4A6DA

Crystal structure of human n-acetylserotonin methyltransferase (asmt) in complex with sam
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
347
structure length
345
Chain Sequence
MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARKGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HYDROXYINDOLE O-METHYLTRANSFERASE
publication title Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 124
structure length 345
sequence length 347
ec nomenclature ec 2.1.1.4: Acetylserotonin O-methyltransferase.
pdb deposition date 2011-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00891 Methyltransf_2 O-methyltransferase domain
A PF16864 Dimerisation2 Dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4a6dA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4a6dA02
4AIHA 3ZMTA 2EV6A 4YV1A 2STTA 1LB2A 4LLGF 4MQVA 3REOA 3VOEA 1ORHA 3MB5A 3MTEA 1KA8A 4DNCA 1WKMA 4F84A 2IA2A 5E17F 3DPTA 2GB4A 3ID6C 4PGHA 1T98A 5DM1A 3LKDA 4ENKA 3FTDA 4YV2A 5E1XA 3VODA 2EFPA 2AN3A 1MJAA 1XGMA 4Y30A 1L3IA 2IFTA 5EMMA 5DM0A 2EX4A 2G7HA 1O7LA 3L00A 3DXXA 3GWZA 4YFXF 4RVGA 2D1VA 3OE4A 2FMLA 1T38A 4A0ZA 2L4MA 2PBIA 1R36A 1O3QA 2HEOA 3OU6A 1IRGA 1YO5C 2UZKA 3K9TA 2V9VA 4EJVA 5K5RA 4TV7A 2DPDA 3GJYA 3HRMA 2FBIA 1E17A 4IRIA 5E8IA 3E05A 1KQ0A 2ZO4A 3UJCA 3KZYA 3LQQA 1BI3A 1BI0A 1K79A 4EM1A 4E30A 4M74A 4U88A 4A5MA 5D4RA 3BWYA 3SVZA 2QLZA 3R6SA 1YYVA 4BNCA 1YB2A 2KW5A 3LSTA 3T8TA 3KP6A 1JQEA 4DKJA 3T1BA 1I27A 4XUCA 1Y0UA 5EC8A 2PEXA 4L9JA 4HV6A 3CCFA 4POOA 5H6QA 4U7DA 4DQ0A 4IHTA 5DRTA 3U9GA 1V3FA 1SMTA 4HF0A 3KQYA 1XSVA 2QWWA 4RWZA 2WA2A 1I5ZA 2FQ3A 1ZLKA 1FP1D 1U5TA 2YVLA 3NTVA 4AIJA 2UXNA 3C7JA 1S6LA 4YUVA 2ZCJA 3GYHX 1WXWA 5LQAA 3QPHA 5K0BA 5TRDA 3OFKA 3LA2A 2O0YA 4GO1A 3G7UA 5LRRA 4FX0A 4QTTB 4KN7X 4BH9A 3K0BA 3EMBA 4ER3A 3HA7A 2I9KA 2IBTA 1K78B 1DUSA 4OX9Y 2FBKA 4AVPA 2PLWA 3M70A 3PS9A 4LK0F 1C0WA 1JXSA 5GIOE 1DPUA 4RYLA 2HTEA 5A2QZ 4GQBA 1UHWA 2IDJA 3SMQA 5EVJA 1ZG3A 3A25A 4WVLA 1Y8CA 2J5PA 4L5JA 2EK5A 1XVAA 2XBMA 2VC1A 4XSZF 4OIPF 3CGGA 5IH3A 1JTFA 5ICEA 3LHDA 3RYRA 4GOMD 5GWXA 3HVHA 1X1DA 4KDPA 4MEXF 3DV8A 5EMJA 4MHGA 1NE2A 2ZIGA 3CUOA 9MHTA 3SGLA 3WGGA 2OQGA 5IT9Z 2IH2A 4LJZF 1BJAA 1USSA 1YQAA 3TDZC 5FFXA 4KMFA 3KP7A 3O4FA 4A0XA 1HW1A 5K0LA 3OZRA 3EEOA 3EVAA 5K0FA 4B8XA 2K7LA 5ILVA 4E2YA 3WTZA 5HLGA 3EVFA 2FE3A 2OZ6A 5DPMA 4E33A 5U4XA 1DCTA 4WX9A 2RV8A 3GXOA 2NYUA 2PSSA 3KPVA 1W5SA 2GLUA 4I7HA 2WA1A 2FSWA 3S2WA 2YXLA 3RIEA 1RI4A 2AOVA 2EWNA 2Z99A 2LF8A 5EHIA 4M71A 4PYQA 1RJGA 5K05A 4RTPA 2QRVA 3NW9A 1KGSA 5FLXK 1DL5A 1ZKDA 1U8RA 1XB4A 1F4KA 3M6UA 2HQNA 2IPXA 3UA4A 4L7VA 1WRJA 4ASNA 2LNBA 4KVZA 4PYLA 5CVRA 1TW2A 2AVNA 1RIOH 2BM9A 4IKPA 5K03A 3KR1A 2OB1A 3ELKA 2OXTA 3SM3A 2NP6A 1S8NA 3T0YA 2X4HA 2Y48A 3SXJA 1R7JA 1TBXA 1YW7A 3G5LA 1CGPA 4RTJA 5EMKA 3WTXC 2OO3A 2VDVE 5HILA 5LEJA 5HIMA 4WF2A 2VODA 5LQRA 3WTUC 2L3DA 1O57A 1VQ1A 1R58A 2BGCA 1S3JA 2KIMA 4CYDA 3FZGA 1VIDA 3DULA 3IWFA 5FTWA 1F5TA 2HGCA 1IN7A 4LGWA 5IT3A 2FEZA 2VT3A 3FXQA 3G88A 3TOSA 1G6Q1 5DTRA 3NDJA 3N97A 3KR9A 2ZSUA 1X3UA 5DX1A 4IHSA 2EA4A 3GNLA 1VL5A 3HEMA 2ADMA 2HWVA 4PCQA 2O0LA 3HHGA 1YFHA 2A3SA 2NXJA 2MH2A 2ZJ2A 4OIQF 3CJQA 2IDKA 4MEYF 3DLCA 3OPNA 5LRSA 4OQEA 1L3BA 1BC8C 2W25A 4HG2A 3GEZA 3VYWA 1SD7A 2Q41A 4WK8F 2PXXA 3KQWA 1BIAA 2A14A 5DEQA 2GH1A 2EJUA 2ZZNA 4M73A 2AOXA 4M7RA 1QBJA 1TQIA 4FT2A 1HSTA 3QRFF 2K86A 4LG0B 5DSTA 2ZVJA 4OOIA 2FHPA 2A61A 2VBYA 2R3SA 3FX3A 1FYMA 1S7OA 4UUVA 3R61A 4I2OA 2BR3A 2ZKZA 2QENA 2KRFA 1TNSA 2HV9A 2IA0A 2G7UA 2MC3A 1J75A 4AZVA 2A07F 1DDNA 5E8JA 3GF2A 1O3RA 3HA5A 2PVCA 1R1TA 2K27A 3K0LA 4HLYA 5DM2A 2IH5A 2ESRA 2M45A 2C6YA 1T0FA 1IN4A 2DU9A 4RGSA 5FFZA 1NW5A 4HW0A 3GO5A 4U0VA 4QPPA 4ER5A 3P71T 4G56A 3ZP5A 3G2QA 2E5WA 1U6GA 4CKCA 1KIAA 1INLA 3C18A 3NJRA 3BZ6A 2BEOA 1PUEE 2P5KA 3SHFA 1EG2A 4PYJA 2L54A 2KIUA 5CIYA 3B89A 1E2XA 4M72A 10MHA 3IKTA 1OYYA 4P7KA 1R1VA 5DX0A 3P97A 1YS7A 1KYZA 5M5BA 1SFEA 3L8DA 3AXTA 5HEKA 3F8CA 3E23A 4P96A 2RGVA 1UCRA 5LHGA 3LECA 2V1UA 2FCAA 2Q0OA 2QM3A 1FNNA 4PYIA 2PWPA 3D0SA 5GP1A 1T39A 4FR0A 4HX7A 1SMYF 4HLXA 2H1RA 2HR1A 1X1AA 4JQFA 3AJDA 4GOLD 1FOKA 2MBFA 4QDJA 1P4XA 5DX8A 3EGEA 1TLHB 1RI2A 3THRA 3R9XB 3JAMZ 4HQEA 5LLQA 5EQJB 3T7SA 5FQOA 3DKWA 3CJRA 1TTYA 3CKKA 5DRYA 2HMYB 5E1WA 2Q2EA 3FMQA 3V8JA 4MTLA 3CUQA 1XDSA 4RB3C 5LQUA 2GAUA 3PB3A 4KRGA 5FULA 3I71A 2VZ9A 2NS0A 4ESJA 1YTYA 1OR7A 4UVAA 1EIZA 4HGYA 4HA8A 3TM4A 1XN7A 5AIPA 3HUGA 3BJOA 4GXOA 4CO8A 1BOOA 1AF7A 2COMA 5EGSA 5FUBA 2ETHA 4Y17A 2V74B 1U5TB 4L0YB 2PKWA 2E1CA 3F4KA 1R18A 3NVKI 1D8JA 4EJUA 4LLNA 5JR3A 2OB2A 2PX4A 2AN5A 3P9KA 4BYYA 3C0KA 2FRHA 5LEKA 2HYFA 4QPNA 2B25A 4IF4A 5K0CA 2DQRA 4RTRA 2VT2A 3LAJA 4UXNA 1H9TA 5CJ9A 4P58A 2ZWVA 3ECOA 2XIGA 5AONA 2K4MA 3ZPLA 1O9HA 3H3UA 2OYRA 4HZFA 3MWMA 2FYTA 2XYQA 2O61A 1XCVA 1FBNA 2UWMA 1EAMA 3Q9VA 3IKVA 5FWAA 2CWEA 2YR0A 5LBQA 4XLPF 5LQKA 4PNEA 1IXCA 3B02A 2LSOA 5MHTA 2P41A 3PQKA 3EYYA 3MAJA 3O6BB 3ZN1A 2CO5A 3I9FA 5BMZA 3F22A 2A5YB 1O54A 3V7RA 4CGZA 3OFJA 4S04A 4V0RA 1KHHA 3GIWA 4X63A 2A6EF 3GRUA 1B4AA 3NEUA 3E6MA 4Q48A 1LQ1A 2Z6UA 3I64A 3KR2A 