4A6DA

Crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
347
structure length
345
Chain Sequence
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARKGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROXYINDOLE O-METHYLTRANSFERASE
publication title Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 124
structure length 345
sequence length 347
ec nomenclature ec 2.1.1.4: Acetylserotonin O-methyltransferase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF16864 Dimerisation2 Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a6dA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4a6dA02
1SFUA 1INLA 4BY9E 5LLQA 3FMRA 1TQMA 3IHTA 5K0GA 1EG2A 4H0NA 5BQTA 3O3KA 3KPVA 3MB5A 3I59A 5HLGA 3REOA 3TM4A 3HIFA 5LQAA 3GIWA 2Z5UA 2ZFUA 1O54A 3V8KA 2L02A 3DQVC 3SSOA 3F8FA 2ZXJA 1JR4A 3KPUA 3C6KA 4DCMA 3OFJA 3BROA 4KFCA 3M6VA 4CXFA 2LF7A 4IF4A 3HCAA 1WXXA 2P6TA 5GM2A 4IRGA 1P4WA 3EDPA 3TOBA 3TKAA 3KFWX 2QQAA 3OE5A 1UHMA 1L3LA 3FZGA 4E31A 4RTRA 2KKOA 3HRSA 4O5VA 1SG9A 2G7UA 1XCJA 4OMZA 2XVMA 4E30A 1VP9A 3IV6A 1M0EA 1U2ZA 4Q5SF 4JQFA 2NNYA 2P3LA 1SVUA 3E3VA 2KIMA 3KR0A 3LKZA 3BY6A 1XGNA 5D8LB 2ESRA 1NBIA 3FTDA 5CCXA 2OXTA 3FF5A 4HTFA 4F86A 3GZ6A 5T67A 5DD8A 5JHUA 3G2QA 1KPHA 2JRTA 1Z3CA 2D1VA 2XYRA 3T1BA 3T8TA 3SVZA 1WQ2A 5AIQA 2JHAA 4YUVA 2PXXA 5DPMA 4PGHA 4CWAA 5K0FA 3FZVA 1R58A 4FSDA 3OE4A 4HX8A 1HQCA 1L0OC 2Q41A 2FYTA 3QAHA 1O9GA 3GCZA 3HEMA 5DDGA 2CO5A 2ZBRA 1EV7A 2YSRA 2AN5A 5BXYA 3X0DA 2O8XA 3EVGA 2PY6A 2L4AA 3EVBA 2UYHA 3HA5A 1SMTA 3DFGA 5M5BA 5ERIA 3KPYA 3HVKA 5BOXA 3C3PA 2V7EA 2ZKZA 2I6GA 1TQIA 1SD4A 3NW9A 3GLXA 2GLUA 5EVJA 2JPBA 2Z9OA 2CKDA 3BWCA 4QVKA 4ESFA 3MQ2A 5JI6A 4YMGA 3P2IA 2PJPA 1OYYA 3I0TA 3O4FA 5CVDA 3G8AA 4ESJA 4GF5A 5EGSA 3CVOA 2FNPA 4RVGA 4DZRA 4LWOA 3FM3A 1SD5A 2W25A 5L3FA 1EH6A 3M9AA 1FT9A 5D5XB 5EZQA 3OU7A 4BQAA 2PG4A 5KS2A 2PXCA 1U5TB 1RZ4A 3ZMSA 5EEHA 4RGUA 5E8IA 2FK8A 4PNEA 4P9FA 1NW5A 4CTJA 3ELYA 2DPMA 4X60A 2W57A 1KYWA 3HYIA 2OYRA 1QANA 4OIQF 5K01A 4KICA 5D6EA 2DQLA 2YX4A 3OU2A 3PTAA 2ZLBA 5HS8A 2XAGA 4PCQA 2X4HA 3I4PA 1G8AA 1GXQA 4F7ZA 3F8CA 4MTEA 4OQEA 3KETA 4ZYGA 1NW3A 3RODA 3D5LA 5HS7A 4UHTA 1YLFA 5HDKA 2YR2A 5K0LA 4C04A 1BI3A 3LL7A 2P41A 5DSTA 1HSJA 3QP6A 4YFXF 1LDKB 1RI7A 2CL5A 1I27A 3BDDA 4FSXA 1GHCA 3T0YA 3TGNA 5MHTA 2AVDA 3RTRA 4KIGA 3VEPA 3J80K 2EV6A 1BC7C 1QAOA 5GP1A 4MEXF 2O3FA 4HV5A 2AR0A 1SD6A 2AXLA 2YPRA 2O57A 1U3EM 2OD5A 1ZAOA 3HTUA 4RGRA 4MTLA 1T2KA 4Q48A 2M30A 3GFLA 1K78A 4QVGA 3R0AA 1UHWA 5FADA 3FPEA 2HZTA 1I5ZA 4YV0A 4P7GA 3FPGA 4HX7A 1Z9CA 4DQ2A 2QWWA 3B3GA 2ESHA 2VBXA 2FBKA 2P7IA 1MJBA 1QPMA 5JR3A 2VS1A 2MA3A 4UVCA 4XSXF 4OA5A 1ZHFA 4L7VA 2F5DA 5E1WA 4A0ZA 1WSUA 5E2AA 3EVCA 1ZN2A 1YS7A 5TRDA 4LLNA 3O7WA 2NP6A 5EHGA 3E5XA 3B73A 2JH9A 4S05A 2HMYB 2IGTA 3MZHA 2JZYA 3ER8A 2XKPA 4M6YA 2X0LA 5EIWA 4LK0F 3B3FA 4RGXA 2OB2A 5JVTA 3M7GA 2RNJA 4IHTA 5DM0A 2PGXA 2B25A 1RUOA 3PFGA 2R7DA 3TRKA 2VE8A 1B6AA 2P4WA 5E1OA 3S68A 1NW6A 1OYIA 5FD6A 4RX1A 1O7FA 3FMSA 4EMSA 5D5VB 3J81K 3EMBA 1XCBA 1VP3A 3WTSC 3T5XA 1HKSA 4YUXA 2IDJA 5F2KA 4PCLA 3K1PA 3KQOA 1RJGA 3BT7A 2MC3A 3HSRA 4RAZA 3LDGA 3VC1A 2EK5A 5DX1A 3P8ZA 2P5KA 2ZMEB 1X3UA 3CUQC 5LHHA 3M33A 2I62A 2DLLA 3V97A 2EFPA 1R7JA 1AV6A 1YG2A 4PYJA 3SX0A 2FCAA 3DXXA 5LQNA 4ENJA 1KU7A 1BIAA 4LG1A 5ICGA 1ZLKA 1JGSA 1ZRCA 3BWYA 2Q0OA 2BR4A 3EVZA 1JXSA 1W7PD 5F6FA 4KDRA 5LQRA 2BR5A 1Z05A 5IT9K 2ADMA 2XGXA 4UVAA 3T0IA 2C7PA 2Y0MA 2FMYA 2QBYB 4A6DA 5ICEA 4KW7A 4ENNA 5ICFA 2MH9A 1S3JA 1RJEA 4XLPF 4G6DA 4GBED 1ON1A 4PYQA 2NS0A 2QYOA 4BHPA 1UWVA 4P7FA 5BP7A 2CMHA 5KK1A 1P2FA 4NQWA 2CW0F 5E8RA 1ZG3A 2IA2A 1IN5A 5K5OA 5E9WA 4ENMA 2P35A 3QOXA 4MHTA 3KZYA 4B8XA 5CVIA 4N9HA 2QUFA 4A5NA 1P39A 3LA3A 4YG2F 1ONVA 3KEOA 2AOVA 1BI2A 4CKCA 3ZQ7A 5K0NA 5FFXA 5L3BA 3DXZA 2I7CA 5C9ZA 2ESNA 1W5SA 3DXYA 1F4KA 3SQNA 5DTRA 3TO6A 2VN2A 3MWMA 5DX0A 3IWZA 5L3GA 4RVFA 3NWBA 1G3TA 4RYLA 2GS9A 3DEUA 1LEBA 3WSTA 3HRMA 2M8EA 1KYZA 5GM1A 2GXGA 1H1DA 3OZSA 2IDKA 2NAZA 1YO5C 4I2OA 5D4SA 3EVDA 4HC4A 4A0YA 4GO1A 4LFUA 3WE2A 4BYYA 1WY7A 2FEZA 1YB2A 3CGGA 5BPIA 3A26A 6PAXA 3MTEA 2ZZNA 2V74B 4C05A 1ZARA 4DKJA 1PRYA 4RGSA 1T39A 2VP3A 2ZIEA 2ADUA 3Q7EA 2V1UA 2MH2A 4QWQA 3ZMVA 3IRQA 1XB4A 4IPAA 2J5OA 3E7PA 4G7HF 4I09A 2PI0A 4WF2A 3ROUA 5DCMB 2UYOA 4OU0A 2YX1A 5FB2A 2IH4A 2RDPA 1PUEE 3GGDA 1USTA 1PP8F 3A7DA 4YMHA 4AIKA 3FRHA 2P40A 4WXCA 1FWZA 3UJ7A 4U7PB 3WTZA 3M4XA 5LGNA 3UJAA 4Y17A 3FUUA 1TLHB 1PJZA 1SQFA 1SQGA 1SAXA 4CYDA 1U2WA 5CVUA 1RI4A 4JK1X 2UZKA 1SKMA 2PWPA 1J0RA 3HOSA 3UBTA 1IRGA 3CTAA 1KPGA 4PIMA 4PDKA 4KIFA 2PLWA 3LDUA 4H0EA 3RIEA 3I9FA 2PSSA 4LJZF 1BN5A 3IEIA 2HTEA 4ASNA 4LMYA 3V4GA 1YFHA 3P2KA 4HQMA 4E2ZA 3SGLA 2A68F 5E2BA 1REPC 1KU9A 2WTEA 2CFXA 2VT2A 4L9NA 3GRVA 2VONA 1G3WA 4WVLA 1YUBA 1TW3A 3FWEA 5K1YA 1FX7A 4G6QA 4LLGF 3C3WA 3GDHA 5DSXA 2I9KA 3N4MA 1F1ZA 5FCDA 1N7IA 2G1PA 4BAYA 3P2EA 1IN4A 3LA7A 2HR1A 5DV5A 3G73A 5BMZA 1D2HA 1FLIA 1VLMA 3BZBA 1NV8A 4ER0A 2YUIA 3EEYA 1TW2A 3PX3A 2OQGA 1B9NA 4QPPA 2DI3A 5DX8A 1AOYA 3O31A 4RB3C 4RB2C 3ID6C 2OO3A 5EMKA 4Y15A 1XCLA 5FA5A 5CD1A 3QV2A 