1FP2A

Crystal structure analysis of isoflavone o-methyltransferase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
345
structure length
345
Chain Sequence
RKPSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIGNVRRLMRYLAHNGFFEIITKEEESYALTVASELLVRGSDLCLAPMVECVLDPTLSGSYHELKKWIYEEDLTLFGVTLGSGFWDFLDKNPEYNTSFNDAMASDSKLINLALRDCDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVIDKKKDENQVTQIKLLMDVNMACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.
pubmed doi rcsb
source organism Medicago sativa
molecule tags Transferase
molecule keywords ISOFLAVONE O-METHYLTRANSFERASE
total genus 122
structure length 345
sequence length 345
ec nomenclature ec 2.1.1.150: Isoflavone 7-O-methyltransferase.
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fp2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1fp2A02
1PJZA 2HDCA 5LR6A 4P5OA 4E32A 3E6CC 5CUQA 1XSVA 1B9MA 3K2ZA 5DEQA 3X0DA 2UWMA 1DCTA 2NYUA 4CICA 1F5TA 3IRRA 2QBYA 1OYWA 1I4WA 1WI9A 2DPMA 1V3FA 3LSTA 4KT5C 3WGIA 5T6BA 4KWCA 1LB2A 3KQMA 2IBSA 2E1CA 4QQNA 2ZZMA 4PGGA 1DP7P 2V79A 5LGNA 4FT4A 5DPMA 4FGZA 2ZFUA 3EMBA 4HRAA 1U6GA 2I7CA 4EJTA 1LEAA 1VP9A 2YVLA 1L3BA 3HM2A 3DFGA 3ZMZA 4U0VA 2V6CA 3T8RA 5EVJA 1XCLA 1XGMA 1J5YA 2C7PA 5CVEA 3CUQB 1G60A 2PFBA 1BM9A 2TDXA 4MHGA 4ZYEA 3QPHA 3CUQA 3T8TA 1JHHA 2LD4A 3V7RA 1MKMA 2ONYA 4CZZA 3I0TA 3L8DA 3OV8A 5F1RA 4L9NA 1EJ6A 2AOUA 3E5QA 2AOTB 5F2KA 4A12A 4LG0A 3FRHA 3SX0A 3WE2A 5K5OA 3EVAA 3LCVB 1D8JA 5D1NA 4IV8A 3AWIA 4EGZA 3MERA 1P1BA 2OBFA 4L18B 2Y48A 2UYHA 4AUKA 4RGSA 3BWBA 1VTNC 5EGSA 3ELDA 4OA5A 3DUWA 3WE3A 4QVKA 2YUIA 5FLXK 3DMGA 3FPHA 2PKWA 1N2XA 2C7OA 3EQLF 3ZPLA 3U2RA 2NRAC 2VN2A 3R60A 5KQRA 2IDKA 5ILUA 1TQPA 3D0SA 3G3ZA 1KA8A 2HZTA 1YB2A 4QVGA 2OZUA 2I9KA 5LQNA 3UJCA 4PWYA 1VBFA 2NP7A 2MH2A 1EH6A 3I54A 2ADUA 4PINA 5ERGB 1SAXA 2JPBA 2K86A 4V0QA 3FZVA 5LQAA 4MTEA 3HCDA 3OZSA 4IKPA 3RKXA 2ADMA 3EUHA 1BKYA 2VDUE 2Q2EA 5DX8A 4PYQA 5ICGA 4PYKA 2FPOA 4MIKA 3TO6A 1T6SA 3G7UA 3LGAA 2DAOA 2KIMA 5HDNA 2AOWA 2FXAA 1Z6RA 3ABTA 3GU3A 5ILVA 2M87A 1BI3A 3SXYA 3KEQA 2FCAA 4M9XA 4PIMA 3DPTA 3KEOA 2ZTHA 1R1UA 3DEUA 3M1EA 4ZYHA 4DKJA 3LBYA 2AOUB 3C7JA 4M71A 1BN5A 1ZRFA 2GAUA 3NRVA 5KVRA 1NHAA 1K6OA 2FRXA 2KW5A 3HSFA 4PIPA 3J81K 2XUBA 3ZMTA 2P3OA 3L09A 1SD4A 5HDKA 1KIAA 4CXFA 3C6KA 4P7JA 1YZ3A 1VL5A 1GVJA 1O7FA 3GF2A 3ZQ7A 2G1PA 5E1ZB 4WXHA 1IAWA 4WXDA 3MTEA 1QQIA 4IRIA 1QGPA 2PQ8A 3ER9A 1YLFA 2RN7A 2LNBA 3HYIA 1NW6A 2B78A 2M1BA 1ZG5A 5LHGA 5HIJA 3ECOA 3ORHA 2KJCA 2MD5A 3QAHA 4C07A 1P92A 4CYDA 5IT9K 2FK8A 5BPIA 3TOAA 3ELUA 4RGRA 2QUFA 2PVCA 5DX0A 4ER3A 4GOMD 3TRKA 3KPUA 4GOND 2XVCA 2HV9A 5FO5A 3M6WA 3GW2A 4NB5A 1S29A 3WU0A 3BJ6A 4PONA 2OQGA 1ZGJA 5E9JA 3DMHA 1DUSA 2C7RA 2A68F 2EJTA 1K7AA 5L3CA 2XAHA 2X0LA 5EC8A 3IKVA 3HA5A 4GUAA 1D5VA 3FTFA 2UZKA 2XV4S 5L3DA 1PDNC 2HR3A 3FX3A 2PI0A 3DXYA 3F4KA 2PXXA 1TW2A 2WA2A 3KR9A 4EKIA 4HBLA 3BKXA 1O7LA 1PP7U 1KP9A 4JBAA 2NXCA 5LQRA 1FYMA 2XROA 4F7ZA 1R36A 1JR4A 4S05A 2A69F 3RJPA 3I58A 3KETA 1M6EX 3F72A 3VOEA 2RGVA 3SMQA 4PCLA 2DU9A 3IV6A 3OU6A 2EV6A 1OYIA 2QM3A 3CTAA 5KVAA 4ON0A 4CKEA 3DV8A 2QQAA 3EVZA 4M36A 5G02A 1QZYA 3NW9A 3TKAA 3HSRA 1KYZA 2WWYA 1XMKA 3G5LA 3FXUA 2F5EA 4RVHA 4I0BA 3KQVA 4OIOF 4FZVA 3AY0A 3TKYA 1I5ZA 2CQKA 5LRRA 3HVJA 3HEMA 4M7RA 2XAGA 2FNAA 1BOAA 3FM5A 3KZZA 4G56A 2OY0A 2CG4A 1G3YA 2WTEA 4HQMA 4O29A 4RVGA 2QY6A 3HA7A 3TLJA 4IF4A 2AN3A 2AOVA 2YXLA 4ER0A 4M72A 4H0NA 8MHTA 4IJAA 4DCMA 1QO0D 2PT9A 1FPQA 1R8XA 4KNYA 5C0OE 2QENA 1B6AA 3MCZA 1RJEA 5DTRA 4GCVA 4U7DA 4FT2A 2ISYA 2JTVA 3HRMA 5CVIA 2FU4A 5LBQA 5CCXA 2LF8A 2PBFA 3LDFA 3PQJA 1FLIA 4PYLA 1U8RA 3RDIA 1KHHA 4E30A 5E8GA 5CLSA 1YQAA 2FYTA 3MQ0A 2Q0OA 2STTA 5HOQA 1J0RA 5D4RA 5FA8A 1CGPA 5BOXA 1VPTA 3FPFA 1HMYA 5EQJB 4TV7A 4BHBA 4HLYA 1RUNA 2BR5A 4MTDA 4U88A 1USTA 3HTUA 2CGPA 5LQJA 2Y75A 5HILA 4JXJA 1VIDA 1FNNA 4O5VA 2ETHA 2Z9OA 1S3JA 3ELYA 5HS8A 4HTFA 1YFLA 1YFJA 2O0YA 4E2XA 1W7PA 4MWZA 1O3QA 2UYCA 2V1UA 3KP5A 2FMLA 3TDZC 5ERIA 1PUEE 2E5WA 5FWDA 4MQVA 4PZJA 5H6QA 1I1SA 4HQEA 2PWYA 5DCMA 3HIFA 1NBIA 2OZVA 3B3JA 4IRGA 3FTDA 3KHKA 2BV6A 2IH5A 2Q8KA 2NXEA 4XUEA 4L5JA 1OYYA 3DH0A 3FUUA 4PNEA 3NWBA 3LPMA 4MHTA 2YXDA 4KIGA 2JT1A 2FHPA 2GZWA 3RYPA 4WXCA 2G7HA 3B02A 2P8TA 1WSUA 5GM2A 4BAYA 4ZZDA 5EMLA 3GRVA 3KFWX 4GYIA 3A7EA 1XSDA 1S7OA 3ZMUA 1TNSA 3M33A 3Q7EA 2DFIA 4A5NA 2PLWA 3G88A 1ZQ9A 5B1SA 3MQ2A 2G9WA 2XHKA 4L9TA 2RC4A 3MFKA 2G70A 1L0OC 3FHZA 2O06A 2O05A 5BMZA 3LBFA 2H6CA 3DTNA 3EETA 2FK7A 2VE8A 2ESRA 3JTHA 4LLLA 4P9FA 1WRJA 2BEOA 2EB7A 3BP8A 3IWZA 3DLIA 3A4TA 2NS0A 3PFIA 5EHGA 3HTXA 3EEYA 1R6AA 3BGIA 4BNCA 4RB1A 1IY9A 1FBQA 3WODF 4L0YB 3ZN0A 4HGZA 3EEOA 2DK5A 4F86A 3P97A 2XKOA 2D2WA 4KICA 3KQOA 2VZ9A 2RVCA 1MD0A 2HQRA 1AOYA 4Q47A 3CJNA 1ZG1A 4KYWA 5F64A 3E23A 4YMGA 5EMMA 2STWA 2HOEA 3T7RA 5K0GA 3AAFA 1N7IA 1QANA 1RI3A 2ZLBA 2BYVE 1G3WA 4UUVA 3COAC 2JPCA 4E33A 2ORED 3TQSA 2ZJ2A 2HYGD 5LRSA 4LG0B 1ZAOA 3DPLC 2P7VB 2VC0A 3GYHX 5CVVA 3LDUA 3QPTA 3RYRA 1R5HA 1W7PD 2O07A 4QQKA 2UZ4A 4IRHA 4F84A 3HA3A 4LGWA 2WK1A 3K9TA 5K0NA 1YW9A 5DXJA 3BWCA 1HKTA 3E6BA 4AIJA 3GXOA 5CJ9A 