3HDDA

Engrailed homeodomain dna complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
55
structure length
55
Chain Sequence
RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*TP*AP*CP*CP*
publication title Engrailed homeodomain-DNA complex at 2.2 A resolution: a detailed view of the interface and comparison with other engrailed structures.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 19
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3hddA00
1RKWA 1MSEC 4IHVA 2CU7A 4LOCA 2LTPA 2JA6J 2MG4A 4Y7NJ 2HOTA 3D1NI 4MIMA 3GBGA 5JLXA 1IRZA 3HOYJ 2DA4A 2I10A 3ZOBA 5M5YJ 2GM4A 1UHSA 1JKRC 4BY1J 2K9NA 4C3HJ 5IOYA 2G0EA 3LSGA 2COBA 1JT0A 3G1OA 1GV5A 2LKXA 4XICA 1BW5A 2ECCA 1QPIA 1X58A 2M9HA 5FKOA 3I4NJ 5J3LA 1S7EA 1IG7A 3M4OJ 1MBJA 1LFUP 1JUMA 1JUSA 3HOVJ 5M5XJ 1D5YA 2KT0A 4B4CA 1UMQA 2H1KA 5FKLA 3H3VK 2O7OA 2DA1A 1JT6A 2NVTJ 1QVUA 1ZTRA 2R0QC 3TP0A 4A3GJ 4AC0A 4QSHA 1QVTA 3BTJA 5E3OA 2YU9J 4DYCA 3B6AA 2TRTA 5EZGA 1IDZA 2NVQJ 3SFIA 3H0GJ 1GUUA 4JP0A 3HEFA 1RR7A 1Z77A 4FISA 2O9LA 2EZLA 2XPVA 3K2AA 2DA6A 1R9TJ 4A3LJ 1AKHB 1JTYA 1K61A 3C2BA 1FIAA 5EEAA 5M5WJ 1YRNA 1FTTA 2FX0A 2HXOA 1H88C 5JLWA 5F0FA 2LK2A 2XGEA 2EBIA 2FD5A 1FIPA 1OJLA 2LR8A 5IOZA 2HXIA 1ZQ3P 1CQTA 5IYCJ 4XRSA 2W48A 2ME6A 3HGYA 3MN2A 3FK7A 1BL0A 1OCTC 4D5FA 2XGCA 4I76A 2VKEA 3HOZJ 2HDDA 5DTDA 1ZR4A 2DMUA 3A02A 1O4XA 5DS9A 5IP7J 5EDNA 1JKPC 4A3FJ 2CJJA 3DCFA 1PUFB 5K7ZA 1RKTA 2XSDC 4A3IJ 1ETYA 2LD5A 2EH3A 2E2HJ 3RQIA 5J1RA 5J1UA 3GTKJ 1G2HA 1HDDC 2LLKA 2WB1N 4QTRA 4IEJA 1TWCJ 3BR1A 2NVYJ 1JKQC 4DZJA 3NAUA 5FKNA 3BR2A 4RBOA 3Q0WA 3HDDA 1WI3A 2JJ7A 3M3YJ 1ETQA 1NK3P 3RKQA 4A3DJ 4GFBA 3FKIJ 2M2EA 3S15J 2M34A 3WHBA 3GTPJ 1ZK8A 2ECBA 2K9QA 1AU7A 1BA5A 1EF4A 3S14J 3IH2A 2Y30A 1VFCA 4A69C 3S17J 2IEKA 2KDZA 2VI6A 2DMPA 2R7ZJ 3BR5A 3OOUA 3S2DJ 4MO7A 2N8GA 2LFBA 1ITYA 2FJ1A 2R5YA 1TC3C 2YS9A 4DW6A 1U9NA 3K7AJ 5FLMJ 2L7ZA 2CQQA 4UUSA 4XK4A 2NOGA 2DMTA 1JJ8C 1I6HJ 1ETKA 3CQZJ 1VNDA 3BTIA 1MH4A 1QRYA 1OFCX 4EEFG 1LE8A 5IYDJ 1BW6A 2DN0A 1SFOJ 4M3FA 4DYRA 1MBGA 2ME0A 2M8GX 3A01B 4A3EJ 1IJWC 3FK6A 3BR0A 5BNGA 1TWGJ 1FJLA 1A5JA 1HOMA 3DEWA 2X9DA 1MBFA 3FIWA 3TP3A 4CYCA 1DU0A 1MBEA 2Y0SN 3FISA 1I50J 2DMQA 2VPRA 4MFDA 5F08A 2XRLA 2HYJA 4L5EA 1U8BA 1WH5A 3Q0UA 3VPRA 5IYBJ 5F0HA 2FQ4A 2XB5A 2VKVA 1B8IB 2R92J 2E1OA 1Y1VJ 3HKZN 2HOSA 5C4JJ 3QPLA 4BBRJ 3HOXJ 2DA3A 1APLC 1ORKA 1YRNB 2DA5A 2DMNA 2WAQN 5IPAA 2MGQA 3BTCA 1IUFA 2DA2A 2GBYA 3SJMA 3Q3SA 2YUSA 2RAEA 3MVPA 5EYRA 2L7MP 2OPTA 5IP9J 2ELKA 1GT0C 1X2NA 3JRGA 2JA8J 2IAIA 2QCOA 3IV5A 1MBKA 1WH7A 1IV6A 1TWFJ 3Q0VA 3GTOJ 1JTXA 4JX4A 1BJZA 4A93J 4AYBN 3S1RJ 3BG3A 3O8GA 2DA7A 4NDLA 3JRIA 4HNVA 3SDGA 1FEXA 3JRCA 1ETXA 2XGDA 2JWTA 4XIDA 4IHXA 3JR9A 1E3OC 5EG0A 4FCYA 1MSFC 4X1EA 3G1LA 2R93J 1ETWA 1JJ6C 4I6ZA 3S2HJ 1POGA 2X6OA 4JYKA 3GTMJ 4FE7A 1B72B 2MSYA 2XPUA 2R5ZA 4B3AA 5EF6A 2CQXA 3W6VA 5M3MJ 3S16J 4W1UA 2H8RA 3OSGA 4C2MJ 4D7NA 1I3QJ 1GDTA 1U9OA 5EGOA 3LNQA 3HOUJ 1X2MA 4S0HB 1F43A 1HCRA 1Q1VA 2L0KA 3JRFA 4D5CA 2CUFA 2XPWA 3GTLJ 4V2FA 4A3KJ 2VUMJ 1SANA 3S1MJ 3QPSA 3G1MA 4QIWN 3JRDA 3LOCA 4MLOA 2EQRA 3WHCA 2HQ5A 4C3JJ 1DU6A 3CCYA 3BR3A 3JRAA 4BY7J 1F36A 4M3DA 2R5YB 3BG5A 3GTQJ 4D7MA 4UUSB 4A3JJ 1ZR2A 3HB9A 2ZB9A 2EZKA 1ENHA 2LY9A 3L1PA 2CRGA 1Z0XA 2LP0A 3S1NJ 1VI0A 2L7FP 1LE8B 3HGGA 2DJNA 2B63J 4AUXA 3LSPA 4BKXA 3LSJA 5FKMA 1W0UA 1A6IA 2Y9YA 1HDPA 5C44J 4JX5A 2JA7J 3OIOA 2Y9ZA 4M6VA 5C4XJ 4CYCB 3JREA 2Y2ZA 2AO9A 4A3MJ 3S1QJ 2NS8A 3ZQGA 4BBSJ 2OF7A 4DYQA 1T56A 3O8HA 5M3FJ 3UKGA 3BTLA 1TWAJ 4M3EA 4M3GA 5F27A 3TW6A 5GP9A 1MH3A 4XRMA 3LSRA 3MKLA 1H8AC 1XC5A 1JKOC 5F1JA 4A3CJ 2E2JJ 2O8KA 3BT9A 4BXXJ 3TEDA 3BQZA 2E19A 4DZPA 3A03A 2NVXJ 3A01A 3B6CA 4B1RA 2P81A 4FE4A 3ZQLA 3GTGJ 3RZDJ 1ETVA 2D5VA 5K7FA 2JK3A 1VF9A 1IC8A 3TW7A 3HOWJ 2XB0X 2EZIA 1NTCA 4IHYA 5GPCA 2TCTA 3I4MJ 1WCMJ 2HI3A 3HBLA 5HODA 1NK2P 4IHWA 3NARA 5E3MA 1K83J 4J19A 3BG9A 5EZHA 3ZQHA 5FJ8J 3IH3A 3CMYA 1XG1A 3ZQFA 1B8IA 2GLOA 2K40A 4XRSG 1IGNA 4M3BA 4V2GA 5E3LA 4A3BJ 1JGGA 2WV1A 1AHDP 2ID6A 1XS9A 3E7LA 3IH4A 2HOAA 5EG0B 4FTHA 1AKHA 4Y52J 5IP6A 2DTZA 1U78A 3F0CA 4C3IJ 3BQYA 9ANTA 1WPKA 1FTZA 2K9SA 3JRBA 5FLVA 2MW8A 2L9RA 4MFEA 2R5ZB 1P7JA 3ZQCA 3HM5A 2JA5J 1RETA 4W97A 1T33A 1P7IA 1GVDA 5EGOB 5K7HA 1JUPA 1HLVA 1OCPA 2X48A 2AHQA 5C3EJ 1HF0A 5E3NA 1RESA 1RPWA 4G12A 1UG2A 2JN6A 1IDYA 1ETOA 5FKKA 3ZQIA 1PUFA 1LFBA 5GPAA 2E2IJ 1ZKGA 2PMZN 1W0TA 4RDUA 2QF7A 4X6AJ 2Y31A 1TWHJ 5F04A 2ID3A 2LVSA 4JX6A 2EZHA 1Y1WJ 3JRHA 3RZOJ 1B72A 2JMWA 3BR6A 2NS7A 5F0CA 3GTJJ 1WGXA 2M0CA 3PO3J 5J1YA 3CDLA 3PO2J 2CUEA 3QQAA 1MBHA 4UUTA 1GV2A 3OSFA 4ABZA 1H89C 2IBDA 1ZGWA 3PM1A 1MNMC
chains in the Genus database with same CATH superfamily
4IHVA 4EMSA 2RQPA 5E17F 4CZZA 3OR2C 2MG4A 5GTHC 3D1NI 4RS8A 1FOXA 3A1YA 2L9SA 3ABKH 3EUKL 3LA7A 1I5ZA 2MLKA 5J40A 1HXDA 2DU9A 3S8PA 2GM4A 3WU2C 3E0JB 4BY1J 4XLAA 2V9KA 1A6QA 1OR7A 1FMVA 1IW7F 4AYBA 4WCGA 2L01A 5H6RA 4YIIA 3JSOA 2YX4A 4GGGA 3F23A 3LSGA 2PMUA 4CCMA 2L4MA 3G1OA 1BM9A 2LKXA 2RKHA 2OZ6A 2ECCA 1QGPA 1QPIA 3KP3A 1UG0A 3GZNB 3J7AO 2J5OA 2NOJB 1W4MA 4G94A 5CQEA 1G8XA 3KP2A 4KN4X 2LKSA 3ZN0A 5K5OA 2F6CA 2X6XA 3EUHA 4ITVA 3CUOA 3K4JA 1LFUP 3M4OJ 3OWTA 5FFXA 1QPMA 1EH7A 4E7KA 5FKLA 2NVTJ 3DBLB 2JUCA 4A3GJ 1QNTA 4A2UA 1F9NA 4QSHA 2HQRA 1Y0NA 1TZLA 2W82A 1QVTA 2BOLA 3BTJA 3JAMZ 3A0HC 4F91B 2YU9J 4DYCA 3B6AA 2A3SA 2TRTA 4ZYHA 1IDZA 2NVQJ 3L9FA 3SFIA 1GUUA 2JPCA 2IGOA 2O9LA 1MDMA 4IKFA 2XPVA 3K2AA 3HTSB 1R5GA 1XSVA 2ISYA 4CH7A 3SYTA 3MKYB 4BQNA 5DCFA 1S29A 2IA2A 1YRNA 3FBIB 1FTTA 2DO7A 4ZC3A 3ZMSA 1LB2A 1HKSA 3TDUC 3ABMH 1SVMA 5F0FA 4UVAA 5J6XA 5KAFC 3I55I 2EBIA 5JVTA 4GCVA 4B3XA 1UZCA 3ECHA 2WA0A 1FOWA 4XRSA 3E5UA 1STZA 3RQ4A 3MN2A 3FK7A 3FWEA 5D4RA 2GA2A 2OTLI 4NBQA 2DT6A 3FMRA 3ASOH 1H0MA 5H6QA 3CCJI 2HDDA 1D1CA 3AG1H 2QBYB 2MC4A 5EDNA 5HNHA 4A3FJ 2HQAA 1YW8A 5K7ZA 2E7WA 1RKTA 3CF5F 1CF7B 2XSDC 4A3IJ 2UXXA 4G9YA 3V7CA 2DTRA 2X4HA 1Y6IA 4TV7A 5J1UA 2IS6A 4F55A 1SVOA 4EJTA 1HDDC 3T8TA 2WB1N 4QTRA 3DU5A 1BIAA 3HC7A 1U5TA 4IEJA 3F8CA 3F8FA 5ED4A 3NAUA 3ZQ7A 3H3ZA 4RBOA 2A61A 5HDKA 1N25A 2VXDA 3HKZA 1NK3P 2KPMA 1W5SA 2WC2A 2HTSA 3OYKA 2F5DA 4LMYA 2M2EA 3GTPJ 2BXZA 2VQLA 3FKJA 2WAQA 1D5VA 1X1AA 1ZK8A 1TTYA 1QA6A 3JTHA 3K69A 1AU7A 2E5ZA 3IH2A 2Y30A 3LSTA 1VFCA 1ZRCA 1O3RA 3S17J 1ZARA 2KDZA 3SHFA 2DMPA 2XV4S 3OYBA 2X1DA 2K9MA 3PFYA 4XSZF 1QHHD 3OOUA 3V7SA 3RPUA 5KK1A 2FJ1A 4P5OA 3CP8A 2HFHA 3C3WA 1I27A 2CV0A 2NOGA 3CC4I 1I6HJ 1ETKA 3BTIA 1HW1A 4U88A 3D5RC 3ULQB 5IYDJ 3TO7A 1MD0A 4G7ZF 4DBQA 3CP2A 2ME0A 3IWFA 1LKXA 3OS0A 5CVJA 3A01B 3C2GA 1IJWC 4I01A 2QSGX 4NB5A 3PIPF 3DLLF 1E3PA 1UCRA 4ZTFA 3ZMDA 4ENMA 2XF5A 3I54A 5DD8A 4HQMA 2X9DA 2DOAA 4I02A 1IRGA 1LQ1A 2R7TA 4M9ZA 4LG3A 2ISZA 3CLOA 2M87A 1OYIA 3C2HA 4CYCA 2KP6A 3CLQA 2QEXI 1DDNA 1MMDA 2ESNA 5F08A 5F1RA 3WTXC 5IT9Z 5JHUA 2IS1A 1R49A 1WH5A 1UB9A 2IPQX 3E5XA 1USSA 2R3SA 2FQ4A 3N97A 2VKVA 5TISC 1MMGA 2QQBA 3HOXJ 3FM3A 1APLC 4FX0A 3ESWB 4YIRX 3KEOA 3VFZA 2HZTA 3A0BC 3GCMA 5B1BH 2MGQA 4Y33A 1UHMA 2CQ7A 5KHDA 5DD4A 3SJMA 4G6DA 1Z91A 5HDNA 4P9UA 3MVPA 3ZXSA 2R7UA 1BN5A 2R7DA 5LBQA 1L3LA 2HVSA 4EM2A 2JA8J 3IV5A 2VOOA 3GO5A 2HQNA 2ACJA 1MZBA 2ZFUA 2XHKA 1JTXA 3LFUA 4BXUA 2EJRA 2GZWA 3BG3A 1F4KA 1QBJA 2Z33A 1ETXA 4EVIA 4PUSA 4V19K 3ZMTA 4U0VA 4ZYDA 1E3OC 4XKBA 4PFOA 4X1EA 4NC8A 5LGTA 2Y69H 3S2HJ 4BJ6C 2Q1ZB 4PSXA 2ZXHA 1IXSB 4RM3A 2R5ZA 4RAYA 4MQVA 4CUGA 3S16J 3VYUB 1XPXA 3OSGA 4D7NA 3IKTA 1MJBA 2VN2A 5EGOA 3F72A 4P96A 4IHSA 1F1ZA 1SVLA 4HEA2 4C30A 3KYCB 1GLNA 1HCRA 1C0WA 2L0KA 3JRFA 1B9NA 2HVRA 1CGPA 2XPWA 3ML6A 5AONA 3GTLJ 1G6NA 4A3KJ 1SANA 2VJJA 4YIFA 3DTEA 3TO6A 2VLAA 1R22A 3LOCA 4MLOA 4RMNA 2K9LA 3RYPA 3RSNA 4L18B 2IGKA 5K5QA 1EJ9A 4L0YB 3BG6A 3BR3A 2F4OB 3CCYA 1DU6A 2BV6A 4LFUA 3DLAA 3BG5A 2L2OA 1D8KA 3IAS2 1WRJA 2A07F 4FQGA 3E97A 3GTQJ 4HQEA 2RN7A 2DK5A 3KEYA 3HB9A 1K79A 1S7OA 2LY9A 5E79C 5D5XB 2DW4A 2K02A 4WXCA 1Z0XA 2LP0A 5D6FA 1YQAA 3OYAA 2B63J 3LSPA 3GF2A 4WX9A 2BYVE 3PUFA 3I56I 4AVZA 3WTSC 3LSJA 2DK8A 1I1GA 5FKMA 3M7GA 1W0UA 1XGMA 1A6IA 2Y9YA 5HVQC 5C44J 1R1TA 3M9AA 1BI3A 3GVAA 4ZYAA 2JA7J 5GAEJ 5C4XJ 1S3JA 3WTVC 3OYDA 2Y2ZA 4DGWB 4OWRB 1HC8A 4RB0A 4AVPA 4BBSJ 4LLLA 2I8DA 1JHFA 2H27A 4BAYA 3KE2A 3O8HA 3KYLA 3BZCA 2BBYA 4XLHA 4E7LA 4Q5SF 5JVGF 2MC3A 1YITI 4M3GA 3F6VA 4NC6A 3BROA 5HLHA 3ZCOA 5B66C 1ON1A 1Z7UA 3COAC 3LMMA 2FMYA 5F1JA 3HYIA 4UB6C 3WTUC 3QYFA 1YI2I 1HBXG 2XUBA 2ZXJA 1T2KA 3QU3A 3A03A 2IS4A 3B6CA 1M1EB 2P81A 3E6DA 3NRVA 4FE4A 3DPTA 1LFPA 1D3YA 3RZDJ 1ETVA 3GTGJ 1XDSA 4O6JA 4DQ2A 2DYSH 4RM2A 2EINH 2EIKH 3SZGA 3HRUA 4RAZA 2OJED 3FMQA 1A31A 1HA8A 3HBLA 2ZMEC 2X85A 1W36D 5D8KB 2OCEA 5HODA 1O3SA 3QP6A 3OS2A 2E1CA 2R7FA 