3ERMA

The crystal structure of a conserved protein with unknown function from pseudomonas syringae pv. tomato str. dc3000
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
67
structure length
67
Chain Sequence
VDRKLADAHDQMLELAELLTDVLIKNVPGLSEKHAEDASIYMAKNRAVFAAAFKNNATALSELSEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a conserved protein with unknown function from Pseudomonas syringae pv. tomato str. DC3000
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized conserved protein
total genus 21
structure length 67
sequence length 67
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07130 YebG YebG protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.710 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A PSPTO_1197 like 3ermA00
3ERMA
chains in the Genus database with same CATH superfamily
3GF2A 3ZRGA 3F6OA 3W2WA 3DEWA 2E1OA 2VOPA 1Z7UA 5GP9A 1L3LA 4E7IA 2L02A 2EA2A 2HDWA 1X19A 2XIGA 3LL7A 1VQKI 1K4SA 3CP2A 1MMGA 2EILH 5HVQC 5DTDA 3AKZA 1SMTA 2X0LA 4XRMA 4DZPA 3NAUA 2AXLA 2GM4A 2O6GE 3T1BA 5E3OA 4FX4A 5JFRA 2EJRA 2HOSA 3CUQA 2DA1A 4XR6A 1XSDA 1S5LC 2MC4A 3OYIA 2M0MA 2DA4A 4YG2F 4YIFA 1LEAA 1EA3A 4NQWA 3PL8A 4XICA 3GFJA 1ORKA 3PO2J 3BT9A 3IC7A 4KISA 1JUSA 4BAYA 1S72I 1TLHB 1KA8A 4CXFA 1UHSA 1DP7P 3A0HC 2R3SA 3P9CA 2JJ7A 2QVOA 2ZJQF 1MNMC 2HFHA 3REOA 5DS9A 5J4YA 3CLQA 2M5WA 2R7WA 1VQ8I 1JGGA 2H09A 4BY7J 2R93J 1NHAA 1G2HA 1WHUA 2ME0A 1IN7A 1OCRH 3CP8A 3I3LA 2DDBA 3OMYA 2DMNA 2QSGX 4CCKA 1W1WE 2EIKH 2HWVA 2Y0MA 3L2VA 2EFOA 2F6CA 3S16J 1JXSA 1IV8A 2MSYA 2JN6A 3K4JA 4CYDA 3ECOA 5E8GA 1MBFA 2NRAC 1I39A 1MBJA 4QLCU 2CV2A 1SFKA 4ZDPA 3LSMA 1I6XA 4ETSA 4XRSG 3HIFA 3DTKA 3PNTA 2KQRA 3IRRA 2ZBKA 2M0CA 3EETA 2BEOA 2DT5A 1YE9A 4GYGA 5D8LB 3WTXC 1O3TA 4PCQA 1C0WA 2LNBA 4WXCA 1DU6A 3M8JA 3VPRA 3A0BC 4Q48A 3M9AA 4UV8A 2HPIA 4UVAA 2KIMA 2VPRA 4NDLA 1K7AA 4HOBA 5HS7A 2VOOA 4FETA 1Z67A 4M3EA 4XM3A 2X51A 1ZHFA 2O5RA 3P5JA 2W84A 5DDGA 2ISZA 2NAZA 4LIVA 4MLOA 4G6TB 2NVQJ 1Y56A 5JHUA 1EH8A 1EV7A 1B1BA 3ZN0A 2R7FA 2QCOA 4QSHA 3J7YJ 3U1KA 5A2QZ 4UUVA 3CCYA 3KP4A 1ZK8A 2RKHA 5KAIC 3RKYA 1BJAA 3TP0A 3DEEA 2W57A 2JA6J 1QU3A 4KUMA 5KK1A 2HQRA 2R5ZB 1AU7A 3D1NI 1MW7A 1LDKB 3SFIA 3O2PE 1GT0C 4A5NA 2E19A 3K4MA 2XSDC 1ITYA 3TO9A 1MZBA 3KZIC 1OYIA 4UXNA 3IKTA 3BG5A 3F9KA 4L0YB 1R5GA 1W7PD 1ZREA 3GZ6A 1IZ1A 3G3ZA 2MLKA 3KE2A 4Y15A 4LK1F 2V1DA 3SJMA 3LSHA 1T95A 4YFKF 5ICFA 3BTLA 3C1DA 2R7OA 3H9QA 3Q0WA 4A0ZA 1YHQI 3HOTA 2X6OA 3LA3A 4RM2A 3EUHA 2CQQA 1Q1VA 2ZNZA 2X1CA 3LWFA 4ANJA 3MKWB 1OCPA 3I4MJ 1ZYRF 3BQYA 2Y75A 1Y1WJ 1Y8RB 1SVOA 2A3SA 4B3AA 3FISA 3BPXA 5HS9A 1E0EA 1JKPC 4UHTA 1NG6A 4XKBA 1OKRA 4NC6A 1JT0A 1IXRC 3HRTA 3CCEI 2CW0F 5GPCA 4M3GA 3HSRA 5DCMB 1LDJA 3AG1H 4E7SA 1FTTA 1LFPA 1DDNA 2PG4A 2IVMA 2O03A 1W36C 2Z3YA 2F5EA 2V1NA 4RS8A 5TRDA 2MH2A 3DBHB 4I01A 2BW3A 3FBIB 4UUTA 4HDVA 2Y2ZA 4IZZA 4L0ZB 5FKMA 1JT6A 5CVVA 2R4GA 4XL9A 3E7LA 2LDUA 1Y0UA 4WXDA 5IPAA 2L9VA 3C7JA 3CUQC 3MZHA 3JRGA 2LLKA 1IXSB 3ERMA 4UUSB 4BHPA 1MJBA 2HKOA 2LFBA 4I7HA 1SAXA 1MMAA 1HBXG 5D5WB 4OIQF 2RN7A 5E3MA 2PEXA 4BQAA 3F8NA 2EFWA 2KT0A 2E34A 2JA2A 2XKOA 5KHDA 3GFLA 3K4NA 2R92J 3ZMSA 1Q1HA 3FIWA 3JSOA 1ZG1A 1E3PA 1SANA 2FBKA 2OUMA 2KRHA 3HGGA 1F1ZA 4AYBA 4U0YA 4N0BA 3LA7A 2GIVA 5HS8A 2DMQA 1DGWY 3VOEA 3TDUC 2H1LA 1IV6A 2K9QA 3FBNB 3GX4X 2LY2A 2Y31A 1JTXA 5J8FA 1N75A 2QLZA 4WF2A 2XSJC 5LFAA 3OYCA 4HV5A 3IH4A 1BR4A 1UELB 3HRSA 5IOZA 2R5ZA 3MVPA 2GBYA 3IL2A 1H88C 3L2CA 1BOBA 3WGGA 4HQEA 2VASA 3VYSB 2XUBA 2MGQA 1YW7A 3JW4A 2HGCA 4KICA 5EZHA 5M5WJ 1HKSA 2LY9A 5F1JA 3OYMA 2EINH 1F43A 1KQ9A 2LKXA 4II3A 4YFXF 1I6HJ 2F4OB 2NXNB 4PSXA 5D5UB 2VODA 4M3BA 1RR7A 2FQ4A 5GADJ 2EB7A 4HW0A 4JOMA 2EBIA 3B6CA 1NG7A 3PNVA 5M5YJ 3HJEA 1TL8A 1PDNC 3KLNA 4XLCA 1RZ4A 2O0YA 3IH2A 2FX0A 5FKLA 1OCOH 4G6DA 3H0GJ 3GTGJ 2PJPA 4P5OA 3R61A 3OYAA 3HSEA 1CF7B 3ABTA 3CC4I 1G8XA 1ETVA 4EM0B 4A5MA 1IRXA 1T0FA 1FSHA 2PFBA 3S1MJ 3RKQA 3I53A 1LB2A 2OCEA 1MD0A 4RM3A 5K1YA 2E2HJ 2FJ1A 2IPQX 2ECBA 4KN7X 3Q0UA 4ESBA 3BR6A 3OSGA 4EJOA 4B1RA 2OU2A 1V4RA 5D5XB 4MIMA 4UVCA 1T6SA 4RB3C 3V4GA 2VJ4A 4C3JJ 1A31A 1GXPA 2FOWA 5ED4A 4R1HA 2STTA 4XSXF 5D6EA 1R71A 1GDTA 2HDCA 2FOKA 4KT5C 4A3EJ 2BHYA 5BNGA 4CGZA 1Z9CA 3DCFA 2CW7A 3N97A 4EJVA 4GRIA 4AWXB 1U9NA 3KEYA 3T5XA 2VUMJ 1UFMA 2WAQN 2DN0A 2HKXA 5HODA 2ZMEC 5D5VB 3ABLH 1R7JA 2X6WA 1J2XA 1VQ5I 2P81A 4LITA 1ACIA 1G3YA 1AKHB 1RNLA 4I76A 2J5OA 3VYRB 1WI9A 3ZMZA 2CUEA 2DA7A 3G1MA 2OQRA 1GV2A 3KYLA 4NC7A 1SD7A 4CCJA 3GTJJ 1R1UA 1W4MA 3HM5A 3E6BA 3DV8A 2LF8A 3S3MA 2ZMEA 1RKTA 4C3HJ 5F04A 2HZTA 3C3WA 5JLWA 1OQYA 1BR2A 2K27A 2PMUA 4CYCA 4ZYGA 1IAWA 2EFQA 2AO9A 5FLVA 5E1WA 2OTLI 4HLXA 5DUIA 2E71A 4ASNA 4A3IJ 1YX3A 2LBFB 1FBQA 3CDIA 3H9JA 2DYSH 1FT9A 3D0SA 3WTVC 4M74A 1YJNI 4PK4A 2XPUA 4IXAA 2JSPA 4CYCB 1LUJB 2DQRA 4MHGA 1FYMA 3LSJA 5AIQA 2QSFX 4N9IA 2V4JC 5AONA 1B9MA 3RQ4A 1QNTA 1K6YA 3HHHA 2IS6A 1KGSA 2XGEA 5TGTA 1XTAA 1SMYF 2LF7A 5K5OA 3OOUA 5C4XJ 1PJRA 1I50J 3JRDA 1TT0A 4L9NA 3F8MA 5LRSA 1U5TA 1WRJA 4XONA 2XAGA 1ZG5A 3V8JA 1S6LA 2GXGA 3NARA 1ETQA 1Z1DA 2K5CA 5L3BA 1HW5A 2LP0A 1DU0A 2BGCA 1ZARA 3K70D 3HG9A 3HDDA 1TWHJ 4IRGA 3O6BB 3EQLF 1YITI 2EIJH 5B5EC 4BS9A 5ICGA 3S14J 1H9TA 2HR3A 2LH9A 3KZZA 1GUUA 3J7AO 3V8LA 3AG2H 3OSFA 1TWGJ 2IEKA 2GQQA 3IRQA 4ENKA 3E6CC 3WHCA 3MAJA 3OR2C 4HDUA 1BI2A 3CCUI 2FNPA 3DKXA 5IP7J 3LSPA 3QODA 3W2AA 4A3CJ 3LQQA 4QPOA 3K9TA 1Z3YA 3HZJA 1BI0A 1OISA 3SXYA 2ACJA 2R7VA 4BQQA 2K9NA 3F0CA 3CD6I 4MQ9F 2ZKZA 3VDXA 4Y17A 2DMTA 3MN2A 3Q9SA 1MBKA 3FXOA 2VL8A 3E5QA 1IRZA 3Q5FA 2K9LA 4AIHA 2ZCWA 2QENA 3B73A 3V7SA 3CCQI 2VKHA 4HF2A 3VYTB 3K1NA 3FXQA 3K6GA 3WTUC 2KKOA 1VNDA 2M4GA 2FA5A 2YUSA 2DFIA 3F3XA 1GVJA 1I5ZA 2OPTA 1VQ4I 2M8GX 1SFEA 2WTEA 3ZMVA 2Y0SA 3CO7C 2DBBA 3WTSC 1YQAA 1IUFA 3M7GA 2NOJB 4M6VA 4BH9A 1OMIA 3V8KA 3L09A 2HXOA 4XLEA 2Z33A 1POGA 4PDKA 2K4JA 3GLXA 3HEFA 3S93A 4HNVA 4EJTA 5EEAA 2P7CB 1DPRA 2RQQA 4HZFA 2WADA 2H6BA 2P4WA 3H3VK 1B8IB 3OYFA 2VC0A 4Y33A 1FBSA 1JE8A 1O3QA 5HLIA 1S9HA 4HG2A 1HW2A 2Z1DA 4A3BJ 4HX8A 4WK8F 2X1DA 4AIKA 2K40A 3FXJA 2EV5A 3FHNA 2Q8KA 1F4KA 5M3FJ 5H6QA 3TL4X 2C6YA 