3HDDA

Engrailed homeodomain dna complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
55
structure length
55
Chain Sequence
b'RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*TP*AP*CP*CP*
publication title Engrailed homeodomain-DNA complex at 2.2 A resolution: a detailed view of the interface and comparison with other engrailed structures.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 19
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hddA00
1ZR4A 3K2AA 3QPLA 1IJWC 4JX6A 2L0KA 3CQZJ 1QPIA 1GV5A 2JMWA 1HLVA 1Q1VA 5M5XJ 2XSDC 3ZQFA 3ZQLA 4XICA 3S2DJ 5C44J 3S2HJ 3I4NJ 1UG2A 3RZOJ 1H88C 2TCTA 2MW8A 2ECCA 3GTKJ 4XIDA 1AKHB 2E2IJ 3IH3A 4M3GA 1WPKA 5EZHA 1DU6A 2M8GX 3LSJA 4J19A 4JP0A 1PUFB 3NAUA 1MBHA 2VPRA 1POGA 3QPSA 4IHYA 3BQZA 5EZGA 1JKPC 1NK3P 1SFOJ 4A3FJ 5F08A 1MBGA 5F0HA 4G12A 3HM5A 5GPAA 3Q3SA 5EG0B 2R7ZJ 3JR9A 2O7OA 5J3LA 1B8IA 1IGNA 2B63J 4NDLA 3HB9A 3BR0A 2GBYA 2RAEA 5DS9A 4A3DJ 3F0CA 1LE8B 1S7EA 1HCRA 1P7IA 2MG4A 3GTJJ 3ZQHA 2VKVA 4A3IJ 1B72B 2YUSA 4A3JJ 3BT9A 1MBJA 1ETVA 3LSGA 2NVTJ 3BTLA 2L7ZA 1MH4A 1SANA 3H0GJ 4X1EA 2XGCA 3E7LA 1QVUA 3HKZN 3RKQA 2E1OA 2ECBA 2XB5A 3C2BA 2LD5A 2R5YA 3BR2A 1MBEA 3CCYA 4D5CA 3A01A 3ZQGA 1XS9A 1R9TJ 2WB1N 3FIWA 9ANTA 1U9NA 4IHWA 1F43A 3ZQIA 4DZPA 3G1OA 2P81A 5K7ZA 4A3LJ 2LFBA 5IYBJ 2EQRA 2K40A 2N8GA 5EF6A 1UHSA 4A3MJ 1JUSA 2Y30A 3MVPA 2DMQA 1VNDA 3K7AJ 2DMPA 3LSPA 1MSFC 2FQ4A 1JTYA 1IDYA 2ID3A 4FE7A 3MN2A 2QCOA 3HOVJ 3JRHA 1TWFJ 3OSFA 3GTPJ 4S0HB 2NVXJ 2OPTA 3OOUA 5M5WJ 1HOMA 2HXOA 3LOCA 1TC3C 4C3JJ 3IH4A 5F0FA 3CDLA 2DJNA 3RQIA 4JX5A 4RBOA 2COBA 2JJ7A 2VI6A 1DU0A 1E3OC 2NVYJ 4I76A 3S1MJ 2AHQA 2MSYA 3IH2A 1ETWA 2HOSA 4GFBA 2HDDA 2FJ1A 2CRGA 4RDUA 2DN0A 1U8BA 3CMYA 2JA7J 4XRSG 3ZOBA 3PO2J 2JA5J 4LOCA 4V2FA 5F1JA 4CYCB 1CQTA 2ID6A 4UUSA 1UMQA 1YRNA 4XK4A 2DMUA 3GTMJ 2KDZA 2LKXA 3IV5A 2NVQJ 1RKTA 2E2JJ 4B3AA 2DA2A 1X58A 3MKLA 4V2GA 4C3IJ 2ZB9A 5GPCA 4A93J 4C3HJ 1TWAJ 2EZKA 4QSHA 1XG1A 3BTJA 3BG5A 3NARA 5FKNA 5J1RA 2VKEA 4FTHA 5E3OA 2CJJA 2AO9A 1GDTA 2X9DA 2R5ZB 1QRYA 1U78A 1ITYA 1NK2P 2Y0SN 2Y9ZA 5F04A 1BL0A 2LLKA 1K83J 3TP0A 2W48A 2DTZA 1G2HA 5FKLA 3TW6A 4HNVA 2LP0A 5E3NA 5EGOB 2E2HJ 1BW5A 1LFBA 1F36A 2VUMJ 2KT0A 3BR5A 4UUTA 1H89C 3B6AA 4AC0A 3BR6A 1FTTA 1FIAA 1GVDA 2LTPA 4JYKA 4M6VA 5IYCJ 3M3YJ 5FKOA 3SFIA 1VFCA 1JT6A 5IP6A 1AU7A 2K9NA 4Y7NJ 3GBGA 4XRSA 4A3KJ 3O8GA 2I10A 2HYJA 2FX0A 1Z0XA 2CQQA 3TP3A 3JRFA 1MBKA 3D1NI 1AHDP 3LNQA 1ZR2A 1U9OA 1ZTRA 3GTOJ 5JLXA 4JX4A 3O8HA 2D5VA 1JJ6C 2FD5A 3DEWA 5IP9J 2HXIA 1IG7A 4FISA 2DMTA 3JREA 2G0EA 4IEJA 1WH5A 1WCMJ 2XGEA 1WH7A 2HI3A 3JRGA 4FCYA 3BQYA 4AYBN 2XPUA 1ETXA 3HOZJ 2X48A 3GTQJ 2ELKA 1WI3A 5EDNA 2K9QA 1ETYA 4IHVA 1HDPA 5EEAA 1RESA 4D7MA 3QQAA 2DA4A 1H8AC 2H1KA 1FJLA 1VF9A 1JKOC 4B4CA 1X2MA 1QVTA 1TWGJ 3UKGA 1HF0A 1JTXA 2M0CA 2DA3A 4AUXA 2CUFA 1ETOA 2EZIA 4A3GJ 4BBRJ 5IPAA 3JRAA 1OJLA 5IOZA 3L1PA 1AKHA 5C4JJ 1ETQA 2EZHA 2L9RA 4X6AJ 3OIOA 1B8IB 2M9HA 1PUFA 3BTIA 1K61A 2LVSA 2IEKA 1TWHJ 4XRMA 2IBDA 3HOXJ 2XPWA 4W1UA 4DW6A 2EH3A 4MFEA 5EG0A 1IDZA 2CU7A 3B6CA 3HBLA 3A03A 2YS9A 2HOAA 4BY1J 2DA7A 5C4XJ 2DMNA 1LE8A 1RPWA 3BG3A 3VPRA 2NS7A 5F0CA 5E3MA 1ZQ3P 2R5YB 2EZLA 4W97A 1B72A 1ZK8A 3A01B 3S1NJ 2HQ5A 5K7FA 1JKRC 2X6OA 1P7JA 2PMZN 2H8RA 3W6VA 1X2NA 4DYRA 1JJ8C 2O9LA 1BA5A 3SJMA 3ZQCA 5FLVA 4I6ZA 2TRTA 1T56A 2XB0X 3JRBA 3S15J 1LFUP 1O4XA 2Y31A 1GUUA 3S1QJ 2K9SA 4L5EA 1OFCX 2JWTA 3DCFA 1BW6A 1FEXA 4EEFG 1I6HJ 4M3FA 4A3BJ 4MIMA 2Y2ZA 1IUFA 4BXXJ 4C2MJ 2NS8A 2QF7A 5EYRA 3I4MJ 1ZKGA 4QTRA 2WV1A 1MSEC 4BBSJ 2NOGA 3BG9A 4M3DA 3LSRA 5IOYA 2DA1A 1ETKA 2CQXA 1ZGWA 2YU9J 2JA8J 3BR1A 4IHXA 3Q0VA 5IYDJ 1ENHA 3FISA 2HOTA 3HDDA 5IP7J 5M3FJ 3S16J 4A69C 1IV6A 5DTDA 2IAIA 3G1MA 3Q0WA 3JRDA 1D5YA 3TW7A 3G1LA 2CUEA 1NTCA 1BJZA 5GP9A 1ORKA 3HGGA 1JUPA 3PM1A 4Y52J 1OCPA 4D5FA 4MO7A 4UUSB 1YRNB 1RR7A 1Z77A 1W0UA 2EBIA 3TEDA 2XRLA 1OCTC 1JGGA 3HEFA 5FKMA 2MGQA 3A02A 5HODA 1W0TA 3HGYA 2JN6A 3S14J 4FE4A 2GM4A 4CYCA 3RZDJ 4DYCA 4DZJA 1RKWA 5FLMJ 3GTGJ 3WHBA 3GTLJ 1I3QJ 1RETA 2R92J 3HOUJ 1A6IA 5C3EJ 5F27A 3M4OJ 5BNGA 5FJ8J 5J1UA 1FTZA 2E19A 2M2EA 4DYQA 3HOYJ 5K7HA 1GT0C 4M3EA 1IRZA 2LY9A 3PO3J 1MBFA 2M34A 2DA5A 5M3MJ 2L7FP 4ABZA 3FK7A 2DA6A 3SDGA 1TWCJ 1GV2A 1MH3A 1Y1WJ 4M3BA 3S1RJ 2R5ZA 2ME0A 4BKXA 3HOWJ 3FK6A 4MLOA 1IC8A 3S17J 5JLWA 2LK2A 1HDDC 5J1YA 4A3CJ 3H3VK 5FKKA 1A5JA 4QIWN 4BY7J 2L7MP 2GLOA 1EF4A 1Y1VJ 5EGOA 4A3EJ 4MFDA 3JRCA 1FIPA 2JA6J 3WHCA 2O8KA 2XPVA 5M5YJ 1I50J 3BTCA 4B1RA 2JK3A 1VI0A 3FKIJ 2R0QC 2WAQN 2XGDA 3JRIA 1JT0A 2OF7A 3OSGA 1JKQC 1MNMC 1WGXA 2R93J 1T33A 2ME6A 1APLC 2LR8A 4D7NA 3Q0UA 3BR3A 1XC5A 1JUMA 5E3LA 2Y9YA
chains in the Genus database with same CATH superfamily
5FD6A 1WJBA 3K4MA 4ESBA 2A6HF 2R7UA 1QA6A 2L0KA 1X3ZB 3ASNH 1VQ7I 2ZFUA 3RKXA 4BE0A 3ZQLA 3X2QH 4IHTA 4IPAA 2P8TA 1H88C 2IS1A 1W36C 2JPBA 4CICA 1LUJB 3IH3A 1WPKA 5EZHA 3K9TA 5CPRB 4JP0A 4GRIA 1G3SA 2VPRA 3KZIC 1POGA 3QPSA 4IHYA 2BGCA 3SXYA 3MD2A 3H9JA 3QRFF 3TOBA 2B0LA 4FT8A 5F08A 1TNTA 4G12A 4XNFA 3K1PA 3FXMA 2NOJB 2O7OA 2WV0A 2X0LA 2ZMEB 3HB9A 4LLLA 1FMWA 3L9FA 3TL4X 4E7SA 5DS9A 2RAEA 1PUEE 4A3DJ 2DQRA 2W4SA 3F0CA 3S3OA 2DLLA 2WTEA 3CF2A 1BC8C 1P7IA 2KPMA 3GTJJ 1YTYA 2VKVA 2A5YB 2CO5A 4A3IJ 1YX3A 2RC4A 4MGRA 3BT9A 1A36A 2LSOA 1NHAA 2NVUB 2Q1ZB 3AG1H 4KDPA 1WWXA 3I59A 2XAUA 4XM3A 1IAWA 2NVTJ 3H0GJ 4X1EA 2Q2EB 3E7LA 2GAUA 2V6CA 4PGHA 3OV8A 5GAHJ 2KZVA 2BE5F 4YFNF 1E17A 2LD5A 3SEZA 4R79A 2P6TA 4PSWA 1FZPB 1MBEA 1Z3YA 2HQRA 2KHMA 2FUG2 3DTIA 1XB4A 9ANTA 2UUZA 1U9NA 4IHWA 1D5VA 4WXCA 4P55A 1ZH5A 1ZG1A 2LREA 2PBIA 4BQQA 2BXZA 3FZVA 4DZPA 5K7ZA 1DDNA 2DFFA 3AKZA 1ONVA 2LFBA 2OA4A 4BXFA 2K40A 2F5DA 2CMPA 2BY3A 3KP3A 4A3MJ 1M1EB 2Y30A 3F8BA 3MVPA 2BVLA 2L4MA 2DMQA 3WTYC 1VNDA 1WJDA 3K7AJ 1GLNA 2QSHX 2KL4A 2ZJRF 2MLGA 2ZC2A 4WXDA 3G73A 4MHGA 3PUBA 3VEPA 3L09A 4P1WA 2H6CA 2I5UA 3I5UA 1B4AA 4LFUA 5HS7A 2CUZA 5LEJA 4A5MA 3W2WA 3JRHA 2C6YA 4S0HB 1G59A 4HLYA 1BI2A 2L7KA 3KZYA 2EA2A 1VQKI 1IN4A 2K85A 1G4DA 4HSRA 2AS5F 3IL2A 1HOMA 4ZZDA 1MMDA 2VODA 1YW8A 2X6XA 2OZUA 3SZTA 2DJNA 3FMSA 4HQMA 3L00A 4HZFA 3IAS2 4JX5A 2UXXA 4A6EA 4RBOA 1IRFA 5H2FC 4C2TA 1IV8A 2V1XA 3HTUA 3ISPA 2LRDA 4I76A 1K78B 2WA0A 3RJPA 1R4NB 1TTYA 1PP8F 2IT0A 4OIPF 5HLGA 5JHFA 3FHNA 4HRIA 2D45A 2W25A 4FX4A 1B1BA 2CQKA 2D1VA 2EPFA 2VLAA 2HVSA 3QP6A 3RYPA 1CQTA 5HVQC 4UUSA 1UMQA 1YIOA 1UCRA 2WAQA 4ITVA 3GTMJ 1USTA 2KDZA 2LKXA 4HPQA 4BJ6C 2DA2A 4LB6B 1FPQA 2MBFA 3KEOA 4CCKA 4I0BA 5IT9K 3LA7A 4E7KA 2VJ5A 2W85A 2EIMH 4DIQA 1STZA 5GPCA 3P5JA 1USSA 2QLZA 5JI6A 2KIMA 2AXLA 1XG1A 1Z67A 2ZJQF 3F72A 5TISC 3BG5A 3NARA 4I0AA 3H9QA 4XOTA 1LQ1A 3DFGA 1QZEA 2JUGA 3CCUI 4PJJA 5LD2C 3KLOA 3VSKA 1QRYA 3OYHA 2EFQA 1R58A 1U78A 2EIJH 3K70C 2Y9ZA 2BY0A 4CO8A 3PNYA 4BH9A 3KP4A 1G2HA 4HG2A 4PDKA 4H0EA 5J6XA 2XRNA 4BS9A 3U1DA 1U6GA 3DF8A 4K2EA 1F36A 1RUNA 3OYMA 4J00A 3F6VA 1H89C 3ZXSA 1FTTA 1I3AA 5J47A 1GVDA 2CGPA 4HF2A 1X4OA 5FKOA 1VFCA 3ZGKA 3JCUC 2IS2A 4NBQA 4A3KJ 1UHWA 2HYJA 1SVMA 1Z0XA 3DLLF 1MBKA 3GXOA 5LGNA 2VQGA 3RYRA 4NQWB 1ZTRA 1B9MA 3WG7H 2K7LA 2HDCA 5JLXA 2KJBA 3O8HA 1SD5A 5B66C 3ZMDA 3DEWA 3R6SA 1LNWA 1Z1DA 5IP9J 2DMTA 2M7BA 3D0SA 2CSOA 1YW7A 3JAMK 4D0PA 2XGEA 3OYFA 2L54A 3U1KA 2DOEA 2RKHA 3HOZJ 2RQPA 4AD9A 1WI3A 2BXYA 2LY1A 2RGVA 3IP4B 2K3FA 2K9QA 2LYCA 1P4AA 1HDPA 2VJIA 1C0WA 4D7MA 4PJ0C 1K6OA 3ZMZA 2H1KA 5CQEA 3TQNA 2CQ7A 2V26A 3DPLC 1Z3XA 2DCEA 1X2MA 2WY8Q 5F1RA 2EA4A 4AIHA 2DA3A 4AUXA 1T6SA 1PYVA 4GO1A 1GXQA 4CCNA 4PJLA 2EZIA 2Z99A 3H5AA 2X1CA 3E6DA 3VWBA 2FA5A 2LKSA 4UHTA 4YIIA 5IOZA 2L02A 1XSVA 2L9RA 3OIOA 1OR7A 2IW5A 1ZN2A 1D8KA 2HZDA 1LJ9A 4YFXF 3MEXA 2R7OA 1A04A 3RPQA 5IT3A 2JVHA 4PZJA 1J75A 4W1UA 1GXPA 1S6LA 3E5XA 4DW6A 2EH3A 2TDXA 1HC8A 3CLQA 4MFEA 2XHKA 3K4CA 1E3PA 2EV5A 2GA2A 2ZMEA 2GZWA 2P4WA 2R4GA 4P96A 3K0LA 1H9GA 1R22A 4BQNA 4HQEA 4LB5A 2ZXJA 2OBPA 1X3WB 2EFNA 2BVMA 2E7XA 3LSKA 5F0CA 3AG4H 3DEUA 3OWTA 4DOZA 4WK8F 2PJRB 5D5UB 3JTHA 1SMYF 3A01B 3HIFA 4LK1F 2KIQA 5K7FA 4F92B 4DQ2A 2CS3A 2CH0A 3DBRB 2O9LA 3SJMA 1TBXA 2Q2EA 5JVTA 1V3FA 2E71A 1SFXA 3GUDA 3JRBA 3S15J 2V1NA 2QUFA 5ERIA 4C2UA 1EH6A 2DO7A 2BHZA 2GIZA 2WC2A 1OFCX 2YX4A 3HSFA 4F52A 3B73A 4KNYA 5E1ZB 4M72A 5KAFC 1TL8A 1J2XA 2HFHA 3FM5A 4RLFA 1I6HJ 1K6YA 1QGPA 2Y2ZA 2NS8A 5EYRA 4OINF 4RS8A 4DBRA 5K5OA 1MSEC 2VC0A 1XN7A 4RM2A 3LSRA 2DA1A 3VB2A 2E35A 1ZRFA 1ETKA 1VQ4I 1ZGWA 1DPUA 3SZPA 4BDZA 1RUOA 3S93A 2V9KA 3PFYA 4P9FA 2IRFG 2Y0SA 2A61A 4R1HA 5LHHA 5FROA 1U3EM 5CVJA 2M1BA 3HDDA 3S16J 4A69C 2IAIA 5ED4A 1OR7C 3G1MA 1YQAA 3JRDA 1D5YA 4HYEA 3TW7A 1IF1A 2OTJI 1HQCA 2GOXB 5LHGA 2A68F 3L2UA 4HEA2 3HGGA 2QZ8A 1JUPA 3LSMA 4Y52J 1OCPA 4MO7A 1QBJA 2HDWA 3VYUB 3HSRA 2FNPA 3J81K 