4KICA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-methionine and phenylpyruvic acid
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
334
structure length
334
Chain Sequence
EVSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 116
structure length 334
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kicA01
2P6TA 2K4JA 2Z5UA 5L3DA 4HOBA 4OU0A 2D45A 1KQ8A 2QWWA 4UVBA 4BYYA 2DAOA 3MQ0A 2VBZA 2XUBA 1O3TA 2GAUA 2HOEA 2QQAA 3TO9A 2OZUA 1G4DA 4A5NA 1IW7F 1P2FA 4M9SA 5DV5A 5FFXA 4O6JA 2P8TA 2STWA 1P4XA 2DLLA 4MQVA 2FMYA 1BI2A 3BP8A 1K78B 3J80K 3MZHA 5FLXK 2W57A 2NYXA 1IN5A 3F3XA 2QM3A 2WWYA 5K5OA 4MNUA 2IT0A 4CO8A 4D0PA 3QAHA 2OBPA 3IC7A 2J5OA 1R5HA 5DUIA 3BJAA 4M73A 3L9FA 1S7AA 1J2XA 1RZ4A 5D6FA 2GZWA 3GZ6A 1PUEE 3LAJA 3BZ6A 1WWXA 2E7WA 3V4GA 1F4KA 1ZRFA 5K5QA 4LFUA 2Y48A 4HX7A 4TV7A 5ICGA 3IRQA 1L3LA 3WTUC 2B0LA 1MDMB 1HW5A 4M9XA 5JI6A 4ENMA 3QP6A 4KT5C 1T38A 2PG4A 2DO7A 1K7AA 1LDKB 3RKWA 3WTYC 5L3EA 4LB5A 5H20A 3FXUA 1EV7A 3FM5A 2QZ8A 2EFQA 1YW7A 3I64A 3I53A 3M8FA 2QVOA 4WXCA 2WV0A 1MGTA 3MWMA 4CXFA 1T98A 1KU9A 1FOKA 3TGNA 3P9KA 5FD6A 4KA4A 3KFWX 1JXSA 2QENA 4GCVA 4O3MA 5AONA 3B02A 2FNPA 3F23A 4OOIA 1WRJA 2CWEA 1LNWA 4RGUA 3RYPA 1BC7C 1XSDA 2ZJ2A 5E1WA 2P6SA 4XBFA 1FWZA 2VT2A 2M30A 4RGSA 4Z2YA 4EM2A 3GO5A 1ZG5A 5HS9A 2BGCA 2RKHA 4E70A 1QPMA 1J59A 2JPBA 3WU0A 5ILVA 2UWMA 1P4AA 2X4HA 3EQLF 2XAQA 5BPIA 3ULQB 1OYIA 3F8BA 3JW4A 3GFIA 5HDGA 4U88A 1OYWA 1MD0A 2BE5F 4IHSA 2JTVA 3O3KA 5BS6A 1SD7A 4A6EA 1OPCA 5K5RA 4EGYA 1FPQA 2OD5A 5DD4A 1Q1HA 2Z99A 3TDZC 3CDHA 4L9TA 3KZYA 2ZMEB 2DT5A 1QQIA 3V8JA 1HW1A 3BPXA 2XAJA 3JAMK 4YFNF 2RV8A 4ZZLA 2XKOA 3KEQA 5D5XB 4XLNF 2ZBKA 3KETA 4L5IA 4GGGA 1LB2A 2A07F 3E6BA 1FYKA 1YTYA 3M8EA 2L3DA 4I09A 3MEXA 3P9IA 3WGGA 2ACJA 2R7DA 2HTJA 2EFWA 1SMTA 1ZRDA 1YW8A 2A68F 2P5LC 3L7WA 2OZ6A 4UUVA 2FXAA 4LGWA 3GF2A 4A0YA 2JRTA 4A5MA 1SFUA 2EA4A 3F6VA 3KP6A 1FBSA 5D8KB 3G73A 4I0BA 3KP2A 3M1EA 1RIOH 5HOOA 3LA3A 1PDNC 2VONA 2RQPA 1J0RA 1TTYA 1V4RA 2QUFA 4HV6A 2IRFG 1YG2A 1FLIA 3F6OA 5JVTA 4RGRA 1G3SA 3ZN1A 1TNSA 2H09A 1FSEA 4HQMA 5TRDA 4P55A 1IXSB 3GZ5A 1U78A 2IA0A 1Z6TA 3F8CA 1BM9A 3LQRA 5LLQA 2EWNA 1K79A 1IXCA 4GO1A 4K2EA 1CGPA 4PZJA 2MH2A 1U8RA 2ZKZA 2MLKA 3M9AA 4KMUX 2NS0A 1KU7A 5ED4A 1YS6A 2XAGA 4AIHA 3ZPLA 2E1NA 2DQLA 5A2QK 1FYLA 3G3ZA 1LDDA 3IWFA 2G7HA 2GWRA 5DEQA 1P6RA 2MA3A 3FHZA 1IRFA 5BQTA 1Z9CA 3O2PE 3TO6A 3F72A 3MAJA 1Z7UA 5L3BA 4L0YB 5CLSA 3WGIA 2QBYA 5ILSA 2L4AA 3KZZA 1OMIA 4L5JA 1S8NA 4ENNA 4UV8A 1F1ZA 4AWXB 5FFZA 4HAMA 2FQ3A 4GXOA 1EH6A 3RI4A 4WWCA 4EJTA 2O6GE 3R6SA 3V7RA 2V1XA 3CUQB 1HKSA 3MCZA 4KIFA 3KP3A 4RS8A 5CJ9A 1F5TA 1XMKA 1IZ1A 3QOPA 4EGZA 2H6CA 3HUGA 2IA1A 2VBYA 3QPHA 5D5WB 2P7CB 1JHHA 3W6KB 1B1BA 5CVIA 2HKXA 5ICFA 4HYEA 2VXZA 5BPDA 1TLHB 2ZNZA 2DI3A 1LVAA 2LF8A 2V1UA 3HSEA 1XB4A 2GA1A 4N0BA 4YFKF 1BI3A 3BROA 1YFHA 4PCQA 4MGRA 1TBXA 5L3GA 2QQ9A 2WTEA 1AOYA 1P92A 5IT3A 3OV8A 1O7LA 4KNYA 2D2WA 1W4MA 3KLNA 1BIAA 1BC8C 4FT8A 2PMHA 5D6EA 2DTRA 2VE9A 1MJ9A 2VT3A 3ISPA 2XIGA 4ZYDA 1E17A 2X0LA 2CW0F 2ISYA 4CHUA 1D8JA 5LGNA 3U9GA 5D4SA 1ODDA 2DFIA 1OYYA 1RUOA 1W7PA 3I71A 3P9CA 3GFLA 1S7OA 3H3UA 4IRIA 4KFCA 2J5PA 5KVRA 4KICA 2XVCA 1V3FA 5JHUA 2QYOA 4G8XA 4BH9A 4ZZDA 2ELHA 1KYWA 2ZCWA 4XLPF 4WK8F 3EDPA 3I4PA 4RAYA 1R58A 1B6AA 5E8IA 3ZMUA 3V7CA 2IA2A 4ESBA 3HOSA 2EFNA 2KRFA 4NB5A 1R1VA 4B09A 4YIIA 2VODA 1QZYA 4HA8A 1A04A 1FP1D 1TNTA 4JQFA 2RN7A 2VBXA 4ESJA 2KKOA 4Y17A 4OIPF 3FWEA 4HX4A 1HW2A 3ELKA 4L9NA 4HF2A 2WC2A 2VE8A 3I54A 4IRGA 4G7OF 2A6EF 2CSOA 3T0YA 1JHFA 2PEXA 1Z1DA 4Y15A 4M6YA 3J7AO 4UV9A 1O3RA 3SXYA 3OOPA 3F8NA 2BEOA 3GVAA 4EJOA 1SD6A 2FSWA 1HBXG 5HLIA 1ZHFA 1O3QA 2V6CA 5HLGA 3HTSB 1OKRA 2XKPA 3FF5A 4ETSA 2YSRA 1VTNC 3IHUA 4EJVA 3T8TA 1XDUA 6PAXA 2JT1A 4BNCA 1FP2A 3QRFF 2BYVE 1KQ9A 2STTA 1ZAOA 2DPUA 2CO5A 3I5UA 3WTXC 4M6XA 3DXJF 5ILUA 4U0YA 1FX7A 2QBYB 4U0WA 2FE3A 1XGMA 1LEAA 3LWFA 2QQBA 3DFGA 1EH7A 3EUHA 4GYGA 4HX8A 3COAC 3RYRA 1JE8A 1D8KA 5L3FA 1HSTA 1SFEA 5E1XA 5LHIA 2FRHA 1F9NA 3R4KA 1WQ2A 3B73A 4XSXF 2IP2A 1GHCA 1FY7A 4KMFA 3EYYA 5JR3A 4XSZF 2BV6A 2JZYA 2HQNA 4LLLA 3GEZA 3I58A 4IPAA 2V79A 3F22A 1E2XA 4RGXA 3HRSA 1T0FA 1EH8A 2XGXA 2IVMA 2ZNYA 1FNNA 1UHWA 1LEBA 2L4MA 3HRMA 4IF4A 1BOAA 2OQRA 3E6CC 3BOQA 2L01A 2MBFA 1FBQA 2MH9A 3GXOA 3WU1B 4ENKA 2LDUA 4WF2A 1WKMA 1ZN2A 4M74A 3HSRA 4CICA 3HIFA 3QPTA 4HLXA 3HRTA 2PLYA 1UHMA 4KN4X 3T1BA 4R1HA 3VFZA 1QNTA 2M5WA 1XD7A 4A2UA 3WODF 3ZMDA 3KP5A 2K27A 2P5VA 3ECHA 1CF7A 4I98B 2ZFWA 1W7PD 4HW0A 1LQ1A 2W25A 2NNNA 3QP5A 4BQAA 4LJZF 3K0LA 3P7NA 3LAPA 2P4WA 4KUMA 4OINF 5CVUA 1I27A 2FBHA 2Q0OA 4LB6B 4IHTA 3K69A 2VBWA 1H9GA 1MJBA 1IN6A 4WXDA 5AIPA 3T8RA 4GYIA 2CGPA 4Q4ZF 3IWZA 4KIBA 5HLHA 2UZKA 2MLGA 3FMRA 2KJCA 2TDXA 2GA2A 1XDSA 2CG4A 1TW2A 3BPVA 5D8LB 3WTWC 3F21A 1IAWA 1U2WA 4JBAA 1K78A 4OIOF 4OMYA 1U5TA 1UB9A 3U2RA 3KEOA 3U1DA 2NNYA 3CLOA 2YR2A 3FMSA 3CO6C 3ECOA 1KA8A 1UCRA 3V7SA 1DUXC 4OIQF 3SZTA 2XAHA 3GYHX 2EFPA 2ISZA 1B9NA 2FBIA 2FNAA 4HDUA 2GQQA 3VB2A 5LEKA 1R1TA 3E3VA 1H9TA 2F5DA 3HTUA 4ZYHA 3ABUA 2BBYA 4QLCU 3BY6A 3ML6A 2IJLA 1STZA 1RI7A 3FX3A 2A5YB 1IN8A 5LGTA 1IUYA 4AIKA 2JPCA 3L00A 4L9JA 1ZH5A 1JGSA 4LG0A 1SMYF 5H6QA 1R5GA 3FXRA 1FZPB 4PGGA 4CDGA 2A3SA 2FBKA 2OQGA 2O8XA 1U5TC 1Z6RA 3LA7A 2FF4A 5L3CA 3JTGA 3GX4X 3R0AA 3IKTA 2YX7A 3GUDA 3ZMTA 2PN6A 2EV0A 2DQRA 3BJ6A 5DDGA 4UVCA 4HF0A 5ICCA 5HDNA 2RVCA 4RB1A 2IW5A 2VC1A 5KK1A 1MJAA 4A0ZA 3JSPA 3C18A 4UXNA 1BBYA 3RKYA 1ZGAA 1ON1A 3DKWA 1RNLA 3DPTA 1USTA 1IRGA 2ZO4A 3E6MA 2W84A 1P4WA 2LF7A 4EV0A 2G7UA 3TQNA 5E1ZB 2F5FA 4ZYGA 2FOKA 4MEXF 4I01A 1DP7P 3REOA 3O6BB 3LSTA 4I0AA 1HXDA 2EK5A 2F5CA 2Z9OA 1XN7A 2ESHA 2PBIA 5FGMA 1DPRA 1R7JA 3V8KA 1T2KA 1YYVA 3T5XA 2EB7A 2P5KA 1QBJA 1BI1A 5D4RA 3W6JB 3C3WA 1TW3A 3R0JA 4CYDA 4L18B 4HLYA 5DCMA 1R22A 5LGUA 5JFRA 1ONVA 3K1NA 1HSJA 4MTEA 3TO7A 1REPC 1S6LA 1USSA 3NQOA 2MD5A 5FB2A 2PFBA 2D1VA 4Y13A 2ZMEA 1L0OC 4EVIA 2FMLA 5LHHA 1IN7A 2XRNA 1C0WA 4MQ9F 2EV5A 1QGPA 3FZVA 3RPUA 3L2CA 2PMUA 2NRAC 4NQWA 4BHPA 1J5YA 2M8EA 3SZPA 4XRFA 2K4BA 2GXGA 5BOXA 2Y75A 3E97A 2LNBA 5E20A 1G6NA 1W5TA 1Z91A 3ZMSA 1SFXA 1I1SA 2F5EA 1YQAA 3HOTA 2M45A 3F8MA 4U7BA 1KGSA 3GFJA 1X3UA 4BXUA 3DQVC 4A6DA 1FBUA 2HEOA 1XMAA 2PI0A 1GXQA 3KCCA 1IN4A 2Q2EA 2R7FA 1QZZA 1XGOA 3GLXA 2MC3A 1LDJA 5E8GA 1R36A 2K86A 3E5UA 1TQPA 4PDKA 1GVJA 2F2EA 2G9WA 2O3FA 3ZN0A 2H27A 1H0MA 1G3WA 3I59A 4UHTA 5HVQC 3SHFA 4KYWA 3V8LA 2V1DA 1D3YA 3N97A 1U5TB 2K02A 4CZZA 4O5VA 4LLGF 4LLNA 4A12A 2NAZA 4QWQA 3EETA 4P9FA 1KU2A 2HGCA 3J80Z 5FLXZ 2DBBA 1B4AA 1KQ0A 1ZRCA 1I1GA 1S29A 5LRRA 1XGNA 1NHAA 4G6QA 3MFKA 4KDPA 4FHTA 5BMZA 2KIMA 4AVPA 1YS7A 1B59A 2C6YA 1W5SA 2OA4A 2O0YA 4EM1A 1SD5A 1SD4A 3C7JA 4JK1X 3JSOA 4IRHA 3N4MA 4G94A 1SAXA 2DPDA 3I0TA 5LHGA 4R8HA 3CJNA 4M9ZA 3WTTC 4N9HA 3RKXA 4ON0A 5LEJA 4Q48A 3WG9A 1I5ZA 5IT9K 1G3YA 1R00A 3ZMVA 4LG0B 1ULYA 3TOBA 4EJWA 2VOOA 4ESFA 3D5LA 3TOAA 4M71A 5IT9Z 3KP4A 1FSHA 2DW4A 3WGHA 4NHJA 4U0VA 5J6XA 2XASA 1T6SA 3HYIA 5LBQA 3Q5FA 2E7XA 1BN5A 1YIOA 3WE3A 4WX9A 3FM3A 3E5XA 2P7VB 2QLZA 3CTAA 5FO5A 5HDKA 2M1BA 3C1DA 4ASNA 3ZP5A 5DYMA 4LMYA 3IKVA 4U7DA 1XSVA 3CUQA 4RAZA 5F6FA 4HBLA 3EYIA 4KIGA 4Q5SF 4L0ZB 2Q8KA 5E17F 2YPRA 1MKMA 4P96A 2IPQX 3VODA 5F64A 3DEUA 2XAFA 3PQJA 4LK0F 5DCFA 4H0EA 5K1YA 2KJBA 1WSUA 1R23A 3Q9VA 2CFXA 1KU3A 5E18F 4EMSA 5CYVA 3ZMZA 2GIVA 3SFZA 2FU4A 1FYMA 3WTSC 3LQQA 1BIBA 2DK5A 1AWCA 2HR3A 3DPLC 5DCMB 3K9TA 5AIQA 4ZYEA 2O61A 3DP7A 1ON2A 2D1HA 3WTZA 1T39A 2RGVA 2E1CA 3HHHA 1ZLJA 3ABTA 3CUQC 1WI9A 4YG2F 1TQMA 3Q9SA 4S05A 2ESNA 3HHGA 4G7ZF 1LJ9A 5DD8A 2O03A 1DDNA 1OR7A 3HSFA 4HZFA 4G6DA 5FD5A 1Z05A 1ZREA 2EJRA 3DF8A 4S04A 3JAMZ 1O3SA 3AAFA 2HDCA 1W7PB 5TJJA 3M7GA 1Y0UA 3PFIA 1IF1A 4RB3C 2HKOA 5ICEA 4EJUA 2A69F 3QU3A 2H6BA 3QU6A 3E5QA 2HZTA 3K1MA 1G3TA 3TDUC 2KIFA 4B8XA 4AIJA 5HS8A 3ERED 1U3EM 1TQIA 2RNJA 1HKTA 3F8FA 3K2ZA 1QO0D 3H92A 2W85A 4MEYF 3GW2A 2YX4A 4ZH4F 3CUOA 3TKYA 1J75A 4P9UA 4LD5A 3LFKA 3L09A 4BHBA 3ZQ7A 2RC4A 3J81K 5HS7A 3CO7C 2Z3YA 3VOEA 1K6OA 4EQQA 1BJAA 2Y0MA 4I2OA 3KLOA 5D5VB 4HV5A 3J81Z 3FMQA 3BJOA 4MHGA 1GXPA 2ETHA 3I59B 5CVRA 4AD9A 2JSCA 4KN7X 4DQ2A 4DNCA 4A0XA 2HYGD 1ZYRF 2HQRA 2L02A 4M72A 4YIFA 4MTDA 4G7HF 1FC3A 2A61A 1ZG3A 4WXHA 4PGHA 2DK8A 2VN2A 2AXLA 3KE2A 1RUNA 1UFMA 1MDMA 1ZARA 1ZLKA 1DPUA 3E6DA 4RB0A 1YLFA 2A6HF 2PJPA 4P5OA 1YO5C 3WE2A 2HFHA 5EEHA 1O57A 3MZYA 1HKQA 3WTVC 4FX0A 4HQEA 4IXAA 3RJPA 3HRUA 2V9VA 5EEGA 2EFOA 5A2QZ 2VC0A 4F7ZA 2CQKA 1XCBA 4Q47A 4WCGA 3BDDA 4OIRF 3SQNA 1I6XA 3LA2A 2ADUA 2LKPA 2LSOA 2AS5F 5LRSA 4ENJA 5ERIA 4G9YA 2KIUA 2YU3A 4HF1A 1IXRC 4L9VA 5F1RA 1O7FA 2EV6A 4RB2C 2M87A 4N9IA 5J8CA 1ZGJA 3K1PA 2HS5A 2K7LA 3JTHA 2CYYA 4BHCA 4YFXF 1PP7U 3S2WA 2COMA 3R61A 2ZXJA 1KYZA 3VEPA 2UXXA 2RDPA 4I02A 3NRVA 4IVNA 1YW9A 4LK1F 5J8FA 1XCVA 5CVVA 3NEUA 3RPQA 2XV4S 4EM0B 4R79A 3RTRA 4HDVA 1MZBA 4OMZA 3D0SA 2Z33A 4IJAA 3GWZA 2FEZA 3GFMA 3RIRA 2H94A 2XHKA 4UVAA 2VOPA 2FA5A 2HYFA 2OU2A 5H6RA 2XROA 1XSXA 3BWGA 3R60A 1FT9A 3KP7A 1HQCA 1BI0A 4UNOA 5CVJA 2EA2A 1B9MA 3ROUA 3RDIA 3IRRA 3H3ZA 1J7KA 1CF7B 2L54A 1R1UA 2GXBA 3FXQA 3PQKA 2HWVA 1ZG1A 5DUKA 2R3SA 3IL2A 2DU9A 1D5VA 1U6GA 2HTSA 3DV8A 2PQ8A 4BAYA 1PP8F 1XGSA 2OAZA 2UXNA 4I7HA 4CGZA 4FX4A 1S3JA 5D5UB 2W24A 1J9IA
chains in the Genus database with same CATH superfamily
3CESA 5DTDA 1RR8C 2LFBA 3HB9A 2P6TA 4F52A 2K4JA 4IZZA 2Z5UA 1NG6A 5L3DA 4HOBA 3GTOJ 4OU0A 1DU0A 2KT0A 1MMNA 2D45A 1Z67A 1KQ8A 1ETKA 2QWWA 4UVBA 1OQYA 4BYYA 2DAOA 3MQ0A 4DGWB 2DXIA 2VBZA 3K4BA 2XUBA 1O3TA 1UZCA 2GAUA 4DZPA 2HOEA 3TL4X 2QQAA 5EG0A 4YIRX 3K4JA 5E3MA 3TO9A 4J00A 1GUUA 2LR8A 2OZUA 1G4DA 4A5NA 1IW7F 1P2FA 1D0ZA 3DKXA 1IV6A 4M9SA 3BR6A 2HDDA 5DV5A 5FFXA 2Y9ZA 1POGA 2P0WA 3S2DJ 4M3DA 4O6JA 1QVTA 2P8TA 2STWA 4YEJA 1P4XA 1G2HA 2DLLA 4MQVA 2FMYA 2L9VA 3CMAI 1BI2A 3BP8A 5GAEJ 1K78B 3L2RA 1QHGA 5KHDA 3J80K 3MZHA 5FLXK 1PJRA 2W57A 2NYXA 2X1DA 3G4SI 1IN5A 3F3XA 2QM3A 2WWYA 1TWCJ 3L2UA 5K5OA 4MNUA 2IT0A 4XL9A 2BXYA 4CO8A 4D0PA 2NVXJ 2HXOA 1X1DA 3QAHA 2OBPA 3IC7A 1X2MA 2J5OA 2X6OA 3U21A 1R5HA 2CUJA 1MBHA 5DUIA 3BJAA 4M73A 3L9FA 1S7AA 2Z2SB 3H9QA 1ITYA 1J2XA 1RZ4A 3S3OA 5D6FA 2GZWA 2HVRA 4MO7A 3GZ6A 1UHSA 1PUEE 3E1SA 3LAJA 1SC7A 2R7WA 3HOXJ 3BZ6A 1WWXA 1EA3A 2L0KA 1VQNI 3EUAA 2E7WA 3ESWB 3V4GA 1F4KA 3HXLA 1ZRFA 2KRHA 5K5QA 3CP2A 4LFUA 5E3NA 1OCPA 1TWGJ 2Y48A 4HX7A 4TV7A 2DDAA 3VDXA 5ICGA 2V9PA 1P7IA 2KP6A 5TGTA 4XKCA 3X2QH 3IRQA 3GZNB 2DA6A 2KRCA 3WHCA 3WTUC 1L3LA 1D1CA 2B0LA 1T8IA 4Y4RA 3OMYA 1MDMB 4IHXA 1HW5A 4M9XA 1JUPA 3LFUA 5JI6A 4ENMA 3QP6A 2QKMB 3IP4B 3FK6A 4KT5C 3OYIA 1A31A 4IO9F 2R7UA 1T38A 2PG4A 2DO7A 3K4LA 4EM1A 3GTJJ 2XAUA 2K3FA 1K7AA 3FKIJ 1LDKB 4XLHA 3ZR8X 3LMMA 4QPOA 3RKWA 3WTYC 3G71I 2XDVA 5L3EA 1XMXA 5GAHJ 4BE1A 4LB5A 5H20A 4J19A 3FXUA 1EV7A 5B1BH 3FM5A 2QZ8A 1MSFC 2EFQA 1FIAA 1YW7A 3SYTA 3LSMA 3I64A 3JRHA 2CUEA 1VFCA 3I53A 3M8FA 1OCCH 2QVOA 4WXCA 2LMDA 2WV0A 3LSIA 3LSJA 1U0JA 5KAIC 1MGTA 3MWMA 2I8DA 3ABMH 3DPUA 4CUGA 4CXFA 2CFOA 1JUMA 1T98A 1KU9A 1FOKA 1Y0NA 1ETVA 3TGNA 3PSFA 4MFDA 5DS9A 3P9KA 2DCEA 3OR1C 5FD6A 4KA4A 3A0HC 3KFWX 1JXSA 2LRDA 4FE7A 2QENA 2OCCH 3J7YJ 4GCVA 4O3MA 5AONA 3B02A 4C3HJ 3AG1H 2FNPA 3F23A 4OOIA 1WRJA 5C44J 2CWEA 2M3AA 2VASA 1LNWA 4RGUA 3RYPA 4ITVA 3S1RJ 3CCRI 1BC7C 1XSDA 2ZJ2A 2F48A 5CQEA 5E1WA 3S32A 1S72I 4UUSA 2P6SA 4XBFA 1JKOC 1FWZA 2VT2A 2M30A 2X51A 4RGSA 2ZXHA 3A01B 4Z2YA 4BKXA 4EM2A 2FJ1A 2NVQJ 5FLMJ 1ZR4A 3GO5A 1ZG5A 5HS9A 4IHYA 1OCOH 2BGCA 2RKHA 3SDGA 4E70A 1QPMA 3L2QA 2JPBA 4XNFA 3WU0A 1VQOI 1J59A 5ILVA 2UWMA 1P4AA 2KZGA 3OL4A 2X4HA 3EQLF 2XAQA 5BPIA 4B48A 4XORA 3ULQB 1HOMA 5F27A 1OYIA 3F8BA 3JW4A 3GFIA 