1DGWY

Structure of the rhombohedral crystal of canavalin from jack bean
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
92
structure length
92
Chain Sequence
QLRRYAATLSEGDIIVIPSSFPVALKAASDLNMVGIGVNAENNERNFLAGHKENVIRQIPRQVSDLTFPGSGEEVEELLENQKESYFVDGQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Plant protein
molecule keywords CANAVALIN
publication title X-ray diffraction and atomic force microscopy analysis of twinned crystals: rhombohedral canavalin.
pubmed doi rcsb
total genus 8
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1999-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.840 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1dgwY01
1DGWY 1DGRM
chains in the Genus database with same CATH superfamily
3E6BA 4CUGA 2H1LA 4YG2F 4E7LA 1QPIA 3OSGA 1TQPA 1ZYRF 3BZCA 4PK4A 2BY1A 1UCRA 4P1WA 2W84A 3GTJJ 1YOVB 3N4MA 1XSXA 2ZB9A 4AWXB 2FXAA 1E0EA 2M34A 2LVSA 2FQ4A 2NS7A 3V4GA 5LEKA 3ABUA 3ULQB 5LD2C 4EQQA 2RV8A 2OPTA 1QO0D 2R5YB 2IW5A 1D3YA 1G8XA 2M87A 3EUKL 2FJ1A 3RQ4A 4RLQA 3ZMUA 3S1MJ 2DJIA 1W5TA 1IJWC 2ZJRF 3S2HJ 3DPTA 3DU6A 2DA7A 2W85A 1ZLJA 2CYYA 2EV5A 1D8KA 2L7FP 2XVCA 2MYSA 1D0YA 1SD7A 5DCMA 3T1BA 2IPQX 3ROUA 5HNFA 1Z6TA 1JTXA 3IH3A 4B3XA 2V79A 3F21A 1BW5A 4LMYA 1SAUA 1B9NA 3WTWC 2R7OA 3QYFA 3FHNA 5FLXK 1YQAA 4B4CA 4GXOA 4I7HA 3H3UA 1TT5B 3GLXA 4JBAA 4ZDLA 4L9TA 2GXBA 3DBLB 2QSGX 3FXQA 4AD9A 4DYCA 2F4MB 3CQZJ 1PVEA 4XM3A 5L3BA 4HBLA 2FBKA 5D8KB 1Z67A 2XF7A 2E2HJ 4BH9A 3Q9VA 4IO9F 4D5FA 1B8IA 3AG3H 5F1RA 2V1NA 5D5XB 2IS6A 5D8LB 2DA5A 1YIJI 2KL4A 4IQ4A 3VEPA 3SYTA 2HTSA 3RSNA 2H6BA 1YIOA 4XOPA 2E1NA 2V9VA 1IRZA 3KP2A 1LJ9A 4B3AA 1B72B 4M9SA 2YR2A 1HBXG 5EG0A 5E3OA 4ENJA 1XSDA 1VQ8I 2J5OA 1R6RA 4HSTA 2TRTA 3GFMA 2EZHA 3KP3A 4Q47A 4FETA 1A5JA 5TJJA 3RPUA 5K5RA 2MFZA 3HRTA 3RIRA 4OOIA 4ON0A 2NYXA 1TZLA 2X0LA 3HUGB 4BS9A 1W7PB 2NOJB 3BG6A 1O7LA 2NS0A 4CSWA 5JVTA 5EZGA 2P4WA 3WG9A 3BJAA 1R71A 2MLGA 1G59A 3H5RA 4HV6A 1TWFJ 1AKHA 1WHUA 4WXCA 3HZJA 1YE9A 2ZXIA 4BACA 3MFKA 2EIMH 1EKEA 3KYCB 3OS2A 1T39A 2E1OA 4FX0A 3VSKA 3ZR8X 2F48A 4HQMA 1OR7A 2QF7A 3M07A 5F27A 3LQRA 1GXPA 3E1SA 4BJTA 3JRHA 1X1PA 3HSEA 2KP6A 3O8GA 2VC1A 4LIUA 4BQAA 2P8TA 3ZGKA 3N05A 1OCRH 3S32A 1I3AA 2X48A 3BZ6A 2EK5A 1LVKA 4G8XA 4Y15A 4II3A 2D45A 4Y7NJ 4LJZF 2XKOA 4PJ0C 4DZPA 1WJCA 3NWSA 1DGRM 1R1UA 4HLXA 1BOBA 5F64A 2RN7A 1MBKA 5FO5A 5LHHA 3NEUA 3CC4I 2QYOA 3W2VA 4HNTA 3PFIA 5DM7F 2H6CA 5CVUA 3CCUI 4Q48A 2FNPA 2BW3A 3REOA 2E1CA 2EINH 1K7AA 5KAIC 4IHXA 1R5ID 4B48A 4HF0A 2DJNA 4HDUA 5IT9K 2DT5A 5ICCA 3I58A 1FBQA 2M30A 4IHSA 2HOTA 4I0AA 1F4KA 3S3NA 1BI0A 3V8LA 1IAWA 1FZPB 1H0MA 2ACJA 3JRGA 1JHFA 1J59A 4C2TA 5HLHA 3OYNA 3JSOA 2JK3A 3V42A 1OKRA 4CCLA 1EV7A 4AIHA 2V6EA 1MJBA 2ZC2A 1SVLA 5BNGA 3EQLF 1YJNI 1HW1A 2VE9A 4Q4ZF 4BHPA 2XPWA 2W1OA 1JUSA 2KZGA 3ABLH 5J1UA 3CCMI 1QZYA 4I09A 5DCMB 3FISA 1BJZA 5DYMA 2F5CA 3GFJA 3SFIA 3WHCA 1MBFA 4ZYEA 3BROA 3C7JA 1FNNA 1YX3A 2M7BA 2PMZA 2JUGA 3B73A 3FX3A 3D0SA 3QOEA 4KIGA 4IRIA 5E3MA 2R4GA 4LK0F 4EM2A 2V1XA 1P7IA 5J6XA 4DIQA 2H94A 4ZYGA 1X2MA 3W6KB 1BM9A 2MGQA 2FUG2 1Q1HA 4IEJA 2BVMA 3GF2A 4F93B 4U7BA 1AA7A 3O8HA 3A4CA 4HX7A 4V2FA 4I0BA 4DOZA 4FE4A 3S3MA 2C6YA 1SVOA 1ERDA 3F23A 2L7MP 1QU3A 2L0KA 3T8TA 4AVPA 4GYGA 1ENHA 4BGDA 1VQ6I 1SD6A 4XK4A 1LVAA 1VF9A 4N0BA 5LGUA 1B8IB 1FOXA 3K4LA 2VXZA 1AWCA 2GXGA 4Y52J 4CA0A 1SAXA 3I4MJ 3Q3SA 5IY5H 1O3SA 2Z5UA 4OAYA 9ANTA 4P55A 1KU3A 4F55A 3SEQA 2VLAA 2M4KA 2EWNA 3BG9A 4LGWA 5FB2A 1MMGA 2PMHA 3FBIB 4EJWA 2PG4A 2IGNA 3TW7A 3EPZA 5DEQA 4RGRA 3KFWX 2G7UA 3I53A 5EG0B 1ETVA 2RKHA 1FIAA 2FEZA 1I6HJ 3BR6A 1MBEA 1TW2A 1B59A 4HF1A 3ASOH 1S3JA 2ZXJA 2HQAA 1SMYF 3FXLA 2CV1A 3RKYA 4DJAA 3BTIA 3DLAA 1IO2A 4W1UA 1TLHB 2NVTJ 2VQGA 1IRXA 4ZTFA 2XRLA 3KZIC 3NQOA 3LA7A 4XR6A 1MSEC 3I64A 2VE8A 3OIPA 4A3LJ 1P4WA 2A07F 4WXDA 3OL3A 1AKHB 4YFXF 4HF2A 1V5EA 5GAGJ 3KCCA 2HKXA 4OINF 1GUUA 4KMFA 2YUSA 1ZGAA 2JJ7A 2L9NA 5FD6A 4JX4A 2ZJQF 1W1WE 1F36A 4HV5A 4OMYA 2UXNA 3ABTA 3I9V2 5EJCA 2STTA 1MNMC 2VBXA 5IP9J 1IUYA 2LFBA 2DPUA 3CDHA 4KIFA 1R4NB 1ETOA 2F6CA 1MW7A 4IPAA 2JT1A 1BN5A 1Z9CA 3HOZJ 2MLKA 4XLCA 1SFKA 2M1BA 1YHQI 3GTQJ 4JYKA 5ILUA 1A31A 1T0FC 2P5KA 1ZN2A 4Y13A 3PNVA 1UAAA 4DYQA 1H88C 2EH3A 3ML6A 3GX4X 3CLOA 2ME0A 2BW3B 4HAMA 1SC7A 4IHWA 1NG6A 4FQGA 3BR0A 1T38A 4D5CA 3ECHA 1MBJA 1ZQ3P 2HQ5A 2EFOA 4E6KG 5IOZA 4RBOA 3A02A 4EMSA 1CQTA 1SD4A 2LH9A 4UB8C 3SZTA 4CZCA 2XF6A 1Z7UA 2M0CA 4L9VA 1XMAA 2GAUA 2AO9A 3K4JA 5KK1A 5J1RA 2LKXA 1OCZH 2CS3A 3QU6A 3JRBA 4PZJA 1OCCH 1USSA 1JGGA 4RGXA 2VJ5A 4N4NB 2IAIA 3OMYA 4D1QA 4OIQF 2JA2A 2A5WA 1R7JA 2DA3A 1AHDP 5M5YJ 3BG3A 5CQEA 2OCCH 3VYRB 2O03A 2VIXA 1QBJA 1O57A 1O4XA 1Z77A 4PJLA 2DTZA 4QPQA 1VQMI 4O6JA 3E6CC 3ZOBA 1JI8A 3MN2A 2XGEA 1YJWI 1R9TJ 1V5GA 2MBFA 1Y39A 3BDDA 1WGXA 1K4TA 2L54A 1VQ4I 5JLXA 1YG2A 3OL4A 4A2UA 2P6TA 2R7DA 4MQVA 1QZEA 4S05A 1EA3A 4PSXA 3PSIA 2LLKA 3RDIA 2GA2A 1IRGA 3S3OA 2DN0A 4G7HF 5GTIC 4FHTA 2NOGA 2QLZA 3CC7I 4BQNA 3LSRA 4IXAA 4CCNA 5HS8A 2V26A 1NG7A 3K1MA 3A01B 3OOPA 2OF7A 3TMOA 2LYCA 3R61A 3IC7A 1VFCA 2HOSA 4CHUA 4V2GA 1U78A 2JWTA 3QP5A 4XLHA 2K9LA 3DEWA 3CO7C 2Y30A 1FP1D 1XGOA 3FXJA 4UVBA 1Z7LA 1FYKA 2CGPA 4FCYA 2O8XA 1XCVA 3C2BA 2R0QC 2YU9J 2LDUA 1KQ0A 1KYWA 3HOYJ 2RQPA 2JQ7A 1PYVA 3JREA 3MZ8A 3DU5A 5DUKA 2P6SA 5E8IA 2A3SA 2AQEA 2XAGA 1ETQA 4LK1F 3S1QJ 3MQ0A 4D7NA 1UFMA 4MIMA 1T33A 1MMAA 4UNOA 2HZDA 2ZNZA 4DGWB 1LUJB 1V5FA 2Y75A 2ZBKA 4OU0A 2HOAA 4OIPF 5CPRB 3KLOA 2CG4A 1REPC 1ZARA 5JVGF 3BG5A 1NK2P 1VQ5I 2AHQA 3BOQA 5D4SA 2PX9A 2LF8A 2LR8A 3BLYA 3L2CA 2IGKA 1XTAA 1XG1A 1WVRA 1VQKI 1V3FA 2EIJH 3CCQI 4NB5A 3ZP5A 3HG9A 1XMXA 2Y0SA 4KT6A 3RYRA 4AC0A 3NAUA 2X9DA 1T8IA 4XONA 3DTEA 4ZZLA 1IZ1A 4I99C 3KEQA 3I3LA 1JKOC 3FXOA 1R5GA 4A93J 2JSCA 1RESA 1ZG3A 3JRCA 4AIDA 4UB6C 3CF2A 3T5XA 4WX9A 4IHTA 4M9XA 1BI3A 1DU0A 4HSRA 2DT7B 3CESA 2PMUA 2L02A 2FBIA 2E5ZA 1VNDA 5K7FA 4YFKF 5A2QZ 2DI3A 1UHSA 3CLQA 1ON1A 2LD5A 2E5NA 2EFPA 2KZVA 4RB3C 5CJ9A 3ZQGA 2XPUA 3RKQA 2KJCA 2HWVA 4XKVA 1BR1A 4HYEA 3W6JB 4RB1A 4LD5A 5J4VA 4BXXJ 4LIVA 5HDGA 2WAQA 3JW4A 1R23A 3ZMSA 2CU7A 3OIOA 2XB0X 1IV6A 1JJ6C 2TCTA 2M2EA 2HDDA 3H0GJ 1X4OA 2VKHA 3KZZA 1BOAA 3IP4B 4G7ZF 2VBWA 1XS9A 1TNSA 2GM4A 2GLOA 3NWTA 1T08B 5J1YA 2VOOA 4J19A 5D6EA 3TEDA 2LNBA 4UV9A 4BKXA 3J81Z 1J5YA 5EEAA 1JT0A 1WJBA 2WAFA 4E7KA 1WJ5A 2FE3A 1BI2A 1MGTA 1E17A 3I59A 1A6QA 1APLC 5DV5A 3HKZA 3E5UA 4A12A 4KISA 3GO5A 4XN3A 2CFOA 2LC2A 2O61A 4A0ZA 2CW0F 2EIKH 3IWFA 3T8RA 1MD0A 2DA4A 1ZTRA 4NUBA 1WJEA 4BL0B 2OV7A 5BS6A 2QVOA 1D8JA 4O3MA 3PJRA 2DAOA 3H9JA 1U8BA 5ICEA 1IGNA 5E17F 4CCOA 1KU9A 5GP9A 1B9MA 2X6XA 3HRUA 4M6YA 2H27A 3BTCA 3JRDA 2WB1A 2WY7Q 3MKLA 3K6GA 1Y0UA 5B3SH 1UG2A 3IAS2 4JK1X 3PQKA 3CUQC 2R7FA 3ZMTA 1XDSA 5E18F 1S7OA 2JA7J 3O2PE 2K40A 1I3QJ 5HLIA 3PUFA 3K4MA 4XSZF 3KETA 2QQ9A 1P92A 3ZQIA 4YFNF 5FJ8J 2CQXA 2K9NA 1BW6A 1TW3A 1PUFA 2OTLI 4IJAA 3JCUC 1HOMA 1YI2I 2Z3YA 3MZYA 1Y8RB 1UB9A 3ZMVA 3I5UA 1N78A 4MGRA 1ORKA 2TDXA 5CVIA 2VJ4A 5DM6F 2JN6A 2E1MC 3CCJI 1IDZA 3OYDA 4B43A 2CV2A 3C2HA 5B66C 3FIWA 1MJ9A 1X2NA 1J0RA 1JUPA 1MMNA 1XX5A 3LSIA 1TC3C 4M71A 3PSFA 3H9QA 2EQRA 4EJUA 1FOWA 5K7HA 3ABKH 4XIDA 3OYKA 3GZ6A 3LQQA 4ENMA 1RR8C 4NDLA 1FIPA 2Q0OA 3ZMZA 4OIOF 2D2WA 2ZFUA 3MKYB 2NS8A 2QSHX 4A3JJ 4G12A 2V7FA 3EYIA 5GAHJ 1ZAOA 3BJ6A 4LG3A 2I10A 5J8CA 3AL0C 5B1AH 5LRSA 2WWYA 5LFAA 2XB5A 4IRHA 3SEZA 2JSPA 3HSFA 4IOCF 3BR3A 4C3JJ 2BXZA 5ICFA 1Y6IA 3G73A 1HSTA 3MWMA 2HYGD 3F8FA 4RMNA 1J9IA 