2Y0SN

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
total genus 13
structure length 64
sequence length 64
chains with identical sequence O
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y0sN00
3M3YJ 3CCYA 1JGGA 3QPLA 1VF9A 5F0FA 2CQXA 3JRFA 3FK6A 1PUFA 3TEDA 1IV6A 1VNDA 5F27A 4BY1J 1IJWC 2E19A 2XPUA 2ID6A 1TWGJ 2Y31A 5FKOA 3NAUA 1AKHB 2DA2A 3G1OA 5IOZA 4CYCB 4V2FA 2HDDA 2X48A 3HDDA 2XGCA 2XGEA 4ABZA 2HQ5A 1HDPA 4J19A 2DA3A 3RQIA 3S16J 4JYKA 1D5YA 1U8BA 2CUEA 2L7MP 2O7OA 3O8HA 1QPIA 2EBIA 1ZK8A 4X1EA 3S2HJ 2QF7A 3HOUJ 1JT0A 3QPSA 2ELKA 2ID3A 1ETWA 4EEFG 4FE7A 1RPWA 3I4NJ 4M3FA 1ENHA 1UHSA 3S1MJ 3BR3A 2XPWA 3CMYA 2MG4A 4QTRA 3MVPA 4JP0A 3A03A 5JLXA 3S14J 2E2IJ 4A3FJ 3DCFA 1LE8A 5IYBJ 2N8GA 2FQ4A 5IYDJ 3BQZA 2R5YB 2G0EA 5FKNA 4XRMA 3GTJJ 4D5FA 1QVTA 2HOSA 3FK7A 3QQAA 5E3LA 3FISA 4M3EA 3S1NJ 2EQRA 3S2DJ 3JR9A 5FLVA 2HOAA 3OIOA 2HYJA 3ZQCA 4B3AA 2EH3A 5FKMA 4XRSG 2DA6A 1RESA 2TRTA 4JX5A 1S7EA 1Y1WJ 2H1KA 3LOCA 2DMQA 5M5WJ 4A3GJ 5EZGA 3IV5A 1MH4A 3S17J 4A3MJ 1IG7A 3GTLJ 4L5EA 3HOZJ 5M5XJ 3I4MJ 3OSGA 5BNGA 3GTMJ 2JN6A 3GBGA 2VUMJ 3FKIJ 1FEXA 3G1MA 5FJ8J 5F1JA 1FIAA 5EZHA 2DJNA 1XS9A 5EGOA 2HXIA 2DA1A 1O4XA 3JRIA 3B6CA 1X58A 5E3OA 3BR2A 4DYRA 2XPVA 3BTIA 3PO2J 3WHBA 1Z77A 4A3BJ 3ZOBA 4MFEA 1HF0A 2IAIA 3BR5A 1MBEA 2VKVA 2VPRA 1R9TJ 4A3IJ 4V2GA 1ZR2A 1E3OC 4C3JJ 1EF4A 2ME6A 1B8IA 4XK4A 4HNVA 1AHDP 1GUUA 3HBLA 3VPRA 3LSRA 2K9QA 2EZKA 4A3LJ 2HXOA 2H8RA 2Y30A 3H0GJ 4UUSA 4DYQA 4JX6A 1APLC 2IBDA 3UKGA 2R0QC 2JK3A 5HODA 5IYCJ 4LOCA 1I3QJ 2DMTA 2XSDC 2GLOA 3BG9A 2X6OA 5F0CA 1A5JA 3TP3A 4B4CA 4RBOA 3S1QJ 1A6IA 3BR1A 2E2JJ 1P7JA 4XRSA 2XB0X 1MBHA 4IEJA 3WHCA 4A3JJ 1OJLA 4MIMA 1OCTC 4W1UA 1ZR4A 1JKOC 4M3GA 4X6AJ 3HB9A 3HOWJ 2EZHA 5EEAA 5C44J 2HOTA 3SJMA 1WH7A 1WPKA 3GTQJ 5C4XJ 1BA5A 2DMPA 5J1RA 3Q3SA 3BT9A 2XRLA 1ORKA 4AC0A 1BW5A 3JRGA 5GPCA 5EG0B 2WAQN 3MKLA 2FJ1A 2Y9ZA 4I76A 3SDGA 1MSFC 3HM5A 4C2MJ 2W48A 3HKZN 1JTYA 2KDZA 2JJ7A 1NK2P 1ETVA 4FTHA 5F04A 4M3DA 2LVSA 2CQQA 2NS7A 1CQTA 2X9DA 4DYCA 2K9SA 3S15J 3IH4A 4C3HJ 3RZOJ 1WI3A 2FD5A 3G1LA 2LTPA 1OFCX 4Y7NJ 5K7FA 3LSPA 3RZDJ 2HI3A 5M3FJ 3OOUA 1X2MA 5EGOB 3TW6A 2NVYJ 3BR0A 1F36A 1ZKGA 1AKHA 2MW8A 2L7FP 3Q0UA 1JJ6C 2ECCA 1ETQA 2MGQA 5IOYA 4JX4A 5GP9A 4BKXA 1JT6A 2OPTA 2LFBA 2WV1A 2YUSA 2CU7A 2K40A 4A69C 1TWHJ 1ZQ3P 5FKLA 1B8IB 1TWCJ 1Y1VJ 3Q0WA 1H89C 1SFOJ 1ETOA 5EYRA 3HGGA 2CUFA 4D7NA 1IDZA 1TWFJ 2R7ZJ 4UUTA 4UUSB 2M0CA 3E7LA 4BXXJ 1IC8A 1FTZA 5C3EJ 2R92J 2RAEA 4D5CA 5K7HA 2L0KA 4I6ZA 2D5VA 1ETKA 1K61A 3NARA 1MBGA 4C3IJ 2AO9A 1H88C 2E2HJ 2R5YA 3CDLA 1TWAJ 2JA8J 4MO7A 4GFBA 2R5ZA 1JUPA 2VKEA 4Y52J 1JUSA 1HLVA 1PUFB 5IPAA 3ZQIA 3H3VK 4XICA 1POGA 1T56A 2M2EA 4AYBN 3BTJA 1RR7A 3JRDA 3HOXJ 2YS9A 4IHXA 2WB1N 1ZGWA 2B63J 1I6HJ 1XC5A 1U9OA 2O8KA 1RKWA 3CQZJ 3SFIA 2LR8A 3A02A 5M5YJ 3ZQLA 5IP6A 1Z0XA 3A01A 1FJLA 3HOVJ 4QSHA 5FLMJ 2GBYA 2Y9YA 3K7AJ 1YRNA 1T33A 5J1UA 3BG3A 5F08A 1MSEC 5J1YA 4A3CJ 2JA7J 3PM1A 1HCRA 2LY9A 4M6VA 2KT0A 3BQYA 1GV2A 4A3KJ 2E1OA 5JLWA 3GTGJ 4XIDA 4FCYA 2NOGA 3HOYJ 1UG2A 5F0HA 1I50J 2NVQJ 1LE8B 2CRGA 3MN2A 4M3BA 1GV5A 3BR6A 1U9NA 3GTPJ 3LSGA 4BY7J 2ME0A 3OSFA 2TCTA 4IHVA 3FIWA 1WCMJ 3B6AA 1H8AC 1LFUP 3JRBA 4S0HB 4G12A 5EDNA 1WGXA 1IDYA 1RKTA 2CJJA 1B72A 2NVTJ 2L9RA 3W6VA 3K2AA 1P7IA 2O9LA 3ZQFA 1QRYA 2FX0A 3GTOJ 2JWTA 1BW6A 3IH2A 5M3MJ 3BTLA 2DA5A 2OF7A 3JRAA 3C2BA 1K83J 3M4OJ 1MBKA 2XB5A 1JKRC 4A3DJ 2LD5A 2JA5J 2M34A 2DMUA 1NTCA 2M9HA 5DTDA 1BL0A 3GTKJ 5J3LA 3ZQGA 1FIPA 1MBFA 3HGYA 5GPAA 4DZJA 2DTZA 4CYCA 4RDUA 2DA7A 5IP7J 1AU7A 1WH5A 3BTCA 1IGNA 1MBJA 3S1RJ 1F43A 2COBA 2EZLA 2LP0A 5E3NA 2LK2A 1ETXA 2R5ZB 3F0CA 2EZIA 2L7ZA 2M8GX 1BJZA 2ZB9A 1HOMA 1X2NA 1Q1VA 4AUXA 5K7ZA 5EG0A 3HEFA 2DA4A 2MSYA 1MNMC 5DS9A 1G2HA 1MH3A 3RKQA 4FISA 1VI0A 5C4JJ 1LFBA 1JTXA 9ANTA 3DEWA 1HDDC 2AHQA 3Q0VA 4MFDA 1TC3C 4A93J 3TP0A 2PMZN 3A01B 2XGDA 1GVDA 2Y0SN 2JMWA 3JRCA 4FE4A 4B1RA 2GM4A 1NK3P 2ECBA 4D7MA 1FTTA 2NS8A 1YRNB 2DN0A 2R93J 1GDTA 3IH3A 1W0UA 1UMQA 3PO3J 1VFCA 2DMNA 1ITYA 1XG1A 4IHYA 5EF6A 4W97A 2K9NA 4QIWN 2LKXA 2NVXJ 1QVUA 1JUMA 2Y2ZA 2LLKA 3LNQA 4BBRJ 1DU6A 1JKPC 1DU0A 4A3EJ 2P81A 1IUFA 5E3MA 4MLOA 5IP9J 2VI6A 2YU9J 1U78A 4BBSJ 3LSJA 1RETA 3JREA 2JA6J 1SANA 1JJ8C 2IEKA 2I10A 1IRZA 3BG5A 1B72B 3D1NI 1OCPA 3JRHA 5FKKA 4NDLA 4DW6A 1GT0C 3ZQHA 1W0TA 3L1PA 1ETYA 4DZPA 4IHWA 2QCOA 1ZTRA 3TW7A 1JKQC 3O8GA
chains in the Genus database with same CATH superfamily
4OIRF 4I09A 5H20A 2W24A 3K9TA 2DQRA 3H3ZA 2CYYA 3JRFA 4BQQA 1DGWY 2ZJPF 3ABUA 3LQQA 4F7ZA 1IV6A 4PGHA 1ERDA 2E36A 5GAGJ 3E6MA 4HX4A 3LFUA 4U0VA 2XUBA 1TWGJ 5LLQA 5ED4A 5L3GA 3B02A 1R5GA 3HYIA 3FZVA 4ITVA 3ZPLA 1MIJA 2GXAA 2DA2A 5IOZA 3FXQA 1U0JA 2LDUA 4QPQA 4L9TA 2HDDA 1QU3A 2XGEA 3BOQA 1BI2A 3H5AA 4ABZA 1D1BA 5FRNA 2HQAA 1WFXA 4JYKA 2L7MP 3VYTB 4AU7A 2O7OA 1ZRDA 2ZMEA 4L5JA 2ZJQF 4ZH4F 1ZK8A 2CW0F 4X1EA 3S2HJ 3HHHA 1R7JA 2Z1DA 2JTVA 1S6LA 1JT0A 1KQ8A 3A1YA 4KMUX 2JUGA 2Y69H 4EEFG 1K79A 2JQ7A 4FT8A 1RPWA 3QU6A 1ENHA 1HKTA 2XPWA 3H92A 3CMYA 4BEHB 5JLXA 3T5XA 4BNCA 4CHUA 3I59B 2E2IJ 3MQ0A 3ISPA 4H4KC 2AQEA 3WGIA 2YX4A 5LHHA 3PQKA 4NUBA 3BQZA 2ZMEC 3L2VA 2R5YB 2ESNA 5FKNA 5HS7A 1Z6TA 1OPCA 2BGCA 2ETHA 3ZXSA 2JRTA 2D1HA 3OYIA 3CJTB 1QNTA 3JR9A 3KEYA 3SHFA 2W00A 1KU3A 4NC8A 4B3AA 5FKMA 4XRSG 3L7WA 4JX5A 4GGGA 2H1KA 2R3SA 2DMQA 2LY1A 1IN6A 5LRRA 4PFPA 3S17J 3L00A 1FP1D 4A3MJ 1SFUA 3GTLJ 2P7CB 3QRFF 4L5EA 1TBXA 2CUJA 3TL4X 5M5XJ 3CP8A 3I0TA 2XIGA 4C30A 3OSGA 4OMYA 5BNGA 1V5GA 2KZVA 3G1MA 2RQPA 1FIAA 2MH2A 1RUOA 2EJRA 1XS9A 2MA3A 1IV8A 1O4XA 2F5FA 1XSVA 1QA6A 2FF4A 3DTKA 5DV5A 5E3OA 3MZHA 4A5NA 2XPVA 1ZG1A 3VWBA 5DD8A 3WHBA 3TDUC 4X0GA 1XN7A 2IAIA 2R7WA 3R6SA 2H27A 3LFKA 1MBEA 2VPRA 4OOIA 3FF5A 1R9TJ 1YJWI 4RM3A 2E71A 2M1BA 2JPCA 1OCRH 3OMYA 3F6VA 3HOSA 2Z9OA 4XK4A 2RN7A 1R23A 2M7BA 3RYPA 2VBZA 2EZKA 1FNNA 2PN6A 4DBQA 3OYDA 2VPLA 2ADUA 3BJ6A 4EQQA 4AM3A 3K4BA 1LEAA 2XRNA 4IQJA 2V79A 4XSZF 1I6XA 3QPTA 4GRIA 1W36C 2OBPA 3D5RC 3GXOA 2IBDA 3R0AA 4FHTA 3VEPA 4L9VA 2QGUA 2XAFA 4LOCA 2Q1ZB 2IP2A 2XSDC 3BG9A 2P4WA 2OA4A 2P5VA 2X6OA 4MEXF 4KN7X 4RBOA 2R7RA 4AIDA 3BR1A 1UCRA 4RGUA 4HQEA 2DU9A 1A31A 2JZYA 2K5CA 4YRVA 1U8RA 2FBHA 2EWNA 2XB0X 2BOLA 3ZP5A 4A3JJ 3VOEA 1E2XA 4N4OB 3V8JA 4HPQA 4IOCF 5KVRA 3HOWJ 2HOTA 5JHFA 3SJMA 3LSHA 4KISA 1P4AA 1ZELA 3K1PA 4EGYA 3DP7A 3EYYA 3R60A 2L2OA 5J1RA 3Q3SA 1OQYA 5B66C 4KICA 4B48A 4Y13A 4AC0A 2F5CA 3DF8A 1USSA 2ZXHA 4OIPF 2FJ1A 4I76A 2K02A 3HM5A 5DDGA 4C2MJ 1PP7U 1GXPA 2CW7A 4L5IA 1TTYA 2WY7Q 3ZMTA 1WJAA 4M3DA 1S7AA 3WTYC 1CQTA 4BU2A 2NS7A 2X9DA 1KYWA 1D5VA 2K9SA 1UB9A 2JT1A 2BW3B 1X1CA 4C3HJ 4FASD 2EK5A 2FD5A 2Q2EA 4PJ0C 2YU3A 1OFCX 3L9FA 3BJOA 3RZDJ 2PI0A 3J80K 3K4CA 1D0ZA 3I9V2 1QHHD 3VB2A 3WTZA 1Z05A 3O3KA 2B9SA 2A6TA 1SD6A 3TW6A 2NVYJ 2GA1A 2STTA 3ECOA 1Z21A 1UG0A 1AKHA 1F4KA 5LEJA 1U5TA 2FNPA 4ANJA 4F92B 4GCVA 1WI9A 5GP9A 4BKXA 2X1CA 1FT9A 1QGPA 2L4AA 1RNLA 4A69C 5ERIA 2OC6A 2MD0A 1ZQ3P 2R7XA 5FKLA 3IWFA 4I0AA 5BQTA 1Y1VJ 2L9VA 3Q0WA 4U0WA 3PUBA 5TISC 4BGDA 1R1VA 4D7NA 2G9WA 2RGVA 3DBLB 1IDZA 3FX3A 1U5TC 5CPRB 2L9SA 1OYIA 4OAZA 2R92J 5J40A 4Y33A 3VSKA 1FP2A 3L2QA 2L0KA 4I6ZA 1ETKA 1K61A 3NARA 2LBFA 3TOAA 1H88C 1N25A 3QYBA 2NYXA 1TWAJ 2JA8J 1Z9CA 2HNHA 3KFWX 3F3XA 3H1CA 1JUPA 3V42A 1HLVA 1LVAA 3ZQIA 1LDDA 2D1VA 2L3DA 3IL2A 3BZCA 2VQCA 2DO7A 2ISYA 1RR7A 2E1NA 1O3RA 2VE8A 2QZ8A 3CZ6A 3M1CA 4IHXA 1ZGWA 2R4GA 1U9OA 3DLLF 2IS1A 4NB5A 1IZ1A 4NQWA 1ON2A 3ZQLA 5IP6A 4ZYHA 5E79C 2A07F 3CC7I 4NNJA 5H6QA 2EIMH 3CLOA 5FLMJ 4XRFA 1T2KA 2DDAA 5CVUA 5F08A 1X1AA 4AIJA 1YS7A 4A2UA 3J81K 4B3XA 3A4CA 3IC7A 3R61A 3CCJI 1K4SA 2JA7J 4R1HA 4HLXA 2ZXJA 2LY9A 2VL8A 5F64A 3QU3A 4TV7A 4OINF 3PIOF 2KT0A 2WWYA 1XGMA 2KMUA 3KCCA 4YFNF 2ZSHB 5JLWA 4FCYA 4XLEA 2QENA 2NOGA 5L3EA 3CDHA 3HUGA 1PVEA 3GZ5A 3OIPA 4MQ9F 2AQFA 3T8TA 1EH7A 4A0ZA 3ABTA 4BQOA 2ME0A 3OSFA 2TCTA 3FIWA 3RPQA 1WCMJ 3VODA 4R79A 2PEXA 4IRHA 5LFAA 1FSEA 4G12A 5EDNA 1IAWA 4K2EA 1XCBA 3FXRA 1BIAA 2HQRA 2IPQX 2LY2A 2PMHA 2NVTJ 1IN4A 4DNCA 3ZQFA 1QRYA 3J80Z 3W3CA 2BHZA 3HHGA 1ZG5A 1D1CA 4Y15A 1DP3A 1V5FA 5LGNA 5M3MJ 4BQAA 2DA5A 1W5TA 4CO8A 2Z33A 1MMDA 3C2BA 4B47A 3M4OJ 1MBKA 1W5SA 5HNHA 4YG2F 1SVMA 3IRQA 2NOJB 4A3DJ 4UB6C 2F5VA 1NTCA 2EB7A 2IA1A 3BPVA 3LA2A 5DTDA 4CH7A 4IOAF 1ULYA 1BJAA 2W25A 4F3QA 3BY6A 3JSPA 1CF7B 4E7ZA 3IWZA 1HKSA 2CQKA 3BTCA 2D2WA 1MBJA 5JFRA 4XQFA 2EZLA 3HPGA 4G94A 2X6YA 2ZSIB 5E3NA 4RB3C 3F23A 5BPDA 2DBBA 2ZNYA 5FROA 4BXUA 3GYHX 4ESBA 2R5ZB 2L7ZA 2CMPA 2GZWA 4WXHA 2ZB9A 1LB2A 3TBIA 4AUXA 1Y6IA 2BXYA 1K4TA 2E1MB 2DA4A 3EQLF 2VT3A 2QVOA 4GO1A 4PZJA 3HOTA 1MNMC 4G7OF 2Y0MA 2O61A 3GWZA 3RCOA 5DS9A 4RGSA 1MJ9A 5K1YA 1VQPI 4HBLA 