5HDGA 1VZ0A 2CS3A 4U88A 1OYWA 2JA7J 4V2FA 1MD0A 2BE5F 2E35A 4IHSA 2JTVA 2OC6A 3O3KA 5BS6A 1SD7A 4A6EA 1AA7A 2QGUA 1WPKA 1AKHA 3LSPA 3IH2A 1FIPA 1OPCA 5K5RA 2ZXWH 2WA0A 4EGYA 1FPQA 2OD5A 5DD4A 1Q1HA 2F4MB 4BBRJ 4OAYA 1U9NA 2V6EA 3HOVJ 2Z99A 4PSXA 3TDZC 3CDHA 1WJFA 1QHHD 4L9TA 3KZYA 1NK2P 2ZMEB 2DT5A 2PJRA 2VJIA 4MIMA 2CQQA 1QQIA 5CPRB 3V8JA 5J3LA 1HW1A 3BPXA 4IX7A 1YRNB 3OS1A 1V5GA 2JRMA 2XAJA 3JAMK 2VB6A 4YFNF 4OAZA 2RV8A 3CP8A 2XKOA 4ZZLA 3KEQA 2ZJPF 1XTAA 1JT0A 4Y33A 5FRMA 3LSHA 3HPHA 5D5XB 1LFBA 4XLNF 3GTGJ 2ZBKA 3KETA 2VPRA 1JKRC 4L5IA 2WV1A 3OYHA 4GGGA 4XLCA 1HC8A 4NQWB 1LB2A 3BG7A 3BCAA 2A07F 2R7TA 4HRIA 3HJEA 1FOXA 2LBFA 3E6BA 1MBFA 2FX0A 1PVEA 3FKJA 1FYKA 1YTYA 2NS8A 2XB0X 2L3DA 3M8EA 4I09A 4FQGA 3MEXA 3OOUA 3MKLA 3P9IA 4UUTA 2ZSHB 3WGGA 4RLFA 2VKHA 2R7DA 2ACJA 1N77A 4XOPA 2HTJA 3VSLA 2EFWA 3ONQA 1SMTA 3FBNB 1ZRDA 1YW8A 2A68F 3PNYA 3TP0A 2P5LC 3L7WA 4W1UA 2OZ6A 4NUBA 4UUVA 2FXAA 4BE2A 3FK7A 4ANJA 3SFIA 4LGWA 3JRDA 1F36A 2MW8A 5J4YA 3GF2A 3PIOF 3HOZJ 3FXLA 2DTZA 1V55H 1BJZA 3OL3A 1D1AA 2Y2ZA 4A0YA 2JRTA 3BR2A 4A5MA 1SFUA 2EA4A 3F6VA 5FKOA 2VLAA 1ERDA 1MBKA 4X1EA 3JR9A 3KP6A 3CCJI 1FBSA 5D8KB 3G73A 2Q2EB 5K7ZA 4I0BA 3KP2A 1I3AA 1R4NB 3M1EA 4CA0A 1RIOH 3HKZN 2CUFA 1OR7C 2X6WA 5HOOA 3LA3A 1PDNC 4KISA 2VONA 2RQPA 1J0RA 4J01A 2DA5A 1TTYA 1V4RA 2M4GA 5B66C 4XONA 2QUFA 3S1NJ 3SEZA 4HV6A 5C4XJ 4Y7NJ 2IRFG 4Z6YA 1KZHA 1YG2A 1FLIA 3F6OA 5H2FC 1Z77A 5JVTA 5M3FJ 4CYCB 4RGRA 1G3SA 3ZN1A 1NK3P 1TNSA 2H09A 1T95A 1FSEA 4HQMA 1LVKA 5TRDA 4P55A 1IXSB 3GZ5A 3JRIA 3SJMA 1YITI 1U78A 2IA0A 1Z6TA 3F8CA 1BM9A 2HXIA 3OYFA 3LQRA 5LLQA 9ANTA 1Y6IA 1GVDA 2EWNA 2KISA 3QOEA 5FROA 2ID6A 1K79A 1IXCA 2JQ7A 2NVUB 4GO1A 3CMEI 2QSFX 3OY9A 4BEHB 2MGQA 4K2EA 4XLEA 1B8IA 1CGPA 4BQNA 4B43A 4PZJA 2MH2A 2KLOA 1U8RA 2ZKZA 2MLKA 3M9AA 3ZQQA 4BY1J 2I5UA 3NAUA 2NS0A 4KMUX 1KU7A 5ED4A 1YS6A 4XIDA 4M3FA 3W2VA 2K85A 2XAGA 5DM7F 1I39A 4AIHA 3ZPLA 2DOAA 3ZQHA 1VQ5I 3HG9A 1DP3A 2E1NA 2NOJB 3FBIB 4QIWN 2DA3A 2DQLA 5A2QK 3PO2J 5JLWA 1O4XA 1FYLA 3G3ZA 4XLFA 4QTRA 1LDDA 4E6KG 3ASNH 5IP6A 5GPCA 3IWFA 1ETQA 3AKZA 1ETOA 3CMMA 2G7HA 2GWRA 1ZQ3P 2OCEA 5DEQA 3CJRB 1P6RA 1WJ5A 2H8WA 2MA3A 1HLVA 3FHZA 5IP9J 1ACIA 1IRFA 5BQTA 2DFFA 1JGGA 2OJED 1X1BA 1N75A 3BCBA 1Z9CA 3O2PE 1MMGA 1VNDA 1TP4A 3C2HA 3TO6A 3F72A 4ABZA 1YOVB 3MAJA 1Z7UA 5L3BA 1SVLA 4L0YB 3J7ZI 5CLSA 1APLC 3WGIA 2QBYA 4CCOA 5ILSA 3OYCA 2L4AA 3PNVA 3KZZA 1OMIA 4L5JA 4AUXA 4AIDA 5GP9A 1TT0A 1S8NA 4ENNA 4UV8A 1F1ZA 2NS7A 3TW7A 4AWXB 5FFZA 2E1OA 3KYLA 1WZ2A 4XQFA 1KONA 4HAMA 2FQ3A 4GXOA 1EH6A 3RI4A 3ZCOA 3BQZA 4BQQA 4WWCA 2W00A 4EJTA 2O6GE 3R6SA 3V7RA 5IYCJ 3QODA 2V1XA 3M8JA 3CUQB 1HKSA 3MCZA 4KIFA 3KP3A 1ETXA 4RS8A 5CJ9A 1F5TA 3I56I 1XMKA 1IZ1A 2EIMH 3QOPA 2ELKA 2WBMA 4EGZA 2H6CA 1E3PA 3CJQB 3HUGA 2IA1A 2VBYA 2RREA 3QPHA 3JRFA 5D5WB 3OYKA 3WHBA 2P7CB 1JHHA 3W6KB 1B1BA 2ECBA 5CVIA 4C3JJ 2HOTA 2BHYA 2HKXA 4NBQA 4F93B 5ICFA 4HYEA 3U1KA 2EPFA 3MKWB 2R7QA 2V1NA 2VXZA 3RCOA 3DCFA 2LTPA 4F91B 5BPDA 1TLHB 2ZNZA 2QKLB 2DI3A 1LVAA 2LF8A 2V1UA 3HSEA 1XB4A 1K61A 2GA1A 2NOGA 4N0BA 4YFKF 1BI3A 3BROA 1YFHA 3K10A 4PCQA 4MGRA 1TBXA 5L3GA 4BQOA 2QQ9A 2WTEA 1AOYA 1P92A 3MN2A 4XRSA 4PFPA 5IT3A 1IDYA 3F0CA 3H36A 4XKWA 3OV8A 1O7LA 4KNYA 2D2WA 2DA7A 4C30A 1W4MA 2PMZN 3W2AA 2X9DA 3KLNA 1AU7A 1BIAA 4HNTA 1BC8C 4A3FJ 2E1MC 4F3QA 2P81A 1WVRA 4FT8A 4CSWA 3GTMJ 2X6XA 2PMHA 3JRGA 2MD0A 2ZB9A 5D6EA 2DTRA 2CW8A 1RRJA 2KFDA 1X1PA 4X6AJ 3HBLA 2DOFA 3IH3A 4KJZA 3CDLA 2CMPA 4N4NB 1I6HJ 3A1YA 2VE9A 1MJ9A 2PJRB 2R92J 1FTTA 2R7SA 1RC9A 2VT3A 2GM4A 3BT9A 3H9JA 4IOCF 3ISPA 2XIGA 1Z21A 4D9JA 4ZYDA 1XS9A 2Y31A 3BZCA 1E17A 2X0LA 2CW0F 2ISYA 4CHUA 1D8JA 1W0UA 5LGNA 2VJJA 3U9GA 3DTEA 5D4SA 5JLXA 1ODDA 1K6YA 2DFIA 1OYYA 1J09A 1RUOA 2DA1A 1W7PA 3I71A 3P9CA 3A03A 3GFLA 1S7OA 3H3UA 4IRIA 4KFCA 1E3OC 2IEKA 2LBFB 3LSRA 4PJJA 2J5PA 4KICA 5KVRA 2XVCA 1V3FA 1GV5A 4HSTA 2QYOA 5JHUA 4G8XA 2HVSA 4BH9A 3MKYB 4ZZDA 2ELHA 1KYWA 4FETA 1Z7LA 5M3MJ 1QPIA 1JI8A 2ZCWA 2HPMA 1R4MB 1VQ8I 4XLPF 5LFAA 4CCJA 3OYMA 4WK8F 4XN3A 3EDPA 1V5FA 3CZ6A 3I4PA 1JJ8C 4YELA 2V4JC 5FRNA 1Y39A 4RAYA 5HNFA 2K40A 4JX6A 1R58A 1B6AA 3HM5A 3DBHB 5E8IA 3ZMUA 3V7CA 2K5CA 2A5WA 2IA2A 2XF6A 4ESBA 3HOSA 4S0HB 3ZRGA 2EFNA 2KRFA 5EJCA 4UB8C 3NARA 1LE8A 4E7SA 2XF7A 4QPQA 3UNGC 1ZTRA 3S2HJ 4NB5A 1YHQI 2AXTC 2V26A 1R1VA 2DFHA 5FKNA 4B09A 4YIIA 2VODA 2OF7A 5IOYA 1QZYA 4HA8A 4I99C 1A04A 2ICWG 1FP1D 4ZTFA 1TNTA 2LH9A 4JQFA 5DM6F 2RN7A 2VBXA 4ESJA 1XX5A 2KKOA 5F04A 4Y17A 3RZDJ 4OIPF 3NWTA 2Y30A 3FWEA 4HX4A 1X58A 3ELKA 3S93A 3UR3C 1HW2A 4A3LJ 4JYKA 3ZQIA 1U9OA 4UY8I 4L9NA 3BG3A 2WC2A 5F1JA 4HF2A 3HZJA 2VE8A 3I54A 4IRGA 1W1WE 4ZYAA 3QPLA 4G7OF 2A6EF 2CSOA 3T0YA 1JHFA 2PEXA 1Z1DA 4Y15A 2EINH 2LC2A 4M6YA 4MLOA 3H5AA 3OYLA 3J7AO 4UV9A 1O3RA 3SXYA 3OOPA 2IS2A 2W1OA 3F8NA 2JVGA 3Q3SA 3SEQA 5K7HA 2GXAA 4L5EA 4LG3A 2MYSA 2QEXI 5GTIC 4D7NA 2BEOA 2K9LA 3GVAA 4EJOA 1SD6A 3H5NA 2FSWA 1HBXG 3VYTB 3PUBA 5HLIA 1ZHFA 4XR6A 1O3QA 3EPZA 3G1MA 2ZFUA 2V6CA 5E3OA 4B47A 3RZOJ 3C2BA 5HLGA 3HTSB 1OKRA 3CC4I 4B4CA 2XKPA 3TP3A 3FF5A 4ETSA 4HNUA 2YSRA 1VTNC 3K4NA 2KPMA 2DMPA 2X1CA 3IHUA 2CV2A 3KIOA 4EJVA 3T8TA 4GRIA 3W2WA 1XDUA 4PSWA 6PAXA 2XPVA 2JT1A 2VJ4A 4BNCA 1FP2A 2IGKA 4C2MJ 2XC7A 3L2VA 2WY8Q 3QRFF 1KQ9A 1MH3A 2BYVE 2WB1N 2STTA 3S3NA 1JTYA 2V9KA 1EKEA 1ZAOA 2DPUA 3M07A 3OR2C 2CO5A 2AQFA 3I5UA 3WTXC 1VF9A 2CUZA 4M6XA 3PO3J 3DXJF 5ILUA 3H0DA 3VYUB 2LG4A 4U0YA 1FX7A 2QBYB 2AQEA 4U0WA 1TL8A 2Y69H 3CDIA 2FE3A 4II3A 2JN6A 2H8RA 3JRBA 2F4OB 2OTJI 1XGMA 1GLNA 4DBQA 2XGCA 1LEAA 4C2UA 3LWFA 2QQBA 3DFGA 3H0GJ 5M5XJ 1EH7A 1ETYA 3EUHA 4GYGA 4HX8A 5C3EJ 4MFEA 3COAC 3RYRA 1JE8A 1F43A 3KEYA 2DYRH 3RQIA 5TISC 3DWLE 1SANA 1D8KA 2V7FA 2E1MB 2PMZA 2E5ZA 2E34A 5L3FA 4BGDA 1RESA 1HSTA 2XSJC 2IXSA 3IAS2 3QQAA 1MBGA 2LLKA 4RBOA 1SFEA 4JX4A 4A3MJ 4A3GJ 2JUCA 3Q0WA 3JRCA 5E1XA 4JOMA 5LHIA 2VUMJ 1LKXA 5J1RA 2FRHA 3HPGA 5JVGF 2IGMA 3CCMI 1F9NA 4NC8A 1V54H 3R4KA 1WQ2A 3B73A 1BL0A 2VXDA 4XSXF 2IP2A 1R71A 1FY7A 1GHCA 4KMFA 3EYYA 4XKVA 5JR3A 3MZ8A 2CQXA 4XSZF 2BV6A 4UB6C 2JZYA 2HQNA 4LLLA 1GT0C 3GEZA 3UKGA 3I58A 2M2EA 1X4PA 4IPAA 2MC4A 2V79A 2VQGA 3F22A 1E2XA 4RGXA 3OIOA 3HRSA 2HPIA 1T0FA 1EH8A 2L9NA 2XGXA 2IVMA 5EZHA 1NH3A 2ZNYA 1X1CA 3ASOH 2BW3A 1FNNA 1UHWA 4A3CJ 1LEBA 2L4MA 1IGNA 3RSNA 1IG7A 1QVUA 3FXMA 3AG2H 3HRMA 1SFKA 2LVSA 1BOAA 2OQRA 4IF4A 3E6CC 2JUGA 2R5YA 3BOQA 2R7VA 2L01A 2MBFA 1FBQA 2K9MA 2CQ7A 1GV2A 2W7NA 2MH9A 2R4GA 3GXOA 3WU1B 4ENKA 3MMYB 1VQMI 1X3WB 2LDUA 3O8GA 4WF2A 1BR2A 2L9SA 1WKMA 2MFZA 1ZN2A 4M74A 1VQ4I 3ERMA 2XGEA 3TW6A 3IV5A 3BG6A 1RPWA 3HSRA 4CICA 3HIFA 2BY3A 3QPTA 4HLXA 4LOCA 3I4MJ 3HRTA 2L2OA 2BOLA 3CCQI 2PLYA 1UHMA 1IRXA 3EUKL 4KN4X 1DGRM 3Q0VA 3T1BA 2EZHA 4R1HA 1IJWC 2D5VA 3ZQFA 3OYGA 1B72A 3VFZA 1QNTA 2M5WA 1XD7A 4A2UA 3CMYA 3WODF 3ZMDA 3HL2A 3GMEA 3KP5A 2K27A 3IH4A 3DBRB 2P5VA 3ECHA 4IL6C 4RMNA 2VJ5A 4I98B 1CF7A 3KYCB 4XMYA 2ZFWA 1W7PD 4HW0A 1Y56A 2N8GA 1LQ1A 4DOZA 2W25A 3S15J 2NNNA 2EZKA 3QP5A 4GDFA 4BQAA 4LJZF 4ZC3A 2OV7A 4BL0B 4A3EJ 3C2GA 2W82A 3HOUJ 3K0LA 4AC0A 3P7NA 3LAPA 2P4WA 2DDBA 2DA4A 3HOYJ 4KUMA 4OINF 1T0FC 4IQ4A 4Y52J 3CF2A 1JKQC 5CVUA 1WGXA 3H3VK 1I27A 1A35A 2FBHA 4BXXJ 2Q0OA 2M8GX 4LB6B 5HODA 4IHTA 2ECCA 3S16J 3K69A 5FKLA 2VBWA 1MNDA 5JHFA 1H9GA 1MJBA 1IN6A 4WXDA 5AIPA 3T8RA 4GYIA 2DFEA 2CGPA 4Q4ZF 3IWZA 2E2JJ 2IS1A 1N25A 4KIBA 4QSHA 4BJ5C 5HLHA 2UZKA 2HYJA 2MLGA 2B9SA 3FMRA 2KJCA 1E3HA 2B7EA 3P5JA 5J4VA 5EG0B 4D5FA 1FMWA 2TDXA 2GA2A 3ABKH 2DMTA 1XDSA 2CG4A 1WJDA 3I3LA 2KHMA 1TW2A 2KMUA 3BC8A 1TWFJ 3BPVA 3ZQGA 5D8LB 3PJRA 1U8BA 3WTWC 2JWTA 3F21A 1IAWA 2R93J 1U2WA 4JBAA 4PJNA 1K78A 2VI6A 1LE8B 4OIOF 2ZJRF 4PK4A 2VKDA 1EF4A 4OMYA 5CQGA 1U5TA 1UB9A 2M4KA 3U2RA 2BY0A 3DTKA 3KEOA 3U1DA 4X0GA 1FEXA 4RDUA 2NNYA 3CLOA 2FQ4A 2YR2A 1T56A 3NWSA 1MBJA 2KZVA 5IPAA 3FMSA 5EYRA 4DYCA 2XRLA 3CO6C 3ECOA 1RETA 1KA8A 1UCRA 3W3CA 1HF0A 1OFCX 2M0MA 3V7SA 5J47A 2GOMA 1DUXC 3HDDA 4OIQF 4E7LA 4E7KA 2BVLA 3SZTA 2XAHA 1H88C 3GYHX 2WB1A 2EFPA 2LYCA 4AYBN 4IQJA 1OCZH 4PUSA 4DYQA 2ISZA 1B9NA 2FBIA 2IGOA 2K9SA 2FNAA 4HDUA 2GQQA 3VB2A 5LEKA 4A3DJ 1R1TA 1OCTC 3GTQJ 4BY7J 3E3VA 5J1UA 2KL4A 1H9TA 2F5DA 3HTUA 4ZYHA 4BBSJ 3ABUA 2BBYA 2X48A 4QLCU 3BY6A 3HGGA 3ML6A 5E3LA 2IS4A 2M0CA 3L2WA 2IJLA 1STZA 2X1EA 1RI7A 3FX3A 4A69C 2A5YB 2HQAA 1IN8A 5LGTA 1UG2A 1IUYA 1T33A 4AIKA 2JPCA 3L00A 4L9JA 1ZH5A 2ZC2A 1JGSA 4LG0A 3TBIA 1SMYF 2KDZA 1P9QC 2BY1A 5H6QA 3TEDA 1R5GA 4B3AA 2QSGX 2WADA 3FXRA 3N05A 1FZPB 4PGGA 2MABA 4CDGA 2A3SA 2FBKA 2R7XA 2HI3A 1MNMC 3BR5A 4PJMA 2OQGA 3BTIA 2O8XA 1E0EA 1U5TC 1DGWY 2F4IA 3WU2C 1TZLA 1SAUA 3DU5A 4IHVA 3VWBA 1FOWA 2R7OA 1IRZA 1Z6RA 3LA7A 2FF4A 5L3CA 2BXZA 1WJCA 1BA5A 3JTGA 3GX4X 3DEEA 5IYDJ 3R0AA 3IKTA 1W5CC 2HVQA 2YX7A 3GUDA 3H1CA 3ZMTA 3CCUI 2PN6A 2EV0A 2DQRA 3BJ6A 5DDGA 4UVCA 4HF0A 5ICCA 1A6QA 5HDNA 2RVCA 4BXFA 1BW6A 4RB1A 3KPHA 4CH7A 4GFBA 3OYEA 1R49A 2IW5A 3S14J 2VC1A 5KK1A 1MJAA 4A0ZA 3HEFA 3JSPA 3C18A 4UXNA 1BBYA 3RKYA 2DODA 2WAQA 1ZGAA 1ON1A 2HU9A 2LY1A 3OYAA 3DKWA 1RNLA 3DPTA 4DW6A 1USTA 1Y8QB 1IRGA 2L7KA 2ZO4A 3QYFA 1ZKGA 5LD2C 2GIZA 3E6MA 2W84A 1P4WA 2LF7A 4EV0A 1IUFA 2G7UA 2EIKH 3TQNA 4UUSB 2R0QC 3A01A 4ZTJA 5E1ZB 2GLOA 3QPSA 2F5FA 3E0JB 4ZYGA 2HOSA 2FOKA 3D5SC 3PIPF 2RAEA 4MEXF 2HZDA 4I01A 1DP7P 3REOA 3RQ4A 3LNQA 3O6BB 3LSTA 4I0AA 1HXDA 2EK5A 2F5CA 2Z9OA 4HNVA 3K2AA 5J40A 1XN7A 2HQ5A 3CCVI 3BR1A 2ESHA 2PBIA 5FGMA 1DPRA 2HDWA 3WG7H 1R7JA 4FE4A 3V8KA 1T2KA 1YYVA 3T5XA 2EB7A 2P5KA 1QBJA 1BI1A 4AVZA 5D4RA 3SDBA 4H4KC 2L9RA 3GTLJ 1JTXA 2ZSIB 3W6JB 1LPQA 4IOAF 2DMQA 1ETWA 3C3WA 1VQLI 1TW3A 3BQYA 3R0JA 3BTJA 4CYDA 4L18B 4HLYA 2BW3B 5DCMA 3K4KA 3AFHA 4ZDLA 1R22A 5LGUA 3OSGA 5JFRA 2DYSH 5C4JJ 1ONVA 1AKHB 4EEFG 4AM3A 3K1NA 1D5YA 3BZKA 1HSJA 2EZIA 2F5VA 2F6CA 3VYRB 4MTEA 3TO7A 1REPC 1S6LA 3OYBA 1USSA 3CF5F 3NQOA 4RM3A 3M1CA 2BVMA 2MD5A 5FB2A 1MH4A 2JA2A 2K9NA 2G0EA 3Q0UA 2PFBA 2D1VA 4Y13A 2ZMEA 1IC8A 3JRAA 4NC7A 1L0OC 4IEJA 4EVIA 3FISA 1BOBA 3OIPA 2FMLA 5LHHA 1IN7A 2XRNA 5FKMA 2CV1A 1C0WA 2UUZA 4MQ9F 1Y1VJ 3FHNA 2EV5A 1B72B 1QGPA 4BDYA 3FZVA 2L5QA 2NVYJ 3RPUA 2E71A 4BS9A 5IY5H 3L2CA 2PMUA 3S3MA 2NRAC 4NQWA 4BHPA 1J5YA 1JKPC 1YX3A 1ZELA 2M8EA 3QYEA 4Y3OA 4XK4A 3SZPA 2VQHA 1S7EA 3KX2A 4PJ0C 4E7ZA 4C9YA 2KIQA 4XRFA 2K4BA 2GXGA 2CW7A 5BOXA 2K9QA 2Y75A 1X19A 2TCTA 5EEAA 3E97A 2YU9J 2VQLA 2LNBA 5E20A 1Z0XA 1G6NA 1W5TA 1P7JA 1Z91A 3ZMSA 1SFXA 1I1SA 2VPLA 2F5EA 1YQAA 3HOTA 3LSGA 3IUOA 4XICA 5EDNA 2M45A 3F8MA 1XPXA 4FCYA 3DTIA 3V42A 4U7BA 2E60A 1UAAA 2R7ZJ 1KGSA 3GFJA 4RAFA 5FLVA 1X3UA 2DT7B 4BXUA 1MBEA 3DQVC 4A6DA 4YRVA 1FBUA 1WI3A 4AYBA 2HEOA 1XMAA 1ZR2A 3I9V2 2PI0A 1GXQA 1IV8A 3A2KA 1QRYA 3KCCA 3VSKA 1MSEC 1IN4A 2LY9A 2A6TA 2ZMEC 4XN0A 1HDDC 2Q2EA 1ZK8A 2FUG2 2R7FA 1QZZA 1XGOA 3GLXA 4RLQA 2ME6A 4EATA 2MC3A 1BR1A 3I55I 1LDJA 5E8GA 1R36A 2K86A 1RKWA 3PM1A 4B3XA 3BG5A 4PJLA 3E5UA 1TQPA 4PDKA 1GVJA 2F2EA 2FD5A 2G9WA 2PX9A 2O3FA 4HG2A 3ZN0A 2DMNA 2H27A 1H0MA 2IAIA 1G3WA 4M6VA 3I59A 4P1WA 4UHTA 5HVQC 3SHFA 4E7JA 4KYWA 2DJIA 3S8PA 2AHQA 2V1DA 3V8LA 2EBIA 1D3YA 2NVTJ 1WJBA 4CYCA 2Z1DA 1U5TB 3N97A 3DBLB 2IS6A 2K02A 3D5RC 4CZZA 5EZGA 4O5VA 4LLGF 4LLNA 1PUFA 4A12A 2NAZA 4QWQA 3EETA 4P9FA 4PFOA 1Z3XA 1KU2A 2E19A 2HGCA 4KITB 1MMSA 2VKEA 3J80Z 1TWHJ 4KT6A 5FLXZ 2DBBA 3BR3A 2LREA 1B4AA 2UV1A 1KQ0A 4FTHA 3F9KA 5IYBJ 1ZRCA 1TWAJ 1I1GA 4BEHA 4CCKA 1S29A 5LRRA 1XGNA 3S1QJ 3CC7I 1B8IB 1NHAA 4G6QA 3MFKA 4KDPA 2LK2A 4FHTA 5BMZA 4LIUA 2COBA 2KIMA 1WHUA 1LFPA 4AVPA 5KCMA 1YS7A 1B59A 3I4NJ 2C6YA 1W5SA 2GBYA 2OA4A 2YS9A 2O0YA 2WAEA 4U87A 2LP0A 1SD5A 1SD4A 3C7JA 4JK1X 4XOTA 2Y0SN 4IRHA 3JSOA 3N4MA 3CJTB 4G94A 1SAXA 