4A6DA

Crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
347
structure length
345
Chain Sequence
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARKGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HYDROXYINDOLE O-METHYLTRANSFERASE
total genus 124
structure length 345
sequence length 347
ec nomenclature ec 2.1.1.4: Acetylserotonin O-methyltransferase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF16864 Dimerisation2 Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a6dA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4a6dA02
2AS5F 3ABTA 2IH2A 1YG2A 5L3EA 3AY0A 2AN4A 3NMUF 3KQQA 4ZTBA 1G38A 2BM9A 3ELYA 4KN4X 2ONYA 3BJAA 4O6JA 1HMYA 2XAQA 3E3VA 3E6CC 5EMLA 2COMA 4C04A 2G7HA 2PWYA 1L3LA 3LDFA 3FUXA 3EETA 2OKCA 4UV9A 1FOKA 2BR5A 3ELUA 2PT6A 5DUIA 2V6CA 2W85A 2G1PA 3WU0A 3F6OA 5DSTA 2B3TA 2LDUA 4TV7A 4YUWA 1JTEA 2ESHA 2D1HA 2XUBA 2EV5A 3LA3A 2AVNA 4CZZA 3BGIA 2JPBA 1JR4A 3KPJA 2Z6AA 1R1VA 2L02A 1MZBA 2NXNA 5P8WA 5E1MA 4BXUA 4OBWA 3QAHA 4FT2A 4PYQA 1PP8F 3S2WA 2K86A 1Z3CA 3LQQA 4HG2A 4M71A 5E8RA 1XMKA 4KWCA 2DBBA 2RKHA 3GXOA 1X1DA 1WXWA 2OBPA 3OZTA 2IH4A 3BPXA 2EJTA 3LWFA 3R3HA 1EJ6A 3TO9A 4DCGA 3RPQA 4DA4A 1CGPA 4G94A 1F5TA 2FYTA 2IP2A 3GZ6A 3QOWA 1DL5A 2YR0A 2H27A 2H6BA 4U7PB 2PJDA 3GZ5A 1T39A 1J59A 2STWA 3UBTA 4L7VA 3KPYA 10MHA 4Y13A 4XUCA 2FNPA 1YB2A 5E9QA 2LNBA 4YV2A 4C06A 3DXJF 2YXLA 1FLIA 2KKOA 5MHTA 2NP6A 4CDGA 5LEKA 4Z2YA 1U5TC 4HLYA 4WXCA 5ED4A 4EJUA 5DLYA 3T7RA 3P2IA 4ER0A 1U6GA 2E5WA 4M38A 4PYKA 2AR0A 2XAHA 4PYIA 3RKWA 2X4HA 2Z6UA 2HMYB 3PVCA 2YXDA 1JG1A 2R7DA 2GPYA 3RW9A 3COAC 3E97A 4X60A 3WSTA 4KDPA 3GJYA 2XVAA 1M6EX 5GIPE 4HRAA 1PRYA 3I0TA 5C0OE 3NWEA 2PY6A 4M9ZA 4X61A 1PJZA 5J8CA 3I5UA 2P40A 3ID6C 5FQNA 2O57A 4B09A 3FXQA 3L8DA 4A12A 1EV7A 3N97A 3CUQB 5K0FA 3K1PA 5GINE 4O5VA 2IFTA 3DMFA 2F5CA 2MLKA 4XSXF 1QBJA 2EK5A 1I1SA 3MAJA 2HV9A 3DR5A 3KQPA 2ZBPA 3EGVA 5E8JA 5AONA 1T38A 3B3GA 4PYMA 3TFWA 3HSEA 1GXQA 5U4XA 4FP9A 2FU4A 2QUFA 2WV0A 5GWXA 2A69F 3AXTA 2VOPA 1R8YA 3LGAA 1R18A 2NRAC 1TQIA 2NNWB 3CDHA 2DQRA 4BLWA 4BHPA 5T67A 3DPTA 5CVJA 2C6YA 3J80Z 1YW8A 2EB7A 3EVZA 4RTMA 4EJWA 1D2CA 2YX4A 4BHBA 1NV9A 2DULA 1YW7A 2P1DA 4I0AA 3C3YA 4QQKA 1T43A 5CVDA 2AOUB 1K79A 4LECA 2RNJA 4AVPA 3QPHA 1FZPB 1WY7A 3U81A 2W24A 4M72A 1L9KA 4DMGA 1SKMA 1MD0A 3LAJA 3LCVB 1B42A 2G72A 3P71T 1BC5A 2YR2A 1NBIA 3EMBA 1TW3A 2F5FA 5E2AA 4ENNA 4HLXA 5BPDA 4GO1A 5DDGA 4IV0A 5LR6A 4CWAA 4AUKA 3TKYA 4ER5A 3PQJA 5DRTA 5K0NA 1FNNA 2AOUA 4MHGA 4MQ9F 4HSGA 2P41A 3M1EA 3WTTC 1FSEA 2PX5A 2ZMEA 2PI0A 4RWZA 3PX3A 2HOEA 1F38A 5F2NA 1XB4A 3A4TA 5DWQA 5CD1A 2IVMA 2GA1A 4YIFA 2ZFUA 3C0KA 4RB0A 3PFHA 1WRJA 4P96A 5FWDA 1WQ2A 1LNWA 5H02A 1QPMA 4XLPF 2OU2A 1ONVA 3E8SA 1XDUA 3SMQA 4WXDA 2AXLA 1DCTA 1VQ1A 3KR1A 2GXGA 5J8FA 2FMLA 2BR4A 3NWBA 2O6GE 2ADMA 4Y15A 3HIFA 5D5WB 1O9GA 1S7AA 2JTVA 1BOAA 2A07F 1XCJA 1LB2A 4M36A 4MQ4A 3CLOA 3FX3A 1I1GA 3QP5A 2IDJA 3GRYA 2ONZA 3MTEA 1QQIA 2HS5A 2RQPA 2RC4A 2KJCA 2BZGA 3ELDA 4G9YA 1ZN2A 2HGCA 2VDWA 4PGGA 3TRKA 1STZA 3ZMTA 2GWRA 4KMFA 3KQSA 4JXJA 5HLIA 1KR5A 5LGUA 2V74B 3M70A 4CKEA 4QVGA 3L00A 2YPRA 2OBFA 4AZTA 4HYEA 1IRFA 5GOZA 4N9IA 4GOMD 1UHMA 3KCCA 3HEMA 1NBHA 1KA8A 4L5JA 5CCBA 1S7OA 1Z91A 4BY9E 2CWWA 5BQTA 1L0OC 4CGZA 2IA1A 4RTNA 2A3SA 4L0YB 5FADA 5EKXA 1O9HA 4DNCA 1R36A 4HV5A 3BWCA 1ORIA 1RUOA 3O2PE 2H94A 5F2OA 1HBXG 4PYNA 3PT9A 5K0BA 4NECA 3NQOA 5CCXA 2ZCJA 4MTDA 3HCCA 3KZZA 3FRIA 3KPWA 3UJBA 3DV8A 3M6WA 1RIOH 1UHWA 1QAMA 3TQSA 3EMDA 4QQNA 2EFPA 4PWYA 3MAGA 5FB2A 2EFOA 3ZMVA 2L01A 2IBSA 3V8JA 2ZZNA 1RI2A 2EX4A 3QOXA 2O8XA 4YMHA 2XYRA 4HOBA 1WKMA 1EH7A 3M7GA 3JSPA 2OZVA 3CJTA 5FA5A 5KQRA 2IA2A 2PSSA 5CVRA 3E6DA 3UJ9A 1VL5A 2A6HF 2VXZA 3HA5A 5JR3A 1SD5A 5HIIA 3ELKA 2YX1A 4O29A 4KIBA 3TO7A 2FOKA 4UNOA 5DM4A 2V9VA 1FYLA 1YUBA 2YVLA 4KN7X 5LQUA 5DX8A 2OB2A 2ZWAA 3ZMSA 4EJTA 1H0MA 3A27A 4HX4A 2VDVE 4FR0A 4PCAA 5HDGA 1Z1DA 4GEKA 4AIKA 3FMRA 4RTOA 2HYGD 3KP5A 1KQ9A 1IXSB 2QQBA 2ZTHA 3TGNA 2R6ZA 2OQGA 5EEHA 3BWMA 2C7QA 1AOYA 3EYYA 1KU7A 3LSTA 3KEOA 5H6QA 3G7UA 4RGRA 2C7PA 5HS8A 1XTPA 2FE3A 1H9GA 3ERED 2N47A 2P7HA 5EMJA 5K5QA 4ENMA 4AD9A 5D5XB 1R5GA 3AAFA 3RDIA 4HX7A 2NP7A 5ERIA 2CO5A 4UVBA 1N7IA 3T0IA 1MHTA 1FY7A 4DQ2A 2A14A 3KR2A 3DEUA 2ZWVA 3H3ZA 1L3IA 1EH8A 2GAUA 2IIPA 1YW9A 4POOA 1YS7A 1V4RA 4ZH4F 5IH3A 2DI3A 3WGGA 2JH9A 5FLXK 2FPOA 2ZKZA 1FX7A 1G8SA 3TDZC 1FSHA 4F84A 2Z33A 2FHPA 1ZYRF 3EVFA 5CVEA 3GX4X 3IKTA 3KFWX 1O54A 4FX0A 2QY6A 1EJ0A 3RTRA 5CVVA 3QV2A 3EPPA 2VODA 1SAXA 3CJNA 3E5UA 1IXKA 1LJ9A 2PG4A 2XVCA 2Z3YA 2ZZMA 1F4KA 4IF4A 1FPQA 1HW1A 1L3BA 4IRHA 3B3JA 2P7CB 1U2WA 1FJXA 1Y8CA 1DP7P 5IT9K 2I6GA 4K2EA 3VC1A 3KPVA 2HQRA 1X1BA 3H2BA 4K6MA 3HVHA 1VIDA 3GW2A 4KRGA 5L3DA 3NVMB 2V1XA 1G4DA 3C6KA 1FBQA 4OQDA 4ETSA 4QDKA 1LEBA 4PIMA 5D8KB 1ZQ9A 5JUWA 1ORHA 2ESNA 3IKVA 3J7AO 3CBGA 3KETA 5EC8A 2UYHA 1KPIA 3R0AA 2A61A 4RAYA 4GQBA 4OIRF 3HVIA 4FGZA 2YSRA 1ZGAA 2XIGA 3EVDA 3D2LA 1IY9A 5T64A 4ZYEA 2Z99A 2K27A 1SD4A 2ZNZA 4B8XA 1OMIA 3H3UA 4GF5A 4P7JA 3KHKA 1R1TA 2WWYA 1SG9A 2PX2A 2QRVB 2QRVA 3DULA 3FHZA 4OBXA 