1FP2A

Crystal structure analysis of isoflavone o-methyltransferase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
345
structure length
345
Chain Sequence
RKPSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIGNVRRLMRYLAHNGFFEIITKEEESYALTVASELLVRGSDLCLAPMVECVLDPTLSGSYHELKKWIYEEDLTLFGVTLGSGFWDFLDKNPEYNTSFNDAMASDSKLINLALRDCDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVIDKKKDENQVTQIKLLMDVNMACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords ISOFLAVONE O-METHYLTRANSFERASE
publication title Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.
pubmed doi rcsb
source organism Medicago sativa
total genus 122
structure length 345
sequence length 345
ec nomenclature ec 2.1.1.150: Isoflavone 7-O-methyltransferase.
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fp2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1fp2A02
3LQQA 3SHFA 2JPCA 3QRFF 3ERED 4GC5A 1KR5A 2HEOA 1HSJA 4A5NA 5T64A 2OY0A 2W84A 5FO5A 2QUFA 5DCMB 2IVMA 5GIOE 2VDVE 3T7RA 3BWBA 3EQLF 3ML6A 2STWA 5AONA 3SFZA 4RTKA 4U0WA 1UWVA 2NAZA 2K86A 3RJPA 2O0YA 4I09A 4ETSA 2YXLA 3JW4A 2WTEA 4JBAA 5E17F 4FR0A 3V7SA 3GIWA 2HFHA 5DTRA 4I98B 3RW9A 3KQPA 3R0AA 2CWWA 4PZJA 2D1HA 4MTDA 4R8SA 2K4JA 1XGSA 3GEZA 1QGPA 3M6XA 3L2CA 2ZVJA 4FS8A 4YIFA 3AWIA 4YFNF 5HLHA 3FHZA 2RQPA 3WE3A 5D4RA 2V74B 3UJ8A 5FQNA 1ZHFA 1FBNA 2CKDA 1TPYA 2P8JA 3FUXA 2XUBA 2PY6A 2ZW9A 3IHUA 2EG5A 4GQBA 4HOBA 3PFIA 1HNNA 1XSXA 2HTJA 3H2BA 4EJUA 4RGUA 4YG2F 3JSOA 3HVJA 1WXXA 1B6AA 3WSTA 3I4PA 2A5YB 3L00A 3REOA 2JZYA 4ER5A 4X63A 3I54A 5HOQA 2FXAA 1P1BA 3UA3A 1FBSA 1I1SA 1TBXA 3S2WA 3FUUA 2H09A 2YR0A 2WC2A 5CVVA 1ZG5A 2B9EA 1R1VA 2P5VA 3JWGA 3DUWA 4PWYA 4M7RA 4L9VA 3T1BA 3BWYA 5EZSA 2DT5A 3TR6A 5KS2A 1SFEA 1DUXC 3I0TA 4LGWA 1SFXA 1SD4A 1NV9A 5LSAA 1HW1A 1YFJA 3WG9A 1L3LA 3OU2A 1KGSA 1I9GA 5ICEA 2OZ6A 1BI3A 1F1ZA 3HCBA 3LCUA 5DD8A 5BXYA 4OBXA 1V3FA 3AXTA 5L3EA 1IW7F 2KJCA 5KQSA 1DUSA 5E8IA 3G7UA 2QRVB 4X41A 3K0LA 1N7JA 2AR0A 2PI0A 4C4AA 4OMYA 3MB5A 3CDHA 1L3CA 3T8TA 3R3HA 3V4GA 2A07F 4PNEA 5E20A 2QVOA 4KRGA 2AOTB 3OPNA 1F3LA 3DXJF 2A3SA 2FPOA 2GXBA 1NW5A 1JSXA 1SQFA 2HV9A 5P8WA 4RVHA 4U0VA 3BP8A 3ECOA 3HHHA 2AXLA 5E18F 3EGIA 1NW3A 4HAMA 4OX9Y 1ODDA 5EPEA 2P5KA 5GIPE 4L5IA 4C03A 4ENMA 1FNNA 4GO1A 3P7NA 3TOSA 2ONYA 1G3TA 1SUIA 4RWZA 4CKBA 1P1CA 5K0CA 2D45A 4BHPA 4ER7A 2CQKA 2VBYA 2RV8A 5K0GA 3FM3A 5FADA 2FBIA 4KIFA 4BLWA 2A61A 1QQIA 2A14A 5D4SA 2N47A 5D5VB 3JSPA 4RTJA 2PMUA 5D8LB 3H92A 2PXCA 2BZGA 3EVBA 5FA5A 2PG4A 3W6KB 2C7OA 4RB3C 3M8FA 1U2ZA 3L8DA 3UWPA 4QPNA 2G7UA 1JQEA 1IN7A 4GGGA 3RKWA 1MDMA 4UNOA 3WGGA 2PXAA 4E31A 3VFZA 2LSOA 2ADMA 2J5PA 2LNBA 3EVCA 2C6YA 5CCXA 4I2OA 2ETHA 1IM8A 4BY9E 1SG9A 1HKSA 2FRXA 4XLNF 2NNNA 3KQOA 4UXNA 3AAFA 4MHGA 2VZ9A 4RGRA 2B2CA 4AX8A 2FEZA 1LQ1A 2WK1A 2Z99A 4KDPA 3FPGA 1UHWA 4A2UA 3TLJA 3HCFA 5E2AA 1GXPA 4PIMA 2IP2A 1S7AA 2VODA 4MNUA 5JI6A 1RJDA 3GDHA 4IHSA 2MLKA 5EC8A 2YU3A 5LGTA 3E23A 4CKCA 5DTQA 1XDZA 3KPWA 2DBBA 1IXSB 3JWIA 2DTRA 2QENA 1ZRDA 3O6BB 3JAMK 2P7CB 4LG0A 1KIAA 3ZQ7A 3SR4A 5DX0A 4UOEA 1UFKA 4WXHA 3H3ZA 3NJRA 2HQNA 1I4WA 3GJYA 4XSZF 4E2YA 2H1RA 1XMKA 3GFIA 3NDIA 5H20A 1YZ3A 2L4MA 3MEXA 3KETA 5FUBA 2M1BA 3KPUA 2XVCA 2GPYA 2ESRA 1SD7A 1NW6A 3SSOA 1X19A 1XCJA 3E7PA 4G56A 4IVNA 5DM0A 3GFMA 2HGCA 5BPIA 2E1NA 2RNJA 3KQMA 1I27A 3D0SA 1K7AA 3EUHA 2XKPA 4LMYA 4I7HA 3HVIA 2P3QA 3ABUA 5LQRA 1SAXA 2Z6QA 4IPAA 3NVMB 3G2OA 2OAZA 1RI4A 4G94A 2H94A 3R61A 1IN6A 3G89A 4QTTB 2NS0A 5KVRA 3CJRA 2EJUA 2NRAC 2PKWA 3UZUA 3U2RA 5HIJA 3ZPLA 3NDJA 1MZBA 3UJ7A 4S04A 1ZRCA 2GA9A 3GVAA 3Q87B 3V7RA 3WTTC 4EQZA 4IV0A 1FY7A 2BR4A 1JG1A 5ED4A 4OIRF 1YFHA 4KNYA 2H6BA 3CLOA 5BMZA 4UV8A 4RB1A 3HA3A 3DP7A 1OYYA 1ORIA 3ELYA 3THSA 2GIVA 2DPDA 4Y30A 5EMJA 2V1UA 1HKQA 4IRGA 4CYDA 4U7DA 5HIIA 1XXLA 1AF7A 1HXDA 3AXSA 5FLXK 3GRZA 3HRSA 4MQ9F 1P6RA 2NP7A 4PDKA 5LHHA 5IT9K 3RTRA 4MQ4A 4HLYA 3PX2A 2XYRA 2P35A 5LLQA 3JWHA 3X0DA 3CCFA 4OINF 2FRHA 3COAC 5K01A 1XCBA 3R0JA 3E5UA 4DQ2A 4KA4A 2ZULA 3KU1A 1T2KA 2MLGA 4RAZA 2XAHA 2G1PA 4BHBA 1Z7UA 2C7QA 3P9NA 4ON0A 2R3SA 4HX7A 4Y13A 1AWCA 3OCJA 1Z91A 5ILUA 4ZYDA 3QV2A 1WI9A 3I59B 3KQTA 5AIQA 5GM1A 1R00A 1U5TA 3UBTA 3M6WA 3EEYA 3E6DA 3E6MA 3UJAA 3BWCA 1TLHB 1I1GA 1FYLA 4M6YA 3R6SA 4POOA 2RKHA 2PX4A 2FBKA 3FTDA 4PCLA 3R60A 3SZTA 4H0EA 4M73A 4KDRA 1OYWA 2Y75A 1DP7P 5DTMA 5CD1A 2KKOA 2AN3A 2AOUB 4EM1A 1KU3A 1YW8A 3TRKA 3DR5A 2UZKA 2VT2A 1FWZA 3HRUA 2ZNYA 3HSFA 4DM3A 4HX4A 1ZN2A 3P2EA 3ZMZA 2XYQA 3TQSA 1QZZA 4LWOA 4EGZA 3E5QA 3BJOA 3KP4A 2FOKA 4MTLA 5C1IA 2F8LA 5ERGB 3E05A 3TQNA 1NW8A 5K09A 1Y0UA 1VPTA 1ULYA 4UUVA 5KQRA 1XN7A 5J8CA 2IRFG 5F6FA 3M6UA 4BNCA 4AWXB 4NECA 3KFWX 1W5SA 3B89A 4NB5A 1FLIA 3UFBA 4OQDA 4RYLA 2NXJA 3WTYC 1R8XA 5FA8A 2G7HA 4M72A 2EFPA 4O6JA 1XVAA 3KP2A 10MHA 4IRHA 3PVCA 1ZGJA 3OFKA 1H9GA 3AY0A 2EV5A 3TO7A 2P8TA 2EB7A 2TDXA 3O3KA 4ASNA 4P58A 4Q48A 5CVIA 2VN2A 4IJAA 3KLOA 2FK7A 4ER6A 5DCMA 1FP2A 3DULA 4GBED 5DM2A 4KMFA 2QQBA 3EDPA 3FPJA 1MHTA 4CXMA 2FF4A 5LHIA 3TO6A 5LEKA 4A0XA 2VXZA 2DW4A 2K4BA 5DYMA 4B17A 1R74A 4ATNA 2LDUA 2E7WA 1BHJA 3T0YA 3ZMVA 2IPQX 3PT9A 5LHGA 2Q0OA 