3ERMA

The crystal structure of a conserved protein with unknown function from pseudomonas syringae pv. tomato str. dc3000
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
67
structure length
67
Chain Sequence
VDRKLADAHDQMLELAELLTDVLIKNVPGLSEKHAEDASIYMAKNRAVFAAAFKNNATALSELSEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized conserved protein
publication title The crystal structure of a conserved protein with unknown function from Pseudomonas syringae pv. tomato str. DC3000
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
total genus 21
structure length 67
sequence length 67
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07130 YebG YebG protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.710 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A PSPTO_1197 like 3ermA00
3ERMA
chains in the Genus database with same CATH superfamily
3HKZA 2KT0A 4I09A 2DDBA 3BQYA 2LBFA 3KCCA 4RB1A 4IOCF 1REPC 5E3MA 3QP5A 2MYSA 3OOUA 1ZN2A 1A6QA 4ZYEA 4WCGA 4KJZA 2ETHA 3WG9A 1I50J 3TL4X 2VOPA 2PMZA 4ZDOA 1UHWA 2XV4S 3ZQGA 4P55A 4V2FA 5DYMA 4KNYA 3QPTA 2VJJA 3K0LA 1OLTA 5JHFA 1U8RA 1NTCA 1WFXA 4CYDA 4E7ZA 3OYDA 1GDTA 2ZMEA 5IP9J 2OC6A 2A69F 3KETA 4BQQA 1R5ID 1IN8A 3LSJA 4DYCA 3CCLI 5ILSA 3T8TA 3E1SA 2BY1A 3U2RA 1UZCA 5L3FA 2GBYA 2ZCWA 3QOPA 1R1VA 3ZQIA 3GTMJ 1LVKA 2CJJA 2ZNZA 1ULYA 2VC0A 4HSRA 4RAFA 3BR0A 4HF2A 2E60A 4IO9F 2XGDA 4I98B 1UCRA 4MLOA 4A3DJ 1TQMA 2HYFA 3DCFA 3O2PE 4AYBN 2CU7A 4BUPA 5HDNA 3CCQI 2HOAA 1WVRA 5CJ9A 3RIRA 5C3EJ 1ZRFA 3KZIC 2CQ7A 1X1AA 2CO5A 4KA4A 3TEDA 2JA7J 5FGMA 1P6RA 1MMDA 2ZC2A 1ODDA 3CJQB 4HOBA 3IRQA 3JRIA 4I01A 3RYPA 2ELKA 3I58A 3FXKA 3OS0A 4NUBA 2QSGX 1OCZH 1OISA 3F72A 1FYLA 4KIBA 2MBFA 2EINH 5FKMA 4YRVA 5D4SA 2LOOA 2NVTJ 4A3GJ 1LEBA 2XSDC 4XNFA 2OQGA 1JKOC 4FQGA 2O03A 1ZRCA 1QBJA 3S2HJ 4FT8A 1JUSA 1ZREA 3ZCOA 4FCYA 4C2TA 3J7AY 1SFUA 2C6YA 2VJ4A 4WWCA 3O8GA 3SXYA 1S7OA 2Q2EB 1NG6A 1TT5B 3RYRA 2ZSHB 3JRAA 3CCMI 1W5SA 1N77A 1YI2I 1WGXA 2Y69H 2M9HA 4LK1F 3CMYA 4EQQA 2UXXA 4HQEA 2B7EA 2R3SA 2L9NA 3Q0WA 4RAYA 4AYBA 3QPHA 1AOYA 3GZ5A 2R7TA 4D5CA 1E3OC 3HTSB 5IT3A 2IS4A 2DT6A 4M6YA 4ENJA 1R00A 3H1CA 5ILVA 1OMIA 4DBRA 5C4XJ 2MGQA 2W4SA 3CMAI 5FKNA 2FSWA 3CCUI 4ON0A 5IYCJ 1MKMA 2G7HA 1ZR2A 1R7JA 2DLLA 3U1KA 1OKRA 2VKHA 1H8AC 4QPOA 1O3RA 2F5FA 2WC2A 1IV8A 2V1DA 4L5EA 4DZPA 2E19A 2EIMH 2ID3A 5LGUA 1RI7A 2ZNYA 2VBXA 4ASNA 3LQQA 4AD9A 4BQNA 5HS8A 5ICCA 1VQ8I 2EBIA 3S17J 1T33A 3BG7A 1S6LA 2P6SA 4XMYA 1HA8A 2STWA 4XLPF 2F5DA 5BOXA 3I71A 2GZWA 3E5XA 1F36A 2DCEA 1KONA 1X58A 4F7ZA 1DP7P 3NRVA 2FRHA 2P7VB 5HDGA 2B9SA 3IH2A 4E7IA 3HHGA 2CW7A 2DK5A 1PJRA 1MMNA 4MFDA 1ACIA 1VQNI 4XLNF 5AIQA 3HGGA 2RV8A 3FIWA 1MSEC 1ON2A 5FB2A 2EQRA 5EJCA 3JSPA 1U0JA 4BQAA 1ORKA 1FOWA 1RPWA 1G6NA 2QQAA 3DU6A 5K7ZA 2HPMA 1HCRA 3DF8A 4XKBA 3ZP5A 2CUZA 2VT2A 3JSOA 1SMYF 1VQ7I 2RGVA 3PNVA 4OIPF 4M71A 1K6YA 3VYRB 3GMEA 2M7AA 3ASNH 4F91B 3ZQHA 3TGNA 3G1OA 3HTUA 1CQTA 3OS1A 2E1MC 1UMQA 3R60A 4CA0A 1FOXA 2KRFA 3OYKA 5HS7A 1T6SA 3VWBA 1BIBA 1FPQA 2K4BA 4M3DA 2VASA 3CP2A 4BU2A 1XN7A 3W6VA 3DWLE 5L3EA 1XDSA 3ZN0A 2JA8J 3L2RA 2OAZA 3ECHA 3SZPA 1P9QC 2OU2A 3MN2A 1ENHA 3BLYA 4WX9A 4L0YB 3QPSA 3LOCA 4G12A 2VUMJ 3GFLA 3KLNA 3KPHA 4KYWA 2PLYA 1TC3C 1H9GA 2QWWA 2F5VA 2X6WA 3IH4A 4XLAA 3FXRA 3W2AA 1JI8A 3MKLA 4R8HA 1SFEA 2DQRA 2HGCA 3I4MJ 4E7KA 1P2FA 1LQ1A 4Q5SF 2DFFA 3JRBA 1PUEE 4I0AA 3ZMTA 3WTTC 2CS3A 2LF7A 5M3FJ 4DNCA 5H20A 1HBXG 2BV6A 3S93A 2GOMA 3WE2A 3K4KA 2HI3A 4GRIA 1A36A 1FBQA 3SDBA 1JJ8C 1CF7B 5ICGA 3UNGC 3DEEA 3I3LA 3HHHA 1ZRDA 2DA5A 3ERED 1I27A 1FP1D 1YRNB 2H27A 2Q0OA 3C2HA 3ULQB 3GF2A 2IA2A 4CYCB 3CCRI 3D0SA 3VODA 1B59A 2NS8A 2AXTC 2LVSA 2QVOA 3KP6A 4RB0A 1GXPA 2KJCA 3LA3A 5AONA 1KYWA 3CUQC 2H6CA 1JKQC 2R5YB 3K1PA 2FMLA 3CQZJ 1OJLA 1TWHJ 1JHFA 3KE2A 1NH3A 3LL7A 1HOMA 1IN6A 4KUMA 1LE8B 4XM3A 4XSXF 3K69A 4C9YA 1D8JA 4N4OB 2JA2A 3ECOA 3OYEA 1TNSA 4Y4RA 1K6OA 4A3KJ 5DS9A 2XGCA 4PJJA 1R49A 1Y1VJ 3BZKA 3H92A 3S32A 3V8KA 1S7EA 3DLLF 5AIPA 5GAEJ 1ZR4A 3CDLA 2VKDA 3MEXA 2HDDA 2XHKA 2HVQA 3K4NA 5EDNA 4LB5A 3SEZA 3WTWC 5K1YA 1AA7A 1E17A 4GFBA 5BMZA 4L9TA 2LC2A 2MSYA 1WI9A 5JLXA 2EFWA 4A3IJ 3K70C 2ZJPF 4EM1A 5E8IA 2XGEA 2LG4A 2PJPA 4MNUA 5D5WB 1ZH5A 3WTXC 4RGUA 2L3DA 4PFOA 3H3VK 3S3OA 1BA5A 5JR3A 3K1NA 2E5ZA 4XK4A 2M0CA 3NQOA 4ZZLA 1F1ZA 3FM5A 2MC3A 2K4JA 2BZTA 5J1RA 2F4IA 5FLMJ 4GCVA 4IF4A 3CUQB 1I39A 2M45A 3TOBA 2I5UA 3OOPA 1QPMA 4KICA 5EEGA 1K78B 1S72I 1MZBA 5KNLA 3U21A 1A6IA 3GZNB 1BM9A 3C3WA 2CFOA 5JI6A 1LPQA 2YU9J 1MMSA 3SYTA 4RB2C 4PGGA 4A0ZA 5J47A 1P4AA 3HRUA 1I1SA 3BR3A 3RKQA 3GWZA 1ETKA 3ZN1A 3I56I 5D6FA 3TDUC 2V79A 4BQOA 3MZYA 4XKWA 1YX5A 2E36A 1RKWA 4KT6A 3H3ZA 3I55I 2F5EA 2XGXA 5E8GA 1W36C 2EJRA 2OBPA 3DFGA 5HNHA 3G2BA 1K4SA 3JCUC 5J1UA 5BS6A 2F48A 2DT5A 4XIDA 4XRSA 5JHUA 3DKXA 3OL4A 1DP3A 2KZVA 1FWZA 1WH5A 5KCMA 5F0FA 2CMPA 1QQIA 3QU3A 4HNTA 2DW4A 2EZLA 2XAJA 3TQNA 5GPCA 4R1HA 4ITVA 3V4GA 2E7XA 3CCSI 3OIPA 1JE8A 5FRMA 1YW9A 1E2XA 2DOFA 4CUGA 2HTSA 3PIPF 2Z16A 3M9AA 1K4TA 1JT6A 2PQ8A 2EFNA 2R7OA 1O3TA 3T0YA 2FQ4A 2OZ6A 1TW3A 5LHGA 4AU7A 2IS6A 1D8KA 1Z91A 2F5CA 5JFRA 3VPRA 2B0LA 3MD2A 5DDGA 1W5TA 4ZH4F 3DTIA 4I6ZA 2UV1A 2Z2SB 2GIVA 2DTRA 2MC4A 3K10A 4MO7A 3OYMA 4BAYA 5TISC 3H9GA 2DOEA 3E6MA 4BKXA 2L9RA 3AG4H 3MKWB 4P1WA 1DGWY 5E3LA 3WG7H 1I1GA 3IH3A 1BR4A 5E79C 2X1EA 4AIHA 4G6DA 5KVRA 3WU0A 3DBHB 2L9VA 2DA4A 2NVXJ 3Q9SA 1W0UA 1GV5A 2V9KA 5EYRA 4BJTA 3GTJJ 3QOEA 1APLC 3A0BC 3S2DJ 2AS5F 4IXAA 2LK2A 1IG7A 1E3PA 5H6QA 4QSHA 1MBGA 3FKIJ 2Y0SN 1YJ9I 4BEHA 1SAXA 2NVQJ 3K4BA 4BHPA 4EM0B 4NB5A 2CQKA 2A6TA 1BR1A 3J7ZI 2GA2A 2M2EA 4HQMA 3LSPA 3M4OJ 2OA4A 5IOYA 3FWEA 3Q0VA 2FX0A 1T0FC 1Z7UA 5F1JA 4LOCA 4I2OA 4S0HB 3Q5FA 4GO1A 2ICWG 5E1XA 1NG7A 2ADUA 3HL2A 4JP0A 2WY8Q 4C2MJ 2Q8KA 1WJ5A 3JREA 1YJWI 3WODF 3S15J 1WH7A 4A0XA 1DU6A 4MGRA 4NC8A 3M8JA 4YG2F 4HEA2 3G71I 5LLQA 3QYFA 1IRGA 2R7RA 1BI1A 3REOA 1XS9A 3DXJF 4DBQA 1RUOA 2HOSA 2QLZA 3ZMVA 1KU9A 1GVDA 1HF0A 1XGNA 1U9OA 1XPXA 1F4KA 5DEQA 2ZSIB 2KP6A 5F1RA 1TP4A 3BQZA 4UXNA 2QKLB 4YFKF 2MW8A 1I5ZA 4MIMA 1X1DA 2Y0SA 4E7SA 1PUFA 1EJ9A 3KP4A 1JT0A 3CO6C 