3S1QJ

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s1qJ00
3Q0VA 2GM4A 4C2MJ 2TRTA 1U78A 4JX5A 2O9LA 2LY9A 4V2GA 1JJ6C 5EZGA 4DZPA 3S2DJ 2YU9J 2H8RA 3D1NI 5E3NA 1I6HJ 5JLXA 3H3VK 1MBFA 5IYBJ 1H89C 4BY7J 3OOUA 3CMYA 3LSGA 3GTOJ 2AHQA 3W6VA 2HOTA 5FKMA 1B72A 3QPLA 3JRGA 1K61A 3OSGA 1IDZA 3BTCA 3BQYA 4LOCA 5C4XJ 1MSEC 3DCFA 1AKHB 5IP9J 1GT0C 1GUUA 4FE4A 4A3CJ 3RKQA 2GLOA 2EZIA 5J1RA 2CJJA 1YRNB 2KDZA 4MO7A 2ECCA 1U8BA 1MSFC 1WCMJ 2NS8A 3OSFA 2L7MP 5F27A 4CYCB 1TWGJ 2DMNA 5F0HA 1JGGA 2R92J 1BW6A 3BR6A 3FKIJ 4IHYA 3CCYA 4M3BA 3IH4A 1GDTA 4FE7A 3ZQGA 3SJMA 3HM5A 3S17J 1OCPA 1OCTC 1P7IA 2Y0SN 2ME0A 4QSHA 3S15J 1OFCX 2Y9ZA 3DEWA 2DTZA 4QTRA 3BG9A 3JRHA 1WH5A 1W0TA 5F0CA 1XC5A 2LVSA 4I6ZA 5EGOA 3GTLJ 2DA6A 2W48A 3GBGA 4BBSJ 1ORKA 5K7ZA 1JT0A 1PUFB 1ETOA 3O8HA 2X9DA 3PM1A 1BJZA 2IEKA 5IP7J 5M3FJ 5C44J 5EZHA 4A93J 3TEDA 1IV6A 1P7JA 3JRDA 1F36A 2E2JJ 4M6VA 1TWFJ 1NTCA 3TP3A 3HGYA 4A69C 5BNGA 4X1EA 2M8GX 3HOZJ 1IRZA 3A01B 1Z77A 2CUEA 2XPUA 2LKXA 3ZOBA 3OIOA 3F0CA 2GBYA 3L1PA 2D5VA 3CQZJ 3S1MJ 3RZDJ 1SFOJ 1WH7A 2JWTA 5M5XJ 5IYDJ 2R7ZJ 2JN6A 4J19A 3C2BA 4ABZA 2IBDA 4UUSB 5C3EJ 1Z0XA 4A3LJ 2VI6A 1JKPC 2EZKA 1E3OC 1ZGWA 2XGEA 1NK2P 2FQ4A 4DYRA 1JT6A 1UG2A 5K7HA 2Y2ZA 1U9OA 1JTXA 1A6IA 2M34A 3ZQFA 1IGNA 2DA5A 1SANA 2YS9A 3IH3A 5IYCJ 2X6OA 3IH2A 1LFBA 1G2HA 4BY1J 5M3MJ 3LNQA 1T33A 3NAUA 5EG0B 4A3GJ 1WGXA 2XSDC 4XRMA 2K40A 5FKOA 1DU6A 3M3YJ 3JREA 3ZQCA 4A3EJ 4HNVA 5GPAA 3B6AA 1X2MA 1ZQ3P 1MBEA 4AYBN 1I3QJ 2R0QC 2LR8A 3PO3J 2DMTA 4RBOA 1IDYA 2VPRA 5FJ8J 1JKRC 1FJLA 2JA5J 2Y9YA 2L0KA 2XPVA 2HI3A 4FTHA 3FISA 5E3LA 5F1JA 3MVPA 4JX4A 2R5YB 2DA3A 1X2NA 2O8KA 1DU0A 1ETXA 1K83J 4X6AJ 2CU7A 1MBJA 5M5YJ 1B72B 2RAEA 2VKEA 3LSJA 9ANTA 3JR9A 2Y31A 4A3FJ 1FTZA 1X58A 4A3KJ 3BQZA 2E2HJ 2EH3A 4DYCA 1TWHJ 1RR7A 1S7EA 2N8GA 1AKHA 3S1QJ 1HOMA 1ZKGA 1TWCJ 1UHSA 2QF7A 1ETWA 4A3IJ 2K9SA 3K7AJ 2COBA 4JX6A 2R5ZA 2LD5A 1YRNA 3BT9A 1FIAA 1VF9A 1ZTRA 4W97A 4A3JJ 4CYCA 5FLVA 3I4MJ 1EF4A 2FX0A 1BL0A 3HGGA 2HXIA 1MH4A 5HODA 1W0UA 1ZR2A 2L9RA 1R9TJ 3HEFA 2ID6A 2QCOA 4Y7NJ 1LE8B 3FIWA 2MG4A 4IHVA 1RETA 2G0EA 2NS7A 2NVQJ 3UKGA 1GVDA 2E2IJ 3SDGA 3HBLA 2KT0A 1RKTA 2OPTA 3GTMJ 4A3BJ 4IHWA 1JKOC 1B8IB 1PUFA 4JYKA 1QVTA 4D7NA 2DMPA 1JUPA 1ETYA 2TCTA 4BXXJ 1BA5A 5EDNA 3BG5A 3ZQHA 3S14J 1ITYA 3Q3SA 4BKXA 3GTPJ 2L7FP 4FCYA 2YUSA 3QPSA 1T56A 1I50J 1QVUA 3A01A 3E7LA 2DA2A 2LK2A 5IP6A 1GV2A 3O8GA 4FISA 1VNDA 1F43A 2M9HA 4IHXA 3BTLA 5IOYA 4I76A 2EBIA 2NVYJ 3WHBA 1RESA 4XIDA 3JRAA 3BR0A 1U9NA 2OF7A 2LLKA 2DA1A 4XK4A 1IC8A 3BG3A 1WI3A 2DJNA 3Q0WA 1JTYA 3HB9A 4UUSA 4QIWN 3GTQJ 3HOVJ 1ENHA 4C3HJ 4W1UA 3JRBA 4A3DJ 1BW5A 2E1OA 2H1KA 2WB1N 4EEFG 4DYQA 3S1RJ 3MN2A 2HOAA 1XG1A 1D5YA 3GTJJ 3GTGJ 2XRLA 2JK3A 2NVTJ 4B4CA 1FEXA 2JMWA 2DN0A 5EEAA 1ZR4A 3HKZN 4XICA 5C4JJ 5EG0A 3I4NJ 1Q1VA 2K9NA 2XB0X 5EYRA 3VPRA 1HDPA 3G1OA 5J1UA 3PO2J 1AU7A 3BR5A 2MGQA 2MW8A 2ZB9A 4AUXA 2LTPA 1H88C 1Y1WJ 2JA7J 5F0FA 1AHDP 3BTIA 4C3IJ 5EF6A 3HDDA 3TW6A 3FK7A 3NARA 1RKWA 3ZQLA 5JLWA 3LSRA 1RPWA 2HQ5A 2O7OA 2DMUA 2DA7A 5GPCA 1LFUP 3HOUJ 1HLVA 3JRFA 1MBHA 3LSPA 2R5YA 1FTTA 2WAQN 1ZK8A 3RQIA 1TWAJ 4M3EA 3RZOJ 3MKLA 4NDLA 4D7MA 3SFIA 3FK6A 1IJWC 2P81A 1A5JA 4G12A 2ID3A 1MH3A 2L7ZA 1WPKA 1FIPA 2AO9A 5DS9A 2R5ZB 1NK3P 2M2EA 4GFBA 5F08A 5FLMJ 3TP0A 1TC3C 3JRIA 5K7FA 4UUTA 2FD5A 1HCRA 2XGDA 2HYJA 2HXOA 2R93J 2XGCA 3A02A 1JJ8C 2DA4A 2Y30A 4M3FA 5EGOB 1HDDC 3K2AA 2CUFA 4B1RA 2EQRA 3ZQIA 4DW6A 1IG7A 2NVXJ 4V2FA 2PMZN 3JRCA 4DZJA 4JP0A 5IOZA 4MFDA 1LE8A 1HF0A 3HOXJ 1IUFA 4D5FA 2HOSA 3HOYJ 1VFCA 5FKNA 1CQTA 4C3JJ 2ME6A 3BR3A 3BR1A 5M5WJ 3BTJA 4RDUA 2VKVA 2I10A 4B3AA 1B8IA 3GTKJ 2EZHA 4M3GA 2IAIA 4MLOA 5DTDA 3TW7A 4A3MJ 4S0HB 4L5EA 3A03A 3CDLA 2DMQA 5E3MA 3Q0UA 2MSYA 5GP9A 2FJ1A 1POGA 2ELKA 3H0GJ 3G1MA 3B6CA 4BBRJ 4MIMA 4XRSA 2EZLA 1JKQC 1UMQA 2LP0A 3S1NJ 3S16J 4MFEA 1OJLA 1ETKA 4IEJA 3S2HJ 4XRSG 3LOCA 3BR2A 2JJ7A 4Y52J 2X48A 2JA6J 3M4OJ 2ECBA 2M0CA 2WV1A 3IV5A 1ETQA 1O4XA 4AC0A 2JA8J 3QQAA 3G1LA 5E3OA 1ETVA 5J3LA 2K9QA 2NOGA 2E19A 4M3DA 5FKLA 2CQXA 1QPIA 1Y1VJ 2HDDA 1XS9A 2B63J 1H8AC 1MBKA 4D5CA 1GV5A 2XB5A 3WHCA 5J1YA 1QRYA 2CRGA 2CQQA 1VI0A 2LFBA 5IPAA 1APLC 3HOWJ 1MBGA 1JUSA 2XPWA 2VUMJ 1MNMC 1JUMA 5FKKA 5F04A
chains in the Genus database with same CATH superfamily
3PNYA 4GDFA 3EDPA 3KE2A 2TRTA 1U78A 2X1EA 3QOPA 4BXUA 1O7FA 3PJRA 2O9LA 4HDUA 3GYHX 2F48A 5LHGA 1XD7A 3LAJA 1I1GA 4DZPA 4JK1X 2H8RA 4AWXB 2E35A 1FSHA 4BDYA 2PBIA 5E79C 1U3EM 2E71A 2GIVA 1VTNC 3OOUA 4N4NB 4RA2A 2K9LA 5FD5A 3ASNH 3SDBA 3TO9A 2CGPA 3W6VA 3E3VA 3HTUA 5FKMA 1UAAA 3QPLA 2R7QA 3OSGA 1IDZA 2FNPA 3BQYA 3GZ6A 1VQ9I 4OIOF 3IRRA 5IP9J 1GT0C 3BY6A 4G6QA 4FE4A 4A3CJ 3SFZA 3EQLF 1MKMA 5D4RA 3BG6A 1MSFC 5HVQC 4RB2C 5LEJA 1SFKA 1S7OA 3DV8A 3EUHC 2O0YA 1BW6A 1VQPI 4R1HA 1N25A 2LOOA 3KP2A 1G59A 3HM5A 1FP1D 3U1DA 3S17J 1OCTC 4I09A 3DBHB 1KGSA 2Y9ZA 1YG2A 4QTRA 1OR7A 1WH5A 1Y6IA 2IA0A 1QZZA 1V5FA 2KIMA 1O7LA 3WTZA 2VJJA 4I6ZA 5EGOA 4UVBA 1V5GA 3GTLJ 2F5VA 4XM3A 2W48A 2ZC2A 3GBGA 3TGNA 1FOYA 1ORKA 2IS1A 1BIAA 4YFXF 4IVNA 1BI3A 1R7JA 1B1BA 1BJZA 4BAYA 1K6OA 3FM3A 1QZYA 5FRNA 4Q5SF 2BYVE 2RKHA 5C44J 3TEDA 4LFUA 4OINF 3OL4A 2GXBA 1YYVA 2ZFUA 4LB6B 4XR6A 4J01A 2K85A 4M6VA 1TWFJ 1NTCA 3ZR8X 2R7DA 3S3MA 2DOEA 2EV6A 3BZCA 3OYGA 3RQ4A 3OR1C 1YO5C 4XQFA 2XPUA 3EYYA 3ZOBA 2WAFA 2GBYA 2D5VA 1H9GA 4B44A 2A6TA 2P5KA 1W1WE 3MCZA 4KIGA 3WTVC 2DLLA 2HTSA 3EUKL 4ASNA 3TOBA 4MEXF 5FROA 2R7ZJ 1LDJA 1TW3A 1YOVB 2VN2A 2EJRA 1UELB 4PJMA 4LIUA 3LSIA 3R60A 4R79A 2L4AA 1MGTA 2BY0A 3E6DA 1ZGWA 2XAHA 1NK2P 4ANJA 2OTJI 2VJ4A 4DYRA 3RTRA 4G7HF 1IN8A 1BI0A 4XKVA 1JTXA 4XL9A 3IUOA 3FXMA 3ABTA 1G6NA 2DA5A 3V8JA 2YS9A 5FB2A 1USSA 1LEBA 1Z05A 4PUSA 3DKWA 1S72I 3KEQA 1R5GA 3IH2A 5M3MJ 4LK1F 3LNQA 1X4PA 5EG0B 2HWVA 4ZTJA 4P5OA 2ETHA 3T8RA 1D1CA 2VQGA 2W82A 5HLIA 4EM1A 3FKJA 2CFXA 2HTJA 2QQBA 3ZQCA 3GUDA 3SZGA 1PUEE 4Y17A 5GPAA 5KAIC 4AYBA 1X2MA 3P9KA 1ZQ3P 1MBEA 2DYSH 2ZJ2A 2R0QC 1Z91A 2LR8A 2BW3B 1ZRCA 1IO2A 1IDYA 2VPRA 2CUZA 5FJ8J 4X0GA 1JKRC 2Y9YA 4CZZA 5AIPA 2HI3A 1Y0NA 3RI4A 2A61A 2HYFA 4WX9A 2L5QA 1XCBA 5E8GA 2DT7B 1KA8A 4LG0B 1X2NA 1ETXA 3OYKA 3L2VA 5K5OA 3I4PA 1K83J 1T2KA 2RAEA 3FXJA 3DFGA 4ZH4F 2F6CA 3CMMA 3JR9A 1SAXA 4A3FJ 3CCLI 1X58A 5CVIA 3I56I 4A3KJ 1LVKA 3CCEI 3HPHA 3JTGA 2ZXWH 1AKHA 2KMUA 1ZKGA 2QF7A 3K4MA 3K7AJ 4A6EA 1IV8A 4JX6A 2CH0A 3SZTA 2LD5A 3WODF 2F2EA 2W25A 1FIAA 3E6MA 1WVRA 1VF9A 2F4OB 4A3JJ 4OIRF 3ROUA 4LLNA 2YX7A 1LNWA 2WTEA 1DP3A 3DU5A 1ZR2A 1W0UA 2L9RA 2VJIA 2RN7A 1IN4A 2XF6A 1R9TJ 1JXSA 2V1XA 2PEXA 3FIWA 1S7AA 4LGWA 2JUGA 1RETA 2NVQJ 1U5TA 3UKGA 2HQRA 2P5VA 1F1ZA 3SDGA 1RKTA 3P5JA 3OR2C 4A3BJ 4E7KA 4F92B 1B8IB 1PUFA 2L2OA 4CDGA 2JUCA 3KEYA 5E20A 1XDSA 4D7NA 1OPCA 5CPRB 4FASD 4CZCA 3GFMA 1JUPA 3F72A 2M7BA 4B43A 2D45A 2KKOA 3S14J 1ITYA 1QGPA 3RYPA 3K69A 1YS7A 4RB0A 2EIJH 1CGPA 3WE2A 1T56A 1I50J 1QVUA 3DU6A 2DA2A 4LJZF 1GV2A 3O8GA 1IRFA 5EJCA 3LAPA 1XCVA 1R22A 1W7PB 5IOYA 4I76A 5LLQA 1RESA 3FHZA 4IL6C 3JRAA 2CV1A 2P6TA 2ZNYA 2D1VA 2X1CA 4CXFA 1TP4A 2IJLA 2DO7A 2DJNA 4ENNA 3ZRGA 3S32A 3HB9A 4OMYA 2NNNA 1W36D 3W2WA 2DT5A 1Y8RB 3CLOA 1UZCA 1NG7A 4KN7X 1MD0A 1TT5B 2XAJA 2ZMEB 4W1UA 4C3HJ 1BW5A 2Y75A 3H36A 3V7SA 1HSTA 5H6QA 4BNCA 4LB5A 3S1RJ 3K10A 1TZLA 3IC7A 3QOEA 1R1VA 4WF2A 3MQ0A 4HF1A 3OL3A 1Z9CA 4MQ9F 2JMWA 4IO9F 3HKZA 3CMAI 4U88A 1ZR4A 2QSFX 5HNHA 3WTTC 3I4NJ 4XN0A 2I8DA 2IS6A 5DV5A 2JT1A 4O6JA 3GFLA 4EM0B 3BR5A 2MW8A 3B02A 5A2QZ 2XKOA 2UZKA 1A36A 1F9NA 1H88C 4PJLA 2LKSA 1HKQA 1BJAA 5B3SH 3Q5FA 4UVCA 4F3QA 1VQNI 3I0TA 3DP7A 1RKWA 2W24A 4A5NA 1FMVA 4U0WA 5GPCA 1LFUP 1W7PD 2WV0A 3I5UA 3S8PA 3FHNA 1MBHA 1SD4A 3LSPA 3MKYB 2O6GE 3ZMDA 2XIGA 2ZSHB 5DUIA 3WTSC 2IT0A 4NHJA 3BLYA 4PDKA 1XN7A 4KIFA 3RZOJ 3L9FA 3PSFA 5HLGA 3E6CC 3SFIA 1E3HA 1IJWC 4IPAA 2MFZA 4G12A 4FQGA 2X1DA 3EETA 1AOYA 2GQQA 2JA2A 1WPKA 3HTSB 1FMWA 1MZBA 3K2ZA 3DBRB 2E1MC 1X3ZB 1OYWA 1K4SA 5TGTA 2FD5A 3ZQQA 1V55H 1FLIA 2HYJA 3CJQB 3FBIB 3A02A 4BU2A 2Y30A 5EGOB 3OV8A 4EGYA 2H94A 4B1RA 2EQRA 3T5XA 4RS8A 4IOCF 3TKYA 3BJOA 3H3UA 2PMZN 3OYMA 3OYIA 2XUBA 4N0BA 2FUG2 3B73A 2EFWA 1UHMA 3K6GA 1OQYA 1ZAOA 3S93A 1HF0A 4E6KG 1DPRA 1FX7A 1LQ1A 4HRIA 4Y3OA 1Y0UA 2IGKA 2L54A 2BY2A 4QWQA 2L4MA 2PN6A 1PP8F 3S3OA 2MYSA 1JHHA 4WCGA 2VASA 4B3AA 2EZHA 3I58A 4A3MJ 4S0HB 4IRGA 4EMSA 3G4SI 5FRMA 3Q0UA 4ZDOA 2M7AA 2FJ1A 3N97A 1POGA 2ELKA 4XKWA 3M1CA 3G1MA 3PL8A 3RJPA 4XRSA 3S16J 4XONA 4MFEA 3J7YJ 3E5UA 1IF1A 2HR3A 1KONA 3HXLA 3R6SA 5KK1A 1EH7A 2KJBA 3M4OJ 2M0CA 4XKBA 3HOTA 3IV5A 3PUBA 2YPRA 3H9JA 3LL7A 3D5SC 2EK5A 2DJIA 2EFQA 1ETVA 5J3LA 4KYWA 2R7TA 2NOGA 4KJZA 4M3DA 4FT8A 3V7CA 2OAZA 2OJED 1D8KA 1Y1VJ 