5AIQA

Crystal structure of ligand-free nadr
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
131
Chain Sequence
ASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLLAENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLVFLKLTAEGEKLYEEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIEDALNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTIONAL REGULATOR, MARR FAMILY
publication title Molecular Basis of Ligand-Dependent Regulation of Nadr, the Transcriptional Repressor of Meningococcal Virulence Factor Nada.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
total genus 47
structure length 131
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5aiqA00
2P6SA 5F64A 4XSZF 2W57A 1K6OA 1LVAA 1YFHA 4EM0B 1BC8C 1ZG3A 3M9AA 3E6MA 2XUBA 3IC7A 1FC3A 2TDXA 3GLXA 5E1ZB 3ECOA 2DK5A 3KZZA 4G6DA 4HDVA 4LG0B 3GFIA 2ZO4A 4HZFA 4M6YA 2HEOA 1YG2A 4CO8A 2G7UA 5E8IA 4U0WA 1RUOA 1J7KA 2QVOA 1RI7A 3I53A 3L9FA 1XGNA 2IA2A 5HLHA 2BV6A 4GGGA 2JPCA 5FB2A 2VOPA 3SXYA 3EQLF 2M87A 4OIPF 2A6EF 2VODA 1U5TC 1LNWA 4WXDA 1SFUA 5ILSA 1B9NA 1IN7A 1BOAA 2P8TA 1EH6A 2PN6A 2PQ8A 3L7WA 2HZTA 4Q4ZF 4BH9A 1I1GA 3TO9A 3WTYC 2QYOA 1TNSA 4QLCU 5FFZA 4EM2A 3ABUA 3U9GA 2PJPA 1FSHA 1ZGJA 4G6QA 3BWGA 2NRAC 1T0FA 1SMTA 2ELHA 4HW0A 2AS5F 2C6YA 1FOKA 4K2EA 3KE2A 3ZQ7A 4AVPA 1ONVA 2J5OA 1DPRA 2EB7A 2A07F 3KP7A 3OOPA 3H92A 2F5FA 5IT9K 1TW2A 2FXAA 1U2WA 2HQRA 1B9MA 1F1ZA 3Q9SA 2Z99A 4UHTA 3VFZA 4ENNA 1TQPA 2XAQA 4KIBA 1UCRA 2VBXA 2YPRA 4KYWA 1G3WA 3WGHA 1XDUA 1XGSA 3BY6A 5E18F 3SQNA 2MLGA 4LGWA 1QZZA 2VE8A 1Z91A 4WXHA 3R0JA 2K02A 2H94A 5L3BA 1ZARA 4BXUA 2A68F 2RGVA 1OYWA 2YR2A 1O3SA 3QP6A 4HX8A 2EV5A 2KJCA 4ESFA 3BPVA 1SD7A 2XASA 2DK8A 2LSOA 4ZH4F 4BAYA 1O57A 3B02A 4IRGA 4L0YB 2QQBA 1RUNA 4HA8A 3JSPA 4LB6B 2OZUA 5EEHA 2COMA 5HDKA 1G3SA 4G9YA 1OYIA 4OIQF 1WKMA 3GXOA 1OR7A 2EV0A 3TQNA 5K1YA 3KCCA 2RQPA 4GCVA 3HOSA 3E3VA 2EFPA 2EJRA 5CVIA 3WTTC 5KK1A 5DUKA 2DI3A 2PEXA 4GO1A 3T5XA 3D5LA 3MWMA 3GYHX 4LMYA 3DQVC 2YSRA 5J8CA 3GZ6A 3G73A 3DEUA 1TLHB 4M6XA 3E5XA 1LDJA 4EGZA 3I0TA 2O3FA 3LA2A 3QPTA 2FSWA 1JHFA 4HV5A 2CG4A 5CVVA 1B59A 1YW9A 4ZYGA 2R3SA 5JHUA 3P9IA 1V3FA 2W85A 2FE3A 3BOQA 2XAFA 1U3EM 3HSFA 4HV6A 3V7RA 1L0OC 2L02A 1K78A 4L9VA 2UXXA 3ZMUA 4D0PA 4P55A 4I2OA 1YW8A 1R1VA 4BHCA 1SFEA 2KIUA 2LF8A 3IKTA 1HQCA 3WTVC 4A0YA 3HHHA 2ZNZA 3KEOA 1PDNC 3GUDA 4RS8A 1I1SA 2BE5F 3MZYA 5EEGA 2OU2A 5HS9A 1IW7F 3HSEA 2MC3A 1LJ9A 5E1WA 2WC2A 5E20A 5CVUA 4YIIA 1I5ZA 2K86A 1T98A 4IRHA 4O3MA 3BDDA 3CDHA 3FM3A 5FD6A 2CGPA 2XAGA 4HLYA 4NHJA 3M1EA 5HDGA 5DCFA 3JTHA 4Q48A 3CO6C 1U78A 3Q9VA 2Y0MA 2JZYA 2Q2EA 2FOKA 1XCBA 3TOBA 3EETA 1Z1DA 2Q0OA 2J5PA 3QP5A 3RPQA 4UNOA 3KFWX 1IRFA 4U0VA 2RVCA 2F5DA 1R36A 4LG0A 1MGTA 3HHGA 2CYYA 4KN4X 3ERED 2HYFA 1FPQA 1XGMA 4N0BA 2P5LC 2FEZA 4Y15A 1IN6A 1UFMA 2HKOA 3KP2A 1HKTA 4DNCA 4AWXB 2QBYA 1T39A 1HBXG 3KZYA 2PLYA 4OMYA 2DBBA 5HVQC 3TGNA 1FBUA 3GFMA 2HOEA 2QM3A 2GWRA 1HW5A 1ZG5A 1MJ9A 2XIGA 3MAJA 5CVRA 1FYMA 2QLZA 4S05A 5A2QK 1T2KA 4UUVA 2FU4A 4MGRA 1MZBA 3S2WA 2JSCA 2RV8A 2GIVA 3JAMZ 3TO6A 1EH7A 1TQMA 1RNLA 2STWA 3V8KA 3K69A 3RDIA 1D3YA 3GWZA 4RB3C 3I58A 5LGTA 1B4AA 2ZMEB 3T0YA 4WWCA 3GVAA 2AXLA 1S29A 1R00A 4EJTA 3WTZA 3EYIA 2ZCWA 4WXCA 3WE3A 2UWMA 5L3GA 3FMSA 3EDPA 1G4DA 2R7DA 2QZ8A 2HQNA 4G7HF 4U7DA 5AONA 3LA3A 2MLKA 2XAJA 2D2WA 4A0XA 3FXUA 4EJWA 2NYXA 2HR3A 1J9IA 1KYZA 5K5OA 3WE2A 2X0LA 4JK1X 2FNAA 2HDCA 2E1NA 4BQAA 3IHUA 3WTWC 4GYGA 3D0SA 5D5WB 1BI1A 4KN7X 1MJAA 2VC1A 5H20A 3ML6A 3KP6A 2A5YB 4ESBA 2O61A 2VXZA 4I09A 5K5RA 4M71A 2KIFA 1QPMA 2G9WA 1A04A 4EM1A 3WGIA 1R1UA 1F9NA 4OMZA 4G8XA 1KGSA 1KU2A 3QPHA 1KYWA 4PCQA 3E5QA 3DPTA 3WGGA 3SZTA 5D4SA 3IL2A 4KNYA 2EFNA 3F8MA 3F22A 4OINF 2ISZA 1FNNA 1BI2A 5D4RA 4U7BA 4L5JA 5D8KB 3J80K 2XKOA 1YTYA 3PQJA 3F6OA 3GFJA 2A69F 2QENA 2F2EA 3WG9A 3J81K 2MA3A 2NAZA 1R58A 2QBYB 5J8FA 2PI0A 1H9GA 4O5VA 6PAXA 3DPLC 3HRUA 4HAMA 3BJ6A 4E70A 1H9TA 1BJAA 2K27A 2ISYA 3KEQA 1P4WA 1OMIA 5JFRA 2QWWA 2ADUA 4OOIA 2D45A 2GXBA 1HSTA 5BMZA 4ZYEA 5LBQA 4MNUA 2RDPA 1R5GA 2Z33A 4UVBA 3ZMTA 3RTRA 4RGUA 2DQLA 2KJBA 2GQQA 3ISPA 1ZLJA 3WU0A 3FHZA 2DW4A 4MTEA 5H6RA 1KA8A 2O03A 3L00A 3O3KA 3T8TA 5FLXK 5D5UB 4AIKA 1WI9A 1W7PB 2IP2A 1P2FA 3QOPA 1UHWA 2FBHA 4P5OA 5DDGA 3HOTA 3ZP5A 1QNTA 3ZN0A 4PDKA 1XSDA 3RKXA 4F7ZA 1PP8F 2FRHA 2Y75A 2V9VA 3T8RA 2XGXA 1IRGA 5AIPA 4FX4A 5ERIA 1C0WA 3AAFA 3QAHA 5A2QZ 3K9TA 1RIOH 1MJBA 1FZPB 2MBFA 5LLQA 2BGCA 2NS0A 1WWXA 2ZBKA 3VEPA 2Z9OA 4RB2C 4I02A 1IXRC 4MEYF 5ILVA 1U6GA 2YX4A 3NEUA 3SZPA 1BIBA 5CYVA 1MKMA 2IPQX 2G7HA 2DT5A 4KICA 3V8LA 2W25A 5LEJA 2EFOA 1ZHFA 4ZZLA 3RIRA 4A2UA 3FXRA 2QUFA 3I64A 2YU3A 3IRRA 4EJVA 1FY7A 3M8FA 5HLIA 4I01A 1KU7A 1FT9A 1CF7B 3SHFA 4U0YA 3WTSC 2FBKA 4EVIA 3QU6A 3FX3A 1IF1A 3COAC 5JR3A 4RGSA 1W4MA 1JXSA 5E1XA 5KVRA 1FX7A 2QQ9A 3LA7A 2O0YA 4XRFA 4Y17A 3W6KB 1B6AA 5JVTA 4ENKA 1BM9A 1G6NA 3CUQA 3E6BA 2ZJ2A 4LLGF 3M7GA 2JTVA 4P96A 2EWNA 3O6BB 1ON1A 2VBWA 1AWCA 2GA1A 1NHAA 1TW3A 4H0EA 2EFQA 1Z7UA 1IAWA 3F8CA 4M9XA 3R0AA 4RGXA 2HFHA 3C3WA 3IRQA 4GYIA 3P7NA 2LNBA 2BYVE 3L2CA 2VBZA 2LKPA 2CW0F 1W7PD 4OIOF 4ASNA 1K7AA 2L4AA 3K1PA 5E17F 1D8KA 1FYLA 1S7OA 1MDMA 1U8RA 1XDSA 2ZMEA 5HS8A 2F5EA 1R5HA 4AIHA 4U88A 5IT3A 4RAZA 3BJOA 4L5IA 4NQWA 3DF8A 5D5VB 2DAOA 2B0LA 3J81Z 5ED4A 1LDDA 4LFUA 3V8JA 2JPBA 2DQRA 3ELKA 2XKPA 3TDZC 1USTA 2XHKA 1XD7A 3K1MA 3O2PE 3R61A 1ZYRF 3LQRA 3HUGA 1PUEE 5TJJA 1YIOA 1YLFA 1HW1A 3B73A 2HS5A 3G3ZA 3M8EA 1FBSA 1AOYA 1HXDA 4FHTA 1IZ1A 1XSVA 4R79A 4HF0A 1XB4A 2CO5A 4O6JA 3CJNA 1W5TA 2VONA 1FP1D 3KLOA 3U2RA 1SMYF 1KQ8A 5TRDA 1S7AA 4A12A 2VBYA 1FSEA 4FX0A 3R4KA 4WF2A 1OKRA 4IF4A 5FGMA 3VB2A 3ZMVA 5IT9Z 3PFIA 4XBFA 1UHMA 3FM5A 1LQ1A 1YQAA 4M9ZA 1GVJA 4A5NA 2M1BA 2FNPA 3K0LA 1O3RA 5DD4A 2KRFA 2ZXJA 4UV9A 5HS7A 2VT3A 1J0RA 2FA5A 1KQ0A 3ZMZA 3CUQB 4EQQA 4NB5A 2EV6A 1KQ9A 2VN2A 4L0ZB 3VOEA 4KFCA 4CYDA 2FF4A 2OD5A 2Y48A 2M30A 2ZKZA 3HTUA 2Q8KA 4AD9A 2DO7A 1ZH5A 3I4PA 1GXQA 2KKOA 3E6CC 4IVNA 5E8GA 4MHGA 3LAJA 4XLNF 3F8NA 1S8NA 1S3JA 3J7AO 1R7JA 2PMHA 1BN5A 1LDKB 1R23A 2K4JA 4Q5SF 1MDMB 4HYEA 1R1TA 1V4RA 1FP2A 1R22A 1DUXC 4GXOA 2RKHA 4MQ9F 1FLIA 3IWFA 1LB2A 5DCMB 4ENJA 1YYVA 5LHHA 1Q1HA 2OBPA 3MQ0A 1W7PA 5CLSA 3TDUC 1YW7A 1XN7A 4YIFA 1KU3A 4CGZA 1ZN2A 3HTSB 1ZLKA 2UZKA 4LB5A 5D5XB 3GF2A 2MH9A 3N97A 4LJZF 4N9HA 2OA4A 4B8XA 5LGNA 4UVCA 3WU1B 1I6XA 3W6JB 2M45A 4WCGA 1O7LA 2ETHA 4I0BA 3N4MA 5D8LB 1USSA 5LGUA 2FMYA 4UXNA 4A6EA 2VT2A 3ROUA 1J59A 3KETA 4EJUA 3KP5A 4Z2YA 4RGRA 2P7CB 2FBIA 1T38A 4EGYA 1RZ4A 1IN5A 3GZ5A 4HX7A 1J5YA 2M5WA 2HWVA 3JTGA 4YG2F 5DEQA 4I0AA 4CHUA 2WTEA 5L3EA 3ZMDA 3R6SA 3FXQA 4EMSA 1TBXA 4R8HA 3GW2A 1E17A 5BPDA 3FMQA 4OIRF 2OAZA 1QGPA 4ZZDA 3RYRA 3QRFF 2HKXA 2K4BA 4G94A 3DFGA 2V1XA 1OPCA 4I7HA 3U1DA 1CF7A 4PZJA 2VC0A 2L4MA 1REPC 5BPIA 2H09A 3V4GA 3FMRA 1GHCA 4XSXF 4M72A 4HQEA 3FWEA 5ICFA 4LLNA 5FFXA 3CTAA 3REOA 5DUIA 3DXJF 3I54A 2M8EA 3RKYA 4KMFA 5DV5A 1D8JA 3HRTA 1IN8A 2NNYA 5HLGA 2HYGD 2L3DA 3E6DA 4IJAA 3I59A 5D6FA 2E1CA 5FD5A 2ESNA 1U5TB 1GXPA 2CSOA 2WV0A 2PMUA 2MH2A 4HOBA 2O6GE 2V79A 1E2XA 4BHPA 2A61A 2CQKA 5LRRA 5ICGA 4M74A 1IUYA 3KLNA 1BBYA 5AIQA 4WK8F 5L3DA 1S6LA 3IWZA 5CJ9A 1HKSA 1J2XA 3F3XA 2VOOA 4P9FA 4M9SA 1QZYA 1LEBA 4KMUX 1ULYA 2A6HF 2WWYA 2V6CA 3ECHA 3F8BA 3ULQB 1P92A 3TKYA 3FF5A 4ESJA 5HOOA 5F6FA 1G3TA 3GX4X 4G7ZF 5DD8A 5H6QA 1K79A 2ESHA 3LFKA 3OV8A 4JBAA 4P9UA 4HLXA 2STTA 2IW5A 3WTXC 1Z6RA 4ZYDA 4LK1F 3E5UA 4LLLA 4CZZA 3T1BA 2IA0A 2XAHA 3K1NA 2IVMA 2OQRA 1SAXA 4YFXF 3HRSA 5L3CA 5CVJA 4ENMA 3NRVA 2P5KA 4WX9A 3Q5FA 1VTNC 1O3TA 3H3UA 4IPAA 5L3FA 3CUOA 1ZRFA 4Y13A 2W24A 3IKVA 3EUHA 1OYYA 3V7SA 5K5QA 4EJOA 5LHGA 4PGHA 3JAMK 1JE8A 4RB0A 4YFNF 2IT0A 2LDUA 1FWZA 1WSUA 4IHSA 2HTSA 2HGCA 2A3SA 2E7XA 2F5CA 4FT8A 3TOAA 1X3UA 3ZPLA 2FQ3A 1ZG1A 4RB1A 2UXNA 4EV0A 3R60A 4HDUA 3LSTA 3RKWA 2P5VA 3F8FA 2XROA 3K2ZA 3I5UA 2GZWA 2L01A 2JT1A 2P4WA 1Y0UA 3GO5A 3I59B 2PFBA 4CICA 4UV8A 4A5MA 3GFLA 3V7CA 1WRJA 2BBYA 2W84A 1G3YA 4MEXF 3MEXA 2Z3YA 1XMAA 2XRNA 4XLPF 4I98B 2EA4A 3LWFA 3E97A 5LEKA 2JRTA 4BYYA 2IJLA 3F72A 2RC4A 4A0ZA 2KIMA 4HF1A 2QQAA 3DV8A 3KP3A 1XMKA 2MD5A 1Z9CA 1IXSB 3J80Z 3SFZA 4IRIA 3CLOA 4M73A 1STZA 3BROA 4AIJA 5DCMA 1XSXA 4HBLA 4LD5A 2GAUA 1BC7C 3ABTA 2XV4S 2OZ6A 2X4HA 3HSRA 2DPDA 4MQVA 5ICCA 2DFIA 1WQ2A 5D6EA 1DPUA 1TTYA 1O3QA 3BZ6A 5ILUA 1SD6A 1JHHA 4QWQA 3WODF 1Z6TA 3RYPA 1IXCA 1FYKA 1BI0A 1UB9A 3KP4A 3HRMA 1P6RA 2GA2A 2EA2A 5J6XA 5JI6A 4L9JA 1SFXA 3I71A 3ZMSA 2ACJA 2L54A 4MTDA 3P9CA 3HYIA 1P4AA 2H6BA 2P7VB 2CWEA 4L9NA 1L3LA 2DU9A 3GEZA 3NQOA 1TNTA 1XGOA 4OU0A 2GXGA 2PG4A 1I27A 4ETSA 3FZVA 4Q47A 1FBQA 3C7JA 2ZFWA 3MZHA 2RNJA 5FLXZ 4PGGA 3CUQC 1YO5C 1IN4A 3PQKA 4L18B 4A6DA 1ZREA 3C18A 4IHTA 2P6TA 1EH8A 2FMLA 3DP7A 3LQQA 2RN7A 1EV7A 4IXAA 1O7FA 2D1VA 4KUMA 5LRSA 1W5SA 2IRFG 1D5VA 4CXFA 5ICEA 2YX7A 5F1RA 3BP8A 4BHBA 3MCZA 1B1BA 1BI3A 4BNCA 1JGSA 1F5TA 3QU3A 2BEOA 4S04A 1CGPA 4RAYA 1Z05A 1ODDA 2V1DA 1HSJA 4TV7A 3ZN1A 4G7OF 2O8XA 4KT5C 2IA1A 3HIFA 5FO5A 2H6CA 3TO7A 1QBJA 3C1DA 2DPUA 4ZYHA 1U5TA 1BIAA 4L9TA 4B09A 2PBIA 2OQGA 1QO0D 4KIGA 2HTJA 2LF7A 1P4XA 1DP7P 1H0MA 3P9KA 1QQIA 2XVCA 4KDPA 3F21A 1YS6A 5BQTA 1K78B 1ZRCA 4UVAA 4KA4A 4R1HA 4DQ2A 2VE9A 4CDGA 3F23A 1MD0A 5BS6A 1F4KA 3JSOA 3RJPA 4N9IA 4ON0A 3RPUA 1KU9A 4LK0F 1XCVA 5BOXA 1J75A 4HQMA 2CFXA 1PP7U 1HW2A 3H3ZA 5LHIA 1ZAOA 1DDNA 2ZNYA 2K7LA 2EK5A 1ON2A 3MFKA 3RI4A 2DLLA 2E7WA 1SD4A 3L09A 1LEAA 2EFWA 4KIFA 5HDNA 1TQIA 3EYYA 4HF2A 2NNNA 5DYMA 3LAPA 2D1HA 3WTUC 3F6VA 3BJAA 3DKWA 4JQFA 1HKQA 1SD5A 2H27A 4HX4A 1ZGAA 2V1UA 2DTRA 2R7FA 2Z5UA 3BPXA 1YS7A 3JW4A 1ZRDA 4YFKF 3CO7C 3VODA 1T6SA
chains in the Genus database with same CATH superfamily
2P6SA 5F64A 1ZR2A 4XSZF 2W57A 1K6OA 1YJ9I 1LVAA 4BEHA 1YFHA 4EM0B 1BC8C 1ZG3A 3M9AA 3E6MA 3LSRA 2XUBA 3HGGA 3IC7A 1FC3A 2BW3B 2EIJH 2TDXA 3JRDA 4DIQA 3GLXA 5E1ZB 3ECOA 2ID3A 2DK5A 5IPAA 2R5YB 3KZZA 4G6DA 1EKEA 4HDVA 4LG0B 2DYSH 2ZFUA 3GFIA 2X6WA 4A3FJ 4DOZA 2ZO4A 4HZFA 4M6YA 2LMDA 5GAGJ 2HEOA 3BLYA 1YG2A 2DYRH 2Q1ZB 4CO8A 2G7UA 5E8IA 1POGA 4U0WA 1RUOA 1J7KA 2QVOA 1RI7A 3I53A 4J00A 1BR4A 3L9FA 2W1OA 4RMNA 5IYDJ 2WY8Q 3Q3SA 1XGNA 2IA2A 5HLHA 2BV6A 4LIUA 4GGGA 2JPCA 2OUMA 3F9KA 2UV1A 5FB2A 2VOPA 2IS6A 3W2VA 3SXYA 3VYUB 2CJJA 3K7AJ 3EQLF 2MFZA 2M87A 4FCYA 4OIPF 1UZCA 2A6EF 2VODA 2M2EA 1MH3A 1LNWA 1U5TC 4WXDA 1SFUA 1B72B 1SVOA 2XGEA 3FKIJ 5ILSA 4FASD 4FQGA 4BJ6C 1B9NA 2ME0A 3PNYA 1IN7A 4XOTA 1GLNA 5B3SH 1BOAA 3VYRB 2P8TA 1EH6A 2PN6A 2KISA 2PQ8A 3L2WA 3L7WA 1RKTA 2DT6A 2HZTA 4Q4ZF 4BH9A 5EZHA 1I1GA 2Y69H 1OQYA 3TO9A 2L7FP 3WTYC 2QYOA 3AG1H 2P0WA 3CCJI 2F4OB 3DKXA 2LH9A 1TNSA 1R4NB 4QLCU 5FFZA 2EQRA 1PJRA 1QZEA 3ABUA 3U9GA 4EM2A 2XSJC 1HDPA 2PJRB 2PJPA 1FSHA 3RSNA 4BJ5C 3W2WA 1ZGJA 4G6QA 3BWGA 2NVYJ 3KYLA 2NRAC 1T0FA 1FTTA 3SYTA 1SMTA 3CJRB 3G71I 2ELHA 2VASA 4HW0A 2V9PA 1SAUA 2AS5F 2C6YA 1FOKA 4K2EA 5C4JJ 4XLCA 3KE2A 4XLFA 2R92J 3ZQ7A 3OYEA 5JHFA 3RQIA 3BR3A 2KMUA 4B44A 2BHYA 2XAUA 4AVPA 3ABMH 1ONVA 2KQRA 2WA0A 4BGDA 3S3OA 2J5OA 1DPRA 2EB7A 2A07F 1MBGA 3KP7A 2PX9A 3OOPA 1NG7A 3M1CA 3J7AY 3H92A 3MZ8A 1X1CA 2F5FA 2WBMA 5IT9K 4RLFA 1TW2A 1BW5A 1X19A 1U2WA 2FXAA 2HQRA 2JVHA 1B9MA 1F1ZA 1YI2I 2CV0A 1YITI 3Q9SA 2Z99A 4UHTA 5J47A 3VFZA 1P7IA 5J1UA 4ENNA 2D5VA 3BR6A 1GVDA 1TQPA 2LY9A 2NVXJ 1TWFJ 1ERDA 2XAQA 1UJ8A 4KIBA 4Z6YA 1UCRA 3H35A 3FK6A 2F6CA 2VBXA 2YPRA 3E0JB 4KYWA 1G3WA 3WGHA 1MMDA 1XDUA 2K9LA 1XGSA 3BY6A 3OSFA 3MMYB 5E18F 1ZK8A 3SQNA 4P1WA 2MLGA 2BZTA 3BR2A 4LGWA 1QZZA 2L9RA 1APLC 1MMNA 3MKZA 1DGRM 2VE8A 1Z91A 2JQ7A 4WXHA 3R0JA 3GTKJ 3G1LA 3W6VA 2LRDA 2K02A 2A6TA 5F04A 2VPRA 2H94A 5J4VA 3UKGA 3HDDA 2E5ZA 5L3BA 3KZIC 2E5NA 1ZARA 4BXUA 1Z3YA 5IP6A 2IS2A 