4YUZA 2XBMA 3UJBA 3S2WA 3FTCA 4TV7A 5JFRA 2JJQA 1E2XA 3GUDA 2XHKA 3QPHA 3KR2A 4RVHA 1JSXA 1YZ3A 3C6MA 2STTA 1J9IA 5HILA 5DXAA 2OZUA 3BUSA 5DLYA 3TOSA 3EYYA 2JTVA 1HKQA 1OPCA 4WXHA 3GZ5A 2H6CA 2COMA 9MHTA 4FHTA 5FUBA 5DUIA 1RJDA 1YW8A 1LEAA 2FA5A 1JQ3A 3VB2A 1ZG1A 4EGZA 3E6CC 2Z6QA 3VOEA 5FHQA 4EM1A 3JTHA 2VXZA 5K5RA 3KQWA 3BWBA 2AOTA 1JHFA 3GFMA 1VQ1A 3SXJA 4OMYA 2F5CA 4AUKA 4RTOA 1I9GA 1KPIA 4QDJA 2QENA 4A5MA 5A2QK 1BC8C 2J5PA 2BH2A 2OBFA 3GO4A 1G38A 3RKWA 4R1HA 1Q0SA 4DCGA 4HBLA 1M6YA 1YYVA 3OFKA 5U4XA 1NBHA 4A12A 5EC8A 2BGCA 1XSDA 2XVAA 2HOEA 5HFJA 2ZWAA 5HDNA 2D2WA 4PYNA 1O3TA 5D5WB 2B9EA 3KP2A 1J2XA 1WG8A 3M6WA 2LKPA 2PJDA 2DQRA 1ZRFA 1R36A 5HIKA 2EX4A 3H3UA 3BXOA 3PQKA 5FLXZ 3JAMZ 4OIRF 4LLLA 4I01A 1TNTA 2H00A 2K86A 4HQEA 3ZMDA 3K69A 1TPYA 1UB9A 3NRVA 1I6XA 3FTEA 3J81Z 1RI1A 4HF2A 1ZG5A 2LD4A 3F6VA 3HRUA 2DPUA 2ZIGA 1UFMA 1DCTA 3G3ZA 1ORHA 5B1SA 1RIOH 5FGMA 3F8BA 1JG1A 2AOUA 3P9NA 4ISCA 2PX8A 3G5TA 3LCVB 4PONA 4L18B 1I1GA 5CM2Z 2FBIA 3CO7C 5F1RA 4GOOD 1OR8A 1IN6A 3GXOA 4HF1A 1B1BA 4MQ9F 4HGYA 2HQNA 5FO5A 5K0BA 3T7SA 4GOMD 1FBUA 5DT2A 2P1DA 2IA0A 2C7RA 4C06A 5ERGB 3DKWA 3CO6C 2BEOA 4CO8A 5GIOE 2G71A 3RYPA 5DM4A 3K1MA 8MHTA 1IRFA 1BI0A 5EMLA 5D1HA 3D0SA 5K8VA 3FYCA 1N2XA 3IC7A 3WODF 1FYMA 2FF4A 2GWRA 4O3MA 1D8KA 4HW0A 4FP9A 3MEXA 3GRZA 2EFJA 4QLCU 3FX3A 2IVMA 4AVPA 4AWXB 1W7PB 2F2EA 3G5LA 1QZZA 1KA8A 4IXAA 4GEKA 1BJAA 4U88A 2QQ9A 1FOKA 2PT9A 1RI5A 4GCVA 3LGAA 1EJ0A 4UV8A 5D6FA 2QY6A 4K6MA 5DTMA 5LEKA 3HVHA 1QZYA 1DPRA 3FUTA 2VDUE 2PT6A 2BYVE 2NYUA 3FXQA 2IH5A 1IZ1A 2ZWVA 2EV5A 4A2UA 1I1NA 3LAJA 1IXCA 2L01A 3WTXC 3FTFA 3D2LA 2PN6A 5KQRA 1XJ5A 1D2CA 1S7AA 4C03A 5E8GA 2NXEA 2AN4A 2XAQA 1TNSA 4Z2YA 1HBXG 2HGCA 1R1TA 4OINF 3OZTA 5C1IA 3BPXA 1S29A 3SZPA 2Z99A 4EQZA 3ZMZA 4HAMA 2BM8A 3GRRA 2PBIA 1VTNC 1T6SA 3G89A 4DA4A 2YQZA 3PQJA 3RYRA 1AWCA 5ICCA 1MDMA 3BJ6A 5FULA 3RKYA 5LHIA 5LQCA 4DMGA 4FT2A 1NW8A 4Y30A 3KQMA 1LQ1A 3B02A 5AONA 5H02A 5L3DA 3DR5A 1MHTA 1U78A 5LBQA 5TJJA 2UWMA 1H9GA 4BHCA 4D0PA 1FP1D 1XSXA 3FUVA 1XTPA 4OA8A 4I7HA 3R6SA 1QBJA 4M9SA 3TPZA 2ZNYA 3WG9A 4A0XA 5FWAA 3HP7A 1HXDA 3BWGA 5E17F 2Y1XA 5LQJA 3KEQA 2GQQA 2G70A 2RVCA 2YXLA 2FRHA 1ZGAA 3SHFA 2WK1A 5LSAA 2QRVB 3DMGA 2YR0A 3EEOA 4IV8A 3PB3A 3RJPA 3ZN0A 2ACJA 4E32A 5D4RA 3SXYA 3KR9A 4MGRA 1P1CA 3CUQA 4GUAA 4PGGA 2E7WA 1XD7A 5DM1A 3A7EA 2EJRA 4R6WA 5DXJA 3JWIA 3CJRA 4LECA 5HIIA 4PYOA 1I1SA 5LR6A 2Z33A 2FPOA 2VBZA 1NT2A 1L1EA 4XCXA 2ZBQA 4HA8A 5J8FA 2IP2A 5EKUA 2V79A 2LNBA 2AN3A 4K2EA 2BE5F 1ZLJA 2WV0A 3FPHA 1I4WA 4YUWA 4NHJA 5HIJA 1IXSB 1SFXA 2FMLA 3DH0A 3JSOA 1SMYF 5EHIA 1U6GA 4CTKA 2DTRA 4HH4A 3WU0A 3R0QA 1T0FA 2K02A 3C7JA 2DT5A 2O03A 3Q87B 4PYIA 3L9FA 2IT0A 4RTMA 1FZPB 2OZ6A 4PYMA 5CCBA 1MJ9A 2ZFWA 1Q0TA 1R5HA 2O06A 3OU6A 4OBXA 2QQBA 4M38A 1JTEA 5KVAA 2O07A 2H94A 4RTLA 3LA2A 3P9IA 1O57A 1F38A 4O29A 4I98B 1ZGJA 4BP3A 1Z7UA 3ECHA 5EMJA 1T38A 3KQPA 1HKTA 3PFHA 4FZVA 2Y48A 3DF8A 3RKXA 2K4MA 2O0YA 1ODDA 5FD5A 4G7ZF 1U8RA 3B3JA 1WRJA 2A3SA 2NXNA 2BBYA 3FPJA 4P7KA 5DEQA 3COAC 2Z6UA 1L9KA 4RSRA 4FX4A 1MZBA 4LWPA 2AZTA 2MBFA 4AD9A 5LRSA 5FHRA 1GVJA 3MHTA 3AWIA 5EIFA 4HZFA 5H6QA 3BPVA 3NVKI 1L3BA 3IKVA 4YUYA 1BOOA 4U0WA 2G72A 2XYVA 1WZNA 2V1DA 1O3SA 5DRTA 1IN8A 4BP1A 3Q9VA 4P55A 1RI2A 3BKXA 2KJBA 5HLHA 2HS5A 2IIPA 3I59B 4I02A 1XCVA 2Y1WA 1ZH5A 2D1HA 4KA4A 4DM3A 3AAFA 2F5FA 2UZ4A 4HSGA 3LDFA 5K0EA 1XDZA 4KDCA 4G56A 3E6MA 1G4DA 3TLJA 5H6RA 4IRHA 3ERED 3UJDA 3CUOA 3TFWA 5A2QZ 3L00A 4XUDA 3ZMUA 1QGPA 3M8EA 3A25A 2LDUA 3V8LA 1DUSA 5LGUA 3ANXA 3UA3A 2OAZA 4EJTA 1KGSA 3MCZA 3DMHA 1W5TA 4EM2A 3LBYA 3R6TA 4RTSA 2OB1A 3G88A 4KRGA 2DK8A 3U81A 3LWFA 1FYLA 4EJWA 4EKGA 1R1UA 2DW4A 3M6XA 3MGGA 3A27A 1AQJA 1JQDA 1WI9A 2WA1A 3P97A 2CWEA 1FP2A 3R0JA 5JUWA 4L0ZB 1HW5A 4QQKA 1OR7A 3H92A 1JG2A 1VE3A 3WTYC 4ER5A 2PMUA 2R3SA 4O6JA 3HCDA 1B59A 5K0CA 3ORHA 4RWZA 3QU3A 3UJ8A 1DUXC 2DBBA 2HKXA 4M74A 4HTFB 4AIJA 5EG5A 2FK7A 2UYQA 2JPCA 3V7CA 1FNNA 2B78A 3GYHX 1O7LA 1W4MA 3VFZA 4M9XA 4XLNF 4V0RA 1OKRA 4N0BA 3V8JA 4U7DA 5HVQC 2DU9A 1NKVA 2H27A 1VL5A 3L8DA 2DAOA 2VT3A 4X63A 4X41A 2UYCA 2IBSA 2EV0A 3ABUA 3B89A 3KHKA 4RS8A 3IYLW 1MGTA 3HA7A 4ER3A 4E2XA 4P96A 4LB6B 2ONZA 1FSEA 2O6GE 2WWYA 3NEUA 5E1ZB 2YX7A 3KZZA 4MTDA 4LD5A 4YIFA 3CLOA 3WGIA 2ZSUA 2E7XA 1KQ9A 3NJRA 4F84A 1P1BA 1DDNA 4CZZA 3Q5FA 1HNNA 5EPEA 1G3YA 3V7RA 4RTJA 1G3SA 1YW9A 2V1XA 2GIVA 3QP5A 3CC8A 2C7OA 2G8NA 3KQQA 3SR4A 3DMFA 1XGOA 2AOWA 4R6XA 1MD0A 4QTTB 10MHA 5HIMA 4CXMA 2EFQA 2RC4A 3DV8A 1KXZA 2IPXA 4M7RA 5D1NA 3T7TA 3F21A 5IKMA 4HDUA 3WTWC 2B3TA 4U7BA 4POOA 4GC9A 4HDVA 2P7VB 4B09A 4ESBA 1KP9A 2VDVE 4GQBA 3MERA 3ABTA 4QPNA 4LG0A 4ZZLA 1BOAA 4CKBA 3I5UA 4M6XA 1ZRDA 2GPYA 1FC3A 1YIOA 4KIBA 3IHUA 3KKZA 2W24A 3ECOA 1Y8CA 5CIYA 1ZQ9A 2A6EF 4PIPA 2NNWB 4UVBA 3VODA 4ZYDA 4HRAA 3LQQA 3CJNA 5HDGA 3FMQA 3Q9SA 2FOKA 2P8TA 4KMFA 3HHGA 4WXDA 1R00A 1F3LA 1R1VA 4KN7X 2OKCA 2Q8KA 4KT5C 2HNKA 3CCFA 3K0BA 2OY0A 4EGYA 4UXNA 4FX0A 5DD4A 3TDZC 4Q4ZF 1JG3A 3K0LA 2HR3A 2A69F 2JHPA 3NTVA 3HTSB 1RNLA 3G2PA 2MD5A 1D8JA 2YTZA 2W84A 1JHHA 4ZTBA 5T64A 2DFIA 2DK5A 3UA4A 3DULA 