1HC8A

Crystal structure of a conserved ribosomal protein-rna complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
74
structure length
74
Chain Sequence
TFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAMRMIEGTARSMGIVVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords RIBOSOMAL PROTEIN L11
publication title A Compact RNA Tertiary Structure Contains a Buried Backbone-K+ Complex
pubmed doi rcsb
source organism Bacillus stearothermophilus
total genus 18
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 1hc8A00
1VQMI 5GAGJ 5GAEJ 3G71I 2ZJRF 3I55I 1VQ7I 4IOCF 1YJ9I 4IOAF 2E35A 3I56I 1FOWA 1VQKI 1ACIA 1YIJI 3CMAI 1S72I 1FOXA 1FOYA 3CC4I 3CF5F 2OTLI 3CC7I 3CJTB 1YITI 4UY8I 3CCEI 3CCVI 5DM7F 1YHQI 1YI2I 5GAHJ 3CCRI 2ZJPF 4IO9F 1VQ9I 3CD6I 1MMSA 1VQ8I 5JVGF 2NXNB 2QEXI 1Y39A 2ZJQF 2E36A 5GADJ 1VQ4I 3CCLI 1VQOI 2JQ7A 2QA4I 3J7YJ 1YJWI 1YJNI 3G4SI 3PIOF 2OTJI 1VQ5I 1VQLI 3CC2I 1QA6A 3PIPF 5DM6F 3DLLF 1HC8A 3CMEI 3CCMI 2H8WA 1VQNI 4V19K 1VQ6I 3CCJI 3CCQI 3J7ZI 2K3FA 2FOWA 2E34A 3CCSI 1VQPI 3CCUI 3G6EI
chains in the Genus database with same CATH superfamily
4BJ6C 3DBLB 4I0BA 4A3IJ 4EGZA 1J09A 2QLZA 1T33A 4AVPA 4RB0A 1JUSA 2O0YA 3WU0A 1K79A 2ME0A 3ABKH 3A03A 1TW2A 2YX4A 3AG2H 4YG2F 3Q9VA 3MMYB 2ESHA 1R1UA 5KNLA 4HG2A 4UUVA 1ITYA 1Y56A 2Y48A 2DT6A 3SFZA 2WAQA 2L9SA 1Z9CA 2ZXJA 3ZMSA 1YO5C 1JJ8C 3BQYA 2V1XA 2KJBA 4IJAA 1RRJA 2Y0SN 4U0VA 3V7RA 2ZNZA 1STZA 3HRUA 1ZAOA 2XB5A 4XNFA 1U9OA 3S2WA 2M3AA 5BNGA 3V4GA 3AFHA 2Q8KA 1DUXC 4GFBA 4FE4A 4D5CA 1XMXA 1R9TJ 2QUFA 5FFZA 2MSYA 4F3QA 2DQLA 5AIPA 3GBGA 3KZIC 1V5EA 1MSEC 2H1LA 3L2QA 5HS9A 2FX0A 2PFBA 3K7AJ 4Y7NJ 3JTGA 1W0TA 4QTRA 1FC3A 2FOKA 2VJ4A 2M2EA 1OCTC 2X1EA 2FRHA 2PN6A 4RB2C 1CGPA 5A2QZ 4BHBA 2WAQN 3SDBA 1ODDA 4PGHA 4I2OA 3QPHA 2IS2A 4DBRA 1E2XA 4HOBA 1YE9A 5L3DA 4M9XA 4IX7A 2EZIA 4C3HJ 1MH3A 4LITA 4ETSA 3Q5FA 2XHKA 2W25A 2B63J 3CZ6A 2FQ3A 3DBRB 4EJWA 1BW6A 2Z33A 5B66C 4MNUA 4GDFA 5EEGA 1T0FA 3KZYA 3ZP5A 2V6EA 3P7NA 3LSRA 4D9JA 1E3PA 5LHGA 3DXJF 2GOXB 3QYBA 1O7FA 2M45A 2B0LA 1G8XA 2BBYA 4M3BA 4Q4ZF 4A3KJ 2BY2A 1RETA 2V26A 2XF6A 3KEQA 5CPRB 1T6SA 2ZMEB 3GX4X 3I59A 2OZ6A 2Q2EA 4BY7J 3SQNA 1UB9A 1ZARA 3RKWA 1BA5A 5IOZA 4L5IA 3P9KA 5EF6A 2GLOA 4XLNF 4C30A 3WGHA 3OIPA 5EG0B 1I1GA 3EDPA 1D8KA 1SFUA 2GQQA 2P5KA 4ZYGA 1IN4A 4CA0A 4W1UA 1D5VA 5J8CA 3I0TA 2LLKA 2KISA 1JTYA 3HBLA 4ABZA 2BXZA 1NHAA 3FXQA 3GF2A 3SEZA 1V55H 4LLGF 2ZKZA 1MMGA 2P7CB 2G9WA 1OJLA 1O57A 5LHHA 2HOSA 4A3MJ 2XAQA 4HNUA 2GXGA 2E5NA 5J1UA 1H0MA 2DMQA 1YQAA 1RPWA 1MNDA 2VXZA 4XN0A 2NNNA 1W5SA 4XR6A 4NC7A 1EJ9A 3H1CA 2NRAC 1Z0XA 1MBGA 2HQ5A 2BW3A 3KP3A 1V54H 2QQBA 1J7KA 3ECHA 3RPQA 5D8LB 4DQ2A 1RUOA 3CCRI 3N4MA 3A0BC 5E3MA 4IRIA 1VQ8I 1KU2A 2HKOA 2CUFA 2DO7A 1MD0A 2D45A 4N9IA 5C4XJ 2LR8A 3CP8A 5LRSA 1K83J 1WI9A 3PM1A 2QENA 2QKLB 4S04A 3WGIA 4ZYDA 2DJNA 1CF7A 4HQMA 1IDZA 2LRDA 3QYFA 1YS7A 1BW5A 1TT5B 2A69F 3F3XA 5CVJA 3JREA 3MFKA 3C2BA 1I50J 3SEQA 4ZYAA 1K4SA 1YX3A 5L3GA 3VSKA 1RR7A 3M7GA 3DP7A 4W97A 2PJRB 4ASNA 1BM9A 4DOZA 2XASA 4S0HB 2PMUA 3KETA 3PIOF 2W57A 2MD5A 1WJAA 1IRXA 1HW2A 2EWNA 3RDIA 5CVRA 4BBRJ 3RTRA 3E6CC 5J1RA 4HX8A 2XUBA 1WVRA 1TTYA 2IS4A 2NAZA 4ZTJA 5M5XJ 4D7NA 1TW3A 3IKTA 5E1XA 4JYKA 2A6EF 1HC8A 2LKXA 5FJ8J 3LMMA 1IN8A 4B4CA 4BE2A 2PEXA 1BR4A 4I98B 1V3FA 2RQPA 1MJAA 4KDPA 1XB4A 2RDPA 2QQ9A 1OFCX 2VASA 5LBQA 1TQIA 2XSDC 3CCSI 2HPIA 4OIPF 4AIDA 1FT9A 1G3YA 1KYZA 4YFKF 1AU7A 2VBXA 1U6GA 1F9NA 3RSNA 3KP6A 3FM3A 1Z77A 1U8BA 2QBYB 2QCOA 5LEKA 4DIQA 3ROUA 3GFIA 2L2OA 1JGSA 5EEHA 1FOWA 4ZZLA 3HPHA 5KHDA 2R5ZA 2CW8A 3R0AA 2O03A 2MLKA 1LFUP 1YW9A 1REPC 1NTCA 3TO9A 3WU1B 1QNTA 4BE0A 2R7TA 2E1NA 1HCRA 1QHGA 2K9QA 2VT3A 1R22A 3L2VA 4AIHA 5B3SH 3GO5A 4WXDA 2XC7A 2A5YB 2R7DA 4WWCA 3MN2A 1K6YA 2MH9A 1AHDP 4HRIA 1SD6A 2M4KA 4HLXA 3L1PA 4BEHB 3OYEA 2JMWA 2X48A 3BZ6A 1BOBA 3WTTC 4XSXF 5M3FJ 3HB9A 5EYRA 1PUEE 2M0MA 4P9FA 3DKXA 3H5RA 3JRIA 1HKTA 3HC7A 4A2UA 2A05A 1LKXA 5K5RA 4RB3C 3OS1A 4IO9F 4G7OF 1P6RA 3HOUJ 3FXLA 3KYLA 1P92A 2K9NA 2YR2A 1R4NB 4BUPA 2P8TA 4RAYA 1SD5A 1ORKA 1UG0A 2FUG2 1HW1A 1UHMA 2KFDA 4KN7X 4DYRA 3T1BA 4ESFA 3E7LA 1MBKA 2RREA 2MA3A 5J6XA 1KYWA 5ICCA 1S9HA 4RGXA 4L0YB 2QKMB 4YEJA 2KKOA 5F64A 1YJWI 3PUFA 4P55A 2ICWG 3GWZA 3J81K 4CCJA 2HPMA 3HOWJ 3WHCA 2DA5A 2WV1A 3BJOA 1OR7C 4A6DA 1OLTA 1Y8QB 4RGSA 3GW2A 3W6VA 3I54A 2DA6A 1QRYA 1UFMA 3ECOA 4ZDOA 2W4SA 2NVUB 4ENKA 5ILSA 3OYCA 2TRTA 3HOSA 5F27A 1YG2A 2XIGA 2COBA 3IH3A 3KLOA 3VYSB 2AQFA 2KRFA 1VQNI 4KICA 4RGRA 2QM3A 1JUPA 4LB6B 2QYOA 2QF7A 3R0JA 2CMPA 3TKYA 1K61A 2ACJA 4ZZDA 1FP1D 2L4MA 5HDNA 3J7ZI 4R79A 2R5YA 1LB2A 3S32A 4S05A 5BQTA 3U1DA 1SFEA 4G8XA 3OYDA 4L5EA 1K78B 1XPXA 1FMVA 2TDXA 2K9MA 2DOAA 2ECCA 4EJOA 2V79A 3F9KA 4AU7A 3NQOA 3H36A 3OYJA 1KU9A 3VFZA 2K5CA 1B8IA 2DFEA 4RAZA 3F23A 2ZFUA 3HL2A 4UV9A 2ZB9A 3JW4A 4U0WA 1R00A 3PQJA 1TQPA 1SFXA 1WFXA 3WHBA 5F08A 3W2VA 3HUGB 3S14J 2DQRA 5E8IA 2DA4A 3QP6A 2K3PA 4A6EA 1ON2A 3EUHC 2CJJA 2WV0A 4M9SA 1WJ5A 5M5YJ 3BLYA 1UELB 3L00A 2L3DA 2DFHA 1KQ8A 1K4TA 1IRFA 4GRIA 1YI2I 2C6YA 3VOEA 1O3RA 2IEKA 3A01B 1XC5A 1MNEA 2IBDA 1I5ZA 3GCMA 2HDWA 5TJJA 3QRFF 1GUUA 5JHUA 3GLXA 2EZLA 3BG3A 3RKQA 2P7VB 2VE8A 4BY1J 3HYIA 1ZRFA 2H8RA 1Z05A 3D1NI 3I53A 2RAEA 2MFZA 5BOXA 3OYIA 4UXNA 3HOTA 3PNTA 2QVOA 3L2UA 2W7NA 3KPHA 1X1BA 5GPCA 3CCLI 1FEXA 4XICA 2EFWA 3BC8A 5DUKA 2QA4I 2LG4A 3PFYA 2AXLA 4PJMA 3OSGA 4A3GJ 3JSOA 2R7WA 3K69A 2OV7A 3M8EA 3K0LA 3FZVA 1MDMB 2K9LA 4F52A 3FX3A 1FNNA 2ZXWH 1ON1A 2YSRA 2V1NA 4B3XA 1MW7A 1OYIA 4HDUA 3PIPF 4UUSB 2K4BA 2Y2ZA 5E17F 2O8XA 1GV2A 1X4OA 4RS8A 4B47A 2DA7A 3DLLF 1YRNB 4M73A 3E5QA 3HPGA 2VBYA 4EVIA 3QU6A 1W1WE 5LGUA 4LIVA 3QODA 5DD8A 1ZH5A 1A6QA 3EQLF 4XLFA 1I6XA 2F4MB 4V19K 3K4CA 4OMYA 2CYYA 1XGSA 4BDYA 4Y17A 3RPUA 4UVCA 5D6EA 2VBWA 2MBFA 2E1MB 3HSRA 2LOOA 5K5QA 1FZPB 5GAEJ 4JX4A 3DU5A 4FQGA 4KITB 3R6SA 3DLAA 3K4KA 4MTEA 5L3BA 5E3NA 1TWFJ 1IDYA 4KFCA 3P9IA 2WWYA 4D1QA 2VB6A 1H88C 2HKXA 3KP7A 4RDUA 6PAXA 4OIRF 1ETQA 2CFOA 5FKLA 2BVMA 3PUBA 5D5WB 3JTHA 4L9JA 3O2PE 1MBEA 2MABA 1TC3C 2BY3A 4YIRX 2IGNA 4CGZA 1WI3A 2EIKH 3IP4B 3PFIA 5H2FC 1EH6A 1NG6A 4XIDA 4BXXJ 3NAUA 1YITI 5CJ9A 4U7DA 3ZPLA 4NB5A 3FWEA 5HODA 3GTOJ 2R7XA 1OR7A 4G7ZF 2GAUA 3TO7A 1D0XA 3H3ZA 4E7JA 3E0JB 1ULYA 4CCKA 2R7QA 4FT8A 5B1AH 2E2HJ 3ABMH 1HF0A 1T8IA 5DUIA 1YW7A 2HXOA 1X3WB 4OU0A 3Q0UA 4IRGA 2GM4A 1U2WA 2EV0A 2F48A 3WTZA 5D8KB 2H94A 1R49A 3RQIA 