1FP2A

Crystal structure analysis of isoflavone o-methyltransferase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
345
structure length
345
Chain Sequence
RKPSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIGNVRRLMRYLAHNGFFEIITKEEESYALTVASELLVRGSDLCLAPMVECVLDPTLSGSYHELKKWIYEEDLTLFGVTLGSGFWDFLDKNPEYNTSFNDAMASDSKLINLALRDCDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVIDKKKDENQVTQIKLLMDVNMACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.
pubmed doi rcsb
source organism Medicago sativa
molecule tags Transferase
molecule keywords ISOFLAVONE O-METHYLTRANSFERASE
total genus 122
structure length 345
sequence length 345
ec nomenclature ec 2.1.1.150: Isoflavone 7-O-methyltransferase.
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fp2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1fp2A02
4YFXF 2XHKA 3DLCA 1I27A 4G8XA 2VDWA 1USSA 1C0WA 3ABUA 2NP7A 2I62A 2XAJA 2O0LA 2HMYB 3TRKA 4I01A 3RYRA 3TM4A 2B25A 4K2EA 1B6AA 4I98B 3GU3A 3Q5FA 2PLYA 3BGIA 3HUGA 1KU3A 3DR5A 1QAOA 3TOBA 4D0PA 4ZYEA 5E1BA 4EMSA 2HFHA 3BJAA 5CCBA 4U0VA 1XSVA 1RI7A 2L01A 4EM2A 5BQTA 2PV0A 3TOSA 1KIAA 3DF8A 3P2IA 2PXXA 3I71A 4RX1A 3NWBA 3O7WA 3ZMVA 3FXQA 3SXYA 4FGZA 2OAZA 1ZRCA 4WXDA 3WE3A 2DT5A 3PQKA 1ZRFA 2VE8A 1DPRA 1O3TA 4Q5SF 1G6Q1 1W4MA 2VE9A 1P4AA 5FFZA 4RSRA 4OIPF 3JSOA 3WU1B 1LDKB 4QTTB 2KW5A 2OQGA 2Q2EA 3KEQA 1Z05A 3L00A 2PXCA 5E9JA 3EETA 3HVJA 2X4HA 4HF1A 2EK5A 2CWEA 2QBYB 2N47A 3UJ8A 4X63A 2XAHA 5BMZA 3CGGA 3TOAA 3UJ9A 3CLOA 4BAYA 4YV2A 3K1MA 1FYMA 3K1NA 3JWIA 2BR5A 5CVEA 4Q47A 4HH4A 3WG9A 3QOXA 2IDJA 4PIMA 1S29A 4PCLA 3BKXA 3UJAA 1P4WA 2PJDA 1U6GA 3KP4A 4KA4A 4MIKA 5ICCA 5GP1A 5CVRA 1G3TA 4YUVA 1UHWA 3S2WA 3BWCA 1ZG1A 3HCEA 3NW9A 3MEXA 3CJRA 3TLJA 4CDGA 5BW4A 2EA2A 1YQAA 5K0BA 4S04A 2IA0A 1TW3A 2F5CA 3KLNA 5HEKA 3U9GA 1E17A 2VZ9A 1SKMA 2D1VA 3RPQA 2IGTA 3KP5A 3MHTA 2PBFA 5EVJA 5F2OA 2I7CA 2BZGA 5FHQA 1IXSB 2MH9A 4KDCA 4OBWA 1YYVA 5FGMA 3RIEA 2VS1A 2GXBA 3ZN0A 3CVOA 4L0ZB 1ZLJA 2DULA 3HA7A 4U0YA 4WVLA 1SD6A 1I1NA 4CKCA 2OO3A 1K79A 2FU4A 1IXRC 5HIJA 2K4MA 5HDNA 2ZZNA 3M6WA 1Q0TA 3L7WA 3ERCA 3CO7C 1R8XA 2IBSA 3I5UA 3QAHA 5CVJA 4ENJA 1ZQ9A 1U78A 4P7KA 4E2WA 1QNTA 1QQIA 1T43A 4K6MA 3C1DA 5D1HA 1INLA 4GOLD 3EGIA 5IT9K 3FTDA 2KKOA 1XCJA 2CQKA 2O0YA 4P55A 4ZH4F 2RV8A 4Y15A 5FFXA 5J8FA 4AVPA 2BM8A 3BPXA 3DKWA 4IWNA 2OBFA 3GWZA 3DH0A 4RGUA 2KIFA 3W6KB 4YMGA 2DQRA 4RVDA 4HX7A 5DUIA 2AXLA 4PGGA 3O31A 2AOUA 4CWAA 2KIMA 3QP5A 2Z6QA 1UHMA 2BBYA 2G8NA 4X1OA 1NW8A 2LSOA 4OA5A 2M5WA 2QVOA 1IXKA 2O8XA 2AN4A 4HTFB 2ZKZA 2GAFA 1KPGA 3CJNA 5IT3A 3BZBA 4R79A 3GYHX 2GS9A 4G56A 3TMAA 2NAZA 5L3BA 1VE3A 4IPAA 3NMUF 4KVZA 4DQ0A 1HKSA 4M73A 1D2HA 3KZYA 3CUQC 3JTGA 1LQ1A 4FS8A 5DX1A 1F3LA 2IA1A 2P7HA 4RTLA 2C7RA 4U7DA 2PWPA 2VODA 3ID6C 4U7BA 4CKBA 5L3GA 1U8RA 2P1DA 2EG5A 3PFGA 3Q9VA 4BP3A 1RI5A 3U2RA 1SG9A 1NV9A 4E33A 5E9QA 2FBIA 1WXXA 2RC4A 5DD4A 2P6SA 3IV6A 5EHGA 1JXSA 3B5IA 2PFBA 2DTRA 1CF7B 1ZYRF 4B8XA 2GA2A 5KQSA 2C6YA 1VL5A 4YFNF 4GEKA 1M6YA 3MTEA 4JBAA 2V1DA 3QU3A 5DX0A 5A2QZ 1XB4A 3QPTA 4LG1A 2JH9A 2HNKA 4RTKA 2NS0A 3L2CA 4EK9A 3G8BA 2VXZA 2GIVA 1IRFA 1IN8A 4R8HA 3VEPA 5F64A 1G60A 2FHPA 3LFKA 3THRA 2F2EA 2HQRA 5HDGA 4UVAA 1UB9A 3DMHA 3R0QA 2HWKA 5EEHA 3D5LA 3ECHA 5T67A 3EVDA 5EKXA 2YR2A 3ECOA 5BS6A 2VBXA 3CO6C 2DPDA 1S7OA 2YXEA 2P8TA 4R1HA 3G73A 1F4KA 1D8KA 1I6XA 1FBQA 4LK0F 4POOA 3ISPA 1LEAA 4KWCA 2YPRA 2GWRA 4GOND 1BN5A 4LLLA 5E2AA 1JSXA 4ATNA 1K7AA 1CF7A 3VOEA 4KDRA 3BZ6A 1K78A 3OFKA 3QPHA 5DXJA 5A2QK 2RN7A 3PX2A 4U7PB 2HTJA 4XSXF 5ICFA 5DRTA 2ZJ2A 4TV7A 4LLNA 3HRUA 1BIAA 5HLIA 2ESHA 3RKWA 3NEUA 2HWVA 3AXSA 2Y0MA 2JJQA 2YX1A 3J7AO 2OZ6A 3ELKA 3M1EA 3MB5A 4R6XA 1Y0UA 2OPBA 3SZPA 3HCCA 3GFMA 3QV2A 4EGZA 1YW8A 2ZBQA 3FPJA 5GM2A 1NW3A 4EQQA 5KQRA 5GIPE 2G70A 1LVAA 2NNYA 3E6MA 1S6LA 2ADUA 3RTRA 1Z91A 2FA5A 2FMLA 5L3DA 2AOWA 3RODA 3KR9A 2FOKA 1FP1D 1OMIA 3T0IA 2DW4A 4KDPA 3EDPA 2A61A 4DNCA 3VYWA 2PMHA 4E30A 3A26A 2DO7A 4F7ZA 5FLXZ 2ETHA 2ESRA 1KHHA 5LLQA 3EYIA 3KP6A 4ZYGA 1MJFA 3SQNA 5FQOA 2IA2A 2ZIEA 3KKZA 3DXZA 5FD6A 3MAJA 3LDFA 3MWMA 4EM1A 3O6BB 5H02A 3FMRA 3R6TA 1F5TA 2OY0A 5FUBA 1EV7A 2G71A 1BI3A 3MGGA 2A07F 4BHPA 4QPPA 1BKYA 2P7IA 1XCVA 3G89A 3UJBA 5K03A 3UWPA 3WGGA 2IFTA 3OZSA 3KPUA 1R8YA 4YUYA 4RTQA 4RTNA 2VONA 4DCGA 3OCJA 1SD4A 3HA5A 1IM8A 3HOTA 3O2PE 5FA5A 1IZ1A 5LRRA 4DKJA 1REPC 4PINA 1BIBA 1FYLA 5K0LA 1S3JA 4IVNA 4PYQA 4EJTA 2FF4A 4ER0A 4LG0B 4Q48A 3BGVA 2P5VA 3C3WA 2ZWAA 3LBYA 5CJ9A 1BM9A 5EZSA 3EGVA 3QP6A 5D4RA 1KU9A 5D1NA 5G02A 2XASA 4E2ZA 2O61A 3LAJA 5L3EA 1QBJA 1TNTA 3CJQA 3JWJA 1B9MA 1ULYA 1FP2A 4UUVA 4UV8A 1R23A 3ORHA 3KEOA 1LNWA 2X0LA 2Y1WA 1B1BA 2HEOA 1G8SA 3F22A 3TKYA 4R05A 1GVJA 3HRTA 3FPGA 3KQMA 4EKGA 4KW7A 5EQJB 2UXNA 2QRVB 1QGPA 5EZQA 4UOEA 4O29A 2DI3A 3FZGA 3J81K 2CMHA 2Z33A 2YSRA 1MGTA 2JPBA 1HXDA 1T6SA 1WSUA 2EFJA 5ERGB 4C08A 5GOZA 3ABTA 2KJBA 4N9IA 1YZHA 1DUSA 4AX8A 4L18B 5DUKA 4BQAA 1WXWA 4IV8A 2ZVJA 1MKMA 1SFUA 2KRFA 1V3FA 3BWYA 5ERIA 4WF2A 4QDJA 4A6DA 4AZVA 4EJUA 4A0ZA 4LGWA 4ENKA 4RS8A 4E70A 3F8FA 1JTFA 3I59A 2Z6UA 4GC9A 4BLUA 1JHFA 1XDSA 1FSHA 