3HRTA 4A5NA 3OYNA 1B9NA 2W57A 3IKVA 4IEJA 4D0PA 1BJAA 3J81K 2M5WA 3FK6A 1G8XA 3HBLA 3VYSB 4DJAA 4E6KG 2CSOA 2ME0A 4LG3A 3ZR8X 1UHSA 2MABA 2ELHA 2IS1A 2GM4A 2LFBA 3VSLA 5CVUA 1G59A 1YW8A 4X6AJ 5LGTA 4BGDA 5J40A 3ZXSA 4WXHA 1IN7A 5J4VA 5LRRA 4A6DA 1T98A 4G7OF 2HQNA 2HQRA 3EUAA 3FKJA 3AL0B 1X3UA 1G3YA 1FEXA 1ZAOA 3KLOA 1ETXA 1XGOA 2K40A 3RPUD 2GIZA 4PJLA 3H36A 5D4RA 4GYGA 1WJDA 3E6BA 2CFXA 4D7NA 4A3EJ 2DO7A 2JMWA 1Y0UA 3ZMDA 5K5RA 2WAQN 4CZCA 5A2QK 2EV0A 2JPBA 2GXAA 4JX4A 4FX4A 2BE5F 3LQRA 1FOYA 3KP3A 2E2IJ 2BHYA 4X0GA 4HLXA 4BBRJ 3RKYA 2K85A 3GEZA 2GXBA 1Z6TA 2DDAA 5F0CA 1QVTA 3U9GA 1AHDP 1ZK8A 4A2UA 2W82A 2YSRA 5J6XA 3IAM2 5EZGA 2EIKH 4EJVA 4Y13A 2R5ZB 4IL6C 4L9JA 4J19A 4CSWA 1HDDC 2LF8A 2HVRA 2WAEA 1WQ2A 2R7DA 3CCJI 1IAWA 2HS5A 1VTNC 3BJOA 1FT9A 1FC3A 1KU3A 2QF7A 4MQVA 5DD8A 1DPUA 3PL8A 1SFKA 2L01A 3ABKH 4M6VA 2R7WA 3HSEA 1PP7U 4C3HJ 2IA0A 2KL4A 2FD5A 1H89C 3L09A 5K7FA 1ZG1A 1DGRM 4XLHA 1ZQ3P 1B8IB 1ETYA 4HX4A 3WHBA 2A3SA 3CCYA 5LEJA 1ITYA 1D0YA 4HV6A 4C2UA 4L0ZB 1T08B 4H4KC 2M0MA 1JXSA 3HJEA 4OMZA 2PJRB 4S04A 3A1YA 4E7JA 3HOZJ 5TGTA 4EM2A 3ESWB 1HW1A 2VJIA 1X2NA 1D1AA 2A61A 3ZQFA 5FKLA 1G3TA 1R58A 1P7IA 2DTZA 2VIXA 2LY2A 2QQ8A 2F2EA 4UVAA 1W1WE 3DTKA 1ON1A 3RKWA 5TRDA 2WAQA 4P9FA 3B6AA 2JUGA 4M74A 1ZGWA 4Z6YA 3S3MA 3GTQJ 4RM2A 2GQQA 1MBFA 1J2XA 2R7ZJ 2JA6J 3P9KA 3SHFA 3WTSC 1XSVA 2FA5A 2A05A 5K5OA 4HV5A 4XONA 2H8WA 2Z5UA 1WPKA 3DP7A 3MVPA 4M72A 2RN7A 3CTAA 3O8HA 3WGIA 1O57A 4BACA 3FXMA 3CUOA 2HQAA 3SDGA 1RR7A 4MTEA 5E20A 2Y31A 4C3IJ 2PMUA 3I64A 2AQFA 3I4NJ 3GW2A 4UVBA 2H1KA 2OV7A 4D5FA 1QZYA 2LLKA 5CVJA 2WA0A 4JOMA 4II3A 5LBQA 3G73A 3G1LA 4F55A 2R4GA 1EF4A 4P9UA 3AG3H 4NC6A 5L3CA 3FXQA 2H6BA 4V2GA 3JAMK 5D5XB 2OCCH 2P81A 4M6XA 4V19K 2L9SA 1Z0XA 3OSFA 3J81Z 3RQIA 2QKMB 2ZMEC 2DAOA 2BY0A 1R6RA 1T95A 2CUFA 5C4JJ 4Q47A 1IC8A 3AG2H 3SEQA 4A3JJ 4HDVA 1FP2A 2LYCA 2NNNA 1V4RA 5FRNA 1LFPA 3GTGJ 1S9HA 3RZOJ 3EUHA 4MTDA 3GO5A 2E71A 4C3JJ 3RTRA 2FMYA 2MH2A 5D5VB 2YX4A 3HOWJ 1SEUA 4L18B 4M9ZA 4AVZA 2RDPA 1IXRC 2UUZA 3EETA 1USTA 3Q9VA 2E2JJ 1RETA 4RA2A 2LNBA 1YIOA 1LDDA 2K7LA 1XCVA 1H88C 1XD7A 4BBSJ 3HPHA 5IYDJ 2A5WA 3IKTA 3M8FA 5CLSA 1W36D 2UZKA 5HDKA 4BJ6C 1U78A 2DMPA 1W7PD 3OYAA 1QGPA 3CJTB 3B73A 1XC5A 4G94A 2JUCA 3H5AA 4CO8A 2RQPA 3E6CC 3TO6A 4KN7X 3HOUJ 5EG0A 3LAPA 2COMA 3VYTB 3UKGA 3RSNA 2Z3YA 3K4LA 4UNOA 2ZBKA 5A2QZ 1BOBA 3CJRB 5B66C 1HKSA 1A5JA 1E3HA 3R0AA 5BNGA 2EV5A 4I02A 1Q1HA 2DMNA 2L54A 1XSDA 1JKRC 4J00A 4A3BJ 5EF6A 1MBHA 4A5MA 1LKXA 2HU9A 1JTXA 4DZJA 2EA2A 2ELJA 1WJAA 2LH9A 4A12A 4N4NB 3ASOH 2CUJA 4BHBA 1G3SA 1B72B 1MH3A 3EDPA 2CQXA 4Z2YA 3AAFA 1K79A 2KDOA 1YRNA 1ZLJA 4CGZA 3E7LA 4YELA 2R7QA 2BVLA 1Z7LA 2Y75A 1UG2A 3F22A 4IHTA 3TMOA 1UG0A 3HUGB 4G9YA 1HKQA 5IY5H 5D5UB 4CCKA 4ZYDA 2R0QC 1HXDA 2R5YA 4Y15A 2KPMA 5LRSA 2XPUA 3A0HC 2QQBA 3EYIA 2MD5A 1B1BA 2E7WA 1HQCA 4CCNA 1LVAA 4JK1X 5L3DA 1R4MB 2JRMA 2D1HA 1MMGA 4BE0A 2NRAC 2QENA 4LFUA 2QZ8A 3ISPA 2ZFUA 2XUBA 5DM7F 1TL8A 3LSIA 2QUFA 3L2QA 1F43A 1FSEA 2VPLA 1VNDA 5J8CA 2AHQA 2E35A 3CC2I 2P5LC 4IHXA 2IRFG 2WB1N 1U9NA 3P5JA 1KU2A 2G9WA 1R22A 2FF4A 5J8FA 3L2CA 1LFUP 5CQGA 2WADA 1IN5A 4UB6C 2DT7B 1IRFA 3OYIA 2ZO4A 1KA8A 3BG5A 2JQ7A 3V7SA 4ENMA 2EH3A 2XDVA 4KN4X 3F9KA 2IVMA 4HLYA 3EQLF 4L9VA 2IGNA 1V54H 4UHTA 1W0TA 1WJFA 3OIQA 3HC7A 2R7XA 4DGWB 5GADJ 3BR6A 2XAFA 4PJMA 2VKEA 1JUPA 3I4PA 4XRMA 3S2WA 1ZG3A 4CZZA 1YHQI 3CP8A 5FKOA 4GGGA 5C44J 3CF2A 1UHMA 5CKTA 2FOWA 2OCEA 3WGHA 3R0JA 4LB6B 3ABMH 2BW3A 4G7ZF 2Y2ZA 1IW7F 2PI0A 1UFMA 3F8FA 1BW6A 3RI4A 5J4YA 3BTJA 1IUFA 4O5VA 1P4XA 3JAMZ 2KIUA 3CDHA 1RZ4A 3R4KA 3MCZA 4BXFA 4PFPA 5E1ZB 2K9NA 1ZG5A 3PSFA 3IAS2 2LKXA 2E1MB 4M3EA 1RESA 1FX7A 1EA3A 3M8EA 4I0BA 2NS7A 2IAIA 4ZDPA 2DJIA 3WTZA 2XROA 1X1BA 3FDYA 4IQ4A 4ZC3A 4YIIA 1WWXA 2EFPA 3WU1B 4OMYA 3S1MJ 1EV7A 2M7BA 3PM1A 2DMTA 2X6OA 1QU3A 2XAQA 4XLEA 1O7LA 2M34A 2O7OA 1U5TC 1ZHFA 3MKYB 4A3CJ 3KYDB 2JRTA 2DMQA 4WK8F 3LNQA 5LFAA 2DI3A 2TCTA 3BTCA 1XTAA 2M8GX 3LFUA 2XASA 2COBA 2HYJA 4PSXA 3WTUC 3A01B 1FIAA 4BYYA 1ERDA 4RGRA 5KAIC 1YLFA 2N8GA 1YIJI 5K7HA 3LSMA 3I0TA 3CZ6A 1XG1A 1WJEA 2F4MB 2YR2A 4M3FA 4Y17A 3PO3J 2L7MP 2PMHA 4IRGA 5EEHA 3T1BA 3BC8A 3K6GA 4OOIA 3FMRA 3SJMA 1MJAA 4G6TB 2IP2A 4LGWA 2B63J 2DK8A 5B1AH 4XORA 3KP5A 3VSKA 2O8XA 1V5FA 2K3PA 3HSRA 4ESFA 3ZPLA 3WGGA 2A07F 4S05A 4BE1A 3M7GA 1W7PA 2CGPA 4XKVA 1X1CA 2X9DA 2WV0A 4ZYGA 1I3AA 2V6CA 2EPFA 3OMYA 4LIUA 4XOPA 2A6HF 4XRSG 1DQUA 2MLGA 5HS9A 2NOJB 2QA4I 4CXFA 1U5TB 4LLLA 2X48A 2VONA 1VI0A 3GUDA 1CGPA 2FE3A 3BT9A 3ELKA 2O9LA 2VT3A 2OTJI 3BY6A 1HDPA 1IDZA 1OPCA 1QRYA 4W97A 1X1PA 1YYVA 2V9VA 1PP8F 5F04A 5B1BH 1TT0A 2BXYA 2QBYA 3BZ6A 4U87A 4IPAA 5ILUA 1WSUA 2XPWA 4PK4A 3HEFA 3A03A 4CCMA 1FSHA 4FE4A 5LHIA 3LWFA 2X0LA 3ZMSA 1BL0A 3VB2A 2V1XA 3P9IA 2P4WA 4AIDA 2FBHA 3KIOA 3K1MA 3L2WA 2W25A 4B3AA 2IXSA 3DBLB 2FJ1A 4IHWA 5CYVA 2ECBA 2PX9A 4XN3A 1GXQA 2VKVA 3QYBA 1SD4A 1A31A 3QODA 2XRLA 4BE2A 4KIGA 2VLAA 3HOYJ 3JTHA 4A93J 4YEJA 4CCOA 4PJ0C 2M3AA 2IA1A 4LD5A 2HTJA 5F6FA 3L2UA 1FMWA 4JBAA 4BHCA 3QRFF 1T8IA 3SFZA 1MH4A 4AC0A 1MJ9A 4EJWA 3M3YJ 3ABUA 3PJRA 1SVMA 4IX7A 4MEXF 2EV6A 1TQPA 4HF0A 3GZ6A 3C2BA 3HRMA 1FBUA 3FBNB 2QYOA 4A3FJ 1WKMA 1XCBA 3CO7C 2HOEA 4HZFA 1EH8A 1MBEA 3H3UA 1O3QA 4FASD 4HF1A 4MHGA 1X2MA 4Q48A 2E5NA 1IXCA 2VN2A 1A35A 3F0CA 1IO2A 2BY2A 4RGXA 2F4OB 4ESJA 3PFYA 4W1UA 2KIFA 1ETQA 1ZELA 1SMTA 3R61A 2JK3A 4QPQA 5DCMA 4DIQA 2ZJ2A 1T0FA 3E5UA 3FHNA 3OY9A 2FU4A 1XSXA 3ZQLA 3IV5A 2E1CA 2KDZA 1YS6A 2YU3A 2XAHA 1YITI 3O6BB 1V5GA 1IUYA 2OQRA 3ZGKA 3A2KA 1D1BA 5L3BA 4WF2A 1OCRH 4DW6A 2P7CB 1LJ9A 4GYIA 1FNNA 2CV2A 2EK5A 2D45A 2VI6A 3F6VA 4A3LJ 2M30A 1VQLI 3SQNA 3MWMA 4EVIA 1AKHA 2VQGA 4GDFA 2EA4A 4LJZF 1I3QJ 1LDJA 1TWAJ 2KIMA 1YS7A 4LG0A 4QLCU 1OCTC 1MBJA 5H6RA 4KMFA 5EGOA 5F64A 4KITB 2ZFWA 4BJ5C 3MZ8A 3K4CA 3TW7A 1QHHD 3FM3A 4BNCA 2QGUA 1WJCA 2OPTA 3S1QJ 2J5PA 1F5TA 4NBQA 2Y48A 2Z33A 1OR7C 2VQCA 4EGZA 1G3WA 1MJBA 1ETOA 4JQFA 3TBIA 3IUOA 2XKOA 3IC7A 3LAJA 1LB2A 3M1EA 1FYMA 3H5RA 4G8XA 2K02A 3F23A 1J0RA 2R5ZA 1VQ6I 3N4MA 4AWXB 3FISA 1TWFJ 3LFKA 4B48A 2DJNA 2DYSH 1Y8QB 4AUXA 1YW7A 1FYKA 2ZJRF 3MKZA 3BPVA 