3HDDA

Engrailed homeodomain dna complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
55
structure length
55
Chain Sequence
RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*TP*AP*CP*CP*
publication title Engrailed homeodomain-DNA complex at 2.2 A resolution: a detailed view of the interface and comparison with other engrailed structures.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 19
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hddA00
3LSJA 5FLVA 3H3VK 2XPUA 3A03A 1ZGWA 1MBHA 3PO3J 3H0GJ 3F0CA 1Z77A 3GTOJ 3BR3A 4IHWA 1Z0XA 5DS9A 3CDLA 1G2HA 3A02A 2QCOA 4BBRJ 2O8KA 1QVUA 4DYCA 2VKEA 3LSRA 2LR8A 2XB0X 2CUEA 1MBJA 2CUFA 2R5YB 2WV1A 3BTIA 3RKQA 3IH4A 2EZKA 3GBGA 3S1RJ 4BXXJ 1MBEA 5EYRA 4DYQA 4W97A 1JKPC 3HBLA 4MFDA 1AKHA 2ELKA 2NVYJ 3IV5A 1LFBA 2DA7A 3RZDJ 1H88C 4A3BJ 2M8GX 4J19A 2Y9YA 4XRSG 1RKWA 2M0CA 1LE8A 4Y7NJ 4MO7A 2DMQA 2B63J 2Y30A 2Y2ZA 3O8GA 4B4CA 1OCTC 1TWCJ 1TWFJ 2MSYA 4A3GJ 3CQZJ 5FKOA 4C3JJ 5EGOA 3LSGA 1FEXA 3HOZJ 4FISA 4MIMA 3JRFA 1A6IA 2JK3A 1JUSA 3S14J 4I76A 3BR0A 4A93J 1I50J 3HM5A 1I3QJ 2COBA 3MKLA 5FKKA 1MBKA 3PM1A 2XGCA 4AC0A 4M3DA 3K2AA 3I4MJ 5EG0A 4CYCA 3GTJJ 1FTZA 3TEDA 4IHVA 3SJMA 1FJLA 5M5XJ 2YS9A 5GPAA 5J1RA 3GTMJ 1B8IA 1RETA 3QPSA 2FD5A 4XICA 3HEFA 4NDLA 4A69C 1XC5A 2DMUA 2P81A 3DEWA 3GTGJ 4A3IJ 3GTQJ 5E3LA 4DW6A 3TW7A 2M2EA 3BR1A 2X9DA 4UUSB 3MVPA 2K9NA 5EDNA 1UG2A 5DTDA 1R9TJ 2JA7J 4FE4A 4LOCA 5F27A 3QPLA 2CQQA 5FKMA 4QSHA 2IAIA 2Y0SN 2R7ZJ 1JJ6C 1LFUP 2CQXA 2EZIA 1SFOJ 2GBYA 5E3OA 2M9HA 2L7ZA 2DA3A 4M3EA 2DA5A 5EZHA 2VPRA 4C3IJ 2AHQA 1BJZA 4V2FA 2JJ7A 3HOXJ 3O8HA 2HOSA 2ECBA 3OSGA 1HCRA 1ETVA 4A3DJ 1BA5A 5F08A 2EZLA 3NARA 3LSPA 1VFCA 1U9NA 2K9QA 1T56A 2HYJA 4IEJA 3S1NJ 1P7JA 3JRCA 2MGQA 2DMPA 5EF6A 2WAQN 5GP9A 1S7EA 3S2DJ 4A3KJ 5EZGA 1JTXA 3ZQGA 2R5YA 3CMYA 2H8RA 4V2GA 3IH3A 2DMNA 3BTLA 2IBDA 4JP0A 3JRBA 1E3OC 1VF9A 4AYBN 4BBSJ 1WH5A 3S1QJ 2G0EA 3RQIA 3HKZN 3BQZA 5K7FA 3D1NI 1W0TA 2XRLA 3RZOJ 1JUMA 4A3FJ 1PUFB 3S16J 2KDZA 2YU9J 1GVDA 3BTJA 3UKGA 1QRYA 4A3JJ 4W1UA 1B72A 2VKVA 2R92J 1MSFC 1DU6A 2HDDA 2FQ4A 4DZPA 3MN2A 1ZR4A 5FKNA 4QTRA 1OJLA 1U9OA 2R93J 3E7LA 2NVQJ 3GTPJ 1GV5A 1JKQC 2DJNA 2O7OA 5E3MA 3S17J 2FJ1A 5C4JJ 1B72B 2E2JJ 2JMWA 2ID6A 2HOTA 5FJ8J 1K83J 5J1UA 2ME6A 2DMTA 3G1OA 3HOWJ 1ZK8A 5JLXA 3QQAA 2XGDA 1XG1A 4XK4A 5IYBJ 2TRTA 4FE7A 1WCMJ 2NS7A 5K7ZA 3NAUA 2ID3A 2N8GA 2LTPA 1WI3A 2JA6J 2E2IJ 2GLOA 2CJJA 4M3GA 2EZHA 3BR2A 4UUSA 5GPCA 3BG9A 4AUXA 1A5JA 2LK2A 5FLMJ 1APLC 2Y31A 1ETOA 4MLOA 4G12A 1JKRC 5E3NA 1ETKA 3B6CA 3LOCA 3OOUA 2O9LA 3G1LA 1ETQA 1POGA 5J3LA 1AHDP 3JRIA 4QIWN 2DTZA 1BW5A 3HOUJ 3Q0VA 2Y9ZA 9ANTA 3VPRA 1ETYA 1RKTA 1FIPA 4RBOA 1ORKA 3FISA 5F0FA 2XGEA 2AO9A 2XB5A 4L5EA 2HXIA 2L0KA 2JA8J 1I6HJ 3WHCA 1Y1VJ 3SDGA 4X1EA 4IHYA 3HDDA 4D5CA 3JRAA 5J1YA 2LD5A 4JX4A 1MBFA 1DU0A 1IC8A 1WGXA 2K9SA 4EEFG 3BR5A 3S1MJ 1W0UA 4A3LJ 1T33A 2E2HJ 1UMQA 3TP0A 3OSFA 2CRGA 2LKXA 2E1OA 5BNGA 5IYCJ 5F1JA 3S15J 3Q0WA 1OCPA 3WHBA 2R5ZA 2HXOA 4RDUA 5C44J 1ENHA 1VI0A 4IHXA 1F43A 2IEKA 1JUPA 1ZTRA 2LY9A 2L7FP 2MG4A 1U78A 1RESA 1GDTA 1GUUA 2ECCA 2JWTA 1PUFA 1AU7A 1UHSA 1ZQ3P 3ZQFA 4DZJA 2WB1N 1JKOC 3G1MA 2R5ZB 1JT6A 2DA2A 2NVXJ 4JX5A 2LFBA 3ZQHA 3CCYA 4M3FA 3BTCA 2DA4A 2DA6A 4D7MA 1IGNA 5IYDJ 4HNVA 2XPWA 3BG3A 5F0CA 1ZKGA 1K61A 4JX6A 3Q0UA 4Y52J 2L7MP 2HI3A 3HB9A 4C3HJ 3L1PA 1X2NA 1MH4A 2X6OA 2HQ5A 4A3MJ 2D5VA 3FKIJ 2W48A 5HODA 1Y1WJ 3BG5A 1U8BA 1RPWA 3TW6A 1TWHJ 3M3YJ 1JT0A 2OF7A 4FCYA 2YUSA 5JLWA 1WH7A 4M6VA 1H89C 5M5WJ 2DA1A 3K7AJ 2PMZN 2XSDC 1D5YA 2JA5J 2HOAA 5F0HA 5IP6A 2ZB9A 1O4XA 3LNQA 1IV6A 2CU7A 1TWAJ 2EH3A 1IDZA 4I6ZA 1FIAA 2ME0A 2FX0A 5M5YJ 2NS8A 3GTLJ 5K7HA 5IP7J 2DN0A 2VI6A 5F04A 1GV2A 4GFBA 1AKHB 4UUTA 4S0HB 1HDDC 2GM4A 1JGGA 2KT0A 4D5FA 1ZR2A 2L9RA 1X58A 3JR9A 4A3EJ 5IP9J 3HOVJ 1EF4A 2TCTA 3ZOBA 3W6VA 5M3MJ 2K40A 3BT9A 2X48A 4FTHA 2LLKA 3OIOA 5FKLA 3ZQCA 1LE8B 3HOYJ 2LP0A 4JYKA 4B1RA 3GTKJ 1HLVA 2H1KA 1VNDA 2NOGA 1ETWA 1IDYA 4XRMA 1QPIA 1TWGJ 1CQTA 5EGOB 1HOMA 1MNMC 2EBIA 1H8AC 4M3BA 3JREA 3JRDA 4X6AJ 3I4NJ 5C3EJ 3PO2J 3FK6A 2R0QC 2JN6A 3DCFA 2LVSA 4C2MJ 1GT0C 1OFCX 4XIDA 1MBGA 1JTYA 3B6AA 4BY7J 5EG0B 4CYCB 2I10A 2NVTJ 1RR7A 4D7NA 1SANA 5IOZA 1YRNA 1B8IB 1XS9A 3ZQIA 3JRHA 1ITYA 4DYRA 1NK3P 4ABZA 1Q1VA 1X2MA 3M4OJ 4BKXA 3HGYA 1P7IA 3Q3SA 1IJWC 3BQYA 1F36A 5IOYA 4B3AA 1MH3A 1WPKA 5IPAA 3S2HJ 1ETXA 2EQRA 1YRNB 1QVTA 2RAEA 5M3FJ 3FK7A 1IRZA 3A01A 2E19A 4BY1J 2M34A 3TP3A 3C2BA 5EEAA 1BW6A 3BR6A 3JRGA 1BL0A 1IUFA 1IG7A 2VUMJ 5C4XJ 1NK2P 3ZQLA 3HGGA 1HF0A 3SFIA 1JJ8C 3FIWA 3IH2A 2MW8A 2XPVA 1FTTA 4MFEA 2OPTA 1MSEC 4A3CJ 1NTCA 1HDPA 1TC3C 3A01B 2QF7A 4XRSA
chains in the Genus database with same CATH superfamily
4JOMA 5FLVA 3H3VK 2XPUA 3A03A 3PJRA 4GGGA 4KNYA 3WU0A 5CJ9A 4MGRA 3DTEA 1Z0XA 2M3AA 3OYJA 1F1ZA 3CCJI 2PG4A 1AA7A 2A69F 2QCOA 4X0GA 1PP7U 3MKYB 4II3A 2JQ7A 3S2WA 2CUEA 1VQ4I 4LLNA 2K86A 4ZDLA 4FASD 1BJAA 1UCRA 1Y6IA 3RIRA 3ZR8X 2EZKA 4OMZA 2HVSA 4CHUA 1I1GA 2Z99A 1KU7A 4BXXJ 3VFZA 2YU3A 5E1ZB 1K79A 1JKPC 4MFDA 2EK5A 2GXAA 1OCCH 2ELKA 4CH7A 2HZDA 1DGWY 3KZZA 4LB6B 3PFIA 2IPQX 1FY7A 5H20A 3IRRA 1TT5B 4XRSG 3K69A 2RREA 1MDMB 2FRHA 4MO7A 4XM3A 3O8GA 3S93A 4Z6YA 3CQZJ 1TTYA 2RVCA 5EGOA 1VQLI 2D45A 3JRFA 2F48A 2F4OB 3U1KA 2PJRA 3RPQA 2VBWA 4BQAA 2RC4A 1I50J 5DUKA 2COBA 4F55A 1MGTA 4BE1A 3HJEA 3FBNB 4ZDPA 4M3DA 1FC3A 1S7AA 3CCEI 2CV0A 1OPCA 5E79C 2LOOA 3L9FA 3SJMA 3V7RA 5M5XJ 1IN7A 1FJLA 5GPAA 1B8IA 1SFXA 2MH2A 3H5NA 3MKZA 1XC5A 2DXIA 4NBQA 4A3IJ 3I58A 4CA0A 4ON0A 2HU9A 5B3SH 4CXFA 4RMNA 4E70A 1IXSB 2F2EA 2W82A 2EJRA 4XLAA 4UNOA 2Z2SB 4WWCA 1Y0NA 5FKMA 4QSHA 1LDDA 2Y0SN 1JJ6C 1R7JA 2NNNA 3M7GA 2R7OA 3DKXA 3HC7A 4HX7A 4OIQF 1SVOA 1SFOJ 4BDZA 2ZKZA 1YIJI 3SDBA 4L9VA 1CF7B 2UV1A 4EJWA 5EZHA 1V54H 2IW5A 2AHQA 1BJZA 4B48A 3IWZA 3RDIA 2VXDA 4V2FA 4DIQA 3HRUA 2EFQA 3K1NA 5HOOA 1WJFA 2KFDA 2DYRH 3L2CA 4A3DJ 1L3LA 5F08A 2QLZA 1R36A 2EZLA 1VFCA 2K9QA 1SC7A 1T56A 2GIZA 4IEJA 1P7JA 2K85A 3FHNA 3CUOA 4RAGA 2M30A 3QODA 3QAHA 4L9TA 2Y0MA 3IRQA 4MEYF 1BR1A 4A3KJ 2P7VB 2E1NA 2CW8A 1R5GA 3R0AA 3CMYA 1HA8A 2UWMA 3IH3A 2KLOA 2IBDA 4KYWA 2DDBA 3KP4A 5E8IA 1W7PB 3K1PA 1E3OC 1XTAA 2V1NA 3P9CA 4NHJA 1WH5A 1LVKA 4O6JA 3SEZA 2ELHA 4XMYA 4RB1A 2K02A 4CCJA 5L3EA 3ELKA 4Q4ZF 1W0TA 3LQQA 2XRLA 3IL2A 3RZOJ 5F64A 1W4MA 4UUVA 3F9KA 2EPFA 3PFYA 3BG6A 2YU9J 4BJ5C 1QZYA 4IX7A 3BTJA 4A3JJ 5FLXZ 3GCMA 4DOZA 2NXNB 1K78B 1ZR4A 1UELB 5FKNA 1IN6A 3CDHA 2JA2A 4F91B 4QTRA 4CCNA 4CO8A 3ZMUA 1D0YA 2F6CA 5LEJA 3KYLA 1GV5A 5BPIA 1K4TA 3GTPJ 4Y17A 5E3MA 4RB3C 1EH8A 2FJ1A 1YO5C 2BHZA 1B72B 5LFAA 2E2JJ 4YFKF 2JMWA 3TMOA 5FJ8J 1ZRFA 1E17A 2DMTA 4NB5A 1OR7A 1V5GA 5LLQA 3KZYA 4FETA 1D8KA 1IW7F 2NS0A 5JLXA 3J80K 4HLYA 5IYBJ 5D8LB 2VXZA 3ZQQA 1WCMJ 5D6FA 5K7ZA 3MZYA 4OOIA 3CC4I 3DU6A 3RYRA 2LTPA 3C2GA 5AONA 5D5VB 1VTNC 4G7HF 2GLOA 1XMXA 1QO0D 6PAXA 1NG6A 2EZHA 3HPGA 4XLNF 3RTRA 4L0ZB 1YIOA 2O8XA 4ESBA 3FBIB 2MYSA 1APLC 1N77A 1LEAA 2BY0A 3QU3A 3QOPA 1IO2A 5E8GA 2DFEA 5FFZA 2M7BA 3ONQA 5CKTA 5KK1A 1KU3A 2ZFUA 1P2FA 4IZZA 5GADJ 4BJ6C 2AS5F 5CQGA 2JUGA 1P9QC 3LOCA 2DPUA 2O9LA 1POGA 3ROUA 4RA2A 3OV8A 4CSWA 1AHDP 1IXCA 4QIWN 2OU2A 1E2XA 3HG9A 2E35A 2F5VA 2FBHA 3ML6A 3BZCA 3UR3C 3FISA 1W36D 2XB5A 1V55H 2L4AA 2RQPA 2L0KA 3M8FA 2C6YA 2FQ3A 1I6HJ 4U88A 3CLQA 1G3SA 1Y1VJ 3G71I 2OA4A 3FX3A 1FMWA 3KLNA 4PK4A 5L3DA 1U8RA 4ZTJA 3SZTA 1ON2A 3WGIA 4GYIA 1U0JA 4D5CA 2H6BA 3FMQA 5J1YA 4WF2A 1FOWA 4BAYA 3OOPA 4JX4A 5TGTA 1FOYA 1UJ8A 1GXQA 3OYGA 3AG3H 3GZ5A 1LKXA 2LKPA 2K9SA 4HNUA 3D5RC 3E5QA 3S1MJ 3GFMA 4UB6C 1T33A 5KHDA 1J09A 2XKPA 2CUJA 2PI0A 4C2TA 2XSJC 4PDKA 3GZNB 3AG1H 4UHTA 2CRGA 3I53A 5BNGA 3K70C 5J8CA 2BHYA 4EM0B 2CFOA 5JR3A 3TDUC 2B7EA 4HLXA 2ZXJA 3GZ6A 3LSIA 2E60A 3OYCA 4XSXF 3CO6C 1M1EB 3E6CC 2R5ZA 5GAHJ 3I59B 2DOEA 1F43A 2I5UA 2V4JC 1X4OA 1JUPA 5TRDA 1S29A 1QHGA 1Z6RA 1RESA 1GUUA 3BPXA 4IHSA 1D1BA 1PUFA 3ZQFA 2WBMA 3OIQA 1VZ0A 3WTTC 3CF5F 3E6MA 1E3PA 4ASNA 4JX5A 2LFBA 5EEHA 2H09A 1BM9A 1S5LC 1W5TA 4BNCA 1D8JA 2WV0A 3SHFA 1CGPA 1KQ0A 3IWFA 4ANJA 1QHHD 1JGSA 2DI3A 1Z67A 1E0EA 1VQ6I 2HDWA 2GXBA 3JTHA 4I99C 2XRNA 2JSPA 2ZJPF 1X2NA 2VQLA 2UUZA 3FKIJ 4P5OA 1U5TC 3EUAA 5HODA 1H0MA 1OR7C 1D3YA 2QUFA 1G8XA 2H8WA 1G6NA 2OF7A 4AU7A 3MZ8A 3CP8A 1XN7A 2M8EA 1YE9A 1BI3A 5M5WJ 2ICWG 3P7NA 2JA5J 4LITA 2ZB9A 1LQ1A 4B09A 2EH3A 4F92B 4OMYA 2NYXA 3IAS2 2BXYA 3HRMA 2X0LA 3KCCA 5DUIA 2DN0A 5F04A 5J47A 2E1CA 4GFBA 2BE5F 4P96A 1X3UA 2IVMA 4WCGA 4L5JA 3K10A 2GM4A 3DKYA 3PSFA 1V3FA 2KT0A 4D5FA 3JR9A 5F1RA 2K40A 2R7RA 1IRFA 2LLKA 4FX0A 2V6EA 5ILUA 4ENKA 1IUYA 1YJ9I 1QNTA 2H1KA 3CP2A 4BDYA 1VNDA 1ETWA 1IDYA 2VONA 2DYSH 3H5AA 1CQTA 5IT9K 2MD5A 2E5ZA 3R4KA 5H2FC 2M7AA 4E7HA 