2Y0SN

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 13
structure length 64
sequence length 64
chains with identical sequence O
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y0sN00
1JTYA 4M3DA 2OF7A 3H0GJ 4MO7A 2HOTA 4S0HB 2R93J 1WI3A 2Y31A 5J1RA 3BG9A 3LOCA 2X9DA 3HKZN 4B3AA 3K7AJ 2XB5A 1IDZA 4ABZA 5IP9J 3Q0VA 3O8HA 4BY7J 1JUSA 1MSFC 4A3MJ 5FKMA 3RQIA 2MGQA 1HF0A 4LOCA 2LR8A 2NS7A 3HOYJ 1AKHA 3S14J 1ETOA 3TEDA 1B8IB 1TC3C 1JGGA 1JKRC 4CYCB 1OFCX 2HQ5A 1A6IA 2DMNA 2O7OA 3HM5A 1OJLA 1G2HA 1AHDP 2IAIA 3ZQHA 4J19A 1AKHB 2AHQA 2ZB9A 1ORKA 5M5YJ 1JKOC 2K9SA 2EZLA 1H88C 1FJLA 1X58A 3RKQA 1D5YA 1SFOJ 4QTRA 3S17J 1MNMC 3BR6A 5EZHA 2HOAA 1VFCA 5FKKA 4A3IJ 4FCYA 1X2NA 3SFIA 2HDDA 3MVPA 3GTOJ 3TW6A 3GTGJ 1IDYA 3GTQJ 1ETQA 2R5ZB 5F04A 4A3DJ 4MFDA 4BY1J 2ECBA 1A5JA 2Y2ZA 5FKOA 5EF6A 4HNVA 2VKEA 2ELKA 5K7ZA 1I50J 3GTLJ 4XRSA 4DW6A 9ANTA 4A69C 2E2JJ 3E7LA 3G1OA 5F1JA 2CUEA 5F0FA 5C4XJ 2WB1N 2LVSA 5M5XJ 1QRYA 3JR9A 4MFEA 4A3GJ 2ID3A 2JWTA 2ECCA 1HDPA 3LSGA 1HOMA 2Y9ZA 3TP0A 1ETWA 1ETXA 4NDLA 4XRMA 2K9QA 3S1MJ 1U9NA 2HOSA 4A3KJ 3TW7A 2CQXA 2G0EA 3B6CA 4A3CJ 1K61A 3BQZA 4G12A 4BBRJ 2R0QC 4CYCA 4DYRA 5IYCJ 2GLOA 4JYKA 1JKQC 1H8AC 3BR0A 1XC5A 2WV1A 5J1YA 2K40A 1FIAA 2GM4A 3O8GA 4B1RA 1WCMJ 1ZR2A 2E2IJ 4JX4A 4DYQA 1ITYA 2R7ZJ 3OSGA 2PMZN 2L0KA 1LE8B 2KDZA 5GP9A 4IEJA 4C3HJ 1P7JA 3LNQA 2D5VA 1F43A 3S1RJ 2M0CA 5DS9A 4BBSJ 5IP6A 1TWGJ 2Y0SN 3JRHA 3ZQGA 1ZKGA 5M3MJ 1RKTA 4C3JJ 5FKLA 5IOZA 4UUTA 2NVXJ 2H8RA 3D1NI 2DA2A 1P7IA 3ZQFA 4GFBA 3OIOA 1F36A 2LFBA 3HOXJ 3GTPJ 2DA6A 3WHCA 1JT0A 1WH5A 4B4CA 1FEXA 3CCYA 1W0UA 4MLOA 3HOWJ 4C3IJ 2CUFA 1MBKA 1POGA 2CU7A 2JMWA 5EG0A 1RETA 3RZDJ 1EF4A 5IYDJ 2L7MP 1I3QJ 1YRNB 5EDNA 1JJ8C 4V2FA 2YU9J 3Q0WA 2FX0A 1MH3A 2DMUA 2HI3A 5K7FA 5HODA 1BJZA 5C3EJ 1IGNA 2DA7A 5FKNA 1PUFA 3GBGA 3HGGA 3SDGA 4A3JJ 4UUSA 3LSJA 3HOVJ 4JP0A 3BTLA 2N8GA 3I4NJ 3JRDA 1T56A 2R92J 3BR3A 1LFBA 2DA4A 4C2MJ 1ENHA 2MW8A 1Z0XA 4Y52J 5EGOB 2E1OA 1IV6A 1H89C 3JRBA 3FISA 1MBGA 4A3BJ 2X48A 1UG2A 3MKLA 1DU6A 4RBOA 1B72A 1AU7A 1JTXA 3DCFA 3S1QJ 3A01B 2O9LA 2LY9A 2EBIA 2RAEA 2JJ7A 2EQRA 2JA6J 3BR1A 2DA5A 4V2GA 1MH4A 2P81A 2EZHA 1RKWA 5IPAA 3HDDA 1GDTA 2DMQA 4FTHA 4D5CA 5IP7J 3I4MJ 2R5ZA 3BQYA 1ETVA 4BKXA 2XSDC 3ZQCA 1PUFB 2XGEA 1WH7A 2DMTA 1BA5A 1BW5A 2R5YA 1GT0C 2AO9A 4M3GA 1VNDA 1XS9A 3RZOJ 4JX6A 1XG1A 1VI0A 3DEWA 3IH3A 1ETKA 1X2MA 1I6HJ 1YRNA 5IYBJ 1TWHJ 3LSPA 4BXXJ 2MG4A 3GTKJ 3OSFA 2VUMJ 3NARA 3LSRA 2LK2A 2R5YB 1DU0A 3HBLA 5EZGA 2NVQJ 2E2HJ 1VF9A 2YUSA 1BW6A 3BR2A 5FLVA 4DYCA 3BTIA 4EEFG 2M9HA 3HB9A 1ZGWA 5EYRA 2DA1A 2FD5A 1JUPA 3W6VA 2LP0A 4IHVA 1Z77A 5EG0B 2H1KA 1UMQA 5GPCA 2X6OA 1ZQ3P 1LFUP 4D5FA 4M3EA 2M2EA 1ZTRA 3BG5A 5JLXA 3L1PA 1S7EA 4FE4A 4JX5A 1LE8A 2NVTJ 3CMYA 2DJNA 3IH4A 4XIDA 3NAUA 2XPUA 4A3FJ 4UUSB 2QF7A 4I6ZA 1IJWC 3A02A 2TCTA 4M3FA 1ZK8A 5F0HA 1CQTA 4IHYA 2Y9YA 5F08A 2CJJA 3PO3J 2L9RA 2XGDA 4RDUA 3GTJJ 3HGYA 5EEAA 2K9NA 3ZOBA 3IV5A 3A01A 2HXOA 4A3EJ 3M4OJ 3G1MA 3JRGA 4I76A 4IHXA 1U8BA 2QCOA 1IG7A 1MBHA 2FJ1A 1RESA 3CDLA 4MIMA 1JT6A 1RR7A 2CQQA 4X1EA 2B63J 3F0CA 3FK7A 1RPWA 2HXIA 2LKXA 3H3VK 2I10A 2WAQN 5K7HA 3IH2A 3S16J 1APLC 4D7MA 5EGOA 2VKVA 4A93J 4XRSG 1MSEC 2EZIA 1HLVA 2XB0X 2CRGA 4DZPA 3S1NJ 5C44J 5E3MA 1JUMA 5F0CA 4QSHA 1OCPA 2LD5A 1GVDA 2ME6A 5DTDA 3MN2A 5E3NA 3M3YJ 5GPAA 4L5EA 1W0TA 3HEFA 2JN6A 1Q1VA 4D7NA 2M8GX 3QPSA 4Y7NJ 2XGCA 3JRAA 3ZQLA 2JK3A 4FISA 3OOUA 1IC8A 1IRZA 5M5WJ 1R9TJ 5J1UA 1Y1WJ 3BTCA 3ZQIA 3JRIA 2YS9A 1JJ6C 1FTZA 4IHWA 5IOYA 4AC0A 4W97A 3HOZJ 1TWCJ 1TWAJ 3WHBA 3JRFA 3SJMA 3VPRA 1IUFA 4FE7A 1QPIA 3QQAA 1QVUA 1SANA 2DMPA 4DZJA 3GTMJ 5E3LA 2ME0A 1MBJA 5FJ8J 4XK4A 1FIPA 1JKPC 1Y1VJ 1K83J 3K2AA 2XPVA 1O4XA 3S2HJ 1UHSA 3CQZJ 2GBYA 2JA8J 3JRCA 3BTJA 4W1UA 1B72B 4AYBN 1E3OC 2XRLA 4X6AJ 3FK6A 3Q0UA 2COBA 2VPRA 3S15J 3PO2J 2NVYJ 1T33A 2LTPA 2L7FP 2OPTA 3FKIJ 1B8IA 2JA5J 1NK2P 5BNGA 5F27A 2M34A 2DN0A 5JLWA 4A3LJ 2JA7J 3PM1A 3BG3A 2E19A 2MSYA 1TWFJ 3HOUJ 1GUUA 2ID6A 2IBDA 1ZR4A 1BL0A 1MBFA 2LLKA 2DTZA 3C2BA 5J3LA 1GV5A 2O8KA 3UKGA 1FTTA 5FLMJ 3A03A 3QPLA 3TP3A 2KT0A 5C4JJ 2Y30A 5M3FJ 2NS8A 2FQ4A 1NTCA 1HDDC 1QVTA 2XPWA 1NK3P 4M6VA 2NOGA 1ETYA 4XICA 1WGXA 3G1LA 3S2DJ 3JREA 1U78A 2TRTA 1HCRA 1U9OA 3BT9A 3B6AA 1OCTC 1WPKA 2W48A 2EH3A 5E3OA 2IEKA 2EZKA 2HYJA 2DA3A 4QIWN 4M3BA 2VI6A 3BR5A 3FIWA 1MBEA 1GV2A 2L7ZA 3Q3SA 4AUXA
chains in the Genus database with same CATH superfamily
4M3DA 2OF7A 2PX9A 2R93J 1ZRFA 3HOTA 5J1RA 2E36A 5DV5A 1J09A 3HKZN 4AVPA 3K7AJ 5K1YA 2E60A 3EUHA 4H0EA 2H1LA 3CCVI 2KL4A 2F4IA 2QSFX 1MSFC 1MKMA 4KIGA 1SVMA 1HF0A 4LOCA 4L9VA 5FROA 1ZRCA 4LLLA 2LR8A 2ISYA 2R4GA 2KZVA 2NS7A 4B47A 4BUPA 2IS6A 1FSHA 3E5XA 4MEXF 3S14J 3CF2A 1H0MA 1B8IB 1TC3C 5B5EC 2I8DA 4HNTA 3QU6A 1DPUA 2HZDA 1V3FA 3NQOA 5TRDA 2V1XA 1A6IA 3GLXA 1K79A 1OJLA 1P6RA 2UXXA 4GRIA 2KJCA 1YS6A 1OCRH 2IAIA 1YW8A 2AHQA 3ABUA 2K9SA 2EZLA 4PGHA 4KITB 1T08B 3E6MA 3HRUA 2D1HA 3PJRA 1QO0D 3GFMA 5EZHA 1U8RA 4IOAF 1YIJI 3IAM2 3HYIA 3FBNB 2V6CA 2ZJRF 2XVCA 2M3AA 3H3ZA 5F1RA 4Q47A 1IUYA 3SQNA 3GTQJ 1BIAA 5F04A 4UUVA 4A3DJ 4RM2A 4HW0A 3P9CA 1G3YA 3T5XA 3S3NA 3CUOA 4D1QA 2MLGA 2VKEA 2ELJA 2BHZA 2VOOA 2WB1A 2K3FA 1ACIA 3QOEA 1YE9A 4XRSA 3L2CA 1SVLA 2VIXA 2IS4A 2YSRA 4HNUA 5CVJA 5FD6A 2E2JJ 2DQRA 6PAXA 4RGUA 2CUEA 4C30A 3FDYA 5C4XJ 3BY6A 1PJRA 3CDIA 4MFEA 2HPIA 3DXJF 3ZQQA 2JWTA 2ZXWH 4RGXA 2JRMA 4L5JA 1ETWA 4BH9A 4NDLA 4NQWB 4P1WA 4ENNA 2QLZA 4XLAA 5F64A 3OS1A 2CQXA 4A3KJ 2K86A 3B6CA 3M1CA 3CUQA 5HVQC 3V7CA 3JSOA 1XC5A 2VL8A 2K40A 3B73A 2O5RA 3OL4A 3O8GA 1PDNC 2KIFA 3KCCA 2L3DA 1TQMA 3OSGA 1IN7A 2WBMA 3HXLA 2HWVA 2VT2A 2PMZN 3W2WA 2L0KA 2BY2A 3RYPA 2KDZA 1C0WA 4IEJA 2VOPA 3FXJA 1U5TC 1F43A 1MW7A 3GF2A 5DS9A 1K78B 4BBSJ 3ERED 1E3PA 2PMZA 5IP6A 2MFZA 2Y0SN 3D5LA 4HZFA 1JE8A 1KA8A 1RKTA 1ZG1A 1QBJA 2K7LA 2EV6A 1RUOA 2NAZA 4I7HA 5H6QA 3ZMUA 1P7IA 2KP6A 4LK0F 2NRAC 1F36A 2DFEA 3GTPJ 2JUCA 1AA7A 2HS5A 1WH5A 3MKYB 2X6WA 4LG0A 4HAMA 1QZZA 1W0UA 2DOAA 1WJCA 3M9AA 3OS2A 1T2KA 3OS0A 3DF8A 5BQTA 2KRFA 2PFBA 5EG0A 4EJVA 4PCQA 2L7MP 3RZDJ 1VQPI 2BW3B 2FMYA 4XORA 1N78A 3M07A 4V2FA 3MKWB 4XR6A 2L02A 3Q0WA 2FX0A 2VODA 3H5RA 3I59A 2Q0OA 3MZHA 2QBYA 1MH3A 3IAS2 1YLFA 2EK5A 5KAFC 2V7FA 2ZO4A 5CVRA 2GIZA 2DA7A 2WY8Q 5EEHA 4MHGA 4PGGA 4CCMA 1TNSA 1K4SA 4LFUA 3SDGA 4A3JJ 4DOZA 1D1BA 3V7RA 2AQFA 2XF5A 1T39A 3KFWX 4CZZA 3LQRA 2JTVA 3BTLA 2HZTA 2VBWA 4LIVA 1T56A 4DBRA 3DV8A 2GIVA 5D5WB 1Z6TA 5DYMA 3F8MA 3K4KA 3NEUA 1WJ5A 1LPQA 2F6CA 1RR8C 1ZN2A 1DU6A 2OCCH 1B72A 2M4GA 2K85A 3ZMZA 2PQ8A 1SD5A 1UELB 1K6OA 2E7XA 4ENKA 1B59A 2KHMA 3CF5F 3WTWC 2RAEA 2BEOA 2M87A 2XAFA 4KN4X 4EATA 5HDGA 5ILUA 3FXUA 2DA5A 4V2GA 3RYRA 2OTLI 1SFEA 2EZHA 5IPAA 4BE0A 4PJ0C 1O3RA 3CCQI 2L9VA 2RKHA 1XD7A 4RAZA 3TO6A 3LFKA 2XSDC 3OYGA 4CA0A 1PUFB 1WH7A 1J2XA 1FBSA 1BW5A 1GT0C 2AO9A 3ZQ7A 2ZMEA 3EYIA 4HX7A 2MLKA 3VYUB 1OCCH 4NUBA 4JBAA 4XKBA 4G6TB 3IH3A 3E97A 1YRNA 1AOYA 5KNLA 4ANJA 2P6SA 2WA0A 3JCUC 4OMYA 3P5JA 3DTEA 4HX4A 4BXXJ 4G7OF 2K4JA 3M8EA 3D0SA 1ON1A 3HSEA 5DCMB 2PN6A 4UV8A 4KT6A 3DKYA 3OYFA 3BR2A 2B7EA 4GGGA 4DYCA 2Z3YA 3HB9A 1WQ2A 1ZGWA 4C2UA 4II3A 4GDFA 3HRSA 2LP0A 1SEUA 3FWEA 1RNLA 5GPCA 2X6OA 3D5SC 3WGGA 1ZQ3P 2VJ5A 1AWCA 4PK4A 4M3EA 2IGOA 5CVIA 1ZTRA 3BG5A 1MJ9A 4ZTJA 2FQ3A 2CV1A 4IPAA 4JX5A 4MTDA 3CO7C 3T8RA 1SMYF 5HLGA 2GA1A 3NAUA 2DODA 3E0JB 1FP1D 3DBLB 1P4WA 3ZMTA 4A3FJ 1PVEA 4CUGA 3Q5FA 4UUSB 1IJWC 2R7DA 4N0BA 3BG6A 4P9FA 1TW3A 1FOWA 4RAGA 5LLQA 2EFWA 3LA2A 3RKYA 2L9RA 1KGSA 2H6BA 2A5YB 3GTJJ 3K70C 2XRNA 5L3GA 5EEAA 1QQIA 2PBIA 3IV5A 2KRHA 3VYRB 3CC2I 1G8XA 3GLLA 2JVGA 4HQEA 1VQKI 2OJED 4B44A 4IF4A 2VE9A 3OMYA 2RQPA 1IRXA 2DYRH 1XMXA 2ADUA 2K27A 3C7JA 2WAQA 3CDLA 1RR7A 2CQQA 4X1EA 2B63J 4AM3A 1V5FA 3GZ6A 3F0CA 4YFNF 1IRFA 2HXIA 3L2WA 3BJAA 3RQ4A 1W7PB 2E71A 4BQQA 5K7HA 2M45A 3IH2A 5J8CA 1APLC 5EGOA 4XM3A 4A93J 3OYLA 1R6RA 2CRGA 3L9FA 1MMNA 2WY7Q 4Q4ZF 1MNEA 3MCZA 2ME6A 2HKOA 1L3LA 2VPLA 3FZVA 1F1ZA 4J01A 1ONVA 1W0TA 4UB6C 3SYTA 3VYSB 2G7UA 5A2QK 2CFXA 2HPMA 1Q1VA 2CQ7A 4D7NA 2M8GX 3QPSA 5BOXA 3ZQLA 3IWFA 1HBXG 4Y15A 4PSWA 5J1UA 4AVZA 1FMWA 3BTCA 4XKWA 3DTKA 1YOVB 1XCBA 3JRIA 2L9SA 2XAJA 5J8FA 4BAYA 1X3WB 4W97A 3HOZJ 4PJJA 3K0LA 1TWCJ 3QAHA 1IUFA 1QVUA 1YIOA 1X4PA 2VJ4A 2GQQA 4DZJA 3GTMJ 1J5YA 4IQJA 4RB3C 3L09A 1SFUA 5DM7F 1FY7A 4EMSA 4BGDA 1XPXA 3L2QA 2JSPA 1JKPC 2BBYA 2VC0A 1FP2A 3BCAA 3K2AA 1Y39A 4NNJA 2DT5A 2LKSA 4A0YA 3S2HJ 3CQZJ 3CMMA 2FOWA 3JRCA 2ZNYA 2P5VA 3CMEI 3E6DA 3GFLA 2FSWA 4XOPA 1XGOA 2EWNA 3EPZA 5TISC 2LTPA 1S29A 4E6KG 2M4KA 1UHMA 1RZ4A 4B3XA 1NK2P 4RB2C 3COAC 5GADJ 1HSTA 5F27A 2MH2A 2M34A 4O3MA 2CW7A 4ENJA 2QBYB 3PM1A 3TDUC 4ZYHA 2YX7A 1TWFJ 