3OIOA

Crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
112
structure length
112
Chain Sequence
b'NAGSQPKLTEAVSLMEANIEEPLSTDDIAYYVGVSRRQLERLFKQYLGTVPSKYYLELRLNRARQLLQQTSKSIVQIGLACGFSSGPHFSSTYRNHFNITPREERAQRAQPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator (AraC-type DNA-binding domain-cont
molecule tags Transcription regulator
source organism Chromobacterium violaceum
publication title Crystal structure of transcriptional regulator (AraC-type DNA-binding domain-containing proteins) from Chromobacterium violaceum
rcsb
total genus 40
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3oioA00
3BR1A 4I6ZA 2O9LA 3JRHA 2JA6J 1NK3P 3ZQGA 3BR3A 1POGA 1WGXA 3BTLA 2XGCA 3I4NJ 4A3CJ 2ME0A 2KT0A 4M3EA 4A3JJ 5JLXA 3GBGA 4JX4A 3HOWJ 3S1RJ 3BG5A 2AHQA 2LY9A 5J3LA 2LKXA 1ZR4A 5IYCJ 1NK2P 2LD5A 1HDDC 1IV6A 4IHWA 2WB1N 3O8GA 1JTXA 2HOAA 1GUUA 3B6CA 4QTRA 1GT0C 4D5CA 1W0UA 1O4XA 2P81A 4BXXJ 1IC8A 1SANA 1TWHJ 4HNVA 2IEKA 4A93J 4AUXA 3TP3A 5IYBJ 1WI3A 1VNDA 1H89C 5JLWA 5FKKA 4CYCB 3JRGA 3BR5A 1ZGWA 2E2JJ 3BQZA 1JUPA 2XGDA 5IYDJ 4DW6A 3S16J 4Y52J 1JKOC 1LFBA 3SDGA 4V2GA 2XSDC 1YRNA 2YUSA 1BW6A 5J1RA 2XPWA 2DTZA 2X6OA 3BTJA 3IV5A 3K2AA 3A01B 1VI0A 2JJ7A 1ETQA 2MW8A 4A3EJ 2IBDA 2NVQJ 3S1MJ 2X9DA 1LFUP 5EGOB 2KDZA 3CDLA 4A69C 4M3GA 4NDLA 3PO3J 2JA8J 2B63J 3SJMA 3Q0UA 5K7FA 2GBYA 3NAUA 4C3JJ 4FISA 1FTZA 2NVTJ 1G2HA 4XIDA 2L7ZA 4JYKA 4QIWN 1BL0A 2AO9A 2DA6A 2HDDA 3TW6A 1F43A 4MFEA 1U78A 1DU0A 1JGGA 3FIWA 1A6IA 1TWCJ 1UMQA 3HOZJ 1HCRA 5C4JJ 4M3BA 4A3IJ 3BG9A 1ITYA 4B3AA 2CJJA 2HYJA 3IH4A 4XK4A 1QVUA 1IDZA 1JJ8C 2L9RA 4XICA 2GM4A 4BKXA 1X58A 1AU7A 2DMQA 5F0HA 2VKVA 1Y1VJ 1WH5A 3DEWA 1ETOA 2MGQA 1AKHB 3HOXJ 2DMPA 4BY1J 1LE8A 1F36A 1RKWA 2L0KA 2R7ZJ 3TP0A 3GTQJ 4X1EA 3S1NJ 4MIMA 1OCTC 3RKQA 3F0CA 1JTYA 3ZQIA 1AKHA 3BG3A 4GFBA 3OIOA 1IUFA 2L7MP 4D7MA 4EEFG 4J19A 5EEAA 1U8BA 2K9QA 3FK7A 2XB0X 3K7AJ 3S2HJ 5F0FA 3S14J 4RDUA 1HOMA 1HDPA 2NVXJ 3HB9A 1MSEC 5IPAA 1QRYA 2R5YA 2NS8A 3C2BA 3UKGA 2FJ1A 3GTGJ 3BQYA 5M5YJ 5M3FJ 1ETVA 2CUEA 1RKTA 4I76A 2VI6A 1FIPA 2CQQA 2HXIA 4DZPA 1BJZA 3CMYA 2COBA 2YU9J 4B1RA 3MKLA 4DYQA 3HM5A 3NARA 1RESA 3GTJJ 3BTCA 1ZTRA 4M3DA 4FCYA 1H88C 1RR7A 2FX0A 5DTDA 3IH3A 2CUFA 5FLVA 4X6AJ 1MBKA 2W48A 3CCYA 5F27A 2DA5A 4C3IJ 1Z77A 3MN2A 5FKNA 4BBRJ 1Z0XA 4FTHA 3GTPJ 2M2EA 2DA7A 3JRDA 5GP9A 3OSFA 4DZJA 3CQZJ 2VKEA 2H8RA 5E3LA 2GLOA 3G1OA 4A3FJ 3ZOBA 3LSPA 2IAIA 5E3NA 1IG7A 1OJLA 1TWFJ 4XRSG 3JREA 4AYBN 1IRZA 1QPIA 3BTIA 3H0GJ 1GDTA 3GTMJ 5DS9A 5IOZA 3VPRA 3LNQA 4A3DJ 2E1OA 3Q3SA 3FK6A 2R93J 5BNGA 4UUSB 2ID6A 2HOTA 5FKMA 2Y2ZA 1WPKA 2R5ZB 4M6VA 1MBHA 2FQ4A 2I10A 1Y1WJ 4DYRA 3LOCA 5C3EJ 4XRMA 1JJ6C 2K9SA 2EZIA 2K9NA 1ETYA 3LSRA 3HGYA 2ZB9A 1U9NA 4UUTA 5F0CA 1MBFA 1D5YA 2JK3A 2CU7A 2HOSA 2NOGA 3HKZN 1MBGA 1ORKA 2M9HA 2M8GX 3G1LA 1LE8B 5IOYA 5M5WJ 2Y30A 2HXOA 2DA2A 3H3VK 2TCTA 5FKOA 4UUSA 2O8KA 1FEXA 2VPRA 1JKQC 3ZQHA 2MSYA 1EF4A 3Q0WA 5EZHA 1R9TJ 3RZDJ 1BW5A 1U9OA 3S2DJ 4MO7A 5J1UA 5C44J 1JKPC 2LVSA 2DA4A 1K61A 2M34A 4V2FA 1FTTA 4BY7J 4IHVA 1UG2A 5FLMJ 1I50J 4FE4A 2LTPA 4M3FA 1P7JA 2Y0SN 3PM1A 5E3OA 1MBJA 1VF9A 3QPSA 2L7FP 2XPUA 1GV5A 5HODA 3JR9A 2EZLA 2TRTA 5EF6A 1Q1VA 2RAEA 1MBEA 4C2MJ 1OCPA 1B72A 4C3HJ 5EZGA 4D5FA 5M3MJ 2XB5A 1B8IA 5IP6A 3ZQLA 3G1MA 1K83J 1X2MA 2JWTA 5FKLA 3JRBA 1S7EA 4A3KJ 5E3MA 2JA5J 3A03A 1WCMJ 2FD5A 1BA5A 5K7HA 3HDDA 4IEJA 3M4OJ 4QSHA 3I4MJ 3M3YJ 1QVTA 2XGEA 1CQTA 4RBOA 4XRSA 5C4XJ 4JX6A 3A01A 1MH3A 5EG0B 1I6HJ 2JA7J 1JT0A 3GTKJ 3OSGA 5K7ZA 3GTLJ 1JT6A 1B72B 4A3BJ 2ELKA 5F1JA 2E19A 3QPLA 2E2HJ 3S15J 1T56A 1JUMA 2OF7A 2DMNA 3JRCA 4IHXA 3TW7A 3LSJA 5EDNA 3L1PA 3HOVJ 1WH7A 2LFBA 1APLC 5EGOA 1HLVA 2K40A 4BBSJ 3FISA 3SFIA 4A3MJ 3S1QJ 4ABZA 2NVYJ 1RPWA 1FIAA 2EZHA 2EZKA 2ID3A 3WHCA 2R5ZA 1NTCA 1ETWA 4MFDA 1PUFA 1W0TA 2WAQN 2CRGA 5EYRA 1ZKGA 2R5YB 1XS9A 1MNMC 3LSGA 2M0CA 2EBIA 2LR8A 2N8GA 4S0HB 2R0QC 1AHDP 5EG0A 3HBLA 3JRIA 3D1NI 1T33A 4W1UA 2X48A 3GTOJ 1XC5A 1UHSA 3HOUJ 1ETKA 2CQXA 2Y31A 3TEDA 3QQAA 3FKIJ 1FJLA 3WHBA 2HQ5A 3BR2A 4A3GJ 4JP0A 2LK2A 4W97A 2QF7A 2ECBA 1A5JA 2JMWA 4AC0A 3ZQCA 1ZQ3P 5GPCA 3A02A 2EQRA 1ETXA 1TWGJ 1H8AC 1GV2A 2VUMJ 3OOUA 1TWAJ 2WV1A 4Y7NJ 1JUSA 2DJNA 4B4CA 2DA1A 2LP0A 3PO2J 1I3QJ 1DU6A 1IGNA 5IP9J 1YRNB 1ZR2A 2O7OA 3O8HA 5M5XJ 3IH2A 5J1YA 5F04A 2LLKA 2NS7A 2YS9A 2QCOA 3RQIA 3ZQFA 2PMZN 5F08A 3S17J 5GPAA 3B6AA 1HF0A 1GVDA 1IJWC 1PUFB 2G0EA 3HGGA 1OFCX 4L5EA 4LOCA 1ENHA 2DN0A 2R92J 3JRFA 3JRAA 3BR6A 2D5VA 4A3LJ 1X2NA 5FJ8J 1E3OC 2MG4A 2OPTA 1B8IB 3E7LA 1P7IA 2JN6A 2XPVA 1MH4A 2DMUA 3HEFA 3HOYJ 2XRLA 4DYCA 1MSFC 4CYCA 4D7NA 2Y9ZA 3Q0VA 4FE7A 3BT9A 3MVPA 4G12A 4IHYA 2ME6A 4MLOA 9ANTA 1IDYA 2DMTA 3DCFA 5IP7J 2EH3A 3W6VA 2E2IJ 3RZOJ 1SFOJ 1XG1A 4JX5A 1RETA 2ECCA 1JKRC 2Y9YA 2DA3A 1ZK8A 2HI3A 3BR0A 1TC3C 2H1KA 1VFCA
chains in the Genus database with same CATH superfamily
3BR1A 5EEGA 1QHHD 3OS2A 3FMRA 2IRFG 1POGA 1T98A 4A3CJ 4M3EA 2QKMB 4YFNF 4A3JJ 3VYTB 3R0AA 3KLOA 2V26A 3GBGA 3V7CA 1VQOI 5BS6A 2LKSA 1FY7A 2KP6A 3H5NA 3T8RA 2AHQA 2P5KA 3K6GA 3KETA 2LD5A 1NK2P 3RCOA 3O6BB 1FP1D 4OIRF 4EJTA 3W2AA 1GUUA 1DDNA 5DEQA 4GYGA 4CZCA 2HNHA 3SXYA 4D5CA 4BXXJ 2HDCA 3ZMDA 4HSRA 4BQOA 2KIQA 1IC8A 2LREA 2E1MB 1U5TC 4LITA 5KAIC 2HR3A 4A0XA 3M8EA 4XSZF 1Y6IA 2A3SA 4KUMA 4S05A 1WI3A 3C2GA 2LYCA 5FKKA 1ZGWA 1R4NB 4U7BA 2E2JJ 2K27A 1JUPA 1YX5A 3EUHA 1H0MA 2AS5F 3E6DA 1Z7LA 1P9QC 3SDGA 3T0YA 1XSXA 2YUSA 5J1RA 3PNTA 2XPWA 2DT6A 4XOPA 2ELHA 2O6GE 2DU9A 2R7OA 1O57A 5E8GA 3KP2A 5DCMA 3T8TA 1YYVA 2MH9A 5D5XB 4U0YA 3IAS2 1LB2A 2KZVA 2GZWA 3SZTA 2Y48A 2M87A 2PX9A 1SMTA 2DLLA 2NS0A 4A69C 2EILH 3KEOA 3CC7I 3KZZA 4NDLA 5DM7F 3GX4X 3CD6I 3Q0UA 5DYMA 3ZN0A 1OISA 1VQ8I 4HG2A 1FTZA 3GMEA 2Y0SA 2M30A 1G2HA 1KZHA 4XIDA 2ZO4A 4JYKA 5LFAA 3D5LA 2DA6A 3TW6A 2ZJPF 2W24A 5K5OA 4ZC3A 4MFEA 2ISZA 5E1WA 3S2WA 3T5XA 3WG9A 3CZ6A 4BXFA 5E1ZB 3WTYC 3ABUA 1A6IA 1R7JA 1YTYA 1UMQA 3HOZJ 5HS8A 1XMAA 4BYYA 4WWCA 4BQAA 3FBIB 2CJJA 4XK4A 2KZGA 1MMNA 4AIDA 4B8XA 3CO7C 2GM4A 1X58A 4CCOA 4E7KA 1FYLA 1HQCA 3DEWA 1ETOA 1AKHB 1RRJA 3RDIA 4DNCA 4ZH4F 4GYIA 3A4CA 3VYUB 3J7ZI 1BIAA 2M4KA 2CQNA 1KGSA 3SZPA 3F23A 4C30A 5CVVA 3LQQA 5LRRA 3DFGA 1HKSA 4A6DA 3TP0A 1R23A 3PUFA 3GFLA 1P4WA 2XASA 4GFBA 1V55H 5B1AH 4D7MA 3PL8A 2JQ7A 1U8BA 4CXFA 4CA0A 3M1EA 3K7AJ 5CYVA 1FBUA 2O0YA 5BQTA 3AG2H 1W36C 1HDPA 1MMDA 1OYYA 2JRMA 4EATA 3IKVA 4UHTA 2EFOA 4GRIA 3OYBA 4XL9A 2FJ1A 3PUBA 4DIQA 3BROA 5M3FJ 3HJEA 4PGHA 4A6EA 3ZGKA 2BBYA 2FOKA 2BY2A 2CUEA 2CV1A 3LAJA 3M7GA 1RKTA 1G6NA 3PFYA 