1H8AC 2MD0A 1IRGA 4X6AJ 2ZJQF 2K5CA 3FK6A 3OYAA 2OTJI 2JN6A 4HNTA 4HX8A 1GT0C 1OFCX 2W1OA 4XIDA 1MBGA 1JTYA 2VE9A 3S3NA 3HHGA 2IGMA 2D1VA 4ZYAA 2BW3A 5D6EA 2MBFA 4HZFA 1OCOH 1X1DA 3BY6A 3ZQIA 5DDGA 4I7HA 4DYRA 3OS1A 2V79A 2P6SA 1XGSA 1X1AA 3K4KA 4RLFA 3CCQI 1Q1VA 5LHHA 3M07A 3R61A 2DQLA 1SFUA 1A35A 4G94A 4IVNA 1P7IA 3VDXA 2O3FA 2NAZA 4IHTA 3GFIA 4B3AA 2EQRA 4EMSA 5ICFA 3OYIA 1XCVA 1R1UA 2RAEA 3RJPA 4N9HA 1HKSA 2K7LA 2LC2A 2DJIA 2IXSA 2MA3A 4YIIA 3LSKA 2ZFWA 4HOBA 4G6TB 2K9MA 3VYTB 1KA8A 1BL0A 2VUMJ 2W00A 2G7HA 3VYSB 4XKCA 1TNTA 3SFIA 3KX2A 3QRFF 4HYEA 3IH2A 2XPVA 2PLYA 4CZCA 5F6FA 1WFXA 1NTCA 2L4MA 2OJED 2M45A 2GWRA 2ZMEB 5JHUA 2QF7A 2WTEA 3IKVA 2E7XA 3J7YJ 4HQEA 2R7WA 5LHIA 2R7VA 4DGWB 4MQVA 3LSJA 3WGHA 1XSVA 1ZGWA 1XDSA 3CC7I 4YFNF 3PUFA 4HBLA 3E5XA 2JSCA 1FBSA 4HV5A 4EGYA 3BR3A 4IHWA 4XSZF 4BS9A 2LYCA 5LGTA 4OU0A 2JT1A 4GDFA 2O8KA 4DYCA 2OAZA 2LR8A 5JVTA 3HSRA 3QP5A 2CUFA 3HIFA 3BTIA 3RKQA 2ZCWA 2BY3A 5JHFA 2VBZA 3M1CA 3F8MA 4MTEA 4M74A 2LF8A 1FYKA 4HEA2 1T39A 4W97A 2X6YA 5HNHA 2OD5A 2NVYJ 3IV5A 2HQRA 3K4JA 3J80Z 1S72I 2Z3YA 2X1EA 1H88C 2JPBA 1ZLKA 2M8GX 2MC3A 5DM6F 1RKWA 4O5VA 4L18B 1SFKA 5CQEA 1LE8A 2OZ6A 1OYIA 2B63J 2FSWA 2Y30A 2W57A 3RPUD 3JAMK 1OCTC 1ZYRF 3H1CA 1R1TA 1SMTA 1TWFJ 1YS6A 5DV5A 4A3GJ 5FKOA 2OBPA 2WY8Q 2XF7A 4FISA 3HTSB 1A6IA 2EA2A 1P4AA 1O7LA 2VJIA 2JK3A 1JUSA 4K2EA 1VQMI 3BR0A 4F7ZA 4RB0A 2DAOA 4XLHA 3FXOA 3CCUI 1I3QJ 3LWFA 3MKLA 1W7PD 1K7AA 3PM1A 2J5PA 1TT0A 1ZAOA 2R4GA 4KT5C 4B47A 1XPXA 5EG0A 4OIPF 3I4MJ 1MMSA 2EILH 2Q2EA 3TEDA 3K4CA 5J1RA 1MJAA 3GTMJ 3BC8A 4LMYA 2P5KA 1LEBA 2FD5A 2P81A 3GTGJ 2OQRA 2M2EA 2X9DA 4UUSB 2YPRA 3DPLC 1LPQA 2K9NA 5EDNA 3TO7A 1RUNA 2RN7A 2BVMA 2FXAA 3B73A 2JZYA 2DFIA 1BN5A 2A61A 2KRFA 5F27A 3GYHX 3W2AA 3I64A 2FE3A 3U1DA 2B9SA 2I8DA 2R7ZJ 3ECHA 3F6OA 2MC4A 4S05A 4PGGA 2CQXA 2EZIA 1ZH5A 1SD6A 2BXZA 4GXOA 1ZREA 2F4IA 1HW5A 2L7ZA 2DA3A 4Q47A 2XROA 3M8JA 3BCBA 5HS8A 2O03A 3F8CA 3MKWB 1EV7A 3GVAA 1GXPA 3BZ6A 3O8HA 2XAQA 1UHMA 3K4LA 1HCRA 1ETVA 1NG7A 3WTWC 1BA5A 4HF0A 3VYRB 2XF6A 3NARA 3OMYA 1U9NA 2KZGA 2XGXA 4DBRA 1VQOI 1YS7A 1ACIA 1UB9A 2K4BA 2OV7A 2QENA 3C7JA 2EFOA 3JSOA 1LJ9A 1ZN2A 1IF1A 1HSJA 3HRTA 2F5EA 3HRSA 2R3SA 1PDNC 3N4MA 4ZDOA 1TNSA 2ZXWH 5E18F 4QWQA 4ZC3A 1B1BA 3ZQGA 2R5YA 2DBBA 1ZGAA 5AIQA 4V2GA 4CCOA 1HSTA 4BUPA 3D5SC 2HQAA 2FBIA 4EATA 1VF9A 3I3LA 4BHBA 3E6BA 1WKMA 1FT9A 1EKEA 2Z9OA 1WJBA 3BQZA 3PL8A 2NVUB 5ICCA 3WG9A 2EFNA 2FMLA 3OYBA 3P9IA 1Z21A 4BQQA 1JUMA 2NOJB 3HL2A 4N4NB 4A3FJ 5TJJA 1SFEA 3DPUA 4LIUA 2KDZA 3VOEA 1K6OA 4BQOA 4HPQA 1GVDA 4HSRA 4ZYGA 4NC8A 3UKGA 4W1UA 1B72A 2R92J 4IQ4A 5HDGA 4BEHB 1MSFC 1XD7A 2FQ4A 3MN2A 5CVUA 1X4PA 2GA2A 1LDKB 2EV0A 1UFMA 3FMSA 1OJLA 1U9OA 4QPOA 4A5NA 1B9MA 3CJNA 1R5HA 2R93J 1JKQC 4IQJA 5FGMA 3WODF 1Y8RB 1YG2A 4G9YA 3E0JB 5J1UA 2KJCA 3G1OA 2HPMA 2RNGA 2KL4A 1ZK8A 1WJEA 1ERDA 4QLCU 2XGDA 1XG1A 4XK4A 3LSHA 2TRTA 3HUGB 2QQ8A 3ABUA 3DBRB 1ZG3A 3H36A 4LG3A 3BJAA 2MLGA 2DPDA 2ACJA 3I9V2 3BG9A 2A07F 2LK2A 1PP8F 4YIRX 2CSOA 4LK0F 3K2ZA 1T2KA 5HNFA 2L01A 2M5WA 1B59A 1WWXA 2GQQA 4I2OA 3A0BC 2ZSHB 2HTJA 4UVBA 4IO9F 3A1YA 1Y8QB 3G3ZA 5E3NA 2HDCA 4PSXA 3OOUA 2G9WA 3G1LA 2VOOA 1ETQA 2LBFA 3Q9SA 3OYDA 4LIVA 1ODDA 1ZRDA 3JRIA 3M9AA 2Q1ZB 1XCBA 3UNGC 3WGGA 2Y9ZA 9ANTA 1BC8C 1ETYA 1D0ZA 3KP3A 1RKTA 4RBOA 1ORKA 4GRIA 2JRMA 3C2HA 5EEGA 1ZG5A 3I71A 2XGEA 3WTYC 4L5EA 1T98A 4LLGF 2HXIA 3K70D 3WE3A 2JA8J 2DO7A 3WHCA 2M87A 1MNDA 3AG4H 3QYFA 3FXLA 3SDGA 4X1EA 1Y39A 4IHYA 2F5DA 2VKHA 2PFBA 5HLGA 3HDDA 3V7CA 1STZA 4XLCA 2LD5A 4J01A 4D0PA 2E1MC 1DU0A 1RI7A 4UVAA 1IC8A 3S8PA 1WGXA 2HEOA 2P7CB 2R7QA 4BXFA 4HG2A 1TQPA 2RNJA 4MQ9F 2AQEA 4PJJA 1UMQA 2ISZA 2BVLA 1R4MB 3T1BA 3NWSA 3PQJA 3OSFA 2PBIA 2ZJRF 5IYCJ 5ILSA 1D5VA 3S15J 1OCPA 2CGPA 3AKZA 3FHZA 2DW4A 2HR3A 4RDUA 5C44J 1VI0A 3KPHA 1PJRA 2Z33A 1BIAA 2IEKA 4KMUX 4KMFA 3WU2C 3EPZA 2QQBA 2VL8A 1U78A 2HYGD 1GDTA 2ECCA 1UHSA 3TOAA 4DZJA 4R8HA 1XDUA 3G2BA 2QA4I 3OYMA 3H0DA 1DP3A 1JHFA 2NVXJ 4M3FA 2DA4A 2UXXA 3MZHA 3FKJA 2V7FA 3GO5A 4HNVA 3S32A 2CH0A 4AVZA 4LG0B 2KISA 3GF2A 2LKSA 2E71A 2XPWA 5LBQA 5BS6A 5F0CA 5DCMA 1K61A 3H9JA 4JX6A 3VSLA 4Y52J 2LG4A 2HI3A 2LSOA 1D1AA 2XHKA 1MH4A 2BY1A 2X6OA 2O5RA 4XORA 2EV6A 2HQ5A 4UY8I 4IOCF 4H4KC 2MLKA 1R5ID 3CMEI 5LD2C 2W48A 2Q0OA 3E1SA 2L7KA 4E7SA 4AIJA 4M9ZA 1FNNA 1Z91A 5L3FA 3Q5FA 1JT0A 1I5ZA 3S3MA 1O3RA 2YUSA 4I98B 3FXUA 1QGPA 5KAIC 3SZGA 3EQLF 3MAJA 1H89C 2M4GA 5D4RA 4V19K 1S3JA 2EFPA 2LDUA 4WXCA 2XSDC 3JAMZ 2AXLA 2HOAA 4A2UA 3FXJA 5IP6A 1BR2A 5ICGA 1XSXA 3WU1B 3LNQA 4ESFA 4BACA 1K4SA 2BV6A 4YFXF 4IOAF 4E7LA 4I6ZA 1FIAA 2FX0A 1TQMA 2NS8A 4XKBA 5IP7J 1T38A 3N97A 1Z3XA 1T0FA 4XLFA 5L3CA 2X1CA 3DFGA 1VQKI 3PNTA 1EH6A 1HDDC 2LMDA 3H92A 1FSEA 2IGOA 2HNHA 3CF2A 4NC6A 5A2QK 4L9JA 4UXNA 2L9RA 3MEXA 3G73A 2FEZA 5IP9J 3S3OA 2ESNA 2X51A 1Y56A 3ZQCA 3OIOA 4XR6A 3DKWA 5LEKA 4UB8C 2VB6A 5D4SA 2VN2A 5J4VA 3GTKJ 2A6TA 3MD2A 1IV8A 2X85A 3RYPA 3OR2C 2A6EF 3V8LA 2UXNA 1OCZH 5FRMA 5EGOB 3OY9A 1G3TA 5HDNA 3V8JA 2QQ9A 4LGWA 1MNMC 3CLOA 4NNJA 3DBLB 1F5TA 4M3BA 1SAUA 4II2A 1I39A 2DFFA 2IP2A 4RS8A 2KIUA 4WXHA 1R00A 4C9YA 4B3XA 1JI8A 2JVGA 1O3TA 2LVSA 1MJBA 1OMIA 3CTAA 3VSKA 3ABTA 4BY7J 2DOAA 3C18A 1USSA 3DV8A 2VQHA 1SANA 1X19A 4B43A 5IOZA 3HOSA 1B8IB 1UAAA 1JXSA 1HBXG 2EINH 1TW2A 3JRHA 1MJ9A 3TKYA 3M4OJ 4BKXA 1ON1A 3HGYA 1J9IA 1R23A 3FWEA 2P6TA 1IJWC 1BR4A 3BQYA 5HVQC 1SEUA 1WPKA 1YRNB 3T5XA 3FXQA 3BROA 4P1WA 4ZZDA 5M3FJ 4L9NA 2L3DA 3WTZA 1IRZA 2KRCA 2IS2A 2QEXI 1T08B 3DWLE 1YX3A 1T8IA 4S04A 3C2BA 2LH9A 5EEAA 2OCCH 3FXMA 2XAJA 4HSTA 3ECOA 2H27A 1NK2P 3J81K 1HF0A 2R7TA 1FOKA 2O6GE 3IHUA 3L7WA 1JJ8C 3QWLA 2VLAA 3EUHA 1MIJA 4D1QA 2XV4S 1MSEC 4A3CJ 1ONVA 3BDDA 4ENJA 1B6AA 3LFUA 3T8TA 1TC3C 3VB2A 1YYVA 2VE8A 3EDPA 2R7FA 4C30A 1XGNA 1MBHA 3IUOA 3F0CA 3GTOJ 2R7UA 3SXYA 5DS9A 3E3VA 3CUQA 3OIPA 4M6XA 2PEXA 1QVUA 1ZG1A 2VKEA 4G8XA 3K6GA 4U7BA 2XB0X 1MBJA 4KDPA 3GLLA 1B9NA 2MH9A 5B1BH 4HAMA 3IH4A 1TP4A 2OCEA 3GBGA 4PJ0C 3CC2I 2IS6A 3F3XA 4IJAA 1DDNA 2XIGA 5LGNA 5EYRA 4DYQA 2RQQA 3DTKA 3HBLA 1AKHA 3BZKA 3D5LA 3FM3A 4XRFA 4O3MA 1T0FC 2J5OA 3LL7A 2ETHA 2HVRA 4XONA 4J19A 1PUEE 3CD6I 1SVMA 1D0XA 2PX9A 4HA8A 2EV5A 2M0CA 4Y7NJ 3CCRI 3CO7C 2DMQA 3H35A 3K4MA 4J00A 4B4CA 2MSYA 4KA4A 3F21A 1FBQA 1MMNA 2L9VA 2ZXIA 3MMYB 4C3JJ 2CMPA 3WG7H 3HOZJ 3KP2A 2Z16A 4MIMA 3W3CA 2GAUA 5LRRA 4A12A 4I76A 2WAQA 4XN0A 4A93J 3HM5A 5KCMA 1FSHA 2H6CA 5CPRB 2ZBKA 5HLIA 2XGCA 1SD5A 1TZLA 1U5TB 3K2AA 4CYCA 3GTJJ 4Y4RA 4CDGA 1FTZA 5BQTA 1ZGJA 2YS9A 2EIJH 1RETA 3QPSA 4QPQA 4AYBA 4XICA 3HEFA 4A69C 2DMUA 1YHQI 3AG2H 3HKZA 1H9GA 4DW6A 3TW7A 2CV1A 3BR1A 5D5XB 4EJTA 3LA3A 2EIKH 5DD4A 3MVPA 4XQFA 1P6RA 4B8XA 4EV0A 1BOAA 1UG2A 1BI0A 5DTDA 5B5EC 1R9TJ 4FE4A 3OS0A 3KETA 3E6DA 3QPLA 4IXAA 3PNVA 4E4HA 2IAIA 1MMAA 4Y3OA 5HLHA 4Y15A 2DCEA 2VBXA 1LFUP 2XKOA 1WJCA 3LQRA 3OYEA 3DLLF 2GBYA 2LY1A 2M9HA 4M3EA 3L2QA 2HOEA 3ABKH 1O3QA 2VPRA 5FD5A 4C3IJ 4RM3A 2P0WA 4PJLA 4P9UA 1AOYA 3X2QH 1GHCA 3EUHC 2HOSA 1P92A 1YLFA 3OSGA 4IL6C 1EA3A 4ZH4F 2HYJA 2QWWA 2VKDA 3S1NJ 4XOPA 3HOTA 2V6CA 3CCSI 2W85A 2DMPA 3DPTA 1C0WA 4YELA 1S7EA 3I55I 3CUQC 4I0AA 1IN5A 3S2DJ 2CW7A 3U9GA 3HYIA 5EZGA 3U21A 3FZVA 3R6SA 2KIQA 3H3UA 1IXRC 2H8RA 2WAFA 2W25A 1KYWA 2DMNA 3GFJA 5KVRA 1E3HA 4U87A 3JRBA 1OISA 4ZJZA 4BBSJ 2LNBA 4OAYA 1UZCA 4U0VA 4ZZLA 5IT3A 2IS1A 5CVJA 2G0EA 3F8NA 2ZNYA 3RQIA 2VJ5A 1ZLJA 3EUKL 2XASA 3P5JA 5K7FA 4R1HA 3HHHA 2IRFG 3KP6A 1DPUA 3EYIA 2X6XA 1HC8A 3ABMH 3DTIA 4AIDA 1PUFB 3S16J 1MDMA 2D2WA 4EM1A 1FYMA 4Y33A 1QRYA 3G6EI 1BI1A 1DU6A 3L2RA 2HDDA 2RDPA 1ULYA 1YOVB 4DZPA 5ED4A 1FOXA 2DODA 1UG0A 4HF2A 1DPRA 3CJQB 2BBYA 3QYEA 2KQRA 5E1XA 3E7LA 2NVQJ 3LMMA 3S17J 4M73A 1V5EA 5C4JJ 1XMKA 1MMGA 1K83J 2QKLB 1N25A 2ME6A 3HOWJ 1FP1D 3KP5A 1TL8A 1TW3A 4BGDA 4TV7A 1NHAA 3DLAA 2AXTC 1FP2A 1VQ9I 2ID3A 2XAGA 2JA6J 4NC7A 2E2IJ 2A6HF 2WAEA 2CJJA 1X3WB 4M3GA 3BG7A 3BR2A 3IC7A 2IA2A 3KE2A 2KRHA 5GPCA 2RKHA 3SFZA 3ZMTA 2ELJA 2Y31A 1VQNI 3ZMZA 1ETOA 2GA1A 2WB1A 4MLOA 4NUBA 3HSFA 1SD7A 5FD6A 2HGCA 2QBYB 1JKRC 1GVJA 3K9TA 2F5FA 2EFWA 4DBQA 2V1XA 2DTZA 2WY7Q 1CF7A 2HKXA 3VPRA 4A6DA 5B1AH 5F0FA 4ETSA 1FWZA 2F5CA 2W7NA 1S6LA 1YITI 4PJMA 1SD4A 5D8KB 4EJOA 4RAZA 3K4NA 3V42A 2L9SA 4G7OF 4HW0A 4CYDA 1FYLA 3BWGA 1D1CA 3AFHA 4WXDA 4BH9A 2DT6A 4XL9A 2VASA 3DXJF 3JRAA 3COAC 4KICA 4ZYHA 1R1VA 1P4WA 1WQ2A 3PUBA 2FUG2 3RPUA 4Y13A 1Y0UA 3SEQA 4WK8F 2ZSIB 2PMZA 5FO5A 3SZPA 2KZVA 5IY5H 2QSHX 4A3LJ 4BQNA 2E2HJ 3CZ6A 3G4SI 3TP0A 2FNPA 2BW3B 3J81Z 1SVLA 4IRGA 3KZIC 4JQFA 4I0BA 2R7XA 2LKXA 2E1OA 1W7PA 3R60A 2BZTA 4LD5A 1RR8C 1RC9A 5F1JA 1R4NB 4KN7X 4F93B 4E7IA 3ZRGA 2HXOA 3OWTA 1ENHA 4IHXA 2KMUA 2VQGA 4RLQA 1TLHB 3RSNA 1B4AA 4HX4A 