3ERMA

The crystal structure of a conserved protein with unknown function from pseudomonas syringae pv. tomato str. dc3000
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
67
structure length
67
Chain Sequence
VDRKLADAHDQMLELAELLTDVLIKNVPGLSEKHAEDASIYMAKNRAVFAAAFKNNATALSELSEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a conserved protein with unknown function from Pseudomonas syringae pv. tomato str. DC3000
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized conserved protein
total genus 21
structure length 67
sequence length 67
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07130 YebG YebG protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.710 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A PSPTO_1197 like 3ermA00
3ERMA
chains in the Genus database with same CATH superfamily
3VYRB 4Y3OA 3RPQA 4KT6A 2R7VA 1U78A 5KVRA 4B44A 5K5RA 2NS7A 2G9WA 1S7OA 2JJ7A 4EM1A 3ONQA 4NC7A 1MMDA 3CCSI 2LNBA 4X6AJ 2ISZA 2E34A 3HOTA 1OYYA 3DBRB 4XN3A 1R4NB 3HOUJ 1TNTA 2XAQA 4RGRA 4M3GA 1ZGWA 2OPTA 1MZBA 4C2TA 4A2UA 4RGXA 1ZGAA 4Q5SF 2K3PA 3QYFA 2DT6A 5B5EC 2X6YA 5GTIC 2DA6A 2F4OB 1B4AA 4AIJA 4XLCA 5IT3A 2XF6A 2YSRA 5D5XB 3PQKA 1XGSA 4N9HA 2KIUA 1T08B 2XPVA 1ZR4A 5JR3A 2MABA 2RAEA 2ZXJA 2QEXI 5M5XJ 5CYVA 4RB3C 5DTDA 2K7LA 2JA6J 3FK7A 2EB7A 4DZPA 4ZYGA 2IGKA 3BDDA 3TKYA 3W2VA 4M71A 1P2FA 1E17A 3WTUC 1N25A 2WA0A 4G6TB 3F23A 1DDNA 1ZRDA 2EINH 1WJAA 3G2BA 5LLQA 2HZDA 1FPQA 2HKOA 4WWCA 3E3VA 2CV1A 1Z7LA 5J47A 2WB1N 4LG0B 5BMZA 1O4XA 2MG4A 3J7AY 5J6XA 1R23A 1VTNC 4A5NA 3A02A 2MD0A 4W1UA 5FRNA 3J80K 2VC0A 4OAYA 4DBRA 4F92B 2XGEA 1UJ8A 2L9NA 2MSYA 5CVIA 1U6GA 1TBXA 3F22A 4BJ5C 1FP1D 5FD6A 1D1BA 5E18F 4A0YA 1FBQA 3OL4A 4UV9A 1KU3A 2VIXA 1AKHA 1T38A 5FKOA 2XGCA 4N4OB 3M8FA 5A2QZ 1W0TA 2GM4A 1SMYF 5EDNA 2DK8A 4XN0A 2DFHA 2LK2A 4YELA 1UFMA 2MLKA 2IS2A 3NAUA 4NC8A 1V4RA 4KN7X 2KZVA 4PDKA 1W36D 3Q0UA 3K70D 4BHBA 3IAM2 2BYVE 5L3BA 1X1CA 1G3TA 2W48A 3HGGA 3L00A 3CCLI 2X1EA 1IUFA 3HHHA 5HLTA 2C6YA 1Y8QB 2FBIA 4A3BJ 2V1XA 2DBBA 3Q0WA 1J5YA 1D0YA 1MH4A 2HQRA 1Y0NA 2LR8A 3ASNH 2DMPA 4I76A 1SMTA 5EJCA 2CV0A 3R6SA 3GF2A 3OYCA 1YJNI 1Q1HA 3ABTA 4I09A 3PJRA 4XLNF 4OINF 2W57A 3BG9A 2Y2ZA 3L9FA 3ZPLA 4F7ZA 3LWFA 1BOAA 2ECBA 2PN6A 3NEUA 3T1BA 2KPMA 4G7ZF 2GOXB 2HU9A 4CYDA 1ZKGA 3L7WA 1X2NA 4A3LJ 3WU2C 1F4KA 1H9TA 1ENHA 1YG2A 2QA4I 3A0BC 2HVRA 1S6LA 3WTVC 1YX3A 2DFFA 3BG6A 1W7PB 2M7AA 1GXQA 3WHCA 1K79A 3FDYA 3LFKA 4LIVA 1KONA 1R5HA 1T6SA 2OZUA 2FX0A 2KFDA 2LDUA 4LLGF 3RDIA 4U0YA 2GXGA 1V5FA 1HKTA 1OYWA 2L3DA 3VB2A 4Z2YA 1YLFA 2X6OA 2RQPA 3VWBA 3I4PA 1IRXA 3QYBA 5HDKA 4ZC3A 2VQLA 5E8IA 1ETOA 1O3TA 3BR2A 3PM1A 3WE3A 4N0BA 3T5XA 2ZSIB 3EUKL 4ON0A 4A3GJ 4CXFA 4FQGA 5D8KB 2QSFX 3F8CA 4S04A 1O7LA 4CCLA 3FBIB 2BY3A 2P5LC 4HX8A 2Z9OA 2M87A 4CUGA 5L3GA 4H0EA 1K6OA 1YI2I 2CYYA 3IUOA 1JE8A 5J1RA 1HDDC 1S29A 1ZTRA 2KZGA 2M30A 2DAOA 2WAQA 1SD7A 4PCQA 5FJ8J 1IDZA 4I99C 2WTEA 2QQAA 1GXPA 2DA4A 4U0WA 3RSNA 2P7CB 3DV8A 4ENNA 3RKWA 4M9ZA 3GW2A 4ZYEA 1MKMA 3IWFA 3KPHA 5KNLA 4GXOA 5C44J 4UUVA 2FF4A 3CC7I 3K4KA 2R5YB 2K86A 3DEUA 2LH9A 3QU6A 4KUMA 3SZTA 5B3SH 4ZYDA 2AO9A 4BBSJ 2HDDA 3VSLA 4I98B 4ZTJA 1N77A 3GLLA 3ZRGA 4XRMA 4S05A 1EKEA 3AG3H 3DFGA 2VQHA 3S2DJ 3HPHA 1BR2A 2K9LA 1SFUA 3PIOF 3BPXA 1HW2A 3TBIA 1P9QC 2A61A 4C2MJ 3HKZA 5CVUA 3JRDA 1V5GA 3ZMDA 4A5MA 1PUFB 5H6RA 3HTSB 1UHMA 1UG2A 2HQNA 4F3QA 4FCYA 2LBFB 2NVQJ 2GXBA 2PMZN 3F8BA 2JK3A 2R7WA 3A03A 2PJRB 5FKMA 3IKVA 1XCBA 3RQIA 1RC9A 2N8GA 3RI4A 4CDGA 1KU7A 2IEKA 1E2XA 4A3KJ 2LY9A 2FNAA 5F08A 1ONVA 2OD5A 4EM0B 4CYCB 2K27A 4IO9F 2WV0A 4OOIA 3H3UA 4QTRA 1WJDA 2P8TA 3I9V2 5D4SA 5HS8A 4B3AA 3UR3C 5B1AH 3K2ZA 2LP0A 1SFOJ 3M1EA 3GUDA 3K1PA 2BHZA 2KQRA 3DP7A 3ERMA 5J4YA 1J75A 4NDLA 4P1WA 2CQKA 2O3FA 2LTPA 1ETVA 4BHPA 2RKHA 4KIGA 3AG4H 2L7ZA 3L2RA 3WE2A 5IOZA 4KN4X 3HKZN 2K9QA 2JUCA 1OCZH 2P81A 4I02A 4J00A 3JRHA 3S93A 2JA7J 1FLIA 2HGCA 4YIRX 2NS0A 2JPCA 2MC3A 4JX6A 1Z91A 2YR2A 3Q5FA 2NVTJ 3C2BA 1VZ0A 1K83J 1HLVA 1HOMA 3D1NI 1OCOH 4LFUA 2MBFA 4M6YA 3KETA 2IAIA 2F5CA 3TO9A 2PEXA 5E3LA 3TW6A 4KICA 2HPIA 4Y52J 2Q8KA 4X1EA 3ZXSA 1JGGA 4RLFA 4KA4A 2VC1A 1P4XA 2VODA 3F3XA 3TO7A 3QQAA 1H9GA 1LJ9A 5H2FC 3CDLA 3OR2C 2LVSA 3C18A 3FXRA 5ICGA 4IPAA 2DJIA 4ITVA 5F64A 1E3PA 1BW6A 1JT6A 1YRNB 4G8XA 1USTA 1R5ID 1AA7A 4XBFA 2OCCH 3CMEI 3DCFA 1ZG3A 1LEAA 4I01A 1QBJA 2JT1A 5IOYA 3HRUA 2L7MP 1WSUA 4II2A 4OIQF 3SEZA 1QQIA 4QIWN 4IRHA 1ZGJA 5HS7A 4EJVA 2A68F 2L7FP 3FIWA 1SD5A 4XSXF 5D5WB 2FRHA 5J1YA 1IXCA 3LFUA 3W2AA 2F4MB 4V19K 4L5JA 2D1VA 4CYCA 2NRAC 3GFJA 3ABKH 2X51A 4B1RA 3CD6I 2RV8A 3V7RA 4EQQA 3GZ6A 5BS6A 3KYDB 1GV2A 2R7UA 4HPQA 1Y1VJ 2XC7A 9ANTA 3PSIA 2B7EA 3BJAA 5ICCA 2W82A 1FSHA 1W4MA 3DBHB 1MW7A 4BQQA 2MW8A 2JZYA 3PFIA 4PSWA 1K7AA 4BNCA 3AL0B 4I7HA 5BOXA 4ZDOA 2GXAA 2E2IJ 1T0FA 3I54A 2VOPA 1FTTA 3BZKA 3IH3A 3DTIA 3H3VK 4OIPF 1GT0C 4XQFA 3N4MA 1UZCA 4JP0A 3GFIA 1A35A 3U9GA 1X1AA 4LOCA 3EETA 4WX9A 1SFXA 1NH3A 4WCGA 1WVRA 2R7DA 3CMAI 3S1QJ 4E4HA 2OC6A 2QWWA 5GADJ 4YRVA 3OIPA 2R7FA 2KJCA 3DKYA 3NARA 1Z6RA 1N78A 1I3QJ 3HYIA 2DQRA 3ISPA 1L3LA 2P4WA 2K4JA 3F21A 2EV0A 3OS2A 3ML6A 4DW6A 4EJWA 4A3CJ 2H6CA 4U7DA 4E6KG 2BY1A 3ECOA 2DW4A 2L01A 3A1YA 3HG9A 1FT9A 3CO7C 1Z9CA 4LK1F 3G1MA 1C0WA 4A3IJ 1G59A 1TW2A 1ZELA 4BE0A 1W5CC 4AD9A 2Y31A 4XLPF 3ZP5A 3K10A 2K40A 5EEGA 3CUOA 4OIOF 1LPQA 3OR1C 3WU0A 2EIJH 3LMMA 5IT9Z 1U8BA 4LJZF 1W1WE 1LQ1A 3I59B 5LGNA 1W5TA 2HOAA 3E5XA 4DBQA 3IHUA 2E35A 1JKOC 3B6CA 5JLXA 5HNFA 4H4KC 1QPMA 4CSWA 1ZH5A 3I4NJ 3JSPA 2PMZA 2D45A 5K1YA 1AHDP 4GGGA 3C2HA 3SDBA 4JX4A 2FEZA 1YE9A 2KDZA 4BE2A 1TWCJ 5JHUA 3MFKA 1JXSA 2PBIA 1B9MA 2OU2A 3GTQJ 4ZJZA 1MMSA 5F1RA 2VE8A 2RDPA 2VBXA 2WADA 1RUNA 1MJBA 4M6XA 2XPWA 2XHKA 1JJ6C 3KP3A 3NWSA 3A01A 1J7KA 1JHFA 5DD8A 2NOGA 2NVXJ 1LDJA 2NOJB 1QVUA 4U88A 2M7BA 4HSTA 4E7JA 2EFWA 4R1HA 2HQ5A 4MIMA 4HA8A 1D5VA 3R0JA 1LB2A 2VBWA 3MAJA 4M6VA 4L0YB 1V55H 3HRTA 2KJBA 3EYIA 4DOZA 1IW7F 3BROA 4HNTA 4S0HB 1JTYA 3U1KA 1EA3A 3SHFA 5HOOA 2ZXHA 2V7FA 3GYHX 1T39A 3S2HJ 3QPSA 4IKFA 1NTCA 3LSKA 3ROUA 4E7SA 5D5VB 5JLWA 3CCUI 3OYJA 3C7JA 3VODA 3GTPJ 