1TT5B 4AU7A 3VB2A 3G2BA 2DCEA 3KFWX 2Q1ZB 3EUHC 2UZKA 1X2NA 4B47A 1OPCA 1U5TB 1HQCA 4U7BA 4LG0B 1SD5A 1S7OA 3FZVA 4DNCA 4CCMA 2D1HA 5CYVA 1PVEA 4D7MA 1FWZA 2KP6A 2F5VA 5IT3A 2HVSA 5B1BH 3K10A 3K4LA 4E4HA 1P4XA 1SEUA 1JUPA 5B3SH 3PIOF 3CUOA 3HOYJ 2JRTA 5EG0B 1LE8B 2VQLA 1MNDA 3DP7A 2P6TA 3EYIA 3OL3A 4M6YA 3HKZA 5L3DA 3OY9A 4FISA 3V7CA 4G7ZF 2PX9A 3G6EI 1FBUA 1V55H 4BACA 2PBIA 2QQ9A 2IS2A 2IS4A 2RDPA 2HOEA 3BWGA 3OS1A 1BIBA 1ETYA 1YYVA 2DTZA 4XNFA 4LIUA 3X2QH 3JTGA 1D8JA 5HDNA 1WCMJ 2ZXJA 2GA1A 1YS6A 4BUPA 2JVHA 4HRIA 2P5VA 2MG4A 4G94A 3NRVA 3F22A 4HAMA 4ZDLA 1X2MA 2ELKA 4DZJA 1FLIA 1WJCA 2ECCA 2PN6A 2GZWA 4ON0A 2A5WA 1SVLA 1HLVA 2Y30A 4CA0A 1X3WB 4PUSA 5D8KB 4C9YA 5GAGJ 2D1VA 4V19K 4I0BA 4U7DA 2VE9A 2JA8J 3M1CA 1BC8C 2PMZA 3S1NJ 2E5NA 1QO0D 2CQKA 3KP6A 4BEHB 3DU6A 2VJ5A 2VQGA 3FXUA 1EH7A 2VBZA 2DFHA 3BLYA 1ULYA 2WV1A 3LNQA 2XHKA 4AC0A 2V6EA 2JT1A 1JHFA 2CW8A 2QQ8A 1H0MA 1KZHA 4F93B 4PJMA 3JTHA 2BZTA 1R36A 3LSKA 4DIQA 2FUG2 2JRMA 3I0TA 3OYHA 4BKXA 2WV0A 1UAAA 5LGUA 2UUZA 2UWMA 1OCTC 1TBXA 1FIPA 2BOLA 2QGUA 1A36A 3PQJA 1NTCA 3PSFA 2NS8A 2HTJA 2DDAA 1K4TA 1B59A 3HUGB 3ZQLA 4O3MA 4PJJA 1RKWA 2E1CA 3OS0A 2ME6A 4ZYDA 4Y7NJ 1J75A 1X4OA 1APLC 1XDSA 3TQNA 1AA7A 4I98B 3E3VA 2O7OA 4ENNA 5FLXK 1YJWI 2A61A 4PFPA 4L9VA 1NK3P 4IHXA 5IYBJ 2ZC2A 3GEZA 3TP3A 2XASA 3RPQA 3RKWA 1UCRA 2ZJ2A 4LOCA 4F3QA 3A1YA 3OYKA 2CSOA 1OLTA 2Y48A 2R0QC 4M73A 5L3GA 1YRNA 4UB8C 3A4CA 3RYPA 3RZOJ 5EEGA 1YS7A 4KIFA 2IP2A 4EQQA 3L00A 2LD5A 5EYRA 1FP2A 2EIMH 1X1PA 1E3HA 2EWNA 1QGPA 5CKTA 2YU9J 1ONVA 2QM3A 2E2IJ 4U87A 4KNYA 3OYJA 2VN2A 2A05A 4G9YA 4JX6A 1YW9A 3QPLA 3W6KB 2L7KA 4B09A 4DYRA 2QYOA 3RPUA 3G71I 4CCLA 3S1RJ 3OV8A 2M9HA 3BTJA 3FXMA 2EH3A 1W0UA 3FHZA 1K61A 4HSTA 3K1MA 2BVMA 2XPWA 4DQ2A 2CG4A 2EZKA 2XF5A 2LMDA 5EG0A 4I2OA 2RNJA 2IA2A 4BJ5C 3DLLF 2IA0A 2KFDA 2HPMA 3OYGA 1IXCA 4W1UA 2LVSA 1WVRA 3LMMA 3V42A 3T8TA 2QEXI 4C2UA 4A2UA 2R7DA 2QF7A 3P7NA 3LAPA 1U5TC 1TP4A 3EDPA 2PLYA 4OIPF 3VYUB 3A03A 1LFUP 2P8TA 1ZGJA 4LG0A 4IO9F 3WU0A 5FRMA 1QZYA 1V5GA 1JUMA 4JQFA 2L7FP 4X0GA 5ILUA 3G1LA 3FM3A 1HDDC 2X4HA 2NNNA 3KP7A 2HU9A 1HDPA 5E8IA 5LGNA 2HS5A 1A6IA 1OCCH 2Y9ZA 4RGUA 1ZRDA 3GLLA 5B66C 1WI3A 5E1XA 2E2JJ 4PFOA 4RGRA 1B8IA 2DFEA 4GO1A 3R0JA 4QWQA 3HHGA 1Z05A 4A3DJ 2R7QA 4Y4RA 5ILVA 4Q47A 3ZMTA 3L2UA 4J19A 3WU1B 3CMMA 1FYLA 4I99C 4PSWA 4DGWB 1XB4A 3K4CA 1WJEA 3MKLA 3QWLA 4CUGA 4J00A 1ZN2A 3GUDA 1UHWA 3HYIA 4KMUX 1DUXC 3D5RC 2ZXIA 4I0AA 3K70C 2DOAA 4IX7A 3OOPA 2Y0SN 4A69C 5M3MJ 2OD5A 3LSTA 1LQ1A 4PZJA 1XCBA 3LFKA 2HI3A 2XGCA 4E7KA 4BQOA 2OZ6A 2QA4I 1ZGAA 2DAOA 3H5RA 4NHJA 4XKCA 2ZXWH 2IGNA 2B7EA 3F21A 1CQTA 3CQZJ 3GVAA 2DT6A 4XLNF 4OU0A 4CHUA 3VSLA 3E5XA 2W24A 1GXQA 5IP9J 4A6DA 2X6XA 5EGOB 2RAEA 2G9WA 3RSNA 3GZNB 2KL4A 3HPHA 4LK0F 5JI6A 3ISPA 1MBHA 4GYIA 4E7HA 1WH7A 2VBYA 4RGXA 1U8BA 4UY8I 3ZOBA 5K7HA 4N4NB 5ICCA 5BPDA 5CLSA 3IAM2 4AUXA 4BDZA 1TWFJ 4BBSJ 4KYWA 1XGOA 3T0YA 5FROA 4A3KJ 2HYJA 3JRAA 4JX4A 1YIOA 5DEQA 3CCMI 4KFCA 1AOYA 1FOWA 1XGMA 4EJUA 3KIOA 4BE2A 1VQ6I 4M3DA 1T08B 3MWMA 2RNGA 1TZLA 4BEHA 4HX7A 2VONA 4D5FA 4UB6C 3HOSA 1Y6IA 3AAFA 1IN8A 1PYVA 3CCRI 1XS9A 2PJRA 4M3FA 3TO6A 1UJ8A 2DW4A 4HV6A 3MKYB 3Q3SA 3FKIJ 5EF6A 4XKWA 4OAYA 3FM5A 3D5SC 1LVAA 3EUKL 4BHCA 2A5YB 1EJ9A 4ABZA 2E60A 1U3EM 3I4NJ 2ETHA 4IHTA 3K4KA 4MEYF 1ON2A 2D5VA 3DQVC 3AL0B 3IWFA 2FD5A 4BU2A 2D45A 4E7LA 3ASOH 2STWA 5DYMA 1J09A 2BV6A 2EFPA 2QQAA 3GYHX 3MCZA 2XC7A 5EZGA 1D5VA 1FOYA 2XRLA 4A0XA 5IOYA 4MTDA 2KPMA 3NWSA 3I64A 4KJZA 1FMWA 2M34A 4EATA 3OR1C 4DBRA 2JPCA 4A12A 1O4XA 4OWRB 2L54A 5CVRA 2V9KA 4E7ZA 3OYLA 4XK4A 1ZRCA 4LMYA 3ERED 3PUFA 2UXXA 1HXDA 5LHGA 2L01A 3K0LA 5GAEJ 4AM3A 1IN4A 3S3OA 2B0LA 1WGXA 2VBXA 4G12A 1XGSA 1T0FC 4B4CA 3R60A 4R79A 3Q9VA 2M7BA 3BZKA 5IP6A 1K78A 3RPUD 2KMUA 4NC8A 3WODF 1E2XA 1F9NA 2JQ7A 1FNNA 2BW3B 3H5AA 3PFYA 2E35A 2W25A 3GWZA 3CJQB 4ENJA 2DJIA 4M71A 1BR1A 1G3SA 3COAC 3OS2A 2E7WA 1RC9A 2H8WA 3K69A 1V5EA 4L5JA 3IKVA 3SFZA 1KYZA 2CU7A 1YW8A 3MEXA 1YOVB 5E1ZB 3K4BA 1ZTRA 1LVKA 1ON1A 1FP1D 3UNGC 1FZPB 2ZJRF 3W6VA 3S32A 3V7RA 3HTSB 2OC6A 3J81Z 3HOXJ 1GLNA 3BR1A 1ENHA 3TDZC 1TQIA 5CVJA 1OR7A 4QPQA 3JRHA 5GTIC 2ICWG 5LRRA 2L4AA 2GA2A 4GDFA 2GLOA 4EM1A 4IVNA 2L9SA 1Y8QB 4HLYA 5LEJA 5D4RA 1XX5A 5L3FA 1UB9A 2AHQA 3BR5A 5C3EJ 1MH4A 2V6CA 1B72A 3FXLA 2BY2A 2K9SA 2VKVA 1ZH5A 4NB5A 2KJCA 3ZQHA 1JHHA 1D3YA 4RBOA 4M9SA 2HXIA 3BY6A 2LSOA 3OIQA 4QIWN 2QKMB 1I1SA 5ERIA 3TBIA 3J7ZI 4BBRJ 2DA5A 1LFBA 4M9XA 4KITB 2JUGA 2FF4A 4GGGA 2A6HF 4CICA 1MJAA 3C2GA 4EMSA 5M5XJ 4ZH4F 5FRNA 2O3FA 2KZGA 4FE7A 5FO5A 1W36D 3ZQIA 3WG9A 5L3EA 5HOOA 2CFOA 3I55I 5FJ8J 2DA3A 4PJLA 4XN0A 1PUFA 1VQPI 1Z21A 3DTIA 3LQRA 5F64A 1O3SA 4RAYA 4DW6A 3MZYA 1WKMA 3BP8A 2ESHA 3C18A 3ZGKA 1Z7LA 2HVRA 1WH5A 4YFNF 4UUSA 2WA0A 1IDYA 3HRMA 3CMAI 3CCJI 2O8KA 3I71A 4OINF 1IN6A 2PQ8A 2P6SA 2QUFA 1KU3A 1XGNA 3J81K 1R1TA 2I8DA 4PJNA 1VF9A 2AS5F 3S17J 2X6YA 1RESA 2E5ZA 4D7NA 5GAHJ 4A3GJ 2FBIA 4EVIA 4H4KC 1B9NA 2BXYA 2KDOA 2VJJA 1S7AA 2W85A 4OIRF 2ID3A 1ZLJA 4JX5A 3IHUA 2M45A 3AL0C 1DGRM 3ZN1A 1X1BA 4YELA 2NS7A 4BL0B 4XLHA 1BJZA 3PQKA 2ZSHB 2K3PA 1BIAA 5BQTA 2HYGD 2FMYA 4IHSA 3GTPJ 3KYCB 3FKJA 1FIAA 3DPUA 4F52A 4HF1A 3BPVA 3S2DJ 1YLFA 3CDLA 3BG9A 4C3IJ 4ZZLA 4LLLA 1U78A 3M4OJ 3CJNA 4I02A 2IJLA 1TW2A 4D0PA 2HQNA 3QOEA 1DPUA 3BJOA 2LY1A 5E3NA 1I3QJ 1WFXA 1XSXA 2CO5A 2MC3A 3DKWA 2UV1A 5CVUA 4AD9A 4F7ZA 1T39A 2F5FA 2ZMEB 5FKOA 2IGKA 5FLXZ 1WJAA 2CFXA 2Q2EB 2XF6A 2FQ3A 2BVLA 3GMEA 4FX0A 2Z2SB 1YRNB 2H94A 3FXRA 3TGNA 4IHVA 4XORA 1BW5A 4IRIA 5L3CA 1JKQC 4RGSA 1G3TA 3MMYB 3BG7A 3PJRA 3DKYA 4TV7A 5FGMA 3S15J 4XLFA 3OIOA 4FTHA 3SEZA 3RCOA 2BHZA 3DTEA 2HYFA 5CVIA 3CCSI 3SDGA 2ELHA 2FBHA 2JMWA 1RR8C 3KPHA 5ILSA 1X3UA 1AHDP 1MNEA 2LKSA 1O7FA 1MMDA 2R7RA 5IYDJ 2ZFUA 4O6JA 4Y3OA 4LB6B 4A93J 3CCLI 3MQ0A 4A6EA 4XN3A 3WU2C 2AXTC 2DT7B 2VE8A 1D5YA 2BBYA 2MW8A 1N25A 1R4MB 4HPQA 1JJ8C 4U0WA 1XDUA 2IRFG 2XVCA 3H35A 1RRJA 3FMQA 3JREA 5KNLA 1P7JA 4EGZA 2QSHX 1EKEA 1O7LA 2K85A 1HSTA 2MFZA 2R7ZJ 3F8BA 1Z91A 1I27A 4OMZA 4BE0A 2XKPA 1TTYA 4KT6A 2R7TA 3I4PA 5FLMJ 3FF5A 2FXAA 1LDDA 2DA2A 2XAFA 1SFOJ 5FD6A 