4A6DA

Crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
347
structure length
345
Chain Sequence
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARKGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords HYDROXYINDOLE O-METHYLTRANSFERASE
total genus 124
structure length 345
sequence length 347
ec nomenclature ec 2.1.1.4: Acetylserotonin O-methyltransferase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF16864 Dimerisation2 Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a6dA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4a6dA02
3E5QA 5LHIA 5AIPA 3BXOA 5D5VB 2Z9OA 3K69A 2E7XA 4GBED 3KQTA 5IT9K 2DLLA 5F2OA 5C0OE 3TFWA 1V39A 3FM5A 2VOPA 4HH4A 5HS8A 2DQLA 1X19A 4P9FA 3DEUA 2PJPA 4F86A 4IF4A 5DM1A 5FWDA 1B9MA 2ORED 1QBJA 2FRHA 5K0JA 2B0LA 2L01A 3JTGA 4CGZA 4E2ZA 1TQIA 2BBYA 1K78A 5CCBA 4K6MA 3A27A 1HKTA 1OR7A 1IZ1A 4RWZA 2IW5A 4RTJA 2DPMA 5LRSA 4UVBA 1IAWA 3TM5A 2Q41A 1IN4A 5FHQA 3BT7A 4DMGA 2FBHA 3HOSA 3BGIA 3I5UA 5CLSA 3HM2A 3IL2A 3KQWA 2DT5A 5DDGA 2QBYB 4G56A 2H27A 3KFWX 2HWKA 4A0XA 4FZVA 1YW8A 4XBFA 3TR6A 4JXJA 5BMZA 3IWZA 3KKZA 3MAJA 5FLXZ 5E1ZB 1DPRA 4IRHA 3TRKA 5E8IA 2AS5F 2H6CA 2FYTA 2V1UA 4RGRA 1HQCA 3UJDA 3HA7A 2YSRA 1BKYA 1M6YA 5LQUA 1C0WA 1WI9A 3DP7A 3WTZA 3IHUA 2LD4A 3CTAA 1ZAOA 5D1HA 5L3BA 2ZZMA 2HR1A 2BH2A 2ZIFA 5LQAA 4ENKA 2PLWA 4AD9A 3J7AO 5DX8A 3RODA 1QANA 5DYMA 5E1XA 4OMYA 2W25A 2NXCA 3P2KA 2YX1A 2XAFA 3P7NA 4P7KA 1ZH5A 2GZWA 5KQSA 3IC7A 3IKVA 4HGZA 1XGOA 1LDKB 3CGGA 5HS7A 4N0BA 1QZZA 1NV9A 2FHPA 1F38A 4E32A 3NWEA 3HSRA 1RJFA 3OZSA 2AN5A 1OYIA 4XUCA 1F9NA 4RVFA 5T64A 5F2NA 3KEQA 1IRGA 4C06A 2PMUA 4O5VA 5HLGA 3B3JA 2PWYA 1O9GA 4R6WA 3FMSA 3FTFA 9MHTA 3M9AA 2AOTB 3HTUA 4UNOA 2AS0A 1BIBA 1AQIA 5FUBA 2IH4A 3WU0A 2BZGA 2QYOA 1FPQA 1R74A 2BR5A 3M4XA 5CVVA 4H0EA 5E1WA 4PGHA 3SZPA 3PFIA 4Q48A 3BJAA 3HCBA 3JW4A 1GHCA 3A7EA 3JWJA 2ZLBA 3CUQB 4A0ZA 2VBXA 3C1DA 2D45A 4E33A 3HTXA 3CJTA 2EFPA 1USSA 2VDVE 2FE3A 1S6LA 4I02A 1R1UA 2VBWA 1O3QA 3DMGA 4UOEA 4CWAA 2E7WA 1RI1A 4A6EA 1VIDA 2ZIEA 4AZVA 2KIUA 5LQJA 3HCDA 4R79A 4CTKA 2GA9A 2XASA 4GYIA 3MEXA 5LHHA 1JE8A 1JG4A 4KYWA 5GINE 3QOXA 5EMMA 1XDZA 3K1PA 4LLNA 4JK1X 2YU3A 5H6RA 4M9ZA 4ZH4F 5DEQA 3RKWA 1B59A 1J7KA 4PYLA 4HTFA 1DPUA 2HOEA 3MAGA 3WG9A 2XKPA 2L3DA 1SD6A 3DTNA 3JWIA 3IWFA 5TRDA 3MGGA 1IXKA 5K0CA 3KP2A 4KFCA 5P8WA 2CG4A 2C7RA 2QRVB 1G38A 2HKOA 2HQRA 1B4AA 1STZA 1YLFA 5L3EA 3R24A 5E1DA 2P8JA 4FX4A 3SZTA 2NXJA 1BC5A 4IJAA 1LDDA 3SVZA 3C18A 3G2QA 3ISPA 2NRAC 4WVLA 1RNLA 1SAXA 4H0NA 4EV0A 1B42A 3MFKA 1T2KA 2ZWVA 4KIGA 3DQVC 3EDPA 4QTTB 3UWPA 4OINF 5K0LA 1N2XA 1XCVA 1YZHA 2PX4A 3GNLA 5DV5A 5DRYA 4IXAA 3SMQA 4XSXF 3L7WA 4CZZA 3UJBA 4BLVA 1AWCA 4YV0A 2EK5A 4EM0B 5T6BA 5E1BA 3IYLW 3FUUA 1F3LA 4PIMA 1SFXA 1NT2A 5EOVA 3LL7A 4CKEA 1V4RA 1ZRDA 4CHUA 3FRHA 4FGZA 3GRZA 1BOOA 4FSDA 2H09A 4FT4A 2CFXA 2JPBA 1BOAA 3WE3A 3SSMA 5EQJB 2D1HA 4O29A 2CGPA 2JG3A 5FULA 2D1VA 1G3TA 4DQ2A 2H11A 3EVZA 3OFJA 2DW4A 4EMSA 4C05A 1K79A 3HTSB 1JQEA 1GXQA 4WCGA 3KE2A 4BNCA 2P35A 2Y75A 1OMIA 3KQMA 5M5BA 3RYPA 3HVIA 4RB1A 3KP6A 2STTA 1JHFA 3O2PE 4WXDA 1QAOA 1FSHA 4QVGA 1D8JA 3RJPA 3CDHA 1DUSA 1IW7F 4OA8A 3VOEA 2JPCA 2ELHA 4X41A 1TLHB 4YV2A 2I7CA 4ENNA 5ICCA 3QAHA 2HFHA 2VE8A 1L3LA 3SM3A 1M6EX 2K27A 2X0LA 4A5MA 2QENA 1CF7B 1NW7A 4OQEA 5EKUA 5HEKA 3F6VA 3FUXA 1X1BA 3CCFA 2H94A 4C03A 3LA7A 4OBWA 2A5YB 3PX3A 4V0QA 3FMRA 4KNYA 4UVAA 5HIMA 4MHGA 4RGSA 5K1YA 4HF1A 2ZFWA 2ONYA 3K9TA 4X1OA 2GWRA 5JVTA 3PFGA 1R8YA 1OYWA 5HFJA 4HA8A 3CUOA 4WWCA 2PWPA 4MTEA 4I01A 1BI0A 2VODA 1KPHA 2YR0A 2NP7A 4HF2A 4XCXA 5HOQA 3V8JA 1SFUA 3V4GA 1VLMA 4S05A 3G5LA 5AONA 1SVUA 1Q0SA 1FSEA 3FXRA 3FRIA 5EC8A 3LA3A 2AN4A 5MHTA 3BY6A 2NAZA 3GZ6A 1I6XA 3ULQB 2ESHA 2ZULA 1GVJA 2EV5A 5LR6A 1I1SA 2JZYA 4CYDA 2OBPA 4HLXA 5AIQA 3QRFF 1LEBA 1NW8A 3KQSA 2QUFA 5EGSA 3RPUA 1I4WA 4MQ4A 5DUIA 1SMTA 3UJ6A 4HV5A 3I54A 2A68F 4PONA 1S7AA 3OU6A 4GXOA 4WX9A 5JHUA 3QU3A 4BP1A 4I0BA 3JSPA 1Z3CA 3RTRA 4B17A 1HW2A 3I59B 2AOTA 4MQVA 2B78A 2MA3A 3E6CC 3SXYA 3OCJA 1NW5A 3LDFA 3OE4A 1NV8A 1ZYRF 2KKOA 4TV7A 4Q4ZF 2WV0A 4NQWA 3HA5A 2KJCA 5EIFA 1W5TA 3R9XB 3NQOA 5DCMB 1J2XA 2I6GA 1NW6A 3UA4A 1AQJA 3ML6A 4EM1A 4R8SA 4L5JA 3RKXA 4GQBA 5ED4A 2HGCA 2RKHA 4EJWA 1OKRA 5FO5A 1FP1D 5K0GA 2CMHA 3QP5A 4Y15A 3N4MA 4ER7A 4RB2C 4KMFA 4QTUB 3ELDA 3TPZA 1IY9A 1O57A 4KDPA 3RIRA 4CO8A 5CCXA 3QPHA 1LB2A 3BZ6A 4M7RA 3PX2A 2GA2A 3UJCA 2ADMA 3BWGA 1TNTA 1H9TA 2XGXA 3B02A 4MIKA 3T1BA 1I1GA 3BJ6A 3JAMZ 1DDNA 4FT8A 3T5XA 3GU3A 2FOKA 2G70A 1YYVA 4F7ZA 4L9TA 2Z33A 2W24A 4BHBA 1XD7A 4ZYGA 1UWVA 2MBFA 4UV9A 5E2BA 3ME5A 2CKDA 4C07A 2WC2A 1FBUA 4Z2YA 1XDUA 1KR5A 2V9VA 1YFHA 4PYNA 1U78A 1QAMA 1G60A 1I9GA 1RI3A 5CD1A 1SMYF 2HQNA 4U7PB 5LBQA 1I5ZA 2OB2A 3F8FA 4RVDA 1G4DA 1T0FA 5BS6A 3KEOA 3ERED 4GCVA 5TJJA 5DT2A 5T67A 2J5PA 2EA2A 1RI4A 4E70A 2K4JA 5JI6A 1E2XA 4AX8A 2EFWA 5DTRA 1X1CA 3T8TA 2YXEA 1O3RA 3TOSA 3EGEA 3BWBA 4BYYA 2HDCA 5K05A 3PFHA 2P6SA 5H20A 2VBZA 3EVCA 4UVCA 2ZNZA 3REOA 5E17F 3UJ9A 1FWZA 3KPVA 3O7WA 5E1OA 3C6KA 3BOQA 2ZO4A 2FEZA 3IRQA 3KP5A 3V97A 1BM9A 2UXXA 4POOA 