3ERMA

The crystal structure of a conserved protein with unknown function from pseudomonas syringae pv. tomato str. dc3000
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
67
structure length
67
Chain Sequence
VDRKLADAHDQMLELAELLTDVLIKNVPGLSEKHAEDASIYMAKNRAVFAAAFKNNATALSELSEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized conserved protein
publication title The crystal structure of a conserved protein with unknown function from Pseudomonas syringae pv. tomato str. DC3000
rcsb
source organism Pseudomonas syringae pv. tomato
total genus 21
structure length 67
sequence length 67
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07130 YebG YebG protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.710 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A PSPTO_1197 like 3ermA00
3ERMA
chains in the Genus database with same CATH superfamily
4XOPA 5L3FA 2EV0A 3CCSI 2CW7A 5FD6A 2NOJB 2NVTJ 1ZG1A 1HW2A 2OA4A 2ZKZA 3V8KA 2DMPA 4IOAF 1GHCA 4BJTA 1LQ1A 2AQFA 1XD7A 2M34A 2BHYA 2X1EA 4DBQA 3S17J 2K7LA 4AU7A 3QPSA 2F4OB 1IJWC 4Z6YA 3GZ6A 3GTPJ 2VOPA 5FO5A 4M9XA 1TNTA 2CWEA 2OC6A 3DTEA 3EUKL 5D8KB 1DQUA 5FLXZ 4EM1A 5CJ9A 2LMDA 4BAYA 3LSMA 3S1NJ 4HRIA 3HYIA 2KHMA 3ERED 2DA2A 3WTSC 4L18B 3V7SA 2VBYA 1BL0A 1XSVA 2L01A 3BWGA 3JRFA 2JZYA 3JSPA 5KVRA 2EILH 4HV5A 3TQNA 4E7SA 4KN4X 1OMIA 4A3FJ 3GVAA 5HDGA 5FLXK 4WWCA 2A6TA 1MNDA 4NNJA 3VPRA 4U0WA 4U0YA 5J1RA 4YIFA 2GIVA 2K85A 1KA8A 3VYSB 1SEUA 4ITVA 1EJ9A 2M9HA 3G3ZA 2BW3A 2W24A 5E3NA 4C2UA 1FX7A 3F8MA 1USSA 2W84A 4MQ9F 3PQJA 1WI9A 2P6TA 2V1XA 4WK8F 3WHBA 3H5AA 5FGMA 3ZMTA 3OL4A 4G7ZF 5F1JA 3KYDB 2VKEA 2CUFA 2XGXA 2K27A 3L2UA 3FBIB 1TC3C 2OCCH 5HDKA 3HSRA 3WTUC 1YTYA 3NWTA 1VQ7I 5FRNA 4IOCF 3GWZA 5LLQA 3H0DA 2NVUB 1Z0XA 4P96A 5F27A 3R0AA 2VC0A 1D8KA 2LKPA 2X48A 2PQ8A 4IRGA 5K7HA 1PP7U 2K4JA 2LYCA 4BJ6C 3JRBA 1EV7A 1T33A 4ABZA 2Y75A 1APLC 5EGOB 2GQQA 1K7AA 2UV1A 2IGOA 2VASA 1QO0D 3DEEA 3FK7A 4FT8A 3DXJF 3FKIJ 1U78A 5E79C 4ZC3A 2K9MA 2V79A 2O6GE 1KU2A 2RNJA 4A3CJ 2JQ7A 5KNLA 4GGGA 4IVNA 2QVOA 2VXZA 2MSYA 1V5GA 2X6WA 2QLZA 2ZMEC 1J5YA 2R0QC 4DYRA 1JHHA 3E6DA 1H9TA 1D1AA 3AAFA 5F04A 2LD5A 1T0FC 4EJVA 2YUSA 3I56I 3WTZA 1WRJA 2LH9A 4HBLA 3S1RJ 2E2IJ 2ID3A 2J5PA 1JGGA 1X1BA 2XAHA 4LLLA 3TL4X 3HKZA 4V2GA 1VQPI 2HVSA 3I3LA 1O4XA 2V4JC 2DTZA 4PJJA 1X2NA 1VI0A 2ME0A 4KYWA 4XM3A 3NARA 3GCMA 2DLLA 3G6EI 4O3MA 4KIGA 1GUUA 1ETKA 3CCMI 1X19A 1XGSA 2JMWA 4ZDLA 4DNCA 2CQNA 3CLQA 3MZYA 1W0UA 1YHQI 4JX5A 2RREA 5DDGA 4L9JA 3K4JA 2PBIA 2HXOA 2GIZA 3CMYA 1EH7A 2M5WA 2DQLA 3QQAA 5D5XB 1I3QJ 2LK2A 3HRTA 2RQPA 4MGRA 4NB5A 3VSLA 2EFWA 4MHGA 4HV6A 3F8BA 5BMZA 3BG7A 2OPTA 2V6CA 1IUFA 4DYCA 5D6EA 3E1SA 3SZPA 2OZ6A 1FYMA 3HOYJ 1Y6IA 2GOXB 4LK0F 3TP3A 3A01A 1Z6TA 4UB8C 4E70A 3KLOA 1C0WA 1JKPC 3ABUA 4IZZA 3PO2J 2DJIA 1MMAA 1G3SA 1MBHA 3VFZA 1MBKA 3DTIA 4M6VA 3V7RA 4ON0A 3F9KA 2FXAA 4RGSA 5TRDA 1Z3XA 1W4MA 2I10A 2VE8A 2X0LA 2R7WA 2AXLA 3EYIA 1P4AA 2KDOA 1XMKA 2FE3A 1HQCA 1LJ9A 2FMYA 3IH3A 2STTA 1D1CA 3SEQA 2WB1A 1OCRH 3M8JA 4I02A 4HAMA 2JUGA 3FWEA 1G8XA 1JUPA 1DDNA 2Z16A 4UHTA 3LAJA 4E7HA 3CCJI 2YR2A 2FNPA 3T5XA 2E5NA 2IA1A 1YS6A 1X4OA 3AG1H 3CJNA 3QODA 4G6TB 1MMDA 3BG3A 3EUHC 4YRVA 3JRDA 4B44A 1ETQA 1EF4A 2XVCA 2HVQA 1G2HA 3I4MJ 2R7OA 3X2QH 1D8JA 4U87A 3ASNH 3I54A 2VN2A 1HSTA 1HKQA 3KZYA 1IXRC 1A6QA 4JX6A 4XN0A 3TMOA 5J8CA 2A5YB 2NRAC 5D6FA 3S1QJ 2OBPA 2Y0SN 2GWRA 4LLNA 2E1NA 4ESBA 1Y8RB 5CVIA 1E2XA 3ZP5A 4F3QA 3ZQHA 1TL8A 1XN7A 1Y56A 4DOZA 3AKZA 2M3AA 5E8GA 2DK5A 2WA0A 4FETA 2QQ8A 2EZIA 4UXNA 1ZREA 3ZQFA 1KU3A 2HTSA 3OYDA 2LTPA 4IQ4A 3BZCA 1I27A 4D1QA 4XLHA 5E1ZB 1FTZA 2ADUA 3ZPLA 2AXTC 2PJRB 1MBGA 4CICA 2VQGA 5GTIC 1DU0A 1ZRDA 3J7AO 5JHFA 4LMYA 4J01A 2ZMEB 4G6QA 3WE3A 2JPCA 1KQ0A 1UCRA 1I5ZA 5KCMA 4BY7J 2E1MC 3FMQA 3MCZA 1YYVA 4UB6C 1Z7UA 3VYUB 4MTEA 2OCEA 3MKYB 3OYKA 5DD4A 2DAOA 4F91B 4IHSA 1QZYA 3DU6A 4AM3A 3CJRB 3FXLA 4WF2A 3QYFA 1FOKA 1OISA 3CZ6A 4PCQA 5FROA 2X6YA 2EIMH 4H4KC 3ROUA 1VQNI 3BPXA 3D5SC 1RKWA 3LSPA 2NOGA 1SFUA 4AIHA 3F8FA 3MD2A 2HR3A 4HSRA 4Q5SF 4ZDOA 2DYSH 2GBYA 1S7OA 4S0HB 1N75A 1T6SA 4EEFG 5GAEJ 4HNUA 1GT0C 3IV5A 4L9NA 5KK1A 3E0JB 1W7PA 3HB9A 4HA8A 3L1PA 2QGUA 4X6AJ 1W0TA 1R5HA 1VF9A 2I5UA 4YELA 4UVCA 1EH6A 1FYKA 2PEXA 3DLLF 4E7KA 2W4SA 1XB4A 5KAIC 1ETOA 2V1DA 2M87A 4MFDA 2FU4A 4ZDPA 2HPMA 3RDIA 3FXMA 4CA0A 3V4GA 4X0GA 2R7RA 1ZR2A 1XC5A 4CO8A 2VPLA 2HGCA 2F2EA 3ONQA 4I76A 4CYCA 5JI6A 2P6SA 3FKJA 4M3DA 1F43A 2M45A 3A4CA 3K4NA 4OINF 4ENMA 2Q2EA 3BP8A 1XSXA 4BHCA 4XLEA 4M74A 2VJ4A 2K3FA 1S72I 3QPHA 1WJCA 1X4PA 3BG6A 2VUMJ 2LSOA 2LDUA 2L7KA 2JTVA 3DBHB 4RMNA 3PNVA 4UY8I 4DZPA 2F5DA 2XKOA 5JLWA 1WCMJ 2ISZA 1R1UA 5J8FA 1VNDA 3IRQA 2EZHA 4RLFA 5J47A 2ZCWA 2LVSA 1Y1VJ 4PZJA 2TDXA 4PFPA 1IN5A 1TZLA 2OJED 3DU5A 4OWRB 1T8IA 1ETYA 2EV6A 4WXCA 2L02A 1KZHA 1ZRFA 2X85A 1BI1A 1XGMA 3N05A 2B9SA 2IBDA 2MW8A 3S1MJ 1JXSA 3EUHA 1ZAOA 1K78A 4B09A 1H8AC 5B1AH 2ZJRF 1R9TJ 3FXJA 3L2VA 2O0YA 5FFXA 2P5LC 4BDZA 4QWQA 1ZRCA 1PVEA 2BY0A 1R1TA 1K4TA 2HXIA 1JKQC 1P4WA 1BJAA 3COAC 3UR3C 2WY7Q 3N4MA 2Q1ZB 5J3LA 4I0BA 4P1WA 2QWWA 4KN7X 3S93A 3BQYA 5H20A 3ZXSA 2CV1A 2UXXA 1AKHA 2K3PA 2V9KA 1LEBA 5ILUA 1G3WA 4QLCU 3PQKA 3D5RC 3C2HA 3U9GA 2XPWA 2LKXA 4M3GA 2LLKA 1ZN2A 3H36A 5EDNA 1KQ8A 5E8IA 5FKMA 1HKSA 1S6LA 1CF7A 2MH2A 1YG2A 1YE9A 1YW9A 3OY9A 4IL6C 3MKLA 5BQTA 5K5OA 1NG7A 1IAWA 3DQVC 2MLGA 3PIOF 2E1MB 1T56A 4HX4A 2ME6A 1BN5A 3F23A 1AOYA 3GZNB 2FUG2 2RDPA 3ABLH 3MEXA 3FHNA 2IPQX 1RI7A 2KRFA 1BIBA 2QSFX 3LA7A 2DA1A 4A3MJ 3CCRI 1Z67A 1R1VA 4MLOA 1X1DA 2MBFA 3J81K 2L9SA 3W3CA 2M7BA 2X6OA 2CFXA 2XRNA 5K5RA 2OAZA 3DKYA 2CSOA 3BR3A 3HJEA 3HTUA 3OYAA 4PGGA 1UFMA 2FF4A 5B5EC 2NVYJ 5F1RA 1ULYA 3GTGJ 4DJAA 2EFQA 2HQAA 4PJNA 1SD4A 4P5OA 3E7LA 1Z77A 3ABKH 2JVGA 2FBIA 4PJMA 4A93J 1FSHA 2JA7J 1VZ0A 3BTIA 3FBNB 5IT3A 4A3IJ 2ISYA 1Y0NA 3Q9SA 2VIXA 3T8TA 2E36A 4E7ZA 2KKOA 2NXNB 2P7CB 1WHUA 4Q4ZF 3WU2C 1UHMA 3W2WA 4IKFA 1MDMA 1J2XA 2PMUA 3DFGA 4HQEA 2W82A 3ZQLA 4HDVA 4MEXF 2HTJA 5EZGA 4EV0A 4ZH4F 3ZQGA 1F4KA 4X1EA 4ESFA 1XS9A 2L7MP 1E3OC 2KRHA 2R3SA 4HX7A 3JRGA 5FKOA 2HDCA 1IG7A 1P4XA 1HW5A 3C18A 