4A6DA

Crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
347
structure length
345
Chain Sequence
b'MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARKGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROXYINDOLE O-METHYLTRANSFERASE
publication title Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 124
structure length 345
sequence length 347
ec nomenclature ec 2.1.1.4: Acetylserotonin O-methyltransferase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF16864 Dimerisation2 Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a6dA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4a6dA02
2P8TA 1U78A 1TQIA 4I0BA 2E5WA 3A7DA 2O61A 2H6BA 3QPTA 2P6SA 2HR3A 5LEKA 3B3JA 5L3CA 1IF1A 5LEJA 3GU3A 5D5XB 1JHHA 4ZYGA 2QRVB 5ILUA 4RB0A 2HTJA 2EFQA 1BIBA 2M1BA 3FMSA 3OE5A 2UYOA 4O3MA 1QO0D 3NMUF 3IHTA 2K4MA 2ISYA 3MHTA 1L1EA 2OZVA 2HQRA 2O0YA 2X0LA 4HQEA 2UZKA 5IKMA 1S29A 4HF2A 3FPHA 2GIVA 4YFXF 3KPYA 2JPCA 4UXNA 4PIPA 3KP5A 5B1SA 4I01A 3ABTA 2RVCA 2H6CA 5TJJA 1IXSB 2VT2A 4GOLD 4NECA 1XN7A 3OZSA 3BP8A 4DKJA 5HLGA 2VODA 4E2WA 3GW2A 3KP4A 1CF7A 2IJLA 5K5OA 1EV7A 2FCAA 3R6SA 4I0AA 1DL5A 3NW9A 4ER3A 4M37A 5P8WA 3E5UA 1RI3A 4MWZA 2EJUA 1ON2A 1XJ5A 5E9WA 3JSPA 1D2GA 1RJGA 2GXGA 1WSUA 2XAFA 2PWYA 4HA8A 4AUKA 4AIKA 3IEIA 3WTSC 4XCXA 2IBSA 4RB3C 3P2IA 2DU9A 4WWCA 5EIFA 3G2OA 2XVCA 4GXOA 1K78A 5EMKA 3DXYA 3WU1B 3PQJA 5LHIA 2RDPA 2A69F 2EFWA 4CZZA 1P91A 3LDUA 2IW5A 1RI7A 3HCDA 5CVJA 4DZRA 4GF5A 4CICA 4HDUA 1R1UA 3WE3A 5LQCA 5KQSA 5DM2A 1BI3A 4BLUA 1P4XA 5CVUA 4XBFA 1ZGAA 3Q7EA 4EKGA 2VONA 2KIFA 2OQRA 4LECA 1NT2A 2P7IA 1JR4A 1KXZA 1H9TA 3SXJA 3RODA 2YU3A 4O29A 4U0YA 1IN8A 4M73A 2O3FA 3HEMA 2QQAA 2EV6A 3RKWA 2O06A 3E05A 1FBUA 3E7PA 5JUWA 3QV2A 1FBNA 2EFJA 3DQVC 2ONYA 4YMHA 2OD5A 4BYYA 5DEQA 1G6Q1 5CM2Z 3M1EA 1I1GA 1HQCA 2HGCA 2Z33A 3LKZA 1YO5C 5BMZA 5EHIA 4AWXB 4DA4A 3S68A 5HDNA 4UVCA 3LX6A 1UHWA 3BDDA 2MLKA 5DXJA 3UJ7A 5GOZA 3F6VA 4YUZA 4MGRA 3HRSA 2EK5A 1R22A 2QBYB 5FA5A 4FX0A 3GRZA 2BR5A 2DI3A 3RPUA 2JH8A 1JTFA 1UCRA 3B73A 3NJRA 1BKYA 1O57A 1BN5A 5GIPE 2NNWB 4ZYEA 2O57A 4YIFA 3V4GA 1BJAA 1B6AA 2PXXA 1YYVA 4KDPA 5LHHA 5HDKA 4B8XA 1IXCA 3GZ6A 3GRYA 5HLIA 2DLLA 2UXXA 2XAHA 2FEZA 5DSTA 1SAXA 4LG0B 3UZUA 2I6GA 2Z6AA 3I5UA 5DRYA 2BYVE 4AIHA 3T0YA 4BHCA 3L7WA 3RI4A 1ZG1A 1Z1DA 4A5NA 5K5QA 1R5HA 4AZVA 3M70A 3LGAA 2ONZA 3R61A 2AXLA 3E8SA 5ICGA 4PYJA 3O4FA 3T5XA 1IY9A 4RTLA 4A5MA 2VC1A 3FPGA 1INLA 3J7AO 1BI2A 3EMBA 4PGGA 5ILSA 5E1OA 3VYWA 4O6JA 1HXDA 3HVIA 3FZVA 3GIWA 1F3LA 3M6VA 3E5XA 5K09A 4DCMA 1N2XA 4RV9A 2IA2A 3HVJA 1BC5A 4YUWA 1FBQA 3TOSA 3LPMA 1J2XA 2C7QA 3WE2A 2ZSUA 4A12A 2PG4A 4UUVA 1B42A 1J75A 2Q41A 4OU0A 1BI1A 2WA1A 5DX8A 3HVHA 3SGLA 4PGHA 5FGMA 5HS7A 4OQEA 4U0VA 3FZGA 3EVZA 3SR4A 4C06A 4E70A 4RTNA 3TO6A 2B78A 5GIOE 2QENA 1ULYA 3EVEA 1FOKA 3IKTA 2ZZKA 3ABUA 3GO4A 3FYDA 5J8CA 1G3YA 2R6ZA 3NTVA 4F86A 1SUIA 5BPDA 2C7OA 2BEOA 1SUSA 3WTXC 2IIPA 1EAMA 3HHGA 2AOTB 1IUYA 3UJAA 3KU1A 2PLWA 2YPRA 4HC4A 2EJRA 2LSOA 3BOQA 5L3DA 3SMQA 1MD0A 3LFKA 3GYHX 3QOWA 1K7AA 2VT3A 2DTRA 4HGYA 2X4HA 2ZBPA 2NXCA 5K0JA 1DPUA 5IT3A 1PP8F 1QAQA 3EGVA 1XMAA 3PT9A 4CXFA 4JQFA 4JK1X 5FQNA 2QVOA 1M0EA 1IN7A 2VE9A 2KJCA 1XVAA 3ZMDA 3IL2A 4EM0B 3G2PA 9MHTA 3CVOA 3VB2A 2KJBA 4MTEA 4Q4ZF 5D8KB 1KU2A 5HIMA 5KS2A 2VDVE 4KA4A 2DQRA 1YFHA 4RB2C 5DCMA 4K2EA 3I64A 4M74A 5DX1A 5D6FA 2BV6A 1XCLA 3REOA 3OCJA 1XGNA 1MGTA 3HA5A 1N7JA 4KIFA 4OIPF 3M6XA 2L3DA 2W24A 4BQAA 4L5JA 2HEOA 3EQLF 3T8RA 3ELDA 3MZHA 3I53A 3H92A 1JE8A 3HCFA 2MBFA 5CVEA 3HSRA 5IH3A 3RDIA 3V8KA 2XASA 4YG2F 1ORHA 1QAOA 2LF7A 2L4MA 3KP6A 2OQGA 3C3WA 3CO6C 2H09A 4C07A 3G8AA 3LCUA 3QRFF 1RUOA 1LEBA 5GWXA 3QAHA 4JBAA 1HW1A 3K1NA 4LD5A 4LLNA 3G5LA 5E1DA 2IH2A 2YVLA 5L3BA 2OAZA 3LDFA 2P41A 1O3TA 4WK8F 4UNOA 3UA4A 4ER0A 5E20A 1P1BA 3V7SA 3BT7A 3DTNA 5KVRA 2BR3A 5ICEA 2KKOA 4N9IA 5LRRA 4ASNA 5LQUA 3BXOA 3HCAA 1H1DA 2QQBA 3T7TA 1EQAA 4IHTA 1NBIA 1XDZA 2YUIA 4OBXA 4QVGA 2YQZA 3BJ6A 4U88A 2VP3A 5E9JA 1B1BA 5EEGA 4M6YA 4PYNA 2QY6A 2UYQA 4AZSA 3EETA 3COAC 2EFPA 1PP7U 4QDKA 3O7WA 2ORED 2ZIGA 4O5VA 3UJDA 3I59A 2M8EA 3F8CA 3TOBA 2NRAC 1J0RA 5HIKA 1G3TA 2OB1A 5BW4A 1RI1A 3NDIA 2FMYA 1ZLKA 1REPC 2ISZA 4PYMA 5DLYA 4OOIA 3V7CA 2GQQA 1PRYA 1WG8A 2ZBRA 4EM2A 4A0YA 2ELHA 5H20A 5LGUA 3LQRA 2F5CA 4DQ2A 5D5VB 1G8AA 3E5QA 1BBYA 4RWZA 2I62A 1JTEA 5CVDA 4HTFA 3I4PA 3TKAA 2M45A 2XV4S 6PAXA 1D2CA 1JG4A 5CJ9A 1R7JA 3Q9VA 3SSMA 5KVAA 3D0SA 3GVAA 3KQYA 2IDKA 3FTCA 4BLVA 5CVIA 2KW5A 1LDDA 5FTWA 4KMUX 3JTHA 1UB9A 1PDNC 3E6MA 2PBFA 1FJXA 2K27A 3FUTA 5GP1A 4ENMA 2CG4A 3ECOA 2OXTA 2QLZA 1WI9A 4ZYHA 3TOAA 4F85A 1T6SA 2JSCA 3FRHA 4PYIA 4YUYA 3CUQA 4HG2A 3I0TA 2M30A 2PKWA 3VODA 3JWJA 3AXTA 4KYWA 3G3ZA 2XKOA 4L9TA 3KP2A 3LA3A 1TNTA 2P5LC 3R60A 3J81K 3ZN1A 1CF7B 2CGPA 3I71A 1F5TA 4HQMA 1J9IA 3DULA 5HZMA 3P9IA 3HCCA 2YX4A 3HM2A 3LQQA 1TNSA 5T64A 1WKMA 1H0MA 3RW9A 2XUBA 4R8HA 1KHHA 1VPTA 4EJOA 3B3GA 2AVNA 5ILVA 3GRVA 1ZRFA 4CWAA 2EFOA 5DV5A 2B25A 1WRJA 3FHZA 5MHTA 2E1CA 5FWDA 5U4XA 1STZA 2L54A 1K78B 3ID6C 1QNTA 2Z99A 2NXEA 4HF0A 1R1VA 1BOOA 1TW3A 1I27A 3LCCA 