2EJRA 3K1PA 3DPTA 3WODF 2ISZA 1DPRA 2JRMA 2ADUA 2E36A 4I6ZA 2GA2A 3ZXSA 2IS1A 3D5SC 2DK8A 2DDAA 4G9YA 2CUJA 4BQOA 1HLVA 4GCVA 3QP5A 2VUMJ 3IRRA 1VTNC 5E79C 1IV6A 3DEWA 3FF5A 1QPIA 2CH0A 1W4MA 3EUAA 4XOPA 3VYUB 5BS6A 3BPXA 2ZMEC 1WH5A 3RQ4A 1JKRC 4C9YA 2J5PA 3OL3A 2AHQA 2XROA 4KIFA 4WXHA 2A5WA 4KYWA 5J4YA 4DYCA 3HRSA 2V4JC 1SAXA 3F72A 4CDGA 5K1YA 3AG3H 3GLLA 2P6TA 3W3CA 3EUHA 2M5WA 3CDIA 4N9HA 2MW8A 3K4BA 1TWCJ 1U3EM 4U88A 3GTJJ 1DGRM 3CJNA 2MLGA 1B72B 1YYVA 2ZBKA 4O5VA 2DODA 1QQIA 3OYBA 3G6EI 2EIJH 2FMYA 2VKDA 3NWSA 2M1BA 3V8KA 1LFPA 3MKZA 3EYIA 2E5ZA 3QQAA 2LBFA 2XPVA 1FLIA 1Z91A 4A12A 2CV0A 1D1BA 3RIRA 5D5VB 2L5QA 1S7EA 1WJBA 2OC6A 2CWEA 4OMZA 4NQWB 4DZJA 2Y9ZA 1DPUA 4PCQA 2XRNA 1RUNA 5ICGA 4AYBA 1J59A 2HU9A 4Z6YA 1O3SA 1ZRDA 3M1EA 2GZWA 1LQ1A 1FOYA 3OYAA 5ILVA 5C4JJ 3RZOJ 4DZPA 1W0UA 3H9GA 3G3ZA 3G73A 1OCRH 2Y9YA 4XM3A 4NC6A 4XONA 2GIZA 3H35A 4EM1A 3OIOA 2STWA 1Q1HA 1RC9A 3I71A 1YLFA 3KZZA 4GYIA 3GUDA 5E1ZB 3WGGA 3E5XA 2AS5F 1BN5A 3CCVI 2DA3A 4A93J 2JPCA 4HQEA 2EH3A 1PJRA 2VQGA 5D5XB 4HDVA 2Z3YA 4NQWA 3G1LA 2L9NA 3DKYA 2ZJPF 1XD7A 2PQ8A 3HGYA 3ERMA 5GTIC 4E7LA 1ZGAA 4G7HF 5JVGF 1N25A 2CW7A 3LWFA 4AYBN 2HZDA 1UHSA 1RR8C 1PUFB 2HNHA 3ZGKA 1XMAA 5D4SA 3TGNA 3W6JB 4QSHA 3AKZA 4AM3A 3ESWB 2LF8A 4E7IA 2IA0A 4EJUA 3LAJA 2BV6A 3FXJA 1IN5A 4XKWA 3UKGA 5FFXA 3LA7A 3QPLA 4NBQA 4CCLA 3BOQA 2M8EA 2NOJB 3IH4A 3M3YJ 3CO7C 4Q47A 4ZJZA 1WJCA 4E6KG 1YJNI 3W6KB 4MQ9F 3PL8A 4AUXA 2VOOA 3NARA 4JBAA 5B1BH 5AIQA 3V42A 4N4OB 2OCEA 3OWTA 5TRDA 2DT7B 3I9V2 1A5JA 2W48A 3RKXA 2HTSA 3HHHA 3HTUA 1T98A 3BT9A 4A5NA 1IXRC 2NVYJ 3E5UA 3KE2A 1SFOJ 4C2MJ 1OQYA 3MKYB 2K40A 2WAFA 1V5GA 1IN6A 5TISC 1KU3A 5CVUA 2BOLA 3I4MJ 2IAIA 3DQVC 3CCMI 1BJZA 3PO2J 1Y0UA 2JSPA 3FXKA 1X2MA 3OIQA 5CVIA 3DEUA 4RLFA 3P9CA 2KIQA 3VODA 1OCOH 3C2GA 1FWZA 1FBUA 2N8GA 2E34A 2KIFA 2E71A 3CCUI 3X2QH 2HXIA 1AKHB 1XDUA 2OZUA 2ZJ2A 4HLYA 4PJLA 2DPUA 1HKQA 4P9UA 1T08B 2XV4S 3DTIA 1A35A 5F0CA 4AIKA 4HYEA 2Y75A 2PX9A 4IHSA 4ON0A 2XF5A 4Y15A 2KLOA 1ZTRA 2DU9A 3C18A 3DKWA 3M9AA 2CO5A 4BU2A 3K70D 3CP2A 2V9VA 3WE2A 1FOXA 2DBBA 5F1RA 3CC4I 4I02A 1IN7A 2A6TA 1LPQA 4HEA2 1GV5A 2NOGA 2FNAA 3IAS2 1ETOA 3DTKA 3TDZC 4ITVA 3BG7A 2RNGA 3CCEI 3W2AA 3FMSA 1DDNA 2P4WA 3GTPJ 3IUOA 1LDDA 5CQEA 1IXCA 5IT9K 2IA2A 1HXDA 4XN3A 2ZMEA 2HWVA 3B02A 3HGGA 1FOKA 2JPBA 1PP8F 3DWLE 4BHPA 5J40A 3FKJA 2ISYA 2FU4A 4RLQA 3BR2A 1I3QJ 1R5HA 1TLHB 3SJMA 3L2WA 2Y30A 1X2NA 2LK2A 5EG0A 3ZQCA 2CQKA 4FASD 3IHUA 4RBOA 3EUKL 1SVLA 3K6GA 2EFOA 2F2EA 4BYYA 3LNQA 4V2FA 3WU2C 2F4OB 1WH7A 1RKWA 2JUCA 1FSEA 2IJLA 1E3HA 4JX6A 2Z16A 1HBXG 5DV5A 2E2IJ 1SVMA 4ZYEA 2DMTA 5CQGA 3GTGJ 1BI1A 3GYHX 2HI3A 3FIWA 2Z2SB 3F6OA 1JJ6C 4U7BA 2CQQA 3A1YA 2M87A 4HSRA 2VE9A 1LFBA 3ZMVA 2EZHA 3KEYA 2W24A 1S6LA 3WTXC 4E7KA 3BJ6A 2KIMA 4JQFA 3A2KA 2DFIA 2M7AA 3E6BA 4NUBA 4HV5A 4E7SA 3H92A 1RKTA 5DDGA 2VJ5A 2L7ZA 4QWQA 5JVTA 3K4MA 2DPDA 3GTQJ 4L0ZB 2MD0A 3LSTA 4LGWA 1HW5A 1SMYF 2HQNA 4A3CJ 1Z3YA 2LMDA 4C2UA 2EV6A 3ABUA 3FXRA 2LY2A 2ZFWA 3HDDA 4M6VA 5GAGJ 4CHUA 1JE8A 3RYPA 4C2TA 4NNJA 2XPUA 3G71I 3D5LA 2DOEA 1P7JA 5FKOA 2ZJRF 1J75A 1ZREA 3H3VK 2BGCA 3JSPA 2F5EA 3VB2A 1B6AA 5BPIA 3I56I 1Z7LA 3O6BB 4J01A 4F55A 2M8GX 2DOFA 4MHGA 1I3AA 2JSCA 4AVZA 2IXSA 2XGEA 2PJRA 3G1OA 1R5ID 1MMAA 1KU7A 3FXOA 1TWHJ 2W85A 3OSFA 1ETKA 1BL0A 2KDOA 2ZSHB 3FDYA 1JI8A 2XB0X 3S3NA 2R7SA 2XAFA 2BY0A 3H5AA 2ZNYA 2HR3A 2YS9A 3TP3A 2I5UA 2KT0A 2M7BA 1P2FA 4HNTA 5K7ZA 3FXMA 2IRFG 2X0LA 3TMOA 4BL0B 2FQ4A 3V7SA 2HTJA 3ZN0A 4IZZA 3J81Z 4XORA 4OIOF 9ANTA 4ZH4F 2JVHA 3B73A 5C44J 2FE3A 3ONQA 2DAOA 2VPRA 1TP4A 1W36C 4AWXB 1YOVB 3F8CA 3CUQB 3MD2A 1X4PA 2NVQJ 3PO3J 2CSOA 3BR6A 3DCFA 5IOYA 4RGUA 1SD4A 3E6DA 2FD5A 4X0GA 1JT0A 1RNLA 3S16J 4P1WA 1MBHA 1WRJA 4K2EA 2XGCA 2QBYA 3IAM2 4UV8A 4OOIA 1O4XA 2LP0A 1WJFA 2DT5A 1BJAA 4FCYA 1FPQA 2V6CA 1XMKA 2XSJC 1S5LC 4KIGA 1FYLA 2GIVA 3HOYJ 2M30A 2X4HA 3EPZA 4IVNA 5HNHA 4ENMA 4LG0B 3S2HJ 4MIMA 5M5WJ 1FYMA 3TOBA 4JP0A 1I6HJ 2VLAA 1LNWA 4BEHA 4YRVA 1BR2A 1XCVA 4J00A 3CCYA 2A6HF 2ELHA 2PMHA 3L2RA 4LG3A 2E1MC 2KRHA 3KIOA 3A4CA 3BTCA 4I7HA 1ERDA 4MO7A 3QYEA 4UB8C 2H1KA 2LC2A 1GVJA 1BR1A 1R7JA 3TBIA 5DEQA 3ZQHA 1T39A 1R5GA 2X51A 3ELKA 2W84A 3BG5A 3K2ZA 2GWRA 3L9FA 1LVAA 1B59A 2BZTA 2L7FP 3K1MA 4BJTA 5LHIA 1GT0C 1YTYA 2V1UA 2VI6A 2XRLA 3I55I 3L09A 1D1CA 4CH7A 1D1AA 2XDVA 4M9ZA 4CCMA 5CLSA 2A3SA 3O8HA 2FBIA 2ZXHA 3ZOBA 5D4RA 4XOTA 3W2WA 2R4GA 3LSPA 4A3BJ 2VKHA 2R0QC 3I3LA 4Y13A 5FLVA 3HSFA 1H89C 5J47A 1T95A 3LSIA 2OPTA 2OTLI 2IGKA 3WTVC 1MMNA 2R7UA 3MZ8A 1LE8B 1LDKB 1UAAA 1HA8A 2BVLA 2EV5A 4CSWA 1XGOA 5DM7F 2UUZA 2EFQA 3CF2A 2JT1A 2KZGA 3ML6A 2WAEA 3WTYC 3JRHA 3HJEA 3F8MA 5EZGA 1P4WA 3E3VA 3MEXA 3BR5A 4LJZF 4R1HA 3VPRA 3S17J 1DP3A 2VQHA 3K10A 1J9IA 2X6YA 2CQXA 2CQ7A 4EM0B 5HS8A 3M4OJ 2HQRA 3UR3C 2D5VA 1Y39A 2YX7A 4EMSA 5HS7A 1RESA 4WK8F 3V8JA 2UZKA 1K78A 2HOTA 4A0YA 4XLPF 2OD5A 3C3WA 4X6AJ 3OR2C 2MC3A 1A31A 2CGPA 1JHHA 1BIBA 2OF7A 1R36A 2HOAA 1F43A 1FTZA 5EGOB 1IZ1A 2OBPA 4A3LJ 1X1PA 4EEFG 2OTJI 5ILUA 3K4JA 1IV8A 3PNVA 3HUGA 5HLTA 3L2CA 1OYWA 1R1TA 4KIBA 4X1EA 4Y4RA 5FKNA 4UUTA 2V7FA 3RJPA 2QZ8A 3B6CA 3JR9A 2GA1A 3CDHA 2P0WA 5IYBJ 1TL8A 1PP7U 4RM3A 1EF4A 2EZKA 3OL4A 1DGWY 2ME6A 1N77A 5C3EJ 2EFNA 2RC4A 2B9SA 4BH9A 1MJBA 2HDDA 2A61A 2LH9A 3M8FA 3K70C 1RI7A 3LQQA 3A01A 5EGOA 1GXPA 4YIFA 3CCQI 2WC2A 2R7OA 1TWAJ 4M6YA 1B9NA 4I76A 1QBJA 3KLNA 3K4NA 4XRSG 1SAUA 3DU6A 3OS0A 3T5XA 4B48A 5LLQA 2XF7A 1VF9A 2P5LC 1QVUA 3NRVA 2EFPA 1VQ7I 1IO2A 2X1CA 5DCMB 4BXFA 1MBFA 2Y31A 1K7AA 3G2BA 4PJJA 4BKXA 1R71A 2X1DA 4UHTA 4XLCA 3HSEA 3S3OA 2VODA 2DMUA 5ERIA 1VI0A 4HF1A 4EM2A 2VPLA 4MFEA 2PI0A 4KJZA 1ONVA 3OYLA 2ZCWA 1MBJA 3DPUA 1MDMA 4E4HA 3CJTB 2NS0A 3SYTA 2FNPA 1D5YA 1A6IA 1KA8A 1YS6A 2ZO4A 3H9QA 1EH8A 2H6BA 3E1SA 4XLEA 1FTTA 4UUSA 3S15J 4M3EA 4DBQA 4QIWN 4IL6C 3SZGA 3F21A 1YRNA 3S1MJ 2DMNA 2VN2A 5GAHJ 4A3FJ 4G6DA 3BG9A 1T2KA 3OYFA 1YFHA 3CD6I 1EKEA 1VQ9I 1MMSA 3U9GA 4Q48A 1S29A 2CV2A 1X1AA 3SDGA 1O3TA 2JVGA 1U5TB 2KZVA 2K4JA 1ETXA 3QU3A 3ULQB 4Y52J 2DTRA 1LEAA 1Z67A 3REOA 2HOEA 1BC7C 2L7KA 1W5TA 3G1MA 3UNGC 3V8LA 4BQNA 1W7PB 2OQRA 4NDLA 2NVXJ 1ZK8A 3RCOA 1MIJA 4E7ZA 3SHFA 1V4RA 1IUYA 4AIJA 3I4PA 4BDZA 1BBYA 1IF1A 2DMPA 5E3LA 5HOOA 3COAC 4BGDA 2QGUA 2OCCH 4AD9A 4CZCA 2X85A 2VQCA 1ZG3A 4O3MA 4L18B 3HOZJ 2VOPA 4B3AA 4BNCA 5M3MJ 4EGYA 3CTAA 1WWXA 1K6OA 2HVRA 3JRDA 4BAYA 1A36A 4O6JA 5IYDJ 1ZLKA 2E19A 4AC0A 1Y1VJ 