2ESNA 5K5QA 1GUUA 2IBDA 1ZR4A 1FT9A 2KQRA 2V1UA 4BDZA 5HNHA 3KE2A 3HPHA 3C2BA 3DPUA 4DIQA 3AG3H 2Y0MA 1FTTA 2PMHA 1HKTA 2HGCA 3IUOA 3TP3A 2KT0A 3HSRA 1BR2A 2Y30A 2FQ4A 4PUSA 3WU0A 3Q9SA 2DFFA 4OAZA 5HLIA 1NHAA 1R5ID 1WJBA 5IT9K 3E1SA 4LJZF 5B1AH 1WGXA 4U88A 3S2DJ 3DBHB 3OYDA 4YG2F 2TRTA 1UG0A 2HNHA 3R61A 2DPUA 1LFPA 1T38A 2P5KA 2W48A 3RDIA 2XF6A 5AIPA 1XN7A 5D4RA 3DU5A 2EZKA 2HYJA 2B9SA 1ERDA 2QQBA 3FIWA 4Z2YA 2G9WA 3TMOA 2HEOA 2HDCA 4CSWA 1GV2A 4AUXA 3LSKA 2NXNB 2ACJA 1JGSA 4S0HB 4M72A 3F23A 4PFPA 3BG9A 3IL2A 2VQHA 2X9DA 2DOFA 4ABZA 1EH8A 3Q0VA 4BY7J 2FE3A 2HYGD 3A0HC 3RQIA 2MGQA 3G4SI 1TLHB 1HXDA 2BY3A 2EA2A 4EV0A 3GX4X 3HOYJ 5LEKA 4U0WA 3TEDA 2V4JC 4QPOA 3ZP5A 2ZSHB 2P7CB 3EETA 2OQRA 4KUMA 2HQ5A 1YFHA 1R5GA 4A6DA 2EIJH 3HM5A 1X19A 3FM3A 4MTEA 2VASA 2NYXA 1YO5C 2M1BA 3ZQHA 1JI8A 1I39A 2ZB9A 2E7WA 5M5YJ 5D8LB 1D5VA 2O0YA 1K6YA 4G7ZF 1H88C 1A36A 1X58A 2RVCA 1WJAA 3A4CA 1UZCA 3S17J 1W5CC 5E8GA 3U1DA 5FGMA 4IX7A 3OR2C 1RUNA 2K5CA 3SZPA 5FKKA 1FOYA 2VKDA 4OIPF 1X2NA 3SFIA 2MYSA 2HDDA 2KMUA 1UHWA 3FBIB 3MVPA 4IVNA 1I6XA 3LQQA 3GTOJ 3VSKA 1FOXA 3GTGJ 1IDYA 3K4LA 3WTVC 1ETQA 3OYHA 3ABTA 1LDDA 4MFDA 5KK1A 1IN5A 2NOJB 5IY5H 2STWA 1P2FA 2ECBA 4UVCA 3QWLA 4JK1X 5FKOA 1J0RA 5EF6A 1F4KA 2Y48A 3H5NA 4QWQA 2ELKA 3KPHA 5K7ZA 1RC9A 3GTLJ 2JT1A 9ANTA 3CCEI 1TNTA 1RIOH 2LOOA 2WB1N 2LVSA 3S32A 5M5XJ 1QRYA 1O3TA 1YW7A 3CCRI 1BI2A 3LSGA 5LBQA 4F52A 5JI6A 2CW8A 1G6NA 2K9QA 2ISZA 2GXGA 3S1MJ 1U9NA 1FBQA 3ZMSA 1FBUA 1D0ZA 2CQNA 2G0EA 2VN2A 4A3CJ 2M8EA 3BQZA 4G12A 1G3WA 5DCMA 2DW4A 1J7KA 4JYKA 1JKQC 2DAOA 2V9PA 2WV1A 5J1YA 3DBRB 3P9KA 2R3SA 1BI0A 3GMEA 4WK8F 1Z05A 3NWSA 4B1RA 1WCMJ 1V54H 5ILVA 4RS8A 2E2IJ 1V4RA 4DYQA 2DFIA 5J4VA 3H36A 2R7ZJ 1XGMA 3I64A 2A3SA 2XKOA 5BPDA 3H9JA 2H94A 2BW3A 3ABMH 3OOPA 2UV1A 1LE8B 3IKTA 2ZXIA 5GP9A 4NC8A 1FYKA 1WVRA 2M0CA 1R23A 3V7SA 1FZPB 4ZTFA 3RSNA 4OAYA 3IKVA 4BXFA 3IHUA 3J81K 3ECOA 3HRMA 1FNNA 1OYYA 2GZWA 4KMFA 2EINH 2HU9A 2A6HF 5HDKA 3F9KA 2OQGA 2NVXJ 3PQJA 2H8RA 2DA2A 3CCSI 1TT0A 4GFBA 2RNGA 3OIOA 5EEGA 1JHFA 2E1CA 1Z7LA 4BEHB 3JAMZ 1LNWA 2BY1A 4B4CA 2AXLA 2PJRA 4DGWB 1EA3A 2P8TA 3DKXA 4DJAA 1D8JA 1LKXA 4HOBA 2DQLA 3E3VA 3U21A 1BC7C 1SAXA 1R7JA 2F48A 1YHQI 4LG0B 4E7KA 4BQAA 1W36D 1EF4A 1TT5B 1E17A 2L54A 1WZ2A 4N9HA 1R36A 2M30A 2BY0A 1ZGAA 2VBZA 5EDNA 1TL8A 1W36C 5FLXK 1KU7A 1IZ1A 2XGXA 1BM9A 3T8TA 3F22A 4HLYA 2W85A 4ZYDA 1NG6A 2LYCA 2DO7A 2GXAA 2VONA 1LEAA 2IS1A 1IGNA 4YIIA 1YJ9I 1PUFA 2FNPA 1R1UA 3EYYA 3MEXA 1Z9CA 2LY1A 4E7SA 3OYCA 3R6SA 5DUKA 4XONA 3I4NJ 1SVOA 3JRDA 3AG2H 2HR3A 3DEEA 1V5EA 3BR3A 1HA8A 2O8XA 3G73A 1IV6A 1MZBA 2XAQA 3MQ0A 2GWRA 3KEYA 1EKEA 4A3BJ 4XSZF 2K3PA 3MKLA 3KLNA 4KYWA 5DUIA 1AU7A 1W1WE 2A68F 3DCFA 3S1QJ 3B02A 1ZYRF 2O9LA 1BR4A 2LY9A 2CS3A 4P9UA 2M7AA 3BR1A 1P4AA 2P81A 1SMTA 4XKCA 4BJ5C 1YG2A 1ZGJA 4AU7A 5ICEA 4IHSA 1GHCA 3HDDA 2JVHA 2DMQA 2EIMH 2OD5A 5LHIA 3EUKL 4UNOA 3PUBA 3HUGB 2DBBA 3SXYA 5H20A 1Y6IA 3MMYB 5E1XA 3TOAA 1BA5A 4M71A 2RV8A 4YIFA 1S72I 4KA4A 3UNGC 4M3GA 1CF7B 2MD0A 4LMYA 1WJDA 4C2TA 2QYOA 2MC4A 3N05A 4PDKA 1D3YA 4R1HA 4RGSA 2LNBA 3DEWA 4OOIA 1ETKA 1X2MA 2B0LA 1P4XA 5ICCA 5A2QZ 2J5PA 1TWHJ 3WTXC 2QM3A 1Z6RA 5DCFA 3QYBA 3F72A 3TO9A 3JTGA 3LSRA 3S93A 2EPFA 2F5FA 4XLNF 2F5CA 3G6EI 5EZGA 4NB5A 3C3WA 3BTIA 3BCBA 5EYRA 4OIQF 4M74A 2FD5A 3QPTA 1JUPA 3V4GA 3OYMA 5ICFA 3W6VA 5IT9Z 1Z77A 3K70D 3CTAA 2BXZA 3VDXA 2VJJA 1EV7A 3GCMA 4HLXA 1JHHA 2M2EA 1GXQA 5ED4A 3L1PA 2ESHA 4F7ZA 3PIOF 2ZJPF 1YW9A 2CSOA 4NC6A 3S3MA 3RPUA 4LB5A 3J7AO 4XIDA 3I56I 3K4BA 4HX8A 1M1EB 3QYFA 1VQOI 3WGIA 1NG7A 4ZH4F 5DDGA 3LSMA 3H35A 3HTUA 3BC8A 1ZK8A 2Z5UA 3H9GA 3W6KB 3N4MA 5TGTA 5KAIC 1BR1A 2CJJA 1P9QC 4BE2A 1O57A 5F6FA 4KIBA 3H1CA 2IXSA 4ENMA 1WJEA 1YYVA 3CCJI 3A01A 2L4MA 5CVVA 4A3EJ 3S8PA 2H8WA 4U0YA 2LRDA 4FX4A 4IRIA 1U8BA 3M8FA 1MBHA 3GFIA 3BZ6A 4RLFA 1K4TA 2RGVA 3GFJA 2IA0A 4C9YA 1RPWA 2LKXA 2KIMA 2I10A 2WAQN 5D5UB 3WODF 1ZLJA 3S16J 4YRVA 2EZIA 2D45A 4MQVA 4DZPA 3AG1H 4BEHA 3S1NJ 5E3MA 1JUMA 2ZXHA 1R5HA 1VQLI 1OCPA 2W25A 5LHHA 3DPTA 2LF7A 4BL0B 2PJPA 5DTDA 3MN2A 3M3YJ 1R22A 3OYAA 3T0YA 2EILH 3HEFA 3HC7A 2XUBA 1XMKA 4BNCA 2Q2EA 2YPRA 4HBLA 1IC8A 1IRZA 5M5WJ 4KIFA 4XQFA 1MMDA 3ZN1A 2CH0A 5E8IA 1ZLKA 3HG9A 4E70A 1PUEE 1KU2A 2UWMA 1J9IA 3TQNA 2KIQA 3I3LA 5IOYA 3OYEA 3FX3A 1O7FA 2OCEA 1TWAJ 3CZ6A 1SD6A 1UCRA 2WAEA 4ESJA 3K4MA 3QQAA 2V9KA 3GYHX 3I55I 2CV0A 4IZZA 3WTYC 3ZMDA 4RB1A 3V42A 4CO8A 3ISPA 2ME0A 2EFOA 5CLSA 3T1BA 4XNFA 4XK4A 4HF2A 4M6YA 1QU3A 1IN6A 3GZ5A 1K83J 3SEQA 1W7PA 1O4XA 1KU9A 3ML6A 2JA8J 1IF1A 3BTJA 4OMZA 2VJIA 4P55A 2DK8A 2HOEA 4W1UA 1B72B 5LFAA 2AXTC 3WGHA 2CG4A 1E3OC 1ZRDA 5B1BH 2XRLA 3FK6A 2COBA 2VLAA 3W3CA 2E1NA 2EB7A 3PO2J 2FF4A 2LDUA 3VSLA 2QQAA 2KZGA 2L7FP 5D8KB 1LQ1A 3LL7A 2IT0A 2FBHA 3OYIA 2HDWA 2WV0A 1XSXA 2LBFB 4L18B 1X3UA 3GW2A 2DN0A 3RTRA 4A3LJ 3C2GA 1EH6A 3K1MA 3TGNA 1OPCA 3KEQA 5J47A 1FSEA 3J7YJ 3MFKA 1GV5A 5D5XB 2O61A 1Y0NA 2D2WA 2OV7A 4IO9F 3KLOA 5D6FA 5M3FJ 1R4NB 1LDJA 1QVTA 2FOKA 3E5QA 1VQNI 3S2WA 4M6VA 3LFUA 4WXCA 1KYWA 2QKLB 5AIQA 3DU6A 3CO6C 3P7NA 3TBIA 4L0YB 3OL3A 3JREA 4L5IA 4UXNA 3FXQA 4IHTA 1HCRA 3B6AA 1S6LA 2X4HA 2PJRB 5FO5A 2O6GE 2IEKA 2VC1A 4PJMA 3D5RC 1I5ZA 2VI6A 1OYIA 4YEJA 1JTYA 4M9ZA 3K69A 4MO7A 5L3FA 5JVTA 2Y31A 1U0JA 3WE2A 4F55A 3LOCA 1Z1DA 4B3AA 2QZ8A 2XB5A 2HQNA 3MAJA 2LF8A 2I5UA 5IP9J 3LAJA 2ZMEB 2W57A 3V8JA 2W00A 4EGYA 5HDNA 5FKMA 4A3MJ 1DUXC 4OWRB 3CLOA 4BXUA 2H6CA 3LA7A 2X1DA 4EJUA 4RAFA 2XKPA 1AKHA 1FMVA 1ETOA 2BXYA 3FMSA 1TW2A 2ZBKA 2FNAA 5CPRB 1JGGA 3A1YA 1A6QA 4CYCB 4WCGA 1IO2A 2GOXB 2O7OA 1MMSA 2VE8A 3C18A 5B3SH 5K5RA 3OV8A 4JOMA 1VQ6I 1G2HA 5DEQA 1AHDP 5HLHA 5CJ9A 4J19A 4Z6YA 1AKHB 3K1NA 3ELKA 1FJLA 3RKQA 4RA2A 3RIRA 1Z21A 1X1CA 1D5YA 4CXFA 4H4KC 2BGCA 4DNCA 2XAHA 5HNFA 1MNMC 4HA8A 2W7NA 1G59A 3C1DA 1BI3A 2RN7A 2L4AA 5JHUA 3DWLE 3NRVA 1VFCA 2DTRA 4A3IJ 4FCYA 1HKQA 2EV5A 2IRFG 4M9SA 3OIQA 2AQEA 3DQVC 3DP7A 3L00A 4XKVA 5L3CA 1SFXA 4L0ZB 2ZMEC 1H9GA 4KN7X 1VQ5I 3CJRB 2NNYA 4BQOA 1D0XA 4BY1J 3HZJA 2L7KA 3I59B 3PUFA 1A5JA 4EJTA 4EJOA 4HSTA 1YX5A 2DYSH 3QODA 2KRCA 2ZKZA 3IWZA 3OIPA 4E7HA 1S9HA 1USTA 4A69C 3E7LA 1SAUA 5F1JA 1R1TA 3REOA 1DGRM 2VXZA 3WTUC 3CD6I 3OWTA 3QRFF 2CWEA 2VQGA 3IRRA 1G4DA 3RKXA 2ID3A 4A3GJ 1HDPA 2Y9ZA 3TP0A 1ETXA 2EIKH 2FU4A 2E35A 3I54A 4BBRJ 3TL4X 3WTSC 4BHBA 4DYRA 2C6YA 1X1BA 2GLOA 1KYZA 2QGUA 1ZG5A 1H8AC 2QQ9A 4HDUA 3ROUA 5B66C 3BR0A 1I1GA 2IA2A 4A0XA 3G2BA 1IXRC 2PLYA 4JX4A 4OIOF 1LB2A 1ITYA 3J80K 4IXAA 2ZJQF 1A31A 2IGNA 4BU2A 4C3HJ 3CCMI 2D5VA 1P7JA 1N25A 4Y4RA 5J40A 2CFOA 1S7AA 1X3ZB 4QPQA 3GWZA 1TWGJ 1ULYA 3E6BA 2ZFWA 1OYWA 2OZ6A 3H92A 3HUGA 4I0AA 1R1VA 2OBPA 2JPBA 5D4SA 3KETA 4C3JJ 2OA4A 1X1PA 5ILSA 2QSHX 4E7ZA 4XLCA 2E5ZA 5IOZA 2WWYA 3PNTA 3KEOA 3D1NI 4G9YA 1WFXA 1ON2A 4Y13A 1D0YA 3ZQFA 3HRTA 1TBXA 3O6BB 3VYTB 5DM6F 1UFMA 3F3XA 2DA6A 3WHCA 3M7GA 2FXAA 1LEBA 2FBIA 1FC3A 1QNTA 4MLOA 3CMAI 2FEZA 4C3IJ 4UY8I 4WXDA 2GOMA 5E20A 5JR3A 3CC7I 1MBKA 4ZZDA 2JMWA 2HTSA 5IYDJ 4CCLA 1OCZH 1I3QJ 2R7VA 1UB9A 2OU2A 3PIPF 1JJ8C 2ZJ2A 4F91B 3HPGA 2MA3A 3EDPA 5K7FA 3R4KA 4QLCU 1BJZA 1S3JA 3RKWA 2CMPA 1VZ0A 3MZYA 2F5DA 5KHDA 5E18F 3BPVA 3KZYA 3GBGA 3HGGA 1JXSA 4UUSA 2A6TA 4CZCA 3LSJA 4ASNA 4BYYA 2CQKA 2BV6A 2N8GA 2L5QA 4XRFA 5AONA 3RCOA 3MD2A 2R7FA 5LHGA 2R92J 1LFBA 3TOBA 2DA4A 2R7UA 4OINF 2MW8A 1Z0XA 2ZC2A 1PP8F 4Y52J 1I1SA 2ZSIB 1Y8QB 2E1OA 5GAGJ 3ABKH 3JRBA 2KDOA 1MBGA 3K2ZA 2X48A 4PZJA 1UG2A 3KP6A 3RPQA 2R7TA 4R8HA 2DI3A 4RBOA 2XF7A 3K1PA 1HW1A 2RDPA 4HYEA 2Q1ZB 4ESFA 3A01B 3DEUA 2R7XA 2EBIA 1Y56A 2CGPA 4EQQA 5D6EA 2JJ7A 3BZCA 3I4PA 3ZPLA 3F21A 2JA6J 3CJNA 4FASD 2V1NA 1MH4A 4EM2A 4CCNA 2EV0A 3PQKA 2VT3A 1W5TA 2ELHA 1EH7A 4D5CA 2IW5A 5IP7J 3I4MJ 3FXRA 3BQYA 2R5ZA 4BKXA 3WG9A 5LGUA 3PNVA 3ZQCA 1FWZA 3JTHA 4IKFA 3DFGA 3FXLA 4U7BA 2R5YA 2LY2A 5IT3A 1VNDA 1ZHFA 4KJZA 4S05A 1XS9A 4LIUA 5L3DA 3KP5A 3RZOJ 3OYBA 4FHTA 3LAPA 1XG1A 3KYCB 3OY9A 1WRJA 3VEPA 1I6HJ 1ZELA 5IYBJ 1WKMA 4L9JA 2LSOA 4RB0A 2YR2A 3LSPA 2MG4A 3FF5A 3ZCOA 4BS9A 3OSFA 2LK2A 2QUFA 2A05A 1PYVA 2ETHA 5LRSA 2H09A 2NVQJ 1VF9A 2YUSA 4XLHA 3WTZA 2QWWA 4EEFG 3I53A 2DA1A 3F6OA 2JUGA 2KISA 4IHVA 5EG0B 4KISA 1UMQA 2EFQA 4CICA 2QSGX 2DOEA 1OCOH 4RMNA 4HQMA 5CVUA 3L7WA 1I3AA 3M1EA 1S7EA 4FE4A 2KKOA 4A5NA 3I71A 4G6DA 2NVTJ 3CMYA 1LJ9A 1E0EA 2DJNA 3IH4A 1DP7P 4ESBA 2XPUA 3Q9VA 2Z1DA 4HV6A 3K4CA 4BHCA 1BI1A 5DD8A 1Z67A 4IHYA 2Y9YA 5F08A 1OISA 4D9JA 2JSCA 2R7RA 2XGDA 2JRTA 4RDUA 3HGYA 3K6GA 4KICA 1XSDA 2K9NA 1X1AA 4PJLA 2BOLA 3RPUD 4B43A 3L2VA 4B48A 3I5UA 2HXOA 3BJOA 1I27A 2R7QA 5FD5A 4NHJA 3E5UA 4B09A 3JRGA 4GYIA 3BOQA 1MMAA 4I09A 2QCOA 1TP4A 3K4NA 4ITVA 1IG7A 2FJ1A 4IRHA 