1QPIA 2JVGA 3R61A 3CUQA 4AIHA 1XS9A 2B63J 5DM7F 3C18A 1MBKA 3CO6C 3CMEI 2XB5A 3MEXA 3JSPA 3SYTA 3F22A 2UWMA 3HOWJ 1J5YA 1YJWI 1C0WA 1MBGA 4JBAA 1SAUA 2XROA 3KZYA 2AS5F 3GEZA 2VUMJ 2BE5F 1JUMA 2ZKZA 5FKKA 2HNHA 2STTA 1R1UA 1B4AA 4HF0A 1FY7A 2UXNA 4R8HA 3BZKA 3QU6A 2GAUA 4ZC3A 5TRDA 4V2GA 1MW7A 3I53A 2XC7A 3HRMA 4HQMA 3WTWC 5EZGA 4PFOA 3HSFA 3S2DJ 3OWTA 2F5EA 5FFZA 2QUFA 3VB2A 3HHGA 5JLXA 3AFHA 4BE2A 1XX5A 1O3SA 2G7HA 2V79A 1QA6A 3H3VK 1JI8A 4LG0A 3FXKA 2MH9A 2V1UA 4Y33A 1T38A 3GTOJ 2AHQA 3BJAA 3OS0A 2HOTA 1RR8C 1YX5A 4HPQA 1FPQA 3DPUA 1K61A 1D1BA 4XMYA 2VOOA 5JHUA 5KHDA 1SFUA 4KDPA 3JAMZ 2ELJA 3H3ZA 3DCFA 1AKHB 2W4SA 2NNYA 5J1RA 4CCLA 1T0FA 1HSJA 3V7RA 1WJBA 3KYDB 4HLXA 4EV0A 2B7EA 4YG2F 4ESJA 1FBSA 2FF4A 2IXSA 3DPLC 2L7MP 3OSFA 1UCRA 2H8WA 1TWGJ 5F0HA 2CW7A 3SXYA 3FKIJ 4IHYA 3VOEA 3CCYA 3SQNA 4M3BA 3CCMI 3KLNA 3H9QA 1GDTA 3ZMZA 4RGXA 1WJDA 5AIQA 2Q8KA 2FOKA 1FNNA 5CQEA 3L2QA 1Y39A 3KYCB 5FO5A 2ME0A 3S15J 1OFCX 3LMMA 1XB4A 1U5TB 5GTHC 4UUVA 2DTZA 5ILVA 4RAGA 1OCCH 2QLZA 1JGSA 2O3FA 4XLCA 2L7KA 4I7HA 5K7ZA 1PUFB 3CCRI 1ETOA 3G3ZA 3BP8A 5CLSA 5HLHA 1R5ID 1VQ5I 2QVOA 2XGXA 2FMLA 3VFZA 2AQFA 2GA2A 2PMUA 2BOLA 1EJ9A 1V4RA 4XOPA 3FDYA 3H5AA 3OYNA 3DKXA 1IV6A 5JVTA 1TLHB 3JCUC 1P7JA 1PVEA 3JRDA 1IZ1A 2J5PA 3E5QA 2E2JJ 3ELKA 4HNTA 1K4TA 2BGCA 3HGYA 5BNGA 4X1EA 4LIVA 2M8GX 2XAQA 3HOZJ 1IRZA 3EUHA 4FX0A 2KIUA 3HJEA 2XKPA 4CCMA 2LKXA 2E1MB 4GRIA 4ZYHA 2M3AA 3UR3C 2LF7A 1I5ZA 1IN7A 1PJRA 1SFOJ 1WH7A 3L2RA 3S3NA 5M5XJ 2OTLI 5CVRA 1GLNA 4CH7A 3VYUB 2JN6A 1PP7U 2A5YB 5B1AH 3WTYC 4YFNF 3DF8A 2IBDA 2VXDA 5C3EJ 5IT3A 4A3LJ 1V5EA 2K4JA 2CSOA 2VI6A 1JKPC 4YELA 4U7DA 1IAWA 3FX3A 4RGRA 3HHHA 3E6BA 1SC7A 2VT3A 4LLGF 1R1TA 2M34A 3ZQFA 4B09A 4S05A 1R58A 1IGNA 3O6BB 2K5CA 1J09A 2KHMA 1REPC 1BOAA 2BV6A 3QYFA 2FBKA 2V7FA 1MJ9A 1DUXC 3CD6I 1XGNA 3ECHA 1WZ2A 3GO5A 3W6JB 1WGXA 1K6YA 2OD5A 5FKOA 1DU6A 3GVAA 5LGNA 2FE3A 4BHCA 2EIMH 4A3EJ 4HNVA 2VQCA 2JSCA 2NAZA 1FC3A 2ICWG 4AYBN 3PFYA 4HLYA 1P4WA 3HG9A 4J00A 5E18F 5LEKA 2V26A 3LA3A 1R23A 5ICCA 4HA8A 4A5MA 4RGSA 2L0KA 2XPVA 3F8BA 4Y13A 3LA2A 1F5TA 4G6DA 4BQNA 4L9JA 3MZHA 4N4OB 3CCJI 1I27A 2VE8A 5D4SA 2ZJRF 3IAS2 2V1DA 4F7ZA 3RYRA 5M5YJ 1YHQI 5DDGA 9ANTA 3U2RA 4F93B 4HEA2 1FT9A 2Y31A 3Q9SA 5LD2C 1YJ9I 2DQLA 4EJOA 4PK4A 4RM3A 3BQZA 2Q2EA 4EATA 2E2HJ 2EH3A 3G2BA 1DGWY 4A3IJ 1TWCJ 3ABLH 4IOAF 1ETWA 2UXXA 3F3XA 1YRNA 4CHUA 3X2QH 3ABKH 1ZTRA 2BHYA 3BCAA 4EJVA 4LMYA 5FFXA 4NUBA 3I4MJ 2LMDA 1BL0A 5D6FA 2LG4A 2JSPA 3J7AY 2FBHA 4YEJA 3ZN1A 2MC4A 3HEFA 1BR1A 4C2UA 4IHVA 3NEUA 5JI6A 3JSOA 4D9JA 4AU7A 2FU4A 3CC4I 4GYGA 2V4JC 2KT0A 1B9NA 2QSHX 3MMYB 3I71A 2O5RA 1G3SA 5BOXA 4IHWA 3U1KA 4I0BA 1JKOC 1X3UA 3ONQA 2DBBA 5B1BH 2OU2A 3P9IA 5DYMA 2H6CA 1XSXA 4ESBA 2PJPA 3K4BA 3A1YA 2H1LA 1H9TA 1T08B 1TNTA 4BXXJ 1ON2A 3BG5A 1MNDA 4F52A 3Q3SA 2L7FP 4ENMA 2FOWA 2DK5A 1S3JA 4M9XA 2V1NA 3LA7A 4MQVA 3QPSA 4XLAA 5ERIA 1ZREA 2JVHA 2WAEA 1V3FA 3I55I 2HDCA 4IHXA 3H9GA 4XOTA 3JAMK 4II2A 2EBIA 2NVYJ 1E3PA 3HRTA 4G94A 3OYHA 4BQAA 1J2XA 3M8FA 2IS4A 1U9NA 1RUNA 2IGNA 1WI3A 1R00A 2CMPA 1YS6A 3VSKA 1RI7A 3Q0WA 1I6XA 3PQKA 4MNUA 1RRJA 4UUSA 4QIWN 3DKYA 3HOVJ 2A3SA 3CUQB 3G6EI 3C7JA 1ENHA 3BCBA 3FM5A 1HXDA 1BR2A 1FZPB 1SMYF 2OZUA 3GCMA 2WB1A 3E0JB 1CF7A 3DPTA 4EEFG 4Z6YA 2MD5A 1TW2A 2HOAA 4YIRX 1XG1A 1D5YA 4XLHA 2HOEA 4KT6A 3MKZA 5GADJ 4IQJA 3HZJA 3GTGJ 1XMAA 1Z7UA 3A2KA 2NVTJ 4B4CA 4L9TA 5EEAA 3HKZN 1VQMI 4WWCA 1Q1VA 1HKSA 2XB0X 3ASOH 3VPRA 2BY1A 1HDPA 3HSRA 4UXNA 2L02A 5J1UA 1AU7A 2Z2SB 1UHWA 1ZG3A 4M71A 4KT5C 4AUXA 1YW7A 2LTPA 2O8XA 2HVSA 1HW5A 1Y1WJ 2XAFA 2JA7J 3T8TA 2X0LA 4II3A 4UB8C 3HDDA 3TBIA 1IXRC 3IRQA 3ZQLA 2V6EA 5JLWA 1RPWA 4G9YA 2QKMB 2KRFA 1MMAA 2DMUA 2YR2A 3C2HA 2DA7A 5KCMA 4XKCA 1HLVA 3JRFA 2KFDA 2O61A 2WAQA 1SVOA 3BC8A 4MGRA 4RB1A 2DDAA 2FXAA 2OQRA 3OYJA 1TWAJ 4M3EA 3K70C 4P55A 5D5UB 3MKLA 3IL2A 2HKXA 4OU0A 3K4JA 4L9VA 3F21A 4G7OF 1QPMA 2P81A 4L18B 3HRSA 3TO6A 1MH3A 3OIQA 3KX2A 2M2EA 3KEOA 3ZMVA 4KA4A 4A0ZA 3TP0A 4HSRA 1W5CC 3JRIA 4UNOA 2KL4A 2ELHA 3U21A 3CC7I 2K86A 4UUTA 5KAFC 2DYRH 3TOAA 1W4MA 2BHZA 2NOJB 1JJ8C 2HEOA 1HDDC 2P6SA 4B48A 1S6LA 4UY8I 1FP2A 3QWLA 2L3DA 1YLFA 4BS9A 2K4BA 3JRCA 4JP0A 2YX4A 1P4AA 1X1DA 3BPVA 4Y4RA 4MFDA 3CJTB 1WJAA 2G9WA 3IAM2 4IX7A 4NB5A 2HPIA 2IP2A 5ICEA 3QPHA 1VFCA 3ZPLA 5FKNA 1CQTA 2ME6A 3BR3A 1T6SA 3KP5A 4AM3A 1SVLA 2DDBA 2LSOA 2NXNB 3VYRB 4RDUA 2VIXA 2VKVA 3K9TA 3G71I 3BDDA 2HQAA 4HYEA 1JE8A 4XORA 3F8MA 3A03A 4L5EA 3NWSA 2F4IA 5EEGA 2ZNZA 3AG1H 2R7UA 1R49A 3MZ8A 4A0XA 1BM9A 4ZYGA 3KIOA 1JKQC 3KZZA 1UMQA 1YX3A 4BH9A 1XSDA 2A69F 1OJLA 1ETKA 3FWEA 1J7KA 3QRFF 4E4HA 1S9HA 1IRGA 3CP2A 3BR2A 3H92A 3CTAA 3FZVA 3L7WA 3MKWB 4Y52J 2X48A 1VZ0A 4GCVA 1D0YA 1UB9A 1X1PA 2AQEA 3QP6A 1ETQA 2QA4I 4AC0A 1O4XA 2Z5UA 4AVZA 3QQAA 2IS2A 5DCMA 3WU1B 1KQ9A 3FXRA 1MMNA 3G1LA 4DQ2A 4ZTFA 2K9QA 3GWZA 2XSJC 2M4GA 2RNGA 2E19A 2MLGA 5FKLA 1K78A 3F6OA 2LNBA 4Q47A 3J7AO 1STZA 3H5NA 1Y8QB 1MMGA 1H8AC 3RIRA 1TTYA 1TT0A 1O3RA 2R7XA 1Y56A 4TV7A 5J1YA 2NS0A 3E97A 2CRGA 3ECOA 2ZBKA 2HVQA 2E34A 3CCUI 1WRJA 5IPAA 2R7SA 2VJ5A 1JUSA 1MJBA 2RGVA 1YW8A 2HFHA 2XAUA 4P9UA 4KMFA 5HDKA 4C2MJ 2GM4A 4PJ0C 1Z7LA 3V8KA 4E7LA 3EUAA 2K3PA 1X3WB 1YIOA 1SD5A 4MHGA 4FX4A 1ZG1A 4ENKA 3D1NI 5E3NA 1N75A 3WG9A 4CCOA 1XTAA 1MBFA 5IYBJ 3CCVI 4BY7J 2CV0A 2HS5A 5J40A 3CMYA 3LSGA 2F4MB 2DK8A 2ZO4A 1WI9A 3JRGA 3G73A 4DIQA 1EKEA 2Q2EB 3TDUC 3CUOA 1YITI 3F9KA 3K4NA 1ZYRF 1G3WA 3ZMSA 5LFAA 2HPMA 1MSEC 4M6YA 5C4XJ 4KICA 4BEHA 4WXHA 3VYSB 4U87A 1YRNB 2KDZA 4MO7A 3I3LA 2GA1A 2ECCA 4U7BA 2M45A 1U8BA 4PSWA 4Z2YA 1WCMJ 2BBYA 4A0YA 1KQ0A 2PX9A 2LBFA 1G3YA 2DMNA 4LG3A 3PIPF 1IRXA 2FEZA 3LQQA 2CW0F 3BR6A 2DODA 2FSWA 3IH4A 2FNAA 3HSEA 3SJMA 3OIPA 2XHKA 4HW0A 2M87A 4OMZA 1ZELA 1IUYA 1OCPA 2Y0SA 4PSXA 4F55A 2VBXA 2W7NA 3DEWA 2WBMA 1D5VA 4XLEA 1XC5A 1BN5A 5EEHA 3AL0C 4HOBA 2DA6A 3EYIA 3FXQA 3JTHA 1JT0A 3IHUA 3GF2A 4S04A 2A5WA 2DT6A 3WTXC 4UHTA 3PM1A 5IP7J 5ILUA 2OCEA 2P7VB 2VBZA 2ISYA 2X51A 1EV7A 4H4KC 2E1NA 3U9GA 2A68F 1OYYA 1GXQA 1SEUA 5GTIC 3K1MA 3TP3A 4A69C 2RQPA 4GYIA 2IVMA 4M74A 5CKTA 1RIOH 3TO7A 4EJTA 2CUEA 1SFEA 3OIOA 4CYDA 4A2UA 2D1HA 1HBXG 1B59A 4I01A 3FXUA 4BL0B 1TBXA 5D6EA 4RLQA 3ZXSA 5TJJA 4A6DA 1XGSA 3C2BA 3ERED 2DQRA 4ABZA 4UUSB 2QBYA 2BXYA 2K27A 2IA2A 1Z0XA 3OYFA 3QAHA 2LRDA 1U6GA 2EZKA 1E3OC 5DM6F 5HS8A 1KU7A 3ULQB 5L3BA 1I1SA 2HQNA 2KRHA 2BVMA 2OC6A 1UG2A 2XASA 5K7HA 1U0JA 3C3WA 2Y2ZA 3K1NA 1CF7B 1ZRDA 1U9OA 2X4HA 5K5RA 2VXZA 1T95A 1FBUA 1W5TA 4LK0F 3IH3A 4UVAA 5J4YA 5IYCJ 2P5LC 2K7LA 3W3CA 2X6OA 2V6CA 4NBQA 4XNFA 5JFRA 4NNJA 4I98B 3V4GA 1G2HA 3QPTA 4HX8A 3W2VA 1T33A 2GXGA 2Z99A 4XRMA 2K40A 4UV8A 5DD8A 4G6TB 1B6AA 1G3TA 4DBQA 1BBYA 5K1YA 3M3YJ 1J9IA 3HPGA 3JREA 1R4MB 1Z67A 3LWFA 2HYGD 4C9YA 3QYEA 3V8LA 4E7ZA 4BQQA 3CF5F 5LGUA 2WY8Q 2BY3A 1I3QJ 5FD6A 4AIJA 1UJ8A 2VT2A 1O3QA 4RM2A 2DMTA 2LY1A 5JHFA 3H5RA 4RBOA 3OYEA 3IWZA 5J47A 1FJLA 2HZDA 2JA5J 3HOSA 3WU2C 4FTHA 1P9QC 2EIKH 5E3LA 3MVPA 1WJFA 4QLCU 2DA3A 1JHFA 2O8KA 2LDUA 1DU0A 3TQNA 2GXAA 5ILSA 2YSRA 4M9SA 4EGZA 2DTRA 3MAJA 1B72B 2VB6A 3H35A 2VKEA 2A6HF 3DQVC 2R7WA 3GLXA 4L9NA 2EV5A 2VONA 2A05A 1OLTA 4DYCA 5E17F 2XF5A 1RR7A 1S7EA 3F8FA 3F23A 4XRFA 2LH9A 1HOMA 3MWMA 1QZEA 3TL4X 5LRSA 1DQUA 3BT9A 5LHIA 3J7ZI 2OZ6A 3VDXA 2EA2A 3WE3A 3OYDA 1LFPA 4CYCA 3M8EA 4NQWA 3WGGA 2PQ8A 3DBLB 5FLVA 2FX0A 3FXLA 1MH4A 3WGHA 5D5WB 4BHPA 2VC1A 3M07A 2OCCH 1SFXA 5BQTA 4OIPF 4E7HA 1I3AA 2ID6A 1WJ5A 2P8TA 3FXOA 3LSTA 4Y7NJ 5B66C 2MG4A 2VKDA 2MC3A 1RNLA 4FHTA 3M1EA 2G0EA 2NS7A 1OISA 1UG0A 4BXFA 2E2IJ 2CQKA 4PZJA 3HBLA 2DFEA 4YIFA 1MMSA 2PJRB 3SZPA 3DLLF 2EFNA 2PI0A 2IRFG 3LSHA 1Z1DA 1OCOH 2Z9OA 1TNSA 1NHAA 1QHHD 2DAOA 2TCTA 3KPHA 3KETA 5EDNA 1DPUA 1LDDA 3ZQHA 1QNTA 4BKXA 5B5EC 3ISPA 5ICGA 2Z16A 3T0YA 5IY5H 3A01A 1O57A 3E7LA 3KCCA 2CFOA 1OKRA 2QQ8A 3H0DA 4ZJZA 1UFMA 2M9HA 4CGZA 1F43A 2Z3YA 1MDMA 3D5LA 3EPZA 5DCMB 3WHBA 3A4CA 1KU2A 5J4VA 1J0RA 4AVPA 4XIDA 3BR0A 2VL8A 2Z1DA 2DA1A 2W84A 4P1WA 1D1AA 3BG3A 2QKLB 4HX7A 1P4XA 4XK4A 4BJ5C 1IC8A 1WJEA 5J6XA 5AONA 1E17A 1K78B 1WSUA 1EH6A 4NC8A 1IXCA 3NWTA 3HRUA 4CSWA 4OAYA 3GMEA 3JRBA 3P9CA 4HZFA 2E1OA 4WXCA 2H1KA 3BOQA 2WB1N 3DWLE 2X85A 4L5JA 1BOBA 1BC8C 1R4NB 3LQRA 2AXTC 4LD5A 1FYLA 1HW1A 2KLOA 4CCJA 2EILH 3F6VA 3GXOA 1LVAA 1B9MA 3RPUA 4ENJA 4KITB 2XRLA 2JK3A 3J81Z 3DTKA 1FEXA 4IHTA 1FOKA 3GZNB 4XICA 1FWZA 5C4JJ 2VC0A 3DLAA 5GAHJ 1WHUA 2K9NA 2DI3A 5EYRA 3ZMUA 3G1OA 3PO2J 2QM3A 4HX4A 5ED4A 2MGQA 3O3KA 3CDIA 5F0FA 1ZN2A 4MEYF 2JRTA 2QQAA 1GHCA 4OOIA 5EF6A 3GFJA 3TW6A 4HDVA 3NARA 1R5HA 3LSRA 2RC4A 3OYBA 1W36C 1KU3A 2E60A 2ESNA 1T8IA 1YI2I 4B47A 4B3XA 3AG4H 