3A03A

Crystal structure of hox11l1 homeodomain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
53
structure length
53
Chain Sequence
b'FSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords T-cell leukemia homeobox protein 2
publication title Cooperative DNA-binding and sequence-recognition mechanism of aristaless and clawless
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 19
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2009-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3a03A00
3C2BA 3RKQA 1IDYA 1RKTA 1X2MA 5FLMJ 2DA4A 2DMTA 3S1QJ 1B72B 1Y1VJ 5M5WJ 1XG1A 2KDZA 4M3GA 2DJNA 3BR3A 1JT0A 1AKHB 2DA3A 3IV5A 4I6ZA 2LP0A 4X6AJ 1H88C 1ETKA 4C3HJ 3BTLA 1GV2A 2EH3A 2DA6A 1G2HA 1HF0A 1JUSA 3I4MJ 2JA8J 5GPCA 3MKLA 2Y9ZA 3B6CA 2JMWA 5C4XJ 1GVDA 4A3FJ 1OFCX 2KT0A 2JJ7A 1JJ6C 4Y52J 1ZR2A 4QIWN 1QVUA 2MG4A 4MFDA 3HOVJ 3G1OA 1T56A 1O4XA 3TW7A 3MVPA 5M5YJ 1B8IB 2HDDA 5F04A 1TWGJ 1TWAJ 2ME0A 3HOXJ 2Y0SN 1A5JA 2R5ZB 1JKPC 3BR0A 2JWTA 4V2FA 2R93J 3TEDA 1MSEC 1ETQA 2IEKA 4A93J 1TC3C 3BT9A 4UUSB 3HKZN 3M4OJ 3S1NJ 2DA2A 1LFBA 2LR8A 1EF4A 2NVYJ 1LE8A 4XRSG 1JKRC 2ECCA 3Q0VA 1HDPA 5M3FJ 2TCTA 5IYDJ 5DTDA 1IV6A 1U9NA 5E3NA 4RDUA 5F1JA 4A3JJ 2WV1A 2D5VA 2VI6A 3SJMA 5IP9J 2QCOA 1JTXA 4A3KJ 1F43A 2G0EA 3PO2J 1RKWA 1JUPA 3O8GA 5FJ8J 1B72A 1IDZA 4MO7A 3SDGA 5J1RA 5EG0B 1AKHA 2R92J 3A02A 1WH5A 2L0KA 3FKIJ 4QTRA 1SFOJ 1UHSA 5FKLA 2TRTA 5IPAA 1QVTA 2LD5A 4DYQA 4B1RA 4ABZA 2P81A 1QRYA 1WGXA 1IUFA 3PM1A 2LFBA 2EBIA 1ETOA 5IYBJ 1IG7A 4M3FA 2XB0X 3OOUA 2OPTA 1ZTRA 5IYCJ 2XGCA 1BA5A 1BW6A 5FKOA 3VPRA 3IH4A 1U78A 3HBLA 1RESA 4C3IJ 4A3GJ 2EZKA 1PUFA 1F36A 1YRNB 5IP7J 4BBRJ 1B8IA 3GTOJ 1OJLA 5M5XJ 3BR5A 3Q3SA 1ENHA 1ETXA 3NARA 4JP0A 1GDTA 3LSPA 2NVQJ 2N8GA 2FX0A 2XGDA 2R5ZA 3BTIA 3SFIA 1FEXA 1HCRA 4IHWA 3BTCA 3QQAA 1MBHA 5BNGA 4BXXJ 5M3MJ 2O7OA 2O8KA 3S1MJ 1JGGA 3BG5A 3TW6A 4D5FA 1BW5A 1NTCA 4XRSA 3GTGJ 4MIMA 3QPSA 3F0CA 4QSHA 2MGQA 3E7LA 5IOYA 3RZOJ 2MSYA 1GUUA 3LSGA 1H89C 2GBYA 2XRLA 3MN2A 5F27A 4IHXA 9ANTA 1E3OC 1VFCA 3DCFA 2XB5A 5E3LA 2LKXA 3G1LA 1HOMA 2WB1N 2L7FP 2XGEA 1RR7A 3LSJA 3JRDA 3O8HA 2HQ5A 3FK6A 3CCYA 1AHDP 1X58A 1GV5A 3LOCA 2NVTJ 2ID3A 5E3OA 1APLC 2NS8A 4BKXA 3ZQHA 2XPUA 2CQQA 3OIOA 4NDLA 1WCMJ 1A6IA 2EQRA 2PMZN 3DEWA 2X48A 1ZR4A 4BY1J 3S2DJ 2JA6J 2Y9YA 4W1UA 4B3AA 3NAUA 3K7AJ 3JRFA 1DU6A 4CYCB 5F0CA 3ZQIA 3Q0WA 1MBEA 3S14J 2L7MP 5F08A 3ZOBA 3S16J 5FKMA 2HXIA 2XSDC 4IEJA 3FK7A 2FQ4A 5FLVA 2YU9J 1Z0XA 2DMQA 2NS7A 1VI0A 4MFEA 5FKNA 5C3EJ 3Q0UA 3GBGA 2VUMJ 1YRNA 3JRHA 3OSFA 3GTPJ 2GM4A 2DA1A 4A3BJ 4A3EJ 5EYRA 2VKEA 2HOAA 1I3QJ 3PO3J 1D5YA 1NK2P 3ZQLA 3BR6A 2H8RA 4Y7NJ 2XPWA 2M9HA 4BBSJ 2FJ1A 2ME6A 1WH7A 1ZQ3P 2R5YB 2B63J 5J1UA 1NK3P 3GTLJ 1LFUP 1ZGWA 2K40A 3QPLA 4IHVA 3HGGA 3WHCA 4DYRA 5K7FA 4C3JJ 1Z77A 2EZIA 4AYBN 3FISA 1JUMA 2YS9A 1XS9A 5C4JJ 1HDDC 1BL0A 2GLOA 1HLVA 2JA5J 1GT0C 4D7MA 1BJZA 3D1NI 5FKKA 2CUEA 5EGOB 1VNDA 3LSRA 1T33A 2K9QA 2LY9A 5JLXA 5J1YA 2E2HJ 2DTZA 1ORKA 3S1RJ 2VPRA 2NOGA 3GTMJ 3BQZA 1ETVA 5JLWA 2ECBA 3HOYJ 4XRMA 2AO9A 2DA5A 3L1PA 3ZQCA 1QPIA 3RQIA 3BR2A 3IH2A 3GTJJ 2X9DA 1JJ8C 1JKQC 3HGYA 3ZQGA 4CYCA 1MBKA 1S7EA 4M3EA 3BG3A 4G12A 1JT6A 3UKGA 5IOZA 1MBFA 1OCTC 5F0FA 2HOTA 4UUSA 4EEFG 2DN0A 1WI3A 5HODA 4A3MJ 2VKVA 2K9NA 1FIAA 1W0UA 4J19A 2W48A 2R0QC 1VF9A 5E3MA 3S2HJ 2E19A 1U9OA 1IC8A 2X6OA 2ZB9A 2O9LA 4B4CA 5EF6A 3TP0A 4JX6A 4XIDA 3GTKJ 2YUSA 3HEFA 1JTYA 2RAEA 5C44J 3HOUJ 2JK3A 4D5CA 5EDNA 2K9SA 1CQTA 1IRZA 4M3BA 4A3IJ 1RETA 3IH3A 4AUXA 3JRCA 1K61A 4XK4A 2LVSA 3RZDJ 3BTJA 1ITYA 4I76A 4FE7A 1MSFC 5EZHA 3A01B 2R5YA 4FCYA 1XC5A 2M34A 1FTZA 5EG0A 3JRIA 1ZK8A 4V2GA 4L5EA 2DMNA 3BR1A 1I6HJ 1POGA 3GTQJ 2FD5A 2DMUA 5J3LA 4MLOA 3HB9A 4A3DJ 4AC0A 1DU0A 2Y31A 1RPWA 2NVXJ 3HDDA 1TWFJ 1MNMC 2COBA 2CRGA 5EGOA 2CUFA 2L9RA 2Y2ZA 4DYCA 3JRGA 1MH4A 3I4NJ 4D7NA 5EEAA 3WHBA 1OCPA 3OSGA 2LTPA 2M8GX 1JKOC 1PUFB 2LLKA 3BQYA 3H0GJ 2E2JJ 2L7ZA 4FISA 1ETWA 4M6VA 4A3LJ 2M0CA 1AU7A 4DZJA 5GP9A 3BG9A 4S0HB 5IP6A 3HM5A 2ELKA 4IHYA 2HYJA 2MW8A 3K2AA 3M3YJ 1Q1VA 4DW6A 3HOZJ 1P7IA 1WPKA 2XPVA 3H3VK 2JN6A 4C2MJ 2Y30A 2E2IJ 5F0HA 5K7HA 2DA7A 1U8BA 3JRBA 4FTHA 1X2NA 1R9TJ 4W97A 2IAIA 1FIPA 3CDLA 2E1OA 2OF7A 3TP3A 2EZLA 2R7ZJ 4UUTA 2M2EA 4X1EA 1W0TA 2CJJA 4A3CJ 2QF7A 4LOCA 4HNVA 1MH3A 5K7ZA 4XICA 1UMQA 3JRAA 1MBGA 4JYKA 3A01A 1TWCJ 2HXOA 4GFBA 3A03A 3JREA 2CQXA 1Y1WJ 4BY7J 1UG2A 1ZKGA 3G1MA 2HOSA 1SANA 1MBJA 3JR9A 3B6AA 5DS9A 3HOWJ 4M3DA 1H8AC 1K83J 2I10A 1P7JA 2CU7A 2ID6A 4DZPA 3CMYA 3W6VA 4JX5A 2JA7J 3ZQFA 3FIWA 5EZGA 5GPAA 3S15J 2AHQA 2DMPA 2H1KA 2WAQN 1I50J 3S17J 2EZHA 1LE8B 1IGNA 2LK2A 2HI3A 2IBDA 1ETYA 4RBOA 1IJWC 4A69C 1FTTA 4FE4A 1FJLA 4JX4A 3CQZJ 3LNQA 1TWHJ
chains in the Genus database with same CATH superfamily
1ON2A 3DU6A 4UXNA 3C2BA 1A6QA 2H6BA 4YEJA 5TGTA 1ZREA 2CQNA 3P5JA 4HV6A 1X3WB 5F64A 3H0DA 1TW3A 2GXGA 4GDFA 4M73A 2A07F 2CV0A 1Y1VJ 2FNPA 2QZ8A 1J59A 2JUGA 5E18F 3EUAA 2Q8KA 4UV8A 2KDZA 4M3GA 2YR2A 2DJNA 4IXAA 1AKHB 3F8MA 2DA3A 2OAZA 3IV5A 4X6AJ 1FP2A 2LF8A 1YQAA 2BVLA 2XSJC 3GUDA 2MABA 5D6EA 4ON0A 4HF0A 3OYFA 1JUSA 4MGRA 3DBRB 5GPCA 1U5TB 2EA4A 2Y9ZA 4F92B 3QOEA 2ETHA 2JMWA 4UB6C 2LKPA 3CCLI 1TQMA 1EKEA 1OFCX 5ICCA 1WRJA 4QIWN 2VC0A 4YELA 1F4KA 2FMLA 2MG4A 4MFDA 2CW8A 2NNYA 1K4TA 2HDDA 3RIRA 3QOPA 3O2PE 3JCUC 3HOXJ 1T08B 4RM2A 1IN7A 2BY2A 2R4GA 4AD9A 3BR0A 2P6SA 4P1WA 2DT6A 4V2FA 1RZ4A 1MSEC 1ETQA 1QZZA 2IEKA 2VBWA 1VQPI 5BQTA 4UUSB 1Z6TA 5D8LB 2DA2A 3I9V2 3D5LA 3CCUI 2QLZA 2NVYJ 3KIOA 4A0XA 1LE8A 4XRSG 4BNCA 1JKRC 4XSZF 1BI0A 3CJRB 5M3FJ 3MFKA 1X4OA 3CO7C 5IYDJ 2MC3A 1MJBA 1HA8A 2FOWA 2R3SA 5HNFA 5BS6A 4G9YA 2R7UA 1LB2A 5IP9J 3GZ6A 2DPUA 2RREA 3S8PA 1B4AA 3PO2J 2WAQA 1RKWA 4MQVA 3BP8A 3O8GA 1IDZA 4MHGA 4RMNA 3D5RC 1VQNI 3LSMA 1IO2A 2STWA 2ZXIA 1SD5A 5D5VB 3PQKA 3FKIJ 3HRTA 5JR3A 3WODF 2HPMA 2F5DA 2XAFA 3F8BA 2A68F 3KCCA 3J81K 5DYMA 2HNHA 3QRFF 2EBIA 5LGNA 1R6RA 1IG7A 1Z91A 1ZTRA 5B1AH 5E8IA 3KZZA 4LLNA 4ZC3A 3CC7I 4WXHA 1E2XA 4O6JA 4HA8A 3LSIA 3BZCA 1YRNB 2VJ5A 3E5XA 4BBRJ 1B8IA 3JAMK 3OYHA 2QYOA 1OJLA 1UG0A 1BOAA 3RJPA 5M5XJ 3DXJF 2QKLB 3Q3SA 4BEHB 1ETXA 1V55H 2HPIA 3F8CA 3LSPA 2N8GA 2FX0A 2XGDA 3CUQC 3CUQA 2R5ZA 1T2KA 3C3WA 1FEXA 4NB5A 3G6EI 2E1MC 2DT5A 4IHWA 1EJ9A 1IXRC 4IL6C 2PJPA 1HC8A 1TBXA 1QHHD 1MBHA 2X4HA 5M3MJ 2EIJH 2ZMEC 2F5CA 1JGGA 4D5FA 3ABMH 1RI7A 4MIMA 3F0CA 3H5RA 4XOTA 1SFKA 2GBYA 2XRLA 1YIOA 2RNGA 4DOZA 2VBYA 1SFUA 1W36D 4ETSA 2HTSA 1IRXA 2EV0A 3DCFA 2XB5A 5FB2A 3G1LA 3KP4A 2JVGA 4KICA 2A6HF 1FBUA 2FEZA 4Y33A 3FK6A 1TQPA 3CCYA 5DM7F 3HOSA 4RA2A 2M45A 1L0OC 1NG6A 3JW4A 1EH7A 2AQEA 2ID3A 5E3OA 2FOKA 2H8WA 5B66C 4XKWA 3ULQB 4BKXA 4ENKA 1K79A 1LDDA 2RNJA 3ZQHA 1WJCA 1I5ZA 2CQQA 1XX5A 2K7LA 3T1BA 4D0PA 3JSOA 5HS8A 3M1EA 1WCMJ 4NDLA 2EQRA 3DEWA 2P5LC 2EV5A 4EJVA 3ECOA 2LOOA 2ADUA 3WE3A 3CF5F 3L2RA 4I2OA 1KQ8A 2IS1A 2JA6J 4W1UA 1HW5A 1B9NA 1LEAA 3K7AJ 3MKYB 3JRFA 1DU6A 2ZNYA 4ITVA 3HUGA 1Y8RB 2M7BA 3H3ZA 4KN4X 2XUBA 1B1BA 5F08A 3KP6A 1YG2A 2OUMA 2KIUA 2ZMEB 2ACJA 2CWEA 2L4AA 3RI4A 2ZNZA 2EFPA 2HXIA 4KISA 4CCMA 5FLVA 3FK7A 4BQOA 2EV6A 4BGDA 1X1CA 2DMQA 2NS7A 3V8LA 1TNTA 4GYGA 4MFEA 2QA4I 5C3EJ 3GBGA 5L3CA 3JRHA 1TL8A 4IZZA 3LQQA 1MD0A 2BW3B 2YU3A 4KIFA 2GM4A 2L9VA 4A3BJ 3QP5A 2KQRA 4A6DA 4R79A 3OS0A 1D5YA 2XPWA 2VIXA 1ACIA 2FJ1A 2ZBKA 4A12A 2IXSA 2ZFWA 2KJBA 2BYVE 2VODA 1ZQ3P 1VQ4I 1IN8A 2P6TA 3QPLA 5E17F 3LFUA 2MLKA 1UJ8A 2OCCH 3CCMI 4HX7A 4BE0A 5ICGA 2FE3A 1Z77A 3EQLF 2ELJA 1TLHB 2J5OA 2I8DA 2EZIA 3HJEA 3PFIA 1JUMA 1Z9CA 4XLFA 1XS9A 1HDDC 4HLXA 1BL0A 3OYGA 3HPHA 1XMAA 4NNJA 1HLVA 3L00A 3KE2A 4ZDLA 5HLHA 4EGYA 5HLTA 2DODA 4D7MA 4KYWA 5FKKA 1PYVA 1KGSA 2K4BA 1VNDA 3LSRA 1T33A 1BIBA 2O3FA 3A0BC 1V5FA 4PFOA 3G71I 4AIKA 4OIOF 4CDGA 2DTZA 1CF7B 4OMZA 1ORKA 3KETA 2BY3A 3FZVA 4C30A 4KIBA 4AVZA 1G6NA 3AL0B 4N9HA 3HTUA 3HOYJ 3CCJI 2AO9A 2Q2EA 2H27A 3QU3A 3WTTC 3IH2A 2X9DA 3WG7H 1ZARA 1FY7A 2A61A 3BG3A 5DV5A 4CUGA 2ZC2A 2VKDA 2DYRH 2IGNA 4J00A 1Q1HA 5EEGA 2HOTA 2DU9A 4XSXF 5GAHJ 4GRIA 4A3MJ 2IA0A 2K9NA 1YYVA 3LL7A 1FOKA 3N97A 3F9KA 2Z16A 3KEQA 1IC8A 2ZFUA 3HRMA 5ILUA 2ZB9A 3ONQA 2O9LA 5EF6A 3HXLA 1F9NA 4JX6A 4N0BA 5E1ZB 3GTKJ 4TV7A 4U0WA 5KHDA 3GFJA 2XASA 1FYLA 1OYWA 2F5FA 5DUIA 1RUNA 3HOUJ 4A5NA 2P5VA 3M8EA 4D5CA 1CQTA 1S9HA 1PJRA 3IWZA 1OQYA 2L4MA 1KONA 2NYXA 3LA3A 3DBLB 4M3BA 4HEA2 3I71A 3IH3A 3J7YJ 4AUXA 3L2VA 3WGGA 3JRCA 1K61A 4XK4A 3TMOA 4PFPA 2G7HA 3OYEA 5CPRB 3PJRA 1YJWI 3MKWB 4PSWA 5EZHA 1KU9A 3A01B 1XSXA 3DPTA 5J8FA 2VQCA 5EG0A 3KYCB 2IT0A 2L01A 4P96A 1YJ9I 1XCVA 3GO5A 3QP6A 1SVLA 1TQIA 4OAZA 3GTQJ 2DMUA 5J3LA 2HQAA 2WY7Q 4A3DJ 4AC0A 2GA1A 1RPWA 4XLCA 2DBBA 1W5TA 2WA0A 2X1EA 2PJRB 4CO8A 1V5GA 3PSFA 1N75A 5EGOA 1D0YA 2VXDA 1SC7A 