5AIQA

Crystal structure of ligand-free nadr
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
139
structure length
131
Chain Sequence
ASINIGLIQAREALMTQFRPILNQANITDQQWRIIRLLAENGTLDFQDLANQACILRPSLTGILTRLEKAGLVVRLVFLKLTAEGEKLYEEIGEEVDERYDAIEEVLGREKMLLLKDLLAELAKIEDALNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REGULATOR, MARR FAMILY
publication title Molecular Basis of Ligand-Dependent Regulation of Nadr, the Transcriptional Repressor of Meningococcal Virulence Factor Nada.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Transcription
total genus 47
structure length 131
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5aiqA00
2KIFA 4U7BA 1OYYA 4CHUA 1TQMA 1R23A 4EVIA 3L00A 5K5QA 3IKTA 3PQJA 5E18F 2MD5A 2E7WA 1T2KA 5LLQA 3T0YA 3F3XA 3S2WA 3ECOA 1R1VA 1R22A 4A0YA 4OMZA 3HSRA 3I64A 3MEXA 4RGSA 1MDMA 4PZJA 2CYYA 4KYWA 2XGXA 4RGUA 2ZNZA 3K1NA 3J81K 4ENMA 3Q5FA 2LKPA 2ZKZA 2YU3A 1O3RA 3T5XA 4L5JA 5FD6A 4G8XA 2DT5A 4BXUA 4P96A 3FWEA 4HF2A 1J75A 3QU3A 1I27A 5HLIA 2DW4A 2IT0A 2MLGA 3L2CA 2NNNA 2FSWA 4OU0A 2Y75A 3BJ6A 3HHGA 2JPCA 1R00A 3KE2A 4GCVA 3ZMTA 5ILSA 1IXCA 1Q1HA 4LFUA 1HQCA 5ICCA 1IUYA 3HRTA 4MNUA 2GIVA 4WK8F 2XAQA 2EWNA 4BQAA 1LB2A 2P4WA 3V8JA 1I5ZA 1BN5A 2B0LA 3DEUA 3GFMA 1U6GA 2EFPA 5DDGA 1ZG3A 1YFHA 1R5GA 1P92A 2F5FA 5FFXA 4WCGA 3RKYA 5ICFA 1ULYA 3BPVA 1A04A 3HSFA 1O7LA 1TTYA 3GFLA 3GXOA 1O3QA 1XN7A 1U5TB 4FX4A 1REPC 3TDZC 3QPHA 5DEQA 1F1ZA 2VE8A 3E97A 1HXDA 3KFWX 1QZYA 1FPQA 3T8RA 3C7JA 4WF2A 3ZMVA 1R58A 3Q9SA 3TOBA 2IP2A 1H0MA 3WU0A 3DFGA 4PCQA 4NHJA 1B4AA 4I01A 3R60A 3MZYA 4Z2YA 4P5OA 2ACJA 2BE5F 5LBQA 1XGOA 1WWXA 4PDKA 2FNPA 1IN4A 3H3ZA 2NNYA 2L01A 5L3EA 3MQ0A 3F21A 2FMYA 1U3EM 1CF7A 5BPIA 1MDMB 2DO7A 2R7FA 4BHBA 1D8KA 2K7LA 4HX4A 3IRRA 1QZZA 1HBXG 4LLGF 3GW2A 2FMLA 1B59A 3WGIA 1S7OA 1IW7F 5F1RA 1YW9A 4G94A 3EETA 4PGGA 5HS7A 5ED4A 2HFHA 3KLOA 2L02A 3LA3A 5D6EA 2HS5A 4IRGA 4LK1F 1KU9A 3J80K 2MH2A 2VT3A 3HRSA 4N9HA 4AD9A 4A5MA 5KK1A 3BDDA 2M8EA 3ZMSA 1ZG1A 2W84A 2DAOA 3WODF 2P6SA 4KN7X 4HDUA 3HTUA 1NHAA 2RNJA 4UVAA 2O0YA 1R1UA 2GXBA 2ZO4A 1ZN2A 2FQ3A 1OR7A 4EJOA 2JZYA 1L3LA 2G7HA 2VN2A 3RJPA 1FOKA 2BV6A 5HLHA 4ZZDA 4KIFA 2HKOA 1USSA 2DPUA 2EV0A 3ZMDA 1LNWA 4E70A 1T6SA 2A3SA 2QZ8A 1IN5A 2BGCA 5J8CA 3FX3A 1UHWA 5IT9Z 3ABUA 3D5LA 3L9FA 2FE3A 5A2QZ 2PEXA 4UXNA 3EQLF 3JSPA 3KP4A 1FWZA 5ICGA 3K1PA 2ADUA 3KP3A 4O5VA 4HV6A 3T8TA 3E6MA 4LG0A 2V79A 1XSXA 3SZPA 2G9WA 4MQ9F 2ZFWA 1BI1A 6PAXA 3TGNA 1S8NA 1WI9A 5J8FA 1C0WA 4M6XA 1F9NA 4UVBA 2V1UA 1CF7B 2ZNYA 5D8LB 2K4BA 1FSHA 1YW8A 2DLLA 4O3MA 2D2WA 3VFZA 1IZ1A 2QYOA 4A6DA 1FT9A 1CGPA 2M87A 2W85A 4LK0F 3CJNA 1J5YA 3I54A 3GFIA 2M45A 3LWFA 4IRHA 4AIKA 5HS8A 2OZ6A 2VBZA 3O3KA 1LDJA 4WXDA 1R5HA 3Q9VA 5CVJA 4L18B 2OAZA 4MTDA 1G4DA 3V7SA 1OKRA 1Z05A 1B6AA 4A0XA 1KYZA 4DNCA 3CUQA 3N97A 2F5CA 2QQ9A 2CG4A 3CUOA 2OD5A 2K27A 2CGPA 3WGGA 3LAJA 1Z1DA 3CO6C 3HTSB 3W6JB 4GYIA 3R4KA 4RB0A 2F2EA 1FP1D 3V7CA 3BJAA 4EJTA 1FC3A 3K2ZA 1MZBA 3BROA 4HOBA 2NAZA 2A69F 4LB5A 1BIAA 1ZGJA 2OQRA 2RKHA 1S7AA 5LHIA 3K1MA 2H6CA 3AAFA 4Y15A 3TKYA 3ZP5A 1QBJA 1MKMA 2L3DA 4LLNA 2RC4A 2DFIA 3RI4A 5L3GA 4M73A 2GWRA 3VOEA 5LGUA 3NQOA 5H20A 4LG0B 1HW2A 2P7VB 5DV5A 2O8XA 1ZYRF 2A61A 1ZG5A 2J5PA 1Y0UA 4ZYGA 3GO5A 1TLHB 4N0BA 2P5VA 2CSOA 1HKTA 2YSRA 2FU4A 1UB9A 1UFMA 3W6KB 4B8XA 3O2PE 1G6NA 5ICEA 2JTVA 2STTA 1LQ1A 3I53A 1XMAA 2FNAA 1VTNC 4WX9A 1O3TA 2LF7A 1XCVA 3PFIA 2VOPA 2V1DA 3HSEA 3T1BA 4NB5A 1TW2A 4YIIA 2A6EF 2MLKA 3ZQ7A 4HX7A 4U0WA 4YFKF 3TO9A 2WTEA 3O6BB 1IXRC 4MGRA 2ZXJA 4Q47A 4EV0A 2IA0A 4GXOA 4LJZF 1G3WA 3BWGA 5FLXK 1QQIA 2XAJA 4ENKA 4UNOA 3CUQB 5HVQC 1BBYA 3SQNA 3GZ6A 4HDVA 1FYMA 3F8NA 4CDGA 1FNNA 1MD0A 4IRIA 3B73A 1ZRDA 4JBAA 3LSTA 1E2XA 3IRQA 3FMRA 5EEGA 3L09A 4U88A 1BC8C 4H0EA 2A07F 5FO5A 4MTEA 5LHHA 2IRFG 5L3BA 3MWMA 4P55A 4OINF 3GUDA 2EV5A 5H6RA 1FSEA 1F4KA 4YG2F 2HEOA 5LEKA 3QOPA 3DV8A 4QWQA 2VXZA 3FMQA 3IWFA 3CDHA 3DQVC 2PLYA 2XASA 3TO6A 4M9XA 2EFNA 4L9NA 3JTGA 4Q4ZF 4WWCA 4EM1A 3WU1B 5CVUA 5KVRA 1JXSA 1RZ4A 2IW5A 2RN7A 1XSVA 3WGHA 1AOYA 2NS0A 1EH6A 2BEOA 4EJWA 1S29A 3R61A 4UVCA 5D5UB 5BOXA 3WTYC 2CFXA 2YR2A 1LDDA 2R3SA 3MFKA 2P7CB 4KMFA 2J5OA 3FHZA 2VC1A 3QAHA 3BOQA 3RKWA 1USTA 2X4HA 4I0AA 2O3FA 3HOSA 3HHHA 3RPUA 3I4PA 4A6EA 2P8TA 1PP7U 2X0LA 1BIBA 2HKXA 1Z9CA 1DPUA 3ECHA 4EM2A 5BS6A 2Q8KA 2L4MA 4U0VA 3E6BA 5HDGA 4LGWA 1TQIA 1KU3A 2HR3A 4M9SA 2FRHA 5LRSA 4KA4A 1YLFA 1TNSA 3IHUA 4K2EA 3FF5A 1H9GA 2EV6A 3EYYA 2NYXA 2JPBA 3E5QA 4D0PA 2Q2EA 4CZZA 3H92A 3HRUA 4EGYA 4L9JA 5D8KB 5JFRA 2V9VA 4I09A 1B9MA 3VODA 4AVPA 2HWVA 2DQLA 3FXQA 5D4SA 1IN6A 3E5UA 2H27A 2PI0A 1JE8A 2ZCWA 4S04A 3G73A 4HLXA 1WKMA 3G3ZA 3RPQA 3I5UA 4G7HF 3OOPA 4GYGA 1P4WA 3K0LA 1FYLA 2DQRA 3HRMA 4G7ZF 4OIPF 4Y13A 2EA2A 3MAJA 3J80Z 4CO8A 4L0ZB 1SMTA 3CO7C 3B02A 5D5VB 2IPQX 4IVNA 3MCZA 5D4RA 3I59A 5D5WB 3WTZA 3EYIA 4L9VA 1YTYA 3VEPA 3R0AA 4YIFA 1BI2A 2XV4S 2EFWA 3VB2A 4KN4X 5LGNA 4ESFA 3C1DA 1KQ9A 2HQNA 4IPAA 4ENJA 3LA2A 3QPTA 3IKVA 1HW1A 1BI3A 4BH9A 3ELKA 1DUXC 4HYEA 2VT2A 3RKXA 1J7KA 1RI7A 1UHMA 4XLPF 3KP2A 1Z91A 2VBYA 2VBXA 5DD8A 3GEZA 4ZYEA 3M9AA 4EM0B 3NEUA 5BMZA 3M7GA 2CWEA 1IRGA 5LHGA 2UZKA 5CYVA 3E6DA 3DF8A 1S3JA 4HX8A 1XCBA 1JHFA 2WWYA 1DP7P 5HS9A 3ZMZA 4RB1A 3FXUA 5EEHA 5FD5A 1YS7A 1ONVA 4EJVA 3U1DA 1LJ9A 4G7OF 3V4GA 2Z9OA 2Z5UA 4ETSA 3E3VA 2FBKA 3DPLC 3KEQA 2GZWA 2LF8A 5DUIA 1FBQA 1YW7A 2OBPA 2DU9A 4XSZF 4EQQA 5AIQA 1GXQA 4ZYHA 5LGTA 3IC7A 3ZN1A 2R7DA 2PMUA 4OIRF 5JHUA 4MHGA 3QRFF 1KQ0A 3F23A 2PG4A 5E1ZB 2PJPA 1K6OA 3WTUC 2RGVA 2LSOA 2P6TA 1SD4A 1XDSA 5E20A 4XRFA 1G3TA 2XROA 2WC2A 3WTXC 3RTRA 4PGHA 2HZTA 3GF2A 2V1XA 2Q0OA 1IF1A 2A5YB 1SMYF 1MJ9A 3F8CA 2KIMA 1I1GA 2XAFA 3E5XA 3WE2A 3ZN0A 3F8MA 4YFXF 1QO0D 2ELHA 3I59B 4IJAA 1K7AA 1ZLKA 1BM9A 3U2RA 1SFEA 3JAMZ 2OU2A 4MQVA 1YO5C 1ON1A 4R79A 1OYIA 1BOAA 2KIUA 3KEOA 1U5TC 1KGSA 2XIGA 4NQWA 2L4AA 4XLNF 2PBIA 4GGGA 3GYHX 1AWCA 1UCRA 1OMIA 4FT8A 3RYRA 2NRAC 4WXCA 1KU2A 1SFXA 1HSTA 4L5IA 2FOKA 2AXLA 5TRDA 3KZYA 2P5KA 1XDUA 2VE9A 2FA5A 2QBYA 1T0FA 1XSDA 2DBBA 1RNLA 3GZ5A 4BHCA 4WXHA 4I2OA 4I0BA 3F8FA 4KNYA 2G7UA 2Z99A 1ZREA 1FY7A 3DP7A 2PMHA 4UUVA 1XGMA 4EJUA 2Z33A 2ISYA 3E6CC 3F22A 3FM3A 2MH9A 3GFJA 1WSUA 1GVJA 2CW0F 2DI3A 2LDUA 3I0TA 1JGSA 1HKSA 5HDKA 4AIHA 1I6XA 3ULQB 3CLOA 4P9FA 4LLLA 2GA1A 2JT1A 3V8KA 1RUOA 2IA1A 4U0YA 4I02A 3HIFA 3ROUA 1K79A 2MC3A 3P9KA 1HW5A 1KYWA 2WV0A 4ESBA 5E1WA 2FEZA 4I98B 5TJJA 3K9TA 1K78A 1RUNA 4CICA 2MA3A 5FGMA 2E7XA 4A5NA 2GQQA 1GXPA 4OOIA 3MZHA 3P9IA 5CVVA 3GX4X 2ZMEA 3JTHA 4QLCU 2OQGA 4ON0A 2RV8A 3SZTA 5K5OA 3ZPLA 5E8IA 1PP8F 3NRVA 2QUFA 2ESNA 2QM3A 5CVRA 2ESHA 3WTTC 2D45A 1Z6RA 5BPDA 1EH7A 2AS5F 4IHSA 4CGZA 5DD4A 1HKQA 3TQNA 1LDKB 2ISZA 3L7WA 4IHTA 1PDNC 3PQKA 4BYYA 5ILVA 3WTWC 4RB2C 2FF4A 1T39A 1QGPA 4HQMA 1ZH5A 3M8FA 5HDNA 1ZHFA 1FLIA 3RIRA 3TOAA 2GXGA 1D5VA 5K5RA 3J81Z 3KP5A 5AONA 2TDXA 4A0ZA 1J0RA 2YPRA 2H09A 1D8JA 1ZLJA 1O3SA 1KA8A 1B9NA 2O03A 2XKOA 2CQKA 2E1NA 2XHKA 5CVIA 4I7HA 4HBLA 4XBFA 4EGZA 2XVCA 5IT3A 2XAHA 2QBYB 2EK5A 4MEXF 4U7DA 1G3YA 1E17A 1FP2A 2HYGD 4TV7A 1R1TA 2BYVE 3BJOA 1MJAA 1XGSA 3F72A 3QP6A 4HF0A 3GLXA 2QLZA 1DPRA 4A12A 4AWXB 3DKWA 4Y17A 3F6OA 1BJAA 1F5TA 2COMA 4XSXF 3KETA 5HOOA 1IXSB 1PUEE 1TBXA 4ZZLA 1G3SA 3RDIA 5K1YA 4DQ2A 2O6GE 5L3DA 2DPDA 3WE3A 4M71A 1BI0A 3BY6A 3R6SA 3SXYA 1IAWA 4HA8A 2W57A 4F7ZA 4FHTA 1LVAA 1ODDA 5CJ9A 1YG2A 1TQPA 1ZAOA 4UV9A 4RB3C 3M1EA 4P9UA 1SFUA 1KU7A 2QWWA 2F5DA 3V7RA 4B09A 1K78B 1J2XA 2YX7A 4RAZA 5BQTA 2H6BA 4KUMA 2HDCA 4L0YB 2KJCA 2FBHA 2ZMEB 3BPXA 1QPMA 3KCCA 2STWA 4M9ZA 2BBYA 1P2FA 5LEJA 1ZARA 3FZVA 3SFZA 2VC0A 1TNTA 1TW3A 1B1BA 1S6LA 1W5TA 3WG9A 1SD6A 4AIJA 3BP8A 4CXFA 5DCFA 3SHFA 3RYPA 2HTSA 3EUHA 3KLNA 3JSOA 3J7AO 2VODA 5DYMA 1FYKA 3HUGA 4JK1X 3QP5A 2M1BA 1X3UA 1KQ8A 4GO1A 2M30A 3EDPA 2ZBKA 4G6DA 2A6HF 1V4RA 1P4XA 4M74A 2H94A 3CTAA 3C3WA 2W24A 2XKPA 3GVAA 1YYVA 2DTRA 4UHTA 2EB7A 2UXXA 2YX4A 1ZRCA 3LFKA 3M8EA 3U9GA 1RIOH 1LEAA 3KP6A 3OV8A 4HF1A 4Q48A 4M6YA 1FX7A 2IVMA 2JRTA 2L54A 4LMYA 4BAYA 4RS8A 2JSCA 2PFBA 5FFZA 4O6JA 1YIOA 4ZH4F 4KDPA 5H6QA 2GA2A 1IN8A 2ZJ2A 4JQFA 3I58A 2HQRA 2W25A 2XAGA 1W5SA 3WTVC 4YFNF 1WRJA 2EA4A 2EJRA 5DCMA 3I71A 2Y48A 3GWZA 2A68F 3P9CA 1EV7A 2ETHA 1XB4A 1LEBA 2Z3YA 3BZ6A 3ML6A 2VOOA 2CO5A 1H9TA 1I1SA 3REOA 5HLGA 1FBSA 4KFCA 5E1XA 4BHPA 1XD7A 1P6RA 5J6XA 2HGCA 1O57A 1R36A 3CUQC 2XUBA 4ZYDA 5D5XB 2HOEA 2D1HA 2K86A 3LQQA 3F6VA 1J59A 2P5LC 1STZA 2VONA 1EH8A 1GHCA 4ENNA 4M72A 4IXAA 5JI6A 4RGXA 2K4JA 3K69A 3LAPA 1SD7A 4IF4A 5IT9K 1IRFA 1J9IA 2QVOA 5A2QK 2FBIA 5ILUA 3FM5A 5ERIA 1MGTA 4LB6B 4OIQF 1JHHA 1R7JA 2HTJA 2OA4A 2PN6A 4A2UA 1MJBA 5F6FA 3QU6A 2RDPA 5JR3A 1T38A 5AIPA 3H3UA 5L3CA 4HAMA 1W7PA 2EFOA 3HYIA 3V8LA 1V3FA 1ZRFA 4OMYA 5F64A 3FXRA 3FMSA 3TDUC 4HZFA 2M5WA 3ZMUA 4HW0A 2QQBA 1YS6A 5CLSA 3ERED 4ASNA 2EFQA 1HSJA 1XGNA 1OYWA 2UWMA 1QNTA 1Z6TA 2DK5A 3D0SA 2XRNA 2MBFA 5JVTA 4KIBA 1BC7C 2IJLA 4OIOF 4S05A 1O7FA 3F8BA 1U8RA 4RGRA 2IA2A 1YQAA 2D1VA 1DDNA 3N4MA 5LRRA 1OPCA 2C6YA 2O61A 4KICA 4N9IA 2UXNA 5DCMB 2RQPA 4G6QA 4RAYA 1P4AA 3P7NA 2QENA 3C18A 4R8HA 2OZUA 5D6FA 3ABTA 3JAMK 4Q5SF 1L0OC 1IN7A 3ISPA 3JW4A 1FZPB 2QQAA 1ZGAA 3TO7A 4BNCA 1D3YA 2KJBA 2RVCA 2DK8A 4HV5A 4KMUX 4G9YA 1FBUA 4R1HA 3HOTA 1WQ2A 3KP7A 1XMKA 2K02A 3LA7A 2F5EA 2PQ8A 5E17F 3COAC 1W7PD 4LD5A 4FX0A 2HYFA 1Z7UA 3WTSC 1W4MA 2KRFA 4HQEA 3R0JA 2E1CA 2Y0MA 2LNBA 3KZZA 4CYDA 5DUKA 3LQRA 3DPTA 4UV8A 1U2WA 4KIGA 1ON2A 5FB2A 1U78A 2FXAA 1T98A 2V6CA 1W7PB 2VBWA 3IWZA 2KKOA 3DXJF 4L9TA 4ESJA 1U5TA 5L3FA 5E8GA 4KT5C 3IL2A 2GAUA 4HLYA 5FLXZ 4EMSA 1SAXA 4MEYF 1SD5A
chains in the Genus database with same CATH superfamily
1TT5B 3L2RA 1HCRA 4V19K 2KIFA 4U7BA 4J19A 2MGQA 2E1MB 1OYYA 3IAM2 4CHUA 1TQMA 3FISA 1R23A 1ERDA 4EVIA 3L00A 3QPLA 5K5QA 2HZDA 2GIZA 2JVGA 4CA0A 4DGWB 3E0JB 3MKYB 5DM6F 4IKFA 1ACIA 1DU6A 2O5RA 3IKTA 1GUUA 3PQJA 5E18F 1W36D 2MD5A 2E7WA 3DEEA 2VQCA 1IJWC 1T2KA 5FLMJ 5LLQA 3T0YA 3F3XA 3S2WA 3ECOA 1R1VA 2L9SA 1R22A 4KT6A 4A0YA 1B72A 4OMZA 3HSRA 3I64A 2JUCA 3K4MA 3MEXA 4RGSA 3W3CA 4E6KG 4BQQA 1MDMA 2EBIA 4PZJA 2CYYA 4KYWA 3CCVI 2XGXA 1JUPA 3BC8A 4RGUA 3OYMA 5EEAA 2ZNZA 3K1NA 3K6GA 3J81K 4ENMA 2DMQA 2MSYA 4XL9A 5HNHA 3Q5FA 2LKPA 2ZKZA 2YU3A 4FE4A 4JOMA 1O3RA 4BUPA 3T5XA 4L5JA 5FD6A 4G8XA 2DT5A 2AQEA 4C3IJ 2WAEA 2X85A 1QVUA 3OYJA 1A31A 4BXUA 4P96A 3FWEA 3S1MJ 2Y9ZA 5M5WJ 1J75A 1I3QJ 4HF2A 4XRSG 2H8WA 2IGMA 3QU3A 4DZPA 1I27A 3OYAA 5HLIA 1MMGA 2DW4A 4IOAF 3LSHA 1R71A 1S9HA 4L5EA 2IT0A 2MLGA 3L2CA 2NNNA 2FSWA 2VJ4A 3ZQHA 4OU0A 2W00A 1X19A 2Y75A 1FEXA 3BJ6A 3HHGA 3ZQQA 2JPCA 2HXOA 1R00A 1YITI 3KE2A 4GCVA 3ZMTA 1MMDA 1SVMA 5ILSA 4IOCF 1IXCA 1Z77A 3VYRB 4QTRA 1WCMJ 1Q1HA 2HI3A 4LFUA 1HQCA 4Y52J 5ICCA 2HU9A 3H5RA 1IUYA 3GBGA 5CQEA 3HRTA 1JT0A 1V55H 4ZTFA 2ZC2A 4MNUA 5HLTA 2GIVA 4OWRB 3OIQA 4WK8F 2XAQA 3EUKL 3BZCA 3ZOBA 2EWNA 3FDYA 4BQAA 1LB2A 3DTKA 1VQNI 2P4WA 3V8JA 1I5ZA 2CV2A 3IH3A 2TRTA 3LSRA 3CMAI 1YHQI 1BN5A 2B0LA 2MG4A 3DBRB 3DEUA 3GFMA 4M6VA 1U6GA 2EFPA 5DDGA 1ZG3A 3HKZN 1YFHA 2HVSA 1R5GA 1P92A 2F5FA 3CDLA 3DKXA 5FFXA 4B47A 4WCGA 4Y4RA 1YOVB 3RKYA 5ICFA 1MBJA 2XGEA 3HOWJ 1ULYA 3BPVA 4V2GA 1JI8A 5EGOA 3L2VA 1A04A 3HSFA 3AG1H 1O7LA 1BW6A 1E0EA 1TTYA 4F93B 3FBNB 3GFLA 3GXOA 4XR6A 1O3QA 2EPFA 2KQRA 1XN7A 1RKTA 1U5TB 3Q0WA 4FX4A 1ETQA 2FD5A 1REPC 3TDZC 4V2FA 4UUSB 1YIJI 3QPHA 5DEQA 1F1ZA 4CYCB 2VE8A 2JQ7A 2L9VA 4KISA 4NUBA 3E97A 5HODA 2YU9J 1HXDA 4C3HJ 1Y0NA 3KFWX 1QZYA 1FPQA 3EUAA 3T8RA 3CCRI 4B1RA 2FX0A 2OF7A 4M3BA 3C7JA 1MMNA 3K4CA 3LSMA 4E7KA 2E36A 4WF2A 3ZMVA 1R58A 3Q9SA 3TOBA 2IP2A 3BR0A 1H0MA 3WU0A 4CZCA 2VKHA 3DFGA 4PCQA 2E1OA 4NHJA 1TWGJ 1B4AA 4I01A 2LY9A 3R60A 4F91B 2VKDA 3MZYA 