2R5YA 1FTTA 1QHGA 2WAQN 2EFPA 4G8XA 4K2EA 4BEHB 1D8JA 1QQIA 2OUMA 4DJAA 2W00A 2A07F 2EA4A 4NDLA 4IQ4A 3FK6A 3L00A 4JQFA 1O3TA 4BDZA 2LBFB 1A5JA 1W5SA 2A6EF 4DOZA 1GXPA 4AIKA 2ID3A 3KP7A 1NK3P 1ZHFA 2R5ZB 4HAMA 5F08A 1TQPA 4Q48A 2IGMA 4O3MA 5K7FA 2PG4A 2IPQX 2GWRA 2HGCA 4ZDLA 2HXOA 3W6KB 4E70A 2XGCA 2DA4A 3QU3A 3PIOF 1ULYA 4D0PA 4CCKA 3CF2A 5CVUA 2CUFA 5TISC 1DP7P 1VQ8I 2NVXJ 3VWBA 2ISZA 4MTEA 2DFIA 5IOZA 2JQ7A 1LE8A 2QSGX 1OCRH 3P7NA 1Z6TA 2QGUA 4D5FA 5BPIA 3LFUA 3M9AA 3RCOA 3HOYJ 3CLQA 4NC7A 4RAZA 4ON0A 3GW2A 3BR1A 2RNJA 4V19K 3BTJA 2ACJA 3L2WA 4M3GA 2IAIA 4MLOA 5DTDA 3TW7A 3ZMTA 5L3CA 2ZMEC 1KU9A 2L9SA 2LY2A 3CDLA 3JW4A 5E8IA 4PJNA 1AA7A 2DMQA 2Q1ZB 3F8CA 2MSYA 4CICA 3CJNA 4ZYAA 4P96A 4IRIA 3O2PE 2NRAC 1KQ8A 3H0GJ 3B6CA 4PGGA 4MIMA 2EZLA 3R4KA 4OIQF 1YW9A 3S1NJ 2CG4A 3IWFA 3MZYA 3ZQ7A 5HLTA 2OA4A 3S2HJ 2EV0A 2ZFWA 2VKHA 3V42A 4G7ZF 3BWGA 3GFIA 2COMA 2QBYB 3COAC 1IN6A 1R36A 4KUMA 2E36A 1E0EA 1A31A 6PAXA 3RKXA 1RC9A 1G8XA 4C30A 3CCSI 2X6YA 2EPFA 4KNYA 1VQ6I 5DUKA 1F4KA 2R7VA 3E5XA 3WTUC 1K79A 2V9VA 3KFWX 3HUGA 3C1DA 4GO1A 1X19A 1GV5A 3WHCA 5GAEJ 1X1CA 2Y48A 2VOPA 2CQQA 1VI0A 2EFOA 2UUZA 2LFBA 1APLC 3TMOA 4A12A 2IGOA 3WGIA 1ZH5A 2XPWA 1SMTA 3W2AA 3HC7A 2ZXJA 5K5QA 4QPOA 4IF4A 1XMKA 2M30A 2WA0A 3I59A 3Q0VA 4XLNF 1D3YA 4JX5A 2B9SA 2XF7A 4QPQA 3H1CA 2IW5A 1L0OC 3CDHA 2LY9A 1JJ6C 2P7CB 1P92A 4DGWB 5D5XB 1PDNC 2YU9J 1OR7C 1I6HJ 4I02A 2QWWA 1SVMA 1H89C 1VQLI 2IA1A 5CQGA 2X6XA 1S29A 2GOXB 2MA3A 2XAGA 1B72A 3J80K 4EJWA 3BPXA 4BUPA 3BTCA 3RDIA 4LOCA 4RLFA 4E7SA 5CVJA 3BJ6A 2QQ9A 1G4DA 1GUUA 1MIJA 1VQ7I 2FMYA 3RKQA 2GLOA 2EZIA 4IZZA 2WWYA 2CJJA 4BACA 2E5NA 3ZCOA 2XV4S 1YJNI 4M6XA 3IKTA 2NS8A 1A6QA 4L5IA 1Z3XA 5F27A 2CQNA 4CYCB 3I9V2 4NQWB 1JGGA 2R92J 1Q1HA 3LSKA 3D0SA 1ACIA 2B0LA 2JPBA 1BR4A 1XGOA 4FE7A 2EB7A 3KP4A 3ZQGA 4H0EA 4HG2A 4OAZA 3GZ5A 1P7IA 2Y0SN 4QSHA 1IXSB 2DPDA 4E7IA 4IJAA 2EWNA 2DXIA 3JRHA 3BG9A 1W0TA 4KFCA 2VQLA 1SD7A 2WC2A 3A0HC 4PFPA 2LVSA 5F0CA 3S2WA 1EA3A 5LHHA 3OYAA 3CC2I 4BBSJ 3HYIA 3O8HA 2DU9A 1T39A 2X9DA 2PJRA 3DXJF 3KYLA 2IEKA 4EQQA 3J81K 5M3FJ 1RUOA 3OYLA 3F8NA 5EZHA 1PYVA 4A93J 1D0XA 2CW8A 2W57A 2DW4A 4M9ZA 4IKFA 3C2GA 1RZ4A 3T1BA 1F36A 2KQRA 4HQEA 5FLXZ 2V9KA 5BS6A 2MH2A 1LEAA 1DDNA 1XMXA 2AXLA 3A01B 1Z77A 3E1SA 4HNUA 3NRVA 3F0CA 1ZARA 1LB2A 3L1PA 3DEUA 3CQZJ 4CO8A 2HKOA 4F91B 1MDMB 3S1MJ 3RZDJ 1LPQA 5IT9Z 4EVIA 2M1BA 2JWTA 3FMQA 1USTA 1BC7C 5KNLA 1YE9A 5IYDJ 2YU3A 2DOAA 4XN3A 4B8XA 4J19A 4KN4X 4HBLA 5J8CA 4HF2A 4AD9A 1OYIA 3ESWB 2OBPA 2XRNA 3OS2A 2XGEA 4PGHA 2ADUA 2FQ4A 4RAYA 1JT6A 3CZ6A 2MLKA 4JOMA 1A6IA 1SANA 2CQ7A 2DCEA 4N9IA 2VBYA 3OOPA 1KYZA 5LRRA 1YIJI 1L3LA 3DEEA 2RDPA 5HOOA 3BG7A 1LFBA 2XVCA 4BY1J 4C2TA 3NAUA 4A3GJ 2K3FA 2XSDC 1YFHA 2L01A 4ZDPA 3K4LA 4RMNA 2QYOA 5DCFA 1S8NA 2BEOA 3D5RC 5DD4A 2E1CA 4XLFA 3B6AA 4BHBA 3WU0A 2M0MA 1IN5A 1A04A 2E7XA 3CESA 3PO3J 1SD6A 2R7OA 5HNFA 3VODA 4GGGA 3AG3H 4D1QA 2WY7Q 2KIQA 3PQJA 4PCQA 3FISA 1U5TC 5F1JA 3HL2A 4JX4A 2R7RA 3SEQA 2R5YB 1K7AA 4RGUA 2LREA 4MTDA 3L09A 5E1XA 2HZTA 4X6AJ 2CU7A 4YIIA 1MBJA 3LSJA 1YTYA 2PMHA 2KDOA 2ZXHA 1J59A 1FTZA 4P9FA 1M1EB 4BQOA 1VQ4I 5H6RA 3FMSA 1OCZH 4ZZLA 2VQHA 2CUJA 1DGRM 1TWHJ 3S1QJ 2N8GA 1Z3YA 2Q0OA 1LKXA 2VBWA 1UHSA 2E7WA 2K9SA 2LYCA 5FGMA 5LBQA 2COBA 2R5ZA 3RSNA 3IKVA 1LDKB 1TQMA 2F5DA 3RPUD 2E5ZA 4IRHA 3AKZA 2DOFA 4W97A 3LFKA 2VE9A 2MABA 2DPUA 3IP4B 2O03A 1EF4A 1Z6RA 3HGGA 2HXIA 2RREA 2CYYA 2H27A 5HODA 3PFIA 1FOWA 2CWEA 2ZCWA 3KP3A 2QCOA 4NC6A 1LE8B 4GXOA 4CUGA 2KZVA 2QZ8A 2Y0MA 1GVJA 2ZJPF 1GVDA 1QBJA 3M8JA 5L3FA 4RAFA 2OPTA 2FA5A 4OWRB 5D8LB 1R71A 2P0WA 3GTMJ 1FYMA 1VQKI 1N78A 2M5WA 1HA8A 1KYWA 3NQOA 2DFFA 5HDGA 4JYKA 1ZGAA 2JZYA 3K4KA 4YRVA 1QVTA 5E1ZB 2W1OA 4IXAA 2DMPA 2MBFA 3ZGKA 4BJTA 2ZJQF 2LF8A 1HW2A 1ON1A 3L2UA 5LGTA 1ETYA 4BE0A 2VODA 3CP8A 4Y15A 3KP6A 1BA5A 5E1WA 1P2FA 2M4KA 3RKYA 3OMYA 3GTPJ 3VEPA 3GLLA 3GX4X 4XSZF 4FCYA 2RQQA 2YUSA 1MMDA 4M72A 4IHSA 5CJ9A 3M7GA 2P4WA 1YQAA 4E7JA 5IP6A 2LK2A 1A35A 2ESHA 2QEXI 3RPQA 3VSLA 4FISA 1VNDA 1ZG5A 2KPMA 3OY9A 2M8EA 4L0YB 3BTLA 3FBNB 5JR3A 3SEZA 1FSEA 2Z33A 2GIZA 2OF7A 2LLKA 1KZHA 4KIBA 1ZRFA 2KIFA 1LUJB 4UV9A 2C6YA 1JTYA 5F1RA 4CA0A 2KRCA 1R6RA 3FMRA 4YFKF 3GTQJ 5J8FA 5L3GA 2NYXA 2QENA 3HUGB 5CVVA 4I0AA 5D5VB 3L2CA 1OMIA 2G7UA 1HC8A 3MFKA 2RVCA 2HVRA 3PUFA 4A3DJ 3OYCA 4KISA 3QODA 2CS3A 1WWXA 4ITVA 4DYQA 4DNCA 3VYTB 1U8RA 3K70D 3MD2A 3MN2A 4HSTA 3K1PA 3GTJJ 2OV7A 1FBQA 2VPLA 1S5LC 5H20A 3I59B 2JRMA 5HS7A 3K4CA 2PFBA 1X1AA 4BGDA 2H6BA 2DN0A 1NG6A 4LLLA 2STWA 4ZYDA 5EG0A 4I99C 3UNGC 3ZP5A 5KVRA 4DBRA 4ZZDA 4LITA 3KLOA 2BVLA 2F5FA 2ZB9A 5HS9A 1MNEA 1AHDP 5H2FC 4L0ZB 3WG7H 4CCNA 2JPCA 2L9NA 3BTIA 4C3IJ 5BMZA 4M73A 1WJCA 1X1BA 2BW3A 2K02A 3LSMA 3FK7A 3Q9VA 5CYVA 4I2OA 1QU3A 2VLAA 2BZTA 2HQ5A 4AIDA 5D8KB 4WK8F 2O7OA 5FLXK 5DEQA 3HOUJ 1EH8A 3PNTA 3CCQI 3N05A 2W85A 4XBFA 4FETA 1ZK8A 1E2XA 3RQIA 4HV5A 3BROA 5JVGF 3I54A 2R3SA 3TDZC 1WQ2A 4BE1A 2F5CA 3A0BC 4D7MA 2GZWA 1WFXA 2D2WA 2V9PA 5IT9K 5DS9A 2L7ZA 1FIPA 2AO9A 4GFBA 2JTVA 3ABMH 5FLMJ 4PJJA 1TC3C 1P6RA 3AG2H 2KISA 3FF5A 4HV6A 4ZYEA 3KZIC 1HCRA 2XGDA 1N77A 2L9VA 2ZXIA 1ZLKA 2FQ3A 3RKWA 2OQGA 2R93J 1V54H 3DTIA 3ERMA 4M3FA 2R7FA 4N9HA 1I39A 3K2AA 1X4OA 2CO5A 2XDVA 1IG7A 4DW6A 3ZQIA 3QP5A 3CJRB 2PMZA 4V2FA 1U2WA 4U0YA 1WKMA 4DZJA 1BI2A 3SHFA 5ICFA 2LKPA 3HOXJ 1MJAA 1XPXA 2KP6A 1IUFA 2R4GA 2HOSA 2BXZA 3ML6A 2UV1A 4XLPF 4C3JJ 2ZSIB 5M5WJ 3CUQC 3K0LA 1LJ9A 4RB3C 4EJUA 2I10A 3PNVA 1B8IA 3GTKJ 3I64A 2FRHA 3J80Z 3ZN0A 1ZLJA 2MD0A 4WXDA 5E3MA 1QO0D 5GP9A 1FOXA 4O5VA 4BJ6C 3BZ6A 3CO7C 2K9MA 3REOA 2CV2A 1ERDA 1VQOI 4BBRJ 1XSVA 1Z21A 2EINH 1J75A 2GOMA 5A2QK 2LP0A 5L3EA 5GAGJ 2KJCA 4IEJA 4XRSG 2HDWA 4XSXF 3OS1A 3N4MA 5HDNA 1H0MA 3LOCA 4BYYA 1D0ZA 1T98A 2JJ7A 3HIFA 2TDXA 3AL0B 2JA6J 2HU9A 2ECBA 4KMUX 1FYKA 2WV1A 3PSIA 2J5OA 5F6FA 2JA8J 1NH3A 2H09A 3R0JA 4Q4ZF 3ABUA 1W7PA 2KZGA 2RV8A 5L3DA 1XGMA 2NVUB 2DFHA 4EM2A 5E3OA 5F64A 3AAFA 1BIBA 4U0VA 1TQIA 2PLYA 3R0AA 2CQXA 5BPDA 2HDDA 1HKTA 1BI1A 2X6WA 4D5CA 4ETSA 3DTEA 4ESFA 1IW7F 1HQCA 2FBIA 1QRYA 1T0FC 2ZMEA 2WADA 2I5UA 4UB6C 1TL8A 1AWCA 1ZGJA 2Y69H 2LC2A 1ONVA 1XDUA 1MNMC 1ODDA 5F04A 3QYBA
chains in the Genus database with same CATH topology
3Q0VA 2GM4A 4C2MJ 2TRTA 1U78A 4JX5A 2O9LA 2LY9A 4V2GA 1JJ6C 5EZGA 4DZPA 3S2DJ 2YU9J 2H8RA 3D1NI 5E3NA 1I6HJ 5JLXA 3H3VK 1MBFA 5IYBJ 1H89C 4BY7J 3OOUA 3CMYA 3LSGA 3GTOJ 2AHQA 3W6VA 2HOTA 5FKMA 1B72A 3QPLA 3JRGA 1K61A 3OSGA 1IDZA 3BTCA 3BQYA 4LOCA 5C4XJ 1MSEC 3DCFA 1AKHB 5IP9J 1GT0C 1GUUA 4FE4A 4A3CJ 3RKQA 2GLOA 2EZIA 5J1RA 2CJJA 1YRNB 2KDZA 4MO7A 2ECCA 1U8BA 1MSFC 1WCMJ 2NS8A 3OSFA 2L7MP 5F27A 4CYCB 1TWGJ 2DMNA 5F0HA 1JGGA 2R92J 1BW6A 3BR6A 3FKIJ 4IHYA 3CCYA 4M3BA 3IH4A 1GDTA 4FE7A 3ZQGA 3SJMA 3HM5A 3S17J 1OCPA 1OCTC 1P7IA 2Y0SN 2ME0A 4QSHA 3S15J 1OFCX 2Y9ZA 3DEWA 2DTZA 4QTRA 3BG9A 3JRHA 1WH5A 1W0TA 5F0CA 1XC5A 2LVSA 4I6ZA 5EGOA 3GTLJ 2DA6A 2W48A 3GBGA 4BBSJ 1ORKA 5K7ZA 1JT0A 1PUFB 1ETOA 3O8HA 2X9DA 3PM1A 1BJZA 2IEKA 5IP7J 5M3FJ 5C44J 5EZHA 4A93J 3TEDA 1IV6A 1P7JA 3JRDA 1F36A 2E2JJ 4M6VA 1TWFJ 1NTCA 3TP3A 3HGYA 4A69C 5BNGA 4X1EA 2M8GX 3HOZJ 1IRZA 3A01B 1Z77A 2CUEA 2XPUA 2LKXA 3ZOBA 3OIOA 3F0CA 2GBYA 3L1PA 2D5VA 3CQZJ 3S1MJ 3RZDJ 1SFOJ 1WH7A 2JWTA 5M5XJ 5IYDJ 2R7ZJ 2JN6A 4J19A 3C2BA 4ABZA 2IBDA 4UUSB 5C3EJ 1Z0XA 4A3LJ 2VI6A 1JKPC 2EZKA 1E3OC 1ZGWA 2XGEA 1NK2P 2FQ4A 4DYRA 1JT6A 1UG2A 5K7HA 2Y2ZA 1U9OA 1JTXA 1A6IA 2M34A 3ZQFA 1IGNA 2DA5A 1SANA 2YS9A 3IH3A 5IYCJ 2X6OA 3IH2A 1LFBA 1G2HA 4BY1J 5M3MJ 3LNQA 1T33A 3NAUA 5EG0B 4A3GJ 1WGXA 2XSDC 4XRMA 2K40A 5FKOA 1DU6A 3M3YJ 3JREA 3ZQCA 4A3EJ 4HNVA 5GPAA 3B6AA 1X2MA 1ZQ3P 1MBEA 4AYBN 1I3QJ 2R0QC 2LR8A 3PO3J 2DMTA 4RBOA 1IDYA 2VPRA 5FJ8J 1JKRC 1FJLA 2JA5J 2Y9YA 2L0KA 2XPVA 2HI3A 4FTHA 3FISA 5E3LA 5F1JA 3MVPA 4JX4A 2R5YB 2DA3A 1X2NA 2O8KA 1DU0A 1ETXA 1K83J 4X6AJ 2CU7A 1MBJA 5M5YJ 1B72B 2RAEA 2VKEA 3LSJA 9ANTA 3JR9A 2Y31A 4A3FJ 1FTZA 1X58A 4A3KJ 3BQZA 2E2HJ 2EH3A 4DYCA 1TWHJ 1RR7A 1S7EA 2N8GA 1AKHA 3S1QJ 1HOMA 1ZKGA 1TWCJ 1UHSA 2QF7A 1ETWA 4A3IJ 2K9SA 3K7AJ 2COBA 4JX6A 2R5ZA 2LD5A 1YRNA 3BT9A 1FIAA 1VF9A 1ZTRA 4W97A 4A3JJ 4CYCA 5FLVA 3I4MJ 1EF4A 2FX0A 1BL0A 3HGGA 2HXIA 1MH4A 5HODA 1W0UA 1ZR2A 2L9RA 1R9TJ 3HEFA 2ID6A 2QCOA 4Y7NJ 1LE8B 3FIWA 2MG4A 4IHVA 1RETA 2G0EA 2NS7A 2NVQJ 3UKGA 1GVDA 2E2IJ 3SDGA 3HBLA 2KT0A 1RKTA 2OPTA 3GTMJ 4A3BJ 4IHWA 1JKOC 1B8IB 1PUFA 4JYKA 1QVTA 4D7NA 2DMPA 1JUPA 1ETYA 2TCTA 4BXXJ 1BA5A 5EDNA 3BG5A 3ZQHA 3S14J 1ITYA 3Q3SA 4BKXA 3GTPJ 2L7FP 4FCYA 2YUSA 3QPSA 1T56A 1I50J 1QVUA 3A01A 3E7LA 2DA2A 2LK2A 5IP6A 1GV2A 3O8GA 4FISA 1VNDA 1F43A 2M9HA 4IHXA 3BTLA 5IOYA 4I76A 2EBIA 