4CICA 3CUQB 2GA2A 3QRFF 2XAJA 2HEOA 2VBWA 2HWVA 1WWXA 3IRRA 3HOTA 1IW7F 2YVLA 1BM9A 4MWZA 1G60A 3T8RA 5CJ9A 1K78B 2NXCA 3F8MA 3BP8A 2B2CA 2O61A 3EGEA 3ELKA 3HVIA 2HKOA 1YS6A 3KQYA 1H9TA 3BGVA 3LAPA 3RPQA 1LB2A 1G8SA 5FWDA 3HSEA 3DTNA 1U5TC 4XUCA 3LHDA 3RI4A 2E1CA 3J7AO 4E2WA 2FXAA 2HYGD 3TOAA 1FBSA 1F9NA 1M6EX 4EKIA 3J80Z 4YFKF 2KJCA 4PWYA 3IWFA 2VODA 2P6SA 1ULYA 3I54A 4A6EA 5D8KB 3U1DA 1R23A 3G2OA 2PWYA 4R05A 3WGGA 2GAUA 3HUGA 1X1CA 4CGZA 4YIIA 1G6Q1 2BM9A 5K03A 3CBGA 1SD7A 3LQRA 2MLKA 4RV9A 4E33A 3DXJF 5J8CA 3KP6A 4IV0A 3GRYA 4KWCA 4GGGA 2P3OA 5E1MA 2JSCA 2HQRA 5HLIA 3AXTA 1YW7A 1AQIA 3RIRA 3FRIA 1KQ8A 1JE8A 3HM2A 5DCFA 4UV9A 3NQOA 2RKHA 4Y13A 3P9CA 2NNNA 4OBWA 1NV9A 2HWKA 3CJTA 2QZ8A 1FBNA 3K6RA 4KN4X 3EMDA 3ER9A 3E5QA 2ZMEA 3R4KA 5LEJA 3A4TA 1S8NA 1IN7A 2EA2A 4XSZF 5EMMA 2VBYA 3P9KA 2DULA 5EZSA 1XXLA 1QYRA 1ZREA 2L3DA 1J59A 3JWJA 3KCCA 2E1NA 2IH2A 2KW5A 1XGMA 3EETA 3TQNA 1MJFA 2EJUA 3V8VA 4I0AA 5HS9A 2JH8A 1YF3A 3KLOA 2QBYA 5H20A 1N7JA 2GXBA 2PMHA 3NWEA 3B5IA 4PCAA 3GW2A 3FXUA 2M1BA 2XKOA 3E8SA 4X1OA 3ERCA 3TQSA 3SM3A 2RN7A 4X61A 3PFIA 4IVNA 1FPQA 1VBFA 3PLAE 1MJAA 1Z6RA 3TM5A 4RTPA 2ZO4A 5BW4A 3B7PA 1CF7A 3KQVA 3SFZA 5DM2A 2H6BA 3G8BA 2YXEA 1J5YA 1HW2A 2Z6AA 4BXUA 2QVOA 2ONYA 4BLVA 5LRRA 4B17A 2P7HA 4FT4A 5F2NA 3JWGA 2K4BA 4HLXA 3OV8A 4QTUB 4QDKA 3LPMA 2VC0A 3F72A 1CGPA 2FQ3A 4M71A 3THRA 2XUBA 4E2YA 3W6JB 1Y0UA 4WK8F 5FFZA 1V3FA 1RUNA 2LSOA 2EA4A 5IT9Z 2PEXA 2FNAA 2EFNA 2A5YB 2W85A 3EQLF 3GX4X 3DLIA 2GA9A 3PVCA 4NECA 3WTVC 4QQNA 2ZBKA 1JTFA 4UOEA 4GYGA 3W6KB 5CLSA 3DUWA 2RQPA 4L0YB 2G9WA 1O3QA 3NDJA 3I64A 5C0OE 4AZWA 1WXWA 4L9TA 1EIZA 2ERCA 1P92A 3EPPA 1IF1A 3HA3A 3P7NA 2FBHA 3N97A 3U9GA 3BKWA 1KR5A 3LECA 3UZUA 1P91A 5E9JA 2XAFA 1USSA 2ORED 2V9VA 2E5WA 4RTQA 4Q47A 1WS6A 5DCMA 2PV0A 1D2GA 2PXAA 3FM5A 1MKMA 4ER6A 3BJAA 5HOQA 2XYQA 3SSNA 2EFOA 2GA1A 5IH3A 4OIPF 4EK9A 4YFNF 4PINA 4KYWA 3UJ9A 4FT8A 3WTTC 3MCTA 4P7JA 1FBQA 2PLYA 3EVEA 3KP7A 3HSFA 1J7KA 3GVAA 1BBYA 3HHHA 3OPNA 4BHBA 3BGIA 3DOUA 3CKKA 5E8JA 2ZTHA 3WU1B 4ER7A 2ZCJA 3UFBA 2MLGA 1BKYA 4WX9A 1V4RA 3H3ZA 5E20A 2NP7A 7MHTA 5CVJA 1NW7A 4L9JA 1EAMA 5GWXA 2IBTA 4AIHA 1NE2A 2P8JA 4HLYA 2DPDA 5D5UB 1UIRA 1B9MA 2QLZA 3LBFA 3ULQB 2P3QA 3E23A 3E6DA 4MNUA 2H11A 1KHHA 3C1DA 4BLWA 1LNWA 5E1XA 2IA1A 4EV0A 4ETSA 1O3RA 4HGZA 3L2CA 4GOLD 3VYWA 4M9ZA 1K7AA 1HW1A 4MEYF 2FSWA 1JQEA 2NXJA 4LG0B 5T6BA 5CVRA 4HYEA 3H2BA 5LGTA 5CVVA 4LGWA 2R6ZA 3HNRA 4BH9A 3FYDA 2C7QA 3VC2A 1G6NA 4MIKA 5E1BA 4C07A 3PS9A 4YV1A 2P5LC 2ZCWA 3FUXA 3NMUF 2YXDA 4P9UA 3LX6A 1YTYA 1ZKDA 3GFJA 3KQSA 3O6BB 2CWWA 4PZJA 2O05A 3GO5A 2ETHA 4RVDA 3JWHA 5G02A 3M1EA 3O2PE 2ZNZA 3JSPA 2CSOA 3QOPA 2HYFA 5BW5A 1L3CA 2WC2A 3KP4A 5DYMA 2F8LA 4YV2A 3ZPLA 4ATNA 3DPTA 1QO0D 2PQ8A 4FGZA 1FSHA 2ZW9A 4CDGA 1R22A 3F23A 2AS5F 4S04A 3AJDA 4HX4A 5E1DA 3FHZA 4MHGA 1GXPA 1QAMA 3GEZA 1EH7A 5FA8A 2O0LA 3FXRA 1PDNC 3GRUA 2CQKA 1STZA 4GYIA 1FYKA 3UWPA 4M36A 4L9VA 3LCCA 2ISYA 4UNOA 1QAQA 3E6BA 5FTWA 4R8HA 5FQOA 4R79A 3HCCA 3CDHA 3MAJA 2ZVJA 4JBAA 3ZP5A 3KPJA 5E9QA 4GOND 2OA4A 4JXJA 3UJ6A 1EH8A 4IKPA 2IRFG 3MTIA 1XDUA 3I53A 1LDJA 1X19A 3KLNA 5CVEA 5EOVA 2GZWA 3OOPA 2K7LA 4FS8A 2A14A 3TO9A 4M73A 2PVCA 5DTQA 3MFKA 4V0QA 3PX2A 2R7FA 1T98A 4IJAA 3K9TA 1XGSA 2HTJA 2ZJ2A 5ILVA 1DL5A 3HCEA 1Z6TA 3ELWA 5DRYA 1R6AA 2AOXA 3M6UA 3PT9A 2IJLA 1XMKA 4C08A 1G55A 2AOTB 5J6XA 3JAMK 2C6YA 5FLXK 4EJOA 4UUVA 4BNCA 2XIGA 4EJVA 2LF8A 3F8NA 5BS6A 1KU3A 3C18A 4U0YA 4G94A 4EVIA 1XDSA 4MQVA 4CHUA 1BI1A 3G7UA 3KR1A 1NHAA 2L54A 4EJUA 2PBFA 3CJQA 5LHGA 5K5QA 5GOZA 2M5WA 1BHJA 2ZZKA 3P71T 2WA2A 3HCBA 3LFKA 2OU2A 4LK1F 5KVRA 1IUYA 3KP5A 1K6OA 5GINE 1P4XA 1A04A 4KDPA 3GNLA 2OQRA 2UXNA 1O9HA 5P8WA 3EGVA 3BWMA 3F3XA 3NDIA 2EJTA 1P6RA 2CMGA 1EJ6A 1RI3A 4DF3A 4NB5A 3RPUA 2OBPA 3TO7A 2JT1A 2VOOA 4G7OF 2FE3A 5HEKA 4ENKA 3TMAA 2XRNA 5EEGA 3THSA 3ISPA 2L4MA 4L5IA 3NVMB 4PYKA 1V39A 3IL2A 3QU6A 4XUEA 2M45A 3ZMTA 1TQPA 4GXOA 1SUSA 5FQNA 1D5VA 2F5EA 1S7OA 3ELDA 5BPDA 4OIOF 3G2MA 5ILSA 2AOUB 1VIDA 3DP7A 1B4AA 2K27A 1XMAA 4ZYHA 1TBXA 4R8RA 1SFEA 3ME5A 1XN7A 1T43A 5GIPE 5K0JA 1CF7B 2G7HA 4RAYA 2BV6A 5F64A 3ZN1A 2H1RA 3LSTA 5K05A 3EUHA 1PP7U 5CUQA 3K1NA 4ON0A 4R8SA 4KUMA 2STWA 1OMIA 3FUWA 2NYXA 2CG4A 1F5TA 4IWNA 3K2ZA 3KP3A 3V7SA 1JG4A 1LJ9A 1D3YA 1W7PA 4C4AA 5KYGA 2H09A 2ZULA 3I58A 1P4AA 5DUKA 4G8XA 5ED4A 4WCGA 2ISZA 1X1AA 2AS0A 2XAHA 5ILUA 3SSMA 2JG3A 2A07F 1TTYA 2TDXA 2EB7A 2CGPA 4U0VA 2BR3A 2OPBA 2HV9A 3MZYA 2RGVA 1IAWA 2ZBPA 1DPUA 3OZRA 3MAGA 1AF7A 2XROA 3LKDA 3TDUC 2M87A 2DO7A 5HZMA 4M72A 2VC1A 2EG5A 4BLUA 4N9IA 4G9YA 3HTXA 3VSEA 2FHPA 1E17A 1R8YA 3KPWA 3BJOA 4RB1A 5LQUA 2KIFA 5E18F 3EVAA 1U5TA 3I71A 1YQAA 4DNCA 2BZGA 3GJYA 1Z91A 3R9XB 1IM8A 1Q1HA 4LB5A 4OX9Y 3KQTA 1UCRA 3EYIA 4AZTA 1R8XA 3R3HA 1R18A 2KIUA 3OCJA 3E5UA 1B42A 3T7RA 2N47A 4HV6A 2FU4A 1DP7P 3R24A 1QNTA 5KQSA 5IT3A 1KQ0A 2V6CA 4XBFA 3SMQA 4AZVA 1R74A 3KU1A 3R61A 4IRIA 2UXXA 5K09A 5HOOA 5AIPA 2PFBA 2EWNA 2IPQX 1XVAA 3IKTA 1L3IA 1EQAA 5L3CA 2PX4A 2VE9A 3F4KA 1MDMB 5L3EA 1H0MA 2GAFA 2QM3A 1ON2A 4ZZDA 2VOPA 2VZ9A 2YU3A 1ORIA 1XSVA 3GFIA 