1IXSB 2DK8A 5CCBA 4M6XA 1K6OA 5CVVA 4QWQA 5D5UB 2IRFG 2XKOA 3UBTA 1QO0D 2OD5A 4LD5A 2OBFA 2ESHA 2GA1A 1H0MA 3SR4A 5D1HA 4L18B 3HCBA 3K69A 1QAMA 2NXNA 2GA2A 2PX2A 4MTDA 4BQAA 2P5LC 5LGUA 2CSOA 5EEHA 5B1SA 2JH8A 4AZSA 3QOWA 3DP7A 2LD4A 4LB6B 3ELUA 3RKYA 5HVQC 2GPYA 3PX3A 5HIIA 5FADA 3E6DA 1SKMA 4FGZA 2XKPA 2PQ8A 1VE3A 2UYHA 2M8EA 5K01A 4EMSA 5C9ZA 4KT5C 3ERED 5C0OE 5DM4A 2CG4A 1YZ3A 3VFZA 4C05A 4R1HA 4C03A 3RPQA 1R5HA 1SUIA 3TOBA 1P1CA 4L0ZB 5D6FA 3FM3A 3J81K 5DCMA 2ZBQA 4IV8A 2HYGD 1XMKA 4HTFA 1XSDA 3HA3A 2Y75A 3LDUA 4PDKA 1D5VA 2XAJA 1UIRA 2F5FA 4G8XA 1TPYA 3KQMA 3WE2A 2J5OA 5BPDA 2A68F 4L5IA 6PAXA 3CO7C 2R7FA 2NNWB 2EB7A 2GXGA 4DM3A 4P55A 5FD6A 5A2QK 2AOTA 1YS6A 3EVCA 4ZZLA 1CF7B 2ZBKA 5HDNA 1BI1A 3VSEA 1UWVA 1ZLJA 3AWIA 4EJWA 4X41A 1P39A 2Z9OA 1D2CA 2GQQA 4HC4A 2CKDA 2FMYA 2ONZA 2IGTA 2YX4A 5IT9K 2P7CB 2DO7A 3EGVA 2F5EA 3GZ6A 1OPCA 4RGXA 3ECHA 1L3CA 4KW7A 3HTUA 2HKOA 2PWYA 3ZMVA 3ANXA 3BP8A 2ZNYA 4P7JA 4GYIA 2W24A 3G8AA 3PLAE 2ZNZA 2EA2A 4RVDA 5E2AA 1Z05A 1IY9A 5FHQA 5KK1A 2ZULA 1BIBA 3FRHA 3LA3A 1HXDA 5HIJA 2YXDA 3HCCA 3H2BA 4OBXA 5L3BA 3HRTA 2PY6A 5LSAA 2ZIEA 2OBPA 3ML6A 3EQLF 3P2IA 5F6FA 5H02A 4LLLA 3EVZA 2CMHA 2AVDA 4BP3A 3DR5A 4L9VA 4OQDA 1NKVA 1G55A 2FXAA 1JG4A 1FYKA 3ABUA 1W4MA 2WV0A 3V4GA 1W5TA 5ILSA 4KIGA 3TO9A 4R8RA 3FYDA 2A6HF 2NXCA 3VC2A 4B17A 4PIMA 3RI4A 4RB2C 3AY0A 2HTJA 4M9ZA 1MHTA 4GEKA 2YXEA 1VP9A 2HZTA 1TNTA 1Z91A 1FSHA 1YF3A 3ERCA 2GS9A 2P4WA 2IJLA 4PGGA 3GVAA 5HS7A 3T5XA 3A27A 4M37A 3V7SA 3R24A 3M9AA 2K02A 4ISCA 1BHJA 5JUWA 3V7CA 1JR4A 2ZZKA 2DFIA 5FD5A 2OQRA 2HR3A 1HSJA 4AZTA 4I98B 1J0RA 3W6JB 1FLIA 5EKUA 3OV8A 2VS1A 3LDGA 4A0YA 4I0BA 4ATNA 3GW2A 1Q0TA 3TLJA 3KQVA 4PWYA 1KR5A 1R8XA 1D8KA 2PMUA 4ESFA 2PJPA 2VBWA 2DQLA 4Q4ZF 3CUQB 4PCLA 4YG2F 4A6EA 1ZAOA 2O6GE 4H0NA 3TFWA 1TQMA 2K4BA 1AWCA 2VE9A 1XTPA 4IXAA 1KQ8A 2FF4A 3T8RA 1Z9CA 1EJ0A 2CL5A 1FZPB 2EV0A 2QUFA 3A7DA 2CWWA 2JPCA 3I59A 3J81Z 1GXPA 1NW8A 2E7WA 4HSGA 1FX7A 2G71A 1XD7A 1G60A 1B9MA 3LBFA 1FPQA 4R8HA 1VTNC 1NBIA 4AIKA 3D2LA 4RTOA 3M6WA 4EKGA 5KQSA 2XGXA 4U7BA 4P9UA 2P1DA 2ZWAA 4BHBA 4D0PA 2DPMA 2ZTHA 2GA9A 1P92A 2W57A 5GM2A 4A5NA 1LDDA 1G8AA 2G8NA 1HW2A 3PT9A 2PN6A 2V7EA 1VPTA 1LJ9A 4KNYA 4C06A 4C07A 2XV4S 3KR0A 2LDUA 5E1ZB 4ER7A 2FU4A 4PCAA 4G94A 3DMHA 2P6SA 4KIFA 3E6BA 2B9EA 3FHZA 1RJEA 3MTIA 1RI1A 3T0IA 1WI9A 3CDHA 2RQPA 1EH6A 3R0JA 3WTSC 5EMLA 3THSA 8MHTA 1IRFA 3WTWC 5G02A 3MGGA 2JH9A 2O07A 3I54A 3TKYA 4ER6A 5P8WA 5HIKA 4HBLA 1ZGAA 2FNPA 3HSFA 4WXDA 2B2CA 1NHAA 7MHTA 5FA5A 3MZYA 2C7QA 2OY0A 4EGYA 4FT8A 2ONYA 3V8LA 3ME5A 5KQRA 2Y0MA 5E8RA 1S7AA 1ZRCA 1Q0SA 2ZMEA 4PYOA 3KZZA 2YX7A 2CW0F 1H1DA 4KUMA 3X0DA 3E6CC 2P3QA 2P35A 4PONA 3V8KA 4BHCA 2MLKA 4OBWA 1S29A 5CUQA 5EZSA 1ONVA 2F8LA 4HAMA 5HOQA 3R0AA 3JAMK 2ORED 1WG8A 1WZNA 2AZTA 1NW7A 3LAPA 5HLIA 3WGHA 3WU0A 1IUYA 3BGDA 4IWNA 1VLMA 3MERA 1KXZA 1XDUA 2EJRA 4JK1X 4YFKF 4HX8A 4YUYA 3BROA 2XUBA 4ESBA 4QTUB 2EG5A 4WXCA 4GCVA 4RX1A 1EQAA 1HKTA 4M36A 3WODF 3ABTA 1GXQA 4RTNA 3ZN0A 5K09A 4CKEA 1T2KA 1USTA 3ZMSA 3KLNA 4PZJA 1BM9A 2FBHA 2ZBRA 2R6ZA 4GUAA 1OYIA 5EEGA 1ULYA 2VP3A 4QDKA 2EFNA 3BJ6A 3ZMDA 4MQ4A 5T64A 1ZH5A 3ISPA 5K8VA 5L3CA 3MCTA 2Z6AA 3LFKA 2KJCA 1G6NA 4I09A 4BAYA 2H94A 1KPHA 4AUKA 2Z5UA 3M8FA 1FP2A 1D3YA 4KDRA 1B9NA 2HNKA 4ZZDA 1FY7A 4RAZA 1RNLA 3EGIA 3BGIA 2NNYA 2QQ9A 3B5IA 1L3LA 5AIQA 4ZYHA 2AOTB 3Q7EA 2PG4A 4RTMA 2HS5A 4RTLA 3IYLW 3ER9A 3BZBA 5KYGA 4CHUA 1AV6A 3L7WA 1D2GA 2O03A 4WCGA 1ZREA 5FHRA 4C08A 4EK9A 3GLXA 1JGSA 3UJ7A 1T43A 2VC0A 3HM2A 2H11A 3QOXA 4HDUA 3NVMB 3J7AO 3EUHA 3HHHA 3WGIA 1TW3A 2R7DA 5EIFA 5J8FA 3DLIA 2NRAC 3UJBA 2AR0A 3RPUA 2CFXA 5DTQA 3UZUA 1U3EM 3WTYC 3CJTA 1D2HA 4CZZA 1MKMA 3GU3A 3T7TA 5HZMA 2IIPA 5CVEA 4EV0A 4YIIA 4E2WA 3GX4X 4XRFA 5HS9A 5ERGB 5F64A 2FRXA 2PFBA 3KQQA 1YFJA 1HKSA 1L0OC 3DPLC 2I6GA 5HS8A 4I01A 2HOEA 1UFMA 3GFMA 2O57A 1MDMA 5EG5A 2H6BA 2VBZA 1SAXA 3EYIA 2PX5A 3DQVC 2BH2A 1RJDA 3CC8A 2JPBA 4CXFA 5DUIA 2IBSA 1P91A 5DCFA 3ELDA 1M6EX 4EKIA 2FNAA 3KP5A 2F2EA 1JHFA 3I0TA 4KWCA 3TM5A 3MZHA 4MHTA 1ORIA 3MCZA 3IRQA 3GZ5A 4JBAA 1GHCA 3LX6A 5FA8A 5K0NA 5T67A 4C04A 5DUKA 4DMGA 3WG9A 5DTMA 5FCDA 5E2BA 3PTAA 4YUZA 3N4MA 4HX4A 3L2CA 1PP7U 2Y1WA 2NAZA 1R1UA 1MZBA 4LB5A 3G3ZA 3GRRA 3A7EA 1SD6A 2V6CA 1PJZA 1Z6TA 4R79A 5E18F 3JTGA 4ZH4F 2VDWA 3M8EA 5LQNA 2D45A 2ZXJA 4KN4X 2LKPA 4CTJA 4ENMA 4GC9A 3EVGA 4BXUA 1IXRC 2UYQA 1SVUA 3DMFA 4H0EA 3P2KA 4FX4A 3T7RA 2ZZMA 4U7TB 1YW9A 3PFIA 5DXAA 3LKZA 3KLOA 1RJFA 3LCVB 4DQ2A 5KVRA 2DW4A 5D5VB 3BDDA 5CCXA 2WC2A 2ACJA 1KP9A 1NT2A 3IEIA 2JSCA 3K1NA 3AXSA 3HCEA 1YLFA 3EMDA 5H20A 1X19A 1MJFA 3RODA 5KVAA 2AOWA 3NDIA 1P2FA 3F8BA 1HNNA 4HRAA 2NNNA 5DYMA 5JFRA 4CXMA 3KCCA 2FPOA 2HTSA 2BM8A 4ETSA 3JW4A 4WXHA 2P5VA 3IHUA 1J5YA 5K5QA 3I59B 3B3FA 1YG2A 3WE3A 2PMHA 1PRYA 3MAGA 5BPIA 2DAOA 4G6DA 1UHMA 4RV9A 3K1MA 4WWCA 3H3ZA 4F86A 1RUNA 4ZYDA 4UV9A 5EZQA 5CVIA 4PYNA 3UJ6A 2MH9A 3HIFA 3SQNA 1J7KA 3TRKA 1J2XA 2UXXA 3LL7A 5J6XA 2OA4A 5F2NA 2XVCA 3TMAA 1P1BA 3RW9A 1SFUA 1NV8A 3OU2A 1AQJA 3FPHA 4BLVA 3M1EA 3BPXA 5L3GA 2YQZA 3UA3A 1RUOA 2QVOA 5LQJA 3HRSA 3O2PE 4G7ZF 2PXAA 4A6DA 