1FP2A

Crystal structure analysis of isoflavone o-methyltransferase
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
345
structure length
345
Chain Sequence
b'RKPSEIFKAQALLYKHIYAFIDSMSLKWAVEMNIPNIIQNHGKPISLSNLVSILQVPSSKIGNVRRLMRYLAHNGFFEIITKEEESYALTVASELLVRGSDLCLAPMVECVLDPTLSGSYHELKKWIYEEDLTLFGVTLGSGFWDFLDKNPEYNTSFNDAMASDSKLINLALRDCDFVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVENLSGSNNLTYVGGDMFTSIPNADAVLLKYILHNWTDKDCLRILKKCKEAVTNDGKRGKVTIIDMVIDKKKDENQVTQIKLLMDVNMACLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ISOFLAVONE O-METHYLTRANSFERASE
publication title Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.
pubmed doi rcsb
source organism Medicago sativa
molecule tags Transferase
total genus 122
structure length 345
sequence length 345
ec nomenclature ec 2.1.1.150: Isoflavone 7-O-methyltransferase.
pdb deposition date 2000-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF08100 Dimerisation Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1fp2A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1fp2A02
3W6KB 1XTPA 4LGWA 1M6EX 1FX7A 5ILVA 3M1EA 2OO3A 4YFXF 3KFWX 1YB2A 3OZTA 2AS0A 4FT8A 3KQWA 2Z5UA 4L0YB 5E9QA 1LDKB 1QBJA 2HQRA 4EGZA 5U4XA 4LWOA 3HA3A 3I59A 5D6FA 4AZTA 2ETHA 2K27A 4L9JA 4QLCU 3WTTC 3Q7EA 2ZLBA 3ISPA 1BI1A 3DMHA 2XVAA 2EFWA 2JZYA 3L7WA 5LQUA 2AZTA 4A6EA 4ESJA 2ZZKA 5HFJA 3LCVB 2AOWA 2YVLA 3VSEA 1G3WA 3V7RA 4GO1A 4BAYA 4IPAA 2HS5A 2DPMA 1XCBA 4M36A 3I9FA 2DQLA 1SFXA 1HXDA 2GWRA 1BOOA 3AY0A 1XVAA 1GHCA 3UJ9A 3VEPA 3WTWC 3F6VA 4P9FA 1F38A 5C9ZA 5LQJA 3MFKA 5DLYA 1IN4A 3WTUC 1RI4A 3IYLW 5DX0A 2G9WA 1MJ9A 3DP7A 3L8DA 3QP6A 2YR0A 4V0RA 1ULYA 2NS0A 3G73A 4GYGA 3IC7A 4EJWA 2PVCA 4RAZA 2O06A 4C03A 3CCFA 3TR6A 2DK8A 5LRSA 1JG1A 5FA8A 4R6WA 5L3BA 2ZIGA 2NRAC 4HC4A 3V7CA 4QTTB 5EMKA 2JTVA 4OBWA 2PFBA 4M9XA 2L3DA 2XV4S 5HS9A 3E23A 3V8VA 1KGSA 2FNAA 4G9YA 4EJTA 1DL5A 4RTMA 4OOIA 1X19A 5H6RA 5FHRA 3RDIA 2Z6QA 3G2QA 3HVIA 2ADUA 2YXEA 2QY6A 5K0NA 1UFMA 5DEQA 3MQ0A 3VFZA 4CKEA 1O7LA 1PDNC 1USSA 4RB2C 5ILUA 5LLQA 2Y75A 2I62A 3HA5A 1YG2A 4IHSA 3LKDA 3TLJA 2QYOA 3FMQA 2P7IA 4LB6B 2HYGD 3EVDA 4KDCA 4P7FA 2FE3A 4UHTA 4HRAA 4KWCA 1U6GA 4ZYGA 4ER5A 4L9TA 2VBZA 2CWEA 4M73A 2O07A 2QBYA 1JTEA 2A61A 1O9GA 5HIKA 4M7RA 2PN6A 5K8VA 3ORHA 3REOA 3GRVA 4MQVA 5FHQA 4ASNA 4ENMA 4RX1A 2XGXA 1HW2A 2V7EA 4GC5A 3EGIA 3M8FA 5CVEA 3JAMZ 1LB2A 1ZARA 2ZNZA 2V1XA 5FO5A 5JR3A 2P8JA 2F5DA 3FXUA 3DXXA 4GQBA 5EEGA 3E6CC 3AJDA 4MEXF 1MJBA 5F64A 1NV9A 5DXAA 3MB5A 3FPGA 3SXYA 2IH2A 4U7PB 2LDUA 3KEOA 1ZG3A 5EIFA 4C4AA 1FNNA 1UHMA 2LKPA 5AIQA 4DF3A 3C1DA 1QPMA 2IDKA 1NW6A 3FYDA 3T8RA 3A25A 5L3FA 2PJPA 3M70A 3SX0A 1HBXG 3PLAE 1ZQ9A 1WXWA 2I7CA 1T39A 5K0LA 3DLCA 2V1UA 3KLOA 2Q8KA 3KCCA 3FTDA 1OYWA 1IW7F 4ZH4F 1BC5A 4V0QA 2H1RA 2DAOA 4BP1A 1RI5A 3AWIA 1RJGA 3DH0A 3GFIA 4Y13A 4KICA 1CF7B 2J5OA 5E1WA 1ZAOA 1T98A 5HDNA 1G3SA 4LG0B 4JXJA 3ML6A 4RTPA 4B17A 3K2ZA 1KIAA 2D1VA 1JSXA 5LGUA 2PKWA 5DM2A 4HLYA 3EETA 2HYFA 2QQ9A 1T2KA 2BH2A 4YUVA 1EJ0A 2ZBRA 1G6Q1 1BI2A 4IV8A 5FLXK 2NP6A 3ZMUA 1I1SA 1UB9A 5J6XA 3VB2A 1TBXA 4PWYA 3ELDA 1J0RA 1T0FA 2PBIA 2Z3YA 5LHGA 3TKAA 2EV0A 1V39A 3E5QA 5D1NA 2MH9A 3C6KA 3BROA 4ZZLA 5D5VB 1EQAA 2PSSA 3BWYA 1FSHA 5HIMA 1JE8A 3LFKA 3LAPA 3EVCA 2V79A 4UUVA 1X1DA 1YFHA 3UJ6A 5K1YA 2NYUA 4ENNA 1SMTA 3IKTA 1R1VA 3H92A 4DKJA 3CJRA 5H6QA 3PFIA 2EA4A 4IJAA 4GOLD 3PFGA 3WODF 2LD4A 5DYMA 2IJLA 5IT3A 3LKZA 4BLWA 4OMYA 5DTMA 3GZ5A 3C7JA 3KP6A 3SSOA 1JGSA 2PJDA 1T38A 3VOEA 3EVBA 1RIOH 2GLUA 5DT2A 4EQZA 2IBTA 4I0BA 4OIPF 4E70A 5GIOE 3K9TA 1QAQA 2PX5A 2FBKA 3LDGA 3P97A 3FUXA 2QE6A 3LCCA 5DX8A 2YUIA 4U7TB 4BQAA 5K05A 2VDWA 2VBWA 3MAGA 2P6TA 3HCEA 2VN2A 3GXOA 4XBFA 4EJUA 1LDJA 3IL2A 3LHDA 3KP3A 5DCMA 5JI6A 4WCGA 2R6ZA 2Z99A 4GYIA 5L3GA 5BMZA 4PDKA 2AOTA 1SG9A 2Z6UA 4ZYDA 5ICGA 2OY0A 3G2OA 3KE2A 5E18F 2GH1A 4ATNA 2H94A 4I09A 2PMUA 4RTJA 5FA5A 2HR1A 4KT5C 4FS8A 3F8CA 4DZRA 1PP8F 3L2CA 2GXBA 3COAC 1G6NA 3QOWA 3TKYA 4PYJA 2AN3A 3O6BB 1G8SA 4HV5A 4LK0F 5IT9K 4GOND 3HRUA 4RSRA 1QZYA 2QRVA 1SMYF 3HCCA 4HX4A 2CWWA 1IXSB 2KW5A 2EFPA 2UYQA 5DTRA 1P4AA 1G3YA 2H09A 1YS6A 1P39A 2PXCA 2OQRA 3KP4A 4LG1A 5LRRA 5CVVA 2O3FA 3T8TA 4RWZA 1R5HA 4PYIA 1GVJA 2ZXJA 1HKTA 1VQ1A 1W7PB 4RTRA 2EFJA 2P3QA 4IXAA 4U88A 3GRRA 1F9NA 1BKYA 1O3SA 2IDJA 5BQTA 1YFJA 2Z9OA 1QGPA 2OPBA 4I02A 3SVZA 4G94A 4PYLA 1ZG1A 3OZRA 4HQMA 4E30A 1OPCA 3TO7A 3J81Z 1BC8C 4F86A 3GCZA 4CZZA 4PNEA 5GM1A 5K0BA 1HQCA 4CKCA 5F2NA 3MERA 1JQ3A 3CVOA 2B2CA 4GOMD 4PIPA 5K0FA 1IN6A 4HBLA 2ZCJA 2R7DA 2MLKA 1M0EA 3WSTA 2NNYA 4DMGA 4KYWA 3HA7A 2OZ6A 3R3HA 3A7EA 1NW7A 2P3OA 3EQLF 2IRFG 5E8GA 1O3RA 1FBUA 2XAFA 3F6OA 3RKYA 1LQ1A 1S7OA 3K6RA 4C08A 3EGVA 2HGCA 4C04A 3CO6C 1XMKA 1ZGAA 3ECOA 4I01A 1UFKA 1HMYA 1SQFA 3BZ6A 3TOAA 1S3JA 2P5VA 2VZ9A 2JHPA 1ON2A 4F7ZA 3EEOA 5FD6A 1FT9A 5E9JA 3SSMA 2W84A 2EG5A 3IHTA 3CO7C 5BW4A 1IN5A 3J80K 4HYEA 1WG8A 1QNTA 2A14A 2OQGA 1I6XA 3F8BA 2MC3A 3RTRA 3IRRA 1ONVA 3LBYA 4ER7A 2UYOA 1P2FA 3E6BA 1BOAA 3T1BA 1P4WA 1OKRA 3MHTA 3SQNA 4A12A 3MZHA 2CG4A 2M1BA 1TW3A 4L18B 4ESBA 3PVCA 4YUWA 1O9HA 5CJ9A 5LEKA 1WY7A 2ELHA 2DO7A 5KVAA 1KU2A 