1DGWY

Structure of the rhombohedral crystal of canavalin from jack bean
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
92
structure length
92
Chain Sequence
QLRRYAATLSEGDIIVIPSSFPVALKAASDLNMVGIGVNAENNERNFLAGHKENVIRQIPRQVSDLTFPGSGEEVEELLENQKESYFVDGQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CANAVALIN
publication title X-ray diffraction and atomic force microscopy analysis of twinned crystals: rhombohedral canavalin.
pubmed doi rcsb
molecule tags Plant protein
total genus 8
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1999-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.840 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1dgwY01
1DGWY 1DGRM
chains in the Genus database with same CATH superfamily
2M1BA 2KL4A 2XAQA 3CJTB 3DPTA 4G94A 2DA3A 2OUMA 2ZC2A 3HRUA 3TO7A 2DN0A 4F93B 5K1YA 2DODA 1X2MA 1FBUA 3HKZA 1KU3A 5FKKA 3ZRGA 1B72A 3I9V2 2MD5A 3TP0A 3DBLB 1YX5A 2OQRA 3OYBA 3CUOA 1N25A 5B1BH 4Z2YA 2DOFA 4DIQA 4B09A 1C0WA 2HVSA 4BDYA 2LF8A 3BLYA 1E17A 4RA2A 3IH4A 3LL7A 2HU9A 4QPQA 1W5SA 5B3SH 1A35A 2CW7A 1XMKA 2DQLA 4LJZF 3T8TA 4CCMA 3F8FA 2L9VA 5FD5A 1GXQA 4ZH4F 2X1EA 5D5UB 2V1NA 5IOZA 4G7OF 1TQPA 2VJIA 3OYAA 1WJFA 3GEZA 3GTQJ 1W7PB 1F5TA 4L18B 2WADA 3TDZC 4DOZA 1N75A 1S8NA 1TWCJ 3TEDA 1QNTA 3CMYA 2KRCA 1JJ8C 3E6DA 4A3EJ 3D5LA 3CJQB 3EUKL 2W00A 3LSRA 4IQJA 1VZ0A 4JYKA 3JRHA 2V7FA 1UCRA 2CW8A 5DTDA 2NOJB 2NOGA 4D5FA 3IV5A 4HF1A 5IY5H 3G2BA 3GVAA 2DMUA 5LEKA 4F7ZA 1J7KA 2I8DA 4U88A 2L01A 3SFZA 2EWNA 1VQ8I 1FC3A 4M9SA 3V8LA 2ELKA 2E1OA 2HDDA 3EYYA 3FXMA 1FSEA 3MQ0A 4R8HA 5E8IA 5K5QA 4MQVA 3RIRA 4ZDOA 2LY1A 3PIPF 4J01A 3FK6A 5F08A 4PJJA 5DYMA 2HGCA 4XMYA 1HW2A 4NDLA 4ANJA 2JVGA 4Y52J 4HW0A 3WTTC 1W0UA 4IHSA 3V7SA 3OYHA 4BY1J 2MH9A 2BZTA 3CLOA 5E1ZB 2YS9A 2XROA 3JTGA 1FX7A 3ML6A 1SD6A 4QIWN 2X6OA 3SFIA 2BY2A 4HEA2 3DTIA 2KJBA 4ESFA 1MMGA 1B8IB 3C2GA 4ZDPA 4XNFA 3CJRB 2H8RA 1Z3YA 4PGGA 3L09A 2HVQA 3CDLA 3JTHA 3BPVA 4YFKF 2JZYA 3BG9A 3BQYA 5C3EJ 4D9JA 1GV2A 2HPMA 2I10A 4YIIA 2EFWA 2CV1A 5KHDA 4A3LJ 3D5RC 2XRLA 2A6EF 5IT9K 2E7WA 1A5JA 3H0DA 3MKYB 2E71A 4QLCU 1XMAA 2EFNA 1U5TA 2ICWG 3LSHA 5CVRA 2LKSA 3M9AA 4KN4X 1B1BA 3BT9A 5EZGA 3SEZA 4BU2A 2QQAA 1XPXA 1VQ9I 1CGPA 1ZTRA 1T6SA 2K9MA 1I3QJ 2H94A 4U0WA 2O6GE 1ERDA 1VQ4I 1J75A 3QRFF 4LD5A 1RUOA 3BG7A 3V8JA 3U9GA 4AIKA 2Z16A 3TO6A 4D5CA 3MKWB 3CUQC 2AS5F 4ESJA 1IO2A 3HUGB 2PMUA 3H9GA 4E6KG 2K02A 4LB5A 2VI6A 3J80K 1DPUA 1WSUA 2XAGA 3HJEA 4M3GA 1KQ0A 3BZCA 4UV9A 2DJNA 5E79C 3VB2A 1QPMA 4Q47A 2R7SA 2FOKA 2O03A 2R5ZB 2RDPA 5J4YA 4F91B 1U3EM 3DQVC 2OZUA 3O8GA 4BDZA 5GAHJ 1E3HA 1P92A 4UXNA 1OLTA 1ZGAA 3MKLA 3NRVA 2E2IJ 2JA8J 2CQKA 2K4BA 4DGWB 2XF6A 4XORA 2QQ8A 3M8FA 4BQQA 1OCRH 1V5FA 1B9MA 1YQAA 3DP7A 5LLQA 3WTYC 1HF0A 4B3AA 3K1PA 4NQWA 3FHNA 4DNCA 1TW3A 4OIOF 1D8KA 1T08B 2FSWA 2V26A 4ZYHA 2KPMA 2DU9A 3D1NI 1TWAJ 2OBPA 5EG0B 1OYIA 1X3ZB 3FM3A 2FX0A 4YFNF 1BI2A 4BXXJ 3ZOBA 5B1AH 3RKYA 1S9HA 4A3JJ 2VJJA 2R5YA 1UHWA 3KCCA 2VODA 2XRNA 2Q1ZB 3ZXSA 1X1AA 2DFIA 5JFRA 4XKWA 1PUFA 4BEHB 2HPIA 4YIFA 3CO6C 4HPQA 3WG9A 4HLYA 1SFUA 1ZR2A 4J19A 5DS9A 3QP5A 5GP9A 3BY6A 3S14J 2LBFA 2W4SA 3LWFA 4ENJA 1BIBA 3TOBA 2KIQA 2A3SA 2X6YA 3QOEA 4H4KC 1OCCH 2A68F 2F4IA 3R0JA 2JRMA 1O3SA 2XKPA 1BJZA 4H0EA 2ECBA 3P9CA 1VNDA 1Z6TA 2ZKZA 1LDJA 3CLQA 4GYIA 3VFZA 3SJMA 3Q0WA 2XSJC 4N4OB 2ZCWA 1A6IA 1TNTA 3LSGA 4IQ4A 4JBAA 1UG2A 2Q8KA 3CCRI 4RDUA 2ZMEB 3B6CA 5EYRA 2M34A 3DV8A 1DUXC 1BC7C 3MN2A 3O3KA 3WTVC 2QWWA 2H8WA 4E7SA 3S2DJ 1X4OA 4II2A 4BQNA 5J40A 1GHCA 3HDDA 4LG3A 2EH3A 1OQYA 1FMVA 3K4MA 4HZFA 3I4NJ 3RCOA 5LEJA 5IT9Z 1IXSB 2ISYA 3BR1A 3L2WA 1B9NA 1X1DA 2YPRA 3DWLE 4IKFA 2JJ7A 5EGOB 2LRDA 2MD0A 2R93J 2OC6A 4BBSJ 3I56I 4KYWA 4OIRF 3O6BB 4K2EA 2MYSA 3I71A 3EUAA 4Y3OA 3H35A 2CUFA 2ZXWH 5J1UA 1K6YA 1I6HJ 3BPXA 4FX0A 2DA4A 2QYOA 4C2TA 2Z3YA 1ETKA 4CYDA 4PSXA 1ZLKA 2HYFA 4IHXA 1BBYA 4M72A 4BACA 1RKTA 3DEUA 2V9VA 5H2FC 5JLXA 1FT9A 2DFHA 3J80Z 3K2ZA 2FU4A 2X1DA 3GYHX 5D5XB 4MTDA 4U0VA 3MWMA 4YEJA 3A2KA 3IAM2 4Y17A 4I7HA 1OKRA 1XGMA 3PUFA 3V4GA 4ZJZA 3DCFA 4FT8A 3L1PA 1ZHFA 1QHHD 5KAIC 3K4BA 1KQ8A 1I39A 1XDUA 2M4KA 1M1EB 2ZXIA 2V6CA 2L7MP 1HDDC 2BY3A 5A2QK 5E1XA 2LFBA 4IOCF 4RGXA 3A0HC 3OOPA 1G3TA 1YW7A 2VQGA 5GADJ 3F22A 4L5JA 2IT0A 9ANTA 2JUGA 3HC7A 5JVGF 2VPRA 2G7UA 5E3LA 1V4RA 4IPAA 2KMUA 4M3EA 2GOMA 4BHCA 1HOMA 2E1MC 1LNWA 3FKIJ 1T95A 2IXSA 2BHYA 1X2NA 3BDDA 2IA2A 1JHFA 2LK2A 1VQ7I 3RTRA 2ID3A 1HKSA 4PFPA 2M7BA 2VKHA 3HOXJ 3K4KA 1RUNA 2ID6A 3PNYA 3ZQQA 2XVCA 2DMPA 3LQRA 3ZQCA 1ACIA 1MBHA 4PK4A 4C2UA 3ZGKA 3PSFA 3AKZA 1IDYA 1NG7A 2FNPA 3LSPA 3FWEA 5ICEA 1UJ8A 4C2MJ 1O7LA 1ETXA 2LDUA 3HIFA 2JN6A 5BOXA 2WV1A 2VC0A 2A61A 1TBXA 1D5YA 3GFIA 4O6JA 4M3BA 1AA7A 3MFKA 2NAZA 1LDDA 2O7OA 3K0LA 2STTA 1FWZA 4ZYEA 2ZJPF 1ZRFA 2HYGD 2R7RA 1CF7A 5K7ZA 5HDKA 3L00A 2V9KA 2W1OA 1YS6A 3GTPJ 1GVDA 1BW5A 4FHTA 2PBIA 5CQEA 1YW9A 4ASNA 5HDGA 4G6DA 5HLTA 2LP0A 2WBMA 1WFXA 4L9VA 2HOSA 2IA1A 5CVUA 2BHZA 1Y8QB 4XLCA 5FRMA 4JX5A 2QBYB 2KISA 1EKEA 1XSXA 3BQZA 3FXLA 1S5LC 1Z77A 3BR6A 1MKMA 3OL3A 4A3CJ 2R7XA 2WB1A 5AONA 4A3IJ 4DBRA 2PX9A 4Y13A 3RYRA 2QF7A 5F1JA 3RQIA 3ZMTA 1IN6A 1QBJA 2KRFA 3MD2A 5AIQA 3ZQGA 1BIAA 4CSWA 1O3RA 1HC8A 4Y7NJ 3E5UA 1FSHA 2KIUA 3BJ6A 2CUZA 3HGYA 5IP9J 1E3PA 4PUSA 4XSZF 1XS9A 2Y75A 5B5EC 4FETA 3F9KA 2E36A 3HSRA 1IN4A 2R7OA 2PFBA 4KITB 4DJAA 4HNVA 3VYRB 1U78A 1N77A 1DDNA 4B4CA 4Y15A 3MKZA 3PNVA 3KEQA 4I01A 2H6CA 5L3FA 3J81K 1QO0D 4IHVA 3RPUA 3HTUA 3VYSB 1IV6A 2H6BA 1XGNA 2M0MA 1SC7A 2P7CB 4HQEA 2HXIA 4U7DA 1W7PD 2J5PA 2FA5A 2JSCA 1ORKA 1R6RA 3ELKA 4KMUX 4C3JJ 2DMNA 3JRGA 3CD6I 2YR2A 2M45A 4EMSA 4A3MJ 3GZ5A 1SEUA 3V8KA 1XC5A 2CFXA 1W7PA 3C1DA 1ZLJA 3RPQA 3TO9A 2DXIA 2LC2A 1P4AA 2P6SA 4IHTA 3ZMVA 3MVPA 3R6SA 4ZYAA 2RGVA 2FQ3A 3K4LA 3AG3H 5J8FA 2CS3A 2FQ4A 2WY8Q 2VOPA 5LRSA 2MH2A 4IRHA 4G9YA 3IRQA 3WE3A 5EZHA 5JR3A 4A3GJ 3G3ZA 2XGCA 2N8GA 3TBIA 2Y0SA 2L9NA 2FOWA 3JAMZ 1S7EA 3OYEA 1R36A 4BS9A 1QA6A 4J00A 2K5CA 2ISZA 1ZK8A 1TNSA 3GTOJ 3R4KA 1T0FC 1H9GA 1R22A 3CCQI 3CF5F 3VWBA 3QPHA 2Y30A 4MFDA 1D3YA 2DOAA 4OMYA 1W36D 2QZ8A 2EINH 3W3CA 4HLXA 3V7CA 3WTSC 5CQGA 2E35A 2R3SA 1S72I 1BI3A 3HOWJ 2X9DA 2W84A 4D7MA 4PJMA 2D1HA 2HDWA 1LE8B 1RRJA 3HPGA 3IKVA 4PCQA 2ZFUA 2M8GX 2L5QA 4LLNA 4LG0B 3OYMA 1DU6A 1G3WA 3UKGA 1MBJA 3QU3A 2V9PA 4A5NA 2BXYA 1APLC 5HLGA 1YX3A 1J09A 5CJ9A 2O8KA 4EJWA 1SAXA 2ME0A 2BE5F 3I5UA 4XONA 1B8IA 4CZCA 3OS2A 1ZREA 2P5VA 2OZ6A 2VE9A 4A3KJ 4RAZA 1TLHB 4ZC3A 5LGNA 4RB1A 4HQMA 3I4PA 1Y0UA 3BR3A 4BHBA 3S3NA 4UNOA 2BVLA 2P6TA 4OAYA 1V5EA 4JOMA 4F55A 1E2XA 1LDKB 1Z91A 2XIGA 1AU7A 1U0JA 4EATA 1JHHA 3BG6A 3Q0UA 2QSGX 3MMYB 4GDFA 1HBXG 2M87A 1R7JA 4YELA 3P5JA 3LAJA 4R1HA 4ENKA 4EQQA 4N0BA 4D1QA 3HB9A 1HA8A 2CH0A 2MGQA 3GMEA 3ONQA 3ZQ7A 2HQAA 3FKJA 3WU2C 3I59B 3W6KB 4E4HA 2BW3B 5F1RA 1IN8A 2P0WA 2RQPA 2GM4A 3DBRB 2HTSA 4P96A 2CYYA 1WHUA 3HTSB 5F0HA 1OPCA 4HBLA 2ECCA 1LUJB 3BROA 5HOOA 3BC8A 2BV6A 2WTEA 1WZ2A 4XRSA 1HW1A 3FBIB 5D5VB 1I5ZA 2A6HF 5CPRB 1O4XA 2JK3A 2K85A 2IGNA 2JA7J 4KDPA 2C6YA 5FLVA 2JT1A 5CVVA 5IPAA 4NB5A 1YHQI 2M30A 3KP6A 4N9IA 1VQ5I 3OMYA 1FYKA 4A3BJ 2Z99A 4CO8A 1BOAA 2R5ZA 3AG1H 4WXDA 1Q1HA 1FYLA 1JXSA 4XLEA 3R61A 2A6TA 2R7FA 1VQKI 4P9UA 2P8TA 3GFMA 3F23A 4ETSA 2HR3A 1ZRDA 3QPTA 2L4AA 5D8LB 1LB2A 3GZ6A 2GBYA 3HHGA 1RKWA 2GOXB 3NARA 3QYFA 2ETHA 4FASD 2FEZA 4QTRA 3KETA 3LFUA 2K4JA 2VJ4A 2X1CA 1O7FA 2DA1A 3KZZA 5M3MJ 4RGRA 4CCNA 2HYJA 4A6DA 3KP4A 3ERED 2K9LA 5EG0A 2WWYA 2HZTA 4RB2C 