2GB4A 4RB0A 2IFTA 3WE3A 2Y75A 3ELUA 3GF2A 3MQ0A 1KU2A 2QRVA 4OQDA 3KE2A 2K4JA 1KIAA 3SZTA 5EQJB 3E97A 2PKWA 2CYYA 1YFLA 3L7WA 1HSTA 2P5VA 1LDDA 3F6OA 1X1BA 2ZIFA 2ELHA 4EQQA 4GC5A 3F22A 3C0KA 1BC5A 1FJXA 3LCUA 3TKYA 2EFWA 3JW4A 4P58A 1QQIA 1UFKA 2KRFA 4HG2A 3AY0A 2NRAC 4MQ4A 2B0LA 2AVNA 1IXKA 1JSZA 3BZ6A 4M37A 3M70A 1LVAA 4KNYA 2XASA 2A61A 1S6LA 1BIBA 3JTGA 1FY7A 1YFJA 4EM0B 3AXSA 3L09A 2D45A 4I0BA 1K79A 4IHSA 1IXRC 2HFHA 5EKXA 2VDWA 3M8FA 2PX2A 1J75A 2HTSA 1C0WA 3EVFA 3QOWA 4ZH4F 3U2RA 5LQKA 3WGHA 4U7TB 2Q2EA 3GWZA 5F2OA 3ML6A 2OZVA 2Z3YA 3HRTA 3RDIA 1HMYA 4AZSA 4PYLA 3RW9A 5DWQA 3FPFA 1OYWA 2JHCA 1X1DA 3GU3A 4RTKA 4ZYEA 1VPTA 3DLCA 4HF0A 2A6HF 4E70A 2P7CB 1RJFA 2GH1A 2QE6A 2XVCA 4Y2HA 2HDCA 3C3YA 4HOBA 3EGIA 1WKMA 2XV4S 1SUIA 3DPLC 2RV8A 2ZZMA 3HVJA 3QPTA 1R5GA 1ZYRF 2IW5A 3E05A 4DQ0A 3BGDA 3HCFA 1IY9A 3WTUC 4CKEA 3R60A 4RTNA 3UJCA 1Z1DA 4L5JA 1YZHA 4WWCA 3BOQA 2PX5A 4P5OA 4KVZA 4FR0A 4OOIA 3TR6A 4AX8A 2FRXA 4XRFA 4F85A 4KMUX 5CYVA
chains in the Genus database with same CATH superfamily
1K83J 1NQ5A 3MRSA 1LJ8A 1TQMA 1TD1A 3A4MA 2RK4A 1ZU4A 1WUTA 4A3BJ 5LQAA 3B51X 2IYEA 4LMAA 1KEWA 3AP2A 3IAXA 4D1QA 1XZKA 4QUEA 2RGWA 4BZQA 3AGQA 3OFJA 2FPXA 3FMFA 3LVQE 1RXVA 4G4GA 1HDPA 6LDHA 1UKYA 2ELKA 2QJFA 3U4MA 3CLKA 2PMWB 3N1UA 2LCFA 1CUSA 2K9QA 3M3DA 2NNYA 2JA6J 3L06A 1T24A 2RGNC 2YZ7A 3MJEA 1W46A 3RHFA 2PSHA 4HNAA 4F86A 1XZIA 3QBEA 5I5EA 2F43A 1UKAA 5H81A 4NCAA 3SVZA 3Q7RA 3W9SA 2C82A 5IZCA 4CWAA 4GU5A 1T8RA 2A0KA 4QGGA 3ZDFA 4JC5A 5BXYA 3X0DA 5M3BA 3E9EA 3GYBA 2A0UA 5HXAA 4C22A 3KPYA 2J08A 2H4XA 5EFZA 4J01A 1L5FA 1YO6A 4U6SA 2PJPA 1P5JA 2GN0A 2ZRQA 3JPYA 3FSJX 1XVLA 3OYBA 2XZPA 4QYIA 3OU7A 4U7GA 2R5YB 1TT7A 1ZMRA 5K8JB 1E9BA 1NNUA 4JB2A 1DJOA 4YWHA 2DPMA 3U0BA 1KYWA 2X4LA 4G8DA 1BZYA 1R71A 4UAGA 4WBNB 2AHRA 2QZSA 2J6BA 2ZLBA 4XB6B 1GQ2A 5F9MA 4NYMQ 4JYZA 1KFCB 5JWRA 4OQEA 5CQGA 3RRYA 4CRWB 1BI3A 4P1WA 1A6QA 1LPMA 1I2ZA 1V47A 4K1XA 5F5LA 2HSWA 3VPXA 3T0YA 1PQPA 1M72A 4KIGA 3J80K 2ZCUA 2CXHA 1B41A 3VZCA 4OY3A 3SC3A 2M9MA 1LCIA 4H0FA 3TNDA 4YGYA 3K4BA 2PMBA 4TMWA 1GG9A 4BBAA 1CC1S 1UHWA 3ZCSA 3HRIA 1E7MA 2JASA 2GVDC 2ESHA 2VB6A 4GYJA 7REQB 1VGVA 2Q50A 4UVCA 2WLTA 1XYGA 4EZIA 3KB2A 4X1EA 3G1MA 2CH0A 3O8CA 1QRUA 2LR0A 4IJ6A 4UM8B 4WL0A 4A3GJ 1VG0B 3L1HA 1EFDN 2XYPA 5AVRA 3SSAA 1RWPA 3UCEA 4OHYA 3BE4A 1TYAE 5ETJA 3OZIA 1J33A 1WMAA 1NWCA 5JJBA 1OYIA 1G8JA 4M86A 1A7JA 3J81K 1TU3A 3N6VA 1KWKA 2IHBA 5KI6A 3UXEA 2ZJ1A 2WHYA 3HXMA 2AL7A 2GJ9A 2TRTA 1T1JA 4S3MA 4LFBB 3P8ZA 4E7JA 2EFPA 4PPYA 5JZMA 4HSTA 1E3DA 5F6FA 5DF1A 2WNIA 2W2KA 1Z05A 1L4YA 2Y0MA 1Y4SA 2JLBA 2VI5A 5ICFA 3MK31 4YRMA 3PHIA 4PYQA 3C6ZA 3PUZA 4EITA 2PQ6A 4C5AA 1Z8DA 5K0NA 1VLQA 5L3BA 2VCHA 1U8UA 3AKYA 3SQNA 1AVTA 1LGYA 4O2AA 1PG2A 4FOPA 4RVFA 1AK9A 4BO8A 1LEBA 1Z0AA 4J7CA 4J3JA 1K9SA 4FJ2A 3EVDA 4A0YA 2JZCA 2FSUA 4EARA 2XGGA 1JZQA 3TZ6A 3CNOA 3QKIA 1E2KA 4C05A 3UJNA 2ZIEA 1XZDA 3Q7EA 4RVNA 2HA2A 2XKAA 4JYCA 1JEQB 4YR7A 3EVTA 2W6ID 3I37X 1V2GA 3R6DA 1JECA 2YX1A 5LPNA 3F9CA 3GGDA 5JADA 1WMSA 3PC8C 4QELA 3GVXA 1KJIA 4M3FA 1L4NA 3D8HA 4KKVA 2O8DA 3UJAA 1X7WA 1YI8A 1ODFA 3CLUC 2DUWA 2WUDA 2IXSA 4J94A 2KYRA 2VR1A 3NT4A 1IHOA 4XYBA 3ANSA 1G8XA 5HE8A 5EZHA 5HVNA 4JJ4A 2X3YA 1BE6A 1UXOA 4NENA 2V9ZA 1BN6A 3K1YA 3A1VA 5C37A 4IL6C 5BQPA 1OHHA 2L17A 2X2OA 2JFHA 3G3EA 4DHEA 4G6QA 1E1NA 3C6BA 2MSYA 3CDLA 4OXIA 2CD9A 2D5LA 3JQAD 3QYEA 1JKJA 3OAAA 1EFVA 4W5QA 4DW8A 4A2CA 5DX8A 5AK3A 3M2TA 2MD0A 4JLJA 2RNGA 5CD1A 3DBRA 2JJQA 4JROA 1ICEA 5L7TA 5FTLA 5FUWA 5TMBA 1KMNA 3PTLA 2QN1A 3TPCA 5JZ9A 4TL6A 1JHZA 4TS9A 3TSOA 4ODIA 5DUIA 1BFKA 4G5YA 2GVZC 1YCGA 2HO5A 3ET5A 2GM4A 4EY5A 2ODTX 1UAYA 1L5YA 1DEKA 4BNWA 2ZB2A 2QE7D 2WKWA 1PNRA 3OQVA 3H5OA 1QR2A 2LPMA 5F3RA 2EP5A 3L1KA 1AA6A 1W4CA 1F9AA 2PX6A 2GBYA 1D1CA 4A12A 3T7DA 3BJRA 2HOEA 4XLAA 1IGNA 1FU4A 2XZTA 3RFUA 3W2VA 4UUOA 1K8RA 4DYHA 1R4MA 1RACA 2PJDA 1BDMA 1VXOA 1JTVA 2RGGA 5FBZA 3SC2A 2CVFA 4Z7OB 4IG9A 4NDNE 3FGOA 1UJ5A 2DRIA 2VJCA 2YRFA 4CZCA 1U2RA 1XJ0A 1DCTA 3P7MA 4YRLA 3QENA 1SXJA 4RLQA 1U6KA 4OHUA 1QUEA 3JYLA 4QPCA 1NI4B 1Q19A 3S2GA 5IKEA 5GJCA 1ZM9A 3IDZA 2B6HA 4KYUA 5JT1A 4FN4A 3WOVA 3U7FB 3QPSA 3A02A 2YKGA 4RY2A 2HD4A 4Y0NA 1CY8A 4O2AB 2F2EA 2KJQA 4IXAA 2EKZA 2PT9A 4XI9A 3B5EA 5JNWA 2IGBA 5GPBA 4UV8A 2QY6A 5L3VA 1JSRA 1MBFA 2YRWA 5M3MJ 3MGCA 3FXQA 2F4MB 3AEUA 2VOJA 5FOUA 3WGYA 2W2OA 3HXPA 4FE4A 3DKXA 3B1ZA 3UYKA 4UE3S 5EUCA 3ZDBA 2WB4A 5GONA 3DE4X 3ROFA 3TSAA 1ZK4A 2YNMA 4P36A 5IWAB 4OQ4A 5MGBA 4DLWA 2CQXA 2GJSA 1LKXA 1EEXB 5FULA 3QBJA 4D5FA 2DR0A 4QYXA 4ZVTA 1BVHA 1JZTA 1EE2A 4D0PA 1FP1D 1E32A 1XTPA 3MZ0A 1IHPA 1U7UA 3F3MA 2ZNYA 4MUKA 5LDGA 4L1KA 3AR2A 4HQOA 3EEOA 2Y9MB 2FWRA 1UADA 4ALJA 2POCA 3CJRA 1JJVA 1ZOIA 1JFRA 4MVJD 2A5WA 1CQXA 3HBAA 6AT1A 1CNEA 4LBVA 2C07A 2BFEB 4ZOCA 4M8NE 3FPHA 3HFRA 4QFCA 1A9OA 3V48A 1TYZA 2QTBA 1K2WA 3HG9A 2IKSA 2AF4C 1ACLA 1BHSA 4JS0A 2QL7A 2X6RA 2R00C 1R5HA 4NYIQ 1QVZA 3AHFA 2YFHA 4YT8A 5KNDA 2B21A 1RSZA 2CQNA 3K32A 2YWCA 5FOQA 5KIAA 1Q5PA 3SZGA 3HJFA 3Q3GE 5FD5A 3B3JA 4TQAA 1GKKA 1RLIA 3KSDO 5K99A 3WK9A 2QYHA 5DEQA 