3JWGA 3SXYA 2BM8A 4OX9Y 5KQRA 1KQ0A 5E1BA 3MAJA 2RKHA 3TGNA 1DDNA 3RYPA 3VC1A 2JT1A 1KU9A 4KWCA 5T6BA 3EVDA 3DUWA 3M7GA 4RTRA 2PJDA 2ZBQA 2P7VB 3BJOA 2BGCA 2BE5F 4H0EA 1IZ1A 5K8VA 3EPPA 3HNRA 2JG3A 2FF4A 3EEYA 4GGGA 3TRKA 3P9NA 1VTNC 1WS6A 3P71T 3PTAA 4HDVA 5CCXA 3T7RA 1YQAA 3R6TA 4ATNA 1RIOH 4IVNA 2MLGA 1GHCA 3F22A 3ERED 3EUHA 3IHUA 3P2KA 1Z05A 3CO7C 5FADA 2P5VA 4IWNA 1JXSA 3DOUA 4P9UA 5T67A 1U5TC 1MJAA 1EJ0A 3KPUA 4E30A 4N9HA 4HX8A 2FHPA 4E31A 1VLMA 5JR3A 4MQ9F 2AN3A 1OR8A 2E1NA 3AJDA 3CUQC 2O05A 2DBBA 4BXUA 3THSA 1WXWA 3LWFA 4HBLA 2STWA 2HWKA 3KPJA 1V3FA 1NW3A 4RVFA 1V39A 5F2OA 3V8LA 3WTYC 3KP3A 5F2KA 3PLAE 1Z9CA 1U2WA 2ZXJA 3DEUA 2OPBA 4QLCU 3DPTA 1YTYA 2DO7A 2Y75A 5C9ZA 3LL7A 2CWEA 4X60A 3G8BA 1YZHA 2XBMA 2UWMA 3G2QA 1HW2A 4QWQA 5E2AA 2ZMEA 1Z3CA 2VZ9A 2M87A 2ZZMA 4GOMD 1UFKA 2PSSA 2PV0A 5L3GA 1XMKA 4YUVA 1TBXA 2Z3YA 4P7JA 5E1ZB 1B9MA 4HAMA 2AS0A 4MEXF 2C6YA 3MCTA 3CJNA 1WXXA 1XCVA 4KT5C 1N7IA 4KRGA 3LDGA 2HS5A 3F8NA 3AXSA 4A6DA 1KR5A 3F21A 3SSOA 4KDRA 3FTEA 3DH0A 3GXOA 4I98B 4EK9A 3JW4A 3MB5A 4YV0A 2FRXA 3R0QA 3F23A 4L9VA 4H0NA 3FF5A 2V9VA 3ISPA 4IPAA 4GC9A 5FHQA 1R6AA 2GA1A 3FRIA 1U2ZA 1IXRC 3BZ6A 4HF1A 1NW8A 5ERGB 5CUQA 1B59A 4Y30A 3DFGA 2ACJA 4QQKA 4U7BA 3EGEA 4AZWA 1P92A 1Z6TA 4PYKA 2YSRA 4BHPA 2HZTA 3E6BA 1R8YA 1QZYA 3GEZA 2YX1A 5D1HA 1G60A 3KEQA 5FFXA 3KR0A 3FUWA 1T39A 1JG3A 4G94A 4OA8A 4ENJA 3M8EA 1YS7A 4PIMA 3ER8A 3HHHA 1KPIA 3ERCA 2OB2A 4FT4A 5D6EA 5D4SA 3OOPA 5LSAA 2ZZNA 3TDUC 3J80K 1Q0TA 2JTVA 5J6XA 2DPDA 1LJ9A 3A7EA 3MZYA 1HKTA 1VBFA 3RKXA 2Y1WA 3DPLC 4DM3A 1S7AA 4PINA 1LDKB 1S7OA 3U1DA 4V0QA 2ZLBA 2G1PA 1SMTA 3AWIA 3R9XB 1ORIA 3Q5FA 2ZTHA 2EFNA 4CDGA 3PFHA 1JQ3A 1NKVA 4D0PA 5BP7A 2IH4A 2DAOA 2XYQA 2RQPA 1FX7A 4PONA 2VN2A 2PY6A 2DW4A 3LAJA 2LKPA 5LHGA 2OKCA 1MKMA 3BROA 2C7RA 4OMYA 4Y2HA 2LDUA 2YX7A 1FP2A 3U9GA 1X19A 3KHKA 5K0GA 2FYTA 3LAPA 3ZQ7A 4RAYA 3OE4A 2LF8A 5D5UB 3TFWA 3KPWA 1W5SA 3ELKA 4B09A 3HRMA 1P2FA 1W7PD 2JHCA 3SSNA 3FTFA 4M7RA 3IV6A 2P6TA 3L00A 2PXCA 3FMRA 5DTRA 1OR7A 2PT9A 4IV0A 2DK8A 1YF3A 1R58A 1Z91A 1ZYRF 3FM3A 1VL5A 2RC4A 2GH1A 2WC2A 2ESHA 3IWFA 5C0OE 2OO3A 2PFBA 5EZQA 3U2RA 3K69A 3VOEA 3RPQA 1FYMA 4EQZA 1LDJA 3B7PA 4BLWA 1RJEA 1QQIA 3ZMTA 2YR0A 3DKWA 3ME5A 4MHGA 5HILA 4OBWA 1ZARA 4TV7A 3TKYA 1JG1A 2R7DA 2HV9A 3PS9A 4RX1A 1I1NA 4GBED 4M9ZA 1YS6A 2ZNZA 4LLLA 3KQWA 4HH4A 2NP6A 2R3SA 4C03A 2L02A 1SD4A 2PI0A 1EJ6A 5ED4A 4I09A 3KPVA 5BW5A 4UVAA 1IN4A 5K0EA 2F8LA 4ZZDA 1DCTA 3UFBA 1RUNA 1SFXA 2PN6A 4BY9E 4CTJA 4PCAA 3TO7A 2E7WA 1U8RA 1PUEE 3NEUA 2NNNA 2F5DA 3CJQA 2HDCA 2G72A 2VC0A 4WXDA 4HYEA 4X1OA 1FZPB 3AY0A 5DXAA 3ECHA 4ON0A 2F5EA 4PYOA 5C1IA 4RSRA 4ETSA 2NNYA 2GAUA 5FUBA 3MAGA 4CO8A 2A14A 4DMGA 4G6DA 4Y13A 3MCZA 5HS9A 2OZUA 2K86A 5EEHA 3FX3A 4HTFB 4Z2YA 2HOEA 5FD6A 1CGPA 4QTTB 3GFLA 4LWPA 5JFRA 1DP7P 5L3EA 1TTYA 2FXAA 4LG1A 1L3CA 3VC2A 2P40A 1FP1D 2HQNA 3MWMA 4KNYA 2JJQA 3AAFA 4FZVA 3DXZA 4FT2A 1R00A 3GDHA 4L18B 4U7PB 3HA7A 1U5TB 2EWNA 4BH9A 4PCQA 3OV8A 3HCEA 1SFEA 5JI6A 2VOOA 4RVGA 4GUAA 4NHJA 2AOUA 3CUQB 5EG5A 4RYLA 4CKBA 1ZN2A 1AF7A 3SZTA 1IRFA 2QWWA 3J81Z 1E17A 1FNNA 3VSEA 5CVVA 5EMJA 3P2EA 4Q48A 1MDMA 3TM4A 3PB3A 4BHBA 4CTKA 1XSVA 2ZCWA 3OPNA 4RAZA 3DXJF 4M9SA 1KU7A 2K7LA 1RI5A 3HYIA 3JWHA 3M33A 3TLJA 4HOBA 1F4KA 5DWQA 1QAMA 2ESNA 3QU6A 1P39A 4EM1A 4OQDA 1IN6A 2VXZA 3O3KA 3TMAA 2DFIA 2CMGA 2DPMA 4XLNF 4M36A 3KQPA 4EJTA 3BWGA 2IPQX 3G73A 5LGNA 1FC3A 3A27A 2FNPA 4I7HA 3DP7A 3GJYA 1Y8CA 2JHPA 3RYRA 2WA2A 3HA3A 1ZRCA 1OYIA 5DT2A 1G55A 5DM1A 2ADUA 2C7PA 1YIOA 1WQ2A 2OZ6A 3C7JA 1TLHB 4ER5A 2A5YB 1QBJA 3JAMK 1HKQA 1IAWA 4JXJA 1HSJA 2FBKA 3HTSB 1XCJA 4OMZA 1IM8A 2PX5A 2P4WA 1BHJA 3GNLA 3QPHA 5H6QA 2PX8A 5HOQA 4PNEA 2XIGA 3LSTA 3C18A 2NS0A 4KIGA 1UIRA 3MQ0A 4YFNF 2EX4A 4IJAA 2QBYA 1JHFA 3F72A 4GO1A 2WK1A 2O0LA 1FYLA 5JHUA 2B9EA 2IA0A 1O7LA 2KIMA 1ZHFA 4HZFA 3TQNA 3SQNA 5D1NA 1QGPA 4AZTA 1OMIA 3A25A 3PFGA 3K1PA 1LEAA 4HGZA 2PJPA 1NW5A 3L09A 1Q0SA 4G8XA 5F1RA 3EVBA 4KIBA 5DD8A 5ICFA 3BWBA 2NYUA 2O07A 5JVTA 5E1XA 1XB4A 3C1DA 2AS5F 4QDJA 4EKIA 2NXJA 2BM9A 2FMLA 1RI2A 2EV0A 4L0YB 5H02A 2OYRA 3G5TA 1Q1HA 4P7FA 3W6KB 4G7ZF 3RIEA 3F8MA 5EMMA 3WGHA 3HOSA 3CTAA 2BR4A 3JWIA 3P8ZA 1G3SA 1ZRDA 1RJFA 4FS8A 3UJ8A 4ZZLA 1NW7A 2AOVA 3R24A 1R18A 2P8JA 3QP6A 4CGZA 3PX2A 2FU4A 2RGVA 2IDJA 2Y48A 4RGUA 2Y0MA 1IXKA 3Q9SA 3KQQA 5DM4A 3B89A 2FSWA 1VE3A 1G8SA 1G4DA 5EMLA 3VFZA 4R6WA 4R79A 5DX0A 3LHDA 4E32A 2FA5A 3BY6A 4IRGA 4M72A 3L9FA 1SD7A 1ON1A 4FSXA 3FUXA 4Q47A 3P97A 3TPZA 1ZKDA 1YFJA 2ZVJA 2FPOA 5E1MA 1ZG5A 3DXXA 3BGIA 3L8DA 1I9GA 4GYIA 2EV5A 3A4TA 4RS8A 1FSEA 5F6FA 3QOXA 2VBXA 3C3YA 3W6JB 3C3PA 4E2XA 5FHRA 3I58A 5DCFA 2ZIEA 2B0LA 3CDHA 5FWAA 2YXEA 2AVDA 4P7GA 5K0FA 10MHA 3TQSA 3LA7A 3C0KA 1LNWA 3F8BA 4P55A 3FMQA 4RGXA 4PCLA 4G9YA 4ISCA 4LB6B 4GOND 1IRGA 2STTA 4WVLA 1NW6A 3N4MA 4WXHA 3OFJA 4C05A 1P6RA 2VDWA 3ZMVA 2GB4A 1KGSA 1JSXA 2AZTA 2OU2A 5FULA 3G88A 2VBWA 7MHTA 1FBSA 4DCGA 4YV1A 4GYGA 1K79A 1KU3A 4LJZF 2JH9A 3WTTC 4DF3A 3GLXA 3J80Z 5E9QA 4LK1F 5A2QZ 4Q5SF 3V8JA 2HKXA 3KZZA 4U0WA 3KEOA 5CLSA 4ESFA 2XYRA 1MJ9A 5DDGA 3I9FA 