4A6DA

Crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
347
structure length
345
Chain Sequence
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARKGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROXYINDOLE O-METHYLTRANSFERASE
publication title Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 124
structure length 345
sequence length 347
ec nomenclature ec 2.1.1.4: Acetylserotonin O-methyltransferase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF16864 Dimerisation2 Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a6dA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4a6dA02
1Z6TA 2VT2A 5HIIA 4MQVA 4XSXF 3JWHA 1BOAA 4PINA 2YU3A 1EG2A 1NKVA 3Q9SA 1SFEA 4KFCA 3EDPA 4HDUA 2B0LA 4GEKA 1WG8A 3RTRA 3GEZA 1OMIA 3L7WA 3GO4A 1FOKA 3BJAA 3I54A 5L3GA 5DYMA 3PT9A 3G88A 4C06A 4JQFA 5EEGA 3C3PA 3VEPA 5HS8A 5GWXA 1XGOA 3K1PA 3OU6A 2AOWA 4YV1A 4O29A 1D8JA 4M7RA 5KVRA 5ED4A 3M6XA 3WSTA 4XRFA 4UOEA 5CVUA 3TMAA 5DV5A 1R8YA 3C7JA 4M38A 1F1ZA 3I4PA 3TM4A 2MC3A 4AWXB 2FEZA 3EETA 4BLWA 2OBFA 5EG5A 4RTJA 3ZN1A 1Q1HA 3TDUC 3UJAA 2Z5UA 3CUQB 2J5OA 5JHUA 4RGSA 3G7UA 1R1TA 4BLUA 3R3HA 4QTUB 4GO1A 3RYRA 3OV8A 5D4SA 1NW7A 2FU4A 5DTMA 3HA3A 1XTPA 4FX4A 4EK9A 3LL7A 2Y48A 2D45A 1XDZA 1IN6A 1JE8A 5H6QA 3DXJF 2P1DA 3GIWA 4I0BA 4A12A 3HP7A 1J59A 5CUQA 3EEYA 1MGTA 2PXCA 5LQKA 3M70A 2LF7A 3KQWA 3CUOA 1FLIA 3DKWA 4KMFA 2P3LA 3BWMA 1RUOA 1XB4A 2V74B 2CKDA 3UWPA 3KP7A 1SD7A 2NNNA 3GRYA 5DRYA 2UXXA 3ZMZA 2IPXA 4A0ZA 2ZIFA 1XMKA 1YW7A 2X4HA 2IA1A 2A69F 1FWZA 2CO5A 3I53A 1K6OA 3T7TA 1FSEA 5CVIA 3LCCA 3LECA 3L00A 3R0JA 4HX8A 3Q9VA 2VONA 3HCEA 4LWPA 3UJ6A 3H2BA 3K0LA 3P71T 1R7JA 3B02A 3FTFA 3F8NA 2G7HA 2VOOA 1ZLKA 3G2OA 3JTHA 4HV6A 7MHTA 1B59A 1U78A 4DNCA 1UHWA 2KRFA 2YUIA 2PKWA 2I9KA 4ESJA 2RDPA 2QY6A 4UVCA 5DUKA 5GM2A 3IEIA 5E9QA 1E17A 2PN6A 2TDXA 3G8BA 4UUVA 3C0KA 2CL5A 5EKXA 4ASNA 1QBJA 2O57A 3WTTC 3QP6A 4ENKA 1KQ9A 2DLLA 3HNRA 4E2YA 1SMTA 4M6XA 4G9YA 4HTFA 1SD5A 3M33A 1LNWA 5IH3A 5C9ZA 1BI3A 1SQFA 3EUHA 4XLPF 2HWKA 2M30A 2BM9A 4ZYGA 4YMGA 3EYYA 2FBHA 2BGCA 3C3WA 1BM9A 2EFPA 1Q0TA 1F5TA 1NW8A 5K03A 5E1XA 2BBYA 3OZTA 5L3FA 3LWFA 3KPYA 5E2AA 1BC7C 1W4MA 3ZPLA 4MQ9F 4AIHA 4CXMA 2VC1A 3OPNA 4ON0A 4YIIA 2L54A 1JG3A 4ZH4F 3KU1A 3GYHX 2AN3A 4KICA 3A26A 3EVCA 2JTVA 2W84A 2ZULA 3CLOA 1G8AA 1KQ0A 1EQAA 2LNBA 5L3CA 1KYWA 1MD0A 4EJTA 5BPIA 2ZFWA 5DX8A 3MAGA 1SFXA 2JRTA 3FM5A 1R74A 2YXDA 3KP5A 2CMHA 4HQMA 5FCDA 2HR1A 1I27A 1W7PD 4A2UA 3RODA 2HTJA 4KVZA 5K5RA 2OXTA 3C1DA 1XXLA 4ER0A 2H09A 1QANA 4M37A 3HRMA 3KPVA 2EFWA 3SMQA 4N9IA 1GXQA 1KU3A 1NE2A 1UFMA 3UBTA 4FT2A 4AZSA 1ZHFA 2ISYA 2P8TA 3HHHA 4LG1A 1RJEA 2P5KA 1RI5A 4MHTA 4EVIA 1TPYA 4NB5A 3PX3A 4I98B 3MEXA 2OD5A 3WGGA 3RDIA 1VE3A 4AVPA 1QZZA 2PJPA 2AZTA 3SFZA 1D3YA 4CKCA 3PFHA 3P9CA 1F4KA 3MTEA 4P9UA 4I7HA 2RNJA 1YB2A 1DUXC 2W24A 3GFIA 2L4AA 1P6RA 2QRVA 4U88A 4L0YB 3R4KA 2YQZA 3GXOA 5EZSA 4HAMA 1YIOA 3FF5A 2ZNZA 2HGCA 3OFJA 4ER6A 5TJJA 1IN5A 1IRFA 2ESNA 2PWYA 1G4DA 2UZKA 2PX8A 2ZBQA 3A7EA 3R60A 4Q4ZF 1W7PA 5HS9A 4L9NA 1J75A 3QU6A 4I02A 5ERGB 3ER8A 2KKOA 2DQLA 4F7ZA 3K2ZA 4GUAA 3J80Z 4KIBA 2CW0F 3GRRA 4G7ZF 3KR1A 3LDFA 5CCBA 3QOPA 2LD4A 3ELDA 1N2XA 3KPWA 2B9EA 4KIFA 4HC4A 4KA4A 2G9WA 4O5VA 2GZWA 4NQWA 2V1DA 1PDNC 4ETSA 5LR6A 1HKSA 3I0TA 1RI7A 2KIUA 4LLGF 3FMQA 3O7WA 4OMZA 4BQAA 4UV8A 2C7QA 4LD5A 2IBSA 1EH7A 3ABUA 4OIOF 2BM8A 3ELYA 1R5HA 4G7OF 1G6Q1 2RQPA 2HS5A 4IJAA 4M74A 1I5ZA 3CVOA 3BJOA 3NDIA 1JG4A 1I1GA 5CCXA 4XUEA 1B9MA 4AZVA 3DLIA 1G3WA 5E1MA 1T38A 4U0VA 5LEJA 2DI3A 2F5DA 4WF2A 2K4MA 5D4RA 3VSEA 1UCRA 2NRAC 1HQCA 1O3TA 2XROA 2FK8A 2E7XA 4GOMD 3GUDA 1DPUA 1CF7A 1IXKA 4IPAA 3BGIA 3WODF 3NRVA 2M87A 3TOAA 1G60A 1XDUA 2ZKZA 5HIKA 2HTSA 3SSOA 3R0AA 4MGRA 2XAFA 4L18B 3ELUA 1VTNC 3MHTA 2JG3A 4ZTBA 3HCCA 3B5IA 4A0YA 5HIJA 5J8CA 3HSRA 2E1CA 3KLOA 2IH4A 1BIAA 4DCMA 2WC2A 3GRUA 3KQSA 3L8DA 5K05A 1XN7A 2B3TA 3RYPA 3K6RA 2C7RA 4C08A 2LF8A 4U7BA 3V8JA 1QYRA 3F21A 1NBHA 2K02A 3GRVA 3B7PA 3HSFA 3KQQA 4A6DA 4PDKA 5FWAA 5LHGA 4QPPA 4PYNA 3LQQA 1XVAA 4PYLA 2NXCA 3TQSA 1JHHA 4CICA 2O61A 1EJ0A 1EV7A 5E1WA 5K0FA 3I71A 4EKIA 4QLCU 1X1CA 1ZREA 4A0XA 1MJ9A 4YV2A 5HILA 2A61A 1MKMA 3JSOA 4C03A 1U3EM 2CYYA 2Z6AA 4UNOA 3ZP5A 2FMYA 4I09A 1YLFA 3O2PE 1IY9A 1ZQ9A 1IXRC 3REOA 2F5CA 4KDRA 5D1HA 4H0NA 1FT9A 1W5SA 2L01A 3HSEA 2CWEA 3P9IA 3NJRA 2GXGA 3QP5A 3M8FA 2NNYA 2YXEA 4MTEA 4UHTA 1MDMA 1PRYA 4PYOA 1RI3A 2OBPA 3BKWA 2ORED 4EV0A 1FYMA 3BUSA 2HYGD 3SR4A 2DU9A 1R1VA 1DDNA 4IWNA 5HEKA 1XGNA 4RTMA 3OE5A 2ACJA 1P2FA 2EK5A 2FPOA 2F5FA 1EH8A 3KQTA 2XYQA 2FBIA 4E32A 4KDCA 3A27A 3F8BA 2W25A 3HOTA 3CJQA 3T8RA 5G02A 2B2CA 4YUZA 2XBMA 1G6NA 2G7UA 3FMRA 1JG1A 2HKXA 1IAWA 1R00A 5EMMA 1FBUA 5DCMA 2EJRA 4OQEA 3H3UA 2JHAA 1HW2A 5BPDA 2XVAA 2XASA 3DR5A 2PJDA 3UA3A 3F3XA 3BWCA 4FP9A 3OZRA 5E1ZB 1BHJA 4GCVA 2AOTA 4RSRA 3IWZA 3M6UA 3IYLW 4LLNA 2IA0A 5ICCA 1LB2A 2H11A 3R24A 2XRNA 2EFJA 4LK0F 4P7FA 2IPQX 3KP4A 2AR0A 3KQOA 2DK5A 5D6EA 4IV8A 2DBBA 4FS8A 2PBIA 5DPMA 1PJZA 3ER9A 3R6SA 3LA3A 2NXJA 3EVAA 2ZMEA 3DP7A 1I9GA 5GINE 2AN4A 4EM0B 3BDDA 2CMGA 5JR3A 