2DYSH 2DTZA 4M74A 1WQ2A 5B1BH 3LQQA 1FMVA 4B48A 1SC7A 5FKLA 1WFXA 3RKQA 5LHIA 3E6BA 3JSOA 4RA2A 2KP6A 2DO7A 1XCVA 3TO6A 1UB9A 1FBUA 2LY1A 2E19A 3BJOA 3I59A 4QWQA 3SYTA 2CMPA 3L2WA 4Y13A 3TP3A 2H94A 2GA1A 3OS1A 1J0RA 1SVLA 4LITA 4NC6A 2DDBA 3U2RA 5J3LA 4YIIA 2X9DA 1LFPA 1D8KA 3LSMA 2DI3A 4O5VA 3HJEA 3JTHA 2IBDA 2DPUA 3A4CA 4G6QA 2BHYA 2Z1DA 2KIQA 2ZBKA 4MEYF 3IL2A 2K9NA 3KYLA 3FMSA 4C9YA 5GAGJ 4RB2C 4I0BA 4AYBN 3P5JA 1A6IA 4XLFA 4KFCA 1MBGA 2M4GA 3OL3A 4QLCU 2D5VA 4BEHB 3SZPA 2M8EA 1T56A 1UG0A 2G7HA 2VL8A 2HOSA 4B47A 2XB0X 3QP5A 3GXOA 1I27A 5J8FA 4L9VA 2EQRA 5A2QK 1ZR2A 1ACIA 3F0CA 3C1DA 4ZDLA 2ZFUA 3GEZA 3TL4X 1I39A 1R4MB 1PYVA 2CFXA 3SEQA 2PQ8A 1SAUA 1OCPA 4BY1J 3ZMVA 3DEWA 5M5WJ 3CLOA 3FXQA 1KYWA 3FK6A 5CVVA 3EUHA 1T98A 1W36C 3AFHA 2X1CA 1A31A 3OIQA 1OKRA 2M4KA 3L2QA 3RTRA 1HXDA 1FZPB 2KRCA 3B6AA 2DK5A 5E3NA 3DF8A 3PFYA 1KQ8A 4IRGA 2VXZA 4N4NB 4XKWA 2UWMA 4NNJA 4HX4A 2EZKA 5CQEA 1IAWA 1VI0A 2KIMA 1OPCA 2LKSA 2A5YB 1U5TC 4RLQA 4G7OF 2XKPA 2OTLI 1B1BA 1YQAA 3OSFA 1R5GA 4RGUA 4F91B 3REOA 1R71A 2E2HJ 3BJ6A 4XLAA 4X0GA 4D1QA 2XB5A 2EZHA 3ZMZA 1YJ9I 2E60A 2QF7A 1FOKA 3W3CA 4HEA2 2CW7A 3FX3A 1QNTA 1MNEA 2BE5F 4LGWA 3VFZA 2R7RA 2DCEA 1OYIA 4P9FA 3G1OA 1ZRFA 5H20A 3JAMZ 3OYAA 3VSKA 4A12A 1HSTA 3KZIC 4XOPA 2GOMA 4G7HF 2RQQA 1VF9A 4FASD 5JVGF 2JA2A 3KE2A 1R7JA 3N05A 1I1GA 3CC2I 4NUBA 4IOCF 2HOTA 3FXUA 4XLHA 1R1VA 3K6GA 2PI0A 2ZXIA 2HR3A 3D5RC 1EH7A 2NXNB 3K4NA 3GWZA 3J7YJ 1O57A 1ON2A 5C3EJ 3JRGA 1S5LC 3GTJJ 5LEJA 3C3WA 4B3XA 2KKOA 5EG0A 1ZLKA 3G1LA 2LSOA 3GX4X 5TGTA 2CGPA 2ICWG 4UY8I 1RR8C 1P92A 3HBLA 4IHYA 2VOOA 5FLXK 1DQUA 3FBNB 1VQOI 1ZN2A 4BXXJ 1AKHB 3ECHA 2ECCA 2HZTA 1X1BA 1MJAA 4JQFA 2KDOA 5DUIA 4DZJA 3CJQB 4XLEA 3LA3A 1YS6A 2AS5F 2Y48A 3AAFA 1KQ0A 2ZFWA 2ID3A 1U9OA 3KLNA 2FMLA 4MLOA 3RQ4A 2R5ZB 4RGSA 1STZA 3J7ZI 1WH5A 2XF7A 2CS3A 3K4MA 2W85A 2MGQA 3M07A 1KZHA 3T8RA 2HEOA 4XORA 3OV8A 1NHAA 5LGUA 1LKXA 2J5OA 2CQNA 3WGHA 4UVAA 3RJPA 1FTZA 3V7CA 1I50J 2EFNA 3CMMA 1TC3C 4LLLA 2V79A 4O6JA 1U2WA 2VJ4A 2H1LA 2YPRA 3GTMJ 3KZYA 5KCMA 1MBKA 1XGOA 1POGA 3HIFA 5IP9J 2K4BA 2P7VB 4BUPA 1QO0D 4HDVA 3MN2A 1IF1A 3ZMSA 2HDWA 4HF0A 2W7NA 3ABUA 2VJ5A 2ESHA 1XX5A 2EIKH 5J40A 3UKGA 3WU1B 4D0PA 3OYHA 2XRLA 3HSRA 4A3MJ 1YS7A 5GAEJ 5IY5H 5E3MA 2IW5A 3OYDA 4XRFA 3OYIA 3FZVA 2XAFA 2H27A 1HBXG 3HOWJ 1OJLA 1JGSA 4HRIA 1RI7A 1SEUA 4BL0B 2F2EA 1SAXA 3COAC 3ZMUA 2DA7A 4E7ZA 3SFZA 1X19A 2QKMB 2BVMA 1M1EB 1W7PA 2LKPA 2HDCA 2XGXA 5GPAA 4LK0F 4MGRA 4BY7J 1YW9A 5LGTA 1YRNA 3SZGA 4PGHA 1SVMA 4KISA 3DKXA 4DGWB 1B6AA 2FE3A 3JRAA 4IOAF 3EYYA 2VLAA 1K61A 4AIKA 1G3YA 1MIJA 3CP8A 3RYPA 1IO2A 2AXTC 5DEQA 1HF0A 4BYYA 2HNHA 1J59A 1TQIA 1A6QA 1IV6A 5BPDA 3ERED 2R7QA 2STTA 5CPRB 4YG2F 1OR7A 4Y17A 4MTDA 4UVBA 3O3KA 4F93B 3D5LA 1USSA 1JT0A 5HDGA 3WTSC 2F5VA 4HYEA 3ZGKA 5HLIA 5M3FJ 3JR9A 5KAIC 2K5CA 2LLKA 2X0LA 3GZ5A 4GDFA 3OMYA 4ESJA 3BC8A 1BM9A 2RC4A 4XIDA 2JVHA 2V26A 3NWTA 5L3CA 2FA5A 3TOAA 5F0CA 4UUTA 4U7BA 1I6HJ 2QQ8A 2JMWA 2M8GX 2WY7Q 1JUPA 2CG4A 1NK2P 2R7ZJ 1B59A 1ETQA 3ZCOA 2EFOA 1Q1VA 3ASOH 3BR5A 3HB9A 3H92A 1T2KA 3JW4A 3S15J 1IN6A 2OF7A 1Y1WJ 3GMEA 4UNOA 4EV0A 2ELJA 1XMAA 2R5YA 2LREA 2V6CA 4XKVA 2HPMA 3HL2A 1BI3A 1B9NA 1YO5C 2UZKA 4Q4ZF 5ERIA 1UHSA 2MC4A 3BTIA 2BY2A 2QCOA 4IEJA 1BR1A 3A0HC 1XPXA 1CGPA 3I56I 1O3QA 2HVQA 1O3RA 1BJAA 3E0JB 5EEAA 1YIOA 3QOPA 4LG3A 4EVIA 3S3NA 1KYZA 5CQGA 2BV6A 4N9IA 4A0ZA 2P0WA 3OYFA 4C2UA 2Y69H 1V5EA 3TOBA 4DYRA 3T0YA 2Y0SN 1PUFA 2FSWA 1TWGJ 1UMQA 2M0MA 1UHWA 2UV1A 4KJZA 2CUJA 3K1MA 2JSCA 1XSVA 2O9LA 3SJMA 3CLQA 2ACJA 1TQMA 2Y9YA 3ABLH 3MCZA 3QU3A 3G73A 4M3FA 3E7LA 2H09A 3J7AO 4IL6C 2YU3A 3DPTA 3HTUA 3QPLA 2XUBA 1S9HA 1S7EA 2E1MB 1GVJA 3CCYA 1G8XA 1VQ5I 2K9MA 3IP4B 3Q3SA 2E5ZA 4PJNA 4MTEA 1HW5A 1K78A 1APLC 1R58A 4WXDA 5D4RA 2Z99A 2GBYA 5AONA 5D8LB 3P9CA 2BEOA 4PJ0C 1FEXA 2DOEA 2M0CA 1R1TA 1VQ8I 2A69F 1Z21A 2RNGA 2GZWA 5HDNA 1ZREA 1CF7B 2XAHA 2R0QC 1X3UA 3OYGA 4M73A 1WJCA 5E20A 3BQZA 1FJLA 3K4LA 4OWRB 4IHTA 3FKJA 2CW8A 2VKVA 1FX7A 1U8RA 3FXMA 4MFDA 4BDZA 2Z5UA 1E0EA 1FC3A 3FXJA 4HF1A 3ZOBA 3HGYA 3L1PA 2VB6A 3GBGA 1WPKA 4XMYA 2IPQX 4IHWA 3G71I 4GO1A 3OIOA 2EZLA 5DCMB 2D2WA 4D5CA 2KRHA 4QPQA 1PP7U 1ETYA 2KIFA 4HDUA 3CUQA 1ORKA 2HFHA 4CCNA 2FQ4A 1JHHA 2ZC2A 5J1UA 3UNGC 2WC2A 3HOZJ 3GCMA 1FY7A 5E1ZB 3JRFA 2QZ8A 4KIFA 2EFQA 3OYBA 4G6DA 2A6HF 2CQQA 4XSZF 2VQGA 1QU3A 4II3A 4XKCA 5KK1A 2NYXA 3HDDA 4BGDA 1X4OA 3K9TA 1R00A 1OQYA 4AVZA 4YFXF 4PFPA 3H5NA 3HXLA 3DBLB 4DQ2A 2OCEA 2XKOA 5HLGA 3WTZA 2DTRA 2H6BA 5GTHC 2TDXA 1XSDA 4UXNA 2IGOA 1WZ2A 3S16J 1EF4A 3DLAA 2JRTA 4CGZA 4AIHA 1VQKI 1K4SA 1BW5A 2VT3A 2M9HA 3LSHA 3M8JA 3W6JB 3QAHA 2R5ZA 1ZQ3P 3ZQQA 2GQQA 2VKHA 3HRSA 1FYLA 2LYCA 3F9KA 1YFHA 1QZEA 3OS0A 3CTAA 2OV7A 1SFKA 1T33A 1SD6A 1TTYA 1XMKA 2F5FA 3DTKA 3PNYA 3QP6A 4EMSA 3MKWB 3JRBA 3WODF 4GRIA 1P7IA 1U9NA 3RPUD 1Z1DA 1MDMA 5CVJA 3G4SI 5E79C 3OYMA 2DMNA 3M8EA 4AWXB 5FRMA 1IGNA 3CCMI 1PDNC 2QENA 2UXNA 4YFKF 2DA3A 2HYJA 3CDIA 2F48A 3H5RA 4RAFA 2A5WA 4UV8A 4AU7A 2DXIA 3I4MJ 2CO5A 1XDUA 1X4PA 2DOFA 4RB0A 4BU2A 5DM6F 1I5ZA 1T95A 1RPWA 2HTSA 5IP7J 5J4VA 3KCCA 4DNCA 2FD5A 2FOKA 4ZH4F 3KP7A 1XGNA 1KA8A 1XG1A 4P9UA 1YW7A 4FISA 1LNWA 2L2OA 2DQLA 2LFBA 2F4IA 1J2XA 4AUXA 3H36A 2BVLA 4DYCA 1MBEA 3HOXJ 5HVQC 4MNUA 4A3EJ 2R3SA 3CUQC 2JWTA 4G9YA 4CH7A 4L0ZB 2GWRA 1XTAA 3LSGA 1VNDA 2BW3A 2DN0A 4BS9A 4NHJA 3E5QA 3TGNA 1QVTA 3GLXA 1BJZA 2YX7A 3IC7A 2CJJA 3WG7H 2KMUA 1RKWA 2L4AA 1IV8A 4E7IA 4R8HA 1GHCA 1TP4A 3V42A 1H0MA 3EQLF 2Y9ZA 2VT2A 3VDXA 4LLNA 2L4MA 5TJJA 1D3YA 1VQPI 5EF6A 2ID6A 5FLXZ 2ETHA 2DFEA 1FSEA 1GLNA 4Y7NJ 2FUG2 4CCMA 1VFCA 5E17F 3OYEA 3F72A 1KGSA 2IA2A 4HBLA 2IS6A 1SVOA 4IF4A 4PUSA 1G6NA 4A3DJ 4A0XA 2Q2EB 3BPVA 1E3OC 2STWA 4IHXA 2OBPA 3GVAA 3BTCA 2X85A 5E8GA 4GCVA 3R61A 4LB6B 4EGZA 1FOXA 1T0FC 4B4CA 1U3EM 5BPIA 4XKBA 2O0YA 4IVNA 4KMFA 4LB5A 3LL7A 1X1PA 3ZR8X 4XONA 1XB4A 2FNPA 5KAFC 3A01B 3IV5A 4BQNA 1RUOA 1R36A 1HKQA 1MD0A 3TDZC 2KHMA 1R9TJ 2DDAA 3KP2A 1RETA 2W24A 2CRGA 3I64A 2K3FA 5FROA 3J80Z 1ZHFA 2PMUA 3MEXA 3LAPA 3MMYB 3HPGA 4ESBA 3I58A 2IT0A 3ULQB 2L0KA 5HODA 3TQNA 3RKYA 1RRJA 2Z2SB 1QZZA 1F9NA 