1BIBA 3ZMZA 2HZTA 4OQEA 4L0ZB 4OIPF 2ZMEB 4B17A 4EGYA 1YS6A 5FFZA 1KPGA 1R58A 4D0PA 2ZULA 4PCLA 3KP3A 2EJRA 5D4RA 1O3RA 5DD8A 1VTNC 3BKWA 2QBYA 2ZJ2A 2O61A 3BWYA 3M6VA 1SMTA 2NNYA 3BP8A 1XGSA 4EM1A 1I27A 2E7WA 5CM2Z 3SQNA 4EJVA 2PMUA 4EMSA 1I4WA 1XN7A 3DXYA 3FTEA 3JAMZ 1D5VA 3KP7A 3NEUA 5E1XA 5LGTA 5BP7A 1IW7F 1SMYF 4PNEA 5E17F 2ZBKA 3SXJA 4QPNA 1FBSA 3CKKA 1U8RA 2AVDA 3OFKA 2LF8A 3L7WA 1ZRDA 2HR1A 4E2ZA 3PS9A 2HWKA 2UZKA 2O3FA 2KW5A 5H6RA 4RVHA 4I0BA 3IV6A 4U7DA 3DFGA 3P9KA 4IRIA 4HGZA 1LDJA 1ZKDA 3SSMA 4E2YA 2NYUA 1OYYA 3FUTA 4EKGA 2HNKA 3CJQA 2GB4A 1C0WA 4YG2F 1P4WA 3R6TA 1CF7B 2CW0F 9MHTA 3CO7C 3P9IA 1RNLA 1O3SA 3JWGA 3BPVA 2VBXA 1QYRA 1YIOA 2PX4A 2WC2A 1R6AA 2VT2A 3WODF 1IN5A 5CJ9A 2K4MA 1ZG1A 5KVRA 3LQRA 4HH4A 2ORED 4UV8A 4E2WA 3OZRA 2BV6A 2DQLA 3EDPA 2Q2EA 3R9XB 4BP1A 2DFIA 3OV8A 3HSRA 1M0EA 2FXAA 4CXFA 4A0YA 3ME5A 3M4XA 2H00A 3V7RA 4L9TA 1XCBA 1YQAA 3RKYA 2B2CA 1G6Q1 2ZSUA 4M7RA 2P5LC 4HQEA 3PQKA 4FSDA 3C3PA 3THSA 3L2CA 3BWGA 2VC0A 1HW5A 5ICGA 2EA4A 1TPYA 4KYWA 4ATNA 4A6EA 1ZG5A 1ON2A 2DAOA 1XGMA 3GLXA 5EG5A 3CUOA 2DPUA 3VYWA 2ZIEA 8MHTA 5EIFA 3ABUA 4L9NA 2VDUE 1JTFA 4UOEA 4OMZA 4R1HA 3G8BA 4U88A 3OE5A 1NT2A 3FTFA 2ERCA 4MHTA 1XSDA 3GYHX 1UB9A 5DXAA 3K6RA 1Q0SA 5EMMA 3GFMA 1P92A 3DOUA 1QZZA 3IWZA 3O3KA 4BLUA 1LEAA 1MDMB 2JG3A 4LK1F 4LGWA 3SR4A 1S6LA 1NE2A 1J0RA 1TQMA 3QOPA 3FXRA 3ORHA 5JHUA 3JTHA 3F6VA 2FBHA 5G02A 3KKZA 4YUZA 2NS0A 2ISZA 3P8ZA 5GP1A 4RTPA 2YU3A 3IHTA 5A2QK 4GOOD 4ER3A 3I59A 5BS6A 2ZIFA 4GC9A 3LA7A 4MEYF 3ELWA 4RTKA 3QU3A 3HOTA 1I1NA 1YTYA 1FP1D 3K2ZA 2ZBRA 3GFIA 3O4FA 2XKPA 3WTYC 1ZH5A 3FYCA 4P5OA 2HR3A 1WWXA 2I62A 5HLGA 3MZYA 2ZBQA 4MEXF 2KIMA 3RI4A 5E18F 2I7CA 2GA2A 2HTEA 2FA5A 2OZ6A 5EZQA 1O57A 5ICCA 5D6FA 4CYDA 4I98B 4G6QA 5EOVA 4ESFA 2CWEA 2NAZA 2K4BA 5DCFA 2PGXA 3O6BB 1O7LA 1JQEA 4DM3A 4EV0A 2ACJA 3NTVA 2XHKA 1I9GA 3FWEA 2GXBA 3VOEA 5K0GA 3E23A 5BXYA 3LCUA 3KLNA 3FUVA 3EGIA 1X3UA 2YXEA 4LLLA 3VSEA 3HHHA 4O3MA 2Y48A 3T0YA 3T1BA 4PYLA 3K0LA 3KP4A 1GXPA 1ZRCA 1XD7A 4BHCA 1DPUA 1J2XA 4NB5A 1DUSA 1UCRA 5K0LA 5CUQA 3C3WA 4PYOA 5KVAA 1P4AA 3UJ6A 4LMYA 3KR9A 2Y0MA 4P55A 2DPDA 3GU3A 5LHHA 3UA3A 3VEPA 4R6WA 4LB6B 5ICFA 1Y0UA 2WTEA 1WZNA 4Q4ZF 1B9MA 4WX9A 2H09A 2GQQA 2RV8A 4FSXA 2L4AA 3AWIA 3GO5A 4Y30A 2DO7A 3U9GA 2GH1A 1Q1HA 3R60A 4YFKF 3BT7A 2LKPA 3G3ZA 3OOPA 1VPTA 3DMGA 1OR7A 1JE8A 1AWCA 3QU6A 1R23A 5L3GA 3BXOA 3HYIA 4JQFA 4E30A 4IJAA 3C18A 4G6DA 5LQAA 5K1YA 1ON1A 2MD5A 2O0LA 3BJ6A 4ZYGA 2J5OA 4BLVA 1BC7C 2IBTA 2PX8A 3RODA 4GYIA 5F2KA 2PWPA 4MQVA 4RVDA 4XRFA 1KHHA 4XBFA 1TQPA 4JK1X 4MTEA 2QYOA 4I7HA 3B3FA 3ZN1A 3R0JA 4LG0B 5BW4A 3LX6A 1ZG3A 3I64A 4RVFA 1S8NA 2E7XA 3MQ2A 1YZ3A 1P4XA 3GWZA 4RB2C 1WXXA 3Q9SA 5GM2A 3BJOA 2PN6A 5D1NA 1LDKB 2CMGA 5E1OA 1JQDA 2MH2A 1R00A 3GGDA 4E2XA 1NHAA 5HLHA 3Q5FA 3SHFA 5FUBA 2IH5A 3TOAA 3JWHA 5DT2A 4FT8A 5HS7A 4RTSA 3IHUA 4GBED 1W7PB 2AZTA 3SZTA 4OIOF 5FA8A 1IN4A 4CICA 1USSA 4RB1A 5ILVA 3HA3A 5IT9Z 1JG4A 1X19A 3M33A 1TW2A 2EFNA 7MHTA 5FULA 3LDGA 3GF2A 3MGGA 2CQKA 2OB1A 4OA5A 4F85A 4YV1A 1W5TA 3OCJA 3WGHA 5FQOA 2PBFA 6PAXA 1D2GA 3OZSA 1NV8A 3ANXA 2XRNA 1M6YA 2OO3A 2W25A 3M8FA 3MQ0A 1GVJA 1RJEA 5E9JA 2C7OA 1Z7UA 3I59B 2AOTB 2PXAA 2Z5UA 4S04A 2EV6A 4LLGF 3TO6A 4HDUA 2OXTA 3MTIA 4Q48A 1LVAA 4LLNA 3SM3A 3FTDA 5HS9A 4ESBA 2GA9A 2VS1A 2BGCA 2NXCA 4QTTB 1AF7A 3LKZA 4RAZA 1ODDA 1XSXA 3LAPA 3B02A 5D4SA 3GNLA 4I01A 2Q41A 4GOND 1ZARA 1NW6A 1FC3A 1BJAA 5HDNA 4HX8A 2F8LA 3HRTA 2ZLBA 3LBFA 1FYMA 2P8TA 4U0VA 3W6KB 3NDIA 5DEQA 5DTMA 2H6CA 3QRFF 5JFRA 3KQVA 3E05A 3M6UA 5LBQA 1G6NA 1MKMA 2O0YA 3MWMA 1AQIA 2ZZKA 1ZAOA 1OYIA 1EAMA 2BE5F 3K0BA 3KE2A 4YUXA 1UFKA 3HRUA 1IF1A 4R8HA 3F22A 3G88A 4N0BA 5FCDA 1K6OA 3DH0A 3DLIA 5HZMA 1F3LA 4I09A 4EM0B 4G7ZF 2XGXA 2MH9A 2RDPA 5AIPA 3LCCA 2CG4A 4RTQA 2CKDA 3EVAA 3PFIA 2O03A 2WK1A 5K0CA 1K7AA 3B7PA 2HTSA 2J5PA 2PV0A 3V8LA 4FX4A 5K0JA 1KYZA 2K02A 3MZHA 5K09A 2JJQA 1J5YA 3TQNA 1IN7A 3RJPA 4QTUB 3G2PA 2G9WA 2IJLA 5DCMA 1WSUA 1RZ4A 5CVUA 2P7VB 2CFXA 4IPAA 3DLCA 1KIAA 4DQ0A 3ROUA 3C7JA 4RYLA 4KA4A 5IKMA 3CCFA 3VFZA 2JHCA 2D45A 1DUXC 1VE3A 4MIKA 2L54A 5HIKA 5LRSA 2IPXA 4H0EA 5E9WA 2EFWA 5T6BA 5LQKA 3FZVA 5D5UB 4DCMA 4M9XA 3IRQA 1BI3A 2KIUA 1YLFA 1RJDA 3TLJA 1MDMA 1SD7A 5HVQC 2UYCA 5K0EA 2PKWA 2H1RA 1QGPA 3HM2A 4CXMA 1D8KA 4PINA 1FBUA 4RTJA 5FHRA 5DYMA 3KQYA 4ER6A 1TBXA 1R7JA 4PONA 5DUKA 3THRA 3WTXC 4LWPA 2M5WA 5DSXA 1KP9A 1YFJA 1NKVA 3HVJA 5E20A 1Z9CA 3HNRA 4LB5A 3FTCA 3HRMA 1LDDA 3T8RA 3V8VA 2RVCA 1A04A 3RIRA 3CGGA 4IV8A 3E5XA 1J7KA 2FCAA 2ETHA 1B9NA 4L9JA 1DDNA 4LG1A 1XCVA 2MA3A 3LHDA 2IPQX 5LGNA 2PLYA 5EGSA 2E1NA 3BDDA 3LFKA 1HXDA 5DD4A 2CYYA 2PEXA 2OQRA 2HKXA 4YFNF 4IKPA 3EVEA 1SD6A 4M6YA 4WK8F 2FK7A 4ENJA 5EHIA 1KYWA 1U5TB 1QZYA 2K4JA 1WS6A 1G60A 2G70A 2H11A 5BPIA 1IAWA 4KDCA 1ZLJA 3TMAA 2ELHA 4F7ZA 2XYVA 2PJPA 4BP3A 1REPC 4RX1A 3TKAA 2FEZA 4H0NA 4YUYA 5EKUA 2PMHA 4RTLA 4RS8A 5DX0A 2FBIA 3I4PA 3FPJA 4Y17A 3V8KA 1RI5A 3BGDA 3R24A 3UA4A 4U7BA 1EH6A 2FQ3A 3GUDA 4AIJA 1KQ0A 2M1BA 4M37A 3GO4A 2AS0A 4HF0A 4NHJA 3HUGA 4E33A 1XGNA 3L09A 2HFHA 3ZQ7A 2B9EA 3OE4A 1TTYA 