1R4MB 1RESA 1E3HA 1U5TA 3WE3A 4LLNA 1Z3XA 4G6QA 2Q8KA 3J7AY 2COMA 3KIOA 1DPRA 3QPHA 3FK7A 4P5OA 3DLLF 2KLOA 2F4MB 4EVIA 2QENA 2VKVA 4HG2A 1Y0UA 3NWTA 1MSEC 2L01A 3HHGA 3WTTC 1FLIA 3K9TA 5C44J 3R60A 3CJTB 4ZC3A 1TTYA 2K02A 2LD5A 1HKSA 1KQ8A 1GVDA 1RRJA 3KP7A 1BC8C 3CUQC 1ZREA 1BIBA 1B6AA 5HS7A 4XLFA 2M0MA 4AIHA 3H0DA 1FYLA 2K9LA 3ONQA 1ZARA 3JRAA 2JK3A 4ZDOA 2DPDA 1HW2A 4HRIA 2KFDA 2VKHA 2E5NA 3X2QH 3BG7A 3H5AA 3HJEA 3J80Z 1LVAA 2Q2EB 4Y17A 4BACA 2K4BA 1V55H 2LBFA 1ZH5A 3WHBA 1IN4A 2Y75A 3PL8A 3JRFA 1IXCA 4A5MA 1MDMB 4FE7A 4CCJA 2XHKA 4HDVA 1NH3A 1QPIA 2PEXA 2VB6A 2H27A 5D5VB 1SANA 2DMPA 2Z99A 2IVMA 5E3LA 3MZ8A 2L2OA 2LREA 4E7LA 1DDNA 4DBQA 4Y3OA 5FJ8J 3PFYA 3PNYA 1FIPA 2JPCA 5E1WA 2KJBA 3U2RA 5HOOA 1Y1VJ 3F8NA 1FYMA 2HQRA 3F8FA 3JAMK 4P96A 4AYBN 4IOCF 3ZXSA 3AL0B 5CQGA 4X6AJ 3Q0UA 4UB8C 1B1BA 2VPRA 4G94A 3G71I 3S15J 3U1KA 1HSJA 3FM5A 3C2HA 1O7LA 2NVYJ 1MMGA 1A04A 1OQYA 1T33A 4L9NA 3SDBA 2HVQA 3SHFA 3FKIJ 1B8IA 4AD9A 1TQIA 1N77A 1D8KA 2BVMA 4MGRA 5BNGA 4BE1A 4I0BA 4A6EA 3FHZA 3W2AA 4RLQA 3SEZA 3BPXA 1R49A 3EQLF 5JLWA 2JA7J 3BG3A 2MSYA 4UHTA 1TQPA 5HLTA 4LLGF 2ID6A 4LITA 3BLYA 1HQCA 3SFZA 1MBFA 1SFKA 2DU9A 4KFCA 2A61A 1WI9A 2CUJA 4O5VA 4EGZA 1QGPA 1KQ9A 3HHHA 3ZMVA 3QPLA 4Y33A 2P7VB 4ZZLA 1YTYA 2X6YA 2RC4A 1REPC 3KZZA 4RM3A 3WU1B 4FT8A 3JW4A 1WWXA 1NK3P 3WG7H 1W7PD 3OR1C 2UXNA 4I02A 1WJFA 2G7HA 3G1LA 4I01A 3FXKA 4XSXF 4OIRF 1U9OA 4MNUA 4UVBA 1MJBA 1OCTC 1WPKA 4WX9A 2EH3A 4B8XA 4LD5A 5L3EA 1T95A 2Z33A 3CJQB 4QIWN 4AIKA 3BR5A 3KYDB 1MBEA 3PSFA 2L7ZA 3Q3SA 5CYVA 3BWGA 3H0GJ 2HOTA 5KCMA 1WI3A 4XMYA 4BJTA 4U87A 1FPQA 4KDPA 4DQ2A 1IDZA 3H9QA 3CCUI 1CF7A 3O8HA 1JUSA 2F5VA 1B9NA 3SZGA 4UV9A 2E34A 5CKTA 4HF1A 1X4OA 3HL2A 1MIJA 3BP8A 1DP3A 2E1MB 1UAAA 1Z91A 3KX2A 1VQ8I 1BOBA 5FLXZ 1JKRC 1OFCX 2M5WA 1BN5A 4XOTA 3GXOA 2VBYA 2DMNA 2Z16A 4M6XA 4FETA 2AS5F 1CGPA 4NQWA 5HS9A 2WTEA 4O6JA 2OZUA 4KMUX 1ORKA 3CUQB 4U0VA 4XLEA 2XROA 1JKOC 3A2KA 4WF2A 2KIUA 5GTIC 1XGNA 1YX3A 2ZNZA 1SFOJ 4QTRA 5LGNA 3AKZA 1GVJA 3ASOH 2QQ8A 2X6XA 5LGTA 5GAEJ 3BR6A 1WHUA 2HOAA 2VBXA 1O3SA 2IGMA 3ZRGA 1KONA 2Y69H 1A35A 2R7SA 2YU3A 4N4NB 3TW6A 1ZG3A 1LUJB 2IPQX 2WC2A 2R5ZB 2K9MA 2O03A 3O3KA 3CESA 3R0AA 1O3QA 1E2XA 1L0OC 2XIGA 2V1DA 4X0GA 3FXMA 3JSPA 2Y2ZA 1Z7UA 2P5LC 4HNVA 3KYLA 1Z3YA 3WU2C 4CH7A 4LGWA 4D0PA 1I50J 3VB2A 1XMAA 5JHFA 4DW6A 2EA4A 2CV2A 3G1OA 2DFHA 4ZDLA 2P6TA 4ZYAA 5F0FA 2VQCA 1YJWI 3JR9A 2L9NA 3F8BA 3UR3C 4G7HF 2LG4A 1YI2I 2ECCA 3HIFA 1HOMA 1USSA 3DLAA 4XRMA 3V8KA 4BDYA 3OYKA 2HOSA 3TW7A 1YQAA 2WADA 4BQNA 3R0JA 1K61A 5GTHC 2R0QC 4GYGA 4CYCA 5IYCJ 2VQLA 5BPIA 1WSUA 1FIAA 3OYJA 2GM4A 3PSIA 3ERMA 1ZR2A 1S8NA 4A0ZA 2X85A 2HVRA 4GO1A 3ABLH 3KP3A 4M73A 3CDHA 3FKJA 1T0FA 2Z2SB 1G3TA 3LNQA 3S1RJ 1U2WA 3ASNH 4GXOA 4LK1F 2CW0F 2X51A 1IV8A 3JRHA 4FQGA 3ZQGA 1ZKGA 5M3MJ 2MC3A 3LWFA 5BMZA 5FKLA 2Y0SA 2D1VA 2VXDA 4UUTA 1XSVA 2PI0A 3GVAA 2XAGA 4I98B 5H6RA 1QHHD 1G3SA 3U9GA 4I99C 2JZYA 2LFBA 3HOXJ 2OTJI 1V5GA 3CLQA 2TDXA 1JT0A 3VOEA 2QVOA 1YS7A 2X1CA 4EJWA 3HSFA 1FEXA 3CCYA 2CUZA 4OU0A 3HOWJ 3ZGKA 5E17F 1Y8RB 2FMLA 2KPMA 2CUFA 2HFHA 4ZDPA 2R7OA 1XTAA 5FRMA 1POGA 2CU7A 4AIDA 5JVGF 1HC8A 4CYDA 1RETA 1SD7A 3I0TA 3N97A 4KNYA 2X0LA 2DLLA 1YRNB 2ZXJA 3V8LA 4XBFA 1QPMA 2YU9J 2HYFA 4YELA 1OKRA 4A2UA 2DMUA 4Q5SF 4I2OA 5KVRA 2HI3A 5HODA 5C3EJ 1R58A 3KP4A 1F5TA 5FFXA 4IQ4A 2LMDA 5FKNA 5JFRA 4YFXF 2X1EA 2CO5A 4CCOA 4ON0A 3HOVJ 4JP0A 3I58A 3PFIA 1VQ7I 4E7IA 3SZTA 4C2MJ 1VTNC 2HVSA 4IL6C 1ENHA 2RNJA 5EGOB 1UJ8A 2DJIA 1H89C 2MABA 3QP6A 3FISA 1VQMI 2XDVA 2IGKA 5BS6A 4HF0A 2LH9A 3AAFA 4HPQA 1YITI 1YJNI 3LA3A 3CCLI 1JTXA 2EFPA 2IA1A 4UVAA 3BDDA 1U6GA 1KQ0A 5HS8A 4YFKF 5J4YA 2FBKA 3KP2A 4ZJZA 2EQRA 3EUAA 3G3ZA 2JQ7A 3F8CA 3E6CC 4NBQA 1OMIA 1RKWA 1GDTA 2MBFA 4FTHA 3DKWA 1ODDA 2DT7B 1ETVA 5E1ZB 4EM0B 1BBYA 1KZHA 2XGEA 3FMRA 5DD4A 1XDSA 2DMTA 3BZKA 1LVKA 4II2A 1DQUA 3F6VA 3LSHA 3FMQA 3A0BC 1R71A 1QZEA 2UZKA 4JX6A 2W24A 1VI0A 3LMMA 1T8IA 2YX4A 5H2FC 4KT5C 2V26A 2E1MC 2OAZA 2P4WA 2W82A 3GTKJ 2VUMJ 1J75A 1H9TA 3NARA 2R5YB 1DU0A 3BJ6A 3CC4I 3HBLA 4R79A 2IS2A 2E2HJ 1BW6A 4A12A 1J59A 1EJ9A 2FRHA 5LEJA 1D1AA 1VQ4I 4CHUA 5FLVA 2W4SA 3RJPA 2M9HA 2QA4I 4WWCA 4CGZA 4E7JA 2DDAA 2HKXA 2GAUA 5ICGA 1STZA 1FX7A 4PFOA 2H1KA 5K5OA 3I9V2 2PMUA 2DCEA 1PP7U 1XCVA 3QU3A 1LFUP 4IRGA 4D5FA 2A07F 4G8XA 2ZFUA 4EM1A 4XN0A 5JLXA 2V6EA 3ECHA 3IC7A 1LE8A 3QYEA 3J81Z 4RGRA 5LD2C 1B4AA 2J5OA 5FRNA 2BHYA 4PJNA 1MJAA 5TJJA 5CQEA 3IRQA 4AIJA 2QF7A 4I6ZA 3GUDA 2DT6A 2HQAA 2BVLA 3A02A 4Q48A 2TCTA 4M3FA 4AWXB 5F0HA 1Q1HA 1CQTA 4N9IA 1S7OA 2XC7A 3J7ZI 3PO3J 4S04A 4AYBA 3ULQB 2RREA 3ZN0A 3GZNB 2EFNA 3ESWB 3ZOBA 2MH9A 4HV5A 5EJCA 3M4OJ 1XDUA 2P0WA 3G1MA 4WXHA 4LB6B 4I76A 4JQFA 4XLPF 2O3FA 3GO5A 5ERIA 4F92B 4IHXA 1D1CA 1OLTA 4MQ9F 1P92A 3TKYA 1IRGA 3DTIA 1MNDA 4BHPA 4MIMA 1JT6A 3HOSA 4MEYF 3O2PE 3TDZC 3KZIC 1XX5A 3H3VK 2JA2A 3GEZA 3DPLC 4D7MA 2BZTA 1QHGA 4ZYEA 4XRSG 1DGWY 1K7AA 4N4OB 4L9TA 1HLVA 2XB0X 2XV4S 1IW7F 2F4OB 2V79A 2V9VA 3AL0C 5F0CA 4QSHA 2XAUA 2W84A 3MWMA 3VWBA 4NC7A 4F3QA 2BE5F 3MKZA 3S3OA 1GLNA 1OR7C 1T6SA 5J6XA 1HW5A 2LKPA 1RI7A 5E3NA 1K78A 5GPAA 2A69F 1QA6A 4L5EA 3W2VA 4XN3A 2JN6A 1QZYA 3AFHA 2R7WA 2UUZA 4Y7NJ 5E79C 2F5EA 2XGCA 3P9IA 4CDGA 1MD0A 1VQ9I 2OUMA 4FISA 2IJLA 3K4JA 3OOUA 1R9TJ 1Y1WJ 1IAWA 2STTA 3ZQIA 2YS9A 1JJ6C 1GXPA 2NS0A 2XASA 5LRRA 1XGSA 3CP8A 1FTZA 4IHWA 1TZLA 3W6JB 2LC2A 2PG4A 4AC0A 1S5LC 1MGTA 3RI4A 2OC6A 3SJMA 1W5SA 2GA2A 3VPRA 3HKZA 4K2EA 2DXIA 2NVUB 1W4MA 1LDKB 2FA5A 3EUHC 2IP2A 4U7DA 2HTJA 4RAYA 4BJ6C 1MBJA 4HSRA 2NNNA 3QOPA 2Z9OA 4GCVA 2XPVA 2DK5A 4IJAA 1UHSA 3VODA 3FHNA 2GBYA 2MD5A 1T98A 1IXSB 1R00A 2W1OA 3VFZA 1U5TB 1F9NA 3IP4B 2M7BA 4E4HA 1IN8A 3CP2A 3ZR8X 4ZYGA 1SD4A 3AG4H 2OPTA 2A6EF 2JA5J 3HTSB 3M8JA 2DDBA 4YIRX 1BJAA 1KU3A 1N75A 2RQQA 4F93B 2E19A 3HOUJ 2XSJC 1BL0A 2GXBA 2ZCWA 2LLKA 2DTZA 2WAFA 3LSTA 5J3LA 2O8KA 1BOAA 2ICWG 5GAHJ 3UKGA 5FLMJ 1FOKA 3A03A 5C4JJ 4HEA2 3BROA 2NS8A 4TV7A 1OR7A 4ETSA 1NTCA 2BYVE 3OYNA 1HDDC 5FFZA 1ZAOA 2XPWA 2QEXI 1B9MA 3QP5A 2CYYA 1SC7A 2NOGA 4FX0A 4PSXA 1ETYA 4XICA 4CCKA 1U3EM 3TO7A 3LSIA 4LG3A 4J00A 1U78A 3H3UA 1XB4A 1X1DA 5FB2A 3L2UA 2FUG2 3BT9A 4V19K 1MDMA 5E3OA 2F2EA 3FXOA 2EJRA 2DA3A 4M3BA 2A5WA 4M9XA 2QKMB 3L2RA 1T0FC 4XL9A 5L3BA 3K10A
chains in the Genus database with same CATH topology
1JTYA 4M3DA 2OF7A 3H0GJ 4MO7A 2HOTA 4S0HB 2R93J 1WI3A 2Y31A 5J1RA 3BG9A 3LOCA 2X9DA 3HKZN 4B3AA 3K7AJ 2XB5A 1IDZA 4ABZA 5IP9J 3Q0VA 3O8HA 4BY7J 1JUSA 1MSFC 4A3MJ 5FKMA 3RQIA 2MGQA 1HF0A 4LOCA 2LR8A 2NS7A 3HOYJ 1AKHA 3S14J 1ETOA 3TEDA 1B8IB 1TC3C 1JGGA 1JKRC 4CYCB 1OFCX 2HQ5A 1A6IA 2DMNA 2O7OA 3HM5A 1OJLA 1G2HA 1AHDP 2IAIA 3ZQHA 4J19A 1AKHB 2AHQA 2ZB9A 1ORKA 5M5YJ 1JKOC 2K9SA 2EZLA 1H88C 1FJLA 1X58A 3RKQA 1D5YA 1SFOJ 4QTRA 3S17J 1MNMC 3BR6A 5EZHA 2HOAA 1VFCA 5FKKA 4A3IJ 4FCYA 1X2NA 3SFIA 2HDDA 3MVPA 3GTOJ 3TW6A 3GTGJ 1IDYA 3GTQJ 1ETQA 2R5ZB 5F04A 4A3DJ 4MFDA 4BY1J 2ECBA 1A5JA 2Y2ZA 5FKOA 5EF6A 4HNVA 2VKEA 2ELKA 5K7ZA 1I50J 3GTLJ 4XRSA 4DW6A 9ANTA 4A69C 2E2JJ 3E7LA 3G1OA 5F1JA 2CUEA 5F0FA 5C4XJ 2WB1N 2LVSA 5M5XJ 1QRYA 3JR9A 4MFEA 4A3GJ 2ID3A 2JWTA 2ECCA 1HDPA 3LSGA 1HOMA 2Y9ZA 3TP0A 1ETWA 1ETXA 4NDLA 4XRMA 2K9QA 3S1MJ 1U9NA 2HOSA 4A3KJ 3TW7A 2CQXA 2G0EA 3B6CA 4A3CJ 1K61A 3BQZA 4G12A 4BBRJ 2R0QC 4CYCA 4DYRA 5IYCJ 2GLOA 4JYKA 1JKQC 1H8AC 3BR0A 1XC5A 2WV1A 5J1YA 2K40A 1FIAA 2GM4A 3O8GA 4B1RA 1WCMJ 1ZR2A 2E2IJ 4JX4A 4DYQA 1ITYA 2R7ZJ 3OSGA 2PMZN 2L0KA 1LE8B 2KDZA 5GP9A 4IEJA 4C3HJ 1P7JA 3LNQA 2D5VA 1F43A 3S1RJ 2M0CA 5DS9A 4BBSJ 5IP6A 1TWGJ 2Y0SN 3JRHA 3ZQGA 1ZKGA 5M3MJ 1RKTA 4C3JJ 5FKLA 5IOZA 4UUTA 2NVXJ 2H8RA 3D1NI 2DA2A 1P7IA 3ZQFA 4GFBA 3OIOA 1F36A 2LFBA 3HOXJ 3GTPJ 2DA6A 3WHCA 1JT0A 1WH5A 4B4CA 1FEXA 3CCYA 1W0UA 4MLOA 3HOWJ 4C3IJ 2CUFA 1MBKA 1POGA 2CU7A 2JMWA 5EG0A 1RETA 3RZDJ 1EF4A 5IYDJ 2L7MP 1I3QJ 1YRNB 5EDNA 1JJ8C 4V2FA 2YU9J 3Q0WA 2FX0A 1MH3A 2DMUA 2HI3A 5K7FA 5HODA 1BJZA 5C3EJ 1IGNA 2DA7A 5FKNA 1PUFA 3GBGA 3HGGA 3SDGA 4A3JJ 4UUSA 3LSJA 3HOVJ 4JP0A 3BTLA 2N8GA 3I4NJ 3JRDA 1T56A 2R92J 3BR3A 1LFBA 2DA4A 4C2MJ 1ENHA 2MW8A 1Z0XA 4Y52J 5EGOB 2E1OA 1IV6A 1H89C 3JRBA 3FISA 1MBGA 4A3BJ 2X48A 1UG2A 3MKLA 1DU6A 4RBOA 1B72A 1AU7A 1JTXA 3DCFA 3S1QJ 3A01B 2O9LA 2LY9A 2EBIA 2RAEA 2JJ7A 2EQRA 2JA6J 3BR1A 2DA5A 4V2GA 1MH4A 2P81A 2EZHA 1RKWA 5IPAA 3HDDA 1GDTA 2DMQA 4FTHA 4D5CA 5IP7J 3I4MJ 2R5ZA 3BQYA 1ETVA 4BKXA 2XSDC 3ZQCA 1PUFB 2XGEA 1WH7A 2DMTA 1BA5A 1BW5A 2R5YA 1GT0C 2AO9A 4M3GA 1VNDA 1XS9A 3RZOJ 4JX6A 1XG1A 1VI0A 3DEWA 3IH3A 1ETKA 1X2MA 1I6HJ 1YRNA 5IYBJ 1TWHJ 3LSPA 4BXXJ 2MG4A 3GTKJ 3OSFA 2VUMJ 3NARA 3LSRA 2LK2A 2R5YB 1DU0A 3HBLA 5EZGA 2NVQJ 2E2HJ 1VF9A 2YUSA 