4Z2YA 2VASA 2Y2ZA 2CQ7A 4DYCA 3JRGA 4CHUA 2LY1A 5H2FC 4XLAA 3WHBA 2RDPA 2R7OA 2LLKA 2FBKA 3BQYA 1D1CA 4P9FA 3CDIA 4P9UA 2L7ZA 3GCMA 1R36A 4YFXF 1HBXG 5IT3A 2M0CA 3UNGC 1UELB 2DDBA 5GP9A 3X2QH 4I02A 1EV7A 2MBFA 4Y13A 4YG2F 3M3YJ 5GTIC 2MD5A 4PSXA 1BOBA 4OINF 4XONA 3J7ZI 1QZYA 4C2MJ 2Y30A 1X1DA 2QKMB 3I53A 3RDIA 3N05A 1U8BA 3RQ4A 3JRBA 3G3ZA 4EVIA 1R9TJ 2R7FA 3FDYA 4LITA 3WTSC 1FIPA 1IZ1A 1Y0NA 3JTGA 3T0YA 2W7NA 2KHMA 4Y17A 2E1OA 1W4MA 4FT8A 1A36A 4AVPA 2EZLA 1PP7U 4UUTA 2M2EA 4S05A 4XLEA 4MTEA 3Q5FA 1D0ZA 1J7KA 1BC7C 1MH3A 4XICA 4PK4A 1RC9A 3E1SA 2H09A 4I99C 4M74A 3TKYA 2ZSIB 2K85A 4GYIA 4JYKA 1TWCJ 2YX4A 3CCEI 4C2TA 2M5WA 1LPQA 2FXAA 2Z99A 3H5NA 1KU2A 4FETA 2CQXA 4PJMA 2QENA 4KN7X 1ZKGA 3H9GA 2O6GE 3CJNA 3WGHA 1DP3A 4OMYA 4E7SA 2EIMH 2QQAA 4M3DA 2I10A 2CU7A 3GFLA 3CMYA 2K27A 4HZFA 3CZ6A 5FO5A 1FMWA 3KP5A 2JA7J 3LSHA 2FSWA 1OKRA 2H1KA 2IS4A 1ONVA 4HW0A 4RB2C 3K69A 2BV6A 2ZJPF 5EEHA 1FBQA 5GADJ 2VBZA 1YE9A 1N77A 1X1PA 3VSLA 3U1KA 3V8JA 2CUZA 2HI3A 2KRFA 5L3BA 5LRSA 4RBOA 1W7PA 3CLOA 4MTDA 1ZRFA 1QU3A 1QHGA 4YIIA 3LNQA 1QA6A 2P4WA 1DUXC 2LY2A 2ZJ2A 1X3UA 3J81Z 1E3HA 2A6TA 3SZGA 1LVAA 4V19K 5FLMJ 2ZCWA 2W85A 2RV8A 4KT6A 3S1QJ 4L5IA 1B72B 1FZPB 2IGOA 5CVVA 5M5WJ 4IRIA 2X51A 1JT0A 2NOJB 2LYCA 1ZN2A 2FRHA 3IAS2 4K2EA 2LP0A 3JAMZ 1SFEA 3PNVA 1GV2A 4UV9A 2DAOA 4Y15A 3AFHA 2Z5UA 3FHZA 4ASNA 3F3XA 1G2HA 2JRMA 5GAGJ 1ZYRF 1B9MA 2WAEA 3MKLA 4KIGA 2YPRA 3KPHA 3ZMSA 5DUKA 4A3FJ 1B59A 2JJ7A 3E5UA 3K4LA 1KA8A 2LKSA 2M0MA 1T56A 2HDWA 3BOQA 2L9SA 3IP4B 3MVPA 5M5YJ 3FBNB 4HOBA 5F04A 2F2EA 1VQ6I 1TWAJ 1MIJA 3QYFA 3OIPA 3RKXA 2F48A 2Y0SN 1A5JA 4II3A 1JKPC 1C0WA 4HF1A 1TZLA 3U2RA 2IGKA 1TT0A 4KA4A 4A93J 1I1GA 1TC3C 4GGGA 4OOIA 2ZXJA 3CUOA 2O0YA 3G73A 2K9LA 3S1NJ 2DJIA 1EF4A 3GF2A 3TO7A 2YX7A 3MEXA 3W2VA 5CJ9A 2DOAA 2ECCA 3L2UA 1HDPA 4LIUA 4DNCA 1Z67A 1MDMB 1WVRA 5F1JA 1JXSA 2XIGA 3PIOF 1K78A 3FXQA 3KYDB 3OYIA 3CC4I 3ZQQA 4M9ZA 4G94A 4A0YA 1JTXA 4A3KJ 1YW7A 2M30A 1F43A 3AAFA 2VE8A 2CW7A 3BC8A 5FJ8J 1PP8F 4CYDA 1WJ5A 3GYHX 1BI2A 2V1UA 4XQFA 3QAHA 3W2AA 2PMUA 3SDGA 1BI3A 1AKHA 4HX4A 2R92J 4J01A 3A02A 1WH5A 2K86A 2L0KA 3DBHB 3OOPA 3N4MA 3P9KA 4EM1A 5IPAA 2LD5A 4DYQA 5BPIA 1AOYA 4QWQA 1QRYA 1WGXA 2F5EA 1U5TC 3GFIA 2HVQA 1Z6RA 2E34A 2V9VA 2EJRA 1T6SA 1ETOA 2I5UA 4M3FA 3A2KA 2XB0X 5IYCJ 1YW9A 2XGCA 1BA5A 2FMYA 3OYCA 5CVRA 3K4MA 1UHMA 1BW6A 4B48A 3IH4A 3HBLA 4XKVA 1RESA 1RIOH 4O5VA 2EZKA 1F36A 3MMYB 2OD5A 2VC1A 5IP7J 2UWMA 4I0AA 4KFCA 5J6XA 4UNOA 4XR6A 3NARA 2NVQJ 1ZG5A 2HYGD 3BTIA 2XKOA 5DEQA 4CZCA 1J75A 3M8FA 5BNGA 1D5VA 2O7OA 3BJAA 2O8KA 3S1MJ 3BG5A 1O3QA 3EYIA 1BW5A 4PCQA 1NTCA 1X3ZB 4XRSA 3QPSA 3ZN1A 5D5XB 2AXTC 5IOYA 3GEZA 2MSYA 3RZOJ 1GUUA 3LSGA 3COAC 2DI3A 3AG1H 1LDKB 3DWLE 2OQRA 2STTA 2VKHA 5LRRA 1Y56A 4GXOA 3RKYA 4IHTA 5F27A 1ZG1A 5KVRA 2RKHA 3DTIA 2BVMA 4C9YA 1MMGA 3IC7A 2WB1N 1ZAOA 3DEEA 2WV0A 1FWZA 3GVAA 3KP3A 1VQOI 2QBYB 1BM9A 2HYFA 5GTHC 2LBFB 2A5YB 3OY9A 4LD5A 2V9PA 1X58A 2NVTJ 4F55A 3HKZA 3H35A 1HKQA 4CCNA 4HAMA 2ZKZA 1BC8C 1QPMA 3MAJA 2UXNA 2EK5A 2X48A 1RRJA 2KRHA 2KIFA 2QQ9A 2XAJA 3A0HC 3QYBA 4II2A 3S2DJ 3LMMA 2X6XA 1SMYF 1E3PA 2Y9YA 1D3YA 4EJUA 1G8XA 1WJFA 3HSEA 4KMUX 1WSUA 1SAXA 3ZQIA 3R6SA 2EFNA 2HR3A 3ZMTA 3Q0WA 1MBEA 2FNAA 2K9MA 2L7MP 4XRFA 3RPUA 2BXYA 4U7DA 1I1SA 1DGWY 2XSDC 3K10A 4HNTA 2VJIA 2YU9J 1X1BA 2CG4A 3IUOA 1Z0XA 1VI0A 3QU6A 4U0YA 5FKNA 2C6YA 2KIMA 2XF7A 1YRNA 3GTPJ 3T8RA 2H94A 1DP7P 3QPTA 5DDGA 4DBRA 3OYKA 2EIKH 2CS3A 3FXJA 4ESBA 4N4OB 5EYRA 1SD4A 2FUG2 2P5KA 2L3DA 2VKEA 2E60A 5CVJA 4XMYA 3MZYA 4ZYEA 4KUMA 4BXUA 2H8RA 4LB6B 3H92A 2LSOA 4CCLA 5FD6A 4BBSJ 1MMDA 1DPRA 3V4GA 2DYSH 5BOXA 2R5YB 1B6AA 4D1QA 1NK3P 4WX9A 1YITI 2JZYA 1ZGWA 4P55A 3V42A 4IHVA 2WTEA 3HGGA 3WGIA 2BBYA 3CCVI 3DEUA 3WHCA 3RYPA 4Q48A 5KCMA 4DYRA 1V5EA 4RB3C 3J7AY 1DPUA 3HPGA 1FYMA 3DV8A 2VOOA 3IL2A 2HGCA 2JA5J 3QPHA 1O7FA 1GT0C 3QYEA 1BJZA 4P5OA 2ICWG 2CUEA 2E7XA 5L3FA 2FBIA 2LY9A 3DTEA 5JLXA 2HVSA 5HLIA 1R1UA 2E2HJ 1Z05A 2VPRA 1P92A 2NOGA 3GTMJ 3BQZA 1J09A 2ECBA 3Q9VA 3L1PA 4HSRA 4H0EA 4KMFA 1MNDA 3GTJJ 1FOWA 2W1OA 5DD8A 3ZQGA 2EFOA 3R0AA 2VN2A 1VQ8I 1D1AA 2X1DA 3HHHA 2LC2A 5IOZA 1BR2A 2ZMEA 2JTVA 3FM3A 3FMSA 4ZZDA 5HODA 3GFMA 4ENMA 2VKVA 3E6MA 4J19A 1SAUA 5E3MA 1U9OA 2HQNA 2L54A 1R23A 2XAUA 1ERDA 2IGMA 2COMA 1YS6A 3R4KA 4B09A 4B4CA 2PMZA 4RB0A 4XIDA 2GXBA 2GQQA 2BW3A 1KZHA 5F6FA 3GZNB 5L3DA 3SYTA 5C44J 1A35A 4L5JA 4M6XA 1W5CC 5EDNA 1Y8QB 4E7IA 4KT5C 3FX3A 4JQFA 3ZMDA 3R61A 1P4WA 4HPQA 1RETA 3VODA 4PJ0C 2BEOA 2V7FA 4BAYA 2K02A 5A2QK 3EUHA 4OIPF 3EUHC 3MCZA 4FE7A 3LA2A 4I76A 1MSFC 1W36C 3LWFA 3PQJA 3VYTB 3OMYA 1XC5A 3ABTA 2M34A 3AG3H 3FXMA 4LIVA 2D1HA 1FTZA 1I27A 3HRUA 2OV7A 4G6DA 1R22A 4X0GA 3JRIA 1JI8A 4ENNA 1BR1A 5JHFA 2X6WA 4LFUA 2XRNA 3S93A 1N25A 1BN5A 5BPDA 3BR1A 2RC4A 4PDKA 4Q47A 4UVCA 2DLLA 4OWRB 2HEOA 1DU0A 4L0YB 2Y31A 1TWFJ 3I59B 2IVMA 4IO9F 4HV5A 5HS7A 3K70D 3L2WA 1KYZA 2CH0A 2L9RA 3I4NJ 1R4NB 2M7AA 4D7NA 2X85A 1CF7A 1HKTA 1LJ9A 1OCPA 2DFEA 3MZHA 2M8GX 2Y48A 1UFMA 2H6CA 2A05A 3K4CA 3U21A 4ZYGA 2E2JJ 1IRFA 3DP7A 3AL0C 2OCEA 4I09A 4FISA 4EJOA 5L3GA 4DZJA 3ASNH 4S0HB 1FX7A 3HM5A 3M1CA 2NS0A 3MD2A 4IHYA 1Z7UA 3DLLF 1Q1VA 3HHGA 3LAPA 4RB1A 1FSHA 3WU1B 1QBJA 1WPKA 2PEXA 4ZZLA 4LG3A 4F93B 4IX7A 5K7HA 2NVUB 1TTYA 4W97A 4BDYA 1WJDA 1DDNA 2JQ7A 1YIJI 5E79C 4YIFA 3E6BA 2BY1A 3A4CA 3CO6C 1W0TA 1Z1DA 4A3CJ 5TJJA 1FP1D 1LDJA 2HZTA 2EB7A 4HQMA 4BXFA 1QO0D 2KKOA 3I55I 4BDZA 3JRAA 3WTVC 1MBGA 3GXOA 3GLLA 3A01A 3HTSB 4GFBA 1SMTA 4BYYA 1WQ2A 1Y1WJ 1EH6A 3BWGA 4BY7J 1MBJA 4HDVA 2M4KA 1ZG3A 3DPUA 3CJQB 2Q0OA 5DS9A 3C2GA 4A6EA 2W00A 4EJWA 1KU7A 2MD0A 3W6VA 3OYAA 1SFXA 3H5AA 1HW2A 2CYYA 2V6CA 1GHCA 2UUZA 5D4RA 5IT9K 2VXZA 1FNNA 2V79A 2WAQN 3PUBA 3BPXA 3S17J 2UV1A 2L02A 3JSPA 4XLNF 1WI9A 4WCGA 5AONA 3OYNA 2F6CA 2OTLI 4IVNA 2QSFX 3IHUA 4IF4A 2CO5A 1T95A 3EDPA 4B44A 4OIQF 3BCBA 4UY8I 1O3TA 1V54H 2QQ8A 4JX4A 4LLGF 2R7RA 2KZVA 1HXDA 1TWHJ 1LNWA 3EYYA 1K6YA 3ZP5A 4H4KC 1R1VA 3RKQA 3F8NA 4BQAA 5D5UB 1UCRA 2QEXI 1IDYA 1RKTA 4E7JA 5LBQA 2GOXB 3SEQA 2OU2A 2LG4A 2W25A 2DA4A 2ZO4A 1D8KA 3HSRA 4PJNA 4RGRA 3WU2C 4UUVA 5DCMB 1TP4A 2DFFA 2L9NA 2DK8A 3F72A 4Q4ZF 3BR3A 5D5WB 1WFXA 4RGXA 2BGCA 2PI0A 4I6ZA 3M07A 1K4SA 1U8RA 1VQ5I 2O61A 3EPZA 1ETKA 2PFBA 3TOBA 1WJAA 4C3HJ 3BTLA 2EH3A 4ZJZA 4RS8A 4CCKA 4HX8A 3UR3C 5FRNA 3LSTA 5LGUA 1S5LC 3H9QA 3DKWA 5H6QA 3K1NA 2JA8J 2XROA 3B6CA 1V4RA 4RLQA 5LD2C 1GVDA 3HOTA 1BR4A 2W4SA 5ICEA 1JJ6C 2A6EF 2PN6A 4BUPA 3HOVJ 1AA7A 3OS1A 3G1OA 3IRQA 2FU4A 1XDUA 3ERMA 2XAHA 1TWGJ 2Q2EB 2LH9A 3MKZA 1R00A 2ME0A 3QWLA 1U3EM 3ISPA 4DIQA 2JWTA 4AYBA 1V3FA 3SEZA 5DM6F 4ENJA 5J4VA 1YW8A 3BT9A 4ZYDA 4LJZF 2V4JC 1TNSA 3M7GA 5E20A 3M4OJ 4EMSA 2LR8A 3HG9A 5K1YA 1VQKI 3NQOA 3E97A 4DQ2A 4O3MA 1OYIA 3CCSI 2JRTA 1J2XA 4DBQA 1XPXA 4CCOA 2TCTA 5DTDA 4HDUA 2GIZA 1U9NA 4DJAA 5KAFC 4NHJA 2V1DA 2A69F 3ERED 3ABLH 4UVAA 2WV1A 1KU3A 1MGTA 3NWSA 3HRSA 3FF5A 1GXQA 1X1AA 3TOAA 2D5VA 2FF4A 2IPQX 2QQBA 2QVOA 2QCOA 2XAGA 4B3XA 1S72I 4IOCF 2KISA 5ILSA 1FLIA 4LLLA 4EATA 5HVQC 2G0EA 2NNNA 4LGWA 2HQRA 1UHWA 1B72A 2G7UA 4A0ZA 2D2WA 3SZPA 5F1RA 4MO7A 2UZKA 5J1RA 5EG0B 2WBMA 5DD4A 1R5ID 1Z21A 4QTRA 1UHSA 2W82A 4OIRF 4M6YA 5FKLA 5HDKA 2TRTA 1QVTA 3CF2A 4B1RA 4ABZA 1MJ9A 2KZGA 2P81A 3K6GA 5E1XA 3FWEA 3J80K 1YX5A 1IUFA 3PM1A 3F23A 2OJED 3J7AO 2CV2A 3WTZA 1S8NA 3CMEI 4U88A 3PNYA 5FKOA 3E0JB 3TQNA 1MNEA 2OC6A 4UVBA 3VPRA 1IXSB 4GCVA 1G3WA 3MWMA 3CCRI 4A3GJ 1PUFA 3O6BB 4HYEA 3H36A 3FXUA 3BR5A 2F5VA 1ENHA 1GDTA 2KLOA 2DOEA 4LK1F 2P7CB 3SFIA 2MYSA 1W7PD 4L18B 3BTCA 4BJ5C 3QQAA 3V7CA 4RAGA 4BXXJ 3HSFA 2M4GA 4NQWB 3MQ0A 1FSEA 3W2WA 3DKXA 4CICA 4QSHA 2MGQA 1GLNA 1JHFA 1OLTA 2IS6A 2ISYA 3MN2A 4YIRX 2B0LA 2Z1DA 4ESJA 3BJOA 1IW7F 1XGOA 5ICFA 3K4BA 1WJBA 4IHXA 1MDMA 1GXPA 3W6JB 5E3LA 2L7FP 2VL8A 3LSJA 2Y0MA 4F52A 3O8HA 2HQ5A 2KP6A 1XGNA 5K5RA 3U1DA 3I58A 4UHTA 1DQUA 1H9GA 3ZMVA 2IA1A 1AHDP 3LOCA 2WC2A 5J47A 1VQLI 1APLC 1BBYA 2P0WA 1SEUA 1H9TA 2XPUA 4PJJA 1J5YA 3LSKA 3OIOA 2BXZA 1BI1A 1P6RA 1FC3A 4I0BA 3SZTA 1ZR4A 4IQJA 3I4PA 2E7WA 1R1TA 4BY1J 1MMNA 4EQQA 1F1ZA 3D5SC 1I39A 3B02A 3GZ5A 5LHIA 4CYCB 5F0CA 3K4JA 3JTHA 3IAM2 1MMAA 2ZJQF 3ZOBA 3S16J 2HKXA 1YJNI 3A1YA 1FBSA 4RLFA 5FKMA 1FMVA 1P2FA 2DCEA 2Z33A 2E5ZA 4RAFA 3PFYA 1WJEA 1LFPA 1F5TA 3HZJA 1UZCA 4PUSA 3OSFA 2KL4A 1W7PB 3S3OA 3OL3A 3KLOA 3OIQA 2DA1A 1OPCA 4F7ZA 1I3QJ 1D0XA 3PO3J 1NK2P 3CJTB 3FMRA 5HNHA 3ZQLA 3BR6A 4FQGA 5EJCA 1MKMA 1I3AA 1ZRCA 1MMSA 2HZDA 3EETA 2DT7B 3FHNA 2ME6A 4QPQA 4BH9A 2PX9A 3E3VA 2JSPA 2B63J 5J1UA 3GTLJ 1LFUP 2ESNA 5E8GA 3FKJA 4ZYAA 3ABKH 1D8JA 4AYBN 1DGRM 2YS9A 3VEPA 2QBYA 5C4JJ 5CLSA 1NH3A 3TO6A 2LBFA 1RR8C 3D1NI 1U5TA 2DTRA 4KITB 4HRIA 2VQGA 