4BJTA 5GPCA 4M3GA 4BE0A 4Z2YA 4P5OA 2B63J 2ACJA 1OCCH 2BE5F 5LBQA 1A6IA 1XGOA 2ZFUA 4GRIA 2KDOA 1WWXA 4ZJZA 2VJJA 5J1RA 4PDKA 3CJTB 4RAFA 2LY2A 3S15J 2FNPA 3HM5A 1IN4A 3H3ZA 2NNYA 3OSFA 4XLFA 2L01A 5L3EA 3MQ0A 3F21A 2FMYA 2VB6A 2KDZA 1U3EM 1CF7A 1ORKA 1ETYA 1B72B 1TC3C 2QA4I 5BPIA 1MDMB 1QPIA 1Q1VA 2DO7A 2R7FA 1VQ6I 3CF5F 4BHBA 1D8KA 2AHQA 2K7LA 4HX4A 4AIDA 3IRRA 1QZZA 2R5ZA 1HBXG 2CFOA 4IEJA 1WJ5A 3GW2A 4LLGF 5M3MJ 4I6ZA 2AO9A 5E3NA 2FMLA 1B59A 4BJ5C 3UR3C 3WGIA 1S7OA 3PNVA 1Z21A 2ID3A 1DP3A 1OQYA 3FXLA 1MIJA 2ICWG 1IW7F 1X4PA 5F1RA 1YW9A 2VPLA 4G94A 1RPWA 4M3FA 3EETA 4PGGA 1WJCA 4A69C 1DQUA 5HS7A 5ED4A 2HFHA 2EINH 3G2BA 3FXKA 3KLOA 2L02A 3LA3A 4HSRA 5D6EA 3GTMJ 2HS5A 1D0YA 4IRGA 1Y1VJ 3S2HJ 4LK1F 1KU9A 3J80K 2LH9A 2MH2A 3FK6A 2E5ZA 2VT3A 3HRSA 4N9HA 2QEXI 4AD9A 4A5MA 5KK1A 1NG6A 4PFOA 4G6TB 3HXLA 4YELA 3S1RJ 4C9YA 3BDDA 2M8EA 2ZJRF 3ZMSA 2V6EA 1ZG1A 3QYEA 4E7HA 2W84A 1P7JA 3OYIA 2DAOA 2PMZN 3SDGA 4E7ZA 4FTHA 3WODF 1LPQA 1ETOA 3AG2H 3DTIA 3DBHB 3PSFA 1KZHA 2P6SA 4KN7X 1LFUP 4HDUA 3Q3SA 3HTUA 1NHAA 2RNJA 4UVAA 2P0WA 1RR7A 2DA4A 3OYBA 1IUFA 2O0YA 2VKEA 1R1UA 2GXBA 2ZO4A 4DYRA 3JRDA 1NK3P 1ZN2A 3O8HA 2FQ3A 1SFOJ 1OR7A 2NOGA 2JZYA 4EJOA 3ABKH 1L3LA 2G7HA 2VN2A 3RJPA 2DT6A 1OJLA 3WHCA 1FOKA 4DYCA 2BV6A 5HLHA 4ZZDA 1RETA 4HPQA 4KIFA 1YE9A 2HKOA 3QYFA 1USSA 3B6CA 2DPUA 3JRAA 2EV0A 3ZMDA 1LNWA 4E70A 2B9SA 1T6SA 3ESWB 4MFDA 2A3SA 3W2VA 2QZ8A 2X1EA 1IN5A 2KT0A 1MBEA 2BGCA 5J8CA 3FX3A 3FKIJ 2GLOA 4X0GA 1UHWA 5IT9Z 3ABUA 3D5LA 3L9FA 3A03A 4XNFA 3H0DA 2FE3A 1FTZA 2Z2SB 2PEXA 5A2QZ 1SAUA 2WY8Q 4UXNA 3EQLF 2XDVA 3KP4A 3JSPA 1FWZA 5ICGA 3K1PA 3OSGA 2ADUA 4B44A 3KP3A 5FJ8J 1A36A 4O5VA 5KAFC 4HV6A 3T8TA 4BJ6C 3E6MA 3BTIA 4LG0A 2V79A 1XSXA 2BHYA 3SZPA 2G9WA 4MQ9F 5FKKA 5GADJ 1WI3A 2ECCA 3H36A 2DA5A 3H9QA 3HJEA 4BXFA 3PIPF 1T0FC 3DKYA 2ZFWA 3ONQA 3BLYA 3JRHA 2V1NA 2M9HA 1IGNA 1BI1A 4CCOA 4XRSA 1ETWA 6PAXA 3GTPJ 1IDZA 4A93J 2R92J 3PNTA 1TWAJ 3TGNA 1AU7A 1FOXA 4BY7J 1OCOH 4D5CA 3H3VK 1S8NA 1VQ5I 4HG2A 1WI9A 3EPZA 5J8FA 1C0WA 4M6XA 1F9NA 4UVBA 2V1UA 1CF7B 2EZKA 2ZNYA 2Q2EB 5D8LB 2LC2A 1LVKA 2K4BA 1FSHA 1YW8A 2EH3A 1X2MA 1Z67A 2DLLA 4O3MA 2D2WA 1H89C 2WB1A 3VFZA 1PYVA 2HDWA 1IZ1A 4I76A 2R5ZB 4E7LA 2QYOA 4A6DA 1FT9A 2XC7A 1XTAA 1CGPA 4MLOA 2M87A 2W85A 4OAZA 3L2UA 2H8RA 9ANTA 4D1QA 4LK0F 3PM1A 3CJNA 1J5YA 2A5WA 3I54A 3GFIA 2M45A 2M3AA 3LWFA 2KISA 3BG5A 4IRHA 4AIKA 2JJ7A 5HS8A 4NC6A 2BY2A 2R7VA 5C4XJ 2LY1A 2OZ6A 3BCBA 4Y7NJ 2VBZA 3O3KA 2M8GX 2XPUA 2V4JC 3DCFA 2PJRA 1LDJA 4FE7A 5F27A 4WXDA 1R5HA 3Q9VA 2M34A 5CVJA 4L18B 2OAZA 4MTDA 2H1LA 2WBMA 1G4DA 3V7SA 4B4CA 1OKRA 2Y2ZA 1Z05A 2CUFA 3H0GJ 1B6AA 1ZELA 4A0XA 1KYZA 4DNCA 1UMQA 2CUZA 2HNHA 3CUQA 3N97A 4HNUA 2F5CA 3S17J 3S3MA 2QQ9A 2CG4A 3JRBA 2CQQA 3CUOA 4AC0A 2KLOA 2OD5A 2K27A 2CGPA 3WGGA 1A6QA 1R4NB 1FIAA 1LKXA 3LAJA 1OFCX 1Z1DA 2ZMEC 2LRDA 1IV8A 3CO6C 2F48A 2ZB9A 4D7NA 3HTSB 2CUJA 3W6JB 2QSHX 4GYIA 4A3IJ 3R4KA 1X1CA 4RB0A 2F2EA 1FP1D 3V7CA 5H2FC 3BJAA 2ZJPF 4EJTA 1FC3A 3HPGA 3KX2A 3ABMH 2TCTA 3K2ZA 3AG3H 1MZBA 2VJIA 3BROA 4HOBA 2NAZA 3GTQJ 4MO7A 2A69F 2IGKA 4LB5A 2XSJC 2RREA 3QYBA 4FCYA 2HYJA 5F1JA 1BIAA 1ZGJA 2HQ5A 2JK3A 2OQRA 2XAUA 3FBIB 2RKHA 1PVEA 1AHDP 2KMUA 1HDPA 4FETA 4RMNA 3ZCOA 4DOZA 1S7AA 2GM4A 3PFYA 3NWSA 5LHIA 2XF7A 3K1MA 3DBLB 4XKWA 2H6CA 3VSKA 3AAFA 2IGOA 3ZQLA 4Y15A 1VQ7I 3TKYA 1Y39A 1D1BA 3W2WA 2Q1ZB 3ZP5A 1QBJA 1MKMA 2L3DA 3FIWA 4LLNA 1W0UA 2RC4A 2DFIA 3RI4A 5L3GA 4M73A 2GWRA 1VI0A 3VOEA 1ZKGA 2DA2A 4MIMA 3AFHA 5B1AH 4C30A 3MN2A 3AG4H 5GPAA 5LGUA 3NQOA 5H20A 2F4MB 2L7MP 3OYLA 4YRVA 2HOTA 4LG0B 3AL0C 2Y31A 1HW2A 2E2IJ 3OYDA 1Y1WJ 2P7VB 5DV5A 2O8XA 1ZYRF 2H1KA 4LOCA 3OYEA 2K5CA 2A61A 1I6HJ 1BR1A 2XB5A 4C2UA 4BU2A 2J5PA 1Y0UA 1ZG5A 2ID6A 2ME0A 1TLHB 3GO5A 4ZYGA 3HB9A 2VKVA 4N0BA 2P5VA 2CSOA 4F52A 1HKTA 2YSRA 2E60A 2FU4A 1UB9A 1UFMA 3W6KB 1T56A 4RLFA 4B8XA 2JA7J 3O2PE 2XF6A 1G6NA 1MNEA 5ICEA 2JTVA 2STTA 2EIKH 1LQ1A 3I53A 1XMAA 2FNAA 1VTNC 1N25A 3IH2A 5GAGJ 4WX9A 1O3TA 2Y30A 2LF7A 1XCVA 4ZDLA 4IX7A 4FASD 3H9GA 2HDDA 1Y56A 1OCRH 3A01A 3PFIA 2VOPA 2V1DA 2IGNA 3HSEA 2CU7A 3T1BA 4NB5A 1TW2A 1A5JA 2UUZA 2JUGA 2FJ1A 4YIIA 2A6EF 2MLKA 4HRIA 3ZQ7A 4HX7A 4U0WA 4YFKF 3TO9A 3S1QJ 2I10A 2K40A 2WTEA 3O6BB 1IXRC 5IOZA 3CP8A 3CC2I 1EKEA 4MGRA 2ZXJA 3G1LA 4Q47A 1MMAA 4EV0A 2IA0A 4BQNA 2PJRB 4GXOA 3V42A 1P7IA 2DODA 5F0FA 5J3LA 4LJZF 4LG3A 1G3WA 3BWGA 3J7YJ 3MKWB 3GCMA 4G12A 5FLXK 4A3LJ 1QQIA 2XAJA 2ELJA 3ZR8X 1ENHA 4ENKA 4UNOA 3CUQB 5HVQC 1RRJA 5CPRB 1BBYA 4CCNA 3KIOA 3SQNA 1G59A 3OYKA 3GZ6A 4HDVA 1FYMA 3F8NA 4CDGA 3KPHA 1MBHA 1FNNA 3RKQA 1MD0A 4IRIA 3B73A 2COBA 2DFFA 4D5FA 1ZRDA 4JBAA 3LSTA 1E2XA 2BY3A 2LMDA 3IRQA 3FMRA 5EEGA 3L09A 4U88A 1BC8C 2EZHA 1ZGWA 1GV2A 4H0EA 2A07F 5FO5A 4MTEA 2NVQJ 3K4JA 5LHHA 2IRFG 3W2AA 5L3BA 3TW7A 4NQWB 3H5AA 3OR1C 2B7EA 3MWMA 3DU5A 4LIUA 4P55A 4OINF 2HPIA 2FOWA 3GUDA 2E19A 2EV5A 2LOOA 4AUXA 5H6RA 1FSEA 1F4KA 1POGA 4YG2F 3ABLH 5TGTA 5EZHA 1QHHD 1VFCA 2HEOA 1QHGA 5LEKA 2ZJQF 3QOPA 3TL4X 5JHFA 3BR1A 4AYBA 3DV8A 2QGUA 4QWQA 3VPRA 2VXZA 2LYCA 2VIXA 1TWFJ 1G2HA 3FMQA 4HEA2 4UUTA 2L7FP 2KZVA 3IWFA 4XN3A 3OYCA 3CDHA 4RBOA 3JR9A 1Z3XA 2Z1DA 3EUHC 3WG7H 1JUMA 1WJBA 3DQVC 2PLYA 2XASA 3TO6A 2BW3A 4M9XA 2DYSH 2EFNA 4L9NA 1LFBA 3JTGA 4Q4ZF 5J4YA 4WWCA 4EM1A 1YI2I 4XOTA 3WU1B 1Z3YA 5CVUA 2YS9A 5KVRA 4BQOA 5FRNA 1JXSA 2M4GA 3HL2A 4DBRA 3OWTA 1RZ4A 2IW5A 4XOPA 3P5JA 2NS8A 3M3YJ 2GBYA 2RN7A 3GMEA 3CJQB 1XSVA 3WGHA 2MD0A 1AOYA 2NS0A 2XPWA 3BR5A 1EH6A 2BEOA 4EJWA 1S29A 2L2OA 3R61A 3I4NJ 4UVCA 5E3LA 5D5UB 5BOXA 3WTYC 3HOXJ 4HNVA 1OCZH 2R7OA 5B5EC 2CFXA 1V5FA 2YR2A 2WY7Q 1LDDA 2R3SA 4ANJA 5B3SH 3MFKA 2P7CB 4KMFA 2WV1A 2J5OA 3ERMA 1UAAA 3FHZA 2VJ5A 2VC1A 3QAHA 3BOQA 1X3ZB 3RKWA 4B48A 1D1CA 1JGGA 3A01B 1USTA 2X4HA 4I0AA 2O3FA 3HOSA 5IPAA 5J4VA 2EILH 4PFPA 2DA1A 3HHHA 1OCPA 3TW6A 3RPUA 4C2TA 1QRYA 3I4PA 2VXDA 5E3OA 3SZGA 4A6EA 5F0HA 4UY8I 2YUSA 2DMNA 3S2DJ 2P8TA 3OY9A 1PP7U 2OUMA 2X0LA 3FK7A 1B8IB 1BIBA 2HKXA 3K70D 1Z9CA 4M3DA 1DPUA 3ECHA 5E79C 1JTYA 4EM2A 2VASA 5BS6A 2MW8A 2Q8KA 1D1AA 2HXIA 5J47A 2L4MA 4U0VA 3BG9A 3E6BA 5HDGA 3GTLJ 4LGWA 1BA5A 4UB6C 2K9MA 3VWBA 1TQIA 1K83J 1KU3A 1PJRA 2HR3A 3TMOA 4M9SA 2QF7A 2FRHA 5LRSA 5C3EJ 2EIMH 1H88C 2R7SA 2LVSA 4KA4A 1OLTA 3JREA 2JWTA 1VF9A 2DTZA 1GVDA 1YLFA 2WAQA 1TNSA 3IHUA 3BG7A 4K2EA 2EQRA 3FF5A 1H9GA 3KEYA 2EV6A 3EYYA 3OOUA 2NYXA 2VQHA 1X2NA 2JPBA 2KL4A 3PO2J 1VQ8I 1T08B 2GXAA 3E5QA 2DDBA 4D0PA 2Q2EA 1IRXA 4PJJA 4CZZA 3ZQFA 1X1PA 2I5UA 3H92A 4BDYA 3HRUA 4EEFG 4EGYA 2L7ZA 4L9JA 5D8KB 1SANA 2V9VA 5JFRA 4CSWA 4UB8C 5GAEJ 1W0TA 4I09A 1B9MA 3VODA 4AVPA 2HWVA 2DQLA 3BR6A 3FXQA 5D4SA 4IHWA 1IN6A 3PL8A 3E5UA 3OYGA 2H27A 2PI0A 1JE8A 2R93J 2ZCWA 3ASOH 3BTLA 4S04A 3G73A 4LITA 4IHVA 2BY1A 3HGGA 4HLXA 1WKMA 3CJRB 3G3ZA 3AL0B 3RPQA 3PNYA 3HBLA 3M4OJ 3I5UA 2MFZA 4G7HF 3OOPA 4GYGA 1P4WA 3K0LA 4XM3A 5F08A 1YJWI 3FXJA 3LSIA 1FYLA 2DQRA 2BZTA 5EG0A 2WA0A 3GTKJ 3HRMA 4G7ZF 4DYQA 4OIPF 4Y13A 2EA2A 3BT9A 3MAJA 1ZR4A 1ZQ3P 2NOJB 1BR4A 4PK4A 3J80Z 4CO8A 3S16J 4L0ZB 1SMTA 5IP9J 3B02A 3CO7C 4A3FJ 3LL7A 4DZJA 5D5VB 5C4JJ 1RR8C 4X6AJ 5JLXA 4A3DJ 1LE8A 2IPQX 4IVNA 3MCZA 5D4RA 2BW3B 2LKSA 3I59A 5D5WB 1SVLA 3WTZA 4ITVA 3EYIA 2IBDA 3VYSB 4L9VA 1YTYA 1BJZA 3VEPA 3R0AA 1IO2A 4YIFA 4KITB 2VQLA 1BL0A 1BI2A 2XV4S 2V26A 2EFWA 3VB2A 1VQKI 2PX9A 2HOAA 4U87A 3J7ZI 4KN4X 5LGNA 2R7TA 4ESFA 4BGDA 3C1DA 2MYSA 1KQ9A 2X6WA 4Y33A 2HQNA 4IPAA 2M7BA 4DJAA 4ENJA 3LA2A 3QPTA 3IKVA 4X1EA 1HW1A 1BI3A 3G4SI 3MKLA 2VI6A 4N4NB 1WH7A 4BH9A 3ELKA 1DUXC 4BL0B 4HYEA 2VT2A 2DMUA 2E5NA 3RKXA 1DGWY 1J7KA 1RI7A 1UHMA 2LK2A 3A02A 4XLPF 5FRMA 3KP2A 1Z91A 2VBYA 2DYRH 1JKOC 2VBXA 5DD8A 3GEZA 2OJED 2NXNB 4ZYEA 2E1MC 1SC7A 3M9AA 4EM0B 3NEUA 1K6YA 1V5EA 5BMZA 3M7GA 1I3AA 4AM3A 2CWEA 2R7ZJ 1IRGA 5LHGA 2UZKA 5CYVA 3E6DA 2NVXJ 3DF8A 3NARA 2ELKA 1S3JA 4HX8A 1XCBA 2Y0SA 1JHFA 1LUJB 2WWYA 4CUGA 2DFHA 1DP7P 2M0MA 5HS9A 3ZMZA 1ETVA 4JX4A 4RB1A 3FXUA 5EEHA 5FD5A 1YS7A 1ONVA 4EJVA 1AA7A 2OTJI 1SEUA 3U1DA 1LJ9A 2DOAA 4G7OF 3V4GA 2VPRA 4CCKA 4XLAA 2VQGA 3E1SA 1Y6IA 2Z9OA 5F0CA 2Z5UA 4ETSA 3E3VA 2FBKA 3DPLC 4XN0A 2XGCA 4BKXA 3KEQA 1MBKA 1W1WE 2LR8A 4J01A 3FXOA 2GZWA 5IYCJ 2LF8A 5DUIA 4E7SA 1FBQA 1CQTA 4BBSJ 1UG2A 1YW7A 2QSFX 2OBPA 2DU9A 3ZQCA 3Q0UA 4XSZF 3A1YA 1NH3A 3N05A 2P81A 5IYBJ 3WHBA 4EQQA 1W36C 5AIQA 5FLVA 3L2QA 4IHYA 1GXQA 2K9NA 3SEZA 4ZYHA 5KHDA 5LGTA 3IC7A 3ZN1A 2R7DA 5EF6A 2PMUA 4OIRF 5JHUA 2KFDA 1QZEA 3BCAA 4MHGA 1SVOA 1TWHJ 2EZLA 1KQ0A 4PJ0C 4DW6A 3F23A 2NS7A 3QRFF 1FJLA 2PG4A 3ZQIA 2BVLA 5E1ZB 2LREA 2PJPA 1K6OA 1YRNA 4ZYAA 2HPMA 3WTUC 2RGVA 1HLVA 2LSOA 3CCQI 2P6TA 4XKCA 4AVZA 1SD4A 1XDSA 5E20A 4XRFA 1G3TA 2XROA 5JVGF 5EYRA 2R7XA 2WC2A 3WTXC 3RTRA 1O4XA 4PGHA 2JA5J 4GFBA 2HZTA 5KNLA 3GF2A 2V1XA 1U0JA 2Q0OA 5EG0B 1IF1A 2A5YB 1QVTA 1SMYF 3SJMA 2QCOA 4A3BJ 1MJ9A 4B3XA 2DJIA 3F8CA 2KIMA 5FKMA 1DGRM 1I1GA 2XAFA 3E5XA 3WE2A 5GP9A 4NBQA 3ZN0A 3QQAA 4BEHA 3F8MA 4GDFA 2KRHA 2M4KA 2RQQA 3LSJA 2DT7B 4YFXF 1QO0D 1WJAA 1LE8B 1EA3A 3BR2A 2ELHA 1F43A 3I59B 4IJAA 1K7AA 1ZLKA 1BM9A 3U2RA 4YEJA 1VQLI 1SFEA 3JAMZ 2OU2A 4MQVA 3GLLA 1QA6A 2ZXHA 1BR2A 1YO5C 1ON1A 4R79A 1OYIA 1PUFA 1BOAA 4F3QA 4II3A 2KIUA 3KEOA 2NVTJ 1U5TC 1KGSA 2XIGA 4NQWA 2L4AA 2QQ8A 4XLNF 2HQAA 2PBIA 2GOXB 5J1YA 4GGGA 3OIOA 3GYHX 1AWCA 2ZXWH 1UCRA 3MZ8A 2LLKA 2ECBA 1OMIA 4FT8A 3RYRA 3AKZA 2NRAC 1QU3A 5B1BH 1ITYA 4WXCA 3LSPA 1KU2A 1R49A 1SFXA 2F5VA 3MKZA 1HSTA 5K7ZA 3LNQA 4L5IA 1EF4A 3ZQGA 3RQIA 2X6XA 3CDIA 3CCUI 2FOKA 4CH7A 2AXLA 5F04A 5TRDA 3KZYA 2P5KA 3SFIA 1XDUA 1D0XA 4XIDA 4XLHA 4DIQA 2VE9A 1GDTA 2FA5A 2QBYA 1T0FA 3PIOF 1XSDA 3IAS2 3IV5A 1VNDA 2DBBA 3L1PA 1RNLA 2BOLA 3GZ5A 4BHCA 3CESA 4WXHA 1JJ6C 4I2OA 4I0BA 3F8FA 4NNJA 2F4OB 5C44J 4KNYA 3JRGA 2X6YA 2DOEA 2L9NA 4QPQA 2G7UA 3K4BA 2Z99A 2W82A 4HSTA 1R5ID 4XLCA 1ZREA 1S72I 1FY7A 4W1UA 3DP7A 4HNTA 3CMMA 2PMHA 3HKZA 2KRCA 5KCMA 3C2HA 4UUVA 3TP0A 1XGMA 4EJUA 2Z33A 2ISYA 3E6CC 3F22A 3FM3A 2MH9A 3A2KA 1X1DA 3GFJA 1WSUA 3CC7I 1I39A 2FQ4A 4EATA 3OYHA 1GVJA 3GTOJ 1MMSA 2CW0F 2DI3A 2LDUA 3I0TA 1JGSA 2OC6A 1N77A 1HKSA 5HDKA 2KPMA 1I6XA 4AIHA 4IHXA 3PUBA 3ULQB 3CLOA 2K9SA 2Z16A 4P9FA 4LLLA 2GA1A 2RNGA 2O9LA 3HOYJ 2JT1A 3V8KA 3I3LA 2JSPA 1RUOA 5CKTA 2IA1A 2NVYJ 4U0YA 4I02A 3HIFA 3ROUA 2E2HJ 3LSKA 1K79A 2MC3A 1HA8A 3P9KA 5K7FA 1HW5A 1KYWA 1UJ8A 2WV0A 4ESBA 5E1WA 2NVUB 5IOYA 4QPOA 2FEZA 4I98B 3K4LA 5TJJA 4A3JJ 3K9TA 4RDUA 1K78A 1RUNA 4CICA 2MA3A 5FGMA 5GTHC 2E7XA 1FOWA 4A5NA 2GQQA 1GXPA 1XG1A 1JJ8C 2XF5A 1WJDA 1YRNB 2OPTA 4OOIA 1R6RA 1MSFC 3VYTB 1D0ZA 3MZHA 3DWLE 3P9IA 5CVVA 3GX4X 2ZMEA 3JTHA 2LBFA 4QLCU 2ZSIB 2OQGA 1AKHA 1N78A 4ON0A 2RV8A 3SZTA 5K5OA 4PJNA 1X3WB 1B8IA 4JP0A 3ZPLA 5E8IA 2UV1A 1PP8F 3NRVA 2QUFA 2ESNA 2QM3A 2QSGX 4A3MJ 3GZNB 3SEQA 5CVRA 2ESHA 1MH4A 3WTTC 4BS9A 1Z6RA 2D45A 5BPDA 4N4OB 4CCLA 3ZXSA 1EH7A 4BEHB 2DN0A 2WB1N 4BE2A 1SFKA 1T95A 5DD4A 2AS5F 4IHSA 1HKQA 4CGZA 3TQNA 1LDKB 3A4CA 2R7UA 4P1WA 2ISZA 3L7WA 4IHTA 1PDNC 3PQKA 3U1KA 4BYYA 2CJJA 2HVQA 5ILVA 3WTWC 4RB2C 3LOCA 3OS1A 1I50J 2FF4A 4NDLA 4XQFA 3CCYA 2R7RA 1WPKA 1T39A 1QGPA 1MBFA 3SYTA 4HQMA 1RESA 1PUFB 2JMWA 3HG9A 1ZH5A 1VQPI 3M8FA 3K7AJ 1X1BA 5HDNA 1ZHFA 2N8GA 1FLIA 3RIRA 3TOAA 2GXGA 1D5VA 5K5RA 3J81Z 3KP5A 5AONA 1MH3A 3RZOJ 2TDXA 4A0ZA 1J0RA 4F55A 2Y9YA 3IUOA 1APLC 2YPRA 2H09A 3CCJI 3CZ6A 2CW8A 1D8JA 1FIPA 3G1OA 1ZR2A 1R9TJ 1ZLJA 1O3SA 5EZGA 1KA8A 1B9NA 1Z7LA 2O03A 2XKOA 2CQKA 2E1NA 1FOYA 3CMEI 2XHKA 1KONA 2O8KA 5CVIA 4I7HA 4HBLA 1X58A 4XBFA 4EGZA 5DM7F 3HPHA 3FKJA 2IS1A 3G71I 2XVCA 5IT3A 3CC4I 2XAHA 3X2QH 1IV6A 2QBYB 4BDZA 3W6VA 2EK5A 4MEXF 2X1DA 4U7DA 3E7LA 3M07A 1G3YA 3S1NJ 2XB0X 1E17A 1A35A 3BZKA 1FP2A 3BG3A 3HOUJ 2HYGD 4KJZA 4TV7A 5JLWA 