1W0UA 1K78A 1T98A 3ECOA 3GW2A 5FD5A 2VPLA 1JGGA 3H3ZA 3O3KA 2FBIA 2ZMEC 3HEFA 1WFXA 2MGQA 1W0TA 5HODA 2V79A 3S14J 2OU2A 1IRGA 3LAPA 2PI0A 2EWNA 4KN7X 1T95A 3ABUA 2GXGA 3M8JA 3NQOA 3LAJA 3BG7A 3GTLJ 2DFEA 3HPGA 4B44A 4CYDA 1I3QJ 1RETA 2R92J 3MKWB 2H09A 2DTRA 5C3EJ 4M6YA 3EDPA 1IXSB 4L18B 3M4OJ 3ZPLA 5J1UA 1QHGA 2IGNA 1WZ2A 2ZXWH 2M2EA 1GT0C 1FOYA 3MAJA 4M3EA 2OZ6A 4EQQA 3PO3J 5D6FA 2DA5A 4HA8A 2OAZA 4XKWA 1WI9A 3LL7A 3SDBA 3FK7A 3SQNA 2ZJ2A 4L9TA 3ELKA 2MC4A 1FMVA 4NB5A 2DW4A 1REPC 3FXKA 2O0YA 1HXDA 4U7DA 3F8CA 4L9NA 3FK6A 4L9JA 1T2KA 4M73A 1IC8A 3S17J 1HDDC 1OCZH 2PLYA 1Z7UA 1OCRH 5FKKA 3KFWX 5KCMA 1LFPA 3LSIA 4MFDA 3KEQA 2QM3A 1YW9A 5JVGF 4MTEA 4PJMA 1BR1A 4HF1A 2W24A 4NUBA 1WVRA 1FWZA 1RNLA 4U0WA 5LHIA 1WKMA 1KONA 4B1RA 2PJPA 4II3A 3BPVA 3E6CC 4U0YA 1JI8A 2A05A 3FKIJ 2M87A 3NRVA 3TO7A 3I56I 3J7AO 4KMFA 2CUJA 3OYNA 1R1VA 1O3TA 2JT1A 2OF7A 3OSGA 1MNMC 3LWFA 4NQWA 1YI2I 2HYFA 1SD7A 1ON2A 3ZP5A 3KZZA 4Y15A 4EV0A 4X0GA 3BR3A 3PQJA 2Y9YA 5BMZA 1ZR4A 2QSFX 2P7CB 1O57A 3QPLA 1P6RA 5H20A 4RAZA 2PMZA 3VFZA 1Q1VA 1U0JA 1KQ9A 4UY8I 6PAXA 1ZREA 3K4BA 3NWSA 5C44J 2ZJPF 1UG2A 4AWXB 3RZOJ 3CMMA 2TCTA 3QAHA 2MW8A 4XIDA 1AKHB 4M3GA 2GQQA 4WWCA 1KZHA 4J19A 2BW3B 4I2OA 4UB6C 4EJUA 1H0MA 4P9UA 1EKEA 2R7FA 5LRSA 3HRUA 2Z9OA 4YG2F 3L2QA 2E36A 3CMEI 4OIOF 4XR6A 2R7ZJ 4NC7A 3K2ZA 1IGNA 4PFOA 4Y13A 1Y6IA 3ML6A 1MJAA 3J80K 4I09A 2WBMA 2M8EA 1S7EA 3HJEA 4B48A 2MG4A 4UB8C 3MMYB 1YS7A 3WTUC 4Z6YA 1MD0A 3L2VA 4G94A 4EGZA 3HUGB 5HLTA 3W2AA 4I7HA 3LQRA 1L3LA 3DBHB 2A07F 3H3UA 2LY2A 3GVAA 4Y3OA 4XLNF 3ABMH 4IOCF 3HKZN 1QVUA 3MWMA 3RKQA 2E1OA 3O2PE 1HSJA 2KIFA 1F9NA 1V5GA 2PJRA 4UVBA 4MNUA 4KICA 3FXOA 3A01A 4D5CA 3CCMI 1XS9A 2DFIA 2WB1N 2NXNB 2D2WA 1F43A 1FY7A 3DLAA 1K4SA 1R5ID 1P4WA 3TOAA 3TDZC 1WQ2A 3RQ4A 2QVOA 1S7AA 2EQRA 3GEZA 3GZ5A 4RB0A 5EF6A 5E18F 3L2CA 4UV8A 4C9YA 3OYEA 2ICWG 2A6EF 2XASA 2IVMA 2M0MA 2V9VA 3Q9SA 2Z1DA 4HV6A 4R8HA 1MSFC 3P7NA 4AVZA 5K5RA 3KP7A 4PJNA 1JTYA 1AA7A 5AIPA 3ZRGA 4BU2A 4UVCA 3ABKH 3FDYA 4KA4A 1LKXA 3HOVJ 2BEOA 3OSFA 3GTPJ 4G7ZF 4HNTA 5ICFA 3J7AY 2OPTA 3OOUA 3QOPA 2E1MB 2QYOA 4CCLA 2DT7B 5F0FA 4DNCA 2RN7A 3CDLA 5HOOA 2V1UA 3ESWB 1MMGA 2COBA 2VI6A 3WTSC 4H4KC 3GFIA 1VQOI 5DD8A 3S1MJ 2AHQA 5CVIA 2KP6A 1TW2A 3IH2A 1FSHA 3FKJA 4RGSA 1UJ8A 3WU0A 1FC3A 2Y75A 1IXRC 2AXTC 3DKXA 2HDDA 2RREA 1OPCA 1TLHB 3FXJA 1QNTA 1D8JA 3PO2J 2VOOA 2JPCA 3W3CA 1O3SA 4LOCA 3DXJF 4CYCB 1WJ5A 1W7PB 3RKWA 4ASNA 2EIKH 4IX7A 2X1DA 3PFIA 1Z05A 2BV6A 1CF7B 1IN5A 3IV5A 2NVQJ 2J5OA 3OMYA 4B3AA 4FASD 4V2GA 4JK1X 4C3IJ 4ZYGA 3DPUA 2J5PA 3P9CA 2MABA 1LB2A 2IS4A 1R6RA 1N25A 3QOEA 1P2FA 2Z16A 3ULQB 1SFEA 2OUMA 2EZKA 2VN2A 4C3HJ 1G3TA 4WXHA 1OKRA 2QEXI 2RV8A 3H9GA 2DPUA 3AFHA 3BTJA 3GF2A 3QP5A 3UR3C 4FQGA 4XLPF 1R71A 4GYIA 2G9WA 3BJOA 1XCVA 2X9DA 2NNNA 4GXOA 1YE9A 3P9IA 2BBYA 4G6QA 1ITYA 2R7RA 3OYJA 2E5ZA 1BL0A 1SVLA 4ZYDA 1R1UA 1K83J 4CSWA 3IKTA 3FXQA 5FKLA 1FBQA 2ZXHA 4LMYA 4IVNA 4A6DA 2DYSH 1LFBA 5ICGA 2ZFWA 1E0EA 3BR5A 4E7JA 3B6AA 3FXRA 3BR6A 2QKMB 1R1TA 3FBIB 3ERMA 4M6VA 2LC2A 1QU3A 4OAYA 4BJTA 3LA3A 1S8NA 5IP6A 2CW7A 3T8RA 4XRSA 2ESHA 2I10A 1XCBA 1MGTA 2IXSA 4XSXF 1YX5A 2ZCWA 1ZR2A 4II2A 4HW0A 2DOFA 2FXAA 3BY6A 2MD5A 3GTOJ 3WTXC 3GZ6A 1LEAA 4GDFA 1F5TA 2FU4A 2JRMA 3U21A 2F4MB 3BDDA 1IG7A 1IN6A 1W5SA 1ZARA 5HS8A 2G0EA 3TBIA 4E7IA 3JRGA 2HI3A 1EA3A 4ON0A 1UELB 1TP4A 4AU7A 3K6GA 5JHUA 3KYDB 1ETXA 3DWLE 4GCVA 5D5VB 3E0JB 2E7WA 3IWZA 4IHVA 1ETYA 5EEAA 3HPHA 2DA4A 1AOYA 1VF9A 2VQHA 2KZGA 2VASA 3WE2A 1XDUA 4B4CA 1L0OC 1TWGJ 3I53A 5ICCA 1IN8A 3UKGA 1G8XA 1JTXA 2M0CA 1VQ6I 2CUFA 1E2XA 1X4PA 3MCZA 1W36D 4A3GJ 2MA3A 4BBRJ 5IPAA 1OJLA 1SFKA 5GTHC 1RC9A 1U2WA 1EH7A 5FGMA 1AKHA 4MEXF 1TQPA 1ETQA 4YELA 4X6AJ 2A3SA 2HR3A 5F64A 1S9HA 1B8IB 4OAZA 2BW3A 5A2QZ 2DBBA 2YU3A 1R7JA 2LVSA 2IEKA 3F9KA 5LRRA 2K27A 3SFZA 4XRMA 2IBDA 3E6BA 3HOXJ 2NS0A 2W84A 4A0ZA 4Z2YA 3IUOA 2Y69H 4JOMA 5GTIC 4HBLA 2IGOA 1U8RA 2CU7A 3QU3A 3I3LA 1XD7A 4P5OA 2F5CA 2X6WA 3H0DA 4LD5A 3AAFA 1UFMA 1YJWI 4BY1J 5LBQA 3RPUD 5C4XJ 2DQLA 2JSPA 2LBFB 5HDKA 1RPWA 1G3WA 3VPRA 2NS7A 3CO7C 4BDYA 3T8TA 2R5YB 2EZLA 3C7JA 4ETSA 3DTKA 1JHHA 1QZYA 3DQVC 4ZDPA 4KFCA 3GFJA 1XGNA 2CW8A 3HUGA 1JKRC 1PVEA 5E20A 2H8RA 1X2NA 5KAIC 1XGMA 2HKXA 4DYRA 3C3WA 1TZLA 3KEYA 3ZQCA 5FLVA 2DAOA 3CUQB 4XN0A 4EJOA 4I6ZA 2TRTA 4HAMA 1T56A 3EUKL 2M5WA 2XB0X 4OMZA 4CCMA 3OYLA 3F6OA 2EFOA 4N9HA 3H5NA 2XDVA 1LVKA 3HYIA 2UZKA 4BNCA 3HHHA 1Z9CA 3WTZA 3V8KA 2L01A 3RIRA 2Z5UA 2NNYA 2E1CA 4EEFG 1X3UA 3HG9A 5KVRA 4M9SA 4M3FA 4MIMA 2OJED 1IUFA 5D4SA 5CYVA 1SAUA 3F8FA 2QF7A 3M9AA 4Y33A 3CD6I 2PEXA 4QTRA 2FSWA 4BBSJ 3FHZA 4M3DA 1XSDA 3LFKA 3E3VA 5B1BH 5IYDJ 3PNTA 1BOAA 4G6TB 1MJ9A 4IRGA 4IZZA 3BCAA 2HWVA 5M3FJ 3B02A 2AQEA 4RAGA 3KYLA 4ZYAA 3J7YJ 2DT5A 4ANJA 2KJCA 4XKBA 3BP8A 4V19K 1QO0D 2JUCA 5ILUA 2OD5A 4BE2A 4IL6C 3BROA 4D5FA 2NRAC 3DBLB 1YRNB 1YYVA 4QWQA 3KX2A 4RGXA 3ZQ7A 5LLQA 2EBIA 3TEDA 5B5EC 3MQ0A 1DP3A 3V8JA 5FRMA 2MFZA 3M1EA 3I54A 3SZGA 2QGUA 3V4GA 3WU2C 3MKZA 4CYCA 1I5ZA 1W7PA 3RZDJ 3CLOA 2F5EA 3CTAA 1RKWA 3I64A 3GTGJ 1CF7A 3KYCB 3HOUJ 3WU1B 4IF4A 1T0FA 3PNVA 5F27A 3HOSA 2E19A 2OV7A 1YLFA 5AONA 1SVOA 2MC3A 1P92A 4RB1A 2UWMA 2RDPA 3HSEA 2DYRH 2DOAA 3WGHA 2XGXA 1KQ0A 2DA6A 3SEQA 1MIJA 3RI4A 4CDGA 1Y1WJ 2OQRA 4M74A 4BYYA 3S1RJ 1LDDA 2LKPA 2MLKA 5DEQA 2ME0A 5J4VA 3CDIA 3Q5FA 5DUKA 4XSZF 3LSHA 4A3CJ 2IA1A 5BOXA 3BJAA 4QIWN 3NWTA 2L7MP 1B59A 1Y1VJ 2DODA 2Z2SB 3WODF 1FIPA 3E6MA 2XPVA 1TNSA 1IW7F 3HL2A 4E7ZA 3BTCA 2K9MA 4IRHA 3P9KA 3N05A 1OLTA 2JK3A 4G7OF 1VI0A 5DDGA 4BQAA 4DGWB 3JRIA 4CZZA 3K4KA 4F91B 1WRJA 3J7ZI 1UAAA 3PQKA 5DM7F 4QLCU 2E1MC 2R93J 2HU9A 3F22A 3GWZA 2XSJC 4D7NA 2VBXA 3Q0UA 5FB2A 4D1QA 5J40A 5F6FA 3CJQB 3FWEA 4YFKF 3CQZJ 2EV0A 5EEGA 3R0AA 1HLVA 1UHMA 5M5XJ 3EUHA 2XSDC 1XGSA 4PGGA 2MH2A 2ZNYA 1IRXA 3I4NJ 2EB7A 2PG4A 5CQGA 1IUYA 3MZ8A 4XONA 5LEKA 2XF5A 2DU9A 2ECCA 1BN5A 3GTKJ 2E2IJ 4EJVA 3TO9A 3OYBA 3FXUA 1DU6A 2M8GX 3LSJA 1V5EA 3COAC 1T0FC 1PUFB 3NAUA 4N4NB 1MBHA 3G2BA 2VONA 3BQZA 5EZGA 1SD4A 2P5KA 4EJTA 4O3MA 2RNGA 1SFOJ 4A3FJ 2XKOA 1D3YA 3Q3SA 3T1BA 2W00A 5JR3A 4BHPA 3EYYA 1JXSA 3LMMA 1B8IA 1WJFA 5D8LB 2V1DA 2B63J 3DKWA 3BR0A 2XROA 2GIVA 3OYCA 1LE8B 4N0BA 1T8IA 1H9TA 2FE3A 4KT5C 5J8FA 1HCRA 1OCOH 2WADA 4IHSA 4XORA 1B72B 3FMRA 4A3JJ 1MBJA 2QWWA 2HNHA 1MW7A 1SC7A 2LH9A 1V54H 5D4RA 2XIGA 2L7ZA 4AIKA 4LG3A 1N77A 2XGCA 5BPIA 2F5FA 2XC7A 2LBFA 2V4JC 5K5QA 2ECBA 2XKPA 3C2BA 2STTA 3KPHA 4HDUA 1KYZA 2R5YA 2F2EA 3TO6A 3CCYA 2X4HA 5HNHA 1ZGAA 1R9TJ 2XF7A 2LF8A 3FIWA 4AYBA 4LITA 2PQ8A 2CV2A 2M4KA 2VXDA 3G1OA 4RLQA 2P81A 5E8GA 2DXIA 1D1CA 3CUQA 3CCRI 4EGYA 4BXUA 1X1PA 5FLXZ 5BS6A 1I1GA 5IYBJ 5HLHA 2N8GA 1UHSA 3U2RA 2ZKZA 4IKFA 1JUSA 1F1ZA 1Y8RB 3H35A 2XAHA 3S2WA 2HVQA 3IAM2 3LSPA 5K1YA 2HTJA 1BI0A 2FQ4A 3EUHC 2O03A 1IDYA 2ID3A 2VXZA 3I71A 4ENNA 3MN2A 2QA4I 5IY5H 2VKHA 4WCGA 4M9ZA 1ZG3A 3QYEA 2ELJA 5M5WJ 2HXOA 3D5SC 5BQTA 1TC3C 4C3JJ 4RB2C 3BZKA 1QHHD 4HSTA 4HLXA 4HF0A 3RQIA 5CJ9A 1F4KA 3F8MA 4CGZA 2Q0OA 3M8EA 3WTTC 1DU0A 1HSTA 1RR8C 1RI7A 2MSYA 2VC1A 3S8PA 3CC7I 1ETWA 3VYSB 2HOSA 4GFBA 4O5VA 4D9JA 4RDUA 1VQNI 2DN0A 3F21A 2GXBA 2JA7J 3ZOBA 1TT0A 2DK8A 1PJRA 1OMIA 2JA5J 4IQ4A 4V2FA 1IXCA 1A6QA 2QBYB 1YRNA 4CCOA 4XK4A 3GX4X 2DMUA 2FOWA 3CJNA 3K4LA 2CFXA 4HNUA 3OL3A 1YG2A 3GFLA 2BZTA 2OCEA 5DV5A 4AIJA 2E2JJ 3MKLA 2VT2A 3CC2I 2IPQX 4GGGA 1Y0NA 5E17F 3PSIA 1DPRA 2ZB9A 1J09A 3D5RC 4BE1A 2R7XA 1DQUA 1ZLJA 4QSHA 2CV1A 2KKOA 2A5WA 1LDJA 2FEZA 4KN4X 3AG3H 1JE8A 3DU5A 2ZSHB 2COMA 2VKEA 4FTHA 3GZNB 4MTDA 3ZN1A 2CJJA 2L3DA 2LF7A 5E3OA 1GDTA 4KIBA 1A35A 1FYKA 3KLNA 2JQ7A 3CUQC 3S32A 1NK2P 2VB6A 3M1CA 5F04A 2PX9A 1X1DA 4EM1A 4Q4ZF 3TP0A 1R5HA 2W48A 1KU3A 2DTZA 4E4HA 2Q8KA 4B47A 2LP0A 5E3NA 4PSXA 5EGOB 3FBNB 2ACJA 1WSUA 4RAYA 1E3HA 2PMUA 5E79C 4G7HF 4IO9F 1HW1A 5TRDA 5DM6F 4RB3C 2VUMJ 1ACIA 2KT0A 2VBWA 4AC0A 2H94A 2DDBA 1FIAA 4JYKA 3GO5A 4LG0A 4EMSA 1KU9A 4BEHB 3SFIA 1ERDA 4BJ5C 1MKMA 2K9NA 1AU7A 3GBGA 1HW2A 3O8GA 3EETA 3TP3A 2FX0A 2CQQA 3REOA 5D5XB 1FP2A 1JHFA 1AHDP 3LNQA 1O7LA 1S72I 3LFUA 3K10A 1IN7A 3TMOA 2ISYA 3WGIA 4JX4A 2D5VA 1TT5B 4C30A 1BC7C 1Z21A 4FISA 2R7DA 3JREA 1YS6A 2HVRA 4Q5SF 4IEJA 2G7HA 1WH5A 1WCMJ 1ZRDA 1WH7A 3VSLA 3BQYA 4G6DA 4BHCA 4BL0B 1FX7A 2XPUA 1O3QA 4QPQA 3V7CA 1YIJI 2KMUA 5HLIA 3VYRB 2ELKA 4EM0B 3JSPA 2L9VA 3DV8A 4JQFA 1V5FA 4E70A 4EATA 4ZH4F 1RESA 2G7UA 3QQAA 4XQFA 1H8AC 1X1CA 2K4BA 4U87A 1G6NA 1FJLA 2VJ4A 3HRTA 1VQ5I 4B09A 3OS0A 3KP6A 5CVRA 1LPQA 3HRSA 3IRRA 5LGUA 1X1BA 3DPTA 4G8XA 1ETOA 5L3CA 2W7NA 5DCFA 3JRAA 4OIQF 3D5LA 1FBUA 1UG0A 3QU6A 5C4JJ 1KA8A 2EZHA 4CXFA 3H92A 5D6EA 3G4SI 4ZTFA 5IT9Z 1PUFA 1I39A 1Z91A 4PCQA 3IRQA 2CV0A 4RGUA 4UVAA 3CF5F 4XKCA 