5AIQA

Crystal structure of ligand-free nadr
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
131
Chain Sequence
b'ASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLLAENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLVFLKLTAEGEKLYEEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIEDALNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, MARR FAMILY
publication title Molecular Basis of Ligand-Dependent Regulation of Nadr, the Transcriptional Repressor of Meningococcal Virulence Factor Nada.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription
total genus 47
structure length 131
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5aiqA00
1YS7A 5CJ9A 3ZP5A 3GUDA 2KJBA 1XGNA 3U2RA 2XVCA 2FBKA 4MGRA 4BH9A 5ED4A 1XMAA 2QBYB 3HOTA 2JTVA 2M30A 2W24A 2M87A 2V79A 5BMZA 1LQ1A 1R1UA 1XGMA 1FPQA 3I0TA 1R22A 2GZWA 3QPTA 1B59A 1SD5A 5E1ZB 3I5UA 3W6JB 2FMYA 1O57A 3QPHA 2CYYA 4RGUA 4U0VA 5EEHA 2EA2A 4OMYA 1G3SA 1TTYA 1TQPA 1KQ8A 3BROA 2RNJA 4KMFA 1J9IA 4Z2YA 1ZG3A 1YW8A 3PFIA 5K5RA 1XSDA 4ENNA 3CO7C 4YG2F 3ULQB 5HS7A 1BM9A 3WTSC 3GZ6A 1ON1A 1DP7P 4LJZF 3V7SA 1O3QA 2A3SA 2DQLA 5JI6A 3R61A 1MKMA 2KRFA 2NAZA 2L3DA 3CDHA 3E97A 1KU3A 1QGPA 1Y0UA 5EEGA 1ZRDA 2YR2A 1XCVA 3GVAA 5DCMA 3J81K 3DPTA 3V8KA 3M1EA 2QWWA 3S2WA 4A6EA 4PDKA 2L01A 3ERED 2RGVA 2EV5A 4Q5SF 3AAFA 2X0LA 1W7PD 3VEPA 3MZHA 4KN4X 1E17A 5ICGA 4N9IA 3F23A 3IWFA 2MA3A 3WU1B 2FF4A 3KFWX 3R60A 2R7FA 4L5JA 3WTUC 3K2ZA 1HQCA 2XASA 4Y15A 4IRHA 3IL2A 4MNUA 2PQ8A 4CO8A 2PEXA 3IRRA 3SZTA 1F4KA 2QZ8A 2IRFG 4YIFA 1LDJA 5HLIA 1IXCA 2BV6A 2DFIA 2L4MA 2ISZA 2MBFA 1RUOA 1MDMA 1MGTA 2DT5A 2AXLA 3I59B 1UFMA 5FO5A 4A5NA 1ZRFA 4RAYA 4EJTA 4G94A 4A0XA 4GXOA 2EV6A 2M45A 2UZKA 4OOIA 2P4WA 1IN5A 2DBBA 2MH9A 2HZTA 2ZMEA 1VTNC 2JT1A 4MQ9F 4GYGA 3L2CA 5CLSA 1IN7A 3V7RA 4G7ZF 1GXPA 4G6QA 3JTHA 1K79A 2IW5A 1BIBA 4ON0A 3KEOA 1G3TA 1WKMA 1YTYA 2NYXA 1U2WA 4PGHA 3HYIA 2DW4A 1X3UA 4HA8A 2O0YA 4FX0A 3COAC 4P9FA 4M73A 2LDUA 3CTAA 4BHCA 4BYYA 2VT3A 3P9KA 5D5UB 3FX3A 4HZFA 3SHFA 1O3SA 1ZAOA 3RPUA 3R4KA 3VB2A 2F5EA 3WTVC 1YG2A 1O3TA 1REPC 2ESHA 4B8XA 2LKPA 2Y75A 4MHGA 2OA4A 2RQPA 2NNYA 2O6GE 1SFUA 3M9AA 1MJAA 1K6OA 1TQMA 5LHIA 1YFHA 4OINF 4WX9A 3D0SA 5IT3A 3WGIA 3P7NA 3GYHX 3JTGA 4EM2A 3KE2A 4LG0B 1USTA 3FXQA 5FFXA 2V1DA 3VOEA 4L9VA 2GA2A 4ETSA 3E6DA 1BOAA 3DXJF 4WWCA 4XSXF 5HS9A 1ONVA 4G8XA 2P7VB 5A2QK 3WG9A 5ILSA 5K5QA 1D8KA 3GFLA 3DKWA 1D3YA 3O2PE 2GXBA 1ZGAA 5D6FA 5LGTA 5HDNA 2GXGA 2H6CA 5E17F 5CVVA 5JHUA 4M6YA 1KU2A 2ESNA 4Q48A 4BHPA 1RZ4A 2EFQA 1DDNA 2W57A 3GZ5A 5D5VB 2GQQA 2HDCA 4RGRA 4L9TA 2UWMA 2HGCA 4RB3C 4YIIA 2GIVA 5HVQC 3KETA 1USSA 4HBLA 3HTSB 2FOKA 1ZLJA 4L18B 3WGHA 4CGZA 2V9VA 1HKSA 2HR3A 1U3EM 1S7OA 1YYVA 1F5TA 5LBQA 3ZMSA 1UHWA 3NEUA 1P6RA 1Z9CA 2PMUA 2G7UA 2DAOA 4BHBA 4CDGA 3WTYC 3WE2A 3O6BB 2XAGA 3E5XA 4K2EA 1ZG5A 5DV5A 2K4JA 5ICCA 1KU9A 4LB5A 2XAJA 1HKQA 1O3RA 2ZKZA 2JPBA 1I5ZA 4UV8A 3GF2A 4I7HA 1WSUA 1STZA 3SFZA 2W84A 2DPDA 2FBIA 2JRTA 5ILUA 2CW0F 1XB4A 1KYWA 2PMHA 1OYIA 5TJJA 3OOPA 1JGSA 2HTSA 2A6HF 4KYWA 1XGSA 4XSZF 3GLXA 3FXRA 3EYIA 1HXDA 4A12A 3U9GA 3V7CA 1SMTA 4O6JA 5DCFA 4RGXA 1JHFA 2OBPA 5ICFA 2WV0A 3WTWC 1MZBA 4HV5A 2HYFA 4O3MA 3BJOA 2LSOA 5J8FA 5CVUA 1E2XA 2P7CB 4Q4ZF 5L3GA 1R36A 1KQ9A 5ILVA 2A07F 4Q47A 2DK5A 2NS0A 4QLCU 2Z9OA 1RNLA 4M9ZA 2ZBKA 1R1TA 4BXUA 1H9TA 2KIFA 2FRHA 2E1CA 2V1UA 5ICEA 1FYLA 2LF7A 3RDIA 2CQKA 3ZN0A 1FX7A 5JFRA 3ABTA 3E3VA 3H3ZA 3V8LA 5FB2A 4I2OA 4FHTA 1IAWA 4R1HA 3FHZA 3J81Z 2P5LC 3BY6A 1R00A 3DF8A 1TLHB 1WWXA 4ZYGA 2K02A 4RB2C 1FWZA 2OU2A 3CUQB 1FBQA 1ZYRF 4EM1A 1HW5A 4HV6A 2Q0OA 4EQQA 2MD5A 3RPQA 3T1BA 5DUKA 1GXQA 2A61A 5KK1A 2VC0A 4HQMA 5F1RA 1ZRCA 3EQLF 2NNNA 1FBSA 2GWRA 3DQVC 3IKVA 2O3FA 4G6DA 4MTDA 1ZREA 3ISPA 3LAJA 4G7HF 2KIMA 1WRJA 1XDUA 3CUQC 1PP8F 1B9MA 1S3JA 2QQ9A 4UXNA 5LGNA 4BAYA 3KCCA 3FMSA 1ON2A 3B73A 1RIOH 3TDZC 3LQQA 3RKXA 3GW2A 4HLYA 2J5PA 3VFZA 2BEOA 4JK1X 2MLGA 3ZQ7A 5D4SA 2ZNYA 1LNWA 4KIBA 3C18A 2VBWA 3K1NA 4HX7A 1C0WA 1B1BA 3I4PA 2J5OA 3MAJA 4PGGA 1ZARA 2XAQA 4KDPA 2CWEA 4XBFA 3HRSA 3KP7A 2VT2A 3V4GA 3QU3A 1KA8A 2UXNA 2QQBA 1U5TA 2LNBA 2HQNA 1W5TA 1AWCA 4WF2A 1K78A 4IRIA 2XKPA 5DD8A 5D5XB 2VBZA 1LEAA 2D2WA 3M7GA 1T98A 1IRGA 2WC2A 2IA0A 3K69A 3K1PA 1BIAA 2FNPA 5LEJA 4OIQF 2K4BA 1XGOA 2XKOA 2JZYA 3ZN1A 1J7KA 4U0YA 4OIOF 3HRTA 3MFKA 2VXZA 3FMQA 3ZMTA 4WK8F 4PZJA 5E1WA 5L3DA 1R7JA 4HX4A 4BNCA 2AS5F 4LFUA 2A68F 3HTUA 3LAPA 3LWFA 2QVOA 2K7LA 4FX4A 1KGSA 4L9JA 4A2UA 1F1ZA 2FSWA 4AIHA 5ERIA 4YFKF 3RIRA 4G9YA 4MQVA 1YLFA 4M74A 3GO5A 1HW2A 2PLYA 5H20A 1J5YA 4ESJA 1A04A 4XRFA 4IPAA 2QLZA 5E20A 1SD6A 2ZCWA 4CYDA 5LHHA 4PCQA 5A2QZ 4YFXF 4Y17A 3N97A 1Q1HA 4IHTA 1HKTA 4AWXB 2MLKA 2L54A 1EH8A 1XSVA 2Z3YA 5LRSA 1XDSA 1O7FA 2TDXA 3K9TA 2XIGA 3RKWA 3MQ0A 4L9NA 2EWNA 3TOBA 1YIOA 4RGSA 4ZZLA 2HOEA 2IPQX 2V6CA 2RKHA 1W4MA 3BDDA 4IJAA 1SFXA 3LFKA 1UCRA 3R0AA 2DK8A 3HUGA 5JR3A 4DNCA 2F5FA 2FA5A 5LHGA 2DI3A 3I58A 1OYYA 2ISYA 3HIFA 2UXXA 4AIJA 3FMRA 3SZPA 3C1DA 2EFWA 4ZH4F 1YW7A 4OU0A 3SXYA 3CJNA 3LA2A 5H6QA 1EV7A 4ENMA 3IKTA 1FSHA 3LQRA 3QRFF 3WU0A 1OMIA 3KLNA 1ULYA 3RTRA 2IP2A 1CF7A 2HWVA 4P96A 5LGUA 3WE3A 3GFMA 1PP7U 5HLHA 1QBJA 1EH6A 3I54A 5DDGA 3ZMVA 1XMKA 4Y13A 1T39A 5D6EA 1GHCA 3E6MA 1V3FA 2DO7A 1SD4A 1AOYA 3QOPA 1I1GA 3WTTC 3FWEA 3NQOA 5D8LB 1Z7UA 4LLNA 3K0LA 3R6SA 1BJAA 1K78B 2RN7A 4N9HA 3BJAA 2KJCA 1RUNA 4N0BA 3R0JA 5DCMB 2HFHA 5HOOA 4BQAA 1QPMA 1DPUA 4ENJA 3QAHA 1H9GA 1YO5C 2K27A 4GO1A 2VONA 2VE9A 1FYMA 3RI4A 3KP5A 5L3FA 1W7PA 1J2XA 4P9UA 2IT0A 4UVAA 1IXSB 1XN7A 2HYGD 4IF4A 2CGPA 2X4HA 3HHHA 4EGYA 5FD5A 3TKYA 1W5SA 1FSEA 1HSJA 2PG4A 5HLGA 2IA2A 3TOAA 2M1BA 5DD4A 3WTXC 5CVRA 4LGWA 1I27A 1D5VA 1LJ9A 1P2FA 1IZ1A 3ZMZA 5D5WB 1BBYA 2ZXJA 1YS6A 4OIRF 5E1XA 4UV9A 3L00A 4LMYA 1MDMB 3KP3A 2EJRA 1IN6A 3JSOA 4KT5C 4IVNA 2FE3A 3F6VA 3IWZA 3TGNA 2ADUA 1Z6RA 3T8RA 1FP2A 2CSOA 3BZ6A 4HF0A 3I71A 1MD0A 3B02A 3ML6A 3F8NA 4L0ZB 2Z99A 3J80K 4M71A 4P55A 1DUXC 4ZYEA 2YU3A 1S29A 4S05A 2OZ6A 1JHHA 2A6EF 2HEOA 2ZMEB 2F5CA 3LSTA 3DFGA 3PQKA 4F7ZA 3HSFA 5JVTA 1FYKA 1HSTA 3I53A 3RYPA 2GA1A 5DUIA 2FMLA 3BWGA 3MZYA 1SFEA 3F22A 5D4RA 2XUBA 4I09A 2H09A 4EVIA 3ABUA 4A5MA 2STTA 4ZYHA 1KQ0A 2D45A 4HQEA 2PI0A 1QZYA 1P4XA 1H0MA 2Q2EA 2D1HA 2HS5A 4KIFA 3DPLC 1YW9A 5LLQA 2FXAA 5BOXA 2P5KA 2G9WA 2STWA 1HW1A 2V1XA 1R23A 3NRVA 3F8CA 5IT9Z 1ZN2A 2DTRA 3BPVA 4EJOA 3QU6A 2FEZA 3RJPA 2W25A 4CXFA 1FOKA 2BGCA 3L9FA 4IHSA 1L3LA 2ZFWA 4M9SA 2F5DA 3PQJA 4KIGA 3F72A 1T0FA 5F6FA 4HF2A 3I59A 2VBXA 3ZMUA 4UVCA 1FNNA 3DP7A 4U88A 3BPXA 3REOA 2PFBA 3JAMK 3GEZA 3CLOA 4WXHA 1FC3A 1R58A 4UVBA 4I0BA 2VOPA 1U8RA 1G3WA 3GFJA 2XHKA 1J75A 2VN2A 2R7DA 4EJVA 5FLXZ 3Q9VA 2CFXA 4ASNA 1FY7A 4TV7A 4AVPA 1ZH5A 4KUMA 2QM3A 3JW4A 1IN4A 1G4DA 1ODDA 4HAMA 4EM0B 2L4AA 4XLNF 4EV0A 2ZO4A 1IUYA 1TW2A 3G3ZA 4EMSA 3VODA 5E8GA 3HOSA 3CO6C 4M9XA 3F21A 2H94A 2OAZA 1QZZA 4P5OA 4LB6B 1FZPB 3L7WA 3T8TA 2W85A 5DYMA 2ELHA 3WGGA 1U6GA 1QO0D 3HRUA 1DPRA 1V4RA 2XAHA 4M6XA 2YX4A 1FP1D 2BE5F 4IRGA 3ECHA 4L5IA 4NHJA 2HQRA 2JSCA 1Z1DA 2YX7A 3F6OA 5CVJA 1S8NA 3HSEA 3EUHA 5IT9K 3L09A 1BI3A 3BJ6A 2EV0A 2A5YB 3WTZA 3H3UA 1KYZA 4LG0A 3H92A 1F9NA 2P5VA 2IVMA 5DEQA 1JXSA 1S7AA 1TBXA 5D8KB 3KP4A 2G7HA 1P4WA 2FU4A 2Z5UA 2XAFA 5KVRA 3FXUA 3IC7A 2ZNZA 4HX8A 2VC1A 5CYVA 2DU9A 4OMZA 5BPIA 2M8EA 2DPUA 1T2KA 4WCGA 3GXOA 2BBYA 2P8TA 3TO7A 4RAZA 4U7DA 5FLXK 4A6DA 3HRMA 4KNYA 3G73A 2LF8A 4HDVA 2EK5A 1XCBA 5LRRA 1FT9A 1BC8C 2EA4A 5TRDA 2MH2A 1PUEE 4R79A 2WWYA 5L3BA 3ROUA 4EJWA 1IRFA 4ESFA 1LDDA 4NB5A 1BC7C 2EFPA 5E18F 3F8FA 5L3CA 3QP6A 1EH7A 3EDPA 2OQRA 2MC3A 4HW0A 1S6LA 3WODF 4KICA 3EYYA 2A69F 2GAUA 2B0LA 2P6SA 1XSXA 5HDKA 1R1VA 5AONA 3W6KB 2XRNA 1KU7A 3HSRA 1Z91A 1J0RA 3K1MA 1RI7A 1IW7F 3KLOA 4AD9A 3KZZA 3DV8A 5K1YA 4HOBA 2R3SA 3KZYA 4IXAA 2BYVE 3KEQA 1XD7A 5L3EA 4MEYF 3JSPA 1JE8A 3TO9A 2C6YA 5FGMA 4ESBA 2Z33A 4HDUA 2NRAC 2XGXA 3T5XA 2O8XA 3QP5A 5LEKA 4FT8A 1YQAA 2COMA 4OIPF 1I1SA 4I01A 4U7BA 4D0PA 2PJPA 4I98B 1MJ9A 2VOOA 2HTJA 3FZVA 3ZPLA 1J59A 2RV8A 2M5WA 4O5VA 4LK0F 4JQFA 3FM3A 2RDPA 1ZLKA 3F8MA 2QUFA 2HKOA 3J80Z 2H27A 3ECOA 3E6BA 2D1VA 2VBYA 1LEBA 3CUOA 3MWMA 2Q8KA 5HDGA 1BI1A 2E7WA 2CO5A 3C3WA 4KA4A 1FBUA 1LVAA 1LB2A 2WTEA 3LA3A 2PN6A 4R8HA 1TW3A 1B9NA 4JBAA 2QENA 2Y0MA 3Q9SA 5K5OA 1U5TB 4AIKA 3MEXA 4S04A 3GWZA 1O7LA 4XLPF 1B6AA 2VE8A 4KN7X 4LK1F 2EFOA 4M72A 3CUQA 4MEXF 1IN8A 1D8JA 2IA1A 3SQNA 4WXCA 4MTEA 1IF1A 4EJUA 1TQIA 2EB7A 3F3XA 3TQNA 4WXDA 1P92A 4GGGA 4EGZA 4RB1A 1CGPA 4UNOA 4QWQA 2DLLA 3FM5A 5FFZA 2KIUA 3TO6A 2Y48A 1U5TC 1UB9A 3P9CA 2E1NA 1OPCA 5BS6A 3GFIA 1BN5A 1G6NA 5HS8A 2CG4A 5BQTA 1K7AA 3E5QA 4L0YB 3IHUA 5FD6A 1T6SA 4YFNF 1SD7A 1OKRA 2QBYA 2XROA 4I02A 1TNSA 3E5UA 4CHUA 3BP8A 1SMYF 1WI9A 5AIPA 3RKYA 2E7XA 4HF1A 4RB0A 3ELKA 4UUVA 2ETHA 3FF5A 3TDUC 1R5GA 5J6XA 1B4AA 1GVJA 2YSRA 4GYIA 5CVIA 2OQGA 3KP2A 3JAMZ 3J7AO 1L0OC 6PAXA 4B09A 2YPRA 4G7OF 2EFNA 2QQAA 2L02A 4E70A 2VODA 2PBIA 3P9IA 3M8EA 3HHGA 4A0ZA 1FLIA 5H6RA 4LD5A 3LA7A 5BPDA 5F64A 2QYOA 1R5HA 2ACJA 2K86A 2FNAA 1I6XA 4LLLA 1P4AA 3IRQA 4KFCA 3D5LA 4DQ2A 3C7JA 2FQ3A 1OR7A 4NQWA 3DEUA 1SAXA 2DQRA 4H0EA 4A0YA 1TNTA 4CICA 2RC4A 1IXRC 2FBHA 2JPCA 1PDNC 4LLGF 1BI2A 3BOQA 3T0YA 3ZMDA 3O3KA 4CZZA 2IJLA 5J8CA 2O03A 4HYEA 1ZGJA 4KMUX 1BI0A 1CF7B 2ZJ2A 4HLXA 1HBXG 1Z6TA 1OYWA 3KP6A 3N4MA 3F8BA 1LDKB 4RS8A 1MJBA 1G3YA 1U78A 3E6CC 1WQ2A 1QQIA 2F2EA 3Q5FA 3I64A 4ZYDA 2XV4S 5E8IA 2H6BA 3MCZA 4ZZDA 2O61A 4GCVA 4UHTA 3GX4X 2P6TA 2HKXA 4U0WA 5AIQA 3EETA 2RVCA 3M8FA 3OV8A 1ZG1A 3V8JA 2OD5A 3U1DA 3RYRA 4I0AA 1T38A 1UHMA 1ZHFA 2KKOA 1QNTA 1NHAA 1Z05A 2OZUA 4ENKA 1W7PB
chains in the Genus database with same CATH superfamily
3CCYA 1YS7A 2M9HA 1MMDA 2V9PA 5CJ9A 3ZP5A 4W1UA 1XTAA 3GUDA 2KJBA 2O5RA 1XGNA 3U2RA 1Z3XA 3IUOA 2XVCA 2FBKA 4MGRA 3BZCA 2X85A 4BH9A 2FOWA 1XMAA 4G6TB 5ED4A 3ZRGA 4F52A 4IQ4A 2QBYB 3HOTA 2R4GA 2JTVA 2B63J 2M30A 2W24A 4I6ZA 3ZQIA 4UUSA 4A3JJ 2UV1A 4KJZA 1QU3A 2M87A 3I55I 2V79A 2X6OA 4II3A 5BMZA 1LQ1A 1R1UA 1XGMA 2VKHA 3ERMA 1FPQA 2XGEA 1R22A 3I0TA 1YI2I 1DQUA 2GZWA 3QPTA 2XGDA 1B59A 1FOXA 1SD5A 1PUFA 5E1ZB 2HDDA 4CH7A 3I5UA 4IOAF 2ICWG 2FMYA 3W6JB 1X1AA 1BA5A 1JTYA 3P5JA 3H3VK 1O57A 3QPHA 2CYYA 4RGUA 4U0VA 2KLOA 3FISA 3NWTA 2R7TA 1JTXA 2K3FA 4IKFA 4FTHA 5EEHA 2EA2A 3Q0WA 4XNFA 1IJWC 4NDLA 5IP7J 2XC7A 4OMYA 3PSFA 1FTTA 4XONA 2BOLA 1QRYA 3D1NI 1G3SA 1OCOH 1TTYA 5JHFA 1TQPA 2K9NA 1KQ8A 3BROA 2E34A 4YIRX 3OYNA 1TWGJ 2RNJA 4E7LA 4Z2YA 4KMFA 1J9IA 5B1BH 1ZG3A 1YW8A 3PFIA 2ZJPF 2Z16A 5K5RA 1V54H 3VYTB 1XSDA 2CUFA 3HOVJ 2E2HJ 4ENNA 3CO7C 4YG2F 3PM1A 3ULQB 2JWTA 5HS7A 1HOMA 1BM9A 3WTSC 3GZ6A 1ON1A 5F1JA 1WHUA 3M3YJ 1QVTA 2BHYA 4ZC3A 1BW5A 1DP7P 4LJZF 3V7SA 2LD5A 1O3QA 2A3SA 2DQLA 1HA8A 4CCJA 5JI6A 3R61A 1MKMA 2KRFA 4B47A 3CMYA 1Y1WJ 1B8IB 2Y30A 2NAZA 2W00A 1AHDP 2L3DA 3CDHA 1B72A 3E97A 1M1EB 1KU3A 1QGPA 1X1CA 1Y0UA 5EEGA 1ZRDA 2YR2A 1XCVA 3GVAA 2F4OB 3FK7A 5DCMA 3J81K 3DPTA 3V8KA 3M1EA 2HVQA 1D1CA 1RETA 2QWWA 3S2WA 5FKOA 4A6EA 4PDKA 2L01A 4CCOA 3ZOBA 2XDVA 3ERED 2FQ4A 2RGVA 3OYAA 2CH0A 2EV5A 3SYTA 5HLTA 2DA3A 3RCOA 4Q5SF 3CJQB 1GV2A 3AAFA 2L7ZA 2WADA 2Q2EB 2X0LA 1W7PD 4RM3A 1G59A 3A2KA 3VEPA 3MZHA 4ZTJA 3BC8A 2O9LA 3J7AY 2V4JC 2ZJRF 4KN4X 2HDWA 3KYLA 1E17A 1ENHA 5ICGA 4N9IA 3F23A 2TCTA 3IWFA 2MA3A 4BE1A 2X6XA 2R7XA 2CQ7A 3WU1B 2FF4A 3KFWX 3R60A 2R7FA 2WAQN 4B3AA 4L5JA 5B5EC 3WTUC 3OYKA 3K2ZA 3A1YA 1HQCA 1TWFJ 1VQ5I 2XASA 5FLMJ 3S17J 4Y15A 2IS2A 2JA7J 4IRHA 1O4XA 2CV2A 1GUUA 3IL2A 3ZCOA 4MNUA 2PQ8A 5C4XJ 3MMYB 3OYGA 1R5ID 4DW6A 1ETYA 1WFXA 1WJFA 2XF7A 1BR4A 4CO8A 1MBEA 2PEXA 3LFUA 5F0HA 3IRRA 3SZTA 2O8KA 4BE0A 1F4KA 2QZ8A 4XLAA 2IRFG 2D5VA 1JUMA 2HZDA 2R5YA 1H89C 