3ERMA

The crystal structure of a conserved protein with unknown function from pseudomonas syringae pv. tomato str. dc3000
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
67
structure length
67
Chain Sequence
VDRKLADAHDQMLELAELLTDVLIKNVPGLSEKHAEDASIYMAKNRAVFAAAFKNNATALSELSEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized conserved protein
publication title The crystal structure of a conserved protein with unknown function from Pseudomonas syringae pv. tomato str. DC3000
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
total genus 21
structure length 67
sequence length 67
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07130 YebG YebG protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.710 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A PSPTO_1197 like 3ermA00
3ERMA
chains in the Genus database with same CATH superfamily
2G0EA 2VXZA 1J7KA 3CUQC 2JA7J 3DV8A 3GTJJ 3LSRA 2RC4A 3IAS2 3PNVA 4I98B 4C9YA 3HSEA 5IYDJ 3MFKA 2ECBA 2JA2A 4I7HA 2F6CA 2K9QA 4EJOA 1VQ9I 2CQKA 2VE8A 2DDBA 3ERED 4KIFA 5FLMJ 2JRMA 4WK8F 5IYBJ 4DW6A 4EJUA 3CCLI 3LWFA 3TOBA 3GLLA 3EETA 3DTIA 4Y4RA 2DBBA 2PG4A 1YJ9I 1IUFA 4HF1A 1RKWA 1R58A 2L0KA 3HUGB 4UVCA 3HOTA 2H8RA 2XAGA 1DU6A 3QP5A 1TP4A 2EBIA 4A69C 4CZZA 1RESA 2FQ4A 1B9MA 1N78A 4AU7A 4BJ6C 3OYIA 3ULQB 2STWA 2FNAA 1S9HA 2E19A 2P7VB 2RNJA 4WWCA 3B02A 4YIFA 3O8HA 1B72B 1TWHJ 2MYSA 4W97A 2N8GA 3IRRA 2G7UA 3S1RJ 4AIKA 2COMA 1P4XA 1UCRA 2EFPA 4OU0A 1SVLA 2XF7A 1OMIA 3PFYA 4NUBA 2YPRA 3F8FA 3JREA 1I5ZA 2JT1A 5LHGA 1MJ9A 2V4JC 1IN6A 3ONQA 5C3EJ 4DYCA 1ETOA 2PMZA 3C18A 1J2XA 4HSRA 4JX4A 4O6JA 4RMNA 3AFHA 3GZNB 1UG2A 3W2VA 2E1OA 4UUSA 2V26A 2STTA 1OJLA 4Q47A 5M5YJ 1LEBA 2XGEA 2H8WA 4XNFA 1NK3P 3H3UA 1TWAJ 1ZRCA 2NNNA 1ULYA 2CQNA 3L2CA 5F6FA 5L3EA 2KMUA 3S1NJ 2HYGD 3L2VA 2AXLA 5D8KB 1OR7A 1QZYA 1WJDA 3TEDA 2LBFA 3O3KA 5FKOA 3ZR8X 4A3LJ 4F7ZA 5EDNA 2VN2A 1E3PA 4YG2F 4KT5C 1SFKA 3WU0A 3SYTA 3NQOA 3I4MJ 1Z91A 4Z6YA 4BHBA 1G59A 4UUVA 4E70A 3GTGJ 1ZELA 4BKXA 2X1CA 3K1NA 1QGPA 2XB0X 4IHWA 2VOOA 3HC7A 3K4NA 2M30A 1P6RA 1YQAA 3GMEA 3SZPA 3ZGKA 4BYYA 1H9TA 2XDVA 4KUMA 3L9FA 4WF2A 3L00A 1BL0A 1SFEA 3OSFA 1OFCX 1R22A 2DTRA 3DEEA 5J40A 4U87A 4I6ZA 2GOMA 3GW2A 1T8IA 2WV1A 1TBXA 4E7ZA 1MSEC 3BQZA 3M3YJ 5H2FC 1Y0UA 2BE5F 3CCQI 3OR1C 2XASA 2UV1A 1S5LC 4MLOA 2EA4A 5ICFA 2IA1A 3OYFA 4Y3OA 4JX6A 3H3VK 1GLNA 2Y31A 2VKDA 1ETXA 2X6XA 2DA3A 2X6YA 4C3IJ 2IT0A 2K3PA 2M4KA 2OQGA 2OA4A 3CJNA 3WTTC 3F6OA 1RKTA 2IAIA 2LY2A 1HW5A 1Y6IA 4N9IA 5CVVA 2XGCA 2ZFUA 4DYQA 3DKXA 3FMQA 4U0VA 1SVMA 1Z3XA 4J19A 2ZXJA 3OYCA 2QKMB 1MNMC 2I10A 2EFQA 3U9GA 2NRAC 2Y0SN 1DU0A 1OCCH 3E6BA 1HLVA 3N05A 1FMWA 3SEQA 5TGTA 5CVRA 1YW9A 2GAUA 4OAYA 2E7WA 3CLOA 3F3XA 3CJRB 2FBIA 3VB2A 2KLOA 2HTSA 2K9LA 4ESFA 3IV5A 1O57A 1U9OA 1F5TA 2ZC2A 2L9RA 2JPBA 2KQRA 4XBFA 4C3JJ 2JMWA 5K5QA 1K83J 3RJPA 4ZJZA 3S32A 1FSEA 3K9TA 2M45A 3HPHA 2Q8KA 1CQTA 4RGSA 1HA8A 4A3CJ 3PIOF 3LSMA 3ABKH 3BZCA 1MBGA 1WZ2A 1ERDA 3GO5A 4RGRA 1O3SA 2R5ZB 3OYGA 4BAYA 1E3OC 2OTJI 2HS5A 2EV6A 1UELB 5FO5A 1YG2A 3C7JA 3Q9SA 4E6KG 4BE1A 2DYSH 2E34A 4NNJA 2NAZA 2JUCA 1T39A 4LK0F 1S29A 1OR7C 4M3GA 5ILVA 4AVPA 2P4WA 3G73A 2WWYA 3IHUA 4HNUA 1RETA 2K02A 1I39A 2KISA 2HYJA 3ABMH 2QF7A 3DLAA 2P6TA 1BJZA 3GXOA 3LA7A 4ZYHA 1S3JA 3B6AA 4DOZA 2ZMEA 3K4KA 4LLGF 3FKIJ 5HLHA 5HNHA 4XIDA 2MBFA 5A2QZ 3PUBA 3C2GA 2AHQA 4M73A 4A3MJ 3HXLA 1VQMI 1IRFA 2TDXA 1A04A 2K7LA 1SAXA 2DFHA 3P9CA 2LKSA 1TZLA 2X48A 3QPLA 2Z2SB 1B8IB 3AL0B 4BS9A 4XL9A 4OMYA 3TQNA 2NS7A 1IN4A 1B1BA 5DEQA 3JRCA 2W84A 1IV6A 1LVKA 4II3A 3FHNA 1KQ8A 1P2FA 3COAC 4B3XA 2MGQA 4DIQA 3OIOA 2XIGA 1Z0XA 1JT6A 2Z1DA 3GZ5A 2AQFA 1SD4A 1K4SA 2P5VA 3CTAA 5L3DA 4NBQA 1R7JA 1TW2A 2ETHA 2EV0A 2V1DA 2ZNZA 3V7CA 1WFXA 3TW6A 1Z6RA 3BROA 3TP3A 1N77A 2Y30A 4KT6A 5DD8A 2X1DA 2KRFA 2H09A 3GZ6A 5FRNA 2JVGA 2E5ZA 4BEHA 2DJNA 2VPRA 1U2WA 3O2PE 2E36A 3WGIA 2XPWA 1JUPA 1XDUA 2O03A 3A4CA 3GWZA 1R1VA 3MKLA 4BQQA 1G2HA 4XKWA 2XAHA 1U78A 3J80Z 2PBIA 4X6AJ 2HGCA 5EZHA 1QBJA 4KMFA 1IRZA 2ESHA 2YR2A 4IEJA 4LIUA 4A6EA 3R61A 2P81A 2K3FA 1A35A 2FX0A 2FBKA 1VQPI 3RDIA 3JSOA 2Z16A 4L9VA 1IXCA 2XKPA 3WTYC 1BN5A 4CCMA 3CMYA 3ASNH 3FK7A 4RGXA 1FX7A 3MQ0A 5H6QA 3JRDA 3H9QA 1BOAA 4IHTA 2K85A 4RB3C 2L7FP 3QAHA 3G2BA 5IOYA 5DTDA 2DTZA 4M71A 4ZH4F 1BA5A 1X2MA 3KP7A 2XRLA 2OQRA 3KEYA 2DJIA 3I58A 5L3GA 1WJCA 3LSIA 2OV7A 5E1ZB 3RKQA 1QVUA 2DA5A 2ZMEB 3CD6I 3BR3A 1ACIA 4UVAA 4CXFA 2ZMEC 1MH3A 2HDCA 2VI6A 5BQTA 2L9VA 4XSZF 1ZR2A 1B6AA 1IF1A 1P7IA 3HL2A 3SZTA 4D5FA 4PFOA 2H6BA 4ENJA 2VASA 2LSOA 4OINF 4KICA 2Z99A 4PSXA 3HOVJ 1GUUA 5E20A 2MG4A 2A05A 2K9SA 2FSWA 2Q1ZB 3IC7A 4KMUX 2FBHA 3PM1A 1LNWA 4KISA 1H0MA 3GTPJ 2H6CA 3Q9VA 1QPIA 1VNDA 2VB6A 1FIPA 3DF8A 4M9XA 2NXNB 4LOCA 3BC8A 2BHYA 2VJJA 2V1XA 2MH2A 2VT2A 5TISC 4NC6A 2QCOA 3KYCB 4XONA 5DCMA 3LSKA 4ZDPA 4MTDA 2KDOA 1R23A 2FA5A 4XKVA 4KYWA 1FSHA 1K61A 3E3VA 1HSTA 2YU9J 1OCOH 1XGOA 4BEHB 2LTPA 2JRTA 1HSJA 2ME0A 4MHGA 5M5WJ 2IJLA 3ASOH 4KIGA 2PQ8A 3QU6A 4QIWN 1JKRC 4BH9A 3S2DJ 1XCBA 3W6VA 1RI7A 3BJ6A 2BW3A 2ZJ2A 5HDKA 1BC7C 1VFCA 9ANTA 5JFRA 1BI1A 1F9NA 2R7QA 2WA0A 3ROUA 4LB5A 1RRJA 5JHUA 3WTUC 1FIAA 1JJ8C 1RNLA 3K70D 3WG7H 4C2MJ 4U88A 3A2KA 3D0SA 1XGSA 3FXJA 1P4WA 1X4OA 4RAYA 5K5OA 4A3FJ 4Y52J 1ZN2A 3PUFA 1T33A 3WE3A 2CFXA 3K7AJ 4W1UA 1H8AC 2HPIA 3ZRGA 1LE8A 2HWVA 4D9JA 3CMMA 2L2OA 4ON0A 1AWCA 4MEYF 4NC8A 5AIPA 1I1GA 3ERMA 3WTXC 2BY0A 3E6DA 2A5WA 2CU7A 4I01A 3LNQA 3ZQFA 5LLQA 3T0YA 3BG9A 4Y17A 2PJPA 3J81Z 2GOXB 4RAFA 3AKZA 3S2HJ 3SHFA 2X9DA 2RKHA 3WTZA 5F0CA 3PJRA 2PEXA 3B6CA 1U0JA 5EYRA 4BACA 1H88C 5LD2C 2V9KA 2EIKH 3M9AA 5LFAA 2GM4A 2MH9A 1I1SA 2BHZA 4MFDA 3BZ6A 4M72A 2ELHA 1WJFA 4I2OA 5HLGA 2GZWA 1SVOA 3BG5A 3ML6A 3CCEI 1DUXC 3GCMA 3FHZA 1SANA 2JQ7A 1ZYRF 3BOQA 2NVXJ 1B59A 4GCVA 5F0HA 1L0OC 3T8TA 2C6YA 2GWRA 1K78A 2H94A 2LKXA 3MWMA 2M34A 2XAFA 3QQAA 4HAMA 1X4PA 5FD6A 2VKHA 5FLVA 3ZN0A 5HVQC 2BY2A 4LG3A 1IG7A 3M07A 4KNYA 2QSGX 3BTLA 1MBJA 2ZXIA 4HLYA 1KZHA 2LMDA 1WVRA 2RGVA 4FE7A 2YS9A 5FKNA 1MBFA 2E1CA 2R7XA 2CS3A 1RIOH 5IY5H 1J9IA 2WC2A 3LQRA 5FROA 1G3YA 1PUEE 3HB9A 3LAPA 1YITI 