1FBQA 5L3GA 1EAMA 6PAXA 3ZQ7A 5ICEA 4L7VA 4RV9A 1Q1HA 3K1MA 5D5UB 3HCFA 3LPMA 3CJNA 1IN7A 2M8EA 1PRYA 2P1DA 3KQVA 4EKGA 1L1EA 1NHAA 3RDIA 5E1MA 4HAMA 2RC4A 3K1NA 1KQ9A 2QWWA 2A3SA 3B5IA 5FGMA 1KPGA 5DXAA 3MZYA 1GXPA 2BGCA 2G7HA 5JUWA 3A7DA 3I59A 1LNWA 4HOBA 5L3CA 5DX0A 1YFLA 4HG2A 3LA2A 3DR5A 3HNRA 1F4KA 4PYQA 2COMA 4LG0A 3A26A 2XIGA 2YUIA 3HRTA 2VDWA 2RN7A 2C7OA 1SQGA 2R6ZA 2HTEA 4NECA 3LECA 2P40A 4XRFA 4QLCU 2UYHA 2RDPA 2QM3A 4PYMA 4MEYF 4IV0A 4YV1A 5HOOA 5E9WA 3EEYA 1NBIA 4OA5A 1T38A 4AZWA 4KDCA 2UYCA 2P4WA 4I2OA 4DCMA 2VT2A 3CUQC 2ZKZA 3NJRA 5DWQA 4BHCA 2VXZA 2DQRA 1Z1DA 3KR0A 4FS8A 2ESNA 2P5KA 2NNNA 4ENMA 3IEIA 3SFZA 3LFKA 5C9ZA 3UA3A 1XTPA 5ILVA 4UXNA 1KYZA 5LHGA 2O3FA 1IXSB 3I64A 4HGYA 3KCCA 1KQ0A 3EVBA 1AF7A 1D2GA 2F5DA 1EH7A 4BHPA 2C7PA 1G6Q1 3QOPA 1HSJA 4GOMD 3THRA 3JWGA 5EMJA 1JHHA 2CMGA 5D8KB 5E18F 1QZYA 4ESBA 2ZZKA 2DPDA 1D2HA 2FA5A 1Y0UA 3Q5FA 1ORHA 1S3JA 5F6FA 1BI3A 4G6DA 3PQJA 1FLIA 4YG2F 4GUAA 4U7TB 2FPOA 1JG1A 2Z3YA 5U4XA 3HEMA 2IA0A 4M72A 3HA3A 3P2IA 5DCMA 4LB5A 1YIOA 3PVCA 3BGVA 1BIAA 3P9NA 1VL5A 3EPPA 4AVPA 4Y13A 2HYFA 7MHTA 2IA1A 1SFEA 1WG8A 3F22A 1HBXG 4GYGA 1KPIA 4WXHA 1U5TB 1ZRCA 3W6KB 1REPC 2IA2A 4PCAA 2ZIGA 2H00A 2PX8A 4KWCA 2K7LA 5KQRA 3JTHA 4M71A 4F84A 1EJ6A 4RVGA 4P7JA 2L4AA 4D0PA 2BYVE 5G02A 4R8HA 2VS1A 3EVGA 4C04A 2A69F 3FZVA 4LB6B 5H6QA 2VP3A 2O8XA 3WGIA 3A4TA 2BE5F 3WSTA 4G9YA 2L54A 3BROA 4UV8A 3PT9A 2GQQA 3AXSA 3GRVA 2PXAA 4ESJA 1FY7A 2L02A 1J9IA 3FZGA 3RKYA 3E6DA 4U7BA 3WTSC 2EJTA 1LDJA 3IV6A 2C6YA 3PB3A 2ZTHA 1QGPA 3LDUA 4WF2A 2ZNYA 2JSCA 3HSFA 4E2XA 3R6TA 4KIBA 5FADA 2V74B 3FPEA 5EEHA 2RGVA 1VP3A 3F8MA 2AOUA 2PN6A 3G89A 3EVAA 2IH2A 5F1RA 3AXTA 2DFIA 3CBGA 1TBXA 1D3YA 4PGGA 4QQKA 2TDXA 1G3YA 4E2WA 2OY0A 5FFZA 1XMAA 3F6OA 4RX1A 3C7JA 2FSWA 4RGUA 2CWWA 4CXFA 1FBSA 4E30A 4LLLA 1FYMA 3FMQA 4P55A 4GC5A 4G6QA 4IRIA 5K0EA 5K5QA 3KLOA 1H9GA 4I09A 1SD5A 2DO7A 4MNUA 4RSRA 1QNTA 2IBTA 1W4MA 3LCVB 3HRSA 3MCZA 2CQKA 4HBLA 4G8XA 2GXGA 5K8VA 2H6BA 5ICGA 4DQ0A 1RI5A 4GC9A 5EVJA 2ZMEB 2YXDA 2CL5A 4MGRA 1B6AA 2P6TA 2IFTA 2XVMA 1ZHFA 3CVOA 1XJ5A 1WKMA 4OU0A 2OPBA 5HS9A 4LFUA 5HDGA 1R5HA 1XCJA 1Z91A 3IHTA 1HW1A 4XLNF 4L9NA 3DOUA 3VODA 4M37A 1ZGJA 3TKYA 2AOXA 4DF3A 2I9KA 3R0JA 2QZ8A 2IGTA 1XB4A 2XV4S 3MCTA 3EEOA 1R58A 5CVEA 4X63A 3OOPA 3T0IA 5ILUA 2P3QA 2MLKA 3RPQA 5DSXA 4OMZA 4P7GA 3ZMUA 5FHRA 2WWYA 3E23A 1UB9A 5LQNA 1R18A 2ISYA 1Z9CA 3KR1A 4I7HA 2XYVA 2Y1XA 5E8GA 4R6XA 2A61A 3V8KA 3QOWA 2P7VB 3EVDA 3HVJA 3E6BA 4P7FA 5CVIA 3GCZA 3WTXC 3DUWA 2OQRA 1MKMA 3FTDA 3L00A 4ETSA 2GA1A 2E1NA 2P5LC 1ODDA 1U6GA 3FM3A 4LLGF 4R1HA 3MQ0A 1Z6TA 4PINA 3I71A 3DPLC 2Y48A 4KT5C 2P3OA 5DX1A 2STWA 1K6OA 3TO6A 2P8TA 4ZTBA 4GOLD 2G9WA 3W6JB 2XAHA 1JR4A 1SD7A 4QDKA 1QPMA 2MLGA 3LAPA 4QPPA 1FT9A 5GIOE 3T0YA 1ZG3A 3ANXA 4G7OF 4XSZF 3CO7C 2A6EF 2G8NA 3UJ8A 1PP7U 4EGYA 3NWBA 5GIPE 4RTKA 3R6SA 1BJAA 1S7OA 1T98A 2ZSUA 5JFRA 2Q8KA 5BPDA 1P92A 4QPNA 5FQOA 1WQ2A 2PV0A 5EHGA 3FTCA 4AIKA 2BV6A 2QQ9A 4BLWA 3NVKI 1XN7A 4C08A 3V8LA 1ON1A 1JTFA 1YS6A 4MTDA 5GP1A 3GJYA 3SR4A 3ZMVA 3ZMDA 2P41A 2IPXA 3KHKA 5GOZA 4MHTA 5KVRA 3Q87B 3BKWA 3KQPA 2PT6A 4GGGA 3P71T 2O03A 3ELYA 1LEAA 3HYIA 3KPJA 3KU1A 2ZW9A 5D4SA 4KUMA 1L3CA 5HLIA 4M9SA 1MZBA 3N97A 3C6MA 1UIRA 3HHHA 3LCCA 1JQ3A 3LQRA 1ZARA 1YUBA 2JHPA 1CF7A 4GOND 5DD8A 2FK8A 4L0ZB 3KQOA 1LQ1A 3WE2A 4B8XA 3ABUA 1FOKA 3PQKA 3SQNA 5EPEA 2M1BA 2GXBA 2O57A 3P2EA 2XHKA 3FUVA 3K2ZA 4NB5A 3WGHA 3CJQA 5E8RA 2JTVA 2IDJA 4CXMA 2VDUE 1EV7A 2ZCJA 4WK8F 3NEUA 3R4KA 1UHWA 1FP2A 5K5RA 5F2KA 4M6XA 3ELWA 2B9EA 2NYXA 3PS9A 1R1TA 3MTIA 5D5WB 1EH6A 2F5EA 5E9QA 4IKPA 1Y8CA 3TKAA 3O3KA 4HDUA 2K02A 2NXEA 1YTYA 1ZG5A 4ZZDA 3T7SA 2EFOA 3GO4A 2GLUA 4KMUX 1NBHA 1J5YA 3GDHA 2IVMA 1O9HA 3VFZA 3VYWA 2IT0A 2AOUB 1J75A 1FBNA 1G55A 4ENJA 3J81Z 2DPUA 1HKSA 5DTQA 3DPTA 1R22A 2DK8A 1XSDA 4OOIA 3DXXA 4LG0B 3P9IA 5HIIA 1J59A 5FB2A 2EFJA 1U5TC 3LDGA 2PSSA 1YQAA 1KIAA 3ZMSA 4OIRF 5FD5A 4FR0A 5LEJA 4LK0F 3KR9A 2VE9A 5L3FA 2LNBA 4RB0A 3CO6C 4HYEA 1WS6A 3H3ZA 3FYCA 4GOOD 2ISZA 5LEKA 1ORIA 2ADUA 3FPHA 3WTTC 2WK1A 5EG5A 3S68A 4PYJA 2A07F 4KRGA 4L9JA 4LECA 3E6MA 4ESFA 1MHTA 4EJVA 2B2CA 1R23A 2O05A 2EB7A 3A25A 3MHTA 4PYOA 3DKWA 1RJDA 1VQ1A 3K6RA 4A5NA 1ZLKA 1P2FA 3BDDA 2FBKA 3E97A 1XCLA 2G72A 4RS8A 4ON0A 4Q47A 5HIKA 1U2ZA 4HTFB 1MJFA 2FRXA 3GUDA 4EJOA 3K0BA 1QYRA 3O4FA 3VSEA 2ZJ2A 1R00A 2ZBQA 2O06A 5E20A 3BWMA 5F64A 2A6HF 5L3DA 1P1CA 2M45A 3M7GA 4FHTA 3D0SA 1YZ3A 1HSTA 1BN5A 2IPQX 3I53A 5HIJA 3R61A 4RAYA 5LGUA 4OIQF 3EETA 5KK1A 1R6AA 1T39A 5E9JA 2CYYA 2UYOA 2F5CA 5LGNA 2NNWB 2HZTA 5DCFA 4EJUA 3MQ2A 2HNKA 3H2BA 3M8FA 2O07A 2RV8A 3CJRA 2OU2A 3P9CA 3ECOA 5LGTA 1WSUA 2L4MA 2KRFA 2VBYA 2OQGA 4L5IA 1YO5C 4PIPA 1KU3A 3G73A 2JJQA 5IT9Z 1RIOH 3VEPA 5FLXK 3AAFA 2ERCA 4BP3A 3KETA 5BW5A 5DUKA 2AVNA 2PBIA 3GRRA 3FUWA 1UCRA 1NW3A 2FBIA 3K0LA 1H0MA 1KU9A 4EKIA 4AIJA 2JRTA 3B89A 3HCEA 3ORHA 4YUYA 3LWFA 8MHTA 2P5VA 3B73A 4E2YA 3HVKA 2P3LA 2RVCA 3WGGA 4XLPF 4HSGA 4OIPF 4HX4A 3C3WA 2K86A 1VP9A 2PT9A 1YS7A 3F72A 1MDMB 4N9HA 4HRAA 1TTYA 2KJBA 2WA1A 3PTAA 4YMHA 4S04A 2YPRA 