2NVYJ 3WHBA 1RESA 4XIDA 3JRAA 3BR0A 1U9NA 2OF7A 2LLKA 2DA1A 4XK4A 1IC8A 3BG3A 1WI3A 2DJNA 3Q0WA 1JTYA 3HB9A 4UUSA 4QIWN 3GTQJ 3HOVJ 1ENHA 4C3HJ 4W1UA 3JRBA 4A3DJ 1BW5A 2E1OA 2H1KA 2WB1N 4EEFG 4DYQA 3S1RJ 3MN2A 2HOAA 1XG1A 1D5YA 3GTJJ 3GTGJ 2XRLA 2JK3A 2NVTJ 4B4CA 1FEXA 2JMWA 2DN0A 5EEAA 1ZR4A 3HKZN 4XICA 5C4JJ 5EG0A 3I4NJ 1Q1VA 2K9NA 2XB0X 5EYRA 3VPRA 1HDPA 3G1OA 5J1UA 3PO2J 1AU7A 3BR5A 2MGQA 2MW8A 2ZB9A 4AUXA 2LTPA 1H88C 1Y1WJ 2JA7J 5F0FA 1AHDP 3BTIA 4C3IJ 5EF6A 3HDDA 3TW6A 3FK7A 3NARA 1RKWA 3ZQLA 5JLWA 3LSRA 1RPWA 2HQ5A 2O7OA 2DMUA 2DA7A 5GPCA 1LFUP 3HOUJ 1HLVA 3JRFA 1MBHA 3LSPA 2R5YA 1FTTA 2WAQN 1ZK8A 3RQIA 1TWAJ 4M3EA 3RZOJ 3MKLA 4NDLA 4D7MA 3SFIA 3FK6A 1IJWC 2P81A 1A5JA 4G12A 2ID3A 1MH3A 2L7ZA 1WPKA 1FIPA 2AO9A 5DS9A 2R5ZB 1NK3P 2M2EA 4GFBA 5F08A 5FLMJ 3TP0A 1TC3C 3JRIA 5K7FA 4UUTA 2FD5A 1HCRA 2XGDA 2HYJA 2HXOA 2R93J 2XGCA 3A02A 1JJ8C 2DA4A 2Y30A 4M3FA 5EGOB 1HDDC 3K2AA 2CUFA 4B1RA 2EQRA 3ZQIA 4DW6A 1IG7A 2NVXJ 4V2FA 2PMZN 3JRCA 4DZJA 4JP0A 5IOZA 4MFDA 1LE8A 1HF0A 3HOXJ 1IUFA 4D5FA 2HOSA 3HOYJ 1VFCA 5FKNA 1CQTA 4C3JJ 2ME6A 3BR3A 3BR1A 5M5WJ 3BTJA 4RDUA 2VKVA 2I10A 4B3AA 1B8IA 3GTKJ 2EZHA 4M3GA 2IAIA 4MLOA 5DTDA 3TW7A 4A3MJ 4S0HB 4L5EA 3A03A 3CDLA 2DMQA 5E3MA 3Q0UA 2MSYA 5GP9A 2FJ1A 1POGA 2ELKA 3H0GJ 3G1MA 3B6CA 4BBRJ 4MIMA 4XRSA 2EZLA 1JKQC 1UMQA 2LP0A 3S1NJ 3S16J 4MFEA 1OJLA 1ETKA 4IEJA 3S2HJ 4XRSG 3LOCA 3BR2A 2JJ7A 4Y52J 2X48A 2JA6J 3M4OJ 2ECBA 2M0CA 2WV1A 3IV5A 1ETQA 1O4XA 4AC0A 2JA8J 3QQAA 3G1LA 5E3OA 1ETVA 5J3LA 2K9QA 2NOGA 2E19A 4M3DA 5FKLA 2CQXA 1QPIA 1Y1VJ 2HDDA 1XS9A 2B63J 1H8AC 1MBKA 4D5CA 1GV5A 2XB5A 3WHCA 5J1YA 1QRYA 2CRGA 2CQQA 1VI0A 2LFBA 5IPAA 1APLC 3HOWJ 1MBGA 1JUSA 2XPWA 2VUMJ 1MNMC 1JUMA 5FKKA 5F04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q0V A;  2GM4 A;  4C2M J;  2TRT A;  1U78 A;  4JX5 A;  2O9L A;  2LY9 A;  4V2G A;  1JJ6 C;  5EZG A;  4DZP A;  3S2D J;  2YU9 J;  2H8R A;  3D1N I;  5E3N A;  1I6H J;  5JLX A;  3H3V K;  1MBF A;  5IYB J;  1H89 C;  4BY7 J;  3OOU A;  3CMY A;  3LSG A;  3GTO J;  2AHQ A;  3W6V A;  2HOT A;  5FKM A;  1B72 A;  3QPL A;  3JRG A;  1K61 A;  3OSG A;  1IDZ A;  3BTC A;  3BQY A;  4LOC A;  5C4X J;  1MSE C;  3DCF A;  1AKH B;  5IP9 J;  1GT0 C;  1GUU A;  4FE4 A;  4A3C J;  3RKQ A;  2GLO A;  2EZI A;  5J1R A;  2CJJ A;  1YRN B;  2KDZ A;  4MO7 A;  2ECC A;  1U8B A;  1MSF C;  1WCM J;  2NS8 A;  3OSF A;  2L7M P;  5F27 A;  4CYC B;  1TWG J;  2DMN A;  5F0H A;  1JGG A;  2R92 J;  1BW6 A;  3BR6 A;  3FKI J;  4IHY A;  3CCY A;  4M3B A;  3IH4 A;  1GDT A;  4FE7 A;  3ZQG A;  3SJM A;  3HM5 A;  3S17 J;  1OCP A;  1OCT C;  1P7I A;  2Y0S N;  2ME0 A;  4QSH A;  3S15 J;  1OFC X;  2Y9Z A;  3DEW A;  2DTZ A;  4QTR A;  3BG9 A;  3JRH A;  1WH5 A;  1W0T A;  5F0C A;  1XC5 A;  2LVS A;  4I6Z A;  5EGO A;  3GTL J;  2DA6 A;  2W48 A;  3GBG A;  4BBS J;  1ORK A;  5K7Z A;  1JT0 A;  1PUF B;  1ETO A;  3O8H A;  2X9D A;  3PM1 A;  1BJZ A;  2IEK A;  5IP7 J;  5M3F J;  5C44 J;  5EZH A;  4A93 J;  3TED A;  1IV6 A;  1P7J A;  3JRD A;  1F36 A;  2E2J J;  4M6V A;  1TWF J;  1NTC A;  3TP3 A;  3HGY A;  4A69 C;  5BNG A;  4X1E A;  2M8G X;  3HOZ J;  1IRZ A;  3A01 B;  1Z77 A;  2CUE A;  2XPU A;  2LKX A;  3ZOB A;  3OIO A;  3F0C A;  2GBY A;  3L1P A;  2D5V A;  3CQZ J;  3S1M J;  3RZD J;  1SFO J;  1WH7 A;  2JWT A;  5M5X J;  5IYD J;  2R7Z J;  2JN6 A;  4J19 A;  3C2B A;  4ABZ A;  2IBD A;  4UUS B;  5C3E J;  1Z0X A;  4A3L J;  2VI6 A;  1JKP C;  2EZK A;  1E3O C;  1ZGW A;  2XGE A;  1NK2 P;  2FQ4 A;  4DYR A;  1JT6 A;  1UG2 A;  5K7H A;  2Y2Z A;  1U9O A;  1JTX A;  1A6I A;  2M34 A;  3ZQF A;  1IGN A;  2DA5 A;  1SAN A;  2YS9 A;  3IH3 A;  5IYC J;  2X6O A;  3IH2 A;  1LFB A;  1G2H A;  4BY1 J;  5M3M J;  3LNQ A;  1T33 A;  3NAU A;  5EG0 B;  4A3G J;  1WGX A;  2XSD C;  4XRM A;  2K40 A;  5FKO A;  1DU6 A;  3M3Y J;  3JRE A;  3ZQC A;  4A3E J;  4HNV A;  5GPA A;  3B6A A;  1X2M A;  1ZQ3 P;  1MBE A;  4AYB N;  1I3Q J;  2R0Q C;  2LR8 A;  3PO3 J;  2DMT A;  4RBO A;  1IDY A;  2VPR A;  5FJ8 J;  1JKR C;  1FJL A;  2JA5 J;  2Y9Y A;  2L0K A;  2XPV A;  2HI3 A;  4FTH A;  3FIS A;  5E3L A;  5F1J A;  3MVP A;  4JX4 A;  2R5Y B;  2DA3 A;  1X2N A;  2O8K A;  1DU0 A;  1ETX A;  1K83 J;  4X6A J;  2CU7 A;  1MBJ A;  5M5Y J;  1B72 B;  2RAE A;  2VKE A;  3LSJ A;  9ANT A;  3JR9 A;  2Y31 A;  4A3F J;  1FTZ A;  1X58 A;  4A3K J;  3BQZ A;  2E2H J;  2EH3 A;  4DYC A;  1TWH J;  1RR7 A;  1S7E A;  2N8G A;  1AKH A;  3S1Q J;  1HOM A;  1ZKG A;  1TWC J;  1UHS A;  2QF7 A;  1ETW A;  4A3I J;  2K9S A;  3K7A J;  2COB A;  4JX6 A;  2R5Z A;  2LD5 A;  1YRN A;  3BT9 A;  1FIA A;  1VF9 A;  1ZTR A;  4W97 A;  4A3J J;  4CYC A;  5FLV A;  3I4M J;  1EF4 A;  2FX0 A;  1BL0 A;  3HGG A;  2HXI A;  1MH4 A;  5HOD A;  1W0U A;  1ZR2 A;  2L9R A;  1R9T J;  3HEF A;  2ID6 A;  2QCO A;  4Y7N J;  1LE8 B;  3FIW A;  2MG4 A;  4IHV A;  1RET A;  2G0E A;  2NS7 A;  2NVQ J;  3UKG A;  1GVD A;  2E2I J;  3SDG A;  3HBL A;  2KT0 A;  1RKT A;  2OPT A;  3GTM J;  4A3B J;  4IHW A;  1JKO C;  1B8I B;  1PUF A;  4JYK A;  1QVT A;  4D7N A;  2DMP A;  1JUP A;  1ETY A;  2TCT A;  4BXX J;  1BA5 A;  5EDN A;  3BG5 A;  3ZQH A;  3S14 J;  1ITY A;  3Q3S A;  4BKX A;  3GTP J;  2L7F P;  4FCY A;  2YUS A;  3QPS A;  1T56 A;  1I50 J;  1QVU A;  3A01 A;  3E7L A;  2DA2 A;  2LK2 A;  5IP6 A;  1GV2 A;  3O8G A;  4FIS A;  1VND A;  1F43 A;  2M9H A;  4IHX A;  3BTL A;  5IOY A;  4I76 A;  2EBI A;  2NVY J;  3WHB A;  1RES A;  4XID A;  3JRA A;  3BR0 A;  1U9N A;  2OF7 A;  2LLK A;  2DA1 A;  4XK4 A;  1IC8 A;  3BG3 A;  1WI3 A;  2DJN A;  3Q0W A;  1JTY A;  3HB9 A;  4UUS A;  4QIW N;  3GTQ J;  3HOV J;  1ENH A;  4C3H J;  4W1U A;  3JRB A;  4A3D J;  1BW5 A;  2E1O A;  2H1K A;  2WB1 N;  4EEF G;  4DYQ A;  3S1R J;  3MN2 A;  2HOA A;  1XG1 A;  1D5Y A;  3GTJ J;  3GTG J;  2XRL A;  2JK3 A;  2NVT J;  4B4C A;  1FEX A;  2JMW A;  2DN0 A;  5EEA A;  1ZR4 A;  3HKZ N;  4XIC A;  5C4J J;  5EG0 A;  3I4N J;  1Q1V A;  2K9N A;  2XB0 X;  5EYR A;  3VPR A;  1HDP A;  3G1O A;  5J1U A;  3PO2 J;  1AU7 A;  3BR5 A;  2MGQ A;  2MW8 A;  2ZB9 A;  4AUX A;  2LTP A;  1H88 C;  1Y1W J;  2JA7 J;  5F0F A;  1AHD P;  3BTI A;  4C3I J;  5EF6 A;  3HDD A;  3TW6 A;  3FK7 A;  3NAR A;  1RKW A;  3ZQL A;  5JLW A;  3LSR A;  1RPW A;  2HQ5 A;  2O7O A;  2DMU A;  2DA7 A;  5GPC A;  1LFU P;  3HOU J;  1HLV A;  3JRF A;  1MBH A;  3LSP A;  2R5Y A;  1FTT A;  2WAQ N;  1ZK8 A;  3RQI A;  1TWA J;  4M3E A;  3RZO J;  3MKL A;  4NDL A;  4D7M A;  3SFI A;  3FK6 A;  1IJW C;  2P81 A;  1A5J A;  4G12 A;  2ID3 A;  1MH3 A;  2L7Z A;  1WPK A;  1FIP A;  2AO9 A;  5DS9 A;  2R5Z B;  1NK3 P;  2M2E A;  4GFB A;  5F08 A;  5FLM J;  3TP0 A;  1TC3 C;  3JRI A;  5K7F A;  4UUT A;  2FD5 A;  1HCR A;  2XGD A;  2HYJ A;  2HXO A;  2R93 J;  2XGC A;  3A02 A;  1JJ8 C;  2DA4 A;  2Y30 A;  4M3F A;  5EGO B;  1HDD C;  3K2A A;  2CUF A;  4B1R A;  2EQR A;  3ZQI A;  4DW6 A;  1IG7 A;  2NVX J;  4V2F A;  2PMZ N;  3JRC A;  4DZJ A;  4JP0 A;  5IOZ A;  4MFD A;  1LE8 A;  1HF0 A;  3HOX J;  1IUF A;  4D5F A;  2HOS A;  3HOY J;  1VFC A;  5FKN A;  1CQT A;  4C3J J;  2ME6 A;  3BR3 A;  3BR1 A;  5M5W J;  3BTJ A;  4RDU A;  2VKV A;  2I10 A;  4B3A A;  1B8I A;  3GTK J;  2EZH A;  4M3G A;  2IAI A;  4MLO A;  5DTD A;  3TW7 A;  4A3M J;  4S0H B;  4L5E A;  3A03 A;  3CDL A;  2DMQ A;  5E3M A;  3Q0U A;  2MSY A;  5GP9 A;  2FJ1 A;  1POG A;  2ELK A;  3H0G J;  3G1M A;  3B6C A;  4BBR J;  4MIM A;  4XRS A;  2EZL A;  1JKQ C;  1UMQ A;  2LP0 A;  3S1N J;  3S16 J;  4MFE A;  1OJL A;  1ETK A;  4IEJ A;  3S2H J;  4XRS G;  3LOC A;  3BR2 A;  2JJ7 A;  4Y52 J;  2X48 A;  2JA6 J;  3M4O J;  2ECB A;  2M0C A;  2WV1 A;  3IV5 A;  1ETQ A;  1O4X A;  4AC0 A;  2JA8 J;  3QQA A;  3G1L A;  5E3O A;  1ETV A;  5J3L A;  2K9Q A;  2NOG A;  2E19 A;  4M3D A;  5FKL A;  2CQX A;  1QPI A;  1Y1V J;  2HDD A;  1XS9 A;  2B63 J;  1H8A C;  1MBK A;  4D5C A;  1GV5 A;  2XB5 A;  3WHC A;  5J1Y A;  1QRY A;  2CRG A;  2CQQ A;  1VI0 A;  2LFB A;  5IPA A;  1APL C;  3HOW J;  1MBG A;  1JUS A;  2XPW A;  2VUM J;  1MNM C;  1JUM A;  5FKK A;  5F04 A; 
#chains in the Genus database with same CATH topology