4OMZA 3F8FA 1K6OA 4L0ZB 2O6GE 2W25A 4WVLA 4AZTA 2G9WA 2HS5A 2EA4A 2JRTA 2VBXA 3GGDA 4P7FA 1P39A 1FBUA 3KQQA 1S8NA 2F5EA 5E1ZB 2PMHA 4LK0F 3SXJA 5HVQC 3GX4X 3T5XA 2ZWAA 2AOXA 2DPMA 4BH9A 2Y48A 3ABTA 3SZPA 3CC8A 3LKZA 1FP1D 5DV5A 5E8JA 3UJDA 2PVCA 3AJDA 4RB0A 2CWEA 3G88A 1RI5A 1YW7A 4BAYA 1EJ6A 4MWZA 4YV0A 1N2XA 3NW9A 4G6DA 3FZGA 2Q8KA 1VL5A 5BW5A 2IJLA 3HSEA 1AQJA 1BI0A 3VC2A 5E9WA 1R58A 1IN8A 2YSRA 3HRTA 1KQ9A 3K2ZA 2XBMA 5F64A 1M6YA 3WTWC 3F3XA 1LEAA 1O3QA 4QWQA 1P4AA 4C05A 4L9NA 1FC3A 5GM2A 5FWAA 2E5WA 2XAJA 3TOAA 2FMLA 4Y15A 5CVEA 5EG5A 3GNLA 1J5YA 2YR2A 5K5OA 1ZRFA 4RS8A 5C0OE 3BJAA 5CIYA 2JTVA 4GF5A 1JG2A 5HS9A 1X3UA 2EA2A 2NP6A 1G3WA 5BS6A 3O31A 5LRSA 5GP1A 2QM3A 3TMAA 3I64A 3EPPA 1KU7A 4FSXA 4HGYA 2GQQA 2L02A 3IYLW 1ZARA 5LQJA 2FHPA 1TW2A 4E32A 3GF2A 2QRVA 3M8EA 3OU6A 5IT3A 2Z33A 1V39A 2P40A 3U9GA 5HZMA 5HDKA 1YG2A 1RI2A 3G2QA 3F8NA 4HX8A 3O2PE 5K1YA 1FT9A 2HTEA 1GXQA 2H00A 1FSHA 4XUDA 4HF1A 3IC7A 1INLA 2EFJA 4U7BA 2EX4A 2NXEA 4BP3A 4FHTA 3QPHA 4AIHA 4EGYA 3NWBA 1F4KA 3GLXA 5F1RA 1O7FA 4UHTA 4F86A 4HF0A 4HYEA 1IXRC 4FZVA 3RI4A 4ENKA 1EV7A 3G2MA 4XUCA 3BY6A 1WWXA 3PQKA 5H6QA 2P6TA 3HYIA 2LKPA 4P96A 3DV8A 3V97A 3B5IA 2JT1A 1EJ0A 4BLUA 3FX3A 3UJ9A 5DX8A 3HCCA 2HKXA 2OKCA 3TDUC 3KQVA 2GXGA 1S6LA 1XDUA 3GZ6A 3LA2A 3A26A 3ELDA 1KU2A 3BZ6A 5HIMA 3HVKA 4G8XA 1HSTA 1R5GA 3T7TA 2EWNA 1SD5A 3WTXC 2KJBA 5HS7A 1RI1A 2QBYB 4EK9A 1WXWA 5EVJA 4PGHA 3J81K 4PCQA 2M5WA 2A6EF 4CO8A 2IGTA 2CO5A 2Y0MA 3P8ZA 4G7OF 2RC4A 2W57A 4WWCA 1IY9A 3ULQB 1QAMA 2FK8A 1JQ3A 2UYQA 4Q5SF 1FYKA 1ON1A 5D1NA 4FGZA 4A0ZA 4KUMA 4XCXA 1JG4A 5FD6A 1MJAA 4B09A 3OV8A 3KEOA 1TNSA 3I9FA 1YLFA 3MFKA 1QYRA 1CGPA 1UCRA 2WA1A 3QP6A 4KIBA 2FMYA 1REPC 3KQWA 4U88A 3HEMA 3O7WA 3F8MA 1BIBA 1WQ2A 4ZZDA 2ZKZA 1R1UA 4ER0A 1PRYA 2P41A 4RGSA 3MQ2A 4X60A 2F5DA 1GVJA 2PLYA 2A68F 1P91A 4RTOA 2VOPA 3KPYA 3EEOA 3LFKA 5CVDA 1TQIA 1YTYA 6PAXA 2EK5A 1YIOA 2XIGA 3LCCA 4N0BA 4MIKA 1VP3A 4I0BA 1ZYRF 3ECHA 3DXZA 3U1DA 4P7GA 1VTNC 2OQRA 3MAGA 1P92A 3K6RA 4YMGA 2W24A 4WK8F 3EVEA 2P1DA 3GO4A 1L3BA 2VP3A 3RPQA 2L01A 3N4MA 3J7AO 1YS6A 3DXYA 1G55A 2XAGA 5FQOA 3TFWA 5FTWA 4D0PA 1LVAA 2GS9A 2OXTA 3P9IA 4HC4A 3SQNA 4KN7X 3BXOA 5CJ9A 2LF7A 3DPLC 2PX2A 4UVBA 1KP9A 2JHPA 3CUQA 3FM5A 1MJ9A 4A6EA 5GINE 3EVZA 3SSMA 2GB4A 3ID6C 4KN4X 1R23A 5DPMA 5ICCA 3QOPA 5TRDA 3NTVA 5E8GA 5KK1A 3FYDA 2XKOA 5K0EA 4PONA 2L4AA 4KVZA 2DLLA 5FWDA 2ZIFA 4HSGA 1EIZA 4YUVA 3CUQC 4RVGA 5DRTA 5DSXA 1SMYF 4V0QA 4CGZA 4HDUA 2GA2A 2ZWVA 2P7HA 1F9NA 3K0BA 4M9XA 2FQ3A 4ESJA 2CMHA 3J80Z 2UYHA 4M9ZA 3KZYA 2IW5A 1IUYA 3ER8A 2Z5UA 2OA4A 4PGGA 5L3DA 2CMGA 3BUSA 4C04A 4CZZA 2B3TA 3ELWA 2OBPA 2ZTHA 5AIPA 4HV5A 4IKPA 1T39A 5DM1A 1D5VA 3TM4A 2OBFA 2C7RA 3HM2A 2X4HA 1SQGA 3CKKA 5GWXA 1D2GA 2PN6A 1QNTA 1HQCA 4PCAA 3IRRA 4HTFB 4YV1A 3HA5A 3E5XA 3DFGA 4DNCA 1D2CA 3MCTA 2D2WA 1K78B 1W7PB 1ZREA 3KR9A 1AV6A 2I62A 4U7PB 1BJAA 4IF4A 4IV8A 4EM2A 1O3RA 4MTEA 2ISZA 3OE5A 2K7LA 3IKTA 1I1NA 4ZH4F 4HH4A 4P7KA 3JTGA 4Q4ZF 5JVTA 2GWRA 4M74A 5EKUA 2QYOA 3UJ6A 3C6KA 4YUYA 1DPUA 2OYRA 2VS1A 4EM0B 4V0RA 2B78A 4QDKA 2BR5A 4HQEA 1VBFA 2OB1A 3I59A 3K1NA 1O9HA 3FRIA 3RODA 1O3TA 3EYYA 1EAMA 2BM8A 4LECA 3DQVC 2IA0A 1VLMA 3O4FA 5CM2Z 2M8EA 3DXXA 4A0YA 1P4XA 4E30A 3RDIA 2GLUA 2KW5A 1AOYA 5BP7A 3G3ZA 1X1DA 2M87A 2STTA 2AN5A 1NV8A 2BBYA 4BLVA 1L3IA 3C7JA 2KIFA 2JJQA 1B9MA 4RTPA 5HFJA 2UYOA 3BGDA 1JSZA 2H27A 3ZMSA 2AN4A 4ESBA 2AOUA 3BPVA 3GXOA 3KPVA 2HKOA 2ZJ2A 2LF8A 2BYVE 3SM3A 4G7HF 3SVZA 2PQ8A 5EZQA 4DF3A 4AZVA 2VOOA 2HWKA 3V8LA 1Y8CA 1RNLA 2ZFUA 3E6CC 2ERCA 4BXUA 3LKDA 2PGXA 4WXCA 3FRHA 4G9YA 4NQWA 3MTIA 2V9VA 5K0NA 3IL2A 3VC1A 5FCDA 3IWZA 5ICGA 3C3WA 1HBXG 1IXCA 2ZBKA 3L7WA 3F23A 2ONZA 3P2IA 3THRA 2V1XA 1ZKDA 3Q9SA 2IA1A 1VQ1A 3FYCA 2DK5A 1XTPA 5B1SA 1DL5A 1ZQ9A 4A12A 2O3FA 1U2WA 1UFMA 2QWWA 3CJQA 1Z1DA 1WY7A 3HCEA 4QVKA 4E33A 3LDFA 5TJJA 2EV6A 3KQYA 4DQ0A 1PP7U 1FX7A 4PYLA 3T8RA 1CF7B 1MJFA 2O06A 5KVAA 2QE6A 1IZ1A 2Z3YA 2Y1WA 5K0FA 5A2QZ 1RJEA 4FT4A 1XCLA 4I0AA 4BHCA 2IT0A 1T6SA 1IN4A 3LHDA 3LX6A 3CO6C 3CBGA 3U81A 2ESNA 3I5UA 2YX1A 3HSRA 2EV0A 2HR3A 4P9FA 4YIIA 4LG1A 2P4WA 1BC5A 5J8FA 3FXRA 1T0FA 2PBFA 3LQRA 1Z3CA 4U7TB 1G60A 3ORHA 4GOMD 3C3PA 2NXCA 4E2ZA 5H6RA 3P9KA 4PYJA 2ZLBA 4IRIA 1EH7A 2OZUA 3I71A 1BC8C 2ACJA 2FNPA 1MGTA 1XGOA 3FUVA 4PYQA 1B9NA 3DH0A 4KIGA 1JR4A 2DFIA 2PT9A 4MEYF 5K0BA 5FULA 1VE3A 5DLYA 3B3FA 3JWJA 1BOOA 4YFKF 3HHGA 2X0LA 2P7VB 1RJGA 1WSUA 1SVUA 1BI1A 4O29A 3QAHA 2IDJA 2O07A 8MHTA 1I5ZA 1U5TC 3WGHA 2IIPA 1F5TA 4L9JA 4HLXA 4WXDA 3LBYA 3KP3A 3M4XA 2XV4S 1IF1A 3OU7A 4KFCA 1JE8A 4DKJA 1H9TA 2VE9A 2DK8A 3G8AA 1YFLA 1PDNC 4GOLD 2ISYA 1JTFA 4EVIA 3KR1A 4AVPA 2B0LA 3EVFA 3WU1B 5DRYA 2OB2A 1G38A 2PBIA 2ZFWA 3GW2A 4X1OA 4G6QA 3F6OA 1O7LA 4GOOD 3L09A 1YQAA 1STZA 4BQAA 1BM9A 3LGAA 3M33A 4AD9A 5CVJA 3LWFA 5BPDA 4HV6A 1SFUA 1IRFA 2VT3A 4OOIA 2A6HF 5HEKA 3ERCA 2Z6AA 5CYVA 1G3SA 1X1AA 4QQNA 3T7SA 3W6JB 3KHKA 1R5HA 5K0LA 5CLSA 1NBHA 2DI3A 4ESFA 2CSOA 2E7XA 5CCBA 3WTUC 3A4TA 2G72A 1TTYA 2YVLA 4GC9A 3HCAA 5EEGA 4AZSA 1FYMA 4OA5A 2OPBA 3KLNA 4FT2A 3F4KA 3TPZA 3MCZA 3FTFA 2ZIGA 1SUSA 3HOSA 1J75A 3FPFA 2F5FA 