2ZSIB 2KLOA 2L4AA 3WG9A 3HBLA 1FNNA 3A03A 4I02A 4A2UA 4ZDOA 2YS9A 1DGRM 2HOAA 3OYKA 5E1XA 4KIFA 1MMSA 2DA7A 2LNBA 2KDOA 1LE8A 3BG3A 2FF4A 2H1LA 1BR2A 2HPMA 1BOBA 1ZQ3P 2O61A 2HPIA 4EJWA 2PN6A 4BQOA 5GAEJ 1ZK8A 1B72A 4BHBA 4Y17A 2H8WA 2F4IA 2X6OA 2GWRA 4ESFA 1P7JA 4ZYEA 1YJNI 1EJ9A 3KP5A 1TQMA 1HBXG 1BA5A 2K4JA 4F3QA 2H6BA 3PJRA 3DP7A 5L3GA 2ADUA 5EEHA 2QQBA 1O4XA 2Y31A 1GUUA 4XRFA 4L0YB 2K9SA 3OYDA 4MQ9F 1D0ZA 2V6EA 3S1QJ 1KQ8A 3HHGA 3DCFA 1BW6A 2YSRA 1O3RA 3F8NA 3F23A 4LLGF 1FYMA 5DCMB 2K5CA 4EM2A 3S3NA 2ZXIA 3JTGA 3DTEA 4BXXJ 1DP7P 3I4MJ 3JAMZ 1ZKGA 4B8XA 2WV1A 2VL8A 3CJTB 4NC8A 5JFRA 3BG9A 2F5VA 3CC4I 2HGCA 4KJZA 4IRIA 1P4XA 2CQXA 3AL0B 2DPDA 2GOMA 2Y48A 1Z6TA 1GHCA 3Q0VA 1ENHA 3FISA 2W57A 3SYTA 1EH8A 1OQYA 1IV6A 2WAFA 2R7SA 2Y0MA 4OWRB 1FT9A 1XGOA 1D1BA 2EILH 3Q0WA 3FXLA 2YR2A 4BUPA 2PFBA 4LJZF 4DBQA 2E34A 2EV6A 3CCQI 1FOXA 1ODDA 5GP9A 3PSFA 5FRNA 4G9YA 1RR7A 1Z77A 4ENMA 2XRLA 3WGGA 4XN3A 5LGTA 4EVIA 1OCTC 5FKMA 3OIQA 4M71A 3ZN0A 4AVPA 4E7LA 3KP2A 2KIUA 3GYHX 3HGYA 2O3FA 2WAEA 3H5RA 4FE4A 3CCJI 2GM4A 4DYCA 2QBYA 2QENA 3R0JA 3R4KA 4HX7A 5FLMJ 5FO5A 4ZZLA 1KYWA 5BNGA 4B43A 2XF6A 3K4JA 1FTZA 1WJCA 3BZCA 2AQFA 4AIDA 4Q48A 2STWA 3CP8A 5E3LA 4DYQA 2CG4A 2VJJA 5K7HA 2JZYA 3OL4A 2MH9A 3BPXA 3ZR8X 2OC6A 4OIRF 2X6YA 5M3MJ 2VQLA 1QPMA 3SDGA 3KIOA 1TWCJ 4GYGA 1GV2A 4M3BA 3CDHA 1V55H 3IKVA 3K4NA 1WJEA 3A1YA 5B1AH 4CH7A 4ZTJA 2P5VA 2FMLA 2JTVA 5J1YA 3HRMA 1A5JA 1J5YA 4BY7J 3O6BB 1RIOH 2GLOA 3LQQA 2K3PA 5EGOA 4A3EJ 5ILSA 2R7QA 3JRCA 4YRVA 1FP1D 2JA6J 1OISA 1X1AA 2FNAA 3W6KB 2P5LC 5B3SH 1I50J 5M5YJ 4ZDLA 4BEHA 2I8DA 2HQAA 1BR4A 2HQNA 3F3XA 3L2WA 2E1NA 4CHUA 2R0QC 2WAQN 4XMYA 1OYIA 1SFUA 4HX8A 1WGXA 3R61A 5HS9A 3E97A 1APLC 1XPXA 2LR8A 5L3EA 4U88A 3DKYA 3PUFA 2BOLA 5E8IA 3ERED 5DYMA 3K2AA 4L5IA 1IJWC 1Z7LA 4JX6A 1QPIA 3ABLH 1GV5A 4YIFA 1DGWY 2JMWA 3LSTA 2ZO4A 2XUBA 3ZQFA 4FETA 4AM3A 4XICA 3S2DJ 1MZBA 1ZAOA 4MEYF 3S2HJ 2IA2A 1P9QC 1FOKA 3H36A 3J81Z 3R60A 1O7FA 4IXAA 4Y4RA 4S05A 3L7WA 3RCOA 3ZMSA 2ZBKA 5J4YA 3FM3A 2VE8A 1HKSA 1FSEA 1FOWA 3CCEI 1VQPI 3WTWC 1DUXC 3E1SA 3GLXA 1N78A 2L5QA 1JKPC 1NK3P 4NHJA 2VIXA 4IQJA 1LVAA 1MBGA 5F0HA 2IA0A 1K79A 2KQRA 3HM5A 5GPAA 2VOPA 3BOQA 4QPOA 5LFAA 5EG0B 3GFMA 5FFXA 1W5CC 2JRTA 3JR9A 5J3LA 2IJLA 3I55I 1ZRCA 2DI3A 2JA2A 4XLCA 4U0VA 3JSOA 3OYGA 4NDLA 2X85A 3QPTA 1BM9A 1R4MB 1MNDA 2ESNA 2A69F 2GBYA 3G3ZA 3TKYA 3MKYB 3VOEA 1NG7A 4PK4A 5D5WB 3ZQHA 3H1CA 2EFWA 4XBFA 2YUSA 2XAQA 3ONQA 2EJRA 1W5TA 1ETVA 3BCBA 3FF5A 4CCJA 1MDMB 3LSGA 2KRHA 2ELHA 3BTLA 1MH4A 1SANA 1YITI 5DUIA 4A5NA 5KK1A 1U5TB 3QODA 3Q9VA 1R23A 2CWEA 2XB5A 5L3DA 2K02A 4OMYA 2M7AA 3BR2A 3V42A 4LLNA 3ZQGA 2P0WA 1JGSA 4XLHA 1Y56A 1I27A 3G71I 3ZQIA 3CCLI 3K69A 3K1MA 4A3LJ 3OS2A 1EV7A 4FHTA 4XOPA 2FBKA 5AIQA 3BWGA 5D8KB 3TGNA 5BPDA 4J01A 4DJAA 1ZHFA 2DMPA 5EJCA 1XX5A 2QQ8A 3K70D 4RA2A 5CKTA 4CA0A 4LGWA 1BBYA 4YIRX 3HTSB 5DCMA 1MNEA 4LG0B 1ZELA 2M3AA 3FX3A 3IC7A 4FE7A 4I98B 2QCOA 2O6GE 2VQCA 2IS6A 1GVJA 2YPRA 1TWFJ 2LMDA 1T08B 1FBSA 3CO6C 2FBHA 2NVXJ 1UB9A 3E5QA 4JBAA 1B6AA 3LOCA 1SEUA 3FMQA 2CQNA 3IH4A 3SHFA 2HOEA 4N9IA 2RQQA 1D1AA 3EPZA 4IJAA 1LEBA 3M07A 2QSGX 2JJ7A 3OIPA 4TV7A 1E3OC 2L9SA 3OYAA 3HOTA 2NVYJ 2XV4S 3MZHA 1ZYRF 3WTVC 5H6RA 1S3JA 4PFPA 4B3XA 1J59A 1BIAA 4F55A 2BHYA 1TW3A 1XTAA 2CRGA 2FJ1A 1U8BA 3CMYA 4KYWA 1LDKB 4XRSG 5HNFA 2E5NA 1MMAA 2MYSA 2PMHA 2R7TA 2ETHA 2KRCA 5F1JA 2ID6A 1HKQA 3CP2A 5TJJA 2UV1A 1XMXA 2VE9A 1RKTA 2O5RA 1X58A 1IZ1A 1V4RA 1FYLA 4M9XA 2M4GA 3J80Z 3AG2H 5ILVA 5A2QK 1ZGJA 3A0BC 4ZJZA 3BJ6A 1VQLI 4A93J 3V8LA 1TWAJ 2BYVE 2DJIA 3PL8A 1HA8A 4WX9A 4LIUA 3ZMTA 2NYXA 2EFPA 5FKNA 5J1RA 1CGPA 1AWCA 2AO9A 2HKOA 2R5ZB 1PP7U 2H27A 2QQAA 4S04A 1I6XA 2R7WA 2Y0SN 2V9PA 4N4OB 3OR2C 5HDNA 2XVCA 2LLKA 2LDUA 3TW6A 1S5LC 4HNVA 2WWYA 1VTNC 3KCCA 1BW5A 2E2HJ 3I4PA 4KT6A 2K86A 5H6QA 1VQ9I 3PIOF 4ENJA 4UUTA 3QYFA 3KETA 1T38A 1OYYA 5KHDA 1B9NA 2LTPA 1IO2A 5IYCJ 3M3YJ 1BI1A 1G3YA 2L2OA 1OCCH 1JT6A 2B9SA 4RM3A 1YJ9I 4KMUX 3CMAI 1YO5C 1ZLKA 4Y7NJ 2B7EA 1Y39A 3MFKA 3JRFA 3D1NI 4BACA 3C2GA 1T39A 1R00A 1R36A 3ZMVA 2GXAA 1U9OA 3AL0C 2W82A 4F7ZA 3ZQQA 3IWFA 3CCSI 2P7VB 1JJ6C 2FD5A 3CUOA 3HZJA 3BLYA 2HXIA 1KGSA 3L2RA 2CYYA 1N75A 2FRHA 1W4MA 4UNOA 1D0XA 3KE2A 4ZYHA 3S3MA 4I99C 4HV5A 2FQ3A 4FCYA 3VYTB 2XAGA 4AYBN 4UV9A 1ON1A 2DDAA 2X48A 3GTQJ 4A0XA 1Y8QB 3QWLA 5EDNA 4E7HA 3GLLA 1D0YA 4PUSA 1PDNC 3A2KA 3RTRA 3V7RA 4O6JA 1JKOC 2IP2A 3M8FA 2GA1A 2QQ9A 1QVTA 1HF0A 1MMNA 2VT3A 3WE3A 4ESJA 1YFHA 1W7PD 3RKYA 5L3FA 2L9NA 4XLEA 3A0HC 4HX4A 1BJAA 3OS1A 4L0ZB 3L1PA 4A12A 4A0YA 2HEOA 4ZC3A 1XMAA 3T5XA 2M9HA 4KITB 3BTIA 3N4MA 1KU2A 1J0RA 1K61A 2EK5A 2XAFA 3CZ6A 1TWHJ 2LOOA 1RZ4A 2Z3YA 2JSCA 4CZCA 2XPWA 4XL9A 1A31A 5EG0A 1IDZA 3B6CA 2O8XA 3CJRB 4OU0A 4CUGA 3I59B 1ZG5A 1VQ8I 4LK0F 3VODA 5DD4A 2NAZA 1Y0UA 5E1WA 4LIVA 2DMNA 2Z33A 4KISA 5TGTA 3BZ6A 5E3MA 2OTLI 2UXNA 4W97A 1MJBA 1X19A 2HTSA 3S1NJ 2HQ5A 2OQGA 1MDMA 2PMZN 4XLFA 3W6VA 1JJ8C 5HDGA 1SD6A 1U5TA 3OY9A 1BIBA 3I58A 1FLIA 1LFUP 2E60A 3G6EI 3T0YA 4L5EA 1VZ0A 2KISA 1SAXA 2JWTA 1FEXA 1NH3A 3OOPA 4IOAF 3C2HA 1VQMI 2BY2A 1KU7A 4A3BJ 1NG6A 4C2MJ 3OR1C 2HS5A 3IHUA 4Q47A 2NOGA 2R3SA 3MZYA 3I9V2 5KNLA 3RDIA 5IOYA 3OYIA 2JVGA 1R49A 2YU9J 2JA8J 2KRFA 4M6XA 3BR1A 3M7GA 4IHXA 1XSXA 3W2VA 3DU6A 4L9VA 4L5JA 3V7SA 1UZCA 5ICEA 3CESA 2EINH 2HOTA 2K9LA 5IP7J 4E6KG 1BI3A 5GADJ 5CLSA 2RNJA 5DTDA 3EUAA 2VBZA 2YX7A 4FX0A 3G1LA 1W1WE 2CUEA 4BAYA 3C1DA 1NTCA 1BJZA 1HW5A 3LA2A 4MQVA 4NNJA 4YEJA 5J8CA 1ORKA 3JW4A 3PM1A 3RSNA 5CVUA 3ASOH 3PIPF 2XAJA 4UUSB 2ISZA 2F48A 2FOKA 5FFZA 3K1NA 3UNGC 3NEUA 3U9GA 3VDXA 2DK5A 1YOVB 5GAGJ 1OYWA 2IGKA 3GMEA 2LG4A 3A02A 3HKZA 2JN6A 2M30A 1S29A 4WF2A 1WJAA 1R5GA 2FMYA 2M45A 3ZMUA 4DZJA 3WHBA 2WB1A 1YHQI 4NC6A 3A4CA 3E5UA 1A6IA 1SMTA 2CW0F 2HYGD 2W1OA 1ULYA 2V7FA 3ECHA 5FJ8J 3N97A 4HOBA 3W6JB 1XMKA 1K4TA 4I01A 3C18A 4HDVA 3HOYJ 1U5TC 2WY7Q 3BC8A 2OCCH 1IRZA 2LY9A 2P6SA 1WHUA 1MBFA 2A6TA 3GCMA 1HKTA 3ZCOA 2M34A 2X1EA 4U7BA 2D1HA 4UXNA 2L7FP 4ABZA 1J9IA 3ABTA 4RAFA 4KIGA 1MH3A 1K7AA 2R5ZA 1S7OA 4BKXA 1QZZA 3DEEA 3HOWJ 4F93B 2DT6A 4MLOA 3RPUA 2R7VA 4RMNA 3QPHA 5JLWA 2LK2A 2RVCA 3EQLF 3H3VK 2ZNZA 2IGMA 2KFDA 4KUMA 3EYIA 1EF4A 3I0TA 4XLAA 5L3BA 2CFOA 3HXLA 2HZTA 4UUVA 2QKLB 3WHCA 4OOIA 2O8KA 2MD0A 3HC7A 2VBYA 1QQIA 3QYBA 5FLXK 1TQIA 4ENKA 2DFHA 4BGDA 1XDSA 2XGDA 1JT0A 2VKDA 3CCVI 3BG6A 2F4OB 3ROUA 1Q1HA 1JKQC 1Z6RA 2F6CA 4RGRA 1T33A 2ME6A 5CVVA 1RRJA 1J7KA 2X51A 4XKVA 1I1SA 1XC5A 1JUMA 3TDUC 2BY1A
chains in the Genus database with same CATH topology
1ZR4A 3K2AA 3QPLA 1IJWC 4JX6A 2L0KA 3CQZJ 1QPIA 1GV5A 2JMWA 1HLVA 1Q1VA 5M5XJ 2XSDC 3ZQFA 3ZQLA 4XICA 3S2DJ 5C44J 3S2HJ 3I4NJ 1UG2A 3RZOJ 1H88C 2TCTA 2MW8A 2ECCA 3GTKJ 4XIDA 1AKHB 2E2IJ 3IH3A 4M3GA 1WPKA 5EZHA 1DU6A 2M8GX 3LSJA 4J19A 4JP0A 1PUFB 3NAUA 1MBHA 2VPRA 1POGA 3QPSA 4IHYA 3BQZA 5EZGA 1JKPC 1NK3P 1SFOJ 4A3FJ 5F08A 1MBGA 5F0HA 4G12A 3HM5A 5GPAA 3Q3SA 5EG0B 2R7ZJ 3JR9A 2O7OA 5J3LA 1B8IA 1IGNA 2B63J 4NDLA 3HB9A 3BR0A 2GBYA 2RAEA 5DS9A 4A3DJ 3F0CA 1LE8B 1S7EA 1HCRA 1P7IA 2MG4A 3GTJJ 3ZQHA 2VKVA 4A3IJ 1B72B 2YUSA 4A3JJ 3BT9A 1MBJA 1ETVA 3LSGA 2NVTJ 3BTLA 2L7ZA 1MH4A 1SANA 3H0GJ 4X1EA 2XGCA 3E7LA 1QVUA 3HKZN 3RKQA 2E1OA 2ECBA 2XB5A 3C2BA 2LD5A 2R5YA 3BR2A 1MBEA 3CCYA 4D5CA 3A01A 3ZQGA 1XS9A 1R9TJ 2WB1N 3FIWA 9ANTA 1U9NA 4IHWA 1F43A 3ZQIA 4DZPA 3G1OA 2P81A 5K7ZA 4A3LJ 2LFBA 5IYBJ 2EQRA 2K40A 2N8GA 5EF6A 1UHSA 4A3MJ 1JUSA 2Y30A 3MVPA 2DMQA 1VNDA 3K7AJ 2DMPA 3LSPA 1MSFC 2FQ4A 1JTYA 1IDYA 2ID3A 4FE7A 3MN2A 2QCOA 3HOVJ 3JRHA 1TWFJ 3OSFA 3GTPJ 4S0HB 2NVXJ 2OPTA 3OOUA 5M5WJ 1HOMA 2HXOA 3LOCA 1TC3C 4C3JJ 3IH4A 5F0FA 3CDLA 2DJNA 3RQIA 4JX5A 4RBOA 2COBA 2JJ7A 2VI6A 1DU0A 1E3OC 2NVYJ 4I76A 3S1MJ 2AHQA 2MSYA 3IH2A 1ETWA 2HOSA 4GFBA 2HDDA 2FJ1A 2CRGA 4RDUA 2DN0A 1U8BA 3CMYA 2JA7J 4XRSG 3ZOBA 3PO2J 2JA5J 4LOCA 4V2FA 5F1JA 4CYCB 1CQTA 2ID6A 4UUSA 1UMQA 1YRNA 4XK4A 2DMUA 3GTMJ 2KDZA 2LKXA 3IV5A 2NVQJ 1RKTA 2E2JJ 4B3AA 2DA2A 1X58A 3MKLA 4V2GA 4C3IJ 2ZB9A 5GPCA 4A93J 4C3HJ 1TWAJ 2EZKA 4QSHA 1XG1A 3BTJA 3BG5A 3NARA 5FKNA 5J1RA 2VKEA 4FTHA 5E3OA 2CJJA 2AO9A 1GDTA 2X9DA 2R5ZB 1QRYA 1U78A 1ITYA 1NK2P 2Y0SN 2Y9ZA 5F04A 1BL0A 2LLKA 1K83J 3TP0A 2W48A 2DTZA 1G2HA 5FKLA 3TW6A 4HNVA 2LP0A 5E3NA 5EGOB 2E2HJ 1BW5A 1LFBA 1F36A 2VUMJ 2KT0A 3BR5A 4UUTA 1H89C 3B6AA 4AC0A 3BR6A 1FTTA 1FIAA 1GVDA 2LTPA 4JYKA 4M6VA 5IYCJ 3M3YJ 5FKOA 3SFIA 1VFCA 1JT6A 5IP6A 1AU7A 2K9NA 4Y7NJ 3GBGA 4XRSA 4A3KJ 3O8GA 2I10A 2HYJA 2FX0A 1Z0XA 2CQQA 3TP3A 3JRFA 1MBKA 3D1NI 1AHDP 3LNQA 1ZR2A 1U9OA 1ZTRA 3GTOJ 5JLXA 4JX4A 3O8HA 2D5VA 1JJ6C 2FD5A 3DEWA 5IP9J 2HXIA 1IG7A 4FISA 2DMTA 3JREA 2G0EA 4IEJA 1WH5A 1WCMJ 2XGEA 1WH7A 2HI3A 3JRGA 4FCYA 