1XN7A 4IQ4A 2O8XA 3M3YJ 1LEBA 3PSIA 2J5PA 1T2KA 3ONQA 3WE2A 1P4AA 3ECHA 2HQ5A 5LHIA 5IY5H 3BDDA 4LLNA 3P9KA 2WY8Q 3WTZA 2OJED 2VT2A 4MO7A 3RTRA 4P1WA 4PGGA 4C30A 2MA3A 2RGVA 2WB1A 3CESA 5DD4A 1A6QA 1OYYA 3GXOA 2EV0A 2DU9A 2B9SA 1HOMA 1ETXA 3DXJF 1XD7A 1X3ZB 1RI7A 1O57A 2DO7A 1IO2A 2NYXA 1V5FA 3CCVI 4S05A 4F55A 2A07F 3RIRA 4YEJA 3PO3J 3ZXSA 2R5YB 2UXNA 3GTLJ 3ULQB 1R22A 1SD6A 2G7UA 1OFCX 3SQNA 2GOMA 3WTTC 1TW3A 3HRUA 5DCMA 1V54H 4IOCF 5H2FC 2OA4A 3DPTA 1RUOA 1A5JA 1JGSA 1STZA 4ESFA 4IKFA 2NVYJ 4BYYA 3BG6A 5ICEA 5EGOA 2CYYA 3E0JB 3IH3A 1QA6A 3NEUA 2EV6A 4IHWA 2GOXB 2FEZA 4LG3A 1W0TA 3U1DA 2N8GA 2Q2EA 3E1SA 4HYEA 3QP6A 4MQVA 4NUBA 4ZC3A 4BNCA 2CQ7A 3S8PA 2BYVE 2ESNA 2F48A 2X85A 2Z99A 4Q4ZF 4ZTFA 3KYDB 3ZCOA 4RLQA 2LYCA 4IPAA 1WJDA 2E36A 1JTYA 3CDHA 3SEQA 5GPAA 4BJTA 3DLAA 2VKEA 4LJZF 4HNTA 4FHTA 2I10A 3EPZA 1T8IA 2ISYA 1HW1A 1PP8F 2XAJA 3TOAA 3J80Z 3M07A 4V2FA 1Z77A 3BR2A 3N4MA 5J1YA 3S1QJ 1AWCA 2LTPA 3L1PA 5K7ZA 1GVDA 2V26A 4WXHA 3HC7A 1I3AA 2OBPA 5EEHA 3VEPA 2VB6A 2DTRA 5JLXA 3MKZA 1H9GA 3R6SA 3TMOA 3A01A 4NQWB 2PI0A 1QHHD 1W5CC 2ELJA 4HQMA 1U8RA 2CRGA 3GZ5A 4KIBA 3LSIA 2KHMA 2CJJA 4G8XA 3J7AY 4EM2A 2EZHA 4M9ZA 3CC2I 4ZDOA 5J40A 4FCYA 2KRFA 3QQAA 2IGMA 4F91B 3ZMUA 1MBEA 3K2ZA 2BE5F 4L5EA 1HKTA 3OYBA 4C2TA 3ZQQA 4E7JA 1IRFA 2JWTA 2NNYA 4IL6C 4AIDA 4HA8A 2EQRA 4KIGA 4BXXJ 1TNTA 2WAFA 1ZAOA 2FMLA 2MABA 3QU6A 3ZPLA 4DBQA 1JKOC 1HC8A 4ZZDA 1IG7A 3F6VA 3CTAA 4RB1A 2HDDA 1P7IA 2XGDA 4A3FJ 1KU9A 1VQ7I 3GO5A 4BY1J 4CZZA 2KIQA 3C2HA 3LFUA 2WAQA 3BTIA 4FE4A 3CC7I 4CO8A 2IW5A 2JSCA 4KDPA 1WPKA 2W00A 2V79A 1IRGA 4JK1X 5KAFC 2QQBA 4IEJA 1IN5A 2FU4A 3KP3A 5JVTA 1I1GA 3JRFA 4U0VA 3FMRA 1HSJA 4N4OB 2VPLA 4HEA2 2GXBA 3ZQGA 3A01B 5TJJA 1MH3A 1WJ5A 4XRSA 2VT3A 4DOZA 1IUYA 1KQ8A 3LSGA 3QU3A 1RIOH 1N78A 3SZTA 5KCMA 2VLAA 4I09A 2WBMA 4EGYA 1ERDA 2OF7A 1QBJA 4RB2C 2L7MP 4BXFA 4XIDA 4RDUA 2LRDA 5E20A 3WGHA 1QHGA 1G59A 1UZCA 5LEKA 2L4MA 1DQUA 4XMYA 3J80K 4GFBA 5IYCJ 5HLHA 1OR7C 3OL4A 4II2A 3MD2A 1XMXA 2PJRB 2OV7A 4D9JA 4CZCA 3KLOA 1ZR4A 2P0WA 1J7KA 2E7XA 2K7LA 3KEQA 4CCOA 3H3UA 2FRHA 5HNFA 3ZP5A 2YS9A 3ZQCA 4X6AJ 1VI0A 3BR0A 3CJTB 2VKDA 3I9V2 2M1BA 1IGNA 2ZFWA 3W2VA 4B43A 1HF0A 2W7NA 3D5LA 2NOGA 4BHBA 2RVCA 4G7HF 1MSFC 1X58A 1K6OA 4HX4A 9ANTA 1U0JA 1W7PA 3ABMH 3QPTA 4D1QA 3SZPA 2JZYA 3WE3A 3CLOA 3QPSA 3L2WA 4XLPF 1K83J 3FK6A 1FYKA 1LE8A 2DLLA 1B4AA 4G6QA 2MD0A 5F0HA 1LJ9A 3F23A 3HSFA 5LD2C 1MDMB 1D0ZA 1QZEA 1USTA 3BTCA 1ETKA 1VQOI 2ZB9A 1VQ9I 3KEOA 1BI1A 3VFZA 3CF5F 3PNYA 1FOXA 4D5CA 2KISA 2XB5A 1W5TA 3A02A 1L0OC 1FY7A 3ZMDA 4EV0A 5JHFA 5LBQA 5FKKA 1ETWA 3OYNA 1Z3XA 4Q5SF 3E6DA 2YR2A 1LNWA 2ZO4A 5HNHA 3SHFA 3HPGA 2XDVA 1F36A 1KU7A 2MBFA 4JBAA 2CQXA 2NS0A 1P6RA 1XSVA 4MNUA 3FK7A 3RJPA 5JR3A 3M1EA 1YX5A 1NK2P 2QKLB 4A0YA 1BC7C 2R7UA 1B72B 3OWTA 5J6XA 3HL2A 1REPC 3S2HJ 4RMNA 1GV5A 3HOWJ 1YTYA 4AIJA 2KIFA 4V2GA 2RREA 2G0EA 2XAHA 1R23A 1TWAJ 1FOKA 2A6EF 4XLAA 3IUOA 3UKGA 2H8RA 2QBYB 4P55A 3GTQJ 3RDIA 4E6KG 3I59A 2GXAA 3K1PA 3G1OA 4WX9A 3BCBA 1R6RA 4IRHA 2CQNA 2H27A 1QVTA 5DM6F 3S2WA 2VQCA 2IXSA 2YU3A 3AG4H 5BS6A 4HF0A 3M8EA 2HNHA 3ML6A 3ZQFA 5FD5A 1RETA 3L9FA 3DF8A 1D8KA 4P96A 1ZGWA 1U2WA 1TNSA 1UG0A 4ESJA 1CGPA 2JTVA 2WWYA 2OTJI 1J0RA 1ZRFA 1XC5A 4S0HB 5J8CA 2WC2A 4GCVA 2LOOA 2DK5A 4K2EA 2X48A 3SZGA 1QZZA 3M8FA 2BY1A 3LOCA 1TQPA 3H92A 1TWCJ 2LBFA 1UHMA 5CQEA 1JI8A 4Y13A 1IF1A 4OAZA 3KP2A 3QP5A 2H6CA 1G3WA 1MBGA 4J01A 2AQEA 1BN5A 5FFZA 1R49A 1Z6TA 2EZIA 4L9TA 3TOBA 2W4SA 3WHBA 2COMA 1P4WA 2DMUA 3A2KA 1QVUA 4XQFA 1FX7A 1A35A 3EUAA 5AIPA 3I54A 4Z6YA 3R0AA 2DPUA 5DV5A 3CO6C 1S7EA 2DOEA 2M3AA 3I58A 4BDYA 3ROUA 1ZR2A 1MIJA 5IT9K 2KLOA 2L7ZA 5F0CA 4FASD 3HBLA 5HLGA 3LAJA 1ZKGA 3F8CA 4FQGA 1YI2I 3ESWB 3L2RA 2A6TA 2M2EA 4W97A 1N77A 4X1EA 2IA1A 1S3JA 2YX4A 2DA6A 1WQ2A 5TISC 6PAXA 2Y9YA 5J47A 2Z16A 3SYTA 2QWWA 2CUJA 2XRNA 4UNOA 3GTOJ 3TO7A 3EYYA 2BXZA 1W5SA 3U2RA 2FNAA 5FKNA 1U6GA 5J1RA 3DBLB 2H1KA 3TW7A 3BZCA 4QTRA 4FT8A 1T56A 1MKMA 3KX2A 2X9DA 3SDBA 3Q0VA 2R5YA 5H6RA 2V1UA 2LG4A 4B3XA 5K7FA 2WAEA 4CH7A 2F5DA 2F5CA 2W82A 3HUGA 3HOZJ 1H89C 4ZYEA 2VIXA 1XG1A 2F4MB 3OYDA 2M7AA 3QPHA 3E5UA 3K2AA 5EDNA 1P2FA 2HQAA 1WSUA 2R7SA 2DQLA 2B63J 2JVGA 2KDZA 2QZ8A 2A69F 2L2OA 3FXKA 4BE1A 3CJRB 3CMEI 2Y69H 4U88A 1AKHA 2OAZA 2F2EA 1R00A 4KMFA 2V7FA 4M6XA 4F92B 3I59B 3BQZA 3PFIA 2L3DA 3H36A 1WJFA 2TRTA 5IT9Z 5F27A 1D0XA 4XRFA 1FMVA 4BXUA 4E70A 5C4JJ 2K4BA 1WJBA 2F4IA 2RQPA 4I6ZA 2G7HA 5BOXA 3HKZN 3CMYA 4NBQA 1G6NA 2K3FA 4IQJA 1P9QC 2VXZA 3NQOA 2O61A 4RB0A 3JR9A 2GIZA 1SC7A 4BJ6C 4ZYHA 2KZVA 5JVGF 1FPQA 1VQMI 3K7AJ 1BW6A 2FE3A 2EFNA 2HVQA 2R7XA 1X1AA 2X1EA 3BJ6A 4CDGA 3QYEA 3ZR8X 2Z5UA 5CQGA 3CF2A 2JUCA 2ID6A 5E3LA 2NVTJ 3LSRA 1Y0NA 1EF4A 4HSRA 4MTEA 2M8EA 3HOUJ 3H3ZA 2ZJPF 3G73A 4KN4X 4LB5A 4Y52J 4ZYAA 3JSPA 4LGWA 1H8AC 2DOFA 3RYRA 4BGDA 1SAUA 4L18B 2XAUA 2E1MC 4JP0A 2DI3A 1HCRA 1R58A 5K5QA 3E6MA 3QYFA 1XPXA 3VSKA 3FMSA 3DWLE 4JYKA 5D6FA 2D2WA 2PMZN 4DJAA 4ZTJA 4RA2A 4MEXF 2CV1A 1OJLA 2E1MB 2IAIA 5HDKA 2IGOA 1R5HA 4EJWA 3JRIA 1FEXA 1M1EB 2CUZA 3HTUA 1DP3A 3QOPA 3IAS2 3PUBA 1Y1VJ 2VBWA 4YRVA 3O8HA 4NNJA 4OMYA 2HEOA 1QQIA 3VODA 1D1CA 2ZNYA 3R4KA 3I56I 2RC4A 1KQ0A 1VFCA 1FTZA 3U21A 4LD5A 2CV0A 3RZDJ 1G4DA 3L2QA 2ZSIB 1X1DA 5F0FA 4A3MJ 3HOVJ 1YG2A 1JKRC 3B6AA 2P7VB 1X4PA 4XKVA 2HZDA 2DJNA 2I5UA 3GTKJ 4HBLA 1U9OA 4AVPA 3H9GA 2CH0A 4LFUA 4PGHA 4B48A 2CUFA 3ABKH 3VWBA 5DM7F 2BY0A 3CZ6A 4MFEA 4Z2YA 2OQGA 3RI4A 1OYWA 4KA4A 1S29A 2WY7Q 5F1RA 1YIJI 1R5ID 2OCCH 1XMAA 3GCMA 4WWCA 2KJBA 3UR3C 1K78B 1RPWA 1ETOA 3C2BA 4ZJZA 2L9RA 2VXDA 3FDYA 3ZQ7A 1BA5A 3H0DA 2BY3A 4PJ0C 1MJ9A 2DYRH 2WB1N 3KZYA 1NH3A 3JAMZ 1Z6RA 1T98A 3IWZA 1YFHA 1BBYA 2NVUB 1SFUA 2IS1A 1VZ0A 1IC8A 5B1AH 3U9GA 1PUFB 3BG3A 3IV5A 2HOTA 1IW7F 3BZ6A 4P9FA 2VC1A 3HGYA 3GFMA 2MD5A 3AG3H 1S8NA 4M72A 2LK2A 3W6JB 5C44J 3DPLC 3S3NA 1BI3A 1MGTA 2DFFA 3N05A 2DXIA 5KVRA 1ODDA 1VQNI 3AFHA 1YJ9I 3OYEA 3ELKA 5E79C 3KETA 1CF7A 2DK8A 4RAFA 3KCCA 1F5TA 3O3KA 3I5UA 3TW6A 4YIIA 2K02A 1Z0XA 2ADUA 2YPRA 1ZELA 2TDXA 3RKXA 1J59A 3H1CA 5F6FA 3QYBA 1ZQ3P 2GAUA 1FJLA 2MLGA 2M87A 2RV8A 5FB2A 5HDGA 2LREA 5LGTA 