4LB5A 5J1YA 1JE8A 5FD5A 2HFHA 3Q9SA 3ZGKA 3R60A 2MH9A 2W84A 3S1RJ 3OR1C 2X0LA 5KK1A 4E7ZA 1JGSA 3G2BA 1XSVA 4JBAA 5JLWA 2DQLA 3ZQCA 2O03A 1QPIA 2BE5F 3RQIA 4OU0A 5ED4A 3BR2A 2QGUA 2HKOA 3SQNA 3CCQI 1JJ8C 1JKQC 4G7OF 3HGYA 1H0MA 2VB6A 1ON1A 1MBKA 4M3EA 3WTYC 2J5PA 4G12A 1JT6A 5D6FA 4HF2A 3UKGA 5F0FA 4UUSA 4EEFG 1WI3A 3OWTA 3L9FA 1XD7A 4YRVA 4NUBA 1FIAA 3ROUA 4ESFA 2E1NA 2W48A 1VF9A 2ELHA 2W57A 3W6KB 2H1LA 3LAJA 2VOPA 5CKTA 4QLCU 3GWZA 3K2ZA 4EV0A 3TP0A 4BE1A 3E5QA 2CW0F 3HEFA 2GXAA 1JTYA 1K78B 4I98B 3AG4H 4ANJA 1WZ2A 3WU0A 2JK3A 1ZGAA 2RGVA 3IRRA 3E6DA 2RN7A 2DFHA 4A3IJ 2MC4A 3OV8A 1FOYA 1IUYA 2NAZA 3G4SI 3RTRA 4Y4RA 3OYLA 5IT9Z 1OCZH 4RM3A 1ITYA 3CDHA 2L2OA 2MFZA 2B7EA 2KJCA 2R5YA 4FCYA 3RPQA 3DF8A 3K4NA 4KNYA 1JHHA 4A2UA 3ZN0A 4EJTA 2JA2A 4R1HA 1ZK8A 5LLQA 4XKBA 5JI6A 4LG0B 4V2GA 4L5EA 2VQLA 4HNUA 1IV8A 1POGA 1I6HJ 2GAUA 2L5QA 5CQEA 2BHZA 2W24A 3ZXSA 1P4XA 2CRGA 4N9IA 2IRFG 2VPLA 2CUFA 1MZBA 1S7AA 2JUCA 4BE2A 1MH4A 1YX3A 1VQMI 1FYKA 1RUOA 5EEAA 3CD6I 3RPUD 4F3QA 3OSGA 3U9GA 2LTPA 4BHCA 5FRMA 3RKWA 5CVUA 1FT9A 4B43A 1VQ7I 1LVKA 1ETWA 5GAEJ 3GLXA 1PUEE 3DU5A 4KJZA 2EWNA 4KDPA 4BEHA 1FPQA 4FX4A 1T38A 2NXNB 4CSWA 2R7SA 2IP2A 2HYJA 2MW8A 4XORA 3VYSB 3ELKA 3L2CA 3F22A 3S3NA 3KP2A 5TISC 2G9WA 3HC7A 3K2AA 3OS2A 3HOZJ 2HU9A 4E6KG 3H3VK 1YOVB 4XLHA 3BPVA 2OA4A 2E2IJ 5CQGA 2ZXWH 2DA7A 3BROA 1OCCH 4XNFA 5AIQA 2VT2A 3OYDA 1XDSA 1X2NA 4R8HA 4FASD 2IAIA 1HKSA 1UAAA 4RGSA 1RNLA 1M1EB 2OZUA 6PAXA 3CDLA 1ZHFA 4I01A 2OF7A 1STZA 3TP3A 5LGTA 3WTWC 1U6GA 2R7ZJ 4X1EA 2L7KA 3DTKA 4LOCA 1OCOH 3FXOA 5K7ZA 5B3SH 3C18A 1QNTA 3ZQ7A 5K5QA 1XMXA 3CMAI 2DW4A 3V7RA 2HXOA 3OL4A 4AU7A 2GOMA 4CCJA 3JREA 3H3UA 2DDAA 4G8XA 4QPOA 4ZTFA 2HOSA 1CGPA 3JR9A 2V1NA 4HG2A 5JVGF 2GWRA 3KX2A 1H8AC 1KYWA 3SFZA 2ID6A 2OQGA 3ZMUA 4JX5A 1TW2A 3I59A 3C2HA 2QWWA 3CP8A 5EZGA 4AIHA 2DMPA 1I50J 1O3SA 5L3EA 2IS2A 3T5XA 4M9XA 3BG7A 1ODDA 1NHAA 2DK5A 1YS7A 3AKZA 1LE8B 2VQHA 1IGNA 2M8EA 3M8JA 5J4YA 2IBDA 5FLXK 3VB2A 2V9KA 3K1MA 3VFZA 2XGXA 1FTTA 4FE4A 1FJLA 2XVCA 3CQZJ 2XKPA 2IJLA 3M9AA 4U87A 2M3AA 2HVRA 4Y3OA 3VDXA 2Q1ZB 3K0LA 1R5GA 3J80Z 1ZLKA 2ISZA 3K9TA 1X2MA 1O3RA 1IN6A 2V6EA 2DMTA 3RCOA 4D9JA 1ZGJA 2AXLA 1XG1A 2VJJA 1K7AA 4XM3A 3T8TA 4F91B 1ZH5A 1H88C 4B8XA 2E35A 3BZ6A 3S2WA 1XN7A 2RQQA 4U0VA 1NG7A 4Q5SF 1XTAA 2DA6A 2VONA 1HF0A 5FROA 4B47A 3I4MJ 3CTAA 2UXXA 4G6TB 4BQQA 2P8TA 1EA3A 2DO7A 1S6LA 2VT3A 3VSKA 4BS9A 4CA0A 4HBLA 5C4XJ 3HL2A 2KT0A 3EUKL 2BHYA 2X6YA 4Y52J 1ZR2A 1R7JA 3L09A 2P7VB 4ZDOA 2CQKA 1SVOA 1QVUA 2OBPA 2CGPA 2PMHA 3BDDA 3TW7A 1R4MB 1O4XA 1B8IB 5KNLA 2FQ3A 5LEJA 1R5HA 4BHPA 5ILVA 2CFOA 1WHUA 2AQFA 3CUQB 2R5ZB 3K70C 2E1MB 2KPMA 3TEDA 2R93J 5CVIA 3BZKA 4PGGA 4L9JA 3HKZN 3K4KA 3IKVA 3TDUC 3DLAA 2E71A 1LFBA 2JSCA 4RGUA 4BHBA 2FA5A 3LQRA 5B5EC 3DFGA 4IPAA 1IN5A 1X19A 2F4IA 4AIJA 1LEBA 3Q0VA 1U2WA 2OTJI 3QODA 2KFDA 1IV6A 5E3NA 4RDUA 2RVCA 3D0SA 3DKYA 4LMYA 4A3JJ 3GMEA 1ZELA 1EH8A 2PBIA 4RAYA 1W5SA 2VI6A 1J0RA 3FXKA 5FFZA 3SJMA 4MEXF 3H1CA 5JVTA 1OCRH 1I6XA 2ZSHB 3BCAA 1PDNC 2LREA 3VYRB 5DCFA 2Y75A 3WTUC 1USSA 2WADA 1JUPA 2DQRA 2XAQA 1IXCA 1QGPA 5DCMA 1T8IA 3PIPF 2D1VA 2WAFA 5E1WA 1SD7A 1HSTA 1WKMA 1SFOJ 3BY6A 3PNTA 2JPCA 2XHKA 3ASOH 4CXFA 2BOLA 2TDXA 2QUFA 3B73A 4L9VA 3W3CA 1T39A 1J9IA 3KFWX 4WXDA 4PZJA 3HUGB 4E7HA 2QSHX 1E17A 3S3MA 2LFBA 1S3JA 3VOEA 2HS5A 4UB8C 3SXYA 2PJRA 3C1DA 3VYUB 5IYBJ 4E7KA 3OOUA 2OPTA 4C2UA 2VE9A 1YLFA 2LNBA 1U78A 4L9TA 5ERIA 4C3IJ 1OMIA 5FFXA 3WG9A 1IAWA 1HQCA 3NEUA 3GTOJ 2R7XA 4NC6A 4JP0A 3V7SA 1ZRDA 1Z3XA 2DFIA 5IY5H 1HCRA 2RQPA 2LMDA 3OYBA 4IRHA 2D45A 2YSRA 3ZMZA 3VWBA 4M9SA 2GZWA 3TW6A 3K1PA 2DXIA 3KZIC 3GTGJ 3PL8A 4WF2A 3E7LA 3ESWB 2E5NA 1H89C 3NWTA 1U0JA 3TGNA 9ANTA 1E3OC 1VFCA 2LKXA 3IWFA 1HOMA 2XGEA 2Y0SA 5HOOA 1RR7A 1S29A 3MZ8A 3JRDA 1YHQI 3V8KA 4ZH4F 3PSIA 5LFAA 4HQEA 1QQIA 1AWCA 2A3SA 2CUJA 1Z7LA 3IKTA 1GV5A 3LA7A 5H20A 4Z6YA 1VTNC 2LRDA 2NS8A 1GVJA 2VLAA 2WWYA 2Z3YA 2K3FA 1REPC 1A6IA 4S04A 2PMZN 3F6VA 4BL0B 5BMZA 2EINH 4IHSA 5JHUA 2PG4A 4FHTA 2CMPA 4L9NA 2HWVA 3F8FA 4B3AA 3NAUA 5B1BH 2KMUA 4IKFA 4XOPA 1ULYA 3P9IA 5HDGA 1G4DA 2EA2A 2XF6A 3TDZC 1Y0UA 5J8CA 3S14J 5H6RA 1L3LA 5J40A 2A5WA 2PQ8A 2FQ4A 4IEJA 4AWXB 1S7OA 3F6OA 1PVEA 3REOA 4A5MA 4EM2A 3ZRGA 4G7HF 3Q0UA 1HSJA 2VUMJ 3TL4X 1FOXA 4FX0A 2HOEA 3CP2A 3GW2A 2O5RA 4A3EJ 4XLPF 2HOAA 4ZDPA 3KP7A 4U7BA 1VQ9I 3I56I 4Y7NJ 2KIQA 2M9HA 1R71A 4NQWA 5LHHA 3CMMA 3O3KA 1WH7A 4IQ4A 3WTXC 2F4OB 2K40A 1A04A 5HDNA 2O8XA 4XL9A 4MEYF 3SDBA 3KYLA 5K7FA 4C3JJ 2ZXHA 2DOFA 3FISA 4WK8F 2R7WA 2GLOA 1MW7A 1VZ0A 2LF7A 4MNUA 1XB4A 3TBIA 4E7LA 5EGOB 2MA3A 1K6OA 2K9QA 1XCBA 3PUFA 2BZTA 3TO9A 2R7TA 2HDCA 2ESHA 3KZYA 3ZCOA 1OYYA 1O57A 3SHFA 4NC7A 1ETVA 3H9JA 2M1BA 4XRMA 2DA5A 1Y39A 4I7HA 1YFHA 2DPDA 3BJ6A 2GA2A 2WB1A 1Y6IA 1A31A 4CYCA 3KLNA 1S7EA 4PJLA 3HIFA 2KDOA 4AIDA 4EGZA 4GO1A 4RAZA 5AIPA 1MBFA 4ZYHA 1OCTC 4L0ZB 3ABUA 2DN0A 4XBFA 2LDUA 1XGMA 1IRGA 3R0JA 1W0UA 2R0QC 3S2HJ 1G3TA 2E19A 5D4SA 4BACA 2X6OA 4E70A 1G59A 1OR7A 4EM0B 1OR7C 2Z9OA 4N4NB 5CYVA 2YUSA 4YFKF 2AS5F 2QM3A 2RAEA 2E36A 4G7ZF 2BY0A 4M72A 4YFNF 1MJAA 2K9SA 1P4AA 1X4PA 3KEYA 1IRZA 1G3YA 3OYJA 2XF5A 1G3SA 1R49A 2B9SA 2KRCA 2LVSA 3RZDJ 3BTJA 5HLGA 2Y69H 2GIVA 5FGMA 4BJ6C 2ZJRF 3CESA 3C7JA 2EPFA 4MQ9F 2JPBA 3CC2I 5FLXZ 2V26A 1YI2I 2DMNA 2FD5A 1O7LA 1USTA 4MLOA 3HB9A 3FBIB 2NVXJ 3HDDA 1MNMC 2COBA 3I5UA 3HYIA 2XDVA 1R58A 3P9CA 1BJAA 2EFQA 3CLQA 4HSTA 3ZPLA 2F4MB 1T0FA 1SVMA 1T0FC 4XN3A 5A2QZ 4IOAF 1YO5C 2PLYA 3BLYA 1PUFB 1JKOC 3E6CC 5KAIC 2NRAC 3H0GJ 4E4HA 2IA2A 2V1XA 5JFRA 2E1CA 4M6VA 4DGWB 4M71A 3F21A 4A3LJ 3WE2A 1AU7A 3BG9A 4BQNA 2EILH 5IP6A 3I54A 1QZEA 3L7WA 2ELKA 2K3PA 1IF1A 2R7VA 1LUJB 4JOMA 4BU2A 5LHGA 2MLGA 4DW6A 3DPLC 4NC8A 2JT1A 5K5OA 1P7IA 2XPVA 2CSOA 1P9QC 2JN6A 2JVHA 1W1WE 3FM5A 1E0EA 1WWXA 2WY8Q 5F0HA 4WXCA 2R7QA 2HTJA 4NBQA 3RSNA 2K5CA 2XV4S 4FTHA 2M87A 1Z3YA 1HW1A 2QSGX 4XKCA 1TT5B 3RYRA 4CH7A 5HS9A 2Z2SB 1XSDA 2CV1A 2IW5A 3LFKA 3KEOA 2CJJA 1IN4A 1T98A 2QF7A 1ZLJA 3OYMA 1N78A 1KQ9A 4HNVA 2K4JA 3P7NA 1LKXA 4IRGA 3DQVC 1UMQA 5D8KB 3ZR8X 1BIAA 3ML6A 4WWCA 1D1BA 3A03A 1UG2A 3G1MA 1LQ1A 3NRVA 1SANA 4LG0A 3B6AA 4G6QA 4CZZA 2CFXA 3HOWJ 3FMQA 1XMKA 3OR2C 2VJ4A 1K83J 1P7JA 1XGSA 4DZPA 2R7DA 2VBXA 4ZTJA 3I0TA 5LEKA 2FBHA 4BJTA 3S32A 3ZQFA 3FIWA 5GPAA 3S15J 2X1CA 2AHQA 3I64A 3I3LA 3BG6A 2EZHA 4XN0A 3GX4X 2LK2A 5TRDA 1SD6A 1YTYA 4LK0F 4CGZA 2OZ6A 1KQ0A 3AG2H 2EFWA 4JK1X 1ETYA 1IJWC 4A69C 4PGHA 4AM3A 1UB9A 4IJAA 1OISA 4HLYA 3FXLA 2XC7A 4OAYA 2MH2A 3ECHA 3L2QA 3FXRA
chains in the Genus database with same CATH topology
3C2BA 3RKQA 1IDYA 1RKTA 1X2MA 5FLMJ 2DA4A 2DMTA 3S1QJ 1B72B 1Y1VJ 5M5WJ 1XG1A 2KDZA 4M3GA 2DJNA 3BR3A 1JT0A 1AKHB 2DA3A 3IV5A 4I6ZA 2LP0A 4X6AJ 1H88C 1ETKA 4C3HJ 3BTLA 1GV2A 2EH3A 2DA6A 1G2HA 1HF0A 1JUSA 3I4MJ 2JA8J 5GPCA 3MKLA 2Y9ZA 3B6CA 2JMWA 5C4XJ 1GVDA 4A3FJ 1OFCX 2KT0A 2JJ7A 1JJ6C 4Y52J 1ZR2A 4QIWN 1QVUA 2MG4A 4MFDA 3HOVJ 3G1OA 1T56A 1O4XA 3TW7A 3MVPA 5M5YJ 1B8IB 2HDDA 5F04A 1TWGJ 1TWAJ 2ME0A 3HOXJ 2Y0SN 1A5JA 2R5ZB 1JKPC 3BR0A 2JWTA 4V2FA 2R93J 3TEDA 1MSEC 1ETQA 2IEKA 4A93J 1TC3C 3BT9A 4UUSB 3HKZN 3M4OJ 3S1NJ 2DA2A 1LFBA 2LR8A 1EF4A 2NVYJ 1LE8A 4XRSG 1JKRC 2ECCA 3Q0VA 1HDPA 5M3FJ 2TCTA 5IYDJ 5DTDA 1IV6A 1U9NA 5E3NA 4RDUA 5F1JA 4A3JJ 2WV1A 2D5VA 2VI6A 3SJMA 5IP9J 2QCOA 1JTXA 4A3KJ 1F43A 2G0EA 3PO2J 1RKWA 1JUPA 3O8GA 5FJ8J 1B72A 1IDZA 4MO7A 3SDGA 5J1RA 5EG0B 1AKHA 2R92J 3A02A 1WH5A 2L0KA 3FKIJ 4QTRA 1SFOJ 1UHSA 5FKLA 2TRTA 5IPAA 1QVTA 2LD5A 4DYQA 4B1RA 4ABZA 2P81A 1QRYA 1WGXA 1IUFA 3PM1A 2LFBA 2EBIA 1ETOA 5IYBJ 1IG7A 4M3FA 2XB0X 3OOUA 2OPTA 1ZTRA 5IYCJ 2XGCA 1BA5A 1BW6A 5FKOA 3VPRA 3IH4A 1U78A 3HBLA 1RESA 4C3IJ 4A3GJ 2EZKA 1PUFA 1F36A 1YRNB 5IP7J 4BBRJ 1B8IA 3GTOJ 1OJLA 5M5XJ 3BR5A 3Q3SA 1ENHA 1ETXA 3NARA 4JP0A 1GDTA 3LSPA 2NVQJ 2N8GA 2FX0A 2XGDA 2R5ZA 3BTIA 3SFIA 1FEXA 1HCRA 4IHWA 3BTCA 3QQAA 1MBHA 5BNGA 4BXXJ 5M3MJ 2O7OA 2O8KA 3S1MJ 1JGGA 3BG5A 3TW6A 4D5FA 1BW5A 1NTCA 4XRSA 3GTGJ 4MIMA 3QPSA 3F0CA 4QSHA 2MGQA 3E7LA 5IOYA 3RZOJ 2MSYA 1GUUA 3LSGA 1H89C 2GBYA 2XRLA 3MN2A 5F27A 4IHXA 9ANTA 1E3OC 1VFCA 3DCFA 2XB5A 5E3LA 2LKXA 3G1LA 1HOMA 2WB1N 2L7FP 2XGEA 1RR7A 3LSJA 3JRDA 3O8HA 2HQ5A 3FK6A 3CCYA 1AHDP 1X58A 1GV5A 3LOCA 2NVTJ 2ID3A 5E3OA 1APLC 2NS8A 4BKXA 3ZQHA 2XPUA 2CQQA 3OIOA 4NDLA 1WCMJ 1A6IA 2EQRA 2PMZN 3DEWA 2X48A 1ZR4A 4BY1J 3S2DJ 2JA6J 2Y9YA 4W1UA 4B3AA 3NAUA 3K7AJ 3JRFA 1DU6A 4CYCB 5F0CA 3ZQIA 3Q0WA 1MBEA 3S14J 2L7MP 5F08A 3ZOBA 3S16J 5FKMA 2HXIA 2XSDC 4IEJA 3FK7A 2FQ4A 5FLVA 2YU9J 1Z0XA 2DMQA 2NS7A 1VI0A 4MFEA 5FKNA 5C3EJ 3Q0UA 3GBGA 2VUMJ 1YRNA 3JRHA 3OSFA 3GTPJ 2GM4A 2DA1A 4A3BJ 4A3EJ 5EYRA 2VKEA 2HOAA 1I3QJ 3PO3J 1D5YA 1NK2P 3ZQLA 3BR6A 2H8RA 