4L0YB 1X1DA 3HHHA 5BOXA 2JSCA 2A07F 4L0ZB 3SFZA 2XROA 4IZZA 2E2IJ 1P9QC 2R7FA 3TO6A 2BV6A 3IUOA 4CCJA 4D1QA 3S17J 2UZKA 1IXSB 3T5XA 2DK5A 5J8FA 3I59B 3IH3A 3R6SA 2L9SA 3V8JA 4ZDLA 3HPGA 2P8TA 3VFZA 2ZXWH 2EQRA 5DD4A 2BGCA 1SD5A 1XB4A 2QQ9A 3C2HA 3EUKL 1E3HA 2CO5A 2E7XA 3NARA 4ENKA 4IHSA 4U7DA 2ICWG 4RLQA 1X1AA 3BDDA 3CMAI 3BY6A 2R7TA 3FM5A 5H6RA 1YS6A 2ZJQF 1XD7A 5GAEJ 3S3OA 3BR1A 2DFIA 2VL8A 4LITA 1W5SA 4PJLA 4V2GA 2UXNA 3EDPA 4XLCA 4FX0A 4GYIA 1O3RA 2YUSA 1YTYA 4P9UA 1EH6A 4OMZA 4XLPF 2PX9A 3ABLH 3BTCA 1U8RA 1ZRFA 2MABA 4C30A 3E6MA 1BIAA 5D5WB 2E1NA 4IQJA 3OSGA 1QO0D 5IT3A 2EA2A 2A61A 4IPAA 4AYBA 1TWFJ 2V7FA 1QHHD 3PO2J 5LBQA 3MKYB 1OYWA 4QSHA 3CUQA 4EJVA 5EGOB 2D45A 1Z6TA 2FOWA 2ZBKA 2L54A 2Y69H 1MZBA 3RPUD 4ANJA 1H89C 2V1UA 2DT6A 4RS8A 2OAZA 5IT9K 3KZYA 2CRGA 2R3SA 1FP1D 4DNCA 2HVRA 5HLIA 4HV6A 2GA1A 3PNYA 4OIPF 1D5YA 3JRBA 3CCVI 2L5QA 4Y13A 4XKCA 4IRGA 3DKYA 4NB5A 4KDPA 2MC4A 5L3FA 5GTHC 1MMSA 3FBIB 3UNGC 1XSVA 3HUGA 1JKPC 4I0AA 3BCAA 3HOWJ 1R5GA 2DYRH 2HDDA 1AOYA 3IKTA 4BDYA 3W3CA 3OYMA 2EFNA 3OYEA 4IXAA 4UVBA 4UNOA 2EWNA 3OWTA 5E8IA 3HOXJ 1DPRA 1R71A 1BR1A 2HQRA 2W00A 5LGUA 3JRFA 2KJCA 2LY1A 1LFPA 2DPDA 4LLNA 4E7IA 2FE3A 2J5OA 2LP0A 4PK4A 4R1HA 2XB5A 5DV5A 2XAUA 4DYRA 2EFOA 1YYVA 3HOYJ 3QYBA 4HX4A 2CH0A 1HXDA 4NDLA 3LMMA 1IDZA 1CGPA 3L1PA 2VJ5A 1AKHB 4V19K 1LEAA 3VYTB 4PFPA 3H1CA 1XSXA 3HRMA 3ZMZA 3IH2A 2BEOA 4F55A 1SC7A 5FKMA 1QZEA 3LFKA 3QODA 3WG9A 3MVPA 3ZMDA 3CZ6A 3D5LA 2COBA 1ZQ3P 1GVDA 4PCQA 3NAUA 2ZSHB 4CH7A 3E5XA 1PJRA 4NHJA 2LH9A 3WGGA 5E3MA 4A3JJ 5HDNA 4Q48A 4LFUA 4B48A 4FTHA 1JUMA 1U9NA 1YI2I 4ENNA 4XORA 3M8EA 1MMNA 1RC9A 1FWZA 2M87A 2DFFA 2BVMA 3SXYA 2P5LC 4HF2A 3BLYA 3DPUA 3WTWC 2DA4A 1L3LA 2WAQA 3SDBA 5LRSA 4JYKA 3RCOA 3J7AY 5FKKA 4B47A 5E8GA 2KIQA 4D7MA 2NYXA 5C44J 1IRGA 4EV0A 3IKVA 3TKYA 4QPQA 4BNCA 1UG0A 5LGNA 1LJ9A 1B4AA 1E17A 3ISPA 3P9IA 1FOKA 2DMPA 2XRNA 1ITYA 2A6HF 3H9JA 4FCYA 1WI3A 1BM9A 3QP6A 2DA7A 4XK4A 5DUKA 3ELKA 2ECCA 4RAGA 2FF4A 3EPZA 2A68F 5F1JA 1PP8F 1Q1HA 4CO8A 4BBSJ 1U5TA 5AIQA 2OZ6A 2R7RA 3HYIA 3KYDB 3GTQJ 1R4NB 4RA2A 4WCGA 4K2EA 1RUNA 3A01A 4E4HA 4IX7A 3DU5A 4DZJA 3MEXA 3V8KA 4HDVA 2F4IA 4TV7A 1P7JA 1GXQA 2IP2A 2WB1N 1ZRDA 1FOXA 4X0GA 2HOEA 2R5ZA 3K2ZA 1MGTA 3ABTA 2CMPA 3HG9A 5ICEA 1YS7A 2D1HA 3L7WA 1BOBA 3GTKJ 4BXXJ 1FP2A 1LDJA 2IW5A 3FXMA 4BXUA 1PUFB 1PDNC 3CP2A 3VSKA 4CSWA 2Z9OA 3ZMVA 1D0YA 3G4SI 1CF7B 3F0CA 4J01A 2CFOA 4G6DA 3HOUJ 3BP8A 2XV4S 2DMQA 3IH4A 3LA2A 4N4OB 2PMHA 4ZDOA 3DQVC 1VQNI 3OY9A 2LVSA 2W7NA 3LSPA 1W5TA 1MBKA 1I6HJ 3FK6A 1OLTA 1HC8A 3TL4X 1B8IA 2V9PA 2DCEA 3VYSB 4XRSA 1R1TA 2F4OB 5EJCA 2GQQA 4G6QA 1IN5A 2IVMA 4G94A 3CC7I 2R7UA 3I9V2 2I8DA 4M3BA 1BR2A 2IPQX 3KP4A 2CW0F 3RI4A 3MCZA 4P1WA 1WJ5A 3IWFA 2V6EA 1D8JA 4IRHA 3U1KA 4XN0A 4HZFA 2XC7A 2XF5A 5KNLA 2K86A 1QNTA 4Y7NJ 4EGZA 2QENA 5DDGA 2P5KA 1PP7U 5IP9J 2FUG2 2L3DA 3RQ4A 1Y56A 4BQOA 1O4XA 1EJ9A 3T1BA 5K1YA 2DA1A 1HF0A 2W4SA 3JTGA 3CO6C 4UXNA 1ZG3A 1J5YA 2HOAA 2Q0OA 1DGWY 4XKBA 3KCCA 3DCFA 1U5TB 5D5XB 2R5YA 5HOOA 3GBGA 1ETQA 1TWCJ 2K9MA 1NTCA 1U5TC 5E3NA 3A01B 2M2EA 1BJAA 3P7NA 4EMSA 3MMYB 3F72A 5GP9A 3CQZJ 1O7FA 3KP2A 1IJWC 2OTLI 2Y75A 1ODDA 3V7SA 3CCRI 4ESJA 1W0UA 1JJ6C 1J75A 4F92B 2KZVA 1FNNA 2BBYA 2QGUA 3IAM2 3IRQA 1VQOI 1I6XA 3QU3A 2Y0SA 1NH3A 3V4GA 4AIDA 1BI0A 4CICA 3P5JA 2VQGA 1MNDA 2XGDA 4HF0A 4A6DA 2DMNA 2HEOA 1TNSA 3M1EA 3R0AA 1WRJA 2XSDC 2JA6J 2HI3A 3FXRA 3JRAA 4B3AA 1VQKI 4F91B 3B73A 4UB8C 3HKZN 4G7OF 2ESNA 3L2QA 3SDGA 2M9HA 4S04A 5CVUA 1FBQA 1REPC 3O8GA 1T0FA 3H5RA 3W2WA 1Y0NA 3U21A 1OYYA 3K4LA 4XRFA 3HGGA 2IXSA 2VQCA 4BHPA 3IL2A 3SQNA 5JLXA 1IGNA 1OCTC 1QA6A 3AL0C 2E60A 4UV9A 2Q2EA 1YJNI 4HG2A 1XDSA 5F0FA 1A6IA 2ZKZA 2CV0A 4L5IA 1ZK8A 3R0JA 4EGYA 2CUJA 5GAGJ 3OYJA 1MSFC 2ZFWA 3H0GJ 2IRFG 3JAMZ 3G3ZA 2R93J 3TO7A 1KU9A 1U6GA 3RKYA 4E7JA 1K4TA 3PL8A 2LC2A 2BXYA 3MD2A 3TOAA 2RV8A 5KAFC 2CV1A 3CDHA 1TT0A 3H92A 4O5VA 2ZSIB 4V2FA 5A2QK 3CC4I 1Q1VA 4DGWB 5FLXZ 3JRIA 2DW4A 5EEHA 2PN6A 4MGRA 1DPUA 4PUSA 3OS1A 5CJ9A 5M5XJ 1FMVA 3WHCA 3GX4X 5EG0B 2W48A 1ZGAA 1AHDP 2R7SA 1FEXA 4U0YA 4GO1A 2R5YB 1QHGA 2KRHA 2O8KA 5JLWA 4AVZA 3CO7C 4GRIA 1W7PD 3SZGA 3CDLA 1KA8A 2ADUA 1FJLA 1IV8A 2YX7A 3CCUI 4IO9F 2VPLA 2ELKA 5F1RA 1YLFA 3FM3A 4FX4A 1XTAA 2L7KA 4B43A 3K1MA 3JRHA 1JHFA 3TDZC 1K6OA 5J1UA 1D8KA 5J6XA 5E1WA 3H9GA 4LD5A 2VQLA 3LSGA 5HDGA 3RZOJ 3OL3A 1Z1DA 3OV8A 3RSNA 2EB7A 2F4MB 4PGHA 3S1QJ 1VQ6I 1R6RA 2DOEA 1HBXG 1XMKA 2OBPA 2CJJA 3ZXSA 1BIBA 3O6BB 4M6XA 1IZ1A 4HNVA 2NS0A 4XLAA 5GAHJ 3DTKA 4LMYA 3J80K 5D8LB 1U3EM 3S93A 4MIMA 5BNGA 5JVGF 3BJOA 4UV8A 4H0EA 3S1MJ 2DN0A 2KKOA 5B5EC 2OU2A 3BR0A 2DT5A 5LHIA 3BCBA 1XN7A 4XLNF 5E18F 4HNTA 3W2AA 2J5PA 1Y39A 1G3TA 1XG1A 1T0FC 4M6VA 3DU6A 4ETSA 2ME6A 3ABUA 4M6YA 4E7KA 3KEQA 3GVAA 1VQ7I 2VQHA 1O3QA 4IVNA 2IA0A 2K27A 2Q2EB 4A0ZA 3ECOA 3HOSA 1KGSA 2KP6A 4AWXB 1D0ZA 1QVTA 5K7HA 2ZNYA 1IC8A 2R4GA 4E7SA 5GTIC 4O3MA 1D1AA 1UMQA 2EK5A 2HZDA 4J00A 3KLOA 5F27A 3GTMJ 2P0WA 1ZREA 1TQIA 1RR8C 1R9TJ 4L5JA 3K4CA 1LQ1A 2A3SA 2DU9A 2KIUA 2QVOA 2BOLA 1T2KA 4A3DJ 3K70C 2CSOA 4AC0A 2YX4A 3LSHA 2BXZA 6PAXA 2IS6A 2CUZA 1WGXA 2IGNA 5HS8A 3BR6A 1LDKB 1HDDC 1HDPA 4MFEA 3LFUA 5K5RA 2MD5A 1HW2A 1TQPA 5ICCA 1S7OA 3MAJA 4BQAA 3ZMTA 1ZLJA 1VQ4I 4Y15A 2L7ZA 2F5EA 1TL8A 2O3FA 2YU3A 2CYYA 4D0PA 2KZGA 2R7DA 2KIFA 2IGOA 3I59A 4LG0A 1R49A 4YEJA 2E5NA 1W1WE 3K69A 1MIJA 3BPXA 1XX5A 3NEUA 1VF9A 3D5RC 5GPAA 2MLGA 3BR5A 2LY9A 1Y1WJ 4B8XA 5FB2A 2VBZA 3ZQLA 4CUGA 4ZYGA 3NWTA 1ETVA 4PZJA 1O7LA 2RQQA 3OR2C 4QTRA 2LD5A 4JX5A 4BY1J 1FYKA 2A6TA 3QOEA 1S7EA 4XOTA 3H3ZA 4WXDA 3RPUA 1JT0A 1Y1VJ 4PJJA 3RTRA 3REOA 5B1BH 3GFLA 1ON1A 3CDIA 3QYFA 1D5VA 1P4AA 5LEJA 1OQYA 4N0BA 4M3DA 1K79A 5DCFA 1I3AA 4L9JA 1W4MA 2JJ7A 4BXFA 4F52A 5IP7J 5IYCJ 4IOCF 1A6QA 1IAWA 2JPCA 3TBIA 5EGOA 1U8BA 1QU3A 2FMYA 1JXSA 1FC3A 2A5YB 4A93J 5JR3A 1Y8RB 2FMLA 3V8LA 3TGNA 4ZYEA 3A02A 1T95A 1EA3A 1DDNA 3E1SA 4CHUA 4H4KC 1IDYA 3S16J 5H20A 2MC3A 3HRTA 2JA8J 5J4YA 2VODA 2TRTA 3AG4H 5D6FA 4LB6B 2M1BA 4CYDA 1DQUA 4IHXA 1T38A 4YFXF 2H1KA 4RAZA 1NHAA 1V5GA 2KDZA 5HODA 3DBHB 2QEXI 2VC1A 1P92A 3KZZA 4B44A 2K40A 2HPMA 1YIJI 4HSTA 