3A03A

Crystal structure of hox11l1 homeodomain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
FSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords T-cell leukemia homeobox protein 2
total genus 19
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2009-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3a03A00
5C3EJ 2XB0X 3A01B 2DA6A 5F04A 4BY7J 1VI0A 3HOUJ 4A3MJ 2FQ4A 2K9SA 1AHDP 2NVXJ 4A3FJ 2E19A 5E3OA 5DTDA 5JLWA 1ETKA 3NARA 2JA6J 3BTJA 5IPAA 3LOCA 1SANA 1PUFB 1XG1A 5E3LA 3WHBA 4XICA 5K7HA 3I4MJ 1ZQ3P 3BR5A 5M3MJ 5M5YJ 4BXXJ 2ELKA 2Y31A 5EYRA 1FIAA 1MBJA 1S7EA 2KDZA 2R5ZB 2LP0A 1IUFA 4D7MA 2JMWA 3K2AA 2L7MP 2EZHA 3BR2A 4AUXA 3NAUA 2DA3A 1Y1VJ 1RKTA 1DU6A 3HGYA 1JTYA 2M34A 2HDDA 1JKQC 2B63J 2DA5A 3JRAA 1P7IA 5J1RA 1A6IA 2I10A 3Q0WA 1ETXA 2X48A 4M6VA 5IP6A 2EH3A 4DZPA 1B72A 5FLMJ 4D7NA 1CQTA 3W6VA 3Q3SA 4DW6A 4XRSG 2QF7A 2CQXA 4CYCA 3JRFA 2WB1N 3BQZA 1U9OA 3F0CA 4MO7A 3S1NJ 2HI3A 2Y9YA 1UMQA 5IYCJ 2EQRA 2EZLA 4Y7NJ 1ETYA 2MGQA 2K9NA 3B6AA 1GDTA 1JGGA 2AHQA 2LY9A 2XPUA 1NTCA 3GTLJ 3TP3A 2ME6A 5FLVA 4DYQA 4DYCA 2VI6A 4QIWN 3H3VK 2MG4A 4JX4A 1WH5A 1Y1WJ 1G2HA 1GV2A 3BR6A 4JYKA 4JX5A 1LE8A 2M8GX 2ECCA 1HF0A 4M3FA 4BBSJ 1JT0A 3WHCA 5J1UA 3QPLA 3ZQGA 5F08A 3RQIA 3BG5A 3ZQHA 1BL0A 2XGCA 1Z77A 1K83J 1VFCA 2TRTA 2H1KA 2TCTA 3GBGA 3Q0VA 2LK2A 1VNDA 2EBIA 1X2MA 2E2JJ 4IHVA 1XC5A 2IEKA 2Y0SN 4J19A 4X1EA 5EDNA 3BQYA 1EF4A 1ETOA 2JA5J 2L7ZA 2D5VA 1TWGJ 2LFBA 2R5YA 1APLC 1B8IA 2CRGA 3S14J 2LD5A 1NK3P 3HOXJ 4LOCA 5JLXA 3G1LA 3S1QJ 3S1MJ 2DMQA 4JP0A 1GUUA 3E7LA 3CQZJ 2DA1A 3RZOJ 2VPRA 2VUMJ 2O8KA 2E2IJ 3OSFA 2ECBA 3S1RJ 4XK4A 1TWCJ 3FK7A 1ZTRA 2LLKA 4A3IJ 1WCMJ 4XRSA 5FKLA 2FD5A 2EZKA 1JT6A 3LSJA 4EEFG 3HOZJ 4UUTA 3B6CA 2NS8A 1JKPC 2W48A 2K9QA 3TW6A 2X6OA 1ZKGA 2OF7A 3MKLA 2Y2ZA 2ID6A 1BW6A 4A93J 1Z0XA 4A3GJ 4FE4A 2ID3A 2NVYJ 3MVPA 5BNGA 2KT0A 3M3YJ 1AU7A 4IEJA 2XPWA 1T56A 5DS9A 1F43A 2VKEA 2IAIA 3BG9A 5EEAA 2DA4A 3QPSA 2OPTA 1O4XA 2H8RA 3GTOJ 1I50J 1BW5A 3HOYJ 3JRGA 2P81A 1YRNA 5EF6A 2CUEA 3S16J 1IGNA 1X2NA 1I6HJ 4V2GA 1RESA 4FTHA 4V2FA 3OIOA 3GTGJ 4A69C 4X6AJ 3RZDJ 1WH7A 2RAEA 5IYBJ 2HXOA 5EGOB 1B72B 4W1UA 5IP7J 3BR3A 2JWTA 1OCPA 1OJLA 1K61A 3SJMA 1IRZA 3CDLA 5EGOA 2JN6A 4XRMA 3S15J 3IH2A 2E2HJ 1WPKA 3DCFA 5FKOA 5F1JA 1JUMA 1HDPA 3BR1A 2R5ZA 1TWAJ 1IV6A 5M5XJ 1WI3A 1BJZA 5EZGA 2L9RA 3SFIA 1RKWA 3BT9A 3HKZN 3MN2A 1MBKA 2XRLA 1YRNB 4B4CA 3A03A 5GPAA 5K7ZA 1IG7A 1BA5A 2MW8A 2COBA 2G0EA 2EZIA 4BBRJ 1HDDC 1JJ8C 3G1OA 3RKQA 2WV1A 2Y9ZA 3O8GA 5FJ8J 1HCRA 2DMTA 5EZHA 3HB9A 2LR8A 4G12A 1TWFJ 3OSGA 2XGDA 3G1MA 2XSDC 2NOGA 1WGXA 1ZK8A 4I76A 1ETQA 2HOTA 2DMPA 3PM1A 5GPCA 1ZR4A 4DYRA 4A3JJ 1XS9A 1IDYA 1MH3A 1I3QJ 1MH4A 1TWHJ 2DTZA 3FK6A 3JRIA 3DEWA 2JA7J 1A5JA 3JRBA 1MSFC 2L0KA 3M4OJ 1FEXA 4Y52J 3C2BA 2M2EA 3IV5A 2LKXA 2CQQA 2E1OA 2CU7A 3GTQJ 5F0FA 5EG0B 3JREA 4AC0A 2N8GA 1ORKA 5HODA 2JA8J 2XPVA 3IH3A 5M3FJ 4A3LJ 4W97A 5C44J 2YS9A 3LSRA 4C3HJ 3TEDA 1ZR2A 1W0TA 3L1PA 1U78A 1QPIA 2Y30A 5FKKA 1GV5A 2L7FP 2JJ7A 3BR0A 2FX0A 4IHYA 5M5WJ 1ZGWA 1FTTA 1JUSA 5IYDJ 1W0UA 1ETVA 4MFDA 4BY1J 2HYJA 3BTLA 1MNMC 4I6ZA 2NVTJ 1IDZA 3QQAA 2X9DA 1PUFA 3VPRA 4IHWA 1QVTA 4A3CJ 3HOVJ 1VF9A 3IH4A 4HNVA 1MBFA 5J1YA 2MSYA 3D1NI 1E3OC 4MFEA 1GVDA 4DZJA 3JRCA 5E3MA 1JTXA 3ZQIA 1P7JA 2XB5A 3HM5A 2M0CA 4S0HB 3TP0A 4D5FA 2R7ZJ 1GT0C 1FJLA 4M3BA 4IHXA 5GP9A 2DN0A 2GM4A 2FJ1A 1QRYA 3HDDA 3HGGA 1JKOC 5EG0A 3GTKJ 2LTPA 3S17J 4A3BJ 1B8IB 3S2HJ 1LFBA 2R92J 3FIWA 1MBEA 2IBDA 1HOMA 2XGEA 1NK2P 1H89C 1Q1VA 1LE8B 1JJ6C 1H88C 2AO9A 4AYBN 3CCYA 3LSPA 2R0QC 1LFUP 2CUFA 1MBHA 5F0CA 3Q0UA 3ZOBA 2R93J 4CYCB 2QCOA 3CMYA 1D5YA 2GLOA 2O7OA 2ZB9A 4GFBA 4FCYA 1U9NA 4B1RA 3K7AJ 4C3JJ 3H0GJ 5E3NA 5K7FA 5IP9J 4RDUA 1X58A 3HBLA 1AKHA 1OCTC 5IOYA 3PO3J 1H8AC 2K40A 5F27A 4A3DJ 3ZQFA 3GTPJ 2HQ5A 3O8HA 3JR9A 2O9LA 4FISA 4UUSA 1HLVA 2VKVA 1FTZA 4XIDA 2DA2A 4C2MJ 2PMZN 4M3GA 1ENHA 1IJWC 1MSEC 3BTCA 5FKMA 1UG2A 4ABZA 1DU0A 1SFOJ 3JRDA 4QSHA 1ETWA 1TC3C 3ZQCA 4B3AA 3BG3A 3HEFA 9ANTA 4MIMA 4RBOA 1FIPA 1T33A 2DJNA 1MBGA 1POGA 2DMUA 4C3IJ 1RETA 4MLOA 2ME0A 3LNQA 3GTMJ 4NDLA 3UKGA 2JK3A 1U8BA 2R5YB 4M3DA 3PO2J 5FKNA 3S2DJ 1AKHB 3I4NJ 3HOWJ 1ITYA 2HOSA 2DA7A 2NVQJ 5C4JJ 5J3LA 4FE7A 2HXIA 1UHSA 1JUPA 3A02A 4M3EA 2NS7A 3BTIA 2CJJA 5F0HA 3TW7A 5IOZA 2WAQN 2YUSA 1IC8A 3OOUA 2YU9J 2HOAA 1QVUA 1R9TJ 2GBYA 3GTJJ 2DMNA 4L5EA 3ZQLA 1JKRC 4UUSB 1F36A 3JRHA 2M9HA 1OFCX 2LVSA 4A3EJ 4JX6A 3FISA 4QTRA 4A3KJ 5C4XJ 3A01A 1RR7A 3LSGA 4D5CA 3FKIJ 4BKXA 1RPWA 3SDGA
chains in the Genus database with same CATH superfamily
3AFHA 2XB0X 1IXRC 1HQCA 2L4MA 2OQRA 2XF5A 4A5NA 2HS5A 4ASNA 2FOWA 2AXTC 2FQ4A 2MLKA 5H6RA 3WE3A 2NAZA 3OIQA 2COMA 2HKXA 1ETKA 2CGPA 1B6AA 4OIQF 3LOCA 4EMSA 1PUFB 2X0LA 3WHBA 4XICA 4IQJA 5K7HA 4YG2F 3I4MJ 3MMYB 3DBLB 3BR5A 2P7VB 4BXXJ 4OINF 3PL8A 1BOBA 2F5DA 3M8FA 1MBJA 1D1CA 2KMUA 2PFBA 2V1XA 3OL3A 4D7MA 3E5UA 1NG6A 1PP8F 2V1DA 5KVRA 4RGSA 1EA3A 2LH9A 2EZHA 4AUXA 3NAUA 3ERMA 1MIJA 3FXRA 2M34A 2HDDA 2JVGA 1JKQC 3MQ0A 2VC1A 1ZLKA 2I10A 3VOEA 3RPUA 1KU2A 1VQ9I 1W5TA 3H35A 2HEOA 1WJCA 3CD6I 2CV2A 3SDBA 1B72A 3F21A 4D7NA 1DPRA 3W6VA 3Q3SA 2AQEA 3BQZA 4MO7A 3S1NJ 3MD2A 4CZCA 1HW1A 2CUZA 2V79A 2HI3A 2ELJA 1UMQA 1GHCA 1ZREA 2VOOA 2EQRA 2EZLA 1X1BA 3ZQ7A 3DWLE 4HQMA 2GXBA 2OV7A 1RUOA 1TQIA 1X4OA 1TBXA 2RV8A 2EA4A 2XPUA 2Z16A 1J59A 2GAUA 2MBFA 1E0EA 1ODDA 4DYQA 3H5RA 4I09A 4P96A 1K4SA 4JX4A 1Y1WJ 1G2HA 2K02A 4EJWA 3BR6A 2F5EA 4JYKA 4L18B 5LBQA 1WRJA 3QYEA 4M3FA 1P4AA 3E3VA 1ZLJA 3WHCA 4IOCF 2DT7B 3QPTA 3BG5A 5B5EC 1U5TB 3M07A 5D5VB 2HZTA 3VYSB 3Q0VA 5BS6A 5CVVA 3F8NA 2E2JJ 1X2MA 3R0AA 3OYEA 5DUKA 1PJRA 3RKYA 1YIJI 2OC6A 3N05A 1BIAA 2JA5J 2TDXA 1MNDA 4KFCA 4LLNA 2LFBA 2R5YA 1APLC 2JVHA 2WWYA 3IP4B 3BROA 4XM3A 4BL0B 4RGUA 2MLGA 3TQNA 1XN7A 1V55H 3HXLA 3HOXJ 4LOCA 4EATA 2HZDA 4YIFA 4KISA 2PN6A 1IUYA 1Z6TA 2X85A 1FY7A 1GUUA 1WFXA 3OYDA 2HQAA 3J7YJ 4KIFA 4ANJA 2Z99A 2KIMA 2VBWA 2O8KA 4A6DA 2E2IJ 3TDUC 2ELHA 4A3IJ 1SC7A 2XGXA 4FASD 2Z3YA 4M73A 2H94A 3CCRI 2V6EA 3LSJA 2VB6A 2ZJQF 3T5XA 2EJRA 1FBUA 2RNJA 2IP2A 1JKPC 2DAOA 1BC8C 4ENMA 4BQOA 2QGUA 3O3KA 3LSMA 1CF7B 4UVAA 5GAGJ 3CCVI 2ID6A 2DQRA 2K4JA 2WTEA 4OWRB 1WJAA 3CZ6A 2VODA 4BAYA 1RC9A 2ID3A 1TNSA 4IZZA 4ZTJA 3M3YJ 4IRGA 1EH7A 2MFZA 4IEJA 4BQQA 1T56A 5DUIA 3CMAI 1XPXA 2FNPA 2VKEA 5K1YA 4WWCA 3RCOA 2XRNA 1R36A 2K85A 5GAHJ 3I71A 3J81Z 3ABLH 2BVLA 2MYSA 1QQIA 2ZMEA 3K6GA 3TOBA 4IOAF 2P81A 2MA3A 1K78A 3I0TA 1FMVA 4CICA 3S16J 4I01A 1YFHA 3TO9A 4GYIA 2STTA 4V2FA 2M7AA 4A69C 4RAGA 4PJLA 3T8TA 2VQHA 3RZDJ 5EJCA 2LF7A 2DYSH 1WH7A 2DOFA 5LEJA 2HXOA 1VQKI 5IP7J 2RDPA 3BR3A 5K5QA 1K61A 3L09A 5FRNA 3GZNB 3QU3A 1UJ8A 1K78B 2YX7A 3S15J 4P9UA 5FKOA 1IV6A 2CMPA 1TWAJ 2R7OA 3QOEA 1YJNI 2R7VA 1WVRA 1D8JA 1WI3A 3UNGC 1BJZA 3G4SI 2KKOA 2L9RA 4LJZF 2DPDA 1MBKA 1SVLA 1S3JA 2IGOA 2R7RA 4B4CA 1XGSA 2G0EA 2EZIA 3FBIB 1HDDC 3OR1C 1SD4A 1T38A 2CFXA 2NS0A 4YELA 4CXFA 3Q5FA 1O57A 3RKQA 2WV1A 3CCSI 2W82A 4F93B 4IRIA 4KITB 2FF4A 4CCNA 2HPMA 1U3EM 3QRFF 4IX7A 1VQ4I 3OSGA 2XGDA 3A1YA 3G1MA 2P0WA 2K86A 4BE2A 2DLLA 2XSDC 1ACIA 4QPQA 4I76A 2HR3A 4H4KC 2HOTA 3PM1A 1AA7A 2K9MA 3KE2A 2O3FA 1IDYA 3KCCA 2LDUA 1I3QJ 3KP5A 1S6LA 1TWHJ 2VBYA 3LSKA 2DOAA 4HF2A 1A36A 1Q1HA 3DEWA 4OAZA 3TGNA 4EV0A 1BJAA 1MSFC 1R1TA 1B9NA 1UB9A 1FBQA 4Y4RA 2E1OA 5HLHA 2ZXJA 5A2QK 2OTLI 2CU7A 3GTQJ 1RR8C 5F0FA 5EG0B 2D1VA 2ZMEB 3NRVA 4IJAA 5HODA 1HKSA 4ZTFA 5BPIA 1REPC 2XPVA 2MD0A 1XGMA 4A3LJ 1RI7A 1R4MB 1WJFA 5C44J 3LSRA 3E5XA 4PJNA 1U78A 2WB1A 5FFZA 3BG7A 1V3FA 2PBIA 3REOA 3JTHA 5TGTA 4UHTA 4XBFA 1STZA 2M1BA 3WG7H 2QQ8A 2XF6A 4EQQA 3GFIA 3JCUC 5IYDJ 5CPRB 1FYMA 3P9IA 4MFDA 2QVOA 3K4MA 3GZ6A 3CUQC 4HEA2 3S3NA 3ULQB 4UV9A 5HLGA 3PSIA 2HKOA 1U5TC 3DV8A 4I02A 2EA2A 2PMUA 4LLLA 5HDKA 3J80K 3CC4I 3HOVJ 2H6BA 5L3CA 1DP7P 5J4YA 2EILH 1R1VA 1XSVA 2A6HF 2ICWG 3D1NI 3IKTA 3E6DA 2HU9A 3BC8A 4L9JA 2M0CA 1G3WA 3TP0A 2R7ZJ 5LHIA 1FYLA 4XR6A 3BJ6A 5FD6A 2Q8KA 1J0RA 1JKOC 2DO7A 5J4VA 2XF7A 4N9HA 1QGPA 3S2HJ 1LFBA 4V19K 4LB6B 2LC2A 1T0FA 2DK8A 4CCJA 1HOMA 2XGEA 3I64A 3C7JA 1H89C 3CDHA 3CJQB 1LE8B 3J7AY 4BUPA 2XAQA 1ZHFA 1FP2A 1NG7A 3LSPA 1YLFA 4JK1X 4HSRA 1QHHD 2CUFA 1TZLA 2WAFA 2VIXA 1FOKA 1D5YA 1U8RA 4BHPA 4FCYA 4LB5A 4B1RA 1YG2A 2YX4A 3LFKA 4ENJA 1X1AA 4I99C 3GWZA 4ON0A 3TBIA 4M9SA 3FXOA 5E3NA 5CQEA 5K7FA 2AQFA 3PFYA 2D1HA 1IN4A 3HKZA 3HUGA 4Y33A 1Y56A 4UXNA 3I58A 2VASA 2HQ5A 3ABTA 3O8HA 4RM2A 3HSFA 4UB6C 4U88A 1S7OA 5HOOA 2O9LA 2VONA 3GW2A 4LGWA 2IA1A 5FD5A 1HLVA 2CV0A 4XIDA 3SYTA 2RC4A 3HRUA 4M3GA 1ENHA 1IJWC 4XLNF 4HF0A 2VE9A 3CF5F 2BZTA 3GF2A 1HBXG 3OYLA 1DU0A 1QU3A 3JRDA 1NHAA 1ETWA 3H3UA 2Y75A 3ZMVA 4YFNF 4B3AA 4C2TA 4P5OA 2QSGX 2P5VA 