1DGWY

Structure of the rhombohedral crystal of canavalin from jack bean
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
92
structure length
92
Chain Sequence
b'QLRRYAATLSEGDIIVIPSSFPVALKAASDLNMVGIGVNAENNERNFLAGHKENVIRQIPRQVSDLTFPGSGEEVEELLENQKESYFVDGQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CANAVALIN
publication title X-ray diffraction and atomic force microscopy analysis of twinned crystals: rhombohedral canavalin.
pubmed doi rcsb
molecule tags Plant protein
total genus 8
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1999-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.840 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1dgwY01
1DGWY 1DGRM
chains in the Genus database with same CATH superfamily
5LGUA 2RQPA 1XGSA 4CICA 4F55A 1JKQC 1GV2A 3CCSI 1ZTRA 4C2UA 5FFZA 1Z91A 4JK1X 3HB9A 2QQAA 3O3KA 2ELKA 1XGMA 1R9TJ 2DI3A 2F2EA 2AQFA 4IF4A 1TQIA 4JQFA 3L1PA 2E19A 4IXAA 4N4NB 3M4OJ 1ETOA 3LFUA 1W5TA 3R60A 3MWMA 3K4KA 2LY2A 3DLAA 2E60A 1W1WE 4XSXF 1YRNB 4BEHB 4AM3A 5E20A 3WGHA 5F0HA 4XQFA 3L00A 1XN7A 2XPVA 4ZZLA 4EV0A 4PSXA 3KP6A 2ZXJA 3ECOA 3MMYB 3BR3A 1Z0XA 2XIGA 3K1MA 4HLXA 1VNDA 1WRJA 3ML6A 1IDZA 2JT1A 4UV9A 4JX5A 3CD6I 3LSIA 9ANTA 1KZHA 5M3FJ 1W7PD 2QM3A 3P5JA 4AC0A 1EA3A 2V79A 4PUSA 1EKEA 2BW3A 4ANJA 4AYBN 2K9MA 1IV8A 5ICFA 3KP3A 4HNTA 2VT2A 3TDUC 2ZO4A 4UHTA 5L3BA 2HYFA 4P55A 2L2OA 2XPWA 2WADA 1S8NA 2DT6A 3K4LA 2EA2A 4U0WA 2ZJQF 2ME0A 4XN3A 4B44A 2IW5A 1VQKI 1S9HA 2R7DA 3T1BA 2CH0A 3PSIA 1FPQA 4XOPA 4AIHA 3OYLA 1R7JA 2W25A 2KL4A 3W2VA 3SFIA 3V8LA 4G94A 5M5WJ 2V1UA 1X1AA 2ID6A 3E7LA 3U2RA 4A0YA 2KIMA 4EATA 2V26A 1P9QC 3S3MA 4RAFA 2NVXJ 4XLCA 1OCPA 2JRMA 2LH9A 1SANA 3C2HA 5HOOA 3S3OA 2HPIA 1W0UA 3FWEA 1OR7A 2MD5A 3VWBA 2QCOA 4M6VA 2HVSA 4CGZA 2ZJ2A 1Y56A 2VONA 3HIFA 2ELHA 3H5RA 1F1ZA 2M87A 4BHPA 4U87A 3PQJA 2STWA 1SD5A 1ZRCA 1W7PA 1YS7A 4M3BA 4MLOA 1AWCA 3VODA 1IXCA 3IH4A 1W5SA 3FKJA 2AXLA 1K79A 3G1LA 4A2UA 1IW7F 2DTZA 1RNLA 3KP2A 3OOUA 1K6OA 3BCAA 1PP7U 2DQRA 3WGIA 2XAGA 3A02A 5FKMA 3GTKJ 3IH3A 2KT0A 1Y1VJ 3J81Z 4KIBA 1Q1HA 2WAQN 4IRHA 1CQTA 2YR2A 2H1LA 5DM7F 3OYMA 4A0ZA 4XRFA 4RB3C 1ZR4A 2X6OA 4D7MA 2KISA 3QYEA 1D5YA 2DCEA 2AS5F 2QA4I 3OR1C 4KN7X 3VYUB 3JRDA 1BR4A 1MIJA 5GTHC 4XRSG 2BBYA 5GAEJ 2ZXWH 1OQYA 4Y17A 1ZRFA 2HS5A 1Z6RA 3WU0A 3HRUA 4AWXB 4DQ2A 1Y8QB 4BU2A 4QSHA 2FMYA 4D9JA 1IN8A 1U5TC 3LA3A 1U78A 2HTSA 2M8GX 2E1MB 3Q9VA 2CU7A 4WCGA 1QZYA 2CQQA 2HKOA 3CC2I 2R4GA 3GF2A 1HKTA 2MA3A 1WJAA 1NG6A 3IL2A 4UUSA 4JX4A 5KAFC 3JSPA 2MGQA 4EJUA 2NS8A 2V1NA 2ECBA 2Y0SN 2VN2A 2IRFG 2EV5A 1O7FA 1V3FA 4UUTA 1T38A 5IP9J 1IAWA 3TP3A 3MCZA 3ERMA 2LR8A 3U1KA 4H0EA 2BZTA 1YJ9I 3W3CA 4I0AA 5LD2C 2XRNA 5FKOA 2XROA 3KCCA 2L4MA 3SZGA 4L5JA 1LQ1A 4YIFA 1MSEC 1TBXA 1ZQ3P 2LYCA 3N4MA 3I64A 3CCMI 1IJWC 3MEXA 2CGPA 3CUQB 4Q47A 2RAEA 1O3QA 1QPIA 2AXTC 1I1GA 1VF9A 2K86A 5EF6A 2PLYA 2R7FA 5EZHA 4LG0A 2CWEA 4A12A 4XR6A 1S3JA 4BACA 3CO6C 2DOAA 3IHUA 4BQQA 4CCNA 2A68F 1RR8C 3F0CA 3HOYJ 3E0JB 2OZ6A 2VBZA 2GIVA 4RA2A 4XLNF 4EGZA 4MFDA 4KA4A 5L3GA 3T5XA 3QRFF 4C3JJ 3REOA 3FXOA 2ZJRF 3VB2A 5IY5H 1FBQA 3Q0VA 4XL9A 4A69C 3RI4A 3OSGA 3LSTA 4LD5A 3HOVJ 2CW0F 1S6LA 2Z2SB 1T0FA 2GOMA 2X1DA 5DDGA 2EINH 4CSWA 2QLZA 3FMRA 4BBRJ 4J01A 3ONQA 1G59A 4XK4A 3W6KB 4BL0B 3MQ0A 4M9ZA 4A3EJ 3OIQA 4BBSJ 4ZDLA 3GTOJ 2F5DA 3CDIA 1H8AC 1D8KA 2PBIA 4IEJA 1MNDA 4BQNA 1HKQA 3F22A 3EYIA 2MC4A 3N97A 2KJBA 4FE7A 1G3TA 4EEFG 3F23A 3CCVI 2O9LA 3RTRA 2VBYA 4WK8F 4PCQA 3E6CC 1G3WA 3ZQ7A 4JOMA 1DGRM 3LSGA 2HOSA 2LLKA 5K1YA 2F48A 4MO7A 4KIGA 2DA5A 2H27A 4ZYEA 3L2CA 4U0YA 4DOZA 4KN4X 1JT0A 5J40A 2DFIA 4GRIA 2VJ5A 4LFUA 2QBYA 3CESA 1FC3A 1S5LC 2RQQA 3I71A 2IGOA 1O3RA 2ZMEB 4BDZA 4B4CA 1D5VA 1FZPB 1A35A 2DQLA 1ZARA 4PFPA 1SMTA 2QWWA 3ZMVA 1W5CC 3M8JA 2Y75A 5IYDJ 1N75A 3K9TA 5KNLA 4HDVA 2PMHA 3EUKL 1GV5A 1QRYA 4LJZF 4BY1J 2RGVA 4M3GA 3DPUA 1FLIA 3AFHA 1LPQA 4Z2YA 2COMA 2JRTA 5BQTA 2LY9A 2GZWA 5F04A 3J81K 2V9VA 3GYHX 2ISZA 4HSRA 5JR3A 5FRMA 4IHWA 5HLTA 3LSHA 2AO9A 1X3ZB 2CS3A 5CLSA 5HDGA 1Q1VA 4CA0A 5E3OA 1MSFC 2DXIA 2W57A 2E5NA 1O3TA 1MW7A 4BXFA 4IO9F 3PUFA 3FXJA 1T39A 4BDYA 3ZN0A 4IVNA 2GOXB 1K4SA 3KFWX 1USTA 5L3CA 2HYGD 1DGWY 2JTVA 3FF5A 1F36A 1ETYA 1J75A 3R0AA 3K4CA 3TDZC 4ASNA 3MFKA 3D5SC 2JVGA 1OISA 3TGNA 2K02A 3WTVC 1J9IA 4IHSA 2TCTA 5TRDA 2XHKA 3VYRB 1LEBA 2V7FA 2EFWA 4L9NA 1IN7A 1ZG1A 2K40A 5EEHA 4C9YA 3DKYA 2ZXHA 5H20A 3M8FA 3FIWA 1ZAOA 4PSWA 4I09A 3OYBA 2OTJI 3BR0A 3C1DA 4LITA 3FBIB 3QODA 4HNVA 1R58A 1XX5A 3FISA 3OS0A 4IRIA 1GXQA 1FP1D 2FA5A 1Y0UA 4NQWB 3SHFA 2Z99A 1A31A 2R7UA 1PUFB 5D4SA 2JA8J 4DYQA 2DDBA 2NNNA 3I59A 3VYTB 3E5QA 2VODA 1KQ9A 2HZTA 4HAMA 1ORKA 1JGSA 3I4NJ 2P5KA 4JYKA 3UKGA 2ZFWA 2LDUA 2GWRA 5KAIC 4FCYA 1SFKA 2E34A 4OINF 3FKIJ 2XB0X 3TOBA 1XSXA 2R5YB 1HCRA 2HDDA 2RREA 2PQ8A 4MTDA 4MQVA 2UV1A 4TV7A 3OL3A 5HVQC 3LA2A 4MIMA 2R0QC 3GLLA 1R4NB 3JRAA 4RM2A 4CCOA 3KETA 2LREA 3K4NA 1QBJA 1BC8C 1X19A 2YX7A 5B3SH 3JRBA 5GADJ 4F92B 4ZYDA 3L2VA 4IHTA 4AVPA 1OYWA 2NVQJ 3HPGA 3WHCA 1JUMA 4ON0A 2FSWA 3CO7C 2D2WA 5JHFA 4YRVA 2EIMH 3HBLA 3CCEI 2I8DA 3ELKA 3L2UA 4A0XA 5E18F 1HLVA 4XLHA 4LMYA 3IKTA 2ECCA 2HOAA 2VKDA 5ICEA 4I99C 2ESNA 4LLLA 3GFMA 2HPMA 1FOYA 1V5FA 3IUOA 4V2FA 3DCFA 3KPHA 2X6WA 4GYIA 2EJRA 3M9AA 2M7BA 4GCVA 2A6TA 5ICCA 4UB8C 2N8GA 1O3SA 4BAYA 2VXZA 1IV6A 3MKZA 1L3LA 1G3SA 1AA7A 3FM3A 3CMEI 1MNEA 2GXGA 3MVPA 1FYMA 1XB4A 4HOBA 2V9PA 5C4JJ 2DJNA 5HNHA 5IP7J 5CKTA 1B59A 2DFEA 3GZ6A 3BPVA 1ONVA 2DDAA 3CP2A 3I58A 1WVRA 3CC7I 3H9QA 2H8WA 5E8IA 3TW7A 2FF4A 2BEOA 5EGOA 4LB6B 4KNYA 2E71A 4C30A 3ULQB 4ZYAA 1V55H 2DYRH 2ELJA 4EJTA 1N77A 3FK7A 1ZLJA 4QIWN 3LQRA 1H9TA 3GLXA 5BOXA 2F5EA 2B63J 3DXJF 2W84A 1MMSA 2V1XA 3HRTA 5ILVA 4BNCA 1WI3A 4WXDA 4HX4A 2ADUA 1FTTA 2K27A 2CW7A 2IXSA 4QLCU 4Q5SF 1MMAA 1RUNA 5D6EA 2L9SA 4FHTA 3RPUA 4KITB 3HTSB 1QU3A 2XASA 1VQ6I 1R4MB 1FOKA 4HV6A 2BYVE 2L7FP 2E1OA 3TBIA 1ERDA 1JUSA 5FD6A 2CQNA 1TWGJ 4HG2A 2VPRA 1LKXA 3EQLF 2IT0A 3M3YJ 3ISPA 4A3JJ 2UXXA 4G6DA 3ROUA 1HQCA 1MMDA 2VB6A 1DPUA 1TNTA 2IAIA 3JRFA 3GTQJ 3GTJJ 1ZG5A 4RLQA 2DJIA 5HNFA 2BE5F 4UXNA 2KDZA 1YIJI 3ZQGA 2ZCWA 3IC7A 3P7NA 2Q8KA 1RR7A 1T95A 3S15J 3FX3A 4Y13A 3H0GJ 4A3MJ 1FSHA 2BXYA 4CYCB 4KDPA 3CJQB 5JVGF 2DT5A 2VPLA 3BZCA 4XRMA 2P7VB 2CJJA 4RAYA 5CJ9A 2P6SA 1FMWA 1U5TB 2M4KA 3ZQHA 2KRCA 1J7KA 1AU7A 2E36A 4LIUA 4I01A 1UAAA 1BBYA 1B4AA 1KYWA 2YUSA 3ECHA 5C44J 4HZFA 2DTRA 3CQZJ 2MYSA 2HTJA 5FGMA 3ZQIA 3QYFA 3BLYA 2WB1A 4BHCA 3U9GA 2NXNB 1R49A 3E6DA 1BIBA 1I6HJ 4IQJA 3WTUC 1DU0A 1TP4A 4JBAA 4FX4A 2YU9J 3PO3J 2EV0A 3CCJI 3CTAA 3LMMA 2BXZA 3G1OA 2HXOA 1W4MA 3DKWA 3H5NA 1VQNI 2OD5A 5FFXA 4M3EA 5F0CA 4R1HA 3JSOA 2GA1A 1DDNA 5DTDA 4U7BA 3D5RC 1AHDP 4F7ZA 3TQNA 1STZA 2CRGA 2NYXA 1RC9A 1DU6A 2EZIA 2TDXA 2XUBA 4D5CA 1J09A 5E8GA 5DCMB 3DEWA 3WU1B 2A05A 1W36C 2JA6J 4PJ0C 1Y0NA 2AQEA 3CP8A 4HYEA 5IP6A 1H88C 2Z1DA 3JTHA 2KRHA 2Y0MA 5K7HA 3AG2H 3HOSA 3HTUA 4RAZA 4CYCA 2HDWA 1HBXG 3IWZA 3MZYA 1C0WA 1IUYA 3WHBA 2XB5A 4CUGA 2XSJC 1U5TA 1LEAA 1MKMA 1Z6TA 4ZDOA 2M0MA 3LSMA 1TQMA 1D1CA 2IS4A 1XGOA 3K1PA 1ZRDA 2F4MB 4H4KC 3B6AA 2VT3A 3GVAA 2JA5J 3EYYA 3K4BA 5FO5A 2MBFA 2IA1A 1U9OA 5ED4A 5AIPA 2A61A 1VI0A 5DD8A 4HBLA 2NAZA 2HQNA 4JP0A 1YW7A 2VBWA 1N25A 2CV2A 3M1EA 3BTCA 2LRDA 3IP4B 1YITI 5GPCA 2HQ5A 3S2WA 4E4HA 5CYVA 4FASD 1LE8B 3OIOA 4QWQA 3WE2A 3ABLH 3VSLA 2IS2A 2K9NA 4Y33A 1AKHA 3HYIA 3V7SA 3PO2J 4PFOA 1JGGA 2GBYA 1ZG3A 2XAUA 4XNFA 1DP7P 2GM4A 1Z3XA 5IT9K 2J5PA 3KIOA 