2Y0SN

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
total genus 13
structure length 64
sequence length 64
chains with identical sequence O
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y0sN00
5F1JA 2PMZN 3O8HA 3QQAA 3HOVJ 2LVSA 2HDDA 1ENHA 5FKKA 1FEXA 3G1MA 3HOYJ 4FE4A 3GBGA 5JLXA 3M3YJ 1B72B 3GTKJ 3VPRA 2EBIA 2ID3A 2FJ1A 3MN2A 5FKMA 1BW6A 2ECCA 4XICA 2L7ZA 4MIMA 1O4XA 3FIWA 3HDDA 1I6HJ 3BG9A 4FISA 1MBEA 2IBDA 2JK3A 3SJMA 4J19A 2E2HJ 2MSYA 2HOSA 1RKTA 3ZQCA 4MO7A 2NS8A 3C2BA 3S16J 5E3NA 5EG0A 5J3LA 1ZR4A 2XPUA 2Y9ZA 2R7ZJ 3OSGA 4IHXA 4RDUA 5IOZA 2ELKA 3BTCA 2Y0SN 4A3FJ 2MGQA 2K9SA 2O8KA 2DA5A 4FCYA 1AKHA 3LSPA 2HI3A 2HOTA 3ZQHA 2ID6A 1WPKA 3OIOA 3NAUA 5FKNA 1WH7A 3HOUJ 3BQYA 3IV5A 3TW7A 4IHWA 4A3CJ 4L5EA 4M3GA 3I4NJ 3GTMJ 4X6AJ 5C44J 5FLMJ 3BR0A 1HCRA 1HF0A 5IPAA 1FTTA 4A93J 2DA2A 3IH3A 4IHYA 2EZIA 3FK7A 4LOCA 4UUSB 1Q1VA 4GFBA 2NVQJ 2HXIA 2DMUA 4DZJA 2NS7A 3L1PA 3H3VK 2COBA 5F0CA 5GP9A 5F0FA 5M3FJ 4B4CA 2GM4A 2JA5J 2IAIA 4Y7NJ 3HM5A 3Q0WA 2K9QA 5EGOB 1WI3A 2CUEA 5C4JJ 3E7LA 2LFBA 1U8BA 5IP6A 5J1YA 4FE7A 2JA6J 2XGCA 5C4XJ 2WAQN 3TP3A 3HBLA 2H1KA 1FIPA 4A3EJ 4A3IJ 2XSDC 4BY7J 4BBSJ 5IOYA 1XS9A 2QCOA 1RKWA 3H0GJ 2R5YA 2LY9A 1PUFA 4QIWN 3RZDJ 2FX0A 2LD5A 4DYCA 1TWAJ 3CDLA 4B3AA 4BKXA 4JX6A 1SFOJ 3OSFA 3F0CA 3ZQFA 5HODA 1G2HA 2E2JJ 1EF4A 3GTJJ 1MNMC 1APLC 4MLOA 3ZQIA 5EG0B 1RPWA 3BT9A 1VNDA 1NTCA 2X48A 2DMTA 2XRLA 3GTPJ 3LSGA 1OCTC 4I76A 4A3LJ 3A02A 1E3OC 1AKHB 3GTOJ 2DTZA 2EZHA 3S17J 1U9OA 3TW6A 2FQ4A 4D7MA 1I50J 1JKOC 1ETQA 2G0EA 3RQIA 1JUPA 4DW6A 2DMNA 1ZR2A 3MKLA 4DYRA 2ME0A 4XRSA 5F08A 3S1QJ 2K9NA 1TC3C 3LSJA 3JRCA 3A03A 4MFDA 1RETA 2JN6A 3GTQJ 5IP7J 3JRBA 2DA7A 5GPCA 4CYCA 3G1LA 2AHQA 3S15J 1ETYA 1GV2A 3BTJA 2E2IJ 3PM1A 1IG7A 4NDLA 2DA4A 3IH4A 3UKGA 5M5XJ 3O8GA 2R0QC 2NVYJ 2TCTA 3JRHA 2I10A 3BR5A 5E3OA 4XRMA 3S14J 2ZB9A 1OJLA 1JKPC 2H8RA 1F36A 2DMPA 2DMQA 3DCFA 1H8AC 1BJZA 5F27A 1ORKA 2D5VA 5C3EJ 1JUSA 4D5CA 4M3EA 2OF7A 2L7FP 2NVTJ 3LOCA 1RESA 1XC5A 2O7OA 1IDYA 3K2AA 3D1NI 1FTZA 1GDTA 5EYRA 1W0UA 3LNQA 2LLKA 4M3DA 1TWFJ 4XIDA 2AO9A 2TRTA 1MBGA 4IEJA 4A3GJ 1FIAA 1JUMA 1YRNA 3BR3A 4MFEA 1MBKA 4DYQA 2O9LA 1SANA 1VF9A 2VI6A 2WV1A 4Y52J 3ZQLA 1ZTRA 3JRIA 2RAEA 3HOZJ 1DU6A 3BTLA 1ZQ3P 3I4MJ 3S1RJ 1GV5A 1B72A 3M4OJ 3RZOJ 2CRGA 1XG1A 2CQQA 3HOWJ 2DA6A 1TWCJ 1WGXA 1Y1VJ 5F04A 2CQXA 2E1OA 4W97A 1IV6A 3MVPA 9ANTA 2XGDA 1F43A 4QTRA 2R92J 1JTXA 1X2MA 3ZQGA 2HXOA 2M34A 5EZGA 3S1MJ 1DU0A 1QVUA 4S0HB 4M3BA 5JLWA 1MSFC 1B8IA 1HOMA 4C3JJ 1JJ8C 5E3MA 3HKZN 3S2DJ 1HLVA 3BG3A 4CYCB 2XB0X 5J1RA 2Y2ZA 1AU7A 2EZLA 2CUFA 3S1NJ 3DEWA 1P7JA 2XPVA 1WH5A 4A3JJ 2Y30A 1ETXA 1QRYA 1MBFA 3K7AJ 3OOUA 4JX5A 1RR7A 3JRFA 2Y9YA 3Q0VA 3NARA 5K7FA 2M9HA 2GLOA 1ZKGA 3LSRA 2MG4A 3BR6A 1UMQA 3CMYA 4BXXJ 2LK2A 1MBJA 2W48A 1OFCX 2KDZA 4A3MJ 2JJ7A 3G1OA 5K7ZA 5DTDA 5FKOA 1OCPA 2M0CA 4BBRJ 2N8GA 1U9NA 2XPWA 2L0KA 5IYBJ 1K83J 4UUSA 1MH4A 3HB9A 1POGA 2ECBA 5EZHA 3HGGA 1TWHJ 1X2NA 2L9RA 2CU7A 5BNGA 3JRAA 5EEAA 3JRGA 1JKRC 1D5YA 5EF6A 1U78A 1YRNB 2NVXJ 5EGOA 1JJ6C 1LFUP 5FLVA 3Q0UA 2HQ5A 2HYJA 4AUXA 4G12A 4BY1J 1Z0XA 4M6VA 4RBOA 4V2FA 1JGGA 3B6AA 2DJNA 5M3MJ 2HOAA 5GPAA 4JX4A 1Z77A 3A01A 4DZPA 3ZOBA 3JR9A 1W0TA 3BR1A 2OPTA 4D5FA 5EDNA 1H88C 3HEFA 1FJLA 2JA8J 3BG5A 1IUFA 3B6CA 1GVDA 2FD5A 2GBYA 4V2GA 1H89C 3BQZA 2K40A 1MH3A 2R5YB 1P7IA 4UUTA 1PUFB 2JWTA 1B8IB 1LE8A 1I3QJ 3PO2J 4C3IJ 1MSEC 1VI0A 1ZK8A 3HOXJ 3CCYA 2DA3A 1QVTA 4C3HJ 1IGNA 1T56A 2VUMJ 4A69C 2M2EA 2WB1N 2M8GX 4A3BJ 1LFBA 2Y31A 4FTHA 2EZKA 1ETKA 2YS9A 2R93J 1IJWC 2R5ZA 1WCMJ 1IDZA 1ZGWA 4C2MJ 1Y1WJ 1TWGJ 1T33A 2X6OA 3FKIJ 3SFIA 3FK6A 5FKLA 1VFCA 1JT6A 4XRSG 1UG2A 3JREA 1R9TJ 2LKXA 1UHSA 3TP0A 2X9DA 3GTGJ 2LTPA 3FISA 3QPLA 2JMWA 3WHBA 4HNVA 3HGYA 2DN0A 4X1EA 1IC8A 5FJ8J 3CQZJ 4AC0A 3Q3SA 4AYBN 3BR2A 5K7HA 2EQRA 1GUUA 2YU9J 1HDDC 2VPRA 4QSHA 2IEKA 1JTYA 2DA1A 2KT0A 4W1UA 1MBHA 5F0HA 4I6ZA 1QPIA 2MW8A 3S2HJ 2P81A 4ABZA 3QPSA 1GT0C 2ME6A 2JA7J 3RKQA 1A5JA 2VKEA 2E19A 5DS9A 1S7EA 5J1UA 3IH2A 2XGEA 1IRZA 5IYCJ 3A01B 1X58A 4EEFG 5E3LA 4A3DJ 2YUSA 2XB5A 4D7NA 3JRDA 4XK4A 2B63J 2NOGA 4JYKA 1K61A 2LR8A 1HDPA 1CQTA 1JT0A 1BA5A 1JKQC 1ITYA 1LE8B 5M5WJ 2CJJA 4A3KJ 5IYDJ 1BL0A 3GTLJ 3PO3J 1ETOA 2L7MP 1AHDP 5IP9J 3W6VA 1ETVA 2EH3A 5M5YJ 4B1RA 3TEDA 4IHVA 3BTIA 4JP0A 1ETWA 2VKVA 3SDGA 1NK2P 4M3FA 1A6IA 2LP0A 1NK3P 3WHCA 2QF7A 2R5ZB 1BW5A
chains in the Genus database with same CATH superfamily
2PMZN 1Y39A 2VOPA 3LWFA 1ENHA 5FKKA 1FEXA 1G3WA 2X85A 4FE4A 1B72B 3E5XA 3LMMA 3MD2A 1LNWA 2FJ1A 4BHCA 3BLYA 5TRDA 4IRGA 3EUAA 4U87A 3AG3H 3NQOA 1R4MB 3BG9A 4FISA 2IBDA 1UB9A 2DQLA 2JK3A 4E7HA 3ONQA 3TOBA 2HOSA 1RKTA 3KLNA 3GZNB 5E8GA 3WG7H 3S16J 2K7LA 1ZR4A 3ELKA 5L3DA 4RB2C 1OYWA 2Y9ZA 1K78A 3G73A 3OSGA 3M07A 5IOZA 2WV0A 2CGPA 3WGIA 2K9SA 3UNGC 2DA5A 5CVRA 5FFXA 3CTAA 5A2QK 1YJ9I 2M1BA 3MEXA 2IW5A 3FMQA 1R71A 1WPKA 3OIOA 2Y69H 4IHTA 3HOUJ 3HTUA 3BQYA 3C2HA 1SFXA 3IV5A 3D0SA 3QU3A 4AVZA 1MW7A 4L5EA 2GQQA 2FBHA 5F64A 2H1LA 4X6AJ 5FLMJ 2W00A 2WY8Q 5LHGA 3CUOA 3W6KB 1MJAA 4A93J 2DA2A 2ICWG 4IHYA 1UHWA 1FP1D 3KETA 5FLXK 4PFPA 1X3UA 4LFUA 3R4KA 5HDKA 5F0CA 4ENNA 5F0FA 2R7QA 3C18A 4XN3A 2CWEA 3IAM2 2JA5J 1U5TA 3IP4B 1U8RA 4O3MA 4Q5SF 4UVAA 2HQAA 3TO7A 1WI3A 5JVGF 2E5NA 5C4JJ 3E7LA 5IP6A 1YW8A 3V7RA 2OD5A 2WAQN 3IHUA 1BI3A 1DGWY 3CUQC 1WJFA 2XSDC 3KEQA 1FC3A 3CCSI 1FYKA 4BY7J 2WC2A 4KISA 2VJJA 4CUGA 1T39A 4YFXF 1XS9A 2BY0A 1RKWA 2QCOA 3BDDA 5HNHA 3BJAA 1PUFA 3F72A 4LG0A 4G7OF 3PFIA 1J5YA 3RZDJ 4UB6C 5KNLA 2UUZA 3HOTA 4CH7A 1UELB 1IF1A 5GADJ 1KONA 3NWTA 4L9NA 4XM3A 2VQGA 4UHTA 5DM7F 3EUKL 4C9YA 4WF2A 3L9FA 2V6CA 3FXOA 2CMPA 5TJJA 3NRVA 1APLC 4ENJA 5EG0B 2LH9A 4M73A 3BG6A 3BT9A 2OC6A 2X48A 4ZDPA 3BOQA 1IZ1A 3PSIA 4A3LJ 2NNYA 1FZPB 3K2ZA 4GXOA 1BIAA 2E7XA 1Z21A 2HGCA 3V4GA 1O3RA 2EZHA 3S17J 1U9OA 4II2A 2HFHA 4XN0A 3VOEA 1FWZA 1X1DA 1WI9A 3ZXSA 1GVJA 2KISA 2M45A 3RQIA 2ZJPF 1JUPA 2KP6A 2KZVA 2MH9A 3MKZA 3WTVC 2QZ8A 3MKLA 4XONA 2X6YA 1R22A 3LA2A 3LSMA 1TC3C 1G3SA 3QYEA 2VASA 3A03A 4HNUA 2E7WA 1SD6A 2DXIA 4UNOA 2JN6A 3JRBA 2E71A 5J8CA 4QWQA 2M0MA 3V42A 5GPCA 1XN7A 3KYLA 3R60A 5L3GA 2ETHA 3G1LA 2AHQA 1XGSA 1FYMA 3OYJA 1ETYA 1GV2A 2E2IJ 3I5UA 4GCVA 2BZTA 1EH8A 4MNUA 3BR5A 2BY1A 3WTXC 5BMZA 2PJPA 3OYEA 4HAMA 2R7UA 1CGPA 2NS0A 4OINF 2I5UA 1S8NA 4RS8A 1YOVB 3DCFA 4CZCA 4A5NA 2R7DA 5D5WB 1ORKA 1SVOA 2A69F 4RAZA 2H94A 2MH2A 3SZPA 4XKVA 2OF7A 5D8LB 2XIGA 4PCQA 2ZNYA 4WWCA 2PMUA 3ZMVA 3K2AA 3D1NI 5EYRA 4B09A 3LNQA 3ECHA 4AU7A 1LEBA 4CCLA 4M3DA 2EJRA 4XIDA 2LC2A 1UCRA 5AIQA 1BI2A 2XVCA 2IT0A 1MBGA 2VJ5A 4R1HA 4U0YA 1YRNA 3KP6A 5KK1A 1ZG5A 3DKWA 3PNTA 4II3A 2O9LA 3MZHA 2DK8A 5LEJA 2KHMA 4ZYHA 2RAEA 5JHUA 3A4CA 1DU6A 4FASD 2K4JA 1X4OA 5K1YA 1XCBA 1O3SA 1ONVA 1Y6IA 3RZOJ 3WGGA 3KP7A 2CQQA 5KHDA 1EH6A 5DCFA 3HOWJ 3FXUA 3G3ZA 1TWCJ 1WGXA 2FF4A 2CQXA 4W97A 4JBAA 3MVPA 3CDHA 3ERED 4XLAA 3KP4A 4G7HF 5L3EA 2X1CA 1QU3A 5CLSA 1R1VA 4S0HB 2EIJH 5JLWA 4C3JJ 2Z1DA 4LK0F 3HKZN 2NRAC 3H35A 5K5QA 2Y2ZA 1BJAA 1GLNA 3DTEA 5D8KB 3S1NJ 3DEWA 4ZDLA 3ZR8X 2XPVA 3HRSA 5LFAA 2QUFA 2UXXA 4KUMA 2V1DA 1SAXA 4A2UA 2VT2A 2K9MA 1MBFA 3K7AJ 1HSJA 1OMIA 3F8MA 2IVMA 2O61A 1SMYF 2IS2A 2BOLA 3Q0VA 1YG2A 2LG4A 1VQNI 2GLOA 3ZMSA 4I0AA 3I59A 3GO5A 3LSRA 2MG4A 3BR6A 1UMQA 3CMYA 3JTGA 4BXXJ 5JHFA 1WQ2A 3I55I 2OTLI 3HIFA 2DFFA 3M9AA 2CG4A 1FOWA 4YIRX 3D5RC 2BGCA 3DEUA 4ESJA 2M0CA 3HSRA 4QPQA 3I0TA 4WK8F 2L0KA 2O0YA 4DQ2A 4IRHA 4IO9F 1MH4A 1IN5A 1POGA 1U2WA 3REOA 2AXTC 2DI3A 1TWHJ 1TNSA 3OS0A 2V6EA 1K4SA 3EUHA 3HPHA 3JRAA 1W36D 1XSDA 2XRNA 1KU7A 2NVXJ 4GYIA 4CXFA 3Q0UA 2RVCA 4RGXA 3OY9A 4AUXA 3AG2H 1R1UA 1BIBA 3CCJI 1HW5A 3JSPA 2VJ4A 3G71I 1QNTA 1T0FC 1R00A 3B6AA 4EV0A 2DJNA 5BPDA 5M3MJ 1UZCA 1YLFA 3E97A 1MDMA 3V8KA 2HOAA 4KDPA 4JX4A 1IO2A 2L54A 3BY6A 1P92A 1ZGAA 3BJ6A 4DZPA 3A01A 4PGGA 1UAAA 2A68F 2GIVA 3ZOBA 1TT0A 2WB1A 3VSKA 4D5FA 5EDNA 1H88C 3HEFA 5IT9Z 2JA8J 2HEOA 1OQYA 2VL8A 3RJPA 1ULYA 2GXBA 3B6CA 2XC7A 2ESHA 4PJNA 3CJRB 3J7ZI 1H89C 2XAFA 1MH3A 1N77A 2W85A 1P7IA 4WXHA 1PUFB 3F22A 4EJTA 3P7NA 1ZG1A 2JWTA 4A6DA 1QHHD 3PO2J 3HOXJ 2DQRA 1VQ4I 2FQ3A 4GGGA 2DA3A 1QVTA 2IXSA 4M74A 4C3HJ 2RN7A 3O6BB 3CC2I 1A04A 4IPAA 4A0XA 4XQFA 2VODA 2WB1N 2M8GX 4FTHA 2LY2A 3H92A 4P9FA 3BZCA 3FBNB 1IJWC 4S04A 5D5XB 2R5ZA 1ZGWA 1Y1WJ 1TWGJ 2X6OA 4HBLA 1RC9A 3MQ0A 3AG1H 4B3XA 2ISYA 5FKLA 5H6QA 1VFCA 1JT6A 2Y48A 1UG2A 5H20A 3JREA 2FNPA 2MLKA 1R36A 4E6KG 2P7VB 3PUFA 5A2QZ 4F92B 3LA3A 3SZTA 3TP0A 3GTGJ 2JMWA 2HPIA 2GWRA 4X1EA 2DDBA 2JUGA 3M7GA 5FJ8J 3DPTA 3DU6A 2Y75A 4UVCA 4BL0B 4ENKA 3QAHA 5E17F 2EQRA 4EM1A 4MEYF 1JI8A 2O03A 2QLZA 1JTYA 4EM2A 2HOEA 1QPIA 1WJAA 2X6WA 3DXJF 1S3JA 3GFLA 