4Y7NJ 2XPWA 2M9HA 4BBSJ 2FJ1A 2ME6A 1WH7A 1ZQ3P 2R5YB 2B63J 5J1UA 1NK3P 3GTLJ 1LFUP 1ZGWA 2K40A 3QPLA 4IHVA 3HGGA 3WHCA 4DYRA 5K7FA 4C3JJ 1Z77A 2EZIA 4AYBN 3FISA 1JUMA 2YS9A 1XS9A 5C4JJ 1HDDC 1BL0A 2GLOA 1HLVA 2JA5J 1GT0C 4D7MA 1BJZA 3D1NI 5FKKA 2CUEA 5EGOB 1VNDA 3LSRA 1T33A 2K9QA 2LY9A 5JLXA 5J1YA 2E2HJ 2DTZA 1ORKA 3S1RJ 2VPRA 2NOGA 3GTMJ 3BQZA 1ETVA 5JLWA 2ECBA 3HOYJ 4XRMA 2AO9A 2DA5A 3L1PA 3ZQCA 1QPIA 3RQIA 3BR2A 3IH2A 3GTJJ 2X9DA 1JJ8C 1JKQC 3HGYA 3ZQGA 4CYCA 1MBKA 1S7EA 4M3EA 3BG3A 4G12A 1JT6A 3UKGA 5IOZA 1MBFA 1OCTC 5F0FA 2HOTA 4UUSA 4EEFG 2DN0A 1WI3A 5HODA 4A3MJ 2VKVA 2K9NA 1FIAA 1W0UA 4J19A 2W48A 2R0QC 1VF9A 5E3MA 3S2HJ 2E19A 1U9OA 1IC8A 2X6OA 2ZB9A 2O9LA 4B4CA 5EF6A 3TP0A 4JX6A 4XIDA 3GTKJ 2YUSA 3HEFA 1JTYA 2RAEA 5C44J 3HOUJ 2JK3A 4D5CA 5EDNA 2K9SA 1CQTA 1IRZA 4M3BA 4A3IJ 1RETA 3IH3A 4AUXA 3JRCA 1K61A 4XK4A 2LVSA 3RZDJ 3BTJA 1ITYA 4I76A 4FE7A 1MSFC 5EZHA 3A01B 2R5YA 4FCYA 1XC5A 2M34A 1FTZA 5EG0A 3JRIA 1ZK8A 4V2GA 4L5EA 2DMNA 3BR1A 1I6HJ 1POGA 3GTQJ 2FD5A 2DMUA 5J3LA 4MLOA 3HB9A 4A3DJ 4AC0A 1DU0A 2Y31A 1RPWA 2NVXJ 3HDDA 1TWFJ 1MNMC 2COBA 2CRGA 5EGOA 2CUFA 2L9RA 2Y2ZA 4DYCA 3JRGA 1MH4A 3I4NJ 4D7NA 5EEAA 3WHBA 1OCPA 3OSGA 2LTPA 2M8GX 1JKOC 1PUFB 2LLKA 3BQYA 3H0GJ 2E2JJ 2L7ZA 4FISA 1ETWA 4M6VA 4A3LJ 2M0CA 1AU7A 4DZJA 5GP9A 3BG9A 4S0HB 5IP6A 3HM5A 2ELKA 4IHYA 2HYJA 2MW8A 3K2AA 3M3YJ 1Q1VA 4DW6A 3HOZJ 1P7IA 1WPKA 2XPVA 3H3VK 2JN6A 4C2MJ 2Y30A 2E2IJ 5F0HA 5K7HA 2DA7A 1U8BA 3JRBA 4FTHA 1X2NA 1R9TJ 4W97A 2IAIA 1FIPA 3CDLA 2E1OA 2OF7A 3TP3A 2EZLA 2R7ZJ 4UUTA 2M2EA 4X1EA 1W0TA 2CJJA 4A3CJ 2QF7A 4LOCA 4HNVA 1MH3A 5K7ZA 4XICA 1UMQA 3JRAA 1MBGA 4JYKA 3A01A 1TWCJ 2HXOA 4GFBA 3A03A 3JREA 2CQXA 1Y1WJ 4BY7J 1UG2A 1ZKGA 3G1MA 2HOSA 1SANA 1MBJA 3JR9A 3B6AA 5DS9A 3HOWJ 4M3DA 1H8AC 1K83J 2I10A 1P7JA 2CU7A 2ID6A 4DZPA 3CMYA 3W6VA 4JX5A 2JA7J 3ZQFA 3FIWA 5EZGA 5GPAA 3S15J 2AHQA 2DMPA 2H1KA 2WAQN 1I50J 3S17J 2EZHA 1LE8B 1IGNA 2LK2A 2HI3A 2IBDA 1ETYA 4RBOA 1IJWC 4A69C 1FTTA 4FE4A 1FJLA 4JX4A 3CQZJ 3LNQA 1TWHJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2B A;  3RKQ A;  1IDY A;  1RKT A;  1X2M A;  5FLM J;  2DA4 A;  2DMT A;  3S1Q J;  1B72 B;  1Y1V J;  5M5W J;  1XG1 A;  2KDZ A;  4M3G A;  2DJN A;  3BR3 A;  1JT0 A;  1AKH B;  2DA3 A;  3IV5 A;  4I6Z A;  2LP0 A;  4X6A J;  1H88 C;  1ETK A;  4C3H J;  3BTL A;  1GV2 A;  2EH3 A;  2DA6 A;  1G2H A;  1HF0 A;  1JUS A;  3I4M J;  2JA8 J;  5GPC A;  3MKL A;  2Y9Z A;  3B6C A;  2JMW A;  5C4X J;  1GVD A;  4A3F J;  1OFC X;  2KT0 A;  2JJ7 A;  1JJ6 C;  4Y52 J;  1ZR2 A;  4QIW N;  1QVU A;  2MG4 A;  4MFD A;  3HOV J;  3G1O A;  1T56 A;  1O4X A;  3TW7 A;  3MVP A;  5M5Y J;  1B8I B;  2HDD A;  5F04 A;  1TWG J;  1TWA J;  2ME0 A;  3HOX J;  2Y0S N;  1A5J A;  2R5Z B;  1JKP C;  3BR0 A;  2JWT A;  4V2F A;  2R93 J;  3TED A;  1MSE C;  1ETQ A;  2IEK A;  4A93 J;  1TC3 C;  3BT9 A;  4UUS B;  3HKZ N;  3M4O J;  3S1N J;  2DA2 A;  1LFB A;  2LR8 A;  1EF4 A;  2NVY J;  1LE8 A;  4XRS G;  1JKR C;  2ECC A;  3Q0V A;  1HDP A;  5M3F J;  2TCT A;  5IYD J;  5DTD A;  1IV6 A;  1U9N A;  5E3N A;  4RDU A;  5F1J A;  4A3J J;  2WV1 A;  2D5V A;  2VI6 A;  3SJM A;  5IP9 J;  2QCO A;  1JTX A;  4A3K J;  1F43 A;  2G0E A;  3PO2 J;  1RKW A;  1JUP A;  3O8G A;  5FJ8 J;  1B72 A;  1IDZ A;  4MO7 A;  3SDG A;  5J1R A;  5EG0 B;  1AKH A;  2R92 J;  3A02 A;  1WH5 A;  2L0K A;  3FKI J;  4QTR A;  1SFO J;  1UHS A;  5FKL A;  2TRT A;  5IPA A;  1QVT A;  2LD5 A;  4DYQ A;  4B1R A;  4ABZ A;  2P81 A;  1QRY A;  1WGX A;  1IUF A;  3PM1 A;  2LFB A;  2EBI A;  1ETO A;  5IYB J;  1IG7 A;  4M3F A;  2XB0 X;  3OOU A;  2OPT A;  1ZTR A;  5IYC J;  2XGC A;  1BA5 A;  1BW6 A;  5FKO A;  3VPR A;  3IH4 A;  1U78 A;  3HBL A;  1RES A;  4C3I J;  4A3G J;  2EZK A;  1PUF A;  1F36 A;  1YRN B;  5IP7 J;  4BBR J;  1B8I A;  3GTO J;  1OJL A;  5M5X J;  3BR5 A;  3Q3S A;  1ENH A;  1ETX A;  3NAR A;  4JP0 A;  1GDT A;  3LSP A;  2NVQ J;  2N8G A;  2FX0 A;  2XGD A;  2R5Z A;  3BTI A;  3SFI A;  1FEX A;  1HCR A;  4IHW A;  3BTC A;  3QQA A;  1MBH A;  5BNG A;  4BXX J;  5M3M J;  2O7O A;  2O8K A;  3S1M J;  1JGG A;  3BG5 A;  3TW6 A;  4D5F A;  1BW5 A;  1NTC A;  4XRS A;  3GTG J;  4MIM A;  3QPS A;  3F0C A;  4QSH A;  2MGQ A;  3E7L A;  5IOY A;  3RZO J;  2MSY A;  1GUU A;  3LSG A;  1H89 C;  2GBY A;  2XRL A;  3MN2 A;  5F27 A;  4IHX A;  9ANT A;  1E3O C;  1VFC A;  3DCF A;  2XB5 A;  5E3L A;  2LKX A;  3G1L A;  1HOM A;  2WB1 N;  2L7F P;  2XGE A;  1RR7 A;  3LSJ A;  3JRD A;  3O8H A;  2HQ5 A;  3FK6 A;  3CCY A;  1AHD P;  1X58 A;  1GV5 A;  3LOC A;  2NVT J;  2ID3 A;  5E3O A;  1APL C;  2NS8 A;  4BKX A;  3ZQH A;  2XPU A;  2CQQ A;  3OIO A;  4NDL A;  1WCM J;  1A6I A;  2EQR A;  2PMZ N;  3DEW A;  2X48 A;  1ZR4 A;  4BY1 J;  3S2D J;  2JA6 J;  2Y9Y A;  4W1U A;  4B3A A;  3NAU A;  3K7A J;  3JRF A;  1DU6 A;  4CYC B;  5F0C A;  3ZQI A;  3Q0W A;  1MBE A;  3S14 J;  2L7M P;  5F08 A;  3ZOB A;  3S16 J;  5FKM A;  2HXI A;  2XSD C;  4IEJ A;  3FK7 A;  2FQ4 A;  5FLV A;  2YU9 J;  1Z0X A;  2DMQ A;  2NS7 A;  1VI0 A;  4MFE A;  5FKN A;  5C3E J;  3Q0U A;  3GBG A;  2VUM J;  1YRN A;  3JRH A;  3OSF A;  3GTP J;  2GM4 A;  2DA1 A;  4A3B J;  4A3E J;  5EYR A;  2VKE A;  2HOA A;  1I3Q J;  3PO3 J;  1D5Y A;  1NK2 P;  3ZQL A;  3BR6 A;  2H8R A;  4Y7N J;  2XPW A;  2M9H A;  4BBS J;  2FJ1 A;  2ME6 A;  1WH7 A;  1ZQ3 P;  2R5Y B;  2B63 J;  5J1U A;  1NK3 P;  3GTL J;  1LFU P;  1ZGW A;  2K40 A;  3QPL A;  4IHV A;  3HGG A;  3WHC A;  4DYR A;  5K7F A;  4C3J J;  1Z77 A;  2EZI A;  4AYB N;  3FIS A;  1JUM A;  2YS9 A;  1XS9 A;  5C4J J;  1HDD C;  1BL0 A;  2GLO A;  1HLV A;  2JA5 J;  1GT0 C;  4D7M A;  1BJZ A;  3D1N I;  5FKK A;  2CUE A;  5EGO B;  1VND A;  3LSR A;  1T33 A;  2K9Q A;  2LY9 A;  5JLX A;  5J1Y A;  2E2H J;  2DTZ A;  1ORK A;  3S1R J;  2VPR A;  2NOG A;  3GTM J;  3BQZ A;  1ETV A;  5JLW A;  2ECB A;  3HOY J;  4XRM A;  2AO9 A;  2DA5 A;  3L1P A;  3ZQC A;  1QPI A;  3RQI A;  3BR2 A;  3IH2 A;  3GTJ J;  2X9D A;  1JJ8 C;  1JKQ C;  3HGY A;  3ZQG A;  4CYC A;  1MBK A;  1S7E A;  4M3E A;  3BG3 A;  4G12 A;  1JT6 A;  3UKG A;  5IOZ A;  1MBF A;  1OCT C;  5F0F A;  2HOT A;  4UUS A;  4EEF G;  2DN0 A;  1WI3 A;  5HOD A;  4A3M J;  2VKV A;  2K9N A;  1FIA A;  1W0U A;  4J19 A;  2W48 A;  2R0Q C;  1VF9 A;  5E3M A;  3S2H J;  2E19 A;  1U9O A;  1IC8 A;  2X6O A;  2ZB9 A;  2O9L A;  4B4C A;  5EF6 A;  3TP0 A;  4JX6 A;  4XID A;  3GTK J;  2YUS A;  3HEF A;  1JTY A;  2RAE A;  5C44 J;  3HOU J;  2JK3 A;  4D5C A;  5EDN A;  2K9S A;  1CQT A;  1IRZ A;  4M3B A;  4A3I J;  1RET A;  3IH3 A;  4AUX A;  3JRC A;  1K61 A;  4XK4 A;  2LVS A;  3RZD J;  3BTJ A;  1ITY A;  4I76 A;  4FE7 A;  1MSF C;  5EZH A;  3A01 B;  2R5Y A;  4FCY A;  1XC5 A;  2M34 A;  1FTZ A;  5EG0 A;  3JRI A;  1ZK8 A;  4V2G A;  4L5E A;  2DMN A;  3BR1 A;  1I6H J;  1POG A;  3GTQ J;  2FD5 A;  2DMU A;  5J3L A;  4MLO A;  3HB9 A;  4A3D J;  4AC0 A;  1DU0 A;  2Y31 A;  1RPW A;  2NVX J;  3HDD A;  1TWF J;  1MNM C;  2COB A;  2CRG A;  5EGO A;  2CUF A;  2L9R A;  2Y2Z A;  4DYC A;  3JRG A;  1MH4 A;  3I4N J;  4D7N A;  5EEA A;  3WHB A;  1OCP A;  3OSG A;  2LTP A;  2M8G X;  1JKO C;  1PUF B;  2LLK A;  3BQY A;  3H0G J;  2E2J J;  2L7Z A;  4FIS A;  1ETW A;  4M6V A;  4A3L J;  2M0C A;  1AU7 A;  4DZJ A;  5GP9 A;  3BG9 A;  4S0H B;  5IP6 A;  3HM5 A;  2ELK A;  4IHY A;  2HYJ A;  2MW8 A;  3K2A A;  3M3Y J;  1Q1V A;  4DW6 A;  3HOZ J;  1P7I A;  1WPK A;  2XPV A;  3H3V K;  2JN6 A;  4C2M J;  2Y30 A;  2E2I J;  5F0H A;  5K7H A;  2DA7 A;  1U8B A;  3JRB A;  4FTH A;  1X2N A;  1R9T J;  4W97 A;  2IAI A;  1FIP A;  3CDL A;  2E1O A;  2OF7 A;  3TP3 A;  2EZL A;  2R7Z J;  4UUT A;  2M2E A;  4X1E A;  1W0T A;  2CJJ A;  4A3C J;  2QF7 A;  4LOC A;  4HNV A;  1MH3 A;  5K7Z A;  4XIC A;  1UMQ A;  3JRA A;  1MBG A;  4JYK A;  3A01 A;  1TWC J;  2HXO A;  4GFB A;  3A03 A;  3JRE A;  2CQX A;  1Y1W J;  4BY7 J;  1UG2 A;  1ZKG A;  3G1M A;  2HOS A;  1SAN A;  1MBJ A;  3JR9 A;  3B6A A;  5DS9 A;  3HOW J;  4M3D A;  1H8A C;  1K83 J;  2I10 A;  1P7J A;  2CU7 A;  2ID6 A;  4DZP A;  3CMY A;  3W6V A;  4JX5 A;  2JA7 J;  3ZQF A;  3FIW A;  5EZG A;  5GPA A;  3S15 J;  2AHQ A;  2DMP A;  2H1K A;  2WAQ N;  1I50 J;  3S17 J;  2EZH A;  1LE8 B;  1IGN A;  2LK2 A;  2HI3 A;  2IBD A;  1ETY A;  4RBO A;  1IJW C;  4A69 C;  1FTT A;  4FE4 A;  1FJL A;  4JX4 A;  3CQZ J;  3LNQ A;  1TWH J; 
#chains in the Genus database with same CATH topology