5J1RA 1RIOH 1IV8A 1WVRA 3RDIA 2E5ZA 2KT0A 3N97A 1FEXA 5HVQC 1P4WA 4FTHA 2LF7A 4XOPA 3VSLA 2MA3A 5L3CA 3ABKH 3WTWC 2PJPA 5ICCA 4ZDLA 4P55A 4BEHA 3REOA 3HXLA 4BE1A 2QKMB 5DV5A 2IS4A 1SVMA 2ZXJA 4KUMA 4E70A 4A3DJ 1JTYA 3VEPA 3I54A 1O3TA 1B4AA 2LY2A 2HOEA 3LFKA 1JUSA 1LEBA 3W2VA 1TQMA 5D5WB 2YU9J 3SZGA 1U8RA 3OYNA 3MZYA 3RZDJ 3JRIA 4LB6B 4BYYA 5BPIA 2VXDA 3F8CA 3QYBA 3TDUC 1FBSA 1Y1WJ 1QPIA 4WK8F 2EJRA 3G6EI 3J7ZI 2EV0A 1P7JA 4KT6A 1WH5A 4LLGF 1RR8C 1JGGA 4KNYA 3BR0A 1MGTA 1S29A 2L9SA 1D0ZA 2VASA 3RKWA 1T0FA 1JE8A 4EJTA 5IYCJ 2ZMEA 4QSHA 1MH3A 2NNNA 2HEOA 1MDMB 3CP8A 5DD8A 5DM6F 3L2CA 2XGXA 4S0HB 3S1RJ 1TZLA 3BCBA 3G73A 1MSFC 1WJ5A 4Y33A 4LMYA 1L3LA 2OCCH 1GLNA 3GTGJ 1P6RA 2D5VA 5KK1A 3HKZN 3CQZJ 1UB9A 3QYEA 4EM0B 1LVAA 3B02A 5FKLA 1SFXA 2B9SA 5DCFA 2R7ZJ 2VJ5A 5EGOA 2OU2A 2HQNA 2OCEA 2CRGA 2F48A 1FJLA 3ASOH 1IXCA 1F1ZA 3H9JA 3BWGA 3I53A 2UV1A 2R4GA 4XKVA 2LTPA 4D7NA 1MSEC 3WU1B 1QZEA 1TP4A 3KLNA 4W97A 5HS7A 3CC2I 1MMDA 1IGNA 5FGMA 4M3FA 3SZTA 1ZQ3P 4UUSB 3E0JB 1XGSA 2Y0MA 3DFGA 3GFJA 1WI9A 4C3IJ 3GUDA 2F5EA 3ECHA 3U1DA 1DPRA 3M4OJ 3VOEA 3E5QA 3VSKA 2LG4A 1Y6IA 5AIPA 1J0RA 1R5GA 1KU7A 4NHJA 1KGSA 2Z5UA 5FLMJ 4CCOA 3JR9A 1YE9A 2LKXA 1I1SA 1BM9A 1HKQA 4DZPA 1R71A 3OR1C 5J1YA 4UUVA 2R7WA 2UWMA 3QODA 2CQNA 2VKDA 4MGRA 2UZKA 3BCAA 4KJZA 4XICA 5JHFA 2X6XA 3S8PA 2Z33A 2F5FA 4HX4A 4LIUA 4F3QA 3L7WA 3GTLJ 3IKTA 1HSTA 2K7LA 3WG7H 3RJPA 5IP6A 4U7BA 2PG4A 3OV8A 2JSPA 2RVCA 4F92B 4C9YA 3A02A 3VYTB 5KNLA 4EJUA 5F6FA 3IWFA 5FFZA 3RYPA 2EFPA 3AL0C 1G3YA 2M2EA 3IWZA 2Q2EB 3CDHA 2CV2A 4IRIA 1LVKA 1WQ2A 3JCUC 1FZPB 1EF4A 1ULYA 1MBKA 5GAGJ 4A6EA 3JSPA 1FOKA 1HDPA 2NVTJ 2E1CA 4XSXF 1T33A 3KIOA 4EM2A 5IYBJ 4E7IA 5IOYA 2ZJ2A 1TQIA 4M74A 4BQOA 5HNFA 5FKNA 3HOZJ 1XGOA 2DFEA 4XLFA 3FXRA 2LLKA 5FJ8J 2EZLA 4BXFA 2R7UA 3L9FA 4ZTJA 3GZNB 4CYCB 1WRJA 3BG5A 4GFBA 2M4GA 4I6ZA 1YLFA 3FISA 2FBHA 3F0CA 5EEHA 1D1BA 2DMQA 5D4RA 2LNBA 2WAFA 2DW4A 2Z9OA 3OYCA 2VBWA 2RAEA 2LREA 2CMPA 1VTNC 4QWQA 3S15J 4EEFG 3HYIA 2K86A 2HQRA 2ZJQF 4CCJA 3V42A 4XBFA 5CKTA 2DPDA 2UUZA 2DT6A 1RC9A 1NK2P 1U6GA 1K79A 3WU0A 2CQQA 4L9JA 4KA4A 4YIRX 1A6QA 4HOBA 2Y9ZA 2QBYA 3CP2A 1VFCA 2QKLB 2M7AA 2ZJRF 2A07F 1BI1A 1UZCA 4IJAA 3E7LA 2F5CA 3G1MA 4HV5A 1ZGWA 3W6VA 2RNJA 4CGZA 1DP3A 3E3VA 3SZPA 3JRDA 4XK4A 3N4MA 1MNMC 1Y39A 3WTZA 1K6OA 1AWCA 1OCPA 4M6XA 2KKOA 1K7AA 4CA0A 1IN7A 4L5IA 5DUKA 3OIPA 4CDGA 4AM3A 1ZYRF 2DMTA 2L0KA 3VPRA 1YIOA 2AQFA 2QUFA 2H1LA 3ASNH 5CVIA 2M3AA 4AYBA 3HHHA 4LK0F 4S04A 3HRTA 5LHGA 1B59A 2NXNB 1MJAA 1I6XA 1H89C 3FF5A 3OYFA 1JT0A 5GTIC 5FB2A 4G8XA 1MD0A 4NC7A 4I2OA 2HNHA 4BH9A 1U2WA 1JJ6C 4M73A 3C2HA 4OWRB 2E34A 4HF0A 2XKOA 1J9IA 3OS1A 2GAUA 2VBYA 1LKXA 4Y4RA 2JUCA 3HPHA 1AKHB 1YITI 2EFOA 2CSOA 4HAMA 2HZDA 4RB3C 1VF9A 2KQRA 1KZHA 1J2XA 2R0QC 1V54H 2BEOA 5LBQA 1SFEA 1T39A 1YRNA 1X3WB 1FMWA 4G6QA 2WC2A 3KE2A 2VQLA 1PVEA 5FFXA 3OOUA 1R23A 1E3OC 3ECOA 2KJCA 4RAFA 4HSTA 2XB5A 5LGUA 2OA4A 1K4SA 4ENMA 5L3GA 2HKXA 1P7IA 4PZJA 2EA2A 2P7VB 1IN5A 3IP4B 3WODF 1WJCA 2G7HA 3GXOA 3FXQA 1WH7A 3I58A 2DLLA 4KN7X 1R58A 4AYBN 3LSKA 4YFXF 1X3UA 4CZZA 2P5KA 2KP6A 5F0FA 3RQ4A 1LE8A 1NHAA 1G4DA 4I0BA 4G12A 3FXJA 1U5TB 2F4OB 1FOXA 1OR7A 4LG0A 1QVUA 4B48A 3HOUJ 1Y1VJ 2O61A 2WV0A 4KIBA 2XGEA 1W36C 2VXZA 2OPTA 1Z3XA 1VQMI 3ZMZA 2L4MA 2YU3A 4E7KA 3OYLA 1BJAA 1F4KA 3Q5FA 4FX4A 3IUOA 1EJ9A 1Y8RB 3FMRA 3CMAI 5DEQA 3PUBA 5LHIA 1YW8A 5JVTA 3VDXA 4OINF 2L02A 4M6VA 5M3FJ 1ZN2A 1AOYA 2RQQA 2HWVA 1BC8C 3FHZA 2E5NA 2BW3A 4CHUA 3Q0VA 1QGPA 1WJBA 1FIAA 2D1VA 2L3DA 4PDKA 1G6NA 2EV6A 1YOVB 1ZH5A 5TJJA 1GUUA 4BNCA 4BAYA 3GTMJ 2W57A 1D1CA 1QHGA 3OYIA 3BZKA 3S32A 1YTYA 2V1UA 1G8XA 3RSNA 4DQ2A 3GCMA 2XPUA 3GLLA 4UB8C 4A0ZA 5ICGA 1RR7A 2VN2A 2W48A 3TP3A 2B7EA 3K1NA 2RV8A 2LD5A 3K70C 2HFHA 2KIFA 2EBIA 2OF7A 3CCLI 2BY1A 4E7HA 3I55I 2L7ZA 2IS6A 2STWA 3KP7A 1XCVA 4R79A 3HL2A 2HQ5A 3LMMA 2BBYA 3LAPA 2HXOA 2AQEA 1TT5B 1HKTA 5ILSA 1MMAA 2KIMA 3BJOA 1KYZA 1RNLA 2HTJA 1BW6A 1GXPA 1XDSA 2A69F 3H92A 3K4NA 1W4MA 3K4JA 1YJWI 2IGKA 5EDNA 2LH9A 3S2WA 4I0AA 1A04A 1UFMA 1G3SA 1QZZA 3LSMA 5DM7F 3KLOA 3H5RA 2L7KA 2L9RA 3PNTA 3OL4A 4HSRA 4MO7A 4XN0A 2B63J 3RPUD 1VI0A 1OYWA 1HQCA 5EEAA 4A5MA 3IH2A 4LK1F 4OU0A 1IJWC 4AD9A 5ILVA 1R1VA 1V3FA 4WXCA 4MEXF 3G71I 4JP0A 5FD6A 1XN7A 3FX3A 5A2QZ 5L3DA 2YUSA 4G7ZF 3F8MA 3QWLA 4OOIA 3PQKA 2JRTA 1D8JA 3HOTA 4LLLA 4A12A 1ZG3A 2MW8A 4Q5SF 5J3LA 3ZQHA 3OYGA 1STZA 3V7RA 2GA2A 4MTEA 4G7HF 2V1XA 1MJ9A 3ESWB 3J7AY 4CICA 4BHPA 3F8NA 3VYUB 3ABLH 1OCOH 2A05A 3ABUA 4CH7A 2YX7A 5EEGA 3DKWA 2XSDC 2JA2A 2K40A 2R7DA 5FRNA 2WB1N 2XGDA 4ZYGA 3BTJA 2VT2A 5JI6A 1OMIA 4RS8A 2JVHA 2WAQA 4BJ5C 4IOAF 4RGSA 1POGA 5D6FA 2OTJI 2FBIA 1A36A 1T8IA 3HOYJ 2L54A 4ITVA 4A69C 5HLHA 3WGIA 1P9QC 2KRHA 2OAZA 4RGUA 1SVOA 3TL4X 2ZMEC 2IAIA 3A01B 4XQFA 1GDTA 3IHUA 3ERMA 1FTZA 3T0YA 1FOYA 1H88C 1OJLA 2EZHA 4JQFA 4I98B 4RLQA 4E7LA 1ON1A 5GTHC 3IH3A 1OCTC 5D4SA 2DQRA 2RREA 2PMZA 3HSEA 1HW5A 5H6RA 2LYCA 3H3ZA 3F6VA 1TWHJ 1RZ4A 1SD5A 2W24A 3I4MJ 3RI4A 1FP1D 3CUQB 3N05A 4ZZDA 2FMYA 2Z1DA 4UUSA 1Z05A 5GPCA 3S3MA 1ETOA 1KONA 1ZARA 2XUBA 2COMA 3Q9SA 1NG6A 2EZIA 2Y2ZA 2EK5A 5FKMA 1MNEA 3R0AA 3S93A 3RZOJ 2JTVA 4S05A 2W7NA 1TC3C 4ZYDA 2IS2A 4BL0B 2P5LC 2DFFA 1FOWA 4I76A 2XPWA 2MABA 2JWTA 3NAUA 4B44A 1U9NA 2W82A 2NVXJ 2WAEA 1NK3P 4RM3A 2VIXA 3KPHA 1ON2A 4V2FA 4XL9A 1RESA 2OJED 3D0SA 3G1LA 3M3YJ 2Y0SN 1A31A 2QA4I 5E17F 1DGWY 2PN6A 3K70D 2M0CA 1X4PA 3WHCA 4KIGA 1ETQA 3PFIA 3TMOA 3F21A 1MW7A 1IXRC 1QZYA 2NRAC 1R00A 5M5XJ 2JPCA 2TCTA 1BOBA 1DU0A 3SYTA 3K4CA 4XLAA 2K27A 1XD7A 3HUGA 3SDGA 3C18A 3SEQA 3S1QJ 2VE8A 4DYQA 4CXFA 1ITYA 1JKQC 3ISPA 2XF5A 1RETA 4C3HJ 4DW6A 3J81Z 1FP2A 1UMQA 2MSYA 3AG2H 4BJ6C 2D45A 2Y48A 2E2HJ 1WCMJ 1FLIA 4NBQA 2XPVA 3GW2A 2NS0A 3ROUA 3A4CA 4LGWA 1WJAA 2DJIA 2CO5A 4TV7A 5ILUA 3MZHA 3H1CA 1MIJA 2F2EA 3U1KA 4CYCA 3P9KA 1YYVA 1MMSA 1R5ID 1HXDA 3IRRA 2GIZA 4Q4ZF 2PI0A 2E1NA 5DD4A 1VQ6I 4CCKA 2LKPA 4BE0A 2KLOA 4DYRA 5IYDJ 2PJRB 3BOQA 3K6GA 3KYLA 3CCYA 3E5XA 3FIWA 2GXAA 3LSTA 2VBZA 1ODDA 2ZSIB 3A0BC 2IJLA 2XAUA 2HKOA 3H5NA 5J47A 4XKBA 5F0CA 1CQTA 1YFHA 1MBEA 3P9IA 3CTAA 3TW7A 3WTUC 3KZIC 2HS5A 4IEJA 1DP7P 3PIOF 1QVTA 1WI3A 2Y31A 4II3A 1LFPA 2V79A 4M9XA 2DK8A 3H0GJ 2LMDA 2M5WA 4WWCA 4IO9F 4ENNA 1K4TA 4LFUA 3L2QA 2F6CA 4CUGA 1T2KA 3GX4X 3KX2A 2VQHA 3GTJJ 2X0LA 1JI8A 2DYSH 2RN7A 4L9NA 3CC4I 2QENA 2VL8A 3S2HJ 2EQRA 1JT6A 2XV4S 4UVBA 4GCVA 1DGRM 1XCBA 4HV6A 5L3EA 3L2VA 3GO5A 2G0EA 4RAYA 2DAOA 2UXXA 4UVAA 3KEYA 3E1SA 2DYRH 4FQGA 5F04A 1LQ1A 2ADUA 3WHBA 1BI0A 1FPQA 3ZN1A 2W85A 1PP7U 2JMWA 2EIMH 2W25A 2BXZA 3P7NA 4HNTA 2PEXA 4P1WA 3W2AA 1FNNA 1K78B 5K7FA 5KVRA 1E0EA 3S1NJ 2G9WA 2FF4A 3OIOA 2VB6A 2A5YB 3E6BA 3CCUI 3A1YA 2XB0X 1JGSA 2PMHA 3QPSA 5HS8A 3E6CC 5J8CA 4N9HA 1Z67A 4UB6C 3QQAA 1EH6A 1KYWA 2L2OA 3MEXA 4MNUA 2IGMA 4W1UA 5TISC 3OYDA 3LNQA 1AKHA 1H8AC 4OIPF 4I09A 3H3UA 2NVYJ 4MIMA 4IX7A 4IXAA 4AUXA 3CMEI 3TKYA 2E1MB 2CU7A 4G6TB 2NS8A 1YJNI 1IC8A 2D2WA 3CZ6A 4M71A 2JQ7A 1JKOC 4XLNF 3U21A 5LRRA 2IPQX 2VKVA 1JUPA 2YSRA 1JKPC 4C30A 1VQOI 1X1BA 2MG4A 4L0ZB 4KISA 2FBKA 4IL6C 3TW6A 1PUEE 5ERIA 2VC1A 2DT7B 1O57A 2I5UA 2E19A 1IZ1A 2IA0A 4QPOA 3BTCA 3MCZA 1R9TJ 3DLAA 2K9NA 1SD7A 1U8BA 4EV0A 3NWTA 2ZXHA 3O2PE 3DEWA 1PJRA 4GO1A 3M8JA 5CLSA 1XSDA 1Q1VA 3SHFA 4OMZA 5D6EA 1XMXA 3CCEI 3R60A 2CV0A 2GXBA 1X1CA 2FXAA 3WTXC 2CGPA 4WF2A 2LY9A 2ACJA 1K61A 3BR2A 3CDIA 3M1CA 4RLFA 3TQNA 1SD4A 3DEEA 2EIKH 3HEFA 3BZ6A 4DYCA 1XSVA 3BR5A 2XAJA 4HDVA 3Q9VA 3H9QA 