2Y0SN

Crystal structure of sulfolobus shibatae rna polymerase in p21 space group
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
64
structure length
64
Chain Sequence
MMIPIRCFTCGSLIADKWQPFITRVNAGENPGKVLDDLGVKRYCCRRMLLSHIDIISEVIHYTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
pubmed doi rcsb
total genus 13
structure length 64
sequence length 64
chains with identical sequence O
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2010-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y0sN00
2K9SA 1SFOJ 1UG2A 1U78A 1OFCX 2K40A 2O8KA 4GFBA 3PM1A 4EEFG 1O4XA 3QPLA 3JREA 2N8GA 2OF7A 5F08A 1HDDC 2VUMJ 3ZOBA 3M4OJ 1JTXA 2XGCA 2LLKA 4AUXA 2R93J 1RKWA 1MBHA 4I6ZA 1JJ6C 2KDZA 4M3FA 1LFUP 5JLWA 1ZGWA 3BR1A 1PUFB 3IH4A 2JN6A 3HOXJ 2YUSA 3G1OA 2L0KA 1IG7A 3G1MA 3S1MJ 4A3DJ 5F27A 3IH3A 1VF9A 3D1NI 5IOYA 4MLOA 4FE7A 2DMQA 3W6VA 3ZQHA 5E3LA 1ETXA 5J1YA 2GM4A 3HBLA 4AYBN 3SJMA 3O8GA 3GTJJ 1HDPA 1B8IB 3GTKJ 1JT6A 1ZR4A 3BR6A 2EZLA 4CYCA 3O8HA 3S16J 3S2DJ 2LTPA 5IP7J 4FTHA 2DA4A 5EEAA 5HODA 1WPKA 4FCYA 2TRTA 3BR3A 1AKHA 2JWTA 1ZKGA 2JJ7A 1Z0XA 3K7AJ 2JA5J 1A6IA 2CUFA 1K61A 2WB1N 4I76A 1ORKA 4MO7A 2L9RA 4BKXA 4XK4A 4BBRJ 1E3OC 5EZHA 2DMPA 2R5YA 2O7OA 3GTMJ 1WH7A 4RDUA 3JRGA 1JKOC 1FJLA 4A3BJ 5IYBJ 1Y1VJ 3HOYJ 4XRSG 1GT0C 4S0HB 2M0CA 1G2HA 4IHWA 1MBGA 3FIWA 4FE4A 3HB9A 2HOSA 1MH4A 3BTCA 4DYRA 3RQIA 1YRNB 5EF6A 2ME0A 1MH3A 3BTJA 3DCFA 3RZDJ 1X2NA 2IBDA 3BT9A 1JUMA 3GTGJ 3DEWA 5E3MA 2IEKA 1HCRA 2WAQN 1IC8A 2P81A 2Y9ZA 2R92J 4DW6A 3BR5A 4A3IJ 1RPWA 2LKXA 1APLC 3JRHA 4M6VA 1W0TA 4MFEA 1JUPA 3I4NJ 5IPAA 1X2MA 3G1LA 3ZQIA 3B6AA 2K9NA 1P7JA 3JRAA 2CUEA 1BL0A 3MN2A 2FJ1A 1MSFC 1TC3C 3HOWJ 2QF7A 1MNMC 1ETKA 2DTZA 4DYCA 4M3GA 2FX0A 2Y2ZA 4IHXA 1GV2A 9ANTA 1GDTA 3BG3A 4C3JJ 4BXXJ 2B63J 2XRLA 2CRGA 1TWGJ 4Y7NJ 1U9OA 2W48A 1DU0A 2VPRA 5BNGA 3WHBA 2Y30A 3E7LA 2TCTA 4D7MA 4IHYA 2LK2A 3CQZJ 5F0CA 4M3BA 5EYRA 1HF0A 1B72A 1ETQA 1QRYA 2VI6A 2LD5A 4IEJA 1ETVA 1NK2P 3FK6A 3BG5A 3A01A 1PUFA 2L7MP 5FKNA 1LE8B 1HOMA 3LNQA 2CQQA 3PO3J 5FKMA 2WV1A 1BW5A 2HDDA 3TP3A 2E19A 1D5YA 2Y31A 1Q1VA 3JR9A 1RKTA 2XPVA 4AC0A 1QPIA 1BW6A 4XIDA 3ZQCA 1XS9A 2ID3A 3IV5A 4ABZA 3OSFA 1JJ8C 4A3GJ 3GTLJ 5GPCA 2DJNA 1AHDP 4A93J 4BBSJ 1GV5A 4DZPA 2HOAA 2COBA 2NVXJ 2PMZN 4QTRA 1JKPC 5M3MJ 1ZR2A 2M34A 4B3AA 2LFBA 4XRMA 4X6AJ 1Z77A 1LFBA 3BR2A 5EGOA 3QQAA 3HGYA 1S7EA 1QVUA 2EQRA 1XG1A 2DA7A 4CYCB 4V2GA 5EDNA 4NDLA 3SDGA 1HLVA 1ZK8A 3Q0UA 4D5FA 3ZQFA 2O9LA 4A3MJ 3NAUA 3HOUJ 2JMWA 1AKHB 2NVQJ 1SANA 2YU9J 1MBFA 1JTYA 2R5ZB 1ZQ3P 5C3EJ 1P7IA 3LSGA 1JT0A 1MBKA 2ELKA 5K7ZA 2D5VA 1JGGA 2R5YB 3S2HJ 4W97A 4HNVA 3ZQGA 1IJWC 1YRNA 5FJ8J 3M3YJ 1WH5A 4QSHA 2E2JJ 1IDYA 5IYDJ 3HEFA 4B4CA 3S1NJ 4UUTA 1MSEC 2IAIA 5J1RA 1OJLA 4J19A 4UUSB 2L7ZA 4D5CA 3MVPA 2XGEA 1TWCJ 2EH3A 3C2BA 4M3EA 3CMYA 2MW8A 3TP0A 3A03A 3RZOJ 5IYCJ 3BR0A 2E1OA 5M5YJ 3TEDA 2VKEA 1CQTA 2XB5A 1IV6A 3S14J 5EG0A 5FLMJ 1ETOA 1FIPA 5FLVA 1TWFJ 2NVYJ 3HM5A 2G0EA 2DMUA 3IH2A 3QPSA 2MSYA 3SFIA 5K7HA 3FISA 3VPRA 5E3OA 2ZB9A 5GPAA 2DA6A 3JRCA 3PO2J 2EZKA 2I10A 3GBGA 2K9QA 1QVTA 4A3EJ 1VNDA 5J3LA 1OCPA 4C3IJ 4BY7J 1W0UA 4A3LJ 2ID6A 1IUFA 1I6HJ 4D7NA 2DA3A 4G12A 3MKLA 5E3NA 4A3JJ 2FD5A 3RKQA 4A3KJ 4JX5A 3FK7A 5M3FJ 2CU7A 1IRZA 5J1UA 1H89C 3L1PA 3HOZJ 2E2IJ 1JKQC 2XPWA 1H88C 3S1QJ 5FKKA 3F0CA 3OSGA 1LE8A 3HOVJ 3HDDA 1B72B 5F04A 2AHQA 5IP6A 1IGNA 1T33A 1POGA 2MGQA 3A01B 3JRDA 4JX4A 1R9TJ 1GUUA 3B6CA 1U8BA 3OOUA 1RR7A 5GP9A 1ENHA 1B8IA 3TW7A 2CQXA 3H0GJ 1I3QJ 3Q3SA 4MFDA 4MIMA 2JA7J 2NS8A 3FKIJ 3A02A 5C4JJ 3H3VK 3BQYA 5JLXA 1OCTC 5IOZA 2XB0X 3LSJA 2H1KA 2JA6J 4Y52J 1VI0A 2NOGA 2LR8A 1DU6A 1Y1WJ 4M3DA 3JRBA 3GTPJ 4QIWN 4LOCA 1UMQA 2QCOA 5FKLA 2GLOA 1FTTA 3NARA 5C4XJ 3ZQLA 3LOCA 1UHSA 2EBIA 1MBEA 4RBOA 5EGOB 2HYJA 2XGDA 1FIAA 5FKOA 4L5EA 4A3FJ 2R5ZA 2DA1A 5F0HA 2HQ5A 2X6OA 1RETA 5M5WJ 3HGGA 2HXIA 3LSPA 3JRIA 2LY9A 1RESA 2HOTA 2JK3A 2CJJA 4C3HJ 1GVDA 2R0QC 2HI3A 4W1UA 2MG4A 1MBJA 2DMTA 2VKVA 1AU7A 5IP9J 1TWHJ 2E2HJ 4DZJA 2NS7A 2JA8J 4JX6A 3BG9A 4XRSA 4B1RA 2L7FP 4JYKA 1WGXA 3BTIA 4A69C 2YS9A 4X1EA 4UUSA 1FTZA 1ETWA 1U9NA 3GTOJ 2RAEA 1FEXA 1JKRC 2M2EA 1IDZA 2X48A 2Y0SN 2LP0A 2HXOA 1K83J 2M8GX 2NVTJ 4FISA 2R7ZJ 5C44J 2KT0A 2DN0A 3S15J 2OPTA 3BQZA 2AO9A 3WHCA 2FQ4A 5F1JA 1EF4A 1F36A 5M5XJ 2XSDC 2ECBA 5DTDA 2DA5A 2M9HA 5F0FA 1WCMJ 1H8AC 2ME6A 4IHVA 1BJZA 2H8RA 3I4MJ 1I50J 1F43A 1ZTRA 3CCYA 2DA2A 3Q0VA 5EZGA 4A3CJ 3K2AA 3Q0WA 3TW6A 4BY1J 3S17J 4DYQA 2EZHA 3BTLA 4JP0A 5EG0B 2XPUA 4XICA 3JRFA 3OIOA 3S1RJ 1VFCA 1TWAJ 4C2MJ 2EZIA 5DS9A 1X58A 2LVSA 1ETYA 1A5JA 3HKZN 2X9DA 2Y9YA 1T56A 1XC5A 2ECCA 3LSRA 1NK3P 1BA5A 3CDLA 1JUSA 1WI3A 5K7FA 1ITYA 2DMNA 3GTQJ 3UKGA 2GBYA 1NTCA 4V2FA
chains in the Genus database with same CATH superfamily
4CZZA 2K9SA 1SFOJ 1OFCX 3MKYB 4WF2A 4BQNA 1O4XA 1D3YA 5F08A 1HDDC 3W2AA 3TO6A 3WE3A 2ISZA 2VUMJ 1MMSA 4LLNA 2E7XA 2EFQA 2R93J 2VT3A 2Z16A 2KDZA 4M3FA 3BWGA 1LFUP 3ABUA 5TGTA 3VYSB 5JLWA 1ON2A 1ZGWA 2KP6A 4Y15A 1FX7A 3HOXJ 1XGSA 2W25A 4MQ9F 4Y33A 3TKYA 3FMRA 2YUSA 3G1OA 3AG4H 3D0SA 1WHUA 4BJ5C 1IG7A 3S1MJ 1J5YA 5CYVA 4CCLA 3FX3A 5FRMA 3HSFA 5F27A 4ZYEA 2CV0A 1VF9A 4RAYA 3HRMA 1F9NA 1MW7A 4FT8A 4HF1A 3KE2A 4EVIA 3BPXA 5J6XA 3HIFA 3W6VA 1AOYA 1PYVA 3HHGA 1XPXA 2IGMA 3HBLA 4AYBN 3ULQB 3MFKA 2B9SA 1KU3A 1JT6A 2PQ8A 4YELA 4KIGA 2V9VA 2VXDA 2XIGA 1YG2A 2O5RA 3DXJF 3OYHA 2LTPA 4M72A 5IP7J 3ZMTA 2KZVA 4U7BA 4OU0A 5HODA 3ZQQA 2RQPA 3J81K 4FCYA 2TRTA 4L9NA 4JK1X 4BAYA 1G3TA 4KMFA 1S3JA 1DGWY 3GZNB 1BIBA 3K4KA 2FNAA 1MMNA 3B73A 1PP8F 3OYNA 1O57A 5DEQA 3OYAA 2YPRA 2L9RA 2QBYA 3HKZA 1G8XA 4RM2A 4BBRJ 4LG0B 3VYTB 1WH7A 2X6XA 2MFZA 5LFAA 2M45A 1O3TA 2R7VA 3JRGA 2F5VA 1JKOC 1A36A 5TISC 4A3BJ 4E4HA 1Y1VJ 2RGVA 4EM2A 2ZNZA 3KCCA 1WRJA 2KRFA 3H9QA 3ZMVA 4XRSG 1YO5C 1GT0C 3I59B 4PDKA 4II2A 2HOSA 1MH4A 1W7PB 3HPGA 3L00A 2VQHA 1YRNB 1TQIA 5CKTA 5HS8A 3G71I 4ENKA 3FXKA 5DD4A 2A6TA 2ACJA 4D1QA 1LKXA 5E3MA 2H1LA 1FWZA 1U2WA 3D5SC 2P81A 1QGPA 4PJ0C 1FNNA 3QOPA 3UNGC 2L54A 4E7JA 3WODF 3K70D 3GZ5A 1RPWA 2QKMB 4Y4RA 3L2WA 2ZC2A 1YJWI 4WXCA 4MFEA 2HKOA 2XKPA 3I4NJ 5D8KB 4NNJA 4CYDA 5LHGA 1X2MA 3T8RA 2BY2A 5DCMB 3KYDB 4BHCA 1MSFC 3CTAA 3LSIA 1ZGAA 4PCQA 3DU5A 1MNMC 1ETKA 2NVUB 2DTZA 4E7IA 4DYCA 2F4IA 4UV8A 5K5OA 3CJRB 2VKHA 1R49A 2FX0A 1GV2A 2A68F 2Y75A 4QPOA 9ANTA 4C3JJ 3K4MA 2B63J 2XRLA 4ZYGA 3H1CA 3RJPA 3M7GA 1FBUA 2CRGA 1GVJA 2W48A 2WB1A 2XRNA 5HLTA 2QQBA 1ODDA 4D7MA 3DV8A 2CH0A 2HYGD 3LWFA 4FQGA 5F0CA 4IRGA 4IPAA 3MZHA 1TBXA 3G73A 1B72A 4OIQF 4ZYHA 1XGOA 2OU2A 3HTSB 2BGCA 3JAMK 2LD5A 1IN6A 2V9KA 4ZYDA 4F55A 3CMAI 2ELHA 4Y13A 3NQOA 2IGNA 2L7MP 1LE8B 2C6YA 1FP2A 3IRQA 3CD6I 4LIVA 1ZH5A 3PO3J 5FKMA 4GGGA 2KIFA 2HNHA 2RDPA 4A5MA 3OYCA 3TP3A 2E19A 4HQMA 5LGNA 3OS1A 2DTRA 2Y31A 1RKTA 2XAGA 4M9SA 1BW6A 1XS9A 3FBIB 3FXQA 2DFHA 1JJ8C 4A3GJ 2WAQA 3GVAA 1OYYA 3CC4I 1IV8A 2GOMA 2MYSA 5LGTA 3CCLI 3E5QA 2X85A 3OV8A 1GV5A 2DFEA 2COBA 2NVXJ 2FBHA 2OV7A 5L3GA 2MH2A 4QTRA 2OC6A 2QQ9A 2A3SA 3EYIA 2RKHA 1EA3A 3NWSA 3F8BA 4X6AJ 4ZYAA 3DF8A 1EV7A 4YRVA 2IGKA 1O3QA 1S7EA 3HC7A 2DA7A 4GDFA 2YSRA 4CYCB 3J7AO 2VT2A 4V2GA 2DT6A 1YX5A 2QSFX 3CUQC 4DIQA 5J4VA 1O7FA 2ZJQF 3Q0UA 1FY7A 3GCMA 4IQJA 5DM6F 5KNLA 3JCUC 4M71A 1SD4A 5JI6A 2BY3A 5C3EJ 4E7HA 1YS7A 1P7IA 2P8TA 3LSGA 1T2KA 2ELKA 2K27A 3K2ZA 1S7OA 1S9HA 3S2HJ 3S3OA 4W97A 2ZJRF 3IP4B 4ESBA 1YRNA 2VODA 2M3AA 5EEHA 1FPQA 4F52A 5FJ8J 3K4LA 4ITVA 3AG3H 5B3SH 4A2UA 1D8KA 2P6SA 2R7RA 3HEFA 3S1NJ 3DBLB 2YX7A 3LQRA 4C30A 3SDBA 2IAIA 2GXAA 1EH7A 5JHUA 1OJLA 3PUBA 4G9YA 4UUSB 2IA0A 3N05A 5DM7F 2L7ZA 3S3MA 1TWCJ 2KIMA 5DUKA 2EH3A 1KYZA 2MC3A 3GXOA 1PJRA 4XKVA 3CMEI 3AKZA 3FM3A 3TP0A 1TW3A 4DBRA 2RN7A 3CC2I 4E7SA 2E1OA 4PJJA 1T0FC 2LKSA 3OYFA 2DPUA 1SVMA 3V7RA 1VQMI 1XMKA 3GMEA 1YYVA 1IV6A 5DCMA 3S14J 5FLMJ 2AS5F 4J00A 1ETOA 2E71A 3F8FA 4FX4A 1HW1A 3F3XA 4YIIA 4ASNA 5FLVA 3F22A 4P96A 2GXBA 2G0EA 2XHKA 3PQJA 3QPSA 2MSYA 3FISA 3PO2J 3TOBA 1U5TB 1FOWA 3GBGA 3QYFA 1I39A 5AIPA 3KYCB 2KRHA 3BROA 4P9UA 2A5WA 5E79C 1OYIA 1QNTA 4H4KC 4IOCF 2KLOA 5J3LA 4C3IJ 5LEKA 3E5UA 3C7JA 2V6CA 4A3LJ 2A6HF 1I6HJ 1GHCA 2VOOA 2DA3A 4G12A 3J81Z 4A5NA 4RAGA 1XDUA 3TBIA 2BY0A 4GRIA 2BY1A 2FD5A 2QVOA 3RKQA 2VJIA 3FK7A 3IAS2 4JX5A 3U1KA 3H36A 3KYLA 1XGNA 4GYGA 2JVHA 3PNVA 1O7LA 2AQEA 2XPWA 1H88C 1Z3YA 4A0YA 3FBNB 1YJ9I 3MWMA 3OSGA 1LE8A 4ZC3A 1BIAA 3ASOH 3OOPA 1YIJI 3CLOA 5BOXA 1W5CC 3K1MA 1I27A 1MZBA 3GUDA 5HDGA 3WU0A 4G7HF 3OYGA 3WTVC 2CG4A 2DQLA 2MGQA 3A2KA 4JX4A 1SFXA 4BYYA 1O3RA 2M7BA 1HW2A 5GP9A 4MFDA 3H0GJ 2JA7J 5DD8A 4RLFA 2ZFUA 3A02A 1DP3A 2LBFA 4XORA 1OCTC 2TDXA 2H1KA 1BC8C 1R36A 1VI0A 2BXZA 2NOGA 3RKYA 4BE1A 3OMYA 3KLNA 3M8FA 3SFZA 2XAHA 3CLQA 2O8XA 4S05A 4XRFA 4XLHA 1KZHA 