4FISA 4CCMA 1VQNI 2ZNZA 5B5EC 1AOYA 1JTXA 1XPXA 4ZZDA 3SXYA 3DEWA 1HDDC 4MFDA 2FNAA 4A93J 3TP0A 2A6HF 3IHUA 1F1ZA 3A01B 2KIUA 1VZ0A 1R6RA 1X1PA 2XGDA 4BAYA 3BWGA 4BDZA 4CXFA 1VQLI 2ECBA 1FTTA 1MDMB 2DN0A 4CA0A 2VB6A 5ILUA 2LH9A 4EJUA 3E97A 2X1DA 3QYEA 4HLYA 3F22A 3C3WA 2GAUA 4HG2A 3U9GA 3RKWA 1R36A 1HQCA 3K70D 1ZYRF 3J81Z 4I0BA 3SYTA 2IRFG 1IN8A 4L0ZB 6PAXA 5JI6A 1RRJA 1YX3A 1JKPC 1DU0A 2HEOA 4M9XA 3RKYA 2RC4A 1IUFA 2V6CA 4XNFA 2VI6A 3ESWB 2YU9J 2BVLA 4ZYEA 3LSJA 1RETA 3F9KA 3TO9A 2A3SA 2TDXA 3ABMH 3KETA 3GZNB 1E0EA 2DCEA 3U21A 2VXDA 3HSFA 1USTA 2I10A 1IRZA 5DEQA 2DI3A 2FBIA 5JR3A 4J01A 1B72B 1OCCH 3P7NA 3L1PA 3JSOA 2EA2A 2HU9A 3WU0A 3FXJA 4XLNF 3TW7A 1X3UA 2LOOA 3QOEA 3O8GA 4ZTFA 4N9IA 3MFKA 1BN5A 2P5KA 2K7LA 3F6OA 5CVRA 3DU6A 2V9PA 5FD5A 2LRDA 4E70A 1JGGA 3BZKA 2FMLA 4BACA 5F0FA 1BR2A 2Q2EB 3HTUA 3FK6A 1PUFA 1L3LA 4KNYA 5DUKA 2XHKA 5HVQC 4BY1J 1X1BA 4XM3A 2CW8A 2YSRA 5LD2C 2ID6A 2Y31A 5DUIA 4HNUA 2DFIA 2M87A 5IY5H 1AKHB 1S7OA 4CZCA 2UWMA 2HFHA 4V2FA 3HDDA 3AL0B 2XGCA 1HKQA 1MJAA 2QM3A 2DA3A 4J19A 3KYCB 4M9ZA 2VC0A 1IXSB 1TQPA 1D5YA 1U8BA 2CUEA 2E34A 2BVMA 3SDBA 5CQEA 2KJCA 1R00A 4RB0A 2E5ZA 2QF7A 3HOUJ 2PX9A 3GZ6A 2Z16A 3FKJA 2EV5A 3QPSA 2ELKA 2ID3A 3MD2A 4XN3A 3AFHA 3CTAA 2E7XA 4FE7A 4F91B 4IHSA 2LF7A 3S1MJ 1X1DA 2KZGA 2DFFA 1Z3YA 3BR3A 1Y0UA 4JP0A 3S14J 2R7SA 2R7QA 3OYJA 2LBFB 1S3JA 2IW5A 4J00A 4YELA 1YJ9I 2BE5F 1B59A 1QVTA 2HOSA 2VBYA 2HVRA 2FA5A 1Q1HA 1BBYA 3QQAA 5D6FA 4F93B 5E3LA 1OYYA 3FISA 2X0LA 3S1NJ 2DOEA 2PJPA 3FXMA 2HOAA 2HYJA 4KT6A 3QODA 4LGWA 2HDCA 4GXOA 4PSXA 3G71I 2EH3A 1RESA 1VQ4I 2TRTA 2XV4S 3WGHA 3S8PA 1Y1WJ 4XOPA 4XBFA 2EIJH 5BOXA 4HX8A 2VKDA 3E1SA 3IV5A 2XVCA 1EA3A 2VC1A 5E1ZB 2BW3A 1TW2A 4ZTJA 3LMMA 3ZCOA 2Z99A 1T8IA 1WJ5A 3DWLE 5FFZA 3OYKA 1SEUA 1KYZA 5DD4A 2NNNA 5FJ8J 3WTTC 5F1JA 2H6CA 4ESJA 4XLCA 2HXIA 3ZMZA 1SFXA 2HZDA 2OTLI 2MYSA 5ICEA 4BYYA 4G9YA 1WJDA 3BTIA 4S05A 2GXGA 2VT2A 5E1XA 2JUCA 3PO2J 5HLGA 4A3BJ 5J4YA 1BOBA 1GHCA 2ZFUA 2KP6A 1EH6A 2LSOA 2A05A 3EDPA 2DOAA 4BJ6C 3DTEA 4G6DA 3F8CA 4D1QA 4II3A 4UVCA 1E3OC 1YE9A 2EV6A 2M4GA 3JCUC 3HL2A 1AHDP 4E7JA 1GUUA 3HBLA 4MTEA 3UNGC 3LSRA 1R71A 1BI1A 1HBXG 2ZXWH 2R7VA 5CYVA 3MZ8A 2Y30A 2MABA 2P6SA 4KUMA 3KYLA 4XLAA 1MGTA 3SZPA 5KAIC 3DEEA 4HW0A 3KYDB 1DPRA 1YFHA 4M74A 4AVZA 3UKGA 1MD0A 1G59A 3KZZA 5IYCJ 1UFMA 2VJIA 1I3QJ 1OMIA 2P6TA 2DQLA 3QOPA 5F0CA 3C2HA 1T98A 2H94A 4B4CA 1TW3A 1KZHA 3S1QJ 1P7JA 1ZN2A 3RPUD 4PSWA 3ULQB 1DPUA 4XRSA 1HSJA 1MBHA 1UHMA 4IEJA 3WHCA 1TLHB 4MIMA 4W1UA 3GFLA 1ZR4A 3Q5FA 1IUYA 3BDDA 2OU2A 4DIQA 2ELHA 3KZYA 4EM1A 4PUSA 3NQOA 5EEAA 4IVNA 2M5WA 1YIJI 2LC2A 5CKTA 3E5XA 4G8XA 1SAUA 3MEXA 3IKTA 3M7GA 5C4XJ 3E3VA 2A69F 2HKOA 3OR2C 2OV7A 1OYWA 4WWCA 1Z6RA 3IAS2 2NNYA 4LG0B 1SD5A 2NXNB 2XRLA 1ORKA 4YIFA 3LSIA 5D4SA 2E60A 1K7AA 5GPCA 1MW7A 4MTDA 1WJCA 2Y9ZA 2GIZA 4EJWA 3FMSA 3TO6A 5GADJ 1JTYA 4LK1F 2JJ7A 2WC2A 3REOA 1I1SA 4OAYA 1Z91A 4FTHA 1JXSA 3H9JA 2LVSA 2QQAA 1XGNA 3KLOA 5FD6A 4EJVA 3IH4A 2CS3A 3F8NA 3RZOJ 1WI3A 3GMEA 3OYAA 2CH0A 2FE3A 2LTPA 3I56I 4HV6A 1QZYA 4Y7NJ 4HEA2 1LDKB 3HRMA 4FETA 1A04A 2M8EA 2WAFA 3CO6C 1X2MA 2CQNA 2EFNA 5EGOB 5DCMB 5D5WB 4Q48A 1MMAA 4UHTA 2HZTA 2FBKA 1QHGA 1H0MA 3ERMA 1TQIA 3D0SA 2L9NA 5HS9A 1LEBA 1JJ6C 3FMQA 4O5VA 3LL7A 3RQ4A 1WQ2A 1XSXA 2G7HA 2WV1A 2K40A 3WG9A 2R7UA 4MNUA 1B8IB 2FSWA 3BG7A 1TWCJ 1VQMI 1GLNA 2FOWA 3I54A 1SFOJ 3DKXA 1ZAOA 2K27A 5EYRA 2RV8A 4BUPA 1S29A 5TGTA 4UUSB 1A36A 3E7LA 1J9IA 3QAHA 3L2RA 1IC8A 1FTZA 5C3EJ 1CF7A 2K86A 1IF1A 4UY8I 1R4NB 2Z3YA 2Z2SB 3G2BA 2WTEA 2EILH 2AO9A 2LF8A 4R8HA 2E2HJ 3OS1A 2AXTC 2NS0A 5HS8A 3JW4A 2ZBKA 2XDVA 2ZC2A 2ZFWA 3CDLA 1VQ6I 4GFBA 2R5ZA 3OL4A 1R58A 4EMSA 4KYWA 3PUFA 2PFBA 4UV8A 3ZMUA 1PUFB 3V7CA 3SEQA 4XICA 1TT5B 1WKMA 3K2ZA 3OV8A 1NG6A 3E6CC 1U6GA 4G7HF 2UXNA 3K1MA 5B1BH 3MKYB 1BM9A 2O8KA 1L0OC 1Y0NA 1RKWA 3CQZJ 3M8FA 5M5YJ 2QQ8A 1ZRCA 3A01A 2FMYA 1G6NA 3N97A 1VQ7I 3L2CA 2Y9YA 4A0YA 2E1MC 3IP4B 1T33A 1MDMA 1MSEC 1OKRA 2DLLA 4HF1A 5J8FA 2R7FA 1RUNA 3TKYA 2VQLA 4IHTA 1PP8F 3TMOA 1P6RA 3DXJF 4IRIA 3RSNA 4M6VA 1P4XA 5D8KB 2DT6A 3AKZA 2E1OA 2NRAC 2DDBA 1FC3A 4B43A 2NVQJ 1S5LC 4MEYF 4RMNA 4ZZLA 1NH3A 3MN2A 2LNBA 2KRFA 2Q0OA 4BY7J 1D8JA 4IHVA 1M1EB 1H8AC 3KP6A 4XR6A 1KU9A 1ZARA 2CQ7A 3ECHA 1B72A 3P9KA 2EPFA 2HYGD 2L9RA 4Q5SF 5L3CA 1FOXA 3GTOJ 4WF2A 4HV5A 2YX7A 4RLFA 1BW6A 4BE0A 2WA0A 2FQ3A 4NC6A 1TNTA 1WRJA 3FDYA 2VBWA 3ZN0A 3IAM2 1BR4A 4OWRB 3CCUI 3JRAA 1K83J 1MKMA 3I5UA 5K5QA 2PQ8A 2M9HA 3BLYA 4XKBA 3ZQGA 2DPDA 3OIQA 4CCJA 3H35A 4ENJA 2XF6A 1Z67A 4RDUA 4EVIA 2DA7A 3B73A 5J4VA 3E5UA 3ZMDA 1VQOI 1WH5A 5L3FA 3S1RJ 3CCSI 4FQGA 5GTIC 4KT5C 4HSRA 2LP0A 3KZIC 4P5OA 1ETXA 1ACIA 4M71A 3BC8A 2EZIA 4LB5A 1X2NA 2FU4A 1YHQI 3F72A 3BCAA 1JHHA 1G3TA 1DP7P 3M8EA 2GQQA 3D5SC 1TL8A 4BDYA 3K70C 1XMAA 1BR1A 3AL0C 1G2HA 3W2WA 4Q47A 3P5JA 2K9MA 3K0LA 3FXOA 1XMKA 9ANTA 4ZDLA 1FMVA 3VYSB 4PCQA 1GVDA 1V3FA 3JRCA 1EKEA 4B1RA 3ZRGA 1G3SA 3ASOH 2LKPA 4C2UA 2NS8A 3H9GA 2XKOA 4HQMA 1GDTA 4E7KA 4WXCA 1UMQA 2O0YA 2WB1A 4CSWA 1VFCA 3HTSB 3LSTA 1ZRFA 3HSRA 2NVXJ 1QVUA 1JUMA 2Y2ZA 3W2VA 3GLXA 4NHJA 3W6KB 4BE1A 2B7EA 1LQ1A 2XASA 4E4HA 2EFWA 3ABLH 5EEHA 2Q8KA 4UNOA 3CMEI 2XAHA 2LREA 5HDGA 2QKMB 3CJQB 2LKSA 1UAAA 1FBUA 1Y39A 1W7PD 3F8BA 1OCPA 3FBNB 1YW8A 4DQ2A 1GT0C 4DW6A 4I2OA 2RKHA 3ZQHA 2W1OA 2DFHA 1T38A 3S93A 1ETYA 3ONQA 1IN7A 1R22A 2CFXA 2QCOA 3HSEA 5HOOA 2I8DA 5H2FC 1I27A 3OL3A 1IW7F 2VXZA 3CUQB 1P2FA 1SFEA 1VF9A 3O2PE 1T6SA 4D9JA 2UUZA 1R4MB 2V1XA 3I58A 1T08B 2BY3A 3TEDA 1YIOA 5F27A 1LFPA 3ZQ7A 3H9QA 3J7AY 3DFGA 4WCGA 1BIBA 1SC7A 5FKOA 4LLLA 1I39A 3NAUA 4UVBA 1ZREA 2MC4A 4A5MA 1V5EA 1J09A 2HOEA 4CYCB 5KCMA 3A2KA 2V9VA 4IL6C 4UXNA 4N4NB 2BY2A 5E20A 2HQ5A 2A6EF 1MMGA 1TZLA 3M8JA 4QPOA 3RQIA 4A0XA 5HLHA 1RI7A 1QZEA 4ZYDA 2IGOA 4U0YA 3VDXA 2EFQA 2EBIA 1LKXA 2XAGA 3H0DA 3CDIA 2ELJA 4ZYAA 1YYVA 1W7PB 2RNGA 1ETWA 3HRSA 1OCZH 1UHSA 3OYLA 1OCOH 4HOBA 2LMDA 1MNEA 2F4IA 2KIQA 2M45A 2MG4A 3RTRA 3MVPA 3U1KA 3A03A 2FUG2 5H6RA 2DXIA 5CVVA 3DCFA 2RREA 2M0MA 5IYBJ 3EUKL 2N8GA 1XGSA 1LE8A 2FQ4A 1WZ2A 5IYDJ 2G0EA 1EH8A 4XRMA 3GTJJ 2ZJ2A 2HDWA 3FK7A 1O7FA 5CQGA 4LG0A 4B44A 4YIRX 3H5NA 4M3EA 2GIVA 2EQRA 3G6EI 3DBHB 3PFIA 3S2DJ 3T8RA 3KP2A 2J5PA 3NRVA 4UB8C 1UJ8A 3LQRA 2FXAA 3E6BA 2R7TA 4M6YA 5K5OA 2PMZA 3LOCA 5M5WJ 4A3GJ 1SD4A 2F5EA 2Y0SA 4OU0A 1EV7A 3K10A 3OOPA 4RB1A 1SAXA 2WV0A 5E8GA 2V1UA 2HTSA 1DGRM 3RPUA 2FRHA 4BE2A 2VUMJ 2QSGX 3K69A 2RVCA 5EGOA 5DCMA 1XDSA 5K5RA 4NC7A 3CCEI 3JRIA 1ZLKA 4UUVA 1K78B 3B6CA 1X58A 2M30A 3BR2A 3N05A 2F4MB 3V8KA 2O8XA 3ZOBA 4MFEA 5D5VB 3KE2A 1XDUA 2CO5A 2VKVA 5TJJA 4V2GA 3F8MA 2ZO4A 4A3IJ 1ZR2A 1FYMA 1EF4A 4YIIA 1B4AA 4Y3OA 2ME6A 4IX7A 1B9NA 1B8IA 2IS2A 2HGCA 2CV2A 4M73A 2KFDA 4DGWB 2DYRH 2KRHA 4YFXF 4A3LJ 2HXOA 2QA4I 5TRDA 3H0GJ 4UUSA 2K3PA 1AWCA 3DKYA 2FOKA 1RC9A 1D0YA 4FX0A 3CF5F 1APLC 5JHUA 2BY1A 2JK3A 3WTSC 4A12A 2DMTA 3K6GA 3ROUA 4BS9A 4MGRA 3F21A 1Z1DA 1A5JA 3ERED 1N77A 1A6IA 1YQAA 1J7KA 4B09A 1LVKA 1D8KA 3I53A 1E3HA 1PDNC 3ZMSA 1HSTA 2A61A 3KP7A 1GVJA 1OJLA 3AG2H 1KA8A 4UVAA 4M3GA 2MC3A 1FY7A 3I55I 3HB9A 4PDKA 3S3OA 1O7LA 1Z7LA 3O6BB 1YW7A 1T0FA 4RGRA 1A6QA 1WPKA 1TNSA 3LA7A 1BA5A 3GEZA 2EV0A 2O3FA 2X1EA 4GDFA 3S3MA 2H09A 5KHDA 4I98B 4JOMA 4CDGA 5LEKA 1O3TA 1OLTA 3M1EA 4GYGA 1BW5A 5BS6A 2O6GE 1G8XA 4OIOF 3SDGA 2VLAA 4HA8A 4EJOA 1VQ9I 5FRMA 3FXKA 1T0FC 1ETVA 3MMYB 3D5LA 2OQGA 4I01A 2W85A 3ZQQA 1YG2A 3OS0A 3H3UA 2D45A 3BROA 5F04A 2E35A 2CQQA 3GFJA 1WJBA 1J2XA 3BJAA 2L7KA 1IXCA 2GOXB 2QUFA 4RLQA 3G1LA 1J0RA 1BOAA 2XSJC 1W1WE 1HW2A 2VQHA 5K7FA 3LSPA 3AG1H 4P1WA 4XOTA 4GYIA 4WXDA 4S04A 3GVAA 2PG4A 3K4MA 3RJPA 4YFKF 4KDPA 3MCZA 3BR0A 1F36A 4P96A 1XCVA 4V19K 1ZKGA 4N0BA 1LJ9A 3I71A 2GWRA 4RM2A 2L7FP 3BZ6A 3FM5A 3Q0UA 2NVUB 1ZGJA 5ILVA 3PNVA 1ETQA 2MGQA 4E7SA 5IOYA 2IJLA 5E18F 2O5RA 4ZDOA 1JT6A 5LHIA 1N75A 2JPBA 4G6QA 5AONA 4QLCU 2WBMA 4IJAA 2W57A 1VTNC 2MLKA 4XKWA 1YI2I 3RI4A 2JVHA 3G3ZA 1NG7A 2KPMA 5GAEJ 1ETOA 3HGGA 5ICFA 5BMZA 2QLZA 3DV8A 2F6CA 4EGZA 2R7ZJ 1WJEA 3FBIB 4C9YA 4BXXJ 3HRTA 1YOVB 1ZLJA 1PJRA 2RAEA 5K7HA 1R49A 3FWEA 2D5VA 5GTHC 5HNFA 4KN4X 4DOZA 5DYMA 2M4KA 5HDNA 3KPHA 4AIHA 4BL0B 4XKVA 1QO0D 2JRMA 3S32A 3L2UA 3VYRB 4RB2C 5FLXK 1YX5A 3KLNA 4HDUA 5IPAA 1TQMA 2CV1A 1S8NA 4ENNA 1KU7A 1POGA 2M2EA 4PJMA 3BTJA 3CJNA 3PFYA 4EATA 2P7VB 4HAMA 2ICWG 2WB1N 4ETSA 1YLFA 5DM7F 2PBIA 3RYRA 2BBYA 3A02A 2DJIA 2ACJA 1VQ5I 3A0BC 1FJLA 1Y8RB 4QSHA 3WU2C 4MHGA 2XGXA 4LMYA 1SMYF 3K7AJ 4LFUA 3VFZA 5J1UA 1OISA 1G3YA 4A3CJ 2HPMA 2XF5A 1I3AA 3PM1A 3CD6I 3M3YJ 1HCRA 1FBSA 3DPLC 2OAZA 1MNDA 3Q9VA 1GV2A 4A3KJ 5E17F 4P55A 2CGPA 2OTJI 1UG2A 4AWXB 5F0HA 1I50J 2JA2A 2VKHA 4WX9A 