1FP1D 3WTZA 1DPUA 3WG9A 5DM1A 4EQQA 2L01A 3QPTA 3M8EA 5FLXZ 2VT2A 3V4GA 2I9KA 5J8FA 3TPZA 2DT5A 3JSPA 5DSXA 1Q1HA 5KQRA 5LQCA 4OA5A 2XROA 3JWHA 3EVEA 5D8KB 3B5IA 1IY9A 4X1OA 3F22A 1U2ZA 2FMYA 4OIRF 4AIHA 5LR6A 1SD7A 2EV6A 2A68F 4RTKA 3B02A 2JJQA 3IWZA 3F72A 5CD1A 4M6XA 3RI4A 1KHHA 4LB5A 5E1OA 3CUQC 4IV0A 3AXTA 1TNSA 4PGGA 1R58A 4Q4ZF 4BY9E 1SFEA 1XSXA 3G2MA 2GA9A 3BWBA 1B9MA 2P35A 5DD8A 1XDZA 5FD5A 3RPUA 5EZQA 5DUKA 1H1DA 1MZBA 1L9KA 1R00A 4KDPA 1YZHA 3BWMA 3E5XA 2GAFA 2Y0MA 1LDDA 3TM5A 5L3DA 1VTNC 1TLHB 2MLGA 2MD5A 1QAMA 2AOVA 2PX2A 1NW8A 2H00A 3U9GA 3EMDA 3R4KA 1U5TC 2W57A 4F84A 4KN7X 4HGYA 4QVKA 4UXNA 1F5TA 2IIPA 3R6TA 5JUWA 2CO5A 2VXZA 3LA7A 3W6JB 2VOOA 2HTEA 5LQNA 2EFNA 3LAJA 2EX4A 4M38A 3SR4A 4EVIA 1ZH5A 5BXYA 3VC2A 1PUEE 4RGRA 2IFTA 1K78B 2ZFUA 3QOPA 5HZMA 1YFLA 5H20A 3ROUA 4O3MA 3RIEA 1HKQA 4JK1X 4MTDA 1XB4A 1LEAA 2YX4A 3HCAA 3DOUA 3KZZA 4HV6A 2PY6A 2UXXA 3ERED 5CCBA 3CJQA 2HZTA 2M8EA 3K69A 2IVMA 1L3BA 3SXJA 3OPNA 3RKWA 3V8JA 4AX8A 2D1HA 2OB1A 3I71A 2ZKZA 3E6DA 4NQWA 1TQPA 4LMYA 3ABTA 5FUBA 2EFOA 3HVKA 3DTNA 4UNOA 5EHGA 3G8BA 4YV1A 3BZBA 3GGDA 4ISCA 3UJCA 3QOXA 3FHZA 2NNNA 2BBYA 2HTSA 2DW4A 4U7BA 3PTAA 3G5LA 3KPWA 4N9IA 1WXXA 4M9SA 5GINE 1KPIA 5D6EA 3KP2A 2W25A 2GPYA 1HKSA 1WI9A 5LHIA 5CLSA 3LGAA 4OMZA 1PP7U 2FU4A 2STWA 5D5WB 2OZUA 3P71T 3NVKI 4POOA 5FFXA 5HEKA 3G2PA 1P1BA 3V7SA 1WS6A 4OIQF 2O05A 2J5PA 2RV8A 1YIOA 5ERGB 1I9GA 3UJ8A 3RKXA 1U8RA 4A5NA 4WK8F 2FA5A 3PQJA 4DQ2A 3ELUA 2ZCWA 2EA2A 2P5KA 4EGYA 2FNPA 1D8KA 3CJTA 1REPC 3KR9A 5F2OA 4XLPF 3FUUA 3SGLA 2YQZA 2QENA 3HIFA 3RYPA 3LCUA 1Z6RA 2JG3A 5E1ZB 4IF4A 4TV7A 3KQVA 1NKVA 2MH2A 4UV9A 3ZP5A 1B6AA 3QP5A 3CKKA 3J80Z 4AZVA 5LBQA 3F21A 3TDZC 2VDUE 4E2ZA 2YXLA 1JHHA 1WSUA 4QVGA 5K03A 4KIBA 4PYKA 1B1BA 2UYHA 2UZKA 5EMJA 4U0VA 1V4RA 3A4TA 4OQDA 1TNTA 2VODA 2CKDA 2X4HA 2NAZA 3PB3A 4FP9A 5EQJB 1NW5A 1VE3A 4BYYA 1U2WA 2FF4A 4P96A 5DUIA 5HILA 4WXDA 1KU3A 5HLHA 1NE2A 4QDJA 3KQMA 1O3TA 3F3XA 1BJAA 3EVZA 4E2XA 4QTUB 2W24A 3HUGA 3E7PA 3P2EA 1Q0SA 4X41A 2O6GE 3BJ6A 4P58A 4RTOA 2RNJA 3EEYA 5T6BA 4HA8A 2WV0A 1SD5A 4CTKA 4PINA 4AIKA 1RJFA 3BGVA 2O0YA 3I53A 4PCQA 4Q47A 4MHTA 4AIJA 2A6HF 2BM8A 4HAMA 1YW8A 4JQFA 3UBTA 1FP2A 4DCGA 4YFNF 3PX2A 3JWIA 4HSGA 1KPHA 5E8JA 5DD4A 1RJDA 5LQRA 1B42A 1SKMA 4YV2A 2XVCA 5L3CA 3NWBA 2XKPA 3I64A 1H0MA 1HSTA 2GZWA 2F5EA 3KP5A 4YUYA 2ZNYA 3FPEA 5DM0A 3ER9A 4OIOF 5EHIA 4NB5A 1KP9A 1RZ4A 4FT2A 1IXKA 2FBHA 1KR5A 3KP7A 4B09A 2OKCA 4HDVA 1OYYA 2XASA 3TDUC 1FPQA 3M4XA 3OU7A 2EB7A 4RB0A 4EM2A 1H9TA 5TRDA 3Q5FA 4LLGF 1HW1A 3BXOA 2L4MA 4FR0A 2BV6A 5K01A 3DMFA 1EH6A 2QUFA 4Y15A 1S29A 1O57A 3C3YA 4EKGA 5D8LB 2FK8A 3FUWA 5GIPE 3DUWA 4OA8A 2ZMEB 1ZGJA 2I6GA 4BHBA 3E97A 1PRYA 2UZ4A 5C1IA 3BKWA 4RS8A 2E7WA 5JFRA 3ER8A 3R0AA 3C3PA 1BN5A 3FF5A 3N97A 3CUOA 2Q0OA 3ELWA 2VE8A 5ED4A 4PONA 3GUDA 4BNCA 4XSZF 2WA2A 2NXNA 3CDHA 3DMGA 4G56A 2PLWA 2PWYA 2M87A 3FXQA 5EOVA 5BP7A 1O54A 2P40A 2PMHA 2AOUB 4AZSA 3JWJA 1FBQA 2K4JA 1LNWA 3NW9A 3VC1A 2P7VB 2DTRA 2FK7A 3ERCA 1ORIA 2DPUA 4O5VA 1X1CA 5E9WA 4XCXA 4L9VA 4WX9A 3NDJA 3CLOA 2VC0A 3NJRA 3BPVA 5K5QA 1H9GA 3D2LA 2IP2A 4OX9Y 2FXAA 4ZYEA 5LHHA 2DPDA 2XAJA 4UVBA 1BIBA 4FHTA 4P9UA 4RB1A 1UCRA 2A6EF 3LA3A 4PYQA 1R8YA 2BM9A 4U0WA 3U81A 4NHJA 1NBHA 3FTEA 1IUYA 4EJVA 3P9KA 5K5OA 3WGGA 1QANA 3TO6A 3HNRA 1CF7A 1K79A 4P55A 1KU7A 3BGDA 4KUMA 3FPJA 4LG0A 2JSCA 3KQOA 2UYCA 2LSOA 2FCAA 2VONA 4FX0A 3DF8A 4M6YA 4E33A 1ZREA 4MQ4A 3DXYA 3X0DA 3LX6A 4U7DA 4YUXA 3FXRA 4L0ZB 2O0LA 2B3TA 4G8XA 3F23A 2CYYA 4QQKA 4HF0A 3IEIA 5KK1A 4L5IA 1S7AA 3J7AO 3P2IA 3HVJA 2PT9A 3C3WA 3JWGA 4GF5A 4C06A 4CXMA 3L09A 3ZN0A 2D2WA 2STTA 3OZSA 3U2RA 1FZPB 2DU9A 1YTYA 5BS6A 2VC1A 4ER6A 3R60A 3I5UA 2L4AA 4DNCA 3EVFA 5D5UB 4RTNA 2E5WA 5E1MA 8MHTA 3LSTA 5BPIA 3SM3A 4R05A 5CUQA 2EJRA 4KIFA 2O61A 2TDXA 3NTVA 1KQ8A 4RGUA 1G8AA 3ELYA 4NECA 4OQEA 2Z33A 2P41A 5E2BA 4WXCA 3FUVA 3MWMA 5ILSA 1QQIA 4A0YA 3V8KA 4A0ZA 3UFBA 4AZWA 5HOOA 2IH5A 1ZRFA 2OZVA 4XLNF 1ZHFA 3R6SA 2YX7A 4GC9A 2XVMA 1LVAA 2CQKA 2WWYA 4HF1A 1NBIA 1AF7A 5GOZA 3KU1A 4CTJA 1E2XA 4FGZA 1B4AA 4KNYA 4HG2A 4O29A 3E5UA 1OYIA 5FCDA 3DKWA 4A0XA 3G5TA 3AXSA 2HWVA 1G4DA 3HSRA 3ZN1A 1JR4A 3TO9A 2HNKA 4YIFA 2ZBQA 3WU1B 4MEYF 1EG2A 1FWZA 5IKMA 2ONYA 5E1BA 5KQSA 4PCLA 1RI2A 1N7JA 5EZSA 1W7PD 4MGRA 2CMHA 4I0AA 1L3CA 2EFQA 2X0LA 4RVFA 4CYDA 5K5RA 3UJAA 2ZO4A 4DM3A 3TM4A 2EJUA 5HS8A 3RW9A 3E05A 3H3UA 4M74A 2XKOA 2K4BA 4RAYA 1XMAA 4WVLA 3GIWA 2NNWB 3FM3A 1QZZA 2XBMA 3T0IA 10MHA 2V9VA 1KXZA 1W7PA 3R24A 3RIRA 1WZNA 5DPMA 3S68A 4RTSA 4B8XA 3DULA 5LGTA 1B9NA 3DEUA 2HTJA 2PI0A 2IA2A 3KZYA 2G1PA 3NDIA 3M6WA 3KR0A 3QAHA 3HTUA 2VS1A 2K4MA 3EGEA 1JG3A 1G55A 3GDHA 3ME5A 5HIIA 4OINF 3PFHA 1X3UA 5FWDA 2RGVA 4HOBA 2OYRA 3CUQB 2P5LC 3BGIA 4HX8A 3TQSA 4HDUA 3QU3A 2M30A 4CDGA 2B9EA 4R1HA 5HLGA 4EK9A 3RODA 2YSRA 2YXDA 2ZBKA 4MTLA 2L54A 3HP7A 2WA1A 1OR7A 2KJBA 2IBSA 1SAXA 3KR1A 3NMUF 3BDDA 2BEOA 1BBYA 2YU3A 3GRZA 3DLIA 3BP8A 1L3LA 3PQKA 4RTQA 1J2XA 3L00A 3GEZA 1YS7A 2IA1A 5JHUA 1P4XA 1U5TB 4AVPA 2AN5A 4P5OA 3GYHX 3IHUA 1VLMA 2JT1A 4HGZA 2OD5A 3HM2A 3GJYA 3HOTA 1OR8A 3HRMA 3HTXA 2CGPA 3C0KA 3H2BA 3BT7A 1YF3A 3KETA 5D4SA 