3A03A

Crystal structure of hox11l1 homeodomain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
FSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-cell leukemia homeobox protein 2
publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 19
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2009-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3a03A00
3UKGA 1ETKA 3I4MJ 2LY9A 3MN2A 2DMNA 4MO7A 2IEKA 2L7ZA 2NS8A 3BG3A 3VPRA 1U78A 1MNMC 5K7FA 1UHSA 2AO9A 1B8IA 2XPWA 2O7OA 1UMQA 2CUFA 2DJNA 4M3GA 4B1RA 1U8BA 3GTLJ 1ENHA 3C2BA 5FJ8J 1FIAA 3A02A 5EG0B 1BW5A 3G1MA 4A3CJ 1QVUA 2MG4A 4G12A 2G0EA 1JKQC 2LP0A 3OSFA 3JRHA 3H0GJ 4IHVA 1A5JA 4JYKA 1K61A 5C3EJ 1BL0A 4M3BA 5M5WJ 4BBSJ 1NTCA 4CYCB 1Y1VJ 1RR7A 4DYQA 1IGNA 1MH3A 5J1RA 3JRDA 2YS9A 1SFOJ 4JP0A 4JX6A 5BNGA 5E3MA 3ZQLA 3A01B 3JRCA 2JA6J 1JUSA 3FIWA 2XRLA 4HNVA 3LSPA 5GPCA 3CDLA 2Y9YA 2M9HA 5FKLA 3JRFA 2YU9J 3S2HJ 5M5XJ 3TP0A 1JT0A 3G1OA 5EF6A 3QPLA 3K7AJ 2LR8A 4MLOA 1YRNB 3TP3A 1P7IA 1RPWA 1LE8A 2LLKA 4I6ZA 2EZLA 1ETQA 2R5ZA 3CMYA 3LOCA 4W1UA 4A3BJ 2LKXA 4V2FA 2CQQA 1MBGA 1WH7A 5J3LA 5IYBJ 3H3VK 3S1NJ 3HOYJ 2I10A 1IUFA 3B6AA 2P81A 1B8IB 5J1UA 1GV2A 3GTOJ 5GP9A 2VKEA 1A6IA 3IH2A 3MVPA 2Y2ZA 3BR5A 4DYRA 1ITYA 1E3OC 5J1YA 3M4OJ 4Y52J 5M3FJ 4UUSA 1MBEA 1GVDA 5FKNA 4BBRJ 1HCRA 2WB1N 3BR3A 3IH4A 3ZOBA 2EZIA 2WV1A 2YUSA 1WPKA 2TRTA 2ZB9A 3S1RJ 5M3MJ 2JN6A 1O4XA 5EDNA 3JRGA 4M3EA 1P7JA 2HOTA 2ELKA 2JMWA 1IDYA 2M34A 3PM1A 4MFEA 3F0CA 1I50J 1IRZA 4ABZA 5IYDJ 4DYCA 1QVTA 1Z0XA 1XG1A 4BY7J 2N8GA 2H1KA 3BR0A 3M3YJ 2CJJA 5F04A 3SDGA 1CQTA 5FLVA 2GBYA 4D7MA 4IHYA 4A3MJ 5C4JJ 1WCMJ 1IC8A 2CRGA 2NVYJ 3GTQJ 1LFUP 1JJ6C 3FKIJ 2R0QC 2K9QA 1LE8B 1K83J 1XS9A 3TW6A 4BKXA 3HGYA 3JREA 2R5ZB 2E2JJ 2E2IJ 5EGOA 2NVQJ 3I4NJ 3BTCA 1BJZA 5E3LA 1HLVA 3GBGA 2M8GX 4GFBA 4RBOA 1ZR4A 5EZGA 2HXIA 1NK2P 2MW8A 1JTXA 1DU6A 3WHBA 1ETXA 5DS9A 1GUUA 5F0HA 3HKZN 3SJMA 3Q0WA 4QTRA 2DMQA 3BR6A 1ETWA 3O8GA 3ZQHA 5IPAA 2DA7A 2K9NA 1JUPA 1X58A 4UUSB 2VUMJ 1F43A 1JTYA 1VI0A 3IH3A 4XRSG 5IOYA 9ANTA 2XSDC 3S15J 1Y1WJ 1ZGWA 1S7EA 2M2EA 2VI6A 3ZQCA 2FJ1A 2OPTA 2Y9ZA 1TC3C 2JK3A 2R92J 2DMUA 1W0UA 1MSFC 3E7LA 3DEWA 4M3DA 3FK6A 3GTJJ 2XGEA 4FTHA 1WH5A 3BG9A 1MSEC 2W48A 3K2AA 3JR9A 1GT0C 2MSYA 4FISA 1ZKGA 4DW6A 2JWTA 4XK4A 3HM5A 1JGGA 4A69C 1HDDC 3FK7A 1F36A 3HGGA 3NARA 2Y0SN 4DZPA 2OF7A 1T33A 3HBLA 1PUFA 5IOZA 2ID3A 1B72B 4AUXA 4A3JJ 2DN0A 1H88C 2DA4A 4A3DJ 3W6VA 3RZOJ 3HDDA 4A3FJ 1UG2A 5HODA 2XB0X 2X48A 3Q0VA 1G2HA 2NOGA 5EGOB 3LSGA 2XPUA 3HOUJ 2LK2A 2XPVA 2R93J 1TWCJ 1RKWA 5E3NA 1FTTA 4C3HJ 4MIMA 1XC5A 2IBDA 3ZQIA 1AKHA 2D5VA 1FIPA 1JJ8C 2KT0A 3RKQA 1T56A 2FX0A 3BR1A 4C3JJ 3D1NI 3RZDJ 3BQZA 1QRYA 1ZTRA 3CCYA 1H89C 2DTZA 4JX4A 2QCOA 2DMTA 1EF4A 2GM4A 3FISA 1I6HJ 1U9NA 1VNDA 2O8KA 1Q1VA 3HEFA 2XGCA 3HOZJ 3QPSA 3LSJA 5IP6A 1GV5A 1MH4A 1FTZA 2O9LA 3TEDA 1ZK8A 1MBHA 1HDPA 2RAEA 2VPRA 3G1LA 3IV5A 5DTDA 3BR2A 1R9TJ 3LSRA 1PUFB 2JJ7A 3GTGJ 4X1EA 2Y30A 3BTIA 3ZQFA 2MGQA 2VKVA 1JKOC 2FQ4A 3PO2J 5FKOA 4UUTA 2DA3A 3GTKJ 1ETOA 1GDTA 4XRSA 1I3QJ 4IHWA 2IAIA 4RDUA 5C44J 2LFBA 4FE4A 4QIWN 2Y31A 2E1OA 2EQRA 3HOXJ 2CUEA 2FD5A 3OIOA 3BG5A 1AU7A 1TWGJ 3L1PA 1HF0A 1AKHB 5K7HA 3O8HA 4XIDA 4XICA 2NVXJ 4IHXA 4M3FA 1BW6A 1OFCX 3JRIA 3CQZJ 1MBKA 2ID6A 5FLMJ 5IYCJ 3B6CA 3TW7A 1FJLA 4I76A 3LNQA 3GTMJ 1IDZA 2R5YA 2HI3A 3S1MJ 2EZKA 1W0TA 1TWFJ 4Y7NJ 2M0CA 3HOWJ 2X6OA 2GLOA 4D5CA 2EH3A 1ETVA 1MBJA 1X2NA 4FE7A 1IV6A 1WGXA 3HOVJ 3OSGA 5EYRA 3NAUA 4A93J 4AC0A 1LFBA 2L7FP 2LTPA 5F08A 4AYBN 3S1QJ 4X6AJ 4D5FA 1TWAJ 2CU7A 2CQXA 4J19A 5IP7J 1VF9A 3BT9A 3RQIA 4DZJA 2LVSA 2ME0A 5FKKA 3BTLA 4L5EA 2HOAA 1ZQ3P 2B63J 2EZHA 4QSHA 2R7ZJ 1RESA 4W97A 1SANA 5F0CA 2JA7J 1BA5A 3MKLA 2E2HJ 2H8RA 4A3GJ 3BTJA 4B4CA 4D7NA 2PMZN 2E19A 2ECBA 1JT6A 3JRAA 3A03A 5EEAA 2WAQN 2ME6A 2LD5A 2NVTJ 3Q3SA 2K40A 1WI3A 3OOUA 1ORKA 3BQYA 4A3KJ 2QF7A 3S16J 3DCFA 2XGDA 4S0HB 1JKRC 1APLC 2KDZA 2HDDA 1ETYA 4A3EJ 4C2MJ 4EEFG 4A3IJ 5EZHA 1D5YA 2EBIA 4IEJA 3HB9A 4C3IJ 4BXXJ 2R5YB 5FKMA 3SFIA 3GTPJ 2JA8J 5EG0A 2DA2A 2L7MP 1RETA 2L9RA 1TWHJ 1MBFA 4MFDA 3WHCA 2DMPA 5JLXA 1AHDP 2HXOA 2TCTA 2COBA 2X9DA 1OCPA 5GPAA 4XRMA 4M6VA 1OCTC 4CYCA 4BY1J 3S2DJ 2L0KA 1NK3P 4A3LJ 5M5YJ 2XB5A 1FEXA 1Z77A 1RKTA 5E3OA 5F27A 3ZQGA 1VFCA 1ZR2A 4JX5A 2AHQA 3JRBA 2HQ5A 5F1JA 2HOSA 3QQAA 3A01A 1JUMA 2K9SA 1H8AC 1HOMA 3PO3J 1OJLA 5K7ZA 2DA6A 1QPIA 2DA5A 4B3AA 1JKPC 1U9OA 2ECCA 1POGA 1IG7A 1X2MA 5JLWA 2NS7A 3Q0UA 5IP9J 5F0FA 1DU0A 3S14J 4NDLA 1B72A 4FCYA 1IJWC 1YRNA 4LOCA 3S17J 5C4XJ 4V2GA 2DA1A 2JA5J 2HYJA
chains in the Genus database with same CATH superfamily
3OL4A 4CXFA 2RV8A 2PMUA 4DBRA 1Z7UA 2ETHA 3AG3H 3TMOA 1KQ8A 4RLQA 3ZN0A 1G8XA 2M5WA 2XF6A 1LNWA 2OA4A 3BG3A 2A05A 1U78A 4ZTJA 5K7FA 2M45A 4B8XA 5HDKA 4DNCA 4HLYA 2M8EA 4UY8I 2FMYA 3E6MA 3HG9A 2ZMEC 2KJBA 3J7AO 4KIGA 4A3CJ 1QVUA 4E7KA 3SEQA 2G0EA 3ESWB 4N9IA 2LP0A 3CZ6A 2P6TA 3DP7A 3H0GJ 5C3EJ 2E60A 3IAM2 3AL0B 4CYCB 1Y1VJ 5LRRA 4A0ZA 3OY9A 1D8JA 4DYQA 4EJWA 3KP4A 1IGNA 4L9TA 1WKMA 2IPQX 2QM3A 1TZLA 4JP0A 1K78B 3FF5A 1DUXC 1HW1A 3TOBA 4U88A 3OWTA 2YR2A 4BACA 3AAFA 3GMEA 5DDGA 1ON1A 4M6YA 4O3MA 2HGCA 3VSKA 1XB4A 5GPCA 2O5RA 5ILUA 3J80Z 3DTKA 3OV8A 3ZMVA 1W5CC 2E7XA 1IZ1A 5K5OA 3O6BB 2P8TA 2Z99A 3P5JA 1P4XA 1NH3A 3VYRB 2LR8A 2FU4A 2STWA 1TW3A 3OYKA 3CC4I 3EYYA 2VC0A 3BP8A 3CP2A 4HSRA 1RI7A 2BE5F 2FE3A 1LE8A 2EZLA 4OMYA 2ZXIA 4CCMA 2EIKH 3QPHA 4EGZA 1SMYF 3LOCA 3X2QH 1FOWA 5FLXK 3DBHB 1VQ5I 1MBGA 1UJ8A 4Q4ZF 3I64A 3VYUB 2JSCA 2I10A 2P81A 3OIPA 1XGMA 2IS2A 2DJIA 4L0ZB 2MLKA 4HNUA 1VQ4I 1FX7A 1SD4A 1F5TA 1V4RA 1GLNA 3IH2A 3MVPA 3EUAA 2Y2ZA 3BR5A 1ITYA 1WJDA 2ZSHB 5J1YA 2VOOA 1T08B 4LGWA 2DPDA 4UUSA 4HRIA 1OR7C 5FKNA 3C2HA 4BBRJ 3S2WA 1S9HA 4G6DA 3BR3A 4XRFA 1D8KA 1DP7P 3QYEA 2OQGA 3U2RA 2KPMA 2P0WA 2V7FA 2JPBA 1VQMI 2ZB9A 2RGVA 3BROA 3K4BA 3L2QA 2JN6A 2MH2A 3CCVI 3CUQA 2V1NA 1R4NB 2ELKA 4JQFA 3VWBA 2XSJC 1B4AA 1R5GA 4L9VA 2BY1A 4ABZA 3CCRI 1XG1A 2CW8A 2Y0SA 1LB2A 1X19A 3K4KA 1X1CA 4AYBA 3D5SC 2KFDA 1D0XA 2PJRA 5J8CA 1CQTA 3LQRA 3M7GA 4LK1F 3J81K 4JBAA 4FHTA 4NQWB 4AIJA 1RC9A 3HPHA 4QWQA 4AU7A 3TO7A 5C4JJ 3CTAA 2CWEA 2CRGA 1R1VA 3FKIJ 3BCAA 3DLAA 5DUKA 4QLCU 2IVMA 1SFEA 1N75A 1Y0NA 2VONA 5B66C 3K1PA 4A2UA 4BKXA 1LVKA 3OYCA 2IGOA 2KMUA 4MTEA 3E5QA 1QO0D 4E7JA 1F4KA 1WRJA 4D1QA 4MEXF 1ZR4A 3TL4X 2R7TA 2IP2A 4HNTA 5HDNA 1VTNC 1BN5A 2MW8A 3MKZA 2WAQA 5B5EC 4BDYA 2V6EA 2CUZA 1GUUA 2JVGA 4N9HA 3O8GA 1OCCH 3GUDA 2K9NA 1X58A 3GYHX 2AXLA 4BXUA 1JTYA 1VI0A 4XRSG 3C18A 5IOYA 2O8XA 2XSDC 2VKHA 4ESBA 4A0XA 2R7WA 3RPUA 4IXAA 2VQCA 1BR1A 2R92J 4BJ6C 5FB2A 3WTUC 1W5SA 2QUFA 1J09A 4CCKA 2P5LC 1W0UA 3V7CA 1Z7LA 3E7LA 2G7UA 2FRHA 4N4OB 4ZYHA 1BIAA 4MEYF 3BG9A 2ZMEB 5ERIA 2EWNA 4BJTA 1D1CA 2VOPA 2MSYA 1A35A 2DCEA 2F4IA 5CJ9A 2UV1A 4NUBA 1XMKA 1QPMA 4XK4A 2X6YA 1K6OA 3GFJA 2BW3A 2BHYA 4DZPA 5J4YA 2OF7A 1G3YA 1Z67A 1T33A 4I7HA 2ID3A 3FXOA 1FMWA 2H8WA 4KIFA 4A3JJ 3W6VA 1G3TA 3RZOJ 3K10A 3U1KA 4A3FJ 3LFKA 2HWVA 3F9KA 4I0BA 1I6XA 2K7LA 3Q0VA 3H1CA 1PUEE 3I53A 4NC6A 2F5FA 4IVNA 4CUGA 5EGOB 1MDMA 1KU2A 3HOUJ 1K6YA 3QP6A 2LK2A 2IJLA 2R93J 2OTLI 2JSPA 3T5XA 2JUGA 4C3HJ 1UG0A 2HDCA 1YG2A 2F5CA 2IBDA 3ZQIA 3CMEI 4BAYA 1AOYA 1AKHA 2OCCH 3KZIC 1JJ8C 5GADJ 2O6GE 1T56A 2VBYA 4LLLA 4EATA 2P7CB 3HJEA 5E1XA 2Q1ZB 2BY2A 5JVGF 1QRYA 2A3SA 2BZTA 3CCYA 3RPUD 3BY6A 4ZH4F 1UCRA 4XKWA 1V5EA 1D1BA 4F3QA 5JR3A 3IC7A 4BE2A 4Y33A 3LSTA 2VBZA 2GM4A 3FISA 3LMMA 4M71A 5CVVA 3OL3A 5K5RA 2Y75A 2HQRA 1J9IA 2RC4A 5CVRA 4H0EA 1UHWA 1XTAA 1Q1VA 3HEFA 1B1BA 3HOZJ 3K69A 5HLTA 3U9GA 1BOBA 3ERMA 3W3CA 2L5QA 2PQ8A 4N4NB 3KYDB 3TEDA 1HDPA 3T0YA 3ZP5A 2QA4I 2DOAA 2M30A 1UHMA 4MNUA 4ZTFA 1PUFB 2JJ7A 3I3LA 4XKBA 4CCNA 5IT9K 1SD5A 3ZQFA 3ULQB 5CYVA 4UXNA 1JKOC 4G8XA 1R23A 3T1BA 1O3QA 4ESFA 5LBQA 1FPQA 2XKOA 3GTKJ 2R4GA 1IRFA 1TT5B 3PIOF 2IAIA 1E3HA 4MTDA 4JK1X 2ZNZA 2L9SA 2MBFA 5C44J 5JHFA 1WJBA 4QIWN 3GVAA 2LY2A 3K70D 3OR2C 3HOXJ 2FD5A 3OIOA 5AIQA 1BJAA 2XAFA 5KNLA 1Z9CA 4LD5A 2X4HA 1PP7U 2JTVA 4XIDA 4LK0F 1OCRH 3HRSA 4RAGA 3HRMA 2V9KA 2XC7A 5JHUA 1MBKA 1XCBA 3E5UA 3HOTA 5FLMJ 2M4GA 3GFLA 3HTUA 3QWLA 1YI2I 2GWRA 1QHHD 3B6CA 5BQTA 1YE9A 3CUQC 2WC2A 4CCJA 1YS7A 4LMYA 1YIOA 4ASNA 3LNQA 5ICGA 2R5YA 3B02A 3FBNB 1Z6TA 2D1VA 4XLPF 2DFEA 1YO5C 4U7BA 2Y0MA 5FFXA 4DJAA 1TWFJ 3MWMA 2M0CA 2V6CA 4B43A 4WWCA 3H9JA 2X6OA 3M07A 4UVAA 3PQJA 2WY8Q 3HSEA 3ZMDA 2K9LA 1IUYA 3R6SA 5EYRA 2Z9OA 4A93J 1DP3A 4EM0B 2PI0A 2L7FP 2LTPA 4X6AJ 5LFAA 2PJPA 2XV4S 2DFHA 1HSJA 2H6CA 2OAZA 3BT9A 3SZTA 1IRXA 1XSXA 1ODDA 1X1PA 2ME0A 3PFIA 4B3XA 4RGSA 4L5EA 5E8IA 2NNNA 3BZ6A 2HOAA 3WGGA 2M4KA 1ZGJA 2H6BA 2R7ZJ 1QA6A 1WZ2A 2IS1A 2NAZA 4W97A 4BJ5C 3RYPA 2JA7J 3H36A 1QGPA 1NG6A 