2LG4A 2VXDA 2DQRA 1LUJB 3J81K 5BPDA 1OCRH 1ZG1A 1UFMA 2VOPA 4HLXA 2X85A 1Z77A 4XRMA 2QQBA 3EUHA 1ZARA 1MNEA 1ZR4A 2CG4A 3CCMI 5EEAA 5E79C 4I09A 3QPHA 3N97A 2HQNA 1R4MB 3FIWA 4EVIA 1KU2A 2XGXA 3D1NI 4LG0B 3AG2H 3JCUC 4EJTA 2WAEA 1G4DA 3F8BA 2Y9YA 3IP4B 4XLEA 1KQ9A 4EM1A 4BUPA 3L2WA 4C2TA 2BY3A 2KRCA 1ZLKA 1QQIA 2GXBA 2GBYA 4EM2A 4ABZA 1UZCA 2EINH 3R60A 1TC3C 3OIQA 1J59A 3WGHA 1W36D 2FXAA 1AKHA 5LHHA 2WV0A 2AXTC 4LIVA 3CMEI 3DPLC 5AONA 3JSPA 3F6VA 4Q4ZF 3BG7A 4YRVA 1T6SA 3PSFA 1W0TA 1V3FA 2F2EA 1NG7A 3BG3A 4HV5A 2EZKA 2BZTA 4MQVA 3ZQCA 3I4NJ 1V5FA 3BJAA 2AO9A 3NRVA 4HDUA 1RUOA 1ETKA 5CKTA 1NK2P 1GHCA 1BR4A 4CCKA 2LF7A 4XRSG 4G7HF 1LPQA 1BI2A 1V4RA 3F23A 2ISYA 5LGTA 3UR3C 2XSJC 4B1RA 4A12A 2NNYA 3ZQ7A 3RYRA 3M7GA 4E7LA 3CF5F 3OS2A 2P6SA 2JK3A 4JQFA 1YJWI 2HR3A 1YE9A 3QWLA 5ILSA 3G71I 4LK1F 2LRDA 1LFBA 3CLQA 4X1EA 2JUGA 3MZ8A 2VBXA 2XPVA 1PVEA 2DMUA 3JW4A 1YHQI 1T08B 5JI6A 4CCNA 2PMUA 4XOPA 1MH4A 1FBSA 3ZQHA 1E0EA 3TMOA 3K0LA 2LREA 1HKTA 1F43A 3V42A 4DBQA 4A3IJ 2M3AA 2LYCA 1Z7LA 2QLZA 4BY7J 2EIMH 5FJ8J 3V7RA 4IF4A 1UHMA 3Q3SA 3WTVC 2FU4A 3PSIA 5L3BA 2F5VA 1MMDA 3EUHC 3QYEA 4BQNA 1MMGA 3OYNA 1D1CA 1TW3A 3MN2A 5EF6A 4C2UA 3VYUB 4AD9A 2V9VA 5BMZA 4B4CA 2VIXA 2FOKA 2OCEA 4CYCB 2RAEA 2Z33A 2FD5A 2W25A 3I55I 2XVCA 1JKOC 2HKXA 4HEA2 3GFIA 1WCMJ 4U7BA 1J0RA 3G1MA 1R5ID 3ZPLA 4A3GJ 1Z05A 2EV5A 3FXUA 3OYHA 3SEZA 2D5VA 2V6CA 5D5UB 3E5UA 1XMAA 2R7OA 3C3WA 3LAJA 2MSYA 3K10A 3F8CA 5GADJ 1KONA 2GXAA 2FEZA 1I50J 2IS1A 1PUFA 2NVQJ 2WY8Q 1YW8A 3HDDA 1CF7A 1KYWA 1B9NA 1FOYA 1WHUA 2K4BA 2K4JA 3HM5A 3KZIC 4P55A 4BGDA 3DTEA 2ACJA 4G12A 2JSPA 2HQAA 4P9FA 2CQXA 2L7MP 4EQQA 4KITB 2L01A 2DT7B 1SD7A 1ONVA 2DOAA 4N4NB 3CCJI 3I4PA 2QQAA 3J7AO 3CUOA 4A5MA 1G3SA 3BWGA 4BJ5C 2LF8A 1JE8A 3DWLE 1YRNB 4ZYAA 1YFHA 1EH8A 1FT9A 4HX7A 1N75A 5J1YA 2DXIA 4IHVA 3K4BA 5BS6A 3ZQQA 2OD5A 2R0QC 4GGGA 3J7YJ 2HFHA 1HOMA 3HTUA 4ZZLA 3PQJA 1YO5C 1QPMA 2E35A 3GFJA 4DBRA 2ID3A 4YELA 4MNUA 2MLKA 1XSDA 4JOMA 2GIVA 2PMZN 2W24A 4EATA 4XLHA 2X1EA 3FBNB 2HOSA 3MZHA 2E1MB 2XUBA 3LOCA 2O5RA 2LR8A 4G6TB 5E3LA 4PDKA 2E1MC 3I54A 4NC7A 1OCZH 4FHTA 4AIJA 1WSUA 1RPWA 4XMYA 3RKXA 4BBRJ 5ILUA 3Q0WA 2DI3A 4EM0B 1GV2A 2WBMA 1ETWA 1XS9A 3KPHA 3RKWA 2FRHA 4FE4A 2P7CB 4IRIA 4M3EA 2GXGA 1S7AA 4D5CA 2WY7Q 1BI3A 2DFEA 2JVHA 4XQFA 5BPIA 3G1LA 2IS4A 2XF6A 3QRFF 2HYFA 1O3TA 3FXQA 2O61A 5HNFA 4GXOA 4XLFA 2OF7A 4BE2A 3HHGA 1MMAA 4KN7X 4NQWB 1FTZA 2F5FA 3ZQGA 4CA0A 1XMXA 4WXCA 4IKFA 5JHFA 2KIMA 4ZYDA 1ON2A 2IA2A 1SFOJ 1FLIA 2R92J 1A5JA 2VUMJ 2WAFA 5HLTA 3S3NA 2NVTJ 1VQ8I 4D7NA 1LB2A 2HXIA 1POGA 4RM3A 1G6NA 2GLOA 4M74A 2PJRB 2XHKA 3WU1B 2OUMA 2X0LA 3EYYA 1GVJA 3BZKA 3GUDA 1VQLI 1SMTA 2YSRA 1MBHA 3L09A 3T8RA 2R7ZJ 2X4HA 1HKQA 2B9SA 4G9YA 3TO9A 2RQPA 5EZGA 2JTVA 2CWEA 3GEZA 2VKVA 4C3HJ 4QPOA 5KHDA 2DAOA 5D4SA 4OIOF 4AIHA 1IN7A 3ZQIA 5E3OA 1YIOA 4YIRX 4QLCU 2O8XA 4HA8A 5CQGA 1Z21A 1V5EA 2KFDA 2PI0A 2WB1A 4F93B 3KE2A 3PFIA 1DP7P 2F5CA 2BVLA 2R7VA 2ZO4A 4ZC3A 4GDFA 1YW7A 2ISZA 2NOGA 3OMYA 3SJMA 1STZA 3OYAA 5B3SH 5DUIA 5LRRA 2A6EF 3DLLF 4UY8I 3K4JA 4JBAA 1LFUP 1S6LA 3FF5A 3F22A 3Q0UA 1KU7A 3DXJF 1W7PA 5DS9A 2OPTA 2W85A 2GA2A 2OZUA 3D5SC 5EEGA 1IO2A 3AAFA 1UHSA 1XPXA 1X1BA 1ZHFA 3DFGA 1I27A 2NVYJ 1R5HA 1BC8C 3LSTA 2UXXA 1JGSA 2IBDA 5EG0A 3C2BA 4HX8A 2CQ7A 4B09A 2LKPA 3HIFA 4XICA 2CV2A 3JTHA 1DP3A 3K6GA 2RDPA 5TRDA 1X1PA 1H9GA 2H1LA 1XC5A 2QWWA 4U0WA 3VSLA 1OPCA 1LDDA 4EJWA 4IJAA 2WADA 4UB6C 4YIIA 2RREA 4LGWA 3E5QA 4WX9A 5M3FJ 3HTSB 2X6WA 4RB0A 2HNHA 5CVIA 1MD0A 4GYGA 2EFWA 4CZCA 1NG6A 1F36A 4ASNA 4CGZA 4OAZA 1TNTA 1X3UA 1IUYA 1MBEA 5IPAA 5IOZA 5C4XJ 4UUSB 3JRGA 1PYVA 2CW7A 4I02A 3CF2A 3AG1H 1VTNC 4OWRB 2JN6A 1HKSA 1WJAA 1KYZA 3BR2A 2IGMA 5HS7A 1YOVB 1XCVA 3CP8A 1RZ4A 2F5DA 3WE2A 2DK8A 3RIRA 2DQLA 2ZXHA 2LBFB 3FXLA 1Y8QB 1XGMA 3L2UA 3GF2A 4PSWA 5J8CA 4GFBA 2FQ3A 4HYEA 1E2XA 2HDWA 2HKOA 2VJ4A 2M8GX 1JUSA 2OJED 2QSHX 3WODF 2O7OA 1ZH5A 1G8XA 4HBLA 4PJNA 3DP7A 5FFZA 5L3CA 1MKMA 3FWEA 1R1UA 3OL4A 1FTTA 3E6CC 5JVTA 3ESWB 4RGUA 4UUTA 4CCLA 3DEWA 1WKMA 3CJTB 4A3KJ 1TWGJ 1J09A 2KPMA 3ZMSA 2DLLA 1WH7A 2TCTA 1W7PB 3BPVA 1BW6A 4RDUA 3VPRA 1Z9CA 3PO3J 1ZAOA 2L4AA 3HKZA 2O6GE 4II2A 4L5EA 2NOJB 5J3LA 2RNGA 1X19A 3L2RA 4DJAA 3HSRA 2Y0MA 2XPUA 1T98A 4R8HA 2EH3A 4M9ZA 1UB9A 4F3QA 2B7EA 2IS2A 4MEXF 3KLNA 2VBYA 5KK1A 5ICGA 2E71A 3DPTA 3G1OA 2BYVE 5KAIC 3A0HC 1IN8A 1MW7A 4MQ9F 4Y33A 3KETA 2HOTA 1TT5B 2HQ5A 3VYRB 4A0XA 4R79A 2A69F 3JAMK 1IW7F 1A36A 2AQEA 2VBWA 1V54H 3OYDA 4L18B 2IEKA 2UWMA 1AA7A 2M7AA 2DODA 2LK2A 2JA5J 2W82A 2QYOA 3LQQA 3I5UA 3CESA 4UHTA 3VWBA 3AG3H 1ZKGA 2HZTA 1SMYF 2XKOA 1WJEA 4LJZF 5FLXK 1F1ZA 3GFMA 3Q0VA 3X2QH 5CQEA 2EILH 1Z3YA 2UUZA 1JTXA 5J1RA 1BW5A 2QZ8A 3FMSA 4HQEA 4P96A 2ZJRF 2EJRA 4FQGA 3OYBA 5K7ZA 3OYKA 3TW7A 2E2HJ 3I56I 1FPQA 2FNPA 3N4MA 2H27A 2B63J 1UJ8A 3S2WA 2L9NA 1GV5A 4DQ2A 4E7HA 4BHCA 1FZPB 2WTEA 1SEUA 3H0DA 4BL0B 1GDTA 3H5NA 4IQ4A 3TP0A 2D2WA 1XGNA 5E17F 2QBYA 3RYPA 3W6KB 4HRIA 3G6EI 1UHWA 3KEOA 3M8FA 4FT8A 2E2JJ 5CYVA 4S0HB 3F8NA 3HRUA 1Z7UA 2HU9A 5ERIA 1OYIA 5ED4A 3J7ZI 2K9NA 3VODA 5F08A 2CW8A 2M0MA 5KVRA 2RN7A 3FZVA 5DYMA 3U2RA 4ENMA 2X6OA 4JK1X 5HS9A 4L9TA 1D3YA 1LVAA 3FISA 3HZJA 4QWQA 2KL4A 3QPSA 1USTA 1V55H 3GTOJ 1APLC 2M8EA 2X51A 1RR7A 5FGMA 1X2NA 1SD6A 2HVSA 2M0CA 1TQMA 1FY7A 4G7ZF 4IOAF 3KP5A 5TJJA 1WQ2A 1WPKA 2GIZA 5D5VB 4Z2YA 4KFCA 1X3WB 3HSFA 3KP3A 1OISA 2DMTA 4YFKF 5FRMA 1N25A 2QM3A 2VONA 3VOEA 2VKEA 1JTYA 2ZB9A 1USSA 3OIPA 1HW1A 2LOOA 1VZ0A 1HCRA 1ZGJA 4OIRF 3K1PA 3I64A 2HVQA 4PJMA 1BBYA 4M9SA 3MKWB 3F21A 1A31A 2G7HA 3HOZJ 3M4OJ 2NS8A 2CQQA 4A3EJ 1OKRA 3H35A 4BJTA 3I71A 1FYLA 2XAJA 1GXPA 4KIBA 3BTJA 1VQ5I 4ZZDA 3A0BC 1KU3A 4OOIA 2EZLA 2V79A 1MJBA 3CJQB 2M7BA 5M3MJ 1FYMA 3HJEA 5CLSA 2JZYA 3OS0A 2ELJA 3OOPA 5FKLA 1SFXA 2DA6A 2QBYB 1WH5A 3W6JB 3EYIA 1EV7A 1UAAA 3I3LA 1EKEA 2KJBA 4JP0A 3RPQA 3DBLB 1YX3A 4S05A 3Q5FA 2VJIA 2K5CA 3KFWX 5B66C 3S15J 2LFBA 4HW0A 1R36A 3OOUA 2VT3A 1X1CA 1ZG5A 2XAQA 1KQ0A 3DBRB 3E97A 1DGRM 4Q5SF 3BTIA 4FISA 1EF4A 2Y9ZA 2QKLB 3R4KA 2VLAA 3SFIA 3UKGA 2Z5UA 3MZYA 1F4KA 5F04A 1WJBA 5CVJA 4KJZA 2ZCWA 1D0XA 3CCYA 2BY1A 4EEFG 