4PJMA 4IX7A 4P9FA 1QRYA 3HSRA 1S6LA 2MH2A 4WCGA 3LAJA 4I6ZA 4AUXA 2RNJA 1DU6A 1FEXA 2HFHA 1D0ZA 5FLXZ 2CUJA 3E5XA 1HC8A 2K4BA 3S1RJ 3BZKA 5TGTA 1W0UA 2OJED 2DO7A 1AOYA 4PUSA 2GA1A 2KPMA 1K61A 4BU2A 5FGMA 4P96A 3E7LA 5EZHA 4A3CJ 3GWZA 1M1EB 2EPFA 2ID3A 2K9QA 3CJNA 1BC8C 4X1EA 4ZZDA 3IH2A 3VPRA 4AVZA 3JAMK 3L09A 1ZRDA 4W97A 2UV1A 3M1CA 2VQHA 2DOEA 2E34A 2L2OA 2W48A 3TDUC 2BE5F 1D1CA 1WJDA 3AAFA 3MKWB 3FHZA 4UXNA 4I98B 1TQMA 3VYUB 1U5TB 1P4AA 3MKZA 4XICA 4A5MA 3I59B 3M8FA 1LE8A 2W25A 3BTLA 3G1OA 3EYYA 3RQIA 2VKDA 4F91B 3LSJA 1BIAA 2YPRA 4HX4A 4XLNF 4BYYA 4F3QA 1MKMA 4EGYA 3RPQA 3K4BA 2IRFG 4RLFA 2WADA 5F1JA 3HXLA 3BPVA 1FBUA 1G3WA 3Q0VA 2XV4S 1VQ9I 3LSHA 3O3KA 1U2WA 4ZYAA 1XGMA 5BPDA 3J7ZI 2L9VA 3BY6A 3WGIA 2GOMA 3G2BA 5F6FA 2Y0MA 1AU7A 3HOTA 3VB2A 1OMIA 2RGVA 3FKIJ 2L7ZA 4XL9A 4G94A 3DWLE 2R7QA 3GVAA 2IS1A 2LREA 3HOWJ 3IV5A 2R93J 1OYYA 1FWZA 1ETWA 3M9AA 3TOAA 3VYSB 1X58A 4GO1A 3S1NJ 1XCBA 4F92B 3L2VA 1RKWA 3K70C 1W5SA 2JZYA 3W2AA 4MLOA 4UUSA 2DMTA 4BUPA 2ZXHA 3MD2A 3DEEA 4XRSG 1T56A 4CCMA 3H35A 1WZ2A 4UY8I 3ZQHA 1ZH5A 2JRTA 5E3LA 3GTPJ 4LLLA 1MIJA 2RREA 3R60A 1SMTA 2EB7A 1R36A 3TO9A 2H1KA 2XDVA 2GIZA 3QPTA 1ETKA 4RDUA 3OYBA 4LFUA 1WRJA 2BVLA 1I27A 4YRVA 4HG2A 4KICA 4NNJA 2ID6A 5IT3A 3VDXA 1RI7A 4D0PA 3WTSC 2LKSA 3SXYA 3H9GA 2RQQA 2UZKA 1VZ0A 2VBYA 2PMZN 4DZJA 3KYLA 4FTHA 5L3EA 2B63J 1X1BA 2ZMEA 4ABZA 5IT9Z 1ODDA 5E3NA 4E7HA 5J4YA 2KIUA 1P4XA 5FKOA 2L4MA 3F22A 4YIIA 4I76A 4U88A 3DBRB 4CXFA 1Z91A 5HDNA 5EEGA 4U0WA 1GVDA 3EDPA 3BC8A 3A2KA 4L0ZB 2HYJA 3GYHX 4PCQA 2OZUA 3BR5A 3W6VA 2JPCA 3EUHA 2NVUB 4ITVA 3SHFA 3GFIA 3PNYA 1BL0A 1I5ZA 2R7WA 3OR1C 2CUEA 1W0TA 5JFRA 2W57A 3HJEA 2ESHA 2K3FA 1QHHD 3RKXA 3K69A 2LOOA 2ICWG 4C2MJ 2JUCA 1SFUA 2HDCA 2CFXA 1FC3A 2OQGA 2W82A 4XLEA 1SFEA 2V9PA 2MABA 1DPRA 1N77A 3DFGA 3K70D 4A3KJ 1BR4A 4CGZA 5EEHA 3WGHA 1MH3A 1E3PA 3QAHA 3QU3A 2R7XA 3MEXA 3DCFA 4ZYDA 1WQ2A 1FJLA 2Z2SB 3BTJA 4QIWN 1MDMA 1Z3YA 2AXTC 2LY2A 1BC7C 1KGSA 1T95A 3MZHA 2COBA 5HOOA 1RETA 3SDBA 2K9MA 3AKZA 1D1AA 1YS6A 2OTJI 3P7NA 3OYIA 4KFCA 3LL7A 5DTDA 2P7CB 2CUZA 2A68F 4XMYA 5JLWA 1ZG1A 1TWCJ 1ONVA 1UJ8A 3K1PA 4NQWA 4M72A 3JR9A 3GZ5A 3CZ6A 3KYDB 2ZFWA 1E3HA 2IBDA 1IXCA 3ISPA 4KDPA 1YTYA 2ZCWA 1GT0C 1O3TA 2HS5A 1I50J 2K5CA 3L2UA 4K2EA 2VC0A 3W2WA 2EFNA 1BBYA 2FOWA 3SDGA 3PIPF 1HKTA 3CUQA 3OWTA 3P9CA 5FFZA 2O0YA 3D5LA 2COMA 1FYMA 3DTKA 2OU2A 3AG2H 4ESFA 2G0EA 3HBLA 4PFOA 1S8NA 3VYTB 2QEXI 2X85A 3M7GA 5AIQA 5F0FA 2WA0A 1XGSA 1X4PA 3ZRGA 1CF7A 1USTA 5M5XJ 2MD0A 1LQ1A 3S16J 3WTYC 4U0VA 2HNHA 2HEOA 1O7FA 5HDKA 4G6DA 1S7EA 4JP0A 2ZXWH 3LSGA 4I01A 4N4OB 4KJZA 4OWRB 2Y9YA 4RA2A 1LFPA 2J5PA 1MNDA 1IN5A 4UUSB 1O3QA 2PJRA 1N25A 2HR3A 2JA8J 1R1TA 1LNWA 4A3DJ 5L3GA 4Y17A 1HA8A 2KRHA 1KQ8A 1SFOJ 4LB6B 2XGDA 2IS2A 2WY8Q 5K7ZA 1JUMA 1SFXA 4A0XA 2PBIA 4L5EA 1UELB 3UNGC 2KISA 2HTJA 1Z1DA 3F0CA 2HXIA 4U87A 3C18A 4XBFA 4A3MJ 2LBFA 2KRCA 2XSJC 3IRRA 1V55H 2HDWA 4ZDPA 2KIMA 2XAQA 5M3MJ 4KYWA 3CMMA 4RAGA 3L9FA 1W7PD 4XRMA 3ELKA 1WJAA 5FD5A 1H9GA 1WI9A 2ZMEB 3HRSA 3CP8A 2UWMA 3S8PA 3R6SA 4XKCA 2HVRA 4QWQA 3DV8A 3NARA 3S93A 2NNYA 4MTEA 3F9KA 3RKWA 1B4AA 5BMZA 2RDPA 3FXMA 5CVRA 4F7ZA 3GTMJ 5GPAA 3PIOF 4KN4X 2VOPA 4LB5A 4KIBA 2NVQJ 2A6HF 3MVPA 2MSYA 4L0YB 2XGCA 2V1DA 2ZJPF 3CF5F 3C3WA 2P5VA 3E5QA 3G4SI 2A6TA 3L2QA 3V7SA 3JRIA 3U2RA 2KMUA 3RTRA 1XN7A 1VTNC 2F5VA 3HGYA 2A5YB 3LOCA 4MO7A 2OZ6A 2XAJA 2ELJA 5C44J 4BDYA 2KHMA 1OYIA 4E7IA 1WPKA 3U9GA 2FMYA 4EGZA 3GZNB 2FBHA 5J3LA 1W5CC 4AU7A 4UV8A 1RIOH 2D5VA 3DPLC 3MCZA 2OC6A 2VN2A 1XMKA 2FX0A 4L5JA 2MC4A 4N9IA 1QQIA 2UXXA 3OS0A 5DS9A 3TP3A 1FMVA 4XLPF 5HODA 4LOCA 5EF6A 2VODA 2XAUA 1TBXA 3OYEA 1FOKA 2QUFA 2K9SA 3K2ZA 2XPVA 4L18B 1ULYA 3CTAA 4MFDA 5ILSA 4HLYA 4KMUX 3OYJA 3LSTA 2IA1A 4FT8A 1SVMA 2DYSH 4EJTA 3HOXJ 1UMQA 4RB0A 4KN7X 2DTRA 1P9QC 2VJIA 4CDGA 5FLVA 2R7ZJ 4S0HB 2R7VA 2AQFA 5ERIA 4ENKA 2D1VA 2CQQA 2RC4A 2Y0SN 3CCYA 3BQYA 5F0CA 5JR3A 3OYLA 3HL2A 4IVNA 2K3PA 4BXUA 4MTDA 1OLTA 3W3CA 2HZTA 4XN0A 1JTYA 2IGMA 2M5WA 3FZVA 2QGUA 3E97A 3R0AA 2IA2A 4IL6C 5EGOA 2DFEA 3G6EI 3QODA 4EV0A 3LFUA 4JOMA 2DA1A 2ETHA 4PFPA 2XHKA 3GEZA 3WG7H 4BBRJ 2R7RA 2W00A 3WHBA 3HPHA 5AIPA 1OR7C 4O5VA 5E8GA 5KNLA 2ME6A 4M3EA 3E3VA 2DU9A 4UVCA 1YW8A 1FTTA 1CF7B 4RAYA 5FKKA 2ZNYA 2VONA 2BGCA 2WAEA 1ZGWA 1R1VA 3KEOA 1ZREA 1D0XA 1GHCA 2BZTA 3ASNH 2PN6A 5JHUA 4LLGF 3IKTA 1LEAA 1ACIA 2EJRA 4A5NA 2DXIA 2VQLA 4IZZA 4PGGA 3ONQA 2EFWA 4BNCA 4CCJA 4HQEA 2WAQN 4B09A 2VKEA 1YFHA 3K4CA 2MD5A 3IWZA 4R8HA 2WBMA 4ZDOA 2VJJA 2M45A 3FDYA 4IF4A 4N9HA 4BE2A 5FKLA 4LLNA 1LDDA 4TV7A 1X1AA 1KYZA 2ESNA 2CQ7A 2DMUA 4FX4A 2R92J 2HI3A 3VOEA 1O3RA 3BPXA 5LEJA 1GV2A 1WH7A 3DP7A 2DCEA 2LBFB 1OYWA 5F08A 1Y1VJ 3OS1A 2B0LA 4CCKA 3GCMA 3RPUD 3BR1A 1EH6A 3A0HC 3PQJA 3IL2A 2PEXA 2HU9A 1R49A 1MBGA 4OIRF 3DBHB 2OUMA 2KFDA 4NC8A 3TO7A 1WKMA 2DT6A 2JA5J 3X2QH 3HKZN 3B6AA 3OIQA 1OCPA 2P81A 3ZQCA 4XKBA 3FXRA 4B47A 2CW7A 3AG1H 5FFXA 1K83J 5F04A 2KDZA 2BXYA 3P9IA 4G7OF 4A6EA 1D1BA 1ZKGA 4HNUA 2E2JJ 2GQQA 3ZXSA 2L9RA 3Q9SA 3TO6A 2FOKA 3TDZC 1KA8A 3JRAA 3RZOJ 1BR2A 1G6NA 1HSJA 1X3ZB 2WB1N 3OYMA 5IYCJ 4BQOA 1A35A 2HKOA 3LA3A 5CQGA 3U1DA 2FRHA 2Y31A 2N8GA 2RVCA 2JA6J 5L3DA 2HVQA 3GTOJ 2NVYJ 4RM3A 4M74A 4A69C 1STZA 5B5EC 5DUIA 3J7AY 2QQBA 3FXUA 1FBSA 2Y9ZA 3S14J 1RZ4A 5K1YA 2LSOA 1R4MB 2PI0A 1U8RA 4BBSJ 1FOYA 1R00A 3Q0WA 4NHJA 1UG0A 1V4RA 5CLSA 4EEFG 4HDVA 1YRNA 2NRAC 3DTIA 2EA2A 1V54H 4JX5A 1G3YA 4L9JA 1MNEA 1YO5C 2E36A 1ZELA 3F8CA 5L3CA 1LDJA 4Q5SF 1Z05A 3K10A 4ANJA 3E6MA 4MFEA 3G71I 3J80K 4YIRX 2CMPA 4C2UA 1EH8A 3LSPA 2QA4I 2XASA 1RNLA 5HVQC 3PO3J 3SFZA 1IXRC 3SZGA 1ZHFA 3PFYA 2H8RA 2FD5A 2M7AA 1TQIA 2MA3A 5IYBJ 1QZZA 5L3FA 1LPQA 3ERED 4BXFA 3A0BC 4LITA 3BWGA 3LSMA 5EGOB 3IAM2 2BV6A 1VQLI 4M6VA 3H5AA 2WC2A 1A04A 1OJLA 4Z2YA 2G9WA 3MMYB 2P5LC 3BT9A 3CDIA 4KITB 3GTLJ 5TRDA 5LRRA 2EZIA 1R58A 3R4KA 5IOYA 4PDKA 2GXAA 1X3WB 1FT9A 3B02A 1JJ8C 2E60A 4BY7J 1T0FA 2ADUA 4OAZA 1U9NA 3E0JB 3HDDA 1VQOI 2K85A 2KDOA 3ABMH 1HF0A 3RCOA 1GVJA 3OR2C 3VFZA 4S04A 3HPGA 1FSHA 1OQYA 2IP2A 4PJJA 3OYGA 2DW4A 3CD6I 3L2RA 4AYBA 2ISZA 5DD4A 4A0YA 2R7TA 1E2XA 2M0MA 3S2WA 3RJPA 4XOTA 1FSEA 4BHCA 3OY9A 2K27A 1NHAA 4M9ZA 1HW2A 1G2HA 4ESJA 4B44A 3QQAA 3L2WA 5GPCA 4GRIA 1DGWY 1OCTC 2X6OA 1I39A 2OD5A 3CCVI 1ZGJA 2R5ZA 3FM3A 2O5RA 4A3FJ 3HOUJ 2VQCA 2DDBA 3CJQB 1FP2A 3VWBA 3A03A 1FPQA 2O9LA 2BBYA 2HQNA 1MH4A 3S2DJ 4RM2A 2LKPA 3QRFF 1RUNA 3FMQA 4G9YA 1ITYA 2IGOA 5GAEJ 1GLNA 3RYPA 5J47A 3JTHA 4MQ9F 3WODF 5D6FA 2V1UA 3WTUC 3TL4X 1JT6A 3VODA 2JTVA 3TKYA 4BJ6C 4DBQA 4BDZA 2Z33A 2LRDA 5BOXA 5KCMA 2Z1DA 4IRGA 2MH9A 1KU7A 2G7HA 1XD7A 3HOVJ 4M3BA 2QSFX 3FBNB 1VI0A 1J09A 2KIFA 2KRFA 3OSFA 5HLGA 3H1CA 3HIFA 1LDKB 4HZFA 2QKLB 5IP7J 1HLVA 2O3FA 1TL8A 1P7JA 1W4MA 4EM1A 4IKFA 1C0WA 4CICA 4IHVA 4D7MA 3I55I 2BOLA 1SEUA 4E7ZA 3JAMZ 4AM3A 1WWXA 2LP0A 1YITI 1HCRA 3GUDA 1XPXA 2L01A 2VT3A 4RAFA 2I5UA 4F52A 2DQRA 1G4DA 3ECOA 3GW2A 1ZG5A 1XC5A 1Z0XA 2F2EA 4DYRA 1YX5A 1Y8QB 3F6VA 2W7NA 2EFQA 2VT2A 2JVHA 1TP4A 1IUFA 2Y48A 1U9OA 1MJAA 4RGSA 1DPUA 5FKMA 5GTHC 5GADJ 3TBIA 1WCMJ 4J01A 4CYCA 1YRNB 4GDFA 3QP6A 3M8EA 2PFBA 2VUMJ 3HHGA 3K7AJ 2X4HA 3UKGA 1F5TA 2CQKA 1QVUA 4CZZA 3WTTC 2IXSA 1Z3XA 2LG4A 2QWWA 2CW8A 4XQFA 2EZKA 4GCVA 1ETYA 2A69F 1L0OC 1UZCA 2ZSHB 3QPHA 3WU0A 2CH0A 3DQVC 1P6RA 2ZSIB 3U1KA 5J8FA 4BQQA 1BIBA 5LGNA 2DMQA 2ECCA 2WV0A 5CVVA 2X6WA 1TTYA 1FMWA 1DP3A 3D5SC 3M1EA 2E7XA 4CH7A 1MBHA 2ELHA 4HRIA 3FK6A 1PUFB 4XORA 4ETSA 2XAHA 4HOBA 