2D2WA 2DDBA 4HQEA 1FP1D 3AKZA 2RVCA 4YIFA 2BVLA 5CVIA 1L0OC 1JT6A 3FWEA 1KU7A 4II2A 3JAMZ 1D5VA 1WJAA 2HYFA 3JCUC 5GAGJ 2FMLA 1TT0A 1T2KA 4L18B 1LDKB 3GLXA 4FX4A 4LITA 1IN5A 3W6KB 4X0GA 3DCFA 2XGDA 4IL6C 4Y13A 3G73A 1ETYA 4C2MJ 3EUKL 3IWFA 4EEFG 2Q0OA 2HDWA 5EZHA 4A3IJ 1D5YA 1YQAA 2GA2A 3PFYA 4AM3A 5KHDA 2QQ8A 1SC7A 1RNLA 4DBQA 2DA2A 2JA8J 2L9RA 4GCVA 4EM2A 3KEQA 1IXCA 4WCGA 2RREA 4UUVA 1U3EM 2KRCA 1OCPA 3OYLA 4IQJA 1OCTC 1UB9A 3R4KA 3Q9SA 4BDZA 2ZXWH 4RM2A 1NK3P 4F52A 3CO7C 2EFPA 5M5YJ 3COAC 3OYAA 1Z77A 1KU3A 1RKTA 2VN2A 1ZLJA 1FYLA 2DQRA 1VFCA 3V8KA 3JRBA 4E7HA 4IKFA 2K86A 3EYIA 1USTA 2HOSA 3QQAA 3R61A 1JUMA 3A01A 1VZ0A 2DLLA 1HOMA 3CJQB 2IS6A 3SQNA 5K7ZA 4LIVA 4OIQF 1DGRM 1QPIA 3V8LA 4BL0B 3K70C 3UNGC 5K1YA 2NS7A 4F93B 3OOPA 4ENMA 2M7AA 3PNVA 1T8IA 4PJNA 5IP9J 5F0FA 1O7FA 2BXYA 4CO8A 3S14J 2CSOA 2R7SA 2DQLA 5J40A 2DA1A 2JA5J 3ABUA 3HYIA 2QLZA 3CMMA 1SMTA 3DKXA 3UKGA 2LY9A 5BPIA 1G4DA 3CMAI 2Z1DA 3F8FA 3MN2A 2QVOA 1U5TC 3ISPA 2DMNA 4MO7A 1UAAA 4AD9A 2IEKA 2NS8A 3D0SA 3HSFA 2XRNA 2Y69H 1O3TA 3VFZA 1B8IA 2O7OA 2EK5A 1U8BA 2MA3A 2QBYB 2ZJPF 3KX2A 1FY7A 4R1HA 2VBXA 5HLHA 4Y17A 5TGTA 2STTA 1KQ0A 1AWCA 3DFGA 4MQ9F 3G1MA 4BHPA 1ZHFA 3CF2A 4YRVA 3VYTB 1JKQC 1IN6A 2K4BA 3OSFA 3JRHA 1S5LC 2OUMA 3WGHA 3H92A 5DYMA 5F64A 1K61A 1A5JA 2HNHA 3H3UA 5LGNA 1BL0A 4M3BA 3UR3C 1VQ6I 5M5WJ 4BBSJ 1NTCA 3P9KA 4V19K 2HZTA 2L7KA 5L3EA 1RR7A 2JA2A 3KP5A 3O2PE 4CDGA 1E17A 5J1RA 2W57A 2J5PA 3BG6A 3JRDA 2ZC2A 1JI8A 3VEPA 2VE9A 2L2OA 2FBHA 2VC1A 3JRCA 1MD0A 1R1UA 1JUSA 1MNEA 1JE8A 2P7VB 1Z1DA 3IRQA 1QNTA 2VJJA 1L3LA 2JZYA 2JRMA 2Y9YA 5FKLA 2YU9J 3DPTA 1VQ9I 2PG4A 3QYFA 3TBIA 5HOOA 3K7AJ 3PIPF 2K85A 3EUHA 2CH0A 4MLOA 1OYIA 1CGPA 3CDHA 3M1CA 3G4SI 1YRNB 2M1BA 3GO5A 1P7IA 4XLEA 1ETQA 1Z91A 3MCZA 2R5ZA 3CMYA 3F8MA 4GRIA 4W1UA 2LKXA 4LG0B 2LRDA 1UFMA 2BV6A 3CJTB 4KFCA 2ZJ2A 1WH7A 2CW0F 3S1NJ 3G6EI 3DV8A 1IUFA 1TL8A 2EFWA 4EV0A 2LSOA 1PVEA 1N25A 3PUBA 4I01A 3V42A 2VKEA 1A6IA 4M6XA 1VQPI 3GX4X 4DYRA 1EJ9A 3WU0A 4E6KG 2XAJA 3F21A 2XAGA 4Y52J 4F7ZA 3L2RA 2XAQA 4NC8A 4BGDA 4P55A 4RAYA 1FOXA 4FX0A 4XN3A 1R49A 2B0LA 2IGNA 2FOKA 3H9GA 3IH4A 4KMUX 2ZCWA 3OYMA 3OYIA 3JTHA 1IN7A 2EZIA 2WV1A 4NC7A 5M3MJ 3S3OA 3JRGA 2RKHA 2E1CA 2JMWA 1IDYA 2LF7A 4M9ZA 3F0CA 3QU6A 1MKMA 2F2EA 5FGMA 1WFXA 2Z2SB 3P9IA 3ZRGA 3GWZA 3C1DA 1VQLI 4F55A 1KA8A 5LEKA 2ZNYA 5E1WA 1T6SA 5D4SA 1X3UA 3CLOA 3HUGB 3I4PA 2DK8A 3M3YJ 1NG7A 3B73A 3G3ZA 1P4WA 1X1BA 1YX5A 2GBYA 2NNYA 1HKSA 4RGUA 1OQYA 1IC8A 5JI6A 2A6EF 3GTQJ 1EH7A 5HLIA 2R0QC 1XS9A 1G3SA 3LL7A 3TW6A 3MKWB 1K4SA 3HGYA 4RB0A 1SD6A 1Z3YA 2XDVA 3GBGA 4GFBA 4KT6A 3ZMTA 3E1SA 5EZGA 2HXIA 2IXSA 4PDKA 1IV8A 2BY3A 4XQFA 3I58A 3A0BC 5F0HA 2ICWG 4IOAF 1ERDA 3SJMA 3Q0WA 2OTJI 2OZUA 1IAWA 3K4LA 1PJRA 1JUPA 2YPRA 3NRVA 9ANTA 4M73A 3CESA 2EILH 2ISYA 4BU2A 2UWMA 2K3FA 1U5TB 1Y1WJ 1FWZA 2VI6A 1CF7A 2OPTA 2Y9ZA 3ZQQA 1MSFC 1J5YA 4DGWB 3AG2H 1LJ9A 1LDJA 3OIQA 4C9YA 4PFPA 2IS4A 2EA2A 4XLCA 1R58A 3DEUA 4O5VA 3WU2C 3TQNA 3FXUA 2D1HA 5L3FA 3GTJJ 3FMRA 5KAIC 4FTHA 1LQ1A 1FSEA 1MSEC 2W48A 2L01A 3JR9A 3TKYA 1S8NA 3GZ5A 2Z16A 3FXMA 4FISA 2VL8A 2JWTA 2KRFA 1XDSA 4A69C 3VDXA 1SEUA 4NHJA 2CQNA 2YX7A 3NARA 2Y0SN 3SYTA 5BS6A 1ZRCA 5DV5A 2KRHA 2CV0A 1O3RA 1H88C 3KP7A 2P6SA 5H2FC 1D0YA 2A6HF 2CFXA 2ZSIB 3DBLB 4IZZA 2KIMA 3K4CA 1WJFA 3AFHA 2E1MC 3LQQA 5HODA 4U7DA 2X48A 1G2HA 3IAS2 1MMGA 3LSGA 2XPUA 3C7JA 5KCMA 4HDVA 1H0MA 5E79C 4CCOA 2TDXA 5LEJA 1F9NA 1Z3XA 2W00A 4Q48A 3FDYA 2L4MA 3D5LA 4I09A 1XMAA 5D5WB 3DKWA 2DOFA 4MIMA 1MMNA 1TNSA 1XC5A 2QSHX 2LKPA 3WTSC 3QRFF 2D5VA 4B09A 2DFIA 4JOMA 3FHZA 3IP4B 2M7BA 2NXNB 2CYYA 5ICCA 1I1SA 1B6AA 2GIVA 2CW7A 1GHCA 3GZ6A 2HQAA 4R79A 4XOTA 2VQHA 5IY5H 2E1NA 3DTIA 3OYDA 1FC3A 2XHKA 4F91B 2DMTA 1Z05A 1I6HJ 1EA3A 2MABA 1VNDA 2FOWA 2VKDA 2O8KA 4IJAA 2HS5A 3HSRA 2HTSA 3CJNA 1HSTA 2EFOA 2QENA 2K4JA 3LSJA 2NYXA 2QKLB 2ESNA 1MH4A 3TDUC 1JGSA 1X1AA 1MJBA 1ZN2A 3GF2A 1KZHA 4ETSA 5B1AH 1FP2A 1XGOA 3G1LA 3RJPA 3IV5A 1OISA 5DTDA 1H9GA 1FYMA 2XVCA 4HF0A 4D0PA 3LSRA 4OIOF 4X1EA 2Y30A 1S72I 2OV7A 5JFRA 4J01A 4BEHB 1FOYA 2CV2A 1ACIA 3K6GA 4GYGA 4IRGA 5B1BH 1FZPB 1I3QJ 4CICA 4IHWA 2BOLA 2LC2A 4HF1A 1KGSA 4RB2C 2LFBA 1IF1A 1W7PA 2PMZA 3CCEI 2X6WA 2EQRA 2CUEA 4HLXA 3I0TA 2Q8KA 5L3DA 3KYLA 1AU7A 1TWGJ 2CG4A 1HF0A 3QODA 2L9NA 3KE2A 5LHIA 2CS3A 1IRGA 1EKEA 2NVXJ 3S8PA 2HQNA 2B9SA 4BH9A 1V5FA 2LMDA 2WAFA 3CQZJ 4B44A 3R60A 2A5WA 3PNTA 5IYCJ 3TW7A 1FJLA 2CFOA 4II3A 3L2UA 5D5XB 3LSHA 2A07F 4AWXB 2RDPA 1IDZA 1RZ4A 1FBSA 3KEOA 3OYNA 2HI3A 4M72A 3MKYB 2I8DA 3HHHA 3HOWJ 3CO6C 2V1XA 2QSGX 3TOAA 3KZZA 1ETVA 4XSZF 1WGXA 1T0FA 4KIBA 3OSGA 3KETA 3NAUA 4BHBA 1OCOH 4YFXF 2M87A 2QWWA 1QBJA 1HKTA 1W5TA 3U21A 4D5FA 1P6RA 5CVUA 2CU7A 3CCQI 5IP7J 1QZYA 4D9JA 3E6CC 5E17F 3FXJA 3WE3A 4CZZA 4A12A 4OIPF 4WXCA 3BTLA 3N4MA 4HV6A 1RESA 5F0CA 1W7PD 1R5ID 3U1DA 3GFIA 2GXBA 1ZELA 1BA5A 4PZJA 1J59A 2ESHA 3C2GA 4I02A 4N0BA 3K4MA 2E2HJ 3M1EA 2H8RA 4A3GJ 3BTJA 3IRRA 2VIXA 4B4CA 2LDUA 5D5VB 1I1GA 1V5GA 4D7NA 4PSXA 3QPTA 3DPUA 4HW0A 4G6QA 3J81Z 2NVTJ 1KYZA 3MZHA 2HEOA 4A3KJ 5H6QA 1N77A 1R71A 2HDDA 1JKRC 3NWSA 4QPOA 3SEZA 4YFNF 1USSA 4UHTA 1Y6IA 2EBIA 4PJ0C 3R0JA 4C3IJ 4BXXJ 2E71A 1O3SA 3GTPJ 1LKXA 1RETA 2B7EA 1N78A 3RYRA 3SZPA 3WHCA 3HOSA 1ZRFA 2DMPA 4KT5C 4OOIA 5JLXA 1BR4A 1AHDP 2TCTA 4OU0A 5GPAA 4XRMA 3K2ZA 3L2WA 2OQRA 5F6FA 2WA0A 3PQKA 2WAEA 4CYCA 4BY1J 3S2DJ 3LA3A 2A6TA 2YU3A 2KLOA 2CUJA 2F6CA 2QKMB 2EINH 1K78A 3TO9A 4JX5A 4RAZA 4ZZDA 3H0DA 4EJOA 2MH9A 2MFZA 4RB1A 2ZKZA 4WX9A 3VYSB 1JKPC 5TJJA 1POGA 1X2MA 5JLWA 4RM3A 1XN7A 3DLLF 1ZGAA 1K4TA 1ZH5A 2UXNA 1DU0A 4ZDPA 4FCYA 2GAUA 2FEZA 4ENKA 3S17J 1B9NA 2AXTC 2GZWA 2K3PA 5F1RA 1KYWA 2VLAA 2I5UA 2IA0A 1Q1HA 4KYWA 2ZXHA 2R7FA 3DQVC 5FFZA 4KNYA 5EEHA 3VPRA 1YFHA 1DGWY 4L5IA 2OBPA 2ZBKA 1SVLA 2AO9A 4ZYAA 2XPWA 1UMQA 2CUFA 2DJNA 4B1RA 4Z6YA 5FRMA 1ENHA 5FJ8J 1FIAA 2DOEA 3A02A 2DW4A 5EG0B 2EFNA 1BW5A 1ZG1A 4PJMA 4EGYA 3H9QA 4G12A 4YIRX 3ABTA 2LBFB 3KPHA 1TBXA 4JYKA 4B48A 1Z6RA 1MNDA 1ZYRF 3GEZA 4BYYA 5BPDA 3LSKA 2R7VA 1S29A 1MH3A 2IT0A 1T38A 1SFOJ 4OMZA 3E0JB 4JX6A 5H20A 3ZQLA 1W36D 2ELJA 5TRDA 2E35A 5LLQA 2JA6J 4LG3A 5DCMB 3I5UA 3FIWA 3HPGA 2GXGA 2XRLA 1S7OA 4C2UA 4YG2F 5DEQA 1DPUA 2HU9A 3I9V2 3JRFA 3S2HJ 5M5XJ 3TP0A 3I59B 2Z3YA 3WTWC 3OS1A 1T95A 3ZPLA 5EF6A 4ITVA 3GZNB 4NQWA 4L9NA 4DQ2A 2V9VA 1XSVA 1VQNI 1HW5A 4ZC3A 3TP3A 2JQ7A 2LLKA 3K0LA 1ON2A 4I6ZA 2RNGA 1S7AA 1LDDA 3L2CA 3CUOA 3LWFA 4LIUA 2DPUA 4RLFA 4V2FA 4PGGA 5J3LA 4U87A 5IYBJ 3HTSB 3H3VK 2LKSA 4PJJA 3HOYJ 5GAEJ 1V54H 4OAZA 1YJNI 1YJWI 3BDDA 2WY7Q 5HVQC 1TW2A 4G7ZF 4EQQA 4ENNA 3M4OJ 3LAJA 1WJEA 3SZGA 1MBEA 1GVDA 3JW4A 2CQKA 1T0FC 3VODA 2WB1N 1IW7F 3E5XA 2CV1A 2GXAA 3PUFA 3ZOBA 3PSFA 5LRSA 5FD5A 2YUSA 2TRTA 2CQ7A 1DDNA 3BLYA 4IX7A 3CC7I 3BWGA 1P9QC 5CVJA 1P7JA 2HOTA 4UB8C 4UNOA 2M34A 3F8BA 3PM1A 4MFEA 1I50J 1P4AA 2ZMEA 3FXLA 2DAOA 2PBIA 5IYDJ 4AIKA 1O57A 1QVTA 3BCBA 4AIHA 2N8GA 2FBIA 2O3FA 2H1KA 5KVRA 3BR0A 2DU9A 4CH7A 2ZO4A 2Z5UA 1YJ9I 4K2EA 1XDUA 3C3WA 2QGUA 3SDGA 3T8TA 1BIBA 4LB6B 3CCUI 1S6LA 2HTJA 4A3MJ 3HRTA 4ZYDA 3H5AA 1XSDA 1WCMJ 3W2VA 3W2WA 1I39A 4XLNF 3H5NA 1JJ6C 1GXPA 3H35A 1JHFA 2L02A 3J7ZI 1LE8B 3REOA 2W25A 3M8EA 2DYRH 2E2JJ 3SFZA 3ECHA 3GCMA 3QYBA 2E2IJ 5EGOA 2KP6A 5HS9A 2NVQJ 3CP8A 3I4NJ 5E3LA 3KP3A 4RBOA 1GXQA 3J7AY 1I5ZA 1KONA 2F4MB 1JTXA 5FO5A 4ON0A 3ZMUA 5A2QK 1DU6A 1E3PA 2W85A 1ETXA 3F6OA 3M8JA 4M9XA 4HAMA 4BHCA 3HKZN 4QTRA 1ETWA 3ZQHA 5E1ZB 5IPAA 2DA7A 4UUSB 1OCZH 2VUMJ 3L9FA 3AL0C 3IH3A 5EEGA 4Q5SF 2E7WA 3S15J 1AA7A 1S7EA 1YLFA 4HV5A 4O6JA 2FJ1A 1RRJA 1A6QA 2JK3A 1TC3C 2JRTA 5IT3A 3OYFA 1LVAA 3KP6A 3JSOA 3CUQB 2FUG2 1MJ9A 2KJCA 2J5OA 3DXJF 3VB2A 4UVCA 1HXDA 1WH5A 2BYVE 3OYGA 2BVMA 4PJLA 4DIQA 2HVSA 4XLHA 2XKPA 3ONQA 2UZKA 5KAFC 1BOAA 2ELHA 5BOXA 1V3FA 3HM5A 4M74A 1HDDC 3FK7A 2JUCA 1F36A 2D45A 3HGGA 2PJRB 1U2WA 3HBLA 1PUFA 5IOZA 4EMSA 1RR8C 1XPXA 6PAXA 3HRUA 1G3WA 4P1WA 3M9AA 3CLQA 4A3DJ 1VQ7I 4G94A 3HDDA 1WWXA 2FQ3A 3F72A 2HPMA 2ZJQF 2DYSH 3NEUA 4G7OF 1XCVA 3H3ZA 4BQQA 2EV0A 1TWCJ 1RKWA 2KL4A 4IOCF 4A6EA 5E3NA 4Y4RA 3P9CA 1FTTA 1MIJA 3E6BA 1T98A 1T39A 2Q2EB 1REPC 1Y8RB 1IXSB 1TP4A 2KZVA 4EM1A 2C6YA 3A0HC 3RKQA 2ADUA 3D1NI 4C3JJ 1LEAA 5J4VA 4XR6A 2FXAA 3L2VA 1ZTRA 4PGHA 3K1NA 1H89C 3IUOA 1ZAOA 2BEOA 4XONA 2K27A 4JX4A 5D8KB 1VQKI 1RIOH 5CPRB 2DDAA 2VBWA 1EF4A 2A5YB 4A5NA 1S3JA 3WTZA 1U9NA 2NRAC 2MD0A 3FM3A 3J80K 3KLNA 1PYVA 2LOOA 2MYSA 3D5RC 3DKYA 4WXHA 3KYCB 3Q9VA 3MZYA 3RIRA 3JSPA 4L0YB 1GV5A 1FTZA 3ASOH 4E7LA 3FMSA 2OCEA 4NNJA 2O9LA 1FLIA 1MBHA 2H1LA 1OYWA 4BQOA 3FKJA 1Y39A 3W6JB 2VPRA 5DD4A 4WXDA 3BR2A 1R9TJ 4C2TA 3F6VA 2HYGD 3F22A 2IA1A 3GTGJ 1KQ9A 1NHAA 1HC8A 2X1DA 