3S1QJ

Rna polymerase ii initiation complex with a 5-nt 3'-deoxy rna soaked with atp
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3s1qJ00
3FK7A 1ORKA 4S0HB 5F0CA 4A3EJ 2N8GA 3O8HA 5E3NA 5EDNA 5F0HA 3JRBA 1JGGA 3WHCA 1FJLA 2JK3A 5F08A 5IOYA 1U9OA 2E1OA 4MFDA 2CQXA 2R5YB 3E7LA 4MLOA 4DYRA 3GTGJ 5E3LA 1T56A 5EEAA 1TWCJ 1ZTRA 1ZKGA 2DA2A 2DA3A 2LK2A 2NS7A 1QRYA 1WGXA 3OSGA 3L1PA 1UHSA 2DMQA 3HOXJ 3W6VA 3JRFA 3LSJA 3OOUA 3IH4A 1ETWA 1F36A 1MBEA 3HOYJ 4A3LJ 4RBOA 1JUMA 1PUFA 2P81A 3H0GJ 3K2AA 1XS9A 1XC5A 4ABZA 2E2JJ 3FIWA 4JX4A 1AKHB 3C2BA 4FCYA 2NVTJ 2ZB9A 2K9SA 3RKQA 9ANTA 3H3VK 1U9NA 4A3DJ 2XPUA 2VUMJ 1G2HA 1ETKA 5M5WJ 1JUPA 4M3FA 4D7MA 2R5ZA 1B72A 3BR1A 1RESA 2DTZA 3HM5A 2K9QA 4MIMA 2FQ4A 2ID3A 2VKVA 1ZR2A 1SFOJ 3BR3A 5HODA 2GM4A 5IP7J 5J1RA 4IHVA 4M3EA 1U78A 2COBA 3LNQA 3TP0A 2FX0A 2G0EA 2QF7A 2KT0A 2HQ5A 4X1EA 1U8BA 4G12A 2XB5A 2DA4A 2Y0SN 3HBLA 1GVDA 2CUFA 2MSYA 1Y1VJ 1JJ6C 1NK3P 1XG1A 3HKZN 4BY7J 3LSRA 3D1NI 2DJNA 1JT0A 1MSEC 5GPCA 1I50J 2HXIA 2EZLA 4J19A 2R5ZB 3LOCA 3BR0A 5DS9A 3SDGA 2D5VA 1UMQA 1F43A 5J1UA 5BNGA 5K7FA 2MW8A 5C3EJ 5GPAA 1X2MA 4D7NA 2YUSA 3BTLA 3G1LA 5K7ZA 4M6VA 3GTQJ 1IRZA 1FEXA 4A3IJ 2X9DA 5M5YJ 3GTMJ 3JRCA 3S1RJ 4UUSB 5F0FA 4XICA 2LFBA 3TW6A 4A3MJ 3QPLA 1RKTA 3RQIA 2M34A 4A3KJ 1O4XA 2JJ7A 1APLC 3HOWJ 1BJZA 1ETVA 2E19A 2WB1N 3GTLJ 3PO2J 1GUUA 1RKWA 2HOAA 3BTJA 1HDDC 2JA5J 3DCFA 2ID6A 2DMPA 3BQYA 1LFUP 1FIAA 3GTJJ 2NVYJ 1ZR4A 4A3CJ 4XK4A 3QQAA 1OCPA 2X6OA 2WAQN 5F27A 1TWHJ 2L0KA 5E3MA 3PO3J 1IGNA 3SJMA 1WH5A 3S16J 4MFEA 4C3HJ 2Y30A 2DMUA 3K7AJ 3M4OJ 4C3JJ 1HOMA 1I3QJ 1D5YA 2DN0A 2H8RA 2AHQA 2M0CA 2Y9ZA 4I76A 1RETA 3CCYA 3OSFA 1WPKA 1MBHA 1R9TJ 4I6ZA 1EF4A 3ZQGA 2Y9YA 4UUTA 3ZQIA 3MVPA 3FKIJ 2EH3A 1UG2A 3HOVJ 1LFBA 2LD5A 2XPVA 5EYRA 3ZQHA 1JKQC 4BBSJ 3GBGA 1SANA 3BT9A 1OCTC 2ME0A 1IV6A 5IP6A 1MNMC 5IYBJ 3Q3SA 5FKLA 2FD5A 4XRSA 2HDDA 3M3YJ 1HDPA 2GLOA 3BG5A 4FE4A 1AKHA 1JKPC 4M3GA 2ME6A 2EZIA 4QSHA 1JUSA 4A3BJ 3FK6A 4JYKA 1W0TA 2NS8A 2K9NA 4AC0A 3DEWA 1E3OC 3FISA 5C4JJ 1B72B 2QCOA 2DMTA 3RZOJ 5FLMJ 1ITYA 1H88C 1IJWC 1S7EA 5GP9A 1MBGA 1TWGJ 2JWTA 3JRHA 2CJJA 4DZJA 2TRTA 5EG0A 4XRMA 1IDYA 1Z0XA 1OFCX 3A02A 2X48A 3Q0WA 1JJ8C 2IBDA 5J3LA 4BKXA 2CU7A 2LY9A 4V2FA 3GTKJ 3HOUJ 2VKEA 4C3IJ 3JR9A 4W1UA 3PM1A 2M8GX 3LSGA 3UKGA 1RPWA 4W97A 4MO7A 3BG3A 2H1KA 1VFCA 1ZK8A 2DA1A 4UUSA 3S1NJ 5IYCJ 4XRSG 3S1QJ 3WHBA 5IPAA 1DU6A 1YRNB 3B6CA 2DA5A 4CYCA 3S2HJ 1Z77A 1ZGWA 2HI3A 2XPWA 4QTRA 4A3JJ 4EEFG 2JA7J 1B8IB 2L7ZA 2ELKA 3I4MJ 1POGA 3MKLA 4Y52J 4FE7A 4JX5A 3CDLA 2XRLA 4X6AJ 4IEJA 1MBJA 2K40A 1OJLA 3TP3A 3LSPA 3JRDA 4A93J 2IEKA 2LVSA 4HNVA 2JA8J 4B1RA 5J1YA 5EG0B 4B3AA 4B4CA 3JRIA 2L7FP 1FTTA 2HYJA 3SFIA 5DTDA 2M9HA 5EF6A 2XSDC 1CQTA 1ZQ3P 2XGDA 1JTXA 1RR7A 2LLKA 1TWFJ 4JP0A 1MBKA 3MN2A 4DYCA 1YRNA 4LOCA 1X58A 3GTOJ 1BL0A 1HCRA 3G1MA 2ECCA 1IUFA 2KDZA 3A01B 1LE8B 2MGQA 3BG9A 5JLXA 4GFBA 1B8IA 5IYDJ 4D5FA 1ETYA 5M3MJ 1H89C 1JTYA 5EZGA 1JKOC 5K7HA 5EGOA 2EQRA 4BBRJ 5IOZA 2EZHA 1HF0A 3Q0UA 3CMYA 2LP0A 1VI0A 2RAEA 4DW6A 2IAIA 3HB9A 4RDUA 1TWAJ 4D5CA 5M3FJ 1H8AC 1AHDP 1TC3C 4IHYA 2DMNA 2EBIA 2TCTA 1MBFA 5C4XJ 3F0CA 2YS9A 2NVXJ 2FJ1A 1IC8A 2M2EA 4XIDA 2LKXA 1QVUA 1Q1VA 2O7OA 3QPSA 1T33A 1IG7A 1A6IA 2B63J 3S15J 5FKMA 3JRAA 2DA7A 1JT6A 2DA6A 2OF7A 1NK2P 3RZDJ 2HOSA 1ETOA 5EGOB 3IV5A 1P7JA 1ETQA 3HGYA 3IH3A 1HLVA 5C44J 2OPTA 3HEFA 3S2DJ 2VPRA 1WCMJ 1K61A 3A01A 2LTPA 1LE8A 2O8KA 2R93J 3S14J 3BR2A 2HXOA 2GBYA 1GT0C 2L7MP 2XGEA 4BY1J 4Y7NJ 3S1MJ 3O8GA 1MH3A 2L9RA 3HGGA 4L5EA 4BXXJ 1IDZA 3BTIA 2YU9J 1FTZA 2ECBA 3TW7A 4JX6A 4A3FJ 4CYCB 1NTCA 2MG4A 4AUXA 5IP9J 1QVTA 4A3GJ 1VF9A 3TEDA 2XGCA 3CQZJ 2AO9A 5FKKA 4V2GA 2R0QC 5F1JA 2W48A 1W0UA 3S17J 3NAUA 5F04A 1GV5A 2JA6J 1WI3A 2I10A 5EZHA 1AU7A 2R7ZJ 4C2MJ 3BQZA 3HOZJ 3I4NJ 1FIPA 3JRGA 4DZPA 1ETXA 3ZOBA 2E2HJ 1MSFC 1WH7A 1ENHA 3Q0VA 2O9LA 1K83J 3VPRA 2NVQJ 5FLVA 1Y1WJ 1BA5A 1BW5A 2XB0X 4FISA 2EZKA 5JLWA 3B6AA 2CUEA 4QIWN 5FKNA 2CRGA 3BR5A 1BW6A 1QPIA 5FJ8J 3ZQCA 4M3DA 3OIOA 3G1OA 3HDDA 3GTPJ 4A69C 1A5JA 2LR8A 3BR6A 2JMWA 2R92J 3ZQLA 1DU0A 4IHWA 1GDTA 4DYQA 3IH2A 3NARA 2WV1A 5FKOA 1X2NA 2HOTA 4M3BA 1PUFB 2E2IJ 1GV2A 2CQQA 1JKRC 2PMZN 3A03A 2Y2ZA 2R5YA 3BTCA 5E3OA 1P7IA 1I6HJ 1MH4A 2VI6A 4AYBN 4NDLA 2NOGA 3JREA 1VNDA 2Y31A 4IHXA 3ZQFA 5M5XJ 4FTHA 2JN6A
chains in the Genus database with same CATH superfamily
3FK7A 4O5VA 2R7OA 3ECHA 2N8GA 4RB2C 4CA0A 3JSPA 1SD6A 1DPRA 1JGGA 3WHCA 1FJLA 3ML6A 1J9IA 1FBQA 4MFDA 3I53A 1W4MA 2CQXA 3H36A 1E3HA 4U7DA 4MLOA 2DT7B 5E20A 4P5OA 4Y15A 4Y4RA 2CV0A 4FETA 3HRUA 3BPXA 5HDKA 1IXRC 2QYOA 3RKXA 1T56A 3WE2A 1I1GA 4BXUA 1TWCJ 1WJ5A 1ZTRA 3KYLA 3WG7H 2XKOA 2FNAA 2LY1A 2DA3A 4C2UA 2HZTA 2J5OA 1RRJA 2IS2A 3FMRA 3OSGA 2MLGA 3QAHA 4XLNF 1R1UA 2OZUA 1LKXA 1UHSA 3MKZA 3QRFF 4CYDA 3W6VA 3LSJA 3L2UA 3SYTA 1LDDA 3OOUA 1ETWA 3T8RA 3CUOA 2HOEA 2XASA 3M9AA 2CGPA 5HLTA 1BJAA 3HOSA 1JUMA 1WJBA 5L3DA 2CW8A 2F6CA 2IS1A 2YU3A 1XS9A 1XC5A 5LHIA 1R1TA 2LC2A 3H5RA 4FCYA 2VQGA 2ZB9A 2NVTJ 2QA4I 3RKQA 3H35A 3DKYA 4MTDA 1EH6A 3H3VK 1SMYF 2VUMJ 4HF2A 1ETKA 2FQ3A 4EM1A 1YG2A 4M3FA 4ZYGA 1B72A 1P4XA 2ELJA 3HM5A 3G71I 4BEHA 1W5SA 4FT8A 2VKVA 2FMLA 1Z67A 1QO0D 2CUZA 5IP7J 3QODA 4IHVA 1U78A 3LNQA 4XLCA 2FX0A 2R7UA 2HQ5A 3L7WA 1S7AA 2QBYA 3GW2A 1Y1VJ 2E34A 3M7GA 5J6XA 5FLXZ 4QPQA 4AWXB 2BBYA 3GX4X 3WTXC 4D9JA 5HLGA 2EZLA 2NYXA 2QQAA 1SEUA 3QYEA 2R5ZB 1USSA 1XMKA 2HYGD 3FM3A 4HG2A 3TQNA 3I3LA 4MEYF 1KA8A 3W2AA 3FXMA 4A2UA 2FRHA 5J1UA 5K7FA 5E18F 4HDVA 2VJJA 4DBQA 5GPAA 5L3FA 2YUSA 3G1LA 1T08B 4OWRB 3AL0C 2X9DA 1AA7A 5TISC 2DTRA 1PP7U 1MD0A 3JRCA 3EYYA 3BCAA 2QWWA 4UUSB 2Y48A 2EIJH 3TW6A 4XQFA 3AL0B 5FGMA 4BXFA 4A3KJ 1O4XA 2JJ7A 1TQPA 1W7PA 4XBFA 5IT9K 2OCEA 3FXRA 3PO2J 5E79C 4EJTA 1XTAA 2CH0A 2EFOA 1MJAA 2HOAA 3DCFA 3BQYA 2NVYJ 4PUSA 2IS6A 2M4KA 1KYWA 4XK4A 1VQ4I 1VQKI 4X0GA 2MD0A 1TWHJ 3RCOA 1IGNA 2E1MB 3BZCA 3PNTA 3W6KB 3PIOF 3S16J 1C0WA 4NNJA 1R22A 4AM3A 5B3SH 3OYDA 1UFMA 2VB6A 1NG6A 4OIQF 2AS5F 3KEYA 2M0CA 3OYLA 3CCYA 2P7CB 1WPKA 2UZKA 3K6GA 1N25A 3PL8A 2BVLA 4I6ZA 2DU9A 1X3UA 3ZQGA 4UUTA 4YIIA 3K9TA 4I02A 2R7VA 2EFQA 3FKIJ 3KP6A 1UG2A 4II2A 2LD5A 2VONA 2GQQA 3FXLA 4MGRA 1Z3XA 4PGHA 3BT9A 1OCTC 3S93A 3QP6A 3GLXA 4UB6C 3CCJI 1S6LA 2E1CA 4LD5A 1YX3A 5IP6A 3Q3SA 1HC8A 4RAFA 2JRTA 3M3YJ 4FE4A 3BJ6A 3DWLE 1U5TC 4G8XA 4JYKA 3Q9SA 3OL3A 2QSGX 2W85A 1XCVA 1TP4A 2IGOA 2RC4A 3FXKA 2FNPA 5FO5A 1USTA 3QPHA 2O8XA 4XLEA 2XF5A 4XRFA 1B72B 1ZELA 2QCOA 3MD2A 3CCLI 3DPLC 4XONA 4F92B 1H88C 1IJWC 2Z16A 3QPTA 2PMZA 5GP9A 2YX7A 1T0FA 3IUOA 1TWGJ 3RTRA 1GHCA 2KIFA 4EGYA 5EG0A 1IDYA 3E6MA 3GFIA 1MZBA 1OFCX 5BMZA 2M5WA 3CCVI 2W00A 4DNCA 1XGSA 2IA1A 4RLFA 3AG1H 2X48A 3H9GA 3Q0WA 2P7VB 1JJ8C 3J7AO 5J47A 3BG7A 5EEHA 1Z9CA 5D5UB 3IHUA 1V3FA 1ZHFA 3BWGA 4MQVA 5FD6A 4CUGA 2FBKA 3WU1B 2PLYA 3BLYA 4EJOA 5E8IA 2LY9A 2BE5F 2VKEA 2V79A 3TDUC 1IV8A 4W1UA 4IQ4A 1QGPA 3BJOA 2JQ7A 1VQLI 2QM3A 1ZRFA 4NQWA 4GXOA 1FOYA 1BN5A 4D0PA 2H1KA 1L0OC 1OCZH 3TO7A 3K4LA 4UUSA 2E60A 5IYCJ 1G6NA 4Y33A 4CCNA 5IPAA 1DU6A 2HKOA 1ZH5A 4RLQA 3V7SA 2HI3A 4DQ2A 3CMMA 1XB4A 1DP7P 1B4AA 4KJZA 2W4SA 2OV7A 3O3KA 4A3JJ 1YI2I 1PVEA 2QGUA 1MNEA 2WY7Q 2ELKA 3I4MJ 1POGA 2UXNA 4E70A 2VT3A 3CP8A 4LFUA 1MBJA 3TP3A 5J8FA 2ZBKA 3JRDA 1Y39A 2IEKA 1OCOH 1PJRA 2ZNYA 4B1RA 2X4HA 1DUXC 2XAQA 3E3VA 3R61A 3SEZA 2PFBA 4BE2A 3MQ0A 3TGNA 2M7AA 2HGCA 1A5JA 4UVCA 5DTDA 2M9HA 3A1YA 2BHZA 1EH8A 2H94A 2F5VA 2JRMA 1E17A 2VL8A 3MN2A 4DYCA 3V7CA 2DJIA 1HCRA 2R7RA 1OMIA 4LIUA 4L18B 1LE8B 2MGQA 5JLXA 4GFBA 3LQRA 3QOPA 2K85A 4XKVA 3A0BC 2ZKZA 4AIDA 4EJUA 1EH7A 5LD2C 2JTVA 2W25A 1HF0A 3SDBA 1T0FC 3CMYA 2VC1A 2KRCA 2LP0A 1VI0A 2RAEA 1XCBA 3HB9A 4RDUA 2DFHA 2VE9A 4PJMA 2STWA 1B9NA 2HWVA 2W7NA 1OR7A 3F72A 3F0CA 1UG0A 4G6QA 2YS9A 4PJJA 5EEGA 3H3ZA 2F4MB 5HVQC 1TW2A 1FSHA 2LKXA 1BM9A 4DBRA 2P5LC 3AG4H 1VQ7I 2V7FA 2AXTC 2WC2A 3C2GA 5CQGA 2L2OA 2DODA 2Z1DA 3KZZA 3BG6A 3LSHA 3J81K 5FKMA 4BH9A 2CV1A 3JRAA 2EV6A 2DA6A 1BOAA 2IGMA 3MEXA 3W2VA 3F9KA 1IXSB 4EVIA 2HOSA 4PSWA 4CCOA 2IGNA 4YRVA 1YITI 4C30A 4XR6A 3IV5A 3OYMA 3S2DJ 1DDNA 5KAFC 4MHGA 1MMAA 1WCMJ 1LDJA 5ICFA 4R79A 4EM2A 5GAEJ 5KCMA 3F8FA 1ZRDA 3L2WA 2HEOA 4WXCA 4G7ZF 2HXOA 1U5TB 1T6SA 3FXQA 1QZZA 2K4BA 3E5XA 5LRSA 3O8GA 2F5DA 2LKSA 4L5EA 4BXXJ 1IDZA 3EQLF 2DDAA 3TBIA 4M72A 3K4BA 3J7ZI 1FNNA 2R7XA 5A2QK 1VF9A 2Z99A 3W3CA 2O03A 1KONA 3TOBA 3CQZJ 1S72I 1TL8A 4Q5SF 5ILVA 1MMNA 5FKKA 5F1JA 1DGRM 2M3AA 2V6CA 1E2XA 3NAUA 3ISPA 4QWQA 2JA6J 2W57A 2R7ZJ 2LDUA 2IA0A 1MMSA 3EDPA 4XNFA 1XSVA 5HLIA 3ABLH 3CJTB 2TDXA 1X1AA 3JCUC 1Y0NA 2IGKA 3ZOBA 1T8IA 2E2HJ 1YJ9I 1WH7A 1ENHA 2BZTA 4UV9A 1K83J 4XN0A 2B9SA 4BNCA 5FLVA 