1SD6A 1TLHB 3F9KA 4J19A 3IH3A 4NC7A 1UAAA 4II3A 1XG1A 2QQAA 3CMYA 5L3CA 2E34A 3RTRA 2LYCA 4CCKA 4E7HA 2K40A 3CO6C 3LA2A 3TQNA 2VBXA 4V2GA 3V8LA 2JQ7A 1RC9A 1JGGA 1AHDP 5LGNA 2OZUA 1XS9A 3E7LA 4FTHA 3OL4A 2ZXWH 4Y52J 2RNJA 1T8IA 3F0CA 3H9QA 4C3IJ 3BQYA 3HG9A 2F5CA 4NQWA 1FTZA 1WPKA 5J8FA 3K0LA 4HLXA 3H5AA 3JRBA 5GADJ 2CGPA 4MFEA 5LRRA 5ICFA 3R0AA 4DJAA 3K10A 3D0SA 3K70C 3K2ZA 3E3VA 2K3FA 1P7IA 2MD0A 5K7HA 3OR1C 3ONQA 1RIOH 3M8FA 1E3HA 2EK5A 2XASA 3IWZA 3J80Z 2A6HF 2COMA 2XAFA 3BY6A 2JN6A 3H3UA 1ETOA 1VQ5I 1WJDA 4LGWA 3L00A 3J7ZI 3L2WA 1LFBA 3K4NA 5GPAA 1YJWI 3FHZA 1PUFA 1QU3A 3CESA 4IRHA 1VQOI 3U1DA 2Y31A 4UUVA 2ID3A 2CW7A 4JX6A 2CH0A 1LDKB 1Y1WJ 4EGYA 1X4OA 2ZNZA 3ABLH 2JUGA 3VYRB 4KN7X 4BE1A 5F6FA 4M9XA 2JMWA 3BR6A 2WV0A 3GTJJ 1WGXA 2OUMA 1PP8F 3R4KA 2XSJC 2DAOA 1YJNI 1VQ6I 3FXRA 4HX4A 2CUEA 3QQAA 1V54H 4ABZA 2GXGA 4GYGA 3T0YA 3IHUA 3WTTC 2A6EF 4ZYGA 4FT8A 2ZSHB 3HXLA 1MNMC 1A35A 1ZREA 3I59B 1X1BA 2CU7A 4LOCA 1QZEA 4OINF 2CMPA 1DUXC 4OOIA 2KRFA 5JLXA 4G7OF 3GMEA 4XRFA 2DA4A 3MWMA 1X1CA 3SZTA 3CCSI 2FA5A 2VJIA 3P9CA 4G7HF 3ZN1A 4IQJA 3SEQA 3KP6A 4YFNF 2K9NA 3ZRGA 4ENKA 1V3FA 5IOYA 2G0EA 2XAUA 2COBA 1S72I 3CC2I 1JT0A 3CJRB 4LITA 1X58A 2M9HA 1SD4A 4KT5C 1SFKA 1ZGJA 1S7EA 2A68F 1IG7A 1VQPI 4GXOA 4CICA 2GOMA 5M5XJ 3LSHA 3BZKA 4AU7A 2HNHA 1JXSA 1ZTRA 4BHBA 3A4CA 3E1SA 4HG2A 2MABA 3Q9VA 4BEHA 1J59A 2EWNA 4I2OA 4ZDLA 5E3OA 2H8WA 5EZGA 3CCMI 1ZLKA 4I09A 2Q2EB 1Z77A 4FISA 2X1EA 1T0FA 2EA4A 1K4TA 1A04A 3DU6A 4A3LJ 1AKHB 1JTYA 1FIAA 3W6JB 5M5WJ 3RIRA 5ERIA 5E1XA 5D8LB 4L0ZB 5JR3A 3K4KA 5ILVA 1H88C 4HV6A 1U3EM 2LK2A 4ESBA 5ICEA 4BJ5C 2BVLA 1FIPA 5IOZA 3TOBA 2HXIA 1CQTA 5IYCJ 2W48A 3LQQA 3PQJA 2K4BA 2PX9A 2IRFG 5H20A 3DKXA 1BL0A 1OCTC 2R7WA 4RGUA 5FLXK 3CUQC 3AG3H 3W2WA 2ZFWA 3F6OA 4I76A 3PJRA 2LOOA 4A0YA 5DTDA 1FWZA 4KITB 1K78A 1O4XA 4II2A 2VJ5A 4LB6B 4EV0A 5K5RA 2BGCA 3I3LA 3AFHA 3BP8A 4FETA 2CJJA 2LMDA 1FYKA 2QA4I 2KIMA 5ILSA 4IOAF 5A2QK 2AXTC 3RQIA 3SEZA 4YFXF 2Y0SA 5E8IA 1TP4A 4XN3A 3CJNA 2XC7A 1FBSA 3K4LA 4JQFA 3PNYA 3PIOF 1Z05A 1TT5B 1W1WE 4D1QA 4XL9A 2UZKA 3Q0WA 1I1SA 3M3YJ 1ETQA 2L5QA 2MA3A 2K85A 3FKIJ 4D0PA 1X3WB 4RGSA 3SQNA 3WHBA 1LDDA 3VWBA 2G7HA 1IRFA 1J5YA 2ETHA 4HA8A 2ECBA 2K9QA 2PQ8A 1BA5A 4S04A 3S14J 3GFMA 1IRXA 4A69C 4L9TA 1PVEA 2IEKA 1BR2A 3SFZA 3CUQB 1YHQI 2R7ZJ 3LSMA 4O3MA 4OU0A 3OYCA 2LY2A 2OBPA 3WTYC 3S2DJ 5HOOA 1X3UA 3BCBA 4F92B 1VQLI 2QENA 2DDBA 3RYRA 1TC3C 3K7AJ 5KAIC 2DOFA 2L7ZA 2VL8A 3C1DA 4XK4A 2DODA 4L5JA 1HKTA 4R1HA 2B7EA 4KFCA 3Q5FA 1XGSA 3LFKA 3M1CA 3I0TA 1MH4A 1XSXA 1QRYA 4PJMA 1OFCX 1LE8A 4BACA 1YIJI 4KIBA 2LF8A 3HSRA 1MBGA 4WXHA 4A3EJ 2KZVA 3V7RA 1K7AA 3OL3A 4DIQA 1B59A 3GZ5A 1VQ4I 3MZYA 1TWGJ 5DM6F 1FJLA 1HOMA 2F4IA 3IUOA 3FXQA 5KVRA 5HS7A 3FIWA 2FBHA 2L3DA 3TP3A 4CGZA 4QPQA 2MFZA 1MBEA 1HQCA 3FISA 1I50J 4CHUA 2P4WA 2W85A 1SAUA 4L5EA 2OC6A 3CDHA 3U9GA 1XCBA 3OIQA 1NG7A 3Q0UA 2D45A 4D9JA 3QOEA 3V4GA 4BU2A 1YS6A 1MDMB 2QGUA 2HWVA 2O5RA 1B8IB 2E1OA 2DYRH 2Z1DA 4XM3A 1Y1VJ 3HKZN 1RRJA 3QPLA 3T1BA 2DA3A 1YRNB 4QWQA 4ANJA 4BQQA 4EQQA 2WAQN 2X51A 2YR2A 3V42A 5IPAA 1QQIA 2KHMA 5AIPA 2EFQA 4XQFA 2W4SA 2YUSA 4DOZA 1QZYA 2L7MP 1MJAA 4EATA 2ELKA 3F8MA 5E18F 3ZP5A 4ASNA 1MJ9A 2DOEA 2IAIA 3FDYA 3I71A 4MGRA 4UB8C 1G3SA 1WH7A 2DBBA 2M3AA 3IL2A 3HSEA 1TWFJ 3KP7A 3CTAA 3Q0VA 4I0AA 2Z9OA 3BCAA 4JX4A 1BJZA 1IN6A 2JRTA 4A0XA 3DKWA 3W2VA 2EB7A 3S1RJ 3ZPLA 3JRIA 4EJVA 5BMZA 2Z2SB 2XGDA 4PJJA 3JR9A 4HNUA 5EG0A 3QRFF 4FCYA 2ZJRF 1HKQA 3GLXA 4ESFA 3OYFA 2H6BA 2CYYA 5CQGA 1QO0D 2CSOA 2EFOA 4I6ZA 1U5TB 3HUGA 3CC7I 2PG4A 1EH8A 1POGA 2X6OA 4JYKA 1B72B 2MSYA 3DEUA 4B3AA 2D1HA 2CQXA 2KJCA 3J81Z 3W6VA 5M3MJ 5K1YA 4W1UA 2H8RA 2LG4A 4C2MJ 1YLFA 4J00A 1GDTA 1D0YA 4M71A 2VIXA 3FXLA 3M8EA 2VE9A 3PSFA 5JI6A 3HOUJ 3QPTA 2IP2A 1X2MA 4UHTA 1F43A 1D8JA 2M8EA 1Q1VA 3K4CA 3V8JA 1FMWA 4MEXF 4HAMA 4J01A 1CF7A 2VUMJ 3O6BB 5LHHA 4IRGA 4IVNA 2EQRA 2K3PA 4A12A 1WFXA 2ELHA 5E1ZB 3L2VA 2VT3A 1EH6A 3HPGA 3BJOA 5AIQA 4BY7J 4CSWA 1F36A 3HJEA 4L9NA 2V6EA 1LUJB 4ZJZA 5EEGA 1J0RA 1XMKA 3S2WA 1ZAOA 1R7JA 3IAM2 4E7JA 2LF7A 1VQKI 3C18A 2EZKA 2KMUA 3L1PA 4Y13A 2FRHA 3EPZA 2EV5A 4G8XA 2R7SA 1JI8A 3F21A 5CPRB 3HGGA 4LG0A 4AUXA 2IGNA 2LY1A 1VQ9I 1QHGA 3BPXA 4P1WA 4N9HA 3W6KB 2HPMA 1P2FA 3LQRA 1D0XA 1MW7A 3LAJA 2Q8KA 3JSPA 2PI0A 4JX5A 4GDFA 3OIOA 2Y9ZA 2VQCA 2F5EA 4CYCB 3P7NA 3S1QJ 1YYVA 2HKXA 3KP5A 2XKOA 3G6EI 3QAHA 2PJRA 3TMOA 2IGMA 1NH3A 1TWAJ 3LSKA 1WZ2A 4OIOF 2K5CA 3HHHA 5F27A 4XRMA 3LSRA 2QUFA 4ZYEA 4AWXB 3WE2A 2IW5A 4KIFA 1JKOC 1YW7A 2E2JJ 2O8KA 3BT9A 2ZJ2A 3TEDA 4XSXF 5DDGA 3BQZA 3OYEA 1KQ9A 3HRMA 4JBAA 4DZPA 3DBHB 3A01A 4B1RA 2UV1A 1BC8C 4Y3OA 3ZQLA 2ZNYA 5J47A 2LBFA 2WAFA 2JK3A 3ZMUA 2GAUA 1LDJA 2AXLA 2XB0X 4F3QA 1NTCA 2EFNA 4XLFA 4IHYA 2DT5A 3BWGA 3KP4A 2FMLA 3I4MJ 2Z16A 3VYTB 4BH9A 3JCUC 3AAFA 1BOBA 1OCCH 1LNWA 3I9V2 1NK2P 3FF5A 3VB2A 3ZGKA 5E3MA 1K83J 3OMYA 4CA0A 4CO8A 3OYGA 3UR3C 3GZ6A 2R7XA 5EZHA 4ON0A 2MH2A 5FJ8J 1AA7A 2JPBA 3OYLA 2NNYA 2DPUA 4PJ0C 3D5LA 1D0ZA 4XRSG 4M3BA 5E3LA 1PP7U 2ID6A 4PSWA 3IH4A 5DCMA 2HOAA 5IP6A 2RVCA 3TBIA 2W84A 1V4RA 1BR1A 2VQHA 3VEPA 3QU6A 2K9SA 1FSHA 1B9MA 4XBFA 2L9RA 2R5ZB 2E36A 4B09A 2VXZA 3IKVA 5LEJA 5LFAA 3MCZA 2H1LA 3GWZA 4U7BA 2GXAA 2FQ3A 3WGGA 1GVDA 2BY0A 5EGOB 1X1DA 4AIHA 1JUPA 2X48A 2AHQA 2ZBKA 1HF0A 2CUZA 2QQ9A 3O3KA 3CMAI 1IF1A 3W2AA 2PMZN 1W0TA 1VTNC 2QF7A 4X6AJ 1TWHJ 1R1UA 2NRAC 2A05A 3N05A 3REOA 3K4BA 5BOXA 1WJBA 3DKYA 1P92A 1FC3A 3FXKA 4P55A 3RKYA 1RNLA 3RKXA 1N78A 2P0WA 3MZHA 4ZTJA 3S3MA 1YOVB 2QYOA 3D5SC 3AL0B 1MBHA 2QSHX 4UUTA 1TQIA 4HOBA 2EFWA 4HX7A 3OSFA 2PEXA 2GWRA 3DEEA 1H89C 3FZVA 1ZGWA 4HW0A 1Q1HA 1XDUA 1OKRA 2R7VA 2CFXA 1RKWA 3IRRA 2R7QA 1MSEC 1OISA 2K7LA 3ZMZA 2LTPA 1ONVA 2DT7B 2JA6J 2KIQA 4Y7NJ 2STWA 4KIGA 1ZYRF 1SD7A 2V1DA 1U2WA 3QOPA 3H9GA 2I10A 3HOYJ 2XKPA 3CCVI 4XOTA 3SDBA 5M5YJ 1UHSA 4RGXA 3DF8A 3M07A 3ISPA 2V1XA 3PUBA 4BL0B 1RUOA 4N0BA 3SZPA 1IV8A 1DPRA 3G71I 1HW5A 3ABUA 3LA3A 2E71A 1FPQA 2OA4A 2H6CA 2IA1A 2M4KA 4BNCA 3I4NJ 5J3LA 1KU9A 2WBMA 1X4PA 4UVBA 1SMYF 1XCVA 5BS6A 2PFBA 1FOYA 1MBJA 5FO5A 1TL8A 1BOAA 1JUSA 2XAQA 4KDPA 1D5YA 2HGCA 1UMQA 2O7OA 2WTEA 2QKLB 4KJZA 2R0QC 2V1UA 2DFFA 1B4AA 2A5WA 2HOEA 3VDXA 1NHAA 3ZR8X 5HS8A 2X1CA 3FBNB 3FMSA 4UV9A 1KU3A 1YE9A 3HRTA 1JGSA 3PNVA 1DPUA 2L02A 3RKWA 3CZ6A 4I7HA 5LEKA 4M6XA 3WTWC 3R61A 3H0GJ 1LEAA 4JP0A 1ERDA 3HEFA 1RR7A 2CO5A 1PDNC 4UY8I 4QPOA 2EZLA 1JHHA 1RR8C 4GYIA 2ICWG 4Q47A 3MEXA 3FHNA 2NNNA 3RI4A 3KYDB 1K61A 2M1BA 3ERMA 3C2BA 3TGNA 2NAZA 4NQWB 4LB5A 2FF4A 5DUKA 3OYMA 2AQFA 2FX0A 2FNPA 4KT6A 5JLWA 5L3DA 2HKOA 4QLCU 2XGEA 2WY8Q 2VPLA 3MKZA 5B3SH 1H9TA 2LR8A 1S9HA 3OV8A 4I99C 4KUMA 1ODDA 1Y39A 5ILUA 3JAMK 2V6CA 1N75A 4LD5A 3TO9A 2ME6A 4B8XA 3HGYA 3U21A 2E35A 3E6BA 2XAHA 4L5IA 1FYMA 2O6GE 4C2UA 1ZR4A 2MLGA 2PMHA 4ZDOA 2DMUA 3A02A 1PUEE 1YS7A 1VQ8I 3FM5A 3OS1A 2P8TA 4XNFA 2OAZA 5IP7J 4EM1A 1KYZA 1S6LA 1R1VA 1PUFB 1ZELA 1GXQA 1EV7A 2IA0A 5L3EA 1X3ZB 2VBWA 2LD5A 2EH3A 5J1RA 3WGHA 4RB3C 1W36C 4LLNA 4HLYA 1G2HA 1E2XA 2H09A 5J4VA 4KNYA 1OLTA 3BR1A 2NVYJ 2Q0OA 1JKQC 4DZJA 4PZJA 3KZYA 3H92A 3S3NA 2L4AA 4RB2C 1WI3A 3F8BA 3Q9SA 2JJ7A 4PGGA 3RKQA 3IP4B 1Z7LA 4CCOA 2M34A 3ROUA 3J7AY 1Z3XA 2BHZA 1EF4A 2R4GA 3C7JA 2CQKA 2DJIA 2ZMEA 1P9QC 2KQRA 3KX2A 3VODA 1I3AA 1UFMA 2MBFA 1F5TA 5CVUA 3B73A 2HYGD 2FXAA 3DP7A 2VI6A 3GXOA 4X0GA 3CCQI 4BUPA 3DFGA 2NXNB 4M73A 4N4NB 1W7PA 4MO7A 1XMXA 2N8GA 1ITYA 2R5YA 1T08B 2YS9A 4DW6A 1U9NA 5FLMJ 2CQQA 4XKWA 3K6GA 4UUSA 2DMTA 1JJ8C 3HZJA 2CW8A 1VNDA 2HU9A 1ZRFA 3P9KA 4PK4A 4EEFG 1YFHA 3G73A 2DN0A 1SFOJ 2VOPA 3I59A 3NWTA 4M9SA 2K27A 4PCQA 4DYRA 4XONA 5L3GA 1ULYA 2VB6A 2DQRA 2W25A 1U0JA 3BR0A 5TGTA 5BNGA 1A5JA 4I0BA 3DEWA 3KFWX 2KIUA 4KICA 4BEHB 1MBFA 1XTAA 3VOEA 2V9VA 1KQ0A 1DU0A 2Y0SN 4UXNA 3T8RA 2DMQA 2VPRA 2GA1A 2NS0A 2FOKA 2XRLA 5B1AH 4HV5A 3WG9A 1IZ1A 2EIJH 4RGRA 5IYBJ 3VPRA 1MNDA 2EV6A 4BDZA 5F0HA 1Y8RB 4HF1A 1XGNA 4N9IA 2G9WA 4NNJA 2HOSA 1WI9A 3CJQB 4BBRJ 5C4JJ 5DM7F 5L3BA 2HPIA 1K6OA 2B0LA 4K2EA 5D6EA 2EA2A 4IQ4A 3HL2A 2PJPA 1BJAA 3I64A 3BTCA 2VQGA 2GBYA 4WWCA 1FSEA 4LIVA 4HBLA 1U8RA 1U6GA 3Q3SA 3TDZC 1FLIA 3IC7A 3EQLF 5EYRA 4KMUX 4IO9F 5IT9K 1X2NA 4P9FA 3ECOA 4Z2YA 1MBKA 4OIQF 4E7ZA 2FSWA 2Q2EA 2BW3B 1K78B 1G3YA 3F8NA 3GYHX 1IO2A 5D5UB 4A93J 4AYBN 2EV0A 3O8GA 2DA7A 4NDLA 1OR7C 4HNVA 3CCLI 4IHXA 5FFZA 4CXFA 3V8KA 4ZDPA 3L2QA 3VSKA 1AWCA 4OIPF 4AM3A 4M72A 3QPHA 3LAPA 1MSFC 1P4AA 3G1LA 1K4SA 4IPAA 4A0ZA 1ETWA 1R36A 2DDAA 5GAHJ 1JJ6C 4BXFA 2EPFA 3F3XA 1VZ0A 1T6SA 2HDCA 1ON2A 1A36A 1LEBA 3EUHC 5EF6A 2YSRA 1O7FA 1Y8QB 3M8JA 1TBXA 1T38A 2HYFA 3OYHA 3J7YJ 1ZG1A 1MIJA 3S93A 4B44A 1XMAA 2V9PA 5HS9A 3AKZA 5IT3A 4D5CA 4F7ZA 3HSFA 2O61A 2LC2A 