4JXJA 3HTSB 1XSVA 2AVNA 4RTRA 3KPJA 1KYWA 2B25A 4ISCA 1OMIA 1DCTA 4EV0A 1RIOH 4OA8A 3SX0A 4KICA 3RYRA 5LGUA 2FCAA 3E97A 4AIJA 1WS6A 4DMGA 4HZFA 1G8SA 2CFXA 4GXOA 1LDKB 3CUOA 3WTZA 4P7JA 3BWGA 4MHTA 3UA4A 3IRQA 2FA5A 2YXDA 3KP7A 4O3MA 1R36A 2ZIEA 1USSA 2ZMEB 3FMSA 3EGVA 3SXYA 5EHIA 2ZBQA 3Q9VA 4OQEA 5JR3A 2DQRA 3PFGA 4HG2A 4FX4A 5LQAA 1S7OA 2P7IA 1FSEA 2A69F 1VIDA 3F8CA 2P6SA 3BKXA 4F84A 3KQSA 3LECA 4Z2YA 4R05A 1J0RA 3LPMA 1EG2A 3LL7A 3GFLA 3FMQA 3H3UA 3EVGA 4GOND 3WGIA 2CW0F 3GYHX 1QBJA 3PFHA 2NNWB 3BGVA 4JK1X 4R6WA 4YUXA 3ZN1A 3ANXA 2ESHA 5CVRA 2QBYA 4AZWA 1G8AA 1UHMA 3KCCA 4HDVA 2HDCA 2AOWA 2JH9A 1KHHA 5ERIA 3HIFA 4FT8A 2RN7A 4MGRA 4EJTA 4EJOA 3M6VA 3KR2A 1Q1HA 2VONA 2Q41A 3I53A 4R1HA 1H0MA 2V79A 2V7EA 2JPBA 2IPXA 1XCVA 4EKGA 3ROUA 4A6DA 4L18B 5GOZA 2K27A 1R22A 4LK1F 1FPQA 1Q0SA 3J80K 2VDWA 3L9FA 2PWPA 3LBFA 3B7PA 1JG3A 4KWCA 1R1TA 3KE2A 2Q2EA 4Y17A 5FLXZ 3ZMTA 2NNYA 2ORED 2DULA 4QVGA 1ZG3A 3K9TA 1TQPA 4LB5A 1EQAA 2J5OA 1YZHA 3DPTA 2ZO4A 5DXAA 1E2XA 2CGPA 2R6ZA 1JTEA 1VP9A 5DUKA 2V6CA 1KQ8A 4PYMA 2CL5A 3LAPA 3RPUA 3LCVB 4AUKA 2CYYA 2AOTA 2G70A 3KR0A 4AIKA 4HBLA 1ZG1A 1B1BA 1L0OC 2EFOA 3R9XB 3S68A 3HUGA 4P55A 3EVDA 2EJTA 3BDDA 3HOTA 2HOEA 1RUOA 3K1MA 3TDZC 4E2XA 3F21A 5EKXA 4M6XA 2Z6UA 5K05A 2ADUA 3LA7A 5L3BA 2YUIA 3BPXA 1R8YA 2DPUA 5FFXA 3DTNA 1JXSA 3PS9A 4QQKA 2AZTA 2OO3A 1KYZA 2K02A 5HIKA 1HW2A 4CKEA 3HTUA 1ZGAA 2EFWA 4O5VA 3IV6A 4LJZF 3PTAA 5LQNA 2HR1A 2PV0A 1OKRA 2XRNA 2NYUA 3D5LA 4RTMA 5DUIA 1L9KA 2FSWA 1BOAA 2ZBPA 3MAJA 5DT2A 3BKWA 1D3YA 3DKWA 4S05A 3F8BA 5HDNA 4P5OA 3EETA 3MZYA 4RX1A 4BP1A 5LR6A 3ELKA 2OQGA 4QTUB 2YX7A 4LFUA 2IFTA 3R24A 3G8BA 4LLNA 1PP8F 2IBSA 2MA3A 3CJNA 3IHTA 3CGGA 4CTJA 3ZMUA 4WX9A 3OOPA 4P9UA 5FHRA 3QU3A 3G2PA 1RZ4A 2C7PA 3K69A 1B59A 3FMRA 1K79A 2XAFA 5HS8A 4PYIA 2RDPA 4E70A 1A04A 1P4WA 1IRGA 3HP7A 3A27A 4UVAA 3MERA 3BGIA 4C07A 2ZZKA 4PYKA 2O0LA 4FX0A 4JQFA 2G71A 1PJZA 1QPMA 4HQMA 3EMBA 1BIAA 1J2XA 5FD5A 4XLPF 3P71T 1ORHA 3FF5A 3ZN0A 4ZZLA 3WE2A 1L1EA 5DSTA 2OZVA 4HTFA 3BWMA 1YS7A 3E3VA 1OR7A 4QLCU 2PWYA 2QY6A 3CVOA 4YUZA 2M30A 1K78A 1E17A 1W7PA 3G5TA 2V1DA 1XSDA 3M7GA 3MHTA 5EIWA 4L5JA 1EH6A 5F2OA 4IXAA 3B73A 2UXNA 4LD5A 5A2QK 5U4XA 2QZ8A 3BJ6A 2ZZMA 3DEUA 2HYGD 3TO9A 3DF8A 2AS5F 3M9AA 3HCDA 2PFBA 4PYNA 3LDUA 2QLZA 3C6MA 2GZWA 2UWMA 4RTSA 1W5TA 1D2HA 5F2KA 2R7DA 1HKTA 4DCMA 2L54A 4RGXA 2P3LA 3F22A 5IH3A 3F6VA 5EMKA 3KP6A 3QU6A 1NE2A 1X1CA 5EMLA 3LA3A 2P5LC 3A7DA 3SGLA 3FWEA 5F2NA 3C1DA 4LLGF 4EJWA 3B3GA 4YUWA 5K5RA 4PYOA 2BGCA 1TQMA 3V8KA 1JHFA 1G6NA 2VBZA 1RUNA 2PX5A 3SSNA 2DQLA 2RGVA 3QPTA 1KPGA 1NT2A 1OR8A 3GRRA 5EQJB 4YV2A 3E6BA 4KYWA 4R79A 1G6Q1 3PB3A 5JHUA 4QPPA 4N9IA 2JSCA 5DD4A 1I6XA 5DEQA 5EIFA 1DDNA 5IKMA 3WU0A 4FP9A 4H0NA 2FYTA 3NEUA 3QP5A 4C06A 2BH2A 5D5UB 4ENJA 2IH4A 1RI3A 1LDDA 1FOKA 5ILSA 3TKYA 2XVMA 2IH2A 4RSRA 5MHTA 1WKMA 1U3EM 1D8JA 2MH2A 4GYIA 5BW4A 2GAFA 2O05A 4L9TA 3TKAA 5D6EA 1KXZA 2VE8A 1FBQA 5E9QA 5K03A 1S3JA 4F85A 5CVUA 3V7CA 2FNAA 1MJBA 4OIOF 5BQTA 3K1PA 1QZYA 4BYYA 5JFRA 4M38A 4C08A 4HA8A 1B4AA 1QO0D 5KYGA 3FXUA 4WF2A 4GEKA 2GAUA 2H6CA 4UVCA 3VYWA 3NQOA 4ZYEA 2F5CA 3FPHA 1UIRA 4HW0A 3ER9A 1CF7A 1XMAA 2COMA 1XD7A 2VC0A 2I6GA 2KIUA 2O03A 3KP5A 3ZMDA 3GWZA 4CXFA 4GCVA 4EJVA 3V8JA 4RVFA 3GRVA 3G5LA 3GU3A 4K2EA 1KU9A 3VB2A 4GYGA 2XROA 4MEXF 2UXXA 1MD0A 2OD5A 4RVDA 1G3YA 5ICFA 2DO7A 3DLIA 1XGNA 4MQVA 3OFJA 1J7KA 1KQ0A 4LB6B 3FZVA 5EMMA 4I02A 3D2LA 3C18A 3BT7A 5D8KB 2FBHA 1U6GA 1U8RA 3DMHA 2GA1A 5K5QA 2MH9A 5LBQA 1T43A 2YQZA 2MD5A 2M45A 2JHCA 3JTHA 3DLCA 5LQCA 1W4MA 1WG8A 2R7FA 2JHAA 4KDCA 2FE3A 2EFQA 3FXQA 4KT5C 1SD6A 3CTAA 4QDJA 1LJ9A 1IXKA 3FPEA 4ZYHA 1U78A 5HOOA 4LWPA 2YTZA 2XAQA 2XASA 1JHHA 1ZLKA 1OYIA 1ZLJA 3CUQB 4L0YB 1HMYA 5E1OA 1QANA 1PUEE 1ONVA 3GRYA 4EKIA 1O3SA 1TNTA 3VEPA 3UJBA 1Z6RA 5K0JA 1ON2A 3VOEA 4RV9A 2XVAA 5T6BA 1P2FA 1KA8A 3KKZA 3KZZA 3R6TA 4R8HA 4CWAA 3J81Z 1YF3A 5DM4A 2ZCWA 2JH8A 3MZHA 5E2BA 1MDMB 3LSTA 1Z9CA 4RTQA 1Q0TA 2EFNA 2YXEA 5T67A 2PXXA 2ELHA 4M36A 3PLAE 4M37A 2HYFA 4DCGA 2PLWA 1RI7A 1O9GA 1LDJA 1EH8A 1YUBA 4CICA 7MHTA 1MKMA 1W7PD 3HVHA 4EMSA 5EGSA 3NWEA 2NYXA 2AVDA 3NMUF 3RIRA 2D1VA 3BZBA 3EGEA 4Y2HA 3UJCA 5E1WA 1NW7A 4L7VA 9MHTA 5E1MA 2I7CA 1M0EA 2RVCA 5D5XB 2O61A 1ZAOA 2BR3A 3M70A 4DZRA 2NXNA 1N7IA 1GHCA 3BROA 3GFJA 4PIPA 4A5MA 2I9KA 3C3YA 3ELUA 2HNKA 1OPCA 1DPRA 2DU9A 1R18A 3LAJA 2LD4A 2F2EA 2QQ9A 4F7ZA 3RKYA 2GH1A 2IA2A 3GCZA 3FUTA 3OZRA 2PJPA 5DWQA 2PSSA 3Q7EA 1B42A 2W85A 2O8XA 4M71A 2Z9OA 3MTEA 4YMHA 4LG0B 3VODA 4OIQF 5DX1A 3OZSA 4CDGA 5LEJA 1BI2A 2ZZNA 2QQAA 5EEHA 4HRAA 1O54A 3HRMA 3R0QA 4R8RA 5HLGA 2VDUE 2ZMEA 1YW9A 1R6AA 1AQIA 4ER3A 3PX3A 4OIPF 3A25A 2XGXA 3P9CA 3NRVA 1O57A 4FSDA 1IAWA 4KW7A 3DMGA 3SMQA 4IHTA 1LEBA 2PJDA 5DXJA 4RAYA 5L3FA 2L3DA 4TV7A 4G7ZF 5K8VA 5FB2A 2ZBRA 4U0YA 1IN5A 5HLIA 5ILVA 3I58A 5DCFA 2HQRA 3ZP5A 1J9IA 2HTSA 3QOXA 2G8NA 2PEXA 3RYPA 2AS0A 4XUEA 2UYCA 5E8RA 3EVAA 3MQ0A 5E1BA 4GUAA 4XBFA 4YFXF 3LDGA 3Q5FA 5EHGA 3OE4A 2MBFA 1F38A 3WODF 1QAQA 2YPRA 4N9HA 1G4DA 4OU0A 3WTVC 3CJTA 2K4MA 5LQUA 2BV6A 3HTXA 1WRJA 1XGMA 4I01A 3TGNA 1RJFA 1T98A 5HDGA 2PX8A 