4CXMA 2ZW9A 2IP2A 4X41A 4RTSA 4IV8A 3EEOA 2XRNA 4ZTBA 3WGGA 1L9KA 4YMGA 3EGIA 5BQTA 2PMUA 1GXQA 2ZO4A 3ZMZA 1J7KA 1IW7F 1JSZA 4EGYA 2B2CA 1T98A 3BJAA 3QOPA 4I2OA 4U7TB 2NP7A 3NDJA 5EGSA 3ZPLA 1BC7C 3ELWA 3P9KA 4AD9A 2BH2A 4A2UA 3EVGA 3JSOA 5DRTA 4OIRF 1HMYA 2ZIFA 2I9KA 3MTIA 3O31A 2GWRA 3VEPA 2D45A 1WZNA 1O3SA 1M6YA 2RNJA 1SG9A 3ER9A 2XGXA 4MEYF 3SFZA 1PJZA 2HFHA 2P35A 1SD6A 5K01A 5D8LB 2VOPA 1NE2A 2Z5UA 5DTQA 1LB2A 2IPXA 1DPRA 4OINF 3G89A 4YV2A 2Z9OA 2P1DA 4RTKA 4CKEA 4IKPA 1W4MA 1R5GA 3ROUA 3M6UA 3FXRA 1BC8C 3KR9A 3KFWX 2NAZA 1J59A 3DLIA 3ZN0A 1U6GA 4UHTA 3ULQB 4QQNA 4DNCA 4U7DA 1R1TA 3WGIA 2AN4A 3IYLW 1Z7UA 3QU3A 3KLNA 1DUXC 3DR5A 2FE3A 4XLPF 3X0DA 3TO9A 1G3WA 4DQ0A 3MERA 2CMHA 1RZ4A 3BPXA 3OU2A 4PYQA 2OBFA 1ONVA 4P7KA 5LGTA 2PLYA 3GFIA 2PEXA 1HBXG 5EKUA 2H00A 2MA3A 5CVRA 4HLYA 3E3VA 3HRUA 1OKRA 3ML6A 4EJUA 2EB7A 2QYOA 1KPHA 3UJBA 4M38A 3G2MA 4ESJA 5HVQC 2JZYA 4BP1A 3WTZA 2K02A 3BWYA 4RVDA 4HW0A 1KA8A 2V1UA 1SQFA 2HWVA 1ZG3A 5E18F 2JRTA 2P3QA 3THRA 1V4RA 4P58A 3MTEA 3UJ9A 4XUDA 3V97A 2OA4A 1NBHA 1P4WA 2H94A 4MQVA 4RGSA 3OZRA 2IGTA 3BKXA 5EC8A 5BPIA 5EHGA 4ER7A 2D1VA 3RKYA 5F2NA 4XRFA 1EG2A 4RTOA 5BS6A 2UZ4A 2HTSA 1X1CA 2G70A 1NV8A 2HYGD 3IRRA 5HS8A 3KE2A 3NVKI 1X1AA 2VS1A 2FNAA 4ER6A 1DUSA 2PX4A 1FSHA 3ELUA 1W7PA 2D1HA 3FM5A 3KQMA 1BM9A 3NWBA 2AN5A 4R05A 3HTXA 2DQLA 4F7ZA 2RV8A 3EMDA 5BXYA 4ENNA 3PQKA 2GZWA 2PX2A 2IBTA 4E2ZA 3GX4X 5FLXK 5EKXA 2XAQA 3EDPA 4LMYA 2WWYA 3NWEA 3P7NA 2COMA 2Y1XA 1O3QA 3IKVA 2P7HA 1MHTA 2WTEA 1U3EM 3ANXA 2J5OA 3HSEA 5DSXA 3OU6A 2V79A 3RTRA 3R4KA 2Z6UA 5DPMA 4HX4A 4FGZA 1D8KA 4L5IA 4PYLA 4RGRA 2GPYA 5A2QK 1D5VA 1BIAA 1FLIA 4LLGF 2AOUB 1XTPA 4PWYA 4EVIA 2WV0A 3EYYA 1BI0A 4ZYDA 2QQ9A 3UJCA 1I4WA 3O2PE 2PT6A 3BZBA 1YW7A 4EMSA 1MDMB 4HLXA 3WTWC 3EVCA 3KQOA 3WU0A 3R0JA 2QUFA 4ESBA 3SZPA 1USTA 1ZAOA 3KCCA 1VP9A 2NXNA 5HDGA 3T0IA 1WWXA 2CYYA 2DK5A 3HIFA 1MZBA 3PFIA 2G8NA 4XUEA 5K0CA 3V7RA 5HFJA 5DCMB 3MEXA 3S2WA 4KVZA 1EIZA 1Y0UA 4CYDA 4KFCA 2FOKA 1FPQA 4R8RA 2FRHA 3T8TA 5K1YA 4GOOD 3UA3A 5EIWA 1XCBA 3JAMZ 2PWPA 2ZFUA 3MQ2A 2YTZA 3TDZC 2H1RA 2EA2A 2FBHA 4XSZF 2A6EF 1O9HA 3LKDA 4PZJA 4XSXF 5AONA 1L0OC 3CJRA 3GFMA 3G7UA 1SFUA 5FO5A 3WODF 2H27A 4AX8A 5HOOA 1EH7A 1HKSA 1YW9A 5EOVA 5EPEA 2F2EA 5G02A 5DYMA 5LBQA 3GWZA 3BGDA 3SM3A 3GUDA 3HUGA 2VDUE 4QPNA 5HEKA 1C0WA 3SVZA 5IT9K 3DV8A 4G7OF 4RTPA 3M4XA 1Z6RA 4PDKA 3F8FA 2UYHA 2ERCA 1R8XA 1D3YA 1YG2A 2L4AA 2MH2A 4EGZA 3OFKA 3O6BB 3CCFA 4IHSA 5K5RA 3K6RA 2KIUA 2BZGA 2XHKA 4WXCA 4EQQA 3BWCA 1JG2A 1VP3A 3F4KA 1OYYA 2V6CA 4R1HA 3CGGA 4I02A 3E6CC 1L3BA 3R0AA 2G7HA 3OZTA 3WTVC 2I7CA 3UJ6A 1B9NA 3DMGA 1O7FA 5LLQA 3I59B 2CL5A 1OYWA 2L01A 1XSXA 4M9XA 4UV9A 4X61A 2O8XA 1GXPA 2O03A 2F5FA 2QRVA 2HKOA 3HRTA 5FB2A 4IRHA 2HTEA 3KQVA 2UXNA 1OPCA 3A26A 3K0BA 3GCZA 3UBTA 1T2KA 5L3FA 5K0BA 2Q0OA 2YXLA 2ZJ2A 1HW5A 1XDSA 1ZREA 2M5WA 2AOXA 2A3SA 2VE8A 1XXLA 5AIQA 2FQ3A 5HIJA 3BGVA 1SD5A 4HX7A 3ZMUA 3FXQA 5LRSA 3CKKA 1JGSA 2ETHA 3H3UA 1FWZA 2CWWA 3FXUA 4BP3A 4WF2A 4RVHA 1UHMA 2G9WA 2W84A 4WCGA 1T43A 4OA5A 5GM1A 5DD4A 4FP9A 1YLFA 3D2LA 3KKZA 4NQWA 4LK0F 4HSGA 2UYCA 1M6EX 4BAYA 1FYKA 2V74B 3L2CA 1ZQ9A 3BKWA 2V7EA 2A68F 1X1BA 1AWCA 4UVBA 3N97A 5EVJA 3DF8A 4CHUA 5EQJB 1F9NA 4QTUB 3M8FA 2EJTA 4POOA 4GQBA 2HNKA 5E8JA 5K0LA 1F1ZA 1FT9A 3CLOA 1AV6A 5E1WA 2CSOA 2TDXA 1JQEA 2ZCJA 2XROA 2FK8A 1UWVA 1BOAA 1HNNA 3UWPA 3B02A 1JQDA 1D8JA 4HV6A 2IT0A 1QANA 2BBYA 1TQMA 2PVCA 3FPJA 2XAJA 3NQOA 2OY0A 2ZWAA 2QE6A 3FYCA 1RI4A 2ZWVA 4B17A 1G38A 1LVAA 1KIAA 5E2BA 4CKCA 3FUVA 2P3OA 1XGSA 4WX9A 3BWMA 2P5KA 2ADMA 2HR1A 5KYGA 1YZ3A 1KYZA 3EYIA 1A04A 3E23A 4LFUA 2ZFWA 1L3LA 5HIIA 2XKPA 3KETA 3C6MA 3NRVA 1QPMA 4FSDA 3CBGA 2PBIA 4X63A 4IF4A 3CUOA 1ODDA 1AQIA 1MJBA 4KUMA 1RNLA 4L9JA 3KR1A 3R3HA 4K6MA 5D5WB 1I1SA 5LQRA 4E33A 2MD5A 3TR6A 1S6LA 1S8NA 5F64A 1QZZA 1NHAA 3NVMB 3P9CA 1I6XA 3D5LA 4KN4X 2JHAA 4RTQA 1XD7A 3H3ZA 3BPVA 2GLUA 2OBPA 1K6OA 3B3FA 3LA2A 5EZSA 3WTUC 3OU7A 1ZGJA 3V8VA 5LQKA 4C08A 1SKMA 4P96A 4OIOF 5H6RA 1UFMA 3FPFA 3MGGA 5KK1A 4LG0A 2EG5A 2MC3A 4L0ZB 4FHTA 3HCBA 3TM5A 5K05A 5DTMA 2IVMA 3EVAA 4MNUA 4MTDA 5CYVA 3PVCA 2IA1A 4OIQF 3LBYA 5FA8A 5CIYA 2XVAA 2VBZA 4L9NA 3GRUA 5FQOA 3GZ5A 5D4RA 1R23A 3F3XA 3KR2A 5LQAA 3IRQA 4P5OA 2NYXA 2W57A 1EH8A 3PX3A 5FCDA 2G7UA 1R74A 2Q2EA 1SQGA 1KYWA 2ZMEB 4QPPA 4G7HF 2PGXA 2CKDA 1USSA 4AVPA 3HVKA 4KICA 2W25A 3F6OA 2CQKA 1T0FA 4M6XA 3CJTA 3GFJA 1AQJA 5FD5A 3LBFA 2LD4A 4G56A 4A0XA 1P4AA 4IXAA 3K9TA 1VQ1A 2KRFA 2FK7A 1TW2A 4QVKA 1ZH5A 3WSTA 2MH9A 1XSDA 4G6QA 1SMYF 5HLHA 2ZULA 3KZYA 5FFZA 3K2ZA 3FTDA 2YXDA 4C4AA 2AR0A 3KP7A 3K1MA 3GRRA 2XVMA 2O6GE 3KLOA 4A6EA 4M71A 3IWZA 2XYVA 2CO5A 4HV5A 2P7CB 3M9AA 2Z6QA 3WG9A 1X3UA 2R7FA 3SHFA 4S05A 5LQJA 2PQ8A 4E2YA 5CD1A 4R6XA 4YUXA 2CFXA 1T38A 2J5PA 4KMFA 4YFKF 5ICCA 2AOTA 4MQ4A 1U5TA 4AIJA 3HTUA 1LQ1A 2PXAA 5FLXZ 1W7PB 1YW8A 2QZ8A 2IFTA 3T7SA 2K4BA 3GF2A 4RB1A 2GA9A 2EA4A 3ZP5A 1HSTA 5E8GA 3T1BA 2GAFA 4R8SA 2PMHA 1NV9A 2B3TA 1YFLA 2GXBA 3GO5A 5DUKA 3K0LA 2ZBKA 2V1DA 3QP5A 3H2BA 1L3IA 3ORHA 1EH6A 2GA2A 4YIIA 3EVFA 1R36A 4UOEA 5K03A 2V1XA 