2JPCA

Ssrb dna binding protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
61
structure length
61
Chain Sequence
LRERQVLKLIDEGYTNHGISEKLHISIKTVETHRMNMMRKLQVHKVTELLNCARRMRLIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords SsrB
publication title SSRB DNA Binding Protein
rcsb
source organism Salmonella typhimurium
total genus 18
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2007-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2jpcA00
4KMFA 1IN8A 2QQ9A 3WTTC 1HXDA 3J80K 2M45A 3WG9A 3BJ6A 4PGGA 1T6SA 1I5ZA 2EA4A 2UXNA 1Z9CA 2QQAA 1V3FA 2P5VA 5D8LB 4U0WA 5LEJA 1W4MA 1P92A 2G9WA 1MJ9A 3L00A 3OV8A 3HSFA 1JXSA 3GW2A 1G3YA 2LF7A 2L54A 2L4MA 4GXOA 2JT1A 3WE2A 1K6OA 1QZZA 3KP5A 2YX4A 1ZRDA 1IN6A 3K2ZA 3SXYA 2A3SA 2DAOA 1V4RA 3K1MA 1LVAA 1SFXA 3I59A 4HLYA 5HDKA 2ZXJA 4Y13A 2DPUA 2O3FA 2XGXA 3CJNA 3ZMZA 2FXAA 4ENMA 1G3WA 3KP7A 3FHZA 1W7PA 1ZG5A 3FXRA 4RGUA 2JTVA 2XV4S 2R3SA 1OKRA 3V4GA 3EYYA 3J81K 5HS8A 3BOQA 4P9FA 1B59A 2EB7A 5LEKA 3F21A 5LHIA 5E8IA 1MD0A 3N97A 1XMAA 3HRMA 1B1BA 5DCFA 3BROA 3T8RA 2FOKA 5JHUA 4IHTA 2ZJ2A 4L18B 2VC1A 3I71A 4U0YA 3R4KA 1TNTA 1H9TA 1LEBA 4ESFA 4KFCA 2Y75A 5D4SA 4EJOA 1IRGA 1KYWA 4IVNA 1BN5A 2KIFA 2NRAC 5E8GA 2IRFG 4P9UA 2VT3A 2RDPA 3I0TA 5ILUA 2OU2A 3CUOA 4WXHA 3G73A 1T98A 2KIMA 1PP8F 1FNNA 2E7XA 3J80Z 2GZWA 4KUMA 2O8XA 3BJAA 2DLLA 2JZYA 2A69F 4L9TA 3V8JA 2CO5A 4WXCA 4ZH4F 5F1RA 3MZHA 2DI3A 3E3VA 3C1DA 4M9ZA 4G6DA 3I59B 3TOBA 4HX4A 1SMYF 4OIOF 1O7FA 3IC7A 1FP2A 5CYVA 5FGMA 2RGVA 5H20A 4MEXF 5HS9A 4RAYA 1TLHB 3LQQA 3ECHA 1EH6A 2EK5A 3IKVA 3GFMA 3FM3A 1OMIA 3FMSA 5E1XA 1ZAOA 2KJCA 3GZ5A 1IXSB 4I2OA 3MAJA 4IXAA 4EM1A 2BEOA 2CG4A 1W7PB 4LJZF 3F3XA 4S04A 2DK5A 1TNSA 3TO9A 4BH9A 2VONA 1UCRA 3MEXA 2Q0OA 4IF4A 1TQMA 5ICGA 4I0AA 3E6CC 2MH2A 2ZNZA 2ZFWA 3J81Z 1GXPA 5D5VB 2HQNA 3ZN0A 4OU0A 3V7SA 1BIBA 4QLCU 4WWCA 1XCBA 5E1WA 3IWFA 2XIGA 2VXZA 3KP3A 1GHCA 2EJRA 3TOAA 4GO1A 3P9CA 2YR2A 3ML6A 4RB2C 4ESJA 2VBXA 1P2FA 5JVTA 4A5MA 1S8NA 2ISZA 2Z99A 3QAHA 2DQLA 2DTRA 2GXBA 3M9AA 1IZ1A 5K5QA 3EDPA 1EV7A 1SFUA 2P4WA 4JK1X 1XGOA 3K1NA 2E1CA 2VN2A 2V1DA 3QU3A 1DP7P 5JI6A 1ZG1A 2OA4A 3BPVA 2F5DA 4RAZA 2ADUA 4LB6B 3F6VA 4ZZLA 4AIKA 4R8HA 2JRTA 1FZPB 3M8EA 5D5UB 2XRNA 1Z7UA 5J8CA 3JSOA 4A0XA 1OPCA 2EA2A 2V1XA 1K7AA 4EJWA 2F5CA 2HKOA 1W5SA 1X3UA 5K1YA 1J7KA 2OQRA 4L9JA 2ACJA 5D5WB 2EFWA 1J0RA 2Y0MA 2IA2A 2FQ3A 1L3LA 2ISYA 3B73A 2GXGA 3KETA 4D0PA 4YFXF 3VOEA 1WRJA 3FX3A 3MQ0A 2HR3A 1WKMA 2EFOA 2VOPA 5A2QK 5LGNA 4CGZA 3L09A 3EQLF 2UXXA 2EFPA 1R36A 2M87A 3KFWX 3E5QA 4I98B 2TDXA 5D5XB 2FBKA 1G3SA 2K7LA 1STZA 2A68F 5HS7A 5FLXZ 2EWNA 3E5XA 4HV5A 3BY6A 3C18A 3LA7A 1D3YA 2W24A 4L9VA 4P5OA 4GYIA 4XRFA 4RB0A 1USTA 3DFGA 3GF2A 3DP7A 1HBXG 5FFXA 5L3EA 1FLIA 1KU9A 1Z6RA 5CVJA 4YFKF 3L7WA 4WX9A 1JHFA 3WE3A 1ON1A 3MCZA 1AOYA 2HTJA 4Y15A 3GX4X 2ESHA 1BI2A 3FMQA 1SAXA 1OYWA 1K78A 5E20A 2GQQA 2PFBA 3FXUA 4EGYA 3RKYA 2HQRA 3IRRA 2VE9A 4AIJA 4RGRA 1XCVA 5H6RA 1JGSA 4CYDA 1KA8A 3BPXA 1T38A 3BWGA 2NNNA 2CYYA 5FD5A 3FM5A 3QRFF 1XGNA 4H0EA 1EH7A 3FF5A 4GYGA 3KLNA 3NEUA 5DDGA 4LD5A 2ZO4A 4ZYGA 1YFHA 2XKPA 2RVCA 1P4WA 1FYMA 3ZMDA 4M74A 4K2EA 3FWEA 1I1SA 4HQEA 3WGIA 3WGHA 2OAZA 5L3FA 1H9GA 4KICA 2WV0A 3HOSA 3P9IA 3M8FA 4R79A 2V79A 3TKYA 2HYGD 3K1PA 2E1NA 3WU0A 2P8TA 5JFRA 2GIVA 5FD6A 2M8EA 1YS7A 3EUHA 3E97A 1U78A 4G8XA 1S6LA 1YYVA 4FT8A 4A6DA 2A6EF 1TW2A 1MDMA 3ZMUA 1R1UA 2RC4A 1HSTA 1SFEA 3DPLC 4B09A 3IKTA 4BXUA 1IXCA 5JR3A 3SQNA 2IA0A 2O0YA 4HW0A 2R7FA 4BYYA 3WTSC 5L3BA 2ESNA 3I64A 2LNBA 5L3CA 2F2EA 2FU4A 2CQKA 3VODA 4HZFA 2BE5F 4UV9A 2Z9OA 1R58A 1NHAA 1ZGJA 3ZMVA 3VEPA 4EM0B 3F8BA 4OMYA 2NNYA 3NQOA 3HHHA 4L5JA 3K0LA 2HKXA 1S7OA 1K78B 4KIFA 3L2CA 1J59A 1F4KA 5AONA 4LG0A 3DXJF 2Q2EA 4CDGA 2VC0A 3S2WA 5LBQA 3Q9SA 3AAFA 4A6EA 1F5TA 1J2XA 2XASA 4DQ2A 3F8MA 3HHGA 3P7NA 2Z5UA 1R23A 4M72A 1ZREA 2VBZA 2DU9A 1P6RA 1MZBA 4L0ZB 4AIHA 2HFHA 4WXDA 1LQ1A 4KIBA 2MC3A 2QBYA 1WI9A 4FX4A 4B8XA 1ZLKA 3V7RA 2FSWA 1U5TC 2LKPA 3GO5A 3BDDA 2L02A 1ZYRF 4BNCA 1E2XA 4OIPF 1B9MA 4A12A 1PP7U 2DFIA 3Q5FA 4DNCA 2BBYA 5HLIA 2RV8A 3DKWA 4XLPF 2Y48A 2XUBA 1MDMB 2OD5A 1I27A 1J5YA 2HZTA 1PUEE 3TDUC 2K27A 2VBWA 3U9GA 1F9NA 4MGRA 3TGNA 2FRHA 3T5XA 3GWZA 4CO8A 4YIFA 2QVOA 2A61A 2WC2A 2DBBA 4ASNA 3J7AO 1TTYA 5DUKA 5BOXA 1SD5A 2W84A 3REOA 4HOBA 2V1UA 2X4HA 4Z2YA 2RQPA 4Q4ZF 1R7JA 3QPHA 3HIFA 1HSJA 2PMHA 4GGGA 4I01A 3HTUA 2P6SA 2PG4A 4MNUA 2XAHA 2YX7A 3CTAA 4IPAA 2QM3A 3CUQC 2GWRA 3ERED 4LG0B 5LGTA 4I09A 3KLOA 1FP1D 3JAMZ 2VOOA 3KP4A 3WTVC 1QPMA 1Q1HA 3I5UA 3P9KA 2CGPA 4A0ZA 2P6TA 3D5LA 1FPQA 3ZMSA 1K79A 2HGCA 1QO0D 3QP6A 2HTSA 1KU2A 2C6YA 4KNYA 3T8TA 2P5LC 4FX0A 2STWA 3WTXC 2QBYB 3F8CA 4BHPA 1T0FA 2ELHA 2YPRA 1FBUA 2PJPA 1ULYA 3V8LA 1PDNC 5CJ9A 3QP5A 2DO7A 5FLXK 2MA3A 1WWXA 3HRUA 1KU3A 2BYVE 3I54A 3I53A 3TDZC 3WU1B 3I4PA 3K69A 4RB3C 2OBPA 1RZ4A 3K9TA 2VE8A 3CO7C 2LDUA 4PGHA 2HOEA 4MTEA 2XAFA 1WQ2A 2EFQA 3F8NA 1XDSA 2UZKA 2IJLA 3HSRA 2DQRA 4O6JA 1R1VA 1OYYA 2CWEA 2ZBKA 4PCQA 1O3RA 3H92A 4ESBA 1T2KA 3GFLA 1R22A 1I1GA 4KT5C 3IWZA 2K02A 3DEUA 3V8KA 2AXLA 5LRRA 4ETSA 1S29A 5CVIA 3F8FA 4E70A 1VTNC 2RN7A 4OINF 5FB2A 2GA1A 3LAJA 3R0JA 2BV6A 3R60A 1IUYA 1FSHA 4CHUA 1U8RA 3RYPA 3RKXA 2O03A 3E5UA 3O6BB 2YSRA 2KKOA 2XAGA 3EYIA 1IF1A 1MJAA 2DPDA 4EQQA 3GLXA 1FBQA 4EV0A 1HW2A 2P7VB 2ZNYA 2ETHA 5EEHA 1KGSA 2IP2A 4OMZA 5LLQA 2COMA 3PFIA 1L0OC 2NAZA 5BQTA 3CLOA 4KYWA 1R5HA 3RJPA 3DQVC 4L9NA 2W25A 1LJ9A 1DUXC 1OR7A 1HW1A 2D1HA 1KU7A 1IRFA 2FEZA 4AD9A 2CFXA 2B0LA 3N4MA 4L0YB 1BM9A 4M9XA 4CZZA 4HF0A 4AVPA 4WCGA 1EH8A 4A2UA 3F23A 1D8KA 2CSOA 1Z05A 5K5RA 2J5OA 3O2PE 4M73A 2FBIA 5AIQA 5E18F 2MD5A 3ZP5A 4LLNA 1R00A 1XGSA 3HUGA 2A6HF 5LRSA 4XBFA 2LSOA 4RGXA 3PQKA 5AIPA 1HW5A 3R6SA 4EJUA 3ECOA 4XSXF 1O3TA 3WTZA 3FMRA 4F7ZA 3KZZA 4HLXA 3W6KB 2PN6A 1U3EM 4RB1A 3G3ZA 3KCCA 4HF1A 4UNOA 5H6QA 5BMZA 1G6NA 4HDVA 5HVQC 2OZUA 3RPQA 1SD4A 3V7CA 5K5OA 5ED4A 3KZYA 4N9HA 1LEAA 3HSEA 2MH9A 5KVRA 4I0BA 2DT5A 5BPIA 1O3QA 4HYEA 3ZMTA 3JTGA 5HDNA 1BBYA 5DCMA 4EJTA 4EVIA 3IL2A 3RYRA 1FC3A 3E6DA 5E17F 3LWFA 4FHTA 3M1EA 4MQVA 1ZG3A 3ELKA 2XKOA 3ZQ7A 1SMTA 2IVMA 2ZCWA 2M1BA 2DK8A 1YG2A 2VT2A 5FFZA 1U6GA 4O3MA 1BJAA 5LGUA 1YQAA 4S05A 2F5FA 5D8KB 4EM2A 3T1BA 5D4RA 1YTYA 1ZARA 2XAQA 2VODA 1JE8A 2OQGA 4IJAA 1S3JA 3MWMA 4AWXB 3LFKA 1IN7A 1XDUA 4HQMA 1O7LA 3HOTA 5ILVA 1QBJA 2RKHA 2JSCA 3COAC 4LLGF 3QU6A 1IAWA 2WTEA 1XD7A 5ICFA 1Z91A 2L3DA 1S7AA 3JSPA 1XSVA 1XN7A 1FY7A 4M71A 1XB4A 4EJVA 3TO7A 2A5YB 1TQIA 2L4AA 2IPQX 3E6MA 5DD4A 1O3SA 4O5VA 3O3KA 1H0MA 4Q48A 3RPUA 4LK0F 3WTWC 1IN4A 2JPBA 3D0SA 3GFJA 3R0AA 4CXFA 5BPDA 3HTSB 2WWYA 1ZHFA 3JTHA 4IRIA 5DYMA 5J8FA 1RUOA 4LGWA 2QENA 1QQIA 4UVBA 5L3GA 4HAMA 2GAUA 2KRFA 5LHHA 2F5EA 2MBFA 1YS6A 1QNTA 3ZPLA 3JAMK 2D1VA 5DV5A 1CF7B 1QGPA 5CVUA 5DCMB 4BHBA 2H27A 4BAYA 2XVCA 5ICEA 2GA2A 1KQ0A 4L5IA 3GEZA 5HDGA 4MEYF 3MZYA 3JW4A 4LK1F 1I6XA 1YW8A 4TV7A 3RKWA 2W57A 4ZYHA 3KEQA 1YLFA 2IT0A 4PZJA 1TBXA 3EETA 1TQPA 1TW3A 2DW4A 1RUNA 5DUIA 4KA4A 3BP8A 1F1ZA 1B6AA 2H6BA 1GVJA 4XSZF 4IHSA 3GYHX 4NQWA 4OOIA 2P7CB 2OZ6A 4EGZA 3GFIA 3HRSA 1CGPA 2V9VA 1FT9A 3GVAA 3LAPA 3VB2A 1D8JA 1UHWA 5IT9Z 1REPC 4Y17A 1FBSA 4UVAA 1Z6TA 2EFNA 3TO6A 3GUDA 2E7WA 4HBLA 5CVRA 1G3TA 3BJOA 4OIQF 4MHGA 4M6YA 1FOKA 3DV8A 3LA3A 3CO6C 3FXQA 4U7BA 4ZZDA 3ROUA 2IW5A 5TJJA 5D6FA 1Y0UA 5E1ZB 2QWWA 3C3WA 3DPTA 1FYLA 3TQNA 1IW7F 4ON0A 5HOOA 1USSA 1ZN2A 2FNAA 1LNWA 3FZVA 3GXOA 1FSEA 1YIOA 1R1TA 3SFZA 4G7ZF 4N9IA 1XSDA 4NHJA 4Q5SF 1P4XA 2H6CA 4WK8F 1FWZA 4UHTA 3MFKA 1A04A 1R5GA 4CICA 2KJBA 1HQCA 4XLNF 2FBHA 5ICCA 5D6EA 3HYIA 1B9NA 1U2WA 3KE2A 4LMYA 3U1DA 5EEGA 2K4JA 5HLGA 2NS0A 1BI1A 2PMUA 1D5VA 1LDKB 4YIIA 2FE3A 1E17A 1YO5C 2Q8KA 4U7DA 2VBYA 4G7OF 1BC8C 1BI3A 3LSTA 2K4BA 3F6OA 3WGGA 4ZYEA 4HF2A 4Q47A 2O61A 4ENKA 3C7JA 1KQ8A 3H3ZA 2FNPA 1LDDA 4HDUA 2QUFA 5KK1A 3WTYC 1XGMA 1ONVA 4OIRF 4UXNA 5CLSA 1W7PD 4BQAA 1YW9A 3GZ6A 3RI4A 3RIRA 2QZ8A 2EV6A 5ERIA 2K86A 4RGSA 1KYZA 1MJBA 1UB9A 1HKSA 2XROA 3Q9VA 3VFZA 1WSUA 4JBAA 1ZLJA 4KN7X 2V6CA 2XHKA 3DF8A 4MQ9F 4UUVA 4YFNF 3B02A 3ULQB 2FF4A 4QWQA 3IRQA 1LDJA 1KQ9A 1DPRA 4EMSA 2M5WA 4IRHA 4RS8A 4ENNA 3HRTA 1YW7A 1ZH5A 1U5TA 1HKQA 4ENJA 5F64A 4G7HF 1ODDA 4R1HA 3QOPA 2H94A 2ZMEA 2QLZA 2CW0F 3L9FA 2JPCA 2STTA 3CDHA 1IN5A 5FO5A 1IXRC 1AWCA 4KN4X 3LA2A 3RTRA 4HV6A 4KDPA 4BHCA 1SD6A 3H3UA 2MLGA 1J75A 2P5KA 3M7GA 2HWVA 1BIAA 1JHHA 2D45A 2ZKZA 4I7HA 3WTUC 2AS5F 2MLKA 2HDCA 1RNLA 1T39A 2R7DA 2PLYA 2IA1A 2PQ8A 2RNJA 2FMLA 2HEOA 3ABUA 4G9YA 5LHGA 4PDKA 1J9IA 2PI0A 3E6BA 4P96A 5HLHA 1ZRCA 3W6JB 4LB5A 2O6GE 2HS5A 5DEQA 1B4AA 2J5PA 3CUQA 4LFUA 1RIOH 3RDIA 3F72A 1MGTA 4MTDA 1DDNA 2HYFA 3ISPA 1G4DA 3T0YA 3ABTA 3OOPA 2LF8A 1RI7A 1SD7A 4ZYDA 3BZ6A 3PQJA 5IT3A 1P4AA 1GXQA 1OYIA 4NB5A 3NRVA 3SZPA 1HKTA 2YU3A 1CF7A 1UHMA 1U5TB 2UWMA 2Z3YA 3KEOA 4HX8A 1BOAA 2M30A 2ZMEB 4GCVA 1QZYA 2G7UA 3WODF 3KP2A 4IRGA 5F6FA 1XMKA 1ZRFA 4UVCA 2A07F 2EV5A 2PBIA 6PAXA 4KIGA 3LQRA 4G94A 2W85A 2G7HA 2X0LA 5TRDA 3I58A 3QPTA 4U0VA 2PEXA 4M6XA 5CVVA 4N0BA 2QQBA 1MKMA 4LLLA 2NYXA 5DD8A 1BI0A 3SZTA 2FMYA 1C0WA 2BGCA 5IT9K 2XAJA 2H09A 4KMUX 2D2WA 2QYOA 2Z33A 3F22A 4JQFA 4UV8A 4HA8A 1Z1DA 4U88A 5ILSA 2EV0A 1BC7C 5L3DA 4G6QA 1LB2A 1DPUA 3KP6A 5A2QZ 4M9SA 4YG2F 2KIUA 3R61A 4A5NA 2L01A 1XSXA 3SHFA 5BS6A 4WF2A 1FX7A 4HX7A 3CUQB 1W5TA 4P55A 1ZGAA 1UFMA 4A0YA 3ZN1A 1ON2A 3U2RA 1O57A 2FA5A 5J6XA 1FYKA 4I02A 3IHUA
chains in the Genus database with same CATH superfamily
3PFYA 5E3LA 3DU5A 4KMFA 1IN8A 2QQ9A 3WTTC 3U1KA 1HXDA 1Y56A 3J80K 2M45A 3WG9A 3BJ6A 4PGGA 5IP7J 1T6SA 1I5ZA 2EA4A 2UXNA 1Z9CA 3OR2C 3B6AA 1TT5B 2QQAA 2VKDA 2L7MP 3K4LA 1V3FA 2P5VA 1Y1WJ 4XONA 5D8LB 4U0WA 3OYJA 1T0FC 1MH4A 5LEJA 1W4MA 3BTCA 1P92A 2BW3B 2G9WA 1YI2I 5CKTA 1MJ9A 3L00A 2R0QC 3OV8A 1FOYA 3HSFA 1JXSA 3GW2A 1G3YA 2LF7A 2L54A 2L4MA 4GXOA 1YJNI 1BA5A 2JT1A 2F6CA 3OIPA 3WE2A 1K6OA 1QZZA 2K9LA 3KP5A 4XR6A 3SEQA 1MNEA 2DMQA 4IQJA 2DT6A 2YX4A 3JRBA 1ZRDA 3OYGA 4LIVA 1IN6A 3K2ZA 1R71A 3SXYA 2A3SA 2DAOA 3HOZJ 1V4RA 2WB1A 1XTAA 3K1MA 4II2A 4B3AA 1LVAA 1SFXA 3I59A 1T8IA 2KHMA 4HLYA 4LIUA 5HDKA 2ZXJA 2DA5A 4Y13A 2DPUA 1VF9A 2O3FA 2CS3A 2XGXA 3CJNA 3PUBA 3ZMZA 2FXAA 4ENMA 1BW6A 1G3WA 3KP7A 4QIWN 3FHZA 2H1KA 3KYCB 2VQHA 2R7SA 4A69C 3CQZJ 1F43A 5E3OA 1DP3A 3FXKA 3L2RA 1Y8QB 1VQKI 2WA0A 2VI6A 1W7PA 4C3IJ 4V19K 2EZHA 1ZG5A 2R7UA 3FXRA 1R4NB 4RGUA 2JTVA 4BQOA 2XV4S 2R3SA 1MH3A 3OSGA 2JJ7A 3ABMH 4BBSJ 1OKRA 3JRIA 3V4GA 3EYYA 3J81K 3CJTB 2AO9A 5HS8A 3BOQA 2M4KA 2VPRA 4P9FA 2IAIA 3S17J 3BTLA 3UR3C 2L7FP 1B59A 2EB7A 5LEKA 3F21A 5LHIA 2W4SA 5E8IA 2HXIA 1MD0A 2M0CA 3N97A 1XMAA 1ZK8A 3HRMA 1B1BA 5DCFA 2DA2A 3BROA 3T8RA 2FOKA 4AC0A 2COBA 5JHUA 4IHTA 2ZJ2A 4L18B 2VC1A 3I71A 3F0CA 4GDFA 1IDZA 4U0YA 3R4KA 3OY9A 2P81A 1TNTA 1B72B 1H9TA 1LEBA 4ESFA 4KFCA 3K70C 2Y75A 3K4NA 5D4SA 4EJOA 1IRGA 3D1NI 3M3YJ 2FX0A 2I5UA 2NOJB 3S1NJ 1KYWA 2CUJA 3S2HJ 2DA7A 4IVNA 1BN5A 2KIFA 2NRAC 5KCMA 5E8GA 2E1MC 2IRFG 1OCZH 4P9UA 3CCRI 3FHNA 2VT3A 2RDPA 5EJCA 3I0TA 3OYBA 5ILUA 1Z77A 1BL0A 2OU2A 3CUOA 4WXHA 3G73A 1T98A 4XN3A 2VLAA 3FXLA 1OR7C 3BG3A 1ETQA 1LPQA 2KIMA 2OCCH 1PP8F 4DIQA 3FIWA 4E7JA 1FNNA 4XN0A 3TL4X 1VFCA 3NWSA 2E19A 1EA3A 2E7XA 3J80Z 1WJ5A 2GZWA 3LOCA 4KUMA 4CCNA 2R7ZJ 2LY9A 2F4OB 2O8XA 3BJAA 2DLLA 2E34A 2JZYA 3ZQGA 2A69F 2OTLI 4L9TA 5TISC 3V8JA 2CO5A 4PSXA 1WJBA 2KPMA 1HDPA 4WXCA 2LR8A 4ZH4F 5F1RA 2ZSIB 3PM1A 3CCJI 4NDLA 3MZHA 2DI3A 3E3VA 3C1DA 3CJRB 3K4JA 4M9ZA 2GXAA 1ETYA 4G6DA 3I59B 3TOBA 3C2HA 2DDBA 4HX4A 4PJJA 1SMYF 4OIOF 1RKWA 2BZTA 1O7FA 3IC7A 2WY8Q 1FP2A 3OMYA 5CYVA 5FGMA 2Q2EB 2OCEA 2RGVA 1N25A 2BHZA 5H20A 3ZQFA 2H1LA 4MEXF 4GFBA 3L2VA 5HS9A 4RAYA 1TLHB 