4LLGF 2HKOA 4OIRF 4EJVA 2Y48A 2VKVA 2FQ4A 4XKVA 3PO2J 5FKOA 1XX5A 4XN0A 3DTEA 4LJZF 1ETOA 5J47A 4XRSA 2QEXI 2MD5A 4I2OA 1ZARA 3L09A 5EJCA 1EV7A 1MDMB 2A68F 3I59A 2DBBA 2DFFA 5GTHC 1X4OA 1QZZA 4FE4A 1HQCA 3OMYA 2Y31A 5H6RA 3FBIB 4KITB 3ZN1A 2IA2A 3BG5A 1A31A 2UXXA 4J00A 2WTEA 2WBMA 1AKHB 4MQVA 3QOEA 5K7HA 4M9SA 4M3FA 1BW6A 1OFCX 3JRIA 1R7JA 3CCMI 4L5JA 2ID6A 2L54A 4PFOA 4HPQA 3WTYC 4HOBA 1G59A 5CLSA 3S3MA 1SAUA 5DCFA 1FYKA 3KP2A 1R36A 3GTMJ 3RQ4A 2VJ4A 5DUIA 2W7NA 1ZREA 2W1OA 2BXZA 2ZXJA 1RUOA 3RDIA 2EZKA 1W0TA 3F23A 2EFQA 5BMZA 4D5CA 1MBJA 1X2NA 3HOVJ 3E3VA 2GA1A 1C0WA 3DEEA 2QYOA 4RGRA 1FBQA 1WI9A 1BBYA 2KHMA 3EETA 5CKTA 3KZYA 5F08A 4AYBN 1YITI 2VODA 3S1QJ 1TWAJ 5E20A 2FNPA 2DTRA 4J19A 4BNCA 1XD7A 3RQIA 1QQIA 5LHHA 2KZGA 4HQMA 5D8LB 2EZHA 4ESJA 2HZDA 4A5MA 2VB6A 1SANA 2M3AA 2GOXB 3ML6A 2LREA 3MKLA 2WV0A 1K79A 1SD7A 3ERED 2PMZN 3KLOA 2E19A 4GXOA 1U6GA 4IF4A 3JRAA 3F3XA 1ONVA 3JTGA 2P5VA 2WAQN 5EEAA 1TLHB 1WI3A 4H4KC 1P2FA 3OOUA 2CMPA 1IO2A 4KISA 1ORKA 3BQYA 4RGXA 4CCLA 3S16J 4S0HB 2KDZA 2R3SA 5ILVA 4A3EJ 4ZDLA 2G7HA 2KIFA 4IEJA 5ED4A 3HB9A 2QBYA 4XBFA 2R7RA 2R5YB 5CQEA 3WGIA 2X1EA 2DXIA 1MBFA 2EA4A 1QU3A 2KIQA 3VOEA 2COBA 4IQ4A 2HPIA 4M6VA 4PCQA 2YSRA 2L0KA 2MLGA 1Y0UA 1J0RA 4MGRA 3EUHC 2XB5A 1FEXA 1STZA 3E6DA 2V1UA 5E3OA 5F27A 4I0AA 3ZQGA 2IW5A 2K5CA 4S04A 1ZR2A 2PLYA 4BQAA 3FMQA 2COMA 2JPCA 2Z33A 2OD5A 2XF5A 1QHGA 1WHUA 1HW2A 2DA5A 4B3AA 4NBQA 3S93A 5GAHJ 5ICEA 1R6RA 2EV5A 2VPLA 4ZDOA 5HS7A 2DT7B 4NDLA 2VASA 1XGSA 1IXRC 1R1TA 4AIDA 4RA2A 1YRNA 2IGMA 4V2GA 2NVUB 3WTVC 4HF2A 2QQBA 2XIGA 3DPLC 4HX7A 2VT2A 1ETKA 3I4MJ 1R5HA 4HSTA 4LG0A 2L7ZA 1PP8F 1R4MB 3GLLA 1ULYA 1MNMC 3QAHA 2HFHA 4Z2YA 2UUZA 1UHSA 4GYIA 3S3NA 2HVRA 2NOJB 4M3GA 5FLXZ 4I98B 1WVRA 3GTLJ 3C2BA 3MEXA 3IL2A 2V4JC 1X4PA 2Q2EA 1Y8QB 3Q5FA 4WK8F 2VQGA 4YELA 1SVMA 2MG4A 3ZXSA 5HDGA 3SHFA 4RAFA 2WWYA 2A61A 4IHVA 4E4HA 3OR1C 4DOZA 3A4CA 3V8JA 4CSWA 5DM7F 3KEYA 2VE8A 3CCJI 1MJAA 1YYVA 4FQGA 4EJUA 3KCCA 5K5QA 1BR2A 3GFMA 1H9TA 2KQRA 2YS9A 5HS8A 3FXQA 5BNGA 1A36A 4ZZLA 5E3MA 1SFKA 1MW7A 3K9TA 4RMNA 3A01B 1FBUA 1MMAA 3RPQA 3BJAA 3I54A 4HNVA 4ZJZA 3LSPA 3RI4A 3CDLA 4FT8A 2M9HA 3HUGA 3OYEA 3AG1H 1YX3A 4CYDA 5JVTA 1JT0A 3CJRB 1MMSA 2ZFWA 3G1OA 4YIIA 3QPLA 2JT1A 4UV9A 3IWZA 3F8CA 1F1ZA 1LEBA 1KU9A 1FNNA 1YW9A 2K02A 2X6XA 1RPWA 4G7HF 2H94A 3K4NA 1Y56A 1E0EA 2DODA 4G9YA 2IRFG 3FM5A 2HKXA 3ABLH 4A3BJ 2F48A 2E1MB 3CC2I 2CQQA 2EV6A 3B6AA 3FXKA 3O3KA 4P9FA 5J1UA 1GV2A 1B8IB 2BY0A 4NB5A 5D6FA 1BM9A 2GOMA 3GTOJ 5GP9A 3E97A 3WTTC 2GIZA 4CA0A 4XMYA 1E3OC 3K4JA 4XLAA 5M3FJ 4P9UA 3V7SA 3HIFA 1V55H 4AVPA 5HNHA 1HCRA 1BI3A 1J7KA 2BGCA 2X85A 1UELB 4MHGA 1U5TA 3LFUA 4AVZA 1VQ8I 1G6NA 1HBXG 1BC8C 1WPKA 3S1RJ 4HX8A 3V7RA 1O4XA 5FROA 5EDNA 4M3EA 2M0MA 2KISA 1D3YA 4XORA 4A0YA 1ZLKA 1E2XA 2KIUA 3PSIA 1IRZA 1BI1A 4CZCA 3A1YA 2ACJA 4XL9A 4DYCA 1Z0XA 2LF8A 4BY7J 5D6EA 3MZ8A 4E70A 5GTIC 3I56I 4I99C 4HDUA 4WF2A 5E8GA 2XF7A 5B3SH 1X3WB 1SVOA 1YW7A 2CJJA 5F04A 3JAMK 2EPFA 5FLVA 4IO9F 3ZMSA 4D7MA 4E7SA 5J8FA 4IHYA 2VJIA 2OC6A 2NVYJ 1LFUP 2R7QA 2K9QA 1I27A 1K83J 5FD6A 5D5UB 3FXRA 2QQAA 2RN7A 5LD2C 2R5ZB 3JREA 4IHTA 3CDIA 1SAXA 1UZCA 1WQ2A 3BTCA 1BJZA 4F92B 2QSFX 1HLVA 2M8GX 4KMFA 3CD6I 5TISC 1YIJI 3PNYA 1NK2P 2HR3A 4KA4A 3WHBA 2HVQA 3TDZC 5DS9A 1MZBA 4S05A 1O7LA 5DD8A 2DMQA 3BR6A 4ZYEA 4A6DA 4QPQA 1HKQA 1F43A 2DK5A 4BUPA 1JXSA 2K9MA 4LLNA 5AONA 1DQUA 1ZGWA 3ABKH 2M2EA 3ZQCA 2W24A 1J2XA 1Z21A 2DMUA 4L9JA 3HXLA 1OKRA 4E7ZA 3WTXC 5J6XA 4XOPA 3DBRB 4OINF 3DEWA 4M3DA 2LG4A 3FK6A 4R8HA 3LAPA 2XGEA 2H27A 3S32A 2R7UA 3FX3A 3HC7A 2O61A 3K2AA 3SDBA 2AQEA 2E5ZA 4UVBA 1GT0C 2A69F 4TV7A 1QZEA 1ZKGA 2EIMH 4DW6A 4LB5A 3WE2A 5HLGA 1JGGA 3MMYB 2E34A 2F5DA 1U8RA 4ENJA 1SFXA 4GO1A 3N97A 5HNFA 1B72B 3IKVA 1P92A 4AUXA 2DN0A 1GVJA 4OAYA 1R22A 2DA4A 4XM3A 3OYBA 4BEHA 2QQ9A 3QU3A 1M1EB 2BBYA 4FETA 1UG2A 3BJOA 1WJCA 3NQOA 5IT9Z 2XB0X 3FHNA 2NOGA 1DPRA 2VJ5A 2XASA 1BI0A 1BI2A 2XPVA 3WG9A 5E18F 2FSWA 2AQFA 5DM6F 3W2AA 3PJRA 1OLTA 3G2BA 4BXFA 3BJ6A 3P7NA 4IRIA 1FIPA 1IN4A 2KT0A 3EPZA 3BZCA 1MGTA 4BS9A 4KDPA 2OU2A 2FX0A 3BR1A 3RTRA 3OS2A 3EQLF 5AIPA 4IPAA 4C30A 3RZDJ 2H09A 3BQZA 2XAUA 3FZVA 3K1MA 4CGZA 2EB7A 4BE0A 2RQPA 3I71A 2DTZA 1CF7B 2RNJA 1B9MA 2QCOA 2XUBA 4PK4A 2WADA 2LY1A 2W82A 3WG7H 1TQPA 2V26A 3EDPA 2QZ8A 1X1DA 3MQ0A 4KJZA 1WJ5A 4Q47A 2XGXA 4G6TB 4P5OA 2XGCA 1XMXA 1EH6A 2ZJRF 3QPSA 5IP6A 2R7XA 1EH8A 3R0AA 1ZK8A 2DI3A 3IKTA 2RAEA 2LYCA 1ZG3A 4FASD 5CQGA 4U0VA 3VSLA 3LA2A 3BTIA 2FF4A 2MGQA 2BHZA 1ZG5A 1FSHA 3LSIA 1YTYA 3TGNA 3SXYA 4HX4A 4UUTA 4XSXF 2DA3A 1GDTA 1TTYA 3ECOA 2G9WA 4IRHA 2GQQA 2L3DA 3LSMA 4RDUA 2E5NA 4B47A 3WU1B 1XGNA 4YEJA 1FOKA 3OYHA 3N05A 4P96A 2IGKA 3M8FA 1TQMA 2E1OA 4UB6C 4Y3OA 1OMIA 2YX4A 2V79A 2FNAA 4PSWA 2O0YA 3ZQ7A 2EJRA 3L1PA 2X0LA 4XKCA 2OJED 3O8HA 4XICA 4IHXA 3RKXA 1K7AA 3RKYA 2XAHA 3DF8A 2VT3A 1TQIA 1I3AA 1IN8A 2PFBA 3F8NA 4HZFA 4RB3C 2EIJH 1J75A 1LUJB 2LNBA 3IHUA 1YOVB 4I76A 2MC4A 4XLFA 1YHQI 1R00A 1WSUA 3ABMH 5FRNA 3A2KA 2F5EA 1W36C 3KIOA 3ZCOA 2L4AA 3HHGA 1OPCA 5KK1A 4BQNA 2XROA 4LFUA 3G71I 2VXDA 4U0YA 1LPQA 2E36A 2WB1A 3H5RA 3S1MJ 3GW2A 2W84A 4Y7NJ 1TNTA 3BZKA 4HA8A 3ZR8X 3I55I 3RSNA 2GLOA 2EH3A 1OR7A 3DWLE 3ZGKA 2F5VA 4FE7A 1IV6A 3PL8A 4YFKF 1ZRDA 1SFUA 4AC0A 1W1WE 1LFBA 2VQLA 4XNFA 4ZYGA 4KN4X 2RQQA 2PX9A 2PMHA 2W4SA 5L3GA 5LHGA 2CQXA 4RS8A 3J7YJ 1U0JA 1VF9A 3ASNH 3MFKA 5LGUA 1X3ZB 4DZJA 3AG4H 2CO5A 2F4OB 2LVSA 5FKKA 1ZQ3P 2B63J 4GGGA 4CHUA 4QSHA 1MMDA 2CGPA 3ZMZA 3BC8A 3GXOA 3QP5A 5D4RA 1W7PB 1LFPA 2OZ6A 2DO7A 2NS0A 2P5KA 3HL2A 1A04A 2ECBA 2DT5A 4ANJA 3A03A 4Y15A 1YW8A 2MC3A 2PN6A 2ME6A 5ILSA 2LD5A 3Q3SA 2K40A 1D0ZA 3CCLI 2V9PA 4PUSA 3DU5A 2ZFUA 1FMVA 2QF7A 4U0WA 2VXZA 2ISZA 2O03A 1APLC 2KDOA 4HG2A 2LH9A 3BPXA 4UV8A 1YS6A 3CCSI 2R7OA 1JHHA 3MAJA 4BE1A 3HKZA 2X51A 3OYJA 3DU6A 5FKMA 3SFIA 1RUNA 2AS5F 5EG0A 4HYEA 2L7MP 4GDFA 4KUMA 1TWHJ 4MFDA 2V1DA 3OS0A 2LBFA 5A2QZ 5LGTA 2HXOA 2X9DA 3ELKA 3BG7A 3NWTA 3BOQA 4HBLA 2JVHA 4EVIA 2BW3B 4A3LJ 1OYYA 1D1AA 5L3CA 1W4MA 2FA5A 4KN7X 3LA7A 2X1CA 2KKOA 3TO6A 4KICA 2AHQA 2HQ5A 5F1JA 2R7DA 2K9SA 1H8AC 3MD2A 1PDNC 2FBKA 3RCOA 5DCMA 3PO3J 1OJLA 4E7IA 2DA6A 3RKWA 4HEA2 2P4WA 3WODF 3V4GA 1VQOI 5ICFA 1BC7C 1U9OA 2ECCA 4EJTA 1IG7A 3QOPA 3L7WA 3L00A 2DT6A 3Q0UA 1FT9A 4OWRB 3T8RA 2HOEA 3ROUA 1B72A 3CF5F 3HZJA 3BPVA 1IJWC 4LOCA 5L3BA 5C4XJ 2PEXA 2HYJA 1B59A 3KFWX 4IHSA 2L9VA 1HA8A
chains in the Genus database with same CATH topology
3UKGA 1ETKA 3I4MJ 2LY9A 3MN2A 2DMNA 4MO7A 2IEKA 2L7ZA 2NS8A 3BG3A 3VPRA 1U78A 1MNMC 5K7FA 1UHSA 2AO9A 1B8IA 2XPWA 2O7OA 1UMQA 2CUFA 2DJNA 4M3GA 4B1RA 1U8BA 3GTLJ 1ENHA 3C2BA 5FJ8J 1FIAA 3A02A 5EG0B 1BW5A 3G1MA 4A3CJ 1QVUA 2MG4A 4G12A 2G0EA 1JKQC 2LP0A 3OSFA 3JRHA 3H0GJ 4IHVA 1A5JA 4JYKA 1K61A 5C3EJ 1BL0A 4M3BA 5M5WJ 4BBSJ 1NTCA 4CYCB 1Y1VJ 1RR7A 4DYQA 1IGNA 1MH3A 5J1RA 3JRDA 2YS9A 1SFOJ 4JP0A 4JX6A 5BNGA 5E3MA 3ZQLA 3A01B 3JRCA 2JA6J 1JUSA 3FIWA 2XRLA 4HNVA 3LSPA 5GPCA 3CDLA 2Y9YA 2M9HA 5FKLA 3JRFA 2YU9J 3S2HJ 5M5XJ 3TP0A 1JT0A 3G1OA 5EF6A 3QPLA 3K7AJ 2LR8A 4MLOA 1YRNB 3TP3A 1P7IA 1RPWA 1LE8A 2LLKA 4I6ZA 2EZLA 1ETQA 2R5ZA 3CMYA 3LOCA 4W1UA 4A3BJ 2LKXA 4V2FA 2CQQA 1MBGA 1WH7A 5J3LA 5IYBJ 3H3VK 3S1NJ 3HOYJ 2I10A 1IUFA 3B6AA 2P81A 1B8IB 5J1UA 1GV2A 3GTOJ 5GP9A 2VKEA 1A6IA 3IH2A 3MVPA 2Y2ZA 3BR5A 4DYRA 1ITYA 1E3OC 5J1YA 3M4OJ 4Y52J 5M3FJ 4UUSA 1MBEA 1GVDA 5FKNA 4BBRJ 1HCRA 2WB1N 3BR3A 3IH4A 3ZOBA 2EZIA 2WV1A 2YUSA 1WPKA 2TRTA 2ZB9A 3S1RJ 5M3MJ 2JN6A 1O4XA 5EDNA 3JRGA 4M3EA 1P7JA 2HOTA 2ELKA 2JMWA 1IDYA 2M34A 3PM1A 4MFEA 3F0CA 1I50J 1IRZA 4ABZA 5IYDJ 4DYCA 1QVTA 1Z0XA 1XG1A 4BY7J 2N8GA 2H1KA 3BR0A 3M3YJ 2CJJA 5F04A 3SDGA 1CQTA 5FLVA 2GBYA 4D7MA 4IHYA 4A3MJ 5C4JJ 1WCMJ 1IC8A 2CRGA 2NVYJ 3GTQJ 1LFUP 1JJ6C 3FKIJ 2R0QC 2K9QA 1LE8B 1K83J 1XS9A 3TW6A 4BKXA 3HGYA 3JREA 2R5ZB 2E2JJ 2E2IJ 5EGOA 2NVQJ 3I4NJ 3BTCA 1BJZA 5E3LA 1HLVA 3GBGA 2M8GX 4GFBA 4RBOA 1ZR4A 5EZGA 2HXIA 1NK2P 2MW8A 1JTXA 1DU6A 3WHBA 1ETXA 5DS9A 1GUUA 5F0HA 3HKZN 3SJMA 3Q0WA 4QTRA 2DMQA 3BR6A 1ETWA 3O8GA 3ZQHA 5IPAA 2DA7A 2K9NA 1JUPA 1X58A 4UUSB 2VUMJ 1F43A 1JTYA 1VI0A 3IH3A 4XRSG 5IOYA 9ANTA 2XSDC 3S15J 1Y1WJ 1ZGWA 1S7EA 2M2EA 2VI6A 3ZQCA 2FJ1A 2OPTA 2Y9ZA 1TC3C 2JK3A 2R92J 2DMUA 1W0UA 1MSFC 3E7LA 3DEWA 4M3DA 3FK6A 3GTJJ 2XGEA 4FTHA 1WH5A 3BG9A 1MSEC 2W48A 3K2AA 3JR9A 1GT0C 2MSYA 4FISA 1ZKGA 4DW6A 2JWTA 4XK4A 3HM5A 1JGGA 4A69C 1HDDC 3FK7A 1F36A 3HGGA 3NARA 2Y0SN 4DZPA 2OF7A 1T33A 3HBLA 1PUFA 5IOZA 2ID3A 1B72B 4AUXA 4A3JJ 2DN0A 1H88C 2DA4A 4A3DJ 3W6VA 3RZOJ 3HDDA 4A3FJ 1UG2A 5HODA 2XB0X 2X48A 3Q0VA 1G2HA 2NOGA 5EGOB 3LSGA 2XPUA 3HOUJ 2LK2A 2XPVA 2R93J 1TWCJ 1RKWA 5E3NA 1FTTA 4C3HJ 4MIMA 