2P5VA 3MCTA 3CC8A 4AX8A 2EFJA 2CMHA 4KIGA 3UJDA 2YUIA 4BNCA 3I71A 5H20A 4BAYA 1XCLA 1PDNC 3PLAE 3CUQC 4G56A 4OIQF 1PUEE 2LD4A 1MJAA 1HNNA 5E1ZB 5ERGB 1NW5A 3O7WA 1NW7A 3GFLA 2ZXJA 4HA8A 5E8IA 1U78A 3ERCA 3BKXA 5K5OA 3V4GA 4E70A 1T2KA 2P8JA 1G3TA 3RIEA 3UJCA 4KFCA 3TM5A 1V3FA 3HSFA 5J6XA 4L18B 4HDVA 5ICEA 5E1DA 3AXSA 3ER9A 1XDZA 1JG3A 3DTNA 2GZWA 2O07A 4MGRA 2P6TA 3KR0A 4UVCA 2YX7A 3P97A 1EIZA 4L5IA 3EGEA 4C08A 2Q0OA 2XAGA 3KPUA 4IWNA 5EMKA 3PTAA 5TJJA 1G8AA 3H92A 4R6XA 4WF2A 3FMQA 1JSZA 5HOQA 2AN3A 5DM1A 3PX2A 1BHJA 4WWCA 2DW4A 1Z05A 5ILSA 4RB3C 3ZN0A 2V1UA 1UWVA 3OU2A 1X1AA 2ZO4A 4RGSA 4HGYA 1MJ9A 2EJUA 2LF7A 1P1CA 4HC4A 2JSCA 1ZLKA 3UWPA 4FT4A 1N2XA 4PYJA 3FPHA 3MB5A 4GYGA 1W4MA 3QPTA 4EQZA 1JGSA 2JHAA 5D8LB 2AOVA 1AV6A 4A6DA 1KU3A 2PFBA 1SQFA 4FHTA 2X0LA 2NXEA 5E2BA 5CYVA 3BZ6A 3KQOA 4Q5SF 4PIPA 5KYGA 3HTUA 2FMYA 5E1WA 1VLMA 4LFUA 2QVOA 4RSRA 3LDUA 4A5MA 2XASA 3DXXA 4KW7A 3M8EA 1BC8C 2CGPA 5LQJA 1HKQA 1W5SA 1XVAA 3P9NA 3TOBA 5A2QZ 2OA4A 1BKYA 3F23A 2IDKA 2JPCA 5F1RA 3V97A 5EQJB 2R3SA 3IRRA 2ZIGA 3DMHA 1RUNA 2XAFA 4U7TB 3J81K 3Q87B 1JHHA 3TDUC 2IA0A 3R0QA 4X41A 3WU1B 4YV0A 1FWZA 1FYKA 3GEZA 3FPFA 4GCVA 1B1BA 3J80K 2OY0A 3G2OA 2TDXA 3GFJA 4NQWA 1BBYA 1HKTA 5D1HA 1AQJA 5FHQA 1W7PD 3NRVA 4M9SA 2CSOA 5DPMA 2M45A 2VONA 1OPCA 4EVIA 3EVBA 3MEXA 1JSXA 3A7EA 4CO8A 2L4MA 5DCMB 3BZBA 2ZCWA 4G7HF 3TPZA 3ZMUA 1O3TA 4UHTA 2GLUA 1EG2A 4PCQA 4LD5A 3MCZA 2IRFG 4A0ZA 4HV6A 2XVMA 1IRGA 3KQMA 5M5BA 1T98A 2RN7A 4C03A 4RVGA 4QPPA 2JRTA 4HF1A 4KVZA 2VE8A 5EEGA 1J75A 1TNTA 4RGUA 5LHGA 1T6SA 4IRGA 2UWMA 2OPBA 2NYXA 3HCDA 4CTKA 1I6XA 4OA8A 4LWOA 3JTGA 1B4AA 3GCZA 2HTJA 4HZFA 4P7GA 2F5EA 4IHTA 2DPMA 2BR3A 4OINF 1YFHA 1Z6RA 4OOIA 2A68F 3NJRA 2A6EF 2OD5A 5K01A 3MFKA 1K78B 5GIOE 1RI1A 1S29A 5FO5A 3OPNA 1U5TA 4E32A 4ENKA 3F21A 4BYYA 5EZSA 4KT5C 5F64A 4WXHA 1BI1A 4I2OA 3AJDA 3BUSA 1YF3A 4M6XA 1YO5C 3FPEA 3HCFA 1U2ZA 1KQ8A 3KP2A 3U1DA 3E7PA 2IW5A 5EIWA 4EQQA 3E5QA 1JXSA 5HILA 3N4MA 1P91A 5LHIA 4HF2A 1RJFA 2V1DA 4HAMA 5JVTA 2Z9OA 5K05A 2VN2A 3T8TA 2V79A 4HQMA 3UJAA 1XGOA 3BY6A 1BOOA 1HSTA 4YMGA 2W57A 2AOTA 2FK8A 4JBAA 3P2KA 3EEYA 5HOOA 1JQ3A 4XUDA 5DV5A 3ZPLA 1VBFA 3NW9A 2KJBA 3X0DA 1HW2A 2ZFWA 3HCBA 3KP6A 3FZGA 2BYVE 5C1IA 5EPEA 3E6MA 4ZYDA 2FNAA 2ZW9A 3BGVA 3IWFA 1FP2A 2QWWA 3NDJA 4Y2HA 4IHSA 3QP6A 3GIWA 1OR8A 3CTAA 3V7SA 2EFQA 1K78A 4CKBA 5IT3A 2ESRA 4EK9A 4QDJA 2Y1WA 2JT1A 1OYWA 3HHGA 3VC2A 3GDHA 1FT9A 5GM1A 2MBFA 4ESJA 3E6BA 1ZRFA 1KPHA 3UZUA 3I54A 3DQVC 1EQAA 2FBKA 3BWBA 4HW0A 2P3OA 3UJ8A 5LEJA 2D1VA 3B73A 3HA7A 1RI4A 4IXAA 5DXJA 4N9HA 1BN5A 4OMYA 2ADUA 2VBZA 4EM2A 2AN5A 3CO6C 4YFXF 1NW8A 1BI0A 4GUAA 2PXXA 4EGZA 3DF8A 1ZREA 1R74A 4GGGA 4M73A 2DT5A 4PZJA 5EVJA 2EWNA 2IT0A 5FD5A 3EVCA 3F8CA 4AZWA 4LG0A 5LLQA 4HTFB 3ECHA 2Y75A 4GXOA 3VODA 3JSOA 2EG5A 5CVIA 4CKCA 1D8JA 1IUYA 3GRRA 2QZ8A 1R22A 2JZYA 1HKSA 1FBNA 5DRYA 1G3YA 3K9TA 2VBYA 4G7OF 4KMUX 1HSJA 3FM5A 4KICA 3P2EA 3IL2A 4WVLA 3G2QA 2F5DA 3IYLW 3RYPA 3Q9VA 4AWXB 3HOSA 5DTRA 2DU9A 2P7IA 4U0YA 1ZHFA 1TLHB 1MGTA 2GS9A 3FUUA 1KU9A 1O7FA 2QENA 2VBWA 3ULQB 1H1DA 4YIIA 3LPMA 4EKIA 1Q0TA 4XLNF 3JW4A 4R8SA 2BM8A 3GRUA 5CIYA 1YZHA 3T5XA 1JG2A 3SFZA 4FS8A 1P39A 2UXXA 4ZZDA 5KQSA 2C7RA 1QAOA 5F6FA 4DF3A 2ZVJA 3SGLA 3S68A 2STTA 3G89A 3WTVC 3SSNA 4OX9Y 3F4KA 3IC7A 1P1BA 2VP3A 3CJRA 3KU1A 3FPGA 4LJZF 1YFLA 2HQNA 3IEIA 4P58A 3J81Z 1HQCA 2NNNA 4LK0F 4XCXA 5E1BA 4IVNA 2M87A 4EJOA 5DM2A 3ZP5A 2Z6QA 1MJFA 5DTQA 3PFGA 2WA2A 4DZRA 3WTWC 2PVCA 4CTJA 4QWQA 5D6EA 3G8AA 5KS2A 2VT3A 5TRDA 1O3QA 3SSOA 3OFJA 2PQ8A 2HDCA 1IXCA 3EUHA 3DP7A 3Q7EA 2O06A 2OZUA 1F1ZA 3OU6A 3KLOA 3RKXA 4L9VA 3ML6A 1JHFA 4ON0A 1XJ5A 1USTA 3HTXA 1RJGA 2IGTA 1LQ1A 1SVUA 3I9FA 1RI3A 5C9ZA 4X1OA 1UIRA 5BMZA 4R05A 3TM4A 1IN8A 1Z6TA 3TOSA 1CF7A 5BOXA 4KDRA 4UUVA 3DUWA 4C4AA 4PDKA 3ER8A 1SFXA 3A26A 3EEOA 4ZZLA 3G5TA 1XMAA 1DPRA 1WG8A 4KUMA 3R61A 3SX0A 4M74A 2VZ9A 2ISYA 4UXNA 4I02A 3F8BA 4HBLA 3FF5A 1R5HA 3WE2A 3K1NA 3M6XA 3JWIA 1J9IA 4A0XA 2JHPA 4X63A 1PP7U 3HRSA 3LL7A 1G3WA 1KU2A 2F2EA 1QAQA 3F8MA 3B5IA 4DKJA 3A7DA 2I9KA 2UYQA 2XKOA 3W6JB 5LQNA 3D5LA 2MLGA 3M9AA 3NVKI 3C6MA 4RV9A 4BH9A 2K7LA 4R8RA 4XSZF 2BH2A 1BI2A 4R79A 2L3DA 1KGSA 3HTSB 5LQCA 1S3JA 1IXRC 1B6AA 2D2WA 1G55A 5HDKA 2YQZA 3WTZA 5HIJA 2P3QA 2DK5A 2KRFA 5HFJA 4QVKA 5E8GA 1WI9A 3LA2A 2GAFA 3LKDA 5B1SA 3I58A 3SXYA 3HCAA 3K1MA 3EYIA 1X1CA 1H9TA 2P5KA 4P7FA 1BM9A 4CHUA 3D0SA 2VOOA 2DK8A 2O05A 4XUEA 3F8NA 2DTRA 4WCGA 5BW5A 2PLWA 2PT9A 3F3XA 4P9UA 2G7UA 2G8NA 2OAZA 2KIFA 4U0WA 1U3EM 2QQ9A 3KZYA 1QANA 5FD6A 1ZGJA 3BOQA 5LRRA 2JH8A 4ZYHA 3B89A 4MWZA 4OU0A 2VE9A 5K03A 4RGXA 3PB3A 5HIMA 2ZNYA 2QQAA 2CL5A 3OU7A 1D2HA 2HEOA 1D3YA 3WE3A 2PBIA 3O31A 4HTFA 3ECOA 4KNYA 2NXJA 1GHCA 2M30A 2Y1XA 5K8VA 4P9FA 2FF4A 5LQRA 4P7KA 2XBMA 2BEOA 2W84A 1QO0D 5FFXA 2HWVA 5D5VB 3KEQA 2LSOA 3G5LA 5ILUA 4V0RA 2A5YB 1IM8A 3CUQA 3LBYA 2R7FA 3RYRA 1TNSA 5L3BA 4AZVA 3WTUC 3ISPA 1SFUA 3DXZA 2FSWA 5KK1A 5FTWA 3VB2A 2HKOA 1INLA 4F86A 1L1EA 1R1UA 2UYOA 3T7SA 4MNUA 3SZPA 3KQWA 2G71A 3GRZA 4Q47A 5JI6A 2XROA 1E2XA 3KQTA 3K69A 2QBYB 3ZMDA 