3MB5A 1O7LA 3IRRA 2AR0A 4NHJA 1XCBA 3KLNA 3UZUA 3I9FA 1TNSA 2YX4A 2UZKA 1IXCA 2PJDA 4IHSA 3TO7A 3R0QA 2GPYA 4F85A 5BPIA 2ZWAA 3U9GA 3GZ5A 4MWZA 2YTZA 3M8EA 4HDVA 1VTNC 4KN4X 3EMBA 2IIPA 3TDUC 1E17A 4HC4A 2XRNA 4A2UA 2NNYA 1H1DA 1PJZA 3GYHX 2XBMA 4A12A 4LWPA 4AWXB 2EJRA 2M30A 3CUQA 3EQLF 3HOTA 2QY6A 3OPNA 3ROUA 2W85A 3HUGA 5DPMA 1KXZA 1OPCA 4KVZA 3DXZA 3Q9VA 1SUIA 4OX9Y 5EIWA 3EMDA 3T7TA 4BH9A 2YXLA 3AY0A 2PXCA 1YW7A 1KU7A 3DULA 3KR2A 1FJXA 3BKXA 3BUSA 1R7JA 3EGIA 2MH2A 5FA5A 1JTEA 4M6YA 2OBFA 1ZG1A 3AWIA 2Z6AA 1HW5A 4GF5A 5BQTA 2ZMEA 2VC1A 4HF0A 2HS5A 1MGTA 4P58A 1N7IA 2CWEA 2OKCA 1T6SA 3THSA 5ILSA 1HNNA 4AIHA 4R05A 2BM8A 3KP4A 3GVAA 3RW9A 3HCAA 2O6GE 3OZRA 3HSEA 2MC3A 3JAMK 3M33A 1BI2A 1NKVA 4DKJA 1JG3A 5KS2A 5CVJA 4EVIA 1ZGAA 2E1CA 3WTUC 1L0OC 2EG5A 5HILA 2LF7A 3KP3A 4GEKA 4FP9A 3R60A 1SQFA 2HKXA 2FXAA 2FK7A 4LMYA 1IN8A 3GX4X 3LHDA 5E2AA 1X1DA 5K0NA 3I0TA 1L3IA 5IKMA 2FF4A 1HXDA 1D2CA 3TDZC 2HTJA 5B1SA 1WXXA 4I0AA 2XYRA 3QP6A 3F21A 5LLQA 3ZMTA 1RUNA 3WTYC 1FYKA 3KPUA 1KA8A 4IPAA 5BP7A 2GAUA 4RTPA 2F5FA 3ABTA 3L8DA 3DF8A 4XUEA 5LQCA 4OIOF 1EH8A 4AZTA 2AOVA 2JH8A 4RTLA 3F4KA 4EQQA 2UWMA 1XVAA 2AVDA 1X3UA 2E5WA 1DUXC 2QBYA 3FPGA 2GIVA 2WTEA 1YG2A 3VB2A 1KHHA 3LX6A 4EJTA 1P91A 1PDNC 2PI0A 4PYKA 5EZQA 1KYWA 2DULA 2WA2A 4RTMA 4G94A 4U88A 2AXLA 5LRRA 5DM0A 3G3ZA 1JSZA 3D5LA 3M6WA 1RUOA 1VE3A 1ZKDA 3ELUA 4AZSA 3J80Z 2FCAA 5J8CA 3V7RA 2IBSA 2YX7A 5DM2A 5K0BA 4P5OA 2XVAA 3FUTA 3SSNA 2QQAA 3G88A 4R8RA 5D6EA 3BP8A 5D1NA 3NVMB 1Q0TA 1P4XA 1BC7C 1Z7UA 4PZJA 3LCUA 1FNNA 3SGLA 3G2PA 3HRUA 5EMLA 3UJ7A 5EEGA 4DM3A 2Z6QA 3TGNA 5DLYA 2UYQA 2G71A 4M38A 5J8FA 3EVFA 2PQ8A 3FWEA 2QQBA 4UHTA 4LWOA 2ZCWA 2V1XA 2VONA 4Y2HA 4IHTA 3LSTA 1OR8A 3ELKA 4MQ9F 1G6NA 4P9UA 1ULYA 5EKXA 4OQDA 4BLUA 4MEXF 3DFGA 4G7ZF 3BGDA 2P7HA 4X60A 3GFIA 1U8RA 4RTQA 1EIZA 2G1PA 2ZZNA 4JBAA 2NP6A 3E8SA 4CKCA 1RJGA 3GGDA 1P1BA 2MH9A 5IH3A 3V8VA 3B3GA 3V7CA 3ER8A 3QU6A 1DP7P 1S8NA 2FU4A 2OO3A 1TW2A 5HVQC 3HCCA 4HX8A 3O6BB 3OZTA 3GFLA 1P4WA 5EMKA 3LAJA 3R0AA 4LG1A 3FPJA 3LBFA 1WWXA 3ZN0A 2KIMA 1PUEE 2XKOA 3FXUA 2B3TA 3KZZA 3P9KA 4B09A 3Q7EA 3I58A 3U1DA 3CLOA 2M87A 3I4PA 1R5GA 1KGSA 4YIFA 4PNEA 4IVNA 3E5XA 4BXUA 3GW2A 2O0YA 3LKZA 3KZYA 3OE5A 4FT2A 3WTVC 2M5WA 1J0RA 4C4AA 5KVAA 4M36A 2LSOA 1RI2A 2DBBA 4RAZA 1WXWA 2JH9A 3M6XA 2YR2A 3FHZA 3CKKA 2LDUA 3NRVA 2BR3A 2W57A 3J81K 1A04A 2D2WA 3DXJF 5LSAA 4MTLA 1JXSA 4YUXA 3TMAA 2Z5UA 2HTSA 3TOBA 1YB2A 3GIWA 3M6UA 3B7PA 2PXXA 3EYIA 3GFJA 2PG4A 2V6CA 3M1EA 4DCGA 1Z05A 2XAQA 3TQSA 10MHA 2QLZA 2DTRA 2R7FA 1KQ8A 4CDGA 3SSOA 4Q5SF 4HLYA 4HQMA 4OBXA 3KPYA 4RTRA 1JG2A 2QRVA 3AJDA 5DM4A 5DTMA 5ERGB 4RYLA 1S29A 2EV0A 2W84A 4L0YB 1HMYA 3DH0A 1L3BA 2C7QA 1XDSA 3DMFA 2F8LA 1XXLA 2K4BA 3EYYA 2OYRA 2IDKA 1ZRFA 2AOWA 5K0FA 1F1ZA 2GB4A 4UUVA 2DU9A 3HHGA 1G8AA 4JQFA 2X4HA 2Y1WA 1SUSA 1FYLA 1O54A 3ECHA 1SD4A 2R3SA 5A2QK 3MERA 3NDIA 5EZSA 3L09A 4M9XA 1PP8F 2FQ3A 5DD4A 1JGSA 3GO5A 3L2CA 1WY7A 1MDMA 3G2MA 5CVDA 1TQPA 2F2EA 2DK5A 4DZRA 2UXNA 5DSTA 1G3WA 4KIFA 4YUWA 3COAC 3HIFA 4YFKF 2OA4A 2PLYA 1ZREA 4ER5A 4ASNA 2EWNA 1TW3A 2HV9A 5ICFA 2Y0MA 1FX7A 4HX7A 1QO0D 2ZBKA 2GAFA 2UZ4A 3ID6C 4A6DA 1INLA 4KN7X 3NDJA 3U81A 2EJUA 2IP2A 3EUHA 5BXYA 1O3SA 3BWCA 1LJ9A 5D5XB 3BJOA 4CICA 2HMYB 1W5SA 2ETHA 3E3VA 1L9KA 1FZPB 3QV2A 3G2OA 3TO9A 4YFNF 3F8NA 3DLCA 3DV8A 5E8JA 1SG9A 4HV6A 3KPWA 2Z6UA 4U0YA 1B9NA 4RB3C 4G7HF 2NXNA 5CUQA 2ZFUA 1R8XA 4YIIA 4PCQA 4O6JA 1IUYA 2PX5A 2OXTA 2VN2A 1IRFA 4DNCA 1W7PA 3BPXA 3V7SA 5K5OA 3FXQA 3MZHA 2GS9A 2YQZA 2OZVA 3G5TA 3ZMZA 4ZZLA 5K09A 4ZYHA 3LGAA 1HKQA 1ZLJA 2DI3A 2CW0F 2PFBA 2VT3A 4BQAA 1G8SA 2YVLA 4IV8A 2B25A 3NW9A 3R3HA 5H02A 1XSVA 1O7FA 2JT1A 4BAYA 3QPTA 1Z6RA 2EV6A 3GFMA 1JSXA 1MD0A 3KQQA 3DXYA 4IRGA 1YF3A 1O3TA 5CM2Z 2DAOA 3RYRA 4YUZA 4RTNA 2CSOA 4YUVA 3RI4A 4E31A 3FTEA 1UFMA 2I62A 1YW9A 4O3MA 4U0VA 5FTWA 1QAQA 3FPFA 1MJBA 3P8ZA 2HEOA 4AUKA 3BZBA 3NMUF 5HLHA 2MD5A 1XGMA 3G7UA 3L9FA 5GM2A 1P6RA 1BC8C 2LF8A 1BHJA 4V0RA 2H1RA 4HZFA 3GWZA 3DMHA 3X0DA 4ER0A 3G8AA 3GXOA 1ON2A 1USTA 3WODF 1KU2A 1DL5A 1N7JA 1F5TA 5FA8A 3TQNA 3LBYA 3LQQA 2AZTA 5LQRA 5C1IA 2PGXA 3TM4A 4PCLA 2ONZA 4ER3A 5D6FA 1R1VA 2EA4A 4RGXA 5K01A 1XGNA 3PLAE 3E7PA 2PMHA 5FCDA 5HDKA 3UBTA 2EX4A 3G8BA 1W7PD 4K2EA 3SX0A 4YMGA 2JHAA 2PY6A 5D8LB 1FC3A 3U2RA 4ISCA 4BY9E 2OZ6A 3M70A 2FNPA 1I27A 2NYUA 1VBFA 4LK1F 4WXCA 2KIFA 3F8CA 1IM8A 3MTEA 5KYGA 4EGZA 2FNAA 2QVOA 5CIYA 4GO1A 3WU1B 1RI7A 2OZUA 1K7AA 2PEXA 3FYDA 5CJ9A 4ZYDA 2KW5A 5FFXA 4A0YA 3E5UA 1D8KA 2FMYA 4YFXF 1P4AA 3HP7A 4CKBA 4RVHA 4ER6A 5CVUA 4Y30A 3GRYA 1G3SA 1V3FA 2RNJA 1IXRC 5BOXA 3BWYA 4PWYA 4EM2A 2IRFG 3M6VA 3T7RA 1LVAA 2EFQA 5BW4A 3FX3A 4N9IA 1MJ9A 1R36A 1M0EA 2Q2EA 3CC8A 2VOOA 4LJZF 1VPTA 2ZBPA 1I1NA 1EQAA 1BBYA 5FD6A 4HQEA 4QDJA 1YFJA 3H3UA 3OV8A 3SHFA 2XROA 2OAZA 2CO5A 4P96A 5EHIA 4U7DA 3BPVA 5HZMA 5JR3A 4ZYEA 1UFKA 2R7DA 2RQPA 2N47A 1EJ0A 4LD5A 3VC2A 5GM1A 1KP9A 2XVCA 3IKTA 1EG2A 3UFBA 2PBFA 1U5TA 1DCTA 2ESRA 5D4RA 3RIEA 1T43A 1W7PB 1K78B 5HDNA 2Q0OA 4DA4A 3F8BA 3UJAA 1TQMA 2BM9A 2EFNA 2ZXJA 2HR3A 3HVHA 2OB1A 4U0WA 4FX0A 