3HSEA 2IP2A 4OIOF 1O3TA 4QVGA 3QU3A 3QV2A 3FYCA 3KP3A 3GUDA 2QBYA 1Z1DA 3VC1A 2Q8KA 5DSXA 3EETA 1BKYA 3HVIA 2VDUE 3E5QA 1XCBA 5E9QA 2DLLA 1G3TA 2JG3A 3BGVA 2YPRA 1NV9A 3MQ0A 2ZMEB 3P9NA 4DA4A 3FMRA 1ZQ9A 4I0AA 4NHJA 1W7PA 4HGZA 4HDVA 4U0WA 4CKBA 2QRVB 4KMUX 4ENJA 2N47A 3K1PA 4AX8A 1KU2A 4XBFA 1XJ5A 3FPGA 3KQOA 5E1MA 1YW8A 1N2XA 1M0EA 4UVBA 3JSOA 1P4WA 3JWJA 2VOOA 3Q9SA 5K0JA 4NECA 4OU0A 4P5OA 2DI3A 1R8YA 3OU7A 5HDGA 4AZWA 1ZHFA 3OZSA 1I1NA 3FXRA 3BWBA 1N7IA 1H9GA 4MTEA 2P40A 2PT6A 4BLUA 1FWZA 3F72A 3UFBA 4R05A 3TR6A 2HQRA 3QOPA 5K0EA 4G7HF 5ICFA 3NQOA 1O3SA 4I02A 3IHTA 4GF5A 5CD1A 1XXLA 3ZQ7A 1EH7A 5ILUA 1WSUA 3KKZA 3CLOA 5LGTA 3E3VA 2RKHA 1IZ1A 2OZVA 2QE6A 4R8SA 3C6KA 3V8VA 3ZMZA 4KDCA 2CMGA 1DPRA 5TJJA 3KQSA 3MFKA 4HF2A 3P8ZA 1ZYRF 3G8BA 3KQPA 3HYIA 4G7OF 4BP1A 1G3YA 3TO6A 2DT5A 2H6CA 2PT9A 2YTZA 3O7WA 5EHGA 1Z6RA 1EH8A 1NBHA 3BUSA 3BJAA 3L09A 2L01A 1STZA 3A26A 3JWGA 5LGNA 1HKQA 2B0LA 5D5XB 3BOQA 2Y1XA 3FUTA 1B6AA 4IJAA 3E8SA 3UJ9A 1G3SA 2NXEA 2FK8A 4RTQA 3TPZA 2PV0A 4FZVA 5F2KA 3TQSA 3JTHA 4DZRA 2GAFA 4ON0A 2MA3A 3HSRA 4N0BA 3PQJA 1FYLA 2YUIA 4MQ9F 5D1NA 4QVKA 1JE8A 1R5GA 4FP9A 4ER0A 4PIPA 3TGNA 4RSRA 1JG3A 1U2WA 4P7FA 4RS8A 2OKCA 4P7GA 2OPBA 1LEBA 4UNOA 1XGNA 3HNRA 3FUXA 2G1PA 1QNTA 1G8SA 2QQBA 4F85A 5LHHA 3I58A 2XYVA 1HW5A 1MJ9A 3J80Z 3S68A 1MDMB 3BKWA 5E8GA 1VBFA 1I1SA 2W84A 1ZARA 5HDKA 3BWCA 1HBXG 1FSEA 3K6RA 3DEUA 4KFCA 3DMGA 2H09A 3B3JA 4RGUA 5DXJA 5T6BA 3V97A 3LA7A 2VBXA 4OINF 1B59A 3WTTC 3KPYA 3E7PA 3IL2A 2XAGA 2JJQA 2KKOA 3Q87B 2K4JA 1O7FA 1JSXA 4MWZA 4QQKA 3FUWA 3ER8A 1DP7P 2YU3A 4O6JA 3DTNA 3KPJA 2F5DA 1P6RA 2C7PA 3PVCA 3EVDA 2ESNA 2XVMA 1EJ6A 2VN2A 5HOOA 4RB1A 4HH4A 2HFHA 2JHAA 2ZW9A 2O8XA 2DPUA 3G89A 5CM2Z 2BR4A 1RI7A 5BS6A 1BOAA 5DD8A 2HKXA 1IM8A 3B7PA 5EKXA 1JHHA 2M87A 2H27A 1L9KA 3VB2A 1QAOA 5BP7A 3KU1A 1I9GA 3R3HA 3KQTA 2YR2A 3DXYA 2WWYA 2I62A 4HOBA 1KU9A 5E20A 5JI6A 1SUSA 2RC4A 4KICA 1JG2A 2QYOA 2CQKA 5D8LB 3HCFA 2QY6A 5JHUA 1GVJA 4BY9E 2X0LA 5E1DA 1XGOA 3OCJA 4YUXA 1I1GA 3LBYA 4YUWA 1BN5A 2WK1A 1R74A 4O5VA 3F3XA 2Z6QA 2FOKA 3LQRA 1KU7A 5DWQA 1YUBA 3I53A 4U0YA 3UJ8A 3SFZA 4GOND 4V0QA 2KJBA 4EQQA 3FZVA 3LWFA 5LHIA 4YFNF 4M9XA 2JT1A 1YFLA 2BE5F 3OZTA 2G9WA 1T6SA 1ZN2A 4X60A 3FF5A 3GGDA 5DT2A 3QP6A 1ZG5A 1U2ZA 3FPEA 2D1HA 3HOTA 1P4AA 4RGRA 1K7AA 1ZRDA 5GM1A 5LR6A 4F7ZA 4XSXF 4EM0B 2XRNA 2YX1A 1ZG1A 4XUDA 1KPIA 4BHPA 2G72A 5EIWA 1ZGJA 4EGZA 2P3LA 3LDFA 5J8CA 2P7HA 4N9IA 3FUUA 2ADUA 2QBYB 3FPJA 3FM5A 5K5OA 1IF1A 2I7CA 5E9JA 4OA5A 3LGAA 3O31A 3KP4A 2PJDA 1U5TC 2GIVA 2P6TA 1X1BA 3HP7A 1W7PD 2EFJA 4DCGA 4B09A 2XROA 3E5XA 4RAYA 2AS0A 2LF7A 4NB5A 3KFWX 3KP2A 2WTEA 2GZWA 3RDIA 2ISYA 3OE5A 3EDPA 1LEAA 1SD4A 3SZTA 1AOYA 1W7PB 1BC7C 4L9NA 1QYRA 1Z3CA 1EV7A 4ZYGA 4YMHA 5F2OA 1B1BA 3FXUA 1DUXC 1BI2A 3G2OA 4A2UA 3BT7A 2BBYA 3CVOA 1KU3A 3EVBA 5BXYA 1QZYA 5ED4A 3U2RA 3B3GA 3E5UA 3M6XA 3K2ZA 1OKRA 2ZCWA 4FSXA 1FBUA 1HMYA 4HQMA 3BKXA 4E2XA 1OR8A 1F1ZA 2O05A 2GWRA 3SZPA 3FPFA 3FRIA 3GDHA 1B42A 3WSTA 3DFGA 4BLWA 3MEXA 5C1IA 5CVJA 2UYOA 1JQDA 5IKMA 2AOUA 1JSZA 2IT0A 3FTCA 1QZZA 3DXJF 5DCMB 4IV0A 5E1OA 4YV0A 2L02A 4HTFB 3RIRA 5BW4A 3RKXA 2HWKA 1O9GA 3P7NA 2P3OA 1V39A 3MHTA 1F38A 2XYRA 4RTKA 1FJXA 1FBQA 1RI5A 1LDJA 2JRTA 3BPVA 1WY7A 4C4AA 2IW5A 4ZYEA 1R22A 5L3FA 1SD5A 3F8NA 2BV6A 3BY6A 1OMIA 2OU2A 4E2ZA 4LECA 1CF7A 4YMGA 1XSXA 5H6RA 4OIRF 4XCXA 4XUEA 4QLCU 4E31A 5GIPE 4E70A 3ELWA 2PI0A 1A04A 2V1DA 3ZMUA 3CTAA 4YIFA 2Z33A 3EEYA 2IH4A 4PYKA 3SXYA 3F8FA 3HTSB 4MNUA 3UJAA 4EJTA 1KQ9A 2STWA 1PDNC 2NYXA 2RNJA 3KHKA 3COAC 3W6KB 4HF1A 1R6AA 4Y15A 5GINE 2EFWA 2FK7A 5EPEA 4E32A 3ORHA 2ERCA 4LMYA 3HVKA 1NW3A 3G5TA 2M1BA 3GFLA 2E7XA 2W85A 5D4SA 3O3KA 2ZFUA 2BR5A 2OZUA 4S05A 4HV5A 1PP8F 5BW5A 1ODDA 2XAQA 4Y13A 5F1RA 1LNWA 1XMAA 5ICGA 2AS5F 3D5LA 3QU6A 4IRHA 4GGGA 2EFQA 2ISZA 4U7PB 1KPGA 1JG1A 2E1NA 5CLSA 3SSOA 5HLHA 3R6TA 3B73A 4AD9A 3SSMA 3LCCA 2DK5A 1FBSA 4ENNA 4R6WA 3F6OA 1SQFA 5FB2A 5L3DA 3JWIA 4OA8A 5K1YA 3TDUC 3SSNA 3MQ2A 2KIFA 3PFGA 2V79A 3CBGA 3HCDA 3GFIA 4GOOD 3IV6A 1IN8A 5FO5A 4G9YA 3F21A 1JTEA 4HYEA 2CGPA 3P9IA 5DLYA 1RI3A 3RKWA 2EJTA 1OYWA 2HDCA 1WQ2A 3QAHA 1WXXA 2B3TA 1YIOA 1VP3A 4Y2HA 3HRUA 1ON2A 2C7RA 3FWEA 3A4TA 1V4RA 4GYGA 5DDGA 1QGPA 4OMYA 4ZTBA 1SFXA 3R60A 4N9HA 5FGMA 3BXOA 3RYPA 5GOZA 2BYVE 5FLXZ 4X61A 1R23A 1IW7F 3M4XA 4P9FA 4EVIA 1M6YA 4OMZA 1FT9A 3GRVA 4PYMA 2D2WA 3NWBA 3C3WA 5E1BA 1REPC 5L3EA 1QPMA 2H00A 3C6MA 5E9WA 5K0GA 3LCUA 3M33A 3I4PA 2G70A 3KEOA 2CYYA 2O3FA 2VONA 2EFOA 4IPAA 2IPQX 4XLNF 1SQGA 5BOXA 1WWXA 2IA1A 3VEPA 3GCZA 3ULQB 3KE2A 4CICA 3I5UA 4UV8A 3EPPA 2OAZA 3FUVA 4Q47A 3WU1B 3CO6C 3H92A 4L9TA 2ELHA 1FC3A 1IN5A 4A12A 3U81A 3HOSA 3KPWA 1K78A 4DCMA 2BZGA 1LVAA 4FSDA 1QAQA 2VXZA 4K2EA 3TOAA 3L9FA 4CWAA 1BBYA 2RVCA 2QZ8A 3TO7A 4M38A 2RN7A 5CYVA 2NP7A 3DH0A 1MGTA 3PFHA 5D5WB 4KIBA 3JSPA 3P2EA 2AXLA 3ELYA 3QPTA 2UZ4A 3P9CA 2FA5A 2VE8A 4MGRA 3J80K 1G3WA 3UJDA 1LDKB 4Z2YA 2B78A 2O06A 2Z3YA 3CUQC 5ICCA 3BWMA 3HCAA 3FTFA 3C3YA 1I4WA 4RTSA 1G4DA 1IXKA 4FS8A 2QQAA 2A69F 3EVEA 2JTVA 4RB0A 1IAWA 3AAFA 2XVAA 3NMUF 3C3PA 2DULA 2L4AA 4UHTA 3KEQA 4PINA 4LG1A 