1GVJA 3FXMA 3CMYA 2COBA 4KYWA 3HM5A 1RESA 3BTCA 3RJPA 3CJRB 4Y4RA 2FX0A 3QP5A 3BG7A 5FGMA 3WTVC 2CUFA 4X6AJ 3QP6A 2M3AA 5F27A 5F64A 1Z77A 1ZLKA 1L3LA 3K2ZA 2M8EA 2L9NA 4BBRJ 3U9GA 5B5EC 3V4GA 3I64A 1SMYF 2BXYA 2QQAA 2GA2A 5GP9A 3CQZJ 2X1EA 5K5RA 4G9YA 1R5HA 1JI8A 2GLOA 2TDXA 1FBSA 2V9VA 1IG7A 3I56I 3JREA 4HZFA 5JI6A 2V4JC 3L00A 5BPDA 4E7HA 3BTIA 4I2OA 3AG4H 3GZNB 4I01A 4HX8A 4EJOA 1WJCA 3VPRA 1X3UA 1KU2A 4CCNA 3BLYA 3Q3SA 3BCBA 2E34A 2R93J 3EUAA 3QYBA 2XKOA 2BEOA 2HOTA 3E5UA 2Y2ZA 2R5ZB 2M7BA 2XHKA 1HA8A 2WAQA 3DV8A 5TGTA 1R6RA 2BYVE 4OINF 1PP7U 2I10A 3VFZA 1N77A 4HRIA 4EV0A 2XAGA 2KFDA 2K9SA 4LD5A 3QOPA 1SVOA 3F22A 3PIPF 1U9NA 1UELB 4UUTA 4BJTA 2P6SA 1NHAA 5ICGA 5KNLA 2OA4A 5FB2A 2JVHA 3JSOA 2P5LC 2VJJA 3HKZN 1MBGA 1ORKA 2RGVA 2Y30A 1OYWA 1UG0A 2STTA 4ON0A 3K4BA 3H3VK 3ZRGA 2LBFA 4UUSA 2EV6A 3H36A 5TISC 4RGRA 2HYGD 2VC1A 3H5AA 5LGNA 2KQRA 1TW3A 4V19K 2A6HF 4RB3C 3J80K 4BQQA 4F52A 2RC4A 1BN5A 1BI0A 3J7AY 3DF8A 3RZDJ 1KONA 1S3JA 1U9OA 5J40A 5C44J 4I98B 1J59A 1LJ9A 1SC7A 1K61A 2DA4A 2CV2A 4HNTA 4V2FA 1TLHB 2ZXJA 4YFXF 4IHVA 2EA2A 3H9GA 3ZQQA 1G3TA 4J01A 2DT7B 1W7PA 3CCRI 1QA6A 4M3FA 1P7JA 1VQMI 2Y0SN 3H9QA 5E3OA 1MBJA 2PJRB 3CJQB 3WE2A 3QPSA 1A31A 1Q1VA 2V1DA 3F8MA 3HTUA 4C3HJ 2AXTC 4H4KC 3EDPA 5L3CA 1T08B 4MEYF 2CUZA 2F2EA 5KK1A 5E1XA 4IX7A 2XIGA 1Z9CA 4XN3A 3DKXA 1YG2A 1S7EA 5CPRB 5E3MA 2JA5J 4WK8F 1WCMJ 2FD5A 3OYDA 2IPQX 1HBXG 2QEXI 3LA3A 3HDDA 2ZMEC 2DFFA 3M4OJ 1LPQA 1ODDA 3I4MJ 4RMNA 3A01A 3KE2A 3U21A 5EG0B 4XLAA 3AL0C 2OJED 3I0TA 2GAUA 3GTKJ 4XOTA 4Q47A 3GTLJ 4XLPF 2VODA 3LA2A 1FOWA 4G7ZF 2XF5A 1DQUA 2E2HJ 1KU3A 1USSA 4FHTA 3J81K 3WTSC 3JRCA 2CW0F 3I53A 1QNTA 2MA3A 3BWGA 3TW7A 2A61A 4Y3OA 2KKOA 3RPUD 3X2QH 1WH7A 2LFBA 2ZKZA 1Y0UA 1C0WA 1BR1A 4BBSJ 4AM3A 3FISA 2R7XA 4ABZA 2RQPA 3LSKA 1DUXC 1RPWA 2EZKA 5ILVA 3BG6A 2HQRA 3LSIA 3WHCA 2R5ZA 4OIOF 1IXSB 1UAAA 4MFDA 4IRHA 4PGGA 3I59A 2I8DA 5EYRA 3D5RC 3P5JA 3M9AA 1V3FA 3GYHX 1FOYA 1LKXA 3K0LA 4P96A 4RM3A 5EEHA 5J8FA 3J80Z 1XGOA 2IS2A 3GF2A 2R0QC 5EG0A 3JRIA 3D1NI 2R7SA 3M1CA 3GTOJ 1UHWA 2CH0A 2NNYA 2JUGA 3HOUJ 2L4MA 2CQXA 2Y31A 3TEDA 5FFZA 1B6AA 4F92B 1FZPB 4EQQA 3OS1A 2A5WA 1SEUA 3BR2A 1VTNC 4FX4A 3RSNA 1DPRA 2DW4A 3OL3A 2FQ3A 2QF7A 3AAFA 2XF7A 4BE2A 3ZQCA 4XLNF 2GIVA 2VB6A 2LSOA 5GPCA 2MLGA 3AKZA 1UFMA 2EQRA 1TWGJ 3HOSA 5K5QA 3HSRA 1S6LA 2JUCA 4XONA 2OZ6A 2EINH 2P7VB 1JUSA 3ISPA 2DJNA 1R1TA 1QZYA 4YEJA 5HLGA 1TL8A 1D5VA 2RNJA 4FETA 1HSJA 2LP0A 3PO2J 3CC2I 4HPQA 2F5FA 4G7OF 4EJWA 2HGCA 3A0HC 3C7JA 3KIOA 4ASNA 2O7OA 2V1NA 3KYDB 4E7SA 3OS0A 2E7XA 5J1YA 2YS9A 3RQIA 1JHFA 2IVMA 4O3MA 1V5FA 3BY6A 1IJWC 3WE3A 1PUFB 1QZEA 2G0EA 1OFCX 4L5EA 3VYSB 5ICCA 3UR3C 1MW7A 2ZNYA 3I58A 2OCCH 1OQYA 1X2NA 4LB6B 1B8IB 5DD4A 5A2QZ 4IZZA 5HNFA 1IV8A 3FMQA 2L54A 4B09A 3R4KA 3PSIA 3LSMA 1USTA 4BH9A 4A5MA 3KPHA 3E5QA 3RYPA 2GOMA 4NQWA 4G12A 3MVPA 1I1SA 2F4OB 1O3QA 2JT1A 3U2RA 4BNCA 1EKEA 2VQGA 3FMSA 3W6VA 2UUZA 1SFEA 3TMOA 4Q5SF 1RETA 3RI4A 1JKRC 2AQEA 1X1CA 1H9TA 3BR0A 4NC8A 3PIOF 3OWTA 3HRTA 1HSTA 2DO7A 3TO7A 3HG9A 2XAHA 1FMVA 1WGXA 1WKMA 2XGCA 3BP8A 4Z2YA 3K10A 3ELKA 1KQ8A 2KT0A 4IO9F 4ZTJA 5ILSA 4JX4A 1QU3A 4B48A 3HUGB 3L2WA 4BEHA 4BJ5C 2ZJRF 3SHFA 2DI3A 3O8GA 1LUJB 2R7DA 2BV6A 3SZGA 4KIGA 3HRMA 1GT0C 4PJJA 2QSHX 1VQ5I 2UXNA 4IVNA 2KPMA 2K86A 2P81A 2NAZA 3G6EI 2QQ9A 3GEZA 4CCKA 1TWHJ 3P9KA 4HNVA 4A5NA 2E5NA 2ZC2A 4Q4ZF 3CTAA 1XD7A 1RNLA 4C2UA 4D1QA 1H89C 1NH3A 3JW4A 5CVIA 4ESBA 4KDPA 4DGWB 1D3YA 4U88A 4EJVA 4IOAF 2XGDA 3KP4A 1IN4A 2J5OA 3FXKA 5B1BH 4BAYA 2DOFA 5LEKA 3OYGA 4WCGA 4IRGA 4HDVA 2OQRA 4V2GA 2JPCA 3WGIA 3IWFA 3F8FA 1O7LA 2DTZA 3BTJA 4F7ZA 4LFUA 4HEA2 2PN6A 4BU2A 2LY1A 1WJFA 2P6TA 2EIKH 3DTKA 5B3SH 5JVTA 4H0EA 4A3EJ 2ZNZA 3CLQA 2IBDA 5D8KB 1K4SA 1XMKA 1MD0A 2X9DA 4PSXA 1LFUP 2QM3A 2XAJA 1MMGA 3DBLB 2WY8Q 2KJCA 4G6TB 1LDJA 4M3GA 2FUG2 2JZYA 1Z6RA 4ENNA 2JA8J 2GIZA 2OTLI 2VXDA 2HTJA 3NAUA 3TKYA 4C3JJ 1OR7C 5JHUA 5EJCA 4QIWN 1BL0A 4E4HA 1PVEA 2CFXA 4M9XA 5IT9Z 2RVCA 1WFXA 3FDYA 4HBLA 2HZDA 1BR4A 1TWCJ 3MAJA 2F4IA 2EA4A 1HCRA 4KJZA 2R7RA 5C4JJ 2DTRA 4S04A 2CFOA 4A3IJ 1ITYA 3V8JA 4L18B 3IH4A 4XQFA 1K78B 4KMUX 1IDZA 2M0MA 3IL2A 2L9RA 3L2RA 4OU0A 3KP3A 4BKXA 2VOOA 1YX3A 2DMQA 2W1OA 4U0VA 2VBXA 1KQ0A 1Y1VJ 3H5RA 4RGXA 3CCVI 3BJAA 2MGQA 1G3SA 1ZRCA 3HOXJ 3MEXA 1U5TA 2FNPA 1L0OC 2QSFX 1F36A 2HQAA 2WADA 2L0KA 2R7ZJ 2W4SA 4EJUA 4G94A 1IN5A 5HLHA 2UWMA 2HFHA 2YSRA 4RAZA 4UV9A 3GTQJ 4X1EA 3S1NJ 1J75A 1OCTC 4BHCA 2WAEA 4BEHB 2OAZA 3F0CA 1AKHA 2EK5A 4YFKF 2HU9A 4NQWB 1IUFA 4EEFG 1CGPA 2IGOA 3GZ5A 1JHHA 1YE9A 1Y56A 4UVAA 5LHHA 3FM3A 4ZDPA 2LDUA 4BACA 3S14J 4I02A 3EYIA 3HC7A 1HOMA 4GGGA 1YHQI 1B9NA 1MSEC 2C6YA 2PJRA 2IA0A 4L0ZB 2KRHA 2NS8A 3BQYA 1SAUA 3M8FA 3PNYA 1A36A 2M7AA 3FXQA 4WXCA 3R61A 3BC8A 4RA2A 2WB1A 1O3TA 2HXIA 3DXJF 1BJZA 4XMYA 4PJ0C 5H2FC 1E3HA 4B1RA 4DYQA 1ZTRA 2XROA 1H88C 3DPTA 3HL2A 4HYEA 1K7AA 4GO1A 2BZTA 1IN7A 4ZDOA 1MBKA 2W48A 1M1EB 1EA3A 4A0ZA 4IJAA 4FTHA 2LRDA 2XGXA 3OYLA 2QSGX 2VN2A 3JRDA 4HLYA 1F1ZA 4DZJA 2QQBA 3WTXC 3OSFA 1ACIA 2EFWA 2QZ8A 1ZHFA 1EH7A 3JSPA 2DAOA 5IT3A 2BY3A 4A3FJ 2BHYA 3W6KB 3GLXA 5GAEJ 3K4NA 2ZCWA 3FZVA 2QGUA 3OOPA 3W6JB 4LLNA 4DQ2A 1X1AA 1KYZA 4AYBN 3LAPA 4BS9A 1TT0A 1GDTA 2P5VA 1FWZA 3GFIA 5DS9A 3E3VA 5IOZA 1CF7B 1R4MB 2FEZA 1PYVA 2HYFA 2GOXB 4A3DJ 2R4GA 3E0JB 2E1OA 5FROA 1P2FA 2M5WA 4LB5A 2VJ4A 4F3QA 3OYEA 2VQCA 2HZTA 5FKMA 1WPKA 3JAMZ 1YI2I 2R7TA 1MBHA 1ON1A 1VZ0A 4ANJA 2BVLA 5H20A 1Y1WJ 2IS1A 3LSTA 5C3EJ 2VL8A 3RKWA 2EZIA 1D8KA 2FBKA 2K9NA 1ETYA 4A0YA 3LSRA 3HGYA 3GLLA 2ZB9A 1Z6TA 2OUMA 3DTIA 2XV4S 4RS8A 3WODF 3ZN1A 2JK3A 1XDSA 2L01A 3B02A 2HVQA 2WY7Q 2M9HA 4RAGA 5D6FA 4HLXA 2R3SA 3SDBA 3VOEA 4EVIA 5M5WJ 3SFZA 3J7YJ 3H92A 5LHGA 4CO8A 3T1BA 5FKOA 3L09A 1ULYA 1ZGJA 3RKYA 1VQ6I 2V6EA 2LMDA 2VE9A 3I59B 3WU2C 3KYCB 1MJBA 2MLKA 3PNVA 3WTZA 1EF4A 3QODA 3EYYA 4F93B 5BOXA 1BW5A 5FLXZ 1N75A 2A5YB 3QPHA 2XC7A 2KHMA 4IQ4A 2VBYA 2LNBA 1B59A 1FSHA 1FTTA 4F91B 3KX2A 4M71A 1UG2A 2Y69H 1WHUA 3F21A 4E7JA 5FLMJ 2LH9A 1I50J 2W84A 4FE4A 3I55I 4UNOA 1VF9A 2EPFA 2NVUB 2XPUA 3KLNA 5K1YA 2TRTA 5EF6A 3D5SC 1MBEA 2H1LA 1B72A 2RREA 2Q1ZB 4PFPA 2JTVA 2W00A 5HDGA 3VYRB 1IN8A 3ZQLA 3G1MA 4LLLA 4RM2A 1Z67A 3BZKA 1NG6A 2CQKA 1ZN2A 2L9VA 2M45A 5FKLA 3JRBA 1Q1HA 4FX0A 2LY2A 4RAFA 5GAHJ 3K4JA 1YIJI 2FA5A 2WV0A 5K7HA 2BW3A 4B3XA 4PK4A 1QVTA 2XGEA 5HDKA 5HOOA 3K4MA 3NWTA 4Y15A 4GDFA 5GTIC 1I6HJ 4ETSA 5KHDA 2F4MB 1PJRA 1JT0A 1N78A 1RIOH 2UZKA 1YW9A 2HEOA 3S8PA 3V42A 4I0AA 5F1JA 4CH7A 2A69F 1BI3A 4XN0A 1T56A 3DP7A 