3VC1A 4M74A 3ZN1A 4KICA 3E05A 1RZ4A 2LKPA 1IF1A 3FF5A 3Q9SA 3ZPLA 3OU7A 4QQNA 4M73A 1IN5A 4ATNA 4RTOA 3B3FA 3DLIA 4X61A 3O31A 5ERIA 1TPYA 3GEZA 1AOYA 2XYQA 4KDRA 2QE6A 2OD5A 2VC0A 4IWNA 3C3PA 3T8RA 2Z99A 1XGSA 1JQDA 1MJAA 5K03A 1IN6A 4EK9A 4QWQA 3EVEA 1U2WA 3GRUA 3P97A 2V79A 4PDKA 3JSOA 1WZNA 2BR4A 3MWMA 4QVKA 4EQZA 2GH1A 2HYGD 1X1AA 2XAGA 2V1DA 4XUDA 4Y17A 3OFKA 1XMKA 1BI1A 4L18B 2P7CB 2J5OA 1WRJA 3NTVA 2G7UA 2V7EA 3LKDA 1OYYA 3SXJA 5FWAA 5GWXA 2IJLA 3C3YA 2BEOA 3F3XA 4HW0A 2O61A 1ZQ9A 3S2WA 2P7IA 5DRTA 1ONVA 2ACJA 3JWHA 3TLJA 5LQKA 3D2LA 1AV6A 4L9VA 5CVRA 1UHMA 3KQYA 2XUBA 1U3EM 2VZ9A 2ZVJA 1D5VA 3HRMA 3F23A 1CGPA 2NS0A 1P39A 5CYVA 1NE2A 1B1BA 5J6XA 4PYIA 4KA4A 4CTJA 3J80K 3EGVA 3H92A 2PX2A 2ZBRA 5DXJA 2HWVA 1XSXA 1ZN2A 4KW7A 2IH5A 3ER9A 4I98B 2XAJA 5IT3A 3GLXA 1QQIA 3C0KA 2FMLA 3ZP5A 2K4MA 2O0LA 3OU2A 2A14A 3KP7A 2AN3A 2PKWA 5A2QZ 4RTSA 4LGWA 4FSXA 2PVCA 3GF2A 1RJEA 3WTWC 3TOAA 5FQNA 3ERCA 2JHCA 1SKMA
chains in the Genus database with same CATH superfamily
1NI5A 1T8PA 3TTSA 3JZFA 4F1JA 3PNMA 4R1OA 2WF7A 2H4ZA 3ZDDA 5DULA 3WBBA 2D54A 2Z9OA 3K69A 4BO0A 2E7XA 3NALA 4ITUA 3M4OJ 2FY8A 2QROA 3GBVA 6ABPA 2G80A 3OF5A 3KQTA 5DOZA 1SVLA 1SK8A 1ZITA 1SBYA 4QJ4A 4K40A 1T2EA 2NXWA 2R79A 3LQ1A 5C0OE 4CIAA 5ILOA 1ZYUA 2OGUA 2ZXHA 4JB8A 5FLKA 1DQPA 1MNAA 3NT2A 3TFWA 1XAGA 2WIGA 3PHHA 3PK0A 2A6TA 4D9HA 5EJ4A 1J2EA 1YR8A 4IO9F 2ETXA 4HH4A 4MVJI 5HS8A 4ALKA 3MWYW 3QITA 4LYFA 1YX3A 3K8QA 2IZ7A 2A59A 4RY8A 4DS3A 4P9FA 4UPDA 1U63A 2WYVA 3DHVA 3OSGA 1E61A 3ER8A 4PSVA 1GL9B 2QUJA 2VYFA 2GUGA 2ZE8A 5EEAA 4TWIA 5DM1A 5FWDA 4C6HA 1B9MA 4HYYA 2ORED 1X1TA 4D0NA 3IJPA 1KXJA 3DBLB 1IO2A 2XTZA 3I01A 1XQXA 5IYBJ 2YWJA 1C3LA 5AI5A 3FNHA 4A3IJ 1K0FA 1PW7A 2D2FA 4K6MA 1UBHS 5CCBA 4MQUA 1OR7A 2ID8A 1VJ1A 1WPRA 2AD1A 1K2WA 3TXAA 3MTQA 3G0OA 5DCWA 2P0AA 1YDHA 5CA0A 5JWOA 4PO3X 3RJMA 1KP3A 3BORA 5E3JA 2I6SA 1DP4A 2ZREA 1T34A 2J7KA 4QDXA 3FPCA 4KV9A 1SKUA 2Q41A 1YX5A 3OX1A 1ORRA 4LZAA 3UOAB 4DMKA 1YQXA 1RYEA 2IVFA 4DMGA 2ASEA 2HOSA 3IAS6 2P11A 2G04A 2FBHA 4MV3A 1EZ1A 2D5AA 1LVUA 4OQFA 4G25A 2DA6A 1QXSA 3GJZA 2W6ZA 1V26A 4BY1J 2ERXA 3FNFA 3OO0A 3RS2A 1LLQA 4IUDS 2XTMA 1ORWA 4Q01A 3H6KA 3HM2A 1L2TA 3KQWA 4FCWA 4J4HA 3STWA 2B7CA 4OHYA 4GMHA 2XYHA 1AK2A 4AKTA 2DH6A 2W6ID 5KWVA 1H1TA 3I37X 2DQKA 3SKYA 2B69A 2HWKA 4ZT2A 5GPBA 3C3JA 5FJJA 3G71I 3I83A 2Z98A 4O1IA 1NJFA 4R2KA 3KKZA 1WJFA 3MAJA 3HC7A 2VYND 3GUCA 5FV4A 5DN6D 5KJ1A 1COWD 4KFRA 2RAFA 1XCPA 2IUEA 4LJAA 3PFWO 5SZHB 1TYAE 4L4YA 4CM9D 4MLDA 3O1LA 1NQOA 1EGAA 1LWOA 2FG6C 1IRIA 5A4JA 3SC2A 5EJIA 4BZWA 3IXQA 3HB4X 4Q3DA 4UTVA 2YSRA 1PS9A 2XGCA 3A4VA 1C0WA 3R77A 4D9IA 4MHOA 3AM1A 1WI9A 1J8QA 3WTZA 1L5WA 3IHUA 1T24A 4L9WA 1J8FA 2AFHA 2NUPB 3TCKA 3UCFA 4NBVA 1U81A 4ZV9A 3HYSA 2E1OA 3NBAA 4JMPA 4J4BA 1SXHA 5D6OA 2ZIFA 5K3BA 4X0GA 4LC9A 3GLRA 4D80A 3J7AO 4LBYA 3MB8A 3K2IA 1MOSA 5DYMA 4OMYA 2FWIA 4RVNA 5ALFA 4MKXA 5ELLA 3S14J 2ZIXB 3AZPA 5LU8A 2YX1A 4DC1A 2CLHB 5C4MA 5JYEA 3E0XA 1PUXA 4GKBA 4ZAYA 1GNLA 2EG9A 4YGYA 3ZDZB 2XPWA 3PHGA 1G5FA 3OYIA 1OTYA 1C8BA 2GBCA 5KQSA 2RAEA 5I3ZA 3EIOA 1Y4ZA 3HDVA 4HGZA 5HS7A 2CUZA 4N0BA 1XG5A 2FQYA 3O03A 4GX2A 4INAA 2YW2A 4QUGA 5LZ7A 4KPFC 3R8FA 3GP8A 3HOYJ 1TK3A 3IUSA 2I54A 1U9CA 1DG3A 2V7FA 1M74A 3F5SA 3QVOA 2AQKA 2ZI3A 5H80A 4AKEA 1VG9B 1F38A 3W3ZB 1JJ8C 5CJPA 3H04A 4E32A 1LPOA 3CRW1 3PIOF 1XMJA 5JZSA 1CYEA 2TRTA 2EIXA 4XYBA 5JCJD 3PE4A 4A6XA 4KN8A 4YRLA 5J4VA 5BRNA 4MGKR 2WJPA 4RKEA 2A0UA 1X8KA 3MRSA 4B0PA 1X13A 1SFOJ 5C8DA 8LDHA 4FX5A 3S81A 3A6HA 2WY8Q 3DTKA 1BVRA 5AXBA 4HXYA 3DZFA 2X8BA 1NK3P 2ICWG 1WMDA 1EGQA 3QJYA 2NU8B 5TV2A 2OVBA 4JC4A 4LI3X 4ND5A 3ZIDA 3ASUA 2B0JA 3FMSA 3AILA 1JPUA 4WW0A 5LB2A 3U37A 3FTFA 3IUMA 4REQB 1F9EA 2ZATA 3OEWA 1RACA 1XAJA 1JB9A 2AOTB 3A9SA 3AO0B 1QHSA 4E08A 3T94A 2BGTA 2AS0A 4XVQA 2DDBA 4K1XA 4TWJA 1EA5A 1VLZA 1J70A 3GJQA 5FUBA 3MMPA 4YB8A 3D2CA 2BZGA 4KE6A 2GESA 4B3DA 1URPA 4WLUA 2PKQO 3N2KA 4OO3A 3AF6A 3IDOA 4LA4A 3VHXB 5TVKA 1K7SN 4I55B 5E1WA 4PGHA 4R9RA 4DGSA 4KXWA 2HHJA 2V7WA 4X45A 1XHLA 1E3MA 3K9NA 1YONA 3BJAA 1F51E 1TZMA 5GJCA 2JH3A 3JWJA 2NAFA 1Q17A 5TR9A 2FJPA 2HBYA 3UJNA 5KWJA 3A05A 1DINA 3FRJA 4IJWA 1SVSA 1P1RA 3CJTA 4G1FA 2WF8A 3NVAA 4UZEA 1V11B 2XUFA 4I02A 1BROA 2QJWA 3I6BA 2VBWA 2Q49A 3L4BC 1C4OA 1O6GA 3DMGA 3MGBA 2XKBA 3CVUA 1H9CA 2G07A 2E7WA 1A2OA 1DKMA 2H57A 3DMYA 4IDNA 5JCOA 4BGVA 2EW8A 5F9FA 1VIDA 4G67A 2NO0A 4AZVA 4EHBA 5AVTA 1BYUA 4QXRA 2PG3A 3TLGB 3HCDA 4DRXB 3AT1A 5KHOC 3UAVA 1T2VA 4Q21A 1TRHA 4CTKA 2B3DA 3Q4GA 4E07A 5JAUA 1NVWQ 1JB1A 4MJ3A 4CM6A 4BMVA 4DLPA 1JE8A 7YASA 3K9WA 3IP6A 4YQZA 2K7ZA 1WU8A 1O2DA 3QOXA 5A5DA 4A82A 2F2TA 4JK1X 5H6RA 4ZH4F 1P0IA 1T9GS 1BNCA 3U3OA 5JAPA 3AF3A 1X7YB 5IZCA 1E1YA 2QQ0A 3NHSA 4AC0A 4PYLA 1J33A 4OIMA 4M1QA 2NQ2C 3CF4A 1DPUA 4YJ3F 4EYKA 5I8WA 3G0HA 1UOPA 2OO5C 2VSXA 2FW9A 4L85A 5D2CA 3ZXIA 4ZI7B 2QKLB 3SBEA 1MXHA 1RMTA 2G40A 3HRHA 4OU5A 4OYRA 5AESA 3JWIA 3LX5A 2KIQA 5EJAA 3AM4A 2AYZA 3E53A 5E6RA 1ONBA 3GVPA 2RH4A 1LC3A 3QG1A 2Q3MA 3RFFA 4AUNA 3QVSA 2B7BA 5DNEA 4RAFA 3RRBA 3S1AB 4ZI2A 1RCFA 3DPSA 