1XC5A 2IBDA 3ZQIA 1AKHA 2D5VA 1FIPA 1JJ8C 2KT0A 3RKQA 1T56A 2FX0A 3BR1A 4C3JJ 3D1NI 3RZDJ 3BQZA 1QRYA 1ZTRA 3CCYA 1H89C 2DTZA 4JX4A 2QCOA 2DMTA 1EF4A 2GM4A 3FISA 1I6HJ 1U9NA 1VNDA 2O8KA 1Q1VA 3HEFA 2XGCA 3HOZJ 3QPSA 3LSJA 5IP6A 1GV5A 1MH4A 1FTZA 2O9LA 3TEDA 1ZK8A 1MBHA 1HDPA 2RAEA 2VPRA 3G1LA 3IV5A 5DTDA 3BR2A 1R9TJ 3LSRA 1PUFB 2JJ7A 3GTGJ 4X1EA 2Y30A 3BTIA 3ZQFA 2MGQA 2VKVA 1JKOC 2FQ4A 3PO2J 5FKOA 4UUTA 2DA3A 3GTKJ 1ETOA 1GDTA 4XRSA 1I3QJ 4IHWA 2IAIA 4RDUA 5C44J 2LFBA 4FE4A 4QIWN 2Y31A 2E1OA 2EQRA 3HOXJ 2CUEA 2FD5A 3OIOA 3BG5A 1AU7A 1TWGJ 3L1PA 1HF0A 1AKHB 5K7HA 3O8HA 4XIDA 4XICA 2NVXJ 4IHXA 4M3FA 1BW6A 1OFCX 3JRIA 3CQZJ 1MBKA 2ID6A 5FLMJ 5IYCJ 3B6CA 3TW7A 1FJLA 4I76A 3LNQA 3GTMJ 1IDZA 2R5YA 2HI3A 3S1MJ 2EZKA 1W0TA 1TWFJ 4Y7NJ 2M0CA 3HOWJ 2X6OA 2GLOA 4D5CA 2EH3A 1ETVA 1MBJA 1X2NA 4FE7A 1IV6A 1WGXA 3HOVJ 3OSGA 5EYRA 3NAUA 4A93J 4AC0A 1LFBA 2L7FP 2LTPA 5F08A 4AYBN 3S1QJ 4X6AJ 4D5FA 1TWAJ 2CU7A 2CQXA 4J19A 5IP7J 1VF9A 3BT9A 3RQIA 4DZJA 2LVSA 2ME0A 5FKKA 3BTLA 4L5EA 2HOAA 1ZQ3P 2B63J 2EZHA 4QSHA 2R7ZJ 1RESA 4W97A 1SANA 5F0CA 2JA7J 1BA5A 3MKLA 2E2HJ 2H8RA 4A3GJ 3BTJA 4B4CA 4D7NA 2PMZN 2E19A 2ECBA 1JT6A 3JRAA 3A03A 5EEAA 2WAQN 2ME6A 2LD5A 2NVTJ 3Q3SA 2K40A 1WI3A 3OOUA 1ORKA 3BQYA 4A3KJ 2QF7A 3S16J 3DCFA 2XGDA 4S0HB 1JKRC 1APLC 2KDZA 2HDDA 1ETYA 4A3EJ 4C2MJ 4EEFG 4A3IJ 5EZHA 1D5YA 2EBIA 4IEJA 3HB9A 4C3IJ 4BXXJ 2R5YB 5FKMA 3SFIA 3GTPJ 2JA8J 5EG0A 2DA2A 2L7MP 1RETA 2L9RA 1TWHJ 1MBFA 4MFDA 3WHCA 2DMPA 5JLXA 1AHDP 2HXOA 2TCTA 2COBA 2X9DA 1OCPA 5GPAA 4XRMA 4M6VA 1OCTC 4CYCA 4BY1J 3S2DJ 2L0KA 1NK3P 4A3LJ 5M5YJ 2XB5A 1FEXA 1Z77A 1RKTA 5E3OA 5F27A 3ZQGA 1VFCA 1ZR2A 4JX5A 2AHQA 3JRBA 2HQ5A 5F1JA 2HOSA 3QQAA 3A01A 1JUMA 2K9SA 1H8AC 1HOMA 3PO3J 1OJLA 5K7ZA 2DA6A 1QPIA 2DA5A 4B3AA 1JKPC 1U9OA 2ECCA 1POGA 1IG7A 1X2MA 5JLWA 2NS7A 3Q0UA 5IP9J 5F0FA 1DU0A 3S14J 4NDLA 1B72A 4FCYA 1IJWC 1YRNA 4LOCA 3S17J 5C4XJ 4V2GA 2DA1A 2JA5J 2HYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKG A;  1ETK A;  3I4M J;  2LY9 A;  3MN2 A;  2DMN A;  4MO7 A;  2IEK A;  2L7Z A;  2NS8 A;  3BG3 A;  3VPR A;  1U78 A;  1MNM C;  5K7F A;  1UHS A;  2AO9 A;  1B8I A;  2XPW A;  2O7O A;  1UMQ A;  2CUF A;  2DJN A;  4M3G A;  4B1R A;  1U8B A;  3GTL J;  1ENH A;  3C2B A;  5FJ8 J;  1FIA A;  3A02 A;  5EG0 B;  1BW5 A;  3G1M A;  4A3C J;  1QVU A;  2MG4 A;  4G12 A;  2G0E A;  1JKQ C;  2LP0 A;  3OSF A;  3JRH A;  3H0G J;  4IHV A;  1A5J A;  4JYK A;  1K61 A;  5C3E J;  1BL0 A;  4M3B A;  5M5W J;  4BBS J;  1NTC A;  4CYC B;  1Y1V J;  1RR7 A;  4DYQ A;  1IGN A;  1MH3 A;  5J1R A;  3JRD A;  2YS9 A;  1SFO J;  4JP0 A;  4JX6 A;  5BNG A;  5E3M A;  3ZQL A;  3A01 B;  3JRC A;  2JA6 J;  1JUS A;  3FIW A;  2XRL A;  4HNV A;  3LSP A;  5GPC A;  3CDL A;  2Y9Y A;  2M9H A;  5FKL A;  3JRF A;  2YU9 J;  3S2H J;  5M5X J;  3TP0 A;  1JT0 A;  3G1O A;  5EF6 A;  3QPL A;  3K7A J;  2LR8 A;  4MLO A;  1YRN B;  3TP3 A;  1P7I A;  1RPW A;  1LE8 A;  2LLK A;  4I6Z A;  2EZL A;  1ETQ A;  2R5Z A;  3CMY A;  3LOC A;  4W1U A;  4A3B J;  2LKX A;  4V2F A;  2CQQ A;  1MBG A;  1WH7 A;  5J3L A;  5IYB J;  3H3V K;  3S1N J;  3HOY J;  2I10 A;  1IUF A;  3B6A A;  2P81 A;  1B8I B;  5J1U A;  1GV2 A;  3GTO J;  5GP9 A;  2VKE A;  1A6I A;  3IH2 A;  3MVP A;  2Y2Z A;  3BR5 A;  4DYR A;  1ITY A;  1E3O C;  5J1Y A;  3M4O J;  4Y52 J;  5M3F J;  4UUS A;  1MBE A;  1GVD A;  5FKN A;  4BBR J;  1HCR A;  2WB1 N;  3BR3 A;  3IH4 A;  3ZOB A;  2EZI A;  2WV1 A;  2YUS A;  1WPK A;  2TRT A;  2ZB9 A;  3S1R J;  5M3M J;  2JN6 A;  1O4X A;  5EDN A;  3JRG A;  4M3E A;  1P7J A;  2HOT A;  2ELK A;  2JMW A;  1IDY A;  2M34 A;  3PM1 A;  4MFE A;  3F0C A;  1I50 J;  1IRZ A;  4ABZ A;  5IYD J;  4DYC A;  1QVT A;  1Z0X A;  1XG1 A;  4BY7 J;  2N8G A;  2H1K A;  3BR0 A;  3M3Y J;  2CJJ A;  5F04 A;  3SDG A;  1CQT A;  5FLV A;  2GBY A;  4D7M A;  4IHY A;  4A3M J;  5C4J J;  1WCM J;  1IC8 A;  2CRG A;  2NVY J;  3GTQ J;  1LFU P;  1JJ6 C;  3FKI J;  2R0Q C;  2K9Q A;  1LE8 B;  1K83 J;  1XS9 A;  3TW6 A;  4BKX A;  3HGY A;  3JRE A;  2R5Z B;  2E2J J;  2E2I J;  5EGO A;  2NVQ J;  3I4N J;  3BTC A;  1BJZ A;  5E3L A;  1HLV A;  3GBG A;  2M8G X;  4GFB A;  4RBO A;  1ZR4 A;  5EZG A;  2HXI A;  1NK2 P;  2MW8 A;  1JTX A;  1DU6 A;  3WHB A;  1ETX A;  5DS9 A;  1GUU A;  5F0H A;  3HKZ N;  3SJM A;  3Q0W A;  4QTR A;  2DMQ A;  3BR6 A;  1ETW A;  3O8G A;  3ZQH A;  5IPA A;  2DA7 A;  2K9N A;  1JUP A;  1X58 A;  4UUS B;  2VUM J;  1F43 A;  1JTY A;  1VI0 A;  3IH3 A;  4XRS G;  5IOY A;  9ANT A;  2XSD C;  3S15 J;  1Y1W J;  1ZGW A;  1S7E A;  2M2E A;  2VI6 A;  3ZQC A;  2FJ1 A;  2OPT A;  2Y9Z A;  1TC3 C;  2JK3 A;  2R92 J;  2DMU A;  1W0U A;  1MSF C;  3E7L A;  3DEW A;  4M3D A;  3FK6 A;  3GTJ J;  2XGE A;  4FTH A;  1WH5 A;  3BG9 A;  1MSE C;  2W48 A;  3K2A A;  3JR9 A;  1GT0 C;  2MSY A;  4FIS A;  1ZKG A;  4DW6 A;  2JWT A;  4XK4 A;  3HM5 A;  1JGG A;  4A69 C;  1HDD C;  3FK7 A;  1F36 A;  3HGG A;  3NAR A;  2Y0S N;  4DZP A;  2OF7 A;  1T33 A;  3HBL A;  1PUF A;  5IOZ A;  2ID3 A;  1B72 B;  4AUX A;  4A3J J;  2DN0 A;  1H88 C;  2DA4 A;  4A3D J;  3W6V A;  3RZO J;  3HDD A;  4A3F J;  1UG2 A;  5HOD A;  2XB0 X;  2X48 A;  3Q0V A;  1G2H A;  2NOG A;  5EGO B;  3LSG A;  2XPU A;  3HOU J;  2LK2 A;  2XPV A;  2R93 J;  1TWC J;  1RKW A;  5E3N A;  1FTT A;  4C3H J;  4MIM A;  1XC5 A;  2IBD A;  3ZQI A;  1AKH A;  2D5V A;  1FIP A;  1JJ8 C;  2KT0 A;  3RKQ A;  1T56 A;  2FX0 A;  3BR1 A;  4C3J J;  3D1N I;  3RZD J;  3BQZ A;  1QRY A;  1ZTR A;  3CCY A;  1H89 C;  2DTZ A;  4JX4 A;  2QCO A;  2DMT A;  1EF4 A;  2GM4 A;  3FIS A;  1I6H J;  1U9N A;  1VND A;  2O8K A;  1Q1V A;  3HEF A;  2XGC A;  3HOZ J;  3QPS A;  3LSJ A;  5IP6 A;  1GV5 A;  1MH4 A;  1FTZ A;  2O9L A;  3TED A;  1ZK8 A;  1MBH A;  1HDP A;  2RAE A;  2VPR A;  3G1L A;  3IV5 A;  5DTD A;  3BR2 A;  1R9T J;  3LSR A;  1PUF B;  2JJ7 A;  3GTG J;  4X1E A;  2Y30 A;  3BTI A;  3ZQF A;  2MGQ A;  2VKV A;  1JKO C;  2FQ4 A;  3PO2 J;  5FKO A;  4UUT A;  2DA3 A;  3GTK J;  1ETO A;  1GDT A;  4XRS A;  1I3Q J;  4IHW A;  2IAI A;  4RDU A;  5C44 J;  2LFB A;  4FE4 A;  4QIW N;  2Y31 A;  2E1O A;  2EQR A;  3HOX J;  2CUE A;  2FD5 A;  3OIO A;  3BG5 A;  1AU7 A;  1TWG J;  3L1P A;  1HF0 A;  1AKH B;  5K7H A;  3O8H A;  4XID A;  4XIC A;  2NVX J;  4IHX A;  4M3F A;  1BW6 A;  1OFC X;  3JRI A;  3CQZ J;  1MBK A;  2ID6 A;  5FLM J;  5IYC J;  3B6C A;  3TW7 A;  1FJL A;  4I76 A;  3LNQ A;  3GTM J;  1IDZ A;  2R5Y A;  2HI3 A;  3S1M J;  2EZK A;  1W0T A;  1TWF J;  4Y7N J;  2M0C A;  3HOW J;  2X6O A;  2GLO A;  4D5C A;  2EH3 A;  1ETV A;  1MBJ A;  1X2N A;  4FE7 A;  1IV6 A;  1WGX A;  3HOV J;  3OSG A;  5EYR A;  3NAU A;  4A93 J;  4AC0 A;  1LFB A;  2L7F P;  2LTP A;  5F08 A;  4AYB N;  3S1Q J;  4X6A J;  4D5F A;  1TWA J;  2CU7 A;  2CQX A;  4J19 A;  5IP7 J;  1VF9 A;  3BT9 A;  3RQI A;  4DZJ A;  2LVS A;  2ME0 A;  5FKK A;  3BTL A;  4L5E A;  2HOA A;  1ZQ3 P;  2B63 J;  2EZH A;  4QSH A;  2R7Z J;  1RES A;  4W97 A;  1SAN A;  5F0C A;  2JA7 J;  1BA5 A;  3MKL A;  2E2H J;  2H8R A;  4A3G J;  3BTJ A;  4B4C A;  4D7N A;  2PMZ N;  2E19 A;  2ECB A;  1JT6 A;  3JRA A;  3A03 A;  5EEA A;  2WAQ N;  2ME6 A;  2LD5 A;  2NVT J;  3Q3S A;  2K40 A;  1WI3 A;  3OOU A;  1ORK A;  3BQY A;  4A3K J;  2QF7 A;  3S16 J;  3DCF A;  2XGD A;  4S0H B;  1JKR C;  1APL C;  2KDZ A;  2HDD A;  1ETY A;  4A3E J;  4C2M J;  4EEF G;  4A3I J;  5EZH A;  1D5Y A;  2EBI A;  4IEJ A;  3HB9 A;  4C3I J;  4BXX J;  2R5Y B;  5FKM A;  3SFI A;  3GTP J;  2JA8 J;  5EG0 A;  2DA2 A;  2L7M P;  1RET A;  2L9R A;  1TWH J;  1MBF A;  4MFD A;  3WHC A;  2DMP A;  5JLX A;  1AHD P;  2HXO A;  2TCT A;  2COB A;  2X9D A;  1OCP A;  5GPA A;  4XRM A;  4M6V A;  1OCT C;  4CYC A;  4BY1 J;  3S2D J;  2L0K A;  1NK3 P;  4A3L J;  5M5Y J;  2XB5 A;  1FEX A;  1Z77 A;  1RKT A;  5E3O A;  5F27 A;  3ZQG A;  1VFC A;  1ZR2 A;  4JX5 A;  2AHQ A;  3JRB A;  2HQ5 A;  5F1J A;  2HOS A;  3QQA A;  3A01 A;  1JUM A;  2K9S A;  1H8A C;  1HOM A;  3PO3 J;  1OJL A;  5K7Z A;  2DA6 A;  1QPI A;  2DA5 A;  4B3A A;  1JKP C;  1U9O A;  2ECC A;  1POG A;  1IG7 A;  1X2M A;  5JLW A;  2NS7 A;  3Q0U A;  5IP9 J;  5F0F A;  1DU0 A;  3S14 J;  4NDL A;  1B72 A;  4FCY A;  1IJW C;  1YRN A;  4LOC A;  3S17 J;  5C4X J;  4V2G A;  2DA1 A;  2JA5 J;  2HYJ A; 
#chains in the Genus database with same CATH topology