1SVMA 3E97A 3W3CA 1QRYA 3ASNH 2JK3A 1TC3C 3FWEA 2KRCA 2MYSA 1R1VA 2VI6A 1OCZH 3DBRB 2Q0OA 5J4VA 2DMPA 3JRCA 1D0YA 4RAGA 1J9IA 1ZLKA 4AVZA 1UG2A 5J1UA 2JA7J 2YX7A 2EPFA 2COBA 2HTSA 1FC3A 1R4NB 3O8GA 4A3JJ 2Z9OA 1VTNC 3GTMJ 4A3LJ 3IP4B 5BPIA 1WWXA 5DD8A 2EZLA 1KU2A 1T33A 2VQHA 4WCGA 3BJAA 2AQFA 4ENMA 4IJAA 2VJIA 3MFKA 1EH6A 1SFXA 2L5QA 1MMNA 2CS3A 2IBDA 5LLQA 3H5NA 4R8HA 1PUEE 5A2QK 1O3RA 2W1OA 3F8FA 2JPBA 5J3LA 4CSWA 1TQMA 3BR3A 3FX3A 1E3OC 4L5IA 4IF4A 1QPMA 4XSZF 1R9TJ 2M4KA 3GBGA 3T8RA 1WZ2A 1MMSA 2GWRA 1D1AA 1BOAA 1HA8A 2LC2A 2IT0A 1XMKA 2LKPA 2CGPA 2V1XA 3PM1A 1JJ6C 3KP5A 3F72A 3JAMK 4EEFG 1E17A 2K9MA 3DU5A 5K5RA 2DPDA 5E18F 3JRBA 1YO5C 4DYQA 4IHYA 1HKQA 1V3FA 1W7PB 3P9IA 1ZG3A 4RAZA 2P5LC 1X1CA 5HLTA 2L9NA 4G7OF 4HNUA 2LR8A 4MGRA 3TKYA 1USSA 4UVBA 4OOIA 4XOTA 4BQNA 1PP7U 2XGXA 1LPQA 1KYWA 1SD4A 4LLGF 4XOPA 2OZUA 1A04A 5F08A 4S04A 1J5YA 3OIPA 2L0KA 1LKXA 3BROA 5D4SA 4AYBN 5CPRB 1B6AA 3DFGA 1P92A 4OIOF 2XPVA 5E17F 1FSEA 1VQLI 1BM9A 5GTHC 3RQIA 2XF7A 3JCUC 4MFDA 1D1BA 2K86A 3BC8A 3HXLA 2E1NA 3WTYC 1KONA 2V9VA 2XV4S 3WGIA 1IDZA 4XBFA 3NWTA 2P5KA 2M30A 4O5VA 5DCFA 4B8XA 5DUKA 2FSWA 2YSRA 1UMQA 2MH9A 2XB0X 2O9LA 4B44A 2QBYA 2W48A 4RLFA 4CCNA 2HOAA 3DEUA 1QPIA 2A68F 2TCTA 4P9UA 2ZXHA 3WG7H 2KIUA 4UV9A 5EJCA 4IOAF 5LHHA 1T38A 4H0EA 1Y39A 2CMPA 5FFXA 3PIPF 1GHCA 3G4SI 2XAQA 5BMZA 2CWEA 3GFIA 4ITVA 4GXOA 3CUQB 1MDMA 2EK5A 3LA2A 5CJ9A 3GW2A 4C2MJ 3B02A 3WTWC 3BOQA 3QAHA 1XCVA 1IJWC 1RUNA 4L9JA 3ABUA 2NVXJ 4YIRX 1MSEC 3BCAA 4DYCA 3QRFF 1BL0A 5H20A 2JA5J 2DODA 2PMHA 2V9PA 1K79A 3L7WA 4N9HA 3HB9A 3MZ8A 2XROA 3TEDA 2EA4A
chains in the Genus database with same CATH topology
3ERMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERM A; 
#chains in the Genus database with same CATH topology
 3GF2 A;  3ZRG A;  3F6O A;  3W2W A;  3DEW A;  2E1O A;  2VOP A;  1Z7U A;  5GP9 A;  1L3L A;  4E7I A;  2L02 A;  2EA2 A;  2HDW A;  1X19 A;  2XIG A;  3LL7 A;  1VQK I;  1K4S A;  3CP2 A;  1MMG A;  2EIL H;  5HVQ C;  5DTD A;  3AKZ A;  1SMT A;  2X0L A;  4XRM A;  4DZP A;  3NAU A;  2AXL A;  2GM4 A;  2O6G E;  3T1B A;  5E3O A;  4FX4 A;  5JFR A;  2EJR A;  2HOS A;  3CUQ A;  2DA1 A;  4XR6 A;  1XSD A;  1S5L C;  2MC4 A;  3OYI A;  2M0M A;  2DA4 A;  4YG2 F;  4YIF A;  1LEA A;  1EA3 A;  4NQW A;  3PL8 A;  4XIC A;  3GFJ A;  1ORK A;  3PO2 J;  3BT9 A;  3IC7 A;  4KIS A;  1JUS A;  4BAY A;  1S72 I;  1TLH B;  1KA8 A;  4CXF A;  1UHS A;  1DP7 P;  3A0H C;  2R3S A;  3P9C A;  2JJ7 A;  2QVO A;  2ZJQ F;  1MNM C;  2HFH A;  3REO A;  5DS9 A;  5J4Y A;  3CLQ A;  2M5W A;  2R7W A;  1VQ8 I;  1JGG A;  2H09 A;  4BY7 J;  2R93 J;  1NHA A;  1G2H A;  1WHU A;  2ME0 A;  1IN7 A;  1OCR H;  3CP8 A;  3I3L A;  2DDB A;  3OMY A;  2DMN A;  2QSG X;  4CCK A;  1W1W E;  2EIK H;  2HWV A;  2Y0M A;  3L2V A;  2EFO A;  2F6C A;  3S16 J;  1JXS A;  1IV8 A;  2MSY A;  2JN6 A;  3K4J A;  4CYD A;  3ECO A;  5E8G A;  1MBF A;  2NRA C;  1I39 A;  1MBJ A;  4QLC U;  2CV2 A;  1SFK A;  4ZDP A;  3LSM A;  1I6X A;  4ETS A;  4XRS G;  3HIF A;  3DTK A;  3PNT A;  2KQR A;  3IRR A;  2ZBK A;  2M0C A;  3EET A;  2BEO A;  2DT5 A;  1YE9 A;  4GYG A;  5D8L B;  3WTX C;  1O3T A;  4PCQ A;  1C0W A;  2LNB A;  4WXC A;  1DU6 A;  3M8J A;  3VPR A;  3A0B C;  4Q48 A;  3M9A A;  4UV8 A;  2HPI A;  4UVA A;  2KIM A;  2VPR A;  4NDL A;  1K7A A;  4HOB A;  5HS7 A;  2VOO A;  4FET A;  1Z67 A;  4M3E A;  4XM3 A;  2X51 A;  1ZHF A;  2O5R A;  3P5J A;  2W84 A;  5DDG A;  2ISZ A;  2NAZ A;  4LIV A;  4MLO A;  4G6T B;  2NVQ J;  1Y56 A;  5JHU A;  1EH8 A;  1EV7 A;  1B1B A;  3ZN0 A;  2R7F A;  2QCO A;  4QSH A;  3J7Y J;  3U1K A;  5A2Q Z;  4UUV A;  3CCY A;  3KP4 A;  1ZK8 A;  2RKH A;  5KAI C;  3RKY A;  1BJA A;  3TP0 A;  3DEE A;  2W57 A;  2JA6 J;  1QU3 A;  4KUM A;  5KK1 A;  2HQR A;  2R5Z B;  1AU7 A;  3D1N I;  1MW7 A;  1LDK B;  3SFI A;  3O2P E;  1GT0 C;  4A5N A;  2E19 A;  3K4M A;  2XSD C;  1ITY A;  3TO9 A;  1MZB A;  3KZI C;  1OYI A;  4UXN A;  3IKT A;  3BG5 A;  3F9K A;  4L0Y B;  1R5G A;  1W7P D;  1ZRE A;  3GZ6 A;  1IZ1 A;  3G3Z A;  2MLK A;  3KE2 A;  4Y15 A;  4LK1 F;  2V1D A;  3SJM A;  3LSH A;  1T95 A;  4YFK F;  5ICF A;  3BTL A;  3C1D A;  2R7O A;  3H9Q A;  3Q0W A;  4A0Z A;  1YHQ I;  3HOT A;  2X6O A;  3LA3 A;  4RM2 A;  3EUH A;  2CQQ A;  1Q1V A;  2ZNZ A;  2X1C A;  3LWF A;  4ANJ A;  3MKW B;  1OCP A;  3I4M J;  1ZYR F;  3BQY A;  2Y75 A;  1Y1W J;  1Y8R B;  1SVO A;  2A3S A;  4B3A A;  3FIS A;  3BPX A;  5HS9 A;  1E0E A;  1JKP C;  4UHT A;  1NG6 A;  4XKB A;  1OKR A;  4NC6 A;  1JT0 A;  1IXR C;  3HRT A;  3CCE I;  2CW0 F;  5GPC A;  4M3G A;  3HSR A;  5DCM B;  1LDJ A;  3AG1 H;  4E7S A;  1FTT A;  1LFP A;  1DDN A;  2PG4 A;  2IVM A;  2O03 A;  1W36 C;  2Z3Y A;  2F5E A;  2V1N A;  4RS8 A;  5TRD A;  2MH2 A;  3DBH B;  4I01 A;  2BW3 A;  3FBI B;  4UUT A;  4HDV A;  2Y2Z A;  4IZZ A;  4L0Z B;  5FKM A;  1JT6 A;  5CVV A;  2R4G A;  4XL9 A;  3E7L A;  2LDU A;  1Y0U A;  4WXD A;  5IPA A;  2L9V A;  3C7J A;  3CUQ C;  3MZH A;  3JRG A;  2LLK A;  1IXS B;  3ERM A;  4UUS B;  4BHP A;  1MJB A;  2HKO A;  2LFB A;  4I7H A;  1SAX A;  1MMA A;  1HBX G;  5D5W B;  4OIQ F;  2RN7 A;  5E3M A;  2PEX A;  4BQA A;  3F8N A;  2EFW A;  2KT0 A;  2E34 A;  2JA2 A;  2XKO A;  5KHD A;  3GFL A;  3K4N A;  2R92 J;  3ZMS A;  1Q1H A;  3FIW A;  3JSO A;  1ZG1 A;  1E3P A;  1SAN A;  2FBK A;  2OUM A;  2KRH A;  3HGG A;  1F1Z A;  4AYB A;  4U0Y A;  4N0B A;  3LA7 A;  2GIV A;  5HS8 A;  2DMQ A;  1DGW Y;  3VOE A;  3TDU C;  2H1L A;  1IV6 A;  2K9Q A;  3FBN B;  3GX4 X;  2LY2 A;  2Y31 A;  1JTX A;  5J8F A;  1N75 A;  2QLZ A;  4WF2 A;  2XSJ C;  5LFA A;  3OYC A;  4HV5 A;  3IH4 A;  1BR4 A;  1UEL B;  3HRS A;  5IOZ A;  2R5Z A;  3MVP A;  2GBY A;  3IL2 A;  1H88 C;  3L2C A;  1BOB A;  3WGG A;  4HQE A;  2VAS A;  3VYS B;  2XUB A;  2MGQ A;  1YW7 A;  3JW4 A;  2HGC A;  4KIC A;  5EZH A;  5M5W J;  1HKS A;  2LY9 A;  5F1J A;  3OYM A;  2EIN H;  1F43 A;  1KQ9 A;  2LKX A;  4II3 A;  4YFX F;  1I6H J;  2F4O B;  2NXN B;  4PSX A;  5D5U B;  2VOD A;  4M3B A;  1RR7 A;  2FQ4 A;  5GAD J;  2EB7 A;  4HW0 A;  4JOM A;  2EBI A;  3B6C A;  1NG7 A;  3PNV A;  5M5Y J;  3HJE