4IX7A 2LH9A 2IA2A 3E6DA 4ZDPA 3I4PA 1JHHA 2XB0X 2XAHA 4B8XA 1YS6A 2DO7A 2JPBA 2DI3A 3TKYA 4HDUA 3KETA 2Q8KA 4A6EA 3DXJF 3K4KA 3GF2A 1G3YA 4KMFA 2ZC2A 1TQIA 3WU0A 2XHKA 1CF7B 3ZQCA 2VN2A 5GTHC 5ICEA 4M3DA 1NG7A 4WF2A 3OIOA 3G1OA 2IW5A 4XLAA 3IKVA 4WX9A 2A5YB 2KJBA 3DEEA 4LITA 3E6CC 2EK5A 2JT1A 4CZZA 5D4SA 1R5HA 1DU0A 4IHWA 2RN7A 5LRRA 3NARA 2WV1A 5FKOA 3BP8A 3GUDA 4QLCU 2HOTA 2VBWA 1FYLA 3M07A 2ZXIA 1BI2A 5F1RA 5J4YA 6PAXA 5CVVA 3F22A 2Y2ZA 2COMA 3BTCA 2R4GA 2JZYA 1XMAA 2L9VA 3K0LA 3M8FA 4AYBN 5ILUA 5LHHA 3HXLA 2DXIA 2GZWA 4NDLA 4RM2A 2XC7A 2NOGA 2KRFA 2ZCWA 2K9MA 2W24A 4KN7X 3COAC 4S0HB 3O8HA 1Y8RB 1K6OA 4HZFA 4HQMA 1U9OA 1HBXG 2E1OA 4S05A 2R5YB 3VWBA 1D8JA 2HQAA 4DYRA 5BS6A 2BV6A 4IOCF 2DOFA 3GTGJ 2QKLB 5BPDA 4U87A 2Z9OA 5E3LA 5CVJA 3LMMA 1ZKGA 3KP7A 5L3GA 2NS7A 3K1NA 1IUYA 2BHYA 1KQ8A 2GA2A 2ZXHA 2GA1A 1E3PA 2MABA 5H6QA 5HNHA 2STTA 3KP3A 1WQ2A 3EPZA 2E36A 3H0GJ 1PUFA 1BIAA 2HNHA 4KITB 1YJNI 3FIWA 4JX4A 3SFZA 3C2BA 1X3ZB 1QBJA 4ZYHA 2OTJI 1FP2A 2D1VA 1B6AA 3L09A 1BR4A 2X85A 2K9SA 2PBIA 3DPTA 3GEZA 2VBYA 1SFKA 1U9NA 4PCQA 1SFEA 2XIGA 2LY2A 4GCVA 1JUPA 2IRFG 2O61A 1MMDA 2VJIA 4D7MA 2R5ZA 3BR1A 2DTZA 3CCQI 3R60A 3H5NA 1MIJA 5CPRB 3IRRA 2BOLA 4E7JA 1ZR2A 3WTTC 1OYIA 4M3EA 2HR3A 2C6YA 4G7OF 1K78B 2MBFA 2G0EA 2E7XA 2A69F 1LDKB 4XMYA 2Y0SN 3CUQA 2CUFA 1JJ6C 1NK3P 3HKZN 2BGCA 3OS1A 1YX5A 1JT0A 1MSEC 2E1MC 5D5WB 4HLYA 2HXIA 2DAOA 3DBRB 1K7AA 4J19A 5DS9A 1M1EB 2D5VA 1OLTA 2RGVA 1FOWA 1UMQA 5AONA 2VLAA 2JUCA 2MW8A 4BQAA 2E5ZA 2RNGA 3WGHA 1P92A 2IXSA 1Z6RA 2X6XA 3HSEA 3J80K 3IRQA 3BTLA 4DJAA 3GTQJ 3B02A 3RI4A 1IRZA 2ZMEB 5FB2A 5M5YJ 4ENJA 3LA2A 5H6RA 2V4JC 4XSXF 1D1AA 2EFPA 4XICA 2FE3A 2BXYA 3K69A 2LFBA 4E7KA 4A3MJ 3QPLA 4C9YA 2M34A 2P4WA 1BJZA 1ETVA 2X1CA 1FX7A 2WB1N 3O6BB 3BJAA 2K86A 2X0LA 3CO6C 2RQPA 1KQ9A 2IS4A 1TLHB 2KIUA 1HDDC 1I27A 2V9KA 1R5ID 2ID6A 3QU6A 1LFUP 3HHGA 1FIAA 3IWFA 1WFXA 4YIRX 1WJEA 3S3MA 3G73A 2LKPA 1ZR4A 5FFZA 1U2WA 4A3CJ 1X1DA 2X1DA 2X6OA 2WAQN 4M6XA 5F27A 1UB9A 5E3MA 2VXDA 3PO3J 4A12A 1WH5A 4MFEA 2UUZA 4C3HJ 3K7AJ 4C3JJ 3H92A 3LAJA 1HOMA 1I3QJ 4LLGF 2H8RA 1RETA 4FQGA 4M9ZA 3ZN1A 2GXAA 4A6DA 3EUHC 2XV4S 1YOVB 1EF4A 4WXHA 1LEBA 1HSTA 3RPUA 4HBLA 5HS9A 5KNLA 1B9MA 2L5QA 1LFBA 1TW3A 5E1WA 3PIPF 1F4KA 4L0YB 3HOVJ 2L9SA 1JKQC 1Z1DA 3GBGA 4IKFA 3CZ6A 3DP7A 4Q4ZF 5KK1A 4G7HF 1IV6A 2VXZA 4XRSA 5CQEA 1SVMA 2GLOA 2EV5A 2JVGA 4XKWA 1LPQA 2VKDA 1JKPC 3DLAA 1ZLJA 1O3SA 1J59A 1A35A 4QSHA 1HA8A 1JUSA 3C1DA 5JFRA 4YELA 2Y0MA 3ERED 3RSNA 4AC0A 1XX5A 2DOEA 3DEWA 3FISA 1S5LC 4AD9A 1U6GA 2KRHA 3FHZA 2PG4A 2FBHA 4CHUA 5HS7A 2DMTA 4OINF 1Z05A 1RZ4A 2KLOA 4F3QA 2LF7A 5ED4A 4AIKA 2PQ8A 1W5CC 2EWNA 4R8HA 4I01A 4HF0A 1QHGA 4CXFA 3QWLA 4L9TA 1MBGA 2OQRA 5DD4A 4AIHA 2JWTA 2X6YA 3K4MA 2JSCA 2HDCA 3V7RA 2CJJA 4DZJA 1S8NA 3ABKH 4BQNA 4RAZA 4YFXF 3GWZA 2OTLI 5E17F 3HUGB 3A02A 4IVNA 2EIKH 2CQKA 3NQOA 2CQ7A 5J3LA 4KICA 2EFNA 1IXCA 2CU7A 3S2WA 1QZEA 3F8NA 3HOUJ 2P5KA 1KU3A 3C2HA 4HA8A 5D8LB 5LHGA 3QP5A 1BR1A 2M8GX 4ANJA 4FASD 1RNLA 2EV0A 4ZDLA 2DDBA 1ZK8A 3HIFA 3OV8A 1VFCA 2DA1A 5ICGA 1D0YA 2M30A 1HKQA 2F5EA 1G3TA 4E7SA 1ON2A 3CD6I 1YRNB 3B6CA 3GLLA 4HX4A 1ZGWA 1ON1A 4RS8A 3HPHA 1FBSA 2BW3A 4IRHA 2VKHA 4CZCA 1F9NA 1B8IB 1W1WE 1FBUA 3ZRGA 5LLQA 4FE7A 4HSRA 1SC7A 4A0YA 1A6QA 4B47A 3BCBA 2GXBA 1WJCA 3LA7A 3LSPA 2XUBA 1FMWA 4HNVA 3KZIC 1V55H 4XLPF 4Q47A 2JA8J 1MJBA 1SAXA 2E35A 2M1BA 2KDOA 4B3AA 3JRIA 1FTTA 3K2ZA 3TOAA 2F2EA 1NH3A 1SD7A 3H3UA 2WAFA 4ZYAA 1VQ5I 1TWFJ 3JTGA 1MBKA 4LK0F 1YLFA 1XSDA 3H9QA 3WGIA 2QZ8A 4I99C 1ERDA 4PZJA 2ZXWH 3DTIA 1BR2A 3G1MA 3IL2A 1IUFA 4MTEA 1A31A 2P0WA 1I1SA 1Q1HA 4LB5A 3KEQA 3DQVC 5IYDJ 4D5FA 1MDMA 5M3MJ 1H89C 5GADJ 2BY3A 1GXQA 1LFPA 5EGOA 4WK8F 4RM3A 5IOZA 2A6TA 2EZHA 3Q0UA 1PDNC 4A0ZA 3RYRA 1H8AC 4D5CA 2CFXA 3F6OA 1D3YA 2DMNA 1H9GA 2EBIA 1O7LA 1LEAA 2BY1A 3ERMA 3I59B 1LNWA 3I58A 4HSTA 1W7PD 2H09A 5FRMA 3A2KA 2FJ1A 1IC8A 1MW7A 2M2EA 1BI0A 4UXNA 2GAUA 3PQKA 1T38A 2B0LA 1V54H 2ESHA 3PFIA 1FLIA 3CC2I 4BHCA 2VIXA 2KP6A 1HKTA 4ZC3A 3MZ8A 5FRNA 1QPMA 4IJAA 4P55A 1NK2P 4A5MA 2HZDA 2K7LA 2W82A 1EKEA 4BE1A 1ZAOA 3OL4A 2ZJ2A 3HYIA 1BOBA 1ETQA 3HGYA 4YIFA 1ZREA 3ZMSA 3ABTA 1TZLA 4I7HA 3O2PE 3A01A 2R93J 3E5QA 3BR2A 1ONVA 1DQUA 3EETA 1GT0C 4O6JA 2XGEA 3G6EI 3S1MJ 1MH3A 2M7BA 3HGGA 3DV8A 1YJWI 3ZQ7A 3OY9A 4D1QA 4N4OB 2YU9J 2EFWA 4ZDOA 3MCZA 1QVTA 3CTAA 3TEDA 3LQQA 2IT0A 2XGCA 2AO9A 3S8PA 5JI6A 2R0QC 3PJRA 1H0MA 2W48A 4J01A 5F04A 3OS0A 4CCKA 1VZ0A 4C2MJ 4KFCA 3LSIA 3LSTA 1FIPA 3U2RA 3JRGA 3ZR8X 1J0RA 4DZPA 2V9PA 1HQCA 4BAYA 1YO5C 1S29A 1REPC 1RC9A 3VPRA 1KQ0A 1TNTA 1BA5A 3JSOA 3D5RC 2VE8A 2OA4A 1N77A 2Q2EA 4FISA 4HEA2 2H8WA 1JE8A 5IT3A 2GIVA 3UNGC 4GYIA 3B6AA 3E1SA 2L7KA 1UZCA 1H9TA 2ADUA 2OD5A 4EGZA 1BW6A 3OYHA 5TRDA 3L2CA 2X1EA 2DQRA 1FMVA 1T39A 3GTPJ 3NRVA 3KP5A 1MDMB 4L0ZB 2LR8A 3ZQLA 3HTSB 3QU3A 2ETHA 2JA2A 4DYQA 4NC6A 1X2NA 2HTSA 4M3BA 1PUFB 2E2IJ 3LSMA 2QEXI 1QA6A 2EA2A 1JKRC 2PMZN 4LIVA 1YIOA 3A03A 2WAQA 3WTUC 2R5YA 4KNYA 4KIBA 1P7IA 3VSKA 1GVJA 1Y6IA 3K4CA 3CC7I 3ZQQA 2EIMH 3SXYA 2EILH 4KMUX 3OYJA 2IPQX 4HV5A 1K4TA 1VQ6I 3JREA 2HKXA 1W36C 1SFXA 2CO5A 3D5SC 2ZSHB 5M5XJ 4FTHA 3TL4X 1TQMA 1Y56A 3FBIB 1ORKA 2DBBA 5B1AH 5HNFA 4I2OA 5F0CA 1R49A 2CFOA 4A3EJ 4IOAF 4TV7A 3DEUA 5F08A 3CESA 2JSPA 1DP3A 5IOYA 4B09A 1OR7C 4XOTA 3EUKL 3E7LA 3KZYA 5DCFA 2PJRB 1STZA 2ZFWA 5FFXA 3OYBA 2GOXB 1WHUA 3ZMZA 3M8JA 1HW2A 2BYVE 2DA2A 1WGXA 1AOYA 2DYSH 3TO9A 5AIPA 4DGWB 1FYKA 2QBYB 2NVUB 2GOMA 2VJ4A 2DMQA 4F7ZA 2L01A 3KYCB 2WB1A 2CMPA 3AG3H 3N05A 1MBEA 3F23A 2G7HA 4ZTJA 2QLZA 5J40A 4A3LJ 4RBOA 2ZMEA 2P81A 2XAGA 1O3TA 4HX8A 1P9QC 4EJWA 3VYTB 2PX9A 3U1KA 3K70C 2D2WA 2XF7A 4E7IA 1XPXA 3CUQB 3CMAI 2L9NA 1G2HA 2F5CA 4KYWA 2MD5A 3PSFA 1QQIA 1RESA 3VODA 4CO8A 2MH9A 2UXXA 1HW1A 3FXOA 3CLQA 3E5UA 2XSJC 3DFGA 3OR1C 5ICCA 5L3BA 2COBA 1OISA 1IN5A 2Q0OA 3TP0A 2HVSA 3HG9A 2QF7A 4X1EA 1J09A 2KQRA 2XB5A 1P4AA 1GVDA 3HBLA 3J81Z 2XAJA 1XG1A 1YFHA 3LSRA 4EMSA 2Q2EB 3BOQA 3WU2C 2F48A 3LOCA 3K10A 2M4GA 3BR0A 3SDGA 1Z7UA 5BNGA 3HL2A 1Y0UA 2KL4A 3I9V2 2O0YA 3C3WA 4D7NA 5CLSA 4AVPA 1LVAA 4M74A 4A3IJ 1YW9A 2BEOA 5FROA 4BDZA 3OYGA 3GTMJ 1O57A 4BQQA 3S1RJ 3ABMH 3LFKA 5F0FA 3U1DA 2DCEA 4CGZA 4Y17A 3RQIA 3HOWJ 3KLOA 2E19A 3LSKA 3NEUA 4M9SA 3N4MA 3BDDA 1VQPI 1U8RA 2EB7A 4N0BA 1RKWA 3HPGA 2JA5J 2FF4A 2K3PA 3AKZA 4Y3OA 4IHTA 2CW0F 5A2QZ 2HFHA 2MLKA 3G2BA 2DMPA 4AU7A 4LG0A 3VOEA 3GTJJ 4FX0A 1PUEE 2ZJPF 4XSZF 2V9VA 3TDZC 3FBNB 2ZFUA 1OCPA 4YFKF 2M0MA 2O3FA 4KN4X 2X51A 3DF8A 2L0KA 3SZPA 2MH2A 1W36D 3SJMA 4BUPA 2DQLA 2I5UA 2DT6A 4RB3C 2G9WA 3FZVA 4CCMA 4GRIA 3R0JA 2NXNB 1R7JA 1YYVA 1IN7A 3GCMA 3Q5FA 2BY2A 2R7QA 1D5YA 2DN0A 3E6BA 4WCGA 4CDGA 3CCEI 2Y9ZA 4I76A 3OSFA 1R36A 1IN4A 4PJLA 4JBAA 3B73A 4XORA 2AXLA 4I0BA 4NBQA 2ZMEC 2Y9YA 3ZQIA 1R23A 3PNYA 3BC8A 4MNUA 1W7PB 4BL0B 4V19K 2GXGA 4E7LA 2X6WA 2WTEA 4BHBA 3OR2C 1G3WA 1X3WB 4BU2A 1E0EA 2VOPA 4G6DA 1KZHA 2ICWG 1SAUA 1MNMC 5FKLA 5D5XB 2VBXA 5HDGA 3DKWA 3H0DA 2JPCA 1HSJA 3BG5A 2LBFA 3KCCA 4BQOA 2OAZA 4M3GA 4LLLA 4S04A 2ME6A 2EZIA 1VTNC 3MZYA 2H27A 4NHJA 3GVAA 3I71A 4WXDA 5TGTA 1JHFA 2NS0A 2EA4A 2B7EA 2NS8A 3HUGA 1E3OC 2UWMA 4KIGA 5C4JJ 2DOAA 4K2EA 1U0JA 3I0TA 3L00A 4WWCA 2WV0A 4UY8I 3SZGA 4B3XA 4ESJA 4UNOA 3HSFA 3LA3A 2F5FA 3M8EA 2RKHA 3BY6A 3NWTA 5FLXK 1VQ8I 4L5JA 2QSHX 2OJED 2LSOA 2ZJRF 5DUKA 2NAZA 4YG2F 3WTSC 3R0AA 2OZ6A 4ZYEA 3JRHA 2R7SA 3BZ6A 5LGUA 2LMDA 2TRTA 3F8CA 2JVHA 1Z0XA 3HKZA 4LK1F 1IRFA 3QOEA 1VQOI 4ZZLA 2V1NA 1UAAA 1VQNI 2IBDA 1EV7A 3HOTA 1QNTA 1F1ZA 4ESBA 1R71A 2V6EA 3GTKJ 3VYUB 3F8BA 3HRMA 4I0AA 1FP1D 3HHHA 5JR3A 3DU6A 4PJ0C 1YW7A 5ERIA 3UKGA 1RPWA 4W97A 2ZSIB 3BG3A 4BHPA 5AIQA 3H1CA 1G3SA 1FWZA 1I5ZA 3K1MA 3OYEA 3S1NJ 4B44A 3S1QJ 3UR3C 4OIRF 5BQTA 2PI0A 1X1BA 1ZARA 4KDPA 3IAS2 3S2HJ 2XPWA 2HVRA 2KIQA 1OCCH 2QQ8A 3U9GA 3I55I 4ENKA 4ZTFA 3Q9VA 4BE0A 3V4GA 4BJTA 1FOXA 4EEFG 5GAGJ 2M45A 4NUBA 4Y52J 5D6EA 4BACA 3CDLA 1D8KA 1FY7A 2H6CA 2W84A 2O5RA 2KHMA 4YEJA 3CCUI 2KZGA 4A93J 4A0XA 5J1YA 3E0JB 2K27A 1V5GA 3V8KA 3RDIA 2L7FP 4BJ5C 1X4PA 3WODF 3K4NA 1OCRH 5EF6A 2K9LA 2XSDC 1CQTA 2XGDA 4M73A 2HPIA 1RR7A 3CJQB 4UVBA 5HDNA 1J2XA 5K5OA 5D5VB 5TJJA 1TTYA 1KU7A 2Z3YA 1X58A 1JGSA 1FC3A 2ZJQF 1BL0A 5F6FA 2KDZA 1S7OA 2UV1A 2VT2A 4LMYA 4PGGA 3A01B 1BC8C 3BG9A 2GIZA 5J4VA 3RPQA 2KJCA 3GXOA 4N4NB 5K7HA 2CYYA 4EJVA 2P6TA 1S9HA 1BI3A 2EQRA 3TO6A 5D8KB 4RB1A 4BBRJ 1L3LA 1IN8A 3HTUA 5HS8A 4CCJA 4Y13A 2FSWA 1TT0A 2FOKA 1V5FA 1IN6A 4F55A 2Y69H 1WJDA 2DPUA 1MNDA 4DW6A 2IAIA 3J80Z 4IHYA 1TWAJ 5M3FJ 1CGPA 1J5YA 1A36A 3BPVA 3OYIA 2NRAC 1MBFA 3H9JA 4G9YA 4PJNA 5CVIA 2LF8A 3AAFA 2NVXJ 5DM7F 1OQYA 3EUHA 1Y8QB 3V8JA 3M1CA 4IHSA 