4GGGA 1OR7C 5F27A 3J7AO 3LA7A 3C7JA 2Z2SB 5J4VA 1F43A 1USSA 3NEUA 3ZMDA 3EUHA 2O9LA 4XN3A 1KU9A 2X4HA 2DO7A 1WKMA 4AIJA 1G59A 1EV7A 3QPLA 1TWGJ 1L0OC 2M8EA 1WJDA 2CUEA 3PO3J 2HDCA 2O3FA 3ZR8X 3EPZA 3PM1A 1FBQA 2VBXA 4EGZA 2L7FP 4KICA 1SAUA 5E8GA 4V2GA 1MBGA 4P5OA 2VT3A 3HSFA 5DCMB 2QSHX 3JSOA 2DT5A 3BTIA 1REPC 2Y9YA 2FUG2 3JRCA 3H36A 2CFOA 1QQIA 3F3XA 4B47A 2J5OA 5DDGA 2DBBA 1V5GA 5CVJA 3FMQA 4MHGA 5DUIA 3OIQA 1MMNA 5HNHA 2MC4A 2QVOA 3FM5A 1W1WE 5H6QA 1B72B 4IHWA 6PAXA 2NS7A 2QM3A 1LJ9A 2QQBA 4GRIA 2KDZA 1TWFJ 1D0XA 3DBHB 4B43A 1D5VA 3VODA 3H5AA 1YS7A 1TL8A 4ON0A 2PLYA 3QOPA 2O8XA 2VOOA 1Y56A 2OD5A 3M8EA 2DA6A 5KCMA 1ETVA 1MZBA 2EIJH 2NYXA 2FMLA 3RKQA 3ZN0A 2R7VA 1MBFA 2OQGA 2MBFA 3BJAA 4MQ9F 5J6XA 4XIDA 1FYMA 1UHMA 1EH8A 2ELHA 1V55H 5H20A 5HLIA 2K9QA 1J59A 4A2UA 4I02A 1WWXA 4PSWA 2R92J 1S7AA 1OYYA 2A5WA 2K9SA 2X85A 1SFKA 4PJ0C 1U9OA 4WCGA 4KMFA 1S6LA 3WE2A 4WXHA 2DK5A 3ABMH 2H27A 1BR2A 4U0YA 2XASA 1UG0A 3QU6A 2IRFG 2DDBA 3KZYA 4AVPA 1Z0XA 3AFHA 2RKHA 4ESBA 4YRVA 1MNDA 2IP2A 3ABTA 3GLXA 2FE3A 3TOAA 1IAWA 1RI7A 2KZGA 3CMMA 2CW0F 3JREA 5BS6A 1G2HA 3FXOA 2X51A 1BN5A 2NVQJ 1BA5A 1GVJA 2UXNA 3COAC 3W6JB 4BE2A 1WGXA 4HDUA 5LFAA 1JUMA 2TRTA 2NVUB 4EVIA 3A03A 4XM3A 4F52A 3PO2J 2R7QA 1X1PA 4UHTA 1ZR4A 3MAJA 3KFWX 1SFOJ 2VUMJ 3DXJF 3LA3A 2EV5A 4XRSG 5M5WJ 5K5RA 5CYVA 4EJOA 4DBQA 1PDNC 4EGYA 2CWEA 3LSJA 1YJ9I 2IVMA 4HRIA 2M9HA 2IS1A 1IUFA 3ZQFA 1BL0A 2IEKA 1R5HA 3GTKJ 1S3JA 2OTLI 4JX6A 1S7OA 4L9TA 3E97A 3JRFA 3OYKA 1X58A 1LPQA 3A01A 3DPUA 3HBLA 2ESHA 2V1DA 1LEAA 1SANA 3ZCOA 1T56A 3IL2A 2DTZA 4PFOA 5F64A 1D1AA 4BJTA 1AHDP 3LQQA 2DDAA 4PGHA 5E18F 5FKOA 4MLOA 2XC7A 5GAEJ 2RNGA 4AVZA 1P2FA 3PSIA 3HM5A 1ETWA 3DF8A 3B6AA 1Z6RA 3AG4H 1IDZA 3CUQA 2DOEA 4JX4A 4RBOA 1VQPI 3FZVA 1EA3A 2TDXA 3EQLF 4P9FA 1PYVA 2RC4A 2P81A 4XKCA 3BTLA 3FK7A 5E1WA 5LD2C 3LSIA 2ME6A 1USTA 3CESA 2FNAA 1BR4A 3SDBA 3OS0A 4A0YA 3CCMI 4IHYA 4WX9A 3AAFA 5HODA 4Q48A 2IBDA 4NC6A 3OWTA 4UV8A 5BNGA 3RKXA 3T5XA 2ESNA 4U87A 5FROA 5K7HA 1F36A 4HF2A 3KP2A 2CQXA 1GV5A 2QLZA 3I59A 5EJCA 3JAMK 5BMZA 4LITA 4N4NB 2AXTC 2GQQA 1Y0NA 1OISA 2MLGA 1R4MB 4IF4A 4IZZA 2X6WA 4HNUA 3ZQLA 1YO5C 4AIDA 4LIVA 1R4NB 1ZELA 3DU6A 1N78A 2HVRA 4IVNA 1MH4A 2DCEA 4NQWB 1YIJI 3PFYA 1XX5A 2BOLA 3F8BA 2IW5A 1IUYA 2VKEA 4AWXB 1W5CC 4RB0A 4UVCA 2QSFX 4CCLA 3UNGC 2EA4A 2JPBA 3X2QH 5BPDA 4EJVA 4O3MA 2FJ1A 2Q0OA 4RM2A 2R5YB 3JRBA 2E2JJ 2FD5A 3KP5A 4BKXA 1RPWA 3B73A 5FLXK 3FDYA 4KIFA 1QU3A 4NUBA 4BXUA 2ELJA 4XRFA 2MC3A 3SXYA 1PUFB 3ZMSA 1OCZH 1MJBA 3HG9A 5C4XJ 1WPKA 4RMNA 4PJLA 1IRGA 3KP3A 4ABZA 2AHQA 4O5VA 2FRHA 2XHKA 1XTAA 2P4WA 2HI3A 1JKRC 3KYDB 3T8RA 2WY7Q 1Z9CA 3H3VK 2LBFB 3DTEA 3UR3C 4M6YA 4NC8A 3DPLC 3K1MA 2MLKA 3U2RA 2WA0A 4A3FJ 4BQAA 4ZTFA 1IF1A 2ZFWA 3K69A 2PJRA 2GLOA 1GT0C 2QGUA 3G1OA 1TT0A 2Y69H 1YI2I 2V6EA 4X1EA 3CJNA 1W5TA 3FXUA 1UHSA 2E7XA 5ED4A 5M5YJ 4UUTA 4KFCA 3DLLF 4EM1A 3L2UA 2CG4A 1LFBA 1ENHA 1O3QA 3FXKA 4XLHA 2R7TA 2VPLA 1BR1A 3J7YJ 3OSGA 1XG1A 1NTCA 3DKYA 3K10A 3NWSA 2DA2A 5IP7J 4X0GA 1IG7A 2COBA 4HX7A 1H0MA 4OIQF 4AC0A 5TRDA 2GA1A 3OR2C 1HSJA 3ZQIA 4E7ZA 2XDVA 3S1MJ 1ZKGA 3O8HA 3EYIA 4OAZA 4E7JA 5C44J 1FY7A 3LOCA 1X19A 4L0YB 1SMTA 3F6OA 1ONVA 2QCOA 3S17J 3WGGA 1SVLA 2GXGA 4BY7J 2ZBKA 3HRMA 2F5DA 1Z1DA 1TTYA 1KU2A 2GIVA 1ZRCA 4XR6A 3DTKA 3PJRA 2LVSA 4V19K 1J5YA 2LSOA 4HA8A 1DQUA 1KA8A 3EDPA 4B3XA 1FTTA 2NNYA 1MDMA 1Z7LA 3NQOA 1T38A 3WGHA 2KDOA 4FE7A 3M1EA 3IAS2 2BY0A 1YRNB 3FBNB 2DA5A 3K2AA 3S16J 3DKXA 1Z7UA 2AXLA 2LOOA 4XRMA 1VQNI 1K78A 2AO9A 3HOSA 2BGCA 1KQ9A 3KYCB 1I27A 1PP8F 1ZAOA 3L2RA 2DA7A 4MFEA 1YG2A 2OV7A 3CCVI 2ZO4A 2CUJA 4A93J 4GXOA 2BYVE 2EFQA 4GYGA 5BQTA 5LGTA 5JLWA 3K7AJ 1R1UA 1Z21A 3GBGA 1R49A 4HYEA 3GFLA 4B1RA 2K3PA 4A0XA 2ZNZA 1R1TA 3HRSA 5EF6A 5C4JJ 2DI3A 4AIHA 1D0YA 3PQJA 3GWZA 3TGNA 1IRZA 3LA2A 1I50J 2EILH 4I99C 3ZMUA 1ZG1A 1LFUP 3AL0B 3HZJA 1P4XA 4M3DA 2DPUA 2QEXI 3QAHA 3CC7I 4KT5C 2ZSHB 2CQ7A 3JRAA 2VQCA 3C2BA 3HGGA 3JW4A 5K5OA 4JK1X 3CCJI 5E20A 3OY9A 5TGTA 2GWRA 2F4MB 1XB4A 2JA5J 4XLPF 2F5VA 3I0TA 4FISA 1T98A 5GPAA 5FLXZ 1NH3A 1B6AA 2KHMA 1OFCX 2ZNYA 2DTRA 3D5SC 3I3LA 4BBRJ 2VONA 1F9NA 4XOTA 2V4JC 4ZZLA 5E3NA 4RAGA 3OSFA 3IC7A 2XAFA 2XF7A 5D8KB 2E60A 1UELB 3KEOA 5KAFC 4L5EA 1I1GA 3SQNA 5HS9A 4LOCA 1FIPA 2B0LA 2BVMA 2HOAA 2WAQN 3BG3A 4AU7A 3S3OA 4X6AJ 1IRXA 4FCYA 2KZVA 1EH7A 3ULQB 3W2WA 3E6MA 2JA6J 3C3WA 3HOVJ 1QRYA 1ETYA 4B8XA 2QQ9A 1IW7F 3CCSI 4M9ZA 2ZB9A 5L3BA 5ICFA 2O0YA 4YG2F 3QP6A 2CJJA 2K3FA 2PQ8A 4IRGA 2IGOA 2KFDA 3F72A 1IRFA 5B66C 2Q2EA 2H1KA 5HDNA 2PMZN 3T1BA 3EETA 2VLAA 2GZWA 4Z6YA 1U5TC 1CF7B 5IT3A 1JTXA 3MZ8A 3Q3SA 5E3MA 2HOTA 4BUPA 3CF2A 5FO5A 3FMSA 3OYJA 2X48A 3G4SI 3ZP5A 4BGDA 5E3OA 2EB7A 3DU5A 2EPFA 5JHUA 4PJNA 4FE4A 2O5RA 4HX8A 4UY8I 2EZKA 3M7GA 2LR8A 1ZG5A 1K83J 2XAHA 3CO7C 2MFZA 1I3AA 3K9TA 3EUHC 4DZJA 3PL8A 4MEYF 5LHHA 1HLVA 1VQLI 3M07A 1SMYF 1W0TA 4NNJA 2YX4A 3ZPLA 1H9TA 1WJEA 1HCRA 1ZGJA 4HG2A 5DCMA 1UAAA 1TW2A 3I64A 2H09A 3BP8A 4D0PA 3GF2A
chains in the Genus database with same CATH topology
2KL4A 4XN3A 2DXIA 3DPTA 2LC2A 2OUMA 4F93B 3LSKA 3HKZA 4ZYAA 3ZRGA 3I9V2 1G59A 2KP6A 3RQ4A 1YX5A 3K4LA 3OYBA 2CS3A 2WY8Q 1WJDA 3TBIA 4DIQA 2Y0SA 4B48A 3ZR8X 2L9NA 3EPZA 2HVSA 3OYEA 4BDYA 3BLYA 4BS9A 3LL7A 1SAUA 2HU9A 4QPQA 1W36C 2VXZA 4P5OA 2CW7A 4J00A 2K5CA 1Z3XA 2FUG2 4CCMA 2CFOA 4B47A 1T0FC 2X1EA 4E7KA 2V1NA 3OYLA 3VWBA 2VJIA 1V5GA 2DOAA 3OYAA 1WJFA 3IUOA 3OIQA 1W36D 2WADA 1MMNA 3W3CA 4DOZA 3PUBA 5HNHA 1N75A 2MC4A 5CQGA 2KRCA 3VDXA 4PJMA 2HDWA 3D5LA 3CJQB 3EUKL 3HPGA 2W00A 4GRIA 2RQQA 1D0XA 2ZFUA 4B43A 2E5NA 1VZ0A 4IQJA 2V7FA 3H5AA 2L5QA 2BW3A 2CW8A 1WJBA 3OYMA 2NOJB 1YX3A 3G2BA 1J09A 1Y56A 2I8DA 4XONA 5KCMA 4CZCA 1D1CA 1QHGA 3OS2A 3OYIA 3S32A 4ZC3A 1G8XA 3RSNA 2R7VA 3S3NA 2BVLA 4OAYA 1V5EA 4JOMA 4F55A 2LY1A 1LDKB 4ZDOA 4J01A 1U0JA 4PJJA 4XMYA 4PSWA 3BG6A 4EATA 2A5WA 3MMYB 3K70C 2X85A 1SFKA 4ANJA 2JVGA 4YELA 4E7HA 1BR2A 4D1QA 3OYHA 2IS6A 1UG0A 1HA8A 2CH0A 3ONQA 2HQAA 3FKJA 4R79A 4E4HA 3AFHA 2BW3B 3HL2A 3LMMA 2P0WA 4YRVA 1MNDA 4HEA2 2AQEA 3DTIA 3CMMA 1MMGA 5HOOA 3C2GA 3BC8A 4ZDPA 4XNFA 3CJRB 1MMAA 2X51A 3FBIB 1Z3YA 4BE2A 5LFAA 2HVQA 5CPRB 3K4NA 4F52A 4XM3A 2IGNA 4D9JA 3K4JA 2HPMA 2R7QA 2IGKA 2LH9A 2CV1A 5KHDA 3D5RC 3LSMA 3OMYA 4DBQA 3H0DA 3H5RA 3MKYB 2L7KA 3PNTA 3OL4A 4HSRA 3LSHA 4XN0A 3RPUD 4XLEA 2A6TA 4HRIA 3SEZA 2IS1A 4BU2A 2K9MA 2GOXB 3QYFA 1ERDA 4FASD 3LFUA 3HOTA 2VJ4A 3BG7A 2X1CA 3OYKA 2Z16A 4CCNA 3MKWB 3DPUA 3ZCOA 3HUGB 4PFOA 3OYGA 3H9GA 2K9LA 4E6KG 1D1AA 4BJTA 3J7AY 2E5ZA 3VYUB 5HVQC 4CH7A 2R7SA 2XC7A 4MLOA 2JA2A 2RNGA 4XOPA 4AVZA 4F91B 3VSLA 3DQVC 3PSIA 4BDZA 5FRNA 1OLTA 4ZDLA 4BEHA 3HXLA 4BE1A 2JVHA 4DGWB 2QKMB 2WAQA 2XF6A 4BJ5C 2IS4A 1EA3A 4XORA 4BQQA 1V5FA 1PYVA 2LY2A 4XKCA 5LD2C 3W2VA 3FHNA 3LSIA 3SZGA 3OYNA 3CESA 4ITVA 1P9QC 2KRHA 3TL4X 1BR4A 2V26A 3SDBA 3OS0A 2VXDA 4XQFA 3QYBA 2KPMA 3OWTA 4KT6A 4JQFA 1S9HA 4RLQA 4E7LA 2VJJA 4U87A 5FROA 2RREA 2PMZA 2L9SA 2Q1ZB 3ZXSA 2LYCA 1X1AA 1D0ZA 2VASA 4LITA 4N4NB 4XKWA 4BEHB 4IZZA 3N05A 2HPIA 2X6WA 4HPQA 2Z1DA 4HNUA 4LIVA 3DU6A 1ZELA 3CP8A 1N78A 3S3MA 1KONA 2HVRA 1TZLA 2DCEA 3BCBA 4NQWB 1NG6A 1WJ5A 2LBFA 3PFYA 4Y33A 1MNEA 3S93A 2BOLA 2W4SA 1GLNA 2W7NA 2IS2A 4BL0B 2X6YA 3QOEA 3QYEA 4H4KC 4CCLA 2MABA 3UNGC 2F4IA 2VJ5A 4B44A 2W82A 4RM2A 2WAEA 4RM3A 2VIXA 4XL9A 3H9JA 2UV1A 2XSJC 2R4GA 3FDYA 4N4OB 4XKVA 1DGWY 4IQ4A 3LSGA 4NUBA 3K70D 1QU3A 1MMDA 2ELJA 3HG9A 1X4PA 4RMNA 4PJLA 3E0JB 3TMOA 1MW7A 4E7SA 