1R1TA 1S5LC 2BYVE 3BJOA 1MJAA 1XGSA 2WADA 3F72A 3QP6A 4HF0A 3GLXA 2QLZA 1DPRA 2PMZA 3D5SC 5LFAA 1V54H 3K2AA 2OCEA 1JTXA 1IG7A 3HC7A 4A12A 4AWXB 1F36A 3DKWA 4Y17A 3F6OA 1BJAA 2L9RA 3RZDJ 1F5TA 2COMA 3IP4B 4XSXF 3KETA 3KYDB 5HOOA 1IXSB 1PUEE 1TBXA 3DPUA 4ZZLA 2ZXIA 3PUFA 1BW5A 1G3SA 3ZGKA 3RDIA 5K1YA 4DQ2A 2O6GE 5L3DA 1GV5A 1GLNA 2G0EA 3WE3A 2DPDA 4M71A 1BI0A 3BY6A 2BXZA 3R6SA 3SXYA 2EIJH 1IAWA 4HA8A 2X48A 2KP6A 1JT6A 2W57A 4F7ZA 3G6EI 4FHTA 1LVAA 1ODDA 5CJ9A 4PJMA 3QODA 1YG2A 3PJRA 1TQPA 3BG6A 1ZAOA 4CCMA 3OR2C 4UV9A 4RB3C 3M1EA 4P9UA 1VQ9I 1SFUA 1E3OC 2X6OA 3JCUC 2QWWA 1KU7A 2F5DA 4RA2A 3V7RA 2ME6A 4B09A 3JRIA 1XMXA 1T8IA 1K78B 1J2XA 2YX7A 2CMPA 3S93A 4E4HA 4RAZA 2FUG2 4IL6C 5BQTA 2H6BA 3FHNA 4KUMA 3Q0VA 2HDCA 1XS9A 1U9NA 4ZC3A 5K7HA 1IC8A 2MABA 3OS0A 4L0YB 2KJCA 1MNDA 2IS6A 5IY5H 3BPXA 2A6TA 2FBHA 2ZMEB 1QPMA 1VZ0A 3M8JA 2R5YB 2LBFB 3HDDA 1AKHB 3KYLA 2LFBA 3BQYA 2L7KA 4RLQA 2VLAA 1TZLA 3BQZA 3MVPA 1R4MB 3KCCA 3QWLA 2WAFA 2STWA 5M5XJ 3TEDA 4E7IA 2Y69H 2BBYA 4M9ZA 3JRCA 3C2BA 1RC9A 1P2FA 5LEJA 1YJNI 1ZARA 3FZVA 1XX5A 3SFZA 2VC0A 3DU6A 3QPSA 1TNTA 1TW3A 2OCCH 1B1BA 1S6LA 5FKNA 2IS2A 1W5TA 3WG9A 1SD6A 4AIJA 3BP8A 4CXFA 1TL8A 1OR7C 5DCFA 2BVMA 1G8XA 4PSXA 3SHFA 4XLEA 2E71A 3RYPA 1MSEC 2V9KA 2HTSA 3J7AY 2M2EA 4IO9F 3EUHA 3KLNA 5GTIC 1H8AC 3JSOA 3J7AO 2LP0A 2W4SA 3KZIC 5E3MA 5DYMA 1FYKA 2VODA 3HUGA 4JK1X 4B3AA 1TWCJ 3QP5A 1IDYA 1VQOI 2M1BA 4BXXJ 2CUEA 1X3UA 1KQ8A 4GO1A 2M30A 3EDPA 2ZBKA 4G6DA 2A6HF 1V4RA 1P4XA 4M74A 2H94A 3CTAA 3C3WA 3U21A 2W24A 2XKPA 3GVAA 3PSIA 1YYVA 2DTRA 4UHTA 2EB7A 2UXXA 2YX4A 1ZRCA 3LFKA 3M8EA 3U9GA 1RIOH 2DMPA 3F0CA 3S8PA 3I56I 4XORA 1UELB 1LEAA 3KP6A 3OV8A 4HF1A 3H5NA 4Q48A 1YX3A 4XKBA 4M6YA 4D9JA 4CCJA 1T33A 5EJCA 5HNFA 1YJ9I 1WGXA 1MNMC 1FX7A 2IVMA 3CLQA 2JRTA 3FXMA 2L54A 1FMWA 4LMYA 3F9KA 2A05A 4BAYA 3CCSI 2E34A 4RS8A 1FMVA 1MBGA 1WHUA 2CV0A 1OISA 2JRMA 2JSCA 1HC8A 1Y8QB 3DLAA 2PFBA 5TISC 2W48A 3G1MA 2XRLA 5FFZA 4O6JA 1YIOA 4ZH4F 4KDPA 5H6QA 3HEFA 3RPUD 2GA2A 2HOSA 1IN8A 1XC5A 2ZJ2A 4JQFA 4AYBN 5M3FJ 3I58A 2HQRA 3S3OA 2W25A 2XAGA 3VYUB 1W5SA 2DA6A 1XPXA 3CF2A 3WTVC 1MW7A 4YFNF 5DS9A 1WRJA 3OYFA 2EA4A 2EJRA 5DCMA 1NTCA 3I71A 2Y48A 1UHSA 2A68F 3GWZA 3LFUA 4LIVA 3P9CA 4RM2A 4XRMA 3OL4A 1EV7A 2ETHA 2DDAA 1XB4A 3I55I 1LEBA 2R0QC 5FKOA 3BZ6A 2Z3YA 3ML6A 1WJEA 1E3HA 4C3JJ 2CO5A 2VOOA 1NK2P 1H9TA 1I1SA 3REOA 5HLGA 1FBSA 4OAYA 4KFCA 3S14J 3O8GA 3HOVJ 4A3GJ 5E1XA 2VL8A 4BHPA 4BY1J 1XD7A 1P6RA 2AXTC 4QSHA 3D5RC 5J6XA 3I4MJ 2HGCA 2R7WA 5B66C 1O57A 2JN6A 3SDBA 4Y3OA 2VUMJ 4A3CJ 3KYCB 2ZSHB 1Z0XA 1J09A 5CQGA 5J40A 5EGOB 1VQ4I 1R36A 3CUQC 2XUBA 3K4KA 1V5GA 4ZYDA 3RQ4A 3TP3A 1M1EB 5D5XB 4PJLA 5IYDJ 2BY0A 4BBRJ 3CCMI 2HOEA 2D1HA 3BR3A 2K86A 2CQXA 3LQQA 3F6VA 1J59A 4M3EA 3K10A 2JA6J 1RKWA 1STZA 2P5LC 4ZDPA 2VONA 1JKPC 1EH8A 3A0BC 4C2MJ 1GHCA 3MD2A 5BNGA 2L0KA 4M72A 4ENNA 1JKRC 4IXAA 3UNGC 5JI6A 1Y8RB 4RGXA 2K4JA 2CW7A 2XPVA 3K69A 3LAPA 1SD7A 3CP2A 3H35A 4IF4A 5IT9K 3HOZJ 1IRFA 1J9IA 2LKXA 2QVOA 5A2QK 3OYNA 1TP4A 2FBIA 3HGYA 3VDXA 5ILUA 3FM5A 5ERIA 1MGTA 4LB6B 4OIQF 3HZJA 4ZTJA 1P9QC 1JHHA 3PO3J 4E7JA 1R7JA 1HOMA 4AU7A 5DTDA 3M1CA 2HTJA 4S0HB 2JA2A 4A3EJ 5M5YJ 1S7EA 2OA4A 2PN6A 4A2UA 5LD2C 4B43A 2V9PA 2R7QA 4JYKA 1JKQC 2E35A 1MJBA 5F6FA 3QU6A 2L5QA 2RDPA 5JR3A 1T38A 4D7MA 3HUGB 5FKLA 5AIPA 3H3UA 4BACA 5L3CA 3CQZJ 4HAMA 5EDNA 1W7PA 2EFOA 2IEKA 3HYIA 1W5CC 3QOEA 3V8LA 1JUSA 1V3FA 3OIPA 1ZRFA 4OMYA 1WJFA 5F64A 2W7NA 1YX5A 3DEWA 3FXRA 3S3NA 3CD6I 2WAQN 4XKVA 4F92B 4IQ4A 3FMSA 3TDUC 4HZFA 2MC4A 2M5WA 4RM3A 4RAGA 3UKGA 3ZMUA 4HW0A 2QQBA 1YS6A 5CLSA 3ERED 1VQMI 4ASNA 3CCEI 1K4TA 3A0HC 2EFQA 1HSJA 1ZTRA 1XGNA 1OYWA 2BHZA 2UWMA 1QNTA 1Z6TA 2DK5A 3D0SA 2XRNA 2MBFA 3OMYA 3GTGJ 3H1CA 5JVTA 4KIBA 2K9QA 4H4KC 2X9DA 2I8DA 1BC7C 2IJLA 2K3FA 4OIOF 4S05A 1WZ2A 5FROA 1O7FA 3F8BA 4QIWN 1U8RA 4RGRA 2DXIA 1TT0A 2IA2A 2BXYA 1YQAA 4A3KJ 2D1VA 1DDNA 3TBIA 3CMYA 5LRRA 3N4MA 1OCTC 1K4SA 1OPCA 3NWTA 2C6YA 3WU2C 1WVRA 2O61A 2LTPA 4PSWA 2KIQA 2V7FA 4KICA 2W1OA 2O7OA 4FISA 2LG4A 4IQJA 1FTTA 4N9IA 2UXNA 5DCMB 2RQPA 4G6QA 4RAYA 4W97A 1P4AA 3P7NA 2QENA 3C18A 4R8HA 2OTLI 3JRFA 1ZK8A 2D5VA 2OZUA 1U9OA 3ABTA 3MMYB 5D6FA 1ETKA 5IP6A 2DA3A 3JAMK 5GAHJ 2KHMA 2IS4A 2OV7A 4Q5SF 3ZRGA 1L0OC 1IN7A 3BTCA 3ISPA 1DU0A 4ZDOA 4NC7A 3JW4A 2KZGA 3BTJA 1E3PA 2CS3A 3S32A 4BE1A 1GT0C 4JX6A 2QQAA 1FZPB 1D5YA 2CV1A 1ZGAA 3TO7A 4BNCA 1D3YA 2EZIA 2KJBA 4ABZA 2RVCA 2DK8A 2DJNA 4HV5A 2M0CA 4G9YA 4KMUX 1FBUA 4PUSA 4XONA 2K85A 5IP7J 4R1HA 2DFEA 1K61A 2DA7A 3HOTA 1WQ2A 3KP7A 3LSGA 2IAIA 2CH0A 1NG7A 1XMKA 2K02A 3LA7A 1U8BA 2K3PA 2F5EA 1UG0A 2PQ8A 3I9V2 3VSLA 2IXSA 5E17F 3RCOA 3COAC 1W7PD 4LD5A 4NC8A 4FX0A 1N75A 3K70C 4FQGA 2HYFA 4XMYA 3NAUA 4II2A 4DBQA 4XICA 1X4OA 3H9JA 1Z7UA 2DCEA 2CQNA 3WTSC 2XSDC 2XGDA 1W4MA 2CRGA 2KRFA 3B6AA 4HQEA 3R0JA 3GTJJ 1BOBA 3ASNH 2E1CA 2Y0SN 2Y0MA 4IZZA 2LNBA 1WH5A 3KZZA 2M7AA 2AQFA 4MFEA 4CYDA 2QKLB 5DUKA 2RAEA 2X1CA 1IRZA 3LQRA 3DPTA 1EJ9A 4UV8A 4YIRX 1HF0A 1U2WA 4KIGA 1ON2A 3LMMA 5FB2A 3RSNA 1U78A 2FXAA 3DLLF 2HVRA 2DOFA 1T98A 2DMTA 2V6CA 4XK4A 1W7PB 2VBWA 1UZCA 3DTEA 3IWZA 2KKOA 3CCLI 3D1NI 3DXJF 4L9TA 2R5YA 3K4NA 5KAIC 4ESJA 1U5TA 5L3FA 2X51A 3IH4A 3OS2A 4I99C 4UUSA 5E8GA 3L2WA 4JX5A 4KT5C 3IL2A 2GAUA 1X1AA 4CYCA 4HLYA 2JA8J 5FLXZ 1LFPA 1HDDC 2QKMB 4J00A 2R4GA 4EMSA 1SAXA 4MEYF 2JVHA 2F6CA 4Z6YA 2LD5A 2GOMA 2F4IA 1WFXA 2CQ7A 2K9LA 1ETXA 2E2JJ 3OL3A 1SD5A 5J1UA 3C2GA
chains in the Genus database with same CATH topology
2KIFA 4U7BA 1OYYA 4CHUA 1TQMA 1R23A 4EVIA 3L00A 5K5QA 3IKTA 3PQJA 5E18F 2MD5A 2E7WA 1T2KA 5LLQA 3T0YA 3F3XA 3S2WA 3ECOA 1R1VA 1R22A 4A0YA 4OMZA 3HSRA 3I64A 3MEXA 4RGSA 1MDMA 4PZJA 2CYYA 4KYWA 2XGXA 4RGUA 2ZNZA 3K1NA 3J81K 4ENMA 3Q5FA 2LKPA 2ZKZA 2YU3A 1O3RA 3T5XA 4L5JA 5FD6A 4G8XA 2DT5A 4BXUA 4P96A 3FWEA 4HF2A 1J75A 3QU3A 1I27A 5HLIA 2DW4A 2IT0A 2MLGA 3L2CA 2NNNA 2FSWA 4OU0A 2Y75A 3BJ6A 3HHGA 2JPCA 1R00A 3KE2A 4GCVA 3ZMTA 5ILSA 1IXCA 1Q1HA 4LFUA 1HQCA 5ICCA 1IUYA 3HRTA 4MNUA 2GIVA 4WK8F 2XAQA 2EWNA 4BQAA 1LB2A 2P4WA 3V8JA 1I5ZA 1BN5A 2B0LA 3DEUA 3GFMA 1U6GA 2EFPA 5DDGA 1ZG3A 1YFHA 1R5GA 1P92A 2F5FA 5FFXA 4WCGA 3RKYA 5ICFA 1ULYA 3BPVA 1A04A 3HSFA 1O7LA 1TTYA 3GFLA 3GXOA 1O3QA 1XN7A 1U5TB 4FX4A 1REPC 3TDZC 3QPHA 5DEQA 1F1ZA 2VE8A 3E97A 1HXDA 3KFWX 1QZYA 1FPQA 3T8RA 3C7JA 4WF2A 3ZMVA 1R58A 3Q9SA 3TOBA 2IP2A 1H0MA 3WU0A 3DFGA 4PCQA 4NHJA 1B4AA 4I01A 3R60A 3MZYA 4Z2YA 4P5OA 2ACJA 2BE5F 5LBQA 1XGOA 1WWXA 4PDKA 2FNPA 1IN4A 3H3ZA 2NNYA 2L01A 5L3EA 3MQ0A 3F21A 2FMYA 1U3EM 1CF7A 5BPIA 1MDMB 2DO7A 2R7FA 4BHBA 1D8KA 2K7LA 4HX4A 3IRRA 1QZZA 1HBXG 4LLGF 3GW2A 2FMLA 1B59A 3WGIA 1S7OA 1IW7F 5F1RA 1YW9A 4G94A 3EETA 4PGGA 5HS7A 5ED4A 2HFHA 3KLOA 2L02A 3LA3A 5D6EA 2HS5A 4IRGA 4LK1F 1KU9A 3J80K 2MH2A 2VT3A 3HRSA 4N9HA 4AD9A 4A5MA 5KK1A 3BDDA 2M8EA 3ZMSA 1ZG1A 2W84A 2DAOA 3WODF 2P6SA 4KN7X 4HDUA 3HTUA 1NHAA 2RNJA 4UVAA 2O0YA 1R1UA 2GXBA 2ZO4A 1ZN2A 2FQ3A 1OR7A 4EJOA 2JZYA 1L3LA 2G7HA 2VN2A 3RJPA 1FOKA 2BV6A 5HLHA 4ZZDA 4KIFA 2HKOA 1USSA 2DPUA 2EV0A 3ZMDA 1LNWA 4E70A 1T6SA 2A3SA 2QZ8A 1IN5A 2BGCA 5J8CA 3FX3A 1UHWA 5IT9Z 3ABUA 3D5LA 3L9FA 2FE3A 5A2QZ 2PEXA 4UXNA 3EQLF 3JSPA 3KP4A 1FWZA 5ICGA 3K1PA 2ADUA 3KP3A 4O5VA 4HV6A 3T8TA 3E6MA 4LG0A 2V79A 1XSXA 3SZPA 2G9WA 4MQ9F 2ZFWA 1BI1A 6PAXA 3TGNA 1S8NA 1WI9A 5J8FA 1C0WA 4M6XA 1F9NA 4UVBA 2V1UA 1CF7B 2ZNYA 5D8LB 2K4BA 1FSHA 1YW8A 2DLLA 4O3MA 2D2WA 3VFZA 1IZ1A 2QYOA 4A6DA 1FT9A 1CGPA 2M87A 2W85A 4LK0F 3CJNA 1J5YA 3I54A 3GFIA 2M45A 3LWFA 4IRHA 4AIKA 5HS8A 2OZ6A 2VBZA 3O3KA 1LDJA 4WXDA 1R5HA 3Q9VA 5CVJA 4L18B 2OAZA 4MTDA 1G4DA 3V7SA 1OKRA 1Z05A 1B6AA 4A0XA 1KYZA 4DNCA 3CUQA 3N97A 2F5CA 2QQ9A 2CG4A 3CUOA 2OD5A 2K27A 2CGPA 3WGGA 3LAJA 1Z1DA 3CO6C 3HTSB 3W6JB 4GYIA 3R4KA 4RB0A 2F2EA 1FP1D 3V7CA 3BJAA 4EJTA 1FC3A 3K2ZA 1MZBA 3BROA 4HOBA 2NAZA 2A69F 4LB5A 1BIAA 1ZGJA 2OQRA 2RKHA 1S7AA 5LHIA 3K1MA 2H6CA 3AAFA 4Y15A 3TKYA 3ZP5A 1QBJA 1MKMA 2L3DA 4LLNA 2RC4A 2DFIA 3RI4A 5L3GA 4M73A 2GWRA 3VOEA 5LGUA 3NQOA 5H20A 4LG0B 1HW2A 2P7VB 5DV5A 2O8XA 1ZYRF 2A61A 1ZG5A 2J5PA 1Y0UA 4ZYGA 3GO5A 1TLHB 4N0BA 2P5VA 2CSOA 1HKTA 2YSRA 2FU4A 1UB9A 1UFMA 3W6KB 4B8XA 3O2PE 1G6NA 5ICEA 2JTVA 2STTA 1LQ1A 3I53A 1XMAA 2FNAA 1VTNC 4WX9A 1O3TA 2LF7A 1XCVA 3PFIA 2VOPA 2V1DA 3HSEA 3T1BA 4NB5A 1TW2A 4YIIA 2A6EF 2MLKA 3ZQ7A 4HX7A 4U0WA 4YFKF 3TO9A 2WTEA 3O6BB 1IXRC 4MGRA 2ZXJA 4Q47A 4EV0A 2IA0A 4GXOA 4LJZF 1G3WA 3BWGA 5FLXK 1QQIA 2XAJA 4ENKA 4UNOA 3CUQB 5HVQC 1BBYA 3SQNA 3GZ6A 4HDVA 1FYMA 3F8NA 4CDGA 1FNNA 1MD0A 4IRIA 3B73A 1ZRDA 4JBAA 3LSTA 1E2XA 3IRQA 3FMRA 5EEGA 3L09A 4U88A 1BC8C 4H0EA 2A07F 5FO5A 4MTEA 5LHHA 2IRFG 5L3BA 3MWMA 4P55A 4OINF 3GUDA 2EV5A 5H6RA 1FSEA 1F4KA 4YG2F 2HEOA 5LEKA 3QOPA 3DV8A 4QWQA 2VXZA 3FMQA 3IWFA 3CDHA 3DQVC 2PLYA 2XASA 3TO6A 4M9XA 2EFNA 4L9NA 3JTGA 4Q4ZF 4WWCA 4EM1A 3WU1B 5CVUA 5KVRA 1JXSA 1RZ4A 2IW5A 2RN7A 1XSVA 3WGHA 1AOYA 2NS0A 1EH6A 2BEOA 4EJWA 1S29A 3R61A 4UVCA 5D5UB 5BOXA 3WTYC 2CFXA 2YR2A 1LDDA 2R3SA 3MFKA 2P7CB 4KMFA 2J5OA 3FHZA 2VC1A 3QAHA 3BOQA 3RKWA 1USTA 2X4HA 4I0AA 2O3FA 3HOSA 3HHHA 3RPUA 3I4PA 4A6EA 2P8TA 1PP7U 2X0LA 1BIBA 2HKXA 1Z9CA 1DPUA 3ECHA 4EM2A 5BS6A 2Q8KA 2L4MA 4U0VA 3E6BA 5HDGA 4LGWA 1TQIA 1KU3A 2HR3A 4M9SA 2FRHA 5LRSA 4KA4A 1YLFA 1TNSA 3IHUA 4K2EA 3FF5A 1H9GA 2EV6A 3EYYA 2NYXA 2JPBA 3E5QA 4D0PA 2Q2EA 4CZZA 3H92A 3HRUA 4EGYA 4L9JA 5D8KB 5JFRA 2V9VA 4I09A 1B9MA 3VODA 4AVPA 2HWVA 2DQLA 3FXQA 5D4SA 1IN6A 3E5UA 2H27A 2PI0A 1JE8A 2ZCWA 4S04A 3G73A 4HLXA 1WKMA 3G3ZA 3RPQA 3I5UA 4G7HF 3OOPA 4GYGA 1P4WA 3K0LA 1FYLA 2DQRA 3HRMA 4G7ZF 4OIPF 4Y13A 2EA2A 3MAJA 3J80Z 4CO8A 4L0ZB 1SMTA 3CO7C 3B02A 5D5VB 2IPQX 4IVNA 3MCZA 5D4RA 3I59A 5D5WB 3WTZA 3EYIA 4L9VA 1YTYA 3VEPA 3R0AA 4YIFA 1BI2A 2XV4S 2EFWA 3VB2A 4KN4X 5LGNA 4ESFA 3C1DA 1KQ9A 2HQNA 4IPAA 4ENJA 3LA2A 3QPTA 3IKVA 1HW1A 1BI3A 4BH9A 3ELKA 1DUXC 4HYEA 2VT2A 3RKXA 1J7KA 1RI7A 1UHMA 4XLPF 3KP2A 1Z91A 2VBYA 2VBXA 5DD8A 3GEZA 4ZYEA 3M9AA 4EM0B 3NEUA 5BMZA 3M7GA 2CWEA 1IRGA 5LHGA 2UZKA 5CYVA 3E6DA 3DF8A 1S3JA 4HX8A 1XCBA 1JHFA 2WWYA 1DP7P 5HS9A 3ZMZA 4RB1A 3FXUA 5EEHA 5FD5A 1YS7A 1ONVA 4EJVA 3U1DA 1LJ9A 4G7OF 3V4GA 2Z9OA 2Z5UA 4ETSA 3E3VA 2FBKA 3DPLC 3KEQA 2GZWA 2LF8A 5DUIA 1FBQA 1YW7A 2OBPA 2DU9A 4XSZF 4EQQA 5AIQA 1GXQA 4ZYHA 5LGTA 3IC7A 3ZN1A 2R7DA 2PMUA 4OIRF 5JHUA 4MHGA 3QRFF 1KQ0A 3F23A 2PG4A 5E1ZB 2PJPA 1K6OA 3WTUC 2RGVA 2LSOA 2P6TA 1SD4A 1XDSA 5E20A 4XRFA 1G3TA 2XROA 2WC2A 3WTXC 3RTRA 4PGHA 2HZTA 3GF2A 2V1XA 2Q0OA 1IF1A 2A5YB 1SMYF 1MJ9A 3F8CA 2KIMA 1I1GA 2XAFA 3E5XA 3WE2A 3ZN0A 3F8MA 4YFXF 1QO0D 2ELHA 3I59B 4IJAA 1K7AA 1ZLKA 1BM9A 3U2RA 1SFEA 3JAMZ 2OU2A 4MQVA 1YO5C 1ON1A 4R79A 1OYIA 1BOAA 2KIUA 3KEOA 1U5TC 1KGSA 2XIGA 4NQWA 2L4AA 4XLNF 2PBIA 4GGGA 3GYHX 1AWCA 1UCRA 1OMIA 4FT8A 3RYRA 2NRAC 4WXCA 1KU2A 1SFXA 1HSTA 4L5IA 2FOKA 2AXLA 5TRDA 3KZYA 2P5KA 1XDUA 2VE9A 2FA5A 2QBYA 1T0FA 1XSDA 2DBBA 1RNLA 3GZ5A 4BHCA 4WXHA 4I2OA 4I0BA 3F8FA 4KNYA 2G7UA 2Z99A 1ZREA 1FY7A 3DP7A 2PMHA 4UUVA 1XGMA 4EJUA 2Z33A 2ISYA 3E6CC 3F22A 3FM3A 2MH9A 3GFJA 1WSUA 1GVJA 2CW0F 2DI3A 2LDUA 3I0TA 1JGSA 1HKSA 5HDKA 4AIHA 1I6XA 3ULQB 3CLOA 4P9FA 4LLLA 2GA1A 2JT1A 3V8KA 1RUOA 2IA1A 4U0YA 4I02A 3HIFA 3ROUA 1K79A 2MC3A 3P9KA 1HW5A 1KYWA 2WV0A 4ESBA 5E1WA 2FEZA 4I98B 5TJJA 3K9TA 1K78A 1RUNA 4CICA 2MA3A 5FGMA 2E7XA 4A5NA 2GQQA 1GXPA 4OOIA 3MZHA 3P9IA 5CVVA 3GX4X 2ZMEA 3JTHA 4QLCU 2OQGA 4ON0A 2RV8A 3SZTA 5K5OA 3ZPLA 5E8IA 1PP8F 3NRVA 2QUFA 2ESNA 2QM3A 5CVRA 2ESHA 3WTTC 2D45A 1Z6RA 5BPDA 1EH7A 2AS5F 4IHSA 4CGZA 5DD4A 1HKQA 3TQNA 1LDKB 2ISZA 3L7WA 4IHTA 1PDNC 3PQKA 4BYYA 5ILVA 3WTWC 4RB2C 2FF4A 1T39A 1QGPA 4HQMA 1ZH5A 3M8FA 5HDNA 1ZHFA 1FLIA 3RIRA 3TOAA 2GXGA 1D5VA 5K5RA 3J81Z 