1OCOH 3TDZC 4J19A 1HDPA 5HOOA 1BM9A 2LY1A 3LA2A 1SC7A 2HFHA 2LKSA 4KMFA 1I6XA 3HUGA 5LEKA 3AG2H 2Y9YA 1FMVA 3OR1C 1UAAA 3JAMK 3HG9A 1UELB 5FKLA 4UUSA 4KA4A 1I6HJ 2BVMA 3CC7I 4IQJA 2XB5A 1POGA 4ZZDA 3ZQCA 5DEQA 1WQ2A 2XGEA 1B72B 1GV2A 1T08B 5IOYA 2G7UA 2UUZA 5FB2A 1KGSA 4F7ZA 5F6FA 1UHWA 3JRIA 4V19K 2UWMA 3DLAA 5EEAA 1D0ZA 4MO7A 2FX0A 2HDDA 2EFNA 3M4OJ 3DEUA 1VQKI 2L9VA 4BQQA 3OSFA 2R7DA 3ZCOA 3U21A 3R61A 2RVCA 2P4WA 4I0AA 4FX0A 1WJAA 2WV1A 2IVMA 1X1CA 2XAUA 1VQ4I 2GXAA 2HS5A 3HBLA 3O2PE 4N4NB 4HPQA 3ZQIA 2P81A 3AL0C 2BVLA 3MQ0A 4WXHA 4KISA 5H6RA 1JKRC 4PK4A 3ZOBA 3HOVJ 3M8EA 4PSWA 3HSEA 4XRSA 4EQQA 4HW0A 3SZGA 3CC2I 1BI0A 1BW6A 2PI0A 1RIOH 3NWSA 1R4MB 1V5FA 1Z6RA 3CQZJ 1MZBA 1QHHD 4H0EA 4HF2A 2LG4A 4RLQA 2QQBA 4DQ2A 2HYGD 2XPVA 2J5OA 2P5VA 3ZMUA 3OYFA 5DCMB 3MZHA 1PUFB 2NYXA 2XAGA 3J80K 1WWXA 4LLGF 2HOAA 3RYRA 1K79A 3LMMA 1IGNA 3ELKA 1LNWA 1IXSB 4BQAA 4EMSA 4YFKF 2KIUA 4A3JJ 5B1BH 1OCTC 5FJ8J 5IY5H 2P0WA 1R5GA 2XF6A 4S04A 4L5IA 3SEZA 1GXQA 3H9JA 5KAFC 4XLFA 3LSGA 4XORA 1O3QA 1ZHFA 2OD5A 3DCFA 4BHBA 2GAUA 3IH2A 1SVOA 1X1PA 4PFOA 2M4GA 4BNCA 1J7KA 3I58A 3WE2A 2IS4A 3LQRA 2XPUA 2VBXA 2CO5A 2JPBA 2IGNA 3SJMA 1BR2A 1LDKB 3K4MA 2VODA 3GFIA 4EJOA 2XV4S 2DOEA 4UUTA 5LGUA 2VONA 3TO7A 2NAZA 1P92A 2ELJA 1N25A 2H1LA 2WAFA 3L7WA 1MH4A 2PMZN 2BOLA 4C9YA 3KP4A 2WAQA 3ZR8X 4IO9F 3R0JA 5JHUA 1OYIA 1TT5B 3OIPA 4C2MJ 3L00A 4XOTA 2VJIA 1MJBA 2Q8KA 3RKYA 5CQEA 2VQHA 2UXNA 3DEWA 4YIIA 5FRMA 1SD7A 2KIQA 1YOVB 4A6DA 3Q0UA 4PDKA 5LFAA 4M6YA 2DT6A 1FEXA 1OJLA 4NUBA 3FM5A 1WSUA 3HOWJ 3I0TA 1JTYA 5HDNA 4ZYDA 1IN7A 1PDNC 1YJWI 4MEYF 5HLIA 3U1DA 3HL2A 3QRFF 3TW6A 3CC4I 2VT3A 4XQFA 2ZO4A 5C4JJ 3P9CA 1YITI 2NVXJ 1E0EA 1FY7A 3KP3A 1ETXA 1SVMA 3Q0VA 1W7PD 4A0YA 3F3XA 4L5EA 3SFIA 3V8LA 3IL2A 4KDPA 3I64A 1JUSA 2HYFA 2Y69H 4KICA 1OYWA 2XRLA 5IYBJ 2KIFA 3PUFA 1OYYA 4JP0A 4XIDA 4AVZA 1JT0A 3ECHA 5HS7A 3MAJA 2BY1A 3ABTA 2NS7A 1TWGJ 2DODA 3RJPA 3K70C 1RRJA 1HC8A 3NEUA 3ZMSA 1J09A 2KP6A 3MKWB 4JX4A 3I9V2 1GVJA 2ZJPF 3HIFA 2KL4A 3AL0B 2M8GX 3HPGA 3GW2A 3K4CA 1OQYA 3IP4B 2VBZA 3T1BA 5EG0B 1XGOA 4LG0B 1XDSA 1ZLJA 3E5UA 1S9HA 4MNUA 1S5LC 2V9PA 2EH3A 4NQWB 2EQRA 4EGYA 1QVUA 4Q47A 2XB0X 2QCOA 3BTCA 5C44J 3LAPA 5ICCA 4GRIA 1J0RA 2XF7A 3ZGKA 1BOBA 1B8IB 5FD5A 5EGOA 1I3AA 3CCYA 5CYVA 2QM3A 4HLXA 3WGIA 1HF0A 1J75A 3FMRA 4A69C 4G6DA 3B6AA 1SANA 3BR5A 2IRFG 4U88A 4LIVA 1LFUP 3KEYA 3PM1A 3KEOA 3WTYC 5LGNA 2R5ZB 4YG2F 1A35A 4BQOA 3BTLA 4ZYEA 2JK3A 1WI3A 3HOSA 2GXBA 1LUJB 2HPIA 4IHXA 3HGGA 1D5VA 3J7YJ 2M2EA 3TP0A 1RETA 5B3SH 4Y17A 2NNNA 2RNGA 2H8RA 3FISA 5IPAA 1QA6A 1MBFA 1VQMI 3VWBA 4A3LJ 1QZZA 3E6MA 4DYQA 2PX9A 1HDDC 2XF5A 3K4LA 1ERDA 3IHUA 3LSJA 1WFXA 1UB9A 2EZKA 3MVPA 4N9IA 3H3ZA 2G7HA 4KITB 3K69A 3S2HJ 2DN0A 3E6CC 2DOFA 4MFEA 2KJBA 4C3HJ 4I2OA 3FXKA 4XK4A 4Y4RA 1WJ5A 4XR6A 4HX8A 3RZDJ 1FP1D 2KLOA 2OTLI 2XIGA 3CO7C 1SFOJ 5ED4A 3F21A 2X1CA 3CF2A 1STZA 4RAYA 2DYRH 2NNYA 2Z5UA 1XX5A 1XSDA 5LHHA 4CDGA 3S16J 2X51A 2E2JJ 4V2FA 1DU6A 4XRSG 1V5EA 2QEXI 3ZMDA 1BBYA 3K2AA 1OCCH 2OZUA 4ZYHA 5E17F 1TWHJ 4E4HA 2P5KA 1W36D 2IS6A 2OQRA 2IA0A 2DTRA 3BLYA 2ESNA 1RR7A 3SXYA 1B1BA 4AIDA 1H88C 2FA5A 2YU9J 1E17A 3BY6A 2X4HA 1TBXA 2LREA 3CMMA 3L9FA 2LOOA 3RPUA 2R5YB 1S8NA 4G7HF 2W25A 2H8WA 1O3RA 5EYRA 4PJ0C 5D8LB 5F0FA 5L3GA 2IGKA 5FLMJ 2AQEA 3OYIA 3CCUI 4XKVA 1UG0A 2FEZA 4F93B 4JK1X 1ZQ3P 2QYOA 1RUNA 3C2BA 4XLCA 4BS9A 3RCOA 2ZBKA 4CXFA 1XMAA 3D0SA 4ETSA 2TCTA 1UZCA 2LY2A 2ZSHB 1FSEA 5GTHC 3M7GA 3L2RA 2TRTA 1WJDA 1BI2A 1KU9A 3GFJA 5GAGJ 2V1NA 1FIAA 5E1XA 4GDFA 4XSZF 2BYVE 1EH8A 5AIPA 2GLOA 3BROA 3EETA 2ZSIB 4CCJA 1G3TA 2E7WA 1MSFC 5M3FJ 2BXYA 1TWCJ 4L0YB 1YW8A 1OR7C 4EM0B 1U6GA 3IWZA 4L9TA 2JUCA 1IW7F 1MD0A 2E1OA 4AVPA 4RB3C 5DYMA 3REOA 3CCEI 4I99C 2K02A 3HM5A 1OLTA 1U0JA 2IAIA 2H6BA 3C2GA 2HOTA 2MD0A 4D7NA 2QQAA 2R4GA 1QU3A 3I5UA 1OPCA 2XUBA 4HYEA 4S05A 3PJRA 4E7JA 3CJQB 5IT9Z 4XICA 1F36A 2MABA 3BJ6A 2PJRA 4WX9A 2BZTA 1PUEE 3CUQC 1QPMA 2AHQA 2E7XA 2M1BA 1ZGWA 2A6HF 5C3EJ 1LVAA 2ZMEA 3EUAA 1TWAJ 2LBFB 3FXUA 5GP9A 4A2UA 3R60A 3W6KB 1T0FA 3GX4X 1P2FA 2HI3A 2KPMA 1MGTA 4A3KJ 5IT9K 1T39A 1TQMA 2F5FA 3J7ZI 2L0KA 2DFHA 3BG5A 4A3BJ 2ETHA 4UV9A 3H3VK 1FC3A 3L2CA 3K9TA 2QA4I 2Y0MA 4EGZA 3MN2A 4BXFA 3LFKA 1ZG3A 2ID6A 1R4NB 4LB6B 1MMNA 1LB2A 2MC3A 1NK3P 2ZXHA 3OS0A 2VLAA 3FZVA 3VDXA 4A6EA 1BI3A 2EA4A 4CCOA 1O3SA 1RESA 5HVQC 1MW7A 1D5YA 2VI6A 5DUIA 3KYCB 1U5TB 2KMUA 2Z33A 3A0BC 4AYBN 1YFHA 2CRGA 1R36A 1VQ8I 2EBIA 3OYMA 1DUXC 2VJ5A 3HC7A 1UJ8A 3K7AJ 3ISPA 5EEGA 2KRCA 5J4YA 1D0XA 2GA2A 4II3A 4J00A 2MA3A 4KFCA 2DA5A 1MMGA 1XDUA 4M9ZA 2F4IA 2IP2A 3QP5A 4AIJA 1RKTA 1Z9CA 2CUJA 1YJNI 3C1DA 2E71A 3K0LA 2IS1A 2PMHA 2R7XA 4OIOF 4N9HA 1MH3A 2L4MA 4JOMA 5K7FA 4BBRJ 1EKEA 3GYHX 2JVHA 1XMXA 3L09A 3OSGA 4LJZF 3TOAA 5BPIA 3KP7A 4M9SA 5FKNA 4RB2C 4UUVA 3PUBA 4A0ZA 3RTRA 4IRHA 1ZELA 5F64A 3K10A 2A61A 5J4VA 5EJCA 1MIJA 2EIJH 3M1EA 4FISA 5CKTA 3K1PA 3LWFA 3GMEA 2ESHA 5GPAA 3B6CA 1MMSA 2BV6A 4JBAA 1VTNC 2JT1A 3ASOH 3ML6A 1U3EM 2Z9OA 2KISA 2N8GA 2VKHA 1A5JA 1IDYA 1W1WE 1MNMC 2Z3YA 5E3LA 5JLXA 1W5TA 1P6RA 2VBWA 5CPRB 4ZTFA 2O9LA 1ONVA 1UHSA 2CQQA 2VPRA 2BHZA 1M1EB 5D4RA 4OMYA 3IWFA 3P9IA 2CQKA 1E3PA 2RC4A 2DMQA 2A5WA 2WY8Q 1DGWY 1X3UA 4BXUA 4XLAA 3HRUA 1WH5A 5ICEA 3JRHA 2XASA 3VODA 1XTAA 2Y9ZA 4DGWB 3HHGA 1KYZA 4HG2A 3IUOA 3KFWX 4A3EJ 3D1NI 1WJFA 4BUPA 2E60A 3WU1B 1NHAA 3CUQB 5HLGA 3WG9A 3S32A 4FCYA 5TJJA 3S8PA 4G12A 3OYBA 1T2KA 4P9FA 3FXRA 3TW7A 3ESWB 4ZTJA 4BU2A 2R7UA 2BE5F 2E1CA 1IN8A 2XAFA 2Y30A 2EFOA 3S3NA 2CV0A 1IN6A 2MFZA 1QZEA 3JTGA 3L2WA 1FP2A 2WADA 1ZH5A 2HNHA 2HYJA 2EINH 2ECBA 4YIRX 3HGYA 2VXDA 2NS0A 3PNTA 2JSPA 4HZFA 1Z1DA 2X9DA 2F4MB 3PSFA 4B1RA 3ZMZA 3LSIA 4LGWA 3DKXA 2VOOA 3F72A 1WPKA 1L0OC 4JQFA 1WVRA 1QQIA 4BEHB 1G3YA 2L54A 4LK1F 4C3JJ 1U8RA 2Z99A 3LQQA 3PSIA 2CS3A 2H6CA 4B47A 5EF6A 1B59A 2ECCA 4CYDA 1XGNA 1D1BA 1Q1HA 2GM4A 3KE2A 1S29A 2DDAA 3O6BB 4B48A 3KP6A 3O8HA 3HKZN 2CUEA 4YFXF 2DMNA 4F55A 5HNHA 1VQ6I 1WKMA 2EJRA 1YRNB 4B4CA 3CCLI 3WODF 2L2OA 1IF1A 2HZDA 3TBIA 5GADJ 1HCRA 2R7ZJ 2OQGA 4CUGA 3T0YA 3RKWA 3O3KA 3ZQ7A 3OS2A 2CG4A 3OIOA 1ZARA 5IYDJ 4BY1J 2QF7A 1H0MA 