4V2FA 3S1MJ 3PNTA 4HZFA 3QPSA 4HX8A 4QIWN 3MAJA 3JRDA 3L2RA 4Q48A 4XKCA 3GUDA 1W5CC 5DUIA 4IL6C 3JRAA 3DPUA 1FNNA 3HOTA 2LNBA 4RLFA 2EFPA 2L54A 3G4SI 1S7AA 4D7MA 1ZR2A 2ZB9A 2CRGA 2V79A 2Z99A 2BZTA 1IUYA 2W7NA 4OMZA 1J75A 4MTEA 4XLCA 2Y75A 1VI0A 2L7FP 1LE8B 4RAFA 2MYSA 2MD5A 1T39A 1YX3A 1XX5A 2LRDA 2QM3A 2DCEA 4JK1X 4ESJA 1MMNA 3CUQA 3K1PA 3RPUD 5JFRA 3KZIC 3EYYA 1OPCA 5B5EC 3JREA 4C2TA 3R60A 4A3MJ 4LK0F 2NS8A 5LLQA 1X1PA 2JSPA 4MNUA 2FBIA 1O57A 1T56A 5LRSA 5M3FJ 3EYIA 3BTLA 3HPHA 2BE5F 4ZZDA 5GP9A 5FB2A 2XAGA 1XC5A 2VJ4A 2KISA 4A3CJ 2Z3YA 2K86A 3WGIA 1TQMA 1U5TC 4HYEA 1YW9A 5TRDA 3L09A 1Z3YA 3F22A 2E1MC 2KRCA 2VONA 2E19A 5HNFA 2CWEA 1WJAA 5CJ9A 5CLSA 6PAXA 4BHCA 1WJCA 3BZ6A 4IF4A 5H2FC 5CYVA 2D5VA 2ELJA 2HZDA 2JTVA 4EJUA 1WHUA 2DLLA 1VF9A 3TW7A 1IN8A 1IN5A 1B1BA 3RJPA 1WJ5A 1ZHFA 3QODA 2R7RA 5GPCA 2TCTA 1WCMJ 2P5KA 4CCLA 5BPIA 2HVQA 2JRMA 5E1WA 3NARA 1EKEA 2X6WA 3BG9A 2I5UA 4IXAA 1TNTA 4BDYA 1YX5A 1SMTA 1R00A 4PFPA 1SFXA 1B8IA 2GLOA 4A3BJ 1DP3A 1UHWA 2WV1A 3GEZA 2O3FA 5EG0B 2L9VA 2DTZA 5D4SA 4HPQA 1BIBA 3AG4H 9ANTA 3BJAA 3HUGB 2ESHA 2IJLA 5FLVA 3GFLA 4L9JA 1FP2A 2IVMA 1SAXA 2VKDA 1P7JA 1LVKA 3ZQCA 3HM5A 3I4PA 2V1NA 3FXJA 2JVHA 2E1MB 2L9NA 4MEYF 1T33A 3I58A 4A5MA 4EGZA 4AIJA 1XD7A 2O0YA 4OAZA 4XLNF 3L2CA 3CD6I 5C3EJ 4BHPA 3GLLA 3H9JA 3ZMVA 5IY5H 5E3NA 1RESA 1RPWA 1PYVA 4G12A 5EEHA 4Z6YA 2QBYA 1IDYA 1ACIA 3E5QA 3PSIA 4LLGF 1ZH5A 5FD6A 3DBRB 4DNCA 4F52A 2NYXA 1ZKGA 3CO7C 2ZSIB 3HRSA 3OYNA 4RDUA 1TW2A 1Z6TA 2IT0A 5F04A 2LVSA 2EZHA 3MKWB 1MGTA 3JRHA 3H1CA 1O3QA 2ZJPF 3RZOJ 4GRIA 3TKYA 1B72A 1ZGAA 2LSOA 3BG7A 1HSJA 5F0CA 2ZC2A 2HDWA 4G6TB 2J5PA 2M5WA 4E70A 4XMYA 2X0LA 3PO2J 1SD5A 4PJNA 1ZN2A 1KONA 2RNGA 3MD2A 4PGHA 4LG0B 2OD5A 1WQ2A 3J80K 3U2RA 5DEQA 3HTUA 3PM1A 5CKTA 2KRHA 2B9SA 2CUJA 4U87A 3HIFA 2HOTA 2XVCA 2H94A 4MIMA 2OQRA 3WU0A 3GBGA 1IRZA 3H5NA 1KQ8A 3X2QH 3ZOBA 2KZGA 3QP5A 4HF0A 3PFIA 4AIKA 3QYEA 1JKRC 1WVRA 3TOAA 3DTKA 1FX7A 2PJRB 4C3HJ 4I98B 2WY7Q 1BI1A 1G3TA 1KA8A 4EJWA 1IXCA 1V5GA 2CW0F 2BY1A 2FUG2 1XN7A 1GV5A 2Z5UA 4XICA 4IX7A 1BW5A 5LHIA 1L0OC 5FKOA 5LHGA 2DXIA 4H4KC 1AOYA 1E0EA 1MMAA 4Y15A 3GFIA 4CZCA 1Z9CA 1WSUA 4E4HA 1JUMA 2WB1A 3HOVJ 4HSRA 2BEOA 2KT0A 4B4CA 2H1KA 2LBFB 3H3VK 1FT9A 5KCMA 2DA1A 1JT6A 1YJ9I 1QVUA 2EIMH 3TP0A 4A5NA 4AC0A 1BC7C 1G4DA 1H9GA 1BBYA 1YIOA 1WKMA 5ICCA 4Q4ZF 5FLXZ 2FNAA 2FE3A 2P6TA 2HR3A 4BQAA 4WXDA 1JE8A 1R71A 1BI2A 2CG4A 1WWXA 2BY2A 4DBRA 2XF6A 3DXJF 5JHFA 5DCMB 2DA6A 1R9TJ 1XGOA 5EEAA 3H36A 4HDVA 5FRMA 1V55H 3BC8A 5A2QZ 2GQQA 2HXOA 5LGUA 3G2BA 3TL4X 3AL0C 1LJ9A 1RZ4A 2FD5A 1LPQA 1OJLA 5BQTA 4E7IA 1ZQ3P 1ZG3A 4ENNA 2JZYA 3BPVA 4IZZA 1TT0A 4F93B 4D5FA 4KMFA 2XGCA 1YO5C 1I39A 2VKEA 3HOZJ 2STTA 3DTIA 1B6AA 1I6XA 2LH9A 2P5LC 4O5VA 5DS9A 2ADUA 1JKPC 2P7CB 3FXMA 2A69F 3DCFA 3CCUI 2OTJI 2IXSA 2V7FA 1DP7P 2F48A 5FD5A 3BJ6A 1MNEA 1ETYA 2E2HJ 4Y17A 2R7OA 3KLNA 4N4OB 4ETSA 3GTKJ 1R58A 2D1VA 2BVMA 2VODA 2LLKA 3P5JA 1TWCJ 3WODF 3KETA 1O3TA 3KPHA 3EUAA 5ICGA 2O8XA 3BR2A 5FKNA 2LREA 3HDDA 1QZZA 2OV7A 2CV2A 2ZKZA 2E60A 4A3DJ 1SFEA 4GFBA 3UNGC 3S15J 3PL8A 4CCNA 2CV1A 2M30A 4Y4RA 2YU3A 4IOCF 5HLIA 1V5FA 1P6RA 1SC7A 1P4XA 2F5VA 2XDVA 3KZZA 1IXRC 3DWLE 4IHTA 1FZPB 3P9IA 2FOWA 2GIZA 4XORA 3K1MA 2QWWA 2M0MA 3BR5A 2RREA 3GX4X 4ENJA 3EETA 3KEQA 1D1BA 3BLYA 3S32A 1VQMI 2LFBA 1R4MB 4BYYA 5FRNA 1OCZH 4A6EA 4A6DA 2XROA 1DGRM 2DFHA 4XKVA 3AG2H 2Y0MA 1OCRH 2YX7A 3L7WA 3CQZJ 2QKMB 2CFOA 4LIUA 2A6TA 2XF7A 3ABTA 1Z21A 1BW6A 4WK8F 2PN6A 2VKHA 3CDIA 4M3FA 2M8GX 2RV8A 1NG6A 2V4JC 1W7PD 3FK6A 1FOKA 1S8NA 1SFUA 3MMYB 1YTYA 3E6CC 3N4MA 2VC0A 1KZHA 4C9YA 3ERED 1OCOH 3G3ZA 1SEUA 1R5ID 2LKPA 1R5HA 2HTJA 4MFDA 2VBYA 4XLEA 3W3CA 2HYJA 4IRIA 3M1EA 2KLOA 4YRVA 2WWYA 4CYDA 1ZG5A 1U8BA 2DI3A 3LL7A 3K70D 2ZCWA 2LDUA 1OYYA 2PMZA 4XOPA 2XB5A 3H35A 2L7KA 2R92J 5TJJA 2RGVA 3WE3A 1X19A 1ORKA 2W24A 4BJTA 2DA5A 2CS3A 2UWMA 2DMNA 4FASD 1KGSA 4ZH4F 1K6YA 1IUFA 2D2WA 5CVIA 2DA2A 2A5YB 1FBQA 4OIRF 4U0YA 1V5EA 3WG7H 2RAEA 3CCEI 2GXBA 3K4MA 1BI0A 2XGXA 3RPQA 3KIOA 2OPTA 1WJFA 1UELB 5IP9J 1RI7A 5KNLA 1GT0C 3JRGA 2QCOA 2F5FA 2RDPA 1Y56A 1IV6A 1KU7A 1R4NB 3OYIA 2FU4A 3GTOJ 4LJZF 4KYWA 1LVAA 4M74A 2VC1A 4B43A 4R8HA 1J9IA 2P6SA 2V26A 3JW4A 3NEUA 3SDGA 5F64A 1FEXA 3JRCA 4XIDA 2JWTA 1WJEA 4M6YA 2R93J 4EJOA 3OIPA 4U7DA 4UVCA 3FXOA 2UXNA 4CDGA 1Z67A 5BPDA 3GTMJ 4FE7A 2XPUA 2KJBA 4E7SA 1XSDA 2HEOA 2P5VA 2EILH 1E17A 1TNSA 4LK1F 2WAEA 1FYLA 3NWSA 1W5TA 1I3QJ 1U9OA 2JT1A 5HLGA 4OMYA 4PDKA 2K4JA 3LNQA 1ZLJA 5L3FA 2E1NA 1HSTA 4GO1A 3VSLA 4S0HB 4FX4A 4MQ9F 4RA2A 4EM0B 2ZMEB 4H0EA 1T98A 2CUFA 3CMMA 2AQEA 1OMIA 5J8CA 4AD9A 2JSCA 3RCOA 4BE0A 3G1MA 3I53A 4E6KG 3HOSA 3WHCA 2VT2A 3PQKA 2HQ5A 4C3JJ 1T0FC 1W7PB 1T95A 2M7BA 4M3DA 3ASNH 5FGMA 2NVUB 3L2UA 2R5YB 2AS5F 1D1AA 3J81K 3BDDA 3DV8A 3OOPA 4UUSB 4A3JJ 2X6YA 1ENHA 3A2KA 4JOMA 1FY7A 4MHGA 3GW2A 4YFKF 4NHJA 4HDUA 4KISA 3S1NJ 4YG2F 3WTZA 2IS2A 1REPC 2UUZA 1XB4A 2DJNA 4WF2A 3DQVC 1TQPA 2F2EA 2E7XA 3SXYA 4BKXA 1ZRDA 3RDIA 4OAYA 2QLZA 4UV8A 3FX3A 2GOXB 1RUNA 3E6MA 3OY9A 2QVOA 2PLYA 1HDPA 3HHGA 4M6VA 1R23A 2YPRA 2AO9A 3GFJA 3MZ8A 3DPLC 1TW3A 1YG2A 3ZQGA 4BGDA 4R79A 2OF7A 1IAWA 2G7UA 4DYQA 2KIFA 2KFDA 3UKGA 1VQ7I 2BXYA 3S3OA 4M3EA 3IRQA 2JVGA 2W00A 4HF2A 3TW6A 1OYWA 1MH3A 5CVVA 4PJLA 3MKLA 4B47A 1H8AC 3CJTB 2OCCH 3R6SA 4S05A 4FHTA 4CCJA 3KCCA 5LD2C 4BXXJ 3VYSB 2KKOA 1HW2A 1KYWA 1UJ8A 5GTIC 3QYBA 2NVXJ 3BOQA 4YEJA 2CQNA 1N77A 2XIGA 4ZZLA 1OQYA 4KA4A 5K7FA 2E5NA 1IC8A 4BQOA 1FP1D 1USTA 4L9VA 3HOWJ 2EZIA 1P4WA 5HDGA 2ZJQF 5D5WB 2M7AA 3OYJA 2HI3A 4BS9A 3LSIA 1S5LC 3K9TA 4IHWA 4UNOA 2DQLA 3ZQHA 1Y0UA 1GHCA 1MKMA 3ZQFA 3MFKA 4YELA 2KL4A 3EDPA 1O7LA 3I5UA 4HNTA 3CMEI 1IGNA 2VE8A 4XN0A 1GXPA 1VQNI 1GVJA 2ZO4A 3H5RA 5DV5A 1KU2A 1Z1DA 2PBIA 3QWLA 1AKHA 3LWFA 1U78A 2HS5A 4XLPF 2M45A 2F4MB 4MTDA 1IN7A 2RC4A 5EJCA 4B48A 4NUBA 2ZXIA 4XR6A 4IJAA 5E8GA 2WADA 1DQUA 2MW8A 3K1NA 1PJRA 2O03A 2BHYA 4AIDA 2JA5J 1BR4A 1RETA 4W97A 1R6RA 2GIVA 2W57A 4G6QA 4HRIA 4BE2A 1HLVA 1OCPA 2BW3A 2P7VB 1G59A 2QZ8A 5E20A 2DFIA 2OQGA 2QSFX 1UG2A 2FBKA 3U1KA 1J2XA 3MQ0A 4U0WA 1IN4A 2DFEA 2XAJA 4HSTA 5FKKA 1MMSA 5DYMA 3ZQIA 1DGWY 1G3WA 3CF2A 3R0JA 2W1OA 3B02A 2TDXA 3FXUA 1J09A 1FBUA 4RAGA 3JTGA 3H0DA 2E2IJ 1Z6RA 5GAGJ 2KDOA 3ZQQA 5HLTA 2VASA 2OU2A 3T5XA 1EA3A 2MH9A 3CCRI 1J7KA 3NQOA 3WU1B 2RQQA 2NS7A 2M0CA 3O2PE 2M4GA 2JA2A 3PO3J 2XRNA 5J1YA 2Y48A 3CDLA 5J4YA 2VBZA 4RLQA 1GV2A 5FROA 5D5VB 2QQ8A 5CVRA 2C6YA 4RB1A 2IBDA 2DPDA 2FEZA 3ELKA 3KLOA 2BY3A
chains in the Genus database with same CATH topology
1RKWA 1MSEC 4IHVA 2CU7A 4LOCA 2LTPA 2JA6J 2MG4A 4Y7NJ 2HOTA 3D1NI 4MIMA 3GBGA 5JLXA 1IRZA 3HOYJ 2DA4A 2I10A 3ZOBA 5M5YJ 2GM4A 1UHSA 1JKRC 4BY1J 2K9NA 4C3HJ 5IOYA 2G0EA 3LSGA 2COBA 1JT0A 3G1OA 1GV5A 2LKXA 4XICA 1BW5A 2ECCA 1QPIA 1X58A 2M9HA 5FKOA 3I4NJ 5J3LA 1S7EA 1IG7A 3M4OJ 1MBJA 1LFUP 1JUMA 1JUSA 3HOVJ 5M5XJ 1D5YA 2KT0A 4B4CA 1UMQA 2H1KA 5FKLA 3H3VK 2O7OA 2DA1A 1JT6A 2NVTJ 1QVUA 1ZTRA 2R0QC 3TP0A 4A3GJ 4AC0A 4QSHA 1QVTA 3BTJA 5E3OA 2YU9J 4DYCA 3B6AA 2TRTA 5EZGA 1IDZA 2NVQJ 3SFIA 3H0GJ 1GUUA 4JP0A 3HEFA 1RR7A 1Z77A 4FISA 2O9LA 2EZLA 2XPVA 3K2AA 2DA6A 1R9TJ 4A3LJ 1AKHB 1JTYA 1K61A 3C2BA 1FIAA 5EEAA 5M5WJ 1YRNA 1FTTA 2FX0A 2HXOA 1H88C 5JLWA 5F0FA 2LK2A 2XGEA 2EBIA 2FD5A 1FIPA 1OJLA 2LR8A 5IOZA 2HXIA 1ZQ3P 1CQTA 5IYCJ 4XRSA 2W48A 2ME6A 3HGYA 3MN2A 3FK7A 1BL0A 1OCTC 4D5FA 2XGCA 4I76A 2VKEA 3HOZJ 2HDDA 5DTDA 1ZR4A 2DMUA 3A02A 1O4XA 5DS9A 5IP7J 5EDNA 1JKPC 4A3FJ 2CJJA 3DCFA 1PUFB 5K7ZA 1RKTA 2XSDC 4A3IJ 1ETYA 2LD5A 2EH3A 2E2HJ 3RQIA 5J1RA 5J1UA 3GTKJ 1G2HA 1HDDC 2LLKA 2WB1N 4QTRA 4IEJA 1TWCJ 3BR1A 2NVYJ 1JKQC 4DZJA 3NAUA 5FKNA 3BR2A 4RBOA 3Q0WA 3HDDA 1WI3A 2JJ7A 3M3YJ 1ETQA 1NK3P 3RKQA 4A3DJ 4GFBA 3FKIJ 2M2EA 3S15J 2M34A 3WHBA 3GTPJ 1ZK8A 2ECBA 2K9QA 1AU7A 1BA5A 1EF4A 3S14J 3IH2A 2Y30A 1VFCA 4A69C 3S17J 2IEKA 2KDZA 2VI6A 2DMPA 2R7ZJ 3BR5A 3OOUA 3S2DJ 4MO7A 2N8GA 2LFBA 1ITYA 2FJ1A 2R5YA 1TC3C 2YS9A 4DW6A 1U9NA 3K7AJ 5FLMJ 2L7ZA 2CQQA 4UUSA 4XK4A 2NOGA 2DMTA 1JJ8C 1I6HJ 1ETKA 3CQZJ 1VNDA 3BTIA 1MH4A 1QRYA 1OFCX 4EEFG 1LE8A 5IYDJ 1BW6A 2DN0A 1SFOJ 4M3FA 4DYRA 1MBGA 2ME0A 2M8GX 3A01B 4A3EJ 1IJWC 3FK6A 3BR0A 5BNGA 1TWGJ 1FJLA 1A5JA 1HOMA 3DEWA 2X9DA 1MBFA 3FIWA 3TP3A 4CYCA 1DU0A 1MBEA 2Y0SN 3FISA 1I50J 2DMQA 2VPRA 4MFDA 5F08A 2XRLA 2HYJA 4L5EA 1U8BA 1WH5A 3Q0UA 3VPRA 5IYBJ 5F0HA 2FQ4A 2XB5A 2VKVA 1B8IB 2R92J 2E1OA 1Y1VJ 3HKZN 2HOSA 5C4JJ 3QPLA 4BBRJ 3HOXJ 2DA3A 1APLC 1ORKA 1YRNB 2DA5A 2DMNA 2WAQN 5IPAA 2MGQA 3BTCA 1IUFA 2DA2A 2GBYA 3SJMA 3Q3SA 2YUSA 2RAEA 3MVPA 5EYRA 2L7MP 2OPTA 5IP9J 2ELKA 1GT0C 1X2NA 3JRGA 2JA8J 2IAIA 2QCOA 3IV5A 1MBKA 1WH7A 1IV6A 1TWFJ 3Q0VA 3GTOJ 1JTXA 4JX4A 1BJZA 4A93J 