2CMGA 2PT9A 1VP3A 1LEBA 2F5DA 3GGDA 5DPMA 1ZLKA 3V7RA 1RUOA 5ICGA 5HLGA 5JUWA 5AIQA 3KFWX 3HCBA 3LCCA 5D5WB 4BHBA 1RJFA 4IF4A 1MDMB 1FNNA 3WTXC 3FXUA 2XRNA 4GXOA 4UXNA 3N97A 3LQRA 3GDHA 4BY9E 4BLWA 5DCMA 1FOKA 1WRJA 3CDHA 4OQDA 1NW5A 5DWQA 5L3CA 1FBNA 2QM3A 4BLVA 2P3QA 1TLHB 5GINE 1LDDA 2IH4A 1XSXA 4AUKA 5HOQA 1JTEA 5HS8A 1RI1A 5IT9Z 3M4XA 3OOPA 2AZTA 3K0BA 5LQJA 2VBZA 3TPZA 4ER3A 2F5EA 4PZJA 4N9HA 3GFIA 1O9HA 2BM9A 2FK7A 1H9TA 4GO1A 4EM0B 5BW5A 3EEYA 3SSOA 1RJEA 2NYXA 1UWVA 2CYYA 3BUSA 2V1UA 4AIKA 4F84A 5LQUA 4RB1A 3RIRA 3B89A 5LRSA 2W85A 5EKUA 4DF3A 5LHHA 1R1UA 3JAMZ 3FHZA 4XLPF 1L9KA 5DEQA 3R3HA 2ZZMA 1O54A 3HRMA 3C0KA 1TNSA 3KP7A 3ZN1A 3MAGA 3RPUA 5LEKA 3VSEA 2V1XA 3HYIA 3U81A 3E8SA 2M30A 3FTCA 2FQ3A 3HEMA 4NQWA 1YTYA 1IF1A 3HCDA 1BI0A 3AAFA 3KQSA 1Z3CA 1J75A 4IKPA 1KQ8A 3PFIA 3L09A 1ZGAA 2L54A 2LF8A 2P3LA 4IHTA 1NV8A 5J6XA 1L3IA 3CC8A 5E8RA 4ESBA 5KVAA 1I5ZA 3GO5A 2XYVA 1QPMA 2PX8A 4YUZA 4HC4A 4GBED 3DTNA 1FJXA 2FSWA 5DV5A 4A0XA 1F38A 4CICA 1YFHA 4P96A 5T6BA 2JSCA 2HDCA 4XLNF 2ZFUA 3SX0A 4M37A 1RUNA 2M45A 2E1CA 3ELUA 2P7VB 1SD5A 1R6AA 2XAGA 2AS0A 4XRFA 4GUAA 4GQBA 3FUVA 2QQ9A 2V6CA 2DQLA 4YG2F 3MERA 3DEUA 3IKTA 1TQIA 2UYCA 3BWBA 4RTRA 5F2NA 1DPUA 3DP7A 2PLWA 1I9GA 2W25A 5JI6A 1KPHA 3M6XA 4PYOA 1KU7A 2P41A 2O07A 1XDUA 1IRGA 5JVTA 4NB5A 2QYOA 2MBFA 2P40A 3FPHA 4KRGA 1P1BA 3ZMSA 3KHKA 3K0LA 3FWEA 2ZZKA 5D5VB 2PQ8A 1OR8A 1J7KA 5C9ZA 1HW5A 4FSXA 2E7WA 5DDGA 4BP1A 3PFHA 5F6FA 1L1EA 5K1YA 4JXJA 3I53A 2C7PA 4P7FA 3KZZA 5D6EA 1DL5A 1GHCA 3KQPA 2V7EA 3HA3A 3TO9A 5E1DA 2BR4A 5EMJA 4HW0A 2EA4A 3JTHA 2P8JA 1VQ1A 2ZBKA 2DPUA 2ZWVA 4ZZLA 3JW4A 2O6GE 5F2KA 2FE3A 5CM2Z 4IRGA 5ILUA 1J9IA 5DTQA 3TR6A 2ZNZA 3AWIA 3ZPLA 3P9NA 1R18A 3PQJA 5CVVA 1XMAA 1WG8A 1YF3A 4A6EA 1IY9A 4LWOA 4Y30A 2IVMA 2NYUA 2CSOA 5TRDA 1MZBA 4Y2HA 5FHRA 4GYGA 1ZG5A 5E1MA 3BT7A 3HHGA 1H9GA 2H00A 2I6GA 3TGNA 4M9ZA 2XVAA 3JAMK 3I54A 5KK1A 3WTWC 1YS6A 2ZNYA 4A0YA 3ZMTA 3OE4A 1D8JA 3UA4A 3F72A 5BPDA 1JG3A 1EIZA 1RJDA 3LDGA 2QENA 3L9FA 5K0CA 2AOUB 2ORED 2W24A 1G8AA 3V97A 2P3OA 4RWZA 5FO5A 1XXLA 2YTZA 2PI0A 3E6DA 1H1DA 1QO0D 3WU0A 3LKDA 3JWHA 2FXAA 5E8IA 2DFIA 2O05A 1EJ6A 3IRRA 3IEIA 2IH5A 2XKPA 2WA2A 3BY6A 3D2LA 4LB5A 2YUIA 4P7GA 2CGPA 2H09A 3OPNA 1QANA 1IW7F 2QUFA 2DPMA 1R1VA 4AIHA 1W5SA 2F5FA 4I7HA 5LBQA 4ER7A 4GGGA 2EFNA 3BPVA 1DCTA 2KJCA 2WTEA 1SUSA 3AXTA 4DCMA 5DSTA 2P4WA 5EPEA 1B59A 3GFLA 2CL5A 1D2CA 4C05A 2XVMA 1YG2A 2NRAC 3NRVA 4M74A 5D4SA 1YFJA 2ZCWA 3VODA 1HKQA 3FRIA 2C7QA 5ILVA 4UVCA 3G2OA 4L9TA 1RIOH 4L9NA 2A14A 3C3PA 4R8SA 2G7UA 5EIFA 2PG4A 1YB2A 3SGLA 3BKWA 4XUDA 1WWXA 3LA7A 2K27A 5CVUA 5E1XA 4LB6B 1YW7A 2V74B 3ERED 1HW2A 4LFUA 4RTJA 4HV5A 3NQOA 2EFQA 5C1IA 3THSA 1X1BA 2OA4A 4FX0A 1R58A 2GXGA 3LHDA 5CYVA 4KMFA 3A27A 2ERCA 3P71T 3UA3A 2O3FA 4MTDA 2ELHA 1WS6A 1IN7A 1XTPA 3OZTA 5GM1A 2E5WA 3CUQA 3C6KA 2IRFG 2EFOA 5F1RA 2B9EA 2DLLA 4EJWA 3FMQA 4IXAA 2JHPA 4FT4A 3RW9A 2HGCA 2O57A 4MTEA 4EVIA 4M6XA 4IHSA 4FT2A 3HTXA 4EGYA 4P7JA 1NE2A 1VP9A 4V0QA 3ER9A 4FP9A 2YU3A 4OINF 2NXNA 1ZAOA 3GXOA 1X1CA 3FYDA 2IJLA 2HV9A 2P5LC 3OU6A 3SMQA 2FNAA 1FYKA 2HOEA 4M6YA 4RV9A 1EH7A 3OE5A 2L4MA 2VBWA 2ZTHA 3HM2A 3M33A 2JG3A 4A2UA 5H6QA 2JPCA 3OV8A 4IRIA 1ZN2A 5K01A 3QU6A 3BXOA 3CCFA 5LR6A 2G1PA 3GZ6A 5LEJA 2PJPA 2P35A 3NWEA 3HSEA 3O3KA 5E8GA 4HLYA 3V7CA 3Q87B 3EVAA 4QWQA 1Q1HA 3KLOA 4YV1A 1MJBA 3P9KA 4YUXA 1U5TB 3VC2A 1XGSA 5DM0A 2D1HA 5FQNA 3TQNA 1TQMA 4I0BA 2OKCA 4PYMA 1SFEA 3DOUA 1ONVA 2RKHA 3GO4A 1V39A 3WTTC 4E2YA 1EQAA 3K9TA 1P92A 5E18F 1T0FA 3WSTA 4KYWA 1OYWA 4KNYA 3MQ0A 3EMBA 5T64A 3GRRA 4AZSA 2V79A 2J5OA 5HOOA 4RB2C 3RJPA 3HCAA 4LD5A 1SMYF 5L3FA 2OD5A 2EX4A 4Z2YA 3SSNA 2PKWA 3MCTA 3V8VA 3GRVA 3G5LA 4ENNA 2Q8KA 3P9IA 5HDKA 4H0NA 3V7SA 3EVFA 4HG2A 2L02A 4I02A 3WGHA 2JHCA 4OQEA 3IWZA 3KE2A 4F86A 4HGZA 1KPIA 4KICA 3W6JB 3I9FA 5E2BA 1VBFA 2OZUA 1JGSA 1USTA 3KPVA 3HSRA 3BDDA 1FX7A 1UCRA 4QQNA 3FRHA 3FTFA 2XVCA 3EYYA 2AOVA 3FUWA 5GIOE 1FC3A 4I0AA 2ZSUA 1ZARA 1B4AA 4E2XA 3FXRA 1BOOA 4YUWA 2OYRA 3E97A 2Y1XA 3QOPA 2IH2A 3GX4X 1IN6A 2RDPA 5DXAA 2ZBRA 2WA1A 3LAPA 3G3ZA 2PN6A 1T2KA 5EC8A 1MHTA 3KQOA 1XVAA 5FULA 1Z6TA 5DM4A 3BP8A 4BHCA 2MC3A 3F21A 4HX4A 3EEOA 3H3UA 2ZFWA 4WK8F 4UV9A 4M38A 2QBYA 4O3MA 3IL2A 1BOAA 2Z5UA 1X1AA 3NVMB 3P97A 1P4XA 1KGSA 5HS7A 2Z6AA 2B0LA 5K09A 5HVQC 5HFJA 2ZMEA 2PY6A 4MHGA 1EH6A 2EV6A 3EVZA 5CVDA 4RTOA 3IWFA 1W7PD 1E2XA 2Q41A 8MHTA 4BH9A 4OU0A 1SVUA 2NXCA 3GCZA 3IC7A 3GJYA 4CGZA 3EGEA 4RGRA 4U0WA 2Y48A 4WXCA 3FX3A 4QPNA 5EOVA 3GEZA 4NECA 4R8RA 4A5MA 4OOIA 1TW2A 3QOWA 4GCVA 2ZCJA 3WTSC 4ON0A 4PYLA 1VPTA 3P9CA 4KUMA 4FR0A 5CUQA 3R9XB 4WWCA 3BWMA 1EH8A 1SFXA 1YIOA 2DK5A 3DLIA 1MJAA 4KN4X 2A3SA 2DAOA 2YQZA 5CD1A 2C7OA 1JE8A 5EHIA 1D3YA 4YIFA 1HKTA 1Q0SA 3EVEA 1CGPA 4HZFA 1B9NA 1LDJA 2J5PA 4ISCA 2CWWA 3Q9SA 3ZMUA 4M36A 1BC7C 2ISZA 1WQ2A 2FBHA 3DFGA 1WKMA 5J8CA 3F4KA 2WC2A 5E1ZB 1J59A 3MZHA 4MQ4A 3LCVB 2E7XA 3B3JA 4BYYA 2XV4S 2NNNA 1D2GA 1NKVA 4HYEA 4QVKA 2HTSA 5BXYA 3A25A 1N7IA 3BGDA 2FRXA 2A6EF 3CTAA 2CO5A 4O6JA 1OYIA 4L9JA 3KPJA 1TBXA 2HYGD 4LLGF 1SQFA 1WY7A 1O3SA 2YX7A 4EV0A 3PTAA 1KYZA 2ZO4A 5FADA 