1XG1A 5L3CA 1XPXA 1RR8C 4MIMA 2MG4A 3NQOA 1R00A 3GXOA 5J40A 3WGHA 2D1HA 1A36A 1IRGA 2O5RA 2FOWA 2KZVA 1JGSA 3BQZA 4A12A 4M71A 2XDVA 2CV2A 3A03A 1IO2A 3TO6A 1IDZA 2DW4A 4Z2YA 2HQNA 4FTHA 2CFOA 1B72A 2QBYB 1S7AA 4II2A 4B43A 2M4KA 4HEA2 1FMWA 3BJAA 3SDGA 4D5FA 5IOZA 2IA2A 3CJTB 4NC7A 3LNQA 1G59A 6PAXA 2HKXA 2Y0SA 3PO3J 3F8NA 3NRVA 3E5QA 2HU9A 3K1NA 3GFLA 5DUKA 4GO1A 3W2AA 4KT5C 1YIJI 4FE4A 5ICFA 4AWXB 4ENKA 2CH0A 2DCEA 1RNLA 1FT9A 3C7JA 4M3EA 2IXSA 3WU0A 2DA3A 3V8JA 4B3AA 1Y8QB 2R7TA 2DMUA 2EB7A 2H27A 3I59B 4EJWA 3RZOJ 1JUMA 2WB1N 3N97A 4CGZA 2AO9A 3P5JA 3RYPA 4EJUA 5LRSA 4BBSJ 2HKOA 3RPUD 2COMA 4BH9A 3DBLB 4OAYA 3RKXA 3OOPA 2ZJQF 2DK8A 2HOEA 2W85A 3E6BA 3ECOA 3I55I 1CGPA 3BTJA 1FBQA 4RS8A 3CF5F 1K6OA 3QP6A 4R1HA 1J9IA 1R5ID 5E3MA 1QPIA 2FD5A 3GLLA 1MBEA 3H92A 3G4SI 4R8HA 2FQ3A 1LE8B 1MJAA 1EA3A 5DTDA 4FHTA 5DCMA 1PUFA 1VFCA 2A07F 1OCPA 3RI4A 2L7ZA 4DBRA 5E3OA 1FWZA 4BE2A 2F5EA 1TW2A 5E20A 5H2FC 2L9RA 2RGVA 4C2TA 3Q9VA 4QTRA 1R7JA 1JT6A 3QAHA 5IP7J 5DD8A 2YSRA 3I4NJ 1Y0UA 4I01A 4E7IA 3B02A 3IH4A 2MD5A 5D5WB 1W5SA 2K9SA 3PFYA 2IGMA 1H9GA 3AG3H 4E7LA 2YS9A 2DFEA 5EEHA 1JTXA 1Z05A 3GBGA 5HLTA 2W48A 2Y31A 2FRHA 3GFMA 3WG7H 5D4SA 1B9MA 1PP8F 2K4BA 2A05A 1SMYF 1X1AA 2K40A 3HSFA 3CD6I 4YFNF 3JR9A 2GZWA 3K4KA 2D2WA 2E35A 3CP8A 4CCMA 4UVBA 1IRFA 1PJRA 2DFFA 4RDUA 3JRAA 4WCGA 4IF4A 2PLYA 2X6XA 5JFRA 2W1OA 4CSWA 3GTOJ 3ZMVA 2EWNA 3DWLE 3LSRA 1G6NA 3R6SA 4GCVA 2CQ7A 3CMEI 5HNFA 3JW4A 2LC2A 4LD5A 3PNYA 2R7VA 4ZYAA 2JA6J 3CLOA 2G9WA 1G4DA 1FOXA 1FLIA 4RAFA 3VYRB 1U2WA 2O3FA 1IUYA 3LFUA 1XCVA 4L5JA 4HNTA 1YJ9I 2K9QA 2MH9A 1BIAA 5M5WJ 3OYGA 4JYKA 2MGQA 2R93J 1UMQA 3BCAA 2FBHA 3SDBA 3TO9A 3LOCA 2L7FP 2R92J 3CDIA 5LGTA 1FBUA 5DCFA 1T38A 2YU3A 5FKKA 4XKWA 3E97A 3KLNA 2HQ5A 2KQRA 1E3HA 2EV5A 4IJAA 1CQTA 3CCVI 1QGPA 2XC7A 1SFXA 4ZZLA 1TNSA 1LKXA 3C3WA 3FXQA 4ESJA 1N77A 4FX4A 3HDDA 3GO5A 2IS2A 3J7AY 2W7NA 5JVGF 1BOAA 3HEFA 1V54H 2V9VA 2ZC2A 4XNFA 3DBRB 2G0EA 2R7FA 3DF8A 4RAZA 4OMZA 5F0CA 1HLVA 1QVTA 3VOEA 4A5MA 3E3VA 2COBA 3UKGA 1TWFJ 3BG9A 2LFBA 2WTEA 5CLSA 1Y39A 5M5XJ 3TOBA 3F6OA 4N0BA 5BOXA 1MJ9A 4U7DA 2V1UA 2BBYA 3IAM2 1MKMA 3LSTA 4D0PA 3A0HC 2BY2A 2L4AA 3IAS2 3M8FA 3VEPA 1AU7A 5LEJA 1GVDA 1OFCX 2BW3B 1L3LA 2MC4A 3AG4H 1ZKGA 5EG0A 1SFKA 4LG0A 4AD9A 1QHGA 2E19A 4RGXA 3R4KA 4EM2A 1Z3YA 4NQWA 3FIWA 1V55H 4Q48A 1NH3A 1R58A 4BKXA 2CUZA 1RUOA 4BQNA 4RA2A 1B8IA 1FIPA 2ZXJA 1IC8A 1H89C 3H5NA 3S15J 4Y33A 3K2ZA 3S2WA 1R6RA 3HXLA 3QWLA 5L3DA 3Q5FA 2DPDA 3FK6A 2JA8J 2WC2A 4MTDA 2KFDA 2R5ZA 1KYWA 4RM2A 1ZLKA 5ICGA 5J1YA 1U9OA 1S3JA 2LF8A 3M9AA 3CO6C 1MBJA 5K7ZA 1NK2P 2DXIA 1TW3A 2O03A 2M8EA 4FE7A 3VB2A 4CH7A 4OIPF 3ZQQA 2H94A 4LB5A 3CCQI 3MZ8A 3RIRA 4LG3A 3RQIA 1R71A 2F6CA 4D7MA 2DMTA 2XSJC 4GYIA 3UNGC 3OR2C 4EATA 3HOTA 3OMYA 2DQRA 2XKPA 4Y13A 2EK5A 1LFBA 5AIQA 4Y7NJ 1FTTA 2ICWG 4BJ5C 5LD2C 4UVAA 5DM6F 1U9NA 2IW5A 3OS1A 3IKVA 4PJLA 4RB1A 2HVRA 3OYHA 5ILSA 2M0MA 2JRMA 4KNYA 1VQ9I 2ZNZA 3CESA 2KT0A 4AC0A 5GPCA 3F0CA 1FPQA 2NS8A 1WZ2A 1JI8A 1U5TC 3KETA 3OWTA 3QU3A 5K1YA 4L9VA 4HDUA 3H0GJ 5JVTA 2YX7A 4YEJA 2ZFWA 3HOXJ 2OTJI 3F6VA 5AONA 2QSGX 3OV8A 5FFZA 2RQQA 4XONA 2KJCA 3FHZA 3GF2A 2BEOA 1IRXA 3P9KA 5LHGA 3QPTA 2VKDA 2ZXIA 1FOYA 1JE8A 3K6GA 1WJEA 4HSTA 1AWCA 2HEOA 2LP0A 2H1KA 4Y52J 4G7OF 3A01B 1YX3A 4BGDA 3BOQA 4RBOA 1USTA 3I53A 2DU9A 4KIBA 3DPLC 1K4SA 1K83J 4IXAA 2R5YA 2HQRA 4A3DJ 2IT0A 2CQXA 1JKOC 2XAQA 2VC1A 2A6EF 4OOIA 3GUDA 2BXZA 2FJ1A 3CMAI 3BPVA 2LRDA 2ACJA 4U0VA 3IRRA 1ACIA 4BACA 2EZLA 4RB0A 3IC7A 4AUXA 4ZJZA 2HWVA 1F1ZA 1ITYA 3KZIC 2QSHX 3OYNA 3DPUA 1KU7A 1A31A 2V6EA 3BT9A 1IV6A 4HQMA 3LSHA 3OIQA 5J6XA 3JREA 4QIWN 1TP4A 2DOAA 4EVIA 2D1VA 2DT5A 1HOMA 4BXXJ 1SAXA 3GTMJ 2DA4A 2F5CA 1LPQA 4BDYA 2AS5F 2O8KA 3OOUA 1O7LA 4KIFA 3BJOA 4P55A 2L9NA 2PFBA 4M72A 5GAHJ 4QPOA 2CW8A 2IJLA 4A3GJ 1YIOA 1YW7A 1O7FA 1I50J 3AFHA 1V4RA 4GFBA 5HODA 3PL8A 1FYLA 2X1DA 4M3BA 1BR1A 1WH7A 2FMLA 5LHIA 3S3MA 3CTAA 3G71I 3S3OA 3WHCA 3BZKA 3G1LA 2K9NA 4D5CA 4ASNA 5CVRA 1FOWA 2R7SA 3A02A 4IX7A 3CDLA 2E5ZA 2LBFA 1HKTA 2QQ9A 3BR2A 4K2EA 2B63J 4N4OB 1R49A 2Y2ZA 2PG4A 1SFEA 3BZ6A 4RM3A 1BW5A 3DTKA 1D0YA 1J59A 4BHPA 3WTTC 4NC6A 2F48A 1MSEC 1MNEA 5IP6A 1OCZH 1IV8A 1QRYA 2FBKA 2PMZA 3FF5A 3P7NA 1TQPA 2PJPA 3KP5A 3T8RA 4XMYA 4L0ZB 3SZTA 1GXPA 3TEDA 4Y3OA 3L2QA 4KT6A 1KONA 1S7EA 2Q0OA 1DP3A 2EIKH 3I71A 1ETWA 3JCUC 4KMUX 3F22A 2GXGA 5L3BA 3WTWC 4O5VA 2O8XA 1W36C 3VSKA 4B8XA 1Q1VA 2DA6A 2JN6A 2RKHA 1U5TA 1HXDA 5JR3A 1Z21A 3FX3A 3WTXC 2JA5J 3FDYA 2A69F 1W7PB 1V3FA 2ZFUA 2E34A 4XKCA 4TV7A 3OYEA 3LL7A 1TTYA 1BR4A 3HRSA 1SMTA 2FQ4A 2VQCA 1TQIA 3PIPF 3EQLF 4P9UA 3FM3A 3PFIA 3KPHA 3H35A 1R23A 1ODDA 2ZNYA 3GTLJ 4RGUA 4NDLA 4QSHA 1ENHA 2GA1A 4CYCB 2WAQN 3W2VA 4CZCA 1I1GA 4NHJA 2KZGA 3ULQB 2Q2EB 4OIQF 3F8CA 2O61A 3G1MA 2XHKA 4IEJA 1KQ9A 2CMPA 4HNVA 5CVUA 5CVJA 5LRRA 3QYEA 3CDHA 4HF0A 5TGTA 5M3MJ 4BYYA 4BL0B 2P7VB 3K1MA 1YQAA 4O6JA 2VB6A 2WBMA 3TDUC 2EPFA 4E6KG 5C4XJ 3ABMH 3QOPA 3BR6A 2B7EA 2QKLB 2M7AA 1D3YA 2R7QA 2OV7A 3A1YA 1LDDA 3GLXA 5DM7F 2XSDC 1SVLA 1LFPA 4KUMA 3S14J 3D5LA 3U1KA 1XCBA 5DV5A 3IKTA 2MYSA 4C3IJ 3E5XA 4Y15A 4HOBA 1YI2I 4G9YA 1P9QC 3QOEA 1O3TA 3RSNA 1HA8A 3WGGA 1WGXA 3BC8A 2OUMA 4CHUA 3KP2A 5J1UA 1UG2A 5HLHA 4WXDA 2L3DA 1OR7A 3G73A 1K78B 2QZ8A 4XRFA 3JTHA 4M3FA 1I39A 4XSXF 3U2RA 5F08A 2W00A 1WJBA 1LEAA 1X2MA 3HOZJ 4KJZA 2D45A 4CCLA 4LIUA 2WV0A 4G8XA 3OYJA 1ON2A 5HS8A 1LVKA 3KCCA 3QPLA 2QKMB 3TKYA 2VJJA 4R79A 1AKHB 4LITA 1A04A 4EJTA 1FJLA 4U7BA 3CUQA 4F52A 1DPUA 4GXOA 2D5VA 4HLYA 1SD5A 4LFUA 3DV8A 4W97A 1YX5A 2DFIA 5EZHA 2ZXWH 2FOKA 3SYTA 2A68F 1CF7B 1JJ6C 1FNNA 3ERMA 1HBXG 4FQGA 2LR8A 3RQ4A 3RKQA 4IHTA 2K86A 1P7JA 5BS6A 4PGHA 4XLNF 1ON1A 3RPQA 4AIKA 3JSOA 1ZK8A 3J81Z 3BR0A 5FLVA 1FBSA 4DIQA 2CJJA 2MLKA 2LF7A 3CP2A 5F0HA 1HW1A 4W1UA 2PN6A 5ERIA 4ENJA 1A6IA 3BR1A 1VQ5I 3H3UA 1REPC 4FASD 5CQGA 3MFKA 3TGNA 1VQOI 3HZJA 1LDJA 2UZKA 3Q3SA 1K6YA 1B4AA 4QPQA 4BE1A 4XLPF 4BEHA 2FSWA 3I4PA 3EPZA 4XN3A 2VKVA 4CCKA 2WWYA 1DGRM 1YS7A 3M1CA 1FZPB 2LY9A 2ZB9A 4ZYGA 1HSJA 1IN4A 3M3YJ 3LSKA 2WAEA 1YLFA 2RN7A 1NG6A 1U8BA 3NAUA 2CYYA 5B66C 1YRNA 1NTCA 3KX2A 