2VJIA 4L9VA 4XMYA 1LFPA 2RQQA 3RKQA 2IPQX 3PUBA 1G3TA 3FMSA 2VKEA 2E19A 1XSVA 1YJWI 5FLXZ 5J1UA 5DCMA 3ZMTA 1IRZA 4EJVA 5IYCJ 5F6FA 1XTAA 2IS1A 4ASNA 4EEFG 3OR1C 4KIBA 5E3LA 4A3DJ 2P5KA 4H4KC 3GW2A 3JRDA 3CO7C 1OR7A 5LHHA 4F52A 3IC7A 3C1DA 4N9IA 3S93A 2R7TA 2Q8KA 3QP5A 5B1AH 3L00A 4Y4RA 5BOXA 1K61A 3TBIA 1JE8A 1VQKI 3RYRA 3LFKA 3CCMI 2JSPA 1LE8B 2W4SA 3MFKA 5M5WJ 4XLNF 1LPQA 4A3KJ 2OTJI 1D1AA 3GTLJ 5IYDJ 2Z5UA 2HU9A 3M8FA 4M9XA 2D45A 3CLQA 5B3SH 4CICA 5E1ZB 2HPMA 1N75A 3CESA 3DBLB 1IXSB 1QBJA 4Q48A 4LB5A 2ZKZA 5EEHA 5M5YJ 3DLLF 1ZARA 5KAFC 2HS5A 2ZSIB 4BHBA 2A5WA 2GZWA 1ZLKA 3LA7A 4GDFA 1A6IA 2RNJA 2LBFB 1ZHFA 2LP0A 4HQEA 1ZREA 1DP3A 3QQAA 5J4YA 4S05A 4L18B 4IHSA 2CW8A 1DGRM 1G8XA 1W5TA 3M8JA 2DT7B 2V9VA 5ILUA 1PDNC 4IQJA 2MBFA 1LDKB 3GTKJ 2V1XA 2EBIA 5GTIC 2F5FA 4RA2A 1XPXA 4XICA 1O4XA 3FXKA 2F5EA 2V79A 5FRMA 2NOJB 3HHGA 2IRFG 3FXMA 3S3NA 1BI1A 3LQQA 3E6CC 2YSRA 2E2HJ 1H9TA 1WJEA 1KU2A 1KQ0A 4M6YA 5ICGA 2DFIA 5EG0A 1OCCH 4G6DA 4N0BA 4IL6C 2VOOA 4IHXA 2MFZA 1UG0A 2ELKA 3KP5A 2RQPA 4XLCA 2MGQA 1LJ9A 2YU3A 4XOTA 2M7BA 1VQ6I 1MMGA 2FXAA 4KN7X 4XLEA 4FCYA 3CD6I 1IV8A 2XSJC 1TW3A 4I0BA 1Z7LA 3K4NA 1TQIA 3JAMK 3NEUA 3K9TA 4CCJA 3I59B 2G9WA 3JCUC 5JFRA 3CUQB 1SC7A 2Z33A 2DK5A 3TKYA 3GTMJ 1P4WA 3BR0A 1FSHA 4RLQA 2KIUA 3W2WA 3L2WA 3IH3A 3D5SC 5HNFA 1TNTA 2VIXA 2DBBA 4JQFA 1Q1VA 1V55H 3R61A 4GFBA 3S3OA 2PEXA 1F5TA 2NS7A 5LGTA 5GP9A 4LIUA 1Z3XA 5DUIA 2VE8A 2GM4A 1Z6TA 3L2UA 1R4NB 3TDUC 4OU0A 3Q0WA 1LQ1A 1VQOI 4BDZA 2CQKA 3DWLE 4CGZA 2LFBA 2WAFA 3KZZA 1FOXA 3T0YA 2DCEA 3X2QH 3GYHX 2EINH 1BI0A 3HBLA 2H1KA 1FOYA 4A3IJ 1GXQA 1YIOA 2KRCA 3L2CA 3BC8A 1YITI 4CHUA 3CF5F 1YW9A 1MDMB 5J40A 3TMOA 2R5YA 2LY9A 2ZMEC 2IA0A 2FX0A 3KIOA 2L3DA 1W1WE 4A0ZA 5IY5H 3M1CA 4N9HA 3H3ZA 2JPBA 1SFOJ 5HODA 3DPLC 1G2HA 1SAUA 3KP2A 1HA8A 1QZZA 3RSNA 5HDNA 4HNTA 4MLOA 4KIFA 2H09A 3OS1A 4DBRA 1NTCA 4NC8A 4PJJA 1R5HA 1W5SA 4LIVA 1OCTC 4BE1A 3CC4I 4EJWA 2KRHA 1AKHB 1MIJA 1OPCA 3WTYC 2V1NA 2VBXA 3GWZA 5H6RA 4DOZA 3LSKA 5ICEA 2NVUB 4BQOA 3T8RA 3ZRGA 1UFMA 1ON2A 4D7MA 1IW7F 2JTVA 1I50J 4HF0A 2DU9A 2G0EA 1MNDA 2DMNA 4UV8A 3F23A 4DYRA 1ZR2A 3BZKA 3HSEA 4OIQF 5D6EA 4XRSA 2JPCA 1BC8C 3R6SA 3H1CA 2B9SA 1T95A 2L4AA 3DEEA 3JRCA 1ZRDA 2PX9A 3CC7I 1S29A 1RETA 1M1EB 3AAFA 1PYVA 4G94A 3GTQJ 4LLLA 4OAYA 1I27A 1D3YA 2MC4A 3GUDA 2EIKH 2HDWA 4JOMA 1GHCA 2A5YB 1XGNA 1SFEA 3PM1A 4ZJZA 1FT9A 4I09A 2MC3A 1IG7A 3UKGA 1FX7A 1IN4A 3O8GA 2CQNA 2EV5A 2NVYJ 2TCTA 3CP2A 2I10A 5CYVA 5E3OA 5ICCA 2W1OA 2ZB9A 1K79A 1MZBA 3BWGA 3PSFA 5B66C 2GIZA 1YI2I 3CLOA 4C30A 2M8EA 2DMQA 3L09A 1O7FA 3W6JB 3MCZA 5F27A 4U7DA 3CMAI 2D5VA 2EFNA 3JSOA 1JUSA 4D5CA 3AL0B 5DCMB 1TBXA 4O5VA 5DD8A 2VBZA 3HRMA 3LOCA 3F8CA 2BHZA 2L7KA 4L5JA 1OISA 2E35A 5IT3A 4O6JA 2HYFA 3MAJA 1YHQI 4I02A 2UXNA 2RC4A 2LLKA 2P7CB 2W7NA 4B44A 1IXRC 2AO9A 2FRHA 2ZNZA 4M72A 1QPMA 5JR3A 1J9IA 2R7RA 1MD0A 3K70D 1FIAA 1YJNI 4A3GJ 5LRRA 1O57A 3S2WA 1MBKA 4DYQA 1I5ZA 1I39A 1IN7A 1VF9A 2VI6A 2XDVA 3ZQLA 2Q1ZB 4AIJA 4Y52J 2DYSH 2EFQA 2QENA 3N05A 3PIOF 3AKZA 2AQFA 1X3WB 1ZQ3P 1HW1A 1ZG3A 2K3PA 2RV8A 3S1RJ 4HF1A 2DW4A 2C6YA 3OWTA 4RMNA 1S6LA 2ZJRF 2E1CA 4BE0A 3EYYA 4YEJA 1TLHB 1V5GA 3GX4X 2E1OA 2XROA 3ESWB 9ANTA 1F43A 3GLXA 2EA4A 5EZGA 2MD0A 1KYZA 2ZO4A 4M3BA 1E2XA 1FBUA 5BQTA 3ABLH 3FZVA 5J6XA 5E3MA 3L2QA 1JJ8C 2E1NA 4N4OB 3WE2A 4CYCB 2CFXA 4AIKA 2ADUA 2OQRA 3CF2A 4CZZA 1P7JA 3QPTA 1VQPI 1WH5A 3ZMZA 4HZFA 1G59A 2Y30A 1TT5B 3QPHA 5D5VB 3OOUA 1IN6A 5TISC 3LSIA 3NARA 2H8WA 2IGOA 3SQNA 4WCGA 2CYYA 1ZKGA 1AWCA 2XF5A 2COMA 3O2PE 1HW2A 4OMYA 4XBFA 3H9JA 3H36A 3I64A 5E1XA 2VKDA 1SVMA 2K85A 2NXNB 3E3VA 2W48A 1OFCX 3DPUA 4RM3A 2JJ7A 4CO8A 3CMMA 2K02A 4YIFA 4FHTA 4PJLA 1U9NA 2XPWA 5CQEA 1K83J 2FE3A 3CCRI 1D1BA 1P4XA 5JI6A 1QQIA 2L9RA 1YQAA 1WZ2A 4IXAA 4CCKA 2F4OB 2ZXJA 3QODA 1STZA 2FOWA 3ABKH 1S5LC 1LFUP 1SD4A 2HQNA 2HYJA 1G4DA 3CJQB 4G12A 3JTHA 4BY1J 4M6VA 4EGZA 4RBOA 3RKXA 1OYYA 2Y0SA 3LAJA 3VFZA 1ZRFA 4YIIA 1Z77A 3FM5A 1G6NA 3IUOA 3Q9VA 5DDGA 1TL8A 1B59A 3J7AO 4P96A 4F3QA 3BR1A 4AD9A 2OPTA 2FU4A 1IUYA 5CVUA 3PNYA 2LMDA 1FJLA 1KU9A 2BHYA 3BCAA 4BDYA 3PIPF 1IUFA 1GVDA 4YG2F 4V2GA 2BYVE 5D6FA 3GVAA 2R5YB 4E7LA 4UUTA 4XSZF 1XCVA 3PQJA 3J80K 1B8IB 1LE8A 4KN4X 3CO6C 1X1CA 4N4NB 2JVHA 4OIPF 1VI0A 5DYMA 4ETSA 4PUSA 2KJCA 4NB5A 1KYWA 2FMLA 4MHGA 3W3CA 2X6XA 1T56A 3LSTA 2M2EA 3KEOA 1JXSA 3R0JA 3OIQA 2Y31A 4XOPA 4AYBA 4I01A 4MQVA 1ETKA 2LBFA 2YS9A 3TGNA 2K86A 1WJ5A 1IDZA 1YFHA 2F6CA 2OBPA 4U88A 3IAS2 3ZCOA 1T33A 1FBSA 3GCMA 1LVKA 3SFIA 3OYGA 3FK6A 3BZ6A 3OL3A 2R7WA 2BW3B 2BEOA 2XV4S 2LF7A 1ON1A 3K1NA 4EQQA 2LKXA 3K6GA 4JK1X 2X9DA 2LTPA 1V5EA 3FISA 2QBYA 3WHBA 3HGYA 3JAMZ 1IC8A 1AOYA 4IZZA 3QRFF 1A35A 4EATA 4ESFA 2HKXA 2DOAA 4MEXF 4AYBN 3BR2A 2Y0MA 5K7HA 1GUUA 1ZELA 2JT1A 2DAOA 1BBYA 2DA1A 4DNCA 2L9SA 2KT0A 5F0HA 1MBHA 3F9KA 4ITVA 4UVBA 2MW8A 3ZP5A 1LVAA 3K0LA 4ABZA 2D1VA 2DJIA 3QPSA 1BOBA 3OS2A 3SDBA 1RUOA 3SEZA 2LF8A 3FWEA 2CO5A 2J5PA 2PBIA 3K1MA 3EQLF 5DS9A 2QVOA 1S7EA 2VC0A 3IH2A 1KA8A 4FT8A 3DBHB 1J2XA 5TGTA 1T6SA 3KLOA 1X58A 1O3QA 1K7AA 3KCCA 2YUSA 1CF7B 2XB5A 3PNVA 5ILSA 3LSHA 3CUQA 5B1BH 1HC8A 2V9PA 2PQ8A 3ISPA 2VC1A 4XK4A 3NWSA 2B63J 1YS7A 2E1MC 5HS8A 4G6QA 4RGSA 5H2FC 3ZQ7A 2K3FA 5FB2A 2OCEA 1RR8C 2CJJA 4NBQA 3ULQB 3PO3J 1I6XA 3QU6A 3RPUD 4R8HA 5IP9J 2KIQA 4PJMA 3RPQA 4BQAA 4CCMA 2CV1A 1J59A 4HLXA 4IHVA 3WG9A 1ETWA 2VKVA 4RLFA 3VODA 3I56I 4EGYA 2VT3A 3QWLA 4PSXA 3EYIA 1F9NA 5KAIC 1NK3P 1A6QA 2QF7A 2F4IA 4HV5A 3WHCA 3ML6A 4EVIA 3J81K 3MMYB 1VQLI 4KMFA 3VYSB 1YO5C 1KGSA 5CKTA 2RKHA 2Z9OA 3G1MA 3HOYJ 5JLXA 3GBGA 3M3YJ 2K4BA 2LREA 3VPRA 2YPRA 4NC7A 5FD6A 2G7HA 3MN2A 4FX4A 5HS9A 2PI0A 3ASOH 2ECCA 4MIMA 2E60A 2PN6A 2UWMA 1HKQA 4GYGA 2VB6A 3U9GA 3HDDA 1I6HJ 4WXCA 2QWWA 5DV5A 1MBEA 3U1DA 3SJMA 1DPUA 2MSYA 4MO7A 3C2BA 3DP7A 5E3NA 4J01A 1IRGA 1PVEA 5J3LA 3CZ6A 2W57A 4C2TA 2RNGA 2R7ZJ 5KVRA 2OZUA 3OYCA 2DFHA 2QKLB 3BTCA 1ZRCA 3H3UA 1AA7A 1E3HA 4HRIA 3I58A 3J7YJ 3FHNA 1AKHA 3GFMA 4Y17A 1WSUA 3FXQA 3LSPA 3F3XA 2WAEA 3P9KA 3BROA 4DIQA 5GAHJ 1X3ZB 3HHHA 3MWMA 1ZN2A 2ID6A 3FM3A 2RREA 3NAUA 4NNJA 2QSHX 2Q2EA 4LITA 1WH7A 3W2VA 3WU0A 3H0DA 1TQPA 4FETA 4UUVA 2EFOA 3H5AA 1Y8RB 1R1TA 1D8JA 2WWYA 2FBKA 4A3CJ 3ZN0A 2YX4A 3BG7A 3QOPA 1BR4A 3OYHA 1QHGA 4Q4ZF 1HCRA 2XAUA 2AQEA 1HF0A 3M8EA 2ZMEB 3CCLI 5IPAA 1YW7A 2CV2A 1LUJB 1Y56A 4LOCA 1ZH5A 2NVQJ 2IS6A 4Y3OA 1O7LA 2QQBA 2HQRA 2KQRA 4DZJA 3H3VK 2X1DA 1YX5A 5M3FJ 4B4CA 1R7JA 4OOIA 2IAIA 1EA3A 3HM5A 3OOPA 4BHPA 4BE2A 3RPUA 3WTUC 1I1GA 4Z2YA 3L2VA 3E6BA 1J7KA 2CUEA 3RIRA 4ON0A 1U8BA 1OLTA 3HRUA 3VYTB 1BR2A 3H9QA 1BN5A 2XGCA 5C4XJ 2CQ7A 3KZYA 1FIPA 4A3EJ 4ZZLA 2IGKA 3E5UA 4XKWA 5IOYA 2XF7A 2OZ6A 3H0GJ 4BXUA 1E0EA 2ACJA 4G8XA 3AG4H 4QIWN 1IN8A 5HLHA 2LD5A 3A2KA 4DYCA 3CDLA 4B3AA 2P5LC 5ILVA 2CS3A 4JX6A 1GXPA 3DBRB 3OSFA 3F0CA 3ZQFA 2XGXA 4PGHA 3K4BA 3GTJJ 1Z05A 1MNMC 3HYIA 1I3AA 1Q1HA 1SVLA 1VNDA 2AXLA 2CH0A 2XRLA 3HL2A 3GTPJ 2TDXA 3RQ4A 1BOAA 3LSGA 3H5NA 4CCOA 4I76A 3UR3C 3FHZA 3A02A 2GA1A 1E3OC 2XF6A 4EJOA 1Z3YA 2ZFWA 2LY1A 3GTOJ 2DTZA 3VB2A 3P9CA 1R5ID 1HQCA 3TW6A 4E7ZA 2V9KA 2E34A 2K27A 1A36A 1JKOC 3WTZA 3AFHA 2PJRA 3QP6A 2ME0A 1R23A 2VKHA 1BR1A 5F08A 1USTA 3S1QJ 3LL7A 3LSJA 3DU5A 4HG2A 2VQCA 4C2UA 1W4MA 3LAPA 1FSEA 5IP7J 5K5OA 2DYRH 2QBYB 2A6HF 2DDAA 4P1WA 4HSRA 4CYCA 3HUGA 1X1PA 1LDJA 3GEZA 4UB8C 1YS6A 1V54H 2DT6A 2NAZA 2ZSHB 3JW4A 3RDIA 3HRTA 5J47A 3S15J 3IWFA 4PJ0C 2KIMA 4NDLA 3IH4A 3SXYA 5M5XJ 2R0QC 3JRHA 4XRMA 2R7VA 3S14J 4G6TB 4XKBA 2EPFA 1JKPC 4F55A 2H8RA 1XDUA 2XAJA 3VSLA 2VE9A 3ZQQA 1H8AC 1T0FA 2A61A 3CP8A 4ZYGA 5C3EJ 1RZ4A 1Z6RA 4KA4A 2IP2A 2BXZA 5JVTA 4WXDA 2F4MB 4E7JA 2L9VA 1ZYRF 3HSFA 2EFWA 1IDYA 2FEZA 1XSXA 3H5RA 2V26A 1NH3A 3OL4A 4ZTFA 1W0UA 1HKSA 2X51A 1YE9A 3CCQI 2VXZA 4KICA 4A0YA 1B6AA 1U5TC 2A6EF 1TWFJ 2O6GE 2TRTA 1FYLA 2XAHA 3V8JA 4Y13A 2HNHA 2WADA 1EV7A 5L3BA 2VBYA 4MFEA 3BPXA 3OR2C 4CCNA 2EV0A 3ECOA 3WTTC 1N78A 2OUMA 3SZGA 1ZTRA 2KMUA 3J80Z 3JRIA 4E70A 4E7KA 3HOZJ 1V4RA 5FO5A 3T5XA 3MKYB 1KZHA 4XRFA 1KQ8A 3L2RA 5CVIA 2DA6A 2NYXA 4AIDA 2HTSA 3ZGKA 5BPIA 1Y1VJ 5F04A 1Z91A 1IV6A 4QTRA 5J4VA 3I4PA 2HXOA 2M34A 2QKMB 4UV9A 1DU0A 3E6MA 1USSA 1QVUA 4CSWA 4BGDA 4UY8I 2H6BA 1B8IA 1HOMA 4ZTJA 3K4CA 4OMZA 1HLVA 2QSGX 3BG3A 2ZXWH 2XB0X 4IF4A 5J1RA 1MMAA 1S9HA 2EZLA 1AU7A 1B9NA 1WRJA 4P55A 4IQ4A 4A5MA 1ETXA 4B43A 5KCMA 4Z6YA 4MGRA 3SHFA 1QRYA 1L3LA 2O3FA 3JRFA 1OCRH 4E7IA 4WX9A 5K7FA 2QA4I 1VZ0A 2M9HA 2PMHA 5ICFA 5L3FA 3OYAA 2WY7Q 2R7XA 5LRSA 2ZXHA 2VBWA 1VTNC 1D0ZA 3HTSB 3HZJA 4ZYDA 4P9UA 3WTSC 3IKTA 2KDZA 2PMZA 2Q2EB 4BH9A 4A3MJ 2BW3A 4ZYAA 4AVPA 3O3KA 5K7ZA 5K5RA 4BBRJ 1IXCA 3OIPA 2ESNA 3BJOA 4UUSA 2W82A 3HB9A 