3QYBA 1S3JA 1W5TA 3CCRI 5BOXA 3J7AY 2HS5A 3AFHA 1Q1VA 2QQ9A 5B66C 1G59A 1T33A 2DW4A 1A6IA 4M9XA 1J7KA 4H0EA 2B63J 1T95A 3S15J 1LJ9A 3OIQA 2OF7A 2F4OB 4U0WA 5L3EA 4OIOF 1NHAA 1ETOA 2A68F 3W2WA 1TBXA 3WG9A 2JUGA 3JAMK 4BYYA 1Z6TA 3OYAA 3IH3A 1HLVA 5C44J 2OPTA 3HEFA 2VPRA 3GZ6A 4HLXA 2O8KA 1RUNA 4MEXF 3S14J 2HU9A 1SMTA 2L7MP 4BY1J 3ZPLA 4HOBA 3ROUA 3WTVC 5CVRA 2L9RA 1WVRA 3FHNA 3ZMDA 1T2KA 3BTIA 3C18A 2RDPA 1OYYA 1VQ9I 1FTZA 3TW7A 4A3FJ 4JX6A 4L9NA 5CJ9A 2V26A 4AUXA 4KISA 3IAM2 1FZPB 2LRDA 1XD7A 1XMXA 3F3XA 5L3CA 2ZXJA 4V2GA 3DBHB 5KAIC 3REOA 5HOOA 3OMYA 3GO5A 3MWMA 2E1NA 1RUOA 1FT9A 1YTYA 2YX4A 4UUVA 1WI3A 2I10A 3KP2A 5EZHA 1AU7A 3BQZA 4ON0A 4HRIA 3IKTA 1FPQA 3CCSI 2K5CA 1ETXA 2OC6A 1FOKA 1Z7LA 3ASNH 1MSFC 3OYFA 2O9LA 2NVQJ 1YHQI 1Y1WJ 3VSLA 3CP2A 1FYMA 2OU2A 1T98A 1IRXA 2HQRA 2A6HF 4JK1X 5KVRA 3SZTA 3OOPA 5J8CA 4J00A 1R4NB 2CUEA 1IZ1A 1SD5A 1D0ZA 3DLLF 2PJRA 5FKNA 3DBLB 1U3EM 3BR5A 1QPIA 2A6EF 2BXZA 2L4AA 3P7NA 4RGRA 4ETSA 5CVUA 3T1BA 4HX7A 2Y0SA 3BROA 3R4KA 4RGUA 2NOJB 3HDDA 1WKMA 4N9IA 4A69C 2A07F 4GDFA 3L9FA 3A4CA 4P9FA 1GDTA 3WTYC 1AWCA 1D1BA 3IH2A 4U7BA 2CW7A 2VOOA 3GFLA 3CO7C 2WA0A 1P4WA 4HAMA 2RNJA 4XKCA 2V1UA 1I6HJ 3HJEA 4RAGA 3EUAA 4OMZA 4F93B 2QKMB 3ONQA 5DEQA 2A5WA 5GTIC 4HNTA 1VNDA 3KX2A 2FXAA 3ZQFA 3L2RA 2CG4A 2Z33A 3CUQC 2JN6A 4ASNA 1GLNA 3M1EA 1GXPA 3H5AA 2AQEA 2CUJA 5E3NA 5EDNA 2DFEA 5F0HA 3JRBA 1CF7A 5LGNA 1UHMA 2MA3A 4ZZDA 2JK3A 4UV8A 1LUJB 4HPQA 3P9CA 1XDUA 2ZNZA 1V4RA 4YFNF 1X4OA 1Z3YA 1R1VA 4Z6YA 5K1YA 1EA3A 4JOMA 2V1XA 3CMEI 4RA2A 2CWEA 2LG4A 4UHTA 5DUIA 3F6VA 3FMSA 3DPUA 5EEAA 1KYZA 3ZMUA 4IL6C 1XDSA 4RB0A 3LL7A 2LK2A 4LG3A 4F91B 1QRYA 1QZYA 2ACJA 1KU2A 2A05A 2EJRA 2VQCA 3L1PA 5DD8A 3HOXJ 3JRFA 5LEJA 3IH4A 3HOYJ 1F36A 5DCMA 4ZJZA 1O7FA 4PDKA 5IY5H 1V5EA 3KEOA 3OYKA 1IRGA 3K2AA 3JAMZ 1HW5A 4ABZA 2E2JJ 3FXUA 3MMYB 2CQNA 1UJ8A 3VYRB 4P1WA 4E6KG 1AKHB 1HXDA 1X19A 1BC7C 4ESFA 2OQGA 1SVLA 3PUFA 4HV6A 1G4DA 9ANTA 4A3DJ 4KT5C 2XPUA 4CICA 4E7ZA 5M5WJ 1WRJA 4Q48A 1LB2A 3CDIA 2MYSA 2QQBA 3JTHA 3FWEA 4LG0B 2KZVA 2K9QA 2E71A 1YS7A 4P9UA 2PJPA 3FKJA 4MIMA 2FQ4A 2ID3A 2J5PA 3MAJA 4CH7A 1SFOJ 2XVCA 3BR3A 3X2QH 5HODA 2GM4A 2YR2A 5J1RA 3I64A 3RKWA 1ZG1A 2YSRA 3ZMVA 1D5VA 3PQJA 5F64A 3SQNA 3PSIA 3RJPA 2KT0A 1U8BA 4G12A 2DA4A 4B48A 2MSYA 1Z21A 1RI7A 4BY7J 1R5GA 3D1NI 2DJNA 3E97A 5GPCA 1I50J 3F8MA 3K70D 4OIPF 1XGMA 1I3AA 1ULYA 4PSXA 4BEHB 2HYFA 4XKBA 1F43A 5LFAA 4I98B 2HVQA 3CDHA 5C3EJ 3OWTA 2RV8A 3DU5A 1X2MA 2QUFA 5K7ZA 3WE3A 4II3A 4M6VA 1R6RA 4AVZA 1BIBA 2L3DA 2MC4A 3J7YJ 2CV2A 2KKOA 1FEXA 2KISA 3KYDB 5GAHJ 4OOIA 3RPUD 3P9KA 1XGNA 2KIMA 1K4SA 2XGXA 4ZYDA 3VYSB 1N78A 3F21A 1RKTA 4XLFA 2WADA 1APLC 3GTLJ 4QPOA 1K78A 2QVOA 1PYVA 3QYFA 1GUUA 3BTJA 4B43A 3ZMTA 2YPRA 5K5RA 1JI8A 5LEKA 2PEXA 3CLOA 3QQAA 3PNVA 2K4JA 4L5IA 3RQ4A 5D6FA 2XROA 2DPDA 3MFKA 3IC7A 2R7FA 4M6YA 4MQ9F 3ZCOA 3FX3A 1N75A 1YE9A 4AIJA 2Y30A 2DMUA 5LGTA 3M4OJ 5E1ZB 2VODA 3AG2H 2BVMA 2AHQA 3I5UA 4UB8C 2OBPA 1Z91A 4HW0A 4KT6A 4IZZA 1I6XA 1MBHA 1R9TJ 1XN7A 2ESNA 2LBFB 2IJLA 3ZGKA 3MVPA 3G3ZA 2V1DA 2EH3A 3DTEA 4BS9A 3TMOA 1DGWY 2VASA 2XPVA 5EYRA 3ZQHA 4ENMA 4BBSJ 5CKTA 1SANA 2RVCA 4HNUA 2A61A 5HLHA 2ME0A 2AQFA 2VQLA 5DCMB 5IYBJ 2FD5A 4EQQA 2HDDA 1HDPA 3FM5A 2RREA 5DV5A 2EPFA 5H20A 4Z2YA 2XF6A 1ZG3A 1AKHA 1FSEA 5IT9Z 1OKRA 1WZ2A 2LYCA 4A3BJ 4LGWA 2L54A 3FK6A 1JXSA 3I56I 1WWXA 3R6SA 3T8TA 1BI1A 3ZXSA 1W0TA 2KFDA 2K9NA 1P6RA 4PK4A 4U88A 2EINH 3ECOA 2M8EA 1ZG5A 3MKYB 1O3QA 3K4JA 1SD4A 2HQNA 3PFYA 1X1PA 3RZOJ 2WWYA 5FLMJ 1ITYA 5JHUA 1WSUA 1S7EA 3BZKA 2HTJA 2FU4A 3MKWB 1K6YA 1ODDA 1J75A 2BW3B 4IXAA 3T5XA 4XRMA 1SFUA 2DLLA 4NC7A 2VQHA 3CJNA 5DYMA 5FD5A 4L9JA 3LFUA 4BKXA 5DM6F 1PP8F 5B1BH 5E1XA 2CS3A 2XKPA 4V2FA 4C3IJ 3JW4A 4P96A 3JR9A 2GWRA 4U0VA 3PM1A 4ENNA 3LSGA 3VDXA 3G4SI 3KE2A 4MO7A 3WTWC 3KIOA 5DDGA 3HSRA 4IRIA 3NWSA 3T0YA 3GYHX 3OS2A 3IP4B 4H4KC 2F4IA 4XRSG 1X1CA 3WHBA 1YIJI 4BGDA 1IF1A 4EV0A 2DA5A 2A3SA 4CYCA 1Z77A 2Q1ZB 3CF2A 4QTRA 1B1BA 3ESWB 3VFZA 3MZHA 4E4HA 1MJ9A 3OYCA 1YQAA 1TNSA 1ZYRF 5D4RA 2JA7J 4DOZA 2L7ZA 4ITVA 3MKLA 2E5NA 2L4MA 2XAFA 4NC8A 4NQWB 4JX5A 4OAZA 3I54A 2XRLA 3VB2A 4X6AJ 4IEJA 2K40A 1OJLA 2H1LA 2LVSA 4O3MA 5ILSA 5EG0B 3OYNA 1MKMA 1MGTA 4OU0A 3D0SA 2FBIA 4B4CA 4IF4A 2LOOA 3V8LA 3HRTA 3HC7A 2HYJA 3I59A 5EJCA 3KPHA 4XM3A 3RYPA 3SFIA 3EYIA 5E8GA 1ZQ3P 3GZNB 3CCMI 1JTXA 2LLKA 2PMHA 1KU9A 4JP0A 2ZO4A 4M71A 5JVGF 1YRNA 1D1CA 4LOCA 2FA5A 3ZN0A 3GFMA 3GTOJ 4G94A 4F52A 2ECCA 1SVOA 4FX4A 2NNYA 2O6GE 3ABUA 3CJRB 2DFIA 1O3RA 1B8IA 4EATA 1WJFA 2IP2A 1UCRA 1ETYA 4C2TA 1JTYA 3KFWX 5EZGA 3RIRA 1JKOC 2XAUA 2FEZA 1ZLKA 2LREA 4LLNA 1OYWA 1IO2A 3LWFA 2ELHA 4R1HA 2XRNA 1XSXA 1TC3C 1AHDP 4CCLA 1A04A 2PMUA 4FHTA 1QU3A 2TCTA 2HDWA 2LNBA 4XN3A 1ZRCA 4HF1A 5C4XJ 1ZN2A 1R58A 4XL9A 3HZJA 1ZGAA 2P6SA 2XDVA 3L2QA 1XGOA 2IVMA 4XIDA 2QENA 1QVUA 5BPIA 2O7OA 2R7TA 3QPSA 4GGGA 1IG7A 2DFFA 4LJZF 4ZH4F 4HYEA 1K79A 4BJ6C 3IWZA 3S32A 5KHDA 4PFPA 2DA7A 1JT6A 4EM0B 4U0YA 1B59A 3RZDJ 2RQQA 4A5NA 1BBYA 3DKXA 2Y75A 2PN6A 5CYVA 4OAYA 3ELKA 3K1PA 5EGOB 2P8TA 1P7JA 4BDYA 1OPCA 4JQFA 3WGGA 5JVTA 1HKSA 4N9HA 3RKYA 4CSWA 1K61A 1LE8A 2G7UA 2LTPA 3S3OA 2VBZA 2GBYA 4L9VA 2FUG2 2L02A 1KGSA 4Y7NJ 1ACIA 3SHFA 1D0XA 2WAEA 2DK8A 2FOWA 3KLNA 3SEQA 2WBMA 4LB6B 1G8XA 5H2FC 2ECBA 2OUMA 4CYCB 1NTCA 2MG4A 5IP9J 1I39A 2R3SA 4A3GJ 1P2FA 4RMNA 3GFJA 4XOPA 3FF5A 1YW8A 4XLHA 1F5TA 3OIPA 3VEPA 4RGSA 1W0UA 3S17J 1WI9A 2VPLA 3L2VA 2Z5UA 1GV5A 1U5TA 2DYRH 2OCCH 3I4NJ 3DTKA 4OMYA 3HOZJ 2NNNA 4GYGA 1LVKA 2M87A 1VQMI 1RIOH 3FDYA 3V42A 3KP4A 4IQJA 3Q0VA 2W1OA 3N97A 2MFZA 4IPAA 2D45A 3D5LA 3S3NA 1QHHD 2CSOA 2K3FA 2KPMA 3LAPA 4UVAA 3ASOH 5B5EC 2D1HA 1BW5A 2K02A 5LBQA 4KA4A 2Z2SB 3CF5F 1IAWA 2HPMA 3FMQA 5K5QA 1DPUA 3ZP5A 2EZKA 5JLWA 2ISZA 4IO9F 4IRGA 1WJAA 1UELB 4QIWN 4GO1A 2H6BA 2CRGA 2MC3A 3P9IA 4NB5A 5FJ8J 4I09A 3WTZA 3C7JA 2ISYA 5JHFA 2P5VA 1UHWA 1ZGJA 3FXJA 1RR8C 3HRSA 1R4MB 3BR6A 2JMWA 2R92J 2DK5A 3U21A 2QSFX 1R00A 2WY8Q 2R7DA 2FMYA 4KIFA 3P5JA 2E7WA 3W6JB 1GV2A 2CQQA 4AYBA 4E7HA 2R7WA 3CC4I 4G6TB 4PFOA 5E3OA 4DIQA 1MMGA 2VJ5A 3ULQB 1MH4A 2VI6A 2VC0A 4KUMA 2I8DA 3GZ5A 2KMUA 4RGXA 2DT5A 2Y31A 1TT5B 3A0HC 4IHXA 3PUBA 4RAYA 3GMEA 4HQEA 1EJ9A 2BY0A 1IW7F 1LQ1A
chains in the Genus database with same CATH topology
3FK7A 1ORKA 4S0HB 5F0CA 4A3EJ 2N8GA 3O8HA 5E3NA 5EDNA 5F0HA 3JRBA 1JGGA 3WHCA 1FJLA 2JK3A 5F08A 5IOYA 1U9OA 2E1OA 4MFDA 2CQXA 2R5YB 3E7LA 4MLOA 4DYRA 3GTGJ 5E3LA 1T56A 5EEAA 1TWCJ 1ZTRA 1ZKGA 2DA2A 2DA3A 2LK2A 2NS7A 1QRYA 1WGXA 3OSGA 3L1PA 1UHSA 2DMQA 3HOXJ 3W6VA 3JRFA 3LSJA 3OOUA 3IH4A 1ETWA 1F36A 1MBEA 3HOYJ 4A3LJ 4RBOA 1JUMA 1PUFA 2P81A 3H0GJ 3K2AA 1XS9A 1XC5A 4ABZA 2E2JJ 3FIWA 4JX4A 1AKHB 3C2BA 4FCYA 2NVTJ 2ZB9A 2K9SA 3RKQA 9ANTA 3H3VK 1U9NA 4A3DJ 2XPUA 2VUMJ 1G2HA 1ETKA 5M5WJ 1JUPA 4M3FA 4D7MA 2R5ZA 1B72A 3BR1A 1RESA 2DTZA 3HM5A 2K9QA 4MIMA 2FQ4A 2ID3A 2VKVA 1ZR2A 1SFOJ 3BR3A 5HODA 2GM4A 5IP7J 5J1RA 4IHVA 4M3EA 1U78A 2COBA 3LNQA 3TP0A 2FX0A 2G0EA 2QF7A 2KT0A 2HQ5A 4X1EA 1U8BA 4G12A 2XB5A 2DA4A 2Y0SN 3HBLA 1GVDA 2CUFA 2MSYA 1Y1VJ 1JJ6C 1NK3P 1XG1A 3HKZN 4BY7J 3LSRA 3D1NI 2DJNA 1JT0A 1MSEC 5GPCA 1I50J 2HXIA 2EZLA 4J19A 2R5ZB 3LOCA 3BR0A 5DS9A 3SDGA 2D5VA 1UMQA 1F43A 5J1UA 5BNGA 5K7FA 2MW8A 5C3EJ 5GPAA 1X2MA 4D7NA 2YUSA 3BTLA 3G1LA 5K7ZA 4M6VA 3GTQJ 1IRZA 1FEXA 4A3IJ 2X9DA 5M5YJ 3GTMJ 3JRCA 3S1RJ 4UUSB 5F0FA 4XICA 2LFBA 3TW6A 4A3MJ 3QPLA 1RKTA 3RQIA 2M34A 4A3KJ 1O4XA 2JJ7A 1APLC 3HOWJ 1BJZA 1ETVA 2E19A 2WB1N 3GTLJ 3PO2J 1GUUA 1RKWA 2HOAA 3BTJA 1HDDC 2JA5J 3DCFA 2ID6A 2DMPA 3BQYA 1LFUP 1FIAA 3GTJJ 2NVYJ 1ZR4A 4A3CJ 4XK4A 3QQAA 1OCPA 2X6OA 2WAQN 5F27A 1TWHJ 2L0KA 5E3MA 3PO3J 1IGNA 3SJMA 1WH5A 3S16J 4MFEA 4C3HJ 2Y30A 2DMUA 3K7AJ 3M4OJ 4C3JJ 1HOMA 1I3QJ 1D5YA 2DN0A 2H8RA 2AHQA 2M0CA 2Y9ZA 4I76A 1RETA 3CCYA 3OSFA 1WPKA 1MBHA 1R9TJ 4I6ZA 1EF4A 3ZQGA 2Y9YA 4UUTA 3ZQIA 3MVPA 3FKIJ 2EH3A 1UG2A 3HOVJ 1LFBA 2LD5A 2XPVA 5EYRA 3ZQHA 1JKQC 4BBSJ 3GBGA 1SANA 3BT9A 1OCTC 2ME0A 1IV6A 5IP6A 1MNMC 5IYBJ 3Q3SA 5FKLA 2FD5A 4XRSA 2HDDA 3M3YJ 1HDPA 2GLOA 3BG5A 4FE4A 1AKHA 1JKPC 4M3GA 2ME6A 2EZIA 4QSHA 1JUSA 4A3BJ 3FK6A 4JYKA 1W0TA 2NS8A 2K9NA 4AC0A 3DEWA 1E3OC 3FISA 5C4JJ 1B72B 2QCOA 2DMTA 3RZOJ 5FLMJ 1ITYA 1H88C 1IJWC 1S7EA 5GP9A 1MBGA 1TWGJ 2JWTA 3JRHA 2CJJA 4DZJA 2TRTA 5EG0A 4XRMA 1IDYA 1Z0XA 1OFCX 3A02A 2X48A 3Q0WA 1JJ8C 2IBDA 5J3LA 4BKXA 2CU7A 2LY9A 4V2FA 3GTKJ 3HOUJ 2VKEA 4C3IJ 3JR9A 4W1UA 3PM1A 2M8GX 3LSGA 3UKGA 1RPWA 4W97A 4MO7A 3BG3A 2H1KA 1VFCA 1ZK8A 2DA1A 4UUSA 3S1NJ 5IYCJ 4XRSG 3S1QJ 3WHBA 5IPAA 1DU6A 1YRNB 3B6CA 2DA5A 4CYCA 3S2HJ 1Z77A 1ZGWA 2HI3A 2XPWA 4QTRA 4A3JJ 4EEFG 2JA7J 1B8IB 2L7ZA 