1VQPI 5FFXA 3QOEA 2L7FP 3TBIA 3KEQA 2ZNZA 2FMYA 2TDXA 1AU7A 2VODA 2IGKA 3A4CA 4XBFA 4ESJA 3V8KA 3HZJA 1JKOC 3G1MA 4LB5A 2O61A 4OAZA 1A6QA 1K78A 1JT6A 4RAYA 1I27A 1OCRH 3CCYA 3ZCOA 4OWRB 1X1BA 3RKYA 3LAPA 1WJ5A 3C3WA 2Y75A 5E1WA 1O7FA 2MABA 1EJ9A 3BG3A 1R6RA 2A68F 3Q0UA 2L7MP 3CCMI 3ESWB 3L1PA 1UHWA 4XLEA 3VEPA 5D5WB 1YFHA 2H1LA 3OYNA 1IRXA 4A3MJ 3KLOA 1RZ4A 1U8BA 1RPWA 1R49A 1TWHJ 3M3YJ 2FF4A 4CGZA 1HQCA 4BJTA 3N05A 4FCYA 5L3GA 5KAFC 3WTSC 3WTUC 4M6VA 1XMAA 4NQWB 2JTVA 2DK8A 4KT6A 3O6BB 3K7AJ 4EJVA 1YX5A 4GYGA 1MZBA 4FQGA 3IAM2 3JTGA 1O4XA 1FMVA 3OYKA 2CO5A 3EETA 5AIPA 1TWAJ 4U0WA 2CQ7A 3NWTA 2WA0A 2YX7A 3CJTB 1FZPB 5J8FA 3GTLJ 3E5UA 3RQ4A 3K0LA 1VQ8I 2DQRA 4E7KA 4UUTA 4PUSA 2OUMA 1BBYA 4LJZF 5IT9Z 4MEXF 4YIFA 1ZR2A 3HOVJ 4A3EJ 1EF4A 4RM2A 4DNCA 2TCTA 4EQQA 3OS2A 2CFXA 5M3MJ 3BLYA 3JCUC 3BT9A 3CMAI 2HTSA 5ICEA 5FKLA 4FTHA 1LE8B 3ZQ7A 4JYKA 4B1RA 2XF5A 1YQAA 3GEZA 4IPAA 1LUJB 2NOGA 2DTRA 4CCLA 1F4KA 4A6EA 2W84A 2EBIA 1Z7UA 3JREA 1QQIA 5HDKA 3FXKA 3I4NJ 3KYDB 5C3EJ 3PO2J 3VWBA 3I0TA 4FT8A 2HKOA 2R0QC 3DCFA 3ZXSA 4C2MJ 1LB2A 3W6KB 2YX4A 1WHUA 5EG0B 4R79A 1GLNA 2CS3A 2Q2EB 3TO6A 2XC7A 2DOFA 3KP7A 1YRNA 2M1BA 2Y69H 1N75A 1ITYA 1W5SA 1NK3P 4ABZA 1WJDA 3I54A 5K5RA 1X1CA 2X6WA 4BXUA 1WJAA 1X2MA 3BP8A 2DFHA 3O2PE 3I59A 1G3YA 4N4OB 5GTHC 3QYBA 1KQ8A 1F36A 5IOYA 3KEOA 2VJ4A 3OYFA 1MH3A 5IPAA 3S2HJ 2VPLA 1FPQA 4HQMA 1Z6TA 3RKWA 3FK7A 2P5VA 3FXRA 1KZHA 1LDJA 4AVPA 2ZJ2A 1XSDA 3H3ZA 3CDIA 2E19A 1OYYA 3ZMDA 1DP7P 3TP3A 1EH7A 2CW0F 3BR6A 1L0OC 1S9HA 2FOKA 1LNWA 1IG7A 1LVAA 2OC6A 1MNEA 3I5UA 1SAXA 4PFOA 1PVEA 3HGGA 2XUBA 3OL3A 3B02A 4KIGA 3FIWA 5BOXA 2MW8A 1FTTA 4UV9A 5DD8A 5BMZA 2HVQA 4RGXA 2HZTA 2DT7B 3A01B 3TGNA 3KIOA 4E6KG 3A0HC 4C2UA 4XNFA 1A31A 3P9KA 3OYLA 2KDOA 1G3WA 3AL0C 3FMRA 4P55A 5GTIC 3PO3J 3H0GJ 2X1DA 2XAHA 1Z77A 2E1MB 4Q48A 5TISC 5GAGJ 4KIBA 3CDLA 4EGZA 2VBYA 1G2HA 3A02A 5ILVA 4BBRJ 4FX4A 3QU6A 4P9FA 4YEJA 3EYYA 3ZMSA 3LSRA 2ADUA 5JFRA 4AIKA 4GO1A 5E20A 3FM5A 3DQVC 1RNLA 2R5YB 2WV1A 4EM2A 5HLTA 1U6GA 5H6RA 5HS7A 4KISA 4BU2A 2STTA 1S8NA 2PQ8A 2Y0SA 1BC7C 2QM3A 3S1RJ 1MBEA 4F52A 4FHTA 4BHCA 5KNLA 3C1DA 2V9PA 4G6DA 2PJPA 4M9SA 2FNAA 3ZPLA 1LFBA 4OIOF 2DA7A 3DF8A 4XN3A 2DT5A 3J7ZI 3RZDJ 4CZZA 4Q5SF 3JW4A 4RAFA 4A3BJ 2ZO4A 1KONA 2QSFX 4HF1A 2Y9YA 1F9NA 4JBAA 4RGSA 2K3FA 3BPVA 3GUDA 1HXDA 1MD0A 4ZYEA 3NEUA 5CVRA 4F3QA 3PSIA 2VQCA 3GW2A 2Y2ZA 3ZGKA 4MHGA 2VC1A 3KFWX 4LK1F 1T6SA 3HPHA 4HV6A 1TWCJ 1U5TA 1BIBA 2K27A 2M4KA 2VJJA 3QPTA 4UVCA 4XOTA 3REOA 4D9JA 1J75A 1RUOA 1FEXA 3LSGA 4AD9A 1J7KA 3ZN0A 3TDZC 1P4XA 3T8RA 2VC0A 3GXOA 3K1MA 1J2XA 2GOXB 2P4WA 3H9QA 3LAJA 3S14J 5E17F 3Q9VA 4A5MA 5FKKA 4CCMA 1MBKA 1WSUA 1R22A 4AC0A 3ASOH 1V4RA 4IHVA 1KU2A 5DM7F 4PZJA 2PJRB 2H94A 2JPCA 4NDLA 3BJ6A 3HXLA 4YG2F 5JI6A 3DEWA 3OYHA 3GTQJ 5E3LA 1Z9CA 3L2UA 3ULQB 2CUZA 3F23A 1QU3A 3ISPA 2UZKA 2XAUA 1DGRM 2KIFA 4L5IA 2JA7J 2HFHA 4LOCA 4RB2C 3H9GA 2CQQA 2LREA 4I09A 2HYFA 4EJUA 4G7ZF 2COMA 3PIOF 3ZMVA 4MTDA 3OL4A 5CYVA 4LFUA 2LBFB 4AIHA 1FX7A 1XB4A 4CUGA 2VT3A 2FU4A 5E3OA 2O0YA 2RGVA 1J0RA 1BI2A 5J6XA 2DA5A 1TQIA 3SQNA 1BOBA 3U2RA 3IP4B 3MWMA 4XLPF 2JJ7A 2ZMEA 3E97A 3DU5A 3HOXJ 2ECBA 3DP7A 4A0ZA 4BHPA 4I01A 3VODA 2BY2A 3LSPA 5K5OA 3QP6A 1I6XA 4ENNA 2HQNA 1IN4A 3JRCA 2QQAA 2MGQA 5EF6A 2WAQN 3WE2A 4L0YB 3K4BA 5GP9A 1A04A 3HSEA 3MQ0A 2XVCA 3F72A 1DQUA 1JTXA 2RV8A 1K6YA 1S7OA 3D0SA 2GOMA 3BJOA 4KIFA 3BTLA 1WZ2A 2R7SA 2A5WA 3L2VA 4JP0A 4OINF 5J4YA 2KPMA 3OR1C 4Z2YA 4AYBN 2E34A 2CWEA 1AWCA 3S1QJ 4PGHA 1YI2I 3HKZN 3WTVC 5L3BA 3D1NI 5CVVA 2IS4A 1I1SA 4N9IA 5DEQA 1VQ5I 1ZARA 2L54A 5CLSA 2VKVA 4KJZA 4M71A 3GMEA 4PSWA 1QA6A 1Z05A 1QZZA 3BOQA 2MFZA 3F8BA 3VYUB 1TBXA 5DCMB 2DJNA 2O7OA 3MCZA 3GWZA 1J59A 2ID6A 4XKWA 5J40A 2R7DA 3TQNA 2HOTA 2QZ8A 2V9VA 1U2WA 2KHMA 3QQAA 4WX9A 2L5QA 4EVIA 4FE7A 1R58A 2NS7A 4GCVA 4DJAA 2BOLA 3LSMA 2ZC2A 3NAUA 2N8GA 2W24A 4AWXB 1WI3A 3J7AO 2Y48A 5LRSA 2QBYA 2CQNA 1MMDA 4UUSA 2ZXHA 4AUXA 1A5JA 2KJBA 3JSPA 1LFPA 4E7ZA 5DCFA 5FLMJ 2K9LA 4MNUA 2DDAA 3FDYA 4A0XA 4G12A 1W5CC 2VOPA 1ETKA 3B6CA 4OIRF 3F8FA 1QZEA 5J3LA 3ERMA 1BW5A 3HOUJ 1O57A 3Q0VA 4U7DA 4BYYA 1YTYA 3F6VA 2OQGA 1FIPA 3KYCB 2JUCA 2BEOA 1X3ZB 2AO9A 1IZ1A 3I4PA 4LLLA 2E5NA 2EIMH 5FB2A 2CG4A 2CQKA 2ZMEC 4PCQA 3AAFA 4AM3A 1YW8A 3PNYA 1SMYF 4HRIA 2D1HA 4XKVA 2LY2A 1KQ9A 1KU9A 1YJWI 3LA2A 1OKRA 1MBFA 1G4DA 3TO9A 3GLXA 2P8TA 1MW7A 2AQFA 3BR5A 4EEFG 2P5LC 1W0UA 3DBHB 2OTLI 3KEYA 2LRDA 3I56I 3R0JA 2L2OA 1W36C 1I3AA 4M9XA 5GAEJ 2HPIA 3A2KA 3ERED 1QBJA 3ASNH 2WWYA 3Q0WA 2GXGA 1H9TA 2JVHA 2NRAC 2V1UA 3WHBA 1XGOA 4A0YA 1XX5A 3GFLA 1ZTRA 2LY9A 2MG4A 2IA0A 2CYYA 2X4HA 4U0YA 2JWTA 3L09A 4ZYDA 1T95A 2VT2A 1ZQ3P 2L02A 2WB1N 5K5QA 2F4MB 1U3EM 3MFKA 1WRJA 2R5ZB 4BEHA 2DA2A 3ZQHA 3BTCA 4D7MA 2DA6A 5B66C 1IGNA 3W6JB 3CCLI 2KKOA 5IYDJ 1YW7A 2QKMB 2G7UA 3V4GA 1J5YA 2E7WA 2A05A 2DLLA 2Z1DA 4PFPA 1ZKGA 3H5RA 1JE8A 2YR2A 3HB9A 2IT0A 4C3HJ 4NQWA 2W4SA 3RCOA 3W2WA 3DEEA 2PMUA 5LHGA 3AL0B 4ZTFA 4BE0A 1HW2A 3M8EA 1HKTA 2DK5A 2D5VA 2EA4A 1RRJA 3CMMA 1Y1WJ 3BG5A 1R71A 3TW6A 3HUGA 2VIXA 1RIOH 2KIMA 3WTXC 1OQYA 1IN8A 4KUMA 2GIVA 2BGCA 5H6QA 3O3KA 4ENMA 2K4JA 2STWA 3M1EA 5JLWA 1WH7A 2FBKA 3CUQB 2XAFA 2CV2A 4IF4A 5FLXK 4RGRA 2DA1A 2PMZN 1D5YA 1FLIA 5F0HA 3TOBA 5A2QZ 3CJRB 2HWVA 1KGSA 2JRTA 2PMHA 1IV6A 2QYOA 1HW1A 2CU7A 3L00A 1IDZA 3CCVI 3LA7A 5JVGF 2ME0A 5M5YJ 2L9NA 3LSTA 2E36A 3RKXA 5K7HA 1WI9A 4IRHA 1V5FA 2VI6A 1GV2A 1OLTA 4HDUA 1AKHB 2KP6A 4S0HB 4BE2A 5DYMA 2B0LA 3ZN1A 1G59A 1JGGA 2HS5A 3DEUA 1PYVA 4UV8A 1X58A 1WVRA 2WC2A 2ISYA 1Z1DA 3ZOBA 3W6VA 1QPMA 1KYZA 4JK1X 4CCKA 2X48A 2WADA 1W1WE 5LGUA 3F22A 2BYVE 4ITVA 1YJNI 4IRIA 3HOYJ 2LP0A 4M6YA 1HLVA 2V9KA 5EJCA 5K1YA 2K3PA 3FF5A 4XRMA 1QPIA 1TWGJ 4KN4X 4N0BA 2IA1A 2A5YB 1HOMA 5HS9A 2M0MA 1YW9A 3L2WA 1HKQA 4RGUA 3JRDA 1X1PA 4YRVA 3HTUA 3GX4X 2Q8KA 2LF7A 3TL4X 2NNYA 4DQ2A 4B44A 3B6AA 1Z7LA 4KITB 4CYCB 2I10A 1ZHFA 1ZRCA 3QPHA 1RR7A 2NVTJ 4D7NA 4PJNA 5FROA 2QSGX 3ZP5A 3IKTA 1XS9A 1IAWA 1N78A 4BL0B 3RI4A 1VQ7I 3PIPF 5FRNA 3W2VA 2A3SA 1NH3A 1OYWA 5BPDA 1A36A 1MKMA 2EB7A 3J7AY 4IKFA 1JHHA 3Q3SA 2IGNA 2V26A 4E7JA 4H0EA 2PN6A 2YSRA 2EWNA 3NRVA 1ETXA 2V1DA 1DUXC 1QVTA 1Q1HA 1REPC 1ZELA 1XGMA 1Z3YA 2GZWA 2QVOA 3LFKA 4M72A 3A01A 3CESA 4CICA 2IJLA 3BCAA 4BY1J 2M34A 4G6QA 1BW6A 2OZUA 3JRGA 1IUFA 3V7SA 4KFCA 3ABLH 4LG0A 5D5UB 5C4XJ 3NQOA 5ERIA 2Z5UA 3ZQLA 2FOWA 5CVIA 3SYTA 2DU9A 4MFEA 1FBUA 2OPTA 4HDVA 3T0YA 2XDVA 1HDPA 2QGUA 1USTA 1O3SA 2FA5A 4I02A 2ESHA 4XRSA 3PQKA
chains in the Genus database with same CATH topology
3LSJA 5FLVA 3H3VK 2XPUA 3A03A 1ZGWA 1MBHA 3PO3J 3H0GJ 3F0CA 1Z77A 3GTOJ 3BR3A 4IHWA 1Z0XA 5DS9A 3CDLA 1G2HA 3A02A 2QCOA 4BBRJ 2O8KA 1QVUA 4DYCA 2VKEA 3LSRA 2LR8A 2XB0X 2CUEA 1MBJA 2CUFA 2R5YB 2WV1A 3BTIA 3RKQA 3IH4A 2EZKA 3GBGA 3S1RJ 4BXXJ 1MBEA 5EYRA 4DYQA 4W97A 1JKPC 3HBLA 4MFDA 1AKHA 2ELKA 2NVYJ 3IV5A 1LFBA 2DA7A 3RZDJ 1H88C 4A3BJ 2M8GX 4J19A 2Y9YA 4XRSG 1RKWA 2M0CA 1LE8A 4Y7NJ 4MO7A 2DMQA 2B63J 2Y30A 2Y2ZA 3O8GA 4B4CA 1OCTC 1TWCJ 1TWFJ 2MSYA 4A3GJ 3CQZJ 5FKOA 4C3JJ 5EGOA 3LSGA 1FEXA 3HOZJ 4FISA 4MIMA 3JRFA 1A6IA 2JK3A 1JUSA 3S14J 4I76A 3BR0A 4A93J 1I50J 3HM5A 1I3QJ 2COBA 3MKLA 5FKKA 1MBKA 3PM1A 2XGCA 4AC0A 4M3DA 3K2AA 3I4MJ 5EG0A 4CYCA 3GTJJ 1FTZA 3TEDA 4IHVA 3SJMA 1FJLA 5M5XJ 2YS9A 5GPAA 5J1RA 3GTMJ 1B8IA 1RETA 3QPSA 2FD5A 4XICA 3HEFA 4NDLA 4A69C 1XC5A 2DMUA 2P81A 3DEWA 3GTGJ 4A3IJ 3GTQJ 5E3LA 4DW6A 3TW7A 2M2EA 3BR1A 2X9DA 4UUSB 3MVPA 2K9NA 5EDNA 1UG2A 5DTDA 1R9TJ 2JA7J 4FE4A 4LOCA 5F27A 3QPLA 2CQQA 5FKMA 4QSHA 2IAIA 2Y0SN 2R7ZJ 1JJ6C 1LFUP 2CQXA 2EZIA 1SFOJ 2GBYA 5E3OA 2M9HA 2L7ZA 2DA3A 4M3EA 2DA5A 5EZHA 2VPRA 4C3IJ 2AHQA 1BJZA 4V2FA 2JJ7A 3HOXJ 3O8HA 2HOSA 2ECBA 3OSGA 1HCRA 1ETVA 4A3DJ 1BA5A 5F08A 2EZLA 3NARA 3LSPA 1VFCA 1U9NA 2K9QA 1T56A 2HYJA 4IEJA 3S1NJ 1P7JA 3JRCA 2MGQA 2DMPA 5EF6A 2WAQN 5GP9A 1S7EA 3S2DJ 4A3KJ 5EZGA 1JTXA 3ZQGA 2R5YA 3CMYA 2H8RA 4V2GA 3IH3A 2DMNA 3BTLA 2IBDA 4JP0A 3JRBA 1E3OC 1VF9A 4AYBN 4BBSJ 1WH5A 3S1QJ 2G0EA 3RQIA 3HKZN 3BQZA 5K7FA 3D1NI 1W0TA 2XRLA 3RZOJ 1JUMA 4A3FJ 1PUFB 3S16J 2KDZA 2YU9J 1GVDA 3BTJA 3UKGA 1QRYA 4A3JJ 4W1UA 1B72A 2VKVA 2R92J 1MSFC 1DU6A 2HDDA 2FQ4A 4DZPA 3MN2A 1ZR4A 5FKNA 4QTRA 1OJLA 1U9OA 2R93J 3E7LA 2NVQJ 3GTPJ 1GV5A 1JKQC 2DJNA 2O7OA 5E3MA 3S17J 2FJ1A 5C4JJ 1B72B 2E2JJ 2JMWA 2ID6A 2HOTA 5FJ8J 1K83J 5J1UA 2ME6A 2DMTA 3G1OA 3HOWJ 1ZK8A 5JLXA 3QQAA 2XGDA 1XG1A 4XK4A 5IYBJ 2TRTA 4FE7A 1WCMJ 2NS7A 5K7ZA 3NAUA 2ID3A 2N8GA 2LTPA 1WI3A 2JA6J 2E2IJ 2GLOA 2CJJA 4M3GA 2EZHA 3BR2A 4UUSA 5GPCA 3BG9A 4AUXA 1A5JA 2LK2A 5FLMJ 1APLC 2Y31A 1ETOA 4MLOA 4G12A 1JKRC 5E3NA 1ETKA 3B6CA 3LOCA 3OOUA 2O9LA 3G1LA 1ETQA 1POGA 5J3LA 1AHDP 3JRIA 4QIWN 2DTZA 