3K05A 1KTVA 2G9QA 3HBMA 4WFQA 1E89A 4C2BA 1QFYA 1W9HA 1L5GB 2HQRA 3TRHA 1PHRA 3EZ9A 1K4KA 4Q00A 3QPCA 1YLFA 1OWOA 3R24A 1DSSG 4A91A 2GJKA 4KHPB 1W1WA 5GAHJ 3H9QA 2ODWA 5E1DA 4ALLA 1ZMRA 4HFJA 3GL9A 3R74A 3TFQA 4B1FA 3Q3VA 1EWVA 1P1KA 1M34A 3ET4A 1M7HA 3PUWA 4U63A 2L2OA 3AB3A 2PQMA 4WCVA 4ZDKA 4GBMA 4IJAA 1LDDA 4YIHA 4RFVA 1U3UA 2VP4A 2A1TS 3SVZA 1RXVA 2YUTA 5CNIA 2YMMA 1SQ0A 4AN0A 4EEZA 4YXWD 5K99A 2ABWA 2JGEA 3FOBA 3GMIA 3I4CA 3W2GA 4FKBA 2RKBA 2H1VA 4WVLA 2XUKA 2ZANA 2QN1A 3ZR8X 3QSGA 5AXAA 4D8WA 1B42A 3MFKA 1B0UA 3AUKA 2ZWVA 1UQTA 1GUYA 2GN0A 2OBLA 4OUDB 4UHHA 4BBSJ 4QTTB 3N8DA 1Z0UA 1Y4AE 4L8GA 4TXLA 5K0LA 2EC5A 5FUXA 1YZHA 4KQEA 4NLLA 1E6EA 5DRYA 3B1KA 4FHFA 1T15A 3L7WA 3GLQA 5EERA 3TEMA 4BQRA 4AVZA 5AKIA 3HWRA 5JAOA 3T9BA 4W8HA 1O6CA 2WV9A 2QB5A 4QOIA 2A30A 3WQQA 3C7CB 5EJFA 1WEHA 3U3DA 2E2WA 5KTNA 4KR9A 1F3LA 4PIMA 2UYYA 1H1LB 3TNJA 4UCFA 1EJ2A 2HNHA 1M0WA 5ICMA 1PF7E 2ZJ1A 4AYXA 3SXPA 4CIXA 1BIFA 4FGZA 3GRZA 2CCJA 1BOOA 2HDNB 5HTKA 3H3VK 1VE1A 3EDQA 4RH3A 1CUAA 3UGJA 1CNEA 4Q7QA 1IAQA 4F2WA 2IHTA 3ZCUA 4GI3A 2H09A 2YC2C 2WIBA 4PC1A 5EXDA 5H68A 5JJ5A 3TQHA 1VPVA 3O5AA 1LNQA 4ZAZA 3SSMA 1KYTA 1PLKA 3GNQA 4G12A 1YTUA 2G63A 2HQAA 2C3UA 3LQ2A 3WKCA 2JG3A 2E34A 4CYCA 1U11A 3BJIC 3OWHA 4RF5A 2ME0A 2VHZA 3GQVA 1R8QA 1JEYB 4ZJZA 5KVSA 5HBRA 2Y6VA 1G3TA 4OVKA 4LYGA 3EVZA 1EKXA 2DW4A 1R9GA 4GYYA 2OORC 4EMSA 2E6UX 3BR0A 1AQ6A 1HSZA 1Q0PA 3OLVA 1KSGA 1GKKA 1QC5B 4JX5A 5AOBA 1ULAA 2ZTVA 3FLEA 4UVDA 1HE5A 3NKVA 3L2VA 3U9SA 2X9LA 4QLBA 2EKPA 2R4UA 3BC1A 3D4BA 3CCQI 1OBHA 1YJBA 1GXQA 3LFTA 3MCVA 5KSPA 3KE2A 1R88A 5LP6C 5EUMA 5AWFC 1G42A 1SAUA 2Y75A 1OMIA 2LFBA 4BO3A 4YO7A 5B2FA 2HO4A 4EJSC 2HBZA 4HBZA 2VPPA 4WBXC 1DC6A 5A3RA 4ONEA 1KVQA 3I1FA 3T1NA 4M3BA 2C42A 1CZHA 2NU6B 1LS1A 2FPLA 3EPRA 3LDHA 1WDLA 4ZDWA 1RPNA 2PDAA 3CDHA 2G9UA 3HB0A 2TCTA 4IJVA 5JAHA 3QX7A 1IW7F 4OA8A 3VOEA 3UKOA 1M8GA 4XPIB 4YV2A 1DU4A 4ENNA 5ICCA 1WL8A 3QAHA 2JFGA 2HFHA 1L3LA 2P62A 1CDOA 3KXLA 4XGKA 3SM3A 4EGFA 4DDUA 4Z54A 2WTUA 3FROA 3PF8A 2IYZA 1FDWA 1QHHA 2QYSA 4IIDA 3F6VA 4RSHA 3X44A 5KYWA 2H94A 2LH9A 2WKPA 1AQNA 1ZRHA 4CM1A 1Z33A 1QORA 3HUFA 4BJ1A 1MBZA 2A9FA 3O4GA 3UB3A 2A5YB 1GAWA 3PX3A 1XKLA 4QREA 4U6NA 3WICA 3F97A 4ZVSA 4AWXA 1EFKA 4MHGA 5A3SA 4S1TA 4ZEWA 3LA8A 4TYNA 2L19A 3UW3A 1I0ZA 2FSPA 5LYJB 1CRWG 1AH2A 3K9TA 1M0SA 3B9BA 4AUMA 3PFGA 2Q1TA 1R8YA 4QU0A 1UZLA 2PFSA 1QFZA 2Q1UA 4HA8A 4PR0A 1UKCA 1V8OA 2AMVA 4WWCA 2HY7A 2IC5A 4YHBA 1EX1A 1BX3A 1YAJA 1ZINA 3ZXXA 4US2R 2PWPA 4I5EA 2XA2A 2ZVQX 3LXRA 5EZYB 2YR0A 4AK9A 1P0QA 5DBGA 5KOJA 2NOAA 1Z5GA 1QA6A 3ABIA 5B7QA 2VYQA 4JI3B 2OZKA 1CY2A 3GD5A 3FRIA 4RGBA 5CRIA 4KJZA 3C4JA 3Q3CA 4U9IS 1ZKMA 3DCYA 2QAJA 3IBGA 4ZKDA 3M8KA 1BDIA 3DEJA 3T06B 5J4HA 1RLUA 1P3Y1 1T8YA 2YL2A 5JECA 1AK1A 3ZJUA 1E6KA 2GEFA 3KFXA 1XX5A 4X5OA 4CMEA 3O8BA 1NW8A 4MRPA 3O74A 4MPPA 4X1YB 3V1TC 3O8QA 3ES9A 3W5BA 1SQ6A 3ITDA 4HDCA 5JROA 4ZOAA 1SMTA 3DONA 5D3KA 3SY8A 5BMVA 2MD0A 3B2EA 2JIMA 1ORKA 2KMUA 1RRVA 4ESHA 3VH2A 3OU6A 2OC4A 2ZJ4A 3QKSB 4GXOA 1U2QA 3F3SA 1M8FA 2FP4B 3HLYA 3R3VA 2CT8A 3DOEA 1YVPA 2J67A 2AGVA 2MJLA 3JSPA 1VHWA 1IZYA 1ZNXA 3ESBA 3HKBA 4JWTA 1G17A 2B9VA 3LSGA 2P9TA 2ZB4A 1HDCA 1X2BA 3WA7A 2LKDA 4P0QB 1RAIA 1TT0A 3EGDA 5E0OA 4EAQA 5ALSA 1FQKA 3LRTA 2QMYA 3ZJYA 1E9CA 1WW8A 1Z2EA 1UUFA 3AHDA 5JWRA 4YY3B 1W0TA 3OE4A 1DQNA 1GTMA 5TY0A 4ZAFA 1XK6A 3QWHA 1ZYRF 2KKOA 4TV7A 1OGYA 3ZHXA 2W7NA 3I4FA 4AS2A 3CP8A 4NQWA 2KJCA 1RE0A 4I8XA 1GM5A 1G8FA 3LDAA 4YQFA 1OH7A 3NQOA 4OM7A 3AL0B 2D1RA 4BNJA 1YQUA 2MIIA 4D5EA 1NW6A 3N28A 3JQPA 4JLSA 4DG8A 5G53C 4A8HA 4JLMA 1YKFA 4L5JA 5BVHA 1TK2A 3RKXA 1KFKB 1T0UA 2CFRA 2OHFA 1S02A 5LYJF 2I3AA 1SVOA 2YDYA 2C9BA 4QYIB 3KTAA 3NBQA 4U3JB 4EY8A 1EWQA 2IZOA 3CW9A 5FO5A 1FP1D 2FZLA 3LT4A 4ZZ1A 5K0GA 2CMHA 3T5AA 4ZTZB 1NBEA 4IDEA 4ER7A 5KYXB 1QPZA 5EIEA 3TW7A 2C98A 3B1ZA 2RHLA 3IOCA 3QPLA 4B47A 1YZNA 3JQFC 2OHHA 4BUZA 1XMVA 3CUSA 1IY9A 1LDBA 1O57A 1X2NA 4KDPA 4D7MA 2I7TA 4CO8A 4P5PA 2CC2A 2ONJA 4GWKA 5BUSA 2VSQA 4ZC1A 4E1AA 4DADA 3DCIA 2KHZA 3TLGA 3HI4A 2PKYX 3M8JA 1BWRA 1JXOA 3B8HA 2J8ZA 3HMQA 3UJCA 1NMXA 2ADMA 2WD9A 2JJ2A 2DUUA 5AW3A 1KO4A 2C84A 1PGNA 2QG6A 4JR2A 2GCEA 4IDGA 1REQB 3FM9A 4HLNA 2OAP1 1Z4JA 2YIMA 3LKBA 3LYHA 5AVJA 4Z3OA 4X8MA 1DDNA 4YRKA 4BLTA 2HA6A 2FOKA 2Z2XA 4L76A 1F6BA 3R5XA 3WHKA 3FK7A 3CLRC 2QTTA 3KYJB 3K1ZA 2EX0A 3GVHA 4G01B 5DOVA 1TCVA 2J0EA 4YDSA 4JP5A 3P7MA 4MTCA 1CUZA 5A1TA 2MBFA 4QYSA 5BR8B 1FJGB 4UV9A 2RREA 1E1LA 3V8BA 3TLYA 3FWPA 3C3DA 4EG6A 1OFIA 2F7SA 3GJXC 1SC7A 2QT0A 4UKDA 4R4JA 5JY1A 2WC2A 2KHMA 1Z5ZA 3F2IA 1WKCA 3PZRA 2DFHA 1U8ZA 1OIWA 2J0UA 1QFJA 1TZCA 3X3HA 1XDUA 1G0NA 1V0JA 2Q6VA 1JA0A 2V9VA 1YFHA 1DKQA 1YVEI 2QRZA 2QZSA 1FFWA 2WFLB 2WJJA 3ORRA 4Q37A 3RU9A 5L7TA 1DMSA 2WD7A 2Y6UA 1CIVA 2EFHB 1YR7A 1CY7A 1ZC3A 3IHLA 3QV1A 1FC0A 5AW0A 2IYQA 2PL9A 1YRLA 5CD1A 1E3QA 1U8EA 5LBQA 3JRIA 1SUAA 1YDFA 4UFNA 4MR9A 2BHTA 2YRWA 3U3JA 3V2HA 2UVPB 2YHAA 3DL7A 4OK3A 5DNWA 1P2SA 2I87A 2XD4A 3VYSB 3NAGA 4FFVA 4BAZA 4DWJA 1N7GA 2W8ZA 2GM9A 3OQIB 5CNMA 1CP2A 4FLEA 2A05A 2FR1A 5BS6A 5ESXA 