1W5SA 4PYOA 4EM1A 5F1RA 3GF2A 4EKIA 4KDRA 1FBSA 2PX8A 3F8NA 3ULQB 5FFZA 2EWNA 3RYRA 1ORHA 2G7HA 3OFJA 4OU0A 4PZJA 1IN8A 3BUSA 4G6DA 3DFGA 1R8XA 5GP1A 4IHTA 4ER3A 3FRHA 4DQ0A 3GFLA 4HLXA 2KKOA 1Z05A 4QQNA 5F6FA 5CVDA 4IRGA 2GQQA 3WU0A 1KQ9A 4Q5SF 1IF1A 3ZQ7A 2GIVA 4AWXB 3EYIA 3MAJA 2ESRA 1HSJA 1MKMA 2VOPA 3KKZA 2Q41A 3K0BA 2AN4A 2GA1A 4G6QA 4BXUA 2FOKA 3ELKA 3OOPA 3B73A 1DPRA 3P7NA 2CL5A 5HLIA 3HHHA 2YTZA 3BY6A 1TQMA 3OV8A 1P92A 5CIYA 2B0LA 1MDMB 5EC8A 5GWXA 3EVGA 3KPJA 4YMGA 2XAGA 3UA3A 2OXTA 2NXCA 4A6DA 3JTHA 3LQRA 1I1NA 1XGMA 3NWEA 4GGGA 2PXXA 2ISYA 4FX4A 2BR5A 3B7PA 4PCAA 1XDUA 2HQNA 2ACJA 1WQ2A 5DRYA 2HMYB 3P8ZA 4GCVA 3O7WA 2BYVE 3KQYA 1YLFA 3E6MA 4PGHA 1L1EA 4M9ZA 3FMRA 4LK1F 3EDPA 1LEBA 1GXQA 2R3SA 1G38A 2FPOA 2F2EA 1J5YA 1UIRA 3F8MA 2A69F 4HTFB 2PBFA 5ICCA 3ID6C 3M6UA 5ICEA 5IT9Z 3HTSB 1XJ5A 3QRFF 4KW7A 1BIAA 1K78A 3TRKA 1XGNA 4LLNA 5TJJA 2HFHA 1MHTA 3VODA 4M37A 3UWPA 2ZWVA 1EH8A 1I5ZA 3G8AA 3F4KA 4MTEA 3BWGA 3OFKA 1X1AA 3KQSA 4HH4A 2PG4A 5CCXA 2FRXA 3R0QA 1G3TA 2L02A 3EMBA 1AQIA 1D2CA 3FYCA 1IRFA 1KYWA 5HDGA 3SHFA 3CTAA 3HCDA 1UHWA 2NXEA 4ZTBA 2ZULA 2BR3A 3LL7A 1ZLKA 3TFWA 5FB2A 2V6CA 5MHTA 1DUSA 4YMHA 3IKVA 1XD7A 1ZLJA 1PJZA 5KVRA 3TOSA 3H3ZA 4EJOA 1Z6TA 3HVHA 3LWFA 4XRFA 1EJ6A 1NW3A 3LPMA 5E20A 3HCFA 5CM2Z 3OE5A 2OAZA 1AQJA 2HKXA 3KR2A 2G7UA 1J9IA 2DBBA 5KS2A 2H6BA 3I59B 4LECA 4S04A 3EUHA 3EYYA 1RI3A 2O03A 2DI3A 4S05A 3ZMZA 1KPGA 5CYVA 1XXLA 4HZFA 2CW0F 3R0JA 1W4MA 2MA3A 4I7HA 5DRTA 1R74A 4LLLA 1JG2A 3KHKA 3TMAA 4QPNA 4GUAA 3ZMDA 1KQ0A 4E2WA 3M33A 2YX1A 3DXZA 2H27A 3GFJA 4HF2A 3M6VA 2ZZMA 2CFXA 1RI1A 3ANXA 5EEHA 3QPHA 2BE5F 1D8JA 2RC4A 4CICA 1BI0A 2P7HA 1Q0TA 4C07A 3A27A 2F8LA 3TOBA 3AAFA 4PIMA 3GRYA 5FWAA 4G7ZF 3M9AA 3LBFA 2P6SA 1FJXA 1VBFA 5K0EA 3QU6A 1K6OA 3GLXA 2VE9A 4LD5A 1KYZA 3WTYC 3GZ6A 5K0GA 5D5XB 5EMMA 5DTQA 3NQOA 1U3EM 1SQGA 3DPTA 5E17F 2KRFA 3P9NA 5M5BA 2CSOA 2HKOA 3O2PE 4WWCA 3DPLC 1QYRA 3CGGA 1JHFA 2KIUA 4Z2YA 3G3ZA 4U0YA 5DSTA 4MNUA 4IVNA 5ERIA 1RI7A 4KRGA 3P9IA 4R8RA 4OBXA 1JSZA 2ZJ2A 4ENKA 2XRNA 4KMFA 5BOXA 3PT9A 4UVAA 4EM0B 4XUEA 4YG2F 3GX4X 5LSAA 3QV2A 5BPDA 3T7RA 5EKXA 5H02A 3KQQA 4K6MA 3V8LA 5FTWA 2AR0A 4RGXA 2XYRA 4BH9A 4FSDA 2XAQA 1JQDA 1Y0UA 3S2WA 4BLVA 3KQTA 1VIDA 4KVZA 4ON0A 1S6LA 2PGXA 2HEOA 2JPBA 1WKMA 4BHPA 3E8SA 2ZVJA 2IA0A 3OU6A 5FGMA 2D45A 2RKHA 2XAHA 1EAMA 1IN7A 2QBYB 4IWNA 3DR5A 1AOYA 1RNLA 2IPQX 1L3IA 1AV6A 2FRHA 2UXNA 3HSEA 4WXHA 5T64A 5AONA 1SD4A 3IV6A 4HQEA 1QO0D 5G02A 2E1CA 1XN7A 1ZN2A 3M6XA 2GAUA 2A3SA 2ZMEA 3GVAA 2E1NA 1ZKDA 3EPPA 3THRA 4DCMA 9MHTA 5A2QK 5HOQA 3HRTA 5CVIA 2FYTA 2GB4A 3B89A 5E8IA 2BZGA 5DCFA 4RVGA 3JTGA 2NP7A 2QVOA 3J81K 3F8FA 2PV0A 2ZTHA 6PAXA 2C6YA 4XUDA 3ECHA 1F3LA 3WTSC 4GEKA 1ZRCA 1VP3A 5F2KA 4AUKA 2EK5A 3I54A 1XCLA 3UJBA 3CC8A 1SUSA 1I1GA 1BI3A 5E8RA 2AOUA 3GNLA 4QWQA 1NT2A 1BM9A 2IH4A 1KA8A 2C7OA 1VL5A 5FULA 4Y2HA 4ZZDA 5EMLA 1BC7C 2QQBA 2K02A 4P7KA 2ZFWA 3SZTA 2FEZA 3GO5A 2AXLA 4RVDA 1R23A 3WTVC 1FOKA 1QAOA 5D4RA 5DX1A 4RGSA 3T0YA 1F4KA 2AVNA 3P9CA 3KPYA 3THSA 4CXFA 4R8SA 1B59A 2A07F 2G8NA 2PX4A 2LNBA 3BJOA 1Z3CA 2XYQA 4QDKA 2LF7A 1R1UA 1XCVA 3MCTA 3KLNA 4D0PA 2EV5A 2G70A 2XHKA 5T67A 3JW4A 4L5JA 3C6MA 3G88A 5B1SA 5C0OE 1IXRC 1ZYRF 2FSWA 1FBNA 3P2KA 1TTYA 3SZPA 1R18A 3FPFA 4KN4X 2V1DA 1I4WA 2GA2A 1Y8CA 5DXJA 3Q9SA 1INLA 2Z6AA 1C0WA 1NHAA 2NXJA 3RJPA 3JSOA 1IRGA 1HNNA 3WTXC 4P7JA 5K0JA 1D2GA 3ZPLA 3SMQA 5BW5A 5E2AA 2EJTA 4LJZF 3KPVA 2RQPA 4FT4A 1R5GA 3IRQA 2ORED 1DDNA 3UJ7A 2BGCA 1R22A 1ZRDA 4X61A 2JH9A 3LQQA 1O3QA 3FX3A 4CKBA 3E3VA 5J8CA 1FYMA 4G7HF 3L9FA 3LDUA 4ETSA 2JH8A 4Y17A 4PYMA 2BR4A 2RVCA 4K2EA 1FLIA 3WGIA 5ICFA 4JBAA 3PS9A 5FQNA 2PT6A 4UV8A 4L9NA 4MQ9F 2KJCA 3WE2A 4R6XA 4E2YA 2K86A 4GXOA 2OU2A 5LQAA 5HDKA 2R7FA 3V97A 1T43A 5EGSA 1YYVA 3PX3A 3UJDA 5IH3A 1N2XA 3FUTA 2WC2A 1EIZA 3ABUA 2XUBA 3LA2A 1BHJA 3B3FA 2B25A 3DQVC 1VPTA 1YW7A 1O7FA 4X63A 2M5WA 3FTCA 5FQOA 3K1MA 3A26A 1OMIA 5DCMB 3NEUA 1XSDA 4FZVA 5HIJA 5EKUA 1ZG5A 4BLUA 4BHCA 2FBIA 2AOTB 3FRIA 1LJ9A 1W5TA 5LEJA 2IGTA 2P4WA 3MCZA 3FWEA 5HVQC 3D5LA 3FMSA 4LFUA 3BWCA 2DULA 1SD6A 1AWCA 4IRIA 4H0EA 2K7LA 1L0OC 3NVMB 3T7SA 2ESNA 4RVHA 3NRVA 4CGZA 3OU2A 4RV9A 2W85A 2VP3A 2NYXA 2O57A 1XGSA 2QRVB 4FSXA 3U1DA 2UWMA 5JVTA 2P1DA 1J7KA 1XSVA 2JHCA 4KA4A 2H11A 4L7VA 1HW5A 3GFMA 2ERCA 3G7UA 4Q48A 1YO5C 3R61A 3Q9VA 1Z9CA 2OB2A 3UZUA 1EH7A 3K1NA 5CVJA 2ZWAA 2HWKA 2FMLA 3A7DA 5DDGA 4AD9A 4O6JA 3DV8A 2IT0A 1TW2A 5EIWA 2WTEA 4Y30A 5D1HA 3GRUA 3TQNA 2PEXA 2VT3A 1FYKA 5A2QZ 1XDSA 2LF8A 3MTIA 3SFZA 3MZYA 5L3EA 4UVCA 4E31A 4DA4A 5P8WA 1UWVA 1Z91A 1FC3A 1D5VA 3I0TA 1A04A 3FM5A 1MD0A 5EG5A 2VDVE 4R79A 1R36A 2COMA 3K0LA 2KIFA 2XYVA 4PYNA 1RJEA 2GS9A 1XGOA 3Q87B 1P1CA 4RTLA 2ADMA 1D3YA 2AVDA 3K1PA 4YFKF 5CVUA 1WWXA 1J75A 4XUCA 2JHAA 4CO8A 4BP3A 2DK5A 4WF2A 2JPCA 4KMUX 2ONZA 4ER0A 4EMSA 2H6CA 4GBED 3WGHA 2QLZA 1IZ1A 4MHGA 1FYLA 4RB3C 2XIGA 3LDFA 3CUQA 1NV8A 1I27A 2QWWA 2RN7A 1SFUA 2C7RA 2E7XA 5CVRA 4N0BA 2PQ8A 1GXPA 2Y1XA 3VYWA 1F1ZA 1ON1A 1JG4A 3T7TA 4A2UA 4UOEA 3CJNA 1J59A 2VBYA 5GM2A 2HOEA 3MGGA 3N4MA 1CGPA 1YW9A 3GW2A 3RPQA 2DLLA 3HEMA 1FY7A 3B3GA 3ZMVA 1U5TA 2ISZA 2ZIEA 3O3KA 