1BW5A 3HOUJ 3Q0VA 2Y9ZA 9ANTA 3VPRA 1ETYA 1RKTA 1FIPA 4RBOA 1ORKA 3FISA 5F0FA 2XGEA 2AO9A 2XB5A 4L5EA 2HXIA 2L0KA 2JA8J 1I6HJ 3WHCA 1Y1VJ 3SDGA 4X1EA 4IHYA 3HDDA 4D5CA 3JRAA 5J1YA 2LD5A 4JX4A 1MBFA 1DU0A 1IC8A 1WGXA 2K9SA 4EEFG 3BR5A 3S1MJ 1W0UA 4A3LJ 1T33A 2E2HJ 1UMQA 3TP0A 3OSFA 2CRGA 2LKXA 2E1OA 5BNGA 5IYCJ 5F1JA 3S15J 3Q0WA 1OCPA 3WHBA 2R5ZA 2HXOA 4RDUA 5C44J 1ENHA 1VI0A 4IHXA 1F43A 2IEKA 1JUPA 1ZTRA 2LY9A 2L7FP 2MG4A 1U78A 1RESA 1GDTA 1GUUA 2ECCA 2JWTA 1PUFA 1AU7A 1UHSA 1ZQ3P 3ZQFA 4DZJA 2WB1N 1JKOC 3G1MA 2R5ZB 1JT6A 2DA2A 2NVXJ 4JX5A 2LFBA 3ZQHA 3CCYA 4M3FA 3BTCA 2DA4A 2DA6A 4D7MA 1IGNA 5IYDJ 4HNVA 2XPWA 3BG3A 5F0CA 1ZKGA 1K61A 4JX6A 3Q0UA 4Y52J 2L7MP 2HI3A 3HB9A 4C3HJ 3L1PA 1X2NA 1MH4A 2X6OA 2HQ5A 4A3MJ 2D5VA 3FKIJ 2W48A 5HODA 1Y1WJ 3BG5A 1U8BA 1RPWA 3TW6A 1TWHJ 3M3YJ 1JT0A 2OF7A 4FCYA 2YUSA 5JLWA 1WH7A 4M6VA 1H89C 5M5WJ 2DA1A 3K7AJ 2PMZN 2XSDC 1D5YA 2JA5J 2HOAA 5F0HA 5IP6A 2ZB9A 1O4XA 3LNQA 1IV6A 2CU7A 1TWAJ 2EH3A 1IDZA 4I6ZA 1FIAA 2ME0A 2FX0A 5M5YJ 2NS8A 3GTLJ 5K7HA 5IP7J 2DN0A 2VI6A 5F04A 1GV2A 4GFBA 1AKHB 4UUTA 4S0HB 1HDDC 2GM4A 1JGGA 2KT0A 4D5FA 1ZR2A 2L9RA 1X58A 3JR9A 4A3EJ 5IP9J 3HOVJ 1EF4A 2TCTA 3ZOBA 3W6VA 5M3MJ 2K40A 3BT9A 2X48A 4FTHA 2LLKA 3OIOA 5FKLA 3ZQCA 1LE8B 3HOYJ 2LP0A 4JYKA 4B1RA 3GTKJ 1HLVA 2H1KA 1VNDA 2NOGA 1ETWA 1IDYA 4XRMA 1QPIA 1TWGJ 1CQTA 5EGOB 1HOMA 1MNMC 2EBIA 1H8AC 4M3BA 3JREA 3JRDA 4X6AJ 3I4NJ 5C3EJ 3PO2J 3FK6A 2R0QC 2JN6A 3DCFA 2LVSA 4C2MJ 1GT0C 1OFCX 4XIDA 1MBGA 1JTYA 3B6AA 4BY7J 5EG0B 4CYCB 2I10A 2NVTJ 1RR7A 4D7NA 1SANA 5IOZA 1YRNA 1B8IB 1XS9A 3ZQIA 3JRHA 1ITYA 4DYRA 1NK3P 4ABZA 1Q1VA 1X2MA 3M4OJ 4BKXA 3HGYA 1P7IA 3Q3SA 1IJWC 3BQYA 1F36A 5IOYA 4B3AA 1MH3A 1WPKA 5IPAA 3S2HJ 1ETXA 2EQRA 1YRNB 1QVTA 2RAEA 5M3FJ 3FK7A 1IRZA 3A01A 2E19A 4BY1J 2M34A 3TP3A 3C2BA 5EEAA 1BW6A 3BR6A 3JRGA 1BL0A 1IUFA 1IG7A 2VUMJ 5C4XJ 1NK2P 3ZQLA 3HGGA 1HF0A 3SFIA 1JJ8C 3FIWA 3IH2A 2MW8A 2XPVA 1FTTA 4MFEA 2OPTA 1MSEC 4A3CJ 1NTCA 1HDPA 1TC3C 3A01B 2QF7A 4XRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LSJ A;  5FLV A;  3H3V K;  2XPU A;  3A03 A;  1ZGW A;  1MBH A;  3PO3 J;  3H0G J;  3F0C A;  1Z77 A;  3GTO J;  3BR3 A;  4IHW A;  1Z0X A;  5DS9 A;  3CDL A;  1G2H A;  3A02 A;  2QCO A;  4BBR J;  2O8K A;  1QVU A;  4DYC A;  2VKE A;  3LSR A;  2LR8 A;  2XB0 X;  2CUE A;  1MBJ A;  2CUF A;  2R5Y B;  2WV1 A;  3BTI A;  3RKQ A;  3IH4 A;  2EZK A;  3GBG A;  3S1R J;  4BXX J;  1MBE A;  5EYR A;  4DYQ A;  4W97 A;  1JKP C;  3HBL A;  4MFD A;  1AKH A;  2ELK A;  2NVY J;  3IV5 A;  1LFB A;  2DA7 A;  3RZD J;  1H88 C;  4A3B J;  2M8G X;  4J19 A;  2Y9Y A;  4XRS G;  1RKW A;  2M0C A;  1LE8 A;  4Y7N J;  4MO7 A;  2DMQ A;  2B63 J;  2Y30 A;  2Y2Z A;  3O8G A;  4B4C A;  1OCT C;  1TWC J;  1TWF J;  2MSY A;  4A3G J;  3CQZ J;  5FKO A;  4C3J J;  5EGO A;  3LSG A;  1FEX A;  3HOZ J;  4FIS A;  4MIM A;  3JRF A;  1A6I A;  2JK3 A;  1JUS A;  3S14 J;  4I76 A;  3BR0 A;  4A93 J;  1I50 J;  3HM5 A;  1I3Q J;  2COB A;  3MKL A;  5FKK A;  1MBK A;  3PM1 A;  2XGC A;  4AC0 A;  4M3D A;  3K2A A;  3I4M J;  5EG0 A;  4CYC A;  3GTJ J;  1FTZ A;  3TED A;  4IHV A;  3SJM A;  1FJL A;  5M5X J;  2YS9 A;  5GPA A;  5J1R A;  3GTM J;  1B8I A;  1RET A;  3QPS A;  2FD5 A;  4XIC A;  3HEF A;  4NDL A;  4A69 C;  1XC5 A;  2DMU A;  2P81 A;  3DEW A;  3GTG J;  4A3I J;  3GTQ J;  5E3L A;  4DW6 A;  3TW7 A;  2M2E A;  3BR1 A;  2X9D A;  4UUS B;  3MVP A;  2K9N A;  5EDN A;  1UG2 A;  5DTD A;  1R9T J;  2JA7 J;  4FE4 A;  4LOC A;  5F27 A;  3QPL A;  2CQQ A;  5FKM A;  4QSH A;  2IAI A;  2Y0S N;  2R7Z J;  1JJ6 C;  1LFU P;  2CQX A;  2EZI A;  1SFO J;  2GBY A;  5E3O A;  2M9H A;  2L7Z A;  2DA3 A;  4M3E A;  2DA5 A;  5EZH A;  2VPR A;  4C3I J;  2AHQ A;  1BJZ A;  4V2F A;  2JJ7 A;  3HOX J;  3O8H A;  2HOS A;  2ECB A;  3OSG A;  1HCR A;  1ETV A;  4A3D J;  1BA5 A;  5F08 A;  2EZL A;  3NAR A;  3LSP A;  1VFC A;  1U9N A;  2K9Q A;  1T56 A;  2HYJ A;  4IEJ A;  3S1N J;  1P7J A;  3JRC A;  2MGQ A;  2DMP A;  5EF6 A;  2WAQ N;  5GP9 A;  1S7E A;  3S2D J;  4A3K J;  5EZG A;  1JTX A;  3ZQG A;  2R5Y A;  3CMY A;  2H8R A;  4V2G A;  3IH3 A;  2DMN A;  3BTL A;  2IBD A;  4JP0 A;  3JRB A;  1E3O C;  1VF9 A;  4AYB N;  4BBS J;  1WH5 A;  3S1Q J;  2G0E A;  3RQI A;  3HKZ N;  3BQZ A;  5K7F A;  3D1N I;  1W0T A;  2XRL A;  3RZO J;  1JUM A;  4A3F J;  1PUF B;  3S16 J;  2KDZ A;  2YU9 J;  1GVD A;  3BTJ A;  3UKG A;  1QRY A;  4A3J J;  4W1U A;  1B72 A;  2VKV A;  2R92 J;  1MSF C;  1DU6 A;  2HDD A;  2FQ4 A;  4DZP A;  3MN2 A;  1ZR4 A;  5FKN A;  4QTR A;  1OJL A;  1U9O A;  2R93 J;  3E7L A;  2NVQ J;  3GTP J;  1GV5 A;  1JKQ C;  2DJN A;  2O7O A;  5E3M A;  3S17 J;  2FJ1 A;  5C4J J;  1B72 B;  2E2J J;  2JMW A;  2ID6 A;  2HOT A;  5FJ8 J;  1K83 J;  5J1U A;  2ME6 A;  2DMT A;  3G1O A;  3HOW J;  1ZK8 A;  5JLX A;  3QQA A;  2XGD A;  1XG1 A;  4XK4 A;  5IYB J;  2TRT A;  4FE7 A;  1WCM J;  2NS7 A;  5K7Z A;  3NAU A;  2ID3 A;  2N8G A;  2LTP A;  1WI3 A;  2JA6 J;  2E2I J;  2GLO A;  2CJJ A;  4M3G A;  2EZH A;  3BR2 A;  4UUS A;  5GPC A;  3BG9 A;  4AUX A;  1A5J A;  2LK2 A;  5FLM J;  1APL C;  2Y31 A;  1ETO A;  4MLO A;  4G12 A;  1JKR C;  5E3N A;  1ETK A;  3B6C A;  3LOC A;  3OOU A;  2O9L A;  3G1L A;  1ETQ A;  1POG A;  5J3L A;  1AHD P;  3JRI A;  4QIW N;  2DTZ A;  1BW5 A;  3HOU J;  3Q0V A;  2Y9Z A;  9ANT A;  3VPR A;  1ETY A;  1RKT A;  1FIP A;  4RBO A;  1ORK A;  3FIS A;  5F0F A;  2XGE A;  2AO9 A;  2XB5 A;  4L5E A;  2HXI A;  2L0K A;  2JA8 J;  1I6H J;  3WHC A;  1Y1V J;  3SDG A;  4X1E A;  4IHY A;  3HDD A;  4D5C A;  3JRA A;  5J1Y A;  2LD5 A;  4JX4 A;  1MBF A;  1DU0 A;  1IC8 A;  1WGX A;  2K9S A;  4EEF G;  3BR5 A;  3S1M J;  1W0U A;  4A3L J;  1T33 A;  2E2H J;  1UMQ A;  3TP0 A;  3OSF A;  2CRG A;  2LKX A;  2E1O A;  5BNG A;  5IYC J;  5F1J A;  3S15 J;  3Q0W A;  1OCP A;  3WHB A;  2R5Z A;  2HXO A;  4RDU A;  5C44 J;  1ENH A;  1VI0 A;  4IHX A;  1F43 A;  2IEK A;  1JUP A;  1ZTR A;  2LY9 A;  2L7F P;  2MG4 A;  1U78 A;  1RES A;  1GDT A;  1GUU A;  2ECC A;  2JWT A;  1PUF A;  1AU7 A;  1UHS A;  1ZQ3 P;  3ZQF A;  4DZJ A;  2WB1 N;  1JKO C;  3G1M A;  2R5Z B;  1JT6 A;  2DA2 A;  2NVX J;  4JX5 A;  2LFB A;  3ZQH A;  3CCY A;  4M3F A;  3BTC A;  2DA4 A;  2DA6 A;  4D7M A;  1IGN A;  5IYD J;  4HNV A;  2XPW A;  3BG3 A;  5F0C A;  1ZKG A;  1K61 A;  4JX6 A;  3Q0U A;  4Y52 J;  2L7M P;  2HI3 A;  3HB9 A;  4C3H J;  3L1P A;  1X2N A;  1MH4 A;  2X6O A;  2HQ5 A;  4A3M J;  2D5V A;  3FKI J;  2W48 A;  5HOD A;  1Y1W J;  3BG5 A;  1U8B A;  1RPW A;  3TW6 A;  1TWH J;  3M3Y J;  1JT0 A;  2OF7 A;  4FCY A;  2YUS A;  5JLW A;  1WH7 A;  4M6V A;  1H89 C;  5M5W J;  2DA1 A;  3K7A J;  2PMZ N;  2XSD C;  1D5Y A;  2JA5 J;  2HOA A;  5F0H A;  5IP6 A;  2ZB9 A;  1O4X A;  3LNQ A;  1IV6 A;  2CU7 A;  1TWA J;  2EH3 A;  1IDZ A;  4I6Z A;  1FIA A;  2ME0 A;  2FX0 A;  5M5Y J;  2NS8 A;  3GTL J;  5K7H A;  5IP7 J;  2DN0 A;  2VI6 A;  5F04 A;  1GV2 A;  4GFB A;  1AKH B;  4UUT A;  4S0H B;  1HDD C;  2GM4 A;  1JGG A;  2KT0 A;  4D5F A;  1ZR2 A;  2L9R A;  1X58 A;  3JR9 A;  4A3E J;  5IP9 J;  3HOV J;  1EF4 A;  2TCT A;  3ZOB A;  3W6V A;  5M3M J;  2K40 A;  3BT9 A;  2X48 A;  4FTH A;  2LLK A;  3OIO A;  5FKL A;  3ZQC A;  1LE8 B;  3HOY J;  2LP0 A;  4JYK A;  4B1R A;  3GTK J;  1HLV A;  2H1K A;  1VND A;  2NOG A;  1ETW A;  1IDY A;  4XRM A;  1QPI A;  1TWG J;  1CQT A;  5EGO B;  1HOM A;  1MNM C;  2EBI A;  1H8A C;  4M3B A;  3JRE A;  3JRD A;  4X6A J;  3I4N J;  5C3E J;  3PO2 J;  3FK6 A;  2R0Q C;  2JN6 A;  3DCF A;  2LVS A;  4C2M J;  1GT0 C;  1OFC X;  4XID A;  1MBG A;  1JTY A;  3B6A A;  4BY7 J;  5EG0 B;  4CYC B;  2I10 A;  2NVT J;  1RR7 A;  4D7N A;  1SAN A;  5IOZ A;  1YRN A;  1B8I B;  1XS9 A;  3ZQI A;  3JRH A;  1ITY A;  4DYR A;  1NK3 P;  4ABZ A;  1Q1V A;  1X2M A;  3M4O J;  4BKX A;  3HGY A;  1P7I A;  3Q3S A;  1IJW C;  3BQY A;  1F36 A;  5IOY A;  4B3A A;  1MH3 A;  1WPK A;  5IPA A;  3S2H J;  1ETX A;  2EQR A;  1YRN B;  1QVT A;  2RAE A;  5M3F J;  3FK7 A;  1IRZ A;  3A01 A;  2E19 A;  4BY1 J;  2M34 A;  3TP3 A;  3C2B A;  5EEA A;  1BW6 A;  3BR6 A;  3JRG A;  1BL0 A;  1IUF A;  1IG7 A;  2VUM J;  5C4X J;  1NK2 P;  3ZQL A;  3HGG A;  1HF0 A;  3SFI A;  1JJ8 C;  3FIW A;  3IH2 A;  2MW8 A;  2XPV A;  1FTT A;  4MFE A;  2OPT A;  1MSE C;  4A3C J;  1NTC A;  1HDP A;  1TC3 C;  3A01 B;  2QF7 A;  4XRS A; 
#chains in the Genus database with same CATH topology