3A2KA 3GTKJ 2VT2A 2YX4A 4LOCA 3DPTA 2RV8A 2Z1DA 3GZ5A 1W5CC 2JSCA 2YPRA 1QBJA 3HRMA 3Q0WA 1MDMB 3H1CA 1JJ8C 1B6AA 1ZYRF 3ZRGA 2ELHA 2Z2SB 4M6XA 4C30A 2F5VA 2ZJ2A 1ZTRA 3HPHA 5HS9A 3W6JB 3ZN0A 4IRIA 1B9NA 1IRZA 2JA2A 2HOSA 4I98B 3GEZA 1BA5A 3JAMZ 3KIOA 3OYLA 1Y1WJ 3VYTB 1DP7P 3H5RA 1T95A 3GTJJ 3B73A 1YO5C 3QU6A 4A5NA 2OU2A 3HUGB 2HDWA 1N78A 2L5QA 4GYGA 3V7CA 2OF7A 2DDBA 2KIMA 1RC9A 4XRMA 2QBYA 4A0XA 2XGDA 3HTSB 4IHVA 4UUSB 4OAZA 1OKRA 4IPAA 1SAUA 4IHWA 1P7IA 4ANJA 3KYLA 3OL3A 2M0CA 1AHDP 5L3EA 3SQNA 2DBBA 4DZJA 3MMYB 5D5VB 2LNBA 4I6ZA 2B0LA 2BY3A 4XKBA 5ILVA 1GV5A 2CW0F 4UNOA 1RZ4A 4OIRF 2GOMA 4D9JA 2V26A 4UV8A 1ORKA 2VL8A 2DO7A 5E1WA 3SFZA 3BCBA 3V42A 1X3ZB 3MKZA 4PSXA 2A3SA 2K9LA 5IYCJ 4IHYA 3DP7A 3G2BA 4RGRA 3GTQJ 3I59A 1BC8C 5IP9J 2C6YA 2JRTA 3HOUJ 4XL9A 4NC8A 2K5CA 5A2QZ 2Y48A 1T98A 3OYCA 3M07A 1ZGJA 1PYVA 3WTVC 2DT7B 3MWMA 1QNTA 1VQLI 2XAJA 2DPUA 1F5TA 2E2HJ 2I8DA 5BPDA 3KEQA 3EYYA 2V7FA 5BNGA 1LE8A 3J80Z 1GDTA 1ETVA 3K70D 5A2QK 1Z91A 3H9QA 3H9GA 3K4BA 2DJNA 2FNAA 1DPRA 5H6QA 1K61A 3EDPA 5E18F 2O7OA 5D5UB 2M30A 3KZZA 1ZG5A 3W6VA 9ANTA 3SHFA 1X3WB 2XGCA 5LBQA 1BJZA 1GLNA 4ENNA 1IZ1A 4G94A 3BDDA 1BC7C 2VQLA 1TLHB 2CU7A 1I1SA 2QUFA 2IEKA 3ZN1A 5DS9A 2QENA 4OU0A 3FXOA 1ZR4A 2HZTA 1TT0A 2DA7A 4I09A 1AA7A 2W57A 2KDZA 2EFPA 2P8TA 1F9NA 1R22A 3S2DJ 1JHFA 4NBQA 4AYBA 2CGPA 3O8GA 1SD6A 2EA2A 3DKWA 4MQVA 5K5QA 2ELKA 5CVVA 2RAEA 3CUOA 3QYBA 2STWA 2NVQJ 2DI3A 5TISC 3FMSA 2XROA 1IXCA 4M73A 2JJ7A 5KHDA 4HF1A 3JRCA 4CZZA 2VE9A 4PUSA 3LA3A 1O57A 3HHHA 4CCNA 4F92B 5M5YJ 4RAGA 2BGCA 4I7HA 1Z7LA 3G1OA 1X58A 4B3XA 2JWTA 4DW6A 4BE0A 1ZGAA 4XBFA 2H09A 1RPWA
chains in the Genus database with same CATH topology
3ERMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERM A; 
#chains in the Genus database with same CATH topology
 4XOP A;  5L3F A;  2EV0 A;  3CCS I;  2CW7 A;  5FD6 A;  2NOJ B;  2NVT J;  1ZG1 A;  1HW2 A;  2OA4 A;  2ZKZ A;  3V8K A;  2DMP A;  4IOA F;  1GHC A;  4BJT A;  1LQ1 A;  2AQF A;  1XD7 A;  2M34 A;  2BHY A;  2X1E A;  4DBQ A;  3S17 J;  2K7L A;  4AU7 A;  3QPS A;  2F4O B;  1IJW C;  4Z6Y A;  3GZ6 A;  3GTP J;  2VOP A;  5FO5 A;  4M9X A;  1TNT A;  2CWE A;  2OC6 A;  3DTE A;  3EUK L;  5D8K B;  1DQU A;  5FLX Z;  4EM1 A;  5CJ9 A;  2LMD A;  4BAY A;  3LSM A;  3S1N J;  4HRI A;  3HYI A;  2KHM A;  3ERE D;  2DA2 A;  3WTS C;  4L18 B;  3V7S A;  2VBY A;  1BL0 A;  1XSV A;  2L01 A;  3BWG A;  3JRF A;  2JZY A;  3JSP A;  5KVR A;  2EIL H;  4HV5 A;  3TQN A;  4E7S A;  4KN4 X;  1OMI A;  4A3F J;  3GVA A;  5HDG A;  5FLX K;  4WWC A;  2A6T A;  1MND A;  4NNJ A;  3VPR A;  4U0W A;  4U0Y A;  5J1R A;  4YIF A;  2GIV A;  2K85 A;  1KA8 A;  3VYS B;  1SEU A;  4ITV A;  1EJ9 A;  2M9H A;  3G3Z A;  2BW3 A;  2W24 A;  5E3N A;  4C2U A;  1FX7 A;  3F8M A;  1USS A;  2W84 A;  4MQ9 F;  3PQJ A;  1WI9 A;  2P6T A;  2V1X A;  4WK8 F;  3WHB A;  3H5A A;  5FGM A;  3ZMT A;  3OL4 A;  4G7Z F;  5F1J A;  3KYD B;  2VKE A;  2CUF A;  2XGX A;  2K27 A;  3L2U A;  3FBI B;  1TC3 C;  2OCC H;  5HDK A;  3HSR A;  3WTU C;  1YTY A;  3NWT A;  1VQ7 I;  5FRN A;  4IOC F;  3GWZ A;  5LLQ A;  3H0D A;  2NVU B;  1Z0X A;  4P96 A;  5F27 A;  3R0A A;  2VC0 A;  1D8K A;  2LKP A;  2X48 A;  2PQ8 A;  4IRG A;  5K7H A;  1PP7 U;  2K4J A;  2LYC A;  4BJ6 C;  3JRB A;  1EV7 A;  1T33 A;  4ABZ A;  2Y75 A;  1APL C;  5EGO B;  2GQQ A;  1K7A A;  2UV1 A;  2IGO A;  2VAS A;  1QO0 D;  3DEE A;  3FK7 A;  4FT8 A;  3DXJ F;  3FKI J;  1U78 A;  5E79 C;  4ZC3 A;  2K9M A;  2V79 A;  2O6G E;  1KU2 A;  2RNJ A;  4A3C J;  2JQ7 A;  5KNL A;  4GGG A;  4IVN A;  2QVO A;  2VXZ A;  2MSY A;  1V5G A;  2X6W A;  2QLZ A;  2ZME C;  1J5Y A;  2R0Q C;  4DYR A;  1JHH A;  3E6D A;  1H9T A;  1D1A A;  3AAF A;  5F04 A;  2LD5 A;  1T0F C;  4EJV A;  2YUS A;  3I56 I;  3WTZ A;  1WRJ A;  2LH9 A;  4HBL A;  3S1R J;  2E2I J;  2ID3 A;  2J5P A;  1JGG A;  1X1B A;  2XAH A;  4LLL A;  3TL4 X;  3HKZ A;  4V2G A;  1VQP I;  2HVS A;  3I3L A;  1O4X A;  2V4J C;  2DTZ A;  4PJJ A;  1X2N A;  1VI0 A;  2ME0 A;  4KYW A;  4XM3 A;  3NAR A;  3GCM A;  2DLL A;  3G6E I;  4O3M A;  4KIG A;  1GUU A;  1ETK A;  3CCM I;  1X19 A;  1XGS A;  2JMW A;  4ZDL A;  4DNC A;  2CQN A;  3CLQ A;  3MZY A;  1W0U A;  1YHQ I;  4JX5 A;  2RRE A;  5DDG A;  4L9J A;  3K4J A;  2PBI A;  2HXO A;  2GIZ A;  3CMY A;  1EH7 A;  2M5W A;  2DQL A;  3QQA A;  5D5X B;  1I3Q J;  2LK2 A;  3HRT A;  2RQP A;  4MGR A;  4NB5 A;  3VSL A;  2EFW A;  4MHG A;  4HV6 A;  3F8B A;  5BMZ A;  3BG7 A;  2OPT A;  2V6C A;  1IUF A;  4DYC A;  5D6E A;  3E1S A;  3SZP A;  2OZ6 A;  1FYM A;  3HOY J;  1Y6I A;  2GOX B;  4LK0 F;  3TP3 A;  3A01 A;  1Z6T A;  4UB8 C;  4E70 A;  3KLO A;  1C0W A;  1JKP C;  3ABU A;  4IZZ A;  3PO2 J;  2DJI A;  1MMA A;  1G3S A;  1MBH A;  3VFZ A;  1MBK A;  3DTI A;  4M6V A;  3V7R A;  4ON0 A;  3F9K A;  2FXA A;  4RGS A;  5TRD A;  1Z3X A;  1W4M A;  2I10 A;  2VE8 A;  2X0L A;  2R7W A;  2AXL A;  3EYI A;  1P4A A;  2KDO A;  1XMK A;  2FE3 A;  1HQC A;  1LJ9 A;  2FMY A;  3IH3 A;  2STT A;  1D1C A;  3SEQ A;  2WB1 A;  1OCR H;  3M8J A;  4I02 A;  4HAM A;  2JUG A;  3FWE A;  1G8X A;  1JUP A;  1DDN A;  2Z16 A;  4UHT A;  3LAJ A;  4E7H A;  3CCJ I;  2YR2 A;  2FNP A;  3T5X A;  2E5N A;  2IA1 A;  1YS6 A;  1X4O A;  3AG1 H;  3CJN A;  3QOD A;  4G6T B;  1MMD A;  3BG3 A;  3EUH C;  4YRV A;  3JRD A;  4B44 A;  1ETQ A;  1EF4 A;  2XVC A;  2HVQ A;  1G2H A;  3I4M J;  2R7O A;  3X2Q H;  1D8J A;  4U87 A;  3ASN H;  3I54 A;  2VN2 A;  1HST A;  1HKQ A;  3KZY A;  1IXR C;  1A6Q A;  4JX6 A;  4XN0 A;  3TMO A;  5J8C A;  2A5Y B;  2NRA C;  5D6F A;  3S1Q J;  2OBP A;  2Y0S N;  2GWR A;  4LLN A;  2E1N A;  4ESB A;  1Y8R B;  5CVI A;  1E2X A;  3ZP5 A;  4F3Q A;  3ZQH A;  1TL8 A;  1XN7 A;  1Y56 A;  4DOZ A;  3AKZ A;  2M3A A;  5E8G A;  2DK5 A;  2WA0 A;  4FET A;  2QQ8 A;  2EZI A;  4UXN A;  1ZRE A;  3ZQF A;  1KU3 A;  2HTS A;  3OYD A;  2LTP A;  4IQ4 A;  3BZC A;  1I27 A;  4D1Q A;  4XLH A;  5E1Z B;  1FTZ A;  2ADU A;  3ZPL A;  2AXT C;  2PJR B;  1MBG A;  4CIC A;  2VQG A;  5GTI C;  1DU0 A;  1ZRD A;  3J7A O;  5JHF A;  4LMY A;  4J01 A;  2ZME B;  4G6Q A;  3WE3 A;  2JPC A;  1KQ0 A;  1UCR A;  