3S1QJ

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s1qJ00
5E3OA 2NVYJ 1Y1VJ 1RR7A 2LY9A 3O8GA 1GT0C 2E2HJ 5FKOA 1E3OC 1IRZA 3OIOA 1TWCJ 2ME6A 2KT0A 1PUFA 1OCPA 4A3DJ 1ENHA 1OFCX 1RETA 1Z0XA 1ORKA 5C4JJ 1PUFB 1T56A 2GBYA 1H88C 1I50J 3Q3SA 3BTJA 1ETVA 3GTQJ 1AKHB 2NVXJ 2JWTA 3BR6A 2Y30A 5IYDJ 1ETKA 1K61A 2ME0A 2HXOA 4A3LJ 1B8IA 3TP3A 2XRLA 2L7FP 1U9OA 5C44J 1HDDC 2JA6J 5JLXA 2E2JJ 1U8BA 2PMZN 2ZB9A 4X1EA 1IV6A 2XSDC 4A69C 1EF4A 2E1OA 1ETYA 2YS9A 2K9SA 1LE8A 4B4CA 4XRSG 5HODA 3JRIA 2JN6A 4I76A 2AHQA 4FE7A 1WH5A 4DYQA 4FTHA 3DEWA 3SDGA 1JT0A 4D5CA 2X9DA 4XRSA 5DTDA 1YRNA 3K2AA 4M6VA 5C4XJ 3NARA 4M3EA 3S2DJ 4A3IJ 3DCFA 1T33A 3MN2A 3WHCA 4A3JJ 3TW6A 5FKKA 5IYCJ 1ETWA 3HGGA 5M5WJ 1IGNA 1GUUA 4MFEA 1TWHJ 5EYRA 5K7FA 2EBIA 2EZHA 4W97A 2WV1A 3S15J 1SANA 3BQZA 5F08A 4C2MJ 1IJWC 2EZIA 2DA6A 2CUFA 2K9QA 1GV5A 3G1LA 1ITYA 3GTLJ 3BG3A 3UKGA 3B6CA 2R5ZB 3BR3A 4UUSA 2H8RA 2R0QC 1MNMC 3IH2A 5F0CA 1AHDP 4JP0A 4JYKA 3A01B 1IG7A 2O8KA 1B72B 1JUSA 3S1QJ 2M0CA 1QRYA 3O8HA 3M3YJ 3CQZJ 4BXXJ 1UHSA 1P7JA 1H8AC 3CCYA 3FK6A 5J1RA 3JRDA 5M3FJ 4M3BA 4A3EJ 1RESA 3BT9A 3ZQIA 3A02A 3MKLA 1ETXA 2EH3A 2DA7A 3S1NJ 3E7LA 1ZK8A 2FX0A 2XGCA 2H1KA 3BTIA 3BR2A 5FLMJ 4IEJA 4NDLA 3A01A 1H89C 2WAQN 2LTPA 3HOZJ 1HLVA 2HYJA 2DA1A 3HKZN 3TW7A 2Y0SN 2DMTA 2XB5A 2X6OA 4M3DA 1GDTA 1JTXA 3RZDJ 3HDDA 2JMWA 2XB0X 4JX6A 5FKLA 1I3QJ 3RQIA 4S0HB 3IV5A 5EEAA 2M34A 5IYBJ 3IH3A 3GTOJ 5EZHA 5K7HA 2Y9ZA 3BG9A 1JT6A 3Q0WA 2LKXA 3QPLA 4AUXA 3HBLA 2DMPA 1MBHA 3BTLA 5EF6A 2FD5A 2LD5A 3K7AJ 2NS8A 5EGOB 2AO9A 2EZKA 2LLKA 2HXIA 3HOYJ 4UUSB 3HM5A 5GPCA 4MFDA 2L7MP 1MBJA 2R92J 1UMQA 3H0GJ 2P81A 1A5JA 2D5VA 1BA5A 1Z77A 1MH3A 1WPKA 2JJ7A 1TC3C 4W1UA 5EZGA 2DMNA 1NTCA 3JRAA 3ZQFA 3L1PA 4C3HJ 1ZR4A 1SFOJ 2ECBA 1IDYA 2DJNA 2JA8J 3ZQHA 1MBKA 1MBGA 1OJLA 5IP6A 1MSEC 2VUMJ 1Q1VA 4BY7J 4J19A 1JJ6C 5E3MA 4IHVA 1JGGA 3SJMA 3Q0VA 1FTZA 2YU9J 5K7ZA 4DW6A 2XGEA 1MSFC 3LSPA 3ZQLA 4DZPA 4IHYA 3HOVJ 4A3GJ 1LE8B 2HOSA 5IP9J 2R93J 2XPWA 1DU6A 3LOCA 3GTPJ 4AC0A 4BKXA 4XIDA 2HQ5A 1VNDA 1JUPA 2DA5A 4BBSJ 1R9TJ 2OPTA 2B63J 1W0UA 1BJZA 2ID6A 4AYBN 1ZR2A 2L0KA 2XPVA 5FKMA 2O7OA 3F0CA 2CRGA 3OSGA 2ID3A 3CDLA 2HDDA 1F43A 1ZTRA 4EEFG 2DMUA 4A3KJ 1FEXA 2W48A 1AKHA 5FLVA 1HCRA 1RPWA 2NOGA 2CU7A 2LVSA 3S17J 1JKPC 1ETQA 1FTTA 1WGXA 5EG0B 4A3FJ 3CMYA 2XPUA 5F0FA 1DU0A 2LR8A 3BR1A 5C3EJ 4FE4A 2QF7A 3LSGA 4GFBA 5F1JA 4Y7NJ 3BR0A 2X48A 1IUFA 2L9RA 1G2HA 2LP0A 3JRFA 3PO2J 1POGA 3D1NI 4XRMA 3FISA 2M2EA 2M8GX 3S1MJ 2EQRA 1LFBA 1I6HJ 2EZLA 2ELKA 2N8GA 1X2MA 3GTJJ 2TRTA 2G0EA 4MIMA 2TCTA 4XICA 2K9NA 3RZOJ 2E2IJ 1MH4A 3MVPA 4L5EA 2LK2A 2RAEA 4MLOA 1O4XA 3B6AA 1U9NA 1VF9A 4JX5A 4XK4A 4IHWA 2IBDA 5FJ8J 2VKVA 1VFCA 1JTYA 1S7EA 2NS7A 2L7ZA 5M5YJ 3JRCA 5J3LA 4I6ZA 1XG1A 2HI3A 1JKQC 4A3BJ 2MG4A 2Y2ZA 3HOUJ 5J1YA 3S14J 4C3IJ 2R5YB 2QCOA 2XGDA 1FJLA 1OCTC 1BL0A 1U78A 2R5YA 3PO3J 3ZOBA 4CYCB 3GTKJ 1YRNB 4RDUA 2Y31A 2OF7A 3NAUA 2JA7J 3WHBA 3LSRA 3LNQA 3S1RJ 3HOWJ 3GTGJ 1WCMJ 4QIWN 2DA3A 3G1OA 1MBEA 5BNGA 2NVQJ 2M9HA 4B3AA 2FJ1A 2DA2A 5IOZA 1VI0A 4MO7A 2VPRA 5JLWA 2GLOA 3C2BA 4CYCA 4HNVA 1P7IA 4A93J 2NVTJ 4DYRA 3TEDA 1HF0A 2JA5J 1ETOA 1ZKGA 1HOMA 5F27A 1XS9A 3OSFA 3HOXJ 2ECCA 4G12A 5IP7J 2E19A 4M3FA 3BR5A 3BG5A 3ZQGA 1FIAA 4DZJA 1IDZA 1UG2A 1W0TA 2R5ZA 4A3MJ 4FCYA 2YUSA 4UUTA 2CQXA 3ZQCA 2JK3A 3HGYA 4D5FA 1GV2A 3RKQA 3GTMJ 4FISA 4QTRA 4ABZA 5IOYA 3QPSA 1LFUP 2I10A 1BW5A 5M3MJ 5EG0A 1JJ8C 3OOUA 4LOCA 4D7NA 4QSHA 1A6IA 1TWAJ 2CQQA 1APLC 2VI6A 5EGOA 3LSJA 2CUEA 2Y9YA 9ANTA 1JKOC 3I4NJ 1QVUA 1RKWA 1RKTA 2R7ZJ 3SFIA 5M5XJ 1CQTA 3S16J 1WH7A 4C3JJ 5EDNA 2DN0A 4A3CJ 1QVTA 2GM4A 3M4OJ 1NK2P 3I4MJ 2DTZA 1Y1WJ 5E3NA 2K40A 1IC8A 2MSYA 4M3GA 5F04A 3Q0UA 1NK3P 2WB1N 3JREA 1XC5A 1D5YA 1JUMA 2MW8A 2LFBA 3A03A 1QPIA 1X2NA 1HDPA 3FK7A 3HB9A 5E3LA 5DS9A 2CJJA 1B8IB 1F36A 3H3VK 3BTCA 5J1UA 3GBGA 5IPAA 1GVDA 1B72A 2IEKA 4Y52J 1MBFA 3TP0A 3JRGA 4RBOA 1WI3A 3FKIJ 3JRBA 4BBRJ 4JX4A 2IAIA 2VKEA 4D7MA 3G1MA 2COBA 1FIPA 1TWFJ 4DYCA 1BW6A 1JKRC 4BY1J 5F0HA 1TWGJ 2KDZA 3HEFA 4X6AJ 3BQYA 4V2GA 5GPAA 3QQAA 5FKNA 2FQ4A 2DA4A 1ZQ3P 2O9LA 1X58A 2MGQA 1K83J 3PM1A 1ZGWA 5GP9A 2HOTA 1AU7A 3FIWA 2HOAA 3W6VA 4B1RA 3VPRA 4V2FA 2DMQA 4IHXA 3IH4A 3JRHA 3S2HJ 3JR9A
chains in the Genus database with same CATH superfamily
2ZC2A 1Y1VJ 3RKYA 4F3QA 4AVZA 1T2KA 3GZ5A 1H9GA 1IO2A 2DFEA 2KP6A 3HSRA 5FKOA 2ZJPF 1E3OC 3VYRB 2HPMA 4JOMA 3HHHA 3LSKA 1J59A 1DDNA 3ABMH 1PUFA 2ZMEA 4A3DJ 5BPIA 4GCVA 1OFCX 1R22A 1Z0XA 4KN4X 5C4JJ 2PJRA 2RC4A 1LQ1A 1AKHB 4GO1A 2NVXJ 2JWTA 4MTDA 2TDXA 3LSTA 3JAMK 3M3YJ 1HSJA 3GO5A 1PUEE 5IYDJ 4B09A 2P5KA 3K4CA 2KKOA 1SAXA 2V26A 3KEOA 1W7PD 1B8IA 3RQ4A 1WKMA 1Y6IA 2XRLA 3R6SA 3ZCOA 4BE1A 2D2WA 4XLFA 1U8BA 4EATA 2ZB9A 3EUKL 2BHYA 4X1EA 3CJQB 3DTEA 4IKFA 4A69C 2E1OA 1ETYA 3H9QA 3SDBA 1IRGA 3JRIA 2E1NA 4FE7A 1WH5A 4KMUX 4FTHA 2EFNA 2NAZA 3MAJA 4XRFA 3SDGA 4D5CA 2X9DA 1GXPA 3E6DA 3NRVA 4U0YA 1JI8A 4M6VA 3ZMZA 3RPUA 1XD7A 3QOPA 2L9SA 4BQOA 2EFQA 3T8TA 1T33A 3MN2A 3LQRA 4A3JJ 2EV0A 3TW6A 1FP1D 2W85A 4BDZA 3I59B 5ICEA 3F21A 1FOKA 2BY3A 5FKKA 1Z6RA 3HJEA 5IYCJ 1R4NB 1D0XA 1ETWA 3A1YA 3GZNB 3HUGA 3QYFA 5EYRA 2R4GA 4ZH4F 1X1DA 5K7FA 4W97A 5D5WB 3S15J 3E5QA 5ILUA 4C2MJ 2CUFA 1ITYA 3DBHB 5E8IA 1T0FC 4Y4RA 2F48A 1G3TA 3GTLJ 3PNVA 1Y8RB 1DQUA 4N4NB 3N4MA 3BR3A 1PYVA 3GF2A 2E5NA 3DF8A 3C2GA 2R0QC 1MZBA 3IH2A 1E17A 1GHCA 3K70C 3DKYA 3MFKA 2JQ7A 4B44A 4AVPA 1AHDP 3F72A 2RGVA 2V1UA 1R5GA 4EJOA 1JUSA 2R7QA 2H09A 3E5XA 3P9KA 4U0VA 3CQZJ 2E7XA 3NQOA 4G6TB 2VQHA 4XNFA 2R3SA 3OYKA 4BXXJ 3WTUC 1A36A 3VYSB 1S7OA 4KITB 1G3YA 3CCYA 2B9SA 1W7PA 3JRDA 4YRVA 5M3FJ 4M3BA 2GQQA 3K0LA 3ZQIA 3CCRI 3HG9A 3HUGB 3MKLA 4V19K 3B02A 2LY1A 1BI3A 2BYVE 2GA1A 2GOMA 2WBMA 1SFXA 3E7LA 3M7GA 1PDNC 2M30A 5E1WA 2XDVA 2DT6A 3BR2A 3KP7A 2KZGA 4NDLA 5FLMJ 4Q47A 1H89C 2WAQN 4XLAA 1HLVA 3A0HC 3DLLF 2RDPA 3TW7A 5J8CA 4IRGA 3KP3A 2V7FA 2HTSA 3V7RA 4JX6A 3RQIA 5IYBJ 3IH3A 2FBHA 2CQKA 5K7HA 5ILVA 1JT6A 2CQ7A 2A6HF 2VONA 2R7VA 1MKMA 3QPLA 4XN3A 5DYMA 5HLGA 5D6FA 4PUSA 3HBLA 1P6RA 1WJEA 3SZPA 2ETHA 4FHTA 4E4HA 1R49A 2NNNA 2IXSA 1YX3A 2DK8A 2KPMA 2LLKA 5DD8A 4IO9F 1IF1A 1FYMA 5GPCA 3MWMA 2HDCA 2R92J 1VQNI 2P81A 3HHGA 2IS1A 3C7JA 5JR3A 1R1VA 2XF6A 5FRMA 2IA2A 3L2VA 2JUCA 3EDPA 2F5FA 3LMMA 1WJCA 4W1UA 4ZZLA 1QHHD 3PFIA 2ESNA 4RLFA 3AL0B 3EUHA 4LG0B 4WCGA 2K02A 2VODA 4HBLA 1IDYA 4PK4A 2AXLA 1S5LC 3PNTA 3IP4B 2CW7A 1EH6A 3G2BA 1MSEC 2FE3A 3GWZA 3R60A 1Q1VA 4HNUA 3DEEA 3HC7A 3K4JA 4RGSA 4J19A 2E1CA 4GDFA 1I6XA 1JJ6C 5EEGA 4IHVA 4PGHA 2IRFG 1JGGA 2A05A 3OYNA 1GLNA 2EK5A 3SJMA 1FTZA 1NG6A 1D1AA 3LSPA 1HW1A 1WZ2A 2M45A 1RR8C 4DZPA 4OMZA 5CLSA 1LE8B 2OTJI 3GTPJ 3A4CA 4BKXA 2Y69H 4ZTFA 2XAQA 1FBQA 1XMAA 2CFXA 3CP2A 1UELB 2HU9A 2R7FA 2ELJA 1BJZA 4AYBN 4XOTA 3CMMA 1S7AA 3PJRA 2VJ4A 4ZDLA 1YX5A 1P4WA 1ZTRA 2W48A 2F2EA 2NNYA 5FLVA 2MD0A 1MDMB 2M8EA 1KU3A 4GYGA 3ZP5A 2O0YA 1ETQA 1WGXA 3FXJA 4LJZF 5EG0B 3VODA 2XPUA 2QM3A 4YFNF 2LR8A 2D45A 3LSGA 3CCQI 2GXGA 3GFMA 1PJRA 4Y7NJ 3BR0A 4YFXF 4EJTA 1IUFA 4XSZF 3RYRA 1Z7UA 4D0PA 1POGA 3D1NI 2E34A 2A68F 4NBQA 1Z9CA 3IRQA 3IHUA 2OBPA 1ZH5A 1RUNA 2Q2EA 1N78A 1X1BA 4BQQA 1SVMA 4F92B 1ZG1A 1X1AA 2OCEA 3J7AO 4PJNA 3E3VA 2BHZA 2L01A 2ZNYA 2O6GE 1BI0A 3ERED 3A2KA 1LNWA 1UHWA 3JW4A 2TCTA 2LF8A 2QZ8A 4EVIA 4DOZA 1KYWA 3F8BA 1O4XA 3KZZA 2M5WA 1U9NA 5CQEA 4E7SA 4IHWA 2IBDA 5LBQA 2W25A 1HW2A 1X1PA 4CCLA 5M5YJ 4I6ZA 1JKQC 1XG1A 1MMSA 3WTXC 1Z05A 2NS0A 4LD5A 3S14J 1OQYA 2QVOA 3KP5A 2QCOA 3I54A 1TQMA 1R5HA 2HYGD 2VASA 1ZG5A 1FJLA 1B1BA 2V9KA 3ZMTA 4ENJA 3LA7A 3TO6A 3BWGA 1U78A 2MD5A 2R5YA 3ZOBA 4CYCB 3F8CA 1CF7B 4IOCF 4RGRA 2V6CA 4CDGA 2XUBA 2OF7A 3CCEI 4G8XA 5A2QK 3WHBA 3LNQA 3OYEA 3S1RJ 3D0SA 1S72I 1OMIA 4QIWN 2XGXA 3RKWA 2VBZA 2VBYA 3BJ6A 5BNGA 4CGZA 2O03A 1MMNA 3IUOA 3DBLB 4QPOA 2A6EF 2CH0A 2DQRA 4HAMA 3F9KA 3HOSA 2GLOA 2B0LA 4XR6A 2EJRA 3K4BA 1P7IA 4A93J 2F4IA 1WVRA 1HQCA 3ML6A 4OAZA 1R36A 1HF0A 2JA5J 3P5JA 3RPUD 5F27A 2ECCA 3H92A 4G12A 5LGTA 5DCMB 1P92A 2DBBA 3BR5A 3ZQGA 4HEA2 1IDZA 2P8TA 1SVOA 2Z3YA 2PQ8A 2KMUA 3I58A 2OTLI 2R7SA 3OYGA 3ZN1A 1D3YA 3FXQA 4A6EA 3G73A 3ZQCA 4P1WA 3KYLA 2L9VA 6PAXA 2O61A 4DBQA 2FSWA 4FISA 3ZGKA 2KL4A 2IGOA 2Q0OA 2I10A 1BW5A 1FWZA 5FB2A 2JVGA 2RVCA 3CMAI 2ZCWA 2HVRA 2BEOA 4LOCA 4QSHA 4CCOA 4IVNA 4L9NA 1A6IA 1STZA 3LSJA 4BXFA 3I5UA 2VC0A 1JKOC 1X3UA 2G7HA 3AKZA 3P7NA 3QPTA 3SFIA 4TV7A 5M5XJ 3L2UA 2RN7A 4ZDPA 3M07A 3ISPA 1QVTA 4HV5A 5E79C 1Y1WJ 1GXQA 1YYVA 3L7WA 5E3NA 4EGYA 3OL4A 2VE9A 4XKVA 4UNOA 2ZO4A 3KEYA 2FBIA 1NK3P 4CYDA 4Y17A 5E1XA 4Y13A 3QYBA 3A03A 1QPIA 3F8FA 3E97A 1HDPA 5TJJA 4G94A 5TGTA 2O5RA 5KK1A 3G6EI 5E3LA 4Q5SF 3DXJF 4HF2A 