4NBQA 1H9TA 3EETA 4H0EA 3M4OJ 1KU2A 3WU2C 4OMZA 3J7AO 1OISA 1S7AA 1D5YA 1F1ZA 4BEHA 1J2XA 3CC2I 3WGGA 1K6YA 2B7EA 3LMMA 1EJ9A 1RKTA 3H0DA 1N75A 3H92A 4WF2A 4RAZA 3F8BA 3CCEI 1QNTA 5B1BH 3COAC 3M8JA 2Z16A 2WTEA 3QOPA 5LHGA 3BG7A 3NRVA 1MMDA 2OBPA 2QM3A 1A6IA 3HYIA 5FROA 5E1WA 2HYFA 2KIQA 2XC7A 2V9KA 2RAEA 4XNFA 3KEYA 2IS4A 2M4GA 4IQJA 1RPWA 2CO5A 2XGXA 3F72A 3WTZA 3WTVC 3KPHA 4H4KC 2BY0A 3GXOA 2XSDC 4CYDA 2M8EA 1IN7A 3IRQA 2JMWA 3F8MA 4PSWA 2GWRA 1S29A 3CUOA 2Y2ZA 5HS9A 2Q2EA 1LB2A 2R5ZB 5H6RA 1JKPC 4JX6A 2KLOA 1RC9A 2L9SA 4DNCA 2DFHA 2GIVA 4HPQA 4I02A 3WTXC 3N97A 2PQ8A 3FKJA 4ESBA 2XROA 3JSPA 2L3DA 1LKXA 1ON2A 2AXLA 2FQ3A 1B1BA 3K2AA 4A6DA 1WSUA 4L9NA 3K0LA 3I4PA 3ZN1A 5K5QA 1T2KA 2MG4A 2AS5F 3LFKA 2X1CA 5ILVA 4V19K 5IP6A 4U0YA 2A05A 3ZN0A 1F43A 5J40A 3KP5A 4ZJZA 3K4KA 2KT0A 2OCEA 3GMEA 3ZMDA 1A36A 1Z21A 1JE8A 2Q1ZB 3PO2J 3DXJF 1ZR2A 4R1HA 2E19A 4LG0A 1LFUP 2KKOA 3ESWB 3R0JA 1GDTA 1S72I 4II2A 2M3AA 5FRNA 1P2FA 4RS8A 2O7OA 3A1YA 4WXHA 4QTRA 4ZTJA 1X3UA 2CV0A 2BEOA 3TW6A 4YEJA 1U5TC 4FISA 4X6AJ 3A01A 3O6BB 3WE3A 1D5VA 3IH4A 2BY2A 3ZQFA 2V6CA 2XIGA 1IN6A 3ZQLA 2LMDA 4Y3OA 1T6SA 2OAZA 1Y56A 4Y4RA 4E70A 1LE8B 2LF7A 4CO8A 3CCRI 2F5DA 2LK2A 3L00A 1IXSB 4C3HJ 3J7YJ 4E7SA 5M5WJ 2E2IJ 3DKWA 4UVAA 1NTCA 2F5EA 1QGPA 4U7DA 2IT0A 3LAPA 4DBRA 2FF4A 2EZLA 2EILH 3H3ZA 1TT0A 3KIOA 1TWAJ 1ZK8A 1IN8A 5BQTA 2X6YA 1K6OA 1OCOH 4CYCB 2FMLA 2JVGA 5KVRA 1X19A 1Q1VA 2QENA 2GZWA 3HC7A 3OOUA 2QZ8A 1R5HA 3HTSB 5M3FJ 2NNNA 4QPOA 4M73A 5E1XA 1WH5A 4YIFA 4C30A 1MSFC 4MEXF 2M8GX 2W24A 1GV5A 2NVXJ 3G1LA 3RZDJ 3QPSA 4EVIA 4NC6A 2BHZA 3CMYA 3GTKJ 2O8KA 4XRFA 3GLLA 3EUAA 3CJRB 3PUBA 4ENNA 2E7WA 3L1PA 1FYLA 4M6XA 5IPAA 3GBGA 3CJTB 3OYCA 5AONA 4XLAA 2VASA 5D4RA 1SD5A 3LSKA 5JHFA 3V7RA 1MMSA 3KZYA 4L5IA 2X51A 1WFXA 2CJJA 3UR3C 4BEHB 1IDYA 4G6TB 5D5WB 2FNAA 1ZRCA 4A3IJ 2Y69H 3K1NA 1IC8A 1S5LC 3WE2A 4Y33A 3CO6C 4QLCU 1J75A 4BHBA 3LA2A 3KP6A 1TWHJ 4HEA2 2KQRA 3BCBA 4EJVA 1PP7U 2DBBA 2HPIA 3IHUA 2NAZA 2X1DA 4B1RA 2P0WA 2BY3A 2ZKZA 1L3LA 2A61A 3C2GA 5CKTA 2PLYA 1LEBA 3CCSI 4M3DA 3I4NJ 2YX4A 1I1GA 4KA4A 5JI6A 2IVMA 2VB6A 5FKNA 3SZPA 2HPMA 1W36C 2EBIA 3KP4A 3TQNA 1XB4A 1LFBA 2XRNA 2DMNA 1S9HA 1OFCX 1POGA 2OQRA 3WU1B 2XF5A 1JXSA 3ZQQA 2HQRA 4M3GA 4QSHA 4WK8F 3HHHA 1JHHA 3U21A 4BAYA 2R7UA 2Q2EB 3LWFA 2KJBA 4HNVA 5C4JJ 3BP8A 2VKVA 5EYRA 3FMRA 5IYDJ 5D5VB 2DK8A 2JPBA 2EV0A 4G6QA 1IN4A 1FY7A 2BYVE 3IKVA 1DP7P 2I8DA 2DA6A 4D9JA 5D5UB 1X1CA 3HTUA 2VI6A 1EF4A 3K4NA 4XRSA 2Z99A 2E35A 2Z9OA 2DPDA 1IW7F 1JKRC 3KP7A 1MDMB 3GFLA 4C3IJ 3BR2A 2F4IA 2D1HA 1Y0NA 2YS9A 2ELKA 4MNUA 4IOAF 1RUOA 3DKYA 4PGHA 2ECBA 3PL8A 2QQ8A 4RB2C 2R7SA 2QBYA 5ED4A 2F5FA 1HQCA 2IA0A 4UHTA 2DODA 2IEKA 3MAJA 2FA5A 2DMPA 3IUOA 4EM0B 2IJLA 4LG0B 5H20A 3FM5A 2MW8A 2LY1A 1UHMA 2A6EF 3K9TA 1IF1A 4NQWB 2M9HA 2DYRH 2VBZA 3PNTA 3RI4A 2QKMB 1FX7A 1BA5A 4FE7A 4EATA 1WJFA 3OYAA 1R22A 5CYVA 1XSVA 5DCFA 2F4OB 1HDDC 1X1DA 3BQZA 1W36D 2ZO4A 5H2FC 4ZYHA 4DQ2A 4UUTA 5E20A 3QWLA 4BE1A 5FLMJ 2DDAA 1BJAA 2NXNB 3CUQB 1VQPI 1K78A 5C4XJ 1JKQC 3V8KA 1HXDA 1HW5A 5F0HA 4E7JA 3G3ZA 2LTPA 2VL8A 4GYIA 5C3EJ 5HS7A 3KLNA 1ZRFA 6PAXA 3TOBA 3P5JA 3Q0UA 2PJPA 1PJRA 5BPIA 1BI1A 2L7KA 2XKPA 3E6DA 3M3YJ 1IRFA 4C9YA 1Z6RA 4EJOA 3G1MA 1PUEE 4BY1J 2K4JA 4X0GA 4JQFA 4A3BJ 1VQNI 3FK7A 3HEFA 4AIKA 1NH3A 2XUBA 4MEYF 4I2OA 3HM5A 1CGPA 1J7KA 3H3VK 2E1MB 4B8XA 4BJ5C 3FWEA 3FXKA 2EV6A 3OYFA 3CMEI 2PJRB 1K4SA 3BCAA 2R5YA 3ZQ7A 3GTGJ 3AFHA 3HOSA 1E3OC 5HNHA 4HX8A 2R3SA 1GXQA 4ASNA 3DLLF 3TP0A 1DUXC 2STWA 2CWEA 5KHDA 2L4AA 3SQNA 3OV8A 2K7LA 5DDGA 3KE2A 4UUVA 5H6QA 4ZH4F 4RGUA 5LHIA 2XAFA 4A3EJ 3L7WA 3T0YA 3S17J 2VXDA 1QHGA 1OPCA 3FMSA 3ERMA 1DQUA 3B6CA 2ISYA 4ZC3A 3FF5A 1FTZA 5CVJA 1QPMA 2B9SA 1I6XA 1YW7A 4PJNA 1F9NA 1ETXA 2CUFA 4P5OA 5A2QK 5K5OA 3V7CA 4P9UA 3QYEA 2ZMEC 3AL0B 2K02A 2O6GE 4HW0A 2V4JC 4YELA 5ICGA 1IG7A 2VPLA 2OA4A 2LY9A 1MZBA 2MC3A 2DOAA 1RR7A 1PP8F 1VQ7I 3CP2A 4WWCA 3H5NA 3DKXA 2Q8KA 1JGSA 2H8WA 2DOFA 2JRMA 3P9KA 4E4HA 2DLLA 2E71A 4NC7A 4BE0A 2CRGA 2GOXB 3CDLA 3ZPLA 3EUHC 4Z6YA 4A3GJ 3BJOA 3HGGA 1KQ9A 4KUMA 3I54A 1K79A 2DK5A 4HA8A 2ZJ2A 2VPRA 1RRJA 1DDNA 2HXOA 3TGNA 2L5QA 1XDUA 4R79A 5LLQA 1IV8A 1U3EM 3OYHA 1QVTA 1T98A 1EH7A 2QQAA 1H8AC 1PDNC 3J81K 3PM1A 2X1EA 1TWGJ 1HKQA 1NK3P 1QA6A 3DPUA 1U0JA 4XLFA 3VSLA 4IHYA 4M3FA 2K86A 4GGGA 5E1ZB 1KZHA 1B72A 3F6OA 3AG4H 3V8JA 1HKSA 1B6AA 1YLFA 5EDNA 4DW6A 1G3SA 1U5TA 2YSRA 3KX2A 3JTGA 2YU3A 5DD8A 2CQNA 3DF8A 5FRMA 3H36A 2QBYB 4GFBA 2RNGA 1I1SA 1WI3A 3I71A 2HOEA 4XKWA 3HUGA 1W7PA 5LBQA 2EA4A 4J00A 2H09A 1KONA 3Q5FA 1UHWA 5TISC 3QPLA 1HDPA 2BHYA 4FASD 2GBYA 1SANA 1YYVA 3HB9A 3S15J 1G3TA 5KAFC 3I56I 2DQLA 3D1NI 3D5RC 2FSWA 2DA2A 3JRFA 3ZCOA 3LNQA 5HLTA 1U6GA 4MHGA 3J80Z 2YX7A 3DEUA 4AYBN 2W4SA 2QCOA 1H89C 1YJ9I 3CCLI 5LGTA 1FLIA 4KT5C 1ZLKA 1XGNA 3C1DA 3HRMA 2DFFA 2CSOA 3SJMA 2WV1A 1Y1WJ 3F8NA 1K78B 4AIJA 3I0TA 5E79C 2HGCA 1TNTA 1YW9A 2HVSA 3CMAI 3F3XA 1YS7A 2FU4A 4XSXF 2UUZA 3QYBA 2P7VB 2DFIA 1ZR4A 4KNYA
chains in the Genus database with same CATH topology
4CUGA 3BLYA 2IGKA 3LSGA 4E7LA 4N4OB 4KJZA 4OWRB 2PJRA 1LFPA 1MNDA 4BEHA 4PK4A 3HG9A 1K6YA 2Y0SA 4P1WA 4KT6A 3LMMA 3H0DA 1N75A 1HA8A 2KRHA 4XONA 3DTEA 1E0EA 3M8JA 2IS2A 2Z16A 2WY8Q 3BG7A 3I3LA 5LD2C 1MMDA 5FROA 2XC7A 1UELB 2V9KA 3UNGC 4XNFA 1G8XA 3EUKL 4U87A 2LBFA 2KRCA 2XSJC 3CF2A 3KEYA 4RLQA 3RQ4A 2HDWA 2DJIA 2M4GA 4ZDPA 4IQJA 2IS4A 3DPTA 3DU6A 4H4KC 3CMMA 4HSRA 2DT7B 3CESA 2E5ZA 2MYSA 1D0YA 1WJAA 4PSWA 3CP8A 2UWMA 3S8PA 4XKCA 2HVRA 2E5NA 5HNFA 2KZVA 3S93A 2KLOA 4B3XA 3F9KA 2L9SA 4HPQA 4XKVA 1BR1A 1SAUA 3FKJA 2R7OA 3QYFA 3FHNA 4LIVA 1LKXA 2WAQA 4ZDLA 2X1CA 1X4OA 2A6TA 3L2QA 4XM3A 2VKHA 4ZJZA 3K4KA 3IP4B 2KMUA 3RTRA 2XF7A 1Z21A 2F5VA 3NWTA 2ELJA 2Q1ZB 2V1NA 4BDYA 2KHMA 2IS6A 1WJBA 2WAFA 4E7KA 1WJ5A 2KL4A 4E7IA 4II2A 2M3AA 5FRNA 4IQ4A 4ZTJA 4AU7A 3A1YA 3SYTA 3DPLC 3RSNA 2OC6A 3HKZA 2CV0A 4XOPA 4KISA 2MC4A 4YEJA 4XN3A 3OS0A 2CFOA 2LC2A 1FMVA 2XAUA 3OYEA 4NUBA 4Y3OA 4Y4RA 1WJEA 1Y56A 4BL0B 3OYJA 2OV7A 1R6RA 4HSTA 3PJRA 4FETA 3H9JA 2MFZA 4CCOA 4E7SA 1P9QC 2X6XA 2VJIA 2R7VA 1TZLA 3HUGB 4BS9A 2AQFA 2NOJB 3BG6A 4CSWA 4DBRA 2WB1A 2WY7Q 3HL2A 3OYLA 3K6GA 1G59A 2K3PA 1OLTA 3IAS2 3H5RA 3W3CA 1TT0A 4XN0A 1YE9A 2IGMA 2ZXIA 4BACA 2X6YA 3OS2A 2JVGA 3VSKA 1X19A 3ZR8X 3HC7A 3K4MA 3QODA 3LFUA 3OOUA 4JOMA 4QPOA 3E1SA 4BJTA 4PFPA 4C30A 2KP6A 2R7RA 4LIUA 2W00A 3HPHA 1OR7C 3ZGKA 3N05A 5KNLA 3S32A 1LVKA 4II3A 1N78A 2VJ4A 1WJCA 3NWSA 3EUAA 1DGRM 2E1MC 3CJRB 2WAEA 3PUBA 3OYDA 4B43A 3GBGA 3OYCA 1BOBA 1D0XA 2CV2A 4XLAA 2VASA 3C2HA 3W2VA 4HNTA 3LSKA 5JHFA 1MMNA 3LSIA 2X51A 3PSFA 2BW3A 1WFXA 3H9QA 3UR3C 4BEHB 2VQLA 4IZZA 2DXIA 3ONQA 4G6TB 4CCJA 3OYKA 4Y33A 4B48A 3K4CA 2ZFUA 3MKYB 2WBMA 4HEA2 4ZDOA 2VJJA 2KQRA 3BCBA 3FDYA 4BE2A 2V7FA 3S3NA 2HPIA 1X1AA 2X1DA 2P0WA 3C2GA 4LG3A 5CKTA 4C2TA 3OYNA 3V42A 3AL0C 2DCEA 2LBFB 4CCLA 3OS1A 2VB6A 4CCKA 3RPUD 2HPMA 2V6EA 1W36C 5LFAA 3SEZA 2JSPA 2HU9A 1S9HA 2OUMA 2W1OA 4NC8A 2DT6A 1Y6IA 2XF5A 3ZQQA 4RMNA 3OIQA 4PJMA 2R7UA 3U21A 4IX7A 2Q2EB 4XKBA 4B47A 2CW7A 1YX3A 2M7BA 2PMZA 2JUGA 1D0ZA 3QOEA 2CUJA 2I8DA 2R4GA 4D9JA 1X1CA 5TGTA 3K4NA 4DIQA 4PUSA 2KPMA 1D1BA 4HNUA 4BU2A 3ZXSA 2FUG2 1BR2A 2BVMA 4F93B 2F4IA 4U7BA 3OYMA 1AA7A 4BQOA 3A4CA 4DOZA 4AVZA 3DKYA 3PL8A 5CQGA 3S3MA 1ERDA 2R7SA 1QU3A 2UV1A 3M1CA 2VQHA 2HVQA 2L2OA 4BGDA 4RM3A 3J7AY 1D1CA 1WJDA 3IUOA 3MKWB 3K4LA 2VXZA 3VYUB 3MKZA 4CA0A 2LY1A 4NQWB 4OAYA 2VKDA 4F55A 4F91B 3PNTA 1UG0A 3SEQA 