3NMUF 4HF0A 1MJBA 2ZWAA 5ICEA 1T2KA 3H2BA 1SMYF 5LHHA 3QOXA 1G6Q1 1XCBA 4KN4X 4LK1F 1F3LA 2MH9A 2HFHA 2IA2A 5FLXZ 3GIWA 1W7PB 3PB3A 3I53A 2ZCWA 1J9IA 4LWOA 3REOA 4HG2A 4XBFA 2CMHA 2G7UA 4ZYDA 3VYWA 4RTSA 3KQYA 4PYNA 3WG9A 4JQFA 4HA8A 2EFNA 2GXGA 2ZNZA 5FQOA 5EG5A 3JSPA 5FA5A 4G7HF 1RZ4A 3KP2A 2PX8A 1JSXA 1AWCA 2Z33A 4YG2F 4UVBA 1XGOA 4ZTBA 4U7BA 4HSGA 1XB4A 3MZYA 3F23A 2D45A 2VOOA 2OPBA 4N9IA 3U1DA 2UYQA 4QWQA 2CMGA 1RNLA 5DD4A 3BZ6A 2FSWA 3FUVA 4U7TB 2GH1A 1IN7A 1RIOH 2LKPA 4HX4A 4OA8A 4X61A 2P4WA 3JAMZ 1ZLKA 3P2KA 5FADA 5EMJA 2AVNA 5BW5A 3BZBA 4CTKA 1QAMA 1T38A 4ER5A 5D5UB 5DTQA 1O9GA 3A7DA 3E3VA 1D2HA 4DF3A 1EH8A 3WTYC 4RX1A 3K0BA 3K69A 4AZTA 3G2QA 2N47A 5EPEA 4GC9A 1P4AA 2ZZNA 3T7SA 1B4AA 2IJLA 3SXJA 1I1GA 2L01A 3G73A 3EGIA 1FT9A 1VLMA 2Y1XA 3BUSA 5EZQA 5K5RA 1F9NA 4RB3C 2PY6A 4R1HA 4LB6B 2PEXA 1SD5A 5F2NA 3CO6C 5GOZA 4N9HA 3Q9SA 4LD5A 2AZTA 5FD6A 2O3FA 2BGCA 2V1XA 1X1BA 2YR0A 2QYOA 2FE3A 4IVNA 4GC5A 3GFIA 3AXSA 2OO3A 3HHHA 4RAZA 2O0LA 4KDCA 1IXKA 3LA3A 4AIKA 1RJFA 2AVDA 5HIIA 4DNCA 3HTSB 1OMIA 4ISCA 4RTMA 3HCEA 3PX3A 5E1OA 3HRTA 3VEPA 5M5BA 4ESFA 3T0IA 5K0JA 3R6SA 3THSA 2CWEA 4BH9A 4RV9A 1D8KA 4CKBA 1BI1A 2P5KA 1U2WA 2V74B 4A0XA 4D0PA 4G6DA 3BWGA 7MHTA 5L3FA 3T5XA 2M8EA 2QZ8A 1Z9CA 2HKOA 4X60A 3FPEA 5E2AA 1J7KA 2YX7A 3R0QA 4RYLA 4HF1A 1RI7A 3LCCA 3K1MA 3C0KA 1YYVA 1UIRA 5BP7A 4ENJA 3CDHA 5CCBA 1T39A 1X19A 2LF7A 5J8CA 1MGTA 3FMSA 1DDNA 3M6XA 5ILSA 4EVIA 2D1HA 3ELKA 3LQQA 4RB2C 2GA9A 1FZPB 5E17F 4JK1X 3K1PA 1ULYA 3VB2A 1ZARA 3THRA 5E18F 4MQ9F 2RKHA 3O31A 5LEKA 3TOBA 4ATNA 1SQGA 1Z6TA 5E20A 2FA5A 2G71A 2EK5A 4XCXA 2PJDA 4KDRA 2XBMA 3KQTA 1KQ9A 4HDVA 4YFKF 3O6BB 1SUIA 5FCDA 1NW7A 4QLCU 1VP3A 1JG4A 1ZRCA 3ER8A 4Y13A 1KPGA 4RB0A 4HDUA 4BQAA 5EIFA 2BM9A 1M0EA 5MHTA 2JJQA 2PX4A 3BY6A 4XSZF 2L02A 4FSXA 2DULA 2IA0A 2H1RA 1IXCA 1U2ZA 1T0FA 2YX4A 3EDPA 1BC8C 1JG2A 4Q48A 3MB5A 4KMFA 4OQEA 3KQPA 4I02A 2QRVA 1Q0SA 4K2EA 4GBED 5DYMA 5FHRA 2VBYA 5LSAA 2IPXA 2VONA 1NW3A 2EA2A 4PYOA 2ZIEA 5A2QK 2OQRA 2KIUA 3ME5A 4YFXF 4O6JA 5E1BA 2P1DA 2Z3YA 4M74A 2VBWA 3CBGA 1KU9A 3OU2A 3Q87B 4P7GA 3KP7A 1ZH5A 1JXSA 1KU7A 3ID6C 2HS5A 2OB2A 3G89A 4A0ZA 3MGGA 4RSRA 4YUWA 5ED4A 5HS9A 3I71A 2PX2A 1XDZA 4X63A 3D2LA 5DT2A 4LLNA 3R0AA 2GA1A 2L4MA 2BZGA 4HX8A 4UVAA 3SZTA 9MHTA 2VOPA 3V4GA 3WTUC 3C3PA 4Q5SF 3GZ5A 4GOOD 4MNUA 5K0BA 1XXLA 3H3UA 3NVMB 5J6XA 4RVFA 5CVUA 3IL2A 1ORIA 3BGDA 2YQZA 2M30A 3CUQC 1O57A 3LCUA 1R1TA 2ZIFA 3FTEA 1HBXG 2P7CB 4OOIA 3EVCA 4BXUA 2HTSA 2PGXA 5HOOA 3FPGA 3T7TA 1J2XA 3C3YA 1D3YA 3I5UA 2ZBKA 2PJPA 2DBBA 1R74A 1J59A 3LWFA 5FFZA 4GOLD 1Z05A 2V9VA 5DM2A 3O3KA 4NECA 4DMGA 4EMSA 4QDKA 4IHTA 3LQRA 2C6YA 2E7XA 3UA3A 2LSOA 2VC1A 1GHCA 2ZVJA 1BIBA 1Z7UA 4I01A 3UA4A 4AX8A 4RTNA 1YG2A 4DCGA 5HLIA 3FMQA 5FD5A 1L1EA 2QQ9A 2Y0MA 3MAGA 3W6JB 4FP9A 2JRTA 1MJAA 1E2XA 2IFTA 2UYOA 3IYLW 2Z6QA 2A6EF 3V8JA 3CC8A 1F38A 3M9AA 1FP1D 1LNWA 3CGGA 3EVGA 3VC2A 4Y2HA 2VT2A 2YU3A 4A6EA 3IRQA 2O57A 4L7VA 5HEKA 4YV2A 2AOXA 2WA1A 2FBIA 2A5YB 2O8XA 3M6UA 4UOEA 4YV1A 3LECA 4EGYA 1T98A 2PMUA 2PBIA 2D1VA 1GXQA 2JH9A 3SSNA 3BJOA 3UJ9A 3S2WA 1I9GA 1R58A 2W25A 5D5VB 3E05A 1ODDA 2KRFA 1FSEA 4OMZA 1TLHB 3P7NA 4LG1A 3KR1A 3HVKA 1YIOA 1WQ2A 4U7PB 1EIZA 5K0LA 5D4SA 2JG3A 3SSOA 1MJ9A 2B25A 5EOVA 1DPUA 2B2CA 2JH8A 2EFWA 1RI5A 2W57A 3GRRA 1W4MA 1KQ0A 2ZSUA 4BLUA 4RTJA 3UJ6A 1SD7A 1JGSA 2JSCA 4EM0B 1SQFA 4P96A 2RDPA 4AD9A 3RKYA 4Y15A 4A6DA 3HCCA 3WTZA 4YUYA 1K78A 3IHTA 3UJAA 4HX7A 1UWVA 5IT9Z 2Z6AA 3AXTA 5H6RA 1V4RA 4CO8A 4EJVA 5DDGA 2MLGA 4YFNF 4GO1A 2KJBA 5CYVA 1HSTA 4Q4ZF 1FYKA 4RWZA 4E31A 4OBXA 5IH3A 1AQJA 4R79A 3ZMSA 3BT7A 1Y8CA 1HNNA 4L9VA 4ZH4F 2XVAA 4EM2A 4NHJA 5CVDA 3Q9VA 3FXQA 5FULA 2YX1A 1FC3A 2YR2A 2XAJA 1WWXA 1EAMA 1ZLJA 3WTVC 1BC7C 3F8BA 1FOKA 4HW0A 3TDUC 1K79A 5KS2A 4FX4A 3KE2A 3CUOA 5D8LB 1TQIA 4R8SA 2XVMA 3QV2A 1OPCA 2ZXJA 3SQNA 3HRSA 4MEXF 2ZBRA 5KK1A 3FF5A 1IRFA 5E1XA 3VC1A 2FOKA 2K27A 2QRVB 3G8AA 2DT5A 3KZYA 4BLWA 1RJGA 1KGSA 4I0AA 4P55A 4RTLA 3G2OA 2XIGA 3QP5A 4PYMA 3JSOA 3WGGA 4R6WA 1B42A 3NDJA 3H3ZA 5E8IA 3OE4A 3E5UA 3JWJA 1YS7A 5FFXA 2ZBQA 4G8XA 3WTXC 1AV6A 4A0YA 4YMHA 5T64A 4AZSA 3C3WA 4XUDA 3JAMK 1I1NA 2CSOA 2JHAA 3CKKA 2XRNA 2R7FA 3PFHA 3F8CA 2IH2A 3E5XA 1HKSA 1ZKDA 5K03A 3G2PA 1SD6A 5KQSA 2FNPA 1JHFA 5HZMA 3OPNA 1E17A 4XLNF 3O7WA 1G8AA 5DV5A 2P40A 4KVZA 3R61A 1IW7F 1R00A 2I62A 3BJAA 3RIRA 3TOSA 3P8ZA 1F1ZA 1G3SA 1XN7A 5P8WA 4M38A 4Y17A 1NBHA 1O3SA 6PAXA 2FMYA 3ZMDA 1GXPA 4PYJA 2QBYB 4U0YA 2EFPA 1PP8F 4YUZA 3LKZA 1XTPA 2QWWA 5DM0A 5GWXA 5EKUA 2GQQA 4C06A 3F8FA 1NKVA 3E8SA 3V7CA 2VP3A 3KQWA 3MHTA 4UNOA 3A27A 1XGNA 5FHQA 3DXXA 1RJDA 4I09A 1IXSB 1ONVA 4ENNA 1EH7A 2ZZKA 3DF8A 1H9TA 4IV0A 2GWRA 3KP4A 2R3SA 4PYIA 5LQCA 3P9IA 4MQ4A 4RTKA 1MZBA 1P91A 4LK0F 2XYRA 3G5TA 2CFXA 5H20A 2BBYA 2PXAA 3LDGA 1SFUA 5KYGA 5LGTA 2RNJA 1LDDA 3OOPA 2IPQX 2M5WA 2CO5A 2DQRA 2A6HF 5E9WA 3I59B 3KP3A 2P6SA 3CO7C 4M37A 2H09A 3VODA 3M8EA 1HQCA 1EG2A 3R24A 2FRHA 5HLGA 1TQMA 1P39A 2P41A 4IPAA 3PLAE 3FWEA 1H0MA 5E8JA 3FUTA 2ZWVA 4NQWA 4HC4A 3KR0A 3UZUA 1STZA 3EYIA 3WTSC 1P4WA 2XAFA 4L0ZB 3KCCA 2Y1WA 3MZHA 1X1AA 4M6YA 4EK9A 