2ELKA 3I4MJ 1POGA 3MKLA 4Y52J 4FE7A 4JX5A 3CDLA 2XRLA 4X6AJ 4IEJA 1MBJA 2K40A 1OJLA 3TP3A 3LSPA 3JRDA 4A93J 2IEKA 2LVSA 4HNVA 2JA8J 4B1RA 5J1YA 5EG0B 4B3AA 4B4CA 3JRIA 2L7FP 1FTTA 2HYJA 3SFIA 5DTDA 2M9HA 5EF6A 2XSDC 1CQTA 1ZQ3P 2XGDA 1JTXA 1RR7A 2LLKA 1TWFJ 4JP0A 1MBKA 3MN2A 4DYCA 1YRNA 4LOCA 1X58A 3GTOJ 1BL0A 1HCRA 3G1MA 2ECCA 1IUFA 2KDZA 3A01B 1LE8B 2MGQA 3BG9A 5JLXA 4GFBA 1B8IA 5IYDJ 4D5FA 1ETYA 5M3MJ 1H89C 1JTYA 5EZGA 1JKOC 5K7HA 5EGOA 2EQRA 4BBRJ 5IOZA 2EZHA 1HF0A 3Q0UA 3CMYA 2LP0A 1VI0A 2RAEA 4DW6A 2IAIA 3HB9A 4RDUA 1TWAJ 4D5CA 5M3FJ 1H8AC 1AHDP 1TC3C 4IHYA 2DMNA 2EBIA 2TCTA 1MBFA 5C4XJ 3F0CA 2YS9A 2NVXJ 2FJ1A 1IC8A 2M2EA 4XIDA 2LKXA 1QVUA 1Q1VA 2O7OA 3QPSA 1T33A 1IG7A 1A6IA 2B63J 3S15J 5FKMA 3JRAA 2DA7A 1JT6A 2DA6A 2OF7A 1NK2P 3RZDJ 2HOSA 1ETOA 5EGOB 3IV5A 1P7JA 1ETQA 3HGYA 3IH3A 1HLVA 5C44J 2OPTA 3HEFA 3S2DJ 2VPRA 1WCMJ 1K61A 3A01A 2LTPA 1LE8A 2O8KA 2R93J 3S14J 3BR2A 2HXOA 2GBYA 1GT0C 2L7MP 2XGEA 4BY1J 4Y7NJ 3S1MJ 3O8GA 1MH3A 2L9RA 3HGGA 4L5EA 4BXXJ 1IDZA 3BTIA 2YU9J 1FTZA 2ECBA 3TW7A 4JX6A 4A3FJ 4CYCB 1NTCA 2MG4A 4AUXA 5IP9J 1QVTA 4A3GJ 1VF9A 3TEDA 2XGCA 3CQZJ 2AO9A 5FKKA 4V2GA 2R0QC 5F1JA 2W48A 1W0UA 3S17J 3NAUA 5F04A 1GV5A 2JA6J 1WI3A 2I10A 5EZHA 1AU7A 2R7ZJ 4C2MJ 3BQZA 3HOZJ 3I4NJ 1FIPA 3JRGA 4DZPA 1ETXA 3ZOBA 2E2HJ 1MSFC 1WH7A 1ENHA 3Q0VA 2O9LA 1K83J 3VPRA 2NVQJ 5FLVA 1Y1WJ 1BA5A 1BW5A 2XB0X 4FISA 2EZKA 5JLWA 3B6AA 2CUEA 4QIWN 5FKNA 2CRGA 3BR5A 1BW6A 1QPIA 5FJ8J 3ZQCA 4M3DA 3OIOA 3G1OA 3HDDA 3GTPJ 4A69C 1A5JA 2LR8A 3BR6A 2JMWA 2R92J 3ZQLA 1DU0A 4IHWA 1GDTA 4DYQA 3IH2A 3NARA 2WV1A 5FKOA 1X2NA 2HOTA 4M3BA 1PUFB 2E2IJ 1GV2A 2CQQA 1JKRC 2PMZN 3A03A 2Y2ZA 2R5YA 3BTCA 5E3OA 1P7IA 1I6HJ 1MH4A 2VI6A 4AYBN 4NDLA 2NOGA 3JREA 1VNDA 2Y31A 4IHXA 3ZQFA 5M5XJ 4FTHA 2JN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FK7 A;  1ORK A;  4S0H B;  5F0C A;  4A3E J;  2N8G A;  3O8H A;  5E3N A;  5EDN A;  5F0H A;  3JRB A;  1JGG A;  3WHC A;  1FJL A;  2JK3 A;  5F08 A;  5IOY A;  1U9O A;  2E1O A;  4MFD A;  2CQX A;  2R5Y B;  3E7L A;  4MLO A;  4DYR A;  3GTG J;  5E3L A;  1T56 A;  5EEA A;  1TWC J;  1ZTR A;  1ZKG A;  2DA2 A;  2DA3 A;  2LK2 A;  2NS7 A;  1QRY A;  1WGX A;  3OSG A;  3L1P A;  1UHS A;  2DMQ A;  3HOX J;  3W6V A;  3JRF A;  3LSJ A;  3OOU A;  3IH4 A;  1ETW A;  1F36 A;  1MBE A;  3HOY J;  4A3L J;  4RBO A;  1JUM A;  1PUF A;  2P81 A;  3H0G J;  3K2A A;  1XS9 A;  1XC5 A;  4ABZ A;  2E2J J;  3FIW A;  4JX4 A;  1AKH B;  3C2B A;  4FCY A;  2NVT J;  2ZB9 A;  2K9S A;  3RKQ A;  9ANT A;  3H3V K;  1U9N A;  4A3D J;  2XPU A;  2VUM J;  1G2H A;  1ETK A;  5M5W J;  1JUP A;  4M3F A;  4D7M A;  2R5Z A;  1B72 A;  3BR1 A;  1RES A;  2DTZ A;  3HM5 A;  2K9Q A;  4MIM A;  2FQ4 A;  2ID3 A;  2VKV A;  1ZR2 A;  1SFO J;  3BR3 A;  5HOD A;  2GM4 A;  5IP7 J;  5J1R A;  4IHV A;  4M3E A;  1U78 A;  2COB A;  3LNQ A;  3TP0 A;  2FX0 A;  2G0E A;  2QF7 A;  2KT0 A;  2HQ5 A;  4X1E A;  1U8B A;  4G12 A;  2XB5 A;  2DA4 A;  2Y0S N;  3HBL A;  1GVD A;  2CUF A;  2MSY A;  1Y1V J;  1JJ6 C;  1NK3 P;  1XG1 A;  3HKZ N;  4BY7 J;  3LSR A;  3D1N I;  2DJN A;  1JT0 A;  1MSE C;  5GPC A;  1I50 J;  2HXI A;  2EZL A;  4J19 A;  2R5Z B;  3LOC A;  3BR0 A;  5DS9 A;  3SDG A;  2D5V A;  1UMQ A;  1F43 A;  5J1U A;  5BNG A;  5K7F A;  2MW8 A;  5C3E J;  5GPA A;  1X2M A;  4D7N A;  2YUS A;  3BTL A;  3G1L A;  5K7Z A;  4M6V A;  3GTQ J;  1IRZ A;  1FEX A;  4A3I J;  2X9D A;  5M5Y J;  3GTM J;  3JRC A;  3S1R J;  4UUS B;  5F0F A;  4XIC A;  2LFB A;  3TW6 A;  4A3M J;  3QPL A;  1RKT A;  3RQI A;  2M34 A;  4A3K J;  1O4X A;  2JJ7 A;  1APL C;  3HOW J;  1BJZ A;  1ETV A;  2E19 A;  2WB1 N;  3GTL J;  3PO2 J;  1GUU A;  1RKW A;  2HOA A;  3BTJ A;  1HDD C;  2JA5 J;  3DCF A;  2ID6 A;  2DMP A;  3BQY A;  1LFU P;  1FIA A;  3GTJ J;  2NVY J;  1ZR4 A;  4A3C J;  4XK4 A;  3QQA A;  1OCP A;  2X6O A;  2WAQ N;  5F27 A;  1TWH J;  2L0K A;  5E3M A;  3PO3 J;  1IGN A;  3SJM A;  1WH5 A;  3S16 J;  4MFE A;  4C3H J;  2Y30 A;  2DMU A;  3K7A J;  3M4O J;  4C3J J;  1HOM A;  1I3Q J;  1D5Y A;  2DN0 A;  2H8R A;  2AHQ A;  2M0C A;  2Y9Z A;  4I76 A;  1RET A;  3CCY A;  3OSF A;  1WPK A;  1MBH A;  1R9T J;  4I6Z A;  1EF4 A;  3ZQG A;  2Y9Y A;  4UUT A;  3ZQI A;  3MVP A;  3FKI J;  2EH3 A;  1UG2 A;  3HOV J;  1LFB A;  2LD5 A;  2XPV A;  5EYR A;  3ZQH A;  1JKQ C;  4BBS J;  3GBG A;  1SAN A;  3BT9 A;  1OCT C;  2ME0 A;  1IV6 A;  5IP6 A;  1MNM C;  5IYB J;  3Q3S A;  5FKL A;  2FD5 A;  4XRS A;  2HDD A;  3M3Y J;  1HDP A;  2GLO A;  3BG5 A;  4FE4 A;  1AKH A;  1JKP C;  4M3G A;  2ME6 A;  2EZI A;  4QSH A;  1JUS A;  4A3B J;  3FK6 A;  4JYK A;  1W0T A;  2NS8 A;  2K9N A;  4AC0 A;  3DEW A;  1E3O C;  3FIS A;  5C4J J;  1B72 B;  2QCO A;  2DMT A;  3RZO J;  5FLM J;  1ITY A;  1H88 C;  1IJW C;  1S7E A;  5GP9 A;  1MBG A;  1TWG J;  2JWT A;  3JRH A;  2CJJ A;  4DZJ A;  2TRT A;  5EG0 A;  4XRM A;  1IDY A;  1Z0X A;  1OFC X;  3A02 A;  2X48 A;  3Q0W A;  1JJ8 C;  2IBD A;  5J3L A;  4BKX A;  2CU7 A;  2LY9 A;  4V2F A;  3GTK J;  3HOU J;  2VKE A;  4C3I J;  3JR9 A;  4W1U A;  3PM1 A;  2M8G X;  3LSG A;  3UKG A;  1RPW A;  4W97 A;  4MO7 A;  3BG3 A;  2H1K A;  1VFC A;  1ZK8 A;  2DA1 A;  4UUS A;  3S1N J;  5IYC J;  4XRS G;  3S1Q J;  3WHB A;  5IPA A;  1DU6 A;  1YRN B;  3B6C A;  2DA5 A;  4CYC A;  3S2H J;  1Z77 A;  1ZGW A;  2HI3 A;  2XPW A;  4QTR A;  4A3J J;  4EEF G;  2JA7 J;  1B8I B;  2L7Z A;  2ELK A;  3I4M J;  1POG A;  3MKL A;  4Y52 J;  4FE7 A;  4JX5 A;  3CDL A;  2XRL A;  4X6A J;  4IEJ A;  1MBJ A;  2K40 A;  1OJL A;  3TP3 A;  3LSP A;  3JRD A;  4A93 J;  2IEK A;  2LVS A;  4HNV A;  2JA8 J;  4B1R A;  5J1Y A;  5EG0 B;  4B3A A;  4B4C A;  3JRI A;  2L7F P;  1FTT A;  2HYJ A;  3SFI A;  5DTD A;  2M9H A;  5EF6 A;  2XSD C;  1CQT A;  1ZQ3 P;  2XGD A;  1JTX A;  1RR7 A;  2LLK A;  1TWF J;  4JP0 A;  1MBK A;  3MN2 A;  4DYC A;  1YRN A;  4LOC A;  1X58 A;  3GTO J;  1BL0 A;  1HCR A;  3G1M A;  2ECC A;  1IUF A;  2KDZ A;  3A01 B;  1LE8 B;  2MGQ A;  3BG9 A;  5JLX A;  4GFB A;  1B8I A;  5IYD J;  4D5F A;  1ETY A;  5M3M J;  1H89 C;  1JTY A;  5EZG A;  1JKO C;  5K7H A;  5EGO A;  2EQR A;  4BBR J;  5IOZ A;  2EZH A;  1HF0 A;  3Q0U A;  3CMY A;  2LP0 A;  1VI0 A;  2RAE A;  4DW6 A;  2IAI A;  3HB9 A;  4RDU A;  1TWA J;  4D5C A;  5M3F J;  1H8A C;  1AHD P;  1TC3 C;  4IHY A;  2DMN A;  2EBI A;  2TCT A;  1MBF A;  5C4X J;  3F0C A;  2YS9 A;  2NVX J;  2FJ1 A;  1IC8 A;  2M2E A;  4XID A;  2LKX A;  1QVU A;  1Q1V A;  2O7O A;  3QPS A;  1T33 A;  1IG7 A;  1A6I A;  2B63 J;  3S15 J;  5FKM A;  3JRA A;  2DA7 A;  1JT6 A;  2DA6 A;  2OF7 A;  1NK2 P;  3RZD J;  2HOS A;  1ETO A;  5EGO B;  3IV5 A;  1P7J A;  1ETQ A;  3HGY A;  3IH3 A;  1HLV A;  5C44 J;  2OPT A;  3HEF A;  3S2D J;  2VPR A;  1WCM J;  1K61 A;  3A01 A;  2LTP A;  1LE8 A;  2O8K A;  2R93 J;  3S14 J;  3BR2 A;  2HXO A;  2GBY A;  1GT0 C;  2L7M P;  2XGE A;  4BY1 J;  4Y7N J;  3S1M J;  3O8G A;  1MH3 A;  2L9R A;  3HGG A;  4L5E A;  4BXX J;  1IDZ A;  3BTI A;  2YU9 J;  1FTZ A;  2ECB A;  3TW7 A;  4JX6 A;  4A3F J;  4CYC B;  1NTC A;  2MG4 A;  4AUX A;  5IP9 J;  1QVT A;  4A3G J;  1VF9 A;  3TED A;  2XGC A;  3CQZ J;  2AO9 A;  5FKK A;  4V2G A;  2R0Q C;  5F1J A;  2W48 A;  1W0U A;  3S17 J;  3NAU A;  5F04 A;  1GV5 A;  2JA6 J;  1WI3 A;  2I10 A;  5EZH A;  1AU7 A;  2R7Z J;  4C2M J;  3BQZ A;  3HOZ J;  3I4N J;  1FIP A;  3JRG A;  4DZP A;  1ETX A;  3ZOB A;  2E2H J;  1MSF C;  1WH7 A;  1ENH A;  3Q0V A;  2O9L A;  1K83 J;  3VPR A;  2NVQ J;  5FLV A;  1Y1W J;  1BA5 A;  1BW5 A;  2XB0 X;  4FIS A;  2EZK A;  5JLW A;  3B6A A;  2CUE A;  4QIW N;  5FKN A;  2CRG A;  3BR5 A;  1BW6 A;  1QPI A;  5FJ8 J;  3ZQC A;  4M3D A;  3OIO A;  3G1O A;  3HDD A;  3GTP J;  4A69 C;  1A5J A;  2LR8 A;  3BR6 A;  2JMW A;  2R92 J;  3ZQL A;  1DU0 A;  4IHW A;  1GDT A;  4DYQ A;  3IH2 A;  3NAR A;  2WV1 A;  5FKO A;  1X2N A;  2HOT A;  4M3B A;  1PUF B;  2E2I J;  1GV2 A;  2CQQ A;  1JKR C;  2PMZ N;  3A03 A;  2Y2Z A;  2R5Y A;  3BTC A;  5E3O A;  1P7I A;  1I6H J;  1MH4 A;  2VI6 A;  4AYB N;  4NDL A;  2NOG A;  3JRE A;  1VND A;  2Y31 A;  4IHX A;  3ZQF A;  5M5X J;  4FTH A;  2JN6 A; 
#chains in the Genus database with same CATH topology