4FR0A 4S04A 3BUSA 2DT5A 4GCVA 4A0ZA 1SVUA 1O54A 2K4JA 4ENKA 1TPYA 4F84A 2Q8KA 3KQTA 3FPEA 4C04A 1IN5A 4Y17A 2G71A 5J8FA 4NB5A 2A07F 1YB2A 4V0RA 1O3RA 2HMYB 4KDCA 3E97A 1J5YA 1ZLJA 1F38A 2DPUA 1XGOA 4UV8A 4HRAA 4RTMA 5E8IA 2D2WA 4N0BA 3DMFA 5E17F 1O9GA 1KPGA 5E8RA 3LCVB 4MTLA 1D2HA 1VIDA 2VBYA 1B4AA 3FWEA 2DULA 4ZH4F 1S3JA 4LWOA 4Y15A 2AOWA 5LR6A 5ERIA 2N47A 3Q87B 1H9GA 3FUUA 4P9FA 3RJPA 4GC5A 1YUBA 3DLCA 4FX4A 2LNBA 1MJFA 4RTJA 3U81A 4EV0A 3B5IA 1KQ9A 5DUIA 3CC8A 2HYFA 1P1CA 1I5ZA 2IRFG 5K0NA 5CCBA 3LECA 2YR2A 1GVJA 4BNCA 3ELYA 2A61A 3RIRA 5IT9Z 4MIKA 4IRIA 2H11A 2XAGA 2GS9A 3HSFA 2ZNYA 2FBIA 4XUCA 4EJVA 3JTGA 3GGDA 4FT8A 8MHTA 1FY7A 2RN7A 1QYRA 3SX0A 5LQNA 1XDUA 2ZKZA 4KN7X 4MHTA 2CW0F 1E2XA 2ESRA 3HOTA 4KW7A 2E7XA 3ZMSA 1G6NA 4LGWA 1AOYA 5GM2A 2W85A 1TQPA 3C6KA 4GEKA 2QM3A 3KQSA 5GINE 1KP9A 2IH5A 2A6HF 4LB5A 5M5BA 3IC7A 3E6DA 3DMHA 3MFKA 5BOXA 1RJDA 5DM0A 5TRDA 1W5TA 1WY7A 2JPBA 1XGMA 1KQ8A 1X1DA 4L7VA 3I54A 2P3LA 4EJWA 3HP7A 3M6WA 5AIPA
chains in the Genus database with same CATH superfamily
1L5MA 5CBPB 3O9ZA 3PF8A 3RSFA 5THKA 3D8RA 4O63O 4QXPA 3FF1A 1SELA 2M1BA 3KZIC 3FETA 4U2CA 5JLJA 5HKAA 2ISYA 1T2DA 1IPHA 3ICOA 2Y0PA 2IW1A 2WF8A 4PZUA 3F9KA 4UXNA 4I01A 3HM5A 3CLTD 3FF4A 5K8JB 3F71A 1IEVA 3OCYA 1P9QC 4I0AA 4DWOA 1UUFA 3CNBA 5P8WA 2CVFA 2BGGA 4BBRJ 4E5MA 3OS1A 2XBUA 3IEIA 3O8HA 1SQ0A 3E7FA 4GMXA 2IBSA 5AHOA 1SZCA 4BFVA 3EBLA 5EIFA 3T9CA 3WGTA 1IYZA 1S2DA 2Y4NA 4HNUA 1YB1A 1RWBA 5CVJA 4ENQA 5DK4A 3VQTA 4CMGA 1MN6A 2HBZA 2M4GA 2BEUA 1ZGAA 5IVHA 1RYMA 4EKGA 2ETXA 1N6PA 4YEJA 1NT2A 5KX5B 1H9TA 4TMXA 2ZJBA 2B6HA 1V95A 3RKWA 3KCNA 1AKMA 2F4IA 3QV2A 4DLPA 1EFRD 4KAAA 1XZFA 4BKUA 2VDMB 4BC0A 2PWZA 3O91A 5B7QA 1OI7A 2O5VA 1H8EA 4YONB 4Y0AA 2LBFA 4Y9UA 2XOXA 3V8NA 2X51A 3NWTA 3W9YA 1KKUA 2IPNA 1CJUC 2ZRMA 4UTOA 1ENHA 5GIPE 1TRHA 2VAPA 4R84A 4JJGA 1FVFA 1R0WA 4EG5A 2G7MC 2V6IA 4QWMA 2DLLA 2P9HA 1O5OA 1GGNA 3DCYA 3OZGA 2PKQO 3IEVA 5BR8B 3WP0A 1XZNA 4P33A 1E4EB 5LBIA 2ONZA 4AJKA 3F46A 2AXLA 1XDWA 4DA9A 3FHJA 1NLMA 2VN8A 1PSDA 4RFLA 4JLNA 1INLA 1L5QA 2GZRA 3DTYA 1D2AA 3F7TA 3VYWA 2D0OB 2FR8A 1P60A 1EDDA 3ZQLA 5EIAA 1PDVA 4DCMA 3OKPA 3H5AA 2HCTA 4O2BA 1Y7IA 5HS7A 2P0YA 4E70A 1U2RA 2WG0A 4GIBA 4MVYA 3TO6A 3ZN2A 5JJCA 1KH1A 1W4LA 1PFKA 4LK2A 4NMHA 3GO4A 2V8OA 1LWOA 4CSWA 3H2HA 2BEOA 1KMHA 1P44A 1YRYE 1SPBS 1AKHA 3VV3A 1NP6A 4DJJA 4N3BA 1UDRA 2VPWA 2PBRA 4LRYA 1U0BB 5IT3A 4P92A 3H87A 2QVOA 4IIXA 1XVAA 3CLRC 4B35A 9MHTA 3AF2A 2XE7A 4R68A 1AS0A 3JPWA 5IP6A 4FHCA 1P4SA 2Z4SA 3LIIA 1IZ9A 4WLUA 2QTNA 1Q74A 1QE3A 2WYIA 4B87A 1ORTA 1BVRA 5KWVA 3AR4A 2ZSHA 2BL4A 5D3MB 1C14A 2L3DA 4EUKA 3TF5A 1SA0B 4WZAB 2VCHA 3UHPA 3EGXA 1SEVA 3HSRA 2EFGA 5GJBA 3TL3A 4WCDA 3ZX5A 1V54H 4DXDA 4YPVA 3AVOA 4BLPA 4X20B 3G59A 4OREX 1YBFA 4CR6A 2HYIC 5GWXA 1QCCA 2ZJ1A 3B3QA 3UPTA 2L17A 2W4SA 1SUWA 3KDSE 1JN0A 2GDZA 4R1SA 4N9IA 3BZKA 2C5FA 4CCNA 2EF1A 2QQBA 5L4SA 5KYUA 1SIOA 5EEGA 3ORFA 1C7EA 3D4PA 1JEOA 2HPZA 2O8NA 4HX9A 1GYRA 2Q8NA 3TOBA 1L7DA 1B72A 1NW9B 1JSCA 1YJWI 2NW6A 4OOIA 5M04A 4MAFA 3H2SA 1K6YA 4EM2A 3V2GA 4AYBN 2BMAA 3CZ4A 4XDHA 4WT7A 4HFJA 4ERNA 4I4LA 2GILA 4UULA 1NKTA 1GZ4A 1GNSA 4FOLA 2TMDA 2B69A 2OMEA 5IUNC 1Z4JA 2CVHA 3EE6A 3BH7A 2OORC 4ZRDA 1PX0A 4OAYA 5M5XJ 2OXTA 5K8IA 3HJTA 1WI9A 1OBHA 2QVZX 4ILEA 4RMHA 5KNCD 2HIHA 4W97A 5CYGA 2QZ4A 1HA3A 4KP7A 2CGPA 1PZXA 1V6AA 1PGOA 5E4YA 1TNSA 1U1EA 1H0MA 1J42A 4DYVA 3VOTA 4R8HA 4HWGA 3QOYA 3GRVA 4DSTA 4YJHB 5JLWA 3A1EA 5CLGA 2WPDA 2Z83A 3RTDA 2YRFA 3V9AA 1P75A 3OETA 1P0QA 1TZ2A 3SJAA 2DOKA 1KWKA 4B73A 2C2KA 5F3WB 3E3MA 1VHQA 1DDNA 3R8FA 1AKYA 1VI6A 4KWCA 2YXNA 3GEGA 2YIJA 1E6WA 3T3IA 2JG3A 3WK4A 3A31A 1KJ8A 1VHLA 2VZ0A 4JVMA 5JYEA 3S1LA 4YREA 2DFKB 2FN7A 3AR8A 1VLMA 3OJ0A 4IJWA 1OR8A 3H0DA 3PM1A 2STWA 1YU6A 4EGJA 4KC0A 1V3FA 2IOYA 4AYXA 4M9RA 2RGUA 1CF2O 3RUEA 4MJ3A 1YTYA 3PQ3A 2DO7A 2ZJZA 1JFRA 3SZLA 4IR7A 4ITVA 3ND7A 2ISCA 1NN0A 1XF1A 3F3YA 3WLNA 2ZZMA 4JUAA 1RXYA 5L3GA 2BRUA 4WY8A 2DMNA 3TCKA 4C3HJ 5FBQB 5AK6A 3CMAI 3NM6B 2DSNA 1PJRA 1RIFA 3TZLA 4E88A 4HXEB 5GJWC 3GLSA 1IN1A 2QRGA 5JNVA 4PLVA 1P4GA 4RD6A 4YV0A 2G9UA 1WMEA 3W9UA 2XCSB 4L9VA 4CF5A 3K9LA 3M1IA 1R6AA 2NGRA 3BZ6A 3BGSA 2FKNA 3K9CA 3FWYA 2XYGA 3DFGA 5BR7A 3UBMA 3UYKA 3EGEA 1T8TA 2I4OA 3B6CA 1K7SN 3B1XA 4BWFB 1Z29A 1R8YA 4WPGA 2FPMA 2XH8A 3DFUA 4ENJA 1EFVB 3M8EA 4I99A 3SMVA 1DDOA 2IKQA 1XT6A 1YQDA 2R7VA 4ZJPA 3ZJ5A 1DTWB 2ZLBA 4UTXA 1I6LA 3Q5FA 3SEZA 2A1IA 5IWCA 1XVVA 2PKCA 3DAPA 4WBNA 3UHJA 5HQJA 3U9SA 1BS2A 2VN2A 1I6HJ 1K97A 3Q7RA 1RP1A 2YX7A 3ESXA 5FPQA 5A5GA 1UJ6A 1I13A 1RYEA 3GTOJ 3CRZA 4LRSB 2X6RA 4RAYA 3OE4A 2V0CA 4ZVUA 2JHCA 3BR1A 2QEXI 5KAFC 1OR7A 3CY6A 2EEZA 4B3RB 4IV0A 2YJNA 1KK0A 1JU9A 5TQVA 1TK3A 1Z45A 1QFYA 4EGCB 3LWDA 1QZXA 5DTDA 3NYWA 1ODSA 5EY5B 4RX1A 4JZKA 3HO1A 1ESMA 2GO7A 3EG9A 4I09A 2YNMC 3MJEA 2D2EA 1M8JA 3M6AA 1RUNA 4CCAA 3O2NA 4RMNA 2F5DA 1UMBA 4L5YA 3QMWA 3I3SR 1TQHA 2C5BA 3NBQA 2QZSA 1W1UA 2WF6A 5ALUA 2OZUA 2ORIA 1ZI9A 1P2TA 1XZAA 3ZJUA 5IY5H 2JAUA 1BFKA 2N0SA 2FZWA 4QOJA 2OXEA 3AL0B 2JJQA 3VC7A 4FT2A 2PUJA 2O20A 4Y2XA 4YCLA 1QKJA 2E35A 