2ECBA 1JHFA 5EZHA 3VEPA 4IKFA 1OKRA 5BNGA 2A07F 3KYCB 3G4SI 5AIPA 1D5YA 3CCVI 4AIHA 2M4GA 5EGOA 4G9YA 2ISZA 3PJRA 2OV7A 2EA2A 5DD4A 2F2EA 2GOXB 1T38A 3GFJA 3OYNA 1Z0XA 2M30A 1JGGA 4ZDOA 3LFUA 1VQ9I 2OAZA 4QLCU 2P6TA 4YFKF 2L5QA 2X4HA 2ZC2A 5GAGJ 1Y0UA 3VYUB 4U0VA 5DUKA 1CF7A 2E36A 4BU2A 3JR9A 4YELA 4HV6A 4LLGF 4BNCA 2FA5A 5AONA 2DPUA 4NHJA 2H6CA 3BG5A 3RCOA 1S7AA 1SEUA 5DEQA 4P5OA 3SYTA 2FD5A 2GBYA 3J81Z 4XLFA 3CCEI 3FF5A 2L9NA 3VDXA 1D0XA 1XX5A 2O5RA 1KU3A 3OMYA 2K5CA 3IRRA 5J8FA 3C3WA 1RNLA 3CCYA 2DLLA 2LNBA 4EJUA 4H0EA 1IGNA 1WJBA 3DTIA 4KT6A 2L2OA 1RUNA 5HLTA 1WFXA 4XORA 4D1QA 1QA6A 2VXDA 3J7AY 2W24A 2HWVA 1QGPA 2KIFA 3T8TA 2XAGA 1Z1DA 4LJZF 4LLNA 4C2MJ 2GXGA 3HJEA 1MGTA 3L7WA 1ERDA 2P8TA 1FLIA 1H0MA 2WAQA 4Q47A 4HW0A 2JVGA 5CVJA 5B5EC 2STTA 3LQRA 4XRSG 3MKWB 1R9TJ 1ZAOA 4RGUA 2PJRB 2RDPA 2QQ8A 4L9TA 2VLAA 2AS5F 1XB4A 2I8DA 2VQLA 2M4KA 3CQZJ 4RM2A 3Q3SA 1ODDA 2E1MB 3CMEI 2DODA 3QYBA 4HDUA 2YU9J 1J09A 3SEQA 1K6YA 2VPRA 1HDDC 3I9V2 4BJTA 4W1UA 1EJ9A 2HZTA 4IX7A 2FUG2 3HUGB 5ERIA 1GT0C 5FFZA 1W7PA 2ME6A 3IL2A 2IGMA 2IGNA 2JA7J 1SMTA 2DTRA 1A5JA 1E3PA 4M6XA 5D4SA 2M7AA 3K4MA 2IA2A 1W5CC 5FD5A 3TDZC 4HX4A 6PAXA 2R7OA 3A1YA 5CQGA 2FNAA 4KNYA 3T1BA 5HLIA 2ZXIA 3KEYA 1MJ9A 1JGSA 5HDGA 3EUHC 3E0JB 3GZ5A 3CCUI 1BA5A 2HTJA 1ITYA 2ZMEA 2A6TA 2X0LA 3F6VA 3KFWX 1B9MA 2M5WA 3DLAA 1BL0A 1ETOA 2L7MP 3OYLA 1J75A 1REPC 3DQVC 1AHDP 2KDOA 1D5VA 3W6VA 1SFKA 4HDVA 4ZYEA 1UHMA 3GF2A 2L4MA 4HLYA 4ZH4F 3TO9A 3BTIA 1SD7A 4LK1F 2E5ZA 3GMEA 2VQHA 3SDGA 5HLGA 2O8XA 1N25A 3FXRA 2J5OA 1VQ5I 2HVRA 5CJ9A 4BEHB 3K4JA 3O8HA 5F1JA 3HOVJ 2LVSA 2HDDA 1U0JA 2CUZA 3S8PA 3U1KA 2B7EA 4A6EA 3WTWC 4PSWA 2BVLA 4CDGA 3RKWA 2KRFA 2GAUA 2ID3A 2DOFA 1XMXA 5FKMA 1BW6A 3KE2A 1HBXG 2L7ZA 2JZYA 2XAQA 3FIWA 4F93B 4XKCA 1T8IA 2BY3A 3DV8A 2QSFX 2KPMA 3EPZA 2OQGA 3WODF 2RGVA 4J19A 3W2AA 1QZEA 3ZQCA 4V19K 2NS8A 3QOEA 4BJ6C 2YX7A 4BAYA 1B4AA 2QYOA 2XPUA 2KFDA 1HSTA 4RDUA 4HX8A 5CPRB 3V8LA 1R5GA 2Y0SN 4A3FJ 4PFOA 3KPHA 2O8KA 4XLHA 4BYYA 2P4WA 4QPOA 5E20A 3FMRA 2HI3A 4HX7A 2HOTA 4TV7A 2FOKA 2EK5A 3ZQHA 2OJED 5FKNA 2HDCA 3ROUA 1MMDA 3OYIA 3TW7A 1D8KA 3HOSA 4YFNF 4BJ5C 4R79A 5F1RA 4IHWA 4M3GA 2XKOA 3I4NJ 2UV1A 4KIGA 5C44J 3TQNA 4U7BA 2NNNA 3F8BA 3CJTB 2STWA 1FTTA 1P6RA 1V3FA 4IJAA 3RKYA 1MMNA 1PP7U 2EZIA 3FK7A 2MLGA 1E17A 4UUSB 1WWXA 5GTHC 4NQWB 3G2BA 3PQKA 3B02A 2HXIA 2DMUA 2DO7A 4RAGA 3L1PA 2YR2A 2G7UA 2COBA 3DFGA 4HEA2 1W36C 3BCBA 1QZYA 3HKZA 4AM3A 2Z16A 4EM0B 4HPQA 1HXDA 2KJBA 4XR6A 3S3MA 4Y7NJ 3AL0C 2K9QA 2IJLA 3ZN1A 5EGOB 1JHHA 4B8XA 3MZYA 5J1YA 4FE7A 4HQMA 4M71A 2JA6J 4UXNA 3IRQA 1LEAA 5EEGA 3EDPA 4MQ9F 3TP3A 3OV8A 1VQ7I 4CA0A 1OR7C 4J00A 3RI4A 1K4TA 4BBSJ 4LB6B 1D0YA 2ZFUA 2HKOA 3FX3A 1WVRA 2EV6A 2D1HA 4AWXB 5LD2C 2P0WA 2H27A 2KLOA 2LSOA 1TWAJ 3GZ6A 1MNEA 1P2FA 2HYGD 4BKXA 3I71A 1OCOH 2ZJ2A 1NHAA 3ASNH 2E2JJ 1IRXA 1EF4A 2LYCA 3ZQIA 1RPWA 2EILH 1IAWA 1SFUA 1K78B 2DMTA 1NG7A 4LMYA 1FMWA 2LOOA 5FGMA 2PG4A 4LG3A 2R3SA 5LBQA 1O3TA 2K9LA 2EB7A 4I98B 2A3SA 3E5QA 1FOKA 2ELHA 4HSTA 1X4PA 4BUPA 4RB3C 1EKEA 2ELJA 1H9GA 3HXLA 4DJAA 1J0RA 2W25A 1V5FA 2FQ4A 2QM3A 1ETQA 1YX3A 1R58A 3GFIA 4DW6A 4DGWB 1YIJI 2ZCWA 1HKTA 1FMVA 5GAEJ 2K9NA 3QYFA 3TL4X 1EH7A 2QQ9A 3C2GA 3U2RA 4F7ZA 4G7ZF 4B48A 3GXOA 1R6RA 4MFDA 2XKPA 3M1EA 2DA7A 4YRVA 1XMKA 2ZBKA 4BQQA 4M9SA 4U0WA 3C7JA 3N97A 3OYMA 1S72I 3BTJA 2FBIA 1U5TB 4GO1A 3IKVA 3OYFA 4KFCA 2DA4A 1P4AA 3FXJA 3DKYA 1OJLA 2CW7A 3I53A 2BE5F 1W7PB 1F36A 3KX2A 2DMPA 2VONA 1Y8QB 1BJZA 4L5IA 5HVQC 4E7SA 1S7OA 4M3EA 2HVQA 2L7FP 4IOAF 2LKSA 2NVTJ 4LG0B 1RESA 1XC5A 5L3CA 2O7OA 3H9GA 2LDUA 1FTZA 1ZGJA 1GDTA 2P6SA 4ENMA 2ZJQF 1LKXA 3VYRB 2WBMA 2JRTA 3FDYA 3G6EI 4IEJA 2FMYA 4XL9A 1JUMA 3V7SA 1G3YA 3BR3A 4BS9A 3F8FA 1WJDA 2MYSA 1SANA 1U3EM 2WV1A 2Z3YA 3A0BC 3BTLA 2UZKA 2BV6A 3I4MJ 2EFPA 3KP3A 1GV5A 2JUCA 1B72A 3FKJA 3M4OJ 2CRGA 1XG1A 4L0ZB 1MJBA 2MD5A 1Z9CA 1F1ZA 1OCZH 1X1BA 2WTEA 2XGDA 2PLYA 5E79C 2R92J 1JTXA 1X2MA 3ZQGA 5LGUA 2PFBA 2XUBA 3SFZA 5LGNA 3S1MJ 1FBQA 3EETA 2IS4A 1MSFC 2GA2A 1NG6A 1YTYA 3TOAA 1R49A 3S2DJ 1DPRA 1PUEE 4KITB 4DBQA 3OYKA 3P9IA 2CUFA 2L02A 5BS6A 4HYEA 2BY2A 2CSOA 4A3JJ 4RGRA 3S32A 3TO6A 5E8IA 2L01A 2DOEA 4PZJA 3K1PA 4RAFA 3RYPA 5LLQA 4I7HA 2IA1A 2GXAA 3K4LA 4HA8A 2VN2A 4JX5A 1RR7A 2W84A 3F8NA 2Y9YA 1DUXC 3DKXA 4FQGA 1PJRA 2V4JC 4OIOF 1T2KA 1A31A 5LHIA 5HS7A 5HOOA 4LD5A 1VQ8I 3K69A 2R7FA 1T98A 4M9ZA 1RIOH 4E4HA 2LK2A 2D2WA 1MBJA 2MABA 4ZC3A 2KL4A 4I2OA 3ZMUA 3FBIB 5E18F 2F48A 1B1BA 4RB0A 3G1OA 1FP2A 4D9JA 3DTKA 5FKOA 1OCPA 5DTDA 4OIRF 2N8GA 3WE3A 5IYBJ 1XD7A 2OU2A 2DT5A 1F4KA 2CW0F 1P9QC 5CVVA 3HGGA 1X2NA 2CU7A 1TQMA 2CUJA 5EEAA 4BQNA 3JRGA 1PP8F 1JKRC 4XLPF 5EF6A 1U78A 4Y15A 1YRNB 1ACIA 3PFYA 3K4KA 1JJ6C 3PL8A 4K2EA 5FLVA 3HPGA 2R7SA 2HQ5A 2X1EA 1BC7C 1T08B 2BBYA 2HZDA 3A0HC 1TZLA 4V2FA 4L9JA 4A12A 5ED4A 1TTYA 1XGMA 4PDKA 4ZZDA 4PK4A 3GLLA 3OYDA 4OWRB 3CJNA 5GPAA 3N4MA 5EJCA 3K10A 4NUBA 4MTDA 2Z2SB 2CV0A 3FXLA 4ANJA 1DQUA 2M87A 2HVSA 1W0TA 1RRJA 4XNFA 1MKMA 4FX0A 4CYDA 3IWZA 2B0LA 2OA4A 3ABTA 2K40A 3BQZA 3HC7A 3WU2C 4ESBA 4NC6A 1QO0D 1KQ9A 4X0GA 1X1AA 1I3QJ 2JQ7A 4C3IJ 1MSEC 5E1WA 1WJCA 1ZK8A 3HG9A 3ZPLA 2V7FA 1LDDA 4RB1A 4MTEA 1L0OC 2VUMJ 2P5VA 4A69C 5D5UB 3F21A 1SD5A 1BM9A 4A3BJ 1LFBA 3I54A 2EZKA 1OYIA 1K6OA 3KZIC 2LKPA 1WKMA 2R93J 2MA3A 1WCMJ 2R4GA 4BEHA 4OAZA 2JRMA 4L0YB 4BXFA 4HOBA 1DP7P 2EWNA 3FKIJ 4LGWA 4KT5C 1ZLJA 3ABMH 3Q5FA 3R0AA 1UHSA 2VPLA 3KYDB 2EIMH 3BP8A 3QPLA 4HNVA 1TP4A 2DN0A 2JA2A 1I1SA 4F91B 3RTRA 3COAC 1FPQA 5FRNA 4AC0A 3CDIA 2A05A 2QQAA 1X19A 3I3LA 1FNNA 4QSHA 2IEKA 1Z7UA 2LRDA 3E6DA 4I6ZA 1YYVA 3S2HJ 1FY7A 3U21A 1DDNA 3P5JA 2P81A 2XASA 2QGUA 2BXYA 4GRIA 1XMAA 3F6OA 1MMSA 2M3AA 2JSCA 1D1CA 2HR3A 5D4RA 1Y0NA 3BPVA 2XGEA 2KZGA 4XSXF 3A01B 1UJ8A 2OCCH 3WGHA 1TW2A 1RI7A 4RAYA 4IVNA 3Q9SA 4D7NA 3OYBA 4KJZA 3VWBA 3WU1B 4KYWA 2BVMA 4BACA 4KMUX 1VQMI 4I99C 2KKOA 2NOGA 1Z67A 4JYKA 2Z99A 4Y33A 5FROA 2LR8A 5LEKA 1HDPA 3D5LA 1JT0A 1CQTA 3ZMDA 2CFOA 3V7CA 1C0WA 1JKQC 1XDSA 4IOCF 2V1UA 4D0PA 3ABUA 1IRFA 3B73A 4HF2A 4NQWA 1ETVA 1LB2A 2DPDA 2F5VA 2F5CA 4B47A 3MZ8A 2FSWA 2Q0OA 4EMSA 1W7PD 2EH3A 2GOMA 3K70C 1XGOA 4IRIA 4B1RA 3TEDA 3E1SA 2F5DA 4JP0A 2XHKA 5DM6F 1WHUA 5IT9K 2WA0A 1NK2P 4M3FA 3ERMA 2QEXI 1U6GA 3DF8A 2R5ZB 1BW5A 2DFEA
chains in the Genus database with same CATH topology
5F1JA 2PMZN 3O8HA 3QQAA 3HOVJ 2LVSA 2HDDA 1ENHA 5FKKA 1FEXA 3G1MA 3HOYJ 4FE4A 3GBGA 5JLXA 3M3YJ 1B72B 3GTKJ 3VPRA 2EBIA 2ID3A 2FJ1A 3MN2A 5FKMA 1BW6A 2ECCA 4XICA 2L7ZA 4MIMA 1O4XA 3FIWA 3HDDA 1I6HJ 3BG9A 4FISA 1MBEA 2IBDA 2JK3A 3SJMA 4J19A 2E2HJ 2MSYA 2HOSA 1RKTA 3ZQCA 4MO7A 2NS8A 3C2BA 3S16J 5E3NA 5EG0A 5J3LA 1ZR4A 2XPUA 2Y9ZA 2R7ZJ 3OSGA 4IHXA 4RDUA 5IOZA 2ELKA 3BTCA 2Y0SN 4A3FJ 2MGQA 2K9SA 2O8KA 2DA5A 4FCYA 1AKHA 3LSPA 2HI3A 2HOTA 3ZQHA 2ID6A 1WPKA 3OIOA 3NAUA 5FKNA 1WH7A 3HOUJ 3BQYA 3IV5A 3TW7A 4IHWA 4A3CJ 4L5EA 4M3GA 3I4NJ 3GTMJ 4X6AJ 5C44J 5FLMJ 3BR0A 1HCRA 1HF0A 5IPAA 1FTTA 4A93J 2DA2A 3IH3A 4IHYA 2EZIA 3FK7A 4LOCA 4UUSB 1Q1VA 4GFBA 2NVQJ 2HXIA 2DMUA 4DZJA 2NS7A 3L1PA 3H3VK 2COBA 5F0CA 5GP9A 5F0FA 5M3FJ 4B4CA 2GM4A 2JA5J 2IAIA 4Y7NJ 3HM5A 3Q0WA 2K9QA 5EGOB 1WI3A 2CUEA 5C4JJ 3E7LA 2LFBA 1U8BA 5IP6A 5J1YA 4FE7A 2JA6J 2XGCA 5C4XJ 2WAQN 3TP3A 3HBLA 2H1KA 1FIPA 4A3EJ 4A3IJ 2XSDC 4BY7J 4BBSJ 5IOYA 1XS9A 2QCOA 1RKWA 3H0GJ 2R5YA 2LY9A 1PUFA 4QIWN 3RZDJ 2FX0A 2LD5A 4DYCA 1TWAJ 3CDLA 4B3AA 4BKXA 4JX6A 1SFOJ 3OSFA 3F0CA 3ZQFA 5HODA 1G2HA 2E2JJ 1EF4A 3GTJJ 1MNMC 1APLC 4MLOA 3ZQIA 5EG0B 1RPWA 3BT9A 1VNDA 1NTCA 2X48A 2DMTA 2XRLA 3GTPJ 3LSGA 1OCTC 4I76A 4A3LJ 3A02A 1E3OC 1AKHB 3GTOJ 2DTZA 2EZHA 3S17J 1U9OA 3TW6A 2FQ4A 4D7MA 1I50J 1JKOC 1ETQA 2G0EA 3RQIA 1JUPA 4DW6A 2DMNA 1ZR2A 3MKLA 4DYRA 2ME0A 4XRSA 5F08A 3S1QJ 2K9NA 1TC3C 3LSJA 3JRCA 3A03A 4MFDA 1RETA 2JN6A 3GTQJ 5IP7J 3JRBA 2DA7A 5GPCA 4CYCA 3G1LA 2AHQA 3S15J 1ETYA 1GV2A 3BTJA 2E2IJ 3PM1A 1IG7A 4NDLA 2DA4A 3IH4A 3UKGA 5M5XJ 3O8GA 2R0QC 2NVYJ 2TCTA 3JRHA 2I10A 3BR5A 5E3OA 4XRMA 3S14J 2ZB9A 1OJLA 1JKPC 2H8RA 1F36A 2DMPA 2DMQA 3DCFA 1H8AC 1BJZA 5F27A 1ORKA 2D5VA 5C3EJ 1JUSA 4D5CA 4M3EA 2OF7A 2L7FP 2NVTJ 3LOCA 1RESA 1XC5A 2O7OA 1IDYA 3K2AA 3D1NI 1FTZA 1GDTA 5EYRA 1W0UA 3LNQA 2LLKA 4M3DA 1TWFJ 4XIDA 2AO9A 2TRTA 1MBGA 4IEJA 4A3GJ 1FIAA 1JUMA 1YRNA 3BR3A 4MFEA 1MBKA 4DYQA 2O9LA 1SANA 1VF9A 2VI6A 2WV1A 4Y52J 3ZQLA 1ZTRA 3JRIA 2RAEA 3HOZJ 1DU6A 3BTLA 1ZQ3P 3I4MJ 3S1RJ 1GV5A 1B72A 3M4OJ 3RZOJ 2CRGA 1XG1A 2CQQA 3HOWJ 2DA6A 1TWCJ 1WGXA 1Y1VJ 5F04A 2CQXA 2E1OA 4W97A 1IV6A 3MVPA 9ANTA 2XGDA 1F43A 4QTRA 2R92J 1JTXA 1X2MA 3ZQGA 2HXOA 2M34A 5EZGA 3S1MJ 1DU0A 1QVUA 4S0HB 4M3BA 5JLWA 1MSFC 1B8IA 1HOMA 4C3JJ 1JJ8C 