1LB2A 1BBYA 4E2WA 3HNRA 4CHUA 4XRFA 5BOXA 2BM9A 3P2KA 1FZPB 1D8KA 4UV9A 1BKYA 3DMFA 1YYVA 1SMTA 2XYVA 1JGSA 5LRRA 4ZYGA 2UZ4A 1NKVA 4EQQA 5LGNA 5C9ZA 3FTCA 3RKXA 1YO5C 1M6EX 3DOUA 3M1EA 3IEIA 1S29A 5L3GA 4R6XA 3R4KA 3IWFA 1ZH5A 2XHKA 4M9SA 5L3CA 1BN5A 3ISPA 4NHJA 1NBIA 4OBWA 1KPIA 1YB2A 2HMYB 1Z05A 2DAOA 1KPHA 5G02A 5FHQA 4DA4A 1T38A 3JAMZ 3GRUA 2ZNZA 2O57A 3B3JA 2KRFA 3CO7C 2IBTA 3T0IA 5H02A 4RB2C 3TM5A 4B8XA 1UB9A 2OU2A 3EYIA 4ZTBA 3MGGA 1JQDA 4CTKA 4IWNA 3NVKI 1XB4A 1TW3A 2BE5F 1WZNA 1R7JA 1LNWA 4HF2A 1U5TB 2HWVA 4Q47A 3EMDA 3P97A 1XDSA 2P3OA 4K6MA 4WCGA 3VSEA 2CG4A 2MC3A 4XSXF 4HGZA 5HILA 3IKVA 5EOVA 5DDGA 3ME5A 3F72A 3C0KA 3BOQA 1Z6TA 3FTEA 3WTSC 1X1BA 3KEQA 2ZSUA 2ZXJA 1V4RA 3B02A 2HZTA 2WWYA 3E8SA 2FU4A 1BC7C 1FJXA 2VC1A 5D5WB 2Y1XA 4PINA 5J6XA 1QAOA 1XJ5A 3N97A 5JUWA 2ZCJA 5FGMA 2PT6A 5D6FA 3PQJA 4RTNA 5CUQA 1C0WA 4ENNA 1SKMA 4LLLA 3HA7A 3V8VA 2JG3A 1NHAA 2IH5A 3G73A 5FFZA 5LQKA 3QOWA 1J59A 1HW5A 2YX4A 1H1DA 2H11A 1USTA 2WV0A 3GZ5A 4X61A 2VBWA 5E9JA 5E1XA 5E1DA 3TOBA 3A7EA 2BEOA 2IDKA 2EJRA 3MWMA 3FUWA 4KMUX 3RIEA 2E1CA 3GO5A 5IT9Z 3GUDA 4RTLA 5M5BA 5D1HA 2KIMA 3OZTA 2AOVA 2WA2A
chains in the Genus database with same CATH superfamily
1BVHA 1EESA 1YACA 3W06A 1V2HE 4KQFA 1KH2A 1Z15A 4PNHA 4JK3A 3A6HA 2WTNA 5C8XA 2OM2A 3OSZA 1N5LA 2WTEA 4FMDB 1G8MA 3I2FA 1MX1A 2HD4A 2VDQB 4D6YA 5SY4A 4WV3A 3K4JA 1FTSA 2VJAA 2VRBA 4H0CA 4FS8A 4PBSA 2P69A 4YIFA 3BCHA 1UBEA 3ZOBA 4MS1A 1MT3A 4BB6A 2PY6A 3AF6A 4Z9FA 2LE0A 1HLDA 3B48A 3GLHE 1IJFA 3H86A 2QU8A 2O8DA 5ALVA 2FXAA 1CKEA 2CXUA 5CVVA 2GAAA 2HPHA 4TKZA 2JA2A 4WMLA 2VPIA 4L9WA 3DMNA 3S3NA 2FMUA 4R5MA 3FJOA 1YFJA 4J0DA 3LX8A 3OC0A 1I9GA 4MW1A 4M3EA 4LJRA 4OJTA 1M8PA 2GX6A 5H83A 4FK8A 3HOZJ 3VPSA 3Q5DA 3CS3A 2HEIA 4HWOA 2ORWA 3QEMA 4RFSB 5A4JA 2Q2VA 3PSHA 2GXBA 3PGVA 2ZTMA 1OWPA 4LF6B 1ZINA 4B7AA 2NZYA 4FLFA 2ZDGA 2WAEA 3ZDZB 2VJ4A 2GBGA 3RTGA 2WBLC 4CKBA 2CBGA 3L2OB 4QSMA 4BLWA 2VJJA 1QQIA 1SY7A 2J31A 4UBJA 5FKJA 2PMUA 4PJJA 3X2EA 3EVBA 3OTGA 5C4IA 1C7EA 3Q1KA 3RKWA 4OAYA 4UNOA 4OXRA 4L85A 3D0KA 1ZXLA 4JYZA 1G2HA 2X1CA 4R4JA 1Z4PX 2NNNA 3KQOA 1RQGA 3RQ4A 2PGAA 4DLAA 1NH3A 3MMZA 3C14C 3QOFA 4J4BA 4UE6A 3DBIA 1GXPA 3MIIA 1QTIA 3ZHXA 1IAVA 4IYRA 3BPSA 2UV1A 2X9GA 2RHHA 3AR3A 2EKBA 3OYFA 3ZQ7A 1JEYB 4BE2A 1UFKA 5CVTA 2VJ5A 2XDAA 4XSZF 2H1RA 3CF4A 1WJGA 4LDPA 3BSYA 3EUKL 3IGFA 1U9IC 1VHDA 4ZMRA 5K6AC 2H29A 3WGOA 1GKYA 4E7LA 4N5HX 4YRDA 1X3WB 4BEJA 4BGVA 3PDIA 3HVIA 2P3QA 3H0EA 3K7EA 4DC9A 5L95A 5LIRA 3DZCA 4NS1A 4C0HA 5EHXA 4LBYA 2QRLA 5JAQA 2E87A 3SZRA 4Y2VA 3UZUA 3GY0A 5FOTA 4LGYA 3B2NA 1EFUA 1ORIA 5EJ4A 3RVLA 2BEUA 1IBMB 2A5JA 4LG3A 3RK1A 2X48A 3BR1A 4Q5IA 3GRZA 5LZ7A 5LPNA 4D9NA 4MQ4A 2ACWA 4HLYA 5I9SA 3TZHA 3COAC 1QDEA 4PSWA 4Z4CA 3U44A 3FVQA 4FVTA 7ADHA 1THGA 4WEQA 3C43A 3USZA 3CZCA 2GRJA 4W9RA 1OE0A 1Z7UA 5HSGA 1TM7E 2YRWA 2R3SA 1Q5PA 2I3AA 1SU4A 1YB1A 5ILUA 4NX2A 4HEA2 2ZIXB 3FVTA 5BYKA 3L0CA 2WWHA 3HJAA 4E94A 1UFRA 4POOA 3K5WA 4V0NA 4MCAA 2GJKA 4G0QA 3QZUA 2FBKA 4CZ2A 2QL9A 4BN5A 1LQ2A 2XTZA 3U13A 2UZKA 4KO2S 4AURA 3KAQA 3QVOA 3WJ7A 2HJGA 1JKMA 3PTLA 5EI5A 1WIWA 3KIPA 3OM0A 3CMCO 4BO3A 3WU2C 1VMDA 2GPBA 1OBOA 2P2DA 5KQRA 3C3BA 4XLEA 1W5SA 1AUVA 2F6CA 1R9NA 3UFBA 4RMJA 2IHVA 4NCHA 2VJQA 2ZBVA 1E6MA 3VNQA 3M1IA 10MHA 3RFXA 5ILOA 4DJAA 4WN9A 3PHIA 1H9GA 4YEJA 2BDTA 2XRZA 4MMXB 1BMDA 1PJQA 4N0EA 1G64A 4FOOA 3DULA 2BM1A 5F9FA 3EZNA 1Q7RA 1KI7A 2DWCA 4RF5A 4OMZA 1U7DA 1K6OA 4CN8A 3ERMA 2EKZA 2G9WA 1VJ0A 2PVSA 3DM9B 1VG0B 4V03A 3IMGA 1Z8HA 2RDMA 3E2MA 2HNAA 4ENTA 2OCGA 4KWIA 4UHKA 1ZUHA 3VV2A 2CWEA 2HQSA 2OG2A 3MQ4A 1LJ8A 4FR2A 4NAHA 1YW7A 2OFFA 1U3UA 4G6DA 1QX3A 3LUJA 3U0VA 4WZBA 5E9WA 3IXQA 3OPMA 4R7TA 3IP1A 3FHNA 3ZS8A 2OCEA 1DC5A 5DNVA 4H0FA 1G5FA 2I8DA 1AS2A 3B9PA 5B66C 2LIVA 3DP9A 5A5DA 1J5YA 1LFDB 3P4XA 4O5OA 3C41J 5CIYA 5EGOB 5HZHA 1G8YA 3ILYA 3AVVA 3OKFA 1KU7A 1SVIA 1BO6A 2GQQA 3RJTA 5JPDA 1QFXA 4BL0B 2VDJA 3IAM2 1VMEA 4HX8A 1YQDA 5I7AA 3E9QA 3NTLA 1TA4A 1J8VA 3FCCA 4KXWA 2I7XA 4LIVA 2EX4A 4QICA 2AFIA 2D0IA 2J08A 1G5IA 2RBKA 1HG0A 3VU3A 1GSHA 5JFTA 2RHWA 4O3FA 1Y3DE 3CEHA 4KO1S 4R81A 1ZH8A 3DV8A 1EP2B 4PZ0A 1HE8B 4N6OA 5CG1A 4ZU1X 1LC0A 3LLCA 4HDRA 4M0DA 5C5DA 2H1LA 4D4KA 1U2EA 5KNBH 2KJBA 5HS7A 3NR2A 4KUGA 3RUEA 5DNEA 1CY2A 3ANLA 3AI3A 2W57A 1NN0A 1G59A 1L7NA 3HQ4O 2AXEA 3S6JA 3N07A 4KUMA 4F6RA 3PSAA 1CGPA 4YP1A 4I81A 2FMYA 3V9PA 4U88A 2XV1A 3B51X 2F5DA 1SRQA 1YS1X 1MIHA 2HPZA 4E7SA 4UNIA 4CTOA 3E58A 4KXLA 1KKLA 1DP3A 1Z7BA 3ECHA 3DOEA 3U1DA 3M5DA 4P7GA 2KT0A 1FOEB 3MAGA 3FRJA 4WBNA 5B1BH 1UJ4A 3WYCA 4C2AA 4BASA 1WPRA 3D9QX 1ZK3A 5HW0A 3WYEA 1LVAA 2VWGA 2LF7A 2CSUA 4FDLA 1RM4A 3FM5A 3ILXA 3OOEA 4YCLA 2X40A 4FTHA 1BTOA 3QOPA 4XJTA 3UMBA 1T5IA 3RFVA 5BR1A 1QU3A 1YBHA 5B1DA 3RV4A 3LZ6A 1BVUA 5DRTA 1Y1VJ 3I83A 1CEYA 4H7DA 3KQLA 1E3MA 3NGMA 6ABPA 1RR8C 4LF5B 1G1MA 5D2CA 3F6PA 4JLMA 3C6ZA 3O8GA 1MBHA 2X9DA 3F49S 3PNOA 3QBTA 5BWCA 1W0CA 4P34A 5F9HA 4PCAA 1RPJA 3R8FA 2C5HA 3G5MA 1ARZA 2AZDA 4LC9A 4N54A 5CT6A 4EHFA 4ZDJA 1XD9A 1HLVA 1PX2A 1V1MB 3RYCA 3DPSA 4QDKA 2P79A 2XSZD 3RODA 1CK4A 3BXPA 3NNSA 3M49A 4G65A 5CFMA 3NTQA 4HS9A 