3UJ8A 1SAXA 1L0OC 2K4BA 1V3FA 3NVKI 1HXDA 4O6JA 4V0RA 2XUBA 3NQOA 1R8XA 1RI4A 2PT9A 5DDGA 2NAZA 3NVMB 2CG4A 1USSA 4NHJA 4WVLA 1W7PB 4GBED 4JK1X 3TFWA 2VZ9A 3MWMA 3I64A 3ULQB 2JHPA 2UYCA 3EGIA 1R36A 4HQEA 4IRGA 2K86A 3DQVC 4RVFA 3RIRA 4Y2HA 4M6YA 3WE3A 4HOBA 3GFMA 4WXCA 4KMUX 4S04A 2B25A 1Y0UA 2IA2A 1T2KA 10MHA 4WXDA 2ZO4A 1ZKDA 3LBYA 3JWIA 1S6LA 4HLYA 2Y1WA 2VBXA 1T98A 2PG4A 3Q87B 5DM1A 1O54A 4QVGA 5CVDA 1ZGJA 1IM8A 2JJQA 1P4XA 1X3UA 3GVAA 4E31A 2FRHA 1M6YA 3P8ZA 1H9GA 1U6GA 1HSTA 3UJ7A 4G7HF 2YTZA 5FULA 1T6SA 2Z6UA 3LSTA 2F8LA 4YG2F 2XHKA 4Z2YA 4DM3A 3DMFA 4MEXF 4HW0A 3R9XB 1KR5A 3CKKA 2G71A 4POOA 2VT3A 4RTSA 8MHTA 5EMKA 3G2QA 1ZH5A 1XSDA 3VODA 2MA3A 4HGZA 2GXBA 4BHBA 2XV4S 1XCBA 2BR3A 5KYGA 2ESHA 3FZGA 5HS7A 2P3OA 4YV0A 2VE8A 4KIGA 2DPMA 1L3LA 4DCGA 4EM1A 2OO3A 2IW5A 1ZARA 2DW4A 3KHKA 2RVCA 2EJUA 2HKOA 3HTXA 2X0LA 1IN7A 1YW9A 5FFZA 2DULA 5E2BA 5BS6A 2K4JA 3MTIA 5DSTA 2AVDA 5IT9K 4WWCA 1P1BA 3FTDA 4RGRA 2VN2A 5AIQA 1BC5A 3S68A 2YX4A 3VC1A 4ZYEA 3RPUA 4HG2A 2FXAA 1G3TA 3TOBA 3DMGA 4S05A 5EQJB 4E2XA 3O6BB 2EB7A 2ZBPA 4CZZA 4ESFA 1ZAOA 2O03A 5ILVA 2BH2A 2OZVA 5C0OE 4RGUA 2YX7A 5K0LA 4CWAA 5E18F 1U5TA 1Y8CA 3OCJA 3D5LA 3HUGA 3M9AA 1H1DA 2UZ4A 2XYRA 3BPVA 1HSJA 2R7DA 3F72A 2ZIGA 3SX0A 2ZW9A 2J5PA 1M6EX 1L3CA 1WSUA 1O3QA 3KQVA 5K09A 3A25A 3J80K 4Q48A 1P92A 2PX4A 3G73A 3DOUA 5E17F 2GH1A 4P7KA 3TO7A 2G72A 1SUIA 4HF2A 2FOKA 2V7EA 4LB6B 1FYKA 2Y75A 3FUWA 1WWXA 4CTJA 5D5UB 1R6AA 5ERIA 1YZHA 1NHAA 2QBYB 1HMYA 4OBWA 3KEOA 1YF3A 1F9NA 1X1AA 1OYYA 1GHCA 3IV6A 1TW2A 2UXNA 3GJYA 3PFIA 1JXSA 4EQZA 1S8NA 2HYFA 2K27A 4HDVA 2FSWA 2L02A 5F2OA 2R3SA 2PQ8A 5HLIA 3HCFA 3WU0A 3E23A 4HH4A 3KCCA 4OA8A 3CO6C 2MLKA 2EV5A 3SZPA 2CWWA 3T1BA 2QENA 5FD6A 3E5XA 5D8LB 3EYIA 3V4GA 1JTFA 2YX1A 4CO8A 3FYCA 2QQBA 2R7FA 2OZUA 1O9GA 2FMLA 4HX7A 4MEYF 2QE6A 2OZ6A 1O3SA 1LJ9A 4HZFA 2I6GA 5K0BA 2XKPA 1QZYA 5DCMB 4WX9A 2AOUA 3Q7EA 3AY0A 2H94A 5M5BA 2DAOA 1KA8A 5LEKA 2G8NA 3F8FA 3FTCA 2I7CA 4M72A 3FYDA 3W6JB 2JPBA 4PCLA 3LAPA 3KR2A 4MHGA 3K1NA 3IC7A 2DQRA 2P40A 2MH2A 2MBFA 2O05A 1J5YA 3WTUC 2BR4A 3G2PA 2ADMA 3FRHA 4A6EA 4PYIA 2OA4A 4QPNA 5CVRA 2NXEA 4Y13A 2ZTHA 4R8RA 5D6FA 4U0YA 4G56A 3F6VA 3IKTA 2AXLA 2VDUE 2VDVE 1ORHA 3BT7A 4M9ZA 1VL5A 1I6XA 2P5LC 2EA4A 3BJ6A 2UYQA 5CVJA 2QLZA 4CXFA 3DLCA 4U7TB 5DTQA 1MJAA 3ECHA 1BI2A 1B6AA 4HX4A 2OKCA 5KVAA 3HA7A 4OQDA 4M9SA 4E33A 5E8GA 3KFWX 5EHGA 1TQIA 2HFHA 4AIKA 4FR0A 4RAZA 4KYWA 3FHZA 1ODDA 3GFJA 2STTA 1TBXA 5CLSA 3ROUA 3NW9A 3J81Z 2GIVA 5DRTA 2QM3A 3AJDA 3H92A 2FYTA 2IH2A 5HOOA 2P7VB 3TGNA 3E5QA 4BNCA 5GIOE 5JUWA 3TDZC 3FMSA 4M36A 2UWMA 3ZMSA 5FB2A 4RB1A 5HIMA 3E6BA 5E8JA 1YUBA 5DX1A 2D1VA 5FHQA 2ZSUA 2NYXA 3EGVA 3TLJA 1STZA 1AV6A 3FXRA 1XGMA 2PLWA 3WTXC 3BGVA 4C07A 4GOND 2NP7A 1ORIA 1DPRA 3GCZA 3HCAA 3VC2A 2ELHA 2HZTA 3B3FA 5EC8A 3HTUA 1I1SA 4G8XA 4RWZA 1O7LA 4PCQA 3P97A 1GVJA 3HCBA 1T43A 3BKXA 4PGHA 3EVGA 1R5GA 5GM1A 4LG0B 1JSZA 4FT4A 3UJCA 5IT9Z 3NWBA 3I59A 1YW8A 3E8SA 2VXZA 4OU0A 4PCAA 2VS1A 3C18A 1Z6RA 3WU1B 2A6EF 4GXOA 3N97A 3V8KA 1OR8A 1RI2A 3F4KA 5ICFA 1LDKB 4GYIA 1U5TC 1BOOA 2AOVA 2KJCA 3FPGA 1IW7F 2C6YA 5KK1A 3BP8A 4CKEA 3KP2A 3SSNA 3BOQA 1MJBA 1Z1DA 4RTLA 2H6BA 4RAYA 4L9JA 5K5OA 3GDHA 2P3QA 1P91A 3SQNA 3GRZA 1DL5A 4CTKA 4BP3A 2LKPA 4MWZA 2A14A 3F8CA 3E5UA 2JHCA 2G1PA 3WTZA 2IP2A 3RIEA 5BXYA 3JTGA 4QDKA 3RW9A 3E05A 1AQJA 3BY6A 4M9XA 5F64A 4DA4A 3T8TA 2OY0A 3IHUA 5K0CA 5KQRA 5H6RA 3LA2A 4IF4A 5D5VB 4EGZA 4OIPF 3G5TA 3LCUA 3NWEA 4G6QA 4TV7A 1ONVA 1O7FA 5LRRA 5BP7A 2L4MA 1LQ1A 4MNUA 4IRHA 5TRDA 3JWJA 5BW5A 3ERCA 1SD6A 3PFGA 1IXCA 3LPMA 3JAMZ 3CJNA 3BWGA 3U1DA 3KQYA 1I4WA 2ZJ2A 1D5VA 3U2RA 2A3SA 4KWCA 2DFIA 3FZVA 1MZBA 3E6MA 5JI6A 1TTYA 3K9TA 2V6CA 4GF5A 4YFKF 5A2QZ 2HNKA 4Y30A 2JH9A 4GGGA 3PVCA 1YG2A 2GQQA 2HEOA 1D2CA 3Q5FA 1KU2A 3MB5A 2IT0A 3GW2A 4IV0A 5E1DA 2XKOA 2O8XA 2WWYA 4ER3A 2IFTA 2CGPA 3U9GA 1JGSA 2W57A 1HBXG 1JSXA 1IZ1A 3B3JA 3QOXA 2XAGA 1P4AA 1BN5A 4UV9A 1HNNA 4G94A 1FPQA 1KP9A 3E6DA 3WE2A 3KR9A 3HOSA 4BYYA 4C05A 4DKJA 2Q2EA 2PMHA 5IKMA 3DEUA 1JQ3A 3M4XA 2ZZMA 2UYHA 5JVTA 4FGZA 1YTYA 4OIQF 3MZYA 4JXJA 3FPJA 2HV9A 2LDUA 4RTQA 2V9VA 2NS0A 5DXAA 4B8XA 2NYUA 3OU7A 2RN7A 1N7JA 4PIPA 2Q0OA 1ZRDA 3TKAA 2WV0A 3UJ9A 4EMSA 2AN5A 3ZMDA 3K0BA 3CUQA 4B09A 1RZ4A 2ONZA 5LGUA 2I62A 5K0EA 4AIJA 3NMUF 4HTFB 3MFKA 5LRSA 3EQLF 3OU2A 5HZMA 3HYIA 4CKBA 4U7PB 2L3DA 2ADUA 2M5WA 2P7HA 3EGEA 4C04A 1LDDA 3ORHA 4P58A 2PX5A 4B17A 4R8SA 1X1DA 5LQUA 2P8JA 4LGWA 1YS7A 4X63A 3JW4A 2OB1A 4YUVA 3DFGA 4RTKA 1UWVA 3VB2A 3C6MA 2GLUA 1TQPA 2FK7A 2Z99A 1SG9A 1S29A 2PBFA 1BC8C 3OFKA 1KHHA 5DM0A 4IXAA 5EMJA 2YPRA 3B3GA 5IT3A 4Q5SF 3FRIA 1SUSA 1Q0SA 1BIBA 1VLMA 3L9FA 3RPQA 3F6OA 2HQNA 3SM3A 3KP3A 2VODA 5D8KB 1JQDA 4RTRA 3HRSA 1VP3A 3GO5A 2HQRA 3W6KB 3RKWA 5LSAA 4EJWA 3SSMA 2A6HF 2GA1A 4EGYA 3EMDA 3LFKA 5LQJA 3FUXA 3P9KA 4YFNF 3HTSB 3P2EA 2HWVA 1L1EA 2FBKA 5T67A 3THRA 3HVKA 3F23A 3P2KA 2NNWB 2IJLA 1G38A 1JQEA 1BKYA 3V7CA 4BP1A 2C7OA 5FD5A 3FTEA 1RUNA 4PYMA 1BI1A 1ZRFA 5K0JA 1U8RA 4ISCA 2AS0A 1FBSA 3DV8A 2GPYA 1VP9A 1KPIA 5F6FA 4OMYA 3KEQA 3FPEA 3OE4A 2ZVJA 4DQ2A 