1LE8B 1IRGA 4C2TA 3GFIA 3HC7A 2KIFA 3BR6A 1U9NA 4IKFA 3GTPJ 3TO7A 3LSGA 2WAQA 3KEOA 2L5QA 1D3YA 4EJTA 3B6AA 4Z6YA 5ILSA 3HKZA 2QEXI 1LFUP 3JRBA 3MZYA 1Z7UA 1RR8C 3ZR8X 3K4LA 3FM3A 2CG4A 2CJJA 4JQFA 2K4BA 4BQNA 1PUEE 2R7OA 3W6VA 4IPAA 3K2AA 3LWFA 4ZDPA 2O9LA 2B0LA 2FX0A 1WVRA 3SEZA 3WTVC 1CGPA 3W6JB 4AVPA 3HG9A 3IH2A 3QP6A 2V1NA 3BTLA 2UZKA 3CUQA 1H9TA 5L3BA 5LBQA 4AIKA 2OCCH 1XB4A 1KQ0A 2Y48A 3LA3A 1XX5A 4JBAA 2A5YB 2XB5A 3E6DA 1FOKA 2LD5A 2XC7A 3CO7C 2H8WA 2ZXIA 1FIPA 2VOOA 2GXBA 5GPAA 4DZJA 2DTZA 2WY8Q 1RZ4A 2MD5A 2V9KA 3RKXA 5IP7J 3DPTA 4CYCA 3R0JA 2M3AA 4PFOA 2HVQA 3PNTA 1BC7C 1XTAA 2VN2A 3CUQC 1IGNA 1P4WA 2COBA 2IGKA 2LK2A 2MLGA 1Y56A 5J47A 2ESHA 3OWTA 1DDNA 3GCMA 3F0CA 3HXLA 2M8GX 1BJZA 1Q1VA 1DUXC 5K7ZA 5EG0A 5GAHJ 3IKVA 1W7PA 4RA2A 1QBJA 2KL4A 1H9GA 1FBQA 4EV0A 4XL9A 3MKZA 2VONA 5D8LB 4AD9A 5FLXZ 1MH3A 3K4JA 2DFEA 3DTIA 2DTRA 2FEZA 2BZTA 4ON0A 1VI0A 2BY0A 2GOMA 2EA4A 5D5XB 2VJ5A 3WU1B 2AHQA 3Q0VA 1TC3C 2XAJA 4CGZA 2PMZN 4IF4A 2Y0SN 5E8IA 4AYBA 3SQNA 2GM4A 3PJRA 4D7MA 1YRNB 2XKPA 3K1NA 2F4OB 4EM0B 2E7WA 2W84A 2X6WA 2V26A 1UELB 1IO2A 1B9MA 4QWQA 4HX7A 1HW5A 3BP8A 3PIPF 2DMNA 2PMUA 5AIQA 3AG3H 3N4MA 1G4DA 1XG1A 1K6OA 3H5RA 4LLNA 1ITYA 4IHYA 5EF6A 2Y75A 4XORA 3C18A 4P9FA 2HVSA 2HYFA 2LLKA 4XLFA 4PK4A 5D5UB 2XROA 4IZZA 3V7RA 2H1LA 2P81A 2DW4A 3E5QA 4A3EJ 5E3MA 4MLOA 5IP9J 4LJZF 3J7YJ 2OD5A 4RAYA 1ON1A 3JAMK 3JREA 3LAPA 2VBXA 1X3WB 2IGNA 2JA6J 1JJ8C 2HTJA 2W4SA 3CC2I 3D1NI 3DU5A 3JRHA 5FKKA 1ONVA 2CV0A 3K4KA 1K78A 1X3ZB 1W0TA 3F8FA 5ICCA 3LAJA 3MAJA 1ZTRA 1J75A 4PGGA 2E1CA 2WAEA 3CCYA 2K9LA 2X6XA 4II2A 4PJLA 3QPLA 5KK1A 3HPHA 2NAZA 1P9QC 3WE3A 2CQXA 1GXQA 5EJCA 2V7FA 1VNDA 1IJWC 2E19A 4FX4A 1FPQA 2XPUA 1PYVA 1FX7A 2HWVA 5L3DA 4BXFA 3TQNA 3G1OA 3PSFA 4BH9A 2X48A 5FFXA 1MMSA 2IT0A 1B1BA 4A6EA 1HDPA 2HQNA 1LUJB 2WADA 3KP5A 3I4PA 4HF0A 4CCNA 3S3NA 3S16J 1ZHFA 4KFCA 3GW2A 5HDKA 2LG4A 3EYIA 3O8HA 1QPIA 2QSHX 3J7AO 1YW9A 3SFZA 1J59A 5LGTA 2EFOA 4I99C 3ZGKA 1A35A 2BYVE 3I4NJ 4M3FA 2YR2A 2QWWA 2OZ6A 3A0HC 4LB6B 2QBYB 3T0YA 4HRIA 2X51A 4QTRA 1KONA 2G7UA 1XGOA 4A3FJ 3V7SA 2BXZA 4B8XA 4D5FA 1I1GA 3CUOA 1O3SA 2JVGA 1O57A 5KNLA 2PJRB 3C1DA 4WK8F 2V6EA 5BPIA 4UV9A 1X19A 5HLIA 5FLVA 1XMXA 3OIOA 2EFPA 4ENMA 3IRRA 1TT0A 3FXUA 3J7ZI 2MH9A 3ZQCA 2DT7B 2DA6A 1ZH5A 1DQUA 3CESA 1S7EA 3OYBA 2C6YA 4BHBA 3KEQA 4L18B 5EZGA 3S2WA 1MH4A 3L09A 5B3SH 1IG7A 3KIOA 4O6JA 3Q9SA 1S9HA 3CF2A 4BJ5C 3HOZJ 3I4MJ 3TDZC 1FOWA 4NBQA 3GUDA 2M7AA 5E1WA 3GTMJ 2JN6A 4KITB 3GBGA 4Z2YA 3FKIJ 1FEXA 4RGXA 5EZHA 2DJNA 2ISZA 5KAFC 2DA1A 1TP4A 4U87A 5F1RA 1YITI 3DQVC 3I64A 4DYRA 1R1UA 4CCOA 4IXAA 2KDOA 3JAMZ 2STWA 2VIXA 1Z77A 1HF0A 3HJEA 4E7IA 3OYGA 3BR5A 4CZZA 3CLQA 1EJ9A 2CSOA 2OZUA 2E5NA 3K4NA 3GF2A 4C3JJ 1V55H 1FLIA 4HNVA 2JSPA 3VPRA 2QQ9A 3OYHA 2K9QA 4F52A 3OR1C 1E17A 4LIVA 3CC4I 3FHZA 2H8RA 4CYDA 2XAUA 2V4JC 1FZPB 3BG6A 4DYQA 1YJNI 1BI3A 4F55A 4JX6A 4XSXF 3C2GA 5D4RA 2VJJA 2I5UA 4OIQF 3OYFA 2R0QC 1SD7A 5HODA 3CMAI 4OMZA 2UV1A 1UHWA 4HYEA 3OY9A 2GLOA 4M9SA 2QKLB 2L4MA 2K85A 2DYSH 3CMMA 3TP3A 5J8CA 2ZMEB 3COAC 2E2JJ 2IGMA 1FMWA 4RAGA 3QWLA 1YTYA 5CVJA 1D0XA 5FO5A 1F5TA 3WTXC 1HC8A 1OCTC 1J5YA 4KA4A 1JKOC 4X6AJ 2BHYA 2KISA 1YO5C 3MKWB 2EZHA 2J5OA 5C44J 4M6XA 3FXLA 3GO5A 1WSUA 2P5LC 1WH7A 1STZA 1W36D 2HR3A 3GTQJ 4ZJZA 2DMPA 3WE2A 3C7JA 3QPHA 5LHGA 1FWZA 3BT9A 4KIGA 1RIOH 3LSKA 3RIRA 3JRGA 5EG0B 2WAQN 3MKLA 2ZKZA 1MSFC 4CCKA 3HZJA 2W48A 3HKZN 2KDZA 2HKXA 2IS6A 3WG7H 1NK2P 4BJTA 1HW1A 2COMA 2VJ4A 3CCRI 4KMFA 5IT9K 3EETA 4DYCA 3S15J 3GFMA 3KP4A 2X4HA 4LD5A 1OR7A 2A5WA 3CCQI 2L01A 3PNYA 3BPXA 5DCFA 4XLPF 2HI3A 5M3FJ 3OOUA 5CLSA 5AIPA 1ZG3A 5D6EA 3AG4H 3U2RA 2YPRA 2MW8A 3U1DA 1V4RA 3QP5A 4XN0A 2F48A 4ASNA 2ECCA 1JI8A 2EINH 4HDVA 2L54A 2BEOA 4ZC3A 2IVMA 4JX4A 1BI0A 1SMTA 5FB2A 1OR7C 2OPTA 2VODA 2LFBA 2YUSA 1WHUA 2CU7A 4LLGF 3GLLA 5J6XA 4U7BA 1VQKI 1TWHJ 1JGSA 1LDJA 4U88A 4HF2A 4L0YB 1H89C 2IS4A 2CUFA 4IRGA 1TWFJ 4CCLA 3X2QH 4UUTA 2M0CA 1WJFA 4E7LA 3DKWA 4D5CA 3VSLA 2KKOA 4BEHA 5IT3A 3I59A 1MBGA 4MQVA 2CUZA 4C3IJ 3GX4X 1C0WA 1VQ8I 2R5YA 3NWSA 2DAOA 3M07A 3H36A 4MO7A 3SZGA 4E7HA 2VKEA 4Y52J 1JUSA 1KU2A 2F5DA 4KJZA 4CUGA 3OYCA 3H3VK 3HIFA 5DM6F 1T56A 4H0EA 2RDPA 4AYBN 1FYKA 3QYFA 1ZGAA 3DLAA 3V4GA 2JSCA 3EUHA 4LITA 4KIBA 3JRDA 3HOXJ 2YS9A 4RS8A 1FYLA 1YS6A 2B63J 3ASNH 1I6HJ 1W4MA 2QYOA 1XC5A 2R7DA 4ZYGA 2DOFA 4O3MA 3WODF 3NEUA 4G7ZF 2QSFX 2Z5UA 3SFIA 2KRCA 2LR8A 4I7HA 3R4KA 1Z0XA 3EPZA 4ENKA 1X4OA 2MBFA 3HOVJ 1SVLA 2GBYA 2QQBA 5HLTA 1YRNA 5A2QK 3BG3A 5LGUA 5J1YA 3EUHC 4ESFA 4LK0F 2DT5A 2HPIA 3BCBA 4Q4ZF 2W7NA 1XSDA 2P8TA 3P9IA 3CJRB 3BQYA 3DPUA 5CVIA 3G73A 1Y8QB 3I3LA 5FGMA 3GTGJ 1N78A 2IA0A 1E3PA 4L9JA 4XIDA 5F6FA 2UXXA 3HOYJ 1K6YA 1S72I 2CFOA 3TOBA 2CRGA 4M3BA 1GV5A 2O03A 4BHPA 1HA8A 2BV6A 3KX2A 3KP3A 5JVTA 2IA2A 2XF7A 2K3FA 2PLYA 1SFKA 1R5HA 3IUOA 3ML6A 2OJED 5IT9Z 4S0HB 3SZTA 1KGSA 2KHMA 1WGXA 1IDYA 1RKTA 3LSMA 4HSTA 3UR3C 2OCEA 3CCVI 3TGNA 2X85A 4G6TB 1P7IA 1U5TB 3FMRA 4HZFA 2HS5A 2JWTA 2OQRA 1U2WA 5ICGA 1FOYA 1V54H 4YEJA 4EM2A 3WGGA 1F9NA 2CWEA 1MMNA 2OUMA 4XONA 2OF7A 3PSIA 1LPQA 4LIUA 3VYUB 3ZMVA 5CJ9A 4N9HA 1T95A 3AAFA 1JKRC 3JTGA 1U3EM 2JA5J 3V8LA 2M34A 2DMUA 2LYCA 1BL0A 3GTKJ 4DBRA 5J3LA 1REPC 2ZJRF 3EUAA 2IXSA 3ZN1A 1W5CC 4U7DA 1MBFA 4L9NA 3HGYA 1QPMA 4PJJA 1JE8A 4HNTA 1AU7A 1ODDA 2DODA 3NWTA 4DJAA 2KIMA 3WTWC 4LG3A 1IRXA 4A6DA 3OS2A 1XD7A 1F43A 3MWMA 2MFZA 1UZCA 3L2WA 4PJNA 3ELKA 4RAFA 1B6AA 5EEGA 1HOMA 4JK1X 4P9UA 3PL8A 4Y17A 2DK5A 4XMYA 1D1AA 3HEFA 2EIKH 2F2EA 4BHCA 3W2AA 1SVOA 1R1TA 1MZBA 3JTHA 1QQIA 2MSYA 5JVGF 2AS5F 4RAZA 4XLHA 2DK8A 1IN5A 1KQ9A 2QBYA 1O3QA 5B1AH 3CCLI 3RKQA 1NHAA 5C4JJ 2KLOA 3PQJA 1LFBA 4NQWB 4Y4RA 3OYEA 4I02A 3T1BA 4D0PA 2JMWA 4FE4A 1NK3P 1IRFA 1AA7A 2PJRA 4CICA 2RQQA 2DPUA 2RNJA 1LNWA 4XKCA 2R93J 3IH3A 3DEUA 3M9AA 1W0UA 2H6BA 1Z3XA 2AXLA 1WWXA 2V1DA 1IXRC 4E6KG 1BC8C 3PO3J 3CP2A 2VASA 3CCMI 2P0WA 2XAQA 1R5ID 4W97A 5A2QZ 1G3WA 3HRUA 2K9NA 4QIWN 2LKXA 3HUGB 3LNQA 4BBRJ 2VQGA 1T39A 1DU6A 1MJBA 2K4JA 2L02A 3OYMA 3G4SI 4IQ4A 3ABKH 3RDIA 3WTUC 1U78A 4BBSJ 3E0JB 4M72A 2KQRA 3DBRB 4IO9F 2W82A 3FHNA 2KJBA 1SANA 2GA2A 2IEKA 1FSHA 3P9CA 3BG5A 1QZZA 4NDLA 1HXDA 2A68F 4KIFA 1X4PA 3OYNA 5LRSA 1JHFA 1I5ZA 1P92A 4DZPA 2VOPA 4IHWA 1JKQC 2VE9A 2ZCWA
chains in the Genus database with same CATH topology
3M3YJ 3CCYA 1JGGA 3QPLA 1VF9A 5F0FA 2CQXA 3JRFA 3FK6A 1PUFA 3TEDA 1IV6A 1VNDA 5F27A 4BY1J 1IJWC 2E19A 2XPUA 2ID6A 1TWGJ 2Y31A 5FKOA 3NAUA 1AKHB 2DA2A 3G1OA 5IOZA 4CYCB 4V2FA 2HDDA 2X48A 3HDDA 2XGCA 2XGEA 4ABZA 2HQ5A 1HDPA 4J19A 2DA3A 3RQIA 3S16J 4JYKA 1D5YA 1U8BA 2CUEA 2L7MP 2O7OA 3O8HA 1QPIA 2EBIA 1ZK8A 4X1EA 3S2HJ 2QF7A 3HOUJ 1JT0A 3QPSA 2ELKA 2ID3A 1ETWA 4EEFG 4FE7A 1RPWA 3I4NJ 4M3FA 1ENHA 1UHSA 3S1MJ 3BR3A 2XPWA 3CMYA 2MG4A 4QTRA 3MVPA 4JP0A 3A03A 5JLXA 3S14J 2E2IJ 4A3FJ 3DCFA 1LE8A 5IYBJ 2N8GA 2FQ4A 5IYDJ 3BQZA 2R5YB 2G0EA 5FKNA 4XRMA 3GTJJ 4D5FA 1QVTA 2HOSA 3FK7A 3QQAA 5E3LA 3FISA 4M3EA 3S1NJ 2EQRA 3S2DJ 3JR9A 5FLVA 2HOAA 3OIOA 2HYJA 3ZQCA 4B3AA 2EH3A 5FKMA 4XRSG 2DA6A 1RESA 2TRTA 4JX5A 1S7EA 1Y1WJ 2H1KA 3LOCA 2DMQA 5M5WJ 4A3GJ 5EZGA 3IV5A 1MH4A 3S17J 4A3MJ 1IG7A 3GTLJ 4L5EA 3HOZJ 5M5XJ 3I4MJ 3OSGA 5BNGA 3GTMJ 2JN6A 3GBGA 2VUMJ 3FKIJ 1FEXA 3G1MA 5FJ8J 5F1JA 1FIAA 5EZHA 2DJNA 1XS9A 5EGOA 2HXIA 2DA1A 1O4XA 3JRIA 3B6CA 1X58A 5E3OA 3BR2A 4DYRA 2XPVA 3BTIA 3PO2J 3WHBA 1Z77A 4A3BJ 3ZOBA 4MFEA 1HF0A 2IAIA 3BR5A 1MBEA 2VKVA 2VPRA 1R9TJ 4A3IJ 4V2GA 1ZR2A 1E3OC 4C3JJ 1EF4A 2ME6A 1B8IA 4XK4A 4HNVA 1AHDP 1GUUA 3HBLA 3VPRA 3LSRA 2K9QA 2EZKA 4A3LJ 2HXOA 2H8RA 2Y30A 3H0GJ 4UUSA 4DYQA 4JX6A 1APLC 2IBDA 3UKGA 2R0QC 2JK3A 5HODA 5IYCJ 4LOCA 1I3QJ 2DMTA 2XSDC 2GLOA 3BG9A 2X6OA 5F0CA 1A5JA 3TP3A 4B4CA 4RBOA 3S1QJ 1A6IA 3BR1A 2E2JJ 1P7JA 4XRSA 2XB0X 1MBHA 4IEJA 3WHCA 4A3JJ 1OJLA 4MIMA 1OCTC 4W1UA 1ZR4A 1JKOC 4M3GA 4X6AJ 3HB9A 3HOWJ 2EZHA 5EEAA 5C44J 2HOTA 3SJMA 1WH7A 1WPKA 3GTQJ 5C4XJ 1BA5A 2DMPA 5J1RA 3Q3SA 3BT9A 2XRLA 1ORKA 4AC0A 1BW5A 3JRGA 5GPCA 5EG0B 2WAQN 3MKLA 2FJ1A 2Y9ZA 4I76A 3SDGA 1MSFC 3HM5A 4C2MJ 2W48A 3HKZN 1JTYA 2KDZA 2JJ7A 1NK2P 1ETVA 4FTHA 5F04A 4M3DA 2LVSA 2CQQA 2NS7A 1CQTA 2X9DA 4DYCA 2K9SA 3S15J 3IH4A 4C3HJ 3RZOJ 1WI3A 2FD5A 3G1LA 2LTPA 1OFCX 4Y7NJ 5K7FA 3LSPA 3RZDJ 2HI3A 5M3FJ 3OOUA 1X2MA 5EGOB 3TW6A 2NVYJ 3BR0A 1F36A 1ZKGA 1AKHA 2MW8A 2L7FP 3Q0UA 1JJ6C 2ECCA 1ETQA 2MGQA 5IOYA 4JX4A 5GP9A 4BKXA 1JT6A 2OPTA 2LFBA 2WV1A 2YUSA 2CU7A 2K40A 4A69C 1TWHJ 1ZQ3P 5FKLA 1B8IB 1TWCJ 1Y1VJ 3Q0WA 1H89C 1SFOJ 1ETOA 5EYRA 3HGGA 2CUFA 4D7NA 1IDZA 1TWFJ 2R7ZJ 4UUTA 4UUSB 2M0CA 3E7LA 4BXXJ 1IC8A 1FTZA 5C3EJ 2R92J 2RAEA 4D5CA 5K7HA 2L0KA 4I6ZA 2D5VA 1ETKA 