A;  1TL8 A;  1PDN C;  3KLN A;  4XLC A;  1RZ4 A;  2O0Y A;  3IH2 A;  2FX0 A;  5FKL A;  1OCO H;  4G6D A;  3H0G J;  3GTG J;  2PJP A;  4P5O A;  3R61 A;  3OYA A;  3HSE A;  1CF7 B;  3ABT A;  3CC4 I;  1G8X A;  1ETV A;  4EM0 B;  4A5M A;  1IRX A;  1T0F A;  1FSH A;  2PFB A;  3S1M J;  3RKQ A;  3I53 A;  1LB2 A;  2OCE A;  1MD0 A;  4RM3 A;  5K1Y A;  2E2H J;  2FJ1 A;  2IPQ X;  2ECB A;  4KN7 X;  3Q0U A;  4ESB A;  3BR6 A;  3OSG A;  4EJO A;  4B1R A;  2OU2 A;  1V4R A;  5D5X B;  4MIM A;  4UVC A;  1T6S A;  4RB3 C;  3V4G A;  2VJ4 A;  4C3J J;  1A31 A;  1GXP A;  2FOW A;  5ED4 A;  4R1H A;  2STT A;  4XSX F;  5D6E A;  1R71 A;  1GDT A;  2HDC A;  2FOK A;  4KT5 C;  4A3E J;  2BHY A;  5BNG A;  4CGZ A;  1Z9C A;  3DCF A;  2CW7 A;  3N97 A;  4EJV A;  4GRI A;  4AWX B;  1U9N A;  3KEY A;  3T5X A;  2VUM J;  1UFM A;  2WAQ N;  2DN0 A;  2HKX A;  5HOD A;  2ZME C;  5D5V B;  3ABL H;  1R7J A;  2X6W A;  1J2X A;  1VQ5 I;  2P81 A;  4LIT A;  1ACI A;  1G3Y A;  1AKH B;  1RNL A;  4I76 A;  2J5O A;  3VYR B;  1WI9 A;  3ZMZ A;  2CUE A;  2DA7 A;  3G1M A;  2OQR A;  1GV2 A;  3KYL A;  4NC7 A;  1SD7 A;  4CCJ A;  3GTJ J;  1R1U A;  1W4M A;  3HM5 A;  3E6B A;  3DV8 A;  2LF8 A;  3S3M A;  2ZME A;  1RKT A;  4C3H J;  5F04 A;  2HZT A;  3C3W A;  5JLW A;  1OQY A;  1BR2 A;  2K27 A;  2PMU A;  4CYC A;  4ZYG A;  1IAW A;  2EFQ A;  2AO9 A;  5FLV A;  5E1W A;  2OTL I;  4HLX A;  5DUI A;  2E71 A;  4ASN A;  4A3I J;  1YX3 A;  2LBF B;  1FBQ A;  3CDI A;  3H9J A;  2DYS H;  1FT9 A;  3D0S A;  3WTV C;  4M74 A;  1YJN I;  4PK4 A;  2XPU A;  4IXA A;  2JSP A;  4CYC B;  1LUJ B;  2DQR A;  4MHG A;  1FYM A;  3LSJ A;  5AIQ A;  2QSF X;  4N9I A;  2V4J C;  5AON A;  1B9M A;  3RQ4 A;  1QNT A;  1K6Y A;  3HHH A;  2IS6 A;  1KGS A;  2XGE A;  5TGT A;  1XTA A;  1SMY F;  2LF7 A;  5K5O A;  3OOU A;  5C4X J;  1PJR A;  1I50 J;  3JRD A;  1TT0 A;  4L9N A;  3F8M A;  5LRS A;  1U5T A;  1WRJ A;  4XON A;  2XAG A;  1ZG5 A;  3V8J A;  1S6L A;  2GXG A;  3NAR A;  1ETQ A;  1Z1D A;  2K5C A;  5L3B A;  1HW5 A;  2LP0 A;  1DU0 A;  2BGC A;  1ZAR A;  3K70 D;  3HG9 A;  3HDD A;  1TWH J;  4IRG A;  3O6B B;  3EQL F;  1YIT I;  2EIJ H;  5B5E C;  4BS9 A;  5ICG A;  3S14 J;  1H9T A;  2HR3 A;  2LH9 A;  3KZZ A;  1GUU A;  3J7A O;  3V8L A;  3AG2 H;  3OSF A;  1TWG J;  2IEK A;  2GQQ A;  3IRQ A;  4ENK A;  3E6C C;  3WHC A;  3MAJ A;  3OR2 C;  4HDU A;  1BI2 A;  3CCU I;  2FNP A;  3DKX A;  5IP7 J;  3LSP A;  3QOD A;  3W2A A;  4A3C J;  3LQQ A;  4QPO A;  3K9T A;  1Z3Y A;  3HZJ A;  1BI0 A;  1OIS A;  3SXY A;  2ACJ A;  2R7V A;  4BQQ A;  2K9N A;  3F0C A;  3CD6 I;  4MQ9 F;  2ZKZ A;  3VDX A;  4Y17 A;  2DMT A;  3MN2 A;  3Q9S A;  1MBK A;  3FXO A;  2VL8 A;  3E5Q A;  1IRZ A;  3Q5F A;  2K9L A;  4AIH A;  2ZCW A;  2QEN A;  3B73 A;  3V7S A;  3CCQ I;  2VKH A;  4HF2 A;  3VYT B;  3K1N A;  3FXQ A;  3K6G A;  3WTU C;  2KKO A;  1VND A;  2M4G A;  2FA5 A;  2YUS A;  2DFI A;  3F3X A;  1GVJ A;  1I5Z A;  2OPT A;  1VQ4 I;  2M8G X;  1SFE A;  2WTE A;  3ZMV A;  2Y0S A;  3CO7 C;  2DBB A;  3WTS C;  1YQA A;  1IUF A;  3M7G A;  2NOJ B;  4M6V A;  4BH9 A;  1OMI A;  3V8K A;  3L09 A;  2HXO A;  4XLE A;  2Z33 A;  1POG A;  4PDK A;  2K4J A;  3GLX A;  3HEF A;  3S93 A;  4HNV A;  4EJT A;  5EEA A;  2P7C B;  1DPR A;  2RQQ A;  4HZF A;  2WAD A;  2H6B A;  2P4W A;  3H3V K;  1B8I B;  3OYF A;  2VC0 A;  4Y33 A;  1FBS A;  1JE8 A;  1O3Q A;  5HLI A;  1S9H A;  4HG2 A;  1HW2 A;  2Z1D A;  4A3B J;  4HX8 A;  4WK8 F;  2X1D A;  4AIK A;  2K40 A;  3FXJ A;  2EV5 A;  3FHN A;  2Q8K A;  1F4K A;  5M3F J;  5H6Q A;  3TL4 X;  2C6Y A;  1TT5 B;  4AU7 A;  3VB2 A;  3G2B A;  2DCE A;  3KFW X;  2Q1Z B;  3EUH C;  2UZK A;  1X2N A;  4B47 A;  1OPC A;  1U5T B;  1HQC A;  4U7B A;  4LG0 B;  1SD5 A;  1S7O A;  3FZV A;  4DNC A;  4CCM A;  2D1H A;  5CYV A;  1PVE A;  4D7M A;  1FWZ A;  2KP6 A;  2F5V A;  5IT3 A;  2HVS A;  5B1B H;  3K10 A;  3K4L A;  4E4H A;  1P4X A;  1SEU A;  1JUP A;  5B3S H;  3PIO F;  3CUO A;  3HOY J;  2JRT A;  5EG0 B;  1LE8 B;  2VQL A;  1MND A;  3DP7 A;  2P6T A;  3EYI A;  3OL3 A;  4M6Y A;  3HKZ A;  5L3D A;  3OY9 A;  4FIS A;  3V7C A;  4G7Z F;  2PX9 A;  3G6E I;  1FBU A;  1V55 H;  4BAC A;  2PBI A;  2QQ9 A;  2IS2 A;  2IS4 A;  2RDP A;  2HOE A;  3BWG A;  3OS1 A;  1BIB A;  1ETY A;  1YYV A;  2DTZ A;  4XNF A;  4LIU A;  3X2Q H;  3JTG A;  1D8J A;  5HDN A;  1WCM J;  2ZXJ A;  2GA1 A;  1YS6 A;  4BUP A;  2JVH A;  4HRI A;  2P5V A;  2MG4 A;  4G94 A;  3NRV A;  3F22 A;  4HAM A;  4ZDL A;  1X2M A;  2ELK A;  4DZJ A;  1FLI A;  1WJC A;  2ECC A;  2PN6 A;  2GZW A;  4ON0 A;  2A5W A;  1SVL A;  1HLV A;  2Y30 A;  4CA0 A;  1X3W B;  4PUS A;  5D8K B;  4C9Y A;  5GAG J;  2D1V A;  4V19 K;  4I0B A;  4U7D A;  2VE9 A;  2JA8 J;  3M1C A;  1BC8 C;  2PMZ A;  3S1N J;  2E5N A;  1QO0 D;  2CQK A;  3KP6 A;  4BEH B;  3DU6 A;  2VJ5 A;  2VQG A;  3FXU A;  1EH7 A;  2VBZ A;  2DFH A;  3BLY A;  1ULY A;  2WV1 A;  3LNQ A;  2XHK A;  4AC0 A;  2V6E A;  2JT1 A;  1JHF A;  2CW8 A;  2QQ8 A;  1H0M A;  1KZH A;  4F93 B;  4PJM A;  3JTH A;  2BZT A;  1R36 A;  3LSK A;  4DIQ A;  2FUG 2;  2JRM A;  3I0T A;  3OYH A;  4BKX A;  2WV0 A;  1UAA A;  5LGU A;  2UUZ A;  2UWM A;  1OCT C;  1TBX A;  1FIP A;  2BOL A;  2QGU A;  1A36 A;  3PQJ A;  1NTC A;  3PSF A;  2NS8 A;  2HTJ A;  2DDA A;  1K4T A;  1B59 A;  3HUG B;  3ZQL A;  4O3M A;  4PJJ A;  1RKW A;  2E1C A;  3OS0 A;  2ME6 A;  4ZYD A;  4Y7N J;  1J75 A;  1X4O A;  1APL C;  1XDS A;  3TQN A;  1AA7 A;  4I98 B;  3E3V A;  2O7O A;  4ENN A;  5FLX K;  1YJW I;  2A61 A;  4PFP A;  4L9V A;  1NK3 P;  4IHX A;  5IYB J;  2ZC2 A;  3GEZ A;  3TP3 A;  2XAS A;  3RPQ A;  3RKW A;  1UCR A;  2ZJ2 A;  4LOC A;  4F3Q A;  3A1Y A;  3OYK A;  2CSO A;  1OLT A;  2Y48 A;  2R0Q C;  4M73 A;  5L3G A;  1YRN A;  4UB8 C;  3A4C A;  3RYP A;  3RZO J;  5EEG A;  1YS7 A;  4KIF A;  2IP2 A;  4EQQ A;  3L00 A;  2LD5 A;  5EYR A;  1FP2 A;  2EIM H;  1X1P A;  1E3H A;  2EWN A;  1QGP A;  5CKT A;  2YU9 J;  1ONV A;  2QM3 A;  2E2I J;  4U87 A;  4KNY A;  3OYJ A;  2VN2 A;  2A05 A;  4G9Y A;  4JX6 A;  1YW9 A;  3QPL A;  3W6K B;  2L7K A;  4B09 A;  4DYR A;  2QYO A;  3RPU A;  3G71 I;  4CCL A;  3S1R J;  3OV8 A;  2M9H