3RQ4A 2A68F 2RGVA 1OYWA 2YR2A 4V19K 1O3SA 2LR8A 4BEHB 3QP6A 4HX8A 2F4MB 1DP3A 2BXZA 4AIDA 3TP0A 2EV5A 2KJCA 4ESFA 3BPVA 1SD7A 2XASA 2DK8A 3P5JA 1LFPA 2LSOA 4RM3A 4ZH4F 3I55I 3I56I 4BAYA 2MC4A 4HG2A 5EZGA 3ZQQA 4EATA 5JVGF 1O57A 3B02A 4IRGA 4MLOA 4HEA2 3A01A 4L0YB 3G2BA 4XONA 2OF7A 3N05A 3BG9A 2EIKH 1BOBA 2QQBA 1P9QC 1RUNA 3FK7A 4HA8A 4II3A 2JA5J 3JSPA 3GTJJ 3E7LA 4LB6B 2OZUA 2M34A 5EEHA 5DM6F 2COMA 5HDKA 2H1KA 1YE9A 3FBNB 1JT6A 1G3SA 3FXMA 1NTCA 3QPLA 3ZRGA 4BE0A 4G9YA 1OYIA 2KIQA 4OIQF 1WKMA 3GXOA 1OR7A 3CMYA 4BQNA 2EV0A 3TQNA 4JP0A 2DA5A 5K1YA 3KCCA 2RQPA 1X4OA 4GCVA 3HOSA 4NNJA 3E3VA 1A6IA 2EFPA 2EJRA 5CVIA 4I76A 3WTTC 5KK1A 1NG6A 3DBRB 2X6OA 3V42A 5DUKA 1VQ6I 3BCBA 2DI3A 2PEXA 4C2UA 4GO1A 3T5XA 3HL2A 4A3DJ 2Y30A 4AYBN 3D5LA 3MWMA 3GYHX 1V5GA 4XN0A 4AYBA 4LMYA 5F1JA 3DQVC 2YSRA 5J8CA 1VQPI 3GZ6A 3QYFA 4FTHA 3G73A 1RPWA 5JLWA 3DEUA 1QA6A 1TLHB 1OCPA 4M6XA 3E5XA 3JCUC 3MN2A 1LDJA 4EGZA 2R5ZA 2X48A 3I0TA 4KJZA 4NC7A 4IOCF 3M4OJ 2O3FA 3PL8A 3LA2A 3QPTA 2FSWA 3KYDB 4NC8A 1B8IA 1JHFA 1RC9A 4HV5A 2ELJA 2ZXHA 2CG4A 3VSKA 5CVVA 4QIWN 1B59A 1YW9A 4ZYGA 2R3SA 1IV8A 1JUMA 5IY5H 1MW7A 2LVSA 2Y2ZA 5JHUA 2WADA 3P9IA 4CCLA 3WU2C 1V3FA 2W85A 2FE3A 3S1NJ 2DTZA 1Y6IA 4MFEA 3BOQA 2XAFA 3S3NA 1U3EM 3HSFA 4HV6A 3V7RA 1VQLI 1V5EA 1L0OC 2HI3A 1WI3A 2K9NA 2L02A 1K78A 1LE8A 4L9VA 3DLLF 2UXXA 4XRSG 3K4NA 2XPUA 2X85A 3ZMUA 4D0PA 4UY8I 4P55A 1R5ID 4I2OA 1YW8A 1R1VA 4BHCA 1SFEA 2LTPA 2KIUA 1VF9A 2LF8A 4LOCA 2VIXA 1VNDA 3IKTA 1HQCA 4BU2A 4DW6A 4YRVA 2EPFA 3WTVC 2KFDA 2R0QC 4A0YA 3OWTA 4UB8C 3HHHA 2ZNZA 2Y0SN 3KEOA 4XOPA 1V5FA 2JA2A 1PDNC 3GUDA 2Y0SA 4RS8A 2JA6J 1I1SA 1E3PA 2BE5F 4IHYA 4ZJZA 3MZYA 1T8IA 3CD6I 5EEGA 5LD2C 2OU2A 5HS9A 2ECCA 3CP2A 2DFEA 1IW7F 3HSEA 2MC3A 2DOAA 4F52A 3BZKA 1LJ9A 1VQNI 4RBOA 1Y8QB 2WC2A 5E1WA 2LYCA 1IDZA 3SJMA 5FKNA 5E20A 4XRMA 5C44J 5CVUA 4YIIA 1I5ZA 2K86A 1T98A 4IRHA 4O3MA 3BDDA 3CDHA 1VQOI 3FM3A 5FD6A 2CGPA 2XAGA 4OWRB 4HLYA 4NHJA 3NARA 2KZGA 1JUSA 3CMAI 3G1MA 3M1EA 3RCOA 1TL8A 3H3VK 1I6HJ 3CF5F 5HDGA 2BY3A 2OV7A 5DCFA 3JTHA 4Q48A 3CO6C 1U78A 4GRIA 1WHUA 3Q9VA 2Y0MA 2JZYA 2Q2EA 2FOKA 1XCBA 3HJEA 4E4HA 2GM4A 3K4MA 5FRMA 3TOBA 4DYRA 1TWGJ 2BVLA 3EETA 2QQ8A 2R7XA 1MMGA 3A01B 1QHHD 4XNFA 4IQ4A 5J40A 1Z1DA 2Q0OA 2J5PA 3QP5A 1OR7C 2I10A 4J19A 2Z2SB 3RPQA 4UNOA 3KFWX 2COBA 4OAYA 4BXFA 2BW3A 1IRFA 4U0VA 3BTLA 2RVCA 2F5DA 1R36A 4LG0A 2ZXWH 4C3JJ 2HDDA 3W3CA 1MGTA 4CSWA 3HHGA 4ZTFA 4DBRA 3DU5A 2QSGX 4E7ZA 2CYYA 2OTJI 4N4OB 4KN4X 4XMYA 2VQCA 3ERED 1SVMA 2HYFA 1FPQA 1XGMA 2JUCA 3K6GA 4N0BA 2P5LC 2K3FA 2FEZA 1WJCA 4ANJA 4Y15A 3OYFA 3QWLA 1IN6A 2VQHA 1D1CA 5EEAA 5FKKA 1UFMA 2HKOA 4BDYA 3KP2A 2V9KA 3KX2A 3PUBA 1HKTA 2NOGA 4DNCA 2M4GA 4AWXB 1UMQA 2QBYA 1T39A 1HBXG 2ZJQF 3KZYA 3ZR8X 2HVSA 2PLYA 4OMYA 2DBBA 1B72A 5HVQC 1G2HA 3TGNA 1FBUA 2K3PA 3GFMA 5B66C 2HOEA 2R5ZB 2QM3A 2L9VA 2GWRA 3HOWJ 3BQZA 4CCJA 1HW5A 4XIDA 1ZG5A 5EJCA 1MJ9A 2XIGA 2JRMA 1JTXA 2RAEA 3MAJA 3H5AA 5CVRA 2IGKA 2VQGA 2BOLA 1FIPA 1FYMA 2QLZA 3GCMA 4S05A 2XF7A 5A2QK 1T2KA 4UUVA 2FU4A 4MGRA 2CMPA 1MNMC 3CC4I 3LSIA 1D5YA 1ZTRA 1MZBA 1FOYA 2FOWA 4LIVA 4H4KC 1UAAA 4JX4A 3S2WA 1Y1WJ 2JSCA 3B6CA 1K4TA 3CJTB 3HPGA 2RV8A 2GIVA 3JAMZ 1EA3A 3TO6A 5J4YA 4E7HA 1EH7A 2BVMA 1TQMA 3WG7H 4PK4A 4PJNA 1RNLA 3LL7A 1TT5B 2STWA 2L5QA 1G8XA 4CH7A 1LE8B 3V8KA 1RKWA 3S8PA 3K69A 3RDIA 2LC2A 1D3YA 4ABZA 3GWZA 4RB3C 2B7EA 3I58A 1B4AA 5LGTA 3DWLE 2ZMEB 2IEKA 3T0YA 3FDYA 3LSJA 4WWCA 4I99C 3GVAA 4D1QA 1E0EA 2AXLA 3JRIA 2WAEA 4E7SA 1S29A 2XF6A 1R00A 3CZ6A 3OL3A 4NQWB 5E3OA 4EJTA 3WTZA 3EYIA 2ZCWA 3AG4H 4WXCA 2F5VA 3WE3A 4D5CA 2UWMA 5L3GA 2LLKA 1S5LC 3S15J 3FMSA 3EDPA 3DLAA 1G4DA 2R7DA 2QZ8A 2VI6A 2HQNA 4G7HF 1D0YA 4U7DA 4XL9A 5AONA 5K7ZA 3OYIA 4YIRX 3LA3A 2MLKA 2XAJA 5GAEJ 1RR8C 5E79C 4FETA 3HG9A 3G4SI 2CQQA 3HUGB 2D2WA 2OJED 1JKRC 4A0XA 5JLXA 3TMOA 1CQTA 3FXUA 1RRJA 4A3EJ 4EJWA 2KHMA 2MG4A 4FE7A 2NYXA 2HR3A 3X2QH 4M3GA 1K83J 1J9IA 1KYZA 2EZLA 1W0TA 3ZQLA 4GDFA 4RAGA 3BG5A 5K5OA 3WE2A 2X0LA 1TC3C 4IHXA 2HNHA 4JK1X 1H88C 2FNAA 2HDCA 2E1NA 2DMTA 3ABKH 2FD5A 2XDVA 4AVZA 4BQAA 3IHUA 2B9SA 2GLOA 3WTWC 4GYGA 1RR7A 2Q2EB 3D0SA 1YJNI 5D5WB 1BI1A 4XLHA 3S1RJ 3S2DJ 4KN7X 1MJAA 2VC1A 5H20A 4L5EA 3ML6A 3KP6A 2QGUA 1VQ4I 2A5YB 2DFHA 3VSLA 4XKVA 1MMAA 1QU3A 4ESBA 2O61A 3GZNB 2LG4A 3CDLA 2VXZA 4I09A 4IHWA 5K5RA 4M71A 2KIFA 1QPMA 2G9WA 1A04A 4EM1A 1MBEA 3WGIA 4BQOA 3ZQGA 1R1UA 2DCEA 1F9NA 2HQ5A 4OMZA 2JK3A 4G8XA 4M3EA 3MD2A 1KGSA 1KU2A 3BR1A 3QPHA 1KYWA 4PCQA 3E5QA 3DPTA 4HPQA 3WGGA 3SZTA 5D4SA 3IL2A 3OIOA 1WZ2A 4KNYA 2EH3A 2EFNA 1MBKA 3F8MA 3F22A 3K70D 4OINF 2ISZA 1FNNA 4NDLA 2EBIA 1BI2A 4PFOA 5D4RA 4U7BA 1E3HA 2ELKA 4L5JA 5D8KB 3J80K 2O9LA 3CCUI 3HOZJ 2VXDA 2XKOA 1YTYA 2HOTA 3PQJA 4HSTA 3F6OA 3GFJA 2ICWG 1XX5A 1ETOA 2A69F 2DOEA 2DJNA 2QENA 2F2EA 3WG9A 3J81K 4NBQA 4DZPA 2MA3A 2NAZA 1LKXA 1R58A 3M07A 2QBYB 2DDBA 1V54H 3OYNA 5J8FA 3A03A 2PI0A 1H9GA 1ZR4A 2VJ4A 4NUBA 4O5VA 3H5NA 1T56A 3OOUA 4RDUA 6PAXA 3DPLC 3HRUA 3BTCA 4E6KG 4E7JA 1W1WE 4HAMA 3S1MJ 3BJ6A 4E70A 1H9TA 3H36A 1BJAA 3H9JA 3UNGC 4BE1A 1YX3A 2K27A 1PUFB 3OYCA 3QQAA 2ISYA 3KEQA 3BZCA 2DFFA 1P4WA 1OMIA 3HEFA 5JFRA 4X1EA 3JRGA 4PJLA 4I6ZA 2QWWA 2ADUA 3SDBA 2LKXA 1SVLA 3ZQIA 4BQQA 2V4JC 4OOIA 2JWTA 3BT9A 2HPMA 1DU6A 2D45A 1ZGWA 3SDGA 4BKXA 2GXBA 5EYRA 1HSTA 2NOJB 5BMZA 1EJ9A 1MMSA 4ZYEA 5LBQA 3HC7A 4Y52J 1XG1A 4MNUA 1IO2A 2E19A 2RDPA 1R5GA 2DA3A 3RKQA 2Z33A 1UG2A 4UVBA 3CCQI 3ZMTA 3RTRA 4B3AA 4RGUA 4KISA 2DQLA 2KJBA 3BQYA 2GQQA 3ESWB 1ZLJA 2CRGA 3ISPA 3WU0A 1GT0C 3FHZA 2DW4A 1U8BA 4MTEA 5IYBJ 1X1BA 3BG7A 3O8HA 5H6RA 4HSRA 1KA8A 2O03A 3L00A 3O3KA 3T8TA 1VQ7I 5D5UB 5FLXK 4AIKA 1WI9A 5F0FA 1GV2A 1W7PB 3PM1A 2IP2A 1P2FA 3QOPA 4X0GA 1UHWA 2FBHA 2I8DA 1AKHB 4P5OA 1ETKA 5DDGA 3HOTA 3ZCOA 3ZP5A 1QNTA 2DXIA 2OC6A 3ZN0A 3PSFA 2CH0A 4PDKA 1XSDA 1QPIA 3RKXA 4F7ZA 2E1MC 1PP8F 1TT0A 2FRHA 3LMMA 2Y75A 1WJFA 4ZYAA 4QPOA 2VKEA 4BBRJ 2V9VA 1W0UA 3K10A 1HLVA 4BBSJ 2ID6A 3T8RA 2XGXA 1IRGA 5AIPA 5FLVA 4FX4A 3DBLB 5ERIA 1IJWC 5DTDA 4FE4A 1C0WA 1IRZA 4F55A 3AAFA 4ZC3A 3S14J 2E1MB 1YIJI 4N4NB 2QKLB 3QAHA 3U1KA 1X2MA 5A2QZ 3OYHA 4IX7A 3K9TA 1RIOH 1ETXA 1MJBA 1FZPB 2MBFA 3CCEI 5B1AH 5LLQA 2BGCA 3BG3A 2NS0A 1WWXA 3FXJA 4CA0A 3PNVA 2ZBKA 3VEPA 2Z9OA 4RB2C 4I02A 1IXRC 4QSHA 4MEYF 3L2UA 3OYMA 1X58A 2KP6A 5ILVA 1U6GA 1IC8A 2YX4A 3NEUA 3SZPA 5E3MA 1BIBA 5CYVA 1MKMA 3HKZN 2IPQX 2G7HA 1TP4A 2DT5A 3H9GA 4KICA 3V8LA 2W25A 1Z0XA 5LEJA 1NK3P 2V1NA 3HKZA 2EFOA 1ZHFA 4ZZLA 3MVPA 3RIRA 4A2UA 1LPQA 2Z16A 3FXRA 1I3AA 1WH5A 2QUFA 1UHSA 3I64A 2YU3A 2XC7A 4A3JJ 2TRTA 4XKBA 2JVGA 3ZGKA 4C3IJ 5GP9A 3IRRA 4EJVA 1FY7A 3M8FA 5HLIA 4I01A 1KU7A 1FT9A 2VPLA 2LKSA 1CF7B 1AU7A 2I5UA 3SHFA 2L9SA 4E7IA 4U0YA 4A3CJ 2O7OA 3WTSC 2GOMA 2BY2A 2FBKA 2XRLA 4EVIA 1N25A 3FX3A 1OCRH 3QU6A 1IF1A 2E1OA 4HNTA 3DKYA 3COAC 1SFKA 5JR3A 3DU6A 4RGSA 1W4MA 1JXSA 5E1XA 5KVRA 2CS3A 4A93J 1FX7A 4XKCA 3ONQA 5DS9A 2QQ9A 3LA7A 2LP0A 4XR6A 4S0HB 2O0YA 4XRFA 4Y17A 2W7NA 1ETYA 3W6KB 1A6QA 1B6AA 5JVTA 3MKWB 2ZB9A 4ENKA 2CUJA 1BM9A 1G6NA 3CUQA 3E6BA 2ZJ2A 4LLGF 2N8GA 2GIZA 3M7GA 2JTVA 2Y31A 4P96A 2G0EA 2L9NA 2EWNA 3O6BB 3CCSI 1ON1A 2VL8A 2VBWA 4M3BA 1T0FC 3LSHA 3CCMI 2O5RA 1AWCA 3AL0B 4M3FA 2GA1A 1NHAA 1TW3A 4A3MJ 4YEJA 5FKMA 2EFQA 1ETVA 4H0EA 5C4XJ 1Z7UA 1IAWA 3F8CA 2QSFX 2MW8A 4M9XA 2R7SA 2XB0X 3C2BA 5F27A 3R0AA 4RGXA 2EINH 2HFHA 2W48A 2XPWA 3C3WA 3IRQA 3C2HA 4GYIA 1DU0A 4JX5A 3P7NA 2LNBA 1S72I 2BYVE 2L7MP 3L2CA 4YELA 2VBZA 2LKPA 2CW0F 3I4NJ 4B48A 1MSFC 1W7PD 3FIWA 4OIOF 5GADJ 2FJ1A 3MKLA 4ASNA 4G6TB 1U9NA 2CV1A 4BE2A 1W36C 1K7AA 3ERMA 2R7UA 2EIMH 2L4AA 3K1PA 3TBIA 3Q0UA 5E17F 1ZELA 1D8KA 2ZJRF 1RETA 1MH4A 1FYLA 1X4PA 3PO2J 2JUGA 1ORKA 3VDXA 1S7OA 1MDMA 2BXYA 4HNUA 1U8RA 2M3AA 3LFUA 1XDSA 1VQ5I 5F08A 5IP7J 2ZMEA 5HS8A 2F5EA 1JKPC 3CJQB 1R5HA 4AIHA 1VFCA 4CCKA 4U88A 5IT3A 4RAZA 4RM2A 1DQUA 3BJOA 4L5IA 2E36A 4A3IJ 3OMYA 1ZKGA 3DF8A 4NQWA 3HB9A 5D5VB 2DAOA 5CKTA 2B0LA 3J81Z 2HPIA 1FJLA 5ED4A 4D7NA 1LDDA 2LY1A 2XGDA 2HOAA 4LFUA 3CDIA 3V8JA 1BJZA 1ZQ3P 2JPBA 3PNTA 2DQRA 1V55H 2RQQA 2XKPA 3ELKA 2K40A 3OYDA 1PVEA 3TDZC 1USTA 1WH7A 2K85A 4NC6A 2XHKA 1XD7A 3K1MA 1XC5A 2LY2A 3O2PE 2VQLA 3R61A 3CCVI 2DMUA 2HYJA 1ZYRF 3LQRA 2YUSA 3HUGA 5M5WJ 1PUEE 4X6AJ 1WJBA 5TJJA 1YIOA 1YLFA 1HW1A 3S93A 3VPRA 3B73A 2HS5A 3G3ZA 3M8EA 2E34A 3LNQA 4Y7NJ 1FBSA 3H5RA 1IV6A 1HXDA 4FHTA 1AOYA 5HNFA 1IZ1A 5GAHJ 1R71A 3E1SA 1XSVA 1ENHA 4R79A 4HF0A 3OIPA 5GTHC 2V26A 4XKWA 1P7JA 1WPKA 1XB4A 4C2MJ 2CO5A 2IAIA 2B63J 4O6JA 1ETWA 2IGOA 3CJNA 4G12A 1W5TA 3TW6A 2VONA 1FP1D 4CYCA 1YRNB 3KLOA 5KNLA 3U2RA 1SMYF 1KQ8A 4XK4A 5TRDA 2DA1A 1FMVA 2EZHA 3JRHA 1S7AA 4U87A 4A12A 2VBYA 4PUSA 1FSEA 4FX0A 3R4KA 1Y8RB 4WF2A 2QA4I 1OKRA 4IF4A 5FGMA 3VB2A 3ZMVA 1WJEA 5IT9Z 5J3LA 2CU7A 3PFIA 4XBFA 4XN3A 1VQ9I 4XQFA 1UHMA 2CQ7A 5FLMJ 3TEDA 3FM5A 1LQ1A 1I39A 1XMXA 1Q1VA 1YQAA 2L7KA 3HZJA 4M9ZA 4BS9A 1XPXA 2R7TA 1GVJA 3KYCB 4A5NA 1JGGA 1MBHA 1H89C 2M1BA 2FNPA 1BR2A 3TW7A 3GTOJ 2HXOA 3K0LA 1O3RA 3HPHA 5DD4A 2V6EA 2KRFA 4DGWB 4C2TA 1SC7A 2ZXJA 1HC8A 4UV9A 5TGTA 3FXOA 3PUFA 4MIMA 4DBQA 1VQKI 5HS7A 2VT3A 5CQEA 1J0RA 2FA5A 1H8AC 1KQ0A 3ZMZA 5GTIC 2UUZA 1OCOH 5B5EC 2ZXIA 1VZ0A 4Y3OA 3CUQB 4EQQA 4NB5A 2EV6A 1KQ9A 2VN2A 3ASOH 1K61A 3IH3A 4L0ZB 4CCOA 3VOEA 4KFCA 4CYDA 2FF4A 3H9QA 2OD5A 2Y48A 2M30A 2ZKZA 3FHNA 2EZIA 3HTUA 2Q8KA 4AD9A 1NH3A 3PFYA 2DO7A 4BJTA 1OISA 1ZH5A 3I4PA 1GXQA 4BY7J 4Y33A 4BUPA 2XSDC 5FKLA 2YS9A 3FKJA 1PUFA 1MNDA 2KKOA 3E6CC 4IVNA 5E8GA 4MHGA 3LAJA 4XLNF 1Y39A 3F8NA 1S8NA 1S3JA 2E35A 3J7AO 2MD0A 1R7JA 2PMHA 1BN5A 2ZMEC 1LDKB 1R23A 5C3EJ 4B4CA 4IL6C 2CQNA 2VKVA 5F0CA 2RREA 2CUZA 1G59A 4JOMA 2K4JA 3K4BA 4Q5SF 1MDMB 3D5RC 4HYEA 1JJ6C 1R1TA 1Y56A 3A0HC 1V4RA 4IEJA 3CCRI 4BACA 1FP2A 1R22A 3LSMA 1FEXA 3OSGA 2H8WA 1OCZH 4M6VA 1DUXC 4GXOA 2RKHA 1EF4A 3IH4A 1IDYA 3AG3H 2KL4A 4JX6A 3KPHA 1LFUP 1JT0A 4MQ9F 1FLIA 3IWFA 1LB2A 5DCMB 4UUTA 4ENJA 3CCYA 4XORA 1YYVA 2MYSA 2GBYA 5LHHA 1Q1HA 3QODA 2OBPA 2OCCH 4FISA 2ZSIB 3DTIA 1HOMA 1YHQI 3MQ0A 2ECBA 3NWSA 1W7PA 5CLSA 3TDUC 1YW7A 1XN7A 4F3QA 4YIFA 1KU3A 1AKHA 4CGZA 1VQ8I 1ITYA 1ZN2A 3HTSB 3GTMJ 1ZLKA 1D0ZA 2UZKA 4LB5A 5D5XB 3GF2A 2MH9A 3N97A 4LJZF 4N9HA 2OA4A 1R6RA 4B8XA 1QHGA 5LGNA 1SEUA 4UVCA 3WU1B 1I6XA 1J09A 3W6JB 4C30A 2M45A 4WCGA 1PYVA 1O7LA 2ETHA 4I0BA 2JA8J 2CW7A 3H0GJ 3N4MA 5D8LB 1USSA 5LGUA 3ABLH 3K4LA 2FMYA 3OL4A 4UXNA 3JRFA 4A6EA 2VT2A 3ROUA 1R49A 1N75A 1J59A 2E2JJ 3KETA 3VWBA 4CYCB 2VUMJ 2NXNB 1SANA 4EJUA 3KP5A 4Z2YA 2KRHA 4B1RA 2HOSA 4RGRA 2E60A 2KRCA 2P7CB 4GFBA 2FBIA 5IOYA 1T38A 4EGYA 2HDWA 5KAFC 3M3YJ 1RZ4A 1IN5A 1QVTA 3M8JA 3GZ5A 3IV5A 3HOYJ 4HX7A 5LFAA 1J5YA 2M5WA 1QRYA 2HWVA 2KT0A 4A69C 3PJRA 1MNEA 2AXTC 3SFIA 2MABA 1A31A 3JTGA 4YG2F 5DEQA 4B43A 3J7ZI 4F93B 3J7YJ 4I0AA 4CHUA 2WTEA 4CCNA 5L3EA 3ZMDA 3R6SA 3FXQA 4AM3A 4EMSA 1TBXA 4R8HA 3GW2A 1E17A 3ZOBA 5BPDA 3GMEA 3FMQA 4AC0A 3L2VA 4OIRF 3K4JA 2HU9A 3I9V2 1N78A 2OAZA 1QGPA 4ZZDA 3RYRA 3QRFF 1VQMI 3OS2A 4IKFA 2HKXA 1JTYA 2K4BA 4G94A 3DFGA 1HA8A 3SEQA 2V1XA 1OPCA 4I7HA 3U1DA 1CF7A 3OS1A 4PZJA 2VC0A 2L4MA 3HBLA 2GXAA 2BHZA 1REPC 1M1EB 4IZZA 2WAQN 2DOFA 2AQFA 3G6EI 2H09A 5BPIA 3V4GA 3FMRA 4B47A 3U21A 4ZTJA 4XLEA 2WAQA 2WV1A 1GHCA 3I3LA 1QVUA 4XSXF 3K4KA 3ZQFA 2R7VA 4M72A 1U0JA 4IO9F 5M3FJ 2O8KA 2DDAA 2M8GX 3GTGJ 4HQEA 2W82A 2VJ5A 3FWEA 3OR1C 5ICFA 2F48A 3Q0WA 4LLNA 5FFXA 1T95A 3CTAA 3VYSB 2NS7A 3REOA 5DUIA 3DXJF 4DYCA 4II2A 5EGOB 3D5SC 3GBGA 3I54A 2M8EA 3BG6A 5CPRB 1JUPA 3RKYA 4KMFA 5EF6A 4XICA 5DV5A 1D8JA 3NAUA 3TP3A 3S2HJ 3HRTA 1IN8A 2DMPA 3CC7I 2W4SA 1IG7A 2L7ZA 2QKMB 5TISC 2NNYA 5HLGA 1Z21A 2HYGD 2L3DA 2L2OA 2HVQA 4UB6C 4W97A 2ZSHB 3E6DA 4IJAA 3I59A 5D6FA 2E1CA 5FD5A 3OYAA 2ESNA 4CZCA 