2QKMB 4F3QA 2M4KA 2VLAA 3DTIA 3K4BA 4RLFA 1MMGA 2WADA 3FBIB 3HXLA 4EATA 1MNEA 1WJFA 3OYAA 2IGNA 1ZELA 3EPZA 1X1DA 3LSHA 3K10A 4ZYAA 1W36D 4ANJA 2HQAA 2CV1A 4C2UA 2CMPA 4DJAA 3DLAA 2GOMA 3G2BA 4BE1A 2VQGA 1IRXA 4ZTFA 5HVQC 3HOTA 4XR6A 3SZGA 3PFYA 4E7JA 2M7AA 4XL9A 3OIPA 2VL8A 2R7QA 3DWLE 2IS1A 2LREA 3OL3A 4BXFA 1V5EA 3VYSB 4LITA 1PJRA 3LSMA 4F92B 3L2VA 3K70C 3W2AA 2L7KA 2L9NA 3IAM2 4MLOA 3H5AA 4C9YA 4BUPA 2ZXHA 3MD2A 3MMYB 3DEEA 4CCMA 3H35A 3I9V2 4KITB 4X0GA 4JQFA 2RREA 2E1MB 2E60A 2F6CA 4BJ5C 2PJRB 2XDVA 1MW7A 3OYFA 3BCAA 4OAZA 3E0JB 3AFHA 3HOSA 3OYBA 2KDOA 5HNHA 3RCOA 2BVLA 3OR2C 3HPGA 4XLCA 1SFKA 4PJJA 5KHDA 4HG2A 4NNJA 4YRVA 3OYGA 3L2RA 4AYBA 3VDXA 1T0FC 2R7TA 2M0MA 3PNVA 1UAAA 3OY9A 4XOTA 3H9GA 2RQQA 1VZ0A 2VXDA 1QHGA 4B44A 3KYLA 3L2WA 1DQUA 4ZC3A 2BW3B 1DGWY 4GRIA 1NG6A 1X1BA 4E7HA 2O5RA 4PJNA 4E6KG 4P5OA 2VQCA 3QYEA 3CJQB 3VWBA 3AL0B 2LH9A 3BC8A 3A2KA 4CZCA 2V4JC 2XF6A 4YELA 2VPLA 3K4JA 4RM2A 2CS3A 2DOAA 4ITVA 3CP2A 2IGOA 3H5NA 3DKXA 1GLNA 3PNYA 2VJ5A 4E4HA 4N4NB 2R7WA 3OMYA 3OR1C 4NC7A 4BE0A 2GOXB 4D1QA 2JA2A 2A5WA 3EUHC 1QHHD 3TL4X 2LOOA 5CQEA 3VYRB 2VIXA 2W82A 4XLEA 2MABA 1N77A 3K70D 4PJLA 4BJ6C 4QPQA 1BR4A 4DBQA 4BDZA 2L5QA 2LRDA 4R79A 5KCMA 2R7XA 2Z1DA 3OYHA 1JI8A 2Z2SB 1Z3YA 1V5GA 3FBNB 1J09A 2LY2A 2X1EA 1T95A 1LDKB 2QKLB 3DPUA 1U0JA 4XLFA 3SDBA 3VSLA 5HOOA 2K9MA 3AKZA 1D1AA 3OL4A 3OYIA 4IKFA 3LL7A 1EA3A 2BOLA 2CUZA 3PSIA 4PSXA 4XMYA 4E7ZA 3S3OA 3KX2A 4BQNA 5FRMA 4CCNA 4F52A 2V26A 1NG7A 2RNGA 3CZ6A 4XKWA 3TMOA 1YX5A 2W7NA 2LYCA 4J00A 1KONA 2JVHA 4FASD 2K5CA 4XLHA 3L2UA 2K9LA 3TBIA 4J01A 3W2WA 3D5RC 1Z7LA 3ZCOA 2IXSA 1Z3XA 2LG4A 2CW8A 4XQFA 3OWTA 5HLTA 3D5LA 2ZSHB 1PYVA 2W4SA 2CH0A 3DU5A 3DQVC 2ZSIB 3DTKA 4BQQA 2AQEA 2X6WA 4PFOA 3VYTB 2X85A 1FMWA 2WA0A 1X4PA 1DP3A 3D5SC 3ZRGA 1MMAA 2HZDA 2MD0A 4CH7A 4DGWB 2HVSA 4HRIA 1V5FA 4XORA 5CPRB 2HNHA 2UUZA 3QYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGW Y;  1DGR M; 
#chains in the Genus database with same CATH topology
 3E6B A;  4CUG A;  2H1L A;  4YG2 F;  4E7L A;  1QPI A;  3OSG A;  1TQP A;  1ZYR F;  3BZC A;  4PK4 A;  2BY1 A;  1UCR A;  4P1W A;  2W84 A;  3GTJ J;  1YOV B;  3N4M A;  1XSX A;  2ZB9 A;  4AWX B;  2FXA A;  1E0E A;  2M34 A;  2LVS A;  2FQ4 A;  2NS7 A;  3V4G A;  5LEK A;  3ABU A;  3ULQ B;  5LD2 C;  4EQQ A;  2RV8 A;  2OPT A;  1QO0 D;  2R5Y B;  2IW5 A;  1D3Y A;  1G8X A;  2M87 A;  3EUK L;  2FJ1 A;  3RQ4 A;  4RLQ A;  3ZMU A;  3S1M J;  2DJI A;  1W5T A;  1IJW C;  2ZJR F;  3S2H J;  3DPT A;  3DU6 A;  2DA7 A;  2W85 A;  1ZLJ A;  2CYY A;  2EV5 A;  1D8K A;  2L7F P;  2XVC A;  2MYS A;  1D0Y A;  1SD7 A;  5DCM A;  3T1B A;  2IPQ X;  3ROU A;  5HNF A;  1Z6T A;  1JTX A;  3IH3 A;  4B3X A;  2V79 A;  3F21 A;  1BW5 A;  4LMY A;  1SAU A;  1B9N A;  3WTW C;  2R7O A;  3QYF A;  3FHN A;  5FLX K;  1YQA A;  4B4C A;  4GXO A;  4I7H A;  3H3U A;  1TT5 B;  3GLX A;  4JBA A;  4ZDL A;  4L9T A;  2GXB A;  3DBL B;  2QSG X;  3FXQ A;  4AD9 A;  4DYC A;  2F4M B;  3CQZ J;  1PVE A;  4XM3 A;  5L3B A;  4HBL A;  2FBK A;  5D8K B;  1Z67 A;  2XF7 A;  2E2H J;  4BH9 A;  3Q9V A;  4IO9 F;  4D5F A;  1B8I A;  3AG3 H;  5F1R A;  2V1N A;  5D5X B;  2IS6 A;  5D8L B;  2DA5 A;  1YIJ I;  2KL4 A;  4IQ4 A;  3VEP A;  3SYT A;  2HTS A;  3RSN A;  2H6B A;  1YIO A;  4XOP A;  2E1N A;  2V9V A;  1IRZ A;  3KP2 A;  1LJ9 A;  4B3A A;  1B72 B;  4M9S A;  2YR2 A;  1HBX G;  5EG0 A;  5E3O A;  4ENJ A;  1XSD A;  1VQ8 I;  2J5O A;  1R6R A;  4HST A;  2TRT A;  3GFM A;  2EZH A;  3KP3 A;  4Q47 A;  4FET A;  1A5J A;  5TJJ A;  3RPU A;  5K5R A;  2MFZ A;  3HRT A;  3RIR A;  4OOI A;  4ON0 A;  2NYX A;  1TZL A;  2X0L A;  3HUG B;  4BS9 A;  1W7P B;  2NOJ B;  3BG6 A;  1O7L A;  2NS0 A;  4CSW A;  5JVT A;  5EZG A;  2P4W A;  3WG9 A;  3BJA A;  1R71 A;  2MLG A;  1G59 A;  3H5R A;  4HV6 A;  1TWF J;  1AKH A;  1WHU A;  4WXC A;  3HZJ A;  1YE9 A;  2ZXI A;  4BAC A;  3MFK A;  2EIM H;  1EKE A;  3KYC B;  3OS2 A;  1T39 A;  2E1O A;  4FX0 A;  3VSK A;  3ZR8 X;  2F48 A;  4HQM A;  1OR7 A;  2QF7 A;  3M07 A;  5F27 A;  3LQR A;  1GXP A;  3E1S A;  4BJT A;  3JRH A;  1X1P A;  3HSE A;  2KP6 A;  3O8G A;  2VC1 A;  4LIU A;  4BQA A;  2P8T A;  3ZGK A;  3N05 A;  1OCR H;  3S32 A;  1I3A A;  2X48 A;  3BZ6 A;  2EK5 A;  1LVK A;  4G8X A;  4Y15 A;  4II3 A;  2D45 A;  4Y7N J;  4LJZ F;  2XKO A;  4PJ0 C;  4DZP A;  1WJC A;  3NWS A;  1DGR M;  1R1U A;  4HLX A;  1BOB A;  5F64 A;  2RN7 A;  1MBK A;  5FO5 A;  5LHH A;  3NEU A;  3CC4 I;  2QYO A;  3W2V A;  4HNT A;  3PFI A;  5DM7 F;  2H6C A;  5CVU A;  3CCU I;  4Q48 A;  2FNP A;  2BW3 A;  3REO A;  2E1C A;  2EIN H;  1K7A A;  5KAI C;  4IHX A;  1R5I D;  4B48 A;  4HF0 A;  2DJN A;  4HDU A;  5IT9 K;  2DT5 A;  5ICC A;  3I58 A;  1FBQ A;  2M30 A;  4IHS A;  2HOT A;  4I0A A;  1F4K A;  3S3N A;  1BI0 A;  3V8L A;  1IAW A;  1FZP B;  1H0M A;  2ACJ A;  3JRG A;  1JHF A;  1J59 A;  4C2T A;  5HLH A;  3OYN A;  3JSO A;  2JK3 A;  3V42 A;  1OKR A;  4CCL A;  1EV7 A;  4AIH A;  2V6E A;  1MJB A;  2ZC2 A;  1SVL A;  5BNG A;  3EQL F;  1YJN I;  1HW1 A;  2VE9 A;  4Q4Z F;  4BHP A;  2XPW A;  2W1O A;  1JUS A;  2KZG A;  3ABL H;  5J1U A;  3CCM I;  1QZY A;  4I09 A;  5DCM B;  3FIS A;  1BJZ A;  5DYM A;  2F5C A;  3GFJ A;  3SFI A;  3WHC A;  1MBF A;  4ZYE A;  3BRO A;  3C7J A;  1FNN A;  1YX3 A;  2M7B A;  2PMZ A;  2JUG A;  3B73 A;  3FX3 A;  3D0S A;  3QOE A;  4KIG A;  4IRI A;  5E3M A;  2R4G A;  4LK0 F;  4EM2 A;  2V1X A;  1P7I A;  5J6X A;  4DIQ A;  2H94 A;  4ZYG A;  1X2M A;  3W6K B;  1BM9 A;  2MGQ A;  2FUG 2;  1Q1H A;  4IEJ A;  2BVM A;  3GF2 A;  4F93 B;  4U7B A;  1AA7 A;  3O8H A;  3A4C A;  4HX7 A;  4V2F A;  4I0B A;  4DOZ A;  4FE4 A;  3S3M A;  2C6Y A;  1SVO A;  1ERD A;  3F23 A;  2L7M P;  1QU3 A;  2L0K A;  3T8T A;  4AVP A;  4GYG A;  1ENH A;  4BGD A;  1VQ6 I;  1SD6 A;  4XK4 A;  1LVA A;  1VF9 A;  4N0B A;  5LGU A;  1B8I B;  1FOX A;  3K4L A;  2VXZ A;  1AWC A;  2GXG A;  4Y52 J;  4CA0 A;  1SAX A;  3I4M J;  3Q3S A;  5IY5 H;  1O3S A;  2Z5U A;  4OAY A;  9ANT A;  4P55 A;  1KU3 A;  4F55 A;  3SEQ A;  2VLA A;  2M4K A;  2EWN A;  3BG9 A;  4LGW A;  5FB2 A;  1MMG A;  2PMH A;  3FBI B;  4EJW A;  2PG4 A;  2IGN A;  3TW7 A;  3EPZ A;  5DEQ A;  4RGR A;  3KFW X;  2G7U A;  3I53 A;  5EG0 B;  1ETV A;  2RKH A;  1FIA A;  2FEZ A;  1I6H J;  3BR6 A;  1MBE A;  1TW2 A;  1B59 A;  4HF1 A;  3ASO H;  1S3J A;  2ZXJ A;  2HQA A;  1SMY F;  3FXL A;  2CV1 A;  3RKY A;  4DJA A;  3BTI A;  3DLA A;  1IO2 A;  4W1U A;  1TLH B;  2NVT J;  2VQG A;  1IRX A;  4ZTF A;  2XRL A;  3KZI C;  3NQO A;  3LA7 A;  4XR6 A;  1MSE C;  3I64 A;  2VE8 A;  3OIP A;  4A3L J;  1P4W A;  2A07 F;  4WXD A;  3OL3 A;  1AKH B;  4YFX F;  4HF2 A;  1V5E A;  5GAG J;  3KCC A;  2HKX A;  4OIN F;  1GUU A;  4KMF A;  2YUS A;  1ZGA A;  2JJ7 A;  2L9N A;  5FD6 A;  4JX4 A;  2ZJQ F;  1W1W E;  1F36 A;  4HV5 A;  4OMY A;  2UXN A;  3ABT A;  3I9V 2;  5EJC A;  2STT A;  1MNM C;  2VBX A;  5IP9 J;  1IUY A;  2LFB A;  2DPU A;  3CDH A;  4KIF A;  1R4N B;  1ETO A;  2F6C A;  1MW7 A;  4IPA A;  2JT1 A;  1BN5 A;  1Z9C A;  3HOZ J;  2MLK A;  4XLC A;  1SFK A;  2M1B A;  1YHQ I;  3GTQ J;  4JYK A;  5ILU A;  1A31 A;  1T0F C;  2P5K A;  1ZN2 A;  4Y13 A;  3PNV A;  1UAA A;  4DYQ A;  1H88 C;  2EH3 A;  3ML6 A;  3GX4 X;  3CLO A;  2ME0 A;  2BW3 B;  4HAM A;  1SC7 A;  4IHW A;  1NG6 A;  4FQG A;  3BR0 A;  1T38 A;  4D5C A;  3ECH A;  1MBJ A;  1ZQ3 P;  2HQ5 A;  2EFO A;  4E6K G;  5IOZ A;  4RBO A;  3A02 A;  4EMS A;  1CQT A;  1SD4 A;  2LH9 A;  4UB8 