5E3MA 3HKZN 3S2DJ 1HLVA 3BG3A 4CYCB 2XB0X 5J1RA 2Y2ZA 1AU7A 2EZLA 2CUFA 3S1NJ 3DEWA 1P7JA 2XPVA 1WH5A 4A3JJ 2Y30A 1ETXA 1QRYA 1MBFA 3K7AJ 3OOUA 4JX5A 1RR7A 3JRFA 2Y9YA 3Q0VA 3NARA 5K7FA 2M9HA 2GLOA 1ZKGA 3LSRA 2MG4A 3BR6A 1UMQA 3CMYA 4BXXJ 2LK2A 1MBJA 2W48A 1OFCX 2KDZA 4A3MJ 2JJ7A 3G1OA 5K7ZA 5DTDA 5FKOA 1OCPA 2M0CA 4BBRJ 2N8GA 1U9NA 2XPWA 2L0KA 5IYBJ 1K83J 4UUSA 1MH4A 3HB9A 1POGA 2ECBA 5EZHA 3HGGA 1TWHJ 1X2NA 2L9RA 2CU7A 5BNGA 3JRAA 5EEAA 3JRGA 1JKRC 1D5YA 5EF6A 1U78A 1YRNB 2NVXJ 5EGOA 1JJ6C 1LFUP 5FLVA 3Q0UA 2HQ5A 2HYJA 4AUXA 4G12A 4BY1J 1Z0XA 4M6VA 4RBOA 4V2FA 1JGGA 3B6AA 2DJNA 5M3MJ 2HOAA 5GPAA 4JX4A 1Z77A 3A01A 4DZPA 3ZOBA 3JR9A 1W0TA 3BR1A 2OPTA 4D5FA 5EDNA 1H88C 3HEFA 1FJLA 2JA8J 3BG5A 1IUFA 3B6CA 1GVDA 2FD5A 2GBYA 4V2GA 1H89C 3BQZA 2K40A 1MH3A 2R5YB 1P7IA 4UUTA 1PUFB 2JWTA 1B8IB 1LE8A 1I3QJ 3PO2J 4C3IJ 1MSEC 1VI0A 1ZK8A 3HOXJ 3CCYA 2DA3A 1QVTA 4C3HJ 1IGNA 1T56A 2VUMJ 4A69C 2M2EA 2WB1N 2M8GX 4A3BJ 1LFBA 2Y31A 4FTHA 2EZKA 1ETKA 2YS9A 2R93J 1IJWC 2R5ZA 1WCMJ 1IDZA 1ZGWA 4C2MJ 1Y1WJ 1TWGJ 1T33A 2X6OA 3FKIJ 3SFIA 3FK6A 5FKLA 1VFCA 1JT6A 4XRSG 1UG2A 3JREA 1R9TJ 2LKXA 1UHSA 3TP0A 2X9DA 3GTGJ 2LTPA 3FISA 3QPLA 2JMWA 3WHBA 4HNVA 3HGYA 2DN0A 4X1EA 1IC8A 5FJ8J 3CQZJ 4AC0A 3Q3SA 4AYBN 3BR2A 5K7HA 2EQRA 1GUUA 2YU9J 1HDDC 2VPRA 4QSHA 2IEKA 1JTYA 2DA1A 2KT0A 4W1UA 1MBHA 5F0HA 4I6ZA 1QPIA 2MW8A 3S2HJ 2P81A 4ABZA 3QPSA 1GT0C 2ME6A 2JA7J 3RKQA 1A5JA 2VKEA 2E19A 5DS9A 1S7EA 5J1UA 3IH2A 2XGEA 1IRZA 5IYCJ 3A01B 1X58A 4EEFG 5E3LA 4A3DJ 2YUSA 2XB5A 4D7NA 3JRDA 4XK4A 2B63J 2NOGA 4JYKA 1K61A 2LR8A 1HDPA 1CQTA 1JT0A 1BA5A 1JKQC 1ITYA 1LE8B 5M5WJ 2CJJA 4A3KJ 5IYDJ 1BL0A 3GTLJ 3PO3J 1ETOA 2L7MP 1AHDP 5IP9J 3W6VA 1ETVA 2EH3A 5M5YJ 4B1RA 3TEDA 4IHVA 3BTIA 4JP0A 1ETWA 2VKVA 3SDGA 1NK2P 4M3FA 1A6IA 2LP0A 1NK3P 3WHCA 2QF7A 2R5ZB 1BW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F1J A;  2PMZ N;  3O8H A;  3QQA A;  3HOV J;  2LVS A;  2HDD A;  1ENH A;  5FKK A;  1FEX A;  3G1M A;  3HOY J;  4FE4 A;  3GBG A;  5JLX A;  3M3Y J;  1B72 B;  3GTK J;  3VPR A;  2EBI A;  2ID3 A;  2FJ1 A;  3MN2 A;  5FKM A;  1BW6 A;  2ECC A;  4XIC A;  2L7Z A;  4MIM A;  1O4X A;  3FIW A;  3HDD A;  1I6H J;  3BG9 A;  4FIS A;  1MBE A;  2IBD A;  2JK3 A;  3SJM A;  4J19 A;  2E2H J;  2MSY A;  2HOS A;  1RKT A;  3ZQC A;  4MO7 A;  2NS8 A;  3C2B A;  3S16 J;  5E3N A;  5EG0 A;  5J3L A;  1ZR4 A;  2XPU A;  2Y9Z A;  2R7Z J;  3OSG A;  4IHX A;  4RDU A;  5IOZ A;  2ELK A;  3BTC A;  2Y0S N;  4A3F J;  2MGQ A;  2K9S A;  2O8K A;  2DA5 A;  4FCY A;  1AKH A;  3LSP A;  2HI3 A;  2HOT A;  3ZQH A;  2ID6 A;  1WPK A;  3OIO A;  3NAU A;  5FKN A;  1WH7 A;  3HOU J;  3BQY A;  3IV5 A;  3TW7 A;  4IHW A;  4A3C J;  4L5E A;  4M3G A;  3I4N J;  3GTM J;  4X6A J;  5C44 J;  5FLM J;  3BR0 A;  1HCR A;  1HF0 A;  5IPA A;  1FTT A;  4A93 J;  2DA2 A;  3IH3 A;  4IHY A;  2EZI A;  3FK7 A;  4LOC A;  4UUS B;  1Q1V A;  4GFB A;  2NVQ J;  2HXI A;  2DMU A;  4DZJ A;  2NS7 A;  3L1P A;  3H3V K;  2COB A;  5F0C A;  5GP9 A;  5F0F A;  5M3F J;  4B4C A;  2GM4 A;  2JA5 J;  2IAI A;  4Y7N J;  3HM5 A;  3Q0W A;  2K9Q A;  5EGO B;  1WI3 A;  2CUE A;  5C4J J;  3E7L A;  2LFB A;  1U8B A;  5IP6 A;  5J1Y A;  4FE7 A;  2JA6 J;  2XGC A;  5C4X J;  2WAQ N;  3TP3 A;  3HBL A;  2H1K A;  1FIP A;  4A3E J;  4A3I J;  2XSD C;  4BY7 J;  4BBS J;  5IOY A;  1XS9 A;  2QCO A;  1RKW A;  3H0G J;  2R5Y A;  2LY9 A;  1PUF A;  4QIW N;  3RZD J;  2FX0 A;  2LD5 A;  4DYC A;  1TWA J;  3CDL A;  4B3A A;  4BKX A;  4JX6 A;  1SFO J;  3OSF A;  3F0C A;  3ZQF A;  5HOD A;  1G2H A;  2E2J J;  1EF4 A;  3GTJ J;  1MNM C;  1APL C;  4MLO A;  3ZQI A;  5EG0 B;  1RPW A;  3BT9 A;  1VND A;  1NTC A;  2X48 A;  2DMT A;  2XRL A;  3GTP J;  3LSG A;  1OCT C;  4I76 A;  4A3L J;  3A02 A;  1E3O C;  1AKH B;  3GTO J;  2DTZ A;  2EZH A;  3S17 J;  1U9O A;  3TW6 A;  2FQ4 A;  4D7M A;  1I50 J;  1JKO C;  1ETQ A;  2G0E A;  3RQI A;  1JUP A;  4DW6 A;  2DMN A;  1ZR2 A;  3MKL A;  4DYR A;  2ME0 A;  4XRS A;  5F08 A;  3S1Q J;  2K9N A;  1TC3 C;  3LSJ A;  3JRC A;  3A03 A;  4MFD A;  1RET A;  2JN6 A;  3GTQ J;  5IP7 J;  3JRB A;  2DA7 A;  5GPC A;  4CYC A;  3G1L A;  2AHQ A;  3S15 J;  1ETY A;  1GV2 A;  3BTJ A;  2E2I J;  3PM1 A;  1IG7 A;  4NDL A;  2DA4 A;  3IH4 A;  3UKG A;  5M5X J;  3O8G A;  2R0Q C;  2NVY J;  2TCT A;  3JRH A;  2I10 A;  3BR5 A;  5E3O A;  4XRM A;  3S14 J;  2ZB9 A;  1OJL A;  1JKP C;  2H8R A;  1F36 A;  2DMP A;  2DMQ A;  3DCF A;  1H8A C;  1BJZ A;  5F27 A;  1ORK A;  2D5V A;  5C3E J;  1JUS A;  4D5C A;  4M3E A;  2OF7 A;  2L7F P;  2NVT J;  3LOC A;  1RES A;  1XC5 A;  2O7O A;  1IDY A;  3K2A A;  3D1N I;  1FTZ A;  1GDT A;  5EYR A;  1W0U A;  3LNQ A;  2LLK A;  4M3D A;  1TWF J;  4XID A;  2AO9 A;  2TRT A;  1MBG A;  4IEJ A;  4A3G J;  1FIA A;  1JUM A;  1YRN A;  3BR3 A;  4MFE A;  1MBK A;  4DYQ A;  2O9L A;  1SAN A;  1VF9 A;  2VI6 A;  2WV1 A;  4Y52 J;  3ZQL A;  1ZTR A;  3JRI A;  2RAE A;  3HOZ J;  1DU6 A;  3BTL A;  1ZQ3 P;  3I4M J;  3S1R J;  1GV5 A;  1B72 A;  3M4O J;  3RZO J;  2CRG A;  1XG1 A;  2CQQ A;  3HOW J;  2DA6 A;  1TWC J;  1WGX A;  1Y1V J;  5F04 A;  2CQX A;  2E1O A;  4W97 A;  1IV6 A;  3MVP A;  9ANT A;  2XGD A;  1F43 A;  4QTR A;  2R92 J;  1JTX A;  1X2M A;  3ZQG A;  2HXO A;  2M34 A;  5EZG A;  3S1M J;  1DU0 A;  1QVU A;  4S0H B;  4M3B A;  5JLW A;  1MSF C;  1B8I A;  1HOM A;  4C3J J;  1JJ8 C;  5E3M A;  3HKZ N;  3S2D J;  1HLV A;  3BG3 A;  4CYC B;  2XB0 X;  5J1R A;  2Y2Z A;  1AU7 A;  2EZL A;  2CUF A;  3S1N J;  3DEW A;  1P7J A;  2XPV A;  1WH5 A;  4A3J J;  2Y30 A;  1ETX A;  1QRY A;  1MBF A;  3K7A J;  3OOU A;  4JX5 A;  1RR7 A;  3JRF A;  2Y9Y A;  3Q0V A;  3NAR A;  5K7F A;  2M9H A;  2GLO A;  1ZKG A;  3LSR A;  2MG4 A;  3BR6 A;  1UMQ A;  3CMY A;  4BXX J;  2LK2 A;  1MBJ A;  2W48 A;  1OFC X;  2KDZ A;  4A3M J;  2JJ7 A;  3G1O A;  5K7Z A;  5DTD A;  5FKO A;  1OCP A;  2M0C A;  4BBR J;  2N8G A;  1U9N A;  2XPW A;  2L0K A;  5IYB J;  1K83 J;  4UUS A;  1MH4 A;  3HB9 A;  1POG A;  2ECB A;  5EZH A;  3HGG A;  1TWH J;  1X2N A;  2L9R A;  2CU7 A;  5BNG A;  3JRA A;  5EEA A;  3JRG A;  1JKR C;  1D5Y A;  5EF6 A;  1U78 A;  1YRN B;  2NVX J;  5EGO A;  1JJ6 C;  1LFU P;  5FLV A;  3Q0U A;  2HQ5 A;  2HYJ A;  4AUX A;  4G12 A;  4BY1 J;  1Z0X A;  4M6V A;  4RBO A;  4V2F A;  1JGG A;  3B6A A;  2DJN A;  5M3M J;  2HOA A;  5GPA A;  4JX4 A;  1Z77 A;  3A01 A;  4DZP A;  3ZOB A;  3JR9 A;  1W0T A;  3BR1 A;  2OPT A;  4D5F A;  5EDN A;  1H88 C;  3HEF A;  1FJL A;  2JA8 J;  3BG5 A;  1IUF A;  3B6C A;  1GVD A;  2FD5 A;  2GBY A;  4V2G A;  1H89 C;  3BQZ A;  2K40 A;  1MH3 A;  2R5Y B;  1P7I A;  4UUT A;  1PUF B;  2JWT A;  1B8I B;  1LE8 A;  1I3Q J;  3PO2 J;  4C3I J;  1MSE C;  1VI0 A;  1ZK8 A;  3HOX J;  3CCY A;  2DA3 A;  1QVT A;  4C3H J;  1IGN A;  1T56 A;  2VUM J;  4A69 C;  2M2E A;  2WB1 N;  2M8G X;  4A3B J;  1LFB A;  2Y31 A;  4FTH A;  2EZK A;  1ETK A;  2YS9 A;  2R93 J;  1IJW C;  2R5Z A;  1WCM J;  1IDZ A;  1ZGW A;  4C2M J;  1Y1W J;  1TWG J;  1T33 A;  2X6O A;  3FKI J;  3SFI A;  3FK6 A;  5FKL A;  1VFC A;  1JT6 A;  4XRS G;  1UG2 A;  3JRE A;  1R9T J;  2LKX A;  1UHS A;  3TP0 A;  2X9D A;  3GTG J;  2LTP A;  3FIS A;  3QPL A;  2JMW A;  3WHB A;  4HNV A;  3HGY A;  2DN0 A;  4X1E A;  1IC8 A;  5FJ8 J;  3CQZ J;  4AC0 A;  3Q3S A;  4AYB N;  3BR2 A;  5K7H A;  2EQR A;  1GUU A;  2YU9 J;  1HDD C;  2VPR A;  4QSH A;  2IEK A;  1JTY A;  2DA1 A;  2KT0 A;  4W1U A;  1MBH A;  5F0H A;  4I6Z A;  1QPI A;  2MW8 A;  3S2H J;  2P81 A;  4ABZ A;  3QPS A;  1GT0 C;  2ME6 A;  2JA7 J;  3RKQ A;  1A5J A;  2VKE A;  2E19 A;  5DS9 A;  1S7E A;  5J1U A;  3IH2 A;  2XGE A;  1IRZ A;  5IYC J;  3A01 B;  1X58 A;  4EEF G;  5E3L A;  4A3D J;  2YUS A;  2XB5 A;  4D7N A;  3JRD A;  4XK4 A;  2B63 J;  2NOG A;  4JYK A;  1K61 A;  2LR8 A;  1HDP A;  1CQT A;  1JT0 A;  1BA5 A;  1JKQ C;  1ITY A;  1LE8 B;  5M5W J;  2CJJ A;  4A3K J;  5IYD J;  1BL0 A;  3GTL J;  3PO3 J;  1ETO A;  2L7M P;  1AHD P;  5IP9 J;  3W6V A;  1ETV A;  2EH3 A;  5M5Y J;  4B1R A;  3TED A;  4IHV A;  3BTI A;  4JP0 A;  1ETW A;  2VKV A;  3SDG A;  1NK2 P;  4M3F A;  1A6I A;  2LP0 A;  1NK3 P;  3WHC A;  2QF7 A;  2R5Z B;  1BW5 A; 
#chains in the Genus database with same CATH topology