1K61A 3NARA 1MBGA 4C3IJ 2AO9A 1H88C 2E2HJ 2R5YA 3CDLA 1TWAJ 2JA8J 4MO7A 4GFBA 2R5ZA 1JUPA 2VKEA 4Y52J 1JUSA 1HLVA 1PUFB 5IPAA 3ZQIA 3H3VK 4XICA 1POGA 1T56A 2M2EA 4AYBN 3BTJA 1RR7A 3JRDA 3HOXJ 2YS9A 4IHXA 2WB1N 1ZGWA 2B63J 1I6HJ 1XC5A 1U9OA 2O8KA 1RKWA 3CQZJ 3SFIA 2LR8A 3A02A 5M5YJ 3ZQLA 5IP6A 1Z0XA 3A01A 1FJLA 3HOVJ 4QSHA 5FLMJ 2GBYA 2Y9YA 3K7AJ 1YRNA 1T33A 5J1UA 3BG3A 5F08A 1MSEC 5J1YA 4A3CJ 2JA7J 3PM1A 1HCRA 2LY9A 4M6VA 2KT0A 3BQYA 1GV2A 4A3KJ 2E1OA 5JLWA 3GTGJ 4XIDA 4FCYA 2NOGA 3HOYJ 1UG2A 5F0HA 1I50J 2NVQJ 1LE8B 2CRGA 3MN2A 4M3BA 1GV5A 3BR6A 1U9NA 3GTPJ 3LSGA 4BY7J 2ME0A 3OSFA 2TCTA 4IHVA 3FIWA 1WCMJ 3B6AA 1H8AC 1LFUP 3JRBA 4S0HB 4G12A 5EDNA 1WGXA 1IDYA 1RKTA 2CJJA 1B72A 2NVTJ 2L9RA 3W6VA 3K2AA 1P7IA 2O9LA 3ZQFA 1QRYA 2FX0A 3GTOJ 2JWTA 1BW6A 3IH2A 5M3MJ 3BTLA 2DA5A 2OF7A 3JRAA 3C2BA 1K83J 3M4OJ 1MBKA 2XB5A 1JKRC 4A3DJ 2LD5A 2JA5J 2M34A 2DMUA 1NTCA 2M9HA 5DTDA 1BL0A 3GTKJ 5J3LA 3ZQGA 1FIPA 1MBFA 3HGYA 5GPAA 4DZJA 2DTZA 4CYCA 4RDUA 2DA7A 5IP7J 1AU7A 1WH5A 3BTCA 1IGNA 1MBJA 3S1RJ 1F43A 2COBA 2EZLA 2LP0A 5E3NA 2LK2A 1ETXA 2R5ZB 3F0CA 2EZIA 2L7ZA 2M8GX 1BJZA 2ZB9A 1HOMA 1X2NA 1Q1VA 4AUXA 5K7ZA 5EG0A 3HEFA 2DA4A 2MSYA 1MNMC 5DS9A 1G2HA 1MH3A 3RKQA 4FISA 1VI0A 5C4JJ 1LFBA 1JTXA 9ANTA 3DEWA 1HDDC 2AHQA 3Q0VA 4MFDA 1TC3C 4A93J 3TP0A 2PMZN 3A01B 2XGDA 1GVDA 2Y0SN 2JMWA 3JRCA 4FE4A 4B1RA 2GM4A 1NK3P 2ECBA 4D7MA 1FTTA 2NS8A 1YRNB 2DN0A 2R93J 1GDTA 3IH3A 1W0UA 1UMQA 3PO3J 1VFCA 2DMNA 1ITYA 1XG1A 4IHYA 5EF6A 4W97A 2K9NA 4QIWN 2LKXA 2NVXJ 1QVUA 1JUMA 2Y2ZA 2LLKA 3LNQA 4BBRJ 1DU6A 1JKPC 1DU0A 4A3EJ 2P81A 1IUFA 5E3MA 4MLOA 5IP9J 2VI6A 2YU9J 1U78A 4BBSJ 3LSJA 1RETA 3JREA 2JA6J 1SANA 1JJ8C 2IEKA 2I10A 1IRZA 3BG5A 1B72B 3D1NI 1OCPA 3JRHA 5FKKA 4NDLA 4DW6A 1GT0C 3ZQHA 1W0TA 3L1PA 1ETYA 4DZPA 4IHWA 2QCOA 1ZTRA 3TW7A 1JKQC 3O8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y J;  3CCY A;  1JGG A;  3QPL A;  1VF9 A;  5F0F A;  2CQX A;  3JRF A;  3FK6 A;  1PUF A;  3TED A;  1IV6 A;  1VND A;  5F27 A;  4BY1 J;  1IJW C;  2E19 A;  2XPU A;  2ID6 A;  1TWG J;  2Y31 A;  5FKO A;  3NAU A;  1AKH B;  2DA2 A;  3G1O A;  5IOZ A;  4CYC B;  4V2F A;  2HDD A;  2X48 A;  3HDD A;  2XGC A;  2XGE A;  4ABZ A;  2HQ5 A;  1HDP A;  4J19 A;  2DA3 A;  3RQI A;  3S16 J;  4JYK A;  1D5Y A;  1U8B A;  2CUE A;  2L7M P;  2O7O A;  3O8H A;  1QPI A;  2EBI A;  1ZK8 A;  4X1E A;  3S2H J;  2QF7 A;  3HOU J;  1JT0 A;  3QPS A;  2ELK A;  2ID3 A;  1ETW A;  4EEF G;  4FE7 A;  1RPW A;  3I4N J;  4M3F A;  1ENH A;  1UHS A;  3S1M J;  3BR3 A;  2XPW A;  3CMY A;  2MG4 A;  4QTR A;  3MVP A;  4JP0 A;  3A03 A;  5JLX A;  3S14 J;  2E2I J;  4A3F J;  3DCF A;  1LE8 A;  5IYB J;  2N8G A;  2FQ4 A;  5IYD J;  3BQZ A;  2R5Y B;  2G0E A;  5FKN A;  4XRM A;  3GTJ J;  4D5F A;  1QVT A;  2HOS A;  3FK7 A;  3QQA A;  5E3L A;  3FIS A;  4M3E A;  3S1N J;  2EQR A;  3S2D J;  3JR9 A;  5FLV A;  2HOA A;  3OIO A;  2HYJ A;  3ZQC A;  4B3A A;  2EH3 A;  5FKM A;  4XRS G;  2DA6 A;  1RES A;  2TRT A;  4JX5 A;  1S7E A;  1Y1W J;  2H1K A;  3LOC A;  2DMQ A;  5M5W J;  4A3G J;  5EZG A;  3IV5 A;  1MH4 A;  3S17 J;  4A3M J;  1IG7 A;  3GTL J;  4L5E A;  3HOZ J;  5M5X J;  3I4M J;  3OSG A;  5BNG A;  3GTM J;  2JN6 A;  3GBG A;  2VUM J;  3FKI J;  1FEX A;  3G1M A;  5FJ8 J;  5F1J A;  1FIA A;  5EZH A;  2DJN A;  1XS9 A;  5EGO A;  2HXI A;  2DA1 A;  1O4X A;  3JRI A;  3B6C A;  1X58 A;  5E3O A;  3BR2 A;  4DYR A;  2XPV A;  3BTI A;  3PO2 J;  3WHB A;  1Z77 A;  4A3B J;  3ZOB A;  4MFE A;  1HF0 A;  2IAI A;  3BR5 A;  1MBE A;  2VKV A;  2VPR A;  1R9T J;  4A3I J;  4V2G A;  1ZR2 A;  1E3O C;  4C3J J;  1EF4 A;  2ME6 A;  1B8I A;  4XK4 A;  4HNV A;  1AHD P;  1GUU A;  3HBL A;  3VPR A;  3LSR A;  2K9Q A;  2EZK A;  4A3L J;  2HXO A;  2H8R A;  2Y30 A;  3H0G J;  4UUS A;  4DYQ A;  4JX6 A;  1APL C;  2IBD A;  3UKG A;  2R0Q C;  2JK3 A;  5HOD A;  5IYC J;  4LOC A;  1I3Q J;  2DMT A;  2XSD C;  2GLO A;  3BG9 A;  2X6O A;  5F0C A;  1A5J A;  3TP3 A;  4B4C A;  4RBO A;  3S1Q J;  1A6I A;  3BR1 A;  2E2J J;  1P7J A;  4XRS A;  2XB0 X;  1MBH A;  4IEJ A;  3WHC A;  4A3J J;  1OJL A;  4MIM A;  1OCT C;  4W1U A;  1ZR4 A;  1JKO C;  4M3G A;  4X6A J;  3HB9 A;  3HOW J;  2EZH A;  5EEA A;  5C44 J;  2HOT A;  3SJM A;  1WH7 A;  1WPK A;  3GTQ J;  5C4X J;  1BA5 A;  2DMP A;  5J1R A;  3Q3S A;  3BT9 A;  2XRL A;  1ORK A;  4AC0 A;  1BW5 A;  3JRG A;  5GPC A;  5EG0 B;  2WAQ N;  3MKL A;  2FJ1 A;  2Y9Z A;  4I76 A;  3SDG A;  1MSF C;  3HM5 A;  4C2M J;  2W48 A;  3HKZ N;  1JTY A;  2KDZ A;  2JJ7 A;  1NK2 P;  1ETV A;  4FTH A;  5F04 A;  4M3D A;  2LVS A;  2CQQ A;  2NS7 A;  1CQT A;  2X9D A;  4DYC A;  2K9S A;  3S15 J;  3IH4 A;  4C3H J;  3RZO J;  1WI3 A;  2FD5 A;  3G1L A;  2LTP A;  1OFC X;  4Y7N J;  5K7F A;  3LSP A;  3RZD J;  2HI3 A;  5M3F J;  3OOU A;  1X2M A;  5EGO B;  3TW6 A;  2NVY J;  3BR0 A;  1F36 A;  1ZKG A;  1AKH A;  2MW8 A;  2L7F P;  3Q0U A;  1JJ6 C;  2ECC A;  1ETQ A;  2MGQ A;  5IOY A;  4JX4 A;  5GP9 A;  4BKX A;  1JT6 A;  2OPT A;  2LFB A;  2WV1 A;  2YUS A;  2CU7 A;  2K40 A;  4A69 C;  1TWH J;  1ZQ3 P;  5FKL A;  1B8I B;  1TWC J;  1Y1V J;  3Q0W A;  1H89 C;  1SFO J;  1ETO A;  5EYR A;  3HGG A;  2CUF A;  4D7N A;  1IDZ A;  1TWF J;  2R7Z J;  4UUT A;  4UUS B;  2M0C A;  3E7L A;  4BXX J;  1IC8 A;  1FTZ A;  5C3E J;  2R92 J;  2RAE A;  4D5C A;  5K7H A;  2L0K A;  4I6Z A;  2D5V A;  1ETK A;  1K61 A;  3NAR A;  1MBG A;  4C3I J;  2AO9 A;  1H88 C;  2E2H J;  2R5Y A;  3CDL A;  1TWA J;  2JA8 J;  4MO7 A;  4GFB A;  2R5Z A;  1JUP A;  2VKE A;  4Y52 J;  1JUS A;  1HLV A;  1PUF B;  5IPA A;  3ZQI A;  3H3V K;  4XIC A;  1POG A;  1T56 A;  2M2E A;  4AYB N;  3BTJ A;  1RR7 A;  3JRD A;  3HOX J;  2YS9 A;  4IHX A;  2WB1 N;  1ZGW A;  2B63 J;  1I6H J;  1XC5 A;  1U9O A;  2O8K A;  1RKW A;  3CQZ J;  3SFI A;  2LR8 A;  3A02 A;  5M5Y J;  3ZQL A;  5IP6 A;  1Z0X A;  3A01 A;  1FJL A;  3HOV J;  4QSH A;  5FLM J;  2GBY A;  2Y9Y A;  3K7A J;  1YRN A;  1T33 A;  5J1U A;  3BG3 A;  5F08 A;  1MSE C;  5J1Y A;  4A3C J;  2JA7 J;  3PM1 A;  1HCR A;  2LY9 A;  4M6V A;  2KT0 A;  3BQY A;  1GV2 A;  4A3K J;  2E1O A;  5JLW A;  3GTG J;  4XID A;  4FCY A;  2NOG A;  3HOY J;  1UG2 A;  5F0H A;  1I50 J;  2NVQ J;  1LE8 B;  2CRG A;  3MN2 A;  4M3B A;  1GV5 A;  3BR6 A;  1U9N A;  3GTP J;  3LSG A;  4BY7 J;  2ME0 A;  3OSF A;  2TCT A;  4IHV A;  3FIW A;  1WCM J;  3B6A A;  1H8A C;  1LFU P;  3JRB A;  4S0H B;  4G12 A;  5EDN A;  1WGX A;  1IDY A;  1RKT A;  2CJJ A;  1B72 A;  2NVT J;  2L9R A;  3W6V A;  3K2A A;  1P7I A;  2O9L A;  3ZQF A;  1QRY A;  2FX0 A;  3GTO J;  2JWT A;  1BW6 A;  3IH2 A;  5M3M J;  3BTL A;  2DA5 A;  2OF7 A;  3JRA A;  3C2B A;  1K83 J;  3M4O J;  1MBK A;  2XB5 A;  1JKR C;  4A3D J;  2LD5 A;  2JA5 J;  2M34 A;  2DMU A;  1NTC A;  2M9H A;  5DTD A;  1BL0 A;  3GTK J;  5J3L A;  3ZQG A;  1FIP A;  1MBF A;  3HGY A;  5GPA A;  4DZJ A;  2DTZ A;  4CYC A;  4RDU A;  2DA7 A;  5IP7 J;  1AU7 A;  1WH5 A;  3BTC A;  1IGN A;  1MBJ A;  3S1R J;  1F43 A;  2COB A;  2EZL A;  2LP0 A;  5E3N A;  2LK2 A;  1ETX A;  2R5Z B;  3F0C A;  2EZI A;  2L7Z A;  2M8G X;  1BJZ A;  2ZB9 A;  1HOM A;  1X2N A;  1Q1V A;  4AUX A;  5K7Z A;  5EG0 A;  3HEF A;  2DA4 A;  2MSY A;  1MNM C;  5DS9 A;  1G2H A;  1MH3 A;  3RKQ A;  4FIS A;  1VI0 A;  5C4J J;  1LFB A;  1JTX A;  9ANT A;  3DEW A;  1HDD C;  2AHQ A;  3Q0V A;  4MFD A;  1TC3 C;  4A93 J;  3TP0 A;  2PMZ N;  3A01 B;  2XGD A;  1GVD A;  2Y0S N;  2JMW A;  3JRC A;  4FE4 A;  4B1R A;  2GM4 A;  1NK3 P;  2ECB A;  4D7M A;  1FTT A;  2NS8 A;  1YRN B;  2DN0 A;  2R93 J;  1GDT A;  3IH3 A;  1W0U A;  1UMQ A;  3PO3 J;  1VFC A;  2DMN A;  1ITY A;  1XG1 A;  4IHY A;  5EF6 A;  4W97 A;  2K9N A;  4QIW N;  2LKX A;  2NVX J;  1QVU A;  1JUM A;  2Y2Z A;  2LLK A;  3LNQ A;  4BBR J;  1DU6 A;  1JKP C;  1DU0 A;  4A3E J;  2P81 A;  1IUF A;  5E3M A;  4MLO A;  5IP9 J;  2VI6 A;  2YU9 J;  1U78 A;  4BBS J;  3LSJ A;  1RET A;  3JRE A;  2JA6 J;  1SAN A;  1JJ8 C;  2IEK A;  2I10 A;  1IRZ A;  3BG5 A;  1B72 B;  3D1N I;  1OCP A;  3JRH A;  5FKK A;  4NDL A;  4DW6 A;  1GT0 C;  3ZQH A;  1W0T A;  3L1P A;  1ETY A;  4DZP A;  4IHW A;  2QCO A;  1ZTR A;  3TW7 A;  1JKQ C;  3O8G A; 
#chains in the Genus database with same CATH topology