4MIKA 2DTRA 2M30A 2AN4A 3IRRA 3LPMA 5KS2A 1Z7UA 3HVJA 3NRVA 4EQZA 2YSRA 3BWGA 5DV5A 1R00A 2EV5A 4O29A 3C1DA 4RVFA 4UOEA 4O3MA 3QP5A 4LWPA 1F9NA 4K6MA 5CVUA 1J9IA 3F23A 3TQNA 1RZ4A 3DXZA 3HTXA 4NQWA 2XAHA 3DF8A 5DD4A 4FHTA 4FT4A 1I6XA 3F8MA 1TQPA 2M5WA 1SG9A 2XHKA 5ERIA 3R0QA 4R6XA 1NW6A 1MJBA 3M6VA 4EJOA 3TKAA 2ZBPA 2IVMA 4GBED 4Q5SF 3RTRA 4M9SA 5CVDA 4EM2A 3GRZA 4X1OA 1KYWA 2P8TA 3KETA 4LWOA 1IN6A 5FWDA 3G73A 3PX2A 5D8KB 5HFJA 2AOUB 2P7VB 3E97A 3GRYA 1AQIA 1WS6A 3SX0A 2UYCA 2TDXA 2PLYA 5LQCA 3Q5FA 4LFUA 3OOPA 1YZHA 5JVTA 3FMSA 1HQCA 3CJNA 4LK1F 4IVNA 4AWXB 1U78A 1XCJA 3G2PA 3IWZA 2VOPA 1F3LA 2XASA 2MLGA 2DBBA 2ZFWA 1X1CA 2JHPA 4GC5A 3WTVC 4IRGA 1L1EA 1XGSA 2MD5A 4CDGA 2XAFA 2ZLBA 3DUWA 3JWHA 2JHCA 1UFKA 2V1XA 5BQTA 4KA4A 3F6VA 1XCLA 1QQIA 2RDPA 4G6QA 3DOUA 1UB9A 3UWPA 4RVHA 5EOVA 3KPUA 3U1DA 1ZRFA 3GO4A 1ON1A 3GFJA 1G38A 4LG0A 4UVCA 5FQNA 3NWEA 2C7OA 2PX8A 3IC7A 4DF3A 3FTEA 4KYWA 1MD0A 4CTKA 4M6YA 3RJPA 2JZYA 2GXBA 1J59A 1Q1HA 1JQ3A 1XDZA 4JXJA 3M7GA 4QQNA 1QANA 2P8JA 2PXCA 3R4KA 2F5CA 1BC5A 3ROUA 1N7JA 2PGXA 2P7IA 2PBFA 3G2MA 2ZIFA 5D6EA
chains in the Genus database with same CATH superfamily
1AH2A 1II8B 2D1TA 2EV6A 3AP3A 1KA8A 3GFRA 4E5VA 4UBLA 3FTDA 4F6RB 3EZGA 2ZAIA 1L3IA 3OIDA 3BGOS 4DADA 1O7LA 4DCTA 1HDPA 3WDMA 2QUZA 2Y0BA 3VX3A 1MQ9A 2ZQYA 4NZ9A 2BJWA 1X0VA 1G5PA 1K7SN 3PNOA 4V2IA 5GVRA 3M0EA 4XKBA 3TZ6A 1Q92A 3O3OB 2HI3A 3KZYA 3LQQA 1K79A 2WD7B 4IO1A 4EG8A 5BQ5A 4I3FA 5T3UA 5D4RA 1UBRS 3KP6A 1DQUA 1IC8A 1KBQA 3A0RB 5AJXA 2Z8ZA 3NVAA 3GLGB 1BL0A 3WLJA 1G6HA 5FTKA 2JBAA 2Y1KA 5AKGA 4MMXB 1SFRA 3NTVA 2BEJA 2EX1A 4KPEC 5G0UA 4CA0A 1JW9B 5TMBA 1R9JA 3K2BA 4GO1A 3AUAA 4IDPA 3G7UA 2I2XB 4L3VA 2CXQA 1QTRA 4UU1A 1YVPA 1Q6YA 3KE9A 1E69A 2NTEA 5FOXA 1SCNE 2IDJA 5KU7A 1ZG3A 3A25A 4L5JA 1D2EA 1NUAA 3LHDA 3H9BA 4QUHA 4HV4A 5BR1A 4MEXF 3RYHA 9MHTA 5D6NA 4G4SO 4BJ5A 1W36B 4DLBA 1E79D 3REQB 3MVEA 4UOQA 1AUQA 4MQ5A 1IQ0A 4BNUA 3T5GA 1ZMRA 3FSGA 2NYUA 4DRXA 1T9GS 1NPTO 5DBHX 3MQFA 3DAPA 4M3NA 2KWIA 4UVDA 2NPOA 1IVSA 2IPXA 4BJ6C 1TL7C 1MKYA 3CKLA 1U81A 1Y4SA 4OXXA 4WN9B 4WI1A 5LWQA 5JIBA 1AZTA 2RGUA 1GJRA 1QPBA 3AF5A 3WTXC 1FVOA 1UJBA 1SVIA 1YJQA 3AVPA 3NHSA 3SZUA 4ZTUB 2BH9A 2OBBA 3SQLA 1WI3A 1AO0A 1F5TA 4R7TA 4EJ0A 4HWSA 1Y3BE 1HSZA 2H08A 4ABTA 1BSVA 5LOVB 4N3BA 3GBSA 4GP7A 3ZWMA 4K6FA 5KNDD 4OIQF 3CJQA 4LCBA 1R37A 4IZZA 2QX9A 2QN2A 1PT6A 1GDTA 1T0BA 3U4DA 2Q41A 2VXCA 3NHYA 1ENZA 2L9NA 3W5IA 3G17A 5C18A 3OM0A 5KTOA 1TQ4A 1T6XA 4PC1A 2D4HA 5JYEA 4HEA2 4AZVA 3M6LA 1X6VA 2QORA 3R3VA 4GFBA 2W90A 1FRFS 3DSRA 4BNZA 4RDXA 2ZB2A 3FVVA 5EXEA 4DNXA 5FFZA 5A1JA 4ACBA 2ZB3A 4QECA 3JR9A 2HL6A 5JAPA 5AWFC 1VJ1A 1KMCA 2RK4A 3B89A 3NYQA 1HI9A 10MHA 2DMNA 3QHQA 1ETKA 1QTNA 3RS5A 5ALQA 4URYR 1H2WA 2JATA 4WE3A 5GP1A 3ZCTA 3GLKA 4DV6B 3EUHC 4G6ZA 3QPCA 1RRCA 5CITA 1FOKA 4OQNA 3IHLA 3IMCA 3M1IA 4CIVA 2IYWA 2XA9A 1D2NA 5DBGA 5KYVA 2SHKA 3G1OA 4KQIA 1NRJB 4UUAA 1YDFA 3FPSA 5JPDA 2YZMA 4MR9A 4K6HA 1YTYA 4P4TA 1R0RE 1R4MB 4ZCIA 1XJQA 4KKXB 4TXJA 2NZVG 3IOBA 2RG7A 1FJLA 2V74B 1ZGZA 3U7IA 4YMIA 4J3FA 5FTNA 3CP8A 2WWTA 4RH0A 5ILGA 5ALIA 2ID9A 2F55A 3TIXB 2VT2A 3F0TA 1IJKA 3PGVA 4IDHA 1MNMC 5L7TA 4BXFA 3NWPA 5HP4A 2HHAA 4DLKA 1I2MA 2FYTA 1AG9A 4G4SP 5IJWA 1XO1A 3IQXA 4NEQA 2AC2A 4OHVA 3LZDA 4MB2A 4CKWA 1PBTA 3DZFA 2O5CA 2GFQA 3E82A 3PQKA 2DFVA 1LH0A 4CGZA 4RDHA 1ZVJA 3NFRA 4I9HA 4Q48A 1LQ1A 1IXSB 4Z4FA 5BMVF 4ZIRA 2RAPA 2HCTA 5ALOA 5KOHB 2H63A 1VCIA 1F0NA 2W11A 1IJWC 3W6VA 4Z3KA 4NZNA 4XKJA 5DYGA 5J3LA 4JCOA 3DP7A 4PTLA 4UDXX 3RCBA 4W1SA 2EYUA 3DOHA 2VNHA 2WAYA 3OL3A 2C97A 3E6DA 2C4WA 2ALJA 5FYQA 2D8AA 4R1HA 2VTDA 3EGXB 2X5XA 2VHJA 3FCSB 5FWYA 2Q0SA 4RPIA 3IBSA 1GQFA 1ODLA 3RIXA 1TT5A 3J81K 2C7VA 3JASA 4A73A 1I36A 3F9RA 4JUCA 3TW0A 3N2NA 1PFVA 3H5WA 3ETEA 5CFOA 2NNWB 1HMPA 2HA3A 4HB0A 1DX6A 1EGHA 5IY5H 2I4MA 4KQJA 4X1IA 2AOTA 2VATA 5HDQA 1Z0IA 3EAFA 5DK4A 2QM7A 2QLNA 3ETHA 3TXYA 4MUXA 4V0SA 1KOFA 1VG1A 3OZWA 2YX4A 3Q3JB 3EGVA 1R8JA 5CXQA 1Z73A 4WJLA 3NQ41 4MRPA 3PJDA 3FW1A 4HBZA 1HQKA 5E2AA 5KK1A 5DYTA 4HEHA 3FOCA 2C5LA 2HSWA 3DDNA 4KO8A 1YV9A 1CD5A 3WLQA 1FW6A 4RD3A 1ZBDA 1TCUA 1G6OA 5IKXA 2WV0A 2O7RA 1RRMA 1YRAA 2PRZA 3FYDA 2NXCA 3ZWQA 3ENZA 3DE2X 2L0XA 1E6UA 1MOPA 1YB1A 4UAJA 3BD7A 5HKBA 1M1YE 3LZ6A 4M37A 3A4NA 1FUIA 5C4MA 3IAEA 4W97A 4BWFB 5JUWA 2B5OA 3JATA 2ZZKA 4EY5A 3IQZA 2LV8A 3R75A 3NYRA 4K6KA 1Z37A 3IUOA 1CFZA 2V6IA 3VR2D 2YS6A 2DQLA 2J8ZA 5JLJA 1XQ6A 2CD9A 4FHGA 3SNKA 1DP4A 3ZZNA 4XLCA 3A7DA 5JEDA 4P53A 2V7QA 4DLZA 1F7VA 4C14A 1G0NA 1B9MA 2VSOA 3A6KA 3U9LA 5I7OA 2KBFA 3SAJA 5FR1A 1VYTA 4Q3BA 1PTKA 3W7BA 1VPTA 1LJ9A 5B1EA 2ZYIA 1CXZA 5ERXA 3PDUA 3N7UA 3DDOA 3PICA 1RJEA 1PK8A 2W7NA 1RI1A 2JDID 3THSA 2RQPA 2J4DA 1G9TA 2X41A 3DE7X 3BIXA 5HIKA 2MSLA 2GI4A 1GQQA 3Q6MA 3ERMA 4G24A 2C7QA 1AZWA 4FT8A 2NT3A 5JANA 3ZWDA 1TQ6A 3EBPA 1Z0AA 4A3SA 2YVQA 1WV1A 4ENSA 1PKXA 3L9XA 4J1TA 1Q15A 2B0CA 2VSFA 4ZYAA 1NXTA 2F8LA 4Z9XA 4EKEA 4H7PA 4XVHA 2GBLA 4FOTA 1NW7A 3LAPA 3WB9A 2Z9BA 2OXEA 4LDRA 4FKMA 3AUUA 2AFIA 2YV4A 4DSUA 4H6WA 2XJ4A 5G1NA 2E55A 3EMVA 2JLSA 3VI3B 4OU5A 4WX2B 4PPNA 3HHEA 3O91A 2WJ3A 