4MIMA 5ICEA 1DPUA 1FIPA 1XX5A 4A0XA 1FLIA 2G7UA 4E6KG 3J7AO 1YX3A 1MBGA 3GFMA 1POGA 2R7DA 3GTMJ 2DK5A 4M6XA 1U8BA 4M3DA 3PO2J 2M30A 2FMLA 3OYKA 1S72I 1UG0A 2FU4A 3HOWJ 4XNFA 2HOSA 1MMAA 3HOTA 2GOMA 2QSFX 2VBXA 4KIBA 4R1HA 4AVZA 3FXKA 1KQ8A 4RA2A 1VQPI 3BZ6A 1MNEA 2HXIA 3QAHA 5GTHC 1PUEE 4M3EA 4AIDA 3M9AA 4ZDLA 2BHZA 5F0HA 2JZYA 3UR3C 1X19A 1ZH5A 4LITA 3TO6A 2XASA 3F6VA 3V7SA 3DU6A 2WAQN 3W2WA 5IOZA 1Y39A 1O7LA 2H6CA 3IL2A 1MMGA 2XDVA 3HHGA 2H1LA 2K9LA 3MEXA 3FHNA 3DPUA 2GBYA 4L5EA 2EFQA 4KN7X 3CO7C 4KICA 5FB2A 4ESFA 3C2HA 3JRHA 3GX4X 5GAEJ 4JX6A 2MH2A 2A69F 4I0BA 4A3KJ 2UXNA 3LL7A 4FQGA 3DKWA 1ZRFA 4FX0A 4U7BA 3SZPA 1RR7A 4DQ2A 4BKXA 1TP4A 3SDGA 5A2QZ 3IRRA 2Q2EA 4XKVA 3D5RC 5F04A 4MEXF 5E8GA 3ELKA 2MD5A 1Z21A 2K9SA 2KL4A 2B9SA 2NVXJ 3U1KA 4Z2YA 3JAMZ 5JLWA 4E7SA 3BTJA 2DT6A 5HDGA 4Q5SF 2PX9A 2CWEA 2EIMH 5IPAA 4NQWB 1G3YA 4ITVA 2M0MA 3CJTB 4HSTA 1ZQ3P 3HSEA 2X6XA 5M3MJ 1R5GA 3RTRA 4KT6A 1TQPA 3C3WA 2Y31A 3O2PE 4GGGA 3WTYC 1RNLA 1XD7A 2KDZA 3ZP5A 1E3HA 1S9HA 4G94A 3BY6A 3ECHA 1VTNC 3PUBA 4R79A 2L7MP 4HDUA 2DA3A 1RKTA 3K2ZA 1VQ7I 4PJJA 5K5RA 4ZDOA 1JTYA 4HX8A 1DU6A 2OJED 4WF2A 3JRAA 1A6IA 3HHHA 1WJEA 4HV6A 1USSA 1TT0A 3S32A 3U21A 3W6JB 3Q0WA 2A07F 4BDZA 2XROA 4M6VA 4DZPA 2CV1A 1KU9A 5FLMJ 2CH0A 1P9QC 4FT8A 1ONVA 1D8KA 1YW8A 4DW6A 1CQTA 4F55A 1B1BA 5D8LB 3F8FA 4GO1A 4BE1A 1MJ9A 1U9OA 2DDAA 4XQFA 5IYCJ 5E17F 4RB3C 1HSJA 4Y7NJ 2ETHA 4PCQA 1ETYA 1FSEA 2MGQA 3IWFA 3C1DA 5KCMA 3WGGA 1JGGA 4M9ZA 2D45A 3HYIA 1I5ZA 3LSIA 3T1BA 3R61A 4DBQA 1YYVA 4DYCA 4AD9A 3MKWB 1GXQA 5JR3A 2QZ8A 2X51A 4FX4A 2HDWA 3L2CA 3S3MA 1GV2A 2KRFA 1K4TA 4BJ5C 2ECCA 5CVUA 3D5LA 2XKPA 3G71I 3CO6C 3ZQHA 4KMFA 1UCRA 2TRTA 2ZJPF 2LK2A 1VNDA 2E1MC 4OIRF 2EV5A 2IEKA 2Y0SN 4J19A 3ZCOA 1TW2A 1IRGA 3FHZA 2CW8A 3L2QA 1YS7A 2NOJB 4A0YA 1YE9A 4AIHA 2AXLA 2F5FA 4N4NB 5D6EA 3S14J 2V9VA 4IHTA 4M72A 2M4KA 3OYJA 1CGPA 3F23A 1TNTA 3QODA 4LG3A 4PGGA 3S1QJ 2X6YA 3G1LA 4MHGA 3ZXSA 3S1MJ 2DMQA 3GFJA 2PLYA 2L3DA 3PIOF 4B3XA 2KRHA 2ZMEC 4EM2A 1EV7A 1W1WE 2F5CA 2XAGA 3RZOJ 4CH7A 2ZC2A 4C30A 4AIJA 3S93A 3OIPA 5L3FA 1QZYA 1TWCJ 3LQRA 4Q4ZF 2FOKA 4ZYHA 3K0LA 1IZ1A 1WCMJ 2F5VA 4Y13A 1D1BA 5FKLA 2LBFB 3FZVA 1JT6A 1DP3A 4GRIA 4Y15A 4AWXB 4LD5A 3VFZA 3HOZJ 2A5WA 1P4XA 2JSPA 3B6CA 2NNNA 2WAEA 2W48A 2K9QA 1XSXA 2Y0MA 1ZKGA 2OF7A 3MKLA 2E34A 1YIOA 3V42A 1PYVA 3CUQB 1X1CA 1Z7UA 2WY7Q 3L2WA 1VQ6I 2E1CA 4FE4A 3V8JA 4DOZA 3T8RA 2F4MB 5BNGA 4EVIA 4U87A 1I1SA 2XPWA 2E7WA 3QPHA 5DS9A 4MNUA 1F43A 2XAFA 1X3ZB 4EM1A 2IS6A 3QPSA 3K1MA 2J5OA 2KLOA 3NWTA 2H8RA 2QSHX 3GTOJ 2D2WA 1ZRCA 3TDZC 3HOYJ 5FLXK 1YRNA 4WK8F 2FE3A 5HVQC 3CJNA 4P1WA 1V5EA 1O3SA 1RESA 3Q9VA 5LFAA 3EYIA 1O7FA 3B02A 1WJ5A 2VN2A 1ZYRF 3GUDA 4X6AJ 5AIPA 2FSWA 3ABMH 4HZFA 5D5XB 2OTJI 1SFXA 1BC7C 4W1UA 2JRTA 4CA0A 4UVBA 3IAS2 3ECOA 3CDLA 3V4GA 1MDMB 4XSZF 2JN6A 3LWFA 1X1PA 4XRMA 2O6GE 5ERIA 3EETA 5F1JA 1JUMA 1HDPA 2FBKA 5M5XJ 2KIUA 3RYRA 2CW0F 3RJPA 1XDUA 2V1UA 3MN2A 3PQKA 2PJPA 2XRLA 1YRNB 5D8KB 1D0ZA 1UFMA 3SEQA 5DCMB 3HL2A 2BE5F 1PDNC 2AS5F 3EUAA 4MQ9F 4BBRJ 2R7SA 1JJ8C 2PJRA 5F1RA 1GVJA 3JTGA 2EV6A 2OUMA 2DMTA 5JHFA 4AM3A 3FWEA 3COAC 2QA4I 3H1CA 1U0JA 3F6OA 3E6MA 3WU1B 3O6BB 3FMRA 2HGCA 2JSCA 3LAJA 5HNFA 2OZUA 1ETQA 2DMPA 1TL8A 5GPCA 1XS9A 2VKHA 1R4NB 3HPHA 1MH3A 4EJOA 2OBPA 1MH4A 3HSRA 1X1DA 3RQ4A 1DGRM 1VQOI 5BQTA 2HFHA 1XB4A 1IN6A 4NC6A 4FETA 2VBZA 2ZSHB 3AG3H 4I98B 4DGWB 5TRDA 2L0KA 5D5UB 1YHQI 1FMWA 3H3ZA 1XGOA 2R7FA 1ZRDA 3IV5A 1MDMA 2MH9A 4BQNA 5EEGA 2JUCA 3ASNH 3OY9A 1S5LC 1ORKA 2N8GA 5ICCA 3FMSA 2V4JC 5ILSA 1D0XA 3IH3A 3E6BA 3DPLC 4UVCA 4W97A 1T95A 3Q9SA 1KYWA 4C3HJ 3L1PA 2ZCWA 3L7WA 5CVRA 5IT3A 2Y30A 2RKHA 2JUGA 1GV5A 2V9KA 1ZGJA 3F9KA 2WADA 1KONA 2L7FP 1J2XA 2CG4A 3S2WA 3HZJA 4KT5C 2L9VA 1XDSA 1MGTA 1ZGWA 5E1XA 1JUSA 2RN7A 1MJAA 1ETVA 4E7JA 3R4KA 3KPHA 5LHGA 2Z5UA 4LG0A 1WZ2A 1SD7A 2X9DA 1S8NA 4XLCA 2W85A 3NEUA 2PJRB 4OOIA 3LSHA 3KLNA 1W7PA 2LKSA 1VF9A 2A6TA 3G73A 2DI3A 4BHBA 3I5UA 5DM6F 4HNVA 4BEHA 5J1YA 4L0YB 1BM9A 2YR2A 3J81K 4BXFA 4NC8A 5KHDA 3JRCA 3I4PA 1LDJA 2H27A 2V1NA 1JTXA 4G8XA 4JOMA 4S0HB 2W24A 4PJ0C 1GT0C 1FJLA 3CUOA 2P6TA 4G6QA 4EGZA 3ZQQA 4BJ6C 4M3BA 4O6JA 4KA4A 1SAUA 2HVQA 3U1DA 2DN0A 2GM4A 4UNOA 2PMZA 2E36A 1QRYA 3QWLA 3P9CA 4ZYGA 3K4CA 3KZIC 2LTPA 3S17J 4A3BJ 1W7PB 1B8IB 2X1CA 5DEQA 4BU2A 2R92J 2LSOA 1MBEA 2O5RA 1ZAOA 1GXPA 4I7HA 2RQQA 2A6EF 3LA3A 4R8HA 1JJ6C 2OZ6A 2AO9A 3L00A 4OU0A 3MCZA 2W57A 2R0QC 3AG4H 2M7BA 2Y48A 2LNBA 5F0CA 3Q0UA 2R93J 4CCKA 2LRDA 2O7OA 2GA1A 5BMZA 2QQBA 4BH9A 2QM3A 3TL4X 1OMIA 1MW7A 1Z9CA 1XCBA 3IHUA 2IA2A 3H0GJ 2GOXB 1CF7A 3F8CA 2UXXA 3ASOH 2JA2A 3D5SC 3LA7A 4RDUA 2DPUA 2M3AA 4HYEA 3CCLI 3JSOA 2IJLA 1OCTC 2UWMA 3RI4A 4LMYA 1HW2A 3GTPJ 3QYFA 4JQFA 3G6EI 2CUJA 2CSOA 4FISA 4DNCA 2VKVA 2HQNA 5EEHA 2ZFWA 5L3EA 1H9TA 1E3PA 1EH6A 2DA2A 4C2MJ 5JVGF 2IA0A 1FOWA 3OV8A 1T0FC 5FKMA 5FLXZ 4ZYDA 1UG2A 4ABZA 2FUG2 3C18A 5H6QA 3I59B 1T08B 4NQWA 2NYXA 5D5WB 4LK1F 1LPQA 2ZBKA 2JTVA 3BG3A 3HEFA 2K5CA 4RBOA 2FNAA 5DD8A 3W3CA 2G9WA 1N75A 2EV0A 3AL0B 2DMUA 2WBMA 3IUOA 1RETA 5AONA 4F3QA 4HRIA 4ZYEA 2QBYB 4E4HA 2R5YB 1C0WA 3S2DJ 3GMEA 4Y3OA 3DKYA 1AKHB 3I4NJ 4IO9F 4HAMA 1MKMA 5H2FC 2Z1DA 5TJJA 5HS8A 4NUBA 4UUVA 5C4JJ 1P4WA 4II2A 5J3LA 2ZSIB 2JT1A 3KYLA 4B44A 1UHSA 3A02A 1OCZH 2NS7A 3BTIA 3WTUC 4B43A 1S29A 4ZYAA 4B47A 4RS8A 3ZMUA 1MJBA 1D0YA 3P5JA 1M1EB 3F3XA 1LNWA 1UHMA 3DU5A 3OOUA 1IC8A 3KX2A 1W5SA 3GZ5A 1QVUA 1YOVB 4DIQA 3SEZA 1R9TJ 3GTJJ 1FBSA 3ZQLA 1JKRC 2R4GA 4QPOA 4ZZDA 1OFCX 3PNYA 1NH3A 3FISA 2VE8A 1MMSA 1D5VA 3BPXA 3DTEA 4L9TA 2BEOA 2F4OB 4D5CA 4PSXA 2EFOA 3CJRB 3FKIJ 4OAYA 2XIGA 3RPUD 2DQLA 2DA6A 4E7LA 4BY7J 1I39A 4BHCA 1VI0A 2M4GA 3HOUJ 4A3MJ 5L3DA 4GXOA 4L0ZB 1UELB 1AHDP 3K69A 3HRTA 1JE8A 5DTDA 2K4BA 3KEQA 4PDKA 3WTXC 2JA6J 2CW7A 3DEEA 4YFXF 1TQMA 1R23A 1SANA 5CKTA 4E70A 4RGXA 1YJWI 4RB2C 2LG4A 5M5YJ 3E97A 2ELKA 5EYRA 1G8XA 1S7EA 4M6YA 5ILUA 2VT2A 2LP0A 3KIOA 3AG1H 2JMWA 1LKXA 3CMEI 1XMKA 3BR2A 4UB8C 1I3AA 3K4JA 3H5AA 2NXNB 1Y0NA 1MZBA 3FXQA 2V9PA 2B63J 4BGDA 1RZ4A 5FO5A 3ROUA 3F72A 4A2UA 2ZJ2A 4N4OB 4LIUA 3DTIA 1HA8A 1ETXA 5IP6A 2EH3A 2Z33A 4HQEA 1A6QA 4KNYA 3S8PA 4MTDA 2OAZA 4XRSG 2QF7A 2CQXA 3JRFA 3F0CA 1OYIA 5DV5A 4ZC3A 1B9MA 4HNTA 3K1PA 5E1WA 4D1QA 4OIOF 2IT0A 1R7JA 2QQAA 1W7PD 1SVOA 3MKZA 3ZMSA 3IWZA 2K9NA 3B6AA 4NC7A 2X4HA 3CDIA 4CDGA 3CLOA 3TP3A 2VI6A 4QIWN 2O61A 4D9JA 3A2KA 2XV4S 2ZNZA 1R71A 1F1ZA 2BY0A 2KRCA 2KDOA 3WE2A 1ZARA 2FEZA 1AOYA 1KQ0A 4JX5A 2L4AA 2VJ4A 2OQGA 3HPGA 1HF0A 2M45A 3KP6A 5J1UA 1ZN2A 3BZKA 1FOXA 3GFLA 2NRAC 1ZELA 2UZKA 1H9GA 1K83J 1I6XA 2TCTA 3GBGA 4N9IA 3W6KB 1FZPB 1YS6A 2EBIA 2KPMA 4IHVA 2Q0OA 4D0PA 5LLQA 1U6GA 5EDNA 3BQYA 1B59A 3LMMA 3ZN1A 3HUGB 4PK4A 2XKOA 4XN0A 2D5VA 3CP8A 2ADUA 1V5GA 4L5JA 2CRGA 4HF1A 2L2OA 3KETA 2W1OA 3BJAA 2PMHA 4LFUA 3KEOA 2X1EA 2LD5A 3F8MA 3PFIA 4EM0B 5JLXA 3FXJA 4IXAA 4MGRA 4JP0A 3MZHA 3EUKL 3H36A 3AAFA 1R22A 4XMYA 4ZZLA 2DT5A 1F5TA 1I27A 3CQZJ 1SEUA 3M1EA 4M74A 1N77A 2ZXIA 1XSDA 3S1RJ 2BBYA 2VXDA 3KEYA 1SAXA 5KAIC 3FK7A 3KLOA 4A12A 1ZTRA 2LLKA 1W4MA 1V54H 2R7UA 4U0YA 4EEFG 5B1BH 4ESBA 3OYGA 2QEXI 3OYBA 4UUTA 3ZPLA 4PSWA 5JFRA 2NS8A 3H9JA 2B7EA 3BJOA 3OMYA 4KJZA 2DXIA 3J7ZI 2Z9OA 1Y6IA 5FGMA 3K4NA 5D6FA 4A3GJ 5B3SH 3A0BC 3MVPA 3L2VA 2VPLA 2KT0A 3GYHX 1J5YA 1AU7A 4PUSA 5DD4A 1IXCA 2IVMA 1QNTA 3BG9A 2J5PA 1W36D 3KZYA 3PJRA 1O4XA 1OPCA 1MMDA 3MKYB 1J75A 3CCJI 2L9NA 3LSTA 3TO7A 1LJ9A 5F6FA 3V7CA 2P7CB 2CQKA 2GXAA 2CUEA 1P6RA 1X2NA 4B8XA 3CC7I 1BI2A 3JAMK 3DEUA 2QKLB 4V2GA 2GQQA 2QKMB 5TISC 1OCRH 3OIOA 1BN5A 2GA2A 4EJUA 2ZXWH 3CTAA 3VEPA 2RAEA 1QHGA 5IYBJ 4YRVA 3AG2H 1OCPA 1LVKA 1BR4A 2LKPA 3FM3A 4GDFA 4AIKA 1OJLA 1AWCA 1IRZA 1A04A 1SFUA 3HIFA 4HW0A 4FHTA 3IH2A 1KU3A 1WPKA 2VKDA 3BR1A 2R5ZA 1V4RA 4HDVA 3SHFA 1R5HA 1P2FA 4C9YA 3I55I 5L3GA 1YQAA 3WTVC 1XTAA 5HNHA 1ERDA 1WHUA 1RKWA 3BT9A 3HKZN 3VODA 1F9NA 4LIVA 1Z67A 4XKWA 2CYYA 2K3PA 1S7AA 3C2GA 5GPAA 1IG7A 1VZ0A 5E8IA 2COBA 2P6SA 1LB2A 2KJBA 5B1AH 3G1OA 5ICFA 2V26A 1HCRA 4I0AA 5EZHA 3HB9A 2LR8A 1OR7A 1BI3A 2GIZA 1TWFJ 5JVTA 3EDPA 4TV7A 4IPAA 4CSWA 2F2EA 1JGSA 4IHSA 2NOGA 1WGXA 1R5ID 1ZK8A 2IS1A 4CCLA 3ZMDA 4GCVA 2QYOA 4A6EA 4DYRA 4H0EA 4F7ZA 1PVEA 4CZZA 1FNNA 2HYGD 3IC7A 2DTZA 5IT9K 3JRIA 2IPQX 2XAUA 4KDPA 2P5KA 3JRBA 2F48A 3H9QA 1FX7A 1IF1A 3M4OJ 2DFIA 3RKWA 1FEXA 2M2EA 2Q1ZB 3KP2A 4JBAA 2E71A 2F6CA 2WAQA 3V8LA 2R3SA 3PNVA 3JREA 2VT3A 1Z6RA 4ZJZA 4HX7A 3TMOA 5E18F 1FC3A 3FKJA 3H5NA 1ZR2A 3DXJF 1W0TA 2LREA 5IY5H 5DM7F 4YFKF 3IRQA 2E35A 2ISYA 4HG2A 2JJ7A 2BOLA 1WI9A 2FX0A 2KQRA 3BR0A 3AL0C 3RSNA 5CQGA 3L2UA 1HKQA 5FROA 1W0UA 2HWVA 4S05A 4YIIA 4B48A 1G3SA 4BY1J 2HYJA 3BTLA 1OLTA 3GEZA 5E20A 