 4JOM A;  5FLV A;  3H3V K;  2XPU A;  3A03 A;  3PJR A;  4GGG A;  4KNY A;  3WU0 A;  5CJ9 A;  4MGR A;  3DTE A;  1Z0X A;  2M3A A;  3OYJ A;  1F1Z A;  3CCJ I;  2PG4 A;  1AA7 A;  2A69 F;  2QCO A;  4X0G A;  1PP7 U;  3MKY B;  4II3 A;  2JQ7 A;  3S2W A;  2CUE A;  1VQ4 I;  4LLN A;  2K86 A;  4ZDL A;  4FAS D;  1BJA A;  1UCR A;  1Y6I A;  3RIR A;  3ZR8 X;  2EZK A;  4OMZ A;  2HVS A;  4CHU A;  1I1G A;  2Z99 A;  1KU7 A;  4BXX J;  3VFZ A;  2YU3 A;  5E1Z B;  1K79 A;  1JKP C;  4MFD A;  2EK5 A;  2GXA A;  1OCC H;  2ELK A;  4CH7 A;  2HZD A;  1DGW Y;  3KZZ A;  4LB6 B;  3PFI A;  2IPQ X;  1FY7 A;  5H20 A;  3IRR A;  1TT5 B;  4XRS G;  3K69 A;  2RRE A;  1MDM B;  2FRH A;  4MO7 A;  4XM3 A;  3O8G A;  3S93 A;  4Z6Y A;  3CQZ J;  1TTY A;  2RVC A;  5EGO A;  1VQL I;  2D45 A;  3JRF A;  2F48 A;  2F4O B;  3U1K A;  2PJR A;  3RPQ A;  2VBW A;  4BQA A;  2RC4 A;  1I50 J;  5DUK A;  2COB A;  4F55 A;  1MGT A;  4BE1 A;  3HJE A;  3FBN B;  4ZDP A;  4M3D A;  1FC3 A;  1S7A A;  3CCE I;  2CV0 A;  1OPC A;  5E79 C;  2LOO A;  3L9F A;  3SJM A;  3V7R A;  5M5X J;  1IN7 A;  1FJL A;  5GPA A;  1B8I A;  1SFX A;  2MH2 A;  3H5N A;  3MKZ A;  1XC5 A;  2DXI A;  4NBQ A;  4A3I J;  3I58 A;  4CA0 A;  4ON0 A;  2HU9 A;  5B3S H;  4CXF A;  4RMN A;  4E70 A;  1IXS B;  2F2E A;  2W82 A;  2EJR A;  4XLA A;  4UNO A;  2Z2S B;  4WWC A;  1Y0N A;  5FKM A;  4QSH A;  1LDD A;  2Y0S N;  1JJ6 C;  1R7J A;  2NNN A;  3M7G A;  2R7O A;  3DKX A;  3HC7 A;  4HX7 A;  4OIQ F;  1SVO A;  1SFO J;  4BDZ A;  2ZKZ A;  1YIJ I;  3SDB A;  4L9V A;  1CF7 B;  2UV1 A;  4EJW A;  5EZH A;  1V54 H;  2IW5 A;  2AHQ A;  1BJZ A;  4B48 A;  3IWZ A;  3RDI A;  2VXD A;  4V2F A;  4DIQ A;  3HRU A;  2EFQ A;  3K1N A;  5HOO A;  1WJF A;  2KFD A;  2DYR H;  3L2C A;  4A3D J;  1L3L A;  5F08 A;  2QLZ A;  1R36 A;  2EZL A;  1VFC A;  2K9Q A;  1SC7 A;  1T56 A;  2GIZ A;  4IEJ A;  1P7J A;  2K85 A;  3FHN A;  3CUO A;  4RAG A;  2M30 A;  3QOD A;  3QAH A;  4L9T A;  2Y0M A;  3IRQ A;  4MEY F;  1BR1 A;  4A3K J;  2P7V B;  2E1N A;  2CW8 A;  1R5G A;  3R0A A;  3CMY A;  1HA8 A;  2UWM A;  3IH3 A;  2KLO A;  2IBD A;  4KYW A;  2DDB A;  3KP4 A;  5E8I A;  1W7P B;  3K1P A;  1E3O C;  1XTA A;  2V1N A;  3P9C A;  4NHJ A;  1WH5 A;  1LVK A;  4O6J A;  3SEZ A;  2ELH A;  4XMY A;  4RB1 A;  2K02 A;  4CCJ A;  5L3E A;  3ELK A;  4Q4Z F;  1W0T A;  3LQQ A;  2XRL A;  3IL2 A;  3RZO J;  5F64 A;  1W4M A;  4UUV A;  3F9K A;  2EPF A;  3PFY A;  3BG6 A;  2YU9 J;  4BJ5 C;  1QZY A;  4IX7 A;  3BTJ A;  4A3J J;  5FLX Z;  3GCM A;  4DOZ A;  2NXN B;  1K78 B;  1ZR4 A;  1UEL B;  5FKN A;  1IN6 A;  3CDH A;  2JA2 A;  4F91 B;  4QTR A;  4CCN A;  4CO8 A;  3ZMU A;  1D0Y A;  2F6C A;  5LEJ A;  3KYL A;  1GV5 A;  5BPI A;  1K4T A;  3GTP J;  4Y17 A;  5E3M A;  4RB3 C;  1EH8 A;  2FJ1 A;  1YO5 C;  2BHZ A;  1B72 B;  5LFA A;  2E2J J;  4YFK F;  2JMW A;  3TMO A;  5FJ8 J;  1ZRF A;  1E17 A;  2DMT A;  4NB5 A;  1OR7 A;  1V5G A;  5LLQ A;  3KZY A;  4FET A;  1D8K A;  1IW7 F;  2NS0 A;  5JLX A;  3J80 K;  4HLY A;  5IYB J;  5D8L B;  2VXZ A;  3ZQQ A;  1WCM J;  5D6F A;  5K7Z A;  3MZY A;  4OOI A;  3CC4 I;  3DU6 A;  3RYR A;  2LTP A;  3C2G A;  5AON A;  5D5V B;  1VTN C;  4G7H F;  2GLO A;  1XMX A;  1QO0 D;  6PAX A;  1NG6 A;  2EZH A;  3HPG A;  4XLN F;  3RTR A;  4L0Z B;  1YIO A;  2O8X A;  4ESB A;  3FBI B;  2MYS A;  1APL C;  1N77 A;  1LEA A;  2BY0 A;  3QU3 A;  3QOP A;  1IO2 A;  5E8G A;  2DFE A;  5FFZ A;  2M7B A;  3ONQ A;  5CKT A;  5KK1 A;  1KU3 A;  2ZFU A;  1P2F A;  4IZZ A;  5GAD J;  4BJ6 C;  2AS5 F;  5CQG A;  2JUG A;  1P9Q C;  3LOC A;  2DPU A;  2O9L A;  1POG A;  3ROU A;  4RA2 A;  3OV8 A;  4CSW A;  1AHD P;  1IXC A;  4QIW N;  2OU2 A;  1E2X A;  3HG9 A;  2E35 A;  2F5V A;  2FBH A;  3ML6 A;  3BZC A;  3UR3 C;  3FIS A;  1W36 D;  2XB5 A;  1V55 H;  2L4A A;  2RQP A;  2L0K A;  3M8F A;  2C6Y A;  2FQ3 A;  1I6H J;  4U88 A;  3CLQ A;  1G3S A;  1Y1V J;  3G71 I;  2OA4 A;  3FX3 A;  1FMW A;  3KLN A;  4PK4 A;  5L3D A;  1U8R A;  4ZTJ A;  3SZT A;  1ON2 A;  3WGI A;  4GYI A;  1U0J A;  4D5C A;  2H6B A;  3FMQ A;  5J1Y A;  4WF2 A;  1FOW A;  4BAY A;  3OOP A;  4JX4 A;  5TGT A;  1FOY A;  1UJ8 A;  1GXQ A;  3OYG A;  3AG3 H;  3GZ5 A;  1LKX A;  2LKP A;  2K9S A;  4HNU A;  3D5R C;  3E5Q A;  3S1M J;  3GFM A;  4UB6 C;  1T33 A;  5KHD A;  1J09 A;  2XKP A;  2CUJ A;  2PI0 A;  4C2T A;  2XSJ C;  4PDK A;  3GZN B;  3AG1 H;  4UHT A;  2CRG A;  3I53 A;  5BNG A;  3K70 C;  5J8C A;  2BHY A;  4EM0 B;  2CFO A;  5JR3 A;  3TDU C;  2B7E A;  4HLX A;  2ZXJ A;  3GZ6 A;  3LSI A;  2E60 A;  3OYC A;  4XSX F;  3CO6 C;  1M1E B;  3E6C C;  2R5Z A;  5GAH J;  3I59 B;  2DOE A;  1F43 A;  2I5U A;  2V4J C;  1X4O A;  1JUP A;  5TRD A;  1S29 A;  1QHG A;  1Z6R A;  1RES A;  1GUU A;  3BPX A;  4IHS A;  1D1B A;  1PUF A;  3ZQF A;  2WBM A;  3OIQ A;  1VZ0 A;  3WTT C;  3CF5 F;  3E6M A;  1E3P A;  4ASN A;  4JX5 A;  2LFB A;  5EEH A;  2H09 A;  1BM9 A;  1S5L C;  1W5T A;  4BNC A;  1D8J A;  2WV0 A;  3SHF A;  1CGP A;  1KQ0 A;  3IWF A;  4ANJ A;  1QHH D;  1JGS A;  2DI3 A;  1Z67 A;  1E0E A;  1VQ6 I;  2HDW A;  2GXB A;  3JTH A;  4I99 C;  2XRN A;  2JSP A;  2ZJP F;  1X2N A;  2VQL A;  2UUZ A;  3FKI J;  4P5O A;  1U5T C;  3EUA A;  5HOD A;  1H0M A;  1OR7 C;  1D3Y A;  2QUF A;  1G8X A;  2H8W A;  1G6N A;  2OF7 A;  4AU7 A;  3MZ8 A;  3CP8 A;  1XN7 A;  2M8E A;  1YE9 A;  1BI3 A;  5M5W J;  2ICW G;  3P7N A;  2JA5 J;  4LIT A;  2ZB9 A;  1LQ1 A;  4B09 A;  2EH3 A;  4F92 B;  4OMY A;  2NYX A;  3IAS 2;  2BXY A;  3HRM A;  2X0L A;  3KCC A;  5DUI A;  2DN0 A;  5F04 A;  5J47 A;  2E1C A;  4GFB A;  2BE5 F;  4P96 A;  1X3U A;  2IVM A;  4WCG A;  4L5J A;  3K10 A;  2GM4 A;  3DKY A;  3PSF A;  1V3F A;  2KT0 A;  4D5F A;  3JR9 A;  5F1R A;  2K40 A;  2R7R A;  1IRF A;  2LLK A;  4FX0 A;  2V6E A;  5ILU A;  4ENK A;  1IUY A;  1YJ9 I;  1QNT A;  2H1K A;  3CP2 A;  4BDY A;  1VND A;  1ETW A;  1IDY A;  2VON A;  2DYS H;  3H5A A;  1CQT A;  5IT9 K;  2MD5 A;  2E5Z A;  3R4K A;  5H2F C;  2M7A A;  4E7H A;  1H8A C;  2MD0 A;  1IRG A;  4X6A J;  2ZJQ F;  2K5C A;  3FK6 A;  3OYA A;  2OTJ I;  2JN6 A;  4HNT A;  4HX8 A;  1GT0 C;  1OFC X;  2W1O A;  4XID A;  1MBG A;  1JTY A;  2VE9 A;  3S3N A;  3HHG A;  2IGM A;  2D1V A;  4ZYA A;  2BW3 A;  5D6E A;  2MBF A;  4HZF A;  1OCO H;  1X1D A;  3BY6 A;  3ZQI A;  5DDG A;  4I7H A;  4DYR A;  3OS1 A;  2V79 A;  2P6S A;  1XGS A;  1X1A A;  3K4K A;  4RLF A;  3CCQ I;  1Q1V A;  5LHH A;  3M07 A;  3R61 A;  2DQL A;  1SFU A;  1A35 A;  4G94 A;  4IVN A;  1P7I A;  3VDX A;  2O3F A;  2NAZ A;  4IHT A;  3GFI A;  4B3A A;  2EQR A;  4EMS A;  5ICF A;  3OYI A;  1XCV A;  1R1U A;  2RAE A;  3RJP A;  4N9H A;  1HKS A;  2K7L A;  2LC2 A;  2DJI A;  2IXS A;  2MA3 A;  4YII A;  3LSK A;  2ZFW A;  4HOB A;  4G6T B;  2K9M A;  3VYT B;  1KA8 A;  1BL0 A;  2VUM J;  2W00 A;  2G7H A;  3VYS B;  4XKC A;  1TNT A;  3SFI A;  3KX2 A;  3QRF F;  4HYE A;  3IH2 A;  2XPV A;  2PLY A;  4CZC A;  5F6F A;  1WFX A;  1NTC A;  2L4M A;  2OJE D;  2M45 A;  2GWR A;  2ZME B;  5JHU A;  2QF7 A;  2WTE A;  3IKV A;  2E7X A;  3J7Y J;  4HQE A;  2R7W A;  5LHI A;  2R7V A;  4DGW B;  4MQV A;  3LSJ A;  3WGH A;  1XSV A;  1ZGW A;  1XDS A;  3CC7 I;  4YFN F;  3PUF A;  4HBL A;  3E5X A;  2JSC A;  1FBS A;  4HV5 A;  4EGY A;  3BR3 A;  4IHW A;  4XSZ F;  4BS9 A;  2LYC A;  5LGT A;  4OU0 A;  2JT1 A;  4GDF A;  2O8K A;  4DYC A;  2OAZ A;  2LR8 A;  5JVT A;  3HSR A;  3QP5 A;  2CUF A;  3HIF A;  3BTI A;  3RKQ A;  2ZCW A;  2BY3 A;  5JHF A;  2VBZ A;  3M1C A;  3F8M A;  4MTE A;  4M74 A;  2LF8 A;  1FYK A;  4HEA 2;  1T39 A;  4W97 A;  2X6Y A;  5HNH A;  2OD5 A;  2NVY J;  3IV5 A;  2HQR A;  3K4J A;  3J80 Z;  1S72 I;  2Z3Y A;  2X1E A;  1H88 C;  2JPB A;  1ZLK A;  2M8G X;  2MC3 A;  5DM6 F;  1RKW A;  4O5V A;  4L18 B;  1SFK A;  5CQE A;  1LE8 A;  2OZ6 A;  1OYI A;  2B63 J;  2FSW A;  2Y30 A;  2W57 A;  3RPU D;  3JAM K;  1OCT C;  1ZYR F;  3H1C A;  1R1T A;  1SMT A;  1TWF J;  1YS6 A;  5DV5 A;  4A3G J;  5FKO A;  2OBP A;  2WY8 Q;  2XF7 A;  4FIS A;  3HTS B;  1A6I A;  2EA2 A;  1P4A A;  1O7L A;  2VJI A;  2JK3 A;  1JUS A;  4K2E A;  1VQM I;  3BR0 A;  4F7Z A;  4RB0 A;  2DAO A;  4XLH A;  3FXO A;  3CCU I;  1I3Q J;  3LWF A;  3MKL A;  1W7P D;  1K7A A;  3PM1 A;  2J5P A;  1TT0 A;  1ZAO A;  2R4G A;  4KT5 C;  4B47 A;  1XPX A;  5EG0 A;  4OIP F;  3I4M J;  1MMS A;  2EIL H;  2Q2E A;  3TED A;  3K4C A;  5J1R A;  1MJA A;  3GTM J;  3BC8 A;  4LMY A;  2P5K A;  1LEB A;  2FD5 A;  2P81 A;  3GTG J;  2OQR A;  2M2E A;  2X9D A;  4UUS B;  2YPR A;  3DPL C;  1LPQ A;  2K9N A;  5EDN A;  3TO7 A;  1RUN A;  2RN7 A;  2BVM A;  2FXA A;  3B73 A;  2JZY A;  2DFI A;  1BN5 A;  2A61 A;  2KRF A;  5F27 A;  3GYH X;  3W2A A;  3I64 A;  2FE3 A;  3U1D A;  2B9S A;  2I8D A;  2R7Z J;  3ECH A;  3F6O A;  2MC4 A;  4S05 A;  4PGG A;  2CQX A;  2EZI A;  1ZH5 A;  1SD6 A;  2BXZ A;  4GXO A;  1ZRE A;  2F4I A;  1HW5 A;  2L7Z A;  2DA3 A;  4Q47 A;  2XRO A;  3M8J A;  3BCB A;  5HS8 A;  2O03 A;  3F8C A;  3MKW B;  1EV7 A;  3GVA A;  1GXP A;  3BZ6 A;  3O8H A;  2XAQ A;  1UHM A;  3K4L A;  1HCR A;  1ETV A;  