3LQQA 3ECHA 1ERDA 1EH6A 2EK5A 3IKVA 3GFMA 4AYBA 3FM3A 1OMIA 3FMSA 5E1XA 3S8PA 1I3QJ 1ZAOA 2KJCA 3GZ5A 1IXSB 4RM3A 4I2OA 3MKWB 3S93A 3MAJA 4IXAA 4EM1A 2QF7A 2BEOA 2CG4A 1W7PB 4LJZF 3TEDA 3F3XA 4S04A 2DK5A 2JWTA 1TNSA 4XORA 3TO9A 4BH9A 2VONA 1JGGA 1UCRA 1VNDA 3MEXA 2Q0OA 2QSFX 4IF4A 3CCVI 2OPTA 1MMNA 3B6CA 1TQMA 2XF6A 5ICGA 4I0AA 3E6CC 1VQLI 3K4KA 2MH2A 2Y0SA 1R5ID 2ZNZA 1ETOA 2ZFWA 3SDBA 3J81Z 3OYHA 1EJ9A 1GXPA 5D5VB 2HQNA 4JX6A 3ZN0A 3LSPA 4OU0A 2X85A 3D5RC 5HLTA 2H8RA 4IQ4A 3V7SA 1BIBA 3ONQA 4QLCU 2LRDA 4WWCA 4FQGA 1XCBA 5E1WA 3IWFA 1UJ8A 3BR0A 2XIGA 2VXZA 2K9SA 3UNGC 3HG9A 3KP3A 3S1QJ 4XKVA 1GHCA 2EJRA 3TOAA 1Z7LA 4IOAF 3PNVA 4GO1A 3P9CA 3JRDA 2YR2A 3ML6A 4UUSA 4RB2C 4ESJA 3OYKA 2VBXA 3RQIA 2IGNA 1P2FA 2YUSA 4A5MA 1S8NA 5JVTA 1ZELA 2ISZA 2XGDA 2Z99A 3ERMA 3QAHA 2X1DA 1BR4A 2DQLA 1OISA 2DTRA 3A0BC 3HKZA 2GXBA 3M9AA 3OL4A 2LKXA 2IS2A 1IZ1A 2EIJH 2BY1A 5K5QA 3EDPA 4BQQA 3O8HA 1D1CA 3AL0B 1EV7A 4AUXA 2DXIA 2LREA 1SFUA 1LE8A 2P4WA 4XLAA 2JMWA 4JK1X 1XGOA 3K1NA 2E1CA 2VN2A 2V1DA 3QU3A 4C3HJ 1DP7P 5JI6A 1ZG1A 2DMTA 2L9VA 2OA4A 2QKMB 3BPVA 1XS9A 1U9NA 2WY7Q 4CCMA 2F5DA 4RAZA 2ADUA 4LB6B 1MMAA 3F6VA 4ZZLA 4AIKA 3KYDB 4R8HA 4V2FA 3KPHA 3CF5F 2JRTA 1QHHD 2CW7A 1FZPB 3M8EA 1HF0A 2MABA 4PJNA 5D5UB 1JKOC 2XRNA 1Z7UA 3BG9A 4G12A 5J8CA 3JSOA 5J1YA 4A0XA 1OPCA 2EA2A 4XMYA 4ZDPA 2IS1A 3OSFA 2V1XA 1K7AA 4XRMA 4EJWA 2F5CA 5KAIC 1UZCA 2HKOA 3VYSB 1W5SA 1X3UA 3FXMA 4PK4A 2Y31A 5K1YA 1W0TA 1J7KA 3ZQHA 4A3BJ 2OQRA 4L9JA 4FETA 5C4JJ 2ACJA 5D5WB 1CQTA 2EFWA 1J0RA 2Y0MA 4ZDOA 2IA2A 2FQ3A 2KT0A 1L3LA 4RBOA 2ISYA 3B73A 1VQ7I 3S16J 5EF6A 2GXGA 3KETA 4BBRJ 4D0PA 4YFXF 2QCOA 1JKQC 3VOEA 3SJMA 1WRJA 3A01A 3FX3A 2KFDA 3MQ0A 1NK2P 4NBQA 2HR3A 3GTLJ 1I6HJ 3DKXA 3H9JA 5EZHA 1WKMA 2EFOA 2VOPA 2F48A 5A2QK 3SDGA 5LGNA 2DJNA 3H0GJ 2HPMA 5J1UA 4CGZA 4XQFA 3L09A 3EQLF 3ZQCA 2UXXA 3BR5A 3G2BA 2EFPA 3O8GA 5K7FA 5CPRB 3SZGA 1X1DA 1R36A 1K4TA 2M87A 3VYRB 3KFWX 4A3KJ 1RR8C 4YEJA 2TCTA 3E5QA 2KDOA 4I98B 4AVZA 2TDXA 5D5XB 2FBKA 1G3SA 2LY1A 1OJLA 2M7AA 1YJ9I 2K7LA 1STZA 2A68F 5HS7A 3UKGA 2DYSH 5FLXZ 2HQ5A 2EWNA 3E5XA 2VQCA 5IP9J 4HV5A 3BY6A 1RC9A 3C18A 3LA7A 2DDAA 3V42A 2UV1A 1D3YA 2W24A 2VXDA 4L9VA 4E7HA 4MO7A 1BR2A 4P5OA 4GYIA 4XL9A 4UUSB 4XRFA 4RB0A 3FXJA 1FOWA 1USTA 3DFGA 1JUPA 3W2WA 3GF2A 3DP7A 2KRHA 1HBXG 5FFXA 3S32A 3LSKA 5L3EA 1FLIA 1KU9A 4PJ0C 3PUFA 1Z6RA 5CVJA 4DJAA 1DU6A 1WJAA 1D5YA 4YFKF 3L7WA 4WX9A 4DW6A 4V2GA 1RRJA 2JSPA 2L9RA 1LE8B 4RM2A 1JHFA 3WE3A 2LK2A 4C3JJ 3OS2A 2VL8A 4LG3A 1WJFA 1ON1A 5IYCJ 3MCZA 1AOYA 4CH7A 2R7VA 2HTJA 2WAEA 4Y15A 3GX4X 2A5WA 2ESHA 5J4YA 1MSFC 1BI2A 3FMQA 1SAXA 1OYWA 3M07A 3VDXA 4BE2A 2LD5A 1K78A 3FK6A 2GQQA 2PFBA 3HC7A 5E20A 4XOTA 3FXUA 4EGYA 3RKYA 2DFFA 3TW6A 3K2AA 2HQRA 3IRRA 1YX5A 1FMVA 2VE9A 2HZDA 4AIJA 4RGRA 1AHDP 1XCVA 5H6RA 3K7AJ 2PX9A 4BEHA 1JGSA 2HVSA 1OCOH 4CYDA 5K7ZA 1R9TJ 1KA8A 2DMPA 3G1LA 4MLOA 3BPXA 1T38A 2DCEA 3BWGA 2XB5A 2NNNA 1FIPA 2CYYA 5J47A 2A05A 2Y0SN 2EIKH 2CMPA 3FM5A 5FD5A 4D1QA 1XGNA 3QRFF 3TP0A 4H0EA 1EH7A 3G6EI 2K9QA 1TWCJ 3FF5A 2XC7A 4GYGA 2LKSA 3KLNA 2VKEA 4M6VA 5J4VA 2BY0A 4UUTA 3NEUA 5DTDA 5F1JA 5DDGA 2MW8A 3H3VK 4LD5A 5IYDJ 2WADA 2ZO4A 4ZYGA 1YFHA 1N77A 2XKPA 2M34A 2RVCA 1P4WA 3M4OJ 3QYFA 1FYMA 3ZMDA 4M74A 4K2EA 3FWEA 3KIOA 1I1SA 3DEEA 3S14J 4IOCF 4HQEA 3HEFA 1U0JA 3WGIA 3WGHA 2OAZA 4HG2A 3K70D 2R7QA 5L3FA 1H9GA 2E36A 2LLKA 3AKZA 3A01B 4KICA 1JI8A 4FTHA 2WV0A 1P7JA 2VJ5A 2G0EA 3HOSA 4BY1J 3P9IA 3GBGA 3M8FA 4X1EA 3OYIA 4KITB 4R79A 2V79A 3TKYA 2HYGD 3K1PA 2E1NA 3WU0A 2P8TA 1BR1A 5JFRA 2GIVA 3C2GA 5FD6A 2M8EA 2CQQA 1YS7A 3EUHA 1X3WB 3CCMI 1ETXA 3E97A 2JK3A 1U78A 4G8XA 1S6LA 1YX3A 5FKKA 2YS9A 1YYVA 4FT8A 2M3AA 4A6DA 2A6EF 1TW2A 1MDMA 1FJLA 2ZFUA 3ZMUA 3ZOBA 4FISA 1R1UA 3FKIJ 2JVHA 5GAHJ 2R7RA 1UHSA 2RC4A 3A4CA 1HSTA 1SFEA 3DPLC 4B09A 3IKTA 4BXFA 2OTJI 4BXUA 5HODA 1IXCA 3I4MJ 2EH3A 2LH9A 5JR3A 3VYTB 3SQNA 2IA0A 1ZTRA 2HXOA 2LVSA 3ZQIA 1ZR2A 1LFBA 3W2VA 1HA8A 3IV5A 2M7BA 3HXLA 2O0YA 4DOZA 4A3MJ 4XK4A 1P7IA 4HW0A 2ID3A 2R7FA 3DU6A 4BYYA 3WTSC 5L3BA 1POGA 2ESNA 5M3FJ 3I64A 2LNBA 1X2MA 1R49A 1YHQI 2VPLA 5L3CA 4CCKA 2F2EA 2FU4A 1XX5A 2CQKA 1A35A 2L7ZA 3VODA 3CDIA 2DT7B 4HZFA 2BE5F 4CCJA 4CCOA 4UV9A 1UAAA 2Z9OA 1W1WE 1R58A 1RETA 1NHAA 1ZGJA 3ZMVA 3VEPA 1OCRH 2CQXA 2L9SA 4EM0B 3F8BA 2XAUA 3BTJA 5JLXA 1TWFJ 2JVGA 2VQLA 1X1PA 4PFOA 4OMYA 2NNYA 2KZVA 2DOAA 3JR9A 3NQOA 3HHHA 3BCAA 4L5JA 3K0LA 2HKXA 1S7OA 1UG2A 1K78B 2E1OA 3FKJA 5F27A 4KIFA 3L2CA 1J59A 1F4KA 2Z2SB 4BEHB 5AONA 4LG0A 1Q1VA 3DXJF 2K3PA 3LFUA 2Q2EA 5GPCA 2CV1A 1X4PA 1Z67A 4CDGA 2VC0A 3S2WA 5LBQA 3Q9SA 3AAFA 4A6EA 4C2UA 1F5TA 1J2XA 2XASA 3FK7A 3A0HC 5IYBJ 4DQ2A 3F8MA 4E4HA 3H35A 1WJCA 1PUFA 3HHGA 2ECCA 2FQ4A 2Z5UA 3P7NA 3HPHA 1R23A 4M72A 1ZREA 3LSHA 2WV1A 2VBZA 1K6YA 2DU9A 1P6RA 1MZBA 4L0ZB 3BR1A 4AIHA 3HPGA 3I3LA 1TL8A 2HFHA 3KZIC 1PVEA 2K9NA 4WXDA 1HDDC 1LQ1A 2L2OA 2JA7J 4KIBA 1GLNA 2MC3A 1M1EB 2OF7A 3JRHA 2VKVA 4JP0A 2QBYA 3S15J 1WI9A 3VYUB 3HOUJ 2DMNA 1N78A 4FX4A 4B8XA 2JA2A 1GV5A 1ZLKA 3CC4I 2XSJC 3V7RA 2FSWA 4FE7A 1U5TC 2LKPA 3GO5A 3BDDA 3CP2A 2L02A 2L7KA 2PMZN 2ZJQF 1ZYRF 4BNCA 3CLQA 1E2XA 2A6TA 4OIPF 2ZMEC 1B9MA 4A12A 1PP7U 2IS6A 1D0XA 2DFIA 4NC7A 4F52A 2DA4A 3Q5FA 4DNCA 2BBYA 2NVYJ 5HLIA 2RV8A 3DKWA 5K7HA 2E2JJ 4XLPF 2Y48A 1MBHA 2XUBA 1MDMB 2OD5A 1I27A 1J5YA 4P1WA 1NH3A 2HZTA 3ZRGA 1PUEE 1QHGA 1N75A 3D5SC 3TDUC 2K27A 2VBWA 3U9GA 1F9NA 4Y4RA 4MGRA 3TGNA 2EZLA 3HOVJ 3HOXJ 2FRHA 2ZJRF 3T5XA 2GOMA 3GWZA 4FASD 4CO8A 4YIFA 4BL0B 4IKFA 1QVUA 2HVRA 3LSRA 2QVOA 2A61A 3HGYA 5FRNA 2ECBA 2WC2A 5TGTA 2DBBA 4LITA 2RNGA 4ASNA 4ZTJA 3ZXSA 5FRMA 3J7AO 1TTYA 4ZTFA 4J00A 5DUKA 3G1OA 5BOXA 1VQ8I 1SD5A 4XICA 2W84A 3REOA 4HOBA 2EZIA 2K85A 2X4HA 2V1UA 1RKTA 4PJMA 1FMWA 1Y0NA 4Z2YA 2DYRH 3BLYA 2RQPA 1JKPC 3RQ4A 3RZOJ 4A93J 4BUPA 4BJTA 5EDNA 2X9DA 4Q4ZF 1R7JA 3QPHA 1YJWI 4M3FA 3RPUD 4B43A 3HIFA 1HSJA 1W0UA 5FKNA 4IHWA 2KRCA 2PMHA 4GGGA 3NARA 2E35A 4I01A 3LMMA 1A6IA 3HTUA 4A3JJ 1V55H 2P6SA 2PG4A 4MNUA 2XAHA 2YX7A 3CTAA 3MZ8A 2VASA 4IPAA 4IHXA 1H88C 4A3IJ 3K4BA 4XLFA 4XIDA 5EYRA 2QM3A 1SANA 3A1YA 1K4SA 3CUQC 2GWRA 3ERED 4G6TB 4LG0B 5LGTA 1QA6A 1QZEA 4I09A 4A3DJ 3KLOA 2R7OA 1FP1D 3BQZA 2EZKA 3JAMZ 2R7TA 2VOOA 2BXZA 3KP4A 4C30A 3WTVC 1MMGA 5FJ8J 2D5VA 1QPMA 1Q1HA 2NXNB 1Z21A 3I5UA 1WH5A 1TWHJ 3P9KA 5EG0A 3CCEI 4A0ZA 2P6TA 2CGPA 1PUFB 3D5LA 2FD5A 1FPQA 3ZMSA 1K79A 2NVTJ 2HGCA 1QO0D 2W1OA 3ABKH 3QP6A 1X1CA 5J1RA 2ZSHB 1TT0A 4B1RA 2M0MA 2BHYA 2HTSA 1KU2A 2C6YA 4JYKA 4KNYA 3T8TA 1A5JA 2P5LC 4M3GA 4FX0A 4ZC3A 4RAGA 1T56A 2AQEA 1BOBA 4ZDLA 3WTXC 3JRGA 2E5ZA 2STWA 3ESWB 4Y7NJ 3A02A 2QBYB 5EGOA 1Z3YA 1JKRC 3DBHB 3IAS2 3F8CA 1TC3C 3NWTA 4BHPA 1T0FA 1FTTA 2ELHA 2YPRA 1FBUA 2MYSA 2PJPA 1ULYA 3V8LA 1PDNC 2DN0A 2LOOA 5CJ9A 3QP5A 3ZQQA 4HNUA 2F5VA 2DO7A 2ZXHA 3A2KA 5FLXK 2IXSA 2JRMA 5J40A 2MA3A 3GTJJ 1WWXA 3HRUA 5IP6A 1KU3A 2BYVE 1JTXA 2HQAA 3I54A 3I53A 4A3FJ 2NVXJ 1GV2A 3TDZC 5GPAA 2IS4A 3WU1B 2V6EA 3ZCOA 1K83J 3I4PA 1VZ0A 3K69A 4KISA 4RB3C 2OBPA 5M3MJ 1DQUA 3S1MJ 1RZ4A 3TMOA 4A3EJ 1MMSA 3K9TA 2VE8A 3CO7C 2LDUA 2AHQA 1JJ8C 4PGHA 4QPQA 2WAQA 2ZB9A 2HPIA 2HOEA 4MTEA 3PSIA 2XAFA 3CCUI 1WQ2A 3GCMA 2QQ8A 2EFQA 3F8NA 1MBJA 2WB1N 1XDSA 2UZKA 3E7LA 3M1CA 3JREA 5HNHA 2I10A 5GADJ 1A6QA 1WCMJ 3IP4B 2IJLA 3HSRA 2DQRA 4O6JA 1R1VA 1OYYA 1FEXA 2M9HA 1MNMC 2CWEA 2ZBKA 4PCQA 3S3NA 1O3RA 3H92A 1IV8A 4ESBA 1R4MB 1T2KA 3GFLA 5B1AH 5KHDA 3HOWJ 1R22A 1I1GA 4KT5C 4BS9A 3IWZA 2K02A 3DEUA 3V8KA 1IRXA 4MFEA 2AXLA 1ORKA 5B5EC 2LMDA 5LRRA 4BJ5C 3Q0UA 1MBKA 2X6WA 4ETSA 1S29A 5F0FA 2Q1ZB 3C2BA 3F8FA 5CVIA 3S1RJ 4E70A 1VTNC 4OWRB 4C9YA 3ZQLA 1TWAJ 2RN7A 1ETKA 4OINF 5FB2A 3DLAA 2GA1A 3LAJA 2HOTA 3SFIA 2M8GX 3R0JA 3RZDJ 4BQNA 3CP8A 2BV6A 3R60A 1IUYA 1FSHA 2HU9A 3GZNB 1U8RA 4CHUA 4N4OB 3RYPA 3RKXA 2O03A 3E5UA 3EPZA 3O6BB 5KAFC 3PIOF 2OC6A 2I8DA 2YSRA 3AG4H 2KKOA 2XAGA 3EYIA 1IF1A 1MJAA 2DPDA 4EQQA 3GLXA 3BR2A 3BC8A 2BVLA 2CV0A 1LFUP 1FBQA 2BY3A 4EV0A 1HW2A 2P7VB 1NG6A 2DOFA 2ETHA 2ZNYA 4DYCA 4BXXJ 5EEHA 1KGSA 4PSWA 1IO2A 2IP2A 4OMZA 3MN2A 5LLQA 1MNDA 2EQRA 2COMA 3WU2C 3PFIA 5EG0B 1L0OC 2NAZA 1T08B 2XPWA 3BG6A 2K40A 2CRGA 5BQTA 2LFBA 2QKLB 2NS8A 3CLOA 4PUSA 1LKXA 3G4SI 4KYWA 5JVGF 3K10A 5JHFA 1R5HA 1KONA 3RJPA 3DQVC 2CU7A 4L9NA 2W25A 1LJ9A 1G8XA 4OAZA 4BE0A 1H8AC 1DUXC 1OR7A 1HW1A 1WH7A 2D1HA 3HL2A 3QPLA 1KU7A 1IRFA 2JA8J 5EGOB 2FEZA 4AD9A 2CFXA 2B0LA 4CSWA 3N4MA 2R5ZA 4L0YB 2LBFA 3AG2H 1FTZA 1VQ6I 4MFDA 1BM9A 1WJDA 2XGCA 4M9XA 2ID6A 3LSMA 4HF0A 4CZZA 3OYEA 4AVPA 1SVOA 4WCGA 1EH8A 5FKLA 4A2UA 3F23A 4F3QA 1D8KA 2CSOA 5F0CA 1Z05A 5K5RA 2QEXI 2J5OA 3LSJA 2EBIA 4L5EA 3O2PE 4M73A 2FBIA 5AIQA 5E18F 2MD5A 4HSRA 3ZP5A 4LLNA 1R00A 1XGSA 3HUGA 4F55A 2A6HF 5LRSA 4XBFA 2LSOA 4YIRX 4RGXA 3PQKA 4XLHA 5GAGJ 1MBGA 2E2IJ 5AIPA 1HW5A 1IC8A 3R6SA 5B3SH 1JUSA 4EJUA 3ECOA 3MKZA 3LSGA 4XSXF 5FKMA 2V9KA 5GTHC 1D0ZA 3WTZA 1O3TA 3FMRA 3WG7H 3DTKA 4F7ZA 2CW8A 3KZZA 4HLXA 4XKBA 2LTPA 2PN6A 3W6KB 3CC7I 1U3EM 4RB1A 1YRNA 1TWGJ 3G3ZA 3KCCA 4HF1A 4UNOA 5M5XJ 4HNVA 5H6QA 2Y69H 5GTIC 5BMZA 1UG0A 1G6NA 1HCRA 3FBNB 2OJED 2X6YA 1BW5A 3CESA 1S72I 1V54H 3HM5A 4HDVA 2R7XA 5HVQC 2XPVA 3HDDA 5FLVA 2HYJA 2OZUA 1EF4A 3ASOH 3RPQA 1SD4A 2XRLA 4RLFA 3V7CA 5K5OA 5ED4A 3KZYA 2DTZA 4YELA 1IJWC 4N9HA 3TP3A 4Z6YA 1RR7A 3IH2A 1LEAA 1QVTA 3HSEA 4AYBN 3TBIA 2MH9A 4BKXA 4QPOA 1G2HA 5KVRA 2V9PA 4I0BA 2DT5A 5BPIA 4UY8I 1FOXA 4F92B 1XMXA 1O3QA 4HYEA 1DGRM 4QTRA 3P5JA 2L9NA 3ZMTA 2CJJA 3JTGA 5HDNA 1BBYA 5DCMA 4JX4A 4EJTA 3DCFA 4EVIA 3IL2A 1A31A 3RYRA 2OV7A 1FC3A 3E6DA 2WAFA 5E17F 2GBYA 3LWFA 2ZC2A 4FHTA 3M1EA 1R6RA 4MQVA 1ZG3A 3ELKA 3X2QH 2W82A 4BDZA 3PO3J 5F04A 2XKOA 2VB6A 2HI3A 3PNTA 3ZQ7A 1SMTA 5DM7F 1AU7A 2CQ7A 2IVMA 3PSFA 3CMAI 2ZCWA 2M1BA 2DK8A 2IEKA 1YG2A 1SEUA 2VT2A 1EKEA 3CDLA 5FFZA 1U6GA 4O3MA 4RLQA 1BJAA 5LGUA 5C3EJ 1YQAA 1ZKGA 4S05A 1IUFA 3OS1A 2F5FA 3ASNH 5D8KB 4EM2A 5E3MA 3EUAA 3CCLI 3AL0C 2DFEA 3T1BA 5D4RA 1YTYA 2E1MB 2VJJA 1ZARA 2XAQA 3S3MA 1Y6IA 2VODA 1JE8A 2OQGA 4E7KA 4IJAA 4UB6C 1S3JA 1HOMA 3MWMA 4AWXB 3IH3A 3LFKA 2CQNA 2CUEA 5M5WJ 1IN7A 1X3ZB 1U9OA 1XDUA 3HKZN 4DZJA 4HQMA 1SAUA 1O7LA 3HOTA 3AG3H 3CZ6A 5ILVA 2R5YA 1QBJA 4N4NB 4XRSG 3GTMJ 2RKHA 4IX7A 3F9KA 2JSCA 2R5ZB 2LBFB 2W7NA 4B44A 3COAC 4LLGF 9ANTA 3QU6A 1IAWA 2WTEA 1X58A 1Y8RB 1XD7A 5ICFA 1Z91A 1JT6A 2ZJPF 2L3DA 2QSGX 1S7AA 3JSPA 2UUZA 4XRSA 1XSVA 2X1CA 2OUMA 5LD2C 4W1UA 2O7OA 1XN7A 3HUGB 1FY7A 1NTCA 4M71A 1XB4A 4NC8A 1V5EA 4BJ6C 3MKYB 2AQFA 1AKHA 4EJVA 3TO7A 1E3HA 2A5YB 4A3CJ 2ME0A 1MSEC 5JLWA 1TQIA 2L4AA 2IPQX 3E6MA 4NNJA 5DD4A 1O3SA 4O5VA 2N8GA 3W3CA 3O3KA 1H0MA 4Q48A 3RPUA 4LK0F 1IN4A 2JPBA 3WTWC 5J3LA 3D0SA 1NG7A 3GFJA 3OIQA 3R0AA 4CXFA 1YRNB 4RAFA 5KNLA 4M3EA 2EINH 4MIMA 3BR6A 5BPDA 3S2DJ 2Y30A 3HGGA 3HTSB 3W6VA 2WWYA 1ZHFA 3JTHA 4IRIA 1YOVB 5DYMA 5J8FA 3FDYA 3MVPA 1RUOA 4LGWA 2QENA 3G71I 1QQIA 4UVBA 1MMDA 4HAMA 5L3GA 2GAUA 2KRFA 5LHHA 2IGOA 4D7MA 2E2HJ 1OQYA 2ELJA 2F5EA 3QWLA 3FXOA 4FE4A 4C2TA 2YU9J 4LOCA 4CA0A 2MBFA 4QSHA 2NVUB 3WHBA 1YS6A 3PL8A 1QNTA 2FUG2 3ZPLA 4IO9F 1LVKA 3JAMK 2D1VA 3H5RA 5DV5A 1MBFA 1CF7B 1QGPA 2EIMH 5CVUA 1WHUA 5DCMB 4BHBA 1PYVA 1IRZA 2H27A 1I50J 3MKLA 1JUMA 4BAYA 2K5CA 2XVCA 5ICEA 2GA2A 1KQ0A 2O8KA 4L5IA 3GEZA 5HDGA 2XGEA 4MEYF 3MMYB 1HC8A 1I39A 2FJ1A 3MZYA 2K3FA 3JW4A 3SYTA 1TZLA 1VQ4I 4LK1F 1I6XA 1YW8A 4B3XA 4TV7A 4AIDA 3IH4A 4W97A 4DGWB 2BXYA 3I56I 3RKWA 3E0JB 3DBLB 3MD2A 3BQYA 2W57A 3IUOA 4ZYHA 3BTIA 3KEQA 4XNFA 3GLLA 1YLFA 5E79C 2IT0A 1Z0XA 4PZJA 1TBXA 1VI0A 3EETA 1TQPA 3I9V2 1TW3A 2DW4A 1RUNA 2GIZA 5F08A 5DUIA 1Y39A 4KA4A 3BP8A 4Y3OA 3DPUA 1F1ZA 4Y33A 3KEYA 1B6AA 1VQNI 2CV2A 2H6BA 1GVJA 3CMEI 4XSZF 2EPFA 3JRFA 1UELB 2V1NA 