1BW6A 3BR2A 5FLVA 4DYCA 3BTIA 4EEFG 2M9HA 3HB9A 1ZGWA 5EYRA 2DA1A 2FD5A 1JUPA 3W6VA 2LP0A 4IHVA 1Z77A 5EG0B 2H1KA 1UMQA 5GPCA 2X6OA 1ZQ3P 1LFUP 4D5FA 4M3EA 2M2EA 1ZTRA 3BG5A 5JLXA 3L1PA 1S7EA 4FE4A 4JX5A 1LE8A 2NVTJ 3CMYA 2DJNA 3IH4A 4XIDA 3NAUA 2XPUA 4A3FJ 4UUSB 2QF7A 4I6ZA 1IJWC 3A02A 2TCTA 4M3FA 1ZK8A 5F0HA 1CQTA 4IHYA 2Y9YA 5F08A 2CJJA 3PO3J 2L9RA 2XGDA 4RDUA 3GTJJ 3HGYA 5EEAA 2K9NA 3ZOBA 3IV5A 3A01A 2HXOA 4A3EJ 3M4OJ 3G1MA 3JRGA 4I76A 4IHXA 1U8BA 2QCOA 1IG7A 1MBHA 2FJ1A 1RESA 3CDLA 4MIMA 1JT6A 1RR7A 2CQQA 4X1EA 2B63J 3F0CA 3FK7A 1RPWA 2HXIA 2LKXA 3H3VK 2I10A 2WAQN 5K7HA 3IH2A 3S16J 1APLC 4D7MA 5EGOA 2VKVA 4A93J 4XRSG 1MSEC 2EZIA 1HLVA 2XB0X 2CRGA 4DZPA 3S1NJ 5C44J 5E3MA 1JUMA 5F0CA 4QSHA 1OCPA 2LD5A 1GVDA 2ME6A 5DTDA 3MN2A 5E3NA 3M3YJ 5GPAA 4L5EA 1W0TA 3HEFA 2JN6A 1Q1VA 4D7NA 2M8GX 3QPSA 4Y7NJ 2XGCA 3JRAA 3ZQLA 2JK3A 4FISA 3OOUA 1IC8A 1IRZA 5M5WJ 1R9TJ 5J1UA 1Y1WJ 3BTCA 3ZQIA 3JRIA 2YS9A 1JJ6C 1FTZA 4IHWA 5IOYA 4AC0A 4W97A 3HOZJ 1TWCJ 1TWAJ 3WHBA 3JRFA 3SJMA 3VPRA 1IUFA 4FE7A 1QPIA 3QQAA 1QVUA 1SANA 2DMPA 4DZJA 3GTMJ 5E3LA 2ME0A 1MBJA 5FJ8J 4XK4A 1FIPA 1JKPC 1Y1VJ 1K83J 3K2AA 2XPVA 1O4XA 3S2HJ 1UHSA 3CQZJ 2GBYA 2JA8J 3JRCA 3BTJA 4W1UA 1B72B 4AYBN 1E3OC 2XRLA 4X6AJ 3FK6A 3Q0UA 2COBA 2VPRA 3S15J 3PO2J 2NVYJ 1T33A 2LTPA 2L7FP 2OPTA 3FKIJ 1B8IA 2JA5J 1NK2P 5BNGA 5F27A 2M34A 2DN0A 5JLWA 4A3LJ 2JA7J 3PM1A 3BG3A 2E19A 2MSYA 1TWFJ 3HOUJ 1GUUA 2ID6A 2IBDA 1ZR4A 1BL0A 1MBFA 2LLKA 2DTZA 3C2BA 5J3LA 1GV5A 2O8KA 3UKGA 1FTTA 5FLMJ 3A03A 3QPLA 3TP3A 2KT0A 5C4JJ 2Y30A 5M3FJ 2NS8A 2FQ4A 1NTCA 1HDDC 1QVTA 2XPWA 1NK3P 4M6VA 2NOGA 1ETYA 4XICA 1WGXA 3G1LA 3S2DJ 3JREA 1U78A 2TRTA 1HCRA 1U9OA 3BT9A 3B6AA 1OCTC 1WPKA 2W48A 2EH3A 5E3OA 2IEKA 2EZKA 2HYJA 2DA3A 4QIWN 4M3BA 2VI6A 3BR5A 3FIWA 1MBEA 1GV2A 2L7ZA 3Q3SA 4AUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTY A;  4M3D A;  2OF7 A;  3H0G J;  4MO7 A;  2HOT A;  4S0H B;  2R93 J;  1WI3 A;  2Y31 A;  5J1R A;  3BG9 A;  3LOC A;  2X9D A;  3HKZ N;  4B3A A;  3K7A J;  2XB5 A;  1IDZ A;  4ABZ A;  5IP9 J;  3Q0V A;  3O8H A;  4BY7 J;  1JUS A;  1MSF C;  4A3M J;  5FKM A;  3RQI A;  2MGQ A;  1HF0 A;  4LOC A;  2LR8 A;  2NS7 A;  3HOY J;  1AKH A;  3S14 J;  1ETO A;  3TED A;  1B8I B;  1TC3 C;  1JGG A;  1JKR C;  4CYC B;  1OFC X;  2HQ5 A;  1A6I A;  2DMN A;  2O7O A;  3HM5 A;  1OJL A;  1G2H A;  1AHD P;  2IAI A;  3ZQH A;  4J19 A;  1AKH B;  2AHQ A;  2ZB9 A;  1ORK A;  5M5Y J;  1JKO C;  2K9S A;  2EZL A;  1H88 C;  1FJL A;  1X58 A;  3RKQ A;  1D5Y A;  1SFO J;  4QTR A;  3S17 J;  1MNM C;  3BR6 A;  5EZH A;  2HOA A;  1VFC A;  5FKK A;  4A3I J;  4FCY A;  1X2N A;  3SFI A;  2HDD A;  3MVP A;  3GTO J;  3TW6 A;  3GTG J;  1IDY A;  3GTQ J;  1ETQ A;  2R5Z B;  5F04 A;  4A3D J;  4MFD A;  4BY1 J;  2ECB A;  1A5J A;  2Y2Z A;  5FKO A;  5EF6 A;  4HNV A;  2VKE A;  2ELK A;  5K7Z A;  1I50 J;  3GTL J;  4XRS A;  4DW6 A;  9ANT A;  4A69 C;  2E2J J;  3E7L A;  3G1O A;  5F1J A;  2CUE A;  5F0F A;  5C4X J;  2WB1 N;  2LVS A;  5M5X J;  1QRY A;  3JR9 A;  4MFE A;  4A3G J;  2ID3 A;  2JWT A;  2ECC A;  1HDP A;  3LSG A;  1HOM A;  2Y9Z A;  3TP0 A;  1ETW A;  1ETX A;  4NDL A;  4XRM A;  2K9Q A;  3S1M J;  1U9N A;  2HOS A;  4A3K J;  3TW7 A;  2CQX A;  2G0E A;  3B6C A;  4A3C J;  1K61 A;  3BQZ A;  4G12 A;  4BBR J;  2R0Q C;  4CYC A;  4DYR A;  5IYC J;  2GLO A;  4JYK A;  1JKQ C;  1H8A C;  3BR0 A;  1XC5 A;  2WV1 A;  5J1Y A;  2K40 A;  1FIA A;  2GM4 A;  3O8G A;  4B1R A;  1WCM J;  1ZR2 A;  2E2I J;  4JX4 A;  4DYQ A;  1ITY A;  2R7Z J;  3OSG A;  2PMZ N;  2L0K A;  1LE8 B;  2KDZ A;  5GP9 A;  4IEJ A;  4C3H J;  1P7J A;  3LNQ A;  2D5V A;  1F43 A;  3S1R J;  2M0C A;  5DS9 A;  4BBS J;  5IP6 A;  1TWG J;  2Y0S N;  3JRH A;  3ZQG A;  1ZKG A;  5M3M J;  1RKT A;  4C3J J;  5FKL A;  5IOZ A;  4UUT A;  2NVX J;  2H8R A;  3D1N I;  2DA2 A;  1P7I A;  3ZQF A;  4GFB A;  3OIO A;  1F36 A;  2LFB A;  3HOX J;  3GTP J;  2DA6 A;  3WHC A;  1JT0 A;  1WH5 A;  4B4C A;  1FEX A;  3CCY A;  1W0U A;  4MLO A;  3HOW J;  4C3I J;  2CUF A;  1MBK A;  1POG A;  2CU7 A;  2JMW A;  5EG0 A;  1RET A;  3RZD J;  1EF4 A;  5IYD J;  2L7M P;  1I3Q J;  1YRN B;  5EDN A;  1JJ8 C;  4V2F A;  2YU9 J;  3Q0W A;  2FX0 A;  1MH3 A;  2DMU A;  2HI3 A;  5K7F A;  5HOD A;  1BJZ A;  5C3E J;  1IGN A;  2DA7 A;  5FKN A;  1PUF A;  3GBG A;  3HGG A;  3SDG A;  4A3J J;  4UUS A;  3LSJ A;  3HOV J;  4JP0 A;  3BTL A;  2N8G A;  3I4N J;  3JRD A;  1T56 A;  2R92 J;  3BR3 A;  1LFB A;  2DA4 A;  4C2M J;  1ENH A;  2MW8 A;  1Z0X A;  4Y52 J;  5EGO B;  2E1O A;  1IV6 A;  1H89 C;  3JRB A;  3FIS A;  1MBG A;  4A3B J;  2X48 A;  1UG2 A;  3MKL A;  1DU6 A;  4RBO A;  1B72 A;  1AU7 A;  1JTX A;  3DCF A;  3S1Q J;  3A01 B;  2O9L A;  2LY9 A;  2EBI A;  2RAE A;  2JJ7 A;  2EQR A;  2JA6 J;  3BR1 A;  2DA5 A;  4V2G A;  1MH4 A;  2P81 A;  2EZH A;  1RKW A;  5IPA A;  3HDD A;  1GDT A;  2DMQ A;  4FTH A;  4D5C A;  5IP7 J;  3I4M J;  2R5Z A;  3BQY A;  1ETV A;  4BKX A;  2XSD C;  3ZQC A;  1PUF B;  2XGE A;  1WH7 A;  2DMT A;  1BA5 A;  1BW5 A;  2R5Y A;  1GT0 C;  2AO9 A;  4M3G A;  1VND A;  1XS9 A;  3RZO J;  4JX6 A;  1XG1 A;  1VI0 A;  3DEW A;  3IH3 A;  1ETK A;  1X2M A;  1I6H J;  1YRN A;  5IYB J;  1TWH J;  3LSP A;  4BXX J;  2MG4 A;  3GTK J;  3OSF A;  2VUM J;  3NAR A;  3LSR A;  2LK2 A;  2R5Y B;  1DU0 A;  3HBL A;  5EZG A;  2NVQ J;  2E2H J;  1VF9 A;  2YUS A;  1BW6 A;  3BR2 A;  5FLV A;  4DYC A;  3BTI A;  4EEF G;  2M9H A;  3HB9 A;  1ZGW A;  5EYR A;  2DA1 A;  2FD5 A;  1JUP A;  3W6V A;  2LP0 A;  4IHV A;  1Z77 A;  5EG0 B;  2H1K A;  1UMQ A;  5GPC A;  2X6O A;  1ZQ3 P;  1LFU P;  4D5F A;  4M3E A;  2M2E A;  1ZTR A;  3BG5 A;  5JLX A;  3L1P A;  1S7E A;  4FE4 A;  4JX5 A;  1LE8 A;  2NVT J;  3CMY A;  2DJN A;  3IH4 A;  4XID A;  3NAU A;  2XPU A;  4A3F J;  4UUS B;  2QF7 A;  4I6Z A;  1IJW C;  3A02 A;  2TCT A;  4M3F A;  1ZK8 A;  5F0H A;  1CQT A;  4IHY A;  2Y9Y A;  5F08 A;  2CJJ A;  3PO3 J;  2L9R A;  2XGD A;  4RDU A;  3GTJ J;  3HGY A;  5EEA A;  2K9N A;  3ZOB A;  3IV5 A;  3A01 A;  2HXO A;  4A3E J;  3M4O J;  3G1M A;  3JRG A;  4I76 A;  4IHX A;  1U8B A;  2QCO A;  1IG7 A;  1MBH A;  2FJ1 A;  1RES A;  3CDL A;  4MIM A;  1JT6 A;  1RR7 A;  2CQQ A;  4X1E A;  2B63 J;  3F0C A;  3FK7 A;  1RPW A;  2HXI A;  2LKX A;  3H3V K;  2I10 A;  2WAQ N;  5K7H A;  3IH2 A;  3S16 J;  1APL C;  4D7M A;  5EGO A;  2VKV A;  4A93 J;  4XRS G;  1MSE C;  2EZI A;  1HLV A;  2XB0 X;  2CRG A;  4DZP A;  3S1N J;  5C44 J;  5E3M A;  1JUM A;  5F0C A;  4QSH A;  1OCP A;  2LD5 A;  1GVD A;  2ME6 A;  5DTD A;  3MN2 A;  5E3N A;  3M3Y J;  5GPA A;  4L5E A;  1W0T A;  3HEF A;  2JN6 A;  1Q1V A;  4D7N A;  2M8G X;  3QPS A;  4Y7N J;  2XGC A;  3JRA A;  3ZQL A;  2JK3 A;  4FIS A;  3OOU A;  1IC8 A;  1IRZ A;  5M5W J;  1R9T J;  5J1U A;  1Y1W J;  3BTC A;  3ZQI A;  3JRI A;  2YS9 A;  1JJ6 C;  1FTZ A;  4IHW A;  5IOY A;  4AC0 A;  4W97 A;  3HOZ J;  1TWC J;  1TWA J;  3WHB A;  3JRF A;  3SJM A;  3VPR A;  1IUF A;  4FE7 A;  1QPI A;  3QQA A;  1QVU A;  1SAN A;  2DMP A;  4DZJ A;  3GTM J;  5E3L A;  2ME0 A;  1MBJ A;  5FJ8 J;  4XK4 A;  1FIP A;  1JKP C;  1Y1V J;  1K83 J;  3K2A A;  2XPV A;  1O4X A;  3S2H J;  1UHS A;  3CQZ J;  2GBY A;  2JA8 J;  3JRC A;  3BTJ A;  4W1U A;  1B72 B;  4AYB N;  1E3O C;  2XRL A;  4X6A J;  3FK6 A;  3Q0U A;  2COB A;  2VPR A;  3S15 J;  3PO2 J;  2NVY J;  1T33 A;  2LTP A;  2L7F P;  2OPT A;  3FKI J;  1B8I A;  2JA5 J;  1NK2 P;  5BNG A;  5F27 A;  2M34 A;  2DN0 A;  5JLW A;  4A3L J;  2JA7 J;  3PM1 A;  3BG3 A;  2E19 A;  2MSY A;  1TWF J;  3HOU J;  1GUU A;  2ID6 A;  2IBD A;  1ZR4 A;  1BL0 A;  1MBF A;  2LLK A;  2DTZ A;  3C2B A;  5J3L A;  1GV5 A;  2O8K A;  3UKG A;  1FTT A;  5FLM J;  3A03 A;  3QPL A;  3TP3 A;  2KT0 A;  5C4J J;  2Y30 A;  5M3F J;  2NS8 A;  2FQ4 A;  1NTC A;  1HDD C;  1QVT A;  2XPW A;  1NK3 P;  4M6V A;  2NOG A;  1ETY A;  4XIC A;  1WGX A;  3G1L A;  3S2D J;  3JRE A;  1U78 A;  2TRT A;  1HCR A;  1U9O A;  3BT9 A;  3B6A A;  1OCT C;  1WPK A;  2W48 A;  2EH3 A;  5E3O A;  2IEK A;  2EZK A;  2HYJ A;  2DA3 A;  4QIW N;  4M3B A;  2VI6 A;  3BR5 A;  3FIW A;  1MBE A;  1GV2 A;  2L7Z A;  3Q3S A;  4AUX A; 
#chains in the Genus database with same CATH topology