4CO8A 2NVTJ 4G7OF 1FWZA 5E79C 2IGNA 3EUHC 3CCMI 1JXSA 2QLZA 2ESHA 1R49A 1D3YA 4IHWA 1HKTA 2A68F 5HLIA 4A3CJ 1HXDA 2ESNA 1QZZA 3KP7A 2VJJA 3U2RA 1LUJB 1QZEA 2RVCA 2GZWA 4L9VA 3MZYA 1E3OC 2EFWA 1GVDA 4DZJA 3BZCA 5DYMA 5E3MA 4BDYA 2L54A 1P7JA 3DLAA 3QYBA 2A61A 4OMYA 2E1NA 2FBHA 4WX9A 3OS0A 3ZMZA 4S04A 3HDDA 2EINH 3WTSC 5FRMA 5EG0A 5F64A 1SMYF 3LA2A 1X3UA 3FIWA 2W84A 1O3QA 2QWWA 4DBRA 4GYGA 2IBDA 4J01A 1FP1D 2R7WA 3KZZA 3RIRA 4NNJA 1Q1VA 3K10A 2KJCA 5JHUA 1W5CC 2L5QA 4U0WA 6PAXA 1LFUP 3L9FA 5LHHA 3PNTA 4F92B 4CYCB 2QCOA 3CMYA 2V7FA 4GFBA 3V7RA 1U9NA 1FPQA 2JPBA 4Q48A 1K6OA 1G4DA 3NQOA 4N0BA 4C3JJ 1VQ8I 4RB1A 3DFGA 4UV8A 1IN5A 2MC3A 1X58A 3HBLA 4F52A 2NVUB 1AKHA 1QPMA 2KIFA 4WXCA 2K40A 2BW3A 2WY8Q 2EIJH 3ZQFA 4A3DJ 2VJ5A 4KUMA 5ILVA 3GCMA 2PG4A 1WJBA 2KFDA 4LLGF 1BI0A 3BP8A 2BY2A 4L5IA 1MSEC 3KYDB 1QBJA 3BTCA 4ZH4F 2QUFA 1DGWY 5CYVA 4CGZA 3HG9A 4QSHA 1Z91A 4RAZA 2Z2SB 4G6DA 1TC3C 3SZTA 2IW5A 4BS9A 9ANTA 2WV0A 2W4SA 2CQ7A 3H92A 3CCQI 3HOSA 1IW7F 1T33A 2DJNA 2DOEA 4IRHA 2WA0A 2EWNA 4MLOA 4C3IJ 2ME0A 3LNQA 1KA8A 2M87A 3DF8A 4NDLA 4XLEA 3UKGA 2BXZA 1Y0UA 5GADJ 1JHHA 1XCVA 1EKEA 2XUBA 2JRMA 3OYCA 1ITYA 3LAPA 2DA7A 2NVQJ 2DU9A 3K1NA 1IXSB 5AIQA 4FE7A 5KK1A 1JUPA 4WCGA 4QWQA 2GIVA 2ZKZA 3OS1A 3TW7A 2YUSA 4E7ZA 1SFEA 3ZN0A 2EFPA 1OCCH 3R60A 1E17A 2DDBA 2DFEA 1HW5A 2YU9J 2HOAA 1YW7A 1YO5C 4II3A 4XRFA 2IS4A 4Z6YA 1KU7A 2DMNA 3OWTA 1F36A 3IKVA 2M9HA 5J6XA 4QTRA 5C4XJ 3R0JA 1RIOH 3VDXA 3A01A 2EIKH 1Y8QB 2HNHA 3T0YA 5LGNA 1J09A 1T2KA 3ZQGA 5C3EJ 3A01B 5CJ9A 2ZXHA 3E1SA 1ON2A 3K4BA 1LVAA 5D4SA 5L3BA 3OS2A 2CFOA 4A3FJ 2XAJA 4M9XA 2E19A 5E3OA 5IT9Z 2IS2A 1YTYA 4OIPF 1X4PA 3NARA 1ZGAA 2PI0A 2G7HA 4KN4X 1FSHA 1XG1A 1QA6A 5E3LA 4RB0A 1SD6A 5J8FA 1RUNA 1OKRA 1OQYA 1FIAA 4CYDA 2ISZA 2HPIA 2R5ZB 1IUFA 3OYAA 2LY1A 3ESWB 4XORA 1H0MA 4ETSA 1SFKA 2R7QA 2YU3A 1TTYA 2P8TA 3K2AA 4HV5A 4BXUA 3S3OA 2LOOA 1Y1VJ 4BACA 1QO0D 1YJ9I 1MD0A 3HGYA 1HSTA 2DODA 4C2UA 1Z7LA 3KFWX 3SQNA 4B09A 3M7GA 2V6CA 4WXHA 2DA5A 1P7IA 5J1RA 2A3SA 1BR2A 4Y17A 3BOQA 1DUXC 2L01A 2X48A 3DBRB 4KMUX 4K2EA 1N78A 4LK0F 1OR7C 1RRJA 2DTRA 4CYCA 2IGKA 2WB1N 3K70C 3QU6A 2PEXA 1IN7A 1BIBA 2YPRA 2Y9YA 4IQ4A 4MTEA 3I59A 2LBFA 2HTJA 2QENA 2ACJA 2K3FA 3FF5A 3WODF 2CO5A 1ZG3A 4J00A 1IV8A 3HJEA 1GDTA 2AHQA 2LY9A 4PZJA 1R1UA 1A31A 1NTCA 3GTLJ 4DJAA 3WGIA 2ME6A 5FLVA 1EJ9A 1OYYA 3H3VK 3DP7A 2L02A 5LGTA 2MG4A 4HX4A 1LQ1A 2OCCH 1WH5A 2X6WA 3G3ZA 4YEJA 3CESA 2LY2A 4O5VA 1LE8A 2M8GX 3DQVC 2EB7A 2EFNA 4BBSJ 1JT0A 1J7KA 1PP7U 3QPLA 3VSLA 5F08A 3RQIA 3FXUA 3NWSA 1BL0A 2XGCA 1Z77A 1TT5B 1YX5A 1SD5A 3PUFA 1VFCA 2H1KA 4PGHA 4I2OA 4PFPA 1T6SA 2C6YA 3U9GA 3FMQA 3ZRGA 1XC5A 5GTIC 3OL4A 3ZR8X 4X1EA 2JPCA 2RREA 1WKMA 2FBIA 2L9SA 3L2RA 1OYWA 4AU7A 1VQLI 1EF4A 1ETOA 3A0HC 3EYYA 1V5FA 2L7ZA 2HVRA 2DW4A 1TWGJ 3MZ8A 2BY3A 1LEAA 3I3LA 4Q47A 1B8IA 4M71A 4OMZA 3BG6A 3V8KA 3CUQA 4ENKA 3B73A 1NK3P 4U0VA 2M8EA 1IN8A 3KP4A 4HPQA 2BVMA 1FT9A 2E5NA 3H9GA 5HLTA 2PQ8A 2STWA 1L0OC 2H8WA 3DTKA 5HDNA 2KZGA 3E7LA 2JQ7A 3CP2A 4RAFA 1IO2A 3E6CC 2E5ZA 4A0ZA 2DA1A 4E7KA 1KGSA 3BCBA 2VPRA 2VQGA 3X2QH 2EPFA 2VUMJ 1USTA 3OSFA 2ECBA 5DDGA 4XLFA 4MEYF 4XK4A 2XHKA 3DKXA 1OISA 1HC8A 2XAHA 4XRSA 1BOAA 2FD5A 2KP6A 1WJDA 2BXYA 2EZKA 2O0YA 1TLHB 2Q2EB 2ZO4A 1ON1A 2CS3A 2FXAA 3FBNB 1MMNA 5KAFC 3TW6A 2X6OA 3M1CA 1R58A 2Y2ZA 1WWXA 2RQPA 3QP6A 3FM5A 1BW6A 3GVAA 3OYIA 4A93J 2OU2A 3OR2C 1Z0XA 2A5YB 5DCMA 1LFPA 1KQ9A 2NVYJ 1J9IA 2DBBA 3I9V2 3M8EA 2FRHA 2IAIA 1P92A 1SMTA 5EEAA 2DA4A 1O3RA 2OPTA 2UV1A 3CC2I 1I50J 4RMNA 1BW5A 1BBYA 3EQLF 3JRGA 5EF6A 1IGNA 3JW4A 4HBLA 4XLHA 1I6HJ 1VQNI 1A35A 3VWBA 3ZMTA 2VC0A 4FTHA 3FDYA 1SVMA 3K9TA 3GLXA 3GTGJ 3E0JB 3ERED 3FXLA 4O3MA 5BOXA 2UUZA 1IRXA 3KP3A 3MFKA 1WSUA 4BE0A 3VYUB 3WTTC 5EGOB 1B72B 2M5WA 2JWTA 2VQCA 2BHYA 4IF4A 4NB5A 2H09A 3EPZA 3SJMA 5EGOA 4XLAA 3R6SA 4RAYA 1T8IA 5KNLA 2E1MB 1ZG5A 2E2HJ 3DCFA 3QP5A 3HRMA 2GWRA 2K27A 4CUGA 2R7TA 3WGHA 4WXDA 3HRSA 2BY1A 2OD5A 5EZGA 2XSJC 1X3WB 1I1GA 3SFIA 2E7XA 2FMYA 4LG0B 3PQJA 2HOEA 2KHMA 3VB2A 3ZGKA 5CLSA 4HA8A 4EJVA 3A03A 5K7ZA 1IAWA 1BA5A 2MW8A 1Z3YA 4XOPA 1FOYA 2VOPA 1DQUA 2KISA 2CQNA 3WTWC 3ABKH 2ZNYA 3TOAA 2Y9ZA 4QLCU 3O8GA 4IL6C 5FJ8J 3TKYA 1EH8A 2O03A 5LGUA 4G12A 1K6YA 3OYMA 1LEBA 5ICGA 4EJTA 2VLAA 4AVPA 1YW9A 5LRRA 3BCAA 5CVJA 1JI8A 2NNYA 4BQAA 3W2VA 1VQMI 1ZR4A 2ZFUA 2F4IA 4A3JJ 3GO5A 3SXYA 2L7KA 1T98A 3FK6A 3VYTB 3OYHA 1A5JA 4HLYA 2JA7J 4ENNA 4HLXA 3EUHA 2W00A 4E7IA 1U5TA 3MAJA 3GXOA 4Y52J 3WG9A 3C2BA 2LKXA 2CQQA 3J80Z 1G59A 2FA5A 4NHJA 4XKCA 3K70D 3K4LA 3E5QA 2MABA 3RPQA 4AC0A 2QQ9A 2VJIA 2A05A 4A5MA 2JA8J 4RLFA 3ABUA 3VSKA 2EK5A 4BYYA 5M3FJ 3TEDA 2YS9A 3N4MA 1KZHA 1G6NA 5HS7A 5LRSA 2BGCA 1XGNA 1QPIA 3WTZA 5FKKA 2P4WA 2BYVE 1E2XA 2HQRA 1B4AA 1ULYA 4IHYA 4G9YA 5HS9A 3ML6A 5M5WJ 2Y0SA 1FTTA 2HYFA 2B0LA 1MNMC 4I6ZA 1BR1A 1IDZA 3QQAA 3BPVA 2MC4A 2XVCA 4CCOA 2I8DA 2LMDA 3VPRA 3WU2C 4AYBA 4BEHB 1QVTA 1PUFA 1DDNA 2DCEA 3IH4A 3LFUA 3CF2A 1MBFA 2IGMA 2YSRA 1GLNA 3OOPA 2VL8A 3CLQA 2MSYA 4MFEA 3A4CA 2XC7A 1JHFA 1LDKB 1Z1DA 2FQ3A 4L9NA 3ZQIA 2XB5A 3HM5A 4D5FA 2ZJRF 4HOBA 2I5UA 3JSPA 1N25A 3PIPF 2QBYA 4IHXA 3F8BA 5GP9A 1Y8RB 2FJ1A 4EGYA 1T39A 5E1ZB 3HGGA 2HTSA 2KZVA 2GXGA 1YI2I 1W36C 3GTKJ 1BI1A 1TW3A 3ISPA 4RLQA 3BLYA 2VXZA 4KYWA 3G2BA 1G3TA 1NK2P 4E7HA 1H88C 4AYBN 3CCYA 4YIRX 3RYPA 1D1AA 1MBHA 3FX3A 3ZOBA 5BPDA 2GLOA 2ZB9A 3OYFA 2DFFA 4MQVA 3BWGA 3K7AJ 2O8XA 3VYRB 4NBQA 3CMMA 5IP9J 3GLLA 5H20A 3IAM2 3SZGA 1UHWA 1KYZA 5J8CA 3HTUA 2RGVA 3KYCB 5IOYA 5B66C 4G6TB 1H8AC 3PO3J 5F27A 3HTSB 3RKXA 3H0DA 3PSFA 4G7ZF 3K4KA 2DYRH 3JR9A 4PJMA 4UUSA 1FTZA 2R7XA 4KIGA 1K7AA 1WQ2A 2PMZN 4X0GA 4ESJA 2W7NA 4XSXF 3N97A 1ZG1A 3DPTA 3D0SA 2K7LA 3ONQA 3RDIA 4XL9A 5D4RA 1SFOJ 3DLLF 4HNUA 5LEKA 1YITI 3OYNA 3ZQCA 5CVIA 3I53A 2OA4A 5LD2C 3CCUI 3CCEI 4F91B 1XMXA 2DJIA 1VQ5I 2DFHA 3I54A 2VQLA 4P55A 5DCFA 2HVSA 4BNCA 4BJTA 1R00A 3FXMA 2JK3A 3M8JA 3WU0A 2RNGA 3AKZA 5FKNA 1U2WA 2LYCA 4PFOA 2OCEA 1IRFA 5J40A 4XONA 4RGRA 3BDDA 4CHUA 2E60A 2LF8A 4XOTA 3SFZA 4ZDPA 3LQQA 3W2AA 4U7DA 4XKBA 1XMAA 2W25A 3F22A 2CJJA 1K79A 1O3TA 4RM3A 3P9KA 2P5LC 5JI6A 2X1DA 4CCMA 1UZCA 3P7NA 1LDDA 5FFXA 1OCOH 5ED4A 3DBHB 1F4KA 4XN3A 2KIQA 1UAAA 4IVNA 3I56I 5J47A 4G7HF 3MWMA 4UUSB 4IKFA 4A3EJ 2LVSA 1Z3XA 2WC2A 3QOPA 2IRFG 3HC7A 2HDCA 5K5OA 2Y69H 4XLPF 4P9FA 1R6RA 1FYKA 1L3LA 4UY8I 3LSGA 2IXSA 1RPWA 2BW3B 1Z05A 2BV6A
chains in the Genus database with same CATH topology
5C3EJ 2XB0X 3A01B 2DA6A 5F04A 4BY7J 1VI0A 3HOUJ 4A3MJ 2FQ4A 2K9SA 1AHDP 2NVXJ 4A3FJ 2E19A 5E3OA 5DTDA 5JLWA 1ETKA 3NARA 2JA6J 3BTJA 5IPAA 3LOCA 1SANA 1PUFB 1XG1A 5E3LA 3WHBA 4XICA 5K7HA 3I4MJ 1ZQ3P 3BR5A 5M3MJ 5M5YJ 4BXXJ 2ELKA 2Y31A 5EYRA 1FIAA 1MBJA 1S7EA 2KDZA 2R5ZB 2LP0A 1IUFA 4D7MA 2JMWA 3K2AA 2L7MP 2EZHA 3BR2A 4AUXA 3NAUA 2DA3A 1Y1VJ 1RKTA 1DU6A 3HGYA 1JTYA 2M34A 2HDDA 1JKQC 2B63J 2DA5A 3JRAA 1P7IA 5J1RA 1A6IA 2I10A 3Q0WA 1ETXA 2X48A 4M6VA 5IP6A 2EH3A 4DZPA 1B72A 5FLMJ 4D7NA 1CQTA 3W6VA 3Q3SA 4DW6A 4XRSG 2QF7A 2CQXA 4CYCA 3JRFA 2WB1N 3BQZA 1U9OA 3F0CA 4MO7A 3S1NJ 2HI3A 2Y9YA 1UMQA 5IYCJ 2EQRA 2EZLA 4Y7NJ 1ETYA 2MGQA 2K9NA 3B6AA 1GDTA 1JGGA 2AHQA 2LY9A 2XPUA 1NTCA 3GTLJ 3TP3A 2ME6A 5FLVA 4DYQA 4DYCA 2VI6A 4QIWN 3H3VK 2MG4A 4JX4A 1WH5A 1Y1WJ 1G2HA 1GV2A 3BR6A 4JYKA 4JX5A 1LE8A 2M8GX 2ECCA 1HF0A 4M3FA 4BBSJ 1JT0A 3WHCA 5J1UA 3QPLA 3ZQGA 5F08A 3RQIA 3BG5A 3ZQHA 1BL0A 2XGCA 1Z77A 1K83J 1VFCA 2TRTA 2H1KA 2TCTA 3GBGA 3Q0VA 2LK2A 1VNDA 2EBIA 1X2MA 2E2JJ 4IHVA 1XC5A 2IEKA 2Y0SN 4J19A 4X1EA 5EDNA 3BQYA 1EF4A 1ETOA 2JA5J 2L7ZA 2D5VA 1TWGJ 2LFBA 2R5YA 1APLC 1B8IA 2CRGA 3S14J 2LD5A 1NK3P 3HOXJ 4LOCA 5JLXA 3G1LA 3S1QJ 3S1MJ 2DMQA 4JP0A 1GUUA 3E7LA 3CQZJ 2DA1A 3RZOJ 2VPRA 2VUMJ 2O8KA 2E2IJ 3OSFA 2ECBA 3S1RJ 4XK4A 1TWCJ 3FK7A 1ZTRA 2LLKA 4A3IJ 1WCMJ 4XRSA 5FKLA 2FD5A 2EZKA 1JT6A 3LSJA 4EEFG 3HOZJ 4UUTA 3B6CA 2NS8A 1JKPC 2W48A 2K9QA 3TW6A 2X6OA 1ZKGA 2OF7A 3MKLA 2Y2ZA 2ID6A 1BW6A 4A93J 1Z0XA 4A3GJ 4FE4A 2ID3A 2NVYJ 3MVPA 5BNGA 2KT0A 3M3YJ 1AU7A 4IEJA 2XPWA 1T56A 5DS9A 1F43A 2VKEA 2IAIA 3BG9A 5EEAA 2DA4A 3QPSA 2OPTA 1O4XA 2H8RA 3GTOJ 1I50J 1BW5A 3HOYJ 3JRGA 2P81A 1YRNA 5EF6A 2CUEA 3S16J 1IGNA 1X2NA 1I6HJ 4V2GA 1RESA 4FTHA 4V2FA 3OIOA 3GTGJ 4A69C 4X6AJ 3RZDJ 1WH7A 2RAEA 5IYBJ 2HXOA 5EGOB 1B72B 4W1UA 5IP7J 3BR3A 2JWTA 1OCPA 1OJLA 1K61A 3SJMA 1IRZA 3CDLA 5EGOA 2JN6A 4XRMA 3S15J 3IH2A 2E2HJ 1WPKA 3DCFA 5FKOA 5F1JA 1JUMA 1HDPA 3BR1A 2R5ZA 1TWAJ 1IV6A 5M5XJ 1WI3A 1BJZA 5EZGA 2L9RA 3SFIA 1RKWA 3BT9A 3HKZN 3MN2A 1MBKA 2XRLA 1YRNB 4B4CA 3A03A 5GPAA 5K7ZA 1IG7A 1BA5A 2MW8A 2COBA 2G0EA 2EZIA 4BBRJ 1HDDC 1JJ8C 3G1OA 3RKQA 2WV1A 2Y9ZA 3O8GA 5FJ8J 1HCRA 2DMTA 5EZHA 3HB9A 2LR8A 4G12A 1TWFJ 3OSGA 