4IHSA 5M5YJ 3VSKA 1OCCH 4NQWA 3VPRA 3GYHX 4OOIA 2P7CB 2OZ6A 4EGZA 3GFIA 3HRSA 2PJRB 4IHVA 2R5YB 2KZGA 2RQQA 1CGPA 2V9VA 1FT9A 1VQPI 3GVAA 3LAPA 2DA3A 3VB2A 4EEFG 2DOEA 1D8JA 1W36D 1UHWA 3OYDA 5IT9Z 5GAEJ 1FIAA 1REPC 1G59A 4Y17A 3H5AA 4ITVA 1HLVA 1FBSA 1IGNA 4DYQA 4UVAA 4BGDA 1Z6TA 4CCLA 2EFNA 3TO6A 1GDTA 3L1PA 3GUDA 1AKHB 5B1BH 2XB0X 4IL6C 2E7WA 4HBLA 4E7SA 1PJRA 5CVRA 1X1BA 1G3TA 3BJOA 1S7EA 5CQEA 4YRVA 3J7AY 1W5CC 3QOEA 5IOZA 4OIQF 3EUKL 5IPAA 4MHGA 1WJEA 3K4MA 4M6YA 1FOKA 3DV8A 3U21A 3LA3A 3OR1C 2EILH 4XM3A 2DFHA 3CO6C 2KL4A 3DBRB 3BCBA 3FXQA 4U7BA 1RESA 4F93B 1IDYA 4HNTA 3I55I 4ZZDA 3ROUA 2IGKA 2IW5A 3QYBA 4H4KC 2JQ7A 1WFXA 5TJJA 4D5CA 5D6FA 1Y0UA 3HB9A 5E1ZB 2QWWA 4E6KG 2JA6J 3BZKA 1X2NA 3QQAA 2DA1A 3C3WA 3DPTA 1FYLA 3TQNA 2JA5J 3DLLF 1IW7F 3KYLA 2IBDA 3GTKJ 4ON0A 1ENHA 5HOOA 1USSA 1ZN2A 2FNAA 1O4XA 1LNWA 3FZVA 3GXOA 1IV6A 1FSEA 2Y9YA 1YIOA 3ZGKA 1R1TA 3SFZA 2XDVA 2L0KA 4G7ZF 4N9IA 4D7NA 1XSDA 2BOLA 2HNHA 4E7ZA 4NHJA 4Q5SF 1P4XA 2H6CA 4WK8F 1FWZA 4UHTA 3MFKA 1A04A 3K6GA 2Z1DA 2DA6A 1R5GA 3CCSI 3CCYA 4CICA 2AXTC 3BG7A 3Q0VA 5IY5H 3PJRA 2KJBA 1HQCA 4XLNF 3OYFA 1S5LC 1VQ5I 2FBHA 5ICCA 5D6EA 2KP6A 4J01A 3HYIA 3S3OA 1B9NA 1BJZA 1U2WA 2ICWG 3KE2A 5FROA 4LMYA 1DU0A 3U1DA 5EEGA 3TW7A 2K4JA 4A3GJ 4XLCA 5HLGA 4XOPA 4B4CA 2NS0A 1BI1A 2PMUA 4M3BA 1D5VA 1LDKB 4YIIA 4NC6A 2FE3A 2VJIA 3CD6I 1E17A 1YO5C 4IZZA 2ME6A 2Q8KA 2KISA 4HSTA 4U7DA 1OCTC 2VBYA 3GTQJ 2O5RA 1IG7A 3M8JA 3SEZA 1BC8C 1BI3A 3LSTA 4G7OF 2K4BA 3F6OA 3WGGA 4ZYEA 2X6OA 4HF2A 4Q47A 2O61A 1QU3A 4ENKA 3H9GA 3C7JA 1RPWA 1KQ8A 3VSLA 1WVRA 3H3ZA 2FNPA 2MSYA 2X6XA 1ETWA 1LDDA 3BZCA 4UB8C 2QUFA 4HDUA 5KK1A 3WTYC 1XGMA 5HNFA 3PIPF 3OIOA 3G1MA 1ONVA 3H9QA 4NQWB 5EEAA 2B9SA 1OLTA 3DWLE 4NUBA 4OIRF 3KX2A 4UXNA 4JOMA 5CLSA 1W7PD 4DBRA 2R93J 4BQAA 1YW9A 2HDWA 2NS7A 3GZ6A 4BE1A 3RI4A 3RIRA 2QZ8A 2EV6A 2ELKA 2GM4A 2MFZA 5ERIA 3GTOJ 4D9JA 1T33A 2K86A 2GOXB 1ETVA 4RGSA 4DBQA 2B63J 1SC7A 2FOWA 2QGUA 1OFCX 2V7FA 4M3DA 1E3PA 1JTYA 1ZQ3P 3HBLA 2VQGA 1KYZA 3CCQI 1ZR4A 3NAUA 2JN6A 1MJBA 1UB9A 4BACA 1HKSA 2MGQA 4II3A 1V5GA 4I99C 2XROA 3Q9VA 3VFZA 3QYEA 1Z3XA 1WSUA 4JBAA 1ZLJA 2LP0A 4KN7X 4U87A 1W36C 2XHKA 2MC4A 1MIJA 2V6CA 3DF8A 3J7ZI 1D1AA 3HZJA 4MQ9F 2HDDA 3L2WA 2NOGA 4UUVA 2MG4A 4YFNF 3B02A 3ULQB 1E3OC 2FF4A 4QWQA 3IRQA 3HJEA 3I4NJ 2KDZA 1LDJA 1ITYA 1KQ9A 1LUJB 1DPRA 4B48A 2LY2A 3OOUA 4EMSA 2M5WA 4IRHA 4RS8A 2DODA 4ENNA 1QRYA 2M4GA 3HRTA 1YW7A 1ZH5A 1U5TA 1HKQA 4ENJA 5F64A 4G7HF 4CUGA 4HPQA 1ODDA 4R1HA 2JUGA 1QPIA 2Y9ZA 3QOPA 2H94A 3EUHC 2ZMEA 5E3NA 3GTGJ 2QLZA 2GLOA 3AFHA 1WPKA 2CW0F 3L9FA 2JPCA 2ZXIA 2E71A 5LFAA 2X51A 4GRIA 2STTA 1D0YA 2MD0A 3H0DA 1H89C 3W2AA 3CDHA 5C4XJ 2X48A 2F4MB 4JX5A 1IN5A 2F4IA 3BR3A 4X6AJ 2CUFA 5FO5A 1IXRC 1GVDA 1AWCA 3J7YJ 4KN4X 1VQ9I 3LA2A 3OYAA 4DYRA 3RTRA 4HV6A 1APLC 4KDPA 4EATA 4BHCA 2VUMJ 1V5FA 3JRAA 1SD6A 3H3UA 1X19A 1P9QC 1VQOI 2RAEA 2LYCA 2MLGA 1J75A 4A3LJ 1XG1A 3DKYA 1SFOJ 1YE9A 2P5KA 2M2EA 1SFKA 4XLEA 4C2MJ 1F36A 4IEJA 2DJIA 2L5QA 1ACIA 3M7GA 1J09A 4X0GA 2HWVA 4ANJA 4S0HB 1BIAA 1JHHA 4BY7J 2WBMA 1SVMA 2D45A 2ZKZA 3IAM2 1I3AA 1B8IA 2DMUA 4I7HA 3WTUC 1VQMI 3CF2A 2AS5F 4HEA2 2MLKA 1MBEA 3OYNA 2HOSA 1KZHA 1K61A 2HDCA 2JUCA 3L2UA 1RNLA 1T39A 5B66C 2LG4A 2R7DA 2PLYA 3RKQA 2IA1A 2PQ8A 1XC5A 2RNJA 2FMLA 3CC2I 3BG5A 2HEOA 4CZCA 3ABUA 3H5NA 4G9YA 3A03A 3DTEA 3JCUC 5LHGA 4PDKA 4E7IA 3QPSA 5BNGA 2W00A 1YIJI 2B7EA 3JRCA 4ZYAA 3LSIA 3OYMA 2PI0A 1J9IA 3E6BA 4P96A 5F0HA 5HLHA 1ZRCA 1LFPA 5DS9A 3W6JB 2HVQA 4LB5A 2H8WA 2O6GE 2HS5A 3PNYA 3WHCA 2VKHA 5DEQA 4I6ZA 1B4AA 4CYCA 2J5PA 3CUQA 1NK3P 2XF5A 4LFUA 1RIOH 2KMUA 3RDIA 3F72A 4HRIA 1MGTA 3FBIB 2VIXA 4MTDA 1DDNA 2LC2A 2HYFA 4PFPA 1A36A 3ISPA 1G4DA 3ABLH 3T0YA 5FKOA 3ABTA 1MW7A 3OOPA 1D1BA 1AA7A 2LF8A 1RI7A 1SD7A 4ZYDA 1ZGWA 1DGWY 3BZ6A 1WI3A 2QSHX 2V4JC 3PQJA 4F91B 2PMZA 2HOAA 5IT3A 2E60A 1GUUA 2BVMA 1P4AA 2CUZA 4ABZA 3CMMA 3OYCA 4KJZA 1UMQA 1WZ2A 2R7WA 1GXQA 2CFOA 2BY2A 2K9MA 3RCOA 1OYIA 4NB5A 4XKCA 3RSNA 3NRVA 1X4OA 5IOYA 2BW3A 2X1EA 2ZXWH 3SZPA 1HKTA 5CQGA 2YU3A 4RDUA 1CF7A 1UHMA 1U5TB 2CH0A 4B47A 4D5FA 2UWMA 1U8BA 2QA4I 2Z3YA 2KIQA 2Z16A 3KEOA 4HX8A 4BU2A 1E0EA 1BOAA 3LL7A 5H2FC 2M30A 2ZMEB 3OWTA 4GCVA 2E5NA 2XSDC 1QZYA 2G7UA 2XPUA 5C44J 3WODF 3KP2A 1SVLA 4IRGA 2Y2ZA 1XMKA 5F6FA 1ZRFA 1OCPA 4KT6A 3FISA 3H36A 3DTIA 2R4GA 4UVCA 3N05A 4RA2A 3GTPJ 3Q0WA 2P0WA 2A07F 1WGXA 2EV5A 2PBIA 6PAXA 2RREA 4KIGA 3LQRA 4G94A 2W85A 2G7HA 2X0LA 3I58A 3AG1H 3QPTA 5TRDA 5FLMJ 4E7LA 4U0VA 3DEWA 2PEXA 4M6XA 5CVVA 3PO2J 4XKWA 4ZJZA 4N0BA 1JJ6C 3Q3SA 2QQBA 2WAQN 4RMNA 1MKMA 4LLLA 2NYXA 3OS0A 5DD8A 1BI0A 1B8IB 3HOYJ 1JT0A 3SZTA 3QODA 2VJ4A 3CJQB 2FMYA 2KQRA 1C0WA 2PJRA 2NVQJ 2BGCA 1Y1VJ 5GP9A 4FCYA 4J19A 5IT9K 2XAJA 5EZGA 1S9HA 2H09A 4KMUX 3ZR8X 5DM6F 2R92J 2D2WA 2QYOA 2Z33A 3F22A 1YITI 4JQFA 3K4CA 2IGMA 4BDYA 4UV8A 4I76A 4HA8A 1GT0C 4Y52J 1Z1DA 4DZPA 4U88A 5ILSA 2W48A 2EV0A 1BC7C 5L3DA 4G6QA 3LNQA 1LB2A 1X1AA 3VWBA 1DPUA 1TP4A 3KP6A 5A2QZ 4AU7A 4M9SA 3OL3A 4YG2F 2KIUA 4PJLA 2O9LA 4OAYA 4AM3A 2V26A 3R61A 4A5NA 1B72A 2L01A 1XSXA 3SHFA 5BS6A 4WF2A 2TRTA 3H1CA 4CYCB 1FX7A 1T95A 4HX7A 3CUQB 1XPXA 1W5TA 4IHYA 4P55A 3OYLA 1ZGAA 1UFMA 4A0YA 3ZN1A 3GMEA 1ON2A 3U2RA 1O57A 2FA5A 3BT9A 5J6XA 2XF7A 3E1SA 1FYKA 4I02A 3IHUA 2KLOA 3L2QA 3CMYA
chains in the Genus database with same CATH topology
4KMFA 1IN8A 2QQ9A 3WTTC 1HXDA 3J80K 2M45A 3WG9A 3BJ6A 4PGGA 1T6SA 1I5ZA 2EA4A 2UXNA 1Z9CA 2QQAA 1V3FA 2P5VA 5D8LB 4U0WA 5LEJA 1W4MA 1P92A 2G9WA 1MJ9A 3L00A 3OV8A 3HSFA 1JXSA 3GW2A 1G3YA 2LF7A 2L54A 2L4MA 4GXOA 2JT1A 3WE2A 1K6OA 1QZZA 3KP5A 2YX4A 1ZRDA 1IN6A 3K2ZA 3SXYA 2A3SA 2DAOA 1V4RA 3K1MA 1LVAA 1SFXA 3I59A 4HLYA 5HDKA 2ZXJA 4Y13A 2DPUA 2O3FA 2XGXA 3CJNA 3ZMZA 2FXAA 4ENMA 1G3WA 3KP7A 3FHZA 1W7PA 1ZG5A 3FXRA 4RGUA 2JTVA 2XV4S 2R3SA 1OKRA 3V4GA 3EYYA 3J81K 5HS8A 3BOQA 4P9FA 1B59A 2EB7A 5LEKA 3F21A 5LHIA 5E8IA 1MD0A 3N97A 1XMAA 3HRMA 1B1BA 5DCFA 3BROA 3T8RA 2FOKA 5JHUA 4IHTA 2ZJ2A 4L18B 2VC1A 3I71A 4U0YA 3R4KA 1TNTA 1H9TA 1LEBA 4ESFA 4KFCA 2Y75A 5D4SA 4EJOA 1IRGA 1KYWA 4IVNA 1BN5A 2KIFA 2NRAC 5E8GA 2IRFG 4P9UA 2VT3A 2RDPA 3I0TA 5ILUA 2OU2A 3CUOA 4WXHA 3G73A 1T98A 2KIMA 1PP8F 1FNNA 2E7XA 3J80Z 2GZWA 4KUMA 2O8XA 3BJAA 2DLLA 2JZYA 2A69F 4L9TA 3V8JA 2CO5A 4WXCA 4ZH4F 5F1RA 3MZHA 2DI3A 3E3VA 3C1DA 4M9ZA 4G6DA 3I59B 3TOBA 4HX4A 1SMYF 4OIOF 1O7FA 3IC7A 1FP2A 5CYVA 5FGMA 2RGVA 5H20A 4MEXF 5HS9A 4RAYA 1TLHB 3LQQA 3ECHA 1EH6A 2EK5A 3IKVA 3GFMA 3FM3A 1OMIA 3FMSA 5E1XA 1ZAOA 2KJCA 3GZ5A 1IXSB 4I2OA 3MAJA 4IXAA 4EM1A 2BEOA 2CG4A 1W7PB 4LJZF 3F3XA 4S04A 2DK5A 1TNSA 3TO9A 4BH9A 2VONA 1UCRA 3MEXA 2Q0OA 4IF4A 1TQMA 5ICGA 4I0AA 3E6CC 2MH2A 2ZNZA 2ZFWA 3J81Z 1GXPA 5D5VB 2HQNA 3ZN0A 4OU0A 3V7SA 1BIBA 4QLCU 4WWCA 1XCBA 5E1WA 3IWFA 2XIGA 2VXZA 3KP3A 1GHCA 2EJRA 3TOAA 4GO1A 3P9CA 2YR2A 3ML6A 4RB2C 4ESJA 2VBXA 1P2FA 5JVTA 4A5MA 1S8NA 2ISZA 2Z99A 3QAHA 2DQLA 2DTRA 2GXBA 3M9AA 1IZ1A 5K5QA 3EDPA 1EV7A 1SFUA 2P4WA 4JK1X 1XGOA 3K1NA 2E1CA 2VN2A 2V1DA 3QU3A 1DP7P 5JI6A 1ZG1A 2OA4A 3BPVA 2F5DA 4RAZA 2ADUA 4LB6B 3F6VA 4ZZLA 4AIKA 4R8HA 2JRTA 1FZPB 3M8EA 5D5UB 2XRNA 1Z7UA 5J8CA 3JSOA 4A0XA 1OPCA 2EA2A 2V1XA 1K7AA 4EJWA 2F5CA 2HKOA 1W5SA 1X3UA 5K1YA 1J7KA 2OQRA 4L9JA 2ACJA 5D5WB 2EFWA 1J0RA 2Y0MA 2IA2A 2FQ3A 1L3LA 2ISYA 3B73A 2GXGA 3KETA 4D0PA 4YFXF 3VOEA 1WRJA 3FX3A 3MQ0A 2HR3A 1WKMA 2EFOA 2VOPA 5A2QK 5LGNA 4CGZA 3L09A 3EQLF 2UXXA 2EFPA 1R36A 2M87A 3KFWX 3E5QA 4I98B 2TDXA 5D5XB 2FBKA 1G3SA 2K7LA 1STZA 2A68F 5HS7A 5FLXZ 2EWNA 3E5XA 4HV5A 3BY6A 3C18A 3LA7A 1D3YA 2W24A 4L9VA 4P5OA 4GYIA 4XRFA 4RB0A 1USTA 3DFGA 3GF2A 3DP7A 1HBXG 5FFXA 5L3EA 1FLIA 1KU9A 1Z6RA 5CVJA 4YFKF 3L7WA 4WX9A 1JHFA 3WE3A 1ON1A 3MCZA 1AOYA 2HTJA 4Y15A 3GX4X 2ESHA 1BI2A 3FMQA 1SAXA 1OYWA 1K78A 5E20A 2GQQA 2PFBA 3FXUA 4EGYA 3RKYA 2HQRA 3IRRA 2VE9A 4AIJA 4RGRA 1XCVA 5H6RA 1JGSA 4CYDA 1KA8A 3BPXA 1T38A 3BWGA 2NNNA 2CYYA 5FD5A 3FM5A 3QRFF 1XGNA 4H0EA 1EH7A 3FF5A 4GYGA 3KLNA 3NEUA 5DDGA 4LD5A 2ZO4A 4ZYGA 1YFHA 2XKPA 2RVCA 1P4WA 1FYMA 3ZMDA 4M74A 4K2EA 3FWEA 1I1SA 4HQEA 3WGIA 3WGHA 2OAZA 5L3FA 1H9GA 4KICA 2WV0A 3HOSA 3P9IA 3M8FA 4R79A 2V79A 3TKYA 2HYGD 3K1PA 2E1NA 3WU0A 2P8TA 5JFRA 2GIVA 5FD6A 2M8EA 1YS7A 3EUHA 3E97A 1U78A 4G8XA 1S6LA 1YYVA 4FT8A 4A6DA 2A6EF 1TW2A 1MDMA 3ZMUA 1R1UA 2RC4A 1HSTA 1SFEA 3DPLC 4B09A 3IKTA 4BXUA 1IXCA 5JR3A 3SQNA 2IA0A 2O0YA 4HW0A 2R7FA 4BYYA 3WTSC 5L3BA 2ESNA 3I64A 2LNBA 5L3CA 2F2EA 2FU4A 2CQKA 3VODA 4HZFA 2BE5F 4UV9A 2Z9OA 1R58A 1NHAA 1ZGJA 3ZMVA 3VEPA 4EM0B 3F8BA 4OMYA 2NNYA 3NQOA 3HHHA 4L5JA 3K0LA 2HKXA 1S7OA 1K78B 4KIFA 3L2CA 1J59A 1F4KA 5AONA 4LG0A 3DXJF 2Q2EA 4CDGA 2VC0A 3S2WA 5LBQA 3Q9SA 3AAFA 4A6EA 1F5TA 1J2XA 2XASA 4DQ2A 3F8MA 3HHGA 3P7NA 2Z5UA 1R23A 4M72A 1ZREA 2VBZA 2DU9A 1P6RA 1MZBA 4L0ZB 4AIHA 2HFHA 4WXDA 1LQ1A 4KIBA 2MC3A 2QBYA 1WI9A 4FX4A 4B8XA 1ZLKA 3V7RA 2FSWA 1U5TC 2LKPA 3GO5A 3BDDA 2L02A 1ZYRF 4BNCA 1E2XA 4OIPF 1B9MA 4A12A 1PP7U 2DFIA 3Q5FA 4DNCA 2BBYA 5HLIA 2RV8A 3DKWA 4XLPF 2Y48A 2XUBA 1MDMB 2OD5A 1I27A 1J5YA 2HZTA 1PUEE 3TDUC 2K27A 2VBWA 3U9GA 1F9NA 4MGRA 3TGNA 2FRHA 3T5XA 3GWZA 4CO8A 4YIFA 2QVOA 2A61A 2WC2A 2DBBA 4ASNA 3J7AO 1TTYA 5DUKA 5BOXA 1SD5A 2W84A 3REOA 4HOBA 2V1UA 2X4HA 4Z2YA 2RQPA 4Q4ZF 1R7JA 3QPHA 3HIFA 1HSJA 2PMHA 4GGGA 4I01A 3HTUA 2P6SA 2PG4A 4MNUA 2XAHA 2YX7A 3CTAA 4IPAA 2QM3A 3CUQC 2GWRA 3ERED 4LG0B 5LGTA 4I09A 3KLOA 1FP1D 3JAMZ 2VOOA 3KP4A 3WTVC 1QPMA 1Q1HA 3I5UA 3P9KA 2CGPA 4A0ZA 2P6TA 3D5LA 1FPQA 3ZMSA 1K79A 2HGCA 1QO0D 3QP6A 2HTSA 1KU2A 2C6YA 4KNYA 3T8TA 2P5LC 4FX0A 2STWA 3WTXC 2QBYB 3F8CA 4BHPA 1T0FA 2ELHA 2YPRA 1FBUA 2PJPA 1ULYA 3V8LA 1PDNC 5CJ9A 3QP5A 2DO7A 5FLXK 2MA3A 1WWXA 3HRUA 1KU3A 2BYVE 3I54A 3I53A 3TDZC 3WU1B 3I4PA 3K69A 4RB3C 2OBPA 1RZ4A 3K9TA 2VE8A 3CO7C 2LDUA 4PGHA 2HOEA 4MTEA 2XAFA 1WQ2A 2EFQA 3F8NA 1XDSA 2UZKA 2IJLA 3HSRA 2DQRA 4O6JA 1R1VA 1OYYA 2CWEA 2ZBKA 4PCQA 1O3RA 3H92A 4ESBA 1T2KA 3GFLA 1R22A 1I1GA 4KT5C 3IWZA 2K02A 3DEUA 3V8KA 2AXLA 5LRRA 4ETSA 1S29A 5CVIA 3F8FA 4E70A 1VTNC 2RN7A 4OINF 5FB2A 2GA1A 3LAJA 3R0JA 2BV6A 3R60A 1IUYA 1FSHA 4CHUA 1U8RA 3RYPA 3RKXA 2O03A 3E5UA 3O6BB 2YSRA 2KKOA 2XAGA 3EYIA 1IF1A 1MJAA 2DPDA 4EQQA 3GLXA 1FBQA 4EV0A 1HW2A 2P7VB 2ZNYA 2ETHA 5EEHA 1KGSA 2IP2A 4OMZA 5LLQA 2COMA 3PFIA 1L0OC 2NAZA 5BQTA 3CLOA 4KYWA 1R5HA 3RJPA 3DQVC 4L9NA 2W25A 1LJ9A 1DUXC 1OR7A 1HW1A 2D1HA 1KU7A 1IRFA 2FEZA 4AD9A 2CFXA 2B0LA 3N4MA 4L0YB 1BM9A 4M9XA 4CZZA 4HF0A 4AVPA 4WCGA 1EH8A 4A2UA 3F23A 1D8KA 2CSOA 1Z05A 5K5RA 2J5OA 3O2PE 4M73A 2FBIA 5AIQA 5E18F 2MD5A 3ZP5A 4LLNA 1R00A 1XGSA 3HUGA 2A6HF 5LRSA 4XBFA 2LSOA 4RGXA 3PQKA 5AIPA 1HW5A 3R6SA 4EJUA 3ECOA 4XSXF 1O3TA 3WTZA 3FMRA 4F7ZA 3KZZA 4HLXA 3W6KB 2PN6A 1U3EM 4RB1A 3G3ZA 3KCCA 4HF1A 4UNOA 5H6QA 5BMZA 1G6NA 4HDVA 5HVQC 2OZUA 3RPQA 1SD4A 3V7CA 5K5OA 5ED4A 3KZYA 4N9HA 1LEAA 3HSEA 2MH9A 5KVRA 4I0BA 2DT5A 5BPIA 1O3QA 4HYEA 3ZMTA 3JTGA 5HDNA 1BBYA 5DCMA 4EJTA 4EVIA 3IL2A 3RYRA 1FC3A 3E6DA 5E17F 3LWFA 4FHTA 3M1EA 4MQVA 1ZG3A 3ELKA 2XKOA 3ZQ7A 1SMTA 2IVMA 2ZCWA 2M1BA 2DK8A 1YG2A 2VT2A 5FFZA 1U6GA 4O3MA 1BJAA 5LGUA 1YQAA 4S05A 2F5FA 5D8KB 4EM2A 3T1BA 5D4RA 1YTYA 1ZARA 2XAQA 2VODA 1JE8A 2OQGA 4IJAA 1S3JA 3MWMA 4AWXB 3LFKA 1IN7A 1XDUA 4HQMA 1O7LA 3HOTA 5ILVA 1QBJA 2RKHA 2JSCA 3COAC 4LLGF 3QU6A 1IAWA 2WTEA 1XD7A 5ICFA 1Z91A 2L3DA 1S7AA 3JSPA 1XSVA 1XN7A 1FY7A 4M71A 1XB4A 4EJVA 3TO7A 2A5YB 1TQIA 2L4AA 2IPQX 3E6MA 5DD4A 1O3SA 4O5VA 3O3KA 1H0MA 4Q48A 3RPUA 4LK0F 3WTWC 1IN4A 2JPBA 3D0SA 3GFJA 3R0AA 4CXFA 5BPDA 3HTSB 2WWYA 1ZHFA 3JTHA 4IRIA 5DYMA 5J8FA 1RUOA 4LGWA 2QENA 1QQIA 4UVBA 5L3GA 4HAMA 2GAUA 2KRFA 5LHHA 2F5EA 2MBFA 1YS6A 1QNTA 3ZPLA 3JAMK 2D1VA 5DV5A 1CF7B 1QGPA 