4A5MA 3IL2A 3BXOA 1KXZA 3FMSA 1VLMA 3HSEA 4JK1X 4YUVA 3OPNA 4AUKA 1Z9CA 1HQCA 3HHHA 1VPTA 1V3FA 1Q1HA 1HW1A 3ZMVA 5CVDA 2IDJA 2JHAA 3FZGA 3U81A 3TQSA 5C0OE 1W7PD 4OQDA 2PFBA 2XYVA 5DTRA 5CCBA 1Z05A 1T6SA 3EUHA 3W6KB 4FSDA 1WY7A 3WGGA 3M70A 1D3YA 2V6CA 3CUQA 3I5UA 4IF4A 4GEKA 3EVGA 5LSAA 4QVGA 4RTLA 5K0GA 1YLFA 4OBXA 2AN5A 4BNCA 4YV2A 5P8WA 2F5FA 2HR1A 2GAUA 4MQ9F 5HS9A 1P4XA 4C03A 3UFBA 1UB9A 2ZFUA 3PX2A 3SXJA 2F5DA 4BHBA 1I6XA 4M9XA 1U78A 1QGPA 3ECHA 4KNYA 4DZRA 3ER8A 5EC8A 3JTGA 2VDUE 3DOUA 4CGZA 3KPVA 5DM1A 2FK7A 5K0EA 1VIDA 4MIKA 3E5XA 2W24A 3HTXA 2OZUA 4M6XA 1WKMA 3REOA 2AOWA 3G5TA 3ELKA 3M8EA 3K6RA 5E1ZB 2FK8A 4XBFA 1YQAA 4QDJA 2ONYA 3ID6C 4OOIA 1O57A 2V79A 4HQEA 3ELDA 3ZP5A 4RB0A 4KA4A 1U2ZA 4HTFB 3MWMA 1RI3A 5T64A 1XDSA 2ESRA 1BI1A 4CXMA 3VEPA 4LG1A 2CGPA 2BBYA 2EX4A 3RIEA 3B5IA 4RSRA 1R1VA 2YTZA 4NB5A 5BOXA 1EH7A 2B3TA 1HXDA 3B3FA 3NW9A 3X0DA 3L09A 8MHTA 2XAFA 4UV9A 1JG4A 4M9SA 1SFUA 1DL5A 3ELUA 3G3ZA 2XAJA 3P9NA 5AONA 2A07F 5BQTA 1JSZA 2IPQX 3IRQA 3KQSA 4CKCA 3I4PA 2Y1XA 4XSZF 5EMKA 2FPOA 2M1BA 1R58A 3DMFA 4A0XA 2V9VA 1IN4A 2K02A 4M72A 1RJFA 4FX4A 3KR9A 5HDNA 4X1OA 2P7CB 3F8CA 2B25A 2Z5UA 1SUSA 4PIPA 1R22A 1M0EA 1ODDA 1E17A 2CFXA 3HA7A 4HAMA 2VBWA 5LQUA 3WTVC 1IRGA 1IM8A 5BMZA 5H02A 1LVAA 3LECA 3KQTA 1BIBA 2IP2A 2HGCA 1RUNA 4G7ZF 3MQ2A 2A68F 4RB1A 2OO3A 3N4MA 4RVHA 1KA8A 3TQNA 3JWHA 1SVUA 1U2WA 4OINF 5E8IA 2PMHA 3WTTC 1R00A 2RV8A 1Z6RA 4LB5A 1WQ2A 2MLKA 3P9KA 1WG8A 3L7WA 3Q9SA 3LCCA 1QAOA 1FLIA 4CTJA 3FTEA 4HQMA 2IA2A 1O7FA 2HTSA 4M71A 2RQPA 1NW3A 2MBFA 5EQJB 5E17F 4L5JA 3VODA 1FOKA 4FGZA 3FPGA 4BY9E 3BGVA 4OQEA 2XAQA 2NXNA 2Z6QA 3IKVA 2PJDA 4ER0A 3MCTA 2MH2A 4CZZA 5HOOA 4YUWA 3E6MA 1JHHA 2QZ8A 3HA5A 2O0LA 4I0AA 4HV6A 4GOND 1SQGA 5DXJA 4HX7A 5ILUA 3G5LA 4RX1A 1I1GA 5A2QZ 1ZN2A 4HSGA 4EKGA 1GXQA 4ESJA 1AQIA 2PI0A 1PJZA 4UVCA 4PYLA 1IRFA 3B89A 1NHAA 3MB5A 1BM9A 1WWXA 1J5YA 2PXXA 5D6EA 4GYIA 4CO8A 5FLXZ 2JSCA 1RIOH 1Q0TA 3GZ6A 2P3OA 4EM0B 3F6OA 4L7VA 2O8XA 4IRHA 1W5TA 3WTXC 1ZG5A 3GDHA 3KQVA 2ZKZA 3BPVA 1MD0A 5FCDA 2UXNA 5L3CA 4E32A 4ZYDA 5LGTA 5EVJA 1LDDA 1LNWA 4P7JA 3HUGA 2WTEA 2HWVA 2Y75A 1UWVA 2OPBA 2P5KA 2M5WA 3KQWA 2PX5A 3DXYA 4QTTB 5LR6A 2NS0A 4WX9A 1UFKA 1VBFA 1TLHB 3DQVC 4GQBA 3PFGA 3RJPA 4EGZA 3DP7A 4LFUA 5KK1A 3Q5FA 2VC0A 1NKVA 1XMAA 4PONA 4Z2YA 1Z6TA 2Z33A 2L3DA 4CHUA 4PCLA 1HBXG 3RIRA 4HGZA 2YQZA 3G2MA 4QDKA 2ZZNA 3J80Z 1N2XA 4JXJA 2WC2A 5CVEA 2XV4S 2H11A 1J59A 3FUTA 4EKIA 4MEXF 2XVCA 4QPNA 3MEXA 2J5PA 4F85A 2H1RA 2AXLA 2ZNYA 5DRYA 5LGUA 2CKDA 2E7XA 1BOOA 3MERA 4BLUA 3B7PA 2AS5F 1I27A 1KU3A 3UJ6A 5L3DA 1U3EM 3FM3A 1HKTA 3MZYA 4PZJA 3DEUA 2EJUA 3HVIA 3T7RA 5DT2A 2GZWA 3EYIA 2CG4A 2VDVE 2RN7A 2IW5A 3HCEA 2QQBA 4YUYA 1QANA 4ENJA 3HOSA 4BAYA 2LSOA 2HFHA 5DSXA 4HBLA 2EFQA 1LQ1A 4RGUA 3HEMA 1RJGA 5DM0A 4EGYA 1FBQA 4DNCA 4LLNA 3ZN1A 3FYCA 5FWDA 3ERED 1EAMA 3KFWX 2ZWVA 4V0QA 3G2PA 1YF3A 1MZBA 3RPUA 2FMLA 2KRFA 2AR0A 3V8VA 2X0LA 4DF3A 3KQMA 2VBYA 3RW9A 1ONVA 3EETA 2P7IA 5E9WA 1M6EX 3UJDA 4YMGA 2D2WA 3E5QA 2OYRA 1XGOA 1JHFA 2P1DA 5ICGA 4N0BA 1NW6A 2ZMEA 4ZYGA 1S8NA 4DQ2A 1J75A 5EMLA 4QTUB 1L3CA 1R8XA 1PDNC 3LFKA 1IZ1A 1I1NA 2LF8A 3ZMDA 4BP3A 4X60A 2RVCA 3D2LA 3KR2A 4PYQA 5G02A 2WV0A 4U0YA 3KEOA 3F8MA 1ZH5A 3LGAA 1XMKA 2M8EA 5ERIA 3GO4A 3ZQ7A 2P5LC 4ESFA 3MAGA 2KIMA 2ZNZA 2LF7A 3S2WA 1T39A 2PBIA 2P3QA 4RVDA 5DEQA 2K4MA 3HCBA 4MTLA 4Q47A 1KYWA 1ZG1A 1YW7A 1O9GA 3BWCA 5CVJA 1JTFA 1FX7A 5EKXA 3J81Z 4G9YA 4N9IA 2ZSUA 3SFZA 3JWIA 3F22A 2A6EF 3K1NA 3FPHA 4POOA 3PQJA 3NMUF 5EGSA 2QENA 3CJQA 1OR8A 1M6YA 2DW4A 3GRVA 3FM5A 3SZTA 3KP5A 4ZYHA 1T43A 2Y1WA 1RJDA 3E23A 2DBBA 3E6DA 3ZN0A 3ECOA 3ISPA 3SMQA 3JW4A 1HW2A 2M30A 5D4RA 4RGXA 3RODA 2ZCWA 4B8XA 3F72A 1YZ3A 4AWXB 2HR3A 5EOVA 3GO5A 2O57A 1FJXA 3GRRA 3GFIA 2K27A 3LX6A 2CWEA 3P8ZA 2JPCA 2G71A 