 3PNY A;  4GDF A;  3EDP A;  3KE2 A;  2TRT A;  1U78 A;  2X1E A;  3QOP A;  4BXU A;  1O7F A;  3PJR A;  2O9L A;  4HDU A;  3GYH X;  2F48 A;  5LHG A;  1XD7 A;  3LAJ A;  1I1G A;  4DZP A;  4JK1 X;  2H8R A;  4AWX B;  2E35 A;  1FSH A;  4BDY A;  2PBI A;  5E79 C;  1U3E M;  2E71 A;  2GIV A;  1VTN C;  3OOU A;  4N4N B;  4RA2 A;  2K9L A;  5FD5 A;  3ASN H;  3SDB A;  3TO9 A;  2CGP A;  3W6V A;  3E3V A;  3HTU A;  5FKM A;  1UAA A;  3QPL A;  2R7Q A;  3OSG A;  1IDZ A;  2FNP A;  3BQY A;  3GZ6 A;  1VQ9 I;  4OIO F;  3IRR A;  5IP9 J;  1GT0 C;  3BY6 A;  4G6Q A;  4FE4 A;  4A3C J;  3SFZ A;  3EQL F;  1MKM A;  5D4R A;  3BG6 A;  1MSF C;  5HVQ C;  4RB2 C;  5LEJ A;  1SFK A;  1S7O A;  3DV8 A;  3EUH C;  2O0Y A;  1BW6 A;  1VQP I;  4R1H A;  1N25 A;  2LOO A;  3KP2 A;  1G59 A;  3HM5 A;  1FP1 D;  3U1D A;  3S17 J;  1OCT C;  4I09 A;  3DBH B;  1KGS A;  2Y9Z A;  1YG2 A;  4QTR A;  1OR7 A;  1WH5 A;  1Y6I A;  2IA0 A;  1QZZ A;  1V5F A;  2KIM A;  1O7L A;  3WTZ A;  2VJJ A;  4I6Z A;  5EGO A;  4UVB A;  1V5G A;  3GTL J;  2F5V A;  4XM3 A;  2W48 A;  2ZC2 A;  3GBG A;  3TGN A;  1FOY A;  1ORK A;  2IS1 A;  1BIA A;  4YFX F;  4IVN A;  1BI3 A;  1R7J A;  1B1B A;  1BJZ A;  4BAY A;  1K6O A;  3FM3 A;  1QZY A;  5FRN A;  4Q5S F;  2BYV E;  2RKH A;  5C44 J;  3TED A;  4LFU A;  4OIN F;  3OL4 A;  2GXB A;  1YYV A;  2ZFU A;  4LB6 B;  4XR6 A;  4J01 A;  2K85 A;  4M6V A;  1TWF J;  1NTC A;  3ZR8 X;  2R7D A;  3S3M A;  2DOE A;  2EV6 A;  3BZC A;  3OYG A;  3RQ4 A;  3OR1 C;  1YO5 C;  4XQF A;  2XPU A;  3EYY A;  3ZOB A;  2WAF A;  2GBY A;  2D5V A;  1H9G A;  4B44 A;  2A6T A;  2P5K A;  1W1W E;  3MCZ A;  4KIG A;  3WTV C;  2DLL A;  2HTS A;  3EUK L;  4ASN A;  3TOB A;  4MEX F;  5FRO A;  2R7Z J;  1LDJ A;  1TW3 A;  1YOV B;  2VN2 A;  2EJR A;  1UEL B;  4PJM A;  4LIU A;  3LSI A;  3R60 A;  4R79 A;  2L4A A;  1MGT A;  2BY0 A;  3E6D A;  1ZGW A;  2XAH A;  1NK2 P;  4ANJ A;  2OTJ I;  2VJ4 A;  4DYR A;  3RTR A;  4G7H F;  1IN8 A;  1BI0 A;  4XKV A;  1JTX A;  4XL9 A;  3IUO A;  3FXM A;  3ABT A;  1G6N A;  2DA5 A;  3V8J A;  2YS9 A;  5FB2 A;  1USS A;  1LEB A;  1Z05 A;  4PUS A;  3DKW A;  1S72 I;  3KEQ A;  1R5G A;  3IH2 A;  5M3M J;  4LK1 F;  3LNQ A;  1X4P A;  5EG0 B;  2HWV A;  4ZTJ A;  4P5O A;  2ETH A;  3T8R A;  1D1C A;  2VQG A;  2W82 A;  5HLI A;  4EM1 A;  3FKJ A;  2CFX A;  2HTJ A;  2QQB A;  3ZQC A;  3GUD A;  3SZG A;  1PUE E;  4Y17 A;  5GPA A;  5KAI C;  4AYB A;  1X2M A;  3P9K A;  1ZQ3 P;  1MBE A;  2DYS H;  2ZJ2 A;  2R0Q C;  1Z91 A;  2LR8 A;  2BW3 B;  1ZRC A;  1IO2 A;  1IDY A;  2VPR A;  2CUZ A;  5FJ8 J;  4X0G A;  1JKR C;  2Y9Y A;  4CZZ A;  5AIP A;  2HI3 A;  1Y0N A;  3RI4 A;  2A61 A;  2HYF A;  4WX9 A;  2L5Q A;  1XCB A;  5E8G A;  2DT7 B;  1KA8 A;  4LG0 B;  1X2N A;  1ETX A;  3OYK A;  3L2V A;  5K5O A;  3I4P A;  1K83 J;  1T2K A;  2RAE A;  3FXJ A;  3DFG A;  4ZH4 F;  2F6C A;  3CMM A;  3JR9 A;  1SAX A;  4A3F J;  3CCL I;  1X58 A;  5CVI A;  3I56 I;  4A3K J;  1LVK A;  3CCE I;  3HPH A;  3JTG A;  2ZXW H;  1AKH A;  2KMU A;  1ZKG A;  2QF7 A;  3K4M A;  3K7A J;  4A6E A;  1IV8 A;  4JX6 A;  2CH0 A;  3SZT A;  2LD5 A;  3WOD F;  2F2E A;  2W25 A;  1FIA A;  3E6M A;  1WVR A;  1VF9 A;  2F4O B;  4A3J J;  4OIR F;  3ROU A;  4LLN A;  2YX7 A;  1LNW A;  2WTE A;  1DP3 A;  3DU5 A;  1ZR2 A;  1W0U A;  2L9R A;  2VJI A;  2RN7 A;  1IN4 A;  2XF6 A;  1R9T J;  1JXS A;  2V1X A;  2PEX A;  3FIW A;  1S7A A;  4LGW A;  2JUG A;  1RET A;  2NVQ J;  1U5T A;  3UKG A;  2HQR A;  2P5V A;  1F1Z A;  3SDG A;  1RKT A;  3P5J A;  3OR2 C;  4A3B J;  4E7K A;  4F92 B;  1B8I B;  1PUF A;  2L2O A;  4CDG A;  2JUC A;  3KEY A;  5E20 A;  1XDS A;  4D7N A;  1OPC A;  5CPR B;  4FAS D;  4CZC A;  3GFM A;  1JUP A;  3F72 A;  2M7B A;  4B43 A;  2D45 A;  2KKO A;  3S14 J;  1ITY A;  1QGP A;  3RYP A;  3K69 A;  1YS7 A;  4RB0 A;  2EIJ H;  1CGP A;  3WE2 A;  1T56 A;  1I50 J;  1QVU A;  3DU6 A;  2DA2 A;  4LJZ F;  1GV2 A;  3O8G A;  1IRF A;  5EJC A;  3LAP A;  1XCV A;  1R22 A;  1W7P B;  5IOY A;  4I76 A;  5LLQ A;  1RES A;  3FHZ A;  4IL6 C;  3JRA A;  2CV1 A;  2P6T A;  2ZNY A;  2D1V A;  2X1C A;  4CXF A;  1TP4 A;  2IJL A;  2DO7 A;  2DJN A;  4ENN A;  3ZRG A;  3S32 A;  3HB9 A;  4OMY A;  2NNN A;  1W36 D;  3W2W A;  2DT5 A;  1Y8R B;  3CLO A;  1UZC A;  1NG7 A;  4KN7 X;  1MD0 A;  1TT5 B;  2XAJ A;  2ZME B;  4W1U A;  4C3H J;  1BW5 A;  2Y75 A;  3H36 A;  3V7S A;  1HST A;  5H6Q A;  4BNC A;  4LB5 A;  3S1R J;  3K10 A;  1TZL A;  3IC7 A;  3QOE A;  1R1V A;  4WF2 A;  3MQ0 A;  4HF1 A;  3OL3 A;  1Z9C A;  4MQ9 F;  2JMW A;  4IO9 F;  3HKZ A;  3CMA I;  4U88 A;  1ZR4 A;  2QSF X;  5HNH A;  3WTT C;  3I4N J;  4XN0 A;  2I8D A;  2IS6 A;  5DV5 A;  2JT1 A;  4O6J A;  3GFL A;  4EM0 B;  3BR5 A;  2MW8 A;  3B02 A;  5A2Q Z;  2XKO A;  2UZK A;  1A36 A;  1F9N A;  1H88 C;  4PJL A;  2LKS A;  1HKQ A;  1BJA A;  5B3S H;  3Q5F A;  4UVC A;  4F3Q A;  1VQN I;  3I0T A;  3DP7 A;  1RKW A;  2W24 A;  4A5N A;  1FMV A;  4U0W A;  5GPC A;  1LFU P;  1W7P D;  2WV0 A;  3I5U A;  3S8P A;  3FHN A;  1MBH A;  1SD4 A;  3LSP A;  3MKY B;  2O6G E;  3ZMD A;  2XIG A;  2ZSH B;  5DUI A;  3WTS C;  2IT0 A;  4NHJ A;  3BLY A;  4PDK A;  1XN7 A;  4KIF A;  3RZO J;  3L9F A;  3PSF A;  5HLG A;  3E6C C;  3SFI A;  1E3H A;  1IJW C;  4IPA A;  2MFZ A;  4G12 A;  4FQG A;  2X1D A;  3EET A;  1AOY A;  2GQQ A;  2JA2 A;  1WPK A;  3HTS B;  1FMW A;  1MZB A;  3K2Z A;  3DBR B;  2E1M C;  1X3Z B;  1OYW A;  1K4S A;  5TGT A;  2FD5 A;  3ZQQ A;  1V55 H;  1FLI A;  2HYJ A;  3CJQ B;  3FBI B;  3A02 A;  4BU2 A;  2Y30 A;  5EGO B;  3OV8 A;  4EGY A;  2H94 A;  4B1R A;  2EQR A;  3T5X A;  4RS8 A;  4IOC F;  3TKY A;  3BJO A;  3H3U A;  2PMZ N;  3OYM A;  3OYI A;  2XUB A;  4N0B A;  2FUG 2;  3B73 A;  2EFW A;  1UHM A;  3K6G A;  1OQY A;  1ZAO A;  3S93 A;  1HF0 A;  4E6K G;  1DPR A;  1FX7 A;  1LQ1 A;  4HRI A;  4Y3O A;  1Y0U A;  2IGK A;  2L54 A;  2BY2 A;  4QWQ A;  2L4M A;  2PN6 A;  1PP8 F;  3S3O A;  2MYS A;  1JHH A;  4WCG A;  2VAS A;  4B3A A;  2EZH A;  3I58 A;  4A3M J;  4S0H B;  4IRG A;  4EMS A;  3G4S I;  5FRM A;  3Q0U A;  4ZDO A;  2M7A A;  2FJ1 A;  3N97 A;  1POG A;  2ELK A;  4XKW A;  3M1C A;  3G1M A;  3PL8 A;  3RJP A;  4XRS A;  3S16 J;  4XON A;  4MFE A;  3J7Y J;  3E5U A;  1IF1 A;  2HR3 A;  1KON A;  3HXL A;  3R6S A;  5KK1 A;  1EH7 A;  2KJB A;  3M4O J;  2M0C A;  4XKB A;  3HOT A;  3IV5 A;  3PUB A;  2YPR A;  3H9J A;  3LL7 A;  3D5S C;  2EK5 A;  2DJI A;  2EFQ A;  1ETV A;  5J3L A;  4KYW A;  2R7T A;  2NOG A;  4KJZ A;  4M3D A;  4FT8 A;  3V7C A;  2OAZ A;  2OJE D;  1D8K A;  1Y1V J;  1QPI A;  2JVG A;  3R61 A;  3CUQ A;  4AIH A;  1XS9 A;  2B63 J;  5DM7 F;  3C18 A;  1MBK A;  3CO6 C;  3CME I;  2XB5 A;  3MEX A;  3JSP A;  3SYT A;  3F22 A;  2UWM A;  3HOW J;  1J5Y A;  1YJW I;  1C0W A;  1MBG A;  4JBA A;  1SAU A;  2XRO A;  3KZY A;  2AS5 F;  3GEZ A;  2VUM J;  2BE5 F;  1JUM A;  2ZKZ A;  5FKK A;  2HNH A;  2STT A;  1R1U A;  1B4A A;  4HF0 A;  1FY7 A;  2UXN A;  4R8H A;  3BZK A;  3QU6 A;  2GAU A;  4ZC3 A;  5TRD A;  4V2G A;  1MW7 A;  3I53 A;  2XC7 A;  3HRM A;  4HQM A;  3WTW C;  5EZG A;  4PFO A;  3HSF A;  3S2D J;  3OWT A;  2F5E A;  5FFZ A;  2QUF A;  3VB2 A;  3HHG A;  5JLX A;  3AFH A;  4BE2 A;  1XX5 A;  1O3S A;  2G7H A;  2V79 A;  1QA6 A;  3H3V K;  1JI8 A;  4LG0 A;  3FXK A;  2MH9 A;  2V1U A;  4Y33 A;  1T38 A;  3GTO J;  2AHQ A;  3BJA A;  3OS0 A;  2HOT A;  1RR8 C;  1YX5 A;  4HPQ A;  1FPQ A;  3DPU A;  1K61 A;  1D1B A;  4XMY A;  2VOO A;  5JHU A;  5KHD A;  1SFU A;  4KDP A;  3JAM Z;  2ELJ A;  3H3Z A;  3DCF A;  1AKH B;  2W4S A;  2NNY A;  5J1R A;  4CCL A;  1T0F A;  1HSJ A;  3V7R A;  1WJB A;  3KYD B;  4HLX A;  4EV0 A;  2B7E A;  4YG2 F;  4ESJ A;  1FBS A;  2FF4 A;  2IXS A;  3DPL C;  2L7M P;  3OSF A;  1UCR A;  2H8W A;  1TWG J;  5F0H A;  2CW7 A;  3SXY A;  3FKI J;  4IHY A;  3VOE A;  3CCY A;  3SQN A;  4M3B A;  3CCM I;  3KLN A;  3H9Q A;  1GDT A;  3ZMZ A;  4RGX A;  1WJD A;  5AIQ A;  2Q8K A;  2FOK A;  1FNN A;  5CQE A;  3L2Q A;  1Y39 A;  3KYC B;  5FO5 A;  2ME0 A;  3S15 J;  1OFC X;  3LMM A;  1XB4 A;  1U5T B;  5GTH C;  4UUV A;  2DTZ A;  5ILV A;  4RAG A;  1OCC H;  2QLZ A;  1JGS A;  2O3F A;  4XLC A;  2L7K A;  4I7H A;  5K7Z A;  1PUF B;  3CCR I;  1ETO A;  3G3Z A;  3BP8 A;  5CLS A;  5HLH A;  1R5I D;  1VQ5 I;  2QVO A;  2XGX A;  2FML A;  3VFZ A;  2AQF A;  2GA2 A;  2PMU A;  2BOL A;  1EJ9 A;  1V4R A;  4XOP A;  3FDY A;  3H5A A;  3OYN A;  3DKX A;  1IV6 A;  5JVT A;  1TLH B;  3JCU C;  1P7J A;  1PVE A;  3JRD A;  1IZ1 A;  2J5P A;  3E5Q A;  2E2J J;  3ELK A;  4HNT A;  1K4T A;  2BGC A;  3HGY A;  5BNG A;  4X1E A;  4LIV A;  2M8G X;  2XAQ A;  3HOZ J;  1IRZ A;  3EUH A;  4FX0 A;  2KIU A;  3HJE A;  2XKP A;  4CCM A;  2LKX A;  2E1M B;  4GRI A;  4ZYH A;  2M3A A;  3UR3 C;  2LF7 A;  1I5Z A;  1IN7 A;  1PJR A;  1SFO J;  1WH7 A;  3L2R A;  3S3N A;  5M5X J;  2OTL I;  5CVR A;  1GLN A;  4CH7 A;  3VYU B;  2JN6 A;  1PP7 U;  2A5Y B;  5B1A H;  3WTY C;  4YFN F;  3DF8 A;  2IBD A;  2VXD A;  5C3E J;  5IT3 A;  4A3L J;  1V5E A;  2K4J A;  2CSO A;  2VI6 A;  1JKP C;  4YEL A;  4U7D A;  1IAW A;  3FX3 A;  4RGR A;  3HHH A;  3E6B A;  1SC7 A;  2VT3 A;  4LLG F;  1R1T A;  2M34 A;  3ZQF A;  4B09 A;  4S05 A;  1R58 A;  1IGN A;  3O6B