5CVUA 5DCMB 4BHBA 2H27A 4BAYA 2XVCA 5ICEA 2GA2A 1KQ0A 4L5IA 3GEZA 5HDGA 4MEYF 3MZYA 3JW4A 4LK1F 1I6XA 1YW8A 4TV7A 3RKWA 2W57A 4ZYHA 3KEQA 1YLFA 2IT0A 4PZJA 1TBXA 3EETA 1TQPA 1TW3A 2DW4A 1RUNA 5DUIA 4KA4A 3BP8A 1F1ZA 1B6AA 2H6BA 1GVJA 4XSZF 4IHSA 3GYHX 4NQWA 4OOIA 2P7CB 2OZ6A 4EGZA 3GFIA 3HRSA 1CGPA 2V9VA 1FT9A 3GVAA 3LAPA 3VB2A 1D8JA 1UHWA 5IT9Z 1REPC 4Y17A 1FBSA 4UVAA 1Z6TA 2EFNA 3TO6A 3GUDA 2E7WA 4HBLA 5CVRA 1G3TA 3BJOA 4OIQF 4MHGA 4M6YA 1FOKA 3DV8A 3LA3A 3CO6C 3FXQA 4U7BA 4ZZDA 3ROUA 2IW5A 5TJJA 5D6FA 1Y0UA 5E1ZB 2QWWA 3C3WA 3DPTA 1FYLA 3TQNA 1IW7F 4ON0A 5HOOA 1USSA 1ZN2A 2FNAA 1LNWA 3FZVA 3GXOA 1FSEA 1YIOA 1R1TA 3SFZA 4G7ZF 4N9IA 1XSDA 4NHJA 4Q5SF 1P4XA 2H6CA 4WK8F 1FWZA 4UHTA 3MFKA 1A04A 1R5GA 4CICA 2KJBA 1HQCA 4XLNF 2FBHA 5ICCA 5D6EA 3HYIA 1B9NA 1U2WA 3KE2A 4LMYA 3U1DA 5EEGA 2K4JA 5HLGA 2NS0A 1BI1A 2PMUA 1D5VA 1LDKB 4YIIA 2FE3A 1E17A 1YO5C 2Q8KA 4U7DA 2VBYA 4G7OF 1BC8C 1BI3A 3LSTA 2K4BA 3F6OA 3WGGA 4ZYEA 4HF2A 4Q47A 2O61A 4ENKA 3C7JA 1KQ8A 3H3ZA 2FNPA 1LDDA 4HDUA 2QUFA 5KK1A 3WTYC 1XGMA 1ONVA 4OIRF 4UXNA 5CLSA 1W7PD 4BQAA 1YW9A 3GZ6A 3RI4A 3RIRA 2QZ8A 2EV6A 5ERIA 2K86A 4RGSA 1KYZA 1MJBA 1UB9A 1HKSA 2XROA 3Q9VA 3VFZA 1WSUA 4JBAA 1ZLJA 4KN7X 2V6CA 2XHKA 3DF8A 4MQ9F 4UUVA 4YFNF 3B02A 3ULQB 2FF4A 4QWQA 3IRQA 1LDJA 1KQ9A 1DPRA 4EMSA 2M5WA 4IRHA 4RS8A 4ENNA 3HRTA 1YW7A 1ZH5A 1U5TA 1HKQA 4ENJA 5F64A 4G7HF 1ODDA 4R1HA 3QOPA 2H94A 2ZMEA 2QLZA 2CW0F 3L9FA 2JPCA 2STTA 3CDHA 1IN5A 5FO5A 1IXRC 1AWCA 4KN4X 3LA2A 3RTRA 4HV6A 4KDPA 4BHCA 1SD6A 3H3UA 2MLGA 1J75A 2P5KA 3M7GA 2HWVA 1BIAA 1JHHA 2D45A 2ZKZA 4I7HA 3WTUC 2AS5F 2MLKA 2HDCA 1RNLA 1T39A 2R7DA 2PLYA 2IA1A 2PQ8A 2RNJA 2FMLA 2HEOA 3ABUA 4G9YA 5LHGA 4PDKA 1J9IA 2PI0A 3E6BA 4P96A 5HLHA 1ZRCA 3W6JB 4LB5A 2O6GE 2HS5A 5DEQA 1B4AA 2J5PA 3CUQA 4LFUA 1RIOH 3RDIA 3F72A 1MGTA 4MTDA 1DDNA 2HYFA 3ISPA 1G4DA 3T0YA 3ABTA 3OOPA 2LF8A 1RI7A 1SD7A 4ZYDA 3BZ6A 3PQJA 5IT3A 1P4AA 1GXQA 1OYIA 4NB5A 3NRVA 3SZPA 1HKTA 2YU3A 1CF7A 1UHMA 1U5TB 2UWMA 2Z3YA 3KEOA 4HX8A 1BOAA 2M30A 2ZMEB 4GCVA 1QZYA 2G7UA 3WODF 3KP2A 4IRGA 5F6FA 1XMKA 1ZRFA 4UVCA 2A07F 2EV5A 2PBIA 6PAXA 4KIGA 3LQRA 4G94A 2W85A 2G7HA 2X0LA 5TRDA 3I58A 3QPTA 4U0VA 2PEXA 4M6XA 5CVVA 4N0BA 2QQBA 1MKMA 4LLLA 2NYXA 5DD8A 1BI0A 3SZTA 2FMYA 1C0WA 2BGCA 5IT9K 2XAJA 2H09A 4KMUX 2D2WA 2QYOA 2Z33A 3F22A 4JQFA 4UV8A 4HA8A 1Z1DA 4U88A 5ILSA 2EV0A 1BC7C 5L3DA 4G6QA 1LB2A 1DPUA 3KP6A 5A2QZ 4M9SA 4YG2F 2KIUA 3R61A 4A5NA 2L01A 1XSXA 3SHFA 5BS6A 4WF2A 1FX7A 4HX7A 3CUQB 1W5TA 4P55A 1ZGAA 1UFMA 4A0YA 3ZN1A 1ON2A 3U2RA 1O57A 2FA5A 5J6XA 1FYKA 4I02A 3IHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMF A;  1IN8 A;  2QQ9 A;  3WTT C;  1HXD A;  3J80 K;  2M45 A;  3WG9 A;  3BJ6 A;  4PGG A;  1T6S A;  1I5Z A;  2EA4 A;  2UXN A;  1Z9C A;  2QQA A;  1V3F A;  2P5V A;  5D8L B;  4U0W A;  5LEJ A;  1W4M A;  1P92 A;  2G9W A;  1MJ9 A;  3L00 A;  3OV8 A;  3HSF A;  1JXS A;  3GW2 A;  1G3Y A;  2LF7 A;  2L54 A;  2L4M A;  4GXO A;  2JT1 A;  3WE2 A;  1K6O A;  1QZZ A;  3KP5 A;  2YX4 A;  1ZRD A;  1IN6 A;  3K2Z A;  3SXY A;  2A3S A;  2DAO A;  1V4R A;  3K1M A;  1LVA A;  1SFX A;  3I59 A;  4HLY A;  5HDK A;  2ZXJ A;  4Y13 A;  2DPU A;  2O3F A;  2XGX A;  3CJN A;  3ZMZ A;  2FXA A;  4ENM A;  1G3W A;  3KP7 A;  3FHZ A;  1W7P A;  1ZG5 A;  3FXR A;  4RGU A;  2JTV A;  2XV4 S;  2R3S A;  1OKR A;  3V4G A;  3EYY A;  3J81 K;  5HS8 A;  3BOQ A;  4P9F A;  1B59 A;  2EB7 A;  5LEK A;  3F21 A;  5LHI A;  5E8I A;  1MD0 A;  3N97 A;  1XMA A;  3HRM A;  1B1B A;  5DCF A;  3BRO A;  3T8R A;  2FOK A;  5JHU A;  4IHT A;  2ZJ2 A;  4L18 B;  2VC1 A;  3I71 A;  4U0Y A;  3R4K A;  1TNT A;  1H9T A;  1LEB A;  4ESF A;  4KFC A;  2Y75 A;  5D4S A;  4EJO A;  1IRG A;  1KYW A;  4IVN A;  1BN5 A;  2KIF A;  2NRA C;  5E8G A;  2IRF G;  4P9U A;  2VT3 A;  2RDP A;  3I0T A;  5ILU A;  2OU2 A;  3CUO A;  4WXH A;  3G73 A;  1T98 A;  2KIM A;  1PP8 F;  1FNN A;  2E7X A;  3J80 Z;  2GZW A;  4KUM A;  2O8X A;  3BJA A;  2DLL A;  2JZY A;  2A69 F;  4L9T A;  3V8J A;  2CO5 A;  4WXC A;  4ZH4 F;  5F1R A;  3MZH A;  2DI3 A;  3E3V A;  3C1D A;  4M9Z A;  4G6D A;  3I59 B;  3TOB A;  4HX4 A;  1SMY F;  4OIO F;  1O7F A;  3IC7 A;  1FP2 A;  5CYV A;  5FGM A;  2RGV A;  5H20 A;  4MEX F;  5HS9 A;  4RAY A;  1TLH B;  3LQQ A;  3ECH A;  1EH6 A;  2EK5 A;  3IKV A;  3GFM A;  3FM3 A;  1OMI A;  3FMS A;  5E1X A;  1ZAO A;  2KJC A;  3GZ5 A;  1IXS B;  4I2O A;  3MAJ A;  4IXA A;  4EM1 A;  2BEO A;  2CG4 A;  1W7P B;  4LJZ F;  3F3X A;  4S04 A;  2DK5 A;  1TNS A;  3TO9 A;  4BH9 A;  2VON A;  1UCR A;  3MEX A;  2Q0O A;  4IF4 A;  1TQM A;  5ICG A;  4I0A A;  3E6C C;  2MH2 A;  2ZNZ A;  2ZFW A;  3J81 Z;  1GXP A;  5D5V B;  2HQN A;  3ZN0 A;  4OU0 A;  3V7S A;  1BIB A;  4QLC U;  4WWC A;  1XCB A;  5E1W A;  3IWF A;  2XIG A;  2VXZ A;  3KP3 A;  1GHC A;  2EJR A;  3TOA A;  4GO1 A;  3P9C A;  2YR2 A;  3ML6 A;  4RB2 C;  4ESJ A;  2VBX A;  1P2F A;  5JVT A;  4A5M A;  1S8N A;  2ISZ A;  2Z99 A;  3QAH A;  2DQL A;  2DTR A;  2GXB A;  3M9A A;  1IZ1 A;  5K5Q A;  3EDP A;  1EV7 A;  1SFU A;  2P4W A;  4JK1 X;  1XGO A;  3K1N A;  2E1C A;  2VN2 A;  2V1D A;  3QU3 A;  1DP7 P;  5JI6 A;  1ZG1 A;  2OA4 A;  3BPV A;  2F5D A;  4RAZ A;  2ADU A;  4LB6 B;  3F6V A;  4ZZL A;  4AIK A;  4R8H A;  2JRT A;  1FZP B;  3M8E A;  5D5U B;  2XRN A;  1Z7U A;  5J8C A;  3JSO A;  4A0X A;  1OPC A;  2EA2 A;  2V1X A;  1K7A A;  4EJW A;  2F5C A;  2HKO A;  1W5S A;  1X3U A;  5K1Y A;  1J7K A;  2OQR A;  4L9J A;  2ACJ A;  5D5W B;  2EFW A;  1J0R A;  2Y0M A;  2IA2 A;  2FQ3 A;  1L3L A;  2ISY A;  3B73 A;  2GXG A;  3KET A;  4D0P A;  4YFX F;  3VOE A;  1WRJ A;  3FX3 A;  3MQ0 A;  2HR3 A;  1WKM A;  2EFO A;  2VOP A;  5A2Q K;  5LGN A;  4CGZ A;  3L09 A;  3EQL F;  2UXX A;  2EFP A;  1R36 A;  2M87 A;  3KFW X;  3E5Q A;  4I98 B;  2TDX A;  5D5X B;  2FBK A;  1G3S A;  2K7L A;  1STZ A;  2A68 F;  5HS7 A;  5FLX Z;  2EWN A;  3E5X A;  4HV5 A;  3BY6 A;  3C18 A;  3LA7 A;  1D3Y A;  2W24 A;  4L9V A;  4P5O A;  4GYI A;  4XRF A;  4RB0 A;  1UST A;  3DFG A;  3GF2 A;  3DP7 A;  1HBX G;  5FFX A;  5L3E A;  1FLI A;  1KU9 A;  1Z6R A;  5CVJ A;  4YFK F;  3L7W A;  4WX9 A;  1JHF A;  3WE3 A;  1ON1 A;  3MCZ A;  1AOY A;  2HTJ A;  4Y15 A;  3GX4 X;  2ESH A;  1BI2 A;  3FMQ A;  1SAX A;  1OYW A;  1K78 A;  5E20 A;  2GQQ A;  2PFB A;  3FXU A;  4EGY A;  3RKY A;  2HQR A;  3IRR A;  2VE9 A;  4AIJ A;  4RGR A;  1XCV A;  5H6R A;  1JGS A;  4CYD A;  1KA8 A;  3BPX A;  1T38 A;  3BWG A;  2NNN A;  2CYY A;  5FD5 A;  3FM5 A;  3QRF F;  1XGN A;  4H0E A;  1EH7 A;  3FF5 A;  4GYG A;  3KLN A;  3NEU A;  5DDG A;  4LD5 A;  2ZO4 A;  4ZYG A;  1YFH A;  2XKP A;  2RVC A;  1P4W A;  1FYM A;  3ZMD A;  4M74 A;  4K2E A;  3FWE A;  1I1S A;  4HQE A;  3WGI A;  3WGH A;  2OAZ A;  5L3F A;  1H9G A;  4KIC A;  2WV0 A;  3HOS A;  3P9I A;  3M8F A;  4R79 A;  2V79 A;  3TKY A;  2HYG D;  3K1P A;  2E1N A;  3WU0 A;  2P8T A;  5JFR A;  2GIV A;  5FD6 A;  2M8E A;  1YS7 A;  3EUH A;  3E97 A;  1U78 A;  4G8X A;  1S6L A;  1YYV A;  4FT8 A;  4A6D A;  2A6E F;  1TW2 A;  1MDM A;  3ZMU A;  1R1U A;  2RC4 A;  1HST A;  1SFE A;  3DPL C;  4B09 A;  3IKT A;  4BXU A;  1IXC A;  5JR3 A;  3SQN A;  2IA0 A;  2O0Y A;  4HW0 A;  2R7F A;  4BYY A;  3WTS C;  5L3B A;  2ESN A;  3I64 A;  2LNB A;  5L3C A;  2F2E A;  2FU4 A;  2CQK A;  3VOD A;  4HZF A;  2BE5 F;  4UV9 A;  2Z9O A;  1R58 A;  1NHA A;  1ZGJ A;  3ZMV A;  3VEP A;  4EM0 B;  3F8B A;  4OMY A;  2NNY A;  3NQO A;  3HHH A;  4L5J A;  3K0L A;  2HKX A;  1S7O A;  1K78 B;  4KIF A;  3L2C A;  1J59 A;  1F4K A;  5AON A;  4LG0 A;  3DXJ F;  2Q2E A;  4CDG A;  2VC0 A;  3S2W A;  5LBQ A;  3Q9S A;  3AAF A;  4A6E A;  1F5T A;  1J2X A;  2XAS A;  4DQ2 A;  3F8M A;  3HHG A;  3P7N A;  2Z5U A;  1R23 A;  4M72 A;  1ZRE A;  2VBZ A;  2DU9 A;  1P6R A;  1MZB A;  4L0Z B;  4AIH A;  2HFH A;  4WXD A;  1LQ1 A;  4KIB A;  2MC3 A;  2QBY A;  1WI9 A;  4FX4 A;  4B8X A;  1ZLK A;  3V7R A;  2FSW A;  1U5T C;  2LKP A;  3GO5 A;  3BDD A;  2L02 A;  1ZYR F;  4BNC A;  1E2X A;  4OIP F;  1B9M A;  4A12 A;  1PP7 U;  2DFI A;  3Q5F A;  4DNC A;  2BBY A;  5HLI A;  2RV8 A;  3DKW A;  4XLP F;  2Y48 A;  2XUB A;  1MDM B;  2OD5 A;  1I27 A;  1J5Y A;  2HZT A;  1PUE E;  3TDU C;  2K27 A;  2VBW A;  3U9G A;  1F9N A;  4MGR A;  3TGN A;  2FRH A;  3T5X A;  3GWZ A;  4CO8 A;  4YIF A;  2QVO A;  2A61 A;  2WC2 A;  2DBB A;  4ASN A;  3J7A O;  1TTY A;  5DUK A;  5BOX A;  1SD5 A;  2W84 A;  3REO A;  4HOB A;  2V1U A;  2X4H A;  4Z2Y A;  2RQP A;  4Q4Z F;  1R7J A;  3QPH A;  3HIF A;  1HSJ A;  2PMH A;  4GGG A;  4I01 A;  3HTU A;  2P6S A;  2PG4 A;  4MNU A;  2XAH A;  2YX7 A;  3CTA A;  4IPA A;  2QM3 A;  3CUQ C;  2GWR A;  3ERE D;  4LG0 B;  5LGT A;  4I09 A;  3KLO A;  1FP1 D;  3JAM Z;  2VOO A;  3KP4 A;  3WTV C;  1QPM A;  1Q1H A;  3I5U A;  3P9K A;  2CGP A;  4A0Z A;  2P6T A;  3D5L A;  1FPQ A;  3ZMS A;  1K79 A;  2HGC A;  1QO0 D;  3QP6 A;  2HTS A;  1KU2 A;  2C6Y A;  4KNY A;  3T8T A;  2P5L C;  4FX0 A;  2STW A;  3WTX C;  2QBY B;  3F8C A;  4BHP A;  1T0F A;  2ELH A;  2YPR A;  1FBU A;  2PJP A;  1ULY A;  3V8L A;  1PDN C;  5CJ9 A;  3QP5 A;  2DO7 A;  5FLX K;  2MA3 A;  1WWX A;  3HRU A;  1KU3 A;  2BYV E;  3I54 A;  3I53 A;  3TDZ C;  3WU1 B;  3I4P A;  3K69 A;  4RB3 C;  2OBP A;  1RZ4 A;  3K9T A;  2VE8 A;  3CO7 C;  2LDU A;  4PGH A;  2HOE A;  4MTE A;  2XAF A;  1WQ2 A;  2EFQ A;  3F8N A;  1XDS A;  2UZK A;  2IJL A;  3HSR A;  2DQR A;  4O6J A;  1R1V A;  1OYY A;  2CWE A;  2ZBK A;  4PCQ A;  1O3R A;  3H92 A;  4ESB A;  1T2K A;  3GFL A;  1R22 A;  1I1G A;  4KT5 C;  3IWZ A;  2K02 A;  3DEU A;  3V8K A;  2AXL A;  5LRR A;  4ETS A;  1S29 A;  5CVI A;  3F8F A;  4E70 A;  1VTN C;  2RN7 A;  4OIN F;  5FB2 A;  2GA1 A;  3LAJ A;  3R0J A;  2BV6 A;  3R60 A;  1IUY A;  1FSH A;  4CHU A;  1U8R A;  3RYP A;  3RKX A;  2O03 A;  3E5U A;  3O6B B;  2YSR A;  2KKO A;  2XAG A;  3EYI A;  1IF1 A;  1MJA A;  2DPD A;  4EQQ A;  3GLX A;  1FBQ A;  4EV0 A;  1HW2 A;  2P7V B;  2ZNY A;  2ETH A;  5EEH A;  1KGS A;  2IP2 A;  4OMZ A;  5LLQ A;  2COM A;  3PFI A;  1L0O C;  2NAZ A;  5BQT A;  3CLO A;  4KYW A;  1R5H A;  3RJP A;  3DQV C;  4L9N A;  2W25 A;  1LJ9 A;  1DUX C;  1OR7 A;  1HW1 A;  2D1H A;  1KU7 A;  1IRF A;  2FEZ A;  4AD9 A;  2CFX A;  2B0L A;  3N4M A;  4L0Y B;  1BM9 A;  4M9X A;  4CZZ A;  4HF0 A;  4AVP A;  4WCG A;  1EH8 A;  4A2U A;  3F23 A;  1D8K A;  2CSO A;  1Z05 A;  5K5R A;  2J5O A;  3O2P E;  4M73 A;  2FBI A;  5AIQ A;  5E18 F;  2MD5 A;  3ZP5 A;  4LLN A;  1R00 A;  1XGS A;  3HUG A;  2A6H F;  5LRS A;  4XBF A;  2LSO A;  4RGX A;  3PQK A;  5AIP A;  1HW5 A;  3R6S A;  4EJU A;  3ECO A;  4XSX F;  1O3T A;  3WTZ A;  3FMR A;  4F7Z A;  3KZZ A;  4HLX A;  3W6K B;  2PN6 A;  1U3E M;  4RB1 A;  3G3Z A;  3KCC A;  4HF1 A;  4UNO A;  5H6Q A;  5BMZ A;  1G6N A;  4HDV A;  5HVQ C;  2OZU A;  3RPQ A;  1SD4 A;  3V7C A;  5K5O A;  5ED4 A;  3KZY A;  4N9H A;  1LEA A;  3HSE A;  2MH9 A;  5KVR A;  4I0B A;  2DT5 A;  5BPI A;  1O3Q A;  4HYE A;  3ZMT A;  3JTG A;  5HDN A;  1BBY A;  5DCM A;  4EJT A;  4EVI A;  3IL2 A;  3RYR A;  1FC3 A;  3E6D A;  5E17 F;  3LWF A;  4FHT A;  3M1E A;  4MQV A;  1ZG3 A;  3ELK A;  2XKO A;  3ZQ7 A;  1SMT A;  2IVM A;  2ZCW A;  2M1B A;  2DK8 A;  1YG2 A;  2VT2 A;  5FFZ A;  1U6G A;  4O3M A;  1BJA A;  5LGU A;  1YQA A;  4S05 A;  2F5F A;  5D8K B;  4EM2 A;  3T1B A;  5D4R A;  1YTY A;  1ZAR A;  2XAQ A;  2VOD A;  1JE8 A;  2OQG A;  4IJA A;  1S3J A;  3MWM A;  4AWX B;  3LFK A;  1IN7 A;  1XDU A;  4HQM A;  1O7L A;  3HOT A;  5ILV A;  1QBJ A;  2RKH A;  2JSC A;  3COA C;  4LLG F;  3QU6 A;  1IAW A;  2WTE A;  1XD7 A;  5ICF A;  1Z91 A;  2L3D A;  1S7A A;  3JSP A;  1XSV A;  1XN7 A;  1FY7 A;  4M71 A;  1XB4 A;  4EJV A;  3TO7 A;  2A5Y B;  