3G2BA 1UMQA 1Z6RA 1FTTA 5LRRA 2DOFA 2L4AA 4Z6YA 5EEGA 3EETA 2JVGA 1LDDA 1UHSA 2E1NA 5FROA 1Z21A 4CCOA 2HVSA 2BZTA 3M9AA 2EV5A 2BXYA 1EH8A 5FKOA 4A3FJ 3FF5A 4XQFA 2MABA 4KN4X 2DA1A 4CCKA 2VB6A 2HQ5A 3F21A 1HKSA 2X6OA 1SD6A 4RLQA 1D1AA 3M8EA 3W2VA 2JPCA 3VODA 3DLLF 1QPMA 1MMAA 4Z2YA 5B5EC 2GAUA 3OIQA 2H27A 2VKVA 1MBJA 1WKMA 2G7UA 1J7KA 5E8GA 3N97A 2NS7A 1X3ZB 1V3FA 1MJAA 2HYFA 3BG9A 5KHDA 4XRSA 1V5GA 3OYIA 1CF7B 1IZ1A 2DW4A 2YS9A 2F5FA 4LK1F 3R61A 1BI1A 4UUSA 3WTUC 1X1PA 3C3WA 2VE8A 2E5NA 2HS5A 1U9NA 3MKWB 3I56I 4YFXF 4CCJA 2NRAC 4UY8I 1QHGA 3LAJA 1K83J 2K86A 5E1WA 3ZPLA 1T98A 1FP1D 1W7PD 3K9TA 2KT0A 1W5TA 1E3PA 3QODA 4ESJA 3CO7C 1EF4A 4HDVA 2DYRH 1LVKA 1V55H 1FYLA 2ECBA 3BZCA 2FQ3A 2DA5A 2ICWG 1WCMJ 5CVIA 5F0FA 2V1XA 3SHFA 1DPRA 1SD5A 2LOOA 1V4RA 1MNDA 1HXDA 3OS2A 4FX0A 3OYJA 3FXJA 4ZZLA 4CICA 3CCYA 5EZGA 2PX9A 3Q0WA 3S17J 3ESWB 4DYQA 2EZHA 3BTLA 5E18F 5EG0B 3S1RJ 1VFCA 1MD0A 1A5JA 2X1CA 1BI2A 2X9DA 2EINH 1E2XA 4OMYA 3JSPA 1XSDA 4JQFA 2PEXA 2E34A 1ITYA 3S2WA 2LC2A 2GBYA 1NTCA 4V2FA 4KITB 1XCVA 3SEZA 3WTZA 2QQ8A 3AAFA 1DDNA 1U78A 2O8KA 2XV4S 3MMYB 5E17F 2WY8Q 2DLLA 3ECHA 2AQFA 3ZOBA 2QZ8A 2OCEA 3I53A 4AUXA 2LLKA 4AD9A 1YW9A 1MBHA 4I6ZA 1JJ6C 2QYOA 3M1CA 3F23A 3LA3A 3BR1A 1MJBA 1Z67A 3IH4A 5FD5A 3HUGA 4PGHA 1Z1DA 2OQGA 3ABMH 1O3SA 4ZJZA 2CMPA 4AIKA 2K85A 4HV6A 4EMSA 2LYCA 3D1NI 3ABKH 1G3YA 4CXFA 2F5DA 3R60A 4MLOA 5IOYA 5L3DA 1LQ1A 3PFYA 4FE7A 1YIOA 4C2TA 1ETXA 5J1YA 1BM9A 4DGWB 4ANJA 3O8GA 2H94A 2Y0SA 1TNSA 4IZZA 2P4WA 1LPQA 1SC7A 5CQEA 5J4YA 4J01A 1B8IB 4HBLA 5K1YA 4ENMA 1NH3A 1PVEA 4O5VA 3S2DJ 2P7CB 2LKPA 4EGZA 2VJJA 4BGDA 5ILSA 2DA4A 4CGZA 3KP7A 2L02A 4HF0A 2ZJPF 5FO5A 2PFBA 3C2GA 4C9YA 2LH9A 5L3CA 5L3BA 1KU2A 2K5CA 3BR3A 3I71A 1ZKGA 1F1ZA 5FB2A 4EM0B 2JA5J 2OD5A 1K78B 4HAMA 3PJRA 5JVGF 1K61A 4NQWB 4MO7A 4M6YA 2WWYA 4XK4A 3DTKA 1V5FA 5EZHA 1E3OC 2DMPA 2R5YA 1DQUA 1SFUA 1A04A 3NRVA 4LD5A 1HSJA 3IWZA 3RQ4A 3L2UA 4RDUA 3HTUA 1VQ7I 3G3ZA 2IW5A 1UAAA 3O2PE 3SZGA 2EK5A 1G59A 5IYBJ 3HL2A 1S72I 3RYPA 3HOYJ 3T8TA 2M0CA 4S0HB 4B47A 1BJAA 3FIWA 4DBQA 4WXHA 2DQRA 3K0LA 1TL8A 3F8NA 5EF6A 2ME0A 3ZN1A 5BPDA 5L3FA 3BTJA 3GLLA 4UVAA 2R7TA 4KUMA 1WVRA 2QGUA 3DCFA 5E8IA 1W1WE 3RZDJ 2BHYA 4CSWA 5D4RA 4HNTA 3GTGJ 3EUKL 2XC7A 1IN7A 2X1EA 4HRIA 2W1OA 2Y9ZA 1ZLJA 4MTEA 1STZA 3S93A 4A3IJ 1R58A 4HZFA 2LKXA 3ZXSA 4H0EA 4M6VA 2QLZA 1JUPA 5B1BH 3CESA 5FFZA 2EFPA 2L7KA 4L9TA 3ABTA 2ZXJA 3G1LA 3B6AA 1OISA 1YW7A 2K9NA 1P7JA 5FRNA 3ZP5A 4HOBA 2CUEA 4F7ZA 2PLYA 3HOWJ 2K02A 4R79A 5BS6A 2DBBA 2XDVA 2OA4A 1X4OA 4I0BA 5CVUA 2EV6A 5E1ZB 3FXLA 2RREA 4BXXJ 1NG6A 3I5UA 4PGGA 3W6KB 4Y7NJ 1J0RA 4ZH4F 2XAJA 2ESNA 2P5KA 3WHBA 2VL8A 2Y30A 3CDHA 3CUOA 2KJCA 1IW7F 2DDAA 4IHYA 1QO0D 2LK2A 2QWWA 4L9JA 1IRXA 1L3LA 3NEUA 1HF0A 3GYHX 1QRYA 3P5JA 1BBYA 4WWCA 4IEJA 3ROUA 3PIPF 1ETVA 4WX9A 2X1DA 3FK6A 4BS9A 3BG5A 4Y3OA 2HTJA 2CQ7A 3K4NA 2GZWA 5FKNA 3C1DA 4A6EA 2F5EA 1XMAA 2W24A 5K5RA 2EIMH 2WV1A 4XONA 2PJRB 3KEQA 4UVCA 3I54A 3R6SA 1D5YA 1OLTA 2XPVA 1M1EB 2P7VB 4HLXA 1QPIA 3ZQCA 1VQ4I 4OIOF 4ABZA 3OSFA 2JPBA 4RB0A 4HPQA 4HYEA 2DJNA 2XGXA 3OYBA 4BBSJ 4HDUA 4XOTA 2CW0F 5JFRA 4RB2C 2HDWA 2K9LA 2V6EA 2HOAA 1MDMB 2PMZN 2HGCA 2GA2A 1JKPC 4E6KG 5M3MJ 2M34A 3H3UA 2LFBA 4XRMA 1U3EM 1LFBA 2F48A 5D8LB 5EGOA 3QQAA 4G6DA 5GADJ 3C2HA 2DFFA 2FU4A 5EDNA 2Z2SB 3VYUB 3EUHA 4LGWA 1B9NA 1WJDA 4P1WA 1ZK8A 2OBPA 4NQWA 4DNCA 4KT6A 1FMVA 4D5FA 1IAWA 5J40A 1X3UA 3DWLE 2O9LA 4KT5C 3K4CA 4A3MJ 2CS3A 4M73A 3HOUJ 1AKHB 1SANA 1MBFA 2CV2A 1JTYA 1R00A 2JTVA 3U21A 1FOKA 1ZQ3P 2VBWA 4IXAA 5FLXZ 1MBKA 2FBKA 2UXNA 2D5VA 5KAIC 4PJNA 2MD0A 3BZ6A 4NC7A 3ZMDA 1YTYA 2FMYA 3RTRA 1IJWC 1MMDA 2E35A 4N4OB 1ULYA 2IJLA 1ZRDA 1VQ6I 1U8RA 4KNYA 3M3YJ 1RI7A 3OYDA 3P7NA 1I3AA 1K79A 4B4CA 4I98B 4UUTA 3ZQ7A 1TP4A 3K1NA 2IRFG 1R1TA 3HOTA 1WSUA 3DTIA 3ABLH 1J9IA 3J80Z 3ZMSA 3A0BC 2VQGA 3JTGA 3CUQB 1I1GA 4BJTA 4OAZA 3C2BA 2FNPA 2OQRA 5LBQA 1QA6A 4KIBA 2HEOA 4ZTFA 2W57A 4LG3A 3CCSI 2AXLA 1SAUA 3BDDA 2Z33A 1B59A 4L5JA 4HQEA 3E0JB 1L0OC 3TEDA 2VKEA 4O3MA 2XB5A 3RPUD 1BR4A 3TDUC 2Z3YA 3WTSC 5E20A 3IHUA 3CCRI 3GFIA 4D9JA 2R7FA 1TWFJ 4WCGA 4V19K 2MC4A 4HX7A 3ZCOA 3IH2A 3SFIA 3OYLA 3VPRA 5GPAA 1F4KA 3U1DA 3DFGA 3WGIA 2I10A 2RNJA 3LAPA 2KISA 1QVTA 4RGRA 3BG7A 2ZXWH 2RNGA 3QWLA 2KIQA 5EJCA 4M74A 1G3SA 2EIJH 2ID6A 1IUFA 3I58A 4D7NA 3L9FA 1OCOH 5H20A 1HKQA 5M3FJ 1IRZA 4I01A 2CO5A 1UB9A 2PBIA 3L1PA 3BCBA 3HOZJ 3BLYA 4N9HA 1FYMA 3FWEA 2A05A 2XAUA 3MKZA 3J7AY 4FASD 1Z6TA 2RQQA 1X1BA 1YITI 1Y0NA 5H6QA 4LIUA 2BHZA 4G7OF 3QU6A 1RIOH 5ICCA 1RR8C 3A01B 1R5HA 3LSMA 1YLFA 2XASA 3OS0A 1GUUA 1RR7A 3LSTA 2P0WA 4KJZA 3PSIA 3KP4A 1VQOI 3IAM2 1N25A 3D5RC 4MIMA 3BP8A 1RNLA 1USSA 3ZRGA 3LQQA 1I6XA 3H3VK 3QOEA 5JLXA 3J7ZI 2MA3A 4IQ4A 4PJLA 1KYWA 2Z1DA 2FXAA 2M87A 3IKVA 2JA6J 3VYRB 3VB2A 4XN0A 4M3DA 3GTPJ 4G7ZF 4XM3A 1JGSA 3PSFA 2QCOA 4AM3A 1X19A 2GLOA 2EA2A 2EWNA 4G6QA 2V9PA 1Y8QB 1E0EA 3H9JA 4BE0A 4LG0A 1TZLA 5GTHC 3FM5A 1OKRA 3QYBA 2XGDA 3CCUI 1FIAA 1Q1HA 4PFPA 5JHFA 3CC7I 1ZRCA 2PMHA 4Q48A 1P4AA 4R1HA 2ZXIA 2VQCA 3I59A 4BDZA 2MH9A 3I55I 2HVQA 3E6DA 5M5WJ 1W7PA 1BOAA 3HSEA 2K4JA 4YIFA 5HLHA 4C3HJ 3V8KA 2HI3A 1RUNA 3DU6A 2DJIA 4WK8F 2M7AA 2VLAA 1F5TA 3V8JA 2RVCA 4PZJA 3VEPA 3K4JA 2P5LC 4RB1A 1TNTA 3A1YA 4M6XA 2JSPA 3DTEA 4A69C 1WJEA 2Q2EB 1B4AA 1FTZA 1UCRA 2D1HA 2QA4I 5HDNA 2LMDA 3PNYA 1JKRC 3OYMA 4B48A 2L2OA 3BG6A 3GLXA 1T8IA 3LSKA 1Y0UA 3I9V2 2R7ZJ 2R7SA 4OAYA 3E97A 2CWEA 4EJTA 1ACIA 1E17A 1X1DA 2JRMA 5DYMA 1S6LA 4LFUA 2KHMA 3H92A 3EYYA 1YJNI 1MIJA 5M5XJ 3GFLA 2NNNA 4P55A 2XSDC 1USTA 2DO7A 3TOAA 5GAGJ 5F6FA 1ZREA 5CPRB 2OAZA 1BJZA 1RZ4A 3I4MJ 1U0JA 1F43A 1ZTRA 4RGXA 2DA2A 2IA2A 4UB6C 1IXSB 3K2AA 2BW3B 3JRFA 3OIOA 4BEHB 1TWAJ 2V7FA 2EZIA 4EV0A 1SFEA 1OYWA 1X58A 2COMA 1ETYA 3CP2A 2W7NA 3V8LA 3HKZN 2Y9YA 1XC5A 1K6OA 1BA5A 3CDLA 5K7FA 5TRDA 5KVRA 2J5OA 2E7WA 3ASNH 2CFXA 5AONA 5D5WB 4IX7A 3GTQJ 5D5XB 5DV5A 4FETA 2FEZA 1Y8RB 4J19A 1UG2A 2V1DA 2V26A 2K40A 4GFBA 3KP3A 2M30A 4EEFG 4MTDA 3JREA 1W36C 2ZKZA 1AA7A 5GAHJ 3LMMA 1BN5A 2HOEA 4UV9A 1ZG3A 1RKWA 5BQTA 4CUGA 1GLNA 2ELJA 2HQNA 3TO7A 5AIQA 3DQVC 1LDJA 2W84A 2JN6A 1IRGA 4I02A 1TQMA 4EQQA 1Z9CA 2R7OA 1QQIA 4A3DJ 2WA0A 2XKOA 3EQLF 3O6BB 3IH3A 1IF1A 1BC7C 3PL8A 2NS0A 3M07A 4GO1A 1RRJA 3ECOA 3MD2A 1A35A 3EPZA 2GM4A 2QUFA 4L0ZB 5HLIA 1TTYA 3GTJJ 1HKTA 3W3CA 3ZMUA 1ZR4A 1J2XA 5CQGA 1R1UA 3BR6A 4GYIA 2EZLA 2EFWA 4CYCA 3C18A 3ERMA 1UG0A 2O0YA 1IN4A 5K5QA 5IT9K 4I0AA 5EEAA 1SMTA 2IGOA 2L9VA 3LSHA 5KAFC 1DGRM 1FBSA 2M5WA 3AG2H 3CJQB 4X0GA 4RA2A 2JJ7A 3WU1B 3SZPA 3J7YJ 1A6IA 2CUFA 3CCVI 2WB1N 1LDKB 2HWVA 4AVZA 1I1SA 2NAZA 4BKXA 1EJ9A 1Z91A 2WAEA 2DT5A 3HXLA 4QLCU 1T6SA 3KX2A 2F2EA 3T5XA 2O7OA 3GTMJ 4RMNA 4NC8A 2XSJC 1R71A 3TGNA 1FJLA 1BR2A 3ML6A 4HF2A 1Z7UA 4XOPA 1ZG5A 1MBGA 2UUZA 3HB9A 2GWRA 3BTCA 3I0TA 3P9IA 4QWQA 2EIKH 4ENNA 2DI3A 4RB3C 1LB2A 4EJOA 2E5ZA 2ZBKA 2L5QA 2MD5A 4CA0A 3JAMZ 1X1AA 4IJAA 2I5UA 1X2NA 3HRSA 1Z05A 4CDGA 3G4SI 3BT9A 5ED4A 1JUMA 3TDZC 4KFCA 3DEWA 2P5VA 1HCRA 2WAQN 3DP7A 3WTYC 1P92A 2JUGA 1SVLA 3W6JB 3L7WA 5CLSA 2HZTA 1RC9A 5FFXA 2HR3A 3JRHA 3TQNA 5LHHA 4AYBA 3HPHA 1W0TA 4HX8A 1UJ8A 2QKLB 1J09A 1Y56A 2BVLA 1X3WB 3RDIA 1U5TA 3FMSA 3RYRA 1X1CA 4I99C 4OMZA 2FJ1A 5GTIC 1OQYA 2LG4A 2XVCA 3IWFA 5CVRA 2KDOA 1SEUA 4DJAA 4M3GA 4IHXA 1GDTA 2JSCA 3H9GA 1IUYA 4BQAA 2ZXHA 4MGRA 4XSXF 5BNGA 1S29A 1VQKI 3K10A 3BOQA 4DQ2A 3QRFF 3E7LA 5LLQA 1BOBA 2TCTA 3DBRB 3SZTA 5D5UB 2ZJ2A 2EFOA 1K4SA 1FT9A 1OR7A 1NK2P 2P6TA 3LA2A 5HNHA 3ISPA 3ZR8X 1KA8A 4IKFA 4EJWA 2HZDA 2R3SA 1HC8A 1HOMA 3LNQA 2CQQA 3VFZA 4IHSA 1AWCA 3CO6C 4U87A 3P9CA 2HDDA 4B43A 1RUOA 1MKMA 2KIUA 1KU9A 1Q1VA 3PUFA 3CZ6A 2BOLA 3QPHA 4AC0A 4XIDA 1P9QC 2XUBA 4Q5SF 2FUG2 2ZCWA 1XDSA 3E3VA 1XCBA 2M8EA 1VQ8I 3GW2A 1QZZA 4E7ZA 4L18B 3B02A 3AL0C 2UZKA 3DPLC 3K70C 4AWXB 2ETHA 1YE9A 3RKXA 1JXSA 3LL7A 2X4HA 2CUJA 1ZR2A 4B3AA 5FGMA 2W85A 3FHZA 4B09A 4XLNF 2F6CA 1OPCA 5LHIA 1FSHA 1IN5A 2KRCA 3QU3A 3BJOA 2PI0A 4RAFA 2IS6A 2EV0A 2EQRA 5D6EA 4L5IA 1ZLKA 1YFHA 4ZDLA 2K7LA 3S3NA 4NDLA 5H6RA 2HPIA 2VJ5A 5HNFA 4XKBA 2QENA 3KETA 4AIHA 3K69A 2M0MA 4II3A 1HLVA 3OYEA 3PIOF 1CGPA 1HBXG 3ZQFA 3Q5FA 3NAUA 5DDGA 2JMWA 2HKXA 2NVQJ 3IUOA 2YU9J 4LMYA 3NWTA 2DYSH 3E5XA 1SVOA 3OY9A 2H09A 3Q9SA 2K9MA 4HG2A 4F92B 2XF7A 4NUBA 3TL4X 1JT0A 5HLGA 1JGGA 2HU9A 1WI9A 1B6AA 2BE5F 2VKDA 1W36D 1D1BA 3MAJA 4HNVA 3KEYA 3ZQGA 5ILVA 2XROA 3RPUA 1CF7A 2EPFA 1FOYA 1IRFA 3CCMI 3MZYA 4BACA 1ZG1A 2R7DA 3SQNA 1W4MA 4UHTA 2OTLI 1WJAA 5IYDJ 2BYVE 1T08B 1TW2A 4A12A 1MSEC 4Q4ZF 3GZ6A 2WADA 5J1RA 4IHTA 2ZNYA 2HFHA 2NOJB 2ZMEC 1GXPA 4U0YA 4B8XA 2GIVA 1Z7LA 2Q1ZB 3WU2C 2XGEA 4MQVA 1FZPB 3DEUA 3O3KA 4WXDA 2WY7Q 3CMYA 2MW8A 2E1MC 3L2RA 3RZOJ 1R22A 