4AYBN 3S1RJ 3BG3A 3O8GA 2DA7A 4NDLA 3JRIA 4HNVA 3SDGA 1FEXA 3JRCA 1ETXA 2XGDA 2JWTA 4XIDA 4IHXA 3JR9A 1E3OC 5EG0A 4FCYA 1MSFC 4X1EA 3G1LA 2R93J 1ETWA 1JJ6C 4I6ZA 3S2HJ 1POGA 2X6OA 4JYKA 3GTMJ 4FE7A 1B72B 2MSYA 2XPUA 2R5ZA 4B3AA 5EF6A 2CQXA 3W6VA 5M3MJ 3S16J 4W1UA 2H8RA 3OSGA 4C2MJ 4D7NA 1I3QJ 1GDTA 1U9OA 5EGOA 3LNQA 3HOUJ 1X2MA 4S0HB 1F43A 1HCRA 1Q1VA 2L0KA 3JRFA 4D5CA 2CUFA 2XPWA 3GTLJ 4V2FA 4A3KJ 2VUMJ 1SANA 3S1MJ 3QPSA 3G1MA 4QIWN 3JRDA 3LOCA 4MLOA 2EQRA 3WHCA 2HQ5A 4C3JJ 1DU6A 3CCYA 3BR3A 3JRAA 4BY7J 1F36A 4M3DA 2R5YB 3BG5A 3GTQJ 4D7MA 4UUSB 4A3JJ 1ZR2A 3HB9A 2ZB9A 2EZKA 1ENHA 2LY9A 3L1PA 2CRGA 1Z0XA 2LP0A 3S1NJ 1VI0A 2L7FP 1LE8B 3HGGA 2DJNA 2B63J 4AUXA 3LSPA 4BKXA 3LSJA 5FKMA 1W0UA 1A6IA 2Y9YA 1HDPA 5C44J 4JX5A 2JA7J 3OIOA 2Y9ZA 4M6VA 5C4XJ 4CYCB 3JREA 2Y2ZA 2AO9A 4A3MJ 3S1QJ 2NS8A 3ZQGA 4BBSJ 2OF7A 4DYQA 1T56A 3O8HA 5M3FJ 3UKGA 3BTLA 1TWAJ 4M3EA 4M3GA 5F27A 3TW6A 5GP9A 1MH3A 4XRMA 3LSRA 3MKLA 1H8AC 1XC5A 1JKOC 5F1JA 4A3CJ 2E2JJ 2O8KA 3BT9A 4BXXJ 3TEDA 3BQZA 2E19A 4DZPA 3A03A 2NVXJ 3A01A 3B6CA 4B1RA 2P81A 4FE4A 3ZQLA 3GTGJ 3RZDJ 1ETVA 2D5VA 5K7FA 2JK3A 1VF9A 1IC8A 3TW7A 3HOWJ 2XB0X 2EZIA 1NTCA 4IHYA 5GPCA 2TCTA 3I4MJ 1WCMJ 2HI3A 3HBLA 5HODA 1NK2P 4IHWA 3NARA 5E3MA 1K83J 4J19A 3BG9A 5EZHA 3ZQHA 5FJ8J 3IH3A 3CMYA 1XG1A 3ZQFA 1B8IA 2GLOA 2K40A 4XRSG 1IGNA 4M3BA 4V2GA 5E3LA 4A3BJ 1JGGA 2WV1A 1AHDP 2ID6A 1XS9A 3E7LA 3IH4A 2HOAA 5EG0B 4FTHA 1AKHA 4Y52J 5IP6A 2DTZA 1U78A 3F0CA 4C3IJ 3BQYA 9ANTA 1WPKA 1FTZA 2K9SA 3JRBA 5FLVA 2MW8A 2L9RA 4MFEA 2R5ZB 1P7JA 3ZQCA 3HM5A 2JA5J 1RETA 4W97A 1T33A 1P7IA 1GVDA 5EGOB 5K7HA 1JUPA 1HLVA 1OCPA 2X48A 2AHQA 5C3EJ 1HF0A 5E3NA 1RESA 1RPWA 4G12A 1UG2A 2JN6A 1IDYA 1ETOA 5FKKA 3ZQIA 1PUFA 1LFBA 5GPAA 2E2IJ 1ZKGA 2PMZN 1W0TA 4RDUA 2QF7A 4X6AJ 2Y31A 1TWHJ 5F04A 2ID3A 2LVSA 4JX6A 2EZHA 1Y1WJ 3JRHA 3RZOJ 1B72A 2JMWA 3BR6A 2NS7A 5F0CA 3GTJJ 1WGXA 2M0CA 3PO3J 5J1YA 3CDLA 3PO2J 2CUEA 3QQAA 1MBHA 4UUTA 1GV2A 3OSFA 4ABZA 1H89C 2IBDA 1ZGWA 3PM1A 1MNMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RKW A;  1MSE C;  4IHV A;  2CU7 A;  4LOC A;  2LTP A;  2JA6 J;  2MG4 A;  4Y7N J;  2HOT A;  3D1N I;  4MIM A;  3GBG A;  5JLX A;  1IRZ A;  3HOY J;  2DA4 A;  2I10 A;  3ZOB A;  5M5Y J;  2GM4 A;  1UHS A;  1JKR C;  4BY1 J;  2K9N A;  4C3H J;  5IOY A;  2G0E A;  3LSG A;  2COB A;  1JT0 A;  3G1O A;  1GV5 A;  2LKX A;  4XIC A;  1BW5 A;  2ECC A;  1QPI A;  1X58 A;  2M9H A;  5FKO A;  3I4N J;  5J3L A;  1S7E A;  1IG7 A;  3M4O J;  1MBJ A;  1LFU P;  1JUM A;  1JUS A;  3HOV J;  5M5X J;  1D5Y A;  2KT0 A;  4B4C A;  1UMQ A;  2H1K A;  5FKL A;  3H3V K;  2O7O A;  2DA1 A;  1JT6 A;  2NVT J;  1QVU A;  1ZTR A;  2R0Q C;  3TP0 A;  4A3G J;  4AC0 A;  4QSH A;  1QVT A;  3BTJ A;  5E3O A;  2YU9 J;  4DYC A;  3B6A A;  2TRT A;  5EZG A;  1IDZ A;  2NVQ J;  3SFI A;  3H0G J;  1GUU A;  4JP0 A;  3HEF A;  1RR7 A;  1Z77 A;  4FIS A;  2O9L A;  2EZL A;  2XPV A;  3K2A A;  2DA6 A;  1R9T J;  4A3L J;  1AKH B;  1JTY A;  1K61 A;  3C2B A;  1FIA A;  5EEA A;  5M5W J;  1YRN A;  1FTT A;  2FX0 A;  2HXO A;  1H88 C;  5JLW A;  5F0F A;  2LK2 A;  2XGE A;  2EBI A;  2FD5 A;  1FIP A;  1OJL A;  2LR8 A;  5IOZ A;  2HXI A;  1ZQ3 P;  1CQT A;  5IYC J;  4XRS A;  2W48 A;  2ME6 A;  3HGY A;  3MN2 A;  3FK7 A;  1BL0 A;  1OCT C;  4D5F A;  2XGC A;  4I76 A;  2VKE A;  3HOZ J;  2HDD A;  5DTD A;  1ZR4 A;  2DMU A;  3A02 A;  1O4X A;  5DS9 A;  5IP7 J;  5EDN A;  1JKP C;  4A3F J;  2CJJ A;  3DCF A;  1PUF B;  5K7Z A;  1RKT A;  2XSD C;  4A3I J;  1ETY A;  2LD5 A;  2EH3 A;  2E2H J;  3RQI A;  5J1R A;  5J1U A;  3GTK J;  1G2H A;  1HDD C;  2LLK A;  2WB1 N;  4QTR A;  4IEJ A;  1TWC J;  3BR1 A;  2NVY J;  1JKQ C;  4DZJ A;  3NAU A;  5FKN A;  3BR2 A;  4RBO A;  3Q0W A;  3HDD A;  1WI3 A;  2JJ7 A;  3M3Y J;  1ETQ A;  1NK3 P;  3RKQ A;  4A3D J;  4GFB A;  3FKI J;  2M2E A;  3S15 J;  2M34 A;  3WHB A;  3GTP J;  1ZK8 A;  2ECB A;  2K9Q A;  1AU7 A;  1BA5 A;  1EF4 A;  3S14 J;  3IH2 A;  2Y30 A;  1VFC A;  4A69 C;  3S17 J;  2IEK A;  2KDZ A;  2VI6 A;  2DMP A;  2R7Z J;  3BR5 A;  3OOU A;  3S2D J;  4MO7 A;  2N8G A;  2LFB A;  1ITY A;  2FJ1 A;  2R5Y A;  1TC3 C;  2YS9 A;  4DW6 A;  1U9N A;  3K7A J;  5FLM J;  2L7Z A;  2CQQ A;  4UUS A;  4XK4 A;  2NOG A;  2DMT A;  1JJ8 C;  1I6H J;  1ETK A;  3CQZ J;  1VND A;  3BTI A;  1MH4 A;  1QRY A;  1OFC X;  4EEF G;  1LE8 A;  5IYD J;  1BW6 A;  2DN0 A;  1SFO J;  4M3F A;  4DYR A;  1MBG A;  2ME0 A;  2M8G X;  3A01 B;  4A3E J;  1IJW C;  3FK6 A;  3BR0 A;  5BNG A;  1TWG J;  1FJL A;  1A5J A;  1HOM A;  3DEW A;  2X9D A;  1MBF A;  3FIW A;  3TP3 A;  4CYC A;  1DU0 A;  1MBE A;  2Y0S N;  3FIS A;  1I50 J;  2DMQ A;  2VPR A;  4MFD A;  5F08 A;  2XRL A;  2HYJ A;  4L5E A;  1U8B A;  1WH5 A;  3Q0U A;  3VPR A;  5IYB J;  5F0H A;  2FQ4 A;  2XB5 A;  2VKV A;  1B8I B;  2R92 J;  2E1O A;  1Y1V J;  3HKZ N;  2HOS A;  5C4J J;  3QPL A;  4BBR J;  3HOX J;  2DA3 A;  1APL C;  1ORK A;  1YRN B;  2DA5 A;  2DMN A;  2WAQ N;  5IPA A;  2MGQ A;  3BTC A;  1IUF A;  2DA2 A;  2GBY A;  3SJM A;  3Q3S A;  2YUS A;  2RAE A;  3MVP A;  5EYR A;  2L7M P;  2OPT A;  5IP9 J;  2ELK A;  1GT0 C;  1X2N A;  3JRG A;  2JA8 J;  2IAI A;  2QCO A;  3IV5 A;  1MBK A;  1WH7 A;  1IV6 A;  1TWF J;  3Q0V A;  3GTO J;  1JTX A;  4JX4 A;  1BJZ A;  4A93 J;  4AYB N;  3S1R J;  3BG3 A;  3O8G A;  2DA7 A;  4NDL A;  3JRI A;  4HNV A;  3SDG A;  1FEX A;  3JRC A;  1ETX A;  2XGD A;  2JWT A;  4XID A;  4IHX A;  3JR9 A;  1E3O C;  5EG0 A;  4FCY A;  1MSF C;  4X1E A;  3G1L A;  2R93 J;  1ETW A;  1JJ6 C;  4I6Z A;  3S2H J;  1POG A;  2X6O A;  4JYK A;  3GTM J;  4FE7 A;  1B72 B;  2MSY A;  2XPU A;  2R5Z A;  4B3A A;  5EF6 A;  2CQX A;  3W6V A;  5M3M J;  3S16 J;  4W1U A;  2H8R A;  3OSG A;  4C2M J;  4D7N A;  1I3Q J;  1GDT A;  1U9O A;  5EGO A;  3LNQ A;  3HOU J;  1X2M A;  4S0H B;  1F43 A;  1HCR A;  1Q1V A;  2L0K A;  3JRF A;  4D5C A;  2CUF A;  2XPW A;  3GTL J;  4V2F A;  4A3K J;  2VUM J;  1SAN A;  3S1M J;  3QPS A;  3G1M A;  4QIW N;  3JRD A;  3LOC A;  4MLO A;  2EQR A;  3WHC A;  2HQ5 A;  4C3J J;  1DU6 A;  3CCY A;  3BR3 A;  3JRA A;  4BY7 J;  1F36 A;  4M3D A;  2R5Y B;  3BG5 A;  3GTQ J;  4D7M A;  4UUS B;  4A3J J;  1ZR2 A;  3HB9 A;  2ZB9 A;  2EZK A;  1ENH A;  2LY9 A;  3L1P A;  2CRG A;  1Z0X A;  2LP0 A;  3S1N J;  1VI0 A;  2L7F P;  1LE8 B;  3HGG A;  2DJN A;  2B63 J;  4AUX A;  3LSP A;  4BKX A;  3LSJ A;  5FKM A;  1W0U A;  1A6I A;  2Y9Y A;  1HDP A;  5C44 J;  4JX5 A;  2JA7 J;  3OIO A;  2Y9Z A;  4M6V A;  5C4X J;  4CYC B;  3JRE A;  2Y2Z A;  2AO9 A;  4A3M J;  3S1Q J;  2NS8 A;  3ZQG A;  4BBS J;  2OF7 A;  4DYQ A;  1T56 A;  3O8H A;  5M3F J;  3UKG A;  3BTL A;  1TWA J;  4M3E A;  4M3G A;  5F27 A;  3TW6 A;  5GP9 A;  1MH3 A;  4XRM A;  3LSR A;  3MKL A;  1H8A C;  1XC5 A;  1JKO C;  5F1J A;  4A3C J;  2E2J J;  2O8K A;  3BT9 A;  4BXX J;  3TED A;  3BQZ A;  2E19 A;  4DZP A;  3A03 A;  2NVX J;  3A01 A;  3B6C A;  4B1R A;  2P81 A;  4FE4 A;  3ZQL A;  3GTG J;  3RZD J;  1ETV A;  2D5V A;  5K7F A;  2JK3 A;  1VF9 A;  1IC8 A;  3TW7 A;  3HOW J;  2XB0 X;  2EZI A;  1NTC A;  4IHY A;  5GPC A;  2TCT A;  3I4M J;  1WCM J;  2HI3 A;  3HBL A;  5HOD A;  1NK2 P;  4IHW A;  3NAR A;  5E3M A;  1K83 J;  4J19 A;  3BG9 A;  5EZH A;  3ZQH A;  5FJ8 J;  3IH3 A;  3CMY A;  1XG1 A;  3ZQF A;  1B8I A;  2GLO A;  2K40 A;  4XRS G;  1IGN A;  4M3B A;  4V2G A;  5E3L A;  4A3B J;  1JGG A;  2WV1 A;  1AHD P;  2ID6 A;  1XS9 A;  3E7L A;  3IH4 A;  2HOA A;  5EG0 B;  4FTH A;  1AKH A;  4Y52 J;  5IP6 A;  2DTZ A;  1U78 A;  3F0C A;  4C3I J;  3BQY A;  9ANT A;  1WPK A;  1FTZ A;  2K9S A;  3JRB A;  5FLV A;  2MW8 A;  2L9R A;  4MFE A;  2R5Z B;  1P7J A;  3ZQC A;  3HM5 A;  2JA5 J;  1RET A;  4W97 A;  1T33 A;  1P7I A;  1GVD A;  5EGO B;  5K7H A;  1JUP A;  1HLV A;  1OCP A;  2X48 A;  2AHQ A;  5C3E J;  1HF0 A;  5E3N A;  1RES A;  1RPW A;  4G12 A;  1UG2 A;  2JN6 A;  1IDY A;  1ETO A;  5FKK A;  3ZQI A;  1PUF A;  1LFB A;  5GPA A;  2E2I J;  1ZKG A;  2PMZ N;  1W0T A;  4RDU A;  2QF7 A;  4X6A J;  2Y31 A;  1TWH J;  5F04 A;  2ID3 A;  2LVS A;  4JX6 A;  2EZH A;  1Y1W J;  3JRH A;  3RZO J;  1B72 A;  2JMW A;  3BR6 A;  2NS7 A;  5F0C A;  3GTJ J;  1WGX A;  2M0C A;  3PO3 J;  5J1Y A;  3CDL A;  3PO2 J;  2CUE A;  3QQA A;  1MBH A;  4UUT A;  1GV2 A;  3OSF A;  4ABZ A;  1H89 C;  2IBD A;  1ZGW A;  3PM1 A;  1MNM C; 
#chains in the Genus database with same CATH topology