 3OL4 A;  4CXF A;  2RV8 A;  2PMU A;  4DBR A;  1Z7U A;  2ETH A;  3AG3 H;  3TMO A;  1KQ8 A;  4RLQ A;  3ZN0 A;  1G8X A;  2M5W A;  2XF6 A;  1LNW A;  2OA4 A;  3BG3 A;  2A05 A;  1U78 A;  4ZTJ A;  5K7F A;  2M45 A;  4B8X A;  5HDK A;  4DNC A;  4HLY A;  2M8E A;  4UY8 I;  2FMY A;  3E6M A;  3HG9 A;  2ZME C;  2KJB A;  3J7A O;  4KIG A;  4A3C J;  1QVU A;  4E7K A;  3SEQ A;  2G0E A;  3ESW B;  4N9I A;  2LP0 A;  3CZ6 A;  2P6T A;  3DP7 A;  3H0G J;  5C3E J;  2E60 A;  3IAM 2;  3AL0 B;  4CYC B;  1Y1V J;  5LRR A;  4A0Z A;  3OY9 A;  1D8J A;  4DYQ A;  4EJW A;  3KP4 A;  1IGN A;  4L9T A;  1WKM A;  2IPQ X;  2QM3 A;  1TZL A;  4JP0 A;  1K78 B;  3FF5 A;  1DUX C;  1HW1 A;  3TOB A;  4U88 A;  3OWT A;  2YR2 A;  4BAC A;  3AAF A;  3GME A;  5DDG A;  1ON1 A;  4M6Y A;  4O3M A;  2HGC A;  3VSK A;  1XB4 A;  5GPC A;  2O5R A;  5ILU A;  3J80 Z;  3DTK A;  3OV8 A;  3ZMV A;  1W5C C;  2E7X A;  1IZ1 A;  5K5O A;  3O6B B;  2P8T A;  2Z99 A;  3P5J A;  1P4X A;  1NH3 A;  3VYR B;  2LR8 A;  2FU4 A;  2STW A;  1TW3 A;  3OYK A;  3CC4 I;  3EYY A;  2VC0 A;  3BP8 A;  3CP2 A;  4HSR A;  1RI7 A;  2BE5 F;  2FE3 A;  1LE8 A;  2EZL A;  4OMY A;  2ZXI A;  4CCM A;  2EIK H;  3QPH A;  4EGZ A;  1SMY F;  3LOC A;  3X2Q H;  1FOW A;  5FLX K;  3DBH B;  1VQ5 I;  1MBG A;  1UJ8 A;  4Q4Z F;  3I64 A;  3VYU B;  2JSC A;  2I10 A;  2P81 A;  3OIP A;  1XGM A;  2IS2 A;  2DJI A;  4L0Z B;  2MLK A;  4HNU A;  1VQ4 I;  1FX7 A;  1SD4 A;  1F5T A;  1V4R A;  1GLN A;  3IH2 A;  3MVP A;  3EUA A;  2Y2Z A;  3BR5 A;  1ITY A;  1WJD A;  2ZSH B;  5J1Y A;  2VOO A;  1T08 B;  4LGW A;  2DPD A;  4UUS A;  4HRI A;  1OR7 C;  5FKN A;  3C2H A;  4BBR J;  3S2W A;  1S9H A;  4G6D A;  3BR3 A;  4XRF A;  1D8K A;  1DP7 P;  3QYE A;  2OQG A;  3U2R A;  2KPM A;  2P0W A;  2V7F A;  2JPB A;  1VQM I;  2ZB9 A;  2RGV A;  3BRO A;  3K4B A;  3L2Q A;  2JN6 A;  2MH2 A;  3CCV I;  3CUQ A;  2V1N A;  1R4N B;  2ELK A;  4JQF A;  3VWB A;  2XSJ C;  1B4A A;  1R5G A;  4L9V A;  2BY1 A;  4ABZ A;  3CCR I;  1XG1 A;  2CW8 A;  2Y0S A;  1LB2 A;  1X19 A;  3K4K A;  1X1C A;  4AYB A;  3D5S C;  2KFD A;  1D0X A;  2PJR A;  5J8C A;  1CQT A;  3LQR A;  3M7G A;  4LK1 F;  3J81 K;  4JBA A;  4FHT A;  4NQW B;  4AIJ A;  1RC9 A;  3HPH A;  4QWQ A;  4AU7 A;  3TO7 A;  5C4J J;  3CTA A;  2CWE A;  2CRG A;  1R1V A;  3FKI J;  3BCA A;  3DLA A;  5DUK A;  4QLC U;  2IVM A;  1SFE A;  1N75 A;  1Y0N A;  2VON A;  5B66 C;  3K1P A;  4A2U A;  4BKX A;  1LVK A;  3OYC A;  2IGO A;  2KMU A;  4MTE A;  3E5Q A;  1QO0 D;  4E7J A;  1F4K A;  1WRJ A;  4D1Q A;  4MEX F;  1ZR4 A;  3TL4 X;  2R7T A;  2IP2 A;  4HNT A;  5HDN A;  1VTN C;  1BN5 A;  2MW8 A;  3MKZ A;  2WAQ A;  5B5E C;  4BDY A;  2V6E A;  2CUZ A;  1GUU A;  2JVG A;  4N9H A;  3O8G A;  1OCC H;  3GUD A;  2K9N A;  1X58 A;  3GYH X;  2AXL A;  4BXU A;  1JTY A;  1VI0 A;  4XRS G;  3C18 A;  5IOY A;  2O8X A;  2XSD C;  2VKH A;  4ESB A;  4A0X A;  2R7W A;  3RPU A;  4IXA A;  2VQC A;  1BR1 A;  2R92 J;  4BJ6 C;  5FB2 A;  3WTU C;  1W5S A;  2QUF A;  1J09 A;  4CCK A;  2P5L C;  1W0U A;  3V7C A;  1Z7L A;  3E7L A;  2G7U A;  2FRH A;  4N4O B;  4ZYH A;  1BIA A;  4MEY F;  3BG9 A;  2ZME B;  5ERI A;  2EWN A;  4BJT A;  1D1C A;  2VOP A;  2MSY A;  1A35 A;  2DCE A;  2F4I A;  5CJ9 A;  2UV1 A;  4NUB A;  1XMK A;  1QPM A;  4XK4 A;  2X6Y A;  1K6O A;  3GFJ A;  2BW3 A;  2BHY A;  4DZP A;  5J4Y A;  2OF7 A;  1G3Y A;  1Z67 A;  1T33 A;  4I7H A;  2ID3 A;  3FXO A;  1FMW A;  2H8W A;  4KIF A;  4A3J J;  3W6V A;  1G3T A;  3RZO J;  3K10 A;  3U1K A;  4A3F J;  3LFK A;  2HWV A;  3F9K A;  4I0B A;  1I6X A;  2K7L A;  3Q0V A;  3H1C A;  1PUE E;  3I53 A;  4NC6 A;  2F5F A;  4IVN A;  4CUG A;  5EGO B;  1MDM A;  1KU2 A;  3HOU J;  1K6Y A;  3QP6 A;  2LK2 A;  2IJL A;  2R93 J;  2OTL I;  2JSP A;  3T5X A;  2JUG A;  4C3H J;  1UG0 A;  2HDC A;  1YG2 A;  2F5C A;  2IBD A;  3ZQI A;  3CME I;  4BAY A;  1AOY A;  1AKH A;  2OCC H;  3KZI C;  1JJ8 C;  5GAD J;  2O6G E;  1T56 A;  2VBY A;  4LLL A;  4EAT A;  2P7C B;  3HJE A;  5E1X A;  2Q1Z B;  2BY2 A;  5JVG F;  1QRY A;  2A3S A;  2BZT A;  3CCY A;  3RPU D;  3BY6 A;  4ZH4 F;  1UCR A;  4XKW A;  1V5E A;  1D1B A;  4F3Q A;  5JR3 A;  3IC7 A;  4BE2 A;  4Y33 A;  3LST A;  2VBZ A;  2GM4 A;  3FIS A;  3LMM A;  4M71 A;  5CVV A;  3OL3 A;  5K5R A;  2Y75 A;  2HQR A;  1J9I A;  2RC4 A;  5CVR A;  4H0E A;  1UHW A;  1XTA A;  1Q1V A;  3HEF A;  1B1B A;  3HOZ J;  3K69 A;  5HLT A;  3U9G A;  1BOB A;  3ERM A;  3W3C A;  2L5Q A;  2PQ8 A;  4N4N B;  3KYD B;  3TED A;  1HDP A;  3T0Y A;  3ZP5 A;  2QA4 I;  2DOA A;  2M30 A;  1UHM A;  4MNU A;  4ZTF A;  1PUF B;  2JJ7 A;  3I3L A;  4XKB A;  4CCN A;  5IT9 K;  1SD5 A;  3ZQF A;  3ULQ B;  5CYV A;  4UXN A;  1JKO C;  4G8X A;  1R23 A;  3T1B A;  1O3Q A;  4ESF A;  5LBQ A;  1FPQ A;  2XKO A;  3GTK J;  2R4G A;  1IRF A;  1TT5 B;  3PIO F;  2IAI A;  1E3H A;  4MTD A;  4JK1 X;  2ZNZ A;  2L9S A;  2MBF A;  5C44 J;  5JHF A;  1WJB A;  4QIW N;  3GVA A;  2LY2 A;  3K70 D;  3OR2 C;  3HOX J;  2FD5 A;  3OIO A;  5AIQ A;  1BJA A;  2XAF A;  5KNL A;  1Z9C A;  4LD5 A;  2X4H A;  1PP7 U;  2JTV A;  4XID A;  4LK0 F;  1OCR H;  3HRS A;  4RAG A;  3HRM A;  2V9K A;  2XC7 A;  5JHU A;  1MBK A;  1XCB A;  3E5U A;  3HOT A;  5FLM J;  2M4G A;  3GFL A;  3HTU A;  3QWL A;  1YI2 I;  2GWR A;  1QHH D;  3B6C A;  5BQT A;  1YE9 A;  3CUQ C;  2WC2 A;  4CCJ A;  1YS7 A;  4LMY A;  1YIO A;  4ASN A;  3LNQ A;  5ICG A;  2R5Y A;  3B02 A;  3FBN B;  1Z6T A;  2D1V A;  4XLP F;  2DFE A;  1YO5 C;  4U7B A;  2Y0M A;  5FFX A;  4DJA A;  1TWF J;  3MWM A;  2M0C A;  2V6C A;  4B43 A;  4WWC A;  3H9J A;  2X6O A;  3M07 A;  4UVA A;  3PQJ A;  2WY8 Q;  3HSE A;  3ZMD A;  2K9L A;  1IUY A;  3R6S A;  5EYR A;  2Z9O A;  4A93 J;  1DP3 A;  4EM0 B;  2PI0 A;  2L7F P;  2LTP A;  4X6A J;  5LFA A;  2PJP A;  2XV4 S;  2DFH A;  1HSJ A;  2H6C A;  2OAZ A;  3BT9 A;  3SZT A;  1IRX A;  1XSX A;  1ODD A;  1X1P A;  2ME0 A;  3PFI A;  4B3X A;  4RGS A;  4L5E A;  5E8I A;  2NNN A;  3BZ6 A;  2HOA A;  3WGG A;  2M4K A;  1ZGJ A;  2H6B A;  2R7Z J;  1QA6 A;  1WZ2 A;  2IS1 A;  2NAZ A;  4W97 A;  4BJ5 C;  3RYP A;  2JA7 J;  3H36 A;  1QGP A;  1NG6 A;  2D2W A;  2DDB A;  4HQE A;  1FP1 D;  3AKZ A;  2RVC A;  4YIF A;  2BVL A;  5CVI A;  1L0O C;  1JT6 A;  3FWE A;  1KU7 A;  4II2 A;  3JAM Z;  1D5V A;  1WJA A;  2HYF A;  3JCU C;  5GAG J;  2FML A;  1TT0 A;  1T2K A;  4L18 B;  1LDK B;  3GLX A;  4FX4 A;  4LIT A;  1IN5 A;  3W6K B;  4X0G A;  3DCF A;  2XGD A;  4IL6 C;  4Y13 A;  3G73 A;  1ETY A;  4C2M J;  3EUK L;  3IWF A;  4EEF G;  2Q0O A;  2HDW A;  5EZH A;  4A3I J;  1D5Y A;  1YQA A;  2GA2 A;  3PFY A;  4AM3 A;  5KHD A;  2QQ8 A;  1SC7 A;  1RNL A;  4DBQ A;  2DA2 A;  2JA8 J;  2L9R A;  4GCV A;  4EM2 A;  3KEQ A;  1IXC A;  4WCG A;  2RRE A;  4UUV A;  1U3E M;  2KRC A;  1OCP A;  3OYL A;  4IQJ A;  1OCT C;  1UB9 A;  3R4K A;  3Q9S A;  4BDZ A;  2ZXW H;  4RM2 A;  1NK3 P;  4F52 A;  3CO7 C;  2EFP A;  5M5Y J;  3COA C;  3OYA A;  1Z77 A;  1KU3 A;  1RKT A;  2VN2 A;  1ZLJ A;  1FYL A;  2DQR A;  1VFC A;  3V8K A;  3JRB A;  4E7H A;  4IKF A;  2K86 A;  3EYI A;  1UST A;  2HOS A;  3QQA A;  3R61 A;  1JUM A;  3A01 A;  1VZ0 A;  2DLL A;  1HOM A;  3CJQ B;  2IS6 A;  3SQN A;  5K7Z A;  4LIV A;  4OIQ F;  1DGR M;  1QPI A;  3V8L A;  4BL0 B;  3K70 C;  3UNG C;  5K1Y A;  2NS7 A;  4F93 B;  3OOP A;  4ENM A;  2M7A A;  3PNV A;  1T8I A;  4PJN A;  5IP9 J;  5F0F A;  1O7F A;  2BXY A;  4CO8 A;  3S14 J;  2CSO A;  2R7S A;  2DQL A;  5J40 A;  2DA1 A;  2JA5 J;  3ABU A;  3HYI A;  2QLZ A;  3CMM A;  1SMT A;  3DKX A;  3UKG A;  2LY9 A;  5BPI A;  1G4D A;  3CMA I;  2Z1D A;  3F8F A;  3MN2 A;  2QVO A;  1U5T C;  3ISP A;  2DMN A;  4MO7 A;  1UAA A;  4AD9 A;  2IEK A;  2NS8 A;  3D0S A;  3HSF A;  2XRN A;  2Y69 H;  1O3T A;  3VFZ A;  1B8I A;  2O7O A;  2EK5 A;  1U8B A;  2MA3 A;  2QBY B;  2ZJP F;  3KX2 A;  1FY7 A;  4R1H A;  2VBX A;  5HLH A;  4Y17 A;  5TGT A;  2STT A;  1KQ0 A;  1AWC A;  3DFG A;  4MQ9 F;  3G1M A;  4BHP A;  1ZHF A;  3CF2 A;  4YRV A;  3VYT B;  1JKQ C;  1IN6 A;  2K4B A;  3OSF A;  3JRH A;  1S5L C;  2OUM A;  3WGH A;  3H92 A;  5DYM A;  5F64 A;  1K61 A;  1A5J A;  2HNH A;  3H3U A;  5LGN A;  1BL0 A;  4M3B A;  3UR3 C;  1VQ6 I;  5M5W J;  4BBS J;  1NTC A;  3P9K A;  4V19 K;  2HZT A;  2L7K A;  5L3E A;  1RR7 A;  2JA2 A;  3KP5 A;  3O2P E;  4CDG A;  1E17 A;  5J1R A;  2W57 A;  2J5P A;  3BG6 A;  3JRD A;  2ZC2 A;  1JI8 A;  3VEP A;  2VE9 A;  2L2O A;  2FBH A;  2VC1 A;  3JRC A;  1MD0 A;  1R1U A;  1JUS A;  1MNE A;  1JE8 A;  2P7V B;  1Z1D A;  3IRQ A;  1QNT A;  2VJJ A;  1L3L A;  2JZY A;  2JRM A;  2Y9Y A;  5FKL A;  2YU9 J;  3DPT A;  1VQ9 I;  2PG4 A;  3QYF A;  3TBI A;  5HOO A;  3K7A J;  3PIP F;  2K85 A;  3EUH A;  2CH0 A;  4MLO A;  1OYI A;  1CGP A;  3CDH A;  3M1C A;  3G4S I;  1YRN B;  2M1B A;  3GO5 A;  1P7I A;  4XLE A;  1ETQ A;  1Z91 A;  3MCZ A;  2R5Z A;  3CMY A;  3F8M A;  4GRI A;  4W1U A;  2LKX A;  4LG0 B;  2LRD A;  1UFM A;  2BV6 A;  3CJT B;  4KFC A;  2ZJ2 A;  1WH7 A;  2CW0 F;  3S1N J;  3G6E I;  3DV8 A;  1IUF A;  1TL8 A;  2EFW A;  4EV0 A;  2LSO A;  1PVE A;  1N25 A;  3PUB A;  4I01 A;  