5IYCJ 3BR0A 2Q8KA 1JHFA 2DOAA 3OIPA 2H8WA 1TT5B 4PFOA 1R7JA 4KYWA 1JE8A 2XF5A 4ON0A 2LY1A 4YIRX 3WTWC 4ETSA 5EG0A 5F64A 2FMLA 3F6OA 2EILH 4BH9A 1FIPA 5J47A 4MHGA 1H9TA 2R4GA 3W2WA 1H0MA 2MLKA 2X0LA 2H6CA 2KMUA 2OZUA 5H2FC 2DA6A 5DCFA 4E7LA 2EZKA 2K9QA 1R5ID 2EFNA 3RI4A 4KDPA 3E6BA 1V5EA 2IXSA 4ESFA 5B1AH 4U0VA 2GOXB 4BE2A 1LJ9A 1VNDA 5LGUA 1XTAA 2DCEA 1OCPA 1MGTA 3H3ZA 1W0UA 3DKXA 4PJMA 4OOIA 2L9SA 2LNBA 3MKLA 5D5VB 5E3NA 1ZHFA 2L3DA 4A3KJ 3H5RA 2HTSA 3VSLA 4N9IA 2M1BA 5J1UA 3RCOA 1H89C 4ZZDA 4LLLA 1JKQC 3KP2A 3WTTC 3ELKA 1XX5A 4K2EA 2B0LA 4CZCA 3WE2A 2VONA 1B72B 1R4NB 2AHQA 4EJVA 5IP6A 4G94A 3OR2C 4F93B 1IGNA 1T33A 2DK8A 3TMOA 1WZ2A 2IVMA 1R9TJ 3B6CA 1U8BA 3EUHC 1UZCA 3OOUA 2V79A 1B8IA 6PAXA 3TW7A 3K4BA 1ERDA 2CQXA 4E7KA 4OIPF 1DPUA 2NS8A 2KKOA 2QM3A 5C4JJ 2JZYA 3BQYA 4XNFA 3VWBA 2I8DA 2OUMA 4HX4A 4LITA 3LSJA 1U6GA 4DOZA 2DK5A 2LR8A 3HJEA 5IT3A 4IF4A 3JRBA 4QIWN 1X4PA 2W00A 1K78A 3V7CA 5FKLA 4NC6A 3NARA 3HOSA 3RSNA 3ZQLA 2EB7A 1VQNI 1LEAA 1OCRH 2NYXA 5KK1A 1XMXA 2HYJA 4CCMA 4KN7X 2EJRA 2VBXA 1YQAA 2DODA 4XMYA 2X6YA 1Y6IA 2JA2A 5F0HA 4M9ZA 5LEJA 1QZYA 2JT1A 3F8MA 4EATA 4R8HA 3JRIA 3HRTA 2LY9A 3GFJA 2A69F 3KPHA 2JK3A 1BI3A 2CJJA 1GVDA 2HDCA 2RV8A 4W1UA 4KISA 2KZGA 2MG4A 5KCMA 3ZN0A 3D5LA 5IP9J 1TWHJ 4DZJA 3V7SA 4JOMA 2L4MA 3OL4A 3VSKA 4B1RA 2L7FP 4JYKA 2CV1A 2GXGA 1D1CA 3JW4A 1ETWA 1BR1A 2JRTA 4G8XA 3GTOJ 2RAEA 2DDBA 1TQPA 1S5LC 2M2EA 1IDZA 2Y0SN 2LP0A 2NVTJ 4CHUA 1UELB 4FISA 2OJED 1LFPA 1VQ9I 1JHHA 2A07F 3S15J 4YFNF 4Y17A 1WJBA 4A0ZA 1WJ5A 2LRDA 3DPTA 5DUIA 4L9VA 2M9HA 5JVTA 2CGPA 3RPQA 4LB6B 3H5AA 4IHVA 3U9GA 1H9GA 2O3FA 4M9XA 3Q0VA 4A3CJ 1G6NA 2ESHA 3HHHA 3LFUA 2E2JJ 4JP0A 2XPUA 3UR3C 1HW5A 2NXNB 2E36A 2LVSA 2BVMA 2VIXA 3I4PA 4Q47A 5HVQC 4AIDA 1JUSA 1WI3A 1EH6A 4ZDOA 4IRIA 3BJ6A 3P9KA 2DMNA 3UKGA 3ONQA 1D0ZA 4YEJA 1E3HA 2UV1A 2HQAA 2A5YB 3PM1A 1V54H 2V4JC 3QPLA 3R0JA 2N8GA 2OF7A 3BJAA 3HYIA 1G4DA 4XSZF 3M4OJ 4EM1A 2PJRA 2VC0A 1JTXA 2XGCA 3N4MA 4HSTA 3SXYA 2DPDA 2VN2A 2OTJI 3L2CA 2QSHX 5FD6A 4S04A 4N0BA 1PUFB 5HDKA 2PMUA 3E1SA 1D0XA 2M4KA 1A6QA 2L0KA 3BCAA 4HV5A 3G6EI 1PUEE 3G1MA 4ZDPA 3V4GA 2DAOA 1MDMA 3FMQA 4I09A 1HA8A 3I3LA 3IKTA 1XSVA 3E6CC 1T39A 2DMQA 4EJUA 2OCCH 3ZQHA 5LD2C 5E3LA 5IY5H 3DLAA 3SJMA 4A6DA 1Z3XA 2LREA 1N78A 1HDPA 1NG7A 3GTKJ 2KQRA 2YX4A 1QU3A 1KQ9A 4BHBA 2YU3A 3O8HA 3S16J 3DKWA 3H35A 4LJZF 4BL0B 4FTHA 2LBFB 3IL2A 3IRRA 3WG7H 1K7AA 1IN8A 1WPKA 3RKWA 4BXUA 4PSWA 2VASA 2F4MB 2CFOA 3E6MA 2JWTA 4A0XA 1AKHA 1Z0XA 3MEXA 3K7AJ 3BY6A 3ZGKA 4XLCA 2BBYA 4I76A 1ORKA 1D8JA 3HG9A 2ZSHB 2UWMA 4XLEA 2D2WA 2R7UA 4BQQA 1EKEA 2CSOA 4CH7A 2K4BA 1VTNC 1MMGA 3OL3A 1IXRC 4XLAA 5CVVA 1YX3A 4CCNA 2OZ6A 1G2HA 4UB8C 4IHWA 2LY2A 4FE4A 2LSOA 1YW8A 3L09A 2V1UA 2IPQX 4DYRA 3RQIA 5D4SA 1GXQA 2F5CA 3RIRA 1MH3A 4E70A 3FKJA 2KFDA 5J8CA 3CUQA 4RGUA 1OMIA 3FXMA 3CCQI 2IBDA 5A2QK 1K4TA 2Y0MA 2GA1A 2Z9OA 2R7XA 2WBMA 2B7EA 4XL9A 2IEKA 1VQ5I 1IC8A 4YG2F 4ZTJA 2R92J 4DW6A 2ZSIB 3BR5A 2RC4A 3DPUA 3PQKA 1APLC 2BV6A 2PG4A 1ZYRF 2FA5A 3CMMA 4XLFA 3GEZA 1Y39A 3QP6A 2IS2A 5IPAA 2O61A 3EUAA 2VJ4A 3ZQIA 1R6RA 3CP8A 2FOWA 1FMWA 3JRAA 4BJ6C 1BL0A 3MN2A 3PFIA 4BXFA 1TC3C 1KGSA 2QF7A 1A31A 3JTHA 3SEQA 4OINF 4C2UA 2Y2ZA 1B1BA 3BG3A 2F4OB 3T1BA 1WJCA 4EGYA 1UHWA 2FRHA 3AG1H 1TWGJ 3KP6A 1U9OA 1DU0A 2VPRA 1TLHB 4F3QA 5F1RA 1T0FA 1FYKA 2E60A 4TV7A 1KU7A 3CQZJ 4M3BA 5ILUA 5EYRA 3L2QA 1ETQA 2VI6A 4BDYA 1LUJB 2X51A 3F8CA 3VDXA 3FXUA 4PK4A 2CW8A 4IRHA 2VQLA 3A01A 1W5SA 4KMUX 1PUFA 2GQQA 2WAFA 2STTA 3V42A 2CW7A 4F91B 4IL6C 1SMYF 4UVBA 2H6BA 1BW5A 1XSXA 3JR9A 4PUSA 4XR6A 4AU7A 2IS4A 4FHTA 1R5GA 1S7AA 2ID3A 3IV5A 3HUGB 4QPQA 3GTLJ 2LDUA 3A0HC 2DOEA 4NHJA 3FZVA 2ZFWA 5GPCA 1AHDP 2JQ7A 2PJPA 4A93J 2DU9A 1XN7A 4DZPA 1QBJA 3I64A 1HQCA 3K6GA 3IC7A 1WQ2A 2ADUA 1Z77A 4MEXF 3HSRA 3R0AA 3BR2A 2HQRA 3WGHA 1K6YA 3HGYA 4I7HA 4RM3A 1QVUA 4RGSA 4BU2A 3OYKA 1REPC 1XG1A 2K3PA 2ZO4A 3KLOA 3FXRA 4BQOA 3LFKA 3KFWX 1N77A 2Z5UA 3SDGA 4NB5A 1SFKA 3ZMZA 2IS1A 1UHMA 2QSGX 1LEBA 2ISYA 1XGMA 1QZEA 2M4GA 4KA4A 1C0WA 3KZYA 4JBAA 1FSEA 1VQLI 2R5ZB 4U88A 4O6JA 2WTEA 4HSRA 3QPTA 1FOXA 3GF2A 3R4KA 4HNUA 2Y69H 5K7ZA 2R5YB 4CO8A 1DUXC 1D0YA 2DXIA 3AL0B 1LVAA 1P2FA 1WWXA 4BUPA 3CCJI 4GXOA 1U5TC 2Q2EA 1WH5A 4QSHA 1NHAA 2IT0A 4HA8A 4IO9F 1IDYA 4HLYA 1SD7A 1KQ8A 1FLIA 3CDIA 5HOOA 3ERED 1MJ9A 3VOEA 2HPMA 1FBQA 2R7QA 2A6EF 4GCVA 3S8PA 2VE9A 4UXNA 4D5CA 1B9MA 3MVPA 4IVNA 4XLPF 2FF4A 1WFXA 3DKYA 3REOA 4M3EA 1DP7P 5BMZA 2L9NA 1XB4A 1YS6A 2LF7A 3A03A 4XKWA 1ZGJA 4P5OA 3M1EA 3MZ8A 4RS8A 5M5YJ 2VOPA 4MNUA 2QEXI 1CQTA 2PMZA 3DEEA 2BW3A 2BEOA 2L01A 3CJNA 1OR7C 2UXXA 1R4MB 4BEHA 1JI8A 2NVYJ 3H5NA 3HM5A 1ZAOA 5D6FA 4L0YB 1T38A 2DMUA 5K7HA 5E3OA 2ZB9A 1YHQI 3F72A 3JRCA 2Y48A 3QYEA 1ZARA 3PNTA 2FBIA 5LRSA 1R1VA 4UNOA 2MLGA 4B3XA 1G3WA 3KP5A 2KJBA 4A3EJ 4OWRB 3A4CA 4OIRF 5FLXK 1VQPI 4KIFA 4BY7J 4HEA2 4N4NB 3FXOA 4PSXA 3QP5A 5ICFA 2ZMEB 4BNCA 4HW0A 3WTXC 3GFMA 2EA4A 5JR3A 1VZ0A 5B66C 4A3JJ 4I2OA 2KPMA 3U2RA 2CU7A 2CQKA 4NBQA 2DT7B 2E1MB 1IO2A 1HSTA 2G9WA 3K1PA 2E2IJ 2GIZA 3S1QJ 5HS7A 5FKKA 3F0CA 2V1NA 3HOVJ 2VBYA 3HDDA 2JUCA 1XD7A 5F04A 3J80K 3CF5F 3OR1C 3SYTA 2YR2A 3GX4X 1POGA 1P4WA 3JRDA 2X6WA 3WGGA 1ENHA 2IA1A 2K3FA 5CJ9A 1I3QJ 3Q3SA 1QHHD 3BPVA 1TT0A 4LB5A 3FKIJ 1IXCA 1KONA 3M8JA 3HRUA 3T0YA 3WG9A 2HVRA 2J5PA 5IOZA 2AXTC 5A2QZ 2XB0X 4U0WA 1N75A 1J75A 4Y52J 1DU6A 1I5ZA 2Z99A 3CF2A 1Y1WJ 3MQ0A 2CQNA 3FHNA 3F6VA 4U7DA 2A61A 3KEOA 1WJFA 2O03A 4LOCA 2VBZA 3KZIC 5J8FA 5C4XJ 2FSWA 4D0PA 5BPIA 3F9KA 2E1CA 3LOCA 4AVPA 1ONVA 2EBIA 1MBEA 4RBOA 4XN3A 2CUZA 5EGOB 4XBFA 5GAEJ 3TO9A 3HZJA 4LK0F 1YOVB 4L5EA 1YI2I 2STWA 2VPLA 3GO5A 1S8NA 2R5ZA 2QBYB 4P9FA 2FE3A 2O6GE 3OWTA 3QAHA 3JSOA 3MCZA 1ZN2A 1RETA 3HGGA 2NNYA 2HXIA 3LSPA 1FC3A 1OCCH 3FDYA 5TJJA 2G7HA 1RESA 2HOTA 2W4SA 2W82A 5HS9A 3H0DA 2R0QC 1D5VA 3S32A 2DMTA 1T95A 1AU7A 1ZELA 2E2HJ 2QQAA 4UUVA 3KIOA 5ERIA 2JA8J 1OCZH 4JX6A 4KICA 1WGXA 3GWZA 3BTIA 2DFIA 2FOKA 2XAQA 4X1EA 2IP2A 4RAZA 2Q0OA 1ZRFA 2MBFA 1FEXA 1PDNC 2WV0A 1ON1A 2X48A 2XF6A 3BZKA 4XKCA 4IOAF 2D45A 2HXOA 2M8GX 4B44A 3X2QH 5C44J 1SAXA 3Q9VA 1PP7U 1BI0A 2DN0A 5ICEA 2OPTA 3BQZA 2AO9A 3WHCA 2FQ4A 5F1JA 2KL4A 1F36A 5DTDA 2R7WA 1H8AC 4MEYF 2ME6A 5ICGA 4YFKF 3KZZA 2H8RA 1J59A 1I50J 1MNEA 1P6RA 3COAC 3TW6A 1UFMA 4BY1J 2VXZA 3DBHB 4XICA 4C2MJ 2PN6A 2D1VA 3LA7A 5L3EA 5DS9A 3L2VA 5IT9Z 3AFHA 3BC8A 4AIJA 1T56A 2ECCA 3LSRA 4ENJA 1NK3P 2ZMEA 2CYYA 2XAFA 2WC2A 4G6TB 5E1XA 3CJTB 4LLGF 2VC1A 5CVJA 1KQ0A 1LNWA 3EDPA 4BHPA 1P4XA 1R23A 2LF8A 3CCEI
chains in the Genus database with same CATH topology
2K9SA 1SFOJ 1UG2A 1U78A 1OFCX 2K40A 2O8KA 4GFBA 3PM1A 4EEFG 1O4XA 3QPLA 3JREA 2N8GA 2OF7A 5F08A 1HDDC 2VUMJ 3ZOBA 3M4OJ 1JTXA 2XGCA 2LLKA 4AUXA 2R93J 1RKWA 1MBHA 4I6ZA 1JJ6C 2KDZA 4M3FA 1LFUP 5JLWA 1ZGWA 3BR1A 1PUFB 3IH4A 2JN6A 3HOXJ 2YUSA 3G1OA 2L0KA 1IG7A 3G1MA 3S1MJ 4A3DJ 5F27A 3IH3A 1VF9A 3D1NI 5IOYA 4MLOA 4FE7A 2DMQA 3W6VA 3ZQHA 5E3LA 1ETXA 5J1YA 2GM4A 3HBLA 4AYBN 3SJMA 3O8GA 3GTJJ 1HDPA 1B8IB 3GTKJ 1JT6A 1ZR4A 3BR6A 2EZLA 4CYCA 3O8HA 3S16J 3S2DJ 2LTPA 5IP7J 4FTHA 2DA4A 5EEAA 5HODA 1WPKA 4FCYA 2TRTA 3BR3A 1AKHA 2JWTA 1ZKGA 2JJ7A 1Z0XA 3K7AJ 2JA5J 1A6IA 2CUFA 1K61A 2WB1N 4I76A 1ORKA 4MO7A 2L9RA 4BKXA 4XK4A 4BBRJ 1E3OC 5EZHA 2DMPA 2R5YA 2O7OA 3GTMJ 1WH7A 4RDUA 3JRGA 1JKOC 1FJLA 4A3BJ 5IYBJ 1Y1VJ 3HOYJ 4XRSG 1GT0C 4S0HB 2M0CA 1G2HA 4IHWA 1MBGA 3FIWA 4FE4A 3HB9A 2HOSA 1MH4A 3BTCA 4DYRA 3RQIA 1YRNB 5EF6A 2ME0A 1MH3A 3BTJA 3DCFA 3RZDJ 1X2NA 2IBDA 3BT9A 1JUMA 3GTGJ 3DEWA 5E3MA 2IEKA 1HCRA 2WAQN 1IC8A 2P81A 2Y9ZA 2R92J 4DW6A 3BR5A 4A3IJ 1RPWA 2LKXA 1APLC 3JRHA 4M6VA 1W0TA 4MFEA 1JUPA 3I4NJ 5IPAA 1X2MA 3G1LA 3ZQIA 3B6AA 2K9NA 1P7JA 3JRAA 2CUEA 1BL0A 3MN2A 2FJ1A 1MSFC 1TC3C 3HOWJ 2QF7A 1MNMC 1ETKA 2DTZA 4DYCA 4M3GA 2FX0A 2Y2ZA 4IHXA 1GV2A 9ANTA 1GDTA 3BG3A 4C3JJ 4BXXJ 2B63J 2XRLA 2CRGA 1TWGJ 4Y7NJ 1U9OA 2W48A 1DU0A 2VPRA 5BNGA 3WHBA 2Y30A 3E7LA 2TCTA 4D7MA 4IHYA 2LK2A 3CQZJ 5F0CA 4M3BA 5EYRA 1HF0A 1B72A 1ETQA 1QRYA 2VI6A 2LD5A 4IEJA 1ETVA 1NK2P 3FK6A 3BG5A 3A01A 1PUFA 2L7MP 5FKNA 1LE8B 1HOMA 3LNQA 2CQQA 3PO3J 5FKMA 2WV1A 1BW5A 2HDDA 3TP3A 2E19A 1D5YA 2Y31A 1Q1VA 3JR9A 1RKTA 2XPVA 4AC0A 1QPIA 1BW6A 4XIDA 3ZQCA 1XS9A 2ID3A 3IV5A 4ABZA 3OSFA 1JJ8C 4A3GJ 3GTLJ 5GPCA 2DJNA 1AHDP 4A93J 4BBSJ 1GV5A 4DZPA 2HOAA 2COBA 2NVXJ 2PMZN 4QTRA 1JKPC 5M3MJ 1ZR2A 2M34A 4B3AA 2LFBA 4XRMA 4X6AJ 1Z77A 1LFBA 3BR2A 5EGOA 3QQAA 3HGYA 1S7EA 1QVUA 2EQRA 1XG1A 2DA7A 4CYCB 4V2GA 5EDNA 4NDLA 3SDGA 1HLVA 1ZK8A 3Q0UA 4D5FA 3ZQFA 2O9LA 4A3MJ 3NAUA 3HOUJ 2JMWA 1AKHB 2NVQJ 1SANA 2YU9J 1MBFA 1JTYA 2R5ZB 1ZQ3P 5C3EJ 1P7IA 3LSGA 1JT0A 1MBKA 2ELKA 5K7ZA 2D5VA 1JGGA 2R5YB 3S2HJ 4W97A 4HNVA 3ZQGA 1IJWC 