4R6WA 2ZZNA 2IGTA 1QAOA 1JR4A 3DF8A 3EVEA 3R61A 3RKXA 1WZNA 1E2XA 3N4MA 4LK1F 2ZZKA 1TNTA 5D5WB 4HA8A 4UVAA 1IXSB 5L3DA 2EA2A 1O3RA 3GNLA 4U7DA 1J0RA 3ZN0A 2QUFA 1ULYA 2ZFUA 3OOPA 5EPEA 4HF0A 2HDCA 2O07A 4AD9A 4KNYA 4RVHA 3SHFA 2QRVB 1QPMA 3O3KA 3CBGA 2O06A 3L2CA 3ID6C 1OYWA 4A5NA 4CGZA 5LBQA 4RB2C 4GOOD 2ZWVA 3CJRA 4BHPA 2ERCA 1ZG1A 3GF2A 1P39A 4V0QA 3L09A 1KPHA 1QAQA 4E30A 4HRAA 1WRJA 2IRFG 5CYVA 1RJFA 2YSRA 2M8EA 1USTA 3VOEA 2OPBA 2PMUA 3SXJA 1MJFA 1FYLA 4RS8A 3DXYA 3SVZA 2MLGA 1NW6A 1SMYF 2ONYA 3D0SA 3UJDA 4GOLD 3TO6A 4AUKA 2EFQA 5K0NA 3CJTA 1X1BA 2PVCA 4RTPA 5LQCA 5DLYA 4RTOA 2FA5A 1RJGA 5HLGA 4Y17A 4P7GA 3FWEA 2P7CB 5LGTA 4KT5C 2GA9A 1WXXA 3AAFA 5EIFA 3KE2A 1VBFA 2D2WA 3T0IA 3M7GA 1WQ2A 2PFBA 2K7LA 3HA5A 4Q47A 3NDJA 1UIRA 2COMA 2VBWA 2IDJA 4MTDA 1SD4A 2BZGA 2IH5A 1J9IA 5AIPA 2IIPA 5HDGA 3J81K 1IF1A 3ZQ7A 1L3IA 2OYRA 1XD7A 1V4RA 3BZBA 4GYGA 4LWOA 2XGXA 5DXJA 1W5TA 3UJBA 2OQRA 1JTEA 1YFJA 2FRXA 1LDJA 1RIOH 1QNTA 2PGXA 5GOZA 1XCLA 4I0AA 1L3BA 4D0PA 4IHTA 5T64A 3LDGA 4DF3A 4MTLA 2EX4A 5DT2A 3CUQC 3IRQA 1CF7B 4L9VA 5AONA 3GX4X 1INLA 4MIKA 3U81A 5ILSA 2BR5A 3MZHA 3G2MA 4KN4X 4M71A 5FA5A 2NP6A 2VBYA 3FXQA 4CDGA 3AWIA 3SGLA 1YQAA 3GZ5A 2BEOA 2LSOA 4YUWA 3S2WA 3KQPA 3PB3A 5DCFA 4HSGA 5CJ9A 1K7AA 2A07F 2P5VA 5FFXA 3HEMA 1AQIA 5F2NA 2XAJA 3TKYA 5FWDA 2DK8A 2XIGA 1ZN2A 2DPDA 4YUYA 3GWZA 4BLVA 3O31A 4QDJA 3COAC 4U0WA 4JBAA 2EG5A 3O4FA 2FF4A 1WY7A 2GB4A 2DO7A 2PY6A 1XSVA 1EH6A 2YR2A 4OOIA 2GAFA 3LDUA 4KW7A 4ENNA 1JG2A 1KPGA 2PI0A 3GZ6A 4GC5A 3LA7A 2Q41A 3MAJA 3KLNA 1ZG5A 3NEUA 3BROA 3ISPA 3FUUA 4RVDA 4EJVA 3IWFA 4UXNA 3DPLC 4F84A 4WXHA 2R6ZA 4DZRA 3T7RA 4YUXA 9MHTA 4PZJA 3B89A 5DUIA 2Q8KA 1OR7A 3ZMUA 1MDMB 3GGDA 3E3VA 5FGMA 1D2GA 3BWYA 4H0EA 4UVBA 2EV6A 2ZBRA 3FPHA 2RV8A 2RGVA 1K78A 4RB3C 3FM3A 1R58A 3K69A 3WTVC 3JAMK 3J7AO 4IKPA 3KKZA 5E1BA 1WXWA 5E9JA 3C3YA 2JZYA 1Z3CA 4AZTA 4Y15A 3FX3A 3T5XA 2BE5F 3F22A 1G3YA 2IVMA 5A2QK 2FNAA 1P1CA 4IRIA 5FLXZ 3P9NA 3BXOA 3NTVA 3LAJA 1B1BA 2NXNA 1KU7A 2KIMA 1NW5A 4GC9A 2CQKA 5FHRA 3LX6A 1U2WA 2GWRA 5CIYA 1FC3A 3PX2A 2ZXJA 2AOTB 5E9WA 2ZIEA 3HHGA 4RB0A 1C0WA 4HF1A 2WK1A 4OA5A 2F2EA 2XAHA 5K1YA 2KIFA 4OIRF 4L7VA 3CO7C 5FUBA 3LQRA 1ON2A 4P7JA 5CM2Z 3SZTA 3I9FA 2P7IA 3LHDA 2VC0A 2M1BA 3ERED 2YVLA 3A7DA 1O57A 2P6TA 3MERA 5GP1A 2ZMEB 3M6WA 4ATNA 5KQSA 4HLXA 2Y0MA 3MQ2A 3DH0A 5J6XA 2GA2A 5E20A 2QZ8A 2OQGA 2OU2A 3A4TA 1EAMA 2AOXA 2A68F 5EZQA 4FT8A 5K01A 4N0BA 2XYVA 4RGXA 4P5OA 1HKQA 5B1SA 4E2WA 3T7SA 1HW5A 3PQJA 3KZZA 3VFZA 4YIFA 4FHTA 3I5UA 4KRGA 5EKUA 3KZYA 1LEBA 1ZYRF 4F86A 3TR6A 2MD5A 3AXSA 2RKHA 2VOPA 2O6GE 1FJXA 5F2KA 3FUVA 4HV5A 5L3EA 3ANXA 3GU3A 1D2HA 1FBNA 3CCFA 5E8IA 1JHFA 5EMLA 1PP8F 4GQBA 5HVQC 5C1IA 1BJAA 5JFRA 1NT2A 2BYVE 2P35A 1ZG3A 3DXXA 4K6MA 1TLHB 1U2ZA 1SKMA 2C7PA 5HOQA 2EJTA 5F1RA 4ESBA 2H27A 4QQNA 1FP2A 1QAMA 2XVMA 5L3BA 4ZYDA 5DX0A 1S7OA 4KDPA 2VE9A 5EEHA 4O3MA 4RV9A 2RC4A 2ZCJA 2PX2A 4F85A 4L9TA 3HCDA 2ZWAA 5EOVA 3RJPA 2HTEA 2HOEA 4PYJA 3IL2A 5ICGA 3ZMTA 2Z33A 3D2LA 3EVDA 3QV2A 2HMYB 3V97A 5HDNA 1AWCA 3HVJA 5T6BA 1NV9A 2ETHA 3ML6A 2XAQA 1T39A 1QO0D 1XGSA 4E2ZA 3V7RA 4LB5A 1AOYA 5E8RA 5LLQA 5CVEA 3QPTA 2Z6QA 2ZNYA 1ZLJA 3KETA 1N7IA 3SXYA 3JWGA 4R8HA 1DP7P 2KW5A 2WA1A 5EHIA 4NECA 2EFOA 3T0YA 1J7KA 4FZVA 1YFLA 4YMHA 1G8SA 3EEOA 4BAYA 3RKYA 4FX0A 4OBXA 5DWQA 1SFUA 2QVOA 5EIWA 3KP6A 2ISZA 3ELWA 5H02A 5BMZA 4AX8A 1XDSA 4R79A 2PWPA 1HKTA 2Z9OA 1O9HA 4HBLA 4L5JA 3FUTA 2H1RA 4XLNF 2JT1A 4PYQA 2VDWA 1FNNA 1HW1A 4C4AA 4R05A 3PS9A 5LHIA 1ZGAA 3M1EA 1OYIA 1Z9CA 2DTRA 5CD1A 1H0MA 2H00A 2B78A 3V8VA 2YXLA 3AXTA 3M8EA 5GIPE 2DPUA 5FA8A 3ABTA 1U5TB 2KJBA 3E97A 4ENJA 2UYOA 4PYKA 2CFXA 1YYVA 4XCXA 3HM2A 5HFJA 5DSXA 4BH9A 2ESRA 2P41A 4EJUA 1FSHA 3PQKA 5LQAA 5H20A 4XUDA 1FP1D 2PXAA 1VPTA 4XSZF 3E6CC 4X1OA 3F8MA 3GLXA 4LLLA 5DEQA 4FSXA 1UHMA 1KGSA 4WCGA 4ZYHA 2QQAA 4I01A 4AZWA 5BOXA 2XVCA 2E7WA 5EGSA 3K1MA 4X61A 5E1OA 5CVVA 3X0DA 4WK8F 3HIFA 4P9FA 3LKZA 5LHHA 3HRTA 5LQNA 2W85A 3WTWC 5D5XB 3LKDA 3LCVB 3IRRA 2OAZA 3BGDA 3TRKA 1MHTA 4CHUA 1KQ8A 1GXPA 5P8WA 1D8KA 2GAUA 4PNEA 1K78B 4LJZF 1R22A 1KYZA 4KUMA 1PUEE 5K8VA 3TPZA 1EJ6A 1NBIA 3DTNA 4QTTB 1LVAA 1IN4A 3GFLA 4FSDA 5K5QA 5EVJA 1OKRA 3HVIA 4ER5A 1TNSA 4DQ0A 3QU3A 3UZUA 2FHPA 2FCAA 2V1XA 2AVNA 3CDHA 2E1NA 4BHCA 2AOUB 1XJ5A 2F5EA 6PAXA 2PEXA 1YZ3A 1P4WA 5LGNA 1K79A 2V79A 4PWYA 2VBZA 4X60A 3WG9A 1NV8A 3DUWA 5K0GA 4K2EA 3KQMA 2MH9A 3TM5A 3DULA 3HRUA 2G70A 2WTEA 1FY7A 2BV6A 2IDKA 2EWNA 5FTWA 3IHTA 3BWBA 4PGGA 1S3JA 4EJOA 2PSSA 3EVFA 5U4XA 2V1UA 3LBFA 2IBTA 4OX9Y 3G3ZA 1F3LA 2H6CA 1KIAA 3PLAE 2M45A 4BXUA 2Z3YA 4QQKA 5BW4A 1Z7UA 2Y1XA 3UA4A 3ZMVA 3FPFA 5HLHA 3CTAA 3MQ0A 1TQMA 2OB2A 4M73A 1Z05A 1REPC 3QAHA 2ZBKA 5D1NA 3P7NA 3H3ZA 2QBYA 5J8FA 3EMBA 3LGAA 1R23A 1F38A 2HR3A 1X19A 3DMHA 3G8AA 3ME5A 2PXXA 5MHTA 1M0EA 1RI1A 2JPCA 1G3SA 1FZPB 2FQ3A 2E5WA 3RI4A 4RTNA 1WI9A 4ZZLA 1KXZA 1CGPA 4ER7A 3R0QA 1YS6A 2QWWA 1V39A 3B73A 4A5MA 1H9TA 4EM2A 4ENMA 1VQ1A 3BZ6A 1PP7U 5FADA 5DTRA 1RNLA 3DXZA 1IN8A 5BQTA 1B9NA 3M6VA 3G5LA 4QWQA 1J2XA 1WKMA 1WS6A 2JSCA 4L0ZB 5ICEA 1ON1A 3P2IA 4R6XA 