 4IHV A;  4EMS A;  2RQP A;  5E17 F;  4CZZ A;  3OR2 C;  2MG4 A;  5GTH C;  3D1N I;  4RS8 A;  1FOX A;  3A1Y A;  2L9S A;  3ABK H;  3EUK L;  3LA7 A;  1I5Z A;  2MLK A;  5J40 A;  1HXD A;  2DU9 A;  3S8P A;  2GM4 A;  3WU2 C;  3E0J B;  4BY1 J;  4XLA A;  2V9K A;  1A6Q A;  1OR7 A;  1FMV A;  1IW7 F;  4AYB A;  4WCG A;  2L01 A;  5H6R A;  4YII A;  3JSO A;  2YX4 A;  4GGG A;  3F23 A;  3LSG A;  2PMU A;  4CCM A;  2L4M A;  3G1O A;  1BM9 A;  2LKX A;  2RKH A;  2OZ6 A;  2ECC A;  1QGP A;  1QPI A;  3KP3 A;  1UG0 A;  3GZN B;  3J7A O;  2J5O A;  2NOJ B;  1W4M A;  4G94 A;  5CQE A;  1G8X A;  3KP2 A;  4KN4 X;  2LKS A;  3ZN0 A;  5K5O A;  2F6C A;  2X6X A;  3EUH A;  4ITV A;  3CUO A;  3K4J A;  1LFU P;  3M4O J;  3OWT A;  5FFX A;  1QPM A;  1EH7 A;  4E7K A;  5FKL A;  2NVT J;  3DBL B;  2JUC A;  4A3G J;  1QNT A;  4A2U A;  1F9N A;  4QSH A;  2HQR A;  1Y0N A;  1TZL A;  2W82 A;  1QVT A;  2BOL A;  3BTJ A;  3JAM Z;  3A0H C;  4F91 B;  2YU9 J;  4DYC A;  3B6A A;  2A3S A;  2TRT A;  4ZYH A;  1IDZ A;  2NVQ J;  3L9F A;  3SFI A;  1GUU A;  2JPC A;  2IGO A;  2O9L A;  1MDM A;  4IKF A;  2XPV A;  3K2A A;  3HTS B;  1R5G A;  1XSV A;  2ISY A;  4CH7 A;  3SYT A;  3MKY B;  4BQN A;  5DCF A;  1S29 A;  2IA2 A;  1YRN A;  3FBI B;  1FTT A;  2DO7 A;  4ZC3 A;  3ZMS A;  1LB2 A;  1HKS A;  3TDU C;  3ABM H;  1SVM A;  5F0F A;  4UVA A;  5J6X A;  5KAF C;  3I55 I;  2EBI A;  5JVT A;  4GCV A;  4B3X A;  1UZC A;  3ECH A;  2WA0 A;  1FOW A;  4XRS A;  3E5U A;  1STZ A;  3RQ4 A;  3MN2 A;  3FK7 A;  3FWE A;  5D4R A;  2GA2 A;  2OTL I;  4NBQ A;  2DT6 A;  3FMR A;  3ASO H;  1H0M A;  5H6Q A;  3CCJ I;  2HDD A;  1D1C A;  3AG1 H;  2QBY B;  2MC4 A;  5EDN A;  5HNH A;  4A3F J;  2HQA A;  1YW8 A;  5K7Z A;  2E7W A;  1RKT A;  3CF5 F;  1CF7 B;  2XSD C;  4A3I J;  2UXX A;  4G9Y A;  3V7C A;  2DTR A;  2X4H A;  1Y6I A;  4TV7 A;  5J1U A;  2IS6 A;  4F55 A;  1SVO A;  4EJT A;  1HDD C;  3T8T A;  2WB1 N;  4QTR A;  3DU5 A;  1BIA A;  3HC7 A;  1U5T A;  4IEJ A;  3F8C A;  3F8F A;  5ED4 A;  3NAU A;  3ZQ7 A;  3H3Z A;  4RBO A;  2A61 A;  5HDK A;  1N25 A;  2VXD A;  3HKZ A;  1NK3 P;  2KPM A;  1W5S A;  2WC2 A;  2HTS A;  3OYK A;  2F5D A;  4LMY A;  2M2E A;  3GTP J;  2BXZ A;  2VQL A;  3FKJ A;  2WAQ A;  1D5V A;  1X1A A;  1ZK8 A;  1TTY A;  1QA6 A;  3JTH A;  3K69 A;  1AU7 A;  2E5Z A;  3IH2 A;  2Y30 A;  3LST A;  1VFC A;  1ZRC A;  1O3R A;  3S17 J;  1ZAR A;  2KDZ A;  3SHF A;  2DMP A;  2XV4 S;  3OYB A;  2X1D A;  2K9M A;  3PFY A;  4XSZ F;  1QHH D;  3OOU A;  3V7S A;  3RPU A;  5KK1 A;  2FJ1 A;  4P5O A;  3CP8 A;  2HFH A;  3C3W A;  1I27 A;  2CV0 A;  2NOG A;  3CC4 I;  1I6H J;  1ETK A;  3BTI A;  1HW1 A;  4U88 A;  3D5R C;  3ULQ B;  5IYD J;  3TO7 A;  1MD0 A;  4G7Z F;  4DBQ A;  3CP2 A;  2ME0 A;  3IWF A;  1LKX A;  3OS0 A;  5CVJ A;  3A01 B;  3C2G A;  1IJW C;  4I01 A;  2QSG X;  4NB5 A;  3PIP F;  3DLL F;  1E3P A;  1UCR A;  4ZTF A;  3ZMD A;  4ENM A;  2XF5 A;  3I54 A;  5DD8 A;  4HQM A;  2X9D A;  2DOA A;  4I02 A;  1IRG A;  1LQ1 A;  2R7T A;  4M9Z A;  4LG3 A;  2ISZ A;  3CLO A;  2M87 A;  1OYI A;  3C2H A;  4CYC A;  2KP6 A;  3CLQ A;  2QEX I;  1DDN A;  1MMD A;  2ESN A;  5F08 A;  5F1R A;  3WTX C;  5IT9 Z;  5JHU A;  2IS1 A;  1R49 A;  1WH5 A;  1UB9 A;  2IPQ X;  3E5X A;  1USS A;  2R3S A;  2FQ4 A;  3N97 A;  2VKV A;  5TIS C;  1MMG A;  2QQB A;  3HOX J;  3FM3 A;  1APL C;  4FX0 A;  3ESW B;  4YIR X;  3KEO A;  3VFZ A;  2HZT A;  3A0B C;  3GCM A;  5B1B H;  2MGQ A;  4Y33 A;  1UHM A;  2CQ7 A;  5KHD A;  5DD4 A;  3SJM A;  4G6D A;  1Z91 A;  5HDN A;  4P9U A;  3MVP A;  3ZXS A;  2R7U A;  1BN5 A;  2R7D A;  5LBQ A;  1L3L A;  2HVS A;  4EM2 A;  2JA8 J;  3IV5 A;  2VOO A;  3GO5 A;  2HQN A;  2ACJ A;  1MZB A;  2ZFU A;  2XHK A;  1JTX A;  3LFU A;  4BXU A;  2EJR A;  2GZW A;  3BG3 A;  1F4K A;  1QBJ A;  2Z33 A;  1ETX A;  4EVI A;  4PUS A;  4V19 K;  3ZMT A;  4U0V A;  4ZYD A;  1E3O C;  4XKB A;  4PFO A;  4X1E A;  4NC8 A;  5LGT A;  2Y69 H;  3S2H J;  4BJ6 C;  2Q1Z B;  4PSX A;  2ZXH A;  1IXS B;  4RM3 A;  2R5Z A;  4RAY A;  4MQV A;  4CUG A;  3S16 J;  3VYU B;  1XPX A;  3OSG A;  4D7N A;  3IKT A;  1MJB A;  2VN2 A;  5EGO A;  3F72 A;  4P96 A;  4IHS A;  1F1Z A;  1SVL A;  4HEA 2;  4C30 A;  3KYC B;  1GLN A;  1HCR A;  1C0W A;  2L0K A;  3JRF A;  1B9N A;  2HVR A;  1CGP A;  2XPW A;  3ML6 A;  5AON A;  3GTL J;  1G6N A;  4A3K J;  1SAN A;  2VJJ A;  4YIF A;  3DTE A;  3TO6 A;  2VLA A;  1R22 A;  3LOC A;  4MLO A;  4RMN A;  2K9L A;  3RYP A;  3RSN A;  4L18 B;  2IGK A;  5K5Q A;  1EJ9 A;  4L0Y B;  3BG6 A;  3BR3 A;  2F4O B;  3CCY A;  1DU6 A;  2BV6 A;  4LFU A;  3DLA A;  3BG5 A;  2L2O A;  1D8K A;  3IAS 2;  1WRJ A;  2A07 F;  4FQG A;  3E97 A;  3GTQ J;  4HQE A;  2RN7 A;  2DK5 A;  3KEY A;  3HB9 A;  1K79 A;  1S7O A;  2LY9 A;  5E79 C;  5D5X B;  2DW4 A;  2K02 A;  4WXC A;  1Z0X A;  2LP0 A;  5D6F A;  1YQA A;  3OYA A;  2B63 J;  3LSP A;  3GF2 A;  4WX9 A;  2BYV E;  3PUF A;  3I56 I;  4AVZ A;  3WTS C;  3LSJ A;  2DK8 A;  1I1G A;  5FKM A;  3M7G A;  1W0U A;  1XGM A;  1A6I A;  2Y9Y A;  5HVQ C;  5C44 J;  1R1T A;  3M9A A;  1BI3 A;  3GVA A;  4ZYA A;  2JA7 J;  5GAE J;  5C4X J;  1S3J A;  3WTV C;  3OYD A;  2Y2Z A;  4DGW B;  4OWR B;  1HC8 A;  4RB0 A;  4AVP A;  4BBS J;  4LLL A;  2I8D A;  1JHF A;  2H27 A;  4BAY A;  3KE2 A;  3O8H A;  3KYL A;  3BZC A;  2BBY A;  4XLH A;  4E7L A;  4Q5S F;  5JVG F;  2MC3 A;  1YIT I;  4M3G A;  3F6V A;  4NC6 A;  3BRO A;  5HLH A;  3ZCO A;  5B66 C;  1ON1 A;  1Z7U A;  3COA C;  3LMM A;  2FMY A;  5F1J A;  3HYI A;  4UB6 C;  3WTU C;  3QYF A;  1YI2 I;  1HBX G;  2XUB A;  2ZXJ A;  1T2K A;  3QU3 A;  3A03 A;  2IS4 A;  3B6C A;  1M1E B;  2P81 A;  3E6D A;  3NRV A;  4FE4 A;  3DPT A;  1LFP A;  1D3Y A;  3RZD J;  1ETV A;  3GTG J;  1XDS A;  4O6J A;  4DQ2 A;  2DYS H;  4RM2 A;  2EIN H;  2EIK H;  3SZG A;  3HRU A;  4RAZ A;  2OJE D;  3FMQ A;  1A31 A;  1HA8 A;  3HBL A;  2ZME C;  2X85 A;  1W36 D;  5D8K B;  2OCE A;  5HOD A;  1O3S A;  3QP6 A;  3OS2 A;  2E1C A;  2R7F A;  1SD6 A;  1TLH B;  3F9K A;  4J19 A;  3IH3 A;  4NC7 A;  1UAA A;  4II3 A;  1XG1 A;  2QQA A;  3CMY A;  5L3C A;  2E34 A;  3RTR A;  2LYC A;  4CCK A;  4E7H A;  2K40 A;  3CO6 C;  3LA2 A;  3TQN A;  2VBX A;  4V2G A;  3V8L A;  2JQ7 A;  1RC9 A;  1JGG A;  1AHD P;  5LGN A;  2OZU A;  1XS9 A;  3E7L A;  4FTH A;  3OL4 A;  2ZXW H;  4Y52 J;  2RNJ A;  1T8I A;  3F0C A;  3H9Q A;  4C3I J;  3BQY A;  3HG9 A;  2F5C A;  4NQW A;  1FTZ A;  1WPK A;  5J8F A;  3K0L A;  4HLX A;  3H5A A;  3JRB A;  5GAD J;  2CGP A;  4MFE A;  5LRR A;  5ICF A;  3R0A A;  4DJA A;  3K10 A;  3D0S A;  3K70 C;  3K2Z A;  3E3V A;  2K3F A;  1P7I A;  2MD0 A;  5K7H A;  3OR1 C;  3ONQ A;  1RIO H;  3M8F A;  1E3H A;  2EK5 A;  2XAS A;  3IWZ A;  3J80 Z;  2A6H F;  2COM A;  2XAF A;  3BY6 A;  2JN6 A;  3H3U A;  1ETO A;  1VQ5 I;  1WJD A;  4LGW A;  3L00 A;  3J7Z I;  3L2W A;  1LFB A;  3K4N A;  5GPA A;  1YJW I;  3FHZ A;  1PUF A;  1QU3 A;  3CES A;  4IRH A;  1VQO I;  3U1D A;  2Y31 A;  4UUV A;  2ID3 A;  2CW7 A;  4JX6 A;  2CH0 A;  1LDK B;  1Y1W J;  4EGY A;  1X4O A;  2ZNZ A;  3ABL H;  2JUG A;  3VYR B;  4KN7 X;  4BE1 A;  5F6F A;  4M9X A;  2JMW A;  3BR6 A;  2WV0 A;  3GTJ J;  1WGX A;  2OUM A;  1PP8 F;  3R4K A;  2XSJ C;  2DAO A;  1YJN I;  1VQ6 I;  3FXR A;  4HX4 A;  2CUE A;  3QQA A;  1V54 H;  4ABZ A;  2GXG A;  4GYG A;  3T0Y A;  3IHU A;  3WTT C;  2A6E F;  4ZYG A;  4FT8 A;  2ZSH B;  3HXL A;  1MNM C;  1A35 A;  1ZRE A;  3I59 B;  1X1B A;  2CU7 A;  4LOC A;  1QZE A;  4OIN F;  2CMP A;  1DUX C;  4OOI A;  2KRF A;  5JLX A;  4G7O F;  3GME A;  4XRF A;  2DA4 A;  3MWM A;  1X1C A;  3SZT A;  3CCS I;  2FA5 A;  2VJI A;  3P9C A;  4G7H F;  3ZN1 A;  4IQJ A;  3SEQ A;  3KP6 A;  4YFN F;  2K9N A;  3ZRG A;  4ENK A;  1V3F A;  5IOY A;  2G0E A;  2XAU A;  2COB A;  1S72 I;  3CC2 I;  1JT0 A;  3CJR B;  4LIT A;  1X58 A;  2M9H A;  1SD4 A;  4KT5 C;  1SFK A;  1ZGJ A;  1S7E A;  2A68 F;  1IG7 A;  1VQP I;  4GXO A;  4CIC A;  2GOM A;  5M5X J;  3LSH A;  3BZK A;  4AU7 A;  2HNH A;  1JXS A;  1ZTR A;  4BHB A;  3A4C A;  3E1S A;  4HG2 A;  2MAB A;  3Q9V A;  4BEH A;  1J59 A;  2EWN A;  4I2O A;  4ZDL A;  5E3O A;  2H8W A;  5EZG A;  3CCM I;  1ZLK A;  4I09 A;  2Q2E B;  1Z77 A;  4FIS A;  2X1E A;  1T0F A;  2EA4 A;  1K4T A;  1A04 A;  3DU6 A;  4A3L J;  1AKH B;  1JTY A;  1FIA A;  3W6J B;  5M5W J;  3RIR A;  5ERI A;  5E1X A;  5D8L B;  4L0Z B;  5JR3 A;  3K4K A;  5ILV A;  1H88 C;  4HV6 A;  1U3E M;  2LK2 A;  4ESB A;  5ICE A;  4BJ5 C;  2BVL A;  1FIP A;  5IOZ A;  3TOB A;  2HXI A;  1CQT A;  5IYC J;  2W48 A;  3LQQ A;  3PQJ A;  2K4B A;  2PX9 A;  2IRF G;  5H20 A;  3DKX A;  1BL0 A;  1OCT C;  2R7W A;  4RGU A;  5FLX K;  3CUQ C;  3AG3 H;  3W2W A;  2ZFW A;  3F6O A;  4I76 A;  3PJR A;  2LOO A;  4A0Y A;  5DTD A;  1FWZ A;  4KIT B;  1K78 A;  1O4X A;  4II2 A;  2VJ5 A;  4LB6 B;  4EV0 A;  5K5R A;  2BGC A;  3I3L A;  3AFH A;  3BP8 A;  4FET A;  2CJJ A;  2LMD A;  1FYK A;  2QA4 I;  2KIM A;  5ILS A;  4IOA F;  5A2Q K;  2AXT C;  3RQI A;  3SEZ A;  4YFX F;  2Y0S A;  5E8I A;  1TP4 A;  4XN3 A;  3CJN A;  2XC7 A;  