4LK1F 3J7AY 4PJNA 2JWTA 3ZQGA 3LL7A 1G59A 1BIAA 2H27A 4YFNF 3LA2A 4EV0A 3OY9A 2WY8Q 3ASNH 2EB7A 2H8WA 2DJIA 4L9NA 2MG4A 4IQJA 3K2AA 2HZTA 4I99C 2W00A 3FKIJ 1RIOH 5IP9J 5LGNA 5E1WA 1FBSA 4GYGA 1VQ6I 1E0EA 5F6FA 5LFAA 3FBNB 3LOCA 1Z6TA 1M1EB 3BDDA 2YU9J 5L3CA 5HVQC 1W36D 3K1NA 3ZMUA 4JK1X 3TDUC 2JA5J 3I5UA 5HLIA 4CO8A 2BYVE 2F4IA 2RN7A 4E70A 3S1NJ 5J8FA 2V9PA 4UB6C 3BTIA 4CYDA 2HGCA 3CMYA 3PJRA 1JKQC 2E35A 3C2HA 1HQCA 2R7RA 5DCFA 1J2XA 2FBKA 5CKTA 3S1RJ 2XKOA 1F5TA 1ZQ3P 3B6AA 1JGGA 2QSFX 3S8PA 4N0BA 3BZKA 2EK5A 1YX5A 1A04A 2ELKA 2IS6A 3RI4A 1XCBA 1ZKGA 3SZPA 1EA3A 2OJED 4A0ZA 2F5DA 1Y8RB 4HX7A 1TT0A 2R7FA 1C0WA 3LFUA 1OCZH 5FROA 5FKKA 4IHXA 4HBLA 4RM2A 2Q0OA 3ISPA 4XK4A 4L9VA 3DBHB 4J19A 1Q1VA 1KZHA 4F91B 3FHNA 4PSWA 3JRAA 1F36A 5FO5A 2K27A 3R60A 4FHTA 2DFFA 2BE5F 2L7MP 1MZBA 2OAZA 1B72A 4GGGA 1XX5A 2TCTA 1DP7P 4A0XA 1X3UA 2JA2A 3E6MA 3LSJA 4RA2A 5K5OA 1ZN2A 1GDTA 2R93J 3HOVJ 1X1DA 1YIOA 3GMEA 3OYNA 2HYFA 1QU3A 2KPMA 5D6FA 4BQAA 4PDKA 2DK5A 4KUMA 3FM5A 3S93A 2JA6J 1W7PD 2LFBA 1NH3A 4II3A 5DTDA 5FB2A 4ZYHA 1FIPA 2CUEA 4D0PA 2O3FA 2JK3A 4UVBA 4F93B 1S3JA 4QPOA 2YUSA 2XAHA 4BQQA 2L9RA 2HFHA 1LEBA 1GHCA 2PMZA 5J4VA 4RB1A 3CJQB 3T8RA 1SFKA 2M34A 1ETYA 1XSXA 4A5MA 3H0GJ 1WJDA 2F5VA 2VKEA 1PVEA 3I58A 4HX4A 1LVKA 4QPQA 3D5RC 5IT3A 2K3FA 2FOWA 2MGQA 1PUFA 2KIUA 4LMYA 3JRCA 1I39A 1WGXA 3GFMA 4ESBA 3T0YA 2F6CA 3JRGA 1IXSB 3S1QJ 5KK1A 3CUOA 3KCCA 2VXDA 2X6WA 1OCCH 4IPAA 1U9NA 4LFUA 4ZC3A 1PYVA 3GEZA 5D5UB 4IOCF 1Z1DA 2J5OA 1MSFC 2VC1A 2ESNA 5IT9Z 3R61A 2JN6A 2PMZN 4V2GA 5K7HA 3I64A 1TWGJ 2P6SA 5FLXK 3VYTB 3IL2A 1F1ZA 3CQZJ 3Q0WA 1G2HA 3AG4H 3KX2A 1P7IA 3F8FA 2PLYA 2YPRA 5F0HA 1OYYA 4NHJA 2NS7A 4Z2YA 2F5FA 3U2RA 2RV8A 4M6XA 1ZR4A 1IAWA 1UHWA 1TBXA 3D0SA 3LAPA 4BJ5C 1JTXA 1TNTA 1USSA 3IC7A 4BXUA 2O61A 3I59B 3IKVA 3GZ6A 2ZSIB 2DTZA 4HA8A 2Q2EB 3BTLA 1YHQI 3CUQC 2MH2A 3TO6A 4P96A 2L01A 1BOAA 5L3FA 4QLCU 1RZ4A 3PQKA 1R58A 1N78A 2FMLA 3JRFA 5KAFC 4KISA 1DU6A 4TV7A 4Q5SF 1SMTA 3FHZA 1ZGWA 2VONA 2JRTA 3ZQFA 4DGWB 2BY1A 2R7VA 2KL4A 4HNVA 5H6QA 4DW6A 4PFOA 2LSOA 5EZHA 1WJEA 2E2JJ 1MH4A 2CUZA 2UXNA 1AKHA 4YIIA 2KQRA 2XAJA 2COMA 2LY9A 3VEPA 5GADJ 1VQOI 3DV8A 2RNJA 4XRMA 2G7UA 4XKBA 2JQ7A 2UV1A 3GXOA 3J7YJ 2DA1A 3C7JA 3H0DA 3G4SI 2NNYA 4B8XA 3MCZA 4II2A 1EH7A 2VBZA 4G6QA 2JJ7A 3FMQA 1JT6A 2EA4A 5LGTA 2LKPA 4XKVA 1NG7A 3BPVA 4KT6A 4RAFA 5A2QK 3HOXJ 4HW0A 1VQLI 1WKMA 2BW3B 3BTJA 3CC2I 2IP2A 1X3ZB 2BXYA 1ZYRF 1Y1WJ 3CMMA 2OUMA 1DQUA 5DM6F 4CCOA 4ZDPA 2XAGA 4XLHA 2GXBA 1XSVA 3KYCB 5KAIC 1UMQA 3BP8A 2CU7A 3QPTA 1GXQA 4LLLA 3TL4X 2E7WA 2DA2A 3A02A 2CG4A 1D0YA 3OV8A 2VQLA 2BHZA 2EINH 2WTEA 2DW4A 1Y0NA 2XVCA 3O8GA 4M3GA 2IPQX 1QZYA 5F1JA 4HF0A 1FBQA 5DS9A 3CCJI 4CXFA 3ZR8X 2BHYA 1ZR2A 5HDKA 1H8AC 3P5JA 2VKVA 2HDCA 3KEOA 1CF7B 2B7EA 1R23A 4BACA 1FY7A 3KYDB 2PJPA 1U0JA 5FLMJ 1FMWA 3VDXA 3ZQIA 4IHWA 4IRHA 4LD5A 1BC8C 4B43A 2VJIA 1X1CA 2O8KA 4G6TB 2HVSA 1D3YA 3FK7A 3HRTA 3VSLA 5HLGA 2GXAA 3CF5F 1QZEA 3MZHA 3WG9A 3N05A 2OQGA 4M3DA 4PGGA 1JHFA 3TQNA 1X19A 2WBMA 1HKSA 2XPWA 2Y0MA 2LF7A 3M1CA 3MZYA 3GVAA 3N97A 4WCGA 3MAJA 4XSZF 1IC8A 1OCPA 4KNYA 2M9HA 2KDZA 3KP5A 2CS3A 2NVTJ 3JRBA 1I1SA 4MGRA 1IUFA 2NS8A 4XKCA 2M0CA 5E8GA 3DEEA 3BCAA 4MFDA 2WA0A 3TOAA 3JAMZ 2O9LA 1F4KA 4A3JJ 4FETA 2JZYA 3MVPA 2FEZA 3WTUC 3OYHA 1MKMA 4EJVA 2L9VA 3CLOA 4R8HA 5BMZA 4EQQA 2ZC2A 3AL0C 4L5JA 2V1DA 3ASOH 3BZCA 5HDGA 4G12A 3RKYA 2D1VA 2LREA 3VYRB 2Z1DA 3Q3SA 2CFXA 3MKWB 1LJ9A 2R5ZB 3H9JA 3LQRA 2DXIA 4ZDLA 1ZRCA 1OKRA 1MGTA 3BCBA 4DNCA 3HIFA 4N4NB 1TQMA 4YFXF 3GTKJ 2BEOA 3ZMTA 1VQ5I 1XGMA 5FGMA 4GO1A 3Q9SA 3OR1C 2EQRA 2CQNA 1SEUA 3FMRA 3S3MA 1QA6A 3PSIA 3ZQQA 4EJTA 1S8NA 3Q0VA 3PSFA 3BR3A 1WPKA 2JUGA 2FSWA 3QAHA 5FD5A 4A69C 4HAMA 1J0RA 2LTPA 5ED4A 4JX5A 3CMEI 4XRSA 4BS9A 1P4XA 2G0EA 5JLWA 3U21A 1U8RA 2IW5A 3ZCOA 3GTMJ 2L54A 5H6RA 1Z7UA 5LEJA 1Z3XA 3SZTA 3BG6A 1TNSA 3KFWX 1IW7F 3JAMK 2WY7Q 1FX7A 1VNDA 3M07A 4RMNA 3ABTA 3MKLA 3CUQA 3V7CA 3HXLA 1XN7A 2HEOA 2LDUA 3OS2A 4IKFA 2CRGA 3CO6C 1H9GA 3AG1H 4F7ZA 4MTDA 2L0KA 5IP6A 1P9QC 3ZMZA 4HPQA 1QPMA 2Z99A 5FRNA 3IRQA 3R4KA 1YJ9I 2JA8J 1SC7A 1XGNA 4FTHA 1AWCA 2IVMA 2ID3A 5KCMA 2R7ZJ 3ABLH 2X9DA 3F8BA 3CMAI 3FISA 4M74A 5JR3A 3TW6A 4UVAA 4GXOA 2EBIA 1JKOC 3L7WA 1MMDA 1E3OC 3CLQA 3F0CA 1WSUA 2KP6A 2IT0A 2RGVA 2OA4A 3ERED 1ETWA 2KJCA 1UG2A 3DFGA 3OOPA 4UY8I 2PBIA 2FBHA 2VL8A 1G3SA 1EV7A 4LG0A 1U5TC 1QZZA 2P81A 3S2DJ 4LK0F 5B5EC 1OISA 4LB5A 1Z21A 1OMIA 2X6XA 4BE1A 3GTLJ 5HLHA 2LD5A 4DJAA 2R5YB 3J80Z 4KA4A 5F04A 1KQ0A 5E3OA 1T38A 1R6RA 4LOCA 2R92J 4B1RA 3RZDJ 1XSDA 4U0YA 5EEAA 2DDBA 1VFCA 3GFJA 1JXSA 4F92B 5DYMA 4KMUX 3AAFA 1B8IB 2UXXA 2WB1A 1XTAA 3U1KA 3IWFA 2QQ8A 2KMUA 4BBSJ 1XDSA 1LUJB 3I4NJ 3E97A 4KN4X 2E7XA 4IHYA 4D5FA 4DYQA 4PZJA 3H5NA 3ZQLA 1YW8A 2K7LA 3ZMDA 5GP9A 3HM5A 3OYGA 2HYJA 4XL9A 4XRFA 1QO0D 1D8JA 1LDJA 4FX0A 1G3WA 4CICA 1G3TA 4ZTFA 4I09A 4HSTA 3ZQ7A 2HVQA 3BJAA 3RYRA 4C3IJ 2O5RA 5BPDA 1LE8A 1WQ2A 1QGPA 3KP2A 1KGSA 2CW0F 5L3EA 5HNFA 2W82A 1MJ9A 2QWWA 3LSGA 4H0EA 1HOMA 5IP7J 1FJLA 4WXCA 2Z5UA 2K9SA 2WB1N 3FBIB 3AL0B 1KONA 4I0AA 4MLOA 2RKHA 4HV6A 2O7OA 4E7HA 2R3SA 3BR1A 2V9KA 3HEFA 2E1CA 3BROA 3FXUA 3J80K 1R1VA 4Y33A 4JOMA 3WTSC 1B1BA 2NYXA 2H09A 3SFIA 1VQPI 2Z9OA 1UJ8A 4A3DJ 1ZLJA 4IXAA 3LSMA 1SANA 3WE3A 1WHUA 1BI0A 2FA5A 2XGXA 5FKMA 1MNMC 4A3EJ 2QSHX 3QOEA 4IHTA 5K7FA 2L4AA 4L9TA 4OWRB 1ENHA 2AQEA 3WTWC 2EPFA 2DN0A 2K86A 2M4GA 3HRMA 1E17A 3CDLA 2I10A 4CZZA 2K85A 2YU3A 2EILH 4MQVA 1FYKA 4WX9A 3TW7A 4WF2A 4BHCA 4ENJA 3H3UA 4H4KC 3CJRB 3OYMA 2AXTC 1DU0A 4IEJA 4IQ4A 3T8TA 3BWGA 2ELJA 5LRRA 2A68F 2FF4A 1AOYA 3MQ0A 1G6NA 1PDNC 2EIMH 4CUGA 2PG4A 1BI3A 2I8DA 2NXNB 5KVRA 2QSGX 3K4LA 3IWZA 1JUMA 5E18F 2X6OA 4PK4A 4G94A 4OAYA 5IY5H 1KQ9A 2ZJQF 1UZCA 2E1OA 1VQ4I 1I27A 1R4MB 1POGA 5DCMA 2LVSA 2K02A 3QWLA 1SD7A 2D1HA 1WCMJ 5EJCA 4IF4A 3VWBA 3GZ5A 5LD2C 2EA2A 4PUSA 2LY1A 1USTA 1G4DA 3BR0A 2VC0A 4B44A 5ICEA 1Z6RA 1ZGJA 3OMYA 1O7LA 3OYKA 5JFRA 2IA1A 4IHVA 4FE7A 1N75A 4KT5C 5J3LA 2DYRH 4UNOA 1ETVA 4B09A 4FX4A 2KRCA 1O3QA 1XS9A 3WG7H 5FRMA 4M3FA 1B9MA 1HSJA 3EETA 4RAGA 3ZN1A 1IRZA 2VT2A 2O6GE 4LLNA 2VJJA 5EDNA 3LSKA 4MEXF 1IGNA 2FJ1A 2KHMA 4OAZA 1X58A 4XBFA 3OOUA 1CQTA 4PFPA 3IH2A 4XMYA 1U5TA 2MYSA 1U78A 1WZ2A 2QQAA 3LA3A 2W1OA 4XQFA 1VQMI 1HDDC 1UCRA 5IPAA 5JI6A 1T0FC 1T56A 2DCEA 1SVOA 1W7PA 2XAUA 3K9TA 3DPLC 1ZG1A 4IOAF 5F0FA 2D2WA 1J5YA 1APLC 4ANJA 1VQKI 1Y6IA 1ACIA 4M72A 2LNBA 