2QM3A 4ZYAA 1OYIA 2O0YA 3WTYC 3HOXJ 5M5YJ 1VQ5I 1W5CC 4PGHA 3RJPA 3GLXA 3E5QA 1L3LA 1J9IA 2BXZA 2HQ5A 1NK2P 2LSOA 2EFOA 3S3NA 1BC8C 1STZA 1E0EA 2KMUA 2WV1A 3BPXA 2PFBA 4CDGA 2GA1A 2K27A 4HDUA 2YUSA 4UVCA 4Y7NJ 1IXSB 2HXIA 2LDUA 2E1NA 4I99C 1VQOI 2VBWA 4NQWB 3HOTA 3JRHA 2XB5A 3QU6A 3QYEA 4BXUA 2NVYJ 3HXLA 5LEKA 5CVIA 4TV7A 1SFOJ 1XGMA 2DU9A 1M1EB 4IVNA 4CCJA 1S5LC 3HSFA 2DODA 1KQ0A 2CUEA 3QAHA 2FBKA 2X6XA 3F8BA 3OYHA 3FX3A 5FLXK 2UXNA 4KIFA 4WXDA 3OYGA 2FQ3A 2OD5A 4B43A 3F8NA 3BG3A 1RKTA 4YIRX 4IKFA 1MNEA 1T38A 2X6YA 1NHAA 2NAZA 2DYRH 4EEFG 1GT0C 2KIQA 1SVOA 2QQ9A 4ZTJA 2XAUA 4XLFA 4EJTA 3AG1H 5CVRA 1FY7A 4XOTA 4A0YA 2O5RA 2KKOA 1VZ0A 1U2WA 3TO7A 4UUSB 1Z21A 4RS8A 3L9FA 1RIOH 5HVQC 3D1NI 3TO9A 4QWQA 3FHZA 3CDIA 1N78A 5DV5A 2Y30A 5LD2C 3K4JA 3ZMZA 4B09A 1OFCX 1Y39A 1Z77A 5D8KB 2D1VA 1TBXA 1FJLA 1IGNA 1MDMB 4HBLA 3PQKA 3I59B 2HFHA 4OIRF 1YFHA 2K9LA 2IJLA 4KT5C 4JX5A 5BPDA 3V8LA 1YTYA 2NVUB 3FMQA 3KEQA 4ZYHA 5B3SH 4LLNA 3K9TA 1T39A 3X2QH 4BH9A 2QEXI 5FLVA 2LKSA 2IGMA 1FTZA 2BHZA 4ETSA 5E18F 3TDZC 1T56A 2P0WA 1HSTA 2NOGA 1JHHA 3GLLA 4AM3A 4Y3OA 3DU5A 3D5SC 3OYJA 4HSTA 2XC7A 3ZQCA 2X4HA 2M1BA 2M87A 3BJ6A 2DFHA 3BCAA 4YFNF 3BDDA 4ENKA 3JRFA 1VQKI 1EH7A 2Q2EA 2A6EF 2KFDA 2ECCA 3KX2A 3J7YJ 5HODA 2L7FP 3ABTA 3H35A 4ZDLA 3ZQ7A 4CH7A 4E7LA 2BEOA 3LSHA 1YOVB 1V55H 1PUFB 1X4PA 3HOVJ 4LIVA 4ZTFA 2LP0A 1Y56A 3C2GA 3K4MA 2MD0A 3TP0A 2IGKA 1GUUA 2XF7A 2ZXIA 3G6EI 4HNUA 1QA6A 4K2EA 2L7KA 2EWNA 2MA3A 2P5VA 3DTEA 1D5VA 5K5QA 2FNPA 2H94A 3OR2C 3S16J 2L5QA 3DKWA 2OF7A 1DPRA 2BYVE 1A04A 1FBSA 2XKPA 3T5XA 3HDDA 4N9IA 2YPRA 1R1UA 2M8EA 4HAMA 2HDWA 2KHMA 3U1DA 4H0EA 1EKEA 1Z3YA 2DA7A 3NARA 3EYYA 2FBIA 5ICEA 1D0XA 3N05A 2CH0A 3H0GJ 1KGSA 3DEWA 3V7CA 4OIQF 2JJ7A 1IJWC 3BR5A 1B72A 1DDNA 1VFCA 3WHCA 2KRCA 3K70D 2PBIA 2OUMA 2VE8A 3V7RA 3LSRA 4FETA 5LHHA 3NEUA 2RNJA 2VODA 5FO5A 4E4HA 3AKZA 1HKTA 2RNGA 2VJ5A 1YQAA 4RLQA 3DPLC 3K2AA 3KYCB 3CLQA 3TKYA 3HUGA 4QTRA 1VQ9I 3BTLA 1BR2A 2WAFA 5F27A 3CMMA 3H9JA 4HW0A 2J5OA 1RUNA 4CICA 2Z1DA 2BGCA 1SD7A 2EIJH 2HWVA 1SVLA 2HNHA 2VL8A 4DQ2A 1PYVA 3MQ0A 2NNYA 2LY1A 1HW5A 1R5HA 4I76A 4PSWA 1YO5C 2IW5A 1OCCH 3GXOA 2LREA 3IWZA 4FISA 4I7HA 2GLOA 1BBYA 3BG6A 5HLHA 5FLXZ 1HW2A 5FJ8J 2IT0A 1O4XA 3CESA 5E1WA 1OCPA 2JTVA 3A02A 4XBFA 5KAFC 4RGSA 3H5NA 4BY7J 2XF6A 1IF1A 2DA3A 4EJUA 1VQMI 1QO0D 1JGSA 2HYGD 3S1RJ 4PDKA 1XMAA 5H2FC 3GVAA 1BI2A 2Y0MA 2WTEA 3NWSA 2V4JC 3HYIA 4DYQA 3LSKA 2X1DA 2LBFB 1IRXA 1V5EA 4Y52J 4OU0A 3WTVC 1KYZA 2DA6A 4C30A 1MD0A 1HLVA 1S7AA 1J09A 2BOLA 3BG9A 1Z6RA 1SAUA 4CCLA 3JR9A 1QNTA 4HX8A 3GYHX 2UWMA 2WY7Q 2VB6A 3G1MA 3BWGA 2R93J 5JLWA 2ZMEB 2Q1ZB 3H9QA 5IPAA 2FXAA 1VQPI 2W00A 1FOKA 1D0ZA 1CF7A 1V3FA 1XMXA 4E7HA 4A3MJ 1GLNA 2I10A 3EUHC 2GOXB 3RPUA 3GTKJ 3FXUA 2EZIA 3QWLA 2KISA 4U88A 2H8RA 3D5LA 4F92B 5L3GA 4CYCA 1MNMC 3KZZA 5DUIA 4BS9A 1U3EM 1HC8A 3GTLJ 2HVSA 2EILH 1YG2A 2LMDA 3S14J 3IWFA 3D5RC 2X85A 3SFIA 2EFQA 3W2VA 4Y33A 4HNVA 3GTOJ 2Z9OA 4WXCA 4NNJA 1ZGAA 3F8MA 5E3NA 1ZTRA 3S8PA 2LRDA 3PNTA 5FFZA 4U7DA 4O6JA 1WCMJ 1LE8A 3VFZA 2M4GA 4UV8A 4EMSA 3BCBA 3V42A 4ENNA 1S29A 3CLOA 3DPTA 3FBIB 3A01A 1RRJA 2DPUA 3PNYA 4LK0F 5J3LA 3JRGA 3QP6A 2E34A 1FLIA 3SZTA 1SC7A 2R7SA 4BXXJ 2ID6A 4BY1J 2LTPA 2MFZA 5IOZA 2G7UA 1IV6A 3QQAA 2F6CA 1K7AA 3OYBA 3HZJA 3W6JB 2LR8A 2TDXA 3PIOF 1GV2A 4B47A 1GHCA 5BQTA 4OAZA 4Q4ZF 4IHSA 4D7MA 5ICFA 2R7UA 2DFEA 3M1CA 2K86A 2ISZA 2PEXA 1ZYRF 3JRDA 2DQLA 1P4WA 4PUSA 4EV0A 2KJBA 1YX3A 4D9JA 2DOAA 5EEAA 1KQ8A 2HPIA 3CUQA 3NAUA 1LEAA 4AIJA 1Y8RB 4QIWN 2RVCA 1K78A 4U0VA 3CCVI 4RMNA 1U5TA 1POGA 5EG0B 2M4KA 3PUBA 2ZXWH 2W84A 1MMAA 4M9XA 4DYRA 1ETWA 1KZHA 2RQQA 3HIFA 4XN0A 1JGGA 3PSIA 3TOAA 1YJNI 4M3GA 3CC4I 4LMYA 1H9TA 1G4DA 1WZ2A 5E3OA 3L1PA 2Y9ZA 1IRZA 1BC7C 3QPLA 2WB1A 4P5OA 3Q3SA 3OSGA 2VXZA 1R5GA 2VBYA 3BZCA 2E2HJ 2FOKA 2W1OA 4YFXF 3ERMA 3I53A 2ACJA 1L0OC 3IHUA 4FTHA 1XMKA 3OV8A 1TQIA 2ZXJA 3OR1C 4D1QA 1Z67A 3H0DA 4IRHA 5DUKA 2WBMA 2HDCA 3GX4X 3EPZA 3OYCA 1AU7A 1QZZA 3F8CA 4IOAF 4B1RA 3OL3A 5FD5A 3M07A 4G6QA 2R7FA 1MW7A 5ED4A 1IDYA 3I54A 2P8TA 3ZOBA 3BTIA 2CRGA 3ML6A 2NS0A 2K9SA 2IBDA 2XIGA 3C18A 2OZUA 4ZJZA 4JYKA 4AIKA 3MZHA 2P6TA 4KISA 1X4OA 5B5EC 1SFXA 2DA1A 1TWCJ 5IT9K 3CMEI 1UJ8A 5FKKA 1D1CA 1P7JA 1TLHB 2XB0X 2IGOA 5F08A 4OINF 4HG2A 1FMVA 3FXJA 5J1YA 3EUKL 1OYWA 2VC1A 2L2OA 5KK1A 3FXLA 1ZLKA 3VYUB 2D5VA 2RAEA 4X1EA 1USSA 1J7KA 3I5UA 2JN6A 3I9V2 5HLIA 2LD5A 4BDZA 4IHVA 3CF5F 3BJAA 2W85A 4E70A 1R71A 1TNTA 3DKYA 2YS9A 3COAC 2V7FA 3J80K 2CV1A 4N0BA 2DN0A 2FEZA 2LY9A 1SD5A 2VXDA 3LMMA 1H0MA 2Y9YA 3ABLH 2L4AA 4B8XA 2BY3A 1VF9A 2RKHA 5FROA 5GP9A 2TRTA 3MMYB 1B6AA 2ESHA 4ESBA 2R92J 2LKPA 3L2VA 3IRRA 3UR3C 4KFCA 5GAGJ 5CPRB 1OYYA 3S1NJ 4XL9A 1BI0A 1NK3P 3FXOA 1B9MA 1JKPC 4NHJA 2R7VA 4IHYA 4P96A 1QPIA 2BW3B 2KRHA 5DD4A 3F3XA 2CWEA 2V26A 1Z3XA 1RC9A 2KLOA 4HX7A 1I6XA 4ZZDA 3KEOA 1AWCA 5D6EA 4B3XA 4HA8A 4MFEA 2CQQA 1OQYA 3OWTA 3W3CA 4XR6A 5LGNA 1TTYA 3DLAA 3OYLA 5M3MJ 4RBOA 3OIOA 1VQ4I 1BW5A 2L7ZA 4FHTA 3KEYA 4YIFA 4FE7A 4CHUA 3RDIA 2O8KA 4XICA 4OAYA 3W2WA 2DMUA 4XRFA 2AO9A 3V8JA 2KZGA 4HPQA 2VOOA 1RR8C 3DBRB 1EH6A 2JVGA 1O7FA 1SANA 3FK7A 1I6HJ 2V9PA 1W4MA 4MQ9F 2P5KA 1TW2A 3PQJA 2GXGA 4JX6A 2QSHX 5GAHJ 5CVVA 3KFWX 2QCOA 1MNDA 2VQHA 4MEYF 3BP8A 2JPCA 2O61A 3DEUA 4U0YA 1N75A 4R79A 3IP4B 4RM3A 1R9TJ 4DOZA 2HZTA 4U0WA 2ZXHA 1BIAA 4BL0B 2V1UA 3J7AO 1R23A 2GAUA 3BR1A 4L5IA 2HKXA 2VPRA 2VQLA 4XQFA 3O3KA 5HLGA 2HZDA 2G0EA 3N97A 4UUVA 2X51A 1YE9A 3GTPJ 2D2WA 1XB4A 4A6EA 4RB3C 4BDYA 2CV0A 5GTHC 5GTIC 3P9CA 3HGYA 4PCQA 2EZHA 3E97A 3HOSA 3RZDJ 4M73A 4NQWA 4IQJA 2CQNA 2XVCA 4IZZA 4L9NA 3F21A 3VOEA 3F6OA 2QSFX 1MSFC 3KP7A 3RCOA 5BPIA 3GCMA 5IYBJ 5EZHA 1O3SA 1PDNC 2XAGA 5HNFA 1K61A 1N25A 3FF5A 3MFKA 1SD6A 4HYEA 4A69C 2CW0F 1QZEA 1W7PB 2MG4A 1Z1DA 1OR7A 5FFXA 3HB9A 5FD6A 2L02A 2NYXA 6PAXA 2EB7A 2JA5J 2L4MA 4ANJA 1C0WA 3RPQA 3KYLA 2A5YB 5DTDA 3DQVC 4G7HF 1KQ9A 4RLFA 5KHDA 1LUJB 1LNWA 2CYYA 2ESNA 2A68F 2I8DA 2ISYA 3MAJA 1Y6IA 3ONQA 4UUSA 3W6KB 3BOQA 2H09A 2HXOA 1Y0NA 3LSTA 2VBZA 3OYFA 3P7NA 2QBYB 3CD6I 1ZARA 3PO2J 1Y1WJ 4PZJA 4B4CA 1IN4A 2L0KA 1MDMA 3K7AJ 3ROUA 3E0JB 