 1ON2 A;  3DU6 A;  4UXN A;  3C2B A;  1A6Q A;  2H6B A;  4YEJ A;  5TGT A;  1ZRE A;  2CQN A;  3P5J A;  4HV6 A;  1X3W B;  5F64 A;  3H0D A;  1TW3 A;  2GXG A;  4GDF A;  4M73 A;  2A07 F;  2CV0 A;  1Y1V J;  2FNP A;  2QZ8 A;  1J59 A;  2JUG A;  5E18 F;  3EUA A;  2Q8K A;  4UV8 A;  2KDZ A;  4M3G A;  2YR2 A;  2DJN A;  4IXA A;  1AKH B;  3F8M A;  2DA3 A;  2OAZ A;  3IV5 A;  4X6A J;  1FP2 A;  2LF8 A;  1YQA A;  2BVL A;  2XSJ C;  3GUD A;  2MAB A;  5D6E A;  4ON0 A;  4HF0 A;  3OYF A;  1JUS A;  4MGR A;  3DBR B;  5GPC A;  1U5T B;  2EA4 A;  2Y9Z A;  4F92 B;  3QOE A;  2ETH A;  2JMW A;  4UB6 C;  2LKP A;  3CCL I;  1TQM A;  1EKE A;  1OFC X;  5ICC A;  1WRJ A;  4QIW N;  2VC0 A;  4YEL A;  1F4K A;  2FML A;  2MG4 A;  4MFD A;  2CW8 A;  2NNY A;  1K4T A;  2HDD A;  3RIR A;  3QOP A;  3O2P E;  3JCU C;  3HOX J;  1T08 B;  4RM2 A;  1IN7 A;  2BY2 A;  2R4G A;  4AD9 A;  3BR0 A;  2P6S A;  4P1W A;  2DT6 A;  4V2F A;  1RZ4 A;  1MSE C;  1ETQ A;  1QZZ A;  2IEK A;  2VBW A;  1VQP I;  5BQT A;  4UUS B;  1Z6T A;  5D8L B;  2DA2 A;  3I9V 2;  3D5L A;  3CCU I;  2QLZ A;  2NVY J;  3KIO A;  4A0X A;  1LE8 A;  4XRS G;  4BNC A;  1JKR C;  4XSZ F;  1BI0 A;  3CJR B;  5M3F J;  3MFK A;  1X4O A;  3CO7 C;  5IYD J;  2MC3 A;  1MJB A;  1HA8 A;  2FOW A;  2R3S A;  5HNF A;  5BS6 A;  4G9Y A;  2R7U A;  1LB2 A;  5IP9 J;  3GZ6 A;  2DPU A;  2RRE A;  3S8P A;  1B4A A;  3PO2 J;  2WAQ A;  1RKW A;  4MQV A;  3BP8 A;  3O8G A;  1IDZ A;  4MHG A;  4RMN A;  3D5R C;  1VQN I;  3LSM A;  1IO2 A;  2STW A;  2ZXI A;  1SD5 A;  5D5V B;  3PQK A;  3FKI J;  3HRT A;  5JR3 A;  3WOD F;  2HPM A;  2F5D A;  2XAF A;  3F8B A;  2A68 F;  3KCC A;  3J81 K;  5DYM A;  2HNH A;  3QRF F;  2EBI A;  5LGN A;  1R6R A;  1IG7 A;  1Z91 A;  1ZTR A;  5B1A H;  5E8I A;  3KZZ A;  4LLN A;  4ZC3 A;  3CC7 I;  4WXH A;  1E2X A;  4O6J A;  4HA8 A;  3LSI A;  3BZC A;  1YRN B;  2VJ5 A;  3E5X A;  4BBR J;  1B8I A;  3JAM K;  3OYH A;  2QYO A;  1OJL A;  1UG0 A;  1BOA A;  3RJP A;  5M5X J;  3DXJ F;  2QKL B;  3Q3S A;  4BEH B;  1ETX A;  1V55 H;  2HPI A;  3F8C A;  3LSP A;  2N8G A;  2FX0 A;  2XGD A;  3CUQ C;  3CUQ A;  2R5Z A;  1T2K A;  3C3W A;  1FEX A;  4NB5 A;  3G6E I;  2E1M C;  2DT5 A;  4IHW A;  1EJ9 A;  1IXR C;  4IL6 C;  2PJP A;  1HC8 A;  1TBX A;  1QHH D;  1MBH A;  2X4H A;  5M3M J;  2EIJ H;  2ZME C;  2F5C A;  1JGG A;  4D5F A;  3ABM H;  1RI7 A;  4MIM A;  3F0C A;  3H5R A;  4XOT A;  1SFK A;  2GBY A;  2XRL A;  1YIO A;  2RNG A;  4DOZ A;  2VBY A;  1SFU A;  1W36 D;  4ETS A;  2HTS A;  1IRX A;  2EV0 A;  3DCF A;  2XB5 A;  5FB2 A;  3G1L A;  3KP4 A;  2JVG A;  4KIC A;  2A6H F;  1FBU A;  2FEZ A;  4Y33 A;  3FK6 A;  1TQP A;  3CCY A;  5DM7 F;  3HOS A;  4RA2 A;  2M45 A;  1L0O C;  1NG6 A;  3JW4 A;  1EH7 A;  2AQE A;  2ID3 A;  5E3O A;  2FOK A;  2H8W A;  5B66 C;  4XKW A;  3ULQ B;  4BKX A;  4ENK A;  1K79 A;  1LDD A;  2RNJ A;  3ZQH A;  1WJC A;  1I5Z A;  2CQQ A;  1XX5 A;  2K7L A;  3T1B A;  4D0P A;  3JSO A;  5HS8 A;  3M1E A;  1WCM J;  4NDL A;  2EQR A;  3DEW A;  2P5L C;  2EV5 A;  4EJV A;  3ECO A;  2LOO A;  2ADU A;  3WE3 A;  3CF5 F;  3L2R A;  4I2O A;  1KQ8 A;  2IS1 A;  2JA6 J;  4W1U A;  1HW5 A;  1B9N A;  1LEA A;  3K7A J;  3MKY B;  3JRF A;  1DU6 A;  2ZNY A;  4ITV A;  3HUG A;  1Y8R B;  2M7B A;  3H3Z A;  4KN4 X;  2XUB A;  1B1B A;  5F08 A;  3KP6 A;  1YG2 A;  2OUM A;  2KIU A;  2ZME B;  2ACJ A;  2CWE A;  2L4A A;  3RI4 A;  2ZNZ A;  2EFP A;  2HXI A;  4KIS A;  4CCM A;  5FLV A;  3FK7 A;  4BQO A;  2EV6 A;  4BGD A;  1X1C A;  2DMQ A;  2NS7 A;  3V8L A;  1TNT A;  4GYG A;  4MFE A;  2QA4 I;  5C3E J;  3GBG A;  5L3C A;  3JRH A;  1TL8 A;  4IZZ A;  3LQQ A;  1MD0 A;  2BW3 B;  2YU3 A;  4KIF A;  2GM4 A;  2L9V A;  4A3B J;  3QP5 A;  2KQR A;  4A6D A;  4R79 A;  3OS0 A;  1D5Y A;  2XPW A;  2VIX A;  1ACI A;  2FJ1 A;  2ZBK A;  4A12 A;  2IXS A;  2ZFW A;  2KJB A;  2BYV E;  2VOD A;  1ZQ3 P;  1VQ4 I;  1IN8 A;  2P6T A;  3QPL A;  5E17 F;  3LFU A;  2MLK A;  1UJ8 A;  2OCC H;  3CCM I;  4HX7 A;  4BE0 A;  5ICG A;  2FE3 A;  1Z77 A;  3EQL F;  2ELJ A;  1TLH B;  2J5O A;  2I8D A;  2EZI A;  3HJE A;  3PFI A;  1JUM A;  1Z9C A;  4XLF A;  1XS9 A;  1HDD C;  4HLX A;  1BL0 A;  3OYG A;  3HPH A;  1XMA A;  4NNJ A;  1HLV A;  3L00 A;  3KE2 A;  4ZDL A;  5HLH A;  4EGY A;  5HLT A;  2DOD A;  4D7M A;  4KYW A;  5FKK A;  1PYV A;  1KGS A;  2K4B A;  1VND A;  3LSR A;  1T33 A;  1BIB A;  2O3F A;  3A0B C;  1V5F A;  4PFO A;  3G71 I;  4AIK A;  4OIO F;  4CDG A;  2DTZ A;  1CF7 B;  4OMZ A;  1ORK A;  3KET A;  2BY3 A;  3FZV A;  4C30 A;  4KIB A;  4AVZ A;  1G6N A;  3AL0 B;  4N9H A;  3HTU A;  3HOY J;  3CCJ I;  2AO9 A;  2Q2E A;  2H27 A;  3QU3 A;  3WTT C;  3IH2 A;  2X9D A;  3WG7 H;  1ZAR A;  1FY7 A;  2A61 A;  3BG3 A;  5DV5 A;  4CUG A;  2ZC2 A;  2VKD A;  2DYR H;  2IGN A;  4J00 A;  1Q1H A;  5EEG A;  2HOT A;  2DU9 A;  4XSX F;  5GAH J;  4GRI A;  4A3M J;  2IA0 A;  2K9N A;  1YYV A;  3LL7 A;  1FOK A;  3N97 A;  3F9K A;  2Z16 A;  3KEQ A;  1IC8 A;  2ZFU A;  3HRM A;  5ILU A;  2ZB9 A;  3ONQ A;  2O9L A;  5EF6 A;  3HXL A;  1F9N A;  4JX6 A;  4N0B A;  5E1Z B;  3GTK J;  4TV7 A;  4U0W A;  5KHD A;  3GFJ A;  2XAS A;  1FYL A;  1OYW A;  2F5F A;  5DUI A;  1RUN A;  3HOU J;  4A5N A;  2P5V A;  3M8E A;  4D5C A;  1CQT A;  1S9H A;  1PJR A;  3IWZ A;  1OQY A;  2L4M A;  1KON A;  2NYX A;  3LA3 A;  3DBL B;  4M3B A;  4HEA 2;  3I71 A;  3IH3 A;  3J7Y J;  4AUX A;  3L2V A;  3WGG A;  3JRC A;  1K61 A;  4XK4 A;  3TMO A;  4PFP A;  2G7H A;  3OYE A;  5CPR B;  3PJR A;  1YJW I;  3MKW B;  4PSW A;  5EZH A;  1KU9 A;  3A01 B;  1XSX A;  3DPT A;  5J8F A;  2VQC A;  5EG0 A;  3KYC B;  2IT0 A;  2L01 A;  4P96 A;  1YJ9 I;  1XCV A;  3GO5 A;  3QP6 A;  1SVL A;  1TQI A;  4OAZ A;  3GTQ J;  2DMU A;  5J3L A;  2HQA A;  2WY7 Q;  4A3D J;  4AC0 A;  2GA1 A;  1RPW A;  4XLC A;  2DBB A;  1W5T A;  2WA0 A;  2X1E A;  2PJR B;  4CO8 A;  1V5G A;  3PSF A;  1N75 A;  5EGO A;  1D0Y A;  2VXD A;  1SC7 A;  4Z2Y A;  2VAS A;  2Y2Z A;  2CQ7 A;  4DYC A;  3JRG A;  4CHU A;  2LY1 A;  5H2F C;  4XLA A;  3WHB A;  2RDP A;  2R7O A;  2LLK A;  2FBK A;  3BQY A;  1D1C A;  4P9F A;  3CDI A;  4P9U A;  2L7Z A;  3GCM A;  1R36 A;  4YFX F;  1HBX G;  5IT3 A;  2M0C A;  3UNG C;  1UEL B;  2DDB A;  5GP9 A;  3X2Q H;  4I02 A;  1EV7 A;  2MBF A;  4Y13 A;  4YG2 F;  3M3Y J;  5GTI C;  2MD5 A;  4PSX A;  1BOB A;  4OIN F;  4XON A;  3J7Z I;  1QZY A;  4C2M J;  2Y30 A;  1X1D A;  2QKM B;  3I53 A;  3RDI A;  3N05 A;  1U8B A;  3RQ4 A;  3JRB A;  3G3Z A;  4EVI A;  1R9T J;  2R7F A;  3FDY A;  4LIT A;  3WTS C;  1FIP A;  1IZ1 A;  1Y0N A;  3JTG A;  3T0Y A;  2W7N A;  2KHM A;  4Y17 A;  2E1O A;  1W4M A;  4FT8 A;  1A36 A;  4AVP A;  2EZL A;  1PP7 U;  4UUT A;  2M2E A;  4S05 A;  4XLE A;  4MTE A;  3Q5F A;  1D0Z A;  1J7K A;  1BC7 C;  1MH3 A;  4XIC A;  4PK4 A;  1RC9 A;  3E1S A;  2H09 A;  4I99 C;  4M74 A;  3TKY A;  2ZSI B;  2K85 A;  4GYI A;  4JYK A;  1TWC J;  2YX4 A;  3CCE I;  4C2T A;  2M5W A;  1LPQ A;  2FXA A;  2Z99 A;  3H5N A;  1KU2 A;  4FET A;  2CQX A;  4PJM A;  2QEN A;  4KN7 X;  1ZKG A;  3H9G A;  2O6G E;  3CJN A;  3WGH A;  1DP3 A;  4OMY A;  4E7S A;  2EIM H;  2QQA A;  4M3D A;  2I10 A;  2CU7 A;  3GFL A;  3CMY A;  2K27 A;  4HZF A;  3CZ6 A;  5FO5 A;  1FMW A;  3KP5 A;  2JA7 J;  3LSH A;  2FSW A;  1OKR A;  2H1K A;  2IS4 A;  1ONV A;  4HW0 A;  4RB2 C;  3K69 A;  2BV6 A;  2ZJP F;  5EEH A;  1FBQ A;  5GAD J;  2VBZ A;  1YE9 A;  1N77 A;  1X1P A;  3VSL A;  3U1K A;  3V8J A;  2CUZ A;  2HI3 A;  2KRF A;  5L3B A;  5LRS A;  4RBO A;  1W7P A;  3CLO A;  4MTD A;  1ZRF A;  1QU3 A;  1QHG A;  4YII A;  3LNQ A;  1QA6 A;  2P4W A;  1DUX C;  2LY2 A;  2ZJ2 A;  1X3U A;  3J81 Z;  1E3H A;  2A6T A;  3SZG A;  1LVA A;  4V19 K;  5FLM J;  2ZCW A;  2W85 A;  2RV8 A;  4KT6 A;  3S1Q J;  4L5I A;  1B72 B;  1FZP B;  2IGO A;  5CVV A;  5M5W J;  4IRI A;  2X51 A;  1JT0 A;  2NOJ B;  2LYC A;  1ZN2 A;  2FRH A;  3IAS 2;  4K2E A;  2LP0 A;  3JAM Z;  1SFE A;  3PNV A;  1GV2 A;  4UV9 A;  2DAO A;  4Y15 A;  3AFH A;  2Z5U A;  3FHZ A;  4ASN A;  3F3X A;  1G2H A;  2JRM A;  5GAG J;  1ZYR F;  1B9M A;  2WAE A;  3MKL A;  4KIG A;  2YPR A;  3KPH A;  3ZMS A;  5DUK A;  4A3F J;  1B59 A;  2JJ7 A;  3E5U A;  3K4L A;  1KA8 A;  2LKS A;  2M0M A;  1T56 A;  2HDW A;  3BOQ A;  2L9S A;  3IP4 B;  3MVP A;  5M5Y J;  3FBN B;  4HOB A;  5F04 A;  2F2E A;  1VQ6 I;  1TWA J;  1MIJ A;  3QYF A;  3OIP A;  3RKX A;  2F48 A;  2Y0S N;  1A5J A;  4II3 A;  1JKP C;  1C0W A;  4HF1 A;  1TZL A;  3U2R A;  2IGK A;  1TT0 A;  4KA4 A;  4A93 J;  1I1G A;  1TC3 C;  4GGG A;  4OOI A;  2ZXJ A;  3CUO A;  2O0Y A;  3G73 A;  2K9L A;  3S1N J;  2DJI A;  1EF4 A;  3GF2 A;  3TO7 A;  2YX7 A;  3MEX A;  3W2V A;  5CJ9 A;  2DOA A;  2ECC A;  3L2U A;  1HDP A;  4LIU A;  4DNC A;  1Z67 A;  1MDM B;  1WVR A;  5F1J A;  1JXS A;  2XIG A;  3PIO F;  1K78 A;  3FXQ A;  3KYD B;  3OYI A;  3CC4 I;  3ZQQ A;  4M9Z A;  4G94 A;  4A0Y A;  1JTX A;  4A3K J;  1YW7 A;  2M30 A;  1F43 A;  3AAF A;  2VE8 A;  2CW7 A;  3BC8 A;  5FJ8 J;  1PP8 F;  4CYD A;  1WJ5 A;  3GYH X;  1BI2 A;  2V1U A;  