1IZ1A 3HCEA 2VC1A 3C1DA 3WG9A 2FRXA 4UVAA 2GIVA 2UXNA 4YUVA 4G8XA 4A2UA 3FUWA 3L9FA 2QE6A 1BIAA 3HP7A 2XYQA 3UFBA 4AIHA 3I53A 3UJ7A 2P4WA 3FM3A 4KIFA 3FXUA 2V7EA 5AIQA 3A25A 5HEKA 2OYRA 1P2FA 5EHGA 3FYDA 3HVKA 2B78A 2UZ4A 2HYFA 5L3CA 2B0LA 2AOXA 2QLZA 1KXZA 2YTZA 1B59A 2FRHA 4ER7A 4ASNA 4ISCA 3BROA 2MC3A 5DX1A 2M8EA 3R6SA 3JWJA 3G2MA 2E1CA 3FMSA 2DLLA 1IN6A 2AOWA 3LECA 1QNTA 2XV4S 4GOLD 1SUIA 2EV0A 1P6RA 3EVGA 3R4KA 2XAJA 5K5RA 4RTRA 2PXCA 5CLSA 2QM3A 5FGMA 4C07A 2P35A 1SQGA 2B25A 1XDSA 3TR6A 1VP9A 1RI7A 1I5ZA 1G3SA 2P6SA 1R8XA 1L3CA 1NW3A 4E31A 4A5NA 2EA2A 5L3FA 4GC5A 4MTLA 1SFEA 3DKWA 2BBYA 1XXLA 1T0FA 1ULYA 3GRVA 5LSAA 3FRHA 3F8FA 1UFMA 3CVOA 4PGHA 3V7CA 3JAMK 1MJBA 3P7NA 4QLCU 1V39A 1F9NA 3P9CA 3G73A 1N7JA 2Q8KA 1VP3A 2P3LA 1OKRA 4V0QA 1E17A 3RPUA 2WA1A 3MERA 3T7TA 1XSVA 3SVZA 3GVAA 3WGIA 4BQAA 1SUSA 3F72A 4AZSA 3EQLF 1W7PA 3REOA 2RGVA 4C05A 5FWAA 3MHTA 4FZVA 3U2RA 5FLXZ 1YYVA 3DPLC 4S05A 3WTSC 5DM0A
chains in the Genus database with same CATH superfamily
2I7XA 3DR3A 1T4CA 3ED1A 1LBHA 4ASUD 1UMBA 1ILWA 2OUMA 1NNSA 4UQPA 3VC7A 1SBZA 2VHJA 5LB2A 1M33A 3KQQA 4OHCA 4DDVA 1OCCH 3T9AA 2Y31A 4CVNA 1YI0A 1G38A 5JSUA 2Q5LA 3E3VA 1N9GB 2FF7A 3DDZX 2G07A 3PI7A 2FWNA 4Y6PA 2PL1A 4C04A 1BS2A 2G7HA 3RQIA 1HXHA 1L3LA 2PWYA 2RBKA 3LDFA 3LO5A 4IDAA 4M9QA 1ETUA 4OI2A 2BSQA 2HBZA 1A7AA 5JROA 2BFCB 2PLNA 2M1XA 4WASA 1XRQA 2F1OA 2WA0A 1MR3F 1PR9A 2DUNA 3OOEA 4HDNB 2V6CA 4OHVA 2W85A 1E5LA 4ARCA 3WU0A 5C8ZA 1L7VC 4TMTA 4XWTA 1BMFA 2ZE8A 4CCMA 3DEAA 2EQBA 3PSAA 2PUBA 1BWPA 2B3TA 3G9ZA 2LDUA 2JAQA 3EE6A 3OP4A 5FEUA 5I7OA 2KT0A 2PQ0A 3WRWA 2A5LA 1JTEA 2OD2A 1GQOA 3GLGA 2ZJFA 1TJNA 3HNOA 5KC9A 2JGRA 1QZUA 2ZWMA 2XZDA 3OH8A 5K8LA 1J1IA 2H51A 3TLXA 3CKMA 1YR2A 3PGMA 5I7EA 4CZZA 1CEXA 4W97A 4XKCA 2GBPA 4F3RA 1GPUA 3C8UA 2A94A 2XB8A 1R1VA 4WY2A 3WG7H 4EG4A 1DXYA 1OC4A 4F2HA 5P8WA 5IX8A 5IC6A 3SEAA 1GZDA 1TK3A 5E6RB 1GQRA 3CCYA 2F43B 2F64A 2PUTA 2XTAA 3CKYA 3O93A 3QSGA 1IBMB 1PP8F 2K86A 1ZL0A 2FJUA 1P7WA 3U26A 3LQQA 1ORDA 4TRMA 1S89A 4BNUA 3SS7X 1UBUS 1FFEA 4M71A 3EXG2 1OX4B 2FEKA 2H4WA 3FFWA 5CXSA 1WJGA 4ICIA 4NQRA 3ZCOA 2B8NA 2JFUA 1U7DA 1WU7A 2WB1N 1N2HA 1QGZA 1TF5A 2O2EA 4M53A 4ENVA 4YNBA 3RYCA 2EWWA 3GG2A 3B3AA 3BPXA 5EG0B 1UXJA 4CEJB 3N0WA 5LP6C 3LWFA 4C3VA 5K2OA 5LLSA 4D81A 2XE6A 3CNHA 4ARZA 1AKTA 4EW1A 4MRSA 2J9GA 3MT9A 2EH3A 2P69A 1Z4KA 4NU0A 3R7AA 2L7MP 3U4AA 4DAOA 1GKIA 1L5VA 4CODB 3A31A 4FD2A 5DHUA 1W5BA 1GZSA 2XXBA 4YGXB 4C4YA 3LUHA 3O9MA 4CCWA 2JZNA 1KZ6A 4G94A 1VIAA 4Z3KA 4IBOA 4QYTA 3IOBA 3K2IA 4P3OA 3K16A 3LUJA 2KFDA 3I4MJ 1EVJA 4TTVA 3H3VK 2WQZA 1IUFA 3HP1A 3KZIC 4RK0A 1EFVB 1OJ7A 1UKZA 1ZDMA 2WD7A 3M3HA 4CDMA 4CMKA 2D0DA 2HXSA 2NSJA 1CB7A 3PEEA 1EK6A 1OMOA 2FG6C 2Q4BA 3EARA 1K8ZB 2ZG6A 4FQ7A 4KMRA 4LVUA 3BGSA 3DC2A 4NZ9A 1V3VA 2Q1ZB 5ALYA 2CXNA 3ZD8A 1KSHA 4ITRC 4JLPA 3NYQA 3UY4A 1ORRA 2G0EA 1AU7A 3NWSA 3D2AA 3HWWA 2AW5A 4KWEA 3RS5A 1KYYA 4AS2A 3KIPA 5E9QA 4BECA 3OUUA 5FOWA 2X19A 4C2AA 1DO2A 2PRSA 1FLIA 2YS6A 5HYVA 2DT7B 1EWYA 4YJHB 2KKOA 1XPXA 2I91A 3M2PA 6GPBA 5MHTA 2KHMA 2I6UA 2NP6A 4MV0A 1ZUNA 4IQJA 4LY9A 2WT4A 4CUZA 3GLVA 3AILA 4QO7A 5A2GA 2LNDA 4HLYA 4GMXA 4XDYA 2L9VA 1D07A 1NI5A 1NMYA 2RGCA 3GGGA 4J07A 2IYLD 2ZJBA 1TD1A 3AG1H 1NAHA 3FPSA 1SZJG 4PLPA 4V0MA 4EJUA 2ZYDA 4WLOA 1PYGA 1C1HA 1W35A 4ZU1X 4JYCA 4WEOA 4N6GA 3T7RA 4G4SP 3X44A 4HAUA 1D9XA 2X15A 3TTWA 2IE8A 2EJCA 5JCJA 2A5WA 2AR0A 1QZEA 1PYVA 4DJEC 1VYUA 1E89A 2V6JA 2ZB2A 3DB1A 4EVQA 5F9FA 4PJMA 1U0BB 1E2BA 3T4PA 2R7DA 1Q2XA 2GPYA 3F98A 1WB6A 3LBHA 1YDWA 3O4GA 5CVCA 4MV7A 1YJQA 4XIJA 3RW9A 1X3WB 1J5XA 3AJ9A 4YCBA 4UHBA 3WSTA 3ZEIA 2KRCA 2Z1MA 1DQNA 2JAHA 3D02A 3GGOA 3GJYA 3MTBA 2ECOA 4YYEA 3ZWKA 5HDQA 2F17A 3SIWA 2UYGA 3UV6A 1L7DA 5F0FA 1NP3A 1PRYA 3V48A 2Z09A 3TTSA 2G5PA 2GPWA 4HUQA 3FDJA 4X61A 5BMVF 3T7KA 5TNXA 5J8CA 4KFTA 3DDUA 4IIHA 3I5UA 4DV1B 1QZXA 1YWGO 2AMLA 2NU8A 1K75A 4EQ6A 2ZE6A 2P40A 4G1UC 3VU9A 3HN7A 1YZQA 3W6OA 3ID6C 3L7IA 3IVGA 1YSCA 5JCZA 2WQ6A 5G4KA 2AFHA 1BGVA 2GEJA 3KHTA 3H17A 3FXQA 3L8DA 5HTKA 4Y6QA 3ZH2A 2FW9A 1HH4A 4QECA 1EV7A 3GQBB 2WLSA 5ALQA 5IJ9B 3OC0A 1YDHA 4P1WA 3BGOS 5ELMA 3NARA 5GINE 3D1VA 4JC0A 1F7VA 4MYTA 1M0WA 5TE9A 1CIVA 2MLKA 3I9V6 2QTHA 4LOCA 2UVDA 4JFRA 5EQFA 4MQEB 5K4AA 5LC1A 1AKUA 1C4XA 3MAJA 1CEYA 3V8EA 4B3RB 3DR5A 1GCGA 3WLQA 3N2LA 1HZZC 5E8JA 4B4VA 1TO1E 3TFWA 4D8VA 3R5HA 1GXQA 2CYBA 2W6PA 4M3GA 2F4NA 1UBFA 3RYHB 4ZZ0A 1DSSG 1KQPA 2QUFA 1Z77A 1JXOA 1X2BA 2VUUA 2VRCD 2YJZA 4HS4A 5ED0A 2H29A 2W2OA 2YNMA 3L9WA 1S02A 4UM8B 3U48A 2NNWB 3KHSA 1I7QB 2NSHA 4PSXA 3DLLF 5T67A 2YOFA 5CVJA 4RJIA 1E3MA 4BKRA 3T5TA 4D26A 1IBSA 2LOOA 2QR5A 4OXQA 4BHBA 5CYOA 2DPXA 3RJ9A 4FR5A 4H35A 1HWYA 4CBVA 1HTBA 1M3SA 1YVUA 2OBLA 4A3MJ 3KXDA 4F7DA 4I0AA 2O8DB 4QXQA 3WK7A 2QYSA 1T43A 2W2VA 4NMXB 2VQEB 2R00C 3NIBA 5ALPA 1DAFA 2IZZA 3KLPX 4FX2A 1G8KA 2RNJA 4YJHA 3E3AA 4ZOLA 4C1BA 4E5VA 4B2IA 4AVPA 4RLQA 1FS5A 2JLSA 3EWSA 5KVVA 1KJQA 1QLWA 1T3HA 2W4SA 3HFGA 2JA2A 2CEKA 1OXKB 1DT5A 3B5JA 3DQZA 3H04A 4DUZB 2OZLA 2GPNA 3ER6A 1DOAA 3PDIA 4M72A 4DMGA 1A7UA 4G1EB 4P3YA 1SVIA 