2KIUA 2Z9OA 1U8RA 3L2CA 5A2QK 1NW8A 5C1IA 1XSVA 5DD8A 5ICCA 1EH8A 3CCFA 4C08A 1FY7A 4OIPF 1CGPA 1MKMA 3KLNA 3NVKI 1QQIA 3PTAA 4C06A 4Y30A 3E6CC 1VL5A 3HCAA 1TTYA 4EQZA 2KKOA 2OQRA 4B09A 3TDUC 4CICA 4R6WA 4R8HA 3WGHA 1A04A 4C07A 4CWAA 2VE8A 5DSTA 3M7GA 1MJAA 4XRFA 5LLQA 3JAMZ 3QOXA 3A7DA 3I53A 3U9GA 1USSA 2Q41A 3MGGA 2I7CA 1DPRA 5GM1A 5EEGA 4YMHA 3NRVA 1ZHFA 3F21A 1SMTA 1XTPA 2JHCA 5K05A 1O54A 3DF8A 2FNPA 3MCZA 5EHIA 4UNOA 2B78A 4E31A 2OZVA 4GC9A 3KPJA 3KHKA 5E8GA 3RDIA 5KVAA 1BHJA 1I1SA 2JPBA 2MC3A 4DQ0A 2ORED 5DCMA 1ZGJA 5HS7A 4RGSA 2BH2A 2XKOA 4L9JA 1XCVA 2H00A 3ERCA 1JG1A 2PT9A 3H3ZA 2OBFA 5FB2A 2NNNA 4RTSA 1XD7A 3KR0A 4M73A 5LHIA 1KHHA 1TQMA 5AIPA 3RYRA 2DQRA 3WGIA 1Z91A 1YYVA 4IWNA 3MHTA 3HVJA 3WE2A 3BKXA 5T67A 3I64A 2XAGA 1V39A 3EVAA 3DR5A 5D1NA 4BHPA 5AIQA 1ZKDA 2R7DA 5EIFA 3KP3A 3BWYA 3DXZA 3KQYA 5CJ9A 5IKMA 3L00A 2P8TA 1XCJA 1YS7A 3QOPA 2OZ6A 2ZCJA 4GF5A 2OU2A 1RI5A 2WK1A 1AF7A 1SD5A 2BM8A 4XSXF 2ZW9A 2ZULA 3GFMA 4HLXA 1F4KA 2UWMA 4U7PB 5CVRA 5E1XA 3VYWA 1TW2A 1VTNC 2JZYA 5CVIA 1YFLA 1XB4A 3RKYA 5ILVA 4QQKA 3RKXA 3BROA 5LQRA 4WXDA 2VN2A 2GPYA 2R3SA 1FP1D 4Y2HA 4BP1A 2FHPA 5LQJA 4BLVA 2PXAA 1P4WA 2ZMEB 4FT4A 4M38A 2BV6A 1HMYA 2FQ3A 1OPCA 3F4KA 1XGNA 4UOEA 1FT9A 2CMHA 1IW7F 2XVMA 1P39A 4ENKA 3NDJA 4G6DA 3MTEA 3FRHA 3C6MA 3RYPA 1H0MA 1H9GA 5BPIA 1K7AA 2IBSA 2XBMA 4XUDA 4UVAA 5H20A 3HRMA 2YX4A 4U7BA 1W7PA 2IGTA 3QRFF 2AN3A 1S7AA 4PGHA 3P7NA 4P7GA 1SFEA 1QZZA 3LQRA 3ABTA 2C6YA 4ZH4F 5E1MA 4R79A 3HSRA 1ORIA 3L8DA 5HDGA 5DWQA 4I98B 5DX8A 2QE6A 4KUMA 4F86A 2FRHA 3PFHA 2PX8A 4YG2F 3LDFA 4PYMA 2UZKA 2NRAC 1D8KA 5FWAA 5D6FA 3BPXA 3OV8A 3LA3A 2JTVA 1ON1A 2A69F 4YFXF 5HOQA 3OOPA 9MHTA 1ZQ9A 5K03A 3VOEA 1NBIA 1T0FA 2HWKA 3QOWA 5HFJA 4JQFA 2AOUA 3A25A 1NT2A 3UJCA 2PX4A 2O06A 1B6AA 3LKDA 3VSEA 1F38A 2PLYA 2VE9A 3IYLW 2V74B 3BGIA 2P8JA 1YB2A 3UJAA 1IXSB 3V4GA 4RTQA 2HTEA 4L9VA 4WXCA 4L0YB 3DKWA 3TPZA 1W5SA 3J80K 3HCCA 4LG0B 4EJTA 2EJRA 5CVUA 3LL7A 3O31A 4P5OA 4G8XA 1KP9A 3E5UA 4DCGA 5ICFA 2Y48A 5E2AA 2EV5A 2HTJA 3SZPA 5E18F 4P7KA 3WTZA 3HYIA 5LBQA 5J6XA 1WXXA 5LHHA 5LRSA 2XGXA 3THSA 1CF7B 3GVAA 2MLGA 1KU2A 3GWZA 3KEQA 3CC8A 3CJNA 4LWPA 5HIIA
chains in the Genus database with same CATH superfamily
1PF7E 1W8IA 1E62A 1GNRA 2A2ZA 2AD5A 3HVHA 2B83A 4R9NA 2ETXA 2WAEA 4KOEC 2YMQA 3U62A 4FKMA 1Z21A 3ZV5A 2ZJ8A 5A1TA 1DQZA 3HGGA 3SQDA 4URVR 2QSYA 4B6GA 1GGMA 3EVDA 2WG0A 1JJAA 1RYZA 3B3AA 3I2FA 5JHHB 1NPDA 2FWIA 2V9CA 5IW8A 5MGNA 1Z0IA 4LV6A 1EVEA 1IOLA 4H7HA 4HPJB 4IIUA 3DXJF 1PV2A 3MQ4A 4YALA 5JI6A 1H8HA 2VH1A 5IANA 2X76A 3NHUA 1NJ8A 4XM0A 2RJNA 2SBTA 1P92A 3UJ7A 2G9QA 4COKA 4JI4B 3ABIA 2H06A 5D8LB 1C8LA 1JJ7A 3BDIA 3R23A 5JT1A 1DWOA 1FDRA 5NLLA 3MFYA 4XZ3A 1GPBA 4YC7A 5EWMB 4W5NA 4KIBA 1NXPA 1ZGWA 2ME0A 2P6MA 4B7XA 4KXMA 2QUFA 5FLXK 1W36C 2VHZA 4CEIB 3FE2A 4EX7A 2HA3A 3C1TA 3W2WA 2VH5R 4WFQA 4CGYA 3H86A 4W9MC 3E6AA 5TPWA 2DI3A 3R7DA 3W4IA 3E9ZA 2XSZD 4R8VA 2XIQA 3RJTA 4Q3LA 4KW7A 4GRIA 2AMFA 3RJZA 3SDZA 3KCCA 2OXFA 4IJKA 2QSHX 4BJHB 2DTRA 5DM60 4J1NA 2CLHB 3JQGB 2JCYA 3IUBA 3PR1A 1IXCA 4JB8A 3B52X 3RVNA 4QXMA 1W4BA 1JFRA 3QJYA 1H1DA 1P6QA 2COKA 2YOGA 3BXGA 3C1UA 4GYGA 4CKBB 4OI1A 3KVVA 3E5MA 2DFKB 4MSUA 3QPBA 5H3LA 4GLJA 2C03A 4M1QA 3HB9A 1YE3A 1O96B 2HO5A 2PWYA 1SQ6A 3O8OB 3U4AA 1V11B 4FYJA 3N6VA 4KQ1A 4OJNA 1NTOA 1RVDA 4CLOA 4IRIA 3N2NA 2WA2A 5DU2A 4TWBA 4BFUA 4YRVA 4NCNA 2ZSFA 2STTA 4E08A 2DYKA 1R1UA 3ZDFA 5LHGA 5F98A 4U02A 4RGRA 3I52A 5IPFA 4M1EA 3RSQA 1J8FA 4CMIA 1T8UA 1ZQ1A 3JQ7B 1T9CA 4P83A 3T5CA 4H4KC 1ZL0A 3VNSA 1JEEA 1I6KA 5FDFA 5EJ8A 3IXLA 3DL2A 2WAFA 4PXSA 4IJUA 5EUCA 4D98A 3CLUD 1C9MA 1YU6A 1EUDA 4EYGA 4A2CA 1M5TA 2AHOA 2WWYA 1OZAA 4V19K 2CXXA 2XT0A 2G77B 4ER3A 1Y6FA 3I0TA 3HFGA 1KP3A 3HDGA 4S1VA 4GT1A 1QC5A 4OHKA 2NU7B 4WK2B 1L7BA 4Z1OA 