1QHHD 2HYGD 2VIXA 3F6VA 3HHGA 3M8JA 4I01A 1TZLA 1YIJI 1S72I 4Y3OA 5GTHC 5GPAA 2Y69H 3F8NA 2ID6A 5E20A 5TGTA 5DD4A 3QPSA 4P5OA 3CC7I 4U87A 1GLNA 5H20A 4C3JJ 5IYCJ 3HKZA 3IV5A 4CCNA 2UWMA 2WADA 3HTSB 5JLXA 1ZG5A 2JTVA 2ECBA 3DTEA 5AONA 1W5CC 2A07F 1XG1A 2ETHA 3GZNB 4CYCB 4EATA 1L3LA 1H9TA 4D7MA 1OPCA 1ZELA 1AA7A 1FIAA 4XLAA 3TEDA 4OINF 3SXYA 1NK2P 2IGMA 4PSXA 3PNYA 2QEXI 2GBYA 3BY6A 3LSHA 4YELA 2HQAA 3C1DA 2RQQA 3O3KA 2ZXIA 3EYYA 2LBFB 1HSTA 3ZRGA 1P4AA 3NEUA 2OU2A 2DI3A 3JCUC 3LFKA 2CV1A 3NWTA 3J7AO 2XKPA 3HKZN 3FK6A 2IGOA 3RPUD 2Q1ZB 4CYCA 3CESA 2H6CA 4FISA 5FD6A 4KMFA 3DF8A 3GFLA 4M71A 1FSHA 1S7AA 2STTA 1L0OC 1ZHFA 2E60A 4HF2A 3HZJA 2JA7J 3BQZA 1FP2A 1VZ0A 4NC8A 5CYVA 2LKSA 1S7OA 2LYCA 4ENNA 4LIUA 4PJ0C 2DLLA 3HG9A 1IRGA 2AO9A 1BI2A 2F5CA 4OIQF 3MWMA 3KP4A 2L02A 1IJWC 2P5VA 5ICFA 5JHFA 1NK3P 2DYSH 3QOPA 4MEYF 1V5FA 5FLXZ 3F22A 2FXAA 1QVTA 1HDPA 1GVDA 2HS5A 4HZFA 1B4AA 2XGDA 2Y0SA 3A0HC 1D0ZA 2MC4A 5J1YA 4ESJA 1IG7A 3TP0A 5CVVA 2GOMA 2RVCA 1JKPC 2G7HA
chains in the Genus database with same CATH topology
1VQMI 5GAGJ 5GAEJ 3G71I 2ZJRF 3I55I 1VQ7I 4IOCF 1YJ9I 4IOAF 2E35A 3I56I 1FOWA 1VQKI 1ACIA 1YIJI 3CMAI 1S72I 1FOXA 1FOYA 3CC4I 3CF5F 2OTLI 3CC7I 3CJTB 1YITI 4UY8I 3CCEI 3CCVI 5DM7F 1YHQI 1YI2I 5GAHJ 3CCRI 2ZJPF 4IO9F 1VQ9I 3CD6I 1MMSA 1VQ8I 5JVGF 2NXNB 2QEXI 1Y39A 2ZJQF 2E36A 5GADJ 1VQ4I 3CCLI 1VQOI 2JQ7A 2QA4I 3J7YJ 1YJWI 1YJNI 3G4SI 3PIOF 2OTJI 1VQ5I 1VQLI 3CC2I 1QA6A 3PIPF 5DM6F 3DLLF 1HC8A 3CMEI 3CCMI 2H8WA 1VQNI 4V19K 1VQ6I 3CCJI 3CCQI 3J7ZI 2K3FA 2FOWA 2E34A 3CCSI 1VQPI 3CCUI 3G6EI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM I;  5GAG J;  5GAE J;  3G71 I;  2ZJR F;  3I55 I;  1VQ7 I;  4IOC F;  1YJ9 I;  4IOA F;  2E35 A;  3I56 I;  1FOW A;  1VQK I;  1ACI A;  1YIJ I;  3CMA I;  1S72 I;  1FOX A;  1FOY A;  3CC4 I;  3CF5 F;  2OTL I;  3CC7 I;  3CJT B;  1YIT I;  4UY8 I;  3CCE I;  3CCV I;  5DM7 F;  1YHQ I;  1YI2 I;  5GAH J;  3CCR I;  2ZJP F;  4IO9 F;  1VQ9 I;  3CD6 I;  1MMS A;  1VQ8 I;  5JVG F;  2NXN B;  2QEX I;  1Y39 A;  2ZJQ F;  2E36 A;  5GAD J;  1VQ4 I;  3CCL I;  1VQO I;  2JQ7 A;  2QA4 I;  3J7Y J;  1YJW I;  1YJN I;  3G4S I;  3PIO F;  2OTJ I;  1VQ5 I;  1VQL I;  3CC2 I;  1QA6 A;  3PIP F;  5DM6 F;  3DLL F;  1HC8 A;  3CME I;  3CCM I;  2H8W A;  1VQN I;  4V19 K;  1VQ6 I;  3CCJ I;  3CCQ I;  3J7Z I;  2K3F A;  2FOW A;  2E34 A;  3CCS I;  1VQP I;  3CCU I;  3G6E I; 
#chains in the Genus database with same CATH topology
 4BJ6 C;  3DBL B;  4I0B A;  4A3I J;  4EGZ A;  1J09 A;  2QLZ A;  1T33 A;  4AVP A;  4RB0 A;  1JUS A;  2O0Y A;  3WU0 A;  1K79 A;  2ME0 A;  3ABK H;  3A03 A;  1TW2 A;  2YX4 A;  3AG2 H;  4YG2 F;  3Q9V A;  3MMY B;  2ESH A;  1R1U A;  5KNL A;  4HG2 A;  4UUV A;  1ITY A;  1Y56 A;  2Y48 A;  2DT6 A;  3SFZ A;  2WAQ A;  2L9S A;  1Z9C A;  2ZXJ A;  3ZMS A;  1YO5 C;  1JJ8 C;  3BQY A;  2V1X A;  2KJB A;  4IJA A;  1RRJ A;  2Y0S N;  4U0V A;  3V7R A;  2ZNZ A;  1STZ A;  3HRU A;  1ZAO A;  2XB5 A;  4XNF A;  1U9O A;  3S2W A;  2M3A A;  5BNG A;  3V4G A;  3AFH A;  2Q8K A;  1DUX C;  4GFB A;  4FE4 A;  4D5C A;  1XMX A;  1R9T J;  2QUF A;  5FFZ A;  2MSY A;  4F3Q A;  2DQL A;  5AIP A;  3GBG A;  3KZI C;  1V5E A;  1MSE C;  2H1L A;  3L2Q A;  5HS9 A;  2FX0 A;  2PFB A;  3K7A J;  4Y7N J;  3JTG A;  1W0T A;  4QTR A;  1FC3 A;  2FOK A;  2VJ4 A;  2M2E A;  1OCT C;  2X1E A;  2FRH A;  2PN6 A;  4RB2 C;  1CGP A;  5A2Q Z;  4BHB A;  2WAQ N;  3SDB A;  1ODD A;  4PGH A;  4I2O A;  3QPH A;  2IS2 A;  4DBR A;  1E2X A;  4HOB A;  1YE9 A;  5L3D A;  4M9X A;  4IX7 A;  2EZI A;  4C3H J;  1MH3 A;  4LIT A;  4ETS A;  3Q5F A;  2XHK A;  2W25 A;  2B63 J;  3CZ6 A;  2FQ3 A;  3DBR B;  4EJW A;  1BW6 A;  2Z33 A;  5B66 C;  4MNU A;  4GDF A;  5EEG A;  1T0F A;  3KZY A;  3ZP5 A;  2V6E A;  3P7N A;  3LSR A;  4D9J A;  1E3P A;  5LHG A;  3DXJ F;  2GOX B;  3QYB A;  1O7F A;  2M45 A;  2B0L A;  1G8X A;  2BBY A;  4M3B A;  4Q4Z F;  4A3K J;  2BY2 A;  1RET A;  2V26 A;  2XF6 A;  3KEQ A;  5CPR B;  1T6S A;  2ZME B;  3GX4 X;  3I59 A;  2OZ6 A;  2Q2E A;  4BY7 J;  3SQN A;  1UB9 A;  1ZAR A;  3RKW A;  1BA5 A;  5IOZ A;  4L5I A;  3P9K A;  5EF6 A;  2GLO A;  4XLN F;  4C30 A;  3WGH A;  3OIP A;  5EG0 B;  1I1G A;  3EDP A;  1D8K A;  1SFU A;  2GQQ A;  2P5K A;  4ZYG A;  1IN4 A;  4CA0 A;  4W1U A;  1D5V A;  5J8C A;  3I0T A;  2LLK A;  2KIS A;  1JTY A;  3HBL A;  4ABZ A;  2BXZ A;  1NHA A;  3FXQ A;  3GF2 A;  3SEZ A;  1V55 H;  4LLG F;  2ZKZ A;  1MMG A;  2P7C B;  2G9W A;  1OJL A;  1O57 A;  5LHH A;  2HOS A;  4A3M J;  2XAQ A;  4HNU A;  2GXG A;  2E5N A;  5J1U A;  1H0M A;  2DMQ A;  1YQA A;  1RPW A;  1MND A;  2VXZ A;  4XN0 A;  2NNN A;  1W5S A;  4XR6 A;  4NC7 A;  1EJ9 A;  3H1C A;  2NRA C;  1Z0X A;  1MBG A;  2HQ5 A;  2BW3 A;  3KP3 A;  1V54 H;  2QQB A;  1J7K A;  3ECH A;  3RPQ A;  5D8L B;  4DQ2 A;  1RUO A;  3CCR I;  3N4M A;  3A0B C;  5E3M A;  4IRI A;  1VQ8 I;  1KU2 A;  2HKO A;  2CUF A;  2DO7 A;  1MD0 A;  2D45 A;  4N9I A;  5C4X J;  2LR8 A;  3CP8 A;  5LRS A;  1K83 J;  1WI9 A;  3PM1 A;  2QEN A;  2QKL B;  4S04 A;  3WGI A;  4ZYD A;  2DJN A;  1CF7 A;  4HQM A;  1IDZ A;  2LRD A;  3QYF A;  1YS7 A;  1BW5 A;  1TT5 B;  2A69 F;  3F3X A;  5CVJ A;  3JRE A;  3MFK A;  3C2B A;  1I50 J;  3SEQ A;  4ZYA A;  1K4S A;  1YX3 A;  5L3G A;  3VSK A;  1RR7 A;  3M7G A;  3DP7 A;  4W97 A;  2PJR B;  4ASN A;  1BM9 A;  4DOZ A;  2XAS A;  4S0H B;  2PMU A;  3KET A;  3PIO F;  2W57 A;  2MD5 A;  1WJA A;  1IRX A;  1HW2 A;  2EWN A;  3RDI A;  5CVR A;  4BBR J;  3RTR A;  3E6C C;  5J1R A;  4HX8 A;  2XUB A;  1WVR A;  1TTY A;  2IS4 A;  2NAZ A;  4ZTJ A;  5M5X J;  4D7N A;  1TW3 A;  3IKT A;  5E1X A;  4JYK A;  2A6E F;  1HC8 A;  2LKX A;  5FJ8 J;  3LMM A;  1IN8 A;  4B4C A;  4BE2 A;  2PEX A;  1BR4 A;  4I98 B;  1V3F A;  2RQP A;  1MJA A;  4KDP A;  1XB4 A;  2RDP A;  2QQ9 A;  1OFC X;  2VAS A;  5LBQ A;  1TQI A;  2XSD C;  3CCS I;  2HPI A;  4OIP F;  4AID A;  1FT9 A;  1G3Y A;  1KYZ A;  4YFK F;  1AU7 A;  2VBX A;  1U6G A;  1F9N A;  3RSN A;  3KP6 A;  3FM3 A;  1Z77 A;  1U8B A;  2QBY B;  2QCO A;  5LEK A;  4DIQ A;  3ROU A;  3GFI A;  2L2O A;  1JGS A;  5EEH A;  1FOW A;  4ZZL A;  3HPH A;  5KHD A;  2R5Z A;  2CW8 A;  3R0A A;  2O03 A;  2MLK A;  1LFU P;  1YW9 A;  1REP C;  1NTC A;  3TO9 A;  3WU1 B;  1QNT A;  4BE0 A;  2R7T A;  2E1N A;  1HCR A;  1QHG A;  2K9Q A;  2VT3 A;  1R22 A;  3L2V A;  4AIH A;  5B3S H;  3GO5 A;  4WXD A;  2XC7 A;  2A5Y B;  