 3FK7 A;  4O5V A;  2R7O A;  3ECH A;  2N8G A;  4RB2 C;  4CA0 A;  3JSP A;  1SD6 A;  1DPR A;  1JGG A;  3WHC A;  1FJL A;  3ML6 A;  1J9I A;  1FBQ A;  4MFD A;  3I53 A;  1W4M A;  2CQX A;  3H36 A;  1E3H A;  4U7D A;  4MLO A;  2DT7 B;  5E20 A;  4P5O A;  4Y15 A;  4Y4R A;  2CV0 A;  4FET A;  3HRU A;  3BPX A;  5HDK A;  1IXR C;  2QYO A;  3RKX A;  1T56 A;  3WE2 A;  1I1G A;  4BXU A;  1TWC J;  1WJ5 A;  1ZTR A;  3KYL A;  3WG7 H;  2XKO A;  2FNA A;  2LY1 A;  2DA3 A;  4C2U A;  2HZT A;  2J5O A;  1RRJ A;  2IS2 A;  3FMR A;  3OSG A;  2MLG A;  3QAH A;  4XLN F;  1R1U A;  2OZU A;  1LKX A;  1UHS A;  3MKZ A;  3QRF F;  4CYD A;  3W6V A;  3LSJ A;  3L2U A;  3SYT A;  1LDD A;  3OOU A;  1ETW A;  3T8R A;  3CUO A;  2HOE A;  2XAS A;  3M9A A;  2CGP A;  5HLT A;  1BJA A;  3HOS A;  1JUM A;  1WJB A;  5L3D A;  2CW8 A;  2F6C A;  2IS1 A;  2YU3 A;  1XS9 A;  1XC5 A;  5LHI A;  1R1T A;  2LC2 A;  3H5R A;  4FCY A;  2VQG A;  2ZB9 A;  2NVT J;  2QA4 I;  3RKQ A;  3H35 A;  3DKY A;  4MTD A;  1EH6 A;  3H3V K;  1SMY F;  2VUM J;  4HF2 A;  1ETK A;  2FQ3 A;  4EM1 A;  1YG2 A;  4M3F A;  4ZYG A;  1B72 A;  1P4X A;  2ELJ A;  3HM5 A;  3G71 I;  4BEH A;  1W5S A;  4FT8 A;  2VKV A;  2FML A;  1Z67 A;  1QO0 D;  2CUZ A;  5IP7 J;  3QOD A;  4IHV A;  1U78 A;  3LNQ A;  4XLC A;  2FX0 A;  2R7U A;  2HQ5 A;  3L7W A;  1S7A A;  2QBY A;  3GW2 A;  1Y1V J;  2E34 A;  3M7G A;  5J6X A;  5FLX Z;  4QPQ A;  4AWX B;  2BBY A;  3GX4 X;  3WTX C;  4D9J A;  5HLG A;  2EZL A;  2NYX A;  2QQA A;  1SEU A;  3QYE A;  2R5Z B;  1USS A;  1XMK A;  2HYG D;  3FM3 A;  4HG2 A;  3TQN A;  3I3L A;  4MEY F;  1KA8 A;  3W2A A;  3FXM A;  4A2U A;  2FRH A;  5J1U A;  5K7F A;  5E18 F;  4HDV A;  2VJJ A;  4DBQ A;  5GPA A;  5L3F A;  2YUS A;  3G1L A;  1T08 B;  4OWR B;  3AL0 C;  2X9D A;  1AA7 A;  5TIS C;  2DTR A;  1PP7 U;  1MD0 A;  3JRC A;  3EYY A;  3BCA A;  2QWW A;  4UUS B;  2Y48 A;  2EIJ H;  3TW6 A;  4XQF A;  3AL0 B;  5FGM A;  4BXF A;  4A3K J;  1O4X A;  2JJ7 A;  1TQP A;  1W7P A;  4XBF A;  5IT9 K;  2OCE A;  3FXR A;  3PO2 J;  5E79 C;  4EJT A;  1XTA A;  2CH0 A;  2EFO A;  1MJA A;  2HOA A;  3DCF A;  3BQY A;  2NVY J;  4PUS A;  2IS6 A;  2M4K A;  1KYW A;  4XK4 A;  1VQ4 I;  1VQK I;  4X0G A;  2MD0 A;  1TWH J;  3RCO A;  1IGN A;  2E1M B;  3BZC A;  3PNT A;  3W6K B;  3PIO F;  3S16 J;  1C0W A;  4NNJ A;  1R22 A;  4AM3 A;  5B3S H;  3OYD A;  1UFM A;  2VB6 A;  1NG6 A;  4OIQ F;  2AS5 F;  3KEY A;  2M0C A;  3OYL A;  3CCY A;  2P7C B;  1WPK A;  2UZK A;  3K6G A;  1N25 A;  3PL8 A;  2BVL A;  4I6Z A;  2DU9 A;  1X3U A;  3ZQG A;  4UUT A;  4YII A;  3K9T A;  4I02 A;  2R7V A;  2EFQ A;  3FKI J;  3KP6 A;  1UG2 A;  4II2 A;  2LD5 A;  2VON A;  2GQQ A;  3FXL A;  4MGR A;  1Z3X A;  4PGH A;  3BT9 A;  1OCT C;  3S93 A;  3QP6 A;  3GLX A;  4UB6 C;  3CCJ I;  1S6L A;  2E1C A;  4LD5 A;  1YX3 A;  5IP6 A;  3Q3S A;  1HC8 A;  4RAF A;  2JRT A;  3M3Y J;  4FE4 A;  3BJ6 A;  3DWL E;  1U5T C;  4G8X A;  4JYK A;  3Q9S A;  3OL3 A;  2QSG X;  2W85 A;  1XCV A;  1TP4 A;  2IGO A;  2RC4 A;  3FXK A;  2FNP A;  5FO5 A;  1UST A;  3QPH A;  2O8X A;  4XLE A;  2XF5 A;  4XRF A;  1B72 B;  1ZEL A;  2QCO A;  3MD2 A;  3CCL I;  3DPL C;  4XON A;  4F92 B;  1H88 C;  1IJW C;  2Z16 A;  3QPT A;  2PMZ A;  5GP9 A;  2YX7 A;  1T0F A;  3IUO A;  1TWG J;  3RTR A;  1GHC A;  2KIF A;  4EGY A;  5EG0 A;  1IDY A;  3E6M A;  3GFI A;  1MZB A;  1OFC X;  5BMZ A;  2M5W A;  3CCV I;  2W00 A;  4DNC A;  1XGS A;  2IA1 A;  4RLF A;  3AG1 H;  2X48 A;  3H9G A;  3Q0W A;  2P7V B;  1JJ8 C;  3J7A O;  5J47 A;  3BG7 A;  5EEH A;  1Z9C A;  5D5U B;  3IHU A;  1V3F A;  1ZHF A;  3BWG A;  4MQV A;  5FD6 A;  4CUG A;  2FBK A;  3WU1 B;  2PLY A;  3BLY A;  4EJO A;  5E8I A;  2LY9 A;  2BE5 F;  2VKE A;  2V79 A;  3TDU C;  1IV8 A;  4W1U A;  4IQ4 A;  1QGP A;  3BJO A;  2JQ7 A;  1VQL I;  2QM3 A;  1ZRF A;  4NQW A;  4GXO A;  1FOY A;  1BN5 A;  4D0P A;  2H1K A;  1L0O C;  1OCZ H;  3TO7 A;  3K4L A;  4UUS A;  2E60 A;  5IYC J;  1G6N A;  4Y33 A;  4CCN A;  5IPA A;  1DU6 A;  2HKO A;  1ZH5 A;  4RLQ A;  3V7S A;  2HI3 A;  4DQ2 A;  3CMM A;  1XB4 A;  1DP7 P;  1B4A A;  4KJZ A;  2W4S A;  2OV7 A;  3O3K A;  4A3J J;  1YI2 I;  1PVE A;  2QGU A;  1MNE A;  2WY7 Q;  2ELK A;  3I4M J;  1POG A;  2UXN A;  4E70 A;  2VT3 A;  3CP8 A;  4LFU A;  1MBJ A;  3TP3 A;  5J8F A;  2ZBK A;  3JRD A;  1Y39 A;  2IEK A;  1OCO H;  1PJR A;  2ZNY A;  4B1R A;  2X4H A;  1DUX C;  2XAQ A;  3E3V A;  3R61 A;  3SEZ A;  2PFB A;  4BE2 A;  3MQ0 A;  3TGN A;  2M7A A;  2HGC A;  1A5J A;  4UVC A;  5DTD A;  2M9H A;  3A1Y A;  2BHZ A;  1EH8 A;  2H94 A;  2F5V A;  2JRM A;  1E17 A;  2VL8 A;  3MN2 A;  4DYC A;  3V7C A;  2DJI A;  1HCR A;  2R7R A;  1OMI A;  4LIU A;  4L18 B;  1LE8 B;  2MGQ A;  5JLX A;  4GFB A;  3LQR A;  3QOP A;  2K85 A;  4XKV A;  3A0B C;  2ZKZ A;  4AID A;  4EJU A;  1EH7 A;  5LD2 C;  2JTV A;  2W25 A;  1HF0 A;  3SDB A;  1T0F C;  3CMY A;  2VC1 A;  2KRC A;  2LP0 A;  1VI0 A;  2RAE A;  1XCB A;  3HB9 A;  4RDU A;  2DFH A;  2VE9 A;  4PJM A;  2STW A;  1B9N A;  2HWV A;  2W7N A;  1OR7 A;  3F72 A;  3F0C A;  1UG0 A;  4G6Q A;  2YS9 A;  4PJJ A;  5EEG A;  3H3Z A;  2F4M B;  5HVQ C;  1TW2 A;  1FSH A;  2LKX A;  1BM9 A;  4DBR A;  2P5L C;  3AG4 H;  1VQ7 I;  2V7F A;  2AXT C;  2WC2 A;  3C2G A;  5CQG A;  2L2O A;  2DOD A;  2Z1D A;  3KZZ A;  3BG6 A;  3LSH A;  3J81 K;  5FKM A;  4BH9 A;  2CV1 A;  3JRA A;  2EV6 A;  2DA6 A;  1BOA A;  2IGM A;  3MEX A;  3W2V A;  3F9K A;  1IXS B;  4EVI A;  2HOS A;  4PSW A;  4CCO A;  2IGN A;  4YRV A;  1YIT I;  4C30 A;  4XR6 A;  3IV5 A;  3OYM A;  3S2D J;  1DDN A;  5KAF C;  4MHG A;  1MMA A;  1WCM J;  1LDJ A;  5ICF A;  4R79 A;  4EM2 A;  5GAE J;  5KCM A;  3F8F A;  1ZRD A;  3L2W A;  2HEO A;  4WXC A;  4G7Z F;  2HXO A;  1U5T B;  1T6S A;  3FXQ A;  1QZZ A;  2K4B A;  3E5X A;  5LRS A;  3O8G A;  2F5D A;  2LKS A;  4L5E A;  4BXX J;  1IDZ A;  3EQL F;  2DDA A;  3TBI A;  4M72 A;  3K4B A;  3J7Z I;  1FNN A;  2R7X A;  5A2Q K;  1VF9 A;  2Z99 A;  3W3C A;  2O03 A;  1KON A;  3TOB A;  3CQZ J;  1S72 I;  1TL8 A;  4Q5S F;  5ILV A;  1MMN A;  5FKK A;  5F1J A;  1DGR M;  2M3A A;  2V6C A;  1E2X A;  3NAU A;  3ISP A;  4QWQ A;  2JA6 J;  2W57 A;  2R7Z J;  2LDU A;  2IA0 A;  1MMS A;  3EDP A;  4XNF A;  1XSV A;  5HLI A;  3ABL H;  3CJT B;  2TDX A;  1X1A A;  3JCU C;  1Y0N A;  2IGK A;  3ZOB A;  1T8I A;  2E2H J;  1YJ9 I;  1WH7 A;  1ENH A;  2BZT A;  4UV9 A;  1K83 J;  4XN0 A;  2B9S A;  4BNC A;  5FLV A;  4IX7 A;  2LH9 A;  2IA2 A;  3E6D A;  4ZDP A;  3I4P A;  1JHH A;  2XB0 X;  2XAH A;  4B8X A;  1YS6 A;  2DO7 A;  2JPB A;  2DI3 A;  3TKY A;  4HDU A;  3KET A;  2Q8K A;  4A6E A;  3DXJ F;  3K4K A;  3GF2 A;  1G3Y A;  4KMF A;  2ZC2 A;  1TQI A;  3WU0 A;  2XHK A;  1CF7 B;  3ZQC A;  2VN2 A;  5GTH C;  5ICE A;  4M3D A;  1NG7 A;  4WF2 A;  3OIO A;  3G1O A;  2IW5 A;  4XLA A;  3IKV A;  4WX9 A;  2A5Y B;  2KJB A;  3DEE A;  4LIT A;  3E6C C;  2EK5 A;  2JT1 A;  4CZZ A;  5D4S A;  1R5H A;  1DU0 A;  4IHW A;  2RN7 A;  5LRR A;  3NAR A;  2WV1 A;  5FKO A;  3BP8 A;  3GUD A;  4QLC U;  2HOT A;  2VBW A;  1FYL A;  3M07 A;  2ZXI A;  1BI2 A;  5F1R A;  5J4Y A;  6PAX A;  5CVV A;  3F22 A;  2Y2Z A;  2COM A;  3BTC A;  2R4G A;  2JZY A;  1XMA A;  2L9V A;  3K0L A;  3M8F A;  4AYB N;  5ILU A;  5LHH A;  3HXL A;  2DXI A;  2GZW A;  4NDL A;  4RM2 A;  2XC7 A;  2NOG A;  2KRF A;  2ZCW A;  2K9M A;  2W24 A;  4KN7 X;  3COA C;  4S0H B;  3O8H A;  1Y8R B;  1K6O A;  4HZF A;  4HQM A;  1U9O A;  1HBX G;  2E1O A;  4S05 A;  2R5Y B;  3VWB A;  1D8J A;  2HQA A;  4DYR A;  5BS6 A;  2BV6 A;  4IOC F;  2DOF A;  3GTG J;  2QKL B;  5BPD A;  4U87 A;  2Z9O A;  5E3L A;  5CVJ A;  3LMM A;  1ZKG A;  3KP7 A;  5L3G A;  2NS7 A;  3K1N A;  1IUY A;  2BHY A;  1KQ8 A;  2GA2 A;  2ZXH A;  2GA1 A;  1E3P A;  2MAB A;  5H6Q A;  5HNH A;  2STT A;  3KP3 A;  1WQ2 A;  3EPZ A;  2E36 A;  3H0G J;  1PUF A;  1BIA A;  2HNH A;  4KIT B;  1YJN I;  3FIW A;  4JX4 A;  3SFZ A;  3C2B A;  1X3Z B;  1QBJ A;  4ZYH A;  2OTJ I;  1FP2 A;  2D1V A;  1B6A A;  3L09 A;  1BR4 A;  2X85 A;  2K9S A;  2PBI A;  3DPT A;  3GEZ A;  2VBY A;  1SFK A;  1U9N A;  4PCQ A;  1SFE A;  2XIG A;  2LY2 A;  4GCV A;  1JUP A;  2IRF G;  2O61 A;  1MMD A;  2VJI A;  4D7M A;  2R5Z A;  3BR1 A;  2DTZ A;  3CCQ I;  3R60 A;  3H5N A;  1MIJ A;  5CPR B;  3IRR A;  2BOL A;  4E7J A;  1ZR2 A;  3WTT C;  1OYI A;  4M3E A;  2HR3 A;  2C6Y A;  4G7O F;  1K78 B;  2MBF A;  2G0E A;  2E7X A;  2A69 F;  1LDK B;  4XMY A;  2Y0S N;  3CUQ A;  2CUF A;  1JJ6 C;  1NK3 P;  3HKZ N;  2BGC A;  3OS1 A;  1YX5 A;  1JT0 A;  1MSE C;  2E1M C;  5D5W B;  4HLY A;  2HXI A;  2DAO A;  3DBR B;  1K7A A;  4J19 A;  5DS9 A;  1M1E B;  2D5V A;  1OLT A;  2RGV A;  1FOW A;  1UMQ A;  5AON A;  2VLA A;  2JUC A;  2MW8 A;  4BQA A;  2E5Z A;  2RNG A;  3WGH A;  1P92 A;  2IXS A;  1Z6R A;  2X6X A;  3HSE A;  3J80 K;  3IRQ A;  3BTL A;  4DJA A;  3GTQ J;  3B02 A;  3RI4 A;  1IRZ A;  2ZME B;  5FB2 A;  5M5Y J;  4ENJ A;  3LA2 A;  5H6R A;  2V4J C;  4XSX F;  1D1A A;  2EFP A;  4XIC A;  2FE3 A;  2BXY A;  3K69 A;  2LFB A;  4E7K A;  4A3M J;  3QPL A;  4C9Y A;  2M34 A;  2P4W A;  1BJZ A;  1ETV A;  2X1C A;  1FX7 A;  2WB1 N;  3O6B B;  3BJA A;  2K86 A;  2X0L A;  3CO6 C;  2RQP