3LIIA 5KPJA 5G1OA 5IU6A 3E8XA 1MO5A 5CNJA 3BR2A 2NADA 3H9QA 5FAKA 1GT6A 3BHJA 2JJQA 3OIUA 2UYOA 1NKTA 2PZKA 4BVFA 5H3CA 2BYVE 4D0RA 2WAQN 4OKNA 1X80A 4LTNA 4DF3A 1XZ8A 4IJMA 1HE3A 4U8GA 2RNGA 5FWXA 4G09A 4QYTA 1EUDB 4PTYA 4E2FA 3VC1A 2FHSA 2BMWA 4GLJA 3T3PB 2OA0A 2QRUA 4AWXA 5K45A 3GOHA 1LFPA 2QWWA 3WLIA 1S4MA 1ULHA 3ZCSA 4E33A 3LDFA 5AKJA 2OORC 3EXFA 4RHYA 4Y98A 4QATA 3RYIA 4RSHA 1J7JA 3BBLA 2O06A 3WRXA 4DFDA 5E0OA 1RR7A 1D4AA 1IZ1A 1E99A 2R7TA 4DJTA 5HQ3B 1R8JA 4LYJA 3EGDB 5J8FA 3EW9A 3DBRA 1RHQA 3B9QA 4OJKA 3VHRA 3E84A 4PAGA 1BC8C 1U9CA 4MK4A 5B7QA 3HKBA 2HTFA 3H9BA 2PT9A 4MEYF 3K15A 3EZGA 3HHGA 1OROA 2XSDC 4JLSA 1RZRD 3AR2A 1JHYA 3PI6A 4Z7NB 4GLOA 1LQTA 5J4VA 4WXDA 4JXXA 4R9NA 4XGQA 2XWSA 4KFCA 1IBKB 4EW3A 1AQUA 4I2VA 1B8IB 2P4UA 4BV9A 2FR8C 3N6RA 1H2RS 2PWZA 3LPAA 3I4MJ 1F0PA 5LP6B 4V1CB 2GK4A 4ZKEA 1SHLA 2FQWA 1S72I 1VDMA 4ROTA 1HFEL 3E9DA 1X2MA 1XIVA 3RLFA 2PBZA 1U3TA 1ZISA 1CJBA 2XQGA 2O0KA 2BKEA 1EVIA 2R65A 2R2AA 1ZFNA 3HCAA 2WQ7A 4KBFA 2J9RA 1QLJA 2OAQ1 4UVIA 3IIIA 2AQEA 2BGUA 3KS9A 4N8EA 1AKYA 3ORQA 1T9AA 1KYWA 4CZCA 1JZQA 5AW3A 4M54A 4B6QA 4OHYA 4DSAA 1G8SA 2CFXA 4CEIB 5IOZA 3IRQA 1RS0A 3AEQA 1QH9A 2ZBGA 3D5TA 5EHIA 5L4NA 4FC7A 4O2BB 1QLHA 5JR3A 4B8YA 2QORA 3OWHA 1UMBA 3S0JA 2P6UA 1L2TA 5K8UA 2CGEA 4BXOB 3GYHX 4PQEA 5K2OA 4EG8A 1V6SA 4R1MA 1P3Y1 4AZWA 4WKOA 2RGAA 1N6LA 3CJTB 5CA1A 5ALLA 1U3VA 3M5CA 1N3LA 4P9NA 5CT4A 2V79A 4DLVA 2BEKA 3G23A 4XQFA 4DAOA 3TZKA 5E3LA 1M76A 3J80K 2WUWE 4JHLA 1LPMA 1T9GS 1YQ9A 2R79A 3NLLA 4XYEA 2IUSA 4G5FA 3F0CA 2GJ9A 3BG5A 1AB6A 4UEJA 4C7JA 4XRSG 2ZJFA 4UM5A 4CM9D 4PRYA 1L9XA 3LY5A 2WWVD 4JMPA 3I3LA 3JY6A 3RSHA 3EVDA 1L5MA 4I1IA 3HB1A 5F35A 1XQ1A 1DPGA 4NI5A 3LA7A 4R2HA 4BNWA 2P90A 4BMSA 1K2WA 5FFXA 3PFFA 2H54A 3W90A 3AHHA 3VZRA 3PF8A 1BA5A 4LYHA 2K02A 1R5JA 4TV8A 1X9GA 1URPA 5LU9A 1QQBA 3H2JA 3KQHA 3MAJA 1EFVA 3DKWA 1JR3D 3A4IA 2YRXA 2H8RA 3MZYA 5BUZA 1AOXA 3RU7A 1W0JA 5EJMA 1EM8B 4A91A 5CDSA 4QOHA 1LD3A 1THMA 4E6KG 1PSWA 3WQSB 5C3UA 3LNQA 2C7BA 3QKUA 3EG9B 1N2BA 1W85A 5F78A 4GQAA 4HQKA 4TKLA 4BNIA 2DB3A 1JHQA 1Z5GA 5EMNA 1E7YA 4EL0A 4XLPF 5LUAA 4RPGA 3GVXA 4RETA 1ZEJA 5JYEA 3Q3GE 3WAKA 1NA5A 4PQGA 4B2IA 3TVYA 3HJBA 2V1DA 4EG7A 1JR3E 2WNIA 2HJ9A 7YASA 1RPTA 4ZT7A 4ETNA 5AW1A 4U0KA 4OHCA 1U90A 4MINA 4BO2A 3T12A 5B3JC 3LKBA 1QO7A 1CEQA 1SNYA 2CNKA 4NC8A 3A11A 4GSYA 5F2KA 5C4GB 2BBOA 5DCWA 2W2KB 1R6RA 3FLBA 1ZK0A 4IOLA 5HFAA 5ES3A 3B3GA 1PEDA 3TQCA 1GOTA 5IYDJ 4NE2A 3CCCA 3WL3A 1ZY2A 3HJNA 5ES4B 1RBYA 2HK7A 4YRAA 2Z98A 2EZ4A 2C0PA 2QTMA 5BW6B 9ANTA 3TSAA 3R77A 1Z5OA 2RG7A 3TKYA 2ZIAA 1CHNA 3GTJJ 2VBGA 3R0ZA 3SC4A 3GPBA 4Z1OA 2GVZC 1TL8A 3A31A 3FBNB 4X92A 3DE4X 4FI3F 1DRKA 4LZWA 3D7LA 4Q21A 1JIKA 2W6ID 3AETA 3ENQA 4MUAA 4XQEA 4BATA 2KIUA 2ZJ4A 2AJTA 4BX3A 3H1PA 4EJVA 1Z75A 4B4DA 3X1JA 4WTOA 5KHOC 3P7MA 2C9DA 2Q3CA 4LB6B 4UU7A 2A7XA 4HMPA 2R751 3I04M 3UB3A 1L7OA 4ARZA 5L7TA 3BRWA 5LQCA 1L5NA 1SD6A 3CTAA 4QDJA 4MIEA 2YTZA 2RAFA 4RD1A 4TL9A 3AV3A 1PUEE 1Y6ZA 4NQZA 1X7YB 4DCVA 2RHBA 5EJIA 3QOYA 3IDQA 3ZQ6A 3AR9A 3HFJA 3STXA 4NEGA 4V0KA 1QCZA 4UOQA 4G1CA 3WO1A 3N86A 4BXXJ 1YUBA 13PKA 5KNDA 1KQNA 2QLLA 1LPBB 3BEOA 3J7AC 3Q0EA 2X4IA 2I8CA 4ID9A 2NXNA 4OL9A 2HI3A 4A5MA 3PIDA 3ELUA 3HDQA 1WJBA 2HDDA 4JBHA 1XLTA 1ZKGA 1FNSA 2LBFA 2PSSA 3RRYA 1B42A 2XCRB 1OCPA 1QHYA 3D6AA 2ZIVB 2XWPA 4H6VA 1AY0A 2ZZNA 4RM3A 4RZSA 1Y3FE 4JQZA 3PX3A 1MHPA 4NBWA 1ZTRA 5DI3B 2HPAA 3JR3A 3L07A 1GGNA 4MR7B 2WFMA 4G7ZF 2VR1A 1SUDA 1KZYC 1Y3CE 1TMOA 1BCSB 3P5JA 4UQOA 1P45A 2FOWA 2AS0A 4QBIA 4JJ6A 3VR3D 5E1BA 3KLBA 3AUFA 1NATA 4JROA 4QJIA 1Z0XA 2FPGA 5A5VA 2N9UA 1Y8ZA 4BVJA 4EVSA 1JFLA 3QPVA 2NUPA 3G02A 1XROA 2WAOA 1WCV1 1R71A 1AZLA 4MP8A 3OZVA 3DONA 4WN3A 5KYUB 1GRVA 1BKYA 4UV9A 2TECE 3SQMA 1YX3A 2YW2A 1Q57A 3NC0C 5L7WA 3ZV6A 4LF9B 1NKVA 3AF4A 3JRCA 3HPHA 1M6EX 3DOUA 2CLFB 5L3GA 3OYBA 1KQ3A 3RVDA 4OBWA 2FGKA 4UQLA 2DAOA 1T38A 1NBEA 3JAMZ 2ZNZA 2O57A 4NE7A 5EWJA 4NESA 1IB0A 3DFKA 1FFBA 5DWDA 2J6IA 4JI5B 1W44A 4CTNA 3IKJA 4ZTBA 1KBZA 2LKXA 3I42A 3HI6A 2DYRH 3HKCA 3GGJA 1HG1A 3U5ZB 2MC3A 4XRRA 4NU0A 5DDGA 4DLZA 5DGIA 1BE6A 1DO2A 2XUKA 1QGUB 2DRIA 1YONA 1WHSA 4UM9B 3RSGA 2QAGA 3JQBC 2ZXJA 2CVPA 4P0TA 1KS9A 2O9LA 5CTJA 5KWSA 3AR7A 4JP2A 3RPEA 1KJ9A 3W5CA 3AQ4A 3DLPX 2SBTA 4D9MA 1F1JA 4JT9A 2WLTA 4LISA 1WO8A 2YW9A 3UAXA 2M0MA 4YMLA 2C8VA 3S70A 2MD0A 5LQKA 4RHUA 5CFZA 3DO8A 3B52X 1WJAA 2IYRA 3NVAA 5H7XA 1Y6QA 1OA1A 3NIBA 5E1XA 3GN1A 5K20A 1BZYA 1A6QA 3R5XA 2ZE5A 4L9AA 3N2IA 3GUDA 3UJ3X 3BR5A 2VHWA 4MMZB 4FB5A 1WB4A 2M1ZA 2LD5A 1ZGHA 3MMSA 5BV1A 3ZUGA 3HB9A 3PGKA 3T7RA 3PF9A 4ENVA 3KXKA 5AONA 2QSGX 4JU9A 3MTDA 2YXLA 2CUTA 4FDUA 4MGIR 4JBNA 5GTDA 4BFWA 1DRVA 4ZMBA 3VKGA 2JH3A 2FEWB 4A3JJ 3RKQA 4PZJA 1IO2A 4FPXA 4RENA 1EGAA 2VEDA 4A1OA 5D4RA 1JR2A 2YMLA 3FUXA 3EARA 4L6CA 4F04A 3D59A 3BFJA 4K87A 4TM8A 3M89A 3IC5A 4I08A 4GFBA 2GBIA 1QTNA 2R1VA 4PYRA 3S2WA 5CW1A 2W6PA 1Z88A 2C9CA 2LMDA 2VNAA 2B9EA 1E4YA 1JW9B 5EZSA 4AS3A 4RNCA 1FLDA 2ZUDA 1PVEA 4BKUA 4KP7A 1AUPA 3H1CA 1NF8A 2TS1A 5DH9A 2XLBA 4JP1A 4MR8B 3CFYA 3E48A 4ISBA 2PZGA 4ZAVA 421PA 5BXYA 3AXTA 5I6DA 3JATB 3VH3A 5GAEJ 