1U5TA 5C4JJ 1JUSA 4E7KA 3BOQA 4OMZA 4EJTA 1VQ7I 2EA2A 4CCJA 5EG0B 1DUXC 1JTXA 1FOWA 3KP5A 5CKTA 5IYDJ 2ZJQF 4E7HA 2EILH 4UB6C 1HQCA 5LHGA 3HSEA 4PK4A 1BOBA 3FMQA 5HNHA 1VQNI 3RYRA 1DPUA 1MMAA 2BW3B 3BR0A 2PFBA 2MD5A 4HV5A 1BR4A 4RAYA 5IYCJ 2Y30A 2Q1ZB 1QHHD 2V9VA 2ZNZA 3BP8A 4BH9A 1Y0UA 4WK8F 2JQ7A 4JOMA 5IPAA 5EGOB 3QPTA 1BC8C 1D0ZA 3ABMH 4HQEA 3PUFA 4MO7A 1ETXA 2LRDA 1RESA 3V8LA 3BTJA 2VJIA 4Y15A 3KEQA 1JKRC 1B8IB 3HUGB 3NQOA 3KEOA 3LNQA 1DGWY 4C3HJ 2P6SA 4WXCA 3G3ZA 2E5NA 3CP2A 4B09A 3F8FA 3KEYA 2EH3A 2KL4A 4KDPA 3RCOA 2GLOA 2M5WA 1FYKA 4B8XA 2VASA 2VI6A 1NG6A 3S3OA 3C2GA 4C30A 4M9XA 2Q2EA 2JA8J 2IRFG 4HX7A 3CCJI 3FM3A 2VKEA 3QOEA 4UB8C 5M3MJ 4C3IJ 1XC5A 2XIGA 4CCOA 3MZHA 1BL0A 4BQOA 2QLZA 5D6FA 5E1XA 1MBHA 5LRRA 3JREA 3CCEI 1QHGA 5FD5A 3GFLA 1RKTA 1UAAA 1WJBA 3RZDJ 4KITB 4J19A 3HM5A 1LUJB 1GDTA 4L9NA 4UUSA 3ZQHA 1YX5A 1ZK8A 1MBFA 4ABZA 4V2GA 2ELHA 2M45A 3MZ8A 3K0LA 2F6CA 4CZZA 5ILUA 3S3MA 4D7MA 1LDKB 5LHHA 2EFPA 4ZYAA 3R0AA 5ILSA 1IJWC 4IQJA 4HNUA 4XR6A 2HYFA 5EYRA 3H35A 3FXLA 3M9AA 1ZG5A 2JSPA 3S32A 2V6EA 3V8KA 1P4AA 4JK1X 3LA7A 2RREA 1WGXA 1G3SA 1J9IA 5JFRA 2CUEA 2DT7B 2QGUA 4FX0A 3QWLA 3K4BA 2W1OA 2HXOA 1YW8A 1X3ZB 1QZYA 2MYSA 2WY8Q 3HEFA 6PAXA 1JI8A 2NVUB 5ICFA 3K69A 3BG3A 1IN5A 1FBSA 5DD4A 4B43A 2YS9A 4M72A 1Y6IA 1ZAOA 3CDHA 2ZMEC 3M7GA 3ZN1A 3F6VA 3PO2J 2DU9A 1WH7A 2L7KA 3KIOA 2XAJA 5LBQA 4XOTA 1MDMB 3BZCA 3S1MJ 3O8GA 1D0XA 3WGIA 3MVPA 1TW3A 1DU6A 4HOBA 5LD2C 3H9GA 3MD2A 1SANA 3DTEA 3U21A 3CESA 2DFIA 1IN8A 2E1NA 3RPUA 3T8TA 1WJEA 3ZQGA 2V4JC 2DJNA 5LEKA 5L3DA 2CUZA 2O03A 3S1RJ 3X2QH 3GTGJ 1NG7A 4NQWB 5CVRA 5KHDA 1UELB 2WV1A 4UUSB 1ERDA 1S3JA 5E1WA 2Y75A 2AXLA 1J09A 5J8CA 1IUYA 1D1CA 2EJRA 5FGMA 2V1DA 5K7FA 2Z3YA 2COMA 3K70C 1A5JA 3E5UA 4KIBA 2A6EF 2E2JJ 2VBZA 2VXDA 1ODDA 1OMIA 2IVMA 3PL8A 2MH2A 3MQ0A 3IH2A 4OMYA 4ANJA 4Z6YA 4U87A 2ZMEA 2QSGX 1BIAA 2K85A 2MLGA 2DODA 5BNGA 3WTXC 2GA2A 2DYRH 3O6BB 2Z33A 2KT0A 1BIBA 4OAZA 2I10A 2L02A 4RM2A 3BCBA 5F0HA 2ME6A 3JAMK 1IN7A 1RZ4A 5JHFA 1VQ4I 4G94A 2XDVA 3QYEA 2W25A 4WXHA 4DYQA 1WI9A 3BG7A 4PJMA 2H8RA 1S72I 2OAZA 2E1OA 5ICEA 1QRYA 1PUEE 1MGTA 4FT8A 2F5EA 1H8AC 4W97A 1XD7A 1B72A 1JJ8C 5F04A 2NVYJ 1FNNA 1IC8A 4M9SA 3EUAA 5LRSA 5D5UB 5FLMJ 1IDYA 3BT9A 4OU0A 4YFNF 1CF7A 1HDPA 3FHNA 2RGVA 3BTLA 2B63J 2O8KA 2DA2A 3K2AA 2FJ1A 2DMQA 4A6DA 4BXFA 2NAZA 3BY6A 2TRTA 1R49A 1DP3A 4A3JJ 1HA8A 5DDGA 3IWZA 1Z3XA 1FP2A 2XGDA 4FETA 3FHZA 2O61A 2ISYA 3U1DA 1LDDA 4FE7A 3SQNA 2O5RA 1WCMJ 3CJNA 4BHCA 2GAUA 4Q48A 4BACA 4HNVA 1S7AA 5DCMA 1F36A 4FHTA 1MSFC 1KU9A 2FBKA 4I6ZA 2JVGA 5DV5A 2ZNYA 1FOYA 1VQ6I 2XV4S 1TLHB 4XRSG 2HXIA 3EDPA 3V8JA 3R60A 3SDGA 1BC7C 1P4WA 3NRVA 2VPLA 1LVAA 4ETSA 4EM2A 4XNFA 3J81Z 2CV2A 1WJFA 4D9JA 3M3YJ 1BBYA 2E1MC 2ZMEB 1G3WA 2CQ7A 4NBQA 1OFCX 2EIMH 1Y8RB 3DXJF 3FISA 1U0JA 1IG7A 4YEJA 1TQPA 3MZYA 4A69C 2EWNA 4ZYHA 5GPCA 1Z05A 1QA6A 1XN7A 3ZQ7A 2XVCA 3LA2A 4ZZLA 1W0UA 1ZLJA 4CICA 2LG4A 5F27A 1R22A 2ZJ2A 4CCKA 1PVEA 1EJ9A 3ZQLA 1D5YA 4D5FA 2EPFA 4PGGA 3QRFF 4CO8A 4EJUA 2KISA 3FM5A 2CH0A 2WAFA 2X6WA 1B8IA 1REPC 4E70A 1AU7A 2XPUA 4AC0A 2B9SA 3KP6A 3WGGA 1X58A 4IRIA 3ZMTA 2EV5A 3H0GJ 2A6TA 2R7OA 1IRGA 4R79A 4CA0A 1ZARA 1TNSA 4LD5A 4PFOA 3EUHC 5DCFA 1Y39A 2IXSA 2EBIA 3GTKJ 2P5KA 3PUBA 4IJAA 4AM3A 5LFAA 4L5IA 4IQ4A 1IN4A 2NS8A 3I0TA 5HS9A 5K7ZA 1LFBA 2QUFA 2PJPA 1KQ9A 2ZXWH 2QBYB 3LSRA 1BN5A 4XRSA 1TWHJ 3OWTA 1WHUA 1Z7UA 1Z77A 2FQ3A 5D6EA 1EH8A 1Y56A 4K2EA 2E71A 1ZG1A 4RAZA 3BQYA 3F8MA 4BAYA 4F55A 2Y0MA 4IXAA 4U0VA 1YHQI 1MNMC 3JCUC 2BXYA 4KMUX 2BY0A 4KNYA 5M5YJ 1RNLA 3K4JA 3LSJA 2JRMA 3FF5A 2LF8A 2X1DA 2J5PA 3DEEA 3GZNB 4EJOA 3PSFA 1WWXA 2QQ9A 3M1CA 4L5EA 1TT0A 1SFEA 3S17J 3PNTA 2RNJA 2M1BA 3D5SC 3B02A 2CU7A 2ZJPF 3DLLF 2BGCA 5DUKA 2DA5A 2K02A 4TV7A 4M3BA 3FXOA 3KZZA 1CQTA 1W7PD 4UHTA 3E1SA 3VOEA 5L3EA 3IRRA 4CHUA 3PIPF 3GFMA 2FXAA 1TWAJ 2RVCA 1PP8F 2OQRA 3BLYA 2I5UA 2O8XA 4MFEA 3Q9SA 2WAQN 2OTJI 3FWEA 1K78B 4RBOA 4MQ9F 3I53A 4GFBA 4BE1A 4JX5A 2H8WA 2IGMA 3F8NA 3KFWX 3IH4A 3JRCA 3L2VA 1T8IA 3HOVJ 3J81K 2E36A 3K7AJ 1JKQC 4LIUA 3H1CA 2X4HA 4UVCA 3OYKA 2PJRA 1ITYA 4G12A 4BXUA 5B66C 2RN7A 1FMWA 3ZQFA 5IT9K 4OIRF 4HZFA 5IP6A 1GV5A 3P9KA 1OLTA 3CO6C 1WI3A 1TZLA 3WTWC 2L5QA 2HOEA 2QBYA 1HW1A 3VPRA 2ZB9A 3RKXA 1Z6TA 1VQLI 3DWLE 2L9RA 2VBYA 2LC2A 3W2WA 1FYMA 4NQWA 3H9JA 4HLXA 5JVTA 3I55I 3CUQB 3O2PE 2Y0SA 3CJTB 2MA3A 3KLOA 3ZQIA 4BJ6C 2XROA 4I0AA 3VEPA 2KRFA 1I3AA 1U5TB 4L9JA 2Z16A 3I3LA 2W4SA 2WAEA 3VYTB 3CMYA 2V1NA 1R6RA 1H89C 1BI2A 1HKSA 2XASA 2VONA 4MQVA 4P55A 1QGPA 1DU0A 3DKWA 5FKKA 3QPHA 2JUGA 2HS5A 3E6MA 1VQMI 2QVOA 5K5OA 2XSDC 4ZZDA 3V7SA 3HZJA 2LKXA 4PSXA 1X3WB 3ESWB 3KX2A 4PJLA 3HOYJ 1D8JA 5TRDA 2LOOA 2QQBA 1AWCA 1F5TA 5FFZA 2IP2A 4P5OA 5E3OA 3OY9A 2HWVA 3W6KB 3S1NJ 3DQVC 3PQJA 2VN2A 2P6TA 5AIQA 3L2CA 2PX9A 4E7LA 1IZ1A 1TL8A 1B72B 1LEBA 3LQRA 2LY2A 4ENMA 4Y33A 2VE9A 2E7XA 1MJ9A 2V9KA 1H88C 1BI0A 2L9VA 3PO3J 1EV7A 2ESNA 3CC4I 2M3AA 2TCTA 2YX4A 2OA4A 1TT5B 2DOAA 3WHBA 1HSJA 3AKZA 3JRIA 3DPUA 3F6OA 1GVDA 4XICA 4BDYA 3BZ6A 3RZOJ 3VYSB 1P6RA 3IAS2 1IRZA 4Q47A 1G2HA 3TP0A 3GTOJ 3MKLA 1BI1A 2R4GA 1ZRCA 1MMNA 3HRMA 5DS9A 1JKPC 2XSJC 2ZSHB 3AG1H 4HF2A 3GTLJ 2DLLA 1OCRH 1LFUP 3I5UA 1MBJA 1WJ5A 2QKLB 2VJJA 3LAJA 4EEFG 3BR6A 5AIPA 3TEDA 1K4TA 2JPBA 3HC7A 1N75A 2CWEA 4ENKA 2EK5A 2HI3A 3OYNA 2G7UA 3M4OJ 4RB1A 4GYGA 1V3FA 2I8DA 3TMOA 2VPRA 3P9IA 4NB5A 3V4GA 1YYVA 2AQFA 2O6GE 4FE4A 3WG9A 4RDUA 1OCTC 4J01A 1QPIA 3CF5F 2WWYA 2BZTA 2WB1A 2CQXA 4V2FA 5JI6A 4ZTFA 2H1KA 2R7SA 5ED4A 4HLYA 1KU2A 3MKYB 1FWZA 3BCAA 4BBRJ 1I1SA 1DGRM 3CF2A 4Y4RA 3A2KA 2DMUA 2MFZA 4EGYA 5FLVA 3S2WA 1DP7P 2UUZA 3K4CA 1A36A 1OISA 2HKXA 1O3SA 1L0OC 4JYKA 5DYMA 2LF7A 1YOVB 1MMGA 2KLOA 2W00A 2ZJRF 3L2UA 2M34A 2VKDA 3LSTA 4XK4A 5H6QA 5ILVA 1F1ZA 4A3FJ 4FTHA 3H5AA 1ON1A 2PG4A 2R93J 3B73A 4MEXF 5HLHA 1LE8A 4IZZA 2LBFA 2A05A 1X2MA 1ETKA 1YITI 3H3ZA 4HW0A 1OCCH 2XRNA 5K5QA 3D0SA 2NNNA 3LOCA 5BQTA 1Z0XA 5F0FA 3S14J 3H9QA 4HAMA 5FO5A 4M3EA 1ZYRF 2IA0A 3L09A 1XMXA 4RS8A 2FBHA 4LMYA 2AQEA 5CJ9A 1HC8A 4KYWA 1RIOH 1S8NA 4BQAA 1E3HA 1IXSB 2IS4A 3OSGA 3W6VA 2ZKZA 2XF5A 2HTJA 3ELKA 3HOSA 2JA5J 