A;  1KQ9 A;  2IS4 A;  1TLH B;  2KIU A;  1HDD C;  1I27 A;  2V9K A;  1R5I D;  2ID6 A;  3QU6 A;  1LFU P;  3HHG A;  1FIA A;  3IWF A;  1WFX A;  4YIR X;  1WJE A;  3S3M A;  3G73 A;  2LKP A;  1ZR4 A;  5FFZ A;  1U2W A;  4A3C J;  1X1D A;  2X1D A;  2X6O A;  2WAQ N;  4M6X A;  5F27 A;  1UB9 A;  5E3M A;  2VXD A;  3PO3 J;  4A12 A;  1WH5 A;  4MFE A;  2UUZ A;  4C3H J;  3K7A J;  4C3J J;  3H92 A;  3LAJ A;  1HOM A;  1I3Q J;  4LLG F;  2H8R A;  1RET A;  4FQG A;  4M9Z A;  3ZN1 A;  2GXA A;  4A6D A;  3EUH C;  2XV4 S;  1YOV B;  1EF4 A;  4WXH A;  1LEB A;  1HST A;  3RPU A;  4HBL A;  5HS9 A;  5KNL A;  1B9M A;  2L5Q A;  1LFB A;  1TW3 A;  5E1W A;  3PIP F;  1F4K A;  4L0Y B;  3HOV J;  2L9S A;  1JKQ C;  1Z1D A;  3GBG A;  4IKF A;  3CZ6 A;  3DP7 A;  4Q4Z F;  5KK1 A;  4G7H F;  1IV6 A;  2VXZ A;  4XRS A;  5CQE A;  1SVM A;  2GLO A;  2EV5 A;  2JVG A;  4XKW A;  1LPQ A;  2VKD A;  1JKP C;  3DLA A;  1ZLJ A;  1O3S A;  1J59 A;  1A35 A;  4QSH A;  1HA8 A;  1JUS A;  3C1D A;  5JFR A;  4YEL A;  2Y0M A;  3ERE D;  3RSN A;  4AC0 A;  1XX5 A;  2DOE A;  3DEW A;  3FIS A;  1S5L C;  4AD9 A;  1U6G A;  2KRH A;  3FHZ A;  2PG4 A;  2FBH A;  4CHU A;  5HS7 A;  2DMT A;  4OIN F;  1Z05 A;  1RZ4 A;  2KLO A;  4F3Q A;  2LF7 A;  5ED4 A;  4AIK A;  2PQ8 A;  1W5C C;  2EWN A;  4R8H A;  4I01 A;  4HF0 A;  1QHG A;  4CXF A;  3QWL A;  4L9T A;  1MBG A;  2OQR A;  5DD4 A;  4AIH A;  2JWT A;  2X6Y A;  3K4M A;  2JSC A;  2HDC A;  3V7R A;  2CJJ A;  4DZJ A;  1S8N A;  3ABK H;  4BQN A;  4RAZ A;  4YFX F;  3GWZ A;  2OTL I;  5E17 F;  3HUG B;  3A02 A;  4IVN A;  2EIK H;  2CQK A;  3NQO A;  2CQ7 A;  5J3L A;  4KIC A;  2EFN A;  1IXC A;  2CU7 A;  3S2W A;  1QZE A;  3F8N A;  3HOU J;  2P5K A;  1KU3 A;  3C2H A;  4HA8 A;  5D8L B;  5LHG A;  3QP5 A;  1BR1 A;  2M8G X;  4ANJ A;  4FAS D;  1RNL A;  2EV0 A;  4ZDL A;  2DDB A;  1ZK8 A;  3HIF A;  3OV8 A;  1VFC A;  2DA1 A;  5ICG A;  1D0Y A;  2M30 A;  1HKQ A;  2F5E A;  1G3T A;  4E7S A;  1ON2 A;  3CD6 I;  1YRN B;  3B6C A;  3GLL A;  4HX4 A;  1ZGW A;  1ON1 A;  4RS8 A;  3HPH A;  1FBS A;  2BW3 A;  4IRH A;  2VKH A;  4CZC A;  1F9N A;  1B8I B;  1W1W E;  1FBU A;  3ZRG A;  5LLQ A;  4FE7 A;  4HSR A;  1SC7 A;  4A0Y A;  1A6Q A;  4B47 A;  3BCB A;  2GXB A;  1WJC A;  3LA7 A;  3LSP A;  2XUB A;  1FMW A;  4HNV A;  3KZI C;  1V55 H;  4XLP F;  4Q47 A;  2JA8 J;  1MJB A;  1SAX A;  2E35 A;  2M1B A;  2KDO A;  4B3A A;  3JRI A;  1FTT A;  3K2Z A;  3TOA A;  2F2E A;  1NH3 A;  1SD7 A;  3H3U A;  2WAF A;  4ZYA A;  1VQ5 I;  1TWF J;  3JTG A;  1MBK A;  4LK0 F;  1YLF A;  1XSD A;  3H9Q A;  3WGI A;  2QZ8 A;  4I99 C;  1ERD A;  4PZJ A;  2ZXW H;  3DTI A;  1BR2 A;  3G1M A;  3IL2 A;  1IUF A;  4MTE A;  1A31 A;  2P0W A;  1I1S A;  1Q1H A;  4LB5 A;  3KEQ A;  3DQV C;  5IYD J;  4D5F A;  1MDM A;  5M3M J;  1H89 C;  5GAD J;  2BY3 A;  1GXQ A;  1LFP A;  5EGO A;  4WK8 F;  4RM3 A;  5IOZ A;  2A6T A;  2EZH A;  3Q0U A;  1PDN C;  4A0Z A;  3RYR A;  1H8A C;  4D5C A;  2CFX A;  3F6O A;  1D3Y A;  2DMN A;  1H9G A;  2EBI A;  1O7L A;  1LEA A;  2BY1 A;  3ERM A;  3I59 B;  1LNW A;  3I58 A;  4HST A;  1W7P D;  2H09 A;  5FRM A;  3A2K A;  2FJ1 A;  1IC8 A;  1MW7 A;  2M2E A;  1BI0 A;  4UXN A;  2GAU A;  3PQK A;  1T38 A;  2B0L A;  1V54 H;  2ESH A;  3PFI A;  1FLI A;  3CC2 I;  4BHC A;  2VIX A;  2KP6 A;  1HKT A;  4ZC3 A;  3MZ8 A;  5FRN A;  1QPM A;  4IJA A;  4P55 A;  1NK2 P;  4A5M A;  2HZD A;  2K7L A;  2W82 A;  1EKE A;  4BE1 A;  1ZAO A;  3OL4 A;  2ZJ2 A;  3HYI A;  1BOB A;  1ETQ A;  3HGY A;  4YIF A;  1ZRE A;  3ZMS A;  3ABT A;  1TZL A;  4I7H A;  3O2P E;  3A01 A;  2R93 J;  3E5Q A;  3BR2 A;  1ONV A;  1DQU A;  3EET A;  1GT0 C;  4O6J A;  2XGE A;  3G6E I;  3S1M J;  1MH3 A;  2M7B A;  3HGG A;  3DV8 A;  1YJW I;  3ZQ7 A;  3OY9 A;  4D1Q A;  4N4O B;  2YU9 J;  2EFW A;  4ZDO A;  3MCZ A;  1QVT A;  3CTA A;  3TED A;  3LQQ A;  2IT0 A;  2XGC A;  2AO9 A;  3S8P A;  5JI6 A;  2R0Q C;  3PJR A;  1H0M A;  2W48 A;  4J01 A;  5F04 A;  3OS0 A;  4CCK A;  1VZ0 A;  4C2M J;  4KFC A;  3LSI A;  3LST A;  1FIP A;  3U2R A;  3JRG A;  3ZR8 X;  1J0R A;  4DZP A;  2V9P A;  1HQC A;  4BAY A;  1YO5 C;  1S29 A;  1REP C;  1RC9 A;  3VPR A;  1KQ0 A;  1TNT A;  1BA5 A;  3JSO A;  3D5R C;  2VE8 A;  2OA4 A;  1N77 A;  2Q2E A;  4FIS A;  4HEA 2;  2H8W A;  1JE8 A;  5IT3 A;  2GIV A;  3UNG C;  4GYI A;  3B6A A;  3E1S A;  2L7K A;  1UZC A;  1H9T A;  2ADU A;  2OD5 A;  4EGZ A;  1BW6 A;  3OYH A;  5TRD A;  3L2C A;  2X1E A;  2DQR A;  1FMV A;  1T39 A;  3GTP J;  3NRV A;  3KP5 A;  1MDM B;  4L0Z B;  2LR8 A;  3ZQL A;  3HTS B;  3QU3 A;  2ETH A;  2JA2 A;  4DYQ A;  4NC6 A;  1X2N A;  2HTS A;  4M3B A;  1PUF B;  2E2I J;  3LSM A;  2QEX I;  1QA6 A;  2EA2 A;  1JKR C;  2PMZ N;  4LIV A;  1YIO A;  3A03 A;  2WAQ A;  3WTU C;  2R5Y A;  4KNY A;  4KIB A;  1P7I A;  3VSK A;  1GVJ A;  1Y6I A;  3K4C A;  3CC7 I;  3ZQQ A;  2EIM H;  3SXY A;  2EIL H;  4KMU X;  3OYJ A;  2IPQ X;  4HV5 A;  1K4T A;  1VQ6 I;  3JRE A;  2HKX A;  1W36 C;  1SFX A;  2CO5 A;  3D5S C;  2ZSH B;  5M5X J;  4FTH A;  3TL4 X;  1TQM A;  1Y56 A;  3FBI B;  1ORK A;  2DBB A;  5B1A H;  5HNF A;  4I2O A;  5F0C A;  1R49 A;  2CFO A;  4A3E J;  4IOA F;  4TV7 A;  3DEU A;  5F08 A;  3CES A;  2JSP A;  1DP3 A;  5IOY A;  4B09 A;  1OR7 C;  4XOT A;  3EUK L;  3E7L A;  3KZY A;  5DCF A;  2PJR B;  1STZ A;  2ZFW A;  5FFX A;  3OYB A;  2GOX B;  1WHU A;  3ZMZ A;  3M8J A;  1HW2 A;  2BYV E;  2DA2 A;  1WGX A;  1AOY A;  2DYS H;  3TO9 A;  5AIP A;  4DGW B;  1FYK A;  2QBY B;  2NVU B;  2GOM A;  2VJ4 A;  2DMQ A;  4F7Z A;  2L01 A;  3KYC B;  2WB1 A;  2CMP A;  3AG3 H;  3N05 A;  1MBE A;  3F23 A;  2G7H A;  4ZTJ A;  2QLZ A;  5J40 A;  4A3L J;  4RBO A;  2ZME A;  2P81 A;  2XAG A;  1O3T A;  4HX8 A;  1P9Q C;  4EJW A;  3VYT B;  2PX9 A;  3U1K A;  3K70 C;  2D2W A;  2XF7 A;  4E7I A;  1XPX A;  3CUQ B;  3CMA I;  2L9N A;  1G2H A;  2F5C A;  4KYW A;  2MD5 A;  3PSF A;  1QQI A;  1RES A;  3VOD A;  4CO8 A;  2MH9 A;  2UXX A;  1HW1 A;  3FXO A;  3CLQ A;  3E5U A;  2XSJ C;  3DFG A;  3OR1 C;  5ICC A;  5L3B A;  2COB A;  1OIS A;  1IN5 A;  2Q0O A;  3TP0 A;  2HVS A;  3HG9 A;  2QF7 A;  4X1E A;  1J09 A;  2KQR A;  2XB5 A;  1P4A A;  1GVD A;  3HBL A;  3J81 Z;  2XAJ A;  1XG1 A;  1YFH A;  3LSR A;  4EMS A;  2Q2E B;  3BOQ A;  3WU2 C;  2F48 A;  3LOC A;  3K10 A;  2M4G A;  3BR0 A;  3SDG A;  1Z7U A;  5BNG A;  3HL2 A;  1Y0U A;  2KL4 A;  3I9V 2;  2O0Y A;  3C3W A;  4D7N A;  5CLS A;  4AVP A;  1LVA A;  4M74 A;  4A3I J;  1YW9 A;  2BEO A;  5FRO A;  4BDZ A;  3OYG A;  3GTM J;  1O57 A;  4BQQ A;  3S1R J;  3ABM H;  3LFK A;  5F0F A;  3U1D A;  2DCE A;  4CGZ A;  4Y17 A;  3RQI A;  3HOW J;  3KLO A;  2E19 A;  3LSK A;  3NEU A;  4M9S A;  3N4M A;  3BDD A;  1VQP I;  1U8R A;  2EB7 A;  4N0B A;  1RKW A;  3HPG A;  2JA5 J;  2FF4 A;  2K3P A;  3AKZ A;  4Y3O A;  4IHT A;  2CW0 F;  5A2Q Z;  2HFH A;  2MLK A;  3G2B A;  2DMP A;  4AU7 A;  4LG0 A;  3VOE A;  3GTJ J;  4FX0 A;  1PUE E;  2ZJP F;  4XSZ F;  2V9V A;  3TDZ C;  3FBN B;  2ZFU A;  1OCP A;  4YFK F;  2M0M A;  2O3F A;  4KN4 X;  2X51 A;  3DF8 A;  2L0K A;  3SZP A;  2MH2 A;  1W36 D;  3SJM A;  4BUP A;  2DQL A;  2I5U A;  2DT6 A;  4RB3 C;  2G9W A;  3FZV A;  4CCM A;  4GRI A;  3R0J A;  2NXN B;  1R7J A;  1YYV A;  1IN7 A;  3GCM A;  3Q5F A;  2BY2 A;  2R7Q A;  1D5Y A;  2DN0 A;  3E6B A;  4WCG A;  4CDG A;  3CCE I;  2Y9Z A;  4I76 A;  3OSF A;  1R36 A;  1IN4 A;  4PJL A;  4JBA A;  3B73 A;  4XOR A;  2AXL A;  4I0B A;  4NBQ A;  2ZME C;  2Y9Y A;  3ZQI A;  1R23 A;  3PNY A;  3BC8 A;  4MNU A;  1W7P B;  4BL0 B;  4V19 K;  2GXG A;  4E7L A;  2X6W A;  2WTE A;  4BHB A;  3OR2 C;  1G3W A;  1X3W B;  4BU2 A;  1E0E A;  2VOP A;  4G6D A;  1KZH A;  2ICW G;  1SAU A;  1MNM C;  5FKL A;  5D5X B;  2VBX A;  5HDG A;  3DKW A;  3H0D A;  2JPC A;  1HSJ A;  3BG5 A;  2LBF A;  3KCC A;  4BQO A;  2OAZ A;  4M3G A;  4LLL A;  4S04 A;  2ME6 A;  2EZI A;  1VTN C;  3MZY A;  2H27 A;  4NHJ A;  3GVA A;  3I71 A;  4WXD A;  5TGT A;  1JHF A;  2NS0 A;  2EA4 A;  2B7E A;  2NS8 A;  3HUG A;  1E3O C;  2UWM A;  4KIG A;  5C4J J;  2DOA A;  4K2E A;  1U0J A;  3I0T A;  3L00 A;  4WWC A;  2WV0 A;  4UY8 I;  3SZG A;  4B3X A;  4ESJ A;  4UNO A;  3HSF A;  3LA3 A;  2F5F A;  3M8E A;  2RKH A;  3BY6 A;  3NWT A;  5FLX K;  1VQ8 I;  4L5J A;  2QSH X;  2OJE D;  2LSO A;  2ZJR F;  5DUK A;  2NAZ A;  4YG2 F;  3WTS C;  3R0A A;  2OZ6 A;  4ZYE A;  3JRH A;  2R7S A;  3BZ6 A;  5LGU A;  2LMD A;  2TRT A;  3F8C A;  2JVH A;  1Z0X A;  3HKZ A;  4LK1 F;  1IRF A;  3QOE A;  1VQO I;  4ZZL A;  2V1N A;  1UAA A;  1VQN I;  2IBD A;  1EV7 A;  3HOT A;  1QNT A;  1F1Z A;  4ESB A;  1R71 A;  2V6E A;  3GTK J;  3VYU B;  3F8B A;  3HRM A;  4I0A A;  1FP1 D;  3HHH A;  5JR3 A;  