2P7CB 2P3LA 1RUOA 1P91A 2YR2A 4YUZA 1R7JA 3KEQA 3OE4A 5K0CA 2PWPA 1EV7A 4RYLA 4N9HA 3MQ2A 3FTFA 4EV0A 1SUIA 4I2OA 2ZW9A 1P6RA 3I4PA 1E17A 2N47A 1TQIA 3FZGA 3ZMTA 3HCBA 2FQ3A 4LWPA 2ZIFA 4MIKA 4F85A 3DXJF 1SVUA 1YUBA 1XCJA 3R9XB 3CBGA 1TPYA 3O31A 3OCJA 4C05A 1MJAA 2OBFA 3I58A 1STZA 4I98B 2F5FA 3BPXA 2PLYA 4R8HA 2AOXA 4ENJA 1R1TA 1USTA 1G60A 4MWZA 3GU3A 1U78A 4HX7A 1DUXC 5HS7A 2GXGA 2A5YB 1V3FA 2FHPA 3TGNA 2MBFA 2B78A 4HW0A 3O4FA 5KYGA 2IPXA 1Z7UA 1IM8A 3M7GA 4G7OF 1RUNA 2QQAA 1FSEA 3SSNA 5LGNA 4IRHA 1ODDA 3WE3A 1MDMA 2HV9A 3FZVA 1DP7P 3ZMSA 5DV5A 3MTEA 4P7GA 2OA4A 2ESHA 4ZYHA 1DCTA 1N7IA 5K09A 2YPRA 3BKXA 2OBPA 1JTFA 2DQRA 3D0SA 1K7AA 5LQKA 2RDPA 2PXAA 2F5CA 3FPHA 1YZ3A 1S8NA 4ESFA 3IWFA 2WK1A 3HSFA 4IKPA 3KQPA 1JQEA 2P8TA 4YV0A 5DM4A 4KIGA 4E32A 4CWAA 4GOOD 1MJFA 2ZBPA 3B3JA 1IAWA 2C7PA 1KU9A 2ZZNA 4KFCA 4M71A 1JXSA 4HTFA 1D2HA 3UA4A 1R6AA 5E1DA 3JAMK 2DFIA 5DWQA 4H0NA 1VP9A 2C7QA 1M6YA 4YIIA 5EPEA 5E1XA 2M45A 4XSXF 2JRTA 4M72A 1YQAA 3BOQA 5AIPA 7MHTA 2CMGA 3MEXA 3BJAA 2VBXA 3G89A 1WRJA 2KIMA 4A5MA 3EVAA 2Y48A 3HYIA 3GWZA 3C18A 2AS5F 4CHUA 2ZSUA 3KPUA 1MGTA 3HRSA 1Z1DA 2Q2EA 2G71A 3T5XA 1T6SA 4QPPA 2HR3A 2HDCA 5EVJA 3HHGA 2O8XA 4X60A 2QZ8A 2V74B 2Y1WA 2IW5A 1X1BA 1IXCA 2QM3A 2G72A 3HOSA 3LECA 5FADA 3GO4A
chains in the Genus database with same CATH superfamily
4CUKA 2M32A 3ZXUB 3LLMA 1YQDA 4FT8A 2UZ1B 2WSSD 2LBFB 3I59A 5IZCC 2OZPA 2OOKA 4ZYTA 4MW1A 2OBBA 1WJFA 3EMKA 3LCVB 3PL5A 3SZLA 1EJBA 4EKNB 3IHLA 4BAYA 4IPAA 2Y1KA 1QWSA 5SY9A 3K9LA 1XVAA 3GJ6A 3DT9A 5KYYA 3S7TA 1QGUB 3I0MA 5JD6A 3K4NA 1JPVA 4C20A 3C2GA 3ZG6A 3TR6A 4NBRA 1G2IA 2OK8A 4HC4A 3HNOA 4QTTB 1UKCA 1NDHA 4M9XA 4P86A 3J7ZI 3U4GA 5TE9A 4ON9A 3ROPA 3EDOA 1UDWA 3HO8A 1O0BA 2I6SA 3HVIA 4PICA 3OVMA 3ZWOA 5JAHA 2ZUCA 1PN3A 2ZYIA 3EZFA 3MQ0A 1J07A 4LF9B 1LA2A 1XJWA 3GJSA 1UZUA 4LB6B 1YCDA 4DNFA 1YNOA 1B2RA 4HRAA 2BY4A 3WSVA 3DG9A 5LP6F 2O07A 5J9FA 3EYWA 1X7YB 3G0CA 4BV3A 1UFRA 3AF5A 1T35A 3QFFA 2CVZA 4UBLA 3KB6A 4E4TA 4LC1A 3MIZA 1ZIXA 1CZHA 4TMYA 4QBKA 2QJTA 2WM2A 5AKGA 3DAPA 4HNHA 4J1TA 3ZLUA 2MSWA 2I8DA 3S3OA 3K7AJ 4PHTA 3FMPB 4XD2A 5IAGA 2D0DA 4EJSC 1N5OX 3T61A 3OYNA 1CP2A 1TL7C 3PWTA 3MBIA 4IIJB 1KE2A 4DRZA 1OHHD 4G09A 3ITNA 5JV5A 4DJEC 4CQNA 2E89A 1T6BY 1AIPA 4GBJA 4H3KB 1KZGB 2VHQA 3KC2A 4J94A 2GHTA 1T98A 5A5DA 3ML6A 1DTEA 4RKYA 3K2ZA 3AEZA 4HTAA 2VXOA 3T1VA 3U3ZA 2HGZA 1U2PA 5FLXK 4HWKA 3ZMUA 1I1SA 1U3UA 2J9RA 1DTSA 5A2QA 3DCNA 3WNBA 4YMWA 4DZPA 4Z7NB 3ELDA 2H5LA 3D3KA 3JQ7B 5AI8A 1C80A 2DY1A 3VR3A 4IJ5A 2Y1LA 2H4JA 2QRPA 5HIMA 1LF5A 2O8EB 4X6LA 3UJ6A 5C1PA 3O8GA 5I4IA 4NV0A 3WGNA 3I05A 2BCGY 1N6OA 1M2OB 3AMVA 2COUA 4JLMA 1C7QA 3I42A 1ZUHA 2Y0BA 121PA 5E6RA 1EK5A 1JVNA 1T95A 1GKKA 5T8KA 2DH6A 3SS7X 2PKCA 4UU8A 4N76A 3HL4A 2GJ9A 5GIOE 2PX5A 5BVHA 4B6SA 5F0HA 1PJLA 3ACBA 3PR1A 2VN2A 4FLMA 3D6VA 3IUOA 4EUHA 2EPFA 5IN4A 5IWCA 1XDDA 4TVOA 5J1UA 1F1BA 5KC8A 2GYVA 2Z6UA 2EGGA 3TPFA 3VU0A 5SZHB 4BVEA 2HR1A 2NW6A 1SPBS 2FUKA 2GXBA 2E4YA 4O4HB 4O4JB 4TQAA 4KRFA 1SMYF 4BL5A 4EG5A 3PNMA 3WRYA 3NGXA 4F97A 2OQRA 1PQ4A 2V65A 3ND9A 4UDXX 3ASNH 3GRRA 2BCEA 4E21A 2H1CA 3P9YA 3H0GJ 3ZD9A 5LQDA 3TO7A 3GCZA 2CNDA 1JQ3A 4KRXA 1IN6A 3CZCA 3LQYA 2FUG6 4ZHQB 3HA7A 4W5OA 4Q7KA 4GM0A 4HXYA 2ZREA 4MDEA 2XAFA 3BEOA 3IC5A 4MQLA 2LCQA 2FEXA 4M3NA 1QMPA 2H1OA 3A3NA 4DLVA 3WWEA 5IUNC 3BCSA 3GNSA 3TBIA 1XK6A 2EG5A 2Z3VA 3HCPA 1MO3A 1R3DA 1RZ3A 3JQDA 3HO6A 3DMDA 1BH2A 1ONVA 5FP0A 4ANJA 1OKRA 4YJKA 2QN6A 3GFVA 2BFPA 1K4MA 4Y0AA 2PNJA 3OLQA 3BGSA 3OM9A 4BIMA 2B92A 2ELHA 4FASD 2CDBA 5EJAA 4ZI2A 2O2EA 4CDNA 1E63A 3UQZA 2YC4C 2INGX 2BZ0A 1PQYA 5CGZA 4G37A 5JDIA 5J8FA 3MGCA 3BQNB 5J59A 2JA2A 1J09A 1X70A 2XUZA 3H2IA 2GILA 4I55F 4EF5A 3RPUD 2YJZA 3PSIA 3ILXA 1SD7A 1U1EA 4NJOA 4Y4RA 2G4CA 2LG4A 3I6QA 1RWQA 3WHBA 2ECPA 4MVWA 4H4EA 5ITSA 1OPRA 2C2MA 1FX0A 5FD5A 1N5RA 1R00A 4DLRA 3FMIA 3DVAA 1WEHA 2VH1A 3R3JA 3TM5A 4QBHA 3THWB 5I7OA 1Z6YA 3GBSA 1RWPA 5J1RA 3FOCA 3FBTA 5JUWA 2N1BA 1JP7A 3HBJA 4L0QA 2XTMA 2SNIE 1E6MA 3DZIA 3L1PA 3N87A 3RIEA 3WB9A 7ABPA 4H1HA 1E5VA 2WIDA 1VRCA 2FEOA 2Q1WA 1UPFA 2QZPA 2PY6A 3ERED 5KMGA 5ALTA 1O77A 2XDAA 2D1HA 4KO1S 4QDOA 5ALYA 5BWBA 4RE6A 1NXXA 3A4IA 3GGDA 4K8RB 4U7BA 1UKYA 3OYMA 2ZB3A 4N5IX 2HH9A 3LGAA 1SIBE 5D5WB 1YITI 2BFBA 2CXNA 2NTEA 3NVKI 5D87A 3PHCA 4AW9A 2H31A 3PR3A 1Z35A 4RWEA 2FZKA 3E8MA 4LKOA 1CD5A 4DIOA 4RZXA 2P5KA 1TA0A 4QXRA 2VASA 4EGYA 1D8KA 3KR9A 4J2OA 1QZTA 3HIFA 1HFKA 2HWYA 3NCHA 3DLHA 1RYFA 5JALA 2BY2A 2O6LA 2PD3A 5IM5A 4QVGA 3O8NA 4LV8B 2CWDA 1XZBA 4Q4CA 3L7DA 3RU2A 3W8FA 1AUPA 4MK4A 3QLVA 1NDQA 5CLFA 5LOVA 5GONF 3IJRA 1U2WA 2FF4A 3KUUA 1KU3A 4CN8A 4YYEA 1JDVA 2H4YA 5AOVA 2QA4I 1W8DA 1KDZA 3IE2A 4XCVA 1B0ZA 1TU3A 1XMJA 4NCNA 4EFLA 1FU8A 2BI8A 5AOAA 1YW8A 3I72A 3CCJI 3ZV4A 4LDNA 2A3RA 1N9KA 2W0MA 3JRDA 5I9MA 5BSWA 3C98A 3QMWA 4C2BA 3B6CA 1Z0ZA 1XDGA 5BMVB 3FPEA 5FOQA 3DZFA 4OIOF 3PXDA 3ZTYA 1A96A 1E2EA 1VMDA 2J3DA 5K8TA 1H9TA 4N40A 4OK3A 5I5GA 4H16A 4UFPA 4HGRA 3CLRD 3OSGA 3PM1A 3S4YA 5KYTA 3CP8A 2I6GA 2UZ4A 2CHVA 4OJTA 3BKWA 2H1KA 3VH1A 1J1UA 4F8YA 3L2WA 3N97A 1GPWB 1ENYA 1EFRA 1LFAA 4MKXA 3R7LA 4PONA 4ZGWA 3FLEA 13PKA 