 4M3D A;  2OF7 A;  2PX9 A;  2R93 J;  1ZRF A;  3HOT A;  5J1R A;  2E36 A;  5DV5 A;  1J09 A;  3HKZ N;  4AVP A;  3K7A J;  5K1Y A;  2E60 A;  3EUH A;  4H0E A;  2H1L A;  3CCV I;  2KL4 A;  2F4I A;  2QSF X;  1MSF C;  1MKM A;  4KIG A;  1SVM A;  1HF0 A;  4LOC A;  4L9V A;  5FRO A;  1ZRC A;  4LLL A;  2LR8 A;  2ISY A;  2R4G A;  2KZV A;  2NS7 A;  4B47 A;  4BUP A;  2IS6 A;  1FSH A;  3E5X A;  4MEX F;  3S14 J;  3CF2 A;  1H0M A;  1B8I B;  1TC3 C;  5B5E C;  2I8D A;  4HNT A;  3QU6 A;  1DPU A;  2HZD A;  1V3F A;  3NQO A;  5TRD A;  2V1X A;  1A6I A;  3GLX A;  1K79 A;  1OJL A;  1P6R A;  2UXX A;  4GRI A;  2KJC A;  1YS6 A;  1OCR H;  2IAI A;  1YW8 A;  2AHQ A;  3ABU A;  2K9S A;  2EZL A;  4PGH A;  4KIT B;  1T08 B;  3E6M A;  3HRU A;  2D1H A;  3PJR A;  1QO0 D;  3GFM A;  5EZH A;  1U8R A;  4IOA F;  1YIJ I;  3IAM 2;  3HYI A;  3FBN B;  2V6C A;  2ZJR F;  2XVC A;  2M3A A;  3H3Z A;  5F1R A;  4Q47 A;  1IUY A;  3SQN A;  3GTQ J;  1BIA A;  5F04 A;  4UUV A;  4A3D J;  4RM2 A;  4HW0 A;  3P9C A;  1G3Y A;  3T5X A;  3S3N A;  3CUO A;  4D1Q A;  2MLG A;  2VKE A;  2ELJ A;  2BHZ A;  2VOO A;  2WB1 A;  2K3F A;  1ACI A;  3QOE A;  1YE9 A;  4XRS A;  3L2C A;  1SVL A;  2VIX A;  2IS4 A;  2YSR A;  4HNU A;  5CVJ A;  5FD6 A;  2E2J J;  2DQR A;  6PAX A;  4RGU A;  2CUE A;  4C30 A;  3FDY A;  5C4X J;  3BY6 A;  1PJR A;  3CDI A;  4MFE A;  2HPI A;  3DXJ F;  3ZQQ A;  2JWT A;  2ZXW H;  4RGX A;  2JRM A;  4L5J A;  1ETW A;  4BH9 A;  4NDL A;  4NQW B;  4P1W A;  4ENN A;  2QLZ A;  4XLA A;  5F64 A;  3OS1 A;  2CQX A;  4A3K J;  2K86 A;  3B6C A;  3M1C A;  3CUQ A;  5HVQ C;  3V7C A;  3JSO A;  1XC5 A;  2VL8 A;  2K40 A;  3B73 A;  2O5R A;  3OL4 A;  3O8G A;  1PDN C;  2KIF A;  3KCC A;  2L3D A;  1TQM A;  3OSG A;  1IN7 A;  2WBM A;  3HXL A;  2HWV A;  2VT2 A;  2PMZ N;  3W2W A;  2L0K A;  2BY2 A;  3RYP A;  2KDZ A;  1C0W A;  4IEJ A;  2VOP A;  3FXJ A;  1U5T C;  1F43 A;  1MW7 A;  3GF2 A;  5DS9 A;  1K78 B;  4BBS J;  3ERE D;  1E3P A;  2PMZ A;  5IP6 A;  2MFZ A;  2Y0S N;  3D5L A;  4HZF A;  1JE8 A;  1KA8 A;  1RKT A;  1ZG1 A;  1QBJ A;  2K7L A;  2EV6 A;  1RUO A;  2NAZ A;  4I7H A;  5H6Q A;  3ZMU A;  1P7I A;  2KP6 A;  4LK0 F;  2NRA C;  1F36 A;  2DFE A;  3GTP J;  2JUC A;  1AA7 A;  2HS5 A;  1WH5 A;  3MKY B;  2X6W A;  4LG0 A;  4HAM A;  1QZZ A;  1W0U A;  2DOA A;  1WJC A;  3M9A A;  3OS2 A;  1T2K A;  3OS0 A;  3DF8 A;  5BQT A;  2KRF A;  2PFB A;  5EG0 A;  4EJV A;  4PCQ A;  2L7M P;  3RZD J;  1VQP I;  2BW3 B;  2FMY A;  4XOR A;  1N78 A;  3M07 A;  4V2F A;  3MKW B;  4XR6 A;  2L02 A;  3Q0W A;  2FX0 A;  2VOD A;  3H5R A;  3I59 A;  2Q0O A;  3MZH A;  2QBY A;  1MH3 A;  3IAS 2;  1YLF A;  2EK5 A;  5KAF C;  2V7F A;  2ZO4 A;  5CVR A;  2GIZ A;  2DA7 A;  2WY8 Q;  5EEH A;  4MHG A;  4PGG A;  4CCM A;  1TNS A;  1K4S A;  4LFU A;  3SDG A;  4A3J J;  4DOZ A;  1D1B A;  3V7R A;  2AQF A;  2XF5 A;  1T39 A;  3KFW X;  4CZZ A;  3LQR A;  2JTV A;  3BTL A;  2HZT A;  2VBW A;  4LIV A;  1T56 A;  4DBR A;  3DV8 A;  2GIV A;  5D5W B;  1Z6T A;  5DYM A;  3F8M A;  3K4K A;  3NEU A;  1WJ5 A;  1LPQ A;  2F6C A;  1RR8 C;  1ZN2 A;  1DU6 A;  2OCC H;  1B72 A;  2M4G A;  2K85 A;  3ZMZ A;  2PQ8 A;  1SD5 A;  1UEL B;  1K6O A;  2E7X A;  4ENK A;  1B59 A;  2KHM A;  3CF5 F;  3WTW C;  2RAE A;  2BEO A;  2M87 A;  2XAF A;  4KN4 X;  4EAT A;  5HDG A;  5ILU A;  3FXU A;  2DA5 A;  4V2G A;  3RYR A;  2OTL I;  1SFE A;  2EZH A;  5IPA A;  4BE0 A;  4PJ0 C;  1O3R A;  3CCQ I;  2L9V A;  2RKH A;  1XD7 A;  4RAZ A;  3TO6 A;  3LFK A;  2XSD C;  3OYG A;  4CA0 A;  1PUF B;  1WH7 A;  1J2X A;  1FBS A;  1BW5 A;  1GT0 C;  2AO9 A;  3ZQ7 A;  2ZME A;  3EYI A;  4HX7 A;  2MLK A;  3VYU B;  1OCC H;  4NUB A;  4JBA A;  4XKB A;  4G6T B;  3IH3 A;  3E97 A;  1YRN A;  1AOY A;  5KNL A;  4ANJ A;  2P6S A;  2WA0 A;  3JCU C;  4OMY A;  3P5J A;  3DTE A;  4HX4 A;  4BXX J;  4G7O F;  2K4J A;  3M8E A;  3D0S A;  1ON1 A;  3HSE A;  5DCM B;  2PN6 A;  4UV8 A;  4KT6 A;  3DKY A;  3OYF A;  3BR2 A;  2B7E A;  4GGG A;  4DYC A;  2Z3Y A;  3HB9 A;  1WQ2 A;  1ZGW A;  4C2U A;  4II3 A;  4GDF A;  3HRS A;  2LP0 A;  1SEU A;  3FWE A;  1RNL A;  5GPC A;  2X6O A;  3D5S C;  3WGG A;  1ZQ3 P;  2VJ5 A;  1AWC A;  4PK4 A;  4M3E A;  2IGO A;  5CVI A;  1ZTR A;  3BG5 A;  1MJ9 A;  4ZTJ A;  2FQ3 A;  2CV1 A;  4IPA A;  4JX5 A;  4MTD A;  3CO7 C;  3T8R A;  1SMY F;  5HLG A;  2GA1 A;  3NAU A;  2DOD A;  3E0J B;  1FP1 D;  3DBL B;  1P4W A;  3ZMT A;  4A3F J;  1PVE A;  4CUG A;  3Q5F A;  4UUS B;  1IJW C;  2R7D A;  4N0B A;  3BG6 A;  4P9F A;  1TW3 A;  1FOW A;  4RAG A;  5LLQ A;  2EFW A;  3LA2 A;  3RKY A;  2L9R A;  1KGS A;  2H6B A;  2A5Y B;  3GTJ J;  3K70 C;  2XRN A;  5L3G A;  5EEA A;  1QQI A;  2PBI A;  3IV5 A;  2KRH A;  3VYR B;  3CC2 I;  1G8X A;  3GLL A;  2JVG A;  4HQE A;  1VQK I;  2OJE D;  4B44 A;  4IF4 A;  2VE9 A;  3OMY A;  2RQP A;  1IRX A;  2DYR H;  1XMX A;  2ADU A;  2K27 A;  3C7J A;  2WAQ A;  3CDL A;  1RR7 A;  2CQQ A;  4X1E A;  2B63 J;  4AM3 A;  1V5F A;  3GZ6 A;  3F0C A;  4YFN F;  1IRF A;  2HXI A;  3L2W A;  3BJA A;  3RQ4 A;  1W7P B;  2E71 A;  4BQQ A;  5K7H A;  2M45 A;  3IH2 A;  5J8C A;  1APL C;  5EGO A;  4XM3 A;  4A93 J;  3OYL A;  1R6R A;  2CRG A;  3L9F A;  1MMN A;  2WY7 Q;  4Q4Z F;  1MNE A;  3MCZ A;  2ME6 A;  2HKO A;  1L3L A;  2VPL A;  3FZV A;  1F1Z A;  4J01 A;  1ONV A;  1W0T A;  4UB6 C;  3SYT A;  3VYS B;  2G7U A;  5A2Q K;  2CFX A;  2HPM A;  1Q1V A;  2CQ7 A;  4D7N A;  2M8G X;  3QPS A;  5BOX A;  3ZQL A;  3IWF A;  1HBX G;  4Y15 A;  4PSW A;  5J1U A;  4AVZ A;  1FMW A;  3BTC A;  4XKW A;  3DTK A;  1YOV B;  1XCB A;  3JRI A;  2L9S A;  2XAJ A;  5J8F A;  4BAY A;  1X3W B;  4W97 A;  3HOZ J;  4PJJ A;  3K0L A;  1TWC J;  3QAH A;  1IUF A;  1QVU A;  1YIO A;  1X4P A;  2VJ4 A;  2GQQ A;  4DZJ A;  3GTM J;  1J5Y A;  4IQJ A;  4RB3 C;  3L09 A;  1SFU A;  5DM7 F;  1FY7 A;  4EMS A;  4BGD A;  1XPX A;  3L2Q A;  2JSP A;  1JKP C;  2BBY A;  2VC0 A;  1FP2 A;  3BCA A;  3K2A A;  1Y39 A;  4NNJ A;  2DT5 A;  2LKS A;  4A0Y A;  3S2H J;  3CQZ J;  3CMM A;  2FOW A;  3JRC A;  2ZNY A;  2P5V A;  3CME I;  3E6D A;  3GFL A;  2FSW A;  4XOP A;  1XGO A;  2EWN A;  3EPZ A;  5TIS C;  2LTP A;  1S29 A;  4E6K G;  2M4K A;  1UHM A;  1RZ4 A;  4B3X A;  1NK2 P;  4RB2 C;  3COA C;  5GAD J;  1HST A;  5F27 A;  2MH2 A;  2M34 A;  4O3M A;  2CW7 A;  4ENJ A;  2QBY B;  3PM1 A;  3TDU C;  4ZYH A;  2YX7 A;  1TWF J;  2ESN A;  5K5Q A;  1GUU A;  2IBD A;  1ZR4 A;  1FT9 A;  2KQR A;  2V1U A;  4BDZ A;  5HNH A;  3KE2 A;  3HPH A;  3C2B A;  3DPU A;  4DIQ A;  3AG3 H;  2Y0M A;  1FTT A;  2PMH A;  1HKT A;  2HGC A;  3IUO A;  3TP3 A;  2KT0 A;  3HSR A;  1BR2 A;  2Y30 A;  2FQ4 A;  4PUS A;  3WU0 A;  3Q9S A;  2DFF A;  4OAZ A;  5HLI A;  1NHA A;  1R5I D;  1WJB A;  5IT9 K;  3E1S A;  4LJZ F;  5B1A H;  1WGX A;  4U88 A;  3S2D J;  3DBH B;  3OYD A;  4YG2 F;  2TRT A;  1UG0 A;  2HNH A;  3R61 A;  2DPU A;  1LFP A;  1T38 A;  2P5K A;  2W48 A;  3RDI A;  2XF6 A;  5AIP A;  1XN7 A;  5D4R A;  3DU5 A;  2EZK A;  2HYJ A;  2B9S A;  1ERD A;  2QQB A;  3FIW A;  4Z2Y A;  2G9W A;  3TMO A;  2HEO A;  2HDC A;  4CSW A;  1GV2 A;  4AUX A;  3LSK A;  2NXN B;  2ACJ A;  1JGS A;  4S0H B;  4M72 A;  3F23 A;  4PFP A;  3BG9 A;  3IL2 A;  2VQH A;  2X9D A;  2DOF A;  4ABZ A;  1EH8 A;  3Q0V A;  4BY7 J;  2FE3 A;  2HYG D;  3A0H C;  3RQI A;  2MGQ A;  3G4S I;  1TLH B;  1HXD A;  2BY3 A;  2EA2 A;  4EV0 A;  3GX4 X;  3HOY J;  5LEK A;  4U0W A;  3TED A;  2V4J C;  4QPO A;  3ZP5 A;  2ZSH B;  2P7C B;  3EET A;  2OQR A;  4KUM A;  2HQ5 A;  1YFH A;  1R5G A;  4A6D A;  2EIJ H;  3HM5 A;  1X19 A;  3FM3 A;  4MTE A;  2VAS A;  2NYX A;  1YO5 C;  2M1B A;  3ZQH A;  1JI8 A;  1I39 A;  2ZB9 A;  2E7W A;  5M5Y J;  5D8L B;  1D5V A;  2O0Y A;  1K6Y A;  4G7Z F;  1H88 C;  1A36 A;  1X58 A;  2RVC A;  1WJA A;  3A4C A;  1UZC A;  3S17 J;  1W5C C;  5E8G A;  3U1D A;  5FGM A;  4IX7 A;  3OR2 C;  1RUN A;  2K5C A;  3SZP A;  5FKK A;  1FOY A;  2VKD A;  4OIP F;  1X2N A;  3SFI A;  2MYS A;  2HDD A;  2KMU A;  1UHW A;  3FBI B;  3MVP A;  4IVN A;  1I6X A;  3LQQ A;  3GTO J;  3VSK A;  1FOX A;  3GTG J;  1IDY A;  3K4L A;  3WTV C;  1ETQ A;  3OYH A;  3ABT A;  1LDD A;  4MFD A;  5KK1 A;  1IN5 A;  2NOJ B;  5IY5 H;  2STW A;  1P2F A;  2ECB A;  4UVC A;  3QWL A;  4JK1 X;  5FKO A;  1J0R A;  5EF6 A;  1F4K A;  2Y48 A;  3H5N A;  4QWQ A;  2ELK A;  3KPH A;  5K7Z A;  1RC9 A;  3GTL J;  2JT1 A;  9ANT A;  3CCE I;  1TNT A;  1RIO H;  2LOO A;  2WB1 N;  2LVS A;  3S32 A;  5M5X J;  1QRY A;  1O3T A;  1YW7 A;  3CCR I;  1BI2 A;  3LSG A;  5LBQ A;  4F52 A;  5JI6 A;  2CW8 A;  1G6N A;  2K9Q A;  2ISZ A;  2GXG A;  3S1M J;  1U9N A;  1FBQ A;  3ZMS A;  1FBU A;  1D0Z A;  2CQN A;  2G0E A;  2VN2 A;  4A3C J;  2M8E A;  3BQZ A;  4G12 A;  1G3W A;  5DCM A;  2DW4 A;  1J7K A;  4JYK A;  1JKQ C;  2DAO A;  2V9P A;  2WV1 A;  5J1Y A;  3DBR B;  3P9K A;  2R3S A;  1BI0 A;  3GME A;  4WK8 F;  1Z05 A;  3NWS A;  4B1R A;  1WCM J;  1V54 H;  5ILV A;  4RS8 A;  2E2I J;  1V4R A;  4DYQ A;  2DFI A;  5J4V A;  3H36 A;  2R7Z J;  1XGM A;  3I64 A;  2A3S A;  2XKO A;  5BPD A;  3H9J A;  2H94 A;  2BW3 A;  3ABM H;  3OOP A;  2UV1 A;  1LE8 B;  3IKT A;  2ZXI A;  5GP9 A;  4NC8 A;  1FYK A;  1WVR