2MA3A 4XR6A 4RB2C 5DCMB 4OIQF 2Z3YA 3C1DA 2DO7A 3ECHA 2PLYA 5FFXA 3KYLA 4A5NA 1W36C 3ZCOA 4L9NA 2L02A 3ZMUA 3PIPF 5CPRB 1EH7A 2HTJA 4YFNF 4CYCA 1FOWA 2ID6A 4G8XA 4ZTFA 4ESBA 5F64A 2CUFA 3WHBA 1SAUA 2BW3B 2O0YA 3KP6A 4RLFA 1AU7A 3BG6A 5DM7F 4AYBN 1QRYA 5J4VA 4HQMA 1ORKA 1GT0C 1MDMA 4RM2A 4CDGA 2D1VA 2EIJH 4HPQA 4AUXA 3M8JA 2CGPA 3A03A 4A0YA 1SFUA 2MW8A 4AM3A 4KN4X 5FD5A 2KT0A 3HBLA 3S14J 5IT9Z 3H5AA 3I0TA 3HRSA 3VDXA 3WTSC 1VI0A 2QQ8A 1LE8B 5IP6A 3JR9A 1T56A 4XN3A 5K7FA 3A1YA 2B0LA 2F48A 4FASD 5D4RA 5C4JJ 3GTLJ 3F8MA 4MTEA 3RZDJ 4XM3A 1ETYA 2OCCH 5DM6F 4BE0A 3FX3A 3LL7A 3QPTA 1OCPA 2QSFX 3MKZA 1YRNA 3KIOA 5J47A 3FXKA 1TTYA 4LLLA 3ZP5A 3S8PA 1K7AA 2LNBA 2VE9A 2G9WA 3TDUC 1R00A 5GPCA 1ZTRA 4CCOA 3FXOA 2DOFA 3EUAA 4RBOA 1ENHA 1JHHA 1ZGWA 3FMRA 3QOPA 4MO7A 2RVCA 3ZOBA 4DZPA 2ZJPF 1IRXA 1MJAA 3PNTA 1K78B 5LEKA 5E1XA 3WU2C 5D6EA 2EZHA 4ZTJA 1WI9A 2AS5F 2DPUA 2FJ1A 1X58A 1WWXA 2DA2A 2PFBA 2MD0A 1K6YA 1M1EB 3EQLF 4PJ0C 1JGGA 3LSJA 4ITVA 4PGGA 4XSXF 2KHMA 3NWSA 3OYLA 1S8NA 1S72I 3P9KA 3U1DA 1HQCA 3FDYA 2L4MA 4I76A 3BT9A 3K2AA 2EZIA 3IWZA 1YX5A 2JWTA 1B72A 2VC0A 2QUFA 3DKWA 1C0WA 4IL6C 3S3MA 2M5WA 4NQWA 1MDMB 1IXRC 2I5UA 2LLKA 3ZN1A 1JI8A 2W1OA 1Z67A 2V1NA 4N9HA 3I53A 4KA4A 3E7LA 5B1AH 2OC6A 3RQIA 2LDUA 2M4GA 3CC2I 1TLHB 3KX2A 2Y48A 3F9KA 1X3ZB 2PJRA 4HOBA 3HEFA 1G3WA 4FETA 3K4MA 4A3BJ 2EPFA 3M1CA 4WXHA 2QA4I 4M3FA 3PQKA 3GLXA 4RB1A 3VEPA 4IHYA 3LA3A 1QZZA 5KCMA 2IGKA 2DDAA 2WAQN 1D1BA 3E0JB 3GYHX 2MFZA 3H36A 4A2UA 2HXOA 3BQYA 3DEUA 2O9LA 1I3QJ 4I99C 4P5OA 1JKQC 1W5CC 3CCSI 2W57A 4BDZA 2Y2ZA 1FBUA 4BU2A 1LKXA 2CUEA 3CUQB 3HGYA 2NVUB 2R7WA 4I0BA 3FKJA
chains in the Genus database with same CATH topology
3ERMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERM A; 
#chains in the Genus database with same CATH topology
 2G0E A;  2VXZ A;  1J7K A;  3CUQ C;  2JA7 J;  3DV8 A;  3GTJ J;  3LSR A;  2RC4 A;  3IAS 2;  3PNV A;  4I98 B;  4C9Y A;  3HSE A;  5IYD J;  3MFK A;  2ECB A;  2JA2 A;  4I7H A;  2F6C A;  2K9Q A;  4EJO A;  1VQ9 I;  2CQK A;  2VE8 A;  2DDB A;  3ERE D;  4KIF A;  5FLM J;  2JRM A;  4WK8 F;  5IYB J;  4DW6 A;  4EJU A;  3CCL I;  3LWF A;  3TOB A;  3GLL A;  3EET A;  3DTI A;  4Y4R A;  2DBB A;  2PG4 A;  1YJ9 I;  1IUF A;  4HF1 A;  1RKW A;  1R58 A;  2L0K A;  3HUG B;  4UVC A;  3HOT A;  2H8R A;  2XAG A;  1DU6 A;  3QP5 A;  1TP4 A;  2EBI A;  4A69 C;  4CZZ A;  1RES A;  2FQ4 A;  1B9M A;  1N78 A;  4AU7 A;  4BJ6 C;  3OYI A;  3ULQ B;  2STW A;  2FNA A;  1S9H A;  2E19 A;  2P7V B;  2RNJ A;  4WWC A;  3B02 A;  4YIF A;  3O8H A;  1B72 B;  1TWH J;  2MYS A;  4W97 A;  2N8G A;  3IRR A;  2G7U A;  3S1R J;  4AIK A;  2COM A;  1P4X A;  1UCR A;  2EFP A;  4OU0 A;  1SVL A;  2XF7 A;  1OMI A;  3PFY A;  4NUB A;  2YPR A;  3F8F A;  3JRE A;  1I5Z A;  2JT1 A;  5LHG A;  1MJ9 A;  2V4J C;  1IN6 A;  3ONQ A;  5C3E J;  4DYC A;  1ETO A;  2PMZ A;  3C18 A;  1J2X A;  4HSR A;  4JX4 A;  4O6J A;  4RMN A;  3AFH A;  3GZN B;  1UG2 A;  3W2V A;  2E1O A;  4UUS A;  2V26 A;  2STT A;  1OJL A;  4Q47 A;  5M5Y J;  1LEB A;  2XGE A;  2H8W A;  4XNF A;  1NK3 P;  3H3U A;  1TWA J;  1ZRC A;  2NNN A;  1ULY A;  2CQN A;  3L2C A;  5F6F A;  5L3E A;  2KMU A;  3S1N J;  2HYG D;  3L2V A;  2AXL A;  5D8K B;  1OR7 A;  1QZY A;  1WJD A;  3TED A;  2LBF A;  3O3K A;  5FKO A;  3ZR8 X;  4A3L J;  4F7Z A;  5EDN A;  2VN2 A;  1E3P A;  4YG2 F;  4KT5 C;  1SFK A;  3WU0 A;  3SYT A;  3NQO A;  3I4M J;  1Z91 A;  4Z6Y A;  4BHB A;  1G59 A;  4UUV A;  4E70 A;  3GTG J;  1ZEL A;  4BKX A;  2X1C A;  3K1N A;  1QGP A;  2XB0 X;  4IHW A;  2VOO A;  3HC7 A;  3K4N A;  2M30 A;  1P6R A;  1YQA A;  3GME A;  3SZP A;  3ZGK A;  4BYY A;  1H9T A;  2XDV A;  4KUM A;  3L9F A;  4WF2 A;  3L00 A;  1BL0 A;  1SFE A;  3OSF A;  1OFC X;  1R22 A;  2DTR A;  3DEE A;  5J40 A;  4U87 A;  4I6Z A;  2GOM A;  3GW2 A;  1T8I A;  2WV1 A;  1TBX A;  4E7Z A;  1MSE C;  3BQZ A;  3M3Y J;  5H2F C;  1Y0U A;  2BE5 F;  3CCQ I;  3OR1 C;  2XAS A;  2UV1 A;  1S5L C;  4MLO A;  2EA4 A;  5ICF A;  2IA1 A;  3OYF A;  4Y3O A;  4JX6 A;  3H3V K;  1GLN A;  2Y31 A;  2VKD A;  1ETX A;  2X6X A;  2DA3 A;  2X6Y A;  4C3I J;  2IT0 A;  2K3P A;  2M4K A;  2OQG A;  2OA4 A;  3CJN A;  3WTT C;  3F6O A;  1RKT A;  2IAI A;  2LY2 A;  1HW5 A;  1Y6I A;  4N9I A;  5CVV A;  2XGC A;  2ZFU A;  4DYQ A;  3DKX A;  3FMQ A;  4U0V A;  1SVM A;  1Z3X A;  4J19 A;  2ZXJ A;  3OYC A;  2QKM B;  1MNM C;  2I10 A;  2EFQ A;  3U9G A;  2NRA C;  2Y0S N;  1DU0 A;  1OCC H;  3E6B A;  1HLV A;  3N05 A;  1FMW A;  3SEQ A;  5TGT A;  5CVR A;  1YW9 A;  2GAU A;  4OAY A;  2E7W A;  3CLO A;  3F3X A;  3CJR B;  2FBI A;  3VB2 A;  2KLO A;  2HTS A;  2K9L A;  4ESF A;  3IV5 A;  1O57 A;  1U9O A;  1F5T A;  2ZC2 A;  2L9R A;  2JPB A;  2KQR A;  4XBF A;  4C3J J;  2JMW A;  5K5Q A;  1K83 J;  3RJP A;  4ZJZ A;  3S32 A;  1FSE A;  3K9T A;  2M45 A;  3HPH A;  2Q8K A;  1CQT A;  4RGS A;  1HA8 A;  4A3C J;  3PIO F;  3LSM A;  3ABK H;  3BZC A;  1MBG A;  1WZ2 A;  1ERD A;  3GO5 A;  4RGR A;  1O3S A;  2R5Z B;  3OYG A;  4BAY A;  1E3O C;  2OTJ I;  2HS5 A;  2EV6 A;  1UEL B;  5FO5 A;  1YG2 A;  3C7J A;  3Q9S A;  4E6K G;  4BE1 A;  2DYS H;  2E34 A;  4NNJ A;  2NAZ A;  2JUC A;  1T39 A;  4LK0 F;  1S29 A;  1OR7 C;  4M3G A;  5ILV A;  4AVP A;  2P4W A;  3G73 A;  2WWY A;  3IHU A;  4HNU A;  1RET A;  2K02 A;  1I39 A;  2KIS A;  2HYJ A;  3ABM H;  2QF7 A;  3DLA A;  2P6T A;  1BJZ A;  3GXO A;  3LA7 A;  4ZYH A;  1S3J A;  3B6A A;  4DOZ A;  2ZME A;  3K4K A;  4LLG F;  3FKI J;  5HLH A;  5HNH A;  4XID A;  2MBF A;  5A2Q Z;  3PUB A;  3C2G A;  2AHQ A;  4M73 A;  4A3M J;  3HXL A;  1VQM I;  1IRF A;  2TDX A;  1A04 A;  2K7L A;  1SAX A;  2DFH A;  3P9C A;  2LKS A;  1TZL A;  2X48 A;  3QPL A;  2Z2S B;  1B8I B;  3AL0 B;  4BS9 A;  4XL9 A;  4OMY A;  3TQN A;  2NS7 A;  1IN4 A;  1B1B A;  5DEQ A;  3JRC A;  2W84 A;  1IV6 A;  1LVK A;  4II3 A;  3FHN A;  1KQ8 A;  1P2F A;  3COA C;  4B3X A;  2MGQ A;  4DIQ A;  3OIO A;  2XIG A;  1Z0X A;  1JT6 A;  2Z1D A;  3GZ5 A;  2AQF A;  1SD4 A;  1K4S A;  2P5V A;  3CTA A;  5L3D A;  4NBQ A;  1R7J A;  1TW2 A;  2ETH A;  2EV0 A;  2V1D A;  2ZNZ A;  3V7C A;  1WFX A;  3TW6 A;  