1NG7 A;  3WTW C;  1BA5 A;  4HF0 A;  3VYR B;  2XF6 A;  3NAR A;  3OMY A;  1U9N A;  2KZG A;  2XGX A;  4DBR A;  1VQO I;  1YS7 A;  1ACI A;  1UB9 A;  2K4B A;  2OV7 A;  2QEN A;  3C7J A;  2EFO A;  3JSO A;  1LJ9 A;  1ZN2 A;  1IF1 A;  1HSJ A;  3HRT A;  2F5E A;  3HRS A;  2R3S A;  1PDN C;  3N4M A;  4ZDO A;  1TNS A;  2ZXW H;  5E18 F;  4QWQ A;  4ZC3 A;  1B1B A;  3ZQG A;  2R5Y A;  2DBB A;  1ZGA A;  5AIQ A;  4V2G A;  4CCO A;  1HST A;  4BUP A;  3D5S C;  2HQA A;  2FBI A;  4EAT A;  1VF9 A;  3I3L A;  4BHB A;  3E6B A;  1WKM A;  1FT9 A;  1EKE A;  2Z9O A;  1WJB A;  3BQZ A;  3PL8 A;  2NVU B;  5ICC A;  3WG9 A;  2EFN A;  2FML A;  3OYB A;  3P9I A;  1Z21 A;  4BQQ A;  1JUM A;  2NOJ B;  3HL2 A;  4N4N B;  4A3F J;  5TJJ A;  1SFE A;  3DPU A;  4LIU A;  2KDZ A;  3VOE A;  1K6O A;  4BQO A;  4HPQ A;  1GVD A;  4HSR A;  4ZYG A;  4NC8 A;  3UKG A;  4W1U A;  1B72 A;  2R92 J;  4IQ4 A;  5HDG A;  4BEH B;  1MSF C;  1XD7 A;  2FQ4 A;  3MN2 A;  5CVU A;  1X4P A;  2GA2 A;  1LDK B;  2EV0 A;  1UFM A;  3FMS A;  1OJL A;  1U9O A;  4QPO A;  4A5N A;  1B9M A;  3CJN A;  1R5H A;  2R93 J;  1JKQ C;  4IQJ A;  5FGM A;  3WOD F;  1Y8R B;  1YG2 A;  4G9Y A;  3E0J B;  5J1U A;  2KJC A;  3G1O A;  2HPM A;  2RNG A;  2KL4 A;  1ZK8 A;  1WJE A;  1ERD A;  4QLC U;  2XGD A;  1XG1 A;  4XK4 A;  3LSH A;  2TRT A;  3HUG B;  2QQ8 A;  3ABU A;  3DBR B;  1ZG3 A;  3H36 A;  4LG3 A;  3BJA A;  2MLG A;  2DPD A;  2ACJ A;  3I9V 2;  3BG9 A;  2A07 F;  2LK2 A;  1PP8 F;  4YIR X;  2CSO A;  4LK0 F;  3K2Z A;  1T2K A;  5HNF A;  2L01 A;  2M5W A;  1B59 A;  1WWX A;  2GQQ A;  4I2O A;  3A0B C;  2ZSH B;  2HTJ A;  4UVB A;  4IO9 F;  3A1Y A;  1Y8Q B;  3G3Z A;  5E3N A;  2HDC A;  4PSX A;  3OOU A;  2G9W A;  3G1L A;  2VOO A;  1ETQ A;  2LBF A;  3Q9S A;  3OYD A;  4LIV A;  1ODD A;  1ZRD A;  3JRI A;  3M9A A;  2Q1Z B;  1XCB A;  3UNG C;  3WGG A;  2Y9Z A;  9ANT A;  1BC8 C;  1ETY A;  1D0Z A;  3KP3 A;  1RKT A;  4RBO A;  1ORK A;  4GRI A;  2JRM A;  3C2H A;  5EEG A;  1ZG5 A;  3I71 A;  2XGE A;  3WTY C;  4L5E A;  1T98 A;  4LLG F;  2HXI A;  3K70 D;  3WE3 A;  2JA8 J;  2DO7 A;  3WHC A;  2M87 A;  1MND A;  3AG4 H;  3QYF A;  3FXL A;  3SDG A;  4X1E A;  1Y39 A;  4IHY A;  2F5D A;  2VKH A;  2PFB A;  5HLG A;  3HDD A;  3V7C A;  1STZ A;  4XLC A;  2LD5 A;  4J01 A;  4D0P A;  2E1M C;  1DU0 A;  1RI7 A;  4UVA A;  1IC8 A;  3S8P A;  1WGX A;  2HEO A;  2P7C B;  2R7Q A;  4BXF A;  4HG2 A;  1TQP A;  2RNJ A;  4MQ9 F;  2AQE A;  4PJJ A;  1UMQ A;  2ISZ A;  2BVL A;  1R4M B;  3T1B A;  3NWS A;  3PQJ A;  3OSF A;  2PBI A;  2ZJR F;  5IYC J;  5ILS A;  1D5V A;  3S15 J;  1OCP A;  2CGP A;  3AKZ A;  3FHZ A;  2DW4 A;  2HR3 A;  4RDU A;  5C44 J;  1VI0 A;  3KPH A;  1PJR A;  2Z33 A;  1BIA A;  2IEK A;  4KMU X;  4KMF A;  3WU2 C;  3EPZ A;  2QQB A;  2VL8 A;  1U78 A;  2HYG D;  1GDT A;  2ECC A;  1UHS A;  3TOA A;  4DZJ A;  4R8H A;  1XDU A;  3G2B A;  2QA4 I;  3OYM A;  3H0D A;  1DP3 A;  1JHF A;  2NVX J;  4M3F A;  2DA4 A;  2UXX A;  3MZH A;  3FKJ A;  2V7F A;  3GO5 A;  4HNV A;  3S32 A;  2CH0 A;  4AVZ A;  4LG0 B;  2KIS A;  3GF2 A;  2LKS A;  2E71 A;  2XPW A;  5LBQ A;  5BS6 A;  5F0C A;  5DCM A;  1K61 A;  3H9J A;  4JX6 A;  3VSL A;  4Y52 J;  2LG4 A;  2HI3 A;  2LSO A;  1D1A A;  2XHK A;  1MH4 A;  2BY1 A;  2X6O A;  2O5R A;  4XOR A;  2EV6 A;  2HQ5 A;  4UY8 I;  4IOC F;  4H4K C;  2MLK A;  1R5I D;  3CME I;  5LD2 C;  2W48 A;  2Q0O A;  3E1S A;  2L7K A;  4E7S A;  4AIJ A;  4M9Z A;  1FNN A;  1Z91 A;  5L3F A;  3Q5F A;  1JT0 A;  1I5Z A;  3S3M A;  1O3R A;  2YUS A;  4I98 B;  3FXU A;  1QGP A;  5KAI C;  3SZG A;  3EQL F;  3MAJ A;  1H89 C;  2M4G A;  5D4R A;  4V19 K;  1S3J A;  2EFP A;  2LDU A;  4WXC A;  2XSD C;  3JAM Z;  2AXL A;  2HOA A;  4A2U A;  3FXJ A;  5IP6 A;  1BR2 A;  5ICG A;  1XSX A;  3WU1 B;  3LNQ A;  4ESF A;  4BAC A;  1K4S A;  2BV6 A;  4YFX F;  4IOA F;  4E7L A;  4I6Z A;  1FIA A;  2FX0 A;  1TQM A;  2NS8 A;  4XKB A;  5IP7 J;  1T38 A;  3N97 A;  1Z3X A;  1T0F A;  4XLF A;  5L3C A;  2X1C A;  3DFG A;  1VQK I;  3PNT A;  1EH6 A;  1HDD C;  2LMD A;  3H92 A;  1FSE A;  2IGO A;  2HNH A;  3CF2 A;  4NC6 A;  5A2Q K;  4L9J A;  4UXN A;  2L9R A;  3MEX A;  3G73 A;  2FEZ A;  5IP9 J;  3S3O A;  2ESN A;  2X51 A;  1Y56 A;  3ZQC A;  3OIO A;  4XR6 A;  3DKW A;  5LEK A;  4UB8 C;  2VB6 A;  5D4S A;  2VN2 A;  5J4V A;  3GTK J;  2A6T A;  3MD2 A;  1IV8 A;  2X85 A;  3RYP A;  3OR2 C;  2A6E F;  3V8L A;  2UXN A;  1OCZ H;  5FRM A;  5EGO B;  3OY9 A;  1G3T A;  5HDN A;  3V8J A;  2QQ9 A;  4LGW A;  1MNM C;  3CLO A;  4NNJ A;  3DBL B;  1F5T A;  4M3B A;  1SAU A;  4II2 A;  1I39 A;  2DFF A;  2IP2 A;  4RS8 A;  2KIU A;  4WXH A;  1R00 A;  4C9Y A;  4B3X A;  1JI8 A;  2JVG A;  1O3T A;  2LVS A;  1MJB A;  1OMI A;  3CTA A;  3VSK A;  3ABT A;  4BY7 J;  2DOA A;  3C18 A;  1USS A;  3DV8 A;  2VQH A;  1SAN A;  1X19 A;  4B43 A;  5IOZ A;  3HOS A;  1B8I B;  1UAA A;  1JXS A;  1HBX G;  2EIN H;  1TW2 A;  3JRH A;  1MJ9 A;  3TKY A;  3M4O J;  4BKX A;  1ON1 A;  3HGY A;  1J9I A;  1R23 A;  3FWE A;  2P6T A;  1IJW C;  1BR4 A;  3BQY A;  5HVQ C;  1SEU A;  1WPK A;  1YRN B;  3T5X A;  3FXQ A;  3BRO A;  4P1W A;  4ZZD A;  5M3F J;  4L9N A;  2L3D A;  3WTZ A;  1IRZ A;  2KRC A;  2IS2 A;  2QEX I;  1T08 B;  3DWL E;  1YX3 A;  1T8I A;  4S04 A;  3C2B A;  2LH9 A;  5EEA A;  2OCC H;  3FXM A;  2XAJ A;  4HST A;  3ECO A;  2H27 A;  1NK2 P;  3J81 K;  1HF0 A;  2R7T A;  1FOK A;  2O6G E;  3IHU A;  3L7W A;  1JJ8 C;  3QWL A;  2VLA A;  3EUH A;  1MIJ A;  4D1Q A;  2XV4 S;  1MSE C;  4A3C J;  1ONV A;  3BDD A;  4ENJ A;  1B6A A;  3LFU A;  3T8T A;  1TC3 C;  3VB2 A;  1YYV A;  2VE8 A;  3EDP A;  2R7F A;  4C30 A;  1XGN A;  1MBH A;  3IUO A;  3F0C A;  3GTO J;  2R7U A;  3SXY A;  5DS9 A;  3E3V A;  3CUQ A;  3OIP A;  4M6X A;  2PEX A;  1QVU A;  1ZG1 A;  2VKE A;  4G8X A;  3K6G A;  4U7B A;  2XB0 X;  1MBJ A;  4KDP A;  3GLL A;  1B9N A;  2MH9 A;  5B1B H;  4HAM A;  3IH4 A;  1TP4 A;  2OCE A;  3GBG A;  4PJ0 C;  3CC2 I;  2IS6 A;  3F3X A;  4IJA A;  1DDN A;  2XIG A;  5LGN A;  5EYR A;  4DYQ A;  2RQQ A;  3DTK A;  3HBL A;  1AKH A;  3BZK A;  3D5L A;  3FM3 A;  4XRF A;  4O3M A;  1T0F C;  2J5O A;  3LL7 A;  2ETH A;  2HVR A;  4XON A;  4J19 A;  1PUE E;  3CD6 I;  1SVM A;  1D0X A;  2PX9 A;  4HA8 A;  2EV5 A;  2M0C A;  4Y7N J;  3CCR I;  3CO7 C;  2DMQ A;  3H35 A;  3K4M A;  4J00 A;  4B4C A;  2MSY A;  4KA4 A;  3F21 A;  1FBQ A;  1MMN A;  2L9V A;  2ZXI A;  3MMY B;  4C3J J;  2CMP A;  3WG7 H;  3HOZ J;  3KP2 A;  2Z16 A;  4MIM A;  3W3C A;  2GAU A;  5LRR A;  4A12 A;  4I76 A;  2WAQ A;  4XN0 A;  4A93 J;  3HM5 A;  5KCM A;  1FSH A;  2H6C A;  5CPR B;  2ZBK A;  5HLI A;  2XGC A;  1SD5 A;  1TZL A;  1U5T B;  3K2A A;  4CYC A;  3GTJ J;  4Y4R A;  4CDG A;  1FTZ A;  5BQT A;  1ZGJ A;  2YS9 A;  2EIJ H;  1RET A;  3QPS A;  4QPQ A;  4AYB A;  4XIC A;  3HEF A;  4A69 C;  2DMU A;  1YHQ I;  3AG2 H;  3HKZ A;  1H9G A;  4DW6 A;  3TW7 A;  2CV1 A;  3BR1 A;  5D5X B;  4EJT A;  3LA3 A;  2EIK H;  5DD4 A;  3MVP A;  4XQF A;  1P6R A;  4B8X A;  4EV0 A;  1BOA A;  1UG2 A;  1BI0 A;  5DTD A;  5B5E C;  1R9T J;  4FE4 A;  3OS0 A;  3KET A;  3E6D A;  3QPL A;  4IXA A;  3PNV A;  4E4H A;  2IAI A;  1MMA A;  4Y3O A;  5HLH A;  4Y15 A;  2DCE A;  2VBX A;  1LFU P;  2XKO A;  1WJC A;  3LQR A;  3OYE A;  3DLL F;  2GBY A;  2LY1 A;  2M9H A;  4M3E A;  3L2Q A;  2HOE A;  3ABK H;  1O3Q A;  2VPR A;  5FD5 A;  4C3I J;  4RM3 A;  2P0W A;  4PJL A;  4P9U A;  1AOY A;  3X2Q H;  1GHC A;  3EUH C;  2HOS A;  1P92 A;  1YLF A;  3OSG A;  4IL6 C;  1EA3 A;  4ZH4 F;  2HYJ A;  2QWW A;  2VKD A;  3S1N J;  4XOP A;  3HOT A;  2V6C A;  3CCS I;  2W85 A;  2DMP A;  3DPT A;  1C0W A;  4YEL A;  1S7E A;  3I55 I;  3CUQ C;  4I0A A;  1IN5 A;  3S2D J;  2CW7 A;  3U9G A;  3HYI A;  5EZG A;  3U21 A;  3FZV A;  3R6S A;  2KIQ A;  3H3U A;  1IXR C;  2H8R A;  2WAF A;  2W25 A;  1KYW A;  2DMN A;  3GFJ A;  5KVR A;  1E3H A;  4U87 A;  3JRB A;  1OIS A;  4ZJZ A;  4BBS J;  2LNB A;  4OAY A;  1UZC A;  4U0V A;  4ZZL A;  5IT3 A;  2IS1 A;  5CVJ A;  2G0E A;  3F8N A;  2ZNY A;  3RQI A;  2VJ5 A;  1ZLJ A;  3EUK L;  2XAS A;  3P5J A;  5K7F A;  4R1H A;  3HHH A;  2IRF G;  3KP6 A;  1DPU A;  3EYI A;  2X6X A;  1HC8 A;  3ABM H;  3DTI A;  4AID A;  1PUF B;  3S16 J;  1MDM A;  2D2W A;  4EM1 A;  1FYM A;  4Y33 A;  1QRY A;  3G6E I;  1BI1 A;  1DU6 A;  3L2R A;  2HDD A;  2RDP A;  1ULY A;  1YOV B;  4DZP A;  5ED4 A;  1FOX A;  2DOD A;  1UG0 A;  4HF2 A;  1DPR A;  3CJQ B;  2BBY A;  3QYE A;  2KQR A;  5E1X A;  3E7L A;  2NVQ J;  3LMM A;  3S17 J;  4M73 A;  1V5E A;  5C4J J;  1XMK A;  1MMG A;  1K83 J;  2QKL B;  1N25 A;  2ME6 A;  3HOW J;  1FP1 D;  3KP5 A;  1TL8 A;  1TW3 A;  4BGD A;  4TV7 A;  1NHA A;  3DLA A;  2AXT C;  1FP2 A;  1VQ9 I;  2ID3 A;  2XAG A;  