A;  2M0C A;  1R23 A;  3V7S A;  1FZP B;  4ZTF A;  3RSN A;  4OAY A;  3IKV A;  4BXF A;  3IHU A;  3J81 K;  3ECO A;  3HRM A;  1FNN A;  1OYY A;  2GZW A;  4KMF A;  2EIN H;  2HU9 A;  2A6H F;  5HDK A;  3F9K A;  2OQG A;  2NVX J;  3PQJ A;  2H8R A;  2DA2 A;  3CCS I;  1TT0 A;  4GFB A;  2RNG A;  3OIO A;  5EEG A;  1JHF A;  2E1C A;  1Z7L A;  4BEH B;  3JAM Z;  1LNW A;  2BY1 A;  4B4C A;  2AXL A;  2PJR A;  4DGW B;  1EA3 A;  2P8T A;  3DKX A;  4DJA A;  1D8J A;  1LKX A;  4HOB A;  2DQL A;  3E3V A;  3U21 A;  1BC7 C;  1SAX A;  1R7J A;  2F48 A;  1YHQ I;  4LG0 B;  4E7K A;  4BQA A;  1W36 D;  1EF4 A;  1TT5 B;  1E17 A;  2L54 A;  1WZ2 A;  4N9H A;  1R36 A;  2M30 A;  2BY0 A;  1ZGA A;  2VBZ A;  5EDN A;  1TL8 A;  1W36 C;  5FLX K;  1KU7 A;  1IZ1 A;  2XGX A;  1BM9 A;  3T8T A;  3F22 A;  4HLY A;  2W85 A;  4ZYD A;  1NG6 A;  2LYC A;  2DO7 A;  2GXA A;  2VON A;  1LEA A;  2IS1 A;  1IGN A;  4YII A;  1YJ9 I;  1PUF A;  2FNP A;  1R1U A;  3EYY A;  3MEX A;  1Z9C A;  2LY1 A;  4E7S A;  3OYC A;  3R6S A;  5DUK A;  4XON A;  3I4N J;  1SVO A;  3JRD A;  3AG2 H;  2HR3 A;  3DEE A;  1V5E A;  3BR3 A;  1HA8 A;  2O8X A;  3G73 A;  1IV6 A;  1MZB A;  2XAQ A;  3MQ0 A;  2GWR A;  3KEY A;  1EKE A;  4A3B J;  4XSZ F;  2K3P A;  3MKL A;  3KLN A;  4KYW A;  5DUI A;  1AU7 A;  1W1W E;  2A68 F;  3DCF A;  3S1Q J;  3B02 A;  1ZYR F;  2O9L A;  1BR4 A;  2LY9 A;  2CS3 A;  4P9U A;  2M7A A;  3BR1 A;  1P4A A;  2P81 A;  1SMT A;  4XKC A;  4BJ5 C;  1YG2 A;  1ZGJ A;  4AU7 A;  5ICE A;  4IHS A;  1GHC A;  3HDD A;  2JVH A;  2DMQ A;  2EIM H;  2OD5 A;  5LHI A;  3EUK L;  4UNO A;  3PUB A;  3HUG B;  2DBB A;  3SXY A;  5H20 A;  1Y6I A;  3MMY B;  5E1X A;  3TOA A;  1BA5 A;  4M71 A;  2RV8 A;  4YIF A;  1S72 I;  4KA4 A;  3UNG C;  4M3G A;  1CF7 B;  2MD0 A;  4LMY A;  1WJD A;  4C2T A;  2QYO A;  2MC4 A;  3N05 A;  4PDK A;  1D3Y A;  4R1H A;  4RGS A;  2LNB A;  3DEW A;  4OOI A;  1ETK A;  1X2M A;  2B0L A;  1P4X A;  5ICC A;  5A2Q Z;  2J5P A;  1TWH J;  3WTX C;  2QM3 A;  1Z6R A;  5DCF A;  3QYB A;  3F72 A;  3TO9 A;  3JTG A;  3LSR A;  3S93 A;  2EPF A;  2F5F A;  4XLN F;  2F5C A;  3G6E I;  5EZG A;  4NB5 A;  3C3W A;  3BTI A;  3BCB A;  5EYR A;  4OIQ F;  4M74 A;  2FD5 A;  3QPT A;  1JUP A;  3V4G A;  3OYM A;  5ICF A;  3W6V A;  5IT9 Z;  1Z77 A;  3K70 D;  3CTA A;  2BXZ A;  3VDX A;  2VJJ A;  1EV7 A;  3GCM A;  4HLX A;  1JHH A;  2M2E A;  1GXQ A;  5ED4 A;  3L1P A;  2ESH A;  4F7Z A;  3PIO F;  2ZJP F;  1YW9 A;  2CSO A;  4NC6 A;  3S3M A;  3RPU A;  4LB5 A;  3J7A O;  4XID A;  3I56 I;  3K4B A;  4HX8 A;  1M1E B;  3QYF A;  1VQO I;  3WGI A;  1NG7 A;  4ZH4 F;  5DDG A;  3LSM A;  3H35 A;  3HTU A;  3BC8 A;  1ZK8 A;  2Z5U A;  3H9G A;  3W6K B;  3N4M A;  5TGT A;  5KAI C;  1BR1 A;  2CJJ A;  1P9Q C;  4BE2 A;  1O57 A;  5F6F A;  4KIB A;  3H1C A;  2IXS A;  4ENM A;  1WJE A;  1YYV A;  3CCJ I;  3A01 A;  2L4M A;  5CVV A;  4A3E J;  3S8P A;  2H8W A;  4U0Y A;  2LRD A;  4FX4 A;  4IRI A;  1U8B A;  3M8F A;  1MBH A;  3GFI A;  3BZ6 A;  4RLF A;  1K4T A;  2RGV A;  3GFJ A;  2IA0 A;  4C9Y A;  1RPW A;  2LKX A;  2KIM A;  2I10 A;  2WAQ N;  5D5U B;  3WOD F;  1ZLJ A;  3S16 J;  4YRV A;  2EZI A;  2D45 A;  4MQV A;  4DZP A;  3AG1 H;  4BEH A;  3S1N J;  5E3M A;  1JUM A;  2ZXH A;  1R5H A;  1VQL I;  1OCP A;  2W25 A;  5LHH A;  3DPT A;  2LF7 A;  4BL0 B;  2PJP A;  5DTD A;  3MN2 A;  3M3Y J;  1R22 A;  3OYA A;  3T0Y A;  2EIL H;  3HEF A;  3HC7 A;  2XUB A;  1XMK A;  4BNC A;  2Q2E A;  2YPR A;  4HBL A;  1IC8 A;  1IRZ A;  5M5W J;  4KIF A;  4XQF A;  1MMD A;  3ZN1 A;  2CH0 A;  5E8I A;  1ZLK A;  3HG9 A;  4E70 A;  1PUE E;  1KU2 A;  2UWM A;  1J9I A;  3TQN A;  2KIQ A;  3I3L A;  5IOY A;  3OYE A;  3FX3 A;  1O7F A;  2OCE A;  1TWA J;  3CZ6 A;  1SD6 A;  1UCR A;  2WAE A;  4ESJ A;  3K4M A;  3QQA A;  2V9K A;  3GYH X;  3I55 I;  2CV0 A;  4IZZ A;  3WTY C;  3ZMD A;  4RB1 A;  3V42 A;  4CO8 A;  3ISP A;  2ME0 A;  2EFO A;  5CLS A;  3T1B A;  4XNF A;  4XK4 A;  4HF2 A;  4M6Y A;  1QU3 A;  1IN6 A;  3GZ5 A;  1K83 J;  3SEQ A;  1W7P A;  1O4X A;  1KU9 A;  3ML6 A;  2JA8 J;  1IF1 A;  3BTJ A;  4OMZ A;  2VJI A;  4P55 A;  2DK8 A;  2HOE A;  4W1U A;  1B72 B;  5LFA A;  2AXT C;  3WGH A;  2CG4 A;  1E3O C;  1ZRD A;  5B1B H;  2XRL A;  3FK6 A;  2COB A;  2VLA A;  3W3C A;  2E1N A;  2EB7 A;  3PO2 J;  2FF4 A;  2LDU A;  3VSL A;  2QQA A;  2KZG A;  2L7F P;  5D8K B;  1LQ1 A;  3LL7 A;  2IT0 A;  2FBH A;  3OYI A;  2HDW A;  2WV0 A;  1XSX A;  2LBF B;  4L18 B;  1X3U A;  3GW2 A;  2DN0 A;  3RTR A;  4A3L J;  3C2G A;  1EH6 A;  3K1M A;  3TGN A;  1OPC A;  3KEQ A;  5J47 A;  1FSE A;  3J7Y J;  3MFK A;  1GV5 A;  5D5X B;  2O61 A;  1Y0N A;  2D2W A;  2OV7 A;  4IO9 F;  3KLO A;  5D6F A;  5M3F J;  1R4N B;  1LDJ A;  1QVT A;  2FOK A;  3E5Q A;  1VQN I;  3S2W A;  4M6V A;  3LFU A;  4WXC A;  1KYW A;  2QKL B;  5AIQ A;  3DU6 A;  3CO6 C;  3P7N A;  3TBI A;  4L0Y B;  3OL3 A;  3JRE A;  4L5I A;  4UXN A;  3FXQ A;  4IHT A;  1HCR A;  3B6A A;  1S6L A;  2X4H A;  2PJR B;  5FO5 A;  2O6G E;  2IEK A;  2VC1 A;  4PJM A;  3D5R C;  1I5Z A;  2VI6 A;  1OYI A;  4YEJ A;  1JTY A;  4M9Z A;  3K69 A;  4MO7 A;  5L3F A;  5JVT A;  2Y31 A;  1U0J A;  3WE2 A;  4F55 A;  3LOC A;  1Z1D A;  4B3A A;  2QZ8 A;  2XB5 A;  2HQN A;  3MAJ A;  2LF8 A;  2I5U A;  5IP9 J;  3LAJ A;  2ZME B;  2W57 A;  3V8J A;  2W00 A;  4EGY A;  5HDN A;  5FKM A;  4A3M J;  1DUX C;  4OWR B;  3CLO A;  4BXU A;  2H6C A;  3LA7 A;  2X1D A;  4EJU A;  4RAF A;  2XKP A;  1AKH A;  1FMV A;  1ETO A;  2BXY A;  3FMS A;  1TW2 A;  2ZBK A;  2FNA A;  5CPR B;  1JGG A;  3A1Y A;  1A6Q A;  4CYC B;  4WCG A;  1IO2 A;  2GOX B;  2O7O A;  1MMS A;  2VE8 A;  3C18 A;  5B3S H;  5K5R A;  3OV8 A;  4JOM A;  1VQ6 I;  1G2H A;  5DEQ A;  1AHD P;  5HLH A;  5CJ9 A;  4J19 A;  4Z6Y A;  1AKH B;  3K1N A;  3ELK A;  1FJL A;  3RKQ A;  4RA2 A;  3RIR A;  1Z21 A;  1X1C A;  1D5Y A;  4CXF A;  4H4K C;  2BGC A;  4DNC A;  2XAH A;  5HNF A;  1MNM C;  4HA8 A;  2W7N A;  1G59 A;  3C1D A;  1BI3 A;  2RN7 A;  2L4A A;  5JHU A;  3DWL E;  3NRV A;  1VFC A;  2DTR A;  4A3I J;  4FCY A;  1HKQ A;  2EV5 A;  2IRF G;  4M9S A;  3OIQ A;  2AQE A;  3DQV C;  3DP7 A;  3L00 A;  4XKV A;  5L3C A;  1SFX A;  4L0Z B;  2ZME C;  1H9G A;  4KN7 X;  1VQ5 I;  3CJR B;  2NNY A;  4BQO A;  1D0X A;  4BY1 J;  3HZJ A;  2L7K A;  3I59 B;  3PUF A;  1A5J A;  4EJT A;  4EJO A;  4HST A;  1YX5 A;  2DYS H;  3QOD A;  2KRC A;  2ZKZ A;  3IWZ A;  3OIP A;  4E7H A;  1S9H A;  1UST A;  4A69 C;  3E7L A;  1SAU A;  5F1J A;  1R1T A;  3REO A;  1DGR M;  2VXZ A;  3WTU C;  3CD6 I;  3OWT A;  3QRF F;  2CWE A;  2VQG A;  3IRR A;  1G4D A;  3RKX A;  2ID3 A;  4A3G J;  1HDP A;  2Y9Z A;  3TP0 A;  1ETX A;  2EIK H;  2FU4 A;  2E35 A;  3I54 A;  4BBR J;  3TL4 X;  3WTS C;  4BHB A;  4DYR A;  2C6Y A;  1X1B A;  2GLO A;  1KYZ A;  2QGU A;  1ZG5 A;  1H8A C;  2QQ9 A;  4HDU A;  3ROU A;  5B66 C;  3BR0 A;  1I1G A;  2IA2 A;  4A0X A;  3G2B A;  1IXR C;  2PLY A;  4JX4 A;  4OIO F;  1LB2 A;  1ITY A;  3J80 K;  4IXA A;  2ZJQ F;  1A31 A;  2IGN A;  4BU2 A;  4C3H J;  3CCM I;  2D5V A;  1P7J A;  1N25 A;  4Y4R A;  5J40 A;  2CFO A;  1S7A A;  1X3Z B;  4QPQ A;  3GWZ A;  1TWG J;  1ULY A;  3E6B A;  2ZFW A;  1OYW A;  2OZ6 A;  3H92 A;  3HUG A;  4I0A A;  1R1V A;  2OBP A;  2JPB A;  5D4S A;  3KET A;  4C3J J;  2OA4 A;  1X1P A;  5ILS A;  2QSH X;  4E7Z A;  4XLC A;  2E5Z A;  5IOZ A;  2WWY A;  3PNT A;  3KEO A;  3D1N I;  4G9Y A;  1WFX A;  1ON2 A;  4Y13 A;  1D0Y A;  3ZQF A;  3HRT A;  1TBX A;  3O6B B;  3VYT B;  5DM6 F;  1UFM A;  3F3X A;  2DA6 A;  3WHC A;  3M7G A;  2FXA A;  1LEB A;  2FBI A;  1FC3 A;  1QNT A;  4MLO A;  3CMA I;  2FEZ A;  4C3I J;  4UY8 I;  4WXD A;  2GOM A;  5E20 A;  5JR3 A;  3CC7 I;  1MBK A;  4ZZD A;  2JMW A;  2HTS A;  5IYD J;  4CCL A;  1OCZ H;  1I3Q J;  2R7V A;  1UB9 A;  2OU2 A;  3PIP F;  1JJ8 C;  2ZJ2 A;  4F91 B;  3HPG A;  2MA3 A;  3EDP A;  5K7F A;  3R4K A;  4QLC U;  1BJZ A;  1S3J A;  3RKW A;  2CMP A;  1VZ0 A;  3MZY A;  2F5D A;  5KHD A;  5E18 F;  3BPV A;  3KZY A;  3GBG A;  3HGG A;  1JXS A;  4UUS A;  2A6T A;  4CZC A;  3LSJ A;  4ASN A;  4BYY A;  2CQK A;  2BV6 A;  2N8G A;  2L5Q A;  4XRF A;  5AON A;  3RCO A;  3MD2 A;  2R7F A;  5LHG A;  2R92 J;  1LFB A;  3TOB A;  2DA4 A;  2R7U A;  4OIN F;  2MW8 A;  1Z0X A;  2ZC2 A;  1PP8 F;  4Y52 J;  1I1S A;  2ZSI B;  1Y8Q B;  2E1O A;  5GAG J;  3ABK H;  3JRB A;  2KDO A;  1MBG A;  3K2Z A;  2X48 A;  4PZJ A;  1UG2 A;  3KP6 A;  3RPQ A;  2R7T A;  4R8H A;  2DI3 A;  4RBO A;  2XF7 A;  3K1P A;  1HW1 A;  2RDP A;  4HYE A;  2Q1Z B;  4ESF A;  3A01 B;  3DEU A;  2R7X A;  2EBI A;  1Y56 A;  2CGP A;  4EQQ A;  5D6E A;  2JJ7 A;  3BZC A;  3I4P A;  3ZPL A;  3F21 A;  2JA6 J;  3CJN A;  4FAS D;  2V1N