1TQI A;  2L4A A;  2IPQ X;  3E6M A;  5DD4 A;  1O3S A;  4O5V A;  3O3K A;  1H0M A;  4Q48 A;  3RPU A;  4LK0 F;  3WTW C;  1IN4 A;  2JPB A;  3D0S A;  3GFJ A;  3R0A A;  4CXF A;  5BPD A;  3HTS B;  2WWY A;  1ZHF A;  3JTH A;  4IRI A;  5DYM A;  5J8F A;  1RUO A;  4LGW A;  2QEN A;  1QQI A;  4UVB A;  5L3G A;  4HAM A;  2GAU A;  2KRF A;  5LHH A;  2F5E A;  2MBF A;  1YS6 A;  1QNT A;  3ZPL A;  3JAM K;  2D1V A;  5DV5 A;  1CF7 B;  1QGP A;  5CVU A;  5DCM B;  4BHB A;  2H27 A;  4BAY A;  2XVC A;  5ICE A;  2GA2 A;  1KQ0 A;  4L5I A;  3GEZ A;  5HDG A;  4MEY F;  3MZY A;  3JW4 A;  4LK1 F;  1I6X A;  1YW8 A;  4TV7 A;  3RKW A;  2W57 A;  4ZYH A;  3KEQ A;  1YLF A;  2IT0 A;  4PZJ A;  1TBX A;  3EET A;  1TQP A;  1TW3 A;  2DW4 A;  1RUN A;  5DUI A;  4KA4 A;  3BP8 A;  1F1Z A;  1B6A A;  2H6B A;  1GVJ A;  4XSZ F;  4IHS A;  3GYH X;  4NQW A;  4OOI A;  2P7C B;  2OZ6 A;  4EGZ A;  3GFI A;  3HRS A;  1CGP A;  2V9V A;  1FT9 A;  3GVA A;  3LAP A;  3VB2 A;  1D8J A;  1UHW A;  5IT9 Z;  1REP C;  4Y17 A;  1FBS A;  4UVA A;  1Z6T A;  2EFN A;  3TO6 A;  3GUD A;  2E7W A;  4HBL A;  5CVR A;  1G3T A;  3BJO A;  4OIQ F;  4MHG A;  4M6Y A;  1FOK A;  3DV8 A;  3LA3 A;  3CO6 C;  3FXQ A;  4U7B A;  4ZZD A;  3ROU A;  2IW5 A;  5TJJ A;  5D6F A;  1Y0U A;  5E1Z B;  2QWW A;  3C3W A;  3DPT A;  1FYL A;  3TQN A;  1IW7 F;  4ON0 A;  5HOO A;  1USS A;  1ZN2 A;  2FNA A;  1LNW A;  3FZV A;  3GXO A;  1FSE A;  1YIO A;  1R1T A;  3SFZ A;  4G7Z F;  4N9I A;  1XSD A;  4NHJ A;  4Q5S F;  1P4X A;  2H6C A;  4WK8 F;  1FWZ A;  4UHT A;  3MFK A;  1A04 A;  1R5G A;  4CIC A;  2KJB A;  1HQC A;  4XLN F;  2FBH A;  5ICC A;  5D6E A;  3HYI A;  1B9N A;  1U2W A;  3KE2 A;  4LMY A;  3U1D A;  5EEG A;  2K4J A;  5HLG A;  2NS0 A;  1BI1 A;  2PMU A;  1D5V A;  1LDK B;  4YII A;  2FE3 A;  1E17 A;  1YO5 C;  2Q8K A;  4U7D A;  2VBY A;  4G7O F;  1BC8 C;  1BI3 A;  3LST A;  2K4B A;  3F6O A;  3WGG A;  4ZYE A;  4HF2 A;  4Q47 A;  2O61 A;  4ENK A;  3C7J A;  1KQ8 A;  3H3Z A;  2FNP A;  1LDD A;  4HDU A;  2QUF A;  5KK1 A;  3WTY C;  1XGM A;  1ONV A;  4OIR F;  4UXN A;  5CLS A;  1W7P D;  4BQA A;  1YW9 A;  3GZ6 A;  3RI4 A;  3RIR A;  2QZ8 A;  2EV6 A;  5ERI A;  2K86 A;  4RGS A;  1KYZ A;  1MJB A;  1UB9 A;  1HKS A;  2XRO A;  3Q9V A;  3VFZ A;  1WSU A;  4JBA A;  1ZLJ A;  4KN7 X;  2V6C A;  2XHK A;  3DF8 A;  4MQ9 F;  4UUV A;  4YFN F;  3B02 A;  3ULQ B;  2FF4 A;  4QWQ A;  3IRQ A;  1LDJ A;  1KQ9 A;  1DPR A;  4EMS A;  2M5W A;  4IRH A;  4RS8 A;  4ENN A;  3HRT A;  1YW7 A;  1ZH5 A;  1U5T A;  1HKQ A;  4ENJ A;  5F64 A;  4G7H F;  1ODD A;  4R1H A;  3QOP A;  2H94 A;  2ZME A;  2QLZ A;  2CW0 F;  3L9F A;  2JPC A;  2STT A;  3CDH A;  1IN5 A;  5FO5 A;  1IXR C;  1AWC A;  4KN4 X;  3LA2 A;  3RTR A;  4HV6 A;  4KDP A;  4BHC A;  1SD6 A;  3H3U A;  2MLG A;  1J75 A;  2P5K A;  3M7G A;  2HWV A;  1BIA A;  1JHH A;  2D45 A;  2ZKZ A;  4I7H A;  3WTU C;  2AS5 F;  2MLK A;  2HDC A;  1RNL A;  1T39 A;  2R7D A;  2PLY A;  2IA1 A;  2PQ8 A;  2RNJ A;  2FML A;  2HEO A;  3ABU A;  4G9Y A;  5LHG A;  4PDK A;  1J9I A;  2PI0 A;  3E6B A;  4P96 A;  5HLH A;  1ZRC A;  3W6J B;  4LB5 A;  2O6G E;  2HS5 A;  5DEQ A;  1B4A A;  2J5P A;  3CUQ A;  4LFU A;  1RIO H;  3RDI A;  3F72 A;  1MGT A;  4MTD A;  1DDN A;  2HYF A;  3ISP A;  1G4D A;  3T0Y A;  3ABT A;  3OOP A;  2LF8 A;  1RI7 A;  1SD7 A;  4ZYD A;  3BZ6 A;  3PQJ A;  5IT3 A;  1P4A A;  1GXQ A;  1OYI A;  4NB5 A;  3NRV A;  3SZP A;  1HKT A;  2YU3 A;  1CF7 A;  1UHM A;  1U5T B;  2UWM A;  2Z3Y A;  3KEO A;  4HX8 A;  1BOA A;  2M30 A;  2ZME B;  4GCV A;  1QZY A;  2G7U A;  3WOD F;  3KP2 A;  4IRG A;  5F6F A;  1XMK A;  1ZRF A;  4UVC A;  2A07 F;  2EV5 A;  2PBI A;  6PAX A;  4KIG A;  3LQR A;  4G94 A;  2W85 A;  2G7H A;  2X0L A;  5TRD A;  3I58 A;  3QPT A;  4U0V A;  2PEX A;  4M6X A;  5CVV A;  4N0B A;  2QQB A;  1MKM A;  4LLL A;  2NYX A;  5DD8 A;  1BI0 A;  3SZT A;  2FMY A;  1C0W A;  2BGC A;  5IT9 K;  2XAJ A;  2H09 A;  4KMU X;  2D2W A;  2QYO A;  2Z33 A;  3F22 A;  4JQF A;  4UV8 A;  4HA8 A;  1Z1D A;  4U88 A;  5ILS A;  2EV0 A;  1BC7 C;  5L3D A;  4G6Q A;  1LB2 A;  1DPU A;  3KP6 A;  5A2Q Z;  4M9S A;  4YG2 F;  2KIU A;  3R61 A;  4A5N A;  2L01 A;  1XSX A;  3SHF A;  5BS6 A;  4WF2 A;  1FX7 A;  4HX7 A;  3CUQ B;  1W5T A;  4P55 A;  1ZGA A;  1UFM A;  4A0Y A;  3ZN1 A;  1ON2 A;  3U2R A;  1O57 A;  2FA5 A;  5J6X A;  1FYK A;  4I02 A;  3IHU A; 
#chains in the Genus database with same CATH topology
 3PFY A;  5E3L A;  3DU5 A;  4KMF A;  1IN8 A;  2QQ9 A;  3WTT C;  3U1K A;  1HXD A;  1Y56 A;  3J80 K;  2M45 A;  3WG9 A;  3BJ6 A;  4PGG A;  5IP7 J;  1T6S A;  1I5Z A;  2EA4 A;  2UXN A;  1Z9C A;  3OR2 C;  3B6A A;  1TT5 B;  2QQA A;  2VKD A;  2L7M P;  3K4L A;  1V3F A;  2P5V A;  1Y1W J;  4XON A;  5D8L B;  4U0W A;  3OYJ A;  1T0F C;  1MH4 A;  5LEJ A;  1W4M A;  3BTC A;  1P92 A;  2BW3 B;  2G9W A;  1YI2 I;  5CKT A;  1MJ9 A;  3L00 A;  2R0Q C;  3OV8 A;  1FOY A;  3HSF A;  1JXS A;  3GW2 A;  1G3Y A;  2LF7 A;  2L54 A;  2L4M A;  4GXO A;  1YJN I;  1BA5 A;  2JT1 A;  2F6C A;  3OIP A;  3WE2 A;  1K6O A;  1QZZ A;  2K9L A;  3KP5 A;  4XR6 A;  3SEQ A;  1MNE A;  2DMQ A;  4IQJ A;  2DT6 A;  2YX4 A;  3JRB A;  1ZRD A;  3OYG A;  4LIV A;  1IN6 A;  3K2Z A;  1R71 A;  3SXY A;  2A3S A;  2DAO A;  3HOZ J;  1V4R A;  2WB1 A;  1XTA A;  3K1M A;  4II2 A;  4B3A A;  1LVA A;  1SFX A;  3I59 A;  1T8I A;  2KHM A;  4HLY A;  4LIU A;  5HDK A;  2ZXJ A;  2DA5 A;  4Y13 A;  2DPU A;  1VF9 A;  2O3F A;  2CS3 A;  2XGX A;  3CJN A;  3PUB A;  3ZMZ A;  2FXA A;  4ENM A;  1BW6 A;  1G3W A;  3KP7 A;  4QIW N;  3FHZ A;  2H1K A;  3KYC B;  2VQH A;  2R7S A;  4A69 C;  3CQZ J;  1F43 A;  5E3O A;  1DP3 A;  3FXK A;  3L2R A;  1Y8Q B;  1VQK I;  2WA0 A;  2VI6 A;  1W7P A;  4C3I J;  4V19 K;  2EZH A;  1ZG5 A;  2R7U A;  3FXR A;  1R4N B;  4RGU A;  2JTV A;  4BQO A;  2XV4 S;  2R3S A;  1MH3 A;  3OSG A;  2JJ7 A;  3ABM H;  4BBS J;  1OKR A;  3JRI A;  3V4G A;  3EYY A;  3J81 K;  3CJT B;  2AO9 A;  5HS8 A;  3BOQ A;  2M4K A;  2VPR A;  4P9F A;  2IAI A;  3S17 J;  3BTL A;  3UR3 C;  2L7F P;  1B59 A;  2EB7 A;  5LEK A;  3F21 A;  5LHI A;  2W4S A;  5E8I A;  2HXI A;  1MD0 A;  2M0C A;  3N97 A;  1XMA A;  1ZK8 A;  3HRM A;  1B1B A;  5DCF A;  2DA2 A;  3BRO A;  3T8R A;  2FOK A;  4AC0 A;  2COB A;  5JHU A;  4IHT A;  2ZJ2 A;  4L18 B;  2VC1 A;  3I71 A;  3F0C A;  4GDF A;  1IDZ A;  4U0Y A;  3R4K A;  3OY9 A;  2P81 A;  1TNT A;  1B72 B;  1H9T A;  1LEB A;  4ESF A;  4KFC A;  3K70 C;  2Y75 A;  3K4N A;  5D4S A;  4EJO A;  1IRG A;  3D1N I;  3M3Y J;  2FX0 A;  2I5U A;  2NOJ B;  3S1N J;  1KYW A;  2CUJ A;  3S2H J;  2DA7 A;  4IVN A;  1BN5 A;  2KIF A;  2NRA C;  5KCM A;  5E8G A;  2E1M C;  2IRF G;  1OCZ H;  4P9U A;  3CCR I;  3FHN A;  2VT3 A;  2RDP A;  5EJC A;  3I0T A;  3OYB A;  5ILU A;  1Z77 A;  1BL0 A;  2OU2 A;  3CUO A;  4WXH A;  3G73 A;  1T98 A;  4XN3 A;  2VLA A;  3FXL A;  1OR7 C;  3BG3 A;  1ETQ A;  1LPQ A;  2KIM A;  2OCC H;  1PP8 F;  4DIQ A;  3FIW A;  4E7J A;  1FNN A;  4XN0 A;  3TL4 X;  1VFC A;  3NWS A;  2E19 A;  1EA3 A;  2E7X A;  3J80 Z;  1WJ5 A;  2GZW A;  3LOC A;  4KUM A;  4CCN A;  2R7Z J;  2LY9 A;  2F4O B;  2O8X A;  3BJA A;  2DLL A;  2E34 A;  2JZY A;  3ZQG A;  2A69 F;  2OTL I;  4L9T A;  5TIS C;  3V8J A;  2CO5 A;  4PSX A;  1WJB A;  2KPM A;  1HDP A;  4WXC A;  2LR8 A;  4ZH4 F;  5F1R A;  2ZSI B;  3PM1 A;  3CCJ I;  4NDL A;  3MZH A;  2DI3 A;  3E3V A;  3C1D A;  3CJR B;  3K4J A;  4M9Z A;  2GXA A;  1ETY A;  4G6D A;  3I59 B;  3TOB A;  3C2H A;  2DDB A;  4HX4 A;  4PJJ A;  1SMY F;  4OIO F;  1RKW A;  2BZT A;  1O7F A;  3IC7 A;  2WY8 Q;  1FP2 A;  3OMY A;  5CYV A;  5FGM A;  2Q2E B;  2OCE A;  2RGV A;  1N25 A;  2BHZ A;  5H20 A;  3ZQF A;  2H1L A;  4MEX F;  4GFB A;  3L2V A;  5HS9 A;  4RAY A;  1TLH B;  3LQQ A;  3ECH A;  1ERD A;  1EH6 A;  2EK5 A;  3IKV A;  3GFM A;  4AYB A;  3FM3 A;  1OMI A;  3FMS A;  5E1X A;  3S8P A;  1I3Q J;  1ZAO A;  2KJC A;  3GZ5 A;  1IXS B;  4RM3 A;  4I2O A;  3MKW B;  3S93 A;  3MAJ A;  4IXA A;  4EM1 A;  2QF7 A;  2BEO A;  2CG4 A;  1W7P B;  4LJZ F;  3TED A;  3F3X A;  4S04 A;  2DK5 A;  2JWT A;  1TNS A;  4XOR A;  3TO9 A;  4BH9 A;  2VON A;  1JGG A;  1UCR A;  1VND A;  3MEX A;  2Q0O A;  2QSF X;  4IF4 A;  3CCV I;  2OPT A;  1MMN A;  3B6C A;  1TQM A;  2XF6 A;  5ICG A;  4I0A A;  3E6C C;  1VQL I;  3K4K A;  2MH2 A;  2Y0S A;  1R5I D;  2ZNZ A;  1ETO A;  2ZFW A;  3SDB A;  3J81 Z;  3OYH A;  1EJ9 A;  1GXP A;  5D5V B;  2HQN A;  4JX6 A;  3ZN0 A;  3LSP A;  4OU0 A;  2X85 A;  3D5R C;  5HLT A;  2H8R A;  4IQ4 A;  3V7S A;  1BIB A;  3ONQ A;  4QLC U;  2LRD A;  4WWC A;  4FQG A;  1XCB A;  5E1W A;  3IWF A;  1UJ8 A;  3BR0 A;  2XIG A;  2VXZ A;  2K9S A;  3UNG C;  3HG9 A;  3KP3 A;  3S1Q J;  4XKV A;  1GHC A;  2EJR A;  3TOA A;  1Z7L A;  4IOA F;  3PNV A;  4GO1 A;  3P9C A;  3JRD A;  2YR2 A;  3ML6 A;  4UUS A;  4RB2 C;  4ESJ A;  3OYK A;  2VBX A;  3RQI A;  2IGN A;  1P2F A;  2YUS A;  4A5M A;  1S8N A;  5JVT A;  1ZEL A;  2ISZ A;  2XGD A;  2Z99 A;  3ERM A;  3QAH A;  2X1D A;  1BR4 A;  2DQL A;  1OIS A;  2DTR A;  3A0B C;  3HKZ A;  2GXB A;  3M9A A;  3OL4 A;  2LKX A;  2IS2 A;  1IZ1 A;  2EIJ H;  2BY1 A;  5K5Q A;  3EDP A;  4BQQ A;  3O8H A;  1D1C A;  3AL0 B;  1EV7 A;  4AUX A;  2DXI A;  2LRE A;  1SFU A;  1LE8 A;  2P4W A;  4XLA A;  2JMW A;  4JK1 X;  1XGO A;  3K1N A;  2E1C A;  2VN2 A;  2V1D A;  3QU3 A;  4C3H J;  1DP7 P;  5JI6 A;  1ZG1 A;  2DMT A;  2L9V A;  2OA4 A;  2QKM B;  3BPV A;  1XS9 A;  1U9N A;  2WY7 Q;  4CCM A;  2F5D A;  4RAZ A;  2ADU A;  4LB6 B;  1MMA A;  3F6V A;  4ZZL A;  4AIK A;  3KYD B;  4R8H A;  4V2F A;  3KPH A;  3CF5 F;  2JRT A;  1QHH D;  2CW7 A;  1FZP B;  3M8E A;  1HF0 A;  2MAB A;  4PJN A;  5D5U B;  1JKO C;  2XRN A;  1Z7U A;  3BG9 A;  4G12 A;  5J8C A;  3JSO A;  5J1Y A;  4A0X A;  1OPC A;  2EA2 A;  4XMY A;  4ZDP A;  2IS1 A;  3OSF A;  2V1X A;  1K7A A;  4XRM A;  4EJW A;  2F5C A;  5KAI C;  1UZC A;  2HKO A;  3VYS B;  1W5S A;  1X3U A;  3FXM A;  4PK4 A;  2Y31 A;  5K1Y A;  1W0T A;  1J7K A;  3ZQH A;  4A3B J;  2OQR A;  4L9J A;  4FET A;  5C4J J;  2ACJ A;  5D5W B;  1CQT A;  2EFW A;  1J0R A;  2Y0M A;  4ZDO A;  2IA2 A;  2FQ3 A;  2KT0 A;  1L3L A;  4RBO A;  2ISY A;  3B73 A;  1VQ7 I;  3S16 J;  5EF6 A;  2GXG A;  3KET A;  4BBR J;  4D0P A;  4YFX F;  2QCO A;  1JKQ C;  3VOE A;  3SJM A;  1WRJ A;  3A01 A;  3FX3 A;  2KFD A;  3MQ0 A;  1NK2 P;  4NBQ A;  2HR3 A;  3GTL J;  1I6H J;  3DKX A;  3H9J A;  5EZH A;  1WKM A;  2EFO A;  2VOP A;  2F48 A;  5A2Q K;  3SDG A;  5LGN A;  2DJN A;  3H0G J;  2HPM A;  5J1U A;  4CGZ A;  4XQF A;  3L09 A;  3EQL F;  3ZQC A;  2UXX A;  3BR5 A;  3G2B A;  2EFP A;  3O8G A;  5K7F A;  5CPR B;  3SZG A;  1X1D A;  1R36 A;  1K4T A;  2M87 A;  3VYR B;  3KFW X;  4A3K J;  1RR8 C;  4YEJ A;  2TCT A;  3E5Q A;  2KDO A;  4I98 B;  4AVZ A;  2TDX A;  5D5X B;  2FBK A;  1G3S A;  2LY1 A;  1OJL A;  2M7A A;  1YJ9 I;  2K7L A;  1STZ A;  2A68 F;  5HS7 A;  3UKG A;  2DYS H;  5FLX Z;  2HQ5 A;  2EWN A;  3E5X A;  2VQC A;  5IP9 J;  4HV5 A;  3BY6 A;  1RC9 A;  3C18 A;  3LA7 A;  2DDA A;  3V42 A;  2UV1 A;  1D3Y A;  2W24 A;  2VXD A;  4L9V A;  4E7H A;  4MO7 A;  1BR2 A;  4P5O A;  4GYI A;  4XL9 A;  4UUS B;  4XRF A;  4RB0 A;  3FXJ A;  1FOW A;  1UST A;  3DFG A;  1JUP A;  3W2W A;  3GF2 A;  3DP7 A;  2KRH A;  1HBX G;  5FFX A;  3S32 A;  3LSK A;  5L3E A;  1FLI A;  1KU9 A;  4PJ0 C;  3PUF A;  1Z6R A;  5CVJ A;  4DJA A;  1DU6 A;  1WJA A;  1D5Y A;  4YFK F;  3L7W A;  4WX9 A;  4DW6 A;  4V2G A;  1RRJ A;  2JSP A;  2L9R A;  1LE8 B;  4RM2 A;  1JHF A;  3WE3 A;  2LK2 A;  4C3J J;  3OS2 A;  2VL8 A;  4LG3 A;  1WJF A;  1ON1 A;  5IYC J;  3MCZ A;  1AOY A;  4CH7 A;  2R7V A;  2HTJ A;  2WAE A;  4Y15 A;  3GX4 X;  2A5W A;  2ESH A;  5J4Y A;  1MSF C;  