1X4OA 4II2A 4BQNA 2WY7Q 1BOBA 4LG3A 3SYTA 1FMVA 2LBFB 3DTEA 3K4MA 3UR3C 3K4CA 4NC8A 4XLAA 3RCOA 3DPLC 3VSKA 2LG4A 1Y6IA 2WA0A 3SEQA 3L2WA 1X1DA 3DWLE 4CCOA 4IKFA 4ZTFA 1YE9A 2XF5A 2LRDA 2PJRA 2MD0A 1TT0A 2OC6A 2V6EA 3OR1C 2R7WA 2UWMA 3QODA 2VKDA 2MYSA 3EUAA 4Y3OA 3H35A 4BJ6C 1K6YA 3BCAA 4KJZA 5JHFA 3L2UA 2X6XA 3S8PA 4C2TA 4LIUA 4PSXA 4XLHA 2R7TA 2VPLA 1BR1A 3DKYA 3K10A 4F3QA 4BACA 3NWSA 3A4CA 4X0GA 1WJAA 2DJIA 3OR2C 2X1DA 4U7BA 4E7ZA 2XDVA 2JSPA 4YEJA 3A2KA 4F92B 4C9YA 5KNLA 3IAM2 3VYTB 4OAZA 4E7JA 4CCKA 1X19A 3AL0C 4ZJZA 2KLOA 4BE0A 2PJRB 3K6GA 3KYLA 2Q2EB 2CV2A 1QHHD 1LVKA 3K4BA 2XAUA 2ZSIB 2M4KA 4XR6A 3DTKA 3H5NA 2ZXIA 4XKBA 3PJRA 1DQUA 4B3XA 4E7IA 1Z7LA 2VQGA 2KDOA 4II3A 1LFPA 3IAS2 4BQOA 5HNFA 3FBNB 4XLFA 2JUGA 3HC7A 3DKXA 2LOOA 4BXFA 2R7UA 4ZTJA 3L2QA 2F6CA 4CUGA 2KMUA 3HOSA 2M4GA 2GOMA 3KX2A 2E1MC 1T95A 2IXSA 2VQHA 1JI8A 1D1BA 2VL8A 3L2RA 2WAFA 2OV7A 3OYCA 3L2VA 1DGRM 2LREA 3RTRA 4PFPA 2CUJA 2M7BA 2VKHA 2CMPA 3K4KA 3PNYA 3ZQQA 3KEYA 1Z21A 3GBGA 3E1SA 4CCJA 3V42A 2K3PA 5CKTA 4PK4A 4C2UA 2UUZA 3ZGKA 2DT6A 3PSFA 1D0YA 3AKZA 1NG7A 3AL0B 4HNTA 4P1WA 3W2AA 3CP2A 2QKLB 2ZSHB 2M7AA 2VQCA 1E0EA 2VB6A 5TGTA 3OY9A 1AA7A 1DP3A 2F5VA 3A1YA 2KHMA 3D5SC 3I3LA 4XOTA 2V4JC 2R7RA 2XF7A 2E60A 1UELB 2V9KA 2W1OA 4CA0A 2L2OA 3OYDA 2IGMA 3OIPA 2BVMA 4AU7A 4IX7A 3S3OA 5CQEA 1IRXA 2E1MB 2KZVA 5HLTA 2AQFA 2WBMA 3W2WA 4G6TB 1WFXA 2M3AA 4AYBA 3CZ6A 4XLCA 5FRMA 3U21A 3OYFA 4C30A 1X1BA 4KISA 4NC7A 3OL3A 2R7XA 2WB1A 2HNHA 2DT7B 2IGOA 4DBRA 3C2HA 4OWRB 2VLAA 3OS1A 3MD2A 1LKXA 4CSWA 4QPOA 4Y4RA 3DLAA 3HPHA 4BUPA 3CF2A 2HZDA 2CUZA 3NWTA 4PUSA 2ZXHA 2KQRA 3OYJA 1PJRA 4BGDA 3DU5A 4FETA 3F9KA 4PJNA 2O5RA 1FMWA 2R7OA 3M8JA 4KITB 4DJAA 3VYRB 2VQLA 2CV0A 1N77A 3OOUA 2MFZA 3EUHC 1X1CA 3PL8A 3MKZA 3PNVA 4HSTA 3M1CA 4NNJA 4RLFA 3VYSB 1WJEA 3DEEA 2M0MA 4HG2A 1UAAA 3IP4B 3H9QA 1OR7C 1R6RA 1WJCA 2Z2SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGW Y;  1DGR M; 
#chains in the Genus database with same CATH topology
 2M1B A;  2KL4 A;  2XAQ A;  3CJT B;  3DPT A;  4G94 A;  2DA3 A;  2OUM A;  2ZC2 A;  3HRU A;  3TO7 A;  2DN0 A;  4F93 B;  5K1Y A;  2DOD A;  1X2M A;  1FBU A;  3HKZ A;  1KU3 A;  5FKK A;  3ZRG A;  1B72 A;  3I9V 2;  2MD5 A;  3TP0 A;  3DBL B;  1YX5 A;  2OQR A;  3OYB A;  3CUO A;  1N25 A;  5B1B H;  4Z2Y A;  2DOF A;  4DIQ A;  4B09 A;  1C0W A;  2HVS A;  4BDY A;  2LF8 A;  3BLY A;  1E17 A;  4RA2 A;  3IH4 A;  3LL7 A;  2HU9 A;  4QPQ A;  1W5S A;  5B3S H;  1A35 A;  2CW7 A;  1XMK A;  2DQL A;  4LJZ F;  3T8T A;  4CCM A;  3F8F A;  2L9V A;  5FD5 A;  1GXQ A;  4ZH4 F;  2X1E A;  5D5U B;  2V1N A;  5IOZ A;  4G7O F;  1TQP A;  2VJI A;  3OYA A;  1WJF A;  3GEZ A;  3GTQ J;  1W7P B;  1F5T A;  4L18 B;  2WAD A;  3TDZ C;  4DOZ A;  1N75 A;  1S8N A;  1TWC J;  3TED A;  1QNT A;  3CMY A;  2KRC A;  1JJ8 C;  3E6D A;  4A3E J;  3D5L A;  3CJQ B;  3EUK L;  2W00 A;  3LSR A;  4IQJ A;  1VZ0 A;  4JYK A;  3JRH A;  2V7F A;  1UCR A;  2CW8 A;  5DTD A;  2NOJ B;  2NOG A;  4D5F A;  3IV5 A;  4HF1 A;  5IY5 H;  3G2B A;  3GVA A;  2DMU A;  5LEK A;  4F7Z A;  1J7K A;  2I8D A;  4U88 A;  2L01 A;  3SFZ A;  2EWN A;  1VQ8 I;  1FC3 A;  4M9S A;  3V8L A;  2ELK A;  2E1O A;  2HDD A;  3EYY A;  3FXM A;  1FSE A;  3MQ0 A;  4R8H A;  5E8I A;  5K5Q A;  4MQV A;  3RIR A;  4ZDO A;  2LY1 A;  3PIP F;  4J01 A;  3FK6 A;  5F08 A;  4PJJ A;  5DYM A;  2HGC A;  4XMY A;  1HW2 A;  4NDL A;  4ANJ A;  2JVG A;  4Y52 J;  4HW0 A;  3WTT C;  1W0U A;  4IHS A;  3V7S A;  3OYH A;  4BY1 J;  2MH9 A;  2BZT A;  3CLO A;  5E1Z B;  2YS9 A;  2XRO A;  3JTG A;  1FX7 A;  3ML6 A;  1SD6 A;  4QIW N;  2X6O A;  3SFI A;  2BY2 A;  4HEA 2;  3DTI A;  2KJB A;  4ESF A;  1MMG A;  1B8I B;  3C2G A;  4ZDP A;  4XNF A;  3CJR B;  2H8R A;  1Z3Y A;  4PGG A;  3L09 A;  2HVQ A;  3CDL A;  3JTH A;  3BPV A;  4YFK F;  2JZY A;  3BG9 A;  3BQY A;  5C3E J;  4D9J A;  1GV2 A;  2HPM A;  2I10 A;  4YII A;  2EFW A;  2CV1 A;  5KHD A;  4A3L J;  3D5R C;  2XRL A;  2A6E F;  5IT9 K;  2E7W A;  1A5J A;  3H0D A;  3MKY B;  2E71 A;  4QLC U;  1XMA A;  2EFN A;  1U5T A;  2ICW G;  3LSH A;  5CVR A;  2LKS A;  3M9A A;  4KN4 X;  1B1B A;  3BT9 A;  5EZG A;  3SEZ A;  4BU2 A;  2QQA A;  1XPX A;  1VQ9 I;  1CGP A;  1ZTR A;  1T6S A;  2K9M A;  1I3Q J;  2H94 A;  4U0W A;  2O6G E;  1ERD A;  1VQ4 I;  1J75 A;  3QRF F;  4LD5 A;  1RUO A;  3BG7 A;  3V8J A;  3U9G A;  4AIK A;  2Z16 A;  3TO6 A;  4D5C A;  3MKW B;  3CUQ C;  2AS5 F;  4ESJ A;  1IO2 A;  3HUG B;  2PMU A;  3H9G A;  4E6K G;  2K02 A;  4LB5 A;  2VI6 A;  3J80 K;  1DPU A;  1WSU A;  2XAG A;  3HJE A;  4M3G A;  1KQ0 A;  3BZC A;  4UV9 A;  2DJN A;  5E79 C;  3VB2 A;  1QPM A;  4Q47 A;  2R7S A;  2FOK A;  2O03 A;  2R5Z B;  2RDP A;  5J4Y A;  4F91 B;  1U3E M;  3DQV C;  2OZU A;  3O8G A;  4BDZ A;  5GAH J;  1E3H A;  1P92 A;  4UXN A;  1OLT A;  1ZGA A;  3MKL A;  3NRV A;  2E2I J;  2JA8 J;  2CQK A;  2K4B A;  4DGW B;  2XF6 A;  4XOR A;  2QQ8 A;  3M8F A;  4BQQ A;  1OCR H;  1V5F A;  1B9M A;  1YQA A;  3DP7 A;  5LLQ A;  3WTY C;  1HF0 A;  4B3A A;  3K1P A;  4NQW A;  3FHN A;  4DNC A;  1TW3 A;  4OIO F;  1D8K A;  1T08 B;  2FSW A;  2V26 A;  4ZYH A;  2KPM A;  2DU9 A;  3D1N I;  1TWA J;  2OBP A;  5EG0 B;  1OYI A;  1X3Z B;  3FM3 A;  2FX0 A;  4YFN F;  1BI2 A;  4BXX J;  3ZOB A;  5B1A H;  3RKY A;  1S9H A;  4A3J J;  2VJJ A;  2R5Y A;  1UHW A;  3KCC A;  2VOD A;  2XRN A;  2Q1Z B;  3ZXS A;  1X1A A;  2DFI A;  5JFR A;  4XKW A;  1PUF A;  4BEH B;  2HPI A;  4YIF A;  3CO6 C;  4HPQ A;  3WG9 A;  4HLY A;  1SFU A;  1ZR2 A;  4J19 A;  5DS9 A;  3QP5 A;  5GP9 A;  3BY6 A;  3S14 J;  2LBF A;  2W4S A;  3LWF A;  4ENJ A;  1BIB A;  3TOB A;  2KIQ A;  2A3S A;  2X6Y A;  3QOE A;  4H4K C;  1OCC H;  2A68 F;  2F4I A;  3R0J A;  2JRM A;  1O3S A;  2XKP A;  1BJZ A;  4H0E A;  2ECB A;  3P9C A;  1VND A;  1Z6T A;  2ZKZ A;  1LDJ A;  3CLQ A;  4GYI A;  3VFZ A;  3SJM A;  3Q0W A;  2XSJ C;  4N4O B;  2ZCW A;  1A6I A;  1TNT A;  3LSG A;  4IQ4 A;  4JBA A;  1UG2 A;  2Q8K A;  3CCR I;  4RDU A;  2ZME B;  3B6C A;  5EYR A;  2M34 A;  3DV8 A;  1DUX C;  1BC7 C;  3MN2 A;  3O3K A;  3WTV C;  2QWW A;  2H8W A;  4E7S A;  3S2D J;  1X4O A;  4II2 A;  4BQN A;  5J40 A;  1GHC A;  3HDD A;  4LG3 A;  2EH3 A;  1OQY A;  1FMV A;  3K4M A;  4HZF A;  3I4N J;  3RCO A;  5LEJ A;  5IT9 Z;  1IXS B;  2ISY A;  3BR1 A;  3L2W A;  1B9N A;  1X1D A;  2YPR A;  3DWL E;  4IKF A;  2JJ7 A;  5EGO B;  2LRD A;  2MD0 A;  2R93 J;  2OC6 A;  4BBS J;  3I56 I;  4KYW A;  4OIR F;  3O6B B;  4K2E A;  2MYS A;  3I71 A;  3EUA A;  4Y3O A;  3H35 A;  2CUF A;  2ZXW H;  5J1U A;  1K6Y A;  1I6H J;  3BPX A;  4FX0 A;  2DA4 A;  2QYO A;  4C2T A;  2Z3Y A;  1ETK A;  4CYD A;  4PSX A;  1ZLK A;  2HYF A;  4IHX A;  1BBY A;  4M72 A;  4BAC A;  1RKT A;  3DEU A;  2V9V A;  5H2F C;  5JLX A;  1FT9 A;  2DFH A;  3J80 Z;  3K2Z A;  2FU4 A;  2X1D A;  3GYH X;  5D5X B;  4MTD A;  4U0V A;  3MWM A;  4YEJ A;  3A2K A;  3IAM 2;  4Y17 A;  4I7H A;  1OKR A;  1XGM A;  3PUF A;  3V4G A;  4ZJZ A;  3DCF A;  4FT8 A;  3L1P A;  1ZHF A;  1QHH D;  5KAI C;  3K4B A;  1KQ8 A;  1I39 A;  1XDU A;  2M4K A;  1M1E B;  2ZXI A;  2V6C A;  2L7M P;  1HDD C;  2BY3 A;  5A2Q K;  5E1X A;  2LFB A;  4IOC F;  4RGX A;  3A0H C;  3OOP A;  1G3T A;  1YW7 A;  2VQG A;  5GAD J;  3F22 A;  4L5J A;  2IT0 A;  9ANT A;  2JUG A;  3HC7 A;  5JVG F;  2VPR A;  2G7U A;  5E3L A;  1V4R A;  4IPA A;  2KMU A;  4M3E A;  2GOM A;  4BHC A;  1HOM A;  2E1M C;  1LNW A;  3FKI J;  1T95 A;  2IXS A;  2BHY A;  1X2N A;  3BDD A;  