1DGWY

Structure of the rhombohedral crystal of canavalin from jack bean
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
92
structure length
92
Chain Sequence
QLRRYAATLSEGDIIVIPSSFPVALKAASDLNMVGIGVNAENNERNFLAGHKENVIRQIPRQVSDLTFPGSGEEVEELLENQKESYFVDGQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CANAVALIN
publication title X-ray diffraction and atomic force microscopy analysis of twinned crystals: rhombohedral canavalin.
pubmed doi rcsb
molecule tags Plant protein
total genus 8
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1999-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.840 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1dgwY01
1DGWY 1DGRM
chains in the Genus database with same CATH superfamily
4HLYA 3MQ0A 2IBDA 1LFPA 2IA2A 3KYLA 2DJIA 2RKHA 4XRFA 4HZFA 2XGEA 2RDPA 3LFKA 4M3BA 3TDUC 3PM1A 3Q0VA 1FMWA 3W2WA 2LK2A 1YFHA 2BW3A 3OYIA 3JRHA 1N78A 5ILSA 1FBSA 2ICWG 2YPRA 4RLFA 1WJBA 5KAIC 2QWWA 3J7YJ 1D1BA 4AIDA 4C3HJ 2QF7A 3JSOA 1HCRA 4KIGA 1IV6A 5CVJA 1SEUA 3FMSA 4XNFA 2ADUA 2GQQA 3KP7A 3S93A 2O0YA 4Y4RA 1ZRDA 2DDBA 2R7TA 4BBSJ 4ZJZA 2AQEA 3VPRA 3CMYA 3Q0WA 1D0ZA 1HSJA 5EEAA 2V26A 4XM3A 3GTGJ 3BG9A 5D6EA 1JGSA 1Z3YA 2ZMEB 3J7AY 1S7AA 4M3DA 4A3DJ 3RKWA 4JOMA 3HOXJ 4F91B 2EK5A 1FOKA 2K4JA 1LEAA 4HOBA 1IDZA 2K40A 4FASD 3SFZA 1IF1A 3ESWB 3ZMDA 3VEPA 5HS8A 1KU3A 2DA4A 2XF5A 2FX0A 3L2WA 1H0MA 2Y30A 3CUOA 3E6BA 2K9QA 4G7ZF 2DA3A 3PIPF 1AHDP 5E18F 1JXSA 1KGSA 3M8JA 2KT0A 3GVAA 1ZGJA 4HQEA 1LFBA 5CVUA 1ZAOA 1ZKGA 3BZKA 3JRCA 3KLOA 2CUJA 2VB6A 4A3GJ 2FQ3A 3OY9A 4FCYA 2P7CB 3LSGA 2CQXA 1YIOA 2BBYA 3ZRGA 2QUFA 1W7PD 2A6EF 4HV6A 1RI7A 2DA7A 4M9SA 3DEEA 3JRBA 2DAOA 3WTZA 4B3XA 1R23A 3S3MA 1MD0A 2NVUB 4CO8A 2EB7A 1YRNA 2V1UA 4BEHA 3DEWA 4WXCA 1D5VA 2PG4A 3ISPA 3OYKA 3I4PA 3HPHA 3LSJA 2ZBKA 3PJRA 1IXCA 2DA6A 1WH5A 2ID3A 1Y0NA 2GAUA 3K9TA 1X58A 1SFOJ 2QBYB 3QYBA 5E17F 1MDMB 1ITYA 4PJ0C 4X0GA 3KE2A 2HOSA 3HOUJ 1PYVA 1SD7A 3WODF 4YFXF 4CCNA 1FYKA 1TQMA 3CCMI 1B72A 4P9FA 3BZCA 5HODA 4RM2A 1MH3A 3M8FA 4PGHA 2XDVA 2R7UA 3KYDB 1TT5B 3HUGA 2JA5J 3D0SA 4XOTA 2AQFA 3VOEA 3HRTA 4NB5A 4G94A 5DV5A 3TO6A 3RTRA 1R22A 4LK0F 2Z3YA 4IRIA 2M8EA 2R7SA 3KYCB 4XLHA 3M7GA 3LSIA 5CVVA 5E3NA 3F0CA 2ZXIA 5DUIA 4FX4A 1VQLI 5K5OA 1EV7A 2FE3A 4U0WA 2NVTJ 4EM1A 4MQ9F 1SD4A 1HDDC 2NAZA 4NDLA 5EZHA 2FBHA 3TW7A 2IS6A 2CUZA 1TWGJ 3GMEA 2VKDA 4HQMA 2GOXB 2J5PA 2UV1A 1T0FA 3NRVA 1OR7C 4II2A 2FEZA 4KITB 5A2QK 1YIJI 4MNUA 3G2BA 3ZGKA 4HDUA 3HOVJ 2H1KA 1R1UA 3K0LA 3K2ZA 2EFWA 2Y9ZA 1SFUA 2ME0A 2XRNA 4E7JA 1PUFB 2GBYA 2E71A 1Z91A 2XSJC 1FP2A 3CDHA 4XIDA 3KZIC 2BVMA 2B7EA 3MCZA 2WY7Q 5H2FC 1JKPC 3PFYA 1K83J 4O3MA 1UHWA 3DQVC 3WTWC 1ZG1A 4AIJA 1I1SA 3CZ6A 1XG1A 1K61A 3HKZN 4RB3C 2M4KA 3M07A 2OTLI 3WU0A 2VUMJ 3OL3A 2ZMEA 2O8XA 4RGUA 4CZCA 2OZUA 1LUJB 2X6WA 1LEBA 3MFKA 1ETKA 3PIOF 3DKXA 5LHIA 1X2NA 3BOQA 4BH9A 3IWFA 4IHYA 5HNFA 4PFOA 3ZP5A 3LWFA 3DEUA 1XX5A 1YO5C 1GVJA 3G1LA 2XPWA 4DJAA 2Y0SA 5D6FA 3IWZA 4PUSA 1FTTA 2QVOA 4BHCA 3CTAA 1S8NA 4BQAA 4YIIA 3BR1A 1D0YA 2CG4A 2WAQN 3I59B 2W7NA 2GXBA 5FRNA 3CP8A 1JT6A 4M9ZA 3C7JA 4HNVA 2QLZA 2W1OA 4MHGA 5TRDA 4IQJA 3CJNA 5L3EA 1POGA 2QZ8A 3R0AA 2YX4A 1RUNA 2MFZA 2R5ZB 4LK1F 1RC9A 2ZO4A 3SEZA 3X2QH 1U9NA 4IZZA 1N77A 3E5QA 2A61A 4XSZF 3BTCA 2G7HA 3E5XA 1BR2A 3OIQA 3DU5A 4OIPF 1TNSA 1VQOI 3S1QJ 4G7HF 1WJCA 2QBYA 3H5AA 2P7VB 1E3PA 2IAIA 1W5SA 2DI3A 4F93B 3M4OJ 5HLTA 5D5WB 4KMUX 2VE8A 3QP6A 4V2GA 2JK3A 2CQQA 2IEKA 3OOPA 3HHHA 1QO0D 2K27A 2Z99A 1VQ4I 2DOFA 2KIQA 4M3EA 1X1DA 2FSWA 3OYJA 2JA2A 3AG2H 4IRHA 2P8TA 1R5GA 4BQQA 3SJMA 1J75A 2NS7A 4P1WA 2X48A 2UUZA 3Q3SA 1APLC 3FHZA 1T95A 3GCMA 1J7KA 3R4KA 5ILUA 1WJEA 4RGSA 2ZKZA 2TRTA 4KN4X 3GUDA 4KT5C 5FFZA 3IHUA 2XC7A 1VQKI 1JGGA 1UJ8A 2QQ9A 3SZGA 2DTZA 2K86A 4Y17A 3H5NA 3B73A 1S7OA 4LMYA 2RAEA 4GYIA 5CLSA 2V4JC 2E60A 4NUBA 5DCFA 2VBWA 3CF2A 5GAEJ 3S17J 5M5XJ 3F23A 4LG0A 4BJ6C 1SFXA 1Z1DA 4HF0A 1PUFA 4HPQA 3ZN1A 2JRTA 1FOWA 3K4MA 3GZNB 3LAJA 1UFMA 1QVTA 4CCLA 4P5OA 5F6FA 2EFPA 5HVQC 3G4SI 2WC2A 1EKEA 1CQTA 3DBLB 1GXPA 3QU6A 4PJLA 2EINH 3F72A 1QNTA 4A2UA 2Q8KA 1PP8F 1EH7A 1Y8RB 1TW3A 4MEXF 5M5WJ 2GOMA 3MMYB 2L5QA 2L3DA 2TCTA 1FY7A 1F36A 2VJJA 1DQUA 2VQLA 5FB2A 5FD6A 2PJPA 1XGNA 3ZCOA 1WHUA 4RBOA 3QYFA 3CESA 4HSTA 3GFMA 2PLYA 3C2HA 2EIKH 4ENJA 3FXKA 4I0AA 2LREA 1O57A 5C3EJ 3PSIA 5ICEA 4BXUA 1O3RA 1VQ8I 3DV8A 3I59A 1WPKA 5JVGF 3FXUA 2K85A 1IDYA 1IW7F 1RETA 4XKBA 4PJNA 1X2MA 3WTXC 5KCMA 3GTMJ 2FF4A 3ABTA 3UNGC 3JREA 2L54A 3A01B 5HS9A 3DKWA 2R5ZA 2YUSA 1UMQA 2JJ7A 1QVUA 3CF5F 4ENMA 1K6YA 2F6CA 1ERDA 1IRXA 1HOMA 1BW5A 1XMAA 1UHMA 3AG3H 2NNYA 3BTIA 4P9UA 1ZK8A 1K4TA 4BAYA 3BDDA 4WCGA 4G6TB 2K9LA 2ZJPF 4LOCA 2DT6A 2CO5A 2R4GA 5D4SA 3LAPA 1W36D 3OYCA 5FLXK 2ZB9A 2JPBA 3D5LA 3K70D 1K7AA 4ZZLA 4E7KA 4D1QA 3CCQI 5EG0A 1A04A 2Z2SB 3I5UA 3VYTB 5TGTA 3WHBA 2DT5A 2A5WA 1ETYA 3ABUA 2CRGA 2DFFA 5ICGA 2QKMB 1FBUA 1I50J 3L7WA 1OPCA 2NVYJ 1S72I 1MBEA 1QQIA 3D5RC 1JHFA 2AXTC 3CD6I 2ZC2A 2HQNA 4HYEA 2WB1N 1BI3A 3GTPJ 5E3LA 4BQNA 4XL9A 3IKVA 2HYJA 4YIFA 1Z0XA 3F8MA 4UUSB 3LMMA 4V2FA 2R7QA 2XPVA 3HTUA 3OR1C 3B6CA 4KIFA 3W6JB 4BS9A 3O8GA 2DU9A 1ZG5A 4C2TA 1P7JA 1DPRA 2R7OA 4RGXA 2E7XA 3MKYB 5IYBJ 2XIGA 4E7ZA 2LP0A 5HDNA 1XDSA 5JVTA 5HOOA 3RZOJ 3DU6A 1BIAA 4UB8C 2HPMA 4A6DA 4A0ZA 2L7KA 3CCSI 2Q0OA 1U5TC 4NQWA 1KYWA 3MD2A 3V4GA 5GAGJ 1P4WA 5K5QA 2NYXA 1HW2A 2LC2A 4DYRA 2CUFA 1BA5A 1X4PA 1TNTA 4A3MJ 3LOCA 5ICFA 4UNOA 2M4GA 2YU3A 5FLVA 2LF7A 2R5YB 5BS6A 2H6CA 5KHDA 2H1LA 1GV5A 1YE9A 5TISC 4I99C 2LH9A 4DZJA 2CV1A 2KRCA 4XR6A 3BJOA 2FOWA 2L4MA 3KP3A 3F8NA 2AO9A 3N05A 3GTJJ 2EA4A 1SD5A 4PJJA 3FX3A 3RYPA 4BKXA 4G7OF 3B6AA 1C0WA 1XN7A 1X3UA 4BE2A 4FETA 2JPCA 1LKXA 2LY9A 1Z9CA 4UVAA 1ETQA 1IXSB 5J4VA 3RI4A 3HG9A 1O3SA 2MH9A 3OYBA 1XGMA 1YX5A 4G9YA 1ZTRA 3VYUB 1YQAA 1BI2A 4D5CA 5B1AH 3KCCA 2ZNZA 3BZ6A 2BE5F 1O3TA 4A12A 1X1BA 2I8DA 2FU4A 4CDGA 2DOEA 1R4NB 2M8GX 2XHKA 1BOBA 3CCYA 4BXFA 3GTLJ 3G1MA 1TWCJ 1ZG3A 2XGDA 2LY1A 3W6KB 3DP7A 5FROA 2MABA 1XTAA 2O03A 1NG6A 1TT0A 2KHMA 1JUSA 1QBJA 3KEQA 5E79C 3ZXSA 4BUPA 2HZTA 1UELB 1OCCH 2BV6A 4XOPA 2LY2A 5E20A 3TEDA 1GVDA 4DOZA 1QZZA 2ECCA 3K4NA 2BXYA 4XLEA 4ZYDA 4BE0A 1JJ8C 3QPSA 1WQ2A 3F8BA 2QSFX 2LBFB 2K9MA 2XF7A 4JX6A 4LG3A 5L3CA 3CCVI 3KP4A 2G9WA 2QQAA 3OSFA 2CJJA 4WWCA 1T08B 2Z9OA 3JTHA 1JTXA 2MSYA 3M8EA 3UKGA 2CQKA 2DMTA 3KEOA 5EF6A 2R93J 1NK2P 1OCPA 4RMNA 5A2QZ 2COMA 2PMZA 1ORKA 3GLLA 1G4DA 1A31A 4HBLA 4ZYHA 2XROA 2D1HA 2ZCWA 3A03A 3BTJA 3RQIA 2XV4S 5F1JA 1B1BA 2EFNA 1GUUA 4UUSA 1Y1VJ 2UXNA 3PO3J 3FXJA 1HC8A 4QLCU 4RB0A 5J3LA 4C3JJ 5HLHA 3BJ6A 1OKRA 5F0HA 1TP4A 3D1NI 1S5LC 1ZYRF 1TWAJ 2EA2A 2DTRA 2X1CA 2D1VA 2W85A 5DD8A 4MTDA 4Q48A 2STTA 1HQCA 2EJRA 2Y31A 5GP9A 2OCCH 1R9TJ 3BQYA 2AS5F 3AL0C 5JLXA 1FX7A 1WKMA 1OYIA 1LPQA 4BEHB 3A1YA 2LVSA 3CJTB 4FHTA 4L5JA 2XAUA 1U3EM 3HGGA 1I6XA 2R7DA 4I7HA 2Q2EA 1G3TA 4D7MA 2R5YA 1MMAA 2RNJA 4BQOA 2F4MB 5ILVA 3DLLF 3BPVA 2OV7A 3BC8A 3WE2A 5IT3A 1SVMA 4PGGA 1GXQA 1S29A 2KKOA 2R7RA 2ESHA 1GV2A 3HEFA 4WX9A 3CMAI 1H8AC 3OS0A 2OD5A 2WV1A 2NOGA 2HZDA 4GYGA 1IRGA 1J5YA 4IXAA 1FYMA 3HOSA 3V7SA 3I4MJ 3HM5A 3LNQA 2V6CA 4B43A 2LLKA 3QRFF 3I9V2 5K7ZA 2PMHA 1NK3P 3C3WA 4DIQA 2IVMA 5L3GA 2PI0A 4E7HA 3GXOA 3LQRA 4CCKA 1ON1A 3L9FA 3NWTA 2JA6J 1OMIA 2W57A 5LEKA 1XGSA 3BR3A 3F8FA 3GTOJ 4M6YA 4RA2A 5F08A 4CCMA 3E1SA 2P0WA 2PMUA 2VXDA 4IJAA 1VQPI 2K9NA 3WU1B 4HG2A 1XSDA 5B5EC 3H9GA 2Y75A 2ZSIB 5J1UA 2COBA 5EZGA 3S14J 3OYEA 1HA8A 3V8LA 