1L3CA 4E31A 5HZMA 1GXPA 3M6UA 2IPQX 1YLFA 3C18A 3BJ6A 3X0DA 4LMYA 3Q7EA 3OU2A 3G2PA 1MD0A 5DRYA 3NVKI 3TO6A 1XGMA 4CYDA 3EVGA 4XUCA 3CBGA 5AONA 1R74A 5DT2A 1PP7U 2XGXA 3A7EA 4OMZA 1N2XA 1YS7A 5KS2A 4AIJA 3DXJF 2FPOA 3F6VA 5H20A 2QLZA 2COMA 2QE6A 1Z9CA 3WTUC 4HRAA 4P58A 1Y8CA 2R7FA 2LDUA 4EJOA 1LB2A 1AWCA 1FBSA 4FX4A 4Y13A 4XUEA 2F8LA 3GRUA 3QRFF 2A69F 4KIGA 3C7JA 3ML6A 1G6NA 3AJDA 1MDMA 1OKRA 4U7TB 1IXCA 3KETA 2OZVA 1K6OA 4IJAA 2ONZA 2YXLA 4R6WA 4G9YA 1HBXG 4ESFA 5BP7A 2ZIFA 2ZBPA 3E7PA 3KP2A 1A04A 1MJ9A 3SZTA 3FUTA 2FEZA 1XCLA 3LSTA 1ZKDA 2XYQA 4HF2A 2P5KA 2K4JA 5ILSA 1P39A 2VN2A 5KYGA 2BGCA 2EJUA 2W84A 3P8ZA 1Z6RA 3IHTA 2PWYA 1YUBA 2W57A 3GVAA 6PAXA 1HMYA 4C07A 4YIIA 4HTFA 1OPCA 4LK1F 3G2QA 4L9VA 5TJJA 3GFJA 4GC5A 4DM3A 3DXYA 1R00A 1W5TA 2QZ8A 1NHAA 2ZLBA 4FT8A 3P2EA 4HSGA 2L3DA 4BXUA 3EVCA 5IH3A 3PB3A 4PWYA 4RYLA 2AOXA 4EQZA 2ONYA 2XIGA 3WE2A 2M8EA 4IRHA 1AF7A 1IN5A 5HIMA 2NXEA 1TQPA 3G8AA 3I0TA 5E9WA 3RDIA 3ELDA 2DU9A 2VDUE 2IBTA 4I2OA 3LPMA 1JG4A 3IYLW 4PGHA 4L5JA 4RTSA 4YFKF 3UJDA 3GIWA 2MH2A 3WGIA 3CUQB 1TPYA 2EWNA 3DMFA 5E8JA 5DX8A 2GB4A 4Y17A 3SR4A 4DA4A 4B09A 3DMGA 4PCQA 3DV8A 2RVCA 2GZWA 3LGAA 5M5BA 3UBTA 2STTA 4PIPA 2LKPA 3EQLF 1OR7A 3PVCA 1OYYA 4RAYA 4GOMD 4CTJA 1H0MA 5CVIA 3COAC 1M0EA 1QAMA 4WX9A 2EJRA 3LBFA 1FPQA 4NHJA 1AV6A 5B1SA 5FD5A 5EMKA 3LWFA 2G72A 3E3VA 3HOSA 1UFKA 2Z9OA 1L0OC 3VB2A 2MA3A 3U1DA 1HNNA 5FWAA 3O4FA 3HVKA 3OFJA 1G4DA 3ER8A 4X61A 2D2WA 2UXXA 4V0RA 2YXDA 3MTIA 2CG4A 3D0SA 2QQBA 3FUUA 4RAZA 3V8LA 3T7RA 2BR3A 4CXMA 3B73A 4PYNA 3FPEA 3K2ZA 4RB3C 2H6CA 4CXFA 2OB1A 4LWPA 2XUBA 1DDNA 1ON2A 7MHTA 3H3ZA 5CLSA 4OIQF 2H27A 1XCBA 3FM5A 4RVFA 5BPIA 5U4XA 4ESJA 3H2BA 5CIYA 2IP2A 4G6DA 2G7HA 2FCAA 1HW1A 2HKXA 2RGVA 2ZXJA 5EMMA 1O3RA 5P8WA 3DQVC 1F1ZA 4KIFA 3UZUA 3DULA 3HHHA 1ORHA 2TDXA 1U2ZA 1KA8A 1BHJA 2JHAA 5E17F 3H92A 4PYIA 1JG1A 4B17A 2A5YB 1XGNA 4UNOA 2EV5A 4YMHA 2VC1A 1N7JA 3WTYC 4PCAA 3I58A 4E32A 5E1WA 1VLMA 1ZREA 5LQKA 1L3BA 4HBLA 5DSXA 3R4KA 5EEGA 2GA9A 4AZTA 2B2CA 4CHUA 5DTRA 4ZYDA 1W7PB 3M9AA 1KR5A 1T98A 2YR0A 2PX5A 2GQQA 1VIDA 4G7HF 9MHTA 4QVGA 4MEXF 2BH2A 1XSDA 3HVIA 2KIUA 3GW2A 3T8TA 2GPYA 4MGRA 5EIWA 4JK1X 1YZ3A 5D6FA 2XKOA 2BE5F 3SM3A 3DPTA 3HTSB 4OMYA 3GRYA 3M6VA 2FK8A 2ZMEB 3ANXA 2DK8A 1AOYA 1WI9A 3TFWA 2HKOA 2FRHA 4EJVA 4DMGA 3HSFA 3P7NA 2JT1A 4RTPA 2D45A 10MHA 5DD8A 2E1NA 1IAWA 2UYOA 2JZYA 1ZGJA 1BBYA 5LHIA 2Y75A 1P6RA 1TTYA 1XJ5A 1SD7A 4MQVA 1QYRA 4HQEA 2GAUA 2YX4A 1LJ9A 4OX9Y 2FYTA 1U2WA 4N0BA 3ZQ7A 2IIPA 3KQVA 2XAQA 3PT9A 3KQQA 4C04A 1O3QA 2PXAA 1FZPB 4L5IA 1G3WA 1SMTA 3V4GA 4ZTBA 3CUOA 2O06A 4ETSA 1JQ3A 2CFXA 3KQTA 2K86A 2WK1A 4ENMA 2A6HF 1ZG3A 2AVNA 2ZULA 3MZYA 1WZNA 3I4PA 3HNRA 1KYWA 3KPYA 2VDVE 1T38A 3R0AA 3IHUA 2VOPA 4XCXA 3B3GA 3CKKA 1ZRDA 1NBIA 4L7VA 3UJ6A 3WTZA 5JHUA 1YW9A 1S8NA 1STZA 3LECA 3KR2A 3E6CC 4OBXA 2HTEA 1BI1A 2IT0A 2PX2A 3I64A 2JRTA 3CJTA 3SFZA 3AY0A 1PUEE 1PDNC 1NBHA 2H1RA 5LSAA 2JTVA 1VTNC 3KPWA 3TKAA 1UFMA 4G7OF 3NJRA 2RNJA 2CKDA 1V4RA 4HX8A 1I1SA 1NW6A 1RI4A 3LCUA 1I1GA 1BC5A 1FSEA 1B42A 2LD4A 5D8LB 5DYMA 1X19A 5FCDA 3RI4A 3EPPA 2CW0F 1XD7A 5HS9A 3FUXA 3T8RA 3HP7A 1FBUA 4CO8A 5LGNA 3G2MA 2QQAA 3G7UA 1EJ0A 3WODF 1IUYA 2PSSA 2PMUA 4O5VA 3BJOA 2DBBA 2XBMA 5K8VA 2ADMA 2Z3YA 3REOA 2AN5A 4F85A 4MEYF 4HAMA 3FM3A 5LQCA 1ORIA 2AR0A 3FF5A 5K05A 1R22A 1DP7P 4RTMA 2HZTA 3HRSA 2P7CB 3JWGA 3J81Z 4OIOF 2EFPA 5HLHA 2IPXA 3FMSA 5LQRA 4LG0A 3P2KA 4GF5A 2H6BA 1HSJA 4PNEA 1U5TC 1KQ9A 4HOBA 1ZHFA 2OU2A 4EKIA 3F6OA 5LHGA 5K0FA 2O03A 2H94A 4U88A 4PYJA 2R6ZA 2PBIA 2XYRA 2VOOA 2Z99A 1X3UA 3TM5A 4ER5A 4KIBA 2EV0A 2K4BA 3R60A 3MCZA 3F8MA 3V8KA 3LQQA 2GH1A 3F3XA 3KQYA 3SVZA 1FT9A 3RYPA 3UJCA 3DPLC 4YV0A 5BOXA 3BOQA 1S7AA 3M70A 2MD5A 3B3FA 1X1DA 3IKVA 4HA8A 3LL7A 1Z1DA 3R61A 5CCXA 2UZ4A 2GA1A 3L8DA 2UWMA 2ESNA 2VP3A 3GLXA 1YFLA 3JSPA 4IV0A 1QZYA 5H6RA 2EB7A 3F23A 5DCMB 1R5GA 5LQNA 4ZZDA 4RGXA 1ODDA 2M1BA 4FSDA 2OQRA 3ZP5A 4M7RA 1R7JA 1SUIA 3A4TA 3T0YA 2HR1A 3K6RA 4QTUB 4C03A 2H11A 3GUDA 3UJ7A 3G5TA 2HS5A 3BWGA 3E5QA 4PDKA 2BV6A 1W7PA 3PS9A 1D5VA 3K1PA 1DUXC 3VC1A 5JR3A 3I59B 3F8NA 4L0YB 2VBYA 2OBPA 3R6SA 4S05A 4QQKA 5AIPA 5FA8A 1G3SA 4UVBA 1QAQA 4WXHA 2FBKA 5K5QA 1KP9A 4A5NA 4CKEA 4LJZF 5HIIA 4PYKA 3DUWA 1XGOA 2VT3A 3T1BA 5DTMA 4KMUX 1F9NA 2VC0A 3NDIA 3GZ5A 1R5HA 3KR0A 2ZIGA 3F8BA 2YVLA 4RB0A 3DXXA 2ISYA 4HF0A 1QZZA 2A68F 1BJAA 4P9UA 4GYIA 3NDJA 1PJZA 1J5YA 1G38A 3LKZA 1G3YA 3UFBA 3KU1A 3SXJA 1O57A 3M8EA 5LQAA 2UYQA 2IW5A 3RKXA 3F8CA 3J80Z 1JG2A 2STWA 3G88A 5MHTA 3KR1A 2XROA 3HCFA 1SAXA 1L3LA 2UZKA 5DM1A 5EG5A 1K78B 3BROA 3MFKA 5K0NA 4KN7X 5LGUA 5GWXA 5HILA 2PVCA 4DQ2A 2PGXA 1JHHA 4HV6A 3GNLA 2FMYA 2MLGA 4HQMA 4M72A 3N4MA 3ELWA 2VT2A 3VFZA 3FTEA 3T5XA 1RI2A 4FHTA 2BEOA 3R0JA 3E23A 3K69A 1ON1A 5EMLA 3T7TA 1EAMA 3HVHA 5JFRA 4A12A 1KXZA 3TDUC 3TO7A 4UHTA 4XSZF 4HDUA 3T7SA 3A7DA 5HIKA 4HLXA 1XDZA 2FNPA 4ASNA 1O7LA 1HSTA 4MWZA 4RVHA 2G9WA 1FWZA 3LDUA 5E20A 4KFCA 4X41A 2R7DA 3HIFA 2MLKA 3FZVA 4ZYHA 1UIRA 3KQWA 4P9FA 2AOTB 2GLUA 5KVRA 4C4AA 4MHTA 4WCGA 2NNWB 1T39A 3LA2A 4OIRF 5K0EA 4GOOD 2R3SA 2NP6A 1PP8F 4DZRA 5DM2A 4G7ZF 3B7PA 1XMKA 