2O2JA 3LX8A 4KRFA 1DTEA 3DKVA 2L9SA 1D9XA 4GR9A 3QYPA 1BXGB 1L5VA 1QUEA 3UG6A 4NMMA 3UXYA 1W25A 1R5BA 3OIVA 3LTEA 1V8PA 3VNUA 4YJFA 4QFDA 1RTTA 3BXEA 2K3PA 2X4HA 1DU0A 1GA4A 1UFOA 2J08A 2QYHA 1X42A 2WHYA 2DC1A 2ZE8A 3O0TA 5CYVA 4KBYA 4K9QA 1SKYB 2YNMD 3PTZA 5JWHA 3URKA 2V1XA 1VQOI 4OJYA 3WYDA 2EX0A 2IJLA 4BKMA 5KWSA 2NT4A 1M0TA 1DKRA 2HKXA 4JA2A 3HJAA 4D8YA 4MLDA 4A8JB 1O1YA 2XNKA 4M0CA 4RF3A 1WEHA 3W1EA 3AEYA 2A0WA 3U0VA 4RY2A 121PA 4NBWA 1TUBB 2OD7A 2IELA 2Y8EA 4PO3X 2ZB7A 4IHYA 4RXMA 5JEEA 4JWTA 1QQ7A 3S2DJ 1A4UA 4N8SA 4NONA 2V7BA 2YS7A 1MAVA 1Z83A 3F7MA 3OCZA 3JRCA 3AR8A 4PU0A 3OCJA 3BGSA 3WVNA 2XXAB 4L5CA 1XSEA 4PJLA 2R6ZA 4WY2A 1N3BA 1TC1A 1J7KA 3JASB 2HBZA 1U9IC 2ID9A 3JS5A 3EFOA 1QIJA 4GYYA 4MW5A 3RFXA 1M54A 2PQ8A 3GEHA 3PCTA 1PZHA 3UJBA 2LRDA 3RUIA 2I6FA 1EAYA 4B33A 3MJEA 3CZ6A 2YFQA 3OCVA 3EDOA 2BFOA 4NZNA 1A3CA 4LJRA 1K9VF 1Z82A 2ADOA 4GP9A 4RK5A 4YCDA 2GBIA 4EHAA 2WB2A 2NQ8A 1GPMA 5AM0A 4DA4A 5DGXA 1TWAJ 2F90A 4FWBA 3OZAA 1RM0A 1JPVA 1D1BA 4KUGA 1E6KA 4NYIR 1U4SA 5EZGA 2EFGA 2NSLA 4IQ4A 1T2UA 2HQ5A 2FSPA 4IFEA 5F1KA 5EHQA 1LDYA 3A04A 3CUQC 5KJEA 2IHVA 4ODIA 4D4JA 3TDMA 1OAAA 4AY2A 2ZRDA 4TV9B 1K2WA 2IYLD 1Q2XA 1PZMA 4DLLA 4QQNA 4X1KB 1YQTA 4E11A 1JQAA 1VPVA 2AFHB 4HF0A 3OIFA 3PKZA 3R1IA 1LDEA 4ZO8A 5K0ZA 3BE8A 3DEYX 4BYYA 2F5VA 3BC8A 3WP0A 1BI0A 2YY5A 3EYWA 2ZRGA 4YI3A 3RQSA 5ADWA 1G5HA 3DNMA 1N0WA 3GB9A 4WKGA 3VGPA 3RYFB 2PZAA 3IBCA 3HE3A 1ZHOA 3VYUB 3DW3X 5HLGA 4P0PB 3U5ZB 3PL1A 4AULA 2R6JA 3TI7A 4F55A 1AU9A 1J0CA 2G28A 4DQUA 1M1ZA 2JGDA 4C3JJ 3HJBA 2I10A 1NE2A 1Z2NX 4PR0A 3VU8A 1GGKA 2VJ4A 2ZBPA 1G3TA 2LG4A 2HOSA 1E4OA 2FEMA 5JUWA 1THZA 5D86A 3RK4A 2VIIA 2PN6A 3ZHYA 2AB0A 2PR7A 5UKDA 1T33A 4TTTS 4MUGA 5FIUA 3CMYA 4OX9Y 1LVGA 1W88A 1XCOA 4QJ4A 2C82A 1SNYA 2IYUA 3VO2A 4D25A 2EG9A 3AGPA 1JHVA 4X1EA 1EGHA 3R7AA 1O9HA 2W6CX 6REQA 5JDIC 4EG8A 1IG0A 2G9UA 1C3OA 5D8DA 4FB4A 1B2LA 2FRXA 3BHJA 4BNDB 2DQKA 4RV5A 2EHJA 3GQVA 3WOVA 3DFIA 7GPBA 1PTJA 4OXQA 1Z4NA 3IVCA 3C14C 5B4TA 3CVVA 3FB1A 4QUBA 4KCGA 2BY0A 5CNKA 4DIUA 4I46A 1KJJA 2CDAA 4E2ZA 4GSYA 3T9CA 2KQUA 3WSTA 2M87A 2J45A 1M34A 4JEMA 6NULA 5FOTA 1JQ3A 1ON2A 3KTDA 1MN6A 4ZAGA 3ZGYA 1IRZA 4HEHA 2QTRA 3TW0A 2A1UB 2XPUA 3D0KA 3QVWA 4IOLA 5M29A 3VR1A 1IAQA 4G5OA 1UUFA 3IIMA 1DFGA 1STZA 4HZIA 1OXUA 4YP6A 5FO0A 1OD6A 1DCMA 3QEKA 1USVA 1QIFA 1UPAA 2Z04A 4KEAA 2F00A 1MMNA 2IW1A 3X2FA 1USTA 2DPUA 3BE4A 1G21A 4RYDA 3SQLA 3CE6A 4JA0A 10MHA 2MHCA 4MR9A 1JBQA 1NIJA 5GGXA 3SLGA 1F8YA 4PC1A 3LZ6A 5MHTA 3C5HA 1MG0A 4FOOA 2XDAA 4K2AA 1V2GA 2FEZA 2XLBA 4R7TA 3BMQB 1XDDA 2OBNA 1UBUS 3KTAA 4ZV9A 1KDVA 3RTAA 4OAYA 2H1FA 3WB1A 4LC9A 3ZXXA 3PC2A 4ZGBA 5A0VA 2KJCA 1UBLS 3VO1A 1SQFA 5J58A 1CLUA 1QBGA 4X8MA 4ER6A 1VE6A 3BMXA 3EFHA 3NJRA 3SDSA 4ZIRA 2XODA 4CYDA 1CLEA 3DJYA 3IERA 2RCYA 2XHKA 3O8QA 4DGWB 3DEIA 4OAQA 3T34A 2Z08A 3OFSA 3RLIA 4ARIA 2ZBEA 3GTLJ 1X19A 2COUA 2M1ZA 2NNWB 2OORA 4C76A 3QPDA 3X43A 2O59A 4DILA 1HR0B 3FOFC 1N77A 1E2IA 1KJ8A 3A6ZA 4RNDB 3W6PA 1EQAA 1S3IA 2J3DA 3W9YA 3C4VA 3CKLA 4YRJA 2BJVA 2UZ3A 4UFPA 5IT5A 1J97A 1K5HA 2ZRLA 4E7KA 3GAFA 2HYFA 4HF1A 3FXUA 1RYEA 1TD1A 2H6CA 1UP7A 2EQBA 1MQ8B 5J8CA 3O8QB 4DARA 3FTQA 4ETSA 4DAOA 3IEKA 3VZCA 3VDMA 4A0FA 2HU7A 2AS0A 3EOAI 4ZTBA 4YCJA 1XC5A 1BI2A 3HUFA 4OXRA 1TW3A 4A12A 4C4RA 2R751 2VQSA 3CF0A 4Z99A 3IQHX 1I0IA 3CMMA 4WK0B 4Q34A 1WMSA 5HIJA 4EW1A 2O0MA 1C9EA 1E60A 1HSJA 1W85A 1DGRM 2Q9CA 3OO0A 1YASA 2P9TA 3D5LA 1NJFA 4PYIA 1NY6A 2IYFA 4RVFA 1II9A 4Y15A 1SXJA 2JS7A 4P3YA 1IRIA 4PS1A 3UAGA 3ZG6A 1K7SN 2MTBA 4PJ0C 3TFOA 4XLPF 3HXOA 3KV1A 3F0TA 1T2NA 3MUEA 1I3KA 2JRLA 1UMCB 1XMPA 4FN4A 4N39A 2K7LA 2Q6TA 2Z09A 1NN3A 3MXOA 2PGIA 4FQ7A 5AW8A 2FXAA 4FOPA 2HDWA 3VPRA 4OHWA 4HX8A 4XQFA 4G4GA 4Z0TA 3Q6NA 3A1TA 5GVRA 1RHQA 3OYCA 4YAEA 3GGJA 1ORKA 1N2OA 1H6BA 