2IA2 A;  1JHF A;  2LK2 A;  1VQ7 I;  3RTR A;  2ID3 A;  1HKS A;  4PFP A;  2M7B A;  2VKH A;  3HOX J;  3K4K A;  1RUN A;  2ID6 A;  3PNY A;  3ZQQ A;  2XVC A;  2DMP A;  3LQR A;  3ZQC A;  1ACI A;  1MBH A;  4PK4 A;  4C2U A;  3ZGK A;  3PSF A;  3AKZ A;  1IDY A;  1NG7 A;  2FNP A;  3LSP A;  3FWE A;  5ICE A;  1UJ8 A;  4C2M J;  1O7L A;  1ETX A;  2LDU A;  3HIF A;  2JN6 A;  5BOX A;  2WV1 A;  2VC0 A;  2A61 A;  1TBX A;  1D5Y A;  3GFI A;  4O6J A;  4M3B A;  1AA7 A;  3MFK A;  2NAZ A;  1LDD A;  2O7O A;  3K0L A;  2STT A;  1FWZ A;  4ZYE A;  2ZJP F;  1ZRF A;  2HYG D;  2R7R A;  1CF7 A;  5K7Z A;  5HDK A;  3L00 A;  2V9K A;  2W1O A;  1YS6 A;  3GTP J;  1GVD A;  1BW5 A;  4FHT A;  2PBI A;  5CQE A;  1YW9 A;  4ASN A;  5HDG A;  4G6D A;  5HLT A;  2LP0 A;  2WBM A;  1WFX A;  4L9V A;  2HOS A;  2IA1 A;  5CVU A;  2BHZ A;  1Y8Q B;  4XLC A;  5FRM A;  4JX5 A;  2QBY B;  2KIS A;  1EKE A;  1XSX A;  3BQZ A;  3FXL A;  1S5L C;  1Z77 A;  3BR6 A;  1MKM A;  3OL3 A;  4A3C J;  2R7X A;  2WB1 A;  5AON A;  4A3I J;  4DBR A;  2PX9 A;  4Y13 A;  3RYR A;  2QF7 A;  5F1J A;  3RQI A;  3ZMT A;  1IN6 A;  1QBJ A;  2KRF A;  3MD2 A;  5AIQ A;  3ZQG A;  1BIA A;  4CSW A;  1O3R A;  1HC8 A;  4Y7N J;  3E5U A;  1FSH A;  2KIU A;  3BJ6 A;  2CUZ A;  3HGY A;  5IP9 J;  1E3P A;  4PUS A;  4XSZ F;  1XS9 A;  2Y75 A;  5B5E C;  4FET A;  3F9K A;  2E36 A;  3HSR A;  1IN4 A;  2R7O A;  2PFB A;  4KIT B;  4DJA A;  4HNV A;  3VYR B;  1U78 A;  1N77 A;  1DDN A;  4B4C A;  4Y15 A;  3MKZ A;  3PNV A;  3KEQ A;  4I01 A;  2H6C A;  5L3F A;  3J81 K;  1QO0 D;  4IHV A;  3RPU A;  3HTU A;  3VYS B;  1IV6 A;  2H6B A;  1XGN A;  2M0M A;  1SC7 A;  2P7C B;  4HQE A;  2HXI A;  4U7D A;  1W7P D;  2J5P A;  2FA5 A;  2JSC A;  1ORK A;  1R6R A;  3ELK A;  4KMU X;  4C3J J;  2DMN A;  3JRG A;  3CD6 I;  2YR2 A;  2M45 A;  4EMS A;  4A3M J;  3GZ5 A;  1SEU A;  3V8K A;  1XC5 A;  2CFX A;  1W7P A;  3C1D A;  1ZLJ A;  3RPQ A;  3TO9 A;  2DXI A;  2LC2 A;  1P4A A;  2P6S A;  4IHT A;  3ZMV A;  3MVP A;  3R6S A;  4ZYA A;  2RGV A;  2FQ3 A;  3K4L A;  3AG3 H;  5J8F A;  2CS3 A;  2FQ4 A;  2WY8 Q;  2VOP A;  5LRS A;  2MH2 A;  4IRH A;  4G9Y A;  3IRQ A;  3WE3 A;  5EZH A;  5JR3 A;  4A3G J;  3G3Z A;  2XGC A;  2N8G A;  3TBI A;  2Y0S A;  2L9N A;  2FOW A;  3JAM Z;  1S7E A;  3OYE A;  1R36 A;  4BS9 A;  1QA6 A;  4J00 A;  2K5C A;  2ISZ A;  1ZK8 A;  1TNS A;  3GTO J;  3R4K A;  1T0F C;  1H9G A;  1R22 A;  3CCQ I;  3CF5 F;  3VWB A;  3QPH A;  2Y30 A;  4MFD A;  1D3Y A;  2DOA A;  4OMY A;  1W36 D;  2QZ8 A;  2EIN H;  3W3C A;  4HLX A;  3V7C A;  3WTS C;  5CQG A;  2E35 A;  2R3S A;  1S72 I;  1BI3 A;  3HOW J;  2X9D A;  2W84 A;  4D7M A;  4PJM A;  2D1H A;  2HDW A;  1LE8 B;  1RRJ A;  3HPG A;  3IKV A;  4PCQ A;  2ZFU A;  2M8G X;  2L5Q A;  4LLN A;  4LG0 B;  3OYM A;  1DU6 A;  1G3W A;  3UKG A;  1MBJ A;  3QU3 A;  2V9P A;  4A5N A;  2BXY A;  1APL C;  5HLG A;  1YX3 A;  1J09 A;  5CJ9 A;  2O8K A;  4EJW A;  1SAX A;  2ME0 A;  2BE5 F;  3I5U A;  4XON A;  1B8I A;  4CZC A;  3OS2 A;  1ZRE A;  2P5V A;  2OZ6 A;  2VE9 A;  4A3K J;  4RAZ A;  1TLH B;  4ZC3 A;  5LGN A;  4RB1 A;  4HQM A;  3I4P A;  1Y0U A;  3BR3 A;  4BHB A;  3S3N A;  4UNO A;  2BVL A;  2P6T A;  4OAY A;  1V5E A;  4JOM A;  4F55 A;  1E2X A;  1LDK B;  1Z91 A;  2XIG A;  1AU7 A;  1U0J A;  4EAT A;  1JHH A;  3BG6 A;  3Q0U A;  2QSG X;  3MMY B;  4GDF A;  1HBX G;  2M87 A;  1R7J A;  4YEL A;  3P5J A;  3LAJ A;  4R1H A;  4ENK A;  4EQQ A;  4N0B A;  4D1Q A;  3HB9 A;  1HA8 A;  2CH0 A;  2MGQ A;  3GME A;  3ONQ A;  3ZQ7 A;  2HQA A;  3FKJ A;  3WU2 C;  3I59 B;  3W6K B;  4E4H A;  2BW3 B;  5F1R A;  1IN8 A;  2P0W A;  2RQP A;  2GM4 A;  3DBR B;  2HTS A;  4P96 A;  2CYY A;  1WHU A;  3HTS B;  5F0H A;  1OPC A;  4HBL A;  2ECC A;  1LUJ B;  3BRO A;  5HOO A;  3BC8 A;  2BV6 A;  2WTE A;  1WZ2 A;  4XRS A;  1HW1 A;  3FBI B;  5D5V B;  1I5Z A;  2A6H F;  5CPR B;  1O4X A;  2JK3 A;  2K85 A;  2IGN A;  2JA7 J;  4KDP A;  2C6Y A;  5FLV A;  2JT1 A;  5CVV A;  5IPA A;  4NB5 A;  1YHQ I;  2M30 A;  3KP6 A;  4N9I A;  1VQ5 I;  3OMY A;  1FYK A;  4A3B J;  2Z99 A;  4CO8 A;  1BOA A;  2R5Z A;  3AG1 H;  4WXD A;  1Q1H A;  1FYL A;  1JXS A;  4XLE A;  3R61 A;  2A6T A;  2R7F A;  1VQK I;  4P9U A;  2P8T A;  3GFM A;  3F23 A;  4ETS A;  2HR3 A;  1ZRD A;  3QPT A;  2L4A A;  5D8L B;  1LB2 A;  3GZ6 A;  2GBY A;  3HHG A;  1RKW A;  2GOX B;  3NAR A;  3QYF A;  2ETH A;  4FAS D;  2FEZ A;  4QTR A;  3KET A;  3LFU A;  2K4J A;  2VJ4 A;  2X1C A;  1O7F A;  2DA1 A;  3KZZ A;  5M3M J;  4RGR A;  4CCN A;  2HYJ A;  4A6D A;  3KP4 A;  3ERE D;  2K9L A;  5EG0 A;  2WWY A;  2HZT A;  4RB2 C;  5J1R A;  1RIO H;  1IV8 A;  1WVR A;  3RDI A;  2E5Z A;  2KT0 A;  3N97 A;  1FEX A;  5HVQ C;  1P4W A;  4FTH A;  2LF7 A;  4XOP A;  3VSL A;  2MA3 A;  5L3C A;  3ABK H;  3WTW C;  2PJP A;  5ICC A;  4ZDL A;  4P55 A;  4BEH A;  3REO A;  3HXL A;  4BE1 A;  2QKM B;  5DV5 A;  2IS4 A;  1SVM A;  2ZXJ A;  4KUM A;  4E70 A;  4A3D J;  1JTY A;  3VEP A;  3I54 A;  1O3T A;  1B4A A;  2LY2 A;  2HOE A;  3LFK A;  1JUS A;  1LEB A;  3W2V A;  1TQM A;  5D5W B;  2YU9 J;  3SZG A;  1U8R A;  3OYN A;  3MZY A;  3RZD J;  3JRI A;  4LB6 B;  4BYY A;  5BPI A;  2VXD A;  3F8C A;  3QYB A;  3TDU C;  1FBS A;  1Y1W J;  1QPI A;  4WK8 F;  2EJR A;  3G6E I;  3J7Z I;  2EV0 A;  1P7J A;  4KT6 A;  1WH5 A;  4LLG F;  1RR8 C;  1JGG A;  4KNY A;  3BR0 A;  1MGT A;  1S29 A;  2L9S A;  1D0Z A;  2VAS A;  3RKW A;  1T0F A;  1JE8 A;  4EJT A;  5IYC J;  2ZME A;  4QSH A;  1MH3 A;  2NNN A;  2HEO A;  1MDM B;  3CP8 A;  5DD8 A;  5DM6 F;  3L2C A;  2XGX A;  4S0H B;  3S1R J;  1TZL A;  3BCB A;  3G73 A;  1MSF C;  1WJ5 A;  4Y33 A;  4LMY A;  1L3L A;  2OCC H;  1GLN A;  3GTG J;  1P6R A;  2D5V A;  5KK1 A;  3HKZ N;  3CQZ J;  1UB9 A;  3QYE A;  4EM0 B;  1LVA A;  3B02 A;  5FKL A;  1SFX A;  2B9S A;  5DCF A;  2R7Z J;  2VJ5 A;  5EGO A;  2OU2 A;  2HQN A;  2OCE A;  2CRG A;  2F48 A;  1FJL A;  3ASO H;  1IXC A;  1F1Z A;  3H9J A;  3BWG A;  3I53 A;  2UV1 A;  2R4G A;  4XKV A;  2LTP A;  4D7N A;  1MSE C;  3WU1 B;  1QZE A;  1TP4 A;  3KLN A;  4W97 A;  5HS7 A;  3CC2 I;  1MMD A;  1IGN A;  5FGM A;  4M3F A;  3SZT A;  1ZQ3 P;  4UUS B;  3E0J B;  1XGS A;  2Y0M A;  3DFG A;  3GFJ A;  1WI9 A;  4C3I J;  3GUD A;  2F5E A;  3ECH A;  3U1D A;  1DPR A;  3M4O J;  3VOE A;  3E5Q A;  3VSK A;  2LG4 A;  1Y6I A;  5AIP A;  1J0R A;  1R5G A;  1KU7 A;  4NHJ A;  1KGS A;  2Z5U A;  5FLM J;  4CCO A;  3JR9 A;  1YE9 A;  2LKX A;  1I1S A;  1BM9 A;  1HKQ A;  4DZP A;  1R71 A;  3OR1 C;  5J1Y A;  4UUV A;  2R7W A;  2UWM A;  3QOD A;  2CQN A;  2VKD A;  4MGR A;  2UZK A;  3BCA A;  4KJZ A;  4XIC A;  5JHF A;  2X6X A;  3S8P A;  2Z33 A;  2F5F A;  4HX4 A;  4LIU A;  4F3Q A;  3L7W A;  3GTL J;  3IKT A;  1HST A;  2K7L A;  3WG7 H;  3RJP A;  5IP6 A;  4U7B A;  2PG4 A;  3OV8 A;  2JSP A;  2RVC A;  4F92 B;  4C9Y A;  3A02 A;  3VYT B;  5KNL A;  4EJU A;  5F6F A;  3IWF A;  5FFZ A;  3RYP A;  2EFP A;  3AL0 C;  1G3Y A;  2M2E A;  3IWZ A;  2Q2E B;  3CDH A;  2CV2 A;  4IRI A;  1LVK A;  1WQ2 A;  3JCU C;  1FZP B;  1EF4 A;  1ULY A;  1MBK A;  5GAG J;  4A6E A;  3JSP A;  1FOK A;  1HDP A;  2NVT J;  2E1C A;  4XSX F;  1T33 A;  3KIO A;  4EM2 A;  5IYB J;  4E7I A;  5IOY A;  2ZJ2 A;  1TQI A;  4M74 A;  4BQO A;  5HNF A;  5FKN A;  3HOZ J;  1XGO A;  2DFE A;  4XLF A;  3FXR A;  2LLK A;  5FJ8 J;  2EZL A;  4BXF A;  2R7U A;  3L9F A;  4ZTJ A;  3GZN B;  4CYC B;  1WRJ A;  3BG5 A;  4GFB A;  2M4G A;  4I6Z A;  1YLF A;  3FIS A;  2FBH A;  3F0C A;  5EEH A;  1D1B A;  2DMQ A;  5D4R A;  2LNB A;  2WAF A;  2DW4 A;  2Z9O A;  3OYC A;  2VBW A;  2RAE A;  2LRE A;  2CMP A;  1VTN C;  4QWQ A;  3S15 J;  4EEF G;  3HYI A;  2K86 A;  2HQR A;  2ZJQ F;  4CCJ A;  3V42 A;  4XBF A;  5CKT A;  2DPD A;  2UUZ A;  2DT6 A;  1RC9 A;  1NK2 P;  1U6G A;  1K79 A;  3WU0 A;  2CQQ A;  4L9J A;  4KA4 A;  4YIR X;  1A6Q A;  4HOB A;  2Y9Z A;  2QBY A;  3CP2 A;  1VFC A;  2QKL B;  2M7A A;  2ZJR F;  2A07 F;  1BI1 A;  1UZC A;  4IJA A;  3E7L A;  2F5C A;  3G1M A;  4HV5 A;  1ZGW A;  3W6V A;  2RNJ A;  4CGZ A;  1DP3 A;  3E3V A;  3SZP A;  3JRD A;  4XK4 A;  3N4M A;  1MNM C;  1Y39 A;  3WTZ A;  1K6O A;  1AWC A;  1OCP A;  4M6X A;  2KKO A;  1K7A A;  4CA0 A;  1IN7 A;  4L5I A;  5DUK A;  3OIP A;  4CDG A;  4AM3 A;  1ZYR F;  2DMT A;  2L0K A;  3VPR A;  1YIO A;  2AQF A;  2QUF A;  2H1L A;  3ASN H;  5CVI A;  2M3A A;  4AYB A;  3HHH A;  4LK0 F;  4S04 A;  3HRT A;  5LHG A;  1B59 A;  2NXN B;  1MJA A;  1I6X A;  1H89 C;  3FF5 A;  3OYF A;  1JT0 A;  5GTI C;  5FB2 A;  4G8X A;  1MD0 A;  4NC7 A;  4I2O A;  2HNH A;  4BH9 A;  1U2W A;  1JJ6 C;  4M73 A;  3C2H A;  4OWR B;  2E34 A;  4HF0 A;  2XKO A;  1J9I A;  3OS1 A;  2GAU A;  2VBY A;  1LKX A;  4Y4R A;  2JUC A;  3HPH A;  1AKH B;  1YIT I;  2EFO A;  2CSO A;  4HAM A;  2HZD A;  4RB3 C;  1VF9 A;  2KQR A;  1KZH A;  1J2X A;  2R0Q C;  1V54 H;  2BEO A;  5LBQ A;  1SFE A;  1T39 A;  1YRN A;  1X3W B;  1FMW A;  4G6Q A;  2WC2 A;  3KE2 A;  2VQL A;  1PVE A;  5FFX A;  3OOU A;  1R23 A;  1E3O C;  3ECO A;  2KJC A;  4RAF A;  4HST A;  2XB5 A;  5LGU A;  2OA4 A;  1K4S A;  4ENM A;  5L3G A;  2HKX A;  1P7I A;  4PZJ A;  2EA2 A;  2P7V B;  1IN5 A;  3IP4 B;  3WOD F;  1WJC A;  2G7H A;  3GXO A;  3FXQ A;  1WH7 A;  3I58 A;  2DLL A;  4KN7 X;  1R58 A;  4AYB N;  3LSK A;  4YFX F;  1X3U A;  4CZZ A;  2P5K A;  2KP6 A;  5F0F A;  3RQ4 A;  1LE8 A;  1NHA A;  1G4D A;  4I0B A;  4G12 A;  3FXJ A;  1U5T B;  2F4O B;  1FOX A;  1OR7 A;  4LG0 A;  1QVU A;  4B48 A;  3HOU J;  1Y1V J;  2O61 A;  2WV0 A;  4KIB A;  2XGE A;  1W36 C;  2VXZ A;  2OPT A;  1Z3X A;  1VQM I;  3ZMZ A;  2L4M A;  2YU3 A;  4E7K A;  3OYL A;  1BJA A;  1F4K A;  3Q5F A;  4FX4 A;  3IUO A;  1EJ9 A;  1Y8R B;  3FMR A;  3CMA I;  5DEQ A;  3PUB A;  5LHI A;  1YW8 A;  5JVT A;  3VDX A;  4OIN F;  2L02 A;  4M6V A;  5M3F J;  1ZN2 A;  1AOY A;  2RQQ A;  2HWV A;  1BC8 C;  3FHZ A;  2E5N A;  2BW3 A;  4CHU A;  3Q0V A;  1QGP A;  1WJB A;  1FIA A;  2D1V A;  2L3D A;  4PDK A;  1G6N A;  2EV6 A;  1YOV B;  1ZH5 A;  5TJJ A;  1GUU A;  4BNC A;  4BAY A;  3GTM J;  2W57 A;  1D1C A;  1QHG A;  3OYI A;  3BZK A;  3S32 A;  1YTY A;  2V1U A;  1G8X A;  3RSN A;  4DQ2 A;  3GCM A;  2XPU A;  3GLL A;  4UB8 C;  4A0Z A;  5ICG A;  1RR7 A;  2VN2 A;  2W48 A;  3TP3 A;  2B7E A;  3K1N A;  2RV8 A;  2LD5 A;  3K70 C;  2HFH A;  2KIF A;  2EBI A;  2OF7 A;  3CCL I;  2BY1 A;  4E7H A;  3I55 I;  2L7Z A;  2IS6 A;  2STW A;  3KP7 A;  1XCV A;  4R79 A;  3HL2 A;  2HQ5 A;  3LMM A;  2BBY A;  3LAP A;  2HXO A;  2AQE A;  1TT5 B;  1HKT A;  5ILS A;  1MMA A;  2KIM A;  3BJO A;  1KYZ A;  1RNL A;  2HTJ A;  1BW6 A;  1GXP A;  1XDS A;  2A69 F;  3H92 A;  3K4N A;  1W4M A;  3K4J A;  1YJW I;  2IGK A;  5EDN A;  2LH9 A;  3S2W A;  4I0A A;  1A04 A;  1UFM A;  1G3S A;  1QZZ A;  3LSM A;  5DM7 F;  3KLO A;  3H5R A;  2L7K A;  2L9R A;  3PNT A;  3OL4 A;  4HSR A;  4MO7 A;  4XN0 A;  2B63 J;  3RPU D;  1VI0 A;  1OYW A;  1HQC A;  5EEA A;  4A5M A;  3IH2 A;  4LK1 F;  4OU0 A;  1IJW C;  4AD9 A;  5ILV A;  1R1V A;  1V3F A;  4WXC A;  4MEX F;  3G71 I;  4JP0 A;  5FD6 A;  1XN7 A;  3FX3 A;  5A2Q Z;  5L3D A;  2YUS A;  4G7Z F;  3F8M A;  3QWL A;  4OOI A;  3PQK A;  2JRT A;  1D8J A;  3HOT A;  4LLL A;  4A12 A;  1ZG3 A;  2MW8 A;  4Q5S F;  5J3L A;  3ZQH A;  3OYG A;  1STZ A;  3V7R A;  2GA2 A;  4MTE A;  4G7H F;  2V1X A;  1MJ9 A;  3ESW B;  3J7A Y;  4CIC A;  4BHP A;  3F8N A;  3VYU B;  3ABL H;  1OCO H;  2A05 A;  3ABU A;  4CH7 A;  2YX7 A;  5EEG A;  3DKW A;  2XSD C;  2JA2 A;  2K40 A;  2R7D A;  5FRN A;  2WB1 N;  2XGD A;  4ZYG A;  3BTJ A;  2VT2 A;  5JI6 A;  1OMI A;  4RS8 A;  2JVH A;  2WAQ A;  4BJ5 C;  4IOA F;  4RGS A;  1POG A;  5D6F A;  2OTJ I;  2FBI A;  1A36 A;  1T8I A;  3HOY J;  2L54 A;  4ITV A;  4A69 C;  5HLH A;  3WGI A;  1P9Q C;  2KRH A;  2OAZ A;  4RGU A;  1SVO A;  3TL4 X;  2ZME C;  2IAI A;  3A01 B;  4XQF A;  1GDT A;  3IHU A;  3ERM A;  1FTZ A;  3T0Y A;  1FOY A;  1H88 C;  1OJL A;  2EZH A;  4JQF A;  4I98 B;  4RLQ A;  4E7L A;  1ON1 A;  5GTH C;  3IH3 A;  1OCT C;  5D4S A;  2DQR A;  2RRE A;  2PMZ A;  3HSE A;  1HW5 A;  5H6R A;  2LYC A;  3H3Z A;  3F6V A;  1TWH J;  1RZ4 A;  1SD5 A;  2W24 A;  3I4M J;  3RI4 A;  1FP1 D;  3CUQ B;  3N05 A;  4ZZD A;  2FMY A;  2Z1D A;  4UUS A;  1Z05 A;  5GPC A;  3S3M A;  1ETO A;  1KON A;  1ZAR A;  2XUB A;  2COM A;  3Q9S A;  1NG6 A;  2EZI A;  2Y2Z A;  2EK5 A;  5FKM A;  1MNE A;  3R0A A;  3S93 A;  3RZO J;  2JTV A;  4S05 A;  2W7N A;  1TC3 C;  4ZYD A;  2IS2 A;  4BL0 B;  2P5L C;  2DFF A;  1FOW A;  4I76 A;  2XPW A;  2MAB A;  2JWT A;  3NAU A;  4B44 A;  1U9N A;  2W82 A;  2NVX J;  2WAE A;  1NK3 P;  4RM3 A;  2VIX A;  3KPH A;  1ON2 A;  4V2F A;  4XL9 A;  1RES A;  2OJE D;  3D0S A;  3G1L A;  3M3Y J;  2Y0S N;  1A31 A;  2QA4 I;  5E17 F;  1DGW Y;  2PN6 A;  3K70 D;  2M0C A;  1X4P A;  3WHC A;  4KIG A;  1ETQ A;  3PFI A;  3TMO A;  3F21 A;  1MW7 A;  1IXR C;  1QZY A;  2NRA C;  1R00 A;  5M5X J;  2JPC A;  2TCT A;  1BOB A;  1DU0 A;  3SYT A;  3K4C A;  4XLA A;  2K27 A;  1XD7 A;  3HUG A;  3SDG A;  3C18 A;  3SEQ A;  3S1Q J;  2VE8 A;  4DYQ A;  4CXF A;  1ITY A;  1JKQ C;  3ISP A;  2XF5 A;  1RET A;  4C3H J;  4DW6 A;  3J81 Z;  1FP2 A;  1UMQ A;  2MSY A;  3AG2 H;  4BJ6 C;  2D45 A;  2Y48 A;  2E2H J;  1WCM J;  1FLI A;  4NBQ A;  2XPV A;  3GW2 A;  2NS0 A;  3ROU A;  3A4C A;  4LGW A;  1WJA A;  2DJI A;  2CO5 A;  4TV7 A;  5ILU A;  3MZH A;  3H1C A;  1MIJ A;  2F2E A;  3U1K A;  4CYC A;  3P9K A;  1YYV A;  1MMS A;  1R5I D;  1HXD A;  3IRR A;  2GIZ A;  4Q4Z F;  2PI0 A;  2E1N A;  5DD4 A;  1VQ6 I;  4CCK A;  2LKP A;  4BE0 A;  2KLO A;  4DYR A;  5IYD J;  2PJR B;  3BOQ A;  3K6G A;  3KYL A;  3CCY A;  3E5X A;  3FIW A;  2GXA A;  3LST A;  2VBZ A;  1ODD A;  2ZSI B;  3A0B C;  2IJL A;  2XAU A;  2HKO A;  3H5N A;  5J47 A;  4XKB A;  5F0C A;  1CQT A;  1YFH A;  1MBE A;  3P9I A;  3CTA A;  3TW7 A;  3WTU C;  3KZI C;  2HS5 A;  4IEJ A;  1DP7 P;  3PIO F;  1QVT A;  1WI3 A;  2Y31 A;  4II3 A;  1LFP A;  2V79 A;  4M9X A;  2DK8 A;  3H0G J;  2LMD A;  2M5W A;  4WWC A;  4IO9 F;  4ENN A;  1K4T A;  4LFU A;  3L2Q A;  2F6C A;  4CUG A;  1T2K A;  3GX4 X;  3KX2 A;  2VQH A;  3GTJ J;  2X0L A;  1JI8 A;  2DYS H;  2RN7 A;  4L9N A;  3CC4 I;  2QEN A;  2VL8 A;  3S2H J;  2EQR A;  1JT6 A;  2XV4 S;  4UVB A;  4GCV A;  1DGR M;  1XCB A;  4HV6 A;  5L3E A;  3L2V A;  3GO5 A;  2G0E A;  4RAY A;  2DAO A;  2UXX A;  4UVA A;  3KEY A;  3E1S A;  2DYR H;  4FQG A;  5F04 A;  1LQ1 A;  2ADU A;  3WHB A;  1BI0 A;  1FPQ A;  3ZN1 A;  2W85 A;  1PP7 U;  2JMW A;  2EIM H;  2W25 A;  2BXZ A;  3P7N A;  4HNT A;  2PEX A;  4P1W A;  3W2A A;  1FNN A;  1K78 B;  5K7F A;  5KVR A;  1E0E A;  3S1N J;  2G9W A;  2FF4 A;  3OIO A;  2VB6 A;  2A5Y B;  3E6B A;  3CCU I;  3A1Y A;  2XB0 X;  1JGS A;  2PMH A;  3QPS A;  5HS8 A;  3E6C C;  5J8C A;  4N9H A;  1Z67 A;  4UB6 C;  3QQA A;  1EH6 A;  1KYW A;  2L2O A;  3MEX A;  4MNU A;  2IGM A;  4W1U A;  5TIS C;  3OYD A;  3LNQ A;  1AKH A;  1H8A C;  4OIP F;  4I09 A;  3H3U A;  2NVY J;  4MIM A;  4IX7 A;  4IXA A;  4AUX A;  3CME I;  3TKY