4YIFA 1LDJA 5HLIA 5M5YJ 1IXCA 4W97A 5M3MJ 1LFPA 2BV6A 2DFIA 2L4MA 1S9HA 2DN0A 2ISZA 2MBFA 1RUOA 3M4OJ 1MDMA 1MGTA 2AHQA 4XR6A 3FXJA 2DT5A 2AXLA 2DFFA 3S93A 3I59B 1UFMA 2R5ZA 4DYQA 2ZFUA 5FO5A 3W2VA 2CW8A 1U9OA 1JT6A 4A5NA 2XSJC 2LFBA 3BR0A 1ZRFA 2XSDC 3GTQJ 4RAYA 4Z6YA 4EJTA 4A93J 2GOXB 2JK3A 4G94A 4A0XA 2RQQA 3K70C 2MYSA 4GXOA 4X6AJ 3ZQFA 2QKLB 1A31A 2EV6A 2M45A 4F91B 2UZKA 4OOIA 3DKXA 3BLYA 4CYCB 1MMAA 2P4WA 2LG4A 3H5AA 3CJRB 1FIAA 1IN5A 3FBNB 2AXTC 2DBBA 2MH9A 3HXLA 2HZTA 2ZMEA 1T56A 4E7JA 4BDYA 2JT1A 4DJAA 1ETKA 2L7MP 1VTNC 4UY8I 1WZ2A 4MQ9F 1IDZA 1P7IA 1T0FC 3C2HA 4GYGA 3RKQA 3L2CA 5CLSA 1IN7A 3V7RA 4G7ZF 3CCQI 1BL0A 2OC6A 2MGQA 1GXPA 3HOUJ 4G6QA 4C3IJ 3JTHA 1K79A 2M3AA 2VASA 2IW5A 1BIBA 4ON0A 2HOSA 4BE2A 3KEOA 1G3TA 1WKMA 2R7RA 1YTYA 2NYXA 3S1QJ 1U2WA 4PGHA 3HYIA 2DW4A 1X3UA 3H36A 4HA8A 2O0YA 3OYHA 3GZNB 3S2HJ 4FX0A 3QWLA 3COAC 4P9FA 2OCEA 4M73A 2LDUA 3CTAA 3WHCA 3TW6A 1IV8A 4BHCA 4BYYA 1DU6A 1ZK8A 2VT3A 3P9KA 3A4CA 3RQIA 5D5UB 1GLNA 3FX3A 1OCPA 4HZFA 3SHFA 1AA7A 1O3SA 3FHNA 1ZAOA 3RPUA 2R93J 1I3QJ 3K4BA 1BR1A 1TWAJ 3PL8A 3R4KA 1IRXA 2F5EA 3VB2A 3WTVC 1QA6A 1YG2A 2V6EA 1O3TA 3PNTA 1REPC 2F5VA 1Y56A 1F43A 2ESHA 4B8XA 2LKPA 2Y75A 4MHGA 2OA4A 4LITA 2RQPA 2NNYA 2O6GE 1SFUA 3M9AA 1MJAA 1TT5B 2B7EA 4B44A 1TQMA 3VSKA 5LHIA 5EGOA 4IX7A 1YFHA 1K6OA 3CC2I 4OINF 3CESA 4WX9A 1W36D 3Q0UA 2VQHA 2VQGA 3ZQLA 3ONQA 3BR1A 3FKIJ 3D0SA 2DDBA 2M0MA 5IT3A 3MN2A 2JA2A 4X0GA 3WGIA 4AYBA 3P7NA 2FJ1A 3GYHX 1JJ8C 5E79C 3JTGA 4EM2A 1VQ8I 3FIWA 3L2UA 3KE2A 1OQYA 5K7HA 4LG0B 2EBIA 1USTA 2CMPA 2EH3A 3FXQA 2A6TA 2DJNA 2LRDA 5FFXA 2V1DA 4D9JA 3VOEA 4L9VA 4IHYA 2KPMA 2GA2A 4ETSA 3E6DA 1BOAA 3DXJF 5C44J 3I4MJ 4WWCA 2LKXA 4XSXF 1B72B 3HZJA 2KZGA 5HS9A 1ONVA 1VZ0A 4G8XA 2P7VB 4AVZA 1WI3A 5A2QK 3WG9A 5ILSA 5K5QA 1D8KA 3GFLA 4IHVA 4RMNA 5GTHC 4IQJA 3EUHC 1T8IA 1GVDA 4XL9A 3DKWA 1SAUA 1SFKA 2I5UA 3Q3SA 2EZKA 1KONA 1D3YA 5TISC 3O2PE 4NNJA 1E3HA 2GXBA 5JLWA 3VPRA 5TGTA 1ZGAA 1T08B 3JRAA 5H2FC 5D6FA 4ZDOA 3KPHA 2E1MB 3CCEI 5LGTA 1S7EA 5HDNA 2GXGA 2H6CA 2X1DA 4RAGA 3OYFA 5CVVA 5JHUA 5E17F 4M6YA 1KU2A 3FXOA 2ESNA 4Q48A 5GPCA 3H9QA 1RZ4A 2K85A 4BHPA 2EFQA 1DDNA 1T95A 2W57A 3LSIA 3GZ5A 2ZC2A 5D5VB 4PJNA 1QVUA 2GQQA 3S32A 4XRSA 2HDCA 2V9KA 4L9TA 4RGRA 3ZQQA 2UWMA 2HGCA 3H5RA 1ZELA 1J09A 2XRLA 4RB3C 4YIIA 2GIVA 5HVQC 3KETA 1ZQ3P 1USSA 4CCMA 4HBLA 2PJRB 3DEEA 2F48A 3HTSB 2VI6A 2FOKA 1ZLJA 4L18B 3WGHA 4CGZA 2DMTA 5EG0A 2V9VA 1HKSA 5C4JJ 3CCUI 4JX4A 2VPRA 1MBHA 3HOXJ 2PMZA 2HR3A 1U3EM 2E1MC 2Y9YA 4DGWB 1S7OA 1X4PA 3FK6A 1YYVA 3LSRA 1F5TA 9ANTA 2IGMA 1WJAA 5LBQA 2R7SA 4RAFA 3OS2A 3UR3C 1UHWA 3ZMSA 2VLAA 3CC7I 2WA0A 4LIVA 3NEUA 1FOYA 1P6RA 1Z9CA 2PMUA 3BR5A 1KZHA 3JRDA 5KAFC 4HNVA 1JKOC 1DGWY 2G7UA 3ZQCA 2DAOA 4BHBA 4CDGA 3WTYC 1I50J 2WB1A 2DDAA 5FKMA 3WE2A 3O6BB 3IH2A 2XAGA 3E5XA 3PIPF 1LE8B 4K2EA 4DBRA 2DMPA 1ZG5A 3ABLH 2R0QC 2V26A 1KU9A 2K4JA 5DV5A 1MH3A 5ICCA 2EIMH 4LB5A 2XAJA 1GV5A 1HKQA 5CKTA 4HNTA 1O3RA 1TC3C 2ZKZA 5EF6A 2JPBA 2QEXI 1WCMJ 3U1KA 1Y39A 1I5ZA 4UV8A 3GF2A 4I7HA 1WSUA 1STZA 3SFZA 2W84A 2DPDA 2FBIA 2JRTA 4PSWA 1IO2A 2CW0F 1XB4A 5ILUA 4KISA 3D5RC 1WJDA 1KYWA 4DBQA 2PMHA 5BNGA 1OYIA 3LSMA 5DM6F 1QPIA 5TJJA 3I3LA 3OOPA 2QSGX 1JGSA 2HTSA 2A6HF 2VKEA 4KYWA 3FKJA 1XGSA 4F55A 4XSZF 2EZHA 3GLXA 3G1OA 3BG7A 3KIOA 3FXRA 2NS7A 2DA5A 1YJ9I 3EYIA 1HXDA 1NG6A 4A12A 4A3BJ 5KCMA 2Y0SA 2NOJB 3U9GA 3V7CA 4HPQA 1MMNA 2KDZA 1SMTA 4O6JA 5DCFA 4NBQA 3H35A 4RGXA 4B48A 2H8WA 1JHFA 2OBPA 2BY0A 5ICFA 1JUPA 2VB6A 2WV0A 1I39A 3K4JA 1MZBA 3WTWC 4HV5A 2HYFA 2ID3A 3GTPJ 4O3MA 1VQ4I 3BJOA 1POGA 2LSOA 4U87A 5J8FA 5CVUA 1E2XA 1K6YA 1ZR4A 4Q4ZF 4N4OB 2P7CB 5L3GA 3E1SA 1PJRA 4PK4A 2VPLA 1A6IA 1I6HJ 1R36A 1KQ9A 5ILVA 3CCJI 3RQ4A 3BG9A 4Q47A 4E6KG 3OSFA 2DK5A 2A07F 2NS0A 4QLCU 2Z9OA 2XF5A 2KDOA 3NAUA 3UKGA 1RNLA 4M9ZA 2BW3B 2ZBKA 1R1TA 4BXUA 1H9TA 2KT0A 3CCLI 2KIFA 2FRHA 2E1CA 2VJ5A 2V1UA 1IC8A 5EGOB 5ICEA 3CD6I 1Z7LA 1FYLA 2LF7A 3RDIA 3A0HC 2CQKA 3ZN0A 1FX7A 5B1AH 5KAIC 1MH4A 5JFRA 4JX6A 3ABTA 2R92J 2LY2A 3E3VA 5IOZA 3H3ZA 3V8LA 5FB2A 2CS3A 5EZGA 1WJCA 3H0DA 4FHTA 4I2OA 2KISA 1IAWA 4R1HA 3FHZA 3J81Z 1IDYA 2P5LC 4EATA 3BY6A 2ZXWH 3PFYA 1R00A 3DF8A 2WY8Q 3GTMJ 1ETQA 4MFDA 3LOCA 2FX0A 1TLHB 1WWXA 1VI0A 4E7HA 5CQEA 4ZYGA 2K02A 3OR1C 2ELKA 3HC7A 4RB2C 1NTCA 4C2UA 1FWZA 2OU2A 3CUQB 3PSIA 4Y33A 1FBQA 1ZYRF 1U0JA 4EM1A 1HW5A 3OIOA 4HV6A 2Q0OA 2L9RA 4EQQA 2COBA 2MD5A 2TRTA 3RPQA 3T1BA 5DUKA 2K9QA 1GXQA 2A61A 3CDIA 5KK1A 2VC0A 3AL0B 4HQMA 5F1RA 1TWHJ 4XLEA 1ZRCA 5E3OA 3EQLF 2NNNA 1ACIA 5F08A 1FBSA 2QQ8A 2GWRA 3DQVC 3IKVA 1FTZA 2L9VA 1LFBA 1PYVA 1HDDC 2O3FA 2EILH 4G6DA 3CP2A 2HXOA 4OAZA 4MTDA 1ZREA 3ISPA 4CUGA 1V5FA 3LAJA 1G2HA 4G7HF 2KIMA 2CV1A 1WRJA 1OCZH 3H9JA 3HKZA 1AKHB 3GTJJ 2NVQJ 1RRJA 1XDUA 3CUQC 1PP8F 3DWLE 1B9MA 4A3GJ 4V2GA 1S3JA 1G8XA 2VIXA 1WJEA 2DT7B 2VXDA 2ME6A 3CC4I 3AL0C 2QQ9A 1P7JA 3ZQHA 4UXNA 4DYRA 5LGNA 4IO9F 4BAYA 3KCCA 3FMSA 2CV0A 1ON2A 3B73A 3G6EI 3ZQGA 1RIOH 3PO3J 1V55H 1VQNI 1RR8C 5GAEJ 5CQGA 4BY1J 3C2GA 3TDZC 3LQQA 4BQOA 4YELA 1D1AA 4LOCA 3RKXA 3DTEA 3GW2A 4HLYA 2J5PA 3QYBA 2BEOA 3VFZA 4JK1X 3RPUD 4M3GA 2MLGA 3BCAA 3ZQ7A 5D4SA 2ZNYA 1ORKA 2KMUA 1LNWA 3OYIA 2LP0A 2X9DA 4KIBA 2M8GX 3C18A 2VBWA 3K1NA 3K2AA 4HX7A 1C0WA 1B1BA 5JVGF 4C2TA 3I4PA 4FE7A 3U21A 2J5OA 3MAJA 4PGGA 2VJIA 1N75A 1ZARA 2XAQA 4KDPA 2CWEA 4XBFA 1LUJB 4AYBN 4C30A 2DOFA 3M1CA 3HRSA 2QKMB 3KP7A 2VT2A 5FKKA 3K10A 1D1BA 3V4GA 5J1RA 3QU3A 1KA8A 2UXNA 2QQBA 1U5TA 4BGDA 2LNBA 3W2WA 2HQNA 2QGUA 1W5TA 2DA7A 3Q0VA 5GP9A 4D5FA 1AWCA 3CCSI 3BR6A 4WF2A 5K7FA 1K78A 3QQAA 1HF0A 4IRIA 4RM2A 2XKPA 5DD8A 5D5XB 2VBZA 4NQWB 1LEAA 3PIOF 2D2WA 4BEHA 4D1QA 3M7GA 1T98A 1IRGA 2OF7A 2WC2A 2IA0A 3K69A 4QSHA 2EIKH 3K1PA 1APLC 1BIAA 2FNPA 5LEJA 4OIQF 2K4BA 1XGOA 2XKOA 1A6QA 2JZYA 3ZN1A 1K61A 4XKVA 1J7KA 4U0YA 4OIOF 3HRTA 3MFKA 2DYSH 3VSLA 2VXZA 3FMQA 2R7WA 3HOYJ 2X6WA 2CUZA 3AKZA 3ZMTA 1H8AC 4WK8F 4PZJA 5E1WA 5L3DA 5M3FJ 3A01B 4YRVA 1Y6IA 1R7JA 4HX4A 4BJ6C 4BNCA 2E5ZA 2AS5F 4LFUA 2A68F 2ECBA 1ZKGA 1OR7C 4XN0A 4BXFA 2CJJA 1ZR2A 1S72I 1YRNB 3HTUA 3LAPA 3LWFA 2QVOA 2K7LA 2E2JJ 4FX4A 1KGSA 3AG1H 2RREA 1TWCJ 3LMMA 4L9JA 4A2UA 2OTJI 1YITI 1F1ZA 5J1YA 2FSWA 1DU0A 4AIHA 5ERIA 2L7KA 2L7FP 2HPIA 4YFKF 2IS1A 3RIRA 4G9YA 4MQVA 1YLFA 4M74A 3GO5A 2E19A 1HW2A 4V2FA 4C3JJ 2LBFB 5EEAA 1SEUA 5H20A 2PLYA 1J5YA 4Y4RA 4M3DA 4ESJA 3CLQA 1A04A 2PMZN 4XRFA 4IPAA 2QLZA 5E20A 4RLQA 1SD6A 2ZCWA 1X3WB 1JKRC 5FKNA 4CYDA 5LHHA 1AU7A 4PSXA 3GMEA 4PCQA 5A2QZ 4YFXF 1JI8A 4Y17A 3DBHB 1K4TA 3N97A 1W36C 2DA1A 5IYDJ 1Q1HA 3PUFA 4IHTA 1HKTA 4AWXB 3LSGA 2MLKA 1A35A 2FD5A 1LVKA 1V5GA 2L54A 4Y52J 1EH8A 4G12A 4FASD 3V42A 4BJTA 1XSVA 2Z3YA 5LRSA 1XDSA 4DIQA 1O7FA 2TDXA 3PNVA 3H1CA 2JN6A 3K9TA 2XIGA 1Z77A 4AM3A 2WB1N 3RKWA 4BJ5C 3MQ0A 5C3EJ 1IG7A 5EJCA 2ID6A 3S3MA 2XPUA 4L9NA 2E35A 2EWNA 3UNGC 2OV7A 3TOBA 1D5YA 3WU2C 1YIOA 4RGSA 1UELB 3OMYA 4ZZLA 2HOEA 3GTLJ 2IPQX 2V6CA 2IGNA 2OCCH 2RKHA 1W4MA 3BDDA 4XKCA 3TL4X 4IJAA 1SFXA 2FUG2 2L9NA 5B3SH 3LFKA 1T33A 1ITYA 1UCRA 3R0AA 2DK8A 1XX5A 3HUGA 1Y0NA 2E71A 3M07A 5JR3A 1R9TJ 2E2IJ 2W1OA 3X2QH 4DNCA 1Z67A 4B4CA 2F5FA 2FA5A 4MFEA 4IHXA 5LHGA 2DI3A 2WY7Q 2NXNB 3WG7H 4UUSB 3I58A 4UB6C 3ZXSA 3IAS2 1OYYA 2HQAA 3SFIA 2F6CA 3HDDA 2ISYA 3HIFA 4NC7A 2Y0SN 2UXXA 4AIJA 3FMRA 4BY7J 3SZPA 3C1DA 2EFWA 4ZH4F 1BR2A 1YW7A 4PFOA 4OU0A 1PUFB 3SXYA 4BXXJ 3SZGA 3CJNA 3LA2A 4XLHA 5H6QA 3IAM2 1EV7A 1Y1VJ 4ENMA 3IKTA 1IRZA 1FSHA 3LQRA 4XLFA 3K4KA 3RZOJ 4Y3OA 3QRFF 4MO7A 3WU0A 1OMIA 4D7MA 2M7BA 3KLNA 1ULYA 1EJ9A 3RTRA 3TW7A 2QSHX 3MVPA 2BY3A 2YS9A 1OCRH 2IP2A 3IP4B 1CF7A 2HWVA 4P96A 4BQQA 1NK2P 4XOTA 5LGUA 3WE3A 3GFMA 1PP7U 4BBRJ 5HLHA 3GLLA 1QBJA 1EH6A 4XMYA 3HB9A 2HU9A 3I54A 3CCVI 4A69C 5DDGA 3SJMA 1MSFC 3ZMVA 1XMKA 4Y13A 1T39A 2M7AA 5D6EA 1GHCA 1YHQI 3E6MA 1V3FA 2DO7A 1SD4A 4CSWA 1AOYA 4A3KJ 3SDBA 1UG2A 1ETVA 3TMOA 3QOPA 1I1GA 3WTTC 2GM4A 3FWEA 5GADJ 2A5WA 3NQOA 2HQ5A 2WBMA 3DKYA 4CCKA 1MMSA 5D8LB 1Z7UA 4LLNA 2OPTA 3K0LA 4DYCA 2MSYA 3R6SA 4RDUA 1BJAA 2CQNA 4IEJA 1K78B 1MNEA 2RN7A 4S0HB 3BTIA 2JUCA 4N9HA 3S15J 3BJAA 1LPQA 2KJCA 4I99C 4B43A 5DS9A 1RUNA 4XICA 4N0BA 3DBRB 3F9KA 3R0JA 5DCMB 2HFHA 5HOOA 4BQAA 2QA4I 2DA4A 1QPMA 4A3CJ 1K4SA 1DPUA 3C2BA 4ENJA 3QAHA 1H9GA 1YO5C 4F3QA 2K27A 4GO1A 2VONA 3BTLA 2VE9A 3S3OA 4L5EA 2XB5A 1FYMA 3RI4A 3KP5A 1QZEA 5L3FA 1W7PA 1Y8RB 3JRIA 3S14J 1J2XA 1X19A 4P9UA 3CZ6A 4C2MJ 2IT0A 1OJLA 2VL8A 3HKZN 1IXSB 4UVAA 1XN7A 2HYGD 1X3ZB 4BL0B 2JJ7A 5IOYA 4IF4A 2QSFX 3I9V2 3M8JA 2CGPA 2X4HA 1W0UA 2R7QA 3HHHA 5J1UA 3DEWA 5FD5A 3TKYA 1W5SA 4EGYA 3K4MA 1NK3P 1FSEA 3GBGA 5HNFA 1HSJA 1Z21A 2PG4A 2JVGA 3W6VA 2Z1DA 4M3FA 5HLGA 2IA2A 1N78A 4QPQA 1TZLA 3TOAA 2M1BA 2XAUA 2LMDA 5DD4A 3WTXC 4JOMA 5CVRA 5LFAA 4LGWA 2MC4A 1I27A 5JLXA 2VJ4A 2K40A 3E7LA 1D5VA 1LJ9A 2R5YB 1P2FA 1IZ1A 3ZMZA 4RA2A 5D5WB 1BBYA 2ZXJA 1WPKA 2HI3A 2M34A 1YS6A 4OIRF 5E1XA 4UV9A 3L00A 4LMYA 1MDMB 3KP3A 2EJRA 1IN6A 2EINH 3JSOA 1IV6A 4KT5C 4IVNA 4HEA2 2R5ZB 2FE3A 3L2VA 3F6VA 3IWZA 3TGNA 2ADUA 3H0GJ 4ZTFA 1Z6RA 1YJNI 4MIMA 3T8RA 1FP2A 2CSOA 3OYLA 3BR2A 3BZ6A 4HF0A 3K7AJ 3I71A 1MD0A 3B02A 2LKSA 2VKDA 3ML6A 3F8NA 3G71I 4D5CA 2BXYA 4L0ZB 2Z99A 3J80K 4M71A 4P55A 5CPRB 4ZYEA 1DUXC 2LYCA 2YU3A 1FOWA 2KFDA 1S29A 1BW6A 3BG3A 4S05A 2OZ6A 1JHHA 2AQEA 2A6EF 3ZGKA 2HEOA 2E1OA 2ZMEB 2Y2ZA 2F5CA 3LSTA 2KHMA 4HG2A 3DFGA 3JR9A 3AFHA 2IXSA 3PQKA 3HSFA 4F7ZA 3AG3H 5JVTA 4RBOA 3K4NA 3SEQA 2LR8A 4CCLA 1FYKA 1HSTA 1B8IA 3I53A 3ABKH 2JQ7A 3RYPA 2GA1A 1RC9A 5DUIA 2WV1A 2KL4A 2FMLA 3BWGA 4KITB 2X6YA 3MZYA 3S16J 1QHGA 1SFEA 5IYBJ 3K6GA 3F22A 5D4RA 2XUBA 3BT9A 2EZIA 2P81A 4I09A 2H09A 4QPOA 1XS9A 4EVIA 1ETOA 3ABUA 4A5MA 4V19K 2STTA 2EQRA 4ZYHA 4Y7NJ 1KQ0A 1NH3A 2D45A 3LSJA 3QYFA 3PO2J 4HQEA 2ZMEC 2NVUB 1IUFA 1MIJA 1QZYA 2PI0A 1P4XA 3AG2H 3G4SI 1XC5A 2JRMA 1H0MA 3S1NJ 4XOPA 1HDPA 4C3HJ 2IGKA 2Q2EA 2KQRA 2D1HA 2HS5A 3OYJA 4KIFA 4OWRB 1Z3YA 3CJTB 4ZDPA 2GXAA 3DPLC 1UAAA 1YW9A 3OWTA 5LLQA 2FXAA 3K4CA 2M0CA 1XPXA 1FMWA 2ZXHA 4M6VA 2DA6A 5BOXA 1EKEA 2P5KA 2G9WA 2STWA 1HW1A 2V1XA 3VYRB 1R23A 4A3DJ 3NRVA 3F8CA 2DYRH 5KHDA 5IT9Z 1ZN2A 2DTRA 2HXIA 3PUBA 1E3PA 5J4VA 2QCOA 1MBJA 3BPVA 4EJOA 3QU6A 3HL2A 2FEZA 3OYDA 1FJLA 2KZVA 3RJPA 2W25A 4CXFA 2GLOA 2EPFA 4CCNA 1FOKA 2V7FA 1ETXA 2BGCA 3L9FA 3JRGA 1YIJI 1V5EA 2DOEA 2CRGA 1I3AA 4IHSA 1L3LA 3OL4A 5F0FA 2ZFWA 4M9SA 4IL6C 2F5DA 2RNGA 2VJJA 3PQJA 5HNHA 4KIGA 3F72A 3BCBA 1T0FA 5F6FA 3S1MJ 4HF2A 3I59A 4A3IJ 2VBXA 4P1WA 3ZMUA 4UVCA 3DBLB 1FNNA 3DP7A 4U88A 4DZPA 3BPXA 5F0CA 3REOA 4PFPA 2PFBA 2BHZA 2EZLA 2KRCA 2ZB9A 3JAMK 3BZKA 3GEZA 3CLOA 5E3NA 4WXHA 1FC3A 1R58A 4UVBA 5EDNA 4I0BA 3QYEA 2VOPA 1U8RA 1G3WA 1SVOA 3GFJA 2XHKA 1J75A 4BUPA 2VN2A 1VQLI 3KX2A 4CZCA 2R7DA 4CYCA 4NC6A 4EJVA 5FLXZ 4HSTA 3PNYA 3Q9VA 2CFXA 4ASNA 1FY7A 4TV7A 2DJIA 4AVPA 1ZH5A 3LSPA 4NC8A 1DGRM 4KUMA 2QM3A 2LLKA 2XGCA 1TP4A 3OS1A 3JW4A 4MLOA 3BR3A 3H9GA 1IN4A 4XN3A 1G4DA 1ODDA 4ZDLA 4FETA 3WHBA 3OR2C 4HAMA 4B1RA 3IH4A 2L4AA 4XLNF 4EM0B 2ZO4A 4EV0A 1IUYA 4BACA 3MD2A 3HEFA 3A03A 1TW2A 3CP8A 3G3ZA 3BG5A 4EMSA 3VODA 5KNLA 3JRHA 5E8GA 2R7ZJ 3HOSA 3CO6C 3CCRI 2DFEA 4M9XA 2X51A 2W4SA 3JCUC 5F27A 2RAEA 3F21A 2JMWA 2H94A 2OAZA 1QZZA 4P5OA 4LB6B 1FZPB 3L7WA 3T8TA 4JX5A 4C9YA 5EG0B 2W85A 4M3BA 5DYMA 4XKBA 4F93B 2ELHA 1VQOI 3WGGA 1MNDA 2K5CA 1U6GA 4ABZA 2F4MB 1X1DA 1EF4A 1QO0D 2DA2A 3HRUA 3DLLF 1E3OC 3TBIA 1R4NB 2R7VA 4GDFA 1DPRA 2G0EA 1FIPA 1UHSA 1V4RA 2DMNA 2XAHA 3DCFA 2W48A 1IGNA 2E36A 4M6XA 3BQYA 3MKYB 3CF2A 2YX4A 1FP1D 2BE5F 3BTCA 4IRGA 4XKWA 5HODA 1R71A 3LL7A 3ECHA 4L5IA 4AU7A 4NHJA 2HQRA 2JSCA 1Z1DA 1SVLA 2YX7A 3F6OA 1NG7A 5CVJA 1S8NA 5J47A 3HSEA 3OY9A 3EUHA 5IT9K 1D0ZA 3L09A 1BI3A 2V1NA 3KYCB 3BJ6A 2X1EA 