4C30A 2IP2A 2IEKA 3DPLC 4Y52J 1P4XA 2HOEA 2L5QA 3AG4H 2RKHA 2QLZA 5KCMA 3TP0A 4HYEA 2HWVA 1J5YA 3CC4I 3JRBA 3CC7I 4OWRB 3M8JA 4BE0A 3GXOA 4BBRJ 2IAIA 1WJAA 3GUDA 3S3MA 4BYYA 3BCAA 1WFXA 2BW3A 2HFHA 4DYCA 2VKDA 5L3FA 1TWGJ 3HEFA 2F5EA 4V2GA 4LLGF 2JSCA 2Y48A 2BY2A 2P6SA 3I4PA 3QQAA 1JXSA 2Z9OA 3PL8A 2EA2A 3KEQA 2V9PA 1LVKA 3PM1A 1ZGWA 4XORA 2HOAA 1I1SA 2CWEA 3VPRA 5B1AH 1R00A 4XLPF 2VE8A 2VBWA 1A6QA 4L9JA 4IHXA 3DWLE 2H1LA 2ZXWH 3BG6A 1BA5A 1PP8F 4H0EA 2P4WA 1YJ9I 4DIQA 1MIJA 1H0MA 1TNSA 2KHMA 1XSVA 2QWWA 2JA2A 2EIJH 3Q9VA 1FZPB 3OIOA 3GEZA 5TRDA 3K4KA 3JAMZ 4ZDOA 1W5TA 2PMUA 2K3PA 2XRNA 3K2ZA 4F91B 1PUFB 2QKLB 2GBYA 1K6YA 3MKYB 2EILH 1I50J 3QOEA 2K86A 2IPQX 2M4KA 4KISA 1O3SA 1OYYA 3GTQJ 1OCOH 3V8JA 4GXOA 3TDUC 1XGNA 3BR6A 4D1QA 4KIBA 2LC2A 1ETKA 4HX8A 4RB0A 3HPHA 4RM2A 3HRSA 2ME0A 4CA0A 5L3CA 3FHZA 2RQQA 1J0RA 1O3TA 3HKZA 4LG3A 3TP3A 4BS9A 5HNHA 2L7FP 1UG0A 3PQJA 3J80K 5C44J 2HPIA 1YJNI 2X85A 5JLXA 1QNTA 2YS9A 2RNGA 4L9TA 3WTWC 4KNYA 4B4CA 4XRSG 5HODA 2UZKA 2AHQA 1S29A 2HZTA 4DYQA 1AA7A 4ENKA 4Y3OA 2JRTA 1I1GA 2CO5A 3TO9A 4XRSA 2ZSIB 5LHGA 2HEOA 2QQ9A 3TOAA 3ZPLA 2R7XA 3CCLI 1T8IA 3KZIC 4M3EA 1KGSA 4EM1A 4A3IJ 1EJ9A 4BAYA 1RC9A 3WHCA 1D0ZA 2CW0F 4PZJA 1IXCA 3EUAA 5B1BH 1I39A 4MFEA 1TWHJ 4BHBA 1O3QA 4BH9A 1TT0A 2WV1A 3IAS2 3BQZA 3FXUA 1ZAOA 2FOKA 3ABUA 2VXDA 1V4RA 1GV5A 3G1LA 4PJ0C 2ESHA 1WRJA 4A0ZA 1Z3YA 3IAM2 1R58A 4BE2A 2R5ZB 3J7AY 5CVIA 3VYTB 4RAGA 1VQ5I 4KN7X 3T0YA 2H8RA 1YW9A 5CQGA 4KMFA 4M74A 2YSRA 3S3NA 1T0FA 1S6LA 5F1RA 3A01B 1QU3A 5LLQA 2PN6A 3RI4A 1MD0A 4BEHA 3D5RC 1UJ8A 1X1CA 4EV0A 3CP8A 5L3DA 1U5TA 1SEUA 1H8AC 4BJ5C 1EV7A 2Q1ZB 3FK6A 1XGOA 3DU5A 3W2VA 1LEAA 2VJ5A 2M1BA 3A02A 3LAJA 3KP4A 3MKWB 2KIFA 2LRDA 4P96A 1SMTA 2DOEA 2L4MA 2A3SA 2JRMA 3OL3A 5FD5A 4ENMA 3MZYA 3HPGA 1DGWY 3BC8A 2XGCA 4G6QA 2DQLA 4CSWA 2FUG2 1Q1HA 1WHUA 1R1UA 1OYIA 5LD2C 1QO0D 3P9IA 2LTPA 5J6XA 3DTKA 2DA1A 4Q4ZF 2QBYA 1MMAA 2MLGA 1MJBA 3FHNA 2VT2A 2XB5A 1GDTA 4A6DA 2K27A 3RZDJ 2JMWA 2G7UA 2Z99A 3VEPA 4S0HB 4IQ4A 5EEAA 2STWA 3OIQA 5EZHA 4ESFA 3RKXA 1F1ZA 2OQGA 2OQRA 2W4SA 5J4YA 1D5VA 3Q0WA 3IKVA 1DP7P 3KLNA 3JTHA 3RIRA 2KRCA 4EJUA 2KJCA 5EF6A 4G7HF 2PMHA 1V5GA 3M1EA 3TOBA 3PQKA 3KP2A 3AG1H 4HDUA 2HYFA 3OV8A 1LVAA 2BV6A 5DCMA 5EGOB 2ZJQF 2EZKA 1FLIA 3QP6A 2JVHA 3I3LA 2F5DA 2MH9A 1BN5A 1G6NA 3MD2A 4E7KA 1UMQA 1C0WA 2OUMA 3O6BB 3SZGA 3OYHA 3ONQA 1RIOH 1G3WA 1Z77A 2XAFA 1WPKA 3E5UA 3LA3A 1T08B 2A07F 3TKYA 1QHGA 1YI2I 4XKWA 2DODA 2JJ7A 3GVAA 4XLNF 1SAUA 1NTCA 2K85A 3CCJI 1R7JA 4IRHA 3OWTA 4IOAF 1NHAA 5JFRA 2ECBA 1FC3A 1S8NA 1SFOJ 1MMGA 5LHHA 2W1OA 4WXDA 1R1TA 2P0WA 3W2AA 2JA8J 3ZQHA 2AQFA 3SQNA 1MBKA 1OJLA 2PFBA 4HF0A 5B5EC 2VUMJ 2A69F 4BY7J 3BG7A 4FX0A 3QU6A 3S3OA 5E3MA 1TQPA 4GYIA 1KU7A 1RUOA 2IS4A 2QUFA 4Z2YA 3CCSI 3Q0VA 2VPLA 1N75A 2BE5F 5H6RA 2HGCA 1TNTA 3TMOA 4IHYA 5IP9J 3FDYA 4I99C 4HQEA 1YJWI 1MGTA 3BZKA 1VNDA 2HQ5A 1IN6A 1JUPA 1ZGAA 4LLNA 5L3BA 2OPTA 1PVEA 2L0KA 4B8XA 2XPVA 3K1NA 2CUJA 5FKMA 2KRFA 3F0CA 2CRGA 1EA3A 3OSGA 2J5OA 4G7OF 2ID3A 4EEFG 4NQWB 4A3KJ 1FEXA 1BOBA 1R5ID 4N4OB 4I98B 3H9JA 2CU7A 2MC4A 2I5UA 1ZREA 1OLTA 3S17J 1ZELA 1FTTA 5LRRA 4LB5A 3QODA 3CMYA 3BR1A 5GAEJ 4YIFA 4GFBA 4ESBA 5F1JA 3E6MA 4L0ZB 3FX3A 1W4MA 2XAJA 1MNEA 4YIIA 4BU2A 3JRFA 3VOEA 5GADJ 4I7HA 5FGMA 3DV8A 1KQ8A 2M2EA 2M8GX 2EQRA 1LFBA 2W84A 2EFPA 3BZCA 3IC7A 2X1CA 3E6CC 5H6QA 2A5WA 4ZC3A 4LGWA 1X2MA 3LSIA 3BPVA 2DPUA 4M71A 3AG3H 2O8XA 3WTYC 5LEJA 2F4MB 3PUFA 3QU3A 2WB1A 3IRRA 2CW8A 1ZN2A 4O3MA 4L5EA 3WU0A 4HSTA 4I0AA 3PNYA 3CUOA 3SFZA 5K5RA 5BQTA 2DI3A 1D8JA 2IJLA 1OPCA 1G59A 2JPCA 3GFLA 3VSKA 4LB6B 5FJ8J 4PSXA 4E7IA 1FY7A 4RB2C 2Z33A 2L7ZA 2DDAA 2HI3A 3HOUJ 1D1BA 5J1YA 4C3IJ 1FBSA 5HS8A 2LNBA 4MQVA 5KAIC 1UFMA 3SEQA 4YEJA 3PO3J 3GTKJ 3QP5A 2X1EA 1DGRM 3WE3A 3JCUC 3UR3C 2DLLA 3GLLA 3LSRA 3KZYA 4CCNA 3GTGJ 5IT9K 1U8RA 5B3SH 3CJRB 5FFXA 1TQIA 1ZG3A 2L02A 1LEBA 1ON1A 5IY5H 4XKBA 2M9HA 4B3AA 2XAHA 1ERDA 2A6TA 3CUQA 3SXYA 5IOZA 4S04A 4EM0B 2GZWA 1IXSB 2OD5A 1FX7A 2EPFA 2VPRA 2QBYB 4XSXF 2I8DA 2KRHA 4GGGA 4DYRA 5E18F 3V8LA 2V6EA 1HOMA 3OSFA 1IV8A 2IA1A 3HOXJ 3DQVC 2EFOA 4BNCA 3S2WA 1KONA 2WAFA 2QYOA 1BIBA 4IF4A 3BG5A 1FIAA 2VJJA 2DYRH 3WE2A 2C6YA 3CMEI 2YUSA 1JHFA 4UUTA 3V7CA 2VL8A 4KJZA 2GOXB 3ZMUA 4F55A 1TW2A 4RM3A 5LGNA 4MTEA 3WG7H 5ICGA 1IZ1A 3FXRA 4FX4A 4ZJZA 3D5SC 5IOYA 2QENA 3IWZA 3LSMA 2RV8A 4PSWA 1LFUP 2LKSA 3H3ZA 4M9XA 2BY1A 4PGGA 3I64A 4CZCA 3LSHA 3S8PA 4D7NA 4CO8A 3FZVA 3MCZA 4EQQA 1TWAJ 2CQQA 1VQ7I 1EH7A 2VI6A 3U2RA 2CUEA 2VQLA 1YOVB 2L4AA 2Y9YA 3K4NA 4EM2A 9ANTA 5K1YA 1QVUA 4E7LA 4CUGA 1MW7A 3K4MA 2Z16A 4MEYF 3WU2C 2Z5UA 4KYWA 1CQTA 3S16J 3FXOA 2R7OA 3CF2A 3KP6A 4C3JJ 5JVTA 1NK2P 3B73A 4OINF 3LFKA 2LSOA 4HNTA 3KYDB 2KJBA 1VQ4I 4ON0A 2KIQA 4I09A 3OR1C 3DP7A 1JUMA 1Y8QB 3M9AA 4KA4A 4XMYA 5A2QZ 1X2NA 1IN7A 2LBFB 3ZR8X 3FK7A 2CJJA 2BZTA 4MGRA 1WJ5A 2WTEA 1I3AA 4WXCA 5AIQA 3J81K 2VKHA 5J1UA 1B72A 1A04A 1Z7LA 4UXNA 1MBFA 5D8LB 4UV9A 2G9WA 3G3ZA 2ZFUA 3DBRB 4KT5C 4Z6YA 3JRGA 2UUZA 1Z91A 3ASOH 1SMYF 1LUJB 2W82A 1J2XA 4JX4A 2XF7A 4BHPA 4D7MA 3G1MA 4RA2A 5DD4A 1XCBA 2JT1A 3VSLA 3WODF 3ERMA 1S3JA 3SHFA 4AU7A 4BY1J 5F0HA 2KDZA 1HXDA 3BQYA 3CF5F 2W00A 2OJED 2IVMA 4HQMA 5FKNA 2DFIA 4BEHB 3ZXSA 2HZDA 1G8XA 4N9IA 4OIRF 2LDUA 2MBFA 3C3WA 1USTA 3W3CA 4HLYA 2DMQA 4RAZA 3JRHA 3S2HJ 4EMSA 2NVYJ 3FM3A 5D8KB 3WTTC 4QPQA 3KIOA 1GT0C 3C1DA 4JK1X 2DYSH 2XHKA 1K78B 4UVCA 2ZJ2A 2ME6A 5E17F 2KT0A 2HVQA 3CCVI 3D5LA 1RRJA 3R0AA 4I02A 1RETA 5FD6A 3DU6A 1YO5C 3LA2A 2VQCA 4IJAA 3BTJA 4WX9A 1ETVA 1QQIA 1IUYA 3E6BA 2CV0A 4ZYDA 3CO7C 2W7NA 3OYBA 4IPAA 2HVSA 1ZGJA 1K61A 4LFUA 2HXOA 4A3LJ 1V54H 1L3LA 2CV1A 3EYYA 1BR1A 1U9OA 1K7AA 4AIDA 2HKXA 1IV6A 2XSDC 3VDXA 4HRIA 1EF4A 1UHMA 4HZFA 2XROA 3JSOA 1TP4A 2BY0A 1LE8A 1XN7A 4I76A 4Y15A 4R79A 1IN5A 2KIUA 2KIMA 2YX4A 2Y75A 4KT6A 2XAUA 2EFWA 3BPXA 5C4XJ 4DJAA 3K9TA 3NARA 4UB6C 1JGSA 3S2DJ 5IT9Z 2MA3A 1HKTA 2X6YA 1N25A 1UZCA 5FROA 1HC8A 3OYCA 3KLOA 1EH8A 4XN0A 3CTAA 1EKEA 2R7RA 2IA0A 3C2HA 2Z1DA 4N9HA 2HKOA 3DKWA 4E7HA 1XSDA 1GUUA 1IGNA 5CVVA 3A0BC 4BJTA 3V8KA 1E2XA 2M3AA 2EBIA 1LB2A 4A5MA 2XKPA 5LHIA 2CMPA 3GMEA 3PIPF 3GLXA 3N05A 2EZIA 3LWFA 4IZZA 1KQ9A 1MNDA 3KCCA 4HSRA 5D5XB 2HS5A 3BG3A 3UKGA 3B6CA 3DPTA 4WXHA 2WV0A 3ROUA 2LH9A 3FBNB 4P9FA 4ASNA 4N0BA 4UUSA 4LMYA 4M6XA 3CCUI 1MDMA 5HLIA 1IN8A 1MNMC 2IGNA 2V1DA 4CCJA 1G4DA 2LG4A 2JSPA 3GW2A 1IG7A 1X4OA 2H94A 1F9NA 3MQ0A 2GXAA 5BOXA 2O8KA 1B72B 2M0CA 1QRYA 1VQ6I 1AOYA 1P7JA 1OCCH 1FMVA 2KLOA 2P5VA 1WJBA 1P2FA 3LL7A 4UVAA 2P5LC 3BZ6A 1K4TA 5FRNA 5HVQC 1R71A 1SFKA 4LK0F 4PCQA 1BR2A 1R4MB 4A3EJ 4NB5A 1ZLJA 2AXTC 2E1MC 3BT9A 4XQFA 1VQKI 1YHQI 5K5QA 1S9HA 1ETXA 3FKJA 4IL6C 5CPRB 4M9SA 3TQNA 3ZQ7A 3S1NJ 2VLAA 3IKTA 4C2UA 3AL0C 1ZK8A 2FX0A 3QYEA 5CVRA 2H1KA 3BTIA 1FOXA 4IEJA 3F8NA 3HIFA 3A01A 3P9CA 2QQ8A 4UB8C 3HOZJ 3RPQA 5D6EA 1RZ4A 3OYJA 3HKZN 4PFOA 2Y0SN 3CDHA 3K6GA 5F64A 5D4SA 2X6OA 3WGIA 2LKPA 3O2PE 3CC2I 1JTXA 2KDOA 2XB0X 5CVJA 1I3QJ 4G9YA 3RYPA 3IV5A 4Q48A 2M34A 3GTOJ 2ZJRF 2JTVA 1SFUA 3K4LA 3BG9A 1LPQA 1ONVA 3L9FA 2LKXA 5J47A 2X0LA 2HR3A 4CCKA 2DK5A 5HLHA 1Y39A 2ISZA 1NG7A 4UV8A 4AUXA 1YITI 3BTLA 3OY9A 4L18B 3F6OA 1Z21A 1K4SA 1IAWA 4BQNA 3I55I 1Z67A 3CESA 2O3FA 2QSGX 2QQBA 2L2OA 1WJDA 2NS8A 1J7KA 3LQQA 2HXIA 1VQ8I 2D1HA 4UUSB 5E20A 3HM5A 4MFDA 5E1ZB 1IRFA 2ZXIA 2MFZA 3FXLA 2Y0SA 4ZYGA 3VWBA 3OYIA 2D5VA 4U88A 4H4KC 2IS2A 3CO6C 2OZ6A 1QA6A 2KFDA 2L3DA 3JRAA 2WWYA 3ZQFA 4IX7A 3L1PA 3J80Z 1E0EA 4C3HJ 5CJ9A 1ZR4A 1KYZA 2LOOA 2DJNA 2CSOA 4P55A 1HA8A 2VBXA 1D0YA 4NNJA 2YX7A 1OKRA 4HDVA 2Y0MA 1FOYA 3PSFA 5IP6A 2GIZA 3S32A 3H5RA 2ADUA 2FXAA 1XMKA 1IN4A 2Z2SB 1O3RA 2Q8KA 3BY6A 1FMWA 2YU9J 4NC8A 4I2OA 4DW6A 2DW4A 1MSFC 3GZ6A 3KPHA 1QPMA 2A61A 1BC7C 4WF2A 3ZQLA 3V42A 2FF4A 2ZSHB 2FNAA 2YU3A 3HOVJ 4A3GJ 1WSUA 2HOSA 2R93J 2XPWA 3IWFA 1VQ9I 3HSEA 3LOCA 3BCBA 4XIDA 1REPC 3G4SI 2DA5A 3TBIA 1A35A 3RTRA 1R9TJ 2GXBA 1ON2A 1FYKA 1W0UA 1ZR2A 2FOWA 2RNJA 4G7ZF 2B63J 3OMYA 1KZHA 1WJFA 4ESJA 1YTYA 5DCFA 3FXKA 2O7OA 3OS2A 3CDLA 3K70D 1I27A 2HDDA 1RI7A 3H36A 1F43A 2DMUA 2LBFA 3RSNA 3O3KA 1AKHA 3MMYB 1HCRA 2LVSA 2ZFWA 1JKPC 4KFCA 2VOOA 3X2QH 4A3FJ 5F0FA 1DU0A 3I71A 5C3EJ 4FE4A 3TO7A 4AWXB 4L0YB 1SD4A 2EV6A 2P6TA 2OU2A 4ANJA 1K78A 1G2HA 1MJAA 4U0WA 3L2CA 3PO2J 4XRMA 3L2RA 2DAOA 3S1MJ 2M4GA 4FQGA 4LK1F 4IXAA 1I6HJ 3U1DA 2LYCA 5E8GA 2ELKA 1WI9A 3FM5A 1TLHB 4G6DA 3CD6I 3HSFA 4L9VA 2N8GA 3CLQA 4RB3C 2M0MA 5F6FA 2PI0A 4K2EA 2NRAC 2TRTA 1KA8A 1BC8C 1QZEA 4RGXA 1XGSA 4XICA 2K9NA 1TT5B 1YIOA 3FMSA 3RZOJ 2E2IJ 1TW3A 3MVPA 4C2TA 5CYVA 2LK2A 3B6AA 5GAHJ 1FBUA 1VF9A 4JX5A 3RDIA 4ETSA 1VFCA 2VKVA 3V7SA 