3KP5A 5AONA 2TDXA 4A0ZA 1J0RA 2YPRA 2H09A 1D8JA 1ZLJA 1O3SA 1KA8A 1B9NA 2O03A 2XKOA 2CQKA 2E1NA 2XHKA 5CVIA 4I7HA 4HBLA 4XBFA 4EGZA 2XVCA 5IT3A 2XAHA 2QBYB 2EK5A 4MEXF 4U7DA 1G3YA 1E17A 1FP2A 2HYGD 4TV7A 1R1TA 2BYVE 3BJOA 1MJAA 1XGSA 3F72A 3QP6A 4HF0A 3GLXA 2QLZA 1DPRA 4A12A 4AWXB 3DKWA 4Y17A 3F6OA 1BJAA 1F5TA 2COMA 4XSXF 3KETA 5HOOA 1IXSB 1PUEE 1TBXA 4ZZLA 1G3SA 3RDIA 5K1YA 4DQ2A 2O6GE 5L3DA 2DPDA 3WE3A 4M71A 1BI0A 3BY6A 3R6SA 3SXYA 1IAWA 4HA8A 2W57A 4F7ZA 4FHTA 1LVAA 1ODDA 5CJ9A 1YG2A 1TQPA 1ZAOA 4UV9A 4RB3C 3M1EA 4P9UA 1SFUA 1KU7A 2QWWA 2F5DA 3V7RA 4B09A 1K78B 1J2XA 2YX7A 4RAZA 5BQTA 2H6BA 4KUMA 2HDCA 4L0YB 2KJCA 2FBHA 2ZMEB 3BPXA 1QPMA 3KCCA 2STWA 4M9ZA 2BBYA 1P2FA 5LEJA 1ZARA 3FZVA 3SFZA 2VC0A 1TNTA 1TW3A 1B1BA 1S6LA 1W5TA 3WG9A 1SD6A 4AIJA 3BP8A 4CXFA 5DCFA 3SHFA 3RYPA 2HTSA 3EUHA 3KLNA 3JSOA 3J7AO 2VODA 5DYMA 1FYKA 3HUGA 4JK1X 3QP5A 2M1BA 1X3UA 1KQ8A 4GO1A 2M30A 3EDPA 2ZBKA 4G6DA 2A6HF 1V4RA 1P4XA 4M74A 2H94A 3CTAA 3C3WA 2W24A 2XKPA 3GVAA 1YYVA 2DTRA 4UHTA 2EB7A 2UXXA 2YX4A 1ZRCA 3LFKA 3M8EA 3U9GA 1RIOH 1LEAA 3KP6A 3OV8A 4HF1A 4Q48A 4M6YA 1FX7A 2IVMA 2JRTA 2L54A 4LMYA 4BAYA 4RS8A 2JSCA 2PFBA 5FFZA 4O6JA 1YIOA 4ZH4F 4KDPA 5H6QA 2GA2A 1IN8A 2ZJ2A 4JQFA 3I58A 2HQRA 2W25A 2XAGA 1W5SA 3WTVC 4YFNF 1WRJA 2EA4A 2EJRA 5DCMA 3I71A 2Y48A 3GWZA 2A68F 3P9CA 1EV7A 2ETHA 1XB4A 1LEBA 2Z3YA 3BZ6A 3ML6A 2VOOA 2CO5A 1H9TA 1I1SA 3REOA 5HLGA 1FBSA 4KFCA 5E1XA 4BHPA 1XD7A 1P6RA 5J6XA 2HGCA 1O57A 1R36A 3CUQC 2XUBA 4ZYDA 5D5XB 2HOEA 2D1HA 2K86A 3LQQA 3F6VA 1J59A 2P5LC 1STZA 2VONA 1EH8A 1GHCA 4ENNA 4M72A 4IXAA 5JI6A 4RGXA 2K4JA 3K69A 3LAPA 1SD7A 4IF4A 5IT9K 1IRFA 1J9IA 2QVOA 5A2QK 2FBIA 5ILUA 3FM5A 5ERIA 1MGTA 4LB6B 4OIQF 1JHHA 1R7JA 2HTJA 2OA4A 2PN6A 4A2UA 1MJBA 5F6FA 3QU6A 2RDPA 5JR3A 1T38A 5AIPA 3H3UA 5L3CA 4HAMA 1W7PA 2EFOA 3HYIA 3V8LA 1V3FA 1ZRFA 4OMYA 5F64A 3FXRA 3FMSA 3TDUC 4HZFA 2M5WA 3ZMUA 4HW0A 2QQBA 1YS6A 5CLSA 3ERED 4ASNA 2EFQA 1HSJA 1XGNA 1OYWA 2UWMA 1QNTA 1Z6TA 2DK5A 3D0SA 2XRNA 2MBFA 5JVTA 4KIBA 1BC7C 2IJLA 4OIOF 4S05A 1O7FA 3F8BA 1U8RA 4RGRA 2IA2A 1YQAA 2D1VA 1DDNA 3N4MA 5LRRA 1OPCA 2C6YA 2O61A 4KICA 4N9IA 2UXNA 5DCMB 2RQPA 4G6QA 4RAYA 1P4AA 3P7NA 2QENA 3C18A 4R8HA 2OZUA 5D6FA 3ABTA 3JAMK 4Q5SF 1L0OC 1IN7A 3ISPA 3JW4A 1FZPB 2QQAA 1ZGAA 3TO7A 4BNCA 1D3YA 2KJBA 2RVCA 2DK8A 4HV5A 4KMUX 4G9YA 1FBUA 4R1HA 3HOTA 1WQ2A 3KP7A 1XMKA 2K02A 3LA7A 2F5EA 2PQ8A 5E17F 3COAC 1W7PD 4LD5A 4FX0A 2HYFA 1Z7UA 3WTSC 1W4MA 2KRFA 4HQEA 3R0JA 2E1CA 2Y0MA 2LNBA 3KZZA 4CYDA 5DUKA 3LQRA 3DPTA 4UV8A 1U2WA 4KIGA 1ON2A 5FB2A 1U78A 2FXAA 1T98A 2V6CA 1W7PB 2VBWA 3IWZA 2KKOA 3DXJF 4L9TA 4ESJA 1U5TA 5L3FA 5E8GA 4KT5C 3IL2A 2GAUA 4HLYA 5FLXZ 4EMSA 1SAXA 4MEYF 1SD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIF A;  4U7B A;  1OYY A;  4CHU A;  1TQM A;  1R23 A;  4EVI A;  3L00 A;  5K5Q A;  3IKT A;  3PQJ A;  5E18 F;  2MD5 A;  2E7W A;  1T2K A;  5LLQ A;  3T0Y A;  3F3X A;  3S2W A;  3ECO A;  1R1V A;  1R22 A;  4A0Y A;  4OMZ A;  3HSR A;  3I64 A;  3MEX A;  4RGS A;  1MDM A;  4PZJ A;  2CYY A;  4KYW A;  2XGX A;  4RGU A;  2ZNZ A;  3K1N A;  3J81 K;  4ENM A;  3Q5F A;  2LKP A;  2ZKZ A;  2YU3 A;  1O3R A;  3T5X A;  4L5J A;  5FD6 A;  4G8X A;  2DT5 A;  4BXU A;  4P96 A;  3FWE A;  4HF2 A;  1J75 A;  3QU3 A;  1I27 A;  5HLI A;  2DW4 A;  2IT0 A;  2MLG A;  3L2C A;  2NNN A;  2FSW A;  4OU0 A;  2Y75 A;  3BJ6 A;  3HHG A;  2JPC A;  1R00 A;  3KE2 A;  4GCV A;  3ZMT A;  5ILS A;  1IXC A;  1Q1H A;  4LFU A;  1HQC A;  5ICC A;  1IUY A;  3HRT A;  4MNU A;  2GIV A;  4WK8 F;  2XAQ A;  2EWN A;  4BQA A;  1LB2 A;  2P4W A;  3V8J A;  1I5Z A;  1BN5 A;  2B0L A;  3DEU A;  3GFM A;  1U6G A;  2EFP A;  5DDG A;  1ZG3 A;  1YFH A;  1R5G A;  1P92 A;  2F5F A;  5FFX A;  4WCG A;  3RKY A;  5ICF A;  1ULY A;  3BPV A;  1A04 A;  3HSF A;  1O7L A;  1TTY A;  3GFL A;  3GXO A;  1O3Q A;  1XN7 A;  1U5T B;  4FX4 A;  1REP C;  3TDZ C;  3QPH A;  5DEQ A;  1F1Z A;  2VE8 A;  3E97 A;  1HXD A;  3KFW X;  1QZY A;  1FPQ A;  3T8R A;  3C7J A;  4WF2 A;  3ZMV A;  1R58 A;  3Q9S A;  3TOB A;  2IP2 A;  1H0M A;  3WU0 A;  3DFG A;  4PCQ A;  4NHJ A;  1B4A A;  4I01 A;  3R60 A;  3MZY A;  4Z2Y A;  4P5O A;  2ACJ A;  2BE5 F;  5LBQ A;  1XGO A;  1WWX A;  4PDK A;  2FNP A;  1IN4 A;  3H3Z A;  2NNY A;  2L01 A;  5L3E A;  3MQ0 A;  3F21 A;  2FMY A;  1U3E M;  1CF7 A;  5BPI A;  1MDM B;  2DO7 A;  2R7F A;  4BHB A;  1D8K A;  2K7L A;  4HX4 A;  3IRR A;  1QZZ A;  1HBX G;  4LLG F;  3GW2 A;  2FML A;  1B59 A;  3WGI A;  1S7O A;  1IW7 F;  5F1R A;  1YW9 A;  4G94 A;  3EET A;  4PGG A;  5HS7 A;  5ED4 A;  2HFH A;  3KLO A;  2L02 A;  3LA3 A;  5D6E A;  2HS5 A;  4IRG A;  4LK1 F;  1KU9 A;  3J80 K;  2MH2 A;  2VT3 A;  3HRS A;  4N9H A;  4AD9 A;  4A5M A;  5KK1 A;  3BDD A;  2M8E A;  3ZMS A;  1ZG1 A;  2W84 A;  2DAO A;  3WOD F;  2P6S A;  4KN7 X;  4HDU A;  3HTU A;  1NHA A;  2RNJ A;  4UVA A;  2O0Y A;  1R1U A;  2GXB A;  2ZO4 A;  1ZN2 A;  2FQ3 A;  1OR7 A;  4EJO A;  2JZY A;  1L3L A;  2G7H A;  2VN2 A;  3RJP A;  1FOK A;  2BV6 A;  5HLH A;  4ZZD A;  4KIF A;  2HKO A;  1USS A;  2DPU A;  2EV0 A;  3ZMD A;  1LNW A;  4E70 A;  1T6S A;  2A3S A;  2QZ8 A;  1IN5 A;  2BGC A;  5J8C A;  3FX3 A;  1UHW A;  5IT9 Z;  3ABU A;  3D5L A;  3L9F A;  2FE3 A;  5A2Q Z;  2PEX A;  4UXN A;  3EQL F;  3JSP A;  3KP4 A;  1FWZ A;  5ICG A;  3K1P A;  2ADU A;  3KP3 A;  4O5V A;  4HV6 A;  3T8T A;  3E6M A;  4LG0 A;  2V79 A;  1XSX A;  3SZP A;  2G9W A;  4MQ9 F;  2ZFW A;  1BI1 A;  6PAX A;  3TGN A;  1S8N A;  1WI9 A;  5J8F A;  1C0W A;  4M6X A;  1F9N A;  4UVB A;  2V1U A;  1CF7 B;  2ZNY A;  5D8L B;  2K4B A;  1FSH A;  1YW8 A;  2DLL A;  4O3M A;  2D2W A;  3VFZ A;  1IZ1 A;  2QYO A;  4A6D A;  1FT9 A;  1CGP A;  2M87 A;  2W85 A;  4LK0 F;  3CJN A;  1J5Y A;  3I54 A;  3GFI A;  2M45 A;  3LWF A;  4IRH A;  4AIK A;  5HS8 A;  2OZ6 A;  2VBZ A;  3O3K A;  1LDJ A;  4WXD A;  1R5H A;  3Q9V A;  5CVJ A;  4L18 B;  2OAZ A;  4MTD A;  1G4D A;  3V7S A;  1OKR A;  1Z05 A;  1B6A A;  4A0X A;  1KYZ A;  4DNC A;  3CUQ A;  3N97 A;  2F5C A;  2QQ9 A;  2CG4 A;  3CUO A;  2OD5 A;  2K27 A;  2CGP A;  3WGG A;  3LAJ A;  1Z1D A;  3CO6 C;  3HTS B;  3W6J B;  4GYI A;  3R4K A;  4RB0 A;  2F2E A;  1FP1 D;  3V7C A;  3BJA A;  4EJT A;  1FC3 A;  3K2Z A;  1MZB A;  3BRO A;  4HOB A;  2NAZ A;  2A69 F;  4LB5 A;  1BIA A;  1ZGJ A;  2OQR A;  2RKH A;  1S7A A;  5LHI A;  3K1M A;  2H6C A;  3AAF A;  4Y15 A;  3TKY A;  3ZP5 A;  1QBJ A;  1MKM A;  2L3D A;  4LLN A;  2RC4 A;  2DFI A;  3RI4 A;  5L3G A;  4M73 A;  2GWR A;  3VOE A;  5LGU A;  3NQO A;  5H20 A;  4LG0 B;  1HW2 A;  2P7V B;  5DV5 A;  2O8X A;  1ZYR F;  2A61 A;  1ZG5 A;  2J5P A;  1Y0U A;  4ZYG A;  3GO5 A;  1TLH B;  4N0B A;  2P5V A;  2CSO A;  1HKT A;  2YSR A;  2FU4 A;  1UB9 A;  1UFM A;  3W6K B;  4B8X A;  3O2P E;  1G6N A;  5ICE A;  2JTV A;  2STT A;  1LQ1 A;  3I53 A;  1XMA A;  2FNA A;  1VTN C;  4WX9 A;  1O3T A;  2LF7 A;  1XCV A;  3PFI A;  2VOP A;  2V1D A;  3HSE A;  3T1B A;  4NB5 A;  1TW2 A;  4YII A;  2A6E F;  2MLK A;  3ZQ7 A;  4HX7 A;  4U0W A;  4YFK F;  3TO9 A;  2WTE A;  3O6B B;  1IXR C;  4MGR A;  2ZXJ A;  4Q47 A;  4EV0 A;  2IA0 A;  4GXO A;  4LJZ F;  1G3W A;  3BWG A;  5FLX K;  1QQI A;  2XAJ A;  4ENK A;  4UNO A;  3CUQ B;  5HVQ C;  1BBY A;  3SQN A;  3GZ6 A;  4HDV A;  1FYM A;  3F8N A;  4CDG A;  1FNN A;  1MD0 A;  4IRI A;  3B73 A;  1ZRD A;  4JBA A;  3LST A;  1E2X A;  3IRQ A;  3FMR A;  5EEG A;  3L09 A;  4U88 A;  1BC8 C;  4H0E A;  2A07 F;  5FO5 A;  4MTE A;  5LHH A;  2IRF G;  5L3B A;  3MWM A;  4P55 A;  4OIN F;  3GUD A;  2EV5 A;  5H6R A;  1FSE A;  1F4K A;  4YG2 F;  2HEO A;  5LEK A;  3QOP A;  3DV8 A;  4QWQ A;  2VXZ A;  3FMQ A;  3IWF A;  3CDH A;  3DQV C;  2PLY A;  2XAS A;  3TO6 A;  4M9X A;  2EFN A;  4L9N A;  3JTG A;  4Q4Z F;  4WWC A;  4EM1 A;  3WU1 B;  5CVU A;  5KVR A;  1JXS A;  1RZ4 A;  2IW5 A;  2RN7 A;  1XSV A;  3WGH A;  1AOY A;  2NS0 A;  1EH6 A;  2BEO A;  4EJW A;  1S29 A;  3R61 A;  4UVC A;  5D5U B;  5BOX A;  3WTY C;  2CFX A;  2YR2 A;  1LDD A;  2R3S A;  3MFK A;  2P7C B;  4KMF A;  2J5O A;  3FHZ A;  2VC1 A;  3QAH A;  3BOQ A;  3RKW A;  1UST A;  2X4H A;  4I0A A;  2O3F A;  3HOS A;  3HHH A;  3RPU A;  3I4P A;  4A6E A;  2P8T A;  1PP7 U;  2X0L A;  1BIB A;  2HKX A;  1Z9C A;  1DPU A;  3ECH A;  4EM2 A;  5BS6 A;  2Q8K A;  2L4M A;  4U0V A;  3E6B A;  5HDG A;  4LGW A;  1TQI A;  1KU3 A;  2HR3 A;  4M9S A;  2FRH A;  5LRS A;  4KA4 A;  1YLF A;  1TNS A;  3IHU A;  4K2E A;  3FF5 A;  1H9G A;  2EV6 A;  3EYY A;  2NYX A;  2JPB A;  3E5Q A;  4D0P A;  2Q2E A;  4CZZ A;  3H92 A;  3HRU A;  4EGY A;  4L9J A;  5D8K B;  5JFR A;  2V9V A;  4I09 A;  1B9M A;  3VOD A;  4AVP A;  2HWV A;  2DQL A;  3FXQ A;  5D4S A;  1IN6 A;  3E5U A;  2H27 A;  2PI0 A;  1JE8 A;  2ZCW A;  4S04 A;  3G73 A;  4HLX A;  1WKM A;  3G3Z A;  3RPQ A;  3I5U A;  4G7H F;  3OOP A;  4GYG A;  1P4W A;  3K0L A;  1FYL A;  2DQR A;  3HRM A;  4G7Z F;  4OIP F;  4Y13 A;  2EA2 A;  3MAJ A;  3J80 Z;  4CO8 A;  4L0Z B;  1SMT A;  3CO7 C;  3B02 A;  5D5V B;  2IPQ X;  4IVN A;  3MCZ A;  5D4R A;  3I59 A;  5D5W B;  3WTZ A;  3EYI A;  4L9V A;  1YTY A;  3VEP A;  3R0A A;  4YIF A;  1BI2 A;  2XV4 S;  2EFW A;  3VB2 A;  4KN4 X;  5LGN A;  4ESF A;  3C1D A;  1KQ9 A;  2HQN A;  4IPA A;  4ENJ A;  3LA2 A;  3QPT A;  3IKV A;  1HW1 A;  1BI3 A;  4BH9 A;  3ELK A;  1DUX C;  4HYE A;  2VT2 A;  3RKX A;  1J7K A;  1RI7 A;  1UHM A;  4XLP F;  3KP2 A;  1Z91 A;  2VBY A;  2VBX A;  5DD8 A;  3GEZ A;  4ZYE A;  3M9A A;  4EM0 B;  3NEU A;  5BMZ A;  3M7G A;  2CWE A;  1IRG A;  5LHG A;  2UZK A;  5CYV A;  3E6D A;  3DF8 A;  1S3J A;  4HX8 A;  1XCB A;  1JHF A;  2WWY A;  1DP7 P;  5HS9 A;  3ZMZ A;  4RB1 A;  3FXU A;  5EEH A;  5FD5 A;  1YS7 A;  1ONV A;  4EJV A;  3U1D A;  1LJ9 A;  4G7O F;  3V4G A;  2Z9O A;  2Z5U A;  4ETS A;  3E3V A;  2FBK A;  3DPL C;  3KEQ A;  2GZW A;  2LF8 A;  5DUI A;  1FBQ A;  1YW7 A;  2OBP A;  2DU9 A;  4XSZ F;  4EQQ A;  5AIQ A;  1GXQ A;  4ZYH A;  5LGT A;  3IC7 A;  3ZN1 A;  2R7D A;  2PMU A;  4OIR F;  5JHU A;  4MHG A;  3QRF F;  1KQ0 A;  3F23 A;  2PG4 A;  5E1Z B;  2PJP A;  1K6O A;  3WTU C;  2RGV A;  2LSO A;  2P6T A;  1SD4 A;  1XDS A;  5E20 A;  4XRF A;  1G3T A;  2XRO A;  2WC2 A;  3WTX C;  3RTR A;  4PGH A;  2HZT A;  3GF2 A;  2V1X A;  2Q0O A;  1IF1 A;  2A5Y B;  1SMY F;  1MJ9 A;  3F8C A;  2KIM A;  1I1G A;  2XAF A;  3E5X A;  3WE2 A;  3ZN0 A;  3F8M A;  4YFX F;  1QO0 D;  2ELH A;  3I59 B;  4IJA A;  1K7A A;  1ZLK A;  1BM9 A;  3U2R A;  1SFE A;  3JAM Z;  2OU2 A;  4MQV A;  1YO5 C;  1ON1 A;  4R79 A;  1OYI A;  1BOA A;  2KIU A;  3KEO A;  1U5T C;  1KGS A;  2XIG A;  4NQW A;  2L4A A;  4XLN F;  2PBI A;  4GGG A;  3GYH X;  1AWC A;  1UCR A;  1OMI A;  4FT8 A;  3RYR A;  2NRA C;  4WXC A;  1KU2 A;  1SFX A;  1HST A;  4L5I A;  2FOK A;  2AXL A;  5TRD A;  3KZY A;  2P5K A;  1XDU A;  2VE9 A;  2FA5 A;  2QBY A;  1T0F A;  1XSD A;  2DBB A;  1RNL A;  3GZ5 A;  4BHC A;  4WXH A;  4I2O A;  4I0B A;  3F8F A;  4KNY A;  2G7U A;  2Z99 A;  1ZRE A;  1FY7 A;  3DP7 A;  2PMH A;  4UUV A;  1XGM A;  4EJU A;  2Z33 A;  2ISY A;  3E6C C;  3F22 A;  3FM3 A;  2MH9 A;  3GFJ A;  1WSU A;  1GVJ A;  2CW0 F;  2DI3 A;  2LDU A;  3I0T A;  1JGS A;  1HKS A;  5HDK A;  4AIH A;  1I6X A;  3ULQ B;  3CLO A;  4P9F A;  4LLL A;  2GA1 A;  2JT1 A;  3V8K A;  1RUO A;  2IA1 A;  4U0Y A;  4I02 A;  3HIF A;  3ROU A;  1K79 A;  2MC3 A;  3P9K A;  1HW5 A;  1KYW A;  2WV0 A;  4ESB A;  5E1W A;  2FEZ A;  4I98 B;  5TJJ A;  3K9T A;  1K78 A;  1RUN A;  4CIC A;  2MA3 A;  5FGM A;  2E7X A;  4A5N A;  2GQQ A;  1GXP A;  4OOI A;  3MZH A;  3P9I A;  5CVV A;  3GX4 X;  2ZME A;  3JTH A;  4QLC U;  2OQG A;  4ON0 A;  2RV8 A;  3SZT A;  5K5O A;  3ZPL A;  5E8I A;  1PP8 F;  3NRV A;  2QUF A;  2ESN A;  2QM3 