3A03A

Crystal structure of hox11l1 homeodomain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
FSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords T-cell leukemia homeobox protein 2
publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2009-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3a03A00
3A02A 3SFIA 4X6AJ 5J1RA 3BG9A 1IC8A 2LY9A 2R0QC 3JRGA 1JJ8C 1ETXA 2DA3A 3H0GJ 2JN6A 2R93J 2MG4A 2HDDA 4UUSB 5GPAA 2L0KA 4A3DJ 1MSFC 1MBFA 3GTJJ 1U9NA 2E2JJ 4V2FA 5M5XJ 1IDZA 3CCYA 5EEAA 5J1YA 3BTLA 2OF7A 5FLVA 3B6AA 5K7FA 2LP0A 2DN0A 1Y1VJ 2GLOA 1UHSA 2HI3A 1W0TA 5JLXA 5C4JJ 3JRDA 2CUEA 2CQXA 2L7ZA 5C4XJ 4FTHA 5J3LA 5EGOA 5IP6A 1X58A 3ZQGA 2K40A 5EZGA 3F0CA 3RKQA 4Y52J 1VNDA 3OIOA 1OJLA 1ETYA 3FK6A 3WHCA 3Q0WA 3A01A 3HGGA 1D5YA 1I3QJ 1JKRC 1TWCJ 2MSYA 2LVSA 2K9QA 2RAEA 2D5VA 2DMNA 2TRTA 5IP9J 1QVTA 3OOUA 5FKMA 3BG3A 4FISA 2ID6A 5F1JA 4BBRJ 3Q3SA 1BW5A 2NVYJ 2NOGA 4IHVA 4LOCA 2DJNA 1U78A 5M3MJ 3K7AJ 4A69C 2FQ4A 2K9SA 1DU6A 1MBKA 2YS9A 2QF7A 2LLKA 4ABZA 2QCOA 5IYBJ 2CRGA 3FIWA 1PUFB 2L7MP 1FTTA 4M3GA 1JJ6C 1Y1WJ 1TC3C 4GFBA 1XS9A 2R5YA 2ID3A 2FX0A 1IJWC 5GPCA 4Y7NJ 5M3FJ 5E3MA 3TP3A 4BKXA 2VI6A 3JR9A 1BA5A 2N8GA 1FIPA 4MIMA 2GM4A 5M5WJ 2PMZN 4S0HB 4FE7A 2MGQA 1IV6A 4A3BJ 1T33A 1LE8B 1JUPA 2VPRA 3C2BA 4B3AA 1MBEA 4BY7J 3W6VA 5DS9A 3TW7A 5K7HA 2O8KA 5IP7J 2X9DA 1S7EA 1RESA 3FK7A 3CMYA 3BQYA 5IOYA 2HOAA 4M3EA 3GTKJ 2DMUA 4A3CJ 1IDYA 2WAQN 1QVUA 2ECCA 2JJ7A 2HQ5A 2XSDC 1LFBA 4JX4A 2KDZA 5C3EJ 2HXOA 4DYCA 1CQTA 5HODA 2CQQA 3GTLJ 1I50J 1GVDA 3HKZN 4RDUA 2X6OA 4XK4A 1X2NA 3MVPA 4B4CA 1B8IA 4RBOA 1TWFJ 4DYQA 4AUXA 1HDPA 1BJZA 1K61A 2EZHA 3HBLA 4D5CA 1IG7A 1BW6A 2Y30A 1IRZA 2CU7A 2M0CA 3CQZJ 2R92J 2DMPA 1AKHA 3BR6A 1JKPC 2XB5A 2M34A 4I76A 3LSPA 3BG5A 2HYJA 2Y2ZA 2L7FP 1B72A 2DA2A 5E3OA 2HOSA 4A3LJ 1OCTC 1ETKA 1VF9A 3ZQCA 2YUSA 3GTOJ 2XPUA 1JGGA 3HDDA 3DEWA 4M3DA 5F08A 3NARA 3S16J 5FKLA 3GBGA 1SFOJ 1WCMJ 1JUSA 2R5ZA 5GP9A 2G0EA 1RR7A 2Y31A 5FKNA 1Q1VA 1NK2P 2B63J 5EG0B 2JA7J 2FD5A 2WB1N 5F0FA 5EYRA 1YRNA 3S2DJ 3ZQFA 2KT0A 5FKOA 3D1NI 3S1QJ 1ETVA 3QPSA 2ME0A 4B1RA 2DA5A 2EQRA 4QSHA 3HOVJ 3A03A 1HLVA 3GTQJ 2XB0X 2E19A 5K7ZA 1JTXA 2LK2A 5F0CA 4D7NA 1SANA 5EDNA 3IH3A 4CYCB 2YU9J 2JA5J 3PO3J 4XRSA 4BXXJ 1ZKGA 3ZQIA 1OCPA 5DTDA 4I6ZA 5M5YJ 4MLOA 2M2EA 2JA6J 1H89C 1ZQ3P 2XGCA 3H3VK 3WHBA 2LR8A 1BL0A 1ZGWA 3CDLA 2L9RA 1HDDC 3GTMJ 1DU0A 4BY1J 2XPWA 3S17J 2ELKA 1ETOA 5FJ8J 3S2HJ 2I10A 2ZB9A 4JYKA 4JX5A 1MSEC 1U9OA 3TP0A 3K2AA 2MW8A 1ETQA 2XGEA 5IOZA 2GBYA 2O9LA 3HOZJ 1WPKA 1G2HA 2LTPA 5EGOB 3S1RJ 1IGNA 1TWAJ 1MBHA 2AO9A 2VUMJ 3LSGA 3RQIA 4C2MJ 3HEFA 1POGA 2CJJA 3A01B 1T56A 4L5EA 1TWGJ 2Y0SN 3G1LA 2HOTA 2NVTJ 2DMTA 1P7IA 4A3KJ 4UUSA 3BTIA 3BT9A 2W48A 3LSRA 1FEXA 1ZTRA 3IH4A 1F36A 3QQAA 1OFCX 2EBIA 5EZHA 2DA7A 5FKKA 1MH3A 2TCTA 3HGYA 3L1PA 1A6IA 3JRHA 4DW6A 4AYBN 2AHQA 2NS7A 1JTYA 1K83J 1TWHJ 2R5YB 4DZPA 4MFDA 3BQZA 1MNMC 5FLMJ 5F04A 1F43A 1W0UA 2X48A 4FE4A 4C3HJ 2LD5A 2FJ1A 5EF6A 1QPIA 4M6VA 3ZQLA 2E1OA 1I6HJ 4DYRA 3SJMA 2IAIA 1E3OC 1ENHA 3BTJA 1AHDP 1XG1A 2VKEA 4V2GA 4D5FA 4A3JJ 1MBJA 3IH2A 2CUFA 2JA8J 1FIAA 2EH3A 3I4NJ 4XRSG 1GDTA 4C3JJ 3QPLA 4CYCA 1UMQA 1X2MA 3HOUJ 1GV2A 1HOMA 1LFUP 1ZR4A 1IUFA 4EEFG 5JLWA 3S15J 1ITYA 3HM5A 5F27A 1MBGA 3OSFA 3TEDA 3JREA 3S14J 3GTPJ 3SDGA 2DA4A 2R7ZJ 4M3BA 1WGXA 4M3FA 2JK3A 1P7JA 4IEJA 2EZIA 1PUFA 1WH7A 1WI3A 1B8IB 4MFEA 5C44J 2WV1A 5E3NA 4DZJA 1H8AC 4IHWA 3LSJA 4JP0A 5IYCJ 1GV5A 3RZOJ 3OSGA 2M8GX 1AKHB 3MKLA 3BR2A 2DTZA 3O8GA 3S1NJ 3Q0VA 4QTRA 2JWTA 3BR5A 1LE8A 1ZK8A 1RETA 1B72B 4W1UA 3PO2J 2EZLA 3O8HA 4D7MA 2NS8A 3BR0A 3JRAA 2OPTA 3VPRA 3IV5A 2XGDA 4A3IJ 1H88C 3Q0UA 1ORKA 1GT0C 2Y9ZA 1JKOC 2ECBA 2R5ZB 1UG2A 4G12A 1VI0A 3BR3A 4XIDA 3LNQA 2E2HJ 2NVXJ 1EF4A 1JKQC 3E7LA 3B6CA 4IHXA 4A3MJ 4J19A 1Z0XA 1YRNB 2IBDA 3S1MJ 5F0HA 2ME6A 4W97A 1JT0A 3HOYJ 1HF0A 3FKIJ 2LFBA 3RZDJ 1APLC 3JRFA 3G1OA 2P81A 1FJLA 1XC5A 3BR1A 1Z77A 4C3IJ 4XICA 3UKGA 1A5JA 1GUUA 3BTCA 4A93J 4A3EJ 4QIWN 2E2IJ 2DMQA 4FCYA 2Y9YA 4MO7A 4JX6A 3TW6A 1NK3P 5E3LA 5IYDJ 1FTZA 9ANTA 3G1MA 3HB9A 5BNGA 4IHYA 1ZR2A 3HOXJ 3ZOBA 1O4XA 3MN2A 3HOWJ 1WH5A 2COBA 1HCRA 3ZQHA 4A3FJ 2M9HA 4XRMA 3DCFA 2HXIA 1RKWA 3I4MJ 1RKTA 2DA1A 1AU7A 2LKXA 4AC0A 2O7OA 2IEKA 5EG0A 2JMWA 5IPAA 1R9TJ 3JRIA 2K9NA 5J1UA 4X1EA 1MH4A 2VKVA 4HNVA 3FISA 3JRBA 2NVQJ 1QRYA 1U8BA 2XPVA 3JRCA 4NDLA 1VFCA 4BBSJ 4A3GJ 4UUTA 2XRLA 2EZKA 1JT6A 1JUMA 3GTGJ 3M3YJ 2DA6A 2H8RA 3M4OJ 1RPWA 3PM1A 3LOCA 1ETWA 2H1KA 3NAUA 1NTCA
chains in the Genus database with same CATH superfamily
3A02A 2XVCA 4P9UA 1BR2A 5EEHA 4BHCA 2DO7A 1IC8A 5IT9Z 3CF5F 4XN0A 2DA3A 4HEA2 3T1BA 3HSFA 2HDDA 4G6TB 5BOXA 1NG6A 3HPGA 2L0KA 1JI8A 5LD2C 3HL2A 3BC8A 2KJCA 2QSHX 1F5TA 4CA0A 2ZFWA 2ADUA 2OAZA 2VKDA 5CPRB 2QSGX 2R3SA 3CCYA 4XLPF 4KUMA 2VT3A 3E5QA 5J1YA 5LEKA 2LOOA 5FLVA 1ON1A 3SZTA 2FA5A 3U1DA 1T38A 2K9LA 4M74A 2HI3A 1OR7C 5JLXA 2OJED 1TBXA 3O6BB 3OOPA 2CQXA 4Q48A 5D8LB 5K5OA 4S05A 5CYVA 1UB9A 4OIPF 1FZPB 4BHBA 5CVJA 5J3LA 5IP6A 2VODA 4UB6C 4UHTA 2MFZA 5D5XB 1Z6RA 3N05A 4EJTA 4L0YB 4U7BA 2FRHA 6PAXA 4EGZA 3Q0WA 4U88A 1I3QJ 3TGNA 1J09A 1P4XA 5LBQA 2K9QA 1LJ9A 4XMYA 1QVTA 3ECHA 2WWYA 1OCZH 5FKMA 3RYRA 3TL4X 3DTIA 2FU4A 3MAJA 1W36D 2DJNA 3DLLF 2IW5A 3KEOA 4A69C 1VQ8I 1R1UA 4LLGF 5E18F 1A35A 1K78B 3EUAA 2Z2SB 3GW2A 3G3ZA 1VQOI 2LLKA 2JRTA 5IYBJ 3OYCA 4DOZA 4ZDOA 2BXZA 1FTTA 1JJ6C 5LFAA 2ZNYA 4ZH4F 2EFPA 1CF7A 3PQJA 2CV0A 1UZCA 4NB5A 1SD6A 2EV0A 3KP7A 5DV5A 1ZRFA 3GFLA 3KPHA 5DD4A 1X19A 1FOKA 2DDAA 1AWCA 3RJPA 4BJ5C 1B9NA 2NNYA 1ZGAA 2Q2EA 1O3TA 5TISC 2IA1A 1G6NA 1MNEA 2FMLA 5CQEA 5H6RA 3I58A 2C6YA 3GCMA 5B3SH 1T33A 4P5OA 1QNTA 4Y15A 3SEZA 1JUPA 2P0WA 4ETSA 3K70C 4HOBA 5HS8A 2ZJRF 2QLZA 3AG3H 1ZARA 3N97A 3GFIA 5DS9A 1YW8A 4BDYA 2ICWG 1Z67A 5K7HA 4XOPA 2O8KA 2E1CA 1OCCH 2Q0OA 3H92A 5IP7J 2X9DA 3TO7A 1S7EA 3FK7A 4IJAA 3BQYA 3L00A 4UV9A 1T8IA 4A3CJ 1IDYA 1O3RA 2WAQN 2ECCA 4GRIA 2HQ5A 3MEXA 1LFBA 2XSDC 2BVLA 5C3EJ 4XOTA 2ZSIB 2L2OA 2CQQA 2QSFX 3FXRA 2IGOA 3HKZN 1GVDA 2NOJB 1XGOA 3ASNH 4RDUA 4UNOA 5HVQC 1R5HA 2X6OA 2DFHA 2W7NA 4LITA 1DQUA 2GOXB 4N4NB 1EH7A 5E8GA 2VXDA 4CCNA 4D5CA 4CZZA 2VQGA 2AQEA 2I5UA 2M0CA 5BQTA 3PL8A 2DXIA 1T95A 1ZYRF 5AONA 4QPQA 3E6DA 2XB5A 4I76A 3BG5A 1JHFA 2HYJA 3CZ6A 3TO6A 4KT6A 4I01A 2M4KA 2EIKH 3P7NA 3FHZA 2QBYB 5KAFC 2MD0A 4A3LJ 4BS9A 2DBBA 1ETKA 1VF9A 1OCTC 1T0FA 3GTOJ 1FBSA 2XPUA 3SEQA 1JGGA 4N0BA 3H5NA 5F08A 1SD7A 3NARA 2BE5F 3H3UA 3S16J 3GBGA 4EMSA 1WCMJ 3CMEI 1G3SA 2M5WA 2Y31A 1NK2P 2B63J 3GX4X 1T0FC 4KA4A 2V9PA 2WB1N 4ZTFA 2LNBA 5FO5A 4G6QA 2HVQA 5FKOA 3SFZA 4XRFA 2WAEA 4L9TA 3S1QJ 4E6KG 1HBXG 4KT5C 2ME0A 3GUDA 4LB5A 3GO5A 3M07A 1ZG3A 4QSHA 2RC4A 5CVIA 1WI9A 3M8JA 1XCBA 1X3UA 2IGKA 3ZQQA 3GTQJ 1XSXA 4Z2YA 3DBLB 2ZXIA 1Z91A 2L5QA 5FFXA 4CSWA 2YU9J 2YSRA 2F4MB 1O57A 1SVLA 2KL4A 3FXLA 3ZN0A 4YFXF 1G4DA 4BXXJ 4Q5SF 1ZKGA 2VE9A 4ZZDA 3MQ0A 2XKPA 2XGCA 4N9HA 3H3VK 1ZGWA 3CDLA 1HDDC 1CGPA 3DTKA 1A31A 2K4JA 1AOYA 3SXYA 1QZEA 2XPWA 2M0MA 3ROUA 2IT0A 2DOFA 3ZPLA 3P5JA 3D5SC 1FWZA 5FJ8J 3S2HJ 2HDCA 2VOPA 3I53A 4JYKA 2CW8A 1MSEC 1QU3A 4E7LA 1U5TA 4LG0A 2L4AA 3PIPF 1D0YA 1WFXA 2DQLA 5J40A 4HQEA 3K4BA 4I0BA 4LB6B 1WPKA 3I54A 1G2HA 4AIJA 3R4KA 4WWCA 1VQ4I 1S7OA 1NH3A 3LAJA 2LMDA 3I9V2 3KP2A 1U5TC 1IGNA 4YRVA 4RAFA 2VUMJ 2EV5A 3G6EI 4EATA 3F6OA 3O2PE 3K1PA 3J80K 5DDGA 2CJJA 3JCUC 1J5YA 3F9KA 2DT6A 2ELHA 4RGXA 2KHMA 2Y0SN 1HXDA 3PFIA 3MKZA 2YU3A 2X6XA 1X1PA 1P7IA 5K5QA 4A3KJ 3ISPA 1BN5A 2W48A 4IKFA 4ENJA 2CWEA 2R7OA 2HS5A 5E1WA 4A2UA 5D4RA 1K4SA 4CICA 3FBNB 5TRDA 4HF1A 4DW6A 4F92B 1E17A 4AYBN 2X1CA 5KNLA 5ICGA 3K69A 1R00A 2LKPA 4XL9A 2GAUA 2ZXWH 1TZLA 2V1DA 2M45A 3CCUI 2DI3A 4XKCA 3A1YA 3KIOA 2VN2A 4XKVA 4DZPA 1B4AA 4M9XA 5D5UB 3WU1B 1X3WB 3DP7A 3PFYA 2FJ1A 1OYYA 1QPIA 1Y56A 3RIRA 2G7UA 4DYRA 2VONA 2HPIA 3MFKA 4BXUA 1R5ID 3V42A 1AHDP 3D0SA 4HNUA 3HXLA 3COAC 4A3JJ 4F91B 1MBJA 3IH2A 2JA8J 2EH3A 2XAJA 2VBYA 4CYCA 3QPLA 4C2TA 4WF2A 1X2MA 1LNWA 3KZIC 3HOUJ 1LFUP 4RM3A 3S3MA 1ERDA 4LLNA 3OMYA 3QOEA 1IF1A 2ETHA 3I3LA 2A6EF 2VBXA 4II3A 1F4KA 4HAMA 2XGXA 4F93B 3JREA 1K78A 4WK8F 1SFEA 3P9CA 2FBHA 2R7ZJ 2PJRB 1WJCA 3NQOA 4M3FA 4PJLA 2HU9A 1P7JA 4BE0A 3GFJA 5LGNA 3IHUA 4PDKA 3EPZA 1B8IB 4MTEA 4MFEA 3W6JB 1SAXA 4H0EA 4IQJA 5E3NA 4HG2A 1H8AC 3SYTA 4O5VA 2V1XA 2WADA 3OYHA 5IYCJ 4XONA 4HX8A 3OSGA 2OQRA 3ML6A 4BL0B 3ERED 2F2EA 1FBUA 2CH0A 2JPBA 2JWTA 4XLFA 2QQ9A 3IC7A 2BW3B 1HSTA 4W1UA 5BPIA 4D7MA 3C3WA 3JRAA 2X6WA 3OS2A 1N75A 3HRSA 2XGDA 5JHUA 2I8DA 1TLHB 5L3FA 4XLEA 4G12A 4HA8A 2R7SA 2JSPA 4XIDA 4AYBA 1Z6TA 3EYYA 3E7LA 3NEUA 2FQ3A 5J8CA 2L7KA 3LSKA 4IL6C 1Z05A 3FHNA 4AD9A 2PFBA 1Z0XA 5GTHC 1YRNB 5BS6A 1JT0A 5FLXZ 