3BQYA 4AYBN 2XPUA 1ETXA 3HOZJ 2X48A 3GTQJ 2ELKA 1WI3A 5EDNA 2K9QA 1ETYA 4IHVA 1HDPA 5EEAA 1RESA 4D7MA 3QQAA 2DA4A 1H8AC 2H1KA 1FJLA 1VF9A 1JKOC 4B4CA 1X2MA 1QVTA 1TWGJ 3UKGA 1HF0A 1JTXA 2M0CA 2DA3A 4AUXA 2CUFA 1ETOA 2EZIA 4A3GJ 4BBRJ 5IPAA 3JRAA 1OJLA 5IOZA 3L1PA 1AKHA 5C4JJ 1ETQA 2EZHA 2L9RA 4X6AJ 3OIOA 1B8IB 2M9HA 1PUFA 3BTIA 1K61A 2LVSA 2IEKA 1TWHJ 4XRMA 2IBDA 3HOXJ 2XPWA 4W1UA 4DW6A 2EH3A 4MFEA 5EG0A 1IDZA 2CU7A 3B6CA 3HBLA 3A03A 2YS9A 2HOAA 4BY1J 2DA7A 5C4XJ 2DMNA 1LE8A 1RPWA 3BG3A 3VPRA 2NS7A 5F0CA 5E3MA 1ZQ3P 2R5YB 2EZLA 4W97A 1B72A 1ZK8A 3A01B 3S1NJ 2HQ5A 5K7FA 1JKRC 2X6OA 1P7JA 2PMZN 2H8RA 3W6VA 1X2NA 4DYRA 1JJ8C 2O9LA 1BA5A 3SJMA 3ZQCA 5FLVA 4I6ZA 2TRTA 1T56A 2XB0X 3JRBA 3S15J 1LFUP 1O4XA 2Y31A 1GUUA 3S1QJ 2K9SA 4L5EA 1OFCX 2JWTA 3DCFA 1BW6A 1FEXA 4EEFG 1I6HJ 4M3FA 4A3BJ 4MIMA 2Y2ZA 1IUFA 4BXXJ 4C2MJ 2NS8A 2QF7A 5EYRA 3I4MJ 1ZKGA 4QTRA 2WV1A 1MSEC 4BBSJ 2NOGA 3BG9A 4M3DA 3LSRA 5IOYA 2DA1A 1ETKA 2CQXA 1ZGWA 2YU9J 2JA8J 3BR1A 4IHXA 3Q0VA 5IYDJ 1ENHA 3FISA 2HOTA 3HDDA 5IP7J 5M3FJ 3S16J 4A69C 1IV6A 5DTDA 2IAIA 3G1MA 3Q0WA 3JRDA 1D5YA 3TW7A 3G1LA 2CUEA 1NTCA 1BJZA 5GP9A 1ORKA 3HGGA 1JUPA 3PM1A 4Y52J 1OCPA 4D5FA 4MO7A 4UUSB 1YRNB 1RR7A 1Z77A 1W0UA 2EBIA 3TEDA 2XRLA 1OCTC 1JGGA 3HEFA 5FKMA 2MGQA 3A02A 5HODA 1W0TA 3HGYA 2JN6A 3S14J 4FE4A 2GM4A 4CYCA 3RZDJ 4DYCA 4DZJA 1RKWA 5FLMJ 3GTGJ 3WHBA 3GTLJ 1I3QJ 1RETA 2R92J 3HOUJ 1A6IA 5C3EJ 5F27A 3M4OJ 5BNGA 5FJ8J 5J1UA 1FTZA 2E19A 2M2EA 4DYQA 3HOYJ 5K7HA 1GT0C 4M3EA 1IRZA 2LY9A 3PO3J 1MBFA 2M34A 2DA5A 5M3MJ 2L7FP 4ABZA 3FK7A 2DA6A 3SDGA 1TWCJ 1GV2A 1MH3A 1Y1WJ 4M3BA 3S1RJ 2R5ZA 2ME0A 4BKXA 3HOWJ 3FK6A 4MLOA 1IC8A 3S17J 5JLWA 2LK2A 1HDDC 5J1YA 4A3CJ 3H3VK 5FKKA 1A5JA 4QIWN 4BY7J 2L7MP 2GLOA 1EF4A 1Y1VJ 5EGOA 4A3EJ 4MFDA 3JRCA 1FIPA 2JA6J 3WHCA 2O8KA 2XPVA 5M5YJ 1I50J 3BTCA 4B1RA 2JK3A 1VI0A 3FKIJ 2R0QC 2WAQN 2XGDA 3JRIA 1JT0A 2OF7A 3OSGA 1JKQC 1MNMC 1WGXA 2R93J 1T33A 2ME6A 1APLC 2LR8A 4D7NA 3Q0UA 3BR3A 1XC5A 1JUMA 5E3LA 2Y9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZR4 A;  3K2A A;  3QPL A;  1IJW C;  4JX6 A;  2L0K A;  3CQZ J;  1QPI A;  1GV5 A;  2JMW A;  1HLV A;  1Q1V A;  5M5X J;  2XSD C;  3ZQF A;  3ZQL A;  4XIC A;  3S2D J;  5C44 J;  3S2H J;  3I4N J;  1UG2 A;  3RZO J;  1H88 C;  2TCT A;  2MW8 A;  2ECC A;  3GTK J;  4XID A;  1AKH B;  2E2I J;  3IH3 A;  4M3G A;  1WPK A;  5EZH A;  1DU6 A;  2M8G X;  3LSJ A;  4J19 A;  4JP0 A;  1PUF B;  3NAU A;  1MBH A;  2VPR A;  1POG A;  3QPS A;  4IHY A;  3BQZ A;  5EZG A;  1JKP C;  1NK3 P;  1SFO J;  4A3F J;  5F08 A;  1MBG A;  5F0H A;  4G12 A;  3HM5 A;  5GPA A;  3Q3S A;  5EG0 B;  2R7Z J;  3JR9 A;  2O7O A;  5J3L A;  1B8I A;  1IGN A;  2B63 J;  4NDL A;  3HB9 A;  3BR0 A;  2GBY A;  2RAE A;  5DS9 A;  4A3D J;  3F0C A;  1LE8 B;  1S7E A;  1HCR A;  1P7I A;  2MG4 A;  3GTJ J;  3ZQH A;  2VKV A;  4A3I J;  1B72 B;  2YUS A;  4A3J J;  3BT9 A;  1MBJ A;  1ETV A;  3LSG A;  2NVT J;  3BTL A;  2L7Z A;  1MH4 A;  1SAN A;  3H0G J;  4X1E A;  2XGC A;  3E7L A;  1QVU A;  3HKZ N;  3RKQ A;  2E1O A;  2ECB A;  2XB5 A;  3C2B A;  2LD5 A;  2R5Y A;  3BR2 A;  1MBE A;  3CCY A;  4D5C A;  3A01 A;  3ZQG A;  1XS9 A;  1R9T J;  2WB1 N;  3FIW A;  9ANT A;  1U9N A;  4IHW A;  1F43 A;  3ZQI A;  4DZP A;  3G1O A;  2P81 A;  5K7Z A;  4A3L J;  2LFB A;  5IYB J;  2EQR A;  2K40 A;  2N8G A;  5EF6 A;  1UHS A;  4A3M J;  1JUS A;  2Y30 A;  3MVP A;  2DMQ A;  1VND A;  3K7A J;  2DMP A;  3LSP A;  1MSF C;  2FQ4 A;  1JTY A;  1IDY A;  2ID3 A;  4FE7 A;  3MN2 A;  2QCO A;  3HOV J;  3JRH A;  1TWF J;  3OSF A;  3GTP J;  4S0H B;  2NVX J;  2OPT A;  3OOU A;  5M5W J;  1HOM A;  2HXO A;  3LOC A;  1TC3 C;  4C3J J;  3IH4 A;  5F0F A;  3CDL A;  2DJN A;  3RQI A;  4JX5 A;  4RBO A;  2COB A;  2JJ7 A;  2VI6 A;  1DU0 A;  1E3O C;  2NVY J;  4I76 A;  3S1M J;  2AHQ A;  2MSY A;  3IH2 A;  1ETW A;  2HOS A;  4GFB A;  2HDD A;  2FJ1 A;  2CRG A;  4RDU A;  2DN0 A;  1U8B A;  3CMY A;  2JA7 J;  4XRS G;  3ZOB A;  3PO2 J;  2JA5 J;  4LOC A;  4V2F A;  5F1J A;  4CYC B;  1CQT A;  2ID6 A;  4UUS A;  1UMQ A;  1YRN A;  4XK4 A;  2DMU A;  3GTM J;  2KDZ A;  2LKX A;  3IV5 A;  2NVQ J;  1RKT A;  2E2J J;  4B3A A;  2DA2 A;  1X58 A;  3MKL A;  4V2G A;  4C3I J;  2ZB9 A;  5GPC A;  4A93 J;  4C3H J;  1TWA J;  2EZK A;  4QSH A;  1XG1 A;  3BTJ A;  3BG5 A;  3NAR A;  5FKN A;  5J1R A;  2VKE A;  4FTH A;  5E3O A;  2CJJ A;  2AO9 A;  1GDT A;  2X9D A;  2R5Z B;  1QRY A;  1U78 A;  1ITY A;  1NK2 P;  2Y0S N;  2Y9Z A;  5F04 A;  1BL0 A;  2LLK A;  1K83 J;  3TP0 A;  2W48 A;  2DTZ A;  1G2H A;  5FKL A;  3TW6 A;  4HNV A;  2LP0 A;  5E3N A;  5EGO B;  2E2H J;  1BW5 A;  1LFB A;  1F36 A;  2VUM J;  2KT0 A;  3BR5 A;  4UUT A;  1H89 C;  3B6A A;  4AC0 A;  3BR6 A;  1FTT A;  1FIA A;  1GVD A;  2LTP A;  4JYK A;  4M6V A;  5IYC J;  3M3Y J;  5FKO A;  3SFI A;  1VFC A;  1JT6 A;  5IP6 A;  1AU7 A;  2K9N A;  4Y7N J;  3GBG A;  4XRS A;  4A3K J;  3O8G A;  2I10 A;  2HYJ A;  2FX0 A;  1Z0X A;  2CQQ A;  3TP3 A;  3JRF A;  1MBK A;  3D1N I;  1AHD P;  3LNQ A;  1ZR2 A;  1U9O A;  1ZTR A;  3GTO J;  5JLX A;  4JX4 A;  3O8H A;  2D5V A;  1JJ6 C;  2FD5 A;  3DEW A;  5IP9 J;  2HXI A;  1IG7 A;  4FIS A;  2DMT A;  3JRE A;  2G0E A;  4IEJ A;  1WH5 A;  1WCM J;  2XGE A;  1WH7 A;  2HI3 A;  3JRG A;  4FCY A;  3BQY A;  4AYB N;  2XPU A;  1ETX A;  3HOZ J;  2X48 A;  3GTQ J;  2ELK A;  1WI3 A;  5EDN A;  2K9Q A;  1ETY A;  4IHV A;  1HDP A;  5EEA A;  1RES A;  4D7M A;  3QQA A;  2DA4 A;  1H8A C;  2H1K A;  1FJL A;  1VF9 A;  1JKO C;  4B4C A;  1X2M A;  1QVT A;  1TWG J;  3UKG A;  1HF0 A;  1JTX A;  2M0C A;  2DA3 A;  4AUX A;  2CUF A;  1ETO A;  2EZI A;  4A3G J;  4BBR J;  5IPA A;  3JRA A;  1OJL A;  5IOZ A;  3L1P A;  1AKH A;  5C4J J;  1ETQ A;  2EZH A;  2L9R A;  4X6A J;  3OIO A;  1B8I B;  2M9H A;  1PUF A;  3BTI A;  1K61 A;  2LVS A;  2IEK A;  1TWH J;  4XRM A;  2IBD A;  3HOX J;  2XPW A;  4W1U A;  4DW6 A;  2EH3 A;  4MFE A;  5EG0 A;  1IDZ A;  2CU7 A;  3B6C A;  3HBL A;  3A03 A;  2YS9 A;  2HOA A;  4BY1 J;  2DA7 A;  5C4X J;  2DMN A;  1LE8 A;  1RPW A;  3BG3 A;  3VPR A;  2NS7 A;  5F0C A;  5E3M A;  1ZQ3 P;  2R5Y B;  2EZL A;  4W97 A;  1B72 A;  1ZK8 A;  3A01 B;  3S1N J;  2HQ5 A;  5K7F A;  1JKR C;  2X6O A;  1P7J A;  2PMZ N;  2H8R A;  3W6V A;  1X2N A;  4DYR A;  1JJ8 C;  2O9L A;  1BA5 A;  3SJM A;  3ZQC A;  5FLV A;  4I6Z A;  2TRT A;  1T56 A;  2XB0 X;  3JRB A;  3S15 J;  1LFU P;  1O4X A;  2Y31 A;  1GUU A;  3S1Q J;  2K9S A;  4L5E A;  1OFC X;  2JWT A;  3DCF A;  1BW6 A;  1FEX A;  4EEF G;  1I6H J;  4M3F A;  4A3B J;  4MIM A;  2Y2Z A;  1IUF A;  4BXX J;  4C2M J;  2NS8 A;  2QF7 A;  5EYR A;  3I4M J;  1ZKG A;  4QTR A;  2WV1 A;  1MSE C;  4BBS J;  2NOG A;  3BG9 A;  4M3D A;  3LSR A;  5IOY A;  2DA1 A;  1ETK A;  2CQX A;  1ZGW A;  2YU9 J;  2JA8 J;  3BR1 A;  4IHX A;  3Q0V A;  5IYD J;  1ENH A;  3FIS A;  2HOT A;  3HDD A;  5IP7 J;  5M3F J;  3S16 J;  4A69 C;  1IV6 A;  5DTD A;  2IAI A;  3G1M A;  3Q0W A;  3JRD A;  1D5Y A;  3TW7 A;  3G1L A;  2CUE A;  1NTC A;  1BJZ A;  5GP9 A;  1ORK A;  3HGG A;  1JUP A;  3PM1 A;  4Y52 J;  1OCP A;  4D5F A;  4MO7 A;  4UUS B;  1YRN B;  1RR7 A;  1Z77 A;  1W0U A;  2EBI A;  3TED A;  2XRL A;  1OCT C;  1JGG A;  3HEF A;  5FKM A;  2MGQ A;  3A02 A;  5HOD A;  1W0T A;  3HGY A;  2JN6 A;  3S14 J;  4FE4 A;  2GM4 A;  4CYC A;  3RZD J;  4DYC A;  4DZJ A;  1RKW A;  5FLM J;  3GTG J;  3WHB A;  3GTL J;  1I3Q J;  1RET A;  2R92 J;  3HOU J;  1A6I A;  5C3E J;  5F27 A;  3M4O J;  5BNG A;  5FJ8 J;  5J1U A;  1FTZ A;  2E19 A;  2M2E A;  4DYQ A;  3HOY J;  5K7H A;  1GT0 C;  4M3E A;  1IRZ A;  2LY9 A;  3PO3 J;  1MBF A;  2M34 A;  2DA5 A;  5M3M J;  2L7F P;  4ABZ A;  3FK7 A;  2DA6 A;  3SDG A;  1TWC J;  1GV2 A;  1MH3 A;  1Y1W J;  4M3B A;  3S1R J;  2R5Z A;  2ME0 A;  4BKX A;  3HOW J;  3FK6 A;  4MLO A;  1IC8 A;  3S17 J;  5JLW A;  2LK2 A;  1HDD C;  5J1Y A;  4A3C J;  3H3V K;  5FKK A;  1A5J A;  4QIW N;  4BY7 J;  2L7M P;  2GLO A;  1EF4 A;  1Y1V J;  5EGO A;  4A3E J;  4MFD A;  3JRC A;  1FIP A;  2JA6 J;  3WHC A;  2O8K A;  2XPV A;  5M5Y J;  1I50 J;  3BTC A;  4B1R A;  2JK3 A;  1VI0 A;  3FKI J;  2R0Q C;  2WAQ N;  2XGD A;  3JRI A;  1JT0 A;  2OF7 A;  3OSG A;  1JKQ C;  1MNM C;  1WGX A;  2R93 J;  1T33 A;  2ME6 A;  1APL C;  2LR8 A;  4D7N A;  3Q0U A;  3BR3 A;  1XC5 A;  1JUM A;  5E3L A;  2Y9Y A; 
#chains in the Genus database with same CATH topology