4BBSJ 1H88C 2EV0A 2YU9J 2A5YB 2BY1A 3JRFA 3WTZA 2CUJA 1KYZA 3H3UA 4XORA 4LG0A 4J01A 3H92A 3OL3A 1F9NA 2P5VA 2IVMA 3JREA 2ZJQF 3OIPA 5DEQA 1JXSA 1YOVB 1A5JA 1S7AA 1S5LC 1TBXA 2ZXIA 2OTLI 5D8KB 3KP4A 3S1RJ 3OIQA 2G7HA 1P4WA 2FU4A 2VQLA 2Z5UA 2XAFA 5EYRA 5KVRA 2DTZA 2CW7A 3FXUA 3IC7A 1D0XA 3OOUA 3CMMA 2XPWA 2AO9A 3AG4H 2ZNZA 1UJ8A 1X1BA 4CA0A 2MD0A 4HX8A 4ITVA 2VC1A 5CYVA 2DU9A 4OMZA 2MFZA 5BPIA 2M8EA 4YEJA 2DPUA 3CMEI 2IS4A 3FXKA 1T2KA 4WCGA 1WJ5A 2LC2A 4LG3A 4M3EA 2VKVA 3VYUB 5FJ8J 1HCRA 3GXOA 2BBYA 3OSGA 1MW7A 2P8TA 3TO7A 4RAZA 4U7DA 5FLXK 1X2NA 4A6DA 3HRMA 4KNYA 3G73A 2LF8A 4HDVA 2EK5A 1XCBA 4FCYA 2K9MA 5LRRA 1FT9A 4QTRA 1BC8C 2H1KA 1X2MA 2EA4A 5J3LA 2DODA 5TRDA 2MH2A 1JUSA 5F04A 1PUEE 4R79A 3BQZA 2WWYA 1E0EA 4FQGA 5L3BA 4FE4A 4JP0A 3ROUA 4EJWA 4AUXA 1UMQA 3OYBA 1IRFA 4ESFA 2PJRA 1LDDA 1P9QC 4NB5A 5IYCJ 5DTDA 1BC7C 2EFPA 2JA5J 1VFCA 5E18F 3F8FA 3I56I 2LTPA 2K9LA 5L3CA 3QP6A 2BY2A 1X1PA 1EH7A 3EDPA 2OQRA 2MC3A 4HW0A 1S6LA 3WODF 1JJ6C 2IEKA 3LNQA 4LIUA 2NVXJ 4KICA 4I76A 3EYYA 3L2RA 3OYMA 2A69F 2GAUA 2B0LA 2P6SA 3BTJA 1XSXA 5J40A 5HDKA 5IPAA 3DU5A 3KZIC 2QF7A 1R1VA 5AONA 4IZZA 2IS6A 3W6KB 2XRNA 1KU7A 4E7IA 2HYJA 3HSRA 3A02A 3BG6A 1Z91A 5FKLA 1J0RA 2HPMA 3K1MA 5IP9J 1RI7A 4D7NA 1U9NA 2L2OA 1W0TA 3F0CA 1VQKI 1IW7F 3IV5A 1R49A 1LE8A 1DP3A 3KLOA 4AD9A 3CMAI 3KZZA 3DV8A 3OYEA 5FRMA 4OAYA 5K1YA 4HOBA 2R3SA 3KZYA 1RKTA 4IXAA 1RPWA 1F36A 2BYVE 3KEQA 1VF9A 1XD7A 1Z0XA 3FXLA 2NS8A 5L3EA 1SANA 1OCCH 4MEYF 3HG9A 3JSPA 1JE8A 3EPZA 3TO9A 2C6YA 3GTKJ 5FGMA 4ESBA 1VNDA 2Z33A 1SC7A 4HDUA 2NRAC 2DMUA 1MNMC 1VQ6I 5GTIC 2XGXA 3T5XA 3NWSA 2O8XA 3QP5A 5LEKA 2DFHA 5LD2C 4FT8A 1YQAA 2COMA 3OS0A 1SFOJ 4OIPF 1I1SA 4I01A 4U7BA 4II2A 4FISA 3I4NJ 2BVMA 4D0PA 2KRHA 4I98B 1MJ9A 2PJPA 3JRCA 2VOOA 5E3MA 2F4IA 2HVSA 2HTJA 5GPAA 2M2EA 3FZVA 4XIDA 1X58A 1FMVA 3ZPLA 5IP6A 1JT0A 1J59A 2RV8A 3CCMI 2M5WA 4O5VA 4LK0F 2IBDA 4JQFA 4BQNA 3FM3A 2RDPA 3L1PA 3VDXA 3NARA 2W7NA 1ZLKA 1R6RA 3CDLA 3F8MA 1Q1VA 2QUFA 2HKOA 4AC0A 3MKLA 4HRIA 2HVRA 2KP6A 1XMXA 3J80Z 2H27A 1X4OA 3ECOA 1HLVA 2JSPA 5FROA 2CUEA 3E6BA 2D1VA 2VBYA 1LEBA 4BDZA 3CUOA 3MWMA 2Q8KA 5HDGA 1ERDA 2BW3A 1BI1A 1MSEC 2HNHA 2HOTA 2E7WA 5FRNA 2JA6J 3OYCA 2CO5A 5GAGJ 4N4NB 1W1WE 3J7ZI 3C3WA 2LREA 1N25A 4KA4A 1FBUA 1R4MB 1LVAA 1LB2A 2WTEA 1VQPI 3LA3A 2N8GA 2PN6A 4R8HA 2DXIA 1TW3A 2MG4A 1B9NA 2UUZA 1XG1A 4JBAA 2WAFA 2QENA 4IHWA 4XRMA 3K70D 2Y0MA 3Q9SA 5K5OA 1U5TB 2W82A 2YUSA 4BU2A 4AIKA 3MEXA 3L2QA 4S04A 1BJZA 3GWZA 1O7LA 2DOAA 4PJMA 4XLPF 1MBGA 1B6AA 5K7ZA 2CU7A 2VE8A 4B3XA 3FBIB 4KN7X 3W2AA 1WGXA 4LK1F 2EFOA 4M72A 3K4LA 3CUQA 3TP0A 3S3NA 4MEXF 2CQQA 1IN8A 3DPUA 1UZCA 2IA1A 2K9SA 4E4HA 3SQNA 1D8JA 4WXCA 4BEHB 4MTEA 1IF1A 4EJUA 2VQCA 3ASNH 2E5NA 3JRBA 2M4GA 3SDGA 1TQIA 2EB7A 2L5QA 1LKXA 3F3XA 3TP3A 3TQNA 1WH7A 1P92A 4WXDA 4GGGA 5E3LA 4QIWN 4EGZA 1FEXA 4RB1A 3IH3A 4A3EJ 1CGPA 4UNOA 1YJWI 2KIQA 4QWQA 2DLLA 3ZR8X 3FM5A 5J4YA 1JKPC 2LY1A 3GCMA 2KIUA 5FFZA 2ZSIB 4HSRA 3TO6A 2CQXA 2Y48A 1U5TC 5IY5H 2I10A 1UB9A 3P9CA 2Z2SB 4X1EA 2E1NA 2BZTA 3FXMA 1CQTA 1OPCA 5BS6A 3GFIA 1BN5A 3VYSB 5M5XJ 1G6NA 3ESWB 5HS8A 1AKHA 2CG4A 5BQTA 1K7AA 4E7ZA 4AIDA 2GIZA 3DU6A 3E5QA 4L0YB 3IHUA 5FD6A 1ZTRA 4J00A 1T6SA 4YFNF 1SD7A 3QOEA 1OKRA 2QBYA 4JYKA 4PJ0C 1WJBA 4I02A 2WAQA 2XROA 2R7UA 2K3PA 3HOZJ 1TNSA 1OCTC 3E5UA 2LY9A 3RZDJ 4CHUA 2PX9A 3BP8A 4BKXA 1SMYF 4XRSG 1WI9A 5AIPA 3RKYA 2E7XA 2ZSHB 4HF1A 4RB0A 5DM7F 1LFUP 2OJED 2JA8J 3GTOJ 1GDTA 3ELKA 4UUVA 2ETHA 3FF5A 3TDUC 1R5GA 3HBLA 3ASOH 2P0WA 5J6XA 1B4AA 1GVJA 1QHHD 2DT6A 2Y31A 3G1LA 2YSRA 4GYIA 2BVLA 5CVIA 2OQGA 2ECCA 3KP2A 1RESA 3JAMZ 4ZJZA 5M5WJ 1A36A 2IGOA 2VUMJ 3J7AO 1L0OC 2Y69H 2IAIA 4E7KA 6PAXA 3HM5A 1OISA 4B09A 2YPRA 4G7OF 2EFNA 1UG0A 2QQAA 1OLTA 2L02A 2HOAA 2WAEA 4E70A 3HGYA 1ETWA 4H4KC 3HJEA 3SEZA 3J7YJ 2VODA 1SVMA 2PBIA 2LOOA 3P9IA 1YX3A 3S8PA 1EA3A 2NOGA 3KYDB 2BXZA 1D0YA 3D5SC 3M8EA 2LK2A 3HHGA 3E0JB 4HNUA 4A0ZA 1FLIA 4PUSA 5H6RA 4NUBA 4LD5A 3LA7A 5BPDA 5F64A 2QYOA 1R5HA 2ACJA 2R7OA 2K86A 5EZHA 2FNAA 4XQFA 4A3MJ 3CQZJ 1I6XA 4LLLA 3LSKA 1P4AA 3IRQA 4PJLA 4KFCA 3D5LA 1RR7A 2L0KA 3EUAA 5B66C 4DQ2A 2LH9A 3C7JA 2FQ3A 3QPSA 4XK4A 1TT0A 3A0BC 3KEYA 3O8HA 2Q1ZB 2XB0X 1WVRA 1OR7A 4NQWA 2MW8A 3W3CA 3N05A 3RSNA 3HUGB 3DEUA 4GFBA 1SAXA 2DQRA 4H0EA 4A0YA 1TNTA 4CICA 4ZYAA 2DMQA 1JKQC 3L2WA 2JUGA 1VQ9I 1MBFA 1RKWA 2RC4A 1IXRC 2FBHA 1MMGA 2JPCA 4A3FJ 3QPLA 2L9SA 1PDNC 1JGGA 3HOWJ 2LVSA 4LLGF 2M4KA 1BI2A 4XM3A 3BOQA 3A01A 3T0YA 2H8RA 3ZMDA 3H5NA 3O3KA 4EEFG 3GTGJ 2NVYJ 2GOMA 2AQFA 1HC8A 1TL8A 3FDYA 4CZZA 2IJLA 2I8DA 3DTKA 3HGGA 1VQ7I 5J8CA 2O03A 4HYEA 1ZGJA 1YRNA 3G2BA 4KMUX 2B9SA 1BI0A 1CF7B 2OUMA 3B6AA 2ZJ2A 5GAHJ 4HLXA 3HPHA 2H1LA 4PJJA 4E7SA 1HBXG 1Z6TA 2XF6A 2JVHA 3O8GA 2X1CA 2XPVA 3TEDA 3S2DJ 1OYWA 4UUTA 3KP6A 3VWBA 2NVTJ 3N4MA 3F8BA 2LBFA 2EIJH 1LDKB 1K83J 3HPGA 1PVEA 4RS8A 1MJBA 1G3YA 1VQMI 2E60A 1U78A 4F92B 2CFOA 1YE9A 3E6CC 3QODA 3MZ8A 1GT0C 3DTIA 1WQ2A 1QQIA 2A05A 2F2EA 3Q5FA 3I64A 3ABMH 1U8BA 4DZJA 3MKWB 3MKZA 1WH5A 4ZYDA 2XV4S 3EUKL 4KT6A 5E8IA 4RLFA 2H6BA 3B6CA 3CF5F 2DCEA 5FLVA 3PJRA 1OFCX 1BOBA 3MCZA 4ZZDA 2GBYA 2O61A 4GCVA 4ANJA 2O7OA 4UHTA 4DOZA 4J19A 3GX4X 2P6TA 2HKXA 4U0WA 4BS9A 1Y8QB 5AIQA 3EETA 2RVCA 3M8FA 3DLAA 1W5CC 3OV8A 1ZG1A 3V8JA 4GRIA 1ZGWA 2OD5A 3LSHA 2ME0A 3U1DA 3RYRA 3G1MA 4I0AA 1YX5A 1T38A 1UHMA 1ZHFA 2Y9ZA 4A3LJ 2X48A 1N77A 2ELJA 4UB8C 2KKOA 1QNTA 1NHAA 1MBKA 1Z05A 2OZUA 4ENKA 4IOCF 2MABA 1W7PB 4XLCA
chains in the Genus database with same CATH topology
1YS7A 5CJ9A 3ZP5A 3GUDA 2KJBA 1XGNA 3U2RA 2XVCA 2FBKA 4MGRA 4BH9A 5ED4A 1XMAA 2QBYB 3HOTA 2JTVA 2M30A 2W24A 2M87A 2V79A 5BMZA 1LQ1A 1R1UA 1XGMA 1FPQA 3I0TA 1R22A 2GZWA 3QPTA 1B59A 1SD5A 5E1ZB 3I5UA 3W6JB 2FMYA 1O57A 3QPHA 2CYYA 4RGUA 4U0VA 5EEHA 2EA2A 4OMYA 1G3SA 1TTYA 1TQPA 1KQ8A 3BROA 2RNJA 4KMFA 1J9IA 4Z2YA 1ZG3A 1YW8A 3PFIA 5K5RA 1XSDA 4ENNA 3CO7C 4YG2F 3ULQB 5HS7A 1BM9A 3WTSC 3GZ6A 1ON1A 1DP7P 4LJZF 3V7SA 1O3QA 2A3SA 2DQLA 5JI6A 3R61A 1MKMA 2KRFA 2NAZA 2L3DA 3CDHA 3E97A 1KU3A 1QGPA 1Y0UA 5EEGA 1ZRDA 2YR2A 1XCVA 3GVAA 5DCMA 3J81K 3DPTA 3V8KA 3M1EA 2QWWA 3S2WA 4A6EA 4PDKA 2L01A 3ERED 2RGVA 2EV5A 4Q5SF 3AAFA 2X0LA 1W7PD 3VEPA 3MZHA 4KN4X 1E17A 5ICGA 4N9IA 3F23A 3IWFA 2MA3A 3WU1B 2FF4A 3KFWX 3R60A 2R7FA 4L5JA 3WTUC 3K2ZA 1HQCA 2XASA 4Y15A 4IRHA 3IL2A 4MNUA 2PQ8A 4CO8A 2PEXA 3IRRA 3SZTA 1F4KA 2QZ8A 2IRFG 4YIFA 1LDJA 5HLIA 1IXCA 2BV6A 2DFIA 2L4MA 2ISZA 2MBFA 1RUOA 1MDMA 1MGTA 2DT5A 2AXLA 3I59B 1UFMA 5FO5A 4A5NA 1ZRFA 4RAYA 4EJTA 4G94A 4A0XA 4GXOA 2EV6A 2M45A 2UZKA 4OOIA 2P4WA 1IN5A 2DBBA 2MH9A 2HZTA 2ZMEA 1VTNC 2JT1A 4MQ9F 4GYGA 3L2CA 5CLSA 1IN7A 3V7RA 4G7ZF 1GXPA 4G6QA 3JTHA 1K79A 2IW5A 1BIBA 4ON0A 3KEOA 1G3TA 1WKMA 1YTYA 2NYXA 1U2WA 4PGHA 3HYIA 2DW4A 1X3UA 4HA8A 2O0YA 4FX0A 3COAC 4P9FA 4M73A 2LDUA 3CTAA 4BHCA 4BYYA 2VT3A 3P9KA 5D5UB 3FX3A 4HZFA 3SHFA 1O3SA 1ZAOA 3RPUA 3R4KA 3VB2A 2F5EA 3WTVC 1YG2A 1O3TA 1REPC 2ESHA 4B8XA 2LKPA 2Y75A 4MHGA 2OA4A 2RQPA 2NNYA 2O6GE 1SFUA 3M9AA 1MJAA 1K6OA 1TQMA 5LHIA 1YFHA 4OINF 4WX9A 3D0SA 5IT3A 3WGIA 3P7NA 3GYHX 3JTGA 4EM2A 3KE2A 4LG0B 1USTA 3FXQA 5FFXA 2V1DA 3VOEA 4L9VA 2GA2A 4ETSA 3E6DA 1BOAA 3DXJF 4WWCA 4XSXF 5HS9A 1ONVA 4G8XA 2P7VB 5A2QK 3WG9A 5ILSA 5K5QA 1D8KA 3GFLA 3DKWA 1D3YA 3O2PE 2GXBA 1ZGAA 5D6FA 5LGTA 5HDNA 2GXGA 2H6CA 5E17F 5CVVA 5JHUA 4M6YA 1KU2A 2ESNA 4Q48A 4BHPA 1RZ4A 2EFQA 1DDNA 2W57A 3GZ5A 5D5VB 2GQQA 2HDCA 4RGRA 4L9TA 2UWMA 2HGCA 4RB3C 4YIIA 2GIVA 5HVQC 3KETA 1USSA 4HBLA 3HTSB 2FOKA 1ZLJA 4L18B 3WGHA 4CGZA 2V9VA 1HKSA 2HR3A 1U3EM 1S7OA 1YYVA 1F5TA 5LBQA 3ZMSA 1UHWA 3NEUA 1P6RA 1Z9CA 2PMUA 2G7UA 2DAOA 4BHBA 4CDGA 3WTYC 3WE2A 3O6BB 2XAGA 3E5XA 4K2EA 1ZG5A 5DV5A 2K4JA 5ICCA 1KU9A 4LB5A 2XAJA 1HKQA 1O3RA 2ZKZA 2JPBA 1I5ZA 4UV8A 3GF2A 4I7HA 1WSUA 1STZA 3SFZA 2W84A 2DPDA 2FBIA 2JRTA 5ILUA 2CW0F 1XB4A 1KYWA 2PMHA 1OYIA 5TJJA 3OOPA 1JGSA 2HTSA 2A6HF 4KYWA 1XGSA 4XSZF 3GLXA 3FXRA 3EYIA 1HXDA 4A12A 3U9GA 3V7CA 1SMTA 4O6JA 5DCFA 4RGXA 1JHFA 2OBPA 5ICFA 2WV0A 3WTWC 1MZBA 4HV5A 2HYFA 4O3MA 3BJOA 2LSOA 5J8FA 5CVUA 1E2XA 2P7CB 4Q4ZF 5L3GA 1R36A 1KQ9A 5ILVA 2A07F 4Q47A 2DK5A 2NS0A 4QLCU 2Z9OA 1RNLA 4M9ZA 2ZBKA 1R1TA 4BXUA 1H9TA 2KIFA 2FRHA 2E1CA 2V1UA 5ICEA 1FYLA 2LF7A 3RDIA 2CQKA 3ZN0A 1FX7A 5JFRA 3ABTA 3E3VA 3H3ZA 3V8LA 5FB2A 4I2OA 4FHTA 1IAWA 4R1HA 3FHZA 3J81Z 2P5LC 3BY6A 1R00A 3DF8A 1TLHB 1WWXA 4ZYGA 2K02A 4RB2C 1FWZA 2OU2A 3CUQB 1FBQA 1ZYRF 4EM1A 1HW5A 4HV6A 2Q0OA 4EQQA 2MD5A 3RPQA 3T1BA 5DUKA 1GXQA 2A61A 5KK1A 2VC0A 4HQMA 5F1RA 1ZRCA 3EQLF 2NNNA 1FBSA 2GWRA 3DQVC 3IKVA 2O3FA 4G6DA 4MTDA 1ZREA 3ISPA 3LAJA 4G7HF 2KIMA 1WRJA 1XDUA 3CUQC 1PP8F 1B9MA 1S3JA 2QQ9A 4UXNA 5LGNA 4BAYA 3KCCA 3FMSA 1ON2A 3B73A 1RIOH 3TDZC 3LQQA 3RKXA 3GW2A 4HLYA 2J5PA 3VFZA 2BEOA 4JK1X 2MLGA 3ZQ7A 5D4SA 2ZNYA 1LNWA 4KIBA 3C18A 2VBWA 3K1NA 4HX7A 1C0WA 1B1BA 3I4PA 2J5OA 3MAJA 4PGGA 1ZARA 2XAQA 4KDPA 2CWEA 4XBFA 3HRSA 3KP7A 2VT2A 3V4GA 3QU3A 1KA8A 2UXNA 2QQBA 1U5TA 2LNBA 2HQNA 1W5TA 1AWCA 4WF2A 1K78A 4IRIA 2XKPA 5DD8A 5D5XB 2VBZA 1LEAA 2D2WA 3M7GA 1T98A 1IRGA 2WC2A 2IA0A 3K69A 3K1PA 1BIAA 2FNPA 5LEJA 4OIQF 2K4BA 1XGOA 2XKOA 2JZYA 3ZN1A 1J7KA 4U0YA 4OIOF 3HRTA 3MFKA 2VXZA 3FMQA 3ZMTA 4WK8F 4PZJA 5E1WA 5L3DA 1R7JA 4HX4A 4BNCA 2AS5F 4LFUA 2A68F 3HTUA 3LAPA 3LWFA 2QVOA 2K7LA 4FX4A 1KGSA 4L9JA 4A2UA 1F1ZA 2FSWA 4AIHA 5ERIA 4YFKF 3RIRA 4G9YA 4MQVA 1YLFA 4M74A 3GO5A 1HW2A 2PLYA 5H20A 1J5YA 4ESJA 1A04A 4XRFA 4IPAA 2QLZA 5E20A 1SD6A 2ZCWA 4CYDA 5LHHA 4PCQA 5A2QZ 4YFXF 4Y17A 3N97A 1Q1HA 4IHTA 1HKTA 4AWXB 2MLKA 2L54A 1EH8A 1XSVA 2Z3YA 5LRSA 1XDSA 1O7FA 2TDXA 3K9TA 2XIGA 3RKWA 3MQ0A 4L9NA 2EWNA 3TOBA 1YIOA 4RGSA 4ZZLA 2HOEA 2IPQX 2V6CA 2RKHA 1W4MA 3BDDA 4IJAA 1SFXA 3LFKA 1UCRA 3R0AA 2DK8A 3HUGA 5JR3A 4DNCA 2F5FA 2FA5A 5LHGA 2DI3A 3I58A 1OYYA 2ISYA 3HIFA 2UXXA 4AIJA 3FMRA 3SZPA 3C1DA 2EFWA 4ZH4F 1YW7A 4OU0A 3SXYA 3CJNA 3LA2A 5H6QA 1EV7A 4ENMA 3IKTA 1FSHA 3LQRA 3QRFF 3WU0A 1OMIA 3KLNA 1ULYA 3RTRA 2IP2A 1CF7A 2HWVA 4P96A 5LGUA 3WE3A 3GFMA 1PP7U 5HLHA 1QBJA 1EH6A 3I54A 5DDGA 3ZMVA 1XMKA 4Y13A 1T39A 5D6EA 1GHCA 3E6MA 1V3FA 2DO7A 1SD4A 1AOYA 3QOPA 1I1GA 3WTTC 3FWEA 3NQOA 5D8LB 1Z7UA 4LLNA 3K0LA 3R6SA 1BJAA 1K78B 2RN7A 4N9HA 3BJAA 2KJCA 1RUNA 4N0BA 3R0JA 5DCMB 2HFHA 5HOOA 4BQAA 1QPMA 1DPUA 4ENJA 3QAHA 1H9GA 1YO5C 2K27A 4GO1A 2VONA 2VE9A 1FYMA 3RI4A 3KP5A 5L3FA 1W7PA 1J2XA 4P9UA 2IT0A 4UVAA 1IXSB 1XN7A 2HYGD 4IF4A 2CGPA 2X4HA 3HHHA 4EGYA 5FD5A 3TKYA 1W5SA 1FSEA 1HSJA 2PG4A 5HLGA 2IA2A 3TOAA 2M1BA 5DD4A 3WTXC 5CVRA 4LGWA 1I27A 1D5VA 1LJ9A 1P2FA 1IZ1A 3ZMZA 5D5WB 1BBYA 2ZXJA 1YS6A 4OIRF 5E1XA 4UV9A 3L00A 4LMYA 1MDMB 3KP3A 2EJRA 1IN6A 3JSOA 4KT5C 4IVNA 2FE3A 3F6VA 3IWZA 3TGNA 2ADUA 1Z6RA 3T8RA 1FP2A 2CSOA 3BZ6A 4HF0A 3I71A 1MD0A 3B02A 3ML6A 3F8NA 4L0ZB 2Z99A 3J80K 4M71A 4P55A 1DUXC 4ZYEA 2YU3A 1S29A 4S05A 2OZ6A 1JHHA 2A6EF 2HEOA 2ZMEB 2F5CA 3LSTA 3DFGA 3PQKA 4F7ZA 3HSFA 5JVTA 1FYKA 1HSTA 3I53A 3RYPA 2GA1A 5DUIA 2FMLA 3BWGA 3MZYA 1SFEA 3F22A 5D4RA 2XUBA 4I09A 2H09A 4EVIA 3ABUA 4A5MA 2STTA 4ZYHA 1KQ0A 2D45A 4HQEA 2PI0A 1QZYA 1P4XA 1H0MA 2Q2EA 2D1HA 2HS5A 4KIFA 3DPLC 1YW9A 5LLQA 2FXAA 5BOXA 2P5KA 2G9WA 2STWA 1HW1A 2V1XA 1R23A 3NRVA 3F8CA 5IT9Z 1ZN2A 2DTRA 3BPVA 4EJOA 3QU6A 2FEZA 3RJPA 2W25A 4CXFA 1FOKA 2BGCA 3L9FA 4IHSA 1L3LA 2ZFWA 4M9SA 2F5DA 3PQJA 4KIGA 3F72A 1T0FA 5F6FA 4HF2A 3I59A 2VBXA 3ZMUA 4UVCA 1FNNA 3DP7A 4U88A 3BPXA 3REOA 2PFBA 3JAMK 3GEZA 3CLOA 4WXHA 1FC3A 1R58A 4UVBA 4I0BA 2VOPA 1U8RA 1G3WA 3GFJA 2XHKA 1J75A 2VN2A 2R7DA 4EJVA 5FLXZ 3Q9VA 2CFXA 4ASNA 1FY7A 4TV7A 4AVPA 1ZH5A 4KUMA 2QM3A 3JW4A 1IN4A 1G4DA 1ODDA 4HAMA 4EM0B 2L4AA 4XLNF 4EV0A 2ZO4A 1IUYA 1TW2A 3G3ZA 4EMSA 3VODA 5E8GA 3HOSA 3CO6C 4M9XA 3F21A 2H94A 2OAZA 1QZZA 4P5OA 4LB6B 1FZPB 3L7WA 3T8TA 2W85A 5DYMA 2ELHA 3WGGA 1U6GA 1QO0D 3HRUA 1DPRA 1V4RA 2XAHA 4M6XA 2YX4A 1FP1D 2BE5F 4IRGA 3ECHA 4L5IA 4NHJA 2HQRA 2JSCA 1Z1DA 2YX7A 3F6OA 5CVJA 1S8NA 3HSEA 3EUHA 5IT9K 3L09A 1BI3A 3BJ6A 2EV0A 2A5YB 3WTZA 3H3UA 1KYZA 4LG0A 3H92A 1F9NA 2P5VA 2IVMA 5DEQA 1JXSA 1S7AA 1TBXA 5D8KB 3KP4A 2G7HA 1P4WA 2FU4A 2Z5UA 2XAFA 5KVRA 3FXUA 3IC7A 2ZNZA 4HX8A 2VC1A 5CYVA 2DU9A 4OMZA 5BPIA 2M8EA 2DPUA 1T2KA 4WCGA 3GXOA 2BBYA 2P8TA 3TO7A 4RAZA 4U7DA 5FLXK 4A6DA 3HRMA 4KNYA 3G73A 2LF8A 4HDVA 2EK5A 1XCBA 5LRRA 1FT9A 1BC8C 2EA4A 5TRDA 2MH2A 1PUEE 4R79A 2WWYA 5L3BA 3ROUA 4EJWA 1IRFA 4ESFA 1LDDA 4NB5A 1BC7C 2EFPA 5E18F 3F8FA 5L3CA 3QP6A 1EH7A 3EDPA 2OQRA 2MC3A 4HW0A 1S6LA 3WODF 4KICA 3EYYA 2A69F 2GAUA 2B0LA 2P6SA 1XSXA 5HDKA 1R1VA 5AONA 3W6KB 2XRNA 1KU7A 3HSRA 1Z91A 1J0RA 3K1MA 1RI7A 1IW7F 3KLOA 4AD9A 3KZZA 3DV8A 5K1YA 4HOBA 2R3SA 3KZYA 4IXAA 2BYVE 3KEQA 1XD7A 5L3EA 4MEYF 3JSPA 1JE8A 3TO9A 2C6YA 5FGMA 4ESBA 2Z33A 4HDUA 2NRAC 2XGXA 3T5XA 2O8XA 3QP5A 5LEKA 4FT8A 1YQAA 2COMA 4OIPF 1I1SA 4I01A 4U7BA 4D0PA 2PJPA 4I98B 1MJ9A 2VOOA 2HTJA 3FZVA 3ZPLA 1J59A 2RV8A 2M5WA 4O5VA 4LK0F 4JQFA 3FM3A 2RDPA 1ZLKA 3F8MA 2QUFA 2HKOA 3J80Z 2H27A 3ECOA 3E6BA 2D1VA 2VBYA 1LEBA 3CUOA 3MWMA 2Q8KA 5HDGA 1BI1A 2E7WA 2CO5A 3C3WA 4KA4A 1FBUA 1LVAA 1LB2A 2WTEA 3LA3A 2PN6A 4R8HA 1TW3A 1B9NA 4JBAA 2QENA 2Y0MA 3Q9SA 5K5OA 1U5TB 4AIKA 3MEXA 4S04A 3GWZA 1O7LA 4XLPF 1B6AA 2VE8A 4KN7X 4LK1F 2EFOA 4M72A 3CUQA 4MEXF 1IN8A 1D8JA 2IA1A 3SQNA 4WXCA 4MTEA 1IF1A 4EJUA 1TQIA 2EB7A 3F3XA 3TQNA 4WXDA 1P92A 4GGGA 4EGZA 4RB1A 1CGPA 4UNOA 4QWQA 2DLLA 3FM5A 5FFZA 2KIUA 3TO6A 2Y48A 1U5TC 1UB9A 3P9CA 2E1NA 1OPCA 5BS6A 3GFIA 1BN5A 1G6NA 5HS8A 2CG4A 5BQTA 1K7AA 3E5QA 4L0YB 3IHUA 5FD6A 1T6SA 4YFNF 1SD7A 1OKRA 2QBYA 2XROA 4I02A 1TNSA 3E5UA 4CHUA 3BP8A 1SMYF 1WI9A 5AIPA 3RKYA 2E7XA 4HF1A 4RB0A 3ELKA 4UUVA 2ETHA 3FF5A 3TDUC 1R5GA 5J6XA 1B4AA 1GVJA 2YSRA 4GYIA 5CVIA 2OQGA 3KP2A 3JAMZ 3J7AO 1L0OC 6PAXA 4B09A 2YPRA 4G7OF 2EFNA 2QQAA 2L02A 4E70A 2VODA 2PBIA 3P9IA 3M8EA 3HHGA 4A0ZA 1FLIA 5H6RA 4LD5A 3LA7A 5BPDA 5F64A 2QYOA 1R5HA 2ACJA 2K86A 2FNAA 1I6XA 4LLLA 1P4AA 3IRQA 4KFCA 3D5LA 4DQ2A 3C7JA 2FQ3A 1OR7A 4NQWA 3DEUA 1SAXA 2DQRA 4H0EA 4A0YA 1TNTA 4CICA 2RC4A 1IXRC 2FBHA 2JPCA 1PDNC 4LLGF 1BI2A 3BOQA 3T0YA 3ZMDA 3O3KA 4CZZA 2IJLA 5J8CA 2O03A 4HYEA 1ZGJA 4KMUX 1BI0A 1CF7B 2ZJ2A 4HLXA 1HBXG 1Z6TA 1OYWA 3KP6A 3N4MA 3F8BA 1LDKB 4RS8A 1MJBA 1G3YA 1U78A 3E6CC 1WQ2A 1QQIA 2F2EA 3Q5FA 3I64A 4ZYDA 2XV4S 5E8IA 2H6BA 3MCZA 4ZZDA 2O61A 4GCVA 4UHTA 3GX4X 2P6TA 2HKXA 4U0WA 5AIQA 3EETA 2RVCA 3M8FA 3OV8A 1ZG1A 3V8JA 2OD5A 3U1DA 3RYRA 4I0AA 1T38A 1UHMA 1ZHFA 2KKOA 1QNTA 1NHAA 1Z05A 2OZUA 4ENKA 1W7PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YS7 A;  5CJ9 A;  3ZP5 A;  3GUD A;  2KJB A;  1XGN A;  3U2R A;  2XVC A;  2FBK A;  4MGR A;  4BH9 A;  5ED4 A;  1XMA A;  2QBY B;  3HOT A;  2JTV A;  2M30 A;  2W24 A;  2M87 A;  2V79 A;  5BMZ A;  1LQ1 A;  1R1U A;  1XGM A;  1FPQ A;  3I0T A;  1R22 A;  2GZW A;  3QPT A;  1B59 A;  1SD5 A;  5E1Z B;  3I5U A;  3W6J B;  2FMY A;  1O57 A;  3QPH A;  2CYY A;  4RGU A;  4U0V A;  5EEH A;  2EA2 A;  4OMY A;  1G3S A;  1TTY A;  1TQP A;  1KQ8 A;  3BRO A;  2RNJ A;  4KMF A;  1J9I A;  4Z2Y A;  1ZG3 A;  1YW8 A;  3PFI A;  5K5R A;  1XSD A;  4ENN A;  3CO7 C;  4YG2 F;  3ULQ B;  5HS7 A;  1BM9 A;  3WTS C;  3GZ6 A;  1ON1 A;  1DP7 P;  4LJZ F;  3V7S A;  1O3Q A;  2A3S A;  2DQL A;  5JI6 A;  3R61 A;  1MKM A;  2KRF A;  2NAZ A;  2L3D A;  3CDH A;  3E97 A;  1KU3 A;  1QGP A;  1Y0U A;  5EEG A;  1ZRD A;  2YR2 A;  1XCV A;  3GVA A;  5DCM A;  3J81 K;  3DPT A;  3V8K A;  3M1E A;  2QWW A;  3S2W A;  4A6E A;  4PDK A;  2L01 A;  3ERE D;  2RGV A;  2EV5 A;  4Q5S F;  3AAF A;  2X0L A;  1W7P D;  3VEP A;  3MZH A;  4KN4 X;  1E17 A;  5ICG A;  4N9I A;  3F23 A;  3IWF A;  2MA3 A;  3WU1 B;  2FF4 A;  3KFW X;  3R60 A;  2R7F A;  4L5J A;  3WTU C;  3K2Z A;  1HQC A;  2XAS A;  4Y15 A;  4IRH A;  3IL2 A;  4MNU A;  2PQ8 A;  4CO8 A;  2PEX A;  3IRR A;  3SZT A;  1F4K A;  2QZ8 A;  2IRF G;  4YIF A;  1LDJ A;  5HLI A;  1IXC A;  2BV6 A;  2DFI A;  2L4M A;  2ISZ A;  2MBF A;  1RUO A;  1MDM A;  1MGT A;  2DT5 A;  2AXL A;  3I59 B;  1UFM A;  5FO5 A;  4A5N A;  1ZRF A;  4RAY A;  4EJT A;  4G94 A;  4A0X A;  4GXO A;  2EV6 A;  2M45 A;  2UZK A;  4OOI A;  2P4W A;  1IN5 A;  2DBB A;  2MH9 A;  2HZT A;  2ZME A;  1VTN C;  2JT1 A;  4MQ9 F;  4GYG A;  3L2C A;  5CLS A;  1IN7 A;  3V7R A;  4G7Z F;  1GXP A;  4G6Q A;  3JTH A;  1K79 A;  2IW5 A;  1BIB A;  4ON0 A;  3KEO A;  1G3T A;  1WKM A;  1YTY A;  2NYX A;  1U2W A;  4PGH A;  3HYI A;  2DW4 A;  1X3U A;  4HA8 A;  2O0Y A;  4FX0 A;  3COA C;  4P9F A;  4M73 A;  2LDU A;  3CTA A;  4BHC A;  4BYY A;  2VT3 A;  3P9K A;  5D5U B;  3FX3 A;  4HZF A;  3SHF A;  1O3S A;  1ZAO A;  3RPU A;  3R4K A;  3VB2 A;  2F5E A;  3WTV C;  1YG2 A;  1O3T A;  1REP C;  2ESH A;  4B8X A;  2LKP A;  2Y75 A;  4MHG A;  2OA4 A;  2RQP A;  2NNY A;  2O6G E;  1SFU A;  3M9A A;  1MJA A;  1K6O A;  1TQM A;  5LHI A;  1YFH A;  4OIN F;  4WX9 A;  3D0S A;  5IT3 A;  3WGI A;  3P7N A;  3GYH X;  3JTG A;  4EM2 A;  3KE2 A;  4LG0 B;  1UST A;  3FXQ A;  5FFX A;  2V1D A;  3VOE A;  4L9V A;  2GA2 A;  4ETS A;  3E6D A;  1BOA A;  3DXJ F;  4WWC A;  4XSX F;  5HS9 A;  1ONV A;  4G8X A;  2P7V B;  5A2Q K;  3WG9 A;  5ILS A;  5K5Q A;  1D8K A;  3GFL A;  3DKW A;  1D3Y A;  3O2P E;  2GXB A;  1ZGA A;  5D6F A;  5LGT A;  5HDN A;  2GXG A;  2H6C A;  5E17 F;  5CVV A;  5JHU A;  4M6Y A;  1KU2 A;  2ESN A;  4Q48 A;  4BHP A;  1RZ4 A;  2EFQ A;  1DDN A;  2W57 A;  3GZ5 A;  5D5V B;  2GQQ A;  2HDC A;  4RGR A;  4L9T A;  2UWM A;  2HGC A;  4RB3 C;  4YII A;  2GIV A;  5HVQ C;  3KET A;  1USS A;  4HBL A;  3HTS B;  2FOK A;  1ZLJ A;  4L18 B;  3WGH A;  4CGZ A;  2V9V A;  1HKS A;  2HR3 A;  1U3E M;  1S7O A;  1YYV A;  1F5T A;  5LBQ A;  3ZMS A;  1UHW A;  3NEU A;  1P6R A;  1Z9C A;  2PMU A;  2G7U A;  2DAO A;  4BHB A;  4CDG A;  3WTY C;  3WE2 A;  3O6B B;  2XAG A;  3E5X A;  4K2E A;  1ZG5 A;  5DV5 A;  2K4J A;  5ICC A;  1KU9 A;  4LB5 A;  2XAJ A;  1HKQ A;  1O3R A;  2ZKZ A;  2JPB A;  1I5Z A;  4UV8 A;  3GF2 A;  4I7H A;  1WSU A;  1STZ A;  3SFZ A;  2W84 A;  2DPD A;  2FBI A;  2JRT A;  5ILU A;  2CW0 F;  1XB4 A;  1KYW A;  2PMH A;  1OYI A;  5TJJ A;  3OOP A;  1JGS A;  2HTS A;  2A6H F;  4KYW A;  1XGS A;  4XSZ F;  3GLX A;  3FXR A;  3EYI A;  1HXD A;  4A12 A;  3U9G A;  3V7C A;  1SMT A;  4O6J A;  5DCF A;  4RGX A;  1JHF A;  2OBP A;  5ICF A;  2WV0 A;  3WTW C;  1MZB A;  4HV5 A;  2HYF A;  4O3M A;  3BJO A;  2LSO A;  5J8F A;  5CVU A;  1E2X A;  2P7C B;  4Q4Z F;  5L3G A;  1R36 A;  1KQ9 A;  5ILV A;  2A07 F;  4Q47 A;  2DK5 A;  2NS0 A;  4QLC U;  2Z9O A;  1RNL A;  4M9Z A;  2ZBK A;  1R1T A;  4BXU A;  1H9T A;  2KIF A;  2FRH A;  2E1C A;  2V1U A;  5ICE A;  1FYL A;  2LF7 A;  3RDI A;  2CQK A;  3ZN0 A;  1FX7 A;  5JFR A;  3ABT A;  3E3V A;  3H3Z A;  3V8L A;  5FB2 A;  4I2O A;  4FHT A;  1IAW A;  4R1H A;  3FHZ A;  3J81 Z;  2P5L C;  3BY6 A;  1R00 A;  3DF8 A;  1TLH B;  1WWX A;  4ZYG A;  2K02 A;  4RB2 C;  1FWZ A;  2OU2 A;  3CUQ B;  1FBQ A;  1ZYR F;  4EM1 A;  1HW5 A;  4HV6 A;  2Q0O A;  4EQQ A;  2MD5 A;  3RPQ A;  3T1B A;  5DUK A;  1GXQ A;  2A61 A;  5KK1 A;  2VC0 A;  4HQM A;  5F1R A;  1ZRC A;  3EQL F;  2NNN A;  1FBS A;  2GWR A;  3DQV C;  3IKV A;  2O3F A;  4G6D A;  4MTD A;  1ZRE A;  3ISP A;  3LAJ A;  4G7H F;  2KIM A;  1WRJ A;  1XDU A;  3CUQ C;  1PP8 F;  1B9M A;  1S3J A;  2QQ9 A;  4UXN A;  5LGN A;  4BAY A;  3KCC A;  3FMS A;  1ON2 A;  3B73 A;  1RIO H;  3TDZ C;  3LQQ A;  3RKX A;  3GW2 A;  4HLY A;  2J5P A;  3VFZ A;  2BEO A;  4JK1 X;  2MLG A;  3ZQ7 A;  5D4S A;  2ZNY A;  1LNW A;  4KIB A;  3C18 A;  2VBW A;  3K1N A;  4HX7 A;  1C0W A;  1B1B A;  3I4P A;  2J5O A;  3MAJ A;  4PGG A;  1ZAR A;  2XAQ A;  4KDP A;  2CWE A;  4XBF A;  3HRS A;  3KP7 A;  2VT2 A;  3V4G A;  3QU3 A;  1KA8 A;  2UXN A;  2QQB A;  1U5T A;  2LNB A;  2HQN A;  1W5T A;  1AWC A;  4WF2 A;  1K78 A;  4IRI A;  2XKP A;  5DD8 A;  5D5X B;  2VBZ A;  1LEA A;  2D2W A;  3M7G A;  1T98 A;  1IRG A;  2WC2 A;  2IA0 A;  3K69 A;  3K1P A;  1BIA A;  2FNP A;  5LEJ A;  4OIQ F;  2K4B A;  1XGO A;  2XKO A;  2JZY A;  3ZN1 A;  1J7K A;  4U0Y A;  4OIO F;  3HRT A;  3MFK A;  2VXZ A;  3FMQ A;  3ZMT A;  4WK8 F;  4PZJ A;  5E1W A;  5L3D A;  1R7J A;  4HX4 A;  4BNC A;  2AS5 F;  4LFU A;  2A68 F;  3HTU A;  3LAP A;  3LWF A;  2QVO A;  2K7L A;  4FX4 A;  1KGS A;  4L9J A;  4A2U A;  1F1Z A;  2FSW A;  4AIH A;  5ERI A;  4YFK F;  3RIR A;  4G9Y A;  4MQV A;  1YLF A;  4M74 A;  3GO5 A;  1HW2 A;  2PLY A;  5H20 A;  1J5Y A;  4ESJ A;  1A04 A;  4XRF A;  4IPA A;  2QLZ A;  5E20 A;  1SD6 A;  2ZCW A;  4CYD A;  5LHH A;  4PCQ A;  5A2Q Z;  4YFX F;  4Y17 A;  3N97 A;  1Q1H A;  4IHT A;  1HKT A;  4AWX B;  2MLK A;  2L54 A;  1EH8 A;  1XSV A;  2Z3Y A;  5LRS A;  1XDS A;  1O7F A;  2TDX A;  3K9T A;  2XIG A;  3RKW A;  3MQ0 A;  4L9N A;  2EWN A;  3TOB A;  1YIO A;  4RGS A;  4ZZL A;  2HOE A;  2IPQ X;  2V6C A;  2RKH A;  1W4M A;  3BDD A;  4IJA A;  1SFX A;  3LFK A;  1UCR A;  3R0A A;  2DK8 A;  3HUG A;  5JR3 A;  4DNC A;  2F5F A;  2FA5 A;  5LHG A;  2DI3 A;  3I58 A;  1OYY A;  2ISY A;  3HIF A;  2UXX A;  4AIJ A;  3FMR A;  3SZP A;  3C1D A;  2EFW A;  4ZH4 F;  1YW7 A;  4OU0 A;  3SXY A;  3CJN A;  3LA2 A;  5H6Q A;  1EV7 A;  4ENM A;  3IKT A;  1FSH A;  3LQR A;  3QRF F;  3WU0 A;  1OMI A;  3KLN A;  1ULY A;  3RTR A;  2IP2 A;  1CF7 A;  2HWV A;  4P96 A;  5LGU A;  3WE3 A;  3GFM A;  1PP7 U;  5HLH A;  1QBJ A;  1EH6 A;  3I54 A;  5DDG A;  3ZMV A;  1XMK A;  4Y13 A;  1T39 A;  5D6E A;  1GHC A;  3E6M A;  1V3F A;  2DO7 A;  1SD4 A;  1AOY A;  3QOP A;  1I1G A;  3WTT C;  3FWE A;  3NQO A;  5D8L B;  1Z7U A;  4LLN A;  3K0L A;  3R6S A;  1BJA A;  1K78 B;  2RN7 A;  4N9H A;  3BJA A;  2KJC A;  1RUN A;  4N0B A;  3R0J A;  5DCM B;  2HFH A;  5HOO A;  4BQA A;  1QPM A;  1DPU A;  4ENJ A;  3QAH A;  1H9G A;  1YO5 C;  2K27 A;  4GO1 A;  2VON A;  2VE9 A;  1FYM A;  3RI4 A;  3KP5 A;  5L3F A;  1W7P A;  1J2X A;  4P9U A;  2IT0 A;  4UVA A;  1IXS B;  1XN7 A;  2HYG D;  4IF4 A;  2CGP A;  2X4H A;  3HHH A;  4EGY A;  5FD5 A;  3TKY A;  1W5S A;  1FSE A;  1HSJ A;  2PG4 A;  5HLG A;  2IA2 A;  3TOA A;  2M1B A;  5DD4 A;  3WTX C;  5CVR A;  4LGW A;  1I27 A;  1D5V A;  1LJ9 A;  1P2F A;  1IZ1 A;  3ZMZ A;  5D5W B;  1BBY A;  2ZXJ A;  1YS6 A;  4OIR F;  5E1X A;  4UV9 A;  3L00 A;  4LMY A;  1MDM B;  3KP3 A;  2EJR A;  1IN6 A;  3JSO A;  4KT5 C;  4IVN A;  2FE3 A;  3F6V A;  3IWZ A;  3TGN A;  2ADU A;  1Z6R A;  3T8R A;  1FP2 A;  2CSO A;  3BZ6 A;  4HF0 A;  3I71 A;  1MD0 A;  3B02 A;  3ML6 A;  3F8N A;  4L0Z B;  2Z99 A;  3J80 K;  4M71 A;  4P55 A;  1DUX C;  4ZYE A;  2YU3 A;  1S29 A;  4S05 A;  2OZ6 A;  1JHH A;  2A6E F;  2HEO A;  2ZME B;  2F5C A;  3LST A;  3DFG A;  3PQK A;  4F7Z A;  3HSF A;  5JVT A;  1FYK A;  1HST A;  3I53 A;  3RYP A;  2GA1 A;  5DUI A;  2FML A;  3BWG A;  3MZY A;  1SFE A;  3F22 A;  5D4R A;  2XUB A;  4I09 A;  2H09 A;  4EVI A;  3ABU A;  4A5M A;  2STT A;  4ZYH A;  1KQ0 A;  2D45 A;  4HQE A;  2PI0 A;  1QZY A;  1P4X A;  1H0M A;  2Q2E A;  2D1H A;  2HS5 A;  4KIF A;  3DPL C;  1YW9 A;  5LLQ A;  2FXA A;  5BOX A;  2P5K A;  2G9W A;  2STW A;  1HW1 A;  2V1X A;  1R23 A;  3NRV A;  3F8C A;  5IT9 Z;  1ZN2 A;  2DTR A;  3BPV A;  4EJO A;  3QU6 A;  2FEZ A;  3RJP A;  2W25 A;  4CXF A;  1FOK A;  2BGC A;  3L9F A;  4IHS A;  1L3L A;  2ZFW A;  4M9S A;  2F5D A;  3PQJ A;  4KIG A;  3F72 A;  1T0F A;  5F6F A;  4HF2 A;  3I59 A;  2VBX A;  3ZMU A;  4UVC A;  1FNN A;  3DP7 A;  4U88 A;  3BPX A;  3REO A;  2PFB A;  3JAM K;  3GEZ A;  3CLO A;  4WXH A;  1FC3 A;  1R58 A;  4UVB A;  4I0B A;  2VOP A;  1U8R