3GEMA 1GA4A 2ZI6A 4W1QA 3K71B 2ZTSA 5T67A 2J5PA 5B1BH 1JU9A 3JU3A 3KXIA 2K4JA 1RRJA 1Z6PA 3ZEIA 3ZD6A 4UATA 1DXHA 2GOYA 4B82A 2O8CA 2ZB7A 1JQLB 1USWA 3R5TA 5A3QA 3R7AA 1LPBB 1KH2A 3HJEA 1PFGA 1XA3A 2IITA 3LUAA 3ULKA 5DB4A 4CZCA 1C81A 4MV7A 5K05A 2UUZA 3A1WA 2QRGA 5FKNA 2P6SA 1WXGA 5H20A 2MYSA 3D4PA 3Q5GA 2VBZA 1OZHA 2HBRA 1T4BA 4K8OA 4M83A 5CP8A 4K0RA 4ENTA 3QEAZ 2F1IA 1B6SA 1K83J 3O7MA 2IV2X 1FWZA 1M2VB 1FP6A 4DIBA 3C6KA 3I5AA 4PBRA 3U3MA 1F4LA 2FEZA 1C7JA 2PFKA 5EJ7A 5DTEA 3W6NA 2NTEA 4EFDA 4HLDA 1QGED 2CXQA 4KV7A 3IRQA 2R6FA 3NRCA 2MHCA 2XUHA 1RHMA 1YA8A 3HJGA 4KE9A 4ZPJA 5E4JA 4C0SA 2DR2A 2OHOA 1T3GA 1KFJB 2Q45A 3RQIA 2VDNB 2FN9A 5AW7A 3FGNA 1P44A 1DQYA 3E1GA 1JVNA 4L7VA 2F6RA 2J3EA 1JEDA 4O4LA 4AURA 1TTTA 1B8PA 4FHCA 3N59A 1FYDA 1N2ZA 3LPMA 1MV5A 1QGDA 3R5FA 1JIVA 1G4AE 4NPHA 4Q6WA 3CJNA 3ZDEA 3UMMA 2Y99A 4U02A 1IK6A 2EL7A 1IN7A 3GVXA 4W7IA 3HOVJ 5BPHA 3S1RJ 1XRRA 4LBWA 1NHAA 3KXPA 3H18A 3RDIA 2LKSA 2VQHA 1ADCA 1HF3A 3U0BA 2R8XA 4MS4B 4DMUB 3ZNQA 3Q15C 3DMRA 4YJ3B 3K1NA 1RADA 3EWSA 3K4PA 3OSZA 4QBKA 2QWWA 1WUKS 1XTJA 4X20A 1OH6A 4OIFA 1Z0DA 4I4IA 4B3CA 2Z3WA 2G7HA 2PPVA 5JAQA 4C0WA 4DJJA 2XHZA 4XR6A 5DM6F 2QRLA 2XYPA 4NCNA 5L3CA 4HOBA 2COEA 1RRPA 3TX2A 5C2JB 3U16A 3LA2A 4G2NA 1GQFA 1OZFA 1U7HA 5JQGA 1NVVR 1E8DA 1H6BA 4IMRA 4X6XA 4NHOA 3SEAA 3U26A 3WYFA 1P7WA 2Q7XA 3HO8A 5DHPA 2EQAA 5CFZA 1NBAA 2F4VB 5FKOA 5IY5H 1XALA 3FTPA 4OFXA 4WOKA 1BOBA 1DPFA 2X9DA 2VDWA 2RN7A 3A58B 3GRPA 3H1GA 1SQGA 3G5UA 1GR1A 1M34B 3PGVA 3DDZX 4RAQA 4XPZA 4AY6A 3DJYA 2HTEA 5T41A 4ZO7A 3LECA 4C29A 3EXAA 1T1JA 2P40A 1OQAA 2WBMA 2Q0QA 1P60A 2DGDA 2XWQA 3KSDO 3EWIA 4I7EA 2BMFA 2JI6A 4QLCU 1JBKA 4WADA 3IXMA 3ZJ4A 4HLUA 3KJQA 3ZY3A 3OTQA 1UMBB 3F1KA 3IEUA 3IUYA 2VC2B 4KB5A 5HDBB 4AYTA 1OU4A 4YV1A 2HQ1A 3TD6A 2GSWA 4H31A 3FFWA 4HZGA 1FS4A 2GDJA 1BW5A 1TF2A 4QOJA 4QBGB 3MMSA 3U4DA 2PQ2A 3RYFA 3ZDQA 1PD0A 4Z1MD 1FQOA 1P9RA 2LR0A 2WP0A 4C5BA 5KYXA 5C5EA 5L6LB 1TJPB 1X1QA 3C1AA 3BT9A 5IAEA 2KBEA 3NARA 3NUZA 1DJNA 4RD1A 3SEZA 1VGQA 3RFVA 2X2OA 2VT2A 4A3CJ 3KUKA 1E6WA 2ZKZA 2VH1A 3FZYA 2HJHA 2VWGA 4BHCA 3E15A 3NJRA 2R8ZA 1CP3A 3JD4A 1OJLA 3WWEA 2QR2A 2CLKB 5CM9C 1EZZA 4CW7A 1S3FA 1XDWA 5BW8A 1UKBA 4WK0B 2FAXA 1TPZA 1YRBA 1YACA 1EJBA 3P2MA 4RETA 3P5JA 5E3IA 3RK1A 1OFUA 1QCZA 4K9MA 5EVCA 1LFPA 3AM5A 2FWPA 5LHGA 2O3FA 3E5HA 1SULA 3DV0A 3VNVA 2I71A 3JQAD 1V5EA 4IZZA 4DDKA 1XS9A 3KCCA 5IK2D 1KQ0A 1ELOA 1OXTA 2WJ3A 2INGX 4PZPA 1AF7A 3BHNA 5KNDD 5BSEA 2J0SA 5BWMA 5A9RA 2YJ4A 4FCVA 4XCVA 1KDVA 4BHPA 1CE8B 2G7ZA 4NYJQ 4UU8A 2J59A 2OAQ1 3LUFA 1C1HA 3AUFA 1WBBA 1X74A 1ECJA 2ODAA 3MHPA 3MMNA 4BKRA 3TLMA 3C6XA 3JWGA 5FWXB 4DBQA 3Q2OA 1DC7A 1MT3A 2CVZA 3DE7X 1U02A 1ZVJA 1QZYA 1F14A 4NRDA 4ESBA 4Y4RA 2IDMA 1VBMA 4NBNA 4UASA 1CZRA 4BJ3A 1ORHA 5E4TA 1P6UA 2QJTA 1SWWA 2RK3A 3QF4B 4X8HA 3UH1A 4EKDA 5F6FA 4Z6YA 4JI6B 2PKEA 5L4SA 4F45A 2NVXJ 3VU0A 3MCWA 1FFCA 1H4TA 1U1FA 2Y68A 4BFCA 3LOCA 2HK7A 3C3XA 3C74A 2C88A 3NIFB 4GUAA 1NMSA 1YJ8A 3KYBA 1KJ8A 2Y1OA 5CAEB 3N1UA 3SQXA 2QTWB 2Z3YA 4YRIA 3W7VA 2XOXA 3WLKX 3CRVA 4EY3A 1Z2PX 1B2LA 4FUTA 1DGWY 1N5IA 3EPKA 3JVUA 3ZY6A 2VJYA 4K3VA 4XWWA 1KFEB 2WWWA 3MIIA 3O47A 2GZAA 1CW2B 2QRHA 2VEOA 3FJYA 4U0JA 2K5UA 2O8KA 4UFOA 1BIAA 1VL5A 3EPPA 3JYQA 3X1JA 3AERB 3OYJA 1Y4DE 4IO0A 4JQYA 1N4DA 3KYDA 4AT1A 4M1OA 3W5AA 2HYFA 4Z5XA 5K6AA 3K94A 1RKWA 1RRCA 1SFEA 4UOZA 4KXYA 3PXXA 4PSWA 3VPSA 1FMVA 1K9VF 2E1MC 3LSPA 2B61A 3HN6A 4UDOA 3WLPA 5MDHA 1EJ9A 3ZWBA 3GUUA 1IC8A 3IP3A 4WLOA 2WHXA 2IA2A 1F1JA 2GKOA 2XQJA 1HLVA 3V46A 3NWSA 1BGWA 1PJTA 3S16J 2I65A 4RMNA 2PX8A 4YJHA 5EG0A 3WVNA 5GONB 1YIAA 2DJ5A 5HGXA 2P9JA 3JTHA 3HVRA 2GPBA 2IPMA 2PBRA 1OSNA 3ZGVA 2EIKH 1FRFS 5BT8A 2L4AA 3LPDA 2ZAGA 1FDTA 2OV3A 1GV0A 2VDQB 2KISA 2XCSB 1Z21A 4QAQA 4D02A 1FBTA 5BN5B 2OPTA 3DCJA 3EVGA 4HX5A 4EM6A 3THYA 4MVJF 4BTVA 3EEIA 3QIVA 2DUMA 3D6TB 3JATA 1K8XB 2VI5A 4AMZA 3MVPA 4ARAA 4CLEA 4RD3A 4JX8A 1AUOA 2Q5EA 1EPUA 4D1YA 3OZWA 4LRWA 2O8XA 5IUNC 1M33A 4JP8A 4B3JA 4BFLA 2BV3A 1Z0IA 3BROA 1GTZA 1Z2AA 3B2NA 3EODA 4UBJA 4YMSA 3QM1A 4HVAA 4UV8A 1DWQA 3QFSA 3G2HA 2XEXA 1NYRA 5EYPB 5ALIA 1X2EA 1EH5A 3UWMA 2XW6A 1FY7A 2MSKA 1J9IA 1G2OA 3K4KA 4U7BA 1WWKA 2QVLA 3AKYA 4IDDA 4YJ3A 4CIVA 5BV8A 1GYPA 1AA7A 2H4WA 2PRKA 4WKBA 3V9PA 3WJAA 4GWGA 4R7GA 3VPFA 1GKUB 4B3GA 4BVEA 2ZOSA 3LDUA 4JLDA 2IOFK 4HYTA 4F5YA 1HNXB 4GHWA 1R50A 4O2BA 2I10A 2ZE7A 5KO2A 2LGJA 4JAVC 2X7JA 1QQ5A 3R6TA 1VRVA 3DE6X 4D9FA 4KIBA 5FADA 2RGUA 4EABA 521PA 1X86B 2V74B 3FPEA 4EY4A 3DTYA 1RR7A 4MB2A 4R9NA 5L45A 2WLSA 1Q7CA 2YHBA 3E81A 5DGTA 3VZRA 5IFLA 3CNBA 2AOUA 5LZ9A 3OM8A 3G89A 3V1YA 1TF7A 3W77A 1M75A 1DHTA 2QM0A 3EA4A 5F1RA 1LW6E 2ZI7A 3FHTA 3CBGA 2JLRA 3BHMA 1T5SA 2TDXA 4M8IA 4NPCA 4F1WA 5IVDA 3OA2A 3Q10A 1OJ7A 5CLLA 2I0FA 4ZC8A 4U2KA 2F5VA 5E3HA 1E3IA 2QMUA 5EUCA 3SI7A 4I8IA 5TJHA 1RTTA 1HF0A 3L40A 3RUDA 4QO7A 4A2PA 2A9KA 1AU9A 2J3JA 4AM3A 2ZRLA 4LE2A 4YJGB 1JHQA 3I6QA 3HO1A 2A8YA 1MIOA 3LW8A 3EDOA 4LUCA 1U0EA 3NC0C 4LN1A 3S4YA 1BL0A 2VHEA 2X0RA 4HOYA 1OCCH 1FYMA 2FMHA 3CW2A 3G1WA 1UH5A 2F3SA 3CCYA 2ZYVX 3AUXA 4WLFA 4GC5A 