3F0CA 1U5TB 2X1EA 2DMNA 1GXPA 2RNGA 2CSOA 2WV0A 1AA7A 1I50J 2KPMA 2PMUA 2R4GA 2MH2A 4HOBA 2O6GE 2V79A 1E2XA 4BHPA 4DZJA 1XS9A 2A61A 2CQKA 5LRRA 4HRIA 5KHDA 1WJAA 1RESA 2CUEA 3LOCA 5ICGA 4M74A 2X1CA 4KT6A 2M9HA 2JMWA 1IUYA 3KLNA 4IOAF 1BBYA 1WJDA 5AIQA 4WK8F 5L3DA 1S6LA 2P81A 3IWZA 5CJ9A 1HKSA 3PSIA 1J2XA 2DN0A 2VKDA 3F3XA 3A4CA 5FRNA 3IP4B 4C3HJ 1YX5A 2VOOA 2DA2A 5M5YJ 3O8GA 1Z3XA 4P9FA 4M9SA 1QZYA 1LEBA 1Y1VJ 2DODA 1ULYA 4KMUX 2A6HF 3NWTA 2WWYA 1FMWA 4A3BJ 2V6CA 3OYJA 3ECHA 4MO7A 5HODA 3CESA 2M0MA 3F8BA 1X1PA 1ETQA 3ULQB 1P92A 3TKYA 3FF5A 2X51A 3GLLA 3WHCA 4ESJA 5HOOA 3IH2A 2BY0A 5F6FA 3CMEI 4B3XA 1WJ5A 1G3TA 2R7QA 3GX4X 4G7ZF 3GTLJ 5DD8A 5H6QA 1K79A 2ESHA 1Z7LA 2HXIA 3LFKA 1FOWA 3OV8A 1K4SA 4JBAA 4P9UA 4HLXA 3AKZA 1MSEC 1BA5A 2A05A 2K9SA 4A3LJ 4UUSB 2STTA 3A0BC 1O4XA 2IW5A 3WTXC 1Z6RA 3HM5A 2QSHX 4ZYDA 4LK1F 3E5UA 1MIJA 5HLTA 4LLLA 4ZDOA 4CZZA 1X1DA 1OFCX 2LBFB 3T1BA 2IA0A 3C2GA 3S3MA 2XAHA 2IXSA 3K1NA 4XRSA 9ANTA 1TZLA 4E7LA 2QF7A 5B1BH 3RZDJ 3BC8A 3HOVJ 4E7KA 2IVMA 2OQRA 1SAXA 1YRNA 4YFXF 3HRSA 1JI8A 3OIQA 5L3CA 5CVJA 4ENMA 3OYKA 5GPAA 3NRVA 1FIAA 2P5KA 3DTKA 3Q0VA 4WX9A 3L2QA 1WFXA 3Q5FA 1VTNC 1O3TA 3H3UA 4IPAA 5H2FC 5L3FA 2FQ4A 3CUOA 1BL0A 1ZRFA 4Y13A 3HXLA 2W24A 3IKVA 3PIPF 3EUHA 4RA2A 1X3ZB 1OYYA 3V7SA 3I4MJ 5K5QA 2VLAA 5E3NA 4EJOA 2DA7A 2XPVA 5LHGA 2LD5A 1A35A 3EPZA 4PGHA 3JAMK 2K9QA 1HDDC 3LSKA 1JE8A 4RB0A 4YFNF 2X1DA 4LG3A 2IT0A 3BR0A 3H0DA 2LDUA 1TWAJ 1FWZA 1OCCH 1WSUA 4IHSA 2HTSA 2CW8A 2A3SA 2HGCA 4CCMA 1JJ8C 2AHQA 2E7XA 2F5CA 3CLQA 2VKHA 4FT8A 2CV2A 3TOAA 3K2AA 1X3UA 1VI0A 3ZPLA 4EEFG 3HOXJ 2FQ3A 3AL0C 3QOEA 1ZG1A 4RB1A 2UXNA 4EV0A 3R60A 4BXXJ 5BNGA 2DMQA 2M4KA 2WB1N 4HDUA 1U9OA 1IGNA 1KONA 3S17J 3LSTA 3D1NI 2KDZA 2X6XA 3RKWA 2P5VA 2DJIA 2WB1A 3F8FA 2XROA 3K2ZA 2QEXI 1D1BA 2H8RA 3JRAA 3I5UA 2GZWA 1K6YA 2L01A 3FBIB 4IQJA 2JT1A 2P4WA 4ZDLA 1Y0UA 2L0KA 2YU9J 2Y9YA 3CP8A 2X6YA 3GO5A 3CC2I 1HF0A 3CQZJ 3UR3C 3OYBA 3I59B 2PFBA 2NVQJ 1S9HA 4CICA 2FUG2 4UV8A 4A5MA 1A5JA 5KAIC 3GFLA 3V7CA 1WRJA 3L2RA 2IGNA 2XB5A 2BBYA 3KEYA 2OTLI 2W84A 2XGCA 2DA6A 2BY1A 4V2GA 1Y0NA 3PIOF 2LK2A 3CF2A 1G3YA 1MBJA 3CMMA 4MEXF 3MEXA 2Z3YA 2EZKA 3RPUD 1XMAA 2XRNA 4XLPF 4I98B 1W5CC 4IHVA 2EA4A 3RZOJ 3LWFA 3E97A 5M5XJ 2KDOA 1IUFA 5LEKA 1TWHJ 2JRTA 4BYYA 3VYTB 2WY7Q 2IJLA 1S7EA 3F72A 2RC4A 4A0ZA 2X9DA 2KIMA 4C9YA 2WAFA 4HF1A 2QQAA 3DV8A 3KP3A 5FKOA 5GPCA 2NVTJ 2M0CA 1XMKA 2MD5A 3K4CA 2JN6A 1Z9CA 3OR2C 1D0XA 1IXSB 1FTZA 3J80Z 3SFZA 1A36A 1BR1A 4IRIA 1JKQC 3CLOA 2HVRA 1ACIA 2QCOA 4M73A 1STZA 3A1YA 3BROA 4AIJA 5DCMA 5M3MJ 1XSXA 4XLAA 3H1CA 1WVRA 4HBLA 1UG0A 4LD5A 2GAUA 1BC7C 1Z67A 3ABTA 2GOXB 2XV4S 1X2NA 3MKYB 2PMZN 3ZXSA 2OZ6A 4DJAA 2X4HA 3HSRA 2DPDA 4MQVA 3FISA 3DEWA 1D1AA 2PMZA 3OYLA 5ICCA 2R7ZJ 2DFIA 1WQ2A 4Y4RA 2E2HJ 5D6EA 1HCRA 2CUFA 3ZQHA 1DPUA 3GTPJ 1TTYA 2MGQA 2NVUB 3TL4X 1O3QA 3L1PA 3BZ6A 1FOXA 5ILUA 5FJ8J 1YJWI 1SD6A 1JHHA 4QWQA 4OAZA 3WODF 1Z6TA 3RYPA 1IXCA 1FYKA 1BI0A 1BW6A 1UB9A 2R7RA 2A5WA 2M7BA 3KP4A 4ITVA 3A02A 3HRMA 1P6RA 1JKOC 2GA2A 2EA2A 5J6XA 5JI6A 5FROA 4L9JA 1SFXA 5HNHA 5EDNA 3I71A 1OLTA 2JJ7A 3ZMSA 2ACJA 2LOOA 2NS8A 2AQEA 1LUJB 2L54A 1E3OC 3EUHC 4MTDA 3P9CA 3HYIA 1P4AA 2H6BA 2P7VB 5J1YA 5CQGA 2CWEA 1OCTC 4L9NA 1LFBA 2KZVA 4HNVA 1UELB 4M3DA 5J1RA 4QPQA 1L3LA 3FXKA 2KLOA 5K7HA 2CFOA 2DU9A 3GEZA 3IUOA 3NQOA 1TNTA 3JRCA 1XGOA 4F91B 4KITB 1N77A 4OU0A 2GXGA 2PG4A 3QYEA 1I27A 4ETSA 3FZVA 5EG0A 4Q47A 2R7OA 5F0HA 5DM7F 1FBQA 1OJLA 3C7JA 3DEEA 2ZFWA 4D7MA 3MZHA 2DA4A 2RNJA 5FLXZ 3IAM2 4PGGA 3CUQC 1YO5C 2HZDA 1IN4A 3PQKA 4L18B 2IBDA 4A6DA 3FXLA 1F43A 4JYKA 1I3QJ 1R9TJ 4RAFA 4J01A 1ZREA 3C18A 4IHTA 3DTEA 2P6TA 1EH8A 2FMLA 3DP7A 3LQQA 2R5YA 1DGWY 2RN7A 4V2FA 1GV5A 4PJMA 1EV7A 4IXAA 3K70C 1GDTA 1O7FA 4BDZA 2AO9A 2D1VA 1AHDP 4KUMA 1R4MB 5LRSA 1W5SA 5IYCJ 3QYBA 2CQXA 3G1OA 2IRFG 1D5VA 2K5CA 3PO3J 4CXFA 5ICEA 2YX7A 5F1RA 3S1QJ 1X1AA 4AU7A 3BP8A 2ME6A 4BHBA 1X3WB 3MCZA 1B1BA 1BI3A 4BNCA 1JGSA 2VB6A 2W00A 3HGYA 1F5TA 2Z1DA 3LSGA 3SZGA 3QU3A 5EGOA 2ZJPF 2BEOA 4S04A 1CGPA 1WCMJ 1F36A 4RAYA 3SEZA 3OY9A 4BL0B 1Z05A 2VJIA 1ODDA 3A2KA 3AFHA 2V1DA 1HSJA 4F92B 3QPSA 4TV7A 2HQAA 3ZN1A 4G7OF 3DPUA 1TWCJ 1LVKA 2O8XA 4KT5C 2IA1A 2F4IA 2E71A 3HIFA 2OCEA 5FO5A 2H6CA 3TO7A 1B8IB 3S16J 4QTRA 1QBJA 1SFOJ 3C1DA 2DPUA 4ZYHA 1U5TA 2OPTA 4PJJA 1BIAA 4L9TA 1W36D 4B09A 2PBIA 4A3GJ 2OQGA 1QO0D 5K7FA 2ZC2A 4KIGA 2HTJA 4PFPA 2LF7A 1P4XA 1MBFA 3BTIA 3DCFA 1DP7P 2V7FA 1H0MA 3ZQCA 3P9KA 1QQIA 2PJRA 2XVCA 4KDPA 2XF5A 3F21A 3GTQJ 1YS6A 5BQTA 3B6AA 1K78B 1ZRCA 4UVAA 1T08B 4KA4A 4R1HA 4DQ2A 2VE9A 4CDGA 3LSPA 3F23A 1MD0A 1Z77A 5BS6A 3OYGA 2IS4A 1T33A 2LFBA 1NK2P 1F4KA 2TCTA 3JREA 3EUAA 3DBHB 1WGXA 3JSOA 2JSPA 3RJPA 2MSYA 4N9IA 4ON0A 3RPUA 1KU9A 4LK0F 4PSXA 1XCVA 3S32A 3OS0A 5BOXA 1J75A 2VJJA 4HQMA 4RLQA 4CUGA 4XM3A 3ASNH 1GUUA 1XTAA 2CFXA 1YOVB 2K9MA 4PSWA 1PP7U 1HW2A 3H3ZA 5IOZA 5IP9J 1IRXA 2FX0A 5LHIA 3BCAA 2EILH 3IAS2 4LITA 1ZAOA 4W1UA 4MFDA 1DDNA 2ZNYA 2M7AA 4ZDPA 3CCLI 2K7LA 2EK5A 1ON2A 3BTJA 4DYQA 3MFKA 3W2AA 2H1LA 3RI4A 2R93J 2DLLA 2E7WA 1SD4A 3L09A 2DT7B 3JRBA 1LEAA 2EFWA 4KIFA 5HDNA 4UUSA 4BY1J 1TQIA 3EYYA 4D5FA 4HF2A 2E2IJ 2NNNA 5DYMA 5E3LA 4D9JA 3LAPA 3KIOA 3JR9A 2D1HA 2LBFA 3WTUC 4A3KJ 3F6VA 3BJAA 3DKWA 4JQFA 3BR5A 1HKQA 1SD5A 2H27A 2R7WA 2IS1A 4HX4A 1ZGAA 2V1UA 4AUXA 2DTRA 2R7FA 2Y9ZA 2Z5UA 3BPXA 1YS7A 3JW4A 3AG2H 3EUKL 5EG0B 3HOUJ 2IGMA 1ZRDA 2JA7J 5KCMA 4YFKF 4PJ0C 3WHBA 3CO7C 1KZHA 2LREA 3VODA 1T6SA
chains in the Genus database with same CATH topology
2P6SA 5F64A 4XSZF 2W57A 1K6OA 1LVAA 1YFHA 4EM0B 1BC8C 1ZG3A 3M9AA 3E6MA 2XUBA 3IC7A 1FC3A 2TDXA 3GLXA 5E1ZB 3ECOA 2DK5A 3KZZA 4G6DA 4HDVA 4LG0B 3GFIA 2ZO4A 4HZFA 4M6YA 2HEOA 1YG2A 4CO8A 2G7UA 5E8IA 4U0WA 1RUOA 1J7KA 2QVOA 1RI7A 3I53A 3L9FA 1XGNA 2IA2A 5HLHA 2BV6A 4GGGA 2JPCA 5FB2A 2VOPA 3SXYA 3EQLF 2M87A 4OIPF 2A6EF 2VODA 1U5TC 1LNWA 4WXDA 1SFUA 5ILSA 1B9NA 1IN7A 1BOAA 2P8TA 1EH6A 2PN6A 2PQ8A 3L7WA 2HZTA 4Q4ZF 4BH9A 1I1GA 3TO9A 3WTYC 2QYOA 1TNSA 4QLCU 5FFZA 4EM2A 3ABUA 3U9GA 2PJPA 1FSHA 1ZGJA 4G6QA 3BWGA 2NRAC 1T0FA 1SMTA 2ELHA 4HW0A 2AS5F 2C6YA 1FOKA 4K2EA 3KE2A 3ZQ7A 4AVPA 1ONVA 2J5OA 1DPRA 2EB7A 2A07F 3KP7A 3OOPA 3H92A 2F5FA 5IT9K 1TW2A 2FXAA 1U2WA 2HQRA 1B9MA 1F1ZA 3Q9SA 2Z99A 4UHTA 3VFZA 4ENNA 1TQPA 2XAQA 4KIBA 1UCRA 2VBXA 2YPRA 4KYWA 1G3WA 3WGHA 1XDUA 1XGSA 3BY6A 5E18F 3SQNA 2MLGA 4LGWA 1QZZA 2VE8A 1Z91A 4WXHA 3R0JA 2K02A 2H94A 5L3BA 1ZARA 4BXUA 2A68F 2RGVA 1OYWA 2YR2A 1O3SA 3QP6A 4HX8A 2EV5A 2KJCA 4ESFA 3BPVA 1SD7A 2XASA 2DK8A 2LSOA 4ZH4F 4BAYA 1O57A 3B02A 4IRGA 4L0YB 2QQBA 1RUNA 4HA8A 3JSPA 4LB6B 2OZUA 5EEHA 2COMA 5HDKA 1G3SA 4G9YA 1OYIA 4OIQF 1WKMA 3GXOA 1OR7A 2EV0A 3TQNA 5K1YA 3KCCA 2RQPA 4GCVA 3HOSA 3E3VA 2EFPA 2EJRA 5CVIA 3WTTC 5KK1A 5DUKA 2DI3A 2PEXA 4GO1A 3T5XA 3D5LA 3MWMA 3GYHX 4LMYA 3DQVC 2YSRA 5J8CA 3GZ6A 3G73A 3DEUA 1TLHB 4M6XA 3E5XA 1LDJA 4EGZA 3I0TA 2O3FA 3LA2A 3QPTA 2FSWA 1JHFA 4HV5A 2CG4A 5CVVA 1B59A 1YW9A 4ZYGA 2R3SA 5JHUA 3P9IA 1V3FA 2W85A 2FE3A 3BOQA 2XAFA 1U3EM 3HSFA 4HV6A 3V7RA 1L0OC 2L02A 1K78A 4L9VA 2UXXA 3ZMUA 4D0PA 4P55A 4I2OA 1YW8A 1R1VA 4BHCA 1SFEA 2KIUA 2LF8A 3IKTA 1HQCA 3WTVC 4A0YA 3HHHA 2ZNZA 3KEOA 1PDNC 3GUDA 4RS8A 1I1SA 2BE5F 3MZYA 5EEGA 2OU2A 5HS9A 1IW7F 3HSEA 2MC3A 1LJ9A 5E1WA 2WC2A 5E20A 5CVUA 4YIIA 1I5ZA 2K86A 1T98A 4IRHA 4O3MA 3BDDA 3CDHA 3FM3A 5FD6A 2CGPA 2XAGA 4HLYA 4NHJA 3M1EA 5HDGA 5DCFA 3JTHA 4Q48A 3CO6C 1U78A 3Q9VA 2Y0MA 2JZYA 2Q2EA 2FOKA 1XCBA 3TOBA 3EETA 1Z1DA 2Q0OA 2J5PA 3QP5A 3RPQA 4UNOA 3KFWX 1IRFA 4U0VA 2RVCA 2F5DA 1R36A 4LG0A 1MGTA 3HHGA 2CYYA 4KN4X 3ERED 2HYFA 1FPQA 1XGMA 4N0BA 2P5LC 2FEZA 4Y15A 1IN6A 1UFMA 2HKOA 3KP2A 1HKTA 4DNCA 4AWXB 2QBYA 1T39A 1HBXG 3KZYA 2PLYA 4OMYA 2DBBA 5HVQC 3TGNA 1FBUA 3GFMA 2HOEA 2QM3A 2GWRA 1HW5A 1ZG5A 1MJ9A 2XIGA 3MAJA 5CVRA 1FYMA 2QLZA 4S05A 5A2QK 1T2KA 4UUVA 2FU4A 4MGRA 1MZBA 3S2WA 2JSCA 2RV8A 2GIVA 3JAMZ 3TO6A 1EH7A 1TQMA 1RNLA 2STWA 3V8KA 3K69A 3RDIA 1D3YA 3GWZA 4RB3C 3I58A 5LGTA 1B4AA 2ZMEB 3T0YA 4WWCA 3GVAA 2AXLA 1S29A 1R00A 4EJTA 3WTZA 3EYIA 2ZCWA 4WXCA 3WE3A 2UWMA 5L3GA 3FMSA 3EDPA 1G4DA 2R7DA 2QZ8A 2HQNA 4G7HF 4U7DA 5AONA 3LA3A 2MLKA 2XAJA 2D2WA 4A0XA 3FXUA 4EJWA 2NYXA 2HR3A 1J9IA 1KYZA 5K5OA 3WE2A 2X0LA 4JK1X 2FNAA 2HDCA 2E1NA 4BQAA 3IHUA 3WTWC 4GYGA 3D0SA 5D5WB 1BI1A 4KN7X 1MJAA 2VC1A 5H20A 3ML6A 3KP6A 2A5YB 4ESBA 2O61A 2VXZA 4I09A 5K5RA 4M71A 2KIFA 1QPMA 2G9WA 1A04A 4EM1A 3WGIA 1R1UA 1F9NA 4OMZA 4G8XA 1KGSA 1KU2A 3QPHA 1KYWA 4PCQA 3E5QA 3DPTA 3WGGA 3SZTA 5D4SA 3IL2A 4KNYA 2EFNA 3F8MA 3F22A 4OINF 2ISZA 1FNNA 1BI2A 5D4RA 4U7BA 4L5JA 5D8KB 3J80K 2XKOA 1YTYA 3PQJA 3F6OA 3GFJA 2A69F 2QENA 2F2EA 3WG9A 3J81K 2MA3A 2NAZA 1R58A 2QBYB 5J8FA 2PI0A 1H9GA 4O5VA 6PAXA 3DPLC 3HRUA 4HAMA 3BJ6A 4E70A 1H9TA 1BJAA 2K27A 2ISYA 3KEQA 1P4WA 1OMIA 5JFRA 2QWWA 2ADUA 4OOIA 2D45A 2GXBA 1HSTA 5BMZA 4ZYEA 5LBQA 4MNUA 2RDPA 1R5GA 2Z33A 4UVBA 3ZMTA 3RTRA 4RGUA 2DQLA 2KJBA 2GQQA 3ISPA 1ZLJA 3WU0A 3FHZA 2DW4A 4MTEA 5H6RA 1KA8A 2O03A 3L00A 3O3KA 3T8TA 5FLXK 5D5UB 4AIKA 1WI9A 1W7PB 2IP2A 1P2FA 3QOPA 1UHWA 2FBHA 4P5OA 5DDGA 3HOTA 3ZP5A 1QNTA 3ZN0A 4PDKA 1XSDA 3RKXA 4F7ZA 1PP8F 2FRHA 2Y75A 2V9VA 3T8RA 2XGXA 1IRGA 5AIPA 4FX4A 5ERIA 1C0WA 3AAFA 3QAHA 5A2QZ 3K9TA 1RIOH 1MJBA 1FZPB 2MBFA 5LLQA 2BGCA 2NS0A 1WWXA 2ZBKA 3VEPA 2Z9OA 4RB2C 4I02A 1IXRC 4MEYF 5ILVA 1U6GA 2YX4A 3NEUA 3SZPA 1BIBA 5CYVA 1MKMA 2IPQX 2G7HA 2DT5A 4KICA 3V8LA 2W25A 5LEJA 2EFOA 1ZHFA 4ZZLA 3RIRA 4A2UA 3FXRA 2QUFA 3I64A 2YU3A 3IRRA 4EJVA 1FY7A 3M8FA 5HLIA 4I01A 1KU7A 1FT9A 1CF7B 3SHFA 4U0YA 3WTSC 2FBKA 4EVIA 3QU6A 3FX3A 1IF1A 3COAC 5JR3A 4RGSA 1W4MA 1JXSA 5E1XA 5KVRA 1FX7A 2QQ9A 3LA7A 2O0YA 4XRFA 4Y17A 3W6KB 1B6AA 5JVTA 4ENKA 1BM9A 1G6NA 3CUQA 3E6BA 2ZJ2A 4LLGF 3M7GA 2JTVA 4P96A 2EWNA 3O6BB 1ON1A 2VBWA 1AWCA 2GA1A 1NHAA 1TW3A 4H0EA 2EFQA 1Z7UA 1IAWA 3F8CA 4M9XA 3R0AA 4RGXA 2HFHA 3C3WA 3IRQA 4GYIA 3P7NA 2LNBA 2BYVE 3L2CA 2VBZA 2LKPA 2CW0F 1W7PD 4OIOF 4ASNA 1K7AA 2L4AA 3K1PA 5E17F 1D8KA 1FYLA 1S7OA 1MDMA 1U8RA 1XDSA 2ZMEA 5HS8A 2F5EA 1R5HA 4AIHA 4U88A 5IT3A 4RAZA 3BJOA 4L5IA 4NQWA 3DF8A 5D5VB 2DAOA 2B0LA 3J81Z 5ED4A 1LDDA 4LFUA 3V8JA 2JPBA 2DQRA 3ELKA 2XKPA 3TDZC 1USTA 2XHKA 1XD7A 3K1MA 3O2PE 3R61A 1ZYRF 3LQRA 3HUGA 1PUEE 5TJJA 1YIOA 1YLFA 1HW1A 3B73A 2HS5A 3G3ZA 3M8EA 1FBSA 1AOYA 1HXDA 4FHTA 1IZ1A 1XSVA 4R79A 4HF0A 1XB4A 2CO5A 4O6JA 3CJNA 1W5TA 2VONA 1FP1D 3KLOA 3U2RA 1SMYF 1KQ8A 5TRDA 1S7AA 4A12A 2VBYA 1FSEA 4FX0A 3R4KA 4WF2A 1OKRA 4IF4A 5FGMA 3VB2A 3ZMVA 5IT9Z 3PFIA 4XBFA 1UHMA 3FM5A 1LQ1A 1YQAA 4M9ZA 1GVJA 4A5NA 2M1BA 2FNPA 3K0LA 1O3RA 5DD4A 2KRFA 2ZXJA 4UV9A 5HS7A 2VT3A 1J0RA 2FA5A 1KQ0A 3ZMZA 3CUQB 4EQQA 4NB5A 2EV6A 1KQ9A 2VN2A 4L0ZB 3VOEA 4KFCA 4CYDA 2FF4A 2OD5A 2Y48A 2M30A 2ZKZA 3HTUA 2Q8KA 4AD9A 2DO7A 1ZH5A 3I4PA 1GXQA 2KKOA 3E6CC 4IVNA 5E8GA 4MHGA 3LAJA 4XLNF 3F8NA 1S8NA 1S3JA 3J7AO 1R7JA 2PMHA 1BN5A 1LDKB 1R23A 2K4JA 4Q5SF 1MDMB 4HYEA 1R1TA 1V4RA 1FP2A 1R22A 1DUXC 4GXOA 2RKHA 4MQ9F 1FLIA 3IWFA 1LB2A 5DCMB 4ENJA 1YYVA 5LHHA 1Q1HA 2OBPA 3MQ0A 1W7PA 5CLSA 3TDUC 1YW7A 1XN7A 4YIFA 1KU3A 4CGZA 1ZN2A 3HTSB 1ZLKA 2UZKA 4LB5A 5D5XB 3GF2A 2MH9A 3N97A 4LJZF 4N9HA 2OA4A 4B8XA 5LGNA 4UVCA 3WU1B 1I6XA 3W6JB 2M45A 4WCGA 1O7LA 2ETHA 4I0BA 3N4MA 5D8LB 1USSA 5LGUA 2FMYA 4UXNA 4A6EA 2VT2A 3ROUA 1J59A 3KETA 4EJUA 3KP5A 4Z2YA 4RGRA 2P7CB 2FBIA 1T38A 4EGYA 1RZ4A 1IN5A 3GZ5A 4HX7A 1J5YA 2M5WA 2HWVA 3JTGA 4YG2F 5DEQA 4I0AA 4CHUA 2WTEA 5L3EA 3ZMDA 3R6SA 3FXQA 4EMSA 1TBXA 4R8HA 3GW2A 1E17A 5BPDA 3FMQA 4OIRF 2OAZA 1QGPA 4ZZDA 3RYRA 3QRFF 2HKXA 2K4BA 4G94A 3DFGA 2V1XA 1OPCA 4I7HA 3U1DA 1CF7A 4PZJA 2VC0A 2L4MA 1REPC 5BPIA 2H09A 3V4GA 3FMRA 1GHCA 4XSXF 4M72A 4HQEA 3FWEA 5ICFA 4LLNA 5FFXA 