3VB2A 1IGNA 2CSOA 4XORA 3TW6A 1DU0A 2GXAA 2F5CA 4XONA 1XDUA 2VQCA 2K9SA 5H6QA 2XKOA 4AYBN 2ME6A 4A5NA 5DM6F 4Q47A 5D5VB 2DA1A 1VTNC 3GZ5A 2BGCA 3HBLA 4M72A 2GA1A 1OLTA 2CV2A 4M74A 4A3LJ 1YJWI 2CW8A 1R1VA 5BPIA 2CUEA 2IGOA 4L9TA 4ASNA 1HLVA 4PZJA 2MD0A 2A05A 2LBFA 4KYWA 3IH4A 2E1NA 2Y48A 1FT9A 1QA6A 4N9HA 3ZMZA 4ESJA 4ABZA 2X4HA 2QCOA 2XGCA 4HX8A 1VQ6I 4FX0A 5GTIC 4FISA 4OU0A 4BXXJ 1L0OC 2FBKA 1EA3A 2WADA 3FKJA 1F9NA 3JSPA 2VOPA 5L3DA 2E5ZA 5HDGA 1NHAA 1WZ2A 1Y0UA 1I27A 1YW9A 2BY0A 2FNAA 3K4KA 3BY6A 1T2KA 9ANTA 4IOCF 2W82A 2OBPA 5IOYA 4YFNF 1T38A 4X6AJ 5E8GA 3A4CA 3H5RA 4NBQA 2KIMA 3CC4I 2NNNA 2ZFWA 4KNYA 1SVOA 2CQNA 3EDPA 1HKTA 3RJPA 1FSHA 2M9HA 3JRGA 5HNHA 3VYSB 3L2VA 2V1DA 4FE7A 4XK4A 3BTLA 1P4AA 4XKVA 1M1EB 2Z5UA 1IN4A 3N97A 4OIOF 2O3FA 2IA0A 2A68F 3Q9SA 3WTSC 3K10A 2CV0A 1LDDA 5FFXA 4IL6C 3HSRA 3DPTA 3IP4B 4XKCA 3NAUA 1O7LA 2WAFA 3MVPA 2FOKA 1YOVB 4RB1A 3HXLA 4MO7A 4I98B 2FUG2 2EBIA 1WJAA 1V54H 3RKQA 4OMYA 1YS7A 1R36A 4EJVA 3ZQ7A 1P4XA 1MMGA 3I56I 2ETHA 1N75A 3CCRI 1R1TA 1VF9A 2F48A 3GEZA 3JRDA 2IS1A 1JUMA 3DXJF 2ZNYA 3AFHA 3CCUI 3A2KA 3S1RJ 2VQHA 1W36C 1A35A 4LFUA 3K4CA 3K70C 2D45A 1PUEE 1KQ8A 2IGMA 2D2WA 5FLXZ 3RPUD 3FK6A 2VJ5A 3ZN0A 4DQ2A 4EEFG 3F22A 2HKXA 4A3IJ 2HYFA 4KUMA 4HSRA 1BBYA 3TDZC 4U0VA 3H3VK 4D7NA 3RKYA 3GYHX 4BNCA 5FKNA 2VC0A 5LGUA 2P5LC 3K6GA 1J9IA 3VWBA 4A3CJ 3O6BB 4ZYGA 1CF7B 3PFIA 4L9NA 2DMNA 3L2CA 3HTSB 4N9IA 2ZXJA 2VJIA 2YSRA 3EYYA 2CWEA 3UR3C 4ESFA 2PJRB 4V19K 4XLAA 1WI3A 4LG0B 5CPRB 5CVRA 3ABLH 1QPMA 2M5WA 6PAXA 5FKMA 2L7ZA 2B9SA 1W0UA 1Z05A 2YU9J 3QAHA 2VC1A 1OR7A 4H4KC 1TWHJ 3HB9A 2DN0A 3FXOA 1N25A 4B8XA 5M3MJ 3EPZA 4CH7A 5L3FA 1Z6TA 3FXLA 4MQVA 2ZSHB 1X19A 1ON2A 1FSEA 2VT3A 4E70A 2ELJA 1JTYA 1B6AA 2ZJ2A 1IC8A 3BP8A 3J80K 1D1CA 2AXLA 3TKYA 4U7DA 1BW6A 2UXXA 4LIUA 3V7RA 4XRMA 4ZDOA 1PVEA 3MWMA 5LBQA 2QENA 3M3YJ 2Y2ZA 1SFEA 5J1YA 3LA7A 4TV7A 2GIZA 2RN7A 1DDNA 1MMDA 3HPGA 3BWGA 2Y0SN 4QWQA 2K5CA 4MLOA 3H36A 4PK4A 1BN5A 3ZQCA 5FGMA 4JX4A 3G73A 2JUGA 2OPTA 4BJ5C 4GXOA 3HKZA 5CYVA 5KVRA 2NRAC 3WG9A 1DP3A 3SHFA 2A07F 3K7AJ 2XB5A 3O3KA 2HQ5A 1F4KA 1MSEC 1BC8C 4F92B 2HR3A 1E3OC 5D8KB 2XAJA 3FMQA 2V1NA 4E7IA 1IN8A 4UV8A 2HFHA 5CQGA 1KU7A 1I3QJ 1LDJA 2N8GA 3OIPA 3G71I 5K5RA 1V55H 3WU2C 1GHCA 4AIKA 5AIPA 4PFPA 5IT9K 4Y13A 5C4XJ 3Q9VA 1USTA 2P81A 2WAQA 3GFLA 2HWVA 4A69C 2WY8Q 1AU7A 2MBFA 5C4JJ 3H92A 3ZQQA 1Y56A 3I55I 2HS5A 4KDPA 2CW7A 3FXRA 4CICA 5EG0B 3CLQA 2O61A 3IH3A 3BCBA 2DO7A 3CCEI 2OC6A 4M6XA 2CYYA 5EGOB 1UAAA 3RDIA 1KZHA 3VDXA 4WXDA 3FXQA 3MKZA 1NTCA 4A3FJ 2DPUA 3L2UA 1U0JA 2VKVA 5JR3A 3RKXA 2LYCA 4RLQA 3U1KA 1R7JA 5J4YA 2K3FA 1SMTA 2LKSA 2X85A 3BLYA 2EZIA 2KPMA 4EV0A 4OAZA 4BU2A 2BYVE 5D5UB 3ZR8X 5HLIA 1FTZA 4B48A 2JUCA 3GW2A 4RAZA 2P5KA 3KP5A 2W4SA 3JW4A 5DTDA 1CF7A 3WGHA 5EYRA 4IHTA 1VI0A 1RRJA 3E3VA 1T33A 1Z21A 2DFIA 2E2HJ 4Y33A 1ZLKA 3QOPA 3SFIA 1TC3C 1I39A 2HQAA 1MZBA 2NS8A 2L01A 4NQWB 4EATA 4GDFA 1Z7LA 2PJRA 1ZELA 4KT6A 2W84A 3NQOA 2XAFA 1JKOC 2KZVA 4ZTJA 3HGYA 1XD7A 1HW5A 1OJLA 3SEQA 4LLGF 4G12A 4NC8A 3S2WA 4F7ZA 2VLAA 5LHHA 1YHQI 3LQQA 4ZH4F 1TTYA 2LOOA 2M30A 3FK7A 2M0MA 2V6EA 3ZMUA 2QYOA 1U5TB 3EUKL 3EQLF 4RAFA 4LB5A 4OINF 4ETSA 2NVQJ 2CW0F 1OQYA 1B8IB 1J0RA 1B9MA 2IP2A 4QIWN 4A6EA 3QP5A 4I6ZA 1ZQ3P 3TP0A 4BYYA 3LL7A 1XMKA 1ZH5A 2CH0A 3O8HA 1AWCA 3KEYA 2KP6A 5D8LB 2F5DA 4EGZA 1MBHA 1LFUP 2GXGA 1W7PB 1USSA 2BY2A 3EUHC 2VL8A 1R71A 3COAC 2R7ZJ 4CCOA 1BM9A 1B9NA 1YLFA 3RQ4A 3ZQHA 5K7FA 1R4MB 1J59A 1LVAA 2FMLA 2RGVA 1WJ5A 1FIAA 2HOAA 4RM3A 1OCTC 3TP3A 3BG6A 4RAYA 3EUAA 2H8RA 4AVPA 5DYMA 2V9PA 4W97A 3ML6A 4AWXB 1X1PA 2HVRA 1BI0A 2CFXA 4CZZA 3J81K 1QZEA 3R0JA 1IN6A 2HU9A 3L00A 2EV6A 5HLGA 5C44J 4A0YA 3DPLC 3M9AA 3PL8A 2A3SA 2M7BA 2FQ4A 5B1BH 4EMSA 4HNUA 2V7FA 2HYGD 2D5VA 2RREA 1OCZH 5BQTA 1DGWY 1PP7U 2MLKA 5H20A 2OTJI 2FXAA 1X1AA 2P5VA 1JE8A 3MZYA 3LSTA 1YW8A 3T5XA 3R60A 5EGOA 1E3HA 5BPDA 1UCRA 1MMSA 1ZGWA 3AG4H 4N4NB 1S3JA 2FNPA 3DBRB 1XSVA 3HRMA 3KP6A 2HNHA 3K2AA 3L09A 3PUFA 3V8KA 2E2IJ 3NWSA 4CYCB 1T56A 2F5EA 2UZKA 4ZDPA 1VNDA 3PQJA 4IQ4A 2P4WA 4HF2A 2KL4A 2UWMA 5AONA 5GPAA 4L9JA 4L0YB 2XAGA 1F1ZA 4ZC3A 1OYYA 2MG4A 3V7CA 4EQQA 1HBXG 2LFBA 5IP7J 3ECOA 3FHNA 4XN0A 3MEXA 2XRLA 3E97A 1OYWA 5ICCA 4HNTA 2EH3A 3F6OA 2DJNA 2Y69H 2HOEA 2VBXA 1VQ7I 3A02A 1WCMJ 1ENHA 1E0EA 3OWTA 2QGUA 3J7ZI 1H9GA 1K79A 1F5TA 4B09A 3OIOA 2VT2A 1IUFA 1X3ZB 3LFUA 1YTYA 1FOXA 2Q2EB 1WVRA 3I64A 3GTKJ 2A5YB 3WG7H 1G3YA 2FRHA 3P9IA 2KISA 3OOUA 4BE1A 2HEOA 2BY3A 2L7FP 3P7NA 3AL0B 1U5TA 2JT1A 2MW8A 5DD4A 1MJBA 2L4AA 2OUMA 3G3ZA 4B1RA 3SZPA 3CO6C 4GRIA 3IRQA 3BT9A 2DOAA 3DBHB 3QQAA 5KNLA 1B8IA 3HJEA 3RYRA 2X6XA 5CKTA 2BVLA 4XLNF 1AKHB 4XRSG 2L9VA 4AVZA 3C2BA 1IXRC 1H89C 3N4MA 1IRFA 2KDZA 1SC7A 5GADJ 4E4HA 2R7WA 3CDIA 2CGPA 1ETOA 2MD5A 5J8CA 1W7PA 2R7FA 2XB0X 1O3QA 2M34A 5IP6A 2K4BA 5GPCA 5E3OA 3ZQGA 4A3JJ 3OYHA 4NNJA 3QPTA 4M3GA 1JKRC 1FOYA 2A6HF 2DYRH 1IN7A 2F2EA 2PBIA 1KA8A 2JSPA 5FD5A 1J2XA 1D1AA 2HDDA 4HDVA 3K4LA 3M1EA 4N0BA 5B66C 1RKWA 3JRIA 1REPC 1MBFA 3RSNA 5LHGA 3FWEA 4JQFA 3VODA 4E6KG 3BQZA 3KZZA 3FZVA 3TOAA 2Z33A 1XB4A 2MH2A 4YIRX 3DFGA 4M73A 1KONA 3P9KA 2W24A 2RC4A 4J01A 1WJDA 5M5YJ 3A0BC 1LQ1A 4HRIA 2ACJA 2QSHX 1WI9A 5E1WA 5F1RA 1MNMC 3BG3A 2NVXJ 1O7FA 4O5VA 2HVSA 3I71A 4EJOA 3FISA 2GZWA 2Y9YA 4NHJA 2OJED 4YRVA 3IKTA 3VYRB 4B3AA 2JA8J 1RKTA 2PX9A 1MBKA 4CYCA 3TMOA 3E6MA 3NARA 2WBMA 1V4RA 2MC4A 4WK8F 5KK1A 5CQEA 2G0EA 3WGGA 1CGPA 2XASA 2O6GE 5ERIA 2LNBA 2RNGA 3CDLA 1VQ9I 2E34A 2VKHA 1RNLA 1G3WA 5J47A 3CO7C 2PEXA 3E0JB 5FJ8J 1DGRM 1ODDA 2E1CA 1FC3A 2DFHA 2ZXHA 1D8KA 3J80Z 3KP2A 2HKOA 2H6BA 3V8JA 3WGIA 4NC7A 2ZJQF 1I3AA 4NC6A 3LSKA 1HKQA 2H94A 3LSMA 3MKLA 3A0HC 2M1BA 4S0HB 3JR9A 2B63J 2L02A 4C2MJ 1WJFA 3ZQIA 3CMMA 3P9CA 4XKWA 4P96A 3SQNA 3FDYA 4ENNA 2RQPA 4IPAA 1I5ZA 2K7LA 3CUQC 4O6JA 3T8TA 2LG4A 4YG2F 1BR4A 2W00A 1TW2A 2F5FA 4XRSA 1Z7UA 2LF8A 4IHSA 4RS8A 1W1WE 3ELKA 3H35A 2EILH 2EZHA 3IAS2 5EEGA 4DBRA 5J8FA 1Z77A 3OYLA 2IW5A 1AKHA 4PSXA 2ZJRF 2WA0A 1B59A 3ERMA 5FLMJ 4YEJA 1I1GA 1MSFC 1D0XA 3AAFA 2E7WA 3TBIA 1QPIA 5IT9Z 4B47A 2E1MC 4E7SA 2KZGA 4EM0B 3F21A 4BACA 4FE4A 1UHSA 2F4OB 2BHYA 1OISA 1X3WB 2K3PA 4AIHA 1FNNA 1FIPA 2KFDA 2KRHA 1FPQA 1LDKB 2GA2A 1XCVA 4DBQA 4EJWA 4RGRA 4AD9A 3LA3A 4IHVA 2KJBA 1HXDA 5KAFC 1SD6A 1MNDA 2EIMH 4HAMA 4Y7NJ 2DW4A 2ZXWH 3S3NA 1LJ9A 1YI2I 4A3EJ 4MGRA 4FTHA 4BY1J 5F04A 4D0PA 4A3KJ 1A36A 4UUVA 4HV5A 2E1OA 1UB9A 4Q5SF 3CJRB 3DCFA 2KIUA 3I54A 5H6RA 1I6HJ 3OSGA 5F27A 1PDNC 5DCMB 2CFOA 1QHGA 1Y39A 2BOLA 3OL4A 2IA1A 2TDXA 1WRJA 2XAQA 3I53A 4DNCA 4IHXA 4M71A 3PSFA 1WWXA 5D5XB 3FM3A 1BL0A 2ESNA 1GT0C 2VN2A 2VBZA 2XF6A 5LGTA 3CQZJ 2V1XA 4AYBA 3OS2A 1YX3A 1WH7A 2DDAA 4ESBA 3F6VA 4BJTA 3PNYA 3BROA 5IP9J 5JHUA 2NXNB 2O8KA 4GCVA 4E7LA 4JBAA 4IEJA 1K78B 1L3LA 1ONVA 1ZARA 1MJ9A 3ERED 1SANA 2QA4I 4IOAF 3F3XA 1RR7A 2A69F 4DZPA 3SXYA 1MH4A 4XQFA 2CMPA 5E1XA 2Y0MA 4UHTA 1U8RA 1D8JA 1ETVA 1HF0A 3WE3A 2M7AA 3BR0A 3FBIB 3ZQFA 1H88C 4UY8I 1A5JA 4RAGA 1QGPA 1R00A 3REOA 2BXZA 2X6OA 4CSWA 2VONA 2VE9A 1ZHFA 5LRRA 3HDDA 2KQRA 1EH6A 1TBXA 5JHFA 3DF8A 1P6RA 3FM5A 1HDPA 5TJJA 1QU3A 3OV8A 3R6SA 1NG7A 5JLWA 3GZ6A 1KQ9A 1HW1A 2Q1ZB 5F0CA 4OIRF 4I09A 1E17A 2VODA 2AHQA 2M87A 5LLQA 1V3FA 3TQNA 2IPQX 1IAWA 3BR6A 2OQGA 1Y1WJ 2L0KA 4ZZDA 4G8XA 3PO2J 3OYMA 2O7OA 3DPUA 4HEA2 5EDNA 2LSOA 1ZN2A 2IXSA 4F55A 4DW6A 3HOZJ 2Z1DA 3AG1H 2DCEA 4C30A 4R79A 4QSHA 1IN5A 3WHCA 3I4NJ 2CU7A 4F52A 3J81Z 3TOBA 3KPHA 3U9GA 3IRRA 2ECBA 3Q5FA 