1HA3A 4CV2A 3ORFA 4QT0A 4BY7J 4AIDA 2CVOA 5K5QA 1Z8HA 4EG7A 5DIFA 4I55F 2HVSA 2WUFA 3NS7A 4RQAA 1W4MA 3LCVB 4GPBA 4C3IJ 4TV9A 2DFNA 2IXTA 3U3XA 4AECA 3VWBA 4XD7A 3QW2A 2CQKA 3QYAA 2NV6A 4D82A 9LDTA 1W8DA 3BA6A 1PFYA 2VTBB 2P90A 4DSUA 4MSUA 1U1GA 2VB6A 1YJWI 5C44J 1TMOA 2F1JA 4ZAGA 1L5VA 4L2IB 4GC9A 1S7CA 1NVMB 5HJ2A 1B00A 5KI6A 1SCIA 1YVRA 2WQ6A 2QUZA 1GP2A 2ZS9A 1WCV1 3E1KA 3EXG2 3HN2A 2ZBFA 3OLYA 1SCUB 3TWOA 4D3FA 4RWEA 5IP7J 1ACMA 1DIRA 1XJ5A 1YKGA 2XADA 3A9TA 4OI2A 1ABBA 4TUYA 1SOAA 1TTQB 4RCZA 2WIFA 5T57A 4B4CA 2IHNA 3O3MB 2L7ZA 5HDGA 1J39A 3JYHA 2ZBDA 4P4NA 5A4KA 4X62B 5ITVA 2BF4A 2LY2A 5CNKA 2DE0X 1FOWA 4F38A 3ZKAA 1YZFA 4H1UA 4HDSB 3UC9A 3TVYA 4L9NA 2OUIA 1WXFA 2P9ZA 5AW5A 2HQSA 1XBTA 4QELA 5HQTA 5ISMA 2Q2WA 2QX4A 3QF4A 4K7JA 3IEKA 3QWLA 4RMGA 5B37A 2ILTA 1CR1A 4DF3A 1MHPA 3R0JA 3OI7A 3I5YA 3AGPA 4XVRA 1DRJA 1NBME 2IGTA 3U13A 2XV4S 1Y80A 1TQDA 2QLBA 3A1DA 2HHCA 3G0BA 3AEQB 3HR7A 1ZOSA 1X39A 3WGJA 5CFOA 3L6BA 3GG9A 3NGXA 1JIQA 4CT5A 2GYWA 3OOPA 4BPRA 5JAZA 5ITZB 4KPYA 1YOVA 2ECQA 2BVNA 3L8ZA 3EC2A 4OYYA 1N6RA 4ZAVA 2MLKA 2WWHA 3WL6A 2WJWA 3RPQA 2WZBA 4WOPA 5FRDA 1L5KA 5A0VA 4FETA 1JEAA 3TNFA 3DTEA 3HE3A 3BMOB 4FW9A 1QJ4A 2XMBA 4XJTA 3ZHOA 4CLOB 4C7XA 5FHRA 2R1VB 1R6BX 2B4YA 5JNLA 3K9HA 5LQNA 1CJSA 1YT5A 3GLHB 1S2NA 2ERYA 2JL1A 1MT0A 2LK2A 1LBEA 1MGOA 3ZDXB 3ZHBA 3KR1A 4CMAA 3KQKA 2XYVA 3BFVA 1TLTA 2Q9UA 2V9CA 1JHYA 5DMHA 2EBHX 3I9JA 1SHTX 4C0QC 4KFUA 5KNCD 3UUFA 4PLWA 3ROEA 3QOWA 3P2JA 2P7VB 1MMSA 1W46A 2TMDA 5E3NA 4P7FA 5CVIA 4ARVA 3ZNOA 1JLKA 3GCZA 5J58A 3EIEA 3LSMA 1CHNA 2B6NA 2OQRA 4A3FJ 1VG1A 1MKMA 3IELA 1JBEA 4IIGA 4ZQCB 1E9RA 4MUKA 3KG2A 4JEHA 1XZHA 2X5NA 3RKQA 2W90A 2GN1A 4JP2A 2P5LC 4M98A 4CL2A 3WIUA 3FM3A 1NWHA 3NHRA 4L6CA 4P80A 2O3SA 5DWVA 4U3JA 4R1HA 5IBRA 2R1ZA 4GZ6A 2BEUB 3OQ6A 3KHTA 1NTOA 2C4TA 4V39A 3AHCA 2PZMA 5TQ2B 1WNTA 2STWA 3GAAA 3TIFA 1FEZA 3NHUA 3OWOA 3P4UA 4ZYUA 1GUFA 3F90A 2A0YA 1VCIA 3M82A 4D3DA 5F04A 1W581 1NK2P 1NU6A 1PDOA 3U3ZA 2E5LB 1XZNA 2C4UA 4QYTA 3H42B 1JR4A 3MYRA 2YC4C 3FR7A 1SCJA 4PPFA 1HE4A 1UM9A 1T9AA 2RH9B 4QC2A 5GIOE 4KQWA 1MC4A 3LVFO 1Y63A 1SBZA 1IQPA 3TVTA 3LD9A 3T0YA 1STOA 3ER6A 3KP1A 3W8DA 3ED5A 1IXZA 3E3LA 1I3MA 5HIAA 2C00A 3VOAA 1F8UA 1KS9A 1P2DA 1F7UA 4KSYA 3H75A 2FPIA 3PITA 1K4TA 2A6EF 2I4RA 3AU8A 1G21A 4DAOA 3CKLA 1TEXA 3DBLA 1X9HA 3MLEA 2CHQA 2W2PA 3N70A 3QKRA 4GQAA 2CL0X 3VNUA 1BJAA 1S7OA 5IDVA 1W29A 2Q8KA 3FLBA 5AKZA 5TEWA 3SN6A 1P92A 3I2JA 3NVDA 1BE0A 5EMHA 2Q21A 1XYVA 3M6AA 4N5NA 2H54A 3RSGA 4NUBA 3ZJ5A 1OBFO 4L72A 1A8PA 1RLTA 1E2FA 1VHLA 4LXHA 1EQ2A 4YP1A 1Q44A 4NZMA 3L8FA 1N1DA 2D8MA 4QG7A 1CUJA 2DWPA 2C4KA 3V8LA 3RT7A 1ON1A 3PUYA 4MITA 3P9RA 3TE6A 2L7FP 4DQLA 3FXJA 1AS0A 2XF2A 3UT5A 4E6EA 3S8EA 2Z3ZA 3CWZA 2CFSA 2VJ5A 2QSHX 3AR2A 2IPXA 5JXJA 3AERA 4MHTA 2R5YA 5AM3A 5KVRA 2RGGA 1UK7A 1DRUA 3LVQE 4HNAB 2OHJA 3CC4I 3S8MA 2O03A 5F76A 3M49A 2Y9YA 1QH8A 3IEMA 2XUIA 4ZQFA 3LOQA 1B3RA 3KPJA 2ZW9A 1JEYA 1IBLB 2FFHA 5AK4A 3VI4B 5HLIA 1NRIA 4ZVLA 5LJIA 4RV5A 2O8VA 4M9SA 3C48A 1EM6A 3LX4A 4JLKA 3R09A 4ZOLA 3L2RA 1XZ8A 3WB0A 3C6MA 5J4LA 1T6ZA 2QRUA 4N1AA 2C58A 2RGAA 3OURA 3LCCA 4QHSA 3LQRA 2MGQA 1FUUA 1NN3A 3GI1A 4HAVA 5HUJA 2DU8A 3IR5A 3OP4A 5M34A 4C7OB 3OSUA 1J1UA 2NZYA 3CP2A 1SRQA 2I29A 2FK8A 2MC4A 1I32A 1N9KA 3HLKA 1Z2NX 2JVHA 2XA1A 3OIWA 5T4HA 4EFLA 4B8XA 3ABUA 3L1PA 3SQNA 1QX4A 2A7QA 5EAIA 4P36A 2V59A 3WDLA 2B1RA 2GXBA 1TVCA 3N8IA 4MA5A 2DERA 3L49A 4ID3A 4WNIA 1RTKA 2OO5A 2ZQZA 5M3FJ 1SOWA 2DOAA 2RD2A 2IL1A 4MCJA 1JDZA 3WGHA 3ISVA 1I3LA 2CFCA 4BZPA 2CZQA 5E8RA 1UFRA 2IDJA 4CXMA 1I6LA 2FA9A 1MOPA 4MMZB 3S8PA 3VMMA 3QVLA 1IWPB 1E2KA 5LL6P 3JRCA 1TYBE 1WHSA 2A7XA 3PD0A 2HMUA 4KIJA 2XYGA 4DW8A 1F7VA 4U7JA 5AKYA 4AUEA 5DO9A 4CL8A 1CT9A 1R1TA 2IRWA 1O96B 5D5WB 4PFOA 3OIQA 1KAMA 2ZJBA 2VJJA 1DO8A 2I8LA 2P5UA 2FSVA 3IOEA 3KOOA 3VJLA 1JEOA 5DH9A 3NT4A 4O4HA 4EHAA 3MQ4A 1ZAYA 5CTJA 5HQ3A 4JUBA 4AICA 1U7UA 4KBFA 3RSOA 1M5RA 2YBDA 1E63A 3I04A 3LP6A 4KMUX 3VOTA 1NBHA 5F7XA 3S93A 4NCXA 1J5YA 3DYIA 4NE2A 1WCYA 1Z4IA 4CF6A 1O9HA 1TB4A 3PQEA 4BZZA 4EW2A 3P4XA 4ME6A 1J09A 3UNXA 3VFZA 3VYWA 4BFWA 4PLGA 4PZ9A 4B74A 5JTTA 4Y2JA 4A4DA 4Y0NA 4DREA 1KJYA 1DEHA 4FBGA 1C8VB 3TPFA 5KTKA 4E11A 1VA4A 2L0KA 3HBNA 4X44A 1DS6A 2DPUA 1B6TA 1YK1A 2CXXA 1FMCA 3EUAA 1BZYA 4J1TA 3D3NA 4Z4QA 5DTQA 1VJDA 2WY7Q 1DB3A 1XZFA 3RPEA 1R22A 3DZBA 2V3VA 4AO7A 2H2AA 3KEYA 1FQJA 4FEGA 1HDYA 3AKZA 1LJ8A 3L7DA 5CT5A 4FW8A 5T4FA 1SKAA 3H4MA 3LSYA 1FTYA 1XSDA 2WT4A 5CR9A 2BGNA 3JQCA 1X15A 3ILSA 3URMA 2Y93A 3DEIA 3DXXA 3P9IA 4CMCA 4NBSA 3VR4H 5HIIA 3NQ41 2Y0EA 1ZRSA 3GC6A 4A8TA 1GV5A 2PSSA 1N25A 3VHXA 5FFNA 4F4HA 1N6OA 3BRCA 5LUBA 4ODIA 1BU8A 2BEWA 3O3NB 4FR0A 3ZH2A 4KEAA 4OFZA 5LEJA 4LK0F 4KDEA 4ZGBA 3ESQA 1GDTA 4WDQA 4FHZA 4RIFA 1K89A 1QGOA 1MNQA 4X93A 5IC4A 2ZSIB 2ISZA 2HB6A 1O6BA 3FFBA 4WCDA 5D5HA 4YCNA 5LEKA 1WSDA 3C8HA 4R0NA 2P5YA 3S68A 3F2VA 2UZ1A 3GGGA 4L9JA 3QTTA 4P82A 3NYIA 3O82A 3PEUA 3WLMA 1MHTA 1KI3A 1JW9B 4DLXA 2WFMA 3TIXB 2O05A 4NC6A 1DELA 3MK31 4D9JA 1AB5A 1SUDA 4M1EA 2IIQA 4EMBA 1N0WA 2PX0A 3BG3A 1CR4A 