2K9QA 3K2ZA 5DCFA 1S8NA 3I59A 3LA2A 3LA7A 3AFHA 5IT9Z 1UAAA 4UY8I 3OS2A 1F9NA 2V1NA 4HRIA 4FX0A 3VDXA 1Q1VA 3B02A 2BBYA 3KP2A 1JTYA 1JJ6C 2K9MA 1RNLA 3LSGA 3BR2A 4NC7A 4LLGF 1ONVA 3E3VA 1LDKB 1UELB 4M9SA 1X19A 1MBKA 1R4NB 2AQEA 4EJOA 2RREA 3HM5A 2W24A 1FTTA 2XF5A 3C7JA 3FMSA 2O6GE 3ZMUA 1PVEA 1D5YA 4O3MA 1S3JA 2NXNB 3AL0C 3GFJA 3HRSA 3J80Z 1BI3A 2XPVA 3SZGA 2MLKA 2O3FA 3TW6A 1B8IA 4L5JA 3C1DA 5HOOA 4XLCA 2JSPA 3T8RA 5TJJA 2JWTA 1TWGJ 2PJRA 3ZQQA 3KZYA 1BJZA 1WI3A 3L7WA 5IP7J 3CJNA 2DA2A 1TZLA 2ZB9A 5M5WJ 2AXLA 4KMUX 5ERIA 3VEPA 3JW4A 4M3BA 2DXIA 1XDUA 2ME6A 2H1LA 4XSZF 5DCMB 1ETVA 4II2A 4AVPA 1FIPA 2RC4A 2CW8A 1ZGJA 1U6GA 5E17F 1WHUA 1BN5A 2DFIA 4J01A 5CQEA 2E1OA 4KDPA 2HEOA 2HR3A 2PN6A 3DPUA 4F3QA 1LFBA 2X1CA 3ZRGA 4IRIA 1FZPB 1GVJA 3GFIA 1QVUA 1X3ZB 3BROA 2FUG2 2HKOA 2W7NA 1J59A 4EGYA 3JTGA 3B6CA 4LITA 4OWRB 4UB8C 2DPDA 4BEHB 5JVGF 4PJNA 3GBGA 1B4AA 2BVMA 2IPQX 1T2KA 3PFIA 2YX7A 4XKCA 3IL2A 3HPGA 3A4CA 5IP6A 1XX5A 2V6EA 1ZKGA 5D8LB 4U7BA 3RQ4A 2PG4A 5HLTA 3HKZN 3WE3A 2WWYA 1MIJA 1UB9A 1DUXC 3FZVA 3NWTA 2VE9A 2EZKA 3TP3A 3RKXA 3GFMA 4EATA 5DM6F 1HSJA 1D3YA 1R36A 1AKHB 1U8BA 1DU0A 4LG0B 1MGTA 4OIOF 5JVTA 3R6SA 2PMZN 2DBBA 5EGOB 3PUFA 4RDUA 3G3ZA 3WU2C 1WJBA 1Z9CA 1WRJA 4F93B 1QHGA 4RAGA 3Q0UA 4IJAA 2JZYA 1J5YA 2KQRA 1IZ1A 4ABZA 2W48A 2XRNA 5F0HA 2STTA 3CCEI 2HOTA 4UUTA 3JRCA 4B44A 1J75A 2OTLI 4RAZA 3DV8A 1XGSA 2ZKZA 4N9HA 2CG4A 2K5CA 2OJED 2FNAA 4GXOA 2Z99A 2IEKA 2JSCA 1JUMA 5GPAA 2MH9A 2GWRA 2XSJC 1K83J 3G4SI 2IS2A 3L00A 1P92A 1G2HA 2JT1A 4UV9A 1X3WB 3E6DA 1R1TA 5M5XJ 4F52A 2K3FA 3HG9A 1KU7A 3CC7I 9ANTA 2JVHA 4NDLA 1BOAA 1Z05A 1OCOH 2ZJQF
chains in the Genus database with same CATH topology
3ERMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERM A; 
#chains in the Genus database with same CATH topology
 3HKZ A;  2KT0 A;  4I09 A;  2DDB A;  3BQY A;  2LBF A;  3KCC A;  4RB1 A;  4IOC F;  1REP C;  5E3M A;  3QP5 A;  2MYS A;  3OOU A;  1ZN2 A;  1A6Q A;  4ZYE A;  4WCG A;  4KJZ A;  2ETH A;  3WG9 A;  1I50 J;  3TL4 X;  2VOP A;  2PMZ A;  4ZDO A;  1UHW A;  2XV4 S;  3ZQG A;  4P55 A;  4V2F A;  5DYM A;  4KNY A;  3QPT A;  2VJJ A;  3K0L A;  1OLT A;  5JHF A;  1U8R A;  1NTC A;  1WFX A;  4CYD A;  4E7Z A;  3OYD A;  1GDT A;  2ZME A;  5IP9 J;  2OC6 A;  2A69 F;  3KET A;  4BQQ A;  1R5I D;  1IN8 A;  3LSJ A;  4DYC A;  3CCL I;  5ILS A;  3T8T A;  3E1S A;  2BY1 A;  3U2R A;  1UZC A;  5L3F A;  2GBY A;  2ZCW A;  3QOP A;  1R1V A;  3ZQI A;  3GTM J;  1LVK A;  2CJJ A;  2ZNZ A;  1ULY A;  2VC0 A;  4HSR A;  4RAF A;  3BR0 A;  4HF2 A;  2E60 A;  4IO9 F;  2XGD A;  4I98 B;  1UCR A;  4MLO A;  4A3D J;  1TQM A;  2HYF A;  3DCF A;  3O2P E;  4AYB N;  2CU7 A;  4BUP A;  5HDN A;  3CCQ I;  2HOA A;  1WVR A;  5CJ9 A;  3RIR A;  5C3E J;  1ZRF A;  3KZI C;  2CQ7 A;  1X1A A;  2CO5 A;  4KA4 A;  3TED A;  2JA7 J;  5FGM A;  1P6R A;  1MMD A;  2ZC2 A;  1ODD A;  3CJQ B;  4HOB A;  3IRQ A;  3JRI A;  4I01 A;  3RYP A;  2ELK A;  3I58 A;  3FXK A;  3OS0 A;  4NUB A;  2QSG X;  1OCZ H;  1OIS A;  3F72 A;  1FYL A;  4KIB A;  2MBF A;  2EIN H;  5FKM A;  4YRV A;  5D4S A;  2LOO A;  2NVT J;  4A3G J;  1LEB A;  2XSD C;  4XNF A;  2OQG A;  1JKO C;  4FQG A;  2O03 A;  1ZRC A;  1QBJ A;  3S2H J;  4FT8 A;  1JUS A;  1ZRE A;  3ZCO A;  4FCY A;  4C2T A;  3J7A Y;  1SFU A;  2C6Y A;  2VJ4 A;  4WWC A;  3O8G A;  3SXY A;  1S7O A;  2Q2E B;  1NG6 A;  1TT5 B;  3RYR A;  2ZSH B;  3JRA A;  3CCM I;  1W5S A;  1N77 A;  1YI2 I;  1WGX A;  2Y69 H;  2M9H A;  4LK1 F;  3CMY A;  4EQQ A;  2UXX A;  4HQE A;  2B7E A;  2R3S A;  2L9N A;  3Q0W A;  4RAY A;  4AYB A;  3QPH A;  1AOY A;  3GZ5 A;  2R7T A;  4D5C A;  1E3O C;  3HTS B;  5IT3 A;  2IS4 A;  2DT6 A;  4M6Y A;  4ENJ A;  1R00 A;  3H1C A;  5ILV A;  1OMI A;  4DBR A;  5C4X J;  2MGQ A;  2W4S A;  3CMA I;  5FKN A;  2FSW A;  3CCU I;  4ON0 A;  5IYC J;  1MKM A;  2G7H A;  1ZR2 A;  1R7J A;  2DLL A;  3U1K A;  1OKR A;  2VKH A;  1H8A C;  4QPO A;  1O3R A;  2F5F A;  2WC2 A;  1IV8 A;  2V1D A;  4L5E A;  4DZP A;  2E19 A;  2EIM H;  2ID3 A;  5LGU A;  1RI7 A;  2ZNY A;  2VBX A;  4ASN A;  3LQQ A;  4AD9 A;  4BQN A;  5HS8 A;  5ICC A;  1VQ8 I;  2EBI A;  3S17 J;  1T33 A;  3BG7 A;  1S6L A;  2P6S A;  4XMY A;  1HA8 A;  2STW A;  4XLP F;  2F5D A;  5BOX A;  3I71 A;  2GZW A;  3E5X A;  1F36 A;  2DCE A;  1KON A;  1X58 A;  4F7Z A;  1DP7 P;  3NRV A;  2FRH A;  2P7V B;  5HDG A;  2B9S A;  3IH2 A;  4E7I A;  3HHG A;  2CW7 A;  2DK5 A;  1PJR A;  1MMN A;  4MFD A;  1ACI A;  1VQN I;  4XLN F;  5AIQ A;  3HGG A;  2RV8 A;  3FIW A;  1MSE C;  1ON2 A;  5FB2 A;  2EQR A;  5EJC A;  3JSP A;  1U0J A;  4BQA A;  1ORK A;  1FOW A;  1RPW A;  1G6N A;  2QQA A;  3DU6 A;  5K7Z A;  2HPM A;  1HCR A;  3DF8 A;  4XKB A;  3ZP5 A;  2CUZ A;  2VT2 A;  3JSO A;  1SMY F;  1VQ7 I;  2RGV A;  3PNV A;  4OIP F;  4M71 A;  1K6Y A;  3VYR B;  3GME A;  2M7A A;  3ASN H;  4F91 B;  3ZQH A;  3TGN A;  3G1O A;  3HTU A;  1CQT A;  3OS1 A;  2E1M C;  1UMQ A;  3R60 A;  4CA0 A;  1FOX A;  2KRF A;  3OYK A;  5HS7 A;  1T6S A;  3VWB A;  1BIB A;  1FPQ A;  2K4B A;  4M3D A;  2VAS A;  3CP2 A;  4BU2 A;  1XN7 A;  3W6V A;  3DWL E;  5L3E A;  1XDS A;  3ZN0 A;  2JA8 J;  3L2R A;  2OAZ A;  3ECH A;  3SZP A;  1P9Q C;  2OU2 A;  3MN2 A;  1ENH A;  3BLY A;  4WX9 A;  4L0Y B;  3QPS A;  3LOC A;  4G12 A;  2VUM J;  3GFL A;  3KLN A;  3KPH A;  4KYW A;  2PLY A;  1TC3 C;  1H9G A;  2QWW A;  2F5V A;  2X6W A;  3IH4 A;  4XLA A;  3FXR A;  3W2A A;  1JI8 A;  3MKL A;  4R8H A;  1SFE A;  2DQR A;  2HGC A;  3I4M J;  4E7K A;  1P2F A;  1LQ1 A;  4Q5S F;  2DFF A;  3JRB A;  1PUE E;  4I0A A;  3ZMT A;  3WTT C;  2CS3 A;  2LF7 A;  5M3F J;  4DNC A;  5H20 A;  1HBX G;  2BV6 A;  3S93 A;  2GOM A;  3WE2 A;  3K4K A;  2HI3 A;  4GRI A;  1A36 A;  1FBQ A;  3SDB A;  1JJ8 C;  1CF7 B;  5ICG A;  3UNG C;  3DEE A;  3I3L A;  3HHH A;  1ZRD A;  2DA5 A;  3ERE D;  1I27 A;  1FP1 D;  1YRN B;  2H27 A;  2Q0O A;  3C2H A;  3ULQ B;  3GF2 A;  2IA2 A;  4CYC B;  3CCR I;  3D0S A;  3VOD A;  1B59 A;  2NS8 A;  2AXT C;  2LVS A;  2QVO A;  3KP6 A;  4RB0 A;  1GXP A;  2KJC A;  3LA3 A;  5AON A;  1KYW A;  3CUQ C;  2H6C A;  1JKQ C;  2R5Y B;  3K1P A;  