1AOYA 4AM3A 2P6SA 4Z6YA 2QEXI 3AKZA 1W5CC 2L9NA 3FXMA 1DP7P 3BJAA 4AU7A 4BDYA 4UVBA 4XMYA 4H0EA 4BBRJ 2XPUA 2X1EA 1YJNI 1S7EA 5J1RA 3L1PA 4CYDA 1FYLA 1G8XA 1ZGAA 5FKLA 3VFZA 1MIJA 2QSGX 3JAMK 4OMZA 1IUYA 4BGDA 2IRFG 4UUTA 2W48A 2MGQA 3BG5A 4LITA 1HSTA 2EWNA 1KQ0A 2LR8A 4XN3A 1LE8A 3BCAA 4EVIA 3FIWA 1RR8C 3HIFA 1Z67A 1MBJA 2IGNA 2EIJH 3HYIA 1QZYA 2JWTA 2XVCA 5K1YA 2DK8A 4D9JA 2JVGA 1T0FC 4B44A 4DGWB 2JA7J 1V5EA 3HOTA 4G6QA 5CJ9A 3GF2A 4UXNA 5DCMA 4FT8A 1P2FA 1R6RA 3PQKA 1YJ9I 1BR1A 4I76A 3V42A 3H0GJ 2I10A 2V9KA 4OAYA 4P55A 1GLNA 4EGYA 5JFRA 1J09A 3HOWJ 4HW0A 3L2RA 5DM7F 1XCBA 3WTTC 4W1UA 1A6QA 4AUXA 2X0LA 3K1NA 2VPRA 2LKPA 4CHUA 3DLAA 2DMUA 1XMXA 5DS9A 2HGCA 3EETA 5J6XA 3LSRA 3IL2A 2ELKA 1FP1D 1FWZA 1TQPA 3F9KA 2ZMEC 4WF2A 3ASNH 5LFAA 1Q1HA 2J5OA 3GWZA 2L2OA 2IJLA 3FKIJ 3GX4X 2JQ7A 2JTVA 1JI8A 1K78A 4HF1A 4J19A 2MC3A 1WSUA 2ELHA 4GO1A 1T8IA 1TL8A 2OA4A 2V9VA 4LGWA 4JX5A 4KA4A 1UG2A 5CVIA 2ISZA 2LKXA 3HOYJ 1XGOA 2F4IA 1U2WA 1Z6RA 4X1EA 1P7IA 4L0ZB 2L9RA 1FBQA 3U1DA 1MBGA 3CCJI 3O2PE 3S15J 3S8PA 2GIVA 2HXOA 3GTQJ 4XLCA 2ZFUA 3MZ8A 4KICA 3OYGA 2DQLA 2NS0A 3HZJA 1YS6A 2H8WA 4YELA 5FO5A 4UV9A 2VJ4A 1SMYF 4Y3OA 1IV8A 3TO7A 3VSKA 2YS9A 3QU3A 3D5SC 3E6CC 1MKMA 3HRUA 4JK1X 5E8IA 3HHGA 3QYEA 4Z2YA 4ENKA 4LD5A 4A0XA 2VPLA 2DYSH 2WV0A 4UB6C 4F3QA 1TLHB 3MZHA 3W3CA 3G6EI 3S1NJ 1BJAA 2KDOA 3DTKA 2EFOA 3W2VA 3S16J 1LB2A 4KIBA 1Y6IA 3KETA 2MA3A 3C1DA 1W0TA 4BL0B 1G2HA 1DU6A 3U21A 1SFKA 2EQRA 1UZCA 1MDMA 1ZR2A 4KFCA 3OYDA 2HQRA 2KMUA 3K1PA 1UG0A 2VQGA 3DTIA 3HRSA 2VOOA 3W6VA 3K4JA 1Z3XA 1VQ5I 3IH2A 3S3OA 2E19A 3CLOA 4IF4A 2FJ1A 2BEOA 5M3FJ 3S2DJ 2JMWA 3DKYA 3H9QA 4ON0A 3W2AA 2XAHA 4L9VA 4K2EA 4BHPA 5AIQA 2DMPA 1NH3A 4IO9F 3I0TA 1KU9A 4PSWA 4DYCA 1O4XA 4RDUA 2DQRA 3NEUA 2M45A 1QRYA 3H9JA 1IG7A 5IY5H 2MYSA 3LA2A 3U2RA 2E5NA 2X1DA 1VQNI 3SYTA 2Z16A 3I58A 3RZDJ 1PJRA 1U9OA 2X9DA 1KU2A 1D5YA 2G7UA 3KX2A 2M2EA 1R49A 1DUXC 3OYFA 4U88A 1JUPA 3ZMVA 5DUKA 3E5UA 2R0QC 1ZR4A 2R92J 4LLLA 3HC7A 3LSPA 2B0LA 4XLFA 3QPLA 5F0FA 2HTJA 1P92A 2R3SA 4OIQF 2PFBA 5HDKA 2BHZA 5B3SH 1RESA 2IS2A 4HX4A 4BY7J 4L18B 1FEXA 3GO5A 1BIBA 4J00A 1TZLA 2IGKA 3K1MA 2OAZA 4AC0A 4A3BJ 1RPWA 2M3AA 5EEHA 2OQRA 1EF4A 1MMNA 3FBNB 1H9TA 5GTHC 3ZQLA 1SAUA 1JHHA 2M0CA 4PJMA 1XS9A 5E3MA 2EZKA 1DPUA 3P5JA 3IAM2 4D5FA 4KMFA 1OCRH 1OCOH 3BG7A 4IX7A 1R58A 1P9QC 3EUHA 2IS4A 2YR2A 3S32A 2QM3A 3OYAA 4CCJA 2FMYA 3MAJA 2VBYA 2H09A 2OU2A 1R5ID 4KJZA 2QQBA 3TGNA 2WAEA 1QHHD 2L7MP 2PN6A 2RVCA 5L3BA 2XSDC 2OZ6A 3CMEI 2F5VA 2R7XA 3KLNA 4DYQA 2XUBA 2E35A 3WTVC 4U0YA 2LMDA 3FF5A 1ZREA 4EM2A 4LB6B 2WWYA 1IZ1A 1U8BA 2CS3A 4XBFA 2HPIA 1ETWA 2EZLA 4N4OB 3T1BA 3E6DA 2C6YA 4CUGA 4BHBA 4WXHA 3VSLA 1YYVA 1MGTA 1ZLJA 3ULQB 5F64A 1SAXA 3GFIA 2MLGA 4IRGA 1BC7C 1FLIA 2NOJB 3ABMH 4ZYEA 2E36A 2XKPA 2CQ7A 4GGGA 2HDCA 4QPOA 4OWRB 3OR2C 1YG2A 2X51A 4FQGA 1U78A 1IJWC 3ROUA 5BMZA 3DWLE 2DMQA 2WB1A 5FKKA 1ETXA 4IVNA 4OOIA 1EJ9A 1X4OA 3SDGA 5FRMA 2DBBA 5HS7A 1IRZA 4EJUA 1V5GA 3G1OA 5JI6A 2EV0A 4PCQA 4CXFA 1ACIA 4CGZA 1WFXA 2HOTA 4MTEA 3QWLA 1MJAA 2OCEA 2DA5A 5DDGA 5K7HA 1ULYA 1MNEA 3PNTA 1U6GA 1JKQC 3BR2A 1G3SA 1HKSA 3ZOBA 5LRSA 3WTYC 2IT0A 4JYKA 1RUOA 2X6YA 5FKOA 2DPDA 3T8RA 1OFCX 2EFQA 4A5MA 2EPFA 2W25A 1FJLA 3ASOH 3ZMSA 4EJTA 1MW7A 3CUQB 3PUBA 5J40A 2YX7A 3MKWB 1JT0A 3SZTA 5E1ZB 2O9LA 3K4BA 2LDUA 3ABKH 5IYCJ 2R7VA 1IO2A 2QQ8A 3ECHA 4ITVA 1A6IA 2KIFA 2FA5A 1B4AA 3EYIA 4B4CA 3TO9A 3CCLI 4ANJA 4G6DA 4S04A 4QTRA 3OYNA 2E1MB 2STWA 3I3LA 2HI3A 3C18A 1X1CA 4MFDA 5LGNA 2EV5A 2VIXA 4BDZA 3ONQA 2DK5A 2A6TA 3OS1A 1WGXA 1YW7A 4KISA 5IOZA 2H27A 2O5RA 1TQIA 1TWFJ 4M9XA 3CC2I 1Y8QB 3SDBA 1W5TA 1ZRFA 3IUOA 1LNWA 1G6NA 3KZYA 4A93J 1XSXA 4MFEA 3MN2A 3A01A 1E2XA 3JAMZ 3RPUA 2KRFA 1EH8A 2KLOA 2P6TA 3H3ZA 4II3A 3H1CA 2BW3B 4I01A 1D3YA 2DLLA 4XLPF 3BPXA 3F8CA 2QKLB 4L5IA 1W4MA 4HA8A 3GFJA 2GM4A 3J7AO 1FZPB 5BOXA 2JRMA 4U87A 3E7LA 2PMZN 3CP2A 4JP0A 3CC7I 1VQMI 1T98A 3QOEA 4C9YA 2LD5A 1R5HA 4U7BA 1S6LA 5EJCA 4ZDLA 3K69A 1T39A 3S1MJ 2VI6A 1YITI 3RCOA 4XICA 1JJ6C 4LIVA 3OMYA 1T6SA 2HVQA 3JRAA 2FBIA 2OF7A 4IHWA 5DEQA 3KFWX 4HLXA 2I5UA 3L2QA 4CA0A 3JTGA 3Q0UA 5BNGA 4I0BA 3H0DA 2HXIA 4YFKF 2DT7B 3RPQA 3GBGA 2DA2A 3GLXA 3QODA 2DXIA 5LD2C 4QPQA 1XPXA 4Y15A 4XSXF 2PQ8A 5GAHJ 2JSCA 2RQQA 1GDTA 2HDWA 3C2GA 4MEYF 1RIOH 4KN7X 1SVLA 3IC7A 3FMRA 3IV5A 1XC5A 2ID6A 4I2OA 2BY1A 2V79A 4C2UA 1VZ0A 3RIRA 2LRDA 2JZYA 2JVHA 2HTSA 2LTPA 3KIOA 3WTUC 3PNVA 3HSEA 5ED4A 5LEJA 1LVKA 3HSFA 4ZTFA 2BZTA 3JRFA 2GWRA 1FMVA 3CJQB 4PDKA 4R8HA 4GFBA 4Y52J 3H3UA 1YRNB 1STZA 1V5FA 1K6OA 3ZMTA 3R61A 3T0YA 3BR5A 2DFEA 2KJCA 2RV8A 1BJZA 4M3FA 5IPAA 3CUQA 4L5EA 4RB2C 4IKFA 2XGXA 1F43A 2VKEA 2VASA 1ZRCA 1VFCA 4ZYAA 5D4RA 4M6VA 4C3IJ 2E2JJ 1Q1VA 1S9HA 4HX7A 2L9SA 3S2HJ 3M1CA 5IYDJ 1B72B 2JN6A 4MIMA 1K4SA 2GLOA 2ISYA 3HL2A 1BOAA 4I02A 3ZPLA 3LSHA 3HUGB 4Q4ZF 1KYZA 2VXZA 1BI1A 2FD5A 3TL4X 1G59A 4UVCA 1AA7A 2K02A 3DTEA 4R1HA 1LE8B 3B02A 4LLNA 4S05A 1RZ4A 4LJZF 3QPHA 3JCUC 2WTEA 2DODA
chains in the Genus database with same CATH topology
2V9KA 4OAYA 1GLNA 1J09A 1LFPA 3HG9A 3L2RA 3KYLA 2DJIA 3LL7A 3OYBA 2CH0A 1YX5A 3KEYA 3VYUB 2KP6A 3DLAA 1FMWA 3W2WA 3F9KA 1X1BA 2BW3A 2I8DA 3OYIA 1N78A 5LFAA 4BXFA 1BOBA 2L2OA 3EUHC 2VL8A 4CCOA 4RLFA 3RQ4A 1WJBA 1JI8A 1D1BA 1WJ5A 2LY1A 4RM3A 3BG6A 5FROA 2MABA 4XNFA 3EUAA 1NG6A 1TT0A 3S93A 2KHMA 4Y4RA 3ZXSA 2R7TA 4BUPA 2AQEA 4ZJZA 2HVRA 1D0ZA 1UELB 2F4IA 4XOPA 2LY2A 2V26A 4DOZA 4XM3A 2HU9A 3K4NA 3S8PA 4XLEA 4BE0A 3DPLC 4XLCA 3PL8A 2M7BA 2ZFUA 1Z3YA 3J7AY 2LBFB 4HNUA 2K9MA 2V7FA 3OYGA 2XF7A 4JOMA 4LG3A 4F91B 2RREA 4YELA 1DGWY 2VJ4A 4FASD 4Y3OA 1X1AA 3VSKA 2XF5A 3L2WA 4RMNA 3D5SC 2PMZA 3QYEA 3M8JA 2VPLA 4N4NB 2HNHA 4F3QA 3NWSA 3W3CA 3DTKA 2KDOA 3W2VA 2CUJA 2VB6A 4ZDPA 3OY9A 3LSGA 3ZRGA 4IQ4A 1Y6IA 2KL4A 2UWMA 3DEEA 4B3XA 4BL0B 3S3MA 2X1CA 4ZC3A 3U21A 1SFKA 4BEHA 3OYDA 3OYKA 2KMUA 3HPHA 3PJRA 1UG0A 3AL0C 2VQGA 3DTIA 4XN0A 3FHNA 3K4JA 3QYBA 4BEHB 3A1YA 1Z3XA 4X0GA 4HNTA 1PYVA 3S3OA 2XAUA 4CCNA 3DKYA 1MMAA 3H9QA 4RM2A 4BQOA 1E0EA 3W2AA 3OWTA 2XDVA 2OV7A 3BC8A 3LFUA 2Q2EB 4PSWA 2R7RA 4XOTA 2AQFA 3OS0A 3OOUA 4BE1A 3RTRA 3AL0B 2HZDA 3H9JA 2OUMA 2R7SA 4XLHA 2MYSA 4GRIA 3LSIA 2E5NA 2DOAA 2X1DA 3HOSA 3SYTA 2Z16A 5KNLA 2ZXIA 1PJRA 2X6XA 5CKTA 2BVLA 4B43A 3I9V2 3KX2A 4AVZA 4DIQA 3OYFA 2R7UA 4E7HA 3HC7A 4CCKA 3NWTA 4E4HA 4XLFA 2R7WA 2IS6A 2CUZA 2VKDA 4CCMA 2GOXB 2UV1A 3E1SA 2P0WA 2VXDA 2IS2A 4KITB 1OR7C 4II2A 4HG2A 3H9GA 3G2BA 3ZGKA 2ZSIB 4J00A 1TZLA 2IGKA 3OYEA 3OYHA 1HA8A 2M3AA 4NNJA 1MMNA 3FBNB 4E7JA 4XORA 2JSPA 2XSJC 4XONA 2VQCA 1D1AA 2BVMA 2WY7Q 1SAUA 4PJMA 3K4LA 3PFYA 1OLTA 3DQVC 3RSNA 2CV2A 3CZ6A 3IAM2 4JQFA 4E6KG 2CW8A 2M4KA 2IGOA 3OL3A 2MD0A 3BG7A 2LBFA 4CZCA 4IX7A 1P9QC 2IS4A 3S32A 3OYAA 2X6WA 4CCJA 4KJZA 3DKXA 1KONA 1QHHD 2WAEA 5HNFA 4J01A 4PFOA 2R7XA 3FKJA 1EA3A 2F5VA 1WJDA 2WADA 4HRIA 2E5ZA 4DJAA 2Y0SA 4PUSA 2HVSA 3K4KA 4YRVA 2W82A 3VYRB 1D0YA 2W7NA 2CS3A 5FRNA 3CP8A 2HPIA 3TMOA 3A4CA 4N4OB 2W1OA 3H5RA 2WBMA 4IQJA 4CUGA 2MC4A 5CQEA 2MFZA 3VSLA 3SEZA 2RNGA 4IZZA 1N77A 2VKHA 5HNHA 3VYSB 3L2VA 1BR2A 3OIQA 3E0JB 4XKVA 3DU5A 2NOJB 1DGRM 2ZXHA 1WJCA 4QPOA 4OWRB 3OR2C 3H5AA 3K10A 2CV0A 2X51A 4F93B 3DPTA 3IP4B 4XKCA 4NC7A 5HLTA 2WAFA 3DWLE 3HXLA 2FUG2 1WJAA 2WB1A 3LSKA 3LSMA 1X4OA 5FRMA 1X1DA 1MMGA 1N75A 3OYJA 1V5GA 1WJFA 2JA2A 3CMMA 4XKWA 2IS1A 3FDYA 4BQQA 2LG4A 1BR4A 2W00A 4P1WA 1WFXA 3AFHA 3A2KA 2UUZA 1T95A 2VQHA 1W36C 3K4CA 3H35A 1WJEA 3IAS2 4DBRA 3K70C 