3CTAA 3REOA 5DUIA 3DXJF 3I54A 2M8EA 3RKYA 4KMFA 5DV5A 1D8JA 3HRTA 1IN8A 2NNYA 5HLGA 2HYGD 2L3DA 3E6DA 4IJAA 3I59A 5D6FA 2E1CA 5FD5A 2ESNA 1U5TB 1GXPA 2CSOA 2WV0A 2PMUA 2MH2A 4HOBA 2O6GE 2V79A 1E2XA 4BHPA 2A61A 2CQKA 5LRRA 5ICGA 4M74A 1IUYA 3KLNA 1BBYA 5AIQA 4WK8F 5L3DA 1S6LA 3IWZA 5CJ9A 1HKSA 1J2XA 3F3XA 2VOOA 4P9FA 4M9SA 1QZYA 1LEBA 4KMUX 1ULYA 2A6HF 2WWYA 2V6CA 3ECHA 3F8BA 3ULQB 1P92A 3TKYA 3FF5A 4ESJA 5HOOA 5F6FA 1G3TA 3GX4X 4G7ZF 5DD8A 5H6QA 1K79A 2ESHA 3LFKA 3OV8A 4JBAA 4P9UA 4HLXA 2STTA 2IW5A 3WTXC 1Z6RA 4ZYDA 4LK1F 3E5UA 4LLLA 4CZZA 3T1BA 2IA0A 2XAHA 3K1NA 2IVMA 2OQRA 1SAXA 4YFXF 3HRSA 5L3CA 5CVJA 4ENMA 3NRVA 2P5KA 4WX9A 3Q5FA 1VTNC 1O3TA 3H3UA 4IPAA 5L3FA 3CUOA 1ZRFA 4Y13A 2W24A 3IKVA 3EUHA 1OYYA 3V7SA 5K5QA 4EJOA 5LHGA 4PGHA 3JAMK 1JE8A 4RB0A 4YFNF 2IT0A 2LDUA 1FWZA 1WSUA 4IHSA 2HTSA 2HGCA 2A3SA 2E7XA 2F5CA 4FT8A 3TOAA 1X3UA 3ZPLA 2FQ3A 1ZG1A 4RB1A 2UXNA 4EV0A 3R60A 4HDUA 3LSTA 3RKWA 2P5VA 3F8FA 2XROA 3K2ZA 3I5UA 2GZWA 2L01A 2JT1A 2P4WA 1Y0UA 3GO5A 3I59B 2PFBA 4CICA 4UV8A 4A5MA 3GFLA 3V7CA 1WRJA 2BBYA 2W84A 1G3YA 4MEXF 3MEXA 2Z3YA 1XMAA 2XRNA 4XLPF 4I98B 2EA4A 3LWFA 3E97A 5LEKA 2JRTA 4BYYA 2IJLA 3F72A 2RC4A 4A0ZA 2KIMA 4HF1A 2QQAA 3DV8A 3KP3A 1XMKA 2MD5A 1Z9CA 1IXSB 3J80Z 3SFZA 4IRIA 3CLOA 4M73A 1STZA 3BROA 4AIJA 5DCMA 1XSXA 4HBLA 4LD5A 2GAUA 1BC7C 3ABTA 2XV4S 2OZ6A 2X4HA 3HSRA 2DPDA 4MQVA 5ICCA 2DFIA 1WQ2A 5D6EA 1DPUA 1TTYA 1O3QA 3BZ6A 5ILUA 1SD6A 1JHHA 4QWQA 3WODF 1Z6TA 3RYPA 1IXCA 1FYKA 1BI0A 1UB9A 3KP4A 3HRMA 1P6RA 2GA2A 2EA2A 5J6XA 5JI6A 4L9JA 1SFXA 3I71A 3ZMSA 2ACJA 2L54A 4MTDA 3P9CA 3HYIA 1P4AA 2H6BA 2P7VB 2CWEA 4L9NA 1L3LA 2DU9A 3GEZA 3NQOA 1TNTA 1XGOA 4OU0A 2GXGA 2PG4A 1I27A 4ETSA 3FZVA 4Q47A 1FBQA 3C7JA 2ZFWA 3MZHA 2RNJA 5FLXZ 4PGGA 3CUQC 1YO5C 1IN4A 3PQKA 4L18B 4A6DA 1ZREA 3C18A 4IHTA 2P6TA 1EH8A 2FMLA 3DP7A 3LQQA 2RN7A 1EV7A 4IXAA 1O7FA 2D1VA 4KUMA 5LRSA 1W5SA 2IRFG 1D5VA 4CXFA 5ICEA 2YX7A 5F1RA 3BP8A 4BHBA 3MCZA 1B1BA 1BI3A 4BNCA 1JGSA 1F5TA 3QU3A 2BEOA 4S04A 1CGPA 4RAYA 1Z05A 1ODDA 2V1DA 1HSJA 4TV7A 3ZN1A 4G7OF 2O8XA 4KT5C 2IA1A 3HIFA 5FO5A 2H6CA 3TO7A 1QBJA 3C1DA 2DPUA 4ZYHA 1U5TA 1BIAA 4L9TA 4B09A 2PBIA 2OQGA 1QO0D 4KIGA 2HTJA 2LF7A 1P4XA 1DP7P 1H0MA 3P9KA 1QQIA 2XVCA 4KDPA 3F21A 1YS6A 5BQTA 1K78B 1ZRCA 4UVAA 4KA4A 4R1HA 4DQ2A 2VE9A 4CDGA 3F23A 1MD0A 5BS6A 1F4KA 3JSOA 3RJPA 4N9IA 4ON0A 3RPUA 1KU9A 4LK0F 1XCVA 5BOXA 1J75A 4HQMA 2CFXA 1PP7U 1HW2A 3H3ZA 5LHIA 1ZAOA 1DDNA 2ZNYA 2K7LA 2EK5A 1ON2A 3MFKA 3RI4A 2DLLA 2E7WA 1SD4A 3L09A 1LEAA 2EFWA 4KIFA 5HDNA 1TQIA 3EYYA 4HF2A 2NNNA 5DYMA 3LAPA 2D1HA 3WTUC 3F6VA 3BJAA 3DKWA 4JQFA 1HKQA 1SD5A 2H27A 4HX4A 1ZGAA 2V1UA 2DTRA 2R7FA 2Z5UA 3BPXA 1YS7A 3JW4A 1ZRDA 4YFKF 3CO7C 3VODA 1T6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6S A;  5F64 A;  4XSZ F;  2W57 A;  1K6O A;  1LVA A;  1YFH A;  4EM0 B;  1BC8 C;  1ZG3 A;  3M9A A;  3E6M A;  2XUB A;  3IC7 A;  1FC3 A;  2TDX A;  3GLX A;  5E1Z B;  3ECO A;  2DK5 A;  3KZZ A;  4G6D A;  4HDV A;  4LG0 B;  3GFI A;  2ZO4 A;  4HZF A;  4M6Y A;  2HEO A;  1YG2 A;  4CO8 A;  2G7U A;  5E8I A;  4U0W A;  1RUO A;  1J7K A;  2QVO A;  1RI7 A;  3I53 A;  3L9F A;  1XGN A;  2IA2 A;  5HLH A;  2BV6 A;  4GGG A;  2JPC A;  5FB2 A;  2VOP A;  3SXY A;  3EQL F;  2M87 A;  4OIP F;  2A6E F;  2VOD A;  1U5T C;  1LNW A;  4WXD A;  1SFU A;  5ILS A;  1B9N A;  1IN7 A;  1BOA A;  2P8T A;  1EH6 A;  2PN6 A;  2PQ8 A;  3L7W A;  2HZT A;  4Q4Z F;  4BH9 A;  1I1G A;  3TO9 A;  3WTY C;  2QYO A;  1TNS A;  4QLC U;  5FFZ A;  4EM2 A;  3ABU A;  3U9G A;  2PJP A;  1FSH A;  1ZGJ A;  4G6Q A;  3BWG A;  2NRA C;  1T0F A;  1SMT A;  2ELH A;  4HW0 A;  2AS5 F;  2C6Y A;  1FOK A;  4K2E A;  3KE2 A;  3ZQ7 A;  4AVP A;  1ONV A;  2J5O A;  1DPR A;  2EB7 A;  2A07 F;  3KP7 A;  3OOP A;  3H92 A;  2F5F A;  5IT9 K;  1TW2 A;  2FXA A;  1U2W A;  2HQR A;  1B9M A;  1F1Z A;  3Q9S A;  2Z99 A;  4UHT A;  3VFZ A;  4ENN A;  1TQP A;  2XAQ A;  4KIB A;  1UCR A;  2VBX A;  2YPR A;  4KYW A;  1G3W A;  3WGH A;  1XDU A;  1XGS A;  3BY6 A;  5E18 F;  3SQN A;  2MLG A;  4LGW A;  1QZZ A;  2VE8 A;  1Z91 A;  4WXH A;  3R0J A;  2K02 A;  2H94 A;  5L3B A;  1ZAR A;  4BXU A;  2A68 F;  2RGV A;  1OYW A;  2YR2 A;  1O3S A;  3QP6 A;  4HX8 A;  2EV5 A;  2KJC A;  4ESF A;  3BPV A;  1SD7 A;  2XAS A;  2DK8 A;  2LSO A;  4ZH4 F;  4BAY A;  1O57 A;  3B02 A;  4IRG A;  4L0Y B;  2QQB A;  1RUN A;  4HA8 A;  3JSP A;  4LB6 B;  2OZU A;  5EEH A;  2COM A;  5HDK A;  1G3S A;  4G9Y A;  1OYI A;  4OIQ F;  1WKM A;  3GXO A;  1OR7 A;  2EV0 A;  3TQN A;  5K1Y A;  3KCC A;  2RQP A;  4GCV A;  3HOS A;  3E3V A;  2EFP A;  2EJR A;  5CVI A;  3WTT C;  5KK1 A;  5DUK A;  2DI3 A;  2PEX A;  4GO1 A;  3T5X A;  3D5L A;  3MWM A;  3GYH X;  4LMY A;  3DQV C;  2YSR A;  5J8C A;  3GZ6 A;  3G73 A;  3DEU A;  1TLH B;  4M6X A;  3E5X A;  1LDJ A;  4EGZ A;  3I0T A;  2O3F A;  3LA2 A;  3QPT A;  2FSW A;  1JHF A;  4HV5 A;  2CG4 A;  5CVV A;  1B59 A;  1YW9 A;  4ZYG A;  2R3S A;  5JHU A;  3P9I A;  1V3F A;  2W85 A;  2FE3 A;  3BOQ A;  2XAF A;  1U3E M;  3HSF A;  4HV6 A;  3V7R A;  1L0O C;  2L02 A;  1K78 A;  4L9V A;  2UXX A;  3ZMU A;  4D0P A;  4P55 A;  4I2O A;  1YW8 A;  1R1V A;  4BHC A;  1SFE A;  2KIU A;  2LF8 A;  3IKT A;  1HQC A;  3WTV C;  4A0Y A;  3HHH A;  2ZNZ A;  3KEO A;  1PDN C;  3GUD A;  4RS8 A;  1I1S A;  2BE5 F;  3MZY A;  5EEG A;  2OU2 A;  5HS9 A;  1IW7 F;  3HSE A;  2MC3 A;  1LJ9 A;  5E1W A;  2WC2 A;  5E20 A;  5CVU A;  4YII A;  1I5Z A;  2K86 A;  1T98 A;  4IRH A;  4O3M A;  3BDD A;  3CDH A;  3FM3 A;  5FD6 A;  2CGP A;  2XAG A;  4HLY A;  4NHJ A;  3M1E A;  5HDG A;  5DCF A;  3JTH A;  4Q48 A;  3CO6 C;  1U78 A;  3Q9V A;  2Y0M A;  2JZY A;  2Q2E A;  2FOK A;  1XCB A;  3TOB A;  3EET A;  1Z1D A;  2Q0O A;  2J5P A;  3QP5 A;  3RPQ A;  4UNO A;  3KFW X;  1IRF A;  4U0V A;  2RVC A;  2F5D A;  1R36 A;  4LG0 A;  1MGT A;  3HHG A;  2CYY A;  4KN4 X;  3ERE D;  2HYF A;  1FPQ A;  1XGM A;  4N0B A;  2P5L C;  2FEZ A;  4Y15 A;  1IN6 A;  1UFM A;  2HKO A;  3KP2 A;  1HKT A;  4DNC A;  4AWX B;  2QBY A;  1T39 A;  1HBX G;  3KZY A;  2PLY A;  4OMY A;  2DBB A;  5HVQ C;  3TGN A;  1FBU A;  3GFM A;  2HOE A;  2QM3 A;  2GWR A;  1HW5 A;  1ZG5 A;  1MJ9 A;  2XIG A;  3MAJ A;  5CVR A;  1FYM A;  2QLZ A;  4S05 A;  5A2Q K;  1T2K A;  4UUV A;  2FU4 A;  4MGR A;  1MZB A;  3S2W A;  2JSC A;  2RV8 A;  2GIV A;  3JAM Z;  3TO6 A;  1EH7 A;  1TQM A;  1RNL A;  2STW A;  3V8K A;  3K69 A;  3RDI A;  1D3Y A;  3GWZ A;  4RB3 C;  3I58 A;  5LGT A;  1B4A A;  2ZME B;  3T0Y A;  4WWC A;  3GVA A;  2AXL A;  1S29 A;  1R00 A;  4EJT A;  3WTZ A;  3EYI A;  2ZCW A;  4WXC A;  3WE3 A;  2UWM A;  5L3G A;  3FMS A;  3EDP A;  1G4D A;  2R7D A;  2QZ8 A;  2HQN A;  4G7H F;  4U7D A;  5AON A;  3LA3 A;  2MLK A;  2XAJ A;  2D2W A;  4A0X A;  3FXU A;  4EJW A;  2NYX A;  2HR3 A;  1J9I A;  1KYZ A;  5K5O A;  3WE2 A;  2X0L A;  4JK1 X;  2FNA A;  2HDC A;  2E1N A;  4BQA A;  3IHU A;  3WTW C;  4GYG A;  3D0S A;  5D5W B;  1BI1 A;  4KN7 X;  1MJA A;  2VC1 A;  5H20 A;  3ML6 A;  3KP6 A;  2A5Y B;  4ESB A;  2O61 A;  2VXZ A;  4I09 A;  5K5R A;  4M71 A;  2KIF A;  1QPM A;  2G9W A;  1A04 A;  4EM1 A;  3WGI A;  1R1U A;  1F9N A;  4OMZ A;  4G8X A;  1KGS A;  1KU2 A;  3QPH A;  1KYW A;  4PCQ A;  3E5Q A;  3DPT A;  3WGG A;  3SZT A;  5D4S A;  3IL2 A;  4KNY A;  2EFN A;  3F8M A;  3F22 A;  4OIN F;  2ISZ A;  1FNN A;  1BI2 A;  5D4R A;  4U7B A;  4L5J A;  5D8K B;  3J80 K;  2XKO A;  1YTY A;  3PQJ A;  3F6O A;  3GFJ A;  2A69 F;  2QEN A;  2F2E A;  3WG9 A;  3J81 K;  2MA3 A;  2NAZ A;  1R58 A;  2QBY B;  5J8F A;  2PI0 A;  1H9G A;  4O5V A;  6PAX A;  3DPL C;  3HRU A;  4HAM A;  3BJ6 A;  4E70 A;  1H9T A;  1BJA A;  2K27 A;  2ISY A;  3KEQ A;  1P4W A;  1OMI A;  5JFR A;  2QWW A;  2ADU A;  4OOI A;  2D45 A;  2GXB A;  1HST A;  5BMZ A;  4ZYE A;  5LBQ A;  4MNU A;  2RDP A;  1R5G A;  2Z33 A;  4UVB A;  3ZMT A;  3RTR A;  4RGU A;  2DQL A;  2KJB A;  2GQQ A;  3ISP A;  1ZLJ A;  3WU0 A;  3FHZ A;  2DW4 A;  4MTE A;  5H6R A;  1KA8 A;  2O03 A;  3L00 A;  3O3K A;  3T8T A;  5FLX K;  5D5U B;  4AIK A;  1WI9 A;  1W7P B;  2IP2 A;  1P2F A;  3QOP A;  1UHW A;  2FBH A;  4P5O A;  5DDG A;  3HOT A;  3ZP5 A;  1QNT A;  3ZN0 A;  4PDK A;  1XSD A;  3RKX A;  4F7Z A;  1PP8 F;  2FRH A;  2Y75 A;  2V9V A;  3T8R A;  2XGX A;  1IRG A;  5AIP A;  4FX4 A;  5ERI A;  1C0W A;  3AAF A;  3QAH A;  5A2Q Z;  3K9T A;  1RIO H;  1MJB A;  1FZP B;  2MBF A;  5LLQ A;  2BGC A;  2NS0 A;  1WWX A;  2ZBK A;  3VEP A;  2Z9O A;  4RB2 C;  4I02 A;  1IXR C;  4MEY F;  5ILV A;  1U6G A;  2YX4 A;  3NEU A;  3SZP A;  1BIB A;  5CYV A;  1MKM A;  2IPQ X;  2G7H A;  2DT5 A;  4KIC A;  3V8L A;  2W25 A;  5LEJ A;  2EFO A;  1ZHF A;  4ZZL A;  3RIR A;  4A2U A;  3FXR A;  2QUF A;  3I64 A;  2YU3 A;  3IRR A;  4EJV A;  1FY7 A;  3M8F A;  5HLI A;  4I01 A;  1KU7 A;  1FT9 A;  1CF7 B;  3SHF A;  4U0Y A;  3WTS C;  2FBK A;  4EVI A;  3QU6 A;  3FX3 A;  1IF1 A;  3COA C;  5JR3 A;  4RGS A;  1W4M A;  1JXS A;  5E1X A;  5KVR A;  1FX7 A;  2QQ9 A;  3LA7 A;  2O0Y A;  4XRF A;  4Y17 A;  3W6K B;  1B6A A;  5JVT A;  4ENK A;  1BM9 A;  1G6N A;  3CUQ A;  3E6B A;  2ZJ2 A;  4LLG F;  3M7G A;  2JTV A;  4P96 A;  2EWN A;  3O6B B;  1ON1 A;  2VBW A;  1AWC A;  2GA1 A;  1NHA A;  1TW3 A;  4H0E A;  2EFQ A;  1Z7U A;  1IAW A;  3F8C A;  4M9X A;  3R0A A;  4RGX A;  2HFH A;  3C3W A;  3IRQ A;  4GYI A;  3P7N A;  2LNB A;  2BYV E;  3L2C A;  2VBZ A;  2LKP A;  2CW0 F;  1W7P D;  4OIO F;  4ASN A;  1K7A A;  2L4A A;  3K1P A;  5E17 F;  1D8K A;  1FYL A;  1S7O A;  1MDM A;  1U8R A;  1XDS A;  2ZME A;  5HS8 A;  2F5E A;  1R5H A;  4AIH A;  4U88 A;  5IT3 A;  4RAZ A;  3BJO A;  4L5I A;  4NQW A;  3DF8 A;  5D5V B;  2DAO A;  2B0L A;  3J81 Z;  5ED4 A;  1LDD A;  4LFU A;  3V8J A;  2JPB A;  2DQR A;  3ELK A;  2XKP A;  3TDZ C;  1UST A;  2XHK A;  1XD7 A;  3K1M A;  3O2P E;  3R61 A;  1ZYR F;  3LQR A;  3HUG A;  1PUE E;  5TJJ A;  1YIO A;  1YLF A;  1HW1 A;  3B73 A;  2HS5 A;  3G3Z A;  3M8E A;  1FBS A;  1AOY A;  1HXD A;  4FHT A;  1IZ1 A;  1XSV A;  4R79 A;  4HF0 A;  1XB4 A;  2CO5 A;  4O6J A;  3CJN A;  1W5T A;  2VON A;  1FP1 D;  3KLO A;  3U2R A;  1SMY F;  1KQ8 A;  5TRD A;  1S7A A;  4A12 A;  2VBY A;  1FSE A;  4FX0 A;  3R4K A;  4WF2 A;  1OKR A;  4IF4 A;  5FGM A;  3VB2 A;  3ZMV A;  5IT9 Z;  3PFI A;  4XBF A;  1UHM A;  3FM5 A;  1LQ1 A;  1YQA A;  4M9Z A;  1GVJ A;  4A5N A;  2M1B A;  2FNP A;  3K0L A;  1O3R A;  5DD4 A;  2KRF A;  2ZXJ A;  4UV9 A;  5HS7 A;  2VT3 A;  1J0R A;  2FA5 A;  1KQ0 A;  3ZMZ A;  3CUQ B;  4EQQ A;  4NB5 A;  2EV6 A;  1KQ9 A;  2VN2 A;  4L0Z B;  3VOE A;  4KFC A;  4CYD A;  2FF4 A;  2OD5 A;  2Y48 A;  2M30 A;  2ZKZ A;  3HTU A;  2Q8K A;  4AD9 A;  2DO7 A;  1ZH5 A;  3I4P A;  1GXQ A;  2KKO A;  3E6C C;  4IVN A;  5E8G A;  4MHG A;  3LAJ A;  4XLN F;  3F8N A;  1S8N A;  1S3J A;  3J7A O;  1R7J A;  2PMH A;  1BN5 A;  1LDK B;  1R23 A;  2K4J A;  4Q5S F;  1MDM B;  4HYE A;  1R1T A;  1V4R A;  1FP2 A;  1R22 A;  1DUX C;  4GXO A;  2RKH A;  4MQ9 F;  1FLI A;  3IWF A;  1LB2 A;  5DCM B;  4ENJ A;  1YYV A;  5LHH A;  1Q1H A;  2OBP A;  3MQ0 A;  1W7P A;  5CLS A;  3TDU C;  1YW7 A;  1XN7 A;  4YIF A;  1KU3 A;  4CGZ A;  1ZN2 A;  3HTS B;  1ZLK A;  2UZK A;  4LB5 A;  5D5X B;  3GF2 A;  2MH9 A;  3N97 A;  4LJZ F;  4N9H A;  2OA4 A;  4B8X A;  5LGN A;  4UVC A;  3WU1 B;  1I6X A;  3W6J B;  2M45 A;  4WCG A;  1O7L A;  2ETH A;  4I0B A;  3N4M A;  5D8L B;  1USS A;  5LGU A;  2FMY A;  4UXN A;  4A6E A;  2VT2 A;  3ROU A;  1J59 A;  3KET A;  4EJU A;  3KP5 A;  4Z2Y A;  4RGR A;  2P7C B;  2FBI A;  1T38 A;  4EGY A;  1RZ4 A;  1IN5 A;  3GZ5 A;  4HX7 A;  1J5Y A;  2M5W A;  2HWV A;  3JTG A;  4YG2 F;  5DEQ A;  4I0A A;  4CHU A;  2WTE A;  5L3E A;  3ZMD A;  3R6S A;  3FXQ A;  4EMS A;  