1MJ9A 5J3LA 3JRCA 4A3BJ 5DUKA 4E6KG 1ZARA 5J4VA 5HLTA 1Z1DA 3SYTA 2R5YB 4DQ2A 4MEXF 2XGDA 4LIVA 3ABLH 3N97A 1BL0A 2FA5A 3K10A 2ICWG 1YRNB 1LDKB 3WU1B 5BPDA 4IHTA 2X6XA 2R7WA 2JA7J 1B59A 2DTRA 3HOWJ 1R6RA 3W2WA 2DA3A 1LJ9A 3G1OA 1X3ZB 5DEQA 1SC7A 4MHGA 4UHTA 1NH3A 2DA2A 1R23A 3OIPA 4IQJA 2W24A 4U7BA 4MO7A 5JLWA 4CICA 4NQWA 4HNVA 1ZYRF 4FT8A 1YFHA 2OA4A 2DXIA 2NVTJ 3TEDA 3DKXA 3Q9SA 2QQAA 1XS9A 2E5ZA 2VQGA 2DT5A 3MEXA 2RREA 4M3FA 1T6SA 1T39A 2EV5A 1O7FA 4I01A 1FT9A 2E36A 2R5ZA 2H27A 1J09A 2CQXA 4XM3A 1X4PA 1K79A 2JK3A 1OCZH 2EIKH 2QKMB 3HGYA 3HZJA 4RLQA 4D5FA 3F23A 4XONA 3KYCB 3CCMI 3H3UA 1FPQA 2XF5A 3UNGC 1V55H 3H35A 2VN2A 5JI6A 3QPSA 1W7PB 1USSA 2EB7A 5HOOA 5M3MJ 5EG0A 2DT7B 3OOUA 2IS6A 1LKXA 4RAYA 3EETA 1KU9A 2HDWA 1CF7A 1CGPA 2DPDA 2V1NA 5JVGF 3EQLF 4OIPF 4RGUA 1H9TA 1RKTA 2K5CA 2X6WA 2R7ZJ 4UUVA 3VB2A 1XGMA 2KZVA 3MZ8A 4LIUA 2DN0A 5EDNA 4A3CJ 4NC6A 3QAHA 2GM4A 3M4OJ 3I4MJ 4PFPA 1IC8A 2K40A 3DTIA 2HQRA 1VZ0A 4M3GA 4ZTJA 1ZLKA 3Q0UA 3OYAA 5ERIA 3ABTA 4WK8F 3OS0A 4IHSA 3W6KB 2WB1N 4M6YA 1Y0NA 1IRXA 1XCVA 5JHUA 2MABA 1BOAA 3RJPA 4PDKA 3HB9A 4ITVA 4AYBA 5DS9A 1F36A 3QWLA 3H3VK 3ABKH 2H6CA 5IPAA 1GVDA 1BI2A 1XDSA 1QZYA 5DDGA 3H0DA 3EYIA 5H20A 3I53A 4RS8A 2MYSA 3OS1A 2ELHA 2GIVA 5ICFA 3LAPA 4CCMA 3FKIJ 5J8FA 2YPRA 2XKOA 3F6VA 1HBXG 2VKEA 5D5UB 4U7DA 2FEZA 1QZZA 1FIPA 5LRSA 3T8RA 1B4AA 1BW6A 2WC2A 4RB1A 4XLEA 1GVJA 1I5ZA 3REOA 5GPAA 2V1XA 2CV2A 1ULYA 1X58A 4OIQF 2CYYA 1K83J 1WWXA 1JE8A 2PMZA 5D4RA 5H2FC 5GP9A 2HOTA 1AU7A 2F4OB 1LDDA 3ELKA 1W36C 4U87A 1VTNC 4NUBA 3W6VA 3ZMVA 4B1RA 3L2QA 1UCRA 1O57A 1BBYA 3IH4A 5E3OA 3ZN0A 1RR7A 1OYWA 2LY9A 3O8GA 2VJIA 4R1HA 1W5CC 3JTGA 3HXLA 5FO5A 2ACJA 2E2HJ 1BI1A 2E60A 1IRZA 3CUQB 4YELA 1TWCJ 4R8HA 2DJIA 1B9NA 4GRIA 1AWCA 1OCPA 2QSHX 2CS3A 1ENHA 1ORKA 4NHJA 3EPZA 1T56A 2FRHA 1H88C 4MNUA 5BS6A 2JUGA 3Q3SA 2HNHA 4P5OA 3SZTA 2STTA 2Y30A 3L09A 5GTHC 3E1SA 4B43A 1HSTA 2AS5F 2H6BA 4XKCA 1F5TA 5KVRA 3CUQC 5JHFA 3BROA 1OR7C 4RMNA 1FSHA 3K1MA 4B48A 1HDDC 4YIRX 3OYMA 2JA6J 3KFWX 1PP7U 3R61A 2BVLA 2E2JJ 2NYXA 2PMZN 2QEXI 3GX4X 4BQAA 2K9SA 3H9GA 3NWTA 4BXUA 4AD9A 4LG0A 3MKZA 3HOTA 4AIKA 2OV7A 1XDUA 2JN6A 1E3PA 3KETA 4BUPA 1BM9A 3DEWA 2PJPA 1KQ0A 3LFUA 4HW0A 1JT0A 4OAYA 5DTDA 1YRNA 1OISA 3K2AA 2PBIA 5FFZA 2XV4S 4PJJA 1L0OC 3DCFA 3E0JB 2K9LA 2WAEA 2P7CB 2ISYA 4HPQA 1SD7A 2HQAA 1ZRDA 4AIJA 2R7UA 3HGGA 5M5WJ 3QPHA 2X51A 2EZHA 2WADA 1Z6TA 3HTUA 4DNCA 1MMDA 2MH2A 2ZMEB 1SANA 1D1CA 5F08A 4UVBA 1IJWC 4A0XA 4F93B 4CHUA 4OMYA 1VQMI 2DA6A 3W6JB 3AFHA 2K9QA 2UXXA 2JZYA 4II2A 1B6AA 2F5VA 1W5SA 4EGZA 4DGWB 4J01A 2LMDA 1B9MA 3ZMDA 3T5XA 5F0CA 4JP0A 2EIMH 3OOPA 4JYKA 4JBAA 2WY7Q 3DLAA 2XSJC 3ECOA 5CKTA 5HDKA 3S1QJ 3O8HA 2DOAA 2K3FA 2L7KA 1UHSA 1Y56A 4BGDA 2M7AA 3DEUA 5KNLA 3NWSA 3V4GA 1UAAA 1V5EA 2BXZA 5LGUA 5J1RA 1RESA 1YW7A 3JSPA 2GWRA 1HW5A 3WTZA 2CFOA 4OOIA 2EH3A 2DA7A 4M9ZA 3U1KA 2X4HA 1BR4A 4QWQA 3ASNH 4L5JA 5B66C 1VQLI 3ECHA 2LY2A 5KAFC 3OYFA 3OYDA 4HLXA 1YG2A 1U5TC 3M1CA 2HYJA 5AIPA 3HRUA 5D5VB 3ZMSA 2DMTA 2E1MB 2ZMEC 1YW8A 4M3DA 3J7ZI 3H5AA 4CH7A 1XX5A 3K69A 3HDDA 2LREA 2AQEA 5FKLA 3COAC 3FMRA 3WG9A 2QA4I 2K4BA 3HL2A 2Y9ZA 4EJVA 2BW3B 3GCMA 1U5TB 5FLXK 1A31A 3QRFF 5CVUA 2DMPA 1MBHA 4I0BA 5DV5A 2YR2A 2FD5A 1XB4A 2LD5A 1QBJA 2XIGA 2MLKA 3R4KA 3K7AJ 3ZQQA 3IL2A 2PG4A 1XTAA 3C18A 3H1CA 2AO9A 2L54A 2IGMA 2VXZA 3WGHA 4QLCU 4YG2F 5KHDA 3G71I 3HOYJ 4A5NA 2Q2EB 4P9UA 2L7MP 1MBJA 3I9V2 2XAGA 3H0GJ 4A2UA 4DBRA 1A5JA 4FASD 2J5PA 1MH3A 1VQPI 5LFAA 3PIOF 1W1WE 3WGGA 4HG2A 1YS6A 1X3WB 2W57A 3TDZC 5EZGA 2HQNA 2DMNA 4AIHA 3CLOA 1TC3C 1QGPA 4LITA 4ZYEA 2EWNA 1SD6A 2PLYA 2DOFA 3J7YJ 5DM7F 4C9YA 3K1PA 4XLHA 4HA8A 4FETA 2CGPA 2BGCA 1MBGA 3RCOA 2CQNA 3I0TA 4L5IA 2XC7A 2BVMA 1N77A 3VFZA 2V79A 3CZ6A 2VOPA 4BL0B 2JPBA 2WAQA 4YFKF 2K7LA 5HS7A 3R0JA 3FXMA 2M87A 4II3A 4MQ9F 5K7ZA 2XGEA 1XPXA 3PSIA 3Q5FA 1DU6A 4M72A 3TGNA 4XBFA 4AC0A 3BJAA 4CXFA 4BBSJ 4O5VA 4KIFA 2EINH 2ZKZA 2ID6A 3I59A 4XOPA 1YIJI 2HTJA 4UY8I 1F4KA 3HRMA 3BP8A 4ZYAA 4RAFA 3I56I 3FBIB 2BXYA 1T98A 2CUZA 4KUMA 1IW7F 1OR7A 3VYUB 1RPWA 2NOGA 2V9VA 3F22A 3NEUA 4KIGA 1ZRFA 2QF7A 1U6GA 1DUXC 4KICA 4O6JA 2WA0A 2R7TA 2QGUA 4CZZA 2IW5A 2V4JC 2X48A 2L9RA 3CJNA 2LP0A 3F3XA 1XSXA 1U3EM 3FISA 2ZNZA 5EEHA 1SD5A 2EZLA 3U9GA 2B7EA 1ODDA 2DO7A 2COMA 4D9JA 2R7DA 3HYIA 1T95A 3BLYA 1RNLA 3GYHX 2K4JA 5TISC 3GTJJ 4PJLA 2IGKA 2G0EA 4MIMA 1OCRH 4EJWA 4ZYHA 2IT0A 2XVCA 1MH4A 5GTIC 2RAEA 4MLOA 1YS7A 1FYLA 1U2WA 2CG4A 1YE9A 5J40A 4E7JA 3PUBA 5BMZA 4XK4A 5DM6F 4J00A 3DFGA 4PJMA 1JTYA 1S7EA 1HKQA 2P7VB 1YLFA 4HF1A 2NS7A 1FSEA 4BJ6C 2NXNB 2MG4A 2Y2ZA 2F6CA 5LEKA 2FNPA 5L3GA 4OIOF 3HRTA 1G3SA 4ENNA 4OU0A 1OCTC 1SFEA 1XMXA 1J9IA 5EJCA 4KDPA 1LFPA 1TTYA 3KE2A 1O7LA 4RDUA 4HX4A 2Y31A 5EGOA 2UV1A 3NAUA 4M73A 1P9QC 2FMLA 4F52A 2KISA 5FLXZ 1K6OA 1WCMJ 4E70A 1V3FA 4WWCA 2OAZA 3BJOA 4E7ZA 1MBEA 4LLLA 2NVQJ 1FP2A 2PX9A 3T1BA 2FJ1A 2FU4A 2GA2A 2LF7A 1VI0A 1M1EB 5AONA 4ZZDA 2PEXA 3C2BA 4CYCA 2OCCH 2OZUA 2A5YB 1VQOI 3AAFA 3M8FA 1E3HA 1ETOA 1ZKGA 2DCEA 1ZHFA 2VC1A 3SEZA 4JQFA 1W36D 4A12A 5IP7J 4AM3A 1WQ2A 2E19A 4HOBA 2BOLA 4BACA 3L2WA 3ZRGA 4B47A 4DZJA 2UWMA 1LDJA 4B3XA 1UG2A 1W0TA 4A3MJ 4FCYA 2NOJB 5DUIA 2DFHA 4X0GA 1GV2A 1U0JA 1X19A 2VB6A 3RKQA 2VT3A 3BDDA 3EUHC 3BOQA 2QSFX 3FWEA 3GTMJ 2E7WA 4QTRA 4ABZA 5K5OA 3WTVC 5HNFA 2VIXA 4BDYA 1Z3XA 1KU2A 3KX2A 3ESWB 1JJ8C 4A0YA 2E71A 3M8EA 1T38A 1APLC 1TZLA 3FF5A 4HV6A 3PFYA 3I4NJ 1DP3A 1RKWA 1SVLA 2OC6A 5ILSA 3H5NA 3WTSC 3F8MA 5IT3A 4Y33A 1WH7A 4F7ZA 2FMYA 2BBYA 2DFFA 1J75A 2X1DA 1HKSA 2RQPA 2DTZA 5HDNA 3MZHA 4BHCA 2EA4A 3OYLA 2MSYA 1UB9A 5L3EA 1P4AA 5F04A 3AG2H 3L00A 1JHHA 3JREA 1XC5A 3GFIA 2D1VA 1D5YA 3HTSB 2MW8A 2LFBA 1FOWA 5ED4A 1IXRC 5GAGJ 3FMQA 4HX7A 2FBKA 1ZRCA 2ZBKA 1ACIA 1FNNA 1B8IB 2M7BA 3BTCA 4XLCA 3GBGA 2DDBA 1DPRA 1D8KA 2E35A 2WY8Q 2ZXHA 2DU9A 2PJRB 2UXNA 4RBOA 2XASA 1WI3A 3J81Z 1TBXA 3S93A 5HDGA 2K9MA 2H8WA 1TL8A 3OR2C 2GAUA 2F5CA 2COBA 5ICCA 1TWFJ 3DPUA 1JKRC 2MC3A 4X6AJ 1V5FA 1BJAA 4XL9A 2FQ3A 3CJTB 2L9NA 2FQ4A 2DA4A 1ZQ3P 1YQAA 4NC7A 2O9LA 2MGQA 2ZXJA 2NVUB 2KQRA 1Y0UA 1BIAA 3GFJA 3FIWA 4IRIA 1DPUA 3CDIA 4S05A 5HS9A 4V2FA 3U21A 3TL4X 3ULQB 3JR9A
chains in the Genus database with same CATH topology
5E3OA 2NVYJ 1Y1VJ 1RR7A 2LY9A 3O8GA 1GT0C 2E2HJ 5FKOA 1E3OC 1IRZA 3OIOA 1TWCJ 2ME6A 2KT0A 1PUFA 1OCPA 4A3DJ 1ENHA 1OFCX 1RETA 1Z0XA 1ORKA 5C4JJ 1PUFB 1T56A 2GBYA 1H88C 1I50J 3Q3SA 3BTJA 1ETVA 3GTQJ 1AKHB 2NVXJ 2JWTA 3BR6A 2Y30A 5IYDJ 1ETKA 1K61A 2ME0A 2HXOA 4A3LJ 1B8IA 3TP3A 2XRLA 2L7FP 1U9OA 5C44J 1HDDC 2JA6J 5JLXA 2E2JJ 1U8BA 2PMZN 2ZB9A 4X1EA 1IV6A 2XSDC 4A69C 1EF4A 2E1OA 1ETYA 2YS9A 2K9SA 1LE8A 4B4CA 4XRSG 5HODA 3JRIA 2JN6A 4I76A 2AHQA 4FE7A 1WH5A 4DYQA 4FTHA 3DEWA 3SDGA 1JT0A 4D5CA 2X9DA 4XRSA 5DTDA 1YRNA 3K2AA 4M6VA 5C4XJ 3NARA 4M3EA 3S2DJ 4A3IJ 3DCFA 1T33A 3MN2A 3WHCA 4A3JJ 3TW6A 5FKKA 5IYCJ 1ETWA 3HGGA 5M5WJ 1IGNA 1GUUA 4MFEA 1TWHJ 5EYRA 5K7FA 2EBIA 2EZHA 4W97A 2WV1A 3S15J 1SANA 3BQZA 5F08A 4C2MJ 1IJWC 2EZIA 2DA6A 2CUFA 2K9QA 1GV5A 3G1LA 1ITYA 3GTLJ 3BG3A 3UKGA 3B6CA 2R5ZB 3BR3A 4UUSA 2H8RA 2R0QC 1MNMC 3IH2A 5F0CA 1AHDP 4JP0A 4JYKA 3A01B 1IG7A 2O8KA 1B72B 1JUSA 3S1QJ 2M0CA 1QRYA 3O8HA 3M3YJ 3CQZJ 4BXXJ 1UHSA 1P7JA 1H8AC 3CCYA 3FK6A 5J1RA 3JRDA 5M3FJ 4M3BA 4A3EJ 1RESA 3BT9A 3ZQIA 3A02A 3MKLA 1ETXA 2EH3A 2DA7A 3S1NJ 3E7LA 1ZK8A 2FX0A 2XGCA 2H1KA 3BTIA 3BR2A 5FLMJ 4IEJA 4NDLA 3A01A 1H89C 2WAQN 2LTPA 3HOZJ 1HLVA 2HYJA 2DA1A 3HKZN 3TW7A 2Y0SN 2DMTA 2XB5A 2X6OA 4M3DA 1GDTA 1JTXA 3RZDJ 3HDDA 2JMWA 2XB0X 4JX6A 5FKLA 1I3QJ 3RQIA 4S0HB 3IV5A 5EEAA 2M34A 5IYBJ 3IH3A 3GTOJ 5EZHA 5K7HA 2Y9ZA 3BG9A 1JT6A 3Q0WA 2LKXA 3QPLA 4AUXA 3HBLA 2DMPA 1MBHA 3BTLA 5EF6A 2FD5A 2LD5A 3K7AJ 2NS8A 5EGOB 2AO9A 2EZKA 2LLKA 2HXIA 3HOYJ 4UUSB 3HM5A 5GPCA 4MFDA 2L7MP 1MBJA 2R92J 1UMQA 3H0GJ 2P81A 1A5JA 2D5VA 1BA5A 1Z77A 1MH3A 1WPKA 2JJ7A 1TC3C 4W1UA 5EZGA 2DMNA 1NTCA 3JRAA 3ZQFA 3L1PA 4C3HJ 1ZR4A 1SFOJ 2ECBA 1IDYA 2DJNA 2JA8J 3ZQHA 1MBKA 1MBGA 1OJLA 5IP6A 1MSEC 2VUMJ 1Q1VA 4BY7J 4J19A 1JJ6C 5E3MA 4IHVA 1JGGA 3SJMA 3Q0VA 1FTZA 2YU9J 5K7ZA 4DW6A 2XGEA 1MSFC 3LSPA 3ZQLA 4DZPA 4IHYA 3HOVJ 4A3GJ 1LE8B 2HOSA 5IP9J 2R93J 2XPWA 1DU6A 3LOCA 3GTPJ 4AC0A 4BKXA 4XIDA 2HQ5A 1VNDA 1JUPA 2DA5A 4BBSJ 1R9TJ 2OPTA 2B63J 1W0UA 1BJZA 2ID6A 4AYBN 1ZR2A 2L0KA 2XPVA 5FKMA 2O7OA 3F0CA 2CRGA 3OSGA 2ID3A 3CDLA 2HDDA 1F43A 1ZTRA 4EEFG 2DMUA 4A3KJ 1FEXA 2W48A 1AKHA 5FLVA 1HCRA 1RPWA 2NOGA 2CU7A 2LVSA 3S17J 1JKPC 1ETQA 1FTTA 1WGXA 5EG0B 4A3FJ 3CMYA 2XPUA 5F0FA 1DU0A 2LR8A 3BR1A 5C3EJ 4FE4A 2QF7A 3LSGA 4GFBA 5F1JA 4Y7NJ 3BR0A 2X48A 1IUFA 2L9RA 1G2HA 2LP0A 3JRFA 3PO2J 1POGA 3D1NI 4XRMA 