 2PMZ N;  1Y39 A;  2VOP A;  3LWF A;  1ENH A;  5FKK A;  1FEX A;  1G3W A;  2X85 A;  4FE4 A;  1B72 B;  3E5X A;  3LMM A;  3MD2 A;  1LNW A;  2FJ1 A;  4BHC A;  3BLY A;  5TRD A;  4IRG A;  3EUA A;  4U87 A;  3AG3 H;  3NQO A;  1R4M B;  3BG9 A;  4FIS A;  2IBD A;  1UB9 A;  2DQL A;  2JK3 A;  4E7H A;  3ONQ A;  3TOB A;  2HOS A;  1RKT A;  3KLN A;  3GZN B;  5E8G A;  3WG7 H;  3S16 J;  2K7L A;  1ZR4 A;  3ELK A;  5L3D A;  4RB2 C;  1OYW A;  2Y9Z A;  1K78 A;  3G73 A;  3OSG A;  3M07 A;  5IOZ A;  2WV0 A;  2CGP A;  3WGI A;  2K9S A;  3UNG C;  2DA5 A;  5CVR A;  5FFX A;  3CTA A;  5A2Q K;  1YJ9 I;  2M1B A;  3MEX A;  2IW5 A;  3FMQ A;  1R71 A;  1WPK A;  3OIO A;  2Y69 H;  4IHT A;  3HOU J;  3HTU A;  3BQY A;  3C2H A;  1SFX A;  3IV5 A;  3D0S A;  3QU3 A;  4AVZ A;  1MW7 A;  4L5E A;  2GQQ A;  2FBH A;  5F64 A;  2H1L A;  4X6A J;  5FLM J;  2W00 A;  2WY8 Q;  5LHG A;  3CUO A;  3W6K B;  1MJA A;  4A93 J;  2DA2 A;  2ICW G;  4IHY A;  1UHW A;  1FP1 D;  3KET A;  5FLX K;  4PFP A;  1X3U A;  4LFU A;  3R4K A;  5HDK A;  5F0C A;  4ENN A;  5F0F A;  2R7Q A;  3C18 A;  4XN3 A;  2CWE A;  3IAM 2;  2JA5 J;  1U5T A;  3IP4 B;  1U8R A;  4O3M A;  4Q5S F;  4UVA A;  2HQA A;  3TO7 A;  1WI3 A;  5JVG F;  2E5N A;  5C4J J;  3E7L A;  5IP6 A;  1YW8 A;  3V7R A;  2OD5 A;  2WAQ N;  3IHU A;  1BI3 A;  1DGW Y;  3CUQ C;  1WJF A;  2XSD C;  3KEQ A;  1FC3 A;  3CCS I;  1FYK A;  4BY7 J;  2WC2 A;  4KIS A;  2VJJ A;  4CUG A;  1T39 A;  4YFX F;  1XS9 A;  2BY0 A;  1RKW A;  2QCO A;  3BDD A;  5HNH A;  3BJA A;  1PUF A;  3F72 A;  4LG0 A;  4G7O F;  3PFI A;  1J5Y A;  3RZD J;  4UB6 C;  5KNL A;  2UUZ A;  3HOT A;  4CH7 A;  1UEL B;  1IF1 A;  5GAD J;  1KON A;  3NWT A;  4L9N A;  4XM3 A;  2VQG A;  4UHT A;  5DM7 F;  3EUK L;  4C9Y A;  4WF2 A;  3L9F A;  2V6C A;  3FXO A;  2CMP A;  5TJJ A;  3NRV A;  1APL C;  4ENJ A;  5EG0 B;  2LH9 A;  4M73 A;  3BG6 A;  3BT9 A;  2OC6 A;  2X48 A;  4ZDP A;  3BOQ A;  1IZ1 A;  3PSI A;  4A3L J;  2NNY A;  1FZP B;  3K2Z A;  4GXO A;  1BIA A;  2E7X A;  1Z21 A;  2HGC A;  3V4G A;  1O3R A;  2EZH A;  3S17 J;  1U9O A;  4II2 A;  2HFH A;  4XN0 A;  3VOE A;  1FWZ A;  1X1D A;  1WI9 A;  3ZXS A;  1GVJ A;  2KIS A;  2M45 A;  3RQI A;  2ZJP F;  1JUP A;  2KP6 A;  2KZV A;  2MH9 A;  3MKZ A;  3WTV C;  2QZ8 A;  3MKL A;  4XON A;  2X6Y A;  1R22 A;  3LA2 A;  3LSM A;  1TC3 C;  1G3S A;  3QYE A;  2VAS A;  3A03 A;  4HNU A;  2E7W A;  1SD6 A;  2DXI A;  4UNO A;  2JN6 A;  3JRB A;  2E71 A;  5J8C A;  4QWQ A;  2M0M A;  3V42 A;  5GPC A;  1XN7 A;  3KYL A;  3R60 A;  5L3G A;  2ETH A;  3G1L A;  2AHQ A;  1XGS A;  1FYM A;  3OYJ A;  1ETY A;  1GV2 A;  2E2I J;  3I5U A;  4GCV A;  2BZT A;  1EH8 A;  4MNU A;  3BR5 A;  2BY1 A;  3WTX C;  5BMZ A;  2PJP A;  3OYE A;  4HAM A;  2R7U A;  1CGP A;  2NS0 A;  4OIN F;  2I5U A;  1S8N A;  4RS8 A;  1YOV B;  3DCF A;  4CZC A;  4A5N A;  2R7D A;  5D5W B;  1ORK A;  1SVO A;  2A69 F;  4RAZ A;  2H94 A;  2MH2 A;  3SZP A;  4XKV A;  2OF7 A;  5D8L B;  2XIG A;  4PCQ A;  2ZNY A;  4WWC A;  2PMU A;  3ZMV A;  3K2A A;  3D1N I;  5EYR A;  4B09 A;  3LNQ A;  3ECH A;  4AU7 A;  1LEB A;  4CCL A;  4M3D A;  2EJR A;  4XID A;  2LC2 A;  1UCR A;  5AIQ A;  1BI2 A;  2XVC A;  2IT0 A;  1MBG A;  2VJ5 A;  4R1H A;  4U0Y A;  1YRN A;  3KP6 A;  5KK1 A;  1ZG5 A;  3DKW A;  3PNT A;  4II3 A;  2O9L A;  3MZH A;  2DK8 A;  5LEJ A;  2KHM A;  4ZYH A;  2RAE A;  5JHU A;  3A4C A;  1DU6 A;  4FAS D;  2K4J A;  1X4O A;  5K1Y A;  1XCB A;  1O3S A;  1ONV A;  1Y6I A;  3RZO J;  3WGG A;  3KP7 A;  2CQQ A;  5KHD A;  1EH6 A;  5DCF A;  3HOW J;  3FXU A;  3G3Z A;  1TWC J;  1WGX A;  2FF4 A;  2CQX A;  4W97 A;  4JBA A;  3MVP A;  3CDH A;  3ERE D;  4XLA A;  3KP4 A;  4G7H F;  5L3E A;  2X1C A;  1QU3 A;  5CLS A;  1R1V A;  4S0H B;  2EIJ H;  5JLW A;  4C3J J;  2Z1D A;  4LK0 F;  3HKZ N;  2NRA C;  3H35 A;  5K5Q A;  2Y2Z A;  1BJA A;  1GLN A;  3DTE A;  5D8K B;  3S1N J;  3DEW A;  4ZDL A;  3ZR8 X;  2XPV A;  3HRS A;  5LFA A;  2QUF A;  2UXX A;  4KUM A;  2V1D A;  1SAX A;  4A2U A;  2VT2 A;  2K9M A;  1MBF A;  3K7A J;  1HSJ A;  1OMI A;  3F8M A;  2IVM A;  2O61 A;  1SMY F;  2IS2 A;  2BOL A;  3Q0V A;  1YG2 A;  2LG4 A;  1VQN I;  2GLO A;  3ZMS A;  4I0A A;  3I59 A;  3GO5 A;  3LSR A;  2MG4 A;  3BR6 A;  1UMQ A;  3CMY A;  3JTG A;  4BXX J;  5JHF A;  1WQ2 A;  3I55 I;  2OTL I;  3HIF A;  2DFF A;  3M9A A;  2CG4 A;  1FOW A;  4YIR X;  3D5R C;  2BGC A;  3DEU A;  4ESJ A;  2M0C A;  3HSR A;  4QPQ A;  3I0T A;  4WK8 F;  2L0K A;  2O0Y A;  4DQ2 A;  4IRH A;  4IO9 F;  1MH4 A;  1IN5 A;  1POG A;  1U2W A;  3REO A;  2AXT C;  2DI3 A;  1TWH J;  1TNS A;  3OS0 A;  2V6E A;  1K4S A;  3EUH A;  3HPH A;  3JRA A;  1W36 D;  1XSD A;  2XRN A;  1KU7 A;  2NVX J;  4GYI A;  4CXF A;  3Q0U A;  2RVC A;  4RGX A;  3OY9 A;  4AUX A;  3AG2 H;  1R1U A;  1BIB A;  3CCJ I;  1HW5 A;  3JSP A;  2VJ4 A;  3G71 I;  1QNT A;  1T0F C;  1R00 A;  3B6A A;  4EV0 A;  2DJN A;  5BPD A;  5M3M J;  1UZC A;  1YLF A;  3E97 A;  1MDM A;  3V8K A;  2HOA A;  4KDP A;  4JX4 A;  1IO2 A;  2L54 A;  3BY6 A;  1P92 A;  1ZGA A;  3BJ6 A;  4DZP A;  3A01 A;  4PGG A;  1UAA A;  2A68 F;  2GIV A;  3ZOB A;  1TT0 A;  2WB1 A;  3VSK A;  4D5F A;  5EDN A;  1H88 C;  3HEF A;  5IT9 Z;  2JA8 J;  2HEO A;  1OQY A;  2VL8 A;  3RJP A;  1ULY A;  2GXB A;  3B6C A;  2XC7 A;  2ESH A;  4PJN A;  3CJR B;  3J7Z I;  1H89 C;  2XAF A;  1MH3 A;  1N77 A;  2W85 A;  1P7I A;  4WXH A;  1PUF B;  3F22 A;  4EJT A;  3P7N A;  1ZG1 A;  2JWT A;  4A6D A;  1QHH D;  3PO2 J;  3HOX J;  2DQR A;  1VQ4 I;  2FQ3 A;  4GGG A;  2DA3 A;  1QVT A;  2IXS A;  4M74 A;  4C3H J;  2RN7 A;  3O6B B;  3CC2 I;  1A04 A;  4IPA A;  4A0X A;  4XQF A;  2VOD A;  2WB1 N;  2M8G X;  4FTH A;  2LY2 A;  3H92 A;  4P9F A;  3BZC A;  3FBN B;  1IJW C;  4S04 A;  5D5X B;  2R5Z A;  1ZGW A;  1Y1W J;  1TWG J;  2X6O A;  4HBL A;  1RC9 A;  3MQ0 A;  3AG1 H;  4B3X A;  2ISY A;  5FKL A;  5H6Q A;  1VFC A;  1JT6 A;  2Y48 A;  1UG2 A;  5H20 A;  3JRE A;  2FNP A;  2MLK A;  1R36 A;  4E6K G;  2P7V B;  3PUF A;  5A2Q Z;  4F92 B;  3LA3 A;  3SZT A;  3TP0 A;  3GTG J;  2JMW A;  2HPI A;  2GWR A;  4X1E A;  2DDB A;  2JUG A;  3M7G A;  5FJ8 J;  3DPT A;  3DU6 A;  2Y75 A;  4UVC A;  4BL0 B;  4ENK A;  3QAH A;  5E17 F;  2EQR A;  4EM1 A;  4MEY F;  1JI8 A;  2O03 A;  2QLZ A;  1JTY A;  4EM2 A;  2HOE A;  1QPI A;  1WJA A;  2X6W A;  3DXJ F;  1S3J A;  3GFL A;  2VJI A;  4L9V A;  4XMY A;  1LFP A;  2RQQ A;  3RKQ A;  2IPQ X;  3PUB A;  1G3T A;  3FMS A;  2VKE A;  2E19 A;  1XSV A;  1YJW I;  5FLX Z;  5J1U A;  5DCM A;  3ZMT A;  1IRZ A;  4EJV A;  5IYC J;  5F6F A;  1XTA A;  2IS1 A;  4ASN A;  4EEF G;  3OR1 C;  4KIB A;  5E3L A;  4A3D J;  2P5K A;  4H4K C;  3GW2 A;  3JRD A;  3CO7 C;  1OR7 A;  5LHH A;  4F52 A;  3IC7 A;  3C1D A;  4N9I A;  3S93 A;  2R7T A;  2Q8K A;  3QP5 A;  5B1A H;  3L00 A;  4Y4R A;  5BOX A;  1K61 A;  3TBI A;  1JE8 A;  1VQK I;  3RYR A;  3LFK A;  3CCM I;  2JSP A;  1LE8 B;  2W4S A;  3MFK A;  5M5W J;  4XLN F;  1LPQ A;  4A3K J;  2OTJ I;  1D1A A;  3GTL J;  5IYD J;  2Z5U A;  2HU9 A;  3M8F A;  4M9X A;  2D45 A;  3CLQ A;  5B3S H;  4CIC A;  5E1Z B;  2HPM A;  1N75 A;  3CES A;  3DBL B;  1IXS B;  1QBJ A;  4Q48 A;  4LB5 A;  2ZKZ A;  5EEH A;  5M5Y J;  3DLL F;  1ZAR A;  5KAF C;  2HS5 A;  2ZSI B;  4BHB A;  2A5W A;  2GZW A;  1ZLK A;  3LA7 A;  4GDF A;  1A6I A;  2RNJ A;  2LBF B;  1ZHF A;  2LP0 A;  4HQE A;  1ZRE A;  1DP3 A;  3QQA A;  5J4Y A;  4S05 A;  4L18 B;  4IHS A;  2CW8 A;  1DGR M;  1G8X A;  1W5T A;  3M8J A;  2DT7 B;  2V9V A;  5ILU A;  1PDN C;  4IQJ A;  2MBF A;  1LDK B;  3GTK J;  2V1X A;  2EBI A;  5GTI C;  2F5F A;  4RA2 A;  1XPX A;  4XIC A;  1O4X A;  3FXK A;  2F5E A;  2V79 A;  5FRM A;  2NOJ B;  3HHG A;  2IRF G;  3FXM A;  3S3N A;  1BI1 A;  3LQQ A;  3E6C C;  2YSR A;  2E2H J;  1H9T A;  1WJE A;  1KU2 A;  1KQ0 A;  4M6Y A;  5ICG A;  2DFI A;  5EG0 A;  1OCC H;  4G6D A;  4N0B A;  4IL6 C;  2VOO A;  4IHX A;  2MFZ A;  1UG0 A;  2ELK A;  3KP5 A;  2RQP A;  4XLC A;  2MGQ A;  1LJ9 A;  2YU3 A;  4XOT A;  2M7B A;  1VQ6 I;  1MMG A;  2FXA A;  4KN7 X;  4XLE A;  4FCY A;  3CD6 I;  1IV8 A;  2XSJ C;  1TW3 A;  4I0B A;  1Z7L A;  3K4N A;  1TQI A;  3JAM K;  3NEU A;  3K9T A;  4CCJ A;  3I59 B;  2G9W A;  3JCU C;  5JFR A;  3CUQ B;  1SC7 A;  2Z33 A;  2DK5 A;  3TKY A;  3GTM J;  1P4W A;  3BR0 A;  1FSH A;  4RLQ A;  2KIU A;  3W2W A;  3L2W A;  3IH3 A;  3D5S C;  5HNF A;  1TNT A;  2VIX A;  2DBB A;  4JQF A;  1Q1V A;  1V55 H;  3R61 A;  4GFB A;  3S3O A;  2PEX A;  1F5T A;  2NS7 A;  5LGT A;  5GP9 A;  4LIU A;  1Z3X A;  5DUI A;  2VE8 A;  2GM4 A;  1Z6T A;  3L2U A;  1R4N B;  3TDU C;  4OU0 A;  3Q0W A;  1LQ1 A;  1VQO I;  4BDZ A;  2CQK A;  3DWL E;  4CGZ A;  2LFB A;  2WAF A;  3KZZ A;  1FOX A;  3T0Y A;  2DCE A;  3X2Q H;  3GYH X;  2EIN H;  1BI0 A;  3HBL A;  2H1K A;  1FOY A;  4A3I J;  1GXQ A;  1YIO A;  2KRC A;  3L2C A;  3BC8 A;  1YIT I;  4CHU A;  3CF5 F;  1YW9 A;  1MDM B;  5J40 A;  3TMO A;  2R5Y A;  2LY9 A;  2ZME C;  2IA0 A;  2FX0 A;  3KIO A;  2L3D A;  1W1W E;  4A0Z A;  5IY5 H;  3M1C A;  4N9H A;  3H3Z A;  2JPB A;  1SFO J;  5HOD A;  3DPL C;  1G2H A;  1SAU A;  3KP2 A;  1HA8 A;  1QZZ A;  3RSN A;  5HDN A;  4HNT A;  4MLO A;  