2MSLA 1MZBA 2AZTA 5FHRA 2WFLA 3R3ZA 3AO0B 2XNSA 1S2LA 1FLNA 2XYVA 4FI3F 1IY2A 3HL0A 3IUPA 2Z4RA 2J4DA 1R0KA 4MUMA 1ZWKA 3DDZX 3RU9A 1H1LA 4IRHA 4N03A 5FKKA 4C3VA 3L00A 3A2KA 3ANXA 4Q66C 2Q3JA 4OF4A 4AW9A 2G5CA 5EVCA 1QMPA 2W6JA 4FDTA 4QBFA 3A27A 5LD2C 4XKCA 2WA1A 2QTTA 2VYND 3SFTA 2G9NA 5IEJA 1QRAA 1OX5A 1QRRA 4NMMA 2OENG 3HEAA 1W4MA 2PYIA 3GR6A 4EJ6A 1FS6A 1HDGO 1BX0A 4NOJA 1T6YA 1P7JA 5LB2A 2BY4A 2ZJFA 2EQRA 4M8IA 1DINA 2ZB7A 2JPDA 1M33A 1KQ9A 3KZXA 1ODLA 3L2VA 2WJWA 4EI8A 1U0OC 3CUVA 3QLEA 3WNDA 2R5WA 3E27A 3QVJA 3JRBA 2YWGA 3HCPA 1FP4A 3NU1A 3TE6A 3KOUA 3AEUB 3V46A 1N1EA 4GC9A 4LF4B 2JFOA 2DPYA 1ZN9A 5GONB 3Q41A 1BX1A 4ESBA 3AKEA 4WXRA 1ZRDA 2W24A 1ZQ9A 3H0EA 2V4JC 4TXJA 1FNSA 3L8HA 3LQQA 2JKYA 4DMLA 1ZXLA 1KDOA 3S2HJ 2FOKA 2P8TA 4LX0A 2X1MA 3AHIA 4YJ2F 7YASA 1C9EA 1WPGA 2FG6C 1GPYA 2WMYA 2V4UA 3OA0A 2C9MA 4HDQB 2K9MA 4R9NA 2HR3A 1XRRA 1KI2A 2JS7A 3WWDA 3WWCA 4WACA 2BMWA 1FOEB 4NCNA 3NHMA 2COUA 3HB4X 1V9SA 1R6VA 2Z2ZA 4EJ2A 4MWZA 3GFRA 4X00A 3WLAA 4IDFA 1PYVA 2WWGA 1C0EA 1KFBB 4B4VA 1HLPA 3V8EA 1G8SA 5FWDA 1LVGA 3DTNA 5LOVA 4GR4A 1GRQA 2AFIB 4L4UA 4GXNA 3I42A 2V5VA 1UMDA 1F8FA 1KH2A 5EUMA 2DX7A 2BP7A 5K8LA 1D2NA 4TYMA 1NXVA 2ZYWX 1DKPA 1SD7A 3VPHA 5J8CA 3OR1C 4FW9A 3QSGA 2QLBA 3V42A 3CLTC 5NLLA 3ZDZB 3QYBA 1FQJA 1K7SN 4CQJA 2RKHA 4RV4A 3RTEA 3R0ZA 3K6RA 4N6OA 2ZMEA 4MQLA 1R9MA 1KO1A 3MYRA 5EMMA 1W0CA 1LFBA 1VECA 3MMYB 4V24A 1NVGA 3UT5B 3HDHA 2GEKA 1H22A 1REQA 2WFLB 2ZSEA 3CX7A 2ZJYA 1WR8A 1N7GA 1JUDA 3ERCA 2X6TA 5L45A 2C4NA 4IVNA 5TF0A 1QK4A 2O8KA 3PNMA 3BWEA 3DHYA 5BW4A 1U2TA 1MBGA 1H1LB 3LVRE 1BJTA 2Z6AA 4XYGA 1L7PA 1FTSA 2I5PO 1MFZA 1U0EA 3HKEA 1WD7A 2B82A 2H7XA 2W85A 2VKEA 3RV3A 1GILA 1C1XA 1RZUA 2AHOA 3GJZA 2IHJA 4JH0A 3BWVA 1HLGA 3JYNA 1ABBA 2PKQP 1E8DA 1E2LA 2DFHA 3K3PA 4ZVKA 3GB9A 3BQYA 3TR0A 4NBSA 2EFGA 4GG1A 4ENSA 3EVEA 4G1UC 3JQ8A 1BBYA 2ELJA 3OS2A 1T1SA 3UFBA 2BZ0A 1Q1QA 1WOMA 4B4KA 1PUIA 2ZBFA 3B6KA 1PK9A 2GZHA 1U3UA 4TLEA 2OHIA 1FP4B 2VF5X 1F17A 1W1IA 1Z0KA 3EZLA 3QWHA 2MGQA 5I8ZA 4GX0A 3TBHA 4W5NA 3JZAA 1HW1A 2VBIA 2NO5A 4EO9A 2Q6VA 4DV4B 1SCBA 5CVRA 4XUGB 5EIHA 4CEHA 1QHIA 2RBEA 2C2MA 3MKLA 3TBIA 3DTIA 4LNUA 3D3WB 1YR9A 1JHXA 4KC0A 4IQ8A 3WBJA 5CEJA 3RIHA 3TRHA 2WVGA 2XIQA 5KTNA 4AIIA 2ZYRA 5A5EA 3QUQA 3UICA 3DDWA 4BRUA 3F1LA 3QOPA 1RBMA 1KY3A 1C2TA 3DPTA 3ZHXA 4L9WA 1O58A 3AJDA 1JP7A 2GXAA 3KLMX 1V8PA 2OYCA 4IIDA 3GFBA 2O0LA 3FXRA 2C3OA 5MF6A 1D2MA 1DKMA 1RXWA 1WU7A 4GYIA 2Z1MA 2V7QA 4L07A 1NVFA 3CDHA 2ZVJA 5DCYA 1FS4A 1VJRA 5EOVA 2ES4A 1UMDB 1DIGA 2A14A 1R5OA 5TDHA 2TECE 4QQ8A 3M6UA 4J0DA 1IQRA 1D09A 5L7WA 4BNCA 1YMQA 1TEHA 4EJVA 3K0AA 4IMPA 3WGZA 4EA6A 1WKCA 4OKIA 2LF8A 4U63A 3KM0A 3AR4A 4B9AA 4BVAA 4YMTA 4BMCA 1J56A 5HJ5A 5EJAA 2EILH 3ZCVA 3RU7A 5KVRA 4LK1F 4C20A 3MWEB 2UXNA 4YQZA 6Q21A 2DQZA 5P8WA 3NDIA 1HQDA 2C2OA 3ZJYA 4AKTA 4DF3A 4Z8YA 3L1IA 3RPUA 3ZCOA 4Y6RA 3RSGA 2QX9A 5GZ1A 2JLZA 2UUBB 3NVMB 4PYKA 1REQB 2GM5A 3LUKA 3PR2B 3V1NA 3EC7A 4A15A 1V1JA 1S7OA 4M0LA 2RHCA 2ZAIA 5FJ8J 4UFPA 4YRQA 3URMA 4A0FA 3X1YA 1P5FA 2JZOA 1QWOA 3FB4A 3OX4A 3PBKA 3AKDA 2QN2A 1LVKA 2X13A 5BWBA 3LXUX 3LSIA 4YAEA 2OFXA 1UKVY 2JGMA 3W5VA 3R75A 4MP3A 1XI2A 3WMWA 4YAIA 1JI3A 1NF3A 4KPEC 2Q8PA 4IHJA 2GNAA 2XCQA 5JSYA 2AS0A 1VNDA 1ESEA 1TQ6A 3IQWA 4M3BA 2J9ZB 1EZ4A 3NZEA 4Q16A 4ZAVA 2P3SA 2HV9A 1RFLA 2GK6A 2W9XA 4XW2A 4ZTZB 3I9OA 3BIFA 4N7JA 2HZDA 2FHPA 4MKZA 3QBVA 4J90A 4BC0A 3WDKA 3EJWA 1ISPA 1POXA 2ZYGA 4MMZB 1N3BA 2VL8A 2ID9A 1G64A 3R3HA 3SFIA 3B12A 3DO5A 3FUCA 4C0HA 2VUIB 1VKNA 1KQ0A 4MB2A 5EJMA 1KJWA 2XQIA 2QVBA 3RHZA 3N70A 4MFDA 5CFNA 1YOBA 1BKSB 3IKTA 3F4KA 2QTWB 5JLWA 5F3WB 4DIMA 4CCOA 3ABRB 3WE3A 2O8CB 1GAWA 1ULTA 3BR0A 1JYSA 3CR7A 1BS1A 4E7HA 2ZR0A 2I0FA 4EQ6B 3NDBB 2CXOA 2Z9BA 2XB8A 3B9RA 3DF9A 3R0XA 1G8YA 5IBCA 3RLFA 4G0MA 2VNKA 2VQ3A 4L78A 1CUFA 3NHZA 4V03A 4WEOA 2R5NA 3NHYA 4LRSB 2KLBA 4IHXA 3EEQA 3L4KA 2HFHA 3TFOA 4K2HA 3EPHA 5LQKA 4XARA 1FF9A 5F2OA 1U8YA 3RDIA 4HK4A 3CCRI 2JHCA 5A6SA 1XVTA 4E70A 1QKJA 1KWGA 3VZSA 1G8PA 4CG3A 2HHCA 1R5GA 5C51B 2F59A 3PUVA 3HCFA 2JIPA 4YRNA 3X1KA 4GZ3A 2BFNA 4O2AF 2DECA 2L0XA 1KKLA 4KQ2A 4O1HA 4R2KA 1UBKS 4K9LA 1QZEA 2GEUA 3TFQA 3TUJC 3H6GA 4BY9E 4B3HA 5CDFE 1J2JA 4G8CA 1KQGA 3QWFA 1E60A 3GPCA 1C7EA 4P3OA 4INAA 3DQVC 2I33A 4FZ3A 4N0QA 1DC6A 2PSJA 1ETOA 4EF4A 4KFCA 1G5QA 2P6TA 4YLYA 4MGKR 3ZLVA 3TOBA 5IP7J 1KU0A 3K2BA 2W90A 3K0FB 4E31A 3UUWA 2P6MA 1PS9A 2QXTA 4W82A 2JRMA 3N86A 4DREA 2DWOA 4I99A 3I9LA 3IAAA 1XGNA 2O2CA 2ESRA 2LR8A 5CCXA 4XYMA 5F33A 1B8IB 4BKMA 1YKFA 2HA5A 3IOCA 3GOQA 1I3QJ 5A62A 1QXSA 1DTSA 1CQTA 3LP5A 2JHAA 3RRFA 2PXXA 1R58A 1QGDA 4CIWA 4YWJA 1R0YA 2WM3A 4WOBA 3K09C 2A0FA 3GCZA 1PFKA 4NBUA 2WU3A 4B6SA 2QD3A 4DYVA 4IHJB 4L5CA 1GGNA 1HG0A 2GPBA 1V37A 4U3JA 1V35A 3LLCA 2JPBA 3BWCA 5IYDJ 1S89A 1MJHA 2VXCA 3P2IA 1ZK1A 1V3UA 3M8KA 1DWUA 3M3HA 2YWBA 4N9WA 3KZMA 4CE6A 1ZRNA 1DUIA 1CXZA 4S1OA 2HYJA 3AEYA 5MGNA 1VLLA 4MFEA 1XU7A 5MN6A 3M34A 5D6EA 2BY3A 3HO6A 4X93A 2ZRNA 1XEWY 3IQDB 3BD8A 1QSGA 2I6TA 1NW3A 3KL4A 4NSNA 5EXSA 2W48A 5CIQA 1UFRA 2DDAA 4FK8A 1U8BA 1VJ5A 2QL6A 3ZCUA 1CFJA 