5FTNA 5KQSA 4QPJC 3K09A 3ZKWB 3HM5A 2D6FA 4ANFA 3H35A 3NGLA 2EARA 4YI3A 4N5NA 4OQYA 3KC2A 1M1YA 3DXJF 3FHLA 1K4MA 1PEAA 4LRWA 2DT6A 3M81A 4AC0A 2TRSB 4ENQA 3W5BA 2RJOA 2AXLA 4DVJA 4JLPA 1ODDA 3AHCA 5DF1A 2FQYA 4C03A 4D9BA 5F7XA 3DAGA 1TKBA 3A01A 4EY5A 5HM8A 5AM1A 1XEXB 1R3DA 5K0CA 5AVSA 3SR0A 3IPXA 5K0GA 3ISVA 2FBIA 4R54A 3DBHA 1VCOA 1E4EB 1O08A 2ZRAA 2PXCA 4JH0A 3QE4A 2C7OA 2P2ZA 2RIPA 1UG2A 4E31A 3VFZA 3HFGA 4GX0A 1Y89A 3L7AA 2GJSA 1YR9A 4JASB 2BRUC 2B8NA 5HE9A 4Z6YA 1CLUA 1IVSA 4BO6A 4OQLA 3GG9A 5BOSB 4PUSA 2P9JA 2FEZA 4AG3A 4ZREA 4ZDOA 3EAGA 5IXSA 3O0DA 4EHHA 5K3CA 2VRCA 4B6PA 3AM1A 4HFRA 4MW6A 1HA8A 1Z2EA 2X86A 4CF6A 2HRCA 5M3BA 1KONA 4DMKA 2DR3A 2HQNA 1I4WA 5D3MB 3BWDD 3GBGA 1QM5A 2Z8XA 1M33A 4MVCA 2GGSA 3CF2A 2Z04A 5A1JA 4G56A 5C35A 4MI6A 2ZJ1A 1I27A 3D0SA 1TEXA 2Q0XA 3F2VA 5LQRA 3H3VK 5KJ6A 1WF3A 2K9MA 1E6EA 4PEVA 5TMEA 1YULA 4RU1A 4D5EA 2PKWA 3NDJA 5A9SB 2AUTA 2HYIC 5DVZA 1KRHA 2P2LA 1FY7A 2BR4A 4D2IA 1YFHA 3CLOA 4RB1A 1GCGA 1Y5NA 4O2LA 3N8KA 2CXHA 4UU8A 4IRGA 4U7DA 1MJGM 3AVQA 4G85A 3MUNA 3ZBPA 3CONA 3KV1A 4IIJA 3ZLUA 5IT9K 2VO1A 2CNNA 5TEWA 3OZBA 1R3UA 2I55A 1QR6A 2PLFA 1CG6A 2OLEA 1FL9A 2C7QA 2PUHA 4ON0A 1YZVA 4DUGA 1WV0A 4YTEA 2IZ0A 1FPMA 1DB3A 1W4ZA 2VPTA 1A5TA 2YBDA 3OTIA 3K0CA 2CN1A 2HCBA 3U4CA 1PT5A 1TVCA 5HRCA 2D4AA 3U3MA 3CC7I 4PCLA 2IXDA 1BJTA 1TM1E 1BNCA 2IY8A 1ENYA 2NS8A 1L8XA 1ESNA 1E2FA 3A3NA 3HSFA 1R7RA 1ZN2A 4MVJI 5AXAA 2BTQA 5A3RA 4CQLB 3GL9A 2VUUA 2ZQ5A 1Y0UA 2ZITA 1YE9A 3IUNA 1KK3A 4I50F 3M6UA 4GH5A 1NYQA 4R8VA 5LLTA 4PHFA 4WKCA 2JBHA 2NXJA 2FUG1 3AVOA 4O6JA 2V8BA 5CKTA 4BLRA 1FZQA 1N7HA 3TO7A 3PFWO 2YHIB 4KJZA 5AKYA 5HM6A 1Y80A 2YMMA 4II3A 4DLTA 5JNSA 5DCMA 1TWGJ 3INNA 3H65A 2CC2A 3E35A 2ORVA 1KVRA 2J4FA 3GAFA 4HB4A 4ECAA 2ZQZA 3K35A 1ZZEA 1UF9A 3PWSA 5EJ8A 3ZKAA 1AQ6A 3MD2A 1GAWA 5ENDA 3PC2A 5BRNA 1FP1D 1EE9A 1NAHA 3AJDA 4BMPB 4L8WB 4NL4H 1OD6A 3J7ZI 4Z0NA 3L7MA 5ISMA 4HNAA 4EFDA 4Y6PA 4LSMA 5INTA 4PG5A 3FFBA 3WGNA 3G0CA 3U09A 4CCYA 2O23A 4UJ3A 4ZYUA 1X2BA 4C21A 5B6PA 5EJGA 3UV6A 4KFTA 2BDEA 2FZWA 5JS6A 4X7BA 2WJ6A 2QW8A 5GZ1A 2X3FA 2WG1A 3TF5A 4O4JA 4LJAA 1ZVJA 3ESDA 1J70A 2J3HA 5IT3A 4F4JA 1IHXA 2HHJA 1T6NA 3D8SA 1FT9A 4ZANA 1JIIA 3WYFA 2YVUA 1T13A 2PFKA 4BO4A 4NYIQ 4F5ZA 2Q4BA 3NWBA 4ZVOA 1K5DA 4DA0A 3GLXA 4P4SA 2E2JJ 3RI4A 2XZLA 4I9UA 1IQUA 4XUCA 1FB5A 5AJVB 1HM5A 2F6RA 3BFVA 4JLWA 3V97A 3FX3A 3PPVA 2VPPA 2EIKH 5J43A 3A26A 4FC6A 3T1VA 4M53A 4DJ5X 4CV0A 4HQOA 1XVTA 3VRHA 4EK9A 2WILA 4TUYF 2JIMA 1YL6A 3QUSA 4C01A 3I4CA 2Z09A 4CDRA 4XKWA 1VE7A 2I7DA 3KEOA 5C7OO 2V8OA 1EVQA 3BGSA 4CKWB 4M3NA 3U60B 1WQ2A 2AR9A 3TLAA 4YELA 3DOIA 2Y2UA 4RTOA 1J2EA 1WDTA 2GHIA 2HB6A 1C1DB 5H80A 4NNOA 1KDPA 1SC1A 4A8JB 2V9PA 3PRHA 4PG7A 3DKYA 1ZP6A 4RULA 1N34B 3TBKA 1HNWB 1UJNA 3L05A 1E2EA 1TZCA 1CUBA 4II7A 4QM7A 1X8LA 1LFAA 1ZRHA 3V3KA 1ENOA 2QYHA 1JIXA 5I7UA 3H7AA 4AWBA 1JGTA 3DHWC 3HUUA 1ZDMA 4KMSA 2BGGA 1E6CA 3BULA 3CVUA 1MJ9A 5J2UA 3WLOA 3SSMA 2IVZA 2A5LA 2WTUA 3OT1A 4JQOA 2YFQA 3QFTA 1RRPA 4EYKA 3CF5F 2J9XB 4M3BA 1N0VC 1DMRA 2L4AA 4CV3A 3T34A 2YWHA 1E9EA 4RCYA 1U9JA 1NONA 3NEYA 1VJTA 2V5VA 1P8AA 3U61B 4B33A 1H6AA 3KZYA 5CLGA 3P2OA 4J19A 2FDCA 1GGJA 5TSDA 2GDJA 3REQB 1G8GA 4O1IA 1EDBA 1P9RA 5BY2A 1OXBB 5FROA 5EE9A 4XKVA 4Y1FA 1AHPA 2YYAA 3MCTA 2D2WA 1ZNXA 1W7PB 2CLLB 1AV6A 3ADCA 1BJAA 4N76A 1SCUB 1XFAA 4C88A 4F5DA 4HH4A 3EK2A 4Q4ZF 1PL8A 2E21A 5G0UA 5JMTA 1ZJJA 4Z4GA 3P9YA 4TS3A 3JPYA 4MQUA 4N7RA 3QU2A 5CM2Z 1GQOA 3RDIA 2M87A 2BBYA 1Q77A 4TTTS 3KVNA 3DWFA 5CM8B 3TE7A 4PK4A 3A0UA 3RTAA 3DO6A 3GJ8A 3SM3A 2B61A 3QEAZ 3DOFA 1O77A 2OCYC 4DB2A 3BR3A 4LHWA 5C4JJ 3AZOA 3KZ1E 2J85A 3TG2A 4QDZA 2J6CA 1IOLA 2VIIA 5DBIA 3EEBA 2VDKB 1M8KA 1NULA 4J16C 5CLLA 1ZKDA 4ZDLA 1ZQ9A 2MINA 3QI2A 3MWGA 4P80A 1B0AA 3E9EA 3HYLA 4LXXA 1BXGA 2R7AA 1TAHA 4WLVA 3O8QB 2D13A 2MYSA 2AMVA 4CQNA 3F6BX 1DQSA 3N8GA 2BEVA 4TWBA 4DWJA 2PBFA 3BICA 5BV7A 4PYJA 1EXWA 3L9WA 2JPDA 4Q7JB 3F5SA 2IF2A 2V55B 1B9NA 5EJ5A 4I4NA 5LA6B 2NAPA 3JWJA 2J30A 3C6YA 1T0FC 4N1AA 5BVHA 3S16J 2Y77A 2QR2A 6NULA 4YJHB 4V2UA 4YH1A 4C7BA 1DQRA 4CMAA 1P31A 1DTEA 4EVIA 5D86A 3HJCA 1G38A 1BEUB 1W36D 2WICA 4LUCA 3RC8A 2PL9A 1VLLA 4MA0A 4A3EJ 4XD2A 2BGTA 1KJQA 4YXWD 3PVZA 4A16A 5EG0B 3DSRA 1ORTA 4O08A 3GLSA 1MW8X 5CCEA 4N0DA 4FT2A 4MKGA 3T8YA 1XO1A 4JP8A 3L0PA 3AU8A 4D3ZA 4DLWA 2B25A 2I03A 4KG7A 3O82A 4ERNA 3CEPB 3O8DA 3WIVA 1Z2PX 4L8VA 1YDWA 4XGRA 2ZXFA 3FMSA 5U1PA 4K9NA 2YHBA 5J2TB 1Q44A 1W1UA 3EGOA 2IBMA 4HEA6 2ZGVA 5A0TA 1FSEA 3H11B 4XB2A 4DR7B 4HWPA 2AG1A 4DDUA 3R1IA 1L1RA 4IDBA 1HDXA 3RRMA 2ASVA 4JK1X 1YRHA 3HO6A 3KCCA 4GU5A 2AOWA 3PQ6A 4EJTA 3EIHA 3OAAA 2F3RA 1ODJA 1MX5A 1V96A 4RORA 1FJHA 3O4JA 1PYOA 2ATXA 5BSWA 4D9IA 1U5CA 1FDOA 4AMVA 3T1HB 3K9TA 4GKBA 1EGMB 2EJBA 2R5YA 3INGA 1P1RA 2A35A 2ZO4A 4WFKA 5H9VA 2R6ZA 4RD4A 3J81A 2V6CA 1KQ8A 3AI1A 4I19A 4LJ8A 1ZG1A 1B1BA 3TLKA 1H9BA 4KIJA 2LH9A 3IOBA 2N8GA 4MQ6A 1KFBB 2J5QA 1ZA1A 2VUIB 1VLVA 5G53C 3O4GA 5SZKB 3C7KA 4N3AA 2QZPA 1RM3A 4CQJA 4K9QA 4N5IX 1NVKA 4KNVA 4EA6A 3RHSA 4XWGA 2E71A 1OH5A 3QMWA 1SRRA 1QK4A 1UBHS 3N05A 5B4TA 5BQ3A 1XHLA 4CT0A 1MB2A 3F8BA 5ARDA 