2R7D A;  4WWC A;  3MN2 A;  1K6Y A;  2MH9 A;  1AHD P;  4HRI A;  1SD6 A;  2M4K A;  4HLX A;  3L1P A;  4BEH B;  3OYE A;  2JMW A;  2X48 A;  3BZ6 A;  1BOB A;  3WTT C;  4XSX F;  5M3F J;  3HB9 A;  5EYR A;  1PUE E;  2M0M A;  4P9F A;  3DKX A;  3H5R A;  3JRI A;  1HKT A;  3HC7 A;  4A2U A;  2A05 A;  1LKX A;  5K5R A;  4RB3 C;  3OS1 A;  4IO9 F;  4G7O F;  1P6R A;  3HOU J;  3FXL A;  3KYL A;  1P92 A;  2K9N A;  2YR2 A;  1R4N B;  4BUP A;  2P8T A;  4RAY A;  1SD5 A;  1ORK A;  1UG0 A;  2FUG 2;  1HW1 A;  1UHM A;  2KFD A;  4KN7 X;  4DYR A;  3T1B A;  4ESF A;  3E7L A;  1MBK A;  2RRE A;  2MA3 A;  5J6X A;  1KYW A;  5ICC A;  1S9H A;  4RGX A;  4L0Y B;  2QKM B;  4YEJ A;  2KKO A;  5F64 A;  1YJW I;  3PUF A;  4P55 A;  2ICW G;  3GWZ A;  3J81 K;  4CCJ A;  2HPM A;  3HOW J;  3WHC A;  2DA5 A;  2WV1 A;  3BJO A;  1OR7 C;  4A6D A;  1OLT A;  1Y8Q B;  4RGS A;  3GW2 A;  3W6V A;  3I54 A;  2DA6 A;  1QRY A;  1UFM A;  3ECO A;  4ZDO A;  2W4S A;  2NVU B;  4ENK A;  5ILS A;  3OYC A;  2TRT A;  3HOS A;  5F27 A;  1YG2 A;  2XIG A;  2COB A;  3IH3 A;  3KLO A;  3VYS B;  2AQF A;  2KRF A;  1VQN I;  4KIC A;  4RGR A;  2QM3 A;  1JUP A;  4LB6 B;  2QYO A;  2QF7 A;  3R0J A;  2CMP A;  3TKY A;  1K61 A;  2ACJ A;  4ZZD A;  1FP1 D;  2L4M A;  5HDN A;  3J7Z I;  4R79 A;  2R5Y A;  1LB2 A;  3S32 A;  4S05 A;  5BQT A;  3U1D A;  1SFE A;  4G8X A;  3OYD A;  4L5E A;  1K78 B;  1XPX A;  1FMV A;  2TDX A;  2K9M A;  2DOA A;  2ECC A;  4EJO A;  2V79 A;  3F9K A;  4AU7 A;  3NQO A;  3H36 A;  3OYJ A;  1KU9 A;  3VFZ A;  2K5C A;  1B8I A;  2DFE A;  4RAZ A;  3F23 A;  2ZFU A;  3HL2 A;  4UV9 A;  2ZB9 A;  3JW4 A;  4U0W A;  1R00 A;  3PQJ A;  1TQP A;  1SFX A;  1WFX A;  3WHB A;  5F08 A;  3W2V A;  3HUG B;  3S14 J;  2DQR A;  5E8I A;  2DA4 A;  3QP6 A;  2K3P A;  4A6E A;  1ON2 A;  3EUH C;  2CJJ A;  2WV0 A;  4M9S A;  1WJ5 A;  5M5Y J;  3BLY A;  1UEL B;  3L00 A;  2L3D A;  2DFH A;  1KQ8 A;  1K4T A;  1IRF A;  4GRI A;  1YI2 I;  2C6Y A;  3VOE A;  1O3R A;  2IEK A;  3A01 B;  1XC5 A;  1MNE A;  2IBD A;  1I5Z A;  3GCM A;  2HDW A;  5TJJ A;  3QRF F;  1GUU A;  5JHU A;  3GLX A;  2EZL A;  3BG3 A;  3RKQ A;  2P7V B;  2VE8 A;  4BY1 J;  3HYI A;  1ZRF A;  2H8R A;  1Z05 A;  3D1N I;  3I53 A;  2RAE A;  2MFZ A;  5BOX A;  3OYI A;  4UXN A;  3HOT A;  3PNT A;  2QVO A;  3L2U A;  2W7N A;  3KPH A;  1X1B A;  5GPC A;  3CCL I;  1FEX A;  4XIC A;  2EFW A;  3BC8 A;  5DUK A;  2QA4 I;  2LG4 A;  3PFY A;  2AXL A;  4PJM A;  3OSG A;  4A3G J;  3JSO A;  2R7W A;  3K69 A;  2OV7 A;  3M8E A;  3K0L A;  3FZV A;  1MDM B;  2K9L A;  4F52 A;  3FX3 A;  1FNN A;  2ZXW H;  1ON1 A;  2YSR A;  2V1N A;  4B3X A;  1MW7 A;  1OYI A;  4HDU A;  3PIP F;  4UUS B;  2K4B A;  2Y2Z A;  5E17 F;  2O8X A;  1GV2 A;  1X4O A;  4RS8 A;  4B47 A;  2DA7 A;  3DLL F;  1YRN B;  4M73 A;  3E5Q A;  3HPG A;  2VBY A;  4EVI A;  3QU6 A;  1W1W E;  5LGU A;  4LIV A;  3QOD A;  5DD8 A;  1ZH5 A;  1A6Q A;  3EQL F;  4XLF A;  1I6X A;  2F4M B;  4V19 K;  3K4C A;  4OMY A;  2CYY A;  1XGS A;  4BDY A;  4Y17 A;  3RPU A;  4UVC A;  5D6E A;  2VBW A;  2MBF A;  2E1M B;  3HSR A;  2LOO A;  5K5Q A;  1FZP B;  5GAE J;  4JX4 A;  3DU5 A;  4FQG A;  4KIT B;  3R6S A;  3DLA A;  3K4K A;  4MTE A;  5L3B A;  5E3N A;  1TWF J;  1IDY A;  4KFC A;  3P9I A;  2WWY A;  4D1Q A;  2VB6 A;  1H88 C;  2HKX A;  3KP7 A;  4RDU A;  6PAX A;  4OIR F;  1ETQ A;  2CFO A;  5FKL A;  2BVM A;  3PUB A;  5D5W B;  3JTH A;  4L9J A;  3O2P E;  1MBE A;  2MAB A;  1TC3 C;  2BY3 A;  4YIR X;  2IGN A;  4CGZ A;  1WI3 A;  2EIK H;  3IP4 B;  3PFI A;  5H2F C;  1EH6 A;  1NG6 A;  4XID A;  4BXX J;  3NAU A;  1YIT I;  5CJ9 A;  4U7D A;  3ZPL A;  4NB5 A;  3FWE A;  5HOD A;  3GTO J;  2R7X A;  1OR7 A;  4G7Z F;  2GAU A;  3TO7 A;  1D0X A;  3H3Z A;  4E7J A;  3E0J B;  1ULY A;  4CCK A;  2R7Q A;  4FT8 A;  5B1A H;  2E2H J;  3ABM H;  1HF0 A;  1T8I A;  5DUI A;  1YW7 A;  2HXO A;  1X3W B;  4OU0 A;  3Q0U A;  4IRG A;  2GM4 A;  1U2W A;  2EV0 A;  2F48 A;  3WTZ A;  5D8K B;  2H94 A;  1R49 A;  3RQI A;  2EJR A;  3K1P A;  3DPT A;  3WOD F;  2ISZ A;  1DPR A;  2JRM A;  2ADU A;  2E36 A;  4I6Z A;  2GA2 A;  3ZXS A;  2IS1 A;  3D5S C;  2DK8 A;  2DDA A;  4G9Y A;  2CUJ A;  4BQO A;  1HLV A;  4GCV A;  3QP5 A;  2VUM J;  3IRR A;  1VTN C;  5E79 C;  1IV6 A;  3DEW A;  3FF5 A;  1QPI A;  2CH0 A;  1W4M A;  3EUA A;  4XOP A;  3VYU B;  5BS6 A;  3BPX A;  2ZME C;  1WH5 A;  3RQ4 A;  1JKR C;  4C9Y A;  2J5P A;  3OL3 A;  2AHQ A;  2XRO A;  4KIF A;  4WXH A;  2A5W A;  4KYW A;  5J4Y A;  4DYC A;  3HRS A;  2V4J C;  1SAX A;  3F72 A;  4CDG A;  5K1Y A;  3AG3 H;  3GLL A;  2P6T A;  3W3C A;  3EUH A;  2M5W A;  3CDI A;  4N9H A;  2MW8 A;  3K4B A;  1TWC J;  1U3E M;  4U88 A;  3GTJ J;  1DGR M;  3CJN A;  2MLG A;  1B72 B;  1YYV A;  2ZBK A;  4O5V A;  2DOD A;  1QQI A;  3OYB A;  3G6E I;  2EIJ H;  2FMY A;  2VKD A;  3NWS A;  2M1B A;  3V8K A;  1LFP A;  3MKZ A;  3EYI A;  2E5Z A;  3QQA A;  2LBF A;  2XPV A;  1FLI A;  1Z91 A;  4A12 A;  2CV0 A;  1D1B A;  3RIR A;  5D5V B;  2L5Q A;  1S7E A;  1WJB A;  2OC6 A;  2CWE A;  4OMZ A;  4NQW B;  4DZJ A;  2Y9Z A;  1DPU A;  4PCQ A;  2XRN A;  1RUN A;  5ICG A;  4AYB A;  1J59 A;  2HU9 A;  4Z6Y A;  1O3S A;  1ZRD A;  3M1E A;  2GZW A;  1LQ1 A;  1FOY A;  3OYA A;  5ILV A;  5C4J J;  3RZO J;  4DZP A;  1W0U A;  3H9G A;  3G3Z A;  3G73 A;  1OCR H;  2Y9Y A;  4XM3 A;  4NC6 A;  4XON A;  2GIZ A;  3H35 A;  4EM1 A;  3OIO A;  2STW A;  1Q1H A;  1RC9 A;  3I71 A;  1YLF A;  3KZZ A;  4GYI A;  3GUD A;  5E1Z B;  3WGG A;  3E5X A;  2AS5 F;  1BN5 A;  3CCV I;  2DA3 A;  4A93 J;  2JPC A;  4HQE A;  2EH3 A;  1PJR A;  2VQG A;  5D5X B;  4HDV A;  2Z3Y A;  4NQW A;  3G1L A;  2L9N A;  3DKY A;  2ZJP F;  1XD7 A;  2PQ8 A;  3HGY A;  3ERM A;  5GTI C;  4E7L A;  1ZGA A;  4G7H F;  5JVG F;  1N25 A;  2CW7 A;  3LWF A;  4AYB N;  2HZD A;  1UHS A;  1RR8 C;  1PUF B;  2HNH A;  3ZGK A;  1XMA A;  5D4S A;  3TGN A;  3W6J B;  4QSH A;  3AKZ A;  4AM3 A;  3ESW B;  2LF8 A;  4E7I A;  2IA0 A;  4EJU A;  3LAJ A;  2BV6 A;  3FXJ A;  1IN5 A;  4XKW A;  3UKG A;  5FFX A;  3LA7 A;  3QPL A;  4NBQ A;  4CCL A;  3BOQ A;  2M8E A;  2NOJ B;  3IH4 A;  3M3Y J;  3CO7 C;  4Q47 A;  4ZJZ A;  1WJC A;  4E6K G;  1YJN I;  3W6K B;  4MQ9 F;  3PL8 A;  4AUX A;  2VOO A;  3NAR A;  4JBA A;  5B1B H;  5AIQ A;  3V42 A;  4N4O B;  2OCE A;  3OWT A;  5TRD A;  2DT7 B;  3I9V 2;  1A5J A;  2W48 A;  3RKX A;  2HTS A;  3HHH A;  3HTU A;  1T98 A;  3BT9 A;  4A5N A;  1IXR C;  2NVY J;  3E5U A;  