2QY6A 3ELYA 1JSZA 4P5OA 1NT2A 4M9SA 3IRQA 5DLYA 2M87A 1U3EM 1IN4A 3M7GA 2IDKA 5E1OA 1M6EX 4MQ9F 3FPFA 3V8JA 3GRZA 4AD9A 2ZW9A 3PLAE 1AQIA 2PEXA 2P6TA 4G6QA 2OXTA 4AZWA 1HQCA 1U5TA 1ZH5A 3OZRA 3B02A 4MNUA 2JH8A 3GF2A 5C0OE 4FZVA 1P1CA 3S68A 3EMDA 1JQDA 3LA3A 4CZZA 1JR4A 2B78A 2QWWA 2PT6A 2K02A 4XBFA 1Z7UA 5EGSA 1J2XA 4KT5C 4PONA 5ICEA 3E6BA 1RJGA 2Q0OA 4Q4ZF 1EG2A 2V9VA 4M71A 3RKYA 5FB2A 5DCFA 4G94A 2EFWA 3E5XA 2UYHA 1SQGA 2K7LA 2L4AA 1FY7A 1FLIA 2LF7A 1O9GA 1YO5C 3TQSA 4CTKA 2OB2A 4BNCA 1G55A 1P91A 3TDZC 3LX6A 1R1TA 5D5XB 2PX4A 4QDKA 2NXJA 3R24A 2QRVA 2WWYA 1RNLA 1GXQA 2WV0A 2LNBA 2ACJA 3KP3A 4RVGA 1I4WA 1O7FA 4I09A 3ZMZA 1JQEA 5ED4A 4X60A 3ULQB 5FWDA 1J0RA 2RQPA 3FYCA 2XAFA 1KQ0A 3SHFA 5FLXK 3M8FA 2HYFA 1RI3A 1BC8C 1BI2A 3WTVC 5LGTA 5K0GA 3SSMA 2HR3A 2EJTA 2AVDA 5K5RA 4HDVA 3EVBA 1PRYA 4C06A 1P2FA 2BYVE 3PX3A 3ROUA 3ZMDA 3NTVA 1AQJA 4LECA 4AWXB 4QLCU 4RGSA 4MTLA 1NW7A 3C3YA 3OU7A 3EUHA 4M9XA 5D5UB 3KCCA 3E5UA 5K5OA 3MQ2A 5K0JA 2AOTA 4JQFA 3J80K 4HGYA 2AN3A 2B3TA 1RZ4A 2AS5F 3HTUA 3ME5A 1XN7A 5FTWA 1R36A 4H0EA 1KU2A 3C6MA 2I9KA 4OA8A 5IKMA 2HQNA 3E05A 4ER6A 5D8KB
chains in the Genus database with same CATH superfamily
3HZJA 3NPAA 4YFXF 1E9EA 1NYRA 2Z6VA 4L73A 3T7JA 1HF0A 1I27A 3MKLA 4BACA 4AULA 4BVBA 4ZQHA 1QYCA 4HL6A 4DARA 3FSEA 1USSA 2INGX 2WZDA 2WKQA 4LXHA 4O02B 5KINB 1QO9A 4MJLA 1WNFA 5A6VA 1B15A 1V4NA 1W49A 2BOVA 2VN8A 1YE9A 4CBVA 4EHAA 4ZCIA 4ND5A 4WERA 4X91A 5TPWA 3TUIC 4B0PA 5HRAA 4ZMSA 2CVPA 2A4MA 2FB9A 4TT3A 4QHTA 4KR2A 3RU2A 3TB6A 2AJCA 5K7HA 1SR8A 1Z6GA 1IAQA 5CHEA 4BGVA 4HUTA 5AIBA 2OF7A 3KZNA 1KU3A 3DR5A 4HXFB 5E3NA 4NMLA 2H31A 4TWAA 4YRBA 1I32A 4MYDA 5IT0A 3HM5A 4E7PA 4K6FA 1ATIA 3C8MA 4UFNA 4INZA 1MW7A 3RADC 2IXBA 3AB3A 1H1TA 4P80A 4PG6A 5EP4A 5DTEA 1QO0A 2XGCA 1FLAA 1G5RA 4D0LB 1CQTA 1BS1A 3OJCA 3CXRA 3FXLA 3FCUB 1YRNA 2DUWA 1W1WA 1XHLA 3D5TA 4U0VA 3HRHA 3S17J 5IASA 4FDUA 1U63A 1RWBA 3PXAA 5FBKA 5BQTA 3QJ5A 2IPLA 4HJXA 3TOSA 4EGJA 1YI2I 1I51A 2YV4A 1D4FA 4PZCA 2PXXA 4R01A 2VB6A 1PKEA 2H06A 2I5PO 1KK2A 3DOJA 1MG5A 3N0VA 3NWBA 5F27A 3RFFA 5DN9A 4EOGA 3ZMVA 3FXQA 3O0DA 1GTJ1 1LF0A 1HK7A 1L8QA 2X2FA 3DZIA 4FGZA 5DVZA 2QNIA 1AO0A 1V4BA 3PDWA 3TW7A 1XZLA 1P0QA 4FFNA 3PQKA 3HGGA 1N3YA 3Q7IA 4R1UA 4CMKA 1ZRFA 5CK4A 1XPOA 4LDZA 1QZTA 1DPRA 1UPXA 1Z07A 2EBFX 4Q9AA 5L40A 1BWSA 2JIQA 2ODEA 4E21A 2V0GA 1N2ZA 4E7ZA 4D9NA 3R8FA 3KTDA 3OSZA 1N8SA 4F56A 1NSFA 1W4MA 4IW3B 4XNFA 3HL2A 4LPKA 3AR2A 1P4AA 1BE8A 6LDHA 4UHEA 1HKUA 1V16A 4OAYA 2I6FA 4LBYA 4MKHA 5C34B 1R4AA 3WU1B 3BD8A 2MIIA 2KW5A 2WNIA 2Q2EA 3KEQA 3V5NA 4D0SA 4CG3A 1L8LA 4AX4A 1I4TD 4I4IA 2IAIA 1YS1X 2WHRA 2DE0X 3EETA 4FYIA 3WXMA 3L8EA 1SUEA 1OGYA 1NXOA 4GMKA 4KI0A 2EK5A 3GVCA 4QYSA 2CWEA 1R9TJ 2N47A 3A2NA 3UJ8A 3SVTA 2FF5A 1VCNA 4EYSA 3S2FA 3ZLUA 1RAFA 2COUA 1ZICA 4QPDA 2CFOA 1YKSA 5BMZA 3D7RA 3CGGA 3MGKA 2CBGA 1Y5IA 2IUYA 5FUWA 4BAYA 3W3AD 5AW1A 4U5QA 5AVKA 3ZLJA 3GFPA 3H1GA 4V19K 1V35A 2FP4B 4M4SA 4N12A 4WXEA 2HF2A 5DP1A 4B31A 4QUEA 3RAGA 5KKNB 1WBJB 5JFOA 3A6PC 2IDJA 1N32B 2HCBA 1FSSA 1MDBA 3A32A 3K92A 5KBYA 4LGYA 1BA2A 3ZE1B 2CXNA 2W22A 1ZBDA 2UVPA 1BD4A 3BKXA 3O95A 4U1RA 3UMGA 4L5YA 1T95A 4A8TA 4XZ3A 3ZXSA 2E1PA 1YQ9A 3KP4A 2PJDA 2DA7A 1C3LA 1ZKGA 4HOYA 4UUTA 5ICCA 4LK2A 2XB9A 3LK6A 5GP1A 1MFPA 3DMPA 4P4SB 3PD1A 3WNVA 5CDUA 4YUVA 2QVXX 1UHWA 3S2WA 4O2AB 4WZBA 4UXJA 1RQ7A 5GMOA 5BQPA 1ZG1A 3I5YA 3AEUA 1Z2AA 1V45E 3BWXA 3C2HA 3NW9A 3TDKA 1A9YA 3K0CC 3BCUA 3CJRA 1TWFJ 3L01A 2PZMA 4IJ5A 4LXYA 1Y6FA 1X74A 5EXEA 4DEVA 4UDYX 3RCBA 4BJ5A 1VKOA 1FUUA 2WWWA 4DRXB 1KC3A 4DW6A 2A84A 2QS9A 2IA0A 1TW3A 1EGAA 1YIAA 2J9GA 5HZHA 1CQZA 1U1DA 3AH8A 1YJNI 3PIOF 4AZ0A 1ZGHA 4WASA 3T9FA 2OOKA 2P9FA 3DAPA 1DJPA 1HXHA 2XHZA 4MA4A 2JLUA 4KDCA 4BC0A 2OTCA 2J48A 2GXBA 2KB0A 3C98A 4L8GA 3OQ1A 3EJ6A 5IYZA 4P34A 4RF5A 3FBTA 1ATZA 1JKMA 1I3CA 4H4EA 4EB8A 1MC1A 1P8AA 1JQLB 4LZLA 3VO2A 1SD6A 1I1NA 2V6IA 4CKCA 3ROPA 2FU4A 4OMCA 2XIJA 1YCFA 4IVRA 1RFLA 3VR5A 3WYFA 4YDHB 2E9SA 3DDZX 1CDOA 3LHSA 2Y9ZA 1JJIA 1SCUB 2QRZA 4I19A 4E09A 5A6SA 1V7CA 4H3KB 5ALTA 2HSGA 1ZEJA 3KSUA 5C53B 2HM7A 3QWFA 2ZIXA 2IBSA 3MTJA 3I5UA 3UHOA 4CZCA 1ZVJA 1KP2A 3CU5A 3Q85A 4EDHA 1BX0A 2WSYB 4ENJA 1I0LA 2YJ5A 5DEOA 4FX2A 4ZN6A 3ILYA 4Q9DA 5FOVA 3NIGB 5BSGA 1MJHA 4P7KA 2M6KA 5I7HA 1QNTA 1KO7A 1T43A 3BAFA 3B20A 1Y4SA 3E4DA 3LWZA 5JU6A 5D1HA 4GOLD 4ED9A 3MKZA 1DELA 2NUTB 2JK0A 1EMDA 5EINA 4IGAA 4DTCA 1SN7A 5EXDA 4FT2A 2O0YA 1E1QD 4Y15A 4C29A 1I2MA 3DKWA 3CR3C 1LS1A 4J2TA 3EDYA 3HU3A 2X8AA 3KSMA 1OIXA 4XRSG 3DH0A 3NQ41 5ALDA 1WXEA 3LXRA 3AFGA 4CMEC 4Z4HA 4RPCA 4P4UA 5FWXB 1DZ3A 1ECPA 2YYAA 1IHOA 4RVDA 2R11A 3NBZC 2N75A 3OA2A 4D92A 4PGGA 3AERA 2PYZA 3MCAA 3OQHA 4PANA 3HUEA 3WGZA 3V33A 1XG1A 1JHDA 4KODA 4CWAA 3QP5A 4R83A 2W42A 2DFPA 3E84A 2EFDB 1K7EB 2Z6QA 1P9OA 1UHMA 2BBYA 5EA2A 3B78A 2XC7A 1NLUA 3T5DA 3VRHA 4X1OA 1RRGA 4EW6A 3KV3O 2ZBUA 3ACCA 5TPZA 2OFWA 4F45A 3Q8LA 1E5QA 2C1XA 1A9PA 4UW9A 5FFMA 1D8AA 1F6DA 1IXKA 4WLUA 4Y1RB 3Q3HA 3SBEA 2O8XA 3U0BA 4DA0A 1DGQA 1KEUA 2GAFA 4JLWA 3M3DA 1V9LA 3GA5A 3KDSE 3KV1A 5BQ5A 3SSMA 2ZYSA 4GLJA 3GYHX 2MSDB 1GG5A 1P5ZB 