2CFXA 2MC3A 3G1MA 4J19A 2M5WA 3DWLE 1MH4A 1RKWA 1BI3A 3PNVA 2FJ1A 3BOQA 5CVRA 4M6YA 4B8XA 3HZJA 1H89C 1USSA 3R0JA 3DKXA 5BPIA 1K78B 2OTLI 2IGNA 2WWYA 3H3ZA 3ZQFA 1JJ8C 4IZZA 3A0HC 3GTGJ 5EEGA 3DU6A 3F3XA 2HFHA 3MKLA 2VUMJ 4BJ6C 1GVDA 3HOWJ 4RDUA 3F8MA 4P9FA 4NNJA 4E7HA 1BOAA 4B47A 2CW8A 5HS7A 2IGKA 2O5RA 2QF7A 2IPQX 3SJMA 5E3MA 4A3IJ 3A01B 1HDPA 4KMUX 3GTLJ 1ULYA 1YRNA 2BGCA 2ZNZA 4BEHA 1NTCA 4XMYA 4CH7A 5F27A 1BW5A 3TMOA 3PQKA 1P92A 1EV7A 3QOEA 4S04A 3OYGA 1AOYA 1DQUA 3OYAA 4II2A 2KKOA 4R8HA 4D1QA 3S8PA 1BA5A 3ZN1A 3J7ZI 4G8XA 2R7RA 3G2BA 4A3DJ 1B8IB 1YHQI 2JSCA 4KICA 1OPCA 2M9HA 5IYBJ 1POGA 2FBKA 3K7AJ 1I6XA 2R92J 4G7OF 1YFHA 2QSHX 3KEOA 1WJDA 3ABMH 4FE4A 4NC6A 4ZC3A 4A6EA 3WE3A 3F9KA 3PUBA 2DT7B 2LSOA 3PFIA 1W0TA 4I0BA 4FETA 1UHMA 3KEQA 3W2AA 2P5VA 2JQ7A 1FIAA 2HI3A 1ZGWA 3BG7A 3BTLA 3H5AA 2M7AA 4P1WA 4G7HF 2OCEA 2QQ8A 3HKZA 1R22A 3BTIA 1QVUA 2JUGA 5J4VA 5HS8A 1Z67A 1OCZH 2BVLA 2R7OA 5FLXZ 2O7OA 4IRGA 3BQYA 3QPSA 3V42A 4ZYHA 2HEOA 2CQ7A 2KPMA 1VQLI 4B1RA 1K83J 3FXLA 2NRAC 5J8CA 1MGTA 2MH2A 2NOGA 2WV0A 1MBJA 5TISC 2EK5A 1HXDA 2H09A 2Y48A 1WZ2A 1HW5A 1YW8A 3N05A 4RMNA 2P81A 3RDIA 4U7DA 4KISA 3BDDA 1KA8A 2RDPA 3D0SA 2ESHA 2CMPA 5E3NA 1B72B 1T6SA 3ABKH 3BP8A 2JA2A 1TWAJ 1ETQA 4XLFA 4S0HB 3G4SI 3KP7A 1BOBA 5GP9A 1PVEA 1V54H 3S93A 1F5TA 4HQMA 4FX0A 3ZGKA 3AG3H 3GEZA 2XF5A 2HVQA 3GCMA 3I54A 2MW8A 4L18B 4A6DA 2DK5A 3GFLA 1WJCA 1Z21A 5F0FA 3E5XA 4RAGA 3PL8A 5HDNA 4HDUA 1FBUA 2VASA 3FBNB 3EUAA 4XKBA 3VDXA 1BI2A 1P2FA 1IRZA 1LFUP 5E3LA 2H8RA 1K6YA 2HYJA 4CHUA 2VKHA 4WXHA 5DCFA 2DPDA 2A6HF 1A04A 3CJRB 3IKVA 2W24A 3E6BA 3AG1H 3NQOA 3I56I 2R7WA 3SEZA 1NK2P 3E1SA 2DYSH 4Y4RA 2CV0A 2NVTJ 5E79C 2EA4A 4KT6A 4DZPA 4HSTA 4M9SA 1YO5C 3FXRA 1JHHA 3KZIC 1YJNI 4BE2A 2GQQA 2CO5A 1IRXA 2K3FA 1LUJB 1IN6A 3HOTA 2ZNYA 1VQ4I 1BR2A 1A36A 2DAOA 2FOKA 5IOZA 1QZZA 2CUZA 4PZJA 3RPQA 1G2HA 3IH2A 2Z3YA 2M8EA 3PSFA 1SFXA 3F6VA 5J1YA 1XCVA 3HKZN 2L0KA 3GX4X 3J7AO 4L0YB 1S72I 3CJNA 1FY7A 1FTZA 3P9IA 2CQKA 1UMQA 3JAMZ 4I7HA 4LG3A 3KLOA 1TTYA 3HXLA 1WI9A 1BI0A 1V5EA 3GW2A 2DLLA 2XDVA 5HLIA 3HHHA 2EPFA 2D5VA 4XN0A 2O6GE 3OS1A 2QKMB 1MBGA 3TO7A 3RKWA 2IGMA 4C2MJ 4CZZA 2NVUB 2A5YB 2K4BA 2EFQA 3CUQA 4IHVA 3LNQA 4ITVA 2V9KA 1LFPA 2PX9A 4DGWB 2O0YA 1I3AA 5TJJA 4NDLA 3ZMZA 1JHFA 4CYDA 4MTEA 2IP2A 3M7GA 1FEXA 1MDMB 3K2ZA 1E2XA 2BHYA 1EH6A 3HOXJ 1ENHA 3K4MA 1EH8A 2D1VA 1JKPC 1JKRC 1KU7A 3EDPA 1Z7LA 4HQEA 3K70D 3OYCA 4XKCA 2E2HJ 2HXIA 1XMKA 1JTYA 5L3DA 5C3EJ 1T08B 1S7AA 3FXQA 4YFKF 3K4JA 2BY3A 2STTA 1BL0A 2ME6A 1I3QJ 1BIAA 4UVBA 5ILUA 3GZNB 1YIOA 1KU9A 1ITYA 2DOFA 2DA6A 1SAXA 2MABA 3A03A 2ZSIB 4XRSA 2DBBA 4F52A 4RBOA 1FJLA 1XTAA 2X48A 1VTNC 1VQ8I 1G8XA 4OMYA 3OYNA 1S29A 3HHGA 3F8NA 1UCRA 1FWZA 4XORA 3S3NA 6PAXA 3MKWB 4CDGA 5IPAA 2HU9A 2BY1A 5JVTA 5AIQA 5LGTA 3GXOA 4XICA 3FMQA 2OC6A 3BPXA 3D1NI 4QPOA 1RIOH 1FYKA 3G6EI 2GLOA 4EJVA 1IN5A 3JW4A 5E1WA 4MHGA 5FLXK 3OS2A 3J80K 1ODDA 1D1BA 1MDMA 2FNAA 2UXNA 1GXPA 1EH7A 4YFNF 3PJRA 5K5RA 3WTWC 2KLOA 4D7NA 1KQ0A 5F1RA 3FHNA 3Q5FA 4WX9A 2JZYA 2ZMEA 3L9FA 4XONA 3SXYA 4N9HA 1RETA 3M1CA 2VLAA 3V8JA 5EYRA 5CQEA 1BN5A 1KU2A 3HC7A 5F64A 3PIPF 1P7JA 5B5EC 1OJLA 3G71I 2W4SA 2D1HA 5IYCJ 1I27A 3CF5F 3K0LA 3QOPA 4EM0B 5FD5A 2GXBA 4KT5C 4A5MA 3BCBA 1GVJA 2L5QA 3ZRGA 2OJED 2P4WA 5FROA 5K5OA 5D6FA 3WTXC 3W2WA 3OY9A 5DS9A 4V19K 3EUHC 4G7ZF 5B1BH 1TWCJ 4I02A 3VPRA 2HOTA 4HEA2 4EGYA 2X0LA 1YOVB 3B73A 4O6JA 2IA2A 4CO8A 2XVCA 3DU5A 1V4RA 3IRQA 2JMWA 2OQGA 2KZGA 1UJ8A 1S7OA 4ZZDA 1VZ0A 1XDSA 2YS9A 1RPWA 1K61A 2OU2A 5JLXA 2H1KA 4BUPA 3GUDA 5D5VB 1OCTC 1JTXA 1N78A 3HM5A 2OV7A 3LSKA 3OSFA 2VQGA 2JPBA 4B3XA 2XC7A 4G6TB 2XAQA 2P8TA 3E3VA 2QSFX 1FIPA 3FHZA 2EB7A 4MEYF 4OMZA 1LJ9A 2Q2EB 2K4JA 5J47A 3DBLB 1UZCA 2EQRA 4M3DA 3W6JB 5HODA 4BXXJ 3I4PA 1SAUA 4KMFA 4KYWA 3LOCA 2DMTA 1FOWA 3ZQCA 1WFXA 2YPRA 1WCMJ 4MFEA 2COBA 2DK8A 3O8GA 3DFGA 1GT0C 1XCBA 2XRLA 2CV1A 4II3A 4X1EA 5LHGA 3ZOBA 3JRHA 1TZLA 4A3CJ 4ZTJA 3RPUD 5JI6A 2YX4A 1UELB 1T56A 2K9SA 2FEZA 4KJZA 3ZQLA 4GYGA 1ZR2A 3HL2A 5KK1A 2RNGA 3QAHA 2A69F 1Z77A 1LVAA 3V8KA 2YU3A 2RN7A 3CLOA 1X4OA 4NQWA 2OPTA 3LWFA 1IF1A 1R23A 4BS9A 2WY8Q 4OIQF 1PUFA 2W1OA 2HGCA 3JAMK 4E6KG 1QZEA 4N4OB 3FZVA 3JRCA 1A6IA 3WG9A 1SVMA 1X58A 2V1DA 3HUGB 3ZR8X 2E2IJ 2A5WA 3E6MA 4C3IJ 4YIRX 5F08A 5IT9Z 3RCOA 3BC8A 1UFMA 2Y9ZA 2LMDA 3LFKA 2DODA 2LBFB 2Y69H 2R5YA 1A5JA 4GGGA 4OOIA 1MD0A 1X1DA 4LK0F 1TWFJ 1H0MA 4BY7J 3BY6A 3M8EA 3CCUI 4DW6A 3D5LA 1MH3A 5E1XA 3LA7A 3TO9A 2MG4A 2FMLA 2KZVA 2QQBA 1U0JA 1QO0D 5EDNA 4A3LJ 2LOOA 3H3UA 2R5ZB 3DPLC 3BG9A 4K2EA 3H3VK 2ISYA 4U0VA 2ACJA 4F91B 1Y1WJ 2NS0A 1TC3C 4Q4ZF 2B0LA 4L5EA 3CMMA 4OIOF 2W82A 1LB2A 3C7JA 3LSPA 1OYIA 2F5CA 4BE0A 4W97A 2LF7A 3IRRA 1HSJA 1K7AA 4HV5A 1TL8A 1ZLKA 4HX7A 4E70A 1U6GA 4A3BJ 5LRSA 3NEUA 2IEKA 3DQVC 3WG7H 1KONA 2MSYA 2F4IA 3L2QA 1FX7A 3NWSA 1FOXA 3LSRA 4UVCA 3BG6A 2UZKA 2AHQA 4UVAA 3MKYB 5BS6A 5E17F 1OKRA 4ZTFA 1MNMC 2HQRA 3Q0UA 2R7TA 3T0YA 1EF4A 1U9NA 4E7KA 2Q1ZB 4O3MA 4ENKA 2WTEA 1YS6A 1YW9A 2XV4S 2E1NA 3FDYA 2KQRA 5H2FC 1SC7A 4M9XA 2QENA 2OZUA 3NARA 4EJWA 4RGUA 3NAUA 2UWMA 2M34A 4HW0A 3BJOA 2L9NA 1X2MA 4L0ZB 4MGRA 3TL4X 1L0OC 5DYMA 2DA7A 3BG3A 1R6RA 2WY7Q 4RGXA 1X4PA 4YELA 2L01A 3OL4A 3RSNA 1REPC 2L7ZA 5FRNA 1R00A 3OWTA 1VQ5I 2EILH 1CF7B 4LGWA 2OA4A 1MBFA 3P9CA 2HR3A 1PYVA 3AG4H 2Z33A 2VE9A 1YG2A 1XG1A 5B66C 3K2AA 4E7SA 5DUIA 1G6NA 4M74A 3CMYA 4BE1A 3AKZA 2WAFA 3JR9A 2H6CA 2HQAA 2W85A 3GO5A 5HDKA 3OIPA 2MD0A 4ZJZA 1IZ1A 2X9DA 3S1QJ 2X1CA 4ESBA 4ETSA 5IOYA 3VOEA 2RC4A 2XSDC 2EIJH 3OYEA 3BZ6A 1RESA 2EIKH 4AYBA 1FYLA 3PM1A 4M73A 1LDDA 5DEQA 1IXRC 1LVKA 4IKFA 2OCCH 1FNNA 1JKOC 4I6ZA 1LDKB 5M3MJ 5LRRA 1H9GA 2LKXA 1VQ9I 2R93J 3I5UA 1BI1A 2QVOA 4B43A 4D5FA 1YI2I 3DBRB 3FXMA 2MH9A 1P6RA 3GWZA 2HDCA 5L3EA 2VQCA 3SQNA 2DU9A 2K9LA 2WAEA 5DUKA 2VXDA 3O6BB 3CUOA 4IJAA 4RB1A 2VKEA 3GTPJ 2GXAA 4YIIA 2IBDA 2QZ8A 3Q9SA 1ON1A 2Y31A 5LEKA 3AL0C 1IN4A 1F43A 3DBHB 4M72A 4I98B 2BW3B 2E1CA 1TW2A 3HSFA 2ZJPF 1SFUA 3SZTA 3RKQA 2I5UA 1YJWI 3QP5A 3T8RA 3ASNH 3TO6A 4ENMA 1MBKA 5A2QZ 2VBXA 1MZBA 4CZCA 1CF7A 3DEUA 4IOCF 2FRHA 2FQ4A 2PEXA 4XLPF 4NBQA 1GLNA 3C18A 1NK3P 2XGDA 5M5XJ 5HLGA 1XMXA 3WTZA 4ESJA 3QYBA 1A6QA 3OOPA 3T8TA 2CUFA 4L9JA 2C6YA 2WC2A 2R7XA 1JUPA 1YE9A 3HOUJ 4LLGF 4ZH4F 2O8KA 4UNOA 2ZBKA 1ZKGA 2G7UA 2JK3A 3UNGC 1YTYA 4L9TA 1ZHFA 3E97A 1WJEA 4B3AA 2BY2A 2XGCA 2WAQA 4A3GJ 1QHHD 5LLQA 4EQQA 2CFOA 2E35A 2FQ3A 5HS9A 1ZGJA 3OYHA 3RJPA 1JI8A 1GDTA 5D5XB 2V4JC 5J3LA 3GBGA 1WGXA 1FBSA 2E2JJ 2G7HA 3ZMDA 1RI7A 4OIRF 1ON2A 3ZCOA 5DCMA 1R5GA 1EJ9A 1W7PB 4DYCA 2L54A 1R5ID 2QSGX 2WB1N 2ZKZA 4BXUA 5D5WB 3ZXSA 4Y3OA 4AIDA 3S2DJ 1MBEA 1WKMA 1P4XA 2KDOA 2CQXA 5AONA 5CVJA 5J6XA 5D8KB 3U21A 4Z6YA 1QVTA 2EV6A 3SDGA 2O61A 3VSKA 2PMZA 2I10A 2JN6A 4IHYA 1RRJA 2JPCA 5CVIA 5H6RA 2PJPA 2ZC2A 3GMEA 4O5VA 3HRSA 2O3FA 3QPTA 2DOEA 3TP0A 2DFHA 3L2WA 4RLFA 4BJTA 1JXSA 2V6EA 2PN6A 3FXKA 1Z1DA 2VIXA 3OV8A 3FMSA 1DP3A 2KRFA 1IRFA 2Y0SA 1ACIA 1BJZA 2K3PA 4CCJA 1ETWA 1QHGA 5GAHJ 3S1RJ 1JJ6C 4G12A 1SFOJ 4OU0A 2VOOA 3ESWB 3QPHA 4HA8A 5FKNA 2EFNA 4X0GA 4Y52J 1T33A 4ABZA 3I55I 1LE8A 2R7ZJ 4F3QA 2F5VA 4IOAF 4A3FJ 1Y8RB 4PGHA 2DA3A 3HSRA 1WHUA 2QYOA 2Y2ZA 2XGEA 3CDLA 4E7LA 3BR6A 3W6VA 4UUSB 2BVMA 1I39A 1YYVA 5F1JA 1E3OC 2EFPA 2X6YA 1Z3YA 4I2OA 4HX8A 3L2RA 2ZXIA 1TW3A 2VQHA 3DTIA 2B7EA 3H1CA 2M45A 5K5QA 2EH3A 5JLWA 2GAUA 2OF7A 2M30A 1XD7A 1HW2A 5J1UA 5GTIC 4BGDA 4S05A 1R5HA 1YX3A 2DA2A 1K78A 1QNTA 3FXUA 3J7AY 5DM6F 3S1MJ 2FBIA 