3P45A 521PA 5HCIA 4F4FA 4ABTA 3CDHA 2PLWA 4C1BA 4AJJA 2ICAA 2D5IA 2K4JA 4FGSA 1KO8A 2P8SA 3K1AB 2X0JA 4L9VA 4G1BA 1DGRM 4WCFB 2ZE5A 3H7IA 4PCVA 5K5QA 1CVRA 2DQKA 5LHHA 2FJPA 3T9EA 4K6HA 2R2GA 2PJZA 1UCRA 4PYQA 2QKYA 2KX7A 2GFHA 1K6YA 3K70C 5IAAA 5JNVA 3FTEA 1D0YA 1IY2A 4EJVA 1QUFA 5FLYA 1K79A 5CA1A 5H7XA 5KYWB 4KMOA 1D7OA 3RU3A 4LGVA 2I29A 2QSZA 3ORQA 5KK1A 4HSTA 2NUPB 3U9TA 4J7AA 1J22A 1CNFA 2NACA 1LJ8A 2CNKA 2L4AA 1Q7GA 4F5WA 2AD5A 3M1CA 2HHJA 4FPXA 2WAQN 3IXLA 4W7HA 5FYQA 5CQGA 1GCGA 1RYBA 1KQPA 3ZTTA 2G5GX 3OFNA 4LX8A 2O3SA 3DMTC 5E2BA 3AP3A 3A9VA 4A0YA 3V8KA 2WB2A 2H0RA 5EUMA 2EERA 2IYTA 1JFLA 3D2AA 4HYQA 3R6SA 1LVAA 3RFUA 5JAIA 1GDDA 3HY4A 3WWPA 3DJFA 4Q1DA 2H1WA 2ZSEA 3A2MA 3LOUA 4GE3A 3B20A 5BV8A 1T1RA 1IRZA 4RA6A 1OPXA 1SXJD 5AW2A 1CR4A 1V48A 2OXRA 4D8XA 1F4LA 4KLZA 4HAUA 2MOKA 1P45A 1CR0A 5C7YA 3CVWA 3JRBA 5K1ZA 1S72I 3M0EA 1VOTA 1M2FA 4GGMX 1ENZA 2V9VA 2XOEA 2X8JA 4HWTA 3WHIA 2IA2A 3KZYA 1POXA 1D4ZA 3CCQI 2RI6A 4DV7B 3E1SA 2G80A 3EGEA 5HIIA 3AG1H 1E9RA 1PUFB 1C0IA 4DM7A 3RADC 2VF4X 1DSSG 1JWBB 2ON6A 3SJZA 2Z5LA 3IMGA 4CZ2A 2VLIA 1L3LA 1ANKA 3OEYA 4M86A 4P5OA 4JBNA 2B8TA 8AT1A 5DHAA 3DVRX 3HRMA 1ZLXA 4BUPA 3NBYC 3OTOB 4D8UA 3OYCA 1V25A 2PX8A 1QTRA 2G83A 4G0XA 4CW7A 2OGWA 1WCXA 3K2BA 5LA6B 1Z05A 2YINC 3ZQ7A 3EA4A 2VOPA 4B3MB 3L18A 3W9SA 2R93J 1QQTA 4BX3A 3MJHA 3BY6A 4QL3A 5K8LA 4YT2A 2C96A 3MCVA 3RUDA 4I5EA 3ZVMA 2X4DA 3B3QA 2Q6IA 3ZQ6A 3ZWXA 4ZZIA 4GGPA 3KVRA 3GPDG 1PBNA 2BTQB 3AJEA 4MV9A 1TZBA 4XFKA 2DT8A 2HLPA 4PGHA 3MOSA 3K94A 2XKKA 4IOCF 2CLSA 4KE6A 3GJXC 5EUCA 5AUNB 3DMNA 2W58A 2CJWA 2Z43A 2AFRA 1Y80A 1ZONA 5JS7A 2C3YA 2FN4A 2V6BA 2REOA 2O7RA 4DJJA 1E4EB 3N70A 3UK2A 1EH8A 1G3UA 2HRDA 3ZD7A 4XLLA 4GMHA 1P1KA 1GLGA 4L73A 1ZCZA 2P9QA 4ZVSA 4BAZA 3HCDA 1XEWX 3B7WA 4M6WA 2E37A 3DHYA 1HF3A 5FB2A 3SXUB 2K5UA 5AM0A 4PSXA 3AX6A 1OU0A 3ZQGA 4Z7QB 4CG1A 4M4SA 3H2JA 3T15A 1M34A 2KZGA 2FWJA 5KX5B 5AM2A 1WQ3A 2GD2A 5KNBD 2ZJOA 2HKXA 1R88A 3LRPA 4O2RA 1HZJA 1YJBA 1K7YA 1BXRA 3O8LA 3C6XA 3I59B 3GGSA 3L6UA 1UZNA 3WOVA 3E58A 2V9KA 4V2GA 3L7BA 1AKTA 1ZM9A 1MLDA 3TQCA 3SXPA 3RR2A 1R74A 4JR2A 3JRGA 3PHGA 5BQFA 3SZUA 6GPBA 3GFJA 1Q15A 4UUMA 4BTVA 3QPHA 1QG2A 4N8EA 5KYYB 4JVMA 1H5UA 4PQFA 3UC5A 1OD6A 4MI6A 1HTWA 1VHTA 1IMJA 2UXCB 3W2HA 4B3JA 3DAGA 3L7IA 1D2NA 3ZQUA 3B52X 1W36B 4IF6A 1WUKS 3O2PE 3EDMA 4QM6A 1GU0A 3CGGA 4WXEA 3QE2A 2KIUA 2I8LA 3MBOA 4MNUA 4ZMRA 3O94A 1W0TA 4LXQA 2I1VB 4OBXA 4P80A 4XQGA 3OMYA 3PT9A 1GAEO 2YQ4A 3GB9A 2XD4A 4HP8A 4RGXA 3JXEA 2ZIXA 3AHDA 5B7PA 4D9CA 4V0SA 3VA7A 5ALRA 1MMDA 1W1IA 4UEJA 3ASUA 2HLDA 2D45A 4OP3A 1PSWA 3RVPA 4BMCA 4UDNA 2HCFA 1SU4A 4D1YA 4HQEA 3BL8A 2YH2A 1UXOA 3TJZA 2DA1A 4EGCB 1HE3A 2B20A 1ZKDA 3L40A 4D3DA 2G82A 3L7NA 3COVA 2JLQA 4ZVPA 1CY1A 1B1CA 4YRJA 3CC4I 2IBMA 3CW2A 1DQNA 2FPIA 2J4CA 3HJCA 4M53A 2WDZA 3K31A 4KAAA 2E4VA 3GN1A 2DLCX 1LPBB 1ESZA 1RESA 2B63J 2JGFA 2IYAA 4F7WA 1AQ6A 3VKGA 2HU5A 2ZI3A 1D1TA 1C9JA 3C1OA 4IGKA 2K02A 1Z47A 1KEKA 2LTPA 2NT4A 3ENKA 1XQ6A 2CLIB 4G9GA 4QICA 1Z3CA 4F3NA 2VL8A 4D0PA 4D3SA 2X1VA 5JU6A 2QW8A 3EC1A 1QNLA 4H6WA 1TTYA 3X2FA 1XTQA 4L74A 1LDYA 2WTNA 1C0WA 1A9RA 2FPPA 4A3JJ 4A8JA 4DQDA 3HCNA 1AGXA 3IVRA 1YJ9I 5K0JA 2DX7A 1J21A 4HXFB 5BW5A 2EJTA 1Z3XA 3GLFA 4RW0A 3HYRA 2WP8J 3FX3A 3E3VA 1J1IA 3A6GA 4A3CJ 5E6RB 2X7JA 2P62A 3KQHA 1LLFA 4TTIA 5ED0A 4BNYA 3MLEA 4DZJA 4Q37A 1ULTA 3PNPA 3PX3A 2P0WA 5BVHB 1EIZA 4WA7A 2JARA 3H1GA 3DQVC 2ZSIA 3R5SA 1OISA 1GPMA 2C29D 3O8DA 1LJ9A 3M8JA 1Y9AA 1CUEA 2AFIA 2HZBA 3GPIA 1SD6A 4QOIA 2PLRA 4CHTA 2CW8A 4L9RA 2VSYA 3R6DA 3RT9A 3KQUA 1GFZA 4L7VA 4HV4A 2C42A 3OEHD 4W99A 4LAFA 4BJ3A 2HIMA 3KTDA 1PSDA 1REQA 1WJBA 2MSEB 5F1KA 5T4FA 3CZMA 1TW2A 4YVFA 4P31A 1GZ5A 3WQSB 4DV4B 4MUJA 3JD3A 3UATA 1C3EA 2Y2ZA 1ZGCA 2C3MA 4URUR 4IVPA 5AW4A 4BFCA 4PYNA 4A9AA 3H9UA 1QB8A 3KNZA 3N8IA 3E6AA 3K1PA 2WHRA 4CCWA 2GBPA 2VPIA 4EMSA 3C1AA 3W8DA 4MR8A 3VOTA 3DPSA 1NV8A 3LWDA 2RN7A 1I5RA 1DCKA 3ED5A 2AZXA 5KNDA 2E36A 1ZJWA 4EHKA 2ZWMA 1N3YA 2PKQO 2PU5A 2PZ8A 2GSDA 1BGVA 1A8IA 3UR3C 1NP7A 2QY9A 3PPWA 1NXTA 3DT8A 2BF4A 4B8WA 1WHTA 5I7VA 2IEKA 4JLBA 4U0KA 2PM8A 2MSYA 3ZE8A 1QU3A 2FQ3A 1ZC4A 1QHIA 3ND8A 4H7IA 1A4RA 3O31A 3WRXA 3DF9A 3EF3A 4FYWA 5BUQA 3HFRA 3FNGA 2AUMA 1B4DA 3VNRA 1IULA 2R7RA 5EJCA 2YNMD 1KRWA 4IQ4A 1U78A 4AWXA 4R1OA 4G26A 3ZHRA 1WZEA 3P9RA 2DMPA 2FHPA 3OURA 1FX0B 3NRBA 1IM8A 1BIFA 4KVGA 2PX3A 4X95A 4CI0B 3DVAB 4DR3B 3E5NA 2R0QC 2QRLA 4BXOA 1JLSA 2HV9A 3T5CA 1U5BA 3R74A 4MCAA 2L2OA 4Z9BA 1N7IA 3Q5DA 4AUEA 3BKXA 3VHRA 2HRBA 2ZP1A 4BLRA 4F5DA 1K6EA 4RD0A 3L1HA 4DG8A 2JIBA 1E2DA 4N7RA 4F04A 1YE9A 1MP0A 4DDVA 3GFPA 2Q8QA 1BMDA 3ZNOA 5IKXA 1LBSA 1QG4A 5JSUA 4CLOA 2VK4A 3O82A 3H0EA 5KMGB 1CF4A 4KREA 2VXCA 2EILH 2HD4A 3QU2A 2ICWG 4P08A 2ZJ8A 5E1XA 4WLEA 2XZTA 4D8WA 1UDXA 3ENVA 3TL3A 5WRFA 3M2TA 3ZKWA 1FLDA 3NHKA 3O3MB 2FWNA 2HIGA 4MUBA 1GEGA 3DDUA 3KPUA 1V8PA 1Z1DA 4TKUA 2G71A 2FN8A 1E79A 3GT7A 2BFBB 3DBLA 1PGOA 2O1XA 2P9ZA 3WR5A 2IW5A 1TT7A 1MX1A 2QM3A 5HOEA 2G72A 3ABLH 4BNTA 3BFXA 2FOXA 4URWR 3U0BA 4YAJA 5FKNA 3PGJA 2AQEA 1GVDA 1U3WA 3Q6NA 5TX7A 4RD6A 3I62A 4G65A 1JTYA 4A6EA 3OSZA 4QOSA 1T2EA 1FS6A 1NZDA 4IIHA 