1J75A 4B09A 3G2MA 3GEZA 2YXEA 4BLVA 1R22A 2WV0A 4M9ZA 3HP7A 3CJTA 1UFMA 3JWGA 2OAZA 1UHWA 1BI2A 2BM8A 2AS0A 4XSXF 3DOUA 5CVRA 3OZTA 2C7QA 1XSXA 1XD7A 2UXNA 3LX6A 2H94A 3B3GA 5EHIA 3PS9A 4KA4A 3SGLA 1OR7A 1I6XA 4RGUA 3B89A 4M6XA 3B5IA 2ELHA 3CVOA 4CDGA 5J8FA 1O3TA 4Z2YA 3ABUA 1QNTA 2NNNA 1BBYA 1DUXC 2GPYA 4KW7A 5LQKA 4HAMA 2FQ3A 1MHTA 4B8XA 5TRDA 3IKTA 1X1DA 5HVQC 1FX7A 2DPUA 4YIIA 1VE3A 1N7JA 3P9KA 1CF7B 4CKCA 5A2QZ 3UBTA 4WX9A 2CWWA 3ECHA 2KIFA 5IKMA 2IT0A 3RPUA 4KN7X 1W5TA 3PT9A 3MAJA 2O6GE 4E70A 3EVBA 5FTWA 1ZYRF 3V8VA 4BHCA 1YUBA 3RODA 4EJWA 1Z91A 3R6TA 1V39A 3VFZA 5E8RA 2K4BA 4HH4A 2VBXA 2J5OA 1B1BA 2EV5A 4ESJA 2ONZA 4G7ZF 1X1CA 1ZG3A 3ZN1A 4QTUB 4MEYF 1D2GA 2NXNA 4S04A 3N4MA 3PVCA 2CKDA 4BP3A 4KRGA 4EKGA 3GRYA 3CJQA 5GP1A 1O3RA 4I98B 1P4XA 4O3MA 1RI4A 4C03A 5HDGA 2Z5UA 2PX5A 3IHUA 3BXOA 4ASNA 2R6ZA 4G94A 2DO7A 1UHMA 2EWNA 4FHTA 4WWCA 2VS1A 2P3LA 3M4XA 4QTTB 2F5DA 3WTWC 3DQVC 3OFJA 4C4AA 1TNTA 3ZP5A 4CGZA 2BH2A 1WXXA 4RGXA 2ZKZA 1L3CA 3QU6A 2GS9A 3FTCA 1BJAA 5GINE 1KU3A 2HYFA 1R23A 3GWZA 3KLNA 3TM5A 3GUDA 2E7WA 3DP7A 5JVTA 5JUWA 2XAQA 3GLXA 2V1DA 1YO5C 4RTOA 3ROUA 3IWFA 1P6RA 5U4XA 3SSMA 2VODA 3ELWA 4BY9E 4RTQA 3NWEA 3E7PA 3K6RA 5H02A 3L9FA 5L3GA 1G3TA 4AZVA 3GFJA 1D2CA 4CWAA 4HZFA 5EMKA 3KLOA 4PCQA 1S6LA 4DM3A 2O61A 1NV8A 1WXWA 5HIMA 3KPYA 3FM3A 2DI3A 2BR3A 5BXYA 3D5LA 3DKWA 1HSJA 4ZZLA 2EA4A 3B3FA 5DUIA 1G38A 2IBTA 3F8NA 5CVJA 5LQUA 2AS5F 2PV0A 4ENKA 2O03A 1YTYA 2DK8A 5JR3A 3EVFA 2ZNYA 1R1VA 3WSTA 4GQBA 2F5FA 3UJ7A 2IRFG 1Q0TA 2IA1A 4I7HA 1JE8A 1S7AA 1JQ3A 3DULA 1SMTA 3TGNA 2ERCA 1R5GA 2WC2A 2IGTA 1L9KA 2F5CA 2W84A 1QZZA 4A2UA 5DSTA 4BP1A 3M6VA 5C1IA 4EJOA 4R6XA 1DPRA 4HLXA 1HW1A 1BOOA 3R3HA 5DRTA 3GX4X 5BS6A 3ANXA 1EV7A 4OU0A 5E1DA 2HGCA 3TM4A 3KQQA 2K4MA 3HCBA 4QPNA 1SVUA 1NE2A 2Z6UA 2HTJA 2PXCA 2G8NA 3FMRA 2XKPA 1WG8A 3BWMA 4PCAA 1L3LA 2OYRA 2P35A 3EGVA 3LFKA 4R8RA 3DXZA 3NTVA 4ER7A 3OZRA 1B59A 5E1WA 1JTEA 2ZIGA 1YZHA 2DLLA 4B17A 2A07F 2ZMEA 2F8LA 5D1HA 2HKXA 3LL7A 4XRFA 4HOBA 5HLHA 5JI6A 1WY7A 4OBWA 3SVZA 5E9QA 2VE9A 3G8BA 3TR6A 3S68A 5EIWA 2P6TA 3TO9A 1EQAA 2GAFA 3F22A 3Q5FA 3CJRA 4P9UA 3BGVA 1JQDA 2YSRA 2NXJA 4LWPA 3GCZA 4DQ2A 3ZMVA 1FYLA 4C04A 3J81Z 3FUXA 3IEIA 2ACJA 1ZRDA 5K09A 1IRGA 1FBNA 3T0YA 2GLUA 5D6FA 1IM8A 3BPXA 1JQEA 1TW3A 1SFEA 2H27A 3FZGA 3RW9A 1G8SA 2VT3A 2YTZA 3GRUA 3KP6A 5LHIA 5F6FA 4DQ0A 5EKXA 3P9CA 4YIFA 1YW8A 3BWYA 1Q1HA 4GXOA 1OKRA 5D8KB 3HCAA 1HXDA 4ETSA 3PX2A 2W85A 2DW4A 2HR1A 2DTRA 2HWVA 3EVDA 2PT6A 4OIPF 3P9NA 1ZHFA 1IZ1A 4MGRA 2MBFA 3O2PE 4KIFA 5DWQA 2MC3A 4XUCA 2DQLA 2X4HA 4ER6A 3HRUA 3EYYA 3AJDA 4I2OA 2QLZA 2ISZA 2VDVE 1U78A 3F6OA 3M70A 4GYGA 4F85A 3BDDA 3M7GA 4CHUA 2QVOA 2AXLA 4C08A 4YUXA 4PDKA 2HQNA 1Z3CA 4AIHA 3CLOA 1IF1A 4RTPA 2AOTA 3RI4A 5DCMB 1U3EM 3KPWA 1W5SA 2P5LC 5C9ZA 3GZ6A 2ZBPA 1UCRA 1BHJA 4WF2A 4P7KA 2HTEA 2PG4A 4LFUA 1H9GA 2ZMEB 2G72A 1R7JA 2W24A 4GGGA 1XMAA 3KU1A 3O4FA 2BR4A 1MDMB 2V7EA 3DLCA 3V8LA 1YS6A 2HEOA 2P8JA 1MDMA 2EJRA 1UB9A 3F8MA 3LA2A 2FBKA 1G4DA 2MA3A 4WK8F 2HWKA 3IC7A 5TJJA 4CTJA 2EFQA 4RAYA 3F21A 1P1CA 1T43A 5CM2Z 4BYYA 1RUOA 2K7LA 2K4JA 3NDIA 5FGMA 3UWPA 5F2OA 3J7AO 3K1NA 3HUGA 5IT3A 1HW5A 3U81A 4C05A 2YPRA 1FSHA 1G6NA 2J5PA 3C1DA 1P2FA 1JG3A 3I64A 2IIPA 1BC5A 1XJ5A 1R18A 3K0LA 4OQDA 4OINF 3R0JA 5T67A 1SG9A 1KPHA 1LDJA 4R05A 2RQPA 4FR0A 4G9YA 3R9XB 4HGYA 5BPDA 1ON1A 1RI1A 2EFOA 2JZYA 3UJBA 2M45A 3NEUA 4FT8A 4QDJA 4EJUA 1U5TA 5CD1A 2IDJA 2L3DA 2VBZA 3TPZA 2HMYB 4E2YA 3ULQB 2EX4A 2Q41A 3FRIA 4RS8A 3BKWA 3EGEA 5FWAA 4LECA 2AN5A 5DCFA 4OIQF 5BW4A 1KPIA 5JFRA 2H6BA 5DUKA 4M73A 1LQ1A 2B0LA 5K0FA 2OD5A 5DTMA 3NVKI 1U5TC 4E2WA 2OA4A 2I6GA 5EEHA 3FYDA 4G7OF 2IVMA 5L3EA 5LLQA 3GJYA 3ISPA 5AIPA 3KQSA 1XCJA 3EVEA 4WVLA 4LJZF 1I27A 1TBXA 5GM1A 4LB5A 3W6KB 4HV5A 1QPMA 1A04A 1C0WA 5HFJA 1XCVA 1F4KA 3SHFA 4N0BA 5FUBA 3LKDA 1JTFA 1Z1DA 4P58A 3B7PA 1U5TB 1XVAA 5DX1A 3DMFA 3QP6A 3TO7A 3J80K 1IN5A 2CYYA 4WCGA 4E2ZA 2ESNA 4HYEA 1YF3A 1TTYA 1NW8A 5K05A 5AONA 4MTLA 2ZO4A 2PMHA 4V0RA 4EM1A 4POOA 1XGSA 3U9GA 3L2CA 3ERED 3L7WA 1FBUA 3A26A 3OU7A 5DM4A 2VXZA 1IN8A 1WKMA 2K02A 1K78B 2OBPA 1DL5A 4LLGF 2B3TA 5HS7A 3M8FA 1AF7A 3RKWA 3MEXA 4DZRA 4UV8A 1BI0A 4R8HA 1NV9A 4K6MA 3QRFF 1FWZA 2UXXA 5K5QA 5D6EA 3HOTA 3F6VA 4AZWA 4DA4A 3GO4A 1REPC 3JWHA 2XYVA 2H00A 3RTRA 1HKQA 2MLKA 2LDUA 3T1BA 5ICCA 2A14A 2E1NA 3UJ8A 3LHDA 2GB4A 4UHTA 1LVAA 5EEGA 3QOWA 2IH4A 3GGDA 5K0EA 3KPVA 1X3UA 3P2EA 5K0CA 4OX9Y 5K8VA 4Y30A 3GFLA 2CW0F 4XLPF 3E97A 3H92A 1FBSA 5D5WB 3GO5A 2OU2A 3ML6A 1PRYA 2P7HA 3P71T 5LEJA 1IUYA 3FPJA 2A3SA 5K01A 1AQIA 3V97A 3MWMA 1R8YA 3HCFA 3JW4A 2P3QA 2GA2A 1CF7A 1Y0UA 5GIPE 2L54A 4UXNA 2VDWA 4FSDA 4LMYA 1G55A 10MHA 5FQNA 1RI2A 5K1YA 3UFBA 5LGUA 3PFGA 3TFWA 1LDKB 3FYCA 3I4PA 1LJ9A 3GVAA 1EJ0A 2NYXA 4X41A 3B73A 2PSSA 3E6DA 4RVDA 2PN6A 5DD8A 2BE5F 3V8KA 1QAQA 3E6MA 5D5XB 2ESHA 3BROA 1SUSA 4PGHA 2NAZA 2EJUA 3A25A 3GRZA 1KQ8A 3RPQA 4HF2A 3C18A 1WS6A 1B9NA 1XDUA 1ZREA 1H1DA 2KKOA 1WZNA 4ENMA 2FF4A 2JHCA 3GFMA 1KR5A 1ORHA 1QYRA 1JG1A 3CCFA 1JSZA 5ICFA 4IWNA 3V7SA 4HV6A 3F3XA 4ESBA 3SR4A 4EQZA 4KMUX 2PLYA 2PWPA 3R4KA 2OXTA 1UFKA 2XGXA 