1D3YA 3WTSC 2VOPA 3R61A 1IUFA 1MBHA 4MQ9F 4DNCA 3BROA 3J80Z 1XS9A 1QA6A 1NG7A 1HA8A 4RGRA 2P0WA 4GO1A 2VE8A 1APLC 3UR3C 3KEYA 3JRGA 1IRGA 1FP2A 4EVIA 1UB9A 1R1UA 3A01A 3JREA 4FTHA 1G4DA 5KHDA 1TNSA 3ZPLA 2RKHA 1J5YA 3ZMSA 2K7LA 1SVOA 2QUFA 1NH3A 3LSJA 4PK4A 4A3KJ 3IWFA 4LG0B 1Z7UA 1F4KA 4DIQA 4M6XA 4KFCA 4HLYA 5E1ZB 4PJNA 4C2TA 1OCCH 4QPQA 4OAZA 2TRTA 3DTKA 5EG0B 3GTMJ 2PMZN 5L3FA 3BTJA 2JJ7A 1PDNC 2VJJA 4LK1F 3PFYA 3OYDA 2VQLA 1U2WA 3DTEA 3E5UA 1B8IA 5FJ8J 3O8HA 3NRVA 3DV8A 3I0TA 1WH7A 2GIZA 1RZ4A 2O8XA 2A3SA 2DA1A 4I76A 1F9NA 2F5FA 5BMZA 4DZJA 1SFEA 2DO7A 2RV8A 4UB6C 2KFDA 4E7ZA 1B1BA 4QTRA 3LL7A 3JTGA 2ZSHB 4E7IA 2D45A 3LQQA 1OFCX 4BH9A 1BR1A 3KYDB 4P96A 1IC8A 3ZMUA 5A2QK 2KMUA 4ENNA 3H9JA 3TKYA 1QQIA 3CF2A 5KVRA 2ID3A 3A2KA 2X6XA 4R79A 1U8RA 3QWLA 4ENJA 5BPDA 4OWRB 3V7CA 3J7YJ 3ERED 2DW4A 2WV1A 3IAM2 4YEJA 3M07A 4X6AJ 3WGGA 1I1SA 3KE2A 1O4XA 3CLQA 1U8BA 5F6FA 1DPRA 2G9WA 1J59A 3R4KA 3P9KA 1D8JA 1Y6IA 2DFFA 5K7ZA 1OCRH 1PJRA 4W1UA 4N9IA 1B72A 2KIQA 1WSUA 2QBYB 2J5OA 3I53A 3IAS2 4B48A 2NVYJ 2RVCA 4KIFA 3EUHA 1Y39A 3F72A 2L02A 5DD4A 5EG0A 3HSEA 2XAJA 1HKSA 3S32A 2HKXA 3I3LA 2A6EF 2FU4A 4MNUA 5DV5A 3MZHA 4ESFA 3MD2A 4XLAA 3RZDJ 2KIUA 4CCLA 1O57A 1M1EB 4BJ5C 4PJJA 2KHMA 3VFZA 1KQ8A 3KYLA 2HNHA 1OR7C 1FSEA 3BR5A 2ZB9A 3G73A 2LTPA 2EZKA 4N0BA 3PIOF 3C2GA 1ETVA 2H6BA 1WWXA 1KYZA 3SYTA 4DBRA 2ETHA 4XKWA 4HF1A 3EPZA 3VYSB 3MAJA 1TQPA 5K7FA 1OMIA 2A07F 4LIVA 4UUVA 3DPTA 2F4OB 4HF2A 3VEPA 3BR1A 3BG5A 3CCQI 2LVSA 5D4RA 4IPAA 1UHSA 2LKPA 1XPXA 4IL6C 3U1DA 4J00A 4BQAA 1FMVA 1YLFA 3A4CA 1IG7A 2BOLA 2DMQA 5ILSA 2X1EA 3G3ZA 2CUJA 4WF2A 2XF6A 4IHXA 1UG2A 1GHCA 2VKVA 3DEEA 3RQ4A 4EJOA 1SD7A 2H94A 5CPRB 3HPHA 2R7SA 3WODF 1SD6A 4LB5A 3K6GA 2M3AA 1U3EM 2WA0A 1X1CA 1BM9A 4XBFA 2VJ4A 1G3YA 2B9SA 1IDYA 2W48A 3KZZA 3KP5A 1T98A 2VC1A 2MLKA 3BT9A 3HGYA 2FD5A 4M71A 3S17J 1D1AA 2FBHA 2G0EA 3RKYA 2QQ9A 2M1BA 5GPAA 5TGTA 2DMUA 5ERIA 2Q0OA 1BJAA 1ZELA 3QU3A 4XKVA 1J2XA 5FKKA 3H35A 1UHWA 1D0YA 1SMYF 1T2KA 4RGSA 1P7IA 2EWNA 3S14J 3LAJA 2PI0A 1SD4A 1MJ9A 1XDUA 1KGSA 3I59B 3CMAI 2M2EA 4DBQA 1JT6A 2E7XA 4YG2F 1S7EA 1ETXA 2K5CA 4BYYA 3ABTA 3QPLA 1HC8A 3HOZJ 2DMPA 3MN2A 2P5LC 1J0RA 2DN0A 3HRMA 3GFIA 1V5GA 5LBQA 5HLHA 2R7QA 1TWHJ 3H0DA 3WTTC 1TT0A 1VQMI 2W7NA 2LP0A 1E3HA 3ZQQA 3OYJA 2Z5UA 1Z05A 4WWCA 2HVRA 5C4XJ 2YSRA 2BV6A 2LF8A 1QGPA 2JA7J 3DF8A 3S2HJ 3HG9A 3O2PE 2NNYA 2QGUA 2PG4A 3TOAA 5D8LB 3KYCB 4MEXF 2KP6A 2NOJB 1BC7C 4RS8A 2L4AA 3C3WA 4HNUA 3F8CA 2BHZA 3KX2A 4OAYA 4Y15A 4HF0A 5J4YA 2JVHA 3OYIA 3RKXA 2PMUA 1UG0A 3AL0B 3CCLI 5IT3A 1W36D 2V6CA 2Y9YA 1XC5A 3B02A 5M5YJ 2IS1A 1OCOH 1RKTA 2LG4A 4LLNA 2FOWA 2L7MP 3RYPA 2E1MC 1B9NA 1ZYRF 5FKLA 4FT8A 4XSZF 4AD9A 4AIJA 4LOCA 1R71A 4RB2C 2UUZA 2L9VA 1TT5B 3NWTA 3RQIA 1T0FC 2XPUA 5CQGA 1I50J 3COAC 1LDJA 1R1TA 2RNJA 2LC2A 2QEXI 1ZH5A 3SFZA 4PDKA 3S1NJ 3OYFA 3PNYA 1XMAA 3K10A 2GA2A 4CCMA 2E7WA 2R3SA 1HDDC 3OMYA 3CCYA 2EZHA 2ICWG 2X51A 4UV8A 1Z9CA 2CUEA 3H9GA 3QU6A 3SEQA 4PJMA 4PGGA 1KU3A 3BQZA 1OYYA 3DP7A 4FQGA 4CXFA 5EGOB 4FISA 2NS7A 2L9RA 4F93B 1E3PA 4D0PA 3ZP5A 1ZREA 3SDBA 1NHAA 1LFBA 2FXAA 1WJBA 3L7WA 1ETKA 2K85A 1HOMA 3X2QH 5EZGA 2DPUA 2HWVA 3CUQC 4A5NA 3OYKA 5ICGA 2VC0A 1MMNA 1XSVA 2DMNA 5J8FA 5CVVA 1P4WA 5D5UB 4NC8A 3BR2A 2FNPA 3CZ6A 3JCUC 2L3DA 3HGGA 2F6CA 3I9V2 2IJLA 2XF7A 4JX6A 3LAPA 4C3HJ 1O7LA 1MMGA 1I5ZA 2XAFA 2IA0A 1ZGAA 1X3UA 3WTYC 4IX7A 2EZLA 3F8FA 2ZFUA 1PUEE 3FK6A 2MFZA 2OBPA 1WJFA 4XLEA 3ASOH 2P7CB 1D0ZA 5FLMJ 4WXCA 3PNTA 3F8BA 1D0XA 1LNWA 2XGXA 1PP8F 1XSDA 4UY8I 4A93J 3RYRA 5LHIA 2R7VA 4BHBA 2PJRB 3KZYA 5H6QA 2Q2EA 1JE8A 5B1AH 3IV5A 3R6SA 1QPMA 1XGNA 2KIFA 2O03A 3Q0WA 4NHJA 1VQPI 3A1YA 1SEUA 3GFJA 4GFBA 1OLTA 3K69A 2CYYA 1VQOI 1X1BA 3V4GA 2VI6A 1FT9A 2IVMA 3A0BC 2LFBA 1X3WB 2LY1A 5FB2A 3ABUA 2FE3A 5EEAA 1DUXC 3HEFA 1E0EA 1ZN2A 4Q48A 3WU2C 1HF0A 1R36A 4P9UA 1RUOA 2HOEA 1WPKA 1T8IA 4V2GA 2BY0A 3HDDA 4E7JA 1HW1A 5JHUA 1X1PA 1MJAA 5LHHA 1IO2A 2CG4A 1YQAA 4NC7A 5CVUA 1WH5A 2XKPA 3K70C 5GAGJ 4ZYGA 4RB0A 3EETA 3I4MJ 2VJIA 4PJLA 2VL8A 3TW6A 3HUGA 4AVZA 2OQRA 4KUMA 5LGNA 5J1RA 2ZMEC 3H92A 5LEJA 3BZKA 3L09A 2LBFA 4EM1A 3BJ6A 4BQOA 1IXSB 3Q3SA 1VQ7I 3CJTB 2JUCA 4G6QA 2KJCA 3S16J 1R1VA 4U88A 1YX5A 1K4TA 2PFBA 2LD5A 2X4HA 3QP6A 4IQ4A 5KCMA 2OUMA 4NUBA 3CDHA 4HRIA 2FUG2 3BJAA 4AU7A 1WJ5A 2PJRA 2XAHA 4NB5A 2OAZA 2HZDA 4BKXA 3F6OA 2JWTA 5LFAA 2R5ZA 3KP4A 2E5ZA 2LK2A 3H36A 1VFCA 2DA4A 3DLLF 1GUUA 3MZ8A 1MJBA 5JFRA 3F21A 1E17A 5BNGA 4AIKA 1TLHB 2QKLB 4L5IA 1B9MA 4DJAA 3SZPA 2M4GA 4P5OA 1P4AA 4G9YA 3QQAA 1B6AA 3HJEA 2Y30A 3RIRA 4GDFA 4L9VA 5FLVA 4Y7NJ 4OIPF 2IS6A 2L7KA 4EMSA 3JRIA 1ZK8A 2X85A 4B09A 4XM3A 3FM5A 2FX0A 3KLNA 2MLGA 4DYRA 2EBIA 4ZDPA 4GXOA 4AUXA 2Z9OA 3K1NA 3BWGA 2WBMA 4XIDA 1SVLA 2W00A 3TEDA 3GZ5A 3CCRI 2K9QA 2LNBA 1X2NA 1HSTA 4HPQA 1AKHB 1CGPA 1BW6A 2CSOA 3AAFA 1IGNA 2JSPA 2LKSA 3CC4I 1WQ2A 2P6TA 2XKOA 4CCKA 3RZOJ 3OR2C 2EFOA 4EM2A 4YFXF 2Z16A 5EJCA 4XOTA 3ZMTA 2M0CA 3B6CA 3V7RA 3C2BA 4RM3A 4M3FA
chains in the Genus database with same CATH topology
1MNEA 4DIQA 4F52A 4F55A 4PJNA 5HNHA 4C2TA 4C2UA 4QPQA 5CKTA 4OAZA 1G8XA 3OYNA 3DTKA 3CP2A 3H9QA 4XORA 3S3NA 3MKWB 2AQFA 2VJJA 3OYDA 3PFYA 2HU9A 2VQLA 3DTEA 4JQFA 4C30A 4N4NB 4ZYAA 2ELJA 3LFUA 1N77A 2OC6A 3K4KA 2LY2A 4QPOA 3DLAA 2E60A 4BEHB 4XQFA 4E7ZA 2CW7A 3OS2A 2IXSA 3LL7A 4PSXA 1MMAA 2ZSHB 2L9SA 3MMYB 1D1BA 4E7IA 4KITB 1BR1A 1QU3A 3PJRA 2KMUA 2KLOA 3H9JA 3CF2A 3LSIA 3FHNA 3A2KA 2X6XA 3TBIA 4R79A 1ERDA 4XONA 1EA3A 4HG2A 4OWRB 4PUSA 2BW3A 4ANJA 1LKXA 2K9MA 3M1CA 2VLAA 5CQEA 3HC7A 3IAM2 4YEJA 4HNTA 1MMDA 2VB6A 2W4SA 2L2OA 2WADA 2DT6A 1Y6IA 2DJIA 3BCBA 4RLQA 5HNFA 1PJRA 2L5QA 3ZRGA 3K4LA 5FROA 4XN3A 4B44A 1T95A 1S9HA 3IAS2 3W2WA 4B48A 3OY9A 2CH0A 3PSIA 4XOPA 3EUHC 3OYLA 2KL4A 3W2VA 3S32A 3I3LA 4HEA2 2VPLA 3CJQB 1X1AA 3DU5A 1FMWA 4EATA 2M4KA 3MD2A 4XLAA 2V26A 1VZ0A 1P9QC 3S3MA 2KRCA 4XLCA 4CCLA 2LH9A 3C2HA 4BUPA 5HOOA 4LIUA 2HPIA 4BJ5C 3S3OA 1UAAA 1N78A 2OV7A 3LSKA 4PJJA 2KHMA 2VQGA 3KYLA 2HNHA 1OR7C 4B3XA 4G6TB 2XC7A 2HVSA 3VWBA 1Y56A 2MYSA 3C2GA 2Q2EB 3H5RA 4U87A 3QYFA 3BLYA 2WB1A 1SAUA 4MLOA 4DBRA 3SYTA 1WFXA 4XKWA 3EPZA 3VYSB 3FKJA 4IQJA 4LIVA 2CV1A 4II3A 3DPTA 3LMMA 1TZLA 3OOUA 3H5NA 3BCAA 3RPUD 4ZTJA 1UELB 4KJZA 4J00A 3HL2A 1FMVA 2RNGA 3A4CA 3OYMA 4U7BA 2BOLA 2X1EA 3D5RC 2CUJA 1X4OA 2XF6A 3QYEA 2DCEA 2WY8Q 4BS9A 3DEEA 3RQ4A 2W1OA 1W36C 1J09A 3OR1C 3HPHA 4N4OB 5CPRB 3VYUB 4E6KG 2R7SA 1BR4A 2AQEA 3CP8A 3K6GA 2Z1DA 2KRHA 2M3AA 3HUGB 3ZR8X 2WA0A 1X1CA 2A5WA 3HOSA 2VJ4A 3RCOA 3BC8A 2HDWA 4BU2A 4D9JA 2LBFB 4CUGA 2XSJC 1D1AA 4ZDOA 2M0MA 1X1DA 3LSMA 1D1CA 2E1MB 2IS4A 5TGTA 3D5LA 1ZELA 2R4GA 4H4KC 4XKVA 2KZVA 3H35A 1U0JA 1WJAA 1NG6A 3K4BA 1D0YA 2LOOA 2V1NA 2CV2A 3DPLC 4F91B 2LRDA 4DBQA 3IP4B 3CMMA 2W82A 2K5CA 4E4HA 4FASD 4BE0A 3VSLA 2IS2A 1V5GA 3W3CA 2R7QA 3H0DA 4Y33A 5LD2C 1TT0A 2W7NA 4PFOA 3OYJA 3ZQQA 3SZGA 2XAUA 3DQVC 4XNFA 2HVRA 1Z3XA 1KONA 2F4IA 3L2QA 2LYCA 3NWSA 3HG9A 3DWLE 3BG6A 3MKYB 2KP6A 4ZTFA 2NOJB 3PNVA 2R7TA 4E7KA 2Q1ZB 4HNUA 3KX2A 3FDYA 4XR6A 4OAYA 2KQRA 4BACA 2DOAA 2JVHA 3DKXA 3OYIA 4CCNA 4BQQA 3E0JB 2UWMA 1UG0A 2IGNA 3AL0B 1W36D 4IZZA 2L9NA 3DU6A 2IS1A 3TL4X 4BJ6C 2LG4A 2WY7Q 1R6RA 2E1MC 1X4PA 4NNJA 4YELA 4E7HA 4B47A 2CW8A 3OL4A 3RSNA 4XL9A 2IGKA 2UUZA 5FRNA 2O5RA 2Z2SB 3NWTA 3OWTA 1T0FC 5CQGA 2GOMA 2X1DA 1PYVA 4BEHA 4CSWA 4XMYA 4CH7A 4E7SA 2LC2A 4J01A 3ONQA 1G59A 3TMOA 4BL0B 4BE1A 3AKZA 3QOEA 3OYFA 3PNYA 2WAFA 3OYGA 3OIQA 4ZDLA 3K10A 