A;  1G3W A;  3GFJ A;  2XHK A;  1J75 A;  2VN2 A;  2R7D A;  4EJV A;  5FLX Z;  3Q9V A;  2CFX A;  4ASN A;  1FY7 A;  4TV7 A;  4AVP A;  1ZH5 A;  4KUM A;  2QM3 A;  3JW4 A;  1IN4 A;  1G4D A;  1ODD A;  4HAM A;  4EM0 B;  2L4A A;  4XLN F;  4EV0 A;  2ZO4 A;  1IUY A;  1TW2 A;  3G3Z A;  4EMS A;  3VOD A;  5E8G A;  3HOS A;  3CO6 C;  4M9X A;  3F21 A;  2H94 A;  2OAZ A;  1QZZ A;  4P5O A;  4LB6 B;  1FZP B;  3L7W A;  3T8T A;  2W85 A;  5DYM A;  2ELH A;  3WGG A;  1U6G A;  1QO0 D;  3HRU A;  1DPR A;  1V4R A;  2XAH A;  4M6X A;  2YX4 A;  1FP1 D;  2BE5 F;  4IRG A;  3ECH A;  4L5I A;  4NHJ A;  2HQR A;  2JSC A;  1Z1D A;  2YX7 A;  3F6O A;  5CVJ A;  1S8N A;  3HSE A;  3EUH A;  5IT9 K;  3L09 A;  1BI3 A;  3BJ6 A;  2EV0 A;  2A5Y B;  3WTZ A;  3H3U A;  1KYZ A;  4LG0 A;  3H92 A;  1F9N A;  2P5V A;  2IVM A;  5DEQ A;  1JXS A;  1S7A A;  1TBX A;  5D8K B;  3KP4 A;  2G7H A;  1P4W A;  2FU4 A;  2Z5U A;  2XAF A;  5KVR A;  3FXU A;  3IC7 A;  2ZNZ A;  4HX8 A;  2VC1 A;  5CYV A;  2DU9 A;  4OMZ A;  5BPI A;  2M8E A;  2DPU A;  1T2K A;  4WCG A;  3GXO A;  2BBY A;  2P8T A;  3TO7 A;  4RAZ A;  4U7D A;  5FLX K;  4A6D A;  3HRM A;  4KNY A;  3G73 A;  2LF8 A;  4HDV A;  2EK5 A;  1XCB A;  5LRR A;  1FT9 A;  1BC8 C;  2EA4 A;  5TRD A;  2MH2 A;  1PUE E;  4R79 A;  2WWY A;  5L3B A;  3ROU A;  4EJW A;  1IRF A;  4ESF A;  1LDD A;  4NB5 A;  1BC7 C;  2EFP A;  5E18 F;  3F8F A;  5L3C A;  3QP6 A;  1EH7 A;  3EDP A;  2OQR A;  2MC3 A;  4HW0 A;  1S6L A;  3WOD F;  4KIC A;  3EYY A;  2A69 F;  2GAU A;  2B0L A;  2P6S A;  1XSX A;  5HDK A;  1R1V A;  5AON A;  3W6K B;  2XRN A;  1KU7 A;  3HSR A;  1Z91 A;  1J0R A;  3K1M A;  1RI7 A;  1IW7 F;  3KLO A;  4AD9 A;  3KZZ A;  3DV8 A;  5K1Y A;  4HOB A;  2R3S A;  3KZY A;  4IXA A;  2BYV E;  3KEQ A;  1XD7 A;  5L3E A;  4MEY F;  3JSP A;  1JE8 A;  3TO9 A;  2C6Y A;  5FGM A;  4ESB A;  2Z33 A;  4HDU A;  2NRA C;  2XGX A;  3T5X A;  2O8X A;  3QP5 A;  5LEK A;  4FT8 A;  1YQA A;  2COM A;  4OIP F;  1I1S A;  4I01 A;  4U7B A;  4D0P A;  2PJP A;  4I98 B;  1MJ9 A;  2VOO A;  2HTJ A;  3FZV A;  3ZPL A;  1J59 A;  2RV8 A;  2M5W A;  4O5V A;  4LK0 F;  4JQF A;  3FM3 A;  2RDP A;  1ZLK A;  3F8M A;  2QUF A;  2HKO A;  3J80 Z;  2H27 A;  3ECO A;  3E6B A;  2D1V A;  2VBY A;  1LEB A;  3CUO A;  3MWM A;  2Q8K A;  5HDG A;  1BI1 A;  2E7W A;  2CO5 A;  3C3W A;  4KA4 A;  1FBU A;  1LVA A;  1LB2 A;  2WTE A;  3LA3 A;  2PN6 A;  4R8H A;  1TW3 A;  1B9N A;  4JBA A;  2QEN A;  2Y0M A;  3Q9S A;  5K5O A;  1U5T B;  4AIK A;  3MEX A;  4S04 A;  3GWZ A;  1O7L A;  4XLP F;  1B6A A;  2VE8 A;  4KN7 X;  4LK1 F;  2EFO A;  4M72 A;  3CUQ A;  4MEX F;  1IN8 A;  1D8J A;  2IA1 A;  3SQN A;  4WXC A;  4MTE A;  1IF1 A;  4EJU A;  1TQI A;  2EB7 A;  3F3X A;  3TQN A;  4WXD A;  1P92 A;  4GGG A;  4EGZ A;  4RB1 A;  1CGP A;  4UNO A;  4QWQ A;  2DLL A;  3FM5 A;  5FFZ A;  2KIU A;  3TO6 A;  2Y48 A;  1U5T C;  1UB9 A;  3P9C A;  2E1N A;  1OPC A;  5BS6 A;  3GFI A;  1BN5 A;  1G6N A;  5HS8 A;  2CG4 A;  5BQT A;  1K7A A;  3E5Q A;  4L0Y B;  3IHU A;  5FD6 A;  1T6S A;  4YFN F;  1SD7 A;  1OKR A;  2QBY A;  2XRO A;  4I02 A;  1TNS A;  3E5U A;  4CHU A;  3BP8 A;  1SMY F;  1WI9 A;  5AIP A;  3RKY A;  2E7X A;  4HF1 A;  4RB0 A;  3ELK A;  4UUV A;  2ETH A;  3FF5 A;  3TDU C;  1R5G A;  5J6X A;  1B4A A;  1GVJ A;  2YSR A;  4GYI A;  5CVI A;  2OQG A;  3KP2 A;  3JAM Z;  3J7A O;  1L0O C;  6PAX A;  4B09 A;  2YPR A;  4G7O F;  2EFN A;  2QQA A;  2L02 A;  4E70 A;  2VOD A;  2PBI A;  3P9I A;  3M8E A;  3HHG A;  4A0Z A;  1FLI A;  5H6R A;  4LD5 A;  3LA7 A;  5BPD A;  5F64 A;  2QYO A;  1R5H A;  2ACJ A;  2K86 A;  2FNA A;  1I6X A;  4LLL A;  1P4A A;  3IRQ A;  4KFC A;  3D5L A;  4DQ2 A;  3C7J A;  2FQ3 A;  1OR7 A;  4NQW A;  3DEU A;  1SAX A;  2DQR A;  4H0E A;  4A0Y A;  1TNT A;  4CIC A;  2RC4 A;  1IXR C;  2FBH A;  2JPC A;  1PDN C;  4LLG F;  1BI2 A;  3BOQ A;  3T0Y A;  3ZMD A;  3O3K A;  4CZZ A;  2IJL A;  5J8C A;  2O03 A;  4HYE A;  1ZGJ A;  4KMU X;  1BI0 A;  1CF7 B;  2ZJ2 A;  4HLX A;  1HBX G;  1Z6T A;  1OYW A;  3KP6 A;  3N4M A;  3F8B A;  1LDK B;  4RS8 A;  1MJB A;  1G3Y A;  1U78 A;  3E6C C;  1WQ2 A;  1QQI A;  2F2E A;  3Q5F A;  3I64 A;  4ZYD A;  2XV4 S;  5E8I A;  2H6B A;  3MCZ A;  4ZZD A;  2O61 A;  4GCV A;  4UHT A;  3GX4 X;  2P6T A;  2HKX A;  4U0W A;  5AIQ A;  3EET A;  2RVC A;  3M8F A;  3OV8 A;  1ZG1 A;  3V8J A;  2OD5 A;  3U1D A;  3RYR A;  4I0A A;  1T38 A;  1UHM A;  1ZHF A;  2KKO A;  1QNT A;  1NHA A;  1Z05 A;  2OZU A;  4ENK A;  1W7P B; 
#chains in the Genus database with same CATH topology
 3CCY A;  1YS7 A;  2M9H A;  1MMD A;  2V9P A;  5CJ9 A;  3ZP5 A;  4W1U A;  1XTA A;  3GUD A;  2KJB A;  2O5R A;  1XGN A;  3U2R A;  1Z3X A;  3IUO A;  2XVC A;  2FBK A;  4MGR A;  3BZC A;  2X85 A;  4BH9 A;  2FOW A;  1XMA A;  4G6T B;  5ED4 A;  3ZRG A;  4F52 A;  4IQ4 A;  2QBY B;  3HOT A;  2R4G A;  2JTV A;  2B63 J;  2M30 A;  2W24 A;  4I6Z A;  3ZQI A;  4UUS A;  4A3J J;  2UV1 A;  4KJZ A;  1QU3 A;  2M87 A;  3I55 I;  2V79 A;  2X6O A;  4II3 A;  5BMZ A;  1LQ1 A;  1R1U A;  1XGM A;  2VKH A;  3ERM A;  1FPQ A;  2XGE A;  1R22 A;  3I0T A;  1YI2 I;  1DQU A;  2GZW A;  3QPT A;  2XGD A;  1B59 A;  1FOX A;  1SD5 A;  1PUF A;  5E1Z B;  2HDD A;  4CH7 A;  3I5U A;  4IOA F;  2ICW G;  2FMY A;  3W6J B;  1X1A A;  1BA5 A;  1JTY A;  3P5J A;  3H3V K;  1O57 A;  3QPH A;  2CYY A;  4RGU A;  4U0V A;  2KLO A;  3FIS A;  3NWT A;  2R7T A;  1JTX A;  2K3F A;  4IKF A;  4FTH A;  5EEH A;  2EA2 A;  3Q0W A;  4XNF A;  1IJW C;  4NDL A;  5IP7 J;  2XC7 A;  4OMY A;  3PSF A;  1FTT A;  4XON A;  2BOL A;  1QRY A;  3D1N I;  1G3S A;  1OCO H;  1TTY A;  5JHF A;  1TQP A;  2K9N A;  1KQ8 A;  3BRO A;  2E34 A;  4YIR X;  3OYN A;  1TWG J;  2RNJ A;  4E7L A;  4Z2Y A;  4KMF A;  1J9I A;  5B1B H;  1ZG3 A;  1YW8 A;  3PFI A;  2ZJP F;  2Z16 A;  5K5R A;  1V54 H;  3VYT B;  1XSD A;  2CUF A;  3HOV J;  2E2H J;  4ENN A;  3CO7 C;  4YG2 F;  3PM1 A;  3ULQ B;  2JWT A;  5HS7 A;  1HOM A;  1BM9 A;  3WTS C;  3GZ6 A;  1ON1 A;  5F1J A;  1WHU A;  3M3Y J;  1QVT A;  2BHY A;  4ZC3 A;  1BW5 A;  1DP7 P;  4LJZ F;  3V7S A;  2LD5 A;  1O3Q A;  2A3S A;  2DQL A;  1HA8 A;  4CCJ A;  5JI6 A;  3R61 A;  1MKM A;  2KRF A;  4B47 A;  3CMY A;  1Y1W J;  1B8I B;  2Y30 A;  2NAZ A;  2W00 A;  1AHD P;  2L3D A;  3CDH A;  1B72 A;  3E97 A;  1M1E B;  1KU3 A;  1QGP A;  1X1C A;  1Y0U A;  5EEG A;  1ZRD A;  2YR2 A;  1XCV A;  3GVA A;  2F4O B;  3FK7 A;  5DCM A;  3J81 K;  3DPT A;  3V8K A;  3M1E A;  2HVQ A;  1D1C A;  1RET A;  2QWW A;  3S2W A;  5FKO A;  4A6E A;  4PDK A;  2L01 A;  4CCO A;  3ZOB A;  2XDV A;  3ERE D;  2FQ4 A;  2RGV A;  3OYA A;  2CH0 A;  2EV5 A;  3SYT A;  5HLT A;  2DA3 A;  3RCO A;  4Q5S F;  3CJQ B;  1GV2 A;  3AAF A;  2L7Z A;  2WAD A;  2Q2E B;  2X0L A;  1W7P D;  4RM3 A;  1G59 A;  3A2K A;  3VEP A;  3MZH A;  4ZTJ A;  3BC8 A;  2O9L A;  3J7A Y;  2V4J C;  2ZJR F;  4KN4 X;  2HDW A;  3KYL A;  1E17 A;  1ENH A;  5ICG A;  4N9I A;  3F23 A;  2TCT A;  3IWF A;  2MA3 A;  4BE1 A;  2X6X A;  2R7X A;  2CQ7 A;  3WU1 B;  2FF4 A;  3KFW X;  3R60 A;  2R7F A;  2WAQ N;  4B3A A;  4L5J A;  5B5E C;  3WTU C;  3OYK A;  3K2Z A;  3A1Y A;  1HQC A;  1TWF J;  1VQ5 I;  2XAS A;  5FLM J;  3S17 J;  4Y15 A;  2IS2 A;  2JA7 J;  4IRH A;  1O4X A;  2CV2 A;  1GUU A;  3IL2 A;  3ZCO A;  4MNU A;  2PQ8 A;  5C4X J;  3MMY B;  3OYG A;  1R5I D;  4DW6 A;  1ETY A;  1WFX A;  1WJF A;  2XF7 A;  1BR4 A;  4CO8 A;  1MBE A;  2PEX A;  3LFU A;  5F0H A;  3IRR A;  3SZT A;  2O8K A;  4BE0 A;  1F4K A;  2QZ8 A;  4XLA A;  2IRF G;  2D5V A;  1JUM A;  2HZD A;  2R5Y A;  1H89 C;  4YIF A;  1LDJ A;  5HLI A;  5M5Y J;  1IXC A;  4W97 A;  5M3M J;  1LFP A;  2BV6 A;  2DFI A;  2L4M A;  1S9H A;  2DN0 A;  2ISZ A;  2MBF A;  1RUO A;  3M4O J;  1MDM A;  1MGT A;  2AHQ A;  4XR6 A;  3FXJ A;  2DT5 A;  2AXL A;  2DFF A;  3S93 A;  3I59 B;  1UFM A;  2R5Z A;  4DYQ A;  2ZFU A;  5FO5 A;  3W2V A;  2CW8 A;  1U9O A;  1JT6 A;  4A5N A;  2XSJ C;  2LFB A;  3BR0 A;  1ZRF A;  2XSD C;  3GTQ J;  4RAY A;  4Z6Y A;  4EJT A;  4A93 J;  2GOX B;  2JK3 A;  4G94 A;  4A0X A;  2RQQ A;  3K70 C;  2MYS A;  4GXO A;  4X6A J;  3ZQF A;  2QKL B;  1A31 A;  2EV6 A;  2M45 A;  4F91 B;  2UZK A;  4OOI A;  3DKX A;  3BLY A;  4CYC B;  1MMA A;  2P4W A;  2LG4 A;  3H5A A;  3CJR B;  1FIA A;  1IN5 A;  3FBN B;  2AXT C;  2DBB A;  2MH9 A;  3HXL A;  2HZT A;  2ZME A;  1T56 A;  4E7J A;  4BDY A;  2JT1 A;  4DJA A;  1ETK A;  2L7M P;  1VTN C;  4UY8 I;  1WZ2 A;  4MQ9 F;  1IDZ A;  1P7I A;  1T0F C;  3C2H A;  4GYG A;  3RKQ A;  3L2C A;  5CLS A;  1IN7 A;  3V7R A;  4G7Z F;  3CCQ I;  1BL0 A;  2OC6 A;  2MGQ A;  1GXP A;  3HOU J;  4G6Q A;  4C3I J;  3JTH A;  1K79 A;  2M3A A;  2VAS A;  2IW5 A;  1BIB A;  4ON0 A;  2HOS A;  4BE2 A;  3KEO A;  1G3T A;  1WKM A;  2R7R A;  1YTY A;  2NYX A;  3S1Q J;  1U2W A;  4PGH A;  3HYI A;  2DW4 A;  1X3U A;  3H36 A;  4HA8 A;  2O0Y A;  3OYH A;  3GZN B;  3S2H J;  4FX0 A;  3QWL A;  3COA C;  4P9F A;  2OCE A;  4M73 A;  2LDU A;  3CTA A;  3WHC A;  3TW6 A;  1IV8 A;  4BHC A;  4BYY A;  1DU6 A;  1ZK8 A;  2VT3 A;  3P9K A;  3A4C A;  3RQI A;  5D5U B;  1GLN A;  3FX3 A;  1OCP A;  4HZF A;  3SHF A;  1AA7 A;  1O3S A;  3FHN A;  1ZAO A;  3RPU A;  2R93 J;  1I3Q J;  3K4B A;  1BR1 A;  1TWA J;  3PL8 A;  3R4K A;  1IRX A;  2F5E A;  3VB2 A;  3WTV C;  1QA6 A;  1YG2 A;  2V6E A;  1O3T A;  3PNT A;  1REP C;  2F5V A;  1Y56 A;  1F43 A;  2ESH A;  4B8X A;  2LKP A;  2Y75 A;  4MHG A;  2OA4 A;  4LIT A;  2RQP A;  2NNY A;  2O6G E;  1SFU A;  3M9A A;  1MJA A;  1TT5 B;  2B7E A;  4B44 A;  1TQM A;  3VSK A;  5LHI A;  5EGO A;  4IX7 A;  1YFH A;  1K6O A;  3CC2 I;  4OIN F;  3CES A;  4WX9 A;  1W36 D;  3Q0U A;  2VQH A;  2VQG A;  3ZQL A;  3ONQ A;  3BR1 A;  3FKI J;  3D0S A;  2DDB A;  2M0M A;  5IT3 A;  3MN2 A;  2JA2 A;  4X0G A;  3WGI A;  4AYB A;  3P7N A;  2FJ1 A;  3GYH X;  1JJ8 C;  5E79 C;  3JTG A;  4EM2 A;  1VQ8 I;  3FIW A;  3L2U A;  3KE2 A;  1OQY A;  5K7H A;  4LG0 B;  2EBI A;  1UST A;  2CMP A;  2EH3 A;  3FXQ A;  2A6T A;  2DJN A;  2LRD A;  5FFX A;  2V1D A;  4D9J A;  3VOE A;  4L9V A;  4IHY A;  2KPM A;  2GA2 A;  4ETS A;  3E6D A;  1BOA A;  3DXJ F;  5C44 J;  3I4M J;  4WWC A;  2LKX A;  4XSX F;  1B72 B;  3HZJ A;  2KZG A;  5HS9 A;  1ONV A;  1VZ0 A;  4G8X A;  2P7V B;  4AVZ A;  1WI3 A;  5A2Q K;  3WG9 A;  5ILS A;  5K5Q A;  1D8K A;  3GFL A;  4IHV A;  4RMN A;  5GTH C;  4IQJ A;  3EUH C;  1T8I A;  1GVD A;  4XL9 A;  3DKW A;  1SAU A;  1SFK A;  2I5U A;  3Q3S A;  2EZK A;  1KON A;  1D3Y A;  5TIS C;  3O2P E;  4NNJ A;  1E3H A;  2GXB A;  5JLW A;  3VPR A;  5TGT A;  1ZGA A;  1T08 B;  3JRA A;  5H2F C;  5D6F A;  4ZDO A;  3KPH A;  2E1M B;  3CCE I;  5LGT A;  1S7E A;  5HDN A;  2GXG A;  2H6C A;  2X1D A;  4RAG A;  3OYF A;  5CVV A;  5JHU A;  5E17 F;  4M6Y A;  1KU2 A;  3FXO A;  2ESN A;  4Q48 A;  5GPC A;  3H9Q A;  1RZ4 A;  2K85 A;  4BHP A;  2EFQ A;  1DDN A;  1T95 A;  2W57 A;  3LSI A;  3GZ5 A;  2ZC2 A;  5D5V B;  4PJN A;  1QVU A;  2GQQ A;  3S32 A;  4XRS A;  2HDC A;  2V9K A;  4L9T A;  4RGR A;  3ZQQ A;  2UWM A;  2HGC A;  3H5R A;  1ZEL A;  1J09 A;  2XRL A;  4RB3 C;  4YII A;  2GIV A;  5HVQ C;  3KET A;  1ZQ3 P;  1USS A;  4CCM A;  4HBL A;  2PJR B;  3DEE A;  2F48 A;  3HTS B;  2VI6 A;  2FOK A;  1ZLJ A;  4L18 B;  3WGH A;  4CGZ A;  2DMT A;  5EG0 A;  2V9V A;  1HKS A;  5C4J J;  3CCU I;  4JX4 A;  2VPR A;  1MBH A;  3HOX J;  2PMZ A;  2HR3 A;  1U3E M;  2E1M C;  2Y9Y A;  4DGW B;  1S7O A;  1X4P A;  3FK6 A;  1YYV A;  3LSR A;  1F5T A;  9ANT A;  2IGM A;  1WJA A;  5LBQ A;  2R7S A;  4RAF A;  3OS2 A;  3UR3 C;  1UHW A;  3ZMS A;  2VLA A;  3CC7 I;  2WA0 A;  4LIV A;  3NEU A;  1FOY A;  1P6R A;  1Z9C A;  2PMU A;  3BR5 A;  1KZH A;  3JRD A;  5KAF C;  4HNV A;  1JKO C;  1DGW Y;  2G7U A;  3ZQC A;  2DAO A;  