1FBS A;  3K4L A;  4JQF A;  3PNY A;  3PIO F;  1Z05 A;  1TT5 B;  1W1W E;  4D1Q A;  4XL9 A;  2UZK A;  3Q0W A;  1I1S A;  3M3Y J;  1ETQ A;  2L5Q A;  2MA3 A;  2K85 A;  3FKI J;  4D0P A;  1X3W B;  4RGS A;  3SQN A;  3WHB A;  1LDD A;  3VWB A;  2G7H A;  1IRF A;  1J5Y A;  2ETH A;  4HA8 A;  2ECB A;  2K9Q A;  2PQ8 A;  1BA5 A;  4S04 A;  3S14 J;  3GFM A;  1IRX A;  4A69 C;  4L9T A;  1PVE A;  2IEK A;  1BR2 A;  3SFZ A;  3CUQ B;  1YHQ I;  2R7Z J;  3LSM A;  4O3M A;  4OU0 A;  3OYC A;  2LY2 A;  2OBP A;  3WTY C;  3S2D J;  5HOO A;  1X3U A;  3BCB A;  4F92 B;  1VQL I;  2QEN A;  2DDB A;  3RYR A;  1TC3 C;  3K7A J;  5KAI C;  2DOF A;  2L7Z A;  2VL8 A;  3C1D A;  4XK4 A;  2DOD A;  4L5J A;  1HKT A;  4R1H A;  2B7E A;  4KFC A;  3Q5F A;  1XGS A;  3LFK A;  3M1C A;  3I0T A;  1MH4 A;  1XSX A;  1QRY A;  4PJM A;  1OFC X;  1LE8 A;  4BAC A;  1YIJ I;  4KIB A;  2LF8 A;  3HSR A;  1MBG A;  4WXH A;  4A3E J;  2KZV A;  3V7R A;  1K7A A;  3OL3 A;  4DIQ A;  1B59 A;  3GZ5 A;  1VQ4 I;  3MZY A;  1TWG J;  5DM6 F;  1FJL A;  1HOM A;  2F4I A;  3IUO A;  3FXQ A;  5KVR A;  5HS7 A;  3FIW A;  2FBH A;  2L3D A;  3TP3 A;  4CGZ A;  4QPQ A;  2MFZ A;  1MBE A;  1HQC A;  3FIS A;  1I50 J;  4CHU A;  2P4W A;  2W85 A;  1SAU A;  4L5E A;  2OC6 A;  3CDH A;  3U9G A;  1XCB A;  3OIQ A;  1NG7 A;  3Q0U A;  2D45 A;  4D9J A;  3QOE A;  3V4G A;  4BU2 A;  1YS6 A;  1MDM B;  2QGU A;  2HWV A;  2O5R A;  1B8I B;  2E1O A;  2DYR H;  2Z1D A;  4XM3 A;  1Y1V J;  3HKZ N;  1RRJ A;  3QPL A;  3T1B A;  2DA3 A;  1YRN B;  4QWQ A;  4ANJ A;  4BQQ A;  4EQQ A;  2WAQ N;  2X51 A;  2YR2 A;  3V42 A;  5IPA A;  1QQI A;  2KHM A;  5AIP A;  2EFQ A;  4XQF A;  2W4S A;  2YUS A;  4DOZ A;  1QZY A;  2L7M P;  1MJA A;  4EAT A;  2ELK A;  3F8M A;  5E18 F;  3ZP5 A;  4ASN A;  1MJ9 A;  2DOE A;  2IAI A;  3FDY A;  3I71 A;  4MGR A;  4UB8 C;  1G3S A;  1WH7 A;  2DBB A;  2M3A A;  3IL2 A;  3HSE A;  1TWF J;  3KP7 A;  3CTA A;  3Q0V A;  4I0A A;  2Z9O A;  3BCA A;  4JX4 A;  1BJZ A;  1IN6 A;  2JRT A;  4A0X A;  3DKW A;  3W2V A;  2EB7 A;  3S1R J;  3ZPL A;  3JRI A;  4EJV A;  5BMZ A;  2Z2S B;  2XGD A;  4PJJ A;  3JR9 A;  4HNU A;  5EG0 A;  3QRF F;  4FCY A;  2ZJR F;  1HKQ A;  3GLX A;  4ESF A;  3OYF A;  2H6B A;  2CYY A;  5CQG A;  1QO0 D;  2CSO A;  2EFO A;  4I6Z A;  1U5T B;  3HUG A;  3CC7 I;  2PG4 A;  1EH8 A;  1POG A;  2X6O A;  4JYK A;  1B72 B;  2MSY A;  3DEU A;  4B3A A;  2D1H A;  2CQX A;  2KJC A;  3J81 Z;  3W6V A;  5M3M J;  5K1Y A;  4W1U A;  2H8R A;  2LG4 A;  4C2M J;  1YLF A;  4J00 A;  1GDT A;  1D0Y A;  4M71 A;  2VIX A;  3FXL A;  3M8E A;  2VE9 A;  3PSF A;  5JI6 A;  3HOU J;  3QPT A;  2IP2 A;  1X2M A;  4UHT A;  1F43 A;  1D8J A;  2M8E A;  1Q1V A;  3K4C A;  3V8J A;  1FMW A;  4MEX F;  4HAM A;  4J01 A;  1CF7 A;  2VUM J;  3O6B B;  5LHH A;  4IRG A;  4IVN A;  2EQR A;  2K3P A;  4A12 A;  1WFX A;  2ELH A;  5E1Z B;  3L2V A;  2VT3 A;  1EH6 A;  3HPG A;  3BJO A;  5AIQ A;  4BY7 J;  4CSW A;  1F36 A;  3HJE A;  4L9N A;  2V6E A;  1LUJ B;  4ZJZ A;  5EEG A;  1J0R A;  1XMK A;  3S2W A;  1ZAO A;  1R7J A;  3IAM 2;  4E7J A;  2LF7 A;  1VQK I;  3C18 A;  2EZK A;  2KMU A;  3L1P A;  4Y13 A;  2FRH A;  3EPZ A;  2EV5 A;  4G8X A;  2R7S A;  1JI8 A;  3F21 A;  5CPR B;  3HGG A;  4LG0 A;  4AUX A;  2IGN A;  2LY1 A;  1VQ9 I;  1QHG A;  3BPX A;  4P1W A;  4N9H A;  3W6K B;  2HPM A;  1P2F A;  3LQR A;  1D0X A;  1MW7 A;  3LAJ A;  2Q8K A;  3JSP A;  2PI0 A;  4JX5 A;  4GDF A;  3OIO A;  2Y9Z A;  2VQC A;  2F5E A;  4CYC B;  3P7N A;  3S1Q J;  1YYV A;  2HKX A;  3KP5 A;  2XKO A;  3G6E I;  3QAH A;  2PJR A;  3TMO A;  2IGM A;  1NH3 A;  1TWA J;  3LSK A;  1WZ2 A;  4OIO F;  2K5C A;  3HHH A;  5F27 A;  4XRM A;  3LSR A;  2QUF A;  4ZYE A;  4AWX B;  3WE2 A;  2IW5 A;  4KIF A;  1JKO C;  1YW7 A;  2E2J J;  2O8K A;  3BT9 A;  2ZJ2 A;  3TED A;  4XSX F;  5DDG A;  3BQZ A;  3OYE A;  1KQ9 A;  3HRM A;  4JBA A;  4DZP A;  3DBH B;  3A01 A;  4B1R A;  2UV1 A;  1BC8 C;  4Y3O A;  3ZQL A;  2ZNY A;  5J47 A;  2LBF A;  2WAF A;  2JK3 A;  3ZMU A;  2GAU A;  1LDJ A;  2AXL A;  2XB0 X;  4F3Q A;  1NTC A;  2EFN A;  4XLF A;  4IHY A;  2DT5 A;  3BWG A;  3KP4 A;  2FML A;  3I4M J;  2Z16 A;  3VYT B;  4BH9 A;  3JCU C;  3AAF A;  1BOB A;  1OCC H;  1LNW A;  3I9V 2;  1NK2 P;  3FF5 A;  3VB2 A;  3ZGK A;  5E3M A;  1K83 J;  3OMY A;  4CA0 A;  4CO8 A;  3OYG A;  3UR3 C;  3GZ6 A;  2R7X A;  5EZH A;  4ON0 A;  2MH2 A;  5FJ8 J;  1AA7 A;  2JPB A;  3OYL A;  2NNY A;  2DPU A;  4PJ0 C;  3D5L A;  1D0Z A;  4XRS G;  4M3B A;  5E3L A;  1PP7 U;  2ID6 A;  4PSW A;  3IH4 A;  5DCM A;  2HOA A;  5IP6 A;  2RVC A;  3TBI A;  2W84 A;  1V4R A;  1BR1 A;  2VQH A;  3VEP A;  3QU6 A;  2K9S A;  1FSH A;  1B9M A;  4XBF A;  2L9R A;  2R5Z B;  2E36 A;  4B09 A;  2VXZ A;  3IKV A;  5LEJ A;  5LFA A;  3MCZ A;  2H1L A;  3GWZ A;  4U7B A;  2GXA A;  2FQ3 A;  3WGG A;  1GVD A;  2BY0 A;  5EGO B;  1X1D A;  4AIH A;  1JUP A;  2X48 A;  2AHQ A;  2ZBK A;  1HF0 A;  2CUZ A;  2QQ9 A;  3O3K A;  3CMA I;  1IF1 A;  3W2A A;  2PMZ N;  1W0T A;  1VTN C;  2QF7 A;  4X6A J;  1TWH J;  1R1U A;  2NRA C;  2A05 A;  3N05 A;  3REO A;  3K4B A;  5BOX A;  1WJB A;  3DKY A;  1P92 A;  1FC3 A;  3FXK A;  4P55 A;  3RKY A;  1RNL A;  3RKX A;  1N78 A;  2P0W A;  3MZH A;  4ZTJ A;  3S3M A;  1YOV B;  2QYO A;  3D5S C;  3AL0 B;  1MBH A;  2QSH X;  4UUT A;  1TQI A;  4HOB A;  2EFW A;  4HX7 A;  3OSF A;  2PEX A;  2GWR A;  3DEE A;  1H89 C;  3FZV A;  1ZGW A;  4HW0 A;  1Q1H A;  1XDU A;  1OKR A;  2R7V A;  2CFX A;  1RKW A;  3IRR A;  2R7Q A;  1MSE C;  1OIS A;  2K7L A;  3ZMZ A;  2LTP A;  1ONV A;  2DT7 B;  2JA6 J;  2KIQ A;  4Y7N J;  2STW A;  4KIG A;  1ZYR F;  1SD7 A;  2V1D A;  1U2W A;  3QOP A;  3H9G A;  2I10 A;  3HOY J;  2XKP A;  3CCV I;  4XOT A;  3SDB A;  5M5Y J;  1UHS A;  4RGX A;  3DF8 A;  3M07 A;  3ISP A;  2V1X A;  3PUB A;  4BL0 B;  1RUO A;  4N0B A;  3SZP A;  1IV8 A;  1DPR A;  3G71 I;  1HW5 A;  3ABU A;  3LA3 A;  2E71 A;  1FPQ A;  2OA4 A;  2H6C A;  2IA1 A;  2M4K A;  4BNC A;  3I4N J;  5J3L A;  1KU9 A;  2WBM A;  1X4P A;  4UVB A;  1SMY F;  1XCV A;  5BS6 A;  2PFB A;  1FOY A;  1MBJ A;  5FO5 A;  1TL8 A;  1BOA A;  1JUS A;  2XAQ A;  4KDP A;  1D5Y A;  2HGC A;  1UMQ A;  2O7O A;  2WTE A;  2QKL B;  4KJZ A;  2R0Q C;  2V1U A;  2DFF A;  1B4A A;  2A5W A;  2HOE A;  3VDX A;  1NHA A;  3ZR8 X;  5HS8 A;  2X1C A;  3FBN B;  3FMS A;  4UV9 A;  1KU3 A;  1YE9 A;  3HRT A;  1JGS A;  3PNV A;  1DPU A;  2L02 A;  3RKW A;  3CZ6 A;  4I7H A;  5LEK A;  4M6X A;  3WTW C;  3R61 A;  3H0G J;  1LEA A;  4JP0 A;  1ERD A;  3HEF A;  1RR7 A;  2CO5 A;  1PDN C;  4UY8 I;  4QPO A;  2EZL A;  1JHH A;  1RR8 C;  4GYI A;  2ICW G;  4Q47 A;  3MEX A;  3FHN A;  2NNN A;  3RI4 A;  3KYD B;  1K61 A;  2M1B A;  3ERM A;  3C2B A;  3TGN A;  2NAZ A;  4NQW B;  4LB5 A;  2FF4 A;  5DUK A;  3OYM A;  2AQF A;  2FX0 A;  2FNP A;  4KT6 A;  5JLW A;  5L3D A;  2HKO A;  4QLC U;  2XGE A;  2WY8 Q;  2VPL A;  3MKZ A;  5B3S H;  1H9T A;  2LR8 A;  1S9H A;  3OV8 A;  4I99 C;  4KUM A;  1ODD A;  1Y39 A;  5ILU A;  3JAM K;  2V6C A;  1N75 A;  4LD5 A;  3TO9 A;  2ME6 A;  4B8X A;  3HGY A;  3U21 A;  2E35 A;  3E6B A;  2XAH A;  4L5I A;  1FYM A;  2O6G E;  4C2U A;  1ZR4 A;  2MLG A;  2PMH A;  4ZDO A;  2DMU A;  3A02 A;  1PUE E;  1YS7 A;  1VQ8 I;  3FM5 A;  3OS1 A;  2P8T A;  4XNF A;  2OAZ A;  5IP7 J;  4EM1 A;  1KYZ A;  1S6L A;  1R1V A;  1PUF B;  1ZEL A;  1GXQ A;  1EV7 A;  2IA0 A;  5L3E A;  1X3Z B;  2VBW A;  2LD5 A;  2EH3 A;  5J1R A;  3WGH A;  4RB3 C;  1W36 C;  4LLN A;  4HLY A;  1G2H A;  1E2X A;  2H09 A;  5J4V A;  4KNY A;  1OLT A;  3BR1 A;  2NVY J;  2Q0O A;  1JKQ C;  4DZJ A;  4PZJ A;  3KZY A;  3H92 A;  3S3N A;  2L4A A;  4RB2 C;  1WI3 A;  3F8B A;  3Q9S A;  2JJ7 A;  4PGG A;  3RKQ A;  3IP4 B;  1Z7L A;  4CCO A;  2M34 A;  3ROU A;  3J7A Y;  1Z3X A;  2BHZ A;  1EF4 A;  2R4G A;  3C7J A;  2CQK A;  2DJI A;  2ZME A;  1P9Q C;  2KQR A;  3KX2 A;  3VOD A;  1I3A A;  1UFM A;  2MBF A;  1F5T A;  5CVU A;  3B73 A;  2HYG D;  2FXA A;  3DP7 A;  2VI6 A;  3GXO A;  4X0G A;  3CCQ I;  4BUP A;  3DFG A;  2NXN B;  4M73 A;  4N4N B;  1W7P A;  4MO7 A;  1XMX A;  2N8G A;  1ITY A;  2R5Y A;  1T08 B;  2YS9 A;  4DW6 A;  1U9N A;  5FLM J;  2CQQ A;  4XKW A;  3K6G A;  4UUS A;  2DMT A;  1JJ8 C;  3HZJ A;  2CW8 A;  1VND A;  2HU9 A;  1ZRF A;  3P9K A;  4PK4 A;  4EEF G;  1YFH A;  3G73 A;  2DN0 A;  1SFO J;  2VOP A;  3I59 A;  3NWT A;  4M9S A;  2K27 A;  4PCQ A;  4DYR A;  4XON A;  5L3G A;  1ULY A;  2VB6 A;  2DQR A;  2W25 A;  1U0J A;  3BR0 A;  5TGT A;  5BNG A;  1A5J A;  4I0B A;  3DEW A;  3KFW X;  2KIU A;  4KIC A;  4BEH B;  1MBF A;  1XTA A;  3VOE A;  2V9V A;  1KQ0 A;  1DU0 A;  2Y0S N;  4UXN A;  3T8R A;  2DMQ A;  2VPR A;  2GA1 A;  2NS0 A;  2FOK A;  2XRL A;  5B1A H;  4HV5 A;  