3FISA 2M2EA 2M8GX 3S1MJ 2EQRA 1LFBA 1I6HJ 2EZLA 2ELKA 2N8GA 1X2MA 3GTJJ 2TRTA 2G0EA 4MIMA 2TCTA 4XICA 2K9NA 3RZOJ 2E2IJ 1MH4A 3MVPA 4L5EA 2LK2A 2RAEA 4MLOA 1O4XA 3B6AA 1U9NA 1VF9A 4JX5A 4XK4A 4IHWA 2IBDA 5FJ8J 2VKVA 1VFCA 1JTYA 1S7EA 2NS7A 2L7ZA 5M5YJ 3JRCA 5J3LA 4I6ZA 1XG1A 2HI3A 1JKQC 4A3BJ 2MG4A 2Y2ZA 3HOUJ 5J1YA 3S14J 4C3IJ 2R5YB 2QCOA 2XGDA 1FJLA 1OCTC 1BL0A 1U78A 2R5YA 3PO3J 3ZOBA 4CYCB 3GTKJ 1YRNB 4RDUA 2Y31A 2OF7A 3NAUA 2JA7J 3WHBA 3LSRA 3LNQA 3S1RJ 3HOWJ 3GTGJ 1WCMJ 4QIWN 2DA3A 3G1OA 1MBEA 5BNGA 2NVQJ 2M9HA 4B3AA 2FJ1A 2DA2A 5IOZA 1VI0A 4MO7A 2VPRA 5JLWA 2GLOA 3C2BA 4CYCA 4HNVA 1P7IA 4A93J 2NVTJ 4DYRA 3TEDA 1HF0A 2JA5J 1ETOA 1ZKGA 1HOMA 5F27A 1XS9A 3OSFA 3HOXJ 2ECCA 4G12A 5IP7J 2E19A 4M3FA 3BR5A 3BG5A 3ZQGA 1FIAA 4DZJA 1IDZA 1UG2A 1W0TA 2R5ZA 4A3MJ 4FCYA 2YUSA 4UUTA 2CQXA 3ZQCA 2JK3A 3HGYA 4D5FA 1GV2A 3RKQA 3GTMJ 4FISA 4QTRA 4ABZA 5IOYA 3QPSA 1LFUP 2I10A 1BW5A 5M3MJ 5EG0A 1JJ8C 3OOUA 4LOCA 4D7NA 4QSHA 1A6IA 1TWAJ 2CQQA 1APLC 2VI6A 5EGOA 3LSJA 2CUEA 2Y9YA 9ANTA 1JKOC 3I4NJ 1QVUA 1RKWA 1RKTA 2R7ZJ 3SFIA 5M5XJ 1CQTA 3S16J 1WH7A 4C3JJ 5EDNA 2DN0A 4A3CJ 1QVTA 2GM4A 3M4OJ 1NK2P 3I4MJ 2DTZA 1Y1WJ 5E3NA 2K40A 1IC8A 2MSYA 4M3GA 5F04A 3Q0UA 1NK3P 2WB1N 3JREA 1XC5A 1D5YA 1JUMA 2MW8A 2LFBA 3A03A 1QPIA 1X2NA 1HDPA 3FK7A 3HB9A 5E3LA 5DS9A 2CJJA 1B8IB 1F36A 3H3VK 3BTCA 5J1UA 3GBGA 5IPAA 1GVDA 1B72A 2IEKA 4Y52J 1MBFA 3TP0A 3JRGA 4RBOA 1WI3A 3FKIJ 3JRBA 4BBRJ 4JX4A 2IAIA 2VKEA 4D7MA 3G1MA 2COBA 1FIPA 1TWFJ 4DYCA 1BW6A 1JKRC 4BY1J 5F0HA 1TWGJ 2KDZA 3HEFA 4X6AJ 3BQYA 4V2GA 5GPAA 3QQAA 5FKNA 2FQ4A 2DA4A 1ZQ3P 2O9LA 1X58A 2MGQA 1K83J 3PM1A 1ZGWA 5GP9A 2HOTA 1AU7A 3FIWA 2HOAA 3W6VA 4B1RA 3VPRA 4V2FA 2DMQA 4IHXA 3IH4A 3JRHA 3S2HJ 3JR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3O A;  2NVY J;  1Y1V J;  1RR7 A;  2LY9 A;  3O8G A;  1GT0 C;  2E2H J;  5FKO A;  1E3O C;  1IRZ A;  3OIO A;  1TWC J;  2ME6 A;  2KT0 A;  1PUF A;  1OCP A;  4A3D J;  1ENH A;  1OFC X;  1RET A;  1Z0X A;  1ORK A;  5C4J J;  1PUF B;  1T56 A;  2GBY A;  1H88 C;  1I50 J;  3Q3S A;  3BTJ A;  1ETV A;  3GTQ J;  1AKH B;  2NVX J;  2JWT A;  3BR6 A;  2Y30 A;  5IYD J;  1ETK A;  1K61 A;  2ME0 A;  2HXO A;  4A3L J;  1B8I A;  3TP3 A;  2XRL A;  2L7F P;  1U9O A;  5C44 J;  1HDD C;  2JA6 J;  5JLX A;  2E2J J;  1U8B A;  2PMZ N;  2ZB9 A;  4X1E A;  1IV6 A;  2XSD C;  4A69 C;  1EF4 A;  2E1O A;  1ETY A;  2YS9 A;  2K9S A;  1LE8 A;  4B4C A;  4XRS G;  5HOD A;  3JRI A;  2JN6 A;  4I76 A;  2AHQ A;  4FE7 A;  1WH5 A;  4DYQ A;  4FTH A;  3DEW A;  3SDG A;  1JT0 A;  4D5C A;  2X9D A;  4XRS A;  5DTD A;  1YRN A;  3K2A A;  4M6V A;  5C4X J;  3NAR A;  4M3E A;  3S2D J;  4A3I J;  3DCF A;  1T33 A;  3MN2 A;  3WHC A;  4A3J J;  3TW6 A;  5FKK A;  5IYC J;  1ETW A;  3HGG A;  5M5W J;  1IGN A;  1GUU A;  4MFE A;  1TWH J;  5EYR A;  5K7F A;  2EBI A;  2EZH A;  4W97 A;  2WV1 A;  3S15 J;  1SAN A;  3BQZ A;  5F08 A;  4C2M J;  1IJW C;  2EZI A;  2DA6 A;  2CUF A;  2K9Q A;  1GV5 A;  3G1L A;  1ITY A;  3GTL J;  3BG3 A;  3UKG A;  3B6C A;  2R5Z B;  3BR3 A;  4UUS A;  2H8R A;  2R0Q C;  1MNM C;  3IH2 A;  5F0C A;  1AHD P;  4JP0 A;  4JYK A;  3A01 B;  1IG7 A;  2O8K A;  1B72 B;  1JUS A;  3S1Q J;  2M0C A;  1QRY A;  3O8H A;  3M3Y J;  3CQZ J;  4BXX J;  1UHS A;  1P7J A;  1H8A C;  3CCY A;  3FK6 A;  5J1R A;  3JRD A;  5M3F J;  4M3B A;  4A3E J;  1RES A;  3BT9 A;  3ZQI A;  3A02 A;  3MKL A;  1ETX A;  2EH3 A;  2DA7 A;  3S1N J;  3E7L A;  1ZK8 A;  2FX0 A;  2XGC A;  2H1K A;  3BTI A;  3BR2 A;  5FLM J;  4IEJ A;  4NDL A;  3A01 A;  1H89 C;  2WAQ N;  2LTP A;  3HOZ J;  1HLV A;  2HYJ A;  2DA1 A;  3HKZ N;  3TW7 A;  2Y0S N;  2DMT A;  2XB5 A;  2X6O A;  4M3D A;  1GDT A;  1JTX A;  3RZD J;  3HDD A;  2JMW A;  2XB0 X;  4JX6 A;  5FKL A;  1I3Q J;  3RQI A;  4S0H B;  3IV5 A;  5EEA A;  2M34 A;  5IYB J;  3IH3 A;  3GTO J;  5EZH A;  5K7H A;  2Y9Z A;  3BG9 A;  1JT6 A;  3Q0W A;  2LKX A;  3QPL A;  4AUX A;  3HBL A;  2DMP A;  1MBH A;  3BTL A;  5EF6 A;  2FD5 A;  2LD5 A;  3K7A J;  2NS8 A;  5EGO B;  2AO9 A;  2EZK A;  2LLK A;  2HXI A;  3HOY J;  4UUS B;  3HM5 A;  5GPC A;  4MFD A;  2L7M P;  1MBJ A;  2R92 J;  1UMQ A;  3H0G J;  2P81 A;  1A5J A;  2D5V A;  1BA5 A;  1Z77 A;  1MH3 A;  1WPK A;  2JJ7 A;  1TC3 C;  4W1U A;  5EZG A;  2DMN A;  1NTC A;  3JRA A;  3ZQF A;  3L1P A;  4C3H J;  1ZR4 A;  1SFO J;  2ECB A;  1IDY A;  2DJN A;  2JA8 J;  3ZQH A;  1MBK A;  1MBG A;  1OJL A;  5IP6 A;  1MSE C;  2VUM J;  1Q1V A;  4BY7 J;  4J19 A;  1JJ6 C;  5E3M A;  4IHV A;  1JGG A;  3SJM A;  3Q0V A;  1FTZ A;  2YU9 J;  5K7Z A;  4DW6 A;  2XGE A;  1MSF C;  3LSP A;  3ZQL A;  4DZP A;  4IHY A;  3HOV J;  4A3G J;  1LE8 B;  2HOS A;  5IP9 J;  2R93 J;  2XPW A;  1DU6 A;  3LOC A;  3GTP J;  4AC0 A;  4BKX A;  4XID A;  2HQ5 A;  1VND A;  1JUP A;  2DA5 A;  4BBS J;  1R9T J;  2OPT A;  2B63 J;  1W0U A;  1BJZ A;  2ID6 A;  4AYB N;  1ZR2 A;  2L0K A;  2XPV A;  5FKM A;  2O7O A;  3F0C A;  2CRG A;  3OSG A;  2ID3 A;  3CDL A;  2HDD A;  1F43 A;  1ZTR A;  4EEF G;  2DMU A;  4A3K J;  1FEX A;  2W48 A;  1AKH A;  5FLV A;  1HCR A;  1RPW A;  2NOG A;  2CU7 A;  2LVS A;  3S17 J;  1JKP C;  1ETQ A;  1FTT A;  1WGX A;  5EG0 B;  4A3F J;  3CMY A;  2XPU A;  5F0F A;  1DU0 A;  2LR8 A;  3BR1 A;  5C3E J;  4FE4 A;  2QF7 A;  3LSG A;  4GFB A;  5F1J A;  4Y7N J;  3BR0 A;  2X48 A;  1IUF A;  2L9R A;  1G2H A;  2LP0 A;  3JRF A;  3PO2 J;  1POG A;  3D1N I;  4XRM A;  3FIS A;  2M2E A;  2M8G X;  3S1M J;  2EQR A;  1LFB A;  1I6H J;  2EZL A;  2ELK A;  2N8G A;  1X2M A;  3GTJ J;  2TRT A;  2G0E A;  4MIM A;  2TCT A;  4XIC A;  2K9N A;  3RZO J;  2E2I J;  1MH4 A;  3MVP A;  4L5E A;  2LK2 A;  2RAE A;  4MLO A;  1O4X A;  3B6A A;  1U9N A;  1VF9 A;  4JX5 A;  4XK4 A;  4IHW A;  2IBD A;  5FJ8 J;  2VKV A;  1VFC A;  1JTY A;  1S7E A;  2NS7 A;  2L7Z A;  5M5Y J;  3JRC A;  5J3L A;  4I6Z A;  1XG1 A;  2HI3 A;  1JKQ C;  4A3B J;  2MG4 A;  2Y2Z A;  3HOU J;  5J1Y A;  3S14 J;  4C3I J;  2R5Y B;  2QCO A;  2XGD A;  1FJL A;  1OCT C;  1BL0 A;  1U78 A;  2R5Y A;  3PO3 J;  3ZOB A;  4CYC B;  3GTK J;  1YRN B;  4RDU A;  2Y31 A;  2OF7 A;  3NAU A;  2JA7 J;  3WHB A;  3LSR A;  3LNQ A;  3S1R J;  3HOW J;  3GTG J;  1WCM J;  4QIW N;  2DA3 A;  3G1O A;  1MBE A;  5BNG A;  2NVQ J;  2M9H A;  4B3A A;  2FJ1 A;  2DA2 A;  5IOZ A;  1VI0 A;  4MO7 A;  2VPR A;  5JLW A;  2GLO A;  3C2B A;  4CYC A;  4HNV A;  1P7I A;  4A93 J;  2NVT J;  4DYR A;  3TED A;  1HF0 A;  2JA5 J;  1ETO A;  1ZKG A;  1HOM A;  5F27 A;  1XS9 A;  3OSF A;  3HOX J;  2ECC A;  4G12 A;  5IP7 J;  2E19 A;  4M3F A;  3BR5 A;  3BG5 A;  3ZQG A;  1FIA A;  4DZJ A;  1IDZ A;  1UG2 A;  1W0T A;  2R5Z A;  4A3M J;  4FCY A;  2YUS A;  4UUT A;  2CQX A;  3ZQC A;  2JK3 A;  3HGY A;  4D5F A;  1GV2 A;  3RKQ A;  3GTM J;  4FIS A;  4QTR A;  4ABZ A;  5IOY A;  3QPS A;  1LFU P;  2I10 A;  1BW5 A;  5M3M J;  5EG0 A;  1JJ8 C;  3OOU A;  4LOC A;  4D7N A;  4QSH A;  1A6I A;  1TWA J;  2CQQ A;  1APL C;  2VI6 A;  5EGO A;  3LSJ A;  2CUE A;  2Y9Y A;  9ANT A;  1JKO C;  3I4N J;  1QVU A;  1RKW A;  1RKT A;  2R7Z J;  3SFI A;  5M5X J;  1CQT A;  3S16 J;  1WH7 A;  4C3J J;  5EDN A;  2DN0 A;  4A3C J;  1QVT A;  2GM4 A;  3M4O J;  1NK2 P;  3I4M J;  2DTZ A;  1Y1W J;  5E3N A;  2K40 A;  1IC8 A;  2MSY A;  4M3G A;  5F04 A;  3Q0U A;  1NK3 P;  2WB1 N;  3JRE A;  1XC5 A;  1D5Y A;  1JUM A;  2MW8 A;  2LFB A;  3A03 A;  1QPI A;  1X2N A;  1HDP A;  3FK7 A;  3HB9 A;  5E3L A;  5DS9 A;  2CJJ A;  1B8I B;  1F36 A;  3H3V K;  3BTC A;  5J1U A;  3GBG A;  5IPA A;  1GVD A;  1B72 A;  2IEK A;  4Y52 J;  1MBF A;  3TP0 A;  3JRG A;  4RBO A;  1WI3 A;  3FKI J;  3JRB A;  4BBR J;  4JX4 A;  2IAI A;  2VKE A;  4D7M A;  3G1M A;  2COB A;  1FIP A;  1TWF J;  4DYC A;  1BW6 A;  1JKR C;  4BY1 J;  5F0H A;  1TWG J;  2KDZ A;  3HEF A;  4X6A J;  3BQY A;  4V2G A;  5GPA A;  3QQA A;  5FKN A;  2FQ4 A;  2DA4 A;  1ZQ3 P;  2O9L A;  1X58 A;  2MGQ A;  1K83 J;  3PM1 A;  1ZGW A;  5GP9 A;  2HOT A;  1AU7 A;  3FIW A;  2HOA A;  3W6V A;  4B1R A;  3VPR A;  4V2F A;  2DMQ A;  4IHX A;  3IH4 A;  3JRH A;  3S2H J;  3JR9 A; 
#chains in the Genus database with same CATH topology