 4OIR F;  4I09 A;  5H20 A;  2W24 A;  3K9T A;  2DQR A;  3H3Z A;  2CYY A;  3JRF A;  4BQQ A;  1DGW Y;  2ZJP F;  3ABU A;  3LQQ A;  4F7Z A;  1IV6 A;  4PGH A;  1ERD A;  2E36 A;  5GAG J;  3E6M A;  4HX4 A;  3LFU A;  4U0V A;  2XUB A;  1TWG J;  5LLQ A;  5ED4 A;  5L3G A;  3B02 A;  1R5G A;  3HYI A;  3FZV A;  4ITV A;  3ZPL A;  1MIJ A;  2GXA A;  2DA2 A;  5IOZ A;  3FXQ A;  1U0J A;  2LDU A;  4QPQ A;  4L9T A;  2HDD A;  1QU3 A;  2XGE A;  3BOQ A;  1BI2 A;  3H5A A;  4ABZ A;  1D1B A;  5FRN A;  2HQA A;  1WFX A;  4JYK A;  2L7M P;  3VYT B;  4AU7 A;  2O7O A;  1ZRD A;  2ZME A;  4L5J A;  2ZJQ F;  4ZH4 F;  1ZK8 A;  2CW0 F;  4X1E A;  3S2H J;  3HHH A;  1R7J A;  2Z1D A;  2JTV A;  1S6L A;  1JT0 A;  1KQ8 A;  3A1Y A;  4KMU X;  2JUG A;  2Y69 H;  4EEF G;  1K79 A;  2JQ7 A;  4FT8 A;  1RPW A;  3QU6 A;  1ENH A;  1HKT A;  2XPW A;  3H92 A;  3CMY A;  4BEH B;  5JLX A;  3T5X A;  4BNC A;  4CHU A;  3I59 B;  2E2I J;  3MQ0 A;  3ISP A;  4H4K C;  2AQE A;  3WGI A;  2YX4 A;  5LHH A;  3PQK A;  4NUB A;  3BQZ A;  2ZME C;  3L2V A;  2R5Y B;  2ESN A;  5FKN A;  5HS7 A;  1Z6T A;  1OPC A;  2BGC A;  2ETH A;  3ZXS A;  2JRT A;  2D1H A;  3OYI A;  3CJT B;  1QNT A;  3JR9 A;  3KEY A;  3SHF A;  2W00 A;  1KU3 A;  4NC8 A;  4B3A A;  5FKM A;  4XRS G;  3L7W A;  4JX5 A;  4GGG A;  2H1K A;  2R3S A;  2DMQ A;  2LY1 A;  1IN6 A;  5LRR A;  4PFP A;  3S17 J;  3L00 A;  1FP1 D;  4A3M J;  1SFU A;  3GTL J;  2P7C B;  3QRF F;  4L5E A;  1TBX A;  2CUJ A;  3TL4 X;  5M5X J;  3CP8 A;  3I0T A;  2XIG A;  4C30 A;  3OSG A;  4OMY A;  5BNG A;  1V5G A;  2KZV A;  3G1M A;  2RQP A;  1FIA A;  2MH2 A;  1RUO A;  2EJR A;  1XS9 A;  2MA3 A;  1IV8 A;  1O4X A;  2F5F A;  1XSV A;  1QA6 A;  2FF4 A;  3DTK A;  5DV5 A;  5E3O A;  3MZH A;  4A5N A;  2XPV A;  1ZG1 A;  3VWB A;  5DD8 A;  3WHB A;  3TDU C;  4X0G A;  1XN7 A;  2IAI A;  2R7W A;  3R6S A;  2H27 A;  3LFK A;  1MBE A;  2VPR A;  4OOI A;  3FF5 A;  1R9T J;  1YJW I;  4RM3 A;  2E71 A;  2M1B A;  2JPC A;  1OCR H;  3OMY A;  3F6V A;  3HOS A;  2Z9O A;  4XK4 A;  2RN7 A;  1R23 A;  2M7B A;  3RYP A;  2VBZ A;  2EZK A;  1FNN A;  2PN6 A;  4DBQ A;  3OYD A;  2VPL A;  2ADU A;  3BJ6 A;  4EQQ A;  4AM3 A;  3K4B A;  1LEA A;  2XRN A;  4IQJ A;  2V79 A;  4XSZ F;  1I6X A;  3QPT A;  4GRI A;  1W36 C;  2OBP A;  3D5R C;  3GXO A;  2IBD A;  3R0A A;  4FHT A;  3VEP A;  4L9V A;  2QGU A;  2XAF A;  4LOC A;  2Q1Z B;  2IP2 A;  2XSD C;  3BG9 A;  2P4W A;  2OA4 A;  2P5V A;  2X6O A;  4MEX F;  4KN7 X;  4RBO A;  2R7R A;  4AID A;  3BR1 A;  1UCR A;  4RGU A;  4HQE A;  2DU9 A;  1A31 A;  2JZY A;  2K5C A;  4YRV A;  1U8R A;  2FBH A;  2EWN A;  2XB0 X;  2BOL A;  3ZP5 A;  4A3J J;  3VOE A;  1E2X A;  4N4O B;  3V8J A;  4HPQ A;  4IOC F;  5KVR A;  3HOW J;  2HOT A;  5JHF A;  3SJM A;  3LSH A;  4KIS A;  1P4A A;  1ZEL A;  3K1P A;  4EGY A;  3DP7 A;  3EYY A;  3R60 A;  2L2O A;  5J1R A;  3Q3S A;  1OQY A;  5B66 C;  4KIC A;  4B48 A;  4Y13 A;  4AC0 A;  2F5C A;  3DF8 A;  1USS A;  2ZXH A;  4OIP F;  2FJ1 A;  4I76 A;  2K02 A;  3HM5 A;  5DDG A;  4C2M J;  1PP7 U;  1GXP A;  2CW7 A;  4L5I A;  1TTY A;  2WY7 Q;  3ZMT A;  1WJA A;  4M3D A;  1S7A A;  3WTY C;  1CQT A;  4BU2 A;  2NS7 A;  2X9D A;  1KYW A;  1D5V A;  2K9S A;  1UB9 A;  2JT1 A;  2BW3 B;  1X1C A;  4C3H J;  4FAS D;  2EK5 A;  2FD5 A;  2Q2E A;  4PJ0 C;  2YU3 A;  1OFC X;  3L9F A;  3BJO A;  3RZD J;  2PI0 A;  3J80 K;  3K4C A;  1D0Z A;  3I9V 2;  1QHH D;  3VB2 A;  3WTZ A;  1Z05 A;  3O3K A;  2B9S A;  2A6T A;  1SD6 A;  3TW6 A;  2NVY J;  2GA1 A;  2STT A;  3ECO A;  1Z21 A;  1UG0 A;  1AKH A;  1F4K A;  5LEJ A;  1U5T A;  2FNP A;  4ANJ A;  4F92 B;  4GCV A;  1WI9 A;  5GP9 A;  4BKX A;  2X1C A;  1FT9 A;  1QGP A;  2L4A A;  1RNL A;  4A69 C;  5ERI A;  2OC6 A;  2MD0 A;  1ZQ3 P;  2R7X A;  5FKL A;  3IWF A;  4I0A A;  5BQT A;  1Y1V J;  2L9V A;  3Q0W A;  4U0W A;  3PUB A;  5TIS C;  4BGD A;  1R1V A;  4D7N A;  2G9W A;  2RGV A;  3DBL B;  1IDZ A;  3FX3 A;  1U5T C;  5CPR B;  2L9S A;  1OYI A;  4OAZ A;  2R92 J;  5J40 A;  4Y33 A;  3VSK A;  1FP2 A;  3L2Q A;  2L0K A;  4I6Z A;  1ETK A;  1K61 A;  3NAR A;  2LBF A;  3TOA A;  1H88 C;  1N25 A;  3QYB A;  2NYX A;  1TWA J;  2JA8 J;  1Z9C A;  2HNH A;  3KFW X;  3F3X A;  3H1C A;  1JUP A;  3V42 A;  1HLV A;  1LVA A;  3ZQI A;  1LDD A;  2D1V A;  2L3D A;  3IL2 A;  3BZC A;  2VQC A;  2DO7 A;  2ISY A;  1RR7 A;  2E1N A;  1O3R A;  2VE8 A;  2QZ8 A;  3CZ6 A;  3M1C A;  4IHX A;  1ZGW A;  2R4G A;  1U9O A;  3DLL F;  2IS1 A;  4NB5 A;  1IZ1 A;  4NQW A;  1ON2 A;  3ZQL A;  5IP6 A;  4ZYH A;  5E79 C;  2A07 F;  3CC7 I;  4NNJ A;  5H6Q A;  2EIM H;  3CLO A;  5FLM J;  4XRF A;  1T2K A;  2DDA A;  5CVU A;  5F08 A;  1X1A A;  4AIJ A;  1YS7 A;  4A2U A;  3J81 K;  4B3X A;  3A4C A;  3IC7 A;  3R61 A;  3CCJ I;  1K4S A;  2JA7 J;  4R1H A;  4HLX A;  2ZXJ A;  2LY9 A;  2VL8 A;  5F64 A;  3QU3 A;  4TV7 A;  4OIN F;  3PIO F;  2KT0 A;  2WWY A;  1XGM A;  2KMU A;  3KCC A;  4YFN F;  2ZSH B;  5JLW A;  4FCY A;  4XLE A;  2QEN A;  2NOG A;  5L3E A;  3CDH A;  3HUG A;  1PVE A;  3GZ5 A;  3OIP A;  4MQ9 F;  2AQF A;  3T8T A;  1EH7 A;  4A0Z A;  3ABT A;  4BQO A;  2ME0 A;  3OSF A;  2TCT A;  3FIW A;  3RPQ A;  1WCM J;  3VOD A;  4R79 A;  2PEX A;  4IRH A;  5LFA A;  1FSE A;  4G12 A;  5EDN A;  1IAW A;  4K2E A;  1XCB A;  3FXR A;  1BIA A;  2HQR A;  2IPQ X;  2LY2 A;  2PMH A;  2NVT J;  1IN4 A;  4DNC A;  3ZQF A;  1QRY A;  3J80 Z;  3W3C A;  2BHZ A;  3HHG A;  1ZG5 A;  1D1C A;  4Y15 A;  1DP3 A;  1V5F A;  5LGN A;  5M3M J;  4BQA A;  2DA5 A;  1W5T A;  4CO8 A;  2Z33 A;  1MMD A;  3C2B A;  4B47 A;  3M4O J;  1MBK A;  1W5S A;  5HNH A;  4YG2 F;  1SVM A;  3IRQ A;  2NOJ B;  4A3D J;  4UB6 C;  2F5V A;  1NTC A;  2EB7 A;  2IA1 A;  3BPV A;  3LA2 A;  5DTD A;  4CH7 A;  4IOA F;  1ULY A;  1BJA A;  2W25 A;  4F3Q A;  3BY6 A;  3JSP A;  1CF7 B;  4E7Z A;  3IWZ A;  1HKS A;  2CQK A;  3BTC A;  2D2W A;  1MBJ A;  5JFR A;  4XQF A;  2EZL A;  3HPG A;  4G94 A;  2X6Y A;  2ZSI B;  5E3N A;  4RB3 C;  3F23 A;  5BPD A;  2DBB A;  2ZNY A;  5FRO A;  4BXU A;  3GYH X;  4ESB A;  2R5Z B;  2L7Z A;  2CMP A;  2GZW A;  4WXH A;  2ZB9 A;  1LB2 A;  3TBI A;  4AUX A;  1Y6I A;  2BXY A;  1K4T A;  2E1M B;  2DA4 A;  3EQL F;  2VT3 A;  2QVO A;  4GO1 A;  4PZJ A;  3HOT A;  1MNM C;  4G7O F;  2Y0M A;  2O61 A;  3GWZ A;  3RCO A;  5DS9 A;  4RGS A;  1MJ9 A;  5K1Y A;  1VQP I;  4HBL A;  4FIS A;  4CCM A;  1VQN I;  2ZNZ A;  5B5E C;  1AOY A;  1JTX A;  1XPX A;  4ZZD A;  3SXY A;  3DEW A;  1HDD C;  4MFD A;  2FNA A;  4A93 J;  3TP0 A;  2A6H F;  3IHU A;  1F1Z A;  3A01 B;  2KIU A;  1VZ0 A;  1R6R A;  1X1P A;  2XGD A;  4BAY A;  3BWG A;  4BDZ A;  4CXF A;  1VQL I;  2ECB A;  1FTT A;  1MDM B;  2DN0 A;  4CA0 A;  2VB6 A;  5ILU A;  2LH9 A;  4EJU A;  3E97 A;  2X1D A;  3QYE A;  4HLY A;  3F22 A;  3C3W A;  2GAU A;  4HG2 A;  3U9G A;  3RKW A;  1R36 A;  1HQC A;  3K70 D;  1ZYR F;  3J81 Z;  4I0B A;  3SYT A;  2IRF G;  1IN8 A;  4L0Z B;  6PAX A;  5JI6 A;  1RRJ A;  1YX3 A;  1JKP C;  1DU0 A;  2HEO A;  4M9X A;  3RKY A;  2RC4 A;  1IUF A;  2V6C A;  4XNF A;  2VI6 A;  3ESW B;  2YU9 J;  2BVL A;  4ZYE A;  3LSJ A;  1RET A;  3F9K A;  3TO9 A;  2A3S A;  2TDX A;  3ABM H;  3KET A;  3GZN B;  1E0E A;  2DCE A;  3U21 A;  2VXD A;  3HSF A;  1UST A;  2I10 A;  1IRZ A;  5DEQ A;  2DI3 A;  2FBI A;  5JR3 A;  4J01 A;  1B72 B;  1OCC H;  3P7N A;  3L1P A;  3JSO A;  2EA2 A;  2HU9 A;  3WU0 A;  3FXJ A;  4XLN F;  3TW7 A;  1X3U A;  2LOO A;  3QOE A;  3O8G A;  4ZTF A;  4N9I A;  3MFK A;  1BN5 A;  2P5K A;  2K7L A;  3F6O A;  5CVR A;  3DU6 A;  2V9P A;  5FD5 A;  2LRD A;  4E70 A;  1JGG A;  3BZK A;  2FML A;  4BAC A;  5F0F A;  1BR2 A;  2Q2E B;  3HTU A;  3FK6 A;  1PUF A;  1L3L A;  4KNY A;  5DUK A;  2XHK A;  5HVQ C;  4BY1 J;  1X1B A;  4XM3 A;  2CW8 A;  2YSR A;  5LD2 C;  2ID6 A;  2Y31 A;  5DUI A;  4HNU A;  2DFI A;  2M87 A;  5IY5 H;  1AKH B;  1S7O A;  4CZC A;  2UWM A;  2HFH A;  4V2F A;  3HDD A;  3AL0 B;  2XGC A;  1HKQ A;  1MJA A;  2QM3 A;  2DA3 A;  4J19 A;  3KYC B;  4M9Z A;  2VC0 A;  1IXS B;  1TQP A;  1D5Y A;  1U8B A;  2CUE A;  2E34 A;  2BVM A;  3SDB A;  5CQE A;  2KJC A;  1R00 A;  4RB0 A;  2E5Z A;  2QF7 A;  3HOU J;  2PX9 A;  3GZ6 A;  2Z16 A;  3FKJ A;  2EV5 A;  3QPS A;  2ELK A;  2ID3 A;  3MD2 A;  4XN3 A;  3AFH A;  3CTA A;  2E7X A;  4FE7 A;  4F91 B;  4IHS A;  2LF7 A;  3S1M J;  1X1D A;  2KZG A;  2DFF A;  1Z3Y A;  3BR3 A;  1Y0U A;  4JP0 A;  3S14 J;  2R7S A;  2R7Q A;  3OYJ A;  2LBF B;  1S3J A;  2IW5 A;  4J00 A;  4YEL A;  1YJ9 I;  2BE5 F;  1B59 A;  1QVT A;  2HOS A;  2VBY A;  2HVR A;  2FA5 A;  1Q1H A;  1BBY A;  3QQA A;  5D6F A;  4F93 B;  5E3L A;  1OYY A;  3FIS A;  2X0L A;  3S1N J;  2DOE A;  2PJP A;  3FXM A;  2HOA A;  2HYJ A;  4KT6 A;  3QOD A;  4LGW A;  2HDC A;  4GXO A;  4PSX A;  3G71 I;  2EH3 A;  1RES A;  1VQ4 I;  2TRT A;  2XV4 S;  3WGH A;  3S8P A;  1Y1W J;  4XOP A;  4XBF A;  2EIJ H;  5BOX A;  4HX8 A;  2VKD A;  3E1S A;  3IV5 A;  2XVC A;  1EA3 A;  2VC1 A;  5E1Z B;  2BW3 A;  1TW2 A;  4ZTJ A;  3LMM A;  3ZCO A;  2Z99 A;  1T8I A;  1WJ5 A;  3DWL E;  5FFZ A;  3OYK A;  1SEU A;  1KYZ A;  5DD4 A;  2NNN A;  5FJ8 J;  3WTT C;  5F1J A;  2H6C A;  4ESJ A;  4XLC A;  2HXI A;  