2XGDA 3G1MA 2XSDC 2NOGA 1WGXA 1ZK8A 4I76A 1ETQA 2HOTA 2DMPA 3PM1A 5GPCA 1ZR4A 4DYRA 4A3JJ 1XS9A 1IDYA 1MH3A 1I3QJ 1MH4A 1TWHJ 2DTZA 3FK6A 3JRIA 3DEWA 2JA7J 1A5JA 3JRBA 1MSFC 2L0KA 3M4OJ 1FEXA 4Y52J 3C2BA 2M2EA 3IV5A 2LKXA 2CQQA 2E1OA 2CU7A 3GTQJ 5F0FA 5EG0B 3JREA 4AC0A 2N8GA 1ORKA 5HODA 2JA8J 2XPVA 3IH3A 5M3FJ 4A3LJ 4W97A 5C44J 2YS9A 3LSRA 4C3HJ 3TEDA 1ZR2A 1W0TA 3L1PA 1U78A 1QPIA 2Y30A 5FKKA 1GV5A 2L7FP 2JJ7A 3BR0A 2FX0A 4IHYA 5M5WJ 1ZGWA 1FTTA 1JUSA 5IYDJ 1W0UA 1ETVA 4MFDA 4BY1J 2HYJA 3BTLA 1MNMC 4I6ZA 2NVTJ 1IDZA 3QQAA 2X9DA 1PUFA 3VPRA 4IHWA 1QVTA 4A3CJ 3HOVJ 1VF9A 3IH4A 4HNVA 1MBFA 5J1YA 2MSYA 3D1NI 1E3OC 4MFEA 1GVDA 4DZJA 3JRCA 5E3MA 1JTXA 3ZQIA 1P7JA 2XB5A 3HM5A 2M0CA 4S0HB 3TP0A 4D5FA 2R7ZJ 1GT0C 1FJLA 4M3BA 4IHXA 5GP9A 2DN0A 2GM4A 2FJ1A 1QRYA 3HDDA 3HGGA 1JKOC 5EG0A 3GTKJ 2LTPA 3S17J 4A3BJ 1B8IB 3S2HJ 1LFBA 2R92J 3FIWA 1MBEA 2IBDA 1HOMA 2XGEA 1NK2P 1H89C 1Q1VA 1LE8B 1JJ6C 1H88C 2AO9A 4AYBN 3CCYA 3LSPA 2R0QC 1LFUP 2CUFA 1MBHA 5F0CA 3Q0UA 3ZOBA 2R93J 4CYCB 2QCOA 3CMYA 1D5YA 2GLOA 2O7OA 2ZB9A 4GFBA 4FCYA 1U9NA 4B1RA 3K7AJ 4C3JJ 3H0GJ 5E3NA 5K7FA 5IP9J 4RDUA 1X58A 3HBLA 1AKHA 1OCTC 5IOYA 3PO3J 1H8AC 2K40A 5F27A 4A3DJ 3ZQFA 3GTPJ 2HQ5A 3O8HA 3JR9A 2O9LA 4FISA 4UUSA 1HLVA 2VKVA 1FTZA 4XIDA 2DA2A 4C2MJ 2PMZN 4M3GA 1ENHA 1IJWC 1MSEC 3BTCA 5FKMA 1UG2A 4ABZA 1DU0A 1SFOJ 3JRDA 4QSHA 1ETWA 1TC3C 3ZQCA 4B3AA 3BG3A 3HEFA 9ANTA 4MIMA 4RBOA 1FIPA 1T33A 2DJNA 1MBGA 1POGA 2DMUA 4C3IJ 1RETA 4MLOA 2ME0A 3LNQA 3GTMJ 4NDLA 3UKGA 2JK3A 1U8BA 2R5YB 4M3DA 3PO2J 5FKNA 3S2DJ 1AKHB 3I4NJ 3HOWJ 1ITYA 2HOSA 2DA7A 2NVQJ 5C4JJ 5J3LA 4FE7A 2HXIA 1UHSA 1JUPA 3A02A 4M3EA 2NS7A 3BTIA 2CJJA 5F0HA 3TW7A 5IOZA 2WAQN 2YUSA 1IC8A 3OOUA 2YU9J 2HOAA 1QVUA 1R9TJ 2GBYA 3GTJJ 2DMNA 4L5EA 3ZQLA 1JKRC 4UUSB 1F36A 3JRHA 2M9HA 1OFCX 2LVSA 4A3EJ 4JX6A 3FISA 4QTRA 4A3KJ 5C4XJ 3A01A 1RR7A 3LSGA 4D5CA 3FKIJ 4BKXA 1RPWA 3SDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E J;  2XB0 X;  3A01 B;  2DA6 A;  5F04 A;  4BY7 J;  1VI0 A;  3HOU J;  4A3M J;  2FQ4 A;  2K9S A;  1AHD P;  2NVX J;  4A3F J;  2E19 A;  5E3O A;  5DTD A;  5JLW A;  1ETK A;  3NAR A;  2JA6 J;  3BTJ A;  5IPA A;  3LOC A;  1SAN A;  1PUF B;  1XG1 A;  5E3L A;  3WHB A;  4XIC A;  5K7H A;  3I4M J;  1ZQ3 P;  3BR5 A;  5M3M J;  5M5Y J;  4BXX J;  2ELK A;  2Y31 A;  5EYR A;  1FIA A;  1MBJ A;  1S7E A;  2KDZ A;  2R5Z B;  2LP0 A;  1IUF A;  4D7M A;  2JMW A;  3K2A A;  2L7M P;  2EZH A;  3BR2 A;  4AUX A;  3NAU A;  2DA3 A;  1Y1V J;  1RKT A;  1DU6 A;  3HGY A;  1JTY A;  2M34 A;  2HDD A;  1JKQ C;  2B63 J;  2DA5 A;  3JRA A;  1P7I A;  5J1R A;  1A6I A;  2I10 A;  3Q0W A;  1ETX A;  2X48 A;  4M6V A;  5IP6 A;  2EH3 A;  4DZP A;  1B72 A;  5FLM J;  4D7N A;  1CQT A;  3W6V A;  3Q3S A;  4DW6 A;  4XRS G;  2QF7 A;  2CQX A;  4CYC A;  3JRF A;  2WB1 N;  3BQZ A;  1U9O A;  3F0C A;  4MO7 A;  3S1N J;  2HI3 A;  2Y9Y A;  1UMQ A;  5IYC J;  2EQR A;  2EZL A;  4Y7N J;  1ETY A;  2MGQ A;  2K9N A;  3B6A A;  1GDT A;  1JGG A;  2AHQ A;  2LY9 A;  2XPU A;  1NTC A;  3GTL J;  3TP3 A;  2ME6 A;  5FLV A;  4DYQ A;  4DYC A;  2VI6 A;  4QIW N;  3H3V K;  2MG4 A;  4JX4 A;  1WH5 A;  1Y1W J;  1G2H A;  1GV2 A;  3BR6 A;  4JYK A;  4JX5 A;  1LE8 A;  2M8G X;  2ECC A;  1HF0 A;  4M3F A;  4BBS J;  1JT0 A;  3WHC A;  5J1U A;  3QPL A;  3ZQG A;  5F08 A;  3RQI A;  3BG5 A;  3ZQH A;  1BL0 A;  2XGC A;  1Z77 A;  1K83 J;  1VFC A;  2TRT A;  2H1K A;  2TCT A;  3GBG A;  3Q0V A;  2LK2 A;  1VND A;  2EBI A;  1X2M A;  2E2J J;  4IHV A;  1XC5 A;  2IEK A;  2Y0S N;  4J19 A;  4X1E A;  5EDN A;  3BQY A;  1EF4 A;  1ETO A;  2JA5 J;  2L7Z A;  2D5V A;  1TWG J;  2LFB A;  2R5Y A;  1APL C;  1B8I A;  2CRG A;  3S14 J;  2LD5 A;  1NK3 P;  3HOX J;  4LOC A;  5JLX A;  3G1L A;  3S1Q J;  3S1M J;  2DMQ A;  4JP0 A;  1GUU A;  3E7L A;  3CQZ J;  2DA1 A;  3RZO J;  2VPR A;  2VUM J;  2O8K A;  2E2I J;  3OSF A;  2ECB A;  3S1R J;  4XK4 A;  1TWC J;  3FK7 A;  1ZTR A;  2LLK A;  4A3I J;  1WCM J;  4XRS A;  5FKL A;  2FD5 A;  2EZK A;  1JT6 A;  3LSJ A;  4EEF G;  3HOZ J;  4UUT A;  3B6C A;  2NS8 A;  1JKP C;  2W48 A;  2K9Q A;  3TW6 A;  2X6O A;  1ZKG A;  2OF7 A;  3MKL A;  2Y2Z A;  2ID6 A;  1BW6 A;  4A93 J;  1Z0X A;  4A3G J;  4FE4 A;  2ID3 A;  2NVY J;  3MVP A;  5BNG A;  2KT0 A;  3M3Y J;  1AU7 A;  4IEJ A;  2XPW A;  1T56 A;  5DS9 A;  1F43 A;  2VKE A;  2IAI A;  3BG9 A;  5EEA A;  2DA4 A;  3QPS A;  2OPT A;  1O4X A;  2H8R A;  3GTO J;  1I50 J;  1BW5 A;  3HOY J;  3JRG A;  2P81 A;  1YRN A;  5EF6 A;  2CUE A;  3S16 J;  1IGN A;  1X2N A;  1I6H J;  4V2G A;  1RES A;  4FTH A;  4V2F A;  3OIO A;  3GTG J;  4A69 C;  4X6A J;  3RZD J;  1WH7 A;  2RAE A;  5IYB J;  2HXO A;  5EGO B;  1B72 B;  4W1U A;  5IP7 J;  3BR3 A;  2JWT A;  1OCP A;  1OJL A;  1K61 A;  3SJM A;  1IRZ A;  3CDL A;  5EGO A;  2JN6 A;  4XRM A;  3S15 J;  3IH2 A;  2E2H J;  1WPK A;  3DCF A;  5FKO A;  5F1J A;  1JUM A;  1HDP A;  3BR1 A;  2R5Z A;  1TWA J;  1IV6 A;  5M5X J;  1WI3 A;  1BJZ A;  5EZG A;  2L9R A;  3SFI A;  1RKW A;  3BT9 A;  3HKZ N;  3MN2 A;  1MBK A;  2XRL A;  1YRN B;  4B4C A;  3A03 A;  5GPA A;  5K7Z A;  1IG7 A;  1BA5 A;  2MW8 A;  2COB A;  2G0E A;  2EZI A;  4BBR J;  1HDD C;  1JJ8 C;  3G1O A;  3RKQ A;  2WV1 A;  2Y9Z A;  3O8G A;  5FJ8 J;  1HCR A;  2DMT A;  5EZH A;  3HB9 A;  2LR8 A;  4G12 A;  1TWF J;  3OSG A;  2XGD A;  3G1M A;  2XSD C;  2NOG A;  1WGX A;  1ZK8 A;  4I76 A;  1ETQ A;  2HOT A;  2DMP A;  3PM1 A;  5GPC A;  1ZR4 A;  4DYR A;  4A3J J;  1XS9 A;  1IDY A;  1MH3 A;  1I3Q J;  1MH4 A;  1TWH J;  2DTZ A;  3FK6 A;  3JRI A;  3DEW A;  2JA7 J;  1A5J A;  3JRB A;  1MSF C;  2L0K A;  3M4O J;  1FEX A;  4Y52 J;  3C2B A;  2M2E A;  3IV5 A;  2LKX A;  2CQQ A;  2E1O A;  2CU7 A;  3GTQ J;  5F0F A;  5EG0 B;  3JRE A;  4AC0 A;  2N8G A;  1ORK A;  5HOD A;  2JA8 J;  2XPV A;  3IH3 A;  5M3F J;  4A3L J;  4W97 A;  5C44 J;  2YS9 A;  3LSR A;  4C3H J;  3TED A;  1ZR2 A;  1W0T A;  3L1P A;  1U78 A;  1QPI A;  2Y30 A;  5FKK A;  1GV5 A;  2L7F P;  2JJ7 A;  3BR0 A;  2FX0 A;  4IHY A;  5M5W J;  1ZGW A;  1FTT A;  1JUS A;  5IYD J;  1W0U A;  1ETV A;  4MFD A;  4BY1 J;  2HYJ A;  3BTL A;  1MNM C;  4I6Z A;  2NVT J;  1IDZ A;  3QQA A;  2X9D A;  1PUF A;  3VPR A;  4IHW A;  1QVT A;  4A3C J;  3HOV J;  1VF9 A;  3IH4 A;  4HNV A;  1MBF A;  5J1Y A;  2MSY A;  3D1N I;  1E3O C;  4MFE A;  1GVD A;  4DZJ A;  3JRC A;  5E3M A;  1JTX A;  3ZQI A;  1P7J A;  2XB5 A;  3HM5 A;  2M0C A;  4S0H B;  3TP0 A;  4D5F A;  2R7Z J;  1GT0 C;  1FJL A;  4M3B A;  4IHX A;  5GP9 A;  2DN0 A;  2GM4 A;  2FJ1 A;  1QRY A;  3HDD A;  3HGG A;  1JKO C;  5EG0 A;  3GTK J;  2LTP A;  3S17 J;  4A3B J;  1B8I B;  3S2H J;  1LFB A;  2R92 J;  3FIW A;  1MBE A;  2IBD A;  1HOM A;  2XGE A;  1NK2 P;  1H89 C;  1Q1V A;  1LE8 B;  1JJ6 C;  1H88 C;  2AO9 A;  4AYB N;  3CCY A;  3LSP A;  2R0Q C;  1LFU P;  2CUF A;  1MBH A;  5F0C A;  3Q0U A;  3ZOB A;  2R93 J;  4CYC B;  2QCO A;  3CMY A;  1D5Y A;  2GLO A;  2O7O A;  2ZB9 A;  4GFB A;  4FCY A;  1U9N A;  4B1R A;  3K7A J;  4C3J J;  3H0G J;  5E3N A;  5K7F A;  5IP9 J;  4RDU A;  1X58 A;  3HBL A;  1AKH A;  1OCT C;  5IOY A;  3PO3 J;  1H8A C;  2K40 A;  5F27 A;  4A3D J;  3ZQF A;  3GTP J;  2HQ5 A;  3O8H A;  3JR9 A;  2O9L A;  4FIS A;  4UUS A;  1HLV A;  2VKV A;  1FTZ A;  4XID A;  2DA2 A;  4C2M J;  2PMZ N;  4M3G A;  1ENH A;  1IJW C;  1MSE C;  3BTC A;  5FKM A;  1UG2 A;  4ABZ A;  1DU0 A;  1SFO J;  3JRD A;  4QSH A;  1ETW A;  1TC3 C;  3ZQC A;  4B3A A;  3BG3 A;  3HEF A;  9ANT A;  4MIM A;  4RBO A;  1FIP A;  1T33 A;  2DJN A;  1MBG A;  1POG A;  2DMU A;  4C3I J;  1RET A;  4MLO A;  2ME0 A;  3LNQ A;  3GTM J;  4NDL A;  3UKG A;  2JK3 A;  1U8B A;  2R5Y B;  4M3D A;  3PO2 J;  5FKN A;  3S2D J;  1AKH B;  3I4N J;  3HOW J;  1ITY A;  2HOS A;  2DA7 A;  2NVQ J;  5C4J J;  5J3L A;  4FE7 A;  2HXI A;  1UHS A;  1JUP A;  3A02 A;  4M3E A;  2NS7 A;  3BTI A;  2CJJ A;  5F0H A;  3TW7 A;  5IOZ A;  2WAQ N;  2YUS A;  1IC8 A;  3OOU A;  2YU9 J;  2HOA A;  1QVU A;  1R9T J;  2GBY A;  3GTJ J;  2DMN A;  4L5E A;  3ZQL A;  1JKR C;  4UUS B;  1F36 A;  3JRH A;  2M9H A;  1OFC X;  2LVS A;  4A3E J;  4JX6 A;  3FIS A;  4QTR A;  4A3K J;  5C4X J;  3A01 A;  1RR7 A;  3LSG A;  4D5C A;  3FKI J;  4BKX A;  1RPW A;  3SDG A; 
#chains in the Genus database with same CATH topology