 2ZC2 A;  1Y1V J;  3RKY A;  4F3Q A;  4AVZ A;  1T2K A;  3GZ5 A;  1H9G A;  1IO2 A;  2DFE A;  2KP6 A;  3HSR A;  5FKO A;  2ZJP F;  1E3O C;  3VYR B;  2HPM A;  4JOM A;  3HHH A;  3LSK A;  1J59 A;  1DDN A;  3ABM H;  1PUF A;  2ZME A;  4A3D J;  5BPI A;  4GCV A;  1OFC X;  1R22 A;  1Z0X A;  4KN4 X;  5C4J J;  2PJR A;  2RC4 A;  1LQ1 A;  1AKH B;  4GO1 A;  2NVX J;  2JWT A;  4MTD A;  2TDX A;  3LST A;  3JAM K;  3M3Y J;  1HSJ A;  3GO5 A;  1PUE E;  5IYD J;  4B09 A;  2P5K A;  3K4C A;  2KKO A;  1SAX A;  2V26 A;  3KEO A;  1W7P D;  1B8I A;  3RQ4 A;  1WKM A;  1Y6I A;  2XRL A;  3R6S A;  3ZCO A;  4BE1 A;  2D2W A;  4XLF A;  1U8B A;  4EAT A;  2ZB9 A;  3EUK L;  2BHY A;  4X1E A;  3CJQ B;  3DTE A;  4IKF A;  4A69 C;  2E1O A;  1ETY A;  3H9Q A;  3SDB A;  1IRG A;  3JRI A;  2E1N A;  4FE7 A;  1WH5 A;  4KMU X;  4FTH A;  2EFN A;  2NAZ A;  3MAJ A;  4XRF A;  3SDG A;  4D5C A;  2X9D A;  1GXP A;  3E6D A;  3NRV A;  4U0Y A;  1JI8 A;  4M6V A;  3ZMZ A;  3RPU A;  1XD7 A;  3QOP A;  2L9S A;  4BQO A;  2EFQ A;  3T8T A;  1T33 A;  3MN2 A;  3LQR A;  4A3J J;  2EV0 A;  3TW6 A;  1FP1 D;  2W85 A;  4BDZ A;  3I59 B;  5ICE A;  3F21 A;  1FOK A;  2BY3 A;  5FKK A;  1Z6R A;  3HJE A;  5IYC J;  1R4N B;  1D0X A;  1ETW A;  3A1Y A;  3GZN B;  3HUG A;  3QYF A;  5EYR A;  2R4G A;  4ZH4 F;  1X1D A;  5K7F A;  4W97 A;  5D5W B;  3S15 J;  3E5Q A;  5ILU A;  4C2M J;  2CUF A;  1ITY A;  3DBH B;  5E8I A;  1T0F C;  4Y4R A;  2F48 A;  1G3T A;  3GTL J;  3PNV A;  1Y8R B;  1DQU A;  4N4N B;  3N4M A;  3BR3 A;  1PYV A;  3GF2 A;  2E5N A;  3DF8 A;  3C2G A;  2R0Q C;  1MZB A;  3IH2 A;  1E17 A;  1GHC A;  3K70 C;  3DKY A;  3MFK A;  2JQ7 A;  4B44 A;  4AVP A;  1AHD P;  3F72 A;  2RGV A;  2V1U A;  1R5G A;  4EJO A;  1JUS A;  2R7Q A;  2H09 A;  3E5X A;  3P9K A;  4U0V A;  3CQZ J;  2E7X A;  3NQO A;  4G6T B;  2VQH A;  4XNF A;  2R3S A;  3OYK A;  4BXX J;  3WTU C;  1A36 A;  3VYS B;  1S7O A;  4KIT B;  1G3Y A;  3CCY A;  2B9S A;  1W7P A;  3JRD A;  4YRV A;  5M3F J;  4M3B A;  2GQQ A;  3K0L A;  3ZQI A;  3CCR I;  3HG9 A;  3HUG B;  3MKL A;  4V19 K;  3B02 A;  2LY1 A;  1BI3 A;  2BYV E;  2GA1 A;  2GOM A;  2WBM A;  1SFX A;  3E7L A;  3M7G A;  1PDN C;  2M30 A;  5E1W A;  2XDV A;  2DT6 A;  3BR2 A;  3KP7 A;  2KZG A;  4NDL A;  5FLM J;  4Q47 A;  1H89 C;  2WAQ N;  4XLA A;  1HLV A;  3A0H C;  3DLL F;  2RDP A;  3TW7 A;  5J8C A;  4IRG A;  3KP3 A;  2V7F A;  2HTS A;  3V7R A;  4JX6 A;  3RQI A;  5IYB J;  3IH3 A;  2FBH A;  2CQK A;  5K7H A;  5ILV A;  1JT6 A;  2CQ7 A;  2A6H F;  2VON A;  2R7V A;  1MKM A;  3QPL A;  4XN3 A;  5DYM A;  5HLG A;  5D6F A;  4PUS A;  3HBL A;  1P6R A;  1WJE A;  3SZP A;  2ETH A;  4FHT A;  4E4H A;  1R49 A;  2NNN A;  2IXS A;  1YX3 A;  2DK8 A;  2KPM A;  2LLK A;  5DD8 A;  4IO9 F;  1IF1 A;  1FYM A;  5GPC A;  3MWM A;  2HDC A;  2R92 J;  1VQN I;  2P81 A;  3HHG A;  2IS1 A;  3C7J A;  5JR3 A;  1R1V A;  2XF6 A;  5FRM A;  2IA2 A;  3L2V A;  2JUC A;  3EDP A;  2F5F A;  3LMM A;  1WJC A;  4W1U A;  4ZZL A;  1QHH D;  3PFI A;  2ESN A;  4RLF A;  3AL0 B;  3EUH A;  4LG0 B;  4WCG A;  2K02 A;  2VOD A;  4HBL A;  1IDY A;  4PK4 A;  2AXL A;  1S5L C;  3PNT A;  3IP4 B;  2CW7 A;  1EH6 A;  3G2B A;  1MSE C;  2FE3 A;  3GWZ A;  3R60 A;  1Q1V A;  4HNU A;  3DEE A;  3HC7 A;  3K4J A;  4RGS A;  4J19 A;  2E1C A;  4GDF A;  1I6X A;  1JJ6 C;  5EEG A;  4IHV A;  4PGH A;  2IRF G;  1JGG A;  2A05 A;  3OYN A;  1GLN A;  2EK5 A;  3SJM A;  1FTZ A;  1NG6 A;  1D1A A;  3LSP A;  1HW1 A;  1WZ2 A;  2M45 A;  1RR8 C;  4DZP A;  4OMZ A;  5CLS A;  1LE8 B;  2OTJ I;  3GTP J;  3A4C A;  4BKX A;  2Y69 H;  4ZTF A;  2XAQ A;  1FBQ A;  1XMA A;  2CFX A;  3CP2 A;  1UEL B;  2HU9 A;  2R7F A;  2ELJ A;  1BJZ A;  4AYB N;  4XOT A;  3CMM A;  1S7A A;  3PJR A;  2VJ4 A;  4ZDL A;  1YX5 A;  1P4W A;  1ZTR A;  2W48 A;  2F2E A;  2NNY A;  5FLV A;  2MD0 A;  1MDM B;  2M8E A;  1KU3 A;  4GYG A;  3ZP5 A;  2O0Y A;  1ETQ A;  1WGX A;  3FXJ A;  4LJZ F;  5EG0 B;  3VOD A;  2XPU A;  2QM3 A;  4YFN F;  2LR8 A;  2D45 A;  3LSG A;  3CCQ I;  2GXG A;  3GFM A;  1PJR A;  4Y7N J;  3BR0 A;  4YFX F;  4EJT A;  1IUF A;  4XSZ F;  3RYR A;  1Z7U A;  4D0P A;  1POG A;  3D1N I;  2E34 A;  2A68 F;  4NBQ A;  1Z9C A;  3IRQ A;  3IHU A;  2OBP A;  1ZH5 A;  1RUN A;  2Q2E A;  1N78 A;  1X1B A;  4BQQ A;  1SVM A;  4F92 B;  1ZG1 A;  1X1A A;  2OCE A;  3J7A O;  4PJN A;  3E3V A;  2BHZ A;  2L01 A;  2ZNY A;  2O6G E;  1BI0 A;  3ERE D;  3A2K A;  1LNW A;  1UHW A;  3JW4 A;  2TCT A;  2LF8 A;  2QZ8 A;  4EVI A;  4DOZ A;  1KYW A;  3F8B A;  1O4X A;  3KZZ A;  2M5W A;  1U9N A;  5CQE A;  4E7S A;  4IHW A;  2IBD A;  5LBQ A;  2W25 A;  1HW2 A;  1X1P A;  4CCL A;  5M5Y J;  4I6Z A;  1JKQ C;  1XG1 A;  1MMS A;  3WTX C;  1Z05 A;  2NS0 A;  4LD5 A;  3S14 J;  1OQY A;  2QVO A;  3KP5 A;  2QCO A;  3I54 A;  1TQM A;  1R5H A;  2HYG D;  2VAS A;  1ZG5 A;  1FJL A;  1B1B A;  2V9K A;  3ZMT A;  4ENJ A;  3LA7 A;  3TO6 A;  3BWG A;  1U78 A;  2MD5 A;  2R5Y A;  3ZOB A;  4CYC B;  3F8C A;  1CF7 B;  4IOC F;  4RGR A;  2V6C A;  4CDG A;  2XUB A;  2OF7 A;  3CCE I;  4G8X A;  5A2Q K;  3WHB A;  3LNQ A;  3OYE A;  3S1R J;  3D0S A;  1S72 I;  1OMI A;  4QIW N;  2XGX A;  3RKW A;  2VBZ A;  2VBY A;  3BJ6 A;  5BNG A;  4CGZ A;  2O03 A;  1MMN A;  3IUO A;  3DBL B;  4QPO A;  2A6E F;  2CH0 A;  2DQR A;  4HAM A;  3F9K A;  3HOS A;  2GLO A;  2B0L A;  4XR6 A;  2EJR A;  3K4B A;  1P7I A;  4A93 J;  2F4I A;  1WVR A;  1HQC A;  3ML6 A;  4OAZ A;  1R36 A;  1HF0 A;  2JA5 J;  3P5J A;  3RPU D;  5F27 A;  2ECC A;  3H92 A;  4G12 A;  5LGT A;  5DCM B;  1P92 A;  2DBB A;  3BR5 A;  3ZQG A;  4HEA 2;  1IDZ A;  2P8T A;  1SVO A;  2Z3Y A;  2PQ8 A;  2KMU A;  3I58 A;  2OTL I;  2R7S A;  3OYG A;  3ZN1 A;  1D3Y A;  3FXQ A;  4A6E A;  3G73 A;  3ZQC A;  4P1W A;  3KYL A;  2L9V A;  6PAX A;  2O61 A;  4DBQ A;  2FSW A;  4FIS A;  3ZGK A;  2KL4 A;  2IGO A;  2Q0O A;  2I10 A;  1BW5 A;  1FWZ A;  5FB2 A;  2JVG A;  2RVC A;  3CMA I;  2ZCW A;  2HVR A;  2BEO A;  4LOC A;  4QSH A;  4CCO A;  4IVN A;  4L9N A;  1A6I A;  1STZ A;  3LSJ A;  4BXF A;  3I5U A;  2VC0 A;  1JKO C;  1X3U A;  2G7H A;  3AKZ A;  3P7N A;  3QPT A;  3SFI A;  4TV7 A;  5M5X J;  3L2U A;  2RN7 A;  4ZDP A;  3M07 A;  3ISP A;  1QVT A;  4HV5 A;  5E79 C;  1Y1W J;  1GXQ A;  1YYV A;  3L7W A;  5E3N A;  4EGY A;  3OL4 A;  2VE9 A;  4XKV A;  4UNO A;  2ZO4 A;  3KEY A;  2FBI A;  1NK3 P;  4CYD A;  4Y17 A;  5E1X A;  4Y13 A;  3QYB A;  3A03 A;  1QPI A;  3F8F A;  3E97 A;  1HDP A;  5TJJ A;  4G94 A;  5TGT A;  2O5R A;  5KK1 A;  3G6E I;  5E3L A;  4Q5S F;  3DXJ F;  4HF2 A;  4C30 A;  2IP2 A;  2IEK A;  3DPL C;  4Y52 J;  1P4X A;  2HOE A;  2L5Q A;  3AG4 H;  2RKH A;  2QLZ A;  5KCM A;  3TP0 A;  4HYE A;  2HWV A;  1J5Y A;  3CC4 I;  3JRB A;  3CC7 I;  4OWR B;  3M8J A;  4BE0 A;  3GXO A;  4BBR J;  2IAI A;  1WJA A;  3GUD A;  3S3M A;  4BYY A;  3BCA A;  1WFX A;  2BW3 A;  2HFH A;  4DYC A;  2VKD A;  5L3F A;  1TWG J;  3HEF A;  2F5E A;  4V2G A;  4LLG F;  2JSC A;  2Y48 A;  2BY2 A;  2P6S A;  3I4P A;  3QQA A;  1JXS A;  2Z9O A;  3PL8 A;  2EA2 A;  3KEQ A;  2V9P A;  1LVK A;  3PM1 A;  1ZGW A;  4XOR A;  2HOA A;  1I1S A;  2CWE A;  3VPR A;  5B1A H;  1R00 A;  4XLP F;  2VE8 A;  2VBW A;  1A6Q A;  4L9J A;  4IHX A;  3DWL E;  2H1L A;  2ZXW H;  3BG6 A;  1BA5 A;  1PP8 F;  4H0E A;  2P4W A;  1YJ9 I;  4DIQ A;  1MIJ A;  1H0M A;  1TNS A;  2KHM A;  1XSV A;  2QWW A;  2JA2 A;  2EIJ H;  3Q9V A;  1FZP B;  3OIO A;  3GEZ A;  5TRD A;  3K4K A;  3JAM Z;  4ZDO A;  1W5T A;  2PMU A;  2K3P A;  2XRN A;  3K2Z A;  4F91 B;  1PUF B;  2QKL B;  2GBY A;  1K6Y A;  3MKY B;  2EIL H;  1I50 J;  3QOE A;  2K86 A;  2IPQ X;  2M4K A;  4KIS A;  1O3S A;  1OYY A;  3GTQ J;  1OCO H;  3V8J A;  4GXO A;  3TDU C;  1XGN A;  3BR6 A;  4D1Q A;  4KIB A;  2LC2 A;  1ETK A;  4HX8 A;  4RB0 A;  3HPH A;  4RM2 A;  3HRS A;  2ME0 A;  4CA0 A;  5L3C A;  3FHZ A;  2RQQ A;  1J0R A;  1O3T A;  3HKZ A;  4LG3 A;  3TP3 A;  4BS9 A;  5HNH A;  2L7F P;  1UG0 A;  3PQJ A;  3J80 K;  5C44 J;  2HPI A;  1YJN I;  2X85 A;  5JLX A;  1QNT A;  2YS9 A;  2RNG A;  4L9T A;  3WTW C;  4KNY A;  4B4C A;  4XRS G;  5HOD A;  2UZK A;  2AHQ A;  1S29 A;  2HZT A;  4DYQ A;  1AA7 A;  4ENK A;  4Y3O A;  2JRT A;  1I1G A;  2CO5 A;  3TO9 A;  4XRS A;  2ZSI B;  5LHG A;  2HEO A;  2QQ9 A;  3TOA A;  3ZPL A;  2R7X A;  3CCL I;  1T8I A;  3KZI C;  4M3E A;  1KGS A;  4EM1 A;  4A3I J;  1EJ9 A;  4BAY A;  1RC9 A;  3WHC A;  1D0Z A;  2CW0 F;  4PZJ A;  1IXC A;  3EUA A;  5B1B H;  1I39 A;  4MFE A;  1TWH J;  4BHB A;  1O3Q A;  4BH9 A;  1TT0 A;  2WV1 A;  3IAS 2;  3BQZ A;  3FXU A;  1ZAO A;  2FOK A;  3ABU A;  2VXD A;  1V4R A;  1GV5 A;  3G1L A;  4PJ0 C;  2ESH A;  1WRJ A;  4A0Z A;  1Z3Y A;  3IAM 2;  1R58 A;  4BE2 A;  2R5Z B;  3J7A Y;  5CVI A;  3VYT B;  4RAG A;  1VQ5 I;  4KN7 X;  3T0Y A;  2H8R A;  1YW9 A;  5CQG A;  4KMF A;  4M74 A;  2YSR A;  3S3N A;  1T0F A;  1S6L A;  5F1R A;  3A01 B;  1QU3 A;  5LLQ A;  2PN6 A;  3RI4 A;  1MD0 A;  4BEH A;  3D5R C;  1UJ8 A;  1X1C A;  4EV0 A;  3CP8 A;  5L3D A;  1U5T A;  1SEU A;  1H8A C;  4BJ5 C;  1EV7 A;  2Q1Z B;  3FK6 A;  1XGO A;  3DU5 A;  3W2V A;  1LEA A;  2VJ5 A;  2M1B A;  3A02 A;  3LAJ A;  3KP4 A;  3MKW B;  2KIF A;  2LRD A;  4P96 A;  1SMT A;  2DOE A;  2L4M A;  