4JLSA 3SEFA 3A03A 4EKYA 4J0QA 1T2KA 3OTIA 2FBHA 4GUAA 3LRXA 1KI3A 2VP3A 4IINA 2E71A 3QWHA 1GARA 2GJAA 5I9LA 3C70A 1QQ6A 1NLUA 1R71A 2QAGA 3FK6A 3L41A 1H5UA 4Z3DA 1CS0B 3E53A 2W8ZA 2WJYA 4FGUA 4HDUA 2HU5A 4OJNA 3FISA 1MBGA 4OWRB 1C9NA 3B6JA 3ABZA 1VJ0A 4XM1A 4ZVPA 4G1EB 5DTQA 2OO5A 2ZSJA 1U3EM 4O2LA 1UJ8A 4X85A 3K10A 2JMWA 1H2HA 2IL1A 1VCMA 4F12A 2KHZA 3A9SA 5A6SB 1U0LA 4HMPA 4OJMX 3BJMA 1FQKA 1NFQA 3IB6A 3HYTA 4C2MJ 4ZRDA 3VAAA 4B7AA 3WV5A 2Q2WA 1C0KA 3OAAD 4KXQA 1WDLA 1AGPA 4UD2A 1G3IA 2DMUA 2JGFA 1WX1A 3LX6A 4C04A 4DBQA 3V8PA 5EFOA 3ZU5A 1DAPA 1TECE 1MZBA 4HGNA 4AJHA 3G3ZA 2V6CA 2RAVA 4NMHA 2BT4A 3FSRA 2VDWA 1FRZA 4CQLB 2KIQA 4H0EA 3I45A 4O1MA 3FYUA 3LKZA 4D9CA 4D44A 4ZVVA 3BDDA 1GR1A 2JSCA 5KSYA 3B1YA 5JS8A 2QVLA 1MJ5A 2WT8A 2AOWA 3NDIA 3RSQA 1H88C 2OVBA 2AG8A 1K6JA 5I7FA 3IERA 3OTOB 1U1DA 1PRYA 4ZA2A 5BPIA 4LZOA 2HN9A 1K8XB 3UAYA 4UV9A 5EZQA 2AEEA 3QA9A 1J2XA 1YZTA 4AZ3B 1KA9H 4CQMD 2XVCA 2ZJRF 4E11A 5AICA 2AD5A 1Z7LA 3ES9A 2L5QA 1YFZA 1XRSB 3H05A 5L3GA 2YQZA 3H9UA 3RYHB 2PXAA 2A78A 4KYUA 5I8ZA 1UMQA 2FCRA 5IJAA 2FOIA 5DSXA 4AF6A 2EZIA 5DJ5A 3GEMA 4TSRA 4ZEXA 4R2HA 1ZQ9A 4NHJA 4NESA 1HR0B 1MJGA 1POWA 4FI3F 2O54A 5JVGF 2I9PA 5E1MA 1M0EA 2X0KA 1E1CA 3JWJA 3R7WA 3ZEIA 3GARA 4QSMA 3EULA 1XD2A 4YCDA 1JMVA 3P27A 4URXR 4F6CA 3RV3A 5C8ZA 4XWTA 4BLUA 3UFBA 2GZ3A 1YL6A 1GNQA 2DGDA 3V1YA 2PUEA 2ZC2A 3C85A 3K0CA 2W2NA 2O59A 4GYWA 4Q7MB 1ZUIA 3IIIA 1Z3IX 3OPYA 3TQCA 1IEQA 3O8HA 3K70B 2WB1A 4IIJF 2AXEA 4X66B 3VR4D 5AVXA 3ZQCA 4C7VA 1WZEA 5DISB 3H83A 4G7OF 1NVUQ 4MYDA 1ES9A 2RCNA 1R5JA 1GQ2A 1UKCA 3CDIA 4RHUA 1L4GA 2XRMA 2BAGA 3ZW8A 9GPBA 3BQYA 2P4UA 3GT3A 4P4NA 4KUEA 4RV4A 5IX8A 1FJ2A 1LW6E 1AS2A 2VPXA 3EOZA 3C3EA 2BVNA 1QH0A 4TV8F 1CQIA 3ETNA 4IKFA 4Y1GA 4IUBS 4AUEA 2ZETA 4JP5A 4RS8A 1A95A 2BEUA 2WM8A 4LHZA 2H1FA 4DYHA 1L8QA 2BEWA 2A30A 4YUAA 4YROA 1M2JA 5F0CA 3RAFC 5CNJA 2JA1A 3PUYA 4LTMA 1W4AA 5HDKA 1YA6A 1MQSA 3KEFA 4MP6A 4JVSB 5M5WJ 4E15A 4OINF 2NVOA 4JVLA 3LU1A 3HKDB 4KO4S 5JE8A 1KQOA 1LPNA 1H0RA 2YU3A 1JHUA 3ZS9A 2I33A 3EVDA 1E3IA 1B26A 5EJ5A 3EC1A 5FKMA 3IR7A 1D09A 3GL9A 4BJ1A 1RC8A 4MR9B 3UANA 1BWQA 2QRKA 2X76A 3CYFA 1MNEA 2WU4A 5BT8A 4GOJA 5D8LB 4LDQA 2QY6A 1H8ED 2AW5A 3B2EA 1V8BA 3OIWA 4GOND 4WOCA 4EB6A 4F4HA 4BQEA 1EWRA 4AU7A 1JXOA 4BBRJ 1BE6A 2GFHA 1KYVA 1PU2A 4RFSB 2GBPA 4LBYA 4TTTS 2PA3A 4FGJA 4F93B 1TF5A 1MOSA 4UCWA 4CKWB 4BV3A 3KT3A 1NVGA 2UVQA 5J8CA 1JAIA 1L4HA 1IJBA 1UL1X 3KYBA 1L7NA 2I6SA 1VL0A 3TVYA 4FDLA 4ZIRB 3DEFA 1M83A 2ANCA 3QF7A 2LF7A 1XRLA 2UXDB 2DQ4A 4AMUA 1QH8A 4PG5A 1SD4A 1MEEA 3HR7A 4DV4B 5JTTA 1SOWA 1N2JA 4HFRA 4P34A 4XR6A 2A5FA 3ZY4A 4B9EA 1C9KA 2R86A 3ITEA 3JWPA 3B3GA 3MKZA 5FOQA 3PE3A 2HLHA 3W4JA 5EJFA 4Y6QA 1W1UA 4XQEA 2A9FA 4N76A 3E22A 4QJ3A 5CGQB 2N42A 1XRNA 3DOFA 4NQZA 3AERA 2RJ3A 2AZ4A 5B3AA 2HK9A 2ZPTX 3MHTA 4C5CA 5LU9A 1FJXA 3DEKA 2NGRA 2F3TA 3Q3EA 4ZU6X 1BU5A 2BFFA 2W98A 3W5UA 4XN0A 3TZCA 4E2ZA 1LS6A 3AVVA 4C7BA 3P0FA 3OEHD 1YH3A 2DBYA 2BKAA 3L8EA 4N8SA 4UM9D 5DSZA 3UJAA 1CY2A 4FYPA 4BEHB 1T4DA 1BHO1 1M1YB 2EFWA 3OX4A 3D81A 3RS8A 4LMYA 1B8NA 2NU6B 4I5DA 3G5TA 2QE7A 1YBMA 1YHZA 2IKQA 4YRTA 3PXGA 3P7MA 4A16A 4P36A 3B12A 3V32A 5CLSA 8ADHA 3B73A 1PT5A 1FBSA 1GM5A 2ELKA 5EJCA 3NYIA 1X3SA 1P4RA 5F98A 1QRSA 4YPFA 2CVOA 2Z8YM 4JEMA 2CLKB 1F8FA 3E9QA 3IQWA 5JHGB 3QVGA 4GIBA 3G9XA 5TB5A 4RWEA 2C7RA 4DM7A 1HL7A 4RMIA 2B4YA 1WUHS 4JYBA 2B7BA 2ERYA 4X90A 4LZPA 3R60A 4NYJQ 3BXOA 5A71A 3E5NA 1D1PA 4KWHA 2SICE 1WFXA 5K6AA 4C0LA 4KRFA 3KUXA 5IBQA 3IO3A 2B4RO 3CKMA 3R3JA 4QU9A 2QRHA 3T5CA 4L50A 1J1ZA 1UJMA 2KT0A 3A6LA 3ULQB 1I5RA 1L7MA 4P1WA 3I2HA 4QM6A 5KTRA 4WFJA 1N6PA 1DZ3A 1EK2A 2F3QA 4ND5A 4MWCA 2JLQA 1QIKA 3CF2A 3BXXA 3W8FA 4K2EA 4DA9A 1PEDA 4DTCA 1Z0FA 2B1GA 2ZAGA 3G82C 5I4IA 1K7YA 3ROEA 4KT6A 2WIAA 1E3HA 3PDIB 2XRLA 5HJ7A 4ALJA 3DV0A 1NLZA 1K9SA 4WINA 5TVKA 3WJ7A 3UR3C 4P3YA 1QB7A 1Q0LA 3QMPA 3PNVA 1WKCA 3KQHA 4UHTA 1TD9A 4JT9A 3M3PA 4DJEC 1XX6A 3AY3A 3KVNA 1WTAA 1HA8A 2Q07A 2PGJA 1Q19A 5DGIA 1P77A 1UJNA 3D54D 1RZ4A 1CQPA 1KU6A 3ET4A 1JT9A 2O19A 4YQYA 4FHTA 1K4KA 2A9QA 1TWHJ 3RVRA 4L9SA 5CFNA 2XXAB 4D25A 2YIDA 4F4CA 4B3HA 3AI1A 3RIGA 5J43A 3ZQHA 5D3ZA 2GO7A 2FX2A 3AVWA 2SCUB 2X0JA 1GN9A 2FTKE 4RMHA 2ZATA 2RHMA 1AQNA 1V25A 4LVCA 4MK4A 3QH4A 3CRRA 3WGVA 1NJFA 4TS4A 1F3LA 4HFNA 4Z1MD 3VNAA 3C5WP 4ENTA 3CMYA 3RKSA 3DS8A 1ISMA 3GVIA 1UFOA 2PPLA 3GC6A 4UJ5A 4O8CA 4TLLB 2IOYA 3SDBA 1ADGA 2Q3DA 1NJSA 1NATA 5C81A 1R3UA 2AHQA 5C52B 621PA 3PGXA 3RH0A 3M7GA 4QQNA 2DHQA 1D0YA 4MGKR 3LA6A 1S0UA 5E95A 4D2IA 1YI1A 3KQNA 4HHEA 4B80A 3GFBA 5LM3A 3MN1A 4Z4EA 4IOKA 2TECE 3F5DA 1TM7E 4DNCA 4HDQB 2GB4A 1T98A 2GCPA 3U7JA 3HCRA 1Z0SA 2R8EA 4YTEA 1H2AS 3EXG1 2EX4A 2RH4A 4I46A 1XTKA 2DM6A 2FX0A 3GWZA 2H31A 3UJ3X 1LB1B 3CLTD 1GNSA 4QXPA 1IRGA 3JRFA 2AI3A 1L8LA 3K5WA 4A6XA 1RYBA 1DJQA 1QPGA 5EZGA 5E8IA 1D5YA 2WR8A 3K4CA 1VKNA 6CHYA 2VDWB 5CDTA 3QE3A 4WKBA 4ZJYA 5C5EA 5EZYB 1H1TA 4QDZA 3JYQA 1CEQA 4P31A 5FEMA 1H0KA 3HYSA 2QMYA 3AO0B 1JQEA 3ICEA 4L9JA 1GAJA 4HV6A 4PPQA 5A03A 3KT0A 5AIAA 1C7EA 2GRJA 1PWZA 3D4IA 5FI0B 4MV9A 3DVLA 4P4UA 2GETA 3C7JA 4NPHA 4Q18A 