2FML A;  3CQZ J;  1OJL A;  1TWH J;  1JHF A;  3KE2 A;  1NH3 A;  3LL7 A;  1HOM A;  1IN6 A;  4KUM A;  1LE8 B;  4XM3 A;  4XSX F;  3K69 A;  4C9Y A;  1D8J A;  4N4O B;  2JA2 A;  3ECO A;  3OYE A;  1TNS A;  4Y4R A;  1K6O A;  4A3K J;  5DS9 A;  2XGC A;  4PJJ A;  1R49 A;  1Y1V J;  3BZK A;  3H92 A;  3S32 A;  3V8K A;  1S7E A;  3DLL F;  5AIP A;  5GAE J;  1ZR4 A;  3CDL A;  2VKD A;  3MEX A;  2HDD A;  2XHK A;  2HVQ A;  3K4N A;  5EDN A;  4LB5 A;  3SEZ A;  3WTW C;  5K1Y A;  1AA7 A;  1E17 A;  4GFB A;  5BMZ A;  4L9T A;  2LC2 A;  2MSY A;  1WI9 A;  5JLX A;  2EFW A;  4A3I J;  3K70 C;  2ZJP F;  4EM1 A;  5E8I A;  2XGE A;  2LG4 A;  2PJP A;  4MNU A;  5D5W B;  1ZH5 A;  3WTX C;  4RGU A;  2L3D A;  4PFO A;  3H3V K;  3S3O A;  1BA5 A;  5JR3 A;  3K1N A;  2E5Z A;  4XK4 A;  2M0C A;  3NQO A;  4ZZL A;  1F1Z A;  3FM5 A;  2MC3 A;  2K4J A;  2BZT A;  5J1R A;  2F4I A;  5FLM J;  4GCV A;  4IF4 A;  3CUQ B;  1I39 A;  2M45 A;  3TOB A;  2I5U A;  3OOP A;  1QPM A;  4KIC A;  5EEG A;  1K78 B;  1S72 I;  1MZB A;  5KNL A;  3U21 A;  1A6I A;  3GZN B;  1BM9 A;  3C3W A;  2CFO A;  5JI6 A;  1LPQ A;  2YU9 J;  1MMS A;  3SYT A;  4RB2 C;  4PGG A;  4A0Z A;  5J47 A;  1P4A A;  3HRU A;  1I1S A;  3BR3 A;  3RKQ A;  3GWZ A;  1ETK A;  3ZN1 A;  3I56 I;  5D6F A;  3TDU C;  2V79 A;  4BQO A;  3MZY A;  4XKW A;  1YX5 A;  2E36 A;  1RKW A;  4KT6 A;  3H3Z A;  3I55 I;  2F5E A;  2XGX A;  5E8G A;  1W36 C;  2EJR A;  2OBP A;  3DFG A;  5HNH A;  3G2B A;  1K4S A;  3JCU C;  5J1U A;  5BS6 A;  2F48 A;  2DT5 A;  4XID A;  4XRS A;  5JHU A;  3DKX A;  3OL4 A;  1DP3 A;  2KZV A;  1FWZ A;  1WH5 A;  5KCM A;  5F0F A;  2CMP A;  1QQI A;  3QU3 A;  4HNT A;  2DW4 A;  2EZL A;  2XAJ A;  3TQN A;  5GPC A;  4R1H A;  4ITV A;  3V4G A;  2E7X A;  3CCS I;  3OIP A;  1JE8 A;  5FRM A;  1YW9 A;  1E2X A;  2DOF A;  4CUG A;  2HTS A;  3PIP F;  2Z16 A;  3M9A A;  1K4T A;  1JT6 A;  2PQ8 A;  2EFN A;  2R7O A;  1O3T A;  3T0Y A;  2FQ4 A;  2OZ6 A;  1TW3 A;  5LHG A;  4AU7 A;  2IS6 A;  1D8K A;  1Z91 A;  2F5C A;  5JFR A;  3VPR A;  2B0L A;  3MD2 A;  5DDG A;  1W5T A;  4ZH4 F;  3DTI A;  4I6Z A;  2UV1 A;  2Z2S B;  2GIV A;  2DTR A;  2MC4 A;  3K10 A;  4MO7 A;  3OYM A;  4BAY A;  5TIS C;  3H9G A;  2DOE A;  3E6M A;  4BKX A;  2L9R A;  3AG4 H;  3MKW B;  4P1W A;  1DGW Y;  5E3L A;  3WG7 H;  1I1G A;  3IH3 A;  1BR4 A;  5E79 C;  2X1E A;  4AIH A;  4G6D A;  5KVR A;  3WU0 A;  3DBH B;  2L9V A;  2DA4 A;  2NVX J;  3Q9S A;  1W0U A;  1GV5 A;  2V9K A;  5EYR A;  4BJT A;  3GTJ J;  3QOE A;  1APL C;  3A0B C;  3S2D J;  2AS5 F;  4IXA A;  2LK2 A;  1IG7 A;  1E3P A;  5H6Q A;  4QSH A;  1MBG A;  3FKI J;  2Y0S N;  1YJ9 I;  4BEH A;  1SAX A;  2NVQ J;  3K4B A;  4BHP A;  4EM0 B;  4NB5 A;  2CQK A;  2A6T A;  1BR1 A;  3J7Z I;  2GA2 A;  2M2E A;  4HQM A;  3LSP A;  3M4O J;  2OA4 A;  5IOY A;  3FWE A;  3Q0V A;  2FX0 A;  1T0F C;  1Z7U A;  5F1J A;  4LOC A;  4I2O A;  4S0H B;  3Q5F A;  4GO1 A;  2ICW G;  5E1X A;  1NG7 A;  2ADU A;  3HL2 A;  4JP0 A;  2WY8 Q;  4C2M J;  2Q8K A;  1WJ5 A;  3JRE A;  1YJW I;  3WOD F;  3S15 J;  1WH7 A;  4A0X A;  1DU6 A;  4MGR A;  4NC8 A;  3M8J A;  4YG2 F;  4HEA 2;  3G71 I;  5LLQ A;  3QYF A;  1IRG A;  2R7R A;  1BI1 A;  3REO A;  1XS9 A;  3DXJ F;  4DBQ A;  1RUO A;  2HOS A;  2QLZ A;  3ZMV A;  1KU9 A;  1GVD A;  1HF0 A;  1XGN A;  1U9O A;  1XPX A;  1F4K A;  5DEQ A;  2ZSI B;  2KP6 A;  5F1R A;  1TP4 A;  3BQZ A;  4UXN A;  2QKL B;  4YFK F;  2MW8 A;  1I5Z A;  4MIM A;  1X1D A;  2Y0S A;  4E7S A;  1PUF A;  1EJ9 A;  3KP4 A;  1JT0 A;  3CO6 C;  3HRT A;  4A5N A;  3OYN A;  1B9N A;  2W57 A;  3IKV A;  4IEJ A;  4D0P A;  1BJA A;  3J81 K;  2M5W A;  3FK6 A;  1G8X A;  3HBL A;  3VYS B;  4DJA A;  4E6K G;  2CSO A;  2ME0 A;  4LG3 A;  3ZR8 X;  1UHS A;  2MAB A;  2ELH A;  2IS1 A;  2GM4 A;  2LFB A;  3VSL A;  5CVU A;  1G59 A;  1YW8 A;  4X6A J;  5LGT A;  4BGD A;  5J40 A;  3ZXS A;  4WXH A;  1IN7 A;  5J4V A;  5LRR A;  4A6D A;  1T98 A;  4G7O F;  2HQN A;  2HQR A;  3EUA A;  3FKJ A;  3AL0 B;  1X3U A;  1G3Y A;  1FEX A;  1ZAO A;  3KLO A;  1ETX A;  1XGO A;  2K40 A;  3RPU D;  2GIZ A;  4PJL A;  3H36 A;  5D4R A;  4GYG A;  1WJD A;  3E6B A;  2CFX A;  4D7N A;  4A3E J;  2DO7 A;  2JMW A;  1Y0U A;  3ZMD A;  5K5R A;  2WAQ N;  4CZC A;  5A2Q K;  2EV0 A;  2JPB A;  2GXA A;  4JX4 A;  4FX4 A;  2BE5 F;  3LQR A;  1FOY A;  3KP3 A;  2E2I J;  2BHY A;  4X0G A;  4HLX A;  4BBR J;  3RKY A;  2K85 A;  3GEZ A;  2GXB A;  1Z6T A;  2DDA A;  5F0C A;  1QVT A;  3U9G A;  1AHD P;  1ZK8 A;  4A2U A;  2W82 A;  2YSR A;  5J6X A;  3IAM 2;  5EZG A;  2EIK H;  4EJV A;  4Y13 A;  2R5Z B;  4IL6 C;  4L9J A;  4J19 A;  4CSW A;  1HDD C;  2LF8 A;  2HVR A;  2WAE A;  1WQ2 A;  2R7D A;  3CCJ I;  1IAW A;  2HS5 A;  1VTN C;  3BJO A;  1FT9 A;  1FC3 A;  1KU3 A;  2QF7 A;  4MQV A;  5DD8 A;  1DPU A;  3PL8 A;  1SFK A;  2L01 A;  3ABK H;  4M6V A;  2R7W A;  3HSE A;  1PP7 U;  4C3H J;  2IA0 A;  2KL4 A;  2FD5 A;  1H89 C;  3L09 A;  5K7F A;  1ZG1 A;  1DGR M;  4XLH A;  1ZQ3 P;  1B8I B;  1ETY A;  4HX4 A;  3WHB A;  2A3S A;  3CCY A;  5LEJ A;  1ITY A;  1D0Y A;  4HV6 A;  4C2U A;  4L0Z B;  1T08 B;  4H4K C;  2M0M A;  1JXS A;  3HJE A;  4OMZ A;  2PJR B;  4S04 A;  3A1Y A;  4E7J A;  3HOZ J;  5TGT A;  4EM2 A;  3ESW B;  1HW1 A;  2VJI A;  1X2N A;  1D1A A;  2A61 A;  3ZQF A;  5FKL A;  1G3T A;  1R58 A;  1P7I A;  2DTZ A;  2VIX A;  2LY2 A;  2QQ8 A;  2F2E A;  4UVA A;  1W1W E;  3DTK A;  1ON1 A;  3RKW A;  5TRD A;  2WAQ A;  4P9F A;  3B6A A;  2JUG A;  4M74 A;  1ZGW A;  4Z6Y A;  3S3M A;  3GTQ J;  4RM2 A;  2GQQ A;  1MBF A;  1J2X A;  2R7Z J;  2JA6 J;  3P9K A;  3SHF A;  3WTS C;  1XSV A;  2FA5 A;  2A05 A;  5K5O A;  4HV5 A;  4XON A;  2H8W A;  2Z5U A;  1WPK A;  3DP7 A;  3MVP A;  4M72 A;  2RN7 A;  3CTA A;  3O8H A;  3WGI A;  1O57 A;  4BAC A;  3FXM A;  3CUO A;  2HQA A;  3SDG A;  1RR7 A;  4MTE A;  5E20 A;  2Y31 A;  4C3I J;  2PMU A;  3I64 A;  2AQF A;  3I4N J;  3GW2 A;  4UVB A;  2H1K A;  2OV7 A;  4D5F A;  1QZY A;  2LLK A;  5CVJ A;  2WA0 A;  4JOM A;  4II3 A;  5LBQ A;  3G73 A;  3G1L A;  4F55 A;  2R4G A;  1EF4 A;  4P9U A;  3AG3 H;  4NC6 A;  5L3C A;  3FXQ A;  2H6B A;  4V2G A;  3JAM K;  5D5X B;  2OCC H;  