1SVUA 1I1NA 1AF7A 1R1UA 3QPHA 3PTAA 3FXUA 5HDKA 2STWA 2JH8A 2ZCWA 3I58A 4P55A 3C6KA 1VIDA 1T0FA 2A5YB 1EIZA 3I59B 4LFUA 3WGIA 3KR0A 1B4AA 1SQGA 4IHSA 5ILUA 4P96A 2AS5F 5DM2A 1IRGA 5FLXK 1BBYA 2PV0A 5LQRA 3MGGA 1L9KA 3KPUA 2P4WA 2QQ9A 1RJDA 1QQIA 1YO5C 3E7PA 1ZRCA 4L5IA 1XCVA 4EQQA 1XMAA 1YFHA 5FQNA 3VYWA 1XCJA 5FO5A 4OINF 3THSA 1LEAA 4RX1A 3WTYC 4LECA 1KU9A 1S7AA 1IUYA 4BY9E 1OPCA 3TO9A 3JSPA 3EPPA 3V8LA 4ZZDA 1FBQA 3V7SA 3MCZA 3BPXA 3ECOA 2P6SA 1FX7A 3TOSA 5FQOA 2PLYA 5DD4A 2O3FA 4RVGA 4DMGA 4YFXF 2CSOA 4G6DA 2WA2A 2FNPA 3IKVA 4I2OA 4MQ4A 3EVBA 2YR0A 1A04A 3MCTA 1UB9A 2GS9A 4XUCA 4R1HA 5DD8A 2FE3A 4RYLA 4HYEA 1DCTA 3HVHA 2D1HA 2EV0A 2PT6A 3G89A 4N9HA 1DUSA 4IVNA 1NW3A 1BI0A 4PONA 3CGGA 1B42A 2O0YA 4X41A 3ELKA 4HGYA 3WGHA 4LMYA 1R18A 3KPJA 2O0LA 4PIMA 4QVKA 5DM4A 1G55A 1QGPA 2QYOA 2N47A 4LG0A 3QRFF 3DPTA 1XSXA 3OZSA 3R6TA 2ZLBA 3WTSC 3EVZA 2EFNA 3TQNA 2DT5A 4XBFA 4CYDA 3UFBA 1Z91A 4EKGA 1UFKA 2VP3A 5KS2A 1TW3A 3CC8A 3QOWA 4E70A 4KN7X
chains in the Genus database with same CATH superfamily
2J6BA 1ICIA 3WAKA 2WJVA 1XDGA 3C5CA 1X15A 2NSLA 3EDPA 4AP5A 1FOKA 2VHCA 3JRXA 3M2TA 1WHTB 3VEPA 3ZH9B 1JG7A 3TEFA 1E1RA 4GEGA 2QLMA 1JUPA 3KVRA 3CW2A 2CDNA 3NHBA 3SQXA 1TEXA 1H94A 3EXFB 4MPPA 1IZYA 2Q5QA 4EEZA 3G9ZA 1AH2A 5J3LA 3TDUC 4L3VA 3SHOA 2WLSA 2HPHA 1NXPA 1FP4A 3TMKA 3SX4A 3I0MA 3DKYA 2VHVA 2IKQA 1DBSA 2D45A 2XDWA 3D1LA 3DOEA 5IZCA 1ESMA 3SM9A 4DA6A 2E1MB 2Z4SA 3VPAA 3I2HA 3WK4A 3L7MA 2IY9A 2VHQA 4KMFA 4CQMB 3ZJ5A 1S3FA 4XR4A 1XB4A 3HJBA 3GLUA 3TZHA 5AJWA 3UMSA 1TQ8A 1BMFD 1E9AA 5TRTA 4GSLA 3P5SA 1E3WB 1S72I 2ODBA 4HFNA 2E1PA 4IJVA 2IPXA 2Z2KA 2WYWA 4EW6A 3UT5A 1JEDA 3O26A 3S29A 3AVOA 5IEJA 2ZR8A 3HCEA 4WBNF 1RQPA 2ZYRA 2BGNA 4DPLA 1ZGCA 3H7AA 4L9AA 1V7QA 2GN9A 3JTEA 5DUKA 4M1SA 3HACA 2ZIAA 2MTBA 4H3KB 2EFYA 1BIFA 1KQ9A 4AF7A 3CUSA 3QXJA 1SD5A 4PANA 4MDHA 2GUGA 2WTUA 5LZ5A 1SZDA 2EFPA 1FLVA 3JQ6A 1GT6A 2JVGA 3NHLA 4KR6A 1Q7TA 3BH6A 1MH9A 3RCBA 5JBIA 2CHEA 4CCLA 5JXGA 2LNBA 2AMFA 5E6UB 1BG6A 4H18A 2XF7A 5JW6A 2QZSA 1P77A 2YXDA 3OZ7A 2HR1A 3HFJA 3S2HJ 2DFDA 2BRUA 4E12A 1NBOA 4N9IA 1IV8A 3HJTA 2ETXA 3UBTA 1P5HA 5H70A 4MK4A 1GPDG 2F1HA 4MHTA 1C9DB 3TZEA 4FE7A 2F9LA 1FE8A 1PK7A 4B5LA 3AR7A 4JI6B 4FFWA 2R25B 2I2WA 4FCCA 3WYDA 3SZLA 5J4VA 1EGMB 2ARKA 2WM2A 4L5AA 4V19K 4HAMA 4JBNA 3SYMA 1ZUD1 3L7OA 2GPAA 2L9VA 4G1FA 4Q03A 2LWIA 1SHLA 2PX8A 3S17J 5TEVA 4LQCA 1GFIA 3UB2A 3YASA 2DHDA 1VXRA 4UREA 4FKMA 3UICA 3V1MA 1DIGA 3ZWYA 4AQDA 1NUQA 3HWX1 5LU8A 4U7HA 2FOXA 5DWDA 1UZCA 1HKSA 2B6HA 4Y7DA 2IVFA 2DBRA 4JSRA 1AZWA 1XWIA 2BE7A 2Q0XA 3IMKA 4XQGA 2VOEA 3L0YA 1LDGA 2PIAA 3I9KA 3DTVD 3BH0A 3RH0A 1EFCA 4ZU1X 2P4UA 5DHTA 4KXYA 5JMOA 1KH3A 4M53A 3QVWA 3FJ1A 2Y68A 4D41A 4CM8B 4FW9A 4ASUA 3JAWA 4L16A 3AP2A 3ZDQA 3NBXX 2R8BA 2PWZA 5H3HA 4AMBA 2MU1A 1DRKA 2QZ9A 4UATA 1SG6A 5ALHA 2R5WA 4UZEA 3TP0A 1JDVA 3EZ6A 1MBJA 1UF9A 5E0OA 1NWCA 3CM0A 3KVNA 2MR6A 2A9VA 3IJ5A 4FGUA 3OHMA 3BR5A 2FRVA 2V98A 2O50A 3AJEA 3D2CA 3GN2A 1OLUB 2WSMA 1QYCA 3FNRA 3T5BA 3BBPA 3KAKA 2F1JA 4A0XA 3KV3O 5HILA 3O3NB 1NE7A 1JG6A 3P96A 1FXWA 4Q1BA 2CLMB 2PA3A 1W5SA 4RPCA 4DEVA 1LNQA 3IVAA 3U44B 4MTEA 1GA1A 1YJNI 2VHTA 1MAAA 1XGNA 1AOXA 4QBHA 1BS2A 4PWZA 4R1PA 4JGBA 1X7ZB 4EHBA 3ORFA 4TLCA 1U5CA 1KMNA 1R6BX 1CDDA 2B5WA 1NBMA 3UEOA 2JHAA 3K0CC 3TX2A 5JALA 1GZ4A 2P67A 3WB1A 2VAMA 3TAXA 4TXHA 3IWZA 1MIJA 4F92B 4P5EA 3PDIA 3JQEA 4HXYA 4HFRA 3JD1A 3EX7C 2OZKA 5IASA 3ZEIA 5GINE 1PJAA 3DBRA 4I99C 3H9QA 1E9EA 3ZV6A 4FVTA 3E9DA 4UU1A 4PCVA 1G9XA 3P4YA 4JK1X 2JATA 1XROA 3TNDA 4LYGA 1E2KA 3P4UA 3TDMA 1CR4A 5CTJA 1JYSA 2NU8A 4FI3C 1CUIA 4WLVA 1IAVA 1A27A 3LBYA 4BVKA 1KRWA 1N2SA 2Y1WA 1CF9A 4NSNA 4N49A 5DM1A 1TLLA 3R7DA 2LY1A 4URVR 4PZCA 1P4SA 5FULA 1K4SA 3U3JA 4IXDA 4LOIA 3ROTA 3AP1A 3WL8A 3O2NA 3WHLA 4TZTA 5CX1A 1CY1A 2DQ4A 1ZH5A 3U49A 4HN4B 4HZUA 3P0FA 3GD5A 1WU7A 4XRGA 3W9SA 2NSHA 3LV8A 4J75A 2OO3A 1JDUA 1I0LA 3DL0A 3QLEA 1XN4A 1T6YA 4MQ6A 3PM1A 2RVCA 1FFXB 1X2BA 4M6WA 3I52A 1QHYA 3DYVA 3WNCA 2VYND 5C2JB 4EKEA 1J0XO 4ZYEA 3BFVA 1W52X 3QY0A 2EB7A 1HSOA 2XHEA 4RGUA 3BTCA 4F4DA 1BVRA 4M0UA 2RCYA 5KNLA 2ID7A 1ZELA 4F9FA 2R7DA 2J5PA 3SD7A 1AF4A 2AKYA 3OWOA 1FRVA 5TS2A 2FEWB 3MLEA 4AJPA 4NPCA 2PX4A 3ILYA 3CLRC 4WOCA 2HHLA 1I3NA 3H0EA 2EYUA 3K0KA 2O8CA 1G5TA 4KT6A 3LSRA 1LDMA 5AVXA 2JFQA 4JXXA 4YALA 3RARA 3QEJA 2CJPA 2E4AA 4D3SA 3IQXA 4PNPA 1RPAA 1C7JA 4CF3A 4TV9F 3A05A 1Q83A 3I56I 4DLBA 1MO6A 3KO8A 2AXNA 1V3VA 3V2IA 1BVUA 1ADJA 2GZMA 4V1CI 2Q3EA 2Q3MA 2ZAYA 4QDTA 4DVJA 3CZCA 2XKPA 3LUBA 2NT3A 5F23A 2VP4A 4GSYA 4BKQA 2ZGVA 4B34A 3OIUA 2WHPA 1M2HA 3CH5A 2QLTA 2HCJB 4Q15A 4YT8A 3G2PA 3V8EA 2ADMA 3FRHA 4F5EA 1DBQA 4WBNB 2QNIA 4EPVA 3OZBA 5EJMA 3ECHA 1BI2A 1NLUA 1G0OA 4HGPA 4HLUC 3PVZA 1KJJA 4H4EA 4W5NA 1Z8FA 4B75A 2I7DA 3CU5A 2B9VA 3HN6A 3F2IA 4G8CA 1IHPA 4RY8A 2QM3A 1RPNA 4G4IA 5I7AA 1C80A 1ZVJA 1Z2DA 4R2IA 4ZO7A 5BQOA 1N3LA 4U5XA 4LMPA 3TDZC 3FMSA 2C4MA 1RESA 1JEAA 3S8YA 3DBIA 2J4DA 1EVQA 4Y6GB 4CETA 1GT91 3K1ZA 1VTKA 5TARA 3WADA 3ZY5A 2OGUA 2B2NA 1NNEA 2E34A 1HORA 4OF4A 2HZTA 3BAZA 1Q7GA 1YTLA 2RHTA 1SC6A 1I1SA 