1Z6R A;  3BRO A;  3TP3 A;  1N77 A;  2Y30 A;  4KT6 A;  5DD8 A;  2X1D A;  2KRF A;  2H09 A;  3GZ6 A;  5FRN A;  2JVG A;  2E5Z A;  4BEH A;  2DJN A;  2VPR A;  1U2W A;  3O2P E;  2E36 A;  3WGI A;  2XPW A;  1JUP A;  1XDU A;  2O03 A;  3A4C A;  3GWZ A;  1R1V A;  3MKL A;  4BQQ A;  1G2H A;  4XKW A;  2XAH A;  1U78 A;  3J80 Z;  2PBI A;  4X6A J;  2HGC A;  5EZH A;  1QBJ A;  4KMF A;  1IRZ A;  2ESH A;  2YR2 A;  4IEJ A;  4LIU A;  4A6E A;  3R61 A;  2P81 A;  2K3F A;  1A35 A;  2FX0 A;  2FBK A;  1VQP I;  3RDI A;  3JSO A;  2Z16 A;  4L9V A;  1IXC A;  2XKP A;  3WTY C;  1BN5 A;  4CCM A;  3CMY A;  3ASN H;  3FK7 A;  4RGX A;  1FX7 A;  3MQ0 A;  5H6Q A;  3JRD A;  3H9Q A;  1BOA A;  4IHT A;  2K85 A;  4RB3 C;  2L7F P;  3QAH A;  3G2B A;  5IOY A;  5DTD A;  2DTZ A;  4M71 A;  4ZH4 F;  1BA5 A;  1X2M A;  3KP7 A;  2XRL A;  2OQR A;  3KEY A;  2DJI A;  3I58 A;  5L3G A;  1WJC A;  3LSI A;  2OV7 A;  5E1Z B;  3RKQ A;  1QVU A;  2DA5 A;  2ZME B;  3CD6 I;  3BR3 A;  1ACI A;  4UVA A;  4CXF A;  2ZME C;  1MH3 A;  2HDC A;  2VI6 A;  5BQT A;  2L9V A;  4XSZ F;  1ZR2 A;  1B6A A;  1IF1 A;  1P7I A;  3HL2 A;  3SZT A;  4D5F A;  4PFO A;  2H6B A;  4ENJ A;  2VAS A;  2LSO A;  4OIN F;  4KIC A;  2Z99 A;  4PSX A;  3HOV J;  1GUU A;  5E20 A;  2MG4 A;  2A05 A;  2K9S A;  2FSW A;  2Q1Z B;  3IC7 A;  4KMU X;  2FBH A;  3PM1 A;  1LNW A;  4KIS A;  1H0M A;  3GTP J;  2H6C A;  3Q9V A;  1QPI A;  1VND A;  2VB6 A;  1FIP A;  3DF8 A;  4M9X A;  2NXN B;  4LOC A;  3BC8 A;  2BHY A;  2VJJ A;  2V1X A;  2MH2 A;  2VT2 A;  5TIS C;  4NC6 A;  2QCO A;  3KYC B;  4XON A;  5DCM A;  3LSK A;  4ZDP A;  4MTD A;  2KDO A;  1R23 A;  2FA5 A;  4XKV A;  4KYW A;  1FSH A;  1K61 A;  3E3V A;  1HST A;  2YU9 J;  1OCO H;  1XGO A;  4BEH B;  2LTP A;  2JRT A;  1HSJ A;  2ME0 A;  4MHG A;  5M5W J;  2IJL A;  3ASO H;  4KIG A;  2PQ8 A;  3QU6 A;  4QIW N;  1JKR C;  4BH9 A;  3S2D J;  1XCB A;  3W6V A;  1RI7 A;  3BJ6 A;  2BW3 A;  2ZJ2 A;  5HDK A;  1BC7 C;  1VFC A;  9ANT A;  5JFR A;  1BI1 A;  1F9N A;  2R7Q A;  2WA0 A;  3ROU A;  4LB5 A;  1RRJ A;  5JHU A;  3WTU C;  1FIA A;  1JJ8 C;  1RNL A;  3K70 D;  3WG7 H;  4C2M J;  4U88 A;  3A2K A;  3D0S A;  1XGS A;  3FXJ A;  1P4W A;  1X4O A;  4RAY A;  5K5O A;  4A3F J;  4Y52 J;  1ZN2 A;  3PUF A;  1T33 A;  3WE3 A;  2CFX A;  3K7A J;  4W1U A;  1H8A C;  2HPI A;  3ZRG A;  1LE8 A;  2HWV A;  4D9J A;  3CMM A;  2L2O A;  4ON0 A;  1AWC A;  4MEY F;  4NC8 A;  5AIP A;  1I1G A;  3ERM A;  3WTX C;  2BY0 A;  3E6D A;  2A5W A;  2CU7 A;  4I01 A;  3LNQ A;  3ZQF A;  5LLQ A;  3T0Y A;  3BG9 A;  4Y17 A;  2PJP A;  3J81 Z;  2GOX B;  4RAF A;  3AKZ A;  3S2H J;  3SHF A;  2X9D A;  2RKH A;  3WTZ A;  5F0C A;  3PJR A;  2PEX A;  3B6C A;  1U0J A;  5EYR A;  4BAC A;  1H88 C;  5LD2 C;  2V9K A;  2EIK H;  3M9A A;  5LFA A;  2GM4 A;  2MH9 A;  1I1S A;  2BHZ A;  4MFD A;  3BZ6 A;  4M72 A;  2ELH A;  1WJF A;  4I2O A;  5HLG A;  2GZW A;  1SVO A;  3BG5 A;  3ML6 A;  3CCE I;  1DUX C;  3GCM A;  3FHZ A;  1SAN A;  2JQ7 A;  1ZYR F;  3BOQ A;  2NVX J;  1B59 A;  4GCV A;  5F0H A;  1L0O C;  3T8T A;  2C6Y A;  2GWR A;  1K78 A;  2H94 A;  2LKX A;  3MWM A;  2M34 A;  2XAF A;  3QQA A;  4HAM A;  1X4P A;  5FD6 A;  2VKH A;  5FLV A;  3ZN0 A;  5HVQ C;  2BY2 A;  4LG3 A;  1IG7 A;  3M07 A;  4KNY A;  2QSG X;  3BTL A;  1MBJ A;  2ZXI A;  4HLY A;  1KZH A;  2LMD A;  1WVR A;  2RGV A;  4FE7 A;  2YS9 A;  5FKN A;  1MBF A;  2E1C A;  2R7X A;  2CS3 A;  1RIO H;  5IY5 H;  1J9I A;  2WC2 A;  3LQR A;  5FRO A;  1G3Y A;  1PUE E;  3HB9 A;  3LAP A;  1YIT I;  4L0Y B;  1X1D A;  3HHH A;  5BOX A;  2JSC A;  2A07 F;  4L0Z B;  3SFZ A;  2XRO A;  4IZZ A;  2E2I J;  1P9Q C;  2R7F A;  3TO6 A;  2BV6 A;  3IUO A;  4CCJ A;  4D1Q A;  3S17 J;  2UZK A;  1IXS B;  3T5X A;  2DK5 A;  5J8F A;  3I59 B;  3IH3 A;  3R6S A;  2L9S A;  3V8J A;  4ZDL A;  3HPG A;  2P8T A;  3VFZ A;  2ZXW H;  2EQR A;  5DD4 A;  2BGC A;  1SD5 A;  1XB4 A;  2QQ9 A;  3C2H A;  3EUK L;  1E3H A;  2CO5 A;  2E7X A;  3NAR A;  4ENK A;  4IHS A;  4U7D A;  2ICW G;  4RLQ A;  1X1A A;  3BDD A;  3CMA I;  3BY6 A;  2R7T A;  3FM5 A;  5H6R A;  1YS6 A;  2ZJQ F;  1XD7 A;  5GAE J;  3S3O A;  3BR1 A;  2DFI A;  2VL8 A;  4LIT A;  1W5S A;  4PJL A;  4V2G A;  2UXN A;  3EDP A;  4XLC A;  4FX0 A;  4GYI A;  1O3R A;  2YUS A;  1YTY A;  4P9U A;  1EH6 A;  4OMZ A;  4XLP F;  2PX9 A;  3ABL H;  3BTC A;  1U8R A;  1ZRF A;  2MAB A;  4C30 A;  3E6M A;  1BIA A;  5D5W B;  2E1N A;  4IQJ A;  3OSG A;  1QO0 D;  5IT3 A;  2EA2 A;  2A61 A;  4IPA A;  4AYB A;  1TWF J;  2V7F A;  1QHH D;  3PO2 J;  5LBQ A;  3MKY B;  1OYW A;  4QSH A;  3CUQ A;  4EJV A;  5EGO B;  2D45 A;  1Z6T A;  2FOW A;  2ZBK A;  2L54 A;  2Y69 H;  1MZB A;  3RPU D;  4ANJ A;  1H89 C;  2V1U A;  2DT6 A;  4RS8 A;  2OAZ A;  5IT9 K;  3KZY A;  2CRG A;  2R3S A;  1FP1 D;  4DNC A;  2HVR A;  5HLI A;  4HV6 A;  2GA1 A;  3PNY A;  4OIP F;  1D5Y A;  3JRB A;  3CCV I;  2L5Q A;  4Y13 A;  4XKC A;  4IRG A;  3DKY A;  4NB5 A;  4KDP A;  2MC4 A;  5L3F A;  5GTH C;  1MMS A;  3FBI B;  3UNG C;  1XSV A;  3HUG A;  1JKP C;  4I0A A;  3BCA A;  3HOW J;  1R5G A;  2DYR H;  2HDD A;  1AOY A;  3IKT A;  4BDY A;  3W3C A;  3OYM A;  2EFN A;  3OYE A;  4IXA A;  4UVB A;  4UNO A;  2EWN A;  3OWT A;  5E8I A;  3HOX J;  1DPR A;  1R71 A;  1BR1 A;  2HQR A;  2W00 A;  5LGU A;  3JRF A;  2KJC A;  2LY1 A;  1LFP A;  2DPD A;  4LLN A;  4E7I A;  2FE3 A;  2J5O A;  2LP0 A;  4PK4 A;  4R1H A;  2XB5 A;  5DV5 A;  2XAU A;  4DYR A;  2EFO A;  1YYV A;  3HOY J;  3QYB A;  4HX4 A;  2CH0 A;  1HXD A;  4NDL A;  3LMM A;  1IDZ A;  1CGP A;  3L1P A;  2VJ5 A;  1AKH B;  4V19 K;  1LEA A;  3VYT B;  4PFP A;  3H1C A;  1XSX A;  3HRM A;  3ZMZ A;  3IH2 A;  2BEO A;  4F55 A;  1SC7 A;  5FKM A;  1QZE A;  3LFK A;  3QOD A;  3WG9 A;  3MVP A;  3ZMD A;  3CZ6 A;  3D5L A;  2COB A;  1ZQ3 P;  1GVD A;  4PCQ A;  3NAU A;  2ZSH B;  4CH7 A;  3E5X A;  1PJR A;  4NHJ A;  2LH9 A;  3WGG A;  5E3M A;  4A3J J;  5HDN A;  4Q48 A;  4LFU A;  4B48 A;  4FTH A;  1JUM A;  1U9N A;  1YI2 I;  4ENN A;  4XOR A;  3M8E A;  1MMN A;  1RC9 A;  1FWZ A;  2M87 A;  2DFF A;  2BVM A;  3SXY A;  2P5L C;  4HF2 A;  3BLY A;  3DPU A;  3WTW C;  2DA4 A;  1L3L A;  2WAQ A;  