 3AFH A;  2XB0 X;  1IXR C;  1HQC A;  2L4M A;  2OQR A;  2XF5 A;  4A5N A;  2HS5 A;  4ASN A;  2FOW A;  2AXT C;  2FQ4 A;  2MLK A;  5H6R A;  3WE3 A;  2NAZ A;  3OIQ A;  2COM A;  2HKX A;  1ETK A;  2CGP A;  1B6A A;  4OIQ F;  3LOC A;  4EMS A;  1PUF B;  2X0L A;  3WHB A;  4XIC A;  4IQJ A;  5K7H A;  4YG2 F;  3I4M J;  3MMY B;  3DBL B;  3BR5 A;  2P7V B;  4BXX J;  4OIN F;  3PL8 A;  1BOB A;  2F5D A;  3M8F A;  1MBJ A;  1D1C A;  2KMU A;  2PFB A;  2V1X A;  3OL3 A;  4D7M A;  3E5U A;  1NG6 A;  1PP8 F;  2V1D A;  5KVR A;  4RGS A;  1EA3 A;  2LH9 A;  2EZH A;  4AUX A;  3NAU A;  3ERM A;  1MIJ A;  3FXR A;  2M34 A;  2HDD A;  2JVG A;  1JKQ C;  3MQ0 A;  2VC1 A;  1ZLK A;  2I10 A;  3VOE A;  3RPU A;  1KU2 A;  1VQ9 I;  1W5T A;  3H35 A;  2HEO A;  1WJC A;  3CD6 I;  2CV2 A;  3SDB A;  1B72 A;  3F21 A;  4D7N A;  1DPR A;  3W6V A;  3Q3S A;  2AQE A;  3BQZ A;  4MO7 A;  3S1N J;  3MD2 A;  4CZC A;  1HW1 A;  2CUZ A;  2V79 A;  2HI3 A;  2ELJ A;  1UMQ A;  1GHC A;  1ZRE A;  2VOO A;  2EQR A;  2EZL A;  1X1B A;  3ZQ7 A;  3DWL E;  4HQM A;  2GXB A;  2OV7 A;  1RUO A;  1TQI A;  1X4O A;  1TBX A;  2RV8 A;  2EA4 A;  2XPU A;  2Z16 A;  1J59 A;  2GAU A;  2MBF A;  1E0E A;  1ODD A;  4DYQ A;  3H5R A;  4I09 A;  4P96 A;  1K4S A;  4JX4 A;  1Y1W J;  1G2H A;  2K02 A;  4EJW A;  3BR6 A;  2F5E A;  4JYK A;  4L18 B;  5LBQ A;  1WRJ A;  3QYE A;  4M3F A;  1P4A A;  3E3V A;  1ZLJ A;  3WHC A;  4IOC F;  2DT7 B;  3QPT A;  3BG5 A;  5B5E C;  1U5T B;  3M07 A;  5D5V B;  2HZT A;  3VYS B;  3Q0V A;  5BS6 A;  5CVV A;  3F8N A;  2E2J J;  1X2M A;  3R0A A;  3OYE A;  5DUK A;  1PJR A;  3RKY A;  1YIJ I;  2OC6 A;  3N05 A;  1BIA A;  2JA5 J;  2TDX A;  1MND A;  4KFC A;  4LLN A;  2LFB A;  2R5Y A;  1APL C;  2JVH A;  2WWY A;  3IP4 B;  3BRO A;  4XM3 A;  4BL0 B;  4RGU A;  2MLG A;  3TQN A;  1XN7 A;  1V55 H;  3HXL A;  3HOX J;  4LOC A;  4EAT A;  2HZD A;  4YIF A;  4KIS A;  2PN6 A;  1IUY A;  1Z6T A;  2X85 A;  1FY7 A;  1GUU A;  1WFX A;  3OYD A;  2HQA A;  3J7Y J;  4KIF A;  4ANJ A;  2Z99 A;  2KIM A;  2VBW A;  2O8K A;  4A6D A;  2E2I J;  3TDU C;  2ELH A;  4A3I J;  1SC7 A;  2XGX A;  4FAS D;  2Z3Y A;  4M73 A;  2H94 A;  3CCR I;  2V6E A;  3LSJ A;  2VB6 A;  2ZJQ F;  3T5X A;  2EJR A;  1FBU A;  2RNJ A;  2IP2 A;  1JKP C;  2DAO A;  1BC8 C;  4ENM A;  4BQO A;  2QGU A;  3O3K A;  3LSM A;  1CF7 B;  4UVA A;  5GAG J;  3CCV I;  2ID6 A;  2DQR A;  2K4J A;  2WTE A;  4OWR B;  1WJA A;  3CZ6 A;  2VOD A;  4BAY A;  1RC9 A;  2ID3 A;  1TNS A;  4IZZ A;  4ZTJ A;  3M3Y J;  4IRG A;  1EH7 A;  2MFZ A;  4IEJ A;  4BQQ A;  1T56 A;  5DUI A;  3CMA I;  1XPX A;  2FNP A;  2VKE A;  5K1Y A;  4WWC A;  3RCO A;  2XRN A;  1R36 A;  2K85 A;  5GAH J;  3I71 A;  3J81 Z;  3ABL H;  2BVL A;  2MYS A;  1QQI A;  2ZME A;  3K6G A;  3TOB A;  4IOA F;  2P81 A;  2MA3 A;  1K78 A;  3I0T A;  1FMV A;  4CIC A;  3S16 J;  4I01 A;  1YFH A;  3TO9 A;  4GYI A;  2STT A;  4V2F A;  2M7A A;  4A69 C;  4RAG A;  4PJL A;  3T8T A;  2VQH A;  3RZD J;  5EJC A;  2LF7 A;  2DYS H;  1WH7 A;  2DOF A;  5LEJ A;  2HXO A;  1VQK I;  5IP7 J;  2RDP A;  3BR3 A;  5K5Q A;  1K61 A;  3L09 A;  5FRN A;  3GZN B;  3QU3 A;  1UJ8 A;  1K78 B;  2YX7 A;  3S15 J;  4P9U A;  5FKO A;  1IV6 A;  2CMP A;  1TWA J;  2R7O A;  3QOE A;  1YJN I;  2R7V A;  1WVR A;  1D8J A;  1WI3 A;  3UNG C;  1BJZ A;  3G4S I;  2KKO A;  2L9R A;  4LJZ F;  2DPD A;  1MBK A;  1SVL A;  1S3J A;  2IGO A;  2R7R A;  4B4C A;  1XGS A;  2G0E A;  2EZI A;  3FBI B;  1HDD C;  3OR1 C;  1SD4 A;  1T38 A;  2CFX A;  2NS0 A;  4YEL A;  4CXF A;  3Q5F A;  1O57 A;  3RKQ A;  2WV1 A;  3CCS I;  2W82 A;  4F93 B;  4IRI A;  4KIT B;  2FF4 A;  4CCN A;  2HPM A;  1U3E M;  3QRF F;  4IX7 A;  1VQ4 I;  3OSG A;  2XGD A;  3A1Y A;  3G1M A;  2P0W A;  2K86 A;  4BE2 A;  2DLL A;  2XSD C;  1ACI A;  4QPQ A;  4I76 A;  2HR3 A;  4H4K C;  2HOT A;  3PM1 A;  1AA7 A;  2K9M A;  3KE2 A;  2O3F A;  1IDY A;  3KCC A;  2LDU A;  1I3Q J;  3KP5 A;  1S6L A;  1TWH J;  2VBY A;  3LSK A;  2DOA A;  4HF2 A;  1A36 A;  1Q1H A;  3DEW A;  4OAZ A;  3TGN A;  4EV0 A;  1BJA A;  1MSF C;  1R1T A;  1B9N A;  1UB9 A;  1FBQ A;  4Y4R A;  2E1O A;  5HLH A;  2ZXJ A;  5A2Q K;  2OTL I;  2CU7 A;  3GTQ J;  1RR8 C;  5F0F A;  5EG0 B;  2D1V A;  2ZME B;  3NRV A;  4IJA A;  5HOD A;  1HKS A;  4ZTF A;  5BPI A;  1REP C;  2XPV A;  2MD0 A;  1XGM A;  4A3L J;  1RI7 A;  1R4M B;  1WJF A;  5C44 J;  3LSR A;  3E5X A;  4PJN A;  1U78 A;  2WB1 A;  5FFZ A;  3BG7 A;  1V3F A;  2PBI A;  3REO A;  3JTH A;  5TGT A;  4UHT A;  4XBF A;  1STZ A;  2M1B A;  3WG7 H;  2QQ8 A;  2XF6 A;  4EQQ A;  3GFI A;  3JCU C;  5IYD J;  5CPR B;  1FYM A;  3P9I A;  4MFD A;  2QVO A;  3K4M A;  3GZ6 A;  3CUQ C;  4HEA 2;  3S3N A;  3ULQ B;  4UV9 A;  5HLG A;  3PSI A;  2HKO A;  1U5T C;  3DV8 A;  4I02 A;  2EA2 A;  2PMU A;  4LLL A;  5HDK A;  3J80 K;  3CC4 I;  3HOV J;  2H6B A;  5L3C A;  1DP7 P;  5J4Y A;  2EIL H;  1R1V A;  1XSV A;  2A6H F;  2ICW G;  3D1N I;  3IKT A;  3E6D A;  2HU9 A;  3BC8 A;  4L9J A;  2M0C A;  1G3W A;  3TP0 A;  2R7Z J;  5LHI A;  1FYL A;  4XR6 A;  3BJ6 A;  5FD6 A;  2Q8K A;  1J0R A;  1JKO C;  2DO7 A;  5J4V A;  2XF7 A;  4N9H A;  1QGP A;  3S2H J;  1LFB A;  4V19 K;  4LB6 B;  2LC2 A;  1T0F A;  2DK8 A;  4CCJ A;  1HOM A;  2XGE A;  3I64 A;  3C7J A;  1H89 C;  3CDH A;  3CJQ B;  1LE8 B;  3J7A Y;  4BUP A;  2XAQ A;  1ZHF A;  1FP2 A;  1NG7 A;  3LSP A;  1YLF A;  4JK1 X;  4HSR A;  1QHH D;  2CUF A;  1TZL A;  2WAF A;  2VIX A;  1FOK A;  1D5Y A;  1U8R A;  4BHP A;  4FCY A;  4LB5 A;  4B1R A;  1YG2 A;  2YX4 A;  3LFK A;  4ENJ A;  1X1A A;  4I99 C;  3GWZ A;  4ON0 A;  3TBI A;  4M9S A;  3FXO A;  5E3N A;  5CQE A;  5K7F A;  2AQF A;  3PFY A;  2D1H A;  1IN4 A;  3HKZ A;  3HUG A;  4Y33 A;  1Y56 A;  4UXN A;  3I58 A;  2VAS A;  2HQ5 A;  3ABT A;  3O8H A;  4RM2 A;  3HSF A;  4UB6 C;  4U88 A;  1S7O A;  5HOO A;  2O9L A;  2VON A;  3GW2 A;  4LGW A;  2IA1 A;  5FD5 A;  1HLV A;  2CV0 A;  4XID A;  3SYT A;  2RC4 A;  3HRU A;  4M3G A;  1ENH A;  1IJW C;  4XLN F;  4HF0 A;  2VE9 A;  3CF5 F;  2BZT A;  3GF2 A;  1HBX G;  3OYL A;  1DU0 A;  1QU3 A;  3JRD A;  1NHA A;  1ETW A;  3H3U A;  2Y75 A;  3ZMV A;  4YFN F;  4B3A A;  4C2T A;  4P5O A;  2QSG X;  2P5V A;  4MIM A;  5ICE A;  1DPU A;  1FIP A;  1XX5 A;  4A0X A;  1FLI A;  2G7U A;  4E6K G;  3J7A O;  1YX3 A;  1MBG A;  3GFM A;  1POG A;  2R7D A;  3GTM J;  2DK5 A;  4M6X A;  1U8B A;  4M3D A;  3PO2 J;  2M30 A;  2FML A;  3OYK A;  1S72 I;  1UG0 A;  2FU4 A;  3HOW J;  4XNF A;  2HOS A;  1MMA A;  3HOT A;  2GOM A;  2QSF X;  2VBX A;  4KIB A;  4R1H A;  4AVZ A;  3FXK A;  1KQ8 A;  4RA2 A;  1VQP I;  3BZ6 A;  1MNE A;  2HXI A;  3QAH A;  5GTH C;  1PUE E;  4M3E A;  4AID A;  3M9A A;  4ZDL A;  2BHZ A;  5F0H A;  2JZY A;  3UR3 C;  1X19 A;  1ZH5 A;  4LIT A;  3TO6 A;  2XAS A;  3F6V A;  3V7S A;  3DU6 A;  2WAQ N;  3W2W A;  5IOZ A;  1Y39 A;  1O7L A;  2H6C A;  3IL2 A;  1MMG A;  2XDV A;  3HHG A;  2H1L A;  2K9L A;  3MEX A;  3FHN A;  3DPU A;  2GBY A;  4L5E A;  2EFQ A;  4KN7 X;  3CO7 C;  4KIC A;  5FB2 A;  4ESF A;  3C2H A;  3JRH A;  3GX4 X;  5GAE J;  4JX6 A;  2MH2 A;  2A69 F;  4I0B A;  4A3K J;  2UXN A;  3LL7 A;  4FQG A;  3DKW A;  1ZRF A;  4FX0 A;  4U7B A;  3SZP A;  1RR7 A;  4DQ2 A;  4BKX A;  1TP4 A;  3SDG A;  5A2Q Z;  3IRR A;  2Q2E A;  4XKV A;  3D5R C;  5F04 A;  4MEX F;  5E8G A;  3ELK A;  2MD5 A;  1Z21 A;  2K9S A;  2KL4 A;  2B9S A;  2NVX J;  3U1K A;  4Z2Y A;  3JAM Z;  5JLW A;  4E7S A;  3BTJ A;  2DT6 A;  5HDG A;  4Q5S F;  2PX9 A;  2CWE A;  2EIM H;  5IPA A;  4NQW B;  1G3Y A;  4ITV A;  2M0M A;  3CJT B;  4HST A;  1ZQ3 P;  3HSE A;  2X6X A;  5M3M J;  1R5G A;  3RTR A;  4KT6 A;  1TQP A;  3C3W A;  2Y31 A;  3O2P E;  4GGG A;  3WTY C;  1RNL A;  1XD7 A;  2KDZ A;  3ZP5 A;  1E3H A;  1S9H A;  4G94 A;  3BY6 A;  3ECH A;  1VTN C;  3PUB A;  4R79 A;  2L7M P;  4HDU A;  2DA3 A;  1RKT A;  3K2Z A;  1VQ7 I;  4PJJ A;  5K5R A;  4ZDO A;  1JTY A;  4HX8 A;  1DU6 A;  2OJE D;  4WF2 A;  3JRA A;  1A6I A;  3HHH A;  1WJE A;  4HV6 A;  1USS A;  1TT0 A;  3S32 A;  3U21 A;  3W6J B;  3Q0W A;  2A07 F;  4BDZ A;  2XRO A;  4M6V A;  4DZP A;  2CV1 A;  1KU9 A;  5FLM J;  2CH0 A;  1P9Q C;  4FT8 A;  1ONV A;  1D8K A;  1YW8 A;  4DW6 A;  1CQT A;  4F55 A;  1B1B A;  5D8L B;  3F8F A;  4GO1 A;  4BE1 A;  1MJ9 A;  1U9O A;  2DDA A;  4XQF A;  5IYC J;  5E17 F;  4RB3 C;  1HSJ A;  4Y7N J;  2ETH A;  4PCQ A;  1ETY A;  1FSE A;  2MGQ A;  3IWF A;  3C1D A;  5KCM A;  3WGG A;  1JGG A;  4M9Z A;  2D45 A;  3HYI A;  1I5Z A;  3LSI A;  3T1B A;  3R61 A;  4DBQ A;  1YYV A;  4DYC A;  4AD9 A;  3MKW B;  1GXQ A;  5JR3 A;  2QZ8 A;  2X51 A;  4FX4 A;  2HDW A;  3L2C A;  3S3M A;  1GV2 A;  2KRF A;  1K4T A;  4BJ5 C;  2ECC A;  5CVU A;  3D5L A;  2XKP A;  3G71 I;  3CO6 C;  3ZQH A;  4KMF A;  1UCR A;  2TRT A;  2ZJP F;  2LK2 A;  1VND A;  2E1M C;  4OIR F;  2EV5 A;  2IEK A;  2Y0S N;  4J19 A;  3ZCO A;  1TW2 A;  1IRG A;  3FHZ A;  2CW8 A;  3L2Q A;  1YS7 A;  2NOJ B;  4A0Y A;  1YE9 A;  4AIH A;  2AXL A;  2F5F A;  4N4N B;  5D6E A;  3S14 J;  2V9V A;  4IHT A;  4M72 A;  2M4K A;  3OYJ A;  1CGP A;  3F23 A;  1TNT A;  3QOD A;  4LG3 A;  4PGG A;  3S1Q J;  