2Q2EA 1XKLA 3HBAA 2XYHA 5LQKA 3MD9A 4IVRA 2OTJI 4P93A 5AK6A 5I7WA 3VH1A 2B8EA 2RKOA 2ORWA 1SJ9A 2PLAA 2JK0A 4X7PA 3LUKA 2WF6A 4JB3A 3DMGA 3E15A 3OUTA 4LYDA 3AF2A 3HCDA 1DJPA 1W9HA 1Y5IA 4FC7A 1PNOA 4AL4A 1VSUA 3EGEA 5JE8A 1J49A 2J32A 5BRAA 5F9HA 3IQZA 4IV0A 2FOXA 3AH8A 2PUJA 4QBFA 2V97A 4TKMA 4B7CA 3E2PA 3FBNB 2EFWA 1WF3A 4BV9A 5AUPB 1CUJA 5KEIA 4KIGA 3VZPA 1Z45A 1R5ID 1AKHB 4JJKA 3G85A 3BD7A 1E2XA 4QECA 3G3EA 2GFHA 3I92A 4G1EB 2N42A 3M6UA 3FUVA 3K1YA 1K3TA 2HF8A 2IGKA 1I51A 1XHLA 2CJJA 1ZPDA 3B85A 3DE4X 5CM2Z 1E5XA 5CX4A 5CDFE 1ULYA 5L3QB 4BV2A 1JT0A 4A3LJ 2ET6A 2AMVA 3EUKL 1Z4QA 1IUYA 1L8QA 1USWA 2VZ0A 3B8EA 2FQWA 1ADYA 3D5QA 4QRHA 4DJFC 7MHTA 4YIFA 1T9ZA 3F2IA 3FETA 3OTWA 1LB1B 4I9UA 3ENWA 4WCFB 4Y2TA 1M74A 1GRQA 4KYTA 2VSOA 5GQSA 3UJ8A 4LOKA 5CHYA 5BWLA 3OJFA 3UNGC 2B92A 2VHCA 2YR0A 2Z9CA 4JX6A 3RIMA 4PLZA 2C7GA 2VT3A 2BSXA 2GCOB 3C97A 3E9QA 3FPLA 2HKOA 1IQUA 4UUQA 5AKGA 4G1MB 3C1AA 4TQAA 3WOHA 5GAJA 4EJSC 4QJ3A 3ZV3A 2C2ZA 3JRHA 1SBNE 1I6WA 2OGWA 1UXJA 2X5XA 2H94A 4PGGA 3PWTA 4ER7A 2PKCA 3G0GA 3M1YA 4GX2A 2UUBB 4WA8A 3TM5A 3ZD7A 1E0AA 3RSSA 1KVUA 5LD2B 3T1QA 1H0KA 3CO7C 3DAPA 1PBTA 1WV1A 3U49A 2GQ0A 4CYMA 3TNYA 1LEAA 1P4RA 2JWTA 3EYAA 1KYYA 1LK0A 3V2UA 3ENNA 1SKAA 5KQMA 2O19A 1ONNA 3RC2A 1WBDA 4A8TA 4X3PA 1W44A 4GBED 1AUXA 1JUSA 5IYBJ 3V8JA 1FQKA 1M1UA 4ED9A 2FPKA 4Z4CA 2OR3A 5HUHA 3L02A 2YW2A 4L5AA 4O6JA 1F2TB 3WIEA 3ZIDA 4C4ZA 4D42A 1BOBA 4KLNA 1CUHA 2R4TA 3MTQA 4DMLA 1QYIA 2L69A 3R6WA 3VUEA 3IHLA 4Z4EA 1EEXB 1O3SA 3OQOA 2X1MA 9ATCA 5FT9A 4P9FA 1F9AA 2DQYA 1N5KA 4YBZA 4RMJA 1RWWA 3WG9A 3C4JA 3IE0A 2V4UA 4LA4A 1DDIA 2G5PA 2RGCA 3HCWA 3W5UA 2BEJA 3HYLA 1QGYA 1GXSA 3P71T 5JY1A 3AERA 2C2GA 4IIJB 4EUEA 2XPVA 1P91A 4MWBA 5IJ0B 2YYAA 2AI2A 4KP7A 3REQA 4BQEA 1P2GA 1AD2A 2HSJA 3PRKE 3AOEC 4M1MA 3GZ4A 5IOYA 4QUIA 3TOBA 1L8LA 2E48A 4UBIA 5AKLA 3T7CA 4DA6A 4E2WA 4EFLA 4FMDB 2HCFA 2X3FA 2R6HA 4HDRA 4LMYA 2IYNA 5TT0A 4D0GA 5AVXA 3NNDA 1Y7IA 1LPQA 3TKYA 1DXQA 5F12A 3ISTA 4J4HA 1WKCA 4KYVA 3QUQA 4J16A 3L6BA 4DLYA 3JQDA 3RS7A 1WEKA 4BO1A 1RIIA 5GTHC 1ZUD1 4AG6A 2C7OA 5KBYA 2Q0HA 4DUGA 1P4JA 2F8LA 4JBWA 3CPEA 1YKSA 1RADA 3FDYA 1LZKA 4FGUA 1EP2B 1UM9A 2A9VA 2FDXA 2HU8A 3EGDA 3N2YA 3AB3A 2DUJA 1QWOA 2XMGA 2WM8A 3B2EA 4NOKA 4QJIA 5BOSB 5DNCA 3FBWA 4MX8A 4LNAA 4YP0A 1T08B 2P79A 5DIZA 4DJEC 4B71A 1QKKA 2CVQA 2DTXA 3GP3A 2ZXHA 3FKIJ 1PL0A 1SBZA 1VMAA 3BXPA 2RHBA 3D7NA 2YX1A 1TEHA 1H0HA 2VDLB 3ENKA 1NVEA 2YL2A 5D3QA 2EJTA 3V3TA 1ZK8A 3TKAA 2QD3A 4HB0A 4NFYA 1JHZA 3UPDA 1MOPA 2EWVA 4DLVA 4UTPA 2GZMA 5E4TA 1RESA 5G4LA 3K9TA 3ITDA 3TTUA 2OCIA 3P4XA 3ZK9A 2R7VA 2M98A 4YPOA 2FYTA 1OFTA 3ML6A 2OKCA 2B1QA 2FQXA 2Y0MA 1WHTB 3WLFA 1H9BA 4UOZA 1B8IB 2VT6A 2ALJA 1JKIA 4BU2A 2O3FA 1PL7A 2B4RO 2PGNA 3QF4B 3GK3A 2W00A 4H3VA 2IRFG 2W0SA 4RL6A 4AX8A 4RTPA 3IHUA 4DV6B 2GPJA 4QZVA 2KMLA 1I3QJ 1TMOA 1X3ZB 1YZUA 2KSQA 1C0WA 1U6IA 3EH1A 3FLEA 1BVYF 2ZJRF 4LZPA 5E9JA 4WOBA 1PGJA 5JFRA 3QU3A 2AMYA 4RKWA 2DUWA 4U4AA 3QG5A 1Q3HA 4JFAA 1QGED 1AXGA 1OPRA 1U99A 2HMUA 1TZBA 4IVPA 3TFWA 3W05A 3Q0VA 1H2EA 4QT4A 1C8VB 5A3VA 4I76A 3BRSA 4JLBA 2AF3C 1KI8A 2HBQA 3BJZA 4LQCA 2DJIA 4U9UA 2P2GA 5KYKA 4DLTA 3M9LA 1Z13A 1M75A 2CEAA 2IW3A 1S3FA 5DHFA 3NBFA 3BR1A 2P27A 1W8DA 2AOTA 2OBXA 2WZQA 1FYMA 1H94A 3LUFA 3O4RA 1AA7A 2VC2B 4FW8A 4TWRA 2FE4A 2ZAGA 2ZBKA 1PJ4A 5DK4A 1K8YB 2R87A 1HH4A 1X92A 1ZELA 3PA8A 4JLDA 4P4SB 3GMTA 4GRDA 4F2HA 3DQQA 4IHJA 1BH6A 3LRXA 4FDLA 4FFMA 3DDWA 3I73A 2HREA 2VYND 3CU5A 3EYYA 1K5DA 1EZ1A 4RNCA 1RQNA 3ZVMA 2A5FA 4QOIA 3DVAB 5K3DA 2ZBQA 4QXOA 4EABA 3AHHA 2LV8A 4AIIA 2B8TA 3PK0A 3Q6MA 5DTEA 3V7SA 1WE2A 1FBTA 1DPUA 2JGFA 2QMUA 2QYTA 4NE2A 4LGYA 4XTRA 4XRSA 2VDWA 4YRMA 3AR9A 1EUCB 1BKSB 5CGZA 4ZIRB 3HB5X 1XSXA 2IUFA 3OIQA 1EA5A 4N5DA 4JDUA 4NESA 3WGJA 3GLIE 1JW9B 2PSSA 3LYLA 