3KE2 A;  1SFO J;  4C2M J;  1OQY A;  3MKY B;  2K40 A;  2WAF A;  1V5G A;  1IN6 A;  5TIS C;  1KU3 A;  5CVU A;  2BOL A;  3I4M J;  2IAI A;  3DQV C;  3CCM I;  1BJZ A;  3PO2 J;  1Y0U A;  2JSP A;  3FXK A;  1X2M A;  3OIQ A;  5CVI A;  3DEU A;  4RLF A;  3P9C A;  2KIQ A;  3VOD A;  1OCO H;  3C2G A;  1FWZ A;  1FBU A;  2N8G A;  2E34 A;  2KIF A;  2E71 A;  3CCU I;  3X2Q H;  2HXI A;  1AKH B;  1XDU A;  2OZU A;  2ZJ2 A;  4HLY A;  4PJL A;  2DPU A;  1HKQ A;  4P9U A;  1T08 B;  2XV4 S;  3DTI A;  1A35 A;  5F0C A;  4AIK A;  4HYE A;  2Y75 A;  2PX9 A;  4IHS A;  4ON0 A;  2XF5 A;  4Y15 A;  2KLO A;  1ZTR A;  2DU9 A;  3C18 A;  3DKW A;  3M9A A;  2CO5 A;  4BU2 A;  3K70 D;  3CP2 A;  2V9V A;  3WE2 A;  1FOX A;  2DBB A;  5F1R A;  3CC4 I;  4I02 A;  1IN7 A;  2A6T A;  1LPQ A;  4HEA 2;  1GV5 A;  2NOG A;  2FNA A;  3IAS 2;  1ETO A;  3DTK A;  3TDZ C;  4ITV A;  3BG7 A;  2RNG A;  3CCE I;  3W2A A;  3FMS A;  1DDN A;  2P4W A;  3GTP J;  3IUO A;  1LDD A;  5CQE A;  1IXC A;  5IT9 K;  2IA2 A;  1HXD A;  4XN3 A;  2ZME A;  2HWV A;  3B02 A;  3HGG A;  1FOK A;  2JPB A;  1PP8 F;  3DWL E;  4BHP A;  5J40 A;  3FKJ A;  2ISY A;  2FU4 A;  4RLQ A;  3BR2 A;  1I3Q J;  1R5H A;  1TLH B;  3SJM A;  3L2W A;  2Y30 A;  1X2N A;  2LK2 A;  5EG0 A;  3ZQC A;  2CQK A;  4FAS D;  3IHU A;  4RBO A;  3EUK L;  1SVL A;  3K6G A;  2EFO A;  2F2E A;  4BYY A;  3LNQ A;  4V2F A;  3WU2 C;  2F4O B;  1WH7 A;  1RKW A;  2JUC A;  1FSE A;  2IJL A;  1E3H A;  4JX6 A;  2Z16 A;  1HBX G;  5DV5 A;  2E2I J;  1SVM A;  4ZYE A;  2DMT A;  5CQG A;  3GTG J;  1BI1 A;  3GYH X;  2HI3 A;  3FIW A;  2Z2S B;  3F6O A;  1JJ6 C;  4U7B A;  2CQQ A;  3A1Y A;  2M87 A;  4HSR A;  2VE9 A;  1LFB A;  3ZMV A;  2EZH A;  3KEY A;  2W24 A;  1S6L A;  3WTX C;  4E7K A;  3BJ6 A;  2KIM A;  4JQF A;  3A2K A;  2DFI A;  2M7A A;  3E6B A;  4NUB A;  4HV5 A;  4E7S A;  3H92 A;  1RKT A;  5DDG A;  2VJ5 A;  2L7Z A;  4QWQ A;  5JVT A;  3K4M A;  2DPD A;  3GTQ J;  4L0Z B;  2MD0 A;  3LST A;  4LGW A;  1HW5 A;  1SMY F;  2HQN A;  4A3C J;  1Z3Y A;  2LMD A;  4C2U A;  2EV6 A;  3ABU A;  3FXR A;  2LY2 A;  2ZFW A;  3HDD A;  4M6V A;  5GAG J;  4CHU A;  1JE8 A;  3RYP A;  4C2T A;  4NNJ A;  2XPU A;  3G71 I;  3D5L A;  2DOE A;  1P7J A;  5FKO A;  2ZJR F;  1J75 A;  1ZRE A;  3H3V K;  2BGC A;  3JSP A;  2F5E A;  3VB2 A;  1B6A A;  5BPI A;  3I56 I;  1Z7L A;  3O6B B;  4J01 A;  4F55 A;  2M8G X;  2DOF A;  4MHG A;  1I3A A;  2JSC A;  4AVZ A;  2IXS A;  2XGE A;  2PJR A;  3G1O A;  1R5I D;  1MMA A;  1KU7 A;  3FXO A;  1TWH J;  2W85 A;  3OSF A;  1ETK A;  1BL0 A;  2KDO A;  2ZSH B;  3FDY A;  1JI8 A;  2XB0 X;  3S3N A;  2R7S A;  2XAF A;  2BY0 A;  3H5A A;  2ZNY A;  2HR3 A;  2YS9 A;  3TP3 A;  2I5U A;  2KT0 A;  2M7B A;  1P2F A;  4HNT A;  5K7Z A;  3FXM A;  2IRF G;  2X0L A;  3TMO A;  4BL0 B;  2FQ4 A;  3V7S A;  2HTJ A;  3ZN0 A;  4IZZ A;  3J81 Z;  4XOR A;  4OIO F;  9ANT A;  4ZH4 F;  2JVH A;  3B73 A;  5C44 J;  2FE3 A;  3ONQ A;  2DAO A;  2VPR A;  1TP4 A;  1W36 C;  4AWX B;  1YOV B;  3F8C A;  3CUQ B;  3MD2 A;  1X4P A;  2NVQ J;  3PO3 J;  2CSO A;  3BR6 A;  3DCF A;  5IOY A;  4RGU A;  1SD4 A;  3E6D A;  2FD5 A;  4X0G A;  1JT0 A;  1RNL A;  3S16 J;  4P1W A;  1MBH A;  1WRJ A;  4K2E A;  2XGC A;  2QBY A;  3IAM 2;  4UV8 A;  4OOI A;  1O4X A;  2LP0 A;  1WJF A;  2DT5 A;  1BJA A;  4FCY A;  1FPQ A;  2V6C A;  1XMK A;  2XSJ C;  1S5L C;  4KIG A;  1FYL A;  2GIV A;  3HOY J;  2M30 A;  2X4H A;  3EPZ A;  4IVN A;  5HNH A;  4ENM A;  4LG0 B;  3S2H J;  4MIM A;  5M5W J;  1FYM A;  3TOB A;  4JP0 A;  1I6H J;  2VLA A;  1LNW A;  4BEH A;  4YRV A;  1BR2 A;  1XCV A;  4J00 A;  3CCY A;  2A6H F;  2ELH A;  2PMH A;  3L2R A;  4LG3 A;  2E1M C;  2KRH A;  3KIO A;  3A4C A;  3BTC A;  4I7H A;  1ERD A;  4MO7 A;  3QYE A;  4UB8 C;  2H1K A;  2LC2 A;  1GVJ A;  1BR1 A;  1R7J A;  3TBI A;  5DEQ A;  3ZQH A;  1T39 A;  1R5G A;  2X51 A;  3ELK A;  2W84 A;  3BG5 A;  3K2Z A;  2GWR A;  3L9F A;  1LVA A;  1B59 A;  2BZT A;  2L7F P;  3K1M A;  4BJT A;  5LHI A;  1GT0 C;  1YTY A;  2V1U A;  2VI6 A;  2XRL A;  3I55 I;  3L09 A;  1D1C A;  4CH7 A;  1D1A A;  2XDV A;  4M9Z A;  4CCM A;  5CLS A;  2A3S A;  3O8H A;  2FBI A;  2ZXH A;  3ZOB A;  5D4R A;  4XOT A;  3W2W A;  2R4G A;  3LSP A;  4A3B J;  2VKH A;  2R0Q C;  3I3L A;  4Y13 A;  5FLV A;  3HSF A;  1H89 C;  5J47 A;  1T95 A;  3LSI A;  2OPT A;  2OTL I;  2IGK A;  3WTV C;  1MMN A;  2R7U A;  3MZ8 A;  1LE8 B;  1LDK B;  1UAA A;  1HA8 A;  2BVL A;  2EV5 A;  4CSW A;  1XGO A;  5DM7 F;  2UUZ A;  2EFQ A;  3CF2 A;  2JT1 A;  2KZG A;  3ML6 A;  2WAE A;  3WTY C;  3JRH A;  3HJE A;  3F8M A;  5EZG A;  1P4W A;  3E3V A;  3MEX A;  3BR5 A;  4LJZ F;  4R1H A;  3VPR A;  3S17 J;  1DP3 A;  2VQH A;  3K10 A;  1J9I A;  2X6Y A;  2CQX A;  2CQ7 A;  4EM0 B;  5HS8 A;  3M4O J;  2HQR A;  3UR3 C;  2D5V A;  1Y39 A;  2YX7 A;  4EMS A;  5HS7 A;  1RES A;  4WK8 F;  3V8J A;  2UZK A;  1K78 A;  2HOT A;  4A0Y A;  4XLP F;  2OD5 A;  3C3W A;  4X6A J;  3OR2 C;  2MC3 A;  1A31 A;  2CGP A;  1JHH A;  1BIB A;  2OF7 A;  1R36 A;  2HOA A;  1F43 A;  1FTZ A;  5EGO B;  1IZ1 A;  2OBP A;  4A3L J;  1X1P A;  4EEF G;  2OTJ I;  5ILU A;  3K4J A;  1IV8 A;  3PNV A;  3HUG A;  5HLT A;  3L2C A;  1OYW A;  1R1T A;  4KIB A;  4X1E A;  4Y4R A;  5FKN A;  4UUT A;  2V7F A;  3RJP A;  2QZ8 A;  3B6C A;  3JR9 A;  2GA1 A;  3CDH A;  2P0W A;  5IYB J;  1TL8 A;  1PP7 U;  4RM3 A;  1EF4 A;  2EZK A;  3OL4 A;  1DGW Y;  2ME6 A;  1N77 A;  5C3E J;  2EFN A;  2RC4 A;  2B9S A;  4BH9 A;  1MJB A;  2HDD A;  2A61 A;  2LH9 A;  3M8F A;  3K70 C;  1RI7 A;  3LQQ A;  3A01 A;  5EGO A;  1GXP A;  4YIF A;  3CCQ I;  2WC2 A;  2R7O A;  1TWA J;  4M6Y A;  1B9N A;  4I76 A;  1QBJ A;  3KLN A;  3K4N A;  4XRS G;  1SAU A;  3DU6 A;  3OS0 A;  3T5X A;  4B48 A;  5LLQ A;  2XF7 A;  1VF9 A;  2P5L C;  1QVU A;  3NRV A;  2EFP A;  1VQ7 I;  1IO2 A;  2X1C A;  5DCM B;  4BXF A;  1MBF A;  2Y31 A;  1K7A A;  3G2B A;  4PJJ A;  4BKX A;  1R71 A;  2X1D A;  4UHT A;  4XLC A;  3HSE A;  3S3O A;  2VOD A;  2DMU A;  5ERI A;  1VI0 A;  4HF1 A;  4EM2 A;  2VPL A;  4MFE A;  2PI0 A;  4KJZ A;  1ONV A;  3OYL A;  2ZCW A;  1MBJ A;  3DPU A;  1MDM A;  4E4H A;  3CJT B;  2NS0 A;  3SYT A;  2FNP A;  1D5Y A;  1A6I A;  1KA8 A;  1YS6 A;  2ZO4 A;  3H9Q A;  1EH8 A;  2H6B A;  3E1S A;  4XLE A;  1FTT A;  4UUS A;  3S15 J;  4M3E A;  4DBQ A;  4QIW N;  4IL6 C;  3SZG A;  3F21 A;  1YRN A;  3S1M J;  2DMN A;  2VN2 A;  5GAH J;  4A3F J;  4G6D A;  3BG9 A;  1T2K A;  3OYF A;  