A;  3BTJ A;  3FXM A;  2EH3 A;  1W0U A;  3FHZ A;  1K61 A;  4HST A;  3K1M A;  2BVM A;  2XPW A;  4DQ2 A;  2CG4 A;  2EZK A;  2XF5 A;  2LMD A;  5EG0 A;  4I2O A;  2RNJ A;  2IA2 A;  4BJ5 C;  3DLL F;  2IA0 A;  2KFD A;  2HPM A;  3OYG A;  1IXC A;  4W1U A;  2LVS A;  1WVR A;  3LMM A;  3V42 A;  3T8T A;  2QEX I;  4C2U A;  4A2U A;  2R7D A;  2QF7 A;  3P7N A;  3LAP A;  1U5T C;  1TP4 A;  3EDP A;  2PLY A;  4OIP F;  3VYU B;  3A03 A;  1LFU P;  2P8T A;  1ZGJ A;  4LG0 A;  4IO9 F;  3WU0 A;  5FRM A;  1QZY A;  1V5G A;  1JUM A;  4JQF A;  2L7F P;  4X0G A;  5ILU A;  3G1L A;  3FM3 A;  1HDD C;  2X4H A;  2NNN A;  3KP7 A;  2HU9 A;  1HDP A;  5E8I A;  5LGN A;  2HS5 A;  1A6I A;  1OCC H;  2Y9Z A;  4RGU A;  1ZRD A;  3GLL A;  5B66 C;  1WI3 A;  5E1X A;  2E2J J;  4PFO A;  4RGR A;  1B8I A;  2DFE A;  4GO1 A;  3R0J A;  4QWQ A;  3HHG A;  1Z05 A;  4A3D J;  2R7Q A;  4Y4R A;  5ILV A;  4Q47 A;  3ZMT A;  3L2U A;  4J19 A;  3WU1 B;  3CMM A;  1FYL A;  4I99 C;  4PSW A;  4DGW B;  1XB4 A;  3K4C A;  1WJE A;  3MKL A;  3QWL A;  4CUG A;  4J00 A;  1ZN2 A;  3GUD A;  1UHW A;  3HYI A;  4KMU X;  1DUX C;  3D5R C;  2ZXI A;  4I0A A;  3K70 C;  2DOA A;  4IX7 A;  3OOP A;  2Y0S N;  4A69 C;  5M3M J;  2OD5 A;  3LST A;  1LQ1 A;  4PZJ A;  1XCB A;  3LFK A;  2HI3 A;  2XGC A;  4E7K A;  4BQO A;  2OZ6 A;  2QA4 I;  1ZGA A;  2DAO A;  3H5R A;  4NHJ A;  4XKC A;  2ZXW H;  2IGN A;  2B7E A;  3F21 A;  1CQT A;  3CQZ J;  3GVA A;  2DT6 A;  4XLN F;  4OU0 A;  4CHU A;  3VSL A;  3E5X A;  2W24 A;  1GXQ A;  5IP9 J;  4A6D A;  2X6X A;  5EGO B;  2RAE A;  2G9W A;  3RSN A;  3GZN B;  2KL4 A;  3HPH A;  4LK0 F;  5JI6 A;  3ISP A;  1MBH A;  4GYI A;  4E7H A;  1WH7 A;  2VBY A;  4RGX A;  1U8B A;  4UY8 I;  3ZOB A;  5K7H A;  4N4N B;  5ICC A;  5BPD A;  5CLS A;  3IAM 2;  4AUX A;  4BDZ A;  1TWF J;  4BBS J;  4KYW A;  1XGO A;  3T0Y A;  5FRO A;  4A3K J;  2HYJ A;  3JRA A;  4JX4 A;  1YIO A;  5DEQ A;  3CCM I;  4KFC A;  1AOY A;  1FOW A;  1XGM A;  4EJU A;  3KIO A;  4BE2 A;  1VQ6 I;  4M3D A;  1T08 B;  3MWM A;  2RNG A;  1TZL A;  4BEH A;  4HX7 A;  2VON A;  4D5F A;  4UB6 C;  3HOS A;  1Y6I A;  3AAF A;  1IN8 A;  1PYV A;  3CCR I;  1XS9 A;  2PJR A;  4M3F A;  3TO6 A;  1UJ8 A;  2DW4 A;  4HV6 A;  3MKY B;  3Q3S A;  3FKI J;  5EF6 A;  4XKW A;  4OAY A;  3FM5 A;  3D5S C;  1LVA A;  3EUK L;  4BHC A;  2A5Y B;  1EJ9 A;  4ABZ A;  2E60 A;  1U3E M;  3I4N J;  2ETH A;  4IHT A;  3K4K A;  4MEY F;  1ON2 A;  2D5V A;  3DQV C;  3AL0 B;  3IWF A;  2FD5 A;  4BU2 A;  2D45 A;  4E7L A;  3ASO H;  2STW A;  5DYM A;  1J09 A;  2BV6 A;  2EFP A;  2QQA A;  3GYH X;  3MCZ A;  2XC7 A;  5EZG A;  1D5V A;  1FOY A;  2XRL A;  4A0X A;  5IOY A;  4MTD A;  2KPM A;  3NWS A;  3I64 A;  4KJZ A;  1FMW A;  2M34 A;  4EAT A;  3OR1 C;  4DBR A;  2JPC A;  4A12 A;  1O4X A;  4OWR B;  2L54 A;  5CVR A;  2V9K A;  4E7Z A;  3OYL A;  4XK4 A;  1ZRC A;  4LMY A;  3ERE D;  3PUF A;  2UXX A;  1HXD A;  5LHG A;  2L01 A;  3K0L A;  5GAE J;  4AM3 A;  1IN4 A;  3S3O A;  2B0L A;  1WGX A;  2VBX A;  4G12 A;  1XGS A;  1T0F C;  4B4C A;  3R60 A;  4R79 A;  3Q9V A;  2M7B A;  3BZK A;  5IP6 A;  1K78 A;  3RPU D;  2KMU A;  4NC8 A;  3WOD F;  1E2X A;  1F9N A;  2JQ7 A;  1FNN A;  2BW3 B;  3H5A A;  3PFY A;  2E35 A;  2W25 A;  3GWZ A;  3CJQ B;  4ENJ A;  2DJI A;  4M71 A;  1BR1 A;  1G3S A;  3COA C;  3OS2 A;  2E7W A;  1RC9 A;  2H8W A;  3K69 A;  1V5E A;  4L5J A;  3IKV A;  3SFZ A;  1KYZ A;  2CU7 A;  1YW8 A;  3MEX A;  1YOV B;  5E1Z B;  3K4B A;  1ZTR A;  1LVK A;  1ON1 A;  1FP1 D;  3UNG C;  1FZP B;  2ZJR F;  3W6V A;  3S32 A;  3V7R A;  3HTS B;  2OC6 A;  3J81 Z;  3HOX J;  1GLN A;  3BR1 A;  1ENH A;  3TDZ C;  1TQI A;  5CVJ A;  1OR7 A;  4QPQ A;  3JRH A;  5GTI C;  2ICW G;  5LRR A;  2L4A A;  2GA2 A;  4GDF A;  2GLO A;  4EM1 A;  4IVN A;  2L9S A;  1Y8Q B;  4HLY A;  5LEJ A;  5D4R A;  1XX5 A;  5L3F A;  1UB9 A;  2AHQ A;  3BR5 A;  5C3E J;  1MH4 A;  2V6C A;  1B72 A;  3FXL A;  2BY2 A;  2K9S A;  2VKV A;  1ZH5 A;  4NB5 A;  2KJC A;  3ZQH A;  1JHH A;  1D3Y A;  4RBO A;  4M9S A;  2HXI A;  3BY6 A;  2LSO A;  3OIQ A;  4QIW N;  2QKM B;  1I1S A;  5ERI A;  3TBI A;  3J7Z I;  4BBR J;  2DA5 A;  1LFB A;  4M9X A;  4KIT B;  2JUG A;  2FF4 A;  4GGG A;  2A6H F;  4CIC A;  1MJA A;  3C2G A;  4EMS A;  5M5X J;  4ZH4 F;  5FRN A;  2O3F A;  2KZG A;  4FE7 A;  5FO5 A;  1W36 D;  3ZQI A;  3WG9 A;  5L3E A;  5HOO A;  2CFO A;  3I55 I;  5FJ8 J;  2DA3 A;  4PJL A;  4XN0 A;  1PUF A;  1VQP I;  1Z21 A;  3DTI A;  3LQR A;  5F64 A;  1O3S A;  4RAY A;  4DW6 A;  3MZY A;  1WKM A;  3BP8 A;  2ESH A;  3C18 A;  3ZGK A;  1Z7L A;  2HVR A;  1WH5 A;  4YFN F;  4UUS A;  2WA0 A;  1IDY A;  3HRM A;  3CMA I;  3CCJ I;  2O8K A;  3I71 A;  4OIN F;  1IN6 A;  2PQ8 A;  2P6S A;  2QUF A;  1KU3 A;  1XGN A;  3J81 K;  1R1T A;  2I8D A;  4PJN A;  1VF9 A;  2AS5 F;  3S17 J;  2X6Y A;  1RES A;  2E5Z A;  4D7N A;  5GAH J;  4A3G J;  2FBI A;  4EVI A;  4H4K C;  1B9N A;  2BXY A;  2KDO A;  2VJJ A;  1S7A A;  2W85 A;  4OIR F;  2ID3 A;  1ZLJ A;  4JX5 A;  3IHU A;  2M45 A;  3AL0 C;  1DGR M;  3ZN1 A;  1X1B A;  4YEL A;  2NS7 A;  4BL0 B;  4XLH A;  1BJZ A;  3PQK A;  2ZSH B;  2K3P A;  1BIA A;  5BQT A;  2HYG D;  2FMY A;  4IHS A;  3GTP J;  3KYC B;  3FKJ A;  1FIA A;  3DPU A;  4F52 A;  4HF1 A;  3BPV A;  3S2D J;  1YLF A;  3CDL A;  3BG9 A;  4C3I J;  4ZZL A;  4LLL A;  1U78 A;  3M4O J;  3CJN A;  4I02 A;  2IJL A;  1TW2 A;  4D0P A;  2HQN A;  3QOE A;  1DPU A;  3BJO A;  2LY1 A;  5E3N A;  1I3Q J;  1WFX A;  1XSX A;  2CO5 A;  2MC3 A;  3DKW A;  2UV1 A;  5CVU A;  4AD9 A;  4F7Z A;  1T39 A;  2F5F A;  2ZME B;  5FKO A;  2IGK A;  5FLX Z;  1WJA A;  2CFX A;  2Q2E B;  2XF6 A;  2FQ3 A;  2BVL A;  3GME A;  4FX0 A;  2Z2S B;  1YRN B;  2H94 A;  3FXR A;  3TGN A;  4IHV A;  4XOR A;  1BW5 A;  4IRI A;  5L3C A;  1JKQ C;  4RGS A;  1G3T A;  3MMY B;  3BG7 A;  3PJR A;  3DKY A;  4TV7 A;  5FGM A;  3S15 J;  4XLF A;  3OIO A;  4FTH A;  3SEZ A;  3RCO A;  2BHZ A;  3DTE A;  2HYF A;  5CVI A;  3CCS I;  3SDG A;  2ELH A;  2FBH A;  2JMW A;  1RR8 C;  3KPH A;  5ILS A;  1X3U A;  1AHD P;  1MNE A;  2LKS A;  1O7F A;  1MMD A;  2R7R A;  5IYD J;  2ZFU A;  4O6J A;  4Y3O A;  4LB6 B;  