1MNEA 2IGMA 3OYLA 3PNTA 4PSXA 2WA0A 3RPUD 2XC7A 2VJ5A 4YEJA 1D0XA 3TBIA 3SZGA 4B47A 2E1MC 2X6YA 4HSRA 4E7SA 3H5NA 4BACA 2V4JC 1MW7A 2E60A 3K6GA 3CF2A 3PUBA 4NUBA 3VWBA 2K3PA 3MKWB 3K4BA 4BJ6C 2KRHA 2R7VA 1LDKB 4HPQA 4DBQA 3K4MA 4ITVA 2VJIA 4CCLA 3UR3C 4P5OA 5HVQC 2PJRB 4XLAA 1MNDA 5CPRB 3S3NA 4ANJA 3OYNA 2E1MB 4PJLA 3I3LA 3CJRB 1X1CA 4H4KC 2VIXA 2GOMA 3MMYB 2L5QA 4BDZA 3ONQA 2CFOA 1QHGA 3EPZA 4CH7A 2A6TA 1DQUA 2VQLA 2VJJA 3OS1A 2BOLA 3OL4A 3ZCOA 4KISA 2ZSHB 1X19A 2O5RA 3QYFA 2ELJA 3CESA 4HSTA 3C2HA 1D1CA 3SDBA 3PSFA 4LIUA 4ZDOA 3IUOA 2LREA 3PSIA 2XF6A 4AYBA 3OS2A 1YX3A 1MMDA 3HPGA 2KLOA 4BJTA 4II3A 3PNYA 2K5CA 4MLOA 4PJNA 4XKBA 2BW3B 4PK4A 5KCMA 3UNGC 2JUGA 4BJ5C 2QKLB 3HKZA 4E7LA 1DP3A 4U87A 3CP2A 1K6YA 2F6CA 1ERDA 1IRXA 4F92B 3QOEA 4C9YA 2V1NA 4E7IA 4XQFA 4U7BA 2CMPA 5CQGA 4G6TB 2K9LA 4ZDLA 3OIPA 2M7AA 2DT6A 2R4GA 3FBIB 3RCOA 1W36D 4LIVA 3OYCA 3OMYA 2HVQA 3D5LA 4CSWA 3K70D 4E7KA 4D1QA 2Z2SB 4PFPA 2KQRA 3VYTB 5JHFA 5TGTA 3L2QA 2WAQA 1QU3A 2A5WA 4CA0A 1NG7A 2WY8Q 3H0DA 3ZQQA 1Y56A 2Q1ZB 2CW7A 2QKMB 2DT7B 3GBGA 3QODA 2DXIA 5LD2C 4QPQA 3BCBA 3D5RC 2OC6A 2RQQA 1UAAA 2HDWA 3C2GA 3OYMA 4HEA2 3DPUA 3VDXA 3MKZA 2IXSA 4F55A 4BQNA 4XL9A 2Z1DA 2DCEA 3L2UA 1U0JA 4C30A 4R79A 4C2UA 1VZ0A 3LMMA 2LRDA 2R7QA 3OR1C 2LYCA 2JVHA 4F52A 4BS9A 4RLQA 3PNVA 4C2TA 2R7OA 1LVKA 3MKYB 2X85A 4ZTFA 3AKZA 3BLYA 1FMVA 3CJQB 2KPMA 2L9NA 4E7ZA 4OAZA 4AU7A 4BU2A 4BDYA 4XMYA 3ZR8X 1V5FA 5HOOA 2X1EA 4B48A 3DU6A 2HPMA 4IKFA 2L7KA 1G8XA 2W4SA 3MD2A 2VASA 2LC2A 4ZYAA 1X4PA 1Z21A 4Y33A 1S9HA 2L9SA 4BGDA 2M4GA 2HQAA 3M1CA 4NQWB 4EATA 1Z7LA 2PJRA 1ZELA 4KT6A 4LITA 5KHDA 3HL2A 4XN3A 1YE9A 3BCAA 2KZVA 2LH9A 4ZTJA 2CV1A 2IGNA 3SEQA 2KRCA 3LSHA 4NC8A 4XR6A 3HUGB 2VLAA 4D9JA 2JVGA 1T0FC 2VXZA 2LOOA 3N05A 1V5EA 3TL4X 4B44A 4DGWB 1AA7A 2M0MA 4PJJA 3HOTA 1G59A 2V6EA 3DTEA 1R6RA 3EUKL 1BR1A 3V42A 4BE2A 4FETA 1LKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGW Y;  1DGR M; 
#chains in the Genus database with same CATH topology
 4HLY A;  3MQ0 A;  2IBD A;  1LFP A;  2IA2 A;  3KYL A;  2DJI A;  2RKH A;  4XRF A;  4HZF A;  2XGE A;  2RDP A;  3LFK A;  4M3B A;  3TDU C;  3PM1 A;  3Q0V A;  1FMW A;  3W2W A;  2LK2 A;  1YFH A;  2BW3 A;  3OYI A;  3JRH A;  1N78 A;  5ILS A;  1FBS A;  2ICW G;  2YPR A;  4RLF A;  1WJB A;  5KAI C;  2QWW A;  3J7Y J;  1D1B A;  4AID A;  4C3H J;  2QF7 A;  3JSO A;  1HCR A;  4KIG A;  1IV6 A;  5CVJ A;  1SEU A;  3FMS A;  4XNF A;  2ADU A;  2GQQ A;  3KP7 A;  3S93 A;  2O0Y A;  4Y4R A;  1ZRD A;  2DDB A;  2R7T A;  4BBS J;  4ZJZ A;  2AQE A;  3VPR A;  3CMY A;  3Q0W A;  1D0Z A;  1HSJ A;  5EEA A;  2V26 A;  4XM3 A;  3GTG J;  3BG9 A;  5D6E A;  1JGS A;  1Z3Y A;  2ZME B;  3J7A Y;  1S7A A;  4M3D A;  4A3D J;  3RKW A;  4JOM A;  3HOX J;  4F91 B;  2EK5 A;  1FOK A;  2K4J A;  1LEA A;  4HOB A;  1IDZ A;  2K40 A;  4FAS D;  3SFZ A;  1IF1 A;  3ESW B;  3ZMD A;  3VEP A;  5HS8 A;  1KU3 A;  2DA4 A;  2XF5 A;  2FX0 A;  3L2W A;  1H0M A;  2Y30 A;  3CUO A;  3E6B A;  2K9Q A;  4G7Z F;  2DA3 A;  3PIP F;  1AHD P;  5E18 F;  1JXS A;  1KGS A;  3M8J A;  2KT0 A;  3GVA A;  1ZGJ A;  4HQE A;  1LFB A;  5CVU A;  1ZAO A;  1ZKG A;  3BZK A;  3JRC A;  3KLO A;  2CUJ A;  2VB6 A;  4A3G J;  2FQ3 A;  3OY9 A;  4FCY A;  2P7C B;  3LSG A;  2CQX A;  1YIO A;  2BBY A;  3ZRG A;  2QUF A;  1W7P D;  2A6E F;  4HV6 A;  1RI7 A;  2DA7 A;  4M9S A;  3DEE A;  3JRB A;  2DAO A;  3WTZ A;  4B3X A;  1R23 A;  3S3M A;  1MD0 A;  2NVU B;  4CO8 A;  2EB7 A;  1YRN A;  2V1U A;  4BEH A;  3DEW A;  4WXC A;  1D5V A;  2PG4 A;  3ISP A;  3OYK A;  3I4P A;  3HPH A;  3LSJ A;  2ZBK A;  3PJR A;  1IXC A;  2DA6 A;  1WH5 A;  2ID3 A;  1Y0N A;  2GAU A;  3K9T A;  1X58 A;  1SFO J;  2QBY B;  3QYB A;  5E17 F;  1MDM B;  1ITY A;  4PJ0 C;  4X0G A;  3KE2 A;  2HOS A;  3HOU J;  1PYV A;  1SD7 A;  3WOD F;  4YFX F;  4CCN A;  1FYK A;  1TQM A;  3CCM I;  1B72 A;  4P9F A;  3BZC A;  5HOD A;  4RM2 A;  1MH3 A;  3M8F A;  4PGH A;  2XDV A;  2R7U A;  3KYD B;  1TT5 B;  3HUG A;  2JA5 J;  3D0S A;  4XOT A;  2AQF A;  3VOE A;  3HRT A;  4NB5 A;  4G94 A;  5DV5 A;  3TO6 A;  3RTR A;  1R22 A;  4LK0 F;  2Z3Y A;  4IRI A;  2M8E A;  2R7S A;  3KYC B;  4XLH A;  3M7G A;  3LSI A;  5CVV A;  5E3N A;  3F0C A;  2ZXI A;  5DUI A;  4FX4 A;  1VQL I;  5K5O A;  1EV7 A;  2FE3 A;  4U0W A;  2NVT J;  4EM1 A;  4MQ9 F;  1SD4 A;  1HDD C;  2NAZ A;  4NDL A;  5EZH A;  2FBH A;  3TW7 A;  2IS6 A;  2CUZ A;  1TWG J;  3GME A;  2VKD A;  4HQM A;  2GOX B;  2J5P A;  2UV1 A;  1T0F A;  3NRV A;  1OR7 C;  4II2 A;  2FEZ A;  4KIT B;  5A2Q K;  1YIJ I;  4MNU A;  3G2B A;  3ZGK A;  4HDU A;  3HOV J;  2H1K A;  1R1U A;  3K0L A;  3K2Z A;  2EFW A;  2Y9Z A;  1SFU A;  2ME0 A;  2XRN A;  4E7J A;  1PUF B;  2GBY A;  2E71 A;  1Z91 A;  2XSJ C;  1FP2 A;  3CDH A;  4XID A;  3KZI C;  2BVM A;  2B7E A;  3MCZ A;  2WY7 Q;  5H2F C;  1JKP C;  3PFY A;  1K83 J;  4O3M A;  1UHW A;  3DQV C;  3WTW C;  1ZG1 A;  4AIJ A;  1I1S A;  3CZ6 A;  1XG1 A;  1K61 A;  3HKZ N;  4RB3 C;  2M4K A;  3M07 A;  2OTL I;  3WU0 A;  2VUM J;  3OL3 A;  2ZME A;  2O8X A;  4RGU A;  4CZC A;  2OZU A;  1LUJ B;  2X6W A;  1LEB A;  3MFK A;  1ETK A;  3PIO F;  3DKX A;  5LHI A;  1X2N A;  3BOQ A;  4BH9 A;  3IWF A;  4IHY A;  5HNF A;  4PFO A;  3ZP5 A;  3LWF A;  3DEU A;  1XX5 A;  1YO5 C;  1GVJ A;  3G1L A;  2XPW A;  4DJA A;  2Y0S A;  5D6F A;  3IWZ A;  4PUS A;  1FTT A;  2QVO A;  4BHC A;  3CTA A;  1S8N A;  4BQA A;  4YII A;  3BR1 A;  1D0Y A;  2CG4 A;  2WAQ N;  3I59 B;  2W7N A;  2GXB A;  5FRN A;  3CP8 A;  1JT6 A;  4M9Z A;  3C7J A;  4HNV A;  2QLZ A;  2W1O A;  4MHG A;  5TRD A;  4IQJ A;  3CJN A;  5L3E A;  1POG A;  2QZ8 A;  3R0A A;  2YX4 A;  1RUN A;  2MFZ A;  2R5Z B;  4LK1 F;  1RC9 A;  2ZO4 A;  3SEZ A;  3X2Q H;  1U9N A;  4IZZ A;  1N77 A;  3E5Q A;  2A61 A;  4XSZ F;  3BTC A;  2G7H A;  3E5X A;  1BR2 A;  3OIQ A;  3DU5 A;  4OIP F;  1TNS A;  1VQO I;  3S1Q J;  4G7H F;  1WJC A;  2QBY A;  3H5A A;  2P7V B;  1E3P A;  2IAI A;  1W5S A;  2DI3 A;  4F93 B;  3M4O J;  5HLT A;  5D5W B;  4KMU X;  2VE8 A;  3QP6 A;  4V2G A;  2JK3 A;  2CQQ A;  2IEK A;  3OOP A;  3HHH A;  1QO0 D;  2K27 A;  2Z99 A;  1VQ4 I;  2DOF A;  2KIQ A;  4M3E A;  1X1D A;  2FSW A;  3OYJ A;  2JA2 A;  3AG2 H;  4IRH A;  2P8T A;  1R5G A;  4BQQ A;  3SJM A;  1J75 A;  2NS7 A;  4P1W A;  2X48 A;  2UUZ A;  3Q3S A;  1APL C;  3FHZ A;  1T95 A;  3GCM A;  1J7K A;  3R4K A;  5ILU A;  1WJE A;  4RGS A;  2ZKZ A;  2TRT A;  4KN4 X;  3GUD A;  4KT5 C;  5FFZ A;  3IHU A;  2XC7 A;  1VQK I;  1JGG A;  1UJ8 A;  2QQ9 A;  3SZG A;  2DTZ A;  2K86 A;  4Y17 A;  3H5N A;  3B73 A;  1S7O A;  4LMY A;  2RAE A;  4GYI A;  5CLS A;  2V4J C;  2E60 A;  4NUB A;  5DCF A;  2VBW A;  3CF2 A;  5GAE J;  3S17 J;  5M5X J;  3F23 A;  4LG0 A;  4BJ6 C;  1SFX A;  1Z1D A;  4HF0 A;  1PUF A;  4HPQ A;  3ZN1 A;  2JRT A;  1FOW A;  3K4M A;  3GZN B;  3LAJ A;  1UFM A;  1QVT A;  4CCL A;  4P5O A;  5F6F A;  2EFP A;  5HVQ C;  3G4S I;  2WC2 A;  1EKE A;  1CQT A;  3DBL B;  1GXP A;  3QU6 A;  4PJL A;  2EIN H;  3F72 A;  1QNT A;  4A2U A;  2Q8K A;  1PP8 F;  1EH7 A;  1Y8R B;  1TW3 A;  4MEX F;  5M5W J;  2GOM A;  3MMY B;  2L5Q A;  2L3D A;  2TCT A;  1FY7 A;  1F36 A;  2VJJ A;  1DQU A;  2VQL A;  5FB2 A;  5FD6 A;  2PJP A;  1XGN A;  3ZCO A;  1WHU A;  4RBO A;  3QYF A;  3CES A;  4HST A;  3GFM A;  2PLY A;  3C2H A;  2EIK H;  4ENJ A;  3FXK A;  4I0A A;  2LRE A;  1O57 A;  5C3E J;  3PSI A;  5ICE A;  4BXU A;  1O3R A;  1VQ8 I;  3DV8 A;  3I59 A;  1WPK A;  5JVG F;  3FXU A;  