C;  3SZT A;  4CZC A;  2XF6 A;  1Z7U A;  2M0C A;  4L9V A;  1XMA A;  2GAU A;  2AO9 A;  3K4J A;  5KK1 A;  5J1R A;  2LKX A;  1OCZ H;  2CS3 A;  3QU6 A;  3JRB A;  4PZJ A;  1OCC H;  1USS A;  1JGG A;  4RGX A;  2VJ5 A;  4N4N B;  2IAI A;  3OMY A;  4D1Q A;  4OIQ F;  2JA2 A;  2A5W A;  1R7J A;  2DA3 A;  1AHD P;  5M5Y J;  3BG3 A;  5CQE A;  2OCC H;  3VYR B;  2O03 A;  2VIX A;  1QBJ A;  1O57 A;  1O4X A;  1Z77 A;  4PJL A;  2DTZ A;  4QPQ A;  1VQM I;  4O6J A;  3E6C C;  3ZOB A;  1JI8 A;  3MN2 A;  2XGE A;  1YJW I;  1R9T J;  1V5G A;  2MBF A;  1Y39 A;  3BDD A;  1WGX A;  1K4T A;  2L54 A;  1VQ4 I;  5JLX A;  1YG2 A;  3OL4 A;  4A2U A;  2P6T A;  2R7D A;  4MQV A;  1QZE A;  4S05 A;  1EA3 A;  4PSX A;  3PSI A;  2LLK A;  3RDI A;  2GA2 A;  1IRG A;  3S3O A;  2DN0 A;  4G7H F;  5GTI C;  4FHT A;  2NOG A;  2QLZ A;  3CC7 I;  4BQN A;  3LSR A;  4IXA A;  4CCN A;  5HS8 A;  2V26 A;  1NG7 A;  3K1M A;  3A01 B;  3OOP A;  2OF7 A;  3TMO A;  2LYC A;  3R61 A;  3IC7 A;  1VFC A;  2HOS A;  4CHU A;  4V2G A;  1U78 A;  2JWT A;  3QP5 A;  4XLH A;  2K9L A;  3DEW A;  3CO7 C;  2Y30 A;  1FP1 D;  1XGO A;  3FXJ A;  4UVB A;  1Z7L A;  1FYK A;  2CGP A;  4FCY A;  2O8X A;  1XCV A;  3C2B A;  2R0Q C;  2YU9 J;  2LDU A;  1KQ0 A;  1KYW A;  3HOY J;  2RQP A;  2JQ7 A;  1PYV A;  3JRE A;  3MZ8 A;  3DU5 A;  5DUK A;  2P6S A;  5E8I A;  2A3S A;  2AQE A;  2XAG A;  1ETQ A;  4LK1 F;  3S1Q J;  3MQ0 A;  4D7N A;  1UFM A;  4MIM A;  1T33 A;  1MMA A;  4UNO A;  2HZD A;  2ZNZ A;  4DGW B;  1LUJ B;  1V5F A;  2Y75 A;  2ZBK A;  4OU0 A;  2HOA A;  4OIP F;  5CPR B;  3KLO A;  2CG4 A;  1REP C;  1ZAR A;  5JVG F;  3BG5 A;  1NK2 P;  1VQ5 I;  2AHQ A;  3BOQ A;  5D4S A;  2PX9 A;  2LF8 A;  2LR8 A;  3BLY A;  3L2C A;  2IGK A;  1XTA A;  1XG1 A;  1WVR A;  1VQK I;  1V3F A;  2EIJ H;  3CCQ I;  4NB5 A;  3ZP5 A;  3HG9 A;  1XMX A;  2Y0S A;  4KT6 A;  3RYR A;  4AC0 A;  3NAU A;  2X9D A;  1T8I A;  4XON A;  3DTE A;  4ZZL A;  1IZ1 A;  4I99 C;  3KEQ A;  3I3L A;  1JKO C;  3FXO A;  1R5G A;  4A93 J;  2JSC A;  1RES A;  1ZG3 A;  3JRC A;  4AID A;  4UB6 C;  3CF2 A;  3T5X A;  4WX9 A;  4IHT A;  4M9X A;  1BI3 A;  1DU0 A;  4HSR A;  2DT7 B;  3CES A;  2PMU A;  2L02 A;  2FBI A;  2E5Z A;  1VND A;  5K7F A;  4YFK F;  5A2Q Z;  2DI3 A;  1UHS A;  3CLQ A;  1ON1 A;  2LD5 A;  2E5N A;  2EFP A;  2KZV A;  4RB3 C;  5CJ9 A;  3ZQG A;  2XPU A;  3RKQ A;  2KJC A;  2HWV A;  4XKV A;  1BR1 A;  4HYE A;  3W6J B;  4RB1 A;  4LD5 A;  5J4V A;  4BXX J;  4LIV A;  5HDG A;  2WAQ A;  3JW4 A;  1R23 A;  3ZMS A;  2CU7 A;  3OIO A;  2XB0 X;  1IV6 A;  1JJ6 C;  2TCT A;  2M2E A;  2HDD A;  3H0G J;  1X4O A;  2VKH A;  3KZZ A;  1BOA A;  3IP4 B;  4G7Z F;  2VBW A;  1XS9 A;  1TNS A;  2GM4 A;  2GLO A;  3NWT A;  1T08 B;  5J1Y A;  2VOO A;  4J19 A;  5D6E A;  3TED A;  2LNB A;  4UV9 A;  4BKX A;  3J81 Z;  1J5Y A;  5EEA A;  1JT0 A;  1WJB A;  2WAF A;  4E7K A;  1WJ5 A;  2FE3 A;  1BI2 A;  1MGT A;  1E17 A;  3I59 A;  1A6Q A;  1APL C;  5DV5 A;  3HKZ A;  3E5U A;  4A12 A;  4KIS A;  3GO5 A;  4XN3 A;  2CFO A;  2LC2 A;  2O61 A;  4A0Z A;  2CW0 F;  2EIK H;  3IWF A;  3T8R A;  1MD0 A;  2DA4 A;  1ZTR A;  4NUB A;  1WJE A;  4BL0 B;  2OV7 A;  5BS6 A;  2QVO A;  1D8J A;  4O3M A;  3PJR A;  2DAO A;  3H9J A;  1U8B A;  5ICE A;  1IGN A;  5E17 F;  4CCO A;  1KU9 A;  5GP9 A;  1B9M A;  2X6X A;  3HRU A;  4M6Y A;  2H27 A;  3BTC A;  3JRD A;  2WB1 A;  2WY7 Q;  3MKL A;  3K6G A;  1Y0U A;  5B3S H;  1UG2 A;  3IAS 2;  4JK1 X;  3PQK A;  3CUQ C;  2R7F A;  3ZMT A;  1XDS A;  5E18 F;  1S7O A;  2JA7 J;  3O2P E;  2K40 A;  1I3Q J;  5HLI A;  3PUF A;  3K4M A;  4XSZ F;  3KET A;  2QQ9 A;  1P92 A;  3ZQI A;  4YFN F;  5FJ8 J;  2CQX A;  2K9N A;  1BW6 A;  1TW3 A;  1PUF A;  2OTL I;  4IJA A;  3JCU C;  1HOM A;  1YI2 I;  2Z3Y A;  3MZY A;  1Y8R B;  1UB9 A;  3ZMV A;  3I5U A;  1N78 A;  4MGR A;  1ORK A;  2TDX A;  5CVI A;  2VJ4 A;  5DM6 F;  2JN6 A;  2E1M C;  3CCJ I;  1IDZ A;  3OYD A;  4B43 A;  2CV2 A;  3C2H A;  5B66 C;  3FIW A;  1MJ9 A;  1X2N A;  1J0R A;  1JUP A;  1MMN A;  1XX5 A;  3LSI A;  1TC3 C;  4M71 A;  3PSF A;  3H9Q A;  2EQR A;  4EJU A;  1FOW A;  5K7H A;  3ABK H;  4XID A;  3OYK A;  3GZ6 A;  3LQQ A;  4ENM A;  1RR8 C;  4NDL A;  1FIP A;  2Q0O A;  3ZMZ A;  4OIO F;  2D2W A;  2ZFU A;  3MKY B;  2NS8 A;  2QSH X;  4A3J J;  4G12 A;  2V7F A;  3EYI A;  5GAH J;  1ZAO A;  3BJ6 A;  4LG3 A;  2I10 A;  5J8C A;  3AL0 C;  5B1A H;  5LRS A;  2WWY A;  5LFA A;  2XB5 A;  4IRH A;  3SEZ A;  2JSP A;  3HSF A;  4IOC F;  3BR3 A;  4C3J J;  2BXZ A;  5ICF A;  1Y6I A;  3G73 A;  1HST A;  3MWM A;  2HYG D;  3F8F A;  4RMN A;  1J9I A;  4PJM A;  4IX7 A;  4P9F A;  1QRY A;  3HSR A;  1S6L A;  2MH2 A;  4WCG A;  3LAJ A;  4I6Z A;  4AUX A;  2RNJ A;  1DU6 A;  1FEX A;  2HFH A;  1D0Z A;  5FLX Z;  2CUJ A;  3E5X A;  1HC8 A;  2K4B A;  3S1R J;  3BZK A;  5TGT A;  1W0U A;  2OJE D;  2DO7 A;  1AOY A;  4PUS A;  2GA1 A;  2KPM A;  1K61 A;  4BU2 A;  5FGM A;  4P96 A;  3E7L A;  5EZH A;  4A3C J;  3GWZ A;  1M1E B;  2EPF A;  2ID3 A;  2K9Q A;  3CJN A;  1BC8 C;  4X1E A;  4ZZD A;  3IH2 A;  3VPR A;  4AVZ A;  3JAM K;  3L09 A;  1ZRD A;  4W97 A;  2UV1 A;  3M1C A;  2VQH A;  2DOE A;  2E34 A;  2L2O A;  2W48 A;  3TDU C;  2BE5 F;  1D1C A;  1WJD A;  3AAF A;  3MKW B;  3FHZ A;  4UXN A;  4I98 B;  1TQM A;  3VYU B;  1U5T B;  1P4A A;  3MKZ A;  4XIC A;  4A5M A;  3I59 B;  3M8F A;  1LE8 A;  2W25 A;  3BTL A;  3G1O A;  3EYY A;  3RQI A;  2VKD A;  4F91 B;  3LSJ A;  1BIA A;  2YPR A;  4HX4 A;  4XLN F;  4BYY A;  4F3Q A;  1MKM A;  4EGY A;  3RPQ A;  3K4B A;  2IRF G;  4RLF A;  2WAD A;  5F1J A;  3HXL A;  3BPV A;  1FBU A;  1G3W A;  3Q0V A;  2XV4 S;  1VQ9 I;  3LSH A;  3O3K A;  1U2W A;  4ZYA A;  1XGM A;  5BPD A;  3J7Z I;  2L9V A;  3BY6 A;  3WGI A;  2GOM A;  3G2B A;  5F6F A;  2Y0M A;  1AU7 A;  3HOT A;  3VB2 A;  1OMI A;  2RGV A;  3FKI J;  2L7Z A;  4XL9 A;  4G94 A;  3DWL E;  2R7Q A;  3GVA A;  2IS1 A;  2LRE A;  3HOW J;  3IV5 A;  2R93 J;  1OYY A;  1FWZ A;  1ETW A;  3M9A A;  3TOA A;  3VYS B;  1X58 A;  4GO1 A;  3S1N J;  1XCB A;  4F92 B;  3L2V A;  1RKW A;  3K70 C;  1W5S A;  2JZY A;  3W2A A;  4MLO A;  4UUS A;  2DMT A;  4BUP A;  2ZXH A;  3MD2 A;  3DEE A;  4XRS G;  1T56 A;  4CCM A;  3H35 A;  1WZ2 A;  4UY8 I;  3ZQH A;  1ZH5 A;  2JRT A;  5E3L A;  3GTP J;  4LLL A;  1MIJ A;  2RRE A;  3R60 A;  1SMT A;  2EB7 A;  1R36 A;  3TO9 A;  2H1K A;  2XDV A;  2GIZ A;  3QPT A;  1ETK A;  4RDU A;  3OYB A;  4LFU A;  1WRJ A;  2BVL A;  1I27 A;  4YRV A;  4HG2 A;  4KIC A;  4NNJ A;  2ID6 A;  5IT3 A;  3VDX A;  1RI7 A;  4D0P A;  3WTS C;  2LKS A;  3SXY A;  3H9G A;  2RQQ A;  2UZK A;  1VZ0 A;  2VBY A;  2PMZ N;  4DZJ A;  3KYL A;  4FTH A;  5L3E A;  2B63 J;  1X1B A;  2ZME A;  4ABZ A;  5IT9 Z;  1ODD A;  5E3N A;  4E7H A;  5J4Y A;  2KIU A;  1P4X A;  5FKO A;  2L4M A;  3F22 A;  4YII A;  4I76 A;  4U88 A;  3DBR B;  4CXF A;  1Z91 A;  5HDN A;  5EEG A;  4U0W A;  1GVD A;  3EDP A;  3BC8 A;  3A2K A;  4L0Z B;  2HYJ A;  3GYH X;  4PCQ A;  2OZU A;  3BR5 A;  3W6V A;  2JPC A;  3EUH A;  2NVU B;  4ITV A;  3SHF A;  3GFI A;  3PNY A;  1BL0 A;  1I5Z A;  2R7W A;  3OR1 C;  2CUE A;  1W0T A;  5JFR A;  2W57 A;  3HJE A;  2ESH A;  2K3F A;  1QHH D;  3RKX A;  3K69 A;  2LOO A;  2ICW G;  4C2M J;  2JUC A;  1SFU A;  2HDC A;  2CFX A;  1FC3 A;  2OQG A;  2W82 A;  4XLE A;  1SFE A;  2V9P A;  2MAB A;  1DPR A;  1N77 A;  3DFG A;  3K70 D;  4A3K J;  1BR4 A;  4CGZ A;  5EEH A;  3WGH A;  1MH3 A;  1E3P A;  3QAH A;  3QU3 A;  2R7X A;  3MEX A;  3DCF A;  4ZYD A;  1WQ2 