1I5Z A;  5KCM A;  4BY7 J;  2E1M C;  3FMQ A;  3MCZ A;  1YYV A;  4UB6 C;  1Z7U A;  3VYU B;  4MTE A;  2OCE A;  3MKY B;  3OYK A;  5DD4 A;  2DAO A;  4F91 B;  4IHS A;  1QZY A;  3DU6 A;  4AM3 A;  3CJR B;  3FXL A;  4WF2 A;  3QYF A;  1FOK A;  1OIS A;  3CZ6 A;  4PCQ A;  5FRO A;  2X6Y A;  2EIM H;  4H4K C;  3ROU A;  1VQN I;  3BPX A;  3D5S C;  1RKW A;  3LSP A;  2NOG A;  1SFU A;  4AIH A;  3F8F A;  3MD2 A;  2HR3 A;  4HSR A;  4Q5S F;  4ZDO A;  2DYS H;  2GBY A;  1S7O A;  4S0H B;  1N75 A;  1T6S A;  4EEF G;  5GAE J;  4HNU A;  1GT0 C;  3IV5 A;  4L9N A;  5KK1 A;  3E0J B;  1W7P A;  3HB9 A;  4HA8 A;  3L1P A;  2QGU A;  4X6A J;  1W0T A;  1R5H A;  1VF9 A;  2I5U A;  4YEL A;  4UVC A;  1EH6 A;  1FYK A;  2PEX A;  3DLL F;  4E7K A;  2W4S A;  1XB4 A;  5KAI C;  1ETO A;  2V1D A;  2M87 A;  4MFD A;  2FU4 A;  4ZDP A;  2HPM A;  3RDI A;  3FXM A;  4CA0 A;  3V4G A;  4X0G A;  2R7R A;  1ZR2 A;  1XC5 A;  4CO8 A;  2VPL A;  2HGC A;  2F2E A;  3ONQ A;  4I76 A;  4CYC A;  5JI6 A;  2P6S A;  3FKJ A;  4M3D A;  1F43 A;  2M45 A;  3A4C A;  3K4N A;  4OIN F;  4ENM A;  2Q2E A;  3BP8 A;  1XSX A;  4BHC A;  4XLE A;  4M74 A;  2VJ4 A;  2K3F A;  1S72 I;  3QPH A;  1WJC A;  1X4P A;  3BG6 A;  2VUM J;  2LSO A;  2LDU A;  2L7K A;  2JTV A;  3DBH B;  4RMN A;  3PNV A;  4UY8 I;  4DZP A;  2F5D A;  2XKO A;  5JLW A;  1WCM J;  2ISZ A;  1R1U A;  5J8F A;  1VND A;  3IRQ A;  2EZH A;  4RLF A;  5J47 A;  2ZCW A;  2LVS A;  1Y1V J;  4PZJ A;  2TDX A;  4PFP A;  1IN5 A;  1TZL A;  2OJE D;  3DU5 A;  4OWR B;  1T8I A;  1ETY A;  2EV6 A;  4WXC A;  2L02 A;  1KZH A;  1ZRF A;  2X85 A;  1BI1 A;  1XGM A;  3N05 A;  2B9S A;  2IBD A;  2MW8 A;  3S1M J;  1JXS A;  3EUH A;  1ZAO A;  1K78 A;  4B09 A;  1H8A C;  5B1A H;  2ZJR F;  1R9T J;  3FXJ A;  3L2V A;  2O0Y A;  5FFX A;  2P5L C;  4BDZ A;  4QWQ A;  1ZRC A;  1PVE A;  2BY0 A;  1R1T A;  1K4T A;  2HXI A;  1JKQ C;  1P4W A;  1BJA A;  3COA C;  3UR3 C;  2WY7 Q;  3N4M A;  2Q1Z B;  5J3L A;  4I0B A;  4P1W A;  2QWW A;  4KN7 X;  3S93 A;  3BQY A;  5H20 A;  3ZXS A;  2CV1 A;  2UXX A;  1AKH A;  2K3P A;  2V9K A;  1LEB A;  5ILU A;  1G3W A;  4QLC U;  3PQK A;  3D5R C;  3C2H A;  3U9G A;  2XPW A;  2LKX A;  4M3G A;  2LLK A;  1ZN2 A;  3H36 A;  5EDN A;  1KQ8 A;  5E8I A;  5FKM A;  1HKS A;  1S6L A;  1CF7 A;  2MH2 A;  1YG2 A;  1YE9 A;  1YW9 A;  3OY9 A;  4IL6 C;  3MKL A;  5BQT A;  5K5O A;  1NG7 A;  1IAW A;  3DQV C;  2MLG A;  3PIO F;  2E1M B;  1T56 A;  4HX4 A;  2ME6 A;  1BN5 A;  3F23 A;  1AOY A;  3GZN B;  2FUG 2;  2RDP A;  3ABL H;  3MEX A;  3FHN A;  2IPQ X;  1RI7 A;  2KRF A;  1BIB A;  2QSF X;  3LA7 A;  2DA1 A;  4A3M J;  3CCR I;  1Z67 A;  1R1V A;  4MLO A;  1X1D A;  2MBF A;  3J81 K;  2L9S A;  3W3C A;  2M7B A;  2X6O A;  2CFX A;  2XRN A;  5K5R A;  2OAZ A;  3DKY A;  2CSO A;  3BR3 A;  3HJE A;  3HTU A;  3OYA A;  4PGG A;  1UFM A;  2FF4 A;  5B5E C;  2NVY J;  5F1R A;  1ULY A;  3GTG J;  4DJA A;  2EFQ A;  2HQA A;  4PJN A;  1SD4 A;  4P5O A;  3E7L A;  1Z77 A;  3ABK H;  2JVG A;  2FBI A;  4PJM A;  4A93 J;  1FSH A;  2JA7 J;  1VZ0 A;  3BTI A;  3FBN B;  5IT3 A;  4A3I J;  2ISY A;  1Y0N A;  3Q9S A;  2VIX A;  3T8T A;  2E36 A;  4E7Z A;  2KKO A;  2NXN B;  2P7C B;  1WHU A;  4Q4Z F;  3WU2 C;  1UHM A;  3W2W A;  4IKF A;  1MDM A;  1J2X A;  2PMU A;  3DFG A;  4HQE A;  2W82 A;  3ZQL A;  4HDV A;  4MEX F;  2HTJ A;  5EZG A;  4EV0 A;  4ZH4 F;  3ZQG A;  1F4K A;  4X1E A;  4ESF A;  1XS9 A;  2L7M P;  1E3O C;  2KRH A;  2R3S A;  4HX7 A;  3JRG A;  5FKO A;  2HDC A;  1IG7 A;  1P4X A;  1HW5 A;  3C18 A;  1OCO H;  3TDZ C;  4J19 A;  1HDP A;  5HOO A;  1BM9 A;  2LY1 A;  3LA2 A;  1SC7 A;  2HFH A;  2LKS A;  4KMF A;  1I6X A;  3HUG A;  5LEK A;  3AG2 H;  2Y9Y A;  1FMV A;  3OR1 C;  1UAA A;  3JAM K;  3HG9 A;  1UEL B;  5FKL A;  4UUS A;  4KA4 A;  1I6H J;  2BVM A;  3CC7 I;  4IQJ A;  2XB5 A;  1POG A;  4ZZD A;  3ZQC A;  5DEQ A;  1WQ2 A;  2XGE A;  1B72 B;  1GV2 A;  1T08 B;  5IOY A;  2G7U A;  2UUZ A;  5FB2 A;  1KGS A;  4F7Z A;  5F6F A;  1UHW A;  3JRI A;  4V19 K;  2UWM A;  3DLA A;  5EEA A;  1D0Z A;  4MO7 A;  2FX0 A;  2HDD A;  2EFN A;  3M4O J;  3DEU A;  1VQK I;  2L9V A;  4BQQ A;  3OSF A;  2R7D A;  3ZCO A;  3U21 A;  3R61 A;  2RVC A;  2P4W A;  4I0A A;  4FX0 A;  1WJA A;  2WV1 A;  2IVM A;  1X1C A;  2XAU A;  1VQ4 I;  2GXA A;  2HS5 A;  3HBL A;  3O2P E;  4N4N B;  4HPQ A;  3ZQI A;  2P81 A;  3AL0 C;  2BVL A;  3MQ0 A;  4WXH A;  4KIS A;  5H6R A;  1JKR C;  4PK4 A;  3ZOB A;  3HOV J;  3M8E A;  4PSW A;  3HSE A;  4XRS A;  4EQQ A;  4HW0 A;  3SZG A;  3CC2 I;  1BI0 A;  1BW6 A;  2PI0 A;  1RIO H;  3NWS A;  1R4M B;  1V5F A;  1Z6R A;  3CQZ J;  1MZB A;  1QHH D;  4H0E A;  4HF2 A;  2LG4 A;  4RLQ A;  2QQB A;  4DQ2 A;  2HYG D;  2XPV A;  2J5O A;  2P5V A;  3ZMU A;  3OYF A;  5DCM B;  3MZH A;  1PUF B;  2NYX A;  2XAG A;  3J80 K;  1WWX A;  4LLG F;  2HOA A;  3RYR A;  1K79 A;  3LMM A;  1IGN A;  3ELK A;  1LNW A;  1IXS B;  4BQA A;  4EMS A;  4YFK F;  2KIU A;  4A3J J;  5B1B H;  1OCT C;  5FJ8 J;  5IY5 H;  2P0W A;  1R5G A;  2XF6 A;  4S04 A;  4L5I A;  3SEZ A;  1GXQ A;  3H9J A;  5KAF C;  4XLF A;  3LSG A;  4XOR A;  1O3Q A;  1ZHF A;  2OD5 A;  3DCF A;  4BHB A;  2GAU A;  3IH2 A;  1SVO A;  1X1P A;  4PFO A;  2M4G A;  4BNC A;  1J7K A;  3I58 A;  3WE2 A;  2IS4 A;  3LQR A;  2XPU A;  2VBX A;  2CO5 A;  2JPB A;  2IGN A;  3SJM A;  1BR2 A;  1LDK B;  3K4M A;  2VOD A;  3GFI A;  4EJO A;  2XV4 S;  2DOE A;  4UUT A;  5LGU A;  2VON A;  3TO7 A;  2NAZ A;  1P92 A;  2ELJ A;  1N25 A;  2H1L A;  2WAF A;  3L7W A;  1MH4 A;  2PMZ N;  2BOL A;  4C9Y A;  3KP4 A;  2WAQ A;  3ZR8 X;  4IO9 F;  3R0J A;  5JHU A;  1OYI A;  1TT5 B;  3OIP A;  4C2M J;  3L00 A;  4XOT A;  2VJI A;  1MJB A;  2Q8K A;  3RKY A;  5CQE A;  2VQH A;  2UXN A;  3DEW A;  4YII A;  5FRM A;  1SD7 A;  2KIQ A;  1YOV B;  4A6D A;  3Q0U A;  4PDK A;  5LFA A;  4M6Y A;  2DT6 A;  1FEX A;  1OJL A;  4NUB A;  3FM5 A;  1WSU A;  3HOW J;  3I0T A;  1JTY A;  5HDN A;  4ZYD A;  1IN7 A;  1PDN C;  1YJW I;  4MEY F;  5HLI A;  3U1D A;  3HL2 A;  3QRF F;  3TW6 A;  3CC4 I;  2VT3 A;  4XQF A;  2ZO4 A;  5C4J J;  3P9C A;  1YIT I;  2NVX J;  1E0E A;  1FY7 A;  3KP3 A;  1ETX A;  1SVM A;  