2LPMA 4U5QA 1XFDA 3L4KA 1NUPA 1OJLA 1XCBA 4M36A 3SC2A 5LOVB 4WXPA 1RAEA 1L5HA 3NEPX 3T5MA 3WOHA 1ORWA 1C29B 3N8GA 3IDSA 1P31A 3BK7A 1Q1EA 1T2AA 5LQJA 1SUWA 4RPGA 3LXXA 4HQFA 5JSHA 4LPSA 3CPEA 5IASA 2NS0A 4RAZA 1PJRA 5HF9A 2HPZA 3LXUX 1KC3A 5EMKA 2P6NA 3SIXA 2OQIA 1DGWY 2YVUA 1E0DA 3MMZA 2FNAA 4G9YA 2HBRA 1X2NA 4XJVA 1I01A 1ULZA 4JYBA 2ZUEA 1UFMA 2EJVA 2FMUA 1XS9A 3G02A 1YCGA 1VE6A 4LGYA 4PLWA 3FMQA 1PUJA 4JEMA 4KZKA 3PC3A 1RWVA 2R8PA 3ZY4A 4BV9A 4KWCA 4L9TA 5GVRA 3HGGA 5JYDA 3LVRE 3BXFA 2A61A 2C5EA 4IYJA 4JT4A 3VKFA 4Q01A 1PYDA 5JATA 3MKWB 3HGTA 1MNQA 5IVIA 4GC5A 3M8FA 1E3MA 4QT4A 3AJDA 1E1LA 2C04A 2H2AA 2CYAA 2GK6A 2HB6A 3I2KA 5EIFA 4BNDA 1EVYA 1N7HA 3NCTA 2HQOA 1WH5A 4L8WB 4WZAA 3AZOA 1YQTA 4M0CA 3P26A 3UY4A 1MSEC 1XQWA 2ATEA 1EQUA 4LMAA 2OCYC 2BSAA 5HF8A 5EINA 1DKLA 3IH4A 1CYDA 4P36A 4PYRA 5CA1B 4JXJA 2O8KA 5I45A 1C30A 1KEZA 4B17A 4D7MA 1C9DB 3C3BA 5IVHA 4DDUA 2QM0A 1ZRSA 1T2KA 4XM2A 2BH2A 4YUVA 3NEJA 1QFYA 5FLMJ 4B6FA 3MQ4A 2FSFA 1CRWG 4JOCA 2F4MB 1X86B 2X58A 3QVMA 4XONA 1BX0A 1NU6A 5K6RA 4XB2A 2SKEA 5D5VB 4QRIA 1V71A 1FSHA 4I4TF 1KA9H 2KDOA 1PTJA 4ZU3A 4KR7A 1P7CA 1PFWA 4EA8A 5IANA 4O1MA 3GJ0A 1TVEA 3PNVA 4TL9A 1ZPDA 1JKRC 1T38A 4BFLA 1WFXA 3GRAA 2W2MA 2ZTMA 3FUXA 1XP5A 2WZDA 3LSMA 2ZVDA 1VLZA 1JKJA 4EJUA 4E1BA 4AIDA 2QTGA 4RKEA 4XLCA 1F2UA 1I3KA 1H5QA 3R8XA 4B6RA 3VR4A 3KUKA 4ZYDA 3ZHVA 3R41A 3PCRB 2IIVA 5E18F 1RCFA 4ATNA 4WXYB 3RIHA 4RA6B 2A1TS 1QC5A 1Q1AA 3NLLA 4RQBA 3COAC 2ZKIA 3QOWA 3D6MA 3I4FA 2QXTA 3RVMA 3ADDA 4YXWD 4WZ6A 4JQOA 1ZL0A 2YMPA 3WYCA 1FQWA 4OHRA 1RFGE 5CVVA 2QSGX 2FX2A 5AFSA 1K4TA 1B6TA 4IXAA 3CLTD 1K3TA 2ES4A 2X8JB 2AEJA 1PVVA 2J33A 4I1PA 2R751 3TVYA 1SUBA 4A2CA 1XZDA 2IKQA 1E3WA 2WAFA 1ZU5A 1NI4A 1NAIA 4IIGA 4NC9A 2C1ZA 2QTNA 3FD8A 1O94D 4XEUA 2G17A 1XHFA 2NU6A 5C52B 1HMYA 2V4ZA 3IH3A 1UKEA 2II6A 4XIFA 4KPGA 2JHPA 2ZSDA 1U7TA 2GAJA 5GQSA 3FDXA 5KKAA 3ZWNA 5CH8A 3CX4A 4AMUA 2P4EA 5G2OA 2PLAA 4JLOA 4BVJA 3BL5A 1G4UR 3HSSA 2NVQJ 4HGQA 3P4UA 2XCTB 3WTZA 2VHEA 4JP1A 2R00C 2OKGA 3TBFA 3OZWA 4XL9A 2YHSA 4MQ5A 3PJFA 2ISQA 4L3OA 2DT5A 3JSPA 5DSXA 1XPRA 1LK5A 4QSHA 2VHCA 1HRDA 3CNLA 4YQFA 1F0YA 1C7FA 4AIHA 4NONA 1P3DA 5IYCJ 3OH8A 5L3ZA 5GJCA 4OHMA 3RI4A 3FYSA 4LB5A 2Q4EA 5M5WJ 4OXKA 1B9MA 4JJIA 4I4CA 2J3JA 4ZVVA 5L45A 1L9KA 4K9KA 2NO5A 1Y4ZA 2Y69H 1FX1A 1C2YA 4YRDA 1JQKA 1GEEA 1WWKA 3OZBA 4NAVA 5ALFA 5K3EA 1T3GA 2WJ3A 4BZZA 3CCMI 2CJWB 1OGJA 3HSYA 2I6XA 1I80A 3Q4GA 1Z7LA 1WSAA 4R8MA 3L49A 3ZLTA 4W1RA 1XZEA 1P9WA 2K9QA 1Z4OA 3PLNA 3IKMB 3WG7H 4I6JA 2P75A 4HZUA 1XB4A 1MR3F 3E9CA 1U0GA 2XT0A 4S1TA 1QX4A 2AWOA 2CYCA 4XASA 3H0CA 3DZCA 4M6WB 2RMKA 2QXYA 4KFTA 3B1ZA 1DQUA 1KFJB 3HM9A 1DU0A 1QOZA 4BFVA 1M34B 3UJCA 2BE7A 3VU1A 2B7CA 1XMQB 1PP7U 3T3PB 3OSUA 1T8WA 3O4HA 1BXRB 3E61A 2VF7A 1VHWA 5KHDA 1WS6A 1N2OA 1TU0A 4D42A 3RKXA 4AXXA 1CQWA 1VHDA 4Q00A 3QYPA 4DV1B 4EO9A 1TT0A 3OT4A 5AJTA 3RYPA 4HN9A 1SXHA 1U9CA 1CSEE 3QP5A 1TQHA 2UKDA 3F21A 1R6TA 4E2ZA 2O3QA 1I3NA 1RYHA 4W97A 2DPXA 1B1BA 3S55A 3W1EA 3TCXB 3Q3GE 3R9KA 1M83A 1LDBA 2I2BA 4PSDA 2VRCD 2W1OA 1NE2A 3F3XA 2GRJA 1HDDC 2OG2A 1A9TA 4WWHA 2CEKA 1KYIA 5J3JA 4RBOA 4PINA 5C7OO 1JLHA 4LBWA 1HNZB 2I2FA 2FLWA 3UBTA 2FJ1A 1NVXQ 3KJFA 1U9ZA 1CT9A 5DD4A 2Y68A 1J42A 2OGTA 4DPMA 2ZIXB 1NR7A 2QYTA 1Y48E 1H0MA 1YRWA 2WABA 1K9VF 2R92J 4XM1A 1QIKA 4P3XA 3OEWA 1KR5A 1NBME 2AI2A 4N1AA 4EM2A 3OEED 3LW7A 5K01A 1R0XA 5HF6A 3KRTA 1Y63A 3L1JA 5GIPE 1CS4C 4ZO7A 4AJKA 2Y77A 2Z98A 1KP3A 2VJBA 1KORA 1JT0A 3OLYA 2XB5A 2FPIB 3LZ6A 2PZJA 1UELB 4BU2A 1C8LA 2ZR7A 2A86A 3OYDA 2DBZA 1N1GA 2Q21A 3DGFC 2C7VA 3OZIA 2X14A 1R71A 1XU4A 2XH8A 4PZYA 3WZLA 2OILA 3DWEX 3IDAA 1QP8A 1W2HA 3M6MD 1PV1A 2PH3A 2HX1A 1JKFA 3I3LA 3A9UA 4ARSA 4WXRA 4F8EA 4CH7A 1BXZA 4B44A 3CLSC 1K7FB 2BM9A 1GFWA 2FB9A 1FIUA 4IH1A 1IUYA 4AUXA 3I9V1 5K5OA 3PC6A 1L4NA 4R3NA 2Z1DA 2VKHA 3KJZA 1UAYA 4RIEA 1CF7A 2VPZA 4P55A 2Z9DA 2FPPB 3OTHA 2VONA 3HKDA 4A8JB 4Q19A 3SSAA 5EJ7A 2GFQA 3VPSA 5CDGA 3GLFB 1JVSA 3FHCB 4M3DA 1GCUA 3K0CC 1Y6RA 2STTA 3HOZJ 2D7CA 3U48A 3EVNA 4MRNA 1DKPA 4B4KA 3DDCA 3ZIUA 3BAZA 3RJMA 1GA1A 1NQWA 4HDNA 4G5QA 1Z07A 4DMUB 3OP1A 1JT6A 2YN0A 2FG7C 4YJ3F 2ZSIB 1MO5A 4NDZA 4HZIA 2QQ5A 2GARA 2I33A 3HYCA 5L3VA 2AFIB 4BEJA 2YX7A 2BDEA 4E7IA 3KUDA 4BZXA 3LZCA 3C8UA 1B4AA 5JCZA 4F2PA 1ZX1A 3GDGA 1RRFA 3AXSA 3HSRA 1GY8A 3E81A 4GECA 2O2GA 3C7AA 3GL9A 5B12A 2ZUSA 1Z45A 5KQSA 5EL0A 1RI2A 4N3GA 2PO5A 4KJZA 2O8BA 2IYPA 3MLBA 3IRUA 1REQB 1KSHA 1S3IA 1B72A 4G1MB 5LKAA 2IYSA 2EJUA 1GL7A 4B6OA 5NULA 3GLHE 2XKOA 1C3VA 2V58A 3GBPA 2AZ4A 1R0YA 2V6JA 1X77A 1NJ2A 2XBMA 3T0IA 2GEKA 2J0EA 4BQNA 3COSA 4KPYA 2PI0A 1DX4A 4Q9KA 4AS1A 2K4MA 4GMDA 2EBFX 2HA7A 4Y8VA 4OINF 4D96A 4MR8B 3R0VA 5CFLA 4FSHA 4RULA 2HCBA 3FWYA 3IODA 1EBUA 1LPAB 1NW4A 4B2IA 3I5XA 1JEAA 1YBMA 1Z7YA 3U3RA 3B1KA 4DGQA 3PSHA 5AK0A 3GEDA 3ANLA 3BP8A 1ZN8A 1KAOA 5C80A 2AN5A 3GZNA 2C4HA 1X1SA 4JHLA 2JT1A 4HGZA 1WHTB 3ZK7A 4WBNA 3HM2A 3RPEA 1KDTA 3BD6A 4R9RA 4B3TB 2XE6A 2EQBA 1NMZA 4CE6A 1HZZA 1ECCA 4UE6A 3DFGA 5CVDA 4LY9A 4DMLA 4AWXB 4IPTA 4IILA 1W9MA 1YWGO 3EXAA 2GA1A 1TQ2A 2D74A 1HV8A 621PA 3PLRA 2QU7A 4TS1A 4BXOB 4GL4A 1AGYA 2ZRIA 4DR2B 2OOSA 