3F6PA 1PU2A 5EMJA 3ADBA 5HQ3B 3ZKWB 4IHJB 1RWVA 5KKCA 4J8PA 4RAZA 3UT5B 3V00A 3DL0A 2V3CC 1FS5A 1S3GA 1B1CA 2RI6A 1E1QD 5JYCA 2W83A 4YCMA 4M36A 4X1YB 2IPQX 1XTSA 1R12A 5LGNA 1FC3A 3D1VA 3K0FB 2ZUTA 1Y8CA 1CQIA 4KRYA 3VPBA 4M8IA 5J58A 3IBCA 3UWMA 4A1OA 3SQMA 4KREA 1QBJA 1TLLA 3OIUA 3IR7A 1BHJA 4U9IS 2PX8A 1ODJA 3O8QA 3BR5A 3UG6A 1QHYA 2HRDA 3WV4A 3C18A 2NU8B 2OQVA 1YS2X 4IJQA 3MQ0A 3AFIA 2DJNA 2DTXA 4AY4A 4WA7A 1F5SA 2DWOA 2PV7A 3BRCA 1ISRA 4IFEA 4IDCA 3HB1A 2PSHA 3L09A 2NYUA 1M34B 3KZCA 1MPTA 3WLIA 1HUQA 1QWOA 3C43A 5E7QA 1MMNA 4CF3A 3NDPA 4L0YB 4J4HA 4G7ZF 2KZGA 2Q2QA 4TXNA 3WGHA 3HZHA 4BC1A 2FOXA 1BE6A 2YJGA 5REQA 3NYQA 2ISQA 3E5MA 2AOVA 3FI9A 4GE0A 4C1BA 2FMFA 2FU4A 4XFKA 2O2YA 1GVNB 2R6CA 1CF4A 3ENZA 3B89A 5JANA 3DTKA 3DZFA 4E32A 3L9FA 4CQLA 4WMLA 4OUDB 2BGMA 1V5WA 3H7IA 1FTNA 3QLJA 5DGDA 3SBDA 1WBDA 3TP0A 3L8DA 3ZDFA 3EOAI 4CKWB 1OFCX 2G7ZA 2EW8A 5DGHA 1DBVO 4Y9DA 1NULA 4O2AF 2JBHA 2E1PA 4DG8A 4BJ1A 3I58A 1ZOLA 4QO8A 1VL1A 3ZBQA 2ZS9A 5JLAA 2GF2A 4GLBA 1HDZA 3GYBA 3GTMJ 1LNWA 1RAFA 4RU1A 1LX7A 3HKDB 2XCLA 3CZCA 1FTWA 1P6UA 2MU1A 3K4KA 3OIWA 4XFDA 3CTMA 3GJRA 4R3WA 1U3GA 1EGVB 1QS0B 4A8TA 1MB0A 1YRQA 1XTAA 1X1SA 3ANTA 3CEAA 4DV0B 5JWRA 3WGGA 3TBIA 3EGIA 1EAYA 3S2YA 3GP5A 4TMWA 1GXSB 1LNZA 1ZWLA 3A6DA 3LA8A 3EGDB 3RASA 4E7ZA 3QNMA 5CT6A 3A1UA 4TTTS 2CV0A 2R00C 5GOTA 5CK5A 5M7EA 3C7AA 5DHQA 3CF0A 3VI3B 3M0EA 1P7CA 4CKEA 1OFIA 1ECFA 4GBJA 1AZLA 3M6UA 3FXRA 1I1QB 1CR1A 1PWXA 3RGGA 5CNJA 1MH4A 2Q0SA 4NFHA 3U44B 4GYKA 4O4IA 3KLNA 5L3SA 2ZYSA 1NGSA 1ZR4A 1I24A 4RPLA 4UQOA 1WVIA 3X1KA 1K4TA 2ES4A 5CFQA 4B4OA 5C4JJ 2IZ6A 1USKA 2ZSFA 3NIDB 2FPLA 3GFIA 4KL8S 4RJJA 4JLPA 1F8UA 3ONQA 4Y3OA 3E9QA 1E2FA 2CQXA 1UJMA 2RGRA 4FFVA 3U7QA 1SOAA 2W98A 1KSJA 5L3QB 3G2MA 4ZHQB 3EIHA 1RXEA 1SQFA 5E18F 1WA5A 1TECE 1Z13A 3OZVA 2XMBA 2JEOA 5EINA 1X3ZB 3ZWXA 3V97A 1OU0A 3N2KA 3IBSA 4M21A 4RKFA 3W7VA 4MB6A 3NUQA 3GVCA 5BPIA 4I14A 5F2NA 3D4OA 3CVUA 5CDGA 2XGOA 2KMLA 3ZWCA 2PLFA 2DU8A 4F71A 4BFCA 2HNHA 1FSHA 2JKVA 1C9KA 4DLKA 4H59A 1Z67A 4EHIA 3V4RA 3GX4X 5FLXK 2R8EA 2G5CA 3P7NA 3JALB 1MHTA 1P4JA 3SN6A 2FEKA 4M76B 2ADOA 3R4KA 4L6AA 5EHZA 2GPYA 4YT8A 1QGOA 4X7MA 1BGVA 2RC6A 2R84A 2IV3A 2VA8A 2RMKA 2VPRA 3WTWC 3CH5A 4S1PA 1N0IA 1ZUIA 4LZNA 1HDEA 2R5WA 3KD3A 1CEXA 3CURA 1OMOA 1ZAOA 1Y34E 2WW8A 3HOWJ 4I8XA 3PDJA 2NXNA 1NSYA 1FTGA 3DM9B 5EA2A 5K0CA 3UAZA 2IEYA 1JEYB 3P0HA 5DGIA 5B3KA 1OSNA 3FW1A 3JTEA 3E1GA 5LIPA 1NMXA 1GITA 4AKHA 4YCNA 3ONNA 3CJRA 3WWPA 1SFUA 5JTUA 4Q7KA 1NVUQ 1NZDA 3ZE2B 1LBEA 3KQHA 2BF7A 4IOKA 2AEFA 4G7OF 4DLWA 1AKWA 2NAFA 3ZX4A 3CLHA 3ZOKA 2P77A 4EQQA 4OU5A 4RSHA 4EB3A 1W0UA 1EZZA 1ZIPA 3H9EO 4WVFA 4DV1B 2EW1A 3T1TA 1MA3A 5B4TA 3F7MA 1RR6A 1JWBB 2XAUA 1F8GA 2DWQA 5AM2A 4J6FA 2HKOA 4TRMA 4LHWA 2GKOA 2MABA 3JWPA 4QOFA 3GFVA 4B6GA 5ALOA 3FBTA 2G67A 4RV4A 4HDOB 2VE8A 2DJ5A 3W4JA 5BSTA 5JH7A 5U1PA 2CWWA 4TMKA 1AD2A 3HKEA 4Z4IA 2KLOA 4X7PA 1M10A 4OMUA 3BG3A 2R4QA 2UYCA 2MT9A 4IX1A 1IDYA 4CUGA 1JWAB 3WYFA 2Z9CA 4UVBA 2J31A 3DF8A 3MJ4A 3PF9A 5F04A 1JBQA 4OD0A 4I5IA 1ZESA 2VKEA 2PA3A 1E2GA 2RREA 5FUVA 3B02A 2FWAA 5DGCA 1YVDA 1D2NA 2QE6A 1EGHA 2KWIA 4GVLA 2P3OA 3BWMA 4MDHA 3OEED 4BVLA 4P7BA 5JYDA 4AJ1A 1B8PA 2NM0A 4UM9D 5JJLA 1QK5A 3KETA 1M1NB 1X7DA 1JYSA 2VAVA 4URWR 2EAUA 1L8XA 2EZTA 2H59A 2D54A 3TR6A 1QZZA 1NHAA 4D0NA 2P81A 1T5SA 1UH5A 5AM0A 1FJHA 2FDCA 1K6OA 5IKXA 3EWNA 5KYYB 4BEHB 3I52A 2QYTA 1EFDN 3O73A 3KAJA 1NFFA 3HVRA 3MAAC 2ZPTX 4LG0A 1NPDA 1U2SA 1WXDA 2XTZA 2VLIA 3NGXA 2F48A 2O3TA 3PVCA 1MIHA 1CD5A 2R1VB 1LPAB 5FQOA 5CLFA 4F4DA 3KR2A 2PKEA 5K20A 3K4MA 3P5JA 2H1OA 2ZMEB 4LHEA 2PDAA 4WGFA 4ZRNA 4AWBA 2Q62A 1OCEA 4BJ6C 4AVPA 3HVKA 3JTMA 3R41A 1VQ1A 3X43A 1TW2A 1SCAA 1KARA 5CK4A 1BXGB 3KZYA 4P0TA 3FOAA 3GDOA 1DCMA 4WKOA 3LUFA 4JUFA 4OO3A 4EBBA 2NSLA 1QF6A 3WA7A 1U2EA 3KZOA 4UNSA 4ARBA 2ATEA 2FWJA 2J0VA 2XYVA 4MW5A 4CT0A 5LQJA 3TLEA 3VYTB 3S2SA 4C21A 4CODB 3ITDA 1TYDE 3T4UA 2XOKD 1EWKA 4NNJA 3I4NJ 1H2BA 4F9EA 2ALJA 1T2NA 1NR5A 4R8SA 1YFLA 4FI3F 3I2HA 2DA2A 1RKXA 5JNRA 4L5BA 1QVTA 4FD3A 2NPOA 1WZCA 1E9AA 3GCDA 2Z30A 1A2KC 3BUSA 2DT5A 3AI1A 4DSZA 3V4VB 3FPEA 1DG3A 3LPDA 1HF0A 1JEJA 2IELA 2O8DA 1DSSG 3CPEA 4V24A 1WDTA 4H4KC 1DEKA 1XGOA 1W2WB 4QJ4A 5EZ6B 1ZUNA 3DBIA 3H3XA 3T3GA 3RYHB 1PK7A 4O5AA 1GVDA 1MP0A 4QNMA 4JITA 2N47A 4LXXA 2GZ2A 2JFBA 1V4NA 3WRWA 2KHZA 3H8JA 3O8BA 2HYFA 2GPBA 5ITZA 5JNSA 3QA3E 5CCBA 1EX1A 4YRCA 4RM2A 1IZ8A 1DQSA 5JS2A 3A3OA 5I45A 5IT9Z 3KQKA 3HSFA 1Z38A 3BEDA 1J2UA 1TIPA 4CDNA 2ZIXB 3L7NA 4EHNA 1G6NA 1EX9A 4FFBA 1U2GC 4Z7JA 4F8YA 2X0NA 2QM3A 4AP9A 2FUG2 2VTBA 3IC7A 1AKUA 1ZEMA 3VR5A 2ZTUA 1J8FA 5CDFA 1F0PA 2APJA 4IO1A 1RJDA 2JPBA 1PHPA 3I54A 1YOVA 3QIAA 3QXGA 5AHRA 3JYOA 4Q4CA 1G2OA 2GZMA 2VYVD 4QXMA 3LWBA 1GA6A 1PK9A 2MSEB 1T4CA 2H2DA 5D5XB 1JHHA 4PHHA 2JLVA 3DCJA 2PZAA 4RB0A 4J49A 2FFJA 4OXXA 2ME6A 1UQUA 1B76A 5FUXA 1FW6A 2GIVA 2VK8A 5J4YA 4EW3A 4IHKA 1Y8ZA 1N78A 4M37A 2O0JA 1XIVA 3E5UA 2HCRA 3UAGA 1YRAA 3WDMA 4OL0A 4FGLA 1KDTA 5B1IA 2QMHA 2NAPA 4AUKA 3HR7A 2K9NA 3Q8XB 3DXYA 1YX5A 3O1IC 1YRNB 2J9ZB 4PSUA 5LXTB 1NJ2A 3PA6A 1C8BA 