3EFBA 3EQZA 5GP1A 5AIAA 1T2KA 2LDBA 1YWGO 2P4UA 2M30A 3QKWA 4MZXA 3U4GA 1JHRA 2C2XA 2IEIA 1YDGA 5FX2A 4MHOA 1FYVA 1E2FA 2KBFA 1IDYA 4RNCA 2VCEA 5JOQA 1QPMA 1RAFA 1LQUA 2XW6A 1MV8A 4DYQA 4GPIB 1QPGA 3L04A 3BMQB 2BY1A 1X2NA 1WD5A 3J81k 3E48A 4KXFB 2HJVA 1I3LA 2RNJA 2BEVA 5DM0A 1GO2A 5A6SB 1VBKA 4H60A 2LCQA 3TJZA 4COKA 3RK1A 5BV8A 1W4ZA 3PUFA 1NH3A 1VP3A 4PV7A 1OQAA 3NB0A 3PXDA 4P4LA 1HKSA 1XCMA 2SCUA 3QLUC 2K3PA 3R3JA 2OPTA 5DX1A 4FYIA 1HQKA 4LISA 3QVOA 4K28A 2G5PA 4UUAA 1F0NA 1TQDA 2Z2JA 4M3DA 1G63A 1KI7A 3TLCA 2Q0OA 1QHNA 1JXSA 4C89A 4KSBA 1YQ9A 3HXKA 3ZV6A 1XF1A 3T0IA 3M1LA 3CIFA 5A7GA 5JPCA 3TO5A 1FSZA 1U0FA 3E0JB 3BF8A 2A0YA 2FR8A 5GONF 3JASB 3ZNOA 1Y6ZA 1RWKA 1Y4UA 4RFSA 3CF4G 1WXIA 4JEUA 3G0DA 2ECKA 1DV1A 4OGKA 1MC5A 3KEOA 4TROA 5IAOA 1UP6A 2BKVA 4WD3A 4BECA 2IE0A 4MYHA 4HEJA 1I80A 1TYCA 3RS7A 4RYLA 4P54A 2CJXA 4LYJA 3OQ1A 2NG1A 4LFUA 1TWGJ 4LUCA 1M1UA 4C2BA 3X2QH 2CBGA 5KTYA 4BO2A 4XICA 2V1UA 1UPAA 3DKIA 3IRQA 3DSRA 4F0JA 4XLEA 3P5SA 2JWTA 4RL4A 1XL0A 4NMXB 4Z51A 4GKBA 1U9CA 4NC9A 2H4HA 4K9MA 4J8PA 3R7WB 1CEXA 2WHRA 3ANLA 4AJNA 3L49A 4C29A 1N5JA 1LBQA 3N2IA 1D3AA 1AXEA 1REPC 5E2BA 3BC1A 4KE8A 3A31A 2Y9PB 4KO1S 3EAQA 1E3MA 5CLLA 3PKJA 2B99A 3OMLA 4PG5A 2YOHA 1F1ZA 2G1PA 1OAKA 3LX8A 4KTTE 5BYJA 3K9FC 3ONFA 3G6EI 4GHWA 5FP0A 1CRQA 4JI1B 2VPPA 3B2NA 1XX5A 2YC4C 3QV2A 5CGQB 3FTCA 3TZHA 1E2XA 1RR8C 2OMEA 4WX2B 3KR2A 4C6HA 2I5UA 3WGNA 5HG0A 2N9UA 1N6OA 2GPSA 3C3CA 3DE3X 4RPGA 2PLRA 3W8DA 5C2JB 3H11B 1B8NA 2GNOA 1KVTA 4TMZA 4HNVA 2DPXA 1M2VA 5M3FJ 4EM6A 2GBLA 4JU8A 1ZG1A 4ZMRA 3JCZA 2PG3A 4JNCA 5FJJA 2DA3A 1A98A 4UOZA 1WW2A 3NAGA 3GHYA 1JHFA 4LDQA 4NC6A 1CUIA 4QJBA 3BHIA 2BH2A 1WSBA 1H94A 5F76A 3OE1A 2H54A 1EIWA 2NM0A 2ZIUB 3HBLA 1OVMA 1R0LA 5BYAA 4LYYA 5KOIA 4Y2VA 5HDNA 3GJ5A 1EYZA 3ND7A 4HEQA 5AK5A 2DWUA 1YR3A 1R36A 1A9PA 5I8PA 3BXOA 3UB3A 1U3FA 3WC4A 3WG7H 3O2NA 2ZYIA 3KSAC 5CURA 1LF0A 3FTEA 2AJTA 3DFZA 4M99A 3VR6A 3G3ZA 4FYYA 2CWDA 3D0OA 3RABA 4E5KA 3PGVA 3F8BA 3RKSA 3P9NA 1XAJA 3CO7C 1DG3A 4GOOD 1VZ0A 2NVUA 2QNIA 1DT3A 3M1YA 4G2NA 1SIBE 5EGOB 4RFSB 3H9UA 2C7RA 4EVQA 2N75A 1PYOA 1LDEA 5GIOE 5AICA 1SOVA 5K8VA 2C8KA 1VE9A 1U8CB 3GQBA 5KYUB 1GLNA 2H85A 5HFAA 3PHBE 1OBHA 3TSCA 1BSVA 2ZT6A 1HR0B 3LXRA 2VDRB 1FOKA 1Z2EA 1JMVA 2A88A 3ROMA 4LZOA 1JNXX 1F4LA 1LPAB 4QIWN 1OFIA 1B7GO 4DEXA 2L01A 3SYRA 4MW6A 1GUAA 2LTAA 2M6LA 5HM8A 3F98A 3PUIA 1GQOA 2Z99A 4NJOA 3FNFA 2FOXA 3VH1A 1VTNC 2HZBA 4I1PA 3LHKA 2WAEA 1C9DB 5B30A 1RQRA 3F5DA 3UAVA 2HIAA 1YOVA 4UEQA 5AONA 1CNMA 3DR5A 1XSXA 4JFRA 2B1JA 1ZXXA 1F1BA 1JA0A 3T3NA 4DC1A 5LZ4A 3SHFA 2WK1A 1GAQA 2YR0A 2QLTA 2F3QA 2YWDA 3KR9A 3CUQA 2Y1GA 3SZUA 4Y18A 4ZCIA 1C29B 4OHPA 4MW0A 4P33A 2V6GA 2BL4A 1JFLA 3BRQA 2GZ1A 3E3LA 4YDSA 2AI1A 4PEVA 2DETA 1EGVB 1SFXA 2DKOA 4MI1A 3U60B 2EP8A 4QNNA 4H7HA 4CTKA 2ZEJA 1XQYA 2XCUA 4OV6B 2BRUA 2ZB8A 3TX2A 2O03A 1UCFA 3OPVA 3UXYA 1SOUA 2YY7A 2EKPA 4N0DA 2OZ6A 2HA4A 5ARBA 4D4MA 2ZFWA 2MW8A 5AVZA 3MW8A 3OBBA 2EZ9A 3LA2A 3LSJA 3BMNB 3P9IA 1N4DA 1Z0SA 2PRZA 1WFXA 1QJ4A 1ZGJA 2W2LD 4D0RA 1L4FA 4YRAA 1JIQA 1CQJB 1ETYA 3ML1A 1YZNA 4CMIA 5FWNA 3F46A 3RS2A 2YW2A 3HLKA 5EXDA 1WPRA 3HWSA 4PC1A 4BU2A 5LRSA 3KG2A 2MMCA 5HF6A 4YUYA 4DQLA 4AG5A 5I48A 4P55A 4L51A 5HLHA 3GC6A 3I59B 3MMSA 4DM3A 2BDTA 4G56A 2C3MA 2NO7A 4OK5A 1VKRA 2EQ5A 1T2FA 3LBYA 1M3SA 4ZPJA 2OB1A 2C4UA 3G88A 2GCIA 2BIFA 1LI5A 3KJEA 4DJDC 2ZI5A 2ST1A 2WYVA 5JUWA 4UU8A 1LS1A 5FOWA 5ESWA 1LI4A 4O6JA 3I4FA 2J9GA 1TLTA 2QMHA 4CI9A 1KH1A 3Q0IA 2B78A 3D3EA 4B0OA 1J9GA 4LS3A 2HCFA 3L7LA 5K20A 1OKRA 2VBCA 1RTKA 2D74A 2R7NA 3GQBB 1MGTA 3HA7A 4ER3A 4E2XA 4P96A 1JR3E 5BSFA 3I2YX 1TP4A 3QMPA 1IHXA 4G81A 1TMGE 2E7XA 4UEOA 1K63A 3IULA 3FBIB 4OYRA 1WP4A 3Q5FA 4NNJA 3V7RA 2Z5GA 3ASOH 3SR0A 4Q9KA 1JB9A 3AL3A 1MX3A 2R5YA 1LFDB 3WV4A 3DV8A 4DPMA 4DCJA 2M3AA 4E3ZA 2PT7A 3OYLA 4WBNA 1I39A 2JGEA 5ALGA 1GUUA 3HG7A 1YAJA 2C20A 2W70A 1FXWA 4J16C 3D2BA 1GFSA 5FD8A 1X1EA 3TCXB 4FE7A 1K6JA 2NNWB 3SX4A 4GVPA 1R1DA 2LTPA 4RM3A 4JP3A 1A82A 3ADBA 5DASA 4DR6B 2OQVA 2GD1O 4MRMB 1YCFA 3A1FA 1YB7A 1NBME 3LVFO 1U7TA 3D1JA 4CV1A 2DFIA 5TE9A 4IDOA 3D5EA 2Y1CA 3CUQB 3IRRA 4A3EJ 1TF2A 1SBYA 2DA5A 2BXZA 2G5TA 1UKCA 7REQA 4DSOA 4GDFA 1V71A 3QLJA 5IYBJ 4QJ5A 3GLLA 4GXQA 2L9RA 2NLOA 2FH5B 4NU0A 1KK3A 1U8AA 2E89A 3CXUA 1JKRC 3G2OA 3BHJA 5C3MA 2H7CA 1QIIA 1KI4A 3AMVA 4FBGA 3PNLA 3I8XA 1R6RA 3KP6A 4IV0A 4R2MA 4O3FA 2V58A 1AQIA 1ODJA 4WNAB 2X48A 5DTDA 4LIVA 1KYQA 2A57A 4WTOA 2DC1A 2WPNA 1NV9A 2QA5A 2QZ8A 4IH9A 4OHBA 2ONCA 3A4TA 4FM9A 1S8NA 3VPAA 4B6EA 1YE8A 4IHJF 1KYIA 4CMIB 5LP6B 2Q5IA 1MNEA 5TNXA 1DBPA 4IOKA 3QU7A 4IHYA 5CM8B 2D2IA 4HNTA 2FEXA 4GKKB 4GKAA 4PSUA 3V8VA 4NICA 3I28A 2JH8A 2Q9CA 1Z0ZA 3AY7A 1JIXA 5FBKA 1DB3A 4DLAA 3TQSA 1T35A 1VBFA 3CNBA 4MS3B 1WI3A 1WZ2A 2ZO4A 4NYJR 2Q3DA 3BXHA 2H6BA 1TUIA 2YXEA 1GPUA 1G4AE 1VKZA 2PNJA 3ESWB 5HK9A 3RQIA 3EPKA 4M71A 3H1TA 4E2YA 1ZGCA 2K5UA 2RH5A 4DV3B 2QLFA 2LSOA 3PHHA 5IT9Z 1QV6A 1XZCA 3QY0A 4BRWA 2VP0A 1V8ZA 4BKRA 1Z8NA 4ZT5A 2GAAA 3JPWA 2CHGA 5DEIA 3OECA 4L9TA 3JRDA 4XSHA 5A4MS 3CG4A 3EPPA 3BKWA 3GUUA 1JEQA 4ME6A 