2X6Y A;  3G1L A;  4MHG A;  3ZXS A;  3S1M J;  2DMQ A;  3GFJ A;  2PLY A;  2L3D A;  3PIO F;  4B3X A;  2KRH A;  2ZME C;  4EM2 A;  1EV7 A;  1W1W E;  2F5C A;  2XAG A;  3RZO J;  4CH7 A;  2ZC2 A;  4C30 A;  4AIJ A;  3S93 A;  3OIP A;  5L3F A;  1QZY A;  1TWC J;  3LQR A;  4Q4Z F;  2FOK A;  4ZYH A;  3K0L A;  1IZ1 A;  1WCM J;  2F5V A;  4Y13 A;  1D1B A;  5FKL A;  2LBF B;  3FZV A;  1JT6 A;  1DP3 A;  4GRI A;  4Y15 A;  4AWX B;  4LD5 A;  3VFZ A;  3HOZ J;  2A5W A;  1P4X A;  2JSP A;  3B6C A;  2NNN A;  2WAE A;  2W48 A;  2K9Q A;  1XSX A;  2Y0M A;  1ZKG A;  2OF7 A;  3MKL A;  2E34 A;  1YIO A;  3V42 A;  1PYV A;  3CUQ B;  1X1C A;  1Z7U A;  2WY7 Q;  3L2W A;  1VQ6 I;  2E1C A;  4FE4 A;  3V8J A;  4DOZ A;  3T8R A;  2F4M B;  5BNG A;  4EVI A;  4U87 A;  1I1S A;  2XPW A;  2E7W A;  3QPH A;  5DS9 A;  4MNU A;  1F43 A;  2XAF A;  1X3Z B;  4EM1 A;  2IS6 A;  3QPS A;  3K1M A;  2J5O A;  2KLO A;  3NWT A;  2H8R A;  2QSH X;  3GTO J;  2D2W A;  1ZRC A;  3TDZ C;  3HOY J;  5FLX K;  1YRN A;  4WK8 F;  2FE3 A;  5HVQ C;  3CJN A;  4P1W A;  1V5E A;  1O3S A;  1RES A;  3Q9V A;  5LFA A;  3EYI A;  1O7F A;  3B02 A;  1WJ5 A;  2VN2 A;  1ZYR F;  3GUD A;  4X6A J;  5AIP A;  2FSW A;  3ABM H;  4HZF A;  5D5X B;  2OTJ I;  1SFX A;  1BC7 C;  4W1U A;  2JRT A;  4CA0 A;  4UVB A;  3IAS 2;  3ECO A;  3CDL A;  3V4G A;  1MDM B;  4XSZ F;  2JN6 A;  3LWF A;  1X1P A;  4XRM A;  2O6G E;  5ERI A;  3EET A;  5F1J A;  1JUM A;  1HDP A;  2FBK A;  5M5X J;  2KIU A;  3RYR A;  2CW0 F;  3RJP A;  1XDU A;  2V1U A;  3MN2 A;  3PQK A;  2PJP A;  2XRL A;  1YRN B;  5D8K B;  1D0Z A;  1UFM A;  3SEQ A;  5DCM B;  3HL2 A;  2BE5 F;  1PDN C;  2AS5 F;  3EUA A;  4MQ9 F;  4BBR J;  2R7S A;  1JJ8 C;  2PJR A;  5F1R A;  1GVJ A;  3JTG A;  2EV6 A;  2OUM A;  2DMT A;  5JHF A;  4AM3 A;  3FWE A;  3COA C;  2QA4 I;  3H1C A;  1U0J A;  3F6O A;  3E6M A;  3WU1 B;  3O6B B;  3FMR A;  2HGC A;  2JSC A;  3LAJ A;  5HNF A;  2OZU A;  1ETQ A;  2DMP A;  1TL8 A;  5GPC A;  1XS9 A;  2VKH A;  1R4N B;  3HPH A;  1MH3 A;  4EJO A;  2OBP A;  1MH4 A;  3HSR A;  1X1D A;  3RQ4 A;  1DGR M;  1VQO I;  5BQT A;  2HFH A;  1XB4 A;  1IN6 A;  4NC6 A;  4FET A;  2VBZ A;  2ZSH B;  3AG3 H;  4I98 B;  4DGW B;  5TRD A;  2L0K A;  5D5U B;  1YHQ I;  1FMW A;  3H3Z A;  1XGO A;  2R7F A;  1ZRD A;  3IV5 A;  1MDM A;  2MH9 A;  4BQN A;  5EEG A;  2JUC A;  3ASN H;  3OY9 A;  1S5L C;  1ORK A;  2N8G A;  5ICC A;  3FMS A;  2V4J C;  5ILS A;  1D0X A;  3IH3 A;  3E6B A;  3DPL C;  4UVC A;  4W97 A;  1T95 A;  3Q9S A;  1KYW A;  4C3H J;  3L1P A;  2ZCW A;  3L7W A;  5CVR A;  5IT3 A;  2Y30 A;  2RKH A;  2JUG A;  1GV5 A;  2V9K A;  1ZGJ A;  3F9K A;  2WAD A;  1KON A;  2L7F P;  1J2X A;  2CG4 A;  3S2W A;  3HZJ A;  4KT5 C;  2L9V A;  1XDS A;  1MGT A;  1ZGW A;  5E1X A;  1JUS A;  2RN7 A;  1MJA A;  1ETV A;  4E7J A;  3R4K A;  3KPH A;  5LHG A;  2Z5U A;  4LG0 A;  1WZ2 A;  1SD7 A;  2X9D A;  1S8N A;  4XLC A;  2W85 A;  3NEU A;  2PJR B;  4OOI A;  3LSH A;  3KLN A;  1W7P A;  2LKS A;  1VF9 A;  2A6T A;  3G73 A;  2DI3 A;  4BHB A;  3I5U A;  5DM6 F;  4HNV A;  4BEH A;  5J1Y A;  4L0Y B;  1BM9 A;  2YR2 A;  3J81 K;  4BXF A;  4NC8 A;  5KHD A;  3JRC A;  3I4P A;  1LDJ A;  2H27 A;  2V1N A;  1JTX A;  4G8X A;  4JOM A;  4S0H B;  2W24 A;  4PJ0 C;  1GT0 C;  1FJL A;  3CUO A;  2P6T A;  4G6Q A;  4EGZ A;  3ZQQ A;  4BJ6 C;  4M3B A;  4O6J A;  4KA4 A;  1SAU A;  2HVQ A;  3U1D A;  2DN0 A;  2GM4 A;  4UNO A;  2PMZ A;  2E36 A;  1QRY A;  3QWL A;  3P9C A;  4ZYG A;  3K4C A;  3KZI C;  2LTP A;  3S17 J;  4A3B J;  1W7P B;  1B8I B;  2X1C A;  5DEQ A;  4BU2 A;  2R92 J;  2LSO A;  1MBE A;  2O5R A;  1ZAO A;  1GXP A;  4I7H A;  2RQQ A;  2A6E F;  3LA3 A;  4R8H A;  1JJ6 C;  2OZ6 A;  2AO9 A;  3L00 A;  4OU0 A;  3MCZ A;  2W57 A;  2R0Q C;  3AG4 H;  2M7B A;  2Y48 A;  2LNB A;  5F0C A;  3Q0U A;  2R93 J;  4CCK A;  2LRD A;  2O7O A;  2GA1 A;  5BMZ A;  2QQB A;  4BH9 A;  2QM3 A;  3TL4 X;  1OMI A;  1MW7 A;  1Z9C A;  1XCB A;  3IHU A;  2IA2 A;  3H0G J;  2GOX B;  1CF7 A;  3F8C A;  2UXX A;  3ASO H;  2JA2 A;  3D5S C;  3LA7 A;  4RDU A;  2DPU A;  2M3A A;  4HYE A;  3CCL I;  3JSO A;  2IJL A;  1OCT C;  2UWM A;  3RI4 A;  4LMY A;  1HW2 A;  3GTP J;  3QYF A;  4JQF A;  3G6E I;  2CUJ A;  2CSO A;  4FIS A;  4DNC A;  2VKV A;  2HQN A;  5EEH A;  2ZFW A;  5L3E A;  1H9T A;  1E3P A;  1EH6 A;  2DA2 A;  4C2M J;  5JVG F;  2IA0 A;  1FOW A;  3OV8 A;  1T0F C;  5FKM A;  5FLX Z;  4ZYD A;  1UG2 A;  4ABZ A;  2FUG 2;  3C18 A;  5H6Q A;  3I59 B;  1T08 B;  4NQW A;  2NYX A;  5D5W B;  4LK1 F;  1LPQ A;  2ZBK A;  2JTV A;  3BG3 A;  3HEF A;  2K5C A;  4RBO A;  2FNA A;  5DD8 A;  3W3C A;  2G9W A;  1N75 A;  2EV0 A;  3AL0 B;  2DMU A;  2WBM A;  3IUO A;  1RET A;  5AON A;  4F3Q A;  4HRI A;  4ZYE A;  2QBY B;  4E4H A;  2R5Y B;  1C0W A;  3S2D J;  3GME A;  4Y3O A;  3DKY A;  1AKH B;  3I4N J;  4IO9 F;  4HAM A;  1MKM A;  5H2F C;  2Z1D A;  5TJJ A;  5HS8 A;  4NUB A;  4UUV A;  5C4J J;  1P4W A;  4II2 A;  5J3L A;  2ZSI B;  2JT1 A;  3KYL A;  4B44 A;  1UHS A;  3A02 A;  1OCZ H;  2NS7 A;  3BTI A;  3WTU C;  4B43 A;  1S29 A;  4ZYA A;  4B47 A;  4RS8 A;  3ZMU A;  1MJB A;  1D0Y A;  3P5J A;  1M1E B;  3F3X A;  1LNW A;  1UHM A;  3DU5 A;  3OOU A;  1IC8 A;  3KX2 A;  1W5S A;  3GZ5 A;  1QVU A;  1YOV B;  4DIQ A;  3SEZ A;  1R9T J;  3GTJ J;  1FBS A;  3ZQL A;  1JKR C;  2R4G A;  4QPO A;  4ZZD A;  1OFC X;  3PNY A;  1NH3 A;  3FIS A;  2VE8 A;  1MMS A;  1D5V A;  3BPX A;  3DTE A;  4L9T A;  2BEO A;  2F4O B;  4D5C A;  4PSX A;  2EFO A;  3CJR B;  3FKI J;  4OAY A;  2XIG A;  3RPU D;  2DQL A;  2DA6 A;  4E7L A;  4BY7 J;  1I39 A;  4BHC A;  1VI0 A;  2M4G A;  3HOU J;  4A3M J;  5L3D A;  4GXO A;  4L0Z B;  1UEL B;  1AHD P;  3K69 A;  3HRT A;  1JE8 A;  5DTD A;  2K4B A;  3KEQ A;  4PDK A;  3WTX C;  2JA6 J;  2CW7 A;  3DEE A;  4YFX F;  1TQM A;  1R23 A;  1SAN A;  5CKT A;  4E70 A;  4RGX A;  1YJW I;  4RB2 C;  2LG4 A;  5M5Y J;  3E97 A;  2ELK A;  5EYR A;  1G8X A;  1S7E A;  4M6Y A;  5ILU A;  2VT2 A;  2LP0 A;  3KIO A;  3AG1 H;  2JMW A;  1LKX A;  3CME I;  1XMK A;  3BR2 A;  4UB8 C;  1I3A A;  3K4J A;  3H5A A;  2NXN B;  1Y0N A;  1MZB A;  3FXQ A;  2V9P A;  2B63 J;  4BGD A;  1RZ4 A;  5FO5 A;  3ROU A;  3F72 A;  4A2U A;  2ZJ2 A;  4N4O B;  4LIU A;  3DTI A;  1HA8 A;  1ETX A;  5IP6 A;  2EH3 A;  2Z33 A;  4HQE A;  1A6Q A;  4KNY A;  3S8P A;  4MTD A;  2OAZ A;  4XRS G;  2QF7 A;  2CQX A;  3JRF A;  3F0C A;  1OYI A;  5DV5 A;  4ZC3 A;  1B9M A;  4HNT A;  3K1P A;  5E1W A;  4D1Q A;  4OIO F;  2IT0 A;  1R7J A;  2QQA A;  1W7P D;  1SVO A;  3MKZ A;  3ZMS A;  3IWZ A;  2K9N A;  3B6A A;  4NC7 A;  2X4H A;  3CDI A;  4CDG A;  3CLO A;  3TP3 A;  2VI6 A;  4QIW N;  2O61 A;  4D9J A;  3A2K A;  2XV4 S;  2ZNZ A;  1R71 A;  1F1Z A;  2BY0 A;  2KRC A;  2KDO A;  3WE2 A;  1ZAR A;  2FEZ A;  1AOY A;  1KQ0 A;  4JX5 A;  2L4A A;  2VJ4 A;  2OQG A;  3HPG A;  1HF0 A;  2M45 A;  3KP6 A;  5J1U A;  1ZN2 A;  3BZK A;  1FOX A;  3GFL A;  2NRA C;  1ZEL A;  2UZK A;  1H9G A;  1K83 J;  1I6X A;  2TCT A;  3GBG A;  4N9I A;  3W6K B;  1FZP B;  1YS6 A;  2EBI A;  2KPM A;  4IHV A;  2Q0O A;  4D0P A;  5LLQ A;  1U6G A;  5EDN A;  3BQY A;  1B59 A;  3LMM A;  3ZN1 A;  3HUG B;  4PK4 A;  2XKO A;  4XN0 A;  2D5V A;  3CP8 A;  2ADU A;  1V5G A;  4L5J A;  2CRG A;  4HF1 A;  2L2O A;  3KET A;  2W1O A;  3BJA A;  2PMH A;  4LFU A;  3KEO A;  2X1E A;  2LD5 A;  3F8M A;  3PFI A;  4EM0 B;  5JLX A;  3FXJ A;  4IXA A;  4MGR A;  4JP0 A;  3MZH A;  3EUK L;  3H36 A;  3AAF A;  1R22 A;  4XMY A;  4ZZL A;  2DT5 A;  1F5T A;  1I27 A;  3CQZ J;  1SEU A;  3M1E A;  4M74 A;  1N77 A;  2ZXI A;  1XSD A;  3S1R J;  2BBY A;  2VXD A;  3KEY A;  1SAX A;  5KAI C;  3FK7 A;  3KLO A;  4A12 A;  1ZTR A;  2LLK A;  1W4M A;  1V54 H;  2R7U A;  4U0Y A;  4EEF G;  5B1B H;  4ESB A;  3OYG A;  2QEX I;  3OYB A;  4UUT A;  3ZPL A;  4PSW A;  5JFR A;  2NS8 A;  3H9J A;  2B7E A;  3BJO A;  3OMY A;  4KJZ A;  2DXI A;  3J7Z I;  2Z9O A;  1Y6I A;  5FGM A;  3K4N A;  5D6F A;  4A3G J;  5B3S H;  3A0B C;  3MVP A;  3L2V A;  2VPL A;  2KT0 A;  3GYH X;  1J5Y A;  1AU7 A;  4PUS A;  5DD4 A;  1IXC A;  2IVM A;  1QNT A;  3BG9 A;  2J5P A;  1W36 D;  3KZY A;  3PJR A;  1O4X A;  1OPC A;  1MMD A;  3MKY B;  1J75 A;  3CCJ I;  2L9N A;  3LST A;  3TO7 A;  1LJ9 A;  5F6F A;  3V7C A;  2P7C B;  2CQK A;  2GXA A;  2CUE A;  1P6R A;  1X2N A;  4B8X A;  3CC7 I;  1BI2 A;  3JAM K;  3DEU A;  2QKL B;  4V2G A;  2GQQ A;  2QKM B;  5TIS C;  1OCR H;  3OIO A;  1BN5 A;  2GA2 A;  4EJU A;  2ZXW H;  3CTA A;  3VEP A;  2RAE A;  1QHG A;  5IYB J;  4YRV A;  3AG2 H;  1OCP A;  1LVK A;  1BR4 A;  2LKP A;  3FM3 A;  4GDF A;  4AIK A;  1OJL A;  1AWC A;  1IRZ A;  1A04 A;  1SFU A;  3HIF A;  4HW0 A;  4FHT A;  3IH2 A;  1KU3 A;  