3ZMZ A;  1SFX A;  2HZD A;  2OTL I;  2MYS A;  5ICE A;  4BYY A;  4G9Y A;  1WJD A;  3BTI A;  4S05 A;  2GXG A;  2VT2 A;  5E1X A;  2JUC A;  3PO2 J;  5HLG A;  4A3B J;  5J4Y A;  1BOB A;  1GHC A;  2ZFU A;  2KP6 A;  1EH6 A;  2LSO A;  2A05 A;  3EDP A;  2DOA A;  4BJ6 C;  3DTE A;  4G6D A;  3F8C A;  4D1Q A;  4II3 A;  4UVC A;  1E3O C;  1YE9 A;  2EV6 A;  2M4G A;  3JCU C;  3HL2 A;  1AHD P;  4E7J A;  1GUU A;  3HBL A;  4MTE A;  3UNG C;  3LSR A;  1R71 A;  1BI1 A;  1HBX G;  2ZXW H;  2R7V A;  5CYV A;  3MZ8 A;  2Y30 A;  2MAB A;  2P6S A;  4KUM A;  3KYL A;  4XLA A;  1MGT A;  3SZP A;  5KAI C;  3DEE A;  4HW0 A;  3KYD B;  1DPR A;  1YFH A;  4M74 A;  4AVZ A;  3UKG A;  1MD0 A;  1G59 A;  3KZZ A;  5IYC J;  1UFM A;  2VJI A;  1I3Q J;  1OMI A;  2P6T A;  2DQL A;  3QOP A;  5F0C A;  3C2H A;  1T98 A;  2H94 A;  4B4C A;  1TW3 A;  1KZH A;  3S1Q J;  1P7J A;  1ZN2 A;  3RPU D;  4PSW A;  3ULQ B;  1DPU A;  4XRS A;  1HSJ A;  1MBH A;  1UHM A;  4IEJ A;  3WHC A;  1TLH B;  4MIM A;  4W1U A;  3GFL A;  1ZR4 A;  3Q5F A;  1IUY A;  3BDD A;  2OU2 A;  4DIQ A;  2ELH A;  3KZY A;  4EM1 A;  4PUS A;  3NQO A;  5EEA A;  4IVN A;  2M5W A;  1YIJ I;  2LC2 A;  5CKT A;  3E5X A;  4G8X A;  1SAU A;  3MEX A;  3IKT A;  3M7G A;  5C4X J;  3E3V A;  2A69 F;  2HKO A;  3OR2 C;  2OV7 A;  1OYW A;  4WWC A;  1Z6R A;  3IAS 2;  2NNY A;  4LG0 B;  1SD5 A;  2NXN B;  2XRL A;  1ORK A;  4YIF A;  3LSI A;  5D4S A;  2E60 A;  1K7A A;  5GPC A;  1MW7 A;  4MTD A;  1WJC A;  2Y9Z A;  2GIZ A;  4EJW A;  3FMS A;  3TO6 A;  5GAD J;  1JTY A;  4LK1 F;  2JJ7 A;  2WC2 A;  3REO A;  1I1S A;  4OAY A;  1Z91 A;  4FTH A;  1JXS A;  3H9J A;  2LVS A;  2QQA A;  1XGN A;  3KLO A;  5FD6 A;  4EJV A;  3IH4 A;  2CS3 A;  3F8N A;  3RZO J;  1WI3 A;  3GME A;  3OYA A;  2CH0 A;  2FE3 A;  2LTP A;  3I56 I;  4HV6 A;  1QZY A;  4Y7N J;  4HEA 2;  1LDK B;  3HRM A;  4FET A;  1A04 A;  2M8E A;  2WAF A;  3CO6 C;  1X2M A;  2CQN A;  2EFN A;  5EGO B;  5DCM B;  5D5W B;  4Q48 A;  1MMA A;  4UHT A;  2HZT A;  2FBK A;  1QHG A;  1H0M A;  3ERM A;  1TQI A;  3D0S A;  2L9N A;  5HS9 A;  1LEB A;  1JJ6 C;  3FMQ A;  4O5V A;  3LL7 A;  3RQ4 A;  1WQ2 A;  1XSX A;  2G7H A;  2WV1 A;  2K40 A;  3WG9 A;  2R7U A;  4MNU A;  1B8I B;  2FSW A;  3BG7 A;  1TWC J;  1VQM I;  1GLN A;  2FOW A;  3I54 A;  1SFO J;  3DKX A;  1ZAO A;  2K27 A;  5EYR A;  2RV8 A;  4BUP A;  1S29 A;  5TGT A;  4UUS B;  1A36 A;  3E7L A;  1J9I A;  3QAH A;  3L2R A;  1IC8 A;  1FTZ A;  5C3E J;  1CF7 A;  2K86 A;  1IF1 A;  4UY8 I;  1R4N B;  2Z3Y A;  2Z2S B;  3G2B A;  2WTE A;  2EIL H;  2AO9 A;  2LF8 A;  4R8H A;  2E2H J;  3OS1 A;  2AXT C;  2NS0 A;  5HS8 A;  3JW4 A;  2ZBK A;  2XDV A;  2ZC2 A;  2ZFW A;  3CDL A;  1VQ6 I;  4GFB A;  2R5Z A;  3OL4 A;  1R58 A;  4EMS A;  4KYW A;  3PUF A;  2PFB A;  4UV8 A;  3ZMU A;  1PUF B;  3V7C A;  3SEQ A;  4XIC A;  1TT5 B;  1WKM A;  3K2Z A;  3OV8 A;  1NG6 A;  3E6C C;  1U6G A;  4G7H F;  2UXN A;  3K1M A;  5B1B H;  3MKY B;  1BM9 A;  2O8K A;  1L0O C;  1Y0N A;  1RKW A;  3CQZ J;  3M8F A;  5M5Y J;  2QQ8 A;  1ZRC A;  3A01 A;  2FMY A;  1G6N A;  3N97 A;  1VQ7 I;  3L2C A;  2Y9Y A;  4A0Y A;  2E1M C;  3IP4 B;  1T33 A;  1MDM A;  1MSE C;  1OKR A;  2DLL A;  4HF1 A;  5J8F A;  2R7F A;  1RUN A;  3TKY A;  2VQL A;  4IHT A;  1PP8 F;  3TMO A;  1P6R A;  3DXJ F;  4IRI A;  3RSN A;  4M6V A;  1P4X A;  5D8K B;  2DT6 A;  3AKZ A;  2E1O A;  2NRA C;  2DDB A;  1FC3 A;  4B43 A;  2NVQ J;  1S5L C;  4MEY F;  4RMN A;  4ZZL A;  1NH3 A;  3MN2 A;  2LNB A;  2KRF A;  2Q0O A;  4BY7 J;  1D8J A;  4IHV A;  1M1E B;  1H8A C;  3KP6 A;  4XR6 A;  1KU9 A;  1ZAR A;  2CQ7 A;  3ECH A;  1B72 A;  3P9K A;  2EPF A;  2HYG D;  2L9R A;  4Q5S F;  5L3C A;  1FOX A;  3GTO J;  4WF2 A;  4HV5 A;  2YX7 A;  4RLF A;  1BW6 A;  4BE0 A;  2WA0 A;  2FQ3 A;  4NC6 A;  1TNT A;  1WRJ A;  3FDY A;  2VBW A;  3ZN0 A;  3IAM 2;  1BR4 A;  4OWR B;  3CCU I;  3JRA A;  1K83 J;  1MKM A;  3I5U A;  5K5Q A;  2PQ8 A;  2M9H A;  3BLY A;  4XKB A;  3ZQG A;  2DPD A;  3OIQ A;  4CCJ A;  3H35 A;  4ENJ A;  2XF6 A;  1Z67 A;  4RDU A;  4EVI A;  2DA7 A;  3B73 A;  5J4V A;  3E5U A;  3ZMD A;  1VQO I;  1WH5 A;  5L3F A;  3S1R J;  3CCS I;  4FQG A;  5GTI C;  4KT5 C;  4HSR A;  2LP0 A;  3KZI C;  4P5O A;  1ETX A;  1ACI A;  4M71 A;  3BC8 A;  2EZI A;  4LB5 A;  1X2N A;  2FU4 A;  1YHQ I;  3F72 A;  3BCA A;  1JHH A;  1G3T A;  1DP7 P;  3M8E A;  2GQQ A;  3D5S C;  1TL8 A;  4BDY A;  3K70 C;  1XMA A;  1BR1 A;  3AL0 C;  1G2H A;  3W2W A;  4Q47 A;  3P5J A;  2K9M A;  3K0L A;  3FXO A;  1XMK A;  9ANT A;  4ZDL A;  1FMV A;  3VYS B;  4PCQ A;  1GVD A;  1V3F A;  3JRC A;  1EKE A;  4B1R A;  3ZRG A;  1G3S A;  3ASO H;  2LKP A;  4C2U A;  2NS8 A;  3H9G A;  2XKO A;  4HQM A;  1GDT A;  4E7K A;  4WXC A;  1UMQ A;  2O0Y A;  2WB1 A;  4CSW A;  1VFC A;  3HTS B;  3LST A;  1ZRF A;  3HSR A;  2NVX J;  1QVU A;  1JUM A;  2Y2Z A;  3W2V A;  3GLX A;  4NHJ A;  3W6K B;  4BE1 A;  2B7E A;  1LQ1 A;  2XAS A;  4E4H A;  2EFW A;  3ABL H;  5EEH A;  2Q8K A;  4UNO A;  3CME I;  2XAH A;  2LRE A;  5HDG A;  2QKM B;  3CJQ B;  2LKS A;  1UAA A;  1FBU A;  1Y39 A;  1W7P D;  3F8B A;  1OCP A;  3FBN B;  1YW8 A;  4DQ2 A;  1GT0 C;  4DW6 A;  4I2O A;  2RKH A;  3ZQH A;  2W1O A;  2DFH A;  1T38 A;  3S93 A;  1ETY A;  3ONQ A;  1IN7 A;  1R22 A;  2CFX A;  2QCO A;  3HSE A;  5HOO A;  2I8D A;  5H2F C;  1I27 A;  3OL3 A;  1IW7 F;  2VXZ A;  3CUQ B;  1P2F A;  1SFE A;  1VF9 A;  3O2P E;  1T6S A;  4D9J A;  2UUZ A;  1R4M B;  2V1X A;  3I58 A;  1T08 B;  2BY3 A;  3TED A;  1YIO A;  5F27 A;  1LFP A;  3ZQ7 A;  3H9Q A;  3J7A Y;  3DFG A;  4WCG A;  1BIB A;  1SC7 A;  5FKO A;  4LLL A;  1I39 A;  3NAU A;  4UVB A;  1ZRE A;  2MC4 A;  4A5M A;  1V5E A;  1J09 A;  2HOE A;  4CYC B;  5KCM A;  3A2K A;  2V9V A;  4IL6 C;  4UXN A;  4N4N B;  2BY2 A;  5E20 A;  2HQ5 A;  2A6E F;  1MMG A;  1TZL A;  3M8J A;  4QPO A;  3RQI A;  4A0X A;  5HLH A;  1RI7 A;  1QZE A;  4ZYD A;  2IGO A;  4U0Y A;  3VDX A;  2EFQ A;  2EBI A;  1LKX A;  2XAG A;  3H0D A;  3CDI A;  2ELJ A;  4ZYA A;  1YYV A;  1W7P B;  2RNG A;  1ETW A;  3HRS A;  1OCZ H;  1UHS A;  3OYL A;  1OCO H;  4HOB A;  2LMD A;  1MNE A;  2F4I A;  2KIQ A;  2M45 A;  2MG4 A;  3RTR A;  3MVP A;  3U1K A;  3A03 A;  2FUG 2;  5H6R A;  2DXI A;  5CVV A;  3DCF A;  2RRE A;  2M0M A;  5IYB J;  3EUK L;  2N8G A;  1XGS A;  1LE8 A;  2FQ4 A;  1WZ2 A;  5IYD J;  2G0E A;  1EH8 A;  4XRM A;  3GTJ J;  2ZJ2 A;  2HDW A;  3FK7 A;  1O7F A;  5CQG A;  4LG0 A;  4B44 A;  4YIR X;  3H5N A;  4M3E A;  2GIV A;  2EQR A;  3G6E I;  3DBH B;  3PFI A;  3S2D J;  3T8R A;  3KP2 A;  2J5P A;  3NRV A;  4UB8 C;  1UJ8 A;  3LQR A;  2FXA A;  3E6B A;  2R7T A;  4M6Y A;  5K5O A;  2PMZ A;  3LOC A;  5M5W J;  4A3G J;  1SD4 A;  2F5E A;  2Y0S A;  4OU0 A;  1EV7 A;  3K10 A;  3OOP A;  4RB1 A;  1SAX A;  2WV0 A;  5E8G A;  2V1U A;  2HTS A;  1DGR M;  3RPU A;  2FRH A;  4BE2 A;  2VUM J;  2QSG X;  3K69 A;  2RVC A;  5EGO A;  5DCM A;  1XDS A;  5K5R A;  4NC7 A;  3CCE I;  3JRI A;  1ZLK A;  4UUV A;  1K78 B;  3B6C A;  1X58 A;  2M30 A;  3BR2 A;  3N05 A;  2F4M B;  3V8K A;  2O8X A;  3ZOB A;  4MFE A;  5D5V B;  3KE2 A;  1XDU A;  2CO5 A;  2VKV A;  5TJJ A;  4V2G A;  3F8M A;  2ZO4 A;  4A3I J;  1ZR2 A;  1FYM A;  1EF4 A;  4YII A;  1B4A A;  4Y3O A;  2ME6 A;  4IX7 A;  1B9N A;  1B8I A;  2IS2 A;  2HGC A;  2CV2 A;  4M73 A;  2KFD A;  4DGW B;  2DYR H;  2KRH A;  4YFX F;  4A3L J;  2HXO A;  2QA4 I;  5TRD A;  3H0G J;  4UUS A;  2K3P A;  1AWC A;  3DKY A;  2FOK A;  1RC9 A;  1D0Y A;  4FX0 A;  3CF5 F;  1APL C;  5JHU A;  2BY1 A;  2JK3 A;  3WTS C;  4A12 A;  2DMT A;  3K6G A;  3ROU A;  4BS9 A;  4MGR A;  3F21 A;  1Z1D A;  1A5J A;  3ERE D;  1N77 A;  1A6I A;  1YQA A;  1J7K A;  4B09 A;  1LVK A;  1D8K A;  3I53 A;  1E3H A;  1PDN C;  3ZMS A;  1HST A;  2A61 A;  3KP7 A;  1GVJ A;  1OJL A;  3AG2 H;  1KA8 A;  4UVA A;  4M3G A;  2MC3 A;  1FY7 A;  3I55 I;  3HB9 A;  4PDK A;  3S3O A;  1O7L A;  1Z7L A;  3O6B B;  1YW7 A;  1T0F A;  4RGR A;  1A6Q A;  1WPK A;  1TNS A;  3LA7 A;  1BA5 A;  3GEZ A;  2EV0 A;  2O3F A;  2X1E A;  4GDF A;  3S3M A;  2H09 A;  5KHD A;  4I98 B;  4JOM A;  4CDG A;  5LEK A;  1O3T A;  1OLT A;  3M1E A;  4GYG A;  1BW5 A;  5BS6 A;  2O6G E;  1G8X A;  4OIO F;  3SDG A;  2VLA A;  4HA8 A;  4EJO A;  1VQ9 I;  5FRM A;  3FXK A;  1T0F C;  1ETV A;  3MMY B;  3D5L A;  2OQG A;  4I01 A;  2W85 A;  3ZQQ A;  1YG2 A;  3OS0 A;  3H3U A;  2D45 A;  3BRO A;  5F04 A;  2E35 A;  2CQQ A;  3GFJ A;  1WJB A;  1J2X A;  3BJA A;  2L7K A;  1IXC A;  2GOX B;  2QUF A;  4RLQ A;  3G1L A;  1J0R A;  1BOA A;  2XSJ C;  1W1W E;  1HW2 A;  2VQH A;  5K7F A;  3LSP A;  3AG1 H;  4P1W A;  4XOT A;  4GYI A;  4WXD A;  4S04 A;  3GVA A;  2PG4 A;  3K4M A;  3RJP A;  