5KJ1A 4AU7A 4KWIA 4YIHA 3LQRA 1U5BB 4BRSA 1WMSA 5B7GA 3GLVA 1NSFA 2ACJA 3D7LA 2RGUA 1IG7A 3AY7A 1L1EA 3GCDA 1JJFA 3L3BA 3RSLA 4DWJA 2IP1A 1N34B 5A5FA 5LLTA 2GXSA 2D62A 4CLOB 1QZXA 2ID4A 2MINA 3G6EI 3ADCA 1HC8A 3H11A 4YRFA 3E3NA 1IV8A 1XGNA 2VVTA 4L0DA 3VODA 5K8CA 4DADA 3ZKWB 3UWPA 1PJAA 2GJAA 3G0BA 4OU5A 3L2OB 2FRXA 1LRJA 3CSDA 1KYWA 3U37A 1NX6A 4K0RA 1EG7A 4TKUB 4FWIB 2FFBA 4YWJA 3S44A 4ZOEA 3DBLB 2NNLD 1WZUA 1SVNA 5GAHJ 3Q7TA 5KVRA 3UGJA 2CNWD 3HVHA 4C4RA 1WJDA 4XRFA 4I5FA 2VK2A 4HQNA 5CLJA 1SQ5A 2ZATA 5E3NA 2WNIA 1AQJA 3TLBA 3VVLA 2W8BA 5KUTA 3H83A 4X8OA 4ITRC 4IMJB 5IYZF 4Q9HA 1FB5A 1GV1A 2OCKA 1FMFA 3E0XA 2O03A 1QX3A 1KPGA 3R0JA 2CNBA 1KJQA 4UTNA 2H8KA 1CF2O 2DFEA 5TS3A 3SC2B 4HF2A 3JRCA 1U28A 1L5HB 4D3YA 2XCIA 3PC7A 4RMGA 2ZZMA 5L9AA 2BZTA 4LYJA 4F11A 2G5CA 2EEZA 2P2NA 1IO2A 1UPCA 4LSGA 2EBIA 1QYVA 1NMYA 2VTEA 3RC1A 3G17A 3P9NA 3F97A 4GPBA 4YONB 5A4KA 3ILHA 1WO8A 1EHCA 1CZOA 1WMAA 2QF7A 3SQXA 4ADSG 3EXFA 1EEHA 3LSYA 2XRNA 4BNMA 5HJEA 1XUOA 1YI1A 2Y93A 2JA7J 1TQ4A 1J5XA 1A1VA 4YG2F 5FKLA 4F6RA 2CF5A 1X2MA 1KTVA 3PIOF 5HODA 1Q77A 4JB0A 5FTWA 1ZSVA 1SRQA 4KODA 3G2IA 3I45A 4ZREA 1MVOA 1UDCA 3KZNA 4BHPA 2XAHA 4KFUA 1US8A 1DDIA 4ZC3A 4DYDA 4RD4A 2UXNA 3PRJA 1HSZA 3RS3A 1GQQA 3M6XA 2WSMA 3GLUA 1Q14A 5KYNA 3TWOA 1CQJA 2RARA 4DCMA 2C0PA 1XZCA 3CONA 2BZGA 4K28A 2DTDA 5DM70 4XB1A 3O8CA 1QO0A 1X8LA 4BNDB 2CXTA 1DJPA 5EN4A 3CUYA 3EBLA 3K4CA 4NMXB 3G71I 3U13A 3BTLA 3LW8A 1XA4A 1F14A 4WZAB 4KOAA 1SUSA 1U2SA 1ZOSA 2GYYA 1LSSA 1TLTA 1EX6A 3SK0A 2Q4BA 1BC7C 3M1YA 3I8XA 3QM1A 2AXLA 1FY2A 5D4RA 1UJNA 3THSA 3I6BA 2A07F 4GNKA 3RUHA 2ORIA 1C30B 5I9BA 3ESDA 3ZW9A 3CZPA 4XJTA 2YWDA 2I71A 2XHKA 3JW4A 1PJTA 1QRUA 3W5IA 3TNDA 3SZPA 1R8SA 4Y6PA 5HUQA 4D9JA 3RGWS 3NEAA 3I9MA 4Y2PA 1CUJA 3DLBA 4J7CA 1X9IA 3S2GA 1XRRA 4BKMA 2HCJB 5EYPA 1I3AA 1I4TD 2GBGA 1WV0A 2BGCA 1URPA 2XRMA 1E1RA 1YR9A 2LV8A 1SG6A 4B3XA 5FUQA 3LYUA 4PY2A 5EFOA 2HQSA 3NVDA 4XDGA 3AG4H 5CTJA 2K86A 1E0SA 1T43A 3AVOA 2CNLA 4HH3C 1YJWI 2NVXJ 2ZQYA 3V8PA 4AUNA 1P61B 2XUBA 5I4KA 1JKJB 2KQUA 4X63A 2M5WA 2IV3A 3G68A 3CR7A 1F2UB 5EKUA 2GMWA 1RWXA 1W5TA 4C7MA 4Q7JB 1WJGA 2QSYA 3UMMA 5KJ6A 3A6PC 4IFTA 1QC5B 5P21A 2ZSAA 3B1FA 5I7RA 2ESNA 3AQIA 4B83A 4CNBA 3C7KA 2GUGA 1COWA 5DNVA 2MJLA 1BMQA 5FUMA 3N2IA 4WKCA 4OJNA 4OLFA 4ZYVA 2OTLI 2FMLA 4MVJE 3CUSA 2Q6KA 2WU0A 1KF0A 1JDUA 4HX2A 3MQFA 4D43A 3AEKA 3FOEC 3A4MA 3V4ZA 1E3WB 1NI4B 5A2QZ 5HGXA 4LWQA 4MGKR 3F9KA 2FPGA 4DJFC 2WFLA 3ZWBA 4MV4A 4R79A 3CEAA 3CRZA 1IZYA 3FSRA 1OKKA 3A4LA 1IU9A 4UM5A 3WWYA 1VDMA 2NU6B 4ZZ0A 2V7QA 3VNAA 4MHGA 5G1NA 3V4PB 5J1YA 3TFQA 3R8CA 3HFJA 1GXPA 1FU7A 3ZY2A 2PS3A 5E2IA 1XF1A 3A3KA 3O3CA 3WKCA 3WC4A 5DN6D 1U6JA 4FC6A 5KPJA 4F4DA 3BWVA 2QUJA 3IULA 3PR2B 4Z3OA 3ZXXA 2ONKA 2GIZA 5BW8A 3ZNNA 4MARA 3QE9Y 3F3YA 2IA5A 1SB9A 4MYHA 1M7GA 4PSCA 3EGCA 4F85A 1P0MA 3U9LA 4ICIA 5AOCA 3TIVA 2ZM5A 2ZTSA 4UVGA 1FDIA 2XMGA 2LKXA 4ZICA 1NXOA 4RV4A 4DDMA 2EFHB 5TIIA 1PUXA 3GA7A 4L4YA 4J0CA 4GUDA 1HF0A 4S0ZA 4YJDA 4JV5B 4DG9A 4FYMA 1X1QA 3TGNA 5SZJA 5DNDA 3BICA 4I8DA 3WI7A 3SSNA 3IXQA 3DT6A 4I76A 4G9EA 1SJ9A 1DP7P 4EI2A 3KSDO 4BO7A 5CDHA 3RHSA 3VAYA 1B6GA 4D9HA 4QHTA 1KRHA 3PENA 4GG1A 4Y0VA 3EG9A 1H2WA 2ZU0C 3SIPA 1M73E 4PX2A 2B61A 4HZUB 3SR0A 4JR1A 2UVQA 1RRVA 4GICA 1KU9A 3BHIA 1VQ7I 4UHCA 1R6AA 2HL6A 3JAMK 4BO9A 3VPGA 3DVSX 1NVFA 2I87A 2XRZA 4JJ4A 3VTZA 3MEXA 2BVNA 1GLVA 2BONA 1JA0A 1UK9A 4IXDA 3RUEA 1Y3FE 3VTAA 3HHGA 1GNQA 3HH8A 3KEFA 3ROFA 4YP9A 3FDFA 1VFCA 2C7BA 4BV2A 3USCS 3GP5A 2GBIA 3MJRA 4NHEA 2ZPUA 1XTPA 3LUHA 2HUNA 3GJ3A 2QN3A 2XR1A 1G3RA 5ILQA 2DWUA 3PT5A 2HQRA 4EGZA 4LWOA 3PD7A 2K27A 1I94B 3AF2A 3Q7EA 3UG7A 2ZLBA 5EXSA 1UQUA 4MWGA 2ONJA 3QX7A 1J99A 4ESJA 3LAWA 4BQOA 1EIWA 5JCOC 2ZANA 1C50A 1GGNA 1U9OA 4DSUA 3D4OA 3KZOA 3Q8XB 1N0UA 3WTWC 2GEVA 4LYYA 2VJOA 3JYQA 5DLYA 3HSKA 4KXYA 1QVUA 1T5LA 1H89C 3IYLW 5DX0A 1TF5A 1FLNA 4W5WA 3IC7A 3BB1A 4IL5A 4CMJA 2FZEA 4R6WA 3NKFA 3EF0A 3RS8A 4LF5B 1ESMA 1XJ0A 5AM4A 2J3QA 4C88A 2KLBA 4DS3A 1E9SA 1QLJA 3SYRA 3R76A 1EWTA 3V8VA 1WMEA 4UUAA 1X19A 5FHRA 3T3HA 1T3SA 4B73A 1RXYA 3CS3A 2QAJA 3EPKA 4YJHA 1NG1A 4N5HX 1L5WA 1E6CA 2OESA 1TKBA 1EZ4A 3MINA 3GTOJ 1HX7A 1Z7WA 4QPDA 2H17A 1DJQA 4X1KA 1AGRA 1DXYA 2XNKA 3R7NA 3M81A 3H04A 1H2HA 1SH7A 2EFCB 3A1TA 5K8VA 3G2KA 3PXGA 4HB4A 1I5OA 5FTMA 4TRMA 2IP4A 5FHQA 3V1TC 1J8FA 2BGLA 3VOBA 2V7EA 1V55H 1V4VA 2P8JA 5IF3A 2F5DA 3OOUA 3W2TA 1IK6A 3I04A 1X74A 3LSPA 4RFSA 3BR1A 2IEGA 1JAIA 3KKEA 4CDMA 4LTNA 4MRRA 3M70A 2C00A 2A5GA 4LKRA 1TWCJ 2Q8KA 5DBEX 3IH2A 1FFBA 1PD1A 2H1RA 1CY6A 3ROEA 1R16A 2CL0X 4KXUA 1CF7B 4M3FA 4CCYA 2LOOA 1PFKA 3HKDB 1YJAA 4FGKA 4B87A 5IXYA 3GI1A 4Q6BA 4WNCA 3EETA 4WOJA 1O7JA 1E7SA 3N59A 3BG7A 3EXHA 1UJ2A 4DIQA 4GYKA 4HLUA 4C89A 5JNWA 2LKDA 2QNRA 5DFAA 2G3YA 1EQAA 2ZUFA 4G5SA 2XODA 5K1YA 1IVYA 5H6QA 3PFIA 3FZQA 1K5HA 4HDNB 1NP3A 2M6KA 4FHCA 1MNMC 1SIOA 5JJLA 3ZOKA 1VZ0A 2JJ1A 4F9FA 5TGTA 4TL7A 4D9NA 3RTEA 2GHIA 3EVBA 2Y0EA 3VR2A 3HGQA 4KLAA 3VPFA 1Y1RA 5DT2A 2HDWA 2WTUA 1E9FA 2ZJZA 1DELA 2YUIA 1L5OA 4PQGA 2XDYA 2ECKA 2R6ZA 2QG4A 4HO1X 5ES3A 3RS7A 2H1SA 1WSDA 2CB9A 1ORKA 2OY0A 2GH1A 4R41A 2O8BB 4RY9A 1PP8F 