3E1SA 4XKCA 2EWNA 1KYWA 4UB8C 5CVRA 1W5SA 2KIFA 4A2UA 5D4SA 1BR2A 1LDKB 5EGOA 1BI2A 2DYRH 2K40A 2V9KA 3KP7A 4G7HF 3ESWB 1K6OA 3S1QJ 4NBQA 3LA7A 2NVYJ 2QLZA 1FIAA 3QU6A 2ID3A 1NTCA 3FXLA 3HRUA 3CUQB 4CSWA 4IKFA 1W0TA 1Z7UA 1T38A 3HYIA 2WAQN 3UNGC 2CRGA 3ASOH 1XS9A 1RR8C 4LJZF 2K4JA 5E17F 1I1GA 2XRNA 4FASD 3ZMVA 2GXBA 2E60A 3A0BC 2N8GA 4KIFA 2H09A 4KFCA 3VSLA 3H3ZA 4EGYA 2OZUA 5HS9A 5LHIA 2EFNA 3HBLA 2Z33A 1AHDP 3HIFA 4W1UA 2IW5A 4KNYA 1XC5A 3L2VA 2DODA 2Y0MA 3WHBA 6PAXA 2OCEA 4AIKA 4CGZA 2H27A 2EFQA 5ERIA 3FF5A 5AONA 4W97A 1BC8C 3DU6A 2ECBA 1WI9A 4KA4A 1A5JA 2P0WA 1JE8A 3FHZA 1ZQ3P 1D8JA 5L3FA 4K2EA 1ETXA 1BM9A 2Q2EA 3ZP5A 3OOUA 3G2BA 4Y7NJ 2RDPA 2ESHA 4B4CA 2Z9OA 1GLNA 3FXUA 2Z16A 1P92A 1OCRH 3U1DA 1IGNA 5IP9J 3O2PE 2BY0A 4NC7A 5DUKA 2X6WA 2FNAA 3O8HA 4CCMA 5M5XJ 3S93A 5IT9K 5F04A 3ZQFA 3Q9SA 3RQ4A 1R22A 3S17J 5GPAA 1TNTA 4DJAA 1I3AA 4O5VA 4E7IA 3COAC 3OY9A 3JTGA 1ENHA 1RI7A 4OIPF 1WVRA 2YX4A 3VDXA 2D5VA 4A3LJ 3RIRA 3B73A 1H9GA 2DXIA 3HEFA 2XPVA 2W82A 1FNNA 1SFXA 5HNHA 1G8XA 1D1BA 2PMHA 4CYCA 1WJEA 4D7NA 1IO2A 2FU4A 1T8IA 2Y9ZA 4BHPA 4FE7A 2MD0A 2ZXIA 3KEYA 2Q2EB 4E7LA 1WJBA 3IUOA 3OYNA 9ANTA 3R0JA 5IP7J 2EH3A 3E5XA 2H6BA 1LFPA 2VKDA 1OMIA 2OV7A 3HZJA 1XTAA 3IAM2 2E2IJ 3RZOJ 3CESA 2DA3A 1ZK8A 2DYSH 2HI3A 1TC3C 4LLGF 1Y39A 2H1KA 2ETHA 2BXZA 1VFCA 2O8KA 1QBJA 3FXRA 4OAYA 5D8LB 2JA6J 1I6XA 1OYIA 3ROUA 3I4NJ 3EUKL 1IN6A 5JLXA 1IAWA 2KL4A 3OYFA 3GZ6A 3VWBA 1IXCA 3S1RJ 3BG5A 1ZAOA 2LY9A 5J3LA 4ZTFA 1ZR4A 2KISA 1HDDC 1E2XA 4RB2C 2X6YA 2QKLB 4IHWA 2WB1N 2CW8A 3F8BA 5DCFA 3MKZA 1JTXA 2BHZA 3G71I 2VIXA 3CDHA 5GADJ 4KMFA 4YIIA 4L5JA 5BPIA 2VE8A 1X4PA 5TJJA 4B47A 1QO0D 1W0UA 3ABTA 4C2TA 2EIJH 4OAZA 2NOJB 3HUGA 3ZMTA 4A93J 4AUXA 1YW7A 2NRAC 3TP3A 1NG7A 1VNDA 3JRGA 1WWXA 2XAUA 3BQZA 3JCUC 5IYDJ 4DW6A 1STZA 1B4AA 2ZXWH 1G59A 4P9UA 1JKOC 4IQJA 1LFBA 3WTTC 1YRNA 1LNWA 1FC3A 2PLYA 3LL7A 3IV5A 3ONQA 4U7DA 1PUEE 5ILUA 3A01B 2FBHA 2JJ7A 3GCMA 2MW8A 4I0BA 4AD9A 2HVSA 2NVQJ 3S1MJ 4JOMA 5EGOB 1XX5A 2X1CA 2MYSA 3CDLA 1U0JA 4UVCA 1FLIA 4Y33A 3OR1C 2B63J 2F5CA 2GXAA 3SJMA 5K7FA 2D1HA 2BE5F 2ACJA 5FD5A 2MABA 3IHUA 2EFPA 2KIUA 4XLHA 2NVTJ 1Z05A 2F48A 4AYBA 3I4PA 1PDNC 4KN4X 1YO5C 1VQ9I 1XPXA 3BZCA 1ZREA 3FXOA 1WJ5A 3N4MA 3RTRA 4R79A 4XLFA 4L5IA 2ELJA 3WGHA 2RV8A 3FBNB 4BUPA 2VLAA 1SD6A 1JGGA 3FIWA 3HHHA 1IW7F 1G4DA 4MEXF 1V5EA 1ZLJA 1R58A 4R8HA 1CF7A 4XM3A 1XMXA 3ZQ7A 1FOXA 2IA2A 5L3BA 1JJ8C 2KLOA 4LGWA 2DT5A 2PG4A 1E17A 1AU7A 3N97A 2K02A 5F0HA 4LG0A 2K9MA 3ASNH 1J5YA 1D1CA 3K9TA 4NC6A 4EM1A 1BC7C 1R00A 1ZYRF 2OU2A 4XKBA 1AWCA 1TZLA 2DFEA 1G3WA 1W5CC 1P6RA 1RKWA 4MQ9F 3VODA 4CCJA 3G73A 5HLTA 4RGSA 3BPXA 3CCEI 2IJLA 3K69A 4YG2F 1OKRA 1UZCA 3ML6A 1LVAA 1JTYA 3ZQIA 2JSCA 4RB1A 2H8WA 4J19A 4MHGA 2EB7A 2K9QA 2A6EF 4M6XA 5LGUA 3S2HJ 1S8NA 1T0FC 3FXJA 3M8JA 2PMUA 3W3CA 3GVAA 2CQ7A 2MD5A 1HXDA 5J4YA 2K85A 4QWQA 2R5YA 3CP8A 2ISYA 4XBFA 3UKGA 3GTGJ 5M5YJ 3AFHA 1YOVB 3KFWX 3H1CA 2L2OA 1S7AA 1OCZH 5E79C 3DEEA 1XSVA 3E6BA 1WRJA 2CQQA 4DZPA 4ZJZA 2YU9J 2M1BA 3NARA 1T6SA 2R7UA 4M3DA 2ZFUA 4U87A 3TBIA 3VEPA 1EH6A 1D0YA 5DTDA 4DBRA 1XN7A 3IH3A 4MNUA 1IUYA 1S7OA 4WX9A 1O3SA 1QHGA 1WJAA 3CCYA 4TV7A 2Z1DA 1AOYA 4C3IJ 1A35A 1FOKA 3MN2A 1YJ9I 5FKNA 3BCAA 2D1VA 1Z0XA 2CW7A 3WU0A 1IZ1A 2YPRA 3RPQA 3IRQA 2M2EA 4MTDA 2DA7A 3I9V2 3F9KA 2DOAA 1J09A 2VKEA 4JK1X 5E3LA 3G1OA 1TQPA 3ZOBA 2L5QA 1HW1A 5E3NA 3OYKA 5HLIA 1TWFJ 4XRSG 2G7UA 3C3WA 3OIQA 1W7PD 4UUVA 3K4CA 3H0GJ 3GTMJ 2QENA 2V79A 3RKXA 4AVZA 2OBPA 2W25A 2VC0A 3G3ZA 2NNNA 1REPC 3HPGA 2G9WA 4WF2A 1E3PA 3OYCA 4WXHA 5BNGA 5HVQC 2IP2A 4UUSB 3ULQB 2ID6A 2E35A 4IOCF 3TO9A 3CUOA 3CUQA 2DQRA 1V54H 3V8KA 1XGMA 2WTEA 3HOTA 2PI0A 4M6VA 5F1RA 3TGNA 1JJ6C 1SD4A 1FMWA 3LSHA 2MC4A 2L9SA 1WZ2A 4BQNA 1MBFA 2A07F 1D5YA 1ERDA 3P9CA 2CU7A 2XKPA 4NHJA 2NOGA 2P7CB 2HTSA 1SD5A 4O6JA 5IOYA 1XCVA 3ERED 3DBRB 3DLLF 2HXOA 2KIMA 2DA2A 2KMUA 2TCTA 2X51A 3KP5A 4QPOA 2PFBA 4HQEA 1R36A 4X0GA 1WJDA 4CYDA 4IPAA 1W1WE 3VB2A 1J9IA 2XDVA 3K70D 1ZG1A 3Q0WA 5EZHA 1R9TJ 1XDUA 2VQHA 4BL0B 3S2DJ 4UV8A 3KCCA 2H6CA 2MFZA 2EV0A 1SVMA 2M34A 2UV1A 1DP3A 5FD6A 4XNFA 4OMYA 2LTPA 1Y0NA 3ERMA 1A6QA 4HX7A 2KDOA 3QRFF 2GWRA 1TP4A 1LEBA 3ABKH 1GV5A 4P55A 1T0FA 5HODA 5D4RA 2EZLA 1PP8F 5CVUA 3IP4B 2M4GA 4C2MJ 1OCPA 2O3FA 4BGDA 4OWRB 1K79A 1K78A 1XCBA 3OYIA 2XB5A 3OYAA 1B8IA 1TT5B 3PJRA 4D0PA 1U3EM 2XVCA 3TO6A 3TL4X 1K83J 4NUBA 1X2MA 1DP7P 2IXSA 2JWTA 1OPCA 1U2WA 3E6MA 1K4TA 2ZSIB 2OC6A 4M9SA 3TOBA 1BA5A 2V7FA 4IEJA 4QSHA 1VQKI 5D6EA 1BBYA 4RBOA 2HVRA 3CF5F 1I39A 4UVBA 4XRSA 5C4XJ 4JX6A 1MH3A 2JRTA 3L7WA 2L02A 4ITVA 5K7ZA 2QQ8A 1JT6A 4DBQA 1B9MA 2P8TA 1MNDA 2DBBA 3S3MA 2FXAA 3ZMZA 5A2QK 3QPLA 1QGPA 4BHBA 2MC3A 3ABMH 2CUJA 2OF7A 2HDWA 4Z6YA 5LLQA 4ZYGA 2IGMA 4IHXA 1YFHA 5B66C 3L9FA 4II3A 5FRMA 2DDAA 2FMLA 2X4HA 3HOVJ 4LG3A 2QBYA 2YX7A 1FPQA 4G8XA 4D9JA 5ED4A 2R7VA 5FO5A 3LQRA 4HF2A 1R1VA 2IS4A 3QWLA 4RLQA 2CG4A 3ZR8X 3KP6A 1ETWA 3SQNA 3K70C 1SD7A 3CP2A 2DK5A 4I7HA 4KT6A 3JAMK 3K1PA 3IRRA 1I27A 1ZKGA 2VT2A 2R5YB 1MKMA 5IY5H 4CCLA 3SEZA 5BMZA 2I5UA 2JPBA 3LSGA 1FBQA 2EBIA 2M0CA 1EV7A 3CCUI 4ZYHA 3O3KA 4S0HB 2LBFB 3CDIA 3ZMSA 2IA1A 5J47A 2WWYA 2QWWA 3F8NA 3V7RA 1VQPI 1QZZA 2FMYA 3FKIJ 4HSTA 4J00A 1R49A 1Z3YA 2YU3A 4JP0A 1F5TA 1FT9A 4CZZA 4AC0A 2BY1A 1X4OA 1FYMA 3A02A 2NYXA 2DK8A 3Q9VA 1H8AC 1GV2A 3NEUA 1ZRDA 2VUMJ 5HS7A 1TWAJ 4N0BA 1A04A 3F6VA 3GFMA 4PUSA 4ESFA 1ZRFA 4KISA 2ZXHA 1IRXA 1MZBA 2VASA 2DA1A 1LQ1A 2KJBA 1D1AA 1TQMA 3BJOA 4Y13A 2PBIA 3I54A 4ESJA 1GHCA 3ABLH 3U1KA 3C2HA 2NS7A 2QCOA 2PMZN 4BE1A 5F08A 3B6AA 1GVDA 3MQ0A 3HRSA 3ZPLA 3MKWB 3I5UA 1OR7A 3HSFA 3S3OA 3D0SA 3F8CA 2BVMA 2DN0A 3WG7H 2COMA 2X1DA 4Q48A 4YRVA 2CWEA 3J81Z 4M74A 1BOBA 2DDBA 5FJ8J 2MG4A 1E3OC 4IRIA 2DMUA 4HA8A 1TW2A 2XRLA 4DYCA 4DOZA 1MSFC 1GXPA 3IC7A 2EV5A 2FE3A 3QYFA 2R7QA 5L3DA 4IHYA 1KA8A 4NB5A 4C9YA 1U5TB 1Z91A 4MLOA 2W7NA 2DFHA 1IDYA 2QA4I 2P4WA 4ENKA 2DJIA 4P5OA 2Q8KA 5DM6F 3BDDA 5JR3A 5AIQA 4YIRX 1KQ9A 1V4RA 2EIMH 3CCLI 3OL4A 4JX5A 4L9JA 1HKTA 1Y8RB 2ECCA 1F9NA 2B0LA 1TNSA 2L7KA 3PQJA 3REOA 3KYLA 1RUNA 1EH8A 2E7WA 2VJIA 4I6ZA 2O9LA 1EJ9A 2W85A 1R71A 3JRHA 5JVGF 1NK3P 3P9IA 3ZQGA 3BR3A 3BTLA 2FBIA 2RNGA 5AIPA 4AWXB 2ME0A 3ZCOA 2HPMA 1IXRC 4EM0B 2Z2SB 1OCCH 4HX4A 1UJ8A 3HOWJ 2LKXA 1R1UA 4LMYA 2FOWA 5L3EA 5IYCJ 4M72A 1IV6A 2ICWG 1YS6A 4G6QA 3OYMA 3LFKA 2PMZA 1YS7A 2HOAA 2K9LA 3S3NA 2K3PA 3B6CA 3PFIA 4QTRA 4AIJA 2E1CA 2XAQA 4PJMA 4XORA 5JFRA 1E0EA 1O4XA 3CCQI 2L4AA 1SANA 4JQFA 2IEKA 5FLXK 2LG4A 2CMPA 4PFOA 4WXDA 2K3FA 