4XQF A;  3QAH A;  3W2A A;  2PMU A;  3SDG A;  1BI3 A;  1AKH A;  4HX4 A;  2R92 J;  4J01 A;  3A02 A;  1WH5 A;  2K86 A;  2L0K A;  3DBH B;  3OOP A;  3N4M A;  3P9K A;  4EM1 A;  5IPA A;  2LD5 A;  4DYQ A;  5BPI A;  1AOY A;  4QWQ A;  1QRY A;  1WGX A;  2F5E A;  1U5T C;  3GFI A;  2HVQ A;  1Z6R A;  2E34 A;  2V9V A;  2EJR A;  1T6S A;  1ETO A;  2I5U A;  4M3F A;  3A2K A;  2XB0 X;  5IYC J;  1YW9 A;  2XGC A;  1BA5 A;  2FMY A;  3OYC A;  5CVR A;  3K4M A;  1UHM A;  1BW6 A;  4B48 A;  3IH4 A;  3HBL A;  4XKV A;  1RES A;  1RIO H;  4O5V A;  2EZK A;  1F36 A;  3MMY B;  2OD5 A;  2VC1 A;  5IP7 J;  2UWM A;  4I0A A;  4KFC A;  5J6X A;  4UNO A;  4XR6 A;  3NAR A;  2NVQ J;  1ZG5 A;  2HYG D;  3BTI A;  2XKO A;  5DEQ A;  4CZC A;  1J75 A;  3M8F A;  5BNG A;  1D5V A;  2O7O A;  3BJA A;  2O8K A;  3S1M J;  3BG5 A;  1O3Q A;  3EYI A;  1BW5 A;  4PCQ A;  1NTC A;  1X3Z B;  4XRS A;  3QPS A;  3ZN1 A;  5D5X B;  2AXT C;  5IOY A;  3GEZ A;  2MSY A;  3RZO J;  1GUU A;  3LSG A;  3COA C;  2DI3 A;  3AG1 H;  1LDK B;  3DWL E;  2OQR A;  2STT A;  2VKH A;  5LRR A;  1Y56 A;  4GXO A;  3RKY A;  4IHT A;  5F27 A;  1ZG1 A;  5KVR A;  2RKH A;  3DTI A;  2BVM A;  4C9Y A;  1MMG A;  3IC7 A;  2WB1 N;  1ZAO A;  3DEE A;  2WV0 A;  1FWZ A;  3GVA A;  3KP3 A;  1VQO I;  2QBY B;  1BM9 A;  2HYF A;  5GTH C;  2LBF B;  2A5Y B;  3OY9 A;  4LD5 A;  2V9P A;  1X58 A;  2NVT J;  4F55 A;  3HKZ A;  3H35 A;  1HKQ A;  4CCN A;  4HAM A;  2ZKZ A;  1BC8 C;  1QPM A;  3MAJ A;  2UXN A;  2EK5 A;  2X48 A;  1RRJ A;  2KRH A;  2KIF A;  2QQ9 A;  2XAJ A;  3A0H C;  3QYB A;  4II2 A;  3S2D J;  3LMM A;  2X6X A;  1SMY F;  1E3P A;  2Y9Y A;  1D3Y A;  4EJU A;  1G8X A;  1WJF A;  3HSE A;  4KMU X;  1WSU A;  1SAX A;  3ZQI A;  3R6S A;  2EFN A;  2HR3 A;  3ZMT A;  3Q0W A;  1MBE A;  2FNA A;  2K9M A;  2L7M P;  4XRF A;  3RPU A;  2BXY A;  4U7D A;  1I1S A;  1DGW Y;  2XSD C;  3K10 A;  4HNT A;  2VJI A;  2YU9 J;  1X1B A;  2CG4 A;  3IUO A;  1Z0X A;  1VI0 A;  3QU6 A;  4U0Y A;  5FKN A;  2C6Y A;  2KIM A;  2XF7 A;  1YRN A;  3GTP J;  3T8R A;  2H94 A;  1DP7 P;  3QPT A;  5DDG A;  4DBR A;  3OYK A;  2EIK H;  2CS3 A;  3FXJ A;  4ESB A;  4N4O B;  5EYR A;  1SD4 A;  2FUG 2;  2P5K A;  2L3D A;  2VKE A;  2E60 A;  5CVJ A;  4XMY A;  3MZY A;  4ZYE A;  4KUM A;  4BXU A;  2H8R A;  4LB6 B;  3H92 A;  2LSO A;  4CCL A;  5FD6 A;  4BBS J;  1MMD A;  1DPR A;  3V4G A;  2DYS H;  5BOX A;  2R5Y B;  1B6A A;  4D1Q A;  1NK3 P;  4WX9 A;  1YIT I;  2JZY A;  1ZGW A;  4P55 A;  3V42 A;  4IHV A;  2WTE A;  3HGG A;  3WGI A;  2BBY A;  3CCV I;  3DEU A;  3WHC A;  3RYP A;  4Q48 A;  5KCM A;  4DYR A;  1V5E A;  4RB3 C;  3J7A Y;  1DPU A;  3HPG A;  1FYM A;  3DV8 A;  2VOO A;  3IL2 A;  2HGC A;  2JA5 J;  3QPH A;  1O7F A;  1GT0 C;  3QYE A;  1BJZ A;  4P5O A;  2ICW G;  2CUE A;  2E7X A;  5L3F A;  2FBI A;  2LY9 A;  3DTE A;  5JLX A;  2HVS A;  5HLI A;  1R1U A;  2E2H J;  1Z05 A;  2VPR A;  1P92 A;  2NOG A;  3GTM J;  3BQZ A;  1J09 A;  2ECB A;  3Q9V A;  3L1P A;  4HSR A;  4H0E A;  4KMF A;  1MND A;  3GTJ J;  1FOW A;  2W1O A;  5DD8 A;  3ZQG A;  2EFO A;  3R0A A;  2VN2 A;  1VQ8 I;  1D1A A;  2X1D A;  3HHH A;  2LC2 A;  5IOZ A;  1BR2 A;  2ZME A;  2JTV A;  3FM3 A;  3FMS A;  4ZZD A;  5HOD A;  3GFM A;  4ENM A;  2VKV A;  3E6M A;  4J19 A;  1SAU A;  5E3M A;  1U9O A;  2HQN A;  2L54 A;  1R23 A;  2XAU A;  1ERD A;  2IGM A;  2COM A;  1YS6 A;  3R4K A;  4B09 A;  4B4C A;  2PMZ A;  4RB0 A;  4XID A;  2GXB A;  2GQQ A;  2BW3 A;  1KZH A;  5F6F A;  3GZN B;  5L3D A;  3SYT A;  5C44 J;  1A35 A;  4L5J A;  4M6X A;  1W5C C;  5EDN A;  1Y8Q B;  4E7I A;  4KT5 C;  3FX3 A;  4JQF A;  3ZMD A;  3R61 A;  1P4W A;  4HPQ A;  1RET A;  3VOD A;  4PJ0 C;  2BEO A;  2V7F A;  4BAY A;  2K02 A;  5A2Q K;  3EUH A;  4OIP F;  3EUH C;  3MCZ A;  4FE7 A;  3LA2 A;  4I76 A;  1MSF C;  1W36 C;  3LWF A;  3PQJ A;  3VYT B;  3OMY A;  1XC5 A;  3ABT A;  2M34 A;  3AG3 H;  3FXM A;  4LIV A;  2D1H A;  1FTZ A;  1I27 A;  3HRU A;  2OV7 A;  4G6D A;  1R22 A;  4X0G A;  3JRI A;  1JI8 A;  4ENN A;  1BR1 A;  5JHF A;  2X6W A;  4LFU A;  2XRN A;  3S93 A;  1N25 A;  1BN5 A;  5BPD A;  3BR1 A;  2RC4 A;  4PDK A;  4Q47 A;  4UVC A;  2DLL A;  4OWR B;  2HEO A;  1DU0 A;  4L0Y B;  2Y31 A;  1TWF J;  3I59 B;  2IVM A;  4IO9 F;  4HV5 A;  5HS7 A;  3K70 D;  3L2W A;  1KYZ A;  2CH0 A;  2L9R A;  3I4N J;  1R4N B;  2M7A A;  4D7N A;  2X85 A;  1CF7 A;  1HKT A;  1LJ9 A;  1OCP A;  2DFE A;  3MZH A;  2M8G X;  2Y48 A;  1UFM A;  2H6C A;  2A05 A;  3K4C A;  3U21 A;  4ZYG A;  2E2J J;  1IRF A;  3DP7 A;  3AL0 C;  2OCE A;  4I09 A;  4FIS A;  4EJO A;  5L3G A;  4DZJ A;  3ASN H;  4S0H B;  1FX7 A;  3HM5 A;  3M1C A;  2NS0 A;  3MD2 A;  4IHY A;  1Z7U A;  3DLL F;  1Q1V A;  3HHG A;  3LAP A;  4RB1 A;  1FSH A;  3WU1 B;  1QBJ A;  1WPK A;  2PEX A;  4ZZL A;  4LG3 A;  4F93 B;  4IX7 A;  5K7H A;  2NVU B;  1TTY A;  4W97 A;  4BDY A;  1WJD A;  1DDN A;  2JQ7 A;  1YIJ I;  5E79 C;  4YIF A;  3E6B A;  2BY1 A;  3A4C A;  3CO6 C;  1W0T A;  1Z1D A;  4A3C J;  5TJJ A;  1FP1 D;  1LDJ A;  2HZT A;  2EB7 A;  4HQM A;  4BXF A;  1QO0 D;  2KKO A;  3I55 I;  4BDZ A;  3JRA A;  3WTV C;  1MBG A;  3GXO A;  3GLL A;  3A01 A;  3HTS B;  4GFB A;  1SMT A;  4BYY A;  1WQ2 A;  1Y1W J;  1EH6 A;  3BWG A;  4BY7 J;  1MBJ A;  4HDV A;  2M4K A;  1ZG3 A;  3DPU A;  3CJQ B;  2Q0O A;  5DS9 A;  3C2G A;  4A6E A;  2W00 A;  4EJW A;  1KU7 A;  2MD0 A;  3W6V A;  3OYA A;  1SFX A;  3H5A A;  1HW2 A;  2CYY A;  2V6C A;  1GHC A;  2UUZ A;  5D4R A;  5IT9 K;  2VXZ A;  1FNN A;  2V79 A;  2WAQ N;  3PUB A;  3BPX A;  3S17 J;  2UV1 A;  2L02 A;  3JSP A;  4XLN F;  1WI9 A;  4WCG A;  5AON A;  3OYN A;  2F6C A;  2OTL I;  4IVN A;  2QSF X;  3IHU A;  4IF4 A;  2CO5 A;  1T95 A;  3EDP A;  4B44 A;  4OIQ F;  3BCB A;  4UY8 I;  1O3T A;  1V54 H;  2QQ8 A;  4JX4 A;  4LLG F;  2R7R A;  2KZV A;  1HXD A;  1TWH J;  1LNW A;  3EYY A;  1K6Y A;  3ZP5 A;  4H4K C;  1R1V A;  3RKQ A;  3F8N A;  4BQA A;  5D5U B;  1UCR A;  2QEX I;  1IDY A;  1RKT A;  4E7J A;  5LBQ A;  2GOX B;  3SEQ A;  2OU2 A;  2LG4 A;  2W25 A;  2DA4 A;  2ZO4 A;  1D8K A;  3HSR A;  4PJN A;  4RGR A;  3WU2 C;  4UUV A;  5DCM B;  1TP4 A;  2DFF A;  2L9N A;  2DK8 A;  3F72 A;  4Q4Z F;  3BR3 A;  5D5W B;  1WFX A;  4RGX A;  2BGC A;  2PI0 A;  4I6Z A;  3M07 A;  1K4S A;  1U8R A;  1VQ5 I;  2O61 A;  3EPZ A;  1ETK A;  2PFB A;  3TOB A;  1WJA A;  4C3H J;  3BTL A;  2EH3 A;  4ZJZ A;  4RS8 A;  4CCK A;  4HX8 A;  3UR3 C;  5FRN A;  3LST A;  5LGU A;  1S5L C;  3H9Q A;  3DKW A;  5H6Q A;  3K1N A;  2JA8 J;  2XRO A;  3B6C A;  1V4R A;  4RLQ A;  5LD2 C;  1GVD A;  3HOT A;  1BR4 A;  2W4S A;  5ICE A;  1JJ6 C;  2A6E F;  2PN6 A;  4BUP A;  3HOV J;  1AA7 A;  3OS1 A;  3G1O A;  3IRQ A;  2FU4 A;  1XDU A;  3ERM A;  2XAH A;  1TWG J;  2Q2E B;  2LH9 A;  3MKZ A;  1R00 A;  2ME0 A;  3QWL A;  1U3E M;  3ISP A;  4DIQ A;  2JWT A;  4AYB A;  1V3F A;  3SEZ A;  5DM6 F;  4ENJ A;  5J4V A;  1YW8 A;  3BT9 A;  4ZYD A;  4LJZ F;  2V4J C;  1TNS A;  3M7G A;  5E20 A;  3M4O J;  4EMS A;  2LR8 A;  3HG9 A;  5K1Y A;  1VQK I;  3NQO A;  3E97 A;  4DQ2 A;  4O3M A;  1OYI A;  3CCS I;  2JRT A;  1J2X A;  4DBQ A;  1XPX A;  4CCO A;  2TCT A;  5DTD A;  4HDU A;  2GIZ A;  1U9N A;  4DJA A;  5KAF C;  4NHJ A;  2V1D A;  2A69 F;  3ERE D;  3ABL H;  4UVA A;  2WV1 A;  1KU3 A;  1MGT A;  3NWS A;  3HRS A;  3FF5 A;  1GXQ A;  1X1A A;  3TOA A;  2D5V A;  2FF4 A;  2IPQ X;  2QQB A;  2QVO A;  2QCO A;  2XAG A;  4B3X A;  1S72 I;  4IOC F;  2KIS A;  5ILS A;  1FLI A;  4LLL A;  4EAT A;  5HVQ C;  2G0E A;  2NNN A;  4LGW A;  2HQR A;  1UHW A;  1B72 A;  2G7U A;  4A0Z A;  2D2W A;  3SZP A;  5F1R A;  4MO7 A;  2UZK A;  5J1R A;  5EG0 B;  2WBM A;  5DD4 A;  1R5I D;  1Z21 A;  4QTR A;  1UHS A;  2W82 A;  4OIR F;  4M6Y A;  5FKL A;  5HDK A;  2TRT A;  1QVT A;  3CF2 A;  4B1R A;  4ABZ A;  1MJ9 A;  2KZG A;  2P81 A;  3K6G A;  5E1X A;  3FWE A;  3J80 K;  1YX5 A;  1IUF A;  3PM1 A;  3F23 A;  2OJE D;  3J7A O;  2CV2 A;  3WTZ A;  1S8N A;  3CME I;  4U88 A;  3PNY A;  5FKO A;  3E0J B;  3TQN A;  1MNE A;  2OC6 A;  4UVB A;  3VPR A;  1IXS B;  4GCV A;  1G3W A;  3MWM A;  3CCR I;  4A3G J;  1PUF A;  3O6B B;  4HYE A;  3H36 A;  3FXU A;  3BR5 A;  2F5V A;  1ENH A;  1GDT A;  2KLO A;  2DOE A;  4LK1 F;  2P7C B;  3SFI A;  2MYS A;  1W7P D;  4L18 B;  3BTC A;  4BJ5 C;  3QQA A;  3V7C A;  4RAG A;  4BXX J;  3HSF A;  2M4G A;  4NQW B;  3MQ0 A;  1FSE A;  3W2W A;  3DKX A;  4CIC A;  4QSH A;  2MGQ A;  1GLN A;  1JHF A;  1OLT A;  2IS6 A;  2ISY A;  3MN2 A;  4YIR X;  2B0L A;  2Z1D A;  4ESJ A;  3BJO A;  1IW7 F;  1XGO A;  5ICF A;  3K4B A;  1WJB A;  4IHX A;  1MDM A;  1GXP A;  3W6J B;  5E3L A;  2L7F P;  2VL8 A;  3LSJ A;  2Y0M A;  4F52 A;  3O8H A;  2HQ5 A;  2KP6 A;  1XGN A;  5K5R A;  3U1D A;  3I58 A;  