1WPK A;  2VKD A;  3BR1 A;  2R5Z A;  1V4R A;  4HDV A;  3SHF A;  1R5H A;  1P2F A;  4C9Y A;  3I55 I;  5L3G A;  1YQA A;  3WTV C;  1XTA A;  5HNH A;  1ERD A;  1WHU A;  1RKW A;  3BT9 A;  3HKZ N;  3VOD A;  1F9N A;  4LIV A;  1Z67 A;  4XKW A;  2CYY A;  2K3P A;  1S7A A;  3C2G A;  5GPA A;  1IG7 A;  1VZ0 A;  5E8I A;  2COB A;  2P6S A;  1LB2 A;  2KJB A;  5B1A H;  3G1O A;  5ICF A;  2V26 A;  1HCR A;  4I0A A;  5EZH A;  3HB9 A;  2LR8 A;  1OR7 A;  1BI3 A;  2GIZ A;  1TWF J;  5JVT A;  3EDP A;  4TV7 A;  4IPA A;  4CSW A;  2F2E A;  1JGS A;  4IHS A;  2NOG A;  1WGX A;  1R5I D;  1ZK8 A;  2IS1 A;  4CCL A;  3ZMD A;  4GCV A;  2QYO A;  4A6E A;  4DYR A;  4H0E A;  4F7Z A;  1PVE A;  4CZZ A;  1FNN A;  2HYG D;  3IC7 A;  2DTZ A;  5IT9 K;  3JRI A;  2IPQ X;  2XAU A;  4KDP A;  2P5K A;  3JRB A;  2F48 A;  3H9Q A;  1FX7 A;  1IF1 A;  3M4O J;  2DFI A;  3RKW A;  1FEX A;  2M2E A;  2Q1Z B;  3KP2 A;  4JBA A;  2E71 A;  2F6C A;  2WAQ A;  3V8L A;  2R3S A;  3PNV A;  3JRE A;  2VT3 A;  1Z6R A;  4ZJZ A;  4HX7 A;  3TMO A;  5E18 F;  1FC3 A;  3FKJ A;  3H5N A;  1ZR2 A;  3DXJ F;  1W0T A;  2LRE A;  5IY5 H;  5DM7 F;  4YFK F;  3IRQ A;  2E35 A;  2ISY A;  4HG2 A;  2JJ7 A;  2BOL A;  1WI9 A;  2FX0 A;  2KQR A;  3BR0 A;  3AL0 C;  3RSN A;  5CQG A;  3L2U A;  1HKQ A;  5FRO A;  1W0U A;  2HWV A;  4S05 A;  4YII A;  4B48 A;  1G3S A;  4BY1 J;  2HYJ A;  3BTL A;  1OLT A;  3GEZ A;  5E20 A;  4CO8 A;  2NVT J;  4G7O F;  1FWZ A;  5E79 C;  2IGN A;  3EUH C;  3CCM I;  1JXS A;  2QLZ A;  2ESH A;  1R49 A;  1D3Y A;  4IHW A;  1HKT A;  2A68 F;  5HLI A;  4A3C J;  1HXD A;  2ESN A;  1QZZ A;  3KP7 A;  2VJJ A;  3U2R A;  1LUJ B;  1QZE A;  2RVC A;  2GZW A;  4L9V A;  3MZY A;  1E3O C;  2EFW A;  1GVD A;  4DZJ A;  3BZC A;  5DYM A;  5E3M A;  4BDY A;  2L54 A;  1P7J A;  3DLA A;  3QYB A;  2A61 A;  4OMY A;  2E1N A;  2FBH A;  4WX9 A;  3OS0 A;  3ZMZ A;  4S04 A;  3HDD A;  2EIN H;  3WTS C;  5FRM A;  5EG0 A;  5F64 A;  1SMY F;  3LA2 A;  1X3U A;  3FIW A;  2W84 A;  1O3Q A;  2QWW A;  4DBR A;  4GYG A;  2IBD A;  4J01 A;  1FP1 D;  2R7W A;  3KZZ A;  3RIR A;  4NNJ A;  1Q1V A;  3K10 A;  2KJC A;  5JHU A;  1W5C C;  2L5Q A;  4U0W A;  6PAX A;  1LFU P;  3L9F A;  5LHH A;  3PNT A;  4F92 B;  4CYC B;  2QCO A;  3CMY A;  2V7F A;  4GFB A;  3V7R A;  1U9N A;  1FPQ A;  2JPB A;  4Q48 A;  1K6O A;  1G4D A;  3NQO A;  4N0B A;  4C3J J;  1VQ8 I;  4RB1 A;  3DFG A;  4UV8 A;  1IN5 A;  2MC3 A;  1X58 A;  3HBL A;  4F52 A;  2NVU B;  1AKH A;  1QPM A;  2KIF A;  4WXC A;  2K40 A;  2BW3 A;  2WY8 Q;  2EIJ H;  3ZQF A;  4A3D J;  2VJ5 A;  4KUM A;  5ILV A;  3GCM A;  2PG4 A;  1WJB A;  2KFD A;  4LLG F;  1BI0 A;  3BP8 A;  2BY2 A;  4L5I A;  1MSE C;  3KYD B;  1QBJ A;  3BTC A;  4ZH4 F;  2QUF A;  1DGW Y;  5CYV A;  4CGZ A;  3HG9 A;  4QSH A;  1Z91 A;  4RAZ A;  2Z2S B;  4G6D A;  1TC3 C;  3SZT A;  2IW5 A;  4BS9 A;  9ANT A;  2WV0 A;  2W4S A;  2CQ7 A;  3H92 A;  3CCQ I;  3HOS A;  1IW7 F;  1T33 A;  2DJN A;  2DOE A;  4IRH A;  2WA0 A;  2EWN A;  4MLO A;  4C3I J;  2ME0 A;  3LNQ A;  1KA8 A;  2M87 A;  3DF8 A;  4NDL A;  4XLE A;  3UKG A;  2BXZ A;  1Y0U A;  5GAD J;  1JHH A;  1XCV A;  1EKE A;  2XUB A;  2JRM A;  3OYC A;  1ITY A;  3LAP A;  2DA7 A;  2NVQ J;  2DU9 A;  3K1N A;  1IXS B;  5AIQ A;  4FE7 A;  5KK1 A;  1JUP A;  4WCG A;  4QWQ A;  2GIV A;  2ZKZ A;  3OS1 A;  3TW7 A;  2YUS A;  4E7Z A;  1SFE A;  3ZN0 A;  2EFP A;  1OCC H;  3R60 A;  1E17 A;  2DDB A;  2DFE A;  1HW5 A;  2YU9 J;  2HOA A;  1YW7 A;  1YO5 C;  4II3 A;  4XRF A;  2IS4 A;  4Z6Y A;  1KU7 A;  2DMN A;  3OWT A;  1F36 A;  3IKV A;  2M9H A;  5J6X A;  4QTR A;  5C4X J;  3R0J A;  1RIO H;  3VDX A;  3A01 A;  2EIK H;  1Y8Q B;  2HNH A;  3T0Y A;  5LGN A;  1J09 A;  1T2K A;  3ZQG A;  5C3E J;  3A01 B;  5CJ9 A;  2ZXH A;  3E1S A;  1ON2 A;  3K4B A;  1LVA A;  5D4S A;  5L3B A;  3OS2 A;  2CFO A;  4A3F J;  2XAJ A;  4M9X A;  2E19 A;  5E3O A;  5IT9 Z;  2IS2 A;  1YTY A;  4OIP F;  1X4P A;  3NAR A;  1ZGA A;  2PI0 A;  2G7H A;  4KN4 X;  1FSH A;  1XG1 A;  1QA6 A;  5E3L A;  4RB0 A;  1SD6 A;  5J8F A;  1RUN A;  1OKR A;  1OQY A;  1FIA A;  4CYD A;  2ISZ A;  2HPI A;  2R5Z B;  1IUF A;  3OYA A;  2LY1 A;  3ESW B;  4XOR A;  1H0M A;  4ETS A;  1SFK A;  2R7Q A;  2YU3 A;  1TTY A;  2P8T A;  3K2A A;  4HV5 A;  4BXU A;  3S3O A;  2LOO A;  1Y1V J;  4BAC A;  1QO0 D;  1YJ9 I;  1MD0 A;  3HGY A;  1HST A;  2DOD A;  4C2U A;  1Z7L A;  3KFW X;  3SQN A;  4B09 A;  3M7G A;  2V6C A;  4WXH A;  2DA5 A;  1P7I A;  5J1R A;  2A3S A;  1BR2 A;  4Y17 A;  3BOQ A;  1DUX C;  2L01 A;  2X48 A;  3DBR B;  4KMU X;  4K2E A;  1N78 A;  4LK0 F;  1OR7 C;  1RRJ A;  2DTR A;  4CYC A;  2IGK A;  2WB1 N;  3K70 C;  3QU6 A;  2PEX A;  1IN7 A;  1BIB A;  2YPR A;  2Y9Y A;  4IQ4 A;  4MTE A;  3I59 A;  2LBF A;  2HTJ A;  2QEN A;  2ACJ A;  2K3F A;  3FF5 A;  3WOD F;  2CO5 A;  1ZG3 A;  4J00 A;  1IV8 A;  3HJE A;  1GDT A;  2AHQ A;  2LY9 A;  4PZJ A;  1R1U A;  1A31 A;  1NTC A;  3GTL J;  4DJA A;  3WGI A;  2ME6 A;  5FLV A;  1EJ9 A;  1OYY A;  3H3V K;  3DP7 A;  2L02 A;  5LGT A;  2MG4 A;  4HX4 A;  1LQ1 A;  2OCC H;  1WH5 A;  2X6W A;  3G3Z A;  4YEJ A;  3CES A;  2LY2 A;  4O5V A;  1LE8 A;  2M8G X;  3DQV C;  2EB7 A;  2EFN A;  4BBS J;  1JT0 A;  1J7K A;  1PP7 U;  3QPL A;  3VSL A;  5F08 A;  3RQI A;  3FXU A;  3NWS A;  1BL0 A;  2XGC A;  1Z77 A;  1TT5 B;  1YX5 A;  1SD5 A;  3PUF A;  1VFC A;  2H1K A;  4PGH A;  4I2O A;  4PFP A;  1T6S A;  2C6Y A;  3U9G A;  3FMQ A;  3ZRG A;  1XC5 A;  5GTI C;  3OL4 A;  3ZR8 X;  4X1E A;  2JPC A;  2RRE A;  1WKM A;  2FBI A;  2L9S A;  3L2R A;  1OYW A;  4AU7 A;  1VQL I;  1EF4 A;  1ETO A;  3A0H C;  3EYY A;  1V5F A;  2L7Z A;  2HVR A;  2DW4 A;  1TWG J;  3MZ8 A;  2BY3 A;  1LEA A;  3I3L A;  4Q47 A;  1B8I A;  4M71 A;  4OMZ A;  3BG6 A;  3V8K A;  3CUQ A;  4ENK A;  3B73 A;  1NK3 P;  4U0V A;  2M8E A;  1IN8 A;  3KP4 A;  4HPQ A;  2BVM A;  1FT9 A;  2E5N A;  3H9G A;  5HLT A;  2PQ8 A;  2STW A;  1L0O C;  2H8W A;  3DTK A;  5HDN A;  2KZG A;  3E7L A;  2JQ7 A;  3CP2 A;  4RAF A;  1IO2 A;  3E6C C;  2E5Z A;  4A0Z A;  2DA1 A;  4E7K A;  1KGS A;  3BCB A;  2VPR A;  2VQG A;  3X2Q H;  2EPF A;  2VUM J;  1UST A;  3OSF A;  2ECB A;  5DDG A;  4XLF A;  4MEY F;  4XK4 A;  2XHK A;  3DKX A;  1OIS A;  1HC8 A;  2XAH A;  4XRS A;  1BOA A;  2FD5 A;  2KP6 A;  1WJD A;  2BXY A;  2EZK A;  2O0Y A;  1TLH B;  2Q2E B;  2ZO4 A;  1ON1 A;  2CS3 A;  2FXA A;  3FBN B;  1MMN A;  5KAF C;  3TW6 A;  2X6O A;  3M1C A;  1R58 A;  2Y2Z A;  1WWX A;  2RQP A;  3QP6 A;  3FM5 A;  1BW6 A;  3GVA A;  3OYI A;  4A93 J;  2OU2 A;  3OR2 C;  1Z0X A;  2A5Y B;  5DCM A;  1LFP A;  1KQ9 A;  2NVY J;  1J9I A;  2DBB A;  3I9V 2;  3M8E A;  2FRH A;  2IAI A;  1P92 A;  1SMT A;  5EEA A;  2DA4 A;  1O3R A;  2OPT A;  2UV1 A;  3CC2 I;  1I50 J;  4RMN A;  1BW5 A;  1BBY A;  3EQL F;  3JRG A;  5EF6 A;  1IGN A;  3JW4 A;  4HBL A;  4XLH A;  1I6H J;  1VQN I;  1A35 A;  3VWB A;  3ZMT A;  2VC0 A;  4FTH A;  3FDY A;  1SVM A;  3K9T A;  3GLX A;  3GTG J;  3E0J B;  3ERE D;  3FXL A;  4O3M A;  5BOX A;  2UUZ A;  1IRX A;  3KP3 A;  3MFK A;  1WSU A;  4BE0 A;  3VYU B;  3WTT C;  5EGO B;  1B72 B;  2M5W A;  2JWT A;  2VQC A;  2BHY A;  4IF4 A;  4NB5 A;  2H09 A;  3EPZ A;  3SJM A;  5EGO A;  4XLA A;  3R6S A;  4RAY A;  1T8I A;  5KNL A;  2E1M B;  1ZG5 A;  2E2H J;  3DCF A;  3QP5 A;  3HRM A;  2GWR A;  2K27 A;  4CUG A;  2R7T A;  3WGH A;  4WXD A;  3HRS A;  2BY1 A;  2OD5 A;  5EZG A;  2XSJ C;  1X3W B;  1I1G A;  3SFI A;  2E7X A;  2FMY A;  4LG0 B;  3PQJ A;  2HOE A;  2KHM A;  3VB2 A;  3ZGK A;  5CLS A;  4HA8 A;  4EJV A;  3A03 A;  5K7Z A;  1IAW A;  1BA5 A;  2MW8 A;  1Z3Y A;  4XOP A;  1FOY A;  2VOP A;  1DQU A;  2KIS A;  2CQN A;  3WTW C;  3ABK H;  2ZNY A;  3TOA A;  2Y9Z A;  4QLC U;  3O8G A;  4IL6 C;  5FJ8 J;  3TKY A;  1EH8 A;  2O03 A;  5LGU A;  4G12 A;  1K6Y A;  3OYM A;  1LEB A;  5ICG A;  4EJT A;  2VLA A;  4AVP A;  1YW9 A;  5LRR A;  3BCA A;  5CVJ A;  1JI8 A;  2NNY A;  4BQA A;  3W2V A;  1VQM I;  1ZR4 A;  2ZFU A;  2F4I A;  4A3J J;  3GO5 A;  3SXY A;  2L7K A;  1T98 A;  3FK6 A;  3VYT B;  3OYH A;  1A5J A;  4HLY A;  2JA7 J;  4ENN A;  4HLX A;  3EUH A;  2W00 A;  4E7I A;  1U5T A;  3MAJ A;  3GXO A;  4Y52 J;  3WG9 A;  3C2B A;  2LKX A;  2CQQ A;  3J80 Z;  1G59 A;  2FA5 A;  4NHJ A;  4XKC A;  3K70 D;  3K4L A;  3E5Q A;  2MAB A;  3RPQ A;  4AC0 A;  2QQ9 A;  2VJI A;  2A05 A;  4A5M A;  2JA8 J;  4RLF A;  3ABU A;  3VSK A;  2EK5 A;  4BYY A;  5M3F J;  3TED A;  2YS9 A;  3N4M A;  1KZH A;  1G6N A;  5HS7 A;  5LRS A;  2BGC A;  1XGN A;  1QPI A;  3WTZ A;  5FKK A;  2P4W A;  2BYV E;  1E2X A;  2HQR A;  1B4A A;  1ULY A;  4IHY A;  4G9Y A;  5HS9 A;  3ML6 A;  5M5W J;  2Y0S A;  1FTT A;  2HYF A;  2B0L A;  1MNM C;  4I6Z A;  1BR1 