1BI2 A;  3FMQ A;  1SAX A;  1OYW A;  3M07 A;  3VDX A;  4BE2 A;  2LD5 A;  1K78 A;  3FK6 A;  2GQQ A;  2PFB A;  3HC7 A;  5E20 A;  4XOT A;  3FXU A;  4EGY A;  3RKY A;  2DFF A;  3TW6 A;  3K2A A;  2HQR A;  3IRR A;  1YX5 A;  1FMV A;  2VE9 A;  2HZD A;  4AIJ A;  4RGR A;  1AHD P;  1XCV A;  5H6R A;  3K7A J;  2PX9 A;  4BEH A;  1JGS A;  2HVS A;  1OCO H;  4CYD A;  5K7Z A;  1R9T J;  1KA8 A;  2DMP A;  3G1L A;  4MLO A;  3BPX A;  1T38 A;  2DCE A;  3BWG A;  2XB5 A;  2NNN A;  1FIP A;  2CYY A;  5J47 A;  2A05 A;  2Y0S N;  2EIK H;  2CMP A;  3FM5 A;  5FD5 A;  4D1Q A;  1XGN A;  3QRF F;  3TP0 A;  4H0E A;  1EH7 A;  3G6E I;  2K9Q A;  1TWC J;  3FF5 A;  2XC7 A;  4GYG A;  2LKS A;  3KLN A;  2VKE A;  4M6V A;  5J4V A;  2BY0 A;  4UUT A;  3NEU A;  5DTD A;  5F1J A;  5DDG A;  2MW8 A;  3H3V K;  4LD5 A;  5IYD J;  2WAD A;  2ZO4 A;  4ZYG A;  1YFH A;  1N77 A;  2XKP A;  2M34 A;  2RVC A;  1P4W A;  3M4O J;  3QYF A;  1FYM A;  3ZMD A;  4M74 A;  4K2E A;  3FWE A;  3KIO A;  1I1S A;  3DEE A;  3S14 J;  4IOC F;  4HQE A;  3HEF A;  1U0J A;  3WGI A;  3WGH A;  2OAZ A;  4HG2 A;  3K70 D;  2R7Q A;  5L3F A;  1H9G A;  2E36 A;  2LLK A;  3AKZ A;  3A01 B;  4KIC A;  1JI8 A;  4FTH A;  2WV0 A;  1P7J A;  2VJ5 A;  2G0E A;  3HOS A;  4BY1 J;  3P9I A;  3GBG A;  3M8F A;  4X1E A;  3OYI A;  4KIT B;  4R79 A;  2V79 A;  3TKY A;  2HYG D;  3K1P A;  2E1N A;  3WU0 A;  2P8T A;  1BR1 A;  5JFR A;  2GIV A;  3C2G A;  5FD6 A;  2M8E A;  2CQQ A;  1YS7 A;  3EUH A;  1X3W B;  3CCM I;  1ETX A;  3E97 A;  2JK3 A;  1U78 A;  4G8X A;  1S6L A;  1YX3 A;  5FKK A;  2YS9 A;  1YYV A;  4FT8 A;  2M3A A;  4A6D A;  2A6E F;  1TW2 A;  1MDM A;  1FJL A;  2ZFU A;  3ZMU A;  3ZOB A;  4FIS A;  1R1U A;  3FKI J;  2JVH A;  5GAH J;  2R7R A;  1UHS A;  2RC4 A;  3A4C A;  1HST A;  1SFE A;  3DPL C;  4B09 A;  3IKT A;  4BXF A;  2OTJ I;  4BXU A;  5HOD A;  1IXC A;  3I4M J;  2EH3 A;  2LH9 A;  5JR3 A;  3VYT B;  3SQN A;  2IA0 A;  1ZTR A;  2HXO A;  2LVS A;  3ZQI A;  1ZR2 A;  1LFB A;  3W2V A;  1HA8 A;  3IV5 A;  2M7B A;  3HXL A;  2O0Y A;  4DOZ A;  4A3M J;  4XK4 A;  1P7I A;  4HW0 A;  2ID3 A;  2R7F A;  3DU6 A;  4BYY A;  3WTS C;  5L3B A;  1POG A;  2ESN A;  5M3F J;  3I64 A;  2LNB A;  1X2M A;  1R49 A;  1YHQ I;  2VPL A;  5L3C A;  4CCK A;  2F2E A;  2FU4 A;  1XX5 A;  2CQK A;  1A35 A;  2L7Z A;  3VOD A;  3CDI A;  2DT7 B;  4HZF A;  2BE5 F;  4CCJ A;  4CCO A;  4UV9 A;  1UAA A;  2Z9O A;  1W1W E;  1R58 A;  1RET A;  1NHA A;  1ZGJ A;  3ZMV A;  3VEP A;  1OCR H;  2CQX A;  2L9S A;  4EM0 B;  3F8B A;  2XAU A;  3BTJ A;  5JLX A;  1TWF J;  2JVG A;  2VQL A;  1X1P A;  4PFO A;  4OMY A;  2NNY A;  2KZV A;  2DOA A;  3JR9 A;  3NQO A;  3HHH A;  3BCA A;  4L5J A;  3K0L A;  2HKX A;  1S7O A;  1UG2 A;  1K78 B;  2E1O A;  3FKJ A;  5F27 A;  4KIF A;  3L2C A;  1J59 A;  1F4K A;  2Z2S B;  4BEH B;  5AON A;  4LG0 A;  1Q1V A;  3DXJ F;  2K3P A;  3LFU A;  2Q2E A;  5GPC A;  2CV1 A;  1X4P A;  1Z67 A;  4CDG A;  2VC0 A;  3S2W A;  5LBQ A;  3Q9S A;  3AAF A;  4A6E A;  4C2U A;  1F5T A;  1J2X A;  2XAS A;  3FK7 A;  3A0H C;  5IYB J;  4DQ2 A;  3F8M A;  4E4H A;  3H35 A;  1WJC A;  1PUF A;  3HHG A;  2ECC A;  2FQ4 A;  2Z5U A;  3P7N A;  3HPH A;  1R23 A;  4M72 A;  1ZRE A;  3LSH A;  2WV1 A;  2VBZ A;  1K6Y A;  2DU9 A;  1P6R A;  1MZB A;  4L0Z B;  3BR1 A;  4AIH A;  3HPG A;  3I3L A;  1TL8 A;  2HFH A;  3KZI C;  1PVE A;  2K9N A;  4WXD A;  1HDD C;  1LQ1 A;  2L2O A;  2JA7 J;  4KIB A;  1GLN A;  2MC3 A;  1M1E B;  2OF7 A;  3JRH A;  2VKV A;  4JP0 A;  2QBY A;  3S15 J;  1WI9 A;  3VYU B;  3HOU J;  2DMN A;  1N78 A;  4FX4 A;  4B8X A;  2JA2 A;  1GV5 A;  1ZLK A;  3CC4 I;  2XSJ C;  3V7R A;  2FSW A;  4FE7 A;  1U5T C;  2LKP A;  3GO5 A;  3BDD A;  3CP2 A;  2L02 A;  2L7K A;  2PMZ N;  2ZJQ F;  1ZYR F;  4BNC A;  3CLQ A;  1E2X A;  2A6T A;  4OIP F;  2ZME C;  1B9M A;  4A12 A;  1PP7 U;  2IS6 A;  1D0X A;  2DFI A;  4NC7 A;  4F52 A;  2DA4 A;  3Q5F A;  4DNC A;  2BBY A;  2NVY J;  5HLI A;  2RV8 A;  3DKW A;  5K7H A;  2E2J J;  4XLP F;  2Y48 A;  1MBH A;  2XUB A;  1MDM B;  2OD5 A;  1I27 A;  1J5Y A;  4P1W A;  1NH3 A;  2HZT A;  3ZRG A;  1PUE E;  1QHG A;  1N75 A;  3D5S C;  3TDU C;  2K27 A;  2VBW A;  3U9G A;  1F9N A;  4Y4R A;  4MGR A;  3TGN A;  2EZL A;  3HOV J;  3HOX J;  2FRH A;  2ZJR F;  3T5X A;  2GOM A;  3GWZ A;  4FAS D;  4CO8 A;  4YIF A;  4BL0 B;  4IKF A;  1QVU A;  2HVR A;  3LSR A;  2QVO A;  2A61 A;  3HGY A;  5FRN A;  2ECB A;  2WC2 A;  5TGT A;  2DBB A;  4LIT A;  2RNG A;  4ASN A;  4ZTJ A;  3ZXS A;  5FRM A;  3J7A O;  1TTY A;  4ZTF A;  4J00 A;  5DUK A;  3G1O A;  5BOX A;  1VQ8 I;  1SD5 A;  4XIC A;  2W84 A;  3REO A;  4HOB A;  2EZI A;  2K85 A;  2X4H A;  2V1U A;  1RKT A;  4PJM A;  1FMW A;  1Y0N A;  4Z2Y A;  2DYR H;  3BLY A;  2RQP A;  1JKP C;  3RQ4 A;  3RZO J;  4A93 J;  4BUP A;  4BJT A;  5EDN A;  2X9D A;  4Q4Z F;  1R7J A;  3QPH A;  1YJW I;  4M3F A;  3RPU D;  4B43 A;  3HIF A;  1HSJ A;  1W0U A;  5FKN A;  4IHW A;  2KRC A;  2PMH A;  4GGG A;  3NAR A;  2E35 A;  4I01 A;  3LMM A;  1A6I A;  3HTU A;  4A3J J;  1V55 H;  2P6S A;  2PG4 A;  4MNU A;  2XAH A;  2YX7 A;  3CTA A;  3MZ8 A;  2VAS A;  4IPA A;  4IHX A;  1H88 C;  4A3I J;  3K4B A;  4XLF A;  4XID A;  5EYR A;  2QM3 A;  1SAN A;  3A1Y A;  1K4S A;  3CUQ C;  2GWR A;  3ERE D;  4G6T B;  4LG0 B;  5LGT A;  1QA6 A;  1QZE A;  4I09 A;  4A3D J;  3KLO A;  2R7O A;  1FP1 D;  3BQZ A;  2EZK A;  3JAM Z;  2R7T A;  2VOO A;  2BXZ A;  3KP4 A;  4C30 A;  3WTV C;  1MMG A;  5FJ8 J;  2D5V A;  1QPM A;  1Q1H A;  2NXN B;  1Z21 A;  3I5U A;  1WH5 A;  1TWH J;  3P9K A;  5EG0 A;  3CCE I;  4A0Z A;  2P6T A;  2CGP A;  1PUF B;  3D5L A;  2FD5 A;  1FPQ A;  3ZMS A;  1K79 A;  2NVT J;  2HGC A;  1QO0 D;  2W1O A;  3ABK H;  3QP6 A;  1X1C A;  5J1R A;  2ZSH B;  1TT0 A;  4B1R A;  2M0M A;  2BHY A;  2HTS A;  1KU2 A;  2C6Y A;  4JYK A;  4KNY A;  3T8T A;  1A5J A;  2P5L C;  4M3G A;  4FX0 A;  4ZC3 A;  4RAG A;  1T56 A;  2AQE A;  1BOB A;  4ZDL A;  3WTX C;  3JRG A;  2E5Z A;  2STW A;  3ESW B;  4Y7N J;  3A02 A;  2QBY B;  5EGO A;  1Z3Y A;  1JKR C;  3DBH B;  3IAS 2;  3F8C A;  1TC3 C;  3NWT A;  4BHP A;  1T0F A;  1FTT A;  2ELH A;  2YPR A;  1FBU A;  2MYS A;  2PJP A;  1ULY A;  3V8L A;  1PDN C;  2DN0 A;  2LOO A;  5CJ9 A;  3QP5 A;  3ZQQ A;  4HNU A;  2F5V A;  2DO7 A;  2ZXH A;  3A2K A;  5FLX K;  2IXS A;  2JRM A;  5J40 A;  2MA3 A;  3GTJ J;  1WWX A;  3HRU A;  5IP6 A;  1KU3 A;  2BYV E;  1JTX A;  2HQA A;  3I54 A;  3I53 A;  4A3F J;  2NVX J;  1GV2 A;  3TDZ C;  5GPA A;  2IS4 A;  3WU1 B;  2V6E A;  3ZCO A;  1K83 J;  3I4P A;  1VZ0 A;  3K69 A;  4KIS A;  4RB3 C;  2OBP A;  5M3M J;  1DQU A;  3S1M J;  1RZ4 A;  3TMO A;  4A3E J;  1MMS A;  3K9T A;  2VE8 A;  3CO7 C;  2LDU A;  2AHQ A;  1JJ8 C;  4PGH A;  4QPQ A;  2WAQ A;  2ZB9 A;  2HPI A;  2HOE A;  4MTE A;  3PSI A;  2XAF A;  3CCU I;  1WQ2 A;  3GCM A;  2QQ8 A;  2EFQ A;  3F8N A;  1MBJ A;  2WB1 N;  1XDS A;  2UZK A;  3E7L A;  3M1C A;  3JRE A;  5HNH A;  2I10 A;  5GAD J;  1A6Q A;  1WCM J;  3IP4 B;  2IJL A;  3HSR A;  2DQR A;  4O6J A;  1R1V A;  1OYY A;  1FEX A;  2M9H A;  1MNM C;  2CWE A;  2ZBK A;  4PCQ A;  3S3N A;  1O3R A;  3H92 A;  1IV8 A;  4ESB A;  1R4M B;  1T2K A;  3GFL A;  5B1A H;  5KHD A;  3HOW J;  1R22 A;  1I1G A;  4KT5 C;  4BS9 A;  3IWZ A;  2K02 A;  3DEU A;  3V8K A;  1IRX A;  4MFE A;  2AXL A;  1ORK A;  5B5E C;  2LMD A;  5LRR A;  4BJ5 C;  3Q0U A;  1MBK A;  2X6W A;  4ETS A;  1S29 A;  5F0F A;  2Q1Z B;  3C2B A;  3F8F A;  5CVI A;  3S1R J;  4E70 A;  1VTN C;  4OWR B;  4C9Y A;  3ZQL A;  1TWA J;  2RN7 A;  1ETK A;  4OIN F;  5FB2 A;  3DLA A;  2GA1 A;  3LAJ A;  2HOT A;  3SFI A;  2M8G X;  3R0J A;  3RZD J;  4BQN A;  3CP8 A;  2BV6 A;  3R60 A;  1IUY A;  1FSH A;  2HU9 A;  3GZN B;  1U8R A;  4CHU A;  4N4O B;  3RYP A;  3RKX A;  2O03 A;  3E5U A;  3EPZ A;  3O6B B;  5KAF C;  3PIO F;  2OC6 A;  2I8D A;  2YSR A;  3AG4 H;  2KKO A;  2XAG A;  3EYI A;  1IF1 A;  1MJA A;  2DPD A;  4EQQ A;  3GLX A;  3BR2 A;  3BC8 A;  2BVL A;  2CV0 A;  1LFU P;  1FBQ A;  2BY3 A;  4EV0 A;  1HW2 A;  2P7V B;  1NG6 A;  2DOF A;  2ETH A;  2ZNY A;  4DYC A;  4BXX J;  5EEH A;  1KGS A;  4PSW A;  1IO2 A;  2IP2 A;  4OMZ A;  3MN2 A;  5LLQ A;  1MND A;  2EQR A;  2COM A;  3WU2 C;  3PFI A;  5EG0 B;  1L0O C;  2NAZ A;  1T08 B;  2XPW A;  3BG6 A;  2K40 A;  2CRG A;  5BQT A;  2LFB A;  2QKL B;  2NS8 A;  3CLO A;  4PUS A;  1LKX A;  3G4S I;  4KYW A;  5JVG F;  3K10 A;  5JHF A;  1R5H A;  1KON A;  3RJP A;  3DQV C;  2CU7 A;  4L9N A;  2W25 A;  1LJ9 A;  1G8X A;  4OAZ A;  4BE0 A;  1H8A C;  1DUX C;  1OR7 A;  1HW1 A;  1WH7 A;  2D1H A;  3HL2 A;  3QPL A;  1KU7 A;  1IRF A;  2JA8 J;  5EGO B;  2FEZ A;  4AD9 A;  2CFX A;  2B0L A;  4CSW A;  3N4M A;  2R5Z A;  4L0Y B;  2LBF A;  3AG2 H;  1FTZ A;  1VQ6 I;  4MFD A;  1BM9 A;  1WJD A;  2XGC A;  4M9X A;  2ID6 A;  3LSM A;  4HF0 A;  4CZZ A;  3OYE A;  4AVP A;  1SVO A;  4WCG A;  1EH8 A;  5FKL A;  4A2U A;  3F23 A;  4F3Q A;  1D8K A;  2CSO A;  5F0C A;  1Z05 A;  5K5R A;  2QEX I;  2J5O A;  3LSJ A;  2EBI A;  4L5E A;  3O2P E;  4M73 A;  2FBI A;  5AIQ A;  5E18 F;  2MD5 A;  4HSR A;  3ZP5 A;  4LLN A;  1R00 A;  1XGS A;  3HUG A;  4F55 A;  2A6H F;  5LRS A;  4XBF A;  2LSO A;  4YIR X;  4RGX A;  3PQK A;  4XLH A;  5GAG J;  1MBG A;  2E2I J;  5AIP A;  1HW5 A;  1IC8 A;  3R6S A;  5B3S H;  1JUS A;  4EJU A;  3ECO A;  3MKZ A;  3LSG A;  4XSX F;  5FKM A;  2V9K A;  5GTH C;  1D0Z A;  3WTZ A;  1O3T A;  3FMR A;  3WG7 H;  3DTK A;  4F7Z A;  2CW8 A;  3KZZ A;  4HLX A;  4XKB A;  2LTP A;  2PN6 A;  3W6K B;  3CC7 I;  1U3E M;  4RB1 A;  1YRN A;  1TWG J;  3G3Z A;  3KCC A;  4HF1 A;  4UNO A;  5M5X J;  4HNV A;  5H6Q A;  2Y69 H;  5GTI C;  5BMZ A;  1UG0 A;  1G6N A;  1HCR A;  3FBN B;  2OJE D;  2X6Y A;  1BW5 A;  3CES A;  1S72 I;  1V54 H;  3HM5 A;  4HDV A;  2R7X A;  5HVQ C;  2XPV A;  3HDD A;  5FLV A;  2HYJ A;  2OZU A;  1EF4 A;  3ASO H;  3RPQ A;  1SD4 A;  2XRL A;  4RLF A;  3V7C A;  5K5O A;  5ED4 A;  3KZY A;  2DTZ A;  4YEL A;  1IJW C;  4N9H A;  3TP3 A;  4Z6Y A;  1RR7 A;  3IH2 A;  1LEA A;  1QVT A;  3HSE A;  4AYB N;  3TBI A;  2MH9 A;  4BKX A;  4QPO A;  1G2H A;  5KVR A;  2V9P A;  4I0B A;  2DT5 A;  5BPI A;  4UY8 I;  1FOX A;  4F92 B;  1XMX A;  1O3Q A;  4HYE A;  1DGR M;  4QTR A;  3P5J A;  2L9N A;  3ZMT A;  2CJJ A;  3JTG A;  5HDN A;  1BBY A;  5DCM A;  4JX4 A;  4EJT A;  3DCF A;  4EVI A;  3IL2 A;  1A31 A;  3RYR A;  2OV7 A;  1FC3 A;  3E6D A;  2WAF A;  5E17 F;  2GBY A;  3LWF A;  2ZC2 A;  4FHT A;  3M1E A;  1R6R A;  4MQV A;  1ZG3 A;  3ELK A;  3X2Q H;  2W82 A;  4BDZ A;  3PO3 J;  5F04 A;  2XKO A;  2VB6 A;  2HI3 A;  3PNT A;  3ZQ7 A;  1SMT A;  5DM7 F;  1AU7 A;  2CQ7 A;  2IVM A;  3PSF A;  3CMA I;  2ZCW A;  2M1B A;  2DK8 A;  2IEK A;  1YG2 A;  1SEU A;  2VT2 A;  1EKE A;  3CDL A;  5FFZ A;  1U6G A;  4O3M A;  4RLQ A;  1BJA A;  5LGU A;  5C3E J;  1YQA A;  1ZKG A;  4S05 A;  1IUF A;  3OS1 A;  2F5F A;  3ASN H;  5D8K B;  4EM2 A;  5E3M A;  3EUA A;  3CCL I;  3AL0 C;  2DFE A;  3T1B A;  5D4R A;  1YTY A;  2E1M B;  2VJJ A;  1ZAR A;  2XAQ A;  3S3M A;  1Y6I A;  2VOD A;  1JE8 A;  2OQG A;  4E7K A;  4IJA A;  4UB6 C;  1S3J A;  1HOM A;  3MWM A;  4AWX B;  3IH3 A;  3LFK A;  2CQN A;  2CUE A;  5M5W J;  1IN7 A;  1X3Z B;  1U9O A;  1XDU A;  3HKZ N;  4DZJ A;  4HQM A;  1SAU A;  1O7L A;  3HOT A;  3AG3 H;  3CZ6 A;  5ILV A;  2R5Y A;  1QBJ A;  4N4N B;  4XRS G;  3GTM J;  2RKH A;  4IX7 A;  3F9K A;  2JSC A;  2R5Z B;  2LBF B;  2W7N A;  4B44 A;  3COA C;  4LLG F;  9ANT A;  3QU6 A;  1IAW A;  2WTE A;  1X58 A;  1Y8R B;  1XD7 A;  5ICF A;  1Z91 A;  1JT6 A;  2ZJP F;  2L3D A;  2QSG X;  1S7A A;  3JSP A;  2UUZ A;  4XRS A;  1XSV A;  2X1C A;  2OUM A;  5LD2 C;  4W1U A;  2O7O A;  1XN7 A;  3HUG B;  1FY7 A;  1NTC