5CIWA 3ZJTA 5GM1A 4BBSJ 1C1XB 1LBHA 2RHGB 1ZMRA 4I50F 3JQQA 1R9TJ 1ZOLA 4FKBA 2BSAA 3ASOH 5CA1F 3WJ2A 4PG6A 1NMSA 3JQFA 2WQ7A 4TLAA 3EZ2A 2FPIA 4L8FA 3E22A 1DRUA 3SSNA 4Y2UA 5DHPA 4ID9A 4WY5A 4OP1A 1WKCA 1RRMA 2PVSA 4A2WA 1YVUA 5J4HA 4D8TA 3N2EA 2O8DB 4LI3X 3QWBA 2D1RA 3LA2A 2C2ZA 2C3PA 4IRHA 1VM6A 2OENG 1G98A 2WWRA 3WRXC 3SF8B 4UEOA 2ZJ2A 3N2GA 1JUSA 1H23A 3BL8A 5I3CA 2QV0A 1LBIA 1MZBA 3H9CA 4E08A 5KB3A 5BYAA 2Q4EA 4GGGA 1QIMA 2HA7A 2XUIA 2HEOA 2VDQB 2DQKA 1XV5A 1QV9A 1XF9A 3ZWBA 4UVDA 3MB5A 3H0GJ 2CLIB 1ZPDA 3EF0A 4UEJA 3PRJA 7REQA 1NJFA 4BDSA 1U0OC 4UJ3A 3F8TA 4L50A 4DLNA 2CZGA 4C05A 2XA1A 2TMKA 4PZUA 2BH9A 3C2BA 3CE9A 4Q3NA 2ZZMA 2F00A 2CFSA 2EG9A 4BQSA 3CXRA 1NPTO 1LPPA 2ZSBA 5DXAA 2NS0A 1NFFA 1N6LA 2QTCA 3ITNA 1YMUA 2A2ZA 2GBLC 4M86A 3LYHA 1KO5A 1M1EB 1R0XA 4R8SA 3WK8A 1NQ5A 4ZYYA 2C5AA 2DETA 1WH5A 2V7VA 1F12A 5ILQA 3F2VA 1KQ3A 4TT8A 3OFKA 5J1SB 3PEEA 3FKJA 1BIBA 3L9FA 3DMDA 2QRGA 4TWJA 5LA6A 3T1HB 3GO5A 2OQIA 3DTIA 3DQZA 1NHWA 4FNGA 5BQPA 4GU5A 1P7PA 1YBMA 1E1QA 1OT5A 4I55A 4GLLA 1KEKA 3K8OE 5K0JA 1WCYA 4A3JJ 2YY5A 1KPIA 1DT5A 2ZZNA 1WUJS 3KQUA 3GEMA 2ZUFA 3ILVA 1FFDA 1E1CB 1L5RA 5KVCA 3WISA 4N5LA 3GLFE 3GPLA 4TS4A 1W9MA 2PLFA 1D5CA 3RIHA 4ZQIA 2A5JA 5EHZA 3QPVA 4PHHA 4DRXB 5IFKA 5J1RA 5ENVA 2IRFG 1RQ7A 3DZ8A 4CEJA 4LHVA 1D04A 3SXJA 1EDDA 3DE1X 3AI3A 1GLGA 3L7JA 2AYZA 3LVBA 4G37A 4IYRA 4O2LA 3AV0B 1RXYA 1XRNA 4EY6A 4JBXA 2PVCA 5KWVA 1E1DA 3RS0A 2PA0A 4DCPA 1SB8A 4AMVA 3O1LA 3EIQA 1JA1A 1FX0A 3S5UA 3RNLA 5JNSA 4JYZA 4OHPA 2NPOA 1Z4MA 4EJ2A 2IY7A 3MINB 3RKQA 4UFNA 3HJCA 5D85A 4P1ZA 3UMMA 1M33A 3DC2A 5DT2A 2X15A 4Z9XA 1PNTA 4TV8A 1PQYA 1UWLA 2DLCX 1VE6A 5K7FA 3OYHA 3QYAA 1F7VA 2FFQA 1P74A 4A2QA 2JGNA 1N6OA 1LX7A 5GV8A 2QGNA 5FWDA 4DLAA 2MSDB 3SC3A 3CVYA 2ZBFA 1ZMOA 5CPFA 5F4ZA 4U0WA 4FHCA 4MCJA 3FSGA 2XUQA 3QFCA 1R8SA 4AP9A 8GPBA 2AX3A 1RIFA 1VPEA 4YRGA 4F0JA 4AS3A 4F04A 4R8KA 4IX9A 1UJNA 1ZG5A 2RBKA 3FUUA 4DNQA 2DSNA 1RKXA 4EJVA 5CM8B 3TEMA 2Q28A 4NBWA 4DZRA 3UHFA 5I5GA 3B89A 1SVMA 1OOEA 1K4TA 1TAGA 1MDMB 1D2GA 5NULA 1TIBA 1QK5A 5FWXB 5AI5A 2TRSB 4O02B 2IVMA 3UKDA 2GSWA 1ESEA 5JVGF 1GRRA 3L9XA 4D9IA 2OBBA 1KIMA 4YO8A 3Q2OA 1JLLB 3VNVA 1ACIA 4BYMA 4QFDA 4WZBA 4PTLA 4Z1MD 2Q1WA 1BQEA 1HETA 4ND6A 2XAHA 2BONA 4NYJQ 2IHJA 1CULC 2VC0A 5JASA 2YVLA 2EWMA 3RBXA 2DUWA 3IP6A 1EGAA 4NS1A 4JY7A 2YWFA 5KQSA 2Y0MA 3RVDA 4DDVA 5K6RA 2X8WA 2OQGA 3I73A 3ZOKA 1S7EA 4ANJA 2A68F 4FT8A 3LQYA 4N0BA 4X1KB 4J7UA 3QLVA 2AH5A 2D0IA 2YQ4A 1SOWA 4LEIA 1MBZA 4NARA 3Q12A 3KZYA 1QG6A 1FUEA 2Q6KA 5JPIA 4FMCF 4RE5A 2FPMA 3SZMA 5G1NA 2WILA 2OZLB 1TL8A 1E2NA 1GL6A 1HDXA 2WF9A 3R7BA 3M3DA 4C7OB 2IYRA 2VE9A 4O3MA 4IXWA 1R5OA 1YGPA 3V97A 5HDNA 3ML6A 2DFKB 5EYRA 4IUDS 4IQJA 4RJLA 5F0CA 4PJ0C 1B1CA 4XVCA 1TKAA 5HP4A 3DP9A 1I6LA 3L2UA 2JKZA 4OBXA 3IHWA 6NULA 1SUEA 1GIAA 4HWSA 1HKTA 1Z4NA 4I50B 4W63A 4D98A 3C7KA 4J0CA 2HJ9A 4X0EA 1MAUA 1CW2B 3ZDZB 1KVUA 1PUFA 4Y3OA 5L3QA 3CLSD 4QU8A 3NKVA 4CCAA 1PWXA 3PL8A 2Z1DA 2WOOA 3CH7A 4R1LA 4E5YA 4CCYA 3T1YB 4F9GA 3VJMA 3TR5A 1SCQA 4FXPA 4XUDA 3NONA 2IYLD 1F2DA 3WBBA 4QBFA 1XVUA 2SECE 3OP4A 1WL8A 4WXPA 1TJ4A 1JJ7A 1U7WA 5FLEX 4IL5A 1T6ZA 4E2FA 4CZ2A 2WP8J 4NFHA 4BJ5A 1KP2A 3TPZA 1X3LA 1LTKA 3FA2A 4UUSB 3PXBA 3L7YA 4MS3A 1KEWA 1JZTA 1XA0A 4WI1A 4DIEA 4KJZA 1IHDA 4XYGA 1RJ9B 4K2EA 4J7CA 3H6HA 4OHUA 1PJ8A 3TTSA 2WTEA 1FY7A 2EWNA 4PPFA 2NG1A 2W00A 2BW3A 1JYEA 1OLTA 2PFSA 1I4LD 3G3ZA 3EC1A 4MVWA 4HEA1 3WWOA 2IGMA 3H42B 5EP3A 3ZMVA 3FPFA 4F72A 3UCXA 4RIFA 2ZVDA 2L69A 4G01B 3DMHA 1DAFA 3V4SA 3RSLA 4AO6A 1TA0A 2NUPA 3TO5A 1KOLA 4NOKA 5D3ZA 1UC8A 5DHRA 2I5UA 2PRJA 1GUFA 1VQ1A 3JXEA 3NTRA 1T9HA 4WLFA 3DXZA 4XWWA 4QWQA 5DI3A 4AAYA 3AVYA 2J3JA 1DLJA 3EQ7A 4RFLA 3ZQCA 3NNNA 1V8OA 3BB1A 4EY3A 4INZA 3R9IA 3QUBA 2H1FA 3A2MA 4IR7A 3IKLA 1K08A 2R8PA 2JLYA 3JREA 1SZCA 2V9KA 3I2GA 3M8JA 4BNFA 4PQRA 4LRSB 3HL2A 1QQIA 1W59A 3ZWCA 1XMAA 4I6EA 1X94A 3LJKA 4LIVA 2QQGA 4ARVA 1S7AA 3N6RA 2C2GA 1E2UA 1E8DA 3B2EA 3OJWA 3VZSA 1BVYF 3UAZA 2OV4A 2XOXA 2O3FA 3GT7A 2C61A 4R54A 4DMGA 4A1FA 2XCRB 2XY4A 2QN9A 3IKVA 3M5DA 4I2OA 1I01A 3MYRA 3AMVA 5DBIA 3VUEA 1UB9A 3HDGA 3Q88A 3O8NA 4HYEA 3H5WA 4RY2A 2J9FA 2PT6A 1DUSA 3A1NA 4XM1A 2Y92A 4IUBS 3STXA 4BO1A 3U6BA 1LSOA 1JDPA 5CAEA 3R6TA 2AQFA 1T2EA 5BSEA 4X5OA 4C5CA 3JRFA 3FROA 1U4OA 3E70C 4XJVA 1DNPA 3N28A 3DBHB 1P5RA 4NDZA 1Z6TA 4MRNA 4OWRB 5FYQA 2FSVC 2XPUA 1OV6A 5JAOA 2A1TS 4MV3A 1SBZA 3G6EI 3UATA 3BJAA 1XOIA 5IN4A 3G88A 4KQXA 1EXVA 3RCOA 4NMXB 2JLSA 1EVEA 4TXMA 1AS3A 3UWDA 4LJKA 3TW6A 1C30A 3TMAA 3HDYA 4M38A 3WL7A 4HN2A 3U7JA 4ZANA 3EG9A 4G5GA 3NT4A 4BPRA 4QHTA 1U7ZA 4QTUB 4TYPA 4LTNA 1Z5VA 3HPRA 1YQGA 1RYYA 3LL7A 3PXUA 3DKXA 4TWBA 2E36A 3TW0A 4A12A 5CUQA 4O5AA 2EBWA 3CF4G 3ETCA 5HCNA 2F4NA 1LDBA 2O5VA 4HEA6 2CKDA 1FFCA 3D0RA 4U9UA 1KSHA 5FNVA 4O4JB 2E71A 2REQB 2FPSA 5B4UA 5F9MA 4N39A 1XTUA 3E48A 4CT0A 3FTFA 2IHTA 1DXOA 4DNCA 1UHWA 1RLTA 3BGOS 1L5NA 4UVCA 3STHA 1Q6YA 4J8PA 1JIXA 2DWUA 3OLYA 3FCAA 2GFIA 4F56A 2UYYA 2WPDA 1GV5A 1W4LA 4Q7EA 1EDBA 3ZHXA 5IH3A 3W3AA 4MMXB 4WA7A 5MGNA 3EYYA 4QARA 4DAOA 3RUAA 3IERA 4LE1A 5E1XA 