A;  2E1M B;  2CU7 A;  4G6T B;  2NS8 A;  1YJN I;  1IC8 A;  2D2W A;  3CZ6 A;  4M71 A;  2JQ7 A;  1JKO C;  4XLN F;  3U21 A;  5LRR A;  2IPQ X;  2VKV A;  1JUP A;  2YSR A;  1JKP C;  4C30 A;  1VQO I;  1X1B A;  2MG4 A;  4L0Z B;  4KIS A;  2FBK A;  4IL6 C;  3TW6 A;  1PUE E;  5ERI A;  2VC1 A;  2DT7 B;  1O57 A;  2I5U A;  2E19 A;  1IZ1 A;  2IA0 A;  4QPO A;  3BTC A;  3MCZ A;  1R9T J;  3DLA A;  2K9N A;  1SD7 A;  1U8B A;  4EV0 A;  3NWT A;  2ZXH A;  3O2P E;  3DEW A;  1PJR A;  4GO1 A;  3M8J A;  5CLS A;  1XSD A;  1Q1V A;  3SHF A;  4OMZ A;  5D6E A;  1XMX A;  3CCE I;  3R60 A;  2CV0 A;  2GXB A;  1X1C A;  2FXA A;  3WTX C;  2CGP A;  4WF2 A;  2LY9 A;  2ACJ A;  1K61 A;  3BR2 A;  3CDI A;  3M1C A;  4RLF A;  3TQN A;  1SD4 A;  3DEE A;  2EIK H;  3HEF A;  3BZ6 A;  4DYC A;  1XSV A;  3BR5 A;  2XAJ A;  4HDV A;  3Q9V A;  3H9Q A;  4GGG A;  1OR7 C;  5F27 A;  3J7A O;  3LA7 A;  3C7J A;  2Z2S B;  5J4V A;  1F43 A;  1USS A;  3NEU A;  3ZMD A;  3EUH A;  2O9L A;  4XN3 A;  1KU9 A;  2X4H A;  2DO7 A;  1WKM A;  4AIJ A;  1G59 A;  1EV7 A;  3QPL A;  1TWG J;  1L0O C;  2M8E A;  1WJD A;  2CUE A;  3PO3 J;  2HDC A;  2O3F A;  3ZR8 X;  3EPZ A;  3PM1 A;  1FBQ A;  2VBX A;  4EGZ A;  2L7F P;  4KIC A;  1SAU A;  5E8G A;  4V2G A;  1MBG A;  4P5O A;  2VT3 A;  3HSF A;  5DCM B;  2QSH X;  3JSO A;  2DT5 A;  3BTI A;  1REP C;  2Y9Y A;  2FUG 2;  3JRC A;  3H36 A;  2CFO A;  1QQI A;  3F3X A;  4B47 A;  2J5O A;  5DDG A;  2DBB A;  1V5G A;  5CVJ A;  3FMQ A;  4MHG A;  5DUI A;  3OIQ A;  1MMN A;  5HNH A;  2MC4 A;  2QVO A;  3FM5 A;  1W1W E;  5H6Q A;  1B72 B;  4IHW A;  6PAX A;  2NS7 A;  2QM3 A;  1LJ9 A;  2QQB A;  4GRI A;  2KDZ A;  1TWF J;  1D0X A;  3DBH B;  4B43 A;  1D5V A;  3VOD A;  3H5A A;  1YS7 A;  1TL8 A;  4ON0 A;  2PLY A;  3QOP A;  2O8X A;  2VOO A;  1Y56 A;  2OD5 A;  3M8E A;  2DA6 A;  5KCM A;  1ETV A;  1MZB A;  2EIJ H;  2NYX A;  2FML A;  3RKQ A;  3ZN0 A;  2R7V A;  1MBF A;  2OQG A;  2MBF A;  3BJA A;  4MQ9 F;  5J6X A;  4XID A;  1FYM A;  1UHM A;  1EH8 A;  2ELH A;  1V55 H;  5H20 A;  5HLI A;  2K9Q A;  1J59 A;  4A2U A;  4I02 A;  1WWX A;  4PSW A;  2R92 J;  1S7A A;  1OYY A;  2A5W A;  2K9S A;  2X85 A;  1SFK A;  4PJ0 C;  1U9O A;  4WCG A;  4KMF A;  1S6L A;  3WE2 A;  4WXH A;  2DK5 A;  3ABM H;  2H27 A;  1BR2 A;  4U0Y A;  2XAS A;  1UG0 A;  3QU6 A;  2IRF G;  2DDB A;  3KZY A;  4AVP A;  1Z0X A;  3AFH A;  2RKH A;  4ESB A;  4YRV A;  1MND A;  2IP2 A;  3ABT A;  3GLX A;  2FE3 A;  3TOA A;  1IAW A;  1RI7 A;  2KZG A;  3CMM A;  2CW0 F;  3JRE A;  5BS6 A;  1G2H A;  3FXO A;  2X51 A;  1BN5 A;  2NVQ J;  1BA5 A;  1GVJ A;  2UXN A;  3COA C;  3W6J B;  4BE2 A;  1WGX A;  4HDU A;  5LFA A;  1JUM A;  2TRT A;  2NVU B;  4EVI A;  3A03 A;  4XM3 A;  4F52 A;  3PO2 J;  2R7Q A;  1X1P A;  4UHT A;  1ZR4 A;  3MAJ A;  3KFW X;  1SFO J;  2VUM J;  3DXJ F;  3LA3 A;  2EV5 A;  4XRS G;  5M5W J;  5K5R A;  5CYV A;  4EJO A;  4DBQ A;  1PDN C;  4EGY A;  2CWE A;  3LSJ A;  1YJ9 I;  2IVM A;  4HRI A;  2M9H A;  2IS1 A;  1IUF A;  3ZQF A;  1BL0 A;  2IEK A;  1R5H A;  3GTK J;  1S3J A;  2OTL I;  4JX6 A;  1S7O A;  4L9T A;  3E97 A;  3JRF A;  3OYK A;  1X58 A;  1LPQ A;  3A01 A;  3DPU A;  3HBL A;  2ESH A;  2V1D A;  1LEA A;  1SAN A;  3ZCO A;  1T56 A;  3IL2 A;  2DTZ A;  4PFO A;  5F64 A;  1D1A A;  4BJT A;  1AHD P;  3LQQ A;  2DDA A;  4PGH A;  5E18 F;  5FKO A;  4MLO A;  2XC7 A;  5GAE J;  2RNG A;  4AVZ A;  1P2F A;  3PSI A;  3HM5 A;  1ETW A;  3DF8 A;  3B6A A;  1Z6R A;  3AG4 H;  1IDZ A;  3CUQ A;  2DOE A;  4JX4 A;  4RBO A;  1VQP I;  3FZV A;  1EA3 A;  2TDX A;  3EQL F;  4P9F A;  1PYV A;  2RC4 A;  2P81 A;  4XKC A;  3BTL A;  3FK7 A;  5E1W A;  5LD2 C;  3LSI A;  2ME6 A;  1UST A;  3CES A;  2FNA A;  1BR4 A;  3SDB A;  3OS0 A;  4A0Y A;  3CCM I;  4IHY A;  4WX9 A;  3AAF A;  5HOD A;  4Q48 A;  2IBD A;  4NC6 A;  3OWT A;  4UV8 A;  5BNG A;  3RKX A;  3T5X A;  2ESN A;  4U87 A;  5FRO A;  5K7H A;  1F36 A;  4HF2 A;  3KP2 A;  2CQX A;  1GV5 A;  2QLZ A;  3I59 A;  5EJC A;  3JAM K;  5BMZ A;  4LIT A;  4N4N B;  2AXT C;  2GQQ A;  1Y0N A;  1OIS A;  2MLG A;  1R4M B;  4IF4 A;  4IZZ A;  2X6W A;  4HNU A;  3ZQL A;  1YO5 C;  4AID A;  4LIV A;  1R4N B;  1ZEL A;  3DU6 A;  1N78 A;  2HVR A;  4IVN A;  1MH4 A;  2DCE A;  4NQW B;  1YIJ I;  3PFY A;  1XX5 A;  2BOL A;  3F8B A;  2IW5 A;  1IUY A;  2VKE A;  4AWX B;  1W5C C;  4RB0 A;  4UVC A;  2QSF X;  4CCL A;  3UNG C;  2EA4 A;  2JPB A;  3X2Q H;  5BPD A;  4EJV A;  4O3M A;  2FJ1 A;  2Q0O A;  4RM2 A;  2R5Y B;  3JRB A;  2E2J J;  2FD5 A;  3KP5 A;  4BKX A;  1RPW A;  3B73 A;  5FLX K;  3FDY A;  4KIF A;  1QU3 A;  4NUB A;  4BXU A;  2ELJ A;  4XRF A;  2MC3 A;  3SXY A;  1PUF B;  3ZMS A;  1OCZ H;  1MJB A;  3HG9 A;  5C4X J;  1WPK A;  4RMN A;  4PJL A;  1IRG A;  3KP3 A;  4ABZ A;  2AHQ A;  4O5V A;  2FRH A;  2XHK A;  1XTA A;  2P4W A;  2HI3 A;  1JKR C;  3KYD B;  3T8R A;  2WY7 Q;  1Z9C A;  3H3V K;  2LBF B;  3DTE A;  3UR3 C;  4M6Y A;  4NC8 A;  3DPL C;  3K1M A;  2MLK A;  3U2R A;  2WA0 A;  4A3F J;  4BQA A;  4ZTF A;  1IF1 A;  2ZFW A;  3K69 A;  2PJR A;  2GLO A;  1GT0 C;  2QGU A;  3G1O A;  1TT0 A;  2Y69 H;  1YI2 I;  2V6E A;  4X1E A;  3CJN A;  1W5T A;  3FXU A;  1UHS A;  2E7X A;  5ED4 A;  5M5Y J;  4UUT A;  4KFC A;  3DLL F;  4EM1 A;  3L2U A;  2CG4 A;  1LFB A;  1ENH A;  1O3Q A;  3FXK A;  4XLH A;  2R7T A;  2VPL A;  1BR1 A;  3J7Y J;  3OSG A;  1XG1 A;  1NTC A;  3DKY A;  3K10 A;  3NWS A;  2DA2 A;  5IP7 J;  4X0G A;  1IG7 A;  2COB A;  4HX7 A;  1H0M A;  4OIQ F;  4AC0 A;  5TRD A;  2GA1 A;  3OR2 C;  1HSJ A;  3ZQI A;  4E7Z A;  2XDV A;  3S1M J;  1ZKG A;  3O8H A;  3EYI A;  4OAZ A;  4E7J A;  5C44 J;  1FY7 A;  3LOC A;  1X19 A;  4L0Y B;  1SMT A;  3F6O A;  1ONV A;  2QCO A;  3S17 J;  3WGG A;  1SVL A;  2GXG A;  4BY7 J;  2ZBK A;  3HRM A;  2F5D A;  1Z1D A;  1TTY A;  1KU2 A;  2GIV A;  1ZRC A;  4XR6 A;  3DTK A;  3PJR A;  2LVS A;  4V19 K;  1J5Y A;  2LSO A;  4HA8 A;  1DQU A;  1KA8 A;  3EDP A;  4B3X A;  1FTT A;  2NNY A;  1MDM A;  1Z7L A;  3NQO A;  1T38 A;  3WGH A;  2KDO A;  4FE7 A;  3M1E A;  3IAS 2;  2BY0 A;  1YRN B;  3FBN B;  2DA5 A;  3K2A A;  3S16 J;  3DKX A;  1Z7U A;  2AXL A;  2LOO A;  4XRM A;  1VQN I;  1K78 A;  2AO9 A;  3HOS A;  2BGC A;  1KQ9 A;  3KYC B;  1I27 A;  1PP8 F;  1ZAO A;  3L2R A;  2DA7 A;  4MFE A;  1YG2 A;  2OV7 A;  3CCV I;  2ZO4 A;  2CUJ A;  4A93 J;  4GXO A;  2BYV E;  2EFQ A;  4GYG A;  5BQT A;  5LGT A;  5JLW A;  3K7A J;  1R1U A;  1Z21 A;  3GBG A;  1R49 A;  4HYE A;  3GFL A;  4B1R A;  2K3P A;  4A0X A;  2ZNZ A;  1R1T A;  3HRS A;  5EF6 A;  5C4J J;  2DI3 A;  4AIH A;  1D0Y A;  3PQJ A;  3GWZ A;  3TGN A;  1IRZ A;  3LA2 A;  1I50 J;  2EIL H;  4I99 C;  3ZMU A;  1ZG1 A;  1LFU P;  3AL0 B;  3HZJ A;  1P4X A;  4M3D A;  2DPU A;  2QEX I;  3QAH A;  3CC7 I;  4KT5 C;  2ZSH B;  2CQ7 A;  3JRA A;  2VQC A;  3C2B A;  3HGG A;  3JW4 A;  5K5O A;  4JK1 X;  3CCJ I;  5E20 A;  3OY9 A;  5TGT A;  2GWR A;  2F4M B;  1XB4 A;  2JA5 J;  4XLP F;  2F5V A;  3I0T A;  4FIS A;  1T98 A;  5GPA A;  5FLX Z;  1NH3 A;  1B6A A;  2KHM A;  1OFC X;  2ZNY A;  2DTR A;  3D5S C;  3I3L A;  4BBR J;  2VON A;  1F9N A;  4XOT A;  2V4J C;  4ZZL A;  5E3N A;  4RAG A;  3OSF A;  3IC7 A;  2XAF A;  2XF7 A;  5D8K B;  2E60 A;  1UEL B;  3KEO A;  5KAF C;  4L5E A;  1I1G A;  3SQN A;  5HS9 A;  4LOC A;  1FIP A;  2B0L A;  2BVM A;  2HOA A;  2WAQ N;  3BG3 A;  4AU7 A;  3S3O A;  4X6A J;  1IRX A;  4FCY A;  2KZV A;  1EH7 A;  3ULQ B;  3W2W A;  3E6M A;  2JA6 J;  3C3W A;  3HOV J;  1QRY A;  1ETY A;  4B8X A;  2QQ9 A;  1IW7 F;  3CCS I;  4M9Z A;  2ZB9 A;  5L3B A;  5ICF A;  2O0Y A;  4YG2 F;  3QP6 A;  2CJJ A;  2K3F A;  2PQ8 A;  4IRG A;  2IGO A;  2KFD A;  3F72 A;  1IRF A;  5B66 C;  2Q2E A;  2H1K A;  5HDN A;  2PMZ N;  3T1B A;  3EET A;  2VLA A;  2GZW A;  4Z6Y A;  1U5T C;  1CF7 B;  5IT3 A;  1JTX A;  3MZ8 A;  3Q3S A;  5E3M A;  2HOT A;  4BUP A;  3CF2 A;  5FO5 A;  3FMS A;  3OYJ A;  2X48 A;  3G4S I;  3ZP5 A;  4BGD A;  5E3O A;  2EB7 A;  3DU5 A;  2EPF A;  5JHU A;  4PJN A;  4FE4 A;  2O5R A;  4HX8 A;  4UY8 I;  2EZK A;  3M7G A;  2LR8 A;  1ZG5 A;  1K83 J;  2XAH A;  3CO7 C;  2MFZ A;  1I3A A;  3K9T A;  3EUH C;  4DZJ A;  3PL8 A;  4MEY F;  5LHH A;  1HLV A;  1VQL I;  3M07 A;  1SMY F;  1W0T A;  4NNJ A;  2YX4 A;  3ZPL A;  1H9T A;  1WJE A;  1HCR A;  1ZGJ A;  4HG2 A;  5DCM A;  1UAA A;  1TW2 A;  3I64 A;  2H09 A;  3BP8 A;  4D0P A;  3GF2 A; 