3SDB A;  5LRS A;  4JYK A;  3RCO A;  3J7A Y;  5FKK A;  4B47 A;  5E8G A;  2KIQ A;  4D7M A;  2NYX A;  5C44 J;  1IRG A;  4EV0 A;  3IKV A;  3TKY A;  4QPQ A;  4BNC A;  1UG0 A;  5LGN A;  1LJ9 A;  1B4A A;  1E17 A;  3ISP A;  3P9I A;  1FOK A;  2DMP A;  2XRN A;  1ITY A;  2A6H F;  3H9J A;  4FCY A;  1WI3 A;  1BM9 A;  3QP6 A;  2DA7 A;  4XK4 A;  5DUK A;  3ELK A;  2ECC A;  4RAG A;  2FF4 A;  3EPZ A;  2A68 F;  5F1J A;  1PP8 F;  1Q1H A;  4CO8 A;  4BBS J;  1U5T A;  5AIQ A;  2OZ6 A;  2R7R A;  3HYI A;  3KYD B;  3GTQ J;  1R4N B;  4RA2 A;  4WCG A;  4K2E A;  1RUN A;  3A01 A;  4E4H A;  4IX7 A;  3DU5 A;  4DZJ A;  3MEX A;  3V8K A;  4HDV A;  2F4I A;  4TV7 A;  1P7J A;  1GXQ A;  2IP2 A;  2WB1 N;  1ZRD A;  1FOX A;  4X0G A;  2HOE A;  2R5Z A;  3K2Z A;  1MGT A;  3ABT A;  2CMP A;  3HG9 A;  5ICE A;  1YS7 A;  2D1H A;  3L7W A;  1BOB A;  3GTK J;  4BXX J;  1FP2 A;  1LDJ A;  2IW5 A;  3FXM A;  4BXU A;  1PUF B;  1PDN C;  3CP2 A;  3VSK A;  4CSW A;  2Z9O A;  3ZMV A;  1D0Y A;  3G4S I;  1CF7 B;  3F0C A;  4J01 A;  2CFO A;  4G6D A;  3HOU J;  3BP8 A;  2XV4 S;  2DMQ A;  3IH4 A;  3LA2 A;  4N4O B;  2PMH A;  4ZDO A;  3DQV C;  1VQN I;  3OY9 A;  2LVS A;  2W7N A;  3LSP A;  1W5T A;  1MBK A;  1I6H J;  3FK6 A;  1OLT A;  1HC8 A;  3TL4 X;  1B8I A;  2V9P A;  2DCE A;  3VYS B;  4XRS A;  1R1T A;  2F4O B;  5EJC A;  2GQQ A;  4G6Q A;  1IN5 A;  2IVM A;  4G94 A;  3CC7 I;  2R7U A;  3I9V 2;  2I8D A;  4M3B A;  1BR2 A;  2IPQ X;  3KP4 A;  2CW0 F;  3RI4 A;  3MCZ A;  4P1W A;  1WJ5 A;  3IWF A;  2V6E A;  1D8J A;  4IRH A;  3U1K A;  4XN0 A;  4HZF A;  2XC7 A;  2XF5 A;  5KNL A;  2K86 A;  1QNT A;  4Y7N J;  4EGZ A;  2QEN A;  5DDG A;  2P5K A;  1PP7 U;  5IP9 J;  2FUG 2;  2L3D A;  3RQ4 A;  1Y56 A;  4BQO A;  1O4X A;  1EJ9 A;  3T1B A;  5K1Y A;  2DA1 A;  1HF0 A;  2W4S A;  3JTG A;  3CO6 C;  4UXN A;  1ZG3 A;  1J5Y A;  2HOA A;  2Q0O A;  1DGW Y;  4XKB A;  3KCC A;  3DCF A;  1U5T B;  5D5X B;  2R5Y A;  5HOO A;  3GBG A;  1ETQ A;  1TWC J;  2K9M A;  1NTC A;  1U5T C;  5E3N A;  3A01 B;  2M2E A;  1BJA A;  3P7N A;  4EMS A;  3MMY B;  3F72 A;  5GP9 A;  3CQZ J;  1O7F A;  3KP2 A;  1IJW C;  2OTL I;  2Y75 A;  1ODD A;  3V7S A;  3CCR I;  4ESJ A;  1W0U A;  1JJ6 C;  1J75 A;  4F92 B;  2KZV A;  1FNN A;  2BBY A;  2QGU A;  3IAM 2;  3IRQ A;  1VQO I;  1I6X A;  3QU3 A;  2Y0S A;  1NH3 A;  3V4G A;  4AID A;  1BI0 A;  4CIC A;  3P5J A;  2VQG A;  1MND A;  2XGD A;  4HF0 A;  4A6D A;  2DMN A;  2HEO A;  1TNS A;  3M1E A;  3R0A A;  1WRJ A;  2XSD C;  2JA6 J;  2HI3 A;  3FXR A;  3JRA A;  4B3A A;  1VQK I;  4F91 B;  3B73 A;  4UB8 C;  3HKZ N;  4G7O F;  2ESN A;  3L2Q A;  3SDG A;  2M9H A;  4S04 A;  5CVU A;  1FBQ A;  1REP C;  3O8G A;  1T0F A;  3H5R A;  3W2W A;  1Y0N A;  3U21 A;  1OYY A;  3K4L A;  4XRF A;  3HGG A;  2IXS A;  2VQC A;  4BHP A;  3IL2 A;  3SQN A;  5JLX A;  1IGN A;  1OCT C;  1QA6 A;  3AL0 C;  2E60 A;  4UV9 A;  2Q2E A;  1YJN I;  4HG2 A;  1XDS A;  5F0F A;  1A6I A;  2ZKZ A;  2CV0 A;  4L5I A;  1ZK8 A;  3R0J A;  4EGY A;  2CUJ A;  5GAG J;  3OYJ A;  1MSF C;  2ZFW A;  3H0G J;  2IRF G;  3JAM Z;  3G3Z A;  2R93 J;  3TO7 A;  1KU9 A;  1U6G A;  3RKY A;  4E7J A;  1K4T A;  3PL8 A;  2LC2 A;  2BXY A;  3MD2 A;  3TOA A;  2RV8 A;  5KAF C;  2CV1 A;  3CDH A;  1TT0 A;  3H92 A;  4O5V A;  2ZSI B;  4V2F A;  5A2Q K;  3CC4 I;  1Q1V A;  4DGW B;  5FLX Z;  3JRI A;  2DW4 A;  5EEH A;  2PN6 A;  4MGR A;  1DPU A;  4PUS A;  3OS1 A;  5CJ9 A;  5M5X J;  1FMV A;  3WHC A;  3GX4 X;  5EG0 B;  2W48 A;  1ZGA A;  1AHD P;  2R7S A;  1FEX A;  4U0Y A;  4GO1 A;  2R5Y B;  1QHG A;  2KRH A;  2O8K A;  5JLW A;  4AVZ A;  3CO7 C;  4GRI A;  1W7P D;  3SZG A;  3CDL A;  1KA8 A;  2ADU A;  1FJL A;  1IV8 A;  2YX7 A;  3CCU I;  4IO9 F;  2VPL A;  2ELK A;  5F1R A;  1YLF A;  3FM3 A;  4FX4 A;  1XTA A;  2L7K A;  4B43 A;  3K1M A;  3JRH A;  1JHF A;  3TDZ C;  1K6O A;  5J1U A;  1D8K A;  5J6X A;  5E1W A;  3H9G A;  4LD5 A;  2VQL A;  3LSG A;  5HDG A;  3RZO J;  3OL3 A;  1Z1D A;  3OV8 A;  3RSN A;  2EB7 A;  2F4M B;  4PGH A;  3S1Q J;  1VQ6 I;  1R6R A;  2DOE A;  1HBX G;  1XMK A;  2OBP A;  2CJJ A;  3ZXS A;  1BIB A;  3O6B B;  4M6X A;  1IZ1 A;  4HNV A;  2NS0 A;  4XLA A;  5GAH J;  3DTK A;  4LMY A;  3J80 K;  5D8L B;  1U3E M;  3S93 A;  4MIM A;  5BNG A;  5JVG F;  3BJO A;  4UV8 A;  4H0E A;  3S1M J;  2DN0 A;  2KKO A;  5B5E C;  2OU2 A;  3BR0 A;  2DT5 A;  5LHI A;  3BCB A;  1XN7 A;  4XLN F;  5E18 F;  4HNT A;  3W2A A;  2J5P A;  1Y39 A;  1G3T A;  1XG1 A;  1T0F C;  4M6V A;  3DU6 A;  4ETS A;  2ME6 A;  3ABU A;  4M6Y A;  4E7K A;  3KEQ A;  3GVA A;  1VQ7 I;  2VQH A;  1O3Q A;  4IVN A;  2IA0 A;  2K27 A;  2Q2E B;  4A0Z A;  3ECO A;  3HOS A;  1KGS A;  2KP6 A;  4AWX B;  1D0Z A;  1QVT A;  5K7H A;  2ZNY A;  1IC8 A;  2R4G A;  4E7S A;  5GTI C;  4O3M A;  1D1A A;  1UMQ A;  2EK5 A;  2HZD A;  4J00 A;  3KLO A;  5F27 A;  3GTM J;  2P0W A;  1ZRE A;  1TQI A;  1RR8 C;  1R9T J;  4L5J A;  3K4C A;  1LQ1 A;  2A3S A;  2DU9 A;  2KIU A;  2QVO A;  2BOL A;  1T2K A;  4A3D J;  3K70 C;  2CSO A;  4AC0 A;  2YX4 A;  3LSH A;  2BXZ A;  6PAX A;  2IS6 A;  2CUZ A;  1WGX A;  2IGN A;  5HS8 A;  3BR6 A;  1LDK B;  1HDD C;  1HDP A;  4MFE A;  3LFU A;  5K5R A;  2MD5 A;  1HW2 A;  1TQP A;  5ICC A;  1S7O A;  3MAJ A;  4BQA A;  3ZMT A;  1ZLJ A;  1VQ4 I;  4Y15 A;  2L7Z A;  2F5E A;  1TL8 A;  2O3F A;  2YU3 A;  2CYY A;  4D0P A;  2KZG A;  2R7D A;  2KIF A;  2IGO A;  3I59 A;  4LG0 A;  1R49 A;  4YEJ A;  2E5N A;  1W1W E;  3K69 A;  1MIJ A;  3BPX A;  1XX5 A;  3NEU A;  1VF9 A;  3D5R C;  5GPA A;  2MLG A;  3BR5 A;  2LY9 A;  1Y1W J;  4B8X A;  5FB2 A;  2VBZ A;  3ZQL A;  4CUG A;  4ZYG A;  3NWT A;  1ETV A;  4PZJ A;  1O7L A;  2RQQ A;  3OR2 C;  4QTR A;  2LD5 A;  4JX5 A;  4BY1 J;  1FYK A;  2A6T A;  3QOE A;  1S7E A;  4XOT A;  3H3Z A;  4WXD A;  3RPU A;  1JT0 A;  1Y1V J;  4PJJ A;  3RTR A;  3REO A;  5B1B H;  3GFL A;  1ON1 A;  3CDI A;  3QYF A;  1D5V A;  1P4A A;  5LEJ A;  1OQY A;  4N0B A;  4M3D A;  1K79 A;  5DCF A;  1I3A A;  4L9J A;  1W4M A;  2JJ7 A;  4BXF A;  4F52 A;  5IP7 J;  5IYC J;  4IOC F;  1A6Q A;  1IAW A;  2JPC A;  3TBI A;  5EGO A;  1U8B A;  1QU3 A;  2FMY A;  1JXS A;  1FC3 A;  2A5Y B;  