A;  1FJL A;  2Z2S B;  3BTJ A;  4QIW N;  1MDM A;  1Z3Y A;  2AXT C;  2LY2 A;  1BC7 C;  1KGS A;  1T95 A;  3MZH A;  2COB A;  5HOO A;  1RET A;  3SDB A;  2K9M A;  3AKZ A;  1D1A A;  1YS6 A;  2OTJ I;  3P7N A;  3OYI A;  4KFC A;  3LL7 A;  5DTD A;  2P7C B;  2CUZ A;  2A68 F;  4XMY A;  5JLW A;  1ZG1 A;  1TWC J;  1ONV A;  1UJ8 A;  3K1P A;  4NQW A;  4M72 A;  3JR9 A;  3GZ5 A;  3CZ6 A;  3KYD B;  2ZFW A;  1E3H A;  2IBD A;  1IXC A;  3ISP A;  4KDP A;  1YTY A;  2ZCW A;  1GT0 C;  1O3T A;  2HS5 A;  1I50 J;  2K5C A;  3L2U A;  4K2E A;  2VC0 A;  3W2W A;  2EFN A;  1BBY A;  2FOW A;  3SDG A;  3PIP F;  1HKT A;  3CUQ A;  3OWT A;  3P9C A;  5FFZ A;  2O0Y A;  3D5L A;  2COM A;  1FYM A;  3DTK A;  2OU2 A;  3AG2 H;  4ESF A;  2G0E A;  3HBL A;  4PFO A;  1S8N A;  3VYT B;  2QEX I;  2X85 A;  3M7G A;  5AIQ A;  5F0F A;  2WA0 A;  1XGS A;  1X4P A;  3ZRG A;  1CF7 A;  1UST A;  5M5X J;  2MD0 A;  1LQ1 A;  3S16 J;  3WTY C;  4U0V A;  2HNH A;  2HEO A;  1O7F A;  5HDK A;  4G6D A;  1S7E A;  4JP0 A;  2ZXW H;  3LSG A;  4I01 A;  4N4O B;  4KJZ A;  4OWR B;  2Y9Y A;  4RA2 A;  1LFP A;  2J5P A;  1MND A;  1IN5 A;  4UUS B;  1O3Q A;  2PJR A;  1N25 A;  2HR3 A;  2JA8 J;  1R1T A;  1LNW A;  4A3D J;  5L3G A;  4Y17 A;  1HA8 A;  2KRH A;  1KQ8 A;  1SFO J;  4LB6 B;  2XGD A;  2IS2 A;  2WY8 Q;  5K7Z A;  1JUM A;  1SFX A;  4A0X A;  2PBI A;  4L5E A;  1UEL B;  3UNG C;  2KIS A;  2HTJ A;  1Z1D A;  3F0C A;  2HXI A;  4U87 A;  3C18 A;  4XBF A;  4A3M J;  2LBF A;  2KRC A;  2XSJ C;  3IRR A;  1V55 H;  2HDW A;  4ZDP A;  2KIM A;  2XAQ A;  5M3M J;  4KYW A;  3CMM A;  4RAG A;  3L9F A;  1W7P D;  4XRM A;  3ELK A;  1WJA A;  5FD5 A;  1H9G A;  1WI9 A;  2ZME B;  3HRS A;  3CP8 A;  2UWM A;  3S8P A;  3R6S A;  4XKC A;  2HVR A;  4QWQ A;  3DV8 A;  3NAR A;  3S93 A;  2NNY A;  4MTE A;  3F9K A;  3RKW A;  1B4A A;  5BMZ A;  2RDP A;  3FXM A;  5CVR A;  4F7Z A;  3GTM J;  5GPA A;  3PIO F;  4KN4 X;  2VOP A;  4LB5 A;  4KIB A;  2NVQ J;  2A6H F;  3MVP A;  2MSY A;  4L0Y B;  2XGC A;  2V1D A;  2ZJP F;  3CF5 F;  3C3W A;  2P5V A;  3E5Q A;  3G4S I;  2A6T A;  3L2Q A;  3V7S A;  3JRI A;  3U2R A;  2KMU A;  3RTR A;  1XN7 A;  1VTN C;  2F5V A;  3HGY A;  2A5Y B;  3LOC A;  4MO7 A;  2OZ6 A;  2XAJ A;  2ELJ A;  5C44 J;  4BDY A;  2KHM A;  1OYI A;  4E7I A;  1WPK A;  3U9G A;  2FMY A;  4EGZ A;  3GZN B;  2FBH A;  5J3L A;  1W5C C;  4AU7 A;  4UV8 A;  1RIO H;  2D5V A;  3DPL C;  3MCZ A;  2OC6 A;  2VN2 A;  1XMK A;  2FX0 A;  4L5J A;  2MC4 A;  4N9I A;  1QQI A;  2UXX A;  3OS0 A;  5DS9 A;  3TP3 A;  1FMV A;  4XLP F;  5HOD A;  4LOC A;  5EF6 A;  2VOD A;  2XAU A;  1TBX A;  3OYE A;  1FOK A;  2QUF A;  2K9S A;  3K2Z A;  2XPV A;  4L18 B;  1ULY A;  3CTA A;  4MFD A;  5ILS A;  4HLY A;  4KMU X;  3OYJ A;  3LST A;  2IA1 A;  4FT8 A;  1SVM A;  2DYS H;  4EJT A;  3HOX J;  1UMQ A;  4RB0 A;  4KN7 X;  2DTR A;  1P9Q C;  2VJI A;  4CDG A;  5FLV A;  2R7Z J;  4S0H B;  2R7V A;  2AQF A;  5ERI A;  4ENK A;  2D1V A;  2CQQ A;  2RC4 A;  2Y0S N;  3CCY A;  3BQY A;  5F0C A;  5JR3 A;  3OYL A;  3HL2 A;  4IVN A;  2K3P A;  4BXU A;  4MTD A;  1OLT A;  3W3C A;  2HZT A;  4XN0 A;  1JTY A;  2IGM A;  2M5W A;  3FZV A;  2QGU A;  3E97 A;  3R0A A;  2IA2 A;  4IL6 C;  5EGO A;  2DFE A;  3G6E I;  3QOD A;  4EV0 A;  3LFU A;  4JOM A;  2DA1 A;  2ETH A;  4PFP A;  2XHK A;  3GEZ A;  3WG7 H;  4BBR J;  2R7R A;  2W00 A;  3WHB A;  3HPH A;  5AIP A;  1OR7 C;  4O5V A;  5E8G A;  5KNL A;  2ME6 A;  4M3E A;  3E3V A;  2DU9 A;  4UVC A;  1YW8 A;  1FTT A;  1CF7 B;  4RAY A;  5FKK A;  2ZNY A;  2VON A;  2BGC A;  2WAE A;  1ZGW A;  1R1V A;  3KEO A;  1ZRE A;  1D0X A;  1GHC A;  2BZT A;  3ASN H;  2PN6 A;  5JHU A;  4LLG F;  3IKT A;  1LEA A;  1ACI A;  2EJR A;  4A5N A;  2DXI A;  2VQL A;  4IZZ A;  4PGG A;  3ONQ A;  2EFW A;  4BNC A;  4CCJ A;  4HQE A;  2WAQ N;  4B09 A;  2VKE A;  1YFH A;  3K4C A;  2MD5 A;  3IWZ A;  4R8H A;  2WBM A;  4ZDO A;  2VJJ A;  2M45 A;  3FDY A;  4IF4 A;  4N9H A;  4BE2 A;  5FKL A;  4LLN A;  1LDD A;  4TV7 A;  1X1A A;  1KYZ A;  2ESN A;  2CQ7 A;  2DMU A;  4FX4 A;  2R92 J;  2HI3 A;  3VOE A;  1O3R A;  3BPX A;  5LEJ A;  1GV2 A;  1WH7 A;  3DP7 A;  2DCE A;  2LBF B;  1OYW A;  5F08 A;  1Y1V J;  3OS1 A;  2B0L A;  4CCK A;  3GCM A;  3RPU D;  3BR1 A;  1EH6 A;  3A0H C;  3PQJ A;  3IL2 A;  2PEX A;  2HU9 A;  1R49 A;  1MBG A;  4OIR F;  3DBH B;  2OUM A;  2KFD A;  4NC8 A;  3TO7 A;  1WKM A;  2DT6 A;  2JA5 J;  3X2Q H;  3HKZ N;  3B6A A;  3OIQ A;  1OCP A;  2P81 A;  3ZQC A;  4XKB A;  3FXR A;  4B47 A;  2CW7 A;  3AG1 H;  5FFX A;  1K83 J;  5F04 A;  2KDZ A;  2BXY A;  3P9I A;  4G7O F;  4A6E A;  1D1B A;  1ZKG A;  4HNU A;  2E2J J;  2GQQ A;  3ZXS A;  2L9R A;  3Q9S A;  3TO6 A;  2FOK A;  3TDZ C;  1KA8 A;  3JRA A;  3RZO J;  1BR2 A;  1G6N A;  1HSJ A;  1X3Z B;  2WB1 N;  3OYM A;  5IYC J;  4BQO A;  1A35 A;  2HKO A;  3LA3 A;  5CQG A;  3U1D A;  2FRH A;  2Y31 A;  2N8G A;  2RVC A;  2JA6 J;  5L3D A;  2HVQ A;  3GTO J;  2NVY J;  4RM3 A;  4M74 A;  4A69 C;  1STZ A;  5B5E C;  5DUI A;  3J7A Y;  2QQB A;  3FXU A;  1FBS A;  2Y9Z A;  3S14 J;  1RZ4 A;  5K1Y A;  2LSO A;  1R4M B;  2PI0 A;  1U8R A;  4BBS J;  1FOY A;  1R00 A;  3Q0W A;  4NHJ A;  1UG0 A;  1V4R A;  5CLS A;  4EEF G;  4HDV A;  1YRN A;  2NRA C;  3DTI A;  2EA2 A;  1V54 H;  4JX5 A;  1G3Y A;  4L9J A;  1MNE A;  1YO5 C;  2E36 A;  1ZEL A;  3F8C A;  5L3C A;  1LDJ A;  4Q5S F;  1Z05 A;  3K10 A;  4ANJ A;  3E6M A;  4MFE A;  3G71 I;  3J80 K;  4YIR X;  2CMP A;  4C2U A;  1EH8 A;  3LSP A;  2QA4 I;  2XAS A;  1RNL A;  5HVQ C;  3PO3 J;  3SFZ A;  1IXR C;  3SZG A;  1ZHF A;  3PFY A;  2H8R A;  2FD5 A;  2M7A A;  1TQI A;  2MA3 A;  5IYB J;  1QZZ A;  5L3F A;  1LPQ A;  3ERE D;  4BXF A;  3A0B C;  4LIT A;  3BWG A;  3LSM A;  5EGO B;  3IAM 2;  2BV6 A;  1VQL I;  4M6V A;  3H5A A;  2WC2 A;  1A04 A;  1OJL A;  4Z2Y A;  2G9W A;  3MMY B;  2P5L C;  3BT9 A;  3CDI A;  4KIT B;  3GTL J;  5TRD A;  5LRR A;  2EZI A;  1R58 A;  3R4K A;  5IOY A;  4PDK A;  2GXA A;  1X3W B;  1FT9 A;  3B02 A;  1JJ8 C;  2E60 A;  4BY7 J;  1T0F A;  2ADU A;  4OAZ A;  1U9N A;  3E0J B;  3HDD A;  1VQO I;  2K85 A;  2KDO A;  3ABM H;  1HF0 A;  3RCO A;  1GVJ A;  3OR2 C;  3VFZ A;  4S04 A;  3HPG A;  1FSH A;  1OQY A;  2IP2 A;  4PJJ A;  3OYG A;  2DW4 A;  3CD6 I;  3L2R A;  4AYB A;  2ISZ A;  5DD4 A;  4A0Y A;  2R7T A;  1E2X A;  2M0M A;  3S2W A;  3RJP A;  4XOT A;  1FSE A;  4BHC A;  3OY9 A;  2K27 A;  1NHA A;  4M9Z A;  1HW2 A;  1G2H A;  4ESJ A;  4B44 A;  3QQA A;  3L2W A;  5GPC A;  4GRI A;  1DGW Y;  1OCT C;  2X6O A;  1I39 A;  2OD5 A;  3CCV I;  1ZGJ A;  2R5Z A;  3FM3 A;  2O5R A;  4A3F J;  3HOU J;  2VQC A;  2DDB A;  3CJQ B;  1FP2 A;  3VWB A;  3A03 A;  1FPQ A;  2O9L A;  2BBY A;  2HQN A;  1MH4 A;  3S2D J;  4RM2 A;  2LKP A;  3QRF F;  1RUN A;  3FMQ A;  4G9Y A;  1ITY A;  2IGO A;  5GAE J;  1GLN A;  3RYP A;  5J47 A;  3JTH A;  4MQ9 F;  3WOD F;  5D6F A;  2V1U A;  3WTU C;  3TL4 X;  1JT6 A;  3VOD A;  2JTV A;  3TKY A;  4BJ6 C;  4DBQ A;  4BDZ A;  2Z33 A;  2LRD A;  5BOX A;  5KCM A;  2Z1D A;  4IRG A;  2MH9 A;  1KU7 A;  2G7H A;  1XD7 A;  3HOV J;  4M3B A;  2QSF X;  3FBN B;  1VI0 A;  1J09 A;  2KIF A;  2KRF A;  3OSF A;  5HLG A;  3H1C A;  3HIF A;  1LDK B;  4HZF A;  2QKL B;  5IP7 J;  1HLV A;  2O3F A;  1TL8 A;  1P7J A;  1W4M A;  4EM1 A;  4IKF A;  1C0W A;  4CIC A;  4IHV A;  4D7M A;  3I55 I;  2BOL A;  1SEU A;  4E7Z A;  3JAM Z;  4AM3 A;  1WWX A;  2LP0 A;  1YIT I;  1HCR A;  3GUD A;  1XPX A;  2L01 A;  2VT3 A;  4RAF A;  2I5U A;  4F52 A;  2DQR A;  