A;  1IDZ A;  3QQA A;  3BPV A;  2MC4 A;  2XVC A;  4CCO A;  2I8D A;  2LMD A;  3VPR A;  3WU2 C;  4AYB A;  4BEH B;  1QVT A;  1PUF A;  1DDN A;  2DCE A;  3IH4 A;  3LFU A;  3CF2 A;  1MBF A;  2IGM A;  2YSR A;  1GLN A;  3OOP A;  2VL8 A;  3CLQ A;  2MSY A;  4MFE A;  3A4C A;  2XC7 A;  1JHF A;  1LDK B;  1Z1D A;  2FQ3 A;  4L9N A;  3ZQI A;  2XB5 A;  3HM5 A;  4D5F A;  2ZJR F;  4HOB A;  2I5U A;  3JSP A;  1N25 A;  3PIP F;  2QBY A;  4IHX A;  3F8B A;  5GP9 A;  1Y8R B;  2FJ1 A;  4EGY A;  1T39 A;  5E1Z B;  3HGG A;  2HTS A;  2KZV A;  2GXG A;  1YI2 I;  1W36 C;  3GTK J;  1BI1 A;  1TW3 A;  3ISP A;  4RLQ A;  3BLY A;  2VXZ A;  4KYW A;  3G2B A;  1G3T A;  1NK2 P;  4E7H A;  1H88 C;  4AYB N;  3CCY A;  4YIR X;  3RYP A;  1D1A A;  1MBH A;  3FX3 A;  3ZOB A;  5BPD A;  2GLO A;  2ZB9 A;  3OYF A;  2DFF A;  4MQV A;  3BWG A;  3K7A J;  2O8X A;  3VYR B;  4NBQ A;  3CMM A;  5IP9 J;  3GLL A;  5H20 A;  3IAM 2;  3SZG A;  1UHW A;  1KYZ A;  5J8C A;  3HTU A;  2RGV A;  3KYC B;  5IOY A;  5B66 C;  4G6T B;  1H8A C;  3PO3 J;  5F27 A;  3HTS B;  3RKX A;  3H0D A;  3PSF A;  4G7Z F;  3K4K A;  2DYR H;  3JR9 A;  4PJM A;  4UUS A;  1FTZ A;  2R7X A;  4KIG A;  1K7A A;  1WQ2 A;  2PMZ N;  4X0G A;  4ESJ A;  2W7N A;  4XSX F;  3N97 A;  1ZG1 A;  3DPT A;  3D0S A;  2K7L A;  3ONQ A;  3RDI A;  4XL9 A;  5D4R A;  1SFO J;  3DLL F;  4HNU A;  5LEK A;  1YIT I;  3OYN A;  3ZQC A;  5CVI A;  3I53 A;  2OA4 A;  5LD2 C;  3CCU I;  3CCE I;  4F91 B;  1XMX A;  2DJI A;  1VQ5 I;  2DFH A;  3I54 A;  2VQL A;  4P55 A;  5DCF A;  2HVS A;  4BNC A;  4BJT A;  1R00 A;  3FXM A;  2JK3 A;  3M8J A;  3WU0 A;  2RNG A;  3AKZ A;  5FKN A;  1U2W A;  2LYC A;  4PFO A;  2OCE A;  1IRF A;  5J40 A;  4XON A;  4RGR A;  3BDD A;  4CHU A;  2E60 A;  2LF8 A;  4XOT A;  3SFZ A;  4ZDP A;  3LQQ A;  3W2A A;  4U7D A;  4XKB A;  1XMA A;  2W25 A;  3F22 A;  2CJJ A;  1K79 A;  1O3T A;  4RM3 A;  3P9K A;  2P5L C;  5JI6 A;  2X1D A;  4CCM A;  1UZC A;  3P7N A;  1LDD A;  5FFX A;  1OCO H;  5ED4 A;  3DBH B;  1F4K A;  4XN3 A;  2KIQ A;  1UAA A;  4IVN A;  3I56 I;  5J47 A;  4G7H F;  3MWM A;  4UUS B;  4IKF A;  4A3E J;  2LVS A;  1Z3X A;  2WC2 A;  3QOP A;  2IRF G;  3HC7 A;  2HDC A;  5K5O A;  2Y69 H;  4XLP F;  4P9F A;  1R6R A;  1FYK A;  1L3L A;  4UY8 I;  3LSG A;  2IXS A;  1RPW A;  2BW3 B;  1Z05 A;  2BV6 A; 
#chains in the Genus database with same CATH homology
 5C3E J;  2XB0 X;  3A01 B;  2DA6 A;  5F04 A;  4BY7 J;  1VI0 A;  3HOU J;  4A3M J;  2FQ4 A;  2K9S A;  1AHD P;  2NVX J;  4A3F J;  2E19 A;  5E3O A;  5DTD A;  5JLW A;  1ETK A;  3NAR A;  2JA6 J;  3BTJ A;  5IPA A;  3LOC A;  1SAN A;  1PUF B;  1XG1 A;  5E3L A;  3WHB A;  4XIC A;  5K7H A;  3I4M J;  1ZQ3 P;  3BR5 A;  5M3M J;  5M5Y J;  4BXX J;  2ELK A;  2Y31 A;  5EYR A;  1FIA A;  1MBJ A;  1S7E A;  2KDZ A;  2R5Z B;  2LP0 A;  1IUF A;  4D7M A;  2JMW A;  3K2A A;  2L7M P;  2EZH A;  3BR2 A;  4AUX A;  3NAU A;  2DA3 A;  1Y1V J;  1RKT A;  1DU6 A;  3HGY A;  1JTY A;  2M34 A;  2HDD A;  1JKQ C;  2B63 J;  2DA5 A;  3JRA A;  1P7I A;  5J1R A;  1A6I A;  2I10 A;  3Q0W A;  1ETX A;  2X48 A;  4M6V A;  5IP6 A;  2EH3 A;  4DZP A;  1B72 A;  5FLM J;  4D7N A;  1CQT A;  3W6V A;  3Q3S A;  4DW6 A;  4XRS G;  2QF7 A;  2CQX A;  4CYC A;  3JRF A;  2WB1 N;  3BQZ A;  1U9O A;  3F0C A;  4MO7 A;  3S1N J;  2HI3 A;  2Y9Y A;  1UMQ A;  5IYC J;  2EQR A;  2EZL A;  4Y7N J;  1ETY A;  2MGQ A;  2K9N A;  3B6A A;  1GDT A;  1JGG A;  2AHQ A;  2LY9 A;  2XPU A;  1NTC A;  3GTL J;  3TP3 A;  2ME6 A;  5FLV A;  4DYQ A;  4DYC A;  2VI6 A;  4QIW N;  3H3V K;  2MG4 A;  4JX4 A;  1WH5 A;  1Y1W J;  1G2H A;  1GV2 A;  3BR6 A;  4JYK A;  4JX5 A;  1LE8 A;  2M8G X;  2ECC A;  1HF0 A;  4M3F A;  4BBS J;  1JT0 A;  3WHC A;  5J1U A;  3QPL A;  3ZQG A;  5F08 A;  3RQI A;  3BG5 A;  3ZQH A;  1BL0 A;  2XGC A;  1Z77 A;  1K83 J;  1VFC A;  2TRT A;  2H1K A;  2TCT A;  3GBG A;  3Q0V A;  2LK2 A;  1VND A;  2EBI A;  1X2M A;  2E2J J;  4IHV A;  1XC5 A;  2IEK A;  2Y0S N;  4J19 A;  4X1E A;  5EDN A;  3BQY A;  1EF4 A;  1ETO A;  2JA5 J;  2L7Z A;  2D5V A;  1TWG J;  2LFB A;  2R5Y A;  1APL C;  1B8I A;  2CRG A;  3S14 J;  2LD5 A;  1NK3 P;  3HOX J;  4LOC A;  5JLX A;  3G1L A;  3S1Q J;  3S1M J;  2DMQ A;  4JP0 A;  1GUU A;  3E7L A;  3CQZ J;  2DA1 A;  3RZO J;  2VPR A;  2VUM J;  2O8K A;  2E2I J;  3OSF A;  2ECB A;  3S1R J;  4XK4 A;  1TWC J;  3FK7 A;  1ZTR A;  2LLK A;  4A3I J;  1WCM J;  4XRS A;  5FKL A;  2FD5 A;  2EZK A;  1JT6 A;  3LSJ A;  4EEF G;  3HOZ J;  4UUT A;  3B6C A;  2NS8 A;  1JKP C;  2W48 A;  2K9Q A;  3TW6 A;  2X6O A;  1ZKG A;  2OF7 A;  3MKL A;  2Y2Z A;  2ID6 A;  1BW6 A;  4A93 J;  1Z0X A;  4A3G J;  4FE4 A;  2ID3 A;  2NVY J;  3MVP A;  5BNG A;  2KT0 A;  3M3Y J;  1AU7 A;  4IEJ A;  2XPW A;  1T56 A;  5DS9 A;  1F43 A;  2VKE A;  2IAI A;  3BG9 A;  5EEA A;  2DA4 A;  3QPS A;  2OPT A;  1O4X A;  2H8R A;  3GTO J;  1I50 J;  1BW5 A;  3HOY J;  3JRG A;  2P81 A;  1YRN A;  5EF6 A;  2CUE A;  3S16 J;  1IGN A;  1X2N A;  1I6H J;  4V2G A;  1RES A;  4FTH A;  4V2F A;  3OIO A;  3GTG J;  4A69 C;  4X6A J;  3RZD J;  1WH7 A;  2RAE A;  5IYB J;  2HXO A;  5EGO B;  1B72 B;  4W1U A;  5IP7 J;  3BR3 A;  2JWT A;  1OCP A;  1OJL A;  1K61 A;  3SJM A;  1IRZ A;  3CDL A;  5EGO A;  2JN6 A;  4XRM A;  3S15 J;  3IH2 A;  2E2H J;  1WPK A;  3DCF A;  5FKO A;  5F1J A;  1JUM A;  1HDP A;  3BR1 A;  2R5Z A;  1TWA J;  1IV6 A;  5M5X J;  1WI3 A;  1BJZ A;  5EZG A;  2L9R A;  3SFI A;  1RKW A;  3BT9 A;  3HKZ N;  3MN2 A;  1MBK A;  2XRL A;  1YRN B;  4B4C A;  3A03 A;  5GPA A;  5K7Z A;  1IG7 A;  1BA5 A;  2MW8 A;  2COB A;  2G0E A;  2EZI A;  4BBR J;  1HDD C;  1JJ8 C;  3G1O A;  3RKQ A;  2WV1 A;  2Y9Z A;  3O8G A;  5FJ8 J;  1HCR A;  2DMT A;  5EZH A;  3HB9 A;  2LR8 A;  4G12 A;  1TWF J;  3OSG A;  2XGD A;  3G1M A;  2XSD C;  2NOG A;  1WGX A;  1ZK8 A;  4I76 A;  1ETQ A;  2HOT A;  2DMP A;  3PM1 A;  5GPC A;  1ZR4 A;  4DYR A;  4A3J J;  1XS9 A;  1IDY A;  1MH3 A;  1I3Q J;  1MH4 A;  1TWH J;  2DTZ A;  3FK6 A;  3JRI A;  3DEW A;  2JA7 J;  1A5J A;  3JRB A;  1MSF C;  2L0K A;  3M4O J;  1FEX A;  4Y52 J;  3C2B A;  2M2E A;  3IV5 A;  2LKX A;  2CQQ A;  2E1O A;  2CU7 A;  3GTQ J;  5F0F A;  5EG0 B;  3JRE A;  4AC0 A;  2N8G A;  1ORK A;  5HOD A;  2JA8 J;  2XPV A;  3IH3 A;  5M3F J;  4A3L J;  4W97 A;  5C44 J;  2YS9 A;  3LSR A;  4C3H J;  3TED A;  1ZR2 A;  1W0T A;  3L1P A;  1U78 A;  1QPI A;  2Y30 A;  5FKK A;  1GV5 A;  2L7F P;  2JJ7 A;  3BR0 A;  2FX0 A;  4IHY A;  5M5W J;  1ZGW A;  1FTT A;  1JUS A;  5IYD J;  1W0U A;  1ETV A;  4MFD A;  4BY1 J;  2HYJ A;  3BTL A;  1MNM C;  4I6Z A;  2NVT J;  1IDZ A;  3QQA A;  2X9D A;  1PUF A;  3VPR A;  4IHW A;  1QVT A;  4A3C J;  3HOV J;  1VF9 A;  3IH4 A;  4HNV A;  1MBF A;  5J1Y A;  2MSY A;  3D1N I;  1E3O C;  4MFE A;  1GVD A;  4DZJ A;  3JRC A;  5E3M A;  1JTX A;  3ZQI A;  1P7J A;  2XB5 A;  3HM5 A;  2M0C A;  4S0H B;  3TP0 A;  4D5F A;  2R7Z J;  1GT0 C;  1FJL A;  4M3B A;  4IHX A;  5GP9 A;  2DN0 A;  2GM4 A;  2FJ1 A;  1QRY A;  3HDD A;  3HGG A;  1JKO C;  5EG0 A;  3GTK J;  2LTP A;  3S17 J;  4A3B J;  1B8I B;  3S2H J;  1LFB A;  2R92 J;  3FIW A;  1MBE A;  2IBD A;  1HOM A;  2XGE A;  1NK2 P;  1H89 C;  1Q1V A;  1LE8 B;  1JJ6 C;  1H88 C;  2AO9 A;  4AYB N;  3CCY A;  3LSP A;  2R0Q C;  1LFU P;  2CUF A;  1MBH A;  5F0C A;  3Q0U A;  3ZOB A;  2R93 J;  4CYC B;  2QCO A;  3CMY A;  1D5Y A;  2GLO A;  2O7O A;  2ZB9 A;  4GFB A;  4FCY A;  1U9N A;  4B1R A;  3K7A J;  4C3J J;  3H0G J;  5E3N A;  5K7F A;  5IP9 J;  4RDU A;  1X58 A;  3HBL A;  1AKH A;  1OCT C;  5IOY A;  3PO3 J;  1H8A C;  2K40 A;  5F27 A;  4A3D J;  3ZQF A;  3GTP J;  2HQ5 A;  3O8H A;  3JR9 A;  2O9L A;  4FIS A;  4UUS A;  1HLV A;  2VKV A;  1FTZ A;  4XID A;  2DA2 A;  4C2M J;  2PMZ N;  4M3G A;  1ENH A;  1IJW C;  1MSE C;  3BTC A;  5FKM A;  1UG2 A;  4ABZ A;  1DU0 A;  1SFO J;  3JRD A;  4QSH A;  1ETW A;  1TC3 C;  3ZQC A;  4B3A A;  3BG3 A;  3HEF A;  9ANT A;  4MIM A;  4RBO A;  1FIP A;  1T33 A;  2DJN A;  1MBG A;  1POG A;  2DMU A;  4C3I J;  1RET A;  4MLO A;  2ME0 A;  3LNQ A;  3GTM J;  4NDL A;  3UKG A;  2JK3 A;  1U8B A;  2R5Y B;  4M3D A;  3PO2 J;  5FKN A;  3S2D J;  1AKH B;  3I4N J;  3HOW J;  1ITY A;  2HOS A;  2DA7 A;  2NVQ J;  5C4J J;  5J3L A;  4FE7 A;  2HXI A;  1UHS A;  1JUP A;  3A02 A;  4M3E A;  2NS7 A;  3BTI A;  2CJJ A;  5F0H A;  3TW7 A;  5IOZ A;  2WAQ N;  2YUS A;  1IC8 A;  3OOU A;  2YU9 J;  2HOA A;  1QVU A;  1R9T J;  2GBY A;  3GTJ J;  2DMN A;  4L5E A;  3ZQL A;  1JKR C;  4UUS B;  1F36 A;  3JRH A;  2M9H A;  1OFC X;  2LVS A;  4A3E J;  4JX6 A;  3FIS A;  4QTR A;  4A3K J;  5C4X J;  3A01 A;  1RR7 A;  3LSG A;  4D5C A;  3FKI J;  4BKX A;  1RPW A;  3SDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...