4NBSA 4YT8A 1R7RA 2CLFB 2EPFA 2HIHA 2I1QA 2XCQA 5ILGA 1Z16A 5EFOA 4ESOA 1U4NA 1X2EA 3Q9UA 1D4OA 1XLWA 3E22A 1B42A 1EFVA 3F8WA 5KHAA 1UJ2A 3I61A 3NIDB 1RAGA 3EMBA 3BWVA 5E2AA 2O8EB 2ZVDA 4HLXA 3FCEA 3GRKA 1E79D 3A3OA 3EXHA 2PMWB 3NGMA 3OUZA 5CYFA 3KSDO 4AY5A 5DDGA 4Q1AA 4CQJA 1FOWA 5EF6A 1NTRA 3N0XA 1W0KD 3AVOA 2GLOA 4AUKA 5CH3A 4QPOA 2D3TA 2PRYA 2W2QA 1JT2A 2AOUA 1HG1A 2C04A 4IW3B 2H0QA 4RV5A 5L7YA 1QCCA 4N12A 3TQRA 4YXWD 3BA6A 2VQ6A 1YE8A 5CQEA 1KBQA 3KD3A 3O0TA 3PKZA 3QP9A 4TVOA 2VI5A 4UMEA 1O95D 3IEPA 3LDHA 4OGGA 5LQSA 4XVUA 4CR8A 5ILOA 2DMNA 3CUVA 1E3DA 5MN6A 4L08A 4R8VA 2VRBA 3V1LA 2ZI9A 4LQLA 1AUPA 1O94D 4X1KA 4B7AA 4DZJA 2IVMA 1MEJA 4MDHA 3M7IA 4AECA 4E0BA 1CP3A 2FP4A 4RB0A 3BORA 3PFHA 2HDOA 5DBOA 4UW9A 4ZAVA 5FWDA 2GN9A 2O7VA 2QL9A 4ZV4A 1LNWA 2VI6A 3IMFA 2B9SA 2H5IA 3V1UA 4A3FJ 3I05A 3HLKA 3IUJA 3WYDA 3RUFA 4U2CA 4C4ZA 3F96A 3PGXA 1ONVA 1T2VA 4BGUA 3BH0A 2JIQA 1G3RA 3MUOA 3ZU6A 3SMQA 3OAAA 4HGPA 5CA0A 5ALEA 3FBWA 1DRVA 1PVOA 1GN9A 2BM1A 3LXMA 4XWWA 1L7XA 2UYYA 2G5TA 3U3DA 5MFPA 2BR4A 2O19A 3NWBA 5C7OO 4BL5A 3U44A 1Y98A 2PS9A 2JHGA 2Q4TA 4L4RA 4X3OA 1DBQA 4HV4A 1M8JA 3MINB 5A2QA 4D3XA 2ZSDA 5IHXA 1W6RA 4FM9A 4DB2A 2E1MC 2OYSA 2QZ4A 5HQ3B 4FE4A 2ZWOA 2J3DA 2JTVA 1G98A 4QUDA 1K4KA 4TTQA 1XCJA 3CW8X 5FFMA 1IDOA 4E1AA 2ATCA 3Q8MA 4PHFA 1UJMA 2FZ5A 4NYIQ 4I9FA 1UXOA 4YELA 1PVDA 4QPQA 3CLOA 1IZ9A 3HDDA 1U9IC 2C8KA 1YAHA 1JYFA 3QP5A 1RRVA 2IDJA 3E58A 1XZDA 2ONZA 3GRYA 5EIHA 4A0HA 3HOYJ 4CMCA 2XMGA 1UJBA 1Z36A 4PLVA 3PITA 2FGJA 2RC4A 1Q1AA 2PT7A 5F4ZA 5HCUA 1AV7A 1J56A 1Q7BA 2FMIA 4IZHA 5B5SA 1BVHA 5DBIA 3O8NA 4MFDA 2HGCA 3GAZA 4MPPA 4A2QA 4CU5A 1KEVA 3VR6H 3NONA 1GU0A 3IE2A 2I3AA 4CHTA 1STZA 4MO9A 4W5RA 4TLEA 5TX7A 2JD2A 4KMFA 2E5ZA 1HZJA 2WIFA 1XTJA 5HLIA 2YY6A 3H5IA 2BVLA 4JXJA 4MP3A 4RY8A 5LGUA 3M70A 4JP8A 1AXEA 3E35A 4KO2S 2PO5A 4QLAA 5B36A 2V03A 2R7KA 1XNHA 1M5TA 4AZTA 3JD0A 2BLNA 1DT3A 1IRFA 1EUDA 1Z6ZA 2WZCA 5DB4A 3VPGA 4NCNA 1U04A 4N9IA 3L7YA 4GOMD 2J8ZA 4UD2A 5C4IA 2HRBA 4O63O 3ZX4A 1NBHA 1KA8A 4O6VA 3RTDA 1J42A 3OD1A 3LVBA 1FFSA 1PJ2A 3VPDA 3H4VA 4BFLA 1C81A 1ZUWA 3O8OA 5BQTA 4HFNA 1L0OC 2IPAB 3DKVA 3TGWA 3ZHOA 1ULZA 4F2PA 4Z49A 4BFWA 5A4JA 2AD5A 4DR3B 3B7WA 5IYZB 1CB0A 1CE8A 2A3SA 3LY7A 3OEHD 2PRKA 1ZEJA 2QMEA 5FADA 1CRZA 1OFTA 3GUVA 1O9HA 2AGVA 2Z2SB 1L8AA 4DNCA 1Q74A 3A9RA 5TPWA 4Z9FA 3V8NA 1JIVA 3VU0A 5C7LO 5KNBA 4QFDA 3D3QA 4D57A 4CU2A 5EXEA 4DXDA 3U4MA 2GO7A 3RS4A 1QONA 3Q9NA 1HBXG 5KJ6A 3BMQA 4UHFA 4K1LA 4PLGA 5CYGA 5K0BA 4CFSA 4LK2A 1CY7A 2ZJPF 4PTYA 1C8KA 2PANA 3PENA 2O50A 1MVLA 3HCCA 2VPQA 4W9NA 3FRIA 2X1CA 1NLUA 3IQDB 1JSLA 4BQOA 2ACEA 4WJZA 2ID4A 4MLZA 4P3KA 1Z9BA 1T2UA 1UKAA 5GJBA 1Z74A 4LQDA 3HV0A 4HGNA 4B6GA 4GAEA 3RU3A 4PWYA 2CXOA 4BMSA 2Q3BA 3CCCA 4DCVA 2X5JO 4PC2A 3WIUA 4MQ6A 2EFOA 4IKFA 1NZDA 1UEJA 2ORVA 3H16A 4M0FA 4KR0A 3LQKA 4Y6SA 3BL5A 4B4CA 4II3A 3I83A 2Z95A 4N9QA 4ETNA 2IBSA 1JAHA 3RUPA 1EX1A 1PS8A 1FDUA 3W3CA 4K1XA 1A50B 2C5EA 3JVEA 1BH6A 1P5JA 2B83A 2ZM6B 4XQCA 3JX9A 1TQHA 3N76A 4H7PA 4RK1A 4DSAA 2XYRA 2BMEA 4AJ1A 5ADWA 4HOBA 1UMCB 1ZD5A 3BIFA 3CINA 3ND8A 1KVUA 3F5FA 1E2NA 3JR9A 3EMKA 3CJTA 5FA5A 2PSSA 5BRNA 5JSZB 4OB7A 4PO9A 1Y33E 1XIVA 1HZZA 1M0TA 3D6MA 1PEKE 5HIIA 5K51A 1NYRA 1GNSA 4Q1DA 4MI6A 1TVKA 4AG6A 4UB8C 3RDPA 1CDDA 1MQAA 2YVLA 3FHJA 1ZUD1 4DY4A 2V0CA 4HZUA 1Z4MA 2BISA 2I2AA 2R6HA 3QLEA 4OYRA 2G4LA 4D8YA 1RLMA 4EJTA 4I4CA 5G0WA 3K2AA 1IUPA 4XONA 3RKQA 3MD9A 3TKLA 1ZK3A 1NWCA 1J99A 4UNIA 1QHHB 1Z34A 2SNIE 2AZMA 3G13A 3T7EA 4LOIA 4WOPA 1BX1A 4GEKA 1C3VA 2BGTA 2HYGD 2M2EA 1JW9B 3KP5A 3UFXB 4F04A 5ES4B 5F5LA 2QQBA 1BW9A 2QSJA 1WH5A 2BMWA 2WJ6A 3I92A 2P90A 4IG4A 2C96A 4LRTB 5EEHA 4D3FA 4EPWA 2J87A 3QKRB 3QY0A 2TYSB 2OM6A 5AVTA 1VKOA 5IXSA 3LSTA 3WGNA 3KEOA 4GL4A 3R5SA 5DISB 1U2GC 5LP1A 5CMLA 4RGRA 1KONA 1SXHA 1SG0A 1XTPA 2C9MA 3CF4G 3D6FA 1QFSA 5JVGF 2C2XA 4U9IS 4DSUA 2R6R1 5JPIA 3OIWA 1LVKA 3P7MA 2VHQA 3DAYA 4ENMA 2H0RA 3OT4A 3AG5A 3VI3B 1IAQA 3AYZB 2EQAA 3CF5F 2JZCA 3E27A 4BJ3A 3T34A 3HB4X 3IAXA 3VO1A 4NCBA 4HX7A 13PKA 1U7ZA 4FC7A 2VKQA 2CO5A 4WDRA 1SG6A 1W8DA 4FW9A 1OT5A 2HO5A 2JKVA 3DTVA 1ZH6A 2A14A 5IVIA 4R1NA 5TVKA 3ZWBA 2NOJB 2I29A 3UGJA 5ALNA 2ELKA 4GYWA 1P33A 4PZ0A 3MB8A 4QSMA 2DOEA 4AY2A 5KYYA 1EH8A 2J5QA 1FTQA 1YW9A 3OPYB 4RMIA 2X42A 2FZGA 2HBRA 3LOUA 2QTMA 2FMUA 5C4GB 4E7SA 1US8A 4BB0A 3RQ4A 3A01A 3U16A 1V8OA 5FLXK 2X6WA 2A1TR 3DZCA 1FX7A 2X22A 1LLUA 5B1YA 2PRIA 4DTCA 1X7YA 3IV7A 2WY7Q 1L7PA 2JA7J 4UFOA 4E5SA 4J7XA 4X71A 3TNFA 4ZGWA 1EXWA 4I1UA 4JVOA 4DSTA 1RC9A 1ZYRF 3VYUB 3EH1A 1GY8A 4WKCA 4BVGA 1VE7A 3IKTA 5EXDA 1MOQA 3P26A 4L6CA 4J29A 4DJFC 3SI7A 2R25B 3ZWDA 1QK5A 4KUEA 1U3WA 2BI7A 2QY6A 4CG3A 4W5TA 3KSBC 1DIRA 2XBUA 2AE2A 1RP7A 2ODQA 3ESZA 3MJ4A 4AKTA 4A2WA 4DLUA 3BFKA 4M55A 3FROA 4QFBA 3WQSB 3E9DA 3CH7A 4R2KA 3HN2A 4UJ5A 5DHPA 1LJ9A 2FFRA 2A78A 1E66A 2A8YA 3IQXA 4GX0A 5TVGA 2X4IA 1J33A 2W6QA 4TX1A 4DDHA 2ZZMA 3V4SA 1DQYA 2UVPB 3JQPA 3SZGA 3ZZ1A 1ZN8A 4K6OA 5SV2A 3U3JA 2XNSA 3F1KA 5CIWA 4URVR 2O7SA 4HS9A 1Y8CA 5IT9K 3H35A 2XPVA 1K5DA 2W00A 2HY7A 2I6GA 3KAKA 3L49A 