2F5EA 3OYJA 3KETA 3LSMA 2A5WA 1J59A 1N78A 3L2QA 1APLC 2P8TA 3JRFA 4I0AA 1XC5A 2ISZA 4O3MA 4HLXA 2HQRA 3MMYB 3WU2C 1BOBA 3HHHA 2DT7B 2XC7A 2ZSHB 2VJ4A 3HUGB 1K7AA 2KDOA 3A0BC 3LFKA 3S2WA 2Y9YA 1U2WA 4MO7A 1E3HA 4XBFA 4NC6A 3C2HA 4NC8A 3TW6A 2O6GE 5IYDJ 1FTZA 3U21A 2PBIA 2ZKZA 1KQ8A 3RKXA 1O4XA 2LBFB 2QBYA 5IT9K 1LKXA 3HIFA 3HOWJ 4LJZF 1BR1A 2XRNA 3BOQA 1BI1A 5K5RA 5F64A 2M9HA 2V9KA 3DCFA 1OYWA 4XLHA 3I4MJ 4WXDA 3R61A 1YS6A 5D5VB 2LKXA 2O7OA 1S9HA 2JUGA 3U9GA 2KZGA 4D0PA 1CF7B 1A6QA 2HYFA 5IPAA 1R9TJ 3AL0B 3JRIA 2Y48A 2JQ7A 1ZRDA 2FEZA 1MH4A 4S04A 3JRBA 2NVQJ 3EETA 2KP6A 3OWTA 1QRYA 1TNSA 2M1BA 2Q8KA 3S32A 4XKWA 3JRCA 2CW7A 1VFCA 1JUMA 1I39A 3E5XA 5FRNA 3AFHA 2H8RA 5TJJA 2M4GA 3M4OJ 3E1SA 5ED4A 4IQ4A 3K1NA 3QWLA 4B09A 2H1KA 3B73A 2XAFA 2EFWA 1U0JA 1K4TA 4GDFA 2NNNA 2O61A 3VYRB 3BZ6A 4BXFA 4BNCA 2ZXHA 2LY9A 3AKZA 4KNYA 2FBIA 5ILUA 1JJ8C 2H6CA 3H0GJ 1HKSA 1ODDA 2KZVA 3SZGA 4ESFA 3CO6C 2DQRA 4LGWA 1FMVA 1KGSA 4D9JA 1MSFC 2AQFA 3X2QH 4WCGA 2IA2A 3HSRA 5M5XJ 2LY2A 3FM3A 1IDZA 3CCRI 1VQPI 1OPCA 2NXNB 4A0ZA 4ZTJA 1WJBA 2LP0A 3ZMUA 2COMA 1ZG5A 2E1MC 2GLOA 1QPMA 1UHSA 2AXLA 1W0TA 4NC7A 1D1CA 1W36C 2CUEA 1SC7A 4YFKF 4DBRA 1DP3A 4A5NA 4IXAA 1SEUA 3CCEI 4BHPA 3KLOA 5EZGA 2L4MA 3F0CA 2ESNA 2V1NA 4BJ6C 3KP3A 3OIOA 1OJLA 2DFEA 3BPXA 5DM7F 3HGGA 3KYCB 4Y33A 5J4YA 1TWCJ 4A5MA 4TV7A 2BGCA 1XMXA 2RAEA 2OC6A 2CQ7A 3LWFA 2RDPA 2DMNA 2FMYA 2BY3A 3OOUA 3DV8A 1B6AA 1DDNA 3BG3A 4FISA 2ID6A 4G8XA 5F1JA 1BW5A 2KRCA 3IAS2 3TDZC 3CF2A 3HOSA 2VKHA 1X3ZB 3DPUA 3PNYA 1IXSB 1HSJA 1DU6A 4MTDA 1MBKA 4XLNF 4ABZA 2QCOA 3L2UA 2L7MP 1O7FA 4BYYA 1Y1WJ 4YELA 4FHTA 1AA7A 1O7LA 3BROA 2RNGA 2BY2A 1YJNI 4KN4X 4MQVA 5E3MA 3TP3A 3KLNA 1TL8A 4I02A 2QM3A 2G9WA 1R7JA 2F5CA 1FIPA 1XTAA 2JZYA 2KMUA 3LL7A 5F6FA 2PMZN 1KQ9A 4FE7A 1IV6A 2VPRA 3C2BA 3DWLE 2LYCA 2H09A 2LG4A 1MBEA 3ZRGA 5L3BA 3FX3A 3VDXA 4U0VA 2KIMA 4KITB 3CD6I 3IRRA 4E70A 3CMYA 4LIUA 1GLNA 4FX0A 5CVRA 1SMYF 3ZQ7A 3Q9SA 2DMUA 2HVSA 4EGYA 5DM6F 3KX2A 2X85A 2W85A 4AIKA 1UAAA 2PJRA 4UY8I 4IHSA 4DYCA 5BMZA 1CQTA 4K2EA 3VB2A 1WHUA 2GQQA 3EUHC 1V3FA 5J6XA 2FNAA 4XK4A 1X2NA 5LHIA 4B4CA 3P9KA 4RBOA 1TWFJ 1YO5C 1B8IA 1HKTA 3KZYA 1BJZA 1K61A 1RUNA 5LEJA 1T2KA 1BW6A 2Y30A 1X1AA 5JFRA 3W3CA 4J00A 2R92J 1LEBA 4ZC3A 4B44A 2V79A 4L18B 1IXRC 4QLCU 2K9MA 1Z7LA 3E0JB 3LSPA 3EQLF 4Q47A 1MNDA 2BW3A 3L2VA 3F8FA 5E3OA 1LDJA 2Y0MA 4XR6A 2KFDA 4KMUX 4HBLA 4C9YA 2HQNA 4OAZA 4ZZLA 2JT1A 3DPLC 2FUG2 3PNVA 2PMHA 2L01A 2G0EA 2H6BA 1Q1VA 3V7CA 5EG0B 3RI4A 5FRMA 4WXHA 4UB8C 5F0FA 4IRGA 2F5VA 4QWQA 1YRNA 2BXYA 4PSWA 2KT0A 2XAGA 2M8EA 2ZCWA 3T5XA 3QPSA 1YJ9I 2EQRA 4EVIA 5H20A 3HOVJ 2DOAA 4UVCA 4NNJA 1HLVA 3N4MA 3QU3A 1LUJB 4HF0A 4L0ZB 4XKBA 1B59A 1JTXA 3HUGA 2QZ8A 1J75A 1IUYA 1SANA 2H94A 5EDNA 4CYCB 2HZTA 2JA5J 4BQNA 1GXPA 2EFQA 5DTDA 4I6ZA 2HWVA 1JGSA 4B8XA 4MLOA 2PEXA 2LBFA 1VQ9I 1ZQ3P 2VASA 3CC7I 2ZBKA 3WHBA 2L9RA 1PUEE 3CC4I 1KZHA 4BY1J 1HA8A 5E17F 1LVKA 3OYKA 4UVAA 3S17J 2HZDA 2F6CA 1ETOA 4HNTA 4PJ0C 2WY7Q 2KIFA 3BJ6A 3QODA 4L5JA 1UFMA 3OYDA 2ZFUA 4U87A 2L9NA 1UELB 4Y3OA 3WTTC 3K2AA 3OYNA 3G73A 2BYVE 3HZJA 4HLYA 2VOOA 3CCQI 3WTVC 1FPQA 4B48A 1Y0NA 2FXAA 2HR3A 2X1EA 1TP4A 3LSIA 5E20A 2GZWA 3KE2A 5D6FA 3AL0C 3K2ZA 1TWAJ 3ZMZA 4BQQA 3LSGA 3RQIA 3M7GA 4L9NA 2OUMA 1R58A 1POGA 1BI2A 3OY9A 1WVRA 1YITI 2X0LA 1FLIA 1KU3A 2GXGA 1VQNI 2R7UA 4EM2A 3J7AY 4M6YA 1PJRA 2DMTA 3OYAA 5AIPA 1IV8A 3RKWA 3CUQB 2D45A 3BTIA 2CQKA 4MEYF 3BT9A 4RAYA 1WJEA 4GO1A 3KFWX 2VT2A 4ENNA 3T8TA 2LRDA 1FEXA 4I2OA 1KONA 5EZHA 2LDUA 4OIOF 2MC4A 4WX9A 2TCTA 1TNTA 3HGYA 3C18A 3L1PA 1EJ9A 4BU2A 2JUCA 2AHQA 1DPUA 1XB4A 2V6CA 1EKEA 4IF4A 3O3KA 2A6HF 4I09A 2BBYA 2Z3YA 1J0RA 2R5YB 3H36A 4FT8A 4AU7A 2R7VA 3BQZA 5ICFA 3PQKA 4WXCA 3V8LA 5F04A 3WG7H 2IS4A 2FBKA 2X48A 4FE4A 5JVTA 2AS5F 2LD5A 3L7WA 1REPC 2HKOA 2E1OA 3DQVC 5B1AH 3FMSA 1QBJA 3RDIA 1QZZA 3NWSA 5H6QA 3ERMA 1YIJI 1WKMA 5JVGF 1FYMA 1XG1A 1WWXA 4XSZF 3S93A 2VKEA 4V2GA 4D5FA 1IZ1A 1YIOA 2CUFA 1FIAA 2E7WA 3REOA 1YX3A 4XRSG 1GDTA 4C3JJ 4BACA 2IVMA 4P55A 4KJZA 2RN7A 4N9IA 3UNGC 2CUJA 1OMIA 3HHGA 1MMAA 1IUFA 4A0YA 4CYDA 3FF5A 4EEFG 5JLWA 1FOYA 3S15J 4ITVA 2O3FA 4AWXB 1ITYA 3J7AO 1MBGA 4AM3A 1RI7A 1XX5A 3TEDA 3OSFA 1J9IA 4M72A 3VYSB 2R7WA 4M3BA 4YIFA 3BJOA 1PYVA 2CMPA 1MJBA 4HDUA 5FLXK 2KRFA 3ASOH 3PUFA 3DEUA 3E5UA 1H9GA 4ENKA 1FT9A 3LA3A 1R71A 1Y8QB 4DZJA 5H2FC 1SD4A 1I5ZA 5AIQA 3LSJA 5LRRA 2E5NA 4JP0A 2UXNA 2W4SA 3BZKA 1GV5A 3RZOJ 4XM3A 4M73A 4XORA 2M8GX 2BY0A 1FNNA 2MC3A 3M1CA 3MKLA 1BJAA 3Q9VA 3LAPA 3F8MA 3O8GA 3E3VA 2QKLB 3Q0VA 3BP8A 2IPQX 3BR5A 5FROA 5DCFA 4ESBA 3CP2A 3TMOA 1IXCA 2HDWA 3NWTA 2WAQA 3O8HA 2P5LC 2QGUA 3BR0A 1WJDA 4HF2A 4F7ZA 2NYXA 3GVAA 1G3WA 3VPRA 3IV5A 3M1EA 3Q0UA 4E7KA 1H0MA 2ECBA 1D8KA 1MKMA 2GA2A 2R5ZB 3HKZA 4AIHA 1VI0A 3BR3A 3LNQA 5J4VA 1JKQC 5F1RA 1W4MA 2P7CB 4FETA 2LF8A 4EM0B 1ULYA 1MMSA 1ONVA 1UHWA 1I27A 2IBDA 2RQPA 2XDVA 1ZGJA 3BZCA 3FKIJ 3ZXSA 4OMYA 2P81A 2L3DA 4DBQA 1FJLA 2IXSA 3AAFA 3CJRB 2DPDA 4L9VA 3FXJA 3I56I 2HEOA 3FXQA 3BR1A 4C3IJ 1A5JA 1XGSA 2VIXA 1GUUA 1OISA 1WJ5A 3LSTA 1XDUA 3S8PA 2B9SA 2DMQA 2Q1ZB 4CHUA 5DUKA 5GAEJ 3OYEA 1A36A 1S5LC 1D3YA 1J7KA 2P6TA 3K4KA 2STWA 2ISYA 4RGUA 2XF7A 3G1MA 5L3EA 3IRQA 1YX5A 2EPFA 2EINH 2E71A 3CCLI 4AVZA 2WB1A 3J81Z 1ZLKA 3OYIA 1PVEA 2VQHA 2XKOA 2HXIA 3GEZA 3OV8A 4A6DA 3OS1A 1S8NA 1XCVA 4MEXF 1RKTA 1HW1A 2HNHA 1LB2A 1X1DA 1AU7A 4MHGA 4Q4ZF 3PIOF 1G59A 2OD5A 1EV7A 5EG0A 1LDDA 4HYEA 1SMTA 1ZELA 4ASNA 3GLLA 4X1EA 4HNVA 1YJWI 2VXZA 3QPHA 1EH6A 4PGHA 5HLHA 3DKYA 4KFCA 4UUTA 2WA0A 2BEOA 1JT6A 2E60A 3DTEA 2BZTA 4OWRB 3KYLA 5HS9A 4IO9F 1RPWA 1ETWA 1NTCA 2YR2A 3SFIA 2R7TA 1OQYA 5J1RA 3W2WA 1LQ1A 3F6VA 3DKWA 3JRGA 1ETXA 3PNTA 3WGGA 2JN6A 2XUBA 2MG4A 1LDKB 3DLAA 3MZ8A 2V4JC 1MBFA 5DEQA 3W6KB 3GTJJ 2DYSH 2E2JJ 5HDNA 5EEAA 3LA7A 1S29A 3BTLA 3QPTA 5K7FA 2O5RA 4E7JA 4RAGA 2DN0A 2JTVA 3ELKA 4ENMA 2QKMB 2K3PA 4BDZA 1D0ZA 2GIZA 3BPVA 5J47A 5C4JJ 4Y13A 3JRDA 1IAWA 4HSTA 2WTEA 3V7SA 2NS0A 5HDKA 1Z21A 3ABLH 4JOMA 1MDMB 2IS6A 2GXBA 4FTHA 2Y0SA 5LHGA 2DAOA 3H3ZA 1ZRCA 1R1VA 2M3AA 3L09A 3CMMA 5CJ9A 3ZQGA 2K40A 4NBQA 3B02A 4Y52J 2O8XA 1LFPA 3FBIB 4LG3A 3WHCA 3HRTA 3RPQA 2VPLA 1A04A 1FOWA 1T08B 3IWZA 1JKRC 2Z9OA 3KEQA 1HC8A 2XF5A 2ZJ2A 2MSYA 3IUOA 2KLOA 2LVSA 4LK1F 3CLOA 1HW2A 2EV6A 4GCVA 2RVCA 2D5VA 2TRTA 3WTWC 5IP9J 1RNLA 3CUQA 2KISA 4BBRJ 3Q3SA 3RSNA 2NVYJ 2NOGA 5LGTA 1QA6A 4IHVA 4LOCA 1V54H 2YPRA 5M3MJ 2QEXI 2KKOA 3K7AJ 5E8IA 3FMQA 2L9VA 3OYMA 2FQ4A 2QA4I 3K4NA 2YS9A 2QF7A 2IP2A 3CUQC 1WJAA 3MWMA 4UVBA 3CUOA 1TC3C 4UXNA 1FP1D 2DPUA 1XS9A 2R5YA 1TTYA 3RYPA 2FX0A 4BGDA 1IJWC 1E0EA 2EK5A 2IA0A 5E1ZB 5GPCA 3M8FA 2NVUB 1BIBA 5HDGA 4M9SA 2G7HA 3HPHA 5M3FJ 3ZCOA 3CC2I 4BKXA 2VI6A 3JR9A 5ILVA 1TT0A 3CJNA 3F21A 1XN7A 5M5WJ 2FF4A 2D2WA 2TDXA 2VE8A 4S0HB 2MGQA 3F22A 4A3BJ 1P6RA 1HW5A 2JPCA 1R36A 1UCRA 4PFOA 2ZMEB 4IX7A 2DW4A 2Z1DA 1Y8RB 3CCVI 4HQMA 4B3AA 3BG6A 4KICA 3H5RA 4LFUA 4IZZA 3ZMSA 5HOOA 2K27A 4XQFA 4PCQA 1S7AA 4ZYDA 1VTNC 2HFHA 1SVMA 3GTKJ 1D0XA 4RB2C 3TQNA 1BI3A 1U6GA 2JJ7A 3G2BA 2VJIA 4RA2A 1XGMA 5HLIA 2LC2A 4X0GA 2NAZA 2DDBA 2RV8A 3R0JA 5GAHJ 3BY6A 4IVNA 1L0OC 3CP8A 3LSHA 4D1QA 3FKJA 2EZHA 3HBLA 4ZYHA 1IG7A 1FSHA 2WV0A 3RPUD 3HYIA 2CU7A 3GZNB 3JSOA 1MD0A 2CS3A 3TDUC 4ZYEA 2VC1A 4GYIA 3BR6A 3HTUA 3K10A 5D8KB 4LK0F 1JKPC 4I7HA 2M34A 3CJTB 5LGUA 3ZGKA 2Y2ZA 3TOAA 2GWRA 2V9VA 1MMNA 2DA2A 3E6MA 5E79C 3SZPA 1R6RA 3ZQCA 2YUSA 3K1MA 4PJJA 4OIQF 3DEWA 1KYZA 1DGWY 2K86A 4M3DA 3M8EA 3M9AA 3RTRA 5FKLA 4YFNF 1SFOJ 1JUSA 2R5ZA 3W2AA 2MLGA 5GP9A 4BH9A 1RR7A 5FKNA 3R6SA 4HRIA 1LVAA 2XF6A 2FSWA 2JA7J 3I55I 1DP7P 2FD5A 5CKTA 1XSVA 5EYRA 2E36A 3ZQFA 1YE9A 5CVVA 3V8KA 1IN7A 2WBMA 5J8FA 4B1RA 1KU9A 4NQWB 1W7PD 3WGHA 4OMZA 2R7FA 2XB0X 2IJLA 4GYGA 5K7ZA 4L9JA 3K6GA 3V7RA 1FP2A 5F0CA 2RREA 4D7NA 1Q1HA 2JVGA 2XASA 3IH3A 2HPMA 3U2RA 2JVHA 3FXOA 2OZ6A 2HOEA 2VQLA 2HTSA 2HTJA 4OAYA 3HRUA 4MNUA 1OCPA 3ZQIA 1IRXA 4L5IA 5M5YJ 2M2EA 2JA6J 4G94A 1H89C 4ZJZA 5D5WB 4RB3C 1F1ZA 1KA8A 1XMKA 2LR8A 3CTAA 1BL0A 1Z7UA 4NHJA 2R7XA 2R7QA 2WY8Q 1SVOA 2MA3A 3K4MA 3ABUA 2VQCA 4KDPA 2ELKA 1YW7A 5KHDA 5KK1A 2R7DA 2QUFA 2ZB9A 4OINF 1B9MA 2IGNA 2MW8A 2OCEA 2UWMA 2KIUA 2W57A 1WQ2A 4RGSA 5ERIA 3VFZA 5IOZA 1I6XA 1ZREA 2Z16A 3BDDA 4HV6A 5DUIA 2XSJC 3DFGA 1BIAA 5EGOB 2HQAA 1OCOH 2AXTC 3F3XA 1N77A 4P1WA 3ZMDA 5HNHA 1BI0A 4UUVA 3K9TA 2E7XA 3A01B 1KU7A 3I59B 4CDGA 1T56A 2ESHA 4IRHA 3QAHA 4RB1A 4B47A 1T98A 1IN8A 3ABKH 3JSPA 4IOCF 2HOTA 2NVTJ 1QGPA 1RIOH 3GF2A 5HS7A 2M30A 1P2FA 3GMEA 3AG1H 3ZMVA 2MYSA 2LY1A 4BUPA 1MIJA 2E34A 3EUKL 4CCJA 2P4WA 4C2UA 1Y0UA 1OFCX 4XLCA 3VSLA 2DA7A 3DF8A 5FKKA 1A6IA 1O3QA 2NS7A 1JTYA 1YYVA 1FC3A 1TQMA 3OYLA 1SFUA 