2K85 A;  1IDY A;  1IW7 F;  1RET A;  4XKB A;  4PJN A;  1X2M A;  3WTX C;  5KCM A;  3GTM J;  2FF4 A;  3ABT A;  3UNG C;  3JRE A;  2L54 A;  3A01 B;  5HS9 A;  3DKW A;  2R5Z A;  2YUS A;  1UMQ A;  2JJ7 A;  1QVU A;  3CF5 F;  4ENM A;  1K6Y A;  2F6C A;  1ERD A;  1IRX A;  1HOM A;  1BW5 A;  1XMA A;  1UHM A;  3AG3 H;  2NNY A;  3BTI A;  4P9U A;  1ZK8 A;  1K4T A;  4BAY A;  3BDD A;  4WCG A;  4G6T B;  2K9L A;  2ZJP F;  4LOC A;  2DT6 A;  2CO5 A;  2R4G A;  5D4S A;  3LAP A;  1W36 D;  3OYC A;  5FLX K;  2ZB9 A;  2JPB A;  3D5L A;  3K70 D;  1K7A A;  4ZZL A;  4E7K A;  4D1Q A;  3CCQ I;  5EG0 A;  1A04 A;  2Z2S B;  3I5U A;  3VYT B;  5TGT A;  3WHB A;  2DT5 A;  2A5W A;  1ETY A;  3ABU A;  2CRG A;  2DFF A;  5ICG A;  2QKM B;  1FBU A;  1I50 J;  3L7W A;  1OPC A;  2NVY J;  1S72 I;  1MBE A;  1QQI A;  3D5R C;  1JHF A;  2AXT C;  3CD6 I;  2ZC2 A;  2HQN A;  4HYE A;  2WB1 N;  1BI3 A;  3GTP J;  5E3L A;  4BQN A;  4XL9 A;  3IKV A;  2HYJ A;  4YIF A;  1Z0X A;  3F8M A;  4UUS B;  3LMM A;  4V2F A;  2R7Q A;  2XPV A;  3HTU A;  3OR1 C;  3B6C A;  4KIF A;  3W6J B;  4BS9 A;  3O8G A;  2DU9 A;  1ZG5 A;  4C2T A;  1P7J A;  1DPR A;  2R7O A;  4RGX A;  2E7X A;  3MKY B;  5IYB J;  2XIG A;  4E7Z A;  2LP0 A;  5HDN A;  1XDS A;  5JVT A;  5HOO A;  3RZO J;  3DU6 A;  1BIA A;  4UB8 C;  2HPM A;  4A6D A;  4A0Z A;  2L7K A;  3CCS I;  2Q0O A;  1U5T C;  4NQW A;  1KYW A;  3MD2 A;  3V4G A;  5GAG J;  1P4W A;  5K5Q A;  2NYX A;  1HW2 A;  2LC2 A;  4DYR A;  2CUF A;  1BA5 A;  1X4P A;  1TNT A;  4A3M J;  3LOC A;  5ICF A;  4UNO A;  2M4G A;  2YU3 A;  5FLV A;  2LF7 A;  2R5Y B;  5BS6 A;  2H6C A;  5KHD A;  2H1L A;  1GV5 A;  1YE9 A;  5TIS C;  4I99 C;  2LH9 A;  4DZJ A;  2CV1 A;  2KRC A;  4XR6 A;  3BJO A;  2FOW A;  2L4M A;  3KP3 A;  3F8N A;  2AO9 A;  3N05 A;  3GTJ J;  2EA4 A;  1SD5 A;  4PJJ A;  3FX3 A;  3RYP A;  4BKX A;  4G7O F;  3B6A A;  1C0W A;  1XN7 A;  1X3U A;  4BE2 A;  4FET A;  2JPC A;  1LKX A;  2LY9 A;  1Z9C A;  4UVA A;  1ETQ A;  1IXS B;  5J4V A;  3RI4 A;  3HG9 A;  1O3S A;  2MH9 A;  3OYB A;  1XGM A;  1YX5 A;  4G9Y A;  1ZTR A;  3VYU B;  1YQA A;  1BI2 A;  4D5C A;  5B1A H;  3KCC A;  2ZNZ A;  3BZ6 A;  2BE5 F;  1O3T A;  4A12 A;  1X1B A;  2I8D A;  2FU4 A;  4CDG A;  2DOE A;  1R4N B;  2M8G X;  2XHK A;  1BOB A;  3CCY A;  4BXF A;  3GTL J;  3G1M A;  1TWC J;  1ZG3 A;  2XGD A;  2LY1 A;  3W6K B;  3DP7 A;  5FRO A;  2MAB A;  1XTA A;  2O03 A;  1NG6 A;  1TT0 A;  2KHM A;  1JUS A;  1QBJ A;  3KEQ A;  5E79 C;  3ZXS A;  4BUP A;  2HZT A;  1UEL B;  1OCC H;  2BV6 A;  4XOP A;  2LY2 A;  5E20 A;  3TED A;  1GVD A;  4DOZ A;  1QZZ A;  2ECC A;  3K4N A;  2BXY A;  4XLE A;  4ZYD A;  4BE0 A;  1JJ8 C;  3QPS A;  1WQ2 A;  3F8B A;  2QSF X;  2LBF B;  2K9M A;  2XF7 A;  4JX6 A;  4LG3 A;  5L3C A;  3CCV I;  3KP4 A;  2G9W A;  2QQA A;  3OSF A;  2CJJ A;  4WWC A;  1T08 B;  2Z9O A;  3JTH A;  1JTX A;  2MSY A;  3M8E A;  3UKG A;  2CQK A;  2DMT A;  3KEO A;  5EF6 A;  2R93 J;  1NK2 P;  1OCP A;  4RMN A;  5A2Q Z;  2COM A;  2PMZ A;  1ORK A;  3GLL A;  1G4D A;  1A31 A;  4HBL A;  4ZYH A;  2XRO A;  2D1H A;  2ZCW A;  3A03 A;  3BTJ A;  3RQI A;  2XV4 S;  5F1J A;  1B1B A;  2EFN A;  1GUU A;  4UUS A;  1Y1V J;  2UXN A;  3PO3 J;  3FXJ A;  1HC8 A;  4QLC U;  4RB0 A;  5J3L A;  4C3J J;  5HLH A;  3BJ6 A;  1OKR A;  5F0H A;  1TP4 A;  3D1N I;  1S5L C;  1ZYR F;  1TWA J;  2EA2 A;  2DTR A;  2X1C A;  2D1V A;  2W85 A;  5DD8 A;  4MTD A;  4Q48 A;  2STT A;  1HQC A;  2EJR A;  2Y31 A;  5GP9 A;  2OCC H;  1R9T J;  3BQY A;  2AS5 F;  3AL0 C;  5JLX A;  1FX7 A;  1WKM A;  1OYI A;  1LPQ A;  4BEH B;  3A1Y A;  2LVS A;  3CJT B;  4FHT A;  4L5J A;  2XAU A;  1U3E M;  3HGG A;  1I6X A;  2R7D A;  4I7H A;  2Q2E A;  1G3T A;  4D7M A;  2R5Y A;  1MMA A;  2RNJ A;  4BQO A;  2F4M B;  5ILV A;  3DLL F;  3BPV A;  2OV7 A;  3BC8 A;  3WE2 A;  5IT3 A;  1SVM A;  4PGG A;  1GXQ A;  1S29 A;  2KKO A;  2R7R A;  2ESH A;  1GV2 A;  3HEF A;  4WX9 A;  3CMA I;  1H8A C;  3OS0 A;  2OD5 A;  2WV1 A;  2NOG A;  2HZD A;  4GYG A;  1IRG A;  1J5Y A;  4IXA A;  1FYM A;  3HOS A;  3V7S A;  3I4M J;  3HM5 A;  3LNQ A;  2V6C A;  4B43 A;  2LLK A;  3QRF F;  3I9V 2;  5K7Z A;  2PMH A;  1NK3 P;  3C3W A;  4DIQ A;  2IVM A;  5L3G A;  2PI0 A;  4E7H A;  3GXO A;  3LQR A;  4CCK A;  1ON1 A;  3L9F A;  3NWT A;  2JA6 J;  1OMI A;  2W57 A;  5LEK A;  1XGS A;  3BR3 A;  3F8F A;  3GTO J;  4M6Y A;  4RA2 A;  5F08 A;  4CCM A;  3E1S A;  2P0W A;  2PMU A;  2VXD A;  4IJA A;  1VQP I;  2K9N A;  3WU1 B;  4HG2 A;  1XSD A;  5B5E C;  3H9G A;  2Y75 A;  2ZSI B;  5J1U A;  2COB A;  5EZG A;  3S14 J;  3OYE A;  1HA8 A;  3V8L A;  3VB2 A;  1IGN A;  2CSO A;  4XOR A;  3TW6 A;  1DU0 A;  2GXA A;  2F5C A;  4XON A;  1XDU A;  2VQC A;  2K9S A;  5H6Q A;  2XKO A;  4AYB N;  2ME6 A;  4A5N A;  5DM6 F;  4Q47 A;  5D5V B;  2DA1 A;  1VTN C;  3GZ5 A;  2BGC A;  3HBL A;  4M72 A;  2GA1 A;  1OLT A;  2CV2 A;  4M74 A;  4A3L J;  1YJW I;  2CW8 A;  1R1V A;  5BPI A;  2CUE A;  2IGO A;  4L9T A;  4ASN A;  1HLV A;  4PZJ A;  2MD0 A;  2A05 A;  2LBF A;  4KYW A;  3IH4 A;  2E1N A;  2Y48 A;  1FT9 A;  1QA6 A;  4N9H A;  3ZMZ A;  4ESJ A;  4ABZ A;  2X4H A;  2QCO A;  2XGC A;  4HX8 A;  1VQ6 I;  4FX0 A;  5GTI C;  4FIS A;  4OU0 A;  4BXX J;  1L0O C;  2FBK A;  1EA3 A;  2WAD A;  3FKJ A;  1F9N A;  3JSP A;  2VOP A;  5L3D A;  2E5Z A;  5HDG A;  1NHA A;  1WZ2 A;  1Y0U A;  1I27 A;  1YW9 A;  2BY0 A;  2FNA A;  3K4K A;  3BY6 A;  1T2K A;  9ANT A;  4IOC F;  2W82 A;  2OBP A;  5IOY A;  4YFN F;  1T38 A;  4X6A J;  5E8G A;  3A4C A;  3H5R A;  4NBQ A;  2KIM A;  3CC4 I;  2NNN A;  2ZFW A;  4KNY A;  1SVO A;  2CQN A;  3EDP A;  1HKT A;  3RJP A;  1FSH A;  2M9H A;  3JRG A;  5HNH A;  3VYS B;  3L2V A;  2V1D A;  4FE7 A;  4XK4 A;  3BTL A;  1P4A A;  4XKV A;  1M1E B;  2Z5U A;  1IN4 A;  3N97 A;  4OIO F;  2O3F A;  2IA0 A;  2A68 F;  3Q9S A;  3WTS C;  3K10 A;  2CV0 A;  1LDD A;  5FFX A;  4IL6 C;  3HSR A;  3DPT A;  3IP4 B;  4XKC A;  3NAU A;  1O7L A;  2WAF A;  3MVP A;  2FOK A;  1YOV B;  4RB1 A;  3HXL A;  4MO7 A;  4I98 B;  2FUG 2;  2EBI A;  1WJA A;  1V54 H;  3RKQ A;  4OMY A;  1YS7 A;  1R36 A;  4EJV A;  3ZQ7 A;  1P4X A;  1MMG A;  3I56 I;  2ETH A;  1N75 A;  3CCR I;  1R1T A;  1VF9 A;  2F48 A;  3GEZ A;  3JRD A;  2IS1 A;  1JUM A;  3DXJ F;  2ZNY A;  3AFH A;  3CCU I;  3A2K A;  3S1R J;  2VQH A;  1W36 C;  1A35 A;  4LFU A;  3K4C A;  3K70 C;  2D45 A;  1PUE E;  1KQ8 A;  2IGM A;  2D2W A;  5FLX Z;  3RPU D;  3FK6 A;  2VJ5 A;  3ZN0 A;  4DQ2 A;  4EEF G;  3F22 A;  2HKX A;  4A3I J;  2HYF A;  4KUM A;  4HSR A;  1BBY A;  3TDZ C;  4U0V A;  3H3V K;  4D7N A;  3RKY A;  3GYH X;  4BNC A;  5FKN A;  2VC0 A;  5LGU A;  2P5L C;  3K6G A;  1J9I A;  3VWB A;  4A3C J;  3O6B B;  4ZYG A;  1CF7 B;  3PFI A;  4L9N A;  2DMN A;  3L2C A;  3HTS B;  4N9I A;  2ZXJ A;  2VJI A;  2YSR A;  3EYY A;  2CWE A;  3UR3 C;  4ESF A;  2PJR B;  4V19 K;  4XLA A;  1WI3 A;  4LG0 B;  5CPR B;  5CVR A;  3ABL H;  1QPM A;  2M5W A;  6PAX A;  5FKM A;  2L7Z A;  2B9S A;  1W0U A;  1Z05 A;  2YU9 J;  3QAH A;  2VC1 A;  1OR7 A;  4H4K C;  1TWH J;  3HB9 A;  2DN0 A;  3FXO A;  1N25 A;  4B8X A;  5M3M J;  3EPZ A;  4CH7 A;  5L3F A;  1Z6T A;  3FXL A;  4MQV A;  2ZSH B;  1X19 A;  1ON2 A;  1FSE A;  2VT3 A;  4E70 A;  2ELJ A;  1JTY A;  1B6A A;  2ZJ2 A;  1IC8 A;  3BP8 A;  3J80 K;  1D1C A;  2AXL A;  3TKY A;  4U7D A;  1BW6 A;  2UXX A;  4LIU A;  3V7R A;  4XRM A;  4ZDO A;  1PVE A;  3MWM A;  5LBQ A;  2QEN A;  3M3Y J;  2Y2Z A;  1SFE A;  5J1Y A;  3LA7 A;  4TV7 A;  2GIZ A;  2RN7 