4LPKA 4TTAA 5CTAA 4G0PA 5ICSA 1OCOH 3RG8A 3OOJA 4EK9A 4PINA 3UJ9A 3HSFA 3FBGA 3K4CA 1HQYE 1L8LA 4I3HA 4OXQA 4WX9A 1V4RA 1JKIA 3W2TA 2OBMA 1BN7A 1ZIDA 5A71A 4W5RA 1P4JA 2VNSA 3KALA 4X91A 3ZE0B 3OM9A 3ZDXB 2QLZA 2PRSA 4MNUA 1KK2A 3RZDJ 2J09A 5JLAA 2VTBA 1DPFA 1BYUA 4M9ZA 1HZZA 4Q9NA 4MZDA 3W7AA 4B81A 3RVDA 1KA9H 3EQ6A 5KKAA 3BMOA 2JI7A 2NUBA 2F1OA 4HS4A 2ZBUA 2P77A 3FYDA 4HRVA 4IOLA 3V2HA 1G5PA 3L7CA 1IRXA 2X0NA 3L8MA 1JIKA 1IV8A 2HX1A 2HOAA 3OJXA 1KZHA 2RSLA 4NAVA 3SEAA 2O2SA 2FUEA 4R1QA 1P6UA 3DHVA 2FOWA 2PCJA 3CGWA 4M9CA 5G02A 1Q74A 4R81A 3H2HA 1XMQB 2CSOA 4HBGA 4CW7A 1QKIA 3GMIA 4JOBA 3DLLF 2ZW9A 3FA2A 4B3BA 5HS4A 1S1CA 1QCYA 2Q07A 2JFYA 4NESA 5BN1A 2X0RA 3ZHRA 5DP2A 3UWMA 3ZE8A 1DLIA 2ZRCA 1AUPA 3UJ3X 1TZLA 2R6GA 4G5RA 2XR1A 3T0GA 3HGYA 2FEWB 3ABLH 2PVCA 2OXIA 3FNRA 4MWGA 5LKAA 3QELB 4B33A 3FOWA 3DEEA 1T1GA 2WOJA 4RHTA 5DHRA 3ZXXA 4GUDA 1YTLA 1AK2A 4UUVA 3F8NA 4KK3A 2B7LA 2FDXA 4GX2A 1WDLA 1SOWA 1TVCA 1N5OX 2P2YA 5G0UA 2OESA 3EA0A 4Z4GA 2RFLA 3IV9A 3EDCA 1DNPA 1CR0A 3ITEA 4W8GA 1P4XA 2QMOA 4KDPA 3KXKA 3LF1A 3N0RA 3EDYA 5EKSA 1Q1GA 2HGZA 3FZNA 3UC9A 4AYTA 1E94E 4AJ2A 1U94A 2ZUCA 4WUVA 3QU6A 1EX7A 3ZMTA 2E4UA 4YCDA 2HOSA 1TCCA 2O0JA 4LBZA 4C4XA 1QZ3A 1NI4A 1ZY2A 1YQDA 3CTMA 3DP7A 2CLLB 4ZYHA 4JEHA 1GUBA 5EIEA 5K0JA 1FC0A 1WUHS 4MRNA 1U8EA 4BEHA 4LSWA 3BBPA 3GJ3A 1AD2A 3K1NA 1JAZA 1S1MA 4IWNA 3MG9A 4CL3A 2HQ1A 2X14A 2YV2A 3FWZA 3VR1A 1KKMA 5KVCA 1P4AA 5DUKA 1V1RB 4JI0B 4WKOA 3F8WA 5E0OA 3NHWA 2COBA 3QKUA 3JRIA 4BKXA 3F1KA 1AF7A 5H9VA 5KSWB 4N9IA 1Q3HA 3CH4B 3GT7A 3F3YA 3VSEA 3OC6A 1IZYA 1C0IA 3DB2A 4IS3A 5JALA 2H1WA 3A3OA 2KL4A 4G23A 1XLVA 2XKBA 1VB3A 1YZLA 4ZA2A 1Q1HA 4DSAA 2YJNA 3KQTA 1RM5A 3VPCA 2EJVA 1AS2A 3VJRA 4HH1A 3UMVA 3OCJA 1ULAA 3H2ZA 3D64A 1Z83A 2O7RA 3U6BA 5L3CA 2PX4A 1XC5A 4RIGA 5FWYB 2JI8A 2JCBA 4RB0A 3ZU2A 3MQ0A 1N2OA 2PJUA 3T0FA 3EA4A 2VTBB 3ESCA 2VJYA 4B1FA 4NBWA 4ALLA 1U4NA 4CF7A 1V55H 1FYFA 1OA1A 4QXRA 2A92A 4AMGA 3BMOB 4LOAA 4PZYA 4HJRA 1O94D 4RC9A 2ODQA 3P9PA 3WL4A 3O95A 3D6VA 2XASA 2BFEA 1HL3A 4M0PA 4TTSA 3LY8A 3DBOB 1WL8A 1YR6A 2JIZD 3OMWA 3RI3A 1OWOA 3V1KA 5EKXA 4A27A 1T0IA 1Q83A 1XYVA 3GWZA 4BL0B 4BJTA 4Y33A 5LKRA 1EHYA 1XMJA 4FILA 3RC3A 3QPWA 3E81A 2OR3A 1GP2A 2D3TA 2RAPA 3QMVA 2Z08A 5J4YA 4G0XA 1ZJJA 3WTUC 3FH0A 4L5JA 2ISSD 5EE1A 3INTA 2AKEA 4WWCA 4FETA 4X7PA 4KVZA 5K6TA 1XPRA 1W34A 1OC2A 2P6NA 4TTVA 1M1YE 2WV9A 2ZJ8A 4Y7CA 4LDNA 1T5OA 2GHQA 2K6GA 4M6WB 3OE7D 5GAEJ 2K7FA 3ROEA 4ZOQI 1W29A 2G4VA 1T6BY 1L5QA 2H5IA 2PZGA 3H84A 1J2YA 2XRMA 1EXVA 1WOYA 2QQAA 4MMYB 1XCJA 4B5LA 4L3OA 2ZT5A 1HPLA 1C4OA 3KR0A 4JENA 1ZGWA 3ERMA 1PL8A 2QVCA 4M8KA 1KRHA 3EF3A 4PAQA 5T67A 2ZSBA 2IU0A 1RPJA 1E69A 4L22A 1DBQA 4BEHB 1D0VA 1K8ZB 4ASUA 5CFQA 2WWTA 4JR0A 4I1YA 3F4LA 4V0ME 4KQXA 2E6KA 5LMCA 1E7WA 4YGXB 3KTDA 3TQOA 4RAQA 3X1MA 3AYXB 4V38A 5JSUA 2VZEA 1KO5A 3MBKA 2F48A 2PY6A 2L4AA 3AQ4A 2KIQA 2IHZA 5F27A 2VWGA 2V7EA 2ENUA 5K4AA 1XTJA 3VJKA 6GPBA 2I8LA 3IALA 1Y4DE 2AXNA 1PZXA 3LP8A 1G3QA 1ZSYA 4NP6A 4BACA 1AZLA 5BQXA 3D0KA 4RGUA 1VQLI 4PNEA 4JYKA 4P9FA 4ZALA 2ZUSA 4L4RA 5EPUA 4EYQA 2VYVA 2W6ZA 4GGMX 1LXCA 2R1TA 3TP0A 4EJSA 2YU9J 3KETA 4B3CA 3ZQCA 1F8GA 4RD2A 1ADBA 1NKSA 4DLRA 3I30X 5IM5A 4KX3A 4YPVA 1USWA 2JIBA 5C8VA 3L7BA 3QSYA 4EJ0A 2JFZA 3V2UA 3AFHA 1MEOA 3KZIC 3VEPA 2EV6A 3MQFA 1ZH8A 2DOEA 1M5UA 4LJ7A 3PXEA 5HSGA 2GCOB 3DB1A 3FPLA 1Z5ZA 4OM8A 2J07A 5BV0A 2AFIA 5TX7A 3U4HA 3MS4A 4DEVA 3CZPA 1JDSA 5FPTA 1QTIA 1ZHFA 3Q3JB 3KJNA 4AY5A 1TAUA 4F3KA 2NU6B 2AXQA 5JI2E 1ZN2A 4H7IA 4V3CA 4JGBA 2A9RA 1BNCA 1YA8A 4MLZA 4RD4A 3NH9A 1X7XB 3T3IA 3L4SO 5LIRA 1RQPA 1JBKA 1MNAA 3D5QA 2F2TA 4PNPA 2R7DA 5E1OA 3NUGA 2Q5QA 3STYA 5D5VB 4WOPA 4CIAA 4HPQA 1XZHA 2CZCA 2C4VA 4J03A 5ELLA 4PCLA 3KQOA 1P8JA 2ATCA 4N0MA 3UT5A 2HMUA 1R7JA 3NVDA 1Y1WJ 4ALMA 1HSZA 4LG1A 3RSQA 2VTDA 3NPMA 1GA6A 3USZA 3TQQA 4IVQA 1G66A 3WQBA 1NQWA 1QF6A 2IXGA 3UG6A 3NYWA 5H80A 4A6DA 1JU3A 4KW7A 5GV7A 1U5CA 2DA4A 2ZSKA 3JVIA 4OMUA 1YBMA 3BQNB 1HYBA 1XTBA 2Z09A 5T7BA 1UWVA 1JUPA 3LHSA 5MFZA 1MEEA 2OBBA 2CNDA 3ND5A 5BVHB 4PGFA 2PO5A 1Q2XA 2QUFA 3ZQ7A 3LBNA 1SANA 4L4XA 4CT4B 4RAOA 4Q4CA 5DTRA 4DCUA 3ZE1B 1AUXA 2QUAA 1RYYA 4IUBS 4U0JA 4DJEC 2XWJI 5JAUA 2VQGA 2LDXA 3AI7A 4GO1A 3LP6A 1TUBB 1KVRA 2ADUA 3ZMVA 4IDBA 2KSQA 4YELA 3F71A 2GJ8A 3NEAA 3IT0A 2VDQB 1IDOA 3KLBA 3DW1X 1USTA 3ZCRA 1E9VA 3UIEA 4CR8A 4X44A 1OCEA 2G25A 3PJDA 1JBEA 4F52A 1YZQA 2PD4A 1N0UA 3FETA 2UZKA 4G4IA 4HLUA 2DN0A 4ZVUA 1RWVA 3LXMA 1OW3B 3J7YJ 1VRWA 4MUAA 8AT1A 3E3NA 2O5EA 3S27A 4RCYA 3TNLA 1KBQA 4H9GA 3AW8A 4C1NA 2GMWA 4QSMA 4JODA 1RYFA 3AG3H 2WY2D 4HZIA 3D3WA 1UAGA 4AKSA 4V2FA 2R1TB 1Q14A 3HGTA 3GN2A 2HUPA 4ZYXA 2X0FA 4EJSB 4AXXA 4F3RA 4DG9A 3G1LA 3RM3A 2PKRA 3JZDA 3EEYA 2BHLA 1NVWQ 5KJFA 2OAQ1 4MQFB 3HGQA 3F7TA 2FU5C 3ZQFA 2XH8A 4M83A 1EGQA 4YXFA 1WNTA 3UJBA 4QRDA 3T38A 2MU1A 1TZCA 2X9QA 3M0EA 1EFRD 1O95C 2DFKB 2G0EA 2RAFA 1EXDA 5DLYA 3DVQX 3RVOA 4WXHA 3GZ5A 3PFCA 1XFDA 4G6TB 4MO2A 3PD0A 5CDGA 3B78A 4OP1A 1I7LA 3K2QA 1CU1A 2ROQA 4EOGA 2WVHA 3JTHA 4UHJA 4R71A 4D6YA 3RJTA 3RVNA 2CUZA 4YXWD 4RTOA 3HY6A 1FJGB 1CVLA 