2DPDA 5BNGA 1UMQA 3I0TA 5LHGA 4R8HA 3CJNA 4M9ZA 1MNEA 3WTTC 4N9HA 3RKXA 4ON0A 5LEJA 4Q48A 3WG9A 1I5ZA 5IT9K 1G3YA 1D1BA 1R00A 1D0XA 3ZMVA 1RKTA 4CCMA 2QSHX 5GTHC 4LG0B 1OISA 1ULYA 1W36C 3TOBA 4EJWA 1OJLA 2VOOA 3DU6A 3SZGA 4ESFA 3D5LA 2JK3A 3TOAA 4M71A 5IT9Z 1VQKI 5K7FA 3KP4A 1FSHA 2DW4A 3WGHA 4NHJA 4U0VA 5J6XA 1K4TA 2XASA 1T6SA 3HYIA 5LBQA 1XC5A 2R5ZA 1FMVA 3Q5FA 3FXOA 2BHZA 2E7XA 1BN5A 1YIOA 1JUSA 1YIJI 3WE3A 4WX9A 3FM3A 1MMDA 4XM3A 3E5XA 2P7VB 4C2TA 2JMWA 2QLZA 1IDZA 5F0HA 2WY7Q 3OIQA 4DZJA 3CTAA 5FO5A 2JA6J 5HDKA 2M1BA 3C1DA 4ASNA 3ZP5A 2XGDA 1I50J 5DYMA 4LMYA 1YX5A 3IKVA 4U7DA 1XSVA 4ZJZA 3CUQA 3GTPJ 4RAZA 5F6FA 1NTCA 3GCMA 3S17J 3ZQCA 1CQTA 4HBLA 3EYIA 4NDLA 4KIGA 2CH0A 4Q5SF 4L0ZB 3KZIC 1N78A 5GADJ 1VQ9I 2Q8KA 5E17F 3HUGB 4HPQA 1X1AA 2K3PA 2YPRA 1MKMA 4P96A 2IPQX 1FJLA 3VODA 5F64A 3DEUA 2IGNA 3BTCA 4M3GA 2XAFA 3K70C 3PQJA 3HGYA 5F08A 4LK0F 4M3EA 5DCFA 3AL0C 4H0EA 1WCMJ 5K1YA 1S9HA 2KJBA 4BE0A 3H5RA 1WSUA 3CCLI 1R23A 3Q9VA 1ENHA 2CFXA 4B1RA 2XPWA 1KU3A 5E18F 4EMSA 1HA8A 3CCSI 2ME0A 5CYVA 3ZMZA 2GIVA 3E7LA 1X3ZB 2Z16A 3LL7A 3SFZA 2FU4A 1FYMA 1V5EA 2EZLA 2WAQN 3WTSC 1K4SA 1DU6A 3LQQA 1BIBA 2M34A 4C3IJ 2DK5A 1AWCA 2TRTA 3TMOA 2HR3A 4E4HA 1PYVA 3K6GA 2O7OA 3GTKJ 4HEA2 4BUPA 4RM2A 2IBDA 5FJ8J 3DPLC 3EUHC 5DCMB 4V2GA 3DEWA 3K9TA 3K4MA 5AIQA 4ZYEA 5EGOA 2VKVA 1MMAA 1D0YA 4BACA 3DP7A 2O61A 1ON2A 4N4OB 3FXJA 2D1HA 3WTZA 2CRGA 1R6RA 2RGVA 1T39A 2M7BA 2E1CA 2JA8J 4DIQA 3HHHA 1ZLJA 2ID3A 3CUQC 3ABTA 1WI9A 4YG2F 3FDYA 3RPUD 1OCRH 1TQMA 2NXNB 3Q9SA 4S05A 2ESNA 3A02A 3HHGA 4G7ZF 2L7MP 4F55A 1UELB 1LJ9A 2O8KA 5DD8A 2O03A 1DDNA 3QYBA 4RA2A 1JT6A 1OR7A 2RNGA 1MW7A 3JCUC 3HSFA 5EF6A 2QQ8A 4HZFA 3S1MJ 3GBGA 3CD6I 1K83J 2XPUA 4G6DA 5FD5A 3M4OJ 4D7MA 2ZXIA 1QU3A 2EILH 1R9TJ 1Z05A 2EQRA 1ZREA 2EJRA 3DF8A 2QF7A 4S04A 4D5CA 5B3SH 3JAMZ 3DLLF 1O3SA 3AAFA 2E2HJ 2HDCA 4A3BJ 1W7PB 5TJJA 3M7GA 1Y0UA 3PFIA 3DKYA 1IF1A 2B63J 4RB3C 2ELJA 1Z3YA 3AG3H 2LKSA 2HKOA 5ICEA 4EJUA 2A69F 3QU3A 2EH3A 2H6BA 2RQQA 3QU6A 2HNHA 1FOYA 3PL8A 1VQ6I 2BY2A 3E5QA 3OWTA 2HZTA 3W6VA 3K1MA 2JSPA 3LOCA 1G3TA 3TDUC 2KIFA 1UJ8A 4I76A 4B8XA 4AIJA 5HS8A 2X6YA 4DJAA 2XF5A 3ERED 1H89C 2YUSA 1U3EM 4G6TB 1TQIA 2RNJA 2LOOA 1HKTA 3F8FA 2KDOA 1TT5B 1QO0D 3H92A 3K2ZA 1VI0A 3H9GA 2W85A 4MEYF 2XSDC 2DMUA 3GW2A 3J7AY 1BW5A 4NNJA 2YX4A 4ZH4F 4LIVA 3CUOA 3TKYA 3OYJA 3O8HA 1J75A 1WFXA 4P9UA 4LD5A 4CCLA 3LFKA 1SFOJ 3L09A 1A5JA 3IAM2 1W36D 4F92B 4BDZA 4BHBA 1UG0A 3ZQ7A 2RC4A 3J81K 5HS7A 3M3YJ 3CO7C 2WAFA 2Y0SA 2Z3YA 3VOEA 4CCNA 1K6OA 2DA2A 1ORKA 3PNTA 4EQQA 1BJAA 2Y0MA 4I2OA 3KLOA 5D5VB 4HV5A 3BR0A 4M3BA 1W0TA 1H8AC 3ABLH 4B44A 4CZCA 3J81Z 3FMQA 2JJ7A 1X2NA 3BJOA 5FKKA 4JP0A 3MVPA 4MHGA 4ZDPA 4A3IJ 4E7HA 1GXPA 2ETHA 2QA4I 4A93J 1FTZA 3I59B 2DN0A 1M1EB 2DOEA 3PUFA 5CVRA 3ZXSA 2H1KA 4AD9A 2JSCA 4KN7X 4XKBA 4DQ2A 4DNCA 4A0XA 4DBRA 2HYGD 1ZYRF 2HQRA 2L02A 4M72A 4YIFA 4MTDA 4G7HF 1FC3A 2AO9A 2A61A 2I10A 1PUFB 1ZG3A 2DJNA 4WXHA 4PGHA 4A3JJ 2DK8A 2L7ZA 1G59A 2W4SA 2VN2A 1SEUA 1BR4A 2AXLA 3CC2I 3L1PA 2E5NA 3KE2A 5CKTA 1RUNA 1S5LC 1SVOA 4RAGA 5HNHA 3HOWJ 1UFMA 1MDMA 1JJ6C 1ZARA 1ZLKA 1DPUA 3E6DA 2LY2A 4G12A 4II2A 4RB0A 3K70D 1DQUA 1Y8RB 1YLFA 2E2IJ 2CQNA 2A6HF 5IP7J 3CLQA 5KAFC 4P5OA 2PJPA 3ZOBA 3LSKA 5F0CA 1YO5C 3WE2A 1YE9A 4JX5A 2HFHA 5EEHA 1O57A 3MZYA 2MG4A 2H1LA 1YJ9I 4DYRA 2M9HA 1HKQA 1VQPI 1RR7A 3WTVC 2ZJQF 4FX0A 4HQEA 4IXAA 3RJPA 3HRUA 2V9VA 5EEGA 2EFOA 5A2QZ 2VQCA 2M7AA 2X85A 2VC0A 4F7ZA 3JREA 2CQKA 2HOAA 4LITA 3AL0B 4HSRA 2CU7A 3G1OA 1XCBA 4Q47A 2Q1ZB 4WCGA 3BDDA 4OIRF 3A4CA 3SQNA 1QA6A 2A05A 1WH7A 3G2BA 5F0FA 1I6XA 1YI2I 4A3KJ 3LA2A 5M5YJ 4XRSG 1EJ9A 4E7IA 2ADUA 2LKPA 2CJJA 2LSOA 2AS5F 3OYNA 5LRSA 2O5RA 4ENJA 1SVMA 5ERIA 2MSYA 2KIUA 2YU3A 4G9YA 4ZDOA 4HF1A 1T08B 1IXRC 2R5ZB 4L9VA 3VYSB 5F1RA 4IKFA 1O7FA 2EV6A 4RB2C 2M87A 4N9IA 2KQRA 5B5EC 5J8CA 1ZGJA 3K1PA 2R7RA 2HS5A 1HCRA 4I6ZA 1YJNI 1LFUP 4FASD 2K7LA 3A0BC 4OWRB 3JTHA 2CYYA 4BHCA 1OLTA 5M5WJ 4BJ6C 4YFXF 1PP7U 3OS2A 3BG9A 4IHWA 4V19K 3S2WA 1WJEA 2COMA 1NG7A 3B6CA 3R61A 2ZXJA 2OTLI 1KYZA 3ZQLA 3VEPA 3FIWA 4W97A 4NC6A 3G6EI 2UXXA 2RDPA 3K7AJ 3KYDB 5HLTA 1XG1A 3H35A 2VIXA 4I02A 3BLYA 2DT6A 3NRVA 4IVNA 2VL8A 1YW9A 4LK1F 4BU2A 5J8FA 1TC3C 1LUJB 1XCVA 5CVVA 2LKXA 1HDPA 1ZGWA 3NEUA 1A36A 5IOZA 4BJTA 3OS0A 3RPQA 2XV4S 1WJAA 4EM0B 2W48A 4R79A 3RTRA 3PSIA 3VPRA 4HDVA 3CCEI 1WH5A 1MZBA 4OMZA 3D0SA 1Y1WJ 2OPTA 1G8XA 1GDTA 1A6IA 3QWLA 4IJAA 2Z33A 1VQ7I 3GWZA 2FEZA 2L7FP 2GOXB 5J1YA 4XLAA 5E79C 3GFMA 2R5YB 3CCYA 3RIRA 1MIJA 2H94A 5GPAA 2XHKA 4UVAA 3BTLA 4FISA 2VOPA 5KNLA 2FA5A 2HYFA 2OU2A 5H6RA 3HC7A 2XROA 1XSXA 4XRMA 2JVHA 3B6AA 3BWGA 3OYDA 3R60A 4D1QA 1FT9A 2BZTA 1HQCA 3KP7A 5EGOB 1BI0A 2FOWA 1YRNA 4UNOA 1Q1VA 5CVJA 3ZGKA 1YJWI 2E36A 2EA2A 1B9MA 3ROUA 2JA5J 3G1LA 1R5ID 1QZEA 3RDIA 3IRRA 3K4CA 3GLLA 1I3QJ 2QCOA 3RKQA 3CQZJ 3H3ZA 5B1AH 3MKZA 2O9LA 2EIJH 1J7KA 2Y9YA 1CF7B 2L54A 3PFYA 1R1UA 3MD2A 2GXBA 3FXQA 3PQKA 2HWVA 3D1NI 4AU7A 1ZG1A 5DUKA 2R3SA 3IL2A 2DU9A 5GAGJ 1D5VA 1U6GA 1IO2A 3HKZA 2LD5A 2HTSA 3DV8A 2PQ8A 4BAYA 3AG4H 1PP8F 3OSFA 1XGSA 2OAZA 2CV0A 2UXNA 4I7HA 4CGZA 2XB5A 3FXKA 4FX4A 1S3JA 5D5UB 1X4OA 1AHDP 2W24A 1J9IA 3DLAA 2OUMA
chains in the Genus database with same CATH topology
2P6TA 2K4JA 2Z5UA 5L3DA 4HOBA 4OU0A 2D45A 1KQ8A 2QWWA 4UVBA 4BYYA 2DAOA 3MQ0A 2VBZA 2XUBA 1O3TA 2GAUA 2HOEA 2QQAA 3TO9A 2OZUA 1G4DA 4A5NA 1IW7F 1P2FA 4M9SA 5DV5A 5FFXA 4O6JA 2P8TA 2STWA 1P4XA 2DLLA 4MQVA 2FMYA 1BI2A 3BP8A 1K78B 3J80K 3MZHA 5FLXK 2W57A 2NYXA 1IN5A 3F3XA 2QM3A 2WWYA 5K5OA 4MNUA 2IT0A 4CO8A 4D0PA 3QAHA 2OBPA 3IC7A 2J5OA 1R5HA 5DUIA 3BJAA 4M73A 3L9FA 1S7AA 1J2XA 1RZ4A 5D6FA 2GZWA 3GZ6A 1PUEE 3LAJA 3BZ6A 1WWXA 2E7WA 3V4GA 1F4KA 1ZRFA 5K5QA 4LFUA 2Y48A 4HX7A 4TV7A 5ICGA 3IRQA 1L3LA 3WTUC 2B0LA 1MDMB 1HW5A 4M9XA 5JI6A 4ENMA 3QP6A 4KT5C 1T38A 2PG4A 2DO7A 1K7AA 1LDKB 3RKWA 3WTYC 5L3EA 4LB5A 5H20A 3FXUA 1EV7A 3FM5A 2QZ8A 2EFQA 1YW7A 3I64A 3I53A 3M8FA 2QVOA 4WXCA 2WV0A 1MGTA 3MWMA 4CXFA 1T98A 1KU9A 1FOKA 3TGNA 3P9KA 5FD6A 4KA4A 3KFWX 1JXSA 2QENA 4GCVA 4O3MA 5AONA 3B02A 2FNPA 3F23A 4OOIA 1WRJA 2CWEA 1LNWA 4RGUA 3RYPA 1BC7C 1XSDA 2ZJ2A 5E1WA 2P6SA 4XBFA 1FWZA 2VT2A 2M30A 4RGSA 4Z2YA 4EM2A 3GO5A 1ZG5A 5HS9A 2BGCA 2RKHA 4E70A 1QPMA 1J59A 2JPBA 3WU0A 5ILVA 2UWMA 1P4AA 2X4HA 3EQLF 2XAQA 5BPIA 3ULQB 1OYIA 3F8BA 3JW4A 3GFIA 5HDGA 4U88A 1OYWA 1MD0A 2BE5F 4IHSA 2JTVA 3O3KA 5BS6A 1SD7A 4A6EA 1OPCA 5K5RA 4EGYA 1FPQA 2OD5A 5DD4A 1Q1HA 2Z99A 3TDZC 3CDHA 4L9TA 3KZYA 2ZMEB 2DT5A 1QQIA 3V8JA 1HW1A 3BPXA 2XAJA 3JAMK 4YFNF 2RV8A 4ZZLA 2XKOA 3KEQA 5D5XB 4XLNF 2ZBKA 3KETA 4L5IA 4GGGA 1LB2A 2A07F 3E6BA 1FYKA 1YTYA 3M8EA 2L3DA 4I09A 3MEXA 3P9IA 3WGGA 2ACJA 2R7DA 2HTJA 2EFWA 1SMTA 1ZRDA 1YW8A 2A68F 2P5LC 3L7WA 2OZ6A 4UUVA 2FXAA 4LGWA 3GF2A 4A0YA 2JRTA 4A5MA 1SFUA 2EA4A 3F6VA 3KP6A 1FBSA 5D8KB 3G73A 4I0BA 3KP2A 3M1EA 1RIOH 5HOOA 3LA3A 1PDNC 2VONA 2RQPA 1J0RA 1TTYA 1V4RA 2QUFA 4HV6A 2IRFG 1YG2A 1FLIA 3F6OA 5JVTA 4RGRA 1G3SA 3ZN1A 1TNSA 2H09A 1FSEA 4HQMA 5TRDA 4P55A 1IXSB 3GZ5A 1U78A 2IA0A 1Z6TA 3F8CA 1BM9A 3LQRA 5LLQA 2EWNA 1K79A 1IXCA 4GO1A 4K2EA 1CGPA 4PZJA 2MH2A 1U8RA 2ZKZA 2MLKA 3M9AA 4KMUX 2NS0A 1KU7A 5ED4A 1YS6A 2XAGA 4AIHA 3ZPLA 2E1NA 2DQLA 5A2QK 1FYLA 3G3ZA 1LDDA 3IWFA 2G7HA 2GWRA 5DEQA 1P6RA 2MA3A 3FHZA 1IRFA 5BQTA 1Z9CA 3O2PE 3TO6A 3F72A 3MAJA 1Z7UA 5L3BA 4L0YB 5CLSA 3WGIA 2QBYA 5ILSA 2L4AA 3KZZA 1OMIA 4L5JA 1S8NA 4ENNA 4UV8A 1F1ZA 4AWXB 5FFZA 4HAMA 2FQ3A 4GXOA 1EH6A 3RI4A 4WWCA 4EJTA 2O6GE 3R6SA 3V7RA 2V1XA 3CUQB 1HKSA 3MCZA 4KIFA 3KP3A 4RS8A 5CJ9A 1F5TA 1XMKA 1IZ1A 3QOPA 4EGZA 2H6CA 3HUGA 2IA1A 2VBYA 3QPHA 5D5WB 2P7CB 1JHHA 3W6KB 1B1BA 5CVIA 2HKXA 5ICFA 4HYEA 2VXZA 5BPDA 1TLHB 2ZNZA 2DI3A 1LVAA 2LF8A 2V1UA 3HSEA 1XB4A 2GA1A 4N0BA 4YFKF 1BI3A 3BROA 1YFHA 4PCQA 4MGRA 1TBXA 5L3GA 2QQ9A 2WTEA 1AOYA 1P92A 5IT3A 3OV8A 1O7LA 4KNYA 2D2WA 1W4MA 3KLNA 1BIAA 1BC8C 4FT8A 2PMHA 5D6EA 2DTRA 2VE9A 1MJ9A 2VT3A 3ISPA 2XIGA 4ZYDA 1E17A 2X0LA 2CW0F 2ISYA 4CHUA 1D8JA 5LGNA 3U9GA 5D4SA 1ODDA 2DFIA 1OYYA 1RUOA 1W7PA 3I71A 3P9CA 3GFLA 1S7OA 3H3UA 4IRIA 4KFCA 2J5PA 5KVRA 4KICA 2XVCA 1V3FA 5JHUA 2QYOA 4G8XA 4BH9A 4ZZDA 2ELHA 1KYWA 2ZCWA 4XLPF 4WK8F 3EDPA 3I4PA 4RAYA 1R58A 1B6AA 5E8IA 3ZMUA 3V7CA 2IA2A 4ESBA 3HOSA 2EFNA 2KRFA 4NB5A 1R1VA 4B09A 4YIIA 2VODA 1QZYA 4HA8A 1A04A 1FP1D 1TNTA 4JQFA 2RN7A 2VBXA 4ESJA 2KKOA 4Y17A 4OIPF 3FWEA 4HX4A 1HW2A 3ELKA 4L9NA 4HF2A 2WC2A 2VE8A 3I54A 4IRGA 4G7OF 2A6EF 2CSOA 3T0YA 1JHFA 2PEXA 1Z1DA 4Y15A 4M6YA 3J7AO 4UV9A 1O3RA 3SXYA 3OOPA 3F8NA 2BEOA 3GVAA 4EJOA 1SD6A 2FSWA 1HBXG 5HLIA 1ZHFA 1O3QA 2V6CA 5HLGA 3HTSB 1OKRA 2XKPA 3FF5A 4ETSA 2YSRA 1VTNC 3IHUA 4EJVA 3T8TA 1XDUA 6PAXA 2JT1A 4BNCA 1FP2A 3QRFF 2BYVE 1KQ9A 2STTA 1ZAOA 2DPUA 2CO5A 3I5UA 3WTXC 4M6XA 3DXJF 5ILUA 4U0YA 1FX7A 2QBYB 4U0WA 2FE3A 1XGMA 1LEAA 3LWFA 2QQBA 3DFGA 1EH7A 3EUHA 4GYGA 4HX8A 3COAC 3RYRA 1JE8A 1D8KA 5L3FA 1HSTA 1SFEA 5E1XA 5LHIA 2FRHA 1F9NA 3R4KA 1WQ2A 3B73A 4XSXF 2IP2A 1GHCA 1FY7A 4KMFA 3EYYA 5JR3A 4XSZF 2BV6A 2JZYA 2HQNA 4LLLA 3GEZA 3I58A 4IPAA 2V79A 3F22A 1E2XA 4RGXA 3HRSA 1T0FA 1EH8A 2XGXA 2IVMA 2ZNYA 1FNNA 1UHWA 1LEBA 2L4MA 3HRMA 4IF4A 1BOAA 2OQRA 3E6CC 3BOQA 2L01A 2MBFA 1FBQA 2MH9A 3GXOA 3WU1B 4ENKA 2LDUA 4WF2A 1WKMA 1ZN2A 4M74A 3HSRA 4CICA 3HIFA 3QPTA 4HLXA 3HRTA 2PLYA 1UHMA 4KN4X 3T1BA 4R1HA 3VFZA 1QNTA 2M5WA 1XD7A 4A2UA 3WODF 3ZMDA 3KP5A 2K27A 2P5VA 3ECHA 1CF7A 4I98B 2ZFWA 1W7PD 4HW0A 1LQ1A 2W25A 2NNNA 3QP5A 4BQAA 4LJZF 3K0LA 3P7NA 3LAPA 2P4WA 4KUMA 4OINF 5CVUA 1I27A 2FBHA 2Q0OA 4LB6B 4IHTA 3K69A 2VBWA 1H9GA 1MJBA 1IN6A 4WXDA 5AIPA 3T8RA 4GYIA 2CGPA 4Q4ZF 3IWZA 4KIBA 5HLHA 2UZKA 2MLGA 3FMRA 2KJCA 2TDXA 2GA2A 1XDSA 2CG4A 1TW2A 3BPVA 5D8LB 3WTWC 3F21A 1IAWA 1U2WA 4JBAA 1K78A 4OIOF 4OMYA 1U5TA 1UB9A 3U2RA 3KEOA 3U1DA 2NNYA 3CLOA 2YR2A 3FMSA 3CO6C 3ECOA 1KA8A 1UCRA 3V7SA 1DUXC 4OIQF 3SZTA 2XAHA 3GYHX 2EFPA 2ISZA 1B9NA 2FBIA 2FNAA 4HDUA 2GQQA 3VB2A 5LEKA 1R1TA 3E3VA 1H9TA 2F5DA 3HTUA 4ZYHA 3ABUA 2BBYA 4QLCU 3BY6A 3ML6A 2IJLA 1STZA 1RI7A 3FX3A 2A5YB 1IN8A 5LGTA 1IUYA 4AIKA 2JPCA 3L00A 4L9JA 1ZH5A 1JGSA 4LG0A 1SMYF 5H6QA 1R5GA 3FXRA 1FZPB 4PGGA 4CDGA 2A3SA 2FBKA 2OQGA 2O8XA 1U5TC 1Z6RA 3LA7A 2FF4A 5L3CA 3JTGA 3GX4X 3R0AA 3IKTA 2YX7A 3GUDA 3ZMTA 2PN6A 2EV0A 2DQRA 3BJ6A 5DDGA 4UVCA 4HF0A 5ICCA 5HDNA 2RVCA 4RB1A 2IW5A 2VC1A 5KK1A 1MJAA 4A0ZA 3JSPA 3C18A 4UXNA 1BBYA 3RKYA 1ZGAA 1ON1A 3DKWA 1RNLA 3DPTA 1USTA 1IRGA 2ZO4A 3E6MA 2W84A 1P4WA 2LF7A 4EV0A 2G7UA 3TQNA 5E1ZB 2F5FA 4ZYGA 2FOKA 4MEXF 4I01A 1DP7P 3REOA 3O6BB 3LSTA 4I0AA 1HXDA 2EK5A 2F5CA 2Z9OA 1XN7A 2ESHA 2PBIA 5FGMA 1DPRA 1R7JA 3V8KA 1T2KA 1YYVA 3T5XA 2EB7A 2P5KA 1QBJA 1BI1A 5D4RA 3W6JB 3C3WA 1TW3A 3R0JA 4CYDA 4L18B 4HLYA 5DCMA 1R22A 5LGUA 5JFRA 1ONVA 3K1NA 1HSJA 4MTEA 3TO7A 1REPC 1S6LA 1USSA 3NQOA 2MD5A 5FB2A 2PFBA 2D1VA 4Y13A 2ZMEA 1L0OC 4EVIA 2FMLA 5LHHA 1IN7A 2XRNA 1C0WA 4MQ9F 2EV5A 1QGPA 3FZVA 3RPUA 3L2CA 2PMUA 2NRAC 4NQWA 4BHPA 1J5YA 2M8EA 3SZPA 4XRFA 2K4BA 2GXGA 5BOXA 2Y75A 3E97A 2LNBA 5E20A 1G6NA 1W5TA 1Z91A 3ZMSA 1SFXA 1I1SA 2F5EA 1YQAA 3HOTA 2M45A 3F8MA 4U7BA 1KGSA 3GFJA 1X3UA 4BXUA 3DQVC 4A6DA 1FBUA 2HEOA 1XMAA 2PI0A 1GXQA 3KCCA 1IN4A 2Q2EA 2R7FA 1QZZA 1XGOA 3GLXA 2MC3A 1LDJA 5E8GA 1R36A 2K86A 3E5UA 1TQPA 4PDKA 1GVJA 2F2EA 2G9WA 2O3FA 3ZN0A 2H27A 1H0MA 1G3WA 3I59A 4UHTA 5HVQC 3SHFA 4KYWA 3V8LA 2V1DA 1D3YA 3N97A 1U5TB 2K02A 4CZZA 4O5VA 4LLGF 4LLNA 4A12A 2NAZA 4QWQA 3EETA 4P9FA 1KU2A 2HGCA 3J80Z 5FLXZ 2DBBA 1B4AA 1KQ0A 1ZRCA 1I1GA 1S29A 5LRRA 1XGNA 1NHAA 4G6QA 3MFKA 4KDPA 4FHTA 5BMZA 2KIMA 4AVPA 1YS7A 1B59A 2C6YA 1W5SA 2OA4A 2O0YA 4EM1A 1SD5A 1SD4A 3C7JA 4JK1X 3JSOA 4IRHA 