2RKHA 1K83J 3H0DA 4FQGA 1IN4A 2MLKA 5CLSA 4MFDA 3MCZA 4OU0A 1F43A 3FXKA 1W0UA 3OR1C 2IRFG 4FASD 4XNFA 4G6DA 5B66C 1MDMA 2K4BA 3KEYA 5EF6A 3ZQLA 2H8WA 3PJRA 1BR4A 2P5KA 1FOXA 2IAIA 1ENHA 2L02A 3HC7A 3CCSI 4B3XA 1XMAA 4XLAA 2FOKA 1FSEA 4F3QA 3VODA 1V55H 4CXFA 4A12A 4A6EA 3I4NJ 3V4GA 4BEHB 2IS2A 5TGTA 1WRJA 1ZAOA 2F4IA 1MJ9A 4HSRA 3WTYC 2ZJPF 5D6EA 1V5FA 2IGMA 1ZR4A 3EDPA 2EB7A 1B1BA 1M1EB 3A4CA 4IRIA 1Z3XA 5F27A 1WZ2A 1TQIA 2ZXJA 3GTPJ 2J5PA 1YHQI 3SDGA 4LMYA 1OR7A 2K02A 4BQAA 4GXOA 4KN7X 3J7ZI 4IEJA 2EZIA 1VQ6I 2PMZA 1WH7A 2MABA 2A3SA 3QOPA 2UZKA 1JE8A 5BPDA 4MQ9F 3OS0A 3BWGA 3W2VA 3HTSB 1SFXA 1FMWA 3F23A 4IHWA 1YG2A 3DBHB 2A5YB 4G7HF 2OCCH 1W7PB 1U3EM 4DQ2A 1NG7A 3TO9A 1AKHB 3IWFA 2DFIA 3BR2A 4PZJA 1OCRH 4QTRA 4R1HA 1DGRM 1RETA 2QQ8A 3GZ5A 1B72B 2EIMH 3I0TA 3PO2J 2ZMEA 1VQMI 2NS8A 2E1NA 2RNJA 4PSXA 4DIQA 1MMGA 3CCJI 2CV2A 1EA3A 2OPTA 2EFNA 3J81K 4BE2A 1JKOC 4A3IJ 1GT0C 1YI2I 4AIDA 1UG2A 2EA2A 2ACJA 1EF4A 3A0HC 3Q5FA 3LQRA 2ZMEC 3B6CA 1MW7A 4IHXA 2JA2A 4RGRA 3S1MJ 1X4PA 5F0HA 3H9GA 2JRMA 1BBYA 1Y6IA 3ZMTA 3RZDJ 3G1OA 1RC9A 5DCMB 3VEPA 3QYFA 2JSCA 1ON2A 2KQRA 3R60A 1SD5A 2P5VA 4A3EJ 1I3AA 1TW3A 2YX7A 1RRJA 1TW2A 1X4OA 2F5FA 4RMNA 5ICEA 2VLAA 1NK3P 4YIIA 2V7FA 5A2QZ 5E3LA 3KCCA 3WTSC 5CQGA 9ANTA 3I4PA 2CO5A 1ZR2A 1G3TA 5FFZA 2FNPA 3ZOBA 3S3OA 4KIBA 3L2WA 4C30A 1WH5A 2COBA 5DD8A 1BC7C 3ZQHA 2MD5A 4KIGA 4ZDLA 4XRMA 4EV0A 4FX4A 2HVRA 2HKXA 4HX7A 2DA1A 1F9NA 1FY7A 1Y39A 2DTRA 3AG4H 2IEKA 4EJWA 2DLLA 3VYUB 2FE3A 3RQ4A 2OU2A 2M87A 4HPQA 2JMWA 1EH8A 2K9NA 5J1UA 2Z5UA 2VKVA 3IP4B 1R22A 3FISA 4KYWA 3OR2C 1ZH5A 4RB0A 2KJBA 1OYIA 2RQQA 3DXJF 2X51A 4A3GJ 1O3SA 4NQWA 3GTGJ 2OZUA 4CO8A 2UXXA 1QQIA 1OKRA 2KRHA 2DK8A 3PM1A 4R8HA 3JTGA 1YLFA 3E6CC 3PSFA 1ACIA 4HX4A 3T0YA 4R79A 1K6YA 4X6AJ 2E5ZA 5HLGA 3BG9A 2R0QC 2BHZA 1GHCA 2W25A 3FDYA 4OIRF 4EJVA 3KP5A 2PJPA 1V5GA 1UHMA 3C7JA 1ZHFA 2R93J 2V6EA 2LH9A 4UUSB 5GPAA 4A3DJ 4U0WA 1NHAA 4RLFA 2EJRA 1U9NA 3BCBA 4V2FA 5IY5H 3I64A 4NUBA 4PJMA 4ON0A 1Z3YA 3K4JA 2D1HA 3SQNA 2OF7A 3B6AA 1QZYA 1Y1VJ 4Y17A 4CCKA 5HLTA 3L2RA 3OL4A 4N4OB 2R7RA 2A6TA 3TOBA 3WG9A 2QWWA 3JAMZ 5D4SA 3EYIA 4XN3A 2L7ZA 5C4XJ 5EGOA 1X58A 2ZC2A 3BG7A 3IL2A 3RKQA 1XGNA 3HSEA 5E1XA 1VNDA 1T6SA 1IO2A 1ETYA 3FK6A 2DODA 3A01A 2DOEA 1D5YA 3DU5A 3I59A 2X4HA 4E7SA 4RAZA 3FMRA 2V1UA 3HOTA 3FM5A 2KPMA 1E3PA 3RKYA 3CCMI 5GADJ 1TT5B 4B43A 2BY1A 4I98B 1U78A 1P92A 5B1BH 2BV6A 1BOAA 2E1MB 2PMUA 2O03A 4PK4A 3T8RA 2LREA 2K9SA 3CJQB 5FB2A 2PLYA 2XV4S 2F4OB 1FYLA 2R4GA 2MH9A 1SAUA 2CRGA 3FIWA 1PUFB 4M3GA 3S3NA 2LKSA 4GFBA 2QENA 2ID3A 3ONQA 4JK1X 1C0WA 2MBFA 4M71A 4Y7NJ 3BJAA 4E7ZA 2QQAA 1BA5A 5KCMA 3I71A 2N8GA 3BLYA 3KP4A 5ILSA 4MIMA 2GM4A 3RPUA 3OYBA 2DJIA 1J2XA 1LE8B 1LEAA 1V5EA 3OYGA 1YW9A 4U7DA 1E2XA 2YX4A 5KAIC 4BY7J 3W6VA 1GXQA 3CESA 4BEHA 3K4LA 1D5VA 3TW7A 3LA2A 4E4HA 4Z6YA 2W82A 1TQPA 2B0LA 1RESA 5IOYA 2HOAA 3E6BA 4M3EA 1XPXA 3H1CA 4Y4RA 3G71I 2LSOA 3U1KA 1QVUA 2OA4A 2PQ8A 3NRVA 2KDZA 3CMAI 1STZA 4JX4A 3ZP5A 2HXOA 5KVRA 4XSXF 4J01A 1YOVB 2X6YA 5HODA 3OYFA 2VC0A 3GLXA 3ABMH 4ZDPA 3GTLJ 1I50J 2CQNA 4DJAA 3MVPA 4RLQA 2Z33A 3GFMA 4AUXA 4DYQA 1HDPA 3L2CA 3K70D 1IRZA 3H35A 4MGRA 3F8NA 1W7PA 2IS1A 2Z99A 3CQZJ 1D1BA 1QHGA 2DMPA 2L9SA 3MZHA 4KISA 1AKHA 4CCLA 2XAQA 1YTYA 1IW7F 2GOMA 2PX9A 4I99C 3WTUC 2V26A 4DNCA 3FXUA 2L7FP 2XHKA 1W5SA 1B72A 1R4NB 2ZNZA 2UUZA 2F5DA 2HOSA 2PN6A 5GTIC 3HDDA 2CV1A 1ZLJA 2EFOA 2HGCA 3PSIA 1RR8C 2QYOA 3WODF 2MH2A 1R5GA 3GWZA 3LQQA 3KYDB 3ZR8X 2DFFA 4P9FA 1XSDA 4CUGA 3CDHA 1I1GA 4UV8A 3S2DJ 2M7BA 5FD6A 3GZ6A 3D1NI 2VBZA 3L9FA 4IPAA 4ANJA 1ETVA 2EIJH 3OL3A 2OV7A 5DCMA 2DK5A 4CCOA 2DA5A 1MGTA 3A03A 2K5CA 2E19A 2XIGA 2WAFA 1U8RA 2LK2A 4LIVA 2A07F 2DYRH 1MJAA 4IOAF 3PO3J 2CFXA 4XRSA 3ZN1A 3BCAA 4HV5A 2ZO4A 1FBQA 2CGPA 2EILH 1IN5A 1VZ0A 5IT3A 4BAYA 5JHFA 3GTMJ 1DU0A 1P4AA 3C2GA 2H1LA 3H9QA 3SHFA 2CYYA 4E7IA 3WTXC 2I10A 3CLQA 1PP8F 3QYBA 4JX5A 5CVUA 1U9OA 3TP0A 1ETQA 2PG4A 1DPRA 5LLQA 1RUOA 2XGEA 4IHTA 1GVJA 2CSOA 2VB6A 3WE3A 2GBYA 2PI0A 2O9LA 1IRFA 3HOZJ 2DU9A 4BQOA 3PUBA 2LTPA 2VJJA 1IN6A 2DT5A 3S1RJ 5DYMA 3C1DA 3D5RC 4PGGA 2AO9A 1MBHA 1KQ0A 1FYKA 4F52A 4C2MJ 3WGIA 3HEFA 3R0AA 1DUXC 3I5UA 4G9YA 4M6XA 4H4KC 2BVMA 4EQQA 4L5EA 2CUZA 1TWGJ 2P7VB 3G1LA 3TKYA 2A05A 4GGGA 3HJEA 2EWNA 4JBAA 2EA4A 1X1CA 5JI6A 3ESWB 1PDNC 1G3YA 4UUSA 3LSRA 2GXAA 1X1BA 2W00A 4LD5A 3QP5A 1ZTRA 3IH4A 1F36A 1JXSA 3QQAA 2EBIA 1OLTA 2UV1A 1MH3A 3ABTA 2BOLA 1ZN2A 3RCOA 3JRHA 1VQLI 4LLLA 3DEEA 4EJUA 4ZYGA 2VBWA 3VSKA 2VJ5A 1S72I 4YEJA 3ECOA 1TWHJ 1VQ7I 1MNMC 1FX7A 3CDIA 5FLMJ 4C3HJ 2Q2EB 2QVOA 4YIRX 4BE1A 3IAM2 1R49A 1YFHA 2OQGA 2VL8A 4M6VA 1I6HJ 2OTJI 2A68F 3F8BA 3FZVA 3J80Z 1VQ5I 3SJMA 3P9IA 2O0YA 1E3OC 5L3GA 1BC8C 3BTJA 4CH7A 2K3FA 1KYWA 4PJNA 1S3JA 3MD2A 3HRMA 1UJ8A 3WU0A 3OIQA 2CFOA 2Y75A 1MMDA 1VQKI 3K4CA 1UMQA 4OOIA 4PFPA 1GV2A 3H9JA 1HOMA 2WC2A 4EJOA 4HZFA 3QP6A 1ZG1A 3HM5A 2ZJQF 3DBRB 1HQCA 3S14J 3ULQB 2P6SA 2W1OA 2QQBA 4CGZA 1KU2A 2DA4A 3D5LA 1WGXA 3FXMA 2F48A 1USSA 2JK3A 1R1TA 5B5EC 1G8XA 1H9TA 4A0XA 5JR3A 1PUFA 3V8JA 4F55A 4V19K 1WI3A 4QPOA 1JHHA 5C44J 4RM2A 2STTA 2WV1A 4U0YA 3DPTA 2H27A 1N25A 1YQAA 4ZYAA 5LRSA 4G7OF 1Z1DA 2W24A 2DTZA 1D1AA 3S1NJ 2GA1A 2LF7A 2RGVA 5A2QK 5EJCA 1LE8A 1ZK8A 2A61A 3GXOA 3HG9A 1R23A 2W84A 3E97A 2FOWA 1USTA 2EZLA 4CCMA 1IRGA 3WTZA 5L3CA 2NRAC 1XD7A 1H88C 4RS8A 1ORKA 2Y9ZA 1P9QC 2XAUA 1W5CC 1UG0A 2ELJA 2K7LA 5FGMA 2E2HJ 2NVXJ 4KMFA 2XAHA 4A3MJ 1K6OA 4J19A 4BJTA 2HYGD 3FWEA 3QRFF 3G4SI 5ICCA 2ME6A 4W97A 5K1YA 3HOYJ 3DU6A 2DCEA 2XROA 1HF0A 2CG4A 1SFKA 5EEGA 2LFBA 2A69F 3TBIA 4KIFA 3VOEA 2OTLI 3IKTA 1R4MB 1Z77A 4II2A 3WE2A 4XICA 3CO7C 3UKGA 3H5AA 3BTCA 4M9ZA 4YG2F 4A93J 1RZ4A 2D1VA 2K85A 4QIWN 2E2IJ 1MZBA 4PUSA 1Z9CA 4HW0A 3LMMA 2GIVA 4HDVA 3GYHX 4FCYA 1I1SA 1YS7A 1S6LA 1WJFA 4JX6A 5GAGJ 5LHHA 1L3LA 3A2KA 3KP6A 3HB9A 1QO0D 3MKYB 3QYEA 2E35A 4P96A 5BNGA 4IHYA 4CZCA 3HOXJ 1V4RA 3JTHA 3MN2A 2M7AA 1W1WE 2OBPA 5FD5A 1HCRA 3SDBA 3DKXA 4A3FJ 2L54A 1XDSA 1P4WA 1BM9A 1RKWA 3QU6A 3LFUA 4JQFA 3J7YJ 4AC0A 1W5TA 3VYTB 1K79A 2B7EA 2Y69H 3JW4A 2BHYA 1U5TB 2KIQA 5HNFA 4LG0B 1T39A 3EUHA 3F8CA 3OIPA 3KZZA 1LPQA 1HKQA 3MKWB 1U8BA 2XPVA 3VWBA 4O6JA 4NDLA 4G7ZF 1PP7U 1D8JA 3MZYA 3JAMK 2CW0F 4BBSJ 3AG2H 2XRLA 4AVPA 2EZKA 2J5OA 3UR3C 3K0LA 3M3YJ 2DA6A 4E7HA 3IKVA 2X1DA 3F72A 3LOCA 4EM1A 5L3DA 4DGWB 1QHHD 1WSUA 4ESJA 3NAUA
chains in the Genus database with same CATH topology
3A02A 3SFIA 4X6AJ 5J1RA 3BG9A 1IC8A 2LY9A 2R0QC 3JRGA 1JJ8C 1ETXA 2DA3A 3H0GJ 2JN6A 2R93J 2MG4A 2HDDA 4UUSB 5GPAA 2L0KA 4A3DJ 1MSFC 1MBFA 3GTJJ 1U9NA 2E2JJ 4V2FA 5M5XJ 1IDZA 3CCYA 5EEAA 5J1YA 3BTLA 2OF7A 5FLVA 3B6AA 5K7FA 2LP0A 2DN0A 1Y1VJ 2GLOA 1UHSA 2HI3A 1W0TA 5JLXA 5C4JJ 3JRDA 2CUEA 2CQXA 2L7ZA 5C4XJ 4FTHA 5J3LA 5EGOA 5IP6A 1X58A 3ZQGA 2K40A 5EZGA 3F0CA 3RKQA 4Y52J 1VNDA 3OIOA 1OJLA 1ETYA 3FK6A 3WHCA 3Q0WA 3A01A 3HGGA 1D5YA 1I3QJ 1JKRC 1TWCJ 2MSYA 2LVSA 2K9QA 2RAEA 2D5VA 2DMNA 2TRTA 5IP9J 1QVTA 3OOUA 5FKMA 3BG3A 4FISA 2ID6A 5F1JA 4BBRJ 3Q3SA 1BW5A 2NVYJ 2NOGA 4IHVA 4LOCA 2DJNA 1U78A 5M3MJ 3K7AJ 4A69C 2FQ4A 2K9SA 1DU6A 1MBKA 2YS9A 2QF7A 2LLKA 4ABZA 2QCOA 5IYBJ 2CRGA 3FIWA 1PUFB 2L7MP 1FTTA 4M3GA 1JJ6C 1Y1WJ 1TC3C 4GFBA 1XS9A 2R5YA 2ID3A 2FX0A 1IJWC 5GPCA 4Y7NJ 5M3FJ 5E3MA 3TP3A 4BKXA 2VI6A 3JR9A 1BA5A 2N8GA 1FIPA 4MIMA 2GM4A 5M5WJ 2PMZN 4S0HB 4FE7A 2MGQA 1IV6A 4A3BJ 1T33A 1LE8B 1JUPA 2VPRA 3C2BA 4B3AA 1MBEA 4BY7J 3W6VA 5DS9A 3TW7A 5K7HA 2O8KA 5IP7J 2X9DA 1S7EA 1RESA 3FK7A 3CMYA 3BQYA 5IOYA 2HOAA 4M3EA 3GTKJ 2DMUA 4A3CJ 1IDYA 2WAQN 1QVUA 2ECCA 2JJ7A 2HQ5A 2XSDC 1LFBA 4JX4A 2KDZA 5C3EJ 2HXOA 4DYCA 1CQTA 5HODA 2CQQA 3GTLJ 1I50J 1GVDA 3HKZN 4RDUA 2X6OA 4XK4A 1X2NA 3MVPA 4B4CA 1B8IA 4RBOA 1TWFJ 4DYQA 4AUXA 1HDPA 1BJZA 1K61A 2EZHA 3HBLA 4D5CA 1IG7A 1BW6A 2Y30A 1IRZA 2CU7A 2M0CA 3CQZJ 2R92J 2DMPA 1AKHA 3BR6A 1JKPC 2XB5A 2M34A 4I76A 3LSPA 3BG5A 2HYJA 2Y2ZA 2L7FP 1B72A 2DA2A 5E3OA 2HOSA 4A3LJ 1OCTC 1ETKA 1VF9A 3ZQCA 2YUSA 3GTOJ 2XPUA 1JGGA 3HDDA 3DEWA 4M3DA 5F08A 3NARA 3S16J 5FKLA 3GBGA 1SFOJ 1WCMJ 1JUSA 2R5ZA 5GP9A 2G0EA 1RR7A 2Y31A 5FKNA 1Q1VA 1NK2P 2B63J 5EG0B 2JA7J 2FD5A 2WB1N 5F0FA 5EYRA 1YRNA 3S2DJ 3ZQFA 2KT0A 5FKOA 3D1NI 3S1QJ 1ETVA 3QPSA 2ME0A 4B1RA 2DA5A 2EQRA 4QSHA 3HOVJ 3A03A 1HLVA 3GTQJ 2XB0X 2E19A 5K7ZA 1JTXA 2LK2A 5F0CA 4D7NA 1SANA 5EDNA 3IH3A 4CYCB 2YU9J 2JA5J 3PO3J 4XRSA 4BXXJ 1ZKGA 3ZQIA 1OCPA 5DTDA 4I6ZA 5M5YJ 4MLOA 2M2EA 2JA6J 1H89C 1ZQ3P 2XGCA 3H3VK 3WHBA 2LR8A 1BL0A 1ZGWA 3CDLA 2L9RA 1HDDC 3GTMJ 1DU0A 4BY1J 2XPWA 3S17J 2ELKA 1ETOA 5FJ8J 3S2HJ 2I10A 2ZB9A 4JYKA 4JX5A 1MSEC 1U9OA 3TP0A 3K2AA 2MW8A 1ETQA 2XGEA 5IOZA 2GBYA 2O9LA 3HOZJ 1WPKA 1G2HA 2LTPA 5EGOB 3S1RJ 