3V4SA 2YC4C 4NZPA 4A03A 3OIQA 2CQXA 4Q34A 4JGGA 2DFHA 3G7NA 3DAYA 3KC2A 1M7HA 3HR8A 4Q9DA 1ZLYA 4NK4A 2IX3A 3NGMA 1Z33A 1RYHA 4RYLA 2O9LA 4GQBA 1UHWA 1Z08A 2OLEA 4J0KA 4C0SA 4L28A 3FBTA 1DQZA 5AK3A 3SQXA 3JQEA 4MHGA 4XKWA 1TLTA 3WGGA 4HI0E 1JDTA 4KMFA 1ZQ3P 3W8RA 4MAAA 5HUHA 2PMZA 4A0XA 1HW1A 4P3XA 4MJ7A 1PEKE 5CDGA 3NH6A 3OY9A 2QAJA 1QO0A 2M1ZA 2GEVA 1KGSA 4XYMA 1XB4A 3M6UA 1E1CB 4Q39A 3WY9A 4HYTA 1N34B 2VF7A 1RMTA 1IUPA 4LDZA 2HEIA 2OXTA 3ELKA 4BBJA 1L4BA 3G7SA 3T0YA 3SXJA 3QVSA 5BWBA 1R7JA 1TBXA 1NG9A 2CMPA 2QA4I 4QGSA 4BN4A 1W88A 3K0FB 1E1RD 2H8RA 3PPWA 1KDVA 2I4NA 1JMYA 3QUQA 1RXEA 1KYTA 5G40A 2R6GA 1GQRA 2PV7A 2A86A 5CBPA 1BX1A 3THXB 4JVNA 2X8JB 3WWEA 4WOKA 2MH2A 5FNVA 4HG2A 4ETWA 4ICIA 1PYGA 1Y6FA 4JODA 2BFAA 1X7DA 3PJFA 2V9PA 1MZPA 2IEKA 4K86A 4QBTA 2EIMH 1GSOA 3U3DA 4XZ3A 2LCFA 1E2KA 2K86A 2M6SA 4C6HA 3R61A 2CXNA 3RSHA 5SY6A 2QENA 5E8JA 1JR6A 3GF2A 5F9MA 3KELA 2ZT7A 3ZVLA 5B58T 1DKMA 3GTJJ 2C6YA 2BEUB 1P75A 1ZRMA 4DTIA 2GR9A 3MF4A 2NYRA 3W6ZA 2E5WA 1YE3A 2BEWB 2HPZA 3LLVA 2VDJA 2UUOA 2PEZA 3MGKA 5CEFA 4PYJA 1V3TA 5LU8A 1T26A 1DEAA 1C7JA 3EEQA 5ES4B 3QPDA 3IAXA 4DQVA 1X1EA 3E23A 4P96A 5LHGA 2JVIA 3BD6A 1NP6A 2WSSA 2DAPA 2X2EA 1P2UA 4TQ9A 3D0SA 3PGA1 3RG2A 2KHMA 1TK9A 5A4FS 5DI3A 1FRVA 4I7EA 2C2OA 3BR6A 2GPBA 4YLEA 3ENQA 3ROMA 1KEUA 4LC9A 2IVFA 2OXFA 4CEHA 2C20A 2BM1A 3KZNA 5L45A 2HMYB 1DMRA 3CC4I 3CUQA 1XPJA 1FOYA 3I71A 3W2TA 4HA8A 3PWKA 1TO2E 4G0PA 4F5EA 1ORWA 3F4KA 1U28C 1O7JA 1WMEA 4HR7A 2O2HA 4EJ6A 1SD2A 5EXTA 2ZGVA 2Z2XA 4IHWA 3I42A 3ONEA 2ZWVA 4DEXA 3DTVA 3M7IA 5A5DA 1RFGE 2VPWA 2UWMA 1J20A 2AV6A 1KJYA 1I0LA 3OQBA 3PSIA 4ZAYA 3P9ZA 2A5DA 3MAJA 4PY2A 5A3RA 3V7RA 4L9AA 3OFJA 1KHHA 5CT4A 2DR2A 3ZQFA 4MUYA 2BBSA 2XT0A 1GLNA 2DK8A 3MWDA 2LYCA 3UWOA 1W4LA 4LD5A 4NZZA 4X7MA 1J1UA 1ONNA 1QOQB 4JMLA 1SEUA 3AB7A 1M72A 2VCEA 1Z6AA 4RPLA 3EUFA 1K9VF 1QGAA 4U39A 3IT2A 2LTAA 3CNQS 1T5TA 3X1YA 2R7XA 2Y9ZA 3CTPA 2XKPA 1Y1WJ 2R97A 4B2IA 3X1MA 1QXSA 3EZ2A 3E22B 2QSZA 2CFOA 1HLVA 4G5YA 1Q20A 4A3EJ 4I8IA 3LDUA 3G0IA 1FTGA 4OAZA 3EFHA 1LVUA 3WLSA 2EB7A 1HY3A 1G2QA 1YZFA 3QLEA 2H1WA 5HDNA 1O6ZA 3QKRA 4FDMA 3W04A 3S2IA 1MAAA 4BLOA 4Y18A 3OJXA 2YCBA 3AMVA 3WI7A 4JC4A 3HCPA 2I5PO 3ZBQA 5C7YA 4UAGA 3U1KA 4F56A 4P92A 2PWYA 4P5DA 1U02A 4P7JA 2PLAA 4MUMA 3RANA 5CURA 4KRXA 4H2DA 2VN8A 4HAUA 3VO8A 3LA3A 4KZKA 4BZZA 1AX9A 4WOJA 4OAPA 3EQLF 3FMVA 4KYTA 2CLDX 2O8CB 2GCOA 3EVZA 2GKOA 1DBPA 2O3QA 2OGWA 1W25A 4TMKA 4I50F 1VKHA 4Y9RA 1YT5A 3L4EA 1QQAA 3VOBA 2VWHA 2WHQA 2ZRJA 4XIGS 1E2HA 1RSZA 4KFUA 5IDXA 3GCGA 1C3OB 1ZIOA 5C1PA 2J9XB 1T2AA 4O4LF 2C31A 4WGGA 2PNFA 4ISCA 1NF3A 1KETA 4QVIA 4PHHA 1IH8A 1U3DA 4Y67A 1PZEA 4G8BA 4A8HA 4A0YA 1T8TA 4I0BA 1L9XA 4GYJA 2CHFA 1HNXB 3QEKA 1X87A 4JJ8A 3RNOA 2FWRA 1K68A 3ZQ4A 3L0SA 4V2FA 5LZ2A 3F6CA 3HGMA 5CJ2A 4J4BA 2CWWA 3ICCA 3PLRA 1XD7A 4IDFA 4MGZR 4QTZA 2ZE6A 3WGMA 3D2LA 3M6WA 3L07A 4A91A 1QTIA 2ZWAA 3C3XA 4CCWA 2QTCA 1ZI8A 3PUWA 3U7QB 3SC2A 4IQ4A 4C07A 1QU3A 2PDAA 3I9LA 5IRCD 2QJOA 2XGCA 2B9EA 3DV0B 1FPMA 7ADHA 1KAMA 3SXUA 2ZSHA 3C7KA 1RAIA 2O07A 4B3CA 3HSFA 3A05A 2JRMA 1RZ3A 5B1BH 2FSHA 3UAWA 1Z2OX 5B12A 1IRIA 3PFNA 4RVOA 2H16A 1O4WA 4XGNA 1UAGA 821PA 1T6NA 1S7AA 3D4LA 2PVPA 3HZZA 1X2MA 4BJ3A 5AVUA 2C98A 4B3SB 2IS6A 5TVGA 4PONA 4BHCA 2MLKA 2F00A 1ANKA 5CNIA 3W2GA 2QN9A 2IVZA 3H6KA 5JV5A 3T54A 2F4NA 1VXOA 4Y0VA 3DWIA 4YFKF 3KXLA 5HW0A 4NMXB 3WODF 3U7RA 5G4KA 4XQ9A 1P5RA 4EW3A 5MF6A 4IFTA 1S02A 4QRHA 3OE7D 3EHEA 2HPMA 1EK1A 2E87A 5L3CA 3KHUA 2Z6AA 2KJCA 1UKYA 3QG5A 1NBMD 1Q57A 5EJEA 3N8KA 3B5IA 3DM5A 3Q7EA 4AY6A 1Y5LA 2FRDA 1ELOA 16PKA 1T8WA 4Q1DA 3V7UA 1P7CA 4BUPA 5LXTF 1WB4A 3HM2A 2K7FA 4Q05A 3MJRA 3S2UA 4M4SA 5EIFA 5J8FA 4JOBA 1KDOA 3IUYA 2Y27A 1JJ7A 3PQ3A 1ZCFA 1BRTA 4WBNB 5BN5A 2BZ0A 1ZNQO 2XNKA 3IP8A 3GX4X 2XHEA 4NV0A 3NCTA 1ZOSA 5EG5A 3SYLA 2HF9A 3H4MA 4CZCA 3EYIA 5NLLA 4P3NA 5DUIA 3L6EA 1I2ZA 3ELDA 4EKIA 3KP5A 1XTZA 2BW3A 3I0TA 4KWCA 5A6VA 3JCUC 1Y8ZA 5TGDA 4CV1A 1RYFA 5E2BA 5LC1A 1P4JA 2UZAA 1R9NA 2YJ6A 4Q00A 4Z3OA 4A5OA 1SUFA 2G25A 3GRRA 4MS1A 3CPHA 2VK1A 3TDKA 1M2VA 3QFRA 2WPDD 2ZXJA 3AIKA 4CTJA 1FLNA 2PMDA 4RHTA 3RU2A 3SBXA 1G59A 4BB9A 3WHPA 4ECEA 3FBGA 4GKAA 4M60A 1W48A 2Z57A 5CCXA 4BGVA 5K3SA 4C2TA 2OSBA 5EXDA 1SQ5A 3RODA 3X1DA 5KVAA 3LUBA 1GL9B 4CLOB 1XTRA 4ZT6A 4CXMA 3WDSA 4B3FX 3Q3GE 3CLRC 2QZSA 2WBLC 4MP8A 2OGTA 4LJSA 3MOGA 4M46A 4ZVTA 2CBXA 2ORVA 1V45E 4AG3A 1P1KA 4UTPA 1BS9A 3TX2A 4LFCB 2HO5A 5IJ0A 3GNTA 4ZAVA 1LJUA 1SFUA 1AQJA 1RUOA 3EQZA 3ASOH 3CLVA 2A1TR 3EH1A 2IP2A 4YAGA 3QU3A 4WJKB 2Q6IA 3KP3A 4EHHA 5IXJA 3VC1A 1FUEA 1XCBA 3P20A 4MS3A 5HR5A 5H4HA 4KB5A 1KC1A 3G8YA 2NSJA 4OLHA 3GP8A 3OG9A 1E3WB 1NFRA 1SCQA 3ACDA 1T9AA 3FPGA 1KMHB 1MZVA 3E9NA 1P4WA 5K0JA 2Y2UA 5HDGA 5IP5A 2QN1A 3TF5A 1N7IA 5I45A 2BHRA 1NTCA 1W88B 3SEQA 4PC3A 4Z4HA 1CF2O 4ZCSA 5JJBA 3PNTA 3ZUPA 3S8MA 1H69A 4CCYA 4Z6KA 4LDJA 3CF0A 4RESA 1IATA 4UM5A 5ILUA 4ISBA 3KKZA 4XM0A 4RY0A 3ZS8A 4IYRA 5FI5A 2CMGA 4CTOA 4KO3S 1LUJB 1ZYRF 3AKCA 1HYQA 1RHKA 3OQIB 5PGMA 4CIXA 4WUTA 4JUIA 2DT5A 3WB0A 3F5SA 1NBHA 4AP9A 3QU9A 2BGKA 2Y1XA 5KMGB 1B6AA 4IJAA 1CBUA 1UWLA 