4KIF A;  2H09 A;  3OS1 A;  4DBR A;  1NTC A;  4NC8 A;  4PJJ A;  1R5H A;  1W5S A;  4LIV A;  1OCT C;  4BE1 A;  3CC4 I;  4EJW A;  2KRH A;  1AKH B;  1MIJ A;  1OPC A;  3WTY C;  2V1N A;  2VBX A;  3GWZ A;  5H6R A;  4DOZ A;  3LSK A;  5ICE A;  2NVU B;  4BQO A;  3T8R A;  3ZRG A;  1UFM A;  1ON2 A;  4D7M A;  1IW7 F;  2JTV A;  1I50 J;  4HF0 A;  2DU9 A;  2G0E A;  1MND A;  2DMN A;  4UV8 A;  3F23 A;  4DYR A;  1ZR2 A;  3BZK A;  3HSE A;  4OIQ F;  5D6E A;  4XRS A;  2JPC A;  1BC8 C;  3R6S A;  3H1C A;  2B9S A;  1T95 A;  2L4A A;  3DEE A;  3JRC A;  1ZRD A;  2PX9 A;  3CC7 I;  1S29 A;  1RET A;  1M1E B;  3AAF A;  1PYV A;  4G94 A;  3GTQ J;  4LLL A;  4OAY A;  1I27 A;  1D3Y A;  2MC4 A;  3GUD A;  2EIK H;  2HDW A;  4JOM A;  1GHC A;  2A5Y B;  1XGN A;  1SFE A;  3PM1 A;  4ZJZ A;  1FT9 A;  4I09 A;  2MC3 A;  1IG7 A;  3UKG A;  1FX7 A;  1IN4 A;  3O8G A;  2CQN A;  2EV5 A;  2NVY J;  2TCT A;  3CP2 A;  2I10 A;  5CYV A;  5E3O A;  5ICC A;  2W1O A;  2ZB9 A;  1K79 A;  1MZB A;  3BWG A;  3PSF A;  5B66 C;  2GIZ A;  1YI2 I;  3CLO A;  4C30 A;  2M8E A;  2DMQ A;  3L09 A;  1O7F A;  3W6J B;  3MCZ A;  5F27 A;  4U7D A;  3CMA I;  2D5V A;  2EFN A;  3JSO A;  1JUS A;  4D5C A;  3AL0 B;  5DCM B;  1TBX A;  4O5V A;  5DD8 A;  2VBZ A;  3HRM A;  3LOC A;  3F8C A;  2BHZ A;  2L7K A;  4L5J A;  1OIS A;  2E35 A;  5IT3 A;  4O6J A;  2HYF A;  3MAJ A;  1YHQ I;  4I02 A;  2UXN A;  2RC4 A;  2LLK A;  2P7C B;  2W7N A;  4B44 A;  1IXR C;  2AO9 A;  2FRH A;  2ZNZ A;  4M72 A;  1QPM A;  5JR3 A;  1J9I A;  2R7R A;  1MD0 A;  3K70 D;  1FIA A;  1YJN I;  4A3G J;  5LRR A;  1O57 A;  3S2W A;  1MBK A;  4DYQ A;  1I5Z A;  1I39 A;  1IN7 A;  1VF9 A;  2VI6 A;  2XDV A;  3ZQL A;  2Q1Z B;  4AIJ A;  4Y52 J;  2DYS H;  2EFQ A;  2QEN A;  3N05 A;  3PIO F;  3AKZ A;  2AQF A;  1X3W B;  1ZQ3 P;  1HW1 A;  1ZG3 A;  2K3P A;  2RV8 A;  3S1R J;  4HF1 A;  2DW4 A;  2C6Y A;  3OWT A;  4RMN A;  1S6L A;  2ZJR F;  2E1C A;  4BE0 A;  3EYY A;  4YEJ A;  1TLH B;  1V5G A;  3GX4 X;  2E1O A;  2XRO A;  3ESW B;  9ANT A;  1F43 A;  3GLX A;  2EA4 A;  5EZG A;  2MD0 A;  1KYZ A;  2ZO4 A;  4M3B A;  1E2X A;  1FBU A;  5BQT A;  3ABL H;  3FZV A;  5J6X A;  5E3M A;  3L2Q A;  1JJ8 C;  2E1N A;  4N4O B;  3WE2 A;  4CYC B;  2CFX A;  4AIK A;  2ADU A;  2OQR A;  3CF2 A;  4CZZ A;  1P7J A;  3QPT A;  1VQP I;  1WH5 A;  3ZMZ A;  4HZF A;  1G59 A;  2Y30 A;  1TT5 B;  3QPH A;  5D5V B;  3OOU A;  1IN6 A;  5TIS C;  3LSI A;  3NAR A;  2H8W A;  2IGO A;  3SQN A;  4WCG A;  2CYY A;  1ZKG A;  1AWC A;  2XF5 A;  2COM A;  3O2P E;  1HW2 A;  4OMY A;  4XBF A;  3H9J A;  3H36 A;  3I64 A;  5E1X A;  2VKD A;  1SVM A;  2K85 A;  2NXN B;  3E3V A;  2W48 A;  1OFC X;  3DPU A;  4RM3 A;  2JJ7 A;  4CO8 A;  3CMM A;  2K02 A;  4YIF A;  4FHT A;  4PJL A;  1U9N A;  2XPW A;  5CQE A;  1K83 J;  2FE3 A;  3CCR I;  1D1B A;  1P4X A;  5JI6 A;  1QQI A;  2L9R A;  1YQA A;  1WZ2 A;  4IXA A;  4CCK A;  2F4O B;  2ZXJ A;  3QOD A;  1STZ A;  2FOW A;  3ABK H;  1S5L C;  1LFU P;  1SD4 A;  2HQN A;  2HYJ A;  1G4D A;  3CJQ B;  4G12 A;  3JTH A;  4BY1 J;  4M6V A;  4EGZ A;  4RBO A;  3RKX A;  1OYY A;  2Y0S A;  3LAJ A;  3VFZ A;  1ZRF A;  4YII A;  1Z77 A;  3FM5 A;  1G6N A;  3IUO A;  3Q9V A;  5DDG A;  1TL8 A;  1B59 A;  3J7A O;  4P96 A;  4F3Q A;  3BR1 A;  4AD9 A;  2OPT A;  2FU4 A;  1IUY A;  5CVU A;  3PNY A;  2LMD A;  1FJL A;  1KU9 A;  2BHY A;  3BCA A;  4BDY A;  3PIP F;  1IUF A;  1GVD A;  4YG2 F;  4V2G A;  2BYV E;  5D6F A;  3GVA A;  2R5Y B;  4E7L A;  4UUT A;  4XSZ F;  1XCV A;  3PQJ A;  3J80 K;  1B8I B;  1LE8 A;  4KN4 X;  3CO6 C;  1X1C A;  4N4N B;  2JVH A;  4OIP F;  1VI0 A;  5DYM A;  4ETS A;  4PUS A;  2KJC A;  4NB5 A;  1KYW A;  2FML A;  4MHG A;  3W3C A;  2X6X A;  1T56 A;  3LST A;  2M2E A;  3KEO A;  1JXS A;  3R0J A;  3OIQ A;  2Y31 A;  4XOP A;  4AYB A;  4I01 A;  4MQV A;  1ETK A;  2LBF A;  2YS9 A;  3TGN A;  2K86 A;  1WJ5 A;  1IDZ A;  1YFH A;  2F6C A;  2OBP A;  4U88 A;  3IAS 2;  3ZCO A;  1T33 A;  1FBS A;  3GCM A;  1LVK A;  3SFI A;  3OYG A;  3FK6 A;  3BZ6 A;  3OL3 A;  2R7W A;  2BW3 B;  2BEO A;  2XV4 S;  2LF7 A;  1ON1 A;  3K1N A;  4EQQ A;  2LKX A;  3K6G A;  4JK1 X;  2X9D A;  2LTP A;  1V5E A;  3FIS A;  2QBY A;  3WHB A;  3HGY A;  3JAM Z;  1IC8 A;  1AOY A;  4IZZ A;  3QRF F;  1A35 A;  4EAT A;  4ESF A;  2HKX A;  2DOA A;  4MEX F;  4AYB N;  3BR2 A;  2Y0M A;  5K7H A;  1GUU A;  1ZEL A;  2JT1 A;  2DAO A;  1BBY A;  2DA1 A;  4DNC A;  2L9S A;  2KT0 A;  5F0H A;  1MBH A;  3F9K A;  4ITV A;  4UVB A;  2MW8 A;  3ZP5 A;  1LVA A;  3K0L A;  4ABZ A;  2D1V A;  2DJI A;  3QPS A;  1BOB A;  3OS2 A;  3SDB A;  1RUO A;  3SEZ A;  2LF8 A;  3FWE A;  2CO5 A;  2J5P A;  2PBI A;  3K1M A;  3EQL F;  5DS9 A;  2QVO A;  1S7E A;  2VC0 A;  3IH2 A;  1KA8 A;  4FT8 A;  3DBH B;  1J2X A;  5TGT A;  1T6S A;  3KLO A;  1X58 A;  1O3Q A;  1K7A A;  3KCC A;  2YUS A;  1CF7 B;  2XB5 A;  3PNV A;  5ILS A;  3LSH A;  3CUQ A;  5B1B H;  1HC8 A;  2V9P A;  2PQ8 A;  3ISP A;  2VC1 A;  4XK4 A;  3NWS A;  2B63 J;  1YS7 A;  2E1M C;  5HS8 A;  4G6Q A;  4RGS A;  5H2F C;  3ZQ7 A;  2K3F A;  5FB2 A;  2OCE A;  1RR8 C;  2CJJ A;  4NBQ A;  3ULQ B;  3PO3 J;  1I6X A;  3QU6 A;  3RPU D;  4R8H A;  5IP9 J;  2KIQ A;  4PJM A;  3RPQ A;  4BQA A;  4CCM A;  2CV1 A;  1J59 A;  4HLX A;  4IHV A;  3WG9 A;  1ETW A;  2VKV A;  4RLF A;  3VOD A;  3I56 I;  4EGY A;  2VT3 A;  3QWL A;  4PSX A;  3EYI A;  1F9N A;  5KAI C;  1NK3 P;  1A6Q A;  2QF7 A;  2F4I A;  4HV5 A;  3WHC A;  3ML6 A;  4EVI A;  3J81 K;  3MMY B;  1VQL I;  4KMF A;  3VYS B;  1YO5 C;  1KGS A;  5CKT A;  2RKH A;  2Z9O A;  3G1M A;  3HOY J;  5JLX A;  3GBG A;  3M3Y J;  2K4B A;  2LRE A;  3VPR A;  2YPR A;  4NC7 A;  5FD6 A;  2G7H A;  3MN2 A;  4FX4 A;  5HS9 A;  2PI0 A;  3ASO H;  2ECC A;  4MIM A;  2E60 A;  2PN6 A;  2UWM A;  1HKQ A;  4GYG A;  2VB6 A;  3U9G A;  3HDD A;  1I6H J;  4WXC A;  2QWW A;  5DV5 A;  1MBE A;  3U1D A;  3SJM A;  1DPU A;  2MSY A;  4MO7 A;  3C2B A;  3DP7 A;  5E3N A;  4J01 A;  1IRG A;  1PVE A;  5J3L A;  3CZ6 A;  2W57 A;  4C2T A;  2RNG A;  2R7Z J;  5KVR A;  2OZU A;  3OYC A;  2DFH A;  2QKL B;  3BTC A;  1ZRC A;  3H3U A;  1AA7 A;  1E3H A;  4HRI A;  3I58 A;  3J7Y J;  3FHN A;  1AKH A;  3GFM A;  4Y17 A;  1WSU A;  3FXQ A;  3LSP A;  3F3X A;  2WAE A;  3P9K A;  3BRO A;  4DIQ A;  5GAH J;  1X3Z B;  3HHH A;  3MWM A;  1ZN2 A;  2ID6 A;  3FM3 A;  2RRE A;  3NAU A;  4NNJ A;  2QSH X;  2Q2E A;  4LIT A;  1WH7 A;  3W2V A;  3WU0 A;  3H0D A;  1TQP A;  4FET A;  4UUV A;  2EFO A;  3H5A A;  1Y8R B;  1R1T A;  1D8J A;  2WWY A;  2FBK A;  4A3C J;  3ZN0 A;  2YX4 A;  3BG7 A;  3QOP A;  1BR4 A;  3OYH A;  1QHG A;  4Q4Z F;  1HCR A;  2XAU A;  2AQE A;  1HF0 A;  3M8E A;  2ZME B;  3CCL I;  5IPA A;  1YW7 A;  2CV2 A;  1LUJ B;  1Y56 A;  4LOC A;  1ZH5 A;  2NVQ J;  2IS6 A;  4Y3O A;  1O7L A;  2QQB A;  2HQR A;  2KQR A;  4DZJ A;  3H3V K;  2X1D A;  1YX5 A;  5M3F J;  4B4C A;  1R7J A;  4OOI A;  2IAI A;  1EA3 A;  3HM5 A;  3OOP A;  4BHP A;  4BE2 A;  3RPU A;  3WTU C;  1I1G A;  4Z2Y A;  3L2V A;  3E6B A;  1J7K A;  2CUE A;  3RIR A;  4ON0 A;  1U8B A;  1OLT A;  3HRU A;  3VYT B;  1BR2 A;  3H9Q A;  1BN5 A;  2XGC A;  5C4X J;  2CQ7 A;  3KZY A;  1FIP A;  4A3E J;  4ZZL A;  2IGK A;  3E5U A;  4XKW A;  5IOY A;  2XF7 A;  2OZ6 A;  3H0G J;  4BXU A;  1E0E A;  2ACJ A;  4G8X A;  3AG4 H;  4QIW N;  1IN8 A;  5HLH A;  2LD5 A;  3A2K A;  4DYC A;  3CDL A;  4B3A A;  2P5L C;  5ILV A;  2CS3 A;  4JX6 A;  1GXP A;  3DBR B;  3OSF A;  3F0C A;  3ZQF A;  2XGX A;  4PGH A;  3K4B A;  3GTJ J;  1Z05 A;  1MNM C;  3HYI A;  1I3A A;  1Q1H A;  1SVL A;  1VND A;  2AXL A;  2CH0 A;  2XRL A;  3HL2 A;  3GTP J;  2TDX A;  3RQ4 A;  1BOA A;  3LSG A;  3H5N A;  4CCO A;  4I76 A;  3UR3 C;  3FHZ A;  3A02 A;  2GA1 A;  1E3O C;  2XF6 A;  4EJO A;  1Z3Y A;  2ZFW A;  2LY1 A;  3GTO J;  2DTZ A;  3VB2 A;  3P9C A;  1R5I D;  1HQC A;  3TW6 A;  4E7Z A;  2V9K A;  2E34 A;  2K27 A;  1A36 A;  1JKO C;  3WTZ A;  3AFH A;  2PJR A;  3QP6 A;  2ME0 A;  1R23 A;  2VKH A;  1BR1 A;  5F08 A;  1UST A;  3S1Q J;  3LL7 A;  3LSJ A;  3DU5 A;  4HG2 A;  2VQC A;  4C2U A;  1W4M A;  3LAP A;  1FSE A;  5IP7 J;  5K5O A;  2DYR H;  2QBY B;  2A6H F;  2DDA A;  4P1W A;  4HSR A;  4CYC A;  3HUG A;  1X1P A;  1LDJ A;  3GEZ A;  4UB8 C;  1YS6 A;  1V54 H;  2DT6 A;  2NAZ A;  2ZSH B;  3JW4 A;  3RDI A;  3HRT A;  5J47 A;  3S15 J;  3IWF A;  4PJ0 C;  2KIM A;  4NDL A;  3IH4 A;  3SXY A;  5M5X J;  2R0Q C;  3JRH A;  4XRM A;  2R7V A;  3S14 J;  4G6T B;  4XKB A;  2EPF A;  1JKP C;  4F55 A;  2H8R A;  1XDU A;  2XAJ A;  3VSL A;  2VE9 A;  3ZQQ A;  1H8A C;  1T0F A;  2A61 A;  3CP8 A;  4ZYG A;  5C3E J;  1RZ4 A;  1Z6R A;  4KA4 A;  2IP2 A;  2BXZ A;  5JVT A;  4WXD A;  2F4M B;  