1NK3P 3R4KA 1OR7C 2R7TA 1FIPA 4AIDA 3RIRA 4L9TA 1HCRA 5F1JA 4IX7A 1A04A 2ZO4A 4GYIA 1DPRA 2BXZA 3KYCB 2DA1A 3CCRI 3MWMA 1IXRC 4BKXA 4HG2A 3H0DA 3I71A 2M2EA 4D7NA 1BA5A 2P5VA 3DU6A 5GP9A 2GIZA 2W84A 5IYBJ 2AHQA 3BG5A 5F6FA 2IJLA 1RR7A 3OYLA 1LVKA 1W5SA 1P7JA 2FU4A 3CCQI 1WRJA 4A93J 3ZQCA 4RAGA 2EA4A 3E97A 4PJJA 4MHGA 3MKZA 4ZDPA 3KP4A 3LSIA 3OOUA 4WF2A 1ULYA 3JTGA 1MSEC 2HVSA 2EV6A 3BR3A 3OOPA 2QSHX 4CZCA 2O7OA 2XAUA 2WBMA 1R1UA 4ESFA 4QPOA 3TW7A 4A6EA 4F52A 4RM3A 4L18B 3DPLC 3Q9VA 3CJRB 3WTTC 2ELKA 1YTYA 1PJRA 1V54H 2ME0A 1G4DA 5EGOA 2E1CA 1MNDA 1ETWA 4KT5C 1WKMA 3WTYC 2FMYA 5FFXA 1XDSA 2ADUA 2L54A 4I2OA 2QYOA 3O8HA 3E6DA 4XL9A 2BOLA 3HUGA 5EEHA 1LE8B 2D1HA 3HHGA 4PZJA 2IA1A 2F5DA 2ZCWA 3Q0VA 4HQMA 1F43A 4AVPA 3BR1A 2HQAA 2FOWA 3CQZJ 2LMDA 2OQGA 2Q0OA 4HV6A 3SFIA 2GIVA 2K9SA 3TDUC 5CLSA 2HYGD 4P96A 2BBYA 2A07F 2CFOA 3ZN0A 4C3JJ 1MH3A 4DIQA 4ASNA 3FMRA 2NNYA 2CUFA 2PMHA 3IRQA 2X48A 3VYUB 2XAGA 2IGNA 3G6EI 1O7FA 5L3FA 4QSHA 3E6CC 3FXKA 3PNVA 3K1NA 1EH6A 3LSPA 2R7XA 5GAHJ 2LD5A 5EZHA 2G0EA 1K6YA 4IHVA 2R92J 3BWGA 1YIJI 1IRFA 2V9PA 2CSOA 2YUSA 1XS9A 1SD4A 4XM3A 2B0LA 1VQ9I 4ENJA 1GUUA 5C4XJ 5DM7F 3IKTA 2YU9J 4M3DA 5TISC 1Z67A 4DJAA 2IS1A 1XGMA 1XSXA 2CW0F 3CZ6A 2E7WA 3FKIJ 3AL0C 2DPDA 2COBA 2X6XA 1UCRA 2OZ6A 5FKNA 4EATA 4FX4A 2JTVA 4YIFA 4JBAA 1YJWI 1TWFJ 1D1AA 3N97A 1JUMA 3P7NA 4HSRA 3CCVI 2PLYA 4O3MA 1Z3YA 5EZGA 3S8PA 3SXYA 5K7HA 3QODA 2VQCA 4AYBA 4BEHA 1I6XA 1X1DA 1AOYA 4IHSA 3GO5A 2OJED 2L9SA 4LG0A 5FB2A 2EZIA 2MH9A 2DT5A 2V1UA 2DMTA 3AG2H 3HSFA 2OUMA 4BJTA 2JN6A 3EPZA 2A3SA 2VUMJ 2QM3A 4RMNA 3DU5A 1FIAA 2UXXA
chains in the Genus database with same CATH topology
3ERMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERM A; 
#chains in the Genus database with same CATH topology
 3VYR B;  4Y3O A;  3RPQ A;  4KT6 A;  2R7V A;  1U78 A;  5KVR A;  4B44 A;  5K5R A;  2NS7 A;  2G9W A;  1S7O A;  2JJ7 A;  4EM1 A;  3ONQ A;  4NC7 A;  1MMD A;  3CCS I;  2LNB A;  4X6A J;  2ISZ A;  2E34 A;  3HOT A;  1OYY A;  3DBR B;  4XN3 A;  1R4N B;  3HOU J;  1TNT A;  2XAQ A;  4RGR A;  4M3G A;  1ZGW A;  2OPT A;  1MZB A;  4C2T A;  4A2U A;  4RGX A;  1ZGA A;  4Q5S F;  2K3P A;  3QYF A;  2DT6 A;  5B5E C;  2X6Y A;  5GTI C;  2DA6 A;  2F4O B;  1B4A A;  4AIJ A;  4XLC A;  5IT3 A;  2XF6 A;  2YSR A;  5D5X B;  3PQK A;  1XGS A;  4N9H A;  2KIU A;  1T08 B;  2XPV A;  1ZR4 A;  5JR3 A;  2MAB A;  2RAE A;  2ZXJ A;  2QEX I;  5M5X J;  5CYV A;  4RB3 C;  5DTD A;  2K7L A;  2JA6 J;  3FK7 A;  2EB7 A;  4DZP A;  4ZYG A;  2IGK A;  3BDD A;  3TKY A;  3W2V A;  4M71 A;  1P2F A;  1E17 A;  3WTU C;  1N25 A;  2WA0 A;  4G6T B;  3F23 A;  1DDN A;  1ZRD A;  2EIN H;  1WJA A;  3G2B A;  5LLQ A;  2HZD A;  1FPQ A;  2HKO A;  4WWC A;  3E3V A;  2CV1 A;  1Z7L A;  5J47 A;  2WB1 N;  4LG0 B;  5BMZ A;  1O4X A;  2MG4 A;  3J7A Y;  5J6X A;  1R23 A;  1VTN C;  4A5N A;  3A02 A;  2MD0 A;  4W1U A;  5FRN A;  3J80 K;  2VC0 A;  4OAY A;  4DBR A;  4F92 B;  2XGE A;  1UJ8 A;  2L9N A;  2MSY A;  5CVI A;  1U6G A;  1TBX A;  3F22 A;  4BJ5 C;  1FP1 D;  5FD6 A;  1D1B A;  5E18 F;  4A0Y A;  1FBQ A;  3OL4 A;  4UV9 A;  1KU3 A;  2VIX A;  1AKH A;  1T38 A;  5FKO A;  2XGC A;  4N4O B;  3M8F A;  5A2Q Z;  1W0T A;  2GM4 A;  1SMY F;  5EDN A;  2DK8 A;  4XN0 A;  2DFH A;  2LK2 A;  4YEL A;  1UFM A;  2MLK A;  2IS2 A;  3NAU A;  4NC8 A;  1V4R A;  4KN7 X;  2KZV A;  4PDK A;  1W36 D;  3Q0U A;  3K70 D;  4BHB A;  3IAM 2;  2BYV E;  5L3B A;  1X1C A;  1G3T A;  2W48 A;  3HGG A;  3L00 A;  3CCL I;  2X1E A;  1IUF A;  3HHH A;  5HLT A;  2C6Y A;  1Y8Q B;  2FBI A;  4A3B J;  2V1X A;  2DBB A;  3Q0W A;  1J5Y A;  1D0Y A;  1MH4 A;  2HQR A;  1Y0N A;  2LR8 A;  3ASN H;  2DMP A;  4I76 A;  1SMT A;  5EJC A;  2CV0 A;  3R6S A;  3GF2 A;  3OYC A;  1YJN I;  1Q1H A;  3ABT A;  4I09 A;  3PJR A;  4XLN F;  4OIN F;  2W57 A;  3BG9 A;  2Y2Z A;  3L9F A;  3ZPL A;  4F7Z A;  3LWF A;  1BOA A;  2ECB A;  2PN6 A;  3NEU A;  3T1B A;  2KPM A;  4G7Z F;  2GOX B;  2HU9 A;  4CYD A;  1ZKG A;  3L7W A;  1X2N A;  4A3L J;  3WU2 C;  1F4K A;  1H9T A;  1ENH A;  1YG2 A;  2QA4 I;  3A0B C;  2HVR A;  1S6L A;  3WTV C;  1YX3 A;  2DFF A;  3BG6 A;  1W7P B;  2M7A A;  1GXQ A;  3WHC A;  1K79 A;  3FDY A;  3LFK A;  4LIV A;  1KON A;  1R5H A;  1T6S A;  2OZU A;  2FX0 A;  2KFD A;  2LDU A;  4LLG F;  3RDI A;  4U0Y A;  2GXG A;  1V5F A;  1HKT A;  1OYW A;  2L3D A;  3VB2 A;  4Z2Y A;  1YLF A;  2X6O A;  2RQP A;  3VWB A;  3I4P A;  1IRX A;  3QYB A;  5HDK A;  4ZC3 A;  2VQL A;  5E8I A;  1ETO A;  1O3T A;  3BR2 A;  3PM1 A;  3WE3 A;  4N0B A;  3T5X A;  2ZSI B;  3EUK L;  4ON0 A;  4A3G J;  4CXF A;  4FQG A;  5D8K B;  2QSF X;  3F8C A;  4S04 A;  1O7L A;  4CCL A;  3FBI B;  2BY3 A;  2P5L C;  4HX8 A;  2Z9O A;  2M87 A;  4CUG A;  5L3G A;  4H0E A;  1K6O A;  1YI2 I;  2CYY A;  3IUO A;  1JE8 A;  5J1R A;  1HDD C;  1S29 A;  1ZTR A;  2KZG A;  2M30 A;  2DAO A;  2WAQ A;  1SD7 A;  4PCQ A;  5FJ8 J;  1IDZ A;  4I99 C;  2WTE A;  2QQA A;  1GXP A;  2DA4 A;  4U0W A;  3RSN A;  2P7C B;  3DV8 A;  4ENN A;  3RKW A;  4M9Z A;  3GW2 A;  4ZYE A;  1MKM A;  3IWF A;  3KPH A;  5KNL A;  4GXO A;  5C44 J;  4UUV A;  2FF4 A;  3CC7 I;  3K4K A;  2R5Y B;  2K86 A;  3DEU A;  2LH9 A;  3QU6 A;  4KUM A;  3SZT A;  5B3S H;  4ZYD A;  2AO9 A;  4BBS J;  2HDD A;  3VSL A;  4I98 B;  4ZTJ A;  1N77 A;  3GLL A;  3ZRG A;  4XRM A;  4S05 A;  1EKE A;  3AG3 H;  3DFG A;  2VQH A;  3S2D J;  3HPH A;  1BR2 A;  2K9L A;  1SFU A;  3PIO F;  3BPX A;  1HW2 A;  3TBI A;  1P9Q C;  2A61 A;  4C2M J;  3HKZ A;  5CVU A;  3JRD A;  1V5G A;  3ZMD A;  4A5M A;  1PUF B;  5H6R A;  3HTS B;  1UHM A;  1UG2 A;  2HQN A;  4F3Q A;  4FCY A;  2LBF B;  2NVQ J;  2GXB A;  2PMZ N;  3F8B A;  2JK3 A;  2R7W A;  3A03 A;  2PJR B;  5FKM A;  3IKV A;  1XCB A;  3RQI A;  1RC9 A;  2N8G A;  3RI4 A;  4CDG A;  1KU7 A;  2IEK A;  1E2X A;  4A3K J;  2LY9 A;  2FNA A;  5F08 A;  1ONV A;  2OD5 A;  4EM0 B;  4CYC B;  2K27 A;  4IO9 F;  2WV0 A;  4OOI A;  3H3U A;  4QTR A;  1WJD A;  2P8T A;  3I9V 2;  5D4S A;  5HS8 A;  4B3A A;  3UR3 C;  5B1A H;  3K2Z A;  2LP0 A;  1SFO J;  3M1E A;  3GUD A;  3K1P A;  2BHZ A;  2KQR A;  3DP7 A;  3ERM