3GO4A 3RKWA 4HMPA 3W6PA 4JUIA 2JAXA 1L1FA 3I1IA 4IP0A 5FIUA 3MWEA 1Z37A 2XVAA 3I39X 3CISA 4TTIA 3CF0A 3HY4A 1WM1A 1SC1A 3VPDA 2QL5A 2BMAA 1XCOA 5HKKD 5HIKA 3SMVA 3CF5F 3T1YB 3ZU3A 3ZMDA 2GSDA 1N3LA 3R7AA 4EYOA 4DR7B 3A11A 1IEWA 3KKLA 1A1VA 4A73A 2G0AA 1NXXA 4LXQA 1UPBA 5CEEA 1O0SA 1RIOH 1R10A 2FW7A 5CP8A 4I7EA 3WDSA 4WBNF 1OR8A 1NG6A 4MQ9F 4WLEA 1RQ2A 2IOFK 2YS7A 1FXWF 4MV3A 1FBUA 5DT2A 2BZTA 2IA0A 4C06A 3D3JA 2P9QA 2R4GA 2G71A 4LY3A 5T57A 3KKEA 3MWDA 1JEJA 1B0AA 3UGKA 1SVMA 3PGLA 4B9EA 4LOHA 4PZEA 3PYXA 2QVGA 3QU4A 4PJ0C 1W0JA 4QLCU 4R1LA 2IVMA 3VNQA 4AVPA 4D9IA 2AH5A 1RABA 3PFKA 1S72I 3TQRA 4BRSA 1XQVA 3LQ1A 7ABPA 3LGAA 2JQ7A 4AWAA 2EIXA 3F6EX 1X7YA 2BYVE 4G84A 1Z38A 4O4IA 1JIUA 3SS8A 2PWBA 4BO9A 3IAS6 2WJ4A 1MBEA 1HBXG 1ND5A 2YFQA 3VUFA 3H8VA 3LM8A 1T6SA 4DA4A 5ICCA 2HXOA 1KMQA 1BS9A 3V4FA 3TG2A 4LY9A 3ZVKA 2O8CA 1IQ0A 2OGTA 1ND6A 3U49A 3IE0A 2R6DA 3FUVA 2DFPA 4OA8A 3R6SA 2VPZA 2XEDA 4RQUA 3NALA 4YFYA 3IB3A 3LK6A 5KNCA 4EQ6A 2Y1XA 2G70A 2QRVB 4FQ5A 3RJPA 3DCNA 4I8DA 4IHWA 4BJ5A 4N8DA 4F4FA 1XQ9A 3A7EA 3IXQA 4I81A 3ZJ4A 4JELA 2H8WA 5TS3A 2GZMA 2ZYHA 3K7EA 4G8BA 5JD5A 3G0HA 2ZJAA 3SIPA 1AUVA 2AEFA 2YCBA 1Q22A 4CA0A 5IT4A 2J1LA 1NTOA 1CYEA 5CB4B 3T52A 2ZSJA 4DUYB 2G1UA 5CCBA 1OROA 1VJ0A 5KHLB 1Q0TA 3R5TA 5KVAA 2M6SA 5LXTB 3JQAB 3Q0EA 2AYXA 3L6BA 4UREA 5AJTA 1DTWA 3WZ2A 4BUJA 5P21A 2PYDA 3KCNA 3PC7A 3AONB 2Z6UA 4XIFA 1YZVA 3AVPA 1IDZA 4AD9A 1KNQA 3ECCA 4HZFA 2DOAA 4DRZA 3MGKA 5DHAA 4HGNA 4ZJYA 1WB6A 4N65A 2V1DA 1GZ5A 4NJMB 3BKXA 3DOIA 4LBWA 5JAIA 4EKNB 5JNTA 4WNCA 4E22A 3OYJA 1XDZA 1KSFX 3K0FA 3S2YA 1BR4A 4N18A 3QVMA 3MMPA 1YB1A 1W25A 1E0DA 1ESZA 1YJNI 2V7XA 1QTNA 3WLMA 3AI2A 1CUWA 3R6TA 4DLNA 3CVUA 3LWBA 3O9MA 3TMKA 1QNLA 5HWSA 2HMSA 2CE2X 3OZEA 3SJ7A 4C9BA 5HKBA 1DC4A 4P7BA 1B8IA 3V9AA 1TT0A 3NIDB 4BLRA 4XR6A 1U3WA 1A2OA 2VP5A 4DLKA 3WSWA 1QO7A 3OFVA 2ALJA 4MUXA 4WXPA 3FBWA 4U7DA 3KQHA 1G2QA 3L8DA 2P6PA 3MWDB 3EGOA 1PEAA 2EV0A 3ABUA 4M1YA 1GJRA 2O6GE 5E1ZB 5JDCA 2XNDA 3WL5A 4AK9A 3CLOA 3VISA 4F84A 1P1BA 3V1YA 1DDNA 3ENKA 1C1YA 3EWIA 4Y8VA 5JJIA 4XPZA 1L7BA 4TMVA 4OOEA 2IYSA 3KJQA 1SIWA 4B76A 1X7YB 2AZ4A 4ZO7A 3EG9B 4M7RA 3DBHB 4O4IB 3HDGA 5DYWA 4LF7B 3UMYA 4NU5A 4LCEA 1J2TA 3N05A 1D0XA 2RHMA 3EZ9A 2WAFA 4DKXA 3LU1A 3KKZA 2XE6A 2QSZA 2A35A 3PSIA 3L0CA 3HOXJ 1CB7A 3SJMA 3IT2A 2PU7A 1NP3A 2O7NA 3WYEA 2CK3A 2AG8A 4ZOAA 4KN7X 4UW9A 3DXFA 1SBIA 1JG3A 4JQZA 2COEA 1UELB 2JHPA 4A8JC 1J70A 3UG7A 1EDDA 2W2PA 2BW3B 5BPFA 4ZTBA 2AK3A 2DK5A 5F73A 3LW8A 2ON6A 4D9GA 4I76A 1DEHA 1V0JA 1S2GA 3O94A 2HKOA 1YS6A 2E71A 3H65A 4N3NA 1CUYA 3N8DA 1ZCJA 3BMQA 4BLSA 4PWYA 3IWFA 4LKOA 2XPUA 3PK0A 2X9GA 3PNKA 3QI7A 4QXQA 2WV7A 4WGGA 5A4IS 4FIDA 3EBPA 4YJHB 3DPSA 2JA8J 3E8XA 4GGGA 5TVKA 2AA3A 4ZJUA 3OEED 2IYWA 3G6WA 1JE8A 2KZVA 5DCFA 4RQTA 4B74A 4D3SA 4Y13A 1O2DA 4OBWA 3O83A 3M4OJ 1BW5A 4KN4X 5L8VA 3N2LA 1DTWB 4BQEA 3RUAA 5JZBA 2B0JA 2BBTA 1FZTA 1E0JA 4NRDA 4FHGA 4XEHA 5HS9A 1UOOA 2PA0A 2ECBA 4IDHA 1ZBQA 3HJRA 3E8SA 5DS9A 3Q0UA 1G5IA 4X61A 4BXXJ 5H68A 3JASA 3IMCA 1GGFA 5GOTA 4GXRA 3KQVA 2PUDA 1ULUA 4BXUA 1Y42X 2H2WA 2H5JA 1EDEA 4IGEA 4YAKA 1UBHS 3DV9A 4TKMA 1YRQA 5ALXA 2AXEA 5TV2A 2PEXA 1NYRA 5J4LA 3KVNA 4BNXA 3DLIA 3GLIA 4HN4B 1I0ZA 2NIPA 3MIZA 4YX9A 1TEXA 3D8NA 2AMLA 1XUOA 1A8PA 4DJAA 1A5ZA 4IDCA 1MH9A 1QIKA 2IUEA 4MV5A 5LQSA 2BHNA 1N3IA 3CRW1 4XD2A 2LVBA 1KI8A 2XYQA 3OCWA 3EYWA 4JWKA 3ZV5A 1ITZA 3BF7A 4DUGD 5EGNA 1TQHA 1ECJA 4QHTA 3AH8A 4UMVA 3R7WA 2H3EA 1NF8A 5HDBB 2RHHA 2J48A 4AKIA 4GMXA 3FFWA 2O3UA 1IOWA 2F1HA 3E6DA 4Z9XA 3FF4A 5KOHA 3ZBPA 2YIJA 4XWAA 3H3VK 4Q7QA 2WUEA 2VSQA 1DJLA 3OZWA 5LGTA 4LGWA 1OUMA 4HOYA 4IIXA 4Q39A 1Z21A 2YYYA 4C07A 4P9UA 2ETHA 5F0HA 2DY1A 1L8AA 2FP4B 4ZGBA 3H1CA 1MFPA 3KP4A 3MJCA 3VR4H 2F6RA 3FHZA 3DE0X 2OBLA 3H11A 5TGDA 2IXBA 1WJCA 2CQKA 1STZA 2FMKA 4M36A 5J58A 5FQOA 3ROTA 3Q7QA 3MAJA 5BSTA 5FRDA 3UJ6A 1MBJA 5E7QA 2QMZA 2P68A 3BD9A 3I53A 3OLZA 4FS8A 2PZ8A 3QXSA 1FW6A 1DAMA 4X8OA 4GPTA 1B15A 2QI9F 3SLGA 1E1YA 2HLDD 4CM1A 3M07A 5EESA 2DDBA 3O4IA 3WLJA 3E0XA 2W6PA 3DE6X 3TZEA 1QGUA 4M89A 5CFOA 4RMJA 4LOKA 5BR4A 4MJXA 4N5LA 3DWIA 4OHKA 4TZKA 2ZXFA 4FR5A 1SU6A 1LDGA 2VBGA 1NUPA 3AM3A 1PYGA 3RKRA 4MP6A 3L8CA 2QPAA 3T7IA 2PEYA 2PCLA 1SO8A 5A0TA 3LX4A 4PZLA 2G83A 2LH9A 3HB9A 1DO2A 2Q99A 3R9WA 2BM1A 3ABOB 4G12A 4NJEA 3GFSA 1CUZA 5EGOA 1K4KA 2A9QA 4RORA 1QP4A 2YV4A 2P1ZA 1E8NA 4B7ZA 2NS7A 4X84A 3L2WA 2WSBA 3GEEA 5KYUA 3GLGE 3FUWA 1JGGA 2DFDA 2KQRA 3C4QA 5KYGA 4QYWA 2V5UA 4AG6A 3ZN2A 1SCJA 3GLIB 2BDUA 3H2JA 5DHFA 5KYTA 5IBRA 1I3OA 1HDOA 4Z7NB 4R2XA 2Y05A 1IJEA 1WU8A 2OV8A 1CETA 1XD9A 2MSEB 2V3VA 2KIFA 5EWLB 5BUSA 3UAYA 2ZKLA 3QHPA 3ZK8A 3UHJA 1B1CA 2I03A 3OEHA 4OX9Y 1M0TA 4AZTA 1GZ6A 4NBLA 3W4IA 5F04A 2WMOB 8ATCA 3T7RA 4RF2A 3S14J 4MW9A 4TZ6A 1KERA 5J2UB 3R40A 1M7HA 4IFEA 4MUFA 1DGQA 3LSMA 1GNVA 2JLAA 2X4DA 1IBRA 5L3EA 1U2EA 1M6WA 4LWQA 1LBSA 3ELUA 3TK1A 3FPKA 5KOHB 4J1QA 3SZTA 1ZITA 1ADFA 2PAFA 2QJRA 2PMZN 3BIWA 1HSTA 3CEJA 1LDDA 1G5HA 3RWOA 1XZPA 2IE8A 3TKYA 2DTZA 3EZYA 4MQ4A 4AZ3B 3AB8A 3NHSA 1KDRA 821PA 2ZU6A 4R3WA 3Q2OA 3GG9A 4QWMA 4K9PA