1QOPB 5KHDA 2X8WA 3PNSA 5IT4A 5DM60 1V7ZA 1OY1A 2KIFA 2QL9A 2B1IA 2FSGA 3Q5EA 3KP1A 1YZFA 4KITB 3B8HA 2H85A 2PUEA 2O3FA 2QQAA 3A1YA 1IMJA 3M9LA 2O06A 4N82A 3UJHA 4B74A 1R0ZA 1FE8A 2GNAA 3VPGA 3M1EA 1S7EA 1W9MA 4UVCA 1TMKA 2E3JA 4GRAA 1UHWA 1UOEA 5F2EA 3OD1A 1OXTA 5GOZA 1O4VA 3H17A 3C8HA 3RSHA 1YQGA 1R22A 4RE6A 3JQ8A 3UV3A 3TPCA 2AJCA 3DKYA 4G8CA 2RK4A 4ZYEA 4FN4A 1ND5A 3ZXXA 3L1KA 3EXG2 4BXXJ 1GSAA 3ZXUB 3I4FA 3CVYA 5BT9A 3GFSA 1YK0A 1GUZA 4DREA 4LGYA 3HP1A 3WKEA 2V26A 5IC4A 4AIHA 4MGZR 1G98A 2PRJA 3NXKA 3WICA 1YKSA 1CQZA 3BMOA 4ZXFA 4MUNA 2ZJQF 1MSEC 4NU5A 4L4YA 2PVPA 1Z0AA 3X44A 2R5YA 5DWDA 2B7CA 3ZQHA 4PGGA 5AYVA 3DPUA 3OQPA 3KKLA 4H7KA 4QM7A 2QTBA 4ZKDA 5JD4A 3TOSA 1K4MA 4EX7A 5C35A 2HBYA 2A9JA 4P4SB 5FGMA 1R50A 4NCBA 1N3LA 1UT8A 1HO3A 5B5SA 2IPAB 4BV8A 3PJEA 3EVZA 3RHFA 3W79A 1EZ4A 1B0PA 3F7NA 3TSAA 5CW2A 4JBGA 3LXMA 5JFTA 2XGSA 2FEPA 2JCXA 3FYDA 4KDEA 4E51A 3G0GA 4DIQA 1ESCA 4XB6B 4HT3B 4BXOB 4IQJA 4HC4A 2JAPA 8GPBA 5FLVA 1U28C 3CLSC 3MN2A 4LSGA 5IAGA 1BHSA 2RKBA 3QVGB 2IE0A 4EGSA 3KZVA 4KQ2A 1AE1A 4LI0A 3SYKA 3VZCA 3EZ2A 1KU2A 2J08A 3PIOF 2C9OA 4NJMB 5BXQC 4EFDA 1T6ZA 3IEXA 5HRUA 4INZA 2LY2A 1HQYE 4OIPF 2ANCA 3RYFA 3ELDA 2IITA 3CRW1 3DZ8A 3C1AA 1QF9A 4U00A 1ORHA 1IBMB 3HL0A 5FH9A 4GAEA 1XG1A 2JVIA 3WWDA 3TZBA 2XF2A 4F72A 2IAIA 4RD0A 1UBTS 3QAHA 3SLGA 4LLNA 2IH2A 4ZJUA 4WK8F 4URXR 4DE5A 1VGQA 4RF5A 1Z3XA 3GW8A 5JMOA 2PVSA 4ZAWA 1QO7A 1PFYA 2YWDA 5E9JA 1V1MA 4M6YA 1QG2A 1ADBA 4KSBA 4ABYA 3CSUA 1J0RA 1KYXA 2F59A 3HLTA 1VPWA 2ISZA 3V8PA 1GTL1 3REQB 1SBYA 2GPJA 4L4XA 3FG9A 2EBIA 2R5FA 1XI2A 3A03A 1RVDA 1JG6A 1IFXA 2HHCA 2GYUA 4M3NA 1G5IA 3PSAA 3P9ZA 3NHRA 4FZJA 2ZYTX 5HX7A 1QC5A 3DSRA 3PJFA 4EB6A 3ZE1B 1TNDA 2R65A 1MORA 2Z4TA 3O2SB 3OFNA 2OE2A 1ZCZA 4ENMA 3C8UA 3D0OA 4YUYA 3CUQA 4JBNA 1W5CC 3Q7IA 3K71B 4M1QA 2X85A 1SZDA 1UZNA 2QPOA 2YV5A 1A77A 1RBZA 3QLVC 3D8TA 4J03A 4ZGGA 2QDKA 3ANLA 5I9BA 1ULSA 4RIHA 4CE6A 1VBNA 4Q1BA 3GLHE 4OLJA 2VUMJ 3QNUA 4LOLA 1QVRA 2OHVA 4AL4A 4DYRA 1QHGA 1I27A 3PX7A 4MW6A 5IT9A 3VC1A 2BFCB 3G9XA 3ONVA 3LUBA 4UZFA 4RK0A 1J9GA 1NUPA 2JW5A 1QF7A 1MX3A 1U1IA 2EDCA 1KFBB 3T7RA 3IC5A 4NG5A 4ATNA 4UUMA 4QX6A 5EE5B 3T7DA 2QTWB 3ZWWA 1UXOA 4P9UA 5SYNA 1EJ0A 1C1YA 4E30A 3ERMA 3EZNA 4AI6A 3Q3CA 4G07A 1AS3A 3VNVA 4HBLA 1V25A 5JWHA 2QTGA 4LJRA 1K6XA 3RQIA 5KNBH 2OPBA 4BATA 5JT1A 3UK0A 1Y9JA 2WAFA 2HBQA 3NPAA 1B0ZA 5BYAA 3G2QA 5EZ5A 1AB5A 3RRFA 4NYMR 1UFKA 1ODCA 2I3AA 1K8ZB 3VHXA 2EYUA 1XQ1A 3PXBA 3HZJA 3DUFA 4LFCB 3OF2A 1D5WA 2X2PA 4V1CI 1WXXA 3GPCA 1V45E 3JSAA 1LRLA 3FTEA 1USGA 1R0LA 3PNBA 3URKA 4M1OA 2XQVA 4YP7A 3T5CA 1O95A 3V1YA 3JR7A 3HC7A 2W2TA 5ERGB 3W6UA 1XZHA 4X97A 4U7BA 4LIUA 4LFBB 1P92A 1BAPA 3C3DA 1U1GA 2GQ0A 3FWPA 5LP1A 2BONA 3WLOA 4Z9AA 2PUBA 3HG7A 4YECA 3CH7A 3GFPA 3IP1A 3HHHA 1T24A 4FMPA 1TMGE 3M34A 2NVOA 2BKUA 1G66A 4G5QA 3T9EA 2COEA 1C7ZA 2O2XA 3OE1A 2PCJA 3MRSA 1Z7BA 5KNDD 5DSZA 4UZEA 4MRNA 1NKVA 1Y3AA 4JOQA 4NR0A 1MBGA 1LE8A 2LKPA 1L5KA 4N5NA 3UUFA 1AQUA 2IJGX 3EAQA 1WXFA 3AI3A 4B43A 1OFGA 2Y0DA 1C30B 2FZVA 3B53X 1GZ3A 1BDMA 2ROQA 1M6NA 3WGZA 1MIOB 3PE6A 1ZIYA 3PGVA 2WZDA 3KUKA 3U5ZB 3K69A 4FKZA 2Z04A 4JA0A 2HMWA 2XT9A 4OBWA 1FFWA 2ZT6A 1FYFA 4MPTA 4OJYA 1VKJA 4RLQA 2HWXA 3RJ9A 1I1NA 3O2JA 4LCJA 1YS6A 3CHYA 1NG9A 2XYPA 2XKKA 1CFZA 3PCTA 1P33A 2Q5FA 4A3CJ 3T0GA 2AXQA 5C4MA 1CFJA 2QLLA 2E89A 4P32A 3EPRA 5K1ZA 4A36A 2WQZA 3CF2A 3OSGA 3W2WA 2P2YA 5HS9A 3HOXJ 2K86A 5EYPB 3EDOA 3VAZA 2OENG 3STWA 2ZAGA 2F9FA 5GADJ 5TS2A 3PHLA 1GTSA 4WKBA 4LG1A 1FP1D 4DG5A 3STTA 3RH0A 3KM0A 4EA8A 1KEUA 1K0UA 4CM1A 1DJOA 5KOJB 3HKZA 2AWOA 4WDQA 1HLVA 4LKRA 3VNSA 5BNTA 2OAGA 2JJMA 1JNYA 5KTYA 1SFEA 3D0QA 4GUAA 4I4TB 3O95A 4CH7A 1NKSA 2DA3A 1IRFA 2QWWA 2NU9B 1V5FA 2ENWA 3VPFA 1XSVA 3LVFO 2X48A 4M9SA 3GJ7A 4ZC8A 1QWSA 3HYIA 2ZP1A 1U0EA 3SF8B 4B83A 3TH5A 4UHKA 4CLOA 1DT3A 2DPMA 4EWLA 3KQPA 4EJTA 3BWGA 1EM8B 3MTGA 1Q3KA 4LUCA 4J7AA 1UOQA 2C7PA 4QATA 1WZEA 2A5YB 1JKMA 5CFLA 5LQDA 2N9UA 3DE7X 1N2CA 5JS6A 3MJSA 5H6QA 4RZUA 4IG9A 1FVHA 1RCUA 1VOTA 3QITA 1FMCA 3PNYA 4ZYAA 5B55A 4CBVA 2IA0A 2KIMA 1D1TA 2I8DA 1W48A 4A8JC 4EW2A 2PPLA 2BEWA 2YJ5A 2YL2A 4U9UA 4EMBA 2Q4OA 3KO8A 1HYHA 3KLMX 3RROA 1JMVA 2Z08A 1IBKB 1YJXA 4LHZA 1Y1TA 1TLTA 2NXJA 5LZ4A 3THYA 1FOWA 3W6KB 2C4NA 2CUNA 3RIEA 4EI7A 1WSAA 5FKMA 5TY0A 4L75A 1UJBA 5A1TA 1J5EB 3PX2A 3GLRA 2CLDX 3HPHA 3S81A 2IHJA 4QSHA 2HF9A 2REXB 3K9GA 2W4IA 4C4XA 1CK4A 2MSNA 4FYMA 3HXLA 2HRQA 4EI2A 3EQ6A 5J4HA 3OYCA 1Y5MA 3A6PC 5LD2C 4L5EA 2PT7A 2HQAA 2IVZA 1E6UA 1P1FA 2HM7A 4US1R 2CT8A 1A82A 1Y1QA 3DT8A 3TQSA 4B4WA 1O96B 2C1ZA 5HJ7A 5LZ9A 2Z5GA 1FBSA 5E3HA 2VHEA 3OM9A 5AKXA 3E81A 1NJFA 1KU3A 3WTTC 2IHYA 3GLXA 5FLYA 3LOCA 4LX0A 3TRIA 3WQBA 1WQ3A 3LU1A 3ZTWA 3KEOA 4ESFA 1N1EA 5TMPA 4W7IA 4L51A 1TDJA 1VHTA 1QU2A 1DGQA 4L02A 1GWNA 4FZ5A 4HO1X 4C7KA 5GPBA 1VA5A 3KYCA 2DFPA 1K1EA 4UU7A 2CXSA 9GPBA 3N1UA 3BJAA 3DTEA 3RCBA 4AD9A 2BH2A 4OGLA 3KYJB 5COAA 1EVJA 1KQ3A 2NQ8A 1WZNA 3NTQA 2JGLA 3LUJA 4NQZA 4I2NA 3GEHA 2OUKA 3V1LA 5D8LB 5GGYA 1SKAA 1LBTA 1NBME 1NRXA 2Q3FA 5FPKA 4CCYA 3FYUC 3DONA 4FOPA 1W4MA 4B5LA 