3N4MA 4G94A 1SAXA 2DPDA 3I0TA 5LHGA 4R8HA 3CJNA 4M9ZA 3WTTC 4N9HA 3RKXA 4ON0A 5LEJA 4Q48A 3WG9A 1I5ZA 5IT9K 1G3YA 1R00A 3ZMVA 4LG0B 1ULYA 3TOBA 4EJWA 2VOOA 4ESFA 3D5LA 3TOAA 4M71A 5IT9Z 3KP4A 1FSHA 2DW4A 3WGHA 4NHJA 4U0VA 5J6XA 2XASA 1T6SA 3HYIA 5LBQA 3Q5FA 2E7XA 1BN5A 1YIOA 3WE3A 4WX9A 3FM3A 3E5XA 2P7VB 2QLZA 3CTAA 5FO5A 5HDKA 2M1BA 3C1DA 4ASNA 3ZP5A 5DYMA 4LMYA 3IKVA 4U7DA 1XSVA 3CUQA 4RAZA 5F6FA 4HBLA 3EYIA 4KIGA 4Q5SF 4L0ZB 2Q8KA 5E17F 2YPRA 1MKMA 4P96A 2IPQX 3VODA 5F64A 3DEUA 2XAFA 3PQJA 4LK0F 5DCFA 4H0EA 5K1YA 2KJBA 1WSUA 1R23A 3Q9VA 2CFXA 1KU3A 5E18F 4EMSA 5CYVA 3ZMZA 2GIVA 3SFZA 2FU4A 1FYMA 3WTSC 3LQQA 1BIBA 2DK5A 1AWCA 2HR3A 3DPLC 5DCMB 3K9TA 5AIQA 4ZYEA 2O61A 3DP7A 1ON2A 2D1HA 3WTZA 1T39A 2RGVA 2E1CA 3HHHA 1ZLJA 3ABTA 3CUQC 1WI9A 4YG2F 1TQMA 3Q9SA 4S05A 2ESNA 3HHGA 4G7ZF 1LJ9A 5DD8A 2O03A 1DDNA 1OR7A 3HSFA 4HZFA 4G6DA 5FD5A 1Z05A 1ZREA 2EJRA 3DF8A 4S04A 3JAMZ 1O3SA 3AAFA 2HDCA 1W7PB 5TJJA 3M7GA 1Y0UA 3PFIA 1IF1A 4RB3C 2HKOA 5ICEA 4EJUA 2A69F 3QU3A 2H6BA 3QU6A 3E5QA 2HZTA 3K1MA 1G3TA 3TDUC 2KIFA 4B8XA 4AIJA 5HS8A 3ERED 1U3EM 1TQIA 2RNJA 1HKTA 3F8FA 3K2ZA 1QO0D 3H92A 2W85A 4MEYF 3GW2A 2YX4A 4ZH4F 3CUOA 3TKYA 1J75A 4P9UA 4LD5A 3LFKA 3L09A 4BHBA 3ZQ7A 2RC4A 3J81K 5HS7A 3CO7C 2Z3YA 3VOEA 1K6OA 4EQQA 1BJAA 2Y0MA 4I2OA 3KLOA 5D5VB 4HV5A 3J81Z 3FMQA 3BJOA 4MHGA 1GXPA 2ETHA 3I59B 5CVRA 4AD9A 2JSCA 4KN7X 4DQ2A 4DNCA 4A0XA 2HYGD 1ZYRF 2HQRA 2L02A 4M72A 4YIFA 4MTDA 4G7HF 1FC3A 2A61A 1ZG3A 4WXHA 4PGHA 2DK8A 2VN2A 2AXLA 3KE2A 1RUNA 1UFMA 1MDMA 1ZARA 1ZLKA 1DPUA 3E6DA 4RB0A 1YLFA 2A6HF 2PJPA 4P5OA 1YO5C 3WE2A 2HFHA 5EEHA 1O57A 3MZYA 1HKQA 3WTVC 4FX0A 4HQEA 4IXAA 3RJPA 3HRUA 2V9VA 5EEGA 2EFOA 5A2QZ 2VC0A 4F7ZA 2CQKA 1XCBA 4Q47A 4WCGA 3BDDA 4OIRF 3SQNA 1I6XA 3LA2A 2ADUA 2LKPA 2LSOA 2AS5F 5LRSA 4ENJA 5ERIA 4G9YA 2KIUA 2YU3A 4HF1A 1IXRC 4L9VA 5F1RA 1O7FA 2EV6A 4RB2C 2M87A 4N9IA 5J8CA 1ZGJA 3K1PA 2HS5A 2K7LA 3JTHA 2CYYA 4BHCA 4YFXF 1PP7U 3S2WA 2COMA 3R61A 2ZXJA 1KYZA 3VEPA 2UXXA 2RDPA 4I02A 3NRVA 4IVNA 1YW9A 4LK1F 5J8FA 1XCVA 5CVVA 3NEUA 3RPQA 2XV4S 4EM0B 4R79A 3RTRA 4HDVA 1MZBA 4OMZA 3D0SA 2Z33A 4IJAA 3GWZA 2FEZA 3GFMA 3RIRA 2H94A 2XHKA 4UVAA 2VOPA 2FA5A 2HYFA 2OU2A 5H6RA 2XROA 1XSXA 3BWGA 3R60A 1FT9A 3KP7A 1HQCA 1BI0A 4UNOA 5CVJA 2EA2A 1B9MA 3ROUA 3RDIA 3IRRA 3H3ZA 1J7KA 1CF7B 2L54A 1R1UA 2GXBA 3FXQA 3PQKA 2HWVA 1ZG1A 5DUKA 2R3SA 3IL2A 2DU9A 1D5VA 1U6GA 2HTSA 3DV8A 2PQ8A 4BAYA 1PP8F 1XGSA 2OAZA 2UXNA 4I7HA 4CGZA 4FX4A 1S3JA 5D5UB 2W24A 1J9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6T A;  2K4J A;  2Z5U A;  5L3D A;  4HOB A;  4OU0 A;  2D45 A;  1KQ8 A;  2QWW A;  4UVB A;  4BYY A;  2DAO A;  3MQ0 A;  2VBZ A;  2XUB A;  1O3T A;  2GAU A;  2HOE A;  2QQA A;  3TO9 A;  2OZU A;  1G4D A;  4A5N A;  1IW7 F;  1P2F A;  4M9S A;  5DV5 A;  5FFX A;  4O6J A;  2P8T A;  2STW A;  1P4X A;  2DLL A;  4MQV A;  2FMY A;  1BI2 A;  3BP8 A;  1K78 B;  3J80 K;  3MZH A;  5FLX K;  2W57 A;  2NYX A;  1IN5 A;  3F3X A;  2QM3 A;  2WWY A;  5K5O A;  4MNU A;  2IT0 A;  4CO8 A;  4D0P A;  3QAH A;  2OBP A;  3IC7 A;  2J5O A;  1R5H A;  5DUI A;  3BJA A;  4M73 A;  3L9F A;  1S7A A;  1J2X A;  1RZ4 A;  5D6F A;  2GZW A;  3GZ6 A;  1PUE E;  3LAJ A;  3BZ6 A;  1WWX A;  2E7W A;  3V4G A;  1F4K A;  1ZRF A;  5K5Q A;  4LFU A;  2Y48 A;  4HX7 A;  4TV7 A;  5ICG A;  3IRQ A;  1L3L A;  3WTU C;  2B0L A;  1MDM B;  1HW5 A;  4M9X A;  5JI6 A;  4ENM A;  3QP6 A;  4KT5 C;  1T38 A;  2PG4 A;  2DO7 A;  1K7A A;  1LDK B;  3RKW A;  3WTY C;  5L3E A;  4LB5 A;  5H20 A;  3FXU A;  1EV7 A;  3FM5 A;  2QZ8 A;  2EFQ A;  1YW7 A;  3I64 A;  3I53 A;  3M8F A;  2QVO A;  4WXC A;  2WV0 A;  1MGT A;  3MWM A;  4CXF A;  1T98 A;  1KU9 A;  1FOK A;  3TGN A;  3P9K A;  5FD6 A;  4KA4 A;  3KFW X;  1JXS A;  2QEN A;  4GCV A;  4O3M A;  5AON A;  3B02 A;  2FNP A;  3F23 A;  4OOI A;  1WRJ A;  2CWE A;  1LNW A;  4RGU A;  3RYP A;  1BC7 C;  1XSD A;  2ZJ2 A;  5E1W A;  2P6S A;  4XBF A;  1FWZ A;  2VT2 A;  2M30 A;  4RGS A;  4Z2Y A;  4EM2 A;  3GO5 A;  1ZG5 A;  5HS9 A;  2BGC A;  2RKH A;  4E70 A;  1QPM A;  1J59 A;  2JPB A;  3WU0 A;  5ILV A;  2UWM A;  1P4A A;  2X4H A;  3EQL F;  2XAQ A;  5BPI A;  3ULQ B;  1OYI A;  3F8B A;  3JW4 A;  3GFI A;  5HDG A;  4U88 A;  1OYW A;  1MD0 A;  2BE5 F;  4IHS A;  2JTV A;  3O3K A;  5BS6 A;  1SD7 A;  4A6E A;  1OPC A;  5K5R A;  4EGY A;  1FPQ A;  2OD5 A;  5DD4 A;  1Q1H A;  2Z99 A;  3TDZ C;  3CDH A;  4L9T A;  3KZY A;  2ZME B;  2DT5 A;  1QQI A;  3V8J A;  1HW1 A;  3BPX A;  2XAJ A;  3JAM K;  4YFN F;  2RV8 A;  4ZZL A;  2XKO A;  3KEQ A;  5D5X B;  4XLN F;  2ZBK A;  3KET A;  4L5I A;  4GGG A;  1LB2 A;  2A07 F;  3E6B A;  1FYK A;  1YTY A;  3M8E A;  2L3D A;  4I09 A;  3MEX A;  3P9I A;  3WGG A;  2ACJ A;  2R7D A;  2HTJ A;  2EFW A;  1SMT A;  1ZRD A;  1YW8 A;  2A68 F;  2P5L C;  3L7W A;  2OZ6 A;  4UUV A;  2FXA A;  4LGW A;  3GF2 A;  4A0Y A;  2JRT A;  4A5M A;  1SFU A;  2EA4 A;  3F6V A;  3KP6 A;  1FBS A;  5D8K B;  3G73 A;  4I0B A;  3KP2 A;  3M1E A;  1RIO H;  5HOO A;  3LA3 A;  1PDN C;  2VON A;  2RQP A;  1J0R A;  1TTY A;  1V4R A;  2QUF A;  4HV6 A;  2IRF G;  1YG2 A;  1FLI A;  3F6O A;  5JVT A;  4RGR A;  1G3S A;  3ZN1 A;  1TNS A;  2H09 A;  1FSE A;  4HQM A;  5TRD A;  4P55 A;  1IXS B;  3GZ5 A;  1U78 A;  2IA0 A;  1Z6T A;  3F8C A;  1BM9 A;  3LQR A;  5LLQ A;  2EWN A;  1K79 A;  1IXC A;  4GO1 A;  4K2E A;  1CGP A;  4PZJ A;  2MH2 A;  1U8R A;  2ZKZ A;  2MLK A;  3M9A A;  4KMU X;  2NS0 A;  1KU7 A;  5ED4 A;  1YS6 A;  2XAG A;  4AIH A;  3ZPL A;  2E1N A;  2DQL A;  5A2Q K;  1FYL A;  3G3Z A;  1LDD A;  3IWF A;  2G7H A;  2GWR A;  5DEQ A;  1P6R A;  2MA3 A;  3FHZ A;  1IRF A;  5BQT A;  1Z9C A;  3O2P E;  3TO6 A;  3F72 A;  3MAJ A;  1Z7U A;  5L3B A;  4L0Y B;  5CLS A;  3WGI A;  2QBY A;  5ILS A;  2L4A A;  3KZZ A;  1OMI A;  4L5J A;  1S8N A;  4ENN A;  4UV8 A;  1F1Z A;  4AWX B;  5FFZ A;  4HAM A;  2FQ3 A;  4GXO A;  1EH6 A;  3RI4 A;  4WWC A;  4EJT A;  2O6G E;  3R6S A;  3V7R A;  2V1X A;  3CUQ B;  1HKS A;  3MCZ A;  4KIF A;  3KP3 A;  4RS8 A;  5CJ9 A;  1F5T A;  1XMK A;  1IZ1 A;  3QOP A;  4EGZ A;  2H6C A;  3HUG A;  2IA1 A;  2VBY A;  3QPH A;  5D5W B;  2P7C B;  1JHH A;  3W6K B;  1B1B A;  5CVI A;  2HKX A;  5ICF A;  4HYE A;  2VXZ A;  5BPD A;  1TLH B;  2ZNZ A;  2DI3 A;  1LVA A;  2LF8 A;  2V1U A;  3HSE A;  1XB4 A;  2GA1 A;  4N0B A;  4YFK F;  1BI3 A;  3BRO A;  1YFH A;  4PCQ A;  4MGR A;  1TBX A;  5L3G A;  2QQ9 A;  2WTE A;  1AOY A;  1P92 A;  5IT3 A;  3OV8 A;  1O7L A;  4KNY A;  2D2W A;  1W4M A;  3KLN A;  1BIA A;  1BC8 C;  4FT8 A;  2PMH A;  5D6E A;  2DTR A;  2VE9 A;  1MJ9 A;  2VT3 A;  3ISP A;  2XIG A;  4ZYD A;  1E17 A;  2X0L A;  2CW0 F;  2ISY A;  4CHU A;  1D8J A;  5LGN A;  3U9G A;  5D4S A;  1ODD A;  2DFI A;  1OYY A;  1RUO A;  1W7P A;  3I71 A;  3P9C A;  3GFL A;  1S7O A;  3H3U A;  4IRI A;  4KFC A;  2J5P A;  5KVR A;  4KIC A;  2XVC A;  1V3F A;  5JHU A;  2QYO A;  4G8X A;  4BH9 A;  4ZZD A;  2ELH A;  1KYW A;  2ZCW A;  4XLP F;  4WK8 F;  3EDP A;  3I4P A;  4RAY A;  1R58 A;  1B6A A;  5E8I A;  3ZMU A;  3V7C A;  2IA2 A;  4ESB A;  3HOS A;  2EFN A;  2KRF A;  4NB5 A;  1R1V A;  4B09 A;  4YII A;  2VOD A;  1QZY A;  4HA8 A;  1A04 A;  1FP1 D;  1TNT A;  4JQF A;  2RN7 A;  2VBX A;  4ESJ A;  2KKO A;  4Y17 A;  4OIP F;  3FWE A;  4HX4 A;  1HW2 A;  3ELK A;  4L9N A;  4HF2 A;  2WC2 A;  2VE8 A;  3I54 A;  4IRG A;  4G7O F;  2A6E F;  2CSO A;  3T0Y A;  1JHF A;  2PEX A;  1Z1D A;  4Y15 A;  4M6Y A;  3J7A O;  4UV9 A;  1O3R A;  3SXY A;  3OOP A;  3F8N A;  2BEO A;  3GVA A;  4EJO A;  1SD6 A;  2FSW A;  1HBX G;  5HLI A;  1ZHF A;  1O3Q A;  2V6C A;  5HLG A;  3HTS B;  1OKR A;  2XKP A;  3FF5 A;  4ETS A;  2YSR A;  1VTN C;  3IHU A;  4EJV A;  3T8T A;  1XDU A;  6PAX A;  2JT1 A;  4BNC A;  1FP2 A;  3QRF F;  2BYV E;  1KQ9 A;  2STT A;  1ZAO A;  2DPU A;  2CO5 A;  3I5U A;  3WTX C;  4M6X A;  3DXJ F;  5ILU A;  4U0Y A;  1FX7 A;  2QBY B;  4U0W A;  2FE3 A;  1XGM A;  1LEA A;  3LWF A;  2QQB A;  3DFG A;  1EH7 A;  3EUH A;  4GYG A;  4HX8 A;  3COA C;  3RYR A;  1JE8 A;  1D8K A;  5L3F A;  1HST A;  1SFE A;  5E1X A;  5LHI A;  2FRH A;  1F9N A;  3R4K A;  1WQ2 A;  3B73 A;  4XSX F;  2IP2 A;  1GHC A;  1FY7 A;  4KMF A;  3EYY A;  5JR3 A;  4XSZ F;  2BV6 A;  2JZY A;  2HQN A;  4LLL A;  3GEZ A;  3I58 A;  4IPA A;  2V79 A;  3F22 A;  1E2X A;  4RGX A;  3HRS A;  1T0F A;  1EH8 A;  2XGX A;  2IVM A;  2ZNY A;  1FNN A;  1UHW A;  1LEB A;  2L4M A;  3HRM A;  4IF4 A;  1BOA A;  2OQR A;  3E6C C;  3BOQ A;  2L01 A;  2MBF A;  1FBQ A;  2MH9 A;  3GXO A;  3WU1 B;  4ENK A;  2LDU A;  4WF2 A;  1WKM A;  1ZN2 A;  4M74 A;  3HSR A;  4CIC A;  3HIF A;  3QPT A;  4HLX A;  3HRT A;  2PLY A;  1UHM A;  4KN4 X;  3T1B A;  4R1H A;  3VFZ A;  1QNT A;  2M5W A;  1XD7 A;  4A2U A;  3WOD F;  3ZMD A;  3KP5 A;  2K27 A;  2P5V A;  3ECH A;  1CF7 A;  4I98 B;  2ZFW A;  1W7P D;  4HW0 A;  1LQ1 A;  2W25 A;  2NNN A;  3QP5 A;  4BQA A;  4LJZ F;  3K0L A;  3P7N A;  3LAP A;  2P4W A;  4KUM A;  4OIN F;  5CVU A;  1I27 A;  2FBH A;  2Q0O A;  4LB6 B;  4IHT A;  3K69 A;  2VBW A;  1H9G A;  1MJB A;  1IN6 A;  4WXD A;  5AIP A;  3T8R A;  4GYI A;  2CGP A;  4Q4Z F;  3IWZ A;  4KIB A;  5HLH A;  2UZK A;  2MLG A;  3FMR A;  2KJC A;  2TDX A;  2GA2 A;  1XDS A;  2CG4 A;  1TW2 A;  3BPV A;  5D8L B;  3WTW C;  3F21 A;  1IAW A;  1U2W A;  4JBA A;  1K78 A;  4OIO F;  4OMY A;  1U5T A;  1UB9 A;  3U2R A;  3KEO A;  3U1D A;  2NNY A;  3CLO A;  2YR2 A;  3FMS A;  3CO6 C;  3ECO A;  1KA8 A;  1UCR A;  3V7S A;  1DUX C;  4OIQ F;  3SZT A;  2XAH A;  3GYH X;  2EFP A;  2ISZ A;  1B9N A;  2FBI A;  2FNA A;  4HDU A;  2GQQ A;  3VB2 A;  5LEK A;  1R1T A;  3E3V A;  1H9T A;  2F5D A;  3HTU A;  4ZYH A;  3ABU A;  2BBY A;  4QLC U;  3BY6 A;  3ML6 A;  2IJL A;  1STZ A;  1RI7 A;  3FX3 A;  2A5Y B;  1IN8 A;  5LGT A;  1IUY A;  4AIK A;  2JPC A;  3L00 A;  4L9J A;  1ZH5 A;  1JGS A;  4LG0 A;  1SMY F;  5H6Q A;  1R5G A;  3FXR A;  1FZP B;  4PGG A;  4CDG A;  2A3S A;  2FBK A;  2OQG A;  2O8X A;  1U5T C;  1Z6R A;  3LA7 A;  2FF4 A;  5L3C A;  3JTG A;  3GX4 X;  3R0A A;  3IKT A;  2YX7 A;  3GUD A;  3ZMT A;  2PN6 A;  2EV0 A;  2DQR A;  3BJ6 A;  5DDG A;  4UVC A;  4HF0 A;  5ICC A;  5HDN A;  2RVC A;  4RB1 A;  2IW5 A;  2VC1 A;  5KK1 A;  1MJA A;  4A0Z A;  3JSP A;  3C18 A;  4UXN A;  1BBY A;  3RKY A;  1ZGA A;  1ON1 A;  3DKW A;  1RNL A;  3DPT A;  1UST A;  1IRG A;  2ZO4 A;  3E6M A;  2W84 A;  1P4W A;  2LF7 A;  4EV0 A;  2G7U A;  3TQN A;  5E1Z B;  2F5F A;  4ZYG A;  2FOK A;  4MEX F;  4I01 A;  1DP7 P;  3REO A;  3O6B B;  3LST A;  4I0A A;  1HXD A;  2EK5 A;  2F5C A;  2Z9O A;  1XN7 A;  2ESH A;  2PBI A;  5FGM A;  1DPR A;  1R7J A;  3V8K A;  1T2K A;  1YYV A;  3T5X A;  2EB7 A;  2P5K A;  1QBJ A;  1BI1 A;  5D4R A;  3W6J B;  3C3W A;  1TW3 A;  3R0J A;  4CYD A;  4L18 B;  4HLY A;  5DCM A;  1R22 A;  5LGU A;  5JFR A;  1ONV A;  3K1N A;  1HSJ A;  4MTE A;  3TO7 A;  1REP C;  1S6L A;  1USS A;  3NQO A;  2MD5 A;  5FB2 A;  2PFB A;  2D1V A;  4Y13 A;  2ZME A;  1L0O C;  4EVI A;  2FML A;  5LHH A;  1IN7 A;  2XRN A;  1C0W A;  4MQ9 F;  2EV5 A;  1QGP A;  3FZV A;  3RPU A;  3L2C A;  2PMU A;  2NRA C;  4NQW A;  4BHP A;  1J5Y A;  2M8E A;  3SZP A;  4XRF A;  2K4B A;  2GXG A;  5BOX A;  2Y75 A;  3E97 A;  2LNB A;  5E20 A;  1G6N A;  1W5T A;  1Z91 A;  3ZMS A;  1SFX A;  1I1S A;  2F5E A;  1YQA A;  3HOT A;  2M45 A;  3F8M A;  4U7B A;  1KGS A;  3GFJ A;  1X3U A;  4BXU A;  3DQV C;  4A6D A;  1FBU A;  2HEO A;  1XMA A;  2PI0 A;  1GXQ A;  3KCC A;  1IN4 A;  2Q2E A;  2R7F A;  1QZZ A;  1XGO A;  3GLX A;  2MC3 A;  1LDJ A;  5E8G A;  1R36 A;  2K86 A;  3E5U A;  1TQP A;  4PDK A;  1GVJ A;  2F2E A;  2G9W A;  2O3F A;  3ZN0 A;  2H27 A;  1H0M A;  1G3W