4E7J A;  2L9V A;  1ZYR F;  3HSF A;  2EFW A;  1IDY A;  2FEZ A;  1XSX A;  3H5R A;  2V26 A;  1NH3 A;  3OL4 A;  4ZTF A;  1W0U A;  1HKS A;  2X51 A;  1YE9 A;  3CCQ I;  2VXZ A;  4KIC A;  4A0Y A;  1B6A A;  1U5T C;  2A6E F;  1TWF J;  2O6G E;  2TRT A;  1FYL A;  2XAH A;  3V8J A;  4Y13 A;  2HNH A;  2WAD A;  1EV7 A;  5L3B A;  2VBY A;  4MFE A;  3BPX A;  3OR2 C;  4CCN A;  2EV0 A;  3ECO A;  3WTT C;  1N78 A;  2OUM A;  3SZG A;  1ZTR A;  2KMU A;  3J80 Z;  3JRI A;  4E70 A;  4E7K A;  3HOZ J;  1V4R A;  5FO5 A;  3T5X A;  3MKY B;  1KZH A;  4XRF A;  1KQ8 A;  3L2R A;  5CVI A;  2DA6 A;  2NYX A;  4AID A;  2HTS A;  3ZGK A;  5BPI A;  1Y1V J;  5F04 A;  1Z91 A;  1IV6 A;  4QTR A;  5J4V A;  3I4P A;  2HXO A;  2M34 A;  2QKM B;  4UV9 A;  1DU0 A;  3E6M A;  1USS A;  1QVU A;  4CSW A;  4BGD A;  4UY8 I;  2H6B A;  1B8I A;  1HOM A;  4ZTJ A;  3K4C A;  4OMZ A;  1HLV A;  2QSG X;  3BG3 A;  2ZXW H;  2XB0 X;  4IF4 A;  5J1R A;  1MMA A;  1S9H A;  2EZL A;  1AU7 A;  1B9N A;  1WRJ A;  4P55 A;  4IQ4 A;  4A5M A;  1ETX A;  4B43 A;  5KCM A;  4Z6Y A;  4MGR A;  3SHF A;  1QRY A;  1L3L A;  2O3F A;  3JRF A;  1OCR H;  4E7I A;  4WX9 A;  5K7F A;  2QA4 I;  1VZ0 A;  2M9H A;  2PMH A;  5ICF A;  5L3F A;  3OYA A;  2WY7 Q;  2R7X A;  5LRS A;  2ZXH A;  2VBW A;  1VTN C;  1D0Z A;  3HTS B;  3HZJ A;  4ZYD A;  4P9U A;  3WTS C;  3IKT A;  2KDZ A;  2PMZ A;  2Q2E B;  4BH9 A;  4A3M J;  2BW3 A;  4ZYA A;  4AVP A;  3O3K A;  5K7Z A;  5K5R A;  4BBR J;  1IXC A;  3OIP A;  2ESN A;  3BJO A;  4UUS A;  2W82 A;  3HB9 A;  2ECB A;  1JHF A;  5EZH A;  3VEP A;  4IKF A;  1OKR A;  5BNG A;  2A07 F;  3KYC B;  3G4S I;  5AIP A;  1D5Y A;  3CCV I;  4AIH A;  2M4G A;  5EGO A;  4G9Y A;  2ISZ A;  3PJR A;  2OV7 A;  2EA2 A;  5DD4 A;  2F2E A;  2GOX B;  1T38 A;  3GFJ A;  3OYN A;  1Z0X A;  2M30 A;  1JGG A;  4ZDO A;  3LFU A;  1VQ9 I;  2OAZ A;  4QLC U;  2P6T A;  4YFK F;  2L5Q A;  2X4H A;  2ZC2 A;  5GAG J;  1Y0U A;  3VYU B;  4U0V A;  5DUK A;  1CF7 A;  2E36 A;  4BU2 A;  3JR9 A;  4YEL A;  4HV6 A;  4LLG F;  4BNC A;  2FA5 A;  5AON A;  2DPU A;  4NHJ A;  2H6C A;  3BG5 A;  3RCO A;  1S7A A;  1SEU A;  5DEQ A;  4P5O A;  3SYT A;  2FD5 A;  2GBY A;  3J81 Z;  4XLF A;  3CCE I;  3FF5 A;  2L9N A;  3VDX A;  1D0X A;  1XX5 A;  2O5R A;  1KU3 A;  3OMY A;  2K5C A;  3IRR A;  5J8F A;  3C3W A;  1RNL A;  3CCY A;  2DLL A;  2LNB A;  4EJU A;  4H0E A;  1IGN A;  1WJB A;  3DTI A;  4KT6 A;  2L2O A;  1RUN A;  5HLT A;  1WFX A;  4XOR A;  4D1Q A;  1QA6 A;  2VXD A;  3J7A Y;  2W24 A;  2HWV A;  1QGP A;  2KIF A;  3T8T A;  2XAG A;  1Z1D A;  4LJZ F;  4LLN A;  4C2M J;  2GXG A;  3HJE A;  1MGT A;  3L7W A;  1ERD A;  2P8T A;  1FLI A;  1H0M A;  2WAQ A;  4Q47 A;  4HW0 A;  2JVG A;  5CVJ A;  5B5E C;  2STT A;  3LQR A;  4XRS G;  3MKW B;  1R9T J;  1ZAO A;  4RGU A;  2PJR B;  2RDP A;  2QQ8 A;  4L9T A;  2VLA A;  2AS5 F;  1XB4 A;  2I8D A;  2VQL A;  2M4K A;  3CQZ J;  4RM2 A;  3Q3S A;  1ODD A;  2E1M B;  3CME I;  2DOD A;  3QYB A;  4HDU A;  2YU9 J;  1J09 A;  3SEQ A;  1K6Y A;  2VPR A;  1HDD C;  3I9V 2;  4BJT A;  4W1U A;  1EJ9 A;  2HZT A;  4IX7 A;  2FUG 2;  3HUG B;  5ERI A;  1GT0 C;  5FFZ A;  1W7P A;  2ME6 A;  3IL2 A;  2IGM A;  2IGN A;  2JA7 J;  1SMT A;  2DTR A;  1A5J A;  1E3P A;  4M6X A;  5D4S A;  2M7A A;  3K4M A;  2IA2 A;  1W5C C;  5FD5 A;  3TDZ C;  4HX4 A;  6PAX A;  2R7O A;  3A1Y A;  5CQG A;  2FNA A;  4KNY A;  3T1B A;  5HLI A;  2ZXI A;  3KEY A;  1MJ9 A;  1JGS A;  5HDG A;  3EUH C;  3E0J B;  3GZ5 A;  3CCU I;  1BA5 A;  2HTJ A;  1ITY A;  2ZME A;  2A6T A;  2X0L A;  3F6V A;  3KFW X;  1B9M A;  2M5W A;  3DLA A;  1BL0 A;  1ETO A;  2L7M P;  3OYL A;  1J75 A;  1REP C;  3DQV C;  1AHD P;  2KDO A;  1D5V A;  3W6V A;  1SFK A;  4HDV A;  4ZYE A;  1UHM A;  3GF2 A;  2L4M A;  4HLY A;  4ZH4 F;  3TO9 A;  3BTI A;  1SD7 A;  4LK1 F;  2E5Z A;  3GME A;  2VQH A;  3SDG A;  5HLG A;  2O8X A;  1N25 A;  3FXR A;  2J5O A;  1VQ5 I;  2HVR A;  5CJ9 A;  4BEH B;  3K4J A;  3O8H A;  5F1J A;  3HOV J;  2LVS A;  2HDD A;  1U0J A;  2CUZ A;  3S8P A;  3U1K A;  2B7E A;  4A6E A;  3WTW C;  4PSW A;  2BVL A;  4CDG A;  3RKW A;  2KRF A;  2GAU A;  2ID3 A;  2DOF A;  1XMX A;  5FKM A;  1BW6 A;  3KE2 A;  1HBX G;  2L7Z A;  2JZY A;  2XAQ A;  3FIW A;  4F93 B;  4XKC A;  1T8I A;  2BY3 A;  3DV8 A;  2QSF X;  2KPM A;  3EPZ A;  2OQG A;  3WOD F;  2RGV A;  4J19 A;  3W2A A;  1QZE A;  3ZQC A;  4V19 K;  2NS8 A;  3QOE A;  4BJ6 C;  2YX7 A;  4BAY A;  1B4A A;  2QYO A;  2XPU A;  2KFD A;  1HST A;  4RDU A;  4HX8 A;  5CPR B;  3V8L A;  1R5G A;  2Y0S N;  4A3F J;  4PFO A;  3KPH A;  2O8K A;  4XLH A;  4BYY A;  2P4W A;  4QPO A;  5E20 A;  3FMR A;  2HI3 A;  4HX7 A;  2HOT A;  4TV7 A;  2FOK A;  2EK5 A;  3ZQH A;  2OJE D;  5FKN A;  2HDC A;  3ROU A;  1MMD A;  3OYI A;  3TW7 A;  1D8K A;  3HOS A;  4YFN F;  4BJ5 C;  4R79 A;  5F1R A;  4IHW A;  4M3G A;  2XKO A;  3I4N J;  2UV1 A;  4KIG A;  5C44 J;  3TQN A;  4U7B A;  2NNN A;  3F8B A;  3CJT B;  2STW A;  1FTT A;  1P6R A;  1V3F A;  4IJA A;  3RKY A;  1MMN A;  1PP7 U;  2EZI A;  3FK7 A;  2MLG A;  1E17 A;  4UUS B;  1WWX A;  5GTH C;  4NQW B;  3G2B A;  3PQK A;  3B02 A;  2HXI A;  2DMU A;  2DO7 A;  4RAG A;  3L1P A;  2YR2 A;  2G7U A;  2COB A;  3DFG A;  4HEA 2;  1W36 C;  3BCB A;  1QZY A;  3HKZ A;  4AM3 A;  2Z16 A;  4EM0 B;  4HPQ A;  1HXD A;  2KJB A;  4XR6 A;  3S3M A;  4Y7N J;  3AL0 C;  2K9Q A;  2IJL A;  3ZN1 A;  5EGO B;  1JHH A;  4B8X A;  3MZY A;  5J1Y A;  4FE7 A;  4HQM A;  4M71 A;  2JA6 J;  4UXN A;  3IRQ A;  1LEA A;  5EEG A;  3EDP A;  4MQ9 F;  3TP3 A;  3OV8 A;  1VQ7 I;  4CA0 A;  1OR7 C;  4J00 A;  3RI4 A;  1K4T A;  4BBS J;  4LB6 B;  1D0Y A;  2ZFU A;  2HKO A;  3FX3 A;  1WVR A;  2EV6 A;  2D1H A;  4AWX B;  5LD2 C;  2P0W A;  2H27 A;  2KLO A;  2LSO A;  1TWA J;  3GZ6 A;  1MNE A;  1P2F A;  2HYG D;  4BKX A;  3I71 A;  1OCO H;  2ZJ2 A;  1NHA A;  3ASN H;  2E2J J;  1IRX A;  1EF4 A;  2LYC A;  3ZQI A;  1RPW A;  2EIL H;  1IAW A;  1SFU A;  1K78 B;  2DMT A;  1NG7 A;  4LMY A;  1FMW A;  2LOO A;  5FGM A;  2PG4 A;  4LG3 A;  2R3S A;  5LBQ A;  1O3T A;  2K9L A;  2EB7 A;  4I98 B;  2A3S A;  3E5Q A;  1FOK A;  2ELH A;  4HST A;  1X4P A;  4BUP A;  4RB3 C;  1EKE A;  2ELJ A;  1H9G A;  3HXL A;  4DJA A;  1J0R A;  2W25 A;  1V5F A;  2FQ4 A;  2QM3 A;  1ETQ A;  1YX3 A;  1R58 A;  3GFI A;  4DW6 A;  4DGW B;  1YIJ I;  2ZCW A;  1HKT A;  1FMV A;  5GAE J;  2K9N A;  3QYF A;  3TL4 X;  1EH7 A;  2QQ9 A;  3C2G A;  3U2R A;  4F7Z A;  4G7Z F;  4B48 A;  3GXO A;  1R6R A;  4MFD A;  2XKP A;  3M1E A;  2DA7 A;  4YRV A;  1XMK A;  2ZBK A;  4BQQ A;  4M9S A;  4U0W A;  3C7J A;  3N97 A;  3OYM A;  1S72 I;  3BTJ A;  2FBI A;  1U5T B;  4GO1 A;  3IKV A;  3OYF A;  4KFC A;  2DA4 A;  1P4A A;  3FXJ A;  3DKY A;  1OJL A;  2CW7 A;  3I53 A;  2BE5 F;  1W7P B;  1F36 A;  3KX2 A;  2DMP A;  2VON A;  1Y8Q B;  1BJZ A;  4L5I A;  5HVQ C;  4E7S A;  1S7O A;  4M3E A;  2HVQ A;  2L7F P;  4IOA F;  2LKS A;  2NVT J;  4LG0 B;  1RES A;  1XC5 A;  5L3C A;  2O7O A;  3H9G A;  2LDU A;  1FTZ A;  1ZGJ A;  1GDT A;  2P6S A;  4ENM A;  2ZJQ F;  1LKX A;  3VYR B;  2WBM A;  2JRT A;  3FDY A;  3G6E I;  4IEJ A;  2FMY A;  4XL9 A;  1JUM A;  3V7S A;  1G3Y A;  3BR3 A;  4BS9 A;  3F8F A;  1WJD A;  2MYS A;  1SAN A;  1U3E M;  2WV1 A;  2Z3Y A;  3A0B C;  3BTL A;  2UZK A;  2BV6 A;  3I4M J;  2EFP A;  3KP3 A;  1GV5 A;  2JUC A;  1B72 A;  3FKJ A;  3M4O J;  2CRG A;  1XG1 A;  4L0Z B;  1MJB A;  2MD5 A;  1Z9C A;  1F1Z A;  1OCZ H;  1X1B A;  2WTE A;  2XGD A;  2PLY A;  5E79 C;  2R92 J;  1JTX A;  1X2M A;  3ZQG A;  5LGU A;  2PFB A;  2XUB A;  3SFZ A;  5LGN A;  3S1M J;  1FBQ A;  3EET A;  2IS4 A;  1MSF C;  2GA2 A;  1NG6 A;  1YTY A;  3TOA A;  1R49 A;  3S2D J;  1DPR A;  1PUE E;  4KIT B;  4DBQ A;  3OYK A;  3P9I A;  2CUF A;  2L02 A;  5BS6 A;  4HYE A;  2BY2 A;  2CSO A;  4A3J J;  4RGR A;  3S32 A;  3TO6 A;  5E8I A;  2L01 A;  2DOE A;  4PZJ A;  3K1P A;  4RAF A;  3RYP A;  5LLQ A;  4I7H A;  2IA1 A;  2GXA A;  3K4L A;  4HA8 A;  2VN2 A;  4JX5 A;  1RR7 A;  2W84 A;  3F8N A;  2Y9Y A;  1DUX C;  3DKX A;  4FQG A;  1PJR A;  2V4J C;  4OIO F;  1T2K A;  1A31 A;  5LHI A;  5HS7 A;  5HOO A;  4LD5 A;  1VQ8 I;  3K69 A;  2R7F A;  1T98 A;  4M9Z A;  1RIO H;  4E4H A;  2LK2 A;  2D2W A;  1MBJ A;  2MAB A;  4ZC3 A;  2KL4 A;  4I2O A;  3ZMU A;  3FBI B;  5E18 F;  2F48 A;  1B1B A;  4RB0 A;  3G1O A;  1FP2 A;  4D9J A;  3DTK A;  5FKO A;  1OCP A;  5DTD A;  4OIR F;  2N8G A;  3WE3 A;  5IYB J;  1XD7 A;  2OU2 A;  2DT5 A;  1F4K A;  2CW0 F;  1P9Q C;  5CVV A;  3HGG A;  1X2N A;  2CU7 A;  1TQM A;  2CUJ A;  5EEA A;  4BQN A;  3JRG A;  1PP8 F;  1JKR C;  4XLP F;  5EF6 A;  1U78 A;  4Y15 A;  1YRN B;  1ACI A;  3PFY A;  3K4K A;  1JJ6 C;  3PL8 A;  4K2E