2RBEA 3NP9A 4LJ8A 1B72B 5CGQB 4ZI7A 4DG5A 5DP1A 1EU1A 2PXCA 2WU4A 4JL5A 1MO6A 4NG5A 1MBKA 3OAAA 3PDJA 5I3ZA 1JIQA 4WKNA 3ZWPA 4NYJR 1JZTA 3HDVA 2WKSA 2X6QA 2FX3A 4LYGA 2FJ0A 4GPTA 1M5UA 1U7HA 5HTOA 1GCOA 5IM4F 1OPCA 1LF0A 2A0WA 3I6MA 2VDJA 5I47A 1BA2A 1M0EA 2EIKH 5JRZA 4K88A 4FDAA 2LC2A 1TU4A 4GX0A 5LM3A 1O3RA 1FMLA 1XMKA 2RI0A 4AIIA 1PS9A 4OBEA 1S3JA 4RA2A 1J49A 4DPKA 3M4YA 3VJRA 3GZNB 2WFMA 2KL4A 4M87A 1PLJA 4WBNB 2QV7A 4LEIA 2X9DA 1A5SB 2V03A 4B7CA 4FEEA 3AG5A 2RJNA 3VSKA 4A12A 4MS4A 1Q2UA 1TW3A 3PVCA 5LEKA 3O3NB 1I5EA 1DDOA 4POAA 3NT4A 3IOBA 2QPTA 2Z8YM 4CODB 3RQ4A 5DOVA 3V4GA 2I7TA 4G0PA 3BH7A 2D5AA 4MH0R 1Q1HA 4KE8A 4PQYA 1ZHOA 4J91A 4LX0A 5KHOC 1NNSA 1E6WA 4ZOAA 2NQ8A 3L7LA 1U63A 2J3HA 4KO3S 2BEUA 4U2EA 4D8VA 3AXTA 1DMRA 3L8CA 2IXEA 4ZVOA 1NKTA 2P5UA 4RL4A 3BWMA 1PFYA 3WK8A 3LS2A 3D7RA 1VTNC 1MW9X 2JC3A 3D8NA 4KSBA 3UCFA 5J23A 3MHPA 1LUAA 1LTKA 2M1XA 3LOQA 3QOYA 3R4KA 1RZUA 2W57A 2W70A 2R7OA 2VG8A 3SQDA 2Q5OA 3LA7A 1ZELA 3RWOA 1DPGA 2MINB 4D0RA 1IJKA 4EVIA 3FNQA 3H11B 4MP3A 1DRVA 4CUJA 4I2NA 1TAHA 1PNQA 5H20A 3ZHCA 3LSHA 2DMTA 4PBSA 1XTUA 1TTHA 1EA5A 3OCYA 5EJEA 4UATA 1B8IA 2R7NA 2M8EA 1J5PA 3V8JA 3VO9A 4IQ8A 3RYIA 2ECQA 4EHIA 5ILGA 2MYTA 1FVOA 5HJ5A 2CY0A 2X77A 1FXWA 1BVYF 2GLOA 5GINE 5D6EA 2QAGA 5LNK1 4TMZA 3V46A 1K6MA 2W8BB 3DYVA 3GFQA 4D4LA 4NESA 3P71T 1DS6A 1X42A 5A3VA 2J0UA 2Y4OA 4OLHA 5JJKA 1G7RA 3GZ4A 2H2FA 4WK8F 3EPLA 1LNQA 4DQ2A 2DMNA 3WRVA 3HJHA 3N2NA 1I3LA 2DU8A 2AL7A 4B46A 3U1BA 3FUUA 3LCUA 3PVZA 5EPUA 3KQVA 1B6AA 3CKKA 5LJIA 5E3JA 4UNRA 3JQQA 4AZVA 3TDZC 3G1LA 5J2TA 2UZKA 3CNNA 2D1TA 2D2VA 5EJ4A 1B16A 3L2UA 3K0EA 1NW5A 1AQUA 3OQMA 2BGJA 3R5KA 4NATA 3M5CA 4BVGA 3FPKA 3EXFB 4HA8A 4DA6A 4PCQA 5KSYA 3ASYA 1HPLA 4NV1A 4DCGA 4F6RB 2JASA 1PT9A 2XX3A 3HXKA 5KOYA 2R8OA 1UZCA 2PUHA 1TFRA 3IEPA 2J9FA 1MMSA 2ASVA 3I6IA 2OZLA 2R9VA 3CWZA 3U4IA 3IVXA 1PWEA 3HGYA 2W2XA 4B09A 4NEGA 1Q95A 2W4IA 1US8B 5TRDA 3DQZA 3P9ZA 5A02A 3PGMA 3S8MA 2IXSA 2UZAA 3AB8A 3JQAA 4ARAA 4OA8A 4IDNA 2E5NA 4MRMA 4PHGA 5FBQB 4R40A 3SICE 1CQJB 3CKMA 3PNOA 4G5FA 2JGNA 4A10A 2Q0OA 1M6HA 2WM3A 4W8OA 5FPTA 4S12A 4ZJYA 1U0FA 4XSZF 3CMMA 2PUDA 3BCAA 1EE1A 3FSGD 3OKPA 4NMHA 2PWYA 5C51B 3HYSA 3AL0C 2X0RA 4TSRA 3WAKA 1IV6A 2RGRA 2ZIVB 3VI3B 3EXEA 2FDXA 5M04A 4ALKA 4ENTA 1FQJA 1YU6A 1MF7A 3ZX5A 2H52A 1YJ5A 4MEBA 2BAGA 2DPDA 2VDNB 3AEQA 4P9UA 4MIMA 4Q05A 3S8EA 4MULA 1LPSA 3V4RA 1PU2A 2VQGA 1ECJA 1D04A 3DTKA 1Y9ZA 3AQ4A 3DZJA 3HI6A 4LA4A 3K9QO 5IAKA 1RAAA 1CRLA 3C7TA 1RFLA 4LXYA 4IP0A 3I4CA 2O0LA 1XHEA 5EYPB 4G8XA 1E1QA 3QPBA 1THTA 5FRDA 2KSQA 1NZJA 4L5IA 4RFLA 4X5OA 2E55A 2OTJI 4GF5A 3L0OA 1NQTA 3BH6A 4IMIB 3MTAA 3PUYA 4ER6A 5EJMA 1OAAA 5AI0A 1O2DA 3VAZA 3I6YA 4JSRA 1TQ8A 1JAYA 1EX7A 3MJCA 5EP2A 5BPIA 1Y8QA 2QJOA 3D5SC 2TDXA 4WUVA 4OQEA 4QARA 5DTIA 3EQZA 3OZUA 3L0IB 3EBPA 2WJ6A 2EW2A 4AZWA 4YB8A 5HOOA 1TLLA 4I6GA 1C9KA 4RM2A 3G9ZA 3J7AC 3ED1A 4OI2A 4ZD6A 4TL6A 4L1KA 1N0WA 1UKVY 5EP3A 2OJED 2JWTA 2IHBA 3KJIA 3GRPA 3FCYA 3EEFA 4RPKA 5BR1A 1RKVA 3AEKB 3ONNA 4UXIA 3NUQA 2WZBA 1KBOA 4ZYXA 2Y71A 1JDBC 2P5YA 2RK4A 4Y1FA 2DQZA 2CHUA 3A6JA 1G5QA 1JYSA 2FPGB 4EB0A 1CRZA 2HF8A 3C3JA 2WFLB 4JZYA 4IV5A 3BHJA 4EJMA 4O0LA 3N2KA 4ZTZB 4B8XA 3DKXA 1PDOA 4ITUA 3FWHA 2O2ZA 3M6WA 2EQRA 1CRQA 1Y1SA 1Q0QA 1NQUA 3ETGA 3AHGA 2VP4A 1EXVA 2VJLA 4ZQIA 3VYVA 4HPXB 2IBSA 3AJAA 4ENUA 1WUJS 2IHTA 4C0WA 4OHPA 1P9RA 3H5IA 2RHHA 1G7SA 1SZPA 1R6VA 2IOFK 1L4FA 2Q4DA 2WA0A 1H05A 4A8TA 3HLTA 3FI0A 3G82C 3RVSA 1M0WA 3F8NA 3RC9A 2BHTA 5KNDH 3E5HA 4R7GA 3P2YA 2BDTA 1FLAA 2M0MA 2GQQA 1KQ9A 5AHOA 3PJDA 3C3MA 1A69A 1T6YA 4MA0A 1G291 3KJHA 4JGIA 4RU1A 5C8YF 2CFIA 3L0BA 2J1LA 4LV6A 2SCUA 1K68A 1U31A 1UDRA 4OHCA 3A06A 1E9CA 4E7OA 4FX4A 1Q57A 4ALMA 1JPNA 5TEVA 4Z0HO 5DRYA 1YL7A 1VPEA 1LVHA 3TTWA 2D7JA 4HS4A 3EG9B 1WP9A 4IZZA 2R8BA 3OCZA 2B1GA 3I1FA 3G9TA 3VPAA 4F60A 1RACA 4MVJM 2AFHA 4E5YA 4WSOA 2WWHA 1O03A 3LDHA 3OYBA 4WN9A 2Z1MA 5FO1A 2VPTA 3QWLA 1EKXA 4LIUA 3DHEA 3EBOA 1S3FA 1N1EA 3OFKA 1FUEA 1A9XA 2VAXA 3O26A 1E5TA 3R40A 4O02B 5ALGA 2O52A 4M9UA 3HP4A 1PQWA 2NXEA 3SY8A 3IP7A 4P2BA 3TFWA 4I6ZA 4BJ1A 2OV2A 1YAHA 3TX6A 5I7WA 1QDUA 1YTLA 4LV5B 2QYSA 1SIUA 3ZE0B 5G0WA 5THQA 2AG1A 3NM5A 2QVZX 4DCPA 3G7NA 1AXRA 1Z0SA 4LECA 4I5DA 4HEJA 3HLYA 4UOQA 2DI3A 4CM9A 1YACA 4RD2A 1PF7E 2FLKA 1U0BB 4QPNA 1CY7A 3DSRA 1TVKA 4Z3KA 1BZYA 2P7HA 1D0SA 3K4PA 1QJCA 2WWFA 3ZDYB 3TPCA 2DLDA 1Y1KE 2FTKE 2NQ2C 2X0IA 1L5ZA 4KIJA 4C4YA 3CV3A 1QVWA 2WV7A 2VZ0A 1O96A 5K2MA 2ATXA 1UXHA 2V5UA 3NQOA 5M5BA 2CSOA 2WAEA 3DPLC 1LTQA 4XDYA 3L2RA 3IEVA 3ET4A 3P9IA 2ZJ2A 1NOKA 4KQ1A 3WA6A 1L5RA 1P1RA 4RLQA 4KMFA 1X7ZA 5DNUA 4DUYB 3UK0A 4YJHB 4TV8A 3FR8A 1WY5A 2YXBA 3SVTA 1YJCA 2A6PA 4LXHA 3MINB 1S6LA 4X1KB 4JC8A 2RKHA 3E3MA 4EHAA 4YO7A 2Z95A 1KETA 5BWMA 2R47A 1CCWA 1O58A 4LS3A 5TJ9A 5IP5A 1EXWA 4Q16A 1DEAA 4Q3AA 5L3RA 3V8NA 4MLZA 4L5EA 3E35A 4ZJZA 3DTEA 3J81K 4RFSB 3JRFA 1MPTA 2OD2A 2ZBVA 4IL6C 1XTBA 2RJ3A 1K08A 4FGLA 4KLNA 4XSHA 5B1EA 1ZRCA 1P7PA 3EOAI 1GRCA 2EK5A 3KLPX 4FXPA 1MFZA 1QPZA 4F96A 3UJBA 1VF9A 3OLVA 2W00A 2FSPA 5F2EA 1PEDA 4LZLA 1E7WA 4KAFA 1A97A 4RVDA 2QTBA 4RGSA 4CCYB 1DEXA 4UCFA 1R1UA 3EY9A