1YFH A;  3CD6 I;  1EKE A;  1VQ9 I;  1MMS A;  3U9G A;  4Q48 A;  1S29 A;  2CV2 A;  1X1A A;  3SDG A;  1O3T A;  2JVG A;  1U5T B;  2KZV A;  2K4J A;  1ETX A;  3QU3 A;  3ULQ B;  4Y52 J;  2DTR A;  1LEA A;  1Z67 A;  3REO A;  2HOE A;  1BC7 C;  2L7K A;  1W5T A;  3G1M A;  3UNG C;  3V8L A;  4BQN A;  1W7P B;  2OQR A;  4NDL A;  2NVX J;  1ZK8 A;  3RCO A;  1MIJ A;  4E7Z A;  3SHF A;  1V4R A;  1IUY A;  4AIJ A;  3I4P A;  4BDZ A;  1BBY A;  1IF1 A;  2DMP A;  5E3L A;  5HOO A;  3COA C;  4BGD A;  2QGU A;  2OCC H;  4AD9 A;  4CZC A;  2X85 A;  2VQC A;  1ZG3 A;  4O3M A;  4L18 B;  3HOZ J;  2VOP A;  4B3A A;  4BNC A;  5M3M J;  4EGY A;  3CTA A;  1WWX A;  1K6O A;  2HVR A;  3JRD A;  4BAY A;  1A36 A;  4O6J A;  5IYD J;  1ZLK A;  2E19 A;  4AC0 A;  1Y1V J;  4LK1 F;  3J7A Y;  4PJN A;  2JWT A;  3ZQG A;  3LL7 A;  1G59 A;  1BIA A;  2H27 A;  4YFN F;  3LA2 A;  4EV0 A;  3OY9 A;  2WY8 Q;  3ASN H;  2EB7 A;  2H8W A;  2DJI A;  4L9N A;  2MG4 A;  4IQJ A;  3K2A A;  2HZT A;  4I99 C;  2W00 A;  3FKI J;  1RIO H;  5IP9 J;  5LGN A;  5E1W A;  1FBS A;  4GYG A;  1VQ6 I;  1E0E A;  5F6F A;  5LFA A;  3FBN B;  3LOC A;  1Z6T A;  1M1E B;  3BDD A;  2YU9 J;  5L3C A;  5HVQ C;  1W36 D;  3K1N A;  3ZMU A;  4JK1 X;  3TDU C;  2JA5 J;  3I5U A;  5HLI A;  4CO8 A;  2BYV E;  2F4I A;  2RN7 A;  4E70 A;  3S1N J;  5J8F A;  2V9P A;  4UB6 C;  3BTI A;  4CYD A;  2HGC A;  3CMY A;  3PJR A;  1JKQ C;  2E35 A;  3C2H A;  1HQC A;  2R7R A;  5DCF A;  1J2X A;  2FBK A;  5CKT A;  3S1R J;  2XKO A;  1F5T A;  1ZQ3 P;  3B6A A;  1JGG A;  2QSF X;  3S8P A;  4N0B A;  3BZK A;  2EK5 A;  1YX5 A;  1A04 A;  2ELK A;  2IS6 A;  3RI4 A;  1XCB A;  1ZKG A;  3SZP A;  1EA3 A;  2OJE D;  4A0Z A;  2F5D A;  1Y8R B;  4HX7 A;  1TT0 A;  2R7F A;  1C0W A;  3LFU A;  1OCZ H;  5FRO A;  5FKK A;  4IHX A;  4HBL A;  4RM2 A;  2Q0O A;  3ISP A;  4XK4 A;  4L9V A;  3DBH B;  4J19 A;  1Q1V A;  1KZH A;  4F91 B;  3FHN A;  4PSW A;  3JRA A;  1F36 A;  5FO5 A;  2K27 A;  3R60 A;  4FHT A;  2DFF A;  2BE5 F;  2L7M P;  1MZB A;  2OAZ A;  1B72 A;  4GGG A;  1XX5 A;  2TCT A;  1DP7 P;  4A0X A;  1X3U A;  2JA2 A;  3E6M A;  3LSJ A;  4RA2 A;  5K5O A;  1ZN2 A;  1GDT A;  2R93 J;  3HOV J;  1X1D A;  1YIO A;  3GME A;  3OYN A;  2HYF A;  1QU3 A;  2KPM A;  5D6F A;  4BQA A;  4PDK A;  2DK5 A;  4KUM A;  3FM5 A;  3S93 A;  2JA6 J;  1W7P D;  2LFB A;  1NH3 A;  4II3 A;  5DTD A;  5FB2 A;  4ZYH A;  1FIP A;  2CUE A;  4D0P A;  2O3F A;  2JK3 A;  4UVB A;  4F93 B;  1S3J A;  4QPO A;  2YUS A;  2XAH A;  4BQQ A;  2L9R A;  2HFH A;  1LEB A;  1GHC A;  2PMZ A;  5J4V A;  4RB1 A;  3CJQ B;  3T8R A;  1SFK A;  2M34 A;  1ETY A;  1XSX A;  4A5M A;  3H0G J;  1WJD A;  2F5V A;  2VKE A;  1PVE A;  3I58 A;  4HX4 A;  1LVK A;  4QPQ A;  3D5R C;  5IT3 A;  2K3F A;  2FOW A;  2MGQ A;  1PUF A;  2KIU A;  4LMY A;  3JRC A;  1I39 A;  1WGX A;  3GFM A;  4ESB A;  3T0Y A;  2F6C A;  3JRG A;  1IXS B;  3S1Q J;  5KK1 A;  3CUO A;  3KCC A;  2VXD A;  2X6W A;  1OCC H;  4IPA A;  1U9N A;  4LFU A;  4ZC3 A;  1PYV A;  3GEZ A;  5D5U B;  4IOC F;  1Z1D A;  2J5O A;  1MSF C;  2VC1 A;  2ESN A;  5IT9 Z;  3R61 A;  2JN6 A;  2PMZ N;  4V2G A;  5K7H A;  3I64 A;  1TWG J;  2P6S A;  5FLX K;  3VYT B;  3IL2 A;  1F1Z A;  3CQZ J;  3Q0W A;  1G2H A;  3AG4 H;  3KX2 A;  1P7I A;  3F8F A;  2PLY A;  2YPR A;  5F0H A;  1OYY A;  4NHJ A;  2NS7 A;  4Z2Y A;  2F5F A;  3U2R A;  2RV8 A;  4M6X A;  1ZR4 A;  1IAW A;  1UHW A;  1TBX A;  3D0S A;  3LAP A;  4BJ5 C;  1JTX A;  1TNT A;  1USS A;  3IC7 A;  4BXU A;  2O61 A;  3I59 B;  3IKV A;  3GZ6 A;  2ZSI B;  2DTZ A;  4HA8 A;  2Q2E B;  3BTL A;  1YHQ I;  3CUQ C;  2MH2 A;  3TO6 A;  4P96 A;  2L01 A;  1BOA A;  5L3F A;  4QLC U;  1RZ4 A;  3PQK A;  1R58 A;  1N78 A;  2FML A;  3JRF A;  5KAF C;  4KIS A;  1DU6 A;  4TV7 A;  4Q5S F;  1SMT A;  3FHZ A;  1ZGW A;  2VON A;  2JRT A;  3ZQF A;  4DGW B;  2BY1 A;  2R7V A;  2KL4 A;  4HNV A;  5H6Q A;  4DW6 A;  4PFO A;  2LSO A;  5EZH A;  1WJE A;  2E2J J;  1MH4 A;  2CUZ A;  2UXN A;  1AKH A;  4YII A;  2KQR A;  2XAJ A;  2COM A;  2LY9 A;  3VEP A;  5GAD J;  1VQO I;  3DV8 A;  2RNJ A;  4XRM A;  2G7U A;  4XKB A;  2JQ7 A;  2UV1 A;  3GXO A;  3J7Y J;  2DA1 A;  3C7J A;  3H0D A;  3G4S I;  2NNY A;  4B8X A;  3MCZ A;  4II2 A;  1EH7 A;  2VBZ A;  4G6Q A;  2JJ7 A;  3FMQ A;  1JT6 A;  2EA4 A;  5LGT A;  2LKP A;  4XKV A;  1NG7 A;  3BPV A;  4KT6 A;  4RAF A;  5A2Q K;  3HOX J;  4HW0 A;  1VQL I;  1WKM A;  2BW3 B;  3BTJ A;  3CC2 I;  2IP2 A;  1X3Z B;  2BXY A;  1ZYR F;  1Y1W J;  3CMM A;  2OUM A;  1DQU A;  5DM6 F;  4CCO A;  4ZDP A;  2XAG A;  4XLH A;  2GXB A;  1XSV A;  3KYC B;  5KAI C;  1UMQ A;  3BP8 A;  2CU7 A;  3QPT A;  1GXQ A;  4LLL A;  3TL4 X;  2E7W A;  2DA2 A;  3A02 A;  2CG4 A;  1D0Y A;  3OV8 A;  2VQL A;  2BHZ A;  2EIN H;  2WTE A;  2DW4 A;  1Y0N A;  2XVC A;  3O8G A;  4M3G A;  2IPQ X;  1QZY A;  5F1J A;  4HF0 A;  1FBQ A;  5DS9 A;  3CCJ I;  4CXF A;  3ZR8 X;  2BHY A;  1ZR2 A;  5HDK A;  1H8A C;  3P5J A;  2VKV A;  2HDC A;  3KEO A;  1CF7 B;  2B7E A;  1R23 A;  4BAC A;  1FY7 A;  3KYD B;  2PJP A;  1U0J A;  5FLM J;  1FMW A;  3VDX A;  3ZQI A;  4IHW A;  4IRH A;  4LD5 A;  1BC8 C;  4B43 A;  2VJI A;  1X1C A;  2O8K A;  4G6T B;  2HVS A;  1D3Y A;  3FK7 A;  3HRT A;  3VSL A;  5HLG A;  2GXA A;  3CF5 F;  1QZE A;  3MZH A;  3WG9 A;  3N05 A;  2OQG A;  4M3D A;  4PGG A;  1JHF A;  3TQN A;  1X19 A;  2WBM A;  1HKS A;  2XPW A;  2Y0M A;  2LF7 A;  3M1C A;  3MZY A;  3GVA A;  3N97 A;  4WCG A;  3MAJ A;  4XSZ F;  1IC8 A;  1OCP A;  4KNY A;  2M9H A;  2KDZ A;  3KP5 A;  2CS3 A;  2NVT J;  3JRB A;  1I1S A;  4MGR A;  1IUF A;  2NS8 A;  4XKC A;  2M0C A;  5E8G A;  3DEE A;  3BCA A;  4MFD A;  2WA0 A;  3TOA A;  3JAM Z;  2O9L A;  1F4K A;  4A3J J;  4FET A;  2JZY A;  3MVP A;  2FEZ A;  3WTU C;  3OYH A;  1MKM A;  4EJV A;  2L9V A;  3CLO A;  4R8H A;  5BMZ A;  4EQQ A;  2ZC2 A;  3AL0 C;  4L5J A;  2V1D A;  3ASO H;  3BZC A;  5HDG A;  4G12 A;  3RKY A;  2D1V A;  2LRE A;  3VYR B;  2Z1D A;  3Q3S A;  2CFX A;  3MKW B;  1LJ9 A;  2R5Z B;  3H9J A;  3LQR A;  2DXI A;  4ZDL A;  1ZRC A;  1OKR A;  1MGT A;  3BCB A;  4DNC A;  3HIF A;  4N4N B;  1TQM A;  4YFX F;  3GTK J;  2BEO A;  3ZMT A;  1VQ5 I;  1XGM A;  5FGM A;  4GO1 A;  3Q9S A;  3OR1 C;  2EQR A;  2CQN A;  1SEU A;  3FMR A;  3S3M A;  1QA6 A;  3PSI A;  3ZQQ A;  4EJT A;  1S8N A;  3Q0V A;  3PSF A;  3BR3 A;  1WPK A;  2JUG A;  2FSW A;  3QAH A;  5FD5 A;  4A69 C;  4HAM A;  1J0R A;  2LTP A;  5ED4 A;  4JX5 A;  