A;  3I59 A;  4UHT A;  5HVQ C;  3SHF A;  4KYW A;  3V8L A;  2V1D A;  1D3Y A;  3N97 A;  1U5T B;  2K02 A;  4CZZ A;  4O5V A;  4LLG F;  4LLN A;  4A12 A;  2NAZ A;  4QWQ A;  3EET A;  4P9F A;  1KU2 A;  2HGC A;  3J80 Z;  5FLX Z;  2DBB A;  1B4A A;  1KQ0 A;  1ZRC A;  1I1G A;  1S29 A;  5LRR A;  1XGN A;  1NHA A;  4G6Q A;  3MFK A;  4KDP A;  4FHT A;  5BMZ A;  2KIM A;  4AVP A;  1YS7 A;  1B59 A;  2C6Y A;  1W5S A;  2OA4 A;  2O0Y A;  4EM1 A;  1SD5 A;  1SD4 A;  3C7J A;  4JK1 X;  3JSO A;  4IRH A;  3N4M A;  4G94 A;  1SAX A;  2DPD A;  3I0T A;  5LHG A;  4R8H A;  3CJN A;  4M9Z A;  3WTT C;  4N9H A;  3RKX A;  4ON0 A;  5LEJ A;  4Q48 A;  3WG9 A;  1I5Z A;  5IT9 K;  1G3Y A;  1R00 A;  3ZMV A;  4LG0 B;  1ULY A;  3TOB A;  4EJW A;  2VOO A;  4ESF A;  3D5L A;  3TOA A;  4M71 A;  5IT9 Z;  3KP4 A;  1FSH A;  2DW4 A;  3WGH A;  4NHJ A;  4U0V A;  5J6X A;  2XAS A;  1T6S A;  3HYI A;  5LBQ A;  3Q5F A;  2E7X A;  1BN5 A;  1YIO A;  3WE3 A;  4WX9 A;  3FM3 A;  3E5X A;  2P7V B;  2QLZ A;  3CTA A;  5FO5 A;  5HDK A;  2M1B A;  3C1D A;  4ASN A;  3ZP5 A;  5DYM A;  4LMY A;  3IKV A;  4U7D A;  1XSV A;  3CUQ A;  4RAZ A;  5F6F A;  4HBL A;  3EYI A;  4KIG A;  4Q5S F;  4L0Z B;  2Q8K A;  5E17 F;  2YPR A;  1MKM A;  4P96 A;  2IPQ X;  3VOD A;  5F64 A;  3DEU A;  2XAF A;  3PQJ A;  4LK0 F;  5DCF A;  4H0E A;  5K1Y A;  2KJB A;  1WSU A;  1R23 A;  3Q9V A;  2CFX A;  1KU3 A;  5E18 F;  4EMS A;  5CYV A;  3ZMZ A;  2GIV A;  3SFZ A;  2FU4 A;  1FYM A;  3WTS C;  3LQQ A;  1BIB A;  2DK5 A;  1AWC A;  2HR3 A;  3DPL C;  5DCM B;  3K9T A;  5AIQ A;  4ZYE A;  2O61 A;  3DP7 A;  1ON2 A;  2D1H A;  3WTZ A;  1T39 A;  2RGV A;  2E1C A;  3HHH A;  1ZLJ A;  3ABT A;  3CUQ C;  1WI9 A;  4YG2 F;  1TQM A;  3Q9S A;  4S05 A;  2ESN A;  3HHG A;  4G7Z F;  1LJ9 A;  5DD8 A;  2O03 A;  1DDN A;  1OR7 A;  3HSF A;  4HZF A;  4G6D A;  5FD5 A;  1Z05 A;  1ZRE A;  2EJR A;  3DF8 A;  4S04 A;  3JAM Z;  1O3S A;  3AAF A;  2HDC A;  1W7P B;  5TJJ A;  3M7G A;  1Y0U A;  3PFI A;  1IF1 A;  4RB3 C;  2HKO A;  5ICE A;  4EJU A;  2A69 F;  3QU3 A;  2H6B A;  3QU6 A;  3E5Q A;  2HZT A;  3K1M A;  1G3T A;  3TDU C;  2KIF A;  4B8X A;  4AIJ A;  5HS8 A;  3ERE D;  1U3E M;  1TQI A;  2RNJ A;  1HKT A;  3F8F A;  3K2Z A;  1QO0 D;  3H92 A;  2W85 A;  4MEY F;  3GW2 A;  2YX4 A;  4ZH4 F;  3CUO A;  3TKY A;  1J75 A;  4P9U A;  4LD5 A;  3LFK A;  3L09 A;  4BHB A;  3ZQ7 A;  2RC4 A;  3J81 K;  5HS7 A;  3CO7 C;  2Z3Y A;  3VOE A;  1K6O A;  4EQQ A;  1BJA A;  2Y0M A;  4I2O A;  3KLO A;  5D5V B;  4HV5 A;  3J81 Z;  3FMQ A;  3BJO A;  4MHG A;  1GXP A;  2ETH A;  3I59 B;  5CVR A;  4AD9 A;  2JSC A;  4KN7 X;  4DQ2 A;  4DNC A;  4A0X A;  2HYG D;  1ZYR F;  2HQR A;  2L02 A;  4M72 A;  4YIF A;  4MTD A;  4G7H F;  1FC3 A;  2A61 A;  1ZG3 A;  4WXH A;  4PGH A;  2DK8 A;  2VN2 A;  2AXL A;  3KE2 A;  1RUN A;  1UFM A;  1MDM A;  1ZAR A;  1ZLK A;  1DPU A;  3E6D A;  4RB0 A;  1YLF A;  2A6H F;  2PJP A;  4P5O A;  1YO5 C;  3WE2 A;  2HFH A;  5EEH A;  1O57 A;  3MZY A;  1HKQ A;  3WTV C;  4FX0 A;  4HQE A;  4IXA A;  3RJP A;  3HRU A;  2V9V A;  5EEG A;  2EFO A;  5A2Q Z;  2VC0 A;  4F7Z A;  2CQK A;  1XCB A;  4Q47 A;  4WCG A;  3BDD A;  4OIR F;  3SQN A;  1I6X A;  3LA2 A;  2ADU A;  2LKP A;  2LSO A;  2AS5 F;  5LRS A;  4ENJ A;  5ERI A;  4G9Y A;  2KIU A;  2YU3 A;  4HF1 A;  1IXR C;  4L9V A;  5F1R A;  1O7F A;  2EV6 A;  4RB2 C;  2M87 A;  4N9I A;  5J8C A;  1ZGJ A;  3K1P A;  2HS5 A;  2K7L A;  3JTH A;  2CYY A;  4BHC A;  4YFX F;  1PP7 U;  3S2W A;  2COM A;  3R61 A;  2ZXJ A;  1KYZ A;  3VEP A;  2UXX A;  2RDP A;  4I02 A;  3NRV A;  4IVN A;  1YW9 A;  4LK1 F;  5J8F A;  1XCV A;  5CVV A;  3NEU A;  3RPQ A;  2XV4 S;  4EM0 B;  4R79 A;  3RTR A;  4HDV A;  1MZB A;  4OMZ A;  3D0S A;  2Z33 A;  4IJA A;  3GWZ A;  2FEZ A;  3GFM A;  3RIR A;  2H94 A;  2XHK A;  4UVA A;  2VOP A;  2FA5 A;  2HYF A;  2OU2 A;  5H6R A;  2XRO A;  1XSX A;  3BWG A;  3R60 A;  1FT9 A;  3KP7 A;  1HQC A;  1BI0 A;  4UNO A;  5CVJ A;  2EA2 A;  1B9M A;  3ROU A;  3RDI A;  3IRR A;  3H3Z A;  1J7K A;  1CF7 B;  2L54 A;  1R1U A;  2GXB A;  3FXQ A;  3PQK A;  2HWV A;  1ZG1 A;  5DUK A;  2R3S A;  3IL2 A;  2DU9 A;  1D5V A;  1U6G A;  2HTS A;  3DV8 A;  2PQ8 A;  4BAY A;  1PP8 F;  1XGS A;  2OAZ A;  2UXN A;  4I7H A;  4CGZ A;  4FX4 A;  1S3J A;  5D5U B;  2W24 A;  1J9I A; 
#chains in the Genus database with same CATH topology
 3CES A;  5DTD A;  1RR8 C;  2LFB A;  3HB9 A;  2P6T A;  4F52 A;  2K4J A;  4IZZ A;  2Z5U A;  1NG6 A;  5L3D A;  4HOB A;  3GTO J;  4OU0 A;  1DU0 A;  2KT0 A;  1MMN A;  2D45 A;  1Z67 A;  1KQ8 A;  1ETK A;  2QWW A;  4UVB A;  1OQY A;  4BYY A;  2DAO A;  3MQ0 A;  4DGW B;  2DXI A;  2VBZ A;  3K4B A;  2XUB A;  1O3T A;  1UZC A;  2GAU A;  4DZP A;  2HOE A;  3TL4 X;  2QQA A;  5EG0 A;  4YIR X;  3K4J A;  5E3M A;  3TO9 A;  4J00 A;  1GUU A;  2LR8 A;  2OZU A;  1G4D A;  4A5N A;  1IW7 F;  1P2F A;  1D0Z A;  3DKX A;  1IV6 A;  4M9S A;  3BR6 A;  2HDD A;  5DV5 A;  5FFX A;  2Y9Z A;  1POG A;  2P0W A;  3S2D J;  4M3D A;  4O6J A;  1QVT A;  2P8T A;  2STW A;  4YEJ A;  1P4X A;  1G2H A;  2DLL A;  4MQV A;  2FMY A;  2L9V A;  3CMA I;  1BI2 A;  3BP8 A;  5GAE J;  1K78 B;  3L2R A;  1QHG A;  5KHD A;  3J80 K;  3MZH A;  5FLX K;  1PJR A;  2W57 A;  2NYX A;  2X1D A;  3G4S I;  1IN5 A;  3F3X A;  2QM3 A;  2WWY A;  1TWC J;  3L2U A;  5K5O A;  4MNU A;  2IT0 A;  4XL9 A;  2BXY A;  4CO8 A;  4D0P A;  2NVX J;  2HXO A;  1X1D A;  3QAH A;  2OBP A;  3IC7 A;  1X2M A;  2J5O A;  2X6O A;  3U21 A;  1R5H A;  2CUJ A;  1MBH A;  5DUI A;  3BJA A;  4M73 A;  3L9F A;  1S7A A;  2Z2S B;  3H9Q A;  1ITY A;  1J2X A;  1RZ4 A;  3S3O A;  5D6F A;  2GZW A;  2HVR A;  4MO7 A;  3GZ6 A;  1UHS A;  1PUE E;  3E1S A;  3LAJ A;  1SC7 A;  2R7W A;  3HOX J;  3BZ6 A;  1WWX A;  1EA3 A;  2L0K A;  1VQN I;  3EUA A;  2E7W A;  3ESW B;  3V4G A;  1F4K A;  3HXL A;  1ZRF A;  2KRH A;  5K5Q A;  3CP2 A;  4LFU A;  5E3N A;  1OCP A;  1TWG J;  2Y48 A;  4HX7 A;  4TV7 A;  2DDA A;  3VDX A;  5ICG A;  2V9P A;  1P7I A;  2KP6 A;  5TGT A;  4XKC A;  3X2Q H;  3IRQ A;  3GZN B;  2DA6 A;  2KRC A;  3WHC A;  3WTU C;  1L3L A;  1D1C A;  2B0L A;  1T8I A;  4Y4R A;  3OMY A;  1MDM B;  4IHX A;  1HW5 A;  4M9X A;  1JUP A;  3LFU A;  5JI6 A;  4ENM A;  3QP6 A;  2QKM B;  3IP4 B;  3FK6 A;  4KT5 C;  3OYI A;  1A31 A;  4IO9 F;  2R7U A;  1T38 A;  2PG4 A;  2DO7 A;  3K4L A;  4EM1 A;  3GTJ J;  2XAU A;  2K3F A;  1K7A A;  3FKI J;  1LDK B;  4XLH A;  3ZR8 X;  3LMM A;  4QPO A;  3RKW A;  3WTY C;  3G71 I;  2XDV A;  5L3E A;  1XMX A;  5GAH J;  4BE1 A;  4LB5 A;  5H20 A;  4J19 A;  3FXU A;  1EV7 A;  5B1B H;  3FM5 A;  2QZ8 A;  1MSF C;  2EFQ A;  1FIA A;  1YW7 A;  3SYT A;  3LSM A;  3I64 A;  3JRH A;  2CUE A;  1VFC A;  3I53 A;  3M8F A;  1OCC H;  2QVO A;  4WXC A;  2LMD A;  2WV0 A;  3LSI A;  3LSJ A;  1U0J A;  5KAI C;  1MGT A;  3MWM A;  2I8D A;  3ABM H;  3DPU A;  4CUG A;  4CXF A;  2CFO A;  1JUM A;  1T98 A;  1KU9 A;  1FOK A;  1Y0N A;  1ETV A;  3TGN A;  3PSF A;  4MFD A;  5DS9 A;  3P9K A;  2DCE A;  3OR1 C;  5FD6 A;  4KA4 A;  3A0H C;  3KFW X;  1JXS A;  2LRD A;  4FE7 A;  2QEN A;  2OCC H;  3J7Y J;  4GCV A;  4O3M A;  5AON A;  3B02 A;  4C3H J;  3AG1 H;  2FNP A;  3F23 A;  4OOI A;  1WRJ A;  5C44 J;  2CWE A;  2M3A A;  2VAS A;  1LNW A;  4RGU A;  3RYP A;  4ITV A;  3S1R J;  3CCR I;  1BC7 C;  1XSD A;  2ZJ2 A;  2F48 A;  5CQE A;  5E1W A;  3S32 A;  1S72 I;  4UUS A;  2P6S A;  4XBF A;  1JKO C;  1FWZ A;  2VT2 A;  2M30 A;  2X51 A;  4RGS A;  2ZXH A;  3A01 B;  4Z2Y A;  4BKX A;  4EM2 A;  2FJ1 A;  2NVQ J;  5FLM J;  1ZR4 A;  3GO5 A;  1ZG5 A;  5HS9 A;  4IHY A;  1OCO H;  2BGC A;  2RKH A;  3SDG A;  4E70 A;  1QPM A;  3L2Q A;  2JPB A;  4XNF A;  3WU0 A;  1VQO I;  1J59 A;  5ILV A;  2UWM A;  1P4A A;  2KZG A;  3OL4 A;  2X4H A;  3EQL F;  2XAQ A;  5BPI A;  4B48 A;  4XOR A;  3ULQ B;  1HOM A;  5F27 A;  1OYI A;  3F8B A;  3JW4 A;  3GFI A;  5HDG A;  1VZ0 A;  2CS3 A;  4U88 A;  1OYW A;  2JA7 J;  4V2F A;  1MD0 A;  2BE5 F;  2E35 A;  4IHS A;  2JTV A;  2OC6 A;  3O3K A;  5BS6 A;  1SD7 A;  4A6E A;  1AA7 A;  2QGU A;  1WPK A;  1AKH A;  3LSP A;  3IH2 A;  1FIP A;  1OPC A;  5K5R A;  2ZXW H;  2WA0 A;  4EGY A;  1FPQ A;  2OD5 A;  5DD4 A;  1Q1H A;  2F4M B;  4BBR J;  4OAY A;  1U9N A;  2V6E A;  3HOV J;  2Z99 A;  4PSX A;  3TDZ C;  3CDH A;  1WJF A;  1QHH D;  4L9T A;  3KZY A;  1NK2 P;  2ZME B;  2DT5 A;  2PJR A;  2VJI A;  4MIM A;  2CQQ A;  1QQI A;  5CPR B;  3V8J A;  5J3L A;  1HW1 A;  3BPX A;  4IX7 A;  1YRN B;  3OS1 A;  1V5G A;  2JRM A;  2XAJ A;  3JAM K;  2VB6 A;  4YFN F;  4OAZ A;  2RV8 A;  3CP8 A;  2XKO A;  4ZZL A;  3KEQ A;  2ZJP F;  1XTA A;  1JT0 A;  4Y33 A;  5FRM A;  3LSH A;  3HPH A;  5D5X B;  1LFB A;  4XLN F;  3GTG J;  2ZBK A;  3KET A;  2VPR A;  1JKR C;  4L5I A;  2WV1 A;  3OYH A;  4GGG A;  4XLC A;  1HC8 A;  4NQW B;  1LB2 A;  3BG7 A;  3BCA A;  2A07 F;  2R7T A;  4HRI A;  3HJE A;  1FOX A;  2LBF A;  3E6B A;  1MBF A;  2FX0 A;  1PVE A;  3FKJ A;  1FYK A;  1YTY A;  2NS8 A;  2XB0 X;  2L3D A;  3M8E A;  4I09 A;  4FQG A;  3MEX A;  3OOU A;  3MKL A;  3P9I A;  4UUT A;  2ZSH B;  3WGG A;  4RLF A;  2VKH A;  2R7D A;  2ACJ A;  1N77 A;  4XOP A;  2HTJ A;  3VSL A;  2EFW A;  3ONQ A;  1SMT A;  3FBN B;  1ZRD A;  1YW8 A;  2A68 F;  3PNY A;  3TP0 A;  2P5L C;  3L7W A;  4W1U A;  2OZ6 A;  4NUB A;  4UUV A;  2FXA A;  4BE2 A;  3FK7 A;  4ANJ A;  3SFI A;  4LGW A;  3JRD A;  1F36 A;  2MW8 A;  5J4Y A;  3GF2 A;  3PIO F;  3HOZ J;  3FXL A;  2DTZ A;  1V55 H;  1BJZ A;  3OL3 A;  1D1A A;  2Y2Z A;  4A0Y A;  2JRT A;  3BR2 A;  4A5M A;  1SFU A;  2EA4 A;  3F6V A;  5FKO A;  2VLA A;  1ERD A;  1MBK A;  4X1E A;  3JR9 A;  3KP6 A;  3CCJ I;  1FBS A;  5D8K B;  3G73 A;  2Q2E B;  5K7Z A;  4I0B A;  3KP2 A;  1I3A A;  1R4N B;  3M1E A;  4CA0 A;  1RIO H;  3HKZ N;  2CUF A;  1OR7 C;  2X6W A;  5HOO A;  3LA3 A;  1PDN C;  4KIS A;  2VON A;  2RQP A;  1J0R A;  4J01 A;  2DA5 A;  1TTY A;  1V4R A;  2M4G A;  5B66 C;  4XON A;  2QUF A;  3S1N J;  3SEZ A;  4HV6 A;  5C4X J;  4Y7N J;  2IRF G;  4Z6Y A;  1KZH A;  1YG2 A;  1FLI A;  3F6O A;  5H2F C;  1Z77 A;  5JVT A;  5M3F J;  4CYC B;  4RGR A;  1G3S A;  3ZN1 A;  1NK3 P;  1TNS A;  2H09 A;  1T95 A;  1FSE A;  4HQM A;  1LVK A;  5TRD A;  4P55 A;  1IXS B;  3GZ5 A;  3JRI A;  3SJM A;  1YIT I;  1U78 A;  2IA0 A;  1Z6T A;  3F8C A;  1BM9 A;  2HXI A;  3OYF A;  3LQR A;  5LLQ A;  9ANT A;  1Y6I A;  1GVD A;  2EWN A;  2KIS A;  3QOE A;  5FRO A;  2ID6 A;  1K79 A;  1IXC A;  2JQ7 A;  2NVU B;  4GO1 A;  3CME I;  2QSF X;  3OY9 A;  4BEH B;  2MGQ A;  4K2E A;  4XLE A;  1B8I A;  1CGP A;  4BQN A;  4B43 A;  4PZJ A;  2MH2 A;  2KLO A;  1U8R A;  2ZKZ A;  2MLK A;  3M9A A;  3ZQQ A;  4BY1 J;  2I5U A;  3NAU A;  2NS0 A;  4KMU X;  1KU7 A;  5ED4 A;  1YS6 A;  4XID A;  4M3F A;  3W2V A;  2K85 A;  2XAG A;  5DM7 F;  1I39 A;  4AIH A;  3ZPL A;  2DOA A;  3ZQH A;  1VQ5 I;  3HG9 A;  1DP3 A;  2E1N A;  2NOJ B;  3FBI B;  4QIW N;  2DA3 A;  2DQL A;  5A2Q K;  3PO2 J;  5JLW A;  1O4X A;  1FYL A;  3G3Z A;  4XLF A;  4QTR A;  1LDD A;  4E6K G;  3ASN H;  5IP6 A;  5GPC A;  3IWF A;  1ETQ A;  3AKZ A;  1ETO A;  3CMM A;  2G7H A;  2GWR A;  1ZQ3 P;  2OCE A;  5DEQ A;  3CJR B;  1P6R A;  1WJ5 A;  2H8W A;  2MA3 A;  1HLV A;  3FHZ A;  5IP9 J;  1ACI A;  1IRF A;  5BQT A;  2DFF A;  1JGG A;  2OJE D;  1X1B A;  1N75 A;  3BCB A;  1Z9C A;  3O2P E;  1MMG A;  1VND A;  1TP4 A;  3C2H A;  3TO6 A;  3F72 A;  4ABZ A;  1YOV B;  3MAJ A;  1Z7U A;  5L3B A;  1SVL A;  4L0Y B;  3J7Z I;  5CLS A;  1APL C;  3WGI A;  2QBY A;  4CCO A;  5ILS A;  3OYC A;  2L4A A;  3PNV A;  3KZZ A;  1OMI A;  4L5J A;  4AUX A;  4AID A;  5GP9 A;  1TT0 A;  1S8N A;  4ENN A;  4UV8 A;  1F1Z A;  2NS7 A;  3TW7 A;  4AWX B;  5FFZ A;  2E1O A;  3KYL