1WB4A 3MRTA 3WMWA 4D9NA 4NJMA 2H29A 2H54A 4EZIA 2PE5A 3D3WA 4LYJA 2R60A 3RTEA 3MJTA 4KI7A 1CNFA 3KOZA 3GLIB 1QOQB 1FQWA 1OFCX 3JQRA 2ZFWA 3AEUA 2C82A 4URHA 1XZLA 2BEWB 2B7CA 2FW6A 2L17A 4BJ6C 1MQ9A 5FCDA 4F9TA 1ZTRA 3GA7A 4MQFB 4CM9D 1UQTA 4M6VA 4RXTA 4EA6A 1LPQA 1Z8DA 4CIBA 4IWXA 5U4QA 2CKMA 4IIXA 4XOIA 2ISYA 3OS0A 2BGKA 2P5KA 3C1TA 4I46A 4O4LB 1HM5A 4N40A 1YOVA 4I98B 3C4JA 2DJNA 4X6LA 5IDYA 3RDIA 2XWJI 4S0HB 2FKNA 4KAXA 2VDKB 2R87A 2XGEA 3ZDDA 1M8JA 3L2OB 2WG1A 4JX6A 4B2YA 4XQ9A 2B99A 4EUKA 5CFMA 4JC8A 1ETWA 2P5SA 1Q0RA 3HG9A 1ORKA 2RKWA 4U2GA 5C31A 1FMWA 2V5VA 1QJ4A 2PWYA 2UZKA 4IDAA 4QE3A 2E1RA 4NUBA 3ECSA 1MBFA 2I8DA 3RYCA 1LB1B 1S5PA 4TSRA 4D6XA 2J0QA 1GD1O 1YJWI 2NXWA 1NJ6A 5FBRB 3I0TA 1JMKC 1YS2X 1NYQA 2IWRA 5B1YA 4BQAA 2X8LA 4OIOF 5IWCA 3QELB 3IOCA 3FWPA 4A73A 3HVUA 3IT2A 3LBIA 3BJOA 3AEKB 2HDOA 3D59A 3RUFA 5LEJA 2X3FA 1G2PA 4FGLA 1TCVA 3SDZA 3L7CA 3I6BA 3UKGA 1DI0A 1QH0A 1F5SA 4YRLA 2FK8A 1MHPA 3NDBB 2O23A 4RIGA 3L1VA 2PX3A 3GUDA 2ZBUA 3L1JA 2KZGA 1T9GS 1UDWA 1RKWA 3TMYA 1W1WA 4JITA 2QW8A 4G1UC 4M3NA 4N3NA 4LHEA 2K2QB 4OM8A 4PO1A 3Q8WA 3WGKA 1ZVMA 3IUJA 3KQSA 1HE3A 4ITUA 2X6TA 2JGIA 4LYDA 5F3DA 1XZKA 3B2QA 3CKLA 4A6DA 5LHGA 1IE3A 4ERXA 3TZCA 4XX0A 1Q19A 3FMGA 3ZDRA 4CICA 4NH4A 2HPVA 3ED1A 3KOXA 2OD2A 4W8OA 4ZAXA 1A2QA 5F21A 2CH0A 2MSLA 4BVAA 1CPYA 2YJ4A 5EG0A 2NNYA 2RHJA 3CH4B 1IOZA 3C3EA 4UHTA 3JRDA 1T2NA 2NUBA 2XQFA 3FRJA 1OV4A 2Q7OE 2BTQA 1BOBA 2FPOA 1PJSA 1KJQA 1PG2A 3H18A 2C95A 1QLWA 3DM5A 3BVPA 3GP8A 2IYFA 2IYPA 2V97A 3HOTA 2C3UA 3DEFA 3SJMA 2HHAA 1KZ1A 3ORYA 1Y7LA 2IW1A 1DE0A 2XNJA 2HC9A 4CQLA 1JGGA 2GFHA 2Z8YM 4EG6A 2EX0A 2AOTA 3UY4A 1PZFA 2FDCA 2FGKA 3MMSA 1HZZC 5HCUA 1GGNA 2EFJA 1U0SY 4QBTA 3ND6A 4EGSA 5IYZA 4NBQA 3RS4A 1ZH0A 2XSJC 4Q34A 1Y89A 3T1OA 4N48A 5DM70 2V3VA 1IG7A 4JLVA 3TJRA 3VO1A 1EP1B 4RGYA 4FE4A 2DKNA 2CDBA 3Q6MA 3KTAA 1ZLYA 4W5OA 3IEXA 1YMQA 5CDYA 4XKWA 4UAJA 1XEAA 3K9GA 4RVFA 3OUUA 1II8B 2BY1A 2CSXA 3JS5A 1ZKDA 1CZKA 4TGLA 2CY0A 3ORSA 3K8QA 5EXTA 4RSGA 2ENUA 1CY0A 5ALSA 3L9WA 4HS9A 1D4FA 3TN7A 2YTZA 2XNKA 4UU0A 3A9WA 3PF9A 1ZJJA 1WPRA 4YS6A 3D5SC 1EHIA 1I0ZA 3L2VA 2HVSA 3AFMA 3OJCA 4AT1A 2G71A 5EMKA 2Z4TA 3MT9A 1T5HX 2I7TA 5K3AA 2BR3A 1CQJB 1QQ7A 1SXJD 2YMLA 5G1OA 1WPKA 2R7WA 2FEXA 3X1MA 1HT1E 2DW4A 4BBZA 4AO8A 1I51A 5CX4A 4GZLA 2IOFA 1DARA 1SZPA 4XWYA 2FXAA 3MW8A 1AUVA 3ADBA 1NOKA 1YE3A 3WV4A 2O03A 3LZCA 3UGKA 2BH2A 3O8LA 4FYYA 2OF7A 3D5LA 3M9AA 4NDLA 5AW0A 5CIQA 1I6HJ 3KEGA 1P0FA 4RVSA 3P9ZA 2CUNA 2SKDA 4Q48A 3GJTA 2R8YA 1P92A 3T5MA 1V6CA 4BQQA 1A1SA 4P7KA 1P7IA 2FOKA 5THXA 3HRKA 3FMOB 1R6AA 3CONA 1VQOI 2IYVA 4JCCA 4OBWA 1N2CE 5DZSA 1OYYA 3IV6A 4KBFA 4TUYF 3H83A 5FTLA 3O90A 3UR3C 5DLQC 1UFQA 1UK6A 2AG6A 4MVJE 1ONSA 1RWVA 3FYCA 3S81A 1O9GA 3V4LA 1Y6IA 1PV1A 2WYVA 4I81A 5M5BA 1MMDA 3VRHA 4W4TA 3KR2A 2CHGA 4CHTA 2H2GA 1E3MA 3H1GA 4FTHA 2ZJPF 2ZT8A 5A4IS 3WJAA 4G56A 1SHKA 1LX6A 3EGDB 4JX8A 2DLNA 4M8IA 3G17A 4GZMA 4EHHA 1X1RA 1L4YA 4FHGA 4CT4B 5KX5A 5EHGA 1KYVA 4I1OA 1XZQA 2NSYA 3C5WP 2HXOA 4MEBA 3ZHOA 5BNIA 1IO2A 1W4CA 2I4OA 3FOEC 4REQA 1JECA 2JA5J 4EI2A 3IT1A 4EMTA 4BNCA 3ZHSA 4M36A 4GZ5A 4FMBB 2NYXA 3FXRA 3E1SA 2FFHA 4A92A 1P4RA 2HN9A 2QDKA 3HTUA 4JP1A 3CYFA 4PCQA 4ZC3A 3QHAA 3FYUB 4ACAA 1Q2UA 4LWZA 3IUQA 4JOQA 2AD1A 1AXRA 4R1NA 5DNAA 1FFHA 2Z3WA 3MOSA 3R3JA 1BE0A 1QKJA 2AOVA 1BOOA 3E6AA 1G3QA 3TIXB 1T29A 3TGWA 1E3LA 5A6VA 3OTQA 3JRBA 1J39A 3SQNA 3GRZA 3NAMA 4CTKA 4C5AA 4TT3D 4DWWA 1W0CA 4DRZA 2Q5JA 3EULA 1ZH2A 1WDMA 3VKWA 3A4YA 5MN4A 4WAUA 5ETJA 4YRSA 4CMJA 2MYPA 5EWLA 2FB9A 3N86A 3JAMZ 2ZT5A 3FWYA 1USUA 5KOHB 4Q3EA 1WR8A 4HFMA 4LGYA 2F4MB 3ZCQA 5L4SA 1VECA 4OQQA 3D1JA 5BOSA 2XCQA 2R6DA 1QIHA 3QF7A 4Q1FA 1BA5A 1BH2A 4IV0A 1R12A 4JX4A 1QFYA 3Q3EA 2F43B 2R6AA 1FPQA 3R09A 1ITZA 4Y7CA 3DE6X 1TC1A 2VUHB 1N5RA 2H1WA 4ZDPA 1X70A 1A5TA 3H11B 2CE7A 1MNQA 1RWXA 1K75A 1TWAJ 4DUPA 4B40A 1LBEA 5KU7A 2ZJ0A 1GCOA 1N7JA 2YH2A 3QPAA 4HVLA 2H1HA 2BVLA 3GTQJ 5EFZA 3TKAA 3UJ9A 3KJIA 2JLZA 3ZMDA 1Z4LA 1V6SA 1QCYA 3FNHA 3C3BA 2QTFA 5HZMA 1FTNA 3KG2A 4P58A 2KRCA 4HATA 2GZSA 3WHPA 4IEJA 4LGWA 5KYVA 4XFJA 1H8HA 2A5GA 3VTAA 1O4VA 2IE0A 3BTUA 4UPDA 2WW8A 3A31A 1NC1A 5EXEA 3M6MD 4EKDA 5C37A 3DVQX 5IT3A 1YKGA 3KP3A 3FHTA 1NAHA 4R7GA 5K4HA 4J4BA 2VYQA 3JQFC 2HQRA 3THWB 3B5JA 1CZLA 3EXHB 3IJPA 3E8MA 2HA5A 3DDNA 4FZRA 1Y3AA 3L84A 2LYCA 3V7CA 4BP1A 1H9AA 4ZO8A 4HGRA 1PVVA 2PFKA 4IO1A 3K72B 1VP9A 4OMYA 2F17A 1ZRNA 1LVHA 4S0XA 4F4HA 3R61A 1WZNA 3CG4A 3PNYA 2O6HA 4EA9A 4LQ4A 1U3CA 2L0XA 4S0ZA 2AEJA 4WKPA 2XCSB 3ND7A 5JWOA 4PVDA 4Q82A 2PGJA 2W2TA 1M1YA 3IOYA 3CJRA 1PL8A 4F5YA 1YNOA 4CL3A 1ORVA 4X1IA 1PDVA 4M3BA 1E4EA 3KB2A 4FLEA 4PYRA 3BRQA 1YDWA 5AW2A 2FE1A 4FFBA 1K7XB 4RS8A 3TLYA 1PZNA 4OP2A 1ZIOA 3CR8A 3ZZNA 1YA6A 1CRLA 1OFTA 3UMJA 3OTWA 5IJ0B 2WB1A 3QPWA 3QH4A 5DGCA 3RVQA 4UD2A 1RR7A 4G0QA 4KEAA 3R4CA 2BZGA 3A36A 1J9IA 5AIPA 3FAZA 1OXKB 4QREA 3OY9A 1QH8B 2WFAA 1S96A 1TA4A 2EIKH 4HV4A 4CIDA 2OCBA 4GL4A 4GPTA 3I12A 1QNTA 2CVPA 4NENA 2WKWA 4D0PA 4MGIR 5T64A 2GM5A 2RGCA 4C0LA 2FSPA 4ZWNA 3H9UA 4FNOA 3GX4X 2JL1A 4DNFA 2IS4A 3CFYA 