3O3OB 3VBEA 2DODA 3KDPA 5C5IA 1YUMA 5EG5A 2O8CA 2UVPA 1KYQA 5CIQA 5K8IA 2QU8A 1GRCA 1YVUA 3DZIA 3I59B 2BTOA 4UATA 1Q50A 1QVVA 4XD7D 3AOEA 3BPSA 5U4XA 5ES4B 5GTDA 2HD4A 16PKA 1QSGA 1DUVG 1YZFA 3DO5A 3NONA 5DO9A 4YWJA 2OFWA 2PQ2A 2P0EA 3EGDB 4WF2A 2DWPA 1OC4A 2HQSA 4ITRC 4JX8A 4MKIA 3RZDJ 2CNOA 1V8DA 4NENA 1QGUA 2ZB3A 4H60A 1XJQA 4UDYX 4DR6B 4ER5A 1BWSA 1YL7A 3ABOB 2D06A 1TQ8A 1FMVA 2H9YA 2WQZA 5EAIA 1V1RA 1N5IA 1M2JA 1KK2A 1WQ4A 3W5CA 3FVTA 5CBPB 5GGYA 4JLWA 2GXAA 3H2HA 3ICEA 2A0KA 1TPZA 3EVEA 4HDRB 1A76A 3TLBA 1DUSA 1OTXA 2RFLA 1CT9A 1RI4A 1D3AA 2H2DA 4ZCPA 1L3LA 3C3YA 3ZRGA 1RJ9A 4JGBA 2HQAA 2OGTA 4GMKA 2GRAA 2X6XA 3LZCA 4H15A 4X3OA 1ZREA 5DBFA 4Q5SF 5A6SA 4JUIA 3C2HA 3ER6A 2E4UA 3AFMA 1XROA 1PL8A 3D0QA 4G65A 5KJCA 4FZ3A 3I9FA 3CBQA 2QL5A 4CMEC 4TRNA 5C5DA 4TZTA 4BBPA 3CG4A 1MOSA 1Z8HA 5DNDA 5AVZA 1R8JA 3Q1LA 2QG9A 4EK9A 5M5BA 1TIBA 1Z6AA 2A3RA 4J1QA 4QOGA 4CKWA 1Z5GA 4L9TA 3L7AA 2PEXA 1ABEA 2C57A 4ZVTA 3U37A 2C7RA 4GGPA 3LMMA 1P9LA 3UA3A 1MEEA 1U7XA 3QVVA 2Y0SA 1GTRA 4Q48A 3FGOA 1RZRA 3QP5A 1P81A 2V1UA 2B0JA 1TBXA 1X3WB 3WTSC 4DSNA 3F6EX 3IPRA 3QPSA 4L02A 3VTKA 3ZIAA 3UMFA 4PHFA 3V97A 4ZPXA 2JJ8A 4BU0A 2W6NA 4YV1A 3HYNA 4TSFA 1TMKA 2IOYA 3WB0A 3K0AA 4A82A 1X9IA 1QZEA 2F3SA 3F5FA 3OM9A 1KDZA 1U0TA 3CQ9A 3T99A 6Q21A 2ZRNA 5JCZA 5BOVA 4MS4B 1QU2A 4ZAZA 4PANA 2CUKA 5C31A 5DASA 4CBVA 3GCXA 2GJKA 2QD1A 3D6FA 2ODBA 5KAPA 1F6DA 2D5AA 2JIQA 4BGIA 4I1PA 3RAPR 1WRJA 2DFIA 1ZD1A 2IPXA 1NP6A 1TK2A 2IHZA 1YBFA 2REQB 3DTYA 3M6FA 2W25A 4UB6C 4UCFA 5I7EA 2Q1SA 3NQOA 2QLNA 4B45A 3HZJA 3BCUA 5F1JA 1G98A 5BSHA 4DJAA 1WKVA 4HNAA 5IBQA 5A3RA 4IBOA 3AEQA 4JR1A 2ZE5A 2JA1A 5FRNA 3LCRA 2JEYA 1ZEJA 3GJ4A 4E94A 3SZRA 2M32A 2FR1A 1E0JA 1OU0A 5EHGA 3NYQA 1KR2A 4B3SB 2GA8A 4MZDA 1QGAA 5FLMJ 5DBIA 3LOCA 3IP1A 1S9HA 4UVIA 4XKWA 1R6BX 2A86A 2EBFX 4ILEA 4LLLA 2QT1A 1WDWB 3IEVA 3JQQA 4B9AA 3T35A 4YDSA 2QKYA 5ADUS 2VL8A 5E3NA 1DRKA 1IC6A 2XGGA 4DZPA 3RQ4A 4FE3A 3E9NA 2IPOA 1ZYUA 3DBHB 3DVQX 4MYRA 5CBKA 3I83A 4J7XA 2JA6J 5K2MA 3ZU5A 2Q3DA 4UE2A 4ENUA 1DO8A 1Y4SA 3FSEA 4HX2A 3SZ3A 2EFEB 2YDYA 4UFOA 3GC6A 2G0AA 4BZZA 4GVPA 3T1TA 2OAZA 2CUNA 3DHVA 5IYZA 1R50A 4HNVA 1Y3FE 4Q3EA 1THMA 4YV0A 1UZUA 3QELB 2OHFA 4F7ZA 1WGXA 4E7HA 1V11A 2R2AA 3AI7A 3IWFA 3KBBA 1JR4A 1VG0B 2NO5A 3R3VA 4LYYA 1VQ1A 3L77A 5DEOA 4PZ9A 1XZDA 3AR5A 5H4HA 3WIDA 5F2NA 5JCPA 1PO7A 1QHSA 4UNSA 5CIYA 3EF1A 2AFVA 2FPGB 2IVFA 2XTMA 3EGWA 2H8RA 4HXGA 4P5PA 4CIAA 2O3UA 3JRIA 3N58A 2ZDQA 2CW8A 4K28A 1GA1A 4TLMB 5FKJA 1TNTA 1BHSA 5T8KC 4XKCA 2CW0F 4PAOA 8OHMA 2C0PA 4RTOA 2VAMA 4G89A 2IYOA 1G3MA 3GUVA 3PFYA 1OBCA 2QJFA 3KZVA 2AEMA 1EP1B 2DPHA 2E21A 2AH5A 3HHPA 4DA7A 2BTQA 3PEWA 4NR0A 5AOCA 4J9UE 1RKXA 1YRHA 5FP0A 3D81A 4DV1B 1VP9A 3ZGVA 5HSGA 3B12A 3OTOB 2BGWA 5KKCA 2XSZA 1M2OA 3JAMK 1VFCA 1RAGA 4B2YA 4D1YA 2P2YA 1KERA 4S0HB 3BQMB 3GIWA 2IYQA 4LKOA 2LC2A 1HFJA 3OQ1A 4M99A 4JHLA 5T5QA 2FGJA 4I8DA 1D09A 2AN4A 1G60A 4I1RA 4QD3A 1GZ4A 3QELA 3EUWA 2TS1A 1Z1DA 3CBGA 1IHDA 2C42A 1JWAB 3PWZA 1ZARA 2OZPA 5AKZA 1OAOA 4AUXA 2Z5GA 5HDKA 5FNVB 4HPQA 4OBBA 1YWGO 2GRJA 1W93A 3DV0B 4O2RA 4UPVA 2HNAA 3WL5A 1CIJA 4BIMA 2RHJA 4EO9A 1VHLA 1GZ6A 1Z26A 2PZJA 2ZUFA 4Q03A 1VPLA 3KQOA 4ZO4A 5CB4A 3LO8A 2ODWA 2V6EA 3FXRA 1RHKA 1U8EA 1XZKA 2MMCA 3D0OA 1NVFA 3PR3A 2QZ9A 3BUSA 2GLUA 4GMXA 3GJXC 3TLMA 4CDRA 3OQJA 2XUGA 1AU7A 3WLHA 2JIZA 1YJQA 3LSIA 3OCCA 4QOHA 3GLTA 4CM8B 5IRCD 1ZXXA 3DE6X 1A8HA 1ZMRA 2F55A 4X41A 1UJ2A 1EK5A 2ZJPF 3A6JA 1GUYA 3CX4A 4JNCA 1CJMA 1KOFA 3K0CC 4ZI7F 2OHHA 2XT6A 1D03A 4O8ZA 4RD4A 1DX4A 2Q4OA 4HDAA 4RC9A 3V8MA 4MV1A 4I01A 2JJQA 4TV8A 3NVAA 2I4RA 4EEKA 4RORA 5CT5A 3UENA 1Y6IA 2AQKA 2P5SA 3LAJA 3G02A 1RKUA 3QFFA 2JRMA 4O4JA 2VRBA 3BT9A 5DLQC 4BP1A 3Q12A 1QIIA 3HV0A 4ENVA 1H2AS 2J3HA 2Q28A 1NW5A 4O02B 3TEFA 1M66A 5KNBA 2IU3A 