3ONNA 1V96A 4HRVA 4J7UA 4IJQA 4QQFA 4ZVQA 3S2YA 4DBLC 4Q1CA 3LJKA 5FBKA 2GPWA 3DOCA 3OETA 1XF9A 4CCLA 1AA6A 5ICSA 3DFZA 3R23A 2ZCUA 4QM7A 5JS8A 3T5TA 3T3PB 4YRRA 4HK4A 2F9FA 5HQJA 1P2FA 1VKJA 2FBKA 2O2GA 1XCLA 2QD3A 4F4JA 1G7CA 2FI1A 5KNLA 1UDBA 1VMEA 1WPXA 2G72A 1R0WA 2VHUA 2W2MA 3ISTA 4GFBA 3LUBA 4Q47A 4NMWA 3TEFA 1XROA 1U2ZA 4D42A 2BGWA 4PX2A 4CEJB 2DYSH 3L04A 4IRXA 4EJOA 2VF5X 3NC1C 3O4FA 3BF8A 4N8DA 4Y0VA 1U2GA 2YMLA 3VSEA 4BTEA 2C1EA 2XEDA 5IM4F 1FW6A 2FSFA 2O06A 3EBLA 2CHVA 3HPGA 3BWMA 3L41A 5EZYF 5FWXA 4DV5B 4D98A 5L3DA 1E9DA 1P1CA 3IOBA 4AAYA 5JY6A 3FYUC 1OFGA 4EJ2A 4CRWB 2H8RA 2GVDC 4HDMA 4RSMA 4QOFA 5PNTA 3ZV5A 2QPLA 3TW4A 3WRYA 3FBWA 1QS0B 1WB5A 4M1TA 2D1TA 3L8EA 2ZJQF 1COWA 1X94A 1ZH4A 4NQZA 5KDLA 2X86A 3HWX1 3A3YA 4B87A 2ID7A 4BMCA 1U5AA 4EW6A 5IDWA 3R61A 2C2MA 2GXAA 1ZRNA 2XNJA 1ENZA 1T39A 5E9JA 4M3EA 4P3YA 2ZVDA 3ABQB 4HEA1 1J20A 5LGNA 4D4MA 5BSTA 2HZTA 2KFDA 5DCFA 4B6SA 2HOAA 1U1CA 4E5DA 3C98A 2J5QA 3H1PA 3KRTA 5J2TB 3VVBA 4FOOA 1P81A 2WP8J 3FYSA 1Y5MA 1SOMA 2HNKA 3BREA 3HWWA 1SKYB 3MJEA 3QMVA 2PGJA 2X5JO 4RL4A 1N0HA 1Q1AA 1Y3FE 3OESA 1Y3DE 3PUXA 3IVMA 5IH7A 3WGVA 4V1CB 2CQXA 1F5NA 1XMPA 1WQ3A 3WE7A 2OU2A 3R6DA 4DNPA 4XQGA 4TTAA 4FBLA 1OZAA 1RAGA 2F3QA 4JBHA 3RIHA 2OQGA 3D8NA 4ZVPA 3GPLA 4L5IA 1YO5C 4PIPA 2P4UA 3VPBA 2ETVA 5A7FA 1VL6A 2Y30A 3SQLA 1RIOH 5FLXK 1IJWC 1JUPA 4GZLA 4XFKA 5JJIA 4QO8A 2LREA 2HDOA 3BJZA 3MTBA 4ML3A 2IYWA 4LC1A 4RGYA 2RHCA 4JIMA 5DUKA 1P8JA 2AVNA 2PVPA 2PBIA 2C9CA 4CEIA 3MT7A 1Y3CE 3GUHA 1NW3A 2W70A 3K0LA 4YXWA 4NXMB 2QXYA 3O8RA 3SF8B 2GPJA 1QRSA 1JJ7A 5EQTA 4EKIA 5CPRB 2R7SA 2JRTA 2OHVA 2X1DA 1VXOA 3GFQA 4QEZA 3QOYA 4Z7OB 1E0SA 1ZONA 1UELB 3U4IA 1CJMA 4HX2A 1E5DA 3DEKA 2PZJA 2P5VA 1O96A 2UVQA 4KVFA 2Q07A 3B73A 4PZEA 1H8EA 5ERXA 3REQB 4UBIA 4QJIA 1ZCAA 4GECA 1NLMA 4MUYA 1E0KA 3VH4A 5CDGA 1M1UA 2RVCA 1PBNA 4XVUA 5LDHA 3UQZA 1Q83A 4OIPF 1JPJA 3EPLA 1K5HA 2BEVB 1LLCA 5DNAA 4EUHA 4IS3A 1W94A 2XNDD 3QBDA 4QATA 4EJSA 5IW8A 4EZIA 3C3WA 2JGIA 2K86A 2PT9A 5GTHC 1YS7A 3KVVA 2JKZA 3MW8A 4G2TA 4IIJF 5E0KB 3T1OA 1AG9A 1DIGA 2LVBA 4K2HA 4MIYA 5BQXA 2CXHA 2BPOA 3LO8A 2RIRA 5G1PA 4BKMA 4JV5B 4DUZB 1E5XA 1N6HA 5KTRA 1FOEB 4V38A 3PTAA 3PHBE 2JD0A 3QKIA 3NGMA 4NOJA 1PG5A 5IJ9A 5F7JA 3VO8A 1JXQA 1Y3HA 3WHLA 5LNK1 3OHSX 3IRRA 1A6IA 2TMYA 3ETEA 3BCSA 1DAGA 4JL6A 3BBPA 4UJ3A 3UHJA 1PEYA 4DQKA 4NESA 4IXNA 4IHSA 1FP7A 3L4EA 3R0QA 4JOBA 3NEAA 4IP0A 3IH4A 2GPYA 1I2MA 1T1IA 1PQ4A 3ESAA 3JQFA 5BY2A 5KSWB 3GZ5A 3BEDA 2X1EA 1NXPA 3AIOA 5LZ5A 1MAHA 2MTBA 3EUEA 1I2BA 1ZGGA 4P4LA 1VHDA 1AHIA 1ZM9A 3K0KA 1KDRA 1Z7YA 4KN4X 3HBAA 3EMBA 3W90A 3W5VA 4A93J 1KMIY 1PGPA 1AKRA 2QSUA 2BFPA 5C7IO 3D7KA 1U7PA 3DL2A 1SQ5A 2PA3A 4Z3DA 4GDMA 3VM6A 4ECEA 2XZOA 1JXAA 3NXKA 3MTAA 3NOVA 4A2UA 1CK4A 1Q0LA 3KLPX 4WKNA 4D8YA 4F11A 4X1YA 2E87A 3KUCA 3RCOA 2Q6IA 4WD3A 1FCJA 4BPBA 2BBSA 1JKQC 4OL0A 3O94A 1PJZA 3GYHX 4WOJA 3WTCA 4A12A 1PQUA 3GJTA 4LWPA 4AWXB 3DBHB 2RHTA 4U2EA 3CUQA 4X92A 3KKPA 5K4AA 1FRZA 2I78A 1PAUA 4JCOA 1G8GA 1PNQA 4NC9A 2GDZA 5LYJA 1RYZA 2PX6A 4J07A 1CQZA 1IHOA 2BH9A 5LA6B 2QF7A 1WRBA 4PNHA 5JISA 5HRAA 3AVUA 3BTLA 4KVZA 3PQ3A 4LGCA 1XZBA 1Z5VA 2YHIB 3GZNA 2DMTA 5CXXA 4Y7NJ 1OC4A 3UATA 4OX9Y 5EIWA 2OXIA 3ZGZA 2GAIA 3EMDA 3WYGA 2APJA 2W2LD 3U4GA 3WLHA 1O5TA 4Q15A 3AY0A 4NAHA 1C30B 1W2GA 4ZOBA 1YW7A 2V3WA 2FEKA 1T95A 4IBOA 2MYUA 1S4MA 2PBLA 3CG0A 3RAFC 3D31A 1B41A 3RV3A 2NU7B 1LBQA 4B3HA 1JKFA 1GLVA 1PFKA 1N36B 4WEQA 4NQWB 4B3AA 3TLKA 1RXEA 5BWNA 2FPPB 3BR5A 2NZXA 5CLHA 1K97A 4IQ4A 3OOEA 5LZ4A 2Z6AA 3L0CA 1UZUA 2ZJ5A 2D3WA 4GF5A 5BQTA 3D8UA 3CC2I 4TWZA 5B5SA 3TQIA 1T0JB 5F35A 1GGFA 3F5QA 3REFA 5LKRA 2VHXA 5ERYA 4BX8A 1FEXA 2IHJA 4BLSA 2O0JA 5IUKC 2C4WA 2V6IA 2AKYA 1RQNA 1BYIA 1N7IA 3MMZA 4Q7EA 1EBUA 4S1PA 4TUYB 2ORYA 5EKTA 3RARA 4XX1A 1YIJI 1JPNA 1T6SA 2G8LA 1UXIA 1OVGA 3QPWA 1J23A 4PS0A 4Q7LA 3BR2A 1DLIA 5BNIA 3B1FA 4BMPB 2I3ZA 1NW4A 3ICCA 3NXSA 4TZ0A 3KP4A 1I3CA 1E9FA 2JASA 3B6IA 1VF9A 1TUBA 2BGUA 3JV7A 4OSEA 3FKIJ 3B51X 3QPBA 4HNQA 3MN2A 2H1OA 1IOZA 1HZJA 1QS0A 1PVEA 5IASA 2X8WA 1LSOA 1QIHA 4FLMA 4LFCB 4DKJA 3JPWA 1VLJA 5BQPA 4CLXA 3OIGA 5CVJA 1ZGAA 3WNBA 1N6IA 2ZUUA 3RYIA 4K03A 1QH9A 4Q6BA 4HHEA 4CCYA 2XQGA 3JQBC 4R81A 1B14A 3R44A 3K72B 4M4SA 1KZ7B 2DQ4A 2HKXA 1UHSA 4LMYA 4EDFA 1LI7A 3GJRA 2OBXA 5E2AA 2DMPA 2PQ0A 4QUAA 4UXIA 2VDPB 4QD3A 1ISMA 5ILQA 4BO9A 5FOQA 1HXDA 1Z6YA 5BNWA 4XEHA 5JAIA 1MZPA 2HU9A 1S7GA 5B1SA 1U8YA 1WXXA 4HFRA 5LDDC 2NVQJ 5K51A 3QP6A 3WB1A 2WKQA 3GLHA 4R51A 4DIDA 1J99A 1IULA 1BN6A 2HXIA 1KSJA 3QELB 4X9XA 1KK2A 3ZMTA 1U0RA 2VSYA 3OBIA 1P2BA 2B63J 1P2GA 3KPUA 2ONKA 3MELA 3O3OB 1P18A 3V42A 3NBYC 4NFLA 4WFKA 3RYTC 3S17J 2HNAA 3RYIB 1II0A 3AHHA 1U9YA 3QLTA 4RTPA 4JBGA 4XUEA 1EH8A 2EZIA 2BEJA 3ADBA 2M32A 2AOVA 4WVFA 2QN7A 3D4IA 2IODA 4GBGA 1IUPA 2H2DA 3LNTA 1BQEA 4OOFA 4EQQA 2RJNA 3OZIA 1CZNA 3R0XA 1HWYA 4O6VA 4P32A 2EIJH 5ELMA 3W6OA 4AULA 5KDDA 4KRFA 1X3UA 4NNOA 1Z0KA 1DUXC 1RESA 1Y8RB 3GB9A 3OTIA 2QVXX 1MV8A 1R3DA 2H2HA 3NJ8A 1KHHA 3LX6A 2YIDA 1PDNC 2GXSA 4O02B 2CFIA 4DIFA 2ORWA 1IV8A 4ND2A 1Y0NA 3PYXA 2IHUA