3Q0V A;  1W7P D;  4A0Y A;  3F3X A;  4L5E A;  3SFI A;  3V8L A;  3IL2 A;  4KDP A;  3I64 A;  1JUS A;  2HYF A;  2Y69 H;  4KIC A;  1OYW A;  2XRL A;  5IYB J;  2KIF A;  3PUF A;  1OYY A;  4JP0 A;  4XID A;  4AVZ A;  1JT0 A;  3ECH A;  5HS7 A;  3MAJ A;  2BY1 A;  3ABT A;  2NS7 A;  1TWG J;  2DOD A;  3RJP A;  3K70 C;  1RRJ A;  1HC8 A;  3NEU A;  3ZMS A;  1J09 A;  2KP6 A;  3MKW B;  4JX4 A;  3I9V 2;  1GVJ A;  2ZJP F;  3HIF A;  2KL4 A;  3AL0 B;  2M8G X;  3HPG A;  3GW2 A;  3K4C A;  1OQY A;  3IP4 B;  2VBZ A;  3T1B A;  5EG0 B;  1XGO A;  4LG0 B;  1XDS A;  1ZLJ A;  3E5U A;  1S9H A;  4MNU A;  1S5L C;  2V9P A;  2EH3 A;  4NQW B;  2EQR A;  4EGY A;  1QVU A;  4Q47 A;  2XB0 X;  2QCO A;  3BTC A;  5C44 J;  3LAP A;  5ICC A;  4GRI A;  1J0R A;  2XF7 A;  3ZGK A;  1BOB A;  1B8I B;  5FD5 A;  5EGO A;  1I3A A;  3CCY A;  5CYV A;  2QM3 A;  4HLX A;  3WGI A;  1HF0 A;  1J75 A;  3FMR A;  4A69 C;  4G6D A;  3B6A A;  1SAN A;  3BR5 A;  2IRF G;  4U88 A;  4LIV A;  1LFU P;  3KEY A;  3PM1 A;  3KEO A;  3WTY C;  5LGN A;  2R5Z B;  4YG2 F;  1A35 A;  4BQO A;  3BTL A;  4ZYE A;  2JK3 A;  1WI3 A;  3HOS A;  2GXB A;  1LUJ B;  2HPI A;  4IHX A;  3HGG A;  1D5V A;  3J7Y J;  2M2E A;  3TP0 A;  1RET A;  5B3S H;  4Y17 A;  2NNN A;  2RNG A;  2H8R A;  3FIS A;  5IPA A;  1QA6 A;  1MBF A;  1VQM I;  3VWB A;  4A3L J;  1QZZ A;  3E6M A;  4DYQ A;  2PX9 A;  1HDD C;  2XF5 A;  3K4L A;  1ERD A;  3IHU A;  3LSJ A;  1WFX A;  1UB9 A;  2EZK A;  3MVP A;  4N9I A;  3H3Z A;  2G7H A;  4KIT B;  3K69 A;  3S2H J;  2DN0 A;  3E6C C;  2DOF A;  4MFE A;  2KJB A;  4C3H J;  4I2O A;  3FXK A;  4XK4 A;  4Y4R A;  1WJ5 A;  4XR6 A;  4HX8 A;  3RZD J;  1FP1 D;  2KLO A;  2OTL I;  2XIG A;  3CO7 C;  1SFO J;  5ED4 A;  3F21 A;  2X1C A;  3CF2 A;  1STZ A;  4RAY A;  2DYR H;  2NNY A;  2Z5U A;  1XX5 A;  1XSD A;  5LHH A;  4CDG A;  3S16 J;  2X51 A;  2E2J J;  4V2F A;  1DU6 A;  4XRS G;  1V5E A;  2QEX I;  3ZMD A;  1BBY A;  3K2A A;  1OCC H;  2OZU A;  4ZYH A;  5E17 F;  1TWH J;  4E4H A;  2P5K A;  1W36 D;  2IS6 A;  2OQR A;  2IA0 A;  2DTR A;  3BLY A;  2ESN A;  1RR7 A;  3SXY A;  1B1B A;  4AID A;  1H88 C;  2FA5 A;  2YU9 J;  1E17 A;  3BY6 A;  2X4H A;  1TBX A;  2LRE A;  3CMM A;  3L9F A;  2LOO A;  3RPU A;  2R5Y B;  1S8N A;  4G7H F;  2W25 A;  2H8W A;  1O3R A;  5EYR A;  4PJ0 C;  5D8L B;  5F0F A;  5L3G A;  2IGK A;  5FLM J;  2AQE A;  3OYI A;  3CCU I;  4XKV A;  1UG0 A;  2FEZ A;  4F93 B;  4JK1 X;  1ZQ3 P;  2QYO A;  1RUN A;  3C2B A;  4XLC A;  4BS9 A;  3RCO A;  2ZBK A;  4CXF A;  1XMA A;  3D0S A;  4ETS A;  2TCT A;  1UZC A;  2LY2 A;  2ZSH B;  1FSE A;  5GTH C;  3M7G A;  3L2R A;  2TRT A;  1WJD A;  1BI2 A;  1KU9 A;  3GFJ A;  5GAG J;  2V1N A;  1FIA A;  5E1X A;  4GDF A;  4XSZ F;  2BYV E;  1EH8 A;  5AIP A;  2GLO A;  3BRO A;  3EET A;  2ZSI B;  4CCJ A;  1G3T A;  2E7W A;  1MSF C;  5M3F J;  2BXY A;  1TWC J;  4L0Y B;  1YW8 A;  1OR7 C;  4EM0 B;  1U6G A;  3IWZ A;  4L9T A;  2JUC A;  1IW7 F;  1MD0 A;  2E1O A;  4AVP A;  4RB3 C;  5DYM A;  3REO A;  3CCE I;  4I99 C;  2K02 A;  3HM5 A;  1OLT A;  1U0J A;  2IAI A;  2H6B A;  3C2G A;  2HOT A;  2MD0 A;  4D7N A;  2QQA A;  2R4G A;  1QU3 A;  3I5U A;  1OPC A;  2XUB A;  4HYE A;  4S05 A;  3PJR A;  4E7J A;  3CJQ B;  5IT9 Z;  4XIC A;  1F36 A;  2MAB A;  3BJ6 A;  2PJR A;  4WX9 A;  2BZT A;  1PUE E;  3CUQ C;  1QPM A;  2AHQ A;  2E7X A;  2M1B A;  1ZGW A;  2A6H F;  5C3E J;  1LVA A;  2ZME A;  3EUA A;  1TWA J;  2LBF B;  3FXU A;  5GP9 A;  4A2U A;  3R60 A;  3W6K B;  1T0F A;  3GX4 X;  1P2F A;  2HI3 A;  2KPM A;  1MGT A;  4A3K J;  5IT9 K;  1T39 A;  1TQM A;  2F5F A;  3J7Z I;  2L0K A;  2DFH A;  3BG5 A;  4A3B J;  2ETH A;  4UV9 A;  3H3V K;  1FC3 A;  3L2C A;  3K9T A;  2QA4 I;  2Y0M A;  4EGZ A;  3MN2 A;  4BXF A;  3LFK A;  1ZG3 A;  2ID6 A;  1R4N B;  4LB6 B;  1MMN A;  1LB2 A;  2MC3 A;  1NK3 P;  2ZXH A;  3OS0 A;  2VLA A;  3FZV A;  3VDX A;  4A6E A;  1BI3 A;  2EA4 A;  4CCO A;  1O3S A;  1RES A;  5HVQ C;  1MW7 A;  1D5Y A;  2VI6 A;  5DUI A;  3KYC B;  1U5T B;  2KMU A;  2Z33 A;  3A0B C;  4AYB N;  1YFH A;  2CRG A;  1R36 A;  1VQ8 I;  2EBI A;  3OYM A;  1DUX C;  2VJ5 A;  3HC7 A;  1UJ8 A;  3K7A J;  3ISP A;  5EEG A;  2KRC A;  5J4Y A;  1D0X A;  2GA2 A;  4II3 A;  4J00 A;  2MA3 A;  4KFC A;  2DA5 A;  1MMG A;  1XDU A;  4M9Z A;  2F4I A;  2IP2 A;  3QP5 A;  4AIJ A;  1RKT A;  1Z9C A;  2CUJ A;  1YJN I;  3C1D A;  2E71 A;  3K0L A;  2IS1 A;  2PMH A;  2R7X A;  4OIO F;  4N9H A;  1MH3 A;  2L4M A;  4JOM A;  5K7F A;  4BBR J;  1EKE A;  3GYH X;  2JVH A;  1XMX A;  3L09 A;  3OSG A;  4LJZ F;  3TOA A;  5BPI A;  3KP7 A;  4M9S A;  5FKN A;  4RB2 C;  4UUV A;  3PUB A;  4A0Z A;  3RTR A;  4IRH A;  1ZEL A;  5F64 A;  3K10 A;  2A61 A;  5J4V A;  5EJC A;  1MIJ A;  2EIJ H;  3M1E A;  4FIS A;  5CKT A;  3K1P A;  3LWF A;  3GME A;  2ESH A;  5GPA A;  3B6C A;  1MMS A;  2BV6 A;  4JBA A;  1VTN C;  2JT1 A;  3ASO H;  3ML6 A;  1U3E M;  2Z9O A;  2KIS A;  2N8G A;  2VKH A;  1A5J A;  1IDY A;  1W1W E;  1MNM C;  2Z3Y A;  5E3L A;  5JLX A;  1W5T A;  1P6R A;  2VBW A;  5CPR B;  4ZTF A;  2O9L A;  1ONV A;  1UHS A;  2CQQ A;  2VPR A;  2BHZ A;  1M1E B;  5D4R A;  4OMY A;  3IWF A;  3P9I A;  2CQK A;  1E3P A;  2RC4 A;  2DMQ A;  2A5W A;  2WY8 Q;  1DGW Y;  1X3U A;  4BXU A;  4XLA A;  3HRU A;  1WH5 A;  5ICE A;  3JRH A;  2XAS A;  3VOD A;  1XTA A;  2Y9Z A;  4DGW B;  3HHG A;  1KYZ A;  4HG2 A;  3IUO A;  3KFW X;  4A3E J;  3D1N I;  1WJF A;  4BUP A;  2E60 A;  3WU1 B;  1NHA A;  3CUQ B;  5HLG A;  3WG9 A;  3S32 A;  4FCY A;  5TJJ A;  3S8P A;  4G12 A;  3OYB A;  1T2K A;  4P9F A;  3FXR A;  3TW7 A;  3ESW B;  4ZTJ A;  4BU2 A;  2R7U A;  2BE5 F;  2E1C A;  1IN8 A;  2XAF A;  2Y30 A;  2EFO A;  3S3N A;  2CV0 A;  1IN6 A;  2MFZ A;  1QZE A;  3JTG A;  3L2W A;  1FP2 A;  2WAD A;  1ZH5 A;  2HNH A;  2HYJ A;  2EIN H;  2ECB A;  4YIR X;  3HGY A;  2VXD A;  2NS0 A;  3PNT A;  2JSP A;  4HZF A;  1Z1D A;  2X9D A;  2F4M B;  3PSF A;  4B1R A;  3ZMZ A;  3LSI A;  4LGW A;  3DKX A;  2VOO A;  3F72 A;  1WPK A;  1L0O C;  4JQF A;  1WVR A;  1QQI A;  4BEH B;  1G3Y A;  2L54 A;  4LK1 F;  4C3J J;  1U8R A;  2Z99 A;  3LQQ A;  3PSI A;  2CS3 A;  2H6C A;  4B47 A;  5EF6 A;  