A;  1WZ2 A;  4XQF A;  1KON A;  4HAM A;  2FQ3 A;  4GXO A;  1EH6 A;  3RI4 A;  3ZCO A;  3BQZ A;  4BQQ A;  4WWC A;  2W00 A;  4EJT A;  2O6G E;  3R6S A;  3V7R A;  5IYC J;  3QOD A;  2V1X A;  3M8J A;  3CUQ B;  1HKS A;  3MCZ A;  4KIF A;  3KP3 A;  1ETX A;  4RS8 A;  5CJ9 A;  1F5T A;  3I56 I;  1XMK A;  1IZ1 A;  2EIM H;  3QOP A;  2ELK A;  2WBM A;  4EGZ A;  2H6C A;  1E3P A;  3CJQ B;  3HUG A;  2IA1 A;  2VBY A;  2RRE A;  3QPH A;  3JRF A;  5D5W B;  3OYK A;  3WHB A;  2P7C B;  1JHH A;  3W6K B;  1B1B A;  2ECB A;  5CVI A;  4C3J J;  2HOT A;  2BHY A;  2HKX A;  4NBQ A;  4F93 B;  5ICF A;  4HYE A;  3U1K A;  2EPF A;  3MKW B;  2R7Q A;  2V1N A;  2VXZ A;  3RCO A;  3DCF A;  2LTP A;  4F91 B;  5BPD A;  1TLH B;  2ZNZ A;  2QKL B;  2DI3 A;  1LVA A;  2LF8 A;  2V1U A;  3HSE A;  1XB4 A;  1K61 A;  2GA1 A;  2NOG A;  4N0B A;  4YFK F;  1BI3 A;  3BRO A;  1YFH A;  3K10 A;  4PCQ A;  4MGR A;  1TBX A;  5L3G A;  4BQO A;  2QQ9 A;  2WTE A;  1AOY A;  1P92 A;  3MN2 A;  4XRS A;  4PFP A;  5IT3 A;  1IDY A;  3F0C A;  3H36 A;  4XKW A;  3OV8 A;  1O7L A;  4KNY A;  2D2W A;  2DA7 A;  4C30 A;  1W4M A;  2PMZ N;  3W2A A;  2X9D A;  3KLN A;  1AU7 A;  1BIA A;  4HNT A;  1BC8 C;  4A3F J;  2E1M C;  4F3Q A;  2P81 A;  1WVR A;  4FT8 A;  4CSW A;  3GTM J;  2X6X A;  2PMH A;  3JRG A;  2MD0 A;  2ZB9 A;  5D6E A;  2DTR A;  2CW8 A;  1RRJ A;  2KFD A;  1X1P A;  4X6A J;  3HBL A;  2DOF A;  3IH3 A;  4KJZ A;  3CDL A;  2CMP A;  4N4N B;  1I6H J;  3A1Y A;  2VE9 A;  1MJ9 A;  2PJR B;  2R92 J;  1FTT A;  2R7S A;  1RC9 A;  2VT3 A;  2GM4 A;  3BT9 A;  3H9J A;  4IOC F;  3ISP A;  2XIG A;  1Z21 A;  4D9J A;  4ZYD A;  1XS9 A;  2Y31 A;  3BZC A;  1E17 A;  2X0L A;  2CW0 F;  2ISY A;  4CHU A;  1D8J A;  1W0U A;  5LGN A;  2VJJ A;  3U9G A;  3DTE A;  5D4S A;  5JLX A;  1ODD A;  1K6Y A;  2DFI A;  1OYY A;  1J09 A;  1RUO A;  2DA1 A;  1W7P A;  3I71 A;  3P9C A;  3A03 A;  3GFL A;  1S7O A;  3H3U A;  4IRI A;  4KFC A;  1E3O C;  2IEK A;  2LBF B;  3LSR A;  4PJJ A;  2J5P A;  4KIC A;  5KVR A;  2XVC A;  1V3F A;  1GV5 A;  4HST A;  2QYO A;  5JHU A;  4G8X A;  2HVS A;  4BH9 A;  3MKY B;  4ZZD A;  2ELH A;  1KYW A;  4FET A;  1Z7L A;  5M3M J;  1QPI A;  1JI8 A;  2ZCW A;  2HPM A;  1R4M B;  1VQ8 I;  4XLP F;  5LFA A;  4CCJ A;  3OYM A;  4WK8 F;  4XN3 A;  3EDP A;  1V5F A;  3CZ6 A;  3I4P A;  1JJ8 C;  4YEL A;  2V4J C;  5FRN A;  1Y39 A;  4RAY A;  5HNF A;  2K40 A;  4JX6 A;  1R58 A;  1B6A A;  3HM5 A;  3DBH B;  5E8I A;  3ZMU A;  3V7C A;  2K5C A;  2A5W A;  2IA2 A;  2XF6 A;  4ESB A;  3HOS A;  4S0H B;  3ZRG A;  2EFN A;  2KRF A;  5EJC A;  4UB8 C;  3NAR A;  1LE8 A;  4E7S A;  2XF7 A;  4QPQ A;  3UNG C;  1ZTR A;  3S2H J;  4NB5 A;  1YHQ I;  2AXT C;  2V26 A;  1R1V A;  2DFH A;  5FKN A;  4B09 A;  4YII A;  2VOD A;  2OF7 A;  5IOY A;  1QZY A;  4HA8 A;  4I99 C;  1A04 A;  2ICW G;  1FP1 D;  4ZTF A;  1TNT A;  2LH9 A;  4JQF A;  5DM6 F;  2RN7 A;  2VBX A;  4ESJ A;  1XX5 A;  2KKO A;  5F04 A;  4Y17 A;  3RZD J;  4OIP F;  3NWT A;  2Y30 A;  3FWE A;  4HX4 A;  1X58 A;  3ELK A;  3S93 A;  3UR3 C;  1HW2 A;  4A3L J;  4JYK A;  3ZQI A;  1U9O A;  4UY8 I;  4L9N A;  3BG3 A;  2WC2 A;  5F1J A;  4HF2 A;  3HZJ A;  2VE8 A;  3I54 A;  4IRG A;  1W1W E;  4ZYA A;  3QPL A;  4G7O F;  2A6E F;  2CSO A;  3T0Y A;  1JHF A;  2PEX A;  1Z1D A;  4Y15 A;  2EIN H;  2LC2 A;  4M6Y A;  4MLO A;  3H5A A;  3OYL A;  3J7A O;  4UV9 A;  1O3R A;  3SXY A;  3OOP A;  2IS2 A;  2W1O A;  3F8N A;  2JVG A;  3Q3S A;  3SEQ A;  5K7H A;  2GXA A;  4L5E A;  4LG3 A;  2MYS A;  2QEX I;  5GTI C;  4D7N A;  2BEO A;  2K9L A;  3GVA A;  4EJO A;  1SD6 A;  3H5N A;  2FSW A;  1HBX G;  3VYT B;  3PUB A;  5HLI A;  1ZHF A;  4XR6 A;  1O3Q A;  3EPZ A;  3G1M A;  2ZFU A;  2V6C A;  5E3O A;  4B47 A;  3RZO J;  3C2B A;  5HLG A;  3HTS B;  1OKR A;  3CC4 I;  4B4C A;  2XKP A;  3TP3 A;  3FF5 A;  4ETS A;  4HNU A;  2YSR A;  1VTN C;  3K4N A;  2KPM A;  2DMP A;  2X1C A;  3IHU A;  2CV2 A;  3KIO A;  4EJV A;  3T8T A;  4GRI A;  3W2W A;  1XDU A;  4PSW A;  6PAX A;  2XPV A;  2JT1 A;  2VJ4 A;  4BNC A;  1FP2 A;  2IGK A;  4C2M J;  2XC7 A;  3L2V A;  2WY8 Q;  3QRF F;  1KQ9 A;  1MH3 A;  2BYV E;  2WB1 N;  2STT A;  3S3N A;  1JTY A;  2V9K A;  1EKE A;  1ZAO A;  2DPU A;  3M07 A;  3OR2 C;  2CO5 A;  2AQF A;  3I5U A;  3WTX C;  1VF9 A;  2CUZ A;  4M6X A;  3PO3 J;  3DXJ F;  5ILU A;  3H0D A;  3VYU B;  2LG4 A;  4U0Y A;  1FX7 A;  2QBY B;  2AQE A;  4U0W A;  1TL8 A;  2Y69 H;  3CDI A;  2FE3 A;  4II3 A;  2JN6 A;  2H8R A;  3JRB A;  2F4O B;  2OTJ I;  1XGM A;  1GLN A;  4DBQ A;  2XGC A;  1LEA A;  4C2U A;  3LWF A;  2QQB A;  3DFG A;  3H0G J;  5M5X J;  1EH7 A;  1ETY A;  3EUH A;  4GYG A;  4HX8 A;  5C3E J;  4MFE A;  3COA C;  3RYR A;  1JE8 A;  1F43 A;  3KEY A;  2DYR H;  3RQI A;  5TIS C;  3DWL E;  1SAN A;  1D8K A;  2V7F A;  2E1M B;  2PMZ A;  2E5Z A;  2E34 A;  5L3F A;  4BGD A;  1RES A;  1HST A;  2XSJ C;  2IXS A;  3IAS 2;  3QQA A;  1MBG A;  2LLK A;  4RBO A;  1SFE A;  4JX4 A;  4A3M J;  4A3G J;  2JUC A;  3Q0W A;  3JRC A;  5E1X A;  4JOM A;  5LHI A;  2VUM J;  1LKX A;  5J1R A;  2FRH A;  3HPG A;  5JVG F;  2IGM A;  3CCM I;  1F9N A;  4NC8 A;  1V54 H;  3R4K A;  1WQ2 A;  3B73 A;  1BL0 A;  2VXD A;  4XSX F;  2IP2 A;  1R71 A;  1FY7 A;  1GHC A;  4KMF A;  3EYY A;  4XKV A;  5JR3 A;  3MZ8 A;  2CQX A;  4XSZ F;  2BV6 A;  4UB6 C;  2JZY A;  2HQN A;  4LLL A;  1GT0 C;  3GEZ A;  3UKG A;  3I58 A;  2M2E A;  1X4P A;  4IPA A;  2MC4 A;  2V79 A;  2VQG A;  3F22 A;  1E2X A;  4RGX A;  3OIO A;  3HRS A;  2HPI A;  1T0F A;  1EH8 A;  2L9N A;  2XGX A;  2IVM A;  5EZH A;  1NH3 A;  2ZNY A;  1X1C A;  3ASO H;  2BW3 A;  1FNN A;  1UHW A;  4A3C J;  1LEB A;  2L4M A;  1IGN A;  3RSN A;  1IG7 A;  1QVU A;  3FXM A;  3AG2 H;  3HRM A;  1SFK A;  2LVS A;  1BOA A;  2OQR A;  4IF4 A;  3E6C C;  2JUG A;  2R5Y A;  3BOQ A;  2R7V A;  2L01 A;  2MBF A;  1FBQ A;  2K9M A;  2CQ7 A;  1GV2 A;  2W7N A;  2MH9 A;  2R4G A;  3GXO A;  3WU1 B;  4ENK A;  3MMY B;  1VQM I;  1X3W B;  2LDU A;  3O8G A;  4WF2 A;  1BR2 A;  2L9S A;  1WKM A;  2MFZ A;  1ZN2 A;  4M74 A;  1VQ4 I;  3ERM A;  2XGE A;  3TW6 A;  3IV5 A;  3BG6 A;  1RPW A;  3HSR A;  4CIC A;  3HIF A;  2BY3 A;  3QPT A;  4HLX A;  4LOC A;  3I4M J;  3HRT A;  2L2O A;  2BOL A;  3CCQ I;  2PLY A;  1UHM A;  1IRX A;  3EUK L;  4KN4 X;  1DGR M;  3Q0V A;  3T1B A;  2EZH A;  4R1H A;  1IJW C;  2D5V A;  3ZQF A;  3OYG A;  1B72 A;  3VFZ A;  1QNT A;  2M5W A;  1XD7 A;  4A2U A;  3CMY A;  3WOD F;  3ZMD A;  3HL2 A;  3GME A;  3KP5 A;  2K27 A;  3IH4 A;  3DBR B;  2P5V A;  3ECH A;  4IL6 C;  4RMN A;  2VJ5 A;  4I98 B;  1CF7 A;  3KYC B;  4XMY A;  2ZFW A;  1W7P D;  4HW0 A;  1Y56 A;  2N8G A;  1LQ1 A;  4DOZ A;  2W25 A;  3S15 J;  2NNN A;  2EZK A;  3QP5 A;  4GDF A;  4BQA A;  4LJZ F;  4ZC3 A;  2OV7 A;  4BL0 B;  4A3E J;  3C2G A;  2W82 A;  3HOU J;  3K0L A;  4AC0 A;  3P7N A;  3LAP A;  2P4W A;  2DDB A;  2DA4 A;  3HOY J;  4KUM A;  4OIN F;  1T0F C;  4IQ4 A;  4Y52 J;  3CF2 A;  1JKQ C;  5CVU A;  1WGX A;  3H3V K;  1I27 A;  1A35 A;  2FBH A;  4BXX J;  2Q0O A;  2M8G X;  4LB6 B;  5HOD A;  4IHT A;  2ECC A;  3S16 J;  3K69 A;  5FKL A;  2VBW A;  1MND A;  5JHF A;  1H9G A;  1MJB A;  1IN6 A;  4WXD A;  5AIP A;  3T8R A;  4GYI A;  2DFE A;  2CGP A;  4Q4Z F;  3IWZ A;  2E2J J;  2IS1 A;  1N25 A;  4KIB A;  4QSH A;  4BJ5 C;  5HLH A;  2UZK A;  2HYJ A;  2MLG A;  2B9S A;  3FMR A;  2KJC A;  1E3H A;  2B7E A;  3P5J A;  5J4V A;  5EG0 B;  4D5F A;  1FMW A;  2TDX A;  2GA2 A;  3ABK H;  2DMT A;  1XDS A;  2CG4 A;  1WJD A;  3I3L A;  2KHM A;  1TW2 A;  2KMU A;  3BC8 A;  1TWF J;  3BPV A;  3ZQG A;  5D8L B;  3PJR A;  1U8B A;  3WTW C;  2JWT A;  3F21 A;  1IAW A;  2R93 J;  1U2W A;  4JBA A;  4PJN A;  1K78 A;  2VI6 A;  1LE8 B;  4OIO F;  2ZJR F;  4PK4 A;  2VKD A;  1EF4 A;  4OMY A;  5CQG A;  1U5T A;  1UB9 A;  2M4K A;  3U2R A;  2BY0 A;  3DTK A;  3KEO A;  3U1D A;  4X0G A;  1FEX A;  4RDU A;  2NNY A;  3CLO A;  2FQ4 A;  2YR2 A;  1T56 A;  3NWS A;  1MBJ A;  2KZV A;  5IPA A;  3FMS A;  5EYR A;  4DYC A;  2XRL A;  3CO6 C;  3ECO A;  1RET A;  1KA8 A;  1UCR A;  3W3C A;  1HF0 A;  1OFC X;  2M0M A;  3V7S A;  5J47 A;  2GOM A;  1DUX C;  3HDD A;  4OIQ F;  4E7L A;  4E7K A;  2BVL A;  3SZT A;  2XAH A;  1H88 C;  3GYH X;  2WB1 A;  2EFP A;  2LYC A;  4AYB N;  4IQJ A;  1OCZ H;  4PUS A;  4DYQ A;  2ISZ A;  1B9N A;  2FBI A;  2IGO A;  2K9S A;  2FNA A;  4HDU A;  2GQQ A;  3VB2 A;  5LEK A;  4A3D J;  1R1T A;  1OCT C;  3GTQ J;  4BY7 J;  3E3V A;  5J1U A;  2KL4 A;  1H9T A;  2F5D A;  3HTU A;  4ZYH A;  4BBS J;  3ABU A;  2BBY A;  2X48 A;  4QLC U;  3BY6 A;  3HGG A;  3ML6 A;  5E3L A;  2IS4 A;  2M0C A;  3L2W A;  2IJL A;  1STZ A;  2X1E A;  1RI7 A;  3FX3 A;  4A69 C;  2A5Y B;  2HQA A;  1IN8 A;  5LGT A;  1UG2 A;  1IUY A;  1T33 A;  4AIK A;  2JPC A;  3L00 A;  4L9J A;  1ZH5 A;  2ZC2 A;  1JGS A;  4LG0 A;  3TBI A;  1SMY F;  2KDZ A;  1P9Q C;  2BY1 A;  5H6Q A;  3TED A;  1R5G A;  4B3A A;  2QSG X;  2WAD A;  3FXR A;  3N05 A;  1FZP B;  4PGG A;  2MAB A;  4CDG A;  2A3S A;  2FBK A;  2R7X A;  2HI3 A;  1MNM C;  3BR5 A;  4PJM A;  2OQG A;  3BTI A;  2O8X A;  1E0E A;  1U5T C;  1DGW Y;  2F4I A;  3WU2 C;  1TZL A;  1SAU A;  3DU5 A;  4IHV A;  3VWB A;  1FOW A;  2R7O A;  1IRZ A;  1Z6R A;  3LA7 A;  2FF4 A;  5L3C A;  2BXZ A;  1WJC A;  1BA5 A;  3JTG A;  3GX4 X;  3DEE A;  5IYD J;  3R0A A;  3IKT A;  1W5C C;  2HVQ A;  2YX7 A;  3GUD A;  3H1C A;  3ZMT A;  3CCU I;  2PN6 A;  2EV0 A;  2DQR A;  3BJ6 A;  5DDG A;  4UVC A;  4HF0 A;  5ICC A;  1A6Q A;  5HDN A;  2RVC A;  4BXF A;  1BW6 A;  4RB1 A;  3KPH A;  4CH7 A;  4GFB A;  3OYE A;  1R49 A;  2IW5 A;  3S14 J;  2VC1 A;  5KK1 A;  1MJA A;  4A0Z A;  3HEF A;  3JSP A;  3C18 A;  4UXN A;  1BBY A;  3RKY A;  2DOD A;  2WAQ A;  1ZGA A;  1ON1 A;  2HU9 A;  2LY1 A;  3OYA A;  3DKW A;  1RNL A;  3DPT A;  4DW6 A;  1UST A;  1Y8Q B;  1IRG A;  2L7K A;  2ZO4 A;  3QYF A;  1ZKG A;  5LD2 C;  2GIZ A;  3E6M A;  2W84 A;  1P4W A;  2LF7 A;  4EV0 A;  1IUF A;  2G7U A;  2EIK H;  3TQN A;  4UUS B;  2R0Q C;  3A01 A;  4ZTJ A;  5E1Z B;  2GLO A;  3QPS A;  2F5F A;  3E0J B;  4ZYG A;  2HOS A;  2FOK A;  3D5S C;  3PIP F;  2RAE A;  4MEX F;  2HZD A;  4I01 A;  1DP7 P;  3REO A;  3RQ4 A;  3LNQ A;  3O6B B;  3LST A;  4I0A A;  1HXD A;  2EK5 A;  2F5C A;  2Z9O A;  4HNV A;  3K2A A;  5J40 A;  1XN7 A;  2HQ5 A;  3CCV I;  3BR1 A;  2ESH A;  2PBI A;  5FGM A;  1DPR A;  2HDW A;  3WG7 H;  1R7J A;  4FE4 A;  3V8K A;  1T2K A;  1YYV A;  3T5X A;  2EB7 A;  2P5K A;  1QBJ A;  1BI1 A;  4AVZ A;  5D4R A;  3SDB A;  4H4K C;  2L9R A;  3GTL J;  1JTX A;  2ZSI B;  3W6J B;  1LPQ A;  4IOA F;  2DMQ A;  1ETW A;  3C3W A;  1VQL I;  1TW3 A;  3BQY A;  3R0J A;  3BTJ A;  4CYD A;  4L18 B;  4HLY A;  2BW3 B;  5DCM A;  3K4K A;  3AFH A;  4ZDL A;  1R22 A;  5LGU A;  3OSG A;  5JFR A;  2DYS H;  5C4J J;  1ONV A;  1AKH B;  4EEF G;  4AM3 A;  3K1N A;  1D5Y A;  3BZK A;  1HSJ A;  2EZI A;  2F5V A;  2F6C A;  3VYR B;  4MTE A;  3TO7 A;  1REP C;  1S6L A;  3OYB A;  1USS A;  3CF5 F;  3NQO A;  4RM3 A;  3M1C A;  2BVM A;  2MD5 A;  5FB2 A;  1MH4 A;  2JA2 A;  2K9N A;  2G0E A;  3Q0U A;  2PFB A;  2D1V A;  4Y13 A;  2ZME A;  1IC8 A;  3JRA A;  4NC7 A;  1L0O C;  4IEJ A;  4EVI A;  3FIS A;  1BOB A;  3OIP A;  2FML A;  5LHH A;  1IN7 A;  2XRN A;  5FKM A;  2CV1 A;  1C0W A;  2UUZ A;  4MQ9 F;  1Y1V J;  3FHN A;  2EV5 A;  1B72 B;  1QGP A;  4BDY A;  3FZV A;  2L5Q A;  2NVY J;  3RPU A;  2E71 A;  4BS9 A;  5IY5 H;  3L2C A;  2PMU A;  3S3M A;  2NRA C;  4NQW A;  4BHP A;  1J5Y A;  1JKP C;  1YX3 A;  1ZEL A;  2M8E A;  3QYE A;  4Y3O A;  4XK4 A;  3SZP A;  2VQH A;  1S7E A;  3KX2 A;  4PJ0 C;  4E7Z A;  4C9Y A;  2KIQ A;  4XRF A;  2K4B A;  2GXG A;  2CW7 A;  5BOX A;  2K9Q A;  