3RANA 3T7JA 3QODA 4DPLA 2VPXA 4F46A 5F0HA 3ACBA 4JV5B 2FVXA 2NV0A 2Q2WA 5GPAA 3KP1A 5JZSA 3RT1A 3BTVA 2IK8A 1MBEA 4Y3UA 3OZTA 4LSGA 4FBGA 1XZNA 1DG3A 4NHJA 1IBCA 1PZGA 1U8ZA 2MA3A 3DE7X 1Z2CA 1DAKA 3MYRA 1NYTA 4MRPA 1G3RA 2JQ7A 1Z0KA 3JYLA 4OI2A 3U17A 4HTFA 5EJ9A 3THYB 1ADGA 4XFJA 4YCAA 2DQZA 4ZCMA 3N2KA 3CZRA 1DCKA 2GLXA 2QVXX 2WSMA 3C8UA 3LT2A 4KO1S 1AUVA 3LD9A 3FTFA 5DYGA 3FHJA 1RR7A 5BR1A 3AF3A 4MINA 4OU5A 3IESA 2GSWA 4O63O 3OOYA 3PE4A 2Y4NA 3T38A 4JJ6A 2H4WA 4H0NA 2H2HA 5FPKA 2QW0X 4Q9HA 1MVLA 3KM0A 3NUQA 4ZO9A 1XLTA 5CFZA 3CZPA 2QGNA 5HILA 3VPBA 1B8NA 2DOKA 1PVOA 1W0TA 4KL8S 3RJ9A 2VSXA 1G6Q1 3C45A 3CLSD 5FBWB 1YZHA 5HIMA 4YRKA 5HYVA 2EA2A 2P4HX 2XWPA 3TQOA 4MPDA 1R8QA 4RQAA 4R1LA 4RGBA 4WUTA 2PEYA 1NAIA 2A7XA 4G7HF 3Q9VA 2OB2A 2UZ1A 2ESNA 1TYBE 2WINI 3L7LA 5DSZA 1CR1A 2I6SA 5KCZA 4UC0A 2NVWA 3FVQA 3Q7QA 3CRMA 1JQ5A 2HLHA 2FCAA 3D1VA 1NHWA 2GBLA 4H0CA 1RE0A 4B8ZA 4E0BA 2OKGA 1G6NA 2ZYAA 5FTLA 3A6KA 2O7OA 3U80A 2O8NA 4LTNA 4LXGA 1QZUA 5JAIA 4WBNB 1BCSB 4F3QA 4ESBA 2KT0A 1XJWA 5FD8A 3E7PA 5LP6B 3EJ6A 1YUBA 4PNEA 4FDAA 1F6BA 3E9DA 4IDNA 1NVDA 4BFVA 4EDHA 1QHNA 4BVFA 2B98A 5BWNA 2PG4A 3KWMA 4FIZA 2QBYB 4E4RA 4ZYXA 4UBMA 2DK8A 1AO3A 1PGNA 3ESBA 1C9JA 5G53C 4F4IA 1P9OA 5K0CA 1IVSA 1LFBA 2JVGA 3LHSA 3WA6A 2HCBA 4W5TA 2H2WA 3SS8A 3H7IA 1RABA 4F3KA 2V7UA 2XUZA 1W0JA 4ALLA 4HLCA 3AVUA 1I2ZA 1QVZA 4IDQA 2J5OA 4JBAA 1A97A 1ORHA 5B6PA 4PLCA 5ALVA 3E2IA 4LDAA 4DKJA 2O8BA 1D0VA 1E9BA 3MT7A 5GPCA 4GCVA 1JHPA 1TZJA 3K5HA 4Q9IA 5DHSA 4BNGA 2JFGA 3PIRA 4I2NA 5IC4A 2YXEA 3U1KA 1T6XA 1TE2A 4BX8A 1IXYA 1ZA1A 3R3UA 4GS5A 4O4LA 3UG7A 2D45A 1N5MA 1JLLB 4Y1RB 3TLEA 3ZHUA 1GITA 4TXMA 1DUXC 4HMQA 3M4ZA 4PQGA 2XB5A 1FNSA 2R6R1 5FNVA 2QKMB 1IONA 1QYDA 2AOXA 3HWX1 4DCJA 1LLCA 3EOBI 2H9IA 3F6VA 4CV3A 3DAHA 1LEBA 2GB4A 2NYAA 2H1CA 4YQZA 1FLAA 3I2HA 5DN6A 3MSCA 3JRFA 3AP3A 4ON0A 1KI7A 2RIPA 2NNYA 3GEZA 1KF0A 5HKKD 2HDHA 2H27A 3GCZA 1S1CA 3KTAB 3P9SA 1J0DA 2RHGB 5B6IA 2X77A 4WW0A 2DA5A 4XXHA 1VI6A 3FZEA 4G1FA 5IK2A 4M87A 3T52A 4HX9A 4G63A 4P7BA 3R6SA 4EECA 2OG1A 2GXUA 4FI3C 4BC0A 1NQXA 4J2HA 3I42A 1GVHA 3O4VA 2QP3A 5DRTA 4UVDA 5LMUB 1ZH8A 5B4VA 1GFWA 4CEHA 1D07A 4AF8A 4TRJA 4LZAA 3FR7A 4LC1A 2VXDA 1SY7A 3AFGA 4FTHA 5EJCA 2F9LA 3GEEA 4HZFA 2FUNB 3HKCB 3OPXA 4Y1EA 3D0RA 4JEHA 2P4SA 3VZBA 4MQ6A 5I9IA 1Y3HA 2G0NA 4H2DA 1P7WA 1Y3IA 3RBVA 2Y2VA 5ALZA 2A30A 2ADFA 2JRTA 4CCNA 3H0GJ 2A61A 1R0RE 2BHNA 2H2FA 2P4QA 4L75A 5FA8A 2VOJA 4LBWA 5K1ZA 5HRCA 2PUDA 3EGXA 3GVCA 3QVGB 3JQ7A 4EV0A 4K6GA 2A9FA 4AJ1A 5BV1A 3T0YA 2R1VA 3GBGA 2QSJA 4KN4X 3QSGA 4UBOA 1XZFA 4X5OA 3WLPA 3DOJA 3UB2A 1ISJA 4F6CA 1GP2A 1QP4A 1C3OB 4ME6A 4ARCA 4BE1A 2QLTA 3Q6IA 2RHLA 4AJ2A 5JSUA 4KKVA 2HLNA 1B76A 4R98A 3RNLA 1U8BA 3A28A 4D9BA 4NBQA 3JD4A 3VR4A 1PR2A 1ORVA 4BO8A 1RBZA 4WXRA 1FX0B 2PMCA 3CWZA 3LP6A 3NX4A 5E3OA 1IOZA 5K6AA 1P5HA 5FQNA 3ORSA 2G1JA 2MGQA 2I7XA 5LXTA 4LG3A 2CYBA 1J0RA 3OOJA 2W84A 3BICA 1CUVA 3RTEA 3QVSA 1Z4PX 1BE6A 3IOYA 1DKMA 4LE1A 3LAPA 3LT5A 4YT5A 1I7SB 4H1UA 2VJMB 2Z8XA 4R1TA 2ZVQX 1JXSA 4QOJA 3K1JA 2QKLB 3GVPA 5IYDJ 1GSIA 1SXJD 4MXDA 3RTGA 2I1VB 2VXYA 3D7SA 1KBOA 3OEHA 4FYHA 4NZYA 3KKNA 2G5TA 1FIPA 1QIGA 2QNRA 3ME5A 3NHFA 4BZQA 1Q0SA 3OSFA 3E8XA 5JSKA 4G4SO 5FRMA 2ZRMA 3D4LA 3JQ9A 2PD6A 4OQLA 4HNQA 2XF8A 5IZCA 1J1UA 3WZ2A 4EMSA 4PSUA 3ZU3A 2ISZA 3LWBA 3IAM6 1RBYA 1ZXLA 3LSMA 4JC8A 5D2CA 2RK4A 3T4XA 5HM8A 2OSVA 1PV1A 2TDXA 2J59A 4LYJA 4Q7LA 1ZUNB 4N9QA 4NEQA 3PQKA 3MEQA 1XNJA 2L0XA 4H1VA 3CFYA 4R9VA 1KQNA 3SKYA 3L2OB 1MH1A 1V3UA 4RENA 5FFMA 4RSHA 4ZDWA 1E3JA 2NP7A 2YIMA 1O4VA 4X84A 1OPXA 3DEZA 3H13A 4HAWA 4Y6SA 4DREA 1QVUA 3WDMA 3T7SA 4YUZA 4UTVA 2TSYB 4JC5A 4BE0A 1BQ4A 1P2UA 3QWIA 4LQDA 1LWOA 3UK6A 3KOMA 1GQRA 2B34A 4R6XA 4MA5A 4UE6A 3R4CA 1JN0A 3NDPA 4AVYA 1JIUA 5C0OE 2CUZA 1T3LA 