4YFK F;  4KDP A;  3MCZ A;  3BR0 A;  1F36 A;  4P96 A;  1XCV A;  4V19 K;  1ZKG A;  4N0B A;  1LJ9 A;  3I71 A;  2GWR A;  4RM2 A;  2L7F P;  3BZ6 A;  3FM5 A;  3Q0U A;  2NVU B;  1ZGJ A;  5ILV A;  3PNV A;  1ETQ A;  2MGQ A;  4E7S A;  5IOY A;  2IJL A;  5E18 F;  2O5R A;  4ZDO A;  1JT6 A;  5LHI A;  1N75 A;  2JPB A;  4G6Q A;  5AON A;  4QLC U;  2WBM A;  4IJA A;  2W57 A;  1VTN C;  2MLK A;  4XKW A;  1YI2 I;  3RI4 A;  2JVH A;  3G3Z A;  1NG7 A;  2KPM A;  5GAE J;  1ETO A;  3HGG A;  5ICF A;  5BMZ A;  2QLZ A;  3DV8 A;  2F6C A;  4EGZ A;  2R7Z J;  1WJE A;  3FBI B;  4C9Y A;  4BXX J;  3HRT A;  1YOV B;  1ZLJ A;  1PJR A;  2RAE A;  5K7H A;  1R49 A;  3FWE A;  2D5V A;  5GTH C;  5HNF A;  4KN4 X;  4DOZ A;  5DYM A;  2M4K A;  5HDN A;  3KPH A;  4AIH A;  4BL0 B;  4XKV A;  1QO0 D;  2JRM A;  3S32 A;  3L2U A;  3VYR B;  4RB2 C;  5FLX K;  1YX5 A;  3KLN A;  4HDU A;  5IPA A;  1TQM A;  2CV1 A;  1S8N A;  4ENN A;  1KU7 A;  1POG A;  2M2E A;  4PJM A;  3BTJ A;  3CJN A;  3PFY A;  4EAT A;  2P7V B;  4HAM A;  2ICW G;  2WB1 N;  4ETS A;  1YLF A;  5DM7 F;  2PBI A;  3RYR A;  2BBY A;  3A02 A;  2DJI A;  2ACJ A;  1VQ5 I;  3A0B C;  1FJL A;  1Y8R B;  4QSH A;  3WU2 C;  4MHG A;  2XGX A;  4LMY A;  1SMY F;  3K7A J;  4LFU A;  3VFZ A;  5J1U A;  1OIS A;  1G3Y A;  4A3C J;  2HPM A;  2XF5 A;  1I3A A;  3PM1 A;  3CD6 I;  3M3Y J;  1HCR A;  1FBS A;  3DPL C;  2OAZ A;  1MND A;  3Q9V A;  1GV2 A;  4A3K J;  5E17 F;  4P55 A;  2CGP A;  2OTJ I;  1UG2 A;  4AWX B;  5F0H A;  1I50 J;  2JA2 A;  2VKH A;  4WX9 A;  1LE8 B;  1IRG A;  4C2T A;  3GFI A;  3HC7 A;  2KIF A;  3BR6 A;  1U9N A;  4IKF A;  3GTP J;  3TO7 A;  3LSG A;  2WAQ A;  3KEO A;  2L5Q A;  1D3Y A;  4EJT A;  3B6A A;  4Z6Y A;  5ILS A;  3HKZ A;  2QEX I;  1LFU P;  3JRB A;  3MZY A;  1Z7U A;  1RR8 C;  3ZR8 X;  3K4L A;  3FM3 A;  2CG4 A;  2CJJ A;  4JQF A;  2K4B A;  4BQN A;  1PUE E;  2R7O A;  3W6V A;  4IPA A;  3K2A A;  3LWF A;  4ZDP A;  2O9L A;  2B0L A;  2FX0 A;  1WVR A;  3SEZ A;  3WTV C;  1CGP A;  3W6J B;  4AVP A;  3HG9 A;  3IH2 A;  3QP6 A;  2V1N A;  3BTL A;  2UZK A;  3CUQ A;  1H9T A;  5L3B A;  5LBQ A;  4AIK A;  2OCC H;  1XB4 A;  1KQ0 A;  2Y48 A;  3LA3 A;  1XX5 A;  4JBA A;  2A5Y B;  2XB5 A;  3E6D A;  1FOK A;  2LD5 A;  2XC7 A;  3CO7 C;  2H8W A;  2ZXI A;  1FIP A;  2VOO A;  2GXB A;  5GPA A;  4DZJ A;  2DTZ A;  2WY8 Q;  1RZ4 A;  2MD5 A;  2V9K A;  3RKX A;  5IP7 J;  3DPT A;  4CYC A;  3R0J A;  2M3A A;  4PFO A;  2HVQ A;  3PNT A;  1BC7 C;  1XTA A;  2VN2 A;  3CUQ C;  1IGN A;  1P4W A;  2COB A;  2IGK A;  2LK2 A;  2MLG A;  1Y56 A;  5J47 A;  2ESH A;  3OWT A;  1DDN A;  3GCM A;  3F0C A;  3HXL A;  2M8G X;  1BJZ A;  1Q1V A;  1DUX C;  5K7Z A;  5EG0 A;  5GAH J;  3IKV A;  1W7P A;  4RA2 A;  1QBJ A;  2KL4 A;  1H9G A;  1FBQ A;  4EV0 A;  4XL9 A;  3MKZ A;  2VON A;  5D8L B;  4AD9 A;  5FLX Z;  1MH3 A;  3K4J A;  2DFE A;  3DTI A;  2DTR A;  2FEZ A;  2BZT A;  4ON0 A;  1VI0 A;  2BY0 A;  2GOM A;  2EA4 A;  5D5X B;  2VJ5 A;  3WU1 B;  2AHQ A;  3Q0V A;  1TC3 C;  2XAJ A;  4CGZ A;  2PMZ N;  4IF4 A;  2Y0S N;  5E8I A;  4AYB A;  3SQN A;  2GM4 A;  3PJR A;  4D7M A;  1YRN B;  2XKP A;  3K1N A;  2F4O B;  4EM0 B;  2E7W A;  2W84 A;  2X6W A;  2V26 A;  1UEL B;  1IO2 A;  1B9M A;  4QWQ A;  4HX7 A;  1HW5 A;  3BP8 A;  3PIP F;  2DMN A;  2PMU A;  5AIQ A;  3AG3 H;  3N4M A;  1G4D A;  1XG1 A;  1K6O A;  3H5R A;  4LLN A;  1ITY A;  4IHY A;  5EF6 A;  2Y75 A;  4XOR A;  3C18 A;  4P9F A;  2HVS A;  2HYF A;  2LLK A;  4XLF A;  4PK4 A;  5D5U B;  2XRO A;  4IZZ A;  3V7R A;  2H1L A;  2P81 A;  2DW4 A;  3E5Q A;  4A3E J;  5E3M A;  4MLO A;  5IP9 J;  4LJZ F;  3J7Y J;  2OD5 A;  4RAY A;  1ON1 A;  3JAM K;  3JRE A;  3LAP A;  2VBX A;  1X3W B;  2IGN A;  2JA6 J;  1JJ8 C;  2HTJ A;  2W4S A;  3CC2 I;  3D1N I;  3DU5 A;  3JRH A;  5FKK A;  1ONV A;  2CV0 A;  3K4K A;  1K78 A;  1X3Z B;  1W0T A;  3F8F A;  5ICC A;  3LAJ A;  3MAJ A;  1ZTR A;  1J75 A;  4PGG A;  2E1C A;  2WAE A;  3CCY A;  2K9L A;  2X6X A;  4II2 A;  4PJL A;  3QPL A;  5KK1 A;  3HPH A;  2NAZ A;  1P9Q C;  3WE3 A;  2CQX A;  1GXQ A;  5EJC A;  2V7F A;  1VND A;  1IJW C;  2E19 A;  4FX4 A;  1FPQ A;  2XPU A;  1PYV A;  1FX7 A;  2HWV A;  5L3D A;  4BXF A;  3TQN A;  3G1O A;  3PSF A;  4BH9 A;  2X48 A;  5FFX A;  1MMS A;  2IT0 A;  1B1B A;  4A6E A;  1HDP A;  2HQN A;  1LUJ B;  2WAD A;  3KP5 A;  3I4P A;  4HF0 A;  4CCN A;  3S3N A;  3S16 J;  1ZHF A;  4KFC A;  3GW2 A;  5HDK A;  2LG4 A;  3EYI A;  3O8H A;  1QPI A;  2QSH X;  3J7A O;  1YW9 A;  3SFZ A;  1J59 A;  5LGT A;  2EFO A;  4I99 C;  3ZGK A;  1A35 A;  2BYV E;  3I4N J;  4M3F A;  2YR2 A;  2QWW A;  2OZ6 A;  3A0H C;  4LB6 B;  2QBY B;  3T0Y A;  4HRI A;  2X51 A;  4QTR A;  1KON A;  2G7U A;  1XGO A;  4A3F J;  3V7S A;  2BXZ A;  4B8X A;  4D5F A;  1I1G A;  3CUO A;  1O3S A;  2JVG A;  1O57 A;  5KNL A;  2PJR B;  3C1D A;  4WK8 F;  2V6E A;  5BPI A;  4UV9 A;  1X19 A;  5HLI A;  5FLV A;  1XMX A;  3OIO A;  2EFP A;  4ENM A;  3IRR A;  1TT0 A;  3FXU A;  3J7Z I;  2MH9 A;  3ZQC A;  2DT7 B;  2DA6 A;  1ZH5 A;  1DQU A;  3CES A;  1S7E A;  3OYB A;  2C6Y A;  4BHB A;  3KEQ A;  4L18 B;  5EZG A;  3S2W A;  1MH4 A;  3L09 A;  5B3S H;  1IG7 A;  3KIO A;  4O6J A;  3Q9S A;  1S9H A;  3CF2 A;  4BJ5 C;  3HOZ J;  3I4M J;  3TDZ C;  1FOW A;  4NBQ A;  3GUD A;  2M7A A;  5E1W A;  3GTM J;  2JN6 A;  4KIT B;  3GBG A;  4Z2Y A;  3FKI J;  1FEX A;  4RGX A;  5EZH A;  2DJN A;  2ISZ A;  5KAF C;  2DA1 A;  1TP4 A;  4U87 A;  5F1R A;  1YIT I;  3DQV C;  3I64 A;  4DYR A;  1R1U A;  4CCO A;  4IXA A;  2KDO A;  3JAM Z;  2STW A;  2VIX A;  1Z77 A;  1HF0 A;  3HJE A;  4E7I A;  3OYG A;  3BR5 A;  4CZZ A;  3CLQ A;  1EJ9 A;  2CSO A;  2OZU A;  2E5N A;  3K4N A;  3GF2 A;  4C3J J;  1V55 H;  1FLI A;  4HNV A;  2JSP A;  3VPR A;  2QQ9 A;  3OYH A;  2K9Q A;  4F52 A;  3OR1 C;  1E17 A;  4LIV A;  3CC4 I;  3FHZ A;  2H8R A;  4CYD A;  2XAU A;  2V4J C;  1FZP B;  3BG6 A;  4DYQ A;  1YJN I;  1BI3 A;  4F55 A;  4JX6 A;  4XSX F;  3C2G A;  5D4R A;  2VJJ A;  2I5U A;  4OIQ F;  3OYF A;  2R0Q C;  1SD7 A;  5HOD A;  3CMA I;  4OMZ A;  2UV1 A;  1UHW A;  4HYE A;  3OY9 A;  2GLO A;  4M9S A;  2QKL B;  2L4M A;  2K85 A;  2DYS H;  3CMM A;  3TP3 A;  5J8C A;  2ZME B;  3COA C;  2E2J J;  2IGM A;  1FMW A;  4RAG A;  3QWL A;  1YTY A;  5CVJ A;  1D0X A;  5FO5 A;  1F5T A;  3WTX C;  1HC8 A;  1OCT C;  1J5Y A;  4KA4 A;  1JKO C;  4X6A J;  2BHY A;  2KIS A;  1YO5 C;  3MKW B;  2EZH A;  2J5O A;  5C44 J;  4M6X A;  3FXL A;  3GO5 A;  1WSU A;  2P5L C;  1WH7 A;  1STZ A;  1W36 D;  2HR3 A;  3GTQ J;  4ZJZ A;  2DMP A;  3WE2 A;  3C7J A;  3QPH A;  5LHG A;  1FWZ A;  3BT9 A;  4KIG A;  1RIO H;  3LSK A;  3RIR A;  3JRG A;  5EG0 B;  2WAQ N;  3MKL A;  2ZKZ A;  1MSF C;  4CCK A;  3HZJ A;  2W48 A;  3HKZ N;  2KDZ A;  2HKX A;  2IS6 A;  3WG7 H;  1NK2 P;  4BJT A;  1HW1 A;  2COM A;  2VJ4 A;  3CCR I;  4KMF A;  5IT9 K;  3EET A;  4DYC A;  3S15 J;  3GFM A;  3KP4 A;  2X4H A;  4LD5 A;  1OR7 A;  2A5W A;  3CCQ I;  2L01 A;  3PNY A;  3BPX A;  5DCF A;  4XLP F;  2HI3 A;  5M3F J;  3OOU A;  5CLS A;  5AIP A;  1ZG3 A;  5D6E A;  3AG4 H;  3U2R A;  2YPR A;  2MW8 A;  3U1D A;  1V4R A;  3QP5 A;  4XN0 A;  2F48 A;  4ASN A;  2ECC A;  1JI8 A;  2EIN H;  4HDV A;  2L54 A;  2BEO A;  4ZC3 A;  2IVM A;  4JX4 A;  1BI0 A;  1SMT A;  5FB2 A;  1OR7 C;  2OPT A;  2VOD A;  2LFB A;  2YUS A;  1WHU A;  2CU7 A;  4LLG F;  3GLL A;  5J6X A;  4U7B A;  1VQK I;  1TWH J;  1JGS A;  1LDJ A;  4U88 A;  4HF2 A;  4L0Y B;  1H89 C;  2IS4 A;  2CUF A;  4IRG A;  1TWF J;  4CCL A;  3X2Q H;  4UUT A;  2M0C A;  1WJF A;  4E7L A;  3DKW A;  4D5C A;  3VSL A;  2KKO A;  4BEH A;  5IT3 A;  3I59 A;  1MBG A;  4MQV A;  2CUZ A;  4C3I J;  3GX4 X;  1C0W A;  1VQ8 I;  2R5Y A;  3NWS A;  2DAO A;  3M07 A;  3H36 A;  4MO7 A;  3SZG A;  4E7H A;  2VKE A;  4Y52 J;  1JUS A;  1KU2 A;  2F5D A;  4KJZ A;  4CUG A;  3OYC A;  3H3V K;  3HIF A;  5DM6 F;  1T56 A;  4H0E A;  2RDP A;  4AYB N;  1FYK A;  3QYF A;  1ZGA A;  3DLA A;  3V4G A;  2JSC A;  3EUH A;  4LIT A;  4KIB A;  3JRD A;  3HOX J;  2YS9 A;  4RS8 A;  1FYL A;  1YS6 A;  2B63 J;  3ASN H;  1I6H J;  1W4M A;  2QYO A;  1XC5 A;  2R7D A;  4ZYG A;  2DOF A;  4O3M A;  3WOD F;  3NEU A;  4G7Z F;  2QSF X;  2Z5U A;  3SFI A;  2KRC A;  2LR8 A;  4I7H A;  3R4K A;  1Z0X A;  3EPZ A;  4ENK A;  1X4O A;  2MBF A;  3HOV J;  1SVL A;  2GBY A;  2QQB A;  5HLT A;  1YRN A;  5A2Q K;  3BG3 A;  5LGU A;  5J1Y A;  3EUH C;  4ESF A;  4LK0 F;  2DT5 A;  2HPI A;  3BCB A;  4Q4Z F;  2W7N A;  1XSD A;  2P8T A;  3P9I A;  3CJR B;  3BQY A;  3DPU A;  5CVI A;  3G73 A;  1Y8Q B;  3I3L A;  5FGM A;  3GTG J;  1N78 A;  2IA0 A;  1E3P A;  4L9J A;  4XID A;  5F6F A;  2UXX A;  3HOY J;  1K6Y A;  1S72 I;  2CFO A;  3TOB