1TBX A;  4R8H A;  3GW2 A;  1E17 A;  5BPD A;  3FMQ A;  4OIR F;  2OAZ A;  1QGP A;  4ZZD A;  3RYR A;  3QRF F;  2HKX A;  2K4B A;  4G94 A;  3DFG A;  2V1X A;  1OPC A;  4I7H A;  3U1D A;  1CF7 A;  4PZJ A;  2VC0 A;  2L4M A;  1REP C;  5BPI A;  2H09 A;  3V4G A;  3FMR A;  1GHC A;  4XSX F;  4M72 A;  4HQE A;  3FWE A;  5ICF A;  4LLN A;  5FFX A;  3CTA A;  3REO A;  5DUI A;  3DXJ F;  3I54 A;  2M8E A;  3RKY A;  4KMF A;  5DV5 A;  1D8J A;  3HRT A;  1IN8 A;  2NNY A;  5HLG A;  2HYG D;  2L3D A;  3E6D A;  4IJA A;  3I59 A;  5D6F A;  2E1C A;  5FD5 A;  2ESN A;  1U5T B;  1GXP A;  2CSO A;  2WV0 A;  2PMU A;  2MH2 A;  4HOB A;  2O6G E;  2V79 A;  1E2X A;  4BHP A;  2A61 A;  2CQK A;  5LRR A;  5ICG A;  4M74 A;  1IUY A;  3KLN A;  1BBY A;  5AIQ A;  4WK8 F;  5L3D A;  1S6L A;  3IWZ A;  5CJ9 A;  1HKS A;  1J2X A;  3F3X A;  2VOO A;  4P9F A;  4M9S A;  1QZY A;  1LEB A;  4KMU X;  1ULY A;  2A6H F;  2WWY A;  2V6C A;  3ECH A;  3F8B A;  3ULQ B;  1P92 A;  3TKY A;  3FF5 A;  4ESJ A;  5HOO A;  5F6F A;  1G3T A;  3GX4 X;  4G7Z F;  5DD8 A;  5H6Q A;  1K79 A;  2ESH A;  3LFK A;  3OV8 A;  4JBA A;  4P9U A;  4HLX A;  2STT A;  2IW5 A;  3WTX C;  1Z6R A;  4ZYD A;  4LK1 F;  3E5U A;  4LLL A;  4CZZ A;  3T1B A;  2IA0 A;  2XAH A;  3K1N A;  2IVM A;  2OQR A;  1SAX A;  4YFX F;  3HRS A;  5L3C A;  5CVJ A;  4ENM A;  3NRV A;  2P5K A;  4WX9 A;  3Q5F A;  1VTN C;  1O3T A;  3H3U A;  4IPA A;  5L3F A;  3CUO A;  1ZRF A;  4Y13 A;  2W24 A;  3IKV A;  3EUH A;  1OYY A;  3V7S A;  5K5Q A;  4EJO A;  5LHG A;  4PGH A;  3JAM K;  1JE8 A;  4RB0 A;  4YFN F;  2IT0 A;  2LDU A;  1FWZ A;  1WSU A;  4IHS A;  2HTS A;  2HGC A;  2A3S A;  2E7X A;  2F5C A;  4FT8 A;  3TOA A;  1X3U A;  3ZPL A;  2FQ3 A;  1ZG1 A;  4RB1 A;  2UXN A;  4EV0 A;  3R60 A;  4HDU A;  3LST A;  3RKW A;  2P5V A;  3F8F A;  2XRO A;  3K2Z A;  3I5U A;  2GZW A;  2L01 A;  2JT1 A;  2P4W A;  1Y0U A;  3GO5 A;  3I59 B;  2PFB A;  4CIC A;  4UV8 A;  4A5M A;  3GFL A;  3V7C A;  1WRJ A;  2BBY A;  2W84 A;  1G3Y A;  4MEX F;  3MEX A;  2Z3Y A;  1XMA A;  2XRN A;  4XLP F;  4I98 B;  2EA4 A;  3LWF A;  3E97 A;  5LEK A;  2JRT A;  4BYY A;  2IJL A;  3F72 A;  2RC4 A;  4A0Z A;  2KIM A;  4HF1 A;  2QQA A;  3DV8 A;  3KP3 A;  1XMK A;  2MD5 A;  1Z9C A;  1IXS B;  3J80 Z;  3SFZ A;  4IRI A;  3CLO A;  4M73 A;  1STZ A;  3BRO A;  4AIJ A;  5DCM A;  1XSX A;  4HBL A;  4LD5 A;  2GAU A;  1BC7 C;  3ABT A;  2XV4 S;  2OZ6 A;  2X4H A;  3HSR A;  2DPD A;  4MQV A;  5ICC A;  2DFI A;  1WQ2 A;  5D6E A;  1DPU A;  1TTY A;  1O3Q A;  3BZ6 A;  5ILU A;  1SD6 A;  1JHH A;  4QWQ A;  3WOD F;  1Z6T A;  3RYP A;  1IXC A;  1FYK A;  1BI0 A;  1UB9 A;  3KP4 A;  3HRM A;  1P6R A;  2GA2 A;  2EA2 A;  5J6X A;  5JI6 A;  4L9J A;  1SFX A;  3I71 A;  3ZMS A;  2ACJ A;  2L54 A;  4MTD A;  3P9C A;  3HYI A;  1P4A A;  2H6B A;  2P7V B;  2CWE A;  4L9N A;  1L3L A;  2DU9 A;  3GEZ A;  3NQO A;  1TNT A;  1XGO A;  4OU0 A;  2GXG A;  2PG4 A;  1I27 A;  4ETS A;  3FZV A;  4Q47 A;  1FBQ A;  3C7J A;  2ZFW A;  3MZH A;  2RNJ A;  5FLX Z;  4PGG A;  3CUQ C;  1YO5 C;  1IN4 A;  3PQK A;  4L18 B;  4A6D A;  1ZRE A;  3C18 A;  4IHT A;  2P6T A;  1EH8 A;  2FML A;  3DP7 A;  3LQQ A;  2RN7 A;  1EV7 A;  4IXA A;  1O7F A;  2D1V A;  4KUM A;  5LRS A;  1W5S A;  2IRF G;  1D5V A;  4CXF A;  5ICE A;  2YX7 A;  5F1R A;  3BP8 A;  4BHB A;  3MCZ A;  1B1B A;  1BI3 A;  4BNC A;  1JGS A;  1F5T A;  3QU3 A;  2BEO A;  4S04 A;  1CGP A;  4RAY A;  1Z05 A;  1ODD A;  2V1D A;  1HSJ A;  4TV7 A;  3ZN1 A;  4G7O F;  2O8X A;  4KT5 C;  2IA1 A;  3HIF A;  5FO5 A;  2H6C A;  3TO7 A;  1QBJ A;  3C1D A;  2DPU A;  4ZYH A;  1U5T A;  1BIA A;  4L9T A;  4B09 A;  2PBI A;  2OQG A;  1QO0 D;  4KIG A;  2HTJ A;  2LF7 A;  1P4X A;  1DP7 P;  1H0M A;  3P9K A;  1QQI A;  2XVC A;  4KDP A;  3F21 A;  1YS6 A;  5BQT A;  1K78 B;  1ZRC A;  4UVA A;  4KA4 A;  4R1H A;  4DQ2 A;  2VE9 A;  4CDG A;  3F23 A;  1MD0 A;  5BS6 A;  1F4K A;  3JSO A;  3RJP A;  4N9I A;  4ON0 A;  3RPU A;  1KU9 A;  4LK0 F;  1XCV A;  5BOX A;  1J75 A;  4HQM A;  2CFX A;  1PP7 U;  1HW2 A;  3H3Z A;  5LHI A;  1ZAO A;  1DDN A;  2ZNY A;  2K7L A;  2EK5 A;  1ON2 A;  3MFK A;  3RI4 A;  2DLL A;  2E7W A;  1SD4 A;  3L09 A;  1LEA A;  2EFW A;  4KIF A;  5HDN A;  1TQI A;  3EYY A;  4HF2 A;  2NNN A;  5DYM A;  3LAP A;  2D1H A;  3WTU C;  3F6V A;  3BJA A;  3DKW A;  4JQF A;  1HKQ A;  1SD5 A;  2H27 A;  4HX4 A;  1ZGA A;  2V1U A;  2DTR A;  2R7F A;  2Z5U A;  3BPX A;  1YS7 A;  3JW4 A;  1ZRD A;  4YFK F;  3CO7 C;  3VOD A;  1T6S A; 
#chains in the Genus database with same CATH topology
 2P6S A;  5F64 A;  1ZR2 A;  4XSZ F;  2W57 A;  1K6O A;  1YJ9 I;  1LVA A;  4BEH A;  1YFH A;  4EM0 B;  1BC8 C;  1ZG3 A;  3M9A A;  3E6M A;  3LSR A;  2XUB A;  3HGG A;  3IC7 A;  1FC3 A;  2BW3 B;  2EIJ H;  2TDX A;  3JRD A;  4DIQ A;  3GLX A;  5E1Z B;  3ECO A;  2ID3 A;  2DK5 A;  5IPA A;  2R5Y B;  3KZZ A;  4G6D A;  1EKE A;  4HDV A;  4LG0 B;  2DYS H;  2ZFU A;  3GFI A;  2X6W A;  4A3F J;  4DOZ A;  2ZO4 A;  4HZF A;  4M6Y A;  2LMD A;  5GAG J;  2HEO A;  3BLY A;  1YG2 A;  2DYR H;  2Q1Z B;  4CO8 A;  2G7U A;  5E8I A;  1POG A;  4U0W A;  1RUO A;  1J7K A;  2QVO A;  1RI7 A;  3I53 A;  4J00 A;  1BR4 A;  3L9F A;  2W1O A;  4RMN A;  5IYD J;  2WY8 Q;  3Q3S A;  1XGN A;  2IA2 A;  5HLH A;  2BV6 A;  4LIU A;  4GGG A;  2JPC A;  2OUM A;  3F9K A;  2UV1 A;  5FB2 A;  2VOP A;  2IS6 A;  3W2V A;  3SXY A;  3VYU B;  2CJJ A;  3K7A J;  3EQL F;  2MFZ A;  2M87 A;  4FCY A;  4OIP F;  1UZC A;  2A6E F;  2VOD A;  2M2E A;  1MH3 A;  1LNW A;  1U5T C;  4WXD A;  1SFU A;  1B72 B;  1SVO A;  2XGE A;  3FKI J;  5ILS A;  4FAS D;  4FQG A;  4BJ6 C;  1B9N A;  2ME0 A;  3PNY A;  1IN7 A;  4XOT A;  1GLN A;  5B3S H;  1BOA A;  3VYR B;  2P8T A;  1EH6 A;  2PN6 A;  2KIS A;  2PQ8 A;  3L2W A;  3L7W A;  1RKT A;  2DT6 A;  2HZT A;  4Q4Z F;  4BH9 A;  5EZH A;  1I1G A;  2Y69 H;  1OQY A;  3TO9 A;  2L7F P;  3WTY C;  2QYO A;  3AG1 H;  2P0W A;  3CCJ I;  2F4O B;  3DKX A;  2LH9 A;  1TNS A;  1R4N B;  4QLC U;  5FFZ A;  2EQR A;  1PJR A;  1QZE A;  3ABU A;  3U9G A;  4EM2 A;  2XSJ C;  1HDP A;  2PJR B;  2PJP A;  1FSH A;  3RSN A;  4BJ5 C;  3W2W A;  1ZGJ A;  4G6Q A;  3BWG A;  2NVY J;  3KYL A;  2NRA C;  1T0F A;  1FTT A;  3SYT A;  1SMT A;  3CJR B;  3G71 I;  2ELH A;  2VAS A;  4HW0 A;  2V9P A;  1SAU A;  2AS5 F;  2C6Y A;  1FOK A;  4K2E A;  5C4J J;  4XLC A;  3KE2 A;  4XLF A;  2R92 J;  3ZQ7 A;  3OYE A;  5JHF A;  3RQI A;  3BR3 A;  2KMU A;  4B44 A;  2BHY A;  2XAU A;  4AVP A;  3ABM H;  1ONV A;  2KQR A;  2WA0 A;  4BGD A;  3S3O A;  2J5O A;  1DPR A;  2EB7 A;  2A07 F;  1MBG A;  3KP7 A;  2PX9 A;  3OOP A;  1NG7 A;  3M1C A;  3J7A Y;  3H92 A;  3MZ8 A;  1X1C A;  2F5F A;  2WBM A;  5IT9 K;  4RLF A;  1TW2 A;  1BW5 A;  1X19 A;  1U2W A;  2FXA A;  2HQR A;  2JVH A;  1B9M A;  1F1Z A;  1YI2 I;  2CV0 A;  1YIT I;  3Q9S A;  2Z99 A;  4UHT A;  5J47 A;  3VFZ A;  1P7I A;  5J1U A;  4ENN A;  2D5V A;  3BR6 A;  1GVD A;  1TQP A;  2LY9 A;  2NVX J;  1TWF J;  1ERD A;  2XAQ A;  1UJ8 A;  4KIB A;  4Z6Y A;  1UCR A;  3H35 A;  3FK6 A;  2F6C A;  2VBX A;  2YPR A;  3E0J B;  4KYW A;  1G3W A;  3WGH A;  1MMD A;  1XDU A;  2K9L A;  1XGS A;  3BY6 A;  3OSF A;  3MMY B;  5E18 F;  1ZK8 A;  3SQN A;  4P1W A;  2MLG A;  2BZT A;  3BR2 A;  4LGW A;  1QZZ A;  2L9R A;  1APL C;  1MMN A;  3MKZ A;  1DGR M;  2VE8 A;  1Z91 A;  2JQ7 A;  4WXH A;  3R0J A;  3GTK J;  3G1L A;  3W6V A;  2LRD A;  2K02 A;  2A6T A;  5F04 A;  2VPR A;  2H94 A;  5J4V A;  3UKG A;  3HDD A;  2E5Z A;  5L3B A;  3KZI C;  2E5N A;  1ZAR A;  4BXU A;  1Z3Y A;  5IP6 A;  2IS2 A;  3RQ4 A;  2A68 F;  2RGV A;  1OYW A;  2YR2 A;  4V19 K;  1O3S A;  2LR8 A;  4BEH B;  3QP6 A;  4HX8 A;  2F4M B;  1DP3 A;  2BXZ A;  4AID A;  3TP0 A;  2EV5 A;  2KJC A;  4ESF A;  3BPV A;  1SD7 A;  2XAS A;  2DK8 A;  3P5J A;  1LFP A;  2LSO A;  4RM3 A;  4ZH4 F;  3I55 I;  3I56 I;  4BAY A;  2MC4 A;  4HG2 A;  5EZG A;  3ZQQ A;  4EAT A;  5JVG F;  1O57 A;  3B02 A;  4IRG A;  4MLO A;  4HEA 2;  3A01 A;  4L0Y B;  3G2B A;  4XON A;  2OF7 A;  3N05 A;  3BG9 A;  2EIK H;  1BOB A;  2QQB A;  1P9Q C;  1RUN A;  3FK7 A;  4HA8 A;  4II3 A;  2JA5 J;  3JSP A;  3GTJ J;  3E7L A;  4LB6 B;  2OZU A;  2M34 A;  5EEH A;  5DM6 F;  2COM A;  5HDK A;  2H1K A;  1YE9 A;  3FBN B;  1JT6 A;  1G3S A;  3FXM A;  1NTC A;  3QPL A;  3ZRG A;  4BE0 A;  4G9Y A;  1OYI A;  2KIQ A;  4OIQ F;  1WKM A;  3GXO A;  1OR7 A;  3CMY A;  4BQN A;  2EV0 A;  3TQN A;  4JP0 A;  2DA5 A;  5K1Y A;  3KCC A;  2RQP A;  1X4O A;  4GCV A;  3HOS A;  4NNJ A;  3E3V A;  1A6I A;  2EFP A;  2EJR A;  5CVI A;  4I76 A;  3WTT C;  5KK1 A;  1NG6 A;  3DBR B;  2X6O A;  3V42 A;  5DUK A;  1VQ6 I;  3BCB A;  2DI3 A;  2PEX A;  4C2U A;  4GO1 A;  3T5X A;  3HL2 A;  4A3D J;  2Y30 A;  4AYB N;  3D5L A;  3MWM A;  3GYH X;  1V5G A;  4XN0 A;  4AYB A;  4LMY A;  5F1J A;  3DQV C;  2YSR A;  5J8C A;  1VQP I;  3GZ6 A;  3QYF A;  4FTH A;  3G73 A;  1RPW A;  5JLW A;  3DEU A;  1QA6 A;  1TLH B;  1OCP A;  4M6X A;  3E5X A;  3JCU C;  3MN2 A;  1LDJ A;  4EGZ A;  2R5Z A;  2X48 A;  3I0T A;  4KJZ A;  4NC7 A;  4IOC F;  3M4O J;  2O3F A;  3PL8 A;  3LA2 A;  3QPT A;  2FSW A;  3KYD B;  4NC8 A;  1B8I A;  1JHF A;  1RC9 A;  4HV5 A;  2ELJ A;  2ZXH A;  2CG4 A;  3VSK A;  5CVV A;  4QIW N;  1B59 A;  1YW9 A;  4ZYG A;  2R3S A;  1IV8 A;  1JUM A;  5IY5 H;  1MW7 A;  2LVS A;  2Y2Z A;  5JHU A;  2WAD A;  3P9I A;  4CCL A;  3WU2 C;  1V3F A;  2W85 A;  2FE3 A;  3S1N J;  2DTZ A;  1Y6I A;  4MFE A;  3BOQ A;  2XAF A;  3S3N A;  1U3E M;  3HSF A;  4HV6 A;  3V7R A;  1VQL I;  1V5E A;  1L0O C;  2HI3 A;  1WI3 A;  2K9N A;  2L02 A;  1K78 A;  1LE8 A;  4L9V A;  3DLL F;  2UXX A;  4XRS G;  3K4N A;  2XPU A;  2X85 A;  3ZMU A;  4D0P A;  4UY8 I;  4P55 A;  1R5I D;  4I2O A;  1YW8 A;  1R1V A;  4BHC A;  1SFE A;  2LTP A;  2KIU A;  1VF9 A;  2LF8 A;  4LOC A;  2VIX A;  1VND A;  3IKT A;  1HQC A;  4BU2 A;  4DW6 A;  4YRV A;  2EPF A;  3WTV C;  2KFD A;  2R0Q C;  4A0Y A;  3OWT A;  4UB8 C;  3HHH A;  2ZNZ A;  2Y0S N;  3KEO A;  4XOP A;  1V5F A;  2JA2 A;  1PDN C;  3GUD A;  2Y0S A;  4RS8 A;  2JA6 J;  1I1S A;  1E3P A;  2BE5 F;  4IHY A;  4ZJZ A;  3MZY A;  1T8I A;  3CD6 I;  5EEG A;  5LD2 C;  2OU2 A;  5HS9 A;  2ECC A;  3CP2 A;  2DFE A;  1IW7 F;  3HSE A;  2MC3 A;  2DOA A;  4F52 A;  3BZK A;  1LJ9 A;  1VQN I;  4RBO A;  1Y8Q B;  2WC2 A;  5E1W A;  2LYC A;  1IDZ A;  3SJM A;  5FKN A;  5E20 A;  4XRM A;  5C44 J;  5CVU A;  4YII A;  1I5Z A;  2K86 A;  1T98 A;  4IRH A;  4O3M A;  3BDD A;  3CDH A;  1VQO I;  3FM3 A;  5FD6 A;  2CGP A;  2XAG A;  4OWR B;  4HLY A;  4NHJ A;  3NAR A;  2KZG A;  1JUS A;  3CMA I;  3G1M A;  3M1E A;  3RCO A;  1TL8 A;  3H3V K;  1I6H J;  3CF5 F;  5HDG A;  2BY3 A;  2OV7 A;  5DCF A;  3JTH A;  4Q48 A;  3CO6 C;  1U78 A;  4GRI A;  1WHU A;  3Q9V A;  2Y0M A;  2JZY A;  2Q2E A;  2FOK A;  1XCB A;  3HJE A;  4E4H A;  2GM4 A;  3K4M A;  5FRM A;  3TOB A;  4DYR A;  1TWG J;  2BVL A;  3EET A;  2QQ8 A;  2R7X A;  1MMG A;  3A01 B;  1QHH D;  4XNF A;  4IQ4 A;  5J40 A;  1Z1D A;  2Q0O A;  2J5P A;  3QP5 A;  1OR7 C;  2I10 A;  4J19 A;  2Z2S B;  3RPQ A;  4UNO A;  3KFW X;  2COB A;  4OAY A;  4BXF A;  2BW3 A;  1IRF A;  4U0V A;  3BTL A;  2RVC A;  2F5D A;  1R36 A;  4LG0 A;  2ZXW H;  4C3J J;  2HDD A;  3W3C A;  1MGT A;  4CSW A;  3HHG A;  4ZTF A;  4DBR A;  3DU5 A;  2QSG X;  4E7Z A;  2CYY A;  2OTJ I;  4N4O B;  4KN4 X;  4XMY A;  2VQC A;  3ERE D;  1SVM A;  2HYF A;  1FPQ A;  1XGM A;  2JUC A;  3K6G A;  4N0B A;  2P5L C;  2K3F A;  2FEZ A;  1WJC A;  4ANJ A;  4Y15 A;  3OYF A;  3QWL A;  1IN6 A;  2VQH A;  1D1C A;  5EEA A;  5FKK A;  1UFM A;  2HKO A;  4BDY A;  3KP2 A;  2V9K A;  3KX2 A;  3PUB A;  1HKT A;  2NOG A;  4DNC A;  2M4G A;  4AWX B;  1UMQ A;  2QBY A;  1T39 A;  1HBX G;  2ZJQ F;  3KZY A;  3ZR8 