2P81 A;  4M6X A;  4V19 K;  2L9S A;  1Z0X A;  3OSF A;  3J81 Z;  3RQI A;  2QKM B;  2ZME C;  2DAO A;  2BY0 A;  1R6R A;  1T95 A;  2CUF A;  5C4J J;  4Q47 A;  1IC8 A;  3AG2 H;  3SEQ A;  4A3J J;  4HDV A;  1FP2 A;  2LYC A;  2NNN A;  1V4R A;  5FRN A;  1LFP A;  3GTG J;  1S9H A;  3RZO J;  3EUH A;  4MTD A;  3GO5 A;  2E71 A;  4C3J J;  3RTR A;  2FMY A;  2MH2 A;  5D5V B;  2YX4 A;  3HOW J;  1SEU A;  4L18 B;  4M9Z A;  4AVZ A;  2RDP A;  1IXR C;  2UUZ A;  3EET A;  1UST A;  3Q9V A;  2E2J J;  1RET A;  4RA2 A;  2LNB A;  1YIO A;  1LDD A;  2K7L A;  1XCV A;  1H88 C;  1XD7 A;  4BBS J;  3HPH A;  5IYD J;  2A5W A;  3IKT A;  3M8F A;  5CLS A;  1W36 D;  2UZK A;  5HDK A;  4BJ6 C;  1U78 A;  2DMP A;  1W7P D;  3OYA A;  1QGP A;  3CJT B;  3B73 A;  1XC5 A;  4G94 A;  2JUC A;  3H5A A;  4CO8 A;  2RQP A;  3E6C C;  3TO6 A;  4KN7 X;  3HOU J;  5EG0 A;  3LAP A;  2COM A;  3VYT B;  3UKG A;  3RSN A;  2Z3Y A;  3K4L A;  4UNO A;  2ZBK A;  5A2Q Z;  1BOB A;  3CJR B;  5B66 C;  1HKS A;  1A5J A;  1E3H A;  3R0A A;  5BNG A;  2EV5 A;  4I02 A;  1Q1H A;  2DMN A;  2L54 A;  1XSD A;  1JKR C;  4J00 A;  4A3B J;  5EF6 A;  1MBH A;  4A5M A;  1LKX A;  2HU9 A;  1JTX A;  4DZJ A;  2EA2 A;  2ELJ A;  1WJA A;  2LH9 A;  4A12 A;  4N4N B;  3ASO H;  2CUJ A;  4BHB A;  1G3S A;  1B72 B;  1MH3 A;  3EDP A;  2CQX A;  4Z2Y A;  3AAF A;  1K79 A;  2KDO A;  1YRN A;  1ZLJ A;  4CGZ A;  3E7L A;  4YEL A;  2R7Q A;  2BVL A;  1Z7L A;  2Y75 A;  1UG2 A;  3F22 A;  4IHT A;  3TMO A;  1UG0 A;  3HUG B;  4G9Y A;  1HKQ A;  5IY5 H;  5D5U B;  4CCK A;  4ZYD A;  2R0Q C;  1HXD A;  2R5Y A;  4Y15 A;  2KPM A;  5LRS A;  2XPU A;  3A0H C;  2QQB A;  3EYI A;  2MD5 A;  1B1B A;  2E7W A;  1HQC A;  4CCN A;  1LVA A;  4JK1 X;  5L3D A;  1R4M B;  2JRM A;  2D1H A;  1MMG A;  4BE0 A;  2NRA C;  2QEN A;  4LFU A;  2QZ8 A;  3ISP A;  2ZFU A;  2XUB A;  5DM7 F;  1TL8 A;  3LSI A;  2QUF A;  3L2Q A;  1F43 A;  1FSE A;  2VPL A;  1VND A;  5J8C A;  2AHQ A;  2E35 A;  3CC2 I;  2P5L C;  4IHX A;  2IRF G;  2WB1 N;  1U9N A;  3P5J A;  1KU2 A;  2G9W A;  1R22 A;  2FF4 A;  5J8F A;  3L2C A;  1LFU P;  5CQG A;  2WAD A;  1IN5 A;  4UB6 C;  2DT7 B;  1IRF A;  3OYI A;  2ZO4 A;  1KA8 A;  3BG5 A;  2JQ7 A;  3V7S A;  4ENM A;  2EH3 A;  2XDV A;  4KN4 X;  3F9K A;  2IVM A;  4HLY A;  3EQL F;  4L9V A;  2IGN A;  1V54 H;  4UHT A;  1W0T A;  1WJF A;  3OIQ A;  3HC7 A;  2R7X A;  4DGW B;  5GAD J;  3BR6 A;  2XAF A;  4PJM A;  2VKE A;  1JUP A;  3I4P A;  4XRM A;  3S2W A;  1ZG3 A;  4CZZ A;  1YHQ I;  3CP8 A;  5FKO A;  4GGG A;  5C44 J;  3CF2 A;  1UHM A;  5CKT A;  2FOW A;  2OCE A;  3WGH A;  3R0J A;  4LB6 B;  3ABM H;  2BW3 A;  4G7Z F;  2Y2Z A;  1IW7 F;  2PI0 A;  1UFM A;  3F8F A;  1BW6 A;  3RI4 A;  5J4Y A;  3BTJ A;  1IUF A;  4O5V A;  1P4X A;  3JAM Z;  2KIU A;  3CDH A;  1RZ4 A;  3R4K A;  3MCZ A;  4BXF A;  4PFP A;  5E1Z B;  2K9N A;  1ZG5 A;  3PSF A;  3IAS 2;  2LKX A;  2E1M B;  4M3E A;  1RES A;  1FX7 A;  1EA3 A;  3M8E A;  4I0B A;  2NS7 A;  2IAI A;  4ZDP A;  2DJI A;  3WTZ A;  2XRO A;  1X1B A;  3FDY A;  4IQ4 A;  4ZC3 A;  4YII A;  1WWX A;  2EFP A;  3WU1 B;  4OMY A;  3S1M J;  1EV7 A;  2M7B A;  3PM1 A;  2DMT A;  2X6O A;  1QU3 A;  2XAQ A;  4XLE A;  1O7L A;  2M34 A;  2O7O A;  1U5T C;  1ZHF A;  3MKY B;  4A3C J;  3KYD B;  2JRT A;  2DMQ A;  4WK8 F;  3LNQ A;  5LFA A;  2DI3 A;  2TCT A;  3BTC A;  1XTA A;  2M8G X;  3LFU A;  2XAS A;  2COB A;  2HYJ A;  4PSX A;  3WTU C;  3A01 B;  1FIA A;  4BYY A;  1ERD A;  4RGR A;  5KAI C;  1YLF A;  2N8G A;  1YIJ I;  5K7H A;  3LSM A;  3I0T A;  3CZ6 A;  1XG1 A;  1WJE A;  2F4M B;  2YR2 A;  4M3F A;  4Y17 A;  3PO3 J;  2L7M P;  2PMH A;  4IRG A;  5EEH A;  3T1B A;  3BC8 A;  3K6G A;  4OOI A;  3FMR A;  3SJM A;  1MJA A;  4G6T B;  2IP2 A;  4LGW A;  2B63 J;  2DK8 A;  5B1A H;  4XOR A;  3KP5 A;  3VSK A;  2O8X A;  1V5F A;  2K3P A;  3HSR A;  4ESF A;  3ZPL A;  3WGG A;  2A07 F;  4S05 A;  4BE1 A;  3M7G A;  1W7P A;  2CGP A;  4XKV A;  1X1C A;  2X9D A;  2WV0 A;  4ZYG A;  1I3A A;  2V6C A;  2EPF A;  3OMY A;  4LIU A;  4XOP A;  2A6H F;  4XRS G;  1DQU A;  2MLG A;  5HS9 A;  2NOJ B;  2QA4 I;  4CXF A;  1U5T B;  4LLL A;  2X48 A;  2VON A;  1VI0 A;  3GUD A;  1CGP A;  2FE3 A;  3BT9 A;  3ELK A;  2O9L A;  2VT3 A;  2OTJ I;  3BY6 A;  1HDP A;  1IDZ A;  1OPC A;  1QRY A;  4W97 A;  1X1P A;  1YYV A;  2V9V A;  1PP8 F;  5F04 A;  5B1B H;  1TT0 A;  2BXY A;  2QBY A;  3BZ6 A;  4U87 A;  4IPA A;  5ILU A;  1WSU A;  2XPW A;  4PK4 A;  3HEF A;  3A03 A;  4CCM A;  1FSH A;  4FE4 A;  5LHI A;  3LWF A;  2X0L A;  3ZMS A;  1BL0 A;  3VB2 A;  2V1X A;  3P9I A;  2P4W A;  4AID A;  2FBH A;  3KIO A;  3K1M A;  3L2W A;  2W25 A;  4B3A A;  2IXS A;  3DBL B;  2FJ1 A;  4IHW A;  5CYV A;  2ECB A;  2PX9 A;  4XN3 A;  1GXQ A;  2VKV A;  3QYB A;  1SD4 A;  1A31 A;  3QOD A;  2XRL A;  4BE2 A;  4KIG A;  2VLA A;  3HOY J;  3JTH A;  4A93 J;  4YEJ A;  4CCO A;  4PJ0 C;  2M3A A;  2IA1 A;  4LD5 A;  2HTJ A;  5F6F A;  3L2U A;  1FMW A;  4JBA A;  4BHC A;  3QRF F;  1T8I A;  3SFZ A;  1MH4 A;  4AC0 A;  1MJ9 A;  4EJW A;  3M3Y J;  3ABU A;  3PJR A;  1SVM A;  4IX7 A;  4MEX F;  2EV6 A;  1TQP A;  4HF0 A;  3GZ6 A;  3C2B A;  3HRM A;  1FBU A;  3FBN B;  2QYO A;  4A3F J;  1WKM A;  1XCB A;  3CO7 C;  2HOE A;  4HZF A;  1EH8 A;  1MBE A;  3H3U A;  1O3Q A;  4FAS D;  4HF1 A;  4MHG A;  1X2M A;  4Q48 A;  2E5N A;  1IXC A;  2VN2 A;  1A35 A;  3F0C A;  1IO2 A;  2BY2 A;  4RGX A;  2F4O B;  4ESJ A;  3PFY A;  4W1U A;  2KIF A;  1ETQ A;  1ZEL A;  1SMT A;  3R61 A;  2JK3 A;  4QPQ A;  5DCM A;  4DIQ A;  2ZJ2 A;  1T0F A;  3E5U A;  3FHN A;  3OY9 A;  2FU4 A;  1XSX A;  3ZQL A;  3IV5 A;  2E1C A;  2KDZ A;  1YS6 A;  2YU3 A;  2XAH A;  1YIT I;  3O6B B;  1V5G A;  1IUY A;  2OQR A;  3ZGK A;  3A2K A;  1D1B A;  5L3B A;  4WF2 A;  1OCR H;  4DW6 A;  2P7C B;  1LJ9 A;  4GYI A;  1FNN A;  2CV2 A;  2EK5 A;  2D45 A;  2VI6 A;  3F6V A;  4A3L J;  2M30 A;  1VQL I;  3SQN A;  3MWM A;  4EVI A;  1AKH A;  2VQG A;  4GDF A;  2EA4 A;  4LJZ F;  1I3Q J;  1LDJ A;  1TWA J;  2KIM A;  1YS7 A;  4LG0 A;  4QLC U;  1OCT C;  1MBJ A;  5H6R A;  4KMF A;  5EGO A;  5F64 A;  4KIT B;  2ZFW A;  4BJ5 C;  3MZ8 A;  3K4C A;  3TW7 A;  1QHH D;  