3LAJA 1LEBA 1USSA 4P7FA 4IHSA 4KFCA 3UJDA 1S8NA 1VQ1A 4GF5A 4HTFB 1KU2A 2H11A 1HW2A 5DRYA 3KPJA 2FBHA 2FEZA 1NW5A 3GDHA 3SZPA 4X1OA 3MCTA 3I9FA 5CIYA 2EV0A 3MTIA 2L4AA 1INLA 4L5IA 2COMA 3RIEA 4CXMA 4FX0A 5HIKA 2QE6A 4H0EA 2F2EA 2NNYA 1QBJA 3GNLA 2RV8A 2IP2A 3HOSA 5E2BA 2P7IA 5EZSA 3VSEA 3EPPA 4L9JA 4G6QA 1MJFA 3I59A 4AWXB 4A5MA 3PQKA 3DXJF 4AVPA 3LAPA 1O54A 1XDSA 2NNWB 3WTTC 3TMAA 4BHPA 3HVIA 1NT2A 5L3BA 3ERCA 4U0WA 4ZYGA 3FXRA 2Z99A 1IXRC 3OE5A 2JHPA 4EQQA 4UVCA 4UV9A 4EV0A 1ZN2A 2AN4A 3JTGA 4OIRF 2CL5A 2OB1A 2AR0A 2GXBA 4M9SA 2ZCJA 1ON2A 3C6MA 2EG5A 3NJRA 3OCJA 2A61A 3HSEA 5DSXA 5FB2A 1YFHA 4YV0A 3EMDA 3KR2A 5AIQA 4FS8A 5DM1A 3QOPA 2NP6A 1FY7A 1FJXA 2R7DA 4KUMA 4QPPA 3PTAA 1OR8A 1TPYA 3JWIA 4YUVA 1SKMA 3OFKA 5DLYA 3LA7A 3TQNA 1BIAA 1O9HA 3FUWA 2HNKA 2ZFWA 1FP2A 1QAOA 5JHUA 1L3IA 3DR5A 3P2IA 5DXAA 2EFJA 1ZGAA 2QQBA 3BOQA 4KIBA 2XYQA 5BQTA 1KXZA 1IN4A 2IW5A 3HVHA 3HHGA 2P5VA 2DPDA 4OMYA 3L00A 1KYWA 3SM3A 2B9EA 3WU1B 3NQOA 1IN6A 5E1MA 5GIOE 3KKZA 4KDPA 2GIVA 3J80Z 1YW7A 1M6YA 2XASA 1SFXA 3BPVA 2OZ6A 4RTRA 3WGHA 3SFZA 2ZW9A 3N97A 3HNRA 3QU3A 2ZULA 4IXAA 4GEKA 2OKCA
chains in the Genus database with same CATH superfamily
1OROA 2PPLA 3UF0A 2Z4TA 4IZZA 3BJIC 4E6EA 3I5MA 2J33A 1XZMA 4L5CA 2XF5A 1XSVA 3QBTA 4NJMA 2C9MA 5AJUA 3U4GA 3X0DA 3LVRE 1DCTA 2PRSA 2ZVQX 2NYUA 4BKMA 3QBVA 1P9OA 2FUG2 4BATA 2WG2A 3IRRA 4KXMA 5DTJA 2BYTA 5BSVA 4MGZR 4YXFA 2QBYA 1I30A 1TCBA 1X9GA 4JU9A 1JWLA 1HLGA 2LOOA 4OMFG 2V0GA 4DCTA 3UCFA 1Z83A 3ZBPA 3RFVA 4XVRA 1A9RA 3LP6A 4D8XA 4M3FA 4PQRA 1T4BA 4Q7KA 4F38A 4F4JA 3WGIA 1ULSA 5U4QA 5LU8A 1RAHA 3TOXA 3DHYA 4PZ0A 4GXTA 1ECFA 5D00A 4AZ0B 5KVSA 2IBSA 1SUCA 1T2DA 2E2WA 4QQNA 3S0JA 1AHIA 3CT6A 4PGGA 2WI8A 2BVMA 5CM9C 3UT6A 2XC7A 2IP1A 3JD1A 4DNQA 2ZAMA 5LMNB 2XE8A 4FT4A 4D43A 1XNJA 2AF4C 1QBKC 1IUOA 4TXLA 2YBEA 3SYRA 3MWLA 4EJTA 3BSSA 2L0KA 2DWPA 3L8YA 4MB0A 1L3BA 3SBEA 5C7YA 2YV2A 3ACBA 5C1BA 3ZMZA 1GAEO 5E3MA 4U0VA 4LTMA 1AHNA 2QI9F 1V5FA 4H6WA 1QH8B 4UEKA 3V7NA 3OT1A 3CC2I 1W6RA 4IMIB 1I24A 3DM9B 3FNBA 5EVJA 3V3KA 2D0IA 4ND8A 1KOGA 3UHAA 3B2NA 3DKKA 4MRVA 1SUEA 1B23P 2HX1A 1IUKA 1N5IA 1G60A 5GADl 5JJIA 4BFSA 3GJSA 3P0RA 5F21A 1KK3A 3QPHA 1UMCB 1YOVA 2X51A 2JCXA 4V1CB 2LD4A 1JQLB 1PCXA 1ETWA 3WE7A 7ABPA 4OB6A 3L9WA 1VJ0A 3OV8A 2W8BA 4L50A 2VZ8A 4UEOA 4K5QA 1KORA 1NMSA 1E8DA 2OHVA 2CHFA 2EW2A 1SBNE 4PFJA 4BAUA 1KEZA 2AOTB 4JA0A 4OQQA 4WOCA 1E5DA 1JZQA 3QPBA 3CNLA 4UHDA 4NDNE 1T0BA 4BZXA 4Z4IA 1N2SA 2BFAA 1N2CE 2NZYA 1WQ4A 1N36B 1XPUA 4ZDKA 4EGZA 2ZUBA 4O2BF 3EQ6A 2X2OA 2OBFA 1X8JA 3E15A 8AT1A 2Y48A 2GBLC 4OXYA 2FDCA 5CT6A 5C4JJ 2X22A 1EFPA 5FO0A 4NBVA 4OSEA 5EGSA 1Z73A 2DETA 2VP0A 4X6UA 3DUWA 4QVKA 2ZWPA 3IQDB 3V8RA 3ZK9A 5KYKA 4BXXJ 1OREA 1T15A 3V6MA 5HRUA 2QDXA 1DAMA 2FU5C 3DMGA 1VCOA 3FPHA 3QUTA 1PNQA 1N2XA 3DO6A 3EQLF 3ZPLA 3IODA 1R27A 3L3BA 4YH1A 2AEJA 3QUQA 2C8VA 4Y2XA 3KZKA 4BL0B 1C14A 1RAFA 4UVGA 1U7ZA 5IMSA 3LT5A 3SDSA 4RPHA 2V65A 2QTTA 2ZJYA 4H1HA 1O96A 3KZ1E 4G2NA 1YIDA 5LZ8A 5CBKA 5ITVA 1TQPA 2GZ1A 3HB7A 1ZM4A 3THXA 4QVGA 3CCYA 2I3DA 2ZWOA 3I9JA 3H83A 1OWNA 5MFZA 2FRDC 1MDFA 3E03A 2OK8A 1VBFA 1L4GA 5CCDA 2XZLA 4G1FA 1HDEA 4KX5A 2VG8A 4UUQA 3FB1A 5B66C 2K86A 2VSOA 4V0QA 1QRUA 1PUXA 3PUWA 5LQAA 2KISA 3HCDA 4Z6YA 5A04A 2Z30A 3OZSA 1YB6A 2C8LA 3TTWA 1T5BA 3WB1A 5M3BA 4ZTJA 1J90A 2Q2EA 1QHYA 2WD9A 3O38A 4IPTA 1PQYA 3I6IA 1WHTA 4D41A 3ZIAA 4RC9A 4LN1A 4PYKA 5CJJA 2FPOA 5AK3A 2XCUA 3C5EA 3NWJA 1JDVA 4D26A 3PNTA 4LTDA 4RA6A 4YJ2F 3K71B 4D5FA 1JG7A 1OFUX 2IXFA 3E9EA 2R5ZA 3LGAA 1YE3A 4WNYA 2Z2XA 4Y3UA 5F5LA 3SJ7A 1N34B 4K6GA 3UOAB 4QBTA 2ZK7A 3T94A 1NOIA 4Q3OA 1ORRA 5D6NA 2FXAA 1VA5A 3AR7A 2KRHA 3OY2A 4NBNA 5B37A 2YN2A 1GYRA 1H1TA 1W44A 1OCOH 1PGQA 1JG6A 1TCUA 1W0JA 3OOUA 2QTCA 5ILVA 5GONA 3ZW9A 4CIAA 3IX7A 1AURA 1LRJA 1THZA 2XGCA 4M9XA 3MVPA 2ZANA 4UNRA 4PIMA 4HNRA 4OXRA 3GGDA 4IIJA 5DEIA 3KEOA 2ZBFA 4F1KA 5CNIA 5JPIA 5C8ZA 5HUQA 4E1BA 4CIXA 1FTZA 4OMCA 3M1EA 1I2ZA 3JS5A 3TL6A 2PM8A 4ZYHA 4YRSA 2UXDB 3HR7A 4BNMA 4CHGA 2BFCB 3MWDB 4V38A 3EFEA 5KVRA 3UJ3X 2JJ1D 4K8OA 4Q16A 4RK0A 1C9DB 2KW5A 4U7GA 4DNFA 1U94A 4BMDA 4IGIA 1HA3A 2E5ZA 5B55A 1ZJ4A 4ZO6A 4PIPA 4RFSA 1NVAA 2WNSA 3L93A 2BMFA 3ASVA 3A1FA 5IP7J 3L09A 1SD4A 5HDKA 3PHLA 4NU8X 1JFSA 1YZ3A 2HL6A 1VL5A 3NJ4A 3ZQ7A 2G5CA 2GPWA 3OESA 4DIBA 3ZGNA 4P4TA 2ZSHB 1KYXA 1TZJA 1IAWA 1WSBA 4W9RA 5AICA 4WXDA 2IOFK 1S5LC 5LYJA 2VYND 3TW0A 2JGNA 3HCNA 1Z3YA 1W9HA 4IRIA 5TVGA 2WE7A 1BMQA 2R4QA 4US2R 4DGWB 1LI5A 5JISA 2XY4A 2I4IA 3I4NJ 1IDZA 2V0CA 3A32A 1B16A 1Y1VJ 2PQ8A 1J0BA 2IGBA 4OGGA 4XLZA 2FMHA 4YJHA 4BUCA 3M4OJ 1RQGA 3AF6A 4TMWA 3EUKL 2NUAB 1IATA 3F0CA 1PN3A 3ECOA 1RPAA 3ORHA 1EUYA 2BMEA 1WEHA 4EY3A 5DBHX 2EAUA 3JX9A 1QCYA 3DBRB 2FK8A 3HJAA 4R7ZA 2QR2A 1WSWA 1L4NA 3B48A 4O0LA 3DZ8A 2ZTMA 3UYLA 3N7AA 2PVCA 5DX0A 2PPVA 4XQEA 4C3UA 1IQ0A 1Q1QA 1D2MA 4KACA 4GOMD 1VSVA 1CC1S 1EE9A 1V47A 3F71A 3U0BA 1ONBA 2XVCA 1RZUA 4A3GJ 3E3MA 1DKLA 4XUGB 3LW7A 3I8XA 3IIEA 3GW2A 3AR9A 4Z6KA 3HUFA 4I5FA 1NUHA 3FHCB 1XQVA 5LD2C 3U3RA 4DR3B 1ZGJA 3W3CA 1L5FA 1ZN9A 4B7UA 2AHOA 4J0IA 4UJ3A 1K7XB 1Z77A 2EJTA 3L6BA 1OF1A 