 5FD6 A;  1WJB A;  3K4M A;  4ESB A;  2A6H F;  2R7U A;  1QA6 A;  2L0K A;  1X3Z B;  3ASN H;  1VQ7 I;  2ZFU A;  3RKX A;  4BE0 A;  3ZQL A;  3X2Q H;  4IHT A;  4IPA A;  2P8T A;  1H88 C;  2IS1 A;  1W36 C;  2JPB A;  4CIC A;  1LUJ B;  3IH3 A;  1WPK A;  5EZH A;  3K9T A;  5CPR B;  4JP0 A;  4GRI A;  1G3S A;  2VPR A;  3KZI C;  1POG A;  3QPS A;  4IHY A;  2BGC A;  3SXY A;  3MD2 A;  3H9J A;  3QRF F;  3TOB A;  2B0L A;  4FT8 A;  5F08 A;  1TNT A;  4G12 A;  4XNF A;  3K1P A;  3FXM A;  2NOJ B;  2O7O A;  2WV0 A;  2X0L A;  2ZME B;  3HB9 A;  4LLL A;  1FMW A;  3L9F A;  3TL4 X;  4E7S A;  5DS9 A;  2RAE A;  1PUE E;  4A3D J;  2DQR A;  2W4S A;  3F0C A;  3S3O A;  2DLL A;  2WTE A;  3CF2 A;  1BC8 C;  1P7I A;  2KPM A;  3GTJ J;  1YTY A;  2VKV A;  2A5Y B;  2CO5 A;  4A3I J;  1YX3 A;  2RC4 A;  4MGR A;  3BT9 A;  1A36 A;  2LSO A;  1NHA A;  2NVU B;  2Q1Z B;  3AG1 H;  4KDP A;  1WWX A;  3I59 A;  2XAU A;  4XM3 A;  1IAW A;  2NVT J;  3H0G J;  4X1E A;  2Q2E B;  3E7L A;  2GAU A;  2V6C A;  4PGH A;  3OV8 A;  5GAH J;  2KZV A;  2BE5 F;  4YFN F;  1E17 A;  2LD5 A;  3SEZ A;  4R79 A;  2P6T A;  4PSW A;  1FZP B;  1MBE A;  1Z3Y A;  2HQR A;  2KHM A;  2FUG 2;  3DTI A;  1XB4 A;  9ANT A;  2UUZ A;  1U9N A;  4IHW A;  1D5V A;  4WXC A;  4P55 A;  1ZH5 A;  1ZG1 A;  2LRE A;  2PBI A;  4BQQ A;  2BXZ A;  3FZV A;  4DZP A;  5K7Z A;  1DDN A;  2DFF A;  3AKZ A;  1ONV A;  2LFB A;  2OA4 A;  4BXF A;  2K40 A;  2F5D A;  2CMP A;  2BY3 A;  3KP3 A;  4A3M J;  1M1E B;  2Y30 A;  3F8B A;  3MVP A;  2BVL A;  2L4M A;  2DMQ A;  3WTY C;  1VND A;  1WJD A;  3K7A J;  1GLN A;  2QSH X;  2KL4 A;  2ZJR F;  2MLG A;  2ZC2 A;  4WXD A;  3G73 A;  4MHG A;  3PUB A;  3VEP A;  3L09 A;  4P1W A;  2H6C A;  2I5U A;  3I5U A;  1B4A A;  4LFU A;  5HS7 A;  2CUZ A;  5LEJ A;  4A5M A;  3W2W A;  3JRH A;  2C6Y A;  4S0H B;  1G59 A;  4HLY A;  1BI2 A;  2L7K A;  3KZY A;  2EA2 A;  1VQK I;  1IN4 A;  2K85 A;  1G4D A;  4HSR A;  2AS5 F;  3IL2 A;  1HOM A;  4ZZD A;  1MMD A;  2VOD A;  1YW8 A;  2X6X A;  2OZU A;  3SZT A;  2DJN A;  3FMS A;  4HQM A;  3L00 A;  4HZF A;  3IAS 2;  4JX5 A;  2UXX A;  4A6E A;  4RBO A;  1IRF A;  5H2F C;  4C2T A;  1IV8 A;  2V1X A;  3HTU A;  3ISP A;  2LRD A;  4I76 A;  1K78 B;  2WA0 A;  3RJP A;  1R4N B;  1TTY A;  1PP8 F;  2IT0 A;  4OIP F;  5HLG A;  5JHF A;  3FHN A;  4HRI A;  2D45 A;  2W25 A;  4FX4 A;  1B1B A;  2CQK A;  2D1V A;  2EPF A;  2VLA A;  2HVS A;  3QP6 A;  3RYP A;  1CQT A;  5HVQ C;  4UUS A;  1UMQ A;  1YIO A;  1UCR A;  2WAQ A;  4ITV A;  3GTM J;  1UST A;  2KDZ A;  2LKX A;  4HPQ A;  4BJ6 C;  2DA2 A;  4LB6 B;  1FPQ A;  2MBF A;  3KEO A;  4CCK A;  4I0B A;  5IT9 K;  3LA7 A;  4E7K A;  2VJ5 A;  2W85 A;  2EIM H;  4DIQ A;  1STZ A;  5GPC A;  3P5J A;  1USS A;  2QLZ A;  5JI6 A;  2KIM A;  2AXL A;  1XG1 A;  1Z67 A;  2ZJQ F;  3F72 A;  5TIS C;  3BG5 A;  3NAR A;  4I0A A;  3H9Q A;  4XOT A;  1LQ1 A;  3DFG A;  1QZE A;  2JUG A;  3CCU I;  4PJJ A;  5LD2 C;  3KLO A;  3VSK A;  1QRY A;  3OYH A;  2EFQ A;  1R58 A;  1U78 A;  2EIJ H;  3K70 C;  2Y9Z A;  2BY0 A;  4CO8 A;  3PNY A;  4BH9 A;  3KP4 A;  1G2H A;  4HG2 A;  4PDK A;  4H0E A;  5J6X A;  2XRN A;  4BS9 A;  3U1D A;  1U6G A;  3DF8 A;  4K2E A;  1F36 A;  1RUN A;  3OYM A;  4J00 A;  3F6V A;  1H89 C;  3ZXS A;  1FTT A;  1I3A A;  5J47 A;  1GVD A;  2CGP A;  4HF2 A;  1X4O A;  5FKO A;  1VFC A;  3ZGK A;  3JCU C;  2IS2 A;  4NBQ A;  4A3K J;  1UHW A;  2HYJ A;  1SVM A;  1Z0X A;  3DLL F;  1MBK A;  3GXO A;  5LGN A;  2VQG A;  3RYR A;  4NQW B;  1ZTR A;  1B9M A;  3WG7 H;  2K7L A;  2HDC A;  5JLX A;  2KJB A;  3O8H A;  1SD5 A;  5B66 C;  3ZMD A;  3DEW A;  3R6S A;  1LNW A;  1Z1D A;  5IP9 J;  2DMT A;  2M7B A;  3D0S A;  2CSO A;  1YW7 A;  3JAM K;  4D0P A;  2XGE A;  3OYF A;  2L54 A;  3U1K A;  2DOE A;  2RKH A;  3HOZ J;  2RQP A;  4AD9 A;  1WI3 A;  2BXY A;  2LY1 A;  2RGV A;  3IP4 B;  2K3F A;  2K9Q A;  2LYC A;  1P4A A;  1HDP A;  2VJI A;  1C0W A;  4D7M A;  4PJ0 C;  1K6O A;  3ZMZ A;  2H1K A;  5CQE A;  3TQN A;  2CQ7 A;  2V26 A;  3DPL C;  1Z3X A;  2DCE A;  1X2M A;  2WY8 Q;  5F1R A;  2EA4 A;  4AIH A;  2DA3 A;  4AUX A;  1T6S A;  1PYV A;  4GO1 A;  1GXQ A;  4CCN A;  4PJL A;  2EZI A;  2Z99 A;  3H5A A;  2X1C A;  3E6D A;  3VWB A;  2FA5 A;  2LKS A;  4UHT A;  4YII A;  5IOZ A;  2L02 A;  1XSV A;  2L9R A;  3OIO A;  1OR7 A;  2IW5 A;  1ZN2 A;  1D8K A;  2HZD A;  1LJ9 A;  4YFX F;  3MEX A;  2R7O A;  1A04 A;  3RPQ A;  5IT3 A;  2JVH A;  4PZJ A;  1J75 A;  4W1U A;  1GXP A;  1S6L A;  3E5X A;  4DW6 A;  2EH3 A;  2TDX A;  1HC8 A;  3CLQ A;  4MFE A;  2XHK A;  3K4C A;  1E3P A;  2EV5 A;  2GA2 A;  2ZME A;  2GZW A;  2P4W A;  2R4G A;  4P96 A;  3K0L A;  1H9G A;  1R22 A;  4BQN A;  4HQE A;  4LB5 A;  2ZXJ A;  2OBP A;  1X3W B;  2EFN A;  2BVM A;  2E7X A;  3LSK A;  5F0C A;  3AG4 H;  3DEU A;  3OWT A;  4DOZ A;  4WK8 F;  2PJR B;  5D5U B;  3JTH A;  1SMY F;  3A01 B;  3HIF A;  4LK1 F;  2KIQ A;  5K7F A;  4F92 B;  4DQ2 A;  2CS3 A;  2CH0 A;  3DBR B;  2O9L A;  3SJM A;  1TBX A;  2Q2E A;  5JVT A;  1V3F A;  2E71 A;  1SFX A;  3GUD A;  3JRB A;  3S15 J;  2V1N A;  2QUF A;  5ERI A;  4C2U A;  1EH6 A;  2DO7 A;  2BHZ A;  2GIZ A;  2WC2 A;  1OFC X;  2YX4 A;  3HSF A;  4F52 A;  3B73 A;  4KNY A;  5E1Z B;  4M72 A;  5KAF C;  1TL8 A;  1J2X A;  2HFH A;  3FM5 A;  4RLF A;  1I6H J;  1K6Y A;  1QGP A;  2Y2Z A;  2NS8 A;  5EYR A;  4OIN F;  4RS8 A;  4DBR A;  5K5O A;  1MSE C;  2VC0 A;  1XN7 A;  4RM2 A;  3LSR A;  2DA1 A;  3VB2 A;  2E35 A;  1ZRF A;  1ETK A;  1VQ4 I;  1ZGW A;  1DPU A;  3SZP A;  4BDZ A;  1RUO A;  3S93 A;  2V9K A;  3PFY A;  4P9F A;  2IRF G;  2Y0S A;  2A61 A;  4R1H A;  5LHH A;  5FRO A;  1U3E M;  5CVJ A;  2M1B A;  3HDD A;  3S16 J;  4A69 C;  2IAI A;  5ED4 A;  1OR7 C;  3G1M A;  1YQA A;  3JRD A;  1D5Y A;  4HYE A;  3TW7 A;  1IF1 A;  2OTJ I;  1HQC A;  2GOX B;  5LHG A;  2A68 F;  3L2U A;  4HEA 2;  3HGG A;  2QZ8 A;  1JUP A;  3LSM A;  4Y52 J;  1OCP A;  4MO7 A;  1QBJ A;  2HDW A;  3VYU B;  3HSR A;  2FNP A;  3J81 K;  1W0U A;  1K78 A;  1T98 A;  3ECO A;  3GW2 A;  5FD5 A;  2VPL A;  1JGG A;  3H3Z A;  3O3K A;  2FBI A;  2ZME C;  3HEF A;  1WFX A;  2MGQ A;  1W0T A;  5HOD A;  2V79 A;  3S14 J;  2OU2 A;  1IRG A;  3LAP A;  2PI0 A;  2EWN A;  4KN7 X;  1T95 A;  3ABU A;  2GXG A;  3M8J A;  3NQO A;  3LAJ A;  3BG7 A;  3GTL J;  2DFE A;  3HPG A;  4B44 A;  4CYD A;  1I3Q J;  1RET A;  2R92 J;  3MKW B;  2H09 A;  2DTR A;  5C3E J;  4M6Y A;  3EDP A;  1IXS B;  4L18 B;  3M4O J;  3ZPL A;  5J1U A;  1QHG A;  2IGN A;  1WZ2 A;  2ZXW H;  2M2E A;  1GT0 C;  1FOY A;  3MAJ A;  4M3E A;  2OZ6 A;  4EQQ A;  3PO3 J;  5D6F A;  2DA5 A;  4HA8 A;  2OAZ A;  4XKW A;  1WI9 A;  3LL7 A;  3SDB A;  3FK7 A;  3SQN A;  2ZJ2 A;  4L9T A;  3ELK A;  2MC4 A;  1FMV A;  4NB5 A;  2DW4 A;  1REP C;  3FXK A;  2O0Y A;  1HXD A;  4U7D A;  3F8C A;  4L9N A;  3FK6 A;  4L9J A;  1T2K A;  4M73 A;  1IC8 A;  3S17 J;  1HDD C;  1OCZ H;  2PLY A;  1Z7U A;  1OCR H;  5FKK A;  3KFW X;  5KCM A;  1LFP A;  3LSI A;  4MFD A;  3KEQ A;  2QM3 A;  1YW9 A;  5JVG F;  4MTE A;  4PJM A;  1BR1 A;  4HF1 A;  2W24 A;  4NUB A;  1WVR A;  1FWZ A;  1RNL A;  4U0W A;  5LHI A;  1WKM A;  1KON A;  4B1R A;  2PJP A;  4II3 A;  3BPV A;  3E6C C;  4U0Y A;  1JI8 A;  2A05 A;  3FKI J;  2M87 A;  3NRV A;  3TO7 A;  3I56 I;  3J7A O;  4KMF A;  2CUJ A;  3OYN A;  1R1V A;  1O3T A;  2JT1 A;  2OF7 A;  3OSG A;  1MNM C;  3LWF A;  4NQW A;  1YI2 I;  2HYF A;  1SD7 A;  1ON2 A;  3ZP5 A;  3KZZ A;  4Y15 A;  4EV0 A;  4X0G A;  3BR3 A;  3PQJ A;  2Y9Y A;  5BMZ A;  1ZR4 A;  2QSF X;  2P7C B;  1O57 A;  3QPL A;  1P6R A;  5H20 A;  4RAZ A;  2PMZ A;  3VFZ A;  1Q1V A;  1U0J A;  1KQ9 A;  4UY8 I;  6PAX A;  1ZRE A;  3K4B A;  3NWS A;  5C44 J;  2ZJP F;  1UG2 A;  4AWX B;  3RZO J;  3CMM A;  2TCT A;  3QAH A;  2MW8 A;  4XID A;  1AKH B;  4M3G A;  2GQQ A;  4WWC A;  1KZH A;  4J19 A;  2BW3 B;  4I2O A;  4UB6 C;  4EJU A;  1H0M A;  4P9U A;  1EKE A;  2R7F A;  5LRS A;  3HRU A;  2Z9O A;  4YG2 F;  3L2Q A;  2E36 A;  3CME I;  4OIO F;  4XR6 A;  2R7Z J;  4NC7 A;  3K2Z A;  1IGN A;  4PFO A;  4Y13 A;  1Y6I A;  3ML6 A;  1MJA A;  3J80 K;  4I09 A;  2WBM A;  2M8E A;  1S7E A;  3HJE A;  4B48 A;  2MG4 A;  4UB8 C;  3MMY B;  1YS7 A;  3WTU C;  4Z6Y A;  1MD0 A;  3L2V A;  4G94 A;  4EGZ A;  3HUG B;  5HLT A;  3W2A A;  4I7H A;  3LQR A;  1L3L A;  3DBH B;  2A07 F;  3H3U A;  2LY2 A;  3GVA A;  4Y3O A;  4XLN F;  3ABM H;  4IOC F;  3HKZ N;  1QVU A;  3MWM A;  3RKQ A;  2E1O A;  3O2P E;  1HSJ A;  2KIF A;  1F9N A;  1V5G A;  2PJR A;  4UVB A;  4MNU A;  4KIC A;  3FXO A;  3A01 A;  4D5C A;  3CCM I;  1XS9 A;  2DFI A;  2WB1 N;  2NXN B;  2D2W A;  1F43 A;  1FY7 A;  3DLA A;  1K4S A;  1R5I D;  1P4W A;  3TOA A;  3TDZ C;  1WQ2 A;  3RQ4 A;  2QVO A;  1S7A A;  2EQR A;  3GEZ A;  3GZ5 A;  4RB0 A;  5EF6 A;  5E18 F;  3L2C A;  4UV8 A;  4C9Y A;  3OYE A;  2ICW G;  2A6E F;  2XAS A;  2IVM A;  2M0M A;  2V9V A;  3Q9S A;  2Z1D A;  4HV6 A;  4R8H A;  1MSF C;  3P7N A;  4AVZ A;  5K5R A;  3KP7 A;  4PJN A;  1JTY A;  1AA7 A;  5AIP A;  3ZRG A;  4BU2 A;  4UVC A;  3ABK H;  3FDY A;  