2HQAA 4CCMA 1DQUA 3OYAA 3OIPA 2MD0A 3OMYA 2X51A 4II2A 4ZJZA 1MNDA 2X1CA 4BQNA 3H9GA 3SEQA 2MC4A 4PJMA 3S8PA 4D1QA 3OYEA 4AYBA 2R7RA 3G2BA 1LVKA 3RTRA 4IKFA 4JOMA 4F93B 1DGRM 3LSGA 1LDKB 3SDBA 1WJBA 1WJDA 4ZC3A 4B43A 3F9KA 3PUBA 2DT7B 3OYKA 2VQCA 1MMNA 4FETA 2K9LA 2WAEA 4DOZA 3W2AA 2VXDA 4GRIA 2VJ5A 4NC8A 3BG7A 3CESA 3H5AA 2M7AA 3CZ6A 4P1WA 2RQQA 3HKZA 2F6CA 3I9V2 2XF7A 2JUGA 3AL0C 1MMGA 2IGOA 4BDZA 2BVLA 2R7OA 2BW3B 3V42A 4IX7A 2ZFUA 2KPMA 4PFPA 2MFZA 1WJFA 3M8JA 4XLEA 1D0ZA 3PNTA 1D0XA 1N75A 5KNLA 4CZCA 3EUKL 1GLNA 3N05A 4RMNA 3DPUA 4KISA 3AFHA 2CMPA 2R7VA 2PJRB 3QYBA 2JA2A 4XLFA 1BOBA 3A1YA 3S93A 2R7XA 1OLTA 4HSRA 5FRMA 1YE9A 3ZGKA 1X1BA 5HLTA 3LSHA 2CS3A 2XF5A 2HVQA 4CA0A 2LY1A 3UNGC 2DXIA 1WJEA 2E5NA 1E0EA 1MW7A 2WAQA 4BXFA 1WJCA 1QHHD 3OYHA 2CFOA 4BDYA 1Z21A 1JI8A 3PL8A 2GOXB 2VASA 3FBNB 3EUAA 4XKBA 2V4JC 4E7JA 3VDXA 3GBGA 1DGWY 4NC7A 3ZCOA 1K6YA 3K70C 2VKHA 2VJIA 3K4CA 3CJRB 4PJLA 2VL8A 3D5SC 2JVGA 3ZXSA 2R7WA 3SEZA 4Y3OA 4AVZA 3E1SA 4Y4RA 3VYRB 2KDOA 2V7FA 2CV0A 3U21A 3VSKA 4C9YA 2LBFA 2PMZA 3DKYA 4BQOA 4KT6A 2ZXHA 4HSTA 4PSWA 3OYBA 4LITA 1YX5A 3FBIB 3QODA 4BE2A 3OS0A 1IRXA 4IQ4A 4RLFA 5KCMA 4BJTA 2OUMA 4NUBA 3L2WA 2V6EA 4HRIA 3HOTA 2FUG2 4NQWB 2VIXA 1BR2A 1DP3A 4AU7A 2R7UA 1WJ5A 2PJRA 2CUZA 2Y0SA 2HZDA 2K3PA 4CCJA 1QHGA 3PSFA 5LFAA 2E5ZA 3VYTB 4X0GA 2QKLB 2F5VA 4F3QA 1SFKA 4DJAA 4LG3A 2M4GA 4P5OA 3HXLA 2RREA 1V5EA 2XDVA 2UV1A 3OL3A 4XN0A 5HVQC 2IS6A 2L7KA 3OS1A 2QKMB 4E7LA 2IGMA 2X85A 2BVMA 4RM2A 4CCOA 2X6YA 2LREA 1Z3YA 4XM3A 3K4NA 4ITVA 2V9KA 2ZXIA 1LFPA 3L2RA 1X19A 2VQHA 3DTIA 4ZDPA 4DGWB 4F92B 3L2VA 2WBMA 3HPGA 2W00A 4BGDA 3K4MA 5JHFA 1YX3A 4YRVA 3J7AY 2I8DA 3L2UA 1Z7LA 4XLHA 3K70D 3OYCA 4XKCA 4HPQA 2VKDA 1HA8A 1NG7A 2JSPA 2HPMA 1V5FA 3IUOA 2P0WA 3UR3C 3KEYA 3K4JA 4CCKA 2X6WA 3OR2C 2Z16A 2M7BA 4XOTA 5KHDA 2A6TA 4PK4A 2VXZA 4RM3A 3MKZA 1AA7A 2MABA 2ZSIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGW Y;  1DGR M; 
#chains in the Genus database with same CATH topology
 5LGU A;  2RQP A;  1XGS A;  4CIC A;  4F55 A;  1JKQ C;  1GV2 A;  3CCS I;  1ZTR A;  4C2U A;  5FFZ A;  1Z91 A;  4JK1 X;  3HB9 A;  2QQA A;  3O3K A;  2ELK A;  1XGM A;  1R9T J;  2DI3 A;  2F2E A;  2AQF A;  4IF4 A;  1TQI A;  4JQF A;  3L1P A;  2E19 A;  4IXA A;  4N4N B;  3M4O J;  1ETO A;  3LFU A;  1W5T A;  3R60 A;  3MWM A;  3K4K A;  2LY2 A;  3DLA A;  2E60 A;  1W1W E;  4XSX F;  1YRN B;  4BEH B;  4AM3 A;  5E20 A;  3WGH A;  5F0H A;  4XQF A;  3L00 A;  1XN7 A;  2XPV A;  4ZZL A;  4EV0 A;  4PSX A;  3KP6 A;  2ZXJ A;  3ECO A;  3MMY B;  3BR3 A;  1Z0X A;  2XIG A;  3K1M A;  4HLX A;  1VND A;  1WRJ A;  3ML6 A;  1IDZ A;  2JT1 A;  4UV9 A;  4JX5 A;  3CD6 I;  3LSI A;  9ANT A;  1KZH A;  5M3F J;  1W7P D;  2QM3 A;  3P5J A;  4AC0 A;  1EA3 A;  2V79 A;  4PUS A;  1EKE A;  2BW3 A;  4ANJ A;  4AYB N;  2K9M A;  1IV8 A;  5ICF A;  3KP3 A;  4HNT A;  2VT2 A;  3TDU C;  2ZO4 A;  4UHT A;  5L3B A;  2HYF A;  4P55 A;  2L2O A;  2XPW A;  2WAD A;  1S8N A;  2DT6 A;  3K4L A;  2EA2 A;  4U0W A;  2ZJQ F;  2ME0 A;  4XN3 A;  4B44 A;  2IW5 A;  1VQK I;  1S9H A;  2R7D A;  3T1B A;  2CH0 A;  3PSI A;  1FPQ A;  4XOP A;  4AIH A;  3OYL A;  1R7J A;  2W25 A;  2KL4 A;  3W2V A;  3SFI A;  3V8L A;  4G94 A;  5M5W J;  2V1U A;  1X1A A;  2ID6 A;  3E7L A;  3U2R A;  4A0Y A;  2KIM A;  4EAT A;  2V26 A;  1P9Q C;  3S3M A;  4RAF A;  2NVX J;  4XLC A;  1OCP A;  2JRM A;  2LH9 A;  1SAN A;  3C2H A;  5HOO A;  3S3O A;  2HPI A;  1W0U A;  3FWE A;  1OR7 A;  2MD5 A;  3VWB A;  2QCO A;  4M6V A;  2HVS A;  4CGZ A;  2ZJ2 A;  1Y56 A;  2VON A;  3HIF A;  2ELH A;  3H5R A;  1F1Z A;  2M87 A;  4BHP A;  4U87 A;  3PQJ A;  2STW A;  1SD5 A;  1ZRC A;  1W7P A;  1YS7 A;  4M3B A;  4MLO A;  1AWC A;  3VOD A;  1IXC A;  3IH4 A;  1W5S A;  3FKJ A;  2AXL A;  1K79 A;  3G1L A;  4A2U A;  1IW7 F;  2DTZ A;  1RNL A;  3KP2 A;  3OOU A;  1K6O A;  3BCA A;  1PP7 U;  2DQR A;  3WGI A;  2XAG A;  3A02 A;  5FKM A;  3GTK J;  3IH3 A;  2KT0 A;  1Y1V J;  3J81 Z;  4KIB A;  1Q1H A;  2WAQ N;  4IRH A;  1CQT A;  2YR2 A;  2H1L A;  5DM7 F;  3OYM A;  4A0Z A;  4XRF A;  4RB3 C;  1ZR4 A;  2X6O A;  4D7M A;  2KIS A;  3QYE A;  1D5Y A;  2DCE A;  2AS5 F;  2QA4 I;  3OR1 C;  4KN7 X;  3VYU B;  3JRD A;  1BR4 A;  1MIJ A;  5GTH C;  4XRS G;  2BBY A;  5GAE J;  2ZXW H;  1OQY A;  4Y17 A;  1ZRF A;  2HS5 A;  1Z6R A;  3WU0 A;  3HRU A;  4AWX B;  4DQ2 A;  1Y8Q B;  4BU2 A;  4QSH A;  2FMY A;  4D9J A;  1IN8 A;  1U5T C;  3LA3 A;  1U78 A;  2HTS A;  2M8G X;  2E1M B;  3Q9V A;  2CU7 A;  4WCG A;  1QZY A;  2CQQ A;  2HKO A;  3CC2 I;  2R4G A;  3GF2 A;  1HKT A;  2MA3 A;  1WJA A;  1NG6 A;  3IL2 A;  4UUS A;  4JX4 A;  5KAF C;  3JSP A;  2MGQ A;  4EJU A;  2NS8 A;  2V1N A;  2ECB A;  2Y0S N;  2VN2 A;  2IRF G;  2EV5 A;  1O7F A;  1V3F A;  4UUT A;  1T38 A;  5IP9 J;  1IAW A;  3TP3 A;  3MCZ A;  3ERM A;  2LR8 A;  3U1K A;  4H0E A;  2BZT A;  1YJ9 I;  3W3C A;  4I0A A;  5LD2 C;  2XRN A;  5FKO A;  2XRO A;  3KCC A;  2L4M A;  3SZG A;  4L5J A;  1LQ1 A;  4YIF A;  1MSE C;  1TBX A;  1ZQ3 P;  2LYC A;  3N4M A;  3I64 A;  3CCM I;  1IJW C;  3MEX A;  2CGP A;  3CUQ B;  4Q47 A;  2RAE A;  1O3Q A;  1QPI A;  2AXT C;  1I1G A;  1VF9 A;  2K86 A;  5EF6 A;  2PLY A;  2R7F A;  5EZH A;  4LG0 A;  2CWE A;  4A12 A;  4XR6 A;  1S3J A;  4BAC A;  3CO6 C;  2DOA A;  3IHU A;  4BQQ A;  4CCN A;  2A68 F;  1RR8 C;  3F0C A;  3HOY J;  3E0J B;  2OZ6 A;  2VBZ A;  2GIV A;  4RA2 A;  4XLN F;  4EGZ A;  4MFD A;  4KA4 A;  5L3G A;  3T5X A;  3QRF F;  4C3J J;  3REO A;  3FXO A;  2ZJR F;  3VB2 A;  5IY5 H;  1FBQ A;  3Q0V A;  4XL9 A;  4A69 C;  3RI4 A;  3OSG A;  3LST A;  4LD5 A;  3HOV J;  2CW0 F;  1S6L A;  2Z2S B;  1T0F A;  2GOM A;  2X1D A;  5DDG A;  2EIN H;  4CSW A;  2QLZ A;  3FMR A;  4BBR J;  4J01 A;  3ONQ A;  1G59 A;  4XK4 A;  3W6K B;  4BL0 B;  3MQ0 A;  4M9Z A;  4A3E J;  3OIQ A;  4BBS J;  4ZDL A;  3GTO J;  2F5D A;  3CDI A;  1H8A C;  1D8K A;  2PBI A;  4IEJ A;  1MND A;  4BQN A;  1HKQ A;  3F22 A;  3EYI A;  2MC4 A;  3N97 A;  2KJB A;  4FE7 A;  1G3T A;  4EEF G;  3F23 A;  3CCV I;  2O9L A;  3RTR A;  2VBY A;  4WK8 F;  4PCQ A;  3E6C C;  1G3W A;  3ZQ7 A;  4JOM A;  1DGR M;  3LSG A;  2HOS A;  2LLK A;  5K1Y A;  2F48 A;  4MO7 A;  4KIG A;  2DA5 A;  2H27 A;  4ZYE A;  3L2C A;  4U0Y A;  4DOZ A;  4KN4 X;  1JT0 A;  5J40 A;  2DFI A;  4GRI A;  2VJ5 A;  4LFU A;  2QBY A;  3CES A;  1FC3 A;  1S5L C;  2RQQ A;  3I71 A;  2IGO A;  1O3R A;  2ZME B;  4BDZ A;  4B4C A;  1D5V A;  1FZP B;  1A35 A;  2DQL A;  1ZAR A;  4PFP A;  1SMT A;  2QWW A;  3ZMV A;  1W5C C;  3M8J A;  2Y75 A;  5IYD J;  1N75 A;  3K9T A;  5KNL A;  4HDV A;  2PMH A;  3EUK L;  1GV5 A;  1QRY A;  4LJZ F;  4BY1 J;  2RGV A;  4M3G A;  3DPU A;  1FLI A;  3AFH A;  1LPQ A;  4Z2Y A;  2COM A;  2JRT A;  5BQT A;  2LY9 A;  2GZW A;  5F04 A;  3J81 K;  2V9V A;  3GYH X;  2ISZ A;  4HSR A;  5JR3 A;  5FRM A;  4IHW A;  5HLT A;  3LSH A;  2AO9 A;  1X3Z B;  2CS3 A;  5CLS A;  5HDG A;  1Q1V A;  4CA0 A;  5E3O A;  1MSF C;  2DXI A;  2W57 A;  2E5N A;  1O3T A;  1MW7 A;  4BXF A;  4IO9 F;  3PUF A;  3FXJ A;  1T39 A;  4BDY A;  3ZN0 A;  4IVN A;  2GOX B;  1K4S A;  3KFW X;  1UST A;  5L3C A;  2HYG D;  1DGW Y;  2JTV A;  3FF5 A;  1F36 A;  1ETY A;  1J75 A;  3R0A A;  3K4C A;  3TDZ C;  4ASN A;  3MFK A;  3D5S C;  2JVG A;  1OIS A;  3TGN A;  2K02 A;  3WTV C;  1J9I A;  4IHS A;  2TCT A;  5TRD A;  2XHK A;  3VYR B;  1LEB A;  2V7F A;  2EFW A;  4L9N A;  1IN7 A;  1ZG1 A;  2K40 A;  5EEH A;  4C9Y A;  3DKY A;  2ZXH