X;  2HVS A;  2PLY A;  4OMY A;  2DBB A;  1B72 A;  5HVQ C;  1G2H A;  3TGN A;  1FBU A;  2K3P A;  3GFM A;  5B66 C;  2HOE A;  2R5Z B;  2QM3 A;  2L9V A;  2GWR A;  3HOW J;  3BQZ A;  4CCJ A;  1HW5 A;  4XID A;  1ZG5 A;  5EJC A;  1MJ9 A;  2XIG A;  2JRM A;  1JTX A;  2RAE A;  3MAJ A;  3H5A A;  5CVR A;  2IGK A;  2VQG A;  2BOL A;  1FIP A;  1FYM A;  2QLZ A;  3GCM A;  4S05 A;  2XF7 A;  5A2Q K;  1T2K A;  4UUV A;  2FU4 A;  4MGR A;  2CMP A;  1MNM C;  3CC4 I;  3LSI A;  1D5Y A;  1ZTR A;  1MZB A;  1FOY A;  2FOW A;  4LIV A;  4H4K C;  1UAA A;  4JX4 A;  3S2W A;  1Y1W J;  2JSC A;  3B6C A;  1K4T A;  3CJT B;  3HPG A;  2RV8 A;  2GIV A;  3JAM Z;  1EA3 A;  3TO6 A;  5J4Y A;  4E7H A;  1EH7 A;  2BVM A;  1TQM A;  3WG7 H;  4PK4 A;  4PJN A;  1RNL A;  3LL7 A;  1TT5 B;  2STW A;  2L5Q A;  1G8X A;  4CH7 A;  1LE8 B;  3V8K A;  1RKW A;  3S8P A;  3K69 A;  3RDI A;  2LC2 A;  1D3Y A;  4ABZ A;  3GWZ A;  4RB3 C;  2B7E A;  3I58 A;  1B4A A;  5LGT A;  3DWL E;  2ZME B;  2IEK A;  3T0Y A;  3FDY A;  3LSJ A;  4WWC A;  4I99 C;  3GVA A;  4D1Q A;  1E0E A;  2AXL A;  3JRI A;  2WAE A;  4E7S A;  1S29 A;  2XF6 A;  1R00 A;  3CZ6 A;  3OL3 A;  4NQW B;  5E3O A;  4EJT A;  3WTZ A;  3EYI A;  2ZCW A;  3AG4 H;  4WXC A;  2F5V A;  3WE3 A;  4D5C A;  2UWM A;  5L3G A;  2LLK A;  1S5L C;  3S15 J;  3FMS A;  3EDP A;  3DLA A;  1G4D A;  2R7D A;  2QZ8 A;  2VI6 A;  2HQN A;  4G7H F;  1D0Y A;  4U7D A;  4XL9 A;  5AON A;  5K7Z A;  3OYI A;  4YIR X;  3LA3 A;  2MLK A;  2XAJ A;  5GAE J;  1RR8 C;  5E79 C;  4FET A;  3HG9 A;  3G4S I;  2CQQ A;  3HUG B;  2D2W A;  2OJE D;  1JKR C;  4A0X A;  5JLX A;  3TMO A;  1CQT A;  3FXU A;  1RRJ A;  4A3E J;  4EJW A;  2KHM A;  2MG4 A;  4FE7 A;  2NYX A;  2HR3 A;  3X2Q H;  4M3G A;  1K83 J;  1J9I A;  1KYZ A;  2EZL A;  1W0T A;  3ZQL A;  4GDF A;  4RAG A;  3BG5 A;  5K5O A;  3WE2 A;  2X0L A;  1TC3 C;  4IHX A;  2HNH A;  4JK1 X;  1H88 C;  2FNA A;  2HDC A;  2E1N A;  2DMT A;  3ABK H;  2FD5 A;  2XDV A;  4AVZ A;  4BQA A;  3IHU A;  2B9S A;  2GLO A;  3WTW C;  4GYG A;  1RR7 A;  2Q2E B;  3D0S A;  1YJN I;  5D5W B;  1BI1 A;  4XLH A;  3S1R J;  3S2D J;  4KN7 X;  1MJA A;  2VC1 A;  5H20 A;  4L5E A;  3ML6 A;  3KP6 A;  2QGU A;  1VQ4 I;  2A5Y B;  2DFH A;  3VSL A;  4XKV A;  1MMA A;  1QU3 A;  4ESB A;  2O61 A;  3GZN B;  2LG4 A;  3CDL A;  2VXZ A;  4I09 A;  4IHW A;  5K5R A;  4M71 A;  2KIF A;  1QPM A;  2G9W A;  1A04 A;  4EM1 A;  1MBE A;  3WGI A;  4BQO A;  3ZQG A;  1R1U A;  2DCE A;  1F9N A;  2HQ5 A;  4OMZ A;  2JK3 A;  4G8X A;  4M3E A;  3MD2 A;  1KGS A;  1KU2 A;  3BR1 A;  3QPH A;  1KYW A;  4PCQ A;  3E5Q A;  3DPT A;  4HPQ A;  3WGG A;  3SZT A;  5D4S A;  3IL2 A;  3OIO A;  1WZ2 A;  4KNY A;  2EH3 A;  2EFN A;  1MBK A;  3F8M A;  3F22 A;  3K70 D;  4OIN F;  2ISZ A;  1FNN A;  4NDL A;  2EBI A;  1BI2 A;  4PFO A;  5D4R A;  4U7B A;  1E3H A;  2ELK A;  4L5J A;  5D8K B;  3J80 K;  2O9L A;  3CCU I;  3HOZ J;  2VXD A;  2XKO A;  1YTY A;  2HOT A;  3PQJ A;  4HST A;  3F6O A;  3GFJ A;  2ICW G;  1XX5 A;  1ETO A;  2A69 F;  2DOE A;  2DJN A;  2QEN A;  2F2E A;  3WG9 A;  3J81 K;  4NBQ A;  4DZP A;  2MA3 A;  2NAZ A;  1LKX A;  1R58 A;  3M07 A;  2QBY B;  2DDB A;  1V54 H;  3OYN A;  5J8F A;  3A03 A;  2PI0 A;  1H9G A;  1ZR4 A;  2VJ4 A;  4NUB A;  4O5V A;  3H5N A;  1T56 A;  3OOU A;  4RDU A;  6PAX A;  3DPL C;  3HRU A;  3BTC A;  4E6K G;  4E7J A;  1W1W E;  4HAM A;  3S1M J;  3BJ6 A;  4E70 A;  1H9T A;  3H36 A;  1BJA A;  3H9J A;  3UNG C;  4BE1 A;  1YX3 A;  2K27 A;  1PUF B;  3OYC A;  3QQA A;  2ISY A;  3KEQ A;  3BZC A;  2DFF A;  1P4W A;  1OMI A;  3HEF A;  5JFR A;  4X1E A;  3JRG A;  4PJL A;  4I6Z A;  2QWW A;  2ADU A;  3SDB A;  2LKX A;  1SVL A;  3ZQI A;  4BQQ A;  2V4J C;  4OOI A;  2JWT A;  3BT9 A;  2HPM A;  1DU6 A;  2D45 A;  1ZGW A;  3SDG A;  4BKX A;  2GXB A;  5EYR A;  1HST A;  2NOJ B;  5BMZ A;  1EJ9 A;  1MMS A;  4ZYE A;  5LBQ A;  3HC7 A;  4Y52 J;  1XG1 A;  4MNU A;  1IO2 A;  2E19 A;  2RDP A;  1R5G A;  2DA3 A;  3RKQ A;  2Z33 A;  1UG2 A;  4UVB A;  3CCQ I;  3ZMT A;  3RTR A;  4B3A A;  4RGU A;  4KIS A;  2DQL A;  2KJB A;  3BQY A;  2GQQ A;  3ESW B;  1ZLJ A;  2CRG A;  3ISP A;  3WU0 A;  1GT0 C;  3FHZ A;  2DW4 A;  1U8B A;  4MTE A;  5IYB J;  1X1B A;  3BG7 A;  3O8H A;  5H6R A;  4HSR A;  1KA8 A;  2O03 A;  3L00 A;  3O3K A;  3T8T A;  1VQ7 I;  5D5U B;  5FLX K;  4AIK A;  1WI9 A;  5F0F A;  1GV2 A;  1W7P B;  3PM1 A;  2IP2 A;  1P2F A;  3QOP A;  4X0G A;  1UHW A;  2FBH A;  2I8D A;  1AKH B;  4P5O A;  1ETK A;  5DDG A;  3HOT A;  3ZCO A;  3ZP5 A;  1QNT A;  2DXI A;  2OC6 A;  3ZN0 A;  3PSF A;  2CH0 A;  4PDK A;  1XSD A;  1QPI A;  3RKX A;  4F7Z A;  2E1M C;  1PP8 F;  1TT0 A;  2FRH A;  3LMM A;  2Y75 A;  1WJF A;  4ZYA A;  4QPO A;  2VKE A;  4BBR J;  2V9V A;  1W0U A;  3K10 A;  1HLV A;  4BBS J;  2ID6 A;  3T8R A;  2XGX A;  1IRG A;  5AIP A;  5FLV A;  4FX4 A;  3DBL B;  5ERI A;  1IJW C;  5DTD A;  4FE4 A;  1C0W A;  1IRZ A;  4F55 A;  3AAF A;  4ZC3 A;  3S14 J;  2E1M B;  1YIJ I;  4N4N B;  2QKL B;  3QAH A;  3U1K A;  1X2M A;  5A2Q Z;  3OYH A;  4IX7 A;  3K9T A;  1RIO H;  1ETX A;  1MJB A;  1FZP B;  2MBF A;  3CCE I;  5B1A H;  5LLQ A;  2BGC A;  3BG3 A;  2NS0 A;  1WWX A;  3FXJ A;  4CA0 A;  3PNV A;  2ZBK A;  3VEP A;  2Z9O A;  4RB2 C;  4I02 A;  1IXR C;  4QSH A;  4MEY F;  3L2U A;  3OYM A;  1X58 A;  2KP6 A;  5ILV A;  1U6G A;  1IC8 A;  2YX4 A;  3NEU A;  3SZP A;  5E3M A;  1BIB A;  5CYV A;  1MKM A;  3HKZ N;  2IPQ X;  2G7H A;  1TP4 A;  2DT5 A;  3H9G A;  4KIC A;  3V8L A;  2W25 A;  1Z0X A;  5LEJ A;  1NK3 P;  2V1N A;  3HKZ A;  2EFO A;  1ZHF A;  4ZZL A;  3MVP A;  3RIR A;  4A2U A;  1LPQ A;  2Z16 A;  3FXR A;  1I3A A;  1WH5 A;  2QUF A;  1UHS A;  3I64 A;  2YU3 A;  2XC7 A;  4A3J J;  2TRT A;  4XKB A;  2JVG A;  3ZGK A;  4C3I J;  5GP9 A;  3IRR A;  4EJV A;  1FY7 A;  3M8F A;  5HLI A;  4I01 A;  1KU7 A;  1FT9 A;  2VPL A;  2LKS A;  1CF7 B;  1AU7 A;  2I5U A;  3SHF A;  2L9S A;  4E7I A;  4U0Y A;  4A3C J;  2O7O A;  3WTS C;  2GOM A;  2BY2 A;  2FBK A;  2XRL A;  4EVI A;  1N25 A;  3FX3 A;  1OCR H;  3QU6 A;  1IF1 A;  2E1O A;  4HNT A;  3DKY A;  3COA C;  1SFK A;  5JR3 A;  3DU6 A;  4RGS A;  1W4M A;  1JXS A;  5E1X A;  5KVR A;  2CS3 A;  4A93 J;  1FX7 A;  4XKC A;  3ONQ A;  5DS9 A;  2QQ9 A;  3LA7 A;  2LP0 A;  4XR6 A;  4S0H B;  2O0Y A;  4XRF A;  4Y17 A;  2W7N A;  1ETY A;  3W6K B;  1A6Q A;  1B6A A;  5JVT A;  3MKW B;  2ZB9 A;  4ENK A;  2CUJ A;  1BM9 A;  1G6N A;  3CUQ A;  3E6B A;  2ZJ2 A;  4LLG F;  2N8G A;  2GIZ A;  3M7G A;  2JTV A;  2Y31 A;  4P96 A;  2G0E A;  2L9N A;  2EWN A;  3O6B B;  3CCS I;  1ON1 A;  2VL8 A;  2VBW A;  4M3B A;  1T0F C;  3LSH A;  3CCM I;  2O5R A;  1AWC A;  3AL0 B;  4M3F A;  2GA1 A;  1NHA A;  1TW3 A;  4A3M J;  4YEJ A;  5FKM A;  2EFQ A;  1ETV A;  4H0E A;  5C4X J;  1Z7U A;  1IAW A;  3F8C A;  2QSF X;  2MW8 A;  4M9X A;  2R7S A;  2XB0 X;  3C2B A;  5F27 A;  3R0A A;  4RGX A;  2EIN H;  2HFH A;  2W48 A;  2XPW A;  3C3W A;  3IRQ A;  3C2H A;  4GYI A;  1DU0 A;  4JX5 A;  3P7N A;  2LNB A;  1S72 I;  2BYV E;  2L7M P;  3L2C A;  4YEL A;  2VBZ A;  2LKP A;  2CW0 F;  3I4N J;  4B48 A;  1MSF C;  1W7P D;  3FIW A;  4OIO F;  5GAD J;  2FJ1 A;  3MKL A;  4ASN A;  4G6T B;  1U9N A;  2CV1 A;  4BE2 A;  1W36 C;  1K7A A;  3ERM A;  2R7U A;  2EIM H;  2L4A A;  3K1P A;  3TBI A;  3Q0U A;  5E17 F;  1ZEL A;  1D8K A;  2ZJR F;  1RET A;  1MH4 A;  1FYL A;  1X4P A;  3PO2 J;  2JUG A;  1ORK A;  3VDX A;  1S7O A;  1MDM A;  2BXY A;  4HNU A;  1U8R A;  2M3A A;  3LFU A;  1XDS A;  1VQ5 I;  5F08 A;  5IP7 J;  2ZME A;  5HS8 A;  2F5E A;  1JKP C;  3CJQ B;  1R5H A;  4AIH A;  1VFC A;  4CCK A;  4U88 A;  5IT3 A;  4RAZ A;  4RM2 A;  1DQU A;  3BJO A;  4L5I A;  2E36 A;  4A3I J;  3OMY A;  1ZKG A;  3DF8 A;  4NQW A;  3HB9 A;  5D5V B;  2DAO A;  5CKT A;  2B0L A;  3J81 Z;  2HPI A;  1FJL A;  5ED4 A;  4D7N A;  1LDD A;  2LY1 A;  2XGD A;  2HOA A;  4LFU A;  3CDI A;  3V8J A;  1BJZ A;  1ZQ3 P;  2JPB A;  3PNT A;  2DQR A;  1V55 H;  2RQQ A;  2XKP A;  3ELK A;  2K40 A;  3OYD A;  1PVE A;  3TDZ C;  1UST A;  1WH7 A;  2K85 A;  4NC6 A;  2XHK A;  1XD7 A;  3K1M A;  1XC5 A;  2LY2 A;  3O2P E;  2VQL A;  3R61 A;  3CCV I;  2DMU A;  2HYJ A;  1ZYR F;  3LQR A;  2YUS A;  3HUG A;  5M5W J;  1PUE E;  4X6A J;  1WJB A;  5TJJ A;  1YIO A;  1YLF A;  1HW1 A;  3S93 A;  3VPR A;  3B73 A;  2HS5 A;  3G3Z A;  3M8E A;  2E34 A;  3LNQ A;  4Y7N J;  1FBS A;  3H5R A;  1IV6 A;  1HXD A;  4FHT A;  1AOY A;  5HNF A;  1IZ1 A;  5GAH J;  1R71 A;  3E1S A;  1XSV A;  1ENH A;  4R79 A;  4HF0 A;  3OIP A;  5GTH C;  2V26 A;  4XKW A;  1P7J A;  1WPK A;  1XB4 A;  4C2M J;  2CO5 A;  2IAI A;  2B63 J;  4O6J A;  1ETW A;  2IGO A;  3CJN A;  4G12 A;  1W5T A;  3TW6 A;  2VON A;  1FP1 D;  4CYC A;  1YRN B;  3KLO A;  5KNL A;  3U2R A;  1SMY F;  1KQ8 A;  4XK4 A;  5TRD A;  2DA1 A;  1FMV A;  2EZH A;  3JRH A;  1S7A A;  4U87 A;  4A12 A;  2VBY A;  4PUS A;  1FSE A;  4FX0 A;  3R4K A;  1Y8R B;  4WF2 A;  2QA4 I;  1OKR A;  4IF4 A;  5FGM A;  3VB2 A;  3ZMV A;  1WJE A;  5IT9 Z;  5J3L A;  2CU7 A;  3PFI A;  4XBF A;  4XN3 A;  1VQ9 I;  4XQF A;  1UHM A;  2CQ7 A;  5FLM J;  3TED A;  3FM5 A;  1LQ1 A;  1I39 A;  1XMX A;  1Q1V A;  1YQA A;  2L7K A;  3HZJ A;  4M9Z A;  4BS9 A;  1XPX A;  2R7T A;  1GVJ A;  3KYC B;  4A5N A;  1JGG A;  1MBH A;  1H89 C;  2M1B A;  2FNP A;  1BR2 A;  3TW7 A;  3GTO J;  2HXO A;  3K0L A;  1O3R A;  3HPH A;  5DD4 A;  2V6E A;  2KRF A;  4DGW B;  4C2T A;  1SC7 A;  2ZXJ A;  1HC8 A;  4UV9 A;  5TGT A;  3FXO A;  3PUF A;  4MIM A;  4DBQ A;  1VQK I;  5HS7 A;  2VT3 A;  5CQE A;  1J0R A;  2FA5 A;  1H8A C;  1KQ0 A;  3ZMZ A;  5GTI C;  2UUZ A;  1OCO H;  5B5E C;  2ZXI A;  1VZ0 A;  4Y3O A;  3CUQ B;  4EQQ A;  4NB5 A;  2EV6 A;  1KQ9 A;  2VN2 A;  3ASO H;  1K61 A;  3IH3 A;  4L0Z B;  4CCO A;  3VOE A;  4KFC A;  4CYD A;  2FF4 A;  3H9Q A;  2OD5 A;  2Y48 A;  2M30 A;  2ZKZ A;  3FHN A;  2EZI A;  3HTU A;  2Q8K A;  4AD9 A;  1NH3 A;  3PFY A;  2DO7 A;  4BJT A;  1OIS A;  1ZH5 A;  3I4P A;  1GXQ A;  4BY7 J;  4Y33 A;  4BUP A;  2XSD C;  5FKL A;  2YS9 A;  3FKJ A;  1PUF A;  1MND A;  2KKO A;  3E6C C;  4IVN A;  5E8G A;  4MHG A;  3LAJ A;  4XLN F;  1Y39 A;  3F8N A;  1S8N A;  1S3J A;  2E35 A;  3J7A O;  2MD0 A;  1R7J A;  2PMH A;  1BN5 A;  2ZME C;  1LDK B;  1R23 A;  5C3E J;  4B4C A;  4IL6 C;  2CQN A;  2VKV A;  5F0C A;  2RRE A;  2CUZ A;  1G59 A;  4JOM A;  2K4J A;  3K4B A;  4Q5S F;  1MDM B;  3D5R C;  4HYE A;  1JJ6 C;  1R1T A;  1Y56 A;  3A0H C;  1V4R A;  4IEJ A;  3CCR I;  4BAC A;  1FP2 A;  1R22 A;  3LSM A;  1FEX A;  3OSG A;  2H8W A;  1OCZ H;  4M6V A;  1DUX C;  4GXO A;  2RKH A;  1EF4 A;  3IH4 A;  1IDY A;  3AG3 H;  2KL4 A;  4JX6 A;  3KPH A;  1LFU P;  1JT0 A;  4MQ9 F;  1FLI A;  3IWF A;  1LB2 A;  5DCM B;  4UUT A;  4ENJ A;  3CCY A;  4XOR A;  1YYV A;  2MYS A;  2GBY A;  5LHH A;  1Q1H A;  3QOD A;  2OBP A;  2OCC H;  4FIS A;  2ZSI B;  3DTI A;  1HOM A;  1YHQ I;  3MQ0 A;  2ECB A;  3NWS A;  1W7P A;  5CLS A;  3TDU C;  1YW7 A;  1XN7 A;  4F3Q A;  4YIF A;  1KU3 A;  1AKH A;  4CGZ A;  1VQ8 I;  1ITY A;  1ZN2 A;  3HTS B;  3GTM J;  1ZLK A;  1D0Z A;  2UZK A;  4LB5 A;  5D5X B;  3GF2 A;  2MH9 A;  3N97 A;  4LJZ F;  4N9H A;  2OA4 A;  1R6R A;  4B8X A;  1QHG A;  5LGN A;  1SEU A;  4UVC A;  3WU1 B;  1I6X A;  1J09 A;  3W6J B;  4C30 A;  2M45 A;  4WCG A;  1PYV A;  1O7L A;  2ETH A;  4I0B A;  2JA8 J;  2CW7 A;  3H0G J;  3N4M A;  5D8L B;  1USS A;  5LGU A;  3ABL H;  3K4L A;  2FMY A;  3OL4 A;  4UXN A;  3JRF A;  4A6E A;  2VT2 A;  3ROU A;  1R49 A;  1N75 A;  1J59 A;  2E2J J;  3KET A;  3VWB A;  4CYC B;  2VUM J;  2NXN B;  1SAN A;  4EJU A;  3KP5 A;  4Z2Y A;  2KRH A;  4B1R A;  2HOS A;  4RGR A;  2E60 A;  2KRC A;  2P7C B;  4GFB A;  2FBI A;  5IOY A;  1T38 A;  4EGY A;  2HDW A;  5KAF C;  3M3Y