A;  4M71 A;  1XB4 A;  4NC8 A;  1V5E A;  4BJ6 C;  3MKY B;  2AQF A;  1AKH A;  4EJV A;  3TO7 A;  1E3H A;  2A5Y B;  4A3C J;  2ME0 A;  1MSE C;  5JLW A;  1TQI A;  2L4A A;  2IPQ X;  3E6M A;  4NNJ A;  5DD4 A;  1O3S A;  4O5V A;  2N8G A;  3W3C A;  3O3K A;  1H0M A;  4Q48 A;  3RPU A;  4LK0 F;  1IN4 A;  2JPB A;  3WTW C;  5J3L A;  3D0S A;  1NG7 A;  3GFJ A;  3OIQ A;  3R0A A;  4CXF A;  1YRN B;  4RAF A;  5KNL A;  4M3E A;  2EIN H;  4MIM A;  3BR6 A;  5BPD A;  3S2D J;  2Y30 A;  3HGG A;  3HTS B;  3W6V A;  2WWY A;  1ZHF A;  3JTH A;  4IRI A;  1YOV B;  5DYM A;  5J8F A;  3FDY A;  3MVP A;  1RUO A;  4LGW A;  2QEN A;  3G71 I;  1QQI A;  4UVB A;  1MMD A;  4HAM A;  5L3G A;  2GAU A;  2KRF A;  5LHH A;  2IGO A;  4D7M A;  2E2H J;  1OQY A;  2ELJ A;  2F5E A;  3QWL A;  3FXO A;  4FE4 A;  4C2T A;  2YU9 J;  4LOC A;  4CA0 A;  2MBF A;  4QSH A;  2NVU B;  3WHB A;  1YS6 A;  3PL8 A;  1QNT A;  2FUG 2;  3ZPL A;  4IO9 F;  1LVK A;  3JAM K;  2D1V A;  3H5R A;  5DV5 A;  1MBF A;  1CF7 B;  1QGP A;  2EIM H;  5CVU A;  1WHU A;  5DCM B;  4BHB A;  1PYV A;  1IRZ A;  2H27 A;  1I50 J;  3MKL A;  1JUM A;  4BAY A;  2K5C A;  2XVC A;  5ICE A;  2GA2 A;  1KQ0 A;  2O8K A;  4L5I A;  3GEZ A;  5HDG A;  2XGE A;  4MEY F;  3MMY B;  1HC8 A;  1I39 A;  2FJ1 A;  3MZY A;  2K3F A;  3JW4 A;  3SYT A;  1TZL A;  1VQ4 I;  4LK1 F;  1I6X A;  1YW8 A;  4B3X A;  4TV7 A;  4AID A;  3IH4 A;  4W97 A;  4DGW B;  2BXY A;  3I56 I;  3RKW A;  3E0J B;  3DBL B;  3MD2 A;  3BQY A;  2W57 A;  3IUO A;  4ZYH A;  3BTI A;  3KEQ A;  4XNF A;  3GLL A;  1YLF A;  5E79 C;  2IT0 A;  1Z0X A;  4PZJ A;  1TBX A;  1VI0 A;  3EET A;  1TQP A;  3I9V 2;  1TW3 A;  2DW4 A;  1RUN A;  2GIZ A;  5F08 A;  5DUI A;  1Y39 A;  4KA4 A;  3BP8 A;  4Y3O A;  3DPU A;  1F1Z A;  4Y33 A;  3KEY A;  1B6A A;  1VQN I;  2CV2 A;  2H6B A;  1GVJ A;  3CME I;  4XSZ F;  2EPF A;  3JRF A;  1UEL B;  2V1N A;  4IHS A;  5M5Y J;  3VSK A;  1OCC H;  4NQW A;  3VPR A;  3GYH X;  4OOI A;  2P7C B;  2OZ6 A;  4EGZ A;  3GFI A;  3HRS A;  2PJR B;  4IHV A;  2R5Y B;  2KZG A;  2RQQ A;  1CGP A;  2V9V A;  1FT9 A;  1VQP I;  3GVA A;  3LAP A;  2DA3 A;  3VB2 A;  4EEF G;  2DOE A;  1D8J A;  1W36 D;  1UHW A;  3OYD A;  5IT9 Z;  5GAE J;  1FIA A;  1REP C;  1G59 A;  4Y17 A;  3H5A A;  4ITV A;  1HLV A;  1FBS A;  1IGN A;  4DYQ A;  4UVA A;  4BGD A;  1Z6T A;  4CCL A;  2EFN A;  3TO6 A;  1GDT A;  3L1P A;  3GUD A;  1AKH B;  5B1B H;  2XB0 X;  4IL6 C;  2E7W A;  4HBL A;  4E7S A;  1PJR A;  5CVR A;  1X1B A;  1G3T A;  3BJO A;  1S7E A;  5CQE A;  4YRV A;  3J7A Y;  1W5C C;  3QOE A;  5IOZ A;  4OIQ F;  3EUK L;  5IPA A;  4MHG A;  1WJE A;  3K4M A;  4M6Y A;  1FOK A;  3DV8 A;  3U21 A;  3LA3 A;  3OR1 C;  2EIL H;  4XM3 A;  2DFH A;  3CO6 C;  2KL4 A;  3DBR B;  3BCB A;  3FXQ A;  4U7B A;  1RES A;  4F93 B;  1IDY A;  4HNT A;  3I55 I;  4ZZD A;  3ROU A;  2IGK A;  2IW5 A;  3QYB A;  4H4K C;  2JQ7 A;  1WFX A;  5TJJ A;  4D5C A;  5D6F A;  1Y0U A;  3HB9 A;  5E1Z B;  2QWW A;  4E6K G;  2JA6 J;  3BZK A;  1X2N A;  3QQA A;  2DA1 A;  3C3W A;  3DPT A;  1FYL A;  3TQN A;  2JA5 J;  3DLL F;  1IW7 F;  3KYL A;  2IBD A;  3GTK J;  4ON0 A;  1ENH A;  5HOO A;  1USS A;  1ZN2 A;  2FNA A;  1O4X A;  1LNW A;  3FZV A;  3GXO A;  1IV6 A;  1FSE A;  2Y9Y A;  1YIO A;  3ZGK A;  1R1T A;  3SFZ A;  2XDV A;  2L0K A;  4G7Z F;  4N9I A;  4D7N A;  1XSD A;  2BOL A;  2HNH A;  4E7Z A;  4NHJ A;  4Q5S F;  1P4X A;  2H6C A;  4WK8 F;  1FWZ A;  4UHT A;  3MFK A;  1A04 A;  3K6G A;  2Z1D A;  2DA6 A;  1R5G A;  3CCS I;  3CCY A;  4CIC A;  2AXT C;  3BG7 A;  3Q0V A;  5IY5 H;  3PJR A;  2KJB A;  1HQC A;  4XLN F;  3OYF A;  1S5L C;  1VQ5 I;  2FBH A;  5ICC A;  5D6E A;  2KP6 A;  4J01 A;  3HYI A;  3S3O A;  1B9N A;  1BJZ A;  1U2W A;  2ICW G;  3KE2 A;  5FRO A;  4LMY A;  1DU0 A;  3U1D A;  5EEG A;  3TW7 A;  2K4J A;  4A3G J;  4XLC A;  5HLG A;  4XOP A;  4B4C A;  2NS0 A;  1BI1 A;  2PMU A;  4M3B A;  1D5V A;  1LDK B;  4YII A;  4NC6 A;  2FE3 A;  2VJI A;  3CD6 I;  1E17 A;  1YO5 C;  4IZZ A;  2ME6 A;  2Q8K A;  2KIS A;  4HST A;  4U7D A;  1OCT C;  2VBY A;  3GTQ J;  2O5R A;  1IG7 A;  3M8J A;  3SEZ A;  1BC8 C;  1BI3 A;  3LST A;  4G7O F;  2K4B A;  3F6O A;  3WGG A;  4ZYE A;  2X6O A;  4HF2 A;  4Q47 A;  2O61 A;  1QU3 A;  4ENK A;  3H9G A;  3C7J A;  1RPW A;  1KQ8 A;  3VSL A;  1WVR A;  3H3Z A;  2FNP A;  2MSY A;  2X6X A;  1ETW A;  1LDD A;  3BZC A;  4UB8 C;  2QUF A;  4HDU A;  5KK1 A;  3WTY C;  1XGM A;  5HNF A;  3PIP F;  3OIO A;  3G1M A;  1ONV A;  3H9Q A;  4NQW B;  5EEA A;  2B9S A;  1OLT A;  3DWL E;  4NUB A;  4OIR F;  3KX2 A;  4UXN A;  4JOM A;  5CLS A;  1W7P D;  4DBR A;  2R93 J;  4BQA A;  1YW9 A;  2HDW A;  2NS7 A;  3GZ6 A;  4BE1 A;  3RI4 A;  3RIR A;  2QZ8 A;  2EV6 A;  2ELK A;  2GM4 A;  2MFZ A;  5ERI A;  3GTO J;  4D9J A;  1T33 A;  2K86 A;  2GOX B;  1ETV A;  4RGS A;  4DBQ A;  2B63 J;  1SC7 A;  2FOW A;  2QGU A;  1OFC X;  2V7F A;  4M3D A;  1E3P A;  1JTY A;  1ZQ3 P;  3HBL A;  2VQG A;  1KYZ A;  3CCQ I;  1ZR4 A;  3NAU A;  2JN6 A;  1MJB A;  1UB9 A;  4BAC A;  1HKS A;  2MGQ A;  4II3 A;  1V5G A;  4I99 C;  2XRO A;  3Q9V A;  3VFZ A;  3QYE A;  1Z3X A;  1WSU A;  4JBA A;  1ZLJ A;  2LP0 A;  4KN7 X;  4U87 A;  1W36 C;  2XHK A;  2MC4 A;  1MIJ A;  2V6C A;  3DF8 A;  3J7Z I;  1D1A A;  3HZJ A;  4MQ9 F;  2HDD A;  3L2W A;  2NOG A;  4UUV A;  2MG4 A;  4YFN F;  3B02 A;  3ULQ B;  1E3O C;  2FF4 A;  4QWQ A;  3IRQ A;  3HJE A;  3I4N J;  2KDZ A;  1LDJ A;  1ITY A;  1KQ9 A;  1LUJ B;  1DPR A;  4B48 A;  2LY2 A;  3OOU A;  4EMS A;  2M5W A;  4IRH A;  4RS8 A;  2DOD A;  4ENN A;  1QRY A;  2M4G A;  3HRT A;  1YW7 A;  1ZH5 A;  1U5T A;  1HKQ A;  4ENJ A;  5F64 A;  4G7H F;  4CUG A;  4HPQ A;  1ODD A;  4R1H A;  2JUG A;  1QPI A;  2Y9Z A;  3QOP A;  2H94 A;  3EUH C;  2ZME A;  5E3N A;  3GTG J;  2QLZ A;  2GLO A;  3AFH A;  1WPK A;  2CW0 F;  3L9F A;  2JPC A;  2ZXI A;  2E71 A;  5LFA A;  2X51 A;  4GRI A;  2STT A;  1D0Y A;  2MD0 A;  3H0D A;  1H89 C;  3W2A A;  3CDH A;  5C4X J;  2X48 A;  2F4M B;  4JX5 A;  1IN5 A;  2F4I A;  3BR3 A;  4X6A J;  2CUF A;  5FO5 A;  1IXR C;  1GVD A;  1AWC A;  3J7Y J;  4KN4 X;  1VQ9 I;  3LA2 A;  3OYA A;  4DYR A;  3RTR A;  4HV6 A;  1APL C;  4KDP A;  4EAT A;  4BHC A;  2VUM J;  1V5F A;  3JRA A;  1SD6 A;  3H3U A;  1X19 A;  1P9Q C;  1VQO I;  2RAE A;  2LYC A;  2MLG A;  1J75 A;  4A3L J;  1XG1 A;  3DKY A;  1SFO J;  1YE9 A;  2P5K A;  2M2E A;  1SFK A;  4XLE A;  4C2M J;  1F36 A;  4IEJ A;  2DJI A;  2L5Q A;  1ACI A;  3M7G A;  1J09 A;  4X0G A;  2HWV A;  4ANJ A;  4S0H B;  1BIA A;  1JHH A;  4BY7 J;  2WBM A;  1SVM A;  2D45 A;  2ZKZ A;  3IAM 2;  1I3A A;  1B8I A;  2DMU A;  4I7H A;  3WTU C;  1VQM I;  3CF2 A;  2AS5 F;  4HEA 2;  2MLK A;  1MBE A;  3OYN A;  2HOS A;  1KZH A;  1K61 A;  2HDC A;  2JUC A;  3L2U A;  1RNL A;  1T39 A;  5B66 C;  2LG4 A;  2R7D A;  2PLY A;  3RKQ A;  2IA1 A;  2PQ8 A;  1XC5 A;  2RNJ A;  2FML A;  3CC2 I;  3BG5 A;  2HEO A;  4CZC A;  3ABU A;  3H5N A;  4G9Y A;  3A03 A;  3DTE A;  3JCU C;  5LHG A;  4PDK A;  4E7I A;  3QPS A;  5BNG A;  2W00 A;  1YIJ I;  2B7E A;  3JRC A;  4ZYA A;  3LSI A;  3OYM A;  2PI0 A;  1J9I A;  3E6B A;  4P96 A;  5F0H A;  5HLH A;  1ZRC A;  1LFP A;  5DS9 A;  3W6J B;  2HVQ A;  4LB5 A;  2H8W A;  2O6G E;  2HS5 A;  3PNY A;  3WHC A;  2VKH A;  5DEQ A;  4I6Z A;  1B4A A;  4CYC A;  2J5P A;  3CUQ A;  1NK3 P;  2XF5 A;  4LFU A;  1RIO H;  2KMU A;  3RDI A;  3F72 A;  4HRI A;  1MGT A;  3FBI B;  2VIX A;  4MTD A;  1DDN A;  2LC2 A;  2HYF A;  4PFP A;  1A36 A;  3ISP A;  1G4D A;  3ABL H;  3T0Y A;  5FKO A;  3ABT A;  1MW7 A;  3OOP A;  1D1B A;  1AA7 A;  2LF8 A;  1RI7 A;  1SD7 A;  4ZYD A;  1ZGW A;  1DGW Y;  3BZ6 A;  1WI3 A;  2QSH X;  2V4J C;  3PQJ A;  4F91 B;  2PMZ A;  2HOA A;  5IT3 A;  2E60 A;  1GUU A;  2BVM A;  1P4A A;  2CUZ A;  4ABZ A;  3CMM A;  3OYC A;  4KJZ A;  1UMQ A;  1WZ2 A;  2R7W A;  1GXQ A;  2CFO A;  2BY2 A;  2K9M A;  3RCO A;  1OYI A;  4NB5 A;  4XKC A;  3RSN A;  3NRV A;  1X4O A;  5IOY A;  2BW3 A;  2X1E A;  2ZXW H;  3SZP A;  1HKT A;  5CQG A;  2YU3 A;  4RDU A;  1CF7 A;  1UHM A;  1U5T B;  2CH0 A;  4B47 A;  4D5F A;  2UWM A;  1U8B A;  2QA4 I;  2Z3Y A;  2KIQ A;  2Z16 A;  3KEO A;  4HX8 A;  4BU2 A;  1E0E A;  1BOA A;  3LL7 A;  5H2F C;  2M30 A;  2ZME B;  3OWT A;  4GCV A;  2E5N A;  2XSD C;  1QZY A;  2G7U A;  2XPU A;  5C44 J;  3WOD F;  3KP2 A;  1SVL A;  4IRG A;  2Y2Z A;  1XMK A;  5F6F A;  1ZRF A;  1OCP A;  4KT6 A;  3FIS A;  3H36 A;  3DTI A;  2R4G A;  4UVC A;  3N05 A;  4RA2 A;  3GTP J;  3Q0W A;  2P0W A;  2A07 F;  1WGX A;  2EV5 A;  2PBI A;  6PAX A;  2RRE A;  4KIG A;  3LQR A;  4G94 A;  2W85 A;  2G7H A;  2X0L A;  3I58 A;  3AG1 H;  3QPT A;  5TRD A;  5FLM J;  4E7L A;  4U0V A;  3DEW A;  2PEX A;  4M6X A;  5CVV A;  3PO2 J;  4XKW A;  4ZJZ A;  4N0B A;  1JJ6 C;  3Q3S A;  2QQB A;  2WAQ N;  4RMN A;  1MKM A;  4LLL A;  2NYX A;  3OS0 A;  5DD8 A;  1BI0 A;  1B8I B;  3HOY J;  1JT0 A;  3SZT A;  3QOD A;  2VJ4 A;  3CJQ B;  2FMY A;  2KQR A;  1C0W A;  2PJR A;  2NVQ J;  2BGC A;  1Y1V J;  5GP9 A;  4FCY A;  4J19 A;  5IT9 K;  2XAJ A;  5EZG A;  1S9H A;  2H09 A;  4KMU X;  3ZR8 X;  5DM6 F;  2R92 J;  2D2W A;  2QYO A;  2Z33 A;  3F22 A;  1YIT I;  4JQF A;  3K4C A;  2IGM A;  4BDY A;  4UV8 A;  4I76 A;  4HA8 A;  1GT0 C;  4Y52 J;  1Z1D A;  4DZP A;  4U88 A;  5ILS A;  2W48 A;  2EV0 A;  1BC7 C;  5L3D A;  4G6Q A;  3LNQ A;  1LB2 A;  1X1A A;  3VWB A;  1DPU A;  1TP4 A;  3KP6 A;  5A2Q Z;  4AU7 A;  4M9S A;  3OL3 A;  4YG2 F;  2KIU A;  4PJL A;  2O9L A;  4OAY A;  4AM3 A;  2V26 A;  3R61 A;  4A5N A;  1B72 A;  2L01 A;  1XSX A;  3SHF A;  5BS6 A;  4WF2 A;  2TRT A;  3H1C A;  4CYC B;  1FX7 A;  1T95 A;  4HX7 A;  3CUQ B;  1XPX A;  1W5T A;  4IHY A;  4P55 A;  3OYL A;  1ZGA A;  1UFM A;  4A0Y A;  3ZN1 A;  3GME A;  1ON2 A;  3U2R A;  1O57 A;  2FA5 A;  3BT9 A;  5J6X A;  2XF7 A;  3E1S A;  1FYK A;  4I02 A;  3IHU A;  2KLO A;  3L2Q A;  3CMY A; 
#chains in the Genus database with same CATH homology
 4KMF A;  1IN8 A;  2QQ9 A;  3WTT C;  1HXD A;  3J80 K;  2M45 A;  3WG9 A;  3BJ6 A;  4PGG A;  1T6S A;  1I5Z A;  2EA4 A;  2UXN A;  1Z9C A;  2QQA A;  1V3F A;  2P5V A;  5D8L B;  4U0W A;  5LEJ A;  1W4M A;  1P92 A;  2G9W A;  1MJ9 A;  3L00 A;  3OV8 A;  3HSF A;  1JXS A;  3GW2 A;  1G3Y A;  2LF7 A;  2L54 A;  2L4M A;  4GXO A;  2JT1 A;  3WE2 A;  1K6O A;  1QZZ A;  3KP5 A;  2YX4 A;  1ZRD A;  1IN6 A;  3K2Z A;  3SXY A;  2A3S A;  2DAO A;  1V4R A;  3K1M A;  1LVA A;  1SFX A;  3I59 A;  4HLY A;  5HDK A;  2ZXJ A;  4Y13 A;  2DPU A;  2O3F A;  2XGX A;  3CJN A;  3ZMZ A;  2FXA A;  4ENM A;  1G3W A;  3KP7 A;  3FHZ A;  1W7P A;  1ZG5 A;  3FXR A;  4RGU A;  2JTV A;  2XV4 S;  2R3S A;  1OKR A;  3V4G A;  3EYY A;  3J81 K;  5HS8 A;  3BOQ A;  4P9F A;  1B59 A;  2EB7 A;  5LEK A;  3F21 A;  5LHI A;  5E8I A;  1MD0 A;  3N97 A;  1XMA A;  3HRM A;  1B1B A;  5DCF A;  3BRO A;  3T8R A;  2FOK A;  5JHU A;  4IHT A;  2ZJ2 A;  4L18 B;  2VC1 A;  3I71 A;  4U0Y A;  3R4K A;  1TNT A;  1H9T A;  1LEB A;  4ESF A;  4KFC A;  2Y75 A;  5D4S A;  4EJO A;  1IRG A;  1KYW A;  4IVN A;  1BN5 A;  2KIF A;  2NRA C;  5E8G A;  2IRF G;  4P9U A;  2VT3 A;  2RDP A;  3I0T A;  5ILU A;  2OU2 A;  3CUO A;  4WXH A;  3G73 A;  1T98 A;  2KIM A;  1PP8 F;  1FNN A;  2E7X A;  3J80 Z;  2GZW A;  4KUM A;  2O8X A;  3BJA A;  2DLL A;  2JZY A;  2A69 F;  4L9T A;  3V8J A;  2CO5 A;  4WXC A;  4ZH4 F;  5F1R A;  3MZH A;  2DI3 A;  3E3V A;  3C1D A;  4M9Z A;  4G6D A;  3I59 B;  3TOB A;  4HX4 A;  1SMY F;  4OIO F;  1O7F A;  3IC7 A;  1FP2 A;  5CYV A;  5FGM A;  2RGV A;  5H20 A;  4MEX F;  5HS9 A;  4RAY A;  1TLH B;  3LQQ A;  3ECH A;  1EH6 A;  2EK5 A;  3IKV A;  3GFM A;  3FM3 A;  1OMI A;  3FMS A;  5E1X A;  1ZAO A;  2KJC A;  3GZ5 A;  1IXS B;  4I2O A;  