3FM3 A;  4BNC A;  2QGU A;  1WJC A;  2OPT A;  3S1Q J;  2J5P A;  1F5T A;  4NBQ A;  2Y48 A;  2Z33 A;  1OR7 C;  2VQC A;  4EGZ A;  1G3W A;  1MJB A;  1ETO A;  4JQF A;  3TBI A;  3IUO A;  2XKO A;  3IC7 A;  3LAJ A;  1LB2 A;  3M1E A;  1FYM A;  3H5R A;  4G8X A;  2K02 A;  3F23 A;  1J0R A;  2R5Z A;  1VQ6 I;  3N4M A;  4AWX B;  3FIS A;  1TWF J;  3LFK A;  4B48 A;  2DJN A;  2DYS H;  1Y8Q B;  4AUX A;  1YW7 A;  1FYK A;  2ZJR F;  3MKZ A;  3BPV A;  2QM3 A;  4ZYA A;  1OYI A;  2O0Y A;  3WTY C;  3HOX J;  5M5Y J;  1VQ5 I;  1W5C C;  4PGH A;  3RJP A;  3GLX A;  3E5Q A;  1L3L A;  1J9I A;  2BXZ A;  2HQ5 A;  1NK2 P;  2LSO A;  2EFO A;  3S3N A;  1BC8 C;  1STZ A;  1E0E A;  2KMU A;  2WV1 A;  3BPX A;  2PFB A;  4CDG A;  2GA1 A;  2K27 A;  4HDU A;  2YUS A;  4UVC A;  4Y7N J;  1IXS B;  2HXI A;  2LDU A;  2E1N A;  4I99 C;  1VQO I;  2VBW A;  4NQW B;  3HOT A;  3JRH A;  2XB5 A;  3QU6 A;  3QYE A;  4BXU A;  2NVY J;  3HXL A;  5LEK A;  5CVI A;  4TV7 A;  1SFO J;  1XGM A;  2DU9 A;  1M1E B;  4IVN A;  4CCJ A;  1S5L C;  3HSF A;  2DOD A;  1KQ0 A;  2CUE A;  3QAH A;  2FBK A;  2X6X A;  3F8B A;  3OYH A;  3FX3 A;  5FLX K;  2UXN A;  4KIF A;  4WXD A;  3OYG A;  2FQ3 A;  2OD5 A;  4B43 A;  3F8N A;  3BG3 A;  1RKT A;  4YIR X;  4IKF A;  1MNE A;  1T38 A;  2X6Y A;  1NHA A;  2NAZ A;  2DYR H;  4EEF G;  1GT0 C;  2KIQ A;  1SVO A;  2QQ9 A;  4ZTJ A;  2XAU A;  4XLF A;  4EJT A;  3AG1 H;  5CVR A;  1FY7 A;  4XOT A;  4A0Y A;  2O5R A;  2KKO A;  1VZ0 A;  1U2W A;  3TO7 A;  4UUS B;  1Z21 A;  4RS8 A;  3L9F A;  1RIO H;  5HVQ C;  3D1N I;  3TO9 A;  4QWQ A;  3FHZ A;  3CDI A;  1N78 A;  5DV5 A;  2Y30 A;  5LD2 C;  3K4J A;  3ZMZ A;  4B09 A;  1OFC X;  1Y39 A;  1Z77 A;  5D8K B;  2D1V A;  1TBX A;  1FJL A;  1IGN A;  1MDM B;  4HBL A;  3PQK A;  3I59 B;  2HFH A;  4OIR F;  1YFH A;  2K9L A;  2IJL A;  4KT5 C;  4JX5 A;  5BPD A;  3V8L A;  1YTY A;  2NVU B;  3FMQ A;  3KEQ A;  4ZYH A;  5B3S H;  4LLN A;  3K9T A;  1T39 A;  3X2Q H;  4BH9 A;  2QEX I;  5FLV A;  2LKS A;  2IGM A;  1FTZ A;  2BHZ A;  4ETS A;  5E18 F;  3TDZ C;  1T56 A;  2P0W A;  1HST A;  2NOG A;  1JHH A;  3GLL A;  4AM3 A;  4Y3O A;  3DU5 A;  3D5S C;  3OYJ A;  4HST A;  2XC7 A;  3ZQC A;  2X4H A;  2M1B A;  2M87 A;  3BJ6 A;  2DFH A;  3BCA A;  4YFN F;  3BDD A;  4ENK A;  3JRF A;  1VQK I;  1EH7 A;  2Q2E A;  2A6E F;  2KFD A;  2ECC A;  3KX2 A;  3J7Y J;  5HOD A;  2L7F P;  3ABT A;  3H35 A;  4ZDL A;  3ZQ7 A;  4CH7 A;  4E7L A;  2BEO A;  3LSH A;  1YOV B;  1V55 H;  1PUF B;  1X4P A;  3HOV J;  4LIV A;  4ZTF A;  2LP0 A;  1Y56 A;  3C2G A;  3K4M A;  2MD0 A;  3TP0 A;  2IGK A;  1GUU A;  2XF7 A;  2ZXI A;  3G6E I;  4HNU A;  1QA6 A;  4K2E A;  2L7K A;  2EWN A;  2MA3 A;  2P5V A;  3DTE A;  1D5V A;  5K5Q A;  2FNP A;  2H94 A;  3OR2 C;  3S16 J;  2L5Q A;  3DKW A;  2OF7 A;  1DPR A;  2BYV E;  1A04 A;  1FBS A;  2XKP A;  3T5X A;  3HDD A;  4N9I A;  2YPR A;  1R1U A;  2M8E A;  4HAM A;  2HDW A;  2KHM A;  3U1D A;  4H0E A;  1EKE A;  1Z3Y A;  2DA7 A;  3NAR A;  3EYY A;  2FBI A;  5ICE A;  1D0X A;  3N05 A;  2CH0 A;  3H0G J;  1KGS A;  3DEW A;  3V7C A;  4OIQ F;  2JJ7 A;  1IJW C;  3BR5 A;  1B72 A;  1DDN A;  1VFC A;  3WHC A;  2KRC A;  3K70 D;  2PBI A;  2OUM A;  2VE8 A;  3V7R A;  3LSR A;  4FET A;  5LHH A;  3NEU A;  2RNJ A;  2VOD A;  5FO5 A;  4E4H A;  3AKZ A;  1HKT A;  2RNG A;  2VJ5 A;  1YQA A;  4RLQ A;  3DPL C;  3K2A A;  3KYC B;  3CLQ A;  3TKY A;  3HUG A;  4QTR A;  1VQ9 I;  3BTL A;  1BR2 A;  2WAF A;  5F27 A;  3CMM A;  3H9J A;  4HW0 A;  2J5O A;  1RUN A;  4CIC A;  2Z1D A;  2BGC A;  1SD7 A;  2EIJ H;  2HWV A;  1SVL A;  2HNH A;  2VL8 A;  4DQ2 A;  1PYV A;  3MQ0 A;  2NNY A;  2LY1 A;  1HW5 A;  1R5H A;  4I76 A;  4PSW A;  1YO5 C;  2IW5 A;  1OCC H;  3GXO A;  2LRE A;  3IWZ A;  4FIS A;  4I7H A;  2GLO A;  1BBY A;  3BG6 A;  5HLH A;  5FLX Z;  1HW2 A;  5FJ8 J;  2IT0 A;  1O4X A;  3CES A;  5E1W A;  1OCP A;  2JTV A;  3A02 A;  4XBF A;  5KAF C;  4RGS A;  3H5N A;  4BY7 J;  2XF6 A;  1IF1 A;  2DA3 A;  4EJU A;  1VQM I;  1QO0 D;  1JGS A;  2HYG D;  3S1R J;  4PDK A;  1XMA A;  5H2F C;  3GVA A;  1BI2 A;  2Y0M A;  2WTE A;  3NWS A;  2V4J C;  3HYI A;  4DYQ A;  3LSK A;  2X1D A;  2LBF B;  1IRX A;  1V5E A;  4Y52 J;  4OU0 A;  3WTV C;  1KYZ A;  2DA6 A;  4C30 A;  1MD0 A;  1HLV A;  1S7A A;  1J09 A;  2BOL A;  3BG9 A;  1Z6R A;  1SAU A;  4CCL A;  3JR9 A;  1QNT A;  4HX8 A;  3GYH X;  2UWM A;  2WY7 Q;  2VB6 A;  3G1M A;  3BWG A;  2R93 J;  5JLW A;  2ZME B;  2Q1Z B;  3H9Q A;  5IPA A;  2FXA A;  1VQP I;  2W00 A;  1FOK A;  1D0Z A;  1CF7 A;  1V3F A;  1XMX A;  4E7H A;  4A3M J;  1GLN A;  2I10 A;  3EUH C;  2GOX B;  3RPU A;  3GTK J;  3FXU A;  2EZI A;  3QWL A;  2KIS A;  4U88 A;  2H8R A;  3D5L A;  4F92 B;  5L3G A;  4CYC A;  1MNM C;  3KZZ A;  5DUI A;  4BS9 A;  1U3E M;  1HC8 A;  3GTL J;  2HVS A;  2EIL H;  1YG2 A;  2LMD A;  3S14 J;  3IWF A;  3D5R C;  2X85 A;  3SFI A;  2EFQ A;  3W2V A;  4Y33 A;  4HNV A;  3GTO J;  2Z9O A;  4WXC A;  4NNJ A;  1ZGA A;  3F8M A;  5E3N A;  1ZTR A;  3S8P A;  2LRD A;  3PNT A;  5FFZ A;  4U7D A;  4O6J A;  1WCM J;  1LE8 A;  3VFZ A;  2M4G A;  4UV8 A;  4EMS A;  3BCB A;  3V42 A;  4ENN A;  1S29 A;  3CLO A;  3DPT A;  3FBI B;  3A01 A;  1RRJ A;  2DPU A;  3PNY A;  4LK0 F;  5J3L A;  3JRG A;  3QP6 A;  2E34 A;  1FLI A;  3SZT A;  1SC7 A;  2R7S A;  4BXX J;  2ID6 A;  4BY1 J;  2LTP A;  2MFZ A;  5IOZ A;  2G7U A;  1IV6 A;  3QQA A;  2F6C A;  1K7A A;  3OYB A;  3HZJ A;  3W6J B;  2LR8 A;  2TDX A;  3PIO F;  1GV2 A;  4B47 A;  1GHC A;  5BQT A;  4OAZ A;  4Q4Z F;  4IHS A;  4D7M A;  5ICF A;  2R7U A;  2DFE A;  3M1C A;  2K86 A;  2ISZ A;  2PEX A;  1ZYR F;  3JRD A;  2DQL A;  1P4W A;  4PUS A;  4EV0 A;  2KJB A;  1YX3 A;  4D9J A;  2DOA A;  5EEA A;  1KQ8 A;  2HPI A;  3CUQ A;  3NAU A;  1LEA A;  4AIJ A;  1Y8R B;  4QIW N;  2RVC A;  1K78 A;  4U0V A;  3CCV I;  4RMN A;  1U5T A;  1POG A;  5EG0 B;  2M4K A;  3PUB A;  2ZXW H;  2W84 A;  1MMA A;  4M9X A;  4DYR A;  1ETW A;  1KZH A;  2RQQ A;  3HIF A;  4XN0 A;  1JGG A;  3PSI A;  3TOA A;  1YJN I;  4M3G A;  3CC4 I;  4LMY A;  1H9T A;  1G4D A;  1WZ2 A;  5E3O A;  3L1P A;  2Y9Z A;  1IRZ A;  1BC7 C;  3QPL A;  2WB1 A;  4P5O A;  