J;  1RZ4 A;  1IN5 A;  1QVT A;  3M8J A;  3GZ5 A;  3IV5 A;  3HOY J;  4HX7 A;  5LFA A;  1J5Y A;  2M5W A;  1QRY A;  2HWV A;  2KT0 A;  4A69 C;  3PJR A;  1MNE A;  2AXT C;  3SFI A;  2MAB A;  1A31 A;  3JTG A;  4YG2 F;  5DEQ A;  4B43 A;  3J7Z I;  4F93 B;  3J7Y J;  4I0A A;  4CHU A;  2WTE A;  4CCN A;  5L3E A;  3ZMD A;  3R6S A;  3FXQ A;  4AM3 A;  4EMS A;  1TBX A;  4R8H A;  3GW2 A;  1E17 A;  3ZOB A;  5BPD A;  3GME A;  3FMQ A;  4AC0 A;  3L2V A;  4OIR F;  3K4J A;  2HU9 A;  3I9V 2;  1N78 A;  2OAZ A;  1QGP A;  4ZZD A;  3RYR A;  3QRF F;  1VQM I;  3OS2 A;  4IKF A;  2HKX A;  1JTY A;  2K4B A;  4G94 A;  3DFG A;  1HA8 A;  3SEQ A;  2V1X A;  1OPC A;  4I7H A;  3U1D A;  1CF7 A;  3OS1 A;  4PZJ A;  2VC0 A;  2L4M A;  3HBL A;  2GXA A;  2BHZ A;  1REP C;  1M1E B;  4IZZ A;  2WAQ N;  2DOF A;  2AQF A;  3G6E I;  2H09 A;  5BPI A;  3V4G A;  3FMR A;  4B47 A;  3U21 A;  4ZTJ A;  4XLE A;  2WAQ A;  2WV1 A;  1GHC A;  3I3L A;  1QVU A;  4XSX F;  3K4K A;  3ZQF A;  2R7V A;  4M72 A;  1U0J A;  4IO9 F;  5M3F J;  2O8K A;  2DDA A;  2M8G X;  3GTG J;  4HQE A;  2W82 A;  2VJ5 A;  3FWE A;  3OR1 C;  5ICF A;  2F48 A;  3Q0W A;  4LLN A;  5FFX A;  1T95 A;  3CTA A;  3VYS B;  2NS7 A;  3REO A;  5DUI A;  3DXJ F;  4DYC A;  4II2 A;  5EGO B;  3D5S C;  3GBG A;  3I54 A;  2M8E A;  3BG6 A;  5CPR B;  1JUP A;  3RKY A;  4KMF A;  5EF6 A;  4XIC A;  5DV5 A;  1D8J A;  3NAU A;  3TP3 A;  3S2H J;  3HRT A;  1IN8 A;  2DMP A;  3CC7 I;  2W4S A;  1IG7 A;  2L7Z A;  2QKM B;  5TIS C;  2NNY A;  5HLG A;  1Z21 A;  2HYG D;  2L3D A;  2L2O A;  2HVQ A;  4UB6 C;  4W97 A;  2ZSH B;  3E6D A;  4IJA A;  3I59 A;  5D6F A;  2E1C A;  5FD5 A;  3OYA A;  2ESN A;  4CZC A;  3F0C A;  1U5T B;  2X1E A;  2DMN A;  1GXP A;  2RNG A;  2CSO A;  2WV0 A;  1AA7 A;  1I50 J;  2KPM A;  2PMU A;  2R4G A;  2MH2 A;  4HOB A;  2O6G E;  2V79 A;  1E2X A;  4BHP A;  4DZJ A;  1XS9 A;  2A61 A;  2CQK A;  5LRR A;  4HRI A;  5KHD A;  1WJA A;  1RES A;  2CUE A;  3LOC A;  5ICG A;  4M74 A;  2X1C A;  4KT6 A;  2M9H A;  2JMW A;  1IUY A;  3KLN A;  4IOA F;  1BBY A;  1WJD A;  5AIQ A;  4WK8 F;  5L3D A;  1S6L A;  2P81 A;  3IWZ A;  5CJ9 A;  1HKS A;  3PSI A;  1J2X A;  2DN0 A;  2VKD A;  3F3X A;  3A4C A;  5FRN A;  3IP4 B;  4C3H J;  1YX5 A;  2VOO A;  2DA2 A;  5M5Y J;  3O8G A;  1Z3X A;  4P9F A;  4M9S A;  1QZY A;  1LEB A;  1Y1V J;  2DOD A;  1ULY A;  4KMU X;  2A6H F;  3NWT A;  2WWY A;  1FMW A;  4A3B J;  2V6C A;  3OYJ A;  3ECH A;  4MO7 A;  5HOD A;  3CES A;  2M0M A;  3F8B A;  1X1P A;  1ETQ A;  3ULQ B;  1P92 A;  3TKY A;  3FF5 A;  2X51 A;  3GLL A;  3WHC A;  4ESJ A;  5HOO A;  3IH2 A;  2BY0 A;  5F6F A;  3CME I;  4B3X A;  1WJ5 A;  1G3T A;  2R7Q A;  3GX4 X;  4G7Z F;  3GTL J;  5DD8 A;  5H6Q A;  1K79 A;  2ESH A;  1Z7L A;  2HXI A;  3LFK A;  1FOW A;  3OV8 A;  1K4S A;  4JBA A;  4P9U A;  4HLX A;  3AKZ A;  1MSE C;  1BA5 A;  2A05 A;  2K9S A;  4A3L J;  4UUS B;  2STT A;  3A0B C;  1O4X A;  2IW5 A;  3WTX C;  1Z6R A;  3HM5 A;  2QSH X;  4ZYD A;  4LK1 F;  3E5U A;  1MIJ A;  5HLT A;  4LLL A;  4ZDO A;  4CZZ A;  1X1D A;  1OFC X;  2LBF B;  3T1B A;  2IA0 A;  3C2G A;  3S3M A;  2XAH A;  2IXS A;  3K1N A;  4XRS A;  9ANT A;  1TZL A;  4E7L A;  2QF7 A;  5B1B H;  3RZD J;  3BC8 A;  3HOV J;  4E7K A;  2IVM A;  2OQR A;  1SAX A;  1YRN A;  4YFX F;  3HRS A;  1JI8 A;  3OIQ A;  5L3C A;  5CVJ A;  4ENM A;  3OYK A;  5GPA A;  3NRV A;  1FIA A;  2P5K A;  3DTK A;  3Q0V A;  4WX9 A;  3L2Q A;  1WFX A;  3Q5F A;  1VTN C;  1O3T A;  3H3U A;  4IPA A;  5H2F C;  5L3F A;  2FQ4 A;  3CUO A;  1BL0 A;  1ZRF A;  4Y13 A;  3HXL A;  2W24 A;  3IKV A;  3PIP F;  3EUH A;  4RA2 A;  1X3Z B;  1OYY A;  3V7S A;  3I4M J;  5K5Q A;  2VLA A;  5E3N A;  4EJO A;  2DA7 A;  2XPV A;  5LHG A;  2LD5 A;  1A35 A;  3EPZ A;  4PGH A;  3JAM K;  2K9Q A;  1HDD C;  3LSK A;  1JE8 A;  4RB0 A;  4YFN F;  2X1D A;  4LG3 A;  2IT0 A;  3BR0 A;  3H0D A;  2LDU A;  1TWA J;  1FWZ A;  1OCC H;  1WSU A;  4IHS A;  2HTS A;  2CW8 A;  2A3S A;  2HGC A;  4CCM A;  1JJ8 C;  2AHQ A;  2E7X A;  2F5C A;  3CLQ A;  2VKH A;  4FT8 A;  2CV2 A;  3TOA A;  3K2A A;  1X3U A;  1VI0 A;  3ZPL A;  4EEF G;  3HOX J;  2FQ3 A;  3AL0 C;  3QOE A;  1ZG1 A;  4RB1 A;  2UXN A;  4EV0 A;  3R60 A;  4BXX J;  5BNG A;  2DMQ A;  2M4K A;  2WB1 N;  4HDU A;  1U9O A;  1IGN A;  1KON A;  3S17 J;  3LST A;  3D1N I;  2KDZ A;  2X6X A;  3RKW A;  2P5V A;  2DJI A;  2WB1 A;  3F8F A;  2XRO A;  3K2Z A;  2QEX I;  1D1B A;  2H8R A;  3JRA A;  3I5U A;  2GZW A;  1K6Y A;  2L01 A;  3FBI B;  4IQJ A;  2JT1 A;  2P4W A;  4ZDL A;  1Y0U A;  2L0K A;  2YU9 J;  2Y9Y A;  3CP8 A;  2X6Y A;  3GO5 A;  3CC2 I;  1HF0 A;  3CQZ J;  3UR3 C;  3OYB A;  3I59 B;  2PFB A;  2NVQ J;  1S9H A;  4CIC A;  2FUG 2;  4UV8 A;  4A5M A;  1A5J A;  5KAI C;  3GFL A;  3V7C A;  1WRJ A;  3L2R A;  2IGN A;  2XB5 A;  2BBY A;  3KEY A;  2OTL I;  2W84 A;  2XGC A;  2DA6 A;  2BY1 A;  4V2G A;  1Y0N A;  3PIO F;  2LK2 A;  3CF2 A;  1G3Y A;  1MBJ A;  3CMM A;  4MEX F;  3MEX A;  2Z3Y A;  2EZK A;  3RPU D;  1XMA A;  2XRN A;  4XLP F;  4I98 B;  1W5C C;  4IHV A;  2EA4 A;  3RZO J;  3LWF A;  3E97 A;  5M5X J;  2KDO A;  1IUF A;  5LEK A;  1TWH J;  2JRT A;  4BYY A;  3VYT B;  2WY7 Q;  2IJL A;  1S7E A;  3F72 A;  2RC4 A;  4A0Z A;  2X9D A;  2KIM A;  4C9Y A;  2WAF A;  4HF1 A;  2QQA A;  3DV8 A;  3KP3 A;  5FKO A;  5GPC A;  2NVT J;  2M0C A;  1XMK A;  2MD5 A;  3K4C A;  2JN6 A;  1Z9C A;  3OR2 C;  1D0X A;  1IXS B;  1FTZ A;  3J80 Z;  3SFZ A;  1A36 A;  1BR1 A;  4IRI A;  1JKQ C;  3CLO A;  2HVR A;  1ACI A;  2QCO A;  4M73 A;  1STZ A;  3A1Y A;  3BRO A;  4AIJ A;  5DCM A;  5M3M J;  1XSX A;  4XLA A;  3H1C A;  1WVR A;  4HBL A;  1UG0 A;  4LD5 A;  2GAU A;  1BC7 C;  1Z67 A;  3ABT A;  2GOX B;  2XV4 S;  1X2N A;  3MKY B;  2PMZ N;  3ZXS A;  2OZ6 A;  4DJA A;  2X4H A;  3HSR A;  2DPD A;  4MQV A;  3FIS A;  3DEW A;  1D1A A;  2PMZ A;  3OYL A;  5ICC A;  2R7Z J;  2DFI A;  1WQ2 A;  4Y4R A;  2E2H J;  5D6E A;  1HCR A;  2CUF A;  3ZQH A;  1DPU A;  3GTP J;  1TTY A;  2MGQ A;  2NVU B;  3TL4 X;  1O3Q A;  3L1P A;  3BZ6 A;  1FOX A;  5ILU A;  5FJ8 J;  1YJW I;  1SD6 A;  1JHH A;  4QWQ A;  4OAZ A;  3WOD F;  1Z6T A;  3RYP A;  1IXC A;  1FYK A;  1BI0 A;  1BW6 A;  1UB9 A;  2R7R A;  2A5W A;  2M7B A;  3KP4 A;  4ITV A;  3A02 A;  3HRM A;  1P6R A;  1JKO C;  2GA2 A;  2EA2 A;  5J6X A;  5JI6 A;  5FRO A;  4L9J A;  1SFX A;  5HNH A;  5EDN A;  3I71 A;  1OLT A;  2JJ7 A;  3ZMS A;  2ACJ A;  2LOO A;  2NS8 A;  2AQE A;  1LUJ B;  2L54 A;  1E3O C;  3EUH C;  4MTD A;  3P9C A;  3HYI A;  1P4A A;  2H6B A;  2P7V B;  5J1Y A;  5CQG A;  2CWE A;  1OCT C;  4L9N A;  1LFB A;  2KZV A;  4HNV A;  1UEL B;  4M3D A;  5J1R A;  4QPQ A;  1L3L A;  3FXK A;  2KLO A;  5K7H A;  2CFO A;  2DU9 A;  3GEZ A;  3IUO A;  3NQO A;  1TNT A;  3JRC A;  1XGO A;  4F91 B;  4KIT B;  1N77 A;  4OU0 A;  2GXG A;  2PG4 A;  3QYE A;  1I27 A;  4ETS A;  3FZV A;  5EG0 A;  4Q47 A;  2R7O A;  5F0H A;  5DM7 F;  1FBQ A;  1OJL A;  3C7J A;  3DEE A;  2ZFW A;  4D7M A;  3MZH A;  2DA4 A;  2RNJ A;  5FLX Z;  3IAM 2;  4PGG A;  3CUQ C;  1YO5 C;  2HZD A;  1IN4 A;  3PQK A;  4L18 B;  2IBD A;  4A6D A;  3FXL A;  1F43 A;  4JYK A;  1I3Q J;  1R9T J;  4RAF A;  4J01 A;  1ZRE A;  3C18 A;  4IHT A;  3DTE A;  2P6T A;  1EH8 A;  2FML A;  3DP7 A;  3LQQ A;  2R5Y A;  1DGW Y;  2RN7 A;  4V2F A;  1GV5 A;  4PJM A;  1EV7 A;  4IXA A;  3K70 C;  1GDT A;  1O7F A;  4BDZ A;  2AO9 A;  2D1V A;  1AHD P;  4KUM A;  1R4M B;  5LRS A;  1W5S A;  5IYC J;  3QYB A;  2CQX A;  3G1O A;  2IRF G;  1D5V A;  2K5C A;  3PO3 J;  4CXF A;  5ICE A;  2YX7 A;  5F1R A;  3S1Q J;  1X1A A;  4AU7 A;  3BP8 A;  2ME6 A;  4BHB A;  1X3W B;  3MCZ A;  1B1B A;  1BI3 A;  4BNC A;  1JGS A;  2VB6 A;  2W00 A;  3HGY A;  1F5T A;  2Z1D A;  3LSG A;  3SZG A;  3QU3 A;  5EGO A;  2ZJP F;  2BEO A;  4S04 A;  1CGP A;  1WCM J;  1F36 A;  4RAY A;  3SEZ A;  3OY9 A;  4BL0 B;  1Z05 A;  2VJI A;  1ODD A;  3A2K A;  3AFH A;  2V1D A;  1HSJ A;  4F92 B;  3QPS A;  4TV7 A;  2HQA A;  3ZN1 A;  4G7O F;  3DPU A;  1TWC J;  1LVK A;  2O8X A;  4KT5 C;  2IA1 A;  2F4I A;  2E71 A;  3HIF A;  2OCE A;  5FO5 A;  2H6C A;  3TO7 A;  1B8I B;  3S16 J;  4QTR A;  1QBJ A;  1SFO J;  3C1D A;  2DPU A;  4ZYH A;  1U5T A;  2OPT A;  4PJJ A;  1BIA A;  4L9T A;  1W36 D;  4B09 A;  2PBI A;  4A3G J;  2OQG A;  1QO0 D;  5K7F A;  2ZC2 A;  4KIG A;  2HTJ A;  4PFP A;  2LF7 A;  1P4X A;  1MBF A;  3BTI A;  3DCF A;  1DP7 P;  2V7F A;  1H0M A;  3ZQC A;  3P9K A;  1QQI A;  2PJR A;  2XVC A;  4KDP A;  2XF5 A;  3F21 A;  3GTQ J;  1YS6 A;  5BQT A;  3B6A A;  1K78 B;  1ZRC A;  4UVA A;  1T08 B;  4KA4 A;  4R1H A;  4DQ2 A;  2VE9 A;  4CDG A;  3LSP A;  3F23 A;  1MD0 A;  1Z77 A;  5BS6 A;  3OYG A;  2IS4 A;  1T33 A;  2LFB A;  1NK2 P;  1F4K A;  2TCT A;  3JRE A;  3EUA A;  3DBH B;  1WGX A;  3JSO A;  2JSP A;  3RJP A;  2MSY A;  4N9I A;  4ON0 A;  3RPU A;  1KU9 A;  4LK0 F;  4PSX A;  1XCV A;  3S32 A;  3OS0 A;  5BOX A;  1J75 A;  2VJJ A;  4HQM A;  4RLQ A;  4CUG A;  4XM3 A;  3ASN H;  1GUU A;  1XTA A;  2CFX A;  1YOV B;  2K9M A;  4PSW A;  1PP7 U;  1HW2 A;  3H3Z A;  5IOZ A;  5IP9 J;  1IRX A;  2FX0 A;  5LHI A;  3BCA A;  2EIL H;  3IAS 2;  4LIT A;  1ZAO A;  4W1U A;  4MFD A;  1DDN A;  2ZNY A;  2M7A A;  4ZDP A;  3CCL I;  2K7L A;  2EK5 A;  1ON2 A;  3BTJ A;  4DYQ A;  3MFK A;  3W2A A;  2H1L A;  3RI4 A;  2R93 J;  2DLL A;  2E7W A;  1SD4 A;  3L09 A;  2DT7 B;  3JRB A;  1LEA A;  2EFW A;  4KIF A;  5HDN A;  4UUS A;  4BY1 J;  1TQI A;  3EYY A;  4D5F A;  4HF2 A;  2E2I J;  2NNN A;  5DYM A;  5E3L A;  4D9J A;  3LAP A;  3KIO A;  3JR9 A;  2D1H A;  2LBF A;  3WTU C;  4A3K J;  3F6V A;  3BJA A;  3DKW A;  4JQF A;  3BR5 A;  1HKQ A;  1SD5 A;  2H27 A;  2R7W A;  2IS1 A;  4HX4 A;  1ZGA A;  2V1U A;  4AUX A;  2DTR A;  2R7F A;  2Y9Z A;  2Z5U A;  3BPX A;  1YS7 A;  3JW4 A;  3AG2 H;  3EUK L;  5EG0 B;  3HOU J;  2IGM A;  1ZRD A;  2JA7 J;  5KCM A;  4YFK F;  4PJ0 C;  3WHB A;  3CO7 C;  1KZH A;  2LRE A;  3VOD A;  1T6S A; 
#chains in the Genus database with same CATH homology