4FNMA 3TMAA 1OC4A 1VE3A 1C3JA 3F78A 4DWJA 5IPAA 4DQ0A 3NMUF 4JI2B 4M73A 3P0FA 3KOOA 1UM9B 1YDFA 2CXXA 2FOLA 3F97A 4IJWA 4N5MA 3JTGA 3U7GA 3NWSA 2ZTLA 4Q7QA 3QLUC 2JIMA 1F3LA 3OIDA 1E1KA 1PIWA 2CE2X 2VK2A 1UFQA 3PLNA 3EFHA 4BFUA 1WUIS 4KLAA 4HVAA 2OV8A 2X0DA 5L3GA 1U8RA 2AR7A 3FB1A 4BP3A 5A4AA 4F3QA 2PMWB 3U2RA 5GPCA 4EH1A 1KO8A 5E9QA 4HDNA 5KYUA 3AO0B 3HCWA 2X7HA 3I01A 1NASA 2GZRA 3IV6A 3T9EA 2XMBA 1JXSA 1Q95A 2FZ4A 2RGCA 3B5IA 4MA0A 4PLFA 4BWGA 4OY3A 5BPHA 4CW7A 3H3XA 3KKLA 4B8XA 2VOJA 4R2KA 4DJTA 2Q0XA 4X7BA 3E3OA 3ESCA 3AW8A 4B6PA 5JVGF 3W2EA 1ODSA 2YN2A 1ONBA 3AP3A 4NQWB 1GR0A 3HYNA 1HEIA 1HORA 4JUFA 5DX0A 4AN4A 4NEQA 1D2RA 2BY0A 1XTUA 1XTZA 3LOPA 1LZLA 4AP5A 4HXYA 4UUAA 3W4KA 4XM0A 2JH9A 2YIVX 3I5XA 2IYSA 1GXSB 4LYDA 4DCTA 4RTKA 2NS0A 3F71A 2ISCA 5IC5A 3G8BA 5A02A 2M32A 2VXZA 3CNOA 2CWDA 4IDBA 3WOVA 2ZUWA 3MIZA 2FHPA 4IDFA 3Q0TA 4P31A 3LFKA 2AFRA 1RAEA 3AIKA 3SIWA 5BN4A 2BW0A 3B3AA 3AG3H 4J0QA 5DYWA 1JXMA 1Z75A 2LCIA 4UVAA 4MR7B 3O83A 4PX9A 4X85A 3HOUJ 3LA6A 5TQ0A 3CRMA 4F72A 2QD2A 2LLKA 5T67A 3WHIA 3EVDA 3JATB 1OWLA 3QK7A 4HAVA 3GLFA 2VQLA 5GP9A 5BS6A 2DPDA 4BB5A 1W5CC 5GAJA 5D6OA 4CM9D 1MDFA 1FPMA 3BIJA 2CLHB 3OHMA 5FWYB 3HO6A 2P8TA 4HYQA 4J16A 5HK9A 5AVOA 3DMDA 2MYUA 2J41A 2IPMA 2ZRCA 1F4KA 1BW9B 3C7AA 3ITKA 1M2VA 4N0QA 4P4LA 4PHGA 4RBNA 5AKGA 1FBQA 1PV1A 3VU1A 3WHBA 5JISA 1Z2NX 3U17A 4ENUA 4REMA 5CNJA 2LDXA 4FPXA 4O2RA 4WN9A 4GOND 1YZQA 4IPTA 4LLLA 3CCMI 2D5IA 5E2AA 3VBEA 5J1YA 2APJA 2OC6A 3ADKA 3DZ8A 1QIHA 1K7AA 5ED0A 2C57A 3U13A 1CF7A 1VQ8I 2WR8A 4A8JB 4HD8A 4MGHA 3FYUC 1HX7A 3DDHA 1H2WA 3HYTA 5IM5A 3DFZA 1ACLA 3OZIA 3N0TA 1BYUA 1WJFA 4NZOA 4UY8I 1TEHA 3OQ6A 2RN7A 1JXAA 1UL1X 3RHTA 1LFUP 4U7PB 1QQBA 3ZU2A 4QOFA 3ZXXA 1BFDA 4XSXF 4F6LA 5BXQC 4YCCA 3S15J 1E3JA 2Z83A 4BNUA 5CDGA 2E6UX 2E82A 2ECQA 2ZJ2A 1X94A 4ZT6A 1X80B 2KE5A 3AJEA 2M7BA 1JH8A 3A14A 1L5VA 4TXHA 1H2RS 2ESHA 3D5EA 3X1YA 4C6RA 3QFTA 2YX1A 1J8FA 1NVWQ 2OZ6A 3TZHA 4V1CI 1DEOA 4MDEA 3T3MB 3ELKA 3M1EA 3VSKA 1C9MA 1YBAA 3ROEA 3GELA 3MUFA 1TT5A 3O2SB 1Z06A 4N03A 5ILOA 2ID3A 2KP6A 4KQ6A 1E0JA 3G1TA 3ICWA 2X42A 3FBGA 3FK7A 5BSVA 3RANA 1E1RD 1P0IA 3GHYA 4RACA 1YW8A 5FT9A 4MCHA 4B46A 2XTAA 1PZFA 5B55A 3L40A 5P21A 1RADA 5D86A 5GIPE 2Z8YM 1LVAA 1B7GO 3LOQA 4OXXA 1S6LA 1H2YA 1QDUA 1QNFA 1U1GA 5THKA 3QWHA 3EFBA 2I8DA 2MWMA 1Z91A 2FMLA 4XOTA 1DP3A 4I1YA 3GLSA 4JP1A 1BS2A 3KR9A 4RJIA 5FXMA 5JNWA 1I6MA 4NCBA 1FP1D 1OMIA 4TZ6A 3T0IA 4X8MA 1YFKA 5EPUA 3EDPA 5EKTA 2A61A 4DNCA 3EBOA 3AGQA 3P2YA 5JECA 1GYQA 4E4TA 4TVOA 2VQDA 2PMHA 3V80A 1KHTA 1FZTA 4FCYA 4Z8XA 4F7ZA 4GLFA 1N7GA 3VZCA 3QVTA 1SZJG 3V2IA 4UARA 2XH8A 2OC9A 4MGYR 2IZ7A 4MWBA 1FIPA 3A6HA 5LLQA 2HAEA 5BORA 3NKFA 5IP7J 4MEBA 4K6CA 3EOAI 2OT3B 5FQOA 1CIPA 3ZK9A 1ILEA 2HIHA 3G0OA 3KKZA 3PFNA 3VU0A 1GUZA 1BR2A 2QGUA 1CUUA 3MWJA 4NS4A 3UN1A 1Q7GA 1RXCA 1TUEA 1N33B 3FMRA 1N6NA 3CPHA 1EQ2A 2G71A 1ORWA 2SKCA 3PWKA 4LBWA 3RRZA 2ZYVX 4P8RA 1BI3A 3MGGA 4UEJA 2A07F 5BSFA 2AZDA 2P7IA 1XCVA 3LUJA 4XM2A 3CT4A 5K03A 1YJQA 3I5AA 5LC1A 1WSBA 2VJAA 5C3MA 1YRHA 2Q0QA 2WQ7A 3MA0A 5NLLA 3PC6A 4UM8B 4IIJB 3JALB 4MWOA 2CZCA 5AYVA 3UK0A 1L4MA 3ZVKA 2QQEA 3KPUA 4LGMA 5KEIA 1B0ZA 4LISA 1HETA 1YDHA 2ECKA 3KFLA 3O8DA 2ZXEA 4URWR 3SOPA 4RK1A 1X7WA 4RTQA 1EGMB 4MZDA 3ZDEA 2VLAA 3PQCA 1X2EA 2Y1CA 1IM8A 3SYLA 5JD3A 4NZMA 3GVXA 3HOTA 1T4BA 1E89A 1XAIA 2R97A 1WKBA 1IZ1A 2RHBA 4YQYA 5JMOA 4WY5A 3DMNA 1UBUS 4NJMA 4PINA 5BR4A 2GCPA 4EG5A 2OVBA 4QXQA 2H4XA 3P2OA 4MUYA 2YZKA 1X1RA 4WOJA 1ZNXA 3FNEA 2YOGA 5K2MA 1BGVA 4Q48A 3BGVA 1FU7A 4MV8A 1NLZA 2ZWAA 1G21E 4RZ3A 3D1VA 2R5YB 1JNYA 2HBRA 1ZHOA 3L9WA 5CA1B 1OLXB 2X1EA 1QWOA 4OGGA 1BM9A 2FG5A 1RQLA 3IVCA 3CISA 5FL7D 3QP6A 2HSJA 2V6JA 3E1GA 2MCFA 4ZICA 4D46A 3ZJVA 1U81A 4F6CA 1T9HA 2QJOA 3T1NA 4CQLA 1X7HA 1PG0A 2WHEA 4BLSA 5L3EA 1ZJ6A 5SY4A 3W6UA 5J4KA 4R9UC 3T3GA 3CJQA 3JWJA 5BWNA 1B9MA 1ULYA 3UV6A 2P81A 1FP2A 3AU9A 4J0EA 5BUCA 2IEKA 3L1PA 3VR5D 3HB1A 4I99A 1V2HE 1PG2A 3KEOA 2HEOA 1H5NA 3SOZA 4IX7A 1V8OA 3F47A 3F22A 1RAGA 3HE3A 3ZWMA 1W7AA 1Q6ZA 2VTEA 3KDPA 4NJMB 1JIUA 1L5OA 4CIXA 1GVJA 3KQMA 4M54A 5KSOA 5MN5A 3S55A 2EBIA 2L5QA 3DW3X 2UXNA 3VSCA 4YMVA 2NN3C 3C6XA 4C7JA 2OJED 1FNSA 4BS9A 3IKMB 3ZE6A 2F1HA 4DLPA 2CMHA 2FPRA 1DP4A 2IYZA 1K4TA 3BRWA 3CCLI 3AY3A 4QBIA 4BUJA 2Z33A 4RZHA 5JDIA 2YSRA 1NVFA 2GX6A 1CY4A 3W2IA 2JPBA 5ALZA 1YZVA 3BL5A 2ZSJA 2CDNA 3LXUX 4JVOA 5L7YA 3SHTA 3O75A 1R4ZA 1EFPA 1LJUA 1EVEA 1N9GA 1IQRA 1V5WA 4RK5A 3VZPA 4DPLA 4IOCF 3ABTA 1QFMA 4Y0AA 1PLKA 2EIXA 4DCUA 3RSNA 1O0BA 4ZCSA 1EFAA 1L6IA 4GXTA 1D0YA 5T8KA 1C1XA 1XRRA 1ML3A 1VZ2A 3L0IB 1D3AA 3IEPA 3VU8A 2P2SA 2F4MB 3NH9A 1DAGA 4MQ5A 1IBKB 1S2OA 2OWEA 3EA5A 1YR6A 3FFBA 3I6BA 4UXIA 4KREA 2B8EA 2WEKA 4R2HA 2XKBA 1AVTA 2QN1A 3QJYA 3WLEA 4MW5A 1A77A 2WWTA 1F4LA 3UVEA 5H59A 5E79C 1XRQA 3EUHC 4KP7A 4LAFA 1KMCA 4IV8A 2XQKA 2POCA 5IOYA 3BG6A 3LK7A 3RGGA 3D2BA 3UMSA 4N4NB 2RKWA 3COSA 3LLUA 1SFUA 3ITNA 4JLOA 2AKEA 2D13A 1V3FA 5G1NA 3CCUI 5HKOA 1D0IA 3FHLA 4NBVA 3CF4G 3GG9A 5D2CA 3KAKA 3GFFA 4I6EA 4EEXA 4EL5A 2P2CA 1RS0A 2IRWA 3AEYA 1GKKA 3G23A 4AZVA 1ETQA 1CR0A 1EEXB 1FP4B 4CM4A 