2JA6 J;  4NC7 A;  2E2I J;  2A6H F;  2WAE A;  2CJJ A;  1X3W B;  4M3G A;  3BG7 A;  3BR2 A;  3IC7 A;  2IA2 A;  3KE2 A;  2KRH A;  5GPC A;  2RKH A;  3SFZ A;  3ZMT A;  2ELJ A;  2Y31 A;  1VQN I;  3ZMZ A;  1ETO A;  2GA1 A;  2WB1 A;  4MLO A;  4NUB A;  3HSF A;  1SD7 A;  5FD6 A;  2HGC A;  2QBY B;  1JKR C;  1GVJ A;  3K9T A;  2F5F A;  2EFW A;  4DBQ A;  2V1X A;  2DTZ A;  2WY7 Q;  1CF7 A;  2HKX A;  3VPR A;  4A6D A;  5B1A H;  5F0F A;  4ETS A;  1FWZ A;  2F5C A;  2W7N A;  1S6L A;  1YIT I;  4PJM A;  1SD4 A;  5D8K B;  4EJO A;  4RAZ A;  3K4N A;  3V42 A;  2L9S A;  4G7O F;  4HW0 A;  4CYD A;  1FYL A;  3BWG A;  1D1C A;  3AFH A;  4WXD A;  4BH9 A;  2DT6 A;  4XL9 A;  2VAS A;  3DXJ F;  3JRA A;  3COA C;  4KIC A;  4ZYH A;  1R1V A;  1P4W A;  1WQ2 A;  3PUB A;  2FUG 2;  3RPU A;  4Y13 A;  1Y0U A;  3SEQ A;  4WK8 F;  2ZSI B;  2PMZ A;  5FO5 A;  3SZP A;  2KZV A;  5IY5 H;  2QSH X;  4A3L J;  4BQN A;  2E2H J;  3CZ6 A;  3G4S I;  3TP0 A;  2FNP A;  2BW3 B;  3J81 Z;  1SVL A;  4IRG A;  3KZI C;  4JQF A;  4I0B A;  2R7X A;  2LKX A;  2E1O A;  1W7P A;  3R60 A;  2BZT A;  4LD5 A;  1RR8 C;  1RC9 A;  5F1J A;  1R4N B;  4KN7 X;  4F93 B;  4E7I A;  3ZRG A;  2HXO A;  3OWT A;  1ENH A;  4IHX A;  2KMU A;  2VQG A;  4RLQ A;  1TLH B;  3RSN A;  1B4A A;  4HX4 A;  1VQP I;  5FFX A;  3QOE A;  2L7F P;  3TBI A;  3KEQ A;  2ZNZ A;  2FMY A;  2TDX A;  1AU7 A;  2VOD A;  2IGK A;  3A4C A;  4XBF A;  4ESJ A;  3V8K A;  3HZJ A;  1JKO C;  3G1M A;  4LB5 A;  2O61 A;  4OAZ A;  1A6Q A;  1K78 A;  1JT6 A;  4RAY A;  1I27 A;  1OCR H;  3CCY A;  3ZCO A;  4OWR B;  1X1B A;  3RKY A;  3LAP A;  1WJ5 A;  3C3W A;  2Y75 A;  5E1W A;  1O7F A;  2MAB A;  1EJ9 A;  3BG3 A;  1R6R A;  2A68 F;  3Q0U A;  2L7M P;  3CCM I;  3ESW B;  3L1P A;  1UHW A;  4XLE A;  3VEP A;  5D5W B;  1YFH A;  2H1L A;  3OYN A;  1IRX A;  4A3M J;  3KLO A;  1RZ4 A;  1U8B A;  1RPW A;  1R49 A;  1TWH J;  3M3Y J;  2FF4 A;  4CGZ A;  1HQC A;  4BJT A;  3N05 A;  4FCY A;  5L3G A;  5KAF C;  3WTS C;  3WTU C;  4M6V A;  1XMA A;  4NQW B;  2JTV A;  2DK8 A;  4KT6 A;  3O6B B;  3K7A J;  4EJV A;  1YX5 A;  4GYG A;  1MZB A;  4FQG A;  3IAM 2;  3JTG A;  1O4X A;  1FMV A;  3OYK A;  2CO5 A;  3EET A;  5AIP A;  1TWA J;  4U0W A;  2CQ7 A;  3NWT A;  2WA0 A;  2YX7 A;  3CJT B;  1FZP B;  5J8F A;  3GTL J;  3E5U A;  3RQ4 A;  3K0L A;  1VQ8 I;  2DQR A;  4E7K A;  4UUT A;  4PUS A;  2OUM A;  1BBY A;  4LJZ F;  5IT9 Z;  4MEX F;  4YIF A;  1ZR2 A;  3HOV J;  4A3E J;  1EF4 A;  4RM2 A;  4DNC A;  2TCT A;  4EQQ A;  3OS2 A;  2CFX A;  5M3M J;  3BLY A;  3JCU C;  3BT9 A;  3CMA I;  2HTS A;  5ICE A;  5FKL A;  4FTH A;  1LE8 B;  3ZQ7 A;  4JYK A;  4B1R A;  2XF5 A;  1YQA A;  3GEZ A;  4IPA A;  1LUJ B;  2NOG A;  2DTR A;  4CCL A;  1F4K A;  4A6E A;  2W84 A;  2EBI A;  1Z7U A;  3JRE A;  1QQI A;  5HDK A;  3FXK A;  3I4N J;  3KYD B;  5C3E J;  3PO2 J;  3VWB A;  3I0T A;  4FT8 A;  2HKO A;  2R0Q C;  3DCF A;  3ZXS A;  4C2M J;  1LB2 A;  3W6K B;  2YX4 A;  1WHU A;  5EG0 B;  4R79 A;  1GLN A;  2CS3 A;  2Q2E B;  3TO6 A;  2XC7 A;  2DOF A;  3KP7 A;  1YRN A;  2M1B A;  2Y69 H;  1N75 A;  1ITY A;  1W5S A;  1NK3 P;  4ABZ A;  1WJD A;  3I54 A;  5K5R A;  1X1C A;  2X6W A;  4BXU A;  1WJA A;  1X2M A;  3BP8 A;  2DFH A;  3O2P E;  3I59 A;  1G3Y A;  4N4O B;  5GTH C;  3QYB A;  1KQ8 A;  1F36 A;  5IOY A;  3KEO A;  2VJ4 A;  3OYF A;  1MH3 A;  5IPA A;  3S2H J;  2VPL A;  1FPQ A;  4HQM A;  1Z6T A;  3RKW A;  3FK7 A;  2P5V A;  3FXR A;  1KZH A;  1LDJ A;  4AVP A;  2ZJ2 A;  1XSD A;  3H3Z A;  3CDI A;  2E19 A;  1OYY A;  3ZMD A;  1DP7 P;  3TP3 A;  1EH7 A;  2CW0 F;  3BR6 A;  1L0O C;  1S9H A;  2FOK A;  1LNW A;  1IG7 A;  1LVA A;  2OC6 A;  1MNE A;  3I5U A;  1SAX A;  4PFO A;  1PVE A;  3HGG A;  2XUB A;  3OL3 A;  3B02 A;  4KIG A;  3FIW A;  5BOX A;  2MW8 A;  1FTT A;  4UV9 A;  5DD8 A;  5BMZ A;  2HVQ A;  4RGX A;  2HZT A;  2DT7 B;  3A01 B;  3TGN A;  3KIO A;  4E6K G;  3A0H C;  4C2U A;  4XNF A;  1A31 A;  3P9K A;  3OYL A;  2KDO A;  1G3W A;  3AL0 C;  3FMR A;  4P55 A;  5GTI C;  3PO3 J;  3H0G J;  2X1D A;  2XAH A;  1Z77 A;  2E1M B;  4Q48 A;  5TIS C;  5GAG J;  4KIB A;  3CDL A;  4EGZ A;  2VBY A;  1G2H A;  3A02 A;  5ILV A;  4BBR J;  4FX4 A;  3QU6 A;  4P9F A;  4YEJ A;  3EYY A;  3ZMS A;  3LSR A;  2ADU A;  5JFR A;  4AIK A;  4GO1 A;  5E20 A;  3FM5 A;  3DQV C;  1RNL A;  2R5Y B;  2WV1 A;  4EM2 A;  5HLT A;  1U6G A;  5H6R A;  5HS7 A;  4KIS A;  4BU2 A;  2STT A;  1S8N A;  2PQ8 A;  2Y0S A;  1BC7 C;  2QM3 A;  3S1R J;  1MBE A;  4F52 A;  4FHT A;  4BHC A;  5KNL A;  3C1D A;  2V9P A;  4G6D A;  2PJP A;  4M9S A;  2FNA A;  3ZPL A;  1LFB A;  4OIO F;  2DA7 A;  3DF8 A;  4XN3 A;  2DT5 A;  3J7Z I;  3RZD J;  4CZZ A;  4Q5S F;  3JW4 A;  4RAF A;  4A3B J;  2ZO4 A;  1KON A;  2QSF X;  4HF1 A;  2Y9Y A;  1F9N A;  4JBA A;  4RGS A;  2K3F A;  3BPV A;  3GUD A;  1HXD A;  1MD0 A;  4ZYE A;  3NEU A;  5CVR A;  4F3Q A;  3PSI A;  2VQC A;  3GW2 A;  2Y2Z A;  3ZGK A;  4MHG A;  2VC1 A;  3KFW X;  4LK1 F;  1T6S A;  3HPH A;  4HV6 A;  1TWC J;  1U5T A;  1BIB A;  2K27 A;  2M4K A;  2VJJ A;  3QPT A;  4UVC A;  4XOT A;  3REO A;  4D9J A;  1J75 A;  1RUO A;  1FEX A;  3LSG A;  4AD9 A;  1J7K A;  3ZN0 A;  3TDZ C;  1P4X A;  3T8R A;  2VC0 A;  3GXO A;  3K1M A;  1J2X A;  2GOX B;  2P4W A;  3H9Q A;  3LAJ A;  3S14 J;  5E17 F;  3Q9V A;  4A5M A;  5FKK A;  4CCM A;  1MBK A;  1WSU A;  1R22 A;  4AC0 A;  3ASO H;  1V4R A;  4IHV A;  1KU2 A;  5DM7 F;  4PZJ A;  2PJR B;  2H94 A;  2JPC A;  4NDL A;  3BJ6 A;  3HXL A;  4YG2 F;  5JI6 A;  3DEW A;  3OYH A;  3GTQ J;  5E3L A;  1Z9C A;  3L2U A;  3ULQ B;  2CUZ A;  3F23 A;  1QU3 A;  3ISP A;  2UZK A;  2XAU A;  1DGR M;  2KIF A;  4L5I A;  2JA7 J;  2HFH A;  4LOC A;  4RB2 C;  3H9G A;  2CQQ A;  2LRE A;  4I09 A;  2HYF A;  4EJU A;  4G7Z F;  2COM A;  3PIO F;  3ZMV A;  4MTD A;  3OL4 A;  5CYV A;  4LFU A;  2LBF B;  4AIH A;  1FX7 A;  1XB4 A;  4CUG A;  2VT3 A;  2FU4 A;  5E3O A;  2O0Y A;  2RGV A;  1J0R A;  1BI2 A;  5J6X A;  2DA5 A;  1TQI A;  3SQN A;  1BOB A;  3U2R A;  3IP4 B;  3MWM A;  4XLP F;  2JJ7 A;  2ZME A;  3E97 A;  3DU5 A;  3HOX J;  2ECB A;  3DP7 A;  4A0Z A;  4BHP A;  4I01 A;  3VOD A;  2BY2 A;  3LSP A;  5K5O A;  3QP6 A;  1I6X A;  4ENN A;  2HQN A;  1IN4 A;  3JRC A;  2QQA A;  2MGQ A;  5EF6 A;  2WAQ N;  3WE2 A;  4L0Y B;  3K4B A;  5GP9 A;  1A04 A;  3HSE A;  3MQ0 A;  2XVC A;  3F72 A;  1DQU A;  1JTX A;  2RV8 A;  1K6Y A;  1S7O A;  3D0S A;  2GOM A;  3BJO A;  4KIF A;  3BTL A;  1WZ2 A;  2R7S A;  2A5W A;  3L2V A;  4JP0 A;  4OIN F;  5J4Y A;  2KPM A;  3OR1 C;  4Z2Y A;  4AYB N;  2E34 A;  2CWE A;  1AWC A;  3S1Q J;  4PGH A;  1YI2 I;  3HKZ N;  3WTV C;  5L3B A;  3D1N I;  5CVV A;  2IS4 A;  1I1S A;  4N9I A;  5DEQ A;  1VQ5 I;  1ZAR A;  2L54 A;  5CLS A;  2VKV A;  4KJZ A;  4M71 A;  3GME A;  4PSW A;  1QA6 A;  1Z05 A;  1QZZ A;  3BOQ A;  2MFZ A;  3F8B A;  3VYU B;  1TBX A;  5DCM B;  2DJN A;  2O7O A;  3MCZ A;  3GWZ A;  1J59 A;  2ID6 A;  4XKW A;  5J40 A;  2R7D A;  3TQN A;  2HOT A;  2QZ8 A;  2V9V A;  1U2W A;  2KHM A;  3QQA A;  4WX9 A;  2L5Q A;  4EVI A;  4FE7 A;  1R58 A;  2NS7 A;  4GCV A;  4DJA A;  2BOL A;  3LSM A;  2ZC2 A;  3NAU A;  2N8G A;  2W24 A;  4AWX B;  1WI3 A;  3J7A O;  2Y48 A;  5LRS A;  2QBY A;  2CQN A;  1MMD A;  4UUS A;  2ZXH A;  4AUX A;  1A5J A;  2KJB A;  3JSP A;  1LFP A;  4E7Z A;  5DCF A;  5FLM J;  2K9L A;  4MNU A;  2DDA A;  3FDY A;  4A0X A;  4G12 A;  1W5C C;  2VOP A;  1ETK A;  3B6C A;  4OIR F;  3F8F A;  1QZE A;  5J3L A;  3ERM A;  1BW5 A;  3HOU J;  1O57 A;  3Q0V A;  4U7D A;  4BYY A;  1YTY A;  3F6V A;  2OQG A;  1FIP A;  3KYC B;  2JUC A;  2BEO A;  1X3Z B;  2AO9 A;  1IZ1 A;  3I4P A;  4LLL A;  2E5N A;  2EIM H;  5FB2 A;  2CG4 A;  2CQK A;  2ZME C;  4PCQ A;  3AAF A;  4AM3 A;  1YW8 A;  3PNY A;  1SMY F;  4HRI A;  2D1H A;  4XKV A;  2LY2 A;  1KQ9 A;  1KU9 A;  1YJW I;  3LA2 A;  1OKR A;  1MBF A;  1G4D A;  3TO9 A;  3GLX A;  2P8T A;  1MW7 A;  2AQF A;  3BR5 A;  4EEF G;  2P5L C;  1W0U A;  3DBH B;  2OTL I;  3KEY A;  2LRD A;  3I56 I;  3R0J A;  2L2O A;  1W36 C;  1I3A A;  4M9X A;  5GAE J;  2HPI A;  3A2K A;  3ERE D;  1QBJ A;  3ASN H;  2WWY A;  3Q0W A;  2GXG A;  1H9T A;  2JVH A;  2NRA C;  2V1U A;  3WHB A;  1XGO A;  4A0Y A;  1XX5 A;  3GFL A;  1ZTR A;  2LY9 A;  2MG4 A;  2IA0 A;  2CYY A;  2X4H A;  4U0Y A;  2JWT A;  3L09 A;  4ZYD A;  1T95 A;  2VT2 A;  1ZQ3 P;  2L02 A;  2WB1 N;  5K5Q A;  2F4M B;  1U3E M;  3MFK A;  1WRJ A;  2R5Z B;  4BEH A;  2DA2 A;  3ZQH A;  3BTC A;  4D7M A;  2DA6 A;  5B66 C;  1IGN A;  3W6J B;  3CCL I;  2KKO A;  5IYD J;  1YW7 A;  2QKM B;  2G7U A;  3V4G A;  1J5Y A;  2E7W A;  2A05 A;  2DLL A;  2Z1D A;  4PFP A;  1ZKG A;  3H5R A;  1JE8 A;  2YR2 A;  3HB9 A;  2IT0 A;  4C3H J;  4NQW A;  2W4S A;  