A;  5CVR A;  2ESH A;  3WTT C;  2D45 A;  1Z6R A;  5BPD A;  1EH7 A;  2AS5 F;  4IHS A;  4CGZ A;  5DD4 A;  1HKQ A;  3TQN A;  1LDK B;  2ISZ A;  3L7W A;  4IHT A;  1PDN C;  3PQK A;  4BYY A;  5ILV A;  3WTW C;  4RB2 C;  2FF4 A;  1T39 A;  1QGP A;  4HQM A;  1ZH5 A;  3M8F A;  5HDN A;  1ZHF A;  1FLI A;  3RIR A;  3TOA A;  2GXG A;  1D5V A;  5K5R A;  3J81 Z;  3KP5 A;  5AON A;  2TDX A;  4A0Z A;  1J0R A;  2YPR A;  2H09 A;  1D8J A;  1ZLJ A;  1O3S A;  1KA8 A;  1B9N A;  2O03 A;  2XKO A;  2CQK A;  2E1N A;  2XHK A;  5CVI A;  4I7H A;  4HBL A;  4XBF A;  4EGZ A;  2XVC A;  5IT3 A;  2XAH A;  2QBY B;  2EK5 A;  4MEX F;  4U7D A;  1G3Y A;  1E17 A;  1FP2 A;  2HYG D;  4TV7 A;  1R1T A;  2BYV E;  3BJO A;  1MJA A;  1XGS A;  3F72 A;  3QP6 A;  4HF0 A;  3GLX A;  2QLZ A;  1DPR A;  4A12 A;  4AWX B;  3DKW A;  4Y17 A;  3F6O A;  1BJA A;  1F5T A;  2COM A;  4XSX F;  3KET A;  5HOO A;  1IXS B;  1PUE E;  1TBX A;  4ZZL A;  1G3S A;  3RDI A;  5K1Y A;  4DQ2 A;  2O6G E;  5L3D A;  2DPD A;  3WE3 A;  4M71 A;  1BI0 A;  3BY6 A;  3R6S A;  3SXY A;  1IAW A;  4HA8 A;  2W57 A;  4F7Z A;  4FHT A;  1LVA A;  1ODD A;  5CJ9 A;  1YG2 A;  1TQP A;  1ZAO A;  4UV9 A;  4RB3 C;  3M1E A;  4P9U A;  1SFU A;  1KU7 A;  2QWW A;  2F5D A;  3V7R A;  4B09 A;  1K78 B;  1J2X A;  2YX7 A;  4RAZ A;  5BQT A;  2H6B A;  4KUM A;  2HDC A;  4L0Y B;  2KJC A;  2FBH A;  2ZME B;  3BPX A;  1QPM A;  3KCC A;  2STW A;  4M9Z A;  2BBY A;  1P2F A;  5LEJ A;  1ZAR A;  3FZV A;  3SFZ A;  2VC0 A;  1TNT A;  1TW3 A;  1B1B A;  1S6L A;  1W5T A;  3WG9 A;  1SD6 A;  4AIJ A;  3BP8 A;  4CXF A;  5DCF A;  3SHF A;  3RYP A;  2HTS A;  3EUH A;  3KLN A;  3JSO A;  3J7A O;  2VOD A;  5DYM A;  1FYK A;  3HUG A;  4JK1 X;  3QP5 A;  2M1B A;  1X3U A;  1KQ8 A;  4GO1 A;  2M30 A;  3EDP A;  2ZBK A;  4G6D A;  2A6H F;  1V4R A;  1P4X A;  4M74 A;  2H94 A;  3CTA A;  3C3W A;  2W24 A;  2XKP A;  3GVA A;  1YYV A;  2DTR A;  4UHT A;  2EB7 A;  2UXX A;  2YX4 A;  1ZRC A;  3LFK A;  3M8E A;  3U9G A;  1RIO H;  1LEA A;  3KP6 A;  3OV8 A;  4HF1 A;  4Q48 A;  4M6Y A;  1FX7 A;  2IVM A;  2JRT A;  2L54 A;  4LMY A;  4BAY A;  4RS8 A;  2JSC A;  2PFB A;  5FFZ A;  4O6J A;  1YIO A;  4ZH4 F;  4KDP A;  5H6Q A;  2GA2 A;  1IN8 A;  2ZJ2 A;  4JQF A;  3I58 A;  2HQR A;  2W25 A;  2XAG A;  1W5S A;  3WTV C;  4YFN F;  1WRJ A;  2EA4 A;  2EJR A;  5DCM A;  3I71 A;  2Y48 A;  3GWZ A;  2A68 F;  3P9C A;  1EV7 A;  2ETH A;  1XB4 A;  1LEB A;  2Z3Y A;  3BZ6 A;  3ML6 A;  2VOO A;  2CO5 A;  1H9T A;  1I1S A;  3REO A;  5HLG A;  1FBS A;  4KFC A;  5E1X A;  4BHP A;  1XD7 A;  1P6R A;  5J6X A;  2HGC A;  1O57 A;  1R36 A;  3CUQ C;  2XUB A;  4ZYD A;  5D5X B;  2HOE A;  2D1H A;  2K86 A;  3LQQ A;  3F6V A;  1J59 A;  2P5L C;  1STZ A;  2VON A;  1EH8 A;  1GHC A;  4ENN A;  4M72 A;  4IXA A;  5JI6 A;  4RGX A;  2K4J A;  3K69 A;  3LAP A;  1SD7 A;  4IF4 A;  5IT9 K;  1IRF A;  1J9I A;  2QVO A;  5A2Q K;  2FBI A;  5ILU A;  3FM5 A;  5ERI A;  1MGT A;  4LB6 B;  4OIQ F;  1JHH A;  1R7J A;  2HTJ A;  2OA4 A;  2PN6 A;  4A2U A;  1MJB A;  5F6F A;  3QU6 A;  2RDP A;  5JR3 A;  1T38 A;  5AIP A;  3H3U A;  5L3C A;  4HAM A;  1W7P A;  2EFO A;  3HYI A;  3V8L A;  1V3F A;  1ZRF A;  4OMY A;  5F64 A;  3FXR A;  3FMS A;  3TDU C;  4HZF A;  2M5W A;  3ZMU A;  4HW0 A;  2QQB A;  1YS6 A;  5CLS A;  3ERE D;  4ASN A;  2EFQ A;  1HSJ A;  1XGN A;  1OYW A;  2UWM A;  1QNT A;  1Z6T A;  2DK5 A;  3D0S A;  2XRN A;  2MBF A;  5JVT A;  4KIB A;  1BC7 C;  2IJL A;  4OIO F;  4S05 A;  1O7F A;  3F8B A;  1U8R A;  4RGR A;  2IA2 A;  1YQA A;  2D1V A;  1DDN A;  3N4M A;  5LRR A;  1OPC A;  2C6Y A;  2O61 A;  4KIC A;  4N9I A;  2UXN A;  5DCM B;  2RQP A;  4G6Q A;  4RAY A;  1P4A A;  3P7N A;  2QEN A;  3C18 A;  4R8H A;  2OZU A;  5D6F A;  3ABT A;  3JAM K;  4Q5S F;  1L0O C;  1IN7 A;  3ISP A;  3JW4 A;  1FZP B;  2QQA A;  1ZGA A;  3TO7 A;  4BNC A;  1D3Y A;  2KJB A;  2RVC A;  2DK8 A;  4HV5 A;  4KMU X;  4G9Y A;  1FBU A;  4R1H A;  3HOT A;  1WQ2 A;  3KP7 A;  1XMK A;  2K02 A;  3LA7 A;  2F5E A;  2PQ8 A;  5E17 F;  3COA C;  1W7P D;  4LD5 A;  4FX0 A;  2HYF A;  1Z7U A;  3WTS C;  1W4M A;  2KRF A;  4HQE A;  3R0J A;  2E1C A;  2Y0M A;  2LNB A;  3KZZ A;  4CYD A;  5DUK A;  3LQR A;  3DPT A;  4UV8 A;  1U2W A;  4KIG A;  1ON2 A;  5FB2 A;  1U78 A;  2FXA A;  1T98 A;  2V6C A;  1W7P B;  2VBW A;  3IWZ A;  2KKO A;  3DXJ F;  4L9T A;  4ESJ A;  1U5T A;  5L3F A;  5E8G A;  4KT5 C;  3IL2 A;  2GAU A;  4HLY A;  5FLX Z;  4EMS A;  1SAX A;  4MEY F;  1SD5 A; 
#chains in the Genus database with same CATH topology
 1TT5 B;  3L2R A;  1HCR A;  4V19 K;  2KIF A;  4U7B A;  4J19 A;  2MGQ A;  2E1M B;  1OYY A;  3IAM 2;  4CHU A;  1TQM A;  3FIS A;  1R23 A;  1ERD A;  4EVI A;  3L00 A;  3QPL A;  5K5Q A;  2HZD A;  2GIZ A;  2JVG A;  4CA0 A;  4DGW B;  3E0J B;  3MKY B;  5DM6 F;  4IKF A;  1ACI A;  1DU6 A;  2O5R A;  3IKT A;  1GUU A;  3PQJ A;  5E18 F;  1W36 D;  2MD5 A;  2E7W A;  3DEE A;  2VQC A;  1IJW C;  1T2K A;  5FLM J;  5LLQ A;  3T0Y A;  3F3X A;  3S2W A;  3ECO A;  1R1V A;  2L9S A;  1R22 A;  4KT6 A;  4A0Y A;  1B72 A;  4OMZ A;  3HSR A;  3I64 A;  2JUC A;  3K4M A;  3MEX A;  4RGS A;  3W3C A;  4E6K G;  4BQQ A;  1MDM A;  2EBI A;  4PZJ A;  2CYY A;  4KYW A;  3CCV I;  2XGX A;  1JUP A;  3BC8 A;  4RGU A;  3OYM A;  5EEA A;  2ZNZ A;  3K1N A;  3K6G A;  3J81 K;  4ENM A;  2DMQ A;  2MSY A;  4XL9 A;  5HNH A;  3Q5F A;  2LKP A;  2ZKZ A;  2YU3 A;  4FE4 A;  4JOM A;  1O3R A;  4BUP A;  3T5X A;  4L5J A;  5FD6 A;  4G8X A;  2DT5 A;  2AQE A;  4C3I J;  2WAE A;  2X85 A;  1QVU A;  3OYJ A;  1A31 A;  4BXU A;  4P96 A;  3FWE A;  3S1M J;  2Y9Z A;  5M5W J;  1J75 A;  1I3Q J;  4HF2 A;  4XRS G;  2H8W A;  2IGM A;  3QU3 A;  4DZP A;  1I27 A;  3OYA A;  5HLI A;  1MMG A;  2DW4 A;  4IOA F;  3LSH A;  1R71 A;  1S9H A;  4L5E A;  2IT0 A;  2MLG A;  3L2C A;  2NNN A;  2FSW A;  2VJ4 A;  3ZQH A;  4OU0 A;  2W00 A;  1X19 A;  2Y75 A;  1FEX A;  3BJ6 A;  3HHG A;  3ZQQ A;  2JPC A;  2HXO A;  1R00 A;  1YIT I;  3KE2 A;  4GCV A;  3ZMT A;  1MMD A;  1SVM A;  5ILS A;  4IOC F;  1IXC A;  1Z77 A;  3VYR B;  4QTR A;  1WCM J;  1Q1H A;  2HI3 A;  4LFU A;  1HQC A;  4Y52 J;  5ICC A;  2HU9 A;  3H5R A;  1IUY A;  3GBG A;  5CQE A;  3HRT A;  1JT0 A;  1V55 H;  4ZTF A;  2ZC2 A;  4MNU A;  5HLT A;  2GIV A;  4OWR B;  3OIQ A;  4WK8 F;  2XAQ A;  3EUK L;  3BZC A;  3ZOB A;  2EWN A;  3FDY A;  4BQA A;  1LB2 A;  3DTK A;  1VQN I;  2P4W A;  3V8J A;  1I5Z A;  2CV2 A;  3IH3 A;  2TRT A;  3LSR A;  3CMA I;  1YHQ I;  1BN5 A;  2B0L A;  2MG4 A;  3DBR B;  3DEU A;  3GFM A;  4M6V A;  1U6G A;  2EFP A;  5DDG A;  1ZG3 A;  3HKZ N;  1YFH A;  2HVS A;  1R5G A;  1P92 A;  2F5F A;  3CDL A;  3DKX A;  5FFX A;  4B47 A;  4WCG A;  4Y4R A;  1YOV B;  3RKY A;  5ICF A;  1MBJ A;  2XGE A;  3HOW J;  1ULY A;  3BPV A;  4V2G A;  1JI8 A;  5EGO A;  3L2V A;  1A04 A;  3HSF A;  3AG1 H;  1O7L A;  1BW6 A;  1E0E A;  1TTY A;  4F93 B;  3FBN B;  3GFL A;  3GXO A;  4XR6 A;  1O3Q A;  2EPF A;  2KQR A;  1XN7 A;  1RKT A;  1U5T B;  3Q0W A;  4FX4 A;  1ETQ A;  2FD5 A;  1REP C;  3TDZ C;  4V2F A;  4UUS B;  1YIJ I;  3QPH A;  5DEQ A;  1F1Z A;  4CYC B;  2VE8 A;  2JQ7 A;  2L9V A;  4KIS A;  4NUB A;  3E97 A;  5HOD A;  2YU9 J;  1HXD A;  4C3H J;  1Y0N A;  3KFW X;  1QZY A;  1FPQ A;  3EUA A;  3T8R A;  3CCR I;  4B1R A;  2FX0 A;  2OF7 A;  4M3B A;  3C7J A;  1MMN A;  3K4C A;  3LSM A;  4E7K A;  2E36 A;  4WF2 A;  3ZMV A;  1R58 A;  3Q9S A;  3TOB A;  2IP2 A;  3BR0 A;  1H0M A;  3WU0 A;  4CZC A;  2VKH A;  3DFG A;  4PCQ A;  2E1O A;  4NHJ A;  1TWG J;  1B4A A;  4I01 A;  2LY9 A;  3R60 A;  4F91 B;  2VKD A;  3MZY A;  4BJT A;  5GPC A;  4M3G A;  4BE0 A;  4Z2Y A;  4P5O A;  2B63 J;  2ACJ A;  1OCC H;  2BE5 F;  5LBQ A;  1A6I A;  1XGO A;  2ZFU A;  4GRI A;  2KDO A;  1WWX A;  4ZJZ A;  2VJJ A;  5J1R A;  4PDK A;  3CJT B;  4RAF A;  2LY2 A;  3S15 J;  2FNP A;  3HM5 A;  1IN4 A;  3H3Z A;  2NNY A;  3OSF A;  4XLF A;  2L01 A;  5L3E A;  3MQ0 A;  3F21 A;  2FMY A;  2VB6 A;  2KDZ A;  1U3E M;  1CF7 A;  1ORK A;  1ETY A;  1B72 B;  1TC3 C;  2QA4 I;  5BPI A;  1MDM B;  1QPI A;  1Q1V A;  2DO7 A;  2R7F A;  1VQ6 I;  3CF5 F;  4BHB A;  1D8K A;  2AHQ A;  2K7L A;  4HX4 A;  4AID A;  3IRR A;  1QZZ A;  2R5Z A;  1HBX G;  2CFO A;  4IEJ A;  1WJ5 A;  3GW2 A;  4LLG F;  5M3M J;  4I6Z A;  2AO9 A;  5E3N A;  2FML A;  1B59 A;  4BJ5 C;  3UR3 C;  3WGI A;  1S7O A;  3PNV A;  1Z21 A;  2ID3 A;  1DP3 A;  1OQY A;  3FXL A;  1MIJ A;  2ICW G;  1IW7 F;  1X4P A;  5F1R A;  1YW9 A;  2VPL A;  4G94 A;  1RPW A;  4M3F A;  3EET A;  4PGG A;  1WJC A;  4A69 C;  1DQU A;  5HS7 A;  5ED4 A;  2HFH A;  2EIN H;  3G2B A;  3FXK A;  3KLO A;  2L02 A;  3LA3 A;  4HSR A;  5D6E A;  3GTM J;  2HS5 A;  1D0Y A;  4IRG A;  1Y1V J;  3S2H J;  4LK1 F;  1KU9 A;  3J80 K;  2LH9 A;  2MH2 A;  3FK6 A;  2E5Z A;  2VT3 A;  3HRS A;  4N9H A;  2QEX I;  4AD9 A;  4A5M A;  5KK1 A;  1NG6 A;  4PFO A;  4G6T B;  3HXL A;  4YEL A;  3S1R J;  4C9Y A;  3BDD A;  2M8E A;  2ZJR F;  3ZMS A;  2V6E A;  1ZG1 A;  3QYE A;  4E7H A;  2W84 A;  1P7J A;  3OYI A;  2DAO A;  2PMZ N;  3SDG A;  4E7Z A;  4FTH A;  3WOD F;  1LPQ A;  1ETO A;  3AG2 H;  3DTI A;  3DBH B;  3PSF A;  1KZH A;  2P6S A;  4KN7 X;  1LFU P;  4HDU A;  3Q3S A;  3HTU A;  1NHA A;  2RNJ A;  4UVA A;  2P0W A;  1RR7 A;  2DA4 A;  3OYB A;  1IUF A;  2O0Y A;  2VKE A;  1R1U A;  2GXB A;  2ZO4 A;  4DYR A;  3JRD A;  1NK3 P;  1ZN2 A;  3O8H A;  2FQ3 A;  1SFO J;  1OR7 A;  2NOG A;  2JZY A;  4EJO A;  3ABK H;  1L3L A;  2G7H A;  2VN2 A;  3RJP A;  2DT6 A;  1OJL A;  3WHC A;  1FOK A;  4DYC A;  2BV6 A;  5HLH A;  4ZZD A;  1RET A;  4HPQ A;  4KIF A;  1YE9 A;  2HKO A;  3QYF A;  1USS A;  3B6C A;  2DPU A;  3JRA A;  2EV0 A;  3ZMD A;  1LNW A;  4E70 A;  2B9S A;  1T6S A;  3ESW B;  4MFD A;  2A3S A;  3W2V A;  2QZ8 A;  2X1E A;  1IN5 A;  2KT0 A;  1MBE A;  2BGC A;  5J8C A;  3FX3 A;  3FKI J;  2GLO A;  4X0G A;  1UHW A;  5IT9 Z;  3ABU A;  3D5L A;  3L9F A;  3A03 A;  4XNF A;  3H0D A;  2FE3 A;  1FTZ A;  2Z2S B;  2PEX A;  5A2Q Z;  1SAU A;  2WY8 Q;  4UXN A;  3EQL F;  2XDV A;  3KP4 A;  3JSP A;  1FWZ A;  5ICG A;  3K1P A;  3OSG A;  2ADU A;  4B44 A;  3KP3 A;  5FJ8 J;  1A36 A;  4O5V A;  5KAF C;  4HV6 A;  3T8T A;  4BJ6 C;  3E6M A;  3BTI A;  4LG0 A;  2V79 A;  1XSX A;  2BHY A;  3SZP A;  2G9W A;  4MQ9 F;  5FKK A;  5GAD J;  1WI3 A;  2ECC A;  3H36 A;  2DA5 A;  3H9Q A;  3HJE A;  4BXF A;  3PIP F;  1T0F C;  3DKY A;  2ZFW A;  3ONQ A;  3BLY A;  3JRH A;  2V1N A;  2M9H A;  1IGN A;  1BI1 A;  4CCO A;  4XRS A;  1ETW A;  6PAX A;  3GTP J;  1IDZ A;  4A93 J;  2R92 J;  3PNT A;  1TWA J;  3TGN A;  1AU7 A;  1FOX A;  4BY7 J;  1OCO H;  4D5C A;  3H3V K;  1S8N A;  1VQ5 I;  4HG2 A;  1WI9 A;  3EPZ A;  5J8F A;  1C0W A;  4M6X A;  1F9N A;  4UVB A;  2V1U A;  1CF7 B;  2EZK A;  2ZNY A;  2Q2E B;  5D8L B;  2LC2 A;  1LVK A;  2K4B A;  1FSH A;  1YW8 A;  2EH3 A;  1X2M A;  1Z67 A;  2DLL A;  4O3M A;  2D2W A;  1H89 C;  2WB1 A;  3VFZ A;  1PYV A;  2HDW A;  1IZ1 A;  4I76 A;  2R5Z B;  4E7L A;  2QYO A;  4A6D A;  1FT9 A;  2XC7 A;  1XTA A;  1CGP A;  4MLO A;  2M87 A;  2W85 A;  4OAZ A;  3L2U A;  2H8R A;  9ANT A;  4D1Q A;  4LK0 F;  3PM1 A;  3CJN A;  1J5Y A;  2A5W A;  3I54 A;  3GFI A;  2M45 A;  2M3A A;  3LWF A;  2KIS A;  3BG5 A;  4IRH A;  4AIK A;  2JJ7 A;  5HS8 A;  4NC6 A;  2BY2 A;  2R7V A;  5C4X J;  2LY1 A;  2OZ6 A;  3BCB A;  4Y7N J;  2VBZ A;  3O3K A;  2M8G X;  2XPU A;  2V4J C;  3DCF A;  2PJR A;  1LDJ A;  4FE7 A;  5F27 A;  4WXD A;  1R5H A;  3Q9V A;  2M34 A;  5CVJ A;  4L18 B;  2OAZ A;  4MTD A;  2H1L A;  2WBM A;  1G4D A;  3V7S A;  4B4C A;  1OKR A;  2Y2Z A;  1Z05 A;  2CUF A;  3H0G J;  1B6A A;  1ZEL A;  4A0X A;  1KYZ A;  4DNC A;  1UMQ A;  2CUZ A;  2HNH A;  3CUQ A;  3N97 A;  4HNU A;  2F5C A;  3S17 J;  3S3M A;  