5IYBJ 2O8XA 1YLFA 5JLWA 3EQLF 4CYCB 3BR5A 1R5GA 2IT0A 5DCMB 5D5UB 1SAXA 2J5PA 2LOOA 3SYTA 3S16J 4ENJA 4Y52J 2HKXA 5DUIA 1QPMA 1SFKA 1BOAA 1WSUA 5E20A 1KU9A 2XSDC 1BW6A 4CUGA 3OYJA 2K4BA 3R60A 2X6OA 2Y75A 3RPUA 3K2AA 2V9PA 2F5VA 2HPIA 4IL6C 3MZ8A 2OQGA 1VI0A 3MKYB 1ETQA 3OIPA 4IXAA 4OMZA 1N25A 1IF1A 1T39A 1BJAA 1MGTA 4Y17A 1VQLI 2KDZA 2WC2A 3KZIC 3EETA 1SVLA 3KEQA 1ZG3A 1YIOA 2F5EA 3TDZC 3PO3J 1TBXA 2FF4A 3C18A 4MTEA 1P4XA 2K7LA 1AA7A 2GBYA 3FM5A 3DU5A 3PSFA 4FISA 1W7PB 1XGSA 1T2KA 2L7ZA 2AO9A 3QPTA 2HDDA 3CMAI 1F43A 3HXLA 4KITB 2CS3A 2CSOA 3H9JA 1U78A 1MMSA 1DU0A 3MD2A 4HDUA 2CYYA 3K1MA 4RAYA 1V5GA 3DEUA 5J4VA 2HQNA 2IGKA 3CLOA 1F4KA 4OOIA 5GTHC 4LK0F 4BDZA 4M3BA 3BG9A 1JGSA 3EUHC 2HYJA 3DBHB 3W2VA 4B3AA 1VQ7I 1QVUA 4ZYEA 4P9FA 4XICA 1ZG5A 3C1DA 5D5VB 3DKYA 4AVPA 3L2CA 1W5TA 2QYOA 4RGUA 2VKVA 1WH5A 2V1UA 4AIHA 2DMPA 4BY1J 1LE8A 2L3DA 1T95A 2FRHA 3DPUA 1BIBA 2CV0A 3BZ6A 3K4KA 1DGWY 2HWVA 4KIBA 4YELA 1HW2A 2RN7A 4MIMA 1Z1DA 4FQGA 2VONA 5CKTA 3RKQA 4XSXF 3BG3A 3V8LA 1YJNI 3OIOA 2L7MP 3CC4I 5EEAA 1S29A 2XUBA 5LD2C 1X3ZB 2WAFA 5LGTA 1WQ2A 3FK7A 4II2A 3IWZA 1G3YA 2XB0X 3DWLE 2ZFWA 5F0FA 4N4NB 3GW2A 4RDUA 2NVXJ 3HB9A 5E8IA 2PJPA 2GQQA 4M6YA 5IPAA 4I09A 4RB0A 1QRYA 2QVOA 2ZJ2A 2O5RA 3C2BA 2DPDA 3QAHA 1Z3XA 3H35A 2ZMEA 5J8CA 1ZARA 4KN7X 3SEQA 2W57A 1ETVA 4QLCU 5HDNA 1JXSA 4I76A 2BW3B 2VI6A 4HF0A 1FIPA 1YW8A 1UB9A 3MCZA 3MKLA 5FRNA 3GTJJ 3GO5A 2VKHA 4PZJA 5ICFA 4FCYA 2NXNB 3F3XA 1RR7A 2A68F 5J6XA 3K4LA 3K1NA 4ZZDA 3QU3A 4PDKA 3IKTA 5FLVA 3MWMA 4N9IA 2DA5A 3BOQA 3GXOA 3PQKA 3QYEA 3GTPJ 4XLEA 4LG0B 2LKPA 3LMMA 5LRSA 4HF1A 1X1PA 1S72I 3HKZA 1XGNA 2A05A 2LC2A 3OR2C 3EPZA 3P7NA 1W36D 4GXOA 3GUDA 4R1HA 3H0DA 2R7FA 2H8RA 3W2WA 3LSPA 4LK1F 2IAIA 1GXQA 2VJ5A 4XRFA 1OJLA 1VQ4I 1TTYA 4XLCA 1KU7A 1HW5A 1IRZA 1QPIA 4L0YB 1UHMA 2RQQA 1U6GA 4ZDLA 3TDUC 2VBWA 2ZMEB 3LNQA 3TQNA 2BGCA 1LEAA 2IS6A 2Z3YA 4E6KG 1MIJA 2KRCA 3FK6A 2Z99A 4HOBA 3HHGA 5CLSA 3CUQC 2A6TA 1K6YA 1YQAA 3I3LA 4I99C 4BXUA 3CJNA 2FQ4A 1OCOH 1SFUA 3KZYA 4N9HA 4DYRA 2MH2A 3DKWA 3LOCA 3M07A 4XRMA 5LBQA 2VXZA 3CJTB 4L9VA 2X85A 2WBMA 5F0CA 3E97A 3CMMA 1MMAA 3QOEA 3G4SI 2DCEA 2B9SA 5F6FA 2HOSA 3A2KA 1YJWI 2M8GX 2XF6A 3G1LA 3V7SA 5JHFA 1LE8B 4YIFA 5ICEA 4CICA 4KT5C 5KCMA 4UB6C 1FEXA 1FX7A 3DTEA 4XKWA 2VPRA 2RKHA 1JKQC 1D0ZA 2MSYA 3ZQHA 3JTHA 1U8RA 3NRVA 5CQEA 4E70A 3VSKA 4MO7A 5J1UA 4BE0A 1JKPC 5L3GA 2PQ8A 2LVSA 3I71A 1Z21A 4BY7J 4IHSA 3L2UA 2AXLA 3AG1H 3WTWC 4ZYDA 1S9HA 3DQVC 3PM1A 1ZGAA 3E6CC 5CVJA 2L7FP 3S32A 3JR9A 1FYKA 2RAEA 1QQIA 2F6CA 3MZYA 5EZGA 4D5FA 4EM2A 5M3MJ 1FP2A 4GCVA 1BI1A 5IP6A 5DV5A 2V6CA 3ZXSA 1ONVA 5D5WB 1MDMA 2BOLA 2H94A 4ENMA 3BJ6A 2EJRA 1FSEA 4PSWA 1O7FA 4A3KJ 3A03A 1J0RA 1TQIA 3HPHA 1X3WB 4ZZLA 5KVRA 4HAMA 4HW0A 1P4AA 3M3YJ 3CF2A 4B43A 4IHTA 1CQTA 2GA1A 2O03A 3MZHA 3R6SA 4NNJA 2JA7J 5DDGA 1O3RA 1J2XA 3OSGA 2WA0A 2HOEA 3HSEA 2FSWA 1B1BA 1B72B 5TRDA 4A3BJ 1HC8A 2ELKA 2E19A 4LIUA 3S15J 1ZH5A 5CJ9A 1S5LC 1JUMA 1LDDA 1RUOA 2DMNA 2E1NA 3ECOA 4XR6A 3LSJA 5EDNA 3L1PA 3GWZA 2VOPA 3A1YA 4M9ZA 2Z5UA 2XAFA 1APLC 1HLVA 4UXNA 2ESNA 1R5ID 2B7EA 2VPLA 3SFIA 4A3MJ 3HTSB 2EZHA 2JSPA 2QUFA 2JVGA 3FHNA 1D0XA 1PUFA 5H6RA 2X6XA 5E18F 3OV8A 4CDGA 3F6OA 1MNMC 3J7AO 2GXGA 3N05A 1I5ZA 2LR8A 2E1MC 4E7ZA 4HV5A 2VBZA 3MMYB 2DPUA 1T33A 3GFJA 2X48A 1DPUA 1HKQA 4KICA 4RLFA 1UHSA 2OTJI 4HQMA 3WGGA 1ETKA 2UXXA 4L9NA 4MGRA 2DFIA 3QQAA 1FJLA 2LF7A 2HQ5A 5LEJA 2QBYB 4A3GJ 3AL0B 4MQVA 1LVKA 2VQLA 4PCQA 4L9TA 1X1DA 4B44A 2LK2A 1J7KA 4BDYA 3ECHA 2JMWA 2XSJC 3LFUA 1ZELA 3CO6C 2DOEA 1YITI 3FX3A 2E71A 1OLTA 1MJ9A 2OD5A 3WU1B 2WV1A 2KRFA 5GAGJ 4XKVA 3AG3H 2ADUA 1RC9A 2X0LA 1I3QJ 1ON2A 5DD8A 5H6QA 4M73A 1DU6A 4IF4A 3Q5FA 2AQFA 2DQLA 5CQGA 4QPQA 3CCJI 1ZR2A 1YRNB 2STWA 4UY8I 2K5CA 1MNEA 3NQOA 2F5DA 3IH2A 5FFXA 3H3UA 2LLKA 1IRFA 4HNUA 2HKOA 4PJNA 3MFKA 1HF0A 1IRGA 4P1WA 3DLAA 3HGGA 1RZ4A 4LOCA 1X19A 3WTUC 3OMYA 1X1BA 2R92J 4PJLA 3JRFA 3JRAA 3BR6A 4ZYAA 2Q0OA 3CCSI 2HS5A 2OPTA 2YR2A 4FT8A 3RYRA 2CGPA 3E7LA 1UCRA 2ZBKA 2CO5A 1P7IA 2JN6A 1MH4A 2PEXA 3HOYJ 2E36A 4U0WA 4A12A 2JA2A 4F55A 1Y8QB 2E5ZA 3LWFA 2LF8A 4G6DA 2VT3A 4LIVA 3Q0VA 4CHUA 4OIQF 3BT9A 1VQNI 4EGZA 4HV6A 2R7WA 2D45A 3FKJA 4AU7A 2ME6A 3NWSA 3OYHA 3L2QA 1XB4A 3TOAA 2ZJQF 3F72A 2DMTA 3CMEI 3DCFA 2ZSHB 3ZMUA 2D2WA 2V1XA 2IGNA 2MBFA 3FWEA 3BPVA 4JBAA 4EMSA 1XG1A 3CCMI 1SFOJ 2O61A 1MJAA 3DPLC 2Y9YA 1MDMB 4N4OB 1DGRM 1XSDA 1W4MA 2G7HA 5KAFC 4BJ6C
chains in the Genus database with same CATH topology
3BR1A 4I6ZA 2O9LA 3JRHA 2JA6J 1NK3P 3ZQGA 3BR3A 1POGA 1WGXA 3BTLA 2XGCA 3I4NJ 4A3CJ 2ME0A 2KT0A 4M3EA 4A3JJ 5JLXA 3GBGA 4JX4A 3HOWJ 3S1RJ 3BG5A 2AHQA 2LY9A 5J3LA 2LKXA 1ZR4A 5IYCJ 1NK2P 2LD5A 1HDDC 1IV6A 4IHWA 2WB1N 3O8GA 1JTXA 2HOAA 1GUUA 3B6CA 4QTRA 1GT0C 4D5CA 1W0UA 1O4XA 2P81A 4BXXJ 1IC8A 1SANA 1TWHJ 4HNVA 2IEKA 4A93J 4AUXA 3TP3A 5IYBJ 1WI3A 1VNDA 1H89C 5JLWA 5FKKA 4CYCB 3JRGA 3BR5A 1ZGWA 2E2JJ 3BQZA 1JUPA 2XGDA 5IYDJ 4DW6A 3S16J 4Y52J 1JKOC 1LFBA 3SDGA 4V2GA 2XSDC 1YRNA 2YUSA 1BW6A 5J1RA 2XPWA 2DTZA 2X6OA 3BTJA 3IV5A 3K2AA 3A01B 1VI0A 2JJ7A 1ETQA 2MW8A 4A3EJ 2IBDA 2NVQJ 3S1MJ 2X9DA 1LFUP 5EGOB 2KDZA 3CDLA 4A69C 4M3GA 4NDLA 3PO3J 2JA8J 2B63J 3SJMA 3Q0UA 5K7FA 2GBYA 3NAUA 4C3JJ 4FISA 1FTZA 2NVTJ 1G2HA 4XIDA 2L7ZA 4JYKA 4QIWN 1BL0A 2AO9A 2DA6A 2HDDA 3TW6A 1F43A 4MFEA 1U78A 1DU0A 1JGGA 3FIWA 1A6IA 1TWCJ 1UMQA 3HOZJ 1HCRA 5C4JJ 4M3BA 4A3IJ 3BG9A 1ITYA 4B3AA 2CJJA 2HYJA 3IH4A 4XK4A 1QVUA 1IDZA 1JJ8C 2L9RA 4XICA 2GM4A 4BKXA 1X58A 1AU7A 2DMQA 5F0HA 2VKVA 1Y1VJ 1WH5A 3DEWA 1ETOA 2MGQA 1AKHB 3HOXJ 2DMPA 4BY1J 1LE8A 1F36A 1RKWA 2L0KA 2R7ZJ 3TP0A 3GTQJ 4X1EA 3S1NJ 4MIMA 1OCTC 3RKQA 3F0CA 1JTYA 3ZQIA 1AKHA 3BG3A 4GFBA 3OIOA 1IUFA 2L7MP 4D7MA 4EEFG 4J19A 5EEAA 1U8BA 2K9QA 3FK7A 2XB0X 3K7AJ 3S2HJ 5F0FA 3S14J 4RDUA 1HOMA 1HDPA 2NVXJ 3HB9A 1MSEC 5IPAA 1QRYA 2R5YA 2NS8A 3C2BA 3UKGA 2FJ1A 3GTGJ 3BQYA 5M5YJ 5M3FJ 1ETVA 2CUEA 1RKTA 4I76A 2VI6A 1FIPA 2CQQA 2HXIA 4DZPA 1BJZA 3CMYA 2COBA 2YU9J 4B1RA 3MKLA 4DYQA 3HM5A 3NARA 1RESA 3GTJJ 3BTCA 1ZTRA 4M3DA 4FCYA 1H88C 1RR7A 2FX0A 5DTDA 3IH3A 2CUFA 5FLVA 4X6AJ 1MBKA 2W48A 3CCYA 5F27A 2DA5A 4C3IJ 1Z77A 3MN2A 5FKNA 4BBRJ 1Z0XA 4FTHA 3GTPJ 2M2EA 2DA7A 3JRDA 5GP9A 3OSFA 4DZJA 3CQZJ 2VKEA 2H8RA 5E3LA 2GLOA 3G1OA 4A3FJ 3ZOBA 3LSPA 2IAIA 5E3NA 1IG7A 1OJLA 1TWFJ 4XRSG 3JREA 4AYBN 1IRZA 1QPIA 3BTIA 3H0GJ 1GDTA 3GTMJ 5DS9A 5IOZA 3VPRA 3LNQA 4A3DJ 2E1OA 3Q3SA 3FK6A 2R93J 5BNGA 4UUSB 2ID6A 2HOTA 5FKMA 2Y2ZA 1WPKA 2R5ZB 4M6VA 1MBHA 2FQ4A 2I10A 1Y1WJ 4DYRA 3LOCA 