4UHT A;  1DQU A;  1H9G A;  3ZMV A;  2IA1 A;  1AHD P;  3LOC A;  2WC2 A;  5J47 A;  1VQL I;  1APL C;  1BBY A;  2P0W A;  1SEU A;  1H9T A;  2XPU A;  4PJJ A;  1J5Y A;  3LSK A;  3OIO A;  2BXZ A;  1BI1 A;  1P6R A;  1FC3 A;  4I0B A;  3SZT A;  1ZR4 A;  4IQJ A;  3I4P A;  2E7W A;  1R1T A;  4BY1 J;  1MMN A;  4EQQ A;  1F1Z A;  3D5S C;  1I39 A;  3B02 A;  3GZ5 A;  5LHI A;  4CYC B;  5F0C A;  3K4J A;  3JTH A;  3IAM 2;  1MMA A;  2ZJQ F;  3ZOB A;  3S16 J;  2HKX A;  1YJN I;  3A1Y A;  1FBS A;  4RLF A;  5FKM A;  1FMV A;  1P2F A;  2DCE A;  2Z33 A;  2E5Z A;  4RAF A;  3PFY A;  1WJE A;  1LFP A;  1F5T A;  3HZJ A;  1UZC A;  4PUS A;  3OSF A;  2KL4 A;  1W7P B;  3S3O A;  3OL3 A;  3KLO A;  3OIQ A;  2DA1 A;  1OPC A;  4F7Z A;  1I3Q J;  1D0X A;  3PO3 J;  1NK2 P;  3CJT B;  3FMR A;  5HNH A;  3ZQL A;  3BR6 A;  4FQG A;  5EJC A;  1MKM A;  1I3A A;  1ZRC A;  1MMS A;  2HZD A;  3EET A;  2DT7 B;  3FHN A;  2ME6 A;  4QPQ A;  4BH9 A;  2PX9 A;  3E3V A;  2JSP A;  2B63 J;  5J1U A;  3GTL J;  1LFU P;  2ESN A;  5E8G A;  3FKJ A;  4ZYA A;  3ABK H;  1D8J A;  4AYB N;  1DGR M;  2YS9 A;  3VEP A;  2QBY A;  5C4J J;  5CLS A;  1NH3 A;  3TO6 A;  2LBF A;  1RR8 C;  3D1N I;  1U5T A;  2DTR A;  4KIT B;  4HRI A;  2VQG A;  4LB5 A;  5J1Y A;  1JE8 A;  5FD5 A;  2HFH A;  3Q9S A;  3ZGK A;  3R60 A;  2MH9 A;  2W84 A;  3S1R J;  3OR1 C;  2X0L A;  5KK1 A;  4E7Z A;  1JGS A;  3G2B A;  1XSV A;  4JBA A;  5JLW A;  2DQL A;  3ZQC A;  2O03 A;  1QPI A;  2BE5 F;  3RQI A;  4OU0 A;  5ED4 A;  3BR2 A;  2QGU A;  2HKO A;  3SQN A;  3CCQ I;  1JJ8 C;  1JKQ C;  4G7O F;  3HGY A;  1H0M A;  2VB6 A;  1ON1 A;  1MBK A;  4M3E A;  3WTY C;  2J5P A;  4G12 A;  1JT6 A;  5D6F A;  4HF2 A;  3UKG A;  5F0F A;  4UUS A;  4EEF G;  1WI3 A;  3OWT A;  3L9F A;  1XD7 A;  4YRV A;  4NUB A;  1FIA A;  3ROU A;  4ESF A;  2E1N A;  2W48 A;  1VF9 A;  2ELH A;  2W57 A;  3W6K B;  2H1L A;  3LAJ A;  2VOP A;  5CKT A;  4QLC U;  3GWZ A;  3K2Z A;  4EV0 A;  3TP0 A;  4BE1 A;  3E5Q A;  2CW0 F;  3HEF A;  2GXA A;  1JTY A;  1K78 B;  4I98 B;  3AG4 H;  4ANJ A;  1WZ2 A;  3WU0 A;  2JK3 A;  1ZGA A;  2RGV A;  3IRR A;  3E6D A;  2RN7 A;  2DFH A;  4A3I J;  2MC4 A;  3OV8 A;  1FOY A;  1IUY A;  2NAZ A;  3G4S I;  3RTR A;  4Y4R A;  3OYL A;  5IT9 Z;  1OCZ H;  4RM3 A;  1ITY A;  3CDH A;  2L2O A;  2MFZ A;  2B7E A;  2KJC A;  2R5Y A;  4FCY A;  3RPQ A;  3DF8 A;  3K4N A;  4KNY A;  1JHH A;  4A2U A;  3ZN0 A;  4EJT A;  2JA2 A;  4R1H A;  1ZK8 A;  5LLQ A;  4XKB A;  5JI6 A;  4LG0 B;  4V2G A;  4L5E A;  2VQL A;  4HNU A;  1IV8 A;  1POG A;  1I6H J;  2GAU A;  2L5Q A;  5CQE A;  2BHZ A;  2W24 A;  3ZXS A;  1P4X A;  2CRG A;  4N9I A;  2IRF G;  2VPL A;  2CUF A;  1MZB A;  1S7A A;  2JUC A;  4BE2 A;  1MH4 A;  1YX3 A;  1VQM I;  1FYK A;  1RUO A;  5EEA A;  3CD6 I;  3RPU D;  4F3Q A;  3OSG A;  3U9G A;  2LTP A;  4BHC A;  5FRM A;  3RKW A;  5CVU A;  1FT9 A;  4B43 A;  1VQ7 I;  1LVK A;  1ETW A;  5GAE J;  3GLX A;  1PUE E;  3DU5 A;  4KJZ A;  2EWN A;  4KDP A;  4BEH A;  1FPQ A;  4FX4 A;  1T38 A;  2NXN B;  4CSW A;  2R7S A;  2IP2 A;  2HYJ A;  2MW8 A;  4XOR A;  3VYS B;  3ELK A;  3L2C A;  3F22 A;  3S3N A;  3KP2 A;  5TIS C;  2G9W A;  3HC7 A;  3K2A A;  3OS2 A;  3HOZ J;  2HU9 A;  4E6K G;  3H3V K;  1YOV B;  4XLH A;  3BPV A;  2OA4 A;  2E2I J;  5CQG A;  2ZXW H;  2DA7 A;  3BRO A;  1OCC H;  4XNF A;  5AIQ A;  2VT2 A;  3OYD A;  1XDS A;  1X2N A;  4R8H A;  4FAS D;  2IAI A;  1HKS A;  1UAA A;  4RGS A;  1RNL A;  1M1E B;  2OZU A;  6PAX A;  3CDL A;  1ZHF A;  4I01 A;  2OF7 A;  1STZ A;  3TP3 A;  5LGT A;  3WTW C;  1U6G A;  2R7Z J;  4X1E A;  2L7K A;  3DTK A;  4LOC A;  1OCO H;  3FXO A;  5K7Z A;  5B3S H;  3C18 A;  1QNT A;  3ZQ7 A;  5K5Q A;  1XMX A;  3CMA I;  2DW4 A;  3V7R A;  2HXO A;  3OL4 A;  4AU7 A;  2GOM A;  4CCJ A;  3JRE A;  3H3U A;  2DDA A;  4G8X A;  4QPO A;  4ZTF A;  2HOS A;  1CGP A;  3JR9 A;  2V1N A;  4HG2 A;  5JVG F;  2GWR A;  3KX2 A;  1H8A C;  1KYW A;  3SFZ A;  2ID6 A;  2OQG A;  3ZMU A;  4JX5 A;  1TW2 A;  3I59 A;  3C2H A;  2QWW A;  3CP8 A;  5EZG A;  4AIH A;  2DMP A;  1I50 J;  1O3S A;  5L3E A;  2IS2 A;  3T5X A;  4M9X A;  3BG7 A;  1ODD A;  1NHA A;  2DK5 A;  1YS7 A;  3AKZ A;  1LE8 B;  2VQH A;  1IGN A;  2M8E A;  3M8J A;  5J4Y A;  2IBD A;  5FLX K;  3VB2 A;  2V9K A;  3K1M A;  3VFZ A;  2XGX A;  1FTT A;  4FE4 A;  1FJL A;  2XVC A;  3CQZ J;  2XKP A;  2IJL A;  3M9A A;  4U87 A;  2M3A A;  2HVR A;  4Y3O A;  3VDX A;  2Q1Z B;  3K0L A;  1R5G A;  3J80 Z;  1ZLK A;  2ISZ A;  3K9T A;  1X2M A;  1O3R A;  1IN6 A;  2V6E A;  2DMT A;  3RCO A;  4D9J A;  1ZGJ A;  2AXL A;  1XG1 A;  2VJJ A;  1K7A A;  4XM3 A;  3T8T A;  4F91 B;  1ZH5 A;  1H88 C;  4B8X A;  2E35 A;  3BZ6 A;  3S2W A;  1XN7 A;  2RQQ A;  4U0V A;  1NG7 A;  4Q5S F;  1XTA A;  2DA6 A;  2VON A;  1HF0 A;  5FRO A;  4B47 A;  3I4M J;  3CTA A;  2UXX A;  4G6T B;  4BQQ A;  2P8T A;  1EA3 A;  2DO7 A;  1S6L A;  2VT3 A;  3VSK A;  4BS9 A;  4CA0 A;  4HBL A;  5C4X J;  3HL2 A;  2KT0 A;  3EUK L;  2BHY A;  2X6Y A;  4Y52 J;  1ZR2 A;  1R7J A;  3L09 A;  2P7V B;  4ZDO A;  2CQK A;  1SVO A;  1QVU A;  2OBP A;  2CGP A;  2PMH A;  3BDD A;  3TW7 A;  1R4M B;  1O4X A;  1B8I B;  5KNL A;  2FQ3 A;  5LEJ A;  1R5H A;  4BHP A;  5ILV A;  2CFO A;  1WHU A;  2AQF A;  3CUQ B;  2R5Z B;  3K70 C;  2E1M B;  2KPM A;  3TED A;  2R93 J;  5CVI A;  3BZK A;  4PGG A;  4L9J A;  3HKZ N;  3K4K A;  3IKV A;  3TDU C;  3DLA A;  2E71 A;  1LFB A;  2JSC A;  4RGU A;  4BHB A;  2FA5 A;  3LQR A;  5B5E C;  3DFG A;  4IPA A;  1IN5 A;  1X19 A;  2F4I A;  4AIJ A;  1LEB A;  3Q0V A;  1U2W A;  2OTJ I;  3QOD A;  2KFD A;  1IV6 A;  5E3N A;  4RDU A;  2RVC A;  3D0S A;  3DKY A;  4LMY A;  4A3J J;  3GME A;  1ZEL A;  1EH8 A;  2PBI A;  4RAY A;  1W5S A;  2VI6 A;  1J0R A;  3FXK A;  5FFZ A;  3SJM A;  4MEX F;  3H1C A;  5JVT A;  1OCR H;  1I6X A;  2ZSH B;  3BCA A;  1PDN C;  2LRE A;  3VYR B;  5DCF A;  2Y75 A;  3WTU C;  1USS A;  2WAD A;  1JUP A;  2DQR A;  2XAQ A;  1IXC A;  1QGP A;  5DCM A;  1T8I A;  3PIP F;  2D1V A;  2WAF A;  5E1W A;  1SD7 A;  1HST A;  1WKM A;  1SFO J;  3BY6 A;  3PNT A;  2JPC A;  2XHK A;  3ASO H;  4CXF A;  2BOL A;  2TDX A;  2QUF A;  3B73 A;  4L9V A;  3W3C A;  1T39 A;  1J9I A;  3KFW X;  4WXD A;  4PZJ A;  3HUG B;  4E7H A;  2QSH X;  1E17 A;  3S3M A;  2LFB A;  1S3J A;  3VOE A;  2HS5 A;  4UB8 C;  3SXY A;  2PJR A;  3C1D A;  3VYU B;  5IYB J;  4E7K A;  3OOU A;  2OPT A;  4C2U A;  2VE9 A;  1YLF A;  2LNB A;  1U78 A;  4L9T A;  5ERI A;  4C3I J;  1OMI A;  5FFX A;  3WG9 A;  1IAW A;  1HQC A;  3NEU A;  3GTO J;  2R7X A;  4NC6 A;  4JP0 A;  3V7S A;  1ZRD A;  1Z3X A;  2DFI A;  5IY5 H;  1HCR A;  2RQP A;  2LMD A;  3OYB A;  4IRH A;  2D45 A;  2YSR A;  3ZMZ A;  3VWB A;  4M9S A;  2GZW A;  3TW6 A;  3K1P A;  2DXI A;  3KZI C;  3GTG J;  3PL8 A;  4WF2 A;  3E7L A;  3ESW B;  2E5N A;  1H89 C;  3NWT A;  1U0J A;  3TGN A;  9ANT A;  1E3O C;  1VFC A;  2LKX A;  3IWF A;  1HOM A;  2XGE A;  2Y0S A;  5HOO A;  1RR7 A;  1S29 A;  3MZ8 A;  3JRD A;  1YHQ I;  3V8K A;  4ZH4 F;  3PSI A;  5LFA A;  4HQE A;  1QQI A;  1AWC A;  2A3S A;  2CUJ A;  1Z7L A;  3IKT A;  1GV5 A;  3LA7 A;  5H20 A;  4Z6Y A;  1VTN C;  2LRD A;  2NS8 A;  1GVJ A;  2VLA A;  2WWY A;  2Z3Y A;  2K3F A;  1REP C;  1A6I A;  4S04 A;  2PMZ N;  3F6V A;  4BL0 B;  5BMZ A;  2EIN H;  4IHS A;  5JHU A;  2PG4 A;  4FHT A;  2CMP A;  4L9N A;  2HWV A;  3F8F A;  4B3A A;  3NAU A;  5B1B H;  2KMU A;  4IKF A;  4XOP A;  1ULY A;  3P9I A;  5HDG A;  1G4D A;  2EA2 A;  2XF6 A;  3TDZ C;  1Y0U A;  5J8C A;  3S14 J;  5H6R A;  1L3L A;  5J40 A;  2A5W A;  2PQ8 A;  2FQ4 A;  4IEJ A;  4AWX B;  1S7O A;  3F6O A;  1PVE A;  3REO A;  4A5M A;  4EM2 A;  3ZRG A;  4G7H F;  3Q0U A;  1HSJ A;  2VUM J;  3TL4 X;  1FOX A;  4FX0 A;  2HOE A;  3CP2 A;  3GW2 A;  2O5R A;  4A3E J;  4XLP F;  2HOA A;  4ZDP A;  3KP7 A;  4U7B A;  1VQ9 I;  3I56 I;  4Y7N J;  2KIQ A;  2M9H A;  1R71 A;  4NQW A;  5LHH A;  3CMM A;  3O3K A;  1WH7 A;  4IQ4 A;  3WTX C;  2F4O B;  2K40 A;  1A04 A;  5HDN A;  2O8X A;  4XL9 A;  4MEY F;  3SDB A;  3KYL A;  5K7F A;  4C3J J;  2ZXH A;  2DOF A;  3FIS A;  4WK8 F;  2R7W A;  2GLO A;  1MW7 A;  1VZ0 A;  2LF7 A;  4MNU A;  1XB4 A;  3TBI A;  4E7L A;  5EGO B;  2MA3 A;  1K6O A;  2K9Q A;  1XCB A;  3PUF A;  2BZT A;  3TO9 A;  2R7T A;  2HDC A;  2ESH A;  3KZY A;  3ZCO A;  1OYY A;  1O57 A;  3SHF A;  4NC7 A;  1ETV A;  3H9J A;  2M1B A;  4XRM A;  2DA5 A;  1Y39 A;  4I7H A;  1YFH A;  2DPD A;  3BJ6 A;  2GA2 A;  2WB1 A;  1Y6I A;  1A31 A;  4CYC A;  3KLN A;  1S7E A;  4PJL A;  3HIF A;  2KDO A;  4AID A;  4EGZ A;  4GO1 A;  4RAZ A;  5AIP A;  1MBF A;  4ZYH A;  1OCT C;  4L0Z B;  3ABU A;  2DN0 A;  4XBF A;  2LDU A;  1XGM A;  1IRG A;  3R0J A;  1W0U A;  2R0Q C;  3S2H J;  1G3T A;  2E19 