1B59 A;  2ECC A;  4CYD A;  1XGN A;  1D1B A;  1Q1H A;  2GM4 A;  3KE2 A;  1S29 A;  2DDA A;  3O6B B;  4B48 A;  3KP6 A;  3O8H A;  3HKZ N;  2CUE A;  4YFX F;  2DMN A;  4F55 A;  5HNH A;  1VQ6 I;  1WKM A;  2EJR A;  1YRN B;  4B4C A;  3CCL I;  3WOD F;  2L2O A;  1IF1 A;  2HZD A;  3TBI A;  5GAD J;  1HCR A;  2R7Z J;  2OQG A;  4CUG A;  3T0Y A;  3RKW A;  3O3K A;  3ZQ7 A;  3OS2 A;  2CG4 A;  3OIO A;  1ZAR A;  5IYD J;  4BY1 J;  2QF7 A;  1H0M A;  1XG1 A;  5L3C A;  1XPX A;  1RR8 C;  4MIM A;  2MG4 A;  3NQO A;  1R00 A;  3GXO A;  5J40 A;  3WGH A;  2D1H A;  1A36 A;  1IRG A;  2O5R A;  2FOW A;  2KZV A;  1JGS A;  3BQZ A;  4A12 A;  4M71 A;  2XDV A;  2CV2 A;  3A03 A;  1IO2 A;  3TO6 A;  1IDZ A;  2DW4 A;  4Z2Y A;  2HQN A;  4FTH A;  2CFO A;  1B72 A;  2QBY B;  1S7A A;  4II2 A;  4B43 A;  2M4K A;  4HEA 2;  1FMW A;  3BJA A;  3SDG A;  4D5F A;  5IOZ A;  2IA2 A;  3CJT B;  4NC7 A;  3LNQ A;  1G59 A;  6PAX A;  2HKX A;  2Y0S A;  3PO3 J;  3F8N A;  3NRV A;  3E5Q A;  2HU9 A;  3K1N A;  3GFL A;  5DUK A;  4GO1 A;  3W2A A;  4KT5 C;  1YIJ I;  4FE4 A;  5ICF A;  4AWX B;  4ENK A;  2CH0 A;  2DCE A;  1RNL A;  1FT9 A;  3C7J A;  4M3E A;  2IXS A;  3WU0 A;  2DA3 A;  3V8J A;  4B3A A;  1Y8Q B;  2R7T A;  2DMU A;  2EB7 A;  2H27 A;  3I59 B;  4EJW A;  3RZO J;  1JUM A;  2WB1 N;  3N97 A;  4CGZ A;  2AO9 A;  3P5J A;  3RYP A;  4EJU A;  5LRS A;  4BBS J;  2HKO A;  3RPU D;  2COM A;  4BH9 A;  3DBL B;  4OAY A;  3RKX A;  3OOP A;  2ZJQ F;  2DK8 A;  2HOE A;  2W85 A;  3E6B A;  3ECO A;  3I55 I;  1CGP A;  3BTJ A;  1FBQ A;  4RS8 A;  3CF5 F;  1K6O A;  3QP6 A;  4R1H A;  1J9I A;  1R5I D;  5E3M A;  1QPI A;  2FD5 A;  3GLL A;  1MBE A;  3H92 A;  3G4S I;  4R8H A;  2FQ3 A;  1LE8 B;  1MJA A;  1EA3 A;  5DTD A;  4FHT A;  5DCM A;  1PUF A;  1VFC A;  2A07 F;  1OCP A;  3RI4 A;  2L7Z A;  4DBR A;  5E3O A;  1FWZ A;  4BE2 A;  2F5E A;  1TW2 A;  5E20 A;  5H2F C;  2L9R A;  2RGV A;  4C2T A;  3Q9V A;  4QTR A;  1R7J A;  1JT6 A;  3QAH A;  5IP7 J;  5DD8 A;  2YSR A;  3I4N J;  1Y0U A;  4I01 A;  4E7I A;  3B02 A;  3IH4 A;  2MD5 A;  5D5W B;  1W5S A;  2K9S A;  3PFY A;  2IGM A;  1H9G A;  3AG3 H;  4E7L A;  2YS9 A;  2DFE A;  5EEH A;  1JTX A;  1Z05 A;  3GBG A;  5HLT A;  2W48 A;  2Y31 A;  2FRH A;  3GFM A;  3WG7 H;  5D4S A;  1B9M A;  1PP8 F;  2K4B A;  2A05 A;  1SMY F;  1X1A A;  2K40 A;  3HSF A;  3CD6 I;  4YFN F;  3JR9 A;  2GZW A;  3K4K A;  2D2W A;  2E35 A;  3CP8 A;  4CCM A;  4UVB A;  1IRF A;  1PJR A;  2DFF A;  4RDU A;  3JRA A;  4WCG A;  4IF4 A;  2PLY A;  2X6X A;  5JFR A;  2W1O A;  4CSW A;  3GTO J;  3ZMV A;  2EWN A;  3DWL E;  3LSR A;  1G6N A;  3R6S A;  4GCV A;  2CQ7 A;  3CME I;  5HNF A;  3JW4 A;  2LC2 A;  4LD5 A;  3PNY A;  2R7V A;  4ZYA A;  2JA6 J;  3CLO A;  2G9W A;  1G4D A;  1FOX A;  1FLI A;  4RAF A;  3VYR B;  1U2W A;  2O3F A;  1IUY A;  3LFU A;  1XCV A;  4L5J A;  4HNT A;  1YJ9 I;  2K9Q A;  2MH9 A;  1BIA A;  5M5W J;  3OYG A;  4JYK A;  2MGQ A;  2R93 J;  1UMQ A;  3BCA A;  2FBH A;  3SDB A;  3TO9 A;  3LOC A;  2L7F P;  2R92 J;  3CDI A;  5LGT A;  1FBU A;  5DCF A;  1T38 A;  2YU3 A;  5FKK A;  4XKW A;  3E97 A;  3KLN A;  2HQ5 A;  2KQR A;  1E3H A;  2EV5 A;  4IJA A;  1CQT A;  3CCV I;  1QGP A;  2XC7 A;  1SFX A;  4ZZL A;  1TNS A;  1LKX A;  3C3W A;  3FXQ A;  4ESJ A;  1N77 A;  4FX4 A;  3HDD A;  3GO5 A;  2IS2 A;  3J7A Y;  2W7N A;  5JVG F;  1BOA A;  3HEF A;  1V54 H;  2V9V A;  2ZC2 A;  4XNF A;  3DBR B;  2G0E A;  2R7F A;  3DF8 A;  4RAZ A;  4OMZ A;  5F0C A;  1HLV A;  1QVT A;  3VOE A;  4A5M A;  3E3V A;  2COB A;  3UKG A;  1TWF J;  3BG9 A;  2LFB A;  2WTE A;  5CLS A;  1Y39 A;  5M5X J;  3TOB A;  3F6O A;  4N0B A;  5BOX A;  1MJ9 A;  4U7D A;  2V1U A;  2BBY A;  3IAM 2;  1MKM A;  3LST A;  4D0P A;  3A0H C;  2BY2 A;  2L4A A;  3IAS 2;  3M8F A;  3VEP A;  1AU7 A;  5LEJ A;  1GVD A;  1OFC X;  2BW3 B;  1L3L A;  2MC4 A;  3AG4 H;  1ZKG A;  5EG0 A;  1SFK A;  4LG0 A;  4AD9 A;  1QHG A;  2E19 A;  4RGX A;  3R4K A;  4EM2 A;  1Z3Y A;  4NQW A;  3FIW A;  1V55 H;  4Q48 A;  1NH3 A;  1R58 A;  4BKX A;  2CUZ A;  1RUO A;  4BQN A;  4RA2 A;  1B8I A;  1FIP A;  2ZXJ A;  1IC8 A;  1H89 C;  3H5N A;  3S15 J;  4Y33 A;  3K2Z A;  3S2W A;  1R6R A;  3HXL A;  3QWL A;  5L3D A;  3Q5F A;  2DPD A;  3FK6 A;  2JA8 J;  2WC2 A;  4MTD A;  2KFD A;  2R5Z A;  1KYW A;  4RM2 A;  1ZLK A;  5ICG A;  5J1Y A;  1U9O A;  1S3J A;  2LF8 A;  3M9A A;  3CO6 C;  1MBJ A;  5K7Z A;  1NK2 P;  2DXI A;  1TW3 A;  2O03 A;  2M8E A;  4FE7 A;  3VB2 A;  4CH7 A;  4OIP F;  3ZQQ A;  2H94 A;  4LB5 A;  3CCQ I;  3MZ8 A;  3RIR A;  4LG3 A;  3RQI A;  1R71 A;  2F6C A;  4D7M A;  2DMT A;  2XSJ C;  4GYI A;  3UNG C;  3OR2 C;  4EAT A;  3HOT A;  3OMY A;  2DQR A;  2XKP A;  4Y13 A;  2EK5 A;  1LFB A;  5AIQ A;  4Y7N J;  1FTT A;  2ICW G;  4BJ5 C;  5LD2 C;  4UVA A;  5DM6 F;  1U9N A;  2IW5 A;  3OS1 A;  3IKV A;  4PJL A;  4RB1 A;  2HVR A;  3OYH A;  5ILS A;  2M0M A;  2JRM A;  4KNY A;  1VQ9 I;  2ZNZ A;  3CES A;  2KT0 A;  4AC0 A;  5GPC A;  3F0C A;  1FPQ A;  2NS8 A;  1WZ2 A;  1JI8 A;  1U5T C;  3KET A;  3OWT A;  3QU3 A;  5K1Y A;  4L9V A;  4HDU A;  3H0G J;  5JVT A;  2YX7 A;  4YEJ A;  2ZFW A;  3HOX J;  2OTJ I;  3F6V A;  5AON A;  2QSG X;  3OV8 A;  5FFZ A;  2RQQ A;  4XON A;  2KJC A;  3FHZ A;  3GF2 A;  2BEO A;  1IRX A;  3P9K A;  5LHG A;  3QPT A;  2VKD A;  2ZXI A;  1FOY A;  1JE8 A;  3K6G A;  1WJE A;  4HST A;  1AWC A;  2HEO A;  2LP0 A;  2H1K A;  4Y52 J;  4G7O F;  3A01 B;  1YX3 A;  4BGD A;  3BOQ A;  4RBO A;  1UST A;  3I53 A;  2DU9 A;  4KIB A;  3DPL C;  1K4S A;  1K83 J;  4IXA A;  2R5Y A;  2HQR A;  4A3D J;  2IT0 A;  2CQX A;  1JKO C;  2XAQ A;  2VC1 A;  2A6E F;  4OOI A;  3GUD A;  2BXZ A;  2FJ1 A;  3CMA I;  3BPV A;  2LRD A;  2ACJ A;  4U0V A;  3IRR A;  1ACI A;  4BAC A;  2EZL A;  4RB0 A;  3IC7 A;  4AUX A;  4ZJZ A;  2HWV A;  1F1Z A;  1ITY A;  3KZI C;  2QSH X;  3OYN A;  3DPU A;  1KU7 A;  1A31 A;  2V6E A;  3BT9 A;  1IV6 A;  4HQM A;  3LSH A;  3OIQ A;  5J6X A;  3JRE A;  4QIW N;  1TP4 A;  2DOA A;  4EVI A;  2D1V A;  2DT5 A;  1HOM A;  4BXX J;  1SAX A;  3GTM J;  2DA4 A;  2F5C A;  1LPQ A;  4BDY A;  2AS5 F;  2O8K A;  3OOU A;  1O7L A;  4KIF A;  3BJO A;  4P55 A;  