3V42 A;  2VKE A;  1A6I A;  4M6X A;  1VQP I;  3GX4 X;  4DYR A;  1EJ9 A;  3WU0 A;  4E6K G;  2XAJ A;  3F21 A;  2XAG A;  4Y52 J;  4F7Z A;  3L2R A;  2XAQ A;  4NC8 A;  4BGD A;  4P55 A;  4RAY A;  1FOX A;  4FX0 A;  4XN3 A;  1R49 A;  2B0L A;  2IGN A;  2FOK A;  3H9G A;  3IH4 A;  4KMU X;  2ZCW A;  3OYM A;  3OYI A;  3JTH A;  1IN7 A;  2EZI A;  2WV1 A;  4NC7 A;  5M3M J;  3S3O A;  3JRG A;  2RKH A;  2E1C A;  2JMW A;  1IDY A;  2LF7 A;  4M9Z A;  3F0C A;  3QU6 A;  1MKM A;  2F2E A;  5FGM A;  1WFX A;  2Z2S B;  3P9I A;  3ZRG A;  3GWZ A;  3C1D A;  1VQL I;  4F55 A;  1KA8 A;  5LEK A;  2ZNY A;  5E1W A;  1T6S A;  5D4S A;  1X3U A;  3CLO A;  3HUG B;  3I4P A;  2DK8 A;  3M3Y J;  1NG7 A;  3B73 A;  3G3Z A;  1P4W A;  1X1B A;  1YX5 A;  2GBY A;  2NNY A;  1HKS A;  4RGU A;  1OQY A;  1IC8 A;  5JI6 A;  2A6E F;  3GTQ J;  1EH7 A;  5HLI A;  2R0Q C;  1XS9 A;  1G3S A;  3LL7 A;  3TW6 A;  3MKW B;  1K4S A;  3HGY A;  4RB0 A;  1SD6 A;  1Z3Y A;  2XDV A;  3GBG A;  4GFB A;  4KT6 A;  3ZMT A;  3E1S A;  5EZG A;  2HXI A;  2IXS A;  4PDK A;  1IV8 A;  2BY3 A;  4XQF A;  3I58 A;  3A0B C;  5F0H A;  2ICW G;  4IOA F;  1ERD A;  3SJM A;  3Q0W A;  2OTJ I;  2OZU A;  1IAW A;  3K4L A;  1PJR A;  1JUP A;  2YPR A;  3NRV A;  9ANT A;  4M73 A;  3CES A;  2EIL H;  2ISY A;  4BU2 A;  2UWM A;  2K3F A;  1U5T B;  1Y1W J;  1FWZ A;  2VI6 A;  1CF7 A;  2OPT A;  2Y9Z A;  3ZQQ A;  1MSF C;  1J5Y A;  4DGW B;  3AG2 H;  1LJ9 A;  1LDJ A;  3OIQ A;  4C9Y A;  4PFP A;  2IS4 A;  2EA2 A;  4XLC A;  1R58 A;  3DEU A;  4O5V A;  3WU2 C;  3TQN A;  3FXU A;  2D1H A;  5L3F A;  3GTJ J;  3FMR A;  5KAI C;  4FTH A;  1LQ1 A;  1FSE A;  1MSE C;  2W48 A;  2L01 A;  3JR9 A;  3TKY A;  1S8N A;  3GZ5 A;  2Z16 A;  3FXM A;  4FIS A;  2VL8 A;  2JWT A;  2KRF A;  1XDS A;  4A69 C;  3VDX A;  1SEU A;  4NHJ A;  2CQN A;  2YX7 A;  3NAR A;  2Y0S N;  3SYT A;  5BS6 A;  1ZRC A;  5DV5 A;  2KRH A;  2CV0 A;  1O3R A;  1H88 C;  3KP7 A;  2P6S A;  5H2F C;  1D0Y A;  2A6H F;  2CFX A;  2ZSI B;  3DBL B;  4IZZ A;  2KIM A;  3K4C A;  1WJF A;  3AFH A;  2E1M C;  3LQQ A;  5HOD A;  4U7D A;  2X48 A;  1G2H A;  3IAS 2;  1MMG A;  3LSG A;  2XPU A;  3C7J A;  5KCM A;  4HDV A;  1H0M A;  5E79 C;  4CCO A;  2TDX A;  5LEJ A;  1F9N A;  1Z3X A;  2W00 A;  4Q48 A;  3FDY A;  2L4M A;  3D5L A;  4I09 A;  1XMA A;  5D5W B;  3DKW A;  2DOF A;  4MIM A;  1MMN A;  1TNS A;  1XC5 A;  2QSH X;  2LKP A;  3WTS C;  3QRF F;  2D5V A;  4B09 A;  2DFI A;  4JOM A;  3FHZ A;  3IP4 B;  2M7B A;  2NXN B;  2CYY A;  5ICC A;  1I1S A;  1B6A A;  2GIV A;  2CW7 A;  1GHC A;  3GZ6 A;  2HQA A;  4R79 A;  4XOT A;  2VQH A;  5IY5 H;  2E1N A;  3DTI A;  3OYD A;  1FC3 A;  2XHK A;  4F91 B;  2DMT A;  1Z05 A;  1I6H J;  1EA3 A;  2MAB A;  1VND A;  2FOW A;  2VKD A;  2O8K A;  4IJA A;  2HS5 A;  3HSR A;  2HTS A;  3CJN A;  1HST A;  2EFO A;  2QEN A;  2K4J A;  3LSJ A;  2NYX A;  2QKL B;  2ESN A;  1MH4 A;  3TDU C;  1JGS A;  1X1A A;  1MJB A;  1ZN2 A;  3GF2 A;  1KZH A;  4ETS A;  5B1A H;  1FP2 A;  1XGO A;  3G1L A;  3RJP A;  3IV5 A;  1OIS A;  5DTD A;  1H9G A;  1FYM A;  2XVC A;  4HF0 A;  4D0P A;  3LSR A;  4OIO F;  4X1E A;  2Y30 A;  1S72 I;  2OV7 A;  5JFR A;  4J01 A;  4BEH B;  1FOY A;  2CV2 A;  1ACI A;  3K6G A;  4GYG A;  4IRG A;  5B1B H;  1FZP B;  1I3Q J;  4CIC A;  4IHW A;  2BOL A;  2LC2 A;  4HF1 A;  1KGS A;  4RB2 C;  2LFB A;  1IF1 A;  1W7P A;  2PMZ A;  3CCE I;  2X6W A;  2EQR A;  2CUE A;  4HLX A;  3I0T A;  2Q8K A;  5L3D A;  3KYL A;  1AU7 A;  1TWG J;  2CG4 A;  1HF0 A;  3QOD A;  2L9N A;  3KE2 A;  5LHI A;  2CS3 A;  1IRG A;  1EKE A;  2NVX J;  3S8P A;  2HQN A;  2B9S A;  4BH9 A;  1V5F A;  2LMD A;  2WAF A;  3CQZ J;  4B44 A;  3R60 A;  2A5W A;  3PNT A;  5IYC J;  3TW7 A;  1FJL A;  2CFO A;  4II3 A;  3L2U A;  5D5X B;  3LSH A;  2A07 F;  4AWX B;  2RDP A;  1IDZ A;  1RZ4 A;  1FBS A;  3KEO A;  3OYN A;  2HI3 A;  4M72 A;  3MKY B;  2I8D A;  3HHH A;  3HOW J;  3CO6 C;  2V1X A;  2QSG X;  3TOA A;  3KZZ A;  1ETV A;  4XSZ F;  1WGX A;  1T0F A;  4KIB A;  3OSG A;  3KET A;  3NAU A;  4BHB A;  1OCO H;  4YFX F;  2M87 A;  2QWW A;  1QBJ A;  1HKT A;  1W5T A;  3U21 A;  4D5F A;  1P6R A;  5CVU A;  2CU7 A;  3CCQ I;  5IP7 J;  1QZY A;  4D9J A;  3E6C C;  5E17 F;  3FXJ A;  3WE3 A;  4CZZ A;  4A12 A;  4OIP F;  4WXC A;  3BTL A;  3N4M A;  4HV6 A;  1RES A;  5F0C A;  1W7P D;  1R5I D;  3U1D A;  3GFI A;  2GXB A;  1ZEL A;  1BA5 A;  4PZJ A;  1J59 A;  2ESH A;  3C2G A;  4I02 A;  4N0B A;  3K4M A;  2E2H J;  3M1E A;  2H8R A;  4A3G J;  3BTJ A;  3IRR A;  2VIX A;  4B4C A;  2LDU A;  5D5V B;  1I1G A;  1V5G A;  4D7N A;  4PSX A;  3QPT A;  3DPU A;  4HW0 A;  4G6Q A;  3J81 Z;  2NVT J;  1KYZ A;  3MZH A;  2HEO A;  4A3K J;  5H6Q A;  1N77 A;  1R71 A;  2HDD A;  1JKR C;  3NWS A;  4QPO A;  3SEZ A;  4YFN F;  1USS A;  4UHT A;  1Y6I A;  2EBI A;  4PJ0 C;  3R0J A;  4C3I J;  4BXX J;  2E71 A;  1O3S A;  3GTP J;  1LKX A;  1RET A;  2B7E A;  1N78 A;  3RYR A;  3SZP A;  3WHC A;  3HOS A;  1ZRF A;  2DMP A;  4KT5 C;  4OOI A;  5JLX A;  1BR4 A;  1AHD P;  2TCT A;  4OU0 A;  5GPA A;  4XRM A;  3K2Z A;  3L2W A;  2OQR A;  5F6F A;  2WA0 A;  3PQK A;  2WAE A;  4CYC A;  4BY1 J;  3S2D J;  3LA3 A;  2A6T A;  2YU3 A;  2KLO A;  2CUJ A;  2F6C A;  2QKM B;  2EIN H;  1K78 A;  3TO9 A;  4JX5 A;  4RAZ A;  4ZZD A;  3H0D A;  4EJO A;  2MH9 A;  2MFZ A;  4RB1 A;  2ZKZ A;  4WX9 A;  3VYS B;  1JKP C;  5TJJ A;  1POG A;  1X2M A;  5JLW A;  4RM3 A;  1XN7 A;  3DLL F;  1ZGA A;  1K4T A;  1ZH5 A;  2UXN A;  1DU0 A;  4ZDP A;  4FCY A;  2GAU A;  2FEZ A;  4ENK A;  3S17 J;  1B9N A;  2AXT C;  2GZW A;  2K3P A;  5F1R A;  1KYW A;  2VLA A;  2I5U A;  2IA0 A;  1Q1H A;  4KYW A;  2ZXH A;  2R7F A;  3DQV C;  5FFZ A;  4KNY A;  5EEH A;  3VPR A;  1YFH A;  1DGW Y;  4L5I A;  2OBP A;  2ZBK A;  1SVL A;  2AO9 A;  4ZYA A;  2XPW A;  1UMQ A;  2CUF A;  2DJN A;  4B1R A;  4Z6Y A;  5FRM A;  1ENH A;  5FJ8 J;  1FIA A;  2DOE A;  3A02 A;  2DW4 A;  5EG0 B;  2EFN A;  1BW5 A;  1ZG1 A;  4PJM A;  4EGY A;  3H9Q A;  4G12 A;  4YIR X;  3ABT A;  2LBF B;  3KPH A;  1TBX A;  4JYK A;  4B48 A;  1Z6R A;  1MND A;  1ZYR F;  3GEZ A;  4BYY A;  5BPD A;  3LSK A;  2R7V A;  1S29 A;  1MH3 A;  2IT0 A;  1T38 A;  1SFO J;  4OMZ A;  3E0J B;  4JX6 A;  5H20 A;  3ZQL A;  1W36 D;  2ELJ A;  5TRD A;  2E35 A;  5LLQ A;  2JA6 J;  4LG3 A;  5DCM B;  3I5U A;  3FIW A;  3HPG A;  2GXG A;  2XRL A;  1S7O A;  4C2U A;  4YG2 F;  5DEQ A;  1DPU A;  2HU9 A;  3I9V 2;  3JRF A;  3S2H J;  5M5X J;  3TP0 A;  3I59 B;  2Z3Y A;  3WTW C;  3OS1 A;  1T95 A;  3ZPL A;  5EF6 A;  4ITV A;  3GZN B;  4NQW A;  4L9N A;  4DQ2 A;  2V9V A;  1XSV A;  1VQN I;  1HW5 A;  4ZC3 A;  3TP3 A;  2JQ7 A;  2LLK A;  3K0L A;  1ON2 A;  4I6Z A;  2RNG A;  1S7A A;  1LDD A;  3L2C A;  3CUO A;  3LWF A;  4LIU A;  2DPU A;  4RLF A;  4V2F A;  4PGG A;  5J3L A;  4U87 A;  5IYB J;  3HTS B;  3H3V K;  2LKS A;  4PJJ A;  3HOY J;  5GAE J;  1V54 H;  4OAZ A;  1YJN I;  1YJW I;  3BDD A;  2WY7 Q;  5HVQ C;  1TW2 A;  4G7Z F;  4EQQ A;  4ENN A;  3M4O J;  3LAJ A;  1WJE A;  3SZG A;  1MBE A;  1GVD A;  3JW4 A;  2CQK A;  1T0F C;  3VOD A;  2WB1 N;  1IW7 F;  3E5X A;  2CV1 A;  2GXA A;  3PUF A;  3ZOB A;  3PSF A;  5LRS A;  5FD5 A;  2YUS A;  2TRT A;  2CQ7 A;  1DDN A;  3BLY A;  4IX7 A;  3CC7 I;  3BWG A;  1P9Q C;  5CVJ A;  1P7J A;  2HOT A;  4UB8 C;  4UNO A;  2M34 A;  3F8B A;  3PM1 A;  4MFE A;  1I50 J;  1P4A A;  2ZME A;  3FXL A;  2DAO A;  2PBI A;  5IYD J;  4AIK A;  1O57 A;  1QVT A;  3BCB A;  4AIH A;  2N8G A;  2FBI A;  2O3F A;  2H1K A;  5KVR A;  3BR0 A;  2DU9 A;  4CH7 A;  2ZO4 A;  2Z5U A;  1YJ9 I;  4K2E A;  1XDU A;  3C3W A;  2QGU A;  3SDG A;  3T8T A;  1BIB A;  4LB6 B;  3CCU I;  1S6L A;  2HTJ A;  4A3M J;  3HRT A;  4ZYD A;  3H5A A;  1XSD A;  1WCM J;  3W2V A;  3W2W A;  1I39 A;  4XLN F;  3H5N A;  1JJ6 C;  1GXP A;  3H35 A;  1JHF A;  2L02 A;  3J7Z I;  1LE8 B;  3REO A;  2W25 A;  3M8E A;  2DYR H;  2E2J J;  3SFZ A;  3ECH A;  3GCM A;  3QYB A;  2E2I J;  5EGO A;  2KP6 A;  5HS9 A;  2NVQ J;  3CP8 A;  3I4N J;  5E3L A;  3KP3 A;  4RBO A;  1GXQ A;  3J7A Y;  1I5Z A;  1KON A;  2F4M B;  1JTX A;  5FO5 A;  4ON0 A;  3ZMU A;  5A2Q K;  1DU6 A;  1E3P A;  2W85 A;  1ETX A;  3F6O A;  3M8J A;  4M9X A;  4HAM A;  4BHC A;  3HKZ N;  4QTR A;  1ETW A;  3ZQH A;  5E1Z B;  5IPA A;  2DA7 A;  4UUS B;  1OCZ H;  2VUM J;  3L9F A;  3AL0 C;  3IH3 A;  5EEG A;  4Q5S F;  2E7W A;  3S15 J;  1AA7 A;  1S7E A;  1YLF A;  4HV5 A;  4O6J A;  2FJ1 A;  1RRJ A;  1A6Q A;  2JK3 A;  1TC3 C;  2JRT A;  5IT3 A;  3OYF A;  1LVA A;  3KP6 A;  3JSO A;  3CUQ B;  2FUG 2;  1MJ9 A;  2KJC A;  2J5O A;  3DXJ F;  3VB2 A;  4UVC A;  1HXD A;  1WH5 A;  2BYV E;  3OYG A;  2BVM A;  4PJL A;  4DIQ A;  2HVS A;  4XLH A;  2XKP A;  3ONQ A;  2UZK