4KA4 A;  1LKX A;  3HOV J;  2BEO A;  3OSF A;  3GTP J;  4G7Z F;  4HNT A;  5ICF A;  3J7A Y;  2OPT A;  3OOU A;  3QOP A;  2E1M B;  2QYO A;  4CCL A;  2DT7 B;  5F0F A;  4DNC A;  2RN7 A;  3CDL A;  5HOO A;  2V1U A;  3ESW B;  1MMG A;  2COB A;  2VI6 A;  3WTS C;  4H4K C;  3GFI A;  1VQO I;  5DD8 A;  3S1M J;  2AHQ A;  5CVI A;  2KP6 A;  1TW2 A;  3IH2 A;  1FSH A;  3FKJ A;  4RGS A;  1UJ8 A;  3WU0 A;  1FC3 A;  2Y75 A;  1IXR C;  2AXT C;  3DKX A;  2HDD A;  2RRE A;  1OPC A;  1TLH B;  3FXJ A;  1QNT A;  1D8J A;  3PO2 J;  2VOO A;  2JPC A;  3W3C A;  1O3S A;  4LOC A;  3DXJ F;  4CYC B;  1WJ5 A;  1W7P B;  3RKW A;  4ASN A;  2EIK H;  4IX7 A;  2X1D A;  3PFI A;  1Z05 A;  2BV6 A;  1CF7 B;  1IN5 A;  3IV5 A;  2NVQ J;  2J5O A;  3OMY A;  4B3A A;  4FAS D;  4V2G A;  4JK1 X;  4C3I J;  4ZYG A;  3DPU A;  2J5P A;  3P9C A;  2MAB A;  1LB2 A;  2IS4 A;  1R6R A;  1N25 A;  3QOE A;  1P2F A;  2Z16 A;  3ULQ B;  1SFE A;  2OUM A;  2EZK A;  2VN2 A;  4C3H J;  1G3T A;  4WXH A;  1OKR A;  2QEX I;  2RV8 A;  3H9G A;  2DPU A;  3AFH A;  3BTJ A;  3GF2 A;  3QP5 A;  3UR3 C;  4FQG A;  4XLP F;  1R71 A;  4GYI A;  2G9W A;  3BJO A;  1XCV A;  2X9D A;  2NNN A;  4GXO A;  1YE9 A;  3P9I A;  2BBY A;  4G6Q A;  1ITY A;  2R7R A;  3OYJ A;  2E5Z A;  1BL0 A;  1SVL A;  4ZYD A;  1R1U A;  1K83 J;  4CSW A;  3IKT A;  3FXQ A;  5FKL A;  1FBQ A;  2ZXH A;  4LMY A;  4IVN A;  4A6D A;  2DYS H;  1LFB A;  5ICG A;  2ZFW A;  1E0E A;  3BR5 A;  4E7J A;  3B6A A;  3FXR A;  3BR6 A;  2QKM B;  1R1T A;  3FBI B;  3ERM A;  4M6V A;  2LC2 A;  1QU3 A;  4OAY A;  4BJT A;  3LA3 A;  1S8N A;  5IP6 A;  2CW7 A;  3T8R A;  4XRS A;  2ESH A;  2I10 A;  1XCB A;  1MGT A;  2IXS A;  4XSX F;  1YX5 A;  2ZCW A;  1ZR2 A;  4II2 A;  4HW0 A;  2DOF A;  2FXA A;  3BY6 A;  2MD5 A;  3GTO J;  3WTX C;  3GZ6 A;  1LEA A;  4GDF A;  1F5T A;  2FU4 A;  2JRM A;  3U21 A;  2F4M B;  3BDD A;  1IG7 A;  1IN6 A;  1W5S A;  1ZAR A;  5HS8 A;  2G0E A;  3TBI A;  4E7I A;  3JRG A;  2HI3 A;  1EA3 A;  4ON0 A;  1UEL B;  1TP4 A;  4AU7 A;  3K6G A;  5JHU A;  3KYD B;  1ETX A;  3DWL E;  4GCV A;  5D5V B;  3E0J B;  2E7W A;  3IWZ A;  4IHV A;  1ETY A;  5EEA A;  3HPH A;  2DA4 A;  1AOY A;  1VF9 A;  2VQH A;  2KZG A;  2VAS A;  3WE2 A;  1XDU A;  4B4C A;  1L0O C;  1TWG J;  3I53 A;  5ICC A;  1IN8 A;  3UKG A;  1G8X A;  1JTX A;  2M0C A;  1VQ6 I;  2CUF A;  1E2X A;  1X4P A;  3MCZ A;  1W36 D;  4A3G J;  2MA3 A;  4BBR J;  5IPA A;  1OJL A;  1SFK A;  5GTH C;  1RC9 A;  1U2W A;  1EH7 A;  5FGM A;  1AKH A;  4MEX F;  1TQP A;  1ETQ A;  4YEL A;  4X6A J;  2A3S A;  2HR3 A;  5F64 A;  1S9H A;  1B8I B;  4OAZ A;  2BW3 A;  5A2Q Z;  2DBB A;  2YU3 A;  1R7J A;  2LVS A;  2IEK A;  3F9K A;  5LRR A;  2K27 A;  3SFZ A;  4XRM A;  2IBD A;  3E6B A;  3HOX J;  2NS0 A;  2W84 A;  4A0Z A;  4Z2Y A;  3IUO A;  2Y69 H;  4JOM A;  5GTI C;  4HBL A;  2IGO A;  1U8R A;  2CU7 A;  3QU3 A;  3I3L A;  1XD7 A;  4P5O A;  2F5C A;  2X6W A;  3H0D A;  4LD5 A;  3AAF A;  1UFM A;  1YJW I;  4BY1 J;  5LBQ A;  3RPU D;  5C4X J;  2DQL A;  2JSP A;  2LBF B;  5HDK A;  1RPW A;  1G3W A;  3VPR A;  2NS7 A;  3CO7 C;  4BDY A;  3T8T A;  2R5Y B;  2EZL A;  3C7J A;  4ETS A;  3DTK A;  1JHH A;  1QZY A;  3DQV C;  4ZDP A;  4KFC A;  3GFJ A;  1XGN A;  2CW8 A;  3HUG A;  1JKR C;  1PVE A;  5E20 A;  2H8R A;  1X2N A;  5KAI C;  1XGM A;  2HKX A;  4DYR A;  3C3W A;  1TZL A;  3KEY A;  3ZQC A;  5FLV A;  2DAO A;  3CUQ B;  4XN0 A;  4EJO A;  4I6Z A;  2TRT A;  4HAM A;  1T56 A;  3EUK L;  2M5W A;  2XB0 X;  4OMZ A;  4CCM A;  3OYL A;  3F6O A;  2EFO A;  4N9H A;  3H5N A;  2XDV A;  1LVK A;  3HYI A;  2UZK A;  4BNC A;  3HHH A;  1Z9C A;  3WTZ A;  3V8K A;  2L01 A;  3RIR A;  2Z5U A;  2NNY A;  2E1C A;  4EEF G;  1X3U A;  3HG9 A;  5KVR A;  4M9S A;  4M3F A;  4MIM A;  2OJE D;  1IUF A;  5D4S A;  5CYV A;  1SAU A;  3F8F A;  2QF7 A;  3M9A A;  4Y33 A;  3CD6 I;  2PEX A;  4QTR A;  2FSW A;  4BBS J;  3FHZ A;  4M3D A;  1XSD A;  3LFK A;  3E3V A;  5B1B H;  5IYD J;  3PNT A;  1BOA A;  4G6T B;  1MJ9 A;  4IRG A;  4IZZ A;  3BCA A;  2HWV A;  5M3F J;  3B02 A;  2AQE A;  4RAG A;  3KYL A;  4ZYA A;  3J7Y J;  2DT5 A;  4ANJ A;  2KJC A;  4XKB A;  3BP8 A;  4V19 K;  1QO0 D;  2JUC A;  5ILU A;  2OD5 A;  4BE2 A;  4IL6 C;  3BRO A;  4D5F A;  2NRA C;  3DBL B;  1YRN B;  1YYV A;  4QWQ A;  3KX2 A;  4RGX A;  3ZQ7 A;  5LLQ A;  2EBI A;  3TED A;  5B5E C;  3MQ0 A;  1DP3 A;  3V8J A;  5FRM A;  2MFZ A;  3M1E A;  3I54 A;  3SZG A;  2QGU A;  3V4G A;  3WU2 C;  3MKZ A;  4CYC A;  1I5Z A;  1W7P A;  3RZD J;  3CLO A;  2F5E A;  3CTA A;  1RKW A;  3I64 A;  3GTG J;  1CF7 A;  3KYC B;  3HOU J;  3WU1 B;  4IF4 A;  1T0F A;  3PNV A;  5F27 A;  3HOS A;  2E19 A;  2OV7 A;  1YLF A;  5AON A;  1SVO A;  2MC3 A;  1P92 A;  4RB1 A;  2UWM A;  2RDP A;  3HSE A;  2DYR H;  2DOA A;  3WGH A;  2XGX A;  1KQ0 A;  2DA6 A;  3SEQ A;  1MIJ A;  3RI4 A;  4CDG A;  1Y1W J;  2OQR A;  4M74 A;  4BYY A;  3S1R J;  1LDD A;  2LKP A;  2MLK A;  5DEQ A;  2ME0 A;  5J4V A;  3CDI A;  3Q5F A;  5DUK A;  4XSZ F;  3LSH A;  4A3C J;  2IA1 A;  5BOX A;  3BJA A;  4QIW N;  3NWT A;  2L7M P;  1B59 A;  1Y1V J;  2DOD A;  2Z2S B;  3WOD F;  1FIP A;  3E6M A;  2XPV A;  1TNS A;  1IW7 F;  3HL2 A;  4E7Z A;  3BTC A;  2K9M A;  4IRH A;  3P9K A;  3N05 A;  1OLT A;  2JK3 A;  4G7O F;  1VI0 A;  5DDG A;  4BQA A;  4DGW B;  3JRI A;  4CZZ A;  3K4K A;  4F91 B;  1WRJ A;  3J7Z I;  1UAA A;  3PQK A;  5DM7 F;  4QLC U;  2E1M C;  2R93 J;  2HU9 A;  3F22 A;  3GWZ A;  2XSJ C;  4D7N A;  2VBX A;  3Q0U A;  5FB2 A;  4D1Q A;  5J40 A;  5F6F A;  3CJQ B;  3FWE A;  4YFK F;  3CQZ J;  2EV0 A;  5EEG A;  3R0A A;  1HLV A;  1UHM A;  5M5X J;  3EUH A;  2XSD C;  1XGS A;  4PGG A;  2MH2 A;  2ZNY A;  1IRX A;  3I4N J;  2EB7 A;  2PG4 A;  5CQG A;  1IUY A;  3MZ8 A;  4XON A;  5LEK A;  2XF5 A;  2DU9 A;  2ECC A;  1BN5 A;  3GTK J;  2E2I J;  4EJV A;  3TO9 A;  3OYB A;  3FXU A;  1DU6 A;  2M8G X;  3LSJ A;  1V5E A;  3COA C;  1T0F C;  1PUF B;  3NAU A;  4N4N B;  1MBH A;  3G2B A;  2VON A;  3BQZ A;  5EZG A;  1SD4 A;  2P5K A;  4EJT A;  4O3M A;  2RNG A;  1SFO J;  4A3F J;  2XKO A;  1D3Y A;  3Q3S A;  3T1B A;  2W00 A;  5JR3 A;  4BHP A;  3EYY A;  1JXS A;  3LMM A;  1B8I A;  1WJF A;  5D8L B;  2V1D A;  2B63 J;  3DKW A;  3BR0 A;  2XRO A;  2GIV A;  3OYC A;  1LE8 B;  4N0B A;  1T8I A;  1H9T A;  2FE3 A;  4KT5 C;  5J8F A;  1HCR A;  1OCO H;  2WAD A;  4IHS A;  4XOR A;  1B72 B;  3FMR A;  4A3J J;  1MBJ A;  2QWW A;  2HNH A;  1MW7 A;  1SC7 A;  2LH9 A;  1V54 H;  5D4R A;  2XIG A;  2L7Z A;  4AIK A;  4LG3 A;  1N77 A;  2XGC A;  5BPI A;  2F5F A;  2XC7 A;  2LBF A;  2V4J C;  5K5Q A;  2ECB A;  2XKP A;  3C2B A;  2STT A;  3KPH A;  4HDU A;  1KYZ A;  2R5Y A;  2F2E A;  3TO6 A;  3CCY A;  2X4H A;  5HNH A;  1ZGA A;  1R9T J;  2XF7 A;  2LF8 A;  3FIW A;  4AYB A;  4LIT A;  2PQ8 A;  2CV2 A;  2M4K A;  2VXD A;  3G1O A;  4RLQ A;  2P81 A;  5E8G A;  2DXI A;  1D1C A;  3CUQ A;  3CCR I;  4EGY A;  4BXU A;  1X1P A;  5FLX Z;  5BS6 A;  1I1G A;  5IYB J;  5HLH A;  2N8G A;  1UHS A;  3U2R A;  2ZKZ A;  4IKF A;  1JUS A;  1F1Z A;  1Y8R B;  3H35 A;  2XAH A;  3S2W A;  2HVQ A;  3IAM 2;  3LSP A;  5K1Y A;  2HTJ A;  1BI0 A;  2FQ4 A;  3EUH C;  2O03 A;  1IDY A;  2ID3 A;  2VXZ A;  3I71 A;  4ENN A;  3MN2 A;  2QA4 I;  5IY5 H;  2VKH A;  4WCG A;  4M9Z A;  1ZG3 A;  3QYE A;  2ELJ A;  5M5W J;  2HXO A;  3D5S C;  5BQT A;  1TC3 C;  4C3J J;  4RB2 C;  3BZK A;  1QHH D;  4HST A;  4HLX A;  4HF0 A;  3RQI A;  5CJ9 A;  1F4K A;  3F8M A;  4CGZ A;  2Q0O A;  3M8E A;  3WTT C;  1DU0 A;  1HST A;  1RR8 C;  1RI7 A;  2MSY A;  2VC1 A;  3S8P A;  3CC7 I;  1ETW A;  3VYS B;  2HOS A;  4GFB A;  4O5V A;  4D9J A;  4RDU A;  1VQN I;  2DN0 A;  3F21 A;  2GXB A;  2JA7 J;  3ZOB A;  1TT0 A;  2DK8 A;  1PJR A;  1OMI A;  2JA5 J;  4IQ4 A;  4V2F A;  1IXC A;  1A6Q A;  2QBY B;  1YRN A;  4CCO A;  4XK4 A;  3GX4 X;  2DMU A;  2FOW A;  3CJN A;  3K4L A;  2CFX A;  4HNU A;  3OL3 A;  1YG2 A;  3GFL A;  2BZT A;  2OCE A;  5DV5 A;  4AIJ A;  2E2J J;  3MKL A;  2VT2 A;  3CC2 I;  2IPQ X;  4GGG A;  1Y0N A;  5E17 F;  3PSI A;  1DPR A;  2ZB9 A;  1J09 A;  3D5R C;  4BE1 A;  2R7X A;  1DQU A;  1ZLJ A;  4QSH A;  2CV1 A;  2KKO A;  2A5W A;  1LDJ A;  2FEZ A;  4KN4 X;  3AG3 H;  1JE8 A;  3DU5 A;  2ZSH B;  2COM A;  2VKE A;  4FTH A;  3GZN B;  4MTD A;  3ZN1 A;  2CJJ A;  2L3D A;  2LF7 A;  5E3O A;  1GDT A;  4KIB A;  1A35 A;  1FYK A;  3KLN A;  2JQ7 A;  3CUQ C;  3S32 A;  1NK2 P;  2VB6 A;  3M1C A;  5F04 A;  2PX9 A;  1X1D A;  4EM1 A;  4Q4Z F;  3TP0 A;  1R5H A;  2W48 A;  1KU3 A;  2DTZ A;  4E4H A;  2Q8K A;  4B47 A;  2LP0 A;  5E3N A;  4PSX A;  5EGO B;  3FBN B;  2ACJ A;  1WSU A;  4RAY A;  1E3H A;  2PMU A;  5E79 C;  4G7H F;  4IO9 F;  1HW1 A;  5TRD A;  5DM6 F;  4RB3 C;  2VUM J;  