A;  5J4Y A;  1J75 A;  4NDL A;  4P1W A;  2CQK A;  2O3F A;  2LTP A;  1ETV A;  4BHP A;  2RKH A;  4KIG A;  3AG4 H;  2L7Z A;  3L2R A;  3WE2 A;  5IOZ A;  4KN4 X;  3HKZ N;  2K9Q A;  2JUC A;  1OCZ H;  2P81 A;  4I02 A;  4J00 A;  3JRH A;  3S93 A;  2JA7 J;  1FLI A;  2HGC A;  4YIR X;  2NS0 A;  2JPC A;  2MC3 A;  4JX6 A;  1Z91 A;  2YR2 A;  3Q5F A;  2NVT J;  3C2B A;  1VZ0 A;  1K83 J;  1HLV A;  1HOM A;  3D1N I;  1OCO H;  4LFU A;  2MBF A;  4M6Y A;  3KET A;  2IAI A;  2F5C A;  3TO9 A;  2PEX A;  5E3L A;  3TW6 A;  4KIC A;  2HPI A;  4Y52 J;  2Q8K A;  4X1E A;  3ZXS A;  1JGG A;  4RLF A;  4KA4 A;  2VC1 A;  1P4X A;  2VOD A;  3F3X A;  3TO7 A;  3QQA A;  1H9G A;  1LJ9 A;  5H2F C;  3CDL A;  3OR2 C;  2LVS A;  3C18 A;  3FXR A;  5ICG A;  4IPA A;  2DJI A;  4ITV A;  5F64 A;  1E3P A;  1BW6 A;  1JT6 A;  1YRN B;  4G8X A;  1UST A;  1R5I D;  1AA7 A;  4XBF A;  2OCC H;  3CME I;  3DCF A;  1ZG3 A;  1LEA A;  4I01 A;  1QBJ A;  2JT1 A;  5IOY A;  3HRU A;  2L7M P;  1WSU A;  4II2 A;  4OIQ F;  3SEZ A;  1QQI A;  4QIW N;  4IRH A;  1ZGJ A;  5HS7 A;  4EJV A;  2A68 F;  2L7F P;  3FIW A;  1SD5 A;  4XSX F;  5D5W B;  2FRH A;  5J1Y A;  1IXC A;  3LFU A;  3W2A A;  2F4M B;  4V19 K;  4L5J A;  2D1V A;  4CYC A;  2NRA C;  3GFJ A;  3ABK H;  2X51 A;  4B1R A;  3CD6 I;  2RV8 A;  3V7R A;  4EQQ A;  3GZ6 A;  5BS6 A;  3KYD B;  1GV2 A;  2R7U A;  4HPQ A;  1Y1V J;  2XC7 A;  9ANT A;  3PSI A;  2B7E A;  3BJA A;  5ICC A;  2W82 A;  1FSH A;  1W4M A;  3DBH B;  1MW7 A;  4BQQ A;  2MW8 A;  2JZY A;  3PFI A;  4PSW A;  1K7A A;  4BNC A;  3AL0 B;  4I7H A;  5BOX A;  4ZDO A;  2GXA A;  2E2I J;  1T0F A;  3I54 A;  2VOP A;  1FTT A;  3BZK A;  3IH3 A;  3DTI A;  3H3V K;  4OIP F;  1GT0 C;  4XQF A;  3N4M A;  1UZC A;  4JP0 A;  3GFI A;  1A35 A;  3U9G A;  1X1A A;  4LOC A;  3EET A;  4WX9 A;  1SFX A;  1NH3 A;  4WCG A;  1WVR A;  2R7D A;  3CMA I;  3S1Q J;  4E4H A;  2OC6 A;  2QWW A;  5GAD J;  4YRV A;  3OIP A;  2R7F A;  2KJC A;  3DKY A;  3NAR A;  1Z6R A;  1N78 A;  1I3Q J;  3HYI A;  2DQR A;  3ISP A;  1L3L A;  2P4W A;  2K4J A;  3F21 A;  2EV0 A;  3OS2 A;  3ML6 A;  4DW6 A;  4EJW A;  4A3C J;  2H6C A;  4U7D A;  4E6K G;  2BY1 A;  3ECO A;  2DW4 A;  2L01 A;  3A1Y A;  3HG9 A;  1FT9 A;  3CO7 C;  1Z9C A;  4LK1 F;  3G1M A;  1C0W A;  4A3I J;  1G59 A;  1TW2 A;  1ZEL A;  4BE0 A;  1W5C C;  4AD9 A;  2Y31 A;  4XLP F;  3ZP5 A;  3K10 A;  2K40 A;  5EEG A;  3CUO A;  4OIO F;  1LPQ A;  3OR1 C;  3WU0 A;  2EIJ H;  3LMM A;  5IT9 Z;  1U8B A;  4LJZ F;  1W1W E;  1LQ1 A;  3I59 B;  5LGN A;  1W5T A;  2HOA A;  3E5X A;  4DBQ A;  3IHU A;  2E35 A;  1JKO C;  3B6C A;  5JLX A;  5HNF A;  4H4K C;  1QPM A;  4CSW A;  1ZH5 A;  3I4N J;  3JSP A;  2PMZ A;  2D45 A;  5K1Y A;  1AHD P;  4GGG A;  3C2H A;  3SDB A;  4JX4 A;  2FEZ A;  1YE9 A;  2KDZ A;  4BE2 A;  1TWC J;  5JHU A;  3MFK A;  1JXS A;  2PBI A;  1B9M A;  2OU2 A;  3GTQ J;  4ZJZ A;  1MMS A;  5F1R A;  2VE8 A;  2RDP A;  2VBX A;  2WAD A;  1RUN A;  1MJB A;  4M6X A;  2XPW A;  2XHK A;  1JJ6 C;  3KP3 A;  3NWS A;  3A01 A;  1J7K A;  1JHF A;  5DD8 A;  2NOG A;  2NVX J;  1LDJ A;  2NOJ B;  1QVU A;  4U88 A;  2M7B A;  4HST A;  4E7J A;  2EFW A;  4R1H A;  2HQ5 A;  4MIM A;  4HA8 A;  1D5V A;  3R0J A;  1LB2 A;  2VBW A;  3MAJ A;  4M6V A;  4L0Y B;  1V55 H;  3HRT A;  2KJB A;  3EYI A;  4DOZ A;  1IW7 F;  3BRO A;  4HNT A;  4S0H B;  1JTY A;  3U1K A;  1EA3 A;  3SHF A;  5HOO A;  2ZXH A;  2V7F A;  3GYH X;  1T39 A;  3S2H J;  3QPS A;  4IKF A;  1NTC A;  3LSK A;  3ROU A;  4E7S A;  5D5V B;  5JLW A;  3CCU I;  3OYJ A;  3C7J A;  3VOD A;  3GTP J;  2DYS H;  2DTZ A;  4M74 A;  1WQ2 A;  5B1B H;  3LQQ A;  1FMV A;  4B48 A;  1SC7 A;  5FKL A;  1WFX A;  3RKQ A;  5LHI A;  3E6B A;  3JSO A;  4RA2 A;  2KP6 A;  2DO7 A;  1XCV A;  3TO6 A;  1UB9 A;  1FBU A;  2LY1 A;  2E19 A;  3BJO A;  3I59 A;  4QWQ A;  3SYT A;  2CMP A;  3L2W A;  4Y13 A;  3TP3 A;  2H94 A;  2GA1 A;  3OS1 A;  1J0R A;  1SVL A;  4LIT A;  4NC6 A;  2DDB A;  3U2R A;  5J3L A;  4YII A;  2X9D A;  1LFP A;  1D8K A;  3LSM A;  2DI3 A;  4O5V A;  3HJE A;  3JTH A;  2IBD A;  2DPU A;  3A4C A;  4G6Q A;  2BHY A;  2Z1D A;  2KIQ A;  2ZBK A;  4MEY F;  3IL2 A;  2K9N A;  3KYL A;  3FMS A;  4C9Y A;  5GAG J;  4RB2 C;  4I0B A;  4AYB N;  3P5J A;  1A6I A;  4XLF A;  4KFC A;  1MBG A;  2M4G A;  3OL3 A;  4QLC U;  2D5V A;  4BEH B;  3SZP A;  2M8E A;  1T56 A;  1UG0 A;  2G7H A;  2VL8 A;  2HOS A;  4B47 A;  2XB0 X;  3QP5 A;  3GXO A;  1I27 A;  5J8F A;  4L9V A;  2EQR A;  5A2Q K;  1ZR2 A;  1ACI A;  3F0C A;  3C1D A;  4ZDL A;  2ZFU A;  3GEZ A;  3TL4 X;  1I39 A;  1R4M B;  1PYV A;  2CFX A;  3SEQ A;  2PQ8 A;  1SAU A;  1OCP A;  4BY1 J;  3ZMV A;  3DEW A;  5M5W J;  3CLO A;  3FXQ A;  1KYW A;  3FK6 A;  5CVV A;  3EUH A;  1T98 A;  1W36 C;  3AFH A;  2X1C A;  1A31 A;  3OIQ A;  1OKR A;  2M4K A;  3L2Q A;  3RTR A;  1HXD A;  1FZP B;  2KRC A;  3B6A A;  2DK5 A;  5E3N A;  3DF8 A;  3PFY A;  1KQ8 A;  4IRG A;  2VXZ A;  4N4N B;  4XKW A;  2UWM A;  4NNJ A;  4HX4 A;  2EZK A;  5CQE A;  1IAW A;  1VI0 A;  2KIM A;  1OPC A;  2LKS A;  2A5Y B;  1U5T C;  4RLQ A;  4G7O F;  2XKP A;  2OTL I;  1B1B A;  1YQA A;  3OSF A;  1R5G A;  4RGU A;  4F91 B;  3REO A;  1R71 A;  2E2H J;  3BJ6 A;  4XLA A;  4X0G A;  4D1Q A;  2XB5 A;  2EZH A;  3ZMZ A;  1YJ9 I;  2E60 A;  2QF7 A;  1FOK A;  3W3C A;  4HEA 2;  2CW7 A;  3FX3 A;  1QNT A;  1MNE A;  2BE5 F;  4LGW A;  3VFZ A;  2R7R A;  2DCE A;  1OYI A;  4P9F A;  3G1O A;  1ZRF A;  5H20 A;  3JAM Z;  3OYA A;  3VSK A;  4A12 A;  1HST A;  3KZI C;  4XOP A;  2GOM A;  4G7H F;  2RQQ A;  1VF9 A;  4FAS D;  5JVG F;  2JA2 A;  3KE2 A;  1R7J A;  3N05 A;  1I1G A;  3CC2 I;  4NUB A;  4IOC F;  2HOT A;  3FXU A;  4XLH A;  1R1V A;  3K6G A;  2PI0 A;  2ZXI A;  2HR3 A;  3D5R C;  1EH7 A;  2NXN B;  3K4N A;  3GWZ A;  3J7Y J;  1O57 A;  1ON2 A;  5C3E J;  3JRG A;  1S5L C;  3GTJ J;  5LEJ A;  3C3W A;  4B3X A;  2KKO A;  5EG0 A;  1ZLK A;  3G1L A;  2LSO A;  3GX4 X;  5TGT A;  2CGP A;  2ICW G;  4UY8 I;  1RR8 C;  1P92 A;  3HBL A;  4IHY A;  2VOO A;  5FLX K;  1DQU A;  3FBN B;  1VQO I;  1ZN2 A;  4BXX J;  1AKH B;  3ECH A;  2ECC A;  2HZT A;  1X1B A;  1MJA A;  4JQF A;  2KDO