B;  2K5C A;  1J09 A;  2KHM A;  1REP C;  1BOA A;  2BV6 A;  3QYF A;  2FBK A;  2V7F A;  1MJ9 A;  1DUX C;  3CD6 I;  1XGN A;  3ECH A;  1WZ2 A;  3GO5 A;  3W6J B;  1WGX A;  1K6Y A;  2OD5 A;  5FKO A;  1DU6 A;  3GVA A;  5LGN A;  2FE3 A;  4BHC A;  2EIM H;  4A3E J;  4HNV A;  2VQC A;  2JSC A;  2NAZ A;  1FC3 A;  2ICW G;  4AYB N;  3PFY A;  4HLY A;  1P4W A;  3HG9 A;  4J00 A;  5E18 F;  5LEK A;  2V26 A;  3LA3 A;  1R23 A;  5ICC A;  4HA8 A;  4A5M A;  4RGS A;  2L0K A;  2XPV A;  3F8B A;  4Y13 A;  3LA2 A;  1F5T A;  4G6D A;  4BQN A;  4L9J A;  3MZH A;  4N4O B;  3CCJ I;  1I27 A;  2VE8 A;  5D4S A;  2ZJR F;  3IAS 2;  2V1D A;  4F7Z A;  3RYR A;  5M5Y J;  1YHQ I;  5DDG A;  9ANT A;  3U2R A;  4F93 B;  4HEA 2;  1FT9 A;  2Y31 A;  3Q9S A;  5LD2 C;  1YJ9 I;  2DQL A;  4EJO A;  4PK4 A;  4RM3 A;  3BQZ A;  2Q2E A;  4EAT A;  2E2H J;  2EH3 A;  3G2B A;  1DGW Y;  4A3I J;  1TWC J;  3ABL H;  4IOA F;  1ETW A;  2UXX A;  3F3X A;  1YRN A;  4CHU A;  3X2Q H;  3ABK H;  1ZTR A;  2BHY A;  3BCA A;  4EJV A;  4LMY A;  5FFX A;  4NUB A;  3I4M J;  2LMD A;  1BL0 A;  5D6F A;  2LG4 A;  2JSP A;  3J7A Y;  2FBH A;  4YEJ A;  3ZN1 A;  2MC4 A;  3HEF A;  1BR1 A;  4C2U A;  4IHV A;  3NEU A;  5JI6 A;  3JSO A;  4D9J A;  4AU7 A;  2FU4 A;  3CC4 I;  4GYG A;  2V4J C;  2KT0 A;  1B9N A;  2QSH X;  3MMY B;  3I71 A;  2O5R A;  1G3S A;  5BOX A;  4IHW A;  3U1K A;  4I0B A;  1JKO C;  1X3U A;  3ONQ A;  2DBB A;  5B1B H;  2OU2 A;  3P9I A;  5DYM A;  2H6C A;  1XSX A;  4ESB A;  2PJP A;  3K4B A;  3A1Y A;  2H1L A;  1H9T A;  1T08 B;  1TNT A;  4BXX J;  1ON2 A;  3BG5 A;  1MND A;  4F52 A;  3Q3S A;  2L7F P;  4ENM A;  2FOW A;  2DK5 A;  1S3J A;  4M9X A;  2V1N A;  3LA7 A;  4MQV A;  3QPS A;  4XLA A;  5ERI A;  1ZRE A;  2JVH A;  2WAE A;  1V3F A;  3I55 I;  2HDC A;  4IHX A;  3H9G A;  4XOT A;  3JAM K;  4II2 A;  2EBI A;  2NVY J;  1E3P A;  3HRT A;  4G94 A;  3OYH A;  4BQA A;  1J2X A;  3M8F A;  2IS4 A;  1U9N A;  1RUN A;  2IGN A;  1WI3 A;  1R00 A;  2CMP A;  1YS6 A;  3VSK A;  1RI7 A;  3Q0W A;  1I6X A;  3PQK A;  4MNU A;  1RRJ A;  4UUS A;  4QIW N;  3DKY A;  3HOV J;  2A3S A;  3CUQ B;  3G6E I;  3C7J A;  1ENH A;  3BCB A;  3FM5 A;  1HXD A;  1BR2 A;  1FZP B;  1SMY F;  2OZU A;  3GCM A;  2WB1 A;  3E0J B;  1CF7 A;  3DPT A;  4EEF G;  4Z6Y A;  2MD5 A;  1TW2 A;  2HOA A;  4YIR X;  1XG1 A;  1D5Y A;  4XLH A;  2HOE A;  4KT6 A;  3MKZ A;  5GAD J;  4IQJ A;  3HZJ A;  3GTG J;  1XMA A;  1Z7U A;  3A2K A;  2NVT J;  4B4C A;  4L9T A;  5EEA A;  3HKZ N;  1VQM I;  4WWC A;  1Q1V A;  1HKS A;  2XB0 X;  3ASO H;  3VPR A;  2BY1 A;  1HDP A;  3HSR A;  4UXN A;  2L02 A;  5J1U A;  1AU7 A;  2Z2S B;  1UHW A;  1ZG3 A;  4M71 A;  4KT5 C;  4AUX A;  1YW7 A;  2LTP A;  2O8X A;  2HVS A;  1HW5 A;  1Y1W J;  2XAF A;  2JA7 J;  3T8T A;  2X0L A;  4II3 A;  4UB8 C;  3HDD A;  3TBI A;  1IXR C;  3IRQ A;  3ZQL A;  2V6E A;  5JLW A;  1RPW A;  4G9Y A;  2QKM B;  2KRF A;  1MMA A;  2DMU A;  2YR2 A;  3C2H A;  2DA7 A;  5KCM A;  4XKC A;  1HLV A;  3JRF A;  2KFD A;  2O61 A;  2WAQ A;  1SVO A;  3BC8 A;  4MGR A;  4RB1 A;  2DDA A;  2FXA A;  2OQR A;  3OYJ A;  1TWA J;  4M3E A;  3K70 C;  4P55 A;  5D5U B;  3MKL A;  3IL2 A;  2HKX A;  4OU0 A;  3K4J A;  4L9V A;  3F21 A;  4G7O F;  1QPM A;  2P81 A;  4L18 B;  3HRS A;  3TO6 A;  1MH3 A;  3OIQ A;  3KX2 A;  2M2E A;  3KEO A;  3ZMV A;  4KA4 A;  4A0Z A;  3TP0 A;  4HSR A;  1W5C C;  3JRI A;  4UNO A;  2KL4 A;  2ELH A;  3U21 A;  3CC7 I;  2K86 A;  4UUT A;  5KAF C;  2DYR H;  3TOA A;  1W4M A;  2BHZ A;  2NOJ B;  1JJ8 C;  2HEO A;  1HDD C;  2P6S A;  4B48 A;  1S6L A;  4UY8 I;  1FP2 A;  3QWL A;  2L3D A;  1YLF A;  4BS9 A;  2K4B A;  3JRC A;  4JP0 A;  2YX4 A;  1P4A A;  1X1D A;  3BPV A;  4Y4R A;  4MFD A;  3CJT B;  1WJA A;  2G9W A;  3IAM 2;  4IX7 A;  4NB5 A;  2HPI A;  2IP2 A;  5ICE A;  3QPH A;  1VFC A;  3ZPL A;  5FKN A;  1CQT A;  2ME6 A;  3BR3 A;  1T6S A;  3KP5 A;  4AM3 A;  1SVL A;  2DDB A;  2LSO A;  2NXN B;  3VYR B;  4RDU A;  2VIX A;  2VKV A;  3K9T A;  3G71 I;  3BDD A;  2HQA A;  4HYE A;  1JE8 A;  4XOR A;  3F8M A;  3A03 A;  4L5E A;  3NWS A;  2F4I A;  5EEG A;  2ZNZ A;  3AG1 H;  2R7U A;  1R49 A;  3MZ8 A;  4A0X A;  1BM9 A;  4ZYG A;  3KIO A;  1JKQ C;  3KZZ A;  1UMQ A;  1YX3 A;  4BH9 A;  1XSD A;  2A69 F;  1OJL A;  1ETK A;  3FWE A;  1J7K A;  3QRF F;  4E4H A;  1S9H A;  1IRG A;  3CP2 A;  3BR2 A;  3H92 A;  3CTA A;  3FZV A;  3L7W A;  3MKW B;  4Y52 J;  2X48 A;  1VZ0 A;  4GCV A;  1D0Y A;  1UB9 A;  1X1P A;  2AQE A;  3QP6 A;  1ETQ A;  2QA4 I;  4AC0 A;  1O4X A;  2Z5U A;  4AVZ A;  3QQA A;  2IS2 A;  5DCM A;  3WU1 B;  1KQ9 A;  3FXR A;  1MMN A;  3G1L A;  4DQ2 A;  4ZTF A;  2K9Q A;  3GWZ A;  2XSJ C;  2M4G A;  2RNG A;  2E19 A;  2MLG A;  5FKL A;  1K78 A;  3F6O A;  2LNB A;  4Q47 A;  3J7A O;  1STZ A;  3H5N A;  1Y8Q B;  1MMG A;  1H8A C;  3RIR A;  1TTY A;  1TT0 A;  1O3R A;  2R7X A;  1Y56 A;  4TV7 A;  5J1Y A;  2NS0 A;  3E97 A;  2CRG A;  3ECO A;  2ZBK A;  2HVQ A;  2E34 A;  3CCU I;  1WRJ A;  5IPA A;  2R7S A;  2VJ5 A;  1JUS A;  1MJB A;  2RGV A;  1YW8 A;  2HFH A;  2XAU A;  4P9U A;  4KMF A;  5HDK A;  4C2M J;  2GM4 A;  4PJ0 C;  1Z7L A;  3V8K A;  4E7L A;  3EUA A;  2K3P A;  1X3W B;  1YIO A;  1SD5 A;  4MHG A;  4FX4 A;  1ZG1 A;  4ENK A;  3D1N I;  5E3N A;  1N75 A;  3WG9 A;  4CCO A;  1XTA A;  1MBF A;  5IYB J;  3CCV I;  4BY7 J;  2CV0 A;  2HS5 A;  5J40 A;  3CMY A;  3LSG A;  2F4M B;  2DK8 A;  2ZO4 A;  1WI9 A;  3JRG A;  3G73 A;  4DIQ A;  1EKE A;  2Q2E B;  3TDU C;  3CUO A;  1YIT I;  3F9K A;  3K4N A;  1ZYR F;  1G3W A;  3ZMS A;  5LFA A;  2HPM A;  1MSE C;  4M6Y A;  5C4X J;  4KIC A;  4BEH A;  4WXH A;  3VYS B;  4U87 A;  1YRN B;  2KDZ A;  4MO7 A;  3I3L A;  2GA1 A;  2ECC A;  4U7B A;  2M45 A;  1U8B A;  4PSW A;  4Z2Y A;  1WCM J;  2BBY A;  4A0Y A;  1KQ0 A;  2PX9 A;  2LBF A;  1G3Y A;  2DMN A;  4LG3 A;  3PIP F;  1IRX A;  2FEZ A;  3LQQ A;  2CW0 F;  3BR6 A;  2DOD A;  2FSW A;  3IH4 A;  2FNA A;  3HSE A;  3SJM A;  3OIP A;  2XHK A;  4HW0 A;  2M87 A;  4OMZ A;  1ZEL A;  1IUY A;  1OCP A;  2Y0S A;  4PSX A;  4F55 A;  2VBX A;  2W7N A;  3DEW A;  2WBM A;  1D5V A;  4XLE A;  1XC5 A;  1BN5 A;  5EEH A;  3AL0 C;  4HOB A;  2DA6 A;  3EYI A;  3FXQ A;  3JTH A;  1JT0 A;  3IHU A;  3GF2 A;  4S04 A;  2A5W A;  2DT6 A;  3WTX C;  4UHT A;  3PM1 A;  5IP7 J;  5ILU A;  2OCE A;  2P7V B;  2VBZ A;  2ISY A;  2X51 A;  1EV7 A;  4H4K C;  2E1N A;  3U9G A;  2A68 F;  1OYY A;  1GXQ A;  1SEU A;  5GTI C;  3K1M A;  3TP3 A;  4A69 C;  2RQP A;  4GYI A;  2IVM A;  4M74 A;  5CKT A;  1RIO H;  3TO7 A;  4EJT A;  2CUE A;  1SFE A;  3OIO A;  4CYD A;  4A2U A;  2D1H A;  1HBX G;  1B59 A;  4I01 A;  3FXU A;  4BL0 B;  1TBX A;  5D6E A;  4RLQ A;  3ZXS A;  5TJJ A;  4A6D A;  1XGS A;  3C2B A;  3ERE D;  2DQR A;  4ABZ A;  4UUS B;  2QBY A;  2BXY A;  2K27 A;  2IA2 A;  1Z0X A;  3OYF A;  3QAH A;  2LRD A;  1U6G A;  2EZK A;  1E3O C;  5DM6 F;  5HS8 A;  1KU7 A;  3ULQ B;  5L3B A;  1I1S A;  2HQN A;  2KRH A;  2BVM A;  2OC6 A;  1UG2 A;  2XAS A;  5K7H A;  1U0J A;  3C3W A;  2Y2Z A;  3K1N A;  1CF7 B;  1ZRD A;  1U9O A;  2X4H A;  5K5R A;  2VXZ A;  1T95 A;  1FBU A;  1W5T A;  4LK0 F;  3IH3 A;  4UVA A;  5J4Y A;  5IYC J;  2P5L C;  2K7L A;  3W3C A;  2X6O A;  2V6C A;  4NBQ A;  4XNF A;  5JFR A;  4NNJ A;  4I98 B;  3V4G A;  1G2H A;  3QPT A;  4HX8 A;  3W2V A;  1T33 A;  2GXG A;  2Z99 A;  4XRM A;  2K40 A;  4UV8 A;  5DD8 A;  4G6T B;  1B6A A;  1G3T A;  4DBQ A;  1BBY A;  5K1Y A;  3M3Y J;  1J9I A;  3HPG A;  3JRE A;  1R4M B;  1Z67 A;  3LWF A;  2HYG D;  4C9Y A;  3QYE A;  3V8L A;  4E7Z A;  4BQQ A;  3CF5 F;  5LGU A;  2WY8 Q;  2BY3 A;  1I3Q J;  5FD6 A;  4AIJ A;  1UJ8 A;  2VT2 A;  1O3Q A;  4RM2 A;  2DMT A;  2LY1 A;  5JHF A;  3H5R A;  4RBO A;  3OYE A;  3IWZ A;  5J47 A;  1FJL A;  2HZD A;  2JA5 J;  3HOS A;  3WU2 C;  4FTH A;  1P9Q C;  2EIK H;  5E3L A;  3MVP A;  1WJF A;  4QLC U;  2DA3 A;  1JHF A;  2O8K A;  2LDU A;  1DU0 A;  3TQN A;  2GXA A;  5ILS A;  2YSR A;  4M9S A;  4EGZ A;  2DTR A;  3MAJ A;  1B72 B;  2VB6 A;  3H35 A;  2VKE A;  2A6H F;  3DQV C;  2R7W A;  3GLX A;  4L9N A;  2EV5 A;  2VON A;  2A05 A;  1OLT A;  4DYC A;  5E17 F;  2XF5 A;  1RR7 A;  1S7E A;  3F8F A;  3F23 A;  4XRF A;  2LH9 A;  1HOM A;  3MWM A;  1QZE A;  3TL4 X;  5LRS A;  1DQU A;  3BT9 A;  5LHI A;  3J7Z I;  2OZ6 A;  3VDX A;  2EA2 A;  3WE3 A;  3OYD A;  1LFP A;  4CYC A;  3M8E A;  4NQW A;  3WGG A;  2PQ8 A;  3DBL B;  5FLV A;  2FX0 A;  3FXL A;  1MH4 A;  3WGH A;  5D5W B;  4BHP A;  2VC1 A;  3M07 A;  2OCC H;  1SFX A;  5BQT A;  4OIP F;  4E7H A;  1I3A A;  2ID6 A;  1WJ5 A;  2P8T A;  3FXO A;  3LST A;  4Y7N J;  5B66 C;  2MG4 A;  2VKD A;  2MC3 A;  1RNL A;  4FHT A;  3M1E A;  2G0E A;  