3WG9 A;  1IZ1 A;  2EIJ H;  4RGR A;  5IYB J;  3VPR A;  1MND A;  2EV6 A;  4BDZ A;  5F0H A;  1Y8R B;  4HF1 A;  1XGN A;  4N9I A;  2G9W A;  4NNJ A;  2HOS A;  1WI9 A;  3CJQ B;  4BBR J;  5C4J J;  5DM7 F;  5L3B A;  2HPI A;  1K6O A;  2B0L A;  4K2E A;  5D6E A;  2EA2 A;  4IQ4 A;  3HL2 A;  2PJP A;  1BJA A;  3I64 A;  3BTC A;  2VQG A;  2GBY A;  4WWC A;  1FSE A;  4LIV A;  4HBL A;  1U8R A;  1U6G A;  3Q3S A;  3TDZ C;  1FLI A;  3IC7 A;  3EQL F;  5EYR A;  4KMU X;  4IO9 F;  5IT9 K;  1X2N A;  4P9F A;  3ECO A;  4Z2Y A;  1MBK A;  4OIQ F;  4E7Z A;  2FSW A;  2Q2E A;  2BW3 B;  1K78 B;  1G3Y A;  3F8N A;  3GYH X;  1IO2 A;  5D5U B;  4A93 J;  4AYB N;  2EV0 A;  3O8G A;  2DA7 A;  4NDL A;  1OR7 C;  4HNV A;  3CCL I;  4IHX A;  5FFZ A;  4CXF A;  3V8K A;  4ZDP A;  3L2Q A;  3VSK A;  1AWC A;  4OIP F;  4AM3 A;  4M72 A;  3QPH A;  3LAP A;  1MSF C;  1P4A A;  3G1L A;  1K4S A;  4IPA A;  4A0Z A;  1ETW A;  1R36 A;  2DDA A;  5GAH J;  1JJ6 C;  4BXF A;  2EPF A;  3F3X A;  1VZ0 A;  1T6S A;  2HDC A;  1ON2 A;  1A36 A;  1LEB A;  3EUH C;  5EF6 A;  2YSR A;  1O7F A;  1Y8Q B;  3M8J A;  1TBX A;  1T38 A;  2HYF A;  3OYH A;  3J7Y J;  1ZG1 A;  1MIJ A;  3S93 A;  4B44 A;  1XMA A;  2V9P A;  5HS9 A;  3AKZ A;  5IT3 A;  4D5C A;  4F7Z A;  3HSF A;  2O61 A;  2LC2 A;  4V2F A;  3S1M J;  3PNT A;  4HZF A;  3QPS A;  4HX8 A;  4QIW N;  3MAJ A;  3JRD A;  3L2R A;  4Q48 A;  4XKC A;  3GUD A;  1W5C C;  5DUI A;  4IL6 C;  3JRA A;  3DPU A;  1FNN A;  3HOT A;  2LNB A;  4RLF A;  2EFP A;  2L54 A;  3G4S I;  1S7A A;  4D7M A;  1ZR2 A;  2ZB9 A;  2CRG A;  2V79 A;  2Z99 A;  2BZT A;  1IUY A;  2W7N A;  4OMZ A;  1J75 A;  4MTE A;  4XLC A;  2Y75 A;  1VI0 A;  2L7F P;  1LE8 B;  4RAF A;  2MYS A;  2MD5 A;  1T39 A;  1YX3 A;  1XX5 A;  2LRD A;  2QM3 A;  2DCE A;  4JK1 X;  4ESJ A;  1MMN A;  3CUQ A;  3K1P A;  3RPU D;  5JFR A;  3KZI C;  3EYY A;  1OPC A;  5B5E C;  3JRE A;  4C2T A;  3R60 A;  4A3M J;  4LK0 F;  2NS8 A;  5LLQ A;  1X1P A;  2JSP A;  4MNU A;  2FBI A;  1O57 A;  1T56 A;  5LRS A;  5M3F J;  3EYI A;  3BTL A;  3HPH A;  2BE5 F;  4ZZD A;  5GP9 A;  5FB2 A;  2XAG A;  1XC5 A;  2VJ4 A;  2KIS A;  4A3C J;  2Z3Y A;  2K86 A;  3WGI A;  1TQM A;  1U5T C;  4HYE A;  1YW9 A;  5TRD A;  3L09 A;  1Z3Y A;  3F22 A;  2E1M C;  2KRC A;  2VON A;  2E19 A;  5HNF A;  2CWE A;  1WJA A;  5CJ9 A;  5CLS A;  6PAX A;  4BHC A;  1WJC A;  3BZ6 A;  4IF4 A;  5H2F C;  5CYV A;  2D5V A;  2ELJ A;  2HZD A;  2JTV A;  4EJU A;  1WHU A;  2DLL A;  1VF9 A;  3TW7 A;  1IN8 A;  1IN5 A;  1B1B A;  3RJP A;  1WJ5 A;  1ZHF A;  3QOD A;  2R7R A;  5GPC A;  2TCT A;  1WCM J;  2P5K A;  4CCL A;  5BPI A;  2HVQ A;  2JRM A;  5E1W A;  3NAR A;  1EKE A;  2X6W A;  3BG9 A;  2I5U A;  4IXA A;  1TNT A;  4BDY A;  1YX5 A;  1SMT A;  1R00 A;  4PFP A;  1SFX A;  1B8I A;  2GLO A;  4A3B J;  1DP3 A;  1UHW A;  2WV1 A;  3GEZ A;  2O3F A;  5EG0 B;  2L9V A;  2DTZ A;  5D4S A;  4HPQ A;  1BIB A;  3AG4 H;  9ANT A;  3BJA A;  3HUG B;  2ESH A;  2IJL A;  5FLV A;  3GFL A;  4L9J A;  1FP2 A;  2IVM A;  1SAX A;  2VKD A;  1P7J A;  1LVK A;  3ZQC A;  3HM5 A;  3I4P A;  2V1N A;  3FXJ A;  2JVH A;  2E1M B;  2L9N A;  4MEY F;  1T33 A;  3I58 A;  4A5M A;  4EGZ A;  4AIJ A;  1XD7 A;  2O0Y A;  4OAZ A;  4XLN F;  3L2C A;  3CD6 I;  5C3E J;  4BHP A;  3GLL A;  3H9J A;  3ZMV A;  5IY5 H;  5E3N A;  1RES A;  1RPW A;  1PYV A;  4G12 A;  5EEH A;  4Z6Y A;  2QBY A;  1IDY A;  1ACI A;  3E5Q A;  3PSI A;  4LLG F;  1ZH5 A;  5FD6 A;  3DBR B;  4DNC A;  4F52 A;  2NYX A;  1ZKG A;  3CO7 C;  2ZSI B;  3HRS A;  3OYN A;  4RDU A;  1TW2 A;  1Z6T A;  2IT0 A;  5F04 A;  2LVS A;  2EZH A;  3MKW B;  1MGT A;  3JRH A;  3H1C A;  1O3Q A;  2ZJP F;  3RZO J;  4GRI A;  3TKY A;  1B72 A;  1ZGA A;  2LSO A;  3BG7 A;  1HSJ A;  5F0C A;  2ZC2 A;  2HDW A;  4G6T B;  2J5P A;  2M5W A;  4E70 A;  4XMY A;  2X0L A;  3PO2 J;  1SD5 A;  4PJN A;  1ZN2 A;  1KON A;  2RNG A;  3MD2 A;  4PGH A;  4LG0 B;  2OD5 A;  1WQ2 A;  3J80 K;  3U2R A;  5DEQ A;  3HTU A;  3PM1 A;  5CKT A;  2KRH A;  2B9S A;  2CUJ A;  4U87 A;  3HIF A;  2HOT A;  2XVC A;  2H94 A;  4MIM A;  2OQR A;  3WU0 A;  3GBG A;  1IRZ A;  3H5N A;  1KQ8 A;  3X2Q H;  3ZOB A;  2KZG A;  3QP5 A;  4HF0 A;  3PFI A;  4AIK A;  3QYE A;  1JKR C;  1WVR A;  3TOA A;  3DTK A;  1FX7 A;  2PJR B;  4C3H J;  4I98 B;  2WY7 Q;  1BI1 A;  1G3T A;  1KA8 A;  4EJW A;  1IXC A;  1V5G A;  2CW0 F;  2BY1 A;  2FUG 2;  1XN7 A;  1GV5 A;  2Z5U A;  4XIC A;  4IX7 A;  1BW5 A;  5LHI A;  1L0O C;  5FKO A;  5LHG A;  2DXI A;  4H4K C;  1AOY A;  1E0E A;  1MMA A;  4Y15 A;  3GFI A;  4CZC A;  1Z9C A;  1WSU A;  4E4H A;  1JUM A;  2WB1 A;  3HOV J;  4HSR A;  2BEO A;  2KT0 A;  4B4C A;  2H1K A;  2LBF B;  3H3V K;  1FT9 A;  5KCM A;  2DA1 A;  1JT6 A;  1YJ9 I;  1QVU A;  2EIM H;  3TP0 A;  4A5N A;  4AC0 A;  1BC7 C;  1G4D A;  1H9G A;  1BBY A;  1YIO A;  1WKM A;  5ICC A;  4Q4Z F;  5FLX Z;  2FNA A;  2FE3 A;  2P6T A;  2HR3 A;  4BQA A;  4WXD A;  1JE8 A;  1R71 A;  1BI2 A;  2CG4 A;  1WWX A;  2BY2 A;  4DBR A;  2XF6 A;  3DXJ F;  5JHF A;  5DCM B;  2DA6 A;  1R9T J;  1XGO A;  5EEA A;  3H36 A;  4HDV A;  5FRM A;  1V55 H;  3BC8 A;  5A2Q Z;  2GQQ A;  2HXO A;  5LGU A;  3G2B A;  3TL4 X;  3AL0 C;  1LJ9 A;  1RZ4 A;  2FD5 A;  1LPQ A;  1OJL A;  5BQT A;  4E7I A;  1ZQ3 P;  1ZG3 A;  4ENN A;  2JZY A;  3BPV A;  4IZZ A;  1TT0 A;  4F93 B;  4D5F A;  4KMF A;  2XGC A;  1YO5 C;  1I39 A;  2VKE A;  3HOZ J;  2STT A;  3DTI A;  1B6A A;  1I6X A;  2LH9 A;  2P5L C;  4O5V A;  5DS9 A;  2ADU A;  1JKP C;  2P7C B;  3FXM A;  2A69 F;  3DCF A;  3CCU I;  2OTJ I;  2IXS A;  2V7F A;  1DP7 P;  2F48 A;  5FD5 A;  3BJ6 A;  1MNE A;  1ETY A;  2E2H J;  4Y17 A;  2R7O A;  3KLN A;  4N4O B;  4ETS A;  3GTK J;  1R58 A;  2D1V A;  2BVM A;  2VOD A;  2LLK A;  3P5J A;  1TWC J;  3WOD F;  3KET A;  1O3T A;  3KPH A;  3EUA A;  5ICG A;  2O8X A;  3BR2 A;  5FKN A;  2LRE A;  3HDD A;  1QZZ A;  2OV7 A;  2CV2 A;  2ZKZ A;  2E60 A;  4A3D J;  1SFE A;  4GFB A;  3UNG C;  3S15 J;  3PL8 A;  4CCN A;  2CV1 A;  2M30 A;  4Y4R A;  2YU3 A;  4IOC F;  5HLI A;  1V5F A;  1P6R A;  1SC7 A;  1P4X A;  2F5V A;  2XDV A;  3KZZ A;  1IXR C;  3DWL E;  4IHT A;  1FZP B;  3P9I A;  2FOW A;  2GIZ A;  4XOR A;  3K1M A;  2QWW A;  2M0M A;  3BR5 A;  2RRE A;  3GX4 X;  4ENJ A;  3EET A;  3KEQ A;  1D1B A;  3BLY A;  3S32 A;  1VQM I;  2LFB A;  1R4M B;  4BYY A;  5FRN A;  1OCZ H;  4A6E A;  4A6D A;  2XRO A;  1DGR M;  2DFH A;  4XKV A;  3AG2 H;  2Y0M A;  1OCR H;  2YX7 A;  3L7W A;  3CQZ J;  2QKM B;  2CFO A;  4LIU A;  2A6T A;  2XF7 A;  3ABT A;  1Z21 A;  1BW6 A;  4WK8 F;  2PN6 A;  2VKH A;  3CDI A;  4M3F A;  2M8G X;  2RV8 A;  1NG6 A;  2V4J C;  1W7P D;  3FK6 A;  1FOK A;  1S8N A;  1SFU A;  3MMY B;  1YTY A;  3E6C C;  3N4M A;  2VC0 A;  1KZH A;  4C9Y A;  3ERE D;  1OCO H;  3G3Z A;  1SEU A;  1R5I D;  2LKP A;  1R5H A;  2HTJ A;  4MFD A;  2VBY A;  4XLE A;  3W3C A;  2HYJ A;  4IRI A;  3M1E A;  2KLO A;  4YRV A;  2WWY A;  4CYD A;  1ZG5 A;  1U8B A;  2DI3 A;  3LL7 A;  3K70 D;  2ZCW A;  2LDU A;  1OYY A;  2PMZ A;  4XOP A;  2XB5 A;  3H35 A;  2L7K A;  2R92 J;  5TJJ A;  2RGV A;  3WE3 A;  1X19 A;  1ORK A;  2W24 A;  4BJT A;  2DA5 A;  2CS3 A;  2UWM A;  2DMN A;  4FAS D;  1KGS A;  4ZH4 F;  1K6Y A;  1IUF A;  2D2W A;  5CVI A;  2DA2 A;  2A5Y B;  1FBQ A;  4OIR F;  4U0Y A;  1V5E A;  3WG7 H;  2RAE A;  3CCE I;  2GXB A;  3K4M A;  1BI0 A;  2XGX A;  3RPQ A;  3KIO A;  2OPT A;  1WJF A;  1UEL B;  5IP9 J;  1RI7 A;  5KNL A;  1GT0 C;  3JRG A;  2QCO A;  2F5F A;  2RDP A;  1Y56 A;  1IV6 A;  1KU7 A;  1R4N B;  3OYI A;  2FU4 A;  3GTO J;  4LJZ F;  4KYW A;  1LVA A;  4M74 A;  2VC1 A;  4B43 A;  4R8H A;  1J9I A;  2P6S A;  2V26 A;  3JW4 A;  3NEU A;  3SDG A;  5F64 A;  1FEX A;  3JRC A;  4XID A;  2JWT A;  1WJE A;  4M6Y A;  2R93 J;  4EJO A;  3OIP A;  4U7D A;  4UVC A;  3FXO A;  2UXN A;  4CDG A;  1Z67 A;  5BPD A;  3GTM J;  4FE7 A;  2XPU A;  2KJB A;  4E7S A;  1XSD A;  2HEO A;  2P5V A;  2EIL H;  1E17 A;  1TNS A;  4LK1 F;  2WAE A;  1FYL A;  3NWS A;  1W5T A;  1I3Q J;  1U9O A;  2JT1 A;  5HLG A;  4OMY A;  4PDK A;  2K4J A;  3LNQ A;  1ZLJ A;  5L3F A;  2E1N A;  1HST A;  4GO1 A;  3VSL A;  4S0H B;  4FX4 A;  4MQ9 F;  4RA2 A;  4EM0 B;  2ZME B;  4H0E A;  1T98 A;  2CUF A;  3CMM A;  2AQE A;  1OMI A;  5J8C A;  4AD9 A;  2JSC A;  3RCO A;  4BE0 A;  3G1M A;  3I53 A;  4E6K G;  3HOS A;  3WHC A;  2VT2 A;  3PQK A;  2HQ5 A;  4C3J J;  1T0F C;  1W7P B;  1T95 A;  2M7B A;  4M3D A;  3ASN H;  5FGM A;  2NVU B;  3L2U A;  2R5Y B;  2AS5 F;  1D1A A;  3J81 K;  3BDD A;  3DV8 A;  3OOP A;  4UUS B;  4A3J J;  2X6Y A;  1ENH A;  3A2K A;  4JOM A;  1FY7 A;  4MHG A;  3GW2 A;  4YFK F;  4NHJ A;  4HDU A;  4KIS A;  3S1N J;  4YG2 F;  3WTZ A;  2IS2 A;  1REP C;  2UUZ A;  1XB4 A;  