A;  5DUI A;  4DZJ A;  3CJQ B;  4XLE A;  3LA3 A;  1YS6 A;  2AS5 F;  2Y48 A;  3AAF A;  1KQ0 A;  2ZFW A;  2ID3 A;  1U9O A;  3KLN A;  2FML A;  4MLO A;  3RQ4 A;  2R5Z B;  4RGS A;  1STZ A;  3J7Z I;  1WH5 A;  2XF7 A;  2CS3 A;  3K4M A;  2W85 A;  2MGQ A;  3M07 A;  1KZH A;  3T8R A;  2HEO A;  4XOR A;  3OV8 A;  1NHA A;  5LGU A;  1LKX A;  2J5O A;  2CQN A;  3WGH A;  4UVA A;  3RJP A;  1FTZ A;  3V7C A;  1I50 J;  2EFN A;  3CMM A;  1TC3 C;  4LLL A;  2V79 A;  4O6J A;  1U2W A;  2VJ4 A;  2H1L A;  2YPR A;  3GTM J;  3KZY A;  5KCM A;  1MBK A;  1XGO A;  1POG A;  3HIF A;  5IP9 J;  2K4B A;  2P7V B;  4BUP A;  1QO0 D;  4HDV A;  3MN2 A;  1IF1 A;  3ZMS A;  2HDW A;  4HF0 A;  2W7N A;  3ABU A;  2VJ5 A;  2ESH A;  1XX5 A;  2EIK H;  5J40 A;  3UKG A;  3WU1 B;  4D0P A;  3OYH A;  2XRL A;  3HSR A;  4A3M J;  1YS7 A;  5GAE J;  5IY5 H;  5E3M A;  2IW5 A;  3OYD A;  4XRF A;  3OYI A;  3FZV A;  2XAF A;  2H27 A;  1HBX G;  3HOW J;  1OJL A;  1JGS A;  4HRI A;  1RI7 A;  1SEU A;  4BL0 B;  2F2E A;  1SAX A;  3COA C;  3ZMU A;  2DA7 A;  4E7Z A;  3SFZ A;  1X19 A;  2QKM B;  2BVM A;  1M1E B;  1W7P A;  2LKP A;  2HDC A;  2XGX A;  5GPA A;  4LK0 F;  4MGR A;  4BY7 J;  1YW9 A;  5LGT A;  1YRN A;  3SZG A;  4PGH A;  1SVM A;  4KIS A;  3DKX A;  4DGW B;  1B6A A;  2FE3 A;  3JRA A;  4IOA F;  3EYY A;  2VLA A;  1K61 A;  4AIK A;  1G3Y A;  1MIJ A;  3CP8 A;  3RYP A;  1IO2 A;  2AXT C;  5DEQ A;  1HF0 A;  4BYY A;  2HNH A;  1J59 A;  1TQI A;  1A6Q A;  1IV6 A;  5BPD A;  3ERE D;  2R7Q A;  2STT A;  5CPR B;  4YG2 F;  1OR7 A;  4Y17 A;  4MTD A;  4UVB A;  3O3K A;  4F93 B;  3D5L A;  1USS A;  1JT0 A;  5HDG A;  3WTS C;  2F5V A;  4HYE A;  3ZGK A;  5HLI A;  5M3F J;  3JR9 A;  5KAI C;  2K5C A;  2LLK A;  2X0L A;  3GZ5 A;  4GDF A;  3OMY A;  4ESJ A;  3BC8 A;  1BM9 A;  2RC4 A;  4XID A;  2JVH A;  2V26 A;  3NWT A;  5L3C A;  2FA5 A;  3TOA A;  5F0C A;  4UUT A;  4U7B A;  1I6H J;  2QQ8 A;  2JMW A;  2M8G X;  2WY7 Q;  1JUP A;  2CG4 A;  1NK2 P;  2R7Z J;  1B59 A;  1ETQ A;  3ZCO A;  2EFO A;  1Q1V A;  3ASO H;  3BR5 A;  3HB9 A;  3H92 A;  1T2K A;  3JW4 A;  3S15 J;  1IN6 A;  2OF7 A;  1Y1W J;  3GME A;  4UNO A;  4EV0 A;  2ELJ A;  1XMA A;  2R5Y A;  2LRE A;  2V6C A;  4XKV A;  2HPM A;  3HL2 A;  1BI3 A;  1B9N A;  1YO5 C;  2UZK A;  4Q4Z F;  5ERI A;  1UHS A;  2MC4 A;  3BTI A;  2BY2 A;  2QCO A;  4IEJ A;  1BR1 A;  3A0H C;  1XPX A;  1CGP A;  3I56 I;  1O3Q A;  2HVQ A;  1O3R A;  1BJA A;  3E0J B;  5EEA A;  1YIO A;  3QOP A;  4LG3 A;  4EVI A;  3S3N A;  1KYZ A;  5CQG A;  2BV6 A;  4N9I A;  4A0Z A;  2P0W A;  3OYF A;  4C2U A;  2Y69 H;  1V5E A;  3TOB A;  4DYR A;  3T0Y A;  2Y0S N;  1PUF A;  2FSW A;  1TWG J;  1UMQ A;  2M0M A;  1UHW A;  2UV1 A;  4KJZ A;  2CUJ A;  3K1M A;  2JSC A;  1XSV A;  2O9L A;  3SJM A;  3CLQ A;  2ACJ A;  1TQM A;  2Y9Y A;  3ABL H;  3MCZ A;  3QU3 A;  3G73 A;  4M3F A;  3E7L A;  2H09 A;  3J7A O;  4IL6 C;  2YU3 A;  3DPT A;  3HTU A;  3QPL A;  2XUB A;  1S9H A;  1S7E A;  2E1M B;  1GVJ A;  3CCY A;  1G8X A;  1VQ5 I;  2K9M A;  3IP4 B;  3Q3S A;  2E5Z A;  4PJN A;  4MTE A;  1HW5 A;  1K78 A;  1APL C;  1R58 A;  4WXD A;  5D4R A;  2Z99 A;  2GBY A;  5AON A;  5D8L B;  3P9C A;  2BEO A;  4PJ0 C;  1FEX A;  2DOE A;  2M0C A;  1R1T A;  1VQ8 I;  2A69 F;  1Z21 A;  2RNG A;  2GZW A;  5HDN A;  1ZRE A;  1CF7 B;  2XAH A;  2R0Q C;  1X3U A;  3OYG A;  4M73 A;  1WJC A;  5E20 A;  3BQZ A;  1FJL A;  3K4L A;  4OWR B;  4IHT A;  3FKJ A;  2CW8 A;  2VKV A;  1FX7 A;  1U8R A;  3FXM A;  4MFD A;  4BDZ A;  2Z5U A;  1E0E A;  1FC3 A;  3FXJ A;  4HF1 A;  3ZOB A;  3HGY A;  3L1P A;  2VB6 A;  3GBG A;  1WPK A;  4XMY A;  2IPQ X;  4IHW A;  3G71 I;  4GO1 A;  3OIO A;  2EZL A;  5DCM B;  2D2W A;  4D5C A;  2KRH A;  4QPQ A;  1PP7 U;  1ETY A;  2KIF A;  4HDU A;  3CUQ A;  1ORK A;  2HFH A;  4CCN A;  2FQ4 A;  1JHH A;  2ZC2 A;  5J1U A;  3UNG C;  2WC2 A;  3HOZ J;  3GCM A;  1FY7 A;  5E1Z B;  3JRF A;  2QZ8 A;  4KIF A;  2EFQ A;  3OYB A;  4G6D A;  2A6H F;  2CQQ A;  4XSZ F;  2VQG A;  1QU3 A;  4II3 A;  4XKC A;  5KK1 A;  2NYX A;  3HDD A;  4BGD A;  1X4O A;  3K9T A;  1R00 A;  1OQY A;  4AVZ A;  4YFX F;  4PFP A;  3H5N A;  3HXL A;  3DBL B;  4DQ2 A;  2OCE A;  2XKO A;  5HLG A;  3WTZ A;  2DTR A;  2H6B A;  5GTH C;  2TDX A;  1XSD A;  4UXN A;  2IGO A;  1WZ2 A;  3S16 J;  1EF4 A;  3DLA A;  2JRT A;  4CGZ A;  4AIH A;  1VQK I;  1K4S A;  1BW5 A;  2VT3 A;  2M9H A;  3LSH A;  3M8J A;  3W6J B;  3QAH A;  2R5Z A;  1ZQ3 P;  3ZQQ A;  2GQQ A;  2VKH A;  3HRS A;  1FYL A;  2LYC A;  3F9K A;  1YFH A;  1QZE A;  3OS0 A;  3CTA A;  2OV7 A;  1SFK A;  1T33 A;  1SD6 A;  1TTY A;  1XMK A;  2F5F A;  3DTK A;  3PNY A;  3QP6 A;  4EMS A;  3MKW B;  3JRB A;  3WOD F;  4GRI A;  1P7I A;  1U9N A;  3RPU D;  1Z1D A;  1MDM A;  5CVJ A;  3G4S I;  5E79 C;  3OYM A;  2DMN A;  3M8E A;  4AWX B;  5FRM A;  1IGN A;  3CCM I;  1PDN C;  2QEN A;  2UXN A;  4YFK F;  2DA3 A;  2HYJ A;  3CDI A;  2F48 A;  3H5R A;  4RAF A;  2A5W A;  4UV8 A;  4AU7 A;  2DXI A;  3I4M J;  2CO5 A;  1XDU A;  1X4P A;  2DOF A;  4RB0 A;  4BU2 A;  5DM6 F;  1I5Z A;  1T95 A;  1RPW A;  2HTS A;  5IP7 J;  5J4V A;  3KCC A;  4DNC A;  2FD5 A;  2FOK A;  4ZH4 F;  3KP7 A;  1XGN A;  1KA8 A;  1XG1 A;  4P9U A;  1YW7 A;  4FIS A;  1LNW A;  2L2O A;  2DQL A;  2LFB A;  2F4I A;  1J2X A;  4AUX A;  3H36 A;  2BVL A;  4DYC A;  1MBE A;  3HOX J;  5HVQ C;  4MNU A;  4A3E J;  2R3S A;  3CUQ C;  2JWT A;  4G9Y A;  4CH7 A;  4L0Z B;  2GWR A;  1XTA A;  3LSG A;  1VND A;  2BW3 A;  2DN0 A;  4BS9 A;  4NHJ A;  3E5Q A;  3TGN A;  1QVT A;  3GLX A;  1BJZ A;  2YX7 A;  3IC7 A;  2CJJ A;  3WG7 H;  2KMU A;  1RKW A;  2L4A A;  1IV8 A;  4E7I A;  4R8H A;  1GHC A;  1TP4 A;  3V42 A;  1H0M A;  3EQL F;  2Y9Z A;  2VT2 A;  3VDX A;  4LLN A;  2L4M A;  5TJJ A;  1D3Y A;  1VQP I;  5EF6 A;  2ID6 A;  5FLX Z;  2ETH A;  2DFE A;  1FSE A;  1GLN A;  4Y7N J;  2FUG 2;  4CCM A;  1VFC A;  5E17 F;  3OYE A;  3F72 A;  1KGS A;  2IA2 A;  4HBL A;  2IS6 A;  1SVO A;  4IF4 A;  4PUS A;  1G6N A;  4A3D J;  4A0X A;  2Q2E B;  3BPV A;  1E3O C;  2STW A;  4IHX A;  2OBP A;  3GVA A;  3BTC A;  2X85 A;  5E8G A;  4GCV A;  3R61 A;  4LB6 B;  4EGZ A;  1FOX A;  1T0F C;  