2A3S A;  2JRM A;  3OL3 A;  5FD5 A;  4ENM A;  3MZY A;  3HPG A;  1DGW Y;  3BC8 A;  2XGC A;  4G6Q A;  2DQL A;  4CSW A;  2FUG 2;  1Q1H A;  1WHU A;  1R1U A;  1OYI A;  5LD2 C;  1QO0 D;  3P9I A;  2LTP A;  5J6X A;  3DTK A;  2DA1 A;  4Q4Z F;  2QBY A;  1MMA A;  2MLG A;  1MJB A;  3FHN A;  2VT2 A;  2XB5 A;  1GDT A;  4A6D A;  2K27 A;  3RZD J;  2JMW A;  2G7U A;  2Z99 A;  3VEP A;  4S0H B;  4IQ4 A;  5EEA A;  2STW A;  3OIQ A;  5EZH A;  4ESF A;  3RKX A;  1F1Z A;  2OQG A;  2OQR A;  2W4S A;  5J4Y A;  1D5V A;  3Q0W A;  3IKV A;  1DP7 P;  3KLN A;  3JTH A;  3RIR A;  2KRC A;  4EJU A;  2KJC A;  5EF6 A;  4G7H F;  2PMH A;  1V5G A;  3M1E A;  3TOB A;  3PQK A;  3KP2 A;  3AG1 H;  4HDU A;  2HYF A;  3OV8 A;  1LVA A;  2BV6 A;  5DCM A;  5EGO B;  2ZJQ F;  2EZK A;  1FLI A;  3QP6 A;  2JVH A;  3I3L A;  2F5D A;  2MH9 A;  1BN5 A;  1G6N A;  3MD2 A;  4E7K A;  1UMQ A;  1C0W A;  2OUM A;  3O6B B;  3SZG A;  3OYH A;  3ONQ A;  1RIO H;  1G3W A;  1Z77 A;  2XAF A;  1WPK A;  3E5U A;  3LA3 A;  1T08 B;  2A07 F;  3TKY A;  1QHG A;  1YI2 I;  4XKW A;  2DOD A;  2JJ7 A;  3GVA A;  4XLN F;  1SAU A;  1NTC A;  2K85 A;  3CCJ I;  1R7J A;  4IRH A;  3OWT A;  4IOA F;  1NHA A;  5JFR A;  2ECB A;  1FC3 A;  1S8N A;  1SFO J;  1MMG A;  5LHH A;  2W1O A;  4WXD A;  1R1T A;  2P0W A;  3W2A A;  2JA8 J;  3ZQH A;  2AQF A;  3SQN A;  1MBK A;  1OJL A;  2PFB A;  4HF0 A;  5B5E C;  2VUM J;  2A69 F;  4BY7 J;  3BG7 A;  4FX0 A;  3QU6 A;  3S3O A;  5E3M A;  1TQP A;  4GYI A;  1KU7 A;  1RUO A;  2IS4 A;  2QUF A;  4Z2Y A;  3CCS I;  3Q0V A;  2VPL A;  1N75 A;  2BE5 F;  5H6R A;  2HGC A;  1TNT A;  3TMO A;  4IHY A;  5IP9 J;  3FDY A;  4I99 C;  4HQE A;  1YJW I;  1MGT A;  3BZK A;  1VND A;  2HQ5 A;  1IN6 A;  1JUP A;  1ZGA A;  4LLN A;  5L3B A;  2OPT A;  1PVE A;  2L0K A;  4B8X A;  2XPV A;  3K1N A;  2CUJ A;  5FKM A;  2KRF A;  3F0C A;  2CRG A;  1EA3 A;  3OSG A;  2J5O A;  4G7O F;  2ID3 A;  4EEF G;  4NQW B;  4A3K J;  1FEX A;  1BOB A;  1R5I D;  4N4O B;  4I98 B;  3H9J A;  2CU7 A;  2MC4 A;  2I5U A;  1ZRE A;  1OLT A;  3S17 J;  1ZEL A;  1FTT A;  5LRR A;  4LB5 A;  3QOD A;  3CMY A;  3BR1 A;  5GAE J;  4YIF A;  4GFB A;  4ESB A;  5F1J A;  3E6M A;  4L0Z B;  3FX3 A;  1W4M A;  2XAJ A;  1MNE A;  4YII A;  4BU2 A;  3JRF A;  3VOE A;  5GAD J;  4I7H A;  5FGM A;  3DV8 A;  1KQ8 A;  2M2E A;  2M8G X;  2EQR A;  1LFB A;  2W84 A;  2EFP A;  3BZC A;  3IC7 A;  2X1C A;  3E6C C;  5H6Q A;  2A5W A;  4ZC3 A;  4LGW A;  1X2M A;  3LSI A;  3BPV A;  2DPU A;  4M71 A;  3AG3 H;  2O8X A;  3WTY C;  5LEJ A;  2F4M B;  3PUF A;  3QU3 A;  2WB1 A;  3IRR A;  2CW8 A;  1ZN2 A;  4O3M A;  4L5E A;  3WU0 A;  4HST A;  4I0A A;  3PNY A;  3CUO A;  3SFZ A;  5K5R A;  5BQT A;  2DI3 A;  1D8J A;  2IJL A;  1OPC A;  1G59 A;  2JPC A;  3GFL A;  3VSK A;  4LB6 B;  5FJ8 J;  4PSX A;  4E7I A;  1FY7 A;  4RB2 C;  2Z33 A;  2L7Z A;  2DDA A;  2HI3 A;  3HOU J;  1D1B A;  5J1Y A;  4C3I J;  1FBS A;  5HS8 A;  2LNB A;  4MQV A;  5KAI C;  1UFM A;  3SEQ A;  4YEJ A;  3PO3 J;  3GTK J;  3QP5 A;  2X1E A;  1DGR M;  3WE3 A;  3JCU C;  3UR3 C;  2DLL A;  3GLL A;  3LSR A;  3KZY A;  4CCN A;  3GTG J;  5IT9 K;  1U8R A;  5B3S H;  3CJR B;  5FFX A;  1TQI A;  1ZG3 A;  2L02 A;  1LEB A;  1ON1 A;  5IY5 H;  4XKB A;  2M9H A;  4B3A A;  2XAH A;  1ERD A;  2A6T A;  3CUQ A;  3SXY A;  5IOZ A;  4S04 A;  4EM0 B;  2GZW A;  1IXS B;  2OD5 A;  1FX7 A;  2EPF A;  2VPR A;  2QBY B;  4XSX F;  2I8D A;  2KRH A;  4GGG A;  4DYR A;  5E18 F;  3V8L A;  2V6E A;  1HOM A;  3OSF A;  1IV8 A;  2IA1 A;  3HOX J;  3DQV C;  2EFO A;  4BNC A;  3S2W A;  1KON A;  2WAF A;  2QYO A;  1BIB A;  4IF4 A;  3BG5 A;  1FIA A;  2VJJ A;  2DYR H;  3WE2 A;  2C6Y A;  3CME I;  2YUS A;  1JHF A;  4UUT A;  3V7C A;  2VL8 A;  4KJZ A;  2GOX B;  3ZMU A;  4F55 A;  1TW2 A;  4RM3 A;  5LGN A;  4MTE A;  3WG7 H;  5ICG A;  1IZ1 A;  3FXR A;  4FX4 A;  4ZJZ A;  3D5S C;  5IOY A;  2QEN A;  3IWZ A;  3LSM A;  2RV8 A;  4PSW A;  1LFU P;  2LKS A;  3H3Z A;  4M9X A;  2BY1 A;  4PGG A;  3I64 A;  4CZC A;  3LSH A;  3S8P A;  4D7N A;  4CO8 A;  3FZV A;  3MCZ A;  4EQQ A;  1TWA J;  2CQQ A;  1VQ7 I;  1EH7 A;  2VI6 A;  3U2R A;  2CUE A;  2VQL A;  1YOV B;  2L4A A;  2Y9Y A;  3K4N A;  4EM2 A;  9ANT A;  5K1Y A;  1QVU A;  4E7L A;  4CUG A;  1MW7 A;  3K4M A;  2Z16 A;  4MEY F;  3WU2 C;  2Z5U A;  4KYW A;  1CQT A;  3S16 J;  3FXO A;  2R7O A;  3CF2 A;  3KP6 A;  4C3J J;  5JVT A;  1NK2 P;  3B73 A;  4OIN F;  3LFK A;  2LSO A;  4HNT A;  3KYD B;  2KJB A;  1VQ4 I;  4ON0 A;  2KIQ A;  4I09 A;  3OR1 C;  3DP7 A;  1JUM A;  1Y8Q B;  3M9A A;  4KA4 A;  4XMY A;  5A2Q Z;  1X2N A;  1IN7 A;  2LBF B;  3ZR8 X;  3FK7 A;  2CJJ A;  2BZT A;  4MGR A;  1WJ5 A;  2WTE A;  1I3A A;  4WXC A;  5AIQ A;  3J81 K;  2VKH A;  5J1U A;  1B72 A;  1A04 A;  1Z7L A;  4UXN A;  1MBF A;  5D8L B;  4UV9 A;  2G9W A;  3G3Z A;  2ZFU A;  3DBR B;  4KT5 C;  4Z6Y A;  3JRG A;  2UUZ A;  1Z91 A;  3ASO H;  1SMY F;  1LUJ B;  2W82 A;  1J2X A;  4JX4 A;  2XF7 A;  4BHP A;  4D7M A;  3G1M A;  4RA2 A;  5DD4 A;  1XCB A;  2JT1 A;  3VSL A;  3WOD F;  3ERM A;  1S3J A;  3SHF A;  4AU7 A;  4BY1 J;  5F0H A;  2KDZ A;  1HXD A;  3BQY A;  3CF5 F;  2W00 A;  2OJE D;  2IVM A;  4HQM A;  5FKN A;  2DFI A;  4BEH B;  3ZXS A;  2HZD A;  1G8X A;  4N9I A;  4OIR F;  2LDU A;  2MBF A;  3C3W A;  1UST A;  3W3C A;  4HLY A;  2DMQ A;  4RAZ A;  3JRH A;  3S2H J;  4EMS A;  2NVY J;  3FM3 A;  5D8K B;  3WTT C;  4QPQ A;  3KIO A;  1GT0 C;  3C1D A;  4JK1 X;  2DYS H;  2XHK A;  1K78 B;  4UVC A;  2ZJ2 A;  2ME6 A;  5E17 F;  2KT0 A;  2HVQ A;  3CCV I;  3D5L A;  1RRJ A;  3R0A A;  4I02 A;  1RET A;  5FD6 A;  3DU6 A;  1YO5 C;  3LA2 A;  2VQC A;  4IJA A;  3BTJ A;  4WX9 A;  1ETV A;  1QQI A;  1IUY A;  3E6B A;  2CV0 A;  4ZYD A;  3CO7 C;  2W7N A;  3OYB A;  4IPA A;  2HVS A;  1ZGJ A;  1K61 A;  4LFU A;  2HXO A;  4A3L J;  1V54 H;  1L3L A;  2CV1 A;  3EYY A;  1BR1 A;  1U9O A;  1K7A A;  4AID A;  2HKX A;  1IV6 A;  2XSD C;  3VDX A;  4HRI A;  1EF4 A;  1UHM A;  4HZF A;  2XRO A;  3JSO A;  1TP4 A;  2BY0 A;  1LE8 A;  1XN7 A;  4I76 A;  4Y15 A;  4R79 A;  1IN5 A;  2KIU A;  2KIM A;  2YX4 A;  2Y75 A;  4KT6 A;  2XAU A;  2EFW A;  3BPX A;  5C4X J;  4DJA A;  3K9T A;  3NAR A;  4UB6 C;  1JGS A;  3S2D J;  5IT9 Z;  2MA3 A;  1HKT A;  2X6Y A;  1N25 A;  1UZC A;  5FRO A;  1HC8 A;  3OYC A;  3KLO A;  1EH8 A;  4XN0 A;  3CTA A;  1EKE A;  2R7R A;  2IA0 A;  3C2H A;  2Z1D A;  4N9H A;  2HKO A;  3DKW A;  4E7H A;  1XSD A;  1GUU A;  1IGN A;  5CVV A;  3A0B C;  4BJT A;  3V8K A;  1E2X A;  2M3A A;  2EBI A;  1LB2 A;  4A5M A;  2XKP A;  5LHI A;  2CMP A;  3GME A;  3PIP F;  3GLX A;  3N05 A;  2EZI A;  3LWF A;  4IZZ A;  1KQ9 A;  1MND A;  3KCC A;  4HSR A;  5D5X B;  2HS5 A;  3BG3 A;  3UKG A;  3B6C A;  3DPT A;  4WXH A;  2WV0 A;  3ROU A;  2LH9 A;  3FBN B;  4P9F A;  4ASN A;  4N0B A;  4UUS A;  4LMY A;  4M6X A;  3CCU I;  1MDM A;  5HLI A;  1IN8 A;  1MNM C;  2IGN A;  2V1D A;  4CCJ A;  1G4D A;  2LG4 A;  2JSP A;  3GW2 A;  1IG7 A;  1X4O A;  2H94 A;  1F9N A;  3MQ0 A;  2GXA A;  5BOX A;  2O8K A;  1B72 B;  2M0C A;  1QRY A;  1VQ6 I;  1AOY A;  1P7J A;  1OCC H;  1FMV A;  2KLO A;  2P5V A;  1WJB A;  1P2F A;  3LL7 A;  4UVA A;  2P5L C;  3BZ6 A;  1K4T A;  5FRN A;  5HVQ C;  1R71 A;  1SFK A;  4LK0 F;  4PCQ A;  1BR2 A;  1R4M B;  4A3E J;  4NB5 A;  1ZLJ A;  2AXT C;  2E1M C;  3BT9 A;  4XQF A;  1VQK I;  1YHQ I;  5K5Q A;  1S9H A;  1ETX A;  3FKJ A;  4IL6 C;  5CPR B;  4M9S A;  3TQN A;  3ZQ7 A;  3S1N J;  2VLA A;  3IKT A;  4C2U A;  3AL0 C;  1ZK8 A;  2FX0 A;  3QYE A;  5CVR A;  2H1K A;  3BTI A;  1FOX A;  4IEJ A;  3F8N A;  3HIF A;  3A01 A;  3P9C A;  2QQ8 A;  4UB8 C;  3HOZ J;  3RPQ A;  5D6E A;  1RZ4 A;  3OYJ A;  3HKZ N;  4PFO A;  2Y0S N;  3CDH A;  3K6G A;  5F64 A;  5D4S A;  2X6O A;  3WGI A;  2LKP A;  3O2P E;  3CC2 I;  1JTX A;  2KDO A;  2XB0 X;  5CVJ A;  1I3Q J;  4G9Y A;  3RYP A;  3IV5 A;  4Q48 A;  2M34 A;  3GTO J;  2ZJR F;  2JTV A;  1SFU A;  3K4L A;  3BG9 A;  1LPQ A;  1ONV A;  3L9F A;  2LKX A;  5J47 A;  2X0L A;  2HR3 A;  4CCK A;  2DK5 A;  5HLH A;  1Y39 A;  2ISZ A;  1NG7 A;  4UV8 A;  4AUX A;  1YIT I;  3BTL A;  3OY9 A;  4L18 B;  3F6O A;  1Z21 A;  1K4S A;  1IAW A;  4BQN A;  3I55 I;  1Z67 A;  3CES A;  2O3F A;  2QSG X;  2QQB A;  2L2O A;  1WJD A;  2NS8 A;  1J7K A;  3LQQ A;  2HXI A;  1VQ8 I;  2D1H A;  4UUS B;  5E20 A;  3HM5 A;  4MFD A;  5E1Z B;  1IRF A;  2ZXI A;  2MFZ A;  3FXL A;  2Y0S A;  4ZYG A;  3VWB A;  3OYI A;  2D5V A;  4U88 A;  4H4K C;  2IS2 A;  3CO6 C;  2OZ6 A;  1QA6 A;  2KFD A;  2L3D A;  3JRA A;  2WWY A;  3ZQF A;  4IX7 A;  3L1P A;  3J80 Z;  1E0E A;  4C3H J;  5CJ9 A;  1ZR4 A;  1KYZ A;  2LOO A;  2DJN A;  2CSO A;  4P55 A;  