A;  1MH4 A;  4EM2 A;  4CCN A;  2EV0 A;  3PQK A;  2VT3 A;  1W5T A;  2ELH A;  1EH7 A;  4D5C A;  2IW5 A;  5IP7 J;  3I4M J;  3FXR A;  3BQY A;  2R5Z A;  4BKX A;  3WG9 A;  5LGU A;  3PNV A;  3ZQC A;  1FWZ A;  3JTH A;  4IKF A;  3DFG A;  3FXL A;  4U7B A;  2R5Y A;  2LY2 A;  5IT3 A;  1VND A;  1ZHF A;  4KJZ A;  4S05 A;  1XS9 A;  4LIU A;  5L3D A;  3KP5 A;  3RZO J;  3OYB A;  4FHT A;  3LAP A;  1XG1 A;  3KYC B;  3OY9 A;  1WRJ A;  3VEP A;  1I6H J;  1ZEL A;  5IYB J;  1WKM A;  4L9J A;  2LSO A;  4RB0 A;  2YR2 A;  3LSP A;  2MG4 A;  3FF5 A;  3ZCO A;  4BS9 A;  3OSF A;  2LK2 A;  2QUF A;  2A05 A;  1PYV A;  2ETH A;  5LRS A;  2H09 A;  2NVQ J;  1VF9 A;  2YUS A;  4XLH A;  3WTZ A;  2QWW A;  4EEF G;  3I53 A;  2DA1 A;  3F6O A;  2JUG A;  2KIS A;  4IHV A;  5EG0 B;  4KIS A;  1UMQ A;  2EFQ A;  4CIC A;  2QSG X;  2DOE A;  1OCO H;  4RMN A;  4HQM A;  5CVU A;  3L7W A;  1I3A A;  3M1E A;  1S7E A;  4FE4 A;  2KKO A;  4A5N A;  3I71 A;  4G6D A;  2NVT J;  3CMY A;  1LJ9 A;  1E0E A;  2DJN A;  3IH4 A;  1DP7 P;  4ESB A;  2XPU A;  3Q9V A;  2Z1D A;  4HV6 A;  3K4C A;  4BHC A;  1BI1 A;  5DD8 A;  1Z67 A;  4IHY A;  2Y9Y A;  5F08 A;  1OIS A;  4D9J A;  2JSC A;  2R7R A;  2XGD A;  2JRT A;  4RDU A;  3HGY A;  3K6G A;  4KIC A;  1XSD A;  2K9N A;  1X1A A;  4PJL A;  2BOL A;  3RPU D;  4B43 A;  3L2V A;  4B48 A;  3I5U A;  2HXO A;  3BJO A;  1I27 A;  2R7Q A;  5FD5 A;  4NHJ A;  3E5U A;  4B09 A;  3JRG A;  4GYI A;  3BOQ A;  1MMA A;  4I09 A;  2QCO A;  1TP4 A;  3K4N A;  4ITV A;  1IG7 A;  2FJ1 A;  4IRH A;  1R4M B;  1RES A;  1E3H A;  1U5T A;  3WE3 A;  4LLN A;  1Z3X A;  4G6Q A;  2Q8K A;  3J7A Y;  2COM A;  3KIO A;  1DPR A;  3QPH A;  3FK7 A;  4P5O A;  3DLL F;  2KLO A;  2F4M B;  4EVI A;  2QEN A;  2VKV A;  4HG2 A;  1Y0U A;  3NWT A;  1MSE C;  2L01 A;  3HHG A;  3WTT C;  1FLI A;  3K9T A;  5C44 J;  3R60 A;  3CJT B;  4ZC3 A;  1TTY A;  2K02 A;  2LD5 A;  1HKS A;  1KQ8 A;  1GVD A;  1RRJ A;  3KP7 A;  1BC8 C;  3CUQ C;  1ZRE A;  1BIB A;  1B6A A;  5HS7 A;  4XLF A;  2M0M A;  4AIH A;  3H0D A;  1FYL A;  2K9L A;  3ONQ A;  1ZAR A;  3JRA A;  2JK3 A;  4ZDO A;  2DPD A;  1HW2 A;  4HRI A;  2KFD A;  2VKH A;  2E5N A;  3X2Q H;  3BG7 A;  3H5A A;  3HJE A;  3J80 Z;  1LVA A;  2Q2E B;  4Y17 A;  4BAC A;  2K4B A;  1V55 H;  2LBF A;  1ZH5 A;  3WHB A;  1IN4 A;  2Y75 A;  3PL8 A;  3JRF A;  1IXC A;  4A5M A;  1MDM B;  4FE7 A;  4CCJ A;  2XHK A;  4HDV A;  1NH3 A;  1QPI A;  2PEX A;  2VB6 A;  2H27 A;  5D5V B;  1SAN A;  2DMP A;  2Z99 A;  2IVM A;  5E3L A;  3MZ8 A;  2L2O A;  2LRE A;  4E7L A;  1DDN A;  4DBQ A;  4Y3O A;  5FJ8 J;  3PFY A;  3PNY A;  1FIP A;  2JPC A;  5E1W A;  2KJB A;  3U2R A;  5HOO A;  1Y1V J;  3F8N A;  1FYM A;  2HQR A;  3F8F A;  3JAM K;  4P96 A;  4AYB N;  4IOC F;  3ZXS A;  3AL0 B;  5CQG A;  4X6A J;  3Q0U A;  4UB8 C;  1B1B A;  2VPR A;  4G94 A;  3G71 I;  3S15 J;  3U1K A;  1HSJ A;  3FM5 A;  3C2H A;  1O7L A;  2NVY J;  1MMG A;  1A04 A;  1OQY A;  1T33 A;  4L9N A;  3SDB A;  2HVQ A;  3SHF A;  3FKI J;  1B8I A;  4AD9 A;  1TQI A;  1N77 A;  1D8K A;  2BVM A;  4MGR A;  5BNG A;  4BE1 A;  4I0B A;  4A6E A;  3FHZ A;  3W2A A;  4RLQ A;  3SEZ A;  3BPX A;  1R49 A;  3EQL F;  5JLW A;  2JA7 J;  3BG3 A;  2MSY A;  4UHT A;  1TQP A;  5HLT A;  4LLG F;  2ID6 A;  4LIT A;  3BLY A;  1HQC A;  3SFZ A;  1MBF A;  1SFK A;  2DU9 A;  4KFC A;  2A61 A;  1WI9 A;  2CUJ A;  4O5V A;  4EGZ A;  1QGP A;  1KQ9 A;  3HHH A;  3ZMV A;  3QPL A;  4Y33 A;  2P7V B;  4ZZL A;  1YTY A;  2X6Y A;  2RC4 A;  1REP C;  3KZZ A;  4RM3 A;  3WU1 B;  4FT8 A;  3JW4 A;  1WWX A;  1NK3 P;  3WG7 H;  1W7P D;  3OR1 C;  2UXN A;  4I02 A;  1WJF A;  2G7H A;  3G1L A;  4I01 A;  3FXK A;  4XSX F;  4OIR F;  1U9O A;  4MNU A;  4UVB A;  1MJB A;  1OCT C;  1WPK A;  4WX9 A;  2EH3 A;  4B8X A;  4LD5 A;  5L3E A;  1T95 A;  2Z33 A;  3CJQ B;  4QIW N;  4AIK A;  3BR5 A;  3KYD B;  1MBE A;  3PSF A;  2L7Z A;  3Q3S A;  5CYV A;  3BWG A;  3H0G J;  2HOT A;  5KCM A;  1WI3 A;  4XMY A;  4BJT A;  4U87 A;  1FPQ A;  4KDP A;  4DQ2 A;  1IDZ A;  3H9Q A;  3CCU I;  1CF7 A;  3O8H A;  1JUS A;  2F5V A;  1B9N A;  3SZG A;  4UV9 A;  2E34 A;  5CKT A;  4HF1 A;  1X4O A;  3HL2 A;  1MIJ A;  3BP8 A;  1DP3 A;  2E1M B;  1UAA A;  1Z91 A;  3KX2 A;  1VQ8 I;  1BOB A;  5FLX Z;  1JKR C;  1OFC X;  2M5W A;  1BN5 A;  4XOT A;  3GXO A;  2VBY A;  2DMN A;  2Z16 A;  4M6X A;  4FET A;  2AS5 F;  1CGP A;  4NQW A;  5HS9 A;  2WTE A;  4O6J A;  2OZU A;  4KMU X;  1ORK A;  3CUQ B;  4U0V A;  4XLE A;  2XRO A;  1JKO C;  3A2K A;  4WF2 A;  2KIU A;  5GTI C;  1XGN A;  1YX3 A;  2ZNZ A;  1SFO J;  4QTR A;  5LGN A;  3AKZ A;  1GVJ A;  3ASO H;  2QQ8 A;  2X6X A;  5LGT A;  5GAE J;  3BR6 A;  1WHU A;  2HOA A;  2VBX A;  1O3S A;  2IGM A;  3ZRG A;  1KON A;  2Y69 H;  1A35 A;  2R7S A;  2YU3 A;  4N4N B;  3TW6 A;  1ZG3 A;  1LUJ B;  2IPQ X;  2WC2 A;  2R5Z B;  2K9M A;  2O03 A;  3O3K A;  3CES A;  3R0A A;  1O3Q A;  1E2X A;  1L0O C;  2XIG A;  2V1D A;  4X0G A;  3FXM A;  3JSP A;  2Y2Z A;  1Z7U A;  2P5L C;  4HNV A;  3KYL A;  1Z3Y A;  3WU2 C;  4CH7 A;  4LGW A;  4D0P A;  1I50 J;  3VB2 A;  1XMA A;  5JHF A;  4DW6 A;  2EA4 A;  2CV2 A;  3G1O A;  2DFH A;  4ZDL A;  2P6T A;  4ZYA A;  5F0F A;  2VQC A;  1YJW I;  3JR9 A;  2L9N A;  3F8B A;  3UR3 C;  4G7H F;  2LG4 A;  1YI2 I;  2ECC A;  3HIF A;  1HOM A;  1USS A;  3DLA A;  4XRM A;  3V8K A;  4BDY A;  3OYK A;  2HOS A;  3TW7 A;  1YQA A;  2WAD A;  4BQN A;  3R0J A;  1K61 A;  5GTH C;  2R0Q C;  4GYG A;  4CYC A;  5IYC J;  2VQL A;  5BPI A;  1WSU A;  1FIA A;  3OYJ A;  2GM4 A;  3PSI A;  3ERM A;  1ZR2 A;  1S8N A;  4A0Z A;  2X85 A;  2HVR A;  4GO1 A;  3ABL H;  3KP3 A;  4M73 A;  3CDH A;  3FKJ A;  1T0F A;  2Z2S B;  1G3T A;  3LNQ A;  3S1R J;  1U2W A;  3ASN H;  4GXO A;  4LK1 F;  2CW0 F;  2X51 A;  1IV8 A;  3JRH A;  4FQG A;  3ZQG A;  1ZKG A;  5M3M J;  2MC3 A;  3LWF A;  5BMZ A;  5FKL A;  2Y0S A;  2D1V A;  2VXD A;  4UUT A;  1XSV A;  2PI0 A;  3GVA A;  2XAG A;  4I98 B;  5H6R A;  1QHH D;  1G3S A;  3U9G A;  4I99 C;  2JZY A;  2LFB A;  3HOX J;  2OTJ I;  1V5G A;  3CLQ A;  2TDX A;  1JT0 A;  3VOE A;  2QVO A;  1YS7 A;  2X1C A;  4EJW A;  3HSF A;  1FEX A;  3CCY A;  2CUZ A;  4OU0 A;  3HOW J;  3ZGK A;  5E17 F;  1Y8R B;  2FML A;  2KPM A;  2CUF A;  2HFH A;  4ZDP A;  2R7O A;  1XTA A;  5FRM A;  1POG A;  2CU7 A;  4AID A;  5JVG F;  1HC8 A;  4CYD A;  1RET A;  1SD7 A;  3I0T A;  3N97 A;  4KNY A;  2X0L A;  2DLL A;  1YRN B;  2ZXJ A;  3V8L A;  4XBF A;  1QPM A;  2YU9 J;  2HYF A;  4YEL A;  1OKR A;  4A2U A;  2DMU A;  4Q5S F;  4I2O A;  5KVR A;  2HI3 A;  5HOD A;  5C3E J;  1R58 A;  3KP4 A;  1F5T A;  5FFX A;  4IQ4 A;  2LMD A;  5FKN A;  5JFR A;  4YFX F;  2X1E A;  2CO5 A;  4CCO A;  4ON0 A;  3HOV J;  4JP0 A;  3I58 A;  3PFI A;  1VQ7 I;  4E7I A;  3SZT A;  4C2M J;  1VTN C;  2HVS A;  4IL6 C;  1ENH A;  2RNJ A;  5EGO B;  1UJ8 A;  2DJI A;  1H89 C;  2MAB A;  3QP6 A;  3FIS A;  1VQM I;  2XDV A;  2IGK A;  5BS6 A;  4HF0 A;  2LH9 A;  3AAF A;  4HPQ A;  1YIT I;  1YJN I;  3LA3 A;  3CCL I;  1JTX A;  2EFP A;  2IA1 A;  4UVA A;  3BDD A;  1U6G A;  1KQ0 A;  5HS8 A;  4YFK F;  5J4Y A;  2FBK A;  3KP2 A;  4ZJZ A;  2EQR A;  3EUA A;  3G3Z A;  2JQ7 A;  3F8C A;  3E6C C;  4NBQ A;  1OMI A;  1RKW A;  1GDT A;  2MBF A;  4FTH A;  3DKW A;  1ODD A;  2DT7 B;  1ETV A;  5E1Z B;  4EM0 B;  1BBY A;  1KZH A;  2XGE A;  3FMR A;  5DD4 A;  1XDS A;  2DMT A;  3BZK A;  1LVK A;  4II2 A;  1DQU A;  3F6V A;  3LSH A;  3FMQ A;  3A0B C;  1R71 A;  1QZE A;  2UZK A;  4JX6 A;  2W24 A;  1VI0 A;  3LMM A;  1T8I A;  2YX4 A;  5H2F C;  4KT5 C;  2V26 A;  2E1M C;  2OAZ A;  2P4W A;  2W82 A;  3GTK J;  2VUM J;  1J75 A;  1H9T A;  3NAR A;  2R5Y B;  1DU0 A;  3BJ6 A;  3CC4 I;  3HBL A;  4R79 A;  2IS2 A;  2E2H J;  1BW6 A;  4A12 A;  1J59 A;  1EJ9 A;  2FRH A;  5LEJ A;  1D1A A;  1VQ4 I;  4CHU A;  5FLV A;  2W4S A;  3RJP A;  2M9H A;  2QA4 I;  4WWC A;  4CGZ A;  4E7J A;  2DDA A;  2HKX A;  2GAU A;  5ICG A;  1STZ A;  1FX7 A;  4PFO A;  2H1K A;  5K5O A;  3I9V 2;  2PMU A;  2DCE A;  1PP7 U;  1XCV A;  3QU3 A;  1LFU P;  4IRG A;  4D5F A;  2A07 F;  4G8X A;  2ZFU A;  4EM1 A;  4XN0 A;  5JLX A;  2V6E A;  3ECH A;  3IC7 A;  1LE8 A;  3QYE A;  3J81 Z;  4RGR A;  5LD2 C;  1B4A A;  2J5O A;  5FRN A;  2BHY A;  4PJN A;  1MJA A;  5TJJ A;  5CQE A;  3IRQ A;  4AIJ A;  2QF7 A;  4I6Z A;  3GUD A;  2DT6 A;  2HQA A;  2BVL A;  3A02 A;  4Q48 A;  2TCT A;  4M3F A;  4AWX B;  5F0H A;  1Q1H A;  1CQT A;  4N9I A;  1S7O A;  2XC7 A;  3J7Z I;  3PO3 J;  4S04 A;  4AYB A;  3ULQ B;  2RRE A;  3ZN0 A;  3GZN B;  2EFN A;  3ESW B;  3ZOB A;  2MH9 A;  4HV5 A;  5EJC A;  3M4O J;  1XDU A;  2P0W A;  3G1M A;  4WXH A;  4LB6 B;  4I76 A;  4JQF A;  4XLP F;  2O3F A;  3GO5 