4ENKA 4V02A 4ITUA 3PUHA 4IXDA 3IT2A 5LA6B 3STXA 1CNFA 4D79A 2QHXA 2GARA 4G2NA 4X8LA 3DJFA 3UOAB 1Z5NA 2NYAA 2WJ6A 3GT4A 4KVFA 3HMKA 3I2KA 2CXQA 4G0QA 5EWJA 1ZLKA 4RFSB 1DOHA 2ZUSA 4O4HF 3ZD9A 2H1KA 3FETA 3F9IA 3BB4A 3AF3A 2JVHA 1R6BX 2QT9A 2VKTA 1P62B 3OEED 1NAIA 3WNZA 2GTHA 4MCJA 3K9FC 3RIMA 1HZZC 2C8VA 3HI6A 3PD0A 5FWYA 5CRIA 1GSOA 3R7WA 2I03A 1RJFA 3JQ9A 4IOMA 1SIBE 2GOMA 2OXIA 3THXB 4CG1A 4IF4A 2FAXA 3EA4A 1L5SA 1YHQI 4BNXA 3FXUA 3L77A 1JVBA 3GDHA 5EPOA 1THMA 3CNEA 2GK7A 5LZ5A 2IIQA 3N8HA 4K1XA 2ORYA 2V5UA 1WRJA 4NYMR 3I56I 1TMGE 1LBQA 1NW5A 1VE7A 4X7PA 1EZ4A 2YW2A 3R1IA 3RVRA 4ZVSA 3C3MA 3SHWA 2L2QA 3B1VA 3QX3A 2P3QA 3FD8A 1GXSA 1I24A 2WY2D 5LU8A 2RI0A 4JLJA 2GM5A 3VH3A 5KYYA 1YITI 1XSXA 2V45A 4O2BF 3GJ3A 3FPBA 2IH4A 3WB2A 4KK4A 1PUFB 4ZYZA 5HOQA 4TKVB 3EEIA 3I1YA 2NUAA 3P0HA 3Q9LA 4I81A 3JW8A 1IQPA 4WLFA 3X2FA 1LLQA 2GEFA 3TPZA 3K9CA 3PD7A 4UASA 2XDVA 4Y52J 4IOKA 2NZ8A 4PZJA 4FDTA 1CNEA 5EXTA 2MR6A 3JQGA 2WLSA 2C4VA 1FJLA 4TGLA 1B0PA 1H9TA 2NUPA 3RS0A 4LMAA 2I3AA 3EEYA 1BA5A 3X2SA 1Q92A 4E11A 3B6MA 1ESMA 1C30B 4B6RA 5J40A 4CR7A 5EF6A 3S2IA 5K20A 2NYXA 3T1HB 3W9UA 1IXYA 3L8FA 2BXZA 1NQUA 4AD8A 1PR2A 1UWVA 4WT7A 4F3CA 3QKTA 4FCVA 3BN3A 4BGEA 1I2AA 1QZUA 3L7BA 1GKUB 3ILXA 3Q12A 5LQUA 1TM1E 3DQPA 4L74A 1W44A 3A31A 4QQFA 1UM8A 1R0XA 5LRSA 2F3TA 2HOSA 1T2DA 1XC5A 4JI1B 3GRFA 3FHOA 3KUKA 1R1UA 1EINA 3LV8A 2QKYA 3WHPA 4ZVUA 4C78A 5AVUA 4XLPF 3RVKA 5HKBA 5ALEA 4C4PA 4MPDA 4ZOLA 1L9KA 2W4IA 4NCHA 1UDAA 3NU1A 1HM5A 3QXCA 1FS6A 4M8IA 3KP7A 3ZN1A 3MAGA 3HSSA 5H68A 1G4UR 1OTXA 3OPYA 2HL6A 2QN3A 4P36A 3FWPA 3TXXA 2G09A 3U81A 2RHJA 1ORVA 3WXBA 3E8SA 2QTZA 1V47A 2ZTMA 2M30A 3FTCA 4GI7A 2P5TB 1LDNA 4IQ0A 4YALA 5JALA 3BFXA 3EFOA 4NQWA 1YTYA 2B9SA 2V3WA 3X3HA 4BB9A 1KE2A 4DFDA 2DBVO 1GNTA 2O48X 5DW0A 4HZIA 4CCSA 2F62A 1SA0B 4EPXA 2AE2A 3EGDA 1J75A 3PKJA 2Q7DA 1AA7A 2O3SA 2VJDA 3E8XA 1KQ8A 4IKPA 4PEVA 1L7EA 4B33A 4BNNA 3S1NJ 4CI0B 3D3EA 2EH3A 4AWAA 3NBYC 1N1DA 1S1CA 1OXBB 1NV8A 2R4TA 3E3MA 1KQPA 5J6XA 1MG0A 2ZSIA 4K87A 3H7AA 4J1TA 1CY2A 2H8KA 5DNVA 2IYRA 1WJDA 3WMXA 3T5GA 4AUEA 4XR4A 1QF7A 3IB3A 2WJWA 4YUZA 5K6AC 3U60B 5DFAA 3LKVA 3VNQA 3DTNA 3DV0B 3AUKA 4PE5B 1YULA 3OWTA 3BICA 3ZIAA 3F98A 2WILA 4Y0NA 4Q7EA 2Q7OE 4A0XA 5ALNA 3KKQA 1K4MA 4XWWA 3L0CA 4NPAA 2Q1XA 1XEXA 1F38A 4GOXA 4CICA 4U8GA 1JBKA 3ABRB 5ESDA 2G0EA 3LSJA 1PR4A 1P33A 3AHIA 4KIJA 1NVUQ 3DAYA 1OI2A 1QMPA 3H6KA 2X3UA 3IERA 3QG5A 3DAHA 4UCWA 5DE3A 3A10A 5LFAA 1HCRA 1E3LA 1QGZA 4PPQA 3BTUA 1EP1B 2HH9A 3A9RA 5AKKA 4II3A 1UZMA 2D0DA 2VHWA 3ELUA 4H1VA 2C8KA 4UAJA 2IXFA 1ZK1A 2CMFA 4WZAA 4JI3B 3MLBA 4AK9A 3HJEA 3CSUA 2ENUA 4FR5A 2WI8A 5EIOA 4ZT4A 3NHRA 3V48A 5IANA 1WFXA 2O8CA 3S93A 5CNKA 1MSFC 5ESXA 4CT5A 4H35A 4QUDA 3UK7A 1ZSVA 4B3FX 4NU8X 2V6CA 2FQXA 1N4DA 2RH5A 2DQLA 4YG2F 1YRLA 4KMMA 5E4FA 5LDDC 4ODIA 3H8WA 1R6VA 4I1PA 2RHTA 3GJZA 3MWGA 1UXOA 3B7GA 1QBGA 1PR3A 4FYJA 4IEEA 4MCAA 5A04A 4B84A 1DPUA 2BZSA 1TJ5A 2PLWA 1QHHD 5JI6A 5IOZA 2F7SA 3N7UA 4YJ3F 5FNVF 1CNMA 2WWRA 2P41A 2QROA 4A0FA 3A8TA 1Q11A 4DIKA 1XDUA 1FUKA 1Z12A 2WIFA 3FCAA 4OHPA 5T3UA 5C7YA 2ETVA 2N9UA 3CD6I 1J06A 3ECSA 3MGAA 4HH0A 2QYOA 1RDFA 1U3CA 3AF6A 3M6MD 1Z0UA 3PUWA 2J08A 3TKLA 5A4FS 1NIJA 3KHKA 1G7CA 4DBVO 2C59A 4CIWA 1POXA 5JY6A 4OHYA 1UELB 2PSEA 2FFRA 2FI1A 2H2DA 3IAS6 3OTIA 3F5MA 1LDGA 5DBEX 4A92A 3AEUB 1CFZA 4QL3A 3OWHA 2WUDA 5ULLA 2X48A 1U8ZA 4HH1A 2W6IA 4BP1A 2XWPA 3PFHA 4BVHA 3GEGA 5J4HA 1SGWA 2VXBA 1EP2B 1LVUA 3A1EA 3N2GA 2JZNA 4I1UA 3KTAB 5LZ7A 3GLFE 5LOVF 4DBLE 3SNHA 2M2IA 2ZJRF 3EUWA 1Z4LA 5E1DA 5EMJA 2UVPB 3AKDA 1OI7A 4W5JA 4DUGA 3PC4A 2UYCA 3E9NA 1A9XA 2HPZA 2P8JA 3F7NA 5KVVA 3NYQA 1ECJA 2ZB9A 2JAQA 2ICAA 1PVDA 1VPVA 5BT9A 1MPTA 4H7KA 2O6GE 3S3TA 3EIXA 4BP9A 1KWGA 5CM2Z 3L7MA 1VYHA 1YOBA 2G88A 2O8VA 1L5RA 3BE8A 3OI7A 2HU7A 3RI3A 3IP9A 1AQLA 3S28A 4QGAA 2ZBVA 2B21A 2HK9A 4JX8A 3E2PA 1RLJA 4PLYA 2V7WA 4LYJA 3AWIA 1E94E 4X94A 3LL4A 3M81A 3VJLA 4EMTA 5EJEA 1NBMD 4L50A 4A0QA 1T5DX 1T8UA 1VMIA 3IESA 1OH5A 1JDBB 1GPBA 1XMAA 3OR2C 1WG8A 3JU3A 4PG7A 4RABA 5JANA 3ANYB 1IY9A 1F2DA 3HDGA 3M9LA 3OJFA 4LZJA 4AY3A 5IMSA 2Z2XA 4HT3B 2NLOA 4BKXA 3T15A 1R9NA 4HZGA 2ZRQA 3EYWA 4KAJA 5BWOA 1VQ5I 2I4OA 3NIDB 3WLAA 1KMHB 4KRFA 5M5WJ 1HPLA 3MTQA 3TG2A 3QYJA 3W77A 3TBHA 3K9QO 5KWVA 2J0VA 3LUBA 2H4FA 1QCYA 3AKCA 4Y2HA 5FHRA 3A1YA 3M1IA 5AHXA 3Q0WA 2VJBA 3OD5A 4QU8A 1DAFA 2W82A 1MAWA 4ND6A 1HSZA 2PD3A 2WFLB 4GNRA 1NUTA 5ADWA 1QKJA 5JVDA 4MVJD 3TR5A 4M9ZA 2D5BA 4Q9HA 3IO5A 4Q1FA 4UHJA 1KAOA 1YS6A 3ZMTA 4HPQA 3IE2A 3OE4A 3LT1A 5JW6A 3F72A 5CT5A 1W73A 3M4ZA 1CWUA 5DGHA 4Y1FA 1OXSC 3IHWA 1RQGA 2HA6A 1IGNA 2NO4A 4M9RA 3FNBA 1M0WA 3TIVA 1ZKMA 2PR7A 4Z9AA 3BSSA 4LHXA 4BDTA 2B92A 3R0VA 2UZAA 3IUEA 1RR6A 2FP3A 1QIMA 2YTZA 1U0JA 3E6DA 5IH7A 3NX4A 1X77A 2BDTA 2FXAA 3SZGA 2QRKA 4KFTA 4BN5A 1DXYA 2O05A 3OH8A 1LEHA 1EJ6A 1KOLA 4AP6A 3HC7A 4G12A 3S4YA 3NAGA 1CTQA 2ZWPA 2XKPA 4XKCA 2Z5LA 3H83A 2W6OA 1XLUA 2NOGA 3BY6A 4LV8B 5ER6A 3K4HA 4MROA 5IYZF 2H2IA 1F1JA 4ML3A 1J2TA 5K99A 2XV1A 3REGA 3B36A 5ARBA 2CGPA 1P2GA 2G77B 1RC1A 1OFCX 2EDAA 1KYXA 3OZFA 5D3MA 2Q2EB 3OPNA 5DIZA 3I72A 3WLNA 