1IGNA 1TWAJ 1MBHA 2AO9A 2VUMJ 3LSGA 3RQIA 4C2MJ 3HEFA 1POGA 2CJJA 3A01B 1T56A 4L5EA 1TWGJ 2Y0SN 3G1LA 2HOTA 2NVTJ 2DMTA 1P7IA 4A3KJ 4UUSA 3BTIA 3BT9A 2W48A 3LSRA 1FEXA 1ZTRA 3IH4A 1F36A 3QQAA 1OFCX 2EBIA 5EZHA 2DA7A 5FKKA 1MH3A 2TCTA 3HGYA 3L1PA 1A6IA 3JRHA 4DW6A 4AYBN 2AHQA 2NS7A 1JTYA 1K83J 1TWHJ 2R5YB 4DZPA 4MFDA 3BQZA 1MNMC 5FLMJ 5F04A 1F43A 1W0UA 2X48A 4FE4A 4C3HJ 2LD5A 2FJ1A 5EF6A 1QPIA 4M6VA 3ZQLA 2E1OA 1I6HJ 4DYRA 3SJMA 2IAIA 1E3OC 1ENHA 3BTJA 1AHDP 1XG1A 2VKEA 4V2GA 4D5FA 4A3JJ 1MBJA 3IH2A 2CUFA 2JA8J 1FIAA 2EH3A 3I4NJ 4XRSG 1GDTA 4C3JJ 3QPLA 4CYCA 1UMQA 1X2MA 3HOUJ 1GV2A 1HOMA 1LFUP 1ZR4A 1IUFA 4EEFG 5JLWA 3S15J 1ITYA 3HM5A 5F27A 1MBGA 3OSFA 3TEDA 3JREA 3S14J 3GTPJ 3SDGA 2DA4A 2R7ZJ 4M3BA 1WGXA 4M3FA 2JK3A 1P7JA 4IEJA 2EZIA 1PUFA 1WH7A 1WI3A 1B8IB 4MFEA 5C44J 2WV1A 5E3NA 4DZJA 1H8AC 4IHWA 3LSJA 4JP0A 5IYCJ 1GV5A 3RZOJ 3OSGA 2M8GX 1AKHB 3MKLA 3BR2A 2DTZA 3O8GA 3S1NJ 3Q0VA 4QTRA 2JWTA 3BR5A 1LE8A 1ZK8A 1RETA 1B72B 4W1UA 3PO2J 2EZLA 3O8HA 4D7MA 2NS8A 3BR0A 3JRAA 2OPTA 3VPRA 3IV5A 2XGDA 4A3IJ 1H88C 3Q0UA 1ORKA 1GT0C 2Y9ZA 1JKOC 2ECBA 2R5ZB 1UG2A 4G12A 1VI0A 3BR3A 4XIDA 3LNQA 2E2HJ 2NVXJ 1EF4A 1JKQC 3E7LA 3B6CA 4IHXA 4A3MJ 4J19A 1Z0XA 1YRNB 2IBDA 3S1MJ 5F0HA 2ME6A 4W97A 1JT0A 3HOYJ 1HF0A 3FKIJ 2LFBA 3RZDJ 1APLC 3JRFA 3G1OA 2P81A 1FJLA 1XC5A 3BR1A 1Z77A 4C3IJ 4XICA 3UKGA 1A5JA 1GUUA 3BTCA 4A93J 4A3EJ 4QIWN 2E2IJ 2DMQA 4FCYA 2Y9YA 4MO7A 4JX6A 3TW6A 1NK3P 5E3LA 5IYDJ 1FTZA 9ANTA 3G1MA 3HB9A 5BNGA 4IHYA 1ZR2A 3HOXJ 3ZOBA 1O4XA 3MN2A 3HOWJ 1WH5A 2COBA 1HCRA 3ZQHA 4A3FJ 2M9HA 4XRMA 3DCFA 2HXIA 1RKWA 3I4MJ 1RKTA 2DA1A 1AU7A 2LKXA 4AC0A 2O7OA 2IEKA 5EG0A 2JMWA 5IPAA 1R9TJ 3JRIA 2K9NA 5J1UA 4X1EA 1MH4A 2VKVA 4HNVA 3FISA 3JRBA 2NVQJ 1QRYA 1U8BA 2XPVA 3JRCA 4NDLA 1VFCA 4BBSJ 4A3GJ 4UUTA 2XRLA 2EZKA 1JT6A 1JUMA 3GTGJ 3M3YJ 2DA6A 2H8RA 3M4OJ 1RPWA 3PM1A 3LOCA 1ETWA 2H1KA 3NAUA 1NTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A02 A;  3SFI A;  4X6A J;  5J1R A;  3BG9 A;  1IC8 A;  2LY9 A;  2R0Q C;  3JRG A;  1JJ8 C;  1ETX A;  2DA3 A;  3H0G J;  2JN6 A;  2R93 J;  2MG4 A;  2HDD A;  4UUS B;  5GPA A;  2L0K A;  4A3D J;  1MSF C;  1MBF A;  3GTJ J;  1U9N A;  2E2J J;  4V2F A;  5M5X J;  1IDZ A;  3CCY A;  5EEA A;  5J1Y A;  3BTL A;  2OF7 A;  5FLV A;  3B6A A;  5K7F A;  2LP0 A;  2DN0 A;  1Y1V J;  2GLO A;  1UHS A;  2HI3 A;  1W0T A;  5JLX A;  5C4J J;  3JRD A;  2CUE A;  2CQX A;  2L7Z A;  5C4X J;  4FTH A;  5J3L A;  5EGO A;  5IP6 A;  1X58 A;  3ZQG A;  2K40 A;  5EZG A;  3F0C A;  3RKQ A;  4Y52 J;  1VND A;  3OIO A;  1OJL A;  1ETY A;  3FK6 A;  3WHC A;  3Q0W A;  3A01 A;  3HGG A;  1D5Y A;  1I3Q J;  1JKR C;  1TWC J;  2MSY A;  2LVS A;  2K9Q A;  2RAE A;  2D5V A;  2DMN A;  2TRT A;  5IP9 J;  1QVT A;  3OOU A;  5FKM A;  3BG3 A;  4FIS A;  2ID6 A;  5F1J A;  4BBR J;  3Q3S A;  1BW5 A;  2NVY J;  2NOG A;  4IHV A;  4LOC A;  2DJN A;  1U78 A;  5M3M J;  3K7A J;  4A69 C;  2FQ4 A;  2K9S A;  1DU6 A;  1MBK A;  2YS9 A;  2QF7 A;  2LLK A;  4ABZ A;  2QCO A;  5IYB J;  2CRG A;  3FIW A;  1PUF B;  2L7M P;  1FTT A;  4M3G A;  1JJ6 C;  1Y1W J;  1TC3 C;  4GFB A;  1XS9 A;  2R5Y A;  2ID3 A;  2FX0 A;  1IJW C;  5GPC A;  4Y7N J;  5M3F J;  5E3M A;  3TP3 A;  4BKX A;  2VI6 A;  3JR9 A;  1BA5 A;  2N8G A;  1FIP A;  4MIM A;  2GM4 A;  5M5W J;  2PMZ N;  4S0H B;  4FE7 A;  2MGQ A;  1IV6 A;  4A3B J;  1T33 A;  1LE8 B;  1JUP A;  2VPR A;  3C2B A;  4B3A A;  1MBE A;  4BY7 J;  3W6V A;  5DS9 A;  3TW7 A;  5K7H A;  2O8K A;  5IP7 J;  2X9D A;  1S7E A;  1RES A;  3FK7 A;  3CMY A;  3BQY A;  5IOY A;  2HOA A;  4M3E A;  3GTK J;  2DMU A;  4A3C J;  1IDY A;  2WAQ N;  1QVU A;  2ECC A;  2JJ7 A;  2HQ5 A;  2XSD C;  1LFB A;  4JX4 A;  2KDZ A;  5C3E J;  2HXO A;  4DYC A;  1CQT A;  5HOD A;  2CQQ A;  3GTL J;  1I50 J;  1GVD A;  3HKZ N;  4RDU A;  2X6O A;  4XK4 A;  1X2N A;  3MVP A;  4B4C A;  1B8I A;  4RBO A;  1TWF J;  4DYQ A;  4AUX A;  1HDP A;  1BJZ A;  1K61 A;  2EZH A;  3HBL A;  4D5C A;  1IG7 A;  1BW6 A;  2Y30 A;  1IRZ A;  2CU7 A;  2M0C A;  3CQZ J;  2R92 J;  2DMP A;  1AKH A;  3BR6 A;  1JKP C;  2XB5 A;  2M34 A;  4I76 A;  3LSP A;  3BG5 A;  2HYJ A;  2Y2Z A;  2L7F P;  1B72 A;  2DA2 A;  5E3O A;  2HOS A;  4A3L J;  1OCT C;  1ETK A;  1VF9 A;  3ZQC A;  2YUS A;  3GTO J;  2XPU A;  1JGG A;  3HDD A;  3DEW A;  4M3D A;  5F08 A;  3NAR A;  3S16 J;  5FKL A;  3GBG A;  1SFO J;  1WCM J;  1JUS A;  2R5Z A;  5GP9 A;  2G0E A;  1RR7 A;  2Y31 A;  5FKN A;  1Q1V A;  1NK2 P;  2B63 J;  5EG0 B;  2JA7 J;  2FD5 A;  2WB1 N;  5F0F A;  5EYR A;  1YRN A;  3S2D J;  3ZQF A;  2KT0 A;  5FKO A;  3D1N I;  3S1Q J;  1ETV A;  3QPS A;  2ME0 A;  4B1R A;  2DA5 A;  2EQR A;  4QSH A;  3HOV J;  3A03 A;  1HLV A;  3GTQ J;  2XB0 X;  2E19 A;  5K7Z A;  1JTX A;  2LK2 A;  5F0C A;  4D7N A;  1SAN A;  5EDN A;  3IH3 A;  4CYC B;  2YU9 J;  2JA5 J;  3PO3 J;  4XRS A;  4BXX J;  1ZKG A;  3ZQI A;  1OCP A;  5DTD A;  4I6Z A;  5M5Y J;  4MLO A;  2M2E A;  2JA6 J;  1H89 C;  1ZQ3 P;  2XGC A;  3H3V K;  3WHB A;  2LR8 A;  1BL0 A;  1ZGW A;  3CDL A;  2L9R A;  1HDD C;  3GTM J;  1DU0 A;  4BY1 J;  2XPW A;  3S17 J;  2ELK A;  1ETO A;  5FJ8 J;  3S2H J;  2I10 A;  2ZB9 A;  4JYK A;  4JX5 A;  1MSE C;  1U9O A;  3TP0 A;  3K2A A;  2MW8 A;  1ETQ A;  2XGE A;  5IOZ A;  2GBY A;  2O9L A;  3HOZ J;  1WPK A;  1G2H A;  2LTP A;  5EGO B;  3S1R J;  1IGN A;  1TWA J;  1MBH A;  2AO9 A;  2VUM J;  3LSG A;  3RQI A;  4C2M J;  3HEF A;  1POG A;  2CJJ A;  3A01 B;  1T56 A;  4L5E A;  1TWG J;  2Y0S N;  3G1L A;  2HOT A;  2NVT J;  2DMT A;  1P7I A;  4A3K J;  4UUS A;  3BTI A;  3BT9 A;  2W48 A;  3LSR A;  1FEX A;  1ZTR A;  3IH4 A;  1F36 A;  3QQA A;  1OFC X;  2EBI A;  5EZH A;  2DA7 A;  5FKK A;  1MH3 A;  2TCT A;  3HGY A;  3L1P A;  1A6I A;  3JRH A;  4DW6 A;  4AYB N;  2AHQ A;  2NS7 A;  1JTY A;  1K83 J;  1TWH J;  2R5Y B;  4DZP A;  4MFD A;  3BQZ A;  1MNM C;  5FLM J;  5F04 A;  1F43 A;  1W0U A;  2X48 A;  4FE4 A;  4C3H J;  2LD5 A;  2FJ1 A;  5EF6 A;  1QPI A;  4M6V A;  3ZQL A;  2E1O A;  1I6H J;  4DYR A;  3SJM A;  2IAI A;  1E3O C;  1ENH A;  3BTJ A;  1AHD P;  1XG1 A;  2VKE A;  4V2G A;  4D5F A;  4A3J J;  1MBJ A;  3IH2 A;  2CUF A;  2JA8 J;  1FIA A;  2EH3 A;  3I4N J;  4XRS G;  1GDT A;  4C3J J;  3QPL A;  4CYC A;  1UMQ A;  1X2M A;  3HOU J;  1GV2 A;  1HOM A;  1LFU P;  1ZR4 A;  1IUF A;  4EEF G;  5JLW A;  3S15 J;  1ITY A;  3HM5 A;  5F27 A;  1MBG A;  3OSF A;  3TED A;  3JRE A;  3S14 J;  3GTP J;  3SDG A;  2DA4 A;  2R7Z J;  4M3B A;  1WGX A;  4M3F A;  2JK3 A;  1P7J A;  4IEJ A;  2EZI A;  1PUF A;  1WH7 A;  1WI3 A;  1B8I B;  4MFE A;  5C44 J;  2WV1 A;  5E3N A;  4DZJ A;  1H8A C;  4IHW A;  3LSJ A;  4JP0 A;  5IYC J;  1GV5 A;  3RZO J;  3OSG A;  2M8G X;  1AKH B;  3MKL A;  3BR2 A;  2DTZ A;  3O8G A;  3S1N J;  3Q0V A;  4QTR A;  2JWT A;  3BR5 A;  1LE8 A;  1ZK8 A;  1RET A;  1B72 B;  4W1U A;  3PO2 J;  2EZL A;  3O8H A;  4D7M A;  2NS8 A;  3BR0 A;  3JRA A;  2OPT A;  3VPR A;  3IV5 A;  2XGD A;  4A3I J;  1H88 C;  3Q0U A;  1ORK A;  1GT0 C;  2Y9Z A;  1JKO C;  2ECB A;  2R5Z B;  1UG2 A;  4G12 A;  1VI0 A;  3BR3 A;  4XID A;  3LNQ A;  2E2H J;  2NVX J;  1EF4 A;  1JKQ C;  3E7L A;  3B6C A;  4IHX A;  4A3M J;  4J19 A;  1Z0X A;  1YRN B;  2IBD A;  3S1M J;  5F0H A;  2ME6 A;  4W97 A;  1JT0 A;  3HOY J;  1HF0 A;  3FKI J;  2LFB A;  3RZD J;  1APL C;  3JRF A;  3G1O A;  2P81 A;  1FJL A;  1XC5 A;  3BR1 A;  1Z77 A;  4C3I J;  4XIC A;  3UKG A;  1A5J A;  1GUU A;  3BTC A;  4A93 J;  4A3E J;  4QIW N;  2E2I J;  2DMQ A;  4FCY A;  2Y9Y A;  4MO7 A;  4JX6 A;  3TW6 A;  1NK3 P;  5E3L A;  5IYD J;  1FTZ A;  9ANT A;  3G1M A;  3HB9 A;  5BNG A;  4IHY A;  1ZR2 A;  3HOX J;  3ZOB A;  1O4X A;  3MN2 A;  3HOW J;  1WH5 A;  2COB A;  1HCR A;  3ZQH A;  4A3F J;  2M9H A;  4XRM A;  3DCF A;  2HXI A;  1RKW A;  3I4M J;  1RKT A;  2DA1 A;  1AU7 A;  2LKX A;  4AC0 A;  2O7O A;  2IEK A;  5EG0 A;  2JMW A;  5IPA A;  1R9T J;  3JRI A;  2K9N A;  5J1U A;  4X1E A;  1MH4 A;  2VKV A;  4HNV A;  3FIS A;  3JRB A;  2NVQ J;  1QRY A;  1U8B A;  2XPV A;  3JRC A;  4NDL A;  1VFC A;  4BBS J;  4A3G J;  4UUT A;  2XRL A;  2EZK A;  1JT6 A;  1JUM A;  3GTG J;  3M3Y J;  2DA6 A;  2H8R A;  3M4O J;  1RPW A;  3PM1 A;  3LOC A;  1ETW A;  2H1K A;  3NAU A;  1NTC A; 
#chains in the Genus database with same CATH topology