4A93 J;  3CCL I;  3MQ0 A;  4A6E A;  4XN3 A;  3WU2 C;  2AXT C;  2DT7 B;  2VE8 A;  1D5Y A;  2BBY A;  2MW8 A;  1N25 A;  1R4M B;  4HPQ A;  1JJ8 C;  4U0W A;  1XDU A;  2IRF G;  2XVC A;  3H35 A;  1RRJ A;  3FMQ A;  3JRE A;  5KNL A;  1P7J A;  4EGZ A;  2QSH X;  1EKE A;  1O7L A;  2K85 A;  1HST A;  2MFZ A;  2R7Z J;  3F8B A;  1Z91 A;  1I27 A;  4OMZ A;  4BE0 A;  2XKP A;  1TTY A;  4KT6 A;  2R7T A;  3I4P A;  5FLM J;  3FF5 A;  2FXA A;  1LDD A;  2DA2 A;  2XAF A;  1SFO J;  5FD6 A;  1XN7 A;  4IQ4 A;  2O8X A;  3M3Y J;  1LEB A;  3PSI A;  2J5P A;  1T2K A;  3ONQ A;  3WE2 A;  1P4A A;  3ECH A;  2HQ5 A;  5LHI A;  5IY5 H;  3BDD A;  4LLN A;  3P9K A;  2WY8 Q;  3WTZ A;  2OJE D;  2VT2 A;  4MO7 A;  3RTR A;  4P1W A;  4PGG A;  4C30 A;  2MA3 A;  2RGV A;  2WB1 A;  3CES A;  5DD4 A;  1A6Q A;  1OYY A;  3GXO A;  2EV0 A;  2DU9 A;  2B9S A;  1HOM A;  1ETX A;  3DXJ F;  1XD7 A;  1X3Z B;  1RI7 A;  1O57 A;  2DO7 A;  1IO2 A;  2NYX A;  1V5F A;  3CCV I;  4S05 A;  4F55 A;  2A07 F;  3RIR A;  4YEJ A;  3PO3 J;  3ZXS A;  2R5Y B;  2UXN A;  3GTL J;  3ULQ B;  1R22 A;  1SD6 A;  2G7U A;  1OFC X;  3SQN A;  2GOM A;  3WTT C;  1TW3 A;  3HRU A;  5DCM A;  1V54 H;  4IOC F;  5H2F C;  2OA4 A;  3DPT A;  1RUO A;  1A5J A;  1JGS A;  1STZ A;  4ESF A;  4IKF A;  2NVY J;  4BYY A;  3BG6 A;  5ICE A;  5EGO A;  2CYY A;  3E0J B;  3IH3 A;  1QA6 A;  3NEU A;  2EV6 A;  4IHW A;  2GOX B;  2FEZ A;  4LG3 A;  1W0T A;  3U1D A;  2N8G A;  2Q2E A;  3E1S A;  4HYE A;  3QP6 A;  4MQV A;  4NUB A;  4ZC3 A;  4BNC A;  2CQ7 A;  3S8P A;  2BYV E;  2ESN A;  2F48 A;  2X85 A;  2Z99 A;  4Q4Z F;  4ZTF A;  3KYD B;  3ZCO A;  4RLQ A;  2LYC A;  4IPA A;  1WJD A;  2E36 A;  1JTY A;  3CDH A;  3SEQ A;  5GPA A;  4BJT A;  3DLA A;  2VKE A;  4LJZ F;  4HNT A;  4FHT A;  2I10 A;  3EPZ A;  1T8I A;  2ISY A;  1HW1 A;  1PP8 F;  2XAJ A;  3TOA A;  3J80 Z;  3M07 A;  4V2F A;  1Z77 A;  3BR2 A;  3N4M A;  5J1Y A;  3S1Q J;  1AWC A;  2LTP A;  3L1P A;  5K7Z A;  1GVD A;  2V26 A;  4WXH A;  3HC7 A;  1I3A A;  2OBP A;  5EEH A;  3VEP A;  2VB6 A;  2DTR A;  5JLX A;  3MKZ A;  1H9G A;  3R6S A;  3TMO A;  3A01 A;  4NQW B;  2PI0 A;  1QHH D;  1W5C C;  2ELJ A;  4HQM A;  1U8R A;  2CRG A;  3GZ5 A;  4KIB A;  3LSI A;  2KHM A;  2CJJ A;  4G8X A;  3J7A Y;  4EM2 A;  2EZH A;  4M9Z A;  3CC2 I;  4ZDO A;  5J40 A;  4FCY A;  2KRF A;  3QQA A;  2IGM A;  4F91 B;  3ZMU A;  1MBE A;  3K2Z A;  2BE5 F;  4L5E A;  1HKT A;  3OYB A;  4C2T A;  3ZQQ A;  4E7J A;  1IRF A;  2JWT A;  2NNY A;  4IL6 C;  4AID A;  4HA8 A;  2EQR A;  4KIG A;  4BXX J;  1TNT A;  2WAF A;  1ZAO A;  2FML A;  2MAB A;  3QU6 A;  3ZPL A;  4DBQ A;  1JKO C;  1HC8 A;  4ZZD A;  1IG7 A;  3F6V A;  3CTA A;  4RB1 A;  2HDD A;  1P7I A;  2XGD A;  4A3F J;  1KU9 A;  1VQ7 I;  3GO5 A;  4BY1 J;  4CZZ A;  2KIQ A;  3C2H A;  3LFU A;  2WAQ A;  3BTI A;  4FE4 A;  3CC7 I;  4CO8 A;  2IW5 A;  2JSC A;  4KDP A;  1WPK A;  2W00 A;  2V79 A;  1IRG A;  4JK1 X;  5KAF C;  2QQB A;  4IEJ A;  1IN5 A;  2FU4 A;  3KP3 A;  5JVT A;  1I1G A;  3JRF A;  4U0V A;  3FMR A;  1HSJ A;  4N4O B;  2VPL A;  4HEA 2;  2GXB A;  3ZQG A;  3A01 B;  5TJJ A;  1MH3 A;  1WJ5 A;  4XRS A;  2VT3 A;  4DOZ A;  1IUY A;  1KQ8 A;  3LSG A;  3QU3 A;  1RIO H;  1N78 A;  3SZT A;  5KCM A;  2VLA A;  4I09 A;  2WBM A;  4EGY A;  1ERD A;  2OF7 A;  1QBJ A;  4RB2 C;  2L7M P;  4BXF A;  4XID A;  4RDU A;  2LRD A;  5E20 A;  3WGH A;  1QHG A;  1G59 A;  1UZC A;  5LEK A;  2L4M A;  1DQU A;  4XMY A;  3J80 K;  4GFB A;  5IYC J;  5HLH A;  1OR7 C;  3OL4 A;  4II2 A;  3MD2 A;  1XMX A;  2PJR B;  2OV7 A;  4D9J A;  4CZC A;  3KLO A;  1ZR4 A;  2P0W A;  1J7K A;  2E7X A;  2K7L A;  3KEQ A;  4CCO A;  3H3U A;  2FRH A;  5HNF A;  3ZP5 A;  2YS9 A;  3ZQC A;  4X6A J;  1VI0 A;  3BR0 A;  3CJT B;  2VKD A;  3I9V 2;  2M1B A;  1IGN A;  2ZFW A;  3W2V A;  4B43 A;  1HF0 A;  2W7N A;  3D5L A;  2NOG A;  4BHB A;  2RVC A;  4G7H F;  1MSF C;  1X58 A;  1K6O A;  4HX4 A;  9ANT A;  1U0J A;  1W7P A;  3ABM H;  3QPT A;  4D1Q A;  3SZP A;  2JZY A;  3WE3 A;  3CLO A;  3QPS A;  3L2W A;  4XLP F;  1K83 J;  3FK6 A;  1FYK A;  1LE8 A;  2DLL A;  1B4A A;  4G6Q A;  2MD0 A;  5F0H A;  1LJ9 A;  3F23 A;  3HSF A;  5LD2 C;  1MDM B;  1D0Z A;  1QZE A;  1UST A;  3BTC A;  1ETK A;  1VQO I;  2ZB9 A;  1VQ9 I;  3KEO A;  1BI1 A;  3VFZ A;  3CF5 F;  3PNY A;  1FOX A;  4D5C A;  2KIS A;  2XB5 A;  1W5T A;  3A02 A;  1L0O C;  1FY7 A;  3ZMD A;  4EV0 A;  5JHF A;  5LBQ A;  5FKK A;  1ETW A;  3OYN A;  1Z3X A;  4Q5S F;  3E6D A;  2YR2 A;  1LNW A;  2ZO4 A;  5HNH A;  3SHF A;  3HPG A;  2XDV A;  1F36 A;  1KU7 A;  2MBF A;  4JBA A;  2CQX A;  2NS0 A;  1P6R A;  1XSV A;  4MNU A;  3FK7 A;  3RJP A;  5JR3 A;  3M1E A;  1YX5 A;  1NK2 P;  2QKL B;  4A0Y A;  1BC7 C;  2R7U A;  1B72 B;  3OWT A;  5J6X A;  3HL2 A;  1REP C;  3S2H J;  4RMN A;  1GV5 A;  3HOW J;  1YTY A;  4AIJ A;  2KIF A;  4V2G A;  2RRE A;  2G0E A;  2XAH A;  1R23 A;  1TWA J;  1FOK A;  2A6E F;  4XLA A;  3IUO A;  3UKG A;  2H8R A;  2QBY B;  4P55 A;  3GTQ J;  3RDI A;  4E6K G;  3I59 A;  2GXA A;  3K1P A;  3G1O A;  4WX9 A;  3BCB A;  1R6R A;  4IRH A;  2CQN A;  2H27 A;  1QVT A;  5DM6 F;  3S2W A;  2VQC A;  2IXS A;  2YU3 A;  3AG4 H;  5BS6 A;  4HF0 A;  3M8E A;  2HNH A;  3ML6 A;  3ZQF A;  5FD5 A;  1RET A;  3L9F A;  3DF8 A;  1D8K A;  4P96 A;  1ZGW A;  1U2W A;  1TNS A;  1UG0 A;  4ESJ A;  1CGP A;  2JTV A;  2WWY A;  2OTJ I;  1J0R A;  1ZRF A;  1XC5 A;  4S0H B;  5J8C A;  2WC2 A;  4GCV A;  2LOO A;  2DK5 A;  4K2E A;  2X48 A;  3SZG A;  1QZZ A;  3M8F A;  2BY1 A;  3LOC A;  1TQP A;  3H92 A;  1TWC J;  2LBF A;  1UHM A;  5CQE A;  1JI8 A;  4Y13 A;  1IF1 A;  4OAZ A;  3KP2 A;  3QP5 A;  2H6C A;  1G3W A;  1MBG A;  4J01 A;  2AQE A;  1BN5 A;  5FFZ A;  1R49 A;  1Z6T A;  2EZI A;  4L9T A;  3TOB A;  2W4S A;  3WHB A;  2COM A;  1P4W A;  2DMU A;  3A2K A;  1QVU A;  4XQF A;  1FX7 A;  1A35 A;  3EUA A;  5AIP A;  3I54 A;  4Z6Y A;  3R0A A;  2DPU A;  5DV5 A;  3CO6 C;  1S7E A;  2DOE A;  2M3A A;  3I58 A;  4BDY A;  3ROU A;  1ZR2 A;  1MIJ A;  5IT9 K;  2KLO A;  2L7Z A;  5F0C A;  4FAS D;  3HBL A;  5HLG A;  3LAJ A;  1ZKG A;  3F8C A;  4FQG A;  1YI2 I;  3ESW B;  3L2R A;  2A6T A;  2M2E