3RCO A;  3W2W A;  3DEE A;  2PMU A;  5LHG A;  3AL0 B;  4ZTF A;  4BE0 A;  1HW2 A;  3M8E A;  1HKT A;  2DK5 A;  2D5V A;  2EA4 A;  1RRJ A;  3CMM A;  1Y1W J;  3BG5 A;  1R71 A;  3TW6 A;  3HUG A;  2VIX A;  1RIO H;  2KIM A;  3WTX C;  1OQY A;  1IN8 A;  4KUM A;  2GIV A;  2BGC A;  5H6Q A;  3O3K A;  4ENM A;  2K4J A;  2STW A;  3M1E A;  5JLW A;  1WH7 A;  2FBK A;  3CUQ B;  2XAF A;  2CV2 A;  4IF4 A;  5FLX K;  4RGR A;  2DA1 A;  2PMZ N;  1D5Y A;  1FLI A;  5F0H A;  3TOB A;  5A2Q Z;  3CJR B;  2HWV A;  1KGS A;  2JRT A;  2PMH A;  1IV6 A;  2QYO A;  1HW1 A;  2CU7 A;  3L00 A;  1IDZ A;  3CCV I;  3LA7 A;  5JVG F;  2ME0 A;  5M5Y J;  2L9N A;  3LST A;  2E36 A;  3RKX A;  5K7H A;  1WI9 A;  4IRH A;  1V5F A;  2VI6 A;  1GV2 A;  1OLT A;  4HDU A;  1AKH B;  2KP6 A;  4S0H B;  4BE2 A;  5DYM A;  2B0L A;  3ZN1 A;  1G59 A;  1JGG A;  2HS5 A;  3DEU A;  1PYV A;  4UV8 A;  1X58 A;  1WVR A;  2WC2 A;  2ISY A;  1Z1D A;  3ZOB A;  3W6V A;  1QPM A;  1KYZ A;  4JK1 X;  4CCK A;  2X48 A;  2WAD A;  1W1W E;  5LGU A;  3F22 A;  2BYV E;  4ITV A;  1YJN I;  4IRI A;  3HOY J;  2LP0 A;  4M6Y A;  1HLV A;  2V9K A;  5EJC A;  5K1Y A;  2K3P A;  3FF5 A;  4XRM A;  1QPI A;  1TWG J;  4KN4 X;  4N0B A;  2IA1 A;  2A5Y B;  1HOM A;  5HS9 A;  2M0M A;  1YW9 A;  3L2W A;  1HKQ A;  4RGU A;  3JRD A;  1X1P A;  4YRV A;  3HTU A;  3GX4 X;  2Q8K A;  2LF7 A;  3TL4 X;  2NNY A;  4DQ2 A;  4B44 A;  3B6A A;  1Z7L A;  4KIT B;  4CYC B;  2I10 A;  1ZHF A;  1ZRC A;  3QPH A;  1RR7 A;  2NVT J;  4D7N A;  4PJN A;  5FRO A;  2QSG X;  3ZP5 A;  3IKT A;  1XS9 A;  1IAW A;  1N78 A;  4BL0 B;  3RI4 A;  1VQ7 I;  3PIP F;  5FRN A;  3W2V A;  2A3S A;  1NH3 A;  1OYW A;  5BPD A;  1A36 A;  1MKM A;  2EB7 A;  3J7A Y;  4IKF A;  1JHH A;  3Q3S A;  2IGN A;  2V26 A;  4E7J A;  4H0E A;  2PN6 A;  2YSR A;  2EWN A;  3NRV A;  1ETX A;  2V1D A;  1DUX C;  1QVT A;  1Q1H A;  1REP C;  1ZEL A;  1XGM A;  1Z3Y A;  2GZW A;  2QVO A;  3LFK A;  4M72 A;  3A01 A;  3CES A;  4CIC A;  2IJL A;  3BCA A;  4BY1 J;  2M34 A;  4G6Q A;  1BW6 A;  2OZU A;  3JRG A;  1IUF A;  3V7S A;  4KFC A;  3ABL H;  4LG0 A;  5D5U B;  5C4X J;  3NQO A;  5ERI A;  2Z5U A;  3ZQL A;  2FOW A;  5CVI A;  3SYT A;  2DU9 A;  4MFE A;  1FBU A;  2OPT A;  4HDV A;  3T0Y A;  2XDV A;  1HDP A;  2QGU A;  1UST A;  1O3S A;  2FA5 A;  4I02 A;  2ESH A;  4XRS A;  3PQK A; 
#chains in the Genus database with same CATH homology
 3LSJ A;  5FLV A;  3H3V K;  2XPU A;  3A03 A;  1ZGW A;  1MBH A;  3PO3 J;  3H0G J;  3F0C A;  1Z77 A;  3GTO J;  3BR3 A;  4IHW A;  1Z0X A;  5DS9 A;  3CDL A;  1G2H A;  3A02 A;  2QCO A;  4BBR J;  2O8K A;  1QVU A;  4DYC A;  2VKE A;  3LSR A;  2LR8 A;  2XB0 X;  2CUE A;  1MBJ A;  2CUF A;  2R5Y B;  2WV1 A;  3BTI A;  3RKQ A;  3IH4 A;  2EZK A;  3GBG A;  3S1R J;  4BXX J;  1MBE A;  5EYR A;  4DYQ A;  4W97 A;  1JKP C;  3HBL A;  4MFD A;  1AKH A;  2ELK A;  2NVY J;  3IV5 A;  1LFB A;  2DA7 A;  3RZD J;  1H88 C;  4A3B J;  2M8G X;  4J19 A;  2Y9Y A;  4XRS G;  1RKW A;  2M0C A;  1LE8 A;  4Y7N J;  4MO7 A;  2DMQ A;  2B63 J;  2Y30 A;  2Y2Z A;  3O8G A;  4B4C A;  1OCT C;  1TWC J;  1TWF J;  2MSY A;  4A3G J;  3CQZ J;  5FKO A;  4C3J J;  5EGO A;  3LSG A;  1FEX A;  3HOZ J;  4FIS A;  4MIM A;  3JRF A;  1A6I A;  2JK3 A;  1JUS A;  3S14 J;  4I76 A;  3BR0 A;  4A93 J;  1I50 J;  3HM5 A;  1I3Q J;  2COB A;  3MKL A;  5FKK A;  1MBK A;  3PM1 A;  2XGC A;  4AC0 A;  4M3D A;  3K2A A;  3I4M J;  5EG0 A;  4CYC A;  3GTJ J;  1FTZ A;  3TED A;  4IHV A;  3SJM A;  1FJL A;  5M5X J;  2YS9 A;  5GPA A;  5J1R A;  3GTM J;  1B8I A;  1RET A;  3QPS A;  2FD5 A;  4XIC A;  3HEF A;  4NDL A;  4A69 C;  1XC5 A;  2DMU A;  2P81 A;  3DEW A;  3GTG J;  4A3I J;  3GTQ J;  5E3L A;  4DW6 A;  3TW7 A;  2M2E A;  3BR1 A;  2X9D A;  4UUS B;  3MVP A;  2K9N A;  5EDN A;  1UG2 A;  5DTD A;  1R9T J;  2JA7 J;  4FE4 A;  4LOC A;  5F27 A;  3QPL A;  2CQQ A;  5FKM A;  4QSH A;  2IAI A;  2Y0S N;  2R7Z J;  1JJ6 C;  1LFU P;  2CQX A;  2EZI A;  1SFO J;  2GBY A;  5E3O A;  2M9H A;  2L7Z A;  2DA3 A;  4M3E A;  2DA5 A;  5EZH A;  2VPR A;  4C3I J;  2AHQ A;  1BJZ A;  4V2F A;  2JJ7 A;  3HOX J;  3O8H A;  2HOS A;  2ECB A;  3OSG A;  1HCR A;  1ETV A;  4A3D J;  1BA5 A;  5F08 A;  2EZL A;  3NAR A;  3LSP A;  1VFC A;  1U9N A;  2K9Q A;  1T56 A;  2HYJ A;  4IEJ A;  3S1N J;  1P7J A;  3JRC A;  2MGQ A;  2DMP A;  5EF6 A;  2WAQ N;  5GP9 A;  1S7E A;  3S2D J;  4A3K J;  5EZG A;  1JTX A;  3ZQG A;  2R5Y A;  3CMY A;  2H8R A;  4V2G A;  3IH3 A;  2DMN A;  3BTL A;  2IBD A;  4JP0 A;  3JRB A;  1E3O C;  1VF9 A;  4AYB N;  4BBS J;  1WH5 A;  3S1Q J;  2G0E A;  3RQI A;  3HKZ N;  3BQZ A;  5K7F A;  3D1N I;  1W0T A;  2XRL A;  3RZO J;  1JUM A;  4A3F J;  1PUF B;  3S16 J;  2KDZ A;  2YU9 J;  1GVD A;  3BTJ A;  3UKG A;  1QRY A;  4A3J J;  4W1U A;  1B72 A;  2VKV A;  2R92 J;  1MSF C;  1DU6 A;  2HDD A;  2FQ4 A;  4DZP A;  3MN2 A;  1ZR4 A;  5FKN A;  4QTR A;  1OJL A;  1U9O A;  2R93 J;  3E7L A;  2NVQ J;  3GTP J;  1GV5 A;  1JKQ C;  2DJN A;  2O7O A;  5E3M A;  3S17 J;  2FJ1 A;  5C4J J;  1B72 B;  2E2J J;  2JMW A;  2ID6 A;  2HOT A;  5FJ8 J;  1K83 J;  5J1U A;  2ME6 A;  2DMT A;  3G1O A;  3HOW J;  1ZK8 A;  5JLX A;  3QQA A;  2XGD A;  1XG1 A;  4XK4 A;  5IYB J;  2TRT A;  4FE7 A;  1WCM J;  2NS7 A;  5K7Z A;  3NAU A;  2ID3 A;  2N8G A;  2LTP A;  1WI3 A;  2JA6 J;  2E2I J;  2GLO A;  2CJJ A;  4M3G A;  2EZH A;  3BR2 A;  4UUS A;  5GPC A;  3BG9 A;  4AUX A;  1A5J A;  2LK2 A;  5FLM J;  1APL C;  2Y31 A;  1ETO A;  4MLO A;  4G12 A;  1JKR C;  5E3N A;  1ETK A;  3B6C A;  3LOC A;  3OOU A;  2O9L A;  3G1L A;  1ETQ A;  1POG A;  5J3L A;  1AHD P;  3JRI A;  4QIW N;  2DTZ A;  1BW5 A;  3HOU J;  3Q0V A;  2Y9Z A;  9ANT A;  3VPR A;  1ETY A;  1RKT A;  1FIP A;  4RBO A;  1ORK A;  3FIS A;  5F0F A;  2XGE A;  2AO9 A;  2XB5 A;  4L5E A;  2HXI A;  2L0K A;  2JA8 J;  1I6H J;  3WHC A;  1Y1V J;  3SDG A;  4X1E A;  4IHY A;  3HDD A;  4D5C A;  3JRA A;  5J1Y A;  2LD5 A;  4JX4 A;  1MBF A;  1DU0 A;  1IC8 A;  1WGX A;  2K9S A;  4EEF G;  3BR5 A;  3S1M J;  1W0U A;  4A3L J;  1T33 A;  2E2H J;  1UMQ A;  3TP0 A;  3OSF A;  2CRG A;  2LKX A;  2E1O A;  5BNG A;  5IYC J;  5F1J A;  3S15 J;  3Q0W A;  1OCP A;  3WHB A;  2R5Z A;  2HXO A;  4RDU A;  5C44 J;  1ENH A;  1VI0 A;  4IHX A;  1F43 A;  2IEK A;  1JUP A;  1ZTR A;  2LY9 A;  2L7F P;  2MG4 A;  1U78 A;  1RES A;  1GDT A;  1GUU A;  2ECC A;  2JWT A;  1PUF A;  1AU7 A;  1UHS A;  1ZQ3 P;  3ZQF A;  4DZJ A;  2WB1 N;  1JKO C;  3G1M A;  2R5Z B;  1JT6 A;  2DA2 A;  2NVX J;  4JX5 A;  2LFB A;  3ZQH A;  3CCY A;  4M3F A;  3BTC A;  2DA4 A;  2DA6 A;  4D7M A;  1IGN A;  5IYD J;  4HNV A;  2XPW A;  3BG3 A;  5F0C A;  1ZKG A;  1K61 A;  4JX6 A;  3Q0U A;  4Y52 J;  2L7M P;  2HI3 A;  3HB9 A;  4C3H J;  3L1P A;  1X2N A;  1MH4 A;  2X6O A;  2HQ5 A;  4A3M J;  2D5V A;  3FKI J;  2W48 A;  5HOD A;  1Y1W J;  3BG5 A;  1U8B A;  1RPW A;  3TW6 A;  1TWH J;  3M3Y J;  1JT0 A;  2OF7 A;  4FCY A;  2YUS A;  5JLW A;  1WH7 A;  4M6V A;  1H89 C;  5M5W J;  2DA1 A;  3K7A J;  2PMZ N;  2XSD C;  1D5Y A;  2JA5 J;  2HOA A;  5F0H A;  5IP6 A;  2ZB9 A;  1O4X A;  3LNQ A;  1IV6 A;  2CU7 A;  1TWA J;  2EH3 A;  1IDZ A;  4I6Z A;  1FIA A;  2ME0 A;  2FX0 A;  5M5Y J;  2NS8 A;  3GTL J;  5K7H A;  5IP7 J;  2DN0 A;  2VI6 A;  5F04 A;  1GV2 A;  4GFB A;  1AKH B;  4UUT A;  4S0H B;  1HDD C;  2GM4 A;  1JGG A;  2KT0 A;  4D5F A;  1ZR2 A;  2L9R A;  1X58 A;  3JR9 A;  4A3E J;  5IP9 J;  3HOV J;  1EF4 A;  2TCT A;  3ZOB A;  3W6V A;  5M3M J;  2K40 A;  3BT9 A;  2X48 A;  4FTH A;  2LLK A;  3OIO A;  5FKL A;  3ZQC A;  1LE8 B;  3HOY J;  2LP0 A;  4JYK A;  4B1R A;  3GTK J;  1HLV A;  2H1K A;  1VND A;  2NOG A;  1ETW A;  1IDY A;  4XRM A;  1QPI A;  1TWG J;  1CQT A;  5EGO B;  1HOM A;  1MNM C;  2EBI A;  1H8A C;  4M3B A;  3JRE A;  3JRD A;  4X6A J;  3I4N J;  5C3E J;  3PO2 J;  3FK6 A;  2R0Q C;  2JN6 A;  3DCF A;  2LVS A;  4C2M J;  1GT0 C;  1OFC X;  4XID A;  1MBG A;  1JTY A;  3B6A A;  4BY7 J;  5EG0 B;  4CYC B;  2I10 A;  2NVT J;  1RR7 A;  4D7N A;  1SAN A;  5IOZ A;  1YRN A;  1B8I B;  1XS9 A;  3ZQI A;  3JRH A;  1ITY A;  4DYR A;  1NK3 P;  4ABZ A;  1Q1V A;  1X2M A;  3M4O J;  4BKX A;  3HGY A;  1P7I A;  3Q3S A;  1IJW C;  3BQY A;  1F36 A;  5IOY A;  4B3A A;  1MH3 A;  1WPK A;  5IPA A;  3S2H J;  1ETX A;  2EQR A;  1YRN B;  1QVT A;  2RAE A;  5M3F J;  3FK7 A;  1IRZ A;  3A01 A;  2E19 A;  4BY1 J;  2M34 A;  3TP3 A;  3C2B A;  5EEA A;  1BW6 A;  3BR6 A;  3JRG A;  1BL0 A;  1IUF A;  1IG7 A;  2VUM J;  5C4X J;  1NK2 P;  3ZQL A;  3HGG A;  1HF0 A;  3SFI A;  1JJ8 C;  3FIW A;  3IH2 A;  2MW8 A;  2XPV A;  1FTT A;  4MFE A;  2OPT A;  1MSE C;  4A3C J;  1NTC A;  1HDP A;  1TC3 C;  3A01 B;  2QF7 A;  4XRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...