3DU6 A;  4PJ0 C;  1YW7 A;  5ERI A;  3UKG A;  1RPW A;  4W97 A;  2ZSI B;  3BG3 A;  4BHP A;  5AIQ A;  3H1C A;  1G3S A;  1FWZ A;  1I5Z A;  3K1M A;  3OYE A;  3S1N J;  4B44 A;  3S1Q J;  3UR3 C;  4OIR F;  5BQT A;  2PI0 A;  1X1B A;  1ZAR A;  4KDP A;  3IAS 2;  3S2H J;  2XPW A;  2HVR A;  2KIQ A;  1OCC H;  2QQ8 A;  3U9G A;  3I55 I;  4ENK A;  4ZTF A;  3Q9V A;  4BE0 A;  3V4G A;  4BJT A;  1FOX A;  4EEF G;  5GAG J;  2M45 A;  4NUB A;  4Y52 J;  5D6E A;  4BAC A;  3CDL A;  1D8K A;  1FY7 A;  2H6C A;  2W84 A;  2O5R A;  2KHM A;  4YEJ A;  3CCU I;  2KZG A;  4A93 J;  4A0X A;  5J1Y A;  3E0J B;  2K27 A;  1V5G A;  3V8K A;  3RDI A;  2L7F P;  4BJ5 C;  1X4P A;  3WOD F;  3K4N A;  1OCR H;  5EF6 A;  2K9L A;  2XSD C;  1CQT A;  2XGD A;  4M73 A;  2HPI A;  1RR7 A;  3CJQ B;  4UVB A;  5HDN A;  1J2X A;  5K5O A;  5D5V B;  5TJJ A;  1TTY A;  1KU7 A;  2Z3Y A;  1X58 A;  1JGS A;  1FC3 A;  2ZJQ F;  1BL0 A;  5F6F A;  2KDZ A;  1S7O A;  2UV1 A;  2VT2 A;  4LMY A;  4PGG A;  3A01 B;  1BC8 C;  3BG9 A;  2GIZ A;  5J4V A;  3RPQ A;  2KJC A;  3GXO A;  4N4N B;  5K7H A;  2CYY A;  4EJV A;  2P6T A;  1S9H A;  1BI3 A;  2EQR A;  3TO6 A;  5D8K B;  4RB1 A;  4BBR J;  1L3L A;  1IN8 A;  3HTU A;  5HS8 A;  4CCJ A;  4Y13 A;  2FSW A;  1TT0 A;  2FOK A;  1V5F A;  1IN6 A;  4F55 A;  2Y69 H;  1WJD A;  2DPU A;  1MND A;  4DW6 A;  2IAI A;  3J80 Z;  4IHY A;  1TWA J;  5M3F J;  1CGP A;  1J5Y A;  1A36 A;  3BPV A;  3OYI A;  2NRA C;  1MBF A;  3H9J A;  4G9Y A;  4PJN A;  5CVI A;  2LF8 A;  3AAF A;  2NVX J;  5DM7 F;  1OQY A;  3EUH A;  1Y8Q B;  3V8J A;  3M1C A;  4IHS A;  3QYB A;  1S3J A;  1W5T A;  3CCR I;  5BOX A;  3J7A Y;  2HS5 A;  3AFH A;  1Q1V A;  2QQ9 A;  5B66 C;  1G59 A;  1T33 A;  2DW4 A;  1A6I A;  4M9X A;  1J7K A;  4H0E A;  2B63 J;  1T95 A;  3S15 J;  1LJ9 A;  3OIQ A;  2OF7 A;  2F4O B;  4U0W A;  5L3E A;  4OIO F;  1NHA A;  1ETO A;  2A68 F;  3W2W A;  1TBX A;  3WG9 A;  2JUG A;  3JAM K;  4BYY A;  1Z6T A;  3OYA A;  3IH3 A;  1HLV A;  5C44 J;  2OPT A;  3HEF A;  2VPR A;  3GZ6 A;  4HLX A;  2O8K A;  1RUN A;  4MEX F;  3S14 J;  2HU9 A;  1SMT A;  2L7M P;  4BY1 J;  3ZPL A;  4HOB A;  3ROU A;  3WTV C;  5CVR A;  2L9R A;  1WVR A;  3FHN A;  3ZMD A;  1T2K A;  3BTI A;  3C18 A;  2RDP A;  1OYY A;  1VQ9 I;  1FTZ A;  3TW7 A;  4A3F J;  4JX6 A;  4L9N A;  5CJ9 A;  2V26 A;  4AUX A;  4KIS A;  3IAM 2;  1FZP B;  2LRD A;  1XD7 A;  1XMX A;  3F3X A;  5L3C A;  2ZXJ A;  4V2G A;  3DBH B;  5KAI C;  3REO A;  5HOO A;  3OMY A;  3GO5 A;  3MWM A;  2E1N A;  1RUO A;  1FT9 A;  1YTY A;  2YX4 A;  4UUV A;  1WI3 A;  2I10 A;  3KP2 A;  5EZH A;  1AU7 A;  3BQZ A;  4ON0 A;  4HRI A;  3IKT A;  1FPQ A;  3CCS I;  2K5C A;  1ETX A;  2OC6 A;  1FOK A;  1Z7L A;  3ASN H;  1MSF C;  3OYF A;  2O9L A;  2NVQ J;  1YHQ I;  1Y1W J;  3VSL A;  3CP2 A;  1FYM A;  2OU2 A;  1T98 A;  1IRX A;  2HQR A;  2A6H F;  4JK1 X;  5KVR A;  3SZT A;  3OOP A;  5J8C A;  4J00 A;  1R4N B;  2CUE A;  1IZ1 A;  1SD5 A;  1D0Z A;  3DLL F;  2PJR A;  5FKN A;  3DBL B;  1U3E M;  3BR5 A;  1QPI A;  2A6E F;  2BXZ A;  2L4A A;  3P7N A;  4RGR A;  4ETS A;  5CVU A;  3T1B A;  4HX7 A;  2Y0S A;  3BRO A;  3R4K A;  4RGU A;  2NOJ B;  3HDD A;  1WKM A;  4N9I A;  4A69 C;  2A07 F;  4GDF A;  3L9F A;  3A4C A;  4P9F A;  1GDT A;  3WTY C;  1AWC A;  1D1B A;  3IH2 A;  4U7B A;  2CW7 A;  2VOO A;  3GFL A;  3CO7 C;  2WA0 A;  1P4W A;  4HAM A;  2RNJ A;  4XKC A;  2V1U A;  1I6H J;  3HJE A;  4RAG A;  3EUA A;  4OMZ A;  4F93 B;  2QKM B;  3ONQ A;  5DEQ A;  2A5W A;  5GTI C;  4HNT A;  1VND A;  3KX2 A;  2FXA A;  3ZQF A;  3L2R A;  2CG4 A;  2Z33 A;  3CUQ C;  2JN6 A;  4ASN A;  1GLN A;  3M1E A;  1GXP A;  3H5A A;  2AQE A;  2CUJ A;  5E3N A;  5EDN A;  2DFE A;  5F0H A;  3JRB A;  1CF7 A;  5LGN A;  1UHM A;  2MA3 A;  4ZZD A;  2JK3 A;  4UV8 A;  1LUJ B;  4HPQ A;  3P9C A;  1XDU A;  2ZNZ A;  1V4R A;  4YFN F;  1X4O A;  1Z3Y A;  1R1V A;  4Z6Y A;  5K1Y A;  1EA3 A;  4JOM A;  2V1X A;  3CME I;  4RA2 A;  2CWE A;  2LG4 A;  4UHT A;  5DUI A;  3F6V A;  3FMS A;  3DPU A;  5EEA A;  1KYZ A;  3ZMU A;  4IL6 C;  1XDS A;  4RB0 A;  3LL7 A;  2LK2 A;  4LG3 A;  4F91 B;  1QRY A;  1QZY A;  2ACJ A;  1KU2 A;  2A05 A;  2EJR A;  2VQC A;  3L1P A;  5DD8 A;  3HOX J;  3JRF A;  5LEJ A;  3IH4 A;  3HOY J;  1F36 A;  5DCM A;  4ZJZ A;  1O7F A;  4PDK A;  5IY5 H;  1V5E A;  3KEO A;  3OYK A;  1IRG A;  3K2A A;  3JAM Z;  1HW5 A;  4ABZ A;  2E2J J;  3FXU A;  3MMY B;  2CQN A;  1UJ8 A;  3VYR B;  4P1W A;  4E6K G;  1AKH B;  1HXD A;  1X19 A;  1BC7 C;  4ESF A;  2OQG A;  1SVL A;  3PUF A;  4HV6 A;  1G4D A;  9ANT A;  4A3D J;  4KT5 C;  2XPU A;  4CIC A;  4E7Z A;  5M5W J;  1WRJ A;  4Q48 A;  1LB2 A;  3CDI A;  2MYS A;  2QQB A;  3JTH A;  3FWE A;  4LG0 B;  2KZV A;  2K9Q A;  2E71 A;  1YS7 A;  4P9U A;  2PJP A;  3FKJ A;  4MIM A;  2FQ4 A;  2ID3 A;  2J5P A;  3MAJ A;  4CH7 A;  1SFO J;  2XVC A;  3BR3 A;  3X2Q H;  5HOD A;  2GM4 A;  2YR2 A;  5J1R A;  3I64 A;  3RKW A;  1ZG1 A;  2YSR A;  3ZMV A;  1D5V A;  3PQJ A;  5F64 A;  3SQN A;  3PSI A;  3RJP A;  2KT0 A;  1U8B A;  4G12 A;  2DA4 A;  4B48 A;  2MSY A;  1Z21 A;  1RI7 A;  4BY7 J;  1R5G A;  3D1N I;  2DJN A;  3E97 A;  5GPC A;  1I50 J;  3F8M A;  3K70 D;  4OIP F;  1XGM A;  1I3A A;  1ULY A;  4PSX A;  4BEH B;  2HYF A;  4XKB A;  1F43 A;  5LFA A;  4I98 B;  2HVQ A;  3CDH A;  5C3E J;  3OWT A;  2RV8 A;  3DU5 A;  1X2M A;  2QUF A;  5K7Z A;  3WE3 A;  4II3 A;  4M6V A;  1R6R A;  4AVZ A;  1BIB A;  2L3D A;  2MC4 A;  3J7Y J;  2CV2 A;  2KKO A;  1FEX A;  2KIS A;  3KYD B;  5GAH J;  4OOI A;  3RPU D;  3P9K A;  1XGN A;  2KIM A;  1K4S A;  2XGX A;  4ZYD A;  3VYS B;  1N78 A;  3F21 A;  1RKT A;  4XLF A;  2WAD A;  1APL C;  3GTL J;  4QPO A;  1K78 A;  2QVO A;  1PYV A;  3QYF A;  1GUU A;  3BTJ A;  4B43 A;  3ZMT A;  2YPR A;  5K5R A;  1JI8 A;  5LEK A;  2PEX A;  3CLO A;  3QQA A;  3PNV A;  2K4J A;  4L5I A;  3RQ4 A;  5D6F A;  2XRO A;  2DPD A;  3MFK A;  3IC7 A;  2R7F A;  4M6Y A;  4MQ9 F;  3ZCO A;  3FX3 A;  1N75 A;  1YE9 A;  4AIJ A;  2Y30 A;  2DMU A;  5LGT A;  3M4O J;  5E1Z B;  2VOD A;  3AG2 H;  2BVM A;  2AHQ A;  3I5U A;  4UB8 C;  2OBP A;  1Z91 A;  4HW0 A;  4KT6 A;  4IZZ A;  1I6X A;  1MBH A;  1R9T J;  1XN7 A;  2ESN A;  2LBF B;  2IJL A;  3ZGK A;  3MVP A;  3G3Z A;  2V1D A;  2EH3 A;  3DTE A;  4BS9 A;  3TMO A;  1DGW Y;  2VAS A;  2XPV A;  5EYR A;  3ZQH A;  4ENM A;  4BBS J;  5CKT A;  1SAN A;  2RVC A;  4HNU A;  2A61 A;  5HLH A;  2ME0 A;  2AQF A;  2VQL A;  5DCM B;  5IYB J;  2FD5 A;  4EQQ A;  2HDD A;  1HDP A;  3FM5 A;  2RRE A;  5DV5 A;  2EPF A;  5H20 A;  4Z2Y A;  2XF6 A;  1ZG3 A;  1AKH A;  1FSE A;  5IT9 Z;  1OKR A;  1WZ2 A;  2LYC A;  4A3B J;  4LGW A;  2L54 A;  3FK6 A;  1JXS A;  3I56 I;  1WWX A;  3R6S A;  3T8T A;  1BI1 A;  3ZXS A;  1W0T A;  2KFD A;  2K9N A;  1P6R A;  4PK4 A;  4U88 A;  2EIN H;  3ECO A;  2M8E A;  1ZG5 A;  3MKY B;  1O3Q A;  3K4J A;  1SD4 A;  2HQN A;  3PFY A;  1X1P A;  3RZO J;  2WWY A;  5FLM J;  1ITY A;  5JHU A;  1WSU A;  1S7E A;  3BZK A;  2HTJ A;  2FU4 A;  3MKW B;  1K6Y A;  1ODD A;  1J75 A;  2BW3 B;  4IXA A;  3T5X A;  4XRM A;  1SFU A;  2DLL A;  4NC7 A;  2VQH A;  3CJN A;  5DYM A;  5FD5 A;  4L9J A;  3LFU A;  4BKX A;  5DM6 F;  1PP8 F;  5B1B H;  5E1X A;  2CS3 A;  2XKP A;  4V2F A;  4C3I J;  3JW4 A;  4P96 A;  3JR9 A;  2GWR A;  4U0V A;  3PM1 A;  4ENN A;  3LSG A;  3VDX A;  3G4S I;  3KE2 A;  4MO7 A;  3WTW C;  3KIO A;  5DDG A;  3HSR A;  4IRI A;  3NWS A;  3T0Y A;  3GYH X;  3OS2 A;  3IP4 B;  4H4K C;  2F4I A;  4XRS G;  1X1C A;  3WHB A;  1YIJ I;  4BGD A;  1IF1 A;  4EV0 A;  2DA5 A;  2A3S A;  4CYC A;  1Z77 A;  2Q1Z B;  3CF2 A;  4QTR A;  1B1B A;  3ESW B;  3VFZ A;  3MZH A;  4E4H A;  1MJ9 A;  3OYC A;  1YQA A;  1TNS A;  1ZYR F;  5D4R A;  2JA7 J;  4DOZ A;  2L7Z A;  4ITV A;  3MKL A;  2E5N A;  2L4M A;  2XAF A;  4NC8 A;  4NQW B;  4JX5 A;  4OAZ A;  3I54 A;  2XRL A;  3VB2 A;  4X6A J;  4IEJ A;  2K40 A;  1OJL A;  2H1L A;  2LVS A;  4O3M A;  5ILS A;  5EG0 B;  3OYN A;  1MKM A;  1MGT A;  4OU0 A;  3D0S A;  2FBI A;  4B4C A;  4IF4 A;  2LOO A;  3V8L A;  3HRT A;  3HC7 A;  2HYJ A;  3I59 A;  5EJC A;  3KPH A;  4XM3 A;  3RYP A;  3SFI A;  3EYI A;  5E8G A;  1ZQ3 P;  3GZN B;  3CCM I;  1JTX A;  2LLK A;  2PMH A;  1KU9 A;  4JP0 A;  2ZO4 A;  4M71 A;  5JVG F;  1YRN A;  1D1C A;  4LOC A;  2FA5 A;  3ZN0 A;  3GFM A;  3GTO J;  4G94 A;  4F52 A;  2ECC A;  1SVO A;  4FX4 A;  2NNY A;  2O6G E;  3ABU A;  3CJR B;  2DFI A;  1O3R A;  1B8I A;  4EAT A;  1WJF A;  2IP2 A;  1UCR A;  1ETY A;  4C2T A;  1JTY A;  3KFW X;  5EZG A;  3RIR A;  1JKO C;  2XAU A;  2FEZ A;  1ZLK A;  2LRE A;  4LLN A;  1OYW A;  1IO2 A;  3LWF A;  2ELH A;  4R1H A;  2XRN A;  1XSX A;  1TC3 C;  1AHD P;  