1YRNA 5FJ8J 3M3YJ 1WH5A 4QSHA 2E2JJ 1IDYA 5IYDJ 3HEFA 4B4CA 3S1NJ 4UUTA 1MSEC 2IAIA 5J1RA 1OJLA 4J19A 4UUSB 2L7ZA 4D5CA 3MVPA 2XGEA 1TWCJ 2EH3A 3C2BA 4M3EA 3CMYA 2MW8A 3TP0A 3A03A 3RZOJ 5IYCJ 3BR0A 2E1OA 5M5YJ 3TEDA 2VKEA 1CQTA 2XB5A 1IV6A 3S14J 5EG0A 5FLMJ 1ETOA 1FIPA 5FLVA 1TWFJ 2NVYJ 3HM5A 2G0EA 2DMUA 3IH2A 3QPSA 2MSYA 3SFIA 5K7HA 3FISA 3VPRA 5E3OA 2ZB9A 5GPAA 2DA6A 3JRCA 3PO2J 2EZKA 2I10A 3GBGA 2K9QA 1QVTA 4A3EJ 1VNDA 5J3LA 1OCPA 4C3IJ 4BY7J 1W0UA 4A3LJ 2ID6A 1IUFA 1I6HJ 4D7NA 2DA3A 4G12A 3MKLA 5E3NA 4A3JJ 2FD5A 3RKQA 4A3KJ 4JX5A 3FK7A 5M3FJ 2CU7A 1IRZA 5J1UA 1H89C 3L1PA 3HOZJ 2E2IJ 1JKQC 2XPWA 1H88C 3S1QJ 5FKKA 3F0CA 3OSGA 1LE8A 3HOVJ 3HDDA 1B72B 5F04A 2AHQA 5IP6A 1IGNA 1T33A 1POGA 2MGQA 3A01B 3JRDA 4JX4A 1R9TJ 1GUUA 3B6CA 1U8BA 3OOUA 1RR7A 5GP9A 1ENHA 1B8IA 3TW7A 2CQXA 3H0GJ 1I3QJ 3Q3SA 4MFDA 4MIMA 2JA7J 2NS8A 3FKIJ 3A02A 5C4JJ 3H3VK 3BQYA 5JLXA 1OCTC 5IOZA 2XB0X 3LSJA 2H1KA 2JA6J 4Y52J 1VI0A 2NOGA 2LR8A 1DU6A 1Y1WJ 4M3DA 3JRBA 3GTPJ 4QIWN 4LOCA 1UMQA 2QCOA 5FKLA 2GLOA 1FTTA 3NARA 5C4XJ 3ZQLA 3LOCA 1UHSA 2EBIA 1MBEA 4RBOA 5EGOB 2HYJA 2XGDA 1FIAA 5FKOA 4L5EA 4A3FJ 2R5ZA 2DA1A 5F0HA 2HQ5A 2X6OA 1RETA 5M5WJ 3HGGA 2HXIA 3LSPA 3JRIA 2LY9A 1RESA 2HOTA 2JK3A 2CJJA 4C3HJ 1GVDA 2R0QC 2HI3A 4W1UA 2MG4A 1MBJA 2DMTA 2VKVA 1AU7A 5IP9J 1TWHJ 2E2HJ 4DZJA 2NS7A 2JA8J 4JX6A 3BG9A 4XRSA 4B1RA 2L7FP 4JYKA 1WGXA 3BTIA 4A69C 2YS9A 4X1EA 4UUSA 1FTZA 1ETWA 1U9NA 3GTOJ 2RAEA 1FEXA 1JKRC 2M2EA 1IDZA 2X48A 2Y0SN 2LP0A 2HXOA 1K83J 2M8GX 2NVTJ 4FISA 2R7ZJ 5C44J 2KT0A 2DN0A 3S15J 2OPTA 3BQZA 2AO9A 3WHCA 2FQ4A 5F1JA 1EF4A 1F36A 5M5XJ 2XSDC 2ECBA 5DTDA 2DA5A 2M9HA 5F0FA 1WCMJ 1H8AC 2ME6A 4IHVA 1BJZA 2H8RA 3I4MJ 1I50J 1F43A 1ZTRA 3CCYA 2DA2A 3Q0VA 5EZGA 4A3CJ 3K2AA 3Q0WA 3TW6A 4BY1J 3S17J 4DYQA 2EZHA 3BTLA 4JP0A 5EG0B 2XPUA 4XICA 3JRFA 3OIOA 3S1RJ 1VFCA 1TWAJ 4C2MJ 2EZIA 5DS9A 1X58A 2LVSA 1ETYA 1A5JA 3HKZN 2X9DA 2Y9YA 1T56A 1XC5A 2ECCA 3LSRA 1NK3P 1BA5A 3CDLA 1JUSA 1WI3A 5K7FA 1ITYA 2DMNA 3GTQJ 3UKGA 2GBYA 1NTCA 4V2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9S A;  1SFO J;  1UG2 A;  1U78 A;  1OFC X;  2K40 A;  2O8K A;  4GFB A;  3PM1 A;  4EEF G;  1O4X A;  3QPL A;  3JRE A;  2N8G A;  2OF7 A;  5F08 A;  1HDD C;  2VUM J;  3ZOB A;  3M4O J;  1JTX A;  2XGC A;  2LLK A;  4AUX A;  2R93 J;  1RKW A;  1MBH A;  4I6Z A;  1JJ6 C;  2KDZ A;  4M3F A;  1LFU P;  5JLW A;  1ZGW A;  3BR1 A;  1PUF B;  3IH4 A;  2JN6 A;  3HOX J;  2YUS A;  3G1O A;  2L0K A;  1IG7 A;  3G1M A;  3S1M J;  4A3D J;  5F27 A;  3IH3 A;  1VF9 A;  3D1N I;  5IOY A;  4MLO A;  4FE7 A;  2DMQ A;  3W6V A;  3ZQH A;  5E3L A;  1ETX A;  5J1Y A;  2GM4 A;  3HBL A;  4AYB N;  3SJM A;  3O8G A;  3GTJ J;  1HDP A;  1B8I B;  3GTK J;  1JT6 A;  1ZR4 A;  3BR6 A;  2EZL A;  4CYC A;  3O8H A;  3S16 J;  3S2D J;  2LTP A;  5IP7 J;  4FTH A;  2DA4 A;  5EEA A;  5HOD A;  1WPK A;  4FCY A;  2TRT A;  3BR3 A;  1AKH A;  2JWT A;  1ZKG A;  2JJ7 A;  1Z0X A;  3K7A J;  2JA5 J;  1A6I A;  2CUF A;  1K61 A;  2WB1 N;  4I76 A;  1ORK A;  4MO7 A;  2L9R A;  4BKX A;  4XK4 A;  4BBR J;  1E3O C;  5EZH A;  2DMP A;  2R5Y A;  2O7O A;  3GTM J;  1WH7 A;  4RDU A;  3JRG A;  1JKO C;  1FJL A;  4A3B J;  5IYB J;  1Y1V J;  3HOY J;  4XRS G;  1GT0 C;  4S0H B;  2M0C A;  1G2H A;  4IHW A;  1MBG A;  3FIW A;  4FE4 A;  3HB9 A;  2HOS A;  1MH4 A;  3BTC A;  4DYR A;  3RQI A;  1YRN B;  5EF6 A;  2ME0 A;  1MH3 A;  3BTJ A;  3DCF A;  3RZD J;  1X2N A;  2IBD A;  3BT9 A;  1JUM A;  3GTG J;  3DEW A;  5E3M A;  2IEK A;  1HCR A;  2WAQ N;  1IC8 A;  2P81 A;  2Y9Z A;  2R92 J;  4DW6 A;  3BR5 A;  4A3I J;  1RPW A;  2LKX A;  1APL C;  3JRH A;  4M6V A;  1W0T A;  4MFE A;  1JUP A;  3I4N J;  5IPA A;  1X2M A;  3G1L A;  3ZQI A;  3B6A A;  2K9N A;  1P7J A;  3JRA A;  2CUE A;  1BL0 A;  3MN2 A;  2FJ1 A;  1MSF C;  1TC3 C;  3HOW J;  2QF7 A;  1MNM C;  1ETK A;  2DTZ A;  4DYC A;  4M3G A;  2FX0 A;  2Y2Z A;  4IHX A;  1GV2 A;  9ANT A;  1GDT A;  3BG3 A;  4C3J J;  4BXX J;  2B63 J;  2XRL A;  2CRG A;  1TWG J;  4Y7N J;  1U9O A;  2W48 A;  1DU0 A;  2VPR A;  5BNG A;  3WHB A;  2Y30 A;  3E7L A;  2TCT A;  4D7M A;  4IHY A;  2LK2 A;  3CQZ J;  5F0C A;  4M3B A;  5EYR A;  1HF0 A;  1B72 A;  1ETQ A;  1QRY A;  2VI6 A;  2LD5 A;  4IEJ A;  1ETV A;  1NK2 P;  3FK6 A;  3BG5 A;  3A01 A;  1PUF A;  2L7M P;  5FKN A;  1LE8 B;  1HOM A;  3LNQ A;  2CQQ A;  3PO3 J;  5FKM A;  2WV1 A;  1BW5 A;  2HDD A;  3TP3 A;  2E19 A;  1D5Y A;  2Y31 A;  1Q1V A;  3JR9 A;  1RKT A;  2XPV A;  4AC0 A;  1QPI A;  1BW6 A;  4XID A;  3ZQC A;  1XS9 A;  2ID3 A;  3IV5 A;  4ABZ A;  3OSF A;  1JJ8 C;  4A3G J;  3GTL J;  5GPC A;  2DJN A;  1AHD P;  4A93 J;  4BBS J;  1GV5 A;  4DZP A;  2HOA A;  2COB A;  2NVX J;  2PMZ N;  4QTR A;  1JKP C;  5M3M J;  1ZR2 A;  2M34 A;  4B3A A;  2LFB A;  4XRM A;  4X6A J;  1Z77 A;  1LFB A;  3BR2 A;  5EGO A;  3QQA A;  3HGY A;  1S7E A;  1QVU A;  2EQR A;  1XG1 A;  2DA7 A;  4CYC B;  4V2G A;  5EDN A;  4NDL A;  3SDG A;  1HLV A;  1ZK8 A;  3Q0U A;  4D5F A;  3ZQF A;  2O9L A;  4A3M J;  3NAU A;  3HOU J;  2JMW A;  1AKH B;  2NVQ J;  1SAN A;  2YU9 J;  1MBF A;  1JTY A;  2R5Z B;  1ZQ3 P;  5C3E J;  1P7I A;  3LSG A;  1JT0 A;  1MBK A;  2ELK A;  5K7Z A;  2D5V A;  1JGG A;  2R5Y B;  3S2H J;  4W97 A;  4HNV A;  3ZQG A;  1IJW C;  1YRN A;  5FJ8 J;  3M3Y J;  1WH5 A;  4QSH A;  2E2J J;  1IDY A;  5IYD J;  3HEF A;  4B4C A;  3S1N J;  4UUT A;  1MSE C;  2IAI A;  5J1R A;  1OJL A;  4J19 A;  4UUS B;  2L7Z A;  4D5C A;  3MVP A;  2XGE A;  1TWC J;  2EH3 A;  3C2B A;  4M3E A;  3CMY A;  2MW8 A;  3TP0 A;  3A03 A;  3RZO J;  5IYC J;  3BR0 A;  2E1O A;  5M5Y J;  3TED A;  2VKE A;  1CQT A;  2XB5 A;  1IV6 A;  3S14 J;  5EG0 A;  5FLM J;  1ETO A;  1FIP A;  5FLV A;  1TWF J;  2NVY J;  3HM5 A;  2G0E A;  2DMU A;  3IH2 A;  3QPS A;  2MSY A;  3SFI A;  5K7H A;  3FIS A;  3VPR A;  5E3O A;  2ZB9 A;  5GPA A;  2DA6 A;  3JRC A;  3PO2 J;  2EZK A;  2I10 A;  3GBG A;  2K9Q A;  1QVT A;  4A3E J;  1VND A;  5J3L A;  1OCP A;  4C3I J;  4BY7 J;  1W0U A;  4A3L J;  2ID6 A;  1IUF A;  1I6H J;  4D7N A;  2DA3 A;  4G12 A;  3MKL A;  5E3N A;  4A3J J;  2FD5 A;  3RKQ A;  4A3K J;  4JX5 A;  3FK7 A;  5M3F J;  2CU7 A;  1IRZ A;  5J1U A;  1H89 C;  3L1P A;  3HOZ J;  2E2I J;  1JKQ C;  2XPW A;  1H88 C;  3S1Q J;  5FKK A;  3F0C A;  3OSG A;  1LE8 A;  3HOV J;  3HDD A;  1B72 B;  5F04 A;  2AHQ A;  5IP6 A;  1IGN A;  1T33 A;  1POG A;  2MGQ A;  3A01 B;  3JRD A;  4JX4 A;  1R9T J;  1GUU A;  3B6C A;  1U8B A;  3OOU A;  1RR7 A;  5GP9 A;  1ENH A;  1B8I A;  3TW7 A;  2CQX A;  3H0G J;  1I3Q J;  3Q3S A;  4MFD A;  4MIM A;  2JA7 J;  2NS8 A;  3FKI J;  3A02 A;  5C4J J;  3H3V K;  3BQY A;  5JLX A;  1OCT C;  5IOZ A;  2XB0 X;  3LSJ A;  2H1K A;  2JA6 J;  4Y52 J;  1VI0 A;  2NOG A;  2LR8 A;  1DU6 A;  1Y1W J;  4M3D A;  3JRB A;  3GTP J;  4QIW N;  4LOC A;  1UMQ A;  2QCO A;  5FKL A;  2GLO A;  1FTT A;  3NAR A;  5C4X J;  3ZQL A;  3LOC A;  1UHS A;  2EBI A;  1MBE A;  4RBO A;  5EGO B;  2HYJ A;  2XGD A;  1FIA A;  5FKO A;  4L5E A;  4A3F J;  2R5Z A;  2DA1 A;  5F0H A;  2HQ5 A;  2X6O A;  1RET A;  5M5W J;  3HGG A;  2HXI A;  3LSP A;  3JRI A;  2LY9 A;  1RES A;  2HOT A;  2JK3 A;  2CJJ A;  4C3H J;  1GVD A;  2R0Q C;  2HI3 A;  4W1U A;  2MG4 A;  1MBJ A;  2DMT A;  2VKV A;  1AU7 A;  5IP9 J;  1TWH J;  2E2H J;  4DZJ A;  2NS7 A;  2JA8 J;  4JX6 A;  3BG9 A;  4XRS A;  4B1R A;  2L7F P;  4JYK A;  1WGX A;  3BTI A;  4A69 C;  2YS9 A;  4X1E A;  4UUS A;  1FTZ A;  1ETW A;  1U9N A;  3GTO J;  2RAE A;  1FEX A;  1JKR C;  2M2E A;  1IDZ A;  2X48 A;  2Y0S N;  2LP0 A;  2HXO A;  1K83 J;  2M8G X;  2NVT J;  4FIS A;  2R7Z J;  5C44 J;  2KT0 A;  2DN0 A;  3S15 J;  2OPT A;  3BQZ A;  2AO9 A;  3WHC A;  2FQ4 A;  5F1J A;  1EF4 A;  1F36 A;  5M5X J;  2XSD C;  2ECB A;  5DTD A;  2DA5 A;  2M9H A;  5F0F A;  1WCM J;  1H8A C;  2ME6 A;  4IHV A;  1BJZ A;  2H8R A;  3I4M J;  1I50 J;  1F43 A;  1ZTR A;  3CCY A;  2DA2 A;  3Q0V A;  5EZG A;  4A3C J;  3K2A A;  3Q0W A;  3TW6 A;  4BY1 J;  3S17 J;  4DYQ A;  2EZH A;  3BTL A;  4JP0 A;  5EG0 B;  2XPU A;  4XIC A;  3JRF A;  3OIO A;  3S1R J;  1VFC A;  1TWA J;  4C2M J;  2EZI A;  5DS9 A;  1X58 A;  2LVS A;  1ETY A;  1A5J A;  3HKZ N;  2X9D A;  2Y9Y A;  1T56 A;  1XC5 A;  2ECC A;  3LSR A;  1NK3 P;  1BA5 A;  3CDL A;  1JUS A;  1WI3 A;  5K7F A;  1ITY A;  2DMN A;  3GTQ J;  3UKG A;  2GBY A;  1NTC A;  4V2F A; 
#chains in the Genus database with same CATH topology