2CUFA 2BR5A 2Q5FA 2WVAA 3KDPA 3EIUA 4LF8B 1Z5PA 4L57A 3ZHVA 1SMKA 1PT9A 3ONNA 2H8WA 2Y0SA 1RYFA 3ZVMA 2OCAA 4BTEA 2VUUA 3DTVB 4MWEA 4I4LA 4KW7A 4PZZA 1T8WA 5HIAA 3BWXA 1SCKA 2F4IA 1YDFA 1XHFA 1WUHS 5A4KA 1TWCJ 3DV9A 4MVJA 4BEHB 4XPIB 2GSDA 4E15A 2ZJ5A 2L0KA 4DV4B 4BNYA 4MARA 5TMEA 4EEKA 3GGDA 3E3VA 2GD6A 2N8GA 4C7XA 2RV8A 2ADFA 3NHUA 2EBHX 3C1UA 2QRUA 3AONB 4JOBA 2XE6A 2PJUA 4QTRA 4BRZA 2JZYA 1ULBA 4PJNA 3QKRA 2PL5A 3ONQA 4HGQA 2GN2A 4R7ZA 5FLXZ 1IMJA 1M72A 5LN1A 4E4TA 4RSHA 3QZUA 4TUYB 2KIMA 4MQUA 2CQKA 4QUIA 4XA8A 3TX6A 4MUXA 2HKIA 3ICVA 3LUCA 4CIXA 3KM0A 3SLGA 5CDSA 2A8YA 1RBMA 1KS2A 1IL0A 4YIHA 2LLKA 1CY6A 4CVNA 1QDUA 1IHUA 2Q5IA 4ATNA 2C03A 2WU0A 2BI7A 3AR4A 2ERYA 4YAEA 4W6ZA 3AVQA 3GVCA 2QZ8A 4Q3OA 3GDFA 2FH5B 2YQ5A 4GSKA 1O08A 5KQPA 3ESCA 4H1HA 5A0VA 5KOJA 5K3FA 1NXXA 2YWCA 2HQAA 4QTXA 5DVZA 4F86A 2ZM5A 1Y8QB 2RKHA 1DKRA 4J0FA 4XLTA 4UM5A 2W6QA 4HH3C 3D6VA 4C20A 1P1HA 4F1JA 1N1MA 4QLAA 4OHFA 4PF1A 1DTWA 4O6VA 1HY3A 1QAMA 3M6LA 2J0EA 1DAEA 5EEHA 9GPBA 5CLHA 1WW3A 2VNKA 2PX2A 2BBSA 4ZEMA 5BYBA 2JN6A 2GBIA 3ER6A 3KFVA 5EOVA 2HOEA 5ICGA 4WESB 1T4DA 3D4NA 1TZCA 1ZAKA 4MP8A 5LLQA 4S1PA 1ULSA 4ABZA 2V0GA 1WVRA 2IV7A 1N7IA 2LY2A 2BFBB 2PZLA 4KQIA 1V11B 4IG4A 2G0NA 3D8SA 2R6JA 1WSDA 3PI7A 3SQOA 3AL0B 3WQHA 1A76A 4ZRDA 1OC4A 2AGVA 4JBGA 2QQFA 1XQWA 3VQTA 4J29A 5IVKA 4RZSA 4WBSA 1Z5OA 1FJLA 2AHQA 3QYPA 3WOVA 1QO9A 1DEKA 4IIJA 3OTIA 3ABTA 1T5TA 2DA7A 1IWBB 3C2HA 4FX5A 3HUGB 4HDRA 1DFGA 4BKRA 2FP4B 2GUWA 1FSHA 3PQKA 3AIKA 3Q5DA 1XKQA 3F8MA 5FLKA 5LDGA 5KNCA 5DEQA 4JELA 1E64A 4CM4B 2YZKA 3E3MA 1ML4A 5BOXA 2X0DA 3PC7A 2F7SA 3NBKA 4JOMA 3BX1A 4OQZA 5LQNA 4CRWB 3GMTA 1IVYA 3SEFA 3BGDA 4COKA 3ZEAA 1MHTA 1VI0A 4LJ9A 1H3NA 4X7PA 4UTPA 4LJZF 4BGDA 5D84A 2YFHA 3VR5D 2ME6A 1N5OX 1WHTA 3PDUA 4G4SP 3DTNA 2KFDA 1NW9B 2RB5A 1OCTC 2AK2A 1AUQA 4RENA 3RU7A 1XJ5A 2QTGA 4ED9A 4I36A 5A9SA 3LQ1A 1NQTA 1KKMA 5K0GA 4RDXA 1P0PA 3QLVC 4TMYA 2G70A 2X5KO 7ADHA 4R1UA 1EGHA 1GTVA 4X00A 4K9LA 1S3JA 4EJOA 1AU7A 1R5JA 2Q1TA 2PT7A 3T15A 3B20A 4OX9Y 4PIVA 3IHLA 1YTUA 2NIPA 3GELA 2PZAA 4QLOA 3LXXA 5ELXA 3UA4A 1YULA 1I2AA 2Y1KA 4D6YA 1UMDB 4M73A 3RQIA 2BMDA 4Q6BA 1DU0A 2GZ2A 1L5QA 2RNGA 4BMPB 1X19A 1HL3A 3HN7A 5F3WB 5ABPA 1IPEA 1FZPB 4DLUA 5TMBA 5AJYA 2OZEA 4QYIB 4DMFA 4IINA 3ZI4A 5KYUB 2QZPA 2TYSB 1H9TA 4DZPA 1H5NA 3BZ6A 1L4EA 5JV5A 2A9FA 3N2IA 4XDGA 3BZKA 1WKMA 4L0ZB 2P1RA 5AJZA 1GQRA 3OQNA 1QB8A 1IB6A 1G7RA 3I28A 4P55A 1IB0A 2B4AA 3R3WA 4LTMA 3G8DA 3I59B 4LFUA 1JBKA 4NC6A 2FW1A 3NWOA 1FNDA 4M9QA 4F3KA 1KSGA 2C4HA 1VYTA 2XR1A 3Q9UA 1Z77A 1VI2A 4CLOA 1SFRA 3H5IA 3KWLA 4M3DA 3T9BA 1A8SA 4BY9E 3D8RA 3ET5A 1TI7A 1FX7A 3EC7A 1XTZA 2KISA 3H1CA 5ERYA 1SQ5A 1KFBB 3KOMA 3UUWA 4BJ5C 2G9VA 3K05A 1YITI 3CC7I 4Y9SA 3EARA 3G89A 1IJBA 4YAKA 1SHZA 1B42A 5DCWA 4DHEA 2VCEA 4X41A 1TK2A 1DIBA 1AHDP 1TJ3A 2D5CA 3LSJA 1XSXA 4TL6A 2I55A 1A77A 4A3MJ 2QUHA 5C3UA 2OORA 2ZITA 3RV3A 5A03A 5CJPA 3MD2A 2RHDA 5HIIA 1B23P 4B3MB 5THQA 4D7AA 3R75A 4ND4A 4H4KC 3VR2A 5FWYA 4P22A 5K6TA 1XGOA 4FDLA 3E7DA 1LZLA 5KVRA 5ED4A 3R3SA 4XRFA 1VBKA 3VI4B 2IVZA 3HKEA 4MB6A 4N5MA 2Q5EA 3A3YA 4RY0A 1ZOIA 3HV2A 3KTDA 1PSDA 3CUQB 1N9GA 5T3YA 4BZXA 1R1TA 3WE7A 2FU4A 2G06A 2PS1A 2NMVA 2VQCA 5CCDA 3TW8B 3PR2B 1J59A 3EEYA 2WFZA 5LQKA 1QQ6A 5AUQA 2JWTA 3BMNA 4EGJA 2FG7C 4ITRC 2P3LA 4BUJA 4XN0A 1Y9ZA 2ZJ3A 5AVUA 1DINA 5KZMB 5DWVA 4L22A 5AVSA 2RGEA 3JQAD 4L5CA 5D87A 5ALEA 1ODTC 2IA1A 1GILA 3K70B 2KMLA 3VPDA 3RC3A 3PWKA 3PNKA 1BFUA 3CIOA 2EIHA 4JKIA 3S2GA 1PFVA 1I33A 3EDQA 1B59A 3SDGA 4TMWA 3GHHA 1JR3E 4DE5A 1JU9A 4DDWA 1E17A 5EF6A 3ICEA 5DYIA 5EKXA 2D5VA 3OR1C 2D5AA 1V26A 1M2OB 4JVNA 2GZ3A 4G9YA 3RK4A 3RREA 1IGNA 2XF5A 3G1MA 2X9LA 1BM9A 3QTLA 4J0KA 5CFZA 3U44A 4QUHA 3RT9A 4L6CA 1B14A 4IMIB 2VB6A 2YS9A 1GQOA 2J0UA 1KDPA 3IB3A 3Q10A 5A9TA 1QTIA 2HWWA 2FUG1 1K7CA 1KQ0A 1SNYA 2JRTA 3U7FB 2VWGA 4NV3A 3IBTA 2OG2A 4L4YA 4DLPA 2QSGX 1N2EA 2JFUA 2R0QC 2HTJA 2OXTA 1AXGA 1H3EA 2G9QA 1QV6A 4F2DA 5EPUA 5HMLA 5CFNA 4OQLA 4EVIA 3WHKA 2KRHA 2W8BB 1V47A 2EZTA 2GK6A 2JCYA 5K8UA 3K4CA 3NIFB 4BIMA 3C98A 4IOKA 4PFKA 3BSYA 1AB5A 3WLAA 3FHCB 3IH2A 4I7HA 4OMDA 4IZZA 3DU6A 2GM4A 1WMSA 4H1UA 3FBWA 4L5YA 5HM8A 1V4BA 2CBXA 2B0CA 2XV1A 1ZCZA 3HOYJ 2YQZA 2AUMA 4KVFA 1YIOA 5REQB 3IELA 3IV9A 3SU8A 1QXSA 1VSTA 1IN5A 2NU9B 3OYDA 4I02A 3WWYA 2DQLA 4KIBA 4G7ZF 2TMYA 2QN6A 2HW8A 5KAPA 1U3UA 2DE0X 2Y67A 3BFXA 1LLCA 3L4KA 1HEUA 4X3PA 3QU9A 5L95A 3ABUA 1SFOJ 5BSHA 2IOFK 2C77A 2PSHA 3CWQA 2WTBA 1R9JA 4JR1A 5CCXA 3OEHA 4JP3A 4MVJI 3A1UA 3VPGA 3PUYA 3DE3X 3N2LA 3CVXA 3VSEA 4GOMD 1Y6QA 4IPAA 3VHXA 3RAFC 1G60A 3GVXA 4DJJA 2YICA 2XDAA 1E2HA 2HTSA 2R62A 3R0AA 2R7VA 5LNK1 2QJWA 3MHTA 1QE0A 1FFXA 2WAMA 4FE3A 3LCJA 1FC0A 3OZEA 2IYWA 5L6MB 5GY7A 2C7RA 5DISB 2B9SA 1FRZA 2YDXA 3REQB 2K02A 3B7PA 3TVYA 2DECA 1XVAA 1P3Y1 1X7WB 4UB6C 5AVKA 1PJTA 4DQXA 2DHCA 4PPNA 4EKIA 1KYIA 1JEOA 1EFHA 3STUA 1SAUA 4HDSB 3VZPA 3FKSD 1ATIA 2DF8A 3DBVO 3HSEA 1B6SA 2CWEA 2JIZD 5UKDA 1I2MA 3M8FA 3H0CA 2Q27A 2K6GA 2ZYDA 3V34A 5JNLA 3EOZA 3HL4A 4TRMA 2ORED 4EV0A 4X8OA 2A59A 3SR4A 2Q1SA 4GPBA 5B7QA 3I61A 3O4JA 