2CHEA 4H08A 2X9GA 4Q0MA 2QUFA 4PAQA 1RZUA 1R1VA 3OS2A 1LE8B 1U2GC 3WBKA 3WV5A 1CQXA 5ALWA 4WNAA 2FPLA 4JUCA 1FJGB 2IA5A 2R7RA 1RQRA 4RHXA 1FFWA 3MS4A 4HPJB 4MX8A 3UW1A 3ZZ0A 3K6SB 1DCTA 3RC7A 2WTEA 3K4JA 1W19A 1T5HX 1SKQA 2YHBA 1DC4A 4WL0A 3LY8A 5I9BA 1Z2DA 2OXRA 2HI3A 1XZIA 2FKNA 5EPEA 4J7CA 1EA3A 3UM9A 1SVLA 1U8XX 1WKCA 3G9ZA 1XK6A 3OOEA 1DC7A 1Q50A 1VFCA 3LJKA 1KVQA 2ZR7A 2OCAA 1DTSA 2ZWMA 4LY6A 4MVXA 4YX9A 3F0CA 5D4SA 1RBMA 2FMFA 4MQUA 2HOTA 2BEWA 2DPHA 4H6XA 1B26A 3FHJA 4NBTA 5J5CA 4Q7KA 4IFBA 2P9GA 4DLTA 2QRGA 2A78A 2CDBA 1J25A 3MJSA 4UVCA 3ENZA 1FE8A 2LOOA 4M9UA 4QTXA 3V7UA 1UBTS 3VZRA 1RWVA 2I2DA 4N39A 4C22A 4F38A 3M34A 3UGQA 1ZUNA 1UMCB 4OQ4A 4R8SA 1KDOA 1GA4A 1JSRA 1Q21A 1NY6A 2ZR8A 1WY5A 3Q88A 3QW2A 5EIFA 1YB2A 5FF9A 3MMNA 1E6KA 3R7FA 3BKWA 3JTMA 5COAA 1VOTA 1WWXA 1X1QA 2OPTA 2OFOA 3LA7A 3J7TA 5CVUA 3W34A 2OCKA 2ZG6A 4W7HA 5DEIA 1N9KA 3D9QX 4EA6A 2CK3D 3BTLA 4LB6B 4XOIA 2V74B 2XRYA 3H4MA 3ACDA 1FSFA 5AKJA 3RGWS 1RIFA 4MGIR 1BCSB 1YUNA 5ALHA 1U2DA 1R5JA 3NQOA 2Z9CA 1GLGA 3THSA 1EX1A 3R44A 4HGRA 2JHGA 1N3IA 2JLVA 3TD6A 5JRZA 2A1IA 1X6VA 2V7PA 3PDJA 1XKQA 4IUYA 4ZO7A 2W2MA 2C2KA 4MS3B 2DLNA 4CEIB 1Y6ZA 3AJ9A 4Q4LA 3UA3A 3E70C 2B6NA 1TFRA 3LKBA 1XZNA 1TWGJ 4S2EA 3S14J 1JQ5A 3GFBA 3VJKA 1P73A 4RE6A 2Q2NA 1QYDA 4QPCA 3LBHA 1IN7A 1XTPA 1N6RA 3M5PA 3BTOA 1ETKA 1KAMA 2E5WA 1XR3A 3C6KA 2IRFG 1MC5A 2J3LA 4FQGA 5F1RA 2B9EA 4EJWA 2C3YA 2JASA 2WTAA 3GCXA 2FLWA 4FT4A 3GAAA 2JGAA 3EC7A 4TSFA 4M88A 5GTDA 4IGFA 4IHSA 5AR1A 2OQ2A 3FYHA 3D8TA 4HEA1 3PXGA 1Z0FA 3BJEA 3GJSA 4DYVA 3L6EA 4FYVA 4ZDJA 3NT2A 3ND6A 4INOA 1NE2A 5K3DA 1ECGA 2G8LA 4V0QA 1JF8A 4LC9A 5TY0A 3RVOA 5DCWA 5M3MJ 1YJ8A 3L1KA 2XQJA 5EKSA 1I0ZA 3WA6A 4DYDA 4OINF 3SFIA 1T35A 1T3TA 3GXOA 2K5UA 2L17A 2NXNA 2M1ZA 3HU2A 4XTCS 2IJLA 1TIBA 2GASA 2HV9A 1R6RA 2ZR9A 3BRWD 4O4IA 3ZEAA 3Q8MA 1G18A 4M6YA 4I9HA 5LXTB 1QIIA 2R62A 4R54A 2L4MA 1Y1QA 1E63A 1XZEA 3ZY2A 4C0KA 1CUXA 1NHWA 2AFIA 3DPIA 1YIJI 4BNVA 3PWTA 2DKFA 3JQAB 4A2UA 5KAIC 5AUOB 1I1OA 4F4CA 5AK6A 2JCXA 4B8YA 1ZN2A 3PFYA 2QD3A 5K01A 3JZAA 2UZIR 3P45A 3HMQA 1E61A 2QZSA 1XKTA 5IAKA 3JX9A 4EI2A 9ABPA 5IZ4A 3WLRA 1FOXA 2IW1A 5K3EA 4OMFG 3FBNB 2G1PA 1LBSA 4HF7A 1E3WB 4OL9A 3NWEA 1VJCA 4BEJA 3HSEA 4Z5XA 3VH2A 5CKTA 3PE6A 5H8WA 1I3QJ 2AFHB 3GBGA 3K4PA 4JJ4A 3O4JA 4L57A 4ESOA 4DNXA 4XWYA 1R16A 4QWQA 4KO2S 3IS3A 5FBQB 2QLBA 1YOVA 4JP8A 1F8YA 4NG5A 2XRZA 1U5TB 1A5TA 1YONA 3L7JA 1GPMA 3ZHBA 3TQNA 3KP1A 1TQMA 4KXYA 3IBSA 4OCZA 2YIMA 4B6JA 4DSTA 3C7TA 1SFEA 4WFJA 2CVOA 4F8YA 2CLKB 3GO4A 3IFSA 1V39A 3OCUA 3ONEA 3ND7A 4XKWA 4CT0A 4E2YA 3K2IA 3K9TA 4D81A 2DOFA 2ZI9A 4PFKA 1P92A 4WLEA 3WSTA 4KYWA 1P3DA 4KNYA 1RRMA 2CB0A 4IZIA 3RSHA 3AOEA 3VKUA 4BU1A 3GRRA 3K16A 2ODPA 1RLOA 3OUUA 1D1PA 3EGDB 5HOOA 3OE7A 4RVOA 2F3PA 2GYUA 1KDTA 2W6QA 4Y0VA 2H51A 1F2UA 4DBRA 1LUAA 3ZD8A 3F3KA 1TWCJ 2OD5A 1KBQA 4RM3A 1P1RA 3RTCA 2EX4A 2OEPA 5C4JJ 5EGNA 4Z2YA 2Q49A 5FX2A 4Z4GA 3UK6A 1MX9A 1SFKA 5JNTA 3GRVA 1N1MA 5K2OA 1IUOA 1ZIDA 5HDKA 1PWHA 3CRVA 3FJYA 4H0NA 4Y2RA 3U4HA 4BJHB 4ZPXA 4EGCB 2L02A 5MDHA 5GAHJ 4I02A 2AXQA 2IBMA 4IBOA 1LDEA 1EDEA 5GONB 3KE2A 2DBYA 2AMVA 1Z5OA 3KHTA 4KICA 4XOUA 3PRKE 2RHOA 1D07A 2R00A 5E2BA 3ZWCA 1QVTA 2XA2A 5JCOC 3DLBA 1VBFA 4PLZA 1GPJA 2JGFA 2QXYA 5KHDA 3AHDA 1DAPA 2YY6A 5JDCC 2BKAA 5A9TA 5I47A 5IKXA 2QUZA 5KMGA 1A4XA 1S02A 3GTOJ 2GETA 5BUZA 5KOJB 3FRHA 3AG5A 4FJ0A 2DWOA 5EGOB 2RH8A 1RKXA 2Y4OA 2AOVA 3NWTA 1G66A 1GG9A 2R7QA 2IEYA 3FUWA 4NV3A 4I0AA 1WM1A 1ZARA 4EX6A 1J56A 4HAIA 4RIEA 4ZU3A 1FTNA 3F4BA 5CT8A 1P72A 1Z25A 2J6IA 4DXHA 2RHCA 1X3ZB 3ABLH 1YAHA 4ZZ2A 1WXGA 3JAKB 2XBLA 3QXGA 4EO4A 4WBXC 4KHPB 3MLAA 3SKVA 2BUCA 3DJYA 1T2KA 1FIAA 4DGWB 4YCNA 1VCOA 2H54A 5CXXA 3KQOA 3TS1A 1POWA 1UBCA 5UKDA 1HRKA 1XVAA 4HCJA 3AFMA 2R96A 4HBGA 5FULA 4C0WA 1GTMA 1J1IA 1Z6TA 2C9CA 4ADSG 1JJ6C 3INTA 3KX2A 4DL9A 2VJIA 2JIPA 3K4QA 5AW4A 3JVDA 3QEMB 3BP8A 1CETA 2OCXA 3C39A 2PX9A 2XD9A 4LXQA 1GNSA 2R92J 2WD7B 1SVMA 2Y1KA 1QX4A 2XQFA 4ZPJA 3PIPF 4HX4A 4ZV9A 2X7JA 3ENVA 1J0CA 3GTPJ 1U1CA 4NOLA 1U8UA 4Y8VA 1AC5A 3TBKA 1UC9A 3IMGA 4HFNA 4TL8A 5HUHA 3NXSA 2UUOA 2EIMH 4D96A 3IL2A 5LVAA 1BOAA 1X1AA 4JGIA 1XI2A 3GQVA 4Q3KA 2WIBA 2WU4A 5DYTA 4Z6YA 5HHTA 1QB8A 1Z63A 1CSEE 4GFDA 4GI5A 3TF5A 2Z6AA 1EQUA 1DFIA 4U0KA 1MIOB 2BMAA 1GUYA 4YJ2F 4QU0A 2N8GA 4D8YA 3KKKA 3T54A 2DFKB 3LQFA 4N76A 1L5QA 4HNGA 4WKOA 2R8RA 4I50F 2R48A 4ZU1X 2PE5A 1M6NA 1VC2A 2D06A 2E21A 1Z6PA 2Q28A 4HWSA 4BYMA 3S6JA 4MMYB 1JU9A 1YJWI 5JJLA 5CVDA 3K2EA 2V7BA 4U5XA 1W7PD 1ZVKA 2X1MA 1P2TA 2HX1A 2EIKH 3IAAA 2G83A 1PK7A 2GVDC 4FJ1A 1Y5MA 5I7WA 1Z4OA 4D26A 4OU0A 1N2EA 2BTEA 1ISSA 1HDRA 5JJKA 3WB0A 4XIYA 5KYWA 3IC7A 4RCYA 4NLLA 1RXEA 1TCVA 3CW2A 3MZ0A 4DDUA 3B8HA 2Y48A 1K6EA 1N0HA 2BFBA 3A1FA 3Q2OA 5AMXA 2WINI 3R74A 1XVVA 4QPNA 3GEZA 4NECA 1VI2A 3H5VA 3GJ5A 421PA 4LF6B 1BW6A 3KLBA 1ZK3A 3K53A 2QE7D 4PSVA 4FS3A 3FZEA 4JCOA 2QP3A 2HKIA 5IZCC 2JB9A 1JA9A 3IBYA 4JLMA 3CCYA 1LBHA 4PRLA 3JRNA 4KUMA 1MEOA 3JRAA 3V4LA 2XE7A 2CMKA 5KPDA 2LNDA 3R9XB 2QSUA 1GGHA 2CEKA 5D84A 1ODIA 2BZTA 2PRYA 4OJQA 5AM2A 4CRWB 4TSRA 5CQEA 2VC2B 4KN4X 3PGVA 3J7YJ 