4B4C A;  1U3E M;  5BPI A;  4XKB A;  2O0Y A;  4IVN A;  4KMF A;  4LB5 A;  3LL7 A;  1X1P A;  3ZR8 X;  4XON A;  1XB4 A;  2FNP A;  5KAF C;  3A01 B;  3IV5 A;  4BQN A;  1RUO A;  1R36 A;  1HKQ A;  1MD0 A;  3TDZ C;  2KHM A;  1R9T J;  2DDA A;  3KP2 A;  1RET A;  2W24 A;  2CRG A;  3I64 A;  2K3F A;  5FRO A;  3J80 Z;  1ZHF A;  2PMU A;  3MEX A;  3LAP A;  3MMY B;  3HPG A;  4ESB A;  3I58 A;  2IT0 A;  3ULQ B;  2L0K A;  5HOD A;  3TQN A;  3RKY A;  1RRJ A;  2Z2S B;  1QZZ A;  1F9N A;  1U5T A;  5C4J J;  1JUS A;  4E7K A;  3BOQ A;  4OMZ A;  4EJT A;  1VQ7 I;  2EA2 A;  4CCJ A;  5EG0 B;  1DUX C;  1JTX A;  1FOW A;  3KP5 A;  5CKT A;  5IYD J;  2ZJQ F;  4E7H A;  2EIL H;  4UB6 C;  1HQC A;  5LHG A;  3HSE A;  4PK4 A;  1BOB A;  3FMQ A;  5HNH A;  1VQN I;  3RYR A;  1DPU A;  1MMA A;  2BW3 B;  3BR0 A;  2PFB A;  2MD5 A;  4HV5 A;  1BR4 A;  4RAY A;  5IYC J;  2Y30 A;  2Q1Z B;  1QHH D;  2V9V A;  2ZNZ A;  3BP8 A;  4BH9 A;  1Y0U A;  4WK8 F;  2JQ7 A;  4JOM A;  5IPA A;  5EGO B;  3QPT A;  1BC8 C;  1D0Z A;  3ABM H;  4HQE A;  3PUF A;  4MO7 A;  1ETX A;  2LRD A;  1RES A;  3V8L A;  3BTJ A;  2VJI A;  4Y15 A;  3KEQ A;  1JKR C;  1B8I B;  3HUG B;  3NQO A;  3KEO A;  3LNQ A;  1DGW Y;  4C3H J;  2P6S A;  4WXC A;  3G3Z A;  2E5N A;  3CP2 A;  4B09 A;  3F8F A;  3KEY A;  2EH3 A;  2KL4 A;  4KDP A;  3RCO A;  2GLO A;  2M5W A;  1FYK A;  4B8X A;  2VAS A;  2VI6 A;  1NG6 A;  3S3O A;  3C2G A;  4C30 A;  4M9X A;  2Q2E A;  2JA8 J;  2IRF G;  4HX7 A;  3CCJ I;  3FM3 A;  2VKE A;  3QOE A;  4UB8 C;  5M3M J;  4C3I J;  1XC5 A;  2XIG A;  4CCO A;  3MZH A;  1BL0 A;  4BQO A;  2QLZ A;  5D6F A;  5E1X A;  1MBH A;  5LRR A;  3JRE A;  3CCE I;  1QHG A;  5FD5 A;  3GFL A;  1RKT A;  1UAA A;  1WJB A;  3RZD J;  4KIT B;  4J19 A;  3HM5 A;  1LUJ B;  1GDT A;  4L9N A;  4UUS A;  3ZQH A;  1YX5 A;  1ZK8 A;  1MBF A;  4ABZ A;  4V2G A;  2ELH A;  2M45 A;  3MZ8 A;  3K0L A;  2F6C A;  4CZZ A;  5ILU A;  3S3M A;  4D7M A;  1LDK B;  5LHH A;  2EFP A;  4ZYA A;  3R0A A;  5ILS A;  1IJW C;  4IQJ A;  4HNU A;  4XR6 A;  2HYF A;  5EYR A;  3H35 A;  3FXL A;  3M9A A;  1ZG5 A;  2JSP A;  3S32 A;  2V6E A;  3V8K A;  1P4A A;  4JK1 X;  3LA7 A;  2RRE A;  1WGX A;  1G3S A;  1J9I A;  5JFR A;  2CUE A;  2DT7 B;  2QGU A;  4FX0 A;  3QWL A;  3K4B A;  2W1O A;  2HXO A;  1YW8 A;  1X3Z B;  1QZY A;  2MYS A;  2WY8 Q;  3HEF A;  6PAX A;  1JI8 A;  2NVU B;  5ICF A;  3K69 A;  3BG3 A;  1IN5 A;  1FBS A;  5DD4 A;  4B43 A;  2YS9 A;  4M72 A;  1Y6I A;  1ZAO A;  3CDH A;  2ZME C;  3M7G A;  3ZN1 A;  3F6V A;  3PO2 J;  2DU9 A;  1WH7 A;  2L7K A;  3KIO A;  2XAJ A;  5LBQ A;  4XOT A;  1MDM B;  3BZC A;  3S1M J;  3O8G A;  1D0X A;  3WGI A;  3MVP A;  1TW3 A;  1DU6 A;  4HOB A;  5LD2 C;  3H9G A;  3MD2 A;  1SAN A;  3DTE A;  3U21 A;  3CES A;  2DFI A;  1IN8 A;  2E1N A;  3RPU A;  3T8T A;  1WJE A;  3ZQG A;  2V4J C;  2DJN A;  5LEK A;  5L3D A;  2CUZ A;  2O03 A;  3S1R J;  3X2Q H;  3GTG J;  1NG7 A;  4NQW B;  5CVR A;  5KHD A;  1UEL B;  2WV1 A;  4UUS B;  1ERD A;  1S3J A;  5E1W A;  2Y75 A;  2AXL A;  1J09 A;  5J8C A;  1IUY A;  1D1C A;  2EJR A;  5FGM A;  2V1D A;  5K7F A;  2Z3Y A;  2COM A;  3K70 C;  1A5J A;  3E5U A;  4KIB A;  2A6E F;  2E2J J;  2VBZ A;  2VXD A;  1ODD A;  1OMI A;  2IVM A;  3PL8 A;  2MH2 A;  3MQ0 A;  3IH2 A;  4OMY A;  4ANJ A;  4Z6Y A;  4U87 A;  2ZME A;  2QSG X;  1BIA A;  2K85 A;  2MLG A;  2DOD A;  5BNG A;  3WTX C;  2GA2 A;  2DYR H;  3O6B B;  2Z33 A;  2KT0 A;  1BIB A;  4OAZ A;  2I10 A;  2L02 A;  4RM2 A;  3BCB A;  5F0H A;  2ME6 A;  3JAM K;  1IN7 A;  1RZ4 A;  5JHF A;  1VQ4 I;  4G94 A;  2XDV A;  3QYE A;  2W25 A;  4WXH A;  4DYQ A;  1WI9 A;  3BG7 A;  4PJM A;  2H8R A;  1S72 I;  2OAZ A;  2E1O A;  5ICE A;  1QRY A;  1PUE E;  1MGT A;  4FT8 A;  2F5E A;  1H8A C;  4W97 A;  1XD7 A;  1B72 A;  1JJ8 C;  5F04 A;  2NVY J;  1FNN A;  1IC8 A;  4M9S A;  3EUA A;  5LRS A;  5D5U B;  5FLM J;  1IDY A;  3BT9 A;  4OU0 A;  4YFN F;  1CF7 A;  1HDP A;  3FHN A;  2RGV A;  3BTL A;  2B63 J;  2O8K A;  2DA2 A;  3K2A A;  2FJ1 A;  2DMQ A;  4A6D A;  4BXF A;  2NAZ A;  3BY6 A;  2TRT A;  1R49 A;  1DP3 A;  4A3J J;  1HA8 A;  5DDG A;  3IWZ A;  1Z3X A;  1FP2 A;  2XGD A;  4FET A;  3FHZ A;  2O61 A;  2ISY A;  3U1D A;  1LDD A;  4FE7 A;  3SQN A;  2O5R A;  1WCM J;  3CJN A;  4BHC A;  2GAU A;  4Q48 A;  4BAC A;  4HNV A;  1S7A A;  5DCM A;  1F36 A;  4FHT A;  1MSF C;  1KU9 A;  2FBK A;  4I6Z A;  2JVG A;  5DV5 A;  2ZNY A;  1FOY A;  1VQ6 I;  2XV4 S;  1TLH B;  4XRS G;  2HXI A;  3EDP A;  3V8J A;  3R60 A;  3SDG A;  1BC7 C;  1P4W A;  3NRV A;  2VPL A;  1LVA A;  4ETS A;  4EM2 A;  4XNF A;  3J81 Z;  2CV2 A;  1WJF A;  4D9J A;  3M3Y J;  1BBY A;  2E1M C;  2ZME B;  1G3W A;  2CQ7 A;  4NBQ A;  1OFC X;  2EIM H;  1Y8R B;  3DXJ F;  3FIS A;  1U0J A;  1IG7 A;  4YEJ A;  1TQP A;  3MZY A;  4A69 C;  2EWN A;  4ZYH A;  5GPC A;  1Z05 A;  1QA6 A;  1XN7 A;  3ZQ7 A;  2XVC A;  3LA2 A;  4ZZL A;  1W0U A;  1ZLJ A;  4CIC A;  2LG4 A;  5F27 A;  1R22 A;  2ZJ2 A;  4CCK A;  1PVE A;  1EJ9 A;  3ZQL A;  1D5Y A;  4D5F A;  2EPF A;  4PGG A;  3QRF F;  4CO8 A;  4EJU A;  2KIS A;  3FM5 A;  2CH0 A;  2WAF A;  2X6W A;  1B8I A;  1REP C;  4E70 A;  1AU7 A;  2XPU A;  4AC0 A;  2B9S A;  3KP6 A;  3WGG A;  1X58 A;  4IRI A;  3ZMT A;  2EV5 A;  3H0G J;  2A6T A;  2R7O A;  1IRG A;  4R79 A;  4CA0 A;  1ZAR A;  1TNS A;  4LD5 A;  4PFO A;  3EUH C;  5DCF A;  1Y39 A;  2IXS A;  2EBI A;  3GTK J;  2P5K A;  3PUB A;  4IJA A;  4AM3 A;  5LFA A;  4L5I A;  4IQ4 A;  1IN4 A;  2NS8 A;  3I0T A;  5HS9 A;  5K7Z A;  1LFB A;  2QUF A;  2PJP A;  1KQ9 A;  2ZXW H;  2QBY B;  3LSR A;  1BN5 A;  4XRS A;  1TWH J;  3OWT A;  1WHU A;  1Z7U A;  1Z77 A;  2FQ3 A;  5D6E A;  1EH8 A;  1Y56 A;  4K2E A;  2E71 A;  1ZG1 A;  4RAZ A;  3BQY A;  3F8M A;  4BAY A;  4F55 A;  2Y0M A;  4IXA A;  4U0V A;  1YHQ I;  1MNM C;  3JCU C;  2BXY A;  4KMU X;  2BY0 A;  4KNY A;  5M5Y J;  1RNL A;  3K4J A;  3LSJ A;  2JRM A;  3FF5 A;  2LF8 A;  2X1D A;  2J5P A;  3DEE A;  3GZN B;  4EJO A;  3PSF A;  1WWX A;  2QQ9 A;  3M1C A;  4L5E A;  1TT0 A;  1SFE A;  3S17 J;  3PNT A;  2RNJ A;  2M1B A;  3D5S C;  3B02 A;  2CU7 A;  2ZJP F;  3DLL F;  2BGC A;  5DUK A;  2DA5 