1DIBA 3PRHA 4OJKA 3RAGA 4E6KG 1FQWA 2XOEA 4KQHA 4XVQA 5D3KA 4EF5A 2ZU0C 5AVZA 3CU5A 3NC4A 2IGKA 1E2JA 2YVKA 4N7RA 1UBGA 3B6MA 1DIAA 2PO7A 3EW9A 2IZZA 3BIJA 3CCCA 2BFPA 2CYBA 1L7PA 3A02A 2WWTA 2K02A 4RVDA 2J4FA 4EATA 1NBHA 2JF0A 3HNOA 4KE8A 3HBAA 3VR0A 4XRFA 3HV2A 1F2VA 1V47A 3L6RA 2UU9B 3H5WA 3I9NA 3C3BA 4BKXA 5CXXA 3NVKI 4XWAA 1ST3A 2AN5A 2DQLA 2RV8A 1B6TA 4ENNA 3PQKA 4MWTA 3P9YA 4E2ZA 3RD5A 1NG6A 2WWYA 1PO7A 2A2ZA 3DKVA 1J9ZA 3LLMA 1ORDA 4MS4B 5HCIA 4M0EA 4FGZA 1GSHA 4JH0A 3URMA 5A2QK 3LA6A 2DJIA 1XTPA 3AGQA 3LZCA 2I1LA 4HCJA 1WDKA 4DLUA 4GR4A 4V39A 3ZOZA 2AD1A 5IFKA 1Y5IA 3OZIA 1L7AA 4ARZA 3O8LA 5CP8A 3IDSA 1UJ5A 3ZHBA 1F1BA 1QHHA 1KMNA 2QVLA 1HQDA 1T4DA 2PPVA 3LY7A 3SE0A 2EH3A 4TLBA 4NULA 4MW0A 1WCMJ 3QSGA 2I4IA 2DQKA 2OSBA 2C8KA 4LJAA 1M9NA 3QLUC 5HFAA 4PVCA 4PSKA 3LKDA 4NFLA 4A16A 4B3MB 4GR9A 5DTEA 5AIAA 3G7UA 4LDPA 1EH7A 3SM3A 2JCSA 2VDUE 2QJWA 4FJ1A 3PNVA 4UJ5A 1G4AE 5MGBA 5FL7D 4K9DA 3ZU5A 4BRUA 1FNCA 5A4MS 5IAJA 3COYA 1G8XA 4FKBA 2G7HA 2ZB3A 1CWUA 1NBOA 2N3ZA 5IYDJ 2IBDA 4JLWA 4D3DA 2P0WA 5F9MA 3GXBA 3VSCA 1VA4A 2IBMA 3Q0WA 3H8VA 5A4DA 1T4MA 4V3BA 1OHHD 2C20A 3GBGA 4JENA 1MQAA 4UAJA 2CDNA 4IHVA 4G23A 2P9QA 5L3FA 5EHNA 1A7JA 1AK9A 2OBBA 1YDHA 3OYFA 1BQEA 2EZ4A 1QYIA 1I5RA 1W49A 4W6ZA 1G4HA 3ZMUA 2GJ9A 3ENQA 4C6SA 2Q5LA 2B4RO 1ZY2A 2UUBB 4BU2A 3RUPA 4YYZA 3L5OA 2WWFA 4YAIA 3IAS1 2Z43A 3H5RA 4CM3A 4EEFG 3PWSA 4QHYA 3LG2A 4D8WA 3TQCA 4U7FA 1NOIA 1FYKA 3TXAA 4K2AA 3SJBA 1AMNA 3RS5A 4DHWA 2LIVA 3BLYA 4GQBA 4ZVOA 2HNKA 1GG5A 1KZ1A 2E4YA 5JVDA 5H8WA 3Q88A 5C5DA 1CY6A 1R37A 4N4OB 1GZHB 4WKGA 3BDVA 1TQMA 3NVAA 3Q10A 3VR6A 3DPIA 4N6OA 4MWEA 3C6ZA 4DMUB 2B4QA 2BY2A 4JB2A 1N8KA 4WBSA 3TSOA 4G5RA 1L3LA 2ST1A 4I6EA 4AWXA 2AG1A 2XKPA 2BGKA 1MJBA 2UYYA 1LLCA 3WGNA 1I6XA 2JVHA 3WB1A 3EARA 2X4DA 3WLKX 3FTPA 2GLUA 2EJBA 4KEAA 1JQJC 4AB1A 1E7RA 5HWSA 4DYQA 3CFYA 3NHBA 3N5KA 2DA4A 1P17A 1PNTA 5KYTA 4D0GA 4BO7A 4N6GA 1VFPA 1RJ9B 2I67A 3HBNA 3D7KA 1ZINA 2QI9F 4PC6A 3DGFC 3T1NA 3KOMA 1NZJA 1WXHA 1R4NA 3U3JA 1GQ2A 2X1HA 1D1PA 1F4LA 3VPCA 4ZEOA 2AC2A 3RC8A 3K09C 3VPXA 2DBVO 1UPXA 2ZI4A 4HMQA 5IK2A 4OHPA 1PD1A 2AMYA 4QUHA 3K9TA 2L82A 2NSHA 3ER6A 4L8GA 1B7GO 2GF9A 4GFDA 2HOAA 1J56A 1NBMD 3WLMA 4PE5B 3I5XA 5CXQA 1YJCA 2XNKA 2XVMA 5M3BA 3F9IA 2N8GA 3EBOA 2CBZA 2I6SA 4KPYA 3Q9NA 3EHDA 3KVNA 3NH9A 3WG9A 2V6GA 2WVJA 4RADA 2YV4A 4TN5A 5AQEA 3HY3A 1WXGA 4OL9A 1DC8A 4MQ4A 2LUOA 2QT1A 2QZJA 4IZ6A 1LQ1A 1D04A 4QXAA 4YTEA 4PS1A 2EA4A 1UFRA 5HFNA 3HPQA 3T1BA 5I8ZA 1QQ7A 3UICA 3GNSA 5ECDA 2IEDA 5BSGA 2J67A 3GGCA 4F4JA 2XY4A 3T9BA 4CA0A 1UBFA 1TEHA 2ZUEA 1A8PA 5IDXA 4FIZA 1J8YF 2R79A 4C04A 1NRIA 3QUQA 1OB5A 3DZJA 5IC6A 2QPAA 5J4KA 4F38A 3D2AA 3M4ZA 2J9FB 4W1RA 3IAFA 4BYGA 3OQJA 4RTMA 5DIFA 4NE9A 2D2WA 4IXNA 4K9SA 3ZQ6A 4LRQA 4NFYA 2FY8A 2D5LA 1L7XA 4GI3A 1S3JA 1EUYA 5C1BA 4FX4A 1RWMA 3RYCB 3PUIA 1TEVA 5I6DA 1XMIA 1I2MA 2R47A 5IP9J 2IRFG 3ZUGA 5D5HA 2Q9AA 4R1MA 4JQYA 4JQOA 4MIKA 5EE3A 5JARA 2GERA 2CZGA 2GS9A 2TECE 4RZIA 4C6TB 2ECCA 4G24A 2XDYA 4CMCA 2C4UA 5DH9A 2JVKA 2DOFA 2HY7A 3K1TA 1SOUA 1E0EA 2XT6A 2CB9A 3ZGKA 4C0HA 4QNNA 5BOXA 5TRDA 3DCFA 4YHHB 3HGTA 3U13A 2YKGA 2CEKA 5KNDA 4Q12A 5LWHA 3FOWA 5F5XA 4YRIA 1JKQC 3CVXA 1DMRA 3OLCX 2P6SA 4DIEA 5JO0A 2XVYA 1V1RA 2HTJA 1LJUA 2EFQA 3FMSA 4HDMA 4LF7B 2HA7A 2HQRA 4A3BJ 1WXQA 3Q0IA 2HXSA 3JVEA 3JR3A 5TJJA 3CONA 6Q21A 3EC7A 3OZDA 4RVSA 1DL5A 2GM4A 1ELOA 1H89C 2EJUA 1D2GA 1J09A 1WSUA 1U7XA 3HR8A 1XXHB 4LISA 2X1EA 1QH8B 1D4FA 4WWCA 1UPBA 4ZDWA 2DSTA 4GXOA 1JKJA 4YAUA 2EFWA 2EZUA 1APBA 3KB2A 1YE5A 1PG0A 4HDUA 2M6RA 3V5NA 1P7PA 1ZBQA 4E5YA 1PWEA 2RAUA 1H5NA 2QTVA 4YJ3B 5FNVF 4B6OA 1P74A 3E35A 2XUIA 2A59A 2OP1A 1UKAA 2YU3A 4YIRX 4NPHA 2A9FA 1VJTA 4WOBA 3WHPA 1BE0A 3DMPA 1NMZA 2QN8A 3O4JA 1Y1VJ 2HPHA 3R6DA 5A3JA 1R5ID 1CQJA 2JCBA 5EYRA 4AXXA 4HQLA 2EG9A 2B20A 3I6ZA 3BDDA 3L77A 2HMSA 4YUZA 4R2JA 2OLJA 3PEEA 1YR8A 4BLQA 2EK5A 2EZHA 4NBUA 2ZXHA 3C3EA 5TQ2B 2VT6A 1GUDA 1OZAA 3I76A 4N3CA 5AJXA 3KK0A 2AYZA 1OTXA 3GZ6A 5KTPA 3K9QO 5E6SA 3AJAA 2IE8A 2QP9X 3L43A 1Z0SA 2M6LA 4S2UA 2BYVE 1XA3A 4P38A 1JKPC 1E9CA 5ICGA 1TADA 1Y3FE 3OZ7A 1W19A 3TW6A 1F3OA 4MWOA 5JD6A 1AKTA 1JKXA 1Y6FA 4HFMA 1QG0A 1FTZA 2C9DA 1PHRA 1WB4A 4MUXA 1QKIA 3TPFA 2QNIA 2O48X 3GH3A 3W6OA 1QR6A 1YKGA 4D4IA 5ALDA 1KYIA 1I80A 4BACA 2FX5A 1E8DA 4GICA 3DE1X 2OCBA 2D1RA 2VJNA 1H0HA 1A8SA 3F73A 3RIHA 3L1PA 1L5ZA 3LT0A 1TKAA 5DYWA 1EF4A 2ZBDA 4S0ZA 5L3DA 3DBLA 4HGYA 1T9HA 4QBKA 1FLDA 5K0JA 3FOCA 3NTXA 3PNKA 4E7KA 1YOBA 2R8RA 3G2PA 3F78A 3OF3A 3UUGA 1PLJA 2AFIB 2H8GA 2ARKA 3ZD6A 4GD3Q 1X92A 1GV0A 2Z6VA 1ZRMA 4K05A 3H99A 1ODTC 5F23A 1MH9A 4OYYA 2IV2X 3ASVA 3H92A 1NUUA 2Q2WA 5CVEA 1Z0DA 3REFA 4QREA 3O3OB 1X0VA 2BVLA 1EK0A 1K5HA 3QRWA 5G40A 3R1IA 3PC8C 4LMAA 3KU4A 4C07A 1YR6A 1G20B 4I55B 2G17A 4E5NA 4CCSA 3CUSA 4JBAA 4L4SA 3FOZA 5E1DA 1LLQA 4RL6A 4ETMA 4DKXA 5FR1A 1ZK0A 5HE8A 2MYNA 4YGXB 4WE3A 1KO1A 1KAQA 1VL6A 4ZDOA 1U9NA 1NBIA 2WDPA 3IT3A 3BMNA 1YULA 3JQ9C 4CUKA 4MQFA 3KXKA 1RAAA 2HFKA 3JQRA 4NYMQ 2ORED 1O94D 3O7WA 3AKDA 5KI6A 2FR1A 1WPQA 5F9HA 2CJWA 5FI3A 2J3MA 2QW0X 1LBQA 5E3IA 