 4CZZ A;  2K9S A;  1SFO J;  1OFC X;  3MKY B;  4WF2 A;  4BQN A;  1O4X A;  1D3Y A;  5F08 A;  1HDD C;  3W2A A;  3TO6 A;  3WE3 A;  2ISZ A;  2VUM J;  1MMS A;  4LLN A;  2E7X A;  2EFQ A;  2R93 J;  2VT3 A;  2Z16 A;  2KDZ A;  4M3F A;  3BWG A;  1LFU P;  3ABU A;  5TGT A;  3VYS B;  5JLW A;  1ON2 A;  1ZGW A;  2KP6 A;  4Y15 A;  1FX7 A;  3HOX J;  1XGS A;  2W25 A;  4MQ9 F;  4Y33 A;  3TKY A;  3FMR A;  2YUS A;  3G1O A;  3AG4 H;  3D0S A;  1WHU A;  4BJ5 C;  1IG7 A;  3S1M J;  1J5Y A;  5CYV A;  4CCL A;  3FX3 A;  5FRM A;  3HSF A;  5F27 A;  4ZYE A;  2CV0 A;  1VF9 A;  4RAY A;  3HRM A;  1F9N A;  1MW7 A;  4FT8 A;  4HF1 A;  3KE2 A;  4EVI A;  3BPX A;  5J6X A;  3HIF A;  3W6V A;  1AOY A;  1PYV A;  3HHG A;  1XPX A;  2IGM A;  3HBL A;  4AYB N;  3ULQ B;  3MFK A;  2B9S A;  1KU3 A;  1JT6 A;  2PQ8 A;  4YEL A;  4KIG A;  2V9V A;  2VXD A;  2XIG A;  1YG2 A;  2O5R A;  3DXJ F;  3OYH A;  2LTP A;  4M72 A;  5IP7 J;  3ZMT A;  2KZV A;  4U7B A;  4OU0 A;  5HOD A;  3ZQQ A;  2RQP A;  3J81 K;  4FCY A;  2TRT A;  4L9N A;  4JK1 X;  4BAY A;  1G3T A;  4KMF A;  1S3J A;  1DGW Y;  3GZN B;  1BIB A;  3K4K A;  2FNA A;  1MMN A;  3B73 A;  1PP8 F;  3OYN A;  1O57 A;  5DEQ A;  3OYA A;  2YPR A;  2L9R A;  2QBY A;  3HKZ A;  1G8X A;  4RM2 A;  4BBR J;  4LG0 B;  3VYT B;  1WH7 A;  2X6X A;  2MFZ A;  5LFA A;  2M45 A;  1O3T A;  2R7V A;  3JRG A;  2F5V A;  1JKO C;  1A36 A;  5TIS C;  4A3B J;  4E4H A;  1Y1V J;  2RGV A;  4EM2 A;  2ZNZ A;  3KCC A;  1WRJ A;  2KRF A;  3H9Q A;  3ZMV A;  4XRS G;  1YO5 C;  1GT0 C;  3I59 B;  4PDK A;  4II2 A;  2HOS A;  1MH4 A;  1W7P B;  3HPG A;  3L00 A;  2VQH A;  1YRN B;  1TQI A;  5CKT A;  5HS8 A;  3G71 I;  4ENK A;  3FXK A;  5DD4 A;  2A6T A;  2ACJ A;  4D1Q A;  1LKX A;  5E3M A;  2H1L A;  1FWZ A;  1U2W A;  3D5S C;  2P81 A;  1QGP A;  4PJ0 C;  1FNN A;  3QOP A;  3UNG C;  2L54 A;  4E7J A;  3WOD F;  3K70 D;  3GZ5 A;  1RPW A;  2QKM B;  4Y4R A;  3L2W A;  2ZC2 A;  1YJW I;  4WXC A;  4MFE A;  2HKO A;  2XKP A;  3I4N J;  5D8K B;  4NNJ A;  4CYD A;  5LHG A;  1X2M A;  3T8R A;  2BY2 A;  5DCM B;  3KYD B;  4BHC A;  1MSF C;  3CTA A;  3LSI A;  1ZGA A;  4PCQ A;  3DU5 A;  1MNM C;  1ETK A;  2NVU B;  2DTZ A;  4E7I A;  4DYC A;  2F4I A;  4UV8 A;  5K5O A;  3CJR B;  2VKH A;  1R49 A;  2FX0 A;  1GV2 A;  2A68 F;  2Y75 A;  4QPO A;  9ANT A;  4C3J J;  3K4M A;  2B63 J;  2XRL A;  4ZYG A;  3H1C A;  3RJP A;  3M7G A;  1FBU A;  2CRG A;  1GVJ A;  2W48 A;  2WB1 A;  2XRN A;  5HLT A;  2QQB A;  1ODD A;  4D7M A;  3DV8 A;  2CH0 A;  2HYG D;  3LWF A;  4FQG A;  5F0C A;  4IRG A;  4IPA A;  3MZH A;  1TBX A;  3G73 A;  1B72 A;  4OIQ F;  4ZYH A;  1XGO A;  2OU2 A;  3HTS B;  2BGC A;  3JAM K;  2LD5 A;  1IN6 A;  2V9K A;  4ZYD A;  4F55 A;  3CMA I;  2ELH A;  4Y13 A;  3NQO A;  2IGN A;  2L7M P;  1LE8 B;  2C6Y A;  1FP2 A;  3IRQ A;  3CD6 I;  4LIV A;  1ZH5 A;  3PO3 J;  5FKM A;  4GGG A;  2KIF A;  2HNH A;  2RDP A;  4A5M A;  3OYC A;  3TP3 A;  2E19 A;  4HQM A;  5LGN A;  3OS1 A;  2DTR A;  2Y31 A;  1RKT A;  2XAG A;  4M9S A;  1BW6 A;  1XS9 A;  3FBI B;  3FXQ A;  2DFH A;  1JJ8 C;  4A3G J;  2WAQ A;  3GVA A;  1OYY A;  3CC4 I;  1IV8 A;  2GOM A;  2MYS A;  5LGT A;  3CCL I;  3E5Q A;  2X85 A;  3OV8 A;  1GV5 A;  2DFE A;  2COB A;  2NVX J;  2FBH A;  2OV7 A;  5L3G A;  2MH2 A;  4QTR A;  2OC6 A;  2QQ9 A;  2A3S A;  3EYI A;  2RKH A;  1EA3 A;  3NWS A;  3F8B A;  4X6A J;  4ZYA A;  3DF8 A;  1EV7 A;  4YRV A;  2IGK A;  1O3Q A;  1S7E A;  3HC7 A;  2DA7 A;  4GDF A;  2YSR A;  4CYC B;  3J7A O;  2VT2 A;  4V2G A;  2DT6 A;  1YX5 A;  2QSF X;  3CUQ C;  4DIQ A;  5J4V A;  1O7F A;  2ZJQ F;  3Q0U A;  1FY7 A;  3GCM A;  4IQJ A;  5DM6 F;  5KNL A;  3JCU C;  4M71 A;  1SD4 A;  5JI6 A;  2BY3 A;  5C3E J;  4E7H A;  1YS7 A;  1P7I A;  2P8T A;  3LSG A;  1T2K A;  2ELK A;  2K27 A;  3K2Z A;  1S7O A;  1S9H A;  3S2H J;  3S3O A;  4W97 A;  2ZJR F;  3IP4 B;  4ESB A;  1YRN A;  2VOD A;  2M3A A;  5EEH A;  1FPQ A;  4F52 A;  5FJ8 J;  3K4L A;  4ITV A;  3AG3 H;  5B3S H;  4A2U A;  1D8K A;  2P6S A;  2R7R A;  3HEF A;  3S1N J;  3DBL B;  2YX7 A;  3LQR A;  4C30 A;  3SDB A;  2IAI A;  2GXA A;  1EH7 A;  5JHU A;  1OJL A;  3PUB A;  4G9Y A;  4UUS B;  2IA0 A;  3N05 A;  5DM7 F;  2L7Z A;  3S3M A;  1TWC J;  2KIM A;  5DUK A;  2EH3 A;  1KYZ A;  2MC3 A;  3GXO A;  1PJR A;  4XKV A;  3CME I;  3AKZ A;  3FM3 A;  3TP0 A;  1TW3 A;  4DBR A;  2RN7 A;  3CC2 I;  4E7S A;  2E1O A;  4PJJ A;  1T0F C;  2LKS A;  3OYF A;  2DPU A;  1SVM A;  3V7R A;  1VQM I;  1XMK A;  3GME A;  1YYV A;  1IV6 A;  5DCM A;  3S14 J;  5FLM J;  2AS5 F;  4J00 A;  1ETO A;  2E71 A;  3F8F A;  4FX4 A;  1HW1 A;  3F3X A;  4YII A;  4ASN A;  5FLV A;  3F22 A;  4P96 A;  2GXB A;  2G0E A;  2XHK A;  3PQJ A;  3QPS A;  2MSY A;  3FIS A;  3PO2 J;  3TOB A;  1U5T B;  1FOW A;  3GBG A;  3QYF A;  1I39 A;  5AIP A;  3KYC B;  2KRH A;  3BRO A;  4P9U A;  2A5W A;  5E79 C;  1OYI A;  1QNT A;  4H4K C;  4IOC F;  2KLO A;  5J3L A;  4C3I J;  5LEK A;  3E5U A;  3C7J A;  2V6C A;  4A3L J;  2A6H F;  1I6H J;  1GHC A;  2VOO A;  2DA3 A;  4G12 A;  3J81 Z;  4A5N A;  4RAG A;  1XDU A;  3TBI A;  2BY0 A;  4GRI A;  2BY1 A;  2FD5 A;  2QVO A;  3RKQ A;  2VJI A;  3FK7 A;  3IAS 2;  4JX5 A;  3U1K A;  3H36 A;  3KYL A;  1XGN A;  4GYG A;  2JVH A;  3PNV A;  1O7L A;  2AQE A;  2XPW A;  1H88 C;  1Z3Y A;  4A0Y A;  3FBN B;  1YJ9 I;  3MWM A;  3OSG A;  1LE8 A;  4ZC3 A;  1BIA A;  3ASO H;  3OOP A;  1YIJ I;  3CLO A;  5BOX A;  1W5C C;  3K1M A;  1I27 A;  1MZB A;  3GUD A;  5HDG A;  3WU0 A;  4G7H F;  3OYG A;  3WTV C;  2CG4 A;  2DQL A;  2MGQ A;  3A2K A;  4JX4 A;  1SFX A;  4BYY A;  1O3R A;  2M7B A;  1HW2 A;  5GP9 A;  4MFD A;  3H0G J;  2JA7 J;  5DD8 A;  4RLF A;  2ZFU A;  3A02 A;  1DP3 A;  2LBF A;  4XOR A;  1OCT C;  2TDX A;  2H1K A;  1BC8 C;  1R36 A;  1VI0 A;  2BXZ A;  2NOG A;  3RKY A;  4BE1 A;  3OMY A;  3KLN A;  3M8F A;  3SFZ A;  2XAH A;  3CLQ A;  2O8X A;  4S05 A;  4XRF A;  4XLH A;  1KZH A;  3G2B A;  1UMQ A;  1Z6R A;  1FTT A;  5LRR A;  2DOF A;  2L4A A;  4Z6Y A;  5EEG A;  3EET A;  2JVG A;  1LDD A;  1UHS A;  2E1N A;  5FRO A;  1Z21 A;  4CCO A;  2HVS A;  2BZT A;  3M9A A;  2EV5 A;  2BXY A;  1EH8 A;  5FKO A;  4A3F J;  3FF5 A;  4XQF A;  2MAB A;  4KN4 X;  2DA1 A;  4CCK A;  2VB6 A;  2HQ5 A;  3F21 A;  1HKS A;  2X6O A;  1SD6 A;  4RLQ A;  1D1A A;  3M8E A;  3W2V A;  2JPC A;  3VOD A;  3DLL F;  1QPM A;  1MMA A;  4Z2Y A;  5B5E C;  2GAU A;  3OIQ A;  2H27 A;  2VKV A;  1MBJ A;  1WKM A;  2G7U A;  1J7K A;  5E8G A;  3N97 A;  2NS7 A;  1X3Z B;  1V3F A;  1MJA A;  2HYF A;  3BG9 A;  5KHD A;  4XRS A;  1V5G A;  3OYI A;  1CF7 B;  1IZ1 A;  2DW4 A;  2YS9 A;  2F5F A;  4LK1 F;  3R61 A;  1BI1 A;  4UUS A;  3WTU C;  1X1P A;  3C3W A;  2VE8 A;  2E5N A;  2HS5 A;  1U9N A;  3MKW B;  3I56 I;  4YFX F;  4CCJ A;  2NRA C;  4UY8 I;  1QHG A;  3LAJ A;  1K83 J;  2K86 A;  5E1W A;  3ZPL A;  1T98 A;  1FP1 D;  1W7P D;  3K9T A;  2KT0 A;  1W5T A;  1E3P A;  3QOD A;  4ESJ A;  3CO7 C;  1EF4 A;  4HDV A;  2DYR H;  1LVK A;  1V55 H;  1FYL A;  2ECB A;  3BZC A;  2FQ3 A;  2DA5 A;  2ICW G;  1WCM J;  5CVI A;  5F0F A;  2V1X A;  3SHF A;  1DPR A;  1SD5 A;  2LOO A;  1V4R A;  1MND A;  1HXD A;  3OS2 A;  4FX0 A;  3OYJ A;  3FXJ A;  4ZZL A;  4CIC A;  3CCY A;  5EZG A;  2PX9 A;  3Q0W A;  3S17 J;  3ESW B;  4DYQ A;  2EZH A;  3BTL A;  5E18 F;  5EG0 B;  3S1R J;  1VFC A;  1MD0 A;  1A5J A;  2X1C A;  1BI2 A;  2X9D A;  2EIN H;  1E2X A;  4OMY A;  3JSP A;  1XSD A;  4JQF A;  2PEX A;  2E34 A;  1ITY A;  3S2W A;  2LC2 A;  2GBY A;  1NTC A;  4V2F A;  4KIT B;  1XCV A;  3SEZ A;  3WTZ A;  2QQ8 A;  3AAF A;  1DDN A;  1U78 A;  2O8K A;  2XV4 S;  3MMY B;  5E17 F;  2WY8 Q;  2DLL A;  3ECH A;  2AQF A;  3ZOB A;  2QZ8 A;  2OCE A;  3I53 A;  4AUX A;  2LLK A;  4AD9 A;  1YW9 A;  1MBH A;  4I6Z A;  1JJ6 C;  2QYO A;  3M1C A;  3F23 A;  3LA3 A;  3BR1 A;  1MJB A;  1Z67 A;  3IH4 A;  5FD5 A;  3HUG A;  4PGH A;  1Z1D A;  2OQG A;  3ABM H;  1O3S A;  4ZJZ A;  2CMP A;  4AIK A;  2K85 A;  4HV6 A;  4EMS A;  2LYC A;  3D1N I;  3ABK H;  1G3Y A;  4CXF A;  2F5D A;  3R60 A;  4MLO A;  5IOY A;  5L3D A;  1LQ1 A;  3PFY A;  4FE7 A;  1YIO A;  4C2T A;  1ETX A;  5J1Y A;  1BM9 A;  4DGW B;  4ANJ A;  3O8G A;  2H94 A;  2Y0S A;  1TNS A;  4IZZ A;  2P4W A;  1LPQ A;  1SC7 A;  5CQE A;  5J4Y A;  4J01 A;  1B8I B;  4HBL A;  5K1Y A;  4ENM A;  1NH3 A;  1PVE A;  4O5V A;  3S2D J;  2P7C B;  2LKP A;  4EGZ A;  2VJJ A;  4BGD A;  5ILS A;  2DA4 A;  4CGZ A;  3KP7 A;  2L02 A;  4HF0 A;  2ZJP F;  5FO5 A;  2PFB A;  3C2G A;  4C9Y A;  2LH9 A;  5L3C A;  5L3B A;  1KU2 A;  2K5C A;  3BR3 A;  3I71 A;  1ZKG A;  1F1Z A;  5FB2 A;  4EM0 B;  2JA5 J;  2OD5 A;  1K78 B;  4HAM A;  3PJR A;  5JVG F;  1K61 A;  4NQW B;  4MO7 A;  4M6Y A;  2WWY A;  4XK4 A;  3DTK A;  1V5F A;  5EZH A;  1E3O C;  2DMP A;  2R5Y A;  1DQU A;  1SFU A;  1A04 A;  3NRV A;  4LD5 A;  1HSJ A;  3IWZ A;  3RQ4 A;  3L2U A;  4RDU A;  3HTU A;  1VQ7 I;  3G3Z A;  2IW5 A;  1UAA A;  3O2P E;  3SZG A;  2EK5 A;  1G59 A;  5IYB J;  3HL2 A;  1S72 I;  3RYP A;  3HOY J;  3T8T A;  2M0C A;  