1G4D A;  3ECO A;  3GW2 A;  1ZG5 A;  1XC5 A;  1Z0X A;  2F2E A;  4DYR A;  1YX5 A;  1Y8Q B;  3F6V A;  2W7N A;  2EFQ A;  2VT2 A;  2JVH A;  1TP4 A;  1IUF A;  2Y48 A;  1U9O A;  1MJA A;  4RGS A;  1DPU A;  5FKM A;  5GTH C;  5GAD J;  3TBI A;  1WCM J;  4J01 A;  4CYC A;  1YRN B;  4GDF A;  3QP6 A;  3M8E A;  2PFB A;  2VUM J;  3HHG A;  3K7A J;  2X4H A;  3UKG A;  1F5T A;  2CQK A;  1QVU A;  4CZZ A;  3WTT C;  2IXS A;  1Z3X A;  2LG4 A;  2QWW A;  2CW8 A;  4XQF A;  2EZK A;  4GCV A;  1ETY A;  2A69 F;  1L0O C;  1UZC A;  2ZSH B;  3QPH A;  3WU0 A;  2CH0 A;  3DQV C;  1P6R A;  2ZSI B;  3U1K A;  5J8F A;  4BQQ A;  1BIB A;  5LGN A;  2DMQ A;  2ECC A;  2WV0 A;  5CVV A;  2X6W A;  1TTY A;  1FMW A;  1DP3 A;  3D5S C;  3M1E A;  2E7X A;  4CH7 A;  1MBH A;  2ELH A;  4HRI A;  3FK6 A;  1PUF B;  4XOR A;  4ETS A;  2XAH A;  4HOB A;  4NBQ A;  1H9T A;  3EET A;  4H0E A;  3M4O J;  1KU2 A;  3WU2 C;  4OMZ A;  3J7A O;  1OIS A;  1S7A A;  1D5Y A;  1F1Z A;  4BEH A;  1J2X A;  3CC2 I;  3WGG A;  1K6Y A;  2B7E A;  3LMM A;  1EJ9 A;  1RKT A;  3H0D A;  1N75 A;  3H92 A;  4WF2 A;  4RAZ A;  3F8B A;  3CCE I;  1QNT A;  5B1B H;  3COA C;  3M8J A;  2Z16 A;  2WTE A;  3QOP A;  5LHG A;  3BG7 A;  3NRV A;  1MMD A;  2OBP A;  2QM3 A;  1A6I A;  3HYI A;  5FRO A;  5E1W A;  2HYF A;  2KIQ A;  2XC7 A;  2V9K A;  2RAE A;  4XNF A;  3KEY A;  2IS4 A;  2M4G A;  4IQJ A;  1RPW A;  2CO5 A;  2XGX A;  3F72 A;  3WTZ A;  3WTV C;  3KPH A;  4H4K C;  2BY0 A;  3GXO A;  2XSD C;  4CYD A;  2M8E A;  1IN7 A;  3IRQ A;  2JMW A;  3F8M A;  4PSW A;  2GWR A;  1S29 A;  3CUO A;  2Y2Z A;  5HS9 A;  2Q2E A;  1LB2 A;  2R5Z B;  5H6R A;  1JKP C;  4JX6 A;  2KLO A;  1RC9 A;  2L9S A;  4DNC A;  2DFH A;  2GIV A;  4HPQ A;  4I02 A;  3WTX C;  3N97 A;  2PQ8 A;  3FKJ A;  4ESB A;  2XRO A;  3JSP A;  2L3D A;  1LKX A;  1ON2 A;  2AXL A;  2FQ3 A;  1B1B A;  3K2A A;  4A6D A;  1WSU A;  4L9N A;  3K0L A;  3I4P A;  3ZN1 A;  5K5Q A;  1T2K A;  2MG4 A;  2AS5 F;  3LFK A;  2X1C A;  5ILV A;  4V19 K;  5IP6 A;  4U0Y A;  2A05 A;  3ZN0 A;  1F43 A;  5J40 A;  3KP5 A;  4ZJZ A;  3K4K A;  2KT0 A;  2OCE A;  3GME A;  3ZMD A;  1A36 A;  1Z21 A;  1JE8 A;  2Q1Z B;  3PO2 J;  3DXJ F;  1ZR2 A;  4R1H A;  2E19 A;  4LG0 A;  1LFU P;  2KKO A;  3ESW B;  3R0J A;  1GDT A;  1S72 I;  4II2 A;  2M3A A;  5FRN A;  1P2F A;  4RS8 A;  2O7O A;  3A1Y A;  4WXH A;  4QTR A;  4ZTJ A;  1X3U A;  2CV0 A;  2BEO A;  3TW6 A;  4YEJ A;  1U5T C;  4FIS A;  4X6A J;  3A01 A;  3O6B B;  3WE3 A;  1D5V A;  3IH4 A;  2BY2 A;  3ZQF A;  2V6C A;  2XIG A;  1IN6 A;  3ZQL A;  2LMD A;  4Y3O A;  1T6S A;  2OAZ A;  1Y56 A;  4Y4R A;  4E70 A;  1LE8 B;  2LF7 A;  4CO8 A;  3CCR I;  2F5D A;  2LK2 A;  3L00 A;  1IXS B;  4C3H J;  3J7Y J;  4E7S A;  5M5W J;  2E2I J;  3DKW A;  4UVA A;  1NTC A;  2F5E A;  1QGP A;  4U7D A;  2IT0 A;  3LAP A;  4DBR A;  2FF4 A;  2EZL A;  2EIL H;  3H3Z A;  1TT0 A;  3KIO A;  1TWA J;  1ZK8 A;  1IN8 A;  5BQT A;  2X6Y A;  1K6O A;  1OCO H;  4CYC B;  2FML A;  2JVG A;  5KVR A;  1X19 A;  1Q1V A;  2QEN A;  2GZW A;  3HC7 A;  3OOU A;  2QZ8 A;  1R5H A;  3HTS B;  5M3F J;  2NNN A;  4QPO A;  4M73 A;  5E1X A;  1WH5 A;  4YIF A;  4C30 A;  1MSF C;  4MEX F;  2M8G X;  2W24 A;  1GV5 A;  2NVX J;  3G1L A;  3RZD J;  3QPS A;  4EVI A;  4NC6 A;  2BHZ A;  3CMY A;  3GTK J;  2O8K A;  4XRF A;  3GLL A;  3EUA A;  3CJR B;  3PUB A;  4ENN A;  2E7W A;  3L1P A;  1FYL A;  4M6X A;  5IPA A;  3GBG A;  3CJT B;  3OYC A;  5AON A;  4XLA A;  2VAS A;  5D4R A;  1SD5 A;  3LSK A;  5JHF A;  3V7R A;  1MMS A;  3KZY A;  4L5I A;  2X51 A;  1WFX A;  2CJJ A;  3UR3 C;  4BEH B;  1IDY A;  4G6T B;  5D5W B;  2FNA A;  1ZRC A;  4A3I J;  2Y69 H;  3K1N A;  1IC8 A;  1S5L C;  3WE2 A;  4Y33 A;  3CO6 C;  4QLC U;  1J75 A;  4BHB A;  3LA2 A;  3KP6 A;  1TWH J;  4HEA 2;  2KQR A;  3BCB A;  4EJV A;  1PP7 U;  2DBB A;  2HPI A;  3IHU A;  2NAZ A;  2X1D A;  4B1R A;  2P0W A;  2BY3 A;  2ZKZ A;  1L3L A;  2A61 A;  3C2G A;  5CKT A;  2PLY A;  1LEB A;  3CCS I;  4M3D A;  3I4N J;  2YX4 A;  1I1G A;  4KA4 A;  5JI6 A;  2IVM A;  2VB6 A;  5FKN A;  3SZP A;  2HPM A;  1W36 C;  2EBI A;  3KP4 A;  3TQN A;  1XB4 A;  1LFB A;  2XRN A;  2DMN A;  1S9H A;  1OFC X;  1POG A;  2OQR A;  3WU1 B;  2XF5 A;  1JXS A;  3ZQQ A;  2HQR A;  4M3G A;  4QSH A;  4WK8 F;  3HHH A;  1JHH A;  3U21 A;  4BAY A;  2R7U A;  2Q2E B;  3LWF A;  2KJB A;  4HNV A;  5C4J J;  3BP8 A;  2VKV A;  5EYR A;  3FMR A;  5IYD J;  5D5V B;  2DK8 A;  2JPB A;  2EV0 A;  4G6Q A;  1IN4 A;  1FY7 A;  2BYV E;  3IKV A;  1DP7 P;  2I8D A;  2DA6 A;  4D9J A;  5D5U B;  1X1C A;  3HTU A;  2VI6 A;  1EF4 A;  3K4N A;  4XRS A;  2Z99 A;  2E35 A;  2Z9O A;  2DPD A;  1IW7 F;  1JKR C;  3KP7 A;  1MDM B;  3GFL A;  4C3I J;  3BR2 A;  2F4I A;  2D1H A;  1Y0N A;  2YS9 A;  2ELK A;  4MNU A;  4IOA F;  1RUO A;  3DKY A;  4PGH A;  2ECB A;  3PL8 A;  2QQ8 A;  4RB2 C;  2R7S A;  2QBY A;  5ED4 A;  2F5F A;  1HQC A;  2IA0 A;  4UHT A;  2DOD A;  2IEK A;  3MAJ A;  2FA5 A;  2DMP A;  3IUO A;  4EM0 B;  2IJL A;  4LG0 B;  5H20 A;  3FM5 A;  2MW8 A;  2LY1 A;  1UHM A;  2A6E F;  3K9T A;  1IF1 A;  4NQW B;  2M9H A;  2DYR H;  2VBZ A;  3PNT A;  3RI4 A;  2QKM B;  1FX7 A;  1BA5 A;  4FE7 A;  4EAT A;  1WJF A;  3OYA A;  1R22 A;  5CYV A;  1XSV A;  5DCF A;  2F4O B;  1HDD C;  1X1D A;  3BQZ A;  1W36 D;  2ZO4 A;  5H2F C;  4ZYH A;  4DQ2 A;  4UUT A;  5E20 A;  3QWL A;  4BE1 A;  5FLM J;  2DDA A;  1BJA A;  2NXN B;  3CUQ B;  1VQP I;  1K78 A;  5C4X J;  1JKQ C;  3V8K A;  1HXD A;  1HW5 A;  5F0H A;  4E7J A;  3G3Z A;  2LTP A;  2VL8 A;  4GYI A;  5C3E J;  5HS7 A;  3KLN A;  1ZRF A;  6PAX A;  3TOB A;  3P5J A;  3Q0U A;  2PJP A;  1PJR A;  5BPI A;  1BI1 A;  2L7K A;  2XKP A;  3E6D A;  3M3Y J;  1IRF A;  4C9Y A;  1Z6R A;  4EJO A;  3G1M A;  1PUE E;  4BY1 J;  2K4J A;  4X0G A;  4JQF A;  4A3B J;  1VQN I;  3FK7 A;  3HEF A;  4AIK A;  1NH3 A;  2XUB A;  4MEY F;  4I2O A;  3HM5 A;  1CGP A;  1J7K A;  3H3V K;  2E1M B;  4B8X A;  4BJ5 C;  3FWE A;  3FXK A;  2EV6 A;  3OYF A;  3CME I;  2PJR B;  1K4S A;  3BCA A;  2R5Y A;  3ZQ7 A;  3GTG J;  3AFH A;  3HOS A;  1E3O C;  5HNH A;  4HX8 A;  2R3S A;  1GXQ A;  4ASN A;  3DLL F;  3TP0 A;  1DUX C;  2STW A;  2CWE A;  5KHD A;  2L4A A;  3SQN A;  3OV8 A;  2K7L A;  5DDG A;  3KE2 A;  4UUV A;  5H6Q A;  4ZH4 F;  4RGU A;  5LHI A;  2XAF A;  4A3E J;  3L7W A;  3T0Y A;  3S17 J;  2VXD A;  1QHG A;  1OPC A;  3FMS A;  3ERM A;  1DQU A;  3B6C A;  2ISY A;  4ZC3 A;  3FF5 A;  1FTZ A;  5CVJ A;  1QPM A;  2B9S A;  1I6X A;  1YW7 A;  4PJN A;  1F9N A;  1ETX A;  2CUF A;  4P5O A;  5A2Q K;  5K5O A;  3V7C A;  4P9U A;  3QYE A;  2ZME C;  3AL0 B;  2K02 A;  2O6G E;  4HW0 A;  2V4J C;  4YEL A;  5ICG A;  1IG7 A;  2VPL A;  2OA4 A;  2LY9 A;  1MZB A;  2MC3 A;  2DOA A;  1RR7 A;  1PP8 F;  1VQ7 I;  3CP2 A;  4WWC A;  3H5N A;  3DKX A;  2Q8K A;  1JGS A;  2H8W A;  2DOF A;  2JRM A;  3P9K A;  4E4H A;  2DLL A;  2E71 A;  4NC7 A;  4BE0 A;  2CRG A;  2GOX B;  3CDL A;  3ZPL A;  3EUH C;  4Z6Y A;  4A3G J;  3BJO A;  3HGG A;  1KQ9 A;  4KUM A;  3I54 A;  1K79 A;  2DK5 A;  4HA8 A;  2ZJ2 A;  2VPR A;  1RRJ A;  1DDN A;  2HXO A;  3TGN A;  2L5Q A;  1XDU A;  4R79 A;  5LLQ A;  1IV8 A;  1U3E M;  3OYH A;  1QVT A;  1T98 A;  1EH7 A;  2QQA A;  1H8A C;  1PDN C;  3J81 K;  3PM1 A;  2X1E A;  1TWG J;  1HKQ A;  1NK3 P;  1QA6 A;  3DPU A;  1U0J A;  4XLF A;  3VSL A;  4IHY A;  4M3F A;  2K86 A;  4GGG A;  5E1Z B;  1KZH A;  1B72 A;  3F6O A;  3AG4 H;  3V8J A;  1HKS A;  1B6A A;  1YLF A;  5EDN A;  4DW6 A;  1G3S A;  1U5T A;  2YSR A;  3KX2 A;  3JTG A;  2YU3 A;  5DD8 A;  2CQN A;  3DF8 A;  5FRM A;  3H36 A;  2QBY B;  4GFB A;  2RNG A;  1I1S A;  1WI3 A;  3I71 A;  2HOE A;  4XKW A;  3HUG A;  1W7P A;  5LBQ A;  2EA4 A;  4J00 A;  2H09 A;  1KON A;  3Q5F A;  1UHW A;  5TIS C;  3QPL A;  1HDP A;  2BHY A;  4FAS D;  2GBY A;  1SAN A;  1YYV A;  3HB9 A;  3S15 J;  1G3T A;  5KAF C;  3I56 I;  2DQL A;  3D1N I;  3D5R C;  2FSW A;  2DA2 A;  3JRF A;  3ZCO A;  3LNQ A;  5HLT A;  1U6G A;  4MHG A;  3J80 Z;  2YX7 A;  3DEU A;  4AYB N;  2W4S A;  2QCO A;  1H89 C;  1YJ9 I;  3CCL I;  5LGT A;  1FLI A;  4KT5 C;  1ZLK A;  1XGN A;  3C1D A;  3HRM A;  2DFF A;  2CSO A;  3SJM A;  2WV1 A;  1Y1W J;  3F8N A;  1K78 B;  4AIJ A;  3I0T A;  5E79 C;  2HGC A;  1TNT A;  1YW9 A;  2HVS A;  3CMA I;  3F3X A;  1YS7 A;  2FU4 A;  4XSX F;  2UUZ A;  3QYB A;  2P7V B;  2DFI A;  1ZR4 A;  4KNY A; 