4BHB A;  4CDG A;  3WTY C;  1I50 J;  2WB1 A;  2DDA A;  5FKM A;  3WE2 A;  3O6B B;  3IH2 A;  2XAG A;  3E5X A;  3PIP F;  1LE8 B;  4K2E A;  4DBR A;  2DMP A;  1ZG5 A;  3ABL H;  2R0Q C;  2V26 A;  1KU9 A;  2K4J A;  5DV5 A;  1MH3 A;  5ICC A;  2EIM H;  4LB5 A;  2XAJ A;  1GV5 A;  1HKQ A;  5CKT A;  4HNT A;  1O3R A;  1TC3 C;  2ZKZ A;  5EF6 A;  2JPB A;  2QEX I;  1WCM J;  3U1K A;  1Y39 A;  1I5Z A;  4UV8 A;  3GF2 A;  4I7H A;  1WSU A;  1STZ A;  3SFZ A;  2W84 A;  2DPD A;  2FBI A;  2JRT A;  4PSW A;  1IO2 A;  2CW0 F;  1XB4 A;  5ILU A;  4KIS A;  3D5R C;  1WJD A;  1KYW A;  4DBQ A;  2PMH A;  5BNG A;  1OYI A;  3LSM A;  5DM6 F;  1QPI A;  5TJJ A;  3I3L A;  3OOP A;  2QSG X;  1JGS A;  2HTS A;  2A6H F;  2VKE A;  4KYW A;  3FKJ A;  1XGS A;  4F55 A;  4XSZ F;  2EZH A;  3GLX A;  3G1O A;  3BG7 A;  3KIO A;  3FXR A;  2NS7 A;  2DA5 A;  1YJ9 I;  3EYI A;  1HXD A;  1NG6 A;  4A12 A;  4A3B J;  5KCM A;  2Y0S A;  2NOJ B;  3U9G A;  3V7C A;  4HPQ A;  1MMN A;  2KDZ A;  1SMT A;  4O6J A;  5DCF A;  4NBQ A;  3H35 A;  4RGX A;  4B48 A;  2H8W A;  1JHF A;  2OBP A;  2BY0 A;  5ICF A;  1JUP A;  2VB6 A;  2WV0 A;  1I39 A;  3K4J A;  1MZB A;  3WTW C;  4HV5 A;  2HYF A;  2ID3 A;  3GTP J;  4O3M A;  1VQ4 I;  3BJO A;  1POG A;  2LSO A;  4U87 A;  5J8F A;  5CVU A;  1E2X A;  1K6Y A;  1ZR4 A;  4Q4Z F;  4N4O B;  2P7C B;  5L3G A;  3E1S A;  1PJR A;  4PK4 A;  2VPL A;  1A6I A;  1I6H J;  1R36 A;  1KQ9 A;  5ILV A;  3CCJ I;  3RQ4 A;  3BG9 A;  4Q47 A;  4E6K G;  3OSF A;  2DK5 A;  2A07 F;  2NS0 A;  4QLC U;  2Z9O A;  2XF5 A;  2KDO A;  3NAU A;  3UKG A;  1RNL A;  4M9Z A;  2BW3 B;  2ZBK A;  1R1T A;  4BXU A;  1H9T A;  2KT0 A;  3CCL I;  2KIF A;  2FRH A;  2E1C A;  2VJ5 A;  2V1U A;  1IC8 A;  5EGO B;  5ICE A;  3CD6 I;  1Z7L A;  1FYL A;  2LF7 A;  3RDI A;  3A0H C;  2CQK A;  3ZN0 A;  1FX7 A;  5B1A H;  5KAI C;  1MH4 A;  5JFR A;  4JX6 A;  3ABT A;  2R92 J;  2LY2 A;  3E3V A;  5IOZ A;  3H3Z A;  3V8L A;  5FB2 A;  2CS3 A;  5EZG A;  1WJC A;  3H0D A;  4FHT A;  4I2O A;  2KIS A;  1IAW A;  4R1H A;  3FHZ A;  3J81 Z;  1IDY A;  2P5L C;  4EAT A;  3BY6 A;  2ZXW H;  3PFY A;  1R00 A;  3DF8 A;  2WY8 Q;  3GTM J;  1ETQ A;  4MFD A;  3LOC A;  2FX0 A;  1TLH B;  1WWX A;  1VI0 A;  4E7H A;  5CQE A;  4ZYG A;  2K02 A;  3OR1 C;  2ELK A;  3HC7 A;  4RB2 C;  1NTC A;  4C2U A;  1FWZ A;  2OU2 A;  3CUQ B;  3PSI A;  4Y33 A;  1FBQ A;  1ZYR F;  1U0J A;  4EM1 A;  1HW5 A;  3OIO A;  4HV6 A;  2Q0O A;  2L9R A;  4EQQ A;  2COB A;  2MD5 A;  2TRT A;  3RPQ A;  3T1B A;  5DUK A;  2K9Q A;  1GXQ A;  2A61 A;  3CDI A;  5KK1 A;  2VC0 A;  3AL0 B;  4HQM A;  5F1R A;  1TWH J;  4XLE A;  1ZRC A;  5E3O A;  3EQL F;  2NNN A;  1ACI A;  5F08 A;  1FBS A;  2QQ8 A;  2GWR A;  3DQV C;  3IKV A;  1FTZ A;  2L9V A;  1LFB A;  1PYV A;  1HDD C;  2O3F A;  2EIL H;  4G6D A;  3CP2 A;  2HXO A;  4OAZ A;  4MTD A;  1ZRE A;  3ISP A;  4CUG A;  1V5F A;  3LAJ A;  1G2H A;  4G7H F;  2KIM A;  2CV1 A;  1WRJ A;  1OCZ H;  3H9J A;  3HKZ A;  1AKH B;  3GTJ J;  2NVQ J;  1RRJ A;  1XDU A;  3CUQ C;  1PP8 F;  3DWL E;  1B9M A;  4A3G J;  4V2G A;  1S3J A;  1G8X A;  2VIX A;  1WJE A;  2DT7 B;  2VXD A;  2ME6 A;  3CC4 I;  3AL0 C;  2QQ9 A;  1P7J A;  3ZQH A;  4UXN A;  4DYR A;  5LGN A;  4IO9 F;  4BAY A;  3KCC A;  3FMS A;  2CV0 A;  1ON2 A;  3B73 A;  3G6E I;  3ZQG A;  1RIO H;  3PO3 J;  1V55 H;  1VQN I;  1RR8 C;  5GAE J;  5CQG A;  4BY1 J;  3C2G A;  3TDZ C;  3LQQ A;  4BQO A;  4YEL A;  1D1A A;  4LOC A;  3RKX A;  3DTE A;  3GW2 A;  4HLY A;  2J5P A;  3QYB A;  2BEO A;  3VFZ A;  4JK1 X;  3RPU D;  4M3G A;  2MLG A;  3BCA A;  3ZQ7 A;  5D4S A;  2ZNY A;  1ORK A;  2KMU A;  1LNW A;  3OYI A;  2LP0 A;  2X9D A;  4KIB A;  2M8G X;  3C18 A;  2VBW A;  3K1N A;  3K2A A;  4HX7 A;  1C0W A;  1B1B A;  5JVG F;  4C2T A;  3I4P A;  4FE7 A;  3U21 A;  2J5O A;  3MAJ A;  4PGG A;  2VJI A;  1N75 A;  1ZAR A;  2XAQ A;  4KDP A;  2CWE A;  4XBF A;  1LUJ B;  4AYB N;  4C30 A;  2DOF A;  3M1C A;  3HRS A;  2QKM B;  3KP7 A;  2VT2 A;  5FKK A;  3K10 A;  1D1B A;  3V4G A;  5J1R A;  3QU3 A;  1KA8 A;  2UXN A;  2QQB A;  1U5T A;  4BGD A;  2LNB A;  3W2W A;  2HQN A;  2QGU A;  1W5T A;  2DA7 A;  3Q0V A;  5GP9 A;  4D5F A;  1AWC A;  3CCS I;  3BR6 A;  4WF2 A;  5K7F A;  1K78 A;  3QQA A;  1HF0 A;  4IRI A;  4RM2 A;  2XKP A;  5DD8 A;  5D5X B;  2VBZ A;  4NQW B;  1LEA A;  3PIO F;  2D2W A;  4BEH A;  4D1Q A;  3M7G A;  1T98 A;  1IRG A;  2OF7 A;  2WC2 A;  2IA0 A;  3K69 A;  4QSH A;  2EIK H;  3K1P A;  1APL C;  1BIA A;  2FNP A;  5LEJ A;  4OIQ F;  2K4B A;  1XGO A;  2XKO A;  1A6Q A;  2JZY A;  3ZN1 A;  1K61 A;  4XKV A;  1J7K A;  4U0Y A;  4OIO F;  3HRT A;  3MFK A;  2DYS H;  3VSL A;  2VXZ A;  3FMQ A;  2R7W A;  3HOY J;  2X6W A;  2CUZ A;  3AKZ A;  3ZMT A;  1H8A C;  4WK8 F;  4PZJ A;  5E1W A;  5L3D A;  5M3F J;  3A01 B;  4YRV A;  1Y6I A;  1R7J A;  4HX4 A;  4BJ6 C;  4BNC A;  2E5Z A;  2AS5 F;  4LFU A;  2A68 F;  2ECB A;  1ZKG A;  1OR7 C;  4XN0 A;  4BXF A;  2CJJ A;  1ZR2 A;  1S72 I;  1YRN B;  3HTU A;  3LAP A;  3LWF A;  2QVO A;  2K7L A;  2E2J J;  4FX4 A;  1KGS A;  3AG1 H;  2RRE A;  1TWC J;  3LMM A;  4L9J A;  4A2U A;  2OTJ I;  1YIT I;  1F1Z A;  5J1Y A;  2FSW A;  1DU0 A;  4AIH A;  5ERI A;  2L7K A;  2L7F P;  2HPI A;  4YFK F;  2IS1 A;  3RIR A;  4G9Y A;  4MQV A;  1YLF A;  4M74 A;  3GO5 A;  2E19 A;  1HW2 A;  4V2F A;  4C3J J;  2LBF B;  5EEA A;  1SEU A;  5H20 A;  2PLY A;  1J5Y A;  4Y4R A;  4M3D A;  4ESJ A;  3CLQ A;  1A04 A;  2PMZ N;  4XRF A;  4IPA A;  2QLZ A;  5E20 A;  4RLQ A;  1SD6 A;  2ZCW A;  1X3W B;  1JKR C;  5FKN A;  4CYD A;  5LHH A;  1AU7 A;  4PSX A;  3GME A;  4PCQ A;  5A2Q Z;  4YFX F;  1JI8 A;  4Y17 A;  3DBH B;  1K4T A;  3N97 A;  1W36 C;  2DA1 A;  5IYD J;  1Q1H A;  3PUF A;  4IHT A;  1HKT A;  4AWX B;  3LSG A;  2MLK A;  1A35 A;  2FD5 A;  1LVK A;  1V5G A;  2L54 A;  4Y52 J;  1EH8 A;  4G12 A;  4FAS D;  3V42 A;  4BJT A;  1XSV A;  2Z3Y A;  5LRS A;  1XDS A;  4DIQ A;  1O7F A;  2TDX A;  3PNV A;  3H1C A;  2JN6 A;  3K9T A;  2XIG A;  1Z77 A;  4AM3 A;  2WB1 N;  3RKW A;  4BJ5 C;  3MQ0 A;  5C3E J;  1IG7 A;  5EJC A;  2ID6 A;  3S3M A;  2XPU A;  4L9N A;  2E35 A;  2EWN A;  3UNG C;  2OV7 A;  3TOB A;  1D5Y A;  3WU2 C;  1YIO A;  4RGS A;  1UEL B;  3OMY A;  4ZZL A;  2HOE A;  3GTL J;  2IPQ X;  2V6C A;  2IGN A;  2OCC H;  2RKH A;  1W4M A;  3BDD A;  4XKC A;  3TL4 X;  4IJA A;  1SFX A;  2FUG 2;  2L9N A;  5B3S H;  3LFK A;  1T33 A;  1ITY A;  1UCR A;  3R0A A;  2DK8 A;  1XX5 A;  3HUG A;  1Y0N A;  2E71 A;  3M07 A;  5JR3 A;  1R9T J;  2E2I J;  2W1O A;  3X2Q H;  4DNC A;  1Z67 A;  4B4C A;  2F5F A;  2FA5 A;  4MFE A;  4IHX A;  5LHG A;  2DI3 A;  2WY7 Q;  2NXN B;  3WG7 H;  4UUS B;  3I58 A;  4UB6 C;  3ZXS A;  3IAS 2;  1OYY A;  2HQA A;  3SFI A;  2F6C A;  3HDD A;  2ISY A;  3HIF A;  4NC7 A;  2Y0S N;  2UXX A;  4AIJ A;  3FMR A;  4BY7 J;  3SZP A;  3C1D A;  2EFW A;  4ZH4 F;  1BR2 A;  1YW7 A;  4PFO A;  4OU0 A;  1PUF B;  3SXY A;  4BXX J;  3SZG A;  3CJN A;  3LA2 A;  4XLH A;  5H6Q A;  3IAM 2;  1EV7 A;  1Y1V J;  4ENM A;  3IKT A;  1IRZ A;  1FSH A;  3LQR A;  4XLF A;  3K4K A;  3RZO J;  4Y3O A;  3QRF F;  4MO7 A;  3WU0 A;  1OMI A;  4D7M A;  2M7B A;  3KLN A;  1ULY A;  1EJ9 A;  3RTR A;  3TW7 A;  2QSH X;  3MVP A;  2BY3 A;  2YS9 A;  1OCR H;  2IP2 A;  3IP4 B;  1CF7 A;  2HWV A;  4P96 A;  4BQQ A;  1NK2 P;  4XOT A;  5LGU A;  3WE3 A;  3GFM A;  1PP7 U;  4BBR J;  5HLH A;  3GLL A;  1QBJ A;  1EH6 A;  4XMY A;  3HB9 A;  2HU9 A;  3I54 A;  3CCV I;  4A69 C;  5DDG A;  3SJM A;  1MSF C;  3ZMV A;  1XMK A;  4Y13 A;  1T39 A;  2M7A A;  5D6E A;  1GHC A;  1YHQ I;  3E6M A;  1V3F A;  2DO7 A;  1SD4 A;  4CSW A;  1AOY A;  4A3K J;  3SDB A;  1UG2 A;  1ETV A;  3TMO A;  3QOP A;  1I1G A;  3WTT C;  2GM4 A;  3FWE A;  5GAD J;  2A5W A;  3NQO A;  2HQ5 A;  2WBM A;  3DKY A;  4CCK A;  1MMS A;  5D8L B;  1Z7U A;  4LLN A;  2OPT A;  3K0L A;  4DYC A;  2MSY A;  3R6S A;  4RDU A;  1BJA A;  2CQN A;  4IEJ A;  1K78 B;  1MNE A;  2RN7 A;  4S0H B;  3BTI A;  2JUC A;  4N9H A;  3S15 J;  3BJA A;  1LPQ A;  2KJC A;  4I99 C;  4B43 A;  5DS9 A;  1RUN A;  4XIC A;  4N0B A;  3DBR B;  3F9K A;  3R0J A;  5DCM B;  2HFH A;  5HOO A;  4BQA A;  2QA4 I;  2DA4 A;  1QPM A;  4A3C J;  1K4S A;  1DPU A;  3C2B A;  4ENJ A;  3QAH A;  1H9G A;  1YO5 C;  4F3Q A;  2K27 A;  4GO1 A;  2VON A;  3BTL A;  2VE9 A;  3S3O A;  4L5E A;  2XB5 A;  1FYM A;  3RI4 A;  3KP5 A;  1QZE A;  5L3F A;  1W7P A;  1Y8R B;  3JRI A;  3S14 J;  1J2X A;  1X19 A;  4P9U A;  3CZ6 A;  4C2M J;  2IT0 A;  1OJL A;  2VL8 A;  3HKZ N;  1IXS B;  4UVA A;  1XN7 A;  2HYG D;  1X3Z B;  4BL0 B;  2JJ7 A;  5IOY A;  4IF4 A;  2QSF X;  3I9V 2;  3M8J A;  2CGP A;  2X4H A;  1W0U A;  2R7Q A;  3HHH A;  5J1U A;  3DEW A;  5FD5 A;  3TKY A;  1W5S A;  4EGY A;  3K4M A;  1NK3 P;  1FSE A;  3GBG A;  5HNF A;  1HSJ A;  1Z21 A;  2PG4 A;  2JVG A;  3W6V A;  2Z1D A;  4M3F A;  5HLG A;  2IA2 A;  1N78 A;  4QPQ A;  1TZL A;  3TOA A;  2M1B A;  2XAU A;  2LMD A;  5DD4 A;  3WTX C;  4JOM A;  5CVR A;  5LFA A;  4LGW A;  2MC4 A;  1I27 A;  5JLX A;  2VJ4 A;  2K40 A;  3E7L A;  1D5V A;  1LJ9 A;  2R5Y B;  1P2F A;  1IZ1 A;  3ZMZ A;  4RA2 A;  5D5W B;  1BBY A;  2ZXJ A;  1WPK A;  2HI3 A;  2M34 A;  1YS6 A;  4OIR F;  5E1X A;  4UV9 A;  3L00 A;  4LMY A;  1MDM B;  3KP3 A;  2EJR A;  1IN6 A;  2EIN H;  3JSO A;  1IV6 A;  4KT5 C;  4IVN A;  4HEA 2;  2R5Z B;  2FE3 A;  3L2V A;  3F6V A;  3IWZ A;  3TGN A;  2ADU A;  3H0G J;  4ZTF A;  1Z6R A;  1YJN I;  4MIM A;  3T8R A;  1FP2 A;  2CSO A;  3OYL A;  3BR2 A;  3BZ6 A;  4HF0 A;  3K7A J;  3I71 A;  1MD0 A;  3B02 A;  2LKS A;  2VKD A;  3ML6 A;  3F8N A;  3G71 I;  4D5C A;  2BXY A;  4L0Z B;  2Z99 A;  3J80 K;  4M71 A;  4P55 A;  5CPR B;  4ZYE A;  1DUX C;  2LYC A;  2YU3 A;  1FOW A;  2KFD A;  1S29 A;  1BW6 A;  3BG3 A;  4S05 A;  2OZ6 A;  1JHH A;  2AQE A;  2A6E F;  3ZGK A;  2HEO A;  2E1O A;  2ZME B;  2Y2Z A;  2F5C A;  3LST A;  2KHM A;  4HG2 A;  3DFG A;  3JR9 A;  3AFH A;  2IXS A;  3PQK A;  3HSF A;  4F7Z A;  3AG3 H;  5JVT A;  4RBO A;  3K4N A;  3SEQ A;  2LR8 A;  4CCL A;  1FYK A;  1HST A;  1B8I A;  3I53 A;  3ABK H;  2JQ7 A;  3RYP A;  2GA1 A;  1RC9 A;  5DUI A;  2WV1 A;  2KL4 A;  2FML A;  3BWG A;  4KIT B;  2X6Y A;  3MZY A;  3S16 J;  1QHG A;  1SFE A;  5IYB J;  3K6G A;  3F22 A;  5D4R A;  2XUB A;  3BT9 A;  2EZI A;  2P81 A;  4I09 A;  2H09 A;  4QPO A;  1XS9 A;  4EVI A;  1ETO A;  3ABU A;  4A5M A;  4V19 K;  2STT A;  2EQR A;  4ZYH A;  4Y7N J;  1KQ0 A;  1NH3 A;  2D45 A;  3LSJ A;  3QYF A;  3PO2 J;  4HQE A;  2ZME C;  2NVU B;  1IUF A;  1MIJ A;  1QZY A;  2PI0 A;  1P4X A;  3AG2 H;  3G4S I;  1XC5 A;  2JRM A;  1H0M A;  3S1N J;  4XOP A;  1HDP A;  4C3H J;  2IGK A;  2Q2E A;  2KQR A;  2D1H A;  2HS5 A;  3OYJ A;  4KIF A;  4OWR B;  1Z3Y A;  3CJT B;  4ZDP A;  2GXA A;  3DPL C;  1UAA A;  1YW9 A;  3OWT A;  5LLQ A;  2FXA A;  3K4C A;  2M0C A;  1XPX A;  1FMW A;  2ZXH A;  4M6V A;  2DA6 A;  5BOX A;  1EKE A;  2P5K A;  2G9W A;  2STW A;  1HW1 A;  2V1X A;  3VYR B;  1R23 A;  4A3D J;  3NRV A;  3F8C A;  2DYR H;  5KHD A;  5IT9 Z;  1ZN2 A;  2DTR A;  2HXI A;  3PUB A;  1E3P A;  5J4V A;  2QCO A;  1MBJ A;  3BPV A;  4EJO A;  3QU6 A;  3HL2 A;  2FEZ A;  3OYD A;  1FJL A;  2KZV A;  3RJP A;  2W25 A;  4CXF A;  2GLO A;  2EPF A;  4CCN A;  1FOK A;  2V7F A;  1ETX A;  2BGC A;  3L9F A;  3JRG A;  1YIJ I;  1V5E A;  2DOE A;  2CRG A;  1I3A A;  4IHS A;  1L3L A;  3OL4 A;  5F0F A;  2ZFW A;  4M9S A;  4IL6 C;  2F5D A;  2RNG A;  2VJJ A;  3PQJ A;  5HNH A;  4KIG A;  3F72 A;  3BCB A;  1T0F A;  5F6F A;  3S1M J;  4HF2 A;  3I59 A;  4A3I J;  2VBX A;  4P1W A;  3ZMU A;  4UVC A;  3DBL B;  1FNN A;  3DP7 A;  4U88 A;  4DZP A;  3BPX A;  5F0C A;  3REO A;  4PFP A;  2PFB A;  2BHZ A;  2EZL A;  2KRC A;  2ZB9 A;  3JAM K;  3BZK