5HM8A 1S3IA 4N0EA 1E3MA 5EC8A 4XMYA 3HA5A 2V26A 4G4JA 4ZICA 1AA6A 2JIRA 3LVBA 4NC8A 1JKPC 1C1DA 2UZKA 2QX7A 2XV4S 1TZLA 2VHJA 4LDNA 2VI5A 4EI7A 2AZ4A 5KYNA 5J63A 1BCRA 2AFIB 2PXXA 4U2EA 5ARBA 3UGKA 1TW2A 2WA2A 3V2IA 3T3OA 3KR9A 4TN1A 2QN2A 4UUAA 1FDOA 4YCLA 2K9NA 5JXWA 1NTRA 3AI1A 1PP7U 1EGQA 1KP9A 4KGZA 1TTPB 3BICA 3U9LA 4JBAA 4JYZA 4NAUA 1VKRA 3VYVA 4WOPA 1OILA 5F5XA 4KQ2A 3H9JA 4S05A 1JR4A 1YJ8A 3O73A 2X8JA 1QF7A 3IOYA 3KO8A 1DAFA 2HPZA 4RHUA 3D9QX 5DDIP 4BKQA 4ZGWA 3SDBA 3KEYA 8GPBA 3M07A 3DBVO 2P6OA 1UR5A 3NH9A 4DVJA 3F5MA 1XXHB 4WASA 4HAZA 2WAEA 1BD4A 4K9OA 1T0FC 3DPIA 3OBIA 4CLRB 1XP5A 1OYIA 4TT3D 1KOLA 4LW8A 3W2FA 1N7GA 1E3HA 1KVUA 1U2PA 2XSZA 2R7KA 3DMRA 3K6KA 1QGED 1QPIA 4P1WA 2Y66A 4IINA 3HJGA 3UKJA 1QZYA 5HOEA 1BEUB 5A5VA 2J3IA 2R8OA 4FZJA 5BR1A 1V8ZA 2ZWMA 1XIVA 3AVQA 3I9LA 2Q2NA 5F78A 4BUZA 4BYMA 1NMQA 2HZBA 1QYCA 4DZJA 3WL7A 3P19A 3U7QA 3DEEA 3F49S 3FJOA 3RJMA 1E20A 4I0BA 1RWBA 2Z08A 4DNPA 3MKZA 1XTBA 2DUMA 4CH7A 3AY0A 3TKYA 3H1GA 1N5KA 2R96A 1PVDA 1EP2B 1VL0A 2XSZD 2VBGA 2YYZA 4IIFA 4C5AA 2CQKA 3N0VA 4MYHA 2O8DB 4M7RA 4QDTA 5HE9A 5JQGB 2VTKA 1BA2A 2FNAA 3A9RA 1FMFA 1DKMA 5JNLA 3JCUC 2WTEA 1KEEA 1EFRA 3DDNA 1XRPA 1ZUWA 2BSXA 2R7SA 1ZJ6A 2YFHA 3IUNA 4DA9A 4LC9A 4UU1A 2AN3A 3OCUA 2YXLA 3RKQA 2Q5HA 2ZBGA 3I5YA 2D2IA 4M72A 1Z15A 2VEOA 4ER0A 2ILVA 1U5AA 3D6AA 3G0IA 4H0NA 3CVJA 4DCMA 4YCNA 1U5BA 1QK3A 1IY8A 3H2ZA 2G07A 4TMYA 4C21A 4RIEA 3HOWJ 1NJ2A 1VJCA 4GFDA 4JJGA 3HOZJ 2UVPA 3K70D 4LHXA 5FROA 1F8YA 1JU4A 1FLDA 5LZ5A 3IP7A 3W04A 5JS7A 3X1WA 3WIUA 4GCVA 1QG2A 3ENVA 3MRVA 3L1UA 4OHKA 4QUKA 2X3UA 3MUOA 5HHTA 4LF6B 1CZOA 4UVIA 1WU7A 3KKOA 3OJOA 3CUKA 4NZYA 5CVIA 2XXBA 4C4SA 4UFPA 2A1UB 3FN4A 3LUHA 4KR9A 4AWAA 5KWSA 3I01M 1OLSB 4GT1A 4I0WB 5CQGA 1RYMA 1Z8NA 3OEYA 2GKOA 4H0FA 3D3WA 1Z5GA 4QGFA 4HGNA 1MBGA 2ODAA 3RDIA 2OECA 3NM5A 5B1DA 2ONCA 2CJJA 3DDZX 2LREA 3IBYA 3CCLI 3W6OA 1J0DA 4M0LA 2XMDA 1C0LA 5HOQA 5DKFA 4IIYA 1J0RA 4BVAA 3ZVMA 1Q44A 3FR8A 3ENWA 3K2IA 5FA8A 4DSAA 4BV8A 5JTTA 1YU6A 5BOXA 1XP8A 4XQFA 5JAQA 3D6VA 1R9GA 1N33B 3U09A 4BHBA 1ZEMA 4HLYA 2L5QA 2BR5A 4MTDA 3I0MA 5AQEA 4EW2A 4U88A 4RPIA 1FTNA 3VU0A 1KJQA 4MI3A 1SHLA 1FDIA 2CGPA 1HE3A 1U1FA 2WF7A 4K28A 3P4XA 3TKLA 1KMNA 1TC2A 4X64B 4EVQA 5EHXA 3JR7A 1Q91A 1VIDA 1ECJA 4JJ7A 1PTJC 1XA0A 4UM8B 2ETHA 3LUJA 5C4XJ 1S3JA 1WKVA 3ELYA 2IZ1A 1SXJB 3IS3A 6REQB 1TX4B 1MW8X 5HS8A 2XNJA 3L4EA 2WAYA 4I76A 4HTFA 5DU2A 1QHNA 1RM5A 5TF4A 1YFJA 4JP0A 5IVKA 1UJBA 2EW8A 2OL4A 4HEQA 2I3BA 2NU7B 2UYCA 4J4BA 2FMLA 1ENYA 2EQBA 2FE4A 2LW7A 3BXGA 1QTQA 1UK9A 1EQ2A 5ERIA 4Q7JB 4A1FA 2FQQA 2PMWB 3VC7A 4JNKA 3LIPA 4EHHA 3E9CA 3PNPA 1QGAA 3NEAA 3QEMB 3AZQA 1FTYA 1DRUA 3PTZA 1XTTA 3R9IA 3NBZC 1P7IA 1FYDA 2GLTA 3NM4A 4N0PA 1VQNI 1K4YA 1PV2A 3O8HA 3JTEA 3QFCA 3K9FC 2NU9A 2PMCA 3FTDA 1NXVA 3C5WP 4P80A 8LDHA 2Q8KA 3IUEA 1YVPA 3CF4G 2NXEA 2DQ4A 2GZ2A 4WQMA 4RELA 2IYUA 1ETOA 1ZINA 1OYYA 3PUZA 4MA5A 4M0CA 1LWOA 1Q2XA 3U7EB 2CJXA 3EQ2A 4CIVA 2XF6A 3LPMA 1JKOC 3UNGC 2YXDA 4MHTA 2JT1A 1OYOA 3LZ6A 1TADA 4IVQA 3CUEF 3U61B 3EUEA 2GZWA 3RYPA 1DOZA 1Z29A 4WXCA 3KWLA 3AI3A 3I2FA 2G7HA 3B02A 2QB5A 2X5KO 4MX8A 5AIAA 1PJCA 1DIGA 4XKBA 1OFVA 4PLZA 3S2FA 3AEYA 2GD2A 1T3HA 3DVSX 2CHVA 5HJ2A 3IV7A 4ONEA 4GYIA 3A7EA 4KBYA 2FLVA 2CW7A 1XSDA 1JWAB 1TNSA 3AKCA 4JQCA 4Y0AA 2DFIA 5CBPA 3S7ZA 4CKYA 4X20B 4CUZA 3GJTA 1B8UA 4NMXB 1SXQA 3ICEA 1XA3A 4B4KA 5EYPB 2KLBA 2V7WA 1NF3A 1KMIY 1NF2A 2ZE5A 3JQ7B 2VJBA 3DC2A 1E66A 3MFKA 1YO6A 3LYHA 2XE4A 4W8OA 2RGUA 3B82A 2JA7J 3GRPA 2HF2A 2LDBA 3MWEA 3CCQI 2WVGA 3NQ41 2CHEA 4O5AA 5T41A 3ZVNA 4KREA 4DYQA 1UF9A 3WISA 5BRJA 5BMZA 3WGQA 3FIUA 5JWOA 4OKSA 4E12A 2D4AA 4BU2A 4W97A 1XEWY 3DTIA 4Z1OA 2FK7A 1JF8A 2K6GA 5JNSA 4JVLA 4CBVA 1P9QC 4OJTA 4DLRA 1UWCA 4BKXA 2G4CA 4P9FA 2PJRA 2PUVA 4GI7A 4I50F 3ZV7A 1ZI8A 3VU3A 2XLBA 4F55A 1I6MA 1WRJA 3JRXA 3R5HA 5AVKA 4RZQA 1B8IA 3LU1A 3NETA 1P60A 4MEJA 2FSVA 4PSVA 3GGOA 1LK7A 3TD6A 3E18A 2FUNB 5DK6A 4JSTA 4RDIA 5LPNA 3O8NA 3L4BA 3UW1A 5IWCA 1O5OA 4TYYA 3BXPA 1G8KA 2YFQA 4Y2UA 5IARA 4WEQA 2O8FA 2QZ4A 3EDQA 4HS4A 2K85A 1RWWA 3P97A 4MWCA 4QOIA 2D2WA 3BD7A 4KICA 4LGVA 3ROZA 1OYVA 2DFNA 3C70A 2VZ9A 3PPYA 5LVAA 3LTNC 1JHZA 1MD0A 2HQRA 1AOYA 1R6DA 4JYKA 3AZPA 4QBGB 4J0CA 3RSQA 1FPMA 3UY4A 3WYCA 1FS4A 1M74A 3OEED 4G09A 4YTEA 4YMGA 4O2RA 4ZVLA 3GOHA 4EA7A 5K0GA 1KVQA 4H27A 4IVPA 2XEXA 1XQ1A 3OPQA 1LVUA 3EOBI 3P9RA 5K3BA 3ZW8A 3I72A 4UUVA 3HKBA 4NR0A 4ZA2A 3COAC 2YBDA 4MGKR 4FGLA 1UBHS 2JFOA 1GAQA 4TL6A 1RLJA 3KWJA 3TQSA 2ZJ2A 2HYGD 1IY1A 1SEPA 2CDNA 1ZAOA 3RUHA 3DPLC 1EVJA 1D4FA 1LLUA 1ESEA 2FE1A 2JBAB 3UBMA 3W9BA 3B6JA 4O4LF 3S2HJ 1R5HA 1CS0B 4PZYA 4QQKA 4MVJF 5GTDA 1A88A 2IGNA 3WO0A 2QLMA 4F06A 1SOAA 1AQ6A 3C1TA 1B8PA 4LGWA 4MKXA 3GLIE 1EXDA 2JIQA 3R7LA 3F46A 3FSRA 1UMQA 2PE5A 1ZW6A 3ICPA 3UIEA 3ZDFA 4AIJA 5CJ9A 3NMUF 2B4QA 3X44A 4HF0A 1MJBA 4FFDA 2X6TA 3OWHA 3GEEA 4ALNA 3OETA 5F7XA 1RQNA 1T2KA 1XGKA 3PPWA 3H2BA 3BTSA 3GW8A 4OIMA 1G2PA 1SMYF 3HKZN 1J2YA 4OG2A 1XCBA 4MUIA 1D5CA 4NV3A 1MBFA 5K01A 2P2DA 3S2DJ 3B3AA 4NCIA 1VKHA 4WHMA 3DR3A 1ZD1A 3Q8WA 3IBFA 3PB3A 3T3DA 2D74A 3AWDA 3OQ6A 1J9IA 