1GCUA 1QE3A 3EG5A 3W6PA 2ZIXB 2F5FA 1U5BB 3MIZA 3W8DA 2D2VA 4KDCA 3C3CA 3F8BA 5KHDA 2CT8A 4IRMA 4XLCA 1G6NA 4NBKA 5GVSA 3ASZA 4OQ4A 2HKXA 4XM0A 2FUG6 1YVRA 3P94A 4DLKA 3TVTA 3PTLA 5BWCA 2XPVA 1QIIA 3X1ZA 2P6OA 2QEQA 4CE6A 3BCRA 4F5ZA 4LLNA 2FWIA 1GQYA 3DEWA 1OCEA 3KQOA 3UNXA 5CJ2A 4WBNA 2O2SA 2ELJA 1PJZA 4LXYA 4G0WA 2V9ZA 5IVHA 4JT8A 1I9GA 1E2MA 3CN9A 5JBQA 1RZVA 5JR3A 4IDCA 4HXEB 3ZVNA 2LE0A 1K3FA 2IW3A 1CDZA 2YV4A 5DDGA 1GL9B 4MKHA 3G0DA 3AU8A 3B6JA 4IS2A 3TFWA 2LRHA 4NBRA 1ZRMA 3NBFA 3WGVA 4LDQA 3HJRA 4KMUX 1OIXA 3NVDA 4WXDA 4HLYA 4H3SA 4L51A 1W85B 2B6NA 3I04M 4WJLA 2JJQA 2G9RA 5B1EA 2FRHA 1M6YA 1T6SA 3J7AY 5IF3A 1F2TB 3QMPA 1XRRA 4MWSA 1J8VA 1Z0ZA 5HF8A 4A03A 1UDRA 1RXCA 2Z08A 3D2AA 1YZUA 2GXBA 4BC1A 2ZXIA 3L4JA 4RHCA 4GQAA 3SP1A 3BICA 4Q4AA 1QNLA 1YL5A 2PLNA 3PQ8A 4LXUA 3THYA 3FNBA 1JS1X 4FDVA 1P1BA 3BG9A 1BGXT 1L7MA 4WFKA 4HG2A 5LNK6 2HCBA 2BCEA 3SKVA 4EL5A 5JMWA 5AKXA 5H16A 2ZE6A 2JA7J 2UYGA 2QR2A 3OCJA 3SK0A 3PC3A 1EFUA 3K9LA 1QDLB 3KQVA 2CWDA 2Y9ZA 4O2BF 3UC5A 4HI0E 4BXXJ 3J80K 2H17A 4POAA 4PR0A 3DEHA 3ESBA 2OGSA 4O4JF 2G72A 2NTNA 2V7EA 1Y5RA 1VBMA 1Z3YA 3DE5X 1U0TA 1QIDA 4ZU3A 3H9GA 5E0KB 4E7LA 4DNOA 1JR3A 3E23A 4DIMA 4JQZA 1CP2A 4DSNA 5KUTA 5DXFA 1NXSA 5E4TA 4N5NA 1J1IA 5K7ZA 1VLZA 1RHMA 5JMTA 1NNUA 3OOYA 3BC1A 2O8BA 4CLEA 2UUAB 3FTCA 2A9PA 3BCAA 3BK2A 1COWA 5CYGA 3LAPA 4MHGA 3W8FA 4M1OA 1M2WA 2OA4A 5CVRA 4M3FA 1ISRA 3EXG2 2R5ZA 1YIAA 2VDUE 4NMMA 3M9WA 5EHQA 2PH3A 1T0JB 1IQUA 1RABA 3PWZA 3DO5A 4XVRA 1XALA 4Y7NJ 3BYZA 3HP4A 2XIJA 1ZOSA 3NW9A 4BMZA 3HFGA 2J8ZA 3OX3A 4O4LF 1RU3A 5GIOE 3MWDA 5FPQA 2IOQA 3DVRX 2VTBA 1W0JA 4BAGA 2ZSUA 1UT5A 1STZA 2J9XB 3W04A 2C54A 4CNBA 3NALA 1Q95A 3VC2A 3KAQA 1JQBA 2ATEA 1R0KA 3EVGA 4TROA 1QIEA 5IT9Z 4OU0A 1UWCA 4MGEA 2BTOA 4BYGA 5GAHJ 1YQWA 3F4KA 4NHEA 2QXUA 4FFLA 3LO5A 2QW0X 2CVOA 2J3HA 1EGVB 2X6YA 2D2FA 4MXDA 2H6BA 3AR6A 1YFZA 4JLSA 5FTKA 1NI4A 1MXFA 1KVQA 3GCWA 3GB9A 2IP2A 4NS4A 3S40A 5AR1A 1T8RA 4LRQA 4R0VA 4C78A 4PFJA 4F8YA 1RLIA 2XUFA 1YS1X 4LK2A 4RPKA 1E2BA 1W9HA 1ZC4A 3PFGA 3KJEA 4KTTE 1VQMI 3UWKA 4E5MA 1X39A 1GNLA 2QN7A 1T36B 3WI7A 5AI6A 4GF5A 1AKUA 2HNKA 2L18A 3GUCA 4P54A 2NN3C 3ZVLA 2GQQA 2CL6X 1C9EA 1XNQB 2IT0A 4BFZA 2J3KA 4RPLA 5HBGA 4ER3A 2W58A 1JSXA 4J6EA 3LI2A 4F2PA 2J5RA 2P9CA 2PGIA 5CLGA 1C2YA 1KP9A 3RVKA 4BYYA 3S2UA 4DKJA 4FNAA 3QM1A 1N25A 5B4VA 4JXJA 3SZOA 4HWTA 4ZTFA 1KVTA 1R6VA 5KMGB 1BW9A 2Q0OA 4HVCA 3IBCA 3LRXA 1QZUA 1JAIA 1NJGA 3O73A 3VI3B 4HTFB 1X2MA 4KHPB 4CKBA 4ZFNA 1ZJ5A 1TFUA 5B1DA 3H1FA 5DCLA 2F6CA 3SNKA 1X1DA 4YGXB 1YS7A 1D6SA 2HQBA 1KY3A 4MLCA 3HABA 3CC4I 3DQPA 2ZXUA 4MV1A 4F5DA 3OLZA 4IXAA 2YPRA 2WTXA 3GI1A 4INOA 4YDHB 3TCXB 4BKUA 1NNSA 1YONA 1CUAA 2YWRA 3EMDA 5B7PA 2FRDA 4TKZA 1SOVA 3K6SB 4W5HA 3DVLA 4PK4A 4ZCPA 4ZAZA 3RO7A 4TV9A 3CCLI 3GLFA 1W7AA 3GDGA 2GPYA 1BKSB 4KPUB 4JC5A 4DL9A 4QYSA 2XRLA 2ID3A 4FIZA 2FQXA 4PLZA 1YR2A 1L8OA 1B3BA 4FYXA 3Q0VA 5A9RA 5M5WJ 2RI6A 3L2CA 1V25A 5LBQA 1H2ZA 3GJ5A 5HCIA 3L09A 2HQOA 1PD0A 3IV7A 1G66A 2AG0A 4A8TA 1GQFA 1PLJA 5AKEA 2J30A 3DGFC 1IFXA 5SY9A 3RPEA 1UEXC 5BVHB 1SA0B 1T8UA 2E2JJ 2OL4A 1RP1A 4GRDA 5GMOA 3TNFA 4OLFA 1RM3A 1RRPA 2GA9A 1WXXA 3GLIE 5AKZA 2B69A 1HYGA 2WIGA 3F5MA 3ETJA 2XT0A 3NOXA 3WRVA 3OFSA 1I7PA 2GO1A 4ZHSA 5HDGA 4YCCA 4B83A 5ALRA 4IXTA 3CNNA 3AGQA 3BZBA 4LWOA 3U26A 2W90A 2OQRA 2AG1A 2FRXA 4O08A 1M2FA 2QUZA 4C2TA 2BEUA 4DY4A 4E21A 2PGXA 4KBYA 1HDRA 1N5JA 2MINB 3E53A 1R4NB 3BR2A 2QGFA 5DTJA 1W5CC 4L4XA 1EVYA 1GQQA 4E7IA 4N7RA 3R7WA 2O6LA 4AIRA 4NVRA 1DO0A 2VO1A 3AWIA 1UIMA 5DN6D 3S2WA 3UPDA 1YQTA 3KNZA 4YI5A 5CA1A 9ANTA 2EXXA 4WWHA 4YUYA 1PJRA 3GWZA 4BLVA 4IRXA 4JBAA 1JSCA 1WY7A 4ZOBA 4HDKB 2R86A 1LI4A 3S8MA 3ZCVA 3H4VA 3ROPA 2YHSA 2GNOA 2HU2A 3LA7A 4NOMA 3I5MA 3BXFA 1IH8A 2ODTX 3ISPA 4TYWA 4CDNA 3LSGA 4XR6A 4YR9A 4JLKA 4YHBA 2I4TA 3L2QA 3IAS1 3DPLC 3T7RA 4H0FA 3NP7A 1W2GA 3EA0A 4XYBA 2X1VA 2V4UA 3BSWA 3WA6A 2ZVQX 5AI8A 3E9YA 5CRIA 3QENA 4O2BB 2EIXA 1J99A 3JPYA 1W48A 1BEEA 4ZU6X 3T5XA 3PXAA 3CB4A 2G0EA 1P9LA 2GF0A 1ZK0A 1NVEA 3BXGA 3WWPA 3NYRA 3LAJA 2J7PD 2JMWA 3PIPF 3BF8A 1RJ9A 3GROA 4L2IB 1CS0B 3G49A 4U6SA 2VDPB 1XC7A 1Z6YA 1C3EA 3CO7C 4P5PA 2AMLA 1X14A 2CUJA 3LHDA 2B1IA 5GPBA 1YZVA 1VL8A 4AVZA 4URYR 4JP0A 1XQYA 4JYAB 5B3SH 2R48A 5C7YA 1V55H 3A4TA 2QR3A 1P1RA 2XYVA 2QTHA 1I6WA 3WDMA 3EVNA 4F3NA 3W2GA 4NAHA 4DKXA 1C4WA 2ZE7A 1YWGO 5EIEA 1GZ6A 5FBWB 2IYSA 4BCBA 1PP8F 2BHRA 1FUUA 4W9NA 1O03A 1KJ8A 1FUKA 2Q0HA 3A6EA 1EK6A 4H31A 1UM9A 1GAWA 2J7KA 4BJ1A 2CLEB 5TQJA 4F85A 4HSTA 4AQYB 3HCDA 4C4TA 2XCIA 4RS4A 4PYJA 4JU9A 3R2JA 3IL2A 1QVVA 3RFCA 3RASA 3HVJA 3MCWA 3PD7A 2CW7A 5KDOA 1E59A 5K8LA 3EWAA 2RHRA 1WLSA 3NUGA 3MN2A 2YBDA 3D54D 4ZYWA 7GPBA 3ND8A 2QG9A 5KTRA 3RKYA 3B7WA 4NCAA 4E7SA 4QX6A 1XDSA 1J1ZA 4M22A 1DELA 5HUQA 3B9RA 3TKLA 1TRHA 2BL4A 1YOBA 4C4AA 5IZCC 3PS9A 4MJ7A 1KMHB 1HDZA 3GZTB 5J43A 3P19A 4ESOA 4KWEA 1VJDA 3PGVA 4M89A 5DSXA 3GVIA 1OQYA 3LDAA 4EJUA 1J21A 1R88A 4G1BA 1FP1D 4FEYA 4CLHA 4YPVA 1JB1A 4UUNA 2ZJ1A 2WKRA 4E13A 4G86A 1SXJB 1O96A 4OHZA 1QRTA 3K1MA 3AOGA 5A3JA 3NBZC 4IQGA 5ER9A 4MV7A 1RZRD 3DBHA