#chains in the Genus database with same CATH homology
 2KL4 A;  4XN3 A;  2DXI A;  3DPT A;  2LC2 A;  2OUM A;  4F93 B;  3LSK A;  3HKZ A;  4ZYA A;  3ZRG A;  3I9V 2;  1G59 A;  2KP6 A;  3RQ4 A;  1YX5 A;  3K4L A;  3OYB A;  2CS3 A;  2WY8 Q;  1WJD A;  3TBI A;  4DIQ A;  2Y0S A;  4B48 A;  3ZR8 X;  2L9N A;  3EPZ A;  2HVS A;  3OYE A;  4BDY A;  3BLY A;  4BS9 A;  3LL7 A;  1SAU A;  2HU9 A;  4QPQ A;  1W36 C;  2VXZ A;  4P5O A;  2CW7 A;  4J00 A;  2K5C A;  1Z3X A;  2FUG 2;  4CCM A;  2CFO A;  4B47 A;  1T0F C;  2X1E A;  4E7K A;  2V1N A;  3OYL A;  3VWB A;  2VJI A;  1V5G A;  2DOA A;  3OYA A;  1WJF A;  3IUO A;  3OIQ A;  1W36 D;  2WAD A;  1MMN A;  3W3C A;  4DOZ A;  3PUB A;  5HNH A;  1N75 A;  2MC4 A;  5CQG A;  2KRC A;  3VDX A;  4PJM A;  2HDW A;  3D5L A;  3CJQ B;  3EUK L;  3HPG A;  2W00 A;  4GRI A;  2RQQ A;  1D0X A;  2ZFU A;  4B43 A;  2E5N A;  1VZ0 A;  4IQJ A;  2V7F A;  3H5A A;  2L5Q A;  2BW3 A;  2CW8 A;  1WJB A;  3OYM A;  2NOJ B;  1YX3 A;  3G2B A;  1J09 A;  1Y56 A;  2I8D A;  4XON A;  5KCM A;  4CZC A;  1D1C A;  1QHG A;  3OS2 A;  3OYI A;  3S32 A;  4ZC3 A;  1G8X A;  3RSN A;  2R7V A;  3S3N A;  2BVL A;  4OAY A;  1V5E A;  4JOM A;  4F55 A;  2LY1 A;  1LDK B;  4ZDO A;  4J01 A;  1U0J A;  4PJJ A;  4XMY A;  4PSW A;  3BG6 A;  4EAT A;  2A5W A;  3MMY B;  3K70 C;  2X85 A;  1SFK A;  4ANJ A;  2JVG A;  4YEL A;  4E7H A;  1BR2 A;  4D1Q A;  3OYH A;  2IS6 A;  1UG0 A;  1HA8 A;  2CH0 A;  3ONQ A;  2HQA A;  3FKJ A;  4R79 A;  4E4H A;  3AFH A;  2BW3 B;  3HL2 A;  3LMM A;  2P0W A;  4YRV A;  1MND A;  4HEA 2;  2AQE A;  3DTI A;  3CMM A;  1MMG A;  5HOO A;  3C2G A;  3BC8 A;  4ZDP A;  4XNF A;  3CJR B;  1MMA A;  2X51 A;  3FBI B;  1Z3Y A;  4BE2 A;  5LFA A;  2HVQ A;  5CPR B;  3K4N A;  4F52 A;  4XM3 A;  2IGN A;  4D9J A;  3K4J A;  2HPM A;  2R7Q A;  2IGK A;  2LH9 A;  2CV1 A;  5KHD A;  3D5R C;  3LSM A;  3OMY A;  4DBQ A;  3H0D A;  3H5R A;  3MKY B;  2L7K A;  3PNT A;  3OL4 A;  4HSR A;  3LSH A;  4XN0 A;  3RPU D;  4XLE A;  2A6T A;  4HRI A;  3SEZ A;  2IS1 A;  4BU2 A;  2K9M A;  2GOX B;  3QYF A;  1ERD A;  4FAS D;  3LFU A;  3HOT A;  2VJ4 A;  3BG7 A;  2X1C A;  3OYK A;  2Z16 A;  4CCN A;  3MKW B;  3DPU A;  3ZCO A;  3HUG B;  4PFO A;  3OYG A;  3H9G A;  2K9L A;  4E6K G;  1D1A A;  4BJT A;  3J7A Y;  2E5Z A;  3VYU B;  5HVQ C;  4CH7 A;  2R7S A;  2XC7 A;  4MLO A;  2JA2 A;  2RNG A;  4XOP A;  4AVZ A;  4F91 B;  3VSL A;  3DQV C;  3PSI A;  4BDZ A;  5FRN A;  1OLT A;  4ZDL A;  4BEH A;  3HXL A;  4BE1 A;  2JVH A;  4DGW B;  2QKM B;  2WAQ A;  2XF6 A;  4BJ5 C;  2IS4 A;  1EA3 A;  4XOR A;  4BQQ A;  1V5F A;  1PYV A;  2LY2 A;  4XKC A;  5LD2 C;  3W2V A;  3FHN A;  3LSI A;  3SZG A;  3OYN A;  3CES A;  4ITV A;  1P9Q C;  2KRH A;  3TL4 X;  1BR4 A;  2V26 A;  3SDB A;  3OS0 A;  2VXD A;  4XQF A;  3QYB A;  2KPM A;  3OWT A;  4KT6 A;  4JQF A;  1S9H A;  4RLQ A;  4E7L A;  2VJJ A;  4U87 A;  5FRO A;  2RRE A;  2PMZ A;  2L9S A;  2Q1Z B;  3ZXS A;  2LYC A;  1X1A A;  1D0Z A;  2VAS A;  4LIT A;  4N4N B;  4XKW A;  4BEH B;  4IZZ A;  3N05 A;  2HPI A;  2X6W A;  4HPQ A;  2Z1D A;  4HNU A;  4LIV A;  3DU6 A;  1ZEL A;  3CP8 A;  1N78 A;  3S3M A;  1KON A;  2HVR A;  1TZL A;  2DCE A;  3BCB A;  4NQW B;  1NG6 A;  1WJ5 A;  2LBF A;  3PFY A;  4Y33 A;  1MNE A;  3S93 A;  2BOL A;  2W4S A;  1GLN A;  2W7N A;  2IS2 A;  4BL0 B;  2X6Y A;  3QOE A;  3QYE A;  4H4K C;  4CCL A;  2MAB A;  3UNG C;  2F4I A;  2VJ5 A;  4B44 A;  2W82 A;  4RM2 A;  2WAE A;  4RM3 A;  2VIX A;  4XL9 A;  3H9J A;  2UV1 A;  2XSJ C;  2R4G A;  3FDY A;  4N4O B;  4XKV A;  1DGW Y;  4IQ4 A;  3LSG A;  4NUB A;  3K70 D;  1QU3 A;  1MMD A;  2ELJ A;  3HG9 A;  1X4P A;  4RMN A;  4PJL A;  3E0J B;  3TMO A;  1MW7 A;  4E7S A;  1X4O A;  4II2 A;  4BQN A;  2WY7 Q;  1BOB A;  4LG3 A;  3SYT A;  1FMV A;  2LBF B;  3DTE A;  3K4M A;  3UR3 C;  3K4C A;  4NC8 A;  4XLA A;  3RCO A;  3DPL C;  3VSK A;  2LG4 A;  1Y6I A;  2WA0 A;  3SEQ A;  3L2W A;  1X1D A;  3DWL E;  4CCO A;  4IKF A;  4ZTF A;  1YE9 A;  2XF5 A;  2LRD A;  2PJR A;  2MD0 A;  1TT0 A;  2OC6 A;  2V6E A;  3OR1 C;  2R7W A;  2UWM A;  3QOD A;  2VKD A;  2MYS A;  3EUA A;  4Y3O A;  3H35 A;  4BJ6 C;  1K6Y A;  3BCA A;  4KJZ A;  5JHF A;  3L2U A;  2X6X A;  3S8P A;  4C2T A;  4LIU A;  4PSX A;  4XLH A;  2R7T A;  2VPL A;  1BR1 A;  3DKY A;  3K10 A;  4F3Q A;  4BAC A;  3NWS A;  3A4C A;  4X0G A;  1WJA A;  2DJI A;  3OR2 C;  2X1D A;  4U7B A;  4E7Z A;  2XDV A;  2JSP A;  4YEJ A;  3A2K A;  4F92 B;  4C9Y A;  5KNL A;  3IAM 2;  3VYT B;  4OAZ A;  4E7J A;  4CCK A;  1X19 A;  3AL0 C;  4ZJZ A;  2KLO A;  4BE0 A;  2PJR B;  3K6G A;  3KYL A;  2Q2E B;  2CV2 A;  1QHH D;  1LVK A;  3K4B A;  2XAU A;  2ZSI B;  2M4K A;  4XR6 A;  3DTK A;  3H5N A;  2ZXI A;  4XKB A;  3PJR A;  1DQU A;  4B3X A;  4E7I A;  1Z7L A;  2VQG A;  2KDO A;  4II3 A;  1LFP A;  3IAS 2;  4BQO A;  5HNF A;  3FBN B;  4XLF A;  2JUG A;  3HC7 A;  3DKX A;  2LOO A;  4BXF A;  2R7U A;  4ZTJ A;  3L2Q A;  2F6C A;  4CUG A;  2KMU A;  3HOS A;  2M4G A;  2GOM A;  3KX2 A;  2E1M C;  1T95 A;  2IXS A;  2VQH A;  1JI8 A;  1D1B A;  2VL8 A;  3L2R A;  2WAF A;  2OV7 A;  3OYC A;  3L2V A;  1DGR M;  2LRE A;  3RTR A;  4PFP A;  2CUJ A;  2M7B A;  2VKH A;  2CMP A;  3K4K A;  3PNY A;  3ZQQ A;  3KEY A;  1Z21 A;  3GBG A;  3E1S A;  4CCJ A;  3V42 A;  2K3P A;  5CKT A;  4PK4 A;  4C2U A;  2UUZ A;  3ZGK A;  2DT6 A;  3PSF A;  1D0Y A;  3AKZ A;  1NG7 A;  3AL0 B;  4HNT A;  4P1W A;  3W2A A;  3CP2 A;  2QKL B;  2ZSH B;  2M7A A;  2VQC A;  1E0E A;  2VB6 A;  5TGT A;  3OY9 A;  1AA7 A;  1DP3 A;  2F5V A;  3A1Y A;  2KHM A;  3D5S C;  3I3L A;  4XOT A;  2V4J C;  2R7R A;  2XF7 A;  2E60 A;  1UEL B;  2V9K A;  2W1O A;  4CA0 A;  2L2O A;  3OYD A;  2IGM A;  3OIP A;  2BVM A;  4AU7 A;  4IX7 A;  3S3O A;  5CQE A;  1IRX A;  2E1M B;  2KZV A;  5HLT A;  2AQF A;  2WBM A;  3W2W A;  4G6T B;  1WFX A;  2M3A A;  4AYB A;  3CZ6 A;  4XLC A;  5FRM A;  3U21 A;  3OYF A;  4C30 A;  1X1B A;  4KIS A;  4NC7 A;  3OL3 A;  2R7X A;  2WB1 A;  2HNH A;  2DT7 B;  2IGO A;  4DBR A;  3C2H A;  4OWR B;  2VLA A;  3OS1 A;  3MD2 A;  1LKX A;  4CSW A;  4QPO A;  4Y4R A;  3DLA A;  3HPH A;  4BUP A;  3CF2 A;  2HZD A;  2CUZ A;  3NWT A;  4PUS A;  2ZXH A;  2KQR A;  3OYJ A;  1PJR A;  4BGD A;  3DU5 A;  4FET A;  3F9K A;  4PJN A;  2O5R A;  1FMW A;  2R7O A;  3M8J A;  4KIT B;  4DJA A;  3VYR B;  2VQL A;  2CV0 A;  1N77 A;  3OOU A;  2MFZ A;  3EUH C;  1X1C A;  3PL8 A;  3MKZ A;  3PNV A;  4HST A;  3M1C A;  4NNJ A;  4RLF A;  3VYS B;  1WJE A;  3DEE A;  2M0M A;  4HG2 A;  1UAA A;  3IP4 B;  3H9Q A;  1OR7 C;  1R6R A;  1WJC A;  2Z2S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...