 3A02 A;  2XVC A;  4P9U A;  1BR2 A;  5EEH A;  4BHC A;  2DO7 A;  1IC8 A;  5IT9 Z;  3CF5 F;  4XN0 A;  2DA3 A;  4HEA 2;  3T1B A;  3HSF A;  2HDD A;  4G6T B;  5BOX A;  1NG6 A;  3HPG A;  2L0K A;  1JI8 A;  5LD2 C;  3HL2 A;  3BC8 A;  2KJC A;  2QSH X;  1F5T A;  4CA0 A;  2ZFW A;  2ADU A;  2OAZ A;  2VKD A;  5CPR B;  2QSG X;  2R3S A;  3CCY A;  4XLP F;  4KUM A;  2VT3 A;  3E5Q A;  5J1Y A;  5LEK A;  2LOO A;  5FLV A;  1ON1 A;  3SZT A;  2FA5 A;  3U1D A;  1T38 A;  2K9L A;  4M74 A;  2HI3 A;  1OR7 C;  5JLX A;  2OJE D;  1TBX A;  3O6B B;  3OOP A;  2CQX A;  4Q48 A;  5D8L B;  5K5O A;  4S05 A;  5CYV A;  1UB9 A;  4OIP F;  1FZP B;  4BHB A;  5CVJ A;  5J3L A;  5IP6 A;  2VOD A;  4UB6 C;  4UHT A;  2MFZ A;  5D5X B;  1Z6R A;  3N05 A;  4EJT A;  4L0Y B;  4U7B A;  2FRH A;  6PAX A;  4EGZ A;  3Q0W A;  4U88 A;  1I3Q J;  3TGN A;  1J09 A;  1P4X A;  5LBQ A;  2K9Q A;  1LJ9 A;  4XMY A;  1QVT A;  3ECH A;  2WWY A;  1OCZ H;  5FKM A;  3RYR A;  3TL4 X;  3DTI A;  2FU4 A;  3MAJ A;  1W36 D;  2DJN A;  3DLL F;  2IW5 A;  3KEO A;  4A69 C;  1VQ8 I;  1R1U A;  4LLG F;  5E18 F;  1A35 A;  1K78 B;  3EUA A;  2Z2S B;  3GW2 A;  3G3Z A;  1VQO I;  2LLK A;  2JRT A;  5IYB J;  3OYC A;  4DOZ A;  4ZDO A;  2BXZ A;  1FTT A;  1JJ6 C;  5LFA A;  2ZNY A;  4ZH4 F;  2EFP A;  1CF7 A;  3PQJ A;  2CV0 A;  1UZC A;  4NB5 A;  1SD6 A;  2EV0 A;  3KP7 A;  5DV5 A;  1ZRF A;  3GFL A;  3KPH A;  5DD4 A;  1X19 A;  1FOK A;  2DDA A;  1AWC A;  3RJP A;  4BJ5 C;  1B9N A;  2NNY A;  1ZGA A;  2Q2E A;  1O3T A;  5TIS C;  2IA1 A;  1G6N A;  1MNE A;  2FML A;  5CQE A;  5H6R A;  3I58 A;  2C6Y A;  3GCM A;  5B3S H;  1T33 A;  4P5O A;  1QNT A;  4Y15 A;  3SEZ A;  1JUP A;  2P0W A;  4ETS A;  3K70 C;  4HOB A;  5HS8 A;  2ZJR F;  2QLZ A;  3AG3 H;  1ZAR A;  3N97 A;  3GFI A;  5DS9 A;  1YW8 A;  4BDY A;  2ICW G;  1Z67 A;  5K7H A;  4XOP A;  2O8K A;  2E1C A;  1OCC H;  2Q0O A;  3H92 A;  5IP7 J;  2X9D A;  3TO7 A;  1S7E A;  3FK7 A;  4IJA A;  3BQY A;  3L00 A;  4UV9 A;  1T8I A;  4A3C J;  1IDY A;  1O3R A;  2WAQ N;  2ECC A;  4GRI A;  2HQ5 A;  3MEX A;  1LFB A;  2XSD C;  2BVL A;  5C3E J;  4XOT A;  2ZSI B;  2L2O A;  2CQQ A;  2QSF X;  3FXR A;  2IGO A;  3HKZ N;  1GVD A;  2NOJ B;  1XGO A;  3ASN H;  4RDU A;  4UNO A;  5HVQ C;  1R5H A;  2X6O A;  2DFH A;  2W7N A;  4LIT A;  1DQU A;  2GOX B;  4N4N B;  1EH7 A;  5E8G A;  2VXD A;  4CCN A;  4D5C A;  4CZZ A;  2VQG A;  2AQE A;  2I5U A;  2M0C A;  5BQT A;  3PL8 A;  2DXI A;  1T95 A;  1ZYR F;  5AON A;  4QPQ A;  3E6D A;  2XB5 A;  4I76 A;  3BG5 A;  1JHF A;  2HYJ A;  3CZ6 A;  3TO6 A;  4KT6 A;  4I01 A;  2M4K A;  2EIK H;  3P7N A;  3FHZ A;  2QBY B;  5KAF C;  2MD0 A;  4A3L J;  4BS9 A;  2DBB A;  1ETK A;  1VF9 A;  1OCT C;  1T0F A;  3GTO J;  1FBS A;  2XPU A;  3SEQ A;  1JGG A;  4N0B A;  3H5N A;  5F08 A;  1SD7 A;  3NAR A;  2BE5 F;  3H3U A;  3S16 J;  3GBG A;  4EMS A;  1WCM J;  3CME I;  1G3S A;  2M5W A;  2Y31 A;  1NK2 P;  2B63 J;  3GX4 X;  1T0F C;  4KA4 A;  2V9P A;  2WB1 N;  4ZTF A;  2LNB A;  5FO5 A;  4G6Q A;  2HVQ A;  5FKO A;  3SFZ A;  4XRF A;  2WAE A;  4L9T A;  3S1Q J;  4E6K G;  1HBX G;  4KT5 C;  2ME0 A;  3GUD A;  4LB5 A;  3GO5 A;  3M07 A;  1ZG3 A;  4QSH A;  2RC4 A;  5CVI A;  1WI9 A;  3M8J A;  1XCB A;  1X3U A;  2IGK A;  3ZQQ A;  3GTQ J;  1XSX A;  4Z2Y A;  3DBL B;  2ZXI A;  1Z91 A;  2L5Q A;  5FFX A;  4CSW A;  2YU9 J;  2YSR A;  2F4M B;  1O57 A;  1SVL A;  2KL4 A;  3FXL A;  3ZN0 A;  4YFX F;  1G4D A;  4BXX J;  4Q5S F;  1ZKG A;  2VE9 A;  4ZZD A;  3MQ0 A;  2XKP A;  2XGC A;  4N9H A;  3H3V K;  1ZGW A;  3CDL A;  1HDD C;  1CGP A;  3DTK A;  1A31 A;  2K4J A;  1AOY A;  3SXY A;  1QZE A;  2XPW A;  2M0M A;  3ROU A;  2IT0 A;  2DOF A;  3ZPL A;  3P5J A;  3D5S C;  1FWZ A;  5FJ8 J;  3S2H J;  2HDC A;  2VOP A;  3I53 A;  4JYK A;  2CW8 A;  1MSE C;  1QU3 A;  4E7L A;  1U5T A;  4LG0 A;  2L4A A;  3PIP F;  1D0Y A;  1WFX A;  2DQL A;  5J40 A;  4HQE A;  3K4B A;  4I0B A;  4LB6 B;  1WPK A;  3I54 A;  1G2H A;  4AIJ A;  3R4K A;  4WWC A;  1VQ4 I;  1S7O A;  1NH3 A;  3LAJ A;  2LMD A;  3I9V 2;  3KP2 A;  1U5T C;  1IGN A;  4YRV A;  4RAF A;  2VUM J;  2EV5 A;  3G6E I;  4EAT A;  3F6O A;  3O2P E;  3K1P A;  3J80 K;  5DDG A;  2CJJ A;  3JCU C;  1J5Y A;  3F9K A;  2DT6 A;  2ELH A;  4RGX A;  2KHM A;  2Y0S N;  1HXD A;  3PFI A;  3MKZ A;  2YU3 A;  2X6X A;  1X1P A;  1P7I A;  5K5Q A;  4A3K J;  3ISP A;  1BN5 A;  2W48 A;  4IKF A;  4ENJ A;  2CWE A;  2R7O A;  2HS5 A;  5E1W A;  4A2U A;  5D4R A;  1K4S A;  4CIC A;  3FBN B;  5TRD A;  4HF1 A;  4DW6 A;  4F92 B;  1E17 A;  4AYB N;  2X1C A;  5KNL A;  5ICG A;  3K69 A;  1R00 A;  2LKP A;  4XL9 A;  2GAU A;  2ZXW H;  1TZL A;  2V1D A;  2M45 A;  3CCU I;  2DI3 A;  4XKC A;  3A1Y A;  3KIO A;  2VN2 A;  4XKV A;  4DZP A;  1B4A A;  4M9X A;  5D5U B;  3WU1 B;  1X3W B;  3DP7 A;  3PFY A;  2FJ1 A;  1OYY A;  1QPI A;  1Y56 A;  3RIR A;  2G7U A;  4DYR A;  2VON A;  2HPI A;  3MFK A;  4BXU A;  1R5I D;  3V42 A;  1AHD P;  3D0S A;  4HNU A;  3HXL A;  3COA C;  4A3J J;  4F91 B;  1MBJ A;  3IH2 A;  2JA8 J;  2EH3 A;  2XAJ A;  2VBY A;  4CYC A;  3QPL A;  4C2T A;  4WF2 A;  1X2M A;  1LNW A;  3KZI C;  3HOU J;  1LFU P;  4RM3 A;  3S3M A;  1ERD A;  4LLN A;  3OMY A;  3QOE A;  1IF1 A;  2ETH A;  3I3L A;  2A6E F;  2VBX A;  4II3 A;  1F4K A;  4HAM A;  2XGX A;  4F93 B;  3JRE A;  1K78 A;  4WK8 F;  1SFE A;  3P9C A;  2FBH A;  2R7Z J;  2PJR B;  1WJC A;  3NQO A;  4M3F A;  4PJL A;  2HU9 A;  1P7J A;  4BE0 A;  3GFJ A;  5LGN A;  3IHU A;  4PDK A;  3EPZ A;  1B8I B;  4MTE A;  4MFE A;  3W6J B;  1SAX A;  4H0E A;  4IQJ A;  5E3N A;  4HG2 A;  1H8A C;  3SYT A;  4O5V A;  2V1X A;  2WAD A;  3OYH A;  5IYC J;  4XON A;  4HX8 A;  3OSG A;  2OQR A;  3ML6 A;  4BL0 B;  3ERE D;  2F2E A;  1FBU A;  2CH0 A;  2JPB A;  2JWT A;  4XLF A;  2QQ9 A;  3IC7 A;  2BW3 B;  1HST A;  4W1U A;  5BPI A;  4D7M A;  3C3W A;  3JRA A;  2X6W A;  3OS2 A;  1N75 A;  3HRS A;  2XGD A;  5JHU A;  2I8D A;  1TLH B;  5L3F A;  4XLE A;  4G12 A;  4HA8 A;  2R7S A;  2JSP A;  4XID A;  4AYB A;  1Z6T A;  3EYY A;  3E7L A;  3NEU A;  2FQ3 A;  5J8C A;  2L7K A;  3LSK A;  4IL6 C;  1Z05 A;  3FHN A;  4AD9 A;  2PFB A;  1Z0X A;  5GTH C;  1YRN B;  5BS6 A;  1JT0 A;  5FLX Z;  2F5E A;  3OYJ A;  3KET A;  3LSM A;  2A5W A;  1J59 A;  1N78 A;  3L2Q A;  1APL C;  2P8T A;  3JRF A;  4I0A A;  1XC5 A;  2ISZ A;  4O3M A;  4HLX A;  2HQR A;  3MMY B;  3WU2 C;  1BOB A;  3HHH A;  2DT7 B;  2XC7 A;  2ZSH B;  2VJ4 A;  3HUG B;  1K7A A;  2KDO A;  3A0B C;  3LFK A;  3S2W A;  2Y9Y A;  1U2W A;  4MO7 A;  1E3H A;  4XBF A;  4NC6 A;  3C2H A;  4NC8 A;  3TW6 A;  2O6G E;  5IYD J;  1FTZ A;  3U21 A;  2PBI A;  2ZKZ A;  1KQ8 A;  3RKX A;  1O4X A;  2LBF B;  2QBY A;  5IT9 K;  1LKX A;  3HIF A;  3HOW J;  4LJZ F;  1BR1 A;  2XRN A;  3BOQ A;  1BI1 A;  5K5R A;  5F64 A;  2M9H A;  2V9K A;  3DCF A;  1OYW A;  4XLH A;  3I4M J;  4WXD A;  3R61 A;  1YS6 A;  5D5V B;  2LKX A;  2O7O A;  1S9H A;  2JUG A;  3U9G A;  2KZG A;  4D0P A;  1CF7 B;  1A6Q A;  2HYF A;  5IPA A;  1R9T J;  3AL0 B;  3JRI A;  2Y48 A;  2JQ7 A;  1ZRD A;  2FEZ A;  1MH4 A;  4S04 A;  3JRB A;  2NVQ J;  3EET A;  2KP6 A;  3OWT A;  1QRY A;  1TNS A;  2M1B A;  2Q8K A;  3S32 A;  4XKW A;  3JRC A;  2CW7 A;  1VFC A;  1JUM A;  1I39 A;  3E5X A;  5FRN A;  3AFH A;  2H8R A;  5TJJ A;  2M4G A;  3M4O J;  3E1S A;  5ED4 A;  4IQ4 A;  3K1N A;  3QWL A;  4B09 A;  2H1K A;  3B73 A;  2XAF A;  2EFW A;  1U0J A;  1K4T A;  4GDF A;  2NNN A;  2O61 A;  3VYR B;  3BZ6 A;  4BXF A;  4BNC A;  2ZXH A;  2LY9 A;  3AKZ A;  4KNY A;  2FBI A;  5ILU A;  1JJ8 C;  2H6C A;  3H0G J;  1HKS A;  1ODD A;  2KZV A;  3SZG A;  4ESF A;  3CO6 C;  2DQR A;  4LGW A;  1FMV A;  1KGS A;  4D9J A;  1MSF C;  2AQF A;  3X2Q H;  4WCG A;  2IA2 A;  3HSR A;  5M5X J;  2LY2 A;  3FM3 A;  1IDZ A;  3CCR I;  1VQP I;  1OPC A;  2NXN B;  4A0Z A;  4ZTJ A;  1WJB A;  2LP0 A;  3ZMU A;  2COM A;  1ZG5 A;  2E1M C;  2GLO A;  1QPM A;  1UHS A;  2AXL A;  1W0T A;  4NC7 A;  1D1C A;  1W36 C;  2CUE A;  1SC7 A;  4YFK F;  4DBR A;  1DP3 A;  4A5N A;  4IXA A;  1SEU A;  3CCE I;  4BHP A;  3KLO A;  5EZG A;  2L4M A;  3F0C A;  2ESN A;  2V1N A;  4BJ6 C;  3KP3 A;  3OIO A;  1OJL A;  2DFE A;  3BPX A;  5DM7 F;  3HGG A;  3KYC B;  4Y33 A;  5J4Y A;  1TWC J;  4A5M A;  4TV7 A;  2BGC A;  1XMX A;  2RAE A;  2OC6 A;  2CQ7 A;  3LWF A;  2RDP A;  2DMN A;  2FMY A;  2BY3 A;  3OOU A;  3DV8 A;  1B6A A;  1DDN A;  3BG3 A;  4FIS A;  2ID6 A;  4G8X A;  5F1J A;  1BW5 A;  2KRC A;  3IAS 2;  3TDZ C;  3CF2 A;  3HOS A;  2VKH A;  1X3Z B;  3DPU A;  3PNY A;  1IXS B;  1HSJ A;  1DU6 A;  4MTD A;  1MBK A;  4XLN F;  4ABZ A;  2QCO A;  3L2U A;  2L7M P;  1O7F A;  4BYY A;  1Y1W J;  4YEL A;  4FHT A;  1AA7 A;  1O7L A;  3BRO A;  2RNG A;  2BY2 A;  1YJN I;  4KN4 X;  4MQV A;  5E3M A;  3TP3 A;  3KLN A;  1TL8 A;  4I02 A;  2QM3 A;  2G9W A;  1R7J A;  2F5C A;  1FIP A;  1XTA A;  2JZY A;  2KMU A;  3LL7 A;  5F6F A;  2PMZ N;  1KQ9 A;  4FE7 A;  1IV6 A;  2VPR A;  3C2B A;  3DWL E;  2LYC A;  2H09 A;  2LG4 A;  1MBE A;  3ZRG A;  5L3B A;  3FX3 A;  3VDX A;  4U0V A;  2KIM A;  4KIT B;  3CD6 I;  3IRR A;  4E70 A;  3CMY A;  4LIU A;  