#chains in the Genus database with same CATH homology
 4CUG A;  3BLY A;  2IGK A;  3LSG A;  4E7L A;  4N4O B;  4KJZ A;  4OWR B;  2PJR A;  1LFP A;  1MND A;  4BEH A;  4PK4 A;  3HG9 A;  1K6Y A;  2Y0S A;  4P1W A;  4KT6 A;  3LMM A;  3H0D A;  1N75 A;  1HA8 A;  2KRH A;  4XON A;  3DTE A;  1E0E A;  3M8J A;  2IS2 A;  2Z16 A;  2WY8 Q;  3BG7 A;  3I3L A;  5LD2 C;  1MMD A;  5FRO A;  2XC7 A;  1UEL B;  2V9K A;  3UNG C;  4XNF A;  1G8X A;  3EUK L;  4U87 A;  2LBF A;  2KRC A;  2XSJ C;  3CF2 A;  3KEY A;  4RLQ A;  3RQ4 A;  2HDW A;  2DJI A;  2M4G A;  4ZDP A;  4IQJ A;  2IS4 A;  3DPT A;  3DU6 A;  4H4K C;  3CMM A;  4HSR A;  2DT7 B;  3CES A;  2E5Z A;  2MYS A;  1D0Y A;  1WJA A;  4PSW A;  3CP8 A;  2UWM A;  3S8P A;  4XKC A;  2HVR A;  2E5N A;  5HNF A;  2KZV A;  3S93 A;  2KLO A;  4B3X A;  3F9K A;  2L9S A;  4HPQ A;  4XKV A;  1BR1 A;  1SAU A;  3FKJ A;  2R7O A;  3QYF A;  3FHN A;  4LIV A;  1LKX A;  2WAQ A;  4ZDL A;  2X1C A;  1X4O A;  2A6T A;  3L2Q A;  4XM3 A;  2VKH A;  4ZJZ A;  3K4K A;  3IP4 B;  2KMU A;  3RTR A;  2XF7 A;  1Z21 A;  2F5V A;  3NWT A;  2ELJ A;  2Q1Z B;  2V1N A;  4BDY A;  2KHM A;  2IS6 A;  1WJB A;  2WAF A;  4E7K A;  1WJ5 A;  2KL4 A;  4E7I A;  4II2 A;  2M3A A;  5FRN A;  4IQ4 A;  4ZTJ A;  4AU7 A;  3A1Y A;  3SYT A;  3DPL C;  3RSN A;  2OC6 A;  3HKZ A;  2CV0 A;  4XOP A;  4KIS A;  2MC4 A;  4YEJ A;  4XN3 A;  3OS0 A;  2CFO A;  2LC2 A;  1FMV A;  2XAU A;  3OYE A;  4NUB A;  4Y3O A;  4Y4R A;  1WJE A;  1Y56 A;  4BL0 B;  3OYJ A;  2OV7 A;  1R6R A;  4HST A;  3PJR A;  4FET A;  3H9J A;  2MFZ A;  4CCO A;  4E7S A;  1P9Q C;  2X6X A;  2VJI A;  2R7V A;  1TZL A;  3HUG B;  4BS9 A;  2AQF A;  2NOJ B;  3BG6 A;  4CSW A;  4DBR A;  2WB1 A;  2WY7 Q;  3HL2 A;  3OYL A;  3K6G A;  1G59 A;  2K3P A;  1OLT A;  3IAS 2;  3H5R A;  3W3C A;  1TT0 A;  4XN0 A;  1YE9 A;  2IGM A;  2ZXI A;  4BAC A;  2X6Y A;  3OS2 A;  2JVG A;  3VSK A;  1X19 A;  3ZR8 X;  3HC7 A;  3K4M A;  3QOD A;  3LFU A;  3OOU A;  4JOM A;  4QPO A;  3E1S A;  4BJT A;  4PFP A;  4C30 A;  2KP6 A;  2R7R A;  4LIU A;  2W00 A;  3HPH A;  1OR7 C;  3ZGK A;  3N05 A;  5KNL A;  3S32 A;  1LVK A;  4II3 A;  1N78 A;  2VJ4 A;  1WJC A;  3NWS A;  3EUA A;  1DGR M;  2E1M C;  3CJR B;  2WAE A;  3PUB A;  3OYD A;  4B43 A;  3GBG A;  3OYC A;  1BOB A;  1D0X A;  2CV2 A;  4XLA A;  2VAS A;  3C2H A;  3W2V A;  4HNT A;  3LSK A;  5JHF A;  1MMN A;  3LSI A;  2X51 A;  3PSF A;  2BW3 A;  1WFX A;  3H9Q A;  3UR3 C;  4BEH B;  2VQL A;  4IZZ A;  2DXI A;  3ONQ A;  4G6T B;  4CCJ A;  3OYK A;  4Y33 A;  4B48 A;  3K4C A;  2ZFU A;  3MKY B;  2WBM A;  4HEA 2;  4ZDO A;  2VJJ A;  2KQR A;  3BCB A;  3FDY A;  4BE2 A;  2V7F A;  3S3N A;  2HPI A;  1X1A A;  2X1D A;  2P0W A;  3C2G A;  4LG3 A;  5CKT A;  4C2T A;  3OYN A;  3V42 A;  3AL0 C;  2DCE A;  2LBF B;  4CCL A;  3OS1 A;  2VB6 A;  4CCK A;  3RPU D;  2HPM A;  2V6E A;  1W36 C;  5LFA A;  3SEZ A;  2JSP A;  2HU9 A;  1S9H A;  2OUM A;  2W1O A;  4NC8 A;  2DT6 A;  1Y6I A;  2XF5 A;  3ZQQ A;  4RMN A;  3OIQ A;  4PJM A;  2R7U A;  3U21 A;  4IX7 A;  2Q2E B;  4XKB A;  4B47 A;  2CW7 A;  1YX3 A;  2M7B A;  2PMZ A;  2JUG A;  1D0Z A;  3QOE A;  2CUJ A;  2I8D A;  2R4G A;  4D9J A;  1X1C A;  5TGT A;  3K4N A;  4DIQ A;  4PUS A;  2KPM A;  1D1B A;  4HNU A;  4BU2 A;  3ZXS A;  2FUG 2;  1BR2 A;  2BVM A;  4F93 B;  2F4I A;  4U7B A;  3OYM A;  1AA7 A;  4BQO A;  3A4C A;  4DOZ A;  4AVZ A;  3DKY A;  3PL8 A;  5CQG A;  3S3M A;  1ERD A;  2R7S A;  1QU3 A;  2UV1 A;  3M1C A;  2VQH A;  2HVQ A;  2L2O A;  4BGD A;  4RM3 A;  3J7A Y;  1D1C A;  1WJD A;  3IUO A;  3MKW B;  3K4L A;  2VXZ A;  3VYU B;  3MKZ A;  4CA0 A;  2LY1 A;  4NQW B;  4OAY A;  2VKD A;  4F55 A;  4F91 B;  3PNT A;  1UG0 A;  3SEQ A;  2QKM B;  4F3Q A;  2M4K A;  2VLA A;  3DTI A;  3K4B A;  4RLF A;  1MMG A;  2WAD A;  3FBI B;  3HXL A;  4EAT A;  1MNE A;  1WJF A;  3OYA A;  2IGN A;  1ZEL A;  3EPZ A;  1X1D A;  3LSH A;  3K10 A;  4ZYA A;  1W36 D;  4ANJ A;  2HQA A;  2CV1 A;  4C2U A;  2CMP A;  4DJA A;  3DLA A;  2GOM A;  3G2B A;  4BE1 A;  2VQG A;  1IRX A;  4ZTF A;  5HVQ C;  3HOT A;  4XR6 A;  3SZG A;  3PFY A;  4E7J A;  2M7A A;  4XL9 A;  3OIP A;  2VL8 A;  2R7Q A;  3DWL E;  2IS1 A;  2LRE A;  3OL3 A;  4BXF A;  1V5E A;  3VYS B;  4LIT A;  1PJR A;  3LSM A;  4F92 B;  3L2V A;  3K70 C;  3W2A A;  2L7K A;  2L9N A;  3IAM 2;  4MLO A;  3H5A A;  4C9Y A;  4BUP A;  2ZXH A;  3MD2 A;  3MMY B;  3DEE A;  4CCM A;  3H35 A;  3I9V 2;  4KIT B;  4X0G A;  4JQF A;  2RRE A;  2E1M B;  2E60 A;  2F6C A;  4BJ5 C;  2PJR B;  2XDV A;  1MW7 A;  3OYF A;  3BCA A;  4OAZ A;  3E0J B;  3AFH A;  3HOS A;  3OYB A;  2KDO A;  5HNH A;  3RCO A;  2BVL A;  3OR2 C;  3HPG A;  4XLC A;  1SFK A;  4PJJ A;  5KHD A;  4HG2 A;  4NNJ A;  4YRV A;  3OYG A;  3L2R A;  4AYB A;  3VDX A;  1T0F C;  2R7T A;  2M0M A;  3PNV A;  1UAA A;  3OY9 A;  4XOT A;  3H9G A;  2RQQ A;  1VZ0 A;  2VXD A;  1QHG A;  4B44 A;  3KYL A;  3L2W A;  1DQU A;  4ZC3 A;  2BW3 B;  1DGW Y;  4GRI A;  1NG6 A;  1X1B A;  4E7H A;  2O5R A;  4PJN A;  4E6K G;  4P5O A;  2VQC A;  3QYE A;  3CJQ B;  3VWB A;  3AL0 B;  2LH9 A;  3BC8 A;  3A2K A;  4CZC A;  2V4J C;  2XF6 A;  4YEL A;  2VPL A;  3K4J A;  4RM2 A;  2CS3 A;  2DOA A;  4ITV A;  3CP2 A;  2IGO A;  3H5N A;  3DKX A;  1GLN A;  3PNY A;  2VJ5 A;  4E4H A;  4N4N B;  2R7W A;  3OMY A;  3OR1 C;  4NC7 A;  4BE0 A;  2GOX B;  4D1Q A;  2JA2 A;  2A5W A;  3EUH C;  1QHH D;  3TL4 X;  2LOO A;  5CQE A;  3VYR B;  2VIX A;  2W82 A;  4XLE A;  2MAB A;  1N77 A;  3K70 D;  4PJL A;  4BJ6 C;  4QPQ A;  1BR4 A;  4DBQ A;  4BDZ A;  2L5Q A;  2LRD A;  4R79 A;  5KCM A;  2R7X A;  2Z1D A;  3OYH A;  1JI8 A;  2Z2S B;  1Z3Y A;  1V5G A;  3FBN B;  1J09 A;  2LY2 A;  2X1E A;  1T95 A;  1LDK B;  2QKL B;  3DPU A;  1U0J A;  4XLF A;  3SDB A;  3VSL A;  5HOO A;  2K9M A;  3AKZ A;  1D1A A;  3OL4 A;  3OYI A;  4IKF A;  3LL7 A;  1EA3 A;  2BOL A;  2CUZ A;  3PSI A;  4PSX A;  4XMY A;  4E7Z A;  3S3O A;  3KX2 A;  4BQN A;  5FRM A;  4CCN A;  4F52 A;  2V26 A;  1NG7 A;  2RNG A;  3CZ6 A;  4XKW A;  3TMO A;  1YX5 A;  2W7N A;  2LYC A;  4J00 A;  1KON A;  2JVH A;  4FAS D;  2K5C A;  4XLH A;  3L2U A;  2K9L A;  3TBI A;  4J01 A;  3W2W A;  3D5R C;  1Z7L A;  3ZCO A;  2IXS A;  1Z3X A;  2LG4 A;  2CW8 A;  4XQF A;  3OWT A;  5HLT A;  3D5L A;  2ZSH B;  1PYV A;  2W4S A;  2CH0 A;  3DU5 A;  3DQV C;  2ZSI B;  3DTK A;  4BQQ A;  2AQE A;  2X6W A;  4PFO A;  3VYT B;  2X85 A;  1FMW A;  2WA0 A;  1X4P A;  1DP3 A;  3D5S C;  3ZRG A;  1MMA A;  2HZD A;  2MD0 A;  4CH7 A;  4DGW B;  2HVS A;  4HRI A;  1V5F A;  4XOR A;  5CPR B;  2HNH A;  2UUZ A;  3QYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...