5C3EJ 4XRMA 1JJ6C 2K9SA 2EZIA 2K9NA 1ETYA 3LSRA 3HGYA 2ZB9A 1U9NA 4UUTA 5F0CA 1MBFA 1D5YA 2JK3A 2CU7A 2HOSA 2NOGA 3HKZN 1MBGA 1ORKA 2M9HA 2M8GX 3G1LA 1LE8B 5IOYA 5M5WJ 2Y30A 2HXOA 2DA2A 3H3VK 2TCTA 5FKOA 4UUSA 2O8KA 1FEXA 2VPRA 1JKQC 3ZQHA 2MSYA 1EF4A 3Q0WA 5EZHA 1R9TJ 3RZDJ 1BW5A 1U9OA 3S2DJ 4MO7A 5J1UA 5C44J 1JKPC 2LVSA 2DA4A 1K61A 2M34A 4V2FA 1FTTA 4BY7J 4IHVA 1UG2A 5FLMJ 1I50J 4FE4A 2LTPA 4M3FA 1P7JA 2Y0SN 3PM1A 5E3OA 1MBJA 1VF9A 3QPSA 2L7FP 2XPUA 1GV5A 5HODA 3JR9A 2EZLA 2TRTA 5EF6A 1Q1VA 2RAEA 1MBEA 4C2MJ 1OCPA 1B72A 4C3HJ 5EZGA 4D5FA 5M3MJ 2XB5A 1B8IA 5IP6A 3ZQLA 3G1MA 1K83J 1X2MA 2JWTA 5FKLA 3JRBA 1S7EA 4A3KJ 5E3MA 2JA5J 3A03A 1WCMJ 2FD5A 1BA5A 5K7HA 3HDDA 4IEJA 3M4OJ 4QSHA 3I4MJ 3M3YJ 1QVTA 2XGEA 1CQTA 4RBOA 4XRSA 5C4XJ 4JX6A 3A01A 1MH3A 5EG0B 1I6HJ 2JA7J 1JT0A 3GTKJ 3OSGA 5K7ZA 3GTLJ 1JT6A 1B72B 4A3BJ 2ELKA 5F1JA 2E19A 3QPLA 2E2HJ 3S15J 1T56A 1JUMA 2OF7A 2DMNA 3JRCA 4IHXA 3TW7A 3LSJA 5EDNA 3L1PA 3HOVJ 1WH7A 2LFBA 1APLC 5EGOA 1HLVA 2K40A 4BBSJ 3FISA 3SFIA 4A3MJ 3S1QJ 4ABZA 2NVYJ 1RPWA 1FIAA 2EZHA 2EZKA 2ID3A 3WHCA 2R5ZA 1NTCA 1ETWA 4MFDA 1PUFA 1W0TA 2WAQN 2CRGA 5EYRA 1ZKGA 2R5YB 1XS9A 1MNMC 3LSGA 2M0CA 2EBIA 2LR8A 2N8GA 4S0HB 2R0QC 1AHDP 5EG0A 3HBLA 3JRIA 3D1NI 1T33A 4W1UA 2X48A 3GTOJ 1XC5A 1UHSA 3HOUJ 1ETKA 2CQXA 2Y31A 3TEDA 3QQAA 3FKIJ 1FJLA 3WHBA 2HQ5A 3BR2A 4A3GJ 4JP0A 2LK2A 4W97A 2QF7A 2ECBA 1A5JA 2JMWA 4AC0A 3ZQCA 1ZQ3P 5GPCA 3A02A 2EQRA 1ETXA 1TWGJ 1H8AC 1GV2A 2VUMJ 3OOUA 1TWAJ 2WV1A 4Y7NJ 1JUSA 2DJNA 4B4CA 2DA1A 2LP0A 3PO2J 1I3QJ 1DU6A 1IGNA 5IP9J 1YRNB 1ZR2A 2O7OA 3O8HA 5M5XJ 3IH2A 5J1YA 5F04A 2LLKA 2NS7A 2YS9A 2QCOA 3RQIA 3ZQFA 2PMZN 5F08A 3S17J 5GPAA 3B6AA 1HF0A 1GVDA 1IJWC 1PUFB 2G0EA 3HGGA 1OFCX 4L5EA 4LOCA 1ENHA 2DN0A 2R92J 3JRFA 3JRAA 3BR6A 2D5VA 4A3LJ 1X2NA 5FJ8J 1E3OC 2MG4A 2OPTA 1B8IB 3E7LA 1P7IA 2JN6A 2XPVA 1MH4A 2DMUA 3HEFA 3HOYJ 2XRLA 4DYCA 1MSFC 4CYCA 4D7NA 2Y9ZA 3Q0VA 4FE7A 3BT9A 3MVPA 4G12A 4IHYA 2ME6A 4MLOA 9ANTA 1IDYA 2DMTA 3DCFA 5IP7J 2EH3A 3W6VA 2E2IJ 3RZOJ 1SFOJ 1XG1A 4JX5A 1RETA 2ECCA 1JKRC 2Y9YA 2DA3A 1ZK8A 2HI3A 3BR0A 1TC3C 2H1KA 1VFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR1 A;  4I6Z A;  2O9L A;  3JRH A;  2JA6 J;  1NK3 P;  3ZQG A;  3BR3 A;  1POG A;  1WGX A;  3BTL A;  2XGC A;  3I4N J;  4A3C J;  2ME0 A;  2KT0 A;  4M3E A;  4A3J J;  5JLX A;  3GBG A;  4JX4 A;  3HOW J;  3S1R J;  3BG5 A;  2AHQ A;  2LY9 A;  5J3L A;  2LKX A;  1ZR4 A;  5IYC J;  1NK2 P;  2LD5 A;  1HDD C;  1IV6 A;  4IHW A;  2WB1 N;  3O8G A;  1JTX A;  2HOA A;  1GUU A;  3B6C A;  4QTR A;  1GT0 C;  4D5C A;  1W0U A;  1O4X A;  2P81 A;  4BXX J;  1IC8 A;  1SAN A;  1TWH J;  4HNV A;  2IEK A;  4A93 J;  4AUX A;  3TP3 A;  5IYB J;  1WI3 A;  1VND A;  1H89 C;  5JLW A;  5FKK A;  4CYC B;  3JRG A;  3BR5 A;  1ZGW A;  2E2J J;  3BQZ A;  1JUP A;  2XGD A;  5IYD J;  4DW6 A;  3S16 J;  4Y52 J;  1JKO C;  1LFB A;  3SDG A;  4V2G A;  2XSD C;  1YRN A;  2YUS A;  1BW6 A;  5J1R A;  2XPW A;  2DTZ A;  2X6O A;  3BTJ A;  3IV5 A;  3K2A A;  3A01 B;  1VI0 A;  2JJ7 A;  1ETQ A;  2MW8 A;  4A3E J;  2IBD A;  2NVQ J;  3S1M J;  2X9D A;  1LFU P;  5EGO B;  2KDZ A;  3CDL A;  4A69 C;  4M3G A;  4NDL A;  3PO3 J;  2JA8 J;  2B63 J;  3SJM A;  3Q0U A;  5K7F A;  2GBY A;  3NAU A;  4C3J J;  4FIS A;  1FTZ A;  2NVT J;  1G2H A;  4XID A;  2L7Z A;  4JYK A;  4QIW N;  1BL0 A;  2AO9 A;  2DA6 A;  2HDD A;  3TW6 A;  1F43 A;  4MFE A;  1U78 A;  1DU0 A;  1JGG A;  3FIW A;  1A6I A;  1TWC J;  1UMQ A;  3HOZ J;  1HCR A;  5C4J J;  4M3B A;  4A3I J;  3BG9 A;  1ITY A;  4B3A A;  2CJJ A;  2HYJ A;  3IH4 A;  4XK4 A;  1QVU A;  1IDZ A;  1JJ8 C;  2L9R A;  4XIC A;  2GM4 A;  4BKX A;  1X58 A;  1AU7 A;  2DMQ A;  5F0H A;  2VKV A;  1Y1V J;  1WH5 A;  3DEW A;  1ETO A;  2MGQ A;  1AKH B;  3HOX J;  2DMP A;  4BY1 J;  1LE8 A;  1F36 A;  1RKW A;  2L0K A;  2R7Z J;  3TP0 A;  3GTQ J;  4X1E A;  3S1N J;  4MIM A;  1OCT C;  3RKQ A;  3F0C A;  1JTY A;  3ZQI A;  1AKH A;  3BG3 A;  4GFB A;  3OIO A;  1IUF A;  2L7M P;  4D7M A;  4EEF G;  4J19 A;  5EEA A;  1U8B A;  2K9Q A;  3FK7 A;  2XB0 X;  3K7A J;  3S2H J;  5F0F A;  3S14 J;  4RDU A;  1HOM A;  1HDP A;  2NVX J;  3HB9 A;  1MSE C;  5IPA A;  1QRY A;  2R5Y A;  2NS8 A;  3C2B A;  3UKG A;  2FJ1 A;  3GTG J;  3BQY A;  5M5Y J;  5M3F J;  1ETV A;  2CUE A;  1RKT A;  4I76 A;  2VI6 A;  1FIP A;  2CQQ A;  2HXI A;  4DZP A;  1BJZ A;  3CMY A;  2COB A;  2YU9 J;  4B1R A;  3MKL A;  4DYQ A;  3HM5 A;  3NAR A;  1RES A;  3GTJ J;  3BTC A;  1ZTR A;  4M3D A;  4FCY A;  1H88 C;  1RR7 A;  2FX0 A;  5DTD A;  3IH3 A;  2CUF A;  5FLV A;  4X6A J;  1MBK A;  2W48 A;  3CCY A;  5F27 A;  2DA5 A;  4C3I J;  1Z77 A;  3MN2 A;  5FKN A;  4BBR J;  1Z0X A;  4FTH A;  3GTP J;  2M2E A;  2DA7 A;  3JRD A;  5GP9 A;  3OSF A;  4DZJ A;  3CQZ J;  2VKE A;  2H8R A;  5E3L A;  2GLO A;  3G1O A;  4A3F J;  3ZOB A;  3LSP A;  2IAI A;  5E3N A;  1IG7 A;  1OJL A;  1TWF J;  4XRS G;  3JRE A;  4AYB N;  1IRZ A;  1QPI A;  3BTI A;  3H0G J;  1GDT A;  3GTM J;  5DS9 A;  5IOZ A;  3VPR A;  3LNQ A;  4A3D J;  2E1O A;  3Q3S A;  3FK6 A;  2R93 J;  5BNG A;  4UUS B;  2ID6 A;  2HOT A;  5FKM A;  2Y2Z A;  1WPK A;  2R5Z B;  4M6V A;  1MBH A;  2FQ4 A;  2I10 A;  1Y1W J;  4DYR A;  3LOC A;  5C3E J;  4XRM A;  1JJ6 C;  2K9S A;  2EZI A;  2K9N A;  1ETY A;  3LSR A;  3HGY A;  2ZB9 A;  1U9N A;  4UUT A;  5F0C A;  1MBF A;  1D5Y A;  2JK3 A;  2CU7 A;  2HOS A;  2NOG A;  3HKZ N;  1MBG A;  1ORK A;  2M9H A;  2M8G X;  3G1L A;  1LE8 B;  5IOY A;  5M5W J;  2Y30 A;  2HXO A;  2DA2 A;  3H3V K;  2TCT A;  5FKO A;  4UUS A;  2O8K A;  1FEX A;  2VPR A;  1JKQ C;  3ZQH A;  2MSY A;  1EF4 A;  3Q0W A;  5EZH A;  1R9T J;  3RZD J;  1BW5 A;  1U9O A;  3S2D J;  4MO7 A;  5J1U A;  5C44 J;  1JKP C;  2LVS A;  2DA4 A;  1K61 A;  2M34 A;  4V2F A;  1FTT A;  4BY7 J;  4IHV A;  1UG2 A;  5FLM J;  1I50 J;  4FE4 A;  2LTP A;  4M3F A;  1P7J A;  2Y0S N;  3PM1 A;  5E3O A;  1MBJ A;  1VF9 A;  3QPS A;  2L7F P;  2XPU A;  1GV5 A;  5HOD A;  3JR9 A;  2EZL A;  2TRT A;  5EF6 A;  1Q1V A;  2RAE A;  1MBE A;  4C2M J;  1OCP A;  1B72 A;  4C3H J;  5EZG A;  4D5F A;  5M3M J;  2XB5 A;  1B8I A;  5IP6 A;  3ZQL A;  3G1M A;  1K83 J;  1X2M A;  2JWT A;  5FKL A;  3JRB A;  1S7E A;  4A3K J;  5E3M A;  2JA5 J;  3A03 A;  1WCM J;  2FD5 A;  1BA5 A;  5K7H A;  3HDD A;  4IEJ A;  3M4O J;  4QSH A;  3I4M J;  3M3Y J;  1QVT A;  2XGE A;  1CQT A;  4RBO A;  4XRS A;  5C4X J;  4JX6 A;  3A01 A;  1MH3 A;  5EG0 B;  1I6H J;  2JA7 J;  1JT0 A;  3GTK J;  3OSG A;  5K7Z A;  3GTL J;  1JT6 A;  1B72 B;  4A3B J;  