4S0H B;  4B47 A;  1BJA A;  3FIW A;  4DBQ A;  4WXH A;  2DQR A;  3K0L A;  1TL8 A;  3F8N A;  5EF6 A;  2ME0 A;  3ZN1 A;  5BPD A;  5L3F A;  3BTJ A;  3GLL A;  4UVA A;  2R7T A;  4KUM A;  1WVR A;  2QGU A;  3DCF A;  5E8I A;  1W1W E;  3RZD J;  2BHY A;  4CSW A;  5D4R A;  4HNT A;  3GTG J;  3EUK L;  2XC7 A;  1IN7 A;  2X1E A;  4HRI A;  2W1O A;  2Y9Z A;  1ZLJ A;  4MTE A;  1STZ A;  3S93 A;  4A3I J;  1R58 A;  4HZF A;  2LKX A;  3ZXS A;  4H0E A;  4M6V A;  2QLZ A;  1JUP A;  5B1B H;  3CES A;  5FFZ A;  2EFP A;  2L7K A;  4L9T A;  3ABT A;  2ZXJ A;  3G1L A;  3B6A A;  1OIS A;  1YW7 A;  2K9N A;  1P7J A;  5FRN A;  3ZP5 A;  4HOB A;  2CUE A;  4F7Z A;  2PLY A;  3HOW J;  2K02 A;  4R79 A;  5BS6 A;  2DBB A;  2XDV A;  2OA4 A;  1X4O A;  4I0B A;  5CVU A;  2EV6 A;  5E1Z B;  3FXL A;  2RRE A;  4BXX J;  1NG6 A;  3I5U A;  4PGG A;  3W6K B;  4Y7N J;  1J0R A;  4ZH4 F;  2XAJ A;  2ESN A;  2P5K A;  3WHB A;  2VL8 A;  2Y30 A;  3CDH A;  3CUO A;  2KJC A;  1IW7 F;  2DDA A;  4IHY A;  1QO0 D;  2LK2 A;  2QWW A;  4L9J A;  1IRX A;  1L3L A;  3NEU A;  1HF0 A;  3GYH X;  1QRY A;  3P5J A;  1BBY A;  4WWC A;  4IEJ A;  3ROU A;  3PIP F;  1ETV A;  4WX9 A;  2X1D A;  3FK6 A;  4BS9 A;  3BG5 A;  4Y3O A;  2HTJ A;  2CQ7 A;  3K4N A;  2GZW A;  5FKN A;  3C1D A;  4A6E A;  2F5E A;  1XMA A;  2W24 A;  5K5R A;  2EIM H;  2WV1 A;  4XON A;  2PJR B;  3KEQ A;  4UVC A;  3I54 A;  3R6S A;  1D5Y A;  1OLT A;  2XPV A;  1M1E B;  2P7V B;  4HLX A;  1QPI A;  3ZQC A;  1VQ4 I;  4OIO F;  4ABZ A;  3OSF A;  2JPB A;  4RB0 A;  4HPQ A;  4HYE A;  2DJN A;  2XGX A;  3OYB A;  4BBS J;  4HDU A;  4XOT A;  2CW0 F;  5JFR A;  4RB2 C;  2HDW A;  2K9L A;  2V6E A;  2HOA A;  1MDM B;  2PMZ N;  2HGC A;  2GA2 A;  1JKP C;  4E6K G;  5M3M J;  2M34 A;  3H3U A;  2LFB A;  4XRM A;  1U3E M;  1LFB A;  2F48 A;  5D8L B;  5EGO A;  3QQA A;  4G6D A;  5GAD J;  3C2H A;  2DFF A;  2FU4 A;  5EDN A;  2Z2S B;  3VYU B;  3EUH A;  4LGW A;  1B9N A;  1WJD A;  4P1W A;  1ZK8 A;  2OBP A;  4NQW A;  4DNC A;  4KT6 A;  1FMV A;  4D5F A;  1IAW A;  5J40 A;  1X3U A;  3DWL E;  2O9L A;  4KT5 C;  3K4C A;  4A3M J;  2CS3 A;  4M73 A;  3HOU J;  1AKH B;  1SAN A;  1MBF A;  2CV2 A;  1JTY A;  1R00 A;  2JTV A;  3U21 A;  1FOK A;  1ZQ3 P;  2VBW A;  4IXA A;  5FLX Z;  1MBK A;  2FBK A;  2UXN A;  2D5V A;  5KAI C;  4PJN A;  2MD0 A;  3BZ6 A;  4NC7 A;  3ZMD A;  1YTY A;  2FMY A;  3RTR A;  1IJW C;  1MMD A;  2E35 A;  4N4O B;  1ULY A;  2IJL A;  1ZRD A;  1VQ6 I;  1U8R A;  4KNY A;  3M3Y J;  1RI7 A;  3OYD A;  3P7N A;  1I3A A;  1K79 A;  4B4C A;  4I98 B;  4UUT A;  3ZQ7 A;  1TP4 A;  3K1N A;  2IRF G;  1R1T A;  3HOT A;  1WSU A;  3DTI A;  3ABL H;  1J9I A;  3J80 Z;  3ZMS A;  3A0B C;  2VQG A;  3JTG A;  3CUQ B;  1I1G A;  4BJT A;  4OAZ A;  3C2B A;  2FNP A;  2OQR A;  5LBQ A;  1QA6 A;  4KIB A;  2HEO A;  4ZTF A;  2W57 A;  4LG3 A;  3CCS I;  2AXL A;  1SAU A;  3BDD A;  2Z33 A;  1B59 A;  4L5J A;  4HQE A;  3E0J B;  1L0O C;  3TED A;  2VKE A;  4O3M A;  2XB5 A;  3RPU D;  1BR4 A;  3TDU C;  2Z3Y A;  3WTS C;  5E20 A;  3IHU A;  3CCR I;  3GFI A;  4D9J A;  2R7F A;  1TWF J;  4WCG A;  4V19 K;  2MC4 A;  4HX7 A;  3ZCO A;  3IH2 A;  3SFI A;  3OYL A;  3VPR A;  5GPA A;  1F4K A;  3U1D A;  3DFG A;  3WGI A;  2I10 A;  2RNJ A;  3LAP A;  2KIS A;  1QVT A;  4RGR A;  3BG7 A;  2ZXW H;  2RNG A;  3QWL A;  2KIQ A;  5EJC A;  4M74 A;  1G3S A;  2EIJ H;  2ID6 A;  1IUF A;  3I58 A;  4D7N A;  3L9F A;  1OCO H;  5H20 A;  1HKQ A;  5M3F J;  1IRZ A;  4I01 A;  2CO5 A;  1UB9 A;  2PBI A;  3L1P A;  3BCB A;  3HOZ J;  3BLY A;  4N9H A;  1FYM A;  3FWE A;  2A05 A;  2XAU A;  3MKZ A;  3J7A Y;  4FAS D;  1Z6T A;  2RQQ A;  1X1B A;  1YIT I;  1Y0N A;  5H6Q A;  4LIU A;  2BHZ A;  4G7O F;  3QU6 A;  1RIO H;  5ICC A;  1RR8 C;  3A01 B;  1R5H A;  3LSM A;  1YLF A;  2XAS A;  3OS0 A;  1GUU A;  1RR7 A;  3LST A;  2P0W A;  4KJZ A;  3PSI A;  3KP4 A;  1VQO I;  3IAM 2;  1N25 A;  3D5R C;  4MIM A;  3BP8 A;  1RNL A;  1USS A;  3ZRG A;  3LQQ A;  1I6X A;  3H3V K;  3QOE A;  5JLX A;  3J7Z I;  2MA3 A;  4IQ4 A;  4PJL A;  1KYW A;  2Z1D A;  2FXA A;  2M87 A;  3IKV A;  2JA6 J;  3VYR B;  3VB2 A;  4XN0 A;  4M3D A;  3GTP J;  4G7Z F;  4XM3 A;  1JGS A;  3PSF A;  2QCO A;  4AM3 A;  1X19 A;  2GLO A;  2EA2 A;  2EWN A;  4G6Q A;  2V9P A;  1Y8Q B;  1E0E A;  3H9J A;  4BE0 A;  4LG0 A;  1TZL A;  5GTH C;  3FM5 A;  1OKR A;  3QYB A;  2XGD A;  3CCU I;  1FIA A;  1Q1H A;  4PFP A;  5JHF A;  3CC7 I;  1ZRC A;  2PMH A;  4Q48 A;  1P4A A;  4R1H A;  2ZXI A;  2VQC A;  3I59 A;  4BDZ A;  2MH9 A;  3I55 I;  2HVQ A;  3E6D A;  5M5W J;  1W7P A;  1BOA A;  3HSE A;  2K4J A;  4YIF A;  5HLH A;  4C3H J;  3V8K A;  2HI3 A;  1RUN A;  3DU6 A;  2DJI A;  4WK8 F;  2M7A A;  2VLA A;  1F5T A;  3V8J A;  2RVC A;  4PZJ A;  3VEP A;  3K4J A;  2P5L C;  4RB1 A;  1TNT A;  3A1Y A;  4M6X A;  2JSP A;  3DTE A;  4A69 C;  1WJE A;  2Q2E B;  1B4A A;  1FTZ A;  1UCR A;  2D1H A;  2QA4 I;  5HDN A;  2LMD A;  3PNY A;  1JKR C;  3OYM A;  4B48 A;  2L2O A;  3BG6 A;  3GLX A;  1T8I A;  3LSK A;  1Y0U A;  3I9V 2;  2R7Z J;  2R7S A;  4OAY A;  3E97 A;  2CWE A;  4EJT A;  1ACI A;  1E17 A;  1X1D A;  2JRM A;  5DYM A;  1S6L A;  4LFU A;  2KHM A;  3H92 A;  3EYY A;  1YJN I;  1MIJ A;  5M5X J;  3GFL A;  2NNN A;  4P55 A;  2XSD C;  1UST A;  2DO7 A;  3TOA A;  5GAG J;  5F6F A;  1ZRE A;  5CPR B;  2OAZ A;  1BJZ A;  1RZ4 A;  3I4M J;  1U0J A;  1F43 A;  1ZTR A;  4RGX A;  2DA2 A;  2IA2 A;  4UB6 C;  1IXS B;  3K2A A;  2BW3 B;  3JRF A;  3OIO A;  4BEH B;  1TWA J;  2V7F A;  2EZI A;  4EV0 A;  1SFE A;  1OYW A;  1X58 A;  2COM A;  1ETY A;  3CP2 A;  2W7N A;  3V8L A;  3HKZ N;  2Y9Y A;  1XC5 A;  1K6O A;  1BA5 A;  3CDL A;  5K7F A;  5TRD A;  5KVR A;  2J5O A;  2E7W A;  3ASN H;  2CFX A;  5AON A;  5D5W B;  4IX7 A;  3GTQ J;  5D5X B;  5DV5 A;  4FET A;  2FEZ A;  1Y8R B;  4J19 A;  1UG2 A;  2V1D A;  2V26 A;  2K40 A;  4GFB A;  3KP3 A;  2M30 A;  4EEF G;  4MTD A;  3JRE A;  1W36 C;  2ZKZ A;  1AA7 A;  5GAH J;  3LMM A;  1BN5 A;  2HOE A;  4UV9 A;  1ZG3 A;  1RKW A;  5BQT A;  4CUG A;  1GLN A;  2ELJ A;  2HQN A;  3TO7 A;  5AIQ A;  3DQV C;  1LDJ A;  2W84 A;  2JN6 A;  1IRG A;  4I02 A;  1TQM A;  4EQQ A;  1Z9C A;  2R7O A;  1QQI A;  4A3D J;  2WA0 A;  2XKO A;  3EQL F;  3O6B B;  3IH3 A;  1IF1 A;  1BC7 C;  3PL8 A;  2NS0 A;  3M07 A;  4GO1 A;  1RRJ A;  3ECO A;  3MD2 A;  1A35 A;  3EPZ A;  2GM4 A;  2QUF A;  4L0Z B;  5HLI A;  1TTY A;  3GTJ J;  1HKT A;  3W3C A;  3ZMU A;  1ZR4 A;  1J2X A;  5CQG A;  1R1U A;  3BR6 A;  4GYI A;  2EZL A;  2EFW A;  4CYC A;  3C18 A;  3ERM A;  1UG0 A;  2O0Y A;  1IN4 A;  5K5Q A;  5IT9 K;  4I0A A;  5EEA A;  1SMT A;  2IGO A;  2L9V A;  3LSH A;  5KAF C;  1DGR M;  1FBS A;  2M5W A;  3AG2 H;  3CJQ B;  4X0G A;  4RA2 A;  2JJ7 A;  3WU1 B;  3SZP A;  3J7Y J;  1A6I A;  2CUF A;  3CCV I;  2WB1 N;  1LDK B;  2HWV A;  4AVZ A;  1I1S A;  2NAZ A;  4BKX A;  1EJ9 A;  1Z91 A;  2WAE A;  2DT5 A;  3HXL A;  4QLC U;  1T6S A;  3KX2 A;  2F2E A;  3T5X A;  2O7O A;  3GTM J;  4RMN A;  4NC8 A;  2XSJ C;  1R71 A;  3TGN A;  1FJL A;  1BR2 A;  3ML6 A;  4HF2 A;  1Z7U A;  4XOP A;  1ZG5 A;  1MBG A;  2UUZ A;  3HB9 A;  2GWR A;  3BTC A;  3I0T A;  3P9I A;  4QWQ A;  2EIK H;  4ENN A;  2DI3 A;  4RB3 C;  1LB2 A;  4EJO A;  2E5Z A;  2ZBK A;  2L5Q A;  2MD5 A;  4CA0 A;  3JAM Z;  1X1A A;  4IJA A;  2I5U A;  1X2N A;  3HRS A;  1Z05 A;  4CDG A;  3G4S I;  3BT9 A;  5ED4 A;  1JUM A;  3TDZ C;  4KFC A;  3DEW A;  2P5V A;  1HCR A;  2WAQ N;  3DP7 A;  3WTY C;  1P92 A;  2JUG A;  1SVL A;  3W6J B;  3L7W A;  5CLS A;  2HZT A;  1RC9 A;  5FFX A;  2HR3 A;  3JRH A;  3TQN A;  5LHH A;  4AYB A;  3HPH A;  1W0T A;  4HX8 A;  1UJ8 A;  2QKL B;  1J09 A;  1Y56 A;  2BVL A;  1X3W B;  3RDI A;  1U5T A;  3FMS A;  3RYR A;  1X1C A;  4I99 C;  4OMZ A;  2FJ1 A;  5GTI C;  1OQY A;  2LG4 A;  2XVC A;  3IWF A;  5CVR A;  2KDO A;  1SEU A;  4DJA A;  4M3G A;  4IHX A;  1GDT A;  2JSC A;  3H9G A;  1IUY A;  4BQA A;  2ZXH A;  4MGR A;  4XSX F;  5BNG A;  1S29 A;  1VQK I;  3K10 A;  3BOQ A;  4DQ2 A;  3QRF F;  3E7L A;  5LLQ A;  1BOB A;  2TCT A;  3DBR B;  3SZT A;  5D5U B;  2ZJ2 A;  2EFO A;  1K4S A;  1FT9 A;  1OR7 A;  1NK2 P;  2P6T A;  3LA2 A;  5HNH A;  3ISP A;  3ZR8 X;  1KA8 A;  4IKF A;  4EJW A;  2HZD A;  2R3S A;  1HC8 A;  1HOM A;  3LNQ A;  2CQQ A;  3VFZ A;  4IHS A;  1AWC A;  3CO6 C;  4U87 A;  3P9C A;  2HDD A;  4B43 A;  1RUO A;  1MKM A;  2KIU A;  1KU9 A;  1Q1V A;  3PUF A;  3CZ6 A;  2BOL A;  3QPH A;  4AC0 A;  4XID A;  1P9Q C;  2XUB A;  4Q5S F;  2FUG 2;  2ZCW A;  1XDS A;  3E3V A;  1XCB A;  2M8E A;  1VQ8 I;  3GW2 A;  1QZZ A;  4E7Z A;  4L18 B;  3B02 A;  3AL0 C;  2UZK A;  3DPL C;  3K70 C;  4AWX B;  2ETH A;  1YE9 A;  3RKX A;  1JXS A;  3LL7 A;  2X4H A;  2CUJ A;  1ZR2 A;  4B3A