2QQ9 A;  2CG4 A;  3JRB A;  2CQQ A;  3CUO A;  4AC0 A;  2KLO A;  2OD5 A;  2K27 A;  2CGP A;  3WGG A;  1A6Q A;  1R4N B;  1FIA A;  1LKX A;  3LAJ A;  1OFC X;  1Z1D A;  2ZME C;  2LRD A;  1IV8 A;  3CO6 C;  2F48 A;  2ZB9 A;  4D7N A;  3HTS B;  2CUJ A;  3W6J B;  2QSH X;  4GYI A;  4A3I J;  3R4K A;  1X1C A;  4RB0 A;  2F2E A;  1FP1 D;  3V7C A;  5H2F C;  3BJA A;  2ZJP F;  4EJT A;  1FC3 A;  3HPG A;  3KX2 A;  3ABM H;  2TCT A;  3K2Z A;  3AG3 H;  1MZB A;  2VJI A;  3BRO A;  4HOB A;  2NAZ A;  3GTQ J;  4MO7 A;  2A69 F;  2IGK A;  4LB5 A;  2XSJ C;  2RRE A;  3QYB A;  4FCY A;  2HYJ A;  5F1J A;  1BIA A;  1ZGJ A;  2HQ5 A;  2JK3 A;  2OQR A;  2XAU A;  3FBI B;  2RKH A;  1PVE A;  1AHD P;  2KMU A;  1HDP A;  4FET A;  4RMN A;  3ZCO A;  4DOZ A;  1S7A A;  2GM4 A;  3PFY A;  3NWS A;  5LHI A;  2XF7 A;  3K1M A;  3DBL B;  4XKW A;  2H6C A;  3VSK A;  3AAF A;  2IGO A;  3ZQL A;  4Y15 A;  1VQ7 I;  3TKY A;  1Y39 A;  1D1B A;  3W2W A;  2Q1Z B;  3ZP5 A;  1QBJ A;  1MKM A;  2L3D A;  3FIW A;  4LLN A;  1W0U A;  2RC4 A;  2DFI A;  3RI4 A;  5L3G A;  4M73 A;  2GWR A;  1VI0 A;  3VOE A;  1ZKG A;  2DA2 A;  4MIM A;  3AFH A;  5B1A H;  4C30 A;  3MN2 A;  3AG4 H;  5GPA A;  5LGU A;  3NQO A;  5H20 A;  2F4M B;  2L7M P;  3OYL A;  4YRV A;  2HOT A;  4LG0 B;  3AL0 C;  2Y31 A;  1HW2 A;  2E2I J;  3OYD A;  1Y1W J;  2P7V B;  5DV5 A;  2O8X A;  1ZYR F;  2H1K A;  4LOC A;  3OYE A;  2K5C A;  2A61 A;  1I6H J;  1BR1 A;  2XB5 A;  4C2U A;  4BU2 A;  2J5P A;  1Y0U A;  1ZG5 A;  2ID6 A;  2ME0 A;  1TLH B;  3GO5 A;  4ZYG A;  3HB9 A;  2VKV A;  4N0B A;  2P5V A;  2CSO A;  4F52 A;  1HKT A;  2YSR A;  2E60 A;  2FU4 A;  1UB9 A;  1UFM A;  3W6K B;  1T56 A;  4RLF A;  4B8X A;  2JA7 J;  3O2P E;  2XF6 A;  1G6N A;  1MNE A;  5ICE A;  2JTV A;  2STT A;  2EIK H;  1LQ1 A;  3I53 A;  1XMA A;  2FNA A;  1VTN C;  1N25 A;  3IH2 A;  5GAG J;  4WX9 A;  1O3T A;  2Y30 A;  2LF7 A;  1XCV A;  4ZDL A;  4IX7 A;  4FAS D;  3H9G A;  2HDD A;  1Y56 A;  1OCR H;  3A01 A;  3PFI A;  2VOP A;  2V1D A;  2IGN A;  3HSE A;  2CU7 A;  3T1B A;  4NB5 A;  1TW2 A;  1A5J A;  2UUZ A;  2JUG A;  2FJ1 A;  4YII A;  2A6E F;  2MLK A;  4HRI A;  3ZQ7 A;  4HX7 A;  4U0W A;  4YFK F;  3TO9 A;  3S1Q J;  2I10 A;  2K40 A;  2WTE A;  3O6B B;  1IXR C;  5IOZ A;  3CP8 A;  3CC2 I;  1EKE A;  4MGR A;  2ZXJ A;  3G1L A;  4Q47 A;  1MMA A;  4EV0 A;  2IA0 A;  4BQN A;  2PJR B;  4GXO A;  3V42 A;  1P7I A;  2DOD A;  5F0F A;  5J3L A;  4LJZ F;  4LG3 A;  1G3W A;  3BWG A;  3J7Y J;  3MKW B;  3GCM A;  4G12 A;  5FLX K;  4A3L J;  1QQI A;  2XAJ A;  2ELJ A;  3ZR8 X;  1ENH A;  4ENK A;  4UNO A;  3CUQ B;  5HVQ C;  1RRJ A;  5CPR B;  1BBY A;  4CCN A;  3KIO A;  3SQN A;  1G59 A;  3OYK A;  3GZ6 A;  4HDV A;  1FYM A;  3F8N A;  4CDG A;  3KPH A;  1MBH A;  1FNN A;  3RKQ A;  1MD0 A;  4IRI A;  3B73 A;  2COB A;  2DFF A;  4D5F A;  1ZRD A;  4JBA A;  3LST A;  1E2X A;  2BY3 A;  2LMD A;  3IRQ A;  3FMR A;  5EEG A;  3L09 A;  4U88 A;  1BC8 C;  2EZH A;  1ZGW A;  1GV2 A;  4H0E A;  2A07 F;  5FO5 A;  4MTE A;  2NVQ J;  3K4J A;  5LHH A;  2IRF G;  3W2A A;  5L3B A;  3TW7 A;  4NQW B;  3H5A A;  3OR1 C;  2B7E A;  3MWM A;  3DU5 A;  4LIU A;  4P55 A;  4OIN F;  2HPI A;  2FOW A;  3GUD A;  2E19 A;  2EV5 A;  2LOO A;  4AUX A;  5H6R A;  1FSE A;  1F4K A;  1POG A;  4YG2 F;  3ABL H;  5TGT A;  5EZH A;  1QHH D;  1VFC A;  2HEO A;  1QHG A;  5LEK A;  2ZJQ F;  3QOP A;  3TL4 X;  5JHF A;  3BR1 A;  4AYB A;  3DV8 A;  2QGU A;  4QWQ A;  3VPR A;  2VXZ A;  2LYC A;  2VIX A;  1TWF J;  1G2H A;  3FMQ A;  4HEA 2;  4UUT A;  2L7F P;  2KZV A;  3IWF A;  4XN3 A;  3OYC A;  3CDH A;  4RBO A;  3JR9 A;  1Z3X A;  2Z1D A;  3EUH C;  3WG7 H;  1JUM A;  1WJB A;  3DQV C;  2PLY A;  2XAS A;  3TO6 A;  2BW3 A;  4M9X A;  2DYS H;  2EFN A;  4L9N A;  1LFB A;  3JTG A;  4Q4Z F;  5J4Y A;  4WWC A;  4EM1 A;  1YI2 I;  4XOT A;  3WU1 B;  1Z3Y A;  5CVU A;  2YS9 A;  5KVR A;  4BQO A;  5FRN A;  1JXS A;  2M4G A;  3HL2 A;  4DBR A;  3OWT A;  1RZ4 A;  2IW5 A;  4XOP A;  3P5J A;  2NS8 A;  3M3Y J;  2GBY A;  2RN7 A;  3GME A;  3CJQ B;  1XSV A;  3WGH A;  2MD0 A;  1AOY A;  2NS0 A;  2XPW A;  3BR5 A;  1EH6 A;  2BEO A;  4EJW A;  1S29 A;  2L2O A;  3R61 A;  3I4N J;  4UVC A;  5E3L A;  5D5U B;  5BOX A;  3WTY C;  3HOX J;  4HNV A;  1OCZ H;  2R7O A;  5B5E C;  2CFX A;  1V5F A;  2YR2 A;  2WY7 Q;  1LDD A;  2R3S A;  4ANJ A;  5B3S H;  3MFK A;  2P7C B;  4KMF A;  2WV1 A;  2J5O A;  3ERM A;  1UAA A;  3FHZ A;  2VJ5 A;  2VC1 A;  3QAH A;  3BOQ A;  1X3Z B;  3RKW A;  4B48 A;  1D1C A;  1JGG A;  3A01 B;  1UST A;  2X4H A;  4I0A A;  2O3F A;  3HOS A;  5IPA A;  5J4V A;  2EIL H;  4PFP A;  2DA1 A;  3HHH A;  1OCP A;  3TW6 A;  3RPU A;  4C2T A;  1QRY A;  3I4P A;  2VXD A;  5E3O A;  3SZG A;  4A6E A;  5F0H A;  4UY8 I;  2YUS A;  2DMN A;  3S2D J;  2P8T A;  3OY9 A;  1PP7 U;  2OUM A;  2X0L A;  3FK7 A;  1B8I B;  1BIB A;  2HKX A;  3K70 D;  1Z9C A;  4M3D A;  1DPU A;  3ECH A;  5E79 C;  1JTY A;  4EM2 A;  2VAS A;  5BS6 A;  2MW8 A;  2Q8K A;  1D1A A;  2HXI A;  5J47 A;  2L4M A;  4U0V A;  3BG9 A;  3E6B A;  5HDG A;  3GTL J;  4LGW A;  1BA5 A;  4UB6 C;  2K9M A;  3VWB A;  1TQI A;  1K83 J;  1KU3 A;  1PJR A;  2HR3 A;  3TMO A;  4M9S A;  2QF7 A;  2FRH A;  5LRS A;  5C3E J;  2EIM H;  1H88 C;  2R7S A;  2LVS A;  4KA4 A;  1OLT A;  3JRE A;  2JWT A;  1VF9 A;  2DTZ A;  1GVD A;  1YLF A;  2WAQ A;  1TNS A;  3IHU A;  3BG7 A;  4K2E A;  2EQR A;  3FF5 A;  1H9G A;  3KEY A;  2EV6 A;  3EYY A;  3OOU A;  2NYX A;  2VQH A;  1X2N A;  2JPB A;  2KL4 A;  3PO2 J;  1VQ8 I;  1T08 B;  2GXA A;  3E5Q A;  2DDB A;  4D0P A;  2Q2E A;  1IRX A;  4PJJ A;  4CZZ A;  3ZQF A;  1X1P A;  2I5U A;  3H92 A;  4BDY A;  3HRU A;  4EEF G;  4EGY A;  2L7Z A;  4L9J A;  5D8K B;  1SAN A;  2V9V A;  5JFR A;  4CSW A;  4UB8 C;  5GAE J;  1W0T A;  4I09 A;  1B9M A;  3VOD A;  4AVP A;  2HWV A;  2DQL A;  3BR6 A;  3FXQ A;  5D4S A;  4IHW A;  1IN6 A;  3PL8 A;  3E5U A;  3OYG A;  2H27 A;  2PI0 A;  1JE8 A;  2R93 J;  2ZCW A;  3ASO H;  3BTL A;  4S04 A;  3G73 A;  4LIT A;  4IHV A;  2BY1 A;  3HGG A;  4HLX A;  1WKM A;  3CJR B;  3G3Z A;  3AL0 B;  3RPQ A;  3PNY A;  3HBL A;  3M4O J;  3I5U A;  2MFZ A;  4G7H F;  3OOP A;  4GYG A;  1P4W A;  3K0L A;  4XM3 A;  5F08 A;  1YJW I;  3FXJ A;  3LSI A;  1FYL A;  2DQR A;  2BZT A;  5EG0 A;  2WA0 A;  3GTK J;  3HRM A;  4G7Z F;  4DYQ A;  4OIP F;  4Y13 A;  2EA2 A;  3BT9 A;  3MAJ A;  1ZR4 A;  1ZQ3 P;  2NOJ B;  1BR4 A;  4PK4 A;  3J80 Z;  4CO8 A;  3S16 J;  4L0Z B;  1SMT A;  5IP9 J;  3B02 A;  3CO7 C;  4A3F J;  3LL7 A;  4DZJ A;  5D5V B;  5C4J J;  1RR8 C;  4X6A J;  5JLX A;  4A3D J;  1LE8 A;  2IPQ X;  4IVN A;  3MCZ A;  5D4R A;  2BW3 B;  2LKS A;  3I59 A;  5D5W B;  1SVL A;  3WTZ A;  4ITV A;  3EYI A;  2IBD A;  3VYS B;  4L9V A;  1YTY A;  1BJZ A;  3VEP A;  3R0A A;  1IO2 A;  4YIF A;  4KIT B;  2VQL A;  1BL0 A;  1BI2 A;  2XV4 S;  2V26 A;  2EFW A;  3VB2 A;  1VQK I;  2PX9 A;  2HOA A;  4U87 A;  3J7Z I;  4KN4 X;  5LGN A;  2R7T A;  4ESF A;  4BGD A;  3C1D A;  2MYS A;  1KQ9 A;  2X6W A;  4Y33 A;  2HQN A;  4IPA A;  2M7B A;  4DJA A;  4ENJ A;  3LA2 A;  3QPT A;  3IKV A;  4X1E A;  1HW1 A;  1BI3 A;  3G4S I;  3MKL A;  2VI6 A;  4N4N B;  1WH7 A;  4BH9 A;  3ELK A;  1DUX C;  4BL0 B;  4HYE A;  2VT2 A;  2DMU A;  2E5N A;  3RKX A;  1DGW Y;  1J7K A;  1RI7 A;  1UHM A;  2LK2 A;  3A02 A;  4XLP F;  5FRM A;  3KP2 A;  1Z91 A;  2VBY A;  2DYR H;  1JKO C;  2VBX A;  5DD8 A;  3GEZ A;  2OJE D;  2NXN B;  4ZYE A;  2E1M C;  1SC7 A;  3M9A A;  4EM0 B;  3NEU A;  1K6Y A;  1V5E A;  5BMZ A;  3M7G A;  1I3A A;  4AM3 A;  2CWE A;  2R7Z J;  1IRG A;  5LHG A;  2UZK A;  5CYV A;  3E6D A;  2NVX J;  3DF8 A;  3NAR A;  2ELK A;  1S3J A;  4HX8 A;  1XCB A;  2Y0S A;  1JHF A;  1LUJ B;  2WWY A;  4CUG A;  2DFH A;  1DP7 P;  2M0M A;  5HS9 A;  3ZMZ A;  1ETV A;  4JX4 A;  4RB1 A;  3FXU A;  5EEH A;  5FD5 A;  1YS7 A;  1ONV A;  4EJV A;  1AA7 A;  2OTJ I;  1SEU A;  3U1D A;  1LJ9 A;  2DOA A;  4G7O F;  3V4G A;  2VPR A;  4CCK A;  4XLA A;  2VQG A;  3E1S A;  1Y6I A;  2Z9O A;  5F0C A;  2Z5U A;  4ETS A;  3E3V A;  2FBK A;  3DPL C;  4XN0 A;  2XGC A;  4BKX A;  3KEQ A;  1MBK A;  1W1W E;  2LR8 A;  4J01 A;  3FXO A;  2GZW A;  5IYC J;  2LF8 A;  5DUI A;  4E7S A;  1FBQ A;  1CQT A;  4BBS J;  1UG2 A;  1YW7 A;  2QSF X;  2OBP A;  2DU9 A;  3ZQC A;  3Q0U A;  4XSZ F;  3A1Y A;  1NH3 A;  3N05 A;  2P81 A;  5IYB J;  3WHB A;  4EQQ A;  1W36 C;  5AIQ A;  5FLV A;  3L2Q A;  4IHY A;  1GXQ A;  2K9N A;  3SEZ A;  4ZYH A;  5KHD A;  5LGT A;  3IC7 A;  3ZN1 A;  2R7D A;  5EF6 A;  2PMU A;  4OIR F;  5JHU A;  2KFD A;  1QZE A;  3BCA A;  4MHG A;  1SVO A;  1TWH J;  2EZL A;  1KQ0 A;  4PJ0 C;  4DW6 A;  3F23 A;  2NS7 A;  3QRF F;  1FJL A;  2PG4 A;  3ZQI A;  2BVL A;  5E1Z B;  2LRE A;  2PJP A;  1K6O A;  1YRN A;  4ZYA A;  2HPM A;  3WTU C;  2RGV A;  1HLV A;  2LSO A;  3CCQ I;  2P6T A;  4XKC A;  4AVZ A;  1SD4 A;  1XDS A;  5E20 A;  4XRF A;  1G3T A;  2XRO A;  5JVG F;  5EYR A;  2R7X A;  2WC2 A;  3WTX C;  3RTR A;  1O4X A;  4PGH A;  2JA5 J;  4GFB A;  2HZT A;  5KNL A;  3GF2 A;  2V1X A;  1U0J A;  2Q0O A;  5EG0 B;  1IF1 A;  2A5Y B;  1QVT A;  1SMY F;  3SJM A;  2QCO A;  4A3B J;  1MJ9 A;  4B3X A;  2DJI A;  3F8C A;  2KIM A;  5FKM A;  1DGR M;  1I1G A;  2XAF A;  3E5X A;  3WE2 A;  5GP9 A;  4NBQ A;  3ZN0 A;  3QQA A;  4BEH A;  3F8M A;  4GDF A;  2KRH A;  2M4K A;  2RQQ A;  3LSJ A;  2DT7 B;  4YFX F;  1QO0 D;  1WJA A;  1LE8 B;  1EA3 A;  3BR2 A;  2ELH A;  1F43 A;  3I59 B;  4IJA A;  1K7A A;  1ZLK A;  1BM9 A;  3U2R A;  4YEJ A;  1VQL I;  1SFE A;  3JAM Z;  2OU2 A;  4MQV A;  3GLL A;  1QA6 A;  2ZXH A;  1BR2 A;  1YO5 C;  1ON1 A;  4R79 A;  1OYI A;  1PUF A;  1BOA A;  4F3Q A;  4II3 A;  2KIU A;  3KEO A;  2NVT J;  1U5T C;  1KGS A;  2XIG A;  4NQW A;  2L4A A;  2QQ8 A;  4XLN F;  2HQA A;  2PBI A;  2GOX B;  5J1Y A;  4GGG A;  3OIO A;  3GYH X;  1AWC A;  2ZXW H;  1UCR A;  3MZ8 A;  2LLK A;  2ECB A;  1OMI A;  4FT8 A;  3RYR A;  3AKZ A;  2NRA C;  1QU3 A;  5B1B H;  1ITY A;  4WXC A;  3LSP A;  1KU2 A;  1R49 A;  1SFX A;  2F5V A;  3MKZ A;  1HST A;  5K7Z A;  3LNQ A;  4L5I A;  1EF4 A;  3ZQG A;  3RQI A;  2X6X A;  3CDI A;  3CCU I;  2FOK A;  4CH7 A;  2AXL A;  5F04 A;  5TRD A;  3KZY A;  2P5K A;  3SFI A;  1XDU A;  1D0X A;  4XID A;  4XLH A;  4DIQ A;  2VE9 A;  1GDT A;  2FA5 A;  2QBY A;  1T0F A;  3PIO F;  1XSD A;  3IAS 2;  3IV5 A;  1VND A;  2DBB A;  3L1P A;  1RNL A;  2BOL A;  3GZ5 A;  4BHC A;  3CES A;  4WXH A;  1JJ6 C;  4I2O A;  4I0B A;  3F8F A;  4NNJ A;  2F4O B;  5C44 J;  4KNY A;  3JRG A;  2X6Y A;  2DOE A;  2L9N A;  4QPQ A;  2G7U A;  3K4B A;  2Z99 A;  2W82 A;  4HST A;  1R5I D;  4XLC A;  1ZRE A;  1S72 I;  1FY7 A;  4W1U A;  3DP7 A;  4HNT A;  3CMM A;  2PMH A;  3HKZ A;  2KRC A;  5KCM A;  3C2H A;  4UUV A;  3TP0 A;  1XGM A;  4EJU A;  2Z33 A;  2ISY A;  3E6C C;  3F22 A;  3FM3 A;  2MH9 A;  3A2K A;  1X1D A;  3GFJ A;  1WSU A;  3CC7 I;  1I39 A;  2FQ4 A;  4EAT A;  3OYH A;  1GVJ A;  3GTO J;  1MMS A;  2CW0 F;  2DI3 A;  2LDU A;  3I0T A;  1JGS A;  2OC6 A;  1N77 A;  1HKS A;  5HDK A;  2KPM A;  1I6X A;  4AIH A;  4IHX A;  3PUB A;  3ULQ B;  3CLO A;  2K9S A;  2Z16 A;  4P9F A;  4LLL A;  2GA1 A;  2RNG A;  2O9L A;  3HOY J;  2JT1 A;  3V8K A;  3I3L A;  2JSP A;  1RUO A;  5CKT A;  2IA1 A;  2NVY J;  4U0Y A;  4I02 A;  3HIF A;  3ROU A;  2E2H J;  3LSK A;  1K79 A;  2MC3 A;  1HA8 A;  3P9K A;  5K7F A;  1HW5 A;  1KYW A;  1UJ8 A;  2WV0 A;  4ESB A;  5E1W A;  2NVU B;  5IOY A;  4QPO A;  2FEZ A;  4I98 B;  3K4L A;  5TJJ A;  4A3J J;  3K9T A;  4RDU A;  1K78 A;  1RUN A;  4CIC A;  2MA3 A;  5FGM A;  5GTH C;  2E7X A;  1FOW A;  4A5N A;  2GQQ A;  1GXP A;  1XG1 A;  1JJ8 C;  2XF5 A;  1WJD A;  1YRN B;  2OPT A;  4OOI A;  1R6R A;  1MSF C;  3VYT B;  1D0Z A;  3MZH A;  