2L9N A;  2PFB A;  4M72 A;  5GAH J;  4QPO A;  2CW8 A;  2IJL A;  4A3G J;  1YIO A;  1YW7 A;  1O7F A;  1I50 J;  3AFH A;  1V4R A;  4GFB A;  5HOD A;  3PL8 A;  1FYL A;  2X1D A;  4M3B A;  1BR1 A;  1WH7 A;  2FML A;  5LHI A;  3S3M A;  3CTA A;  3G71 I;  3S3O A;  3WHC A;  3BZK A;  3G1L A;  2K9N A;  4D5C A;  4ASN A;  5CVR A;  1FOW A;  2R7S A;  3A02 A;  4IX7 A;  3CDL A;  2E5Z A;  2LBF A;  1HKT A;  2QQ9 A;  3BR2 A;  4K2E A;  2B63 J;  4N4O B;  1R49 A;  2Y2Z A;  2PG4 A;  1SFE A;  3BZ6 A;  4RM3 A;  1BW5 A;  3DTK A;  1D0Y A;  1J59 A;  4BHP A;  3WTT C;  4NC6 A;  2F48 A;  1MSE C;  1MNE A;  5IP6 A;  1OCZ H;  1IV8 A;  1QRY A;  2FBK A;  2PMZ A;  3FF5 A;  3P7N A;  1TQP A;  2PJP A;  3KP5 A;  3T8R A;  4XMY A;  4L0Z B;  3SZT A;  1GXP A;  3TED A;  4Y3O A;  3L2Q A;  4KT6 A;  1KON A;  1S7E A;  2Q0O A;  1DP3 A;  2EIK H;  3I71 A;  1ETW A;  3JCU C;  4KMU X;  3F22 A;  2GXG A;  5L3B A;  3WTW C;  4O5V A;  2O8X A;  1W36 C;  3VSK A;  4B8X A;  1Q1V A;  2DA6 A;  2JN6 A;  2RKH A;  1U5T A;  1HXD A;  5JR3 A;  1Z21 A;  3FX3 A;  3WTX C;  2JA5 J;  3FDY A;  2A69 F;  1W7P B;  1V3F A;  2ZFU A;  2E34 A;  4XKC A;  4TV7 A;  3OYE A;  3LL7 A;  1TTY A;  1BR4 A;  3HRS A;  1SMT A;  2FQ4 A;  2VQC A;  1TQI A;  3PIP F;  3EQL F;  4P9U A;  3FM3 A;  3PFI A;  3KPH A;  3H35 A;  1R23 A;  1ODD A;  2ZNY A;  3GTL J;  4RGU A;  4NDL A;  4QSH A;  1ENH A;  2GA1 A;  4CYC B;  2WAQ N;  3W2V A;  4CZC A;  1I1G A;  4NHJ A;  2KZG A;  3ULQ B;  2Q2E B;  4OIQ F;  3F8C A;  2O61 A;  3G1M A;  2XHK A;  4IEJ A;  1KQ9 A;  2CMP A;  4HNV A;  5CVU A;  5CVJ A;  5LRR A;  3QYE A;  3CDH A;  4HF0 A;  5TGT A;  5M3M J;  4BYY A;  4BL0 B;  2P7V B;  3K1M A;  1YQA A;  4O6J A;  2VB6 A;  2WBM A;  3TDU C;  2EPF A;  4E6K G;  5C4X J;  3ABM H;  3QOP A;  3BR6 A;  2B7E A;  2QKL B;  2M7A A;  1D3Y A;  2R7Q A;  2OV7 A;  3A1Y A;  1LDD A;  3GLX A;  5DM7 F;  2XSD C;  1SVL A;  1LFP A;  4KUM A;  3S14 J;  3D5L A;  3U1K A;  1XCB A;  5DV5 A;  3IKT A;  2MYS A;  4C3I J;  3E5X A;  4Y15 A;  4HOB A;  1YI2 I;  4G9Y A;  1P9Q C;  3QOE A;  1O3T A;  3RSN A;  1HA8 A;  3WGG A;  1WGX A;  3BC8 A;  2OUM A;  4CHU A;  3KP2 A;  5J1U A;  1UG2 A;  5HLH A;  4WXD A;  2L3D A;  1OR7 A;  3G73 A;  1K78 B;  2QZ8 A;  4XRF A;  3JTH A;  4M3F A;  1I39 A;  4XSX F;  3U2R A;  5F08 A;  2W00 A;  1WJB A;  1LEA A;  1X2M A;  3HOZ J;  4KJZ A;  2D45 A;  4CCL A;  4LIU A;  2WV0 A;  4G8X A;  3OYJ A;  1ON2 A;  5HS8 A;  1LVK A;  3KCC A;  3QPL A;  2QKM B;  3TKY A;  2VJJ A;  4R79 A;  1AKH B;  4LIT A;  1A04 A;  4EJT A;  1FJL A;  4U7B A;  3CUQ A;  4F52 A;  1DPU A;  4GXO A;  2D5V A;  4HLY A;  1SD5 A;  4LFU A;  3DV8 A;  4W97 A;  1YX5 A;  2DFI A;  5EZH A;  2ZXW H;  2FOK A;  3SYT A;  2A68 F;  1CF7 B;  1JJ6 C;  1FNN A;  3ERM A;  1HBX G;  4FQG A;  2LR8 A;  3RQ4 A;  3RKQ A;  4IHT A;  2K86 A;  1P7J A;  5BS6 A;  4PGH A;  4XLN F;  1ON1 A;  3RPQ A;  4AIK A;  3JSO A;  1ZK8 A;  3J81 Z;  3BR0 A;  5FLV A;  1FBS A;  4DIQ A;  2CJJ A;  2MLK A;  2LF7 A;  3CP2 A;  5F0H A;  1HW1 A;  4W1U A;  2PN6 A;  5ERI A;  4ENJ A;  1A6I A;  3BR1 A;  1VQ5 I;  3H3U A;  1REP C;  4FAS D;  5CQG A;  3MFK A;  3TGN A;  1VQO I;  3HZJ A;  1LDJ A;  2UZK A;  3Q3S A;  1K6Y A;  1B4A A;  4QPQ A;  4BE1 A;  4XLP F;  4BEH A;  2FSW A;  3I4P A;  3EPZ A;  4XN3 A;  2VKV A;  4CCK A;  2WWY A;  1DGR M;  1YS7 A;  3M1C A;  1FZP B;  2LY9 A;  2ZB9 A;  4ZYG A;  1HSJ A;  1IN4 A;  3M3Y J;  3LSK A;  2WAE A;  1YLF A;  2RN7 A;  1NG6 A;  1U8B A;  3NAU A;  2CYY A;  5B66 C;  1YRN A;  1NTC A;  3KX2 A;  3A2K A;  3GTK J;  2VT2 A;  2YX4 A;  4LOC A;  3DPT A;  2RV8 A;  2Z1D A;  3GZ5 A;  1W5C C;  2JSC A;  2YPR A;  1QBJ A;  3HRM A;  3Q0W A;  1MDM B;  3H1C A;  1JJ8 C;  1B6A A;  1ZYR F;  3ZRG A;  2ELH A;  2Z2S B;  4M6X A;  4C30 A;  2F5V A;  2ZJ2 A;  1ZTR A;  3HPH A;  5HS9 A;  3W6J B;  3ZN0 A;  4IRI A;  1B9N A;  1IRZ A;  2JA2 A;  2HOS A;  4I98 B;  3GEZ A;  1BA5 A;  3JAM Z;  3KIO A;  3OYL A;  1Y1W J;  3VYT B;  1DP7 P;  3H5R A;  1T95 A;  3GTJ J;  3B73 A;  1YO5 C;  3QU6 A;  4A5N A;  2OU2 A;  3HUG B;  2HDW A;  1N78 A;  2L5Q A;  4GYG A;  3V7C A;  2OF7 A;  2DDB A;  2KIM A;  1RC9 A;  4XRM A;  2QBY A;  4A0X A;  2XGD A;  3HTS B;  4IHV A;  4UUS B;  4OAZ A;  1OKR A;  4IPA A;  1SAU A;  4IHW A;  1P7I A;  4ANJ A;  3KYL A;  3OL3 A;  2M0C A;  1AHD P;  5L3E A;  3SQN A;  2DBB A;  4DZJ A;  3MMY B;  5D5V B;  2LNB A;  4I6Z A;  2B0L A;  2BY3 A;  4XKB A;  5ILV A;  1GV5 A;  2CW0 F;  4UNO A;  1RZ4 A;  4OIR F;  2GOM A;  4D9J A;  2V26 A;  4UV8 A;  1ORK A;  2VL8 A;  2DO7 A;  5E1W A;  3SFZ A;  3BCB A;  3V42 A;  1X3Z B;  3MKZ A;  4PSX A;  2A3S A;  2K9L A;  5IYC J;  4IHY A;  3DP7 A;  3G2B A;  4RGR A;  3GTQ J;  3I59 A;  1BC8 C;  5IP9 J;  2C6Y A;  2JRT A;  3HOU J;  4XL9 A;  4NC8 A;  2K5C A;  5A2Q Z;  2Y48 A;  1T98 A;  3OYC A;  3M07 A;  1ZGJ A;  1PYV A;  3WTV C;  2DT7 B;  3MWM A;  1QNT A;  1VQL I;  2XAJ A;  2DPU A;  1F5T A;  2E2H J;  2I8D A;  5BPD A;  3KEQ A;  3EYY A;  2V7F A;  5BNG A;  1LE8 A;  3J80 Z;  1GDT A;  1ETV A;  3K70 D;  5A2Q K;  1Z91 A;  3H9Q A;  3H9G A;  3K4B A;  2DJN A;  2FNA A;  1DPR A;  5H6Q A;  1K61 A;  3EDP A;  5E18 F;  2O7O A;  5D5U B;  2M30 A;  3KZZ A;  1ZG5 A;  3W6V A;  9ANT A;  3SHF A;  1X3W B;  2XGC A;  5LBQ A;  1BJZ A;  1GLN A;  4ENN A;  1IZ1 A;  4G94 A;  3BDD A;  1BC7 C;  2VQL A;  1TLH B;  2CU7 A;  1I1S A;  2QUF A;  2IEK A;  3ZN1 A;  5DS9 A;  2QEN A;  4OU0 A;  3FXO A;  1ZR4 A;  2HZT A;  1TT0 A;  2DA7 A;  4I09 A;  1AA7 A;  2W57 A;  2KDZ A;  2EFP A;  2P8T A;  1F9N A;  1R22 A;  3S2D J;  1JHF A;  4NBQ A;  4AYB A;  2CGP A;  3O8G A;  1SD6 A;  2EA2 A;  3DKW A;  4MQV A;  5K5Q A;  2ELK A;  5CVV A;  2RAE A;  3CUO A;  3QYB A;  2STW A;  2NVQ J;  2DI3 A;  5TIS C;  3FMS A;  2XRO A;  1IXC A;  4M73 A;  2JJ7 A;  5KHD A;  4HF1 A;  3JRC A;  4CZZ A;  2VE9 A;  4PUS A;  3LA3 A;  1O57 A;  3HHH A;  4CCN A;  4F92 B;  5M5Y J;  4RAG A;  2BGC A;  4I7H A;  1Z7L A;  3G1O A;  1X58 A;  4B3X A;  2JWT A;  4DW6 A;  4BE0 A;  1ZGA A;  4XBF A;  2H09 A;  1RPW A; 
#chains in the Genus database with same CATH homology
 3ERM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...