A;  5H20 A;  3M8F A;  3FIW A;  1ZAO A;  4PSW A;  4I09 A;  3OYB A;  2OTJ I;  3BR0 A;  3C1D A;  4LIT A;  3FBI B;  3QOD A;  4HNV A;  1R58 A;  1XX5 A;  3FIS A;  3OS0 A;  4IRI A;  1GXQ A;  1FP1 D;  2FA5 A;  1Y0U A;  4NQW B;  3SHF A;  2Z99 A;  1A31 A;  2R7U A;  1PUF B;  5D4S A;  2JA8 J;  4DYQ A;  2DDB A;  2NNN A;  3I59 A;  3VYT B;  3E5Q A;  2VOD A;  1KQ9 A;  2HZT A;  4HAM A;  1ORK A;  1JGS A;  3I4N J;  2P5K A;  4JYK A;  3UKG A;  2ZFW A;  2LDU A;  2GWR A;  5KAI C;  4FCY A;  1SFK A;  2E34 A;  4OIN F;  3FKI J;  2XB0 X;  3TOB A;  1XSX A;  2R5Y B;  1HCR A;  2HDD A;  2RRE A;  2PQ8 A;  4MTD A;  4MQV A;  2UV1 A;  4TV7 A;  3OL3 A;  5HVQ C;  3LA2 A;  4MIM A;  2R0Q C;  3GLL A;  1R4N B;  3JRA A;  4RM2 A;  4CCO A;  3KET A;  2LRE A;  3K4N A;  1QBJ A;  1BC8 C;  1X19 A;  2YX7 A;  5B3S H;  3JRB A;  5GAD J;  4F92 B;  4ZYD A;  3L2V A;  4IHT A;  4AVP A;  1OYW A;  2NVQ J;  3HPG A;  3WHC A;  1JUM A;  4ON0 A;  2FSW A;  3CO7 C;  2D2W A;  5JHF A;  4YRV A;  2EIM H;  3HBL A;  3CCE I;  2I8D A;  3ELK A;  3L2U A;  4A0X A;  5E18 F;  1HLV A;  4XLH A;  4LMY A;  3IKT A;  2ECC A;  2HOA A;  2VKD A;  5ICE A;  4I99 C;  2ESN A;  4LLL A;  3GFM A;  2HPM A;  1FOY A;  1V5F A;  3IUO A;  4V2F A;  3DCF A;  3KPH A;  2X6W A;  4GYI A;  2EJR A;  3M9A A;  2M7B A;  4GCV A;  2A6T A;  5ICC A;  4UB8 C;  2N8G A;  1O3S A;  4BAY A;  2VXZ A;  1IV6 A;  3MKZ A;  1L3L A;  1G3S A;  1AA7 A;  3FM3 A;  3CME I;  1MNE A;  2GXG A;  3MVP A;  1FYM A;  1XB4 A;  4HOB A;  2V9P A;  5C4J J;  2DJN A;  5HNH A;  5IP7 J;  5CKT A;  1B59 A;  2DFE A;  3GZ6 A;  3BPV A;  1ONV A;  2DDA A;  3CP2 A;  3I58 A;  1WVR A;  3CC7 I;  3H9Q A;  2H8W A;  5E8I A;  3TW7 A;  2FF4 A;  2BEO A;  5EGO A;  4LB6 B;  4KNY A;  2E71 A;  4C30 A;  3ULQ B;  4ZYA A;  1V55 H;  2DYR H;  2ELJ A;  4EJT A;  1N77 A;  3FK7 A;  1ZLJ A;  4QIW N;  3LQR A;  1H9T A;  3GLX A;  5BOX A;  2F5E A;  2B63 J;  3DXJ F;  2W84 A;  1MMS A;  2V1X A;  3HRT A;  5ILV A;  4BNC A;  1WI3 A;  4WXD A;  4HX4 A;  2ADU A;  1FTT A;  2K27 A;  2CW7 A;  2IXS A;  4QLC U;  4Q5S F;  1MMA A;  1RUN A;  5D6E A;  2L9S A;  4FHT A;  3RPU A;  4KIT B;  3HTS B;  1QU3 A;  2XAS A;  1VQ6 I;  1R4M B;  1FOK A;  4HV6 A;  2BYV E;  2L7F P;  2E1O A;  3TBI A;  1ERD A;  1JUS A;  5FD6 A;  2CQN A;  1TWG J;  4HG2 A;  2VPR A;  1LKX A;  3EQL F;  2IT0 A;  3M3Y J;  3ISP A;  4A3J J;  2UXX A;  4G6D A;  3ROU A;  1HQC A;  1MMD A;  2VB6 A;  1DPU A;  1TNT A;  2IAI A;  3JRF A;  3GTQ J;  3GTJ J;  1ZG5 A;  4RLQ A;  2DJI A;  5HNF A;  2BE5 F;  4UXN A;  2KDZ A;  1YIJ I;  3ZQG A;  2ZCW A;  3IC7 A;  3P7N A;  2Q8K A;  1RR7 A;  1T95 A;  3S15 J;  3FX3 A;  4Y13 A;  3H0G J;  4A3M J;  1FSH A;  2BXY A;  4CYC B;  4KDP A;  3CJQ B;  5JVG F;  2DT5 A;  2VPL A;  3BZC A;  4XRM A;  2P7V B;  2CJJ A;  4RAY A;  5CJ9 A;  2P6S A;  1FMW A;  1U5T B;  2M4K A;  3ZQH A;  2KRC A;  1J7K A;  1AU7 A;  2E36 A;  4LIU A;  4I01 A;  1UAA A;  1BBY A;  1B4A A;  1KYW A;  2YUS A;  3ECH A;  5C44 J;  4HZF A;  2DTR A;  3CQZ J;  2MYS A;  2HTJ A;  5FGM A;  3ZQI A;  3QYF A;  3BLY A;  2WB1 A;  4BHC A;  3U9G A;  2NXN B;  1R49 A;  3E6D A;  1BIB A;  1I6H J;  4IQJ A;  3WTU C;  1DU0 A;  1TP4 A;  4JBA A;  4FX4 A;  2YU9 J;  3PO3 J;  2EV0 A;  3CCJ I;  3CTA A;  3LMM A;  2BXZ A;  3G1O A;  2HXO A;  1W4M A;  3DKW A;  3H5N A;  1VQN I;  2OD5 A;  5FFX A;  4M3E A;  5F0C A;  4R1H A;  3JSO A;  2GA1 A;  1DDN A;  5DTD A;  4U7B A;  3D5R C;  1AHD P;  4F7Z A;  3TQN A;  1STZ A;  2CRG A;  2NYX A;  1RC9 A;  1DU6 A;  2EZI A;  2TDX A;  2XUB A;  4D5C A;  1J09 A;  5E8G A;  5DCM B;  3DEW A;  3WU1 B;  2A05 A;  1W36 C;  2JA6 J;  4PJ0 C;  1Y0N A;  2AQE A;  3CP8 A;  4HYE A;  5IP6 A;  1H88 C;  2Z1D A;  3JTH A;  2KRH A;  2Y0M A;  5K7H A;  3AG2 H;  3HOS A;  3HTU A;  4RAZ A;  4CYC A;  2HDW A;  1HBX G;  3IWZ A;  3MZY A;  1C0W A;  1IUY A;  3WHB A;  2XB5 A;  4CUG A;  2XSJ C;  1U5T A;  1LEA A;  1MKM A;  1Z6T A;  4ZDO A;  2M0M A;  3LSM A;  1TQM A;  1D1C A;  2IS4 A;  1XGO A;  3K1P A;  1ZRD A;  2F4M B;  4H4K C;  3B6A A;  2VT3 A;  3GVA A;  2JA5 J;  3EYY A;  3K4B A;  5FO5 A;  2MBF A;  2IA1 A;  1U9O A;  5ED4 A;  5AIP A;  2A61 A;  1VI0 A;  5DD8 A;  4HBL A;  2NAZ A;  2HQN A;  4JP0 A;  1YW7 A;  2VBW A;  1N25 A;  2CV2 A;  3M1E A;  3BTC A;  2LRD A;  3IP4 B;  1YIT I;  5GPC A;  2HQ5 A;  3S2W A;  4E4H A;  5CYV A;  4FAS D;  1LE8 B;  3OIO A;  4QWQ A;  3WE2 A;  3ABL H;  3VSL A;  2IS2 A;  2K9N A;  4Y33 A;  1AKH A;  3HYI A;  3V7S A;  3PO2 J;  4PFO A;  1JGG A;  2GBY A;  1ZG3 A;  2XAU A;  4XNF A;  1DP7 P;  2GM4 A;  1Z3X A;  5IT9 K;  2J5P A;  3KIO A;  2CFX A;  2MC3 A;  3G1M A;  4J19 A;  2M5W A;  3DWL E;  1MH4 A;  1RKW A;  1BI3 A;  3PNV A;  2FJ1 A;  3BOQ A;  5CVR A;  4M6Y A;  4B8X A;  3HZJ A;  1H89 C;  1USS A;  3R0J A;  3DKX A;  5BPI A;  1K78 B;  2OTL I;  2IGN A;  2WWY A;  3H3Z A;  3ZQF A;  1JJ8 C;  4IZZ A;  3A0H C;  3GTG J;  5EEG A;  3DU6 A;  3F3X A;  2HFH A;  3MKL A;  2VUM J;  4BJ6 C;  1GVD A;  3HOW J;  4RDU A;  3F8M A;  4P9F A;  4NNJ A;  4E7H A;  1BOA A;  4B47 A;  2CW8 A;  5HS7 A;  2IGK A;  2O5R A;  2QF7 A;  2IPQ X;  3SJM A;  5E3M A;  4A3I J;  3A01 B;  1HDP A;  4KMU X;  3GTL J;  1ULY A;  1YRN A;  2BGC A;  2ZNZ A;  4BEH A;  1NTC A;  4XMY A;  4CH7 A;  5F27 A;  1BW5 A;  3TMO A;  3PQK A;  1P92 A;  1EV7 A;  3QOE A;  4S04 A;  3OYG A;  1AOY A;  1DQU A;  3OYA A;  4II2 A;  2KKO A;  4R8H A;  4D1Q A;  3S8P A;  1BA5 A;  3ZN1 A;  3J7Z I;  4G8X A;  2R7R A;  3G2B A;  4A3D J;  1B8I B;  1YHQ I;  2JSC A;  4KIC A;  1OPC A;  2M9H A;  5IYB J;  1POG A;  2FBK A;  3K7A J;  1I6X A;  2R92 J;  4G7O F;  1YFH A;  2QSH X;  3KEO A;  1WJD A;  3ABM H;  4FE4 A;  4NC6 A;  4ZC3 A;  4A6E A;  3WE3 A;  3F9K A;  3PUB A;  2DT7 B;  2LSO A;  3PFI A;  1W0T A;  4I0B A;  4FET A;  1UHM A;  3KEQ A;  3W2A A;  2P5V A;  2JQ7 A;  1FIA A;  2HI3 A;  1ZGW A;  3BG7 A;  3BTL A;  3H5A A;  2M7A A;  4P1W A;  4G7H F;  2OCE A;  2QQ8 A;  3HKZ A;  1R22 A;  3BTI A;  1QVU A;  2JUG A;  5J4V A;  5HS8 A;  1Z67 A;  1OCZ H;  2BVL A;  2R7O A;  5FLX Z;  2O7O A;  4IRG A;  3BQY A;  3QPS A;  3V42 A;  4ZYH A;  2HEO A;  2CQ7 A;  2KPM A;  1VQL I;  4B1R A;  1K83 J;  3FXL A;  2NRA C;  5J8C A;  1MGT A;  2MH2 A;  2NOG A;  2WV0 A;  1MBJ A;  5TIS C;  2EK5 A;  1HXD A;  2H09 A;  2Y48 A;  1WZ2 A;  1HW5 A;  1YW8 A;  3N05 A;  4RMN A;  2P81 A;  3RDI A;  4U7D A;  4KIS A;  3BDD A;  1KA8 A;  2RDP A;  3D0S A;  2ESH A;  2CMP A;  5E3N A;  1B72 B;  1T6S A;  3ABK H;  3BP8 A;  2JA2 A;  1TWA J;  1ETQ A;  4XLF A;  4S0H B;  3G4S I;  3KP7 A;  1BOB A;  5GP9 A;  1PVE A;  1V54 H;  3S93 A;  1F5T A;  4HQM A;  4FX0 A;  3ZGK A;  3AG3 H;  3GEZ A;  2XF5 A;  2HVQ A;  3GCM A;  3I54 A;  2MW8 A;  4L18 B;  4A6D A;  2DK5 A;  3GFL A;  1WJC A;  1Z21 A;  5F0F A;  3E5X A;  4RAG A;  3PL8 A;  5HDN A;  4HDU A;  1FBU A;  2VAS A;  3FBN B;  3EUA A;  4XKB A;  3VDX A;  1BI2 A;  1P2F A;  1IRZ A;  1LFU P;  5E3L A;  2H8R A;  1K6Y A;  2HYJ A;  4CHU A;  2VKH A;  4WXH A;  5DCF A;  2DPD A;  2A6H F;  1A04 A;  3CJR B;  3IKV A;  2W24 A;  3E6B A;  3AG1 H;  3NQO A;  3I56 I;  2R7W A;  3SEZ A;  1NK2 P;  3E1S A;  2DYS H;  4Y4R A;  2CV0 A;  2NVT J;  5E79 C;  2EA4 A;  4KT6 A;  4DZP A;  4HST A;  4M9S A;  1YO5 C;  3FXR A;  1JHH A;  3KZI C;  1YJN I;  4BE2 A;  2GQQ A;  2CO5 A;  1IRX A;  2K3F A;  1LUJ B;  1IN6 A;  3HOT A;  2ZNY A;  1VQ4 I;  1BR2 A;  1A36 A;  2DAO A;  2FOK A;  5IOZ A;  1QZZ A;  2CUZ A;  4PZJ A;  3RPQ A;  1G2H A;  3IH2 A;  2Z3Y A;  2M8E A;  3PSF A;  1SFX