A;  4W97 A;  1N77 A;  4X1E A;  2IA1 A;  1S3J A;  2YX4 A;  2DA6 A;  1WQ2 A;  5TIS C;  6PAX A;  2Y9Y A;  5J47 A;  2Z16 A;  3SYT A;  2QWW A;  2CUJ A;  2XRN A;  4UNO A;  3GTO J;  3TO7 A;  3EYY A;  2BXZ A;  1W5S A;  3U2R A;  2FNA A;  5FKN A;  1U6G A;  5J1R A;  3DBL B;  2H1K A;  3TW7 A;  3BZC A;  4QTR A;  4FT8 A;  1T56 A;  1MKM A;  3KX2 A;  2X9D A;  3SDB A;  3Q0V A;  2R5Y A;  5H6R A;  2V1U A;  2LG4 A;  4B3X A;  5K7F A;  2WAE A;  4CH7 A;  2F5D A;  2F5C A;  2W82 A;  3HUG A;  3HOZ J;  1H89 C;  4ZYE A;  2VIX A;  1XG1 A;  2F4M B;  3OYD A;  2M7A A;  3QPH A;  3E5U A;  3K2A A;  5EDN A;  1P2F A;  2HQA A;  1WSU A;  2R7S A;  2DQL A;  2B63 J;  2JVG A;  2KDZ A;  2QZ8 A;  2A69 F;  2L2O A;  3FXK A;  4BE1 A;  3CJR B;  3CME I;  2Y69 H;  4U88 A;  1AKH A;  2OAZ A;  2F2E A;  1R00 A;  4KMF A;  2V7F A;  4M6X A;  4F92 B;  3I59 B;  3BQZ A;  3PFI A;  2L3D A;  3H36 A;  1WJF A;  2TRT A;  5IT9 Z;  5F27 A;  1D0X A;  4XRF A;  1FMV A;  4BXU A;  4E70 A;  5C4J J;  2K4B A;  1WJB A;  2F4I A;  2RQP A;  4I6Z A;  2G7H A;  5BOX A;  3HKZ N;  3CMY A;  4NBQ A;  1G6N A;  2K3F A;  4IQJ A;  1P9Q C;  2VXZ A;  3NQO A;  2O61 A;  4RB0 A;  3JR9 A;  2GIZ A;  1SC7 A;  4BJ6 C;  4ZYH A;  2KZV A;  5JVG F;  1FPQ A;  1VQM I;  3K7A J;  1BW6 A;  2FE3 A;  2EFN A;  2HVQ A;  2R7X A;  1X1A A;  2X1E A;  3BJ6 A;  4CDG A;  3QYE A;  3ZR8 X;  2Z5U A;  5CQG A;  3CF2 A;  2JUC A;  2ID6 A;  5E3L A;  2NVT J;  3LSR A;  1Y0N A;  1EF4 A;  4HSR A;  4MTE A;  2M8E A;  3HOU J;  3H3Z A;  2ZJP F;  3G73 A;  4KN4 X;  4LB5 A;  4Y52 J;  4ZYA A;  3JSP A;  4LGW A;  1H8A C;  2DOF A;  3RYR A;  4BGD A;  1SAU A;  4L18 B;  2XAU A;  2E1M C;  4JP0 A;  2DI3 A;  1HCR A;  1R58 A;  5K5Q A;  3E6M A;  3QYF A;  1XPX A;  3VSK A;  3FMS A;  3DWL E;  4JYK A;  5D6F A;  2D2W A;  2PMZ N;  4DJA A;  4ZTJ A;  4RA2 A;  4MEX F;  2CV1 A;  1OJL A;  2E1M B;  2IAI A;  5HDK A;  2IGO A;  1R5H A;  4EJW A;  3JRI A;  1FEX A;  1M1E B;  2CUZ A;  3HTU A;  1DP3 A;  3QOP A;  3IAS 2;  3PUB A;  1Y1V J;  2VBW A;  4YRV A;  3O8H A;  4NNJ A;  4OMY A;  2HEO A;  1QQI A;  3VOD A;  1D1C A;  2ZNY A;  3R4K A;  3I56 I;  2RC4 A;  1KQ0 A;  1VFC A;  1FTZ A;  3U21 A;  4LD5 A;  2CV0 A;  3RZD J;  1G4D A;  3L2Q A;  2ZSI B;  1X1D A;  5F0F A;  4A3M J;  3HOV J;  1YG2 A;  1JKR C;  3B6A A;  2P7V B;  1X4P A;  4XKV A;  2HZD A;  2DJN A;  2I5U A;  3GTK J;  4HBL A;  1U9O A;  4AVP A;  3H9G A;  2CH0 A;  4LFU A;  4PGH A;  4B48 A;  2CUF A;  3ABK H;  3VWB A;  5DM7 F;  2BY0 A;  3CZ6 A;  4MFE A;  4Z2Y A;  2OQG A;  3RI4 A;  1OYW A;  4KA4 A;  1S29 A;  2WY7 Q;  5F1R A;  1YIJ I;  1R5I D;  2OCC H;  1XMA A;  3GCM A;  4WWC A;  2KJB A;  3UR3 C;  1K78 B;  1RPW A;  1ETO A;  3C2B A;  4ZJZ A;  2L9R A;  2VXD A;  3FDY A;  3ZQ7 A;  1BA5 A;  3H0D A;  2BY3 A;  4PJ0 C;  1MJ9 A;  2DYR H;  2WB1 N;  3KZY A;  1NH3 A;  3JAM Z;  1Z6R A;  1T98 A;  3IWZ A;  1YFH A;  1BBY A;  2NVU B;  1SFU A;  2IS1 A;  1VZ0 A;  1IC8 A;  5B1A H;  3U9G A;  1PUF B;  3BG3 A;  3IV5 A;  2HOT A;  1IW7 F;  3BZ6 A;  4P9F A;  2VC1 A;  3HGY A;  3GFM A;  2MD5 A;  3AG3 H;  1S8N A;  4M72 A;  2LK2 A;  3W6J B;  5C44 J;  3DPL C;  3S3N A;  1BI3 A;  1MGT A;  2DFF A;  3N05 A;  2DXI A;  5KVR A;  1ODD A;  1VQN I;  3AFH A;  1YJ9 I;  3OYE A;  3ELK A;  5E79 C;  3KET A;  1CF7 A;  2DK8 A;  4RAF A;  3KCC A;  1F5T A;  3O3K A;  3I5U A;  3TW6 A;  4YII A;  2K02 A;  1Z0X A;  2ADU A;  2YPR A;  1ZEL A;  2TDX A;  3RKX A;  1J59 A;  3H1C A;  5F6F A;  3QYB A;  1ZQ3 P;  2GAU A;  1FJL A;  2MLG A;  2M87 A;  2RV8 A;  5FB2 A;  5HDG A;  2LRE A;  5LGT A;  1SVM A;  3E97 A;  3W3C A;  1QRY A;  3ASN H;  2JK3 A;  1TC3 C;  3FWE A;  2KRC A;  2MYS A;  1R1V A;  2VI6 A;  1OCZ H;  3DBR B;  2Q0O A;  5J4V A;  2DMP A;  3JRC A;  1D0Y A;  4RAG A;  1J9I A;  1ZLK A;  4AVZ A;  1UG2 A;  5J1U A;  2JA7 J;  2YX7 A;  2EPF A;  2COB A;  2HTS A;  1FC3 A;  1R4N B;  3O8G A;  4A3J J;  2Z9O A;  1VTN C;  3GTM J;  4A3L J;  3IP4 B;  5BPI A;  1WWX A;  5DD8 A;  2EZL A;  1KU2 A;  1T33 A;  2VQH A;  4WCG A;  3BJA A;  2AQF A;  4ENM A;  4IJA A;  2VJI A;  3MFK A;  1EH6 A;  1SFX A;  2L5Q A;  1MMN A;  2CS3 A;  2IBD A;  5LLQ A;  3H5N A;  4R8H A;  1PUE E;  5A2Q K;  1O3R A;  2W1O A;  3F8F A;  2JPB A;  5J3L A;  4CSW A;  1TQM A;  3BR3 A;  3FX3 A;  1E3O C;  4L5I A;  4IF4 A;  1QPM A;  4XSZ F;  1R9T J;  2M4K A;  3GBG A;  3T8R A;  1WZ2 A;  1MMS A;  2GWR A;  1D1A A;  1BOA A;  1HA8 A;  2LC2 A;  2IT0 A;  1XMK A;  2LKP A;  2CGP A;  2V1X A;  3PM1 A;  1JJ6 C;  3KP5 A;  3F72 A;  3JAM K;  4EEF G;  1E17 A;  2K9M A;  3DU5 A;  5K5R A;  2DPD A;  5E18 F;  3JRB A;  1YO5 C;  4DYQ A;  4IHY A;  1HKQ A;  1V3F A;  1W7P B;  3P9I A;  1ZG3 A;  4RAZ A;  2P5L C;  1X1C A;  5HLT A;  2L9N A;  4G7O F;  4HNU A;  2LR8 A;  4MGR A;  3TKY A;  1USS A;  4UVB A;  4OOI A;  4XOT A;  4BQN A;  1PP7 U;  2XGX A;  1LPQ A;  1KYW A;  1SD4 A;  4LLG F;  4XOP A;  2OZU A;  1A04 A;  5F08 A;  4S04 A;  1J5Y A;  3OIP A;  2L0K A;  1LKX A;  3BRO A;  5D4S A;  4AYB N;  5CPR B;  1B6A A;  3DFG A;  1P92 A;  4OIO F;  2XPV A;  5E17 F;  1FSE A;  1VQL I;  1BM9 A;  5GTH C;  3RQI A;  2XF7 A;  3JCU C;  4MFD A;  1D1B A;  2K86 A;  3BC8 A;  3HXL A;  2E1N A;  3WTY C;  1KON A;  2V9V A;  2XV4 S;  3WGI A;  1IDZ A;  4XBF A;  3NWT A;  2P5K A;  2M30 A;  4O5V A;  5DCF A;  4B8X A;  5DUK A;  2FSW A;  2YSR A;  1UMQ A;  2MH9 A;  2XB0 X;  2O9L A;  4B44 A;  2QBY A;  2W48 A;  4RLF A;  4CCN A;  2HOA A;  3DEU A;  1QPI A;  2A68 F;  2TCT A;  4P9U A;  2ZXH A;  3WG7 H;  2KIU A;  4UV9 A;  5EJC A;  4IOA F;  5LHH A;  1T38 A;  4H0E A;  1Y39 A;  2CMP A;  5FFX A;  3PIP F;  1GHC A;  3G4S I;  2XAQ A;  5BMZ A;  2CWE A;  3GFI A;  4ITV A;  4GXO A;  3CUQ B;  1MDM A;  2EK5 A;  3LA2 A;  5CJ9 A;  3GW2 A;  4C2M J;  3B02 A;  3WTW C;  3BOQ A;  3QAH A;  1XCV A;  1IJW C;  1RUN A;  4L9J A;  3ABU A;  2NVX J;  4YIR X;  1MSE C;  3BCA A;  4DYC A;  3QRF F;  1BL0 A;  5H20 A;  2JA5 J;  2DOD A;  2PMH A;  2V9P A;  1K79 A;  3L7W A;  4N9H A;  3HB9 A;  3MZ8 A;  2XRO A;  3TED A;  2EA4 A; 
#chains in the Genus database with same CATH homology
 3ERM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...