A;  5FLV A;  3HPG A;  2R7S A;  2HQ5 A;  2X1E A;  1BC7 C;  1T08 B;  2BBY A;  2HZD A;  3A0H C;  1TZL A;  4V2F A;  4L9J A;  4A12 A;  5ED4 A;  1TTY A;  1XGM A;  4PDK A;  4ZZD A;  4PK4 A;  3GLL A;  3OYD A;  4OWR B;  3CJN A;  5GPA A;  3N4M A;  5EJC A;  3K10 A;  4NUB A;  4MTD A;  2Z2S B;  2CV0 A;  3FXL A;  4ANJ A;  1DQU A;  2M87 A;  2HVS A;  1W0T A;  1RRJ A;  4XNF A;  1MKM A;  4FX0 A;  4CYD A;  3IWZ A;  2B0L A;  2OA4 A;  3ABT A;  2K40 A;  3BQZ A;  3HC7 A;  3WU2 C;  4ESB A;  4NC6 A;  1QO0 D;  1KQ9 A;  4X0G A;  1X1A A;  1I3Q J;  2JQ7 A;  4C3I J;  1MSE C;  5E1W A;  1WJC A;  1ZK8 A;  3HG9 A;  3ZPL A;  2V7F A;  1LDD A;  4RB1 A;  4MTE A;  1L0O C;  2VUM J;  2P5V A;  4A69 C;  5D5U B;  3F21 A;  1SD5 A;  1BM9 A;  4A3B J;  1LFB A;  3I54 A;  2EZK A;  1OYI A;  1K6O A;  3KZI C;  2LKP A;  1WKM A;  2R93 J;  2MA3 A;  1WCM J;  2R4G A;  4BEH A;  4OAZ A;  2JRM A;  4L0Y B;  4BXF A;  4HOB A;  1DP7 P;  2EWN A;  3FKI J;  4LGW A;  4KT5 C;  1ZLJ A;  3ABM H;  3Q5F A;  3R0A A;  1UHS A;  2VPL A;  3KYD B;  2EIM H;  3BP8 A;  3QPL A;  4HNV A;  1TP4 A;  2DN0 A;  2JA2 A;  1I1S A;  4F91 B;  3RTR A;  3COA C;  1FPQ A;  5FRN A;  4AC0 A;  3CDI A;  2A05 A;  2QQA A;  1X19 A;  3I3L A;  1FNN A;  4QSH A;  2IEK A;  1Z7U A;  2LRD A;  3E6D A;  4I6Z A;  1YYV A;  3S2H J;  1FY7 A;  3U21 A;  1DDN A;  3P5J A;  2P81 A;  2XAS A;  2QGU A;  2BXY A;  4GRI A;  1XMA A;  3F6O A;  1MMS A;  2M3A A;  2JSC A;  1D1C A;  2HR3 A;  5D4R A;  1Y0N A;  3BPV A;  2XGE A;  2KZG A;  4XSX F;  3A01 B;  1UJ8 A;  2OCC H;  3WGH A;  1TW2 A;  1RI7 A;  4RAY A;  4IVN A;  3Q9S A;  4D7N A;  3OYB A;  4KJZ A;  3VWB A;  3WU1 B;  4KYW A;  2BVM A;  4BAC A;  4KMU X;  1VQM I;  4I99 C;  2KKO A;  2NOG A;  1Z67 A;  4JYK A;  2Z99 A;  4Y33 A;  5FRO A;  2LR8 A;  5LEK A;  1HDP A;  3D5L A;  1JT0 A;  1CQT A;  3ZMD A;  2CFO A;  3V7C A;  1C0W A;  1JKQ C;  1XDS A;  4IOC F;  2V1U A;  4D0P A;  3ABU A;  1IRF A;  3B73 A;  4HF2 A;  4NQW A;  1ETV A;  1LB2 A;  2DPD A;  2F5V A;  2F5C A;  4B47 A;  3MZ8 A;  2FSW A;  2Q0O A;  4EMS A;  1W7P D;  2EH3 A;  2GOM A;  3K70 C;  1XGO A;  4IRI A;  4B1R A;  3TED A;  3E1S A;  2F5D A;  4JP0 A;  2XHK A;  5DM6 F;  1WHU A;  5IT9 K;  2WA0 A;  1NK2 P;  4M3F A;  3ERM A;  2QEX I;  1U6G A;  3DF8 A;  2R5Z B;  1BW5 A;  2DFE A; 
#chains in the Genus database with same CATH homology
 5F1J A;  2PMZ N;  3O8H A;  3QQA A;  3HOV J;  2LVS A;  2HDD A;  1ENH A;  5FKK A;  1FEX A;  3G1M A;  3HOY J;  4FE4 A;  3GBG A;  5JLX A;  3M3Y J;  1B72 B;  3GTK J;  3VPR A;  2EBI A;  2ID3 A;  2FJ1 A;  3MN2 A;  5FKM A;  1BW6 A;  2ECC A;  4XIC A;  2L7Z A;  4MIM A;  1O4X A;  3FIW A;  3HDD A;  1I6H J;  3BG9 A;  4FIS A;  1MBE A;  2IBD A;  2JK3 A;  3SJM A;  4J19 A;  2E2H J;  2MSY A;  2HOS A;  1RKT A;  3ZQC A;  4MO7 A;  2NS8 A;  3C2B A;  3S16 J;  5E3N A;  5EG0 A;  5J3L A;  1ZR4 A;  2XPU A;  2Y9Z A;  2R7Z J;  3OSG A;  4IHX A;  4RDU A;  5IOZ A;  2ELK A;  3BTC A;  2Y0S N;  4A3F J;  2MGQ A;  2K9S A;  2O8K A;  2DA5 A;  4FCY A;  1AKH A;  3LSP A;  2HI3 A;  2HOT A;  3ZQH A;  2ID6 A;  1WPK A;  3OIO A;  3NAU A;  5FKN A;  1WH7 A;  3HOU J;  3BQY A;  3IV5 A;  3TW7 A;  4IHW A;  4A3C J;  4L5E A;  4M3G A;  3I4N J;  3GTM J;  4X6A J;  5C44 J;  5FLM J;  3BR0 A;  1HCR A;  1HF0 A;  5IPA A;  1FTT A;  4A93 J;  2DA2 A;  3IH3 A;  4IHY A;  2EZI A;  3FK7 A;  4LOC A;  4UUS B;  1Q1V A;  4GFB A;  2NVQ J;  2HXI A;  2DMU A;  4DZJ A;  2NS7 A;  3L1P A;  3H3V K;  2COB A;  5F0C A;  5GP9 A;  5F0F A;  5M3F J;  4B4C A;  2GM4 A;  2JA5 J;  2IAI A;  4Y7N J;  3HM5 A;  3Q0W A;  2K9Q A;  5EGO B;  1WI3 A;  2CUE A;  5C4J J;  3E7L A;  2LFB A;  1U8B A;  5IP6 A;  5J1Y A;  4FE7 A;  2JA6 J;  2XGC A;  5C4X J;  2WAQ N;  3TP3 A;  3HBL A;  2H1K A;  1FIP A;  4A3E J;  4A3I J;  2XSD C;  4BY7 J;  4BBS J;  5IOY A;  1XS9 A;  2QCO A;  1RKW A;  3H0G J;  2R5Y A;  2LY9 A;  1PUF A;  4QIW N;  3RZD J;  2FX0 A;  2LD5 A;  4DYC A;  1TWA J;  3CDL A;  4B3A A;  4BKX A;  4JX6 A;  1SFO J;  3OSF A;  3F0C A;  3ZQF A;  5HOD A;  1G2H A;  2E2J J;  1EF4 A;  3GTJ J;  1MNM C;  1APL C;  4MLO A;  3ZQI A;  5EG0 B;  1RPW A;  3BT9 A;  1VND A;  1NTC A;  2X48 A;  2DMT A;  2XRL A;  3GTP J;  3LSG A;  1OCT C;  4I76 A;  4A3L J;  3A02 A;  1E3O C;  1AKH B;  3GTO J;  2DTZ A;  2EZH A;  3S17 J;  1U9O A;  3TW6 A;  2FQ4 A;  4D7M A;  1I50 J;  1JKO C;  1ETQ A;  2G0E A;  3RQI A;  1JUP A;  4DW6 A;  2DMN A;  1ZR2 A;  3MKL A;  4DYR A;  2ME0 A;  4XRS A;  5F08 A;  3S1Q J;  2K9N A;  1TC3 C;  3LSJ A;  3JRC A;  3A03 A;  4MFD A;  1RET A;  2JN6 A;  3GTQ J;  5IP7 J;  3JRB A;  2DA7 A;  5GPC A;  4CYC A;  3G1L A;  2AHQ A;  3S15 J;  1ETY A;  1GV2 A;  3BTJ A;  2E2I J;  3PM1 A;  1IG7 A;  4NDL A;  2DA4 A;  3IH4 A;  3UKG A;  5M5X J;  3O8G A;  2R0Q C;  2NVY J;  2TCT A;  3JRH A;  2I10 A;  3BR5 A;  5E3O A;  4XRM A;  3S14 J;  2ZB9 A;  1OJL A;  1JKP C;  2H8R A;  1F36 A;  2DMP A;  2DMQ A;  3DCF A;  1H8A C;  1BJZ A;  5F27 A;  1ORK A;  2D5V A;  5C3E J;  1JUS A;  4D5C A;  4M3E A;  2OF7 A;  2L7F P;  2NVT J;  3LOC A;  1RES A;  1XC5 A;  2O7O A;  1IDY A;  3K2A A;  3D1N I;  1FTZ A;  1GDT A;  5EYR A;  1W0U A;  3LNQ A;  2LLK A;  4M3D A;  1TWF J;  4XID A;  2AO9 A;  2TRT A;  1MBG A;  4IEJ A;  4A3G J;  1FIA A;  1JUM A;  1YRN A;  3BR3 A;  4MFE A;  1MBK A;  4DYQ A;  2O9L A;  1SAN A;  1VF9 A;  2VI6 A;  2WV1 A;  4Y52 J;  3ZQL A;  1ZTR A;  3JRI A;  2RAE A;  3HOZ J;  1DU6 A;  3BTL A;  1ZQ3 P;  3I4M J;  3S1R J;  1GV5 A;  1B72 A;  3M4O J;  3RZO J;  2CRG A;  1XG1 A;  2CQQ A;  3HOW J;  2DA6 A;  1TWC J;  1WGX A;  1Y1V J;  5F04 A;  2CQX A;  2E1O A;  4W97 A;  1IV6 A;  3MVP A;  9ANT A;  2XGD A;  1F43 A;  4QTR A;  2R92 J;  1JTX A;  1X2M A;  3ZQG A;  2HXO A;  2M34 A;  5EZG A;  3S1M J;  1DU0 A;  1QVU A;  4S0H B;  4M3B A;  5JLW A;  1MSF C;  1B8I A;  1HOM A;  4C3J J;  1JJ8 C;  5E3M A;  3HKZ N;  3S2D J;  1HLV A;  3BG3 A;  4CYC B;  2XB0 X;  5J1R A;  2Y2Z A;  1AU7 A;  2EZL A;  2CUF A;  3S1N J;  3DEW A;  1P7J A;  2XPV A;  1WH5 A;  4A3J J;  2Y30 A;  1ETX A;  1QRY A;  1MBF A;  3K7A J;  3OOU A;  4JX5 A;  1RR7 A;  3JRF A;  2Y9Y A;  3Q0V A;  3NAR A;  5K7F A;  2M9H A;  2GLO A;  1ZKG A;  3LSR A;  2MG4 A;  3BR6 A;  1UMQ A;  3CMY A;  4BXX J;  2LK2 A;  1MBJ A;  2W48 A;  1OFC X;  2KDZ A;  4A3M J;  2JJ7 A;  3G1O A;  5K7Z A;  5DTD A;  5FKO A;  1OCP A;  2M0C A;  4BBR J;  2N8G A;  1U9N A;  2XPW A;  2L0K A;  5IYB J;  1K83 J;  4UUS A;  1MH4 A;  3HB9 A;  1POG A;  2ECB A;  5EZH A;  3HGG A;  1TWH J;  1X2N A;  2L9R A;  2CU7 A;  5BNG A;  3JRA A;  5EEA A;  3JRG A;  1JKR C;  1D5Y A;  5EF6 A;  1U78 A;  1YRN B;  2NVX J;  5EGO A;  1JJ6 C;  1LFU P;  5FLV A;  3Q0U A;  2HQ5 A;  2HYJ A;  4AUX A;  4G12 A;  4BY1 J;  1Z0X A;  4M6V A;  4RBO A;  4V2F A;  1JGG A;  3B6A A;  2DJN A;  5M3M J;  2HOA A;  5GPA A;  4JX4 A;  1Z77 A;  3A01 A;  4DZP A;  3ZOB A;  3JR9 A;  1W0T A;  3BR1 A;  2OPT A;  4D5F A;  5EDN A;  1H88 C;  3HEF A;  1FJL A;  2JA8 J;  3BG5 A;  1IUF A;  3B6C A;  1GVD A;  2FD5 A;  2GBY A;  4V2G A;  1H89 C;  3BQZ A;  2K40 A;  1MH3 A;  2R5Y B;  1P7I A;  4UUT A;  1PUF B;  2JWT A;  1B8I B;  1LE8 A;  1I3Q J;  3PO2 J;  4C3I J;  1MSE C;  1VI0 A;  1ZK8 A;  3HOX J;  3CCY A;  2DA3 A;  1QVT A;  4C3H J;  1IGN A;  1T56 A;  2VUM J;  4A69 C;  2M2E A;  2WB1 N;  2M8G X;  4A3B J;  1LFB A;  2Y31 A;  4FTH A;  2EZK A;  1ETK A;  2YS9 A;  2R93 J;  1IJW C;  2R5Z A;  1WCM J;  1IDZ A;  1ZGW A;  4C2M J;  1Y1W J;  1TWG J;  1T33 A;  2X6O A;  3FKI J;  3SFI A;  3FK6 A;  5FKL A;  1VFC A;  1JT6 A;  4XRS G;  1UG2 A;  3JRE A;  1R9T J;  2LKX A;  1UHS A;  3TP0 A;  2X9D A;  3GTG J;  2LTP A;  3FIS A;  3QPL A;  2JMW A;  3WHB A;  4HNV A;  3HGY A;  2DN0 A;  4X1E A;  1IC8 A;  5FJ8 J;  3CQZ J;  4AC0 A;  3Q3S A;  4AYB N;  3BR2 A;  5K7H A;  2EQR A;  1GUU A;  2YU9 J;  1HDD C;  2VPR A;  4QSH A;  2IEK A;  1JTY A;  2DA1 A;  2KT0 A;  4W1U A;  1MBH A;  5F0H A;  4I6Z A;  1QPI A;  2MW8 A;  3S2H J;  2P81 A;  4ABZ A;  3QPS A;  1GT0 C;  2ME6 A;  2JA7 J;  3RKQ A;  1A5J A;  2VKE A;  2E19 A;  5DS9 A;  1S7E A;  5J1U A;  3IH2 A;  2XGE A;  1IRZ A;  5IYC J;  3A01 B;  1X58 A;  4EEF G;  5E3L A;  4A3D J;  2YUS A;  2XB5 A;  4D7N A;  3JRD A;  4XK4 A;  2B63 J;  2NOG A;  4JYK A;  1K61 A;  2LR8 A;  1HDP A;  1CQT A;  1JT0 A;  1BA5 A;  1JKQ C;  1ITY A;  1LE8 B;  5M5W J;  2CJJ A;  4A3K J;  5IYD J;  1BL0 A;  3GTL J;  3PO3 J;  1ETO A;  2L7M P;  1AHD P;  5IP9 J;  3W6V A;  1ETV A;  2EH3 A;  5M5Y J;  4B1R A;  3TED A;  4IHV A;  3BTI A;  4JP0 A;  1ETW A;  2VKV A;  3SDG A;  1NK2 P;  4M3F A;  1A6I A;  2LP0 A;  1NK3 P;  3WHC A;  2QF7 A;  2R5Z B;  1BW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...