A;  3F6V A;  5J1Y A;  1XCV A;  3HKZ N;  2L0K A;  3GX4 X;  3J7A O;  4L0Y B;  1S72 I;  3CJN A;  1FY7 A;  1FTZ A;  3P9I A;  2CQK A;  1UMQ A;  3JAM Z;  4I7H A;  4LG3 A;  3KLO A;  1TTY A;  3HXL A;  1WI9 A;  1BI0 A;  1V5E A;  3GW2 A;  2DLL A;  2XDV A;  5HLI A;  3HHH A;  2EPF A;  2D5V A;  4XN0 A;  2O6G E;  3OS1 A;  2QKM B;  1MBG A;  3TO7 A;  3RKW A;  2IGM A;  4C2M J;  4CZZ A;  2NVU B;  2A5Y B;  2K4B A;  2EFQ A;  3CUQ A;  4IHV A;  3LNQ A;  4ITV A;  2V9K A;  1LFP A;  2PX9 A;  4DGW B;  2O0Y A;  1I3A A;  5TJJ A;  4NDL A;  3ZMZ A;  1JHF A;  4CYD A;  4MTE A;  2IP2 A;  3M7G A;  1FEX A;  1MDM B;  3K2Z A;  1E2X A;  2BHY A;  1EH6 A;  3HOX J;  1ENH A;  3K4M A;  1EH8 A;  2D1V A;  1JKP C;  1JKR C;  1KU7 A;  3EDP A;  1Z7L A;  4HQE A;  3K70 D;  3OYC A;  4XKC A;  2E2H J;  2HXI A;  1XMK A;  1JTY A;  5L3D A;  5C3E J;  1T08 B;  1S7A A;  3FXQ A;  4YFK F;  3K4J A;  2BY3 A;  2STT A;  1BL0 A;  2ME6 A;  1I3Q J;  1BIA A;  4UVB A;  5ILU A;  3GZN B;  1YIO A;  1KU9 A;  1ITY A;  2DOF A;  2DA6 A;  1SAX A;  2MAB A;  3A03 A;  2ZSI B;  4XRS A;  2DBB A;  4F52 A;  4RBO A;  1FJL A;  1XTA A;  2X48 A;  1VTN C;  1VQ8 I;  1G8X A;  4OMY A;  3OYN A;  1S29 A;  3HHG A;  3F8N A;  1UCR A;  1FWZ A;  4XOR A;  3S3N A;  6PAX A;  3MKW B;  4CDG A;  5IPA A;  2HU9 A;  2BY1 A;  5JVT A;  5AIQ A;  5LGT A;  3GXO A;  4XIC A;  3FMQ A;  2OC6 A;  3BPX A;  3D1N I;  4QPO A;  1RIO H;  1FYK A;  3G6E I;  2GLO A;  4EJV A;  1IN5 A;  3JW4 A;  5E1W A;  4MHG A;  5FLX K;  3OS2 A;  3J80 K;  1ODD A;  1D1B A;  1MDM A;  2FNA A;  2UXN A;  1GXP A;  1EH7 A;  4YFN F;  3PJR A;  5K5R A;  3WTW C;  2KLO A;  4D7N A;  1KQ0 A;  5F1R A;  3FHN A;  3Q5F A;  4WX9 A;  2JZY A;  2ZME A;  3L9F A;  4XON A;  3SXY A;  4N9H A;  1RET A;  3M1C A;  2VLA A;  3V8J A;  5EYR A;  5CQE A;  1BN5 A;  1KU2 A;  3HC7 A;  5F64 A;  3PIP F;  1P7J A;  5B5E C;  1OJL A;  3G71 I;  2W4S A;  2D1H A;  5IYC J;  1I27 A;  3CF5 F;  3K0L A;  3QOP A;  4EM0 B;  5FD5 A;  2GXB A;  4KT5 C;  4A5M A;  3BCB A;  1GVJ A;  2L5Q A;  3ZRG A;  2OJE D;  2P4W A;  5FRO A;  5K5O A;  5D6F A;  3WTX C;  3W2W A;  3OY9 A;  5DS9 A;  4V19 K;  3EUH C;  4G7Z F;  5B1B H;  1TWC J;  4I02 A;  3VPR A;  2HOT A;  4HEA 2;  4EGY A;  2X0L A;  1YOV B;  3B73 A;  4O6J A;  2IA2 A;  4CO8 A;  2XVC A;  3DU5 A;  1V4R A;  3IRQ A;  2JMW A;  2OQG A;  2KZG A;  1UJ8 A;  1S7O A;  4ZZD A;  1VZ0 A;  1XDS A;  2YS9 A;  1RPW A;  1K61 A;  2OU2 A;  5JLX A;  2H1K A;  4BUP A;  3GUD A;  5D5V B;  1OCT C;  1JTX A;  1N78 A;  3HM5 A;  2OV7 A;  3LSK A;  3OSF A;  2VQG A;  2JPB A;  4B3X A;  2XC7 A;  4G6T B;  2XAQ A;  2P8T A;  3E3V A;  2QSF X;  1FIP A;  3FHZ A;  2EB7 A;  4MEY F;  4OMZ A;  1LJ9 A;  2Q2E B;  2K4J A;  5J47 A;  3DBL B;  1UZC A;  2EQR A;  4M3D A;  3W6J B;  5HOD A;  4BXX J;  3I4P A;  1SAU A;  4KMF A;  4KYW A;  3LOC A;  2DMT A;  1FOW A;  3ZQC A;  1WFX A;  2YPR A;  1WCM J;  4MFE A;  2COB A;  2DK8 A;  3O8G A;  3DFG A;  1GT0 C;  1XCB A;  2XRL A;  2CV1 A;  4II3 A;  4X1E A;  5LHG A;  3ZOB A;  3JRH A;  1TZL A;  4A3C J;  4ZTJ A;  3RPU D;  5JI6 A;  2YX4 A;  1UEL B;  1T56 A;  2K9S A;  2FEZ A;  4KJZ A;  3ZQL A;  4GYG A;  1ZR2 A;  3HL2 A;  5KK1 A;  2RNG A;  3QAH A;  2A69 F;  1Z77 A;  1LVA A;  3V8K A;  2YU3 A;  2RN7 A;  3CLO A;  1X4O A;  4NQW A;  2OPT A;  3LWF A;  1IF1 A;  1R23 A;  4BS9 A;  2WY8 Q;  4OIQ F;  1PUF A;  2W1O A;  2HGC A;  3JAM K;  4E6K G;  1QZE A;  4N4O B;  3FZV A;  3JRC A;  1A6I A;  3WG9 A;  1SVM A;  1X58 A;  2V1D A;  3HUG B;  3ZR8 X;  2E2I J;  2A5W A;  3E6M A;  4C3I J;  4YIR X;  5F08 A;  5IT9 Z;  3RCO A;  3BC8 A;  1UFM A;  2Y9Z A;  2LMD A;  3LFK A;  2DOD A;  2LBF B;  2Y69 H;  2R5Y A;  1A5J A;  4GGG A;  4OOI A;  1MD0 A;  1X1D A;  4LK0 F;  1TWF J;  1H0M A;  4BY7 J;  3BY6 A;  3M8E A;  3CCU I;  4DW6 A;  3D5L A;  1MH3 A;  5E1X A;  3LA7 A;  3TO9 A;  2MG4 A;  2FML A;  2KZV A;  2QQB A;  1U0J A;  1QO0 D;  5EDN A;  4A3L J;  2LOO A;  3H3U A;  2R5Z B;  3DPL C;  3BG9 A;  4K2E A;  3H3V K;  2ISY A;  4U0V A;  2ACJ A;  4F91 B;  1Y1W J;  2NS0 A;  1TC3 C;  4Q4Z F;  2B0L A;  4L5E A;  3CMM A;  4OIO F;  2W82 A;  1LB2 A;  3C7J A;  3LSP A;  1OYI A;  2F5C A;  4BE0 A;  4W97 A;  2LF7 A;  3IRR A;  1HSJ A;  1K7A A;  4HV5 A;  1TL8 A;  1ZLK A;  4HX7 A;  4E70 A;  1U6G A;  4A3B J;  5LRS A;  3NEU A;  2IEK A;  3DQV C;  3WG7 H;  1KON A;  2MSY A;  2F4I A;  3L2Q A;  1FX7 A;  3NWS A;  1FOX A;  3LSR A;  4UVC A;  3BG6 A;  2UZK A;  2AHQ A;  4UVA A;  3MKY B;  5BS6 A;  5E17 F;  1OKR A;  4ZTF A;  1MNM C;  2HQR A;  3Q0U A;  2R7T A;  3T0Y A;  1EF4 A;  1U9N A;  4E7K A;  2Q1Z B;  4O3M A;  4ENK A;  2WTE A;  1YS6 A;  1YW9 A;  2XV4 S;  2E1N A;  3FDY A;  2KQR A;  5H2F C;  1SC7 A;  4M9X A;  2QEN A;  2OZU A;  3NAR A;  4EJW A;  4RGU A;  3NAU A;  2UWM A;  2M34 A;  4HW0 A;  3BJO A;  2L9N A;  1X2M A;  4L0Z B;  4MGR A;  3TL4 X;  1L0O C;  5DYM A;  2DA7 A;  3BG3 A;  1R6R A;  2WY7 Q;  4RGX A;  1X4P A;  4YEL A;  2L01 A;  3OL4 A;  3RSN A;  1REP C;  2L7Z A;  5FRN A;  1R00 A;  3OWT A;  1VQ5 I;  2EIL H;  1CF7 B;  4LGW A;  2OA4 A;  1MBF A;  3P9C A;  2HR3 A;  1PYV A;  3AG4 H;  2Z33 A;  2VE9 A;  1YG2 A;  1XG1 A;  5B66 C;  3K2A A;  4E7S A;  5DUI A;  1G6N A;  4M74 A;  3CMY A;  4BE1 A;  3AKZ A;  2WAF A;  3JR9 A;  2H6C A;  2HQA A;  2W85 A;  3GO5 A;  5HDK A;  3OIP A;  2MD0 A;  4ZJZ A;  1IZ1 A;  2X9D A;  3S1Q J;  2X1C A;  4ESB A;  4ETS A;  5IOY A;  3VOE A;  2RC4 A;  2XSD C;  2EIJ H;  3OYE A;  3BZ6 A;  1RES A;  2EIK H;  4AYB A;  1FYL A;  3PM1 A;  4M73 A;  1LDD A;  5DEQ A;  1IXR C;  1LVK A;  4IKF A;  2OCC H;  1FNN A;  1JKO C;  4I6Z A;  1LDK B;  5M3M J;  5LRR A;  1H9G A;  2LKX A;  1VQ9 I;  2R93 J;  3I5U A;  1BI1 A;  2QVO A;  4B43 A;  4D5F A;  1YI2 I;  3DBR B;  3FXM A;  2MH9 A;  1P6R A;  3GWZ A;  2HDC A;  5L3E A;  2VQC A;  3SQN A;  2DU9 A;  2K9L A;  2WAE A;  5DUK A;  2VXD A;  3O6B B;  3CUO A;  4IJA A;  4RB1 A;  2VKE A;  3GTP J;  2GXA A;  4YII A;  2IBD A;  2QZ8 A;  3Q9S A;  1ON1 A;  2Y31 A;  5LEK A;  3AL0 C;  1IN4 A;  1F43 A;  3DBH B;  4M72 A;  4I98 B;  2BW3 B;  2E1C A;  1TW2 A;  3HSF A;  2ZJP F;  1SFU A;  3SZT A;  3RKQ A;  2I5U A;  1YJW I;  3QP5 A;  3T8R A;  3ASN H;  3TO6 A;  4ENM A;  1MBK A;  5A2Q Z;  2VBX A;  1MZB A;  4CZC A;  1CF7 A;  3DEU A;  4IOC F;  2FRH A;  2FQ4 A;  2PEX A;  4XLP F;  4NBQ A;  1GLN A;  3C18 A;  1NK3 P;  2XGD A;  5M5X J;  5HLG A;  1XMX A;  3WTZ A;  4ESJ A;  3QYB A;  1A6Q A;  3OOP A;  3T8T A;  2CUF A;  4L9J A;  2C6Y A;  2WC2 A;  2R7X A;  1JUP A;  1YE9 A;  3HOU J;  4LLG F;  4ZH4 F;  2O8K A;  4UNO A;  2ZBK A;  1ZKG A;  2G7U A;  2JK3 A;  3UNG C;  1YTY A;  4L9T A;  1ZHF A;  3E97 A;  1WJE A;  4B3A A;  2BY2 A;  2XGC A;  2WAQ A;  4A3G J;  1QHH D;  5LLQ A;  4EQQ A;  2CFO A;  2E35 A;  2FQ3 A;  5HS9 A;  1ZGJ A;  3OYH A;  3RJP A;  1JI8 A;  1GDT A;  5D5X B;  2V4J C;  5J3L A;  3GBG A;  1WGX A;  1FBS A;  2E2J J;  2G7H A;  3ZMD A;  1RI7 A;  4OIR F;  1ON2 A;  3ZCO A;  5DCM A;  1R5G A;  1EJ9 A;  1W7P B;  4DYC A;  2L54 A;  1R5I D;  2QSG X;  2WB1 N;  2ZKZ A;  4BXU A;  5D5W B;  3ZXS A;  4Y3O A;  4AID A;  3S2D J;  1MBE A;  1WKM A;  1P4X A;  2KDO A;  2CQX A;  5AON A;  5CVJ A;  5J6X A;  5D8K B;  3U21 A;  4Z6Y A;  1QVT A;  2EV6 A;  3SDG A;  2O61 A;  3VSK A;  2PMZ A;  2I10 A;  2JN6 A;  4IHY A;  1RRJ A;  2JPC A;  5CVI A;  5H6R A;  2PJP A;  2ZC2 A;  3GME A;  4O5V A;  3HRS A;  2O3F A;  3QPT A;  2DOE A;  3TP0 A;  2DFH A;  3L2W A;  4RLF A;  4BJT A;  1JXS A;  2V6E A;  2PN6 A;  3FXK A;  