A;  1DDN A;  1MMD A;  3HPG A;  3BWG A;  2Y0S N;  4QWQ A;  2K5C A;  4MLO A;  3H36 A;  4PK4 A;  1BN5 A;  3ZQC A;  5FGM A;  4JX4 A;  3G73 A;  2JUG A;  2OPT A;  4BJ5 C;  4GXO A;  3HKZ A;  5CYV A;  5KVR A;  2NRA C;  3WG9 A;  1DP3 A;  3SHF A;  2A07 F;  3K7A J;  2XB5 A;  3O3K A;  2HQ5 A;  1F4K A;  1MSE C;  1BC8 C;  4F92 B;  2HR3 A;  1E3O C;  5D8K B;  2XAJ A;  3FMQ A;  2V1N A;  4E7I A;  1IN8 A;  4UV8 A;  2HFH A;  5CQG A;  1KU7 A;  1I3Q J;  1LDJ A;  2N8G A;  3OIP A;  3G71 I;  5K5R A;  1V55 H;  3WU2 C;  1GHC A;  4AIK A;  5AIP A;  4PFP A;  5IT9 K;  4Y13 A;  5C4X J;  3Q9V A;  1UST A;  2P81 A;  2WAQ A;  3GFL A;  2HWV A;  4A69 C;  2WY8 Q;  1AU7 A;  2MBF A;  5C4J J;  3H92 A;  3ZQQ A;  1Y56 A;  3I55 I;  2HS5 A;  4KDP A;  2CW7 A;  3FXR A;  4CIC A;  5EG0 B;  3CLQ A;  2O61 A;  3IH3 A;  3BCB A;  2DO7 A;  3CCE I;  2OC6 A;  4M6X A;  2CYY A;  5EGO B;  1UAA A;  3RDI A;  1KZH A;  3VDX A;  4WXD A;  3FXQ A;  3MKZ A;  1NTC A;  4A3F J;  2DPU A;  3L2U A;  1U0J A;  2VKV A;  5JR3 A;  3RKX A;  2LYC A;  4RLQ A;  3U1K A;  1R7J A;  5J4Y A;  2K3F A;  1SMT A;  2LKS A;  2X85 A;  3BLY A;  2EZI A;  2KPM A;  4EV0 A;  4OAZ A;  4BU2 A;  2BYV E;  5D5U B;  3ZR8 X;  5HLI A;  1FTZ A;  4B48 A;  2JUC A;  3GW2 A;  4RAZ A;  2P5K A;  3KP5 A;  2W4S A;  3JW4 A;  5DTD A;  1CF7 A;  3WGH A;  5EYR A;  4IHT A;  1VI0 A;  1RRJ A;  3E3V A;  1T33 A;  1Z21 A;  2DFI A;  2E2H J;  4Y33 A;  1ZLK A;  3QOP A;  3SFI A;  1TC3 C;  1I39 A;  2HQA A;  1MZB A;  2NS8 A;  2L01 A;  4NQW B;  4EAT A;  4GDF A;  1Z7L A;  2PJR A;  1ZEL A;  4KT6 A;  2W84 A;  3NQO A;  2XAF A;  1JKO C;  2KZV A;  4ZTJ A;  3HGY A;  1XD7 A;  1HW5 A;  1OJL A;  3SEQ A;  4LLG F;  4G12 A;  4NC8 A;  3S2W A;  4F7Z A;  2VLA A;  5LHH A;  1YHQ I;  3LQQ A;  4ZH4 F;  1TTY A;  2LOO A;  2M30 A;  3FK7 A;  2M0M A;  2V6E A;  3ZMU A;  2QYO A;  1U5T B;  3EUK L;  3EQL F;  4RAF A;  4LB5 A;  4OIN F;  4ETS A;  2NVQ J;  2CW0 F;  1OQY A;  1B8I B;  1J0R A;  1B9M A;  2IP2 A;  4QIW N;  4A6E A;  3QP5 A;  4I6Z A;  1ZQ3 P;  3TP0 A;  4BYY A;  3LL7 A;  1XMK A;  1ZH5 A;  2CH0 A;  3O8H A;  1AWC A;  3KEY A;  2KP6 A;  5D8L B;  2F5D A;  4EGZ A;  1MBH A;  1LFU P;  2GXG A;  1W7P B;  1USS A;  2BY2 A;  3EUH C;  2VL8 A;  1R71 A;  3COA C;  2R7Z J;  4CCO A;  1BM9 A;  1B9N A;  1YLF A;  3RQ4 A;  3ZQH A;  5K7F A;  1R4M B;  1J59 A;  1LVA A;  2FML A;  2RGV A;  1WJ5 A;  1FIA A;  2HOA A;  4RM3 A;  1OCT C;  3TP3 A;  3BG6 A;  4RAY A;  3EUA A;  2H8R A;  4AVP A;  5DYM A;  2V9P A;  4W97 A;  3ML6 A;  4AWX B;  1X1P A;  2HVR A;  1BI0 A;  2CFX A;  4CZZ A;  3J81 K;  1QZE A;  3R0J A;  1IN6 A;  2HU9 A;  3L00 A;  2EV6 A;  5HLG A;  5C44 J;  4A0Y A;  3DPL C;  3M9A A;  3PL8 A;  2A3S A;  2M7B A;  2FQ4 A;  5B1B H;  4EMS A;  4HNU A;  2V7F A;  2HYG D;  2D5V A;  2RRE A;  1OCZ H;  5BQT A;  1DGW Y;  1PP7 U;  2MLK A;  5H20 A;  2OTJ I;  2FXA A;  1X1A A;  2P5V A;  1JE8 A;  3MZY A;  3LST A;  1YW8 A;  3T5X A;  3R60 A;  5EGO A;  1E3H A;  5BPD A;  1UCR A;  1MMS A;  1ZGW A;  3AG4 H;  4N4N B;  1S3J A;  2FNP A;  3DBR B;  1XSV A;  3HRM A;  3KP6 A;  2HNH A;  3K2A A;  3L09 A;  3PUF A;  3V8K A;  2E2I J;  3NWS A;  4CYC B;  1T56 A;  2F5E A;  2UZK A;  4ZDP A;  1VND A;  3PQJ A;  4IQ4 A;  2P4W A;  4HF2 A;  2KL4 A;  2UWM A;  5AON A;  5GPA A;  4L9J A;  4L0Y B;  2XAG A;  1F1Z A;  4ZC3 A;  1OYY A;  2MG4 A;  3V7C A;  4EQQ A;  1HBX G;  2LFB A;  5IP7 J;  3ECO A;  3FHN A;  4XN0 A;  3MEX A;  2XRL A;  3E97 A;  1OYW A;  5ICC A;  4HNT A;  2EH3 A;  3F6O A;  2DJN A;  2Y69 H;  2HOE A;  2VBX A;  1VQ7 I;  3A02 A;  1WCM J;  1ENH A;  1E0E A;  3OWT A;  2QGU A;  3J7Z I;  1H9G A;  1K79 A;  1F5T A;  4B09 A;  3OIO A;  2VT2 A;  1IUF A;  1X3Z B;  3LFU A;  1YTY A;  1FOX A;  2Q2E B;  1WVR A;  3I64 A;  3GTK J;  2A5Y B;  3WG7 H;  1G3Y A;  2FRH A;  3P9I A;  2KIS A;  3OOU A;  4BE1 A;  2HEO A;  2BY3 A;  2L7F P;  3P7N A;  3AL0 B;  1U5T A;  2JT1 A;  2MW8 A;  5DD4 A;  1MJB A;  2L4A A;  2OUM A;  3G3Z A;  4B1R A;  3SZP A;  3CO6 C;  4GRI A;  3IRQ A;  3BT9 A;  2DOA A;  3DBH B;  3QQA A;  5KNL A;  1B8I A;  3HJE A;  3RYR A;  2X6X A;  5CKT A;  2BVL A;  4XLN F;  1AKH B;  4XRS G;  2L9V A;  4AVZ A;  3C2B A;  1IXR C;  1H89 C;  3N4M A;  1IRF A;  2KDZ A;  1SC7 A;  5GAD J;  4E4H A;  2R7W A;  3CDI A;  2CGP A;  1ETO A;  2MD5 A;  5J8C A;  1W7P A;  2R7F A;  2XB0 X;  1O3Q A;  2M34 A;  5IP6 A;  2K4B A;  5GPC A;  5E3O A;  3ZQG A;  4A3J J;  3OYH A;  4NNJ A;  3QPT A;  4M3G A;  1JKR C;  1FOY A;  2A6H F;  2DYR H;  1IN7 A;  2F2E A;  2PBI A;  1KA8 A;  2JSP A;  5FD5 A;  1J2X A;  1D1A A;  2HDD A;  4HDV A;  3K4L A;  3M1E A;  4N0B A;  5B66 C;  1RKW A;  3JRI A;  1REP C;  1MBF A;  3RSN A;  5LHG A;  3FWE A;  4JQF A;  3VOD A;  4E6K G;  3BQZ A;  3KZZ A;  3FZV A;  3TOA A;  2Z33 A;  1XB4 A;  2MH2 A;  4YIR X;  3DFG A;  4M73 A;  1KON A;  3P9K A;  2W24 A;  2RC4 A;  4J01 A;  1WJD A;  5M5Y J;  3A0B C;  1LQ1 A;  4HRI A;  2ACJ A;  2QSH X;  1WI9 A;  5E1W A;  5F1R A;  1MNM C;  3BG3 A;  2NVX J;  1O7F A;  4O5V A;  2HVS A;  3I71 A;  4EJO A;  3FIS A;  2GZW A;  2Y9Y A;  4NHJ A;  2OJE D;  4YRV A;  3IKT A;  3VYR B;  4B3A A;  2JA8 J;  1RKT A;  2PX9 A;  1MBK A;  4CYC A;  3TMO A;  3E6M A;  3NAR A;  2WBM A;  1V4R A;  2MC4 A;  4WK8 F;  5KK1 A;  5CQE A;  2G0E A;  3WGG A;  1CGP A;  2XAS A;  2O6G E;  5ERI A;  2LNB A;  2RNG A;  3CDL A;  1VQ9 I;  2E34 A;  2VKH A;  1RNL A;  1G3W A;  5J47 A;  3CO7 C;  2PEX A;  3E0J B;  5FJ8 J;  1DGR M;  1ODD A;  2E1C A;  1FC3 A;  2DFH A;  2ZXH A;  1D8K A;  3J80 Z;  3KP2 A;  2HKO A;  2H6B A;  3V8J A;  3WGI A;  4NC7 A;  2ZJQ F;  1I3A A;  4NC6 A;  3LSK A;  1HKQ A;  2H94 A;  3LSM A;  3MKL A;  3A0H C;  2M1B A;  4S0H B;  3JR9 A;  2B63 J;  2L02 A;  4C2M J;  1WJF A;  3ZQI A;  3CMM A;  3P9C A;  4XKW A;  4P96 A;  3SQN A;  3FDY A;  4ENN A;  2RQP A;  4IPA A;  1I5Z A;  2K7L A;  3CUQ C;  4O6J A;  3T8T A;  2LG4 A;  4YG2 F;  1BR4 A;  2W00 A;  1TW2 A;  2F5F A;  4XRS A;  1Z7U A;  2LF8 A;  4IHS A;  4RS8 A;  1W1W E;  3ELK A;  3H35 A;  2EIL H;  2EZH A;  3IAS 2;  5EEG A;  4DBR A;  5J8F A;  1Z77 A;  3OYL A;  2IW5 A;  1AKH A;  4PSX A;  2ZJR F;  2WA0 A;  1B59 A;  3ERM A;  5FLM J;  4YEJ A;  1I1G A;  1MSF C;  1D0X A;  3AAF A;  2E7W A;  3TBI A;  1QPI A;  5IT9 Z;  4B47 A;  2E1M C;  4E7S A;  2KZG A;  4EM0 B;  3F21 A;  4BAC A;  4FE4 A;  1UHS A;  2F4O B;  2BHY A;  1OIS A;  1X3W B;  2K3P A;  4AIH A;  1FNN A;  1FIP A;  2KFD A;  2KRH A;  1FPQ A;  1LDK B;  2GA2 A;  1XCV A;  4DBQ A;  4EJW A;  4RGR A;  4AD9 A;  3LA3 A;  4IHV A;  2KJB A;  1HXD A;  5KAF C;  1SD6 A;  1MND A;  2EIM H;  4HAM A;  4Y7N J;  2DW4 A;  2ZXW H;  3S3N A;  1LJ9 A;  1YI2 I;  4A3E J;  4MGR A;  4FTH A;  4BY1 J;  5F04 A;  4D0P A;  4A3K J;  1A36 A;  4UUV A;  4HV5 A;  2E1O A;  1UB9 A;  4Q5S F;  3CJR B;  3DCF A;  2KIU A;  3I54 A;  5H6R A;  1I6H J;  3OSG A;  5F27 A;  1PDN C;  5DCM B;  2CFO A;  1QHG A;  1Y39 A;  2BOL A;  3OL4 A;  2IA1 A;  2TDX A;  1WRJ A;  2XAQ A;  3I53 A;  4DNC A;  4IHX A;  4M71 A;  3PSF A;  1WWX A;  5D5X B;  3FM3 A;  1BL0 A;  2ESN A;  1GT0 C;  2VN2 A;  2VBZ A;  2XF6 A;  5LGT A;  3CQZ J;  2V1X A;  4AYB A;  3OS2 A;  1YX3 A;  1WH7 A;  2DDA A;  4ESB A;  3F6V A;  4BJT A;  3PNY A;  3BRO A;  5IP9 J;  5JHU A;  2NXN B;  2O8K A;  4GCV A;  4E7L A;  4JBA A;  4IEJ A;  1K78 B;  1L3L A;  1ONV A;  1ZAR A;  1MJ9 A;  3ERE D;  1SAN A;  2QA4 I;  4IOA F;  3F3X A;  1RR7 A;  2A69 F;  4DZP A;  3SXY A;  1MH4 A;  4XQF A;  2CMP A;  5E1X A;  2Y0M A;  4UHT A;  