A;  2K02 A;  4TV7 A;  4M3B A;  3FXO A;  3KZZ A;  1CQT A;  1W7P D;  4UHT A;  3E1S A;  3VOE A;  5L3E A;  3IRR A;  4CHU A;  3PIP F;  3GFM A;  2FXA A;  1TWA J;  2RVC A;  1PP8 F;  2OQR A;  3BLY A;  2I5U A;  2O8X A;  4MFE A;  3Q9S A;  2WAQ N;  2OTJ I;  3FWE A;  1K78 B;  4RBO A;  4MQ9 F;  3I53 A;  4GFB A;  4BE1 A;  4JX5 A;  2H8W A;  2IGM A;  3F8N A;  3KFW X;  3IH4 A;  3JRC A;  3L2V A;  1T8I A;  3HOV J;  3J81 K;  2E36 A;  3K7A J;  1JKQ C;  4LIU A;  3H1C A;  2X4H A;  4UVC A;  3OYK A;  2PJR A;  1ITY A;  4G12 A;  4BXU A;  5B66 C;  2RN7 A;  1FMW A;  3ZQF A;  5IT9 K;  4OIR F;  4HZF A;  5IP6 A;  1GV5 A;  3P9K A;  1OLT A;  3CO6 C;  1WI3 A;  1TZL A;  3WTW C;  2L5Q A;  2HOE A;  2QBY A;  1HW1 A;  3VPR A;  2ZB9 A;  3RKX A;  1Z6T A;  1VQL I;  3DWL E;  2L9R A;  2VBY A;  2LC2 A;  3W2W A;  1FYM A;  4NQW A;  3H9J A;  4HLX A;  5JVT A;  3I55 I;  3CUQ B;  3O2P E;  2Y0S A;  3CJT B;  2MA3 A;  3KLO A;  3ZQI A;  4BJ6 C;  2XRO A;  4I0A A;  3VEP A;  2KRF A;  1I3A A;  1U5T B;  4L9J A;  2Z16 A;  3I3L A;  2W4S A;  2WAE A;  3VYT B;  3CMY A;  2V1N A;  1R6R A;  1H89 C;  1BI2 A;  1HKS A;  2XAS A;  2VON A;  4MQV A;  4P55 A;  1QGP A;  1DU0 A;  3DKW A;  5FKK A;  3QPH A;  2JUG A;  2HS5 A;  3E6M A;  1VQM I;  2QVO A;  5K5O A;  2XSD C;  4ZZD A;  3V7S A;  3HZJ A;  2LKX A;  4PSX A;  1X3W B;  3ESW B;  3KX2 A;  4PJL A;  3HOY J;  1D8J A;  5TRD A;  2LOO A;  2QQB A;  1AWC A;  1F5T A;  5FFZ A;  2IP2 A;  4P5O A;  5E3O A;  3OY9 A;  2HWV A;  3W6K B;  3S1N J;  3DQV C;  3PQJ A;  2VN2 A;  2P6T A;  5AIQ A;  3L2C A;  2PX9 A;  4E7L A;  1IZ1 A;  1TL8 A;  1B72 B;  1LEB A;  3LQR A;  2LY2 A;  4ENM A;  4Y33 A;  2VE9 A;  2E7X A;  1MJ9 A;  2V9K A;  1H88 C;  1BI0 A;  2L9V A;  3PO3 J;  1EV7 A;  2ESN A;  3CC4 I;  2M3A A;  2TCT A;  2YX4 A;  2OA4 A;  1TT5 B;  2DOA A;  3WHB A;  1HSJ A;  3AKZ A;  3JRI A;  3DPU A;  3F6O A;  1GVD A;  4XIC A;  4BDY A;  3BZ6 A;  3RZO J;  3VYS B;  1P6R A;  3IAS 2;  1IRZ A;  4Q47 A;  1G2H A;  3TP0 A;  3GTO J;  3MKL A;  1BI1 A;  2R4G A;  1ZRC A;  1MMN A;  3HRM A;  5DS9 A;  1JKP C;  2XSJ C;  2ZSH B;  3AG1 H;  4HF2 A;  3GTL J;  2DLL A;  1OCR H;  1LFU P;  3I5U A;  1MBJ A;  1WJ5 A;  2QKL B;  2VJJ A;  3LAJ A;  4EEF G;  3BR6 A;  5AIP A;  3TED A;  1K4T A;  2JPB A;  3HC7 A;  1N75 A;  2CWE A;  4ENK A;  2EK5 A;  2HI3 A;  3OYN A;  2G7U A;  3M4O J;  4RB1 A;  4GYG A;  1V3F A;  2I8D A;  3TMO A;  2VPR A;  3P9I A;  4NB5 A;  3V4G A;  1YYV A;  2AQF A;  2O6G E;  4FE4 A;  3WG9 A;  4RDU A;  1OCT C;  4J01 A;  1QPI A;  3CF5 F;  2WWY A;  2BZT A;  2WB1 A;  2CQX A;  4V2F A;  5JI6 A;  4ZTF A;  2H1K A;  2R7S A;  5ED4 A;  4HLY A;  1KU2 A;  3MKY B;  1FWZ A;  3BCA A;  4BBR J;  1I1S A;  1DGR M;  3CF2 A;  4Y4R A;  3A2K A;  2DMU A;  2MFZ A;  4EGY A;  5FLV A;  3S2W A;  1DP7 P;  2UUZ A;  3K4C A;  1A36 A;  1OIS A;  2HKX A;  1O3S A;  1L0O C;  4JYK A;  5DYM A;  2LF7 A;  1YOV B;  1MMG A;  2KLO A;  2W00 A;  2ZJR F;  3L2U A;  2M34 A;  2VKD A;  3LST A;  4XK4 A;  5H6Q A;  5ILV A;  1F1Z A;  4A3F J;  4FTH A;  3H5A A;  1ON1 A;  2PG4 A;  2R93 J;  3B73 A;  4MEX F;  5HLH A;  1LE8 A;  4IZZ A;  2LBF A;  2A05 A;  1X2M A;  1ETK A;  1YIT I;  3H3Z A;  4HW0 A;  1OCC H;  2XRN A;  5K5Q A;  3D0S A;  2NNN A;  3LOC A;  5BQT A;  1Z0X A;  5F0F A;  3S14 J;  3H9Q A;  4HAM A;  5FO5 A;  4M3E A;  1ZYR F;  2IA0 A;  3L09 A;  1XMX A;  4RS8 A;  2FBH A;  4LMY A;  2AQE A;  5CJ9 A;  1HC8 A;  4KYW A;  1RIO H;  1S8N A;  4BQA A;  1E3H A;  1IXS B;  2IS4 A;  3OSG A;  3W6V A;  2ZKZ A;  2XF5 A;  2HTJ A;  3ELK A;  3HOS A;  2JA5 J;  1NK3 P;  3R4K A;  1OR7 C;  2R7T A;  1FIP A;  4AID A;  3RIR A;  4L9T A;  1HCR A;  5F1J A;  4IX7 A;  1A04 A;  2ZO4 A;  4GYI A;  1DPR A;  2BXZ A;  3KYC B;  2DA1 A;  3CCR I;  3MWM A;  1IXR C;  4BKX A;  4HG2 A;  3H0D A;  3I71 A;  2M2E A;  4D7N A;  1BA5 A;  2P5V A;  3DU6 A;  5GP9 A;  2GIZ A;  2W84 A;  5IYB J;  2AHQ A;  3BG5 A;  5F6F A;  2IJL A;  1RR7 A;  3OYL A;  1LVK A;  1W5S A;  1P7J A;  2FU4 A;  3CCQ I;  1WRJ A;  4A93 J;  3ZQC A;  4RAG A;  2EA4 A;  3E97 A;  4PJJ A;  4MHG A;  3MKZ A;  4ZDP A;  3KP4 A;  3LSI A;  3OOU A;  4WF2 A;  1ULY A;  3JTG A;  1MSE C;  2HVS A;  2EV6 A;  3BR3 A;  3OOP A;  2QSH X;  4CZC A;  2O7O A;  2XAU A;  2WBM A;  1R1U A;  4ESF A;  4QPO A;  3TW7 A;  4A6E A;  4F52 A;  4RM3 A;  4L18 B;  3DPL C;  3Q9V A;  3CJR B;  3WTT C;  2ELK A;  1YTY A;  1PJR A;  1V54 H;  2ME0 A;  1G4D A;  5EGO A;  2E1C A;  1MND A;  1ETW A;  4KT5 C;  1WKM A;  3WTY C;  2FMY A;  5FFX A;  1XDS A;  2ADU A;  2L54 A;  4I2O A;  2QYO A;  3O8H A;  3E6D A;  4XL9 A;  2BOL A;  3HUG A;  5EEH A;  1LE8 B;  2D1H A;  3HHG A;  4PZJ A;  2IA1 A;  2F5D A;  2ZCW A;  3Q0V A;  4HQM A;  1F43 A;  4AVP A;  3BR1 A;  2HQA A;  2FOW A;  3CQZ J;  2LMD A;  2OQG A;  2Q0O A;  4HV6 A;  3SFI A;  2GIV A;  2K9S A;  3TDU C;  5CLS A;  2HYG D;  4P96 A;  2BBY A;  2A07 F;  2CFO A;  3ZN0 A;  4C3J J;  1MH3 A;  4DIQ A;  4ASN A;  3FMR A;  2NNY A;  2CUF A;  2PMH A;  3IRQ A;  2X48 A;  3VYU B;  2XAG A;  2IGN A;  3G6E I;  1O7F A;  5L3F A;  4QSH A;  3E6C C;  3FXK A;  3PNV A;  3K1N A;  1EH6 A;  3LSP A;  2R7X A;  5GAH J;  2LD5 A;  5EZH A;  2G0E A;  1K6Y A;  4IHV A;  2R92 J;  3BWG A;  1YIJ I;  1IRF A;  2V9P A;  2CSO A;  2YUS A;  1XS9 A;  1SD4 A;  4XM3 A;  2B0L A;  1VQ9 I;  4ENJ A;  1GUU A;  5C4X J;  5DM7 F;  3IKT A;  2YU9 J;  4M3D A;  5TIS C;  1Z67 A;  4DJA A;  2IS1 A;  1XGM A;  1XSX A;  2CW0 F;  3CZ6 A;  2E7W A;  3FKI J;  3AL0 C;  2DPD A;  2COB A;  2X6X A;  1UCR A;  2OZ6 A;  5FKN A;  4EAT A;  4FX4 A;  2JTV A;  4YIF A;  4JBA A;  1YJW I;  1TWF J;  1D1A A;  3N97 A;  1JUM A;  3P7N A;  4HSR A;  3CCV I;  2PLY A;  4O3M A;  1Z3Y A;  5EZG A;  3S8P A;  3SXY A;  5K7H A;  3QOD A;  2VQC A;  4AYB A;  4BEH A;  1I6X A;  1X1D A;  1AOY A;  4IHS A;  3GO5 A;  2OJE D;  2L9S A;  4LG0 A;  5FB2 A;  2EZI A;  2MH9 A;  2DT5 A;  2V1U A;  2DMT A;  3AG2 H;  3HSF A;  2OUM A;  4BJT A;  2JN6 A;  3EPZ A;  2A3S A;  2VUM J;  2QM3 A;  4RMN A;  3DU5 A;  1FIA A;  2UXX A; 
#chains in the Genus database with same CATH homology
 3ERM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...