1EWTA 1TQ4A 3B6ZA 3SPXA 3TRDA 1F5NA 3MELA 2VP5A 3WB0A 2VJMA 1H2AS 3FZEA 2C9ZA 1X1BA 2M98A 3VR0A 3K0CC 4K6MA 1ZD4A 3HVHA 3SX2A 2GZRA 3FVTA 3VKGA 2PSHA 2V4JC 3GTKJ 2PA0A 4RAQA 3PQCA 2QA4I 2W7NA 3C6KA 4LBZA 3WISA 5C5DA 2WTUA 1IM5A 2C3OA 2YJTD 3OZWA 4IL5A 1YB1A 3PC8C 3V1NA 5J1YA 1BAPA 2FX2A 2NZJA 1KOGA 1E3QA 1T8WA 1O94C 2FPSA 2GCGA 1ZJ6A 2HRZA 3PNSA 1RMQA 4QDKA 5JBIA 5JUWA 5KYUA 3TI9A 1LI4A 3VNAA 4RJKA 3GFOA 1E6KA 1ORHA 3IKVA 3KKEA 3AINA 1JGTA 4ABYA 4DV2B 1KPIA 4E3ZA 4PHTA 3R0AA 2A61A 4WOCA 4BN4A 3ZGLA 2YRXA 2D1YA 5U4QA 3ZZ0A 1Y7TA 2XIGA 3CPSA 3EVDA 3NHAA 4H2DA 2V9KA 2FWMX 3D2LA 5GONA 1VLQA 3AGQA 2IX9A 5T64A 3ETEA 4G1FA 2O1WA 1LB1B 1OMIA 1HLPA 3K4MA 3PGJA 4DA0A 4EGJA 1AGXA 5EJ9A 5CHYA 2PX2A 2SKCA 1HOXA 3IH3A 2QRVA 3QWHA 1V48A 3VKWA 3SLGA 3TO5A 2WP8J 1E5TA 1X9GA 1VCHA 4EGYA 1WABA 3RJ5A 5IJ0B 1QFYA 2HLDA 3OEWA 1JEEA 2VVTA 5TISC 4YUAA 5EKSA 1ZY2A 3ODGA 1CUWA 1VTNC 4R2WA 1MSFC 5HZKA 2R1TA 2EJVA 3W34A 1EK0A 3NJ8A 4C5BA 3BKWA 2QBYA 2ZJ2A 3FTNA 4TZ6A 2O61A 1OXMA 3HWX1 2MINA 1GGJA 3BWYA 3PUFA 4W7IA 2DA6A 3PRHA 1WXHA 4RKWA 3C2BA 4JOQA 4FOTA 2O4CA 3ZDFA 4YN3A 1I27A 1EFHA 3B9BA 5EFZA 3VOTA 4YP6A 5BT9A 4C0WA 3ZW8A 1MHPA 1DG3A 1P44A 2WNIA 2IW1A 3ZWMA 2WLTA 3TAXA 2R6DA 2ZXEA 1XN7A 2DFEA 1H2EA 4PZAA 4UDYX 3TR5A 5CB0A 1XRLA 4IQ4A 2O9JA 4C7KA 2DMUA 1B6GA 4Z6YA 5E1XA 3ABKH 1N1EA 5LGTA 3A6EA 2R5ZA 3LCRA 3O91A 3WKBA 4ZEMA 3U7FB 1E1YA 4PNEA 1FSFA 4NKRA 1USIA 1ZK1A 2D1QA 4GX1A 3RLFA 1P9QC 3DCYA 1FBSA 2FP3A 2XSDC 1AIPA 1U8RA 2D7JA 2PIDA 3PQ3A 4P5PA 1YFKA 2LF8A 3L7WA 1ZRDA 1SPXA 3A4NA 3ED5A 4GLBA 4WIAA 3R7BA 4RIHA 4ISBA 3TZ6A 2UZKA 2Z3ZA 3VDNB 3JQ8A 2QN6A 1H5NA 1FRQA 3FWZA 2KPMA 5B7QA 2A0UA 2KW5A 4B7XA 3OCXA 1HL7A 2Z30A 3M6MD 1LDJA 3OAAD 4D9BA 2WV9A 1ECGA 4C2UA 3I45A 4W8GA 2IUUA 3H11A 1TI7A 3L8GA 3LPAA 3CJQA 1W48A 4RMGA 4BMYA 1C4OA 3U4DA 3ZGZA 3TEDA 1D9ZA 4Y0NA 4YG2F 1A0OA 4GBGA 5CLGA 4AU1A 4E5KA 2YICA 4GUDA 3T5BA 5JI2E 4I55F 1RXVA 9MHTA 2IYQA 3D2BA 4TLBA 1JR6A 1RNLA 3A05A 2J46A 1I4TD 4Y8VA 1I3CA 1MJNA 3DA8A 2C7BA 2DA1A 1L4LA 3JWGA 3KTDA 3CW2A 4NC7A 4RCZA 5JSYA 2VBXA 4M2LA 4MV1A 2CSXA 4GQIA 1TKAA 3W2IA 2ECCA 1TD9A 2A1UA 2PX4A 3G1TA 3KYCB 5AXBA 1R6AA 1Y8AA 4MGZR 4HDRB 1KHTA 1NNI1 2QVLA 5CJ9A 1YACA 3QW2A 5E4FA 1T1IA 3WWCA 4DIFA 1VFNA 1BA3A 1X80A 2IV3A 4YJ2F 3WV5A 3AT1A 1B4DA 3EDPA 4XAQA 5BMVB 3GB9A 2C0PA 5SY4A 3NGXA 2NQ8A 4EL0A 1GZ5A 1M72A 4ZXPA 3KO8A 2B21A 2WAOA 3EYAA 4CE6A 4E88A 5CFNA 1G8XA 3CVUA 4Q6BA 3ME5A 1QO7A 3Q8KA 1E1LA 2KBEA 2OFOA 3CVYA 1NNUA 4RM2A 3RKYA 3ZDZB 3S70A 3S15J 3CJTB 1U98A 2KQUA 3FYUC 4M7RA 4LRQA 2G6BA 1FCJA 2ZBUA 3HEAA 4QATA 4TUYF 2H2WA 2P5LC 4XGKA 4B75A 1QK4A 4YP5A 3TE7A 1LGYA 4TMYA 1VLJA 1Z6GA 2AG0A 2GTIA 3KJQA 3B38A 4FSDA 2XNDA 3L2CA 4KR9A 1OYOA 2Z9BA 5ELLA 4EUNA 4B7CA 4JKYA 3V9PA 3VSCA 3C15C 4UNRA 1O4XA 3BWGA 1MOZA 5DGXA 5C46F 5JWOA 1DCKA 1ESNA 2CYAA 4WZZA 3I73A 3IPCA 4IDOA 4NEQA 1HW5A 1CPYA 4AZ3B 2QQ5A 1BZYA 5ICGA 1TM1E 4FE7A 4K9NA 3AU8A 2R8XA 1J9EA 1TPYA 4KYWA 5IY5H 4KJZA 1ZG5A 1ON2A 1XGMA 3K7AJ 2Z2XA 1WGXA 1GPKA 2B34A 3FSGA 3EEQA 3IPXA 3CUOA 2DPUA 1UANA 1W9HA 4QRIA 3TXXA 2PBLA 4TT3D 5I7AA 3USCS 1PZHA 3FWKA 1TXGA 2NV0A 4BNMA 8MHTA 4HATA 5EIFA 3ABUA 1OASA 3Q5GA 2VDUE 2RC5A 2XW6A 4EGFA 1A5BB 1QH9A 4UOEA 4R1HA 3MJVA 2KX7A 3H5WA 1PWEA 3VJKA 4BFSA 3FTFA 2JVHA 2ERCA 3S5UA 1B0AA 3T9FA 1Y6GA 2CCGA 1GFZA 2Q99A 4HRYA 1H1LA 1UB9A 1AHIA 1PDWA 1R8JA 1SKBA 2A67A 1UHSA 3GFMA 2A84A 3K6RA 1UK9A 5KQLA 1EDZA 3W90A 5KOJA 3IWZA 1FLDA 3O3KA 1K3UB 4LWQA 4RD2A 4BLUA 2OG2A 3EVTA 4WNIA 1W0JA 2IEBA 3V3KA 1MDMB 1WX1A 3PIOF 3IPLA 3KTOA 2YWEA 1IY8A 4OHWA 2D5LA 4FGJA 1E3TA 2J3QA 1LZLA 1WZEA 4AJPA 4LGWA 1MH4A 1CRLA 4RMJA 1QVTA 1T3LA 4PK4A 4DMCA 1S6LA 1TQMA 1M66A 3BQ9A 1K83J 4M83A 4FTHA 3BIWA 4MKZA 4OHKA 4CV3A 3QVWA 5JS2A 1J24A 4EB8A 1V7ZA 1OI2A 1TCBA 2QLNA 4U6NA 3TYXA 5E6RA 4C2TA 1AXRA 5DCWA 1O8BA 5GVSA 1RQNA 5TS3A 2AMFA 4FNGA 4PZ9A 3KKZA 5G02A 1LTQA 1R5ID 3FOZA 2GCPA 3QEOA 4MA0A 2Y0CA 1UZLA 5E0OA 3JTEA 5JYCA 1U90A 2BSAA 2EVWX 1EUQA 4EFNA 4TVSA 3K5PA 5GP1A 2YU3A 1E5VA 2ZSIA 5K0ZA 3OR2C 5A2QK 1VKNA 3JVVA 4GOOD 2B8EA 4UAJA 3HABA 3SJUA 1SBQA 4ER3A 5BS6A 2GZ1A 5LPNA 1KSJA 1YQQA 2XTMA 3PVZA 1YZVA 4FBMA 1DI0A 3SQMA 4KISA 1VJTA 2ZXWH 2WKQA 4BU0A 2E6KA 3RB8A 4D8UA 1I2DA 3ELWA 3EGDA 1H5UA 4O4LA 2J0EA 3R5FA 5A4AA 2X1HA 3JYPA 4MTCA 3SXUA 4YPVA 3INRA 1I1NA 1IMJA 3M5PA 1BXRB 1SIWA 4HGOA 4TL9A 4UEWA 5CHEA 5M29A 3GFIA 3O4FA 4ZEOA 1ECBA 2OQVA 1ZH2A 3TDNA 3FYCA 2OXCA 4E1BA 2I62A 5JRJA 3EZ2A 3ORRA 2GAIA 2WD8A 4MPTA 4MEXF 3ASNH 4Z9XA 1AA6A 4DNPA 4ERNA 2KIMA 1DWQA 3Q15C 1CUXA 3RI4A 1HI9A 2AK3A 2ID7A 1WM1A 2HJRA 4V2IA 4TTSA 4ZO6A 5C31A 5BV1A 4W9MC 1TLTA 2IVZA 2FLKA 2HTEA 2FA5A 2OZ6A 3VOAA 5A5FA 5JEDA 3E15A 1XHFA 5D6FA 4BRUA 4CYDA 1NULA 1K6YA 2Z1NA 4FYVA 4S1PA 1OBHA 2C3UA 1ULSA 2CWEA 2JGJA 2XGGA 3CO0S 4YASA 5AYVA 3UMMA 4X65B 8AT1A 1NR1A 4YAWA 3AR9A 2ORWA 5CDYA 4BWFB 4PS1A 1OIVA 4F4IA 3ZWYA 1O0BA 2XUPA 2VK4A 4K5QA 4OJYA 1PX0A 4MUNA 4INPA 1S9HA 4IIUA 4BJ5C 1I9GA 1N6KA 1ZP6A 1ZMTA 4TT8A 5KVQA 4AN1A 2ME0A 2AUMA 3MW8A 1MXHA 3OKPA 3ZTTA 2C59A 1H8HA 1NK3P 5BXYA 2NVQJ 3LCUA 3BQZA 3QMVA 4YJ2A 