1WG8A 5H20A 3BF7A 2F5CA 1K83J 3H0GJ 4WXRA 1CUJA 3R3SA 1NPYA 3OECA 5KTOA 1KDPA 3RSGA 1NSTA 2JLZA 1QV7A 2EJWA 4DMMA 3FTCA 1T29A 1C9NA 4B4KA 1NMQA 1BN7A 3PUZA 1KO8A 1YE8A 3SD7A 4PJLA 1MRNA 3IH2A 3KJNA 4YMSA 3BIXA 1T6SA 4PXYA 1RCFA 1CY0A 2Q4RA 3EZGA 3UAYA 2CEAA 1TNTA 5DN6D 1TT0A 3O84A 1BX3A 3BEOA 4B4CA 3ZWKA 4YRNA 3I55I 2AJLI 4MYRA 4EPTA 1P61B 3E6AA 3HCCA 5LP6F 2NNLD 1TUBA 4QHSA 1QPIA 2ZREA 2QN7A 1WGXA 3VSDA 2HSZA 2FLKA 1E6MA 4FQ7A 5U4XA 2E82A 2PJRA 5IUKC 5AUOB 3E61A 3HABA 3D5TA 2ZQYA 2E2WA 3PKZA 1YVPA 3IDOA 3RJ5A 3VDMA 4HEA2 1X9HA 3UC9A 4HNVA 5LLTA 4YAKA 2WR8A 1U2TA 2ZJ4A 1IZ1A 4DDTA 3AIMA 1GLNA 4MLCA 1WABA 4K88A 1X80B 3B85A 1EGMB 3NC0C 1XFDA 1KH2A 1LUJB 5BVHA 2W2KB 5EXXA 1U65A 1ETYA 2XB2A 3LWFA 5ELXA 3R9KA 3KPJA 4ZV7A 3V8LA 1XK6A 3CR8A 3TX2A 3G5MA 2WFMA 2XNCA 3D5EA 1FFXB 4X64B 4QTYA 2VTEA 4R2LA 3B70A 1PV1A 3O03A 2XUGA 3BL5A 4QBGB 4QWQA 2VDKB 5ANRB 5E4TA 4QSMA 3DO5A 3L7OA 2NVYJ 3EUAA 1X1EA 1AGNA 3KXDA 1QFXA 1E59A 1E7SA 3FPCA 2GBCA 4A92A 5EWJA 3CZPA 4DA0A 3PD7A 1ZM2A 5JXJA 2AHQA 1NVKA 3H11A 2PK3A 5TJ9A 4L28A 4H0NA 3B9QA 1EFRA 5FHQA 3FGPA 4JC0A 8ATCA 3TW4A 4HF1A 2RDMA 1N9GB 1NMSA 4BNNA 3HXQA 1DRKA 4MYTA 2GEUA 4ZVSA 5DNAA 4Q4LA 3NO4A 3GEZA 5D1HA 2NTYC 4OYHA 3WBFA 1MNDA 5BN4B 3NP9A 1MC1A 3UXHA 2H2AA 4OQFA 4B2LA 4AJEA 2H6EA 2MINB 3SQXA 1DAHA 2CC2A 3RKXA 1JUDA 3BMCB 4PINA 1S7OA 4OGGA 1KI1A 4OP1A 4E12A 2OUIA 1HTWA 4J4TA 1M7HA 2XYQA 5FTKA 1NN5A 4TVKA 5EP2A 3WRXA 1ZIOA 3HGQA 4HNGA 4LHVA 3NT2A 1BZYA 3V8EA 2PMWB 3HXPA 3TFWA 4L2IA 1W5SA 3B1WA 4JT9A 4PPGA 2H31A 1S3SA 2NZ2A 1G42A 3EC2A 5AT1A 4MB0A 1DAIA 1TYBE 4UB8C 3G2HA 3ML1A 3AM4A 4RC9A 2JI6A 2PSDA 1QH1A 1WIWA 2QTLA 3EIUA 2PS1A 4D02A 4MGIR 1UWCA 3NHLA 1QQIA 4I4CA 5HILA 2M1ZA 2GK4A 3QWHA 1XMJA 2I1QA 1UAYA 3VMMA 3RKUA 3ZWYA 1TVMA 2X9DA 1C3OA 1K27A 4UM7A 1JH9A 1E1LA 3LZ6A 1IN4A 5I4BA 1J1IA 4QYIA 3RNOA 4MIMA 4MUYA 2JGKA 2X5KO 2RAFA 4PX3A 2DMUA 2QQFA 3VZBA 1PUEE 4G3XA 1UM9A 1VPLA 4WXDA 3JQQA 1CJSA 4QQRA 5LYYA 1LWNA 1NLUA 3JYNA 4DMGA 4G6DA 5BSMA 1EESA 1XTJA 4FZRA 1H2AS 3U6BA 4QTTB 3QM1A 3TINA 4EMUA 3H42B 4URHA 4OQQA 1L3CA 2XHZA 3M9WA 2YFYA 4BVJA 4ZAFA 2QRUA 4FINA 3A2LA 4G63A 3HA7A 3VU3A 1T9AA 2B82A 4TMFA 4LNUB 4Z8XA 3KJZA 2VOOA 3S44A 2CWDA 5KDLA 2VSQA 1XDDA 4XSGA 1ZN2A 1YDMA 1NDUA 3VSEA 3DD5A 3LZDA 2ZSKA 4HI0E 4NDAA 3WYEA 2C4TA 4D56A 2VLBA 4GQAA 4WKNA 4JT4A 3UAWA 2K85A 2HK8A 3RAJA 1EQUA 3QQPA 3I34X 2GJKA 4DNPA 1AO0A 1G55A 3TS1A 5DI3B 4UEWA 2Z9BA 4HN4B 4PLYA 3FIJA 2FG5A 4OMZA 5D6OA 1O8BA 1W0CA 5A0TA 3JRGA 3UT0A 5E9AA 1NF3A 4PNEA 3R3ZA 4S3MA 1UIRA 3ZDXB 2QMEA 3GJ4A 1HEIA 2BSQA 1GARA 1WBJB 1ABEA 5JI2E 4GXQA 1CDEA 4ZVQA 4BJTA 3U3MA 2QLNA 3IPLA 1G1MA 4AZTA 5KNCA 3SAJA 4LBVA 4EW6A 3N59A 2PZLA 3IUBA 1QR2A 4HZIA 3TJZA 5H02A 4Z8YA 3WQRA 3V8RA 2JUGA 3KOYA 3BAFA 1V0JA 1U7TA 4CF7A 4CCOA 3DO6A 5EJ6A 2WIDA 2G0EA 3EY9A 2J3JA 2ZSIA 1WPGA 3PUYA 3R24A 4YMWA 1ETOA 5KJEA 2UKDA 1D0SA 1SHJA 1L7NA 3C97A 2REQB 2K2QB 3DGEC 3QNWA 2X0KA 1K7CA 2JCVA 3FUXA 1DKOA 4IKOA 3G0CA 1ZKDA 4ZK6A 5E1MA 5I8WA 4QIHA 5HRCA 2VKHA 5F6FA 1PJ4A 3QOXA 1X1PA 1I51A 2ZRDA 1FLNA 3LW8A 3WL6A 2XUJA 4FGSA 5IPFA 4AYWA 1ONBA 2MSYA 4BEBA 1ZGBA 1SFOJ 2V7QD 3F8BA 4G9YA 1KI3A 1MLDA 3LUAA 3N87A 1SFKA 4GQIA 1UZCA 1R9NA 4YJGB 5CEEA 3OLZA 3L8MA 2IA5A 5GONF 5BV1A 1RLJA 4UU0A 4YV1A 3GGJA 1FFCA 4A5SA 2HDNB 1P2BA 4DF3A 4RZHA 2XB5A 4LK1F 3UQZA 4YCJA 4U0WA 2DWCA 4MV3A 5TT0A 1Z4OA 2M0MA 3FZYA 5BSVA 3VAAA 1F0KA 1A9PA 4ALNA 5AQ1A 1I3AA 2VPLA 1GQRA 1TIBA 2ZYRA 3WIEA 1FYVA 1JLLA 4WACA 2ODTX 3AIOA 3ICPA 1MKYA 3DLBA 5JAUA 1LCIA 3VVBA 2KBFA 4OIRF 3MBKA 2POCA 3AV0B 3FSRA 4COOA 4KR9A 3ESBA 2RGGA 4BP9A 1E2HA 2H2IA 2OCDA 1LB2A 2JASA 3EWIA 1Q7CA 2KIQA 3N0XA 3BSWA 2HREA 3LH5A 2E1MB 3BQYA 5B64A 2G5GX 1D9XA 4FLMA 2PKYX 3QW4B 4MVJP 1YA6A 4H7FA 4UCWA 4F2WA 4MQEA 3AETB 3CKMA 5JC1A 4XLPF 4RH0A 2PFGA 4JUDX 4WNAA 3X0DA 1G3WA 3CKYA 1E5XA 2UV8A 3P2JA 3LVRE 2JJYA 1B16A 3MTDA 4PYQA 3L7AA 5JECA 3WLJA 3OOWA 2HMVA 2XGGA 4PM4A 4YN3A 1VHJA 2I8AA 4OKIA 4R1TA 3ZY5A 2O8CA 1QIDA 1OLOA 2OCEA 4TLEA 4EO4A 1N8SA 1BL0A 2VCEA 3V33A 1ZG3A 2K2WA 4F8JA 4MMXB 1E66A 4X8MA 1Y0BA 4QIWN 5FT9A 4YCDA 4TKVB 2V7PA 3IPCA 2X3YA 3WFIA 5FTJA 4PSAA 4G4JA 2HYGD 2GBFA 4ETNA 2LR8A 1PS0A 3RUFA 5BXYA 3D7LA 2PX2A 3C16C 3PO3J 2QYHA 1T0IA 3OJOA 4CL0A 2DT8A 4ZV9A 2J5OA 2OCXA 5IF9A 2GCOA 4IMIB 1NTRA 1Y81A 2FI1A 1BDIA 2Q2NA 3OTOB 3KQLA 2AOUB 4PWYA 1BMFD 3AR9A 2WV0A 3EYYA 2QQ9A 4Y1GA 4D4KA 3K1JA 2J0QA 3BGWA 2BFEB 4OSEA 4DCNA 1VQLI 2ZUCA 3HDDA 1V41E 3W3ZB 2CYYA 4XUEA 1B93A 4RETA 4YRRA 2GBLC 5E4FA 3KSBC 1XTRA 4JT2A 1PDWA 2EPFA 4CYDA 3VR4H 3IODA 4R8RA 1FX1A 3H7AA 2OBMA 4V2GA 4XDGA 2EA2A 1F8FA 5I9TA 4J1TA 1K98A 1OW3B 3PQ8A 4QFBA 4K3VA 3GUDA 3DEEA 4LJ9A 2CE7A 3HXKA 1SCNE 4E7OA 3QUSA 1N7HA 2ET6A 4DNOA 1UMDA 4TVSA 5IJ9A 4EQ6B 4MR8B 2IYYA 3CM0A 3SHTA 5H4HA 1Z2DA 3QVSA 1W34A 1E5LA 3UXEA 4MRMB 2R1TB 3CEJA 3Q85A 1ORRA 1E1QA 2EQ5A 4BTEA 1MNMC 1UBJS 4CCMA 2R6GA 3O4GA 4JC5A 2XE4A 1A7UA 9ANTA 4BMDA 3NIBA 3OYMA 3I0NA 3EEBA 3VSAA 3D5RC 1HW5A 1N6HA 5C8DA 3SC3A 3ACDA 1DKMA 2RBEA 1RD4A 3MJCA 1JGSA 5K2OA 2VKQA 4BP3A 4MLZA 3NOQA 1QVZA 2YFHA 3AEXA 3HU1A 3EZFA 2VL8A