1HA8 A;  2VBX A;  1D0Y A;  4NNJ A;  2YX7 A;  1OKR A;  4HDV A;  2Y0M A;  1FOY A;  3PSF A;  5IP6 A;  2GIZ A;  3S32 A;  3H5R A;  2ADU A;  2FXA A;  1XMK A;  1IN4 A;  2Z2S B;  1O3R A;  2Q8K A;  3BY6 A;  1FMW A;  2YU9 J;  4NC8 A;  4I2O A;  4DW6 A;  2DW4 A;  1MSF C;  3GZ6 A;  3KPH A;  1QPM A;  2A61 A;  1BC7 C;  4WF2 A;  3ZQL A;  3V42 A;  2FF4 A;  2ZSH B;  2FNA A;  2YU3 A;  3HOV J;  4A3G J;  1WSU A;  2HOS A;  2R93 J;  2XPW A;  3IWF A;  1VQ9 I;  3HSE A;  3LOC A;  3BCB A;  4XID A;  1REP C;  3G4S I;  2DA5 A;  3TBI A;  1A35 A;  3RTR A;  1R9T J;  2GXB A;  1ON2 A;  1FYK A;  1W0U A;  1ZR2 A;  2FOW A;  2RNJ A;  4G7Z F;  2B63 J;  3OMY A;  1KZH A;  1WJF A;  4ESJ A;  1YTY A;  5DCF A;  3FXK A;  2O7O A;  3OS2 A;  3CDL A;  3K70 D;  1I27 A;  2HDD A;  1RI7 A;  3H36 A;  1F43 A;  2DMU A;  2LBF A;  3RSN A;  3O3K A;  1AKH A;  3MMY B;  1HCR A;  2LVS A;  2ZFW A;  1JKP C;  4KFC A;  2VOO A;  3X2Q H;  4A3F J;  5F0F A;  1DU0 A;  3I71 A;  5C3E J;  4FE4 A;  3TO7 A;  4AWX B;  4L0Y B;  1SD4 A;  2EV6 A;  2P6T A;  2OU2 A;  4ANJ A;  1K78 A;  1G2H A;  1MJA A;  4U0W A;  3L2C A;  3PO2 J;  4XRM A;  3L2R A;  2DAO A;  3S1M J;  2M4G A;  4FQG A;  4LK1 F;  4IXA A;  1I6H J;  3U1D A;  2LYC A;  5E8G A;  2ELK A;  1WI9 A;  3FM5 A;  1TLH B;  4G6D A;  3CD6 I;  3HSF A;  4L9V A;  2N8G A;  3CLQ A;  4RB3 C;  2M0M A;  5F6F A;  2PI0 A;  4K2E A;  2NRA C;  2TRT A;  1KA8 A;  1BC8 C;  1QZE A;  4RGX A;  1XGS A;  4XIC A;  2K9N A;  1TT5 B;  1YIO A;  3FMS A;  3RZO J;  2E2I J;  1TW3 A;  3MVP A;  4C2T A;  5CYV A;  2LK2 A;  3B6A A;  5GAH J;  1FBU A;  1VF9 A;  4JX5 A;  3RDI A;  4ETS A;  1VFC A;  2VKV A;  3V7S A;  1MJ9 A;  5J3L A;  3JRC A;  4A3B J;  5DUK A;  4E6K G;  1ZAR A;  5J4V A;  5HLT A;  1Z1D A;  3SYT A;  2R5Y B;  4DQ2 A;  4MEX F;  2XGD A;  4LIV A;  3ABL H;  3N97 A;  1BL0 A;  2FA5 A;  3K10 A;  2ICW G;  1YRN B;  1LDK B;  3WU1 B;  5BPD A;  4IHT A;  2X6X A;  2R7W A;  2JA7 J;  1B59 A;  2DTR A;  3HOW J;  1R6R A;  3W2W A;  2DA3 A;  1LJ9 A;  3G1O A;  1X3Z B;  5DEQ A;  1SC7 A;  4MHG A;  4UHT A;  1NH3 A;  2DA2 A;  1R23 A;  3OIP A;  4IQJ A;  2W24 A;  4U7B A;  4MO7 A;  5JLW A;  4CIC A;  4NQW A;  4HNV A;  1ZYR F;  4FT8 A;  1YFH A;  2OA4 A;  2DXI A;  2NVT J;  3TED A;  3DKX A;  3Q9S A;  2QQA A;  1XS9 A;  2E5Z A;  2VQG A;  2DT5 A;  3MEX A;  2RRE A;  4M3F A;  1T6S A;  1T39 A;  2EV5 A;  1O7F A;  4I01 A;  1FT9 A;  2E36 A;  2R5Z A;  2H27 A;  1J09 A;  2CQX A;  4XM3 A;  1X4P A;  1K79 A;  2JK3 A;  1OCZ H;  2EIK H;  2QKM B;  3HGY A;  3HZJ A;  4RLQ A;  4D5F A;  3F23 A;  4XON A;  3KYC B;  3CCM I;  3H3U A;  1FPQ A;  2XF5 A;  3UNG C;  1V55 H;  3H35 A;  2VN2 A;  5JI6 A;  3QPS A;  1W7P B;  1USS A;  2EB7 A;  5HOO A;  5M3M J;  5EG0 A;  2DT7 B;  3OOU A;  2IS6 A;  1LKX A;  4RAY A;  3EET A;  1KU9 A;  2HDW A;  1CF7 A;  1CGP A;  2DPD A;  2V1N A;  5JVG F;  3EQL F;  4OIP F;  4RGU A;  1H9T A;  1RKT A;  2K5C A;  2X6W A;  2R7Z J;  4UUV A;  3VB2 A;  1XGM A;  2KZV A;  3MZ8 A;  4LIU A;  2DN0 A;  5EDN A;  4A3C J;  4NC6 A;  3QAH A;  2GM4 A;  3M4O J;  3I4M J;  4PFP A;  1IC8 A;  2K40 A;  3DTI A;  2HQR A;  1VZ0 A;  4M3G A;  4ZTJ A;  1ZLK A;  3Q0U A;  3OYA A;  5ERI A;  3ABT A;  4WK8 F;  3OS0 A;  4IHS A;  3W6K B;  2WB1 N;  4M6Y A;  1Y0N A;  1IRX A;  1XCV A;  5JHU A;  2MAB A;  1BOA A;  3RJP A;  4PDK A;  3HB9 A;  4ITV A;  4AYB A;  5DS9 A;  1F36 A;  3QWL A;  3H3V K;  3ABK H;  2H6C A;  5IPA A;  1GVD A;  1BI2 A;  1XDS A;  1QZY A;  5DDG A;  3H0D A;  3EYI A;  5H20 A;  3I53 A;  4RS8 A;  2MYS A;  3OS1 A;  2ELH A;  2GIV A;  5ICF A;  3LAP A;  4CCM A;  3FKI J;  5J8F A;  2YPR A;  2XKO A;  3F6V A;  1HBX G;  2VKE A;  5D5U B;  4U7D A;  2FEZ A;  1QZZ A;  1FIP A;  5LRS A;  3T8R A;  1B4A A;  1BW6 A;  2WC2 A;  4RB1 A;  4XLE A;  1GVJ A;  1I5Z A;  3REO A;  5GPA A;  2V1X A;  2CV2 A;  1ULY A;  1X58 A;  4OIQ F;  2CYY A;  1K83 J;  1WWX A;  1JE8 A;  2PMZ A;  5D4R A;  5H2F C;  5GP9 A;  2HOT A;  1AU7 A;  2F4O B;  1LDD A;  3ELK A;  1W36 C;  4U87 A;  1VTN C;  4NUB A;  3W6V A;  3ZMV A;  4B1R A;  3L2Q A;  1UCR A;  1O57 A;  1BBY A;  3IH4 A;  5E3O A;  3ZN0 A;  1RR7 A;  1OYW A;  2LY9 A;  3O8G A;  2VJI A;  4R1H A;  1W5C C;  3JTG A;  3HXL A;  5FO5 A;  2ACJ A;  2E2H J;  1BI1 A;  2E60 A;  1IRZ A;  3CUQ B;  4YEL A;  1TWC J;  4R8H A;  2DJI A;  1B9N A;  4GRI A;  1AWC A;  1OCP A;  2QSH X;  2CS3 A;  1ENH A;  1ORK A;  4NHJ A;  3EPZ A;  1T56 A;  2FRH A;  1H88 C;  4MNU A;  5BS6 A;  2JUG A;  3Q3S A;  2HNH A;  4P5O A;  3SZT A;  2STT A;  2Y30 A;  3L09 A;  5GTH C;  3E1S A;  4B43 A;  1HST A;  2AS5 F;  2H6B A;  4XKC A;  1F5T A;  5KVR A;  3CUQ C;  5JHF A;  3BRO A;  1OR7 C;  4RMN A;  1FSH A;  3K1M A;  4B48 A;  1HDD C;  4YIR X;  3OYM A;  2JA6 J;  3KFW X;  1PP7 U;  3R61 A;  2BVL A;  2E2J J;  2NYX A;  2PMZ N;  2QEX I;  3GX4 X;  4BQA A;  2K9S A;  3H9G A;  3NWT A;  4BXU A;  4AD9 A;  4LG0 A;  3MKZ A;  3HOT A;  4AIK A;  2OV7 A;  1XDU A;  2JN6 A;  1E3P A;  3KET A;  4BUP A;  1BM9 A;  3DEW A;  2PJP A;  1KQ0 A;  3LFU A;  4HW0 A;  1JT0 A;  4OAY A;  5DTD A;  1YRN A;  1OIS A;  3K2A A;  2PBI A;  5FFZ A;  2XV4 S;  4PJJ A;  1L0O C;  3DCF A;  3E0J B;  2K9L A;  2WAE A;  2P7C B;  2ISY A;  4HPQ A;  1SD7 A;  2HQA A;  1ZRD A;  4AIJ A;  2R7U A;  3HGG A;  5M5W J;  3QPH A;  2X51 A;  2EZH A;  2WAD A;  1Z6T A;  3HTU A;  4DNC A;  1MMD A;  2MH2 A;  2ZME B;  1SAN A;  1D1C A;  5F08 A;  4UVB A;  1IJW C;  4A0X A;  4F93 B;  4CHU A;  4OMY A;  1VQM I;  2DA6 A;  3W6J B;  3AFH A;  2K9Q A;  2UXX A;  2JZY A;  4II2 A;  1B6A A;  2F5V A;  1W5S A;  4EGZ A;  4DGW B;  4J01 A;  2LMD A;  1B9M A;  3ZMD A;  3T5X A;  5F0C A;  4JP0 A;  2EIM H;  3OOP A;  4JYK A;  4JBA A;  2WY7 Q;  3DLA A;  2XSJ C;  3ECO A;  5CKT A;  5HDK A;  3S1Q J;  3O8H A;  2DOA A;  2K3F A;  2L7K A;  1UHS A;  1Y56 A;  4BGD A;  2M7A A;  3DEU A;  5KNL A;  3NWS A;  3V4G A;  1UAA A;  1V5E A;  2BXZ A;  5LGU A;  5J1R A;  1RES A;  1YW7 A;  3JSP A;  2GWR A;  1HW5 A;  3WTZ A;  2CFO A;  4OOI A;  2EH3 A;  2DA7 A;  4M9Z A;  3U1K A;  2X4H A;  1BR4 A;  4QWQ A;  3ASN H;  4L5J A;  5B66 C;  1VQL I;  3ECH A;  2LY2 A;  5KAF C;  3OYF A;  3OYD A;  4HLX A;  1YG2 A;  1U5T C;  3M1C A;  2HYJ A;  5AIP A;  3HRU A;  5D5V B;  3ZMS A;  2DMT A;  2E1M B;  2ZME C;  1YW8 A;  4M3D A;  3J7Z I;  3H5A A;  4CH7 A;  1XX5 A;  3K69 A;  3HDD A;  2LRE A;  2AQE A;  5FKL A;  3COA C;  3FMR A;  3WG9 A;  2QA4 I;  2K4B A;  3HL2 A;  2Y9Z A;  4EJV A;  2BW3 B;  3GCM A;  1U5T B;  5FLX K;  1A31 A;  3QRF F;  5CVU A;  2DMP A;  1MBH A;  4I0B A;  5DV5 A;  2YR2 A;  2FD5 A;  1XB4 A;  2LD5 A;  1QBJ A;  2XIG A;  2MLK A;  3R4K A;  3K7A J;  3ZQQ A;  3IL2 A;  2PG4 A;  1XTA A;  3C18 A;  3H1C A;  2AO9 A;  2L54 A;  2IGM A;  2VXZ A;  3WGH A;  4QLC U;  4YG2 F;  5KHD A;  3G71 I;  3HOY J;  4A5N A;  2Q2E B;  4P9U A;  2L7M P;  1MBJ A;  3I9V 2;  2XAG A;  3H0G J;  4A2U A;  4DBR A;  1A5J A;  4FAS D;  2J5P A;  1MH3 A;  1VQP I;  5LFA A;  3PIO F;  1W1W E;  3WGG A;  4HG2 A;  1YS6 A;  1X3W B;  2W57 A;  3TDZ C;  5EZG A;  2HQN A;  2DMN A;  4AIH A;  3CLO A;  1TC3 C;  1QGP A;  4LIT A;  4ZYE A;  2EWN A;  1SD6 A;  2PLY A;  2DOF A;  3J7Y J;  5DM7 F;  4C9Y A;  3K1P A;  4XLH A;  4HA8 A;  4FET A;  2CGP A;  2BGC A;  1MBG A;  3RCO A;  2CQN A;  3I0T A;  4L5I A;  2XC7 A;  2BVM A;  1N77 A;  3VFZ A;  2V79 A;  3CZ6 A;  2VOP A;  4BL0 B;  2JPB A;  2WAQ A;  4YFK F;  2K7L A;  5HS7 A;  3R0J A;  3FXM A;  2M87 A;  4II3 A;  4MQ9 F;  5K7Z A;  2XGE A;  1XPX A;  3PSI A;  3Q5F A;  1DU6 A;  4M72 A;  3TGN A;  4XBF A;  4AC0 A;  3BJA A;  4CXF A;  4BBS J;  4O5V A;  4KIF A;  2EIN H;  2ZKZ A;  2ID6 A;  3I59 A;  4XOP A;  1YIJ I;  2HTJ A;  4UY8 I;  1F4K A;  3HRM A;  3BP8 A;  4ZYA A;  4RAF A;  3I56 I;  3FBI B;  2BXY A;  1T98 A;  2CUZ A;  4KUM A;  1IW7 F;  1OR7 A;  3VYU B;  1RPW A;  2NOG A;  2V9V A;  3F22 A;  3NEU A;  4KIG A;  1ZRF A;  2QF7 A;  1U6G A;  1DUX C;  4KIC A;  4O6J A;  2WA0 A;  2R7T A;  2QGU A;  4CZZ A;  2IW5 A;  2V4J C;  2X48 A;  2L9R A;  3CJN A;  2LP0 A;  3F3X A;  1XSX A;  1U3E M;  3FIS A;  2ZNZ A;  5EEH A;  1SD5 A;  2EZL A;  3U9G A;  2B7E A;  1ODD A;  2DO7 A;  2COM A;  4D9J A;  2R7D A;  3HYI A;  1T95 A;  3BLY A;  1RNL A;  3GYH X;  2K4J A;  5TIS C;  3GTJ J;  4PJL A;  2IGK A;  2G0E A;  4MIM A;  1OCR H;  4EJW A;  4ZYH A;  2IT0 A;  2XVC A;  1MH4 A;  5GTI C;  2RAE A;  4MLO A;  1YS7 A;  1FYL A;  1U2W A;  2CG4 A;  1YE9 A;  5J40 A;  4E7J A;  3PUB A;  5BMZ A;  4XK4 A;  5DM6 F;  4J00 A;  3DFG A;  4PJM A;  1JTY A;  1S7E A;  1HKQ A;  2P7V B;  1YLF A;  4HF1 A;  2NS7 A;  1FSE A;  4BJ6 C;  2NXN B;  2MG4 A;  2Y2Z A;  2F6C A;  5LEK A;  2FNP A;  5L3G A;  4OIO F;  3HRT