1ACI A;  2KT0 A;  2VBW A;  4AC0 A;  2H94 A;  2DDB A;  1FIA A;  4JYK A;  3GO5 A;  4LG0 A;  4EMS A;  1KU9 A;  4BEH B;  3SFI A;  1ERD A;  4BJ5 C;  1MKM A;  2K9N A;  1AU7 A;  3GBG A;  1HW2 A;  3O8G A;  3EET A;  3TP3 A;  2FX0 A;  2CQQ A;  3REO A;  5D5X B;  1FP2 A;  1JHF A;  1AHD P;  3LNQ A;  1O7L A;  1S72 I;  3LFU A;  3K10 A;  1IN7 A;  3TMO A;  2ISY A;  3WGI A;  4JX4 A;  2D5V A;  1TT5 B;  4C30 A;  1BC7 C;  1Z21 A;  4FIS A;  2R7D A;  3JRE A;  1YS6 A;  2HVR A;  4Q5S F;  4IEJ A;  2G7H A;  1WH5 A;  1WCM J;  1ZRD A;  1WH7 A;  3VSL A;  3BQY A;  4G6D A;  4BHC A;  4BL0 B;  1FX7 A;  2XPU A;  1O3Q A;  4QPQ A;  3V7C A;  1YIJ I;  2KMU A;  5HLI A;  3VYR B;  2ELK A;  4EM0 B;  3JSP A;  2L9V A;  3DV8 A;  4JQF A;  1V5F A;  4E70 A;  4EAT A;  4ZH4 F;  1RES A;  2G7U A;  3QQA A;  4XQF A;  1H8A C;  1X1C A;  2K4B A;  4U87 A;  1G6N A;  1FJL A;  2VJ4 A;  3HRT A;  1VQ5 I;  4B09 A;  3OS0 A;  3KP6 A;  5CVR A;  1LPQ A;  3HRS A;  3IRR A;  5LGU A;  1X1B A;  3DPT A;  4G8X A;  1ETO A;  5L3C A;  2W7N A;  5DCF A;  3JRA A;  4OIQ F;  3D5L A;  1FBU A;  1UG0 A;  3QU6 A;  5C4J J;  1KA8 A;  2EZH A;  4CXF A;  3H92 A;  5D6E A;  3G4S I;  4ZTF A;  5IT9 Z;  1PUF A;  1I39 A;  1Z91 A;  4PCQ A;  3IRQ A;  2CV0 A;  4RGU A;  4UVA A;  3CF5 F;  4XKC A;  2ZSI B;  2KLO A;  2L4A A;  3WG9 A;  3HBL A;  1FNN A;  3A03 A;  4I02 A;  4A2U A;  4ZDO A;  2YS9 A;  1DGR M;  2HOA A;  3OYK A;  5E1X A;  4KIF A;  1MMS A;  2DA7 A;  2LNB A;  2KDO A;  1LE8 A;  3BG3 A;  2FF4 A;  2H1L A;  1BR2 A;  2HPM A;  1BOB A;  1ZQ3 P;  2O61 A;  2HPI A;  4EJW A;  2PN6 A;  4BQO A;  5GAE J;  1ZK8 A;  1B72 A;  4BHB A;  4Y17 A;  2H8W A;  2F4I A;  2X6O A;  2GWR A;  4ESF A;  1P7J A;  4ZYE A;  1YJN I;  1EJ9 A;  3KP5 A;  1TQM A;  1HBX G;  1BA5 A;  2K4J A;  4F3Q A;  2H6B A;  3PJR A;  3DP7 A;  5L3G A;  2ADU A;  5EEH A;  2QQB A;  1O4X A;  2Y31 A;  1GUU A;  4XRF A;  4L0Y B;  2K9S A;  3OYD A;  4MQ9 F;  1D0Z A;  2V6E A;  3S1Q J;  1KQ8 A;  3HHG A;  3DCF A;  1BW6 A;  2YSR A;  1O3R A;  3F8N A;  3F23 A;  4LLG F;  1FYM A;  5DCM B;  2K5C A;  4EM2 A;  3S3N A;  2ZXI A;  3JTG A;  3DTE A;  4BXX J;  1DP7 P;  3I4M J;  3JAM Z;  1ZKG A;  4B8X A;  2WV1 A;  2VL8 A;  3CJT B;  4NC8 A;  5JFR A;  3BG9 A;  2F5V A;  3CC4 I;  2HGC A;  4KJZ A;  4IRI A;  1P4X A;  2CQX A;  3AL0 B;  2DPD A;  2GOM A;  2Y48 A;  1Z6T A;  1GHC A;  3Q0V A;  1ENH A;  3FIS A;  2W57 A;  3SYT A;  1EH8 A;  1OQY A;  1IV6 A;  2WAF A;  2R7S A;  2Y0M A;  4OWR B;  1FT9 A;  1XGO A;  1D1B A;  2EIL H;  3Q0W A;  3FXL A;  2YR2 A;  4BUP A;  2PFB A;  4LJZ F;  4DBQ A;  2E34 A;  2EV6 A;  3CCQ I;  1FOX A;  1ODD A;  5GP9 A;  3PSF A;  5FRN A;  4G9Y A;  1RR7 A;  1Z77 A;  4ENM A;  2XRL A;  3WGG A;  4XN3 A;  5LGT A;  4EVI A;  1OCT C;  5FKM A;  3OIQ A;  4M71 A;  3ZN0 A;  4AVP A;  4E7L A;  3KP2 A;  2KIU A;  3GYH X;  3HGY A;  2O3F A;  2WAE A;  3H5R A;  4FE4 A;  3CCJ I;  2GM4 A;  4DYC A;  2QBY A;  2QEN A;  3R0J A;  3R4K A;  4HX7 A;  5FLM J;  5FO5 A;  4ZZL A;  1KYW A;  5BNG A;  4B43 A;  2XF6 A;  3K4J A;  1FTZ A;  1WJC A;  3BZC A;  2AQF A;  4AID A;  4Q48 A;  2STW A;  3CP8 A;  5E3L A;  4DYQ A;  2CG4 A;  2VJJ A;  5K7H A;  2JZY A;  3OL4 A;  2MH9 A;  3BPX A;  3ZR8 X;  2OC6 A;  4OIR F;  2X6Y A;  5M3M J;  2VQL A;  1QPM A;  3SDG A;  3KIO A;  1TWC J;  4GYG A;  1GV2 A;  4M3B A;  3CDH A;  1V55 H;  3IKV A;  3K4N A;  1WJE A;  3A1Y A;  5B1A H;  4CH7 A;  4ZTJ A;  2P5V A;  2FML A;  2JTV A;  5J1Y A;  3HRM A;  1A5J A;  1J5Y A;  4BY7 J;  3O6B B;  1RIO H;  2GLO A;  3LQQ A;  2K3P A;  5EGO A;  4A3E J;  5ILS A;  2R7Q A;  3JRC A;  4YRV A;  1FP1 D;  2JA6 J;  1OIS A;  1X1A A;  2FNA A;  3W6K B;  2P5L C;  5B3S H;  1I50 J;  5M5Y J;  4ZDL A;  4BEH A;  2I8D A;  2HQA A;  1BR4 A;  2HQN A;  3F3X A;  3L2W A;  2E1N A;  4CHU A;  2R0Q C;  2WAQ N;  4XMY A;  1OYI A;  1SFU A;  4HX8 A;  1WGX A;  3R61 A;  5HS9 A;  3E97 A;  1APL C;  1XPX A;  2LR8 A;  5L3E A;  4U88 A;  3DKY A;  3PUF A;  2BOL A;  5E8I A;  3ERE D;  5DYM A;  3K2A A;  4L5I A;  1IJW C;  1Z7L A;  4JX6 A;  1QPI A;  3ABL H;  1GV5 A;  4YIF A;  1DGW Y;  2JMW A;  3LST A;  2ZO4 A;  2XUB A;  3ZQF A;  4FET A;  4AM3 A;  4XIC A;  3S2D J;  1MZB A;  1ZAO A;  4MEY F;  3S2H J;  2IA2 A;  1P9Q C;  1FOK A;  3H36 A;  3J81 Z;  3R60 A;  1O7F A;  4IXA A;  4Y4R A;  4S05 A;  3L7W A;  3RCO A;  3ZMS A;  2ZBK A;  5J4Y A;  3FM3 A;  2VE8 A;  1HKS A;  1FSE A;  1FOW A;  3CCE I;  1VQP I;  3WTW C;  1DUX C;  3E1S A;  3GLX A;  1N78 A;  2L5Q A;  1JKP C;  1NK3 P;  4NHJ A;  2VIX A;  4IQJ A;  1LVA A;  1MBG A;  5F0H A;  2IA0 A;  1K79 A;  2KQR A;  3HM5 A;  5GPA A;  2VOP A;  3BOQ A;  4QPO A;  5LFA A;  5EG0 B;  3GFM A;  5FFX A;  1W5C C;  2JRT A;  3JR9 A;  5J3L A;  2IJL A;  3I55 I;  1ZRC A;  2DI3 A;  2JA2 A;  4XLC A;  4U0V A;  3JSO A;  3OYG A;  4NDL A;  2X85 A;  3QPT A;  1BM9 A;  1R4M B;  1MND A;  2ESN A;  2A69 F;  2GBY A;  3G3Z A;  3TKY A;  3MKY B;  3VOE A;  1NG7 A;  4PK4 A;  5D5W B;  3ZQH A;  3H1C A;  2EFW A;  4XBF A;  2YUS A;  2XAQ A;  3ONQ A;  2EJR A;  1W5T A;  1ETV A;  3BCB A;  3FF5 A;  4CCJ A;  1MDM B;  3LSG A;  2KRH A;  2ELH A;  3BTL A;  1MH4 A;  1SAN A;  1YIT I;  5DUI A;  4A5N A;  5KK1 A;  1U5T B;  3QOD A;  3Q9V A;  1R23 A;  2CWE A;  2XB5 A;  5L3D A;  2K02 A;  4OMY A;  2M7A A;  3BR2 A;  3V42 A;  4LLN A;  3ZQG A;  2P0W A;  1JGS A;  4XLH A;  1Y56 A;  1I27 A;  3G71 I;  3ZQI A;  3CCL I;  3K69 A;  3K1M A;  4A3L J;  3OS2 A;  1EV7 A;  4FHT A;  4XOP A;  2FBK A;  5AIQ A;  3BWG A;  5D8K B;  3TGN A;  5BPD A;  4J01 A;  4DJA A;  1ZHF A;  2DMP A;  5EJC A;  1XX5 A;  2QQ8 A;  3K70 D;  4RA2 A;  5CKT A;  4CA0 A;  4LGW A;  1BBY A;  4YIR X;  3HTS B;  5DCM A;  1MNE A;  4LG0 B;  1ZEL A;  2M3A A;  3FX3 A;  3IC7 A;  4FE7 A;  4I98 B;  2QCO A;  2O6G E;  2VQC A;  2IS6 A;  1GVJ A;  2YPR A;  1TWF J;  2LMD A;  1T08 B;  1FBS A;  3CO6 C;  2FBH A;  2NVX J;  1UB9 A;  3E5Q A;  4JBA A;  1B6A A;  3LOC A;  1SEU A;  3FMQ A;  2CQN A;  3IH4 A;  3SHF A;  2HOE A;  4N9I A;  2RQQ A;  1D1A A;  3EPZ A;  4IJA A;  1LEB A;  3M07 A;  2QSG X;  2JJ7 A;  3OIP A;  4TV7 A;  1E3O C;  2L9S A;  3OYA A;  3HOT A;  2NVY J;  2XV4 S;  3MZH A;  1ZYR F;  3WTV C;  5H6R A;  1S3J A;  4PFP A;  4B3X A;  1J59 A;  1BIA A;  4F55 A;  2BHY A;  1TW3 A;  1XTA A;  2CRG A;  2FJ1 A;  1U8B A;  3CMY A;  4KYW A;  1LDK B;  4XRS G;  5HNF A;  2E5N A;  1MMA A;  2MYS A;  2PMH A;  2R7T A;  2ETH A;  2KRC A;  5F1J A;  2ID6 A;  1HKQ A;  3CP2 A;  5TJJ A;  2UV1 A;  1XMX A;  2VE9 A;  1RKT A;  2O5R A;  1X58 A;  1IZ1 A;  1V4R A;  1FYL A;  4M9X A;  2M4G A;  3J80 Z;  3AG2 H;  5ILV A;  5A2Q K;  1ZGJ A;  3A0B C;  4ZJZ A;  3BJ6 A;  1VQL I;  4A93 J;  3V8L A;  1TWA J;  2BYV E;  2DJI A;  3PL8 A;  1HA8 A;  4WX9 A;  4LIU A;  3ZMT A;  2NYX A;  2EFP A;  5FKN A;  5J1R A;  1CGP A;  1AWC A;  2AO9 A;  2HKO A;  2R5Z B;  1PP7 U;  2H27 A;  2QQA A;  4S04 A;  1I6X A;  2R7W A;  2Y0S N;  2V9P A;  4N4O B;  3OR2 C;  5HDN A;  2XVC A;  2LLK A;  2LDU A;  3TW6 A;  1S5L C;  4HNV A;  2WWY A;  1VTN C;  3KCC A;  1BW5 A;  2E2H J;  3I4P A;  4KT6 A;  2K86 A;  5H6Q A;  1VQ9 I;  3PIO F;  4ENJ A;  4UUT A;  3QYF A;  3KET A;  1T38 A;  1OYY A;  5KHD A;  1B9N A;  2LTP A;  1IO2 A;  5IYC J;  3M3Y J;  1BI1 A;  1G3Y A;  2L2O A;  1OCC H;  1JT6 A;  2B9S A;  4RM3 A;  1YJ9 I;  4KMU X;  3CMA I;  1YO5 C;  1ZLK A;  4Y7N J;  2B7E A;  1Y39 A;  3MFK A;  3JRF A;  3D1N I;  4BAC A;  3C2G A;  1T39 A;  1R00 A;  1R36 A;  3ZMV A;  2GXA A;  1U9O A;  3AL0 C;  2W82 A;  4F7Z A;  3ZQQ A;  3IWF A;  3CCS I;  2P7V B;  1JJ6 C;  2FD5 A;  3CUO A;  3HZJ A;  3BLY A;  2HXI A;  1KGS A;  3L2R A;  2CYY A;  1N75 A;  2FRH A;  1W4M A;  4UNO A;  1D0X A;  3KE2 A;  4ZYH A;  3S3M A;  4I99 C;  4HV5 A;  2FQ3 A;  4FCY A;  3VYT B;  2XAG A;  4AYB N;  4UV9 A;  1ON1 A;  2DDA A;  2X48 A;  3GTQ J;  4A0X A;  1Y8Q B;  3QWL A;  5EDN A;  4E7H A;  3GLL A;  1D0Y A;  4PUS A;  1PDN C;  3A2K A;  3RTR A;  3V7R A;  4O6J A;  1JKO C;  2IP2 A;  3M8F A;  2GA1 A;  2QQ9 A;  1QVT A;  1HF0 A;  1MMN A;  2VT3 A;  3WE3 A;  4ESJ A;  1YFH A;  1W7P D;  3RKY A;  5L3F A;  2L9N A;  4XLE A;  3A0H C;  4HX4 A;  1BJA A;  3OS1 A;  4L0Z B;  3L1P A;  4A12 A;  4A0Y A;  2HEO A;  4ZC3 A;  1XMA A;  3T5X A;  2M9H A;  4KIT B;  3BTI A;  3N4M A;  1KU2 A;  1J0R A;  1K61 A;  2EK5 A;  2XAF A;  3CZ6 A;  1TWH J;  2LOO A;  1RZ4 A;  2Z3Y A;  2JSC A;  4CZC A;  2XPW A;  4XL9 A;  1A31 A;  5EG0 A;  1IDZ A;  3B6C A;  2O8X A;  3CJR B;  4OU0 A;  4CUG A;  3I59 B;  1ZG5 A;  1VQ8 I;  4LK0 F;  3VOD A;  5DD4 A;  2NAZ A;  1Y0U A;  5E1W A;  4LIV A;  2DMN A;  2Z33 A;  4KIS A;  5TGT A;  3BZ6 A;  5E3M A;  2OTL I;  2UXN A;  4W97 A;  1MJB A;  1X19 A;  2HTS A;  3S1N J;  2HQ5 A;  2OQG A;  1MDM