1NGSA 4H16A 1ISPA 4RX1A 2IUFA 4PR0A 4OI0A 4V3CA 1QGAA 4C7XA 3R24A 5JD3A 3FDZB 2BI7A 1NPYA 9ABPA 4CU2A 4TN1A 5IP9J 3MINB 2FI1A 1E2MA 5B55A 3MTJA 4CVNA 1IRGA 1OFUA 4CQMA 2LY1A 2BE7A 2VHVA 2QWXA 1OH8A 4FX0A 5KCMA 1Z8DA 3PC4A 3SYKA 4OJMX 5LIPA 4HQMA 2CDAA 1TCAA 2XTJA 3UF0A 2QNBA 3DDZX 1CXZA 4WHMA 4BUZA 3TLGB 4FHGA 4J8PA 1IVNA 4HTFA 3BWMA 1YS7A 3D1VA 2DKOA 3NHWA 2O3TA 3HOXJ 1NJFA 2P81A 3M7GA 4U39A 4BLTA 1YRAA 3T7IA 2Q6LA 5AW6A 3AWDA 2O1EA 4MX8A 3IAM6 3DF8A 1CY4A 3VZQA 3QGMA 1KQFA 2C4NA 3BTOA 1BDHA 1T3GA 2ZWOA 4HP8A 2REQA 2PRSA 2Z83A 3N7UA 3F22A 4OUDB 5D6NA 1AC5A 2R5ZA 1OKKD 2PL1A 2OM6A 4BE9A 4S1VA 1QFJA 4FGSA 1GSIA 1J90A 4PZ9A 2DQLA 1ULAA 3W2WA 2QW1A 1KZ1A 2EGHA 4INPA 5EIFA 1UQUA 2ZJRF 3MEQA 3F3SA 4H0NA 2WWFA 4FYHA 5JDCC 3H3XA 3TS1A 1FOKA 3QIVA 1C9NA 3G1OA 2W43A 2Y6UA 1O0CA 1N77A 2VHUA 4IRUB 2IXGA 1L8AA 2L17A 2X1MA 4BYYA 1QO0D 1EDDA 3OYCA 1GEEA 4OFXA 1ZM7A 3QBVA 2QX4A 4TTSA 4JB0A 4EECA 1S01A 4DJFC 2Z9CA 2JJ2A 1Y4ZA 1GPH1 4CXFA 2Y05A 3GK3A 2C5BA 1Q7EA 4GBGA 2XUIA 2RAUA 3MMXA 3OG9A 1MNAA 4X54A 4AMGA 4DY4A 1A7JA 3LC2O 3BT7A 3MBKA 2VNKA 5JXIA 4BQQA 2JHCA 4X3OA 4A2WA 4PSAA 3ZJ5A 5CEEA 1GWNA 2YY5A 4W8OA 1IDZA 4EO7A 1XU4A 4HEQA 4U3JB 2PQ2A 3TOXA 4L50A 5E1OA 3D31A 3NHBA 2MR6A 1EZ1A 1C4KA 2IE0A 2CCJA 2J3DA 3H5LA 1RWNA 5HKAA 1E2QA 2PH3A 3A9WA 1BWSA 1D1QA 2JAHA 4CJXA 1KAEA 1HT0A 4OOFA 2IS4A 3IEXA 3EFOA 5AVTA 2B37A 4YRQA 2O2SA 3MZHA 4ECEA 2GI4A 1R6BX 4ESOA 3PLAE 3S99A 1MZPA 7MHTA 1W1WA 4IIGA 4M1QA 3ZE0B 1MH1A 1WXEA 5B5EC 4MUKA 2ZYHA 3B5EA 2BFBB 2DG2A 4DZRA 1JVSA 1A5JA 1RLJA 2KMLA 2E1MB 1GYPA 1M2WA 2GT1A 3IUEA 4F7ZA 2RGNC 4HBGA 4JP5A 4KKVA 1QS0B 5A6SB 3Q7EA 1DC8A 2D3TA 1U0JA 3IBYA 2C98A 4BVLA 4C0BA 5CT5A 2VP5A 1CR6A 2GTPA 2WP0A 1RACA 1FE8A 5DIZA 3N2LA 5DMHA 5B57C 3IPLA 5U4QA 2ECQA 4KW7A 4IHTA 1X7WA 1JG6A 1U0SY 3C74A 5LYJA 2RGRA 3E9CA 4XQ9A 1GCAA 3CRRA 3JD1A 2X14A 3L2UA 1J9IA 3SHVA 5B3SH 4G37A 5AVQA 4HGNA 4Q4JA 1G20B 4A03A 4B4VA 3C2QA 4XLHA 3L6OO 4MS4B 4EDHA 3HY3A 2G6BA 4XRFA 2EJVA 1Q7BA 1OXVA 1V9LA 3I5AA 3O8NA 1YYVA 3PUHA 6Q21A 1SXGA 8OHMA 4NP6A 1AK1A 1TECE 3KAKA 1YRNB 3ZNNA 1R0XA 5FHQA 5DBGA 2KRFA 3GJ3A 4HWKA 1TC3C 1OJ7A 2ZT5A 3AV0B 3JD0A 3TYXA 3GLHB 4AY3A 1AMOA 2WLSA 2OBYA 1ORKA 2O5RA 3RIYA 2P3OA 4QTXA 4IZHA 4OHWA 3LX4A 5L4SA 3S8PA 1KJIA 5IY5H 1XS9A 3N8NA 1GA6A 1BC7C 3JQRA 1WX1A 1G8FA 3L40A 5TEVA 3SKXA 3ANSA 4LF4B 4J0JA 5CUQA 5L4LA 2BUAA 1KORA 1VC2A 3HHEA 2BBWA 1NHAA 3WICA 4BRZA 1NQXA 3QKTA 4RHFA 4P98A 4R2MA 2WV0A 2HQOA 4UARA 4MWDA 2VBWA 1UFQA 3LOQA 3NT5A 1ZBDA 2CDNA 3A7EA 4IZIA 4JITA 3T94A 4ZCIA 2WA2A 2FPPB 2YVAA 3LVFO 1S89A 1VI5A 2W2QA 1E1QD 1NVEA 4JBWA 2KHMA 2I34A 2ID6A 4FM9A 2RAPA 4ZVLA 1I7LA 4O4LB 1FLNA 4KR0A 4GWGA 4L5YA 1IY1A 4C0JA 4EH1A 2JVGA 4J7AA 4FR0A 1NQAO 3GIWA 3EISA 4LDZA 1PL0A 1UJCA 1VIVA 4WNYA 2K4JA 3FA2A 3HMKA 4GZ5A 1OVMA 4GMFA 1GGEA 3Q3HA 4ND6A 2XZTA 3RHTA 4HUQA 4D4LA 4IJQA 3CWZA 2P8JA 2R86A 1GKUB 3OL4A 4X3CA 1A4XA 1YMUA 2HTJA 4EJUA 2RI1A 1VYVA 2CCKA 1QCCA 1JH9A 1BU5A 1SA0A 4HAIA 1KWKA 3Q72A 2AIRA 2C5AA 4RMIA 4G1FA 5BSHA 5T4FA 4F2HA 1F5NA 3FD8A 3MTGA 2E5ZA 1B3BA 3I0TA 1W75A 3GCDA 4WLUA 3AM4A 5HLTA 3TW8B 3U4DA 4AG5A 1E2LA 2P9YA 3LCUA 2PS3A 2XKKA 1V3FA 1MBZA 1KMMA 1DIBA 3G1WA 2JRCA 4RF2A 4DA6A 4L0QA 2QMOA 1H0HA 2E37A 4YJ3B 1PNVA 1Y9EA 3PNQA 1SB8A 3EVNA 4M0CA 5P8WA 4RVHA 3RVPA 1TM5E 3ONNA 3HHHA 3CD6I 5CHYA 3T5CA 1CZUA 1G8JA 2WJ4A 3WBKA 2WIKA 3L41A 2WPNA 4UDXX 5G4KA 1A5BB 1U1CA 3RUHA 1DIAA 3Q7RA 2XECA 1XDGA 1ZN9A 4Y2TA 5EPUA 1OLXA 2D45A 1RMTA 3HM9A 1RT9A 2RV8A 2C58A 2XTNA 2DTEA 2A14A 1YE5A 4B3SB 2JHFA 4FFMA 2PG4A 2H1CA 1C4WA 2BBTA 4X5OA 3WRYA 3SCZA 2P9GA 4OOEA 1JRLA 2HJVA 3GLFB 4MOWA 2BL4A 1TJ4A 5CCXA 2ME0A 4Q24A 3AO0B 1XGKA 4B35A 1U8XX 3P0FA 2QX6A 3AAFA 1OYVA 5DKFA 3W5HA 1ZI6A 2LIPA 1TUGA 2JK3A 3ZRGA 1YB4A 1SXPA 5JD4A 4BFUA 2W11A 1LQ1A 3ZI7A 5HYVA 1GUZA 2Q4EA 1PAUA 5SZHB 2CB9A 2QD1A 4TQUS 4QFCA 3ABSB 1CIJA 3I09A 1Y8RB 4RQUA 4EW2A 2V4ZA 3OY9A 1WTCA 1SOMA 1V1RA 2DBBA 2WHPB 1ZXXA 2QUBA 3P0RA 5BN5A 1F9EA 2IV7A 2QTVB 4R8MA 1JECA 2OOSA 3EXHB 1X1RA 1HKUA 3TBIA 3NHMA 1TRHA 2PBRA 3Q6NA 3DTVA 3V7WA 4S3MA 1Q3KA 1MBJA 2WY8Q 1XCJA 2MYNA 2DFTA 3Q7SA 5ICMA 3BXEA 5FL7A 1JA1A 1MXFA 1CRZA 4J7XA 5IYZB 2YWBA 1MMDA 2WHYA 2QN3A 3ZQUA 1JIUA 3UCEA 4R16A 2O9JA 4ZHQF 4M4SA 5IKEA 5E3JA 3R09A 1BX1A 3MZ0A 1AF7A 1XD2B 3OJLA 3IT1A 1ZJWA 2COUA 3F3YA 3PHJA 4LJLA 1PTJA 3JWHA 3CCFA 3ZZMA 4IV5A 3PHBE 3VMFA 1JDBB 2IQ5A 3EGCA 4QPCA 4RAZA 2VJIA 4YP7A 4ZAYA 2AX4A 1X7ZB 4YACA 1AWCA 2M1XA 4RKQA 4Q1AA 3RIHA 1HE1C 4C0QC 2FLWA 3EEYA 3BB1A 3IJ5A 3BWCA 5FEMA 5JSKA 4KZPA 5T5QA 2PEYA 4MUBA 4FCVA 3I8OA 1TUBA 4TV9F 4TVKA 5JJKA 4RPHA 5EE5B 1YW8A 3HUFA 4JNKA 2Y6VA 1JI3A 3ZTWA 2K2QB 3UHPA 3EB9A 4DM3A 4AYWA 1WXHA 4DMRA 1E5VA 1F2TA 4LWOA 1Z7GA 3ZQ4A 1ENZA 4CMEA 3C98A 3E05A 3RJMA 1P9LA 4O0LA 1BN6A 4BNMA 4QRIA 4G4SP 5GV7A 3PE6A 4UUMA 1FLIA 2DUNA 4RYLA 4ZRDA 4BEHB 1R8XA 4HVLA 1NQTA 4M7PA 3KP2A 3AOEA 3K30A 1NT4A 4GYYA 1S2GA 4CF4A 4A3FJ 4Q48A 2KSQA 5CVIA 1YA4A 2O7NA 1I6WA 2Z5LA 3AEUB 1UJ8A 5BUCA 3L7OA 1GGKA 4BNUA 4LYEA 3LYLA 2LDUA 4LSGA 4R0MA 4L0ZB 1FS6A 4AU1A 5CTAA 2VLBA 2RD2A 1X3LA 4YLGA 4QT0A 2PMHA 2ODTX 2J9YB 3HNPA 4BFZA 