1GLN A;  4FX0 A;  5CVR A;  1SMY F;  3ZQ7 A;  3Q9S A;  2DMU A;  2HVS A;  4EGY A;  5DM6 F;  3KX2 A;  2X85 A;  2W85 A;  4AIK A;  1UAA A;  2PJR A;  4UY8 I;  4IHS A;  4DYC A;  5BMZ A;  1CQT A;  4K2E A;  3VB2 A;  1WHU A;  2GQQ A;  3EUH C;  1V3F A;  5J6X A;  2FNA A;  4XK4 A;  1X2N A;  5LHI A;  4B4C A;  3P9K A;  4RBO A;  1TWF J;  1YO5 C;  1B8I A;  1HKT A;  3KZY A;  1BJZ A;  1K61 A;  1RUN A;  5LEJ A;  1T2K A;  1BW6 A;  2Y30 A;  1X1A A;  5JFR A;  3W3C A;  4J00 A;  2R92 J;  1LEB A;  4ZC3 A;  4B44 A;  2V79 A;  4L18 B;  1IXR C;  4QLC U;  2K9M A;  1Z7L A;  3E0J B;  3LSP A;  3EQL F;  4Q47 A;  1MND A;  2BW3 A;  3L2V A;  3F8F A;  5E3O A;  1LDJ A;  2Y0M A;  4XR6 A;  2KFD A;  4KMU X;  4HBL A;  4C9Y A;  2HQN A;  4OAZ A;  4ZZL A;  2JT1 A;  3DPL C;  2FUG 2;  3PNV A;  2PMH A;  2L01 A;  2G0E A;  2H6B A;  1Q1V A;  3V7C A;  5EG0 B;  3RI4 A;  5FRM A;  4WXH A;  4UB8 C;  5F0F A;  4IRG A;  2F5V A;  4QWQ A;  1YRN A;  2BXY A;  4PSW A;  2KT0 A;  2XAG A;  2M8E A;  2ZCW A;  3T5X A;  3QPS A;  1YJ9 I;  2EQR A;  4EVI A;  5H20 A;  3HOV J;  2DOA A;  4UVC A;  4NNJ A;  1HLV A;  3N4M A;  3QU3 A;  1LUJ B;  4HF0 A;  4L0Z B;  4XKB A;  1B59 A;  1JTX A;  3HUG A;  2QZ8 A;  1J75 A;  1IUY A;  1SAN A;  2H94 A;  5EDN A;  4CYC B;  2HZT A;  2JA5 J;  4BQN A;  1GXP A;  2EFQ A;  5DTD A;  4I6Z A;  2HWV A;  1JGS A;  4B8X A;  4MLO A;  2PEX A;  2LBF A;  1VQ9 I;  1ZQ3 P;  2VAS A;  3CC7 I;  2ZBK A;  3WHB A;  2L9R A;  1PUE E;  3CC4 I;  1KZH A;  4BY1 J;  1HA8 A;  5E17 F;  1LVK A;  3OYK A;  4UVA A;  3S17 J;  2HZD A;  2F6C A;  1ETO A;  4HNT A;  4PJ0 C;  2WY7 Q;  2KIF A;  3BJ6 A;  3QOD A;  4L5J A;  1UFM A;  3OYD A;  2ZFU A;  4U87 A;  2L9N A;  1UEL B;  4Y3O A;  3WTT C;  3K2A A;  3OYN A;  3G73 A;  2BYV E;  3HZJ A;  4HLY A;  2VOO A;  3CCQ I;  3WTV C;  1FPQ A;  4B48 A;  1Y0N A;  2FXA A;  2HR3 A;  2X1E A;  1TP4 A;  3LSI A;  5E20 A;  2GZW A;  3KE2 A;  5D6F A;  3AL0 C;  3K2Z A;  1TWA J;  3ZMZ A;  4BQQ A;  3LSG A;  3RQI A;  3M7G A;  4L9N A;  2OUM A;  1R58 A;  1POG A;  1BI2 A;  3OY9 A;  1WVR A;  1YIT I;  2X0L A;  1FLI A;  1KU3 A;  2GXG A;  1VQN I;  2R7U A;  4EM2 A;  3J7A Y;  4M6Y A;  1PJR A;  2DMT A;  3OYA A;  5AIP A;  1IV8 A;  3RKW A;  3CUQ B;  2D45 A;  3BTI A;  2CQK A;  4MEY F;  3BT9 A;  4RAY A;  1WJE A;  4GO1 A;  3KFW X;  2VT2 A;  4ENN A;  3T8T A;  2LRD A;  1FEX A;  4I2O A;  1KON A;  5EZH A;  2LDU A;  4OIO F;  2MC4 A;  4WX9 A;  2TCT A;  1TNT A;  3HGY A;  3C18 A;  3L1P A;  1EJ9 A;  4BU2 A;  2JUC A;  2AHQ A;  1DPU A;  1XB4 A;  2V6C A;  1EKE A;  4IF4 A;  3O3K A;  2A6H F;  4I09 A;  2BBY A;  2Z3Y A;  1J0R A;  2R5Y B;  3H36 A;  4FT8 A;  4AU7 A;  2R7V A;  3BQZ A;  5ICF A;  3PQK A;  4WXC A;  3V8L A;  5F04 A;  3WG7 H;  2IS4 A;  2FBK A;  2X48 A;  4FE4 A;  5JVT A;  2AS5 F;  2LD5 A;  3L7W A;  1REP C;  2HKO A;  2E1O A;  3DQV C;  5B1A H;  3FMS A;  1QBJ A;  3RDI A;  1QZZ A;  3NWS A;  5H6Q A;  3ERM A;  1YIJ I;  1WKM A;  5JVG F;  1FYM A;  1XG1 A;  1WWX A;  4XSZ F;  3S93 A;  2VKE A;  4V2G A;  4D5F A;  1IZ1 A;  1YIO A;  2CUF A;  1FIA A;  2E7W A;  3REO A;  1YX3 A;  4XRS G;  1GDT A;  4C3J J;  4BAC A;  2IVM A;  4P55 A;  4KJZ A;  2RN7 A;  4N9I A;  3UNG C;  2CUJ A;  1OMI A;  3HHG A;  1MMA A;  1IUF A;  4A0Y A;  4CYD A;  3FF5 A;  4EEF G;  5JLW A;  1FOY A;  3S15 J;  4ITV A;  2O3F A;  4AWX B;  1ITY A;  3J7A O;  1MBG A;  4AM3 A;  1RI7 A;  1XX5 A;  3TED A;  3OSF A;  1J9I A;  4M72 A;  3VYS B;  2R7W A;  4M3B A;  4YIF A;  3BJO A;  1PYV A;  2CMP A;  1MJB A;  4HDU A;  5FLX K;  2KRF A;  3ASO H;  3PUF A;  3DEU A;  3E5U A;  1H9G A;  4ENK A;  1FT9 A;  3LA3 A;  1R71 A;  1Y8Q B;  4DZJ A;  5H2F C;  1SD4 A;  1I5Z A;  5AIQ A;  3LSJ A;  5LRR A;  2E5N A;  4JP0 A;  2UXN A;  2W4S A;  3BZK A;  1GV5 A;  3RZO J;  4XM3 A;  4M73 A;  4XOR A;  2M8G X;  2BY0 A;  1FNN A;  2MC3 A;  3M1C A;  3MKL A;  1BJA A;  3Q9V A;  3LAP A;  3F8M A;  3O8G A;  3E3V A;  2QKL B;  3Q0V A;  3BP8 A;  2IPQ X;  3BR5 A;  5FRO A;  5DCF A;  4ESB A;  3CP2 A;  3TMO A;  1IXC A;  2HDW A;  3NWT A;  2WAQ A;  3O8H A;  2P5L C;  2QGU A;  3BR0 A;  1WJD A;  4HF2 A;  4F7Z A;  2NYX A;  3GVA A;  1G3W A;  3VPR A;  3IV5 A;  3M1E A;  3Q0U A;  4E7K A;  1H0M A;  2ECB A;  1D8K A;  1MKM A;  2GA2 A;  2R5Z B;  3HKZ A;  4AIH A;  1VI0 A;  3BR3 A;  3LNQ A;  5J4V A;  1JKQ C;  5F1R A;  1W4M A;  2P7C B;  4FET A;  2LF8 A;  4EM0 B;  1ULY A;  1MMS A;  1ONV A;  1UHW A;  1I27 A;  2IBD A;  2RQP A;  2XDV A;  1ZGJ A;  3BZC A;  3FKI J;  3ZXS A;  4OMY A;  2P81 A;  2L3D A;  4DBQ A;  1FJL A;  2IXS A;  3AAF A;  3CJR B;  2DPD A;  4L9V A;  3FXJ A;  3I56 I;  2HEO A;  3FXQ A;  3BR1 A;  4C3I J;  1A5J A;  1XGS A;  2VIX A;  1GUU A;  1OIS A;  1WJ5 A;  3LST A;  1XDU A;  3S8P A;  2B9S A;  2DMQ A;  2Q1Z B;  4CHU A;  5DUK A;  5GAE J;  3OYE A;  1A36 A;  1S5L C;  1D3Y A;  1J7K A;  2P6T A;  3K4K A;  2STW A;  2ISY A;  4RGU A;  2XF7 A;  3G1M A;  5L3E A;  3IRQ A;  1YX5 A;  2EPF A;  2EIN H;  2E71 A;  3CCL I;  4AVZ A;  2WB1 A;  3J81 Z;  1ZLK A;  3OYI A;  1PVE A;  2VQH A;  2XKO A;  2HXI A;  3GEZ A;  3OV8 A;  4A6D A;  3OS1 A;  1S8N A;  1XCV A;  4MEX F;  1RKT A;  1HW1 A;  2HNH A;  1LB2 A;  1X1D A;  1AU7 A;  4MHG A;  4Q4Z F;  3PIO F;  1G59 A;  2OD5 A;  1EV7 A;  5EG0 A;  1LDD A;  4HYE A;  1SMT A;  1ZEL A;  4ASN A;  3GLL A;  4X1E A;  4HNV A;  1YJW I;  2VXZ A;  3QPH A;  1EH6 A;  4PGH A;  5HLH A;  3DKY A;  4KFC A;  4UUT A;  2WA0 A;  2BEO A;  1JT6 A;  2E60 A;  3DTE A;  2BZT A;  4OWR B;  3KYL A;  5HS9 A;  4IO9 F;  1RPW A;  1ETW A;  1NTC A;  2YR2 A;  3SFI A;  2R7T A;  1OQY A;  5J1R A;  3W2W A;  1LQ1 A;  3F6V A;  3DKW A;  3JRG A;  1ETX A;  3PNT A;  3WGG A;  2JN6 A;  2XUB A;  2MG4 A;  1LDK B;  3DLA A;  3MZ8 A;  2V4J C;  1MBF A;  5DEQ A;  3W6K B;  3GTJ J;  2DYS H;  2E2J J;  5HDN A;  5EEA A;  3LA7 A;  1S29 A;  3BTL A;  3QPT A;  5K7F A;  2O5R A;  4E7J A;  4RAG A;  2DN0 A;  2JTV A;  3ELK A;  4ENM A;  2QKM B;  2K3P A;  4BDZ A;  1D0Z A;  2GIZ A;  3BPV A;  5J47 A;  5C4J J;  4Y13 A;  3JRD A;  1IAW A;  4HST A;  2WTE A;  3V7S A;  2NS0 A;  5HDK A;  1Z21 A;  3ABL H;  4JOM A;  1MDM B;  2IS6 A;  2GXB A;  4FTH A;  2Y0S A;  5LHG A;  2DAO A;  3H3Z A;  1ZRC A;  1R1V A;  2M3A A;  3L09 A;  3CMM A;  5CJ9 A;  3ZQG A;  2K40 A;  4NBQ A;  3B02 A;  4Y52 J;  2O8X A;  1LFP A;  3FBI B;  4LG3 A;  3WHC A;  3HRT A;  3RPQ A;  2VPL A;  1A04 A;  1FOW A;  1T08 B;  3IWZ A;  1JKR C;  2Z9O A;  3KEQ A;  1HC8 A;  2XF5 A;  2ZJ2 A;  2MSY A;  3IUO A;  2KLO A;  2LVS A;  4LK1 F;  3CLO A;  1HW2 A;  2EV6 A;  4GCV A;  2RVC A;  2D5V A;  2TRT A;  3WTW C;  5IP9 J;  1RNL A;  3CUQ A;  2KIS A;  4BBR J;  3Q3S A;  3RSN A;  2NVY J;  2NOG A;  5LGT A;  1QA6 A;  4IHV A;  4LOC A;  1V54 H;  2YPR A;  5M3M J;  2QEX I;  2KKO A;  3K7A J;  5E8I A;  3FMQ A;  2L9V A;  3OYM A;  2FQ4 A;  2QA4 I;  3K4N A;  2YS9 A;  2QF7 A;  2IP2 A;  3CUQ C;  1WJA A;  3MWM A;  4UVB A;  3CUO A;  1TC3 C;  4UXN A;  1FP1 D;  2DPU A;  1XS9 A;  2R5Y A;  1TTY A;  3RYP A;  2FX0 A;  4BGD A;  1IJW C;  1E0E A;  2EK5 A;  2IA0 A;  5E1Z B;  5GPC A;  3M8F A;  2NVU B;  1BIB A;  5HDG A;  4M9S A;  2G7H A;  3HPH A;  5M3F J;  3ZCO A;  3CC2 I;  4BKX A;  2VI6 A;  3JR9 A;  5ILV A;  1TT0 A;  3CJN A;  3F21 A;  1XN7 A;  5M5W J;  2FF4 A;  2D2W A;  2TDX A;  2VE8 A;  4S0H B;  2MGQ A;  3F22 A;  4A3B J;  1P6R A;  1HW5 A;  2JPC A;  1R36 A;  1UCR A;  4PFO A;  2ZME B;  4IX7 A;  2DW4 A;  2Z1D A;  1Y8R B;  3CCV I;  4HQM A;  4B3A A;  3BG6 A;  4KIC A;  3H5R A;  4LFU A;  4IZZ A;  3ZMS A;  5HOO A;  2K27 A;  4XQF A;  4PCQ A;  1S7A A;  4ZYD A;  1VTN C;  2HFH A;  1SVM A;  3GTK J;  1D0X A;  4RB2 C;  3TQN A;  1BI3 A;  1U6G A;  2JJ7 A;  3G2B A;  2VJI A;  4RA2 A;  1XGM A;  5HLI A;  2LC2 A;  4X0G A;  2NAZ A;  2DDB A;  2RV8 A;  3R0J A;  5GAH J;  3BY6 A;  4IVN A;  1L0O C;  3CP8 A;  3LSH A;  4D1Q A;  3FKJ A;  2EZH A;  3HBL A;  4ZYH A;  1IG7 A;  1FSH A;  2WV0 A;  3RPU D;  3HYI A;  2CU7 A;  3GZN B;  3JSO A;  1MD0 A;  2CS3 A;  3TDU C;  4ZYE A;  2VC1 A;  4GYI A;  3BR6 A;  3HTU A;  3K10 A;  5D8K B;  4LK0 F;  1JKP C;  4I7H A;  2M34 A;  3CJT B;  5LGU A;  3ZGK A;  2Y2Z A;  3TOA A;  2GWR A;  2V9V A;  1MMN A;  2DA2 A;  3E6M A;  5E79 C;  3SZP A;  1R6R A;  3ZQC A;  2YUS A;  3K1M A;  4PJJ A;  4OIQ F;  3DEW A;  1KYZ A;  1DGW Y;  2K86 A;  4M3D A;  3M8E A;  3M9A A;  3RTR A;  5FKL A;  4YFN F;  1SFO J;  1JUS A;  2R5Z A;  3W2A A;  2MLG A;  5GP9 A;  4BH9 A;  1RR7 A;  5FKN A;  3R6S A;  4HRI A;  1LVA A;  2XF6 A;  2FSW A;  2JA7 J;  3I55 I;  1DP7 P;  2FD5 A;  5CKT A;  1XSV A;  5EYR A;  2E36 A;  3ZQF A;  1YE9 A;  5CVV A;  3V8K A;  1IN7 A;  2WBM A;  5J8F A;  4B1R A;  1KU9 A;  4NQW B;  1W7P D;  3WGH A;  4OMZ A;  