A;  5FGM A;  2W85 A;  3FHZ A;  4B09 A;  4XLN F;  2F6C A;  1OPC A;  5LHI A;  1FSH A;  1IN5 A;  2KRC A;  3QU3 A;  3BJO A;  2PI0 A;  4RAF A;  2IS6 A;  2EV0 A;  2EQR A;  5D6E A;  4L5I A;  1ZLK A;  1YFH A;  4ZDL A;  2K7L A;  3S3N A;  4NDL A;  5H6R A;  2HPI A;  2VJ5 A;  5HNF A;  4XKB A;  2QEN A;  3KET A;  4AIH A;  3K69 A;  2M0M A;  4II3 A;  1HLV A;  3OYE A;  3PIO F;  1CGP A;  1HBX G;  3ZQF A;  3Q5F A;  3NAU A;  5DDG A;  2JMW A;  2HKX A;  2NVQ J;  3IUO A;  2YU9 J;  4LMY A;  3NWT A;  2DYS H;  3E5X A;  1SVO A;  3OY9 A;  2H09 A;  3Q9S A;  2K9M A;  4HG2 A;  4F92 B;  2XF7 A;  4NUB A;  3TL4 X;  1JT0 A;  5HLG A;  1JGG A;  2HU9 A;  1WI9 A;  1B6A A;  2BE5 F;  2VKD A;  1W36 D;  1D1B A;  3MAJ A;  4HNV A;  3KEY A;  3ZQG A;  5ILV A;  2XRO A;  3RPU A;  1CF7 A;  2EPF A;  1FOY A;  1IRF A;  3CCM I;  3MZY A;  4BAC A;  1ZG1 A;  2R7D A;  3SQN A;  1W4M A;  4UHT A;  2OTL I;  1WJA A;  5IYD J;  2BYV E;  1T08 B;  1TW2 A;  4A12 A;  1MSE C;  4Q4Z F;  3GZ6 A;  2WAD A;  5J1R A;  4IHT A;  2ZNY A;  2HFH A;  2NOJ B;  2ZME C;  1GXP A;  4U0Y A;  4B8X A;  2GIV A;  1Z7L A;  2Q1Z B;  3WU2 C;  2XGE A;  4MQV A;  1FZP B;  3DEU A;  3O3K A;  4WXD A;  2WY7 Q;  3CMY A;  2MW8 A;  2E1M C;  3L2R A;  3RZO J;  1R22 A;  5IYC J;  3BR0 A;  2Q8K A;  1JHF A;  2DOA A;  3OIP A;  2H8W A;  1TT5 B;  4PFO A;  1R7J A;  4KYW A;  1JE8 A;  2XF5 A;  4ON0 A;  2LY1 A;  4YIR X;  3WTW C;  4ETS A;  5EG0 A;  5F64 A;  2FML A;  3F6O A;  2EIL H;  4BH9 A;  1FIP A;  5J47 A;  4MHG A;  1H9T A;  2R4G A;  3W2W A;  1H0M A;  2MLK A;  2X0L A;  2H6C A;  2KMU A;  2OZU A;  5H2F C;  2DA6 A;  5DCF A;  4E7L A;  2EZK A;  2K9Q A;  1R5I D;  2EFN A;  3RI4 A;  4KDP A;  3E6B A;  1V5E A;  2IXS A;  4ESF A;  5B1A H;  4U0V A;  2GOX B;  4BE2 A;  1LJ9 A;  1VND A;  5LGU A;  1XTA A;  2DCE A;  1OCP A;  1MGT A;  3H3Z A;  1W0U A;  3DKX A;  4PJM A;  4OOI A;  2L9S A;  2LNB A;  3MKL A;  5D5V B;  5E3N A;  1ZHF A;  2L3D A;  4A3K J;  3H5R A;  2HTS A;  3VSL A;  4N9I A;  2M1B A;  5J1U A;  3RCO A;  1H89 C;  4ZZD A;  4LLL A;  1JKQ C;  3KP2 A;  3WTT C;  3ELK A;  1XX5 A;  4K2E A;  2B0L A;  4CZC A;  3WE2 A;  2VON A;  1B72 B;  1R4N B;  2AHQ A;  4EJV A;  5IP6 A;  4G94 A;  3OR2 C;  4F93 B;  1IGN A;  1T33 A;  2DK8 A;  3TMO A;  1WZ2 A;  2IVM A;  1R9T J;  3B6C A;  1U8B A;  3EUH C;  1UZC A;  3OOU A;  2V79 A;  1B8I A;  6PAX A;  3TW7 A;  3K4B A;  1ERD A;  2CQX A;  4E7K A;  4OIP F;  1DPU A;  2NS8 A;  2KKO A;  2QM3 A;  5C4J J;  2JZY A;  3BQY A;  4XNF A;  3VWB A;  2I8D A;  2OUM A;  4HX4 A;  4LIT A;  3LSJ A;  1U6G A;  4DOZ A;  2DK5 A;  2LR8 A;  3HJE A;  5IT3 A;  4IF4 A;  3JRB A;  4QIW N;  1X4P A;  2W00 A;  1K78 A;  3V7C A;  5FKL A;  4NC6 A;  3NAR A;  3HOS A;  3RSN A;  3ZQL A;  2EB7 A;  1VQN I;  1LEA A;  1OCR H;  2NYX A;  5KK1 A;  1XMX A;  2HYJ A;  4CCM A;  4KN7 X;  2EJR A;  2VBX A;  1YQA A;  2DOD A;  4XMY A;  2X6Y A;  1Y6I A;  2JA2 A;  5F0H A;  4M9Z A;  5LEJ A;  1QZY A;  2JT1 A;  3F8M A;  4EAT A;  4R8H A;  3JRI A;  3HRT A;  2LY9 A;  3GFJ A;  2A69 F;  3KPH A;  2JK3 A;  1BI3 A;  2CJJ A;  1GVD A;  2HDC A;  2RV8 A;  4W1U A;  4KIS A;  2KZG A;  2MG4 A;  5KCM A;  3ZN0 A;  3D5L A;  5IP9 J;  1TWH J;  4DZJ A;  3V7S A;  4JOM A;  2L4M A;  3OL4 A;  3VSK A;  4B1R A;  2L7F P;  4JYK A;  2CV1 A;  2GXG A;  1D1C A;  3JW4 A;  1ETW A;  1BR1 A;  2JRT A;  4G8X A;  3GTO J;  2RAE A;  2DDB A;  1TQP A;  1S5L C;  2M2E A;  1IDZ A;  2Y0S N;  2LP0 A;  2NVT J;  4CHU A;  1UEL B;  4FIS A;  2OJE D;  1LFP A;  1VQ9 I;  1JHH A;  2A07 F;  3S15 J;  4YFN F;  4Y17 A;  1WJB A;  4A0Z A;  1WJ5 A;  2LRD A;  3DPT A;  5DUI A;  4L9V A;  2M9H A;  5JVT A;  2CGP A;  3RPQ A;  4LB6 B;  3H5A A;  4IHV A;  3U9G A;  1H9G A;  2O3F A;  4M9X A;  3Q0V A;  4A3C J;  1G6N A;  2ESH A;  3HHH A;  3LFU A;  2E2J J;  4JP0 A;  2XPU A;  3UR3 C;  1HW5 A;  2NXN B;  2E36 A;  2LVS A;  2BVM A;  2VIX A;  3I4P A;  4Q47 A;  5HVQ C;  4AID A;  1JUS A;  1WI3 A;  1EH6 A;  4ZDO A;  4IRI A;  3BJ6 A;  3P9K A;  2DMN A;  3UKG A;  3ONQ A;  1D0Z A;  4YEJ A;  1E3H A;  2UV1 A;  2HQA A;  2A5Y B;  3PM1 A;  1V54 H;  2V4J C;  3QPL A;  3R0J A;  2N8G A;  2OF7 A;  3BJA A;  3HYI A;  1G4D A;  4XSZ F;  3M4O J;  4EM1 A;  2PJR A;  2VC0 A;  1JTX A;  2XGC A;  3N4M A;  4HST A;  3SXY A;  2DPD A;  2VN2 A;  2OTJ I;  3L2C A;  2QSH X;  5FD6 A;  4S04 A;  4N0B A;  1PUF B;  5HDK A;  2PMU A;  3E1S A;  1D0X A;  2M4K A;  1A6Q A;  2L0K A;  3BCA A;  4HV5 A;  3G6E I;  1PUE E;  3G1M A;  4ZDP A;  3V4G A;  2DAO A;  1MDM A;  3FMQ A;  4I09 A;  1HA8 A;  3I3L A;  3IKT A;  1XSV A;  3E6C C;  1T39 A;  2DMQ A;  4EJU A;  2OCC H;  3ZQH A;  5LD2 C;  5E3L A;  5IY5 H;  3DLA A;  3SJM A;  4A6D A;  1Z3X A;  2LRE A;  1N78 A;  1HDP A;  1NG7 A;  3GTK J;  2KQR A;  2YX4 A;  1QU3 A;  1KQ9 A;  4BHB A;  2YU3 A;  3O8H A;  3S16 J;  3DKW A;  3H35 A;  4LJZ F;  4BL0 B;  4FTH A;  2LBF B;  3IL2 A;  3IRR A;  3WG7 H;  1K7A A;  1IN8 A;  1WPK A;  3RKW A;  4BXU A;  4PSW A;  2VAS A;  2F4M B;  2CFO A;  3E6M A;  2JWT A;  4A0X A;  1AKH A;  1Z0X A;  3MEX A;  3K7A J;  3BY6 A;  3ZGK A;  4XLC A;  2BBY A;  4I76 A;  1ORK A;  1D8J A;  3HG9 A;  2ZSH B;  2UWM A;  4XLE A;  2D2W A;  2R7U A;  4BQQ A;  1EKE A;  2CSO A;  4CH7 A;  2K4B A;  1VTN C;  1MMG A;  3OL3 A;  1IXR C;  4XLA A;  5CVV A;  1YX3 A;  4CCN A;  2OZ6 A;  1G2H A;  4UB8 C;  4IHW A;  2LY2 A;  4FE4 A;  2LSO A;  1YW8 A;  3L09 A;  2V1U A;  2IPQ X;  4DYR A;  3RQI A;  5D4S A;  1GXQ A;  2F5C A;  3RIR A;  1MH3 A;  4E70 A;  3FKJ A;  2KFD A;  5J8C A;  3CUQ A;  4RGU A;  1OMI A;  3FXM A;  3CCQ I;  2IBD A;  5A2Q K;  1K4T A;  2Y0M A;  2GA1 A;  2Z9O A;  2R7X A;  2WBM A;  2B7E A;  4XL9 A;  2IEK A;  1VQ5 I;  1IC8 A;  4YG2 F;  4ZTJ A;  2R92 J;  4DW6 A;  2ZSI B;  3BR5 A;  2RC4 A;  3DPU A;  3PQK A;  1APL C;  2BV6 A;  2PG4 A;  1ZYR F;  2FA5 A;  3CMM A;  4XLF A;  3GEZ A;  1Y39 A;  3QP6 A;  2IS2 A;  5IPA A;  2O61 A;  3EUA A;  2VJ4 A;  3ZQI A;  1R6R A;  3CP8 A;  2FOW A;  1FMW A;  3JRA A;  4BJ6 C;  1BL0 A;  3MN2 A;  3PFI A;  4BXF A;  1TC3 C;  1KGS A;  2QF7 A;  1A31 A;  3JTH A;  3SEQ A;  4OIN F;  4C2U A;  2Y2Z A;  1B1B A;  3BG3 A;  2F4O B;  3T1B A;  1WJC A;  4EGY A;  1UHW A;  2FRH A;  3AG1 H;  1TWG J;  3KP6 A;  1U9O A;  1DU0 A;  2VPR A;  1TLH B;  4F3Q A;  5F1R A;  1T0F A;  1FYK A;  2E60 A;  4TV7 A;  1KU7 A;  3CQZ J;  4M3B A;  5ILU A;  5EYR A;  3L2Q A;  1ETQ A;  2VI6 A;  4BDY A;  1LUJ B;  2X51 A;  3F8C A;  3VDX A;  3FXU A;  4PK4 A;  2CW8 A;  4IRH A;  2VQL A;  3A01 A;  1W5S A;  4KMU X;  1PUF A;  2GQQ A;  2WAF A;  2STT A;  3V42 A;  2CW7 A;  4F91 B;  4IL6 C;  1SMY F;  4UVB A;  2H6B A;  1BW5 A;  1XSX A;  3JR9 A;  4PUS A;  4XR6 A;  4AU7 A;  2IS4 A;  4FHT A;  1R5G A;  1S7A A;  2ID3 A;  3IV5 A;  3HUG B;  4QPQ A;  3GTL J;  2LDU A;  3A0H C;  2DOE A;  4NHJ A;  3FZV A;  2ZFW A;  5GPC A;  1AHD P;  2JQ7 A;  2PJP A;  4A93 J;  2DU9 A;  1XN7 A;  4DZP A;  1QBJ A;  3I64 A;  1HQC A;  3K6G A;  3IC7 A;  1WQ2 A;  2ADU A;  1Z77 A;  4MEX F;  3HSR A;  3R0A A;  3BR2 A;  2HQR A;  3WGH A;  1K6Y A;  3HGY A;  4I7H A;  4RM3 A;  1QVU A;  4RGS A;  4BU2 A;  3OYK A;  1REP C;  1XG1 A;  2K3P A;  2ZO4 A;  3KLO A;  3FXR A;  4BQO A;  3LFK A;  3KFW X;  1N77 A;  2Z5U A;  3SDG A;  4NB5 A;  1SFK A;  3ZMZ A;  2IS1 A;  1UHM A;  2QSG X;  1LEB A;  2ISY A;  1XGM A;  1QZE A;  2M4G A;  4KA4 A;  1C0W A;  3KZY A;  4JBA A;  1FSE A;  1VQL I;  2R5Z B;  4U88 A;  4O6J A;  2WTE A;  4HSR A;  3QPT A;  1FOX A;  3GF2 A;  3R4K A;  4HNU A;  2Y69 H;  5K7Z A;  2R5Y B;  4CO8 A;  1DUX C;  1D0Y A;  2DXI A;  3AL0 B;  1LVA A;  1P2F A;  1WWX A;  4BUP A;  3CCJ I;  4GXO A;  1U5T C;  2Q2E A;  1WH5 A;  4QSH A;  1NHA A;  2IT0 A;  4HA8 A;  4IO9 F;  1IDY A;  4HLY A;  1SD7 A;  1KQ8 A;  1FLI A;  3CDI A;  5HOO A;  3ERE D;  1MJ9 A;  3VOE A;  2HPM A;  1FBQ A;  2R7Q A;  2A6E F;  4GCV A;  3S8P A;  2VE9 A;  4UXN A;  4D5C A;  1B9M A;  3MVP A;  4IVN A;  4XLP F;  2FF4 A;  1WFX A;  3DKY A;  3REO A;  4M3E A;  1DP7 P;  5BMZ A;  2L9N A;  1XB4 A;  1YS6 A;  2LF7 A;  3A03 A;  4XKW A;  1ZGJ A;  4P5O A;  3M1E A;  3MZ8 A;  4RS8 A;  5M5Y J;  2VOP A;  4MNU A;  2QEX I;  1CQT A;  2PMZ A;  3DEE A;  2BW3 A;  2BEO A;  2L01 A;  3CJN A;  1OR7 C;  2UXX A;  1R4M B;  4BEH A;  1JI8 A;  2NVY J;  3H5N A;  3HM5 A;  1ZAO A;  5D6F A;  4L0Y B;  1T38 A;  2DMU A;  5K7H A;  5E3O A;  2ZB9 A;  1YHQ I;  3F72 A;  3JRC A;  2Y48 A;  3QYE A;  1ZAR A;  3PNT A;  2FBI A;  5LRS A;  1R1V A;  4UNO A;  2MLG A;  4B3X A;  1G3W A;  3KP5 A;  2KJB A;  4A3E J;  4OWR B;  3A4C A;  4OIR F;  5FLX K;  1VQP I;  4KIF A;  4BY7 J;  4HEA 2;  4N4N B;  3FXO A;  4PSX A;  3QP5 A;  5ICF A;  2ZME B;  4BNC A;  4HW0 A;  3WTX C;  3GFM A;  2EA4 A;  5JR3 A;  1VZ0 A;  5B66 C;  