A;  3GEZ A;  3CLO A;  5E3N A;  4WXH A;  1FC3 A;  1R58 A;  4UVB A;  5EDN A;  4I0B A;  3QYE A;  2VOP A;  1U8R A;  1G3W A;  1SVO A;  3GFJ A;  2XHK A;  1J75 A;  4BUP A;  2VN2 A;  1VQL I;  3KX2 A;  4CZC A;  2R7D A;  4CYC A;  4NC6 A;  4EJV A;  5FLX Z;  4HST A;  3PNY A;  3Q9V A;  2CFX A;  4ASN A;  1FY7 A;  4TV7 A;  2DJI A;  4AVP A;  1ZH5 A;  3LSP A;  4NC8 A;  1DGR M;  4KUM A;  2QM3 A;  2LLK A;  2XGC A;  1TP4 A;  3OS1 A;  3JW4 A;  4MLO A;  3BR3 A;  3H9G A;  1IN4 A;  4XN3 A;  1G4D A;  1ODD A;  4ZDL A;  4FET A;  3WHB A;  3OR2 C;  4HAM A;  4B1R A;  3IH4 A;  2L4A A;  4XLN F;  4EM0 B;  2ZO4 A;  4EV0 A;  1IUY A;  4BAC A;  3MD2 A;  3HEF A;  3A03 A;  1TW2 A;  3CP8 A;  3G3Z A;  3BG5 A;  4EMS A;  3VOD A;  5KNL A;  3JRH A;  5E8G A;  2R7Z J;  3HOS A;  3CO6 C;  3CCR I;  2DFE A;  4M9X A;  2X51 A;  2W4S A;  3JCU C;  5F27 A;  2RAE A;  3F21 A;  2JMW A;  2H94 A;  2OAZ A;  1QZZ A;  4P5O A;  4LB6 B;  1FZP B;  3L7W A;  3T8T A;  4JX5 A;  4C9Y A;  5EG0 B;  2W85 A;  4M3B A;  5DYM A;  4XKB A;  4F93 B;  2ELH A;  1VQO I;  3WGG A;  1MND A;  2K5C A;  1U6G A;  4ABZ A;  2F4M B;  1X1D A;  1EF4 A;  1QO0 D;  2DA2 A;  3HRU A;  3DLL F;  1E3O C;  3TBI A;  1R4N B;  2R7V A;  4GDF A;  1DPR A;  2G0E A;  1FIP A;  1UHS A;  1V4R A;  2DMN A;  2XAH A;  3DCF A;  2W48 A;  1IGN A;  2E36 A;  4M6X A;  3BQY A;  3MKY B;  3CF2 A;  2YX4 A;  1FP1 D;  2BE5 F;  3BTC A;  4IRG A;  4XKW A;  5HOD A;  1R71 A;  3LL7 A;  3ECH A;  4L5I A;  4AU7 A;  4NHJ A;  2HQR A;  2JSC A;  1Z1D A;  1SVL A;  2YX7 A;  3F6O A;  1NG7 A;  5CVJ A;  1S8N A;  5J47 A;  3HSE A;  3OY9 A;  3EUH A;  5IT9 K;  1D0Z A;  3L09 A;  1BI3 A;  2V1N A;  3KYC B;  3BJ6 A;  2X1E A;  4BBS J;  1H88 C;  2EV0 A;  2YU9 J;  2A5Y B;  2BY1 A;  3JRF A;  3WTZ A;  2CUJ A;  1KYZ A;  3H3U A;  4XOR A;  4LG0 A;  4J01 A;  3H92 A;  3OL3 A;  1F9N A;  2P5V A;  2IVM A;  3JRE A;  2ZJQ F;  3OIP A;  5DEQ A;  1JXS A;  1YOV B;  1A5J A;  1S7A A;  1S5L C;  1TBX A;  2ZXI A;  2OTL I;  5D8K B;  3KP4 A;  3S1R J;  3OIQ A;  2G7H A;  1P4W A;  2FU4 A;  2VQL A;  2Z5U A;  2XAF A;  5EYR A;  5KVR A;  2DTZ A;  2CW7 A;  3FXU A;  3IC7 A;  1D0X A;  3OOU A;  3CMM A;  2XPW A;  2AO9 A;  3AG4 H;  2ZNZ A;  1UJ8 A;  1X1B A;  4CA0 A;  2MD0 A;  4HX8 A;  4ITV A;  2VC1 A;  5CYV A;  2DU9 A;  4OMZ A;  2MFZ A;  5BPI A;  2M8E A;  4YEJ A;  2DPU A;  3CME I;  2IS4 A;  3FXK A;  1T2K A;  4WCG A;  1WJ5 A;  2LC2 A;  4LG3 A;  4M3E A;  2VKV A;  3VYU B;  5FJ8 J;  1HCR A;  3GXO A;  2BBY A;  3OSG A;  1MW7 A;  2P8T A;  3TO7 A;  4RAZ A;  4U7D A;  5FLX K;  1X2N A;  4A6D A;  3HRM A;  4KNY A;  3G73 A;  2LF8 A;  4HDV A;  2EK5 A;  1XCB A;  4FCY A;  2K9M A;  5LRR A;  1FT9 A;  4QTR A;  1BC8 C;  2H1K A;  1X2M A;  2EA4 A;  5J3L A;  2DOD A;  5TRD A;  2MH2 A;  1JUS A;  5F04 A;  1PUE E;  4R79 A;  3BQZ A;  2WWY A;  1E0E A;  4FQG A;  5L3B A;  4FE4 A;  4JP0 A;  3ROU A;  4EJW A;  4AUX A;  1UMQ A;  3OYB A;  1IRF A;  4ESF A;  2PJR A;  1LDD A;  1P9Q C;  4NB5 A;  5IYC J;  5DTD A;  1BC7 C;  2EFP A;  2JA5 J;  1VFC A;  5E18 F;  3F8F A;  3I56 I;  2LTP A;  2K9L A;  5L3C A;  3QP6 A;  2BY2 A;  1X1P A;  1EH7 A;  3EDP A;  2OQR A;  2MC3 A;  4HW0 A;  1S6L A;  3WOD F;  1JJ6 C;  2IEK A;  3LNQ A;  4LIU A;  2NVX J;  4KIC A;  4I76 A;  3EYY A;  3L2R A;  3OYM A;  2A69 F;  2GAU A;  2B0L A;  2P6S A;  3BTJ A;  1XSX A;  5J40 A;  5HDK A;  5IPA A;  3DU5 A;  3KZI C;  2QF7 A;  1R1V A;  5AON A;  4IZZ A;  2IS6 A;  3W6K B;  2XRN A;  1KU7 A;  4E7I A;  2HYJ A;  3HSR A;  3A02 A;  3BG6 A;  1Z91 A;  5FKL A;  1J0R A;  2HPM A;  3K1M A;  5IP9 J;  1RI7 A;  4D7N A;  1U9N A;  2L2O A;  1W0T A;  3F0C A;  1VQK I;  1IW7 F;  3IV5 A;  1R49 A;  1LE8 A;  1DP3 A;  3KLO A;  4AD9 A;  3CMA I;  3KZZ A;  3DV8 A;  3OYE A;  5FRM A;  4OAY A;  5K1Y A;  4HOB A;  2R3S A;  3KZY A;  1RKT A;  4IXA A;  1RPW A;  1F36 A;  2BYV E;  3KEQ A;  1VF9 A;  1XD7 A;  1Z0X A;  3FXL A;  2NS8 A;  5L3E A;  1SAN A;  1OCC H;  4MEY F;  3HG9 A;  3JSP A;  1JE8 A;  3EPZ A;  3TO9 A;  2C6Y A;  3GTK J;  5FGM A;  4ESB A;  1VND A;  2Z33 A;  1SC7 A;  4HDU A;  2NRA C;  2DMU A;  1MNM C;  1VQ6 I;  5GTI C;  2XGX A;  3T5X A;  3NWS A;  2O8X A;  3QP5 A;  5LEK A;  2DFH A;  5LD2 C;  4FT8 A;  1YQA A;  2COM A;  3OS0 A;  1SFO J;  4OIP F;  1I1S A;  4I01 A;  4U7B A;  4II2 A;  4FIS A;  3I4N J;  2BVM A;  4D0P A;  2KRH A;  4I98 B;  1MJ9 A;  2PJP A;  3JRC A;  2VOO A;  5E3M A;  2F4I A;  2HVS A;  2HTJ A;  5GPA A;  2M2E A;  3FZV A;  4XID A;  1X58 A;  1FMV A;  3ZPL A;  5IP6 A;  1JT0 A;  1J59 A;  2RV8 A;  3CCM I;  2M5W A;  4O5V A;  4LK0 F;  2IBD A;  4JQF A;  4BQN A;  3FM3 A;  2RDP A;  3L1P A;  3VDX A;  3NAR A;  2W7N A;  1ZLK A;  1R6R A;  3CDL A;  3F8M A;  1Q1V A;  2QUF A;  2HKO A;  4AC0 A;  3MKL A;  4HRI A;  2HVR A;  2KP6 A;  1XMX A;  3J80 Z;  2H27 A;  1X4O A;  3ECO A;  1HLV A;  2JSP A;  5FRO A;  2CUE A;  3E6B A;  2D1V A;  2VBY A;  1LEB A;  4BDZ A;  3CUO A;  3MWM A;  2Q8K A;  5HDG A;  1ERD A;  2BW3 A;  1BI1 A;  1MSE C;  2HNH A;  2HOT A;  2E7W A;  5FRN A;  2JA6 J;  3OYC A;  2CO5 A;  5GAG J;  4N4N B;  1W1W E;  3J7Z I;  3C3W A;  2LRE A;  1N25 A;  4KA4 A;  1FBU A;  1R4M B;  1LVA A;  1LB2 A;  2WTE A;  1VQP I;  3LA3 A;  2N8G A;  2PN6 A;  4R8H A;  2DXI A;  1TW3 A;  2MG4 A;  1B9N A;  2UUZ A;  1XG1 A;  4JBA A;  2WAF A;  2QEN A;  4IHW A;  4XRM A;  3K70 D;  2Y0M A;  3Q9S A;  5K5O A;  1U5T B;  2W82 A;  2YUS A;  4BU2 A;  4AIK A;  3MEX A;  3L2Q A;  4S04 A;  1BJZ A;  3GWZ A;  1O7L A;  2DOA A;  4PJM A;  4XLP F;  1MBG A;  1B6A A;  5K7Z A;  2CU7 A;  2VE8 A;  4B3X A;  3FBI B;  4KN7 X;  3W2A A;  1WGX A;  4LK1 F;  2EFO A;  4M72 A;  3K4L A;  3CUQ A;  3TP0 A;  3S3N A;  4MEX F;  2CQQ A;  1IN8 A;  3DPU A;  1UZC A;  2IA1 A;  2K9S A;  4E4H A;  3SQN A;  1D8J A;  4WXC A;  4BEH B;  4MTE A;  1IF1 A;  4EJU A;  2VQC A;  3ASN H;  2E5N A;  3JRB A;  2M4G A;  3SDG A;  1TQI A;  2EB7 A;  2L5Q A;  1LKX A;  3F3X A;  3TP3 A;  3TQN A;  1WH7 A;  1P92 A;  4WXD A;  4GGG A;  5E3L A;  4QIW N;  4EGZ A;  1FEX A;  4RB1 A;  3IH3 A;  4A3E J;  1CGP A;  4UNO A;  1YJW I;  2KIQ A;  4QWQ A;  2DLL A;  3ZR8 X;  3FM5 A;  5J4Y A;  1JKP C;  2LY1 A;  3GCM A;  2KIU A;  5FFZ A;  2ZSI B;  4HSR A;  3TO6 A;  2CQX A;  2Y48 A;  1U5T C;  5IY5 H;  2I10 A;  1UB9 A;  3P9C A;  2Z2S B;  4X1E A;  2E1N A;  2BZT A;  3FXM A;  1CQT A;  1OPC A;  5BS6 A;  3GFI A;  1BN5 A;  3VYS B;  5M5X J;  1G6N A;  3ESW B;  5HS8 A;  1AKH A;  2CG4 A;  5BQT A;  1K7A A;  4E7Z A;  4AID A;  2GIZ A;  3DU6 A;  3E5Q A;  4L0Y B;  3IHU A;  5FD6 A;  1ZTR A;  4J00 A;  1T6S A;  4YFN F;  1SD7 A;  3QOE A;  1OKR A;  2QBY A;  4JYK A;  4PJ0 C;  1WJB A;  4I02 A;  2WAQ A;  2XRO A;  2R7U A;  2K3P A;  3HOZ J;  1TNS A;  1OCT C;  3E5U A;  2LY9 A;  3RZD J;  4CHU A;  2PX9 A;  3BP8 A;  4BKX A;  1SMY F;  4XRS G;  1WI9 A;  5AIP A;  3RKY A;  2E7X A;  2ZSH B;  4HF1 A;  4RB0 A;  5DM7 F;  1LFU P;  2OJE D;  2JA8 J;  3GTO J;  1GDT A;  3ELK A;  4UUV A;  2ETH A;  3FF5 A;  3TDU C;  1R5G A;  3HBL A;  3ASO H;  2P0W A;  5J6X A;  1B4A A;  1GVJ A;  1QHH D;  2DT6 A;  2Y31 A;  3G1L A;  2YSR A;  4GYI A;  2BVL A;  5CVI A;  2OQG A;  2ECC A;  3KP2 A;  1RES A;  3JAM Z;  4ZJZ A;  5M5W J;  1A36 A;  2IGO A;  2VUM J;  3J7A O;  1L0O C;  2Y69 H;  2IAI A;  4E7K A;  6PAX A;  3HM5 A;  1OIS A;  4B09 A;  2YPR A;  4G7O F;  2EFN A;  1UG0 A;  2QQA A;  1OLT A;  2L02 A;  2HOA A;  2WAE A;  4E70 A;  3HGY A;  1ETW A;  4H4K C;  3HJE A;  3SEZ A;  3J7Y J;  2VOD A;  1SVM A;  2PBI A;  2LOO A;  3P9I A;  1YX3 A;  3S8P A;  1EA3 A;  2NOG A;  3KYD B;  2BXZ A;  1D0Y A;  3D5S C;  3M8E A;  2LK2 A;  3HHG A;  3E0J B;  4HNU A;  4A0Z A;  1FLI A;  4PUS A;  5H6R A;  4NUB A;  4LD5 A;  3LA7 A;  5BPD A;  5F64 A;  2QYO A;  1R5H A;  2ACJ A;  2R7O A;  2K86 A;  5EZH A;  2FNA A;  4XQF A;  4A3M J;  3CQZ J;  1I6X A;  4LLL A;  3LSK A;  1P4A A;  3IRQ A;  4PJL A;  4KFC A;  3D5L A;  1RR7 A;  2L0K A;  3EUA A;  5B66 C;  4DQ2 A;  2LH9 A;  3C7J A;  2FQ3 A;  3QPS A;  4XK4 A;  1TT0 A;  3A0B C;  3KEY A;  3O8H A;  2Q1Z B;  2XB0 X;  1WVR A;  1OR7 A;  4NQW A;  2MW8 A;  3W3C A;  3N05 A;  3RSN A;  3HUG B;  3DEU A;  4GFB A;  1SAX A;  2DQR A;  4H0E A;  4A0Y A;  1TNT A;  4CIC A;  4ZYA A;  2DMQ A;  1JKQ C;  3L2W A;  2JUG A;  1VQ9 I;  1MBF A;  1RKW A;  2RC4 A;  1IXR C;  2FBH A;  1MMG A;  2JPC A;  4A3F J;  3QPL A;  2L9S A;  1PDN C;  1JGG A;  3HOW J;  2LVS A;  4LLG F;  2M4K A;  1BI2 A;  4XM3 A;  3BOQ A;  3A01 A;  3T0Y A;  2H8R A;  3ZMD A;  3H5N A;  3O3K A;  4EEF G;  3GTG J;  2NVY J;  2GOM A;  2AQF A;  1HC8 A;  1TL8 A;  3FDY A;  4CZZ A;  2IJL A;  2I8D A;  3DTK A;  3HGG A;  1VQ7 I;  5J8C A;  2O03 A;  4HYE A;  1ZGJ A;  1YRN A;  3G2B A;  4KMU X;  2B9S A;  1BI0 A;  1CF7 B;  2OUM A;  3B6A A;  2ZJ2 A;  5GAH J;  4HLX A;  3HPH A;  2H1L A;  4PJJ A;  4E7S A;  1HBX G;  1Z6T A;  2XF6 A;  2JVH A;  3O8G A;  2X1C A;  2XPV A;  3TED A;  3S2D J;  1OYW A;  4UUT A;  3KP6 A;  3VWB A;  2NVT J;  3N4M A;  3F8B A;  2LBF A;  2EIJ H;  1LDK B;  1K83 J;  3HPG A;  1PVE A;  4RS8 A;  1MJB A;  1G3Y A;  1VQM I;  2E60 A;  1U78 A;  4F92 B;  2CFO A;  1YE9 A;  3E6C C;  3QOD A;  3MZ8 A;  1GT0 C;  3DTI A;  1WQ2 A;  1QQI A;  2A05 A;  2F2E A;  3Q5F A;  3I64 A;  3ABM H;  1U8B A;  4DZJ A;  3MKW B;  3MKZ A;  1WH5 A;  4ZYD A;  2XV4 S;  3EUK L;  4KT6 A;  5E8I A;  4RLF A;  2H6B A;  3B6C A;  3CF5 F;  2DCE A;  5FLV A;  3PJR A;  1OFC X;  1BOB A;  3MCZ A;  4ZZD A;  2GBY A;  2O61 A;  4GCV A;  4ANJ A;  2O7O A;  4UHT A;  4DOZ A;  4J19 A;  3GX4 X;  2P6T A;  2HKX A;  4U0W A;  4BS9 A;  1Y8Q B;  5AIQ A;  3EET A;  2RVC A;  3M8F A;  3DLA A;  1W5C C;  3OV8 A;  1ZG1 A;  3V8J A;  4GRI A;  1ZGW A;  2OD5 A;  3LSH A;  2ME0 A;  3U1D A;  3RYR A;  3G1M A;  4I0A A;  1YX5 A;  1T38 A;  1UHM A;  1ZHF A;  2Y9Z A;  4A3L J;  2X48 A;  1N77 A;  2ELJ A;  4UB8 C;  2KKO A;  1QNT A;  1NHA A;  1MBK A;  1Z05 A;  2OZU A;  4ENK A;  4IOC F;  2MAB A;  1W7P B;  4XLC A; 
#chains in the Genus database with same CATH homology