1U8R A;  1D8J A;  1ETV A;  1HF0 A;  3WE3 A;  2M7A A;  3BR0 A;  3FBI B;  3ZQF A;  1H88 C;  4UY8 I;  1A5J A;  4RAG A;  1QGP A;  1R00 A;  3REO A;  2BXZ A;  2X6O A;  4CSW A;  2VON A;  2VE9 A;  1ZHF A;  5LRR A;  3HDD A;  2KQR A;  1EH6 A;  1TBX A;  5JHF A;  3DF8 A;  1P6R A;  3FM5 A;  1HDP A;  5TJJ A;  1QU3 A;  3OV8 A;  3R6S A;  1NG7 A;  5JLW A;  3GZ6 A;  1KQ9 A;  1HW1 A;  2Q1Z B;  5F0C A;  4OIR F;  4I09 A;  1E17 A;  2VOD A;  2AHQ A;  2M87 A;  5LLQ A;  1V3F A;  3TQN A;  2IPQ X;  1IAW A;  3BR6 A;  2OQG A;  1Y1W J;  2L0K A;  4ZZD A;  4G8X A;  3PO2 J;  3OYM A;  2O7O A;  3DPU A;  4HEA 2;  5EDN A;  2LSO A;  1ZN2 A;  2IXS A;  4F55 A;  4DW6 A;  3HOZ J;  2Z1D A;  3AG1 H;  2DCE A;  4C30 A;  4R79 A;  4QSH A;  1IN5 A;  3WHC A;  3I4N J;  2CU7 A;  4F52 A;  3J81 Z;  3TOB A;  3KPH A;  3U9G A;  3IRR A;  2ECB A;  3Q5F A;  1AOY A;  4AM3 A;  2P6S A;  4Z6Y A;  2QEX I;  3AKZ A;  1W5C C;  2L9N A;  3FXM A;  1DP7 P;  3BJA A;  4AU7 A;  4BDY A;  4UVB A;  4XMY A;  4H0E A;  4BBR J;  2XPU A;  2X1E A;  1YJN I;  1S7E A;  5J1R A;  3L1P A;  4CYD A;  1FYL A;  1G8X A;  1ZGA A;  5FKL A;  3VFZ A;  1MIJ A;  2QSG X;  3JAM K;  4OMZ A;  1IUY A;  4BGD A;  2IRF G;  4UUT A;  2W48 A;  2MGQ A;  3BG5 A;  4LIT A;  1HST A;  2EWN A;  1KQ0 A;  2LR8 A;  4XN3 A;  1LE8 A;  3BCA A;  4EVI A;  3FIW A;  1RR8 C;  3HIF A;  1Z67 A;  1MBJ A;  2IGN A;  2EIJ H;  3HYI A;  1QZY A;  2JWT A;  2XVC A;  5K1Y A;  2DK8 A;  4D9J A;  2JVG A;  1T0F C;  4B44 A;  4DGW B;  2JA7 J;  1V5E A;  3HOT A;  4G6Q A;  5CJ9 A;  3GF2 A;  4UXN A;  5DCM A;  4FT8 A;  1P2F A;  1R6R A;  3PQK A;  1YJ9 I;  1BR1 A;  4I76 A;  3V42 A;  3H0G J;  2I10 A;  2V9K A;  4OAY A;  4P55 A;  1GLN A;  4EGY A;  5JFR A;  1J09 A;  3HOW J;  4HW0 A;  3L2R A;  5DM7 F;  1XCB A;  3WTT C;  4W1U A;  1A6Q A;  4AUX A;  2X0L A;  3K1N A;  2VPR A;  2LKP A;  4CHU A;  3DLA A;  2DMU A;  1XMX A;  5DS9 A;  2HGC A;  3EET A;  5J6X A;  3LSR A;  3IL2 A;  2ELK A;  1FP1 D;  1FWZ A;  1TQP A;  3F9K A;  2ZME C;  4WF2 A;  3ASN H;  5LFA A;  1Q1H A;  2J5O A;  3GWZ A;  2L2O A;  2IJL A;  3FKI J;  3GX4 X;  2JQ7 A;  2JTV A;  1JI8 A;  1K78 A;  4HF1 A;  4J19 A;  2MC3 A;  1WSU A;  2ELH A;  4GO1 A;  1T8I A;  1TL8 A;  2OA4 A;  2V9V A;  4LGW A;  4JX5 A;  4KA4 A;  1UG2 A;  5CVI A;  2ISZ A;  2LKX A;  3HOY J;  1XGO A;  2F4I A;  1U2W A;  1Z6R A;  4X1E A;  1P7I A;  4L0Z B;  2L9R A;  1FBQ A;  3U1D A;  1MBG A;  3CCJ I;  3O2P E;  3S15 J;  3S8P A;  2GIV A;  2HXO A;  3GTQ J;  4XLC A;  2ZFU A;  3MZ8 A;  4KIC A;  3OYG A;  2DQL A;  2NS0 A;  3HZJ A;  1YS6 A;  2H8W A;  4YEL A;  5FO5 A;  4UV9 A;  2VJ4 A;  1SMY F;  4Y3O A;  1IV8 A;  3TO7 A;  3VSK A;  2YS9 A;  3QU3 A;  3D5S C;  3E6C C;  1MKM A;  3HRU A;  4JK1 X;  5E8I A;  3HHG A;  3QYE A;  4Z2Y A;  4ENK A;  4LD5 A;  4A0X A;  2VPL A;  2DYS H;  2WV0 A;  4UB6 C;  4F3Q A;  1TLH B;  3MZH A;  3W3C A;  3G6E I;  3S1N J;  1BJA A;  2KDO A;  3DTK A;  2EFO A;  3W2V A;  3S16 J;  1LB2 A;  4KIB A;  1Y6I A;  3KET A;  2MA3 A;  3C1D A;  1W0T A;  4BL0 B;  1G2H A;  1DU6 A;  3U21 A;  1SFK A;  2EQR A;  1UZC A;  1MDM A;  1ZR2 A;  4KFC A;  3OYD A;  2HQR A;  2KMU A;  3K1P A;  1UG0 A;  2VQG A;  3DTI A;  3HRS A;  2VOO A;  3W6V A;  3K4J A;  1Z3X A;  1VQ5 I;  3IH2 A;  3S3O A;  2E19 A;  3CLO A;  4IF4 A;  2FJ1 A;  2BEO A;  5M3F J;  3S2D J;  2JMW A;  3DKY A;  3H9Q A;  4ON0 A;  3W2A A;  2XAH A;  4L9V A;  4K2E A;  4BHP A;  5AIQ A;  2DMP A;  1NH3 A;  4IO9 F;  3I0T A;  1KU9 A;  4PSW A;  4DYC A;  1O4X A;  4RDU A;  2DQR A;  3NEU A;  2M45 A;  1QRY A;  3H9J A;  1IG7 A;  5IY5 H;  2MYS A;  3LA2 A;  3U2R A;  2E5N A;  2X1D A;  1VQN I;  3SYT A;  2Z16 A;  3I58 A;  3RZD J;  1PJR A;  1U9O A;  2X9D A;  1KU2 A;  1D5Y A;  2G7U A;  3KX2 A;  2M2E A;  1R49 A;  1DUX C;  3OYF A;  4U88 A;  1JUP A;  3ZMV A;  5DUK A;  3E5U A;  2R0Q C;  1ZR4 A;  2R92 J;  4LLL A;  3HC7 A;  3LSP A;  2B0L A;  4XLF A;  3QPL A;  5F0F A;  2HTJ A;  1P92 A;  2R3S A;  4OIQ F;  2PFB A;  5HDK A;  2BHZ A;  5B3S H;  1RES A;  2IS2 A;  4HX4 A;  4BY7 J;  4L18 B;  1FEX A;  3GO5 A;  1BIB A;  4J00 A;  1TZL A;  2IGK A;  3K1M A;  2OAZ A;  4AC0 A;  4A3B J;  1RPW A;  2M3A A;  5EEH A;  2OQR A;  1EF4 A;  1MMN A;  3FBN B;  1H9T A;  5GTH C;  3ZQL A;  1SAU A;  1JHH A;  2M0C A;  4PJM A;  1XS9 A;  5E3M A;  2EZK A;  1DPU A;  3P5J A;  3IAM 2;  4D5F A;  4KMF A;  1OCR H;  1OCO H;  3BG7 A;  4IX7 A;  1R58 A;  1P9Q C;  3EUH A;  2IS4 A;  2YR2 A;  3S32 A;  2QM3 A;  3OYA A;  4CCJ A;  2FMY A;  3MAJ A;  2VBY A;  2H09 A;  2OU2 A;  1R5I D;  4KJZ A;  2QQB A;  3TGN A;  2WAE A;  1QHH D;  2L7M P;  2PN6 A;  2RVC A;  5L3B A;  2XSD C;  2OZ6 A;  3CME I;  2F5V A;  2R7X A;  3KLN A;  4DYQ A;  2XUB A;  2E35 A;  3WTV C;  4U0Y A;  2LMD A;  3FF5 A;  1ZRE A;  4EM2 A;  4LB6 B;  2WWY A;  1IZ1 A;  1U8B A;  2CS3 A;  4XBF A;  2HPI A;  1ETW A;  2EZL A;  4N4O B;  3T1B A;  3E6D A;  2C6Y A;  4CUG A;  4BHB A;  4WXH A;  3VSL A;  1YYV A;  1MGT A;  1ZLJ A;  3ULQ B;  5F64 A;  1SAX A;  3GFI A;  2MLG A;  4IRG A;  1BC7 C;  1FLI A;  2NOJ B;  3ABM H;  4ZYE A;  2E36 A;  2XKP A;  2CQ7 A;  4GGG A;  2HDC A;  4QPO A;  4OWR B;  3OR2 C;  1YG2 A;  2X51 A;  4FQG A;  1U78 A;  1IJW C;  3ROU A;  5BMZ A;  3DWL E;  2DMQ A;  2WB1 A;  5FKK A;  1ETX A;  4IVN A;  4OOI A;  1EJ9 A;  1X4O A;  3SDG A;  5FRM A;  2DBB A;  5HS7 A;  1IRZ A;  4EJU A;  1V5G A;  3G1O A;  5JI6 A;  2EV0 A;  4PCQ A;  4CXF A;  1ACI A;  4CGZ A;  1WFX A;  2HOT A;  4MTE A;  3QWL A;  1MJA A;  2OCE A;  2DA5 A;  5DDG A;  5K7H A;  1ULY A;  1MNE A;  3PNT A;  1U6G A;  1JKQ C;  3BR2 A;  1G3S A;  1HKS A;  3ZOB A;  5LRS A;  3WTY C;  2IT0 A;  4JYK A;  1RUO A;  2X6Y A;  5FKO A;  2DPD A;  3T8R A;  1OFC X;  2EFQ A;  4A5M A;  2EPF A;  2W25 A;  1FJL A;  3ASO H;  3ZMS A;  4EJT A;  1MW7 A;  3CUQ B;  3PUB A;  5J40 A;  2YX7 A;  3MKW B;  1JT0 A;  3SZT A;  5E1Z B;  2O9L A;  3K4B A;  2LDU A;  3ABK H;  5IYC J;  2R7V A;  1IO2 A;  2QQ8 A;  3ECH A;  4ITV A;  1A6I A;  2KIF A;  2FA5 A;  1B4A A;  3EYI A;  4B4C A;  3TO9 A;  3CCL I;  4ANJ A;  4G6D A;  4S04 A;  4QTR A;  3OYN A;  2E1M B;  2STW A;  3I3L A;  2HI3 A;  3C18 A;  1X1C A;  4MFD A;  5LGN A;  2EV5 A;  2VIX A;  4BDZ A;  3ONQ A;  2DK5 A;  2A6T A;  3OS1 A;  1WGX A;  1YW7 A;  4KIS A;  5IOZ A;  2H27 A;  2O5R A;  1TQI A;  1TWF J;  4M9X A;  3CC2 I;  1Y8Q B;  3SDB A;  1W5T A;  1ZRF A;  3IUO A;  1LNW A;  1G6N A;  3KZY A;  4A93 J;  1XSX A;  4MFE A;  3MN2 A;  3A01 A;  1E2X A;  3JAM Z;  3RPU A;  2KRF A;  1EH8 A;  2KLO A;  2P6T A;  3H3Z A;  4II3 A;  3H1C A;  2BW3 B;  4I01 A;  1D3Y A;  2DLL A;  4XLP F;  3BPX A;  3F8C A;  2QKL B;  4L5I A;  1W4M A;  4HA8 A;  3GFJ A;  2GM4 A;  3J7A O;  1FZP B;  5BOX A;  2JRM A;  4U87 A;  3E7L A;  2PMZ N;  3CP2 A;  4JP0 A;  3CC7 I;  1VQM I;  1T98 A;  3QOE A;  4C9Y A;  2LD5 A;  1R5H A;  4U7B A;  1S6L A;  5EJC A;  4ZDL A;  3K69 A;  1T39 A;  3S1M J;  2VI6 A;  1YIT I;  3RCO A;  4XIC A;  1JJ6 C;  4LIV A;  3OMY A;  1T6S A;  2HVQ A;  3JRA A;  2FBI A;  2OF7 A;  4IHW A;  5DEQ A;  3KFW X;  4HLX A;  2I5U A;  3L2Q A;  4CA0 A;  3JTG A;  3Q0U A;  5BNG A;  4I0B A;  3H0D A;  2HXI A;  4YFK F;  2DT7 B;  3RPQ A;  3GBG A;  2DA2 A;  3GLX A;  3QOD A;  2DXI A;  5LD2 C;  4QPQ A;  1XPX A;  4Y15 A;  4XSX F;  2PQ8 A;  5GAH J;  2JSC A;  2RQQ A;  1GDT A;  2HDW A;  3C2G A;  4MEY F;  1RIO H;  4KN7 X;  1SVL A;  3IC7 A;  3FMR A;  3IV5 A;  1XC5 A;  2ID6 A;  4I2O A;  2BY1 A;  2V79 A;  4C2U A;  1VZ0 A;  3RIR A;  2LRD A;  2JZY A;  2JVH A;  2HTS A;  2LTP A;  3KIO A;  3WTU C;  3PNV A;  3HSE A;  5ED4 A;  5LEJ A;  1LVK A;  3HSF A;  4ZTF A;  2BZT A;  3JRF A;  2GWR A;  1FMV A;  3CJQ B;  4PDK A;  4R8H A;  4GFB A;  4Y52 J;  3H3U A;  1YRN B;  1STZ A;  1V5F A;  1K6O A;  3ZMT A;  3R61 A;  3T0Y A;  3BR5 A;  2DFE A;  2KJC A;  2RV8 A;  1BJZ A;  4M3F A;  5IPA A;  3CUQ A;  4L5E A;  4RB2 C;  4IKF A;  2XGX A;  1F43 A;  2VKE A;  2VAS A;  1ZRC A;  1VFC A;  4ZYA A;  5D4R A;  4M6V A;  4C3I J;  2E2J J;  1Q1V A;  1S9H A;  4HX7 A;  2L9S A;  3S2H J;  3M1C A;  5IYD J;  1B72 B;  2JN6 A;  4MIM A;  1K4S A;  2GLO A;  2ISY A;  3HL2 A;  1BOA A;  4I02 A;  3ZPL A;  3LSH A;  3HUG B;  4Q4Z F;  1KYZ A;  2VXZ A;  1BI1 A;  2FD5 A;  3TL4 X;  1G59 A;  4UVC A;  1AA7 A;  2K02 A;  3DTE A;  4R1H A;  1LE8 B;  3B02 A;  4LLN A;  4S05 A;  1RZ4 A;  4LJZ F;  3QPH A;  3JCU C;  2WTE A;  2DOD A; 