3DWL E;  3P9I A;  5CVV A;  3GX4 X;  2ZME A;  3JTH A;  2LBF A;  4QLC U;  2ZSI B;  2OQG A;  1AKH A;  1N78 A;  4ON0 A;  2RV8 A;  3SZT A;  5K5O A;  4PJN A;  1X3W B;  1B8I A;  4JP0 A;  3ZPL A;  5E8I A;  2UV1 A;  1PP8 F;  3NRV A;  2QUF A;  2ESN A;  2QM3 A;  2QSG X;  4A3M J;  3GZN B;  3SEQ A;  5CVR A;  2ESH A;  1MH4 A;  3WTT C;  4BS9 A;  1Z6R A;  2D45 A;  5BPD A;  4N4O B;  4CCL A;  3ZXS A;  1EH7 A;  4BEH B;  2DN0 A;  2WB1 N;  4BE2 A;  1SFK A;  1T95 A;  5DD4 A;  2AS5 F;  4IHS A;  1HKQ A;  4CGZ A;  3TQN A;  1LDK B;  3A4C A;  2R7U A;  4P1W A;  2ISZ A;  3L7W A;  4IHT A;  1PDN C;  3PQK A;  3U1K A;  4BYY A;  2CJJ A;  2HVQ A;  5ILV A;  3WTW C;  4RB2 C;  3LOC A;  3OS1 A;  1I50 J;  2FF4 A;  4NDL A;  4XQF A;  3CCY A;  2R7R A;  1WPK A;  1T39 A;  1QGP A;  1MBF A;  3SYT A;  4HQM A;  1RES A;  1PUF B;  2JMW A;  3HG9 A;  1ZH5 A;  1VQP I;  3M8F A;  3K7A J;  1X1B A;  5HDN A;  1ZHF A;  2N8G A;  1FLI A;  3RIR A;  3TOA A;  2GXG A;  1D5V A;  5K5R A;  3J81 Z;  3KP5 A;  5AON A;  1MH3 A;  3RZO J;  2TDX A;  4A0Z A;  1J0R A;  4F55 A;  2Y9Y A;  3IUO A;  1APL C;  2YPR A;  2H09 A;  3CCJ I;  3CZ6 A;  2CW8 A;  1D8J A;  1FIP A;  3G1O A;  1ZR2 A;  1R9T J;  1ZLJ A;  1O3S A;  5EZG A;  1KA8 A;  1B9N A;  1Z7L A;  2O03 A;  2XKO A;  2CQK A;  2E1N A;  1FOY A;  3CME I;  2XHK A;  1KON A;  2O8K A;  5CVI A;  4I7H A;  4HBL A;  1X58 A;  4XBF A;  4EGZ A;  5DM7 F;  3HPH A;  3FKJ A;  2IS1 A;  3G71 I;  2XVC A;  5IT3 A;  3CC4 I;  2XAH A;  3X2Q H;  1IV6 A;  2QBY B;  4BDZ A;  3W6V A;  2EK5 A;  4MEX F;  2X1D A;  4U7D A;  3E7L A;  3M07 A;  1G3Y A;  3S1N J;  2XB0 X;  1E17 A;  1A35 A;  3BZK A;  1FP2 A;  3BG3 A;  3HOU J;  2HYG D;  4KJZ A;  4TV7 A;  5JLW A;  1R1T A;  1S5L C;  2BYV E;  3BJO A;  1MJA A;  1XGS A;  2WAD A;  3F72 A;  3QP6 A;  4HF0 A;  3GLX A;  2QLZ A;  1DPR A;  2PMZ A;  3D5S C;  5LFA A;  1V54 H;  3K2A A;  2OCE A;  1JTX A;  1IG7 A;  3HC7 A;  4A12 A;  4AWX B;  1F36 A;  3DKW A;  4Y17 A;  3F6O A;  1BJA A;  2L9R A;  3RZD J;  1F5T A;  2COM A;  3IP4 B;  4XSX F;  3KET A;  3KYD B;  5HOO A;  1IXS B;  1PUE E;  1TBX A;  3DPU A;  4ZZL A;  2ZXI A;  3PUF A;  1BW5 A;  1G3S A;  3ZGK A;  3RDI A;  5K1Y A;  4DQ2 A;  2O6G E;  5L3D A;  1GV5 A;  1GLN A;  2G0E A;  3WE3 A;  2DPD A;  4M71 A;  1BI0 A;  3BY6 A;  2BXZ A;  3R6S A;  3SXY A;  2EIJ H;  1IAW A;  4HA8 A;  2X48 A;  2KP6 A;  1JT6 A;  2W57 A;  4F7Z A;  3G6E I;  4FHT A;  1LVA A;  1ODD A;  5CJ9 A;  4PJM A;  3QOD A;  1YG2 A;  3PJR A;  1TQP A;  3BG6 A;  1ZAO A;  4CCM A;  3OR2 C;  4UV9 A;  4RB3 C;  3M1E A;  4P9U A;  1VQ9 I;  1SFU A;  1E3O C;  2X6O A;  3JCU C;  2QWW A;  1KU7 A;  2F5D A;  4RA2 A;  3V7R A;  2ME6 A;  4B09 A;  3JRI A;  1XMX A;  1T8I A;  1K78 B;  1J2X A;  2YX7 A;  2CMP A;  3S93 A;  4E4H A;  4RAZ A;  2FUG 2;  4IL6 C;  5BQT A;  2H6B A;  3FHN A;  4KUM A;  3Q0V A;  2HDC A;  1XS9 A;  1U9N A;  4ZC3 A;  5K7H A;  1IC8 A;  2MAB A;  3OS0 A;  4L0Y B;  2KJC A;  1MND A;  2IS6 A;  5IY5 H;  3BPX A;  2A6T A;  2FBH A;  2ZME B;  1QPM A;  1VZ0 A;  3M8J A;  2R5Y B;  2LBF B;  3HDD A;  1AKH B;  3KYL A;  2LFB A;  3BQY A;  2L7K A;  4RLQ A;  2VLA A;  1TZL A;  3BQZ A;  3MVP A;  1R4M B;  3KCC A;  3QWL A;  2WAF A;  2STW A;  5M5X J;  3TED A;  4E7I A;  2Y69 H;  2BBY A;  4M9Z A;  3JRC A;  3C2B A;  1RC9 A;  1P2F A;  5LEJ A;  1YJN I;  1ZAR A;  3FZV A;  1XX5 A;  3SFZ A;  2VC0 A;  3DU6 A;  3QPS A;  1TNT A;  1TW3 A;  2OCC H;  1B1B A;  1S6L A;  5FKN A;  2IS2 A;  1W5T A;  3WG9 A;  1SD6 A;  4AIJ A;  3BP8 A;  4CXF A;  1TL8 A;  1OR7 C;  5DCF A;  2BVM A;  1G8X A;  4PSX A;  3SHF A;  4XLE A;  2E71 A;  3RYP A;  1MSE C;  2V9K A;  2HTS A;  3J7A Y;  2M2E A;  4IO9 F;  3EUH A;  3KLN A;  5GTI C;  1H8A C;  3JSO A;  3J7A O;  2LP0 A;  2W4S A;  3KZI C;  5E3M A;  5DYM A;  1FYK A;  2VOD A;  3HUG A;  4JK1 X;  4B3A A;  1TWC J;  3QP5 A;  1IDY A;  1VQO I;  2M1B A;  4BXX J;  2CUE A;  1X3U A;  1KQ8 A;  4GO1 A;  2M30 A;  3EDP A;  2ZBK A;  4G6D A;  2A6H F;  1V4R A;  1P4X A;  4M74 A;  2H94 A;  3CTA A;  3C3W A;  3U21 A;  2W24 A;  2XKP A;  3GVA A;  3PSI A;  1YYV A;  2DTR A;  4UHT A;  2EB7 A;  2UXX A;  2YX4 A;  1ZRC A;  3LFK A;  3M8E A;  3U9G A;  1RIO H;  2DMP A;  3F0C A;  3S8P A;  3I56 I;  4XOR A;  1UEL B;  1LEA A;  3KP6 A;  3OV8 A;  4HF1 A;  3H5N A;  4Q48 A;  1YX3 A;  4XKB A;  4M6Y A;  4D9J A;  4CCJ A;  1T33 A;  5EJC A;  5HNF A;  1YJ9 I;  1WGX A;  1MNM C;  1FX7 A;  2IVM A;  3CLQ A;  2JRT A;  3FXM A;  2L54 A;  1FMW A;  4LMY A;  3F9K A;  2A05 A;  4BAY A;  3CCS I;  2E34 A;  4RS8 A;  1FMV A;  1MBG A;  1WHU A;  2CV0 A;  1OIS A;  2JRM A;  2JSC A;  1HC8 A;  1Y8Q B;  3DLA A;  2PFB A;  5TIS C;  2W48 A;  3G1M A;  2XRL A;  5FFZ A;  4O6J A;  1YIO A;  4ZH4 F;  4KDP A;  5H6Q A;  3HEF A;  3RPU D;  2GA2 A;  2HOS A;  1IN8 A;  1XC5 A;  2ZJ2 A;  4JQF A;  4AYB N;  5M3F J;  3I58 A;  2HQR A;  3S3O A;  2W25 A;  2XAG A;  3VYU B;  1W5S A;  2DA6 A;  1XPX A;  3CF2 A;  3WTV C;  1MW7 A;  4YFN F;  5DS9 A;  1WRJ A;  3OYF A;  2EA4 A;  2EJR A;  5DCM A;  1NTC A;  3I71 A;  2Y48 A;  1UHS A;  2A68 F;  3GWZ A;  3LFU A;  4LIV A;  3P9C A;  4RM2 A;  4XRM A;  3OL4 A;  1EV7 A;  2ETH A;  2DDA A;  1XB4 A;  3I55 I;  1LEB A;  2R0Q C;  5FKO A;  3BZ6 A;  2Z3Y A;  3ML6 A;  1WJE A;  1E3H A;  4C3J J;  2CO5 A;  2VOO A;  1NK2 P;  1H9T A;  1I1S A;  3REO A;  5HLG A;  1FBS A;  4OAY A;  4KFC A;  3S14 J;  3O8G A;  3HOV J;  4A3G J;  5E1X A;  2VL8 A;  4BHP A;  4BY1 J;  1XD7 A;  1P6R A;  2AXT C;  4QSH A;  3D5R C;  5J6X A;  3I4M J;  2HGC A;  2R7W A;  5B66 C;  1O57 A;  2JN6 A;  3SDB A;  4Y3O A;  2VUM J;  4A3C J;  3KYC B;  2ZSH B;  1Z0X A;  1J09 A;  5CQG A;  5J40 A;  5EGO B;  1VQ4 I;  1R36 A;  3CUQ C;  2XUB A;  3K4K A;  1V5G A;  4ZYD A;  3RQ4 A;  3TP3 A;  1M1E B;  5D5X B;  4PJL A;  5IYD J;  2BY0 A;  4BBR J;  3CCM I;  2HOE A;  2D1H A;  3BR3 A;  2K86 A;  2CQX A;  3LQQ A;  3F6V A;  1J59 A;  4M3E A;  3K10 A;  2JA6 J;  1RKW A;  1STZ A;  2P5L C;  4ZDP A;  2VON A;  1JKP C;  1EH8 A;  3A0B C;  4C2M J;  1GHC A;  3MD2 A;  5BNG A;  2L0K A;  4M72 A;  4ENN A;  1JKR C;  4IXA A;  3UNG C;  5JI6 A;  1Y8R B;  4RGX A;  2K4J A;  2CW7 A;  2XPV A;  3K69 A;  3LAP A;  1SD7 A;  3CP2 A;  3H35 A;  4IF4 A;  5IT9 K;  3HOZ J;  1IRF A;  1J9I A;  2LKX A;  2QVO A;  5A2Q K;  3OYN A;  1TP4 A;  2FBI A;  3HGY A;  3VDX A;  5ILU A;  3FM5 A;  5ERI A;  1MGT A;  4LB6 B;  4OIQ F;  3HZJ A;  4ZTJ A;  1P9Q C;  1JHH A;  3PO3 J;  4E7J A;  1R7J A;  1HOM A;  4AU7 A;  5DTD A;  3M1C A;  2HTJ A;  4S0H B;  2JA2 A;  4A3E J;  5M5Y J;  1S7E A;  2OA4 A;  2PN6 A;  4A2U A;  5LD2 C;  4B43 A;  2V9P A;  2R7Q A;  4JYK A;  1JKQ C;  2E35 A;  1MJB A;  5F6F A;  3QU6 A;  2L5Q A;  2RDP A;  5JR3 A;  1T38 A;  4D7M A;  3HUG B;  5FKL A;  5AIP A;  3H3U A;  4BAC A;  5L3C A;  3CQZ J;  4HAM A;  5EDN A;  1W7P A;  2EFO A;  2IEK A;  3HYI A;  1W5C C;  3QOE A;  3V8L A;  1JUS A;  1V3F A;  3OIP A;  1ZRF A;  4OMY A;  1WJF A;  5F64 A;  2W7N A;  1YX5 A;  3DEW A;  3FXR A;  3S3N A;  3CD6 I;  2WAQ N;  4XKV A;  4F92 B;  4IQ4 A;  3FMS A;  3TDU C;  4HZF A;  2MC4 A;  2M5W A;  4RM3 A;  4RAG A;  3UKG A;  3ZMU A;  4HW0 A;  2QQB A;  1YS6 A;  5CLS A;  3ERE D;  1VQM I;  4ASN A;  3CCE I;  1K4T A;  3A0H C;  2EFQ A;  1HSJ A;  1ZTR A;  1XGN A;  1OYW A;  2BHZ A;  2UWM A;  1QNT A;  1Z6T A;  2DK5 A;  3D0S A;  2XRN A;  2MBF A;  3OMY A;  3GTG J;  3H1C A;  5JVT A;  4KIB A;  2K9Q A;  4H4K C;  2X9D A;  2I8D A;  1BC7 C;  2IJL A;  2K3F A;  4OIO F;  4S05 A;  1WZ2 A;  5FRO A;  1O7F A;  3F8B A;  4QIW N;  1U8R A;  4RGR A;  2DXI A;  1TT0 A;  2IA2 A;  2BXY A;  1YQA A;  4A3K J;  2D1V A;  1DDN A;  3TBI A;  3CMY A;  5LRR A;  3N4M A;  1OCT C;  1K4S A;  1OPC A;  3NWT A;  2C6Y A;  3WU2 C;  1WVR A;  2O61 A;  2LTP A;  4PSW A;  2KIQ A;  2V7F A;  4KIC A;  2W1O A;  2O7O A;  4FIS A;  2LG4 A;  4IQJ A;  1FTT A;  4N9I A;  2UXN A;  5DCM B;  2RQP A;  4G6Q A;  4RAY A;  4W97 A;  1P4A A;  3P7N A;  2QEN A;  3C18 A;  4R8H A;  2OTL I;  3JRF A;  1ZK8 A;  2D5V A;  2OZU A;  1U9O A;  3ABT A;  3MMY B;  5D6F A;  1ETK A;  5IP6 A;  2DA3 A;  3JAM K;  5GAH J;  2KHM A;  2IS4 A;  2OV7 A;  4Q5S F;  3ZRG A;  1L0O C;  1IN7 A;  3BTC A;  3ISP A;  1DU0 A;  4ZDO A;  4NC7 A;  3JW4 A;  2KZG A;  3BTJ A;  1E3P A;  2CS3 A;  3S32 A;  4BE1 A;  1GT0 C;  4JX6 A;  2QQA A;  1FZP B;  1D5Y A;  2CV1 A;  1ZGA A;  3TO7 A;  4BNC A;  1D3Y A;  2EZI A;  2KJB A;  4ABZ A;  2RVC A;  2DK8 A;  2DJN A;  4HV5 A;  2M0C A;  4G9Y A;  4KMU X;  1FBU A;  4PUS A;  4XON A;  2K85 A;  5IP7 J;  4R1H A;  2DFE A;  1K61 A;  2DA7 A;  3HOT A;  1WQ2 A;  3KP7 A;  3LSG A;  2IAI A;  2CH0 A;  1NG7 A;  1XMK A;  2K02 A;  3LA7 A;  1U8B A;  2K3P A;  2F5E A;  1UG0 A;  2PQ8 A;  3I9V 2;  3VSL A;  2IXS A;  5E17 F;  3RCO A;  3COA C;  1W7P D;  4LD5 A;  4NC8 A;  4FX0 A;  1N75 A;  3K70 C;  4FQG A;  2HYF A;  4XMY A;  3NAU A;  4II2 A;  4DBQ A;  4XIC A;  1X4O A;  3H9J A;  1Z7U A;  2DCE A;  2CQN A;  3WTS C;  2XSD C;  2XGD A;  1W4M A;  2CRG A;  2KRF A;  3B6A A;  4HQE A;  3R0J A;  3GTJ J;  1BOB A;  3ASN H;  2E1C A;  2Y0S N;  2Y0M A;  4IZZ A;  2LNB A;  1WH5 A;  3KZZ A;  2M7A A;  2AQF A;  4MFE A;  4CYD A;  2QKL B;  5DUK A;  2RAE A;  2X1C A;  1IRZ A;  3LQR A;  3DPT A;  1EJ9 A;  4UV8 A;  4YIR X;  1HF0 A;  1U2W A;  4KIG A;  1ON2 A;  3LMM A;  5FB2 A;  3RSN A;  1U78 A;  2FXA A;  3DLL F;  2HVR A;  2DOF A;  1T98 A;  2DMT A;  2V6C A;  4XK4 A;  1W7P B;  2VBW A;  1UZC A;  3DTE A;  3IWZ A;  2KKO A;  3CCL I;  3D1N I;  3DXJ F;  4L9T A;  2R5Y A;  3K4N A;  5KAI C;  4ESJ A;  1U5T A;  5L3F A;  2X51 A;  3IH4 A;  3OS2 A;  4I99 C;  4UUS A;  5E8G A;  3L2W A;  4JX5 A;  4KT5 C;  3IL2 A;  2GAU A;  1X1A A;  4CYC A;  4HLY A;  2JA8 J;  5FLX Z;  1LFP A;  1HDD C;  2QKM B;  4J00 A;  2R4G A;  4EMS A;  1SAX A;  4MEY F;  2JVH A;  2F6C A;  4Z6Y A;  2LD5 A;  2GOM A;  2F4I A;  1WFX A;  2CQ7 A;  2K9L A;  1ETX A;  2E2J J;  3OL3 A;  1SD5 A;  5J1U A;  3C2G A; 
#chains in the Genus database with same CATH homology