2X4LA 4AKGA 4BWYA 1OKKD 2ATCA 2BOLA 4FMBB 3LW8A 3BP8A 3PB3A 2CNNA 3OQHA 4LJ4A 2N46A 5HGJA 4L18B 3AUAA 3GGCA 1POGA 2A59A 2W2KB 5CJ2A 1SBTA 5IHXA 2ZSIA 3ZHCA 2Q2OA 4D9CA 5CLIA 3DLAA 1M5UA 1U65A 1Z4JA 3KAPA 4HHEA 4K40A 5IFKA 1F7UA 1H85A 1OLSA 2YZ2A 4M7RA 5G4KA 1NQTA 3HCRA 1CR0A 5DX0A 4O5AA 5E6UB 1YAHA 5EHNA 1EXMA 4KNVA 3UAYA 5THXA 1H9TA 1WDLA 4IDGA 2OPTA 4BVBA 2R7QA 2FKAA 3GQBA 4AF7A 2PG3A 5BSVA 4MV3A 4YUXA 1GGFA 2R7ZJ 5SYNA 3D6JA 1U94A 2HPZA 3DTTA 1JZTA 3QV1A 4NKRA 3EZ6A 4EMBA 1U7PA 3EXHA 3TLGA 1KQ8A 2UDPA 2FETA 4BX3A 3OYBA 1FFGA 4AO7A 4AP5A 3B38A 4C89A 3V3KA 2O54A 1OYWA 2PWBA 2VP2A 1URPA 3BEOA 4YJ2F 2PNJA 2WVJA 4Z7JA 3ZE7A 1WR8A 2LW7A 3SKVA 5AM4A 4X8OA 2L54A 3TDZC 2L18A 1H9CA 3WJ7A 1L0OC 3ZMUA 3FNRA 1U8AA 1SR8A 2OFOA 3FMFA 1Z25A 2WJYA 4AP6A 4LXUA 4AU7A 1NRJB 3TL4X 3K0BA 3QXGA 1E1LA 5CLJA 4OCZA 4FISA 1PBNA 1XCMA 1IN8A 1Z2DA 3FI0A 1B00A 5CXSA 4ISBA 4QYSA 1DKQA 1SOUA 1WHSA 3GA5A 2HUNA 3D5EA 4OFXA 3VHQA 5JOQA 1K6YA 1DQRA 4G5XA 2XZTA 5LP6C 2W6JA 3KQLA 3QY9A 3NT5A 3QNMA 3UK2A 4RDCA 1VNDA 1X3SA 3BREA 5L9AA 3NHWA 3PSAA 1UKCA 4FYVA 3RC7A 1XL1A 5JQGA 1P9NA 1RLTA 4JFRA 1Z47A 3FMOB 2A5JA 5CPFA 4E88A 4I55F 2MWMA 5K7HA 1Y0UA 2GEFA 3HO8A 2RHMA 4HLNA 3H18A 4IJVA 2N9UA 4UUSB 2P9FA 3L0OA 1Z29A 3NTVA 3ZV6A 4O5VA 2NV2B 2BEWB 2YJNA 4LHYA 2HX1A 4HA8A 4KGZA 2ECFA 3NBAA 1DEAA 4CKBA 1YOVB 5JD4A 1FRFS 2O8KA 3MOGA 3OO1A 4MWZA 4RAOA 2W7NA 1FU7A 2BZSA 2GERA 5F35A 3TZCA 2REBA 2GK6A 2H9AA 4FHDA 5GWXA 2LKPA 4UTXA 5DTIA 4IRGA 4BY7J 2O1SA 2YY6A 2VKEA 2PNFA 5JPDA 4IL6C 3T12A 1J9EA 5D7BA 2KJBA 3KVNA 1VJ0A 4QXRA 3K2QA 3BQNB 4CG0A 1YMQA 2RREA 4DZJA 1SZDA 2J4DA 2NUTA 4KYWA 1YC2A 5TIIA 1EXDA 4ZVRA 1WMBA 1D4ZA 3BH6A 4EPWA 4B8WA 5F3WB 2IYZA 3HJUA 5L3RA 2GZ1A 5LDGA 5DNAA 1ZOOA 4TS4A 5IOZA 4TM7A 1Z62A 1M6VB 4N18A 3UA4A 3O3KA 1G55A 3JYHA 1T2CA 4M3DA 3OFKA 1RJEA 1YKGA 1YBHA 2AXQA 4MS3A 1V0JA 2INGX 2ESHA 5AHKA 3N5CA 5B57C 5A2QA 1VQ9I 3CCEI 1K78B 4RAGA 2ZIXA 4RHCA 1JHRA 1MKYA 3L8CA 1EINA 4GM1A 4GW3A 2J0QA 4MK4A 1E2FA 3TTWA 1W29A 2EZ4A 2W85A 3HRUA 1W49A 3N3AC 3R3JA 5EE9A 3EAFA 4DM4A 3N0TA 4EHNA 4YFVA 3G73A 1QAQA 1SCKA 3USCS 4F7DA 1J2JA 4U87A 2RC5A 5EWLB 3WLEA 2G1PA 1QZYA 1J8QA 4WRRA 1E8NA 1Y4DE 4CIDA 4MVJD 1MQSA 1UL1X 4HEJA 3C3CA 4O33A 4X6XA 3T1YB 4BXOA 4ZWNA 4PAGA 2LD5A 1YDHA 1D9ZA 3RS4A 3TD6A 3W34A 3W7VA 3IT1A 4UTNA 3LWNA 1O8BA 1YFJA 3RTDA 5JZOA 1QAMA 2CFRA 4Q6BA 1JQLB 2M1XA 4P1ZA 1Z2OX 3QUCA 4ZQCB 4ZT4A 3LC0A 1T9KA 3SQOA 1OU4A 2GR9A 3T3NA 4PIMA 4BLOA 4H0EA 3R6TA 4OKIA 3FYUA 1T38A 3RAJA 1A9XA 2H29A 3G13A 1NVMB 3IALA 1C7ZA 4JNKA 1SIBE 2B0LA 3FWEA 1BBYA 3WU2C 3B7WA 3EISA 3QW4B 4QFCA 4ETIA 4B4OA 4F4JA 3HM9A 1QS0B 2HSZA 1E7QA 4AUMA 4C1BA 4OA8A 3ZDBA 1X6VA 1SFOJ 1DLJA 2OD5A 3VYRB 2XCIA 2YINC 3H1FA 1QA6A 3MTBA 3PRJA 5DKFA 4HYEA 4F84A 2VXOA 5IKXA 4PNHA 3UAXA 1DFIA 3IULA 3RRJA 3BZUA 4BNHA 4CEJA 1Z7EA 2NZ2A 2R8OA 3LXMA 3K16A 3KYJB 1JEYA 2HSWA 4UNQA 3SEZA 4C2MJ 3FWPA 1EGQA 1U0HC 4HLYA 1VA4A 4LVNA 4WVFA 3UUEA 4PPGA 3UHFA 3ZHZA 2YWEA 4V1CI 2H8WA 3IV9A 4EG3A 1JAXA 1MC5A 4W63A 1X2MA 1VE3A 2PT5A 3K09C 1EFVB 1H4VB 4KQ9A 3VZQA 4ALIA 1IUOA 5DM2A 4M98A 5ECGC 3VX3A 4AKSA 4RZ3A 1X7XA 4PG8A 1G0NA 3A27A 1YR6A 1Q0ZA 1XAGA 2OHJA 3AG6A 3M1LA 2XYRA 4Z7NB 5JADA 5LP6A 1OYIA 1Y1LA 1G20E 4WK4B 1J2XA 2I34A 1NV8A 2VIXA 2HADA 3KVRA 3MPUA 2I91A 3MCWA 3KKZA 4Q16A 5C7LO 1JHDA 1UG2A 4MRMA 4DOMA 1AK2A 3PQEA 4XIDA 1RZVA 1WS6A 2YUIA 3K5WA 1T2AA 4G07A 4LZZA 4OD0A 3CLHA 1FYDA 4O2AA 1Q7CA 4B75A 3RBXA 2PKWA 1NXXA 1EFRD 3U7JA 4ZREA 4JUBA 3O2PE 4Y2PA 5DM70 2KB0A 2DFHA 5JH7A 2ZITA 2OLJA 4XWAA 4DIDA 2OV8A 4FFWA 3U19A 4NFHA 3EIFA 1JIIA 1TF7A 2M9MA 2R4UA 1UBRS 4EMTA 4EYSA 5JNVA 1JQDA 2EKBA 3E0XA 1DO0A 5TGZA 2ONCA 2BHSA 3VA7A 1K66A 3FGNA 4M6WB 1KFCB 3NETA 3DTNA 1OT3A 2ZTSA 2ZIEA 5B3JA 1GV0A 2WHRA 3IODA 4B4UA 4LSWA 1JHMA 1FOEB 3UMGA 4BX9A 