A;  2CRG A;  4M3B A;  1GV5 A;  2O03 A;  4BHP A;  1HA8 A;  2BV6 A;  3KX2 A;  3KP3 A;  5JVT A;  2IA2 A;  2XF7 A;  2K3F A;  2PLY A;  1SFK A;  1R5H A;  3IUO A;  3ML6 A;  2OJE D;  5IT9 Z;  4S0H B;  3SZT A;  1KGS A;  2KHM A;  1WGX A;  1IDY A;  1RKT A;  3LSM A;  4HST A;  3UR3 C;  2OCE A;  3CCV I;  3TGN A;  2X85 A;  4G6T B;  1P7I A;  1U5T B;  3FMR A;  4HZF A;  2HS5 A;  2JWT A;  2OQR A;  1U2W A;  5ICG A;  1FOY A;  1V54 H;  4YEJ A;  4EM2 A;  3WGG A;  1F9N A;  2CWE A;  1MMN A;  2OUM A;  4XON A;  2OF7 A;  3PSI A;  1LPQ A;  4LIU A;  3VYU B;  3ZMV A;  5CJ9 A;  4N9H A;  1T95 A;  3AAF A;  1JKR C;  3JTG A;  1U3E M;  2JA5 J;  3V8L A;  2M34 A;  2DMU A;  2LYC A;  1BL0 A;  3GTK J;  4DBR A;  5J3L A;  1REP C;  2ZJR F;  3EUA A;  2IXS A;  3ZN1 A;  1W5C C;  4U7D A;  1MBF A;  4L9N A;  3HGY A;  1QPM A;  4PJJ A;  1JE8 A;  4HNT A;  1AU7 A;  1ODD A;  2DOD A;  3NWT A;  4DJA A;  2KIM A;  3WTW C;  4LG3 A;  1IRX A;  4A6D A;  3OS2 A;  1XD7 A;  1F43 A;  3MWM A;  2MFZ A;  1UZC A;  3L2W A;  4PJN A;  3ELK A;  4RAF A;  1B6A A;  5EEG A;  1HOM A;  4JK1 X;  4P9U A;  3PL8 A;  4Y17 A;  2DK5 A;  4XMY A;  1D1A A;  3HEF A;  2EIK H;  2F2E A;  4BHC A;  3W2A A;  1SVO A;  1R1T A;  1MZB A;  3JTH A;  1QQI A;  2MSY A;  5JVG F;  2AS5 F;  4RAZ A;  4XLH A;  2DK8 A;  1IN5 A;  1KQ9 A;  2QBY A;  1O3Q A;  5B1A H;  3CCL I;  3RKQ A;  1NHA A;  5C4J J;  2KLO A;  3PQJ A;  1LFB A;  4NQW B;  4Y4R A;  3OYE A;  4I02 A;  3T1B A;  4D0P A;  2JMW A;  4FE4 A;  1NK3 P;  1IRF A;  1AA7 A;  2PJR A;  4CIC A;  2RQQ A;  2DPU A;  2RNJ A;  1LNW A;  4XKC A;  2R93 J;  3IH3 A;  3DEU A;  3M9A A;  1W0U A;  2H6B A;  1Z3X A;  2AXL A;  1WWX A;  2V1D A;  1IXR C;  4E6K G;  1BC8 C;  3PO3 J;  3CP2 A;  2VAS A;  3CCM I;  2P0W A;  2XAQ A;  1R5I D;  4W97 A;  5A2Q Z;  1G3W A;  3HRU A;  2K9N A;  4QIW N;  2LKX A;  3HUG B;  3LNQ A;  4BBR J;  2VQG A;  1T39 A;  1DU6 A;  1MJB A;  2K4J A;  2L02 A;  3OYM A;  3G4S I;  4IQ4 A;  3ABK H;  3RDI A;  3WTU C;  1U78 A;  4BBS J;  3E0J B;  4M72 A;  2KQR A;  3DBR B;  4IO9 F;  2W82 A;  3FHN A;  2KJB A;  1SAN A;  2GA2 A;  2IEK A;  1FSH A;  3P9C A;  3BG5 A;  1QZZ A;  4NDL A;  1HXD A;  2A68 F;  4KIF A;  1X4P A;  3OYN A;  5LRS A;  1JHF A;  1I5Z A;  1P92 A;  4DZP A;  2VOP A;  4IHW A;  1JKQ C;  2VE9 A;  2ZCW A; 
#chains in the Genus database with same CATH homology
 3M3Y J;  3CCY A;  1JGG A;  3QPL A;  1VF9 A;  5F0F A;  2CQX A;  3JRF A;  3FK6 A;  1PUF A;  3TED A;  1IV6 A;  1VND A;  5F27 A;  4BY1 J;  1IJW C;  2E19 A;  2XPU A;  2ID6 A;  1TWG J;  2Y31 A;  5FKO A;  3NAU A;  1AKH B;  2DA2 A;  3G1O A;  5IOZ A;  4CYC B;  4V2F A;  2HDD A;  2X48 A;  3HDD A;  2XGC A;  2XGE A;  4ABZ A;  2HQ5 A;  1HDP A;  4J19 A;  2DA3 A;  3RQI A;  3S16 J;  4JYK A;  1D5Y A;  1U8B A;  2CUE A;  2L7M P;  2O7O A;  3O8H A;  1QPI A;  2EBI A;  1ZK8 A;  4X1E A;  3S2H J;  2QF7 A;  3HOU J;  1JT0 A;  3QPS A;  2ELK A;  2ID3 A;  1ETW A;  4EEF G;  4FE7 A;  1RPW A;  3I4N J;  4M3F A;  1ENH A;  1UHS A;  3S1M J;  3BR3 A;  2XPW A;  3CMY A;  2MG4 A;  4QTR A;  3MVP A;  4JP0 A;  3A03 A;  5JLX A;  3S14 J;  2E2I J;  4A3F J;  3DCF A;  1LE8 A;  5IYB J;  2N8G A;  2FQ4 A;  5IYD J;  3BQZ A;  2R5Y B;  2G0E A;  5FKN A;  4XRM A;  3GTJ J;  4D5F A;  1QVT A;  2HOS A;  3FK7 A;  3QQA A;  5E3L A;  3FIS A;  4M3E A;  3S1N J;  2EQR A;  3S2D J;  3JR9 A;  5FLV A;  2HOA A;  3OIO A;  2HYJ A;  3ZQC A;  4B3A A;  2EH3 A;  5FKM A;  4XRS G;  2DA6 A;  1RES A;  2TRT A;  4JX5 A;  1S7E A;  1Y1W J;  2H1K A;  3LOC A;  2DMQ A;  5M5W J;  4A3G J;  5EZG A;  3IV5 A;  1MH4 A;  3S17 J;  4A3M J;  1IG7 A;  3GTL J;  4L5E A;  3HOZ J;  5M5X J;  3I4M J;  3OSG A;  5BNG A;  3GTM J;  2JN6 A;  3GBG A;  2VUM J;  3FKI J;  1FEX A;  3G1M A;  5FJ8 J;  5F1J A;  1FIA A;  5EZH A;  2DJN A;  1XS9 A;  5EGO A;  2HXI A;  2DA1 A;  1O4X A;  3JRI A;  3B6C A;  1X58 A;  5E3O A;  3BR2 A;  4DYR A;  2XPV A;  3BTI A;  3PO2 J;  3WHB A;  1Z77 A;  4A3B J;  3ZOB A;  4MFE A;  1HF0 A;  2IAI A;  3BR5 A;  1MBE A;  2VKV A;  2VPR A;  1R9T J;  4A3I J;  4V2G A;  1ZR2 A;  1E3O C;  4C3J J;  1EF4 A;  2ME6 A;  1B8I A;  4XK4 A;  4HNV A;  1AHD P;  1GUU A;  3HBL A;  3VPR A;  3LSR A;  2K9Q A;  2EZK A;  4A3L J;  2HXO A;  2H8R A;  2Y30 A;  3H0G J;  4UUS A;  4DYQ A;  4JX6 A;  1APL C;  2IBD A;  3UKG A;  2R0Q C;  2JK3 A;  5HOD A;  5IYC J;  4LOC A;  1I3Q J;  2DMT A;  2XSD C;  2GLO A;  3BG9 A;  2X6O A;  5F0C A;  1A5J A;  3TP3 A;  4B4C A;  4RBO A;  3S1Q J;  1A6I A;  3BR1 A;  2E2J J;  1P7J A;  4XRS A;  2XB0 X;  1MBH A;  4IEJ A;  3WHC A;  4A3J J;  1OJL A;  4MIM A;  1OCT C;  4W1U A;  1ZR4 A;  1JKO C;  4M3G A;  4X6A J;  3HB9 A;  3HOW J;  2EZH A;  5EEA A;  5C44 J;  2HOT A;  3SJM A;  1WH7 A;  1WPK A;  3GTQ J;  5C4X J;  1BA5 A;  2DMP A;  5J1R A;  3Q3S A;  3BT9 A;  2XRL A;  1ORK A;  4AC0 A;  1BW5 A;  3JRG A;  5GPC A;  5EG0 B;  2WAQ N;  3MKL A;  2FJ1 A;  2Y9Z A;  4I76 A;  3SDG A;  1MSF C;  3HM5 A;  4C2M J;  2W48 A;  3HKZ N;  1JTY A;  2KDZ A;  2JJ7 A;  1NK2 P;  1ETV A;  4FTH A;  5F04 A;  4M3D A;  2LVS A;  2CQQ A;  2NS7 A;  1CQT A;  2X9D A;  4DYC A;  2K9S A;  3S15 J;  3IH4 A;  4C3H J;  3RZO J;  1WI3 A;  2FD5 A;  3G1L A;  2LTP A;  1OFC X;  4Y7N J;  5K7F A;  3LSP A;  3RZD J;  2HI3 A;  5M3F J;  3OOU A;  1X2M A;  5EGO B;  3TW6 A;  2NVY J;  3BR0 A;  1F36 A;  1ZKG A;  1AKH A;  2MW8 A;  2L7F P;  3Q0U A;  1JJ6 C;  2ECC A;  1ETQ A;  2MGQ A;  5IOY A;  4JX4 A;  5GP9 A;  4BKX A;  1JT6 A;  2OPT A;  2LFB A;  2WV1 A;  2YUS A;  2CU7 A;  2K40 A;  4A69 C;  1TWH J;  1ZQ3 P;  5FKL A;  1B8I B;  1TWC J;  1Y1V J;  3Q0W A;  1H89 C;  1SFO J;  1ETO A;  5EYR A;  3HGG A;  2CUF A;  4D7N A;  1IDZ A;  1TWF J;  2R7Z J;  4UUT A;  4UUS B;  2M0C A;  3E7L A;  4BXX J;  1IC8 A;  1FTZ A;  5C3E J;  2R92 J;  2RAE A;  4D5C A;  5K7H A;  2L0K A;  4I6Z A;  2D5V A;  1ETK A;  1K61 A;  3NAR A;  1MBG A;  4C3I J;  2AO9 A;  1H88 C;  2E2H J;  2R5Y A;  3CDL A;  1TWA J;  2JA8 J;  4MO7 A;  4GFB A;  2R5Z A;  1JUP A;  2VKE A;  4Y52 J;  1JUS A;  1HLV A;  1PUF B;  5IPA A;  3ZQI A;  3H3V K;  4XIC A;  1POG A;  1T56 A;  2M2E A;  4AYB N;  3BTJ A;  1RR7 A;  3JRD A;  3HOX J;  2YS9 A;  4IHX A;  2WB1 N;  1ZGW A;  2B63 J;  1I6H J;  1XC5 A;  1U9O A;  2O8K A;  1RKW A;  3CQZ J;  3SFI A;  2LR8 A;  3A02 A;  5M5Y J;  3ZQL A;  5IP6 A;  1Z0X A;  3A01 A;  1FJL A;  3HOV J;  4QSH A;  5FLM J;  2GBY A;  2Y9Y A;  3K7A J;  1YRN A;  1T33 A;  5J1U A;  3BG3 A;  5F08 A;  1MSE C;  5J1Y A;  4A3C J;  2JA7 J;  3PM1 A;  1HCR A;  2LY9 A;  4M6V A;  2KT0 A;  3BQY A;  1GV2 A;  4A3K J;  2E1O A;  5JLW A;  3GTG J;  4XID A;  4FCY A;  2NOG A;  3HOY J;  1UG2 A;  5F0H A;  1I50 J;  2NVQ J;  1LE8 B;  2CRG A;  3MN2 A;  4M3B A;  1GV5 A;  3BR6 A;  1U9N A;  3GTP J;  3LSG A;  4BY7 J;  2ME0 A;  3OSF A;  2TCT A;  4IHV A;  3FIW A;  1WCM J;  3B6A A;  1H8A C;  1LFU P;  3JRB A;  4S0H B;  4G12 A;  5EDN A;  1WGX A;  1IDY A;  1RKT A;  2CJJ A;  1B72 A;  2NVT J;  2L9R A;  3W6V A;  3K2A A;  1P7I A;  2O9L A;  3ZQF A;  1QRY A;  2FX0 A;  3GTO J;  2JWT A;  1BW6 A;  3IH2 A;  5M3M J;  3BTL A;  2DA5 A;  2OF7 A;  3JRA A;  3C2B A;  1K83 J;  3M4O J;  1MBK A;  2XB5 A;  1JKR C;  4A3D J;  2LD5 A;  2JA5 J;  2M34 A;  2DMU A;  1NTC A;  2M9H A;  5DTD A;  1BL0 A;  3GTK J;  5J3L A;  3ZQG A;  1FIP A;  1MBF A;  3HGY A;  5GPA A;  4DZJ A;  2DTZ A;  4CYC A;  4RDU A;  2DA7 A;  5IP7 J;  1AU7 A;  1WH5 A;  3BTC A;  1IGN A;  1MBJ A;  3S1R J;  1F43 A;  2COB A;  2EZL A;  2LP0 A;  5E3N A;  2LK2 A;  1ETX A;  2R5Z B;  3F0C A;  2EZI A;  2L7Z A;  2M8G X;  1BJZ A;  2ZB9 A;  1HOM A;  1X2N A;  1Q1V A;  4AUX A;  5K7Z A;  5EG0 A;  3HEF A;  2DA4 A;  2MSY A;  1MNM C;  5DS9 A;  1G2H A;  1MH3 A;  3RKQ A;  4FIS A;  1VI0 A;  5C4J J;  1LFB A;  1JTX A;  9ANT A;  3DEW A;  1HDD C;  2AHQ A;  3Q0V A;  4MFD A;  1TC3 C;  4A93 J;  3TP0 A;  2PMZ N;  3A01 B;  2XGD A;  1GVD A;  2Y0S N;  2JMW A;  3JRC A;  4FE4 A;  4B1R A;  2GM4 A;  1NK3 P;  2ECB A;  4D7M A;  1FTT A;  2NS8 A;  1YRN B;  2DN0 A;  2R93 J;  1GDT A;  3IH3 A;  1W0U A;  1UMQ A;  3PO3 J;  1VFC A;  2DMN A;  1ITY A;  1XG1 A;  4IHY A;  5EF6 A;  4W97 A;  2K9N A;  4QIW N;  2LKX A;  2NVX J;  1QVU A;  1JUM A;  2Y2Z A;  2LLK A;  3LNQ A;  4BBR J;  1DU6 A;  1JKP C;  1DU0 A;  4A3E J;  2P81 A;  1IUF A;  5E3M A;  4MLO A;  5IP9 J;  2VI6 A;  2YU9 J;  1U78 A;  4BBS J;  3LSJ A;  1RET A;  3JRE A;  2JA6 J;  1SAN A;  1JJ8 C;  2IEK A;  2I10 A;  1IRZ A;  3BG5 A;  1B72 B;  3D1N I;  1OCP A;  3JRH A;  5FKK A;  4NDL A;  4DW6 A;  1GT0 C;  3ZQH A;  1W0T A;  3L1P A;  1ETY A;  4DZP A;  4IHW A;  2QCO A;  1ZTR A;  3TW7 A;  1JKQ C;  3O8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...