1Z1D A;  2VIX A;  3OV8 A;  3FMS A;  1DP3 A;  2KRF A;  1IRF A;  2Y0S A;  1ACI A;  1BJZ A;  2K3P A;  4CCJ A;  1ETW A;  1QHG A;  5GAH J;  3S1R J;  1JJ6 C;  4G12 A;  1SFO J;  4OU0 A;  2VOO A;  3ESW B;  3QPH A;  4HA8 A;  5FKN A;  2EFN A;  4X0G A;  4Y52 J;  1T33 A;  4ABZ A;  3I55 I;  1LE8 A;  2R7Z J;  4F3Q A;  2F5V A;  4IOA F;  4A3F J;  1Y8R B;  4PGH A;  2DA3 A;  3HSR A;  1WHU A;  2QYO A;  2Y2Z A;  2XGE A;  3CDL A;  4E7L A;  3BR6 A;  3W6V A;  4UUS B;  2BVM A;  1I39 A;  1YYV A;  5F1J A;  1E3O C;  2EFP A;  2X6Y A;  1Z3Y A;  4I2O A;  4HX8 A;  3L2R A;  2ZXI A;  1TW3 A;  2VQH A;  3DTI A;  2B7E A;  3H1C A;  2M45 A;  5K5Q A;  2EH3 A;  5JLW A;  2GAU A;  2OF7 A;  2M30 A;  1XD7 A;  1HW2 A;  5J1U A;  5GTI C;  4BGD A;  4S05 A;  1R5H A;  1YX3 A;  2DA2 A;  1K78 A;  1QNT A;  3FXU A;  3J7A Y;  5DM6 F;  3S1M J;  2FBI A;  1D3Y A;  3WTS C;  2VOP A;  3R61 A;  1IUF A;  1MBH A;  4MQ9 F;  4DNC A;  3BRO A;  3J80 Z;  1XS9 A;  1QA6 A;  1NG7 A;  1HA8 A;  4RGR A;  2P0W A;  4GO1 A;  2VE8 A;  1APL C;  3UR3 C;  3KEY A;  3JRG A;  1IRG A;  1FP2 A;  4EVI A;  1UB9 A;  1R1U A;  3A01 A;  3JRE A;  4FTH A;  1G4D A;  5KHD A;  1TNS A;  3ZPL A;  2RKH A;  1J5Y A;  3ZMS A;  2K7L A;  1SVO A;  2QUF A;  1NH3 A;  3LSJ A;  4PK4 A;  4A3K J;  3IWF A;  4LG0 B;  1Z7U A;  1F4K A;  4DIQ A;  4M6X A;  4KFC A;  4HLY A;  5E1Z B;  4PJN A;  4C2T A;  1OCC H;  4QPQ A;  4OAZ A;  2TRT A;  3DTK A;  5EG0 B;  3GTM J;  2PMZ N;  5L3F A;  3BTJ A;  2JJ7 A;  1PDN C;  2VJJ A;  4LK1 F;  3PFY A;  3OYD A;  2VQL A;  1U2W A;  3DTE A;  3E5U A;  1B8I A;  5FJ8 J;  3O8H A;  3NRV A;  3DV8 A;  3I0T A;  1WH7 A;  2GIZ A;  1RZ4 A;  2O8X A;  2A3S A;  2DA1 A;  4I76 A;  1F9N A;  2F5F A;  5BMZ A;  4DZJ A;  1SFE A;  2DO7 A;  2RV8 A;  4UB6 C;  2KFD A;  4E7Z A;  1B1B A;  4QTR A;  3LL7 A;  3JTG A;  2ZSH B;  4E7I A;  2D45 A;  3LQQ A;  1OFC X;  4BH9 A;  1BR1 A;  3KYD B;  4P96 A;  1IC8 A;  3ZMU A;  5A2Q K;  2KMU A;  4ENN A;  3H9J A;  3TKY A;  1QQI A;  3CF2 A;  5KVR A;  2ID3 A;  3A2K A;  2X6X A;  4R79 A;  1U8R A;  3QWL A;  4ENJ A;  5BPD A;  4OWR B;  3V7C A;  3J7Y J;  3ERE D;  2DW4 A;  2WV1 A;  3IAM 2;  4YEJ A;  3M07 A;  4X6A J;  3WGG A;  1I1S A;  3KE2 A;  1O4X A;  3CLQ A;  1U8B A;  5F6F A;  1DPR A;  2G9W A;  1J59 A;  3R4K A;  3P9K A;  1D8J A;  1Y6I A;  2DFF A;  5K7Z A;  1OCR H;  1PJR A;  4W1U A;  4N9I A;  1B72 A;  2KIQ A;  1WSU A;  2QBY B;  2J5O A;  3I53 A;  3IAS 2;  4B48 A;  2NVY J;  2RVC A;  4KIF A;  3EUH A;  1Y39 A;  3F72 A;  2L02 A;  5DD4 A;  5EG0 A;  3HSE A;  2XAJ A;  1HKS A;  3S32 A;  2HKX A;  3I3L A;  2A6E F;  2FU4 A;  4MNU A;  5DV5 A;  3MZH A;  4ESF A;  3MD2 A;  4XLA A;  3RZD J;  2KIU A;  4CCL A;  1O57 A;  1M1E B;  4BJ5 C;  4PJJ A;  2KHM A;  3VFZ A;  1KQ8 A;  3KYL A;  2HNH A;  1OR7 C;  1FSE A;  3BR5 A;  2ZB9 A;  3G73 A;  2LTP A;  2EZK A;  4N0B A;  3PIO F;  3C2G A;  1ETV A;  2H6B A;  1WWX A;  1KYZ A;  3SYT A;  4DBR A;  2ETH A;  4XKW A;  4HF1 A;  3EPZ A;  3VYS B;  3MAJ A;  1TQP A;  5K7F A;  1OMI A;  2A07 F;  4LIV A;  4UUV A;  3DPT A;  2F4O B;  4HF2 A;  3VEP A;  3BR1 A;  3BG5 A;  3CCQ I;  2LVS A;  5D4R A;  4IPA A;  1UHS A;  2LKP A;  1XPX A;  4IL6 C;  3U1D A;  4J00 A;  4BQA A;  1FMV A;  1YLF A;  3A4C A;  1IG7 A;  2BOL A;  2DMQ A;  5ILS A;  2X1E A;  3G3Z A;  2CUJ A;  4WF2 A;  2XF6 A;  4IHX A;  1UG2 A;  1GHC A;  2VKV A;  3DEE A;  3RQ4 A;  4EJO A;  1SD7 A;  2H94 A;  5CPR B;  3HPH A;  2R7S A;  3WOD F;  1SD6 A;  4LB5 A;  3K6G A;  2M3A A;  1U3E M;  2WA0 A;  1X1C A;  1BM9 A;  4XBF A;  2VJ4 A;  1G3Y A;  2B9S A;  1IDY A;  2W48 A;  3KZZ A;  3KP5 A;  1T98 A;  2VC1 A;  2MLK A;  3BT9 A;  3HGY A;  2FD5 A;  4M71 A;  3S17 J;  1D1A A;  2FBH A;  2G0E A;  3RKY A;  2QQ9 A;  2M1B A;  5GPA A;  5TGT A;  2DMU A;  5ERI A;  2Q0O A;  1BJA A;  1ZEL A;  3QU3 A;  4XKV A;  1J2X A;  5FKK A;  3H35 A;  1UHW A;  1D0Y A;  1SMY F;  1T2K A;  4RGS A;  1P7I A;  2EWN A;  3S14 J;  3LAJ A;  2PI0 A;  1SD4 A;  1MJ9 A;  1XDU A;  1KGS A;  3I59 B;  3CMA I;  2M2E A;  4DBQ A;  1JT6 A;  2E7X A;  4YG2 F;  1S7E A;  1ETX A;  2K5C A;  4BYY A;  3ABT A;  3QPL A;  1HC8 A;  3HOZ J;  2DMP A;  3MN2 A;  2P5L C;  1J0R A;  2DN0 A;  3HRM A;  3GFI A;  1V5G A;  5LBQ A;  5HLH A;  2R7Q A;  1TWH J;  3H0D A;  3WTT C;  1TT0 A;  1VQM I;  2W7N A;  2LP0 A;  1E3H A;  3ZQQ A;  3OYJ A;  2Z5U A;  1Z05 A;  4WWC A;  2HVR A;  5C4X J;  2YSR A;  2BV6 A;  2LF8 A;  1QGP A;  2JA7 J;  3DF8 A;  3S2H J;  3HG9 A;  3O2P E;  2NNY A;  2QGU A;  2PG4 A;  3TOA A;  5D8L B;  3KYC B;  4MEX F;  2KP6 A;  2NOJ B;  1BC7 C;  4RS8 A;  2L4A A;  3C3W A;  4HNU A;  3F8C A;  2BHZ A;  3KX2 A;  4OAY A;  4Y15 A;  4HF0 A;  5J4Y A;  2JVH A;  3OYI A;  3RKX A;  2PMU A;  1UG0 A;  3AL0 B;  3CCL I;  5IT3 A;  1W36 D;  2V6C A;  2Y9Y A;  1XC5 A;  3B02 A;  5M5Y J;  2IS1 A;  1OCO H;  1RKT A;  2LG4 A;  4LLN A;  2FOW A;  2L7M P;  3RYP A;  2E1M C;  1B9N A;  1ZYR F;  5FKL A;  4FT8 A;  4XSZ F;  4AD9 A;  4AIJ A;  4LOC A;  1R71 A;  4RB2 C;  2UUZ A;  2L9V A;  1TT5 B;  3NWT A;  3RQI A;  1T0F C;  2XPU A;  5CQG A;  1I50 J;  3COA C;  1LDJ A;  1R1T A;  2RNJ A;  2LC2 A;  2QEX I;  1ZH5 A;  3SFZ A;  4PDK A;  3S1N J;  3OYF A;  3PNY A;  1XMA A;  3K10 A;  2GA2 A;  4CCM A;  2E7W A;  2R3S A;  1HDD C;  3OMY A;  3CCY A;  2EZH A;  2ICW G;  2X51 A;  4UV8 A;  1Z9C A;  2CUE A;  3H9G A;  3QU6 A;  3SEQ A;  4PJM A;  4PGG A;  1KU3 A;  3BQZ A;  1OYY A;  3DP7 A;  4FQG A;  4CXF A;  5EGO B;  4FIS A;  2NS7 A;  2L9R A;  4F93 B;  1E3P A;  4D0P A;  3ZP5 A;  1ZRE A;  3SDB A;  1NHA A;  1LFB A;  2FXA A;  1WJB A;  3L7W A;  1ETK A;  2K85 A;  1HOM A;  3X2Q H;  5EZG A;  2DPU A;  2HWV A;  3CUQ C;  4A5N A;  3OYK A;  5ICG A;  2VC0 A;  1MMN A;  1XSV A;  2DMN A;  5J8F A;  5CVV A;  1P4W A;  5D5U B;  4NC8 A;  3BR2 A;  2FNP A;  3CZ6 A;  3JCU C;  2L3D A;  3HGG A;  2F6C A;  3I9V 2;  2IJL A;  2XF7 A;  4JX6 A;  3LAP A;  4C3H J;  1O7L A;  1MMG A;  1I5Z A;  2XAF A;  2IA0 A;  1ZGA A;  1X3U A;  3WTY C;  4IX7 A;  2EZL A;  3F8F A;  2ZFU A;  1PUE E;  3FK6 A;  2MFZ A;  2OBP A;  1WJF A;  4XLE A;  3ASO H;  2P7C B;  1D0Z A;  5FLM J;  4WXC A;  3PNT A;  3F8B A;  1D0X A;  1LNW A;  2XGX A;  1PP8 F;  1XSD A;  4UY8 I;  4A93 J;  3RYR A;  5LHI A;  2R7V A;  4BHB A;  2PJR B;  3KZY A;  5H6Q A;  2Q2E A;  1JE8 A;  5B1A H;  3IV5 A;  3R6S A;  1QPM A;  1XGN A;  2KIF A;  2O03 A;  3Q0W A;  4NHJ A;  1VQP I;  3A1Y A;  1SEU A;  3GFJ A;  4GFB A;  1OLT A;  3K69 A;  2CYY A;  1VQO I;  1X1B A;  3V4G A;  2VI6 A;  1FT9 A;  2IVM A;  3A0B C;  2LFB A;  1X3W B;  2LY1 A;  5FB2 A;  3ABU A;  2FE3 A;  5EEA A;  1DUX C;  3HEF A;  1E0E A;  1ZN2 A;  4Q48 A;  3WU2 C;  1HF0 A;  1R36 A;  4P9U A;  1RUO A;  2HOE A;  1WPK A;  1T8I A;  4V2G A;  2BY0 A;  3HDD A;  4E7J A;  1HW1 A;  5JHU A;  1X1P A;  1MJA A;  5LHH A;  1IO2 A;  2CG4 A;  1YQA A;  4NC7 A;  5CVU A;  1WH5 A;  2XKP A;  3K70 C;  5GAG J;  4ZYG A;  4RB0 A;  3EET A;  3I4M J;  2VJI A;  4PJL A;  2VL8 A;  3TW6 A;  3HUG A;  4AVZ A;  2OQR A;  4KUM A;  5LGN A;  5J1R A;  2ZME C;  3H92 A;  5LEJ A;  3BZK A;  3L09 A;  2LBF A;  4EM1 A;  3BJ6 A;  4BQO A;  1IXS B;  3Q3S A;  1VQ7 I;  3CJT B;  2JUC A;  4G6Q A;  2KJC A;  3S16 J;  1R1V A;  4U88 A;  1YX5 A;  1K4T A;  2PFB A;  2LD5 A;  2X4H A;  3QP6 A;  4IQ4 A;  5KCM A;  2OUM A;  4NUB A;  3CDH A;  4HRI A;  2FUG 2;  3BJA A;  4AU7 A;  1WJ5 A;  2PJR A;  2XAH A;  4NB5 A;  2OAZ A;  2HZD A;  4BKX A;  3F6O A;  2JWT A;  5LFA A;  2R5Z A;  3KP4 A;  2E5Z A;  2LK2 A;  3H36 A;  1VFC A;  2DA4 A;  3DLL F;  1GUU A;  3MZ8 A;  1MJB A;  5JFR A;  3F21 A;  1E17 A;  5BNG A;  4AIK A;  1TLH B;  2QKL B;  4L5I A;  1B9M A;  4DJA A;  3SZP A;  2M4G A;  4P5O A;  1P4A A;  4G9Y A;  3QQA A;  1B6A A;  3HJE A;  2Y30 A;  3RIR A;  4GDF A;  4L9V A;  5FLV A;  4Y7N J;  4OIP F;  2IS6 A;  2L7K A;  4EMS A;  3JRI A;  1ZK8 A;  2X85 A;  4B09 A;  4XM3 A;  3FM5 A;  2FX0 A;  3KLN A;  2MLG A;  4DYR A;  2EBI A;  4ZDP A;  4GXO A;  4AUX A;  2Z9O A;  3K1N A;  3BWG A;  2WBM A;  4XID A;  1SVL A;  2W00 A;  3TED A;  3GZ5 A;  3CCR I;  2K9Q A;  2LNB A;  1X2N A;  1HST A;  4HPQ A;  1AKH B;  1CGP A;  1BW6 A;  2CSO A;  3AAF A;  1IGN A;  2JSP A;  2LKS A;  3CC4 I;  1WQ2 A;  2P6T A;  2XKO A;  4CCK A;  3RZO J;  3OR2 C;  2EFO A;  4EM2 A;  4YFX F;  2Z16 A;  5EJC A;  4XOT A;  3ZMT A;  2M0C A;  3B6C A;  3V7R A;  3C2B A;  4RM3 A;  4M3F A; 