2Y75 A;  1X19 A;  2TCT A;  5EEA A;  3E97 A;  2YU9 J;  2VQL A;  2LNB A;  5E20 A;  1Z0X A;  1G6N A;  1W5T A;  1P7J A;  1Z91 A;  3ZMS A;  1SFX A;  1I1S A;  2VPL A;  2F5E A;  1YQA A;  3HOT A;  3LSG A;  3IUO A;  4XIC A;  5EDN A;  2M45 A;  3F8M A;  1XPX A;  4FCY A;  3DTI A;  3V42 A;  4U7B A;  2E60 A;  1UAA A;  2R7Z J;  1KGS A;  3GFJ A;  4RAF A;  5FLV A;  1X3U A;  2DT7 B;  4BXU A;  1MBE A;  3DQV C;  4A6D A;  4YRV A;  1FBU A;  1WI3 A;  4AYB A;  2HEO A;  1XMA A;  1ZR2 A;  3I9V 2;  2PI0 A;  1GXQ A;  1IV8 A;  3A2K A;  1QRY A;  3KCC A;  3VSK A;  1MSE C;  1IN4 A;  2LY9 A;  2A6T A;  2ZME C;  4XN0 A;  1HDD C;  2Q2E A;  1ZK8 A;  2FUG 2;  2R7F A;  1QZZ A;  1XGO A;  3GLX A;  4RLQ A;  2ME6 A;  4EAT A;  2MC3 A;  1BR1 A;  3I55 I;  1LDJ A;  5E8G A;  1R36 A;  2K86 A;  1RKW A;  3PM1 A;  4B3X A;  3BG5 A;  4PJL A;  3E5U A;  1TQP A;  4PDK A;  1GVJ A;  2F2E A;  2FD5 A;  2G9W A;  2PX9 A;  2O3F A;  4HG2 A;  3ZN0 A;  2DMN A;  2H27 A;  1H0M A;  2IAI A;  1G3W A;  4M6V A;  3I59 A;  4P1W A;  4UHT A;  5HVQ C;  3SHF A;  4E7J A;  4KYW A;  2DJI A;  3S8P A;  2AHQ A;  2V1D A;  3V8L A;  2EBI A;  1D3Y A;  2NVT J;  1WJB A;  4CYC A;  2Z1D A;  1U5T B;  3N97 A;  3DBL B;  2IS6 A;  2K02 A;  3D5R C;  4CZZ A;  5EZG A;  4O5V A;  4LLG F;  4LLN A;  1PUF A;  4A12 A;  2NAZ A;  4QWQ A;  3EET A;  4P9F A;  4PFO A;  1Z3X A;  1KU2 A;  2E19 A;  2HGC A;  4KIT B;  1MMS A;  2VKE A;  3J80 Z;  1TWH J;  4KT6 A;  5FLX Z;  2DBB A;  3BR3 A;  2LRE A;  1B4A A;  2UV1 A;  1KQ0 A;  4FTH A;  3F9K A;  5IYB J;  1ZRC A;  1TWA J;  1I1G A;  4BEH A;  4CCK A;  1S29 A;  5LRR A;  1XGN A;  3S1Q J;  3CC7 I;  1B8I B;  1NHA A;  4G6Q A;  3MFK A;  4KDP A;  2LK2 A;  4FHT A;  5BMZ A;  4LIU A;  2COB A;  2KIM A;  1WHU A;  1LFP A;  4AVP A;  5KCM A;  1YS7 A;  1B59 A;  3I4N J;  2C6Y A;  1W5S A;  2GBY A;  2OA4 A;  2YS9 A;  2O0Y A;  2WAE A;  4U87 A;  2LP0 A;  1SD5 A;  1SD4 A;  3C7J A;  4JK1 X;  4XOT A;  2Y0S N;  4IRH A;  3JSO A;  3N4M A;  3CJT B;  4G94 A;  1SAX A;  2DPD A;  5BNG A;  1UMQ A;  3I0T A;  5LHG A;  4R8H A;  3CJN A;  4M9Z A;  1MNE A;  3WTT C;  4N9H A;  3RKX A;  4ON0 A;  5LEJ A;  4Q48 A;  3WG9 A;  1I5Z A;  5IT9 K;  1G3Y A;  1D1B A;  1R00 A;  1D0X A;  3ZMV A;  1RKT A;  4CCM A;  2QSH X;  5GTH C;  4LG0 B;  1OIS A;  1ULY A;  1W36 C;  3TOB A;  4EJW A;  1OJL A;  2VOO A;  3DU6 A;  3SZG A;  4ESF A;  3D5L A;  2JK3 A;  3TOA A;  4M71 A;  5IT9 Z;  1VQK I;  5K7F A;  3KP4 A;  1FSH A;  2DW4 A;  3WGH A;  4NHJ A;  4U0V A;  5J6X A;  1K4T A;  2XAS A;  1T6S A;  3HYI A;  5LBQ A;  1XC5 A;  2R5Z A;  1FMV A;  3Q5F A;  3FXO A;  2BHZ A;  2E7X A;  1BN5 A;  1YIO A;  1JUS A;  1YIJ I;  3WE3 A;  4WX9 A;  3FM3 A;  1MMD A;  4XM3 A;  3E5X A;  2P7V B;  4C2T A;  2JMW A;  2QLZ A;  1IDZ A;  5F0H A;  2WY7 Q;  3OIQ A;  4DZJ A;  3CTA A;  5FO5 A;  2JA6 J;  5HDK A;  2M1B A;  3C1D A;  4ASN A;  3ZP5 A;  2XGD A;  1I50 J;  5DYM A;  4LMY A;  1YX5 A;  3IKV A;  4U7D A;  1XSV A;  4ZJZ A;  3CUQ A;  3GTP J;  4RAZ A;  5F6F A;  1NTC A;  3GCM A;  3S17 J;  3ZQC A;  1CQT A;  4HBL A;  3EYI A;  4NDL A;  4KIG A;  2CH0 A;  4Q5S F;  4L0Z B;  3KZI C;  1N78 A;  5GAD J;  1VQ9 I;  2Q8K A;  5E17 F;  3HUG B;  4HPQ A;  1X1A A;  2K3P A;  2YPR A;  1MKM A;  4P96 A;  2IPQ X;  1FJL A;  3VOD A;  5F64 A;  3DEU A;  2IGN A;  3BTC A;  4M3G A;  2XAF A;  3K70 C;  3PQJ A;  3HGY A;  5F08 A;  4LK0 F;  4M3E A;  5DCF A;  3AL0 C;  4H0E A;  1WCM J;  5K1Y A;  1S9H A;  2KJB A;  4BE0 A;  3H5R A;  1WSU A;  3CCL I;  1R23 A;  3Q9V A;  1ENH A;  2CFX A;  4B1R A;  2XPW A;  1KU3 A;  5E18 F;  4EMS A;  1HA8 A;  3CCS I;  2ME0 A;  5CYV A;  3ZMZ A;  2GIV A;  3E7L A;  1X3Z B;  2Z16 A;  3LL7 A;  3SFZ A;  2FU4 A;  1FYM A;  1V5E A;  2EZL A;  2WAQ N;  3WTS C;  1K4S A;  1DU6 A;  3LQQ A;  1BIB A;  2M34 A;  4C3I J;  2DK5 A;  1AWC A;  2TRT A;  3TMO A;  2HR3 A;  4E4H A;  1PYV A;  3K6G A;  2O7O A;  3GTK J;  4HEA 2;  4BUP A;  4RM2 A;  2IBD A;  5FJ8 J;  3DPL C;  3EUH C;  5DCM B;  4V2G A;  3DEW A;  3K9T A;  3K4M A;  5AIQ A;  4ZYE A;  5EGO A;  2VKV A;  1MMA A;  1D0Y A;  4BAC A;  3DP7 A;  2O61 A;  1ON2 A;  4N4O B;  3FXJ A;  2D1H A;  3WTZ A;  2CRG A;  1R6R A;  2RGV A;  1T39 A;  2M7B A;  2E1C A;  2JA8 J;  4DIQ A;  3HHH A;  1ZLJ A;  2ID3 A;  3CUQ C;  3ABT A;  1WI9 A;  4YG2 F;  3FDY A;  3RPU D;  1OCR H;  1TQM A;  2NXN B;  3Q9S A;  4S05 A;  2ESN A;  3A02 A;  3HHG A;  4G7Z F;  2L7M P;  4F55 A;  1UEL B;  1LJ9 A;  2O8K A;  5DD8 A;  2O03 A;  1DDN A;  3QYB A;  4RA2 A;  1JT6 A;  1OR7 A;  2RNG A;  1MW7 A;  3JCU C;  3HSF A;  5EF6 A;  2QQ8 A;  4HZF A;  3S1M J;  3GBG A;  3CD6 I;  1K83 J;  2XPU A;  4G6D A;  5FD5 A;  3M4O J;  4D7M A;  2ZXI A;  1QU3 A;  2EIL H;  1R9T J;  1Z05 A;  2EQR A;  1ZRE A;  2EJR A;  3DF8 A;  2QF7 A;  4S04 A;  4D5C A;  5B3S H;  3JAM Z;  3DLL F;  1O3S A;  3AAF A;  2E2H J;  2HDC A;  4A3B J;  1W7P B;  5TJJ A;  3M7G A;  1Y0U A;  3PFI A;  3DKY A;  1IF1 A;  2B63 J;  4RB3 C;  2ELJ A;  1Z3Y A;  3AG3 H;  2LKS A;  2HKO A;  5ICE A;  4EJU A;  2A69 F;  3QU3 A;  2EH3 A;  2H6B A;  2RQQ A;  3QU6 A;  2HNH A;  1FOY A;  3PL8 A;  1VQ6 I;  2BY2 A;  3E5Q A;  3OWT A;  2HZT A;  3W6V A;  3K1M A;  2JSP A;  3LOC A;  1G3T A;  3TDU C;  2KIF A;  1UJ8 A;  4I76 A;  4B8X A;  4AIJ A;  5HS8 A;  2X6Y A;  4DJA A;  2XF5 A;  3ERE D;  1H89 C;  2YUS A;  1U3E M;  4G6T B;  1TQI A;  2RNJ A;  2LOO A;  1HKT A;  3F8F A;  2KDO A;  1TT5 B;  1QO0 D;  3H92 A;  3K2Z A;  1VI0 A;  3H9G A;  2W85 A;  4MEY F;  2XSD C;  2DMU A;  3GW2 A;  3J7A Y;  1BW5 A;  4NNJ A;  2YX4 A;  4ZH4 F;  4LIV A;  3CUO A;  3TKY A;  3OYJ A;  3O8H A;  1J75 A;  1WFX A;  4P9U A;  4LD5 A;  4CCL A;  3LFK A;  1SFO J;  3L09 A;  1A5J A;  3IAM 2;  1W36 D;  4F92 B;  4BDZ A;  4BHB A;  1UG0 A;  3ZQ7 A;  2RC4 A;  3J81 K;  5HS7 A;  3M3Y J;  3CO7 C;  2WAF A;  2Y0S A;  2Z3Y A;  3VOE A;  4CCN A;  1K6O A;  2DA2 A;  1ORK A;  3PNT A;  4EQQ A;  1BJA A;  2Y0M A;  4I2O A;  3KLO A;  5D5V B;  4HV5 A;  3BR0 A;  4M3B A;  1W0T A;  1H8A C;  3ABL H;  4B44 A;  4CZC A;  3J81 Z;  3FMQ A;  2JJ7 A;  1X2N A;  3BJO A;  5FKK A;  4JP0 A;  3MVP A;  4MHG A;  4ZDP A;  4A3I J;  4E7H A;  1GXP A;  2ETH A;  2QA4 I;  4A93 J;  1FTZ A;  3I59 B;  2DN0 A;  1M1E B;  2DOE A;  3PUF A;  5CVR A;  3ZXS A;  2H1K A;  4AD9 A;  2JSC A;  4KN7 X;  4XKB A;  4DQ2 A;  4DNC A;  4A0X A;  4DBR A;  2HYG D;  1ZYR F;  2HQR A;  2L02 A;  4M72 A;  4YIF A;  4MTD A;  4G7H F;  1FC3 A;  2AO9 A;  2A61 A;  2I10 A;  1PUF B;  1ZG3 A;  2DJN A;  4WXH A;  4PGH A;  4A3J J;  2DK8 A;  2L7Z A;  1G59 A;  2W4S A;  2VN2 A;  1SEU A;  1BR4 A;  2AXL A;  3CC2 I;  3L1P A;  2E5N A;  3KE2 A;  5CKT A;  1RUN A;  1S5L C;  1SVO A;  4RAG A;  5HNH A;  3HOW J;  1UFM A;  1MDM A;  1JJ6 C;  1ZAR A;  1ZLK A;  1DPU A;  3E6D A;  2LY2 A;  4G12 A;  4II2 A;  4RB0 A;  3K70 D;  1DQU A;  1Y8R B;  1YLF A;  2E2I J;  2CQN A;  2A6H F;  5IP7 J;  3CLQ A;  5KAF C;  4P5O A;  2PJP A;  3ZOB A;  3LSK A;  5F0C A;  1YO5 C;  3WE2 A;  1YE9 A;  4JX5 A;  2HFH A;  5EEH A;  1O57 A;  3MZY A;  2MG4 A;  2H1L A;  1YJ9 I;  4DYR A;  2M9H A;  1HKQ A;  1VQP I;  1RR7 A;  3WTV C;  2ZJQ F;  4FX0 A;  4HQE A;  4IXA A;  3RJP A;  3HRU A;  2V9V A;  5EEG A;  2EFO A;  5A2Q Z;  2VQC A;  2M7A A;  2X85 A;  2VC0 A;  4F7Z A;  3JRE A;  2CQK A;  2HOA A;  4LIT A;  3AL0 B;  4HSR A;  2CU7 A;  3G1O A;  1XCB A;  4Q47 A;  2Q1Z B;  4WCG A;  3BDD A;  4OIR F;  3A4C A;  3SQN A;  1QA6 A;  2A05 A;  1WH7 A;  3G2B A;  5F0F A;  1I6X A;  1YI2 I;  4A3K J;  3LA2 A;  5M5Y J;  4XRS G;  1EJ9 A;  4E7I A;  2ADU A;  2LKP A;  2CJJ A;  2LSO A;  2AS5 F;  3OYN A;  5LRS A;  2O5R A;  4ENJ A;  1SVM A;  5ERI A;  2MSY A;  2KIU A;  2YU3 A;  4G9Y A;  4ZDO A;  4HF1 A;  1T08 B;  1IXR C;  2R5Z B;  4L9V A;  3VYS B;  5F1R A;  4IKF A;  1O7F A;  2EV6 A;  4RB2 C;  2M87 A;  4N9I A;  2KQR A;  5B5E C;  5J8C A;  1ZGJ A;  3K1P A;  2R7R A;  2HS5 A;  1HCR A;  4I6Z A;  1YJN I;  1LFU P;  4FAS D;  2K7L A;  3A0B C;  4OWR B;  3JTH A;  2CYY A;  4BHC A;  1OLT A;  5M5W J;  4BJ6 C;  4YFX F;  1PP7 U;  3OS2 A;  3BG9 A;  4IHW A;  4V19 K;  3S2W A;  1WJE A;  2COM A;  1NG7 A;  3B6C A;  3R61 A;  2ZXJ A;  2OTL I;  1KYZ A;  3ZQL A;  3VEP A;  3FIW A;  4W97 A;  4NC6 A;  3G6E I;  2UXX A;  2RDP A;  3K7A J;  3KYD B;  5HLT A;  1XG1 A;  3H35 A;  2VIX A;  4I02 A;  3BLY A;  2DT6 A;  3NRV A;  4IVN A;  2VL8 A;  1YW9 A;  4LK1 F;  4BU2 A;  5J8F A;  1TC3 C;  1LUJ B;  1XCV A;  5CVV A;  2LKX A;  1HDP A;  1ZGW A;  3NEU A;  1A36 A;  5IOZ A;  4BJT A;  3OS0 A;  3RPQ A;  2XV4 S;  1WJA A;  4EM0 B;  2W48 A;  4R79 A;  3RTR A;  3PSI A;  3VPR A;  4HDV A;  3CCE I;  1WH5 A;  1MZB A;  4OMZ A;  3D0S A;  1Y1W J;  2OPT A;  1G8X A;  1GDT A;  1A6I A;  3QWL A;  4IJA A;  2Z33 A;  1VQ7 I;  3GWZ A;  2FEZ A;  2L7F P;  2GOX B;  5J1Y A;  4XLA A;  5E79 C;  3GFM A;  2R5Y B;  3CCY A;  3RIR A;  1MIJ A;  2H94 A;  5GPA A;  2XHK A;  4UVA A;  3BTL A;  4FIS A;  2VOP A;  5KNL A;  2FA5 A;  2HYF A;  2OU2 A;  5H6R A;  3HC7 A;  2XRO A;  1XSX A;  4XRM A;  2JVH A;  3B6A A;  3BWG A;  3OYD A;  3R60 A;  4D1Q A;  1FT9 A;  2BZT A;  1HQC A;  3KP7 A;  5EGO B;  1BI0 A;  2FOW A;  1YRN A;  4UNO A;  1Q1V A;  5CVJ A;  3ZGK A;  1YJW I;  2E36 A;  2EA2 A;  1B9M A;  3ROU A;  2JA5 J;  3G1L A;  1R5I D;  1QZE A;  3RDI A;  3IRR A;  3K4C A;  3GLL A;  1I3Q J;  2QCO A;  3RKQ A;  3CQZ J;  3H3Z A;  5B1A H;  3MKZ A;  2O9L A;  2EIJ H;  1J7K A;  2Y9Y A;  1CF7 B;  2L54 A;  3PFY A;  1R1U A;  3MD2 A;  2GXB A;  3FXQ A;  3PQK A;  2HWV A;  3D1N I;  4AU7 A;  1ZG1 A;  5DUK A;  2R3S A;  3IL2 A;  2DU9 A;  5GAG J;  1D5V A;  1U6G A;  1IO2 A;  3HKZ A;  2LD5 A;  2HTS A;  3DV8 A;  2PQ8 A;  4BAY A;  3AG4 H;  1PP8 F;  3OSF A;  1XGS A;  2OAZ A;  2CV0 A;  2UXN A;  4I7H A;  4CGZ A;  2XB5 A;  3FXK A;  4FX4 A;  1S3J A;  5D5U B;  1X4O A;  1AHD P;  2W24 A;  1J9I A;  3DLA A;  2OUM A; 
#chains in the Genus database with same CATH homology
 2P6T A;  2K4J A;  2Z5U A;  5L3D A;  4HOB A;  4OU0 A;  2D45 A;  1KQ8 A;  2QWW A;  4UVB A;  4BYY A;  2DAO A;  3MQ0 A;  2VBZ A;  2XUB A;  1O3T A;  2GAU A;  2HOE A;  2QQA A;  3TO9 A;  2OZU A;  1G4D A;  4A5N A;  1IW7 F;  1P2F A;  4M9S A;  5DV5 A;  5FFX A;  4O6J A;  2P8T A;  2STW A;  1P4X A;  2DLL A;  4MQV A;  2FMY A;  1BI2 A;  3BP8 A;  1K78 B;  3J80 K;  3MZH A;  5FLX K;  2W57 A;  2NYX A;  1IN5 A;  3F3X A;  2QM3 A;  2WWY A;  5K5O A;  4MNU A;  2IT0 A;  4CO8 A;  4D0P A;  3QAH A;  2OBP A;  3IC7 A;  2J5O A;  1R5H A;  5DUI A;  3BJA A;  4M73 A;  3L9F A;  1S7A A;  1J2X A;  1RZ4 A;  5D6F A;  2GZW A;  3GZ6 A;  1PUE E;  3LAJ A;  3BZ6 A;  1WWX A;  2E7W A;  3V4G A;  1F4K A;  1ZRF A;  5K5Q A;  4LFU A;  2Y48 A;  4HX7 A;  4TV7 A;  5ICG A;  3IRQ A;  1L3L A;  3WTU C;  2B0L A;  1MDM B;  1HW5 A;  4M9X A;  5JI6 A;  4ENM A;  3QP6 A;  4KT5 C;  1T38 A;  2PG4 A;  2DO7 A;  1K7A A;  1LDK B;  3RKW A;  3WTY C;  5L3E A;  4LB5 A;  5H20 A;  3FXU A;  1EV7 A;  3FM5 A;  2QZ8 A;  2EFQ A;  1YW7 A;  3I64 A;  3I53 A;  3M8F A;  2QVO A;  4WXC A;  2WV0 A;  1MGT A;  3MWM A;  4CXF A;  1T98 A;  1KU9 A;  1FOK A;  3TGN A;  3P9K A;  5FD6 A;  4KA4 A;  3KFW X;  1JXS A;  2QEN A;  4GCV A;  4O3M A;  5AON A;  3B02 A;  2FNP A;  3F23 A;  4OOI A;  1WRJ A;  2CWE A;  1LNW A;  4RGU A;  3RYP A;  1BC7 C;  1XSD A;  2ZJ2 A;  5E1W A;  2P6S A;  4XBF A;  1FWZ A;  2VT2 A;  2M30 A;  4RGS A;  4Z2Y A;  4EM2 A;  3GO5 A;  1ZG5 A;  5HS9 A;  2BGC A;  2RKH A;  4E70 A;  1QPM A;  1J59 A;  2JPB A;  3WU0 A;  5ILV A;  2UWM A;  1P4A A;  2X4H A;  3EQL F;  2XAQ A;  5BPI A;  3ULQ B;  1OYI A;  3F8B A;  3JW4 A;  3GFI A;  5HDG A;  4U88 A;  1OYW A;  1MD0 A;  2BE5 F;  4IHS A;  2JTV A;  3O3K A;  5BS6 A;  1SD7 A;  4A6E A;  1OPC A;  5K5R A;  