4X1KB 2O3JA 2VP9A 1FEZA 3L6EA 4UCXA 2JH3A 4QOFA 5I9LA 5KTSA 1OFGA 3SJZA 16PKA 4O8CA 1VCMA 3EGIA 4JB0A 2Y2ZA 2AEMA 4WNAA 3DWLE 1TC1A 4LLLA 4DCTA 1X8XA 2XB6A 3CT6A 4NMWA 1G16A 4WN9A 3NWTA 1T3TA 5IN5A 2FMFA 1UMDA 5LWQA 1MO5A 3QNUA 2Y05A 3T1BA 5EWJA 4YP7A 1KL7A 1GXPA 1HNWB 4C6TB 3ZTYA 1B6TA 3LZDA 4NBUA 2A5JA 1N8TA 1XMVA 1ZJ5A 2LPMA 3BJRA 1MBKA 1Q0ZA 3DBRA 1J2XA 3P0JA 4GRAA 3R23A 2JN6A 4RL6A 4EX6A 1QBKC 4YRPA 4J16C 4YRIA 5CUQA 1W36D 5LA6B 3ZW9A 3R76A 4PYOA 5DLEA 4EPXA 4LZAA 1KERA 4EA7A 3UXHA 1X7WA 2JCYA 4LMYA 4K2AA 2Y0MA 1GG9A 1T2FA 1W0CA 1C3OA 1SNYA 4L0QA 4M99A 4XRRA 2WSSA 4NZPA 5AKZA 5HKAA 1AKRA 5HMMA 2BGGA 3WJ7A 3NMUF 4KGXA 3TFOA 2WFAA 1OTHA 3TPCA 4XLCA 2GDJA 2I03A 3UK1A 3GLRA 4KDEA 5DKFA 2IHKA 2JJ1A 2JLRA 5AHWA 1TCAA 5ALRA 2CL7X 4RA9A 4S2UA 5IYZF 4KKXB 2J30A 1LC0A 4NC8A 1EX7A 4UEJA 1NBEA 1CQJB 2HCTA 3G3EA 4Q3LA 3ZJTA 2JJYA 2QAGB 4JI0B 2RV8A 1X1QA 3VYRB 4EBFA 3OOUA 4RPKA 4FSXA 1QQBA 1PT9A 3D6UA 1O03A 3G9UA 5CB8A 3AWIA 2V7QA 2C03A 1FOYA 3PQ4A 4JB2A 5DT9A 3ZY2A 1P1HA 1XJWA 2DO7A 3BBLA 2QN1A 4XWOA 4XM3A 1D0YA 2AJCA 1Q1HA 4BVLA 5IANA 1DAEA 1CDEA 3R60A 4YFKF 3QNMA 2GOYA 1U2SA 4K03A 3OOPA 3GCGA 3HZHA 5EDNA 2IEAA 3IIMA 3VU3A 4GEGA 2LC2A 4B4UA 1S2NA 1JE8A 3OPMA 1LNSA 2CVZA 3B9QA 4BNFA 1MBFA 1JKPC 5U9CA 3SU8A 3VMFA 5L3GA 3MWEA 3BG7A 3EODA 1O6BA 2E2JJ 3BMOA 1E3JA 1GSAA 3FHCB 3TVTA 3W5UA 4E30A 1YA6A 3F9IA 3RAJA 3ZIAD 3GRCA 1KOFA 2ZJ3A 2R7LA 4IJAA 4J3JA 2E1RA 2B7BA 3D3WB 5FV7A 2GEBA 2Z2KA 3OSZA 4IUYA 4YMSA 5LQAA 1FJHA 1YJBA 2QLFA 2ZJ0A 3QEBZ 5AKEA 3OFVA 3AZQA 1ECFA 3A32A 3BJ6A 3A11A 3N07A 4JBHA 3RFVA 2Q7DA 4W5NA 4WRRA 2IBTA 1HY3A 1J1ZA 1AC5A 2PX8A 1TQ6A 3EXEA 2XDAA 3FOWA 4IH9A 5HKLA 1R50A 4JYKA 2PWPA 1I5RA 3CLVA 2R4UA 2X6QA 1QDEA 1QWSA 3GWGA 3G1OA 4RVDA 3SK0A 4DABA 1AZTA 3V4PB 4F56A 1SXGA 3E2PA 2CJPA 3QTBA 5J43A 3G9TA 3IVCA 1UOPA 1GLVA 3Q7PA 5D3QA 3ZJUA 3UAOA 3OEEA 4OQNA 3O3CA 4RS3A 3ZN1A 5K6RA 2VP6A 3SHOA 3IOCA 4YJDA 4I14A 5E9AA 1YR1A 4BV2A 1W4CA 2WYUA 3NX4A 3KM0A 4TQUS 1UJ4A 2O2YA 2P6NA 1OH5A 3BLYA 1S8NA 1UT8A 1Z0ZA 3PQ2A 3MQ2A 4O5AA 4YP0A 3SHWA 1YZ3A 3OI7A 4BQSA 3W05A 3QVKA 1WCMJ 1G8FA 2Y71A 4YJKA 4F3KA 2BUBA 3LT2A 3BJOA 2OECA 4OLBA 2ZVPX 1RZRD 3GTGJ 3OF5A 4FYKA 1JT6A 1SVKA 2GBFA 4HQFA 2N1BA 1K9VF 4L27A 1XL1A 2ZTVA 4BKPA 5HIAA 3TTTA 3R6WA 3TEFA 3WRXC 3GGDA 4PFQA 4E2XA 1RIIA 1DUVG 3Q5FA 2WFLB 3EXFA 2PCJA 3JCZA 3N7AA 4IRUB 2FFQA 5CT5A 3VR3D 2F8SA 4X1YA 2M0CA 2CNOA 3QF7A 4LW8A 1H3FA 1XALA 5F33A 3JRAA 1T8YA 5GGYA 4NZNA 3DFFA 1PQYA 1I80A 1XLVA 3JWHA 4AM8A 1UJ8A 1KE1A 2QP9X 3GCWA 3OYIA 1KEZA 3S3MA 3MUEA 1I8TA 2IP4A 2JK1A 1E3PA 1XRSB 2CJFA 2YIMA 4NJMB 1EHCA 3SZTA 2C9OA 1BXRA 1SBYA 1C1XA 4O2BF 1IN4A 2VPRA 3OSFA 2DYKA 3FVRA 4UBKA 3CMYA 1UPUA 3RKRA 4COKA 2WKRA 2LK2A 3WQQA 3F6EX 1X19A 5IT9Z 2O2SA 3ASVA 5A3QA 4ROTA 3EBOA 1EXDA 5FULA 4XIGS 3UEOA 3LDGA 4FLEA 2JIPA 4X0EA 2YDYA 1JHQA 3MGGA 4MB6A 1Z4JA 4GH5A 4PLTA 4LZPA 3ZLVA 5H8WA 3TTVA 4YV1A 3HB0A 3E8XA 5ABPA 2HA0A 3D5SC 2J4DA 4BQIA 3NR2A 5CDUA 1NBAA 5FQOA 3K4BA 4G0OA 4ZVNA 4D9CA 1JWLA 6PAXA 1YL6A 1JPUA 3NH9A 1CD5A 5BP7A 5BNWA 1TLLA 4YO7A 3ZQFA 4E4HA 3CLSD 2XRNA 1TM7E 3PDUA 1UBMS 1IV8A 3RUAA 3CPHA 1M6YA 4RGQA 2AIRA 2W25A 3M8FA 3VKHA 4OLJA 5FUWA 1WDTA 4AN4A 4M9CA 1Y5LA 3WOHA 2AOTB 3I5MA 2GQ0A 4OD0A 1XWIA 1YIJI 2X51A 4ZDJA 3SD7A 2RAPA 5JD4A 3KD2A 1D6JA 5EIAA 3A2NA 5JY1A 4TLAA 3CCVI 4ZJYA 3TO6A 3INGA 4MR9B 2GSDA 4HDUA 1Z5VA 3G2HA 3MTIA 1KS9A 4QXPA 1D7OA 4W82A 1NRIA 1LVAA 2OV8A 4LLNA 3TUIC 1P45A 3FOEC 4LY3A 2HW8A 1XAJA 3GF4A 1Z67A 2QRZA 3B2NA 4ESHA 1I10A 2CSUA 2NXCA 3DW3X 3EFOA 3F5QA 3JD2A 1Z5UA 1OJLA 3R09A 2X0JA 5AI4A 5DCYA 1EEHA 1HA8A 3PIDA 1AF7A 1DQUA 1KI1A 1ONSA 3K10A 1XLTA 3C5CA 1UMDB 1ZOLA 1A8UA 2DSNA 3CF4A 3IHWA 3MTGA 4HSRA 4J6EA 4MO2A 2B0CA 3RC1A 3SDSA 4PJ0C 2NT3A 2RKBA 2F55A 3GFBA 1L7BA 2JIZD 1NJSA 4I01A 3CDIA 2RJ3A 4GOND 3EVNA 2BJHA 2JUCA 3VU8A 2O1EA 1FC3A 1DXHA 1E9VA 2M4GA 1CIPA 3TFQA 3KSAC 2F8LA 2WHXA 2Z8YM 3WL7A 4PG5A 1QR2A 1AZLA 1OAOA 1SHJA 1U02A 2PX3A 3LBFA 3NJ4A 2P8TA 3D8UA 4U0VA 4IINA 1GTG1 1ENPA 2CBZA 3ZQIA 3HRKA 1JZQA 4C0XA 4XRSG 2FUG6 2GK6A 4BX8A 3MLBA 1Z7EA 3E05A 1R49A 1Z0AA 1X86B 3BJEA 5BN3A 6REQA 1U5CA 2MSEB 4KYVA 1U3VA 2IEZA 2NNLD 1UXGA 2ZZKA 5DNEA 5JPCA 1ZAOA 3UB3A 3T5AA 3U1TA 4UMDA 3MN2A 1EAMA 5IF9A 4UOZA 2X5KO 1TZCA 3HRUA 4JROA 2GJ8A 5LU8A 4N0BA 4QU5A 4RCVA 3DLIA 3S8MA 4EO4A 2MR5A 4CMEC 3K6SB 4IG9A 4FLMA 2VHTA 4D42A 1WULS 3U62A 3V8RA 4BMPB 3FDXA 1JHMA 1UBSB 1I2AA 2RDPA 5AIPA 2BUAA 1FJ2A 4HDMB 1J39A 4PTLA 3BTLA 1QYVA 5TDHA 2QN3A 5J3JA 4D9EA 3QMPA 3R3VA 4V38A 4YJ3A 4HAZA 1L0BA 3WKCA 4RTQA 2PUGA 2CKDA 4CYCB 2Q2OA 4GXNA 3PFIA 3L8EA 2IKQA 4AF8A 4FB4A 3HY4A 2O03A 4KSBA 5BQFA 2H1FA 1NQWA 2I2WA 4AC9A 2WK1A 1RESA 5IVKA 1YJ8A 3FSRA 2DETA 2E5LB 4FX4A 3SXUB 2RMKA 1UFOA 1KYZA 4CV2A 5JAOA 2ZUDA 4O4LB 3K4CA 2IYVA 1BROA 1ZPDA 7REQA 1XVLA 4OJNA 3B1ZA 2E4ZA 4BEBA 1CU1A 2HPAA 1S7EA 2QDXA 2WSYB 3FLBA 1X7GA 4PE5B 2G9WA 1POXA 2VSXA 1SXJE 3AJRA 4RHUA 5CBKA 2O8BB 1T0HB 5FTLA 1QIHA 2BJWA 2Z5GA 3SC2A 4ZDLA 3DZ8A 5CVUA 1N8NA 1UBEA 4TZTA 3TD9A 2YV1A 3OQIA 2CFXA 4L8FA 1ZELA 4ZRNA 1H4SA 1B2LA 3DLCA 1MB3A 