2NXEA 4TYWA 2FK8A 3BFPA 3FOWA 4RJIA 3L8MA 1QX4A 4P4SB 3OSFA 4YQFA 1S3IA 3PQJA 1VIAA 1J2UA 2IRWA 3M5PA 4PRZA 3Q0UA 5TF4A 3H42B 1JG3A 1CQJA 2OPBA 5GGXA 1LEBA 3Q10A 3QLVC 2KSQA 4QJ5A 5F7OA 1JDNA 1D4OA 2R7LA 5GTDA 1K3TA 2GJ4A 1MO3A 2P5UA 3D5RC 1MAVA 4IZHA 2OORA 2JSPA 2C9BA 3UF0A 3WGLA 1Z4MA 2PH7A 5CDFE 5DXJA 2OV6A 5D87A 2QOEA 3KDSE 5DNWA 5IJ9A 1GV0A 2VKQA 3ZE2B 3LI2A 1E3JA 3IJ5A 1BR4A 4LF5B 2Y0EA 4N4NB 4UUMA 3DFZA 3O2NA 4KFSA 4ADSG 3FNFA 2QSGX 4Y33A 1PTJC 6PFKA 1G2OA 5JADA 2V4UA 1P31A 3BXPA 2EGGA 4OV6B 5KQGA 1NGSA 2HKXA 3WSWA 4CV0A 1NXQA 1VSBA 4D45A 2O5RA 4D6YA 3UG6A 1J25A 3ZDRA 3S4YA 2YR2A 1WCYA 3ESBA 3B9PA 5IUKC 1G0OA 3UT6A 4KICA 3U3ZA 2BEVA 1PJSA 4OQFA 5JHUA 3U62A 4QJBA 4E3WA 2GHQA 4IZOA 2JI9A 1QV9A 4FE7A 2ENUA 2NUTB 3LBHA 3WLFA 1HDZA 5CYOA 3S3OA 5EINA 3LKBA 1KJJA 2ACKA 4PU0A 5JS6A 1SXJC 1GPH1 3T9FA 1UBMS 3X3HA 2BCEA 4LGYA 2X9NA 1N5MA 3RBAA 1K7AA 5IAJA 2ARKA 1NVAA 3O4JA 1X9IA 1KPIA 3L43A 1EF4A 3JRNA 3FUUA 3RV4A 3QU4A 3FM5A 1QZTA 3NBUA 5E9JA 4BEWA 3MWDB 1UK6A 4F3YA 1ZIXA 3V3KA 3THYB 4P3KA 1BMDA 3ZQIA 2OBXA 2PYDA 1SU7A 2X8AA 2E1PA 3SZTA 5DS9A 2D5AA 5D85A 3IH4A 2FPWA 4LJ7A 1WPKA 4KXFB 3F5QA 4DYQA 1RYNA 4UHCA 2EJCA 4BVAA 4Z9AA 3AF3A 4L4UA 3EVBA 4BWVA 2KBEA 2C1ZA 1LUAA 4FNGA 2XDQB 3MEXA 3UQYS 4P3OA 1E64A 1JSZA 4KO1S 1QZZA 4O08A 4IV0A 3JR3A 3CN9A 1ULUA 4M0EA 4Y9DA 3TH5A 2PJUA 1B6GA 4HPJB 4FHFA 1ADJA 1LDJA 3RVLA 1QO7A 1JMKC 3NBXX 1C1DA 3SIXA 4BAGA 5L3FA 1N8KA 4NRDA 3BY6A 2XE7A 1DVRA 3LMKA 2ZCUA 4WW0A 3PPXA 3QYJA 5EUCA 4HSEA 3QF4B 5KTTA 4GI1A 3GHYA 3VKUA 4DCUA 2H9IA 2STWA 1XZKA 4DARA 4KACA 1E2FA 1BXGA 3JX9A 1MR3F 3W6KB 3DZGA 3UMSA 3ZYZA 2R5FA 2ERCA 4PCUA 4CU2A 4ZDIA 3NDPA 4Q1CA 4YJ2F 2BR5A 1MNQA 3OYDA 3TE7A 1E0SA 4WSOA 3ZWNA 1LNWA 1PNOA 1EHIA 3U49A 3IFSA 4RS3A 3KUKA 8OHMA 2VI5A 3C97A 2XWQA 5EL0A 4UMEA 4OA8A 3BMNB 1W0JD 5ETJA 1W29A 3MQ2A 3CBGA 1J4AA 2WHYA 1NRXA 4MULA 1YJ5A 2RHLA 3CFYA 1T2NA 3S5JA 1KSFX 2FLWA 5GV7A 4DCNA 3V1NA 1WNTA 5EUQB 2B3TA 2FFQA 1YQXA 2Y99A 1B8IA 4R3NA 1XNQB 2QUJA 1ON2A 3A4TA 4II2A 4LV6A 3KZMA 1VQ5I 4OXRA 3HVUA 5FLXZ 1SXHA 3DOJA 4JK3A 3W6NA 3PL8A 1A4RA 2H00A 3I4PA 4WNAA 4XWAA 1NNSA 3COWA 1WZUA 2EBHX 4N8EA 3H5VA 1QG2A 4HWPA 4OHPA 2GTIA 2ZQ5A 1TVMA 3TG2A 5KHAA 1ESDA 2DC1A 1ZVVA 2QGFA 5G41A 4LXGA 2H4JA 3D0QA 3GW8A 4CWAA 1BW6A 2PL5A 4F3TA 4JI7B 2GXUA 3B6MA 3SC2B 1XPXA 4E1BA 3U0BA 3LGXA 4LEIA 3WKAA 3UJDA 2HXYA 3QUAA 4WASA 3SXUB 1Z6ZA 2ZSHB 2CCKA 1WHSA 1I4WA 3HFSA 4JI6B 3SF8B 3ULKA 1IXKA 4O33A 3HB4X 1ZRNA 1RQNA 4IIUA 4E22A 3I6YA 3WLIA 4ZYXA 4XM2A 3ABSB 4D79A 3B13B 3EPZA 1A2OA 2JLBA 4OF4A 4E7LA 2H3HA 1NK2P 3E5MA 2I29A 4K9MA 3P52A 3EW9A 4PIVA 4GGPA 3T7DA 5HWSA 1W5CC 2IVMA 1KC3A 5HMLA 3N8HA 1F0KA 2BMDA 4DDMA 1I94B 3UK1A 4EM2A 3GRZA 1MMNA 3OY2A 4LWOA 3C1UA 2BGIA 4EY7A 4JSYA 1I80A 3NEAA 5FBLB 1WS6A 2BOVA 2IQ5A 5JVTA 2ECBA 4OI0A 4W8OA 1NY6A 2ADOA 4MW2A 4EPYA 4RD1A 3THOA 1ZGBA 2Y6UA 1X1CA 2ZFWA 4UAUA 5D84A 5AW2A 3WTVC 2AMJA 1YUMA 4CDGA 3OCZA 2XAFA 4IJ6A 3W2WA 2G0EA 1IEXA 4HZIA 3F6VA 2O8KA 4C76A 4K2HA 2LG4A 1SK9A 4LMAA 1FFBA 4BAUA 4OHZA 1XHLA 2EZHA 3RPUD 1VQ7I 4UPVA 2KPMA 3D1LA 1EHYA 1EP2B 3IAAA 3I6IA 2ZIFA 2PWBA 3GBGA 4INZA 4YV1A 3AF0A 4LLGF 1TJNA 4DZPA 5FWNA 4HXEB 4E6PA 4EYSA 3ZWOA 4KVGA 2I65A 5JH7F 4Y30A 3MWKA 1OFTA 2IC5A 1HE2A 2EKLA 3GDGA 3QVXA 2PBIA 2A9JA 2P1ZA 4K9NA 2OMKA 3JYPA 3A3YA 5IC5A 3NWTA 2DPDA 2DEUA 2EHDA 2FBIA 1CUFA 1Y1KE 2WSYB 4NCAA 1M2VB 2H57A 4U88A 4W9NA 2JI7A 3DHYA 1YYVA 4Y9TA 4RLHA 3K9CA 1AK1A 1YE5A 3QXSA 4DPKA 3NTRA 4FSHA 3VPAA 2XA2A 3JCZA 1NVKA 2F6RA 3WXMA 2H1OA 4ASUA 3AW8A 1SMTA 4EEFG 2C9OA 3C1TA 4X1KA 2WA2A 2OECA 3OC0A 1A9YA 1XZ8A 2XKJE 4LSMA 4RK5A 2ZCJA 1WXWA 1DO0A 3NOQA 2NUAB 3OFKA 1O87A 5KX5F 3O9ZA 3D3QA 2ZDQA 3KYJB 4D9MA 3FE2A 2Z4SA 4OX9Y 4X6LA 4DGSA 1MC8A 1YR9A 2GK7A 1EGVB 2BLLA 6AT1A 5A2QZ 1LLCA 4Q9LA 1C7QA 1DBRA 5B7QA 1RAAA 3EPLA 1DU6A 1W36D 2P0AA 3CGGA 2NU7A 2CGEA 1M33A 1M1NA 2Y0SN 3AP1A 4XGKA 2W8BB 2ZYVX 1OOEA 1NW4A 1KMIY 3OZRA 4MS3B 3NTOA 4B8XA 1NR5A 5ILVA 3OPQA 1DCTA 4E7JA 1CERA 2HF2A 3ZV7A 1W0KD 5DBIA 3S2WA 4NTZA 2AOVA 1ESCA 3LK6A 5IP9J 3A14A 4Y7CA 1D6SA 3NAMA 2FOLA 4M71A 3KEGA 5EYPB 2JCYA 2IYVA 5FLXK 1TEZA 1WRJA 2O2DA 5J5AA 2BFPA 2QJTA 3ISJA 5JDIC 2FEKA 2IHNA 4M0KA 5K03A 1BEUB 5EMKA 3ZHRA 3ANLA 1SC7A 2VDVE 4WF2A 2Q3MA 2V6FA 1XA4A 2OPHA 1XUOA 3AR2A 3MCVA 3UCXA 3GFFA 1Y3HA 1G6Q1 4U63A 1SVMA 3M4ZA 4PFOA 4JC8A 5FKLA 3UK0A 3DL0A 5C8YF 2IDKA 2CNLA 5LRSA 1L4MA 3V55A 2AFIE 3KOZA 1GPWB 4XVUA 3RSNA 1T2UA 2Z04A 2XDVA 2CLSA 4D26A 5HNFA 2BRUC 1G8XA 1Y6ZA 3HHPA 1GFZA 2H7YA 4GBMA 3R8XA 4IOJA 2VAPA 1TZKA 3STTA 1BIFA 4IZ6A 3KP1A 2QYTA 2HT6A 4PC7A 2D62A 1CQJB 4RGSA 3BTUA 5GPCA 3CO0S 3G2QA 3KQUA 1VA5A 2P9HA 1UBEA 4GYYA 5D5PA 3BD8A 3CUVA 4P83A 1W581 2R1TA 1R8SA 3F8CA 1MENA 2RGVA 5IJ9B 1UCRA 1E61A 1QG6A 2Q0OA 1R5ID 3IKLA 5FPTA 4ETNA 5DASA 1Z36A 1LDYA 4HLXA 1L0BA 1M2EA 4HWRA 2PQ0A 1PE0A 4MRRA 2I2BA 2WADA 1G19A 5THKA 1FP6A 1TLHB 2P2SA 1C3EA 4MVJG 1C3VA 1XTQA 3CJRA 3RTGA 4TOIA 1TO6A 1FTTA 2JQ7A 1ZL0A 1U0HC 3Q8LA 4MTLA 4LIPD 2VPZA 3B82A 3NU1A 4QJIA 3FJ1A 2NS0A 4NK5A 4HAOA 3VR3A 1NA5A 4WQMA 4X7PA 2J0EA 3K4HA 2JBAB 2COMA 3FNIA 3I8XA 2E1CA 4K3UA 2ZYUX 