4KO3S 2R1TB 4CLEA 1VPEA 4A10A 4ECAA 3I0ZA 3QWHA 3REOA 1R5ID 1MJGM 5BWNA 5IJWA 4D3DA 3IUOA 4XBFA 2CW5A 4RTSA 2H8KA 3VYWA 4QUAA 2RAFA 3KQYA 4HQNA 4BZQA 3DV9A 1JR2A 3CZ6A 1DDGA 1W581 1M2FA 4ZVQA 3WG9A 3AEXA 3FNIA 4BE9A 2FSSA 2I71A 3JRDA 2P69A 3L7DA 5TQJA 5HRCA 4TYNA 1RM3A 2AB0A 4XLFA 2ZYHA 2O5CA 4DBQA 1GLGA 1ZELA 2VK4A 3WL8A 5FA5A 1UBGA 1NRWA 5AJVB 3SSNA 5GVSA 1DXHA 3OEHA 4MW5A 2YNMC 3QV1A 3H0EA 2XNDD 1VMKA 4IZ6A 1P2SA 5T5QA 3S6JA 5AIBA 1UAGA 4S2EA 1R4NA 1JKJA 4ZTBA 2XMSA 2ZSKA 3DKRA 2OPHA 4B32A 4ZTZB 2HLDD 3K96A 4HSGA 2DLNA 3SGLA 3ZNPA 4HZGA 1XB4A 3PXCX 1E58A 2OORC 1PFWA 3HQ4O 3RGGA 3IAM6 3D3KA 2OPBA 1D2AA 1G5RA 1CY4A 2JZOA 4KR0A 4LMBA 1P19A 4PF1A 4QWQA 4U2GA 1B15A 5AOAA 5C5EA 3CQ9A 4DM7A 1G4UR 2NO6A 4B7ZA 3BTLA 1DOHA 4F04A 1FJGB 1P7WA 1UXIA 1W4AA 2E34A 3D0RA 3FZNA 1Y6RA 2DECA 2GH1A 1SQSA 1IN7A 4CIYA 3G0OA 2HYJA 3H2KA 5HCUA 4LEIA 4MKZA 3WBKA 1BR2A 4HX4A 1J06A 4OA8A 1KO1A 4DCNA 4MULA 3KVYA 2P4WA 4HN9A 3JAMZ 5FFFA 5PGMA 4HDOB 2JD2A 4ZT3A 2OHXA 5KNDH 5KUTA 1XB2A 1T5IA 5EMJA 2M32A 3DAPA 1OQYA 4EJSA 1J7JA 3GPLA 3PJDA 1BKDR 3C2QA 1JYEA 3DO8A 3H2HA 3UT5A 3BZBA 2H1OA 3BXFA 3DLTA 3FMIA 2YDXA 1WVGA 3AB7A 1NMEA 2VRWA 2GPBA 4G8BA 1LF0A 2NVXJ 1QONA 1EH8A 4DF3A 2HDHA 1EWQA 3ZGOA 5EE3A 1I33A 4C0SA 3OEHD 3G2QA 4Q9KA 3T9DA 2UDPA 3ZC3A 1SH7A 2ECQA 1NIJA 5BWLA 3B3QA 1CE8B 3F4LA 4HY3A 5FJ8J 1G2IA 4M3DA 1K2VN 3LP8A 1TMOA 2Z56A 2DVMA 1FMLA 4QGAA 2PLFA 3R4VA 3EGIA 3DKVA 2R44A 3NIBA 4N49A 121PA 3H8JA 4BO4A 4HV4A 4HEA6 3SJCA 2YHSA 4GMGA 1XLTC 2V03A 2OHIA 3BUSA 3HDYA 4RW0A 2X5OA 4DABA 5K5RA 3HS3A 4A0HA 5AVJA 5C80A 3ELBA 4RB3C 3DVAB 4R1HA 4RLQA 2PUTA 4BMZA 1GNRA 2CQ7A 3I39X 3OLCX 4RKWA 2EL9A 1F8FA 2Q4RA 1NJFA 4FW8A 2G5TA 4N9HA 4LD5A 2AZTA 1WMSA 3W1VA 4CTMA 4FOTA 1QE3A 1X1BA 1XZBA 2YR0A 4H3VA 1VBKA 2G04A 5BMVA 3A6GA 4ZO7A 2OHGA 4HTAA 1K89A 1NMZA 1DO8A 4E3WA 2OO3A 2RHLA 1UJMA 4NEGA 5JG7A 1YQTA 3EFHA 1KH3A 1K88A 1E6UA 5FTKA 4BMSA 1APLC 3BWDD 3G59A 5JS8A 1ANKA 4HDMB 4KDCA 4IIJF 3AF2A 5EWMA 3FYUB 4AIKA 4X1IB 3ZDZB 2O9LA 4ZZ3A 1UH5A 4EITA 4CM5A 3KK0A 1XRSB 4MAMA 3DEAA 3VKFA 2IYYA 4NZMA 1LSOA 3TWOA 3PX3A 5FUQA 4DV2B 3HRTA 3VEPA 1KKLA 1ZRHA 1LW7A 5IM4F 3NKVA 1A7KA 2M4KA 4US0R 3PLNA 2PWAA 4RV9A 1FA9A 2R5YB 3H5OA 5CTAA 3ZHCA 1BI1A 1N5JA 2P5KA 1U2WA 1NXTA 4A0XA 3IB6A 4D0PA 2ETXA 4BJ5C 2QN9A 2XGMA 2Z09A 3M83A 4S1WA 5INTA 4ZDLA 1M67A 3PYLA 4X60A 3FPEA 3DG9A 4KZPA 4AURA 2CCJA 3P5SA 3R0QA 2AN1A 2OPTA 1CETA 1T3LA 2CEAA 4P38A 1GDTA 1GL9B 3HJBA 2I5PO 3LCCA 3K3PA 2I33A 2FSVC 4NULA 1RP7A 1AQJA 4PS1A 4C76A 4M1KA 1PEDA 3RYIA 3BERA 3MTDA 4AQDA 1TYAE 4OVKA 2HPHA 1SCUB 1Y3CE 1S5PA 1UOPA 3HYCA 3KE8A 3JYQA 2WQ7A 4G0XA 4PFQA 1Z21A 1T39A 1X19A 5GTIC 1E1KA 3W8DA 4CPDA 5AW8A 5CCEA 1EXWA 5J23A 1VE5A 2QQEA 1V1RA 1KSGA 3WRYA 5CDYA 3DEIA 3PXEA 3KWFA 1FX1A 3FMSA 2R7LA 2NU6B 3BH0A 5ILSA 3BRSA 1W5AA 1HE5A 3LQQA 2PLNA 3RFTA 3M81A 1GLNA 1XEFA 2JJMA 2P9QA 4LXHA 1P0QA 5E17F 4JK1X 4HNQA 4W8HA 4X1OA 5I6DA 2OM2A 1UOQA 5FTJA 3THRA 4CM6A 1KO8A 1VL2A 3B20A 3G2HA 3K09A 3T3IA 5EYPA 4B4WA 2ASEA 2FPMA 3FDZB 3T41A 4AI6A 3Q9UA 1SQGA 5LDGA 5AW4A 1Z6TA 4XLCA 2HGZA 4QUHA 3CLSC 3WQRA 3UC9A 2FZCA 4YO7A 3ADDA 3PEYA 4XCXA 3JQBC 4GICA 3Q7IA 4Y6GB 4KDRA 2QZSA 5F3DA 1OGJA 2C4NA 4YFYA 3JQDA 3I0NA 1DI0A 1VFPA 1NAHA 2H2GA 3KQTA 3QYAA 3GVIA 1KQGA 3RFCA 5E3NA 5FRMA 3LNTA 2QTWB 4CCNA 2ODNA 3D0OA 8ADHA 3I2YX 1NW7A 1FRZA 3K09C 3ZI0A 1RU3A 1KPGA 1MPTA 2Y4OA 1AKTA 4XRSG 4OHBA 4HDUA 1ZH0A 3FCSB 1ZO8A 4LDZA 1R0LA 2B1GA 3ORQA 1OIVA 4TSFA 1I1OA 2JD1A 5DCUA 5ALSA 2JJQA 1W88B 2EGUA 4JC8A 4B83A 1XRRA 1XTAA 1MJHA 1HQYE 2FZVA 2NSLA 2XOKD 1U3GA 3FGOA 3H75A 3IA2A 1JGGA 2MYNA 2DULA 2DT8A 2X4LA 4FSXA 3GEGA 4DMMA 3A0BC 4XGNA 3TBFA 1E2DA 4H4EA 1HX7A 3LZDA 2CFOA 2WJWA 3GRFA 2GKGA 3KZCA 3QTBA 3QQPA 4DMUB 1MBKA 1NOKA 3CNNA 2X9NA 2C7GA 3RUFA 1I6LA 4HVTA 1DWQA 2FAXA 5CFRA 3KYDB 2PBRA 2L9RA 3C5HA 3CRRA 1MP0A 1NVVR 3B6IA 1VSQA 4Q48A 2H4HA 1NC1A 1TM3E 1N6NA 1T3TA 3D2BA 3MB5A 3PQEA 1THMA 3G2IA 4JLOA 3KQPA 4MGEA 4AJ1A 4JMPA 5K0SA 1MQ8B 4FD3A 1UZCA 1J97A 2JFPA 4FSHA 5GMOA 2SKEA 2Q5JA 4F4IA 3JYOA 5DI3A 5DYMA 1YASA 3CB2A 5IYCJ 2VAXA 2VBYA 2HA7A 2YIDA 3AQIA 3HLYA 4KO1S 4S0XA 4BMVA 5ELMA 1ZC3A 4DT1A 1DEOA 1ND6A 3IULA 3GLFA 2IPXA 2IL1A 4ZOLB 4BB9A 4DQKA 2X86A 4F3YA 2QTNA 3MJCA 1QVVA 2PLRA 1Z45A 2XEDA 3ZXIA 5EJFA 1XZGA 1ZVQA 4XJXA 3B1WA 4ED9A 1M8KA 1Z0ZA 4KQMA 5FP0A 2LNDA 2SECE 3D4NA 3RHFA 4AY2A 1B41A 2C5LA 4ZOEA 5D7NA 2XNCA 4XB6B 3VO2A 3ND8A 3JRCA 4BXOB 3VYSB 4YP6A 2VBWA 3KOWA 2GEVA 3ZHBA 4KQEA 3GFGA 3OF5A 3JAKB 3OO0A 3Q87B 3QP9A 3VNRA 3WIEA 3ID6C 1NX6A 3FRJA 2FDRA 2VPPA 4GLFA 2HS5A 1VLVA 4P84A 3ZU3A 2OB2A 4M0KA 5I9SA 3D4BA 2GJ4A 5B1HA 4EYKA 2M98A 3F2IA 3F9CA 1E69A 4DSUA 1K8ZB 2ZJPF 2HEGA 2JFGA 2OCAA 2CLEB 4PFOA 4IZHA 4RSRA 2LBPA 2RGXA 2R7TA 3CSDA 3LA6A 4B3JA 1T3ZA 2GHRA 5AVZA 1E1LA 3HG7A 2D6FA 3NBUA 3VR1A 3PTLA 3WIDA 1HG1A 2J9YB 4H1VA 1T91A 3AFGA 4X63A 1G8YA 4ZI5A 5DT2A 3T1HB 2R5NA 3GYBA 5I4IA 1G18A 1KJ8A 3PWSA 3WJ2A 4ENTA 2QL9A 4CVNA 2AI2A 2DE0X 3IQIX 5CH8A 1YRHA 4ZZ0A 3U7GA 1AUXA 3SZTA 1U5CA 4FJ2A 4U9UA 5HDQA 4ARSA 2Q21A 2VOPA 2VRBA 3V4GA 2X58A 4GX1A 4R8VA 4N6GA 4D9HA 4QPCA 2GNPA 3MT0A 1RETA 