A;  5D4S A;  4BAC A;  2X6O A;  4E70 A;  1G59 A;  1OR7 A;  4EM0 B;  1OR7 C;  2Z9O A;  4N4N B;  5CYV A;  2YUS A;  4YFK F;  2AS5 F;  2QM3 A;  2RAE A;  2E36 A;  4G7Z F;  2BY0 A;  4M72 A;  4YFN F;  1MJA A;  2K9S A;  1P4A A;  1X4P A;  3KEY A;  1IRZ A;  1G3Y A;  3OYJ A;  2XF5 A;  1G3S A;  1R49 A;  2B9S A;  2KRC A;  2LVS A;  3RZD J;  3BTJ A;  5HLG A;  2Y69 H;  2GIV A;  5FGM A;  4BJ6 C;  2ZJR F;  3CES A;  3C7J A;  2EPF A;  4MQ9 F;  2JPB A;  3CC2 I;  5FLX Z;  2V26 A;  1YI2 I;  2DMN A;  2FD5 A;  1O7L A;  1UST A;  4MLO A;  3HB9 A;  3FBI B;  2NVX J;  3HDD A;  1MNM C;  2COB A;  3I5U A;  3HYI A;  2XDV A;  1R58 A;  3P9C A;  1BJA A;  2EFQ A;  3CLQ A;  4HST A;  3ZPL A;  2F4M B;  1T0F A;  1SVM A;  1T0F C;  4XN3 A;  5A2Q Z;  4IOA F;  1YO5 C;  2PLY A;  3BLY A;  1PUF B;  1JKO C;  3E6C C;  5KAI C;  2NRA C;  3H0G J;  4E4H A;  2IA2 A;  2V1X A;  5JFR A;  2E1C A;  4M6V A;  4DGW B;  4M71 A;  3F21 A;  4A3L J;  3WE2 A;  1AU7 A;  3BG9 A;  4BQN A;  2EIL H;  5IP6 A;  3I54 A;  1QZE A;  3L7W A;  2ELK A;  2K3P A;  1IF1 A;  2R7V A;  1LUJ B;  4JOM A;  4BU2 A;  5LHG A;  2MLG A;  4DW6 A;  3DPL C;  4NC8 A;  2JT1 A;  5K5O A;  1P7I A;  2XPV A;  2CSO A;  1P9Q C;  2JN6 A;  2JVH A;  1W1W E;  3FM5 A;  1E0E A;  1WWX A;  2WY8 Q;  5F0H A;  4WXC A;  2R7Q A;  2HTJ A;  4NBQ A;  3RSN A;  2K5C A;  2XV4 S;  4FTH A;  2M87 A;  1Z3Y A;  1HW1 A;  2QSG X;  4XKC A;  1TT5 B;  3RYR A;  4CH7 A;  5HS9 A;  2Z2S B;  1XSD A;  2CV1 A;  2IW5 A;  3LFK A;  3KEO A;  2CJJ A;  1IN4 A;  1T98 A;  2QF7 A;  1ZLJ A;  3OYM A;  1N78 A;  1KQ9 A;  4HNV A;  2K4J A;  3P7N A;  1LKX A;  4IRG A;  3DQV C;  1UMQ A;  5D8K B;  3ZR8 X;  1BIA A;  3ML6 A;  4WWC A;  1D1B A;  3A03 A;  1UG2 A;  3G1M A;  1LQ1 A;  3NRV A;  1SAN A;  4LG0 A;  3B6A A;  4G6Q A;  4CZZ A;  2CFX A;  3HOW J;  3FMQ A;  1XMK A;  3OR2 C;  2VJ4 A;  1K83 J;  1P7J A;  1XGS A;  4DZP A;  2R7D A;  2VBX A;  4ZTJ A;  3I0T A;  5LEK A;  2FBH A;  4BJT A;  3S32 A;  3ZQF A;  3FIW A;  5GPA A;  3S15 J;  2X1C A;  2AHQ A;  3I64 A;  3I3L A;  3BG6 A;  2EZH A;  4XN0 A;  3GX4 X;  2LK2 A;  5TRD A;  1SD6 A;  1YTY A;  4LK0 F;  4CGZ A;  2OZ6 A;  1KQ0 A;  3AG2 H;  2EFW A;  4JK1 X;  1ETY A;  1IJW C;  4A69 C;  4PGH A;  4AM3 A;  1UB9 A;  4IJA A;  1OIS A;  4HLY A;  3FXL A;  2XC7 A;  4OAY A;  2MH2 A;  3ECH A;  3L2Q A;  3FXR A; 
#chains in the Genus database with same CATH homology
 3C2B A;  3RKQ A;  1IDY A;  1RKT A;  1X2M A;  5FLM J;  2DA4 A;  2DMT A;  3S1Q J;  1B72 B;  1Y1V J;  5M5W J;  1XG1 A;  2KDZ A;  4M3G A;  2DJN A;  3BR3 A;  1JT0 A;  1AKH B;  2DA3 A;  3IV5 A;  4I6Z A;  2LP0 A;  4X6A J;  1H88 C;  1ETK A;  4C3H J;  3BTL A;  1GV2 A;  2EH3 A;  2DA6 A;  1G2H A;  1HF0 A;  1JUS A;  3I4M J;  2JA8 J;  5GPC A;  3MKL A;  2Y9Z A;  3B6C A;  2JMW A;  5C4X J;  1GVD A;  4A3F J;  1OFC X;  2KT0 A;  2JJ7 A;  1JJ6 C;  4Y52 J;  1ZR2 A;  4QIW N;  1QVU A;  2MG4 A;  4MFD A;  3HOV J;  3G1O A;  1T56 A;  1O4X A;  3TW7 A;  3MVP A;  5M5Y J;  1B8I B;  2HDD A;  5F04 A;  1TWG J;  1TWA J;  2ME0 A;  3HOX J;  2Y0S N;  1A5J A;  2R5Z B;  1JKP C;  3BR0 A;  2JWT A;  4V2F A;  2R93 J;  3TED A;  1MSE C;  1ETQ A;  2IEK A;  4A93 J;  1TC3 C;  3BT9 A;  4UUS B;  3HKZ N;  3M4O J;  3S1N J;  2DA2 A;  1LFB A;  2LR8 A;  1EF4 A;  2NVY J;  1LE8 A;  4XRS G;  1JKR C;  2ECC A;  3Q0V A;  1HDP A;  5M3F J;  2TCT A;  5IYD J;  5DTD A;  1IV6 A;  1U9N A;  5E3N A;  4RDU A;  5F1J A;  4A3J J;  2WV1 A;  2D5V A;  2VI6 A;  3SJM A;  5IP9 J;  2QCO A;  1JTX A;  4A3K J;  1F43 A;  2G0E A;  3PO2 J;  1RKW A;  1JUP A;  3O8G A;  5FJ8 J;  1B72 A;  1IDZ A;  4MO7 A;  3SDG A;  5J1R A;  5EG0 B;  1AKH A;  2R92 J;  3A02 A;  1WH5 A;  2L0K A;  3FKI J;  4QTR A;  1SFO J;  1UHS A;  5FKL A;  2TRT A;  5IPA A;  1QVT A;  2LD5 A;  4DYQ A;  4B1R A;  4ABZ A;  2P81 A;  1QRY A;  1WGX A;  1IUF A;  3PM1 A;  2LFB A;  2EBI A;  1ETO A;  5IYB J;  1IG7 A;  4M3F A;  2XB0 X;  3OOU A;  2OPT A;  1ZTR A;  5IYC J;  2XGC A;  1BA5 A;  1BW6 A;  5FKO A;  3VPR A;  3IH4 A;  1U78 A;  3HBL A;  1RES A;  4C3I J;  4A3G J;  2EZK A;  1PUF A;  1F36 A;  1YRN B;  5IP7 J;  4BBR J;  1B8I A;  3GTO J;  1OJL A;  5M5X J;  3BR5 A;  3Q3S A;  1ENH A;  1ETX A;  3NAR A;  4JP0 A;  1GDT A;  3LSP A;  2NVQ J;  2N8G A;  2FX0 A;  2XGD A;  2R5Z A;  3BTI A;  3SFI A;  1FEX A;  1HCR A;  4IHW A;  3BTC A;  3QQA A;  1MBH A;  5BNG A;  4BXX J;  5M3M J;  2O7O A;  2O8K A;  3S1M J;  1JGG A;  3BG5 A;  3TW6 A;  4D5F A;  1BW5 A;  1NTC A;  4XRS A;  3GTG J;  4MIM A;  3QPS A;  3F0C A;  4QSH A;  2MGQ A;  3E7L A;  5IOY A;  3RZO J;  2MSY A;  1GUU A;  3LSG A;  1H89 C;  2GBY A;  2XRL A;  3MN2 A;  5F27 A;  4IHX A;  9ANT A;  1E3O C;  1VFC A;  3DCF A;  2XB5 A;  5E3L A;  2LKX A;  3G1L A;  1HOM A;  2WB1 N;  2L7F P;  2XGE A;  1RR7 A;  3LSJ A;  3JRD A;  3O8H A;  2HQ5 A;  3FK6 A;  3CCY A;  1AHD P;  1X58 A;  1GV5 A;  3LOC A;  2NVT J;  2ID3 A;  5E3O A;  1APL C;  2NS8 A;  4BKX A;  3ZQH A;  2XPU A;  2CQQ A;  3OIO A;  4NDL A;  1WCM J;  1A6I A;  2EQR A;  2PMZ N;  3DEW A;  2X48 A;  1ZR4 A;  4BY1 J;  3S2D J;  2JA6 J;  2Y9Y A;  4W1U A;  4B3A A;  3NAU A;  3K7A J;  3JRF A;  1DU6 A;  4CYC B;  5F0C A;  3ZQI A;  3Q0W A;  1MBE A;  3S14 J;  2L7M P;  5F08 A;  3ZOB A;  3S16 J;  5FKM A;  2HXI A;  2XSD C;  4IEJ A;  3FK7 A;  2FQ4 A;  5FLV A;  2YU9 J;  1Z0X A;  2DMQ A;  2NS7 A;  1VI0 A;  4MFE A;  5FKN A;  5C3E J;  3Q0U A;  3GBG A;  2VUM J;  1YRN A;  3JRH A;  3OSF A;  3GTP J;  2GM4 A;  2DA1 A;  4A3B J;  4A3E J;  5EYR A;  2VKE A;  2HOA A;  1I3Q J;  3PO3 J;  1D5Y A;  1NK2 P;  3ZQL A;  3BR6 A;  2H8R A;  4Y7N J;  2XPW A;  2M9H A;  4BBS J;  2FJ1 A;  2ME6 A;  1WH7 A;  1ZQ3 P;  2R5Y B;  2B63 J;  5J1U A;  1NK3 P;  3GTL J;  1LFU P;  1ZGW A;  2K40 A;  3QPL A;  4IHV A;  3HGG A;  3WHC A;  4DYR A;  5K7F A;  4C3J J;  1Z77 A;  2EZI A;  4AYB N;  3FIS A;  1JUM A;  2YS9 A;  1XS9 A;  5C4J J;  1HDD C;  1BL0 A;  2GLO A;  1HLV A;  2JA5 J;  1GT0 C;  4D7M A;  1BJZ A;  3D1N I;  5FKK A;  2CUE A;  5EGO B;  1VND A;  3LSR A;  1T33 A;  2K9Q A;  2LY9 A;  5JLX A;  5J1Y A;  2E2H J;  2DTZ A;  1ORK A;  3S1R J;  2VPR A;  2NOG A;  3GTM J;  3BQZ A;  1ETV A;  5JLW A;  2ECB A;  3HOY J;  4XRM A;  2AO9 A;  2DA5 A;  3L1P A;  3ZQC A;  1QPI A;  3RQI A;  3BR2 A;  3IH2 A;  3GTJ J;  2X9D A;  1JJ8 C;  1JKQ C;  3HGY A;  3ZQG A;  4CYC A;  1MBK A;  1S7E A;  4M3E A;  3BG3 A;  4G12 A;  1JT6 A;  3UKG A;  5IOZ A;  1MBF A;  1OCT C;  5F0F A;  2HOT A;  4UUS A;  4EEF G;  2DN0 A;  1WI3 A;  5HOD A;  4A3M J;  2VKV A;  2K9N A;  1FIA A;  1W0U A;  4J19 A;  2W48 A;  2R0Q C;  1VF9 A;  5E3M A;  3S2H J;  2E19 A;  1U9O A;  1IC8 A;  2X6O A;  2ZB9 A;  2O9L A;  4B4C A;  5EF6 A;  3TP0 A;  4JX6 A;  4XID A;  3GTK J;  2YUS A;  3HEF A;  1JTY A;  2RAE A;  5C44 J;  3HOU J;  2JK3 A;  4D5C A;  5EDN A;  2K9S A;  1CQT A;  1IRZ A;  4M3B A;  4A3I J;  1RET A;  3IH3 A;  4AUX A;  3JRC A;  1K61 A;  4XK4 A;  2LVS A;  3RZD J;  3BTJ A;  1ITY A;  4I76 A;  4FE7 A;  1MSF C;  5EZH A;  3A01 B;  2R5Y A;  4FCY A;  1XC5 A;  2M34 A;  1FTZ A;  5EG0 A;  3JRI A;  1ZK8 A;  4V2G A;  4L5E A;  2DMN A;  3BR1 A;  1I6H J;  1POG A;  3GTQ J;  2FD5 A;  2DMU A;  5J3L A;  4MLO A;  3HB9 A;  4A3D J;  4AC0 A;  1DU0 A;  2Y31 A;  1RPW A;  2NVX J;  3HDD A;  1TWF J;  1MNM C;  2COB A;  2CRG A;  5EGO A;  2CUF A;  2L9R A;  2Y2Z A;  4DYC A;  3JRG A;  1MH4 A;  3I4N J;  4D7N A;  5EEA A;  3WHB A;  1OCP A;  3OSG A;  2LTP A;  2M8G X;  1JKO C;  1PUF B;  2LLK A;  3BQY A;  3H0G J;  2E2J J;  2L7Z A;  4FIS A;  1ETW A;  4M6V A;  4A3L J;  2M0C A;  1AU7 A;  4DZJ A;  5GP9 A;  3BG9 A;  4S0H B;  5IP6 A;  3HM5 A;  2ELK A;  4IHY A;  2HYJ A;  2MW8 A;  3K2A A;  3M3Y J;  1Q1V A;  4DW6 A;  3HOZ J;  1P7I A;  1WPK A;  2XPV A;  3H3V K;  2JN6 A;  4C2M J;  2Y30 A;  2E2I J;  5F0H A;  5K7H A;  2DA7 A;  1U8B A;  3JRB A;  4FTH A;  1X2N A;  1R9T J;  4W97 A;  2IAI A;  1FIP A;  3CDL A;  2E1O A;  2OF7 A;  3TP3 A;  2EZL A;  2R7Z J;  4UUT A;  2M2E A;  4X1E A;  1W0T A;  2CJJ A;  4A3C J;  2QF7 A;  4LOC A;  4HNV A;  1MH3 A;  5K7Z A;  4XIC A;  1UMQ A;  3JRA A;  1MBG A;  4JYK A;  3A01 A;  1TWC J;  2HXO A;  4GFB A;  3A03 A;  3JRE A;  2CQX A;  1Y1W J;  4BY7 J;  1UG2 A;  1ZKG A;  3G1M A;  2HOS A;  1SAN A;  1MBJ A;  3JR9 A;  3B6A A;  5DS9 A;  3HOW J;  4M3D A;  1H8A C;  1K83 J;  2I10 A;  1P7J A;  2CU7 A;  2ID6 A;  4DZP A;  3CMY A;  3W6V A;  4JX5 A;  2JA7 J;  3ZQF A;  3FIW A;  5EZG A;  5GPA A;  3S15 J;  2AHQ A;  2DMP A;  2H1K A;  2WAQ N;  1I50 J;  3S17 J;  2EZH A;  1LE8 B;  1IGN A;  2LK2 A;  2HI3 A;  2IBD A;  1ETY A;  4RBO A;  1IJW C;  4A69 C;  1FTT A;  4FE4 A;  1FJL A;  4JX4 A;  3CQZ J;  3LNQ A;  1TWH J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...