 1YS7 A;  5CJ9 A;  3ZP5 A;  3GUD A;  2KJB A;  1XGN A;  3U2R A;  2XVC A;  2FBK A;  4MGR A;  4BH9 A;  5ED4 A;  1XMA A;  2QBY B;  3HOT A;  2JTV A;  2M30 A;  2W24 A;  2M87 A;  2V79 A;  5BMZ A;  1LQ1 A;  1R1U A;  1XGM A;  1FPQ A;  3I0T A;  1R22 A;  2GZW A;  3QPT A;  1B59 A;  1SD5 A;  5E1Z B;  3I5U A;  3W6J B;  2FMY A;  1O57 A;  3QPH A;  2CYY A;  4RGU A;  4U0V A;  5EEH A;  2EA2 A;  4OMY A;  1G3S A;  1TTY A;  1TQP A;  1KQ8 A;  3BRO A;  2RNJ A;  4KMF A;  1J9I A;  4Z2Y A;  1ZG3 A;  1YW8 A;  3PFI A;  5K5R A;  1XSD A;  4ENN A;  3CO7 C;  4YG2 F;  3ULQ B;  5HS7 A;  1BM9 A;  3WTS C;  3GZ6 A;  1ON1 A;  1DP7 P;  4LJZ F;  3V7S A;  1O3Q A;  2A3S A;  2DQL A;  5JI6 A;  3R61 A;  1MKM A;  2KRF A;  2NAZ A;  2L3D A;  3CDH A;  3E97 A;  1KU3 A;  1QGP A;  1Y0U A;  5EEG A;  1ZRD A;  2YR2 A;  1XCV A;  3GVA A;  5DCM A;  3J81 K;  3DPT A;  3V8K A;  3M1E A;  2QWW A;  3S2W A;  4A6E A;  4PDK A;  2L01 A;  3ERE D;  2RGV A;  2EV5 A;  4Q5S F;  3AAF A;  2X0L A;  1W7P D;  3VEP A;  3MZH A;  4KN4 X;  1E17 A;  5ICG A;  4N9I A;  3F23 A;  3IWF A;  2MA3 A;  3WU1 B;  2FF4 A;  3KFW X;  3R60 A;  2R7F A;  4L5J A;  3WTU C;  3K2Z A;  1HQC A;  2XAS A;  4Y15 A;  4IRH A;  3IL2 A;  4MNU A;  2PQ8 A;  4CO8 A;  2PEX A;  3IRR A;  3SZT A;  1F4K A;  2QZ8 A;  2IRF G;  4YIF A;  1LDJ A;  5HLI A;  1IXC A;  2BV6 A;  2DFI A;  2L4M A;  2ISZ A;  2MBF A;  1RUO A;  1MDM A;  1MGT A;  2DT5 A;  2AXL A;  3I59 B;  1UFM A;  5FO5 A;  4A5N A;  1ZRF A;  4RAY A;  4EJT A;  4G94 A;  4A0X A;  4GXO A;  2EV6 A;  2M45 A;  2UZK A;  4OOI A;  2P4W A;  1IN5 A;  2DBB A;  2MH9 A;  2HZT A;  2ZME A;  1VTN C;  2JT1 A;  4MQ9 F;  4GYG A;  3L2C A;  5CLS A;  1IN7 A;  3V7R A;  4G7Z F;  1GXP A;  4G6Q A;  3JTH A;  1K79 A;  2IW5 A;  1BIB A;  4ON0 A;  3KEO A;  1G3T A;  1WKM A;  1YTY A;  2NYX A;  1U2W A;  4PGH A;  3HYI A;  2DW4 A;  1X3U A;  4HA8 A;  2O0Y A;  4FX0 A;  3COA C;  4P9F A;  4M73 A;  2LDU A;  3CTA A;  4BHC A;  4BYY A;  2VT3 A;  3P9K A;  5D5U B;  3FX3 A;  4HZF A;  3SHF A;  1O3S A;  1ZAO A;  3RPU A;  3R4K A;  3VB2 A;  2F5E A;  3WTV C;  1YG2 A;  1O3T A;  1REP C;  2ESH A;  4B8X A;  2LKP A;  2Y75 A;  4MHG A;  2OA4 A;  2RQP A;  2NNY A;  2O6G E;  1SFU A;  3M9A A;  1MJA A;  1K6O A;  1TQM A;  5LHI A;  1YFH A;  4OIN F;  4WX9 A;  3D0S A;  5IT3 A;  3WGI A;  3P7N A;  3GYH X;  3JTG A;  4EM2 A;  3KE2 A;  4LG0 B;  1UST A;  3FXQ A;  5FFX A;  2V1D A;  3VOE A;  4L9V A;  2GA2 A;  4ETS A;  3E6D A;  1BOA A;  3DXJ F;  4WWC A;  4XSX F;  5HS9 A;  1ONV A;  4G8X A;  2P7V B;  5A2Q K;  3WG9 A;  5ILS A;  5K5Q A;  1D8K A;  3GFL A;  3DKW A;  1D3Y A;  3O2P E;  2GXB A;  1ZGA A;  5D6F A;  5LGT A;  5HDN A;  2GXG A;  2H6C A;  5E17 F;  5CVV A;  5JHU A;  4M6Y A;  1KU2 A;  2ESN A;  4Q48 A;  4BHP A;  1RZ4 A;  2EFQ A;  1DDN A;  2W57 A;  3GZ5 A;  5D5V B;  2GQQ A;  2HDC A;  4RGR A;  4L9T A;  2UWM A;  2HGC A;  4RB3 C;  4YII A;  2GIV A;  5HVQ C;  3KET A;  1USS A;  4HBL A;  3HTS B;  2FOK A;  1ZLJ A;  4L18 B;  3WGH A;  4CGZ A;  2V9V A;  1HKS A;  2HR3 A;  1U3E M;  1S7O A;  1YYV A;  1F5T A;  5LBQ A;  3ZMS A;  1UHW A;  3NEU A;  1P6R A;  1Z9C A;  2PMU A;  2G7U A;  2DAO A;  4BHB A;  4CDG A;  3WTY C;  3WE2 A;  3O6B B;  2XAG A;  3E5X A;  4K2E A;  1ZG5 A;  5DV5 A;  2K4J A;  5ICC A;  1KU9 A;  4LB5 A;  2XAJ A;  1HKQ A;  1O3R A;  2ZKZ A;  2JPB A;  1I5Z A;  4UV8 A;  3GF2 A;  4I7H A;  1WSU A;  1STZ A;  3SFZ A;  2W84 A;  2DPD A;  2FBI A;  2JRT A;  5ILU A;  2CW0 F;  1XB4 A;  1KYW A;  2PMH A;  1OYI A;  5TJJ A;  3OOP A;  1JGS A;  2HTS A;  2A6H F;  4KYW A;  1XGS A;  4XSZ F;  3GLX A;  3FXR A;  3EYI A;  1HXD A;  4A12 A;  3U9G A;  3V7C A;  1SMT A;  4O6J A;  5DCF A;  4RGX A;  1JHF A;  2OBP A;  5ICF A;  2WV0 A;  3WTW C;  1MZB A;  4HV5 A;  2HYF A;  4O3M A;  3BJO A;  2LSO A;  5J8F A;  5CVU A;  1E2X A;  2P7C B;  4Q4Z F;  5L3G A;  1R36 A;  1KQ9 A;  5ILV A;  2A07 F;  4Q47 A;  2DK5 A;  2NS0 A;  4QLC U;  2Z9O A;  1RNL A;  4M9Z A;  2ZBK A;  1R1T A;  4BXU A;  1H9T A;  2KIF A;  2FRH A;  2E1C A;  2V1U A;  5ICE A;  1FYL A;  2LF7 A;  3RDI A;  2CQK A;  3ZN0 A;  1FX7 A;  5JFR A;  3ABT A;  3E3V A;  3H3Z A;  3V8L A;  5FB2 A;  4I2O A;  4FHT A;  1IAW A;  4R1H A;  3FHZ A;  3J81 Z;  2P5L C;  3BY6 A;  1R00 A;  3DF8 A;  1TLH B;  1WWX A;  4ZYG A;  2K02 A;  4RB2 C;  1FWZ A;  2OU2 A;  3CUQ B;  1FBQ A;  1ZYR F;  4EM1 A;  1HW5 A;  4HV6 A;  2Q0O A;  4EQQ A;  2MD5 A;  3RPQ A;  3T1B A;  5DUK A;  1GXQ A;  2A61 A;  5KK1 A;  2VC0 A;  4HQM A;  5F1R A;  1ZRC A;  3EQL F;  2NNN A;  1FBS A;  2GWR A;  3DQV C;  3IKV A;  2O3F A;  4G6D A;  4MTD A;  1ZRE A;  3ISP A;  3LAJ A;  4G7H F;  2KIM A;  1WRJ A;  1XDU A;  3CUQ C;  1PP8 F;  1B9M A;  1S3J A;  2QQ9 A;  4UXN A;  5LGN A;  4BAY A;  3KCC A;  3FMS A;  1ON2 A;  3B73 A;  1RIO H;  3TDZ C;  3LQQ A;  3RKX A;  3GW2 A;  4HLY A;  2J5P A;  3VFZ A;  2BEO A;  4JK1 X;  2MLG A;  3ZQ7 A;  5D4S A;  2ZNY A;  1LNW A;  4KIB A;  3C18 A;  2VBW A;  3K1N A;  4HX7 A;  1C0W A;  1B1B A;  3I4P A;  2J5O A;  3MAJ A;  4PGG A;  1ZAR A;  2XAQ A;  4KDP A;  2CWE A;  4XBF A;  3HRS A;  3KP7 A;  2VT2 A;  3V4G A;  3QU3 A;  1KA8 A;  2UXN A;  2QQB A;  1U5T A;  2LNB A;  2HQN A;  1W5T A;  1AWC A;  4WF2 A;  1K78 A;  4IRI A;  2XKP A;  5DD8 A;  5D5X B;  2VBZ A;  1LEA A;  2D2W A;  3M7G A;  1T98 A;  1IRG A;  2WC2 A;  2IA0 A;  3K69 A;  3K1P A;  1BIA A;  2FNP A;  5LEJ A;  4OIQ F;  2K4B A;  1XGO A;  2XKO A;  2JZY A;  3ZN1 A;  1J7K A;  4U0Y A;  4OIO F;  3HRT A;  3MFK A;  2VXZ A;  3FMQ A;  3ZMT A;  4WK8 F;  4PZJ A;  5E1W A;  5L3D A;  1R7J A;  4HX4 A;  4BNC A;  2AS5 F;  4LFU A;  2A68 F;  3HTU A;  3LAP A;  3LWF A;  2QVO A;  2K7L A;  4FX4 A;  1KGS A;  4L9J A;  4A2U A;  1F1Z A;  2FSW A;  4AIH A;  5ERI A;  4YFK F;  3RIR A;  4G9Y A;  4MQV A;  1YLF A;  4M74 A;  3GO5 A;  1HW2 A;  2PLY A;  5H20 A;  1J5Y A;  4ESJ A;  1A04 A;  4XRF A;  4IPA A;  2QLZ A;  5E20 A;  1SD6 A;  2ZCW A;  4CYD A;  5LHH A;  4PCQ A;  5A2Q Z;  4YFX F;  4Y17 A;  3N97 A;  1Q1H A;  4IHT A;  1HKT A;  4AWX B;  2MLK A;  2L54 A;  1EH8 A;  1XSV A;  2Z3Y A;  5LRS A;  1XDS A;  1O7F A;  2TDX A;  3K9T A;  2XIG A;  3RKW A;  3MQ0 A;  4L9N A;  2EWN A;  3TOB A;  1YIO A;  4RGS A;  4ZZL A;  2HOE A;  2IPQ X;  2V6C A;  2RKH A;  1W4M A;  3BDD A;  4IJA A;  1SFX A;  3LFK A;  1UCR A;  3R0A A;  2DK8 A;  3HUG A;  5JR3 A;  4DNC A;  2F5F A;  2FA5 A;  5LHG A;  2DI3 A;  3I58 A;  1OYY A;  2ISY A;  3HIF A;  2UXX A;  4AIJ A;  3FMR A;  3SZP A;  3C1D A;  2EFW A;  4ZH4 F;  1YW7 A;  4OU0 A;  3SXY A;  3CJN A;  3LA2 A;  5H6Q A;  1EV7 A;  4ENM A;  3IKT A;  1FSH A;  3LQR A;  3QRF F;  3WU0 A;  1OMI A;  3KLN A;  1ULY A;  3RTR A;  2IP2 A;  1CF7 A;  2HWV A;  4P96 A;  5LGU A;  3WE3 A;  3GFM A;  1PP7 U;  5HLH A;  1QBJ A;  1EH6 A;  3I54 A;  5DDG A;  3ZMV A;  1XMK A;  4Y13 A;  1T39 A;  5D6E A;  1GHC A;  3E6M A;  1V3F A;  2DO7 A;  1SD4 A;  1AOY A;  3QOP A;  1I1G A;  3WTT C;  3FWE A;  3NQO A;  5D8L B;  1Z7U A;  4LLN A;  3K0L A;  3R6S A;  1BJA A;  1K78 B;  2RN7 A;  4N9H A;  3BJA A;  2KJC A;  1RUN A;  4N0B A;  3R0J A;  5DCM B;  2HFH A;  5HOO A;  4BQA A;  1QPM A;  1DPU A;  4ENJ A;  3QAH A;  1H9G A;  1YO5 C;  2K27 A;  4GO1 A;  2VON A;  2VE9 A;  1FYM A;  3RI4 A;  3KP5 A;  5L3F A;  1W7P A;  1J2X A;  4P9U A;  2IT0 A;  4UVA A;  1IXS B;  1XN7 A;  2HYG D;  4IF4 A;  2CGP A;  2X4H A;  3HHH A;  4EGY A;  5FD5 A;  3TKY A;  1W5S A;  1FSE A;  1HSJ A;  2PG4 A;  5HLG A;  2IA2 A;  3TOA A;  2M1B A;  5DD4 A;  3WTX C;  5CVR A;  4LGW A;  1I27 A;  1D5V A;  1LJ9 A;  1P2F A;  1IZ1 A;  3ZMZ A;  5D5W B;  1BBY A;  2ZXJ A;  1YS6 A;  4OIR F;  5E1X A;  4UV9 A;  3L00 A;  4LMY A;  1MDM B;  3KP3 A;  2EJR A;  1IN6 A;  3JSO A;  4KT5 C;  4IVN A;  2FE3 A;  3F6V A;  3IWZ A;  3TGN A;  2ADU A;  1Z6R A;  3T8R A;  1FP2 A;  2CSO A;  3BZ6 A;  4HF0 A;  3I71 A;  1MD0 A;  3B02 A;  3ML6 A;  3F8N A;  4L0Z B;  2Z99 A;  3J80 K;  4M71 A;  4P55 A;  1DUX C;  4ZYE A;  2YU3 A;  1S29 A;  4S05 A;  2OZ6 A;  1JHH A;  2A6E F;  2HEO A;  2ZME B;  2F5C A;  3LST A;  3DFG A;  3PQK A;  4F7Z A;  3HSF A;  5JVT A;  1FYK A;  1HST A;  3I53 A;  3RYP A;  2GA1 A;  5DUI A;  2FML A;  3BWG A;  3MZY A;  1SFE A;  3F22 A;  5D4R A;  2XUB A;  4I09 A;  2H09 A;  4EVI A;  3ABU A;  4A5M A;  2STT A;  4ZYH A;  1KQ0 A;  2D45 A;  4HQE A;  2PI0 A;  1QZY A;  1P4X A;  1H0M A;  2Q2E A;  2D1H A;  2HS5 A;  4KIF A;  3DPL C;  1YW9 A;  5LLQ A;  2FXA A;  5BOX A;  2P5K A;  2G9W A;  2STW A;  1HW1 A;  2V1X A;  1R23 A;  3NRV A;  3F8C A;  5IT9 Z;  1ZN2 A;  2DTR A;  3BPV A;  4EJO A;  3QU6 A;  2FEZ A;  3RJP A;  2W25 A;  4CXF A;  1FOK A;  2BGC A;  3L9F A;  4IHS A;  1L3L A;  2ZFW A;  4M9S A;  2F5D A;  3PQJ A;  4KIG A;  3F72 A;  1T0F A;  5F6F A;  4HF2 A;  3I59 A;  2VBX A;  3ZMU A;  4UVC A;  1FNN A;  3DP7 A;  4U88 A;  3BPX A;  3REO A;  2PFB A;  3JAM K;  3GEZ A;  3CLO A;  4WXH A;  1FC3 A;  1R58 A;  4UVB A;  4I0B A;  2VOP A;  1U8R A;  1G3W A;  3GFJ A;  2XHK A;  1J75 A;  2VN2 A;  2R7D A;  4EJV A;  5FLX Z;  3Q9V A;  2CFX A;  4ASN A;  1FY7 A;  4TV7 A;  4AVP A;  1ZH5 A;  4KUM A;  2QM3 A;  3JW4 A;  1IN4 A;  1G4D A;  1ODD A;  4HAM A;  4EM0 B;  2L4A A;  4XLN F;  4EV0 A;  2ZO4 A;  1IUY A;  1TW2 A;  3G3Z A;  4EMS A;  3VOD A;  5E8G A;  3HOS A;  3CO6 C;  4M9X A;  3F21 A;  2H94 A;  2OAZ A;  1QZZ A;  4P5O A;  4LB6 B;  1FZP B;  3L7W A;  3T8T A;  2W85 A;  5DYM A;  2ELH A;  3WGG A;  1U6G A;  1QO0 D;  3HRU A;  1DPR A;  1V4R A;  2XAH A;  4M6X A;  2YX4 A;  1FP1 D;  2BE5 F;  4IRG A;  3ECH A;  4L5I A;  4NHJ A;  2HQR A;  2JSC A;  1Z1D A;  2YX7 A;  3F6O A;  5CVJ A;  1S8N A;  3HSE A;  3EUH A;  5IT9 K;  3L09 A;  1BI3 A;  3BJ6 A;  2EV0 A;  2A5Y B;  3WTZ A;  3H3U A;  1KYZ A;  4LG0 A;  3H92 A;  1F9N A;  2P5V A;  2IVM A;  5DEQ A;  1JXS A;  1S7A A;  1TBX A;  5D8K B;  3KP4 A;  2G7H A;  1P4W A;  2FU4 A;  2Z5U A;  2XAF A;  5KVR A;  3FXU A;  3IC7 A;  2ZNZ A;  4HX8 A;  2VC1 A;  5CYV A;  2DU9 A;  4OMZ A;  5BPI A;  2M8E A;  2DPU A;  1T2K A;  4WCG A;  3GXO A;  2BBY A;  2P8T A;  3TO7 A;  4RAZ A;  4U7D A;  5FLX K;  4A6D A;  3HRM A;  4KNY A;  3G73 A;  2LF8 A;  4HDV A;  2EK5 A;  1XCB A;  5LRR A;  1FT9 A;  1BC8 C;  2EA4 A;  5TRD A;  2MH2 A;  1PUE E;  4R79 A;  2WWY A;  5L3B A;  3ROU A;  4EJW A;  1IRF A;  4ESF A;  1LDD A;  4NB5 A;  1BC7 C;  2EFP A;  5E18 F;  3F8F A;  5L3C A;  3QP6 A;  1EH7 A;  3EDP A;  2OQR A;  2MC3 A;  4HW0 A;  1S6L A;  3WOD F;  4KIC A;  3EYY A;  2A69 F;  2GAU A;  2B0L A;  2P6S A;  1XSX A;  5HDK A;  1R1V A;  5AON A;  3W6K B;  2XRN A;  1KU7 A;  3HSR A;  1Z91 A;  1J0R A;  3K1M A;  1RI7 A;  1IW7 F;  3KLO A;  4AD9 A;  3KZZ A;  3DV8 A;  5K1Y A;  4HOB A;  2R3S A;  3KZY A;  4IXA A;  2BYV E;  3KEQ A;  1XD7 A;  5L3E A;  4MEY F;  3JSP A;  1JE8 A;  3TO9 A;  2C6Y A;  5FGM A;  4ESB A;  2Z33 A;  4HDU A;  2NRA C;  2XGX A;  3T5X A;  2O8X A;  3QP5 A;  5LEK A;  4FT8 A;  1YQA A;  2COM A;  4OIP F;  1I1S A;  4I01 A;  4U7B A;  4D0P A;  2PJP A;  4I98 B;  1MJ9 A;  2VOO A;  2HTJ A;  3FZV A;  3ZPL A;  1J59 A;  2RV8 A;  2M5W A;  4O5V A;  4LK0 F;  4JQF A;  3FM3 A;  2RDP A;  1ZLK A;  3F8M A;  2QUF A;  2HKO A;  3J80 Z;  2H27 A;  3ECO A;  3E6B A;  2D1V A;  2VBY A;  1LEB A;  3CUO A;  3MWM A;  2Q8K A;  5HDG A;  1BI1 A;  2E7W A;  2CO5 A;  3C3W A;  4KA4 A;  1FBU A;  1LVA A;  1LB2 A;  2WTE A;  3LA3 A;  2PN6 A;  4R8H A;  1TW3 A;  1B9N A;  4JBA A;  2QEN A;  2Y0M A;  3Q9S A;  5K5O A;  1U5T B;  4AIK A;  3MEX A;  4S04 A;  3GWZ A;  1O7L A;  4XLP F;  1B6A A;  2VE8 A;  4KN7 X;  4LK1 F;  2EFO A;  4M72 A;  3CUQ A;  4MEX F;  1IN8 A;  1D8J A;  2IA1 A;  3SQN A;  4WXC A;  4MTE A;  1IF1 A;  4EJU A;  1TQI A;  2EB7 A;  3F3X A;  3TQN A;  4WXD A;  1P92 A;  4GGG A;  4EGZ A;  4RB1 A;  1CGP A;  4UNO A;  4QWQ A;  2DLL A;  3FM5 A;  5FFZ A;  2KIU A;  3TO6 A;  2Y48 A;  1U5T C;  1UB9 A;  3P9C A;  2E1N A;  1OPC A;  5BS6 A;  3GFI A;  1BN5 A;  1G6N A;  5HS8 A;  2CG4 A;  5BQT A;  1K7A A;  3E5Q A;  4L0Y B;  3IHU A;  5FD6 A;  1T6S A;  4YFN F;  1SD7 A;  1OKR A;  2QBY A;  2XRO A;  4I02 A;  1TNS A;  3E5U A;  4CHU A;  3BP8 A;  1SMY F;  1WI9 A;  5AIP A;  3RKY A;  2E7X A;  4HF1 A;  4RB0 A;  3ELK A;  4UUV A;  2ETH A;  3FF5 A;  3TDU C;  1R5G A;  5J6X A;  1B4A A;  1GVJ A;  2YSR A;  4GYI A;  5CVI A;  2OQG A;  3KP2 A;  3JAM Z;  3J7A O;  1L0O C;  6PAX A;  4B09 A;  2YPR A;  4G7O F;  2EFN A;  2QQA A;  2L02 A;  4E70 A;  2VOD A;  2PBI A;  3P9I A;  3M8E A;  3HHG A;  4A0Z A;  1FLI A;  5H6R A;  4LD5 A;  3LA7 A;  5BPD A;  5F64 A;  2QYO A;  1R5H A;  2ACJ A;  2K86 A;  2FNA A;  1I6X A;  4LLL A;  1P4A A;  3IRQ A;  4KFC A;  3D5L A;  4DQ2 A;  3C7J A;  2FQ3 A;  1OR7 A;  4NQW A;  3DEU A;  1SAX A;  2DQR A;  4H0E A;  4A0Y A;  1TNT A;  4CIC A;  2RC4 A;  1IXR C;  2FBH A;  2JPC A;  1PDN C;  4LLG F;  1BI2 A;  3BOQ A;  3T0Y A;  3ZMD A;  3O3K A;  4CZZ A;  2IJL A;  5J8C A;  2O03 A;  4HYE A;  1ZGJ A;  4KMU X;  1BI0 A;  1CF7 B;  2ZJ2 A;  4HLX A;  1HBX G;  1Z6T A;  1OYW A;  3KP6 A;  3N4M A;  3F8B A;  1LDK B;  4RS8 A;  1MJB A;  1G3Y A;  1U78 A;  3E6C C;  1WQ2 A;  1QQI A;  2F2E A;  3Q5F A;  3I64 A;  4ZYD A;  2XV4 S;  5E8I A;  2H6B A;  3MCZ A;  4ZZD A;  2O61 A;  4GCV A;  4UHT A;  3GX4 X;  2P6T A;  2HKX A;  4U0W A;  5AIQ A;  3EET A;  2RVC A;  3M8F A;  3OV8 A;  1ZG1 A;  3V8J A;  2OD5 A;  3U1D A;  3RYR A;  4I0A A;  1T38 A;  1UHM A;  1ZHF A;  2KKO A;  1QNT A;  1NHA A;  1Z05 A;  2OZU A;  4ENK A;  1W7P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...