2NS7 A;  1OIS A;  1UG0 A;  4BXF A;  2E2I J;  2CQK A;  4PZJ A;  3HBL A;  2DFE A;  4YIF A;  1MMS A;  2PJR B;  3SZP A;  3DLL F;  2EFN A;  2PI0 A;  2IRF G;  3LSH A;  1Z1D A;  1OCO H;  2Z9O A;  1TNS A;  1NHA A;  1QHH D;  2DAO A;  2TCT A;  3KPH A;  3KET A;  5EDN A;  1DPU A;  1LDD A;  3ZQH A;  1QNT A;  4BKX A;  5B5E C;  3ISP A;  5ICG A;  2Z16 A;  3T0Y A;  5IY5 H;  3A01 A;  1O57 A;  3E7L A;  3KCC A;  2CFO A;  1OKR A;  2QQ8 A;  3H0D A;  4ZJZ A;  1UFM A;  2M9H A;  4CGZ A;  1F43 A;  2Z3Y A;  1MDM A;  3D5L A;  3EPZ A;  5DCM B;  3WHB A;  3A4C A;  1KU2 A;  5J4V A;  1J0R A;  4AVP A;  4XID A;  3BR0 A;  2VL8 A;  2Z1D A;  2DA1 A;  2W84 A;  4P1W A;  1D1A A;  3BG3 A;  2QKL B;  4HX7 A;  1P4X A;  4XK4 A;  4BJ5 C;  1IC8 A;  1WJE A;  5J6X A;  5AON A;  1E17 A;  1K78 B;  1WSU A;  1EH6 A;  4NC8 A;  1IXC A;  3NWT A;  3HRU A;  4CSW A;  4OAY A;  3GME A;  3JRB A;  3P9C A;  4HZF A;  2E1O A;  4WXC A;  2H1K A;  3BOQ A;  2WB1 N;  3DWL E;  2X85 A;  4L5J A;  1BOB A;  1BC8 C;  1R4N B;  3LQR A;  2AXT C;  4LD5 A;  1FYL A;  1HW1 A;  2KLO A;  4CCJ A;  2EIL H;  3F6V A;  3GXO A;  1LVA A;  1B9M A;  3RPU A;  4ENJ A;  4KIT B;  2XRL A;  2JK3 A;  3J81 Z;  3DTK A;  1FEX A;  4IHT A;  1FOK A;  3GZN B;  4XIC A;  1FWZ A;  5C4J J;  2VC0 A;  3DLA A;  5GAH J;  1WHU A;  2K9N A;  2DI3 A;  5EYR A;  3ZMU A;  3G1O A;  3PO2 J;  2QM3 A;  4HX4 A;  5ED4 A;  2MGQ A;  3O3K A;  3CDI A;  5F0F A;  1ZN2 A;  4MEY F;  2JRT A;  2QQA A;  1GHC A;  4OOI A;  5EF6 A;  3GFJ A;  3TW6 A;  4HDV A;  3NAR A;  1R5H A;  3LSR A;  2RC4 A;  3OYB A;  1W36 C;  1KU3 A;  2E60 A;  2ESN A;  1T8I A;  1YI2 I;  4B47 A;  4B3X A;  3AG4 H;  2R5Y A;  1FTT A;  1QHG A;  2WAQ N;  2EFP A;  4G8X A;  4K2E A;  4BEH B;  1D8J A;  1QQI A;  2OUM A;  4DJA A;  2W00 A;  2A07 F;  2EA4 A;  4NDL A;  4IQ4 A;  3FK6 A;  3L00 A;  4JQF A;  1O3T A;  4BDZ A;  2LBF B;  1A5J A;  1W5S A;  2A6E F;  4DOZ A;  1GXP A;  4AIK A;  2ID3 A;  3KP7 A;  1NK3 P;  1ZHF A;  2R5Z B;  4HAM A;  5F08 A;  1TQP A;  4Q48 A;  2IGM A;  4O3M A;  5K7F A;  2PG4 A;  2IPQ X;  2GWR A;  2HGC A;  4ZDL A;  2HXO A;  3W6K B;  4E70 A;  2XGC A;  2DA4 A;  3QU3 A;  3PIO F;  1ULY A;  4D0P A;  4CCK A;  3CF2 A;  5CVU A;  2CUF A;  5TIS C;  1DP7 P;  1VQ8 I;  2NVX J;  3VWB A;  2ISZ A;  4MTE A;  2DFI A;  5IOZ A;  2JQ7 A;  1LE8 A;  2QSG X;  1OCR H;  3P7N A;  1Z6T A;  2QGU A;  4D5F A;  5BPI A;  3LFU A;  3M9A A;  3RCO A;  3HOY J;  3CLQ A;  4NC7 A;  4RAZ A;  4ON0 A;  3GW2 A;  3BR1 A;  2RNJ A;  4V19 K;  3BTJ A;  2ACJ A;  3L2W A;  4M3G A;  2IAI A;  4MLO A;  5DTD A;  3TW7 A;  3ZMT A;  5L3C A;  2ZME C;  1KU9 A;  2L9S A;  2LY2 A;  3CDL A;  3JW4 A;  5E8I A;  4PJN A;  1AA7 A;  2DMQ A;  2Q1Z B;  3F8C A;  2MSY A;  4CIC A;  3CJN A;  4ZYA A;  4P96 A;  4IRI A;  3O2P E;  2NRA C;  1KQ8 A;  3H0G J;  3B6C A;  4PGG A;  4MIM A;  2EZL A;  3R4K A;  4OIQ F;  1YW9 A;  3S1N J;  2CG4 A;  3IWF A;  3MZY A;  3ZQ7 A;  5HLT A;  2OA4 A;  3S2H J;  2EV0 A;  2ZFW A;  2VKH A;  3V42 A;  4G7Z F;  3BWG A;  3GFI A;  2COM A;  2QBY B;  3COA C;  1IN6 A;  1R36 A;  4KUM A;  2E36 A;  1E0E A;  1A31 A;  6PAX A;  3RKX A;  1RC9 A;  1G8X A;  4C30 A;  3CCS I;  2X6Y A;  2EPF A;  4KNY A;  1VQ6 I;  5DUK A;  1F4K A;  2R7V A;  3E5X A;  3WTU C;  1K79 A;  2V9V A;  3KFW X;  3HUG A;  3C1D A;  4GO1 A;  1X19 A;  1GV5 A;  3WHC A;  5GAE J;  1X1C A;  2Y48 A;  2VOP A;  2CQQ A;  1VI0 A;  2EFO A;  2UUZ A;  2LFB A;  1APL C;  3TMO A;  4A12 A;  2IGO A;  3WGI A;  1ZH5 A;  2XPW A;  1SMT A;  3W2A A;  3HC7 A;  2ZXJ A;  5K5Q A;  4QPO A;  4IF4 A;  1XMK A;  2M30 A;  2WA0 A;  3I59 A;  3Q0V A;  4XLN F;  1D3Y A;  4JX5 A;  2B9S A;  2XF7 A;  4QPQ A;  3H1C A;  2IW5 A;  1L0O C;  3CDH A;  2LY9 A;  1JJ6 C;  2P7C B;  1P92 A;  4DGW B;  5D5X B;  1PDN C;  2YU9 J;  1OR7 C;  1I6H J;  4I02 A;  2QWW A;  1SVM A;  1H89 C;  1VQL I;  2IA1 A;  5CQG A;  2X6X A;  1S29 A;  2GOX B;  2MA3 A;  2XAG A;  1B72 A;  3J80 K;  4EJW A;  3BPX A;  4BUP A;  3BTC A;  3RDI A;  4LOC A;  4RLF A;  4E7S A;  5CVJ A;  3BJ6 A;  2QQ9 A;  1G4D A;  1GUU A;  1MIJ A;  1VQ7 I;  2FMY A;  3RKQ A;  2GLO A;  2EZI A;  4IZZ A;  2WWY A;  2CJJ A;  4BAC A;  2E5N A;  3ZCO A;  2XV4 S;  1YJN I;  4M6X A;  3IKT A;  2NS8 A;  1A6Q A;  4L5I A;  1Z3X A;  5F27 A;  2CQN A;  4CYC B;  3I9V 2;  4NQW B;  1JGG A;  2R92 J;  1Q1H A;  3LSK A;  3D0S A;  1ACI A;  2B0L A;  2JPB A;  1BR4 A;  1XGO A;  4FE7 A;  2EB7 A;  3KP4 A;  3ZQG A;  4H0E A;  4HG2 A;  4OAZ A;  3GZ5 A;  1P7I A;  2Y0S N;  4QSH A;  1IXS B;  2DPD A;  4E7I A;  4IJA A;  2EWN A;  2DXI A;  3JRH A;  3BG9 A;  1W0T A;  4KFC A;  2VQL A;  1SD7 A;  2WC2 A;  3A0H C;  4PFP A;  2LVS A;  5F0C A;  3S2W A;  1EA3 A;  5LHH A;  3OYA A;  3CC2 I;  4BBS J;  3HYI A;  3O8H A;  2DU9 A;  1T39 A;  2X9D A;  2PJR A;  3DXJ F;  3KYL A;  2IEK A;  4EQQ A;  3J81 K;  5M3F J;  1RUO A;  3OYL A;  3F8N A;  5EZH A;  1PYV A;  4A93 J;  1D0X A;  2CW8 A;  2W57 A;  2DW4 A;  4M9Z A;  4IKF A;  3C2G A;  1RZ4 A;  3T1B A;  1F36 A;  2KQR A;  4HQE A;  5FLX Z;  2V9K A;  5BS6 A;  2MH2 A;  1LEA A;  1DDN A;  1XMX A;  2AXL A;  3A01 B;  1Z77 A;  3E1S A;  4HNU A;  3NRV A;  3F0C A;  1ZAR A;  1LB2 A;  3L1P A;  3DEU A;  3CQZ J;  4CO8 A;  2HKO A;  4F91 B;  1MDM B;  3S1M J;  3RZD J;  1LPQ A;  5IT9 Z;  4EVI A;  2M1B A;  2JWT A;  3FMQ A;  1UST A;  1BC7 C;  5KNL A;  1YE9 A;  5IYD J;  2YU3 A;  2DOA A;  4XN3 A;  4B8X A;  4J19 A;  4KN4 X;  4HBL A;  5J8C A;  4HF2 A;  4AD9 A;  1OYI A;  3ESW B;  2OBP A;  2XRN A;  3OS2 A;  2XGE A;  4PGH A;  2ADU A;  2FQ4 A;  4RAY A;  1JT6 A;  3CZ6 A;  2MLK A;  4JOM A;  1A6I A;  1SAN A;  2CQ7 A;  2DCE A;  4N9I A;  2VBY A;  3OOP A;  1KYZ A;  5LRR A;  1YIJ I;  1L3L A;  3DEE A;  2RDP A;  5HOO A;  3BG7 A;  1LFB A;  2XVC A;  4BY1 J;  4C2T A;  3NAU A;  4A3G J;  2K3F A;  2XSD C;  1YFH A;  2L01 A;  4ZDP A;  3K4L A;  4RMN A;  2QYO A;  5DCF A;  1S8N A;  2BEO A;  3D5R C;  5DD4 A;  2E1C A;  4XLF A;  3B6A A;  4BHB A;  3WU0 A;  2M0M A;  1IN5 A;  1A04 A;  2E7X A;  3CES A;  3PO3 J;  1SD6 A;  2R7O A;  5HNF A;  3VOD A;  4GGG A;  3AG3 H;  4D1Q A;  2WY7 Q;  2KIQ A;  3PQJ A;  4PCQ A;  3FIS A;  1U5T C;  5F1J A;  3HL2 A;  4JX4 A;  2R7R A;  3SEQ A;  2R5Y B;  1K7A A;  4RGU A;  2LRE A;  4MTD A;  3L09 A;  5E1X A;  2HZT A;  4X6A J;  2CU7 A;  4YII A;  1MBJ A;  3LSJ A;  1YTY A;  2PMH A;  2KDO A;  2ZXH A;  1J59 A;  1FTZ A;  4P9F A;  1M1E B;  4BQO A;  1VQ4 I;  5H6R A;  3FMS A;  1OCZ H;  4ZZL A;  2VQH A;  2CUJ A;  1DGR M;  1TWH J;  3S1Q J;  2N8G A;  1Z3Y A;  2Q0O A;  1LKX A;  2VBW A;  1UHS A;  2E7W A;  2K9S A;  2LYC A;  5FGM A;  5LBQ A;  2COB A;  2R5Z A;  3RSN A;  3IKV A;  1LDK B;  1TQM A;  2F5D A;  3RPU D;  2E5Z A;  4IRH A;  3AKZ A;  2DOF A;  4W97 A;  3LFK A;  2VE9 A;  2MAB A;  2DPU A;  3IP4 B;  2O03 A;  1EF4 A;  1Z6R A;  3HGG A;  2HXI A;  2RRE A;  2CYY A;  2H27 A;  5HOD A;  3PFI A;  1FOW A;  2CWE A;  2ZCW A;  3KP3 A;  2QCO A;  4NC6 A;  1LE8 B;  4GXO A;  4CUG A;  2KZV A;  2QZ8 A;  2Y0M A;  1GVJ A;  2ZJP F;  1GVD A;  1QBJ A;  3M8J A;  5L3F A;  4RAF A;  2OPT A;  2FA5 A;  4OWR B;  5D8L B;  1R71 A;  2P0W A;  3GTM J;  1FYM A;  1VQK I;  1N78 A;  2M5W A;  1HA8 A;  1KYW A;  3NQO A;  2DFF A;  5HDG A;  4JYK A;  1ZGA A;  2JZY A;  3K4K A;  4YRV A;  1QVT A;  5E1Z B;  2W1O A;  4IXA A;  2DMP A;  2MBF A;  3ZGK A;  4BJT A;  2ZJQ F;  2LF8 A;  1HW2 A;  1ON1 A;  3L2U A;  5LGT A;  1ETY A;  4BE0 A;  2VOD A;  3CP8 A;  4Y15 A;  3KP6 A;  1BA5 A;  5E1W A;  1P2F A;  2M4K A;  3RKY A;  3OMY A;  3GTP J;  3VEP A;  3GLL A;  3GX4 X;  4XSZ F;  4FCY A;  2RQQ A;  2YUS A;  1MMD A;  4M72 A;  4IHS A;  5CJ9 A;  3M7G A;  2P4W A;  1YQA A;  4E7J A;  5IP6 A;  2LK2 A;  1A35 A;  2ESH A;  2QEX I;  3RPQ A;  3VSL A;  4FIS A;  1VND A;  1ZG5 A;  2KPM A;  3OY9 A;  2M8E A;  4L0Y B;  3BTL A;  3FBN B;  5JR3 A;  3SEZ A;  1FSE A;  2Z33 A;  2GIZ A;  2OF7 A;  2LLK A;  1KZH A;  4KIB A;  1ZRF A;  2KIF A;  1LUJ B;  4UV9 A;  2C6Y A;  1JTY A;  5F1R A;  4CA0 A;  2KRC A;  1R6R A;  3FMR A;  4YFK F;  3GTQ J;  5J8F A;  5L3G A;  2NYX A;  2QEN A;  3HUG B;  5CVV A;  4I0A A;  5D5V B;  3L2C A;  1OMI A;  2G7U A;  1HC8 A;  3MFK A;  2RVC A;  2HVR A;  3PUF A;  4A3D J;  3OYC A;  4KIS A;  3QOD A;  2CS3 A;  1WWX A;  4ITV A;  4DYQ A;  4DNC A;  3VYT B;  1U8R A;  3K70 D;  3MD2 A;  3MN2 A;  4HST A;  3K1P A;  3GTJ J;  2OV7 A;  1FBQ A;  2VPL A;  1S5L C;  5H20 A;  3I59 B;  2JRM A;  5HS7 A;  3K4C A;  2PFB A;  1X1A A;  4BGD A;  2H6B A;  2DN0 A;  1NG6 A;  4LLL A;  2STW A;  4ZYD A;  5EG0 A;  4I99 C;  3UNG C;  3ZP5 A;  5KVR A;  4DBR A;  4ZZD A;  4LIT A;  3KLO A;  2BVL A;  2F5F A;  2ZB9 A;  5HS9 A;  1MNE A;  1AHD P;  5H2F