3G85A 4RVNA 3E2IA 4UAUA 4DQ0A 4RYLA 3C7JA 5KMGA 2QVYX 3K4PA 3HPRA 4EH1A 5BT8A 2QPTA 4B7UA 1QQ6A 2CW5A 4A8JA 4X0GA 3RSLA 5IKMA 1HR0B 4QT4A 5GAJA 4I9NA 2XQJA 2NO7A 2Q0XA 2FPWA 1VE3A 5BW8A 2D3WA 4E14A 3FYSA 2M6RA 3H1CA 4INZA 5LRSA 2ID6A 5HIKA 3OPXA 3F71A 4FLFA 1E32A 2C07A 3L93A 5E9WA 3S2GA 3TQHA 4CT4B 1ZAKA 2ZRHA 3AKCA 1GD1O 3PNTA 3JD4A 2UDPA 4B3CA 4DCMA 5IC4A 5JJLA 4XZ3A 5EP3A 3LVQE 1BI3A 1PYOA 2IYTA 2RB5A 3ILSA 3UYKA 3TLJA 3KLMX 1MDMA 5C1DA 5AM2A 3VAZA 3MSCA 2PMZN 1CRWG 1U6JA 1K4YA 5HVQC 1U7UA 2UYCA 4W8OA 5K0EA 2HNAA 1IDZA 5BQXA 1UBHS 3C3CA 1QHIA 5PGMA 4YIKA 1RYDA 4J1NA 2QD5A 3TGPA 3HM2A 3HADA 3I0ZA 1CHDA 2XITA 2FB9A 3G0BA 3IC5A 5CGQB 4PINA 4O02B 1U2DC 5JPDA 3TF5A 4G0UA 1UEIA 5FHRA 3TTUA 5J9FA 2AHOA 1ZMOA 2W6NA 5KSPA 1R7JA 1ZOPA 3MZ0A 4CF3A 4DPKA 4ZYAA 4B3XA 3FD8A 4G5SA 3DU5A 3LXRA 3KOZA 4N40A 4DWOA 5KNDD 5TMDA 5KYNA 2L7ZA 1XDBA 4MUYA 2CJYA 2HC9A 4QT0A 4C6RA 1KVQA 1KP9A 4XSVA 1DMRA 4QOEA 1CY2A 2J31A 1PW7A 3LYHA 4QDTA 5HKKA 3F78A 4X54A 4OUDA 2Q5QA 1MW7A 2FEXA 3VKFA 2GO1A 4LHXA 4KXFB 5AO9A 2FZVA 4O1HA 1WUIS 2AMYA 4TL8A 3TLYA 3T8RA 4C29A 4EHLA 3V1KA 5J40A 1A04A 3RIRA 2VHXA 3CGGA 4GZ6A 5K7ZA 2D5IA 1DRKA 2IGBA 3K32A 4HQ6A 4QOHA 3DPSA 4IV8A 2PKQO 3E5XA 4RF4A 3D5QA 4RXMA 4LCBA 2CYCA 2LDBA 3KWJA 1M2EA 5I3ZA 1ACLA 3HH8A 1QG6A 3WAJA 2SICE 1KZ7B 1MABB 4FQ5A 1E6MA 2IXEA 4LG1A 4ZI5A 3KXIA 1XCVA 1CZRA 4K86A 4NE9A 5REQB 3WGZA 2IPQX 1E6CA 5LGNA 2OCXA 2MHCA 3HUEA 3FXOA 2PLYA 1JI3A 1RWBA 2QI9C 5A62A 1GYRA 1WCYA 4YAOA 3T38A 3T3EA 1SVLA 3LFKA 1B8UA 4KMSA 4RZSA 4OPMA 2IPMA 2AC2A 5LMCA 5H81A 4LYYA 1YHQI 5IJZA 4REMA 3PIPF 4YFNF 3QM1A 4IKPA 1F7UA 1SXJA 2BRUC 4D8TA 1LPNA 4D0SA 1AKQA 2HLDD 5EHIA 1KYWA 2DYSH 1QZYA 1KBOA 1EP2B 3K1AA 3M6LA 4QFCA 5M5YJ 1M7BA 2CFTA 3BTSA 2GNOA 3F3KA 2OJED 1IAWA 3GTPJ 1OKKA 3S1LA 3CCJI 5HUJA 2ELHA 2Z1DA 1CUCA 1F5SA 2XYVA 1P5ZB 2PJPA 1UDAA 1CY4A 1KJJA 2C77A 2EKZA 4LJ9A 2H1CA 3R3JA 5TV2A 1RACA 4J16A 4B73A 3L9XA 2YBDA 4Q9DA 4DQLA 4Z1OA 1R6VA 2EF1A 1JJIA 4YUYA 3RYTC 1IIBA 5A03A 2JA5J 3MVPA 3ASUA 4RS8A 3PUHA 3RIXA 5A6SB 3MN1A 3G1UA 3KUKA 2JWTA 4OX9B 1YDEA 2E4YA 1SK9A 1EH6A 2R48A 2WUFA 3KAPA 3L8FA 3EDRA 3QKSB 4C3UA 1FIUA 3FNBA 1G291 1U8YA 5DYNA 3GO4A 4DV0B 4LXUA 4MCJA 4HF0A 2HOSA 4ZT6A 2P0AA 4OAZA 3E03A 3CUUA 3I04A 4FVTA 3M6FA 5JLAA 3TRJA 4E33A 1P77A 1CQIA 1PLKA 3QNWA 2GSWA 3PU6A 1IO2A 1NXOA 3OMYA 4B6OA 2WZDA 2P5VA 1QB8A 1NVVQ 1Z45A 2OHJA 3C2HA 4I2VA 2C83A 1G7TA 5ENDA 4AX8A 3R3XA 4QBFA 1RQLA 2WOOA 5LD2B 4GLJA 1ZC3A 1A77A 4Z8XA 5JXIA 2PZFA 2YUIA 2VKVA 4BNCA 1NURA 2X41A 1HYHA 4BNTA 3P5JA 5IP9J 3OBIA 1MX1A 3R9KA 1QIFA 4XB6B 1CS4C 3JYOA 5K45A 4OIQF 3OHMA 1J8QA 3PEVA 2F9MA 1PUEE 4GR4A 4JX4A 4HYQA 2C00A 2LD4A 4UBNA 5BR1A 1V45E 4RYDA 4Z9YA 1YQEA 3SQOA 1KFCB 3OZ7A 2O6LA 4AX4A 5ERGB 4ENPA 2UU9B 4OFZA 2JGDA 1WDLA 1NW7A 4N4NB 2AKAB 3U39A 3GFLA 3V7YA 5E8IA 2VEDA 1LW6E 1LFBA 3GPBA 1Y0NA 4IGKA 4XX0B 2VDJA 5DHTA 3D43A 3GLHB 4CIDA 1DE0A 1U80A 1TT0A 1NRXA 4E70A 1V25A 1W6UA 1XAIA 2EFHB 2WE8A 3UJCA 2O8VA 3OYAA 3M6AA 3TNDA 5MN4A 3AR3A 3I0MA 1BR4A 3ADOA 4AP9A 4UBJA 5LBTA 3QVGB 4ZPJA 2Y69H 2FPKA 5F3DA 1JDUA 4DYQA 4IFTA 2CF6A 2ZBFA 5BSEA 1IHUA 4HDVA 3A3YA 3G2IA 2QV7A 3KELA 3AXSA 4HYTA 3RYIB 1FUUA 4LXYA 1IB6A 1JG3A 2VXCA 3MWLA 1OWLA 4MGRA 3W6VA 2VAMA 1H8HD 3I8OA 3LP6A 4M49A 3VPCA 4DCCA 1FZTA 3PUZA 4PRKA 5AW5A 1ZUIA 3FCXA 3ZCTA 4A15A 4LJRA 1X14A 3BF8A 4AJ2A 2Z08A 3JZFA 4L5IA 3FW1A 1DC4A 3EIHA 2XAGA 1WZIA 4IWNA 4OGLA 2JRCA 2WUWE 2VJYA 3FCCA 3IAS1 4CM8A 4CV1A 2AYXA 2Q4DA 3W8RA 2BTOA 5TJJA 4P84A 1DOZA 1QS0A 1SKQA 2CFIA 4GP7A 4MVJG 3TOXA 3AFOA 1K6IA 2P81A 2YS7A 2GZMA 1BKDR 3HKCA 5DM1A 2OCPA 2FOIA 3OZXA 4G23A 3VNVA 5JNVA 4QC2A 5BN1A 3WA6A 1F51E 3OWTA 2C1ZA 1P0MA 3CRQA 2PUEA 2DW4A 3E1KA 1JAXA 2J3HA 1Z05A 1J4AA 5ILSA 1QYXA 1UWVA 1WUKS 1X1AA 2F8MA 3HHPA 2RD2A 2Y8EA 3BD7A 3IXLA 1XMOB 1VRCA 4HC4A 5KREA 4IYRA 1VPEA 2ROQA 1YI8A 4G4IA 5LP6B 1S4QA 3ZCUA 2QLBA 3LVFO 5E95A 3SFVA 1E1QA 3GNQA 4B34A 1KZ4A 4S12A 3FPHA 3NVAA 3K8OE 4MR8A 2H52A 2O2JA 3DQQA 5HFNA 4A0GA 5BUZA 1W36B 1M0SA 2R5YB 3Q0TA 1OYVA 2RE8A 3QXCA 2B1JA 4TLCA 2OCLA 3GJXC 2JHAA 3HGQA 1VKZA 1J8YF 3AIOA 3UMGA 2AOVA 2GBLC 1AV6A 3COSA 4K6CA 1SQFA 1TU4A 5ECDA 4WJKB 1V7CA 4CIXA 3OX4A 5E2BA 3PHHA 1P7IA 3LPDA 5BSMA 3TJRA 4Q5SF 4PIPA 3U4QB 1QRUA 3GLFB 3HTUA 3IP3A 2ZR0A 2W37A 2ZYIA 1H3EA 4ND3A 3EGCA 1PGQA 2QSYA 4JOMA 2QTCA 2TMKA 4H4DA 2HXIA 4C4RA 4JGGA 1NBME 4KW7A 4TVBA 1EBUA 4QVIA 3UKOA 3CEAA 3BZKA 1BD3A 2XKBA 3JZAA 4URYR 3HXOA 1HKQA 3ZBQA 3K9GA 1DU6A 3P9NA 4YDRA 3GQVA 4I5IA 2ZYHA 2F4OB 3F47A 3FHLA 1NTCA 2GN4A 5F3RA 1BKYA 3F23A 1IRIA 2JPCA 4XNFA 4PHCA 2VZ0A 4X66B 1FVXA 3V97A 3DM5A 1VA4A 4YONB 3QJGA 4MROA 4NX2A 3P96A 3IRRA 3DMHA 3NIWA 1RUNA 1EFAA 1BJZA 1HE3A 5EP1A 5JAQA 5AW3A 2W58A 2A05A 4HT3B 3TDUC 3CLTD 4E7KA 5DFAA 3F46A 4OBEA 3UAGA 3HG7A 4QWMA 2VJQA 5IYZA 1Q1QA 2GBCA 4MIMA 3MCVA 4Y9RA 5DWVA 4XGNA 4DY6A 1OFUX 5BUSA 1CNFA 4B3MB 4YV0A 2BGRA 1CUVA 1NUTA 1FYKA 1YMQA 4KVFA 3ASYA 1X42A 1I4DD 4L78A 5EL0A 3HYSA 3OCCA 4BQRA 4U00A 3S1AB 2UV1A 3AERA 4D9JA 3EZLA 1E3SA 2FHSA 3NBKA 4DIEA 1ARZA 4ENTA 4YXFA 1GLGA 1P5RA 1K68A 2RFLA 3BFVA