A;  1G3S A;  4ENN A;  4OU0 A;  1OCT C;  1SFE A;  1XMX A;  1J9I A;  5EJC A;  4KDP A;  1LFP A;  1TTY A;  3KE2 A;  1O7L A;  4RDU A;  4HX4 A;  2Y31 A;  5EGO A;  2UV1 A;  3NAU A;  4M73 A;  1P9Q C;  2FML A;  4F52 A;  2KIS A;  5FLX Z;  1K6O A;  1WCM J;  4E70 A;  1V3F A;  4WWC A;  2OAZ A;  3BJO A;  4E7Z A;  1MBE A;  4LLL A;  2NVQ J;  1FP2 A;  2PX9 A;  3T1B A;  2FJ1 A;  2FU4 A;  2GA2 A;  2LF7 A;  1VI0 A;  1M1E B;  5AON A;  4ZZD A;  2PEX A;  3C2B A;  4CYC A;  2OCC H;  2OZU A;  2A5Y B;  1VQO I;  3AAF A;  3M8F A;  1E3H A;  1ETO A;  1ZKG A;  2DCE A;  1ZHF A;  2VC1 A;  3SEZ A;  4JQF A;  1W36 D;  4A12 A;  5IP7 J;  4AM3 A;  1WQ2 A;  2E19 A;  4HOB A;  2BOL A;  4BAC A;  3L2W A;  3ZRG A;  4B47 A;  4DZJ A;  2UWM A;  1LDJ A;  4B3X A;  1UG2 A;  1W0T A;  4A3M J;  4FCY A;  2NOJ B;  5DUI A;  2DFH A;  4X0G A;  1GV2 A;  1U0J A;  1X19 A;  2VB6 A;  3RKQ A;  2VT3 A;  3BDD A;  3EUH C;  3BOQ A;  2QSF X;  3FWE A;  3GTM J;  2E7W A;  4QTR A;  4ABZ A;  5K5O A;  3WTV C;  5HNF A;  2VIX A;  4BDY A;  1Z3X A;  1KU2 A;  3KX2 A;  3ESW B;  1JJ8 C;  4A0Y A;  2E71 A;  3M8E A;  1T38 A;  1APL C;  1TZL A;  3FF5 A;  4HV6 A;  3PFY A;  3I4N J;  1DP3 A;  1RKW A;  1SVL A;  2OC6 A;  5ILS A;  3H5N A;  3WTS C;  3F8M A;  5IT3 A;  4Y33 A;  1WH7 A;  4F7Z A;  2FMY A;  2BBY A;  2DFF A;  1J75 A;  2X1D A;  1HKS A;  2RQP A;  2DTZ A;  5HDN A;  3MZH A;  4BHC A;  2EA4 A;  3OYL A;  2MSY A;  1UB9 A;  5L3E A;  1P4A A;  5F04 A;  3AG2 H;  3L00 A;  1JHH A;  3JRE A;  1XC5 A;  3GFI A;  2D1V A;  1D5Y A;  3HTS B;  2MW8 A;  2LFB A;  1FOW A;  5ED4 A;  1IXR C;  5GAG J;  3FMQ A;  4HX7 A;  2FBK A;  1ZRC A;  2ZBK A;  1ACI A;  1FNN A;  1B8I B;  2M7B A;  3BTC A;  4XLC A;  3GBG A;  2DDB A;  1DPR A;  1D8K A;  2E35 A;  2WY8 Q;  2ZXH A;  2DU9 A;  2PJR B;  2UXN A;  4RBO A;  2XAS A;  1WI3 A;  3J81 Z;  1TBX A;  3S93 A;  5HDG A;  2K9M A;  2H8W A;  1TL8 A;  3OR2 C;  2GAU A;  2F5C A;  2COB A;  5ICC A;  1TWF J;  3DPU A;  1JKR C;  2MC3 A;  4X6A J;  1V5F A;  1BJA A;  4XL9 A;  2FQ3 A;  3CJT B;  2L9N A;  2FQ4 A;  2DA4 A;  1ZQ3 P;  1YQA A;  4NC7 A;  2O9L A;  2MGQ A;  2ZXJ A;  2NVU B;  2KQR A;  1Y0U A;  1BIA A;  3GFJ A;  3FIW A;  4IRI A;  1DPU A;  3CDI A;  4S05 A;  5HS9 A;  4V2F A;  3U21 A;  3TL4 X;  3ULQ B;  3JR9 A; 
#chains in the Genus database with same CATH homology
 5E3O A;  2NVY J;  1Y1V J;  1RR7 A;  2LY9 A;  3O8G A;  1GT0 C;  2E2H J;  5FKO A;  1E3O C;  1IRZ A;  3OIO A;  1TWC J;  2ME6 A;  2KT0 A;  1PUF A;  1OCP A;  4A3D J;  1ENH A;  1OFC X;  1RET A;  1Z0X A;  1ORK A;  5C4J J;  1PUF B;  1T56 A;  2GBY A;  1H88 C;  1I50 J;  3Q3S A;  3BTJ A;  1ETV A;  3GTQ J;  1AKH B;  2NVX J;  2JWT A;  3BR6 A;  2Y30 A;  5IYD J;  1ETK A;  1K61 A;  2ME0 A;  2HXO A;  4A3L J;  1B8I A;  3TP3 A;  2XRL A;  2L7F P;  1U9O A;  5C44 J;  1HDD C;  2JA6 J;  5JLX A;  2E2J J;  1U8B A;  2PMZ N;  2ZB9 A;  4X1E A;  1IV6 A;  2XSD C;  4A69 C;  1EF4 A;  2E1O A;  1ETY A;  2YS9 A;  2K9S A;  1LE8 A;  4B4C A;  4XRS G;  5HOD A;  3JRI A;  2JN6 A;  4I76 A;  2AHQ A;  4FE7 A;  1WH5 A;  4DYQ A;  4FTH A;  3DEW A;  3SDG A;  1JT0 A;  4D5C A;  2X9D A;  4XRS A;  5DTD A;  1YRN A;  3K2A A;  4M6V A;  5C4X J;  3NAR A;  4M3E A;  3S2D J;  4A3I J;  3DCF A;  1T33 A;  3MN2 A;  3WHC A;  4A3J J;  3TW6 A;  5FKK A;  5IYC J;  1ETW A;  3HGG A;  5M5W J;  1IGN A;  1GUU A;  4MFE A;  1TWH J;  5EYR A;  5K7F A;  2EBI A;  2EZH A;  4W97 A;  2WV1 A;  3S15 J;  1SAN A;  3BQZ A;  5F08 A;  4C2M J;  1IJW C;  2EZI A;  2DA6 A;  2CUF A;  2K9Q A;  1GV5 A;  3G1L A;  1ITY A;  3GTL J;  3BG3 A;  3UKG A;  3B6C A;  2R5Z B;  3BR3 A;  4UUS A;  2H8R A;  2R0Q C;  1MNM C;  3IH2 A;  5F0C A;  1AHD P;  4JP0 A;  4JYK A;  3A01 B;  1IG7 A;  2O8K A;  1B72 B;  1JUS A;  3S1Q J;  2M0C A;  1QRY A;  3O8H A;  3M3Y J;  3CQZ J;  4BXX J;  1UHS A;  1P7J A;  1H8A C;  3CCY A;  3FK6 A;  5J1R A;  3JRD A;  5M3F J;  4M3B A;  4A3E J;  1RES A;  3BT9 A;  3ZQI A;  3A02 A;  3MKL A;  1ETX A;  2EH3 A;  2DA7 A;  3S1N J;  3E7L A;  1ZK8 A;  2FX0 A;  2XGC A;  2H1K A;  3BTI A;  3BR2 A;  5FLM J;  4IEJ A;  4NDL A;  3A01 A;  1H89 C;  2WAQ N;  2LTP A;  3HOZ J;  1HLV A;  2HYJ A;  2DA1 A;  3HKZ N;  3TW7 A;  2Y0S N;  2DMT A;  2XB5 A;  2X6O A;  4M3D A;  1GDT A;  1JTX A;  3RZD J;  3HDD A;  2JMW A;  2XB0 X;  4JX6 A;  5FKL A;  1I3Q J;  3RQI A;  4S0H B;  3IV5 A;  5EEA A;  2M34 A;  5IYB J;  3IH3 A;  3GTO J;  5EZH A;  5K7H A;  2Y9Z A;  3BG9 A;  1JT6 A;  3Q0W A;  2LKX A;  3QPL A;  4AUX A;  3HBL A;  2DMP A;  1MBH A;  3BTL A;  5EF6 A;  2FD5 A;  2LD5 A;  3K7A J;  2NS8 A;  5EGO B;  2AO9 A;  2EZK A;  2LLK A;  2HXI A;  3HOY J;  4UUS B;  3HM5 A;  5GPC A;  4MFD A;  2L7M P;  1MBJ A;  2R92 J;  1UMQ A;  3H0G J;  2P81 A;  1A5J A;  2D5V A;  1BA5 A;  1Z77 A;  1MH3 A;  1WPK A;  2JJ7 A;  1TC3 C;  4W1U A;  5EZG A;  2DMN A;  1NTC A;  3JRA A;  3ZQF A;  3L1P A;  4C3H J;  1ZR4 A;  1SFO J;  2ECB A;  1IDY A;  2DJN A;  2JA8 J;  3ZQH A;  1MBK A;  1MBG A;  1OJL A;  5IP6 A;  1MSE C;  2VUM J;  1Q1V A;  4BY7 J;  4J19 A;  1JJ6 C;  5E3M A;  4IHV A;  1JGG A;  3SJM A;  3Q0V A;  1FTZ A;  2YU9 J;  5K7Z A;  4DW6 A;  2XGE A;  1MSF C;  3LSP A;  3ZQL A;  4DZP A;  4IHY A;  3HOV J;  4A3G J;  1LE8 B;  2HOS A;  5IP9 J;  2R93 J;  2XPW A;  1DU6 A;  3LOC A;  3GTP J;  4AC0 A;  4BKX A;  4XID A;  2HQ5 A;  1VND A;  1JUP A;  2DA5 A;  4BBS J;  1R9T J;  2OPT A;  2B63 J;  1W0U A;  1BJZ A;  2ID6 A;  4AYB N;  1ZR2 A;  2L0K A;  2XPV A;  5FKM A;  2O7O A;  3F0C A;  2CRG A;  3OSG A;  2ID3 A;  3CDL A;  2HDD A;  1F43 A;  1ZTR A;  4EEF G;  2DMU A;  4A3K J;  1FEX A;  2W48 A;  1AKH A;  5FLV A;  1HCR A;  1RPW A;  2NOG A;  2CU7 A;  2LVS A;  3S17 J;  1JKP C;  1ETQ A;  1FTT A;  1WGX A;  5EG0 B;  4A3F J;  3CMY A;  2XPU A;  5F0F A;  1DU0 A;  2LR8 A;  3BR1 A;  5C3E J;  4FE4 A;  2QF7 A;  3LSG A;  4GFB A;  5F1J A;  4Y7N J;  3BR0 A;  2X48 A;  1IUF A;  2L9R A;  1G2H A;  2LP0 A;  3JRF A;  3PO2 J;  1POG A;  3D1N I;  4XRM A;  3FIS A;  2M2E A;  2M8G X;  3S1M J;  2EQR A;  1LFB A;  1I6H J;  2EZL A;  2ELK A;  2N8G A;  1X2M A;  3GTJ J;  2TRT A;  2G0E A;  4MIM A;  2TCT A;  4XIC A;  2K9N A;  3RZO J;  2E2I J;  1MH4 A;  3MVP A;  4L5E A;  2LK2 A;  2RAE A;  4MLO A;  1O4X A;  3B6A A;  1U9N A;  1VF9 A;  4JX5 A;  4XK4 A;  4IHW A;  2IBD A;  5FJ8 J;  2VKV A;  1VFC A;  1JTY A;  1S7E A;  2NS7 A;  2L7Z A;  5M5Y J;  3JRC A;  5J3L A;  4I6Z A;  1XG1 A;  2HI3 A;  1JKQ C;  4A3B J;  2MG4 A;  2Y2Z A;  3HOU J;  5J1Y A;  3S14 J;  4C3I J;  2R5Y B;  2QCO A;  2XGD A;  1FJL A;  1OCT C;  1BL0 A;  1U78 A;  2R5Y A;  3PO3 J;  3ZOB A;  4CYC B;  3GTK J;  1YRN B;  4RDU A;  2Y31 A;  2OF7 A;  3NAU A;  2JA7 J;  3WHB A;  3LSR A;  3LNQ A;  3S1R J;  3HOW J;  3GTG J;  1WCM J;  4QIW N;  2DA3 A;  3G1O A;  1MBE A;  5BNG A;  2NVQ J;  2M9H A;  4B3A A;  2FJ1 A;  2DA2 A;  5IOZ A;  1VI0 A;  4MO7 A;  2VPR A;  5JLW A;  2GLO A;  3C2B A;  4CYC A;  4HNV A;  1P7I A;  4A93 J;  2NVT J;  4DYR A;  3TED A;  1HF0 A;  2JA5 J;  1ETO A;  1ZKG A;  1HOM A;  5F27 A;  1XS9 A;  3OSF A;  3HOX J;  2ECC A;  4G12 A;  5IP7 J;  2E19 A;  4M3F A;  3BR5 A;  3BG5 A;  3ZQG A;  1FIA A;  4DZJ A;  1IDZ A;  1UG2 A;  1W0T A;  2R5Z A;  4A3M J;  4FCY A;  2YUS A;  4UUT A;  2CQX A;  3ZQC A;  2JK3 A;  3HGY A;  4D5F A;  1GV2 A;  3RKQ A;  3GTM J;  4FIS A;  4QTR A;  4ABZ A;  5IOY A;  3QPS A;  1LFU P;  2I10 A;  1BW5 A;  5M3M J;  5EG0 A;  1JJ8 C;  3OOU A;  4LOC A;  4D7N A;  4QSH A;  1A6I A;  1TWA J;  2CQQ A;  1APL C;  2VI6 A;  5EGO A;  3LSJ A;  2CUE A;  2Y9Y A;  9ANT A;  1JKO C;  3I4N J;  1QVU A;  1RKW A;  1RKT A;  2R7Z J;  3SFI A;  5M5X J;  1CQT A;  3S16 J;  1WH7 A;  4C3J J;  5EDN A;  2DN0 A;  4A3C J;  1QVT A;  2GM4 A;  3M4O J;  1NK2 P;  3I4M J;  2DTZ A;  1Y1W J;  5E3N A;  2K40 A;  1IC8 A;  2MSY A;  4M3G A;  5F04 A;  3Q0U A;  1NK3 P;  2WB1 N;  3JRE A;  1XC5 A;  1D5Y A;  1JUM A;  2MW8 A;  2LFB A;  3A03 A;  1QPI A;  1X2N A;  1HDP A;  3FK7 A;  3HB9 A;  5E3L A;  5DS9 A;  2CJJ A;  1B8I B;  1F36 A;  3H3V K;  3BTC A;  5J1U A;  3GBG A;  5IPA A;  1GVD A;  1B72 A;  2IEK A;  4Y52 J;  1MBF A;  3TP0 A;  3JRG A;  4RBO A;  1WI3 A;  3FKI J;  3JRB A;  4BBR J;  4JX4 A;  2IAI A;  2VKE A;  4D7M A;  3G1M A;  2COB A;  1FIP A;  1TWF J;  4DYC A;  1BW6 A;  1JKR C;  4BY1 J;  5F0H A;  1TWG J;  2KDZ A;  3HEF A;  4X6A J;  3BQY A;  4V2G A;  5GPA A;  3QQA A;  5FKN A;  2FQ4 A;  2DA4 A;  1ZQ3 P;  2O9L A;  1X58 A;  2MGQ A;  1K83 J;  3PM1 A;  1ZGW A;  5GP9 A;  2HOT A;  1AU7 A;  3FIW A;  2HOA A;  3W6V A;  4B1R A;  3VPR A;  4V2F A;  2DMQ A;  4IHX A;  3IH4 A;  3JRH A;  3S2H J;  3JR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...