4NCKA 4GOOD 5HM6A 3CZAA 3NDRA 1XZNA 3L0CA 2F8MA 3ODGA 4OP3A 5FUYA 2WT4A 1GZ4A 4UNQA 1J39A 3ZY3A 4BGIA 2XF2A 4N8SA 3CEJA 4AMGA 3A3PA 1KY2A 3B85A 4LNHA 5CTJA 3DFFA 3DC7A 1ORIA 2E60A 4AC0A 1M6HA 5GONF 4LHWA 3SR0A 1G63A 4PHFA 1R1TA 2ZIFA 3EXHA 3H9QA 4HP8A 1HBXG 2P7CB 1H2HA 1R5OA 1XQ6A 3K0AB 3FTEA 4C43A 2CNNA 1OT5A 1IHXA 4JBXA 4XJVA 3PNSA 1X3ZB 1NQTA 1PZHA 4TVOA 2XRFA 4U7WA 3S2EA 3H6KA 1Q57A 4MLZA 5EVCA 2PGXA 2WDPA 4MTCA 4QYWA 4U0KA 4UDOA 3FPGA 5JAPA 1WMEA 1QIJA 2AO9A 3E2IA 3CY6A 4K3UA 1OFTA 1Z2EA 2ECBA 4MCHA 1SXJD 5DHPA 1D3YA 4WFQA 1TL7C 3I5UA 5LA6B 1DZ3A 4TV9A 2QEXI 2PJPA 1DT5A 2QT1A 3O8DA 4HFRA 5EJAA 4EH1A 5F2EA 1J59A 1DBPA 4TLEA 4XYBA 4E7KA 1Q11A 4DADA 4GOLD 1R12A 1KETA 2AFHE 5DM2A 3EOZA 3H6HA 5JNVA 2G6TA 2JGRA 3MWYW 4IGEA 4C6SA 4UVEA 4EMSA 1CNMA 1RYEA 4IHTA 4RH0A 3JATB 3L05A 4WK4B 2PS3A 2IDZA 5I4CA 4GS5A 4HWOA 2Z8ZA 2MU1A 4TLAA 2E7XA 2HMSA 4TQGA 3GLFB 3VZSA 3NHMA 3GLHB 3EF3A 3I9KA 1U0HC 3N5KA 3DTKA 1T4DA 3LF1A 3ASOH 1BIBA 1Z7UA 1KGDA 2EPFA 1WZCA 3PGA1 5TQ0A 2QP9X 4WPGA 1OOEA 4IQJA 1PZXA 2DFFA 3AFNA 4AX8A 1Z7EA 3U13A 4MGIR 1D7AA 2QLFA 1E1YA 2ID4A 2E36A 2COBA 5AWFC 2YWGA 5DNDA 1L1EA 5HSGA 1E18A 2QR3A 4AK9A 4IXDA 4UEQA 2DPXA 1EVYA 1HFKA 3HHPA 4OM7A 1O94C 2XKBA 4N7RA 3IYLW 4DS3A 4QBFA 2IUTA 1AU9A 1PEAA 4EY8A 1MQ9A 2H6EA 2AX3A 2V7PA 5EYRA 3CC8A 5G1OA 5A9SB 1UODA 2WINI 2QRQA 3HRIA 3FWNA 1O8BA 3QVJA 1XQWA 4F7WA 2HRBA 1MO5A 3GTMJ 2MJLA 5DYNA 3MLBA 4LV8B 4DJJA 3GNSA 2ZS7A 3QENA 2VF4X 3NO4A 4FDUA 3IRQA 2Q5FA 4WK0B 1IHOA 1RVDA 4JQYA 2AOXA 2VUUA 1LVKA 2V7BA 2A5YB 1SCIA 4ITRC 4XYLA 5CFOA 4IH9A 2VJMB 3V4SA 3E7FA 1HEIA 3QPVA 3WWEA 5SY6A 3M1LA 3GLIA 3WWCA 2K9QA 1CDOA 2I1QA 4FDTA 4NCHA 3CF6R 2MSWA 1T0PA 4M1OA 1T08B 2PMUA 1QS0B 1WZIA 2C5FA 1IJWC 2PBIA 3P5JA 4AMVA 2O8BB 3KL4A 2J08A 1BOFA 2H4JA 3PJFA 4IY1A 5CVCA 2WB2A 8ATCA 3S32A 1GOTA 4Z0HO 1DTSA 3OKPA 1H23A 3S2WA 4ZXFA 1R58A 1TCCA 3WYEA 1MNMC 1RRKA 1E5TA 3QMVA 1ODCA 3PNOA 4MYDA 3P0FA 3PDWA 3BFPA 1SC6A 2IKSA 3LXUX 2P9EA 3DE0X 1HDDC 4D81A 3Q8MA 2C58A 3TW6A 5LNK1 1ZPDA 4NH0A 5KC9A 2VUTA 3DGEC 2JA1A 4LHEA 1OBFO 3W9SA 4M83A 2Y0SN 5K7ZA 4MIMA 4H59A 2YIVX 2C96A 1Y8AA 3EIWA 3HVKA 3ZZ0A 2JK3A 5A62A 3LT2A 2IHJA 2Z6VA 4IZIA 3GJZA 4MUBA 3GDOA 1EIZA 3SS7X 4R3WA 3QLUC 4BEHA 3SSOA 5KOHB 3R8FA 1JH8A 4PHCA 2B25A 2XMRA 2B2CA 2QRLA 2Y1GA 3AR2A 1IDN1 2D1YA 4D1YA 1HURA 1R6XA 1W4MA 1ECCA 1UMDA 1KQ0A 4JENA 2XKKA 4BLUA 1YZVA 3UG7A 2QQ5A 3VR4H 1Q12A 3QVLA 4MVJP 4Y2JA 1JGSA 3L1IA 2JSCA 4EM0B 1XFDA 4P96A 2QTMA 4GD3Q 3ZDYB 1QF6A 2UV8A 1I6WA 3ZYZA 5C7IO 2QN8A 3TB4A 3RKYA 1WSAA 2HCTA 3NEYA 3I73A 3NGMA 3UK6A 2AFIE 2GXQA 4ZQCB 4KQGA 3GLVA 1QGUA 1CLEA 1TJPB 2X8LA 3UJAA 3HFJA 5IT9Z 1ZUD1 2GGSA 4UVDA 2Z6AA 1Q1BA 3BWVA 2IYOA 1K7YA 1QGUB 5I5GA 1I01A 2OFFA 4C6HA 4YFNF 4QXOA 3GEPA 1ZD5A 2C1EA 2KJBA 2WF6A 4M21A 1UQTA 4AP9A 5BQXA 2CYCA 1HSTA 1FYKA 4DA0A 4HLUA 4E31A 2LCFA 4C3HJ 4Q02A 1A6IA 2EFEB 4E0BA 5AVQA 5K8UA 2Z3VA 5CFNA 4PSUA 4CF6A 2HNHA 3WAGA 3OOEA 1RZRD 1JA1A 1FDSA 5IT5A 1TKRA 1Y33E 1ZICA 3IAS6 5C7OO 2RGYA 1V5WA 4L9VA 2WVJA 1ZD4A 2XVAA 3HYRA 3SJZA 1I9CA 3PX7A 2GN1A 5FULA 2I7XA 2X9VA 2G1UA 1FC3A 2YR2A 1Z2DA 3CZPA 2XAJA 5KYVA 3UAZA 2HOTA 3S8MA 2FPIA 1LPBB 3KOMA 4PTYA 5D3ZA 3U2QA 4AJKA 4NZOA 2BAGA 1KQPA 2ALJA 4KT6A 1WCXA 3SCZA 5L51A 1JEYB 3HYSA 3SHTA 3OQIA 4BFVA 4G6ZA 1GCUA 1K79A 1JV2B 1LU9A 5DM7F 1RPNA 2YY6A 2EBWA 2PSHA 1LPMA 2V8BA 3FB4A 4J75A 4JLKA 4Q1DA 4IDAA 4EKNB 3HBNA 3NKLA 2VQ3A 4M1WA 2DBRA 5KS2A 1MB9A 3CUOA 5JJLA 1B43A 1PD1A 5EPOA 3EHDA 4EUNA 1OFUA 2JEYA 3GY0A 5FB3A 3K9BA 4KB5A 1V3QE 2ZXJA 5BYAA 4FXPA 3UT5B 5JAOA 1LPPA 4C7XA 4IFIA 2G9UA 2AFRA 1L5QA 4R0MA 1BH6A 2GN8A 1Y6ZA 3NWSA 3A10A 4D0RA 1LDMA 4C3IJ 3KSAC 2FOKA 1Z75A 2G83A 2ONJA 2QKLB 1JHRA 2OK7A 2OHJA 3ZX4A 3ED1A 2Z8YA 5I9NA 1H2XA 2D7CA 3VOAA 3ORRA 1MEJA 4A0QA 3ZQ6A 3NRJA 5AH0A 3U7RA 2CVQA 1IBMB 4YMVA 3AVVA 1DBSA 3TCXB 3DPSA 3NS7A 3QP5A 2EYUA 1U9IC 5BN3B 3V4OA 4KXWA 1R9JA 1BSVA 1UQUA 3EA0A 1MO2A 1A31A 2Q4EA 4F9TA 4RPCA 2IDMA 4LF8B 4HAUA 3M6MD 4WMLA 4LK2A 3OE4A 3M1CA 2XT6A 3GRCA 5HF6A 4F7DA 3JWJA 1YS7A 5JD6A 3ESWB 1IBLB 4G8XA 3EC2A 4LI0A 5KTMA 1M8GA 2E5NA 4YMHA 4Y67A 3C3WA 5DP1A 2PGAA 4FCYA 3BA1A 2KHZA 1L5MA 2ZJ1A 3J81k 3VOBA 1IN1A 2PZGA 3IE2A 3BMCA 1ADYA 1E6WA 2AQHA 1RBMA 1T6ZA 1H6DA 1RAAA 1R0YA 3VNUA 3Q10A 4QOJA 3R7WB 4B43A 5KSPA 3W4IA 1Y6GA 1HKSA 1ZKDA 1K3UB 4HMPA 3HWWA 5LB4A 5BN1A 2JDID 3V2HA 3EGDB 1DGWY 3NTLA 3OURA 3WLRA 5KQSA 5LN1A 2X7HA 2YMPA 4QRIA 4R2JA 4DMFA 4NXNB 3OPNA 1Q92A 2WJGA 1OFHA 4HH1A 4XLNF 2VXCA 2F1JA 3BMNB 4FN5A 4CFZA 4QUGA 4U2DA 3IQZA 4EP1A 2FZKA 1G8GA 2B4AA 2WA0A 3FSEA 1G8AA 5DV5A 1KFKB 3P2OA 3U80A 2K2QB 4OYHA 2V5VA 3L7MA 2HXOA 1XRQA 3OZBA 4GP9A 1M2HA 1UBUS 1JEAA 2ZIVB 2FR8A 1TVKB 2CNBA 1SUDA 4L3WA 1BN7A 2HJSA 4UW9A 3ITNA 3TOSA 2DBYA 4R5MA 4C4PA 4IHYA 3NIGB 5JO0A 3K4QA 4NYMQ 1P1HA 1J5EB 1LPQA 4KH1A 2YASA 5T4FA 4S1TA 4N7MA 5IULC 1KI6B 5K3OA 1K97A 2PMBA 1RKTA 1EJ2A 1NBHA 3AIMA 1O3SA 1N0HA 6PAXA 5JD4A 2DAPA 3Q7TA 4ESVA 2BFNA 4BL5A 4YUZA 3WOHA 5AVSA 3LKZA 3RCBA 1GY8A 1XTPA 1Z68A 5DM0A 5GWXA 3LC7O 3FISA 2MYUA 3PXBA 5EKUA 2BF7A 4C06A 2WZCA 1RM0A 4Q7QA 3IDFA 1B0PA 2CDCA 2OGTA 3HB9A 2JFFA 