 2KIF A;  4U7B A;  1OYY A;  4CHU A;  1TQM A;  1R23 A;  4EVI A;  3L00 A;  5K5Q A;  3IKT A;  3PQJ A;  5E18 F;  2MD5 A;  2E7W A;  1T2K A;  5LLQ A;  3T0Y A;  3F3X A;  3S2W A;  3ECO A;  1R1V A;  1R22 A;  4A0Y A;  4OMZ A;  3HSR A;  3I64 A;  3MEX A;  4RGS A;  1MDM A;  4PZJ A;  2CYY A;  4KYW A;  2XGX A;  4RGU A;  2ZNZ A;  3K1N A;  3J81 K;  4ENM A;  3Q5F A;  2LKP A;  2ZKZ A;  2YU3 A;  1O3R A;  3T5X A;  4L5J A;  5FD6 A;  4G8X A;  2DT5 A;  4BXU A;  4P96 A;  3FWE A;  4HF2 A;  1J75 A;  3QU3 A;  1I27 A;  5HLI A;  2DW4 A;  2IT0 A;  2MLG A;  3L2C A;  2NNN A;  2FSW A;  4OU0 A;  2Y75 A;  3BJ6 A;  3HHG A;  2JPC A;  1R00 A;  3KE2 A;  4GCV A;  3ZMT A;  5ILS A;  1IXC A;  1Q1H A;  4LFU A;  1HQC A;  5ICC A;  1IUY A;  3HRT A;  4MNU A;  2GIV A;  4WK8 F;  2XAQ A;  2EWN A;  4BQA A;  1LB2 A;  2P4W A;  3V8J A;  1I5Z A;  1BN5 A;  2B0L A;  3DEU A;  3GFM A;  1U6G A;  2EFP A;  5DDG A;  1ZG3 A;  1YFH A;  1R5G A;  1P92 A;  2F5F A;  5FFX A;  4WCG A;  3RKY A;  5ICF A;  1ULY A;  3BPV A;  1A04 A;  3HSF A;  1O7L A;  1TTY A;  3GFL A;  3GXO A;  1O3Q A;  1XN7 A;  1U5T B;  4FX4 A;  1REP C;  3TDZ C;  3QPH A;  5DEQ A;  1F1Z A;  2VE8 A;  3E97 A;  1HXD A;  3KFW X;  1QZY A;  1FPQ A;  3T8R A;  3C7J A;  4WF2 A;  3ZMV A;  1R58 A;  3Q9S A;  3TOB A;  2IP2 A;  1H0M A;  3WU0 A;  3DFG A;  4PCQ A;  4NHJ A;  1B4A A;  4I01 A;  3R60 A;  3MZY A;  4Z2Y A;  4P5O A;  2ACJ A;  2BE5 F;  5LBQ A;  1XGO A;  1WWX A;  4PDK A;  2FNP A;  1IN4 A;  3H3Z A;  2NNY A;  2L01 A;  5L3E A;  3MQ0 A;  3F21 A;  2FMY A;  1U3E M;  1CF7 A;  5BPI A;  1MDM B;  2DO7 A;  2R7F A;  4BHB A;  1D8K A;  2K7L A;  4HX4 A;  3IRR A;  1QZZ A;  1HBX G;  4LLG F;  3GW2 A;  2FML A;  1B59 A;  3WGI A;  1S7O A;  1IW7 F;  5F1R A;  1YW9 A;  4G94 A;  3EET A;  4PGG A;  5HS7 A;  5ED4 A;  2HFH A;  3KLO A;  2L02 A;  3LA3 A;  5D6E A;  2HS5 A;  4IRG A;  4LK1 F;  1KU9 A;  3J80 K;  2MH2 A;  2VT3 A;  3HRS A;  4N9H A;  4AD9 A;  4A5M A;  5KK1 A;  3BDD A;  2M8E A;  3ZMS A;  1ZG1 A;  2W84 A;  2DAO A;  3WOD F;  2P6S A;  4KN7 X;  4HDU A;  3HTU A;  1NHA A;  2RNJ A;  4UVA A;  2O0Y A;  1R1U A;  2GXB A;  2ZO4 A;  1ZN2 A;  2FQ3 A;  1OR7 A;  4EJO A;  2JZY A;  1L3L A;  2G7H A;  2VN2 A;  3RJP A;  1FOK A;  2BV6 A;  5HLH A;  4ZZD A;  4KIF A;  2HKO A;  1USS A;  2DPU A;  2EV0 A;  3ZMD A;  1LNW A;  4E70 A;  1T6S A;  2A3S A;  2QZ8 A;  1IN5 A;  2BGC A;  5J8C A;  3FX3 A;  1UHW A;  5IT9 Z;  3ABU A;  3D5L A;  3L9F A;  2FE3 A;  5A2Q Z;  2PEX A;  4UXN A;  3EQL F;  3JSP A;  3KP4 A;  1FWZ A;  5ICG A;  3K1P A;  2ADU A;  3KP3 A;  4O5V A;  4HV6 A;  3T8T A;  3E6M A;  4LG0 A;  2V79 A;  1XSX A;  3SZP A;  2G9W A;  4MQ9 F;  2ZFW A;  1BI1 A;  6PAX A;  3TGN A;  1S8N A;  1WI9 A;  5J8F A;  1C0W A;  4M6X A;  1F9N A;  4UVB A;  2V1U A;  1CF7 B;  2ZNY A;  5D8L B;  2K4B A;  1FSH A;  1YW8 A;  2DLL A;  4O3M A;  2D2W A;  3VFZ A;  1IZ1 A;  2QYO A;  4A6D A;  1FT9 A;  1CGP A;  2M87 A;  2W85 A;  4LK0 F;  3CJN A;  1J5Y A;  3I54 A;  3GFI A;  2M45 A;  3LWF A;  4IRH A;  4AIK A;  5HS8 A;  2OZ6 A;  2VBZ A;  3O3K A;  1LDJ A;  4WXD A;  1R5H A;  3Q9V A;  5CVJ A;  4L18 B;  2OAZ A;  4MTD A;  1G4D A;  3V7S A;  1OKR A;  1Z05 A;  1B6A A;  4A0X A;  1KYZ A;  4DNC A;  3CUQ A;  3N97 A;  2F5C A;  2QQ9 A;  2CG4 A;  3CUO A;  2OD5 A;  2K27 A;  2CGP A;  3WGG A;  3LAJ A;  1Z1D A;  3CO6 C;  3HTS B;  3W6J B;  4GYI A;  3R4K A;  4RB0 A;  2F2E A;  1FP1 D;  3V7C A;  3BJA A;  4EJT A;  1FC3 A;  3K2Z A;  1MZB A;  3BRO A;  4HOB A;  2NAZ A;  2A69 F;  4LB5 A;  1BIA A;  1ZGJ A;  2OQR A;  2RKH A;  1S7A A;  5LHI A;  3K1M A;  2H6C A;  3AAF A;  4Y15 A;  3TKY A;  3ZP5 A;  1QBJ A;  1MKM A;  2L3D A;  4LLN A;  2RC4 A;  2DFI A;  3RI4 A;  5L3G A;  4M73 A;  2GWR A;  3VOE A;  5LGU A;  3NQO A;  5H20 A;  4LG0 B;  1HW2 A;  2P7V B;  5DV5 A;  2O8X A;  1ZYR F;  2A61 A;  1ZG5 A;  2J5P A;  1Y0U A;  4ZYG A;  3GO5 A;  1TLH B;  4N0B A;  2P5V A;  2CSO A;  1HKT A;  2YSR A;  2FU4 A;  1UB9 A;  1UFM A;  3W6K B;  4B8X A;  3O2P E;  1G6N A;  5ICE A;  2JTV A;  2STT A;  1LQ1 A;  3I53 A;  1XMA A;  2FNA A;  1VTN C;  4WX9 A;  1O3T A;  2LF7 A;  1XCV A;  3PFI A;  2VOP A;  2V1D A;  3HSE A;  3T1B A;  4NB5 A;  1TW2 A;  4YII A;  2A6E F;  2MLK A;  3ZQ7 A;  4HX7 A;  4U0W A;  4YFK F;  3TO9 A;  2WTE A;  3O6B B;  1IXR C;  4MGR A;  2ZXJ A;  4Q47 A;  4EV0 A;  2IA0 A;  4GXO A;  4LJZ F;  1G3W A;  3BWG A;  5FLX K;  1QQI A;  2XAJ A;  4ENK A;  4UNO A;  3CUQ B;  5HVQ C;  1BBY A;  3SQN A;  3GZ6 A;  4HDV A;  1FYM A;  3F8N A;  4CDG A;  1FNN A;  1MD0 A;  4IRI A;  3B73 A;  1ZRD A;  4JBA A;  3LST A;  1E2X A;  3IRQ A;  3FMR A;  5EEG A;  3L09 A;  4U88 A;  1BC8 C;  4H0E A;  2A07 F;  5FO5 A;  4MTE A;  5LHH A;  2IRF G;  5L3B A;  3MWM A;  4P55 A;  4OIN F;  3GUD A;  2EV5 A;  5H6R A;  1FSE A;  1F4K A;  4YG2 F;  2HEO A;  5LEK A;  3QOP A;  3DV8 A;  4QWQ A;  2VXZ A;  3FMQ A;  3IWF A;  3CDH A;  3DQV C;  2PLY A;  2XAS A;  3TO6 A;  4M9X A;  2EFN A;  4L9N A;  3JTG A;  4Q4Z F;  4WWC A;  4EM1 A;  3WU1 B;  5CVU A;  5KVR A;  1JXS A;  1RZ4 A;  2IW5 A;  2RN7 A;  1XSV A;  3WGH A;  1AOY A;  2NS0 A;  1EH6 A;  2BEO A;  4EJW A;  1S29 A;  3R61 A;  4UVC A;  5D5U B;  5BOX A;  3WTY C;  2CFX A;  2YR2 A;  1LDD A;  2R3S A;  3MFK A;  2P7C B;  4KMF A;  2J5O A;  3FHZ A;  2VC1 A;  3QAH A;  3BOQ A;  3RKW A;  1UST A;  2X4H A;  4I0A A;  2O3F A;  3HOS A;  3HHH A;  3RPU A;  3I4P A;  4A6E A;  2P8T A;  1PP7 U;  2X0L A;  1BIB A;  2HKX A;  1Z9C A;  1DPU A;  3ECH A;  4EM2 A;  5BS6 A;  2Q8K A;  2L4M A;  4U0V A;  3E6B A;  5HDG A;  4LGW A;  1TQI A;  1KU3 A;  2HR3 A;  4M9S A;  2FRH A;  5LRS A;  4KA4 A;  1YLF A;  1TNS A;  3IHU A;  4K2E A;  3FF5 A;  1H9G A;  2EV6 A;  3EYY A;  2NYX A;  2JPB A;  3E5Q A;  4D0P A;  2Q2E A;  4CZZ A;  3H92 A;  3HRU A;  4EGY A;  4L9J A;  5D8K B;  5JFR A;  2V9V A;  4I09 A;  1B9M A;  3VOD A;  4AVP A;  2HWV A;  2DQL A;  3FXQ A;  5D4S A;  1IN6 A;  3E5U A;  2H27 A;  2PI0 A;  1JE8 A;  2ZCW A;  4S04 A;  3G73 A;  4HLX A;  1WKM A;  3G3Z A;  3RPQ A;  3I5U A;  4G7H F;  3OOP A;  4GYG A;  1P4W A;  3K0L A;  1FYL A;  2DQR A;  3HRM A;  4G7Z F;  4OIP F;  4Y13 A;  2EA2 A;  3MAJ A;  3J80 Z;  4CO8 A;  4L0Z B;  1SMT A;  3CO7 C;  3B02 A;  5D5V B;  2IPQ X;  4IVN A;  3MCZ A;  5D4R A;  3I59 A;  5D5W B;  3WTZ A;  3EYI A;  4L9V A;  1YTY A;  3VEP A;  3R0A A;  4YIF A;  1BI2 A;  2XV4 S;  2EFW A;  3VB2 A;  4KN4 X;  5LGN A;  4ESF A;  3C1D A;  1KQ9 A;  2HQN A;  4IPA A;  4ENJ A;  3LA2 A;  3QPT A;  3IKV A;  1HW1 A;  1BI3 A;  4BH9 A;  3ELK A;  1DUX C;  4HYE A;  2VT2 A;  3RKX A;  1J7K A;  1RI7 A;  1UHM A;  4XLP F;  3KP2 A;  1Z91 A;  2VBY A;  2VBX A;  5DD8 A;  3GEZ A;  4ZYE A;  3M9A A;  4EM0 B;  3NEU A;  5BMZ A;  3M7G A;  2CWE A;  1IRG A;  5LHG A;  2UZK A;  5CYV A;  3E6D A;  3DF8 A;  1S3J A;  4HX8 A;  1XCB A;  1JHF A;  2WWY A;  1DP7 P;  5HS9 A;  3ZMZ A;  4RB1 A;  3FXU A;  5EEH A;  5FD5 A;  1YS7 A;  1ONV A;  4EJV A;  3U1D A;  1LJ9 A;  4G7O F;  3V4G A;  2Z9O A;  2Z5U A;  4ETS A;  3E3V A;  2FBK A;  3DPL C;  3KEQ A;  2GZW A;  2LF8 A;  5DUI A;  1FBQ A;  1YW7 A;  2OBP A;  2DU9 A;  4XSZ F;  4EQQ A;  5AIQ A;  1GXQ A;  4ZYH A;  5LGT A;  3IC7 A;  3ZN1 A;  2R7D A;  2PMU A;  4OIR F;  5JHU A;  4MHG A;  3QRF F;  1KQ0 A;  3F23 A;  2PG4 A;  5E1Z B;  2PJP A;  1K6O A;  3WTU C;  2RGV A;  2LSO A;  2P6T A;  1SD4 A;  1XDS A;  5E20 A;  4XRF A;  1G3T A;  2XRO A;  2WC2 A;  3WTX C;  3RTR A;  4PGH A;  2HZT A;  3GF2 A;  2V1X A;  2Q0O A;  1IF1 A;  2A5Y B;  1SMY F;  1MJ9 A;  3F8C A;  2KIM A;  1I1G A;  2XAF A;  3E5X A;  3WE2 A;  3ZN0 A;  3F8M A;  4YFX F;  1QO0 D;  2ELH A;  3I59 B;  4IJA A;  1K7A A;  1ZLK A;  1BM9 A;  3U2R A;  1SFE A;  3JAM Z;  2OU2 A;  4MQV A;  1YO5 C;  1ON1 A;  4R79 A;  1OYI A;  1BOA A;  2KIU A;  3KEO A;  1U5T C;  1KGS A;  2XIG A;  4NQW A;  2L4A A;  4XLN F;  2PBI A;  4GGG A;  3GYH X;  1AWC A;  1UCR A;  1OMI A;  4FT8 A;  3RYR A;  2NRA C;  4WXC A;  1KU2 A;  1SFX A;  1HST A;  4L5I A;  2FOK A;  2AXL A;  5TRD A;  3KZY A;  2P5K A;  1XDU A;  2VE9 A;  2FA5 A;  2QBY A;  1T0F A;  1XSD A;  2DBB A;  1RNL A;  3GZ5 A;  4BHC A;  4WXH A;  4I2O A;  4I0B A;  3F8F A;  4KNY A;  2G7U A;  2Z99 A;  1ZRE A;  1FY7 A;  3DP7 A;  2PMH A;  4UUV A;  1XGM A;  4EJU A;  2Z33 A;  2ISY A;  3E6C C;  3F22 A;  3FM3 A;  2MH9 A;  3GFJ A;  1WSU A;  1GVJ A;  2CW0 F;  2DI3 A;  2LDU A;  3I0T A;  1JGS A;  1HKS A;  5HDK A;  4AIH A;  1I6X A;  3ULQ B;  3CLO A;  4P9F A;  4LLL A;  2GA1 A;  2JT1 A;  3V8K A;  1RUO A;  2IA1 A;  4U0Y A;  4I02 A;  3HIF A;  3ROU A;  1K79 A;  2MC3 A;  3P9K A;  1HW5 A;  1KYW A;  2WV0 A;  4ESB A;  5E1W A;  2FEZ A;  4I98 B;  5TJJ A;  3K9T A;  1K78 A;  1RUN A;  4CIC A;  2MA3 A;  5FGM A;  2E7X A;  4A5N A;  2GQQ A;  1GXP A;  4OOI A;  3MZH A;  3P9I A;  5CVV A;  3GX4 X;  2ZME A;  3JTH A;  4QLC U;  2OQG A;  4ON0 A;  2RV8 A;  3SZT A;  5K5O A;  3ZPL A;  5E8I A;  1PP8 F;  3NRV A;  2QUF A;  2ESN A;  2QM3 A;  5CVR A;  2ESH A;  3WTT C;  2D45 A;  1Z6R A;  5BPD A;  1EH7 A;  2AS5 F;  4IHS A;  4CGZ A;  5DD4 A;  1HKQ A;  3TQN A;  1LDK B;  2ISZ A;  3L7W A;  4IHT A;  1PDN C;  3PQK A;  4BYY A;  5ILV A;  3WTW C;  4RB2 C;  2FF4 A;  1T39 A;  1QGP A;  4HQM A;  1ZH5 A;  3M8F A;  5HDN A;  1ZHF A;  1FLI A;  3RIR A;  3TOA A;  2GXG A;  1D5V A;  5K5R A;  3J81 Z;  3KP5 A;  5AON A;  2TDX A;  4A0Z A;  1J0R A;  2YPR A;  2H09 A;  1D8J A;  1ZLJ A;  1O3S A;  1KA8 A;  1B9N A;  2O03 A;  2XKO A;  2CQK A;  2E1N A;  2XHK A;  5CVI A;  4I7H A;  4HBL A;  4XBF A;  4EGZ A;  2XVC A;  5IT3 A;  2XAH A;  2QBY B;  2EK5 A;  4MEX F;  4U7D A;  1G3Y A;  1E17 A;  1FP2 A;  2HYG D;  4TV7 A;  1R1T A;  2BYV E;  3BJO A;  1MJA A;  1XGS A;  3F72 A;  3QP6 A;  4HF0 A;  3GLX A;  2QLZ A;  1DPR A;  4A12 A;  4AWX B;  3DKW A;  4Y17 A;  3F6O A;  1BJA A;  1F5T A;  2COM A;  4XSX F;  3KET A;  5HOO A;  1IXS B;  1PUE E;  1TBX A;  4ZZL A;  1G3S A;  3RDI A;  5K1Y A;  4DQ2 A;  2O6G E;  5L3D A;  2DPD A;  3WE3 A;  4M71 A;  1BI0 A;  3BY6 A;  3R6S A;  3SXY A;  1IAW A;  4HA8 A;  2W57 A;  4F7Z A;  4FHT A;  1LVA A;  1ODD A;  5CJ9 A;  1YG2 A;  1TQP A;  1ZAO A;  4UV9 A;  4RB3 C;  3M1E A;  4P9U A;  1SFU A;  1KU7 A;  2QWW A;  2F5D A;  3V7R A;  4B09 A;  1K78 B;  1J2X A;  2YX7 A;  4RAZ A;  5BQT A;  2H6B A;  4KUM A;  2HDC A;  4L0Y B;  2KJC A;  2FBH A;  2ZME B;  3BPX A;  1QPM A;  3KCC A;  2STW A;  4M9Z A;  2BBY A;  1P2F A;  5LEJ A;  1ZAR A;  3FZV A;  3SFZ A;  2VC0 A;  1TNT A;  1TW3 A;  1B1B A;  1S6L A;  1W5T A;  3WG9 A;  1SD6 A;  4AIJ A;  3BP8 A;  4CXF A;  5DCF A;  3SHF A;  3RYP A;  2HTS A;  3EUH A;  3KLN A;  3JSO A;  3J7A O;  2VOD A;  5DYM A;  1FYK A;  3HUG A;  4JK1 X;  3QP5 A;  2M1B A;  1X3U A;  1KQ8 A;  4GO1 A;  2M30 A;  3EDP A;  2ZBK A;  4G6D A;  2A6H F;  1V4R A;  1P4X A;  4M74 A;  2H94 A;  3CTA A;  3C3W A;  2W24 A;  2XKP A;  3GVA A;  1YYV A;  2DTR A;  4UHT A;  2EB7 A;  2UXX A;  2YX4 A;  1ZRC A;  3LFK A;  3M8E A;  3U9G A;  1RIO H;  1LEA A;  3KP6 A;  3OV8 A;  4HF1 A;  4Q48 A;  4M6Y A;  1FX7 A;  2IVM A;  2JRT A;  2L54 A;  4LMY A;  4BAY A;  4RS8 A;  2JSC A;  2PFB A;  5FFZ A;  4O6J A;  1YIO A;  4ZH4 F;  4KDP A;  5H6Q A;  2GA2 A;  1IN8 A;  2ZJ2 A;  4JQF A;  3I58 A;  2HQR A;  2W25 A;  2XAG A;  1W5S A;  3WTV C;  4YFN F;  1WRJ A;  2EA4 A;  2EJR A;  5DCM A;  3I71 A;  2Y48 A;  3GWZ A;  2A68 F;  3P9C A;  1EV7 A;  2ETH A;  1XB4 A;  1LEB A;  2Z3Y A;  3BZ6 A;  3ML6 A;  2VOO A;  2CO5 A;  1H9T A;  1I1S A;  3REO A;  5HLG A;  1FBS A;  4KFC A;  5E1X A;  4BHP A;  1XD7 A;  1P6R A;  5J6X A;  2HGC A;  1O57 A;  1R36 A;  3CUQ C;  2XUB A;  4ZYD A;  5D5X B;  2HOE A;  2D1H A;  2K86 A;  3LQQ A;  3F6V A;  1J59 A;  2P5L C;  1STZ A;  2VON A;  1EH8 A;  1GHC A;  4ENN A;  4M72 A;  4IXA A;  5JI6 A;  4RGX A;  2K4J A;  3K69 A;  3LAP A;  1SD7 A;  4IF4 A;  5IT9 K;  1IRF A;  1J9I A;  2QVO A;  5A2Q K;  2FBI A;  5ILU A;  3FM5 A;  5ERI A;  1MGT A;  4LB6 B;  4OIQ F;  1JHH A;  1R7J A;  2HTJ A;  2OA4 A;  2PN6 A;  4A2U A;  1MJB A;  5F6F A;  3QU6 A;  2RDP A;  5JR3 A;  1T38 A;  5AIP A;  3H3U A;  5L3C A;  4HAM A;  1W7P A;  2EFO A;  3HYI A;  3V8L A;  1V3F A;  1ZRF A;  4OMY A;  5F64 A;  3FXR A;  3FMS A;  3TDU C;  4HZF A;  2M5W A;  3ZMU A;  4HW0 A;  2QQB A;  1YS6 A;  5CLS A;  3ERE D;  4ASN A;  2EFQ A;  1HSJ A;  1XGN A;  1OYW A;  2UWM A;  1QNT A;  1Z6T A;  2DK5 A;  3D0S A;  2XRN A;  2MBF A;  5JVT A;  4KIB A;  1BC7 C;  2IJL A;  4OIO F;  4S05 A;  1O7F A;  3F8B A;  1U8R A;  4RGR A;  2IA2 A;  1YQA A;  2D1V A;  1DDN A;  3N4M A;  5LRR A;  1OPC A;  2C6Y A;  2O61 A;  4KIC A;  4N9I A;  2UXN A;  5DCM B;  2RQP A;  4G6Q A;  4RAY A;  1P4A A;  3P7N A;  2QEN A;  3C18 A;  4R8H A;  2OZU A;  5D6F A;  3ABT A;  3JAM K;  4Q5S F;  1L0O C;  1IN7 A;  3ISP A;  3JW4 A;  1FZP B;  2QQA A;  1ZGA A;  3TO7 A;  4BNC A;  1D3Y A;  2KJB A;  2RVC A;  2DK8 A;  4HV5 A;  4KMU X;  4G9Y A;  1FBU A;  4R1H A;  3HOT A;  1WQ2 A;  3KP7 A;  1XMK A;  2K02 A;  3LA7 A;  2F5E A;  2PQ8 A;  5E17 F;  3COA C;  1W7P D;  4LD5 A;  4FX0 A;  2HYF A;  1Z7U A;  3WTS C;  1W4M A;  2KRF A;  4HQE A;  3R0J A;  2E1C A;  2Y0M A;  2LNB A;  3KZZ A;  4CYD A;  5DUK A;  3LQR A;  3DPT A;  4UV8 A;  1U2W A;  4KIG A;  1ON2 A;  5FB2 A;  1U78 A;  2FXA A;  1T98 A;  2V6C A;  1W7P B;  2VBW A;  3IWZ A;  2KKO A;  3DXJ F;  4L9T A;  4ESJ A;  1U5T A;  5L3F A;  5E8G A;  4KT5 C;  3IL2 A;  2GAU A;  4HLY A;  5FLX Z;  4EMS A;  1SAX A;  4MEY F;  1SD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...