4CCL A;  1A04 A;  2PMU A;  4FHT A;  1QU3 A;  2TCT A;  2HDW A;  2LNB A;  4XN3 A;  1ZRC A;  4HF1 A;  5C4X J;  1ZN2 A;  1R58 A;  4XL9 A;  3HZJ A;  1ZGA A;  2P6S A;  2XDV A;  3L2Q A;  1XGO A;  2IVM A;  4XID A;  2QEN A;  1QVU A;  5BPI A;  2O7O A;  2R7T A;  3QPS A;  4GGG A;  1IG7 A;  2DFF A;  4LJZ F;  4ZH4 F;  4HYE A;  1K79 A;  4BJ6 C;  3IWZ A;  3S32 A;  5KHD A;  4PFP A;  2DA7 A;  1JT6 A;  4EM0 B;  4U0Y A;  1B59 A;  3RZD J;  2RQQ A;  4A5N A;  1BBY A;  3DKX A;  2Y75 A;  2PN6 A;  5CYV A;  4OAY A;  3ELK A;  3K1P A;  5EGO B;  2P8T A;  1P7J A;  4BDY A;  1OPC A;  4JQF A;  3WGG A;  5JVT A;  1HKS A;  4N9H A;  3RKY A;  4CSW A;  1K61 A;  1LE8 A;  2G7U A;  2LTP A;  3S3O A;  2VBZ A;  2GBY A;  4L9V A;  2FUG 2;  2L02 A;  1KGS A;  4Y7N J;  1ACI A;  3SHF A;  1D0X A;  2WAE A;  2DK8 A;  2FOW A;  3KLN A;  3SEQ A;  2WBM A;  4LB6 B;  1G8X A;  5H2F C;  2ECB A;  2OUM A;  4CYC B;  1NTC A;  2MG4 A;  5IP9 J;  1I39 A;  2R3S A;  4A3G J;  1P2F A;  4RMN A;  3GFJ A;  4XOP A;  3FF5 A;  1YW8 A;  4XLH A;  1F5T A;  3OIP A;  3VEP A;  4RGS A;  1W0U A;  3S17 J;  1WI9 A;  2VPL A;  3L2V A;  2Z5U A;  1GV5 A;  1U5T A;  2DYR H;  2OCC H;  3I4N J;  3DTK A;  4OMY A;  3HOZ J;  2NNN A;  4GYG A;  1LVK A;  2M87 A;  1VQM I;  1RIO H;  3FDY A;  3V42 A;  3KP4 A;  4IQJ A;  3Q0V A;  2W1O A;  3N97 A;  2MFZ A;  4IPA A;  2D45 A;  3D5L A;  3S3N A;  1QHH D;  2CSO A;  2K3F A;  2KPM A;  3LAP A;  4UVA A;  3ASO H;  5B5E C;  2D1H A;  1BW5 A;  2K02 A;  5LBQ A;  4KA4 A;  2Z2S B;  3CF5 F;  1IAW A;  2HPM A;  3FMQ A;  5K5Q A;  1DPU A;  3ZP5 A;  2EZK A;  5JLW A;  2ISZ A;  4IO9 F;  4IRG A;  1WJA A;  1UEL B;  4QIW N;  4GO1 A;  2H6B A;  2CRG A;  2MC3 A;  3P9I A;  4NB5 A;  5FJ8 J;  4I09 A;  3WTZ A;  3C7J A;  2ISY A;  5JHF A;  2P5V A;  1UHW A;  1ZGJ A;  3FXJ A;  1RR8 C;  3HRS A;  1R4M B;  3BR6 A;  2JMW A;  2R92 J;  2DK5 A;  3U21 A;  2QSF X;  1R00 A;  2WY8 Q;  2R7D A;  2FMY A;  4KIF A;  3P5J A;  2E7W A;  3W6J B;  1GV2 A;  2CQQ A;  4AYB A;  4E7H A;  2R7W A;  3CC4 I;  4G6T B;  4PFO A;  5E3O A;  4DIQ A;  1MMG A;  2VJ5 A;  3ULQ B;  1MH4 A;  2VI6 A;  2VC0 A;  4KUM A;  2I8D A;  3GZ5 A;  2KMU A;  4RGX A;  2DT5 A;  2Y31 A;  1TT5 B;  3A0H C;  4IHX A;  3PUB A;  4RAY A;  3GME A;  4HQE A;  1EJ9 A;  2BY0 A;  1IW7 F;  1LQ1 A; 
#chains in the Genus database with same CATH homology
 3FK7 A;  1ORK A;  4S0H B;  5F0C A;  4A3E J;  2N8G A;  3O8H A;  5E3N A;  5EDN A;  5F0H A;  3JRB A;  1JGG A;  3WHC A;  1FJL A;  2JK3 A;  5F08 A;  5IOY A;  1U9O A;  2E1O A;  4MFD A;  2CQX A;  2R5Y B;  3E7L A;  4MLO A;  4DYR A;  3GTG J;  5E3L A;  1T56 A;  5EEA A;  1TWC J;  1ZTR A;  1ZKG A;  2DA2 A;  2DA3 A;  2LK2 A;  2NS7 A;  1QRY A;  1WGX A;  3OSG A;  3L1P A;  1UHS A;  2DMQ A;  3HOX J;  3W6V A;  3JRF A;  3LSJ A;  3OOU A;  3IH4 A;  1ETW A;  1F36 A;  1MBE A;  3HOY J;  4A3L J;  4RBO A;  1JUM A;  1PUF A;  2P81 A;  3H0G J;  3K2A A;  1XS9 A;  1XC5 A;  4ABZ A;  2E2J J;  3FIW A;  4JX4 A;  1AKH B;  3C2B A;  4FCY A;  2NVT J;  2ZB9 A;  2K9S A;  3RKQ A;  9ANT A;  3H3V K;  1U9N A;  4A3D J;  2XPU A;  2VUM J;  1G2H A;  1ETK A;  5M5W J;  1JUP A;  4M3F A;  4D7M A;  2R5Z A;  1B72 A;  3BR1 A;  1RES A;  2DTZ A;  3HM5 A;  2K9Q A;  4MIM A;  2FQ4 A;  2ID3 A;  2VKV A;  1ZR2 A;  1SFO J;  3BR3 A;  5HOD A;  2GM4 A;  5IP7 J;  5J1R A;  4IHV A;  4M3E A;  1U78 A;  2COB A;  3LNQ A;  3TP0 A;  2FX0 A;  2G0E A;  2QF7 A;  2KT0 A;  2HQ5 A;  4X1E A;  1U8B A;  4G12 A;  2XB5 A;  2DA4 A;  2Y0S N;  3HBL A;  1GVD A;  2CUF A;  2MSY A;  1Y1V J;  1JJ6 C;  1NK3 P;  1XG1 A;  3HKZ N;  4BY7 J;  3LSR A;  3D1N I;  2DJN A;  1JT0 A;  1MSE C;  5GPC A;  1I50 J;  2HXI A;  2EZL A;  4J19 A;  2R5Z B;  3LOC A;  3BR0 A;  5DS9 A;  3SDG A;  2D5V A;  1UMQ A;  1F43 A;  5J1U A;  5BNG A;  5K7F A;  2MW8 A;  5C3E J;  5GPA A;  1X2M A;  4D7N A;  2YUS A;  3BTL A;  3G1L A;  5K7Z A;  4M6V A;  3GTQ J;  1IRZ A;  1FEX A;  4A3I J;  2X9D A;  5M5Y J;  3GTM J;  3JRC A;  3S1R J;  4UUS B;  5F0F A;  4XIC A;  2LFB A;  3TW6 A;  4A3M J;  3QPL A;  1RKT A;  3RQI A;  2M34 A;  4A3K J;  1O4X A;  2JJ7 A;  1APL C;  3HOW J;  1BJZ A;  1ETV A;  2E19 A;  2WB1 N;  3GTL J;  3PO2 J;  1GUU A;  1RKW A;  2HOA A;  3BTJ A;  1HDD C;  2JA5 J;  3DCF A;  2ID6 A;  2DMP A;  3BQY A;  1LFU P;  1FIA A;  3GTJ J;  2NVY J;  1ZR4 A;  4A3C J;  4XK4 A;  3QQA A;  1OCP A;  2X6O A;  2WAQ N;  5F27 A;  1TWH J;  2L0K A;  5E3M A;  3PO3 J;  1IGN A;  3SJM A;  1WH5 A;  3S16 J;  4MFE A;  4C3H J;  2Y30 A;  2DMU A;  3K7A J;  3M4O J;  4C3J J;  1HOM A;  1I3Q J;  1D5Y A;  2DN0 A;  2H8R A;  2AHQ A;  2M0C A;  2Y9Z A;  4I76 A;  1RET A;  3CCY A;  3OSF A;  1WPK A;  1MBH A;  1R9T J;  4I6Z A;  1EF4 A;  3ZQG A;  2Y9Y A;  4UUT A;  3ZQI A;  3MVP A;  3FKI J;  2EH3 A;  1UG2 A;  3HOV J;  1LFB A;  2LD5 A;  2XPV A;  5EYR A;  3ZQH A;  1JKQ C;  4BBS J;  3GBG A;  1SAN A;  3BT9 A;  1OCT C;  2ME0 A;  1IV6 A;  5IP6 A;  1MNM C;  5IYB J;  3Q3S A;  5FKL A;  2FD5 A;  4XRS A;  2HDD A;  3M3Y J;  1HDP A;  2GLO A;  3BG5 A;  4FE4 A;  1AKH A;  1JKP C;  4M3G A;  2ME6 A;  2EZI A;  4QSH A;  1JUS A;  4A3B J;  3FK6 A;  4JYK A;  1W0T A;  2NS8 A;  2K9N A;  4AC0 A;  3DEW A;  1E3O C;  3FIS A;  5C4J J;  1B72 B;  2QCO A;  2DMT A;  3RZO J;  5FLM J;  1ITY A;  1H88 C;  1IJW C;  1S7E A;  5GP9 A;  1MBG A;  1TWG J;  2JWT A;  3JRH A;  2CJJ A;  4DZJ A;  2TRT A;  5EG0 A;  4XRM A;  1IDY A;  1Z0X A;  1OFC X;  3A02 A;  2X48 A;  3Q0W A;  1JJ8 C;  2IBD A;  5J3L A;  4BKX A;  2CU7 A;  2LY9 A;  4V2F A;  3GTK J;  3HOU J;  2VKE A;  4C3I J;  3JR9 A;  4W1U A;  3PM1 A;  2M8G X;  3LSG A;  3UKG A;  1RPW A;  4W97 A;  4MO7 A;  3BG3 A;  2H1K A;  1VFC A;  1ZK8 A;  2DA1 A;  4UUS A;  3S1N J;  5IYC J;  4XRS G;  3S1Q J;  3WHB A;  5IPA A;  1DU6 A;  1YRN B;  3B6C A;  2DA5 A;  4CYC A;  3S2H J;  1Z77 A;  1ZGW A;  2HI3 A;  2XPW A;  4QTR A;  4A3J J;  4EEF G;  2JA7 J;  1B8I B;  2L7Z A;  2ELK A;  3I4M J;  1POG A;  3MKL A;  4Y52 J;  4FE7 A;  4JX5 A;  3CDL A;  2XRL A;  4X6A J;  4IEJ A;  1MBJ A;  2K40 A;  1OJL A;  3TP3 A;  3LSP A;  3JRD A;  4A93 J;  2IEK A;  2LVS A;  4HNV A;  2JA8 J;  4B1R A;  5J1Y A;  5EG0 B;  4B3A A;  4B4C A;  3JRI A;  2L7F P;  1FTT A;  2HYJ A;  3SFI A;  5DTD A;  2M9H A;  5EF6 A;  2XSD C;  1CQT A;  1ZQ3 P;  2XGD A;  1JTX A;  1RR7 A;  2LLK A;  1TWF J;  4JP0 A;  1MBK A;  3MN2 A;  4DYC A;  1YRN A;  4LOC A;  1X58 A;  3GTO J;  1BL0 A;  1HCR A;  3G1M A;  2ECC A;  1IUF A;  2KDZ A;  3A01 B;  1LE8 B;  2MGQ A;  3BG9 A;  5JLX A;  4GFB A;  1B8I A;  5IYD J;  4D5F A;  1ETY A;  5M3M J;  1H89 C;  1JTY A;  5EZG A;  1JKO C;  5K7H A;  5EGO A;  2EQR A;  4BBR J;  5IOZ A;  2EZH A;  1HF0 A;  3Q0U A;  3CMY A;  2LP0 A;  1VI0 A;  2RAE A;  4DW6 A;  2IAI A;  3HB9 A;  4RDU A;  1TWA J;  4D5C A;  5M3F J;  1H8A C;  1AHD P;  1TC3 C;  4IHY A;  2DMN A;  2EBI A;  2TCT A;  1MBF A;  5C4X J;  3F0C A;  2YS9 A;  2NVX J;  2FJ1 A;  1IC8 A;  2M2E A;  4XID A;  2LKX A;  1QVU A;  1Q1V A;  2O7O A;  3QPS A;  1T33 A;  1IG7 A;  1A6I A;  2B63 J;  3S15 J;  5FKM A;  3JRA A;  2DA7 A;  1JT6 A;  2DA6 A;  2OF7 A;  1NK2 P;  3RZD J;  2HOS A;  1ETO A;  5EGO B;  3IV5 A;  1P7J A;  1ETQ A;  3HGY A;  3IH3 A;  1HLV A;  5C44 J;  2OPT A;  3HEF A;  3S2D J;  2VPR A;  1WCM J;  1K61 A;  3A01 A;  2LTP A;  1LE8 A;  2O8K A;  2R93 J;  3S14 J;  3BR2 A;  2HXO A;  2GBY A;  1GT0 C;  2L7M P;  2XGE A;  4BY1 J;  4Y7N J;  3S1M J;  3O8G A;  1MH3 A;  2L9R A;  3HGG A;  4L5E A;  4BXX J;  1IDZ A;  3BTI A;  2YU9 J;  1FTZ A;  2ECB A;  3TW7 A;  4JX6 A;  4A3F J;  4CYC B;  1NTC A;  2MG4 A;  4AUX A;  5IP9 J;  1QVT A;  4A3G J;  1VF9 A;  3TED A;  2XGC A;  3CQZ J;  2AO9 A;  5FKK A;  4V2G A;  2R0Q C;  5F1J A;  2W48 A;  1W0U A;  3S17 J;  3NAU A;  5F04 A;  1GV5 A;  2JA6 J;  1WI3 A;  2I10 A;  5EZH A;  1AU7 A;  2R7Z J;  4C2M J;  3BQZ A;  3HOZ J;  3I4N J;  1FIP A;  3JRG A;  4DZP A;  1ETX A;  3ZOB A;  2E2H J;  1MSF C;  1WH7 A;  1ENH A;  3Q0V A;  2O9L A;  1K83 J;  3VPR A;  2NVQ J;  5FLV A;  1Y1W J;  1BA5 A;  1BW5 A;  2XB0 X;  4FIS A;  2EZK A;  5JLW A;  3B6A A;  2CUE A;  4QIW N;  5FKN A;  2CRG A;  3BR5 A;  1BW6 A;  1QPI A;  5FJ8 J;  3ZQC A;  4M3D A;  3OIO A;  3G1O A;  3HDD A;  3GTP J;  4A69 C;  1A5J A;  2LR8 A;  3BR6 A;  2JMW A;  2R92 J;  3ZQL A;  1DU0 A;  4IHW A;  1GDT A;  4DYQ A;  3IH2 A;  3NAR A;  2WV1 A;  5FKO A;  1X2N A;  2HOT A;  4M3B A;  1PUF B;  2E2I J;  1GV2 A;  2CQQ A;  1JKR C;  2PMZ N;  3A03 A;  2Y2Z A;  2R5Y A;  3BTC A;  5E3O A;  1P7I A;  1I6H J;  1MH4 A;  2VI6 A;  4AYB N;  4NDL A;  2NOG A;  3JRE A;  1VND A;  2Y31 A;  4IHX A;  3ZQF A;  5M5X J;  4FTH A;  2JN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...