A;  5KAF C;  1BOA A;  2ELH A;  5BOX A;  1V3F A;  3HM5 A;  4M74 A;  1HDD C;  3FK7 A;  2JUC A;  1F36 A;  2D45 A;  3HGG A;  2PJR B;  1U2W A;  3HBL A;  1PUF A;  5IOZ A;  4EMS A;  1RR8 C;  1XPX A;  6PAX A;  3HRU A;  1G3W A;  4P1W A;  3M9A A;  3CLQ A;  4A3D J;  1VQ7 I;  4G94 A;  3HDD A;  1WWX A;  2FQ3 A;  3F72 A;  2HPM A;  2ZJQ F;  2DYS H;  3NEU A;  4G7O F;  1XCV A;  3H3Z A;  4BQQ A;  2EV0 A;  1TWC J;  1RKW A;  2KL4 A;  4IOC F;  4A6E A;  5E3N A;  4Y4R A;  3P9C A;  1FTT A;  1MIJ A;  3E6B A;  1T98 A;  1T39 A;  2Q2E B;  1REP C;  1Y8R B;  1IXS B;  1TP4 A;  2KZV A;  4EM1 A;  2C6Y A;  3A0H C;  3RKQ A;  2ADU A;  3D1N I;  4C3J J;  1LEA A;  5J4V A;  4XR6 A;  2FXA A;  3L2V A;  1ZTR A;  4PGH A;  3K1N A;  1H89 C;  3IUO A;  1ZAO A;  2BEO A;  4XON A;  2K27 A;  4JX4 A;  5D8K B;  1VQK I;  1RIO H;  5CPR B;  2DDA A;  2VBW A;  1EF4 A;  2A5Y B;  4A5N A;  1S3J A;  3WTZ A;  1U9N A;  2NRA C;  2MD0 A;  3FM3 A;  3J80 K;  3KLN A;  1PYV A;  2LOO A;  2MYS A;  3D5R C;  3DKY A;  4WXH A;  3KYC B;  3Q9V A;  3MZY A;  3RIR A;  3JSP A;  4L0Y B;  1GV5 A;  1FTZ A;  3ASO H;  4E7L A;  3FMS A;  2OCE A;  4NNJ A;  2O9L A;  1FLI A;  1MBH A;  2H1L A;  1OYW A;  4BQO A;  3FKJ A;  1Y39 A;  3W6J B;  2VPR A;  5DD4 A;  4WXD A;  3BR2 A;  1R9T J;  4C2T A;  3F6V A;  2HYG D;  3F22 A;  2IA1 A;  3GTG J;  1KQ9 A;  1NHA A;  1HC8 A;  2X1D A;  4LLG F;  2HKO A;  4OIR F;  4EJV A;  2Y48 A;  2VKV A;  2FQ4 A;  4XKV A;  3PO2 J;  5FKO A;  1XX5 A;  4XN0 A;  3DTE A;  4LJZ F;  1ETO A;  5J47 A;  4XRS A;  2QEX I;  2MD5 A;  4I2O A;  1ZAR A;  3L09 A;  5EJC A;  1EV7 A;  1MDM B;  2A68 F;  3I59 A;  2DBB A;  2DFF A;  5GTH C;  1X4O A;  1QZZ A;  4FE4 A;  1HQC A;  3OMY A;  2Y31 A;  5H6R A;  3FBI B;  4KIT B;  3ZN1 A;  2IA2 A;  3BG5 A;  1A31 A;  2UXX A;  4J00 A;  2WTE A;  2WBM A;  1AKH B;  4MQV A;  3QOE A;  5K7H A;  4M9S A;  4M3F A;  1BW6 A;  1OFC X;  3JRI A;  1R7J A;  3CCM I;  4L5J A;  2ID6 A;  2L54 A;  4PFO A;  4HPQ A;  3WTY C;  4HOB A;  1G59 A;  5CLS A;  3S3M A;  1SAU A;  5DCF A;  1FYK A;  3KP2 A;  1R36 A;  3GTM J;  3RQ4 A;  2VJ4 A;  5DUI A;  2W7N A;  1ZRE A;  2W1O A;  2BXZ A;  2ZXJ A;  1RUO A;  3RDI A;  2EZK A;  1W0T A;  3F23 A;  2EFQ A;  5BMZ A;  4D5C A;  1MBJ A;  1X2N A;  3HOV J;  3E3V A;  2GA1 A;  1C0W A;  3DEE A;  2QYO A;  4RGR A;  1FBQ A;  1WI9 A;  1BBY A;  2KHM A;  3EET A;  5CKT A;  3KZY A;  5F08 A;  4AYB N;  1YIT I;  2VOD A;  3S1Q J;  1TWA J;  5E20 A;  2FNP A;  2DTR A;  4J19 A;  4BNC A;  1XD7 A;  3RQI A;  1QQI A;  5LHH A;  2KZG A;  4HQM A;  5D8L B;  2EZH A;  4ESJ A;  2HZD A;  4A5M A;  2VB6 A;  1SAN A;  2M3A A;  2GOX B;  3ML6 A;  2LRE A;  3MKL A;  2WV0 A;  1K79 A;  1SD7 A;  3ERE D;  2PMZ N;  3KLO A;  2E19 A;  4GXO A;  1U6G A;  4IF4 A;  3JRA A;  3F3X A;  1ONV A;  3JTG A;  2P5V A;  2WAQ N;  5EEA A;  1TLH B;  1WI3 A;  4H4K C;  1P2F A;  3OOU A;  2CMP A;  1IO2 A;  4KIS A;  1ORK A;  3BQY A;  4RGX A;  4CCL A;  3S16 J;  4S0H B;  2KDZ A;  2R3S A;  5ILV A;  4A3E J;  4ZDL A;  2G7H A;  2KIF A;  4IEJ A;  5ED4 A;  3HB9 A;  2QBY A;  4XBF A;  2R7R A;  2R5Y B;  5CQE A;  3WGI A;  2X1E A;  2DXI A;  1MBF A;  2EA4 A;  1QU3 A;  2KIQ A;  3VOE A;  2COB A;  4IQ4 A;  2HPI A;  4M6V A;  4PCQ A;  2YSR A;  2L0K A;  2MLG A;  1Y0U A;  1J0R A;  4MGR A;  3EUH C;  2XB5 A;  1FEX A;  1STZ A;  3E6D A;  2V1U A;  5E3O A;  5F27 A;  4I0A A;  3ZQG A;  2IW5 A;  2K5C A;  4S04 A;  1ZR2 A;  2PLY A;  4BQA A;  3FMQ A;  2COM A;  2JPC A;  2Z33 A;  2OD5 A;  2XF5 A;  1QHG A;  1WHU A;  1HW2 A;  2DA5 A;  4B3A A;  4NBQ A;  3S93 A;  5GAH J;  5ICE A;  1R6R A;  2EV5 A;  2VPL A;  4ZDO A;  5HS7 A;  2DT7 B;  4NDL A;  2VAS A;  1XGS A;  1IXR C;  1R1T A;  4AID A;  4RA2 A;  1YRN A;  2IGM A;  4V2G A;  2NVU B;  3WTV C;  4HF2 A;  2QQB A;  2XIG A;  3DPL C;  4HX7 A;  2VT2 A;  1ETK A;  3I4M J;  1R5H A;  4HST A;  4LG0 A;  2L7Z A;  1PP8 F;  1R4M B;  3GLL A;  1ULY A;  1MNM C;  3QAH A;  2HFH A;  4Z2Y A;  2UUZ A;  1UHS A;  4GYI A;  3S3N A;  2HVR A;  2NOJ B;  4M3G A;  5FLX Z;  4I98 B;  1WVR A;  3GTL J;  3C2B A;  3MEX A;  3IL2 A;  2V4J C;  1X4P A;  2Q2E A;  1Y8Q B;  3Q5F A;  4WK8 F;  2VQG A;  4YEL A;  1SVM A;  2MG4 A;  3ZXS A;  5HDG A;  3SHF A;  4RAF A;  2WWY A;  2A61 A;  4IHV A;  4E4H A;  3OR1 C;  4DOZ A;  3A4C A;  3V8J A;  4CSW A;  5DM7 F;  3KEY A;  2VE8 A;  3CCJ I;  1MJA A;  1YYV A;  4FQG A;  4EJU A;  3KCC A;  5K5Q A;  1BR2 A;  3GFM A;  1H9T A;  2KQR A;  2YS9 A;  5HS8 A;  3FXQ A;  5BNG A;  1A36 A;  4ZZL A;  5E3M A;  1SFK A;  1MW7 A;  3K9T A;  4RMN A;  3A01 B;  1FBU A;  1MMA A;  3RPQ A;  3BJA A;  3I54 A;  4HNV A;  4ZJZ A;  3LSP A;  3RI4 A;  3CDL A;  4FT8 A;  2M9H A;  3HUG A;  3OYE A;  3AG1 H;  1YX3 A;  4CYD A;  5JVT A;  1JT0 A;  3CJR B;  1MMS A;  2ZFW A;  3G1O A;  4YII A;  3QPL A;  2JT1 A;  4UV9 A;  3IWZ A;  3F8C A;  1F1Z A;  1LEB A;  1KU9 A;  1FNN A;  1YW9 A;  2K02 A;  2X6X A;  1RPW A;  4G7H F;  2H94 A;  3K4N A;  1Y56 A;  1E0E A;  2DOD A;  4G9Y A;  2IRF G;  3FM5 A;  2HKX A;  3ABL H;  4A3B J;  2F48 A;  2E1M B;  3CC2 I;  2CQQ A;  2EV6 A;  3B6A A;  3FXK A;  3O3K A;  4P9F A;  5J1U A;  1GV2 A;  1B8I B;  2BY0 A;  4NB5 A;  5D6F A;  1BM9 A;  2GOM A;  3GTO J;  5GP9 A;  3E97 A;  3WTT C;  2GIZ A;  4CA0 A;  4XMY A;  1E3O C;  3K4J A;  4XLA A;  5M3F J;  4P9U A;  3V7S A;  3HIF A;  1V55 H;  4AVP A;  5HNH A;  1HCR A;  1BI3 A;  1J7K A;  2BGC A;  2X85 A;  1UEL B;  4MHG A;  1U5T A;  3LFU A;  4AVZ A;  1VQ8 I;  1G6N A;  1HBX G;  1BC8 C;  1WPK A;  3S1R J;  4HX8 A;  3V7R A;  1O4X A;  5FRO A;  5EDN A;  4M3E A;  2M0M A;  2KIS A;  1D3Y A;  4XOR A;  4A0Y A;  1ZLK A;  1E2X A;  2KIU A;  3PSI A;  1IRZ A;  1BI1 A;  4CZC A;  3A1Y A;  2ACJ A;  4XL9 A;  4DYC A;  1Z0X A;  2LF8 A;  4BY7 J;  5D6E A;  3MZ8 A;  4E70 A;  5GTI C;  3I56 I;  4I99 C;  4HDU A;  4WF2 A;  5E8G A;  2XF7 A;  5B3S H;  1X3W B;  1SVO A;  1YW7 A;  2CJJ A;  5F04 A;  3JAM K;  2EPF A;  5FLV A;  4IO9 F;  3ZMS A;  4D7M A;  4E7S A;  5J8F A;  4IHY A;  2VJI A;  2OC6 A;  2NVY J;  1LFU P;  2R7Q A;  2K9Q A;  1I27 A;  1K83 J;  5FD6 A;  5D5U B;  3FXR A;  2QQA A;  2RN7 A;  5LD2 C;  2R5Z B;  3JRE A;  4IHT A;  3CDI A;  1SAX A;  1UZC A;  1WQ2 A;  3BTC A;  1BJZ A;  4F92 B;  2QSF X;  1HLV A;  2M8G X;  4KMF A;  3CD6 I;  5TIS C;  1YIJ I;  3PNY A;  1NK2 P;  2HR3 A;  4KA4 A;  3WHB A;  2HVQ A;  3TDZ C;  5DS9 A;  1MZB A;  4S05 A;  1O7L A;  5DD8 A;  2DMQ A;  3BR6 A;  4ZYE A;  4A6D A;  4QPQ A;  1HKQ A;  1F43 A;  2DK5 A;  4BUP A;  1JXS A;  2K9M A;  4LLN A;  5AON A;  1DQU A;  1ZGW A;  3ABK H;  2M2E A;  3ZQC A;  2W24 A;  1J2X A;  1Z21 A;  2DMU A;  4L9J A;  3HXL A;  1OKR A;  4E7Z A;  3WTX C;  5J6X A;  4XOP A;  3DBR B;  4OIN F;  3DEW A;  4M3D A;  2LG4 A;  3FK6 A;  4R8H A;  3LAP A;  2XGE A;  2H27 A;  3S32 A;  2R7U A;  3FX3 A;  3HC7 A;  2O61 A;  3K2A A;  3SDB A;  2AQE A;  2E5Z A;  4UVB A;  1GT0 C;  2A69 F;  4TV7 A;  1QZE A;  1ZKG A;  2EIM H;  4DW6 A;  4LB5 A;  3WE2 A;  5HLG A;  1JGG A;  3MMY B;  2E34 A;  2F5D A;  1U8R A;  4ENJ A;  1SFX A;  4GO1 A;  3N97 A;  5HNF A;  1B72 B;  3IKV A;  1P92 A;  4AUX A;  2DN0 A;  1GVJ A;  4OAY A;  1R22 A;  2DA4 A;  4XM3 A;  3OYB A;  4BEH A;  2QQ9 A;  3QU3 A;  1M1E B;  2BBY A;  4FET A;  1UG2 A;  3BJO A;  1WJC A;  3NQO A;  5IT9 Z;  2XB0 X;  3FHN A;  2NOG A;  1DPR A;  2VJ5 A;  2XAS A;  1BI0 A;  1BI2 A;  2XPV A;  3WG9 A;  5E18 F;  2FSW A;  2AQF A;  5DM6 F;  3W2A A;  3PJR A;  1OLT A;  3G2B A;  4BXF A;  3BJ6 A;  3P7N A;  4IRI A;  1FIP A;  1IN4 A;  2KT0 A;  3EPZ A;  3BZC A;  1MGT A;  4BS9 A;  4KDP A;  2OU2 A;  2FX0 A;  3BR1 A;  3RTR A;  3OS2 A;  3EQL F;  5AIP A;  4IPA A;  4C30 A;  3RZD J;  2H09 A;  3BQZ A;  2XAU A;  3FZV A;  3K1M A;  4CGZ A;  2EB7 A;  4BE0 A;  2RQP A;  3I71 A;  2DTZ A;  1CF7 B;  2RNJ A;  1B9M A;  2QCO A;  2XUB A;  4PK4 A;  2WAD A;  2LY1 A;  2W82 A;  3WG7 H;  1TQP A;  2V26 A;  3EDP A;  2QZ8 A;  1X1D A;  3MQ0 A;  4KJZ A;  1WJ5 A;  4Q47 A;  2XGX A;  4G6T B;  4P5O A;  2XGC A;  1XMX A;  1EH6 A;  2ZJR F;  3QPS A;  5IP6 A;  2R7X A;  1EH8 A;  3R0A A;  1ZK8 A;  2DI3 A;  3IKT A;  2RAE A;  2LYC A;  1ZG3 A;  4FAS D;  5CQG A;  4U0V A;  3VSL A;  3LA2 A;  3BTI A;  2FF4 A;  2MGQ A;  2BHZ A;  1ZG5 A;  1FSH A;  3LSI A;  1YTY A;  3TGN A;  3SXY A;  4HX4 A;  4UUT A;  4XSX F;  2DA3 A;  1GDT A;  1TTY A;  3ECO A;  2G9W A;  4IRH A;  2GQQ A;  2L3D A;  3LSM A;  4RDU A;  2E5N A;  4B47 A;  3WU1 B;  1XGN A;  4YEJ A;  1FOK A;  3OYH A;  3N05 A;  4P96 A;  2IGK A;  3M8F A;  1TQM A;  2E1O A;  4UB6 C;  4Y3O A;  1OMI A;  2YX4 A;  2V79 A;  2FNA A;  4PSW A;  2O0Y A;  3ZQ7 A;  2EJR A;  3L1P A;  2X0L A;  4XKC A;  2OJE D;  3O8H A;  4XIC A;  4IHX A;  3RKX A;  1K7A A;  3RKY A;  