2ELK A;  5F1J A;  2E19 A;  3QPL A;  2E2H J;  3S15 J;  1T56 A;  1JUM A;  2OF7 A;  2DMN A;  3JRC A;  4IHX A;  3TW7 A;  3LSJ A;  5EDN A;  3L1P A;  3HOV J;  1WH7 A;  2LFB A;  1APL C;  5EGO A;  1HLV A;  2K40 A;  4BBS J;  3FIS A;  3SFI A;  4A3M J;  3S1Q J;  4ABZ A;  2NVY J;  1RPW A;  1FIA A;  2EZH A;  2EZK A;  2ID3 A;  3WHC A;  2R5Z A;  1NTC A;  1ETW A;  4MFD A;  1PUF A;  1W0T A;  2WAQ N;  2CRG A;  5EYR A;  1ZKG A;  2R5Y B;  1XS9 A;  1MNM C;  3LSG A;  2M0C A;  2EBI A;  2LR8 A;  2N8G A;  4S0H B;  2R0Q C;  1AHD P;  5EG0 A;  3HBL A;  3JRI A;  3D1N I;  1T33 A;  4W1U A;  2X48 A;  3GTO J;  1XC5 A;  1UHS A;  3HOU J;  1ETK A;  2CQX A;  2Y31 A;  3TED A;  3QQA A;  3FKI J;  1FJL A;  3WHB A;  2HQ5 A;  3BR2 A;  4A3G J;  4JP0 A;  2LK2 A;  4W97 A;  2QF7 A;  2ECB A;  1A5J A;  2JMW A;  4AC0 A;  3ZQC A;  1ZQ3 P;  5GPC A;  3A02 A;  2EQR A;  1ETX A;  1TWG J;  1H8A C;  1GV2 A;  2VUM J;  3OOU A;  1TWA J;  2WV1 A;  4Y7N J;  1JUS A;  2DJN A;  4B4C A;  2DA1 A;  2LP0 A;  3PO2 J;  1I3Q J;  1DU6 A;  1IGN A;  5IP9 J;  1YRN B;  1ZR2 A;  2O7O A;  3O8H A;  5M5X J;  3IH2 A;  5J1Y A;  5F04 A;  2LLK A;  2NS7 A;  2YS9 A;  2QCO A;  3RQI A;  3ZQF A;  2PMZ N;  5F08 A;  3S17 J;  5GPA A;  3B6A A;  1HF0 A;  1GVD A;  1IJW C;  1PUF B;  2G0E A;  3HGG A;  1OFC X;  4L5E A;  4LOC A;  1ENH A;  2DN0 A;  2R92 J;  3JRF A;  3JRA A;  3BR6 A;  2D5V A;  4A3L J;  1X2N A;  5FJ8 J;  1E3O C;  2MG4 A;  2OPT A;  1B8I B;  3E7L A;  1P7I A;  2JN6 A;  2XPV A;  1MH4 A;  2DMU A;  3HEF A;  3HOY J;  2XRL A;  4DYC A;  1MSF C;  4CYC A;  4D7N A;  2Y9Z A;  3Q0V A;  4FE7 A;  3BT9 A;  3MVP A;  4G12 A;  4IHY A;  2ME6 A;  4MLO A;  9ANT A;  1IDY A;  2DMT A;  3DCF A;  5IP7 J;  2EH3 A;  3W6V A;  2E2I J;  3RZO J;  1SFO J;  1XG1 A;  4JX5 A;  1RET A;  2ECC A;  1JKR C;  2Y9Y A;  2DA3 A;  1ZK8 A;  2HI3 A;  3BR0 A;  1TC3 C;  2H1K A;  1VFC A; 
#chains in the Genus database with same CATH topology
 3BR1 A;  5EEG A;  1QHH D;  3OS2 A;  3FMR A;  2IRF G;  1POG A;  1T98 A;  4A3C J;  4M3E A;  2QKM B;  4YFN F;  4A3J J;  3VYT B;  3R0A A;  3KLO A;  2V26 A;  3GBG A;  3V7C A;  1VQO I;  5BS6 A;  2LKS A;  1FY7 A;  2KP6 A;  3H5N A;  3T8R A;  2AHQ A;  2P5K A;  3K6G A;  3KET A;  2LD5 A;  1NK2 P;  3RCO A;  3O6B B;  1FP1 D;  4OIR F;  4EJT A;  3W2A A;  1GUU A;  1DDN A;  5DEQ A;  4GYG A;  4CZC A;  2HNH A;  3SXY A;  4D5C A;  4BXX J;  2HDC A;  3ZMD A;  4HSR A;  4BQO A;  2KIQ A;  1IC8 A;  2LRE A;  2E1M B;  1U5T C;  4LIT A;  5KAI C;  2HR3 A;  4A0X A;  3M8E A;  4XSZ F;  1Y6I A;  2A3S A;  4KUM A;  4S05 A;  1WI3 A;  3C2G A;  2LYC A;  5FKK A;  1ZGW A;  1R4N B;  4U7B A;  2E2J J;  2K27 A;  1JUP A;  1YX5 A;  3EUH A;  1H0M A;  2AS5 F;  3E6D A;  1Z7L A;  1P9Q C;  3SDG A;  3T0Y A;  1XSX A;  2YUS A;  5J1R A;  3PNT A;  2XPW A;  2DT6 A;  4XOP A;  2ELH A;  2O6G E;  2DU9 A;  2R7O A;  1O57 A;  5E8G A;  3KP2 A;  5DCM A;  3T8T A;  1YYV A;  2MH9 A;  5D5X B;  4U0Y A;  3IAS 2;  1LB2 A;  2KZV A;  2GZW A;  3SZT A;  2Y48 A;  2M87 A;  2PX9 A;  1SMT A;  2DLL A;  2NS0 A;  4A69 C;  2EIL H;  3KEO A;  3CC7 I;  3KZZ A;  4NDL A;  5DM7 F;  3GX4 X;  3CD6 I;  3Q0U A;  5DYM A;  3ZN0 A;  1OIS A;  1VQ8 I;  4HG2 A;  1FTZ A;  3GME A;  2Y0S A;  2M30 A;  1G2H A;  1KZH A;  4XID A;  2ZO4 A;  4JYK A;  5LFA A;  3D5L A;  2DA6 A;  3TW6 A;  2ZJP F;  2W24 A;  5K5O A;  4ZC3 A;  4MFE A;  2ISZ A;  5E1W A;  3S2W A;  3T5X A;  3WG9 A;  3CZ6 A;  4BXF A;  5E1Z B;  3WTY C;  3ABU A;  1A6I A;  1R7J A;  1YTY A;  1UMQ A;  3HOZ J;  5HS8 A;  1XMA A;  4BYY A;  4WWC A;  4BQA A;  3FBI B;  2CJJ A;  4XK4 A;  2KZG A;  1MMN A;  4AID A;  4B8X A;  3CO7 C;  2GM4 A;  1X58 A;  4CCO A;  4E7K A;  1FYL A;  1HQC A;  3DEW A;  1ETO A;  1AKH B;  1RRJ A;  3RDI A;  4DNC A;  4ZH4 F;  4GYI A;  3A4C A;  3VYU B;  3J7Z I;  1BIA A;  2M4K A;  2CQN A;  1KGS A;  3SZP A;  3F23 A;  4C30 A;  5CVV A;  3LQQ A;  5LRR A;  3DFG A;  1HKS A;  4A6D A;  3TP0 A;  1R23 A;  3PUF A;  3GFL A;  1P4W A;  2XAS A;  4GFB A;  1V55 H;  5B1A H;  4D7M A;  3PL8 A;  2JQ7 A;  1U8B A;  4CXF A;  4CA0 A;  3M1E A;  3K7A J;  5CYV A;  1FBU A;  2O0Y A;  5BQT A;  3AG2 H;  1W36 C;  1HDP A;  1MMD A;  1OYY A;  2JRM A;  4EAT A;  3IKV A;  4UHT A;  2EFO A;  4GRI A;  3OYB A;  4XL9 A;  2FJ1 A;  3PUB A;  4DIQ A;  3BRO A;  5M3F J;  3HJE A;  4PGH A;  4A6E A;  3ZGK A;  2BBY A;  2FOK A;  2BY2 A;  2CUE A;  2CV1 A;  3LAJ A;  3M7G A;  1RKT A;  1G6N A;  3PFY A;  1GVJ A;  3FXM A;  3CMY A;  2COB A;  4KYW A;  3HM5 A;  1RES A;  3BTC A;  3RJP A;  3CJR B;  4Y4R A;  2FX0 A;  3QP5 A;  3BG7 A;  5FGM A;  3WTV C;  2CUF A;  4X6A J;  3QP6 A;  2M3A A;  5F27 A;  5F64 A;  1Z77 A;  1ZLK A;  1L3L A;  3K2Z A;  2M8E A;  2L9N A;  4BBR J;  3U9G A;  5B5E C;  3V4G A;  3I64 A;  1SMY F;  2BXY A;  2QQA A;  2GA2 A;  5GP9 A;  3CQZ J;  2X1E A;  5K5R A;  4G9Y A;  1R5H A;  1JI8 A;  2GLO A;  2TDX A;  1FBS A;  2V9V A;  1IG7 A;  3I56 I;  3JRE A;  4HZF A;  5JI6 A;  2V4J C;  3L00 A;  5BPD A;  4E7H A;  3BTI A;  4I2O A;  3AG4 H;  3GZN B;  4I01 A;  4HX8 A;  4EJO A;  1WJC A;  3VPR A;  1X3U A;  1KU2 A;  4CCN A;  3BLY A;  3Q3S A;  3BCB A;  2E34 A;  2R93 J;  3EUA A;  3QYB A;  2XKO A;  2BEO A;  2HOT A;  3E5U A;  2Y2Z A;  2R5Z B;  2M7B A;  2XHK A;  1HA8 A;  2WAQ A;  3DV8 A;  5TGT A;  1R6R A;  2BYV E;  4OIN F;  1PP7 U;  2I10 A;  3VFZ A;  1N77 A;  4HRI A;  4EV0 A;  2XAG A;  2KFD A;  2K9S A;  4LD5 A;  3QOP A;  1SVO A;  3F22 A;  3PIP F;  1U9N A;  1UEL B;  4UUT A;  4BJT A;  2P6S A;  1NHA A;  5ICG A;  5KNL A;  2OA4 A;  5FB2 A;  2JVH A;  3JSO A;  2P5L C;  2VJJ A;  3HKZ N;  1MBG A;  1ORK A;  2RGV A;  2Y30 A;  1OYW A;  1UG0 A;  2STT A;  4ON0 A;  3K4B A;  3H3V K;  3ZRG A;  2LBF A;  4UUS A;  2EV6 A;  3H36 A;  5TIS C;  4RGR A;  2HYG D;  2VC1 A;  3H5A A;  5LGN A;  2KQR A;  1TW3 A;  4V19 K;  2A6H F;  4RB3 C;  3J80 K;  4BQQ A;  4F52 A;  2RC4 A;  1BN5 A;  1BI0 A;  3J7A Y;  3DF8 A;  3RZD J;  1KON A;  1S3J A;  1U9O A;  5J40 A;  5C44 J;  4I98 B;  1J59 A;  1LJ9 A;  1SC7 A;  1K61 A;  2DA4 A;  2CV2 A;  4HNT A;  4V2F A;  1TLH B;  2ZXJ A;  4YFX F;  4IHV A;  2EA2 A;  3H9G A;  3ZQQ A;  1G3T A;  4J01 A;  2DT7 B;  1W7P A;  3CCR I;  1QA6 A;  4M3F A;  1P7J A;  1VQM I;  2Y0S N;  3H9Q A;  5E3O A;  1MBJ A;  2PJR B;  3CJQ B;  3WE2 A;  3QPS A;  1A31 A;  1Q1V A;  2V1D A;  3F8M A;  3HTU A;  4C3H J;  2AXT C;  4H4K C;  3EDP A;  5L3C A;  1T08 B;  4MEY F;  2CUZ A;  2F2E A;  5KK1 A;  5E1X A;  4IX7 A;  2XIG A;  1Z9C A;  4XN3 A;  3DKX A;  1YG2 A;  1S7E A;  5CPR B;  5E3M A;  2JA5 J;  4WK8 