4A93 J;  5JR3 A;  1Y8R B;  2FML A;  3V8L A;  3TGN A;  4ZYE A;  3A02 A;  1T95 A;  1EA3 A;  1DDN A;  3E1S A;  4CHU A;  4H4K C;  1IDY A;  3S16 J;  5H20 A;  2MC3 A;  3HRT A;  2JA8 J;  5J4Y A;  2VOD A;  2TRT A;  3AG4 H;  5D6F A;  4LB6 B;  2M1B A;  4CYD A;  1DQU A;  4IHX A;  1T38 A;  4YFX F;  2H1K A;  4RAZ A;  1NHA A;  1V5G A;  2KDZ A;  5HOD A;  3DBH B;  2QEX I;  2VC1 A;  1P92 A;  3KZZ A;  4B44 A;  2K40 A;  2HPM A;  1YIJ I;  4HST A;  2LG4 A;  2VXD A;  2DQR A;  1LUJ B;  3J81 K;  5BPD A;  1OCR H;  1ZG1 A;  1UFM A;  2VOP A;  4HLX A;  2X85 A;  1Z77 A;  4XRM A;  2QQB A;  3EUH A;  1ZAR A;  1MNE A;  1ZR4 A;  2CG4 A;  3CCM I;  5EEA A;  5E79 C;  4I09 A;  3QPH A;  3N97 A;  2HQN A;  1R4M B;  3FIW A;  4EVI A;  1KU2 A;  2XGX A;  3D1N I;  4LG0 B;  3AG2 H;  3JCU C;  4EJT A;  2WAE A;  1G4D A;  3F8B A;  2Y9Y A;  3IP4 B;  4XLE A;  1KQ9 A;  4EM1 A;  4BUP A;  3L2W A;  4C2T A;  2BY3 A;  2KRC A;  1ZLK A;  1QQI A;  2GXB A;  2GBY A;  4EM2 A;  4ABZ A;  1UZC A;  2EIN H;  3R60 A;  1TC3 C;  3OIQ A;  1J59 A;  3WGH A;  1W36 D;  2FXA A;  1AKH A;  5LHH A;  2WV0 A;  2AXT C;  4LIV A;  3CME I;  3DPL C;  5AON A;  3JSP A;  3F6V A;  4Q4Z F;  3BG7 A;  4YRV A;  1T6S A;  3PSF A;  1W0T A;  1V3F A;  2F2E A;  1NG7 A;  3BG3 A;  4HV5 A;  2EZK A;  2BZT A;  4MQV A;  3ZQC A;  3I4N J;  1V5F A;  3BJA A;  2AO9 A;  3NRV A;  4HDU A;  1RUO A;  1ETK A;  5CKT A;  1NK2 P;  1GHC A;  1BR4 A;  4CCK A;  2LF7 A;  4XRS G;  4G7H F;  1LPQ A;  1BI2 A;  1V4R A;  3F23 A;  2ISY A;  5LGT A;  3UR3 C;  2XSJ C;  4B1R A;  4A12 A;  2NNY A;  3ZQ7 A;  3RYR A;  3M7G A;  4E7L A;  3CF5 F;  3OS2 A;  2P6S A;  2JK3 A;  4JQF A;  1YJW I;  2HR3 A;  1YE9 A;  3QWL A;  5ILS A;  3G71 I;  4LK1 F;  2LRD A;  1LFB A;  3CLQ A;  4X1E A;  2JUG A;  3MZ8 A;  2VBX A;  2XPV A;  1PVE A;  2DMU A;  3JW4 A;  1YHQ I;  1T08 B;  5JI6 A;  4CCN A;  2PMU A;  4XOP A;  1MH4 A;  1FBS A;  3ZQH A;  1E0E A;  3TMO A;  3K0L A;  2LRE A;  1HKT A;  1F43 A;  3V42 A;  4DBQ A;  4A3I J;  2M3A A;  2LYC A;  1Z7L A;  2QLZ A;  4BY7 J;  2EIM H;  5FJ8 J;  3V7R A;  4IF4 A;  1UHM A;  3Q3S A;  3WTV C;  2FU4 A;  3PSI A;  5L3B A;  2F5V A;  1MMD A;  3EUH C;  3QYE A;  4BQN A;  1MMG A;  3OYN A;  1D1C A;  1TW3 A;  3MN2 A;  5EF6 A;  4C2U A;  3VYU B;  4AD9 A;  2V9V A;  5BMZ A;  4B4C A;  2VIX A;  2FOK A;  2OCE A;  4CYC B;  2RAE A;  2Z33 A;  2FD5 A;  2W25 A;  3I55 I;  2XVC A;  1JKO C;  2HKX A;  4HEA 2;  3GFI A;  1WCM J;  4U7B A;  1J0R A;  3G1M A;  1R5I D;  3ZPL A;  4A3G J;  1Z05 A;  2EV5 A;  3FXU A;  3OYH A;  3SEZ A;  2D5V A;  2V6C A;  5D5U B;  3E5U A;  1XMA A;  2R7O A;  3C3W A;  3LAJ A;  2MSY A;  3K10 A;  3F8C A;  5GAD J;  1KON A;  2GXA A;  2FEZ A;  1I50 J;  2IS1 A;  1PUF A;  2NVQ J;  2WY8 Q;  1YW8 A;  3HDD A;  1CF7 A;  1KYW A;  1B9N A;  1FOY A;  1WHU A;  2K4B A;  2K4J A;  3HM5 A;  3KZI C;  4P55 A;  4BGD A;  3DTE A;  2ACJ A;  4G12 A;  2JSP A;  2HQA A;  4P9F A;  2CQX A;  2L7M P;  4EQQ A;  4KIT B;  2L01 A;  2DT7 B;  1SD7 A;  1ONV A;  2DOA A;  4N4N B;  3CCJ I;  3I4P A;  2QQA A;  3J7A O;  3CUO A;  4A5M A;  1G3S A;  3BWG A;  4BJ5 C;  2LF8 A;  1JE8 A;  3DWL E;  1YRN B;  4ZYA A;  1YFH A;  1EH8 A;  1FT9 A;  4HX7 A;  1N75 A;  5J1Y A;  2DXI A;  4IHV A;  3K4B A;  5BS6 A;  3ZQQ A;  2OD5 A;  2R0Q C;  4GGG A;  3J7Y J;  2HFH A;  1HOM A;  3HTU A;  4ZZL A;  3PQJ A;  1YO5 C;  1QPM A;  2E35 A;  3GFJ A;  4DBR A;  2ID3 A;  4YEL A;  4MNU A;  2MLK A;  1XSD A;  4JOM A;  2GIV A;  2PMZ N;  2W24 A;  4EAT A;  4XLH A;  2X1E A;  3FBN B;  2HOS A;  3MZH A;  2E1M B;  2XUB A;  3LOC A;  2O5R A;  2LR8 A;  4G6T B;  5E3L A;  4PDK A;  2E1M C;  3I54 A;  4NC7 A;  1OCZ H;  4FHT A;  4AIJ A;  1WSU A;  1RPW A;  4XMY A;  3RKX A;  4BBR J;  5ILU A;  3Q0W A;  2DI3 A;  4EM0 B;  1GV2 A;  2WBM A;  1ETW A;  1XS9 A;  3KPH A;  3RKW A;  2FRH A;  4FE4 A;  2P7C B;  4IRI A;  4M3E A;  2GXG A;  1S7A A;  4D5C A;  2WY7 Q;  1BI3 A;  2DFE A;  2JVH A;  4XQF A;  5BPI A;  3G1L A;  2IS4 A;  2XF6 A;  3QRF F;  2HYF A;  1O3T A;  3FXQ A;  2O61 A;  5HNF A;  4GXO A;  4XLF A;  2OF7 A;  4BE2 A;  3HHG A;  1MMA A;  4KN7 X;  4NQW B;  1FTZ A;  2F5F A;  3ZQG A;  4CA0 A;  1XMX A;  4WXC A;  4IKF A;  5JHF A;  2KIM A;  4ZYD A;  1ON2 A;  2IA2 A;  1SFO J;  1FLI A;  2R92 J;  1A5J A;  2VUM J;  2WAF A;  5HLT A;  3S3N A;  2NVT J;  1VQ8 I;  4D7N A;  1LB2 A;  2HXI A;  1POG A;  4RM3 A;  1G6N A;  2GLO A;  4M74 A;  2PJR B;  2XHK A;  3WU1 B;  2OUM A;  2X0L A;  3EYY A;  1GVJ A;  3BZK A;  3GUD A;  1VQL I;  1SMT A;  2YSR A;  1MBH A;  3L09 A;  3T8R A;  2R7Z J;  2X4H A;  1HKQ A;  2B9S A;  4G9Y A;  3TO9 A;  2RQP A;  5EZG A;  2JTV A;  2CWE A;  3GEZ A;  2VKV A;  4C3H J;  4QPO A;  5KHD A;  2DAO A;  5D4S A;  4OIO F;  4AIH A;  1IN7 A;  3ZQI A;  5E3O A;  1YIO A;  4YIR X;  4QLC U;  2O8X A;  4HA8 A;  5CQG A;  1Z21 A;  1V5E A;  2KFD A;  2PI0 A;  2WB1 A;  4F93 B;  3KE2 A;  3PFI A;  1DP7 P;  2F5C A;  2BVL A;  2R7V A;  2ZO4 A;  4ZC3 A;  4GDF A;  1YW7 A;  2ISZ A;  2NOG A;  3OMY A;  3SJM A;  1STZ A;  3OYA A;  5B3S H;  5DUI A;  5LRR A;  2A6E F;  3DLL F;  4UY8 I;  3K4J A;  4JBA A;  1LFU P;  1S6L A;  3FF5 A;  3F22 A;  3Q0U A;  1KU7 A;  3DXJ F;  1W7P A;  5DS9 A;  2OPT A;  2W85 A;  2GA2 A;  2OZU A;  3D5S C;  5EEG A;  1IO2 A;  3AAF A;  1UHS A;  1XPX A;  1X1B A;  1ZHF A;  3DFG A;  1I27 A;  2NVY J;  1R5H A;  1BC8 C;  3LST A;  2UXX A;  1JGS A;  2IBD A;  5EG0 A;  3C2B A;  4HX8 A;  2CQ7 A;  4B09 A;  2LKP A;  3HIF A;  4XIC A;  2CV2 A;  3JTH A;  1DP3 A;  3K6G A;  2RDP A;  5TRD A;  1X1P A;  1H9G A;  2H1L A;  1XC5 A;  2QWW A;  4U0W A;  3VSL A;  1OPC A;  1LDD A;  4EJW A;  4IJA A;  2WAD A;  4UB6 C;  4YII A;  2RRE A;  4LGW A;  3E5Q A;  4WX9 A;  5M3F J;  3HTS B;  2X6W A;  4RB0 A;  2HNH A;  5CVI A;  1MD0 A;  4GYG A;  2EFW A;  4CZC A;  1NG6 A;  1F36 A;  4ASN A;  4CGZ A;  4OAZ A;  1TNT A;  1X3U A;  1IUY A;  1MBE A;  5IPA A;  5IOZ A;  5C4X J;  4UUS B;  3JRG A;  1PYV A;  2CW7 A;  4I02 A;  3CF2 A;  3AG1 H;  1VTN C;  4OWR B;  2JN6 A;  1HKS A;  1WJA A;  1KYZ A;  3BR2 A;  2IGM A;  5HS7 A;  1YOV B;  1XCV A;  3CP8 A;  1RZ4 A;  2F5D A;  3WE2 A;  2DK8 A;  3RIR A;  2DQL A;  