2R7F A;  2XB0 X;  2IJL A;  4GYG A;  5K7Z A;  4L9J A;  3K6G A;  3V7R A;  1FP2 A;  5F0C A;  2RRE A;  4D7N A;  1Q1H A;  2JVG A;  2XAS A;  3IH3 A;  2HPM A;  3U2R A;  2JVH A;  3FXO A;  2OZ6 A;  2HOE A;  2VQL A;  2HTS A;  2HTJ A;  4OAY A;  3HRU A;  4MNU A;  1OCP A;  3ZQI A;  1IRX A;  4L5I A;  5M5Y J;  2M2E A;  2JA6 J;  4G94 A;  1H89 C;  4ZJZ A;  5D5W B;  4RB3 C;  1F1Z A;  1KA8 A;  1XMK A;  2LR8 A;  3CTA A;  1BL0 A;  1Z7U A;  4NHJ A;  2R7X A;  2R7Q A;  2WY8 Q;  1SVO A;  2MA3 A;  3K4M A;  3ABU A;  2VQC A;  4KDP A;  2ELK A;  1YW7 A;  5KHD A;  5KK1 A;  2R7D A;  2QUF A;  2ZB9 A;  4OIN F;  1B9M A;  2IGN A;  2MW8 A;  2OCE A;  2UWM A;  2KIU A;  2W57 A;  1WQ2 A;  4RGS A;  5ERI A;  3VFZ A;  5IOZ A;  1I6X A;  1ZRE A;  2Z16 A;  3BDD A;  4HV6 A;  5DUI A;  2XSJ C;  3DFG A;  1BIA A;  5EGO B;  2HQA A;  1OCO H;  2AXT C;  3F3X A;  1N77 A;  4P1W A;  3ZMD A;  5HNH A;  1BI0 A;  4UUV A;  3K9T A;  2E7X A;  3A01 B;  1KU7 A;  3I59 B;  4CDG A;  1T56 A;  2ESH A;  4IRH A;  3QAH A;  4RB1 A;  4B47 A;  1T98 A;  1IN8 A;  3ABK H;  3JSP A;  4IOC F;  2HOT A;  2NVT J;  1QGP A;  1RIO H;  3GF2 A;  5HS7 A;  2M30 A;  1P2F A;  3GME A;  3AG1 H;  3ZMV A;  2MYS A;  2LY1 A;  4BUP A;  1MIJ A;  2E34 A;  3EUK L;  4CCJ A;  2P4W A;  4C2U A;  1Y0U A;  1OFC X;  4XLC A;  3VSL A;  2DA7 A;  3DF8 A;  5FKK A;  1A6I A;  1O3Q A;  2NS7 A;  1JTY A;  1YYV A;  1FC3 A;  1TQM A;  3OYL A;  1SFU A;  2RKH A;  1K83 J;  3H0D A;  4FQG A;  1IN4 A;  2MLK A;  5CLS A;  4MFD A;  3MCZ A;  4OU0 A;  1F43 A;  3FXK A;  1W0U A;  3OR1 C;  2IRF G;  4FAS D;  4XNF A;  4G6D A;  5B66 C;  1MDM A;  2K4B A;  3KEY A;  5EF6 A;  3ZQL A;  2H8W A;  3PJR A;  1BR4 A;  2P5K A;  1FOX A;  2IAI A;  1ENH A;  2L02 A;  3HC7 A;  3CCS I;  4B3X A;  1XMA A;  4XLA A;  2FOK A;  1FSE A;  4F3Q A;  3VOD A;  1V55 H;  4CXF A;  4A12 A;  4A6E A;  3I4N J;  3V4G A;  4BEH B;  2IS2 A;  5TGT A;  1WRJ A;  1ZAO A;  2F4I A;  1MJ9 A;  4HSR A;  3WTY C;  2ZJP F;  5D6E A;  1V5F A;  2IGM A;  1ZR4 A;  3EDP A;  2EB7 A;  1B1B A;  1M1E B;  3A4C A;  4IRI A;  1Z3X A;  5F27 A;  1WZ2 A;  1TQI A;  2ZXJ A;  3GTP J;  2J5P A;  1YHQ I;  3SDG A;  4LMY A;  1OR7 A;  2K02 A;  4BQA A;  4GXO A;  4KN7 X;  3J7Z I;  4IEJ A;  2EZI A;  1VQ6 I;  2PMZ A;  1WH7 A;  2MAB A;  2A3S A;  3QOP A;  2UZK A;  1JE8 A;  5BPD A;  4MQ9 F;  3OS0 A;  3BWG A;  3W2V A;  3HTS B;  1SFX A;  1FMW A;  3F23 A;  4IHW A;  1YG2 A;  3DBH B;  2A5Y B;  4G7H F;  2OCC H;  1W7P B;  1U3E M;  4DQ2 A;  1NG7 A;  3TO9 A;  1AKH B;  3IWF A;  2DFI A;  3BR2 A;  4PZJ A;  1OCR H;  4QTR A;  4R1H A;  1DGR M;  1RET A;  2QQ8 A;  3GZ5 A;  1B72 B;  2EIM H;  3I0T A;  3PO2 J;  2ZME A;  1VQM I;  2NS8 A;  2E1N A;  2RNJ A;  4PSX A;  4DIQ A;  1MMG A;  3CCJ I;  2CV2 A;  1EA3 A;  2OPT A;  2EFN A;  3J81 K;  4BE2 A;  1JKO C;  4A3I J;  1GT0 C;  1YI2 I;  4AID A;  1UG2 A;  2EA2 A;  2ACJ A;  1EF4 A;  3A0H C;  3Q5F A;  3LQR A;  2ZME C;  3B6C A;  1MW7 A;  4IHX A;  2JA2 A;  4RGR A;  3S1M J;  1X4P A;  5F0H A;  3H9G A;  2JRM A;  1BBY A;  1Y6I A;  3ZMT A;  3RZD J;  3G1O A;  1RC9 A;  5DCM B;  3VEP A;  3QYF A;  2JSC A;  1ON2 A;  2KQR A;  3R60 A;  1SD5 A;  2P5V A;  4A3E J;  1I3A A;  1TW3 A;  2YX7 A;  1RRJ A;  1TW2 A;  1X4O A;  2F5F A;  4RMN A;  5ICE A;  2VLA A;  1NK3 P;  4YII A;  2V7F A;  5A2Q Z;  5E3L A;  3KCC A;  3WTS C;  5CQG A;  9ANT A;  3I4P A;  2CO5 A;  1ZR2 A;  1G3T A;  5FFZ A;  2FNP A;  3ZOB A;  3S3O A;  4KIB A;  3L2W A;  4C30 A;  1WH5 A;  2COB A;  5DD8 A;  1BC7 C;  3ZQH A;  2MD5 A;  4KIG A;  4ZDL A;  4XRM A;  4EV0 A;  4FX4 A;  2HVR A;  2HKX A;  4HX7 A;  2DA1 A;  1F9N A;  1FY7 A;  1Y39 A;  2DTR A;  3AG4 H;  2IEK A;  4EJW A;  2DLL A;  3VYU B;  2FE3 A;  3RQ4 A;  2OU2 A;  2M87 A;  4HPQ A;  2JMW A;  1EH8 A;  2K9N A;  5J1U A;  2Z5U A;  2VKV A;  3IP4 B;  1R22 A;  3FIS A;  4KYW A;  3OR2 C;  1ZH5 A;  4RB0 A;  2KJB A;  1OYI A;  2RQQ A;  3DXJ F;  2X51 A;  4A3G J;  1O3S A;  4NQW A;  3GTG J;  2OZU A;  4CO8 A;  2UXX A;  1QQI A;  1OKR A;  2KRH A;  2DK8 A;  3PM1 A;  4R8H A;  3JTG A;  1YLF A;  3E6C C;  3PSF A;  1ACI A;  4HX4 A;  3T0Y A;  4R79 A;  1K6Y A;  4X6A J;  2E5Z A;  5HLG A;  3BG9 A;  2R0Q C;  2BHZ A;  1GHC A;  2W25 A;  3FDY A;  4OIR F;  4EJV A;  3KP5 A;  2PJP A;  1V5G A;  1UHM A;  3C7J A;  1ZHF A;  2R93 J;  2V6E A;  2LH9 A;  4UUS B;  5GPA A;  4A3D J;  4U0W A;  1NHA A;  4RLF A;  2EJR A;  1U9N A;  3BCB A;  4V2F A;  5IY5 H;  3I64 A;  4NUB A;  4PJM A;  4ON0 A;  1Z3Y A;  3K4J A;  2D1H A;  3SQN A;  2OF7 A;  3B6A A;  1QZY A;  1Y1V J;  4Y17 A;  4CCK A;  5HLT A;  3L2R A;  3OL4 A;  4N4O B;  2R7R A;  2A6T A;  3TOB A;  3WG9 A;  2QWW A;  3JAM Z;  5D4S A;  3EYI A;  4XN3 A;  2L7Z A;  5C4X J;  5EGO A;  1X58 A;  2ZC2 A;  3BG7 A;  3IL2 A;  3RKQ A;  1XGN A;  3HSE A;  5E1X A;  1VND A;  1T6S A;  1IO2 A;  1ETY A;  3FK6 A;  2DOD A;  3A01 A;  2DOE A;  1D5Y A;  3DU5 A;  3I59 A;  2X4H A;  4E7S A;  4RAZ A;  3FMR A;  2V1U A;  3HOT A;  3FM5 A;  2KPM A;  1E3P A;  3RKY A;  3CCM I;  5GAD J;  1TT5 B;  4B43 A;  2BY1 A;  4I98 B;  1U78 A;  1P92 A;  5B1B H;  2BV6 A;  1BOA A;  2E1M B;  2PMU A;  2O03 A;  4PK4 A;  3T8R A;  2LRE A;  2K9S A;  3CJQ B;  5FB2 A;  2PLY A;  2XV4 S;  2F4O B;  1FYL A;  2R4G A;  2MH9 A;  1SAU A;  2CRG A;  3FIW A;  1PUF B;  4M3G A;  3S3N A;  2LKS A;  4GFB A;  2QEN A;  2ID3 A;  3ONQ A;  4JK1 X;  1C0W A;  2MBF A;  4M71 A;  4Y7N J;  3BJA A;  4E7Z A;  2QQA A;  1BA5 A;  5KCM A;  3I71 A;  2N8G A;  3BLY A;  3KP4 A;  5ILS A;  4MIM A;  2GM4 A;  3RPU A;  3OYB A;  2DJI A;  1J2X A;  1LE8 B;  1LEA A;  1V5E A;  3OYG A;  1YW9 A;  4U7D A;  1E2X A;  2YX4 A;  5KAI C;  4BY7 J;  3W6V A;  1GXQ A;  3CES A;  4BEH A;  3K4L A;  1D5V A;  3TW7 A;  3LA2 A;  4E4H A;  4Z6Y A;  2W82 A;  1TQP A;  2B0L A;  1RES A;  5IOY A;  2HOA A;  3E6B A;  4M3E A;  1XPX A;  3H1C A;  4Y4R A;  3G71 I;  2LSO A;  3U1K A;  1QVU A;  2OA4 A;  2PQ8 A;  3NRV A;  2KDZ A;  3CMA I;  1STZ A;  4JX4 A;  3ZP5 A;  2HXO A;  5KVR A;  4XSX F;  4J01 A;  1YOV B;  2X6Y A;  5HOD A;  3OYF A;  2VC0 A;  3GLX A;  3ABM H;  4ZDP A;  3GTL J;  1I50 J;  2CQN A;  4DJA A;  3MVP A;  4RLQ A;  2Z33 A;  3GFM A;  4AUX A;  4DYQ A;  1HDP A;  3L2C A;  3K70 D;  1IRZ A;  3H35 A;  4MGR A;  3F8N A;  1W7P A;  2IS1 A;  2Z99 A;  3CQZ J;  1D1B A;  1QHG A;  2DMP A;  2L9S A;  3MZH A;  4KIS A;  1AKH A;  4CCL A;  2XAQ A;  1YTY A;  1IW7 F;  2GOM A;  2PX9 A;  4I99 C;  3WTU C;  2V26 A;  4DNC A;  3FXU A;  2L7F P;  2XHK A;  1W5S A;  1B72 A;  1R4N B;  2ZNZ A;  2UUZ A;  2F5D A;  2HOS A;  2PN6 A;  5GTI C;  3HDD A;  2CV1 A;  1ZLJ A;  2EFO A;  2HGC A;  3PSI A;  1RR8 C;  2QYO A;  3WOD F;  2MH2 A;  1R5G A;  3GWZ A;  3LQQ A;  3KYD B;  3ZR8 X;  2DFF A;  4P9F A;  1XSD A;  4CUG A;  3CDH A;  1I1G A;  4UV8 A;  3S2D J;  2M7B A;  5FD6 A;  3GZ6 A;  3D1N I;  2VBZ A;  3L9F A;  4IPA A;  4ANJ A;  1ETV A;  2EIJ H;  3OL3 A;  2OV7 A;  5DCM A;  2DK5 A;  4CCO A;  2DA5 A;  1MGT A;  3A03 A;  2K5C A;  2E19 A;  2XIG A;  2WAF A;  1U8R A;  2LK2 A;  4LIV A;  2A07 F;  2DYR H;  1MJA A;  4IOA F;  3PO3 J;  2CFX A;  4XRS A;  3ZN1 A;  3BCA A;  4HV5 A;  2ZO4 A;  1FBQ A;  2CGP A;  2EIL H;  1IN5 A;  1VZ0 A;  5IT3 A;  4BAY A;  5JHF A;  3GTM J;  1DU0 A;  1P4A A;  3C2G A;  2H1L A;  3H9Q A;  3SHF A;  2CYY A;  4E7I A;  3WTX C;  2I10 A;  3CLQ A;  1PP8 F;  3QYB A;  4JX5 A;  5CVU A;  1U9O A;  3TP0 A;  1ETQ A;  2PG4 A;  1DPR A;  5LLQ A;  1RUO A;  2XGE A;  4IHT A;  1GVJ A;  2CSO A;  2VB6 A;  3WE3 A;  2GBY A;  2PI0 A;  2O9L A;  1IRF A;  3HOZ J;  2DU9 A;  4BQO A;  3PUB A;  2LTP A;  2VJJ A;  1IN6 A;  2DT5 A;  3S1R J;  5DYM A;  3C1D A;  3D5R C;  4PGG A;  2AO9 A;  1MBH A;  1KQ0 A;  1FYK A;  4F52 A;  4C2M J;  3WGI A;  3HEF A;  3R0A A;  1DUX C;  3I5U A;  4G9Y A;  4M6X A;  4H4K C;  2BVM A;  4EQQ A;  4L5E A;  2CUZ A;  1TWG J;  2P7V B;  3G1L A;  3TKY A;  2A05 A;  4GGG A;  3HJE A;  2EWN A;  4JBA A;  2EA4 A;  1X1C A;  5JI6 A;  3ESW B;  1PDN C;  1G3Y A;  4UUS A;  3LSR A;  2GXA A;  1X1B A;  2W00 A;  4LD5 A;  3QP5 A;  1ZTR A;  3IH4 A;  1F36 A;  1JXS A;  3QQA A;  2EBI A;  1OLT A;  2UV1 A;  1MH3 A;  3ABT A;  2BOL A;  1ZN2 A;  3RCO A;  3JRH A;  1VQL I;  4LLL A;  3DEE A;  4EJU A;  4ZYG A;  2VBW A;  3VSK A;  2VJ5 A;  1S72 I;  4YEJ A;  3ECO A;  1TWH J;  1VQ7 I;  1MNM C;  1FX7 A;  3CDI A;  5FLM J;  4C3H J;  2Q2E B;  2QVO A;  4YIR X;  4BE1 A;  3IAM 2;  1R49 A;  1YFH A;  2OQG A;  2VL8 A;  4M6V A;  1I6H J;  2OTJ I;  2A68 F;  3F8B A;  3FZV A;  3J80 Z;  1VQ5 I;  3SJM A;  3P9I A;  2O0Y A;  1E3O C;  5L3G A;  1BC8 C;  3BTJ A;  4CH7 A;  2K3F A;  1KYW A;  4PJN A;  1S3J A;  3MD2 A;  3HRM A;  1UJ8 A;  3WU0 A;  3OIQ A;  2CFO A;  2Y75 A;  1MMD A;  1VQK I;  