#chains in the Genus database with same CATH homology
 2V9K A;  4OAY A;  1GLN A;  1J09 A;  1LFP A;  3HG9 A;  3L2R A;  3KYL A;  2DJI A;  3LL7 A;  3OYB A;  2CH0 A;  1YX5 A;  3KEY A;  3VYU B;  2KP6 A;  3DLA A;  1FMW A;  3W2W A;  3F9K A;  1X1B A;  2BW3 A;  2I8D A;  3OYI A;  1N78 A;  5LFA A;  4BXF A;  1BOB A;  2L2O A;  3EUH C;  2VL8 A;  4CCO A;  4RLF A;  3RQ4 A;  1WJB A;  1JI8 A;  1D1B A;  1WJ5 A;  2LY1 A;  4RM3 A;  3BG6 A;  5FRO A;  2MAB A;  4XNF A;  3EUA A;  1NG6 A;  1TT0 A;  3S93 A;  2KHM A;  4Y4R A;  3ZXS A;  2R7T A;  4BUP A;  2AQE A;  4ZJZ A;  2HVR A;  1D0Z A;  1UEL B;  2F4I A;  4XOP A;  2LY2 A;  2V26 A;  4DOZ A;  4XM3 A;  2HU9 A;  3K4N A;  3S8P A;  4XLE A;  4BE0 A;  3DPL C;  4XLC A;  3PL8 A;  2M7B A;  2ZFU A;  1Z3Y A;  3J7A Y;  2LBF B;  4HNU A;  2K9M A;  2V7F A;  3OYG A;  2XF7 A;  4JOM A;  4LG3 A;  4F91 B;  2RRE A;  4YEL A;  1DGW Y;  2VJ4 A;  4FAS D;  4Y3O A;  1X1A A;  3VSK A;  2XF5 A;  3L2W A;  4RMN A;  3D5S C;  2PMZ A;  3QYE A;  3M8J A;  2VPL A;  4N4N B;  2HNH A;  4F3Q A;  3NWS A;  3W3C A;  3DTK A;  2KDO A;  3W2V A;  2CUJ A;  2VB6 A;  4ZDP A;  3OY9 A;  3LSG A;  3ZRG A;  4IQ4 A;  1Y6I A;  2KL4 A;  2UWM A;  3DEE A;  4B3X A;  4BL0 B;  3S3M A;  2X1C A;  4ZC3 A;  3U21 A;  1SFK A;  4BEH A;  3OYD A;  3OYK A;  2KMU A;  3HPH A;  3PJR A;  1UG0 A;  3AL0 C;  2VQG A;  3DTI A;  4XN0 A;  3FHN A;  3K4J A;  3QYB A;  4BEH B;  3A1Y A;  1Z3X A;  4X0G A;  4HNT A;  1PYV A;  3S3O A;  2XAU A;  4CCN A;  3DKY A;  1MMA A;  3H9Q A;  4RM2 A;  4BQO A;  1E0E A;  3W2A A;  3OWT A;  2XDV A;  2OV7 A;  3BC8 A;  3LFU A;  2Q2E B;  4PSW A;  2R7R A;  4XOT A;  2AQF A;  3OS0 A;  3OOU A;  4BE1 A;  3RTR A;  3AL0 B;  2HZD A;  3H9J A;  2OUM A;  2R7S A;  4XLH A;  2MYS A;  4GRI A;  3LSI A;  2E5N A;  2DOA A;  2X1D A;  3HOS A;  3SYT A;  2Z16 A;  5KNL A;  2ZXI A;  1PJR A;  2X6X A;  5CKT A;  2BVL A;  4B43 A;  3I9V 2;  3KX2 A;  4AVZ A;  4DIQ A;  3OYF A;  2R7U A;  4E7H A;  3HC7 A;  4CCK A;  3NWT A;  4E4H A;  4XLF A;  2R7W A;  2IS6 A;  2CUZ A;  2VKD A;  4CCM A;  2GOX B;  2UV1 A;  3E1S A;  2P0W A;  2VXD A;  2IS2 A;  4KIT B;  1OR7 C;  4II2 A;  4HG2 A;  3H9G A;  3G2B A;  3ZGK A;  2ZSI B;  4J00 A;  1TZL A;  2IGK A;  3OYE A;  3OYH A;  1HA8 A;  2M3A A;  4NNJ A;  1MMN A;  3FBN B;  4E7J A;  4XOR A;  2JSP A;  2XSJ C;  4XON A;  2VQC A;  1D1A A;  2BVM A;  2WY7 Q;  1SAU A;  4PJM A;  3K4L A;  3PFY A;  1OLT A;  3DQV C;  3RSN A;  2CV2 A;  3CZ6 A;  3IAM 2;  4JQF A;  4E6K G;  2CW8 A;  2M4K A;  2IGO A;  3OL3 A;  2MD0 A;  3BG7 A;  2LBF A;  4CZC A;  4IX7 A;  1P9Q C;  2IS4 A;  3S32 A;  3OYA A;  2X6W A;  4CCJ A;  4KJZ A;  3DKX A;  1KON A;  1QHH D;  2WAE A;  5HNF A;  4J01 A;  4PFO A;  2R7X A;  3FKJ A;  1EA3 A;  2F5V A;  1WJD A;  2WAD A;  4HRI A;  2E5Z A;  4DJA A;  2Y0S A;  4PUS A;  2HVS A;  3K4K A;  4YRV A;  2W82 A;  3VYR B;  1D0Y A;  2W7N A;  2CS3 A;  5FRN A;  3CP8 A;  2HPI A;  3TMO A;  3A4C A;  4N4O B;  2W1O A;  3H5R A;  2WBM A;  4IQJ A;  4CUG A;  2MC4 A;  5CQE A;  2MFZ A;  3VSL A;  3SEZ A;  2RNG A;  4IZZ A;  1N77 A;  2VKH A;  5HNH A;  3VYS B;  3L2V A;  1BR2 A;  3OIQ A;  3E0J B;  4XKV A;  3DU5 A;  2NOJ B;  1DGR M;  2ZXH A;  1WJC A;  4QPO A;  4OWR B;  3OR2 C;  3H5A A;  3K10 A;  2CV0 A;  2X51 A;  4F93 B;  3DPT A;  3IP4 B;  4XKC A;  4NC7 A;  5HLT A;  2WAF A;  3DWL E;  3HXL A;  2FUG 2;  1WJA A;  2WB1 A;  3LSK A;  3LSM A;  1X4O A;  5FRM A;  1X1D A;  1MMG A;  1N75 A;  3OYJ A;  1V5G A;  1WJF A;  2JA2 A;  3CMM A;  4XKW A;  2IS1 A;  3FDY A;  4BQQ A;  2LG4 A;  1BR4 A;  2W00 A;  4P1W A;  1WFX A;  3AFH A;  3A2K A;  2UUZ A;  1T95 A;  2VQH A;  1W36 C;  3K4C A;  3H35 A;  1WJE A;  3IAS 2;  4DBR A;  3K70 C;  1MNE A;  2IGM A;  3OYL A;  3PNT A;  4PSX A;  2WA0 A;  3RPU D;  2XC7 A;  2VJ5 A;  4YEJ A;  1D0X A;  3TBI A;  3SZG A;  4B47 A;  2E1M C;  2X6Y A;  4HSR A;  4E7S A;  3H5N A;  4BAC A;  2V4J C;  1MW7 A;  2E60 A;  3K6G A;  3CF2 A;  3PUB A;  4NUB A;  3VWB A;  2K3P A;  3MKW B;  3K4B A;  4BJ6 C;  2KRH A;  2R7V A;  1LDK B;  4HPQ A;  4DBQ A;  3K4M A;  4ITV A;  2VJI A;  4CCL A;  3UR3 C;  4P5O A;  5HVQ C;  2PJR B;  4XLA A;  1MND A;  5CPR B;  3S3N A;  4ANJ A;  3OYN A;  2E1M B;  4PJL A;  3I3L A;  3CJR B;  1X1C A;  4H4K C;  2VIX A;  2GOM A;  3MMY B;  2L5Q A;  4BDZ A;  3ONQ A;  2CFO A;  1QHG A;  3EPZ A;  4CH7 A;  2A6T A;  1DQU A;  2VQL A;  2VJJ A;  3OS1 A;  2BOL A;  3OL4 A;  3ZCO A;  4KIS A;  2ZSH B;  1X19 A;  2O5R A;  3QYF A;  2ELJ A;  3CES A;  4HST A;  3C2H A;  1D1C A;  3SDB A;  3PSF A;  4LIU A;  4ZDO A;  3IUO A;  2LRE A;  3PSI A;  2XF6 A;  4AYB A;  3OS2 A;  1YX3 A;  1MMD A;  3HPG A;  2KLO A;  4BJT A;  4II3 A;  3PNY A;  2K5C A;  4MLO A;  4PJN A;  4XKB A;  2BW3 B;  4PK4 A;  5KCM A;  3UNG C;  2JUG A;  4BJ5 C;  2QKL B;  3HKZ A;  4E7L A;  1DP3 A;  4U87 A;  3CP2 A;  1K6Y A;  2F6C A;  1ERD A;  1IRX A;  4F92 B;  3QOE A;  4C9Y A;  2V1N A;  4E7I A;  4XQF A;  4U7B A;  2CMP A;  5CQG A;  4G6T B;  2K9L A;  4ZDL A;  3OIP A;  2M7A A;  2DT6 A;  2R4G A;  3FBI B;  3RCO A;  1W36 D;  4LIV A;  3OYC A;  3OMY A;  2HVQ A;  3D5L A;  4CSW A;  3K70 D;  4E7K A;  4D1Q A;  2Z2S B;  4PFP A;  2KQR A;  3VYT B;  5JHF A;  5TGT A;  3L2Q A;  2WAQ A;  1QU3 A;  2A5W A;  4CA0 A;  1NG7 A;  2WY8 Q;  3H0D A;  3ZQQ A;  1Y56 A;  2Q1Z B;  2CW7 A;  2QKM B;  2DT7 B;  3GBG A;  3QOD A;  2DXI A;  5LD2 C;  4QPQ A;  3BCB A;  3D5R C;  2OC6 A;  2RQQ A;  1UAA A;  2HDW A;  3C2G A;  3OYM A;  4HEA 2;  3DPU A;  3VDX A;  3MKZ A;  2IXS A;  4F55 A;  4BQN A;  4XL9 A;  2Z1D A;  2DCE A;  3L2U A;  1U0J A;  4C30 A;  4R79 A;  4C2U A;  1VZ0 A;  3LMM A;  2LRD A;  2R7Q A;  3OR1 C;  2LYC A;  2JVH A;  4F52 A;  4BS9 A;  4RLQ A;  3PNV A;  4C2T A;  2R7O A;  1LVK A;  3MKY B;  2X85 A;  4ZTF A;  3AKZ A;  3BLY A;  1FMV A;  3CJQ B;  2KPM A;  2L9N A;  4E7Z A;  4OAZ A;  4AU7 A;  4BU2 A;  4BDY A;  4XMY A;  3ZR8 X;  1V5F A;  5HOO A;  2X1E A;  4B48 A;  3DU6 A;  2HPM A;  4IKF A;  2L7K A;  1G8X A;  2W4S A;  3MD2 A;  2VAS A;  2LC2 A;  4ZYA A;  1X4P A;  1Z21 A;  4Y33 A;  1S9H A;  2L9S A;  4BGD A;  2M4G A;  2HQA A;  3M1C A;  4NQW B;  4EAT A;  1Z7L A;  2PJR A;  1ZEL A;  4KT6 A;  4LIT A;  5KHD A;  3HL2 A;  4XN3 A;  1YE9 A;  3BCA A;  2KZV A;  2LH9 A;  4ZTJ A;  2CV1 A;  2IGN A;  3SEQ A;  2KRC A;  3LSH A;  4NC8 A;  4XR6 A;  3HUG B;  2VLA A;  4D9J A;  2JVG A;  1T0F C;  2VXZ A;  2LOO A;  3N05 A;  1V5E A;  3TL4 X;  4B44 A;  4DGW B;  1AA7 A;  2M0M A;  4PJJ A;  3HOT A;  1G59 A;  2V6E A;  3DTE A;  1R6R A;  3EUK L;  1BR1 A;  3V42 A;  4BE2 A;  4FET A;  1LKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...