C;  4L0Z B;  3WG7 H;  4CCN A;  2JPC A;  2L9N A;  3BTI A;  4C3I J;  5BMZ A;  4M73 A;  1WJC A;  1X1B A;  2BW3 A;  2K02 A;  3LSM A;  3FK7 A;  3Q9V A;  5CYV A;  4I2O A;  1QU3 A;  2VLA A;  2BZT A;  2HQ5 A;  4AID A;  5D8K B;  4WK8 F;  2O7O A;  5FLX K;  5DEQ A;  3HOU J;  1EH8 A;  3PNT A;  3CCQ I;  3N05 A;  2W85 A;  4XBF A;  4FET A;  1ZK8 A;  1E2X A;  3RQI A;  4HV5 A;  3BRO A;  5JVG F;  3I54 A;  2R3S A;  3TDZ C;  1WQ2 A;  4BE1 A;  2F5C A;  3A0B C;  4D7M A;  2GZW A;  1WFX A;  2D2W A;  2V9P A;  5IT9 K;  5DS9 A;  2L7Z A;  1FIP A;  2AO9 A;  4GFB A;  2JTV A;  3ABM H;  5FLM J;  4PJJ A;  1TC3 C;  1P6R A;  3AG2 H;  2KIS A;  3FF5 A;  4HV6 A;  4ZYE A;  3KZI C;  1HCR A;  2XGD A;  1N77 A;  2L9V A;  2ZXI A;  1ZLK A;  2FQ3 A;  3RKW A;  2OQG A;  2R93 J;  1V54 H;  3DTI A;  3ERM A;  4M3F A;  2R7F A;  4N9H A;  1I39 A;  3K2A A;  1X4O A;  2CO5 A;  2XDV A;  1IG7 A;  4DW6 A;  3ZQI A;  3QP5 A;  3CJR B;  2PMZ A;  4V2F A;  1U2W A;  4U0Y A;  1WKM A;  4DZJ A;  1BI2 A;  3SHF A;  5ICF A;  2LKP A;  3HOX J;  1MJA A;  1XPX A;  2KP6 A;  1IUF A;  2R4G A;  2HOS A;  2BXZ A;  3ML6 A;  2UV1 A;  4XLP F;  4C3J J;  2ZSI B;  5M5W J;  3CUQ C;  3K0L A;  1LJ9 A;  4RB3 C;  4EJU A;  2I10 A;  3PNV A;  1B8I A;  3GTK J;  3I64 A;  2FRH A;  3J80 Z;  3ZN0 A;  1ZLJ A;  2MD0 A;  4WXD A;  5E3M A;  1QO0 D;  5GP9 A;  1FOX A;  4O5V A;  4BJ6 C;  3BZ6 A;  3CO7 C;  2K9M A;  3REO A;  2CV2 A;  1ERD A;  1VQO I;  4BBR J;  1XSV A;  1Z21 A;  2EIN H;  1J75 A;  2GOM A;  5A2Q K;  2LP0 A;  5L3E A;  5GAG J;  2KJC A;  4IEJ A;  4XRS G;  2HDW A;  4XSX F;  3OS1 A;  3N4M A;  5HDN A;  1H0M A;  3LOC A;  4BYY A;  1D0Z A;  1T98 A;  2JJ7 A;  3HIF A;  2TDX A;  3AL0 B;  2JA6 J;  2HU9 A;  2ECB A;  4KMU X;  1FYK A;  2WV1 A;  3PSI A;  2J5O A;  5F6F A;  2JA8 J;  1NH3 A;  2H09 A;  3R0J A;  4Q4Z F;  3ABU A;  1W7P A;  2KZG A;  2RV8 A;  5L3D A;  1XGM A;  2NVU B;  2DFH A;  4EM2 A;  5E3O A;  5F64 A;  3AAF A;  1BIB A;  4U0V A;  1TQI A;  2PLY A;  3R0A A;  2CQX A;  5BPD A;  2HDD A;  1HKT A;  1BI1 A;  2X6W A;  4D5C A;  4ETS A;  3DTE A;  4ESF A;  1IW7 F;  1HQC A;  2FBI A;  1QRY A;  1T0F C;  2ZME A;  2WAD A;  2I5U A;  4UB6 C;  1TL8 A;  1AWC A;  1ZGJ A;  2Y69 H;  2LC2 A;  1ONV A;  1XDU A;  1MNM C;  1ODD A;  5F04 A;  3QYB A; 
#chains in the Genus database with same CATH homology
 3Q0V A;  2GM4 A;  4C2M J;  2TRT A;  1U78 A;  4JX5 A;  2O9L A;  2LY9 A;  4V2G A;  1JJ6 C;  5EZG A;  4DZP A;  3S2D J;  2YU9 J;  2H8R A;  3D1N I;  5E3N A;  1I6H J;  5JLX A;  3H3V K;  1MBF A;  5IYB J;  1H89 C;  4BY7 J;  3OOU A;  3CMY A;  3LSG A;  3GTO J;  2AHQ A;  3W6V A;  2HOT A;  5FKM A;  1B72 A;  3QPL A;  3JRG A;  1K61 A;  3OSG A;  1IDZ A;  3BTC A;  3BQY A;  4LOC A;  5C4X J;  1MSE C;  3DCF A;  1AKH B;  5IP9 J;  1GT0 C;  1GUU A;  4FE4 A;  4A3C J;  3RKQ A;  2GLO A;  2EZI A;  5J1R A;  2CJJ A;  1YRN B;  2KDZ A;  4MO7 A;  2ECC A;  1U8B A;  1MSF C;  1WCM J;  2NS8 A;  3OSF A;  2L7M P;  5F27 A;  4CYC B;  1TWG J;  2DMN A;  5F0H A;  1JGG A;  2R92 J;  1BW6 A;  3BR6 A;  3FKI J;  4IHY A;  3CCY A;  4M3B A;  3IH4 A;  1GDT A;  4FE7 A;  3ZQG A;  3SJM A;  3HM5 A;  3S17 J;  1OCP A;  1OCT C;  1P7I A;  2Y0S N;  2ME0 A;  4QSH A;  3S15 J;  1OFC X;  2Y9Z A;  3DEW A;  2DTZ A;  4QTR A;  3BG9 A;  3JRH A;  1WH5 A;  1W0T A;  5F0C A;  1XC5 A;  2LVS A;  4I6Z A;  5EGO A;  3GTL J;  2DA6 A;  2W48 A;  3GBG A;  4BBS J;  1ORK A;  5K7Z A;  1JT0 A;  1PUF B;  1ETO A;  3O8H A;  2X9D A;  3PM1 A;  1BJZ A;  2IEK A;  5IP7 J;  5M3F J;  5C44 J;  5EZH A;  4A93 J;  3TED A;  1IV6 A;  1P7J A;  3JRD A;  1F36 A;  2E2J J;  4M6V A;  1TWF J;  1NTC A;  3TP3 A;  3HGY A;  4A69 C;  5BNG A;  4X1E A;  2M8G X;  3HOZ J;  1IRZ A;  3A01 B;  1Z77 A;  2CUE A;  2XPU A;  2LKX A;  3ZOB A;  3OIO A;  3F0C A;  2GBY A;  3L1P A;  2D5V A;  3CQZ J;  3S1M J;  3RZD J;  1SFO J;  1WH7 A;  2JWT A;  5M5X J;  5IYD J;  2R7Z J;  2JN6 A;  4J19 A;  3C2B A;  4ABZ A;  2IBD A;  4UUS B;  5C3E J;  1Z0X A;  4A3L J;  2VI6 A;  1JKP C;  2EZK A;  1E3O C;  1ZGW A;  2XGE A;  1NK2 P;  2FQ4 A;  4DYR A;  1JT6 A;  1UG2 A;  5K7H A;  2Y2Z A;  1U9O A;  1JTX A;  1A6I A;  2M34 A;  3ZQF A;  1IGN A;  2DA5 A;  1SAN A;  2YS9 A;  3IH3 A;  5IYC J;  2X6O A;  3IH2 A;  1LFB A;  1G2H A;  4BY1 J;  5M3M J;  3LNQ A;  1T33 A;  3NAU A;  5EG0 B;  4A3G J;  1WGX A;  2XSD C;  4XRM A;  2K40 A;  5FKO A;  1DU6 A;  3M3Y J;  3JRE A;  3ZQC A;  4A3E J;  4HNV A;  5GPA A;  3B6A A;  1X2M A;  1ZQ3 P;  1MBE A;  4AYB N;  1I3Q J;  2R0Q C;  2LR8 A;  3PO3 J;  2DMT A;  4RBO A;  1IDY A;  2VPR A;  5FJ8 J;  1JKR C;  1FJL A;  2JA5 J;  2Y9Y A;  2L0K A;  2XPV A;  2HI3 A;  4FTH A;  3FIS A;  5E3L A;  5F1J A;  3MVP A;  4JX4 A;  2R5Y B;  2DA3 A;  1X2N A;  2O8K A;  1DU0 A;  1ETX A;  1K83 J;  4X6A J;  2CU7 A;  1MBJ A;  5M5Y J;  1B72 B;  2RAE A;  2VKE A;  3LSJ A;  9ANT A;  3JR9 A;  2Y31 A;  4A3F J;  1FTZ A;  1X58 A;  4A3K J;  3BQZ A;  2E2H J;  2EH3 A;  4DYC A;  1TWH J;  1RR7 A;  1S7E A;  2N8G A;  1AKH A;  3S1Q J;  1HOM A;  1ZKG A;  1TWC J;  1UHS A;  2QF7 A;  1ETW A;  4A3I J;  2K9S A;  3K7A J;  2COB A;  4JX6 A;  2R5Z A;  2LD5 A;  1YRN A;  3BT9 A;  1FIA A;  1VF9 A;  1ZTR A;  4W97 A;  4A3J J;  4CYC A;  5FLV A;  3I4M J;  1EF4 A;  2FX0 A;  1BL0 A;  3HGG A;  2HXI A;  1MH4 A;  5HOD A;  1W0U A;  1ZR2 A;  2L9R A;  1R9T J;  3HEF A;  2ID6 A;  2QCO A;  4Y7N J;  1LE8 B;  3FIW A;  2MG4 A;  4IHV A;  1RET A;  2G0E A;  2NS7 A;  2NVQ J;  3UKG A;  1GVD A;  2E2I J;  3SDG A;  3HBL A;  2KT0 A;  1RKT A;  2OPT A;  3GTM J;  4A3B J;  4IHW A;  1JKO C;  1B8I B;  1PUF A;  4JYK A;  1QVT A;  4D7N A;  2DMP A;  1JUP A;  1ETY A;  2TCT A;  4BXX J;  1BA5 A;  5EDN A;  3BG5 A;  3ZQH A;  3S14 J;  1ITY A;  3Q3S A;  4BKX A;  3GTP J;  2L7F P;  4FCY A;  2YUS A;  3QPS A;  1T56 A;  1I50 J;  1QVU A;  3A01 A;  3E7L A;  2DA2 A;  2LK2 A;  5IP6 A;  1GV2 A;  3O8G A;  4FIS A;  1VND A;  1F43 A;  2M9H A;  4IHX A;  3BTL A;  5IOY A;  4I76 A;  2EBI A;  2NVY J;  3WHB A;  1RES A;  4XID A;  3JRA A;  3BR0 A;  1U9N A;  2OF7 A;  2LLK A;  2DA1 A;  4XK4 A;  1IC8 A;  3BG3 A;  1WI3 A;  2DJN A;  3Q0W A;  1JTY A;  3HB9 A;  4UUS A;  4QIW N;  3GTQ J;  3HOV J;  1ENH A;  4C3H J;  4W1U A;  3JRB A;  4A3D J;  1BW5 A;  2E1O A;  2H1K A;  2WB1 N;  4EEF G;  4DYQ A;  3S1R J;  3MN2 A;  2HOA A;  1XG1 A;  1D5Y A;  3GTJ J;  3GTG J;  2XRL A;  2JK3 A;  2NVT J;  4B4C A;  1FEX A;  2JMW A;  2DN0 A;  5EEA A;  1ZR4 A;  3HKZ N;  4XIC A;  5C4J J;  5EG0 A;  3I4N J;  1Q1V A;  2K9N A;  2XB0 X;  5EYR A;  3VPR A;  1HDP A;  3G1O A;  5J1U A;  3PO2 J;  1AU7 A;  3BR5 A;  2MGQ A;  2MW8 A;  2ZB9 A;  4AUX A;  2LTP A;  1H88 C;  1Y1W J;  2JA7 J;  5F0F A;  1AHD P;  3BTI A;  4C3I J;  5EF6 A;  3HDD A;  3TW6 A;  3FK7 A;  3NAR A;  1RKW A;  3ZQL A;  5JLW A;  3LSR A;  1RPW A;  2HQ5 A;  2O7O A;  2DMU A;  2DA7 A;  5GPC A;  1LFU P;  3HOU J;  1HLV A;  3JRF A;  1MBH A;  3LSP A;  2R5Y A;  1FTT A;  2WAQ N;  1ZK8 A;  3RQI A;  1TWA J;  4M3E A;  3RZO J;  3MKL A;  4NDL A;  4D7M A;  3SFI A;  3FK6 A;  1IJW C;  2P81 A;  1A5J A;  4G12 A;  2ID3 A;  1MH3 A;  2L7Z A;  1WPK A;  1FIP A;  2AO9 A;  5DS9 A;  2R5Z B;  1NK3 P;  2M2E A;  4GFB A;  5F08 A;  5FLM J;  3TP0 A;  1TC3 C;  3JRI A;  5K7F A;  4UUT A;  2FD5 A;  1HCR A;  2XGD A;  2HYJ A;  2HXO A;  2R93 J;  2XGC A;  3A02 A;  1JJ8 C;  2DA4 A;  2Y30 A;  4M3F A;  5EGO B;  1HDD C;  3K2A A;  2CUF A;  4B1R A;  2EQR A;  3ZQI A;  4DW6 A;  1IG7 A;  2NVX J;  4V2F A;  2PMZ N;  3JRC A;  4DZJ A;  4JP0 A;  5IOZ A;  4MFD A;  1LE8 A;  1HF0 A;  3HOX J;  1IUF A;  4D5F A;  2HOS A;  3HOY J;  1VFC A;  5FKN A;  1CQT A;  4C3J J;  2ME6 A;  3BR3 A;  3BR1 A;  5M5W J;  3BTJ A;  4RDU A;  2VKV A;  2I10 A;  4B3A A;  1B8I A;  3GTK J;  2EZH A;  4M3G A;  2IAI A;  4MLO A;  5DTD A;  3TW7 A;  4A3M J;  4S0H B;  4L5E A;  3A03 A;  3CDL A;  2DMQ A;  5E3M A;  3Q0U A;  2MSY A;  5GP9 A;  2FJ1 A;  1POG A;  2ELK A;  3H0G J;  3G1M A;  3B6C A;  4BBR J;  4MIM A;  4XRS A;  2EZL A;  1JKQ C;  1UMQ A;  2LP0 A;  3S1N J;  3S16 J;  4MFE A;  1OJL A;  1ETK A;  4IEJ A;  3S2H J;  4XRS G;  3LOC A;  3BR2 A;  2JJ7 A;  4Y52 J;  2X48 A;  2JA6 J;  3M4O J;  2ECB A;  2M0C A;  2WV1 A;  3IV5 A;  1ETQ A;  1O4X A;  4AC0 A;  2JA8 J;  3QQA A;  3G1L A;  5E3O A;  1ETV A;  5J3L A;  2K9Q A;  2NOG A;  2E19 A;  4M3D A;  5FKL A;  2CQX A;  1QPI A;  1Y1V J;  2HDD A;  1XS9 A;  2B63 J;  1H8A C;  1MBK A;  4D5C A;  1GV5 A;  2XB5 A;  3WHC A;  5J1Y A;  1QRY A;  2CRG A;  2CQQ A;  1VI0 A;  2LFB A;  5IPA A;  1APL C;  3HOW J;  1MBG A;  1JUS A;  2XPW A;  2VUM J;  1MNM C;  1JUM A;  5FKK A;  5F04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...