3K4C A;  1UMQ A;  4OOI A;  4PFP A;  1GV2 A;  3H9J A;  1HOM A;  2WC2 A;  4EJO A;  4HZF A;  3QP6 A;  1ZG1 A;  3HM5 A;  2ZJQ F;  3DBR B;  1HQC A;  3S14 J;  3ULQ B;  2P6S A;  2W1O A;  2QQB A;  4CGZ A;  1KU2 A;  2DA4 A;  3D5L A;  1WGX A;  3FXM A;  2F48 A;  1USS A;  2JK3 A;  1R1T A;  5B5E C;  1G8X A;  1H9T A;  4A0X A;  5JR3 A;  1PUF A;  3V8J A;  4F55 A;  4V19 K;  1WI3 A;  4QPO A;  1JHH A;  5C44 J;  4RM2 A;  2STT A;  2WV1 A;  4U0Y A;  3DPT A;  2H27 A;  1N25 A;  1YQA A;  4ZYA A;  5LRS A;  4G7O F;  1Z1D A;  2W24 A;  2DTZ A;  1D1A A;  3S1N J;  2GA1 A;  2LF7 A;  2RGV A;  5A2Q K;  5EJC A;  1LE8 A;  1ZK8 A;  2A61 A;  3GXO A;  3HG9 A;  1R23 A;  2W84 A;  3E97 A;  2FOW A;  1UST A;  2EZL A;  4CCM A;  1IRG A;  3WTZ A;  5L3C A;  2NRA C;  1XD7 A;  1H88 C;  4RS8 A;  1ORK A;  2Y9Z A;  1P9Q C;  2XAU A;  1W5C C;  1UG0 A;  2ELJ A;  2K7L A;  5FGM A;  2E2H J;  2NVX J;  4KMF A;  2XAH A;  4A3M J;  1K6O A;  4J19 A;  4BJT A;  2HYG D;  3FWE A;  3QRF F;  3G4S I;  5ICC A;  2ME6 A;  4W97 A;  5K1Y A;  3HOY J;  3DU6 A;  2DCE A;  2XRO A;  1HF0 A;  2CG4 A;  1SFK A;  5EEG A;  2LFB A;  2A69 F;  3TBI A;  4KIF A;  3VOE A;  2OTL I;  3IKT A;  1R4M B;  1Z77 A;  4II2 A;  3WE2 A;  4XIC A;  3CO7 C;  3UKG A;  3H5A A;  3BTC A;  4M9Z A;  4YG2 F;  4A93 J;  1RZ4 A;  2D1V A;  2K85 A;  4QIW N;  2E2I J;  1MZB A;  4PUS A;  1Z9C A;  4HW0 A;  3LMM A;  2GIV A;  4HDV A;  3GYH X;  4FCY A;  1I1S A;  1YS7 A;  1S6L A;  1WJF A;  4JX6 A;  5GAG J;  5LHH A;  1L3L A;  3A2K A;  3KP6 A;  3HB9 A;  1QO0 D;  3MKY B;  3QYE A;  2E35 A;  4P96 A;  5BNG A;  4IHY A;  4CZC A;  3HOX J;  1V4R A;  3JTH A;  3MN2 A;  2M7A A;  1W1W E;  2OBP A;  5FD5 A;  1HCR A;  3SDB A;  3DKX A;  4A3F J;  2L54 A;  1XDS A;  1P4W A;  1BM9 A;  1RKW A;  3QU6 A;  3LFU A;  4JQF A;  3J7Y J;  4AC0 A;  1W5T A;  3VYT B;  1K79 A;  2B7E A;  2Y69 H;  3JW4 A;  2BHY A;  1U5T B;  2KIQ A;  5HNF A;  4LG0 B;  1T39 A;  3EUH A;  3F8C A;  3OIP A;  3KZZ A;  1LPQ A;  1HKQ A;  3MKW B;  1U8B A;  2XPV A;  3VWB A;  4O6J A;  4NDL A;  4G7Z F;  1PP7 U;  1D8J A;  3MZY A;  3JAM K;  2CW0 F;  4BBS J;  3AG2 H;  2XRL A;  4AVP A;  2EZK A;  2J5O A;  3UR3 C;  3K0L A;  3M3Y J;  2DA6 A;  4E7H A;  3IKV A;  2X1D A;  3F72 A;  3LOC A;  4EM1 A;  5L3D A;  4DGW B;  1QHH D;  1WSU A;  4ESJ A;  3NAU A; 
#chains in the Genus database with same CATH homology
 3A02 A;  3SFI A;  4X6A J;  5J1R A;  3BG9 A;  1IC8 A;  2LY9 A;  2R0Q C;  3JRG A;  1JJ8 C;  1ETX A;  2DA3 A;  3H0G J;  2JN6 A;  2R93 J;  2MG4 A;  2HDD A;  4UUS B;  5GPA A;  2L0K A;  4A3D J;  1MSF C;  1MBF A;  3GTJ J;  1U9N A;  2E2J J;  4V2F A;  5M5X J;  1IDZ A;  3CCY A;  5EEA A;  5J1Y A;  3BTL A;  2OF7 A;  5FLV A;  3B6A A;  5K7F A;  2LP0 A;  2DN0 A;  1Y1V J;  2GLO A;  1UHS A;  2HI3 A;  1W0T A;  5JLX A;  5C4J J;  3JRD A;  2CUE A;  2CQX A;  2L7Z A;  5C4X J;  4FTH A;  5J3L A;  5EGO A;  5IP6 A;  1X58 A;  3ZQG A;  2K40 A;  5EZG A;  3F0C A;  3RKQ A;  4Y52 J;  1VND A;  3OIO A;  1OJL A;  1ETY A;  3FK6 A;  3WHC A;  3Q0W A;  3A01 A;  3HGG A;  1D5Y A;  1I3Q J;  1JKR C;  1TWC J;  2MSY A;  2LVS A;  2K9Q A;  2RAE A;  2D5V A;  2DMN A;  2TRT A;  5IP9 J;  1QVT A;  3OOU A;  5FKM A;  3BG3 A;  4FIS A;  2ID6 A;  5F1J A;  4BBR J;  3Q3S A;  1BW5 A;  2NVY J;  2NOG A;  4IHV A;  4LOC A;  2DJN A;  1U78 A;  5M3M J;  3K7A J;  4A69 C;  2FQ4 A;  2K9S A;  1DU6 A;  1MBK A;  2YS9 A;  2QF7 A;  2LLK A;  4ABZ A;  2QCO A;  5IYB J;  2CRG A;  3FIW A;  1PUF B;  2L7M P;  1FTT A;  4M3G A;  1JJ6 C;  1Y1W J;  1TC3 C;  4GFB A;  1XS9 A;  2R5Y A;  2ID3 A;  2FX0 A;  1IJW C;  5GPC A;  4Y7N J;  5M3F J;  5E3M A;  3TP3 A;  4BKX A;  2VI6 A;  3JR9 A;  1BA5 A;  2N8G A;  1FIP A;  4MIM A;  2GM4 A;  5M5W J;  2PMZ N;  4S0H B;  4FE7 A;  2MGQ A;  1IV6 A;  4A3B J;  1T33 A;  1LE8 B;  1JUP A;  2VPR A;  3C2B A;  4B3A A;  1MBE A;  4BY7 J;  3W6V A;  5DS9 A;  3TW7 A;  5K7H A;  2O8K A;  5IP7 J;  2X9D A;  1S7E A;  1RES A;  3FK7 A;  3CMY A;  3BQY A;  5IOY A;  2HOA A;  4M3E A;  3GTK J;  2DMU A;  4A3C J;  1IDY A;  2WAQ N;  1QVU A;  2ECC A;  2JJ7 A;  2HQ5 A;  2XSD C;  1LFB A;  4JX4 A;  2KDZ A;  5C3E J;  2HXO A;  4DYC A;  1CQT A;  5HOD A;  2CQQ A;  3GTL J;  1I50 J;  1GVD A;  3HKZ N;  4RDU A;  2X6O A;  4XK4 A;  1X2N A;  3MVP A;  4B4C A;  1B8I A;  4RBO A;  1TWF J;  4DYQ A;  4AUX A;  1HDP A;  1BJZ A;  1K61 A;  2EZH A;  3HBL A;  4D5C A;  1IG7 A;  1BW6 A;  2Y30 A;  1IRZ A;  2CU7 A;  2M0C A;  3CQZ J;  2R92 J;  2DMP A;  1AKH A;  3BR6 A;  1JKP C;  2XB5 A;  2M34 A;  4I76 A;  3LSP A;  3BG5 A;  2HYJ A;  2Y2Z A;  2L7F P;  1B72 A;  2DA2 A;  5E3O A;  2HOS A;  4A3L J;  1OCT C;  1ETK A;  1VF9 A;  3ZQC A;  2YUS A;  3GTO J;  2XPU A;  1JGG A;  3HDD A;  3DEW A;  4M3D A;  5F08 A;  3NAR A;  3S16 J;  5FKL A;  3GBG A;  1SFO J;  1WCM J;  1JUS A;  2R5Z A;  5GP9 A;  2G0E A;  1RR7 A;  2Y31 A;  5FKN A;  1Q1V A;  1NK2 P;  2B63 J;  5EG0 B;  2JA7 J;  2FD5 A;  2WB1 N;  5F0F A;  5EYR A;  1YRN A;  3S2D J;  3ZQF A;  2KT0 A;  5FKO A;  3D1N I;  3S1Q J;  1ETV A;  3QPS A;  2ME0 A;  4B1R A;  2DA5 A;  2EQR A;  4QSH A;  3HOV J;  3A03 A;  1HLV A;  3GTQ J;  2XB0 X;  2E19 A;  5K7Z A;  1JTX A;  2LK2 A;  5F0C A;  4D7N A;  1SAN A;  5EDN A;  3IH3 A;  4CYC B;  2YU9 J;  2JA5 J;  3PO3 J;  4XRS A;  4BXX J;  1ZKG A;  3ZQI A;  1OCP A;  5DTD A;  4I6Z A;  5M5Y J;  4MLO A;  2M2E A;  2JA6 J;  1H89 C;  1ZQ3 P;  2XGC A;  3H3V K;  3WHB A;  2LR8 A;  1BL0 A;  1ZGW A;  3CDL A;  2L9R A;  1HDD C;  3GTM J;  1DU0 A;  4BY1 J;  2XPW A;  3S17 J;  2ELK A;  1ETO A;  5FJ8 J;  3S2H J;  2I10 A;  2ZB9 A;  4JYK A;  4JX5 A;  1MSE C;  1U9O A;  3TP0 A;  3K2A A;  2MW8 A;  1ETQ A;  2XGE A;  5IOZ A;  2GBY A;  2O9L A;  3HOZ J;  1WPK A;  1G2H A;  2LTP A;  5EGO B;  3S1R J;  1IGN A;  1TWA J;  1MBH A;  2AO9 A;  2VUM J;  3LSG A;  3RQI A;  4C2M J;  3HEF A;  1POG A;  2CJJ A;  3A01 B;  1T56 A;  4L5E A;  1TWG J;  2Y0S N;  3G1L A;  2HOT A;  2NVT J;  2DMT A;  1P7I A;  4A3K J;  4UUS A;  3BTI A;  3BT9 A;  2W48 A;  3LSR A;  1FEX A;  1ZTR A;  3IH4 A;  1F36 A;  3QQA A;  1OFC X;  2EBI A;  5EZH A;  2DA7 A;  5FKK A;  1MH3 A;  2TCT A;  3HGY A;  3L1P A;  1A6I A;  3JRH A;  4DW6 A;  4AYB N;  2AHQ A;  2NS7 A;  1JTY A;  1K83 J;  1TWH J;  2R5Y B;  4DZP A;  4MFD A;  3BQZ A;  1MNM C;  5FLM J;  5F04 A;  1F43 A;  1W0U A;  2X48 A;  4FE4 A;  4C3H J;  2LD5 A;  2FJ1 A;  5EF6 A;  1QPI A;  4M6V A;  3ZQL A;  2E1O A;  1I6H J;  4DYR A;  3SJM A;  2IAI A;  1E3O C;  1ENH A;  3BTJ A;  1AHD P;  1XG1 A;  2VKE A;  4V2G A;  4D5F A;  4A3J J;  1MBJ A;  3IH2 A;  2CUF A;  2JA8 J;  1FIA A;  2EH3 A;  3I4N J;  4XRS G;  1GDT A;  4C3J J;  3QPL A;  4CYC A;  1UMQ A;  1X2M A;  3HOU J;  1GV2 A;  1HOM A;  1LFU P;  1ZR4 A;  1IUF A;  4EEF G;  5JLW A;  3S15 J;  1ITY A;  3HM5 A;  5F27 A;  1MBG A;  3OSF A;  3TED A;  3JRE A;  3S14 J;  3GTP J;  3SDG A;  2DA4 A;  2R7Z J;  4M3B A;  1WGX A;  4M3F A;  2JK3 A;  1P7J A;  4IEJ A;  2EZI A;  1PUF A;  1WH7 A;  1WI3 A;  1B8I B;  4MFE A;  5C44 J;  2WV1 A;  5E3N A;  4DZJ A;  1H8A C;  4IHW A;  3LSJ A;  4JP0 A;  5IYC J;  1GV5 A;  3RZO J;  3OSG A;  2M8G X;  1AKH B;  3MKL A;  3BR2 A;  2DTZ A;  3O8G A;  3S1N J;  3Q0V A;  4QTR A;  2JWT A;  3BR5 A;  1LE8 A;  1ZK8 A;  1RET A;  1B72 B;  4W1U A;  3PO2 J;  2EZL A;  3O8H A;  4D7M A;  2NS8 A;  3BR0 A;  3JRA A;  2OPT A;  3VPR A;  3IV5 A;  2XGD A;  4A3I J;  1H88 C;  3Q0U A;  1ORK A;  1GT0 C;  2Y9Z A;  1JKO C;  2ECB A;  2R5Z B;  1UG2 A;  4G12 A;  1VI0 A;  3BR3 A;  4XID A;  3LNQ A;  2E2H J;  2NVX J;  1EF4 A;  1JKQ C;  3E7L A;  3B6C A;  4IHX A;  4A3M J;  4J19 A;  1Z0X A;  1YRN B;  2IBD A;  3S1M J;  5F0H A;  2ME6 A;  4W97 A;  1JT0 A;  3HOY J;  1HF0 A;  3FKI J;  2LFB A;  3RZD J;  1APL C;  3JRF A;  3G1O A;  2P81 A;  1FJL A;  1XC5 A;  3BR1 A;  1Z77 A;  4C3I J;  4XIC A;  3UKG A;  1A5J A;  1GUU A;  3BTC A;  4A93 J;  4A3E J;  4QIW N;  2E2I J;  2DMQ A;  4FCY A;  2Y9Y A;  4MO7 A;  4JX6 A;  3TW6 A;  1NK3 P;  5E3L A;  5IYD J;  1FTZ A;  9ANT A;  3G1M A;  3HB9 A;  5BNG A;  4IHY A;  1ZR2 A;  3HOX J;  3ZOB A;  1O4X A;  3MN2 A;  3HOW J;  1WH5 A;  2COB A;  1HCR A;  3ZQH A;  4A3F J;  2M9H A;  4XRM A;  3DCF A;  2HXI A;  1RKW A;  3I4M J;  1RKT A;  2DA1 A;  1AU7 A;  2LKX A;  4AC0 A;  2O7O A;  2IEK A;  5EG0 A;  2JMW A;  5IPA A;  1R9T J;  3JRI A;  2K9N A;  5J1U A;  4X1E A;  1MH4 A;  2VKV A;  4HNV A;  3FIS A;  3JRB A;  2NVQ J;  1QRY A;  1U8B A;  2XPV A;  3JRC A;  4NDL A;  1VFC A;  4BBS J;  4A3G J;  4UUT A;  2XRL A;  2EZK A;  1JT6 A;  1JUM A;  3GTG J;  3M3Y J;  2DA6 A;  2H8R A;  3M4O J;  1RPW A;  3PM1 A;  3LOC A;  1ETW A;  2H1K A;  3NAU A;  1NTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...