2A3SA 3EJWA 5TGTA 4MJ7A 1JE8A 8LDHA 1MIJA 3CHYA 1JT6A 3EVEA 1CGPA 4PJ0C 1T15A 5E4TA 3RRJA 1B9NA 5BPFA 4N41A 2J5PA 2CWWA 4OFWA 3IT1A 1H2EA 4M36A 2C4UA 3HBMA 3VX3A 3BCBA 1QUFA 2XSDC 2FBHA 3DFGA 2HNHA 4O8CA 3K70C 3I76A 5B2FA 4A3JJ 2MSWA 1TB4A 2WC2A 4ZI7A 5CBPB 1K5DA 2EL9A 1V0JA 2QJWA 1G8XA 1XA3A 3L46A 3NR2A 4NK5A 4J1SA 1OXXK 4YT8A 1CJUC 3HB7A 1X38A 3IEMA 3EUEA 2C3UA 2W4QA 4DJ5X 3FGOA 4FDLA 2YVKA 1MAAA 3D64A 4ISBA 3QVJA 2WUWE 3TSZA 4M53A 3JD0A 3ETJA 4LSGA 6NULA 1B2LA 1GEGA 1MW9X 1UBNA 4BYYA 2R6AA 3ASZA 1OSNA 3OT5A 1PU2A 4UHCA 2NNNA 2GHRA 2G4VA 1D5YA 2HCJB 5F1PA 4C20A 2FFBA 5GQSA 3RS7A 3AV0B 3TD9A 4BZZA 3EXFA 4WK2B 1ZOIA 4V3CA 5BXYA 3BGDA 5JQGF 5C7OO 2C84A 2A6EF 3IP4B 2FRXA 3AZOA 3KFVA 1IHYA 1AUVA 1TO2E 2NV0A 1B3BA 2C5EA 4QPJC 1ZUIA 2FPSA 3TW6A 4ARVA 2WAAA 1HA8A 2H16A 3G9XA 5AT1A 4B4OA 2NO9A 8AT1A 1M6VA 4R2IA 1WSAA 2HYGD 3CR8A 3IXMA 2XUOA 2FX0A 1EM6A 3JSAA 1EKXA 4OV6B 1XT6A 3KU4A 5I5EA 3NVDA 1I94B 3ICQB 4QUBA 3PTAA 1KYZA 2ZO4A 4IS3A 4XJVA 1O8CA 1XD8A 4EMUA 1W581 1A9TA 1KVRA 3JY6A 5FADA 4G5YA 4PS1A 1L3CA 1BQEA 3PO2J 2F90A 2GJ8A 2HEIA 3DHVA 5F4BA 1IUNA 3C6ZA 3NUQA 3RFXA 3I01M 4MR8A 5AOCA 4BMXA 4DSUA 2Q9AA 3M6UA 3L6CA 4MXDA 2IPQX 2R60A 3I2GA 4LJ8A 1YLFA 3H1CA 5NULA 3H3VK 4AJ2A 4KGXA 2C94A 1OHHD 4H6WA 4PRKA 3P2JA 2V9PA 1O1YA 2R5YA 3VHLB 1G3UA 1T0IA 3RAJA 4LRTB 1MD0A 16PKA 4YJHB 1AUXA 2OHVA 5DRYA 5LQSA 2HK6A 2X1LA 1V4VA 3CPSA 4CYDA 2EHDA 3IUNA 4XUCA 2M9MA 1U5CA 4BBPA 1MW8X 4GOJA 4HDSA 4U7JA 1QRUA 5AONA 1FUEA 1ADYA 5DT2A 2JVIA 4OMZA 2NPFA 4W5TA 4PQEA 3WJ1A 5CFRA 4ZD6A 4K9LA 4RYDA 2QLZA 5AD1A 1Z7GA 2COMA 1CB0A 1NBMA 1A8SA 1NPDA 2G67A 3I9KA 2Z57A 4P58A 5DK4A 3D8SA 3TVDA 1KF0A 3ZW9A 4YJ2A 3BT9A 1Y8CA 3HUFA 3ODGA 4XGQA 5FTJA 4C2BA 4D56A 4I9UA 4BV3A 1FTYA 4J91A 3K15A 1Z4NA 4POAA 1N6HA 2BHNA 4FMDF 2HNBA 4LQ4A 4Q1EA 1FBSA 4OGFA 3N05A 1I4EB 1R0RE 3I5MA 2QIPA 4DSNA 5HM6A 3ON5A 3F1LA 2X0NA 4KIGA 2Y93A 2DR0A 1O0SA 1XD2B 2X6TA 2N46A 4Q1CA 3WRYC 1KQOA 5JXIA 3C7JA 4GKBA 3CN9A 3ML6A 2XXAB 2FU5C 3IAHA 4G89A 2FMKA 4R8MA 1MDMA 1OKRA 2CVZA 2DHDA 4JX6A 2G5PA 2UZ1A 1Y98A 3KETA 4G8DA 3M9WA 5DTIA 3DZJA 3GJQA 5AK4A 1OH7A 2D5LA 1PVOA 3LDAA 2YWEA 4PG8A 1K6OA 2NXWA 3NKVA 4L78A 4RD4A 1GTRA 5IAEA 2O8BA 2H5LA 2ONZA 3L6OO 5F1JA 1IC6A 4JOCA 3VAAA 4ZHQF 3EX7C 3I6ZA 4G9YA 2I67A 3D4LA 2HYDA 3MRVA 4OSEA 4V0LA 5B7QA 2IEBA 1ZGWA 1VGVA 2DH5A 4UVGA 4EENA 1AX9A 4EB3A 1FFSA 1ZRHA 2OCGA 3E7PA 1MJ9A 3F5SA 1RKQA 2QAGA 3JQFC 2FSGA 4BE2A 4C3JJ 2QRPA 3GMTA 1MOZA 4JH0A 3MT9A 4WUVA 4H6PA 4PLVA 3O4HA 3U19A 1JKJA 4HF2A 4RPJA 4RL4A 3ESWB 3B6CA 4IEFB 1JVSA 4MHOA 2FPKA 3ZWVA 1Z6QA 4QXAA 3K0FB 4CCOA 1XNHA 1LCIA 4P7BA 1E1QA 5KYGA 2BGCA 1YJAA 3P8ZA 5CJ2A 1TAQA 3IHTA 4NBKA 4B2YA 4AC0A 3MWEB 1LUJB 3MT8A 3RUEA 4CMGA 4YT2A 2Y2VA 3AUUA 3CX7A 3FDZA 1F7UA 1EX6A 4JGGA 4DA7A 2EEZA 1ZXBA 4YIIA 2Q6KA 2ZKLA 1R9JA 3G2LA 2HHAA 2HA2A 3RKQA 1RTTA 2ZI3A 5C52B 3ANMA 3UTCA 4LK1F 1MO2A 4WLNA 3DM9B 1NBAA 4L3VA 5TJJA 4MARA 3BGSA 1PQPA 2H4HA 3QHAA 4J0IA 4EKIA 2QEXI 4M76B 1PYVA 1Z08A 3SYMA 1VM6A 1HDEA 2AYXA 2OK7A 3H8VA 4IO0A 5LU9A 4Q7JB 3L1UA 4LTMA 1B3RA 4X1KA 2ZLBA 2Q1WA 1SUBA 1YZKA 5ALFA 3A6JA 4FT8A 2WA0A 3MF4A 3P2EA 4HNHA 2L3DA 2LCQA 3UGTA 3RVLA 5JBQA 2JUCA 4GI2A 1LBIA 1YI1A 2P78A 3GPBA 2RGWA 4PWYA 4RYLA 2AOXA 4RCVA 5IDQA 1MFZA 1QP4A 5HWSA 3ZJTA 1PLLA 3IAUA 2Y2ZA 3SZRA 2O2YA 1O4VA 4ZYYA 5CITA 2M8EA 5JQWA 3PUIA 2AX3A 4YA6A 3CWQA 1POGA 4Q9NA 1IN5A 4C3UA 5HIMA 3QVVA 4BY1J 1TQPA 4ZARA 2A5LA 1I6LA 1T4MA 3I0TA 4S1OA 3P9RA 3ROMA 2R6HA 5BW8A 1GTZA 2QX8A 3Q98A 4RLHA 4L5JA 1CUWA 1Y33E 3EC2A 3KJXA 4IG9A 4S3MA 4RTSA 1EJ2A 1YBHA 4N1AA 2HWXA 3KT3A 3NHLA 4QATA 1SZCA 1VE5A 5EHNA 1NUPA 3LQYA 3N6VA 2NVUB 1I4OA 4XONA 3UHAA 4WNCA 1SVNA 2FPPB 3D7MA 4F5ZA 2Y66A 1GYRA 2PKEA 2Q3BA 4CV0A 3O4VA 3U4QA 4J2HA 3BXZA 4Y17A 2PWZA 3LLSA 4MS4B 1SURA 2H1FA 3K72B 1ZS9A 5F3RA 3PICA 3B6JA 4ZT7A 3WHKA 3VR3A 3CP2A 2RVCA 3BR6A 2IUFA 1E2FA 2QX4A 1WDLA 2YN0A 3JR7A 3R3JA 2H1HA 2ZATA 3VHXA 5ALVA 3UBTA 2STTA 2NO0A 1E96A 1Z45A 2CLDX 2Q4EA 3RK1A 2PIDA 4PPGA 4PAWA 2BGIA 4PLHA 4RPHA 3WI7A 2RKOA 2Y0BA 2KDOA 1Y9JA 3ASVA 4NZ9A 3D0KA 4B73A 3RG8A 1R3UA 4I4CA 2ZXIA 1H0MA 3MFQA 2YZ7A 1FFBA 5CVIA 4HADA 4TM8A 4BMYA 4FHDA 4YV1A 4L8WB 1KMIY 2F1IA 2EJRA 5LLDA 2R25B 3K5PA 4AW9A 2FA9A 1FPQA 4FD3A 3DC2A 5FD5A 1OIWA 3C4VA 4IGKA 4QEDA 6PFKA 5A5GA 3E3VA 5C51B 2CHFA 1UFKA 1FC0A 4LDNA 3SC6A 1XTQA 3GG2A 4O4IF 2MA3A 3B6KA 5HQJA 1R0CA 4C7MA 1JQBA 3ER8A 4TMYA 1JZQA 1AHHA 3COVA 1AKRA 3MEQA 3TNJA 1GIAA 3WNBA 1K2WA 2EERA 3N39C 2UXXA 4OQLA 5G0VA 3SP1A 2EZLA 4BO3A 4V0RA 2G08A 1YGYA 4WVFA 3MTIA 3L1VA 3D0SA 2QQBA 2FOIA 4K9DA 2HVQA 1NSYA 3V8LA 3FUUA 5KI6A 2H2FA 2H63A 2D8MA 3NGXA 2JFFA 2VUUA 3SQLA 3WV4A 4A4DA 4C4OA 1Z3XA 3K2ZA 4RB3C 1H9BA 4CXFA 1Y6JA 4CL3A 2XCQA 1N2CB 2XUBA 3GX1A 1Q3TA 1LD3A 1M83A 4H15A 4HSTA 4ENQA 5J2UF 3PGJA 1LLUA 4RL6A 1Y1KE 2JBAB 2QJTA 2CUJA 4OIQF 1I6HJ 1XCBA 2ANCA 3IUMA 2QZ4A 4RVFA 4X45A 4E5VA 1L9XA 2HBZA 1NBEA 2VI5A 3F8TA 3H2BA 1ID8A 2IP2A 3U1TA 3DNPA 2G7HA 1WCXA 1HW1A 2Z5FA 1CPYA 3DBHB 2G25A 4HX5A 3QF4B 4G1MB 5P8WA 3DQVC 3QFSA 2PBLA 1Z4PX 2JDID 4FGWA 4TMKA 1VYVA 4LYGA 1F1ZA 4QBHA 3C5HA 1IPEA 3HHHA 4MGZR