4RBNA 7REQB 1W36B 5KX5A 4Z4FA 4PAWA 1GG9A 2F8TA 4Q7MB 4G0OA 4YK7A 1RYYA 2YHBA 2QM3A 1H5NA 1IPFA 2AK3A 2R48A 3QV2A 2PTHA 3HP7A 3H92A 1T0HB 2X2PA 3BJRA 3N0WA 4JOBA 4WJKB 3KU4A 2G1UA 2UYCA 4O4IA 3X1YA 1MGTA 1KR5A 2CO5A 4AM3A 2GVZC 2P2SA 3ULKA 4ZEWA 5GIPE 3FF5A 2LP4Y 2X9DA 3ZQQA 4F91B 2VPWA 3NWPA 3OZ7A 4P58A 2VYQA 5J4HA 2X5OA 2CXHA 3ZJTA 2RBGA 4FUQA 2JAQA 2IUTA 3VDNB 4ASUD 4FGSA 2O48X 1I5EA 1VYUA 4Q4CA 1OX6A 1B72B 2FPWA 3PKJA 1YQGA 4M1WA 3LTNC 3PPIA 1M8FA 2FSSA 1SURA 2JFFA 4KIUA 4W6QA 3HL2A 1UMBB 3A6FA 2D1VA 4ZD6A 1QHIA 2B61A 4ZK2A 1OH5A 3RRZA 4I0BA 4LWOA 4RDHA 4AJIA 3WTUC 1I3LA 3NZEA 4P4LA 5IMSA 4F71A 2BBWA 4FX0A 2BZGA 3DEJA 4WNIA 1MDMB 3A32A 3JSPA 2P6TA 1S2MA 1L4UA 2J30A 4WJZA 4QPJC 4B5LA 1RZRD 2BFDB 2PMZN 2Z6UA 3HR4A 4CCMA 1JKJA 1FFBA 1UFVA 4XR9A 2YJ6A 2CB9A 2FX5A 2Y1OA 4Z9YA 3ZIAD 3ZNPA 4DYRA 2NU6B 3E9CA 4NDZA 2JAXA 4D7NA 3I6QA 3KZXA 1ESNA 3FOAA 3IOEA 1GKUB 4HSEA 4HVTA 4KITB 1BD4A 4RQUA 4MDYA 5I9MA 5J63A 4BKUA 5IH7A 3LOPA 1QFZA 4JEIA 4BPRA 2IH2A 1DT5A 4BJ5C 1YG2A 1AKWA 2IS6A 5JLJA 3W3CA 4A5MA 3DAYA 3Q15C 4J0IA 4NC9A 1R71A 3TJRA 3DQZA 2HW8A 1OWOA 2QE7A 4X62B 1M1YE 3ORRA 2RI1A 1D4FA 4JKIA 4ZU1X 1YB1A 1P74A 4NU5A 4YUVA 4F5YA 1Z9CA 1QVTA 1F0PA 3I76A 3SI7A 4BYMA 3ZWCA 2R5ZA 1V3FA 1PDVA 1WVIA 2IHJA 2YIDA 3DV0A 3WDSA 3ZMVA 1U9IA 1ODSA 2BKUA 2HK6A 3LM8A 4LHZA 2DLNA 2RG7A 1C14A 3NHLA 3PI6A 4MVJP 1LBTA 2W2XA 2B7CA 4JSTA 3PNOA 3F49S 1U6KA 5HK9A 4CQLA 3USZA 4OQDA 2PFBA 1C9YA 2XYVA 5DTRA 5IT9A 3MWEB 4RD6A 3A36A 2DT7B 1Z05A 4MRRA 1T6SA 2WDZA 4M3FA 3W6KB 1A9SA 1PGPA 3IHWA 3O7MA 4FSDA 4OB7A 1CDDA 1PG0A 1V6SA 3H75A 3OF2A 2R7TA 4DCSA 4URXR 4UHDA 1EX6A 3U1TA 3UT0A 1VFPA 2WWIA 2UZIR 1BE0A 3LFHA 4GOKA 2A88A 2R7WA 1U9OA 2WJPA 4X20B 4AS2A 1YLFA 1MQ9A 2JD1A 4KWTA 4OBXA 1XRPA 2WJIA 5JZMA 1PJCA 2I8CA 3ZQUA 4MPJA 2XDWA 5CFNA 2FW0A 3NDBB 2ZS8A 1XLWA 5IJZA 4RS4A 1OXVA 4D4HA 2CXRA 5JXWA 1D6NA 2FZVA 1SEPA 4EITA 2MYSA 4MRAA 4TTPA 3UFBA 8ATCA 3PNYA 3G6KA 1ZCFA 3DAFA 3HU3A 2BFBA 5ELMA 2ZFUA 1OA1A 3K3PA 4BZWA 3PX2A 3LOQA 4ICIA 3UXMA 3LX4A 1L1RA 4BHBA 4E15A 5LKRA 4F3NA 1QGPA 4KNYA 1S3SA 2QN1A 2W5UA 3DZDA 3PGVA 3PUYA 2BMEA 3ER8A 2IYEA 1E79A 3GGSA 4NPHA 1VQ4I 1G4AE 3PQDA 2EL7A 4YVFA 3I8OA 4CF5A 1U8FO 3BJIC 5JJ5A 1P4HA 2QN6A 3A4IA 2C5EA 4K5QA 1CS0B 1VYVA 1K4TA 4IDEA 1UPUA 4I2VA 3WV5A 5JSYA 1SULA 1DWPA 2FK7A 3UO8B 5K0EA 3UPTA 1XTRA 2LLKA 4YP9A 1W35A 4V2IA 3GLIA 4N0MA 3HTXA 2G9RA 2XW6A 4W7SA 4P4UA 5KNBH 5JWRA 4TSKA 1WL8A 3SEAA 1GSAA 1OF1A 1Z07A 4IYJA 4LDRA 4PYRA 3RBAA 4CTNA 4ZRNA 1ARZA 2XUQA 3G5TA 4CIBA 3ELKA 3KXDA 2VRCA 2E4ZA 1LDMA 3GYBA 3I4LA 3K6RA 5DDIP 5LLSA 2UXBB 3OEED 3BGOS 4KXWA 1E3LA 3ID6C 2O1XA 5ALHA 1O57A 3S29A 1WETA 5IKOA 2V79A 1OI2A 1G5RA 3L7NA 3WLMA 4DSAA 2REQA 1NVGA 4KA4A 3GDOA 1U2ZA 3TXYA 2HO4A 2PKEA 3U13A 1E4YA 3K8ZA 2OC4A 3UMMA 5EF6A 3DHEA 3D59A 1M1NA 4WKCA 3MD0A 4MKXA 3ROXA 3B70A 4CXMA 1BAPA 3DTIA 3VEPA 1N5DA 3GTOJ 1YE8A 2W7TA 4L7QA 4RO0A 2CGPA 3I5YA 2XZOA 4HYYA 1LKXA 3QHAA 1AXEA 3CRQA 1N1MA 3IQEA 4M9QA 1ILEA 1QRYA 3K0KA 1C50A 3RS8A 4GKKB 3VXKA 2BN4A 2AFIB 3MB8A 3NIGB 3HZZA 2YTZA 4HAIA 5E3JA 5EXDA 3V1KA 3CUSA 4B7AA 3O1JC 3ICCA 3ESZA 4I50F 3OI7A 2UV1A 1NT4A 1GL3A 3BR3A 4OATA 3B3FA 5IMBA 3WGQA 3ANLA 3NW9A 1U9NA 3E9YA 2J7PA 2QAIA 3N0RA 4Q19A 3ROEA 1DGQA 1RPTA 2WF8A 1DINA 5JS2A 4DPKA 3NUGA 5B4UA 3K8YA 1Y33E 4FNOA 4EUHA 1BWRA 2ENUA 3GHHA 3KYDA 1ZK4A 1E18A 4L95C 1J5XA 1MDBA 4RACA 4XX0A 1CB0A 3HWWA 4M9SA 3GT0A 3UATA 5JVDA 3UMYA 1DMRA 3CX3A 2XNCA 4AJ9A 4IL5A 6AT1A 1JIVA 1EHYA 1XPJA 3D1LA 3KT6A 3FDZB 2NO6A 3OPVA 1DVRA 1TWFJ 3ASNH 2GIZA 2A07F 2HVQA 1MTZA 1VDMA 2QL6A 3KUKA 5GV7A 3LG2A 1F6WA 3IRQA 1PR4A 4CKCA 3CCLI 2DJNA 1PE0A 5IVHA 2P75A 2FPOA 4IWXA 3LIPA 1ZD5A 1R58A 2LBFA 1E2NA 4G36A 5CH5A 3D3JA 2HU9A 3CINA 2K9QA 1IN4A 2K02A 4M72A 1RJFA 1TQ4A 2A0FA 1LPNA 5HDNA 2PKQP 4JLVA