F;  1WCM J;  2FD5 A;  3OYD A;  2IPQ X;  1HBX G;  2QEX I;  3LA3 A;  3HDD A;  2ZME C;  2DFF A;  3M4O J;  1LPQ A;  1ODD A;  3I4M J;  4RMN A;  3A01 A;  3KE2 A;  3U21 A;  5EG0 B;  4XLA A;  3AL0 C;  2OJE D;  3I0T A;  2GAU A;  3GTK J;  4XOT A;  4Q47 A;  3GTL J;  4XLP F;  2VOD A;  3LA2 A;  1FOW A;  4G7Z F;  2XF5 A;  1DQU A;  2E2H J;  1KU3 A;  1USS A;  4FHT A;  3J81 K;  3WTS C;  3JRC A;  2CW0 F;  3I53 A;  1QNT A;  2MA3 A;  3BWG A;  3TW7 A;  2A61 A;  4Y3O A;  2KKO A;  3RPU D;  3X2Q H;  1WH7 A;  2LFB A;  2ZKZ A;  1Y0U A;  1C0W A;  1BR1 A;  4BBS J;  4AM3 A;  3FIS A;  2R7X A;  4ABZ A;  2RQP A;  3LSK A;  1DUX C;  1RPW A;  2EZK A;  5ILV A;  3BG6 A;  2HQR A;  3LSI A;  3WHC A;  2R5Z A;  4OIO F;  1IXS B;  1UAA A;  4MFD A;  4IRH A;  4PGG A;  3I59 A;  2I8D A;  5EYR A;  3D5R C;  3P5J A;  3M9A A;  1V3F A;  3GYH X;  1FOY A;  1LKX A;  3K0L A;  4P96 A;  4RM3 A;  5EEH A;  5J8F A;  3J80 Z;  1XGO A;  2IS2 A;  3GF2 A;  2R0Q C;  5EG0 A;  3JRI A;  3D1N I;  2R7S A;  3M1C A;  3GTO J;  1UHW A;  2CH0 A;  2NNY A;  2JUG A;  3HOU J;  2L4M A;  2CQX A;  2Y31 A;  3TED A;  5FFZ A;  1B6A A;  4F92 B;  1FZP B;  4EQQ A;  3OS1 A;  2A5W A;  1SEU A;  3BR2 A;  1VTN C;  4FX4 A;  3RSN A;  1DPR A;  2DW4 A;  3OL3 A;  2FQ3 A;  2QF7 A;  3AAF A;  2XF7 A;  4BE2 A;  3ZQC A;  4XLN F;  2GIV A;  2VB6 A;  2LSO A;  5GPC A;  2MLG A;  3AKZ A;  1UFM A;  2EQR A;  1TWG J;  3HOS A;  5K5Q A;  3HSR A;  1S6L A;  2JUC A;  4XON A;  2OZ6 A;  2EIN H;  2P7V B;  1JUS A;  3ISP A;  2DJN A;  1R1T A;  1QZY A;  4YEJ A;  5HLG A;  1TL8 A;  1D5V A;  2RNJ A;  4FET A;  1HSJ A;  2LP0 A;  3PO2 J;  3CC2 I;  4HPQ A;  2F5F A;  4G7O F;  4EJW A;  2HGC A;  3A0H C;  3C7J A;  3KIO A;  4ASN A;  2O7O A;  2V1N A;  3KYD B;  4E7S A;  3OS0 A;  2E7X A;  5J1Y A;  2YS9 A;  3RQI A;  1JHF A;  2IVM A;  4O3M A;  1V5F A;  3BY6 A;  1IJW C;  3WE3 A;  1PUF B;  1QZE A;  2G0E A;  1OFC X;  4L5E A;  3VYS B;  5ICC A;  3UR3 C;  1MW7 A;  2ZNY A;  3I58 A;  2OCC H;  1OQY A;  1X2N A;  4LB6 B;  1B8I B;  5DD4 A;  5A2Q Z;  4IZZ A;  5HNF A;  1IV8 A;  3FMQ A;  2L54 A;  4B09 A;  3R4K A;  3PSI A;  3LSM A;  1UST A;  4BH9 A;  4A5M A;  3KPH A;  3E5Q A;  3RYP A;  2GOM A;  4NQW A;  4G12 A;  3MVP A;  1I1S A;  2F4O B;  1O3Q A;  2JT1 A;  3U2R A;  4BNC A;  1EKE A;  2VQG A;  3FMS A;  3W6V A;  2UUZ A;  1SFE A;  3TMO A;  4Q5S F;  1RET A;  3RI4 A;  1JKR C;  2AQE A;  1X1C A;  1H9T A;  3BR0 A;  4NC8 A;  3PIO F;  3OWT A;  3HRT A;  1HST A;  2DO7 A;  3TO7 A;  3HG9 A;  2XAH A;  1FMV A;  1WGX A;  1WKM A;  2XGC A;  3BP8 A;  4Z2Y A;  3K10 A;  3ELK A;  1KQ8 A;  2KT0 A;  4IO9 F;  4ZTJ A;  5ILS A;  4JX4 A;  1QU3 A;  4B48 A;  3HUG B;  3L2W A;  4BEH A;  4BJ5 C;  2ZJR F;  3SHF A;  2DI3 A;  3O8G A;  1LUJ B;  2R7D A;  2BV6 A;  3SZG A;  4KIG A;  3HRM A;  1GT0 C;  4PJJ A;  2QSH X;  1VQ5 I;  2UXN A;  4IVN A;  2KPM A;  2K86 A;  2P81 A;  2NAZ A;  3G6E I;  2QQ9 A;  3GEZ A;  4CCK A;  1TWH J;  3P9K A;  4HNV A;  4A5N A;  2E5N A;  2ZC2 A;  4Q4Z F;  3CTA A;  1XD7 A;  1RNL A;  4C2U A;  4D1Q A;  1H89 C;  1NH3 A;  3JW4 A;  5CVI A;  4ESB A;  4KDP A;  4DGW B;  1D3Y A;  4U88 A;  4EJV A;  4IOA F;  2XGD A;  3KP4 A;  1IN4 A;  2J5O A;  3FXK A;  5B1B H;  4BAY A;  2DOF A;  5LEK A;  3OYG A;  4WCG A;  4IRG A;  4HDV A;  2OQR A;  4V2G A;  2JPC A;  3WGI A;  3IWF A;  3F8F A;  1O7L A;  2DTZ A;  3BTJ A;  4F7Z A;  4LFU A;  4HEA 2;  2PN6 A;  4BU2 A;  2LY1 A;  1WJF A;  2P6T A;  2EIK H;  3DTK A;  5B3S H;  5JVT A;  4H0E A;  4A3E J;  2ZNZ A;  3CLQ A;  2IBD A;  5D8K B;  1K4S A;  1XMK A;  1MD0 A;  2X9D A;  4PSX A;  1LFU P;  2QM3 A;  2XAJ A;  1MMG A;  3DBL B;  2WY8 Q;  2KJC A;  4G6T B;  1LDJ A;  4M3G A;  2FUG 2;  2JZY A;  1Z6R A;  4ENN A;  2JA8 J;  2GIZ A;  2OTL I;  2VXD A;  2HTJ A;  3NAU A;  3TKY A;  4C3J J;  1OR7 C;  5JHU A;  5EJC A;  4QIW N;  1BL0 A;  4E4H A;  1PVE A;  2CFX A;  4M9X A;  5IT9 Z;  2RVC A;  1WFX A;  3FDY A;  4HBL A;  2HZD A;  1BR4 A;  1TWC J;  3MAJ A;  2F4I A;  2EA4 A;  1HCR A;  4KJZ A;  2R7R A;  5C4J J;  2DTR A;  4S04 A;  2CFO A;  4A3I J;  1ITY A;  3V8J A;  4L18 B;  3IH4 A;  4XQF A;  1K78 B;  4KMU X;  1IDZ A;  2M0M A;  3IL2 A;  2L9R A;  3L2R A;  4OU0 A;  3KP3 A;  4BKX A;  2VOO A;  1YX3 A;  2DMQ A;  2W1O A;  4U0V A;  2VBX A;  1KQ0 A;  1Y1V J;  3H5R A;  4RGX A;  3CCV I;  3BJA A;  2MGQ A;  1G3S A;  1ZRC A;  3HOX J;  3MEX A;  1U5T A;  2FNP A;  1L0O C;  2QSF X;  1F36 A;  2HQA A;  2WAD A;  2L0K A;  2R7Z J;  2W4S A;  4EJU A;  4G94 A;  1IN5 A;  5HLH A;  2UWM A;  2HFH A;  2YSR A;  4RAZ A;  4UV9 A;  3GTQ J;  4X1E A;  3S1N J;  1J75 A;  1OCT C;  4BHC A;  2WAE A;  4BEH B;  2OAZ A;  3F0C A;  1AKH A;  2EK5 A;  4YFK F;  2HU9 A;  4NQW B;  1IUF A;  4EEF G;  1CGP A;  2IGO A;  3GZ5 A;  1JHH A;  1YE9 A;  1Y56 A;  4UVA A;  5LHH A;  3FM3 A;  4ZDP A;  2LDU A;  4BAC A;  3S14 J;  4I02 A;  3EYI A;  3HC7 A;  1HOM A;  4GGG A;  1YHQ I;  1B9N A;  1MSE C;  2C6Y A;  2PJR A;  2IA0 A;  4L0Z B;  2KRH A;  2NS8 A;  3BQY A;  1SAU A;  3M8F A;  3PNY A;  1A36 A;  2M7A A;  3FXQ A;  4WXC A;  3R61 A;  3BC8 A;  4RA2 A;  2WB1 A;  1O3T A;  2HXI A;  3DXJ F;  1BJZ A;  4XMY A;  4PJ0 C;  5H2F C;  1E3H A;  4B1R A;  4DYQ A;  1ZTR A;  2XRO A;  1H88 C;  3DPT A;  3HL2 A;  4HYE A;  1K7A A;  4GO1 A;  2BZT A;  1IN7 A;  4ZDO A;  1MBK A;  2W48 A;  1M1E B;  1EA3 A;  4A0Z A;  4IJA A;  4FTH A;  2LRD A;  2XGX A;  3OYL A;  2QSG X;  2VN2 A;  3JRD A;  4HLY A;  1F1Z A;  4DZJ A;  2QQB A;  3WTX C;  3OSF A;  1ACI A;  2EFW A;  2QZ8 A;  1ZHF A;  1EH7 A;  3JSP A;  2DAO A;  5IT3 A;  2BY3 A;  4A3F J;  2BHY A;  3W6K B;  3GLX A;  5GAE J;  3K4N A;  2ZCW A;  3FZV A;  2QGU A;  3OOP A;  3W6J B;  4LLN A;  4DQ2 A;  1X1A A;  1KYZ A;  4AYB N;  3LAP A;  4BS9 A;  1TT0 A;  1GDT A;  2P5V A;  1FWZ A;  3GFI A;  5DS9 A;  3E3V A;  5IOZ A;  1CF7 B;  1R4M B;  2FEZ A;  1PYV A;  2HYF A;  2GOX B;  4A3D J;  2R4G A;  3E0J B;  2E1O A;  5FRO A;  1P2F A;  2M5W A;  4LB5 A;  2VJ4 A;  4F3Q A;  3OYE A;  2VQC A;  2HZT A;  5FKM A;  1WPK A;  3JAM Z;  1YI2 I;  2R7T A;  1MBH A;  1ON1 A;  1VZ0 A;  4ANJ A;  2BVL A;  5H20 A;  1Y1W J;  2IS1 A;  3LST A;  5C3E J;  2VL8 A;  3RKW A;  2EZI A;  1D8K A;  2FBK A;  2K9N A;  1ETY A;  4A0Y A;  3LSR A;  3HGY A;  3GLL A;  2ZB9 A;  1Z6T A;  2OUM A;  3DTI A;  2XV4 S;  4RS8 A;  3WOD F;  3ZN1 A;  2JK3 A;  1XDS A;  2L01 A;  3B02 A;  2HVQ A;  2WY7 Q;  2M9H A;  4RAG A;  5D6F A;  4HLX A;  2R3S A;  3SDB A;  3VOE A;  4EVI A;  5M5W J;  3SFZ A;  3J7Y J;  3H92 A;  5LHG A;  4CO8 A;  3T1B A;  5FKO A;  3L09 A;  