3MAJ A;  4IXA A;  4EM1 A;  2BEO A;  2CG4 A;  1W7P B;  4LJZ F;  3F3X A;  4S04 A;  2DK5 A;  1TNS A;  3TO9 A;  4BH9 A;  2VON A;  1UCR A;  3MEX A;  2Q0O A;  4IF4 A;  1TQM A;  5ICG A;  4I0A A;  3E6C C;  2MH2 A;  2ZNZ A;  2ZFW A;  3J81 Z;  1GXP A;  5D5V B;  2HQN A;  3ZN0 A;  4OU0 A;  3V7S A;  1BIB A;  4QLC U;  4WWC A;  1XCB A;  5E1W A;  3IWF A;  2XIG A;  2VXZ A;  3KP3 A;  1GHC A;  2EJR A;  3TOA A;  4GO1 A;  3P9C A;  2YR2 A;  3ML6 A;  4RB2 C;  4ESJ A;  2VBX A;  1P2F A;  5JVT A;  4A5M A;  1S8N A;  2ISZ A;  2Z99 A;  3QAH A;  2DQL A;  2DTR A;  2GXB A;  3M9A A;  1IZ1 A;  5K5Q A;  3EDP A;  1EV7 A;  1SFU A;  2P4W A;  4JK1 X;  1XGO A;  3K1N A;  2E1C A;  2VN2 A;  2V1D A;  3QU3 A;  1DP7 P;  5JI6 A;  1ZG1 A;  2OA4 A;  3BPV A;  2F5D A;  4RAZ A;  2ADU A;  4LB6 B;  3F6V A;  4ZZL A;  4AIK A;  4R8H A;  2JRT A;  1FZP B;  3M8E A;  5D5U B;  2XRN A;  1Z7U A;  5J8C A;  3JSO A;  4A0X A;  1OPC A;  2EA2 A;  2V1X A;  1K7A A;  4EJW A;  2F5C A;  2HKO A;  1W5S A;  1X3U A;  5K1Y A;  1J7K A;  2OQR A;  4L9J A;  2ACJ A;  5D5W B;  2EFW A;  1J0R A;  2Y0M A;  2IA2 A;  2FQ3 A;  1L3L A;  2ISY A;  3B73 A;  2GXG A;  3KET A;  4D0P A;  4YFX F;  3VOE A;  1WRJ A;  3FX3 A;  3MQ0 A;  2HR3 A;  1WKM A;  2EFO A;  2VOP A;  5A2Q K;  5LGN A;  4CGZ A;  3L09 A;  3EQL F;  2UXX A;  2EFP A;  1R36 A;  2M87 A;  3KFW X;  3E5Q A;  4I98 B;  2TDX A;  5D5X B;  2FBK A;  1G3S A;  2K7L A;  1STZ A;  2A68 F;  5HS7 A;  5FLX Z;  2EWN A;  3E5X A;  4HV5 A;  3BY6 A;  3C18 A;  3LA7 A;  1D3Y A;  2W24 A;  4L9V A;  4P5O A;  4GYI A;  4XRF A;  4RB0 A;  1UST A;  3DFG A;  3GF2 A;  3DP7 A;  1HBX G;  5FFX A;  5L3E A;  1FLI A;  1KU9 A;  1Z6R A;  5CVJ A;  4YFK F;  3L7W A;  4WX9 A;  1JHF A;  3WE3 A;  1ON1 A;  3MCZ A;  1AOY A;  2HTJ A;  4Y15 A;  3GX4 X;  2ESH A;  1BI2 A;  3FMQ A;  1SAX A;  1OYW A;  1K78 A;  5E20 A;  2GQQ A;  2PFB A;  3FXU A;  4EGY A;  3RKY A;  2HQR A;  3IRR A;  2VE9 A;  4AIJ A;  4RGR A;  1XCV A;  5H6R A;  1JGS A;  4CYD A;  1KA8 A;  3BPX A;  1T38 A;  3BWG A;  2NNN A;  2CYY A;  5FD5 A;  3FM5 A;  3QRF F;  1XGN A;  4H0E A;  1EH7 A;  3FF5 A;  4GYG A;  3KLN A;  3NEU A;  5DDG A;  4LD5 A;  2ZO4 A;  4ZYG A;  1YFH A;  2XKP A;  2RVC A;  1P4W A;  1FYM A;  3ZMD A;  4M74 A;  4K2E A;  3FWE A;  1I1S A;  4HQE A;  3WGI A;  3WGH A;  2OAZ A;  5L3F A;  1H9G A;  4KIC A;  2WV0 A;  3HOS A;  3P9I A;  3M8F A;  4R79 A;  2V79 A;  3TKY A;  2HYG D;  3K1P A;  2E1N A;  3WU0 A;  2P8T A;  5JFR A;  2GIV A;  5FD6 A;  2M8E A;  1YS7 A;  3EUH A;  3E97 A;  1U78 A;  4G8X A;  1S6L A;  1YYV A;  4FT8 A;  4A6D A;  2A6E F;  1TW2 A;  1MDM A;  3ZMU A;  1R1U A;  2RC4 A;  1HST A;  1SFE A;  3DPL C;  4B09 A;  3IKT A;  4BXU A;  1IXC A;  5JR3 A;  3SQN A;  2IA0 A;  2O0Y A;  4HW0 A;  2R7F A;  4BYY A;  3WTS C;  5L3B A;  2ESN A;  3I64 A;  2LNB A;  5L3C A;  2F2E A;  2FU4 A;  2CQK A;  3VOD A;  4HZF A;  2BE5 F;  4UV9 A;  2Z9O A;  1R58 A;  1NHA A;  1ZGJ A;  3ZMV A;  3VEP A;  4EM0 B;  3F8B A;  4OMY A;  2NNY A;  3NQO A;  3HHH A;  4L5J A;  3K0L A;  2HKX A;  1S7O A;  1K78 B;  4KIF A;  3L2C A;  1J59 A;  1F4K A;  5AON A;  4LG0 A;  3DXJ F;  2Q2E A;  4CDG A;  2VC0 A;  3S2W A;  5LBQ A;  3Q9S A;  3AAF A;  4A6E A;  1F5T A;  1J2X A;  2XAS A;  4DQ2 A;  3F8M A;  3HHG A;  3P7N A;  2Z5U A;  1R23 A;  4M72 A;  1ZRE A;  2VBZ A;  2DU9 A;  1P6R A;  1MZB A;  4L0Z B;  4AIH A;  2HFH A;  4WXD A;  1LQ1 A;  4KIB A;  2MC3 A;  2QBY A;  1WI9 A;  4FX4 A;  4B8X A;  1ZLK A;  3V7R A;  2FSW A;  1U5T C;  2LKP A;  3GO5 A;  3BDD A;  2L02 A;  1ZYR F;  4BNC A;  1E2X A;  4OIP F;  1B9M A;  4A12 A;  1PP7 U;  2DFI A;  3Q5F A;  4DNC A;  2BBY A;  5HLI A;  2RV8 A;  3DKW A;  4XLP F;  2Y48 A;  2XUB A;  1MDM B;  2OD5 A;  1I27 A;  1J5Y A;  2HZT A;  1PUE E;  3TDU C;  2K27 A;  2VBW A;  3U9G A;  1F9N A;  4MGR A;  3TGN A;  2FRH A;  3T5X A;  3GWZ A;  4CO8 A;  4YIF A;  2QVO A;  2A61 A;  2WC2 A;  2DBB A;  4ASN A;  3J7A O;  1TTY A;  5DUK A;  5BOX A;  1SD5 A;  2W84 A;  3REO A;  4HOB A;  2V1U A;  2X4H A;  4Z2Y A;  2RQP A;  4Q4Z F;  1R7J A;  3QPH A;  3HIF A;  1HSJ A;  2PMH A;  4GGG A;  4I01 A;  3HTU A;  2P6S A;  2PG4 A;  4MNU A;  2XAH A;  2YX7 A;  3CTA A;  4IPA A;  2QM3 A;  3CUQ C;  2GWR A;  3ERE D;  4LG0 B;  5LGT A;  4I09 A;  3KLO A;  1FP1 D;  3JAM Z;  2VOO A;  3KP4 A;  3WTV C;  1QPM A;  1Q1H A;  3I5U A;  3P9K A;  2CGP A;  4A0Z A;  2P6T A;  3D5L A;  1FPQ A;  3ZMS A;  1K79 A;  2HGC A;  1QO0 D;  3QP6 A;  2HTS A;  1KU2 A;  2C6Y A;  4KNY A;  3T8T A;  2P5L C;  4FX0 A;  2STW A;  3WTX C;  2QBY B;  3F8C A;  4BHP A;  1T0F A;  2ELH A;  2YPR A;  1FBU A;  2PJP A;  1ULY A;  3V8L A;  1PDN C;  5CJ9 A;  3QP5 A;  2DO7 A;  5FLX K;  2MA3 A;  1WWX A;  3HRU A;  1KU3 A;  2BYV E;  3I54 A;  3I53 A;  3TDZ C;  3WU1 B;  3I4P A;  3K69 A;  4RB3 C;  2OBP A;  1RZ4 A;  3K9T A;  2VE8 A;  3CO7 C;  2LDU A;  4PGH A;  2HOE A;  4MTE A;  2XAF A;  1WQ2 A;  2EFQ A;  3F8N A;  1XDS A;  2UZK A;  2IJL A;  3HSR A;  2DQR A;  4O6J A;  1R1V A;  1OYY A;  2CWE A;  2ZBK A;  4PCQ A;  1O3R A;  3H92 A;  4ESB A;  1T2K A;  3GFL A;  1R22 A;  1I1G A;  4KT5 C;  3IWZ A;  2K02 A;  3DEU A;  3V8K A;  2AXL A;  5LRR A;  4ETS A;  1S29 A;  5CVI A;  3F8F A;  4E70 A;  1VTN C;  2RN7 A;  4OIN F;  5FB2 A;  2GA1 A;  3LAJ A;  3R0J A;  2BV6 A;  3R60 A;  1IUY A;  1FSH A;  4CHU A;  1U8R A;  3RYP A;  3RKX A;  2O03 A;  3E5U A;  3O6B B;  2YSR A;  2KKO A;  2XAG A;  3EYI A;  1IF1 A;  1MJA A;  2DPD A;  4EQQ A;  3GLX A;  1FBQ A;  4EV0 A;  1HW2 A;  2P7V B;  2ZNY A;  2ETH A;  5EEH A;  1KGS A;  2IP2 A;  4OMZ A;  5LLQ A;  2COM A;  3PFI A;  1L0O C;  2NAZ A;  5BQT A;  3CLO A;  4KYW A;  1R5H A;  3RJP A;  3DQV C;  4L9N A;  2W25 A;  1LJ9 A;  1DUX C;  1OR7 A;  1HW1 A;  2D1H A;  1KU7 A;  1IRF A;  2FEZ A;  4AD9 A;  2CFX A;  2B0L A;  3N4M A;  4L0Y B;  1BM9 A;  4M9X A;  4CZZ A;  4HF0 A;  4AVP A;  4WCG A;  1EH8 A;  4A2U A;  3F23 A;  1D8K A;  2CSO A;  1Z05 A;  5K5R A;  2J5O A;  3O2P E;  4M73 A;  2FBI A;  5AIQ A;  5E18 F;  2MD5 A;  3ZP5 A;  4LLN A;  1R00 A;  1XGS A;  3HUG A;  2A6H F;  5LRS A;  4XBF A;  2LSO A;  4RGX A;  3PQK A;  5AIP A;  1HW5 A;  3R6S A;  4EJU A;  3ECO A;  4XSX F;  1O3T A;  3WTZ A;  3FMR A;  4F7Z A;  3KZZ A;  4HLX A;  3W6K B;  2PN6 A;  1U3E M;  4RB1 A;  3G3Z A;  3KCC A;  4HF1 A;  4UNO A;  5H6Q A;  5BMZ A;  1G6N A;  4HDV A;  5HVQ C;  2OZU A;  3RPQ A;  1SD4 A;  3V7C A;  5K5O A;  5ED4 A;  3KZY A;  4N9H A;  1LEA A;  3HSE A;  2MH9 A;  5KVR A;  4I0B A;  2DT5 A;  5BPI A;  1O3Q A;  4HYE A;  3ZMT A;  3JTG A;  5HDN A;  1BBY A;  5DCM A;  4EJT A;  4EVI A;  3IL2 A;  3RYR A;  1FC3 A;  3E6D A;  5E17 F;  3LWF A;  4FHT A;  3M1E A;  4MQV A;  1ZG3 A;  3ELK A;  2XKO A;  3ZQ7 A;  1SMT A;  2IVM A;  2ZCW A;  2M1B A;  2DK8 A;  1YG2 A;  2VT2 A;  5FFZ A;  1U6G A;  4O3M A;  1BJA A;  5LGU A;  1YQA A;  4S05 A;  2F5F A;  5D8K B;  4EM2 A;  3T1B A;  5D4R A;  1YTY A;  1ZAR A;  2XAQ A;  2VOD A;  1JE8 A;  2OQG A;  4IJA A;  1S3J A;  3MWM A;  4AWX B;  3LFK A;  1IN7 A;  1XDU A;  4HQM A;  1O7L A;  3HOT A;  5ILV A;  1QBJ A;  2RKH A;  2JSC A;  3COA C;  4LLG F;  3QU6 A;  1IAW A;  2WTE A;  1XD7 A;  5ICF A;  1Z91 A;  2L3D A;  1S7A A;  3JSP A;  1XSV A;  1XN7 A;  1FY7 A;  4M71 A;  1XB4 A;  4EJV A;  3TO7 A;  2A5Y B;  1TQI A;  2L4A A;  2IPQ X;  3E6M A;  5DD4 A;  1O3S A;  4O5V A;  3O3K A;  1H0M A;  4Q48 A;  3RPU A;  4LK0 F;  3WTW C;  1IN4 A;  2JPB A;  3D0S A;  3GFJ A;  3R0A A;  4CXF A;  5BPD A;  3HTS B;  2WWY A;  1ZHF A;  3JTH A;  4IRI A;  5DYM A;  5J8F A;  1RUO A;  4LGW A;  2QEN A;  1QQI A;  4UVB A;  5L3G A;  4HAM A;  2GAU A;  2KRF A;  5LHH A;  2F5E A;  2MBF A;  1YS6 A;  1QNT A;  3ZPL A;  3JAM K;  2D1V A;  5DV5 A;  1CF7 B;  1QGP A;  5CVU A;  5DCM B;  4BHB A;  2H27 A;  4BAY A;  2XVC A;  5ICE A;  2GA2 A;  1KQ0 A;  4L5I A;  3GEZ A;  5HDG A;  4MEY F;  3MZY A;  3JW4 A;  4LK1 F;  1I6X A;  1YW8 A;  4TV7 A;  3RKW A;  2W57 A;  4ZYH A;  3KEQ A;  1YLF A;  2IT0 A;  4PZJ A;  1TBX A;  3EET A;  1TQP A;  1TW3 A;  2DW4 A;  1RUN A;  5DUI A;  4KA4 A;  3BP8 A;  1F1Z A;  1B6A A;  2H6B A;  1GVJ A;  4XSZ F;  4IHS A;  3GYH X;  4NQW A;  4OOI A;  2P7C B;  2OZ6 A;  4EGZ A;  3GFI A;  3HRS A;  1CGP A;  2V9V A;  1FT9 A;  3GVA A;  3LAP A;  3VB2 A;  1D8J A;  1UHW A;  5IT9 Z;  1REP C;  4Y17 A;  1FBS A;  4UVA A;  1Z6T A;  2EFN A;  3TO6 A;  3GUD A;  2E7W A;  4HBL A;  5CVR A;  1G3T A;  3BJO A;  4OIQ F;  4MHG A;  4M6Y A;  1FOK A;  3DV8 A;  3LA3 A;  3CO6 C;  3FXQ A;  4U7B A;  4ZZD A;  3ROU A;  2IW5 A;  5TJJ A;  5D6F A;  1Y0U A;  5E1Z B;  2QWW A;  3C3W A;  3DPT A;  1FYL A;  3TQN A;  1IW7 F;  4ON0 A;  5HOO A;  1USS A;  1ZN2 A;  2FNA A;  1LNW A;  3FZV A;  3GXO A;  1FSE A;  1YIO A;  1R1T A;  3SFZ A;  4G7Z F;  4N9I A;  1XSD A;  4NHJ A;  4Q5S F;  1P4X A;  2H6C A;  4WK8 F;  1FWZ A;  4UHT A;  3MFK A;  1A04 A;  1R5G A;  4CIC A;  2KJB A;  1HQC A;  4XLN F;  2FBH A;  5ICC A;  5D6E A;  3HYI A;  1B9N A;  1U2W A;  3KE2 A;  4LMY A;  3U1D A;  5EEG A;  2K4J A;  5HLG A;  2NS0 A;  1BI1 A;  2PMU A;  1D5V A;  1LDK B;  4YII A;  2FE3 A;  1E17 A;  1YO5 C;  2Q8K A;  4U7D A;  2VBY A;  4G7O F;  1BC8 C;  1BI3 A;  3LST A;  2K4B A;  3F6O A;  3WGG A;  4ZYE A;  4HF2 A;  4Q47 A;  2O61 A;  4ENK A;  3C7J A;  1KQ8 A;  3H3Z A;  2FNP A;  1LDD A;  4HDU A;  2QUF A;  5KK1 A;  3WTY C;  1XGM A;  1ONV A;  4OIR F;  4UXN A;  5CLS A;  1W7P D;  4BQA A;  1YW9 A;  3GZ6 A;  3RI4 A;  3RIR A;  2QZ8 A;  2EV6 A;  5ERI A;  2K86 A;  4RGS A;  1KYZ A;  1MJB A;  1UB9 A;  1HKS A;  2XRO A;  3Q9V A;  3VFZ A;  1WSU A;  4JBA A;  1ZLJ A;  4KN7 X;  2V6C A;  2XHK A;  3DF8 A;  4MQ9 F;  4UUV A;  4YFN F;  3B02 A;  3ULQ B;  2FF4 A;  4QWQ A;  3IRQ A;  1LDJ A;  1KQ9 A;  1DPR A;  4EMS A;  2M5W A;  4IRH A;  4RS8 A;  4ENN A;  3HRT A;  1YW7 A;  1ZH5 A;  1U5T A;  1HKQ A;  4ENJ A;  5F64 A;  4G7H F;  1ODD A;  4R1H A;  3QOP A;  2H94 A;  2ZME A;  2QLZ A;  2CW0 F;  3L9F A;  2JPC A;  2STT A;  3CDH A;  1IN5 A;  5FO5 A;  1IXR C;  1AWC A;  4KN4 X;  3LA2 A;  3RTR A;  4HV6 A;  4KDP A;  4BHC A;  1SD6 A;  3H3U A;  2MLG A;  1J75 A;  2P5K A;  3M7G A;  2HWV A;  1BIA A;  1JHH A;  2D45 A;  2ZKZ A;  4I7H A;  3WTU C;  2AS5 F;  2MLK A;  2HDC A;  1RNL A;  1T39 A;  2R7D A;  2PLY A;  2IA1 A;  2PQ8 A;  2RNJ A;  2FML A;  2HEO A;  3ABU A;  4G9Y A;  5LHG A;  4PDK A;  1J9I A;  2PI0 A;  3E6B A;  4P96 A;  5HLH A;  1ZRC A;  3W6J B;  4LB5 A;  2O6G E;  2HS5 A;  5DEQ A;  1B4A A;  2J5P A;  3CUQ A;  4LFU A;  1RIO H;  3RDI A;  3F72 A;  1MGT A;  4MTD A;  1DDN A;  2HYF A;  3ISP A;  1G4D A;  3T0Y A;  3ABT A;  3OOP A;  2LF8 A;  1RI7 A;  1SD7 A;  4ZYD A;  3BZ6 A;  3PQJ A;  5IT3 A;  1P4A A;  1GXQ A;  1OYI A;  4NB5 A;  3NRV A;  3SZP A;  1HKT A;  2YU3 A;  1CF7 A;  1UHM A;  1U5T B;  2UWM A;  2Z3Y A;  3KEO A;  4HX8 A;  1BOA A;  2M30 A;  2ZME B;  4GCV A;  1QZY A;  2G7U A;  3WOD F;  3KP2 A;  4IRG A;  5F6F A;  1XMK A;  1ZRF A;  4UVC A;  2A07 F;  2EV5 A;  2PBI A;  6PAX A;  4KIG A;  3LQR A;  4G94 A;  2W85 A;  2G7H A;  2X0L A;  5TRD A;  3I58 A;  3QPT A;  4U0V A;  2PEX A;  4M6X A;  5CVV A;  4N0B A;  2QQB A;  1MKM A;  4LLL A;  2NYX A;  5DD8 A;  1BI0 A;  3SZT A;  2FMY A;  1C0W A;  2BGC A;  5IT9 K;  2XAJ A;  2H09 A;  4KMU X;  2D2W A;  2QYO A;  2Z33 A;  3F22 A;  4JQF A;  4UV8 A;  4HA8 A;  1Z1D A;  4U88 A;  5ILS A;  2EV0 A;  1BC7 C;  5L3D A;  4G6Q A;  1LB2 A;  1DPU A;  3KP6 A;  5A2Q Z;  4M9S A;  4YG2 F;  2KIU A;  3R61 A;  4A5N A;  2L01 A;  1XSX A;  3SHF A;  5BS6 A;  4WF2 A;  1FX7 A;  4HX7 A;  3CUQ B;  1W5T A;  4P55 A;  1ZGA A;  1UFM A;  4A0Y A;  3ZN1 A;  1ON2 A;  3U2R A;  1O57 A;  2FA5 A;  5J6X A;  1FYK A;  4I02 A;  3IHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...