4EGY A;  1FPQ A;  2OD5 A;  5DD4 A;  1Q1H A;  2Z99 A;  3TDZ C;  3CDH A;  4L9T A;  3KZY A;  2ZME B;  2DT5 A;  1QQI A;  3V8J A;  1HW1 A;  3BPX A;  2XAJ A;  3JAM K;  4YFN F;  2RV8 A;  4ZZL A;  2XKO A;  3KEQ A;  5D5X B;  4XLN F;  2ZBK A;  3KET A;  4L5I A;  4GGG A;  1LB2 A;  2A07 F;  3E6B A;  1FYK A;  1YTY A;  3M8E A;  2L3D A;  4I09 A;  3MEX A;  3P9I A;  3WGG A;  2ACJ A;  2R7D A;  2HTJ A;  2EFW A;  1SMT A;  1ZRD A;  1YW8 A;  2A68 F;  2P5L C;  3L7W A;  2OZ6 A;  4UUV A;  2FXA A;  4LGW A;  3GF2 A;  4A0Y A;  2JRT A;  4A5M A;  1SFU A;  2EA4 A;  3F6V A;  3KP6 A;  1FBS A;  5D8K B;  3G73 A;  4I0B A;  3KP2 A;  3M1E A;  1RIO H;  5HOO A;  3LA3 A;  1PDN C;  2VON A;  2RQP A;  1J0R A;  1TTY A;  1V4R A;  2QUF A;  4HV6 A;  2IRF G;  1YG2 A;  1FLI A;  3F6O A;  5JVT A;  4RGR A;  1G3S A;  3ZN1 A;  1TNS A;  2H09 A;  1FSE A;  4HQM A;  5TRD A;  4P55 A;  1IXS B;  3GZ5 A;  1U78 A;  2IA0 A;  1Z6T A;  3F8C A;  1BM9 A;  3LQR A;  5LLQ A;  2EWN A;  1K79 A;  1IXC A;  4GO1 A;  4K2E A;  1CGP A;  4PZJ A;  2MH2 A;  1U8R A;  2ZKZ A;  2MLK A;  3M9A A;  4KMU X;  2NS0 A;  1KU7 A;  5ED4 A;  1YS6 A;  2XAG A;  4AIH A;  3ZPL A;  2E1N A;  2DQL A;  5A2Q K;  1FYL A;  3G3Z A;  1LDD A;  3IWF A;  2G7H A;  2GWR A;  5DEQ A;  1P6R A;  2MA3 A;  3FHZ A;  1IRF A;  5BQT A;  1Z9C A;  3O2P E;  3TO6 A;  3F72 A;  3MAJ A;  1Z7U A;  5L3B A;  4L0Y B;  5CLS A;  3WGI A;  2QBY A;  5ILS A;  2L4A A;  3KZZ A;  1OMI A;  4L5J A;  1S8N A;  4ENN A;  4UV8 A;  1F1Z A;  4AWX B;  5FFZ A;  4HAM A;  2FQ3 A;  4GXO A;  1EH6 A;  3RI4 A;  4WWC A;  4EJT A;  2O6G E;  3R6S A;  3V7R A;  2V1X A;  3CUQ B;  1HKS A;  3MCZ A;  4KIF A;  3KP3 A;  4RS8 A;  5CJ9 A;  1F5T A;  1XMK A;  1IZ1 A;  3QOP A;  4EGZ A;  2H6C A;  3HUG A;  2IA1 A;  2VBY A;  3QPH A;  5D5W B;  2P7C B;  1JHH A;  3W6K B;  1B1B A;  5CVI A;  2HKX A;  5ICF A;  4HYE A;  2VXZ A;  5BPD A;  1TLH B;  2ZNZ A;  2DI3 A;  1LVA A;  2LF8 A;  2V1U A;  3HSE A;  1XB4 A;  2GA1 A;  4N0B A;  4YFK F;  1BI3 A;  3BRO A;  1YFH A;  4PCQ A;  4MGR A;  1TBX A;  5L3G A;  2QQ9 A;  2WTE A;  1AOY A;  1P92 A;  5IT3 A;  3OV8 A;  1O7L A;  4KNY A;  2D2W A;  1W4M A;  3KLN A;  1BIA A;  1BC8 C;  4FT8 A;  2PMH A;  5D6E A;  2DTR A;  2VE9 A;  1MJ9 A;  2VT3 A;  3ISP A;  2XIG A;  4ZYD A;  1E17 A;  2X0L A;  2CW0 F;  2ISY A;  4CHU A;  1D8J A;  5LGN A;  3U9G A;  5D4S A;  1ODD A;  2DFI A;  1OYY A;  1RUO A;  1W7P A;  3I71 A;  3P9C A;  3GFL A;  1S7O A;  3H3U A;  4IRI A;  4KFC A;  2J5P A;  5KVR A;  4KIC A;  2XVC A;  1V3F A;  5JHU A;  2QYO A;  4G8X A;  4BH9 A;  4ZZD A;  2ELH A;  1KYW A;  2ZCW A;  4XLP F;  4WK8 F;  3EDP A;  3I4P A;  4RAY A;  1R58 A;  1B6A A;  5E8I A;  3ZMU A;  3V7C A;  2IA2 A;  4ESB A;  3HOS A;  2EFN A;  2KRF A;  4NB5 A;  1R1V A;  4B09 A;  4YII A;  2VOD A;  1QZY A;  4HA8 A;  1A04 A;  1FP1 D;  1TNT A;  4JQF A;  2RN7 A;  2VBX A;  4ESJ A;  2KKO A;  4Y17 A;  4OIP F;  3FWE A;  4HX4 A;  1HW2 A;  3ELK A;  4L9N A;  4HF2 A;  2WC2 A;  2VE8 A;  3I54 A;  4IRG A;  4G7O F;  2A6E F;  2CSO A;  3T0Y A;  1JHF A;  2PEX A;  1Z1D A;  4Y15 A;  4M6Y A;  3J7A O;  4UV9 A;  1O3R A;  3SXY A;  3OOP A;  3F8N A;  2BEO A;  3GVA A;  4EJO A;  1SD6 A;  2FSW A;  1HBX G;  5HLI A;  1ZHF A;  1O3Q A;  2V6C A;  5HLG A;  3HTS B;  1OKR A;  2XKP A;  3FF5 A;  4ETS A;  2YSR A;  1VTN C;  3IHU A;  4EJV A;  3T8T A;  1XDU A;  6PAX A;  2JT1 A;  4BNC A;  1FP2 A;  3QRF F;  2BYV E;  1KQ9 A;  2STT A;  1ZAO A;  2DPU A;  2CO5 A;  3I5U A;  3WTX C;  4M6X A;  3DXJ F;  5ILU A;  4U0Y A;  1FX7 A;  2QBY B;  4U0W A;  2FE3 A;  1XGM A;  1LEA A;  3LWF A;  2QQB A;  3DFG A;  1EH7 A;  3EUH A;  4GYG A;  4HX8 A;  3COA C;  3RYR A;  1JE8 A;  1D8K A;  5L3F A;  1HST A;  1SFE A;  5E1X A;  5LHI A;  2FRH A;  1F9N A;  3R4K A;  1WQ2 A;  3B73 A;  4XSX F;  2IP2 A;  1GHC A;  1FY7 A;  4KMF A;  3EYY A;  5JR3 A;  4XSZ F;  2BV6 A;  2JZY A;  2HQN A;  4LLL A;  3GEZ A;  3I58 A;  4IPA A;  2V79 A;  3F22 A;  1E2X A;  4RGX A;  3HRS A;  1T0F A;  1EH8 A;  2XGX A;  2IVM A;  2ZNY A;  1FNN A;  1UHW A;  1LEB A;  2L4M A;  3HRM A;  4IF4 A;  1BOA A;  2OQR A;  3E6C C;  3BOQ A;  2L01 A;  2MBF A;  1FBQ A;  2MH9 A;  3GXO A;  3WU1 B;  4ENK A;  2LDU A;  4WF2 A;  1WKM A;  1ZN2 A;  4M74 A;  3HSR A;  4CIC A;  3HIF A;  3QPT A;  4HLX A;  3HRT A;  2PLY A;  1UHM A;  4KN4 X;  3T1B A;  4R1H A;  3VFZ A;  1QNT A;  2M5W A;  1XD7 A;  4A2U A;  3WOD F;  3ZMD A;  3KP5 A;  2K27 A;  2P5V A;  3ECH A;  1CF7 A;  4I98 B;  2ZFW A;  1W7P D;  4HW0 A;  1LQ1 A;  2W25 A;  2NNN A;  3QP5 A;  4BQA A;  4LJZ F;  3K0L A;  3P7N A;  3LAP A;  2P4W A;  4KUM A;  4OIN F;  5CVU A;  1I27 A;  2FBH A;  2Q0O A;  4LB6 B;  4IHT A;  3K69 A;  2VBW A;  1H9G A;  1MJB A;  1IN6 A;  4WXD A;  5AIP A;  3T8R A;  4GYI A;  2CGP A;  4Q4Z F;  3IWZ A;  4KIB A;  5HLH A;  2UZK A;  2MLG A;  3FMR A;  2KJC A;  2TDX A;  2GA2 A;  1XDS A;  2CG4 A;  1TW2 A;  3BPV A;  5D8L B;  3WTW C;  3F21 A;  1IAW A;  1U2W A;  4JBA A;  1K78 A;  4OIO F;  4OMY A;  1U5T A;  1UB9 A;  3U2R A;  3KEO A;  3U1D A;  2NNY A;  3CLO A;  2YR2 A;  3FMS A;  3CO6 C;  3ECO A;  1KA8 A;  1UCR A;  3V7S A;  1DUX C;  4OIQ F;  3SZT A;  2XAH A;  3GYH X;  2EFP A;  2ISZ A;  1B9N A;  2FBI A;  2FNA A;  4HDU A;  2GQQ A;  3VB2 A;  5LEK A;  1R1T A;  3E3V A;  1H9T A;  2F5D A;  3HTU A;  4ZYH A;  3ABU A;  2BBY A;  4QLC U;  3BY6 A;  3ML6 A;  2IJL A;  1STZ A;  1RI7 A;  3FX3 A;  2A5Y B;  1IN8 A;  5LGT A;  1IUY A;  4AIK A;  2JPC A;  3L00 A;  4L9J A;  1ZH5 A;  1JGS A;  4LG0 A;  1SMY F;  5H6Q A;  1R5G A;  3FXR A;  1FZP B;  4PGG A;  4CDG A;  2A3S A;  2FBK A;  2OQG A;  2O8X A;  1U5T C;  1Z6R A;  3LA7 A;  2FF4 A;  5L3C A;  3JTG A;  3GX4 X;  3R0A A;  3IKT A;  2YX7 A;  3GUD A;  3ZMT A;  2PN6 A;  2EV0 A;  2DQR A;  3BJ6 A;  5DDG A;  4UVC A;  4HF0 A;  5ICC A;  5HDN A;  2RVC A;  4RB1 A;  2IW5 A;  2VC1 A;  5KK1 A;  1MJA A;  4A0Z A;  3JSP A;  3C18 A;  4UXN A;  1BBY A;  3RKY A;  1ZGA A;  1ON1 A;  3DKW A;  1RNL A;  3DPT A;  1UST A;  1IRG A;  2ZO4 A;  3E6M A;  2W84 A;  1P4W A;  2LF7 A;  4EV0 A;  2G7U A;  3TQN A;  5E1Z B;  2F5F A;  4ZYG A;  2FOK A;  4MEX F;  4I01 A;  1DP7 P;  3REO A;  3O6B B;  3LST A;  4I0A A;  1HXD A;  2EK5 A;  2F5C A;  2Z9O A;  1XN7 A;  2ESH A;  2PBI A;  5FGM A;  1DPR A;  1R7J A;  3V8K A;  1T2K A;  1YYV A;  3T5X A;  2EB7 A;  2P5K A;  1QBJ A;  1BI1 A;  5D4R A;  3W6J B;  3C3W A;  1TW3 A;  3R0J A;  4CYD A;  4L18 B;  4HLY A;  5DCM A;  1R22 A;  5LGU A;  5JFR A;  1ONV A;  3K1N A;  1HSJ A;  4MTE A;  3TO7 A;  1REP C;  1S6L A;  1USS A;  3NQO A;  2MD5 A;  5FB2 A;  2PFB A;  2D1V A;  4Y13 A;  2ZME A;  1L0O C;  4EVI A;  2FML A;  5LHH A;  1IN7 A;  2XRN A;  1C0W A;  4MQ9 F;  2EV5 A;  1QGP A;  3FZV A;  3RPU A;  3L2C A;  2PMU A;  2NRA C;  4NQW A;  4BHP A;  1J5Y A;  2M8E A;  3SZP A;  4XRF A;  2K4B A;  2GXG A;  5BOX A;  2Y75 A;  3E97 A;  2LNB A;  5E20 A;  1G6N A;  1W5T A;  1Z91 A;  3ZMS A;  1SFX A;  1I1S A;  2F5E A;  1YQA A;  3HOT A;  2M45 A;  3F8M A;  4U7B A;  1KGS A;  3GFJ A;  1X3U A;  4BXU A;  3DQV C;  4A6D A;  1FBU A;  2HEO A;  1XMA A;  2PI0 A;  1GXQ A;  3KCC A;  1IN4 A;  2Q2E A;  2R7F A;  1QZZ A;  1XGO A;  3GLX A;  2MC3 A;  1LDJ A;  5E8G A;  1R36 A;  2K86 A;  3E5U A;  1TQP A;  4PDK A;  1GVJ A;  2F2E A;  2G9W A;  2O3F A;  3ZN0 A;  2H27 A;  1H0M A;  1G3W A;  3I59 A;  4UHT A;  5HVQ C;  3SHF A;  4KYW A;  3V8L A;  2V1D A;  1D3Y A;  3N97 A;  1U5T B;  2K02 A;  4CZZ A;  4O5V A;  4LLG F;  4LLN A;  4A12 A;  2NAZ A;  4QWQ A;  3EET A;  4P9F A;  1KU2 A;  2HGC A;  3J80 Z;  5FLX Z;  2DBB A;  1B4A A;  1KQ0 A;  1ZRC A;  1I1G A;  1S29 A;  5LRR A;  1XGN A;  1NHA A;  4G6Q A;  3MFK A;  4KDP A;  4FHT A;  5BMZ A;  2KIM A;  4AVP A;  1YS7 A;  1B59 A;  2C6Y A;  1W5S A;  2OA4 A;  2O0Y A;  4EM1 A;  1SD5 A;  1SD4 A;  3C7J A;  4JK1 X;  3JSO A;  4IRH A;  3N4M A;  4G94 A;  1SAX A;  2DPD A;  3I0T A;  5LHG A;  4R8H A;  3CJN A;  4M9Z A;  3WTT C;  4N9H A;  3RKX A;  4ON0 A;  5LEJ A;  4Q48 A;  3WG9 A;  1I5Z A;  5IT9 K;  1G3Y A;  1R00 A;  3ZMV A;  4LG0 B;  1ULY A;  3TOB A;  4EJW A;  2VOO A;  4ESF A;  3D5L A;  3TOA A;  4M71 A;  5IT9 Z;  3KP4 A;  1FSH A;  2DW4 A;  3WGH A;  4NHJ A;  4U0V A;  5J6X A;  2XAS A;  1T6S A;  3HYI A;  5LBQ A;  3Q5F A;  2E7X A;  1BN5 A;  1YIO A;  3WE3 A;  4WX9 A;  3FM3 A;  3E5X A;  2P7V B;  2QLZ A;  3CTA A;  5FO5 A;  5HDK A;  2M1B A;  3C1D A;  4ASN A;  3ZP5 A;  5DYM A;  4LMY A;  3IKV A;  4U7D A;  1XSV A;  3CUQ A;  4RAZ A;  5F6F A;  4HBL A;  3EYI A;  4KIG A;  4Q5S F;  4L0Z B;  2Q8K A;  5E17 F;  2YPR A;  1MKM A;  4P96 A;  2IPQ X;  3VOD A;  5F64 A;  3DEU A;  2XAF A;  3PQJ A;  4LK0 F;  5DCF A;  4H0E A;  5K1Y A;  2KJB A;  1WSU A;  1R23 A;  3Q9V A;  2CFX A;  1KU3 A;  5E18 F;  4EMS A;  5CYV A;  3ZMZ A;  2GIV A;  3SFZ A;  2FU4 A;  1FYM A;  3WTS C;  3LQQ A;  1BIB A;  2DK5 A;  1AWC A;  2HR3 A;  3DPL C;  5DCM B;  3K9T A;  5AIQ A;  4ZYE A;  2O61 A;  3DP7 A;  1ON2 A;  2D1H A;  3WTZ A;  1T39 A;  2RGV A;  2E1C A;  3HHH A;  1ZLJ A;  3ABT A;  3CUQ C;  1WI9 A;  4YG2 F;  1TQM A;  3Q9S A;  4S05 A;  2ESN A;  3HHG A;  4G7Z F;  1LJ9 A;  5DD8 A;  2O03 A;  1DDN A;  1OR7 A;  3HSF A;  4HZF A;  4G6D A;  5FD5 A;  1Z05 A;  1ZRE A;  2EJR A;  3DF8 A;  4S04 A;  3JAM Z;  1O3S A;  3AAF A;  2HDC A;  1W7P B;  5TJJ A;  3M7G A;  1Y0U A;  3PFI A;  1IF1 A;  4RB3 C;  2HKO A;  5ICE A;  4EJU A;  2A69 F;  3QU3 A;  2H6B A;  3QU6 A;  3E5Q A;  2HZT A;  3K1M A;  1G3T A;  3TDU C;  2KIF A;  4B8X A;  4AIJ A;  5HS8 A;  3ERE D;  1U3E M;  1TQI A;  2RNJ A;  1HKT A;  3F8F A;  3K2Z A;  1QO0 D;  3H92 A;  2W85 A;  4MEY F;  3GW2 A;  2YX4 A;  4ZH4 F;  3CUO A;  3TKY A;  1J75 A;  4P9U A;  4LD5 A;  3LFK A;  3L09 A;  4BHB A;  3ZQ7 A;  2RC4 A;  3J81 K;  5HS7 A;  3CO7 C;  2Z3Y A;  3VOE A;  1K6O A;  4EQQ A;  1BJA A;  2Y0M A;  4I2O A;  3KLO A;  5D5V B;  4HV5 A;  3J81 Z;  3FMQ A;  3BJO A;  4MHG A;  1GXP A;  2ETH A;  3I59 B;  5CVR A;  4AD9 A;  2JSC A;  4KN7 X;  4DQ2 A;  4DNC A;  4A0X A;  2HYG D;  1ZYR F;  2HQR A;  2L02 A;  4M72 A;  4YIF A;  4MTD A;  4G7H F;  1FC3 A;  2A61 A;  1ZG3 A;  4WXH A;  4PGH A;  2DK8 A;  2VN2 A;  2AXL A;  3KE2 A;  1RUN A;  1UFM A;  1MDM A;  1ZAR A;  1ZLK A;  1DPU A;  3E6D A;  4RB0 A;  1YLF A;  2A6H F;  2PJP A;  4P5O A;  1YO5 C;  3WE2 A;  2HFH A;  5EEH A;  1O57 A;  3MZY A;  1HKQ A;  3WTV C;  4FX0 A;  4HQE A;  4IXA A;  3RJP A;  3HRU A;  2V9V A;  5EEG A;  2EFO A;  5A2Q Z;  2VC0 A;  4F7Z A;  2CQK A;  1XCB A;  4Q47 A;  4WCG A;  3BDD A;  4OIR F;  3SQN A;  1I6X A;  3LA2 A;  2ADU A;  2LKP A;  2LSO A;  2AS5 F;  5LRS A;  4ENJ A;  5ERI A;  4G9Y A;  2KIU A;  2YU3 A;  4HF1 A;  1IXR C;  4L9V A;  5F1R A;  1O7F A;  2EV6 A;  4RB2 C;  2M87 A;  4N9I A;  5J8C A;  1ZGJ A;  3K1P A;  2HS5 A;  2K7L A;  3JTH A;  2CYY A;  4BHC A;  4YFX F;  1PP7 U;  3S2W A;  2COM A;  3R61 A;  2ZXJ A;  1KYZ A;  3VEP A;  2UXX A;  2RDP A;  4I02 A;  3NRV A;  4IVN A;  1YW9 A;  4LK1 F;  5J8F A;  1XCV A;  5CVV A;  3NEU A;  3RPQ A;  2XV4 S;  4EM0 B;  4R79 A;  3RTR A;  4HDV A;  1MZB A;  4OMZ A;  3D0S A;  2Z33 A;  4IJA A;  3GWZ A;  2FEZ A;  3GFM A;  3RIR A;  2H94 A;  2XHK A;  4UVA A;  2VOP A;  2FA5 A;  2HYF A;  2OU2 A;  5H6R A;  2XRO A;  1XSX A;  3BWG A;  3R60 A;  1FT9 A;  3KP7 A;  1HQC A;  1BI0 A;  4UNO A;  5CVJ A;  2EA2 A;  1B9M A;  3ROU A;  3RDI A;  3IRR A;  3H3Z A;  1J7K A;  1CF7 B;  2L54 A;  1R1U A;  2GXB A;  3FXQ A;  3PQK A;  2HWV A;  1ZG1 A;  5DUK A;  2R3S A;  3IL2 A;  2DU9 A;  1D5V A;  1U6G A;  2HTS A;  3DV8 A;  2PQ8 A;  4BAY A;  1PP8 F;  1XGS A;  2OAZ A;  2UXN A;  4I7H A;  4CGZ A;  4FX4 A;  1S3J A;  5D5U B;  2W24 A;  1J9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...