4A3J J;  4I2O A;  2KPM A;  3U2R A;  2CU7 A;  2CQK A;  4NBQ A;  2DT7 B;  2E1M B;  1IO2 A;  1HST A;  2G9W A;  3K1P A;  2E2I J;  2GIZ A;  3S1Q J;  5HS7 A;  5FKK A;  3F0C A;  2V1N A;  3HOV J;  2VBY A;  3HDD A;  2JUC A;  1XD7 A;  5F04 A;  3J80 K;  3CF5 F;  3OR1 C;  3SYT A;  2YR2 A;  3GX4 X;  1POG A;  1P4W A;  3JRD A;  2X6W A;  3WGG A;  1ENH A;  2IA1 A;  2K3F A;  5CJ9 A;  1I3Q J;  3Q3S A;  1QHH D;  3BPV A;  1TT0 A;  4LB5 A;  3FKI J;  1IXC A;  1KON A;  3M8J A;  3HRU A;  3T0Y A;  3WG9 A;  2HVR A;  2J5P A;  5IOZ A;  2AXT C;  5A2Q Z;  2XB0 X;  4U0W A;  1N75 A;  1J75 A;  4Y52 J;  1DU6 A;  1I5Z A;  2Z99 A;  3CF2 A;  1Y1W J;  3MQ0 A;  2CQN A;  3FHN A;  3F6V A;  4U7D A;  2A61 A;  3KEO A;  1WJF A;  2O03 A;  4LOC A;  2VBZ A;  3KZI C;  5J8F A;  5C4X J;  2FSW A;  4D0P A;  5BPI A;  3F9K A;  2E1C A;  3LOC A;  4AVP A;  1ONV A;  2EBI A;  1MBE A;  4RBO A;  4XN3 A;  2CUZ A;  5EGO B;  4XBF A;  5GAE J;  3TO9 A;  3HZJ A;  4LK0 F;  1YOV B;  4L5E A;  1YI2 I;  2STW A;  2VPL A;  3GO5 A;  1S8N A;  2R5Z A;  2QBY B;  4P9F A;  2FE3 A;  2O6G E;  3OWT A;  3QAH A;  3JSO A;  3MCZ A;  1ZN2 A;  1RET A;  3HGG A;  2NNY A;  2HXI A;  3LSP A;  1FC3 A;  1OCC H;  3FDY A;  5TJJ A;  2G7H A;  1RES A;  2HOT A;  2W4S A;  2W82 A;  5HS9 A;  3H0D A;  2R0Q C;  1D5V A;  3S32 A;  2DMT A;  1T95 A;  1AU7 A;  1ZEL A;  2E2H J;  2QQA A;  4UUV A;  3KIO A;  5ERI A;  2JA8 J;  1OCZ H;  4JX6 A;  4KIC A;  1WGX A;  3GWZ A;  3BTI A;  2DFI A;  2FOK A;  2XAQ A;  4X1E A;  2IP2 A;  4RAZ A;  2Q0O A;  1ZRF A;  2MBF A;  1FEX A;  1PDN C;  2WV0 A;  1ON1 A;  2X48 A;  2XF6 A;  3BZK A;  4XKC A;  4IOA F;  2D45 A;  2HXO A;  2M8G X;  4B44 A;  3X2Q H;  5C44 J;  1SAX A;  3Q9V A;  1PP7 U;  1BI0 A;  2DN0 A;  5ICE A;  2OPT A;  3BQZ A;  2AO9 A;  3WHC A;  2FQ4 A;  5F1J A;  2KL4 A;  1F36 A;  5DTD A;  2R7W A;  1H8A C;  4MEY F;  2ME6 A;  5ICG A;  4YFK F;  3KZZ A;  2H8R A;  1J59 A;  1I50 J;  1MNE A;  1P6R A;  3COA C;  3TW6 A;  1UFM A;  4BY1 J;  2VXZ A;  3DBH B;  4XIC A;  4C2M J;  2PN6 A;  2D1V A;  3LA7 A;  5L3E A;  5DS9 A;  3L2V A;  5IT9 Z;  3AFH A;  3BC8 A;  4AIJ A;  1T56 A;  2ECC A;  3LSR A;  4ENJ A;  1NK3 P;  2ZME A;  2CYY A;  2XAF A;  2WC2 A;  4G6T B;  5E1X A;  3CJT B;  4LLG F;  2VC1 A;  5CVJ A;  1KQ0 A;  1LNW A;  3EDP A;  4BHP A;  1P4X A;  1R23 A;  2LF8 A;  3CCE I; 
#chains in the Genus database with same CATH homology
 2K9S A;  1SFO J;  1UG2 A;  1U78 A;  1OFC X;  2K40 A;  2O8K A;  4GFB A;  3PM1 A;  4EEF G;  1O4X A;  3QPL A;  3JRE A;  2N8G A;  2OF7 A;  5F08 A;  1HDD C;  2VUM J;  3ZOB A;  3M4O J;  1JTX A;  2XGC A;  2LLK A;  4AUX A;  2R93 J;  1RKW A;  1MBH A;  4I6Z A;  1JJ6 C;  2KDZ A;  4M3F A;  1LFU P;  5JLW A;  1ZGW A;  3BR1 A;  1PUF B;  3IH4 A;  2JN6 A;  3HOX J;  2YUS A;  3G1O A;  2L0K A;  1IG7 A;  3G1M A;  3S1M J;  4A3D J;  5F27 A;  3IH3 A;  1VF9 A;  3D1N I;  5IOY A;  4MLO A;  4FE7 A;  2DMQ A;  3W6V A;  3ZQH A;  5E3L A;  1ETX A;  5J1Y A;  2GM4 A;  3HBL A;  4AYB N;  3SJM A;  3O8G A;  3GTJ J;  1HDP A;  1B8I B;  3GTK J;  1JT6 A;  1ZR4 A;  3BR6 A;  2EZL A;  4CYC A;  3O8H A;  3S16 J;  3S2D J;  2LTP A;  5IP7 J;  4FTH A;  2DA4 A;  5EEA A;  5HOD A;  1WPK A;  4FCY A;  2TRT A;  3BR3 A;  1AKH A;  2JWT A;  1ZKG A;  2JJ7 A;  1Z0X A;  3K7A J;  2JA5 J;  1A6I A;  2CUF A;  1K61 A;  2WB1 N;  4I76 A;  1ORK A;  4MO7 A;  2L9R A;  4BKX A;  4XK4 A;  4BBR J;  1E3O C;  5EZH A;  2DMP A;  2R5Y A;  2O7O A;  3GTM J;  1WH7 A;  4RDU A;  3JRG A;  1JKO C;  1FJL A;  4A3B J;  5IYB J;  1Y1V J;  3HOY J;  4XRS G;  1GT0 C;  4S0H B;  2M0C A;  1G2H A;  4IHW A;  1MBG A;  3FIW A;  4FE4 A;  3HB9 A;  2HOS A;  1MH4 A;  3BTC A;  4DYR A;  3RQI A;  1YRN B;  5EF6 A;  2ME0 A;  1MH3 A;  3BTJ A;  3DCF A;  3RZD J;  1X2N A;  2IBD A;  3BT9 A;  1JUM A;  3GTG J;  3DEW A;  5E3M A;  2IEK A;  1HCR A;  2WAQ N;  1IC8 A;  2P81 A;  2Y9Z A;  2R92 J;  4DW6 A;  3BR5 A;  4A3I J;  1RPW A;  2LKX A;  1APL C;  3JRH A;  4M6V A;  1W0T A;  4MFE A;  1JUP A;  3I4N J;  5IPA A;  1X2M A;  3G1L A;  3ZQI A;  3B6A A;  2K9N A;  1P7J A;  3JRA A;  2CUE A;  1BL0 A;  3MN2 A;  2FJ1 A;  1MSF C;  1TC3 C;  3HOW J;  2QF7 A;  1MNM C;  1ETK A;  2DTZ A;  4DYC A;  4M3G A;  2FX0 A;  2Y2Z A;  4IHX A;  1GV2 A;  9ANT A;  1GDT A;  3BG3 A;  4C3J J;  4BXX J;  2B63 J;  2XRL A;  2CRG A;  1TWG J;  4Y7N J;  1U9O A;  2W48 A;  1DU0 A;  2VPR A;  5BNG A;  3WHB A;  2Y30 A;  3E7L A;  2TCT A;  4D7M A;  4IHY A;  2LK2 A;  3CQZ J;  5F0C A;  4M3B A;  5EYR A;  1HF0 A;  1B72 A;  1ETQ A;  1QRY A;  2VI6 A;  2LD5 A;  4IEJ A;  1ETV A;  1NK2 P;  3FK6 A;  3BG5 A;  3A01 A;  1PUF A;  2L7M P;  5FKN A;  1LE8 B;  1HOM A;  3LNQ A;  2CQQ A;  3PO3 J;  5FKM A;  2WV1 A;  1BW5 A;  2HDD A;  3TP3 A;  2E19 A;  1D5Y A;  2Y31 A;  1Q1V A;  3JR9 A;  1RKT A;  2XPV A;  4AC0 A;  1QPI A;  1BW6 A;  4XID A;  3ZQC A;  1XS9 A;  2ID3 A;  3IV5 A;  4ABZ A;  3OSF A;  1JJ8 C;  4A3G J;  3GTL J;  5GPC A;  2DJN A;  1AHD P;  4A93 J;  4BBS J;  1GV5 A;  4DZP A;  2HOA A;  2COB A;  2NVX J;  2PMZ N;  4QTR A;  1JKP C;  5M3M J;  1ZR2 A;  2M34 A;  4B3A A;  2LFB A;  4XRM A;  4X6A J;  1Z77 A;  1LFB A;  3BR2 A;  5EGO A;  3QQA A;  3HGY A;  1S7E A;  1QVU A;  2EQR A;  1XG1 A;  2DA7 A;  4CYC B;  4V2G A;  5EDN A;  4NDL A;  3SDG A;  1HLV A;  1ZK8 A;  3Q0U A;  4D5F A;  3ZQF A;  2O9L A;  4A3M J;  3NAU A;  3HOU J;  2JMW A;  1AKH B;  2NVQ J;  1SAN A;  2YU9 J;  1MBF A;  1JTY A;  2R5Z B;  1ZQ3 P;  5C3E J;  1P7I A;  3LSG A;  1JT0 A;  1MBK A;  2ELK A;  5K7Z A;  2D5V A;  1JGG A;  2R5Y B;  3S2H J;  4W97 A;  4HNV A;  3ZQG A;  1IJW C;  1YRN A;  5FJ8 J;  3M3Y J;  1WH5 A;  4QSH A;  2E2J J;  1IDY A;  5IYD J;  3HEF A;  4B4C A;  3S1N J;  4UUT A;  1MSE C;  2IAI A;  5J1R A;  1OJL A;  4J19 A;  4UUS B;  2L7Z A;  4D5C A;  3MVP A;  2XGE A;  1TWC J;  2EH3 A;  3C2B A;  4M3E A;  3CMY A;  2MW8 A;  3TP0 A;  3A03 A;  3RZO J;  5IYC J;  3BR0 A;  2E1O A;  5M5Y J;  3TED A;  2VKE A;  1CQT A;  2XB5 A;  1IV6 A;  3S14 J;  5EG0 A;  5FLM J;  1ETO A;  1FIP A;  5FLV A;  1TWF J;  2NVY J;  3HM5 A;  2G0E A;  2DMU A;  3IH2 A;  3QPS A;  2MSY A;  3SFI A;  5K7H A;  3FIS A;  3VPR A;  5E3O A;  2ZB9 A;  5GPA A;  2DA6 A;  3JRC A;  3PO2 J;  2EZK A;  2I10 A;  3GBG A;  2K9Q A;  1QVT A;  4A3E J;  1VND A;  5J3L A;  1OCP A;  4C3I J;  4BY7 J;  1W0U A;  4A3L J;  2ID6 A;  1IUF A;  1I6H J;  4D7N A;  2DA3 A;  4G12 A;  3MKL A;  5E3N A;  4A3J J;  2FD5 A;  3RKQ A;  4A3K J;  4JX5 A;  3FK7 A;  5M3F J;  2CU7 A;  1IRZ A;  5J1U A;  1H89 C;  3L1P A;  3HOZ J;  2E2I J;  1JKQ C;  2XPW A;  1H88 C;  3S1Q J;  5FKK A;  3F0C A;  3OSG A;  1LE8 A;  3HOV J;  3HDD A;  1B72 B;  5F04 A;  2AHQ A;  5IP6 A;  1IGN A;  1T33 A;  1POG A;  2MGQ A;  3A01 B;  3JRD A;  4JX4 A;  1R9T J;  1GUU A;  3B6C A;  1U8B A;  3OOU A;  1RR7 A;  5GP9 A;  1ENH A;  1B8I A;  3TW7 A;  2CQX A;  3H0G J;  1I3Q J;  3Q3S A;  4MFD A;  4MIM A;  2JA7 J;  2NS8 A;  3FKI J;  3A02 A;  5C4J J;  3H3V K;  3BQY A;  5JLX A;  1OCT C;  5IOZ A;  2XB0 X;  3LSJ A;  2H1K A;  2JA6 J;  4Y52 J;  1VI0 A;  2NOG A;  2LR8 A;  1DU6 A;  1Y1W J;  4M3D A;  3JRB A;  3GTP J;  4QIW N;  4LOC A;  1UMQ A;  2QCO A;  5FKL A;  2GLO A;  1FTT A;  3NAR A;  5C4X J;  3ZQL A;  3LOC A;  1UHS A;  2EBI A;  1MBE A;  4RBO A;  5EGO B;  2HYJ A;  2XGD A;  1FIA A;  5FKO A;  4L5E A;  4A3F J;  2R5Z A;  2DA1 A;  5F0H A;  2HQ5 A;  2X6O A;  1RET A;  5M5W J;  3HGG A;  2HXI A;  3LSP A;  3JRI A;  2LY9 A;  1RES A;  2HOT A;  2JK3 A;  2CJJ A;  4C3H J;  1GVD A;  2R0Q C;  2HI3 A;  4W1U A;  2MG4 A;  1MBJ A;  2DMT A;  2VKV A;  1AU7 A;  5IP9 J;  1TWH J;  2E2H J;  4DZJ A;  2NS7 A;  2JA8 J;  4JX6 A;  3BG9 A;  4XRS A;  4B1R A;  2L7F P;  4JYK A;  1WGX A;  3BTI A;  4A69 C;  2YS9 A;  4X1E A;  4UUS A;  1FTZ A;  1ETW A;  1U9N A;  3GTO J;  2RAE A;  1FEX A;  1JKR C;  2M2E A;  1IDZ A;  2X48 A;  2Y0S N;  2LP0 A;  2HXO A;  1K83 J;  2M8G X;  2NVT J;  4FIS A;  2R7Z J;  5C44 J;  2KT0 A;  2DN0 A;  3S15 J;  2OPT A;  3BQZ A;  2AO9 A;  3WHC A;  2FQ4 A;  5F1J A;  1EF4 A;  1F36 A;  5M5X J;  2XSD C;  2ECB A;  5DTD A;  2DA5 A;  2M9H A;  5F0F A;  1WCM J;  1H8A C;  2ME6 A;  4IHV A;  1BJZ A;  2H8R A;  3I4M J;  1I50 J;  1F43 A;  1ZTR A;  3CCY A;  2DA2 A;  3Q0V A;  5EZG A;  4A3C J;  3K2A A;  3Q0W A;  3TW6 A;  4BY1 J;  3S17 J;  4DYQ A;  2EZH A;  3BTL A;  4JP0 A;  5EG0 B;  2XPU A;  4XIC A;  3JRF A;  3OIO A;  3S1R J;  1VFC A;  1TWA J;  4C2M J;  2EZI A;  5DS9 A;  1X58 A;  2LVS A;  1ETY A;  1A5J A;  3HKZ N;  2X9D A;  2Y9Y A;  1T56 A;  1XC5 A;  2ECC A;  3LSR A;  1NK3 P;  1BA5 A;  3CDL A;  1JUS A;  1WI3 A;  5K7F A;  1ITY A;  2DMN A;  3GTQ J;  3UKG A;  2GBY A;  1NTC A;  4V2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...