2ZXH A;  2LBF B;  3FXL A;  1Y8Q B;  1XGM A;  3L2U A;  3GF2 A;  4PSW A;  5J8C A;  4GFB A;  2FQ3 A;  4HYE A;  1E2X A;  2HDW A;  2HKO A;  2VJ4 A;  2M8G X;  1JUS A;  2OJE D;  2QSH X;  3WOD F;  2O7O A;  1ZH5 A;  1G8X A;  4HBL A;  4PJN A;  3DP7 A;  5FFZ A;  5L3C A;  1MKM A;  3FWE A;  1R1U A;  3OL4 A;  1FTT A;  3E6C C;  5JVT A;  3ESW B;  4RGU A;  4UUT A;  4CCL A;  3DEW A;  1WKM A;  3CJT B;  4A3K J;  1TWG J;  1J09 A;  2KPM A;  3ZMS A;  2DLL A;  1WH7 A;  2TCT A;  1W7P B;  3BPV A;  1BW6 A;  4RDU A;  3VPR A;  1Z9C A;  3PO3 J;  1ZAO A;  2L4A A;  3HKZ A;  2O6G E;  4II2 A;  4L5E A;  2NOJ B;  5J3L A;  2RNG A;  1X19 A;  3L2R A;  4DJA A;  3HSR A;  2Y0M A;  2XPU A;  1T98 A;  4R8H A;  2EH3 A;  4M9Z A;  1UB9 A;  4F3Q A;  2B7E A;  2IS2 A;  4MEX F;  3KLN A;  2VBY A;  5KK1 A;  5ICG A;  2E71 A;  3DPT A;  3G1O A;  2BYV E;  5KAI C;  3A0H C;  1IN8 A;  1MW7 A;  4MQ9 F;  4Y33 A;  3KET A;  2HOT A;  1TT5 B;  2HQ5 A;  3VYR B;  4A0X A;  4R79 A;  2A69 F;  3JAM K;  1IW7 F;  1A36 A;  2AQE A;  2VBW A;  1V54 H;  3OYD A;  4L18 B;  2IEK A;  2UWM A;  1AA7 A;  2M7A A;  2DOD A;  2LK2 A;  2JA5 J;  2W82 A;  2QYO A;  3LQQ A;  3I5U A;  3CES A;  4UHT A;  3VWB A;  3AG3 H;  1ZKG A;  2HZT A;  1SMY F;  2XKO A;  1WJE A;  4LJZ F;  5FLX K;  1F1Z A;  3GFM A;  3Q0V A;  3X2Q H;  5CQE A;  2EIL H;  1Z3Y A;  2UUZ A;  1JTX A;  5J1R A;  1BW5 A;  2QZ8 A;  3FMS A;  4HQE A;  4P96 A;  2ZJR F;  2EJR A;  4FQG A;  3OYB A;  5K7Z A;  3OYK A;  3TW7 A;  2E2H J;  3I56 I;  1FPQ A;  2FNP A;  3N4M A;  2H27 A;  2B63 J;  1UJ8 A;  3S2W A;  2L9N A;  1GV5 A;  4DQ2 A;  4E7H A;  4BHC A;  1FZP B;  2WTE A;  1SEU A;  3H0D A;  4BL0 B;  1GDT A;  3H5N A;  4IQ4 A;  3TP0 A;  2D2W A;  1XGN A;  5E17 F;  2QBY A;  3RYP A;  3W6K B;  4HRI A;  3G6E I;  1UHW A;  3KEO A;  3M8F A;  4FT8 A;  2E2J J;  5CYV A;  4S0H B;  3F8N A;  3HRU A;  1Z7U A;  2HU9 A;  5ERI A;  1OYI A;  5ED4 A;  3J7Z I;  2K9N A;  3VOD A;  5F08 A;  2CW8 A;  2M0M A;  5KVR A;  2RN7 A;  3FZV A;  5DYM A;  3U2R A;  4ENM A;  2X6O A;  4JK1 X;  5HS9 A;  4L9T A;  1D3Y A;  1LVA A;  3FIS A;  3HZJ A;  4QWQ A;  2KL4 A;  3QPS A;  1UST A;  1V55 H;  3GTO J;  1APL C;  2M8E A;  2X51 A;  1RR7 A;  5FGM A;  1X2N A;  1SD6 A;  2HVS A;  2M0C A;  1TQM A;  1FY7 A;  4G7Z F;  4IOA F;  3KP5 A;  5TJJ A;  1WQ2 A;  1WPK A;  2GIZ A;  5D5V B;  4Z2Y A;  4KFC A;  1X3W B;  3HSF A;  3KP3 A;  1OIS A;  2DMT A;  4YFK F;  5FRM A;  1N25 A;  2QM3 A;  2VON A;  3VOE A;  2VKE A;  1JTY A;  2ZB9 A;  1USS A;  3OIP A;  1HW1 A;  2LOO A;  1VZ0 A;  1HCR A;  1ZGJ A;  4OIR F;  3K1P A;  3I64 A;  2HVQ A;  4PJM A;  1BBY A;  4M9S A;  3MKW B;  3F21 A;  1A31 A;  2G7H A;  3HOZ J;  3M4O J;  2NS8 A;  2CQQ A;  4A3E J;  1OKR A;  3H35 A;  4BJT A;  3I71 A;  1FYL A;  2XAJ A;  1GXP A;  4KIB A;  3BTJ A;  1VQ5 I;  4ZZD A;  3A0B C;  1KU3 A;  4OOI A;  2EZL A;  2V79 A;  1MJB A;  3CJQ B;  2M7B A;  5M3M J;  1FYM A;  3HJE A;  5CLS A;  2JZY A;  3OS0 A;  2ELJ A;  3OOP A;  5FKL A;  1SFX A;  2DA6 A;  2QBY B;  1WH5 A;  3W6J B;  3EYI A;  1EV7 A;  1UAA A;  3I3L A;  1EKE A;  2KJB A;  4JP0 A;  3RPQ A;  3DBL B;  1YX3 A;  4S05 A;  3Q5F A;  2VJI A;  2K5C A;  3KFW X;  5B66 C;  3S15 J;  2LFB A;  4HW0 A;  1R36 A;  3OOU A;  2VT3 A;  1X1C A;  1ZG5 A;  2XAQ A;  1KQ0 A;  3DBR B;  3E97 A;  1DGR M;  4Q5S F;  3BTI A;  4FIS A;  1EF4 A;  2Y9Z A;  2QKL B;  3R4K A;  2VLA A;  3SFI A;  3UKG A;  2Z5U A;  3MZY A;  1F4K A;  5F04 A;  1WJB A;  5CVJ A;  4KJZ A;  2ZCW A;  1D0X A;  3CCY A;  2BY1 A;  4EEF G;  2MA3 A;  4XR6 A;  4RB2 C;  5DCM B;  4OIQ F;  2Z3Y A;  3C1D A;  2DO7 A;  3ECH A;  2PLY A;  5FFX A;  3KYL A;  4A5N A;  1W36 C;  3ZCO A;  4L9N A;  2L02 A;  3ZMU A;  3PIP F;  5CPR B;  1EH7 A;  2HTJ A;  4YFN F;  4CYC A;  1FOW A;  2ID6 A;  4G8X A;  4ZTF A;  4ESB A;  5F64 A;  2CUF A;  3WHB A;  1SAU A;  2BW3 B;  2O0Y A;  3KP6 A;  4RLF A;  1AU7 A;  3BG6 A;  5DM7 F;  4AYB N;  1QRY A;  5J4V A;  4HQM A;  1ORK A;  1GT0 C;  1MDM A;  4RM2 A;  4CDG A;  2D1V A;  2EIJ H;  4HPQ A;  4AUX A;  3M8J A;  2CGP A;  3A03 A;  4A0Y A;  1SFU A;  2MW8 A;  4AM3 A;  4KN4 X;  5FD5 A;  2KT0 A;  3HBL A;  3S14 J;  5IT9 Z;  3H5A A;  3I0T A;  3HRS A;  3VDX A;  3WTS C;  1VI0 A;  2QQ8 A;  1LE8 B;  5IP6 A;  3JR9 A;  1T56 A;  4XN3 A;  5K7F A;  3A1Y A;  2B0L A;  2F48 A;  4FAS D;  5D4R A;  5C4J J;  3GTL J;  3F8M A;  4MTE A;  3RZD J;  4XM3 A;  1ETY A;  2OCC H;  5DM6 F;  4BE0 A;  3FX3 A;  3LL7 A;  3QPT A;  1OCP A;  2QSF X;  3MKZ A;  1YRN A;  3KIO A;  5J47 A;  3FXK A;  1TTY A;  4LLL A;  3ZP5 A;  3S8P A;  1K7A A;  2LNB A;  2VE9 A;  2G9W A;  3TDU C;  1R00 A;  5GPC A;  1ZTR A;  4CCO A;  3FXO A;  2DOF A;  3EUA A;  4RBO A;  1ENH A;  1JHH A;  1ZGW A;  3FMR A;  3QOP A;  4MO7 A;  2RVC A;  3ZOB A;  4DZP A;  2ZJP F;  1IRX A;  1MJA A;  3PNT A;  1K78 B;  5LEK A;  5E1X A;  3WU2 C;  5D6E A;  2EZH A;  4ZTJ A;  1WI9 A;  2AS5 F;  2DPU A;  2FJ1 A;  1X58 A;  1WWX A;  2DA2 A;  2PFB A;  2MD0 A;  1K6Y A;  1M1E B;  3EQL F;  4PJ0 C;  1JGG A;  3LSJ A;  4ITV A;  4PGG A;  4XSX F;  2KHM A;  3NWS A;  3OYL A;  1S8N A;  1S72 I;  3P9K A;  3U1D A;  1HQC A;  3FDY A;  2L4M A;  4I76 A;  3BT9 A;  3K2A A;  2EZI A;  3IWZ A;  1YX5 A;  2JWT A;  1B72 A;  2VC0 A;  2QUF A;  3DKW A;  1C0W A;  4IL6 C;  3S3M A;  2M5W A;  4NQW A;  1MDM B;  1IXR C;  2I5U A;  2LLK A;  3ZN1 A;  1JI8 A;  2W1O A;  1Z67 A;  2V1N A;  4N9H A;  3I53 A;  4KA4 A;  3E7L A;  5B1A H;  2OC6 A;  3RQI A;  2LDU A;  2M4G A;  3CC2 I;  1TLH B;  3KX2 A;  2Y48 A;  3F9K A;  1X3Z B;  2PJR A;  4HOB A;  3HEF A;  1G3W A;  4FET A;  3K4M A;  4A3B J;  2EPF A;  3M1C A;  4WXH A;  2QA4 I;  4M3F A;  3PQK A;  3GLX A;  4RB1 A;  3VEP A;  4IHY A;  3LA3 A;  1QZZ A;  5KCM A;  2IGK A;  2DDA A;  2WAQ N;  1D1B A;  3E0J B;  3GYH X;  2MFZ A;  3H36 A;  4A2U A;  2HXO A;  3BQY A;  3DEU A;  2O9L A;  1I3Q J;  4I99 C;  4P5O A;  1JKQ C;  1W5C C;  3CCS I;  2W57 A;  4BDZ A;  2Y2Z A;  1FBU A;  4BU2 A;  1LKX A;  2CUE A;  3CUQ B;  3HGY A;  2NVU B;  2R7W A;  4I0B A;  3FKJ A; 
#chains in the Genus database with same CATH homology
 3ERM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...