2XAH A;  3DF8 A;  2VT3 A;  1TQI A;  1I3A A;  1IN8 A;  2PFB A;  3F8N A;  4HZF A;  4RB3 C;  2EIJ H;  1J75 A;  1LUJ B;  2LNB A;  3IHU A;  1YOV B;  4I76 A;  2MC4 A;  4XLF A;  1YHQ I;  1R00 A;  1WSU A;  3ABM H;  5FRN A;  3A2K A;  2F5E A;  1W36 C;  3KIO A;  3ZCO A;  2L4A A;  3HHG A;  1OPC A;  5KK1 A;  4BQN A;  2XRO A;  4LFU A;  3G71 I;  2VXD A;  4U0Y A;  1LPQ A;  2E36 A;  2WB1 A;  3H5R A;  3S1M J;  3GW2 A;  2W84 A;  4Y7N J;  1TNT A;  3BZK A;  4HA8 A;  3ZR8 X;  3I55 I;  3RSN A;  2GLO A;  2EH3 A;  1OR7 A;  3DWL E;  3ZGK A;  2F5V A;  4FE7 A;  1IV6 A;  3PL8 A;  4YFK F;  1ZRD A;  1SFU A;  4AC0 A;  1W1W E;  1LFB A;  2VQL A;  4XNF A;  4ZYG A;  4KN4 X;  2RQQ A;  2PX9 A;  2PMH A;  2W4S A;  5L3G A;  5LHG A;  2CQX A;  4RS8 A;  3J7Y J;  1U0J A;  1VF9 A;  3ASN H;  3MFK A;  5LGU A;  1X3Z B;  4DZJ A;  3AG4 H;  2CO5 A;  2F4O B;  2LVS A;  5FKK A;  1ZQ3 P;  2B63 J;  4GGG A;  4CHU A;  4QSH A;  1MMD A;  2CGP A;  3ZMZ A;  3BC8 A;  3GXO A;  3QP5 A;  5D4R A;  1W7P B;  1LFP A;  2OZ6 A;  2DO7 A;  2NS0 A;  2P5K A;  3HL2 A;  1A04 A;  2ECB A;  2DT5 A;  4ANJ A;  3A03 A;  4Y15 A;  1YW8 A;  2MC3 A;  2PN6 A;  2ME6 A;  5ILS A;  2LD5 A;  3Q3S A;  2K40 A;  1D0Z A;  3CCL I;  2V9P A;  4PUS A;  3DU5 A;  2ZFU A;  1FMV A;  2QF7 A;  4U0W A;  2VXZ A;  2ISZ A;  2O03 A;  1APL C;  2KDO A;  4HG2 A;  2LH9 A;  3BPX A;  4UV8 A;  1YS6 A;  3CCS I;  2R7O A;  1JHH A;  3MAJ A;  4BE1 A;  3HKZ A;  2X51 A;  3OYJ A;  3DU6 A;  5FKM A;  3SFI A;  1RUN A;  2AS5 F;  5EG0 A;  4HYE A;  2L7M P;  4GDF A;  4KUM A;  1TWH J;  4MFD A;  2V1D A;  3OS0 A;  2LBF A;  5A2Q Z;  5LGT A;  2HXO A;  2X9D A;  3ELK A;  3BG7 A;  3NWT A;  3BOQ A;  4HBL A;  2JVH A;  4EVI A;  2BW3 B;  4A3L J;  1OYY A;  1D1A A;  5L3C A;  1W4M A;  2FA5 A;  4KN7 X;  3LA7 A;  2X1C A;  2KKO A;  3TO6 A;  4KIC A;  2AHQ A;  2HQ5 A;  5F1J A;  2R7D A;  2K9S A;  1H8A C;  3MD2 A;  1PDN C;  2FBK A;  3RCO A;  5DCM A;  3PO3 J;  1OJL A;  4E7I A;  2DA6 A;  3RKW A;  4HEA 2;  2P4W A;  3WOD F;  3V4G A;  1VQO I;  5ICF A;  1BC7 C;  1U9O A;  2ECC A;  4EJT A;  1IG7 A;  3QOP A;  3L7W A;  3L00 A;  2DT6 A;  3Q0U A;  1FT9 A;  4OWR B;  3T8R A;  2HOE A;  3ROU A;  1B72 A;  3CF5 F;  3HZJ A;  3BPV A;  1IJW C;  4LOC A;  5L3B A;  5C4X J;  2PEX A;  2HYJ A;  1B59 A;  3KFW X;  4IHS A;  2L9V A;  1HA8 A; 
#chains in the Genus database with same CATH homology
 3UKG A;  1ETK A;  3I4M J;  2LY9 A;  3MN2 A;  2DMN A;  4MO7 A;  2IEK A;  2L7Z A;  2NS8 A;  3BG3 A;  3VPR A;  1U78 A;  1MNM C;  5K7F A;  1UHS A;  2AO9 A;  1B8I A;  2XPW A;  2O7O A;  1UMQ A;  2CUF A;  2DJN A;  4M3G A;  4B1R A;  1U8B A;  3GTL J;  1ENH A;  3C2B A;  5FJ8 J;  1FIA A;  3A02 A;  5EG0 B;  1BW5 A;  3G1M A;  4A3C J;  1QVU A;  2MG4 A;  4G12 A;  2G0E A;  1JKQ C;  2LP0 A;  3OSF A;  3JRH A;  3H0G J;  4IHV A;  1A5J A;  4JYK A;  1K61 A;  5C3E J;  1BL0 A;  4M3B A;  5M5W J;  4BBS J;  1NTC A;  4CYC B;  1Y1V J;  1RR7 A;  4DYQ A;  1IGN A;  1MH3 A;  5J1R A;  3JRD A;  2YS9 A;  1SFO J;  4JP0 A;  4JX6 A;  5BNG A;  5E3M A;  3ZQL A;  3A01 B;  3JRC A;  2JA6 J;  1JUS A;  3FIW A;  2XRL A;  4HNV A;  3LSP A;  5GPC A;  3CDL A;  2Y9Y A;  2M9H A;  5FKL A;  3JRF A;  2YU9 J;  3S2H J;  5M5X J;  3TP0 A;  1JT0 A;  3G1O A;  5EF6 A;  3QPL A;  3K7A J;  2LR8 A;  4MLO A;  1YRN B;  3TP3 A;  1P7I A;  1RPW A;  1LE8 A;  2LLK A;  4I6Z A;  2EZL A;  1ETQ A;  2R5Z A;  3CMY A;  3LOC A;  4W1U A;  4A3B J;  2LKX A;  4V2F A;  2CQQ A;  1MBG A;  1WH7 A;  5J3L A;  5IYB J;  3H3V K;  3S1N J;  3HOY J;  2I10 A;  1IUF A;  3B6A A;  2P81 A;  1B8I B;  5J1U A;  1GV2 A;  3GTO J;  5GP9 A;  2VKE A;  1A6I A;  3IH2 A;  3MVP A;  2Y2Z A;  3BR5 A;  4DYR A;  1ITY A;  1E3O C;  5J1Y A;  3M4O J;  4Y52 J;  5M3F J;  4UUS A;  1MBE A;  1GVD A;  5FKN A;  4BBR J;  1HCR A;  2WB1 N;  3BR3 A;  3IH4 A;  3ZOB A;  2EZI A;  2WV1 A;  2YUS A;  1WPK A;  2TRT A;  2ZB9 A;  3S1R J;  5M3M J;  2JN6 A;  1O4X A;  5EDN A;  3JRG A;  4M3E A;  1P7J A;  2HOT A;  2ELK A;  2JMW A;  1IDY A;  2M34 A;  3PM1 A;  4MFE A;  3F0C A;  1I50 J;  1IRZ A;  4ABZ A;  5IYD J;  4DYC A;  1QVT A;  1Z0X A;  1XG1 A;  4BY7 J;  2N8G A;  2H1K A;  3BR0 A;  3M3Y J;  2CJJ A;  5F04 A;  3SDG A;  1CQT A;  5FLV A;  2GBY A;  4D7M A;  4IHY A;  4A3M J;  5C4J J;  1WCM J;  1IC8 A;  2CRG A;  2NVY J;  3GTQ J;  1LFU P;  1JJ6 C;  3FKI J;  2R0Q C;  2K9Q A;  1LE8 B;  1K83 J;  1XS9 A;  3TW6 A;  4BKX A;  3HGY A;  3JRE A;  2R5Z B;  2E2J J;  2E2I J;  5EGO A;  2NVQ J;  3I4N J;  3BTC A;  1BJZ A;  5E3L A;  1HLV A;  3GBG A;  2M8G X;  4GFB A;  4RBO A;  1ZR4 A;  5EZG A;  2HXI A;  1NK2 P;  2MW8 A;  1JTX A;  1DU6 A;  3WHB A;  1ETX A;  5DS9 A;  1GUU A;  5F0H A;  3HKZ N;  3SJM A;  3Q0W A;  4QTR A;  2DMQ A;  3BR6 A;  1ETW A;  3O8G A;  3ZQH A;  5IPA A;  2DA7 A;  2K9N A;  1JUP A;  1X58 A;  4UUS B;  2VUM J;  1F43 A;  1JTY A;  1VI0 A;  3IH3 A;  4XRS G;  5IOY A;  9ANT A;  2XSD C;  3S15 J;  1Y1W J;  1ZGW A;  1S7E A;  2M2E A;  2VI6 A;  3ZQC A;  2FJ1 A;  2OPT A;  2Y9Z A;  1TC3 C;  2JK3 A;  2R92 J;  2DMU A;  1W0U A;  1MSF C;  3E7L A;  3DEW A;  4M3D A;  3FK6 A;  3GTJ J;  2XGE A;  4FTH A;  1WH5 A;  3BG9 A;  1MSE C;  2W48 A;  3K2A A;  3JR9 A;  1GT0 C;  2MSY A;  4FIS A;  1ZKG A;  4DW6 A;  2JWT A;  4XK4 A;  3HM5 A;  1JGG A;  4A69 C;  1HDD C;  3FK7 A;  1F36 A;  3HGG A;  3NAR A;  2Y0S N;  4DZP A;  2OF7 A;  1T33 A;  3HBL A;  1PUF A;  5IOZ A;  2ID3 A;  1B72 B;  4AUX A;  4A3J J;  2DN0 A;  1H88 C;  2DA4 A;  4A3D J;  3W6V A;  3RZO J;  3HDD A;  4A3F J;  1UG2 A;  5HOD A;  2XB0 X;  2X48 A;  3Q0V A;  1G2H A;  2NOG A;  5EGO B;  3LSG A;  2XPU A;  3HOU J;  2LK2 A;  2XPV A;  2R93 J;  1TWC J;  1RKW A;  5E3N A;  1FTT A;  4C3H J;  4MIM A;  1XC5 A;  2IBD A;  3ZQI A;  1AKH A;  2D5V A;  1FIP A;  1JJ8 C;  2KT0 A;  3RKQ A;  1T56 A;  2FX0 A;  3BR1 A;  4C3J J;  3D1N I;  3RZD J;  3BQZ A;  1QRY A;  1ZTR A;  3CCY A;  1H89 C;  2DTZ A;  4JX4 A;  2QCO A;  2DMT A;  1EF4 A;  2GM4 A;  3FIS A;  1I6H J;  1U9N A;  1VND A;  2O8K A;  1Q1V A;  3HEF A;  2XGC A;  3HOZ J;  3QPS A;  3LSJ A;  5IP6 A;  1GV5 A;  1MH4 A;  1FTZ A;  2O9L A;  3TED A;  1ZK8 A;  1MBH A;  1HDP A;  2RAE A;  2VPR A;  3G1L A;  3IV5 A;  5DTD A;  3BR2 A;  1R9T J;  3LSR A;  1PUF B;  2JJ7 A;  3GTG J;  4X1E A;  2Y30 A;  3BTI A;  3ZQF A;  2MGQ A;  2VKV A;  1JKO C;  2FQ4 A;  3PO2 J;  5FKO A;  4UUT A;  2DA3 A;  3GTK J;  1ETO A;  1GDT A;  4XRS A;  1I3Q J;  4IHW A;  2IAI A;  4RDU A;  5C44 J;  2LFB A;  4FE4 A;  4QIW N;  2Y31 A;  2E1O A;  2EQR A;  3HOX J;  2CUE A;  2FD5 A;  3OIO A;  3BG5 A;  1AU7 A;  1TWG J;  3L1P A;  1HF0 A;  1AKH B;  5K7H A;  3O8H A;  4XID A;  4XIC A;  2NVX J;  4IHX A;  4M3F A;  1BW6 A;  1OFC X;  3JRI A;  3CQZ J;  1MBK A;  2ID6 A;  5FLM J;  5IYC J;  3B6C A;  3TW7 A;  1FJL A;  4I76 A;  3LNQ A;  3GTM J;  1IDZ A;  2R5Y A;  2HI3 A;  3S1M J;  2EZK A;  1W0T A;  1TWF J;  4Y7N J;  2M0C A;  3HOW J;  2X6O A;  2GLO A;  4D5C A;  2EH3 A;  1ETV A;  1MBJ A;  1X2N A;  4FE7 A;  1IV6 A;  1WGX A;  3HOV J;  3OSG A;  5EYR A;  3NAU A;  4A93 J;  4AC0 A;  1LFB A;  2L7F P;  2LTP A;  5F08 A;  4AYB N;  3S1Q J;  4X6A J;  4D5F A;  1TWA J;  2CU7 A;  2CQX A;  4J19 A;  5IP7 J;  1VF9 A;  3BT9 A;  3RQI A;  4DZJ A;  2LVS A;  2ME0 A;  5FKK A;  3BTL A;  4L5E A;  2HOA A;  1ZQ3 P;  2B63 J;  2EZH A;  4QSH A;  2R7Z J;  1RES A;  4W97 A;  1SAN A;  5F0C A;  2JA7 J;  1BA5 A;  3MKL A;  2E2H J;  2H8R A;  4A3G J;  3BTJ A;  4B4C A;  4D7N A;  2PMZ N;  2E19 A;  2ECB A;  1JT6 A;  3JRA A;  3A03 A;  5EEA A;  2WAQ N;  2ME6 A;  2LD5 A;  2NVT J;  3Q3S A;  2K40 A;  1WI3 A;  3OOU A;  1ORK A;  3BQY A;  4A3K J;  2QF7 A;  3S16 J;  3DCF A;  2XGD A;  4S0H B;  1JKR C;  1APL C;  2KDZ A;  2HDD A;  1ETY A;  4A3E J;  4C2M J;  4EEF G;  4A3I J;  5EZH A;  1D5Y A;  2EBI A;  4IEJ A;  3HB9 A;  4C3I J;  4BXX J;  2R5Y B;  5FKM A;  3SFI A;  3GTP J;  2JA8 J;  5EG0 A;  2DA2 A;  2L7M P;  1RET A;  2L9R A;  1TWH J;  1MBF A;  4MFD A;  3WHC A;  2DMP A;  5JLX A;  1AHD P;  2HXO A;  2TCT A;  2COB A;  2X9D A;  1OCP A;  5GPA A;  4XRM A;  4M6V A;  1OCT C;  4CYC A;  4BY1 J;  3S2D J;  2L0K A;  1NK3 P;  4A3L J;  5M5Y J;  2XB5 A;  1FEX A;  1Z77 A;  1RKT A;  5E3O A;  5F27 A;  3ZQG A;  1VFC A;  1ZR2 A;  4JX5 A;  2AHQ A;  3JRB A;  2HQ5 A;  5F1J A;  2HOS A;  3QQA A;  3A01 A;  1JUM A;  2K9S A;  1H8A C;  1HOM A;  3PO3 J;  1OJL A;  5K7Z A;  2DA6 A;  1QPI A;  2DA5 A;  4B3A A;  1JKP C;  1U9O A;  2ECC A;  1POG A;  1IG7 A;  1X2M A;  5JLW A;  2NS7 A;  3Q0U A;  5IP9 J;  5F0F A;  1DU0 A;  3S14 J;  4NDL A;  1B72 A;  4FCY A;  1IJW C;  1YRN A;  4LOC A;  3S17 J;  5C4X J;  4V2G A;  2DA1 A;  2JA5 J;  2HYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...