2DJN A;  4WF2 A;  3DQV C;  1TQP A;  2F2E A;  2E7X A;  3SXY A;  4BKX A;  1ZRD A;  3RDI A;  4OAY A;  2QLZ A;  4UV8 A;  3FX3 A;  2GOX B;  1RUN A;  3E6M A;  3OY9 A;  2QVO A;  2PLY A;  1HDP A;  3HHG A;  4M6V A;  1R23 A;  2YPR A;  2AO9 A;  3GFJ A;  3MZ8 A;  3DPL C;  1TW3 A;  1YG2 A;  3ZQG A;  4BGD A;  4R79 A;  2OF7 A;  1IAW A;  2G7U A;  4DYQ A;  2KIF A;  2KFD A;  3UKG A;  1VQ7 I;  2BXY A;  3S3O A;  4M3E A;  3IRQ A;  2JVG A;  2W00 A;  4HF2 A;  3TW6 A;  1OYW A;  1MH3 A;  5CVV A;  4PJL A;  3MKL A;  4B47 A;  1H8A C;  3CJT B;  2OCC H;  3R6S A;  4S05 A;  4FHT A;  4CCJ A;  3KCC A;  5LD2 C;  4BXX J;  3VYS B;  2KKO A;  1HW2 A;  1KYW A;  1UJ8 A;  5GTI C;  3QYB A;  2NVX J;  3BOQ A;  4YEJ A;  2CQN A;  1N77 A;  2XIG A;  4ZZL A;  1OQY A;  4KA4 A;  5K7F A;  2E5N A;  1IC8 A;  4BQO A;  1FP1 D;  1UST A;  4L9V A;  3HOW J;  2EZI A;  1P4W A;  5HDG A;  2ZJQ F;  5D5W B;  2M7A A;  3OYJ A;  2HI3 A;  4BS9 A;  3LSI A;  1S5L C;  3K9T A;  4IHW A;  4UNO A;  2DQL A;  3ZQH A;  1Y0U A;  1GHC A;  1MKM A;  3ZQF A;  3MFK A;  4YEL A;  2KL4 A;  3EDP A;  1O7L A;  3I5U A;  4HNT A;  3CME I;  1IGN A;  2VE8 A;  4XN0 A;  1GXP A;  1VQN I;  1GVJ A;  2ZO4 A;  3H5R A;  5DV5 A;  1KU2 A;  1Z1D A;  2PBI A;  3QWL A;  1AKH A;  3LWF A;  1U78 A;  2HS5 A;  4XLP F;  2M45 A;  2F4M B;  4MTD A;  1IN7 A;  2RC4 A;  5EJC A;  4B48 A;  4NUB A;  2ZXI A;  4XR6 A;  4IJA A;  5E8G A;  2WAD A;  1DQU A;  2MW8 A;  3K1N A;  1PJR A;  2O03 A;  2BHY A;  4AID A;  2JA5 J;  1BR4 A;  1RET A;  4W97 A;  1R6R A;  2GIV A;  2W57 A;  4G6Q A;  4HRI A;  4BE2 A;  1HLV A;  1OCP A;  2BW3 A;  2P7V B;  1G59 A;  2QZ8 A;  5E20 A;  2DFI A;  2OQG A;  2QSF X;  1UG2 A;  2FBK A;  3U1K A;  1J2X A;  3MQ0 A;  4U0W A;  1IN4 A;  2DFE A;  2XAJ A;  4HST A;  5FKK A;  1MMS A;  5DYM A;  3ZQI A;  1DGW Y;  1G3W A;  3CF2 A;  3R0J A;  2W1O A;  3B02 A;  2TDX A;  3FXU A;  1J09 A;  1FBU A;  4RAG A;  3JTG A;  3H0D A;  2E2I J;  1Z6R A;  5GAG J;  2KDO A;  3ZQQ A;  5HLT A;  2VAS A;  2OU2 A;  3T5X A;  1EA3 A;  2MH9 A;  3CCR I;  1J7K A;  3NQO A;  3WU1 B;  2RQQ A;  2NS7 A;  2M0C A;  3O2P E;  2M4G A;  2JA2 A;  3PO3 J;  2XRN A;  5J1Y A;  2Y48 A;  3CDL A;  5J4Y A;  2VBZ A;  4RLQ A;  1GV2 A;  5FRO A;  5D5V B;  2QQ8 A;  5CVR A;  2C6Y A;  4RB1 A;  2IBD A;  2DPD A;  2FEZ A;  3ELK A;  3KLO A;  2BY3 A; 
#chains in the Genus database with same CATH homology
 1RKW A;  1MSE C;  4IHV A;  2CU7 A;  4LOC A;  2LTP A;  2JA6 J;  2MG4 A;  4Y7N J;  2HOT A;  3D1N I;  4MIM A;  3GBG A;  5JLX A;  1IRZ A;  3HOY J;  2DA4 A;  2I10 A;  3ZOB A;  5M5Y J;  2GM4 A;  1UHS A;  1JKR C;  4BY1 J;  2K9N A;  4C3H J;  5IOY A;  2G0E A;  3LSG A;  2COB A;  1JT0 A;  3G1O A;  1GV5 A;  2LKX A;  4XIC A;  1BW5 A;  2ECC A;  1QPI A;  1X58 A;  2M9H A;  5FKO A;  3I4N J;  5J3L A;  1S7E A;  1IG7 A;  3M4O J;  1MBJ A;  1LFU P;  1JUM A;  1JUS A;  3HOV J;  5M5X J;  1D5Y A;  2KT0 A;  4B4C A;  1UMQ A;  2H1K A;  5FKL A;  3H3V K;  2O7O A;  2DA1 A;  1JT6 A;  2NVT J;  1QVU A;  1ZTR A;  2R0Q C;  3TP0 A;  4A3G J;  4AC0 A;  4QSH A;  1QVT A;  3BTJ A;  5E3O A;  2YU9 J;  4DYC A;  3B6A A;  2TRT A;  5EZG A;  1IDZ A;  2NVQ J;  3SFI A;  3H0G J;  1GUU A;  4JP0 A;  3HEF A;  1RR7 A;  1Z77 A;  4FIS A;  2O9L A;  2EZL A;  2XPV A;  3K2A A;  2DA6 A;  1R9T J;  4A3L J;  1AKH B;  1JTY A;  1K61 A;  3C2B A;  1FIA A;  5EEA A;  5M5W J;  1YRN A;  1FTT A;  2FX0 A;  2HXO A;  1H88 C;  5JLW A;  5F0F A;  2LK2 A;  2XGE A;  2EBI A;  2FD5 A;  1FIP A;  1OJL A;  2LR8 A;  5IOZ A;  2HXI A;  1ZQ3 P;  1CQT A;  5IYC J;  4XRS A;  2W48 A;  2ME6 A;  3HGY A;  3MN2 A;  3FK7 A;  1BL0 A;  1OCT C;  4D5F A;  2XGC A;  4I76 A;  2VKE A;  3HOZ J;  2HDD A;  5DTD A;  1ZR4 A;  2DMU A;  3A02 A;  1O4X A;  5DS9 A;  5IP7 J;  5EDN A;  1JKP C;  4A3F J;  2CJJ A;  3DCF A;  1PUF B;  5K7Z A;  1RKT A;  2XSD C;  4A3I J;  1ETY A;  2LD5 A;  2EH3 A;  2E2H J;  3RQI A;  5J1R A;  5J1U A;  3GTK J;  1G2H A;  1HDD C;  2LLK A;  2WB1 N;  4QTR A;  4IEJ A;  1TWC J;  3BR1 A;  2NVY J;  1JKQ C;  4DZJ A;  3NAU A;  5FKN A;  3BR2 A;  4RBO A;  3Q0W A;  3HDD A;  1WI3 A;  2JJ7 A;  3M3Y J;  1ETQ A;  1NK3 P;  3RKQ A;  4A3D J;  4GFB A;  3FKI J;  2M2E A;  3S15 J;  2M34 A;  3WHB A;  3GTP J;  1ZK8 A;  2ECB A;  2K9Q A;  1AU7 A;  1BA5 A;  1EF4 A;  3S14 J;  3IH2 A;  2Y30 A;  1VFC A;  4A69 C;  3S17 J;  2IEK A;  2KDZ A;  2VI6 A;  2DMP A;  2R7Z J;  3BR5 A;  3OOU A;  3S2D J;  4MO7 A;  2N8G A;  2LFB A;  1ITY A;  2FJ1 A;  2R5Y A;  1TC3 C;  2YS9 A;  4DW6 A;  1U9N A;  3K7A J;  5FLM J;  2L7Z A;  2CQQ A;  4UUS A;  4XK4 A;  2NOG A;  2DMT A;  1JJ8 C;  1I6H J;  1ETK A;  3CQZ J;  1VND A;  3BTI A;  1MH4 A;  1QRY A;  1OFC X;  4EEF G;  1LE8 A;  5IYD J;  1BW6 A;  2DN0 A;  1SFO J;  4M3F A;  4DYR A;  1MBG A;  2ME0 A;  2M8G X;  3A01 B;  4A3E J;  1IJW C;  3FK6 A;  3BR0 A;  5BNG A;  1TWG J;  1FJL A;  1A5J A;  1HOM A;  3DEW A;  2X9D A;  1MBF A;  3FIW A;  3TP3 A;  4CYC A;  1DU0 A;  1MBE A;  2Y0S N;  3FIS A;  1I50 J;  2DMQ A;  2VPR A;  4MFD A;  5F08 A;  2XRL A;  2HYJ A;  4L5E A;  1U8B A;  1WH5 A;  3Q0U A;  3VPR A;  5IYB J;  5F0H A;  2FQ4 A;  2XB5 A;  2VKV A;  1B8I B;  2R92 J;  2E1O A;  1Y1V J;  3HKZ N;  2HOS A;  5C4J J;  3QPL A;  4BBR J;  3HOX J;  2DA3 A;  1APL C;  1ORK A;  1YRN B;  2DA5 A;  2DMN A;  2WAQ N;  5IPA A;  2MGQ A;  3BTC A;  1IUF A;  2DA2 A;  2GBY A;  3SJM A;  3Q3S A;  2YUS A;  2RAE A;  3MVP A;  5EYR A;  2L7M P;  2OPT A;  5IP9 J;  2ELK A;  1GT0 C;  1X2N A;  3JRG A;  2JA8 J;  2IAI A;  2QCO A;  3IV5 A;  1MBK A;  1WH7 A;  1IV6 A;  1TWF J;  3Q0V A;  3GTO J;  1JTX A;  4JX4 A;  1BJZ A;  4A93 J;  4AYB N;  3S1R J;  3BG3 A;  3O8G A;  2DA7 A;  4NDL A;  3JRI A;  4HNV A;  3SDG A;  1FEX A;  3JRC A;  1ETX A;  2XGD A;  2JWT A;  4XID A;  4IHX A;  3JR9 A;  1E3O C;  5EG0 A;  4FCY A;  1MSF C;  4X1E A;  3G1L A;  2R93 J;  1ETW A;  1JJ6 C;  4I6Z A;  3S2H J;  1POG A;  2X6O A;  4JYK A;  3GTM J;  4FE7 A;  1B72 B;  2MSY A;  2XPU A;  2R5Z A;  4B3A A;  5EF6 A;  2CQX A;  3W6V A;  5M3M J;  3S16 J;  4W1U A;  2H8R A;  3OSG A;  4C2M J;  4D7N A;  1I3Q J;  1GDT A;  1U9O A;  5EGO A;  3LNQ A;  3HOU J;  1X2M A;  4S0H B;  1F43 A;  1HCR A;  1Q1V A;  2L0K A;  3JRF A;  4D5C A;  2CUF A;  2XPW A;  3GTL J;  4V2F A;  4A3K J;  2VUM J;  1SAN A;  3S1M J;  3QPS A;  3G1M A;  4QIW N;  3JRD A;  3LOC A;  4MLO A;  2EQR A;  3WHC A;  2HQ5 A;  4C3J J;  1DU6 A;  3CCY A;  3BR3 A;  3JRA A;  4BY7 J;  1F36 A;  4M3D A;  2R5Y B;  3BG5 A;  3GTQ J;  4D7M A;  4UUS B;  4A3J J;  1ZR2 A;  3HB9 A;  2ZB9 A;  2EZK A;  1ENH A;  2LY9 A;  3L1P A;  2CRG A;  1Z0X A;  2LP0 A;  3S1N J;  1VI0 A;  2L7F P;  1LE8 B;  3HGG A;  2DJN A;  2B63 J;  4AUX A;  3LSP A;  4BKX A;  3LSJ A;  5FKM A;  1W0U A;  1A6I A;  2Y9Y A;  1HDP A;  5C44 J;  4JX5 A;  2JA7 J;  3OIO A;  2Y9Z A;  4M6V A;  5C4X J;  4CYC B;  3JRE A;  2Y2Z A;  2AO9 A;  4A3M J;  3S1Q J;  2NS8 A;  3ZQG A;  4BBS J;  2OF7 A;  4DYQ A;  1T56 A;  3O8H A;  5M3F J;  3UKG A;  3BTL A;  1TWA J;  4M3E A;  4M3G A;  5F27 A;  3TW6 A;  5GP9 A;  1MH3 A;  4XRM A;  3LSR A;  3MKL A;  1H8A C;  1XC5 A;  1JKO C;  5F1J A;  4A3C J;  2E2J J;  2O8K A;  3BT9 A;  4BXX J;  3TED A;  3BQZ A;  2E19 A;  4DZP A;  3A03 A;  2NVX J;  3A01 A;  3B6C A;  4B1R A;  2P81 A;  4FE4 A;  3ZQL A;  3GTG J;  3RZD J;  1ETV A;  2D5V A;  5K7F A;  2JK3 A;  1VF9 A;  1IC8 A;  3TW7 A;  3HOW J;  2XB0 X;  2EZI A;  1NTC A;  4IHY A;  5GPC A;  2TCT A;  3I4M J;  1WCM J;  2HI3 A;  3HBL A;  5HOD A;  1NK2 P;  4IHW A;  3NAR A;  5E3M A;  1K83 J;  4J19 A;  3BG9 A;  5EZH A;  3ZQH A;  5FJ8 J;  3IH3 A;  3CMY A;  1XG1 A;  3ZQF A;  1B8I A;  2GLO A;  2K40 A;  4XRS G;  1IGN A;  4M3B A;  4V2G A;  5E3L A;  4A3B J;  1JGG A;  2WV1 A;  1AHD P;  2ID6 A;  1XS9 A;  3E7L A;  3IH4 A;  2HOA A;  5EG0 B;  4FTH A;  1AKH A;  4Y52 J;  5IP6 A;  2DTZ A;  1U78 A;  3F0C A;  4C3I J;  3BQY A;  9ANT A;  1WPK A;  1FTZ A;  2K9S A;  3JRB A;  5FLV A;  2MW8 A;  2L9R A;  4MFE A;  2R5Z B;  1P7J A;  3ZQC A;  3HM5 A;  2JA5 J;  1RET A;  4W97 A;  1T33 A;  1P7I A;  1GVD A;  5EGO B;  5K7H A;  1JUP A;  1HLV A;  1OCP A;  2X48 A;  2AHQ A;  5C3E J;  1HF0 A;  5E3N A;  1RES A;  1RPW A;  4G12 A;  1UG2 A;  2JN6 A;  1IDY A;  1ETO A;  5FKK A;  3ZQI A;  1PUF A;  1LFB A;  5GPA A;  2E2I J;  1ZKG A;  2PMZ N;  1W0T A;  4RDU A;  2QF7 A;  4X6A J;  2Y31 A;  1TWH J;  5F04 A;  2ID3 A;  2LVS A;  4JX6 A;  2EZH A;  1Y1W J;  3JRH A;  3RZO J;  1B72 A;  2JMW A;  3BR6 A;  2NS7 A;  5F0C A;  3GTJ J;  1WGX A;  2M0C A;  3PO3 J;  5J1Y A;  3CDL A;  3PO2 J;  2CUE A;  3QQA A;  1MBH A;  4UUT A;  1GV2 A;  3OSF A;  4ABZ A;  1H89 C;  2IBD A;  1ZGW A;  3PM1 A;  1MNM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...