3Q3S A;  3OSG A;  2VXZ A;  1R5G A;  2VBY A;  3BZC A;  2E2H J;  2FOK A;  2W1O A;  4YFX F;  3ERM A;  3I53 A;  2ACJ A;  1L0O C;  3IHU A;  4FTH A;  1XMK A;  3OV8 A;  1TQI A;  2ZXJ A;  3OR1 C;  4D1Q A;  1Z67 A;  3H0D A;  4IRH A;  5DUK A;  2WBM A;  2HDC A;  3GX4 X;  3EPZ A;  3OYC A;  1AU7 A;  1QZZ A;  3F8C A;  4IOA F;  4B1R A;  3OL3 A;  5FD5 A;  3M07 A;  4G6Q A;  2R7F A;  1MW7 A;  5ED4 A;  1IDY A;  3I54 A;  2P8T A;  3ZOB A;  3BTI A;  2CRG A;  3ML6 A;  2NS0 A;  2K9S A;  2IBD A;  2XIG A;  3C18 A;  2OZU A;  4ZJZ A;  4JYK A;  4AIK A;  3MZH A;  2P6T A;  4KIS A;  1X4O A;  5B5E C;  1SFX A;  2DA1 A;  1TWC J;  5IT9 K;  3CME I;  1UJ8 A;  5FKK A;  1D1C A;  1P7J A;  1TLH B;  2XB0 X;  2IGO A;  5F08 A;  4OIN F;  4HG2 A;  1FMV A;  3FXJ A;  5J1Y A;  3EUK L;  1OYW A;  2VC1 A;  2L2O A;  5KK1 A;  3FXL A;  1ZLK A;  3VYU B;  2D5V A;  2RAE A;  4X1E A;  1USS A;  1J7K A;  3I5U A;  2JN6 A;  3I9V 2;  5HLI A;  2LD5 A;  4BDZ A;  4IHV A;  3CF5 F;  3BJA A;  2W85 A;  4E70 A;  1R71 A;  1TNT A;  3DKY A;  2YS9 A;  3COA C;  2V7F A;  3J80 K;  2CV1 A;  4N0B A;  2DN0 A;  2FEZ A;  2LY9 A;  1SD5 A;  2VXD A;  3LMM A;  1H0M A;  2Y9Y A;  3ABL H;  2L4A A;  4B8X A;  2BY3 A;  1VF9 A;  2RKH A;  5FRO A;  5GP9 A;  2TRT A;  3MMY B;  1B6A A;  2ESH A;  4ESB A;  2R92 J;  2LKP A;  3L2V A;  3IRR A;  3UR3 C;  4KFC A;  5GAG J;  5CPR B;  1OYY A;  3S1N J;  4XL9 A;  1BI0 A;  1NK3 P;  3FXO A;  1B9M A;  1JKP C;  4NHJ A;  2R7V A;  4IHY A;  4P96 A;  1QPI A;  2BW3 B;  2KRH A;  5DD4 A;  3F3X A;  2CWE A;  2V26 A;  1Z3X A;  1RC9 A;  2KLO A;  4HX7 A;  1I6X A;  4ZZD A;  3KEO A;  1AWC A;  5D6E A;  4B3X A;  4HA8 A;  4MFE A;  2CQQ A;  1OQY A;  3OWT A;  3W3C A;  4XR6 A;  5LGN A;  1TTY A;  3DLA A;  3OYL A;  5M3M J;  4RBO A;  3OIO A;  1VQ4 I;  1BW5 A;  2L7Z A;  4FHT A;  3KEY A;  4YIF A;  4FE7 A;  4CHU A;  3RDI A;  2O8K A;  4XIC A;  4OAY A;  3W2W A;  2DMU A;  4XRF A;  2AO9 A;  3V8J A;  2KZG A;  4HPQ A;  2VOO A;  1RR8 C;  3DBR B;  1EH6 A;  2JVG A;  1O7F A;  1SAN A;  3FK7 A;  1I6H J;  2V9P A;  1W4M A;  4MQ9 F;  2P5K A;  1TW2 A;  3PQJ A;  2GXG A;  4JX6 A;  2QSH X;  5GAH J;  5CVV A;  3KFW X;  2QCO A;  1MND A;  2VQH A;  4MEY F;  3BP8 A;  2JPC A;  2O61 A;  3DEU A;  4U0Y A;  1N75 A;  4R79 A;  3IP4 B;  4RM3 A;  1R9T J;  4DOZ A;  2HZT A;  4U0W A;  2ZXH A;  1BIA A;  4BL0 B;  2V1U A;  3J7A O;  1R23 A;  2GAU A;  3BR1 A;  4L5I A;  2HKX A;  2VPR A;  2VQL A;  4XQF A;  3O3K A;  5HLG A;  2HZD A;  2G0E A;  3N97 A;  4UUV A;  2X51 A;  1YE9 A;  3GTP J;  2D2W A;  1XB4 A;  4A6E A;  4RB3 C;  4BDY A;  2CV0 A;  5GTH C;  5GTI C;  3P9C A;  3HGY A;  4PCQ A;  2EZH A;  3E97 A;  3HOS A;  3RZD J;  4M73 A;  4NQW A;  4IQJ A;  2CQN A;  2XVC A;  4IZZ A;  4L9N A;  3F21 A;  3VOE A;  3F6O A;  2QSF X;  1MSF C;  3KP7 A;  3RCO A;  5BPI A;  3GCM A;  5IYB J;  5EZH A;  1O3S A;  1PDN C;  2XAG A;  5HNF A;  1K61 A;  1N25 A;  3FF5 A;  3MFK A;  1SD6 A;  4HYE A;  4A69 C;  2CW0 F;  1QZE A;  1W7P B;  2MG4 A;  1Z1D A;  1OR7 A;  5FFX A;  3HB9 A;  5FD6 A;  2L02 A;  2NYX A;  6PAX A;  2EB7 A;  2JA5 J;  2L4M A;  4ANJ A;  1C0W A;  3RPQ A;  3KYL A;  2A5Y B;  5DTD A;  3DQV C;  4G7H F;  1KQ9 A;  4RLF A;  5KHD A;  1LUJ B;  1LNW A;  2CYY A;  2ESN A;  2A68 F;  2I8D A;  2ISY A;  3MAJ A;  1Y6I A;  3ONQ A;  4UUS A;  3W6K B;  3BOQ A;  2H09 A;  2HXO A;  1Y0N A;  3LST A;  2VBZ A;  3OYF A;  3P7N A;  2QBY B;  3CD6 I;  1ZAR A;  3PO2 J;  1Y1W J;  4PZJ A;  4B4C A;  1IN4 A;  2L0K A;  1MDM A;  3K7A J;  3ROU A;  3E0J B;  2K9Q A;  3K2Z A;  5DCF A;  1S8N A;  3I59 A;  3LA2 A;  3LA7 A;  3AFH A;  5IT9 Z;  1UAA A;  4UY8 I;  3OS2 A;  1F9N A;  2V1N A;  4HRI A;  4FX0 A;  3VDX A;  1Q1V A;  3B02 A;  2BBY A;  3KP2 A;  1JTY A;  1JJ6 C;  2K9M A;  1RNL A;  3LSG A;  3BR2 A;  4NC7 A;  4LLG F;  1ONV A;  3E3V A;  1LDK B;  1UEL B;  4M9S A;  1X19 A;  1MBK A;  1R4N B;  2AQE A;  4EJO A;  2RRE A;  3HM5 A;  2W24 A;  1FTT A;  2XF5 A;  3C7J A;  3FMS A;  2O6G E;  3ZMU A;  1PVE A;  1D5Y A;  4O3M A;  1S3J A;  2NXN B;  3AL0 C;  3GFJ A;  3HRS A;  3J80 Z;  1BI3 A;  2XPV A;  3SZG A;  2MLK A;  2O3F A;  3TW6 A;  1B8I A;  4L5J A;  3C1D A;  5HOO A;  4XLC A;  2JSP A;  3T8R A;  5TJJ A;  2JWT A;  1TWG J;  2PJR A;  3ZQQ A;  3KZY A;  1BJZ A;  1WI3 A;  3L7W A;  5IP7 J;  3CJN A;  2DA2 A;  1TZL A;  2ZB9 A;  5M5W J;  2AXL A;  4KMU X;  5ERI A;  3VEP A;  3JW4 A;  4M3B A;  2DXI A;  1XDU A;  2ME6 A;  2H1L A;  4XSZ F;  5DCM B;  1ETV A;  4II2 A;  4AVP A;  1FIP A;  2RC4 A;  2CW8 A;  1ZGJ A;  1U6G A;  5E17 F;  1WHU A;  1BN5 A;  2DFI A;  4J01 A;  5CQE A;  2E1O A;  4KDP A;  2HEO A;  2HR3 A;  2PN6 A;  3DPU A;  4F3Q A;  1LFB A;  2X1C A;  3ZRG A;  4IRI A;  1FZP B;  1GVJ A;  3GFI A;  1QVU A;  1X3Z B;  3BRO A;  2FUG 2;  2HKO A;  2W7N A;  1J59 A;  4EGY A;  3JTG A;  3B6C A;  4LIT A;  4OWR B;  4UB8 C;  2DPD A;  4BEH B;  5JVG F;  4PJN A;  3GBG A;  1B4A A;  2BVM A;  2IPQ X;  1T2K A;  3PFI A;  2YX7 A;  4XKC A;  3IL2 A;  3HPG A;  3A4C A;  5IP6 A;  1XX5 A;  2V6E A;  1ZKG A;  5D8L B;  4U7B A;  3RQ4 A;  2PG4 A;  5HLT A;  3HKZ N;  3WE3 A;  2WWY A;  1MIJ A;  1UB9 A;  1DUX C;  3FZV A;  3NWT A;  2VE9 A;  2EZK A;  3TP3 A;  3RKX A;  3GFM A;  4EAT A;  5DM6 F;  1HSJ A;  1D3Y A;  1R36 A;  1AKH B;  1U8B A;  1DU0 A;  4LG0 B;  1MGT A;  4OIO F;  5JVT A;  3R6S A;  2PMZ N;  2DBB A;  5EGO B;  3PUF A;  4RDU A;  3G3Z A;  3WU2 C;  1WJB A;  1Z9C A;  1WRJ A;  4F93 B;  1QHG A;  4RAG A;  3Q0U A;  4IJA A;  2JZY A;  1J5Y A;  2KQR A;  1IZ1 A;  4ABZ A;  2W48 A;  2XRN A;  5F0H A;  2STT A;  3CCE I;  2HOT A;  4UUT A;  3JRC A;  4B44 A;  1J75 A;  2OTL I;  4RAZ A;  3DV8 A;  1XGS A;  2ZKZ A;  4N9H A;  2CG4 A;  2K5C A;  2OJE D;  2FNA A;  4GXO A;  2Z99 A;  2IEK A;  2JSC A;  1JUM A;  5GPA A;  2MH9 A;  2GWR A;  2XSJ C;  1K83 J;  3G4S I;  2IS2 A;  3L00 A;  1P92 A;  1G2H A;  2JT1 A;  4UV9 A;  1X3W B;  3E6D A;  1R1T A;  5M5X J;  4F52 A;  2K3F A;  3HG9 A;  1KU7 A;  3CC7 I;  9ANT A;  2JVH A;  4NDL A;  1BOA A;  1Z05 A;  1OCO H;  2ZJQ F; 
#chains in the Genus database with same CATH homology
 3ERM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...