2AN5A 1SGWA 9ANTA 2FRHA 4HB2A 2JF0A 2LDBA 5ADWA 1IIBA 5DOZA 1JDUA 1OBFO 3BZCA 2QYSA 5J59A 2JGNA 2D1RA 3ZK8A 3DHVA 4Q4JA 2OYRA 1J49A 4HZFA 2RHRA 5ALYA 3MILA 1FBNA 4HPWA 3QWBA 4ZHQA 5JDCA 1VLJA 4URWR 4XLZA 4JASB 1KVTA 1VLVA 3ZN1A 1JR3D 3FCEA 3AEKA 4BBZA 2R44A 3K30A 3LLMA 5JSKA 4DGQA 4EA6A 3GN2A 4ZREA 2QVYX 3OTQA 4NIMA 3JRCA 1XN4A 1YR1A 5TXGA 2ZJZA 5KNBA 3OUZA 2W6CX 5JS2A 4PNHA 3FHTA 2GEFA 4DRXB 1DC6A 4FOPA 2DODA 1B8UA 2E2IJ 4C29A 4P33A 2I4IA 3TR0A 3T0FA 3VM6A 5M3MJ 3VRHA 4NBSA 3IURA 4BQFA 2IHJA 1P2BA 2FSSA 5G1OA 3ZV3A 4KK3A 1VPEA 2M8EA 1RCUA 1NX6A 3ERED 4RHYA 4C05A 4YR9A 1KEZA 3ZI7A 2ZE7A 3CZ6A 4ZVUA 5KC8A 3RPQA 1N2GA 4IFBA 3Q4GA 3FM3A 1PG2A 3IT3A 3M6AA 3LVFO 3PQ6A 4G0ZA 1UIRA 4LYYA 2X0DA 4G8XA 4M9UA 2P9BA 2RBEA 2P77A 3WE2A 1C1DB 4N49A 2A68F 2DWPA 4QJ4A 3I8OA 2OXIA 2GXGA 1PD0A 3LWDA 5A2QK 3CJQB 4QGBA 2Q5HA 3U48A 3PGKA 3H9EO 2ZBKA 4D0LB 2Q0XA 3STVA 2FWNA 3JS5A 1XB2A 3AWIA 3N0TA 1JTXA 1AO3A 4FCTA 4UTOA 1Y63A 2Z9OA 1J97A 3MJ4A 1F6WA 4BO0A 4XD2A 2X4DA 1E4VA 1YA4A 4Y1RA 1QR6A 2F5EA 1KY5A 4RGXA 5JCOC 3DC7A 2QRJA 2HKOA 3UMYA 1TJ3A 3ZMVA 1T9KA 2W24A 1K86A 2ZNZA 3C4JA 2PQ2A 4I4TA 3FYTA 5FHQA 3FRHA 4IIDA 3F4LA 3HCCA 1T1GA 3I39X 4GLOA 2VTEA 5JALA 2QDKA 2VYND 4WCDA 2EYQA 1WKVA 5IN4A 4E2FA 5K8LA 1B0PA 1LXCA 5FBKA 3A6JA 2COEA 2J0UA 3K09C 5F76A 4YRZA 1IEVA 3AY0A 4M9ZA 1U7ZA 3CNHA 2G9UA 2XADA 3IGFA 1EFCA 3RTEA 1DCMA 1B8IB 4XX0A 4PGGA 3Q7RA 1IM2A 1YDEA 3G0OA 2VNKA 1S8OA 2F3PA 5EKUA 2VS1A 4GEGA 1N6OA 1JSLA 3ZVRA 4TUYA 2EIKH 3LUPA 1U5CA 4AF7A 3H6GA 1Z0JA 4WNAB 3VFDA 1PNVA 3HDDA 4GS5A 2J32A 3VVLA 1NU8A 3W90A 4FYMA 4QICA 1VMAA 2JPCA 3QFTA 3VMFA 1MW9X 2I2AA 2P5TB 5F9HA 1TZCA 4AIKA 3I05A 1BVYF 2XGXA 2IPLA 2G0AA 3NHWA 2JFZA 3MIZA 4FOLA 4WK4B 2PN6A 1KVQA 1UKZA 2P1RA 3AUSA 3H4TA 3KR0A 5TLSA 1U8XX 3UAXA 2QNRA 4KIFA 1CUEA 1EVQA 4JP2A 4MQBA 1WI9A 4PFPA 3NWSA 3WTSC 2HDHA 1CKEA 3VJRA 3RBXA 5HLTA 5IK2D 3EXAA 1S7CA 5E8RA 4HX5A 2YQ4A 2ZMEA 2WWHA 3CNOA 4RYDA 2AR7A 5FBVB 3CWQA 2G83A 1WL8A 1L8XA 3G1LA 3HLTA 2A57A 1WZNA 3OYNA 4F9FA 2FWJA 3S70A 4UVIA 1P60A 2J3IA 1XDUA 3PYXA 3K71B 2I8LA 4P98A 2PBRA 4CR8A 2I7TA 3RYTC 5ALSA 3DKPA 4DR4B 3M8JA 2V9CA 2D5LA 4G5QA 4PZ0A 1D0SA 5FWYB 1TT5B 2WFLA 3JASB 5IM5A 2C2ZA 2XGMA 1A4UA 1UXOA 5KWJA 2JIOA 5AW4A 1HOMA 3BK2A 2QZJA 1WH5A 3WZ2A 2C9YA 2UUPA 5E7MA 4X1IB 4OMFG 2AOTB 2DZDA 1J99A 4XR4A 3ETJA 1F12A 2P6RA 1B6RA 4D02A 2FW8A 4B3GA 3S1NJ 2WNHA 1B8PA 4JP0A 1Z2DA 3RVMA 2QEXI 4K87A 1V95A 3ZGKA 4TWAA 1IOZA 4JC5A 4RPJA 1T5OA 5L51A 3DDZX 2NRAC 1TYAE 1JQBA 5IM4A 4ZMSA 3V7NA 1HWYA 1QVVA 3QLTA 2O3SA 2FN7A 3IUBA 3BGWA 5AHRA 5FUVA 1RQRA 5HS9A 5ERGB 2FRXA 1MBFA 1CDZA 4H3VA 4PX3A 5AM3A 1VJCA 2MSNA 5M3BA 2E3JA 3R23A 2MOKA 5DCFA 4D82A 2XZTA 5FPHA 2BMJA 1Q21A 3NATA 1JIQA 3R3YA 3JWEA 4DEVA 2FKAA 2NMVA 1IXYA 4IFEA 5CRIA 1A97A 4I1UA 1QQ5A 3UUGA 2IXBA 3EIOA 4PHCA 3CZ5A 5KNBH 2DBVO 3K4QA 2FETA 2Q5FA 3ENKA 5KDDA 3RS4A 3JATB 1KFJB 5ELLA 1PL8A 1UKVY 3P2KA 2ID4A 1YFKA 2FUCA 1UJ5A 1MD9A 3LXUX 2ACJA 1QO9A 2IEZA 3DE5X 1VQ4I 4X1KB 1HTTA 5KSOA 4RIGA 1ENHA 4J2TA 2WV7A 1HSOA 1EE1A 2PGNA 2QD3A 2NNNA 1V7PC 4RY8A 1EEXB 1KO1A 2ZE5A 1TMYA 4DAOA 5JAUA 1H2BA 4JKYA 3QJYA 4DLAA 3GGOA 3I34X 1L5HA 4F91B 2PANA 3C2BA 2TYSB 4GXTA 5F2NA 3BRCA 1TC2A 2LY2A 2LIVA 1GTL1 3R7LA 2C42A 1Y9DA 3E9DA 4F4IA 3O2PE 1PDWA 4A6DA 1NHWA 1ZS9A 2GAIA 2DLLA 4PYRA 3LSHA 1ZGWA 3VPXA 5KJ6A 4DA4A 4V0MA 3FMRA 2WUGA 2RGYA 4Z51A 4JDPA 1OT5A 3SX4A 4HDVA 4ILKA 3EWAA 5HCNA 1B1AA 2JFFA 3JQDA 4AY4A 3TLAA 3BTCA 2NZ8A 4O2AA 1P81A 1NU6A 4GKBA 3Q9SA 2AFIB 1SKUA 3FMFA 3SC6A 1ULZA 2A4MA 3B5EA 3CUUA 2X1MA 2IGKA 3OFVA 4DHEA 2VBIA 2VTKA 2XKBA 4TMVA 3K70D 4NH0A 3HN6A 4MKZA 1FS5A 1EXDA 2RKHA 2H85A 4ZTZB 2VUMJ 3BF7A 5FOVA 3MFKA 2FZ4A 1TA0A 2ZJAA 1Y8AA 1YZUA 5AM1A 4B4KA 1CUXA 3FJOA 2QAGB 4RABA 3F7NA 4ZQCB 5A3VA 4UPEA 2ZT8A 4JQOA 4DZRA 4YGXB 3PHLA 3L0PA 3L7JA 3SVTA 1YCFA 2C5SA 3EJ6A 2NO9A 4QVKA 1N7HA 3KZIC 3W6UA 3SS7X 3GGJA 4J6EA 3HKCA 4P7FA 5CX1A 1O5IA 3V4VB 4RAQA 1G8SA 2QQBA 2OCBA 4B5LA 3OO1A 5FA6A 2GCNA 3S68A 3IUQA 1UADA 2XQGA 2Q1ZB 2X1VA 4A0RA 3VPGA 2R1TB 4F4FA 2NTVA 2IE8A 2H09A 3V7WA 3B3JA 3S17J 1UPXA 3SZRA 1CZHA 3EDCA 3NIGB 1HE8B 1QCZA 3R41A 1XG1A 2KKOA 4NPAA 3S3NA 3FFTA 3ISVA 3DG9A 5MN5A 2P0YA 3O6VA 1GPLA 1ETHA 4PXAA 4TKZA 2JVGA 5BS6A 2XOXA 3GVXA 5SV2A 3VR1A 1JHHA 1THTA 3FYUB 4FMDB 2XQKA 1KY2A 2WZCA 1QAOA 3KQTA 4YCBA 3CCVI 5DW3A 2WWYA 1FDRA 2ZS7A 3F9CA 1JG2A 3KNZA 4FLEA 2D1QA 2WTMA 4NQRA 1L4NA 2X6TA 2OZLA 3LBYA 3I6ZA 4YUWA 1WXIA 4AW9A 2Q45A 3NUQA 4D5GA 3UJ8A 4WCVA 2I22A 3RU3A 1T6BY 2OHOA 4F55A 2PXHA 1SVKA 3BCRA 2VSNA 4O63O 1FS4A 2GN2A 4PZLA 4W9RA 4F7ZA 2CZQA 2FWIA 3QPSA 3FZEA 1N4DA 3O47A 2ADUA 3GXBA 2I7CA 1HRKA 3LGAA 1L7OA 2PJDA 1T4BA 5IAAA 3V80A 2EFJA 1I7SB 3SS8A 2F1KA 3KP2A 2AKAB 4J16A 2G88A 3SOZA 1Z3CA 1EV7A 1RMQA 1Q1EA 2BBYA 1JHQA 2IBMA 3OH8A 4ZKDA 4Q9AA 2YFKA 1L6IA 3FAKA 4UEQA 2QKLB 3Q12A 5EUMA 3R7WB 5BVHA 4FSXA 4E2XA 2RGNC 1XD2B 3OOYA 2F4OB 1UEXC 4M76B 1M7GA 1OCPA 3LMMA 2QGUA 5K45A 2IT0A 2G6BA 1GCIA 3E6AA 3DXJF 2IY8A 3MYRA 4KAFA 1R0SA 2DPLA 3OPYB 2JH3A 3W1VA 3F67A 3D6VA 4ZYEA 4HN4B 3P0JA 1Z0XA 3O82A 1VHDA 5LWHA 1LSSA 4OH7A 4YMGA 3KAKA 7AT1A