#chains in the Genus database with same CATH homology
 1MNE A;  4DIQ A;  4F52 A;  4F55 A;  4PJN A;  5HNH A;  4C2T A;  4C2U A;  4QPQ A;  5CKT A;  4OAZ A;  1G8X A;  3OYN A;  3DTK A;  3CP2 A;  3H9Q A;  4XOR A;  3S3N A;  3MKW B;  2AQF A;  2VJJ A;  3OYD A;  3PFY A;  2HU9 A;  2VQL A;  3DTE A;  4JQF A;  4C30 A;  4N4N B;  4ZYA A;  2ELJ A;  3LFU A;  1N77 A;  2OC6 A;  3K4K A;  2LY2 A;  4QPO A;  3DLA A;  2E60 A;  4BEH B;  4XQF A;  4E7Z A;  2CW7 A;  3OS2 A;  2IXS A;  3LL7 A;  4PSX A;  1MMA A;  2ZSH B;  2L9S A;  3MMY B;  1D1B A;  4E7I A;  4KIT B;  1BR1 A;  1QU3 A;  3PJR A;  2KMU A;  2KLO A;  3H9J A;  3CF2 A;  3LSI A;  3FHN A;  3A2K A;  2X6X A;  3TBI A;  4R79 A;  1ERD A;  4XON A;  1EA3 A;  4HG2 A;  4OWR B;  4PUS A;  2BW3 A;  4ANJ A;  1LKX A;  2K9M A;  3M1C A;  2VLA A;  5CQE A;  3HC7 A;  3IAM 2;  4YEJ A;  4HNT A;  1MMD A;  2VB6 A;  2W4S A;  2L2O A;  2WAD A;  2DT6 A;  1Y6I A;  2DJI A;  3BCB A;  4RLQ A;  5HNF A;  1PJR A;  2L5Q A;  3ZRG A;  3K4L A;  5FRO A;  4XN3 A;  4B44 A;  1T95 A;  1S9H A;  3IAS 2;  3W2W A;  4B48 A;  3OY9 A;  2CH0 A;  3PSI A;  4XOP A;  3EUH C;  3OYL A;  2KL4 A;  3W2V A;  3S32 A;  3I3L A;  4HEA 2;  2VPL A;  3CJQ B;  1X1A A;  3DU5 A;  1FMW A;  4EAT A;  2M4K A;  3MD2 A;  4XLA A;  2V26 A;  1VZ0 A;  1P9Q C;  3S3M A;  2KRC A;  4XLC A;  4CCL A;  2LH9 A;  3C2H A;  4BUP A;  5HOO A;  4LIU A;  2HPI A;  4BJ5 C;  3S3O A;  1UAA A;  1N78 A;  2OV7 A;  3LSK A;  4PJJ A;  2KHM A;  2VQG A;  3KYL A;  2HNH A;  1OR7 C;  4B3X A;  4G6T B;  2XC7 A;  2HVS A;  3VWB A;  1Y56 A;  2MYS A;  3C2G A;  2Q2E B;  3H5R A;  4U87 A;  3QYF A;  3BLY A;  2WB1 A;  1SAU A;  4MLO A;  4DBR A;  3SYT A;  1WFX A;  4XKW A;  3EPZ A;  3VYS B;  3FKJ A;  4IQJ A;  4LIV A;  2CV1 A;  4II3 A;  3DPT A;  3LMM A;  1TZL A;  3OOU A;  3H5N A;  3BCA A;  3RPU D;  4ZTJ A;  1UEL B;  4KJZ A;  4J00 A;  3HL2 A;  1FMV A;  2RNG A;  3A4C A;  3OYM A;  4U7B A;  2BOL A;  2X1E A;  3D5R C;  2CUJ A;  1X4O A;  2XF6 A;  3QYE A;  2DCE A;  2WY8 Q;  4BS9 A;  3DEE A;  3RQ4 A;  2W1O A;  1W36 C;  1J09 A;  3OR1 C;  3HPH A;  4N4O B;  5CPR B;  3VYU B;  4E6K G;  2R7S A;  1BR4 A;  2AQE A;  3CP8 A;  3K6G A;  2Z1D A;  2KRH A;  2M3A A;  3HUG B;  3ZR8 X;  2WA0 A;  1X1C A;  2A5W A;  3HOS A;  2VJ4 A;  3RCO A;  3BC8 A;  2HDW A;  4BU2 A;  4D9J A;  2LBF B;  4CUG A;  2XSJ C;  1D1A A;  4ZDO A;  2M0M A;  1X1D A;  3LSM A;  1D1C A;  2E1M B;  2IS4 A;  5TGT A;  3D5L A;  1ZEL A;  2R4G A;  4H4K C;  4XKV A;  2KZV A;  3H35 A;  1U0J A;  1WJA A;  1NG6 A;  3K4B A;  1D0Y A;  2LOO A;  2V1N A;  2CV2 A;  3DPL C;  4F91 B;  2LRD A;  4DBQ A;  3IP4 B;  3CMM A;  2W82 A;  2K5C A;  4E4H A;  4FAS D;  4BE0 A;  3VSL A;  2IS2 A;  1V5G A;  3W3C A;  2R7Q A;  3H0D A;  4Y33 A;  5LD2 C;  1TT0 A;  2W7N A;  4PFO A;  3OYJ A;  3ZQQ A;  3SZG A;  2XAU A;  3DQV C;  4XNF A;  2HVR A;  1Z3X A;  1KON A;  2F4I A;  3L2Q A;  2LYC A;  3NWS A;  3HG9 A;  3DWL E;  3BG6 A;  3MKY B;  2KP6 A;  4ZTF A;  2NOJ B;  3PNV A;  2R7T A;  4E7K A;  2Q1Z B;  4HNU A;  3KX2 A;  3FDY A;  4XR6 A;  4OAY A;  2KQR A;  4BAC A;  2DOA A;  2JVH A;  3DKX A;  3OYI A;  4CCN A;  4BQQ A;  3E0J B;  2UWM A;  1UG0 A;  2IGN A;  3AL0 B;  1W36 D;  4IZZ A;  2L9N A;  3DU6 A;  2IS1 A;  3TL4 X;  4BJ6 C;  2LG4 A;  2WY7 Q;  1R6R A;  2E1M C;  1X4P A;  4NNJ A;  4YEL A;  4E7H A;  4B47 A;  2CW8 A;  3OL4 A;  3RSN A;  4XL9 A;  2IGK A;  2UUZ A;  5FRN A;  2O5R A;  2Z2S B;  3NWT A;  3OWT A;  1T0F C;  5CQG A;  2GOM A;  2X1D A;  1PYV A;  4BEH A;  4CSW A;  4XMY A;  4CH7 A;  4E7S A;  2LC2 A;  4J01 A;  3ONQ A;  1G59 A;  3TMO A;  4BL0 B;  4BE1 A;  3AKZ A;  3QOE A;  3OYF A;  3PNY A;  2WAF A;  3OYG A;  3OIQ A;  4ZDL A;  3K10 A;  2HQA A;  4CCM A;  1DQU A;  3OYA A;  3OIP A;  2MD0 A;  3OMY A;  2X51 A;  4II2 A;  4ZJZ A;  1MND A;  2X1C A;  4BQN A;  3H9G A;  3SEQ A;  2MC4 A;  4PJM A;  3S8P A;  4D1Q A;  3OYE A;  4AYB A;  2R7R A;  3G2B A;  1LVK A;  3RTR A;  4IKF A;  4JOM A;  4F93 B;  1DGR M;  3LSG A;  1LDK B;  3SDB A;  1WJB A;  1WJD A;  4ZC3 A;  4B43 A;  3F9K A;  3PUB A;  2DT7 B;  3OYK A;  2VQC A;  1MMN A;  4FET A;  2K9L A;  2WAE A;  4DOZ A;  3W2A A;  2VXD A;  4GRI A;  2VJ5 A;  4NC8 A;  3BG7 A;  3CES A;  3H5A A;  2M7A A;  3CZ6 A;  4P1W A;  2RQQ A;  3HKZ A;  2F6C A;  3I9V 2;  2XF7 A;  2JUG A;  3AL0 C;  1MMG A;  2IGO A;  4BDZ A;  2BVL A;  2R7O A;  2BW3 B;  3V42 A;  4IX7 A;  2ZFU A;  2KPM A;  4PFP A;  2MFZ A;  1WJF A;  3M8J A;  4XLE A;  1D0Z A;  3PNT A;  1D0X A;  1N75 A;  5KNL A;  4CZC A;  3EUK L;  1GLN A;  3N05 A;  4RMN A;  3DPU A;  4KIS A;  3AFH A;  2CMP A;  2R7V A;  2PJR B;  3QYB A;  2JA2 A;  4XLF A;  1BOB A;  3A1Y A;  3S93 A;  2R7X A;  1OLT A;  4HSR A;  5FRM A;  1YE9 A;  3ZGK A;  1X1B A;  5HLT A;  3LSH A;  2CS3 A;  2XF5 A;  2HVQ A;  4CA0 A;  2LY1 A;  3UNG C;  2DXI A;  1WJE A;  2E5N A;  1E0E A;  1MW7 A;  2WAQ A;  4BXF A;  1WJC A;  1QHH D;  3OYH A;  2CFO A;  4BDY A;  1Z21 A;  1JI8 A;  3PL8 A;  2GOX B;  2VAS A;  3FBN B;  3EUA A;  4XKB A;  2V4J C;  4E7J A;  3VDX A;  3GBG A;  1DGW Y;  4NC7 A;  3ZCO A;  1K6Y A;  3K70 C;  2VKH A;  2VJI A;  3K4C A;  3CJR B;  4PJL A;  2VL8 A;  3D5S C;  2JVG A;  3ZXS A;  2R7W A;  3SEZ A;  4Y3O A;  4AVZ A;  3E1S A;  4Y4R A;  3VYR B;  2KDO A;  2V7F A;  2CV0 A;  3U21 A;  3VSK A;  4C9Y A;  2LBF A;  2PMZ A;  3DKY A;  4BQO A;  4KT6 A;  2ZXH A;  4HST A;  4PSW A;  3OYB A;  4LIT A;  1YX5 A;  3FBI B;  3QOD A;  4BE2 A;  3OS0 A;  1IRX A;  4IQ4 A;  4RLF A;  5KCM A;  4BJT A;  2OUM A;  4NUB A;  3L2W A;  2V6E A;  4HRI A;  3HOT A;  2FUG 2;  4NQW B;  2VIX A;  1BR2 A;  1DP3 A;  4AU7 A;  2R7U A;  1WJ5 A;  2PJR A;  2CUZ A;  2Y0S A;  2HZD A;  2K3P A;  4CCJ A;  1QHG A;  3PSF A;  5LFA A;  2E5Z A;  3VYT B;  4X0G A;  2QKL B;  2F5V A;  4F3Q A;  1SFK A;  4DJA A;  4LG3 A;  2M4G A;  4P5O A;  3HXL A;  2RRE A;  1V5E A;  2XDV A;  2UV1 A;  3OL3 A;  4XN0 A;  5HVQ C;  2IS6 A;  2L7K A;  3OS1 A;  2QKM B;  4E7L A;  2IGM A;  2X85 A;  2BVM A;  4RM2 A;  4CCO A;  2X6Y A;  2LRE A;  1Z3Y A;  4XM3 A;  3K4N A;  4ITV A;  2V9K A;  2ZXI A;  1LFP A;  3L2R A;  1X19 A;  2VQH A;  3DTI A;  4ZDP A;  4DGW B;  4F92 B;  3L2V A;  2WBM A;  3HPG A;  2W00 A;  4BGD A;  3K4M A;  5JHF A;  1YX3 A;  4YRV A;  3J7A Y;  2I8D A;  3L2U A;  1Z7L A;  4XLH A;  3K70 D;  3OYC A;  4XKC A;  4HPQ A;  2VKD A;  1HA8 A;  1NG7 A;  2JSP A;  2HPM A;  1V5F A;  3IUO A;  2P0W A;  3UR3 C;  3KEY A;  3K4J A;  4CCK A;  2X6W A;  3OR2 C;  2Z16 A;  2M7B A;  4XOT A;  5KHD A;  2A6T A;  4PK4 A;  2VXZ A;  4RM3 A;  3MKZ A;  1AA7 A;  2MAB A;  2ZSI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...