A;  5ERI A;  4F92 B;  4IHX A;  1D1C A;  1OLT A;  4MQ9 F;  1P92 A;  3TKY A;  1IRG A;  3DTI A;  1MND A;  4BHP A;  4MIM A;  1JT6 A;  3HOS A;  4MEY F;  3O2P E;  3TDZ C;  3KZI C;  1XX5 A;  3H3V K;  2JA2 A;  3GEZ A;  3DPL C;  4D7M A;  2BZT A;  1QHG A;  4ZYE A;  4XRS G;  1DGW Y;  1K7A A;  4N4O B;  4L9T A;  1HLV A;  2XB0 X;  2XV4 S;  1IW7 F;  2F4O B;  2V79 A;  2V9V A;  3AL0 C;  5F0C A;  4QSH A;  2XAU A;  2W84 A;  3MWM A;  3VWB A;  4NC7 A;  4F3Q A;  2BE5 F;  3MKZ A;  3S3O A;  1GLN A;  1OR7 C;  1T6S A;  5J6X A;  1HW5 A;  2LKP A;  1RI7 A;  5E3N A;  1K78 A;  5GPA A;  2A69 F;  1QA6 A;  4L5E A;  3W2V A;  4XN3 A;  2JN6 A;  1QZY A;  3AFH A;  2R7W A;  2UUZ A;  4Y7N J;  5E79 C;  2F5E A;  2XGC A;  3P9I A;  4CDG A;  1MD0 A;  1VQ9 I;  2OUM A;  4FIS A;  2IJL A;  3K4J A;  3OOU A;  1R9T J;  1Y1W J;  1IAW A;  2STT A;  3ZQI A;  2YS9 A;  1JJ6 C;  1GXP A;  2NS0 A;  2XAS A;  5LRR A;  1XGS A;  3CP8 A;  1FTZ A;  4IHW A;  1TZL A;  3W6J B;  2LC2 A;  2PG4 A;  4AC0 A;  1S5L C;  1MGT A;  3RI4 A;  2OC6 A;  3SJM A;  1W5S A;  2GA2 A;  3VPR A;  3HKZ A;  4K2E A;  2DXI A;  2NVU B;  1W4M A;  1LDK B;  2FA5 A;  3EUH C;  2IP2 A;  4U7D A;  2HTJ A;  4RAY A;  4BJ6 C;  1MBJ A;  4HSR A;  2NNN A;  3QOP A;  2Z9O A;  4GCV A;  2XPV A;  2DK5 A;  4IJA A;  1UHS A;  3VOD A;  3FHN A;  2GBY A;  2MD5 A;  1T98 A;  1IXS B;  1R00 A;  2W1O A;  3VFZ A;  1U5T B;  1F9N A;  3IP4 B;  2M7B A;  4E4H A;  1IN8 A;  3CP2 A;  3ZR8 X;  4ZYG A;  1SD4 A;  3AG4 H;  2OPT A;  2A6E F;  2JA5 J;  3HTS B;  3M8J A;  2DDB A;  4YIR X;  1BJA A;  1KU3 A;  1N75 A;  2RQQ A;  4F93 B;  2E19 A;  3HOU J;  2XSJ C;  1BL0 A;  2GXB A;  2ZCW A;  2LLK A;  2DTZ A;  2WAF A;  3LST A;  5J3L A;  2O8K A;  1BOA A;  2ICW G;  5GAH J;  3UKG A;  5FLM J;  1FOK A;  3A03 A;  5C4J J;  4HEA 2;  3BRO A;  2NS8 A;  4TV7 A;  1OR7 A;  4ETS A;  1NTC A;  2BYV E;  3OYN A;  1HDD C;  5FFZ A;  1ZAO A;  2XPW A;  2QEX I;  1B9M A;  3QP5 A;  2CYY A;  1SC7 A;  2NOG A;  4FX0 A;  4PSX A;  1ETY A;  4XIC A;  4CCK A;  1U3E M;  3TO7 A;  3LSI A;  4LG3 A;  4J00 A;  1U78 A;  3H3U A;  1XB4 A;  1X1D A;  5FB2 A;  3L2U A;  2FUG 2;  3BT9 A;  4V19 K;  1MDM A;  5E3O A;  2F2E A;  3FXO A;  2EJR A;  2DA3 A;  4M3B A;  2A5W A;  4M9X A;  2QKM B;  3L2R A;  1T0F C;  4XL9 A;  5L3B A;  3K10 A; 
#chains in the Genus database with same CATH homology
 1JTY A;  4M3D A;  2OF7 A;  3H0G J;  4MO7 A;  2HOT A;  4S0H B;  2R93 J;  1WI3 A;  2Y31 A;  5J1R A;  3BG9 A;  3LOC A;  2X9D A;  3HKZ N;  4B3A A;  3K7A J;  2XB5 A;  1IDZ A;  4ABZ A;  5IP9 J;  3Q0V A;  3O8H A;  4BY7 J;  1JUS A;  1MSF C;  4A3M J;  5FKM A;  3RQI A;  2MGQ A;  1HF0 A;  4LOC A;  2LR8 A;  2NS7 A;  3HOY J;  1AKH A;  3S14 J;  1ETO A;  3TED A;  1B8I B;  1TC3 C;  1JGG A;  1JKR C;  4CYC B;  1OFC X;  2HQ5 A;  1A6I A;  2DMN A;  2O7O A;  3HM5 A;  1OJL A;  1G2H A;  1AHD P;  2IAI A;  3ZQH A;  4J19 A;  1AKH B;  2AHQ A;  2ZB9 A;  1ORK A;  5M5Y J;  1JKO C;  2K9S A;  2EZL A;  1H88 C;  1FJL A;  1X58 A;  3RKQ A;  1D5Y A;  1SFO J;  4QTR A;  3S17 J;  1MNM C;  3BR6 A;  5EZH A;  2HOA A;  1VFC A;  5FKK A;  4A3I J;  4FCY A;  1X2N A;  3SFI A;  2HDD A;  3MVP A;  3GTO J;  3TW6 A;  3GTG J;  1IDY A;  3GTQ J;  1ETQ A;  2R5Z B;  5F04 A;  4A3D J;  4MFD A;  4BY1 J;  2ECB A;  1A5J A;  2Y2Z A;  5FKO A;  5EF6 A;  4HNV A;  2VKE A;  2ELK A;  5K7Z A;  1I50 J;  3GTL J;  4XRS A;  4DW6 A;  9ANT A;  4A69 C;  2E2J J;  3E7L A;  3G1O A;  5F1J A;  2CUE A;  5F0F A;  5C4X J;  2WB1 N;  2LVS A;  5M5X J;  1QRY A;  3JR9 A;  4MFE A;  4A3G J;  2ID3 A;  2JWT A;  2ECC A;  1HDP A;  3LSG A;  1HOM A;  2Y9Z A;  3TP0 A;  1ETW A;  1ETX A;  4NDL A;  4XRM A;  2K9Q A;  3S1M J;  1U9N A;  2HOS A;  4A3K J;  3TW7 A;  2CQX A;  2G0E A;  3B6C A;  4A3C J;  1K61 A;  3BQZ A;  4G12 A;  4BBR J;  2R0Q C;  4CYC A;  4DYR A;  5IYC J;  2GLO A;  4JYK A;  1JKQ C;  1H8A C;  3BR0 A;  1XC5 A;  2WV1 A;  5J1Y A;  2K40 A;  1FIA A;  2GM4 A;  3O8G A;  4B1R A;  1WCM J;  1ZR2 A;  2E2I J;  4JX4 A;  4DYQ A;  1ITY A;  2R7Z J;  3OSG A;  2PMZ N;  2L0K A;  1LE8 B;  2KDZ A;  5GP9 A;  4IEJ A;  4C3H J;  1P7J A;  3LNQ A;  2D5V A;  1F43 A;  3S1R J;  2M0C A;  5DS9 A;  4BBS J;  5IP6 A;  1TWG J;  2Y0S N;  3JRH A;  3ZQG A;  1ZKG A;  5M3M J;  1RKT A;  4C3J J;  5FKL A;  5IOZ A;  4UUT A;  2NVX J;  2H8R A;  3D1N I;  2DA2 A;  1P7I A;  3ZQF A;  4GFB A;  3OIO A;  1F36 A;  2LFB A;  3HOX J;  3GTP J;  2DA6 A;  3WHC A;  1JT0 A;  1WH5 A;  4B4C A;  1FEX A;  3CCY A;  1W0U A;  4MLO A;  3HOW J;  4C3I J;  2CUF A;  1MBK A;  1POG A;  2CU7 A;  2JMW A;  5EG0 A;  1RET A;  3RZD J;  1EF4 A;  5IYD J;  2L7M P;  1I3Q J;  1YRN B;  5EDN A;  1JJ8 C;  4V2F A;  2YU9 J;  3Q0W A;  2FX0 A;  1MH3 A;  2DMU A;  2HI3 A;  5K7F A;  5HOD A;  1BJZ A;  5C3E J;  1IGN A;  2DA7 A;  5FKN A;  1PUF A;  3GBG A;  3HGG A;  3SDG A;  4A3J J;  4UUS A;  3LSJ A;  3HOV J;  4JP0 A;  3BTL A;  2N8G A;  3I4N J;  3JRD A;  1T56 A;  2R92 J;  3BR3 A;  1LFB A;  2DA4 A;  4C2M J;  1ENH A;  2MW8 A;  1Z0X A;  4Y52 J;  5EGO B;  2E1O A;  1IV6 A;  1H89 C;  3JRB A;  3FIS A;  1MBG A;  4A3B J;  2X48 A;  1UG2 A;  3MKL A;  1DU6 A;  4RBO A;  1B72 A;  1AU7 A;  1JTX A;  3DCF A;  3S1Q J;  3A01 B;  2O9L A;  2LY9 A;  2EBI A;  2RAE A;  2JJ7 A;  2EQR A;  2JA6 J;  3BR1 A;  2DA5 A;  4V2G A;  1MH4 A;  2P81 A;  2EZH A;  1RKW A;  5IPA A;  3HDD A;  1GDT A;  2DMQ A;  4FTH A;  4D5C A;  5IP7 J;  3I4M J;  2R5Z A;  3BQY A;  1ETV A;  4BKX A;  2XSD C;  3ZQC A;  1PUF B;  2XGE A;  1WH7 A;  2DMT A;  1BA5 A;  1BW5 A;  2R5Y A;  1GT0 C;  2AO9 A;  4M3G A;  1VND A;  1XS9 A;  3RZO J;  4JX6 A;  1XG1 A;  1VI0 A;  3DEW A;  3IH3 A;  1ETK A;  1X2M A;  1I6H J;  1YRN A;  5IYB J;  1TWH J;  3LSP A;  4BXX J;  2MG4 A;  3GTK J;  3OSF A;  2VUM J;  3NAR A;  3LSR A;  2LK2 A;  2R5Y B;  1DU0 A;  3HBL A;  5EZG A;  2NVQ J;  2E2H J;  1VF9 A;  2YUS A;  1BW6 A;  3BR2 A;  5FLV A;  4DYC A;  3BTI A;  4EEF G;  2M9H A;  3HB9 A;  1ZGW A;  5EYR A;  2DA1 A;  2FD5 A;  1JUP A;  3W6V A;  2LP0 A;  4IHV A;  1Z77 A;  5EG0 B;  2H1K A;  1UMQ A;  5GPC A;  2X6O A;  1ZQ3 P;  1LFU P;  4D5F A;  4M3E A;  2M2E A;  1ZTR A;  3BG5 A;  5JLX A;  3L1P A;  1S7E A;  4FE4 A;  4JX5 A;  1LE8 A;  2NVT J;  3CMY A;  2DJN A;  3IH4 A;  4XID A;  3NAU A;  2XPU A;  4A3F J;  4UUS B;  2QF7 A;  4I6Z A;  1IJW C;  3A02 A;  2TCT A;  4M3F A;  1ZK8 A;  5F0H A;  1CQT A;  4IHY A;  2Y9Y A;  5F08 A;  2CJJ A;  3PO3 J;  2L9R A;  2XGD A;  4RDU A;  3GTJ J;  3HGY A;  5EEA A;  2K9N A;  3ZOB A;  3IV5 A;  3A01 A;  2HXO A;  4A3E J;  3M4O J;  3G1M A;  3JRG A;  4I76 A;  4IHX A;  1U8B A;  2QCO A;  1IG7 A;  1MBH A;  2FJ1 A;  1RES A;  3CDL A;  4MIM A;  1JT6 A;  1RR7 A;  2CQQ A;  4X1E A;  2B63 J;  3F0C A;  3FK7 A;  1RPW A;  2HXI A;  2LKX A;  3H3V K;  2I10 A;  2WAQ N;  5K7H A;  3IH2 A;  3S16 J;  1APL C;  4D7M A;  5EGO A;  2VKV A;  4A93 J;  4XRS G;  1MSE C;  2EZI A;  1HLV A;  2XB0 X;  2CRG A;  4DZP A;  3S1N J;  5C44 J;  5E3M A;  1JUM A;  5F0C A;  4QSH A;  1OCP A;  2LD5 A;  1GVD A;  2ME6 A;  5DTD A;  3MN2 A;  5E3N A;  3M3Y J;  5GPA A;  4L5E A;  1W0T A;  3HEF A;  2JN6 A;  1Q1V A;  4D7N A;  2M8G X;  3QPS A;  4Y7N J;  2XGC A;  3JRA A;  3ZQL A;  2JK3 A;  4FIS A;  3OOU A;  1IC8 A;  1IRZ A;  5M5W J;  1R9T J;  5J1U A;  1Y1W J;  3BTC A;  3ZQI A;  3JRI A;  2YS9 A;  1JJ6 C;  1FTZ A;  4IHW A;  5IOY A;  4AC0 A;  4W97 A;  3HOZ J;  1TWC J;  1TWA J;  3WHB A;  3JRF A;  3SJM A;  3VPR A;  1IUF A;  4FE7 A;  1QPI A;  3QQA A;  1QVU A;  1SAN A;  2DMP A;  4DZJ A;  3GTM J;  5E3L A;  2ME0 A;  1MBJ A;  5FJ8 J;  4XK4 A;  1FIP A;  1JKP C;  1Y1V J;  1K83 J;  3K2A A;  2XPV A;  1O4X A;  3S2H J;  1UHS A;  3CQZ J;  2GBY A;  2JA8 J;  3JRC A;  3BTJ A;  4W1U A;  1B72 B;  4AYB N;  1E3O C;  2XRL A;  4X6A J;  3FK6 A;  3Q0U A;  2COB A;  2VPR A;  3S15 J;  3PO2 J;  2NVY J;  1T33 A;  2LTP A;  2L7F P;  2OPT A;  3FKI J;  1B8I A;  2JA5 J;  1NK2 P;  5BNG A;  5F27 A;  2M34 A;  2DN0 A;  5JLW A;  4A3L J;  2JA7 J;  3PM1 A;  3BG3 A;  2E19 A;  2MSY A;  1TWF J;  3HOU J;  1GUU A;  2ID6 A;  2IBD A;  1ZR4 A;  1BL0 A;  1MBF A;  2LLK A;  2DTZ A;  3C2B A;  5J3L A;  1GV5 A;  2O8K A;  3UKG A;  1FTT A;  5FLM J;  3A03 A;  3QPL A;  3TP3 A;  2KT0 A;  5C4J J;  2Y30 A;  5M3F J;  2NS8 A;  2FQ4 A;  1NTC A;  1HDD C;  1QVT A;  2XPW A;  1NK3 P;  4M6V A;  2NOG A;  1ETY A;  4XIC A;  1WGX A;  3G1L A;  3S2D J;  3JRE A;  1U78 A;  2TRT A;  1HCR A;  1U9O A;  3BT9 A;  3B6A A;  1OCT C;  1WPK A;  2W48 A;  2EH3 A;  5E3O A;  2IEK A;  2EZK A;  2HYJ A;  2DA3 A;  4QIW N;  4M3B A;  2VI6 A;  3BR5 A;  3FIW A;  1MBE A;  1GV2 A;  2L7Z A;  3Q3S A;  4AUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...