 2P6S A;  5F64 A;  4XSZ F;  2W57 A;  1K6O A;  1LVA A;  1YFH A;  4EM0 B;  1BC8 C;  1ZG3 A;  3M9A A;  3E6M A;  2XUB A;  3IC7 A;  1FC3 A;  2TDX A;  3GLX A;  5E1Z B;  3ECO A;  2DK5 A;  3KZZ A;  4G6D A;  4HDV A;  4LG0 B;  3GFI A;  2ZO4 A;  4HZF A;  4M6Y A;  2HEO A;  1YG2 A;  4CO8 A;  2G7U A;  5E8I A;  4U0W A;  1RUO A;  1J7K A;  2QVO A;  1RI7 A;  3I53 A;  3L9F A;  1XGN A;  2IA2 A;  5HLH A;  2BV6 A;  4GGG A;  2JPC A;  5FB2 A;  2VOP A;  3SXY A;  3EQL F;  2M87 A;  4OIP F;  2A6E F;  2VOD A;  1U5T C;  1LNW A;  4WXD A;  1SFU A;  5ILS A;  1B9N A;  1IN7 A;  1BOA A;  2P8T A;  1EH6 A;  2PN6 A;  2PQ8 A;  3L7W A;  2HZT A;  4Q4Z F;  4BH9 A;  1I1G A;  3TO9 A;  3WTY C;  2QYO A;  1TNS A;  4QLC U;  5FFZ A;  4EM2 A;  3ABU A;  3U9G A;  2PJP A;  1FSH A;  1ZGJ A;  4G6Q A;  3BWG A;  2NRA C;  1T0F A;  1SMT A;  2ELH A;  4HW0 A;  2AS5 F;  2C6Y A;  1FOK A;  4K2E A;  3KE2 A;  3ZQ7 A;  4AVP A;  1ONV A;  2J5O A;  1DPR A;  2EB7 A;  2A07 F;  3KP7 A;  3OOP A;  3H92 A;  2F5F A;  5IT9 K;  1TW2 A;  2FXA A;  1U2W A;  2HQR A;  1B9M A;  1F1Z A;  3Q9S A;  2Z99 A;  4UHT A;  3VFZ A;  4ENN A;  1TQP A;  2XAQ A;  4KIB A;  1UCR A;  2VBX A;  2YPR A;  4KYW A;  1G3W A;  3WGH A;  1XDU A;  1XGS A;  3BY6 A;  5E18 F;  3SQN A;  2MLG A;  4LGW A;  1QZZ A;  2VE8 A;  1Z91 A;  4WXH A;  3R0J A;  2K02 A;  2H94 A;  5L3B A;  1ZAR A;  4BXU A;  2A68 F;  2RGV A;  1OYW A;  2YR2 A;  1O3S A;  3QP6 A;  4HX8 A;  2EV5 A;  2KJC A;  4ESF A;  3BPV A;  1SD7 A;  2XAS A;  2DK8 A;  2LSO A;  4ZH4 F;  4BAY A;  1O57 A;  3B02 A;  4IRG A;  4L0Y B;  2QQB A;  1RUN A;  4HA8 A;  3JSP A;  4LB6 B;  2OZU A;  5EEH A;  2COM A;  5HDK A;  1G3S A;  4G9Y A;  1OYI A;  4OIQ F;  1WKM A;  3GXO A;  1OR7 A;  2EV0 A;  3TQN A;  5K1Y A;  3KCC A;  2RQP A;  4GCV A;  3HOS A;  3E3V A;  2EFP A;  2EJR A;  5CVI A;  3WTT C;  5KK1 A;  5DUK A;  2DI3 A;  2PEX A;  4GO1 A;  3T5X A;  3D5L A;  3MWM A;  3GYH X;  4LMY A;  3DQV C;  2YSR A;  5J8C A;  3GZ6 A;  3G73 A;  3DEU A;  1TLH B;  4M6X A;  3E5X A;  1LDJ A;  4EGZ A;  3I0T A;  2O3F A;  3LA2 A;  3QPT A;  2FSW A;  1JHF A;  4HV5 A;  2CG4 A;  5CVV A;  1B59 A;  1YW9 A;  4ZYG A;  2R3S A;  5JHU A;  3P9I A;  1V3F A;  2W85 A;  2FE3 A;  3BOQ A;  2XAF A;  1U3E M;  3HSF A;  4HV6 A;  3V7R A;  1L0O C;  2L02 A;  1K78 A;  4L9V A;  2UXX A;  3ZMU A;  4D0P A;  4P55 A;  4I2O A;  1YW8 A;  1R1V A;  4BHC A;  1SFE A;  2KIU A;  2LF8 A;  3IKT A;  1HQC A;  3WTV C;  4A0Y A;  3HHH A;  2ZNZ A;  3KEO A;  1PDN C;  3GUD A;  4RS8 A;  1I1S A;  2BE5 F;  3MZY A;  5EEG A;  2OU2 A;  5HS9 A;  1IW7 F;  3HSE A;  2MC3 A;  1LJ9 A;  5E1W A;  2WC2 A;  5E20 A;  5CVU A;  4YII A;  1I5Z A;  2K86 A;  1T98 A;  4IRH A;  4O3M A;  3BDD A;  3CDH A;  3FM3 A;  5FD6 A;  2CGP A;  2XAG A;  4HLY A;  4NHJ A;  3M1E A;  5HDG A;  5DCF A;  3JTH A;  4Q48 A;  3CO6 C;  1U78 A;  3Q9V A;  2Y0M A;  2JZY A;  2Q2E A;  2FOK A;  1XCB A;  3TOB A;  3EET A;  1Z1D A;  2Q0O A;  2J5P A;  3QP5 A;  3RPQ A;  4UNO A;  3KFW X;  1IRF A;  4U0V A;  2RVC A;  2F5D A;  1R36 A;  4LG0 A;  1MGT A;  3HHG A;  2CYY A;  4KN4 X;  3ERE D;  2HYF A;  1FPQ A;  1XGM A;  4N0B A;  2P5L C;  2FEZ A;  4Y15 A;  1IN6 A;  1UFM A;  2HKO A;  3KP2 A;  1HKT A;  4DNC A;  4AWX B;  2QBY A;  1T39 A;  1HBX G;  3KZY A;  2PLY A;  4OMY A;  2DBB A;  5HVQ C;  3TGN A;  1FBU A;  3GFM A;  2HOE A;  2QM3 A;  2GWR A;  1HW5 A;  1ZG5 A;  1MJ9 A;  2XIG A;  3MAJ A;  5CVR A;  1FYM A;  2QLZ A;  4S05 A;  5A2Q K;  1T2K A;  4UUV A;  2FU4 A;  4MGR A;  1MZB A;  3S2W A;  2JSC A;  2RV8 A;  2GIV A;  3JAM Z;  3TO6 A;  1EH7 A;  1TQM A;  1RNL A;  2STW A;  3V8K A;  3K69 A;  3RDI A;  1D3Y A;  3GWZ A;  4RB3 C;  3I58 A;  5LGT A;  1B4A A;  2ZME B;  3T0Y A;  4WWC A;  3GVA A;  2AXL A;  1S29 A;  1R00 A;  4EJT A;  3WTZ A;  3EYI A;  2ZCW A;  4WXC A;  3WE3 A;  2UWM A;  5L3G A;  3FMS A;  3EDP A;  1G4D A;  2R7D A;  2QZ8 A;  2HQN A;  4G7H F;  4U7D A;  5AON A;  3LA3 A;  2MLK A;  2XAJ A;  2D2W A;  4A0X A;  3FXU A;  4EJW A;  2NYX A;  2HR3 A;  1J9I A;  1KYZ A;  5K5O A;  3WE2 A;  2X0L A;  4JK1 X;  2FNA A;  2HDC A;  2E1N A;  4BQA A;  3IHU A;  3WTW C;  4GYG A;  3D0S A;  5D5W B;  1BI1 A;  4KN7 X;  1MJA A;  2VC1 A;  5H20 A;  3ML6 A;  3KP6 A;  2A5Y B;  4ESB A;  2O61 A;  2VXZ A;  4I09 A;  5K5R A;  4M71 A;  2KIF A;  1QPM A;  2G9W A;  1A04 A;  4EM1 A;  3WGI A;  1R1U A;  1F9N A;  4OMZ A;  4G8X A;  1KGS A;  1KU2 A;  3QPH A;  1KYW A;  4PCQ A;  3E5Q A;  3DPT A;  3WGG A;  3SZT A;  5D4S A;  3IL2 A;  4KNY A;  2EFN A;  3F8M A;  3F22 A;  4OIN F;  2ISZ A;  1FNN A;  1BI2 A;  5D4R A;  4U7B A;  4L5J A;  5D8K B;  3J80 K;  2XKO A;  1YTY A;  3PQJ A;  3F6O A;  3GFJ A;  2A69 F;  2QEN A;  2F2E A;  3WG9 A;  3J81 K;  2MA3 A;  2NAZ A;  1R58 A;  2QBY B;  5J8F A;  2PI0 A;  1H9G A;  4O5V A;  6PAX A;  3DPL C;  3HRU A;  4HAM A;  3BJ6 A;  4E70 A;  1H9T A;  1BJA A;  2K27 A;  2ISY A;  3KEQ A;  1P4W A;  1OMI A;  5JFR A;  2QWW A;  2ADU A;  4OOI A;  2D45 A;  2GXB A;  1HST A;  5BMZ A;  4ZYE A;  5LBQ A;  4MNU A;  2RDP A;  1R5G A;  2Z33 A;  4UVB A;  3ZMT A;  3RTR A;  4RGU A;  2DQL A;  2KJB A;  2GQQ A;  3ISP A;  1ZLJ A;  3WU0 A;  3FHZ A;  2DW4 A;  4MTE A;  5H6R A;  1KA8 A;  2O03 A;  3L00 A;  3O3K A;  3T8T A;  5FLX K;  5D5U B;  4AIK A;  1WI9 A;  1W7P B;  2IP2 A;  1P2F A;  3QOP A;  1UHW A;  2FBH A;  4P5O A;  5DDG A;  3HOT A;  3ZP5 A;  1QNT A;  3ZN0 A;  4PDK A;  1XSD A;  3RKX A;  4F7Z A;  1PP8 F;  2FRH A;  2Y75 A;  2V9V A;  3T8R A;  2XGX A;  1IRG A;  5AIP A;  4FX4 A;  5ERI A;  1C0W A;  3AAF A;  3QAH A;  5A2Q Z;  3K9T A;  1RIO H;  1MJB A;  1FZP B;  2MBF A;  5LLQ A;  2BGC A;  2NS0 A;  1WWX A;  2ZBK A;  3VEP A;  2Z9O A;  4RB2 C;  4I02 A;  1IXR C;  4MEY F;  5ILV A;  1U6G A;  2YX4 A;  3NEU A;  3SZP A;  1BIB A;  5CYV A;  1MKM A;  2IPQ X;  2G7H A;  2DT5 A;  4KIC A;  3V8L A;  2W25 A;  5LEJ A;  2EFO A;  1ZHF A;  4ZZL A;  3RIR A;  4A2U A;  3FXR A;  2QUF A;  3I64 A;  2YU3 A;  3IRR A;  4EJV A;  1FY7 A;  3M8F A;  5HLI A;  4I01 A;  1KU7 A;  1FT9 A;  1CF7 B;  3SHF A;  4U0Y A;  3WTS C;  2FBK A;  4EVI A;  3QU6 A;  3FX3 A;  1IF1 A;  3COA C;  5JR3 A;  4RGS A;  1W4M A;  1JXS A;  5E1X A;  5KVR A;  1FX7 A;  2QQ9 A;  3LA7 A;  2O0Y A;  4XRF A;  4Y17 A;  3W6K B;  1B6A A;  5JVT A;  4ENK A;  1BM9 A;  1G6N A;  3CUQ A;  3E6B A;  2ZJ2 A;  4LLG F;  3M7G A;  2JTV A;  4P96 A;  2EWN A;  3O6B B;  1ON1 A;  2VBW A;  1AWC A;  2GA1 A;  1NHA A;  1TW3 A;  4H0E A;  2EFQ A;  1Z7U A;  1IAW A;  3F8C A;  4M9X A;  3R0A A;  4RGX A;  2HFH A;  3C3W A;  3IRQ A;  4GYI A;  3P7N A;  2LNB A;  2BYV E;  3L2C A;  2VBZ A;  2LKP A;  2CW0 F;  1W7P D;  4OIO F;  4ASN A;  1K7A A;  2L4A A;  3K1P A;  5E17 F;  1D8K A;  1FYL A;  1S7O A;  1MDM A;  1U8R A;  1XDS A;  2ZME A;  5HS8 A;  2F5E A;  1R5H A;  4AIH A;  4U88 A;  5IT3 A;  4RAZ A;  3BJO A;  4L5I A;  4NQW A;  3DF8 A;  5D5V B;  2DAO A;  2B0L A;  3J81 Z;  5ED4 A;  1LDD A;  4LFU A;  3V8J A;  2JPB A;  2DQR A;  3ELK A;  2XKP A;  3TDZ C;  1UST A;  2XHK A;  1XD7 A;  3K1M A;  3O2P E;  3R61 A;  1ZYR F;  3LQR A;  3HUG A;  1PUE E;  5TJJ A;  1YIO A;  1YLF A;  1HW1 A;  3B73 A;  2HS5 A;  3G3Z A;  3M8E A;  1FBS A;  1AOY A;  1HXD A;  4FHT A;  1IZ1 A;  1XSV A;  4R79 A;  4HF0 A;  1XB4 A;  2CO5 A;  4O6J A;  3CJN A;  1W5T A;  2VON A;  1FP1 D;  3KLO A;  3U2R A;  1SMY F;  1KQ8 A;  5TRD A;  1S7A A;  4A12 A;  2VBY A;  1FSE A;  4FX0 A;  3R4K A;  4WF2 A;  1OKR A;  4IF4 A;  5FGM A;  3VB2 A;  3ZMV A;  5IT9 Z;  3PFI A;  4XBF A;  1UHM A;  3FM5 A;  1LQ1 A;  1YQA A;  4M9Z A;  1GVJ A;  4A5N A;  2M1B A;  2FNP A;  3K0L A;  1O3R A;  5DD4 A;  2KRF A;  2ZXJ A;  4UV9 A;  5HS7 A;  2VT3 A;  1J0R A;  2FA5 A;  1KQ0 A;  3ZMZ A;  3CUQ B;  4EQQ A;  4NB5 A;  2EV6 A;  1KQ9 A;  2VN2 A;  4L0Z B;  3VOE A;  4KFC A;  4CYD A;  2FF4 A;  2OD5 A;  2Y48 A;  2M30 A;  2ZKZ A;  3HTU A;  2Q8K A;  4AD9 A;  2DO7 A;  1ZH5 A;  3I4P A;  1GXQ A;  2KKO A;  3E6C C;  4IVN A;  5E8G A;  4MHG A;  3LAJ A;  4XLN F;  3F8N A;  1S8N A;  1S3J A;  3J7A O;  1R7J A;  2PMH A;  1BN5 A;  1LDK B;  1R23 A;  2K4J A;  4Q5S F;  1MDM B;  4HYE A;  1R1T A;  1V4R A;  1FP2 A;  1R22 A;  1DUX C;  4GXO A;  2RKH A;  4MQ9 F;  1FLI A;  3IWF A;  1LB2 A;  5DCM B;  4ENJ A;  1YYV A;  5LHH A;  1Q1H A;  2OBP A;  3MQ0 A;  1W7P A;  5CLS A;  3TDU C;  1YW7 A;  1XN7 A;  4YIF A;  1KU3 A;  4CGZ A;  1ZN2 A;  3HTS B;  1ZLK A;  2UZK A;  4LB5 A;  5D5X B;  3GF2 A;  2MH9 A;  3N97 A;  4LJZ F;  4N9H A;  2OA4 A;  4B8X A;  5LGN A;  4UVC A;  3WU1 B;  1I6X A;  3W6J B;  2M45 A;  4WCG A;  1O7L A;  2ETH A;  4I0B A;  3N4M A;  5D8L B;  1USS A;  5LGU A;  2FMY A;  4UXN A;  4A6E A;  2VT2 A;  3ROU A;  1J59 A;  3KET A;  4EJU A;  3KP5 A;  4Z2Y A;  4RGR A;  2P7C B;  2FBI A;  1T38 A;  4EGY A;  1RZ4 A;  1IN5 A;  3GZ5 A;  4HX7 A;  1J5Y A;  2M5W A;  2HWV A;  3JTG A;  4YG2 F;  5DEQ A;  4I0A A;  4CHU A;  2WTE A;  5L3E A;  3ZMD A;  3R6S A;  3FXQ A;  4EMS A;  1TBX A;  4R8H A;  3GW2 A;  1E17 A;  5BPD A;  3FMQ A;  4OIR F;  2OAZ A;  1QGP A;  4ZZD A;  3RYR A;  3QRF F;  2HKX A;  2K4B A;  4G94 A;  3DFG A;  2V1X A;  1OPC A;  4I7H A;  3U1D A;  1CF7 A;  4PZJ A;  2VC0 A;  2L4M A;  1REP C;  5BPI A;  2H09 A;  3V4G A;  3FMR A;  1GHC A;  4XSX F;  4M72 A;  4HQE A;  3FWE A;  5ICF A;  4LLN A;  5FFX A;  3CTA A;  3REO A;  5DUI A;  3DXJ F;  3I54 A;  2M8E A;  3RKY A;  4KMF A;  5DV5 A;  1D8J A;  3HRT A;  1IN8 A;  2NNY A;  5HLG A;  2HYG D;  2L3D A;  3E6D A;  4IJA A;  3I59 A;  5D6F A;  2E1C A;  5FD5 A;  2ESN A;  1U5T B;  1GXP A;  2CSO A;  2WV0 A;  2PMU A;  2MH2 A;  4HOB A;  2O6G E;  2V79 A;  1E2X A;  4BHP A;  2A61 A;  2CQK A;  5LRR A;  5ICG A;  4M74 A;  1IUY A;  3KLN A;  1BBY A;  5AIQ A;  4WK8 F;  5L3D A;  1S6L A;  3IWZ A;  5CJ9 A;  1HKS A;  1J2X A;  3F3X A;  2VOO A;  4P9F A;  4M9S A;  1QZY A;  1LEB A;  4KMU X;  1ULY A;  2A6H F;  2WWY A;  2V6C A;  3ECH A;  3F8B A;  3ULQ B;  1P92 A;  3TKY A;  3FF5 A;  4ESJ A;  5HOO A;  5F6F A;  1G3T A;  3GX4 X;  4G7Z F;  5DD8 A;  5H6Q A;  1K79 A;  2ESH A;  3LFK A;  3OV8 A;  4JBA A;  4P9U A;  4HLX A;  2STT A;  2IW5 A;  3WTX C;  1Z6R A;  4ZYD A;  4LK1 F;  3E5U A;  4LLL A;  4CZZ A;  3T1B A;  2IA0 A;  2XAH A;  3K1N A;  2IVM A;  2OQR A;  1SAX A;  4YFX F;  3HRS A;  5L3C A;  5CVJ A;  4ENM A;  3NRV A;  2P5K A;  4WX9 A;  3Q5F A;  1VTN C;  1O3T A;  3H3U A;  4IPA A;  5L3F A;  3CUO A;  1ZRF A;  4Y13 A;  2W24 A;  3IKV A;  3EUH A;  1OYY A;  3V7S A;  5K5Q A;  4EJO A;  5LHG A;  4PGH A;  3JAM K;  1JE8 A;  4RB0 A;  4YFN F;  2IT0 A;  2LDU A;  1FWZ A;  1WSU A;  4IHS A;  2HTS A;  2HGC A;  2A3S A;  2E7X A;  2F5C A;  4FT8 A;  3TOA A;  1X3U A;  3ZPL A;  2FQ3 A;  1ZG1 A;  4RB1 A;  2UXN A;  4EV0 A;  3R60 A;  4HDU A;  3LST A;  3RKW A;  2P5V A;  3F8F A;  2XRO A;  3K2Z A;  3I5U A;  2GZW A;  2L01 A;  2JT1 A;  2P4W A;  1Y0U A;  3GO5 A;  3I59 B;  2PFB A;  4CIC A;  4UV8 A;  4A5M A;  3GFL A;  3V7C A;  1WRJ A;  2BBY A;  2W84 A;  1G3Y A;  4MEX F;  3MEX A;  2Z3Y A;  1XMA A;  2XRN A;  4XLP F;  4I98 B;  2EA4 A;  3LWF A;  3E97 A;  5LEK A;  2JRT A;  4BYY A;  2IJL A;  3F72 A;  2RC4 A;  4A0Z A;  2KIM A;  4HF1 A;  2QQA A;  3DV8 A;  3KP3 A;  1XMK A;  2MD5 A;  1Z9C A;  1IXS B;  3J80 Z;  3SFZ A;  4IRI A;  3CLO A;  4M73 A;  1STZ A;  3BRO A;  4AIJ A;  5DCM A;  1XSX A;  4HBL A;  4LD5 A;  2GAU A;  1BC7 C;  3ABT A;  2XV4 S;  2OZ6 A;  2X4H A;  3HSR A;  2DPD A;  4MQV A;  5ICC A;  2DFI A;  1WQ2 A;  5D6E A;  1DPU A;  1TTY A;  1O3Q A;  3BZ6 A;  5ILU A;  1SD6 A;  1JHH A;  4QWQ A;  3WOD F;  1Z6T A;  3RYP A;  1IXC A;  1FYK A;  1BI0 A;  1UB9 A;  3KP4 A;  3HRM A;  1P6R A;  2GA2 A;  2EA2 A;  5J6X A;  5JI6 A;  4L9J A;  1SFX A;  3I71 A;  3ZMS A;  2ACJ A;  2L54 A;  4MTD A;  3P9C A;  3HYI A;  1P4A A;  2H6B A;  2P7V B;  2CWE A;  4L9N A;  1L3L A;  2DU9 A;  3GEZ A;  3NQO A;  1TNT A;  1XGO A;  4OU0 A;  2GXG A;  2PG4 A;  1I27 A;  4ETS A;  3FZV A;  4Q47 A;  1FBQ A;  3C7J A;  2ZFW A;  3MZH A;  2RNJ A;  5FLX Z;  4PGG A;  3CUQ C;  1YO5 C;  1IN4 A;  3PQK A;  4L18 B;  4A6D A;  1ZRE A;  3C18 A;  4IHT A;  2P6T A;  1EH8 A;  2FML A;  3DP7 A;  3LQQ A;  2RN7 A;  1EV7 A;  4IXA A;  1O7F A;  2D1V A;  4KUM A;  5LRS A;  1W5S A;  2IRF G;  1D5V A;  4CXF A;  5ICE A;  2YX7 A;  5F1R A;  3BP8 A;  4BHB A;  3MCZ A;  1B1B A;  1BI3 A;  4BNC A;  1JGS A;  1F5T A;  3QU3 A;  2BEO A;  4S04 A;  1CGP A;  4RAY A;  1Z05 A;  1ODD A;  2V1D A;  1HSJ A;  4TV7 A;  3ZN1 A;  4G7O F;  2O8X A;  4KT5 C;  2IA1 A;  3HIF A;  5FO5 A;  2H6C A;  3TO7 A;  1QBJ A;  3C1D A;  2DPU A;  4ZYH A;  1U5T A;  1BIA A;  4L9T A;  4B09 A;  2PBI A;  2OQG A;  1QO0 D;  4KIG A;  2HTJ A;  2LF7 A;  1P4X A;  1DP7 P;  1H0M A;  3P9K A;  1QQI A;  2XVC A;  4KDP A;  3F21 A;  1YS6 A;  5BQT A;  1K78 B;  1ZRC A;  4UVA A;  4KA4 A;  4R1H A;  4DQ2 A;  2VE9 A;  4CDG A;  3F23 A;  1MD0 A;  5BS6 A;  1F4K A;  3JSO A;  3RJP A;  4N9I A;  4ON0 A;  3RPU A;  1KU9 A;  4LK0 F;  1XCV A;  5BOX A;  1J75 A;  4HQM A;  2CFX A;  1PP7 U;  1HW2 A;  3H3Z A;  5LHI A;  1ZAO A;  1DDN A;  2ZNY A;  2K7L A;  2EK5 A;  1ON2 A;  3MFK A;  3RI4 A;  2DLL A;  2E7W A;  1SD4 A;  3L09 A;  1LEA A;  2EFW A;  4KIF A;  5HDN A;  1TQI A;  3EYY A;  4HF2 A;  2NNN A;  5DYM A;  3LAP A;  2D1H A;  3WTU C;  3F6V A;  3BJA A;  3DKW A;  4JQF A;  1HKQ A;  1SD5 A;  2H27 A;  4HX4 A;  1ZGA A;  2V1U A;  2DTR A;  2R7F A;  2Z5U A;  3BPX A;  1YS7 A;  3JW4 A;  1ZRD A;  4YFK F;  3CO7 C;  3VOD A;  1T6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...