3CME I;  4XRS A;  4BS9 A;  1P4X A;  2G0E A;  5JLW A;  3U21 A;  1U8R A;  2IW5 A;  3ZCO A;  3GTM J;  2L54 A;  5H6R A;  1Z7U A;  5LEJ A;  1Z3X A;  3SZT A;  3BG6 A;  1TNS A;  3KFW X;  1IW7 F;  3JAM K;  2WY7 Q;  1FX7 A;  1VND A;  3M07 A;  4RMN A;  3ABT A;  3MKL A;  3CUQ A;  3V7C A;  3HXL A;  1XN7 A;  2HEO A;  2LDU A;  3OS2 A;  4IKF A;  2CRG A;  3CO6 C;  1H9G A;  3AG1 H;  4F7Z A;  4MTD A;  2L0K A;  5IP6 A;  1P9Q C;  3ZMZ A;  4HPQ A;  1QPM A;  2Z99 A;  5FRN A;  3IRQ A;  3R4K A;  1YJ9 I;  2JA8 J;  1SC7 A;  1XGN A;  4FTH A;  1AWC A;  2IVM A;  2ID3 A;  5KCM A;  2R7Z J;  3ABL H;  2X9D A;  3F8B A;  3CMA I;  3FIS A;  4M74 A;  5JR3 A;  3TW6 A;  4UVA A;  4GXO A;  2EBI A;  1JKO C;  3L7W A;  1MMD A;  1E3O C;  3CLQ A;  3F0C A;  1WSU A;  2KP6 A;  2IT0 A;  2RGV A;  2OA4 A;  3ERE D;  1ETW A;  2KJC A;  1UG2 A;  3DFG A;  3OOP A;  4UY8 I;  2PBI A;  2FBH A;  2VL8 A;  1G3S A;  1EV7 A;  4LG0 A;  1U5T C;  1QZZ A;  2P81 A;  3S2D J;  4LK0 F;  5B5E C;  1OIS A;  4LB5 A;  1Z21 A;  1OMI A;  2X6X A;  4BE1 A;  3GTL J;  5HLH A;  2LD5 A;  4DJA A;  2R5Y B;  3J80 Z;  4KA4 A;  5F04 A;  1KQ0 A;  5E3O A;  1T38 A;  1R6R A;  4LOC A;  2R92 J;  4B1R A;  3RZD J;  1XSD A;  4U0Y A;  5EEA A;  2DDB A;  1VFC A;  3GFJ A;  1JXS A;  4F92 B;  5DYM A;  4KMU X;  3AAF A;  1B8I B;  2UXX A;  2WB1 A;  1XTA A;  3U1K A;  3IWF A;  2QQ8 A;  2KMU A;  4BBS J;  1XDS A;  1LUJ B;  3I4N J;  3E97 A;  4KN4 X;  2E7X A;  4IHY A;  4D5F A;  4DYQ A;  4PZJ A;  3H5N A;  3ZQL A;  1YW8 A;  2K7L A;  3ZMD A;  5GP9 A;  3HM5 A;  3OYG A;  2HYJ A;  4XL9 A;  4XRF A;  1QO0 D;  1D8J A;  1LDJ A;  4FX0 A;  1G3W A;  4CIC A;  1G3T A;  4ZTF A;  4I09 A;  4HST A;  3ZQ7 A;  2HVQ A;  3BJA A;  3RYR A;  4C3I J;  2O5R A;  5BPD A;  1LE8 A;  1WQ2 A;  1QGP A;  3KP2 A;  1KGS A;  2CW0 F;  5L3E A;  5HNF A;  2W82 A;  1MJ9 A;  2QWW A;  3LSG A;  4H0E A;  1HOM A;  5IP7 J;  1FJL A;  4WXC A;  2Z5U A;  2K9S A;  2WB1 N;  3FBI B;  3AL0 B;  1KON A;  4I0A A;  4MLO A;  2RKH A;  4HV6 A;  2O7O A;  4E7H A;  2R3S A;  3BR1 A;  2V9K A;  3HEF A;  2E1C A;  3BRO A;  3FXU A;  3J80 K;  1R1V A;  4Y33 A;  4JOM A;  3WTS C;  1B1B A;  2NYX A;  2H09 A;  3SFI A;  1VQP I;  2Z9O A;  1UJ8 A;  4A3D J;  1ZLJ A;  4IXA A;  3LSM A;  1SAN A;  3WE3 A;  1WHU A;  1BI0 A;  2FA5 A;  2XGX A;  5FKM A;  1MNM C;  4A3E J;  2QSH X;  3QOE A;  4IHT A;  5K7F A;  2L4A A;  4L9T A;  4OWR B;  1ENH A;  2AQE A;  3WTW C;  2EPF A;  2DN0 A;  2K86 A;  2M4G A;  3HRM A;  1E17 A;  3CDL A;  2I10 A;  4CZZ A;  2K85 A;  2YU3 A;  2EIL H;  4MQV A;  1FYK A;  4WX9 A;  3TW7 A;  4WF2 A;  4BHC A;  4ENJ A;  3H3U A;  4H4K C;  3CJR B;  3OYM A;  2AXT C;  1DU0 A;  4IEJ A;  4IQ4 A;  3T8T A;  3BWG A;  2ELJ A;  5LRR A;  2A68 F;  2FF4 A;  1AOY A;  3MQ0 A;  1G6N A;  1PDN C;  2EIM H;  4CUG A;  2PG4 A;  1BI3 A;  2I8D A;  2NXN B;  5KVR A;  2QSG X;  3K4L A;  3IWZ A;  1JUM A;  5E18 F;  2X6O A;  4PK4 A;  4G94 A;  4OAY A;  5IY5 H;  1KQ9 A;  2ZJQ F;  1UZC A;  2E1O A;  1VQ4 I;  1I27 A;  1R4M B;  1POG A;  5DCM A;  2LVS A;  2K02 A;  3QWL A;  1SD7 A;  2D1H A;  1WCM J;  5EJC A;  4IF4 A;  3VWB A;  3GZ5 A;  5LD2 C;  2EA2 A;  4PUS A;  2LY1 A;  1UST A;  1G4D A;  3BR0 A;  2VC0 A;  4B44 A;  5ICE A;  1Z6R A;  1ZGJ A;  3OMY A;  1O7L A;  3OYK A;  5JFR A;  2IA1 A;  4IHV A;  4FE7 A;  1N75 A;  4KT5 C;  5J3L A;  2DYR H;  4UNO A;  1ETV A;  4B09 A;  4FX4 A;  2KRC A;  1O3Q A;  1XS9 A;  3WG7 H;  5FRM A;  4M3F A;  1B9M A;  1HSJ A;  3EET A;  4RAG A;  3ZN1 A;  1IRZ A;  2VT2 A;  2O6G E;  4LLN A;  2VJJ A;  5EDN A;  3LSK A;  4MEX F;  1IGN A;  2FJ1 A;  2KHM A;  4OAZ A;  1X58 A;  4XBF A;  3OOU A;  1CQT A;  4PFP A;  3IH2 A;  4XMY A;  1U5T A;  2MYS A;  1U78 A;  1WZ2 A;  2QQA A;  3LA3 A;  2W1O A;  4XQF A;  1VQM I;  1HDD C;  1UCR A;  5IPA A;  5JI6 A;  1T0F C;  1T56 A;  2DCE A;  1SVO A;  1W7P A;  2XAU A;  3K9T A;  3DPL C;  1ZG1 A;  4IOA F;  5F0F A;  2D2W A;  1J5Y A;  1APL C;  4ANJ A;  1VQK I;  1Y6I A;  1ACI A;  4M72 A;  2LNB A;  1QHH D;  2HYG D;  2VIX A;  3F6V A;  3HHG A;  3M8J A;  4I01 A;  1TZL A;  1YIJ I;  1S72 I;  4Y3O A;  5GTH C;  5GPA A;  2Y69 H;  3F8N A;  2ID6 A;  5E20 A;  5TGT A;  5DD4 A;  3QPS A;  4P5O A;  3CC7 I;  4U87 A;  1GLN A;  5H20 A;  4C3J J;  5IYC J;  3HKZ A;  3IV5 A;  4CCN A;  2UWM A;  2WAD A;  3HTS B;  5JLX A;  1ZG5 A;  2JTV A;  2ECB A;  3DTE A;  5AON A;  1W5C C;  2A07 F;  1XG1 A;  2ETH A;  3GZN B;  4CYC B;  4EAT A;  1L3L A;  1H9T A;  4D7M A;  1OPC A;  1ZEL A;  1AA7 A;  1FIA A;  4XLA A;  3TED A;  4OIN F;  3SXY A;  1NK2 P;  2IGM A;  4PSX A;  3PNY A;  2QEX I;  2GBY A;  3BY6 A;  3LSH A;  4YEL A;  2HQA A;  3C1D A;  2RQQ A;  3O3K A;  2ZXI A;  3EYY A;  2LBF B;  1HST A;  3ZRG A;  1P4A A;  3NEU A;  2OU2 A;  2DI3 A;  3JCU C;  3LFK A;  2CV1 A;  3NWT A;  3J7A O;  2XKP A;  3HKZ N;  3FK6 A;  2IGO A;  3RPU D;  2Q1Z B;  4CYC A;  3CES A;  2H6C A;  4FIS A;  5FD6 A;  4KMF A;  3DF8 A;  3GFL A;  4M71 A;  1FSH A;  1S7A A;  2STT A;  1L0O C;  1ZHF A;  2E60 A;  4HF2 A;  3HZJ A;  2JA7 J;  3BQZ A;  1FP2 A;  1VZ0 A;  4NC8 A;  5CYV A;  2LKS A;  1S7O A;  2LYC A;  4ENN A;  4LIU A;  4PJ0 C;  2DLL A;  3HG9 A;  1IRG A;  2AO9 A;  1BI2 A;  2F5C A;  4OIQ F;  3MWM A;  3KP4 A;  2L02 A;  1IJW C;  2P5V A;  5ICF A;  5JHF A;  1NK3 P;  2DYS H;  3QOP A;  4MEY F;  1V5F A;  5FLX Z;  3F22 A;  2FXA A;  1QVT A;  1HDP A;  1GVD A;  2HS5 A;  4HZF A;  1B4A A;  2XGD A;  2Y0S A;  3A0H C;  1D0Z A;  2MC4 A;  5J1Y A;  4ESJ A;  1IG7 A;  3TP0 A;  5CVV A;  2GOM A;  2RVC A;  1JKP C;  2G7H A; 
#chains in the Genus database with same CATH homology
 1VQM I;  5GAG J;  5GAE J;  3G71 I;  2ZJR F;  3I55 I;  1VQ7 I;  4IOC F;  1YJ9 I;  4IOA F;  2E35 A;  3I56 I;  1FOW A;  1VQK I;  1ACI A;  1YIJ I;  3CMA I;  1S72 I;  1FOX A;  1FOY A;  3CC4 I;  3CF5 F;  2OTL I;  3CC7 I;  3CJT B;  1YIT I;  4UY8 I;  3CCE I;  3CCV I;  5DM7 F;  1YHQ I;  1YI2 I;  5GAH J;  3CCR I;  2ZJP F;  4IO9 F;  1VQ9 I;  3CD6 I;  1MMS A;  1VQ8 I;  5JVG F;  2NXN B;  2QEX I;  1Y39 A;  2ZJQ F;  2E36 A;  5GAD J;  1VQ4 I;  3CCL I;  1VQO I;  2JQ7 A;  2QA4 I;  3J7Y J;  1YJW I;  1YJN I;  3G4S I;  3PIO F;  2OTJ I;  1VQ5 I;  1VQL I;  3CC2 I;  1QA6 A;  3PIP F;  5DM6 F;  3DLL F;  1HC8 A;  3CME I;  3CCM I;  2H8W A;  1VQN I;  4V19 K;  1VQ6 I;  3CCJ I;  3CCQ I;  3J7Z I;  2K3F A;  2FOW A;  2E34 A;  3CCS I;  1VQP I;  3CCU I;  3G6E I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...