4GE3A 3FCYA 2Y1FA 3OSFA 3SQWA 3AF1A 2EZUA 2WF8A 5FI1B 1V71A 4YV0A 2WQZA 4WQMA 4L73A 1A6IA 1PFVA 4R7ZA 3HSEA 1AQJA 3NNNA 4YEDA 3VC2A 2OENG 5HKKA 1XEWY 5CJ2A 1X77A 1VSVA 1UJ6A 1I1OA 1RAAA 4N01A 4F4IA 2HA2A 2BKAA 1GPYA 4FQ5A 1YR6A 4C05A 5L9AA 4FMDF 1KQOA 3FGNA 1H1LB 4I3FA 1KI2A 2JAWA 4TYWA 4N3BA 1G0OA 5BS6A 3GJSA 2Q6KA 5LRSA 2PMFA 3Q7PA 5D6OA 4CL8A 3TMAA 1RVDA 3IYLW 4PC6A 4HQ6A 1KEZA 4Q3BA 1V39A 4F60A 1YG2A 1LPQA 3F8NA 2X6RA 2EQ5A 3UWOA 1INLA 4ZGGA 5FO0A 3IP7A 4RC9A 2WD9A 4RMNA 3O1IC 2NO7A 2BZ0A 5F1RA 1WSBA 2DJ5A 1H8EA 2POCA 3ZGLA 1ETVA 1ZSNA 5D7NA 1QRUA 4HEA1 1XTAA 1S7CA 3L4JA 1RD4A 2ZRQA 1BAPA 2EEPA 2YV3A 3PENA 1EF4A 1X7HA 2DC1A 1B72B 1CVRA 1APBA 2RH8A 1S6LA 3PDUA 3GMTA 1QVAA 4G8XA 1QHHA 2KRHA 2QTBA 1UMCA 3J81K 4HRIA 2IGTA 3HUDA 4UUAA 2FK8A 1E7MA 1YKFA 1BR1A 4C2TA 3QVMA 1NP6A 4H3SA 5LMUB 4B79A 2VDWB 1ZPDA 2YCLA 4EG3A 3IIMA 3WYGA 1T5HX 4TMFA 1MV5A 5JY1A 5CDUA 3PKIA 1H2EA 2JGLA 1KEEB 1G3IA 3P2JA 3JALB 1HQDA 1E3HA 2C3UA 5I5EA 1UBRS 3PXDA 4AWAA 4XN0A 3AK4A 1UJ2A 2DFFA 4OH7A 3PQ3A 2NUAB 4XICA 1N0WA 2V59A 4I4LA 2YIDA 4ARIA 1HDEA 2PTHA 4TTPA 1TAUA 3FCSB 2QTAA 2ATVA 1FMWA 3BXOA 4UKDA 1TKRA 1MC5A 1R23A 1MMSA 3IESA 1IONA 3OM9A 3OCYA 5JG7A 2RK3A 4L07A 1F9AA 1Q2XA 3LPDA 1PV1A 2WHXA 4Z4HA 1JEQA 1DBRA 2VHEA 1FVFA 3GLRA 2OCKA 2ODQA 4DQXA 4D9FA 4RZXA 2BELA 2CF6A 4UHHA 3ER8A 5L3DA 4KGVA 4DOZA 2ANCA 4C4RA 2PYIA 5ECDA 1A8SA 4YJDA 1H66A 4JN6B 2ZUWA 3E2IA 4K2HA 1AZTA 2DBQA 1QE5A 2WF9A 2AW3A 3JQGA 2I62A 4I3HA 3F1LA 1RLUA 1O3RA 2WTBA 3EIFA 5EJEA 1I1NA 3DW1X 4CM8A 5JSYA 3SF0A 2QYOA 3A1CA 1ULTA 1W36C 1U28A 3HYCA 5JAPA 4H31A 2OB1A 5BPHA 3FRIA 4F3QA 1DUVG 5FOVA 3KXLA 1P7WA 1VLMA 2P78A 3ZG6A 4NMXB 4LV6A 2NQ2C 4KQGA 4DCUA 4LE2A 4NEQA 2AN5A 3EOZA 3SJBA 2EBUA 3DNPA 5ECGC 1ETQA 3DFZA 4BBSJ 4CDNA 4HLUA 2FRVA 2G36A 3RK0A 1GZDA 2JJ1A 1Y1SA 2FETA 5TPWA 5I9LA 1TKAA 1K0FA 4MR9B 2GXSA 5AP9A 3QU9A 2IYAA 1K4TA 2XJ4A 2V1XA 2IA1A 1M0TA 2I4OA 3ENVA 3A58B 3FYCA 5ADWA 4EJSA 3D6FA 3TQRA 4TRMA 1VG1A 2ILTA 1VKNA 4FFPA 3SQLA 5E7JA 2YWJA 2EV6A 3ADKA 4DRXA 1D0VA 3L6CA 4IOMA 4DKXA 1N2GA 2WYIA 3W9YA 2VAWA 4M1WA 1PFYA 3Q88A 4FUQA 4P9FA 1EU1A 1GVHA 5JAZA 3TTYA 4IQGA 2PK3A 3CVYA 3C3PA 1T0IA 1O4WA 3FUVA 2X9LA 5IJ0A 4LBWA 2YU9J 2X5XA 2HAEA 3D5QA 4WERA 1JPNA 4EUHA 3GUHA 2GCEA 3LSPA 5ALOA 2O07A 3H7IA 2F3SA 3WGHA 2W2LA 3KVOA 5A04A 4ANJA 3ZIUA 1RZUA 1XNRB 1NNEA 1JPUA 3CLRC 3FCUB 3U1BA 4YRCA 1E4OA 4FNMA 1I3NA 5FBQB 1IOVA 4DKJA 4ZXPA 2ST1A 2FPLA 3GLIE 3VV3A 4I9HA 1TUIA 4MPJA 2B0LA 4F0JA 3VI4B 4U1RA 2I2FA 1MR3F 3EQ6A 1HY3A 3UNGC 1ST2A 3G4SI 4Z1MD 4GOOD 3ZX5A 4H77A 1TYBE 1P62B 4DM4A 3WSVA 2FJ0A 4HZUB 5HEKA 1JDTA 1X1AA 4H1HA 4M1OA 2CSOA 5CCBA 3BDAA 2F5VA 2G72A 4E7PA 5EYRA 4GC9A 4IXTA 3KLNA 4X6YA 4O1HA 3KALA 4B32A 1J75A 1ORWA 5KX5A 4XWTA 3VKVA 1FLVA 1E1RD 3PNSA 3RYRA 1WXIA 1A8QA 2BKUA 1ZWLA 3SEZA 1RYBA 2ZAIA 3WQQA 5JWOA 2C9MA 2NO6A 4QU8A 1GU7A 5IWAB 4Z8XA 1IUNA 3PLRA 2PSHA 4OQEA 2PL5A 4E22A 3GFTA 1H5NA 2YHAA 4Z4FA 4WXEA 4YJ2B 2B4YA 2LPMA 4Q16A 4FOSA 2REOA 3ES9A 3FMQA 4GOND 2CDRA 2OXEA 3E6AA 3GZNA 2XNCA 3ONVA 4HDKB 1TF7A 1VHWA 4HDVA 3F3KA 2Z5GA 3UB4A 1UOOA 5DM70 3UICA 3PDCA 2WB2A 1SIBE 1ZRSA 4RV4A 4RDCA 4XLFA 2HFKA 2OWEA 1FPQA 1IHOA 2PUDA 4FETA 3FBIB 4UTOA 2EIJH 4QVGA 4LB5A 1JTEA 2QTNA 3HJHA 1EWVA 1USUA 2PUEA 3LAPA 4IUDS 4RAFA 1B00A 1HDPA 1SC7A 2G70A 3KR0A 4RBNA 3S29A 4NBQA 4RD6A 5IMSA 1MVOA 4ENUA 5DBHX 4LFAB 1CB0A 4ZYAA 1DWPA 1UUFA 1SKUA 4MULA 4NHEA 1R8YA 4K9KA 3DTNA 1BVRA 1GY8A 1KH3A 4DWWA 1D0ZA 2VK2A 4HDMA 5DEOA 1RWMA 4O5VA 1R0BA 3LBHA 1T91A 3PPYA 2L82A 4RTMA 5DUIA 1EFKA 4XWWA 2PMCA 1J9ZA 2KQRA 2FP4A 4H7IA 2J45A 3EETA 3DC2A 3UV7A 2GKSA 2FUEA 5C2JB 2O4CA 2YX7A 1VIMA 2IFTA 3CJNA 3IHTA 4F3CA 4KB5A 2L7ZA 4J1QA 5FHRA 4DCCA 4ZVKA 3H2IA 4ZEXA 5CAEA 4D5CA 2EWWA 3FNIA 1F36A 3Q0WA 4OHFA 1OHHD 1P4WA 3A27A 4X91A 4Y2GA 4G23A 3GPIA 1Z0UA 4B40A 3ZN0A 2G40A 4DLKA 5CD9A 1RQLA 1DOAA 1OR7A 2QMHA 2VWQA 1K78A 5DP1A 1JQBA 4BBJA 3MYRA 1FYVA 3DEUA 3B6AA 3R8CA 2XMCA 1O6CA 1HUQA 2P9FA 1UBUS 1E2DA 1V25A 3OWXA 2WB4A 3I2KA 4DCMA 5FPHA 3CZ6A 3LA3A 4IQ8A 1WWKA 3FG9A 5AVUA 3V8KA 1RUNA 4PPGA 2PO7A 1ZUNB 4OQFA 3HI4A 4J3FA 3E9RA 2N1BA 4FP9A 4OGWA 5K6RA 1ZI8A 2IC5A 3NEUA 1D4ZA 4B3JA 4LDNA 3AUKA 3MMPA 1LDDA 1PF7E 2AC4A 2EYQA 4IHWA 4RSRA 4DDMA 3BMQA 1Z4IA 4JJIA 5BW4A 1CERA 5C44J 2Q9BA 2VTBB 1I2DA 4OIOF 1NXSA 1H2FA 3FXUA 5DS9A 4CM3A 2QGUA 3SBOA 4PXYA 1A2BA 1HLFA 2P65A 4E5VA 2IXTA 4BRSA 1AK9A 3LK7A 1OREA 3O4HA 2FMKA 1NVAA 5ECYA 1G18A 4UBIA 3H05A 3R7SA 3BCRA 2RGWA 3VB2A 1QVRA 3S8MA 3S81A 1VFPA 4QTRA 1J7KA 3T99A 3ZIAA 3BK7A 1U8AA 2JIPA 1R49A 1R15A 2I2BA 3ACCA 1TYCA 3DTTA 1FFDA 3HOYJ 1ZX1A 4ZYHA 3MD0A 1E3SA 3DL7A 4HYYA 4L0YB 1W2GA 5FWYB 5K0TA 1MAHA 1K88A 4WA8A 4MYTA 2PUAA 2WMYA 4BE0A 3AP3A 3RVMA 4R8HA 4US0R 2X7XA 1ZI9A 2V4MA 3JX9A 3RSCA 1T8UA 4NCNA 3OO1A 3K2EA 3LSTA 2VH2A 3H5RA 2HQ5A 2IXSA 4QTZA 1M6VA 4ZQCB 4YAJA 4FQGA 3TJZA 3EGEA 4AQYB 1ZVKA 1AHHA 2C2BA 1HNXB 4RPLA 4M8KA 1RXCA 2PZMA 1MC8A 1EINA 2HLHA 4HLNA 4E3WA 1I6MA 1UPTA 4L22A 2CUNA 2DHRA 4DJDC 1U1DA 4TLDA 4HPXB 1Y42X 3MOSA 1YRBA 3C8ZA 3ZWWA 1BI2A 5A1TA 1E79D 1Q1NA 1TVMA 3HS3A 2ZI9A 3TEFA 5LP6F 5FLMJ 3ZK8A 3AVPA 2R6JA