A;  2PMZ N;  4XLF A;  3W6V A;  1JJ8 C;  5HDG A;  1SD6 A;  1U5T A;  3OY9 A;  1BIB A;  3I58 A;  1FLI A;  1LFU P;  2E60 A;  3G6E I;  3T0Y A;  4L5E A;  1VZ0 A;  2KIS A;  1SAX A;  2JWT A;  1FEX A;  1NH3 A;  3OOP A;  4IOA F;  3C2H A;  1VQM I;  2BY2 A;  1KU7 A;  4A3B J;  1NG6 A;  4C2M J;  3OR1 C;  2HS5 A;  3IHU A;  4Q47 A;  2NOG A;  2R3S A;  3MZY A;  3I9V 2;  5KNL A;  3RDI A;  5IOY A;  3OYI A;  2JVG A;  1R49 A;  2YU9 J;  2JA8 J;  2KRF A;  4M6X A;  3BR1 A;  3M7G A;  4IHX A;  1XSX A;  3W2V A;  3DU6 A;  4L9V A;  4L5J A;  3V7S A;  1UZC A;  5ICE A;  3CES A;  2EIN H;  2HOT A;  2K9L A;  5IP7 J;  4E6K G;  1BI3 A;  5GAD J;  5CLS A;  2RNJ A;  5DTD A;  3EUA A;  2VBZ A;  2YX7 A;  4FX0 A;  3G1L A;  1W1W E;  2CUE A;  4BAY A;  3C1D A;  1NTC A;  1BJZ A;  1HW5 A;  3LA2 A;  4MQV A;  4NNJ A;  4YEJ A;  5J8C A;  1ORK A;  3JW4 A;  3PM1 A;  3RSN A;  5CVU A;  3ASO H;  3PIP F;  2XAJ A;  4UUS B;  2ISZ A;  2F48 A;  2FOK A;  5FFZ A;  3K1N A;  3UNG C;  3NEU A;  3U9G A;  3VDX A;  2DK5 A;  1YOV B;  5GAG J;  1OYW A;  2IGK A;  3GME A;  2LG4 A;  3A02 A;  3HKZ A;  2JN6 A;  2M30 A;  1S29 A;  4WF2 A;  1WJA A;  1R5G A;  2FMY A;  2M45 A;  3ZMU A;  4DZJ A;  3WHB A;  2WB1 A;  1YHQ I;  4NC6 A;  3A4C A;  3E5U A;  1A6I A;  1SMT A;  2CW0 F;  2HYG D;  2W1O A;  1ULY A;  2V7F A;  3ECH A;  5FJ8 J;  3N97 A;  4HOB A;  3W6J B;  1XMK A;  1K4T A;  4I01 A;  3C18 A;  4HDV A;  3HOY J;  1U5T C;  2WY7 Q;  3BC8 A;  2OCC H;  1IRZ A;  2LY9 A;  2P6S A;  1WHU A;  1MBF A;  2A6T A;  3GCM A;  1HKT A;  3ZCO A;  2M34 A;  2X1E A;  4U7B A;  2D1H A;  4UXN A;  2L7F P;  4ABZ A;  1J9I A;  3ABT A;  4RAF A;  4KIG A;  1MH3 A;  1K7A A;  2R5Z A;  1S7O A;  4BKX A;  1QZZ A;  3DEE A;  3HOW J;  4F93 B;  2DT6 A;  4MLO A;  3RPU A;  2R7V A;  4RMN A;  3QPH A;  5JLW A;  2LK2 A;  2RVC A;  3EQL F;  3H3V K;  2ZNZ A;  2IGM A;  2KFD A;  4KUM A;  3EYI A;  1EF4 A;  3I0T A;  4XLA A;  5L3B A;  2CFO A;  3HXL A;  2HZT A;  4UUV A;  2QKL B;  3WHC A;  4OOI A;  2O8K A;  2MD0 A;  3HC7 A;  2VBY A;  1QQI A;  3QYB A;  5FLX K;  1TQI A;  4ENK A;  2DFH A;  4BGD A;  1XDS A;  2XGD A;  1JT0 A;  2VKD A;  3CCV I;  3BG6 A;  2F4O B;  3ROU A;  1Q1H A;  1JKQ C;  1Z6R A;  2F6C A;  4RGR A;  1T33 A;  2ME6 A;  5CVV A;  1RRJ A;  1J7K A;  2X51 A;  4XKV A;  1I1S A;  1XC5 A;  1JUM A;  3TDU C;  2BY1 A; 
#chains in the Genus database with same CATH homology
 1ZR4 A;  3K2A A;  3QPL A;  1IJW C;  4JX6 A;  2L0K A;  3CQZ J;  1QPI A;  1GV5 A;  2JMW A;  1HLV A;  1Q1V A;  5M5X J;  2XSD C;  3ZQF A;  3ZQL A;  4XIC A;  3S2D J;  5C44 J;  3S2H J;  3I4N J;  1UG2 A;  3RZO J;  1H88 C;  2TCT A;  2MW8 A;  2ECC A;  3GTK J;  4XID A;  1AKH B;  2E2I J;  3IH3 A;  4M3G A;  1WPK A;  5EZH A;  1DU6 A;  2M8G X;  3LSJ A;  4J19 A;  4JP0 A;  1PUF B;  3NAU A;  1MBH A;  2VPR A;  1POG A;  3QPS A;  4IHY A;  3BQZ A;  5EZG A;  1JKP C;  1NK3 P;  1SFO J;  4A3F J;  5F08 A;  1MBG A;  5F0H A;  4G12 A;  3HM5 A;  5GPA A;  3Q3S A;  5EG0 B;  2R7Z J;  3JR9 A;  2O7O A;  5J3L A;  1B8I A;  1IGN A;  2B63 J;  4NDL A;  3HB9 A;  3BR0 A;  2GBY A;  2RAE A;  5DS9 A;  4A3D J;  3F0C A;  1LE8 B;  1S7E A;  1HCR A;  1P7I A;  2MG4 A;  3GTJ J;  3ZQH A;  2VKV A;  4A3I J;  1B72 B;  2YUS A;  4A3J J;  3BT9 A;  1MBJ A;  1ETV A;  3LSG A;  2NVT J;  3BTL A;  2L7Z A;  1MH4 A;  1SAN A;  3H0G J;  4X1E A;  2XGC A;  3E7L A;  1QVU A;  3HKZ N;  3RKQ A;  2E1O A;  2ECB A;  2XB5 A;  3C2B A;  2LD5 A;  2R5Y A;  3BR2 A;  1MBE A;  3CCY A;  4D5C A;  3A01 A;  3ZQG A;  1XS9 A;  1R9T J;  2WB1 N;  3FIW A;  9ANT A;  1U9N A;  4IHW A;  1F43 A;  3ZQI A;  4DZP A;  3G1O A;  2P81 A;  5K7Z A;  4A3L J;  2LFB A;  5IYB J;  2EQR A;  2K40 A;  2N8G A;  5EF6 A;  1UHS A;  4A3M J;  1JUS A;  2Y30 A;  3MVP A;  2DMQ A;  1VND A;  3K7A J;  2DMP A;  3LSP A;  1MSF C;  2FQ4 A;  1JTY A;  1IDY A;  2ID3 A;  4FE7 A;  3MN2 A;  2QCO A;  3HOV J;  3JRH A;  1TWF J;  3OSF A;  3GTP J;  4S0H B;  2NVX J;  2OPT A;  3OOU A;  5M5W J;  1HOM A;  2HXO A;  3LOC A;  1TC3 C;  4C3J J;  3IH4 A;  5F0F A;  3CDL A;  2DJN A;  3RQI A;  4JX5 A;  4RBO A;  2COB A;  2JJ7 A;  2VI6 A;  1DU0 A;  1E3O C;  2NVY J;  4I76 A;  3S1M J;  2AHQ A;  2MSY A;  3IH2 A;  1ETW A;  2HOS A;  4GFB A;  2HDD A;  2FJ1 A;  2CRG A;  4RDU A;  2DN0 A;  1U8B A;  3CMY A;  2JA7 J;  4XRS G;  3ZOB A;  3PO2 J;  2JA5 J;  4LOC A;  4V2F A;  5F1J A;  4CYC B;  1CQT A;  2ID6 A;  4UUS A;  1UMQ A;  1YRN A;  4XK4 A;  2DMU A;  3GTM J;  2KDZ A;  2LKX A;  3IV5 A;  2NVQ J;  1RKT A;  2E2J J;  4B3A A;  2DA2 A;  1X58 A;  3MKL A;  4V2G A;  4C3I J;  2ZB9 A;  5GPC A;  4A93 J;  4C3H J;  1TWA J;  2EZK A;  4QSH A;  1XG1 A;  3BTJ A;  3BG5 A;  3NAR A;  5FKN A;  5J1R A;  2VKE A;  4FTH A;  5E3O A;  2CJJ A;  2AO9 A;  1GDT A;  2X9D A;  2R5Z B;  1QRY A;  1U78 A;  1ITY A;  1NK2 P;  2Y0S N;  2Y9Z A;  5F04 A;  1BL0 A;  2LLK A;  1K83 J;  3TP0 A;  2W48 A;  2DTZ A;  1G2H A;  5FKL A;  3TW6 A;  4HNV A;  2LP0 A;  5E3N A;  5EGO B;  2E2H J;  1BW5 A;  1LFB A;  1F36 A;  2VUM J;  2KT0 A;  3BR5 A;  4UUT A;  1H89 C;  3B6A A;  4AC0 A;  3BR6 A;  1FTT A;  1FIA A;  1GVD A;  2LTP A;  4JYK A;  4M6V A;  5IYC J;  3M3Y J;  5FKO A;  3SFI A;  1VFC A;  1JT6 A;  5IP6 A;  1AU7 A;  2K9N A;  4Y7N J;  3GBG A;  4XRS A;  4A3K J;  3O8G A;  2I10 A;  2HYJ A;  2FX0 A;  1Z0X A;  2CQQ A;  3TP3 A;  3JRF A;  1MBK A;  3D1N I;  1AHD P;  3LNQ A;  1ZR2 A;  1U9O A;  1ZTR A;  3GTO J;  5JLX A;  4JX4 A;  3O8H A;  2D5V A;  1JJ6 C;  2FD5 A;  3DEW A;  5IP9 J;  2HXI A;  1IG7 A;  4FIS A;  2DMT A;  3JRE A;  2G0E A;  4IEJ A;  1WH5 A;  1WCM J;  2XGE A;  1WH7 A;  2HI3 A;  3JRG A;  4FCY A;  3BQY A;  4AYB N;  2XPU A;  1ETX A;  3HOZ J;  2X48 A;  3GTQ J;  2ELK A;  1WI3 A;  5EDN A;  2K9Q A;  1ETY A;  4IHV A;  1HDP A;  5EEA A;  1RES A;  4D7M A;  3QQA A;  2DA4 A;  1H8A C;  2H1K A;  1FJL A;  1VF9 A;  1JKO C;  4B4C A;  1X2M A;  1QVT A;  1TWG J;  3UKG A;  1HF0 A;  1JTX A;  2M0C A;  2DA3 A;  4AUX A;  2CUF A;  1ETO A;  2EZI A;  4A3G J;  4BBR J;  5IPA A;  3JRA A;  1OJL A;  5IOZ A;  3L1P A;  1AKH A;  5C4J J;  1ETQ A;  2EZH A;  2L9R A;  4X6A J;  3OIO A;  1B8I B;  2M9H A;  1PUF A;  3BTI A;  1K61 A;  2LVS A;  2IEK A;  1TWH J;  4XRM A;  2IBD A;  3HOX J;  2XPW A;  4W1U A;  4DW6 A;  2EH3 A;  4MFE A;  5EG0 A;  1IDZ A;  2CU7 A;  3B6C A;  3HBL A;  3A03 A;  2YS9 A;  2HOA A;  4BY1 J;  2DA7 A;  5C4X J;  2DMN A;  1LE8 A;  1RPW A;  3BG3 A;  3VPR A;  2NS7 A;  5F0C A;  5E3M A;  1ZQ3 P;  2R5Y B;  2EZL A;  4W97 A;  1B72 A;  1ZK8 A;  3A01 B;  3S1N J;  2HQ5 A;  5K7F A;  1JKR C;  2X6O A;  1P7J A;  2PMZ N;  2H8R A;  3W6V A;  1X2N A;  4DYR A;  1JJ8 C;  2O9L A;  1BA5 A;  3SJM A;  3ZQC A;  5FLV A;  4I6Z A;  2TRT A;  1T56 A;  2XB0 X;  3JRB A;  3S15 J;  1LFU P;  1O4X A;  2Y31 A;  1GUU A;  3S1Q J;  2K9S A;  4L5E A;  1OFC X;  2JWT A;  3DCF A;  1BW6 A;  1FEX A;  4EEF G;  1I6H J;  4M3F A;  4A3B J;  4MIM A;  2Y2Z A;  1IUF A;  4BXX J;  4C2M J;  2NS8 A;  2QF7 A;  5EYR A;  3I4M J;  1ZKG A;  4QTR A;  2WV1 A;  1MSE C;  4BBS J;  2NOG A;  3BG9 A;  4M3D A;  3LSR A;  5IOY A;  2DA1 A;  1ETK A;  2CQX A;  1ZGW A;  2YU9 J;  2JA8 J;  3BR1 A;  4IHX A;  3Q0V A;  5IYD J;  1ENH A;  3FIS A;  2HOT A;  3HDD A;  5IP7 J;  5M3F J;  3S16 J;  4A69 C;  1IV6 A;  5DTD A;  2IAI A;  3G1M A;  3Q0W A;  3JRD A;  1D5Y A;  3TW7 A;  3G1L A;  2CUE A;  1NTC A;  1BJZ A;  5GP9 A;  1ORK A;  3HGG A;  1JUP A;  3PM1 A;  4Y52 J;  1OCP A;  4D5F A;  4MO7 A;  4UUS B;  1YRN B;  1RR7 A;  1Z77 A;  1W0U A;  2EBI A;  3TED A;  2XRL A;  1OCT C;  1JGG A;  3HEF A;  5FKM A;  2MGQ A;  3A02 A;  5HOD A;  1W0T A;  3HGY A;  2JN6 A;  3S14 J;  4FE4 A;  2GM4 A;  4CYC A;  3RZD J;  4DYC A;  4DZJ A;  1RKW A;  5FLM J;  3GTG J;  3WHB A;  3GTL J;  1I3Q J;  1RET A;  2R92 J;  3HOU J;  1A6I A;  5C3E J;  5F27 A;  3M4O J;  5BNG A;  5FJ8 J;  5J1U A;  1FTZ A;  2E19 A;  2M2E A;  4DYQ A;  3HOY J;  5K7H A;  1GT0 C;  4M3E A;  1IRZ A;  2LY9 A;  3PO3 J;  1MBF A;  2M34 A;  2DA5 A;  5M3M J;  2L7F P;  4ABZ A;  3FK7 A;  2DA6 A;  3SDG A;  1TWC J;  1GV2 A;  1MH3 A;  1Y1W J;  4M3B A;  3S1R J;  2R5Z A;  2ME0 A;  4BKX A;  3HOW J;  3FK6 A;  4MLO A;  1IC8 A;  3S17 J;  5JLW A;  2LK2 A;  1HDD C;  5J1Y A;  4A3C J;  3H3V K;  5FKK A;  1A5J A;  4QIW N;  4BY7 J;  2L7M P;  2GLO A;  1EF4 A;  1Y1V J;  5EGO A;  4A3E J;  4MFD A;  3JRC A;  1FIP A;  2JA6 J;  3WHC A;  2O8K A;  2XPV A;  5M5Y J;  1I50 J;  3BTC A;  4B1R A;  2JK3 A;  1VI0 A;  3FKI J;  2R0Q C;  2WAQ N;  2XGD A;  3JRI A;  1JT0 A;  2OF7 A;  3OSG A;  1JKQ C;  1MNM C;  1WGX A;  2R93 J;  1T33 A;  2ME6 A;  1APL C;  2LR8 A;  4D7N A;  3Q0U A;  3BR3 A;  1XC5 A;  1JUM A;  5E3L A;  2Y9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...