2VP3A 3B1XA 3QKUA 4Z7JA 3AVUA 2GBFA 3D4PA 1C1XB 4TV9F 2C5GA 4NBTA 4DRXB 2FQWA 3OPYB 3OL4A 1LW6E 2DSNA 1AGXA 4FWBA 5FHQA 1WDTA 4OCZA 2HA2A 3VMMA 2ODWA 4OO3A 4Y0NA 1EH7A 3ZNQA 4I14A 1QVWA 1FNMA 2G7MC 2PZAA 4JLWA 4DUGA 2DG2A 2WLSA 3V8BA 3KP4A 3D0QA 1ZCBA 2OBXA 4FM9A 4GI5A 3LSJA 1AM4D 1ZESA 3A70A 1VHJA 3H99A 3V3TA 3Q6NA 1ZK2A 1ORTA 1UUFA 4Y0VA 1BJRE 3AVWA 4LJ8A 4PU0A 5HE8A 4PXYA 3R6DA 4OJNA 5TMDA 1J9ZA 3AGPA 3T3HA 2CFXA 5H20A 5J1UA 2BBYA 2CFCA 1EUDB 2EWMA 3P0HA 1BW6A 4Q4LA 1O4XA 4YT8A 4ZHSA 3COSA 5LP6F 1WUYA 2EARA 3OX2A 2IPQX 3JQAB 2WYIA 4PZDA 3GZJA 2CO5A 2F1IA 3V2UA 1W0KD 1FIPA 4KI0A 4ZT7A 4TXHA 1FU7A 2CE2X 4NCXA 5E9WA 3GPBA 3RASA 4DNXA 2QAJA 4K81B 4KU4A 1UZNA 1TZKA 3I61A 3R7WA 2CD9A 3M8EA 2X0DA 2WSLA 4G84A 2PNFA 2SNIE 2Q0HA 4TPKA 4DMKA 4ZCIA 3R7SA 4ZXPA 1UMBA 3R24A 3V1MA 2FRHA 1E7RA 1LBHA 1A27A 1CRQA 1WSDA 3PDHA 1KC3A 1X7YB 1H2YA 3I4CA 2P41A 4I3HA 1TM1E 1SPBS 1T4CB 1J33A 1VJGA 4CR6A 4EVRA 1CUHA 5LMZA 1ZITA 4YASA 3FWEA 3D81A 2J85A 2XUAA 1H0MA 1QGYA 1E94E 1O0SA 3GGSA 2ZWVA 2BEUB 4HC4A 4BJ6A 3NOQA 4YACA 3EYIA 4G0YA 2QY9A 3OZ7A 4XA8A 1ESDA 3EG9B 4O4JA 5J3JA 1T34A 2XUFA 3PQ3A 2RK4A 4KPFC 2O8BA 5M5YJ 3OYKA 1XMOB 3AONB 4EK9A 1WF6A 5E4TA 1SBZA 1E79D 4I9UA 1MMNA 2XZPA 4PLYA 1Z6XA 5A05A 3ROXA 4BMOB 5JATA 2IA5A 2J3JA 3DFZA 2YXEA 1JLRA 2EKZA 1ZH4A 1Z6YA 3EUWA 5T8KA 1HY3A 5COAA 2WV0A 4CQMD 1O5IA 4YAJA 3SS8A 3TQFA 2FX0A 1OVGA 5G4KA 4BVJA 3ZVKA 5HTOA 2XTNA 5JZVA 3BQZA 4I6EA 2M6KA 4E09A 2ECFA 5ERXA 1E3JA 5IXSA 3DE5X 4DLPA 4EKYA 2YQ5A 2ZSIB 1XSXA 2IHUA 2J3KA 2WFAA 3D3QA 3G9XA 4FFBA 1U2DC 3V8QA 5HJ7A 3FBWA 5LC1A 5TXGA 5EIXA 2WMYA 3ZCQA 4ZYVA 2A4MA 3V48A 1QO9A 4KA4A 3U4DA 1JH9A 1HDGO 2IHKA 4W7IA 4NFYA 4QBKA 4DZTA 4K9QA 2HK9A 2R87A 3RD5A 4M6XA 4HGRA 2ELHA 1I7DA 1WMBA 4MCJA 1YB1A 3AM3A 2XCQA 3NHKA 1QZ3A 3W2GA 3N39C 5C51B 3HEAA 1XTJA 2Q6KA 3STTA 5IKPA 1H8HA 1KHTA 3SE0A 2NNNA 3HO6A 1CUDA 1U9OA 2GPYA 2F3PA 4KW7A 4O2AA 4P08A 5FNVF 3M4ZA 4BV9A 4OHWA 2IH5A 4HAMA 3BOSA 3R8XA 3SIRA 1MHTA 5G0TA 1Q7CA 1X1DA 2D06A 3WHPA 5HVQC 1ODLA 3FY4A 5F04A 4P8RA 2IUSA 2DPUA 2VDPB 4MAAA 5HFNA 3TNYA 5LWQA 1N7JA 4G0VA 3TR5A 3CWZA 4TL9A 2WIFA 2LWIA 3ODPA 3S2YA 1IZ0A 1JLSA 1BXRA 2AC7A 1TAHA 4N4NB 3SEQA 3BDAA 4X45A 3UBTA 2CWWA 3ECHA 3SYNA 3UCEA 2WUGA 1MO3A 1PT8A 3RPUA 2RH5A 3HBAA 1Y3AA 2BV3A 3LA8A 4HFJA 3IVGA 4DQVA 5BOSA 2FSGA 4NARA 1C0IA 4AS1A 4Q1EA 1MN6A 1X7WA 3CWCA 3D31A 1OV6A 3FCYA 1ZH8A 3LY8A 4Q9AA 3RQSA 3W5CA 3MAJA 1H05A 4RXMA 3PSIA 1DBRA 4JLMA 2O6GE 4E70A 2W6NA 5D2CA 1C7JA 4QWWA 2F5VA 3PUJA 4V0NA 3DQPA 1GV2A 3MOIA 4RF3A 2RIPA 1BVUA 2Y77A 1XBTA 2WJPA 1QLWA 1M34A 2PGIA 2A78A 2X8WA 3DUFB 1ZXXA 1YOBA 3KJEA 4NY1A 2H4XA 2XUQA 2DQSA 3QBEA 2NV6A 4GYWA 5CH3A 2QLTA 1VSBA 3AKYA 3VFZA 4L5YA 4JVSB 3S4YA 3WLAA 3MD0A 4ARZA 4KGDA 2K4BA 1RFLA 4X9XA 4ZMSA 2IW3A 4IO9F 2GBIA 2HMUA 3X1XA 5DNCA 5D5QA 1JHUA 5K3EA 2J5OA 1P1IA 1U9YA 2BDUA 2I80A 3BX1A 4CUJA 2EV5A 1JQKA 4XX0B 4DLBA 2HA6A 5G0VA 1Y6IA 4REMA 2GAOA 3H11A 4AKTA 3OYGA 4DSTA 1X1CA 2ATCA 4ND1A 5E4JA 5SYMA 1ZG3A 1WNFA 3PRYA 4MEYF 1D2GA 1QHGA 4N03A 4MRMA 3UVEA 2NOGA 3N4MA 5DK4A 5IP5A 3UWDA 1WHSA 1UM9A 1J0XO 2V7FA 2M4GA 1L0BA 2W2QA 4DBVO 2RKWA 2BUCA 3HXKA 1GJRA 1N2CB 4ZV7A 3IEPA 5GP1A 4BEVA 2BEWA 3C3DA 5IJAA 3N74A 2QTVB 1A3CA 2EIXA 4UNNA 3W2AA 1JECA 4I98B 1P4XA 1COZA 2I2FA 3C5VA 3TQIA 1GVDA 4C03A 2W6IA 2P78A 2XOXA 1PR2A 4MJLA 2Z5UA 2ZB7A 3INTA 3ORFA 1HOTA 4XORA 1KEEB 1X7GA 4K9MA 3TXYA 3DEHA 1I13A 2FR8C 3L2VA 1BJZA 3IHUA 1N5OX 1Y37A 2AFHB 1Q15A 3OOHA 3P94A 4DIFA 1NBWB 1Z74A 1D8AA 3HABA 5BWOA 2BP7A 2DXIA 1X9HA 1E7QA 2G1AA 3NDBB 1F2VA 5HZKA 4F9EA 3RJ9A 2EQ5A 2YZMA 4Z99A 3IJ5A 3T1OA 3QM1A 1R37A 4ZVOA 2VKTA 4G9BA 4QYIA 5GV8A 4RGVA 3TRFA 3VZBA 3RZOJ 1B2LA 4C0QC 5CITA 1YSCA 1HDIA 2P3LA 3ASYA 4TXNA 3QXHA 5T6MA 3LWDA 2GM9A 2G40A 1SIBE 3BR6A 4ES6A 1GRVA 1Q22A 1T5OA 2FPPA 4M99A 1WB5A 5ARDA 1QB8A 2FSPA 3EIHA 1TNTA 4C0KA 4EZIA 1U8UA 3HJRA 1T24A 2RB5A 2DC1A 1F7VA 1L3CA 1V5GA 1FUKA 3FPSA 5TF0A 5AOVA 4JI3B 3SZOA 5GINE 1AQLA 2JL1A 3INNA 4C0JA 3CR7A 4FIDA 2PD4A 1FMTA 2PCJA 1KE2A 3UPUA 3JAWA 5C5CA 3MTAA 5K09A 3PNYA 2NZXA 1YO5C 3EWSA 3G1UA 2WWRA 4P54A 2JGFA 2YN4A 5HX7A 4EG0A 1O1YA 4Y3OA 1YE9A 4LBZA 3SY8A 4DJTA 4IX1A 5BVHA 4BY9E 2DKOA 3NWEA 3K6RA 5H02A 4KUHA 1ETYA 4ZU6X 1KAGA 2PGOA 3D4IA 1G3TA 5DM6F 3PUFA 3P26A 1YITI 2VP9A 3ANTA 3AOEA 3G7NA 4KYTA 1AKMA 1F0PA 3PNKA 4NU5A 1RKBA 2JBHA 4H08A 2O3RA 3MFYA 3OG9A 2VI6A 2O52A 4YJDA 3TSOA 3VH2A 3SI7A 3M3YJ 1JMKC 3B9QA 4WCFB 2KZGA 3RSOA 2CCGA 2JCVA 3PRJA 4HDRB 2DMPA 3KLOA 3KVVA 5IAEA 1LQUA 1B73A 1XE3A 3F8WA 4KAFA 3CVVA 1EFDN 4TTJA 1YR8A 4DW8A 3QHPA 2WBMA 2O61A 2HVQA 2OCKA 1X80A 3QPCA 4E7JA 3VBCA 1NV8A 5BNWA 2AKYA 5K8CA 1H85A 1PT6A 2R8YA 3BXZA 4LX8A 1QIDA 4J19A 4UBKA 4LXYA 3FM3A 1W94A 2D7JA 2H1LA 2BR3A 2LBFB 3IXMA 2A6PA 1V6CA 3BE6A 3I2KA 4EOGA 3QEMA 4DV0B 2OHFA 3DTEA 1RPTA 4WCDA 3NHWA 4Y2SA 3F6CA 2JLXA 4ZZLA 3B3FA 2HYIC 1B7GO 2R1UA 3FDFA 3L7KA 4UMDA 3RM3A 5FWXB 4G5OA 2I2AA 3DS8A 4ENKA 1XEAA 3OAAA 1WHSB 2DYKA 2DK8A 5JR3A 1CF9A 2BZSA 2J7KA 4MRNA 4WFIA 3V8PA 3TF5A 4ZRDA 1AK2A 2AYZA 4GE0A 2PO7A 1C7EA 1K5DA 4Y7CA 2IRFG 2REQB 5K0TA 4UXJA 1C8LA 1Q0TA 4XLEA 3L5KA