1ULY A;  1ZGJ A;  3RKY A;  1VQ6 I;  2V6E A;  2LMD A;  2VE9 A;  3I59 B;  3WU2 C;  3KYC B;  1MJB A;  2MLK A;  3PNV A;  3WTZ A;  1EF4 A;  3QOD A;  3EYY A;  4F93 B;  5BOX A;  1BW5 A;  5FLX Z;  1N75 A;  2A5Y B;  3QPH A;  2XC7 A;  2KHM A;  4IQ4 A;  2VBY A;  2LNB A;  1B59 A;  1FSH A;  1FTT A;  4F91 B;  3KX2 A;  4M71 A;  1UG2 A;  2Y69 H;  1WHU A;  3F21 A;  4E7J A;  5FLM J;  2LH9 A;  1I50 J;  2W84 A;  4FE4 A;  3I55 I;  4UNO A;  1VF9 A;  2EPF A;  2NVU B;  2XPU A;  3KLN A;  5K1Y A;  2TRT A;  5EF6 A;  3D5S C;  1MBE A;  2H1L A;  1B72 A;  2RRE A;  2Q1Z B;  4PFP A;  2JTV A;  2W00 A;  5HDG A;  3VYR B;  1IN8 A;  3ZQL A;  3G1M A;  4LLL A;  4RM2 A;  1Z67 A;  3BZK A;  1NG6 A;  2CQK A;  1ZN2 A;  2L9V A;  2M45 A;  5FKL A;  3JRB A;  1Q1H A;  4FX0 A;  2LY2 A;  4RAF A;  5GAH J;  3K4J A;  1YIJ I;  2FA5 A;  2WV0 A;  5K7H A;  2BW3 A;  4B3X A;  4PK4 A;  1QVT A;  2XGE A;  5HDK A;  5HOO A;  3K4M A;  3NWT A;  4Y15 A;  4GDF A;  5GTI C;  1I6H J;  4ETS A;  5KHD A;  2F4M B;  1PJR A;  1JT0 A;  1N78 A;  1RIO H;  2UZK A;  1YW9 A;  2HEO A;  3S8P A;  3V42 A;  4I0A A;  5F1J A;  4CH7 A;  2A69 F;  1BI3 A;  4XN0 A;  1T56 A;  3DP7 A;  3E1S A;  4XKC A;  2EWN A;  1KYW A;  4UB8 C;  5CVR A;  1W5S A;  2KIF A;  4A2U A;  5D4S A;  1BR2 A;  1LDK B;  5EGO A;  1BI2 A;  2DYR H;  2K40 A;  2V9K A;  3KP7 A;  4G7H F;  3ESW B;  1K6O A;  3S1Q J;  4NBQ A;  3LA7 A;  2NVY J;  2QLZ A;  1FIA A;  3QU6 A;  2ID3 A;  1NTC A;  3FXL A;  3HRU A;  3CUQ B;  4CSW A;  4IKF A;  1W0T A;  1Z7U A;  1T38 A;  3HYI A;  2WAQ N;  3UNG C;  2CRG A;  3ASO H;  1XS9 A;  1RR8 C;  4LJZ F;  2K4J A;  5E17 F;  1I1G A;  2XRN A;  4FAS D;  3ZMV A;  2GXB A;  2E60 A;  3A0B C;  2N8G A;  4KIF A;  2H09 A;  4KFC A;  3VSL A;  3H3Z A;  4EGY A;  2OZU A;  5HS9 A;  5LHI A;  2EFN A;  3HBL A;  2Z33 A;  1AHD P;  3HIF A;  4W1U A;  2IW5 A;  4KNY A;  1XC5 A;  3L2V A;  2DOD A;  2Y0M A;  3WHB A;  6PAX A;  2OCE A;  4AIK A;  4CGZ A;  2H27 A;  2EFQ A;  5ERI A;  3FF5 A;  5AON A;  4W97 A;  1BC8 C;  3DU6 A;  2ECB A;  1WI9 A;  4KA4 A;  1A5J A;  2P0W A;  1JE8 A;  3FHZ A;  1ZQ3 P;  1D8J A;  5L3F A;  4K2E A;  1ETX A;  1BM9 A;  2Q2E A;  3ZP5 A;  3OOU A;  3G2B A;  4Y7N J;  2RDP A;  2ESH A;  4B4C A;  2Z9O A;  1GLN A;  3FXU A;  2Z16 A;  1P92 A;  1OCR H;  3U1D A;  1IGN A;  5IP9 J;  3O2P E;  2BY0 A;  4NC7 A;  5DUK A;  2X6W A;  2FNA A;  3O8H A;  4CCM A;  5M5X J;  3S93 A;  5IT9 K;  5F04 A;  3ZQF A;  3Q9S A;  3RQ4 A;  1R22 A;  3S17 J;  5GPA A;  1TNT A;  4DJA A;  1I3A A;  4O5V A;  4E7I A;  3COA C;  3OY9 A;  3JTG A;  1ENH A;  1RI7 A;  4OIP F;  1WVR A;  2YX4 A;  3VDX A;  2D5V A;  4A3L J;  3RIR A;  3B73 A;  1H9G A;  2DXI A;  3HEF A;  2XPV A;  2W82 A;  1FNN A;  1SFX A;  5HNH A;  1G8X A;  1D1B A;  2PMH A;  4CYC A;  1WJE A;  4D7N A;  1IO2 A;  2FU4 A;  1T8I A;  2Y9Z A;  4BHP A;  4FE7 A;  2MD0 A;  2ZXI A;  3KEY A;  2Q2E B;  4E7L A;  1WJB A;  3IUO A;  3OYN A;  9ANT A;  3R0J A;  5IP7 J;  2EH3 A;  3E5X A;  2H6B A;  1LFP A;  2VKD A;  1OMI A;  2OV7 A;  3HZJ A;  1XTA A;  3IAM 2;  2E2I J;  3RZO J;  3CES A;  2DA3 A;  1ZK8 A;  2DYS H;  2HI3 A;  1TC3 C;  4LLG F;  1Y39 A;  2H1K A;  2ETH A;  2BXZ A;  1VFC A;  2O8K A;  1QBJ A;  3FXR A;  4OAY A;  5D8L B;  2JA6 J;  1I6X A;  1OYI A;  3ROU A;  3I4N J;  3EUK L;  1IN6 A;  5JLX A;  1IAW A;  2KL4 A;  3OYF A;  3GZ6 A;  3VWB A;  1IXC A;  3S1R J;  3BG5 A;  1ZAO A;  2LY9 A;  5J3L A;  4ZTF A;  1ZR4 A;  2KIS A;  1HDD C;  1E2X A;  4RB2 C;  2X6Y A;  2QKL B;  4IHW A;  2WB1 N;  2CW8 A;  3F8B A;  5DCF A;  3MKZ A;  1JTX A;  2BHZ A;  3G71 I;  2VIX A;  3CDH A;  5GAD J;  4KMF A;  4YII A;  4L5J A;  5BPI A;  2VE8 A;  1X4P A;  5TJJ A;  4B47 A;  1QO0 D;  1W0U A;  3ABT A;  4C2T A;  2EIJ H;  4OAZ A;  2NOJ B;  3HUG A;  3ZMT A;  4A93 J;  4AUX A;  1YW7 A;  2NRA C;  3TP3 A;  1NG7 A;  1VND A;  3JRG A;  1WWX A;  2XAU A;  3BQZ A;  3JCU C;  5IYD J;  4DW6 A;  1STZ A;  1B4A A;  2ZXW H;  1G59 A;  4P9U A;  1JKO C;  4IQJ A;  1LFB A;  3WTT C;  1YRN A;  1LNW A;  1FC3 A;  2PLY A;  3LL7 A;  3IV5 A;  3ONQ A;  4U7D A;  1PUE E;  5ILU A;  3A01 B;  2FBH A;  2JJ7 A;  3GCM A;  2MW8 A;  4I0B A;  4AD9 A;  2HVS A;  2NVQ J;  3S1M J;  4JOM A;  5EGO B;  1XX5 A;  2X1C A;  2MYS A;  3CDL A;  1U0J A;  4UVC A;  1FLI A;  4Y33 A;  3OR1 C;  2B63 J;  2F5C A;  2GXA A;  3SJM A;  5K7F A;  2D1H A;  2BE5 F;  2ACJ A;  5FD5 A;  2MAB A;  3IHU A;  2EFP A;  2KIU A;  4XLH A;  2NVT J;  1Z05 A;  2F48 A;  4AYB A;  3I4P A;  1PDN C;  4KN4 X;  1YO5 C;  1VQ9 I;  1XPX A;  3BZC A;  1ZRE A;  3FXO A;  1WJ5 A;  3N4M A;  3RTR A;  4R79 A;  4XLF A;  4L5I A;  2ELJ A;  3WGH A;  2RV8 A;  3FBN B;  4BUP A;  2VLA A;  1SD6 A;  1JGG A;  3FIW A;  3HHH A;  1IW7 F;  1G4D A;  4MEX F;  1V5E A;  1ZLJ A;  1R58 A;  4R8H A;  1CF7 A;  4XM3 A;  1XMX A;  3ZQ7 A;  1FOX A;  2IA2 A;  5L3B A;  1JJ8 C;  2KLO A;  4LGW A;  2DT5 A;  2PG4 A;  1E17 A;  1AU7 A;  3N97 A;  2K02 A;  5F0H A;  4LG0 A;  2K9M A;  3ASN H;  1J5Y A;  1D1C A;  3K9T A;  4NC6 A;  4EM1 A;  1BC7 C;  1R00 A;  1ZYR F;  2OU2 A;  4XKB A;  1AWC A;  1TZL A;  2DFE A;  1G3W A;  1W5C C;  1P6R A;  1RKW A;  4MQ9 F;  3VOD A;  4CCJ A;  3G73 A;  5HLT A;  4RGS A;  3BPX A;  3CCE I;  2IJL A;  3K69 A;  4YG2 F;  1OKR A;  1UZC A;  3ML6 A;  1LVA A;  1JTY A;  3ZQI A;  2JSC A;  4RB1 A;  2H8W A;  4J19 A;  4MHG A;  2EB7 A;  2K9Q A;  2A6E F;  4M6X A;  5LGU A;  3S2H J;  1S8N A;  1T0F C;  3FXJ A;  3M8J A;  2PMU A;  3W3C A;  3GVA A;  2CQ7 A;  2MD5 A;  1HXD A;  5J4Y A;  2K85 A;  4QWQ A;  2R5Y A;  3CP8 A;  2ISY A;  4XBF A;  3UKG A;  3GTG J;  5M5Y J;  3AFH A;  1YOV B;  3KFW X;  3H1C A;  2L2O A;  1S7A A;  1OCZ H;  5E79 C;  3DEE A;  1XSV A;  3E6B A;  1WRJ A;  2CQQ A;  4DZP A;  4ZJZ A;  2YU9 J;  2M1B A;  3NAR A;  1T6S A;  2R7U A;  4M3D A;  2ZFU A;  4U87 A;  3TBI A;  3VEP A;  1EH6 A;  1D0Y A;  5DTD A;  4DBR A;  1XN7 A;  3IH3 A;  4MNU A;  1IUY A;  1S7O A;  4WX9 A;  1O3S A;  1QHG A;  1WJA A;  3CCY A;  4TV7 A;  2Z1D A;  1AOY A;  4C3I J;  1A35 A;  1FOK A;  3MN2 A;  1YJ9 I;  5FKN A;  3BCA A;  2D1V A;  1Z0X A;  2CW7 A;  3WU0 A;  1IZ1 A;  2YPR A;  3RPQ A;  3IRQ A;  2M2E A;  4MTD A;  2DA7 A;  3I9V 2;  3F9K A;  2DOA A;  1J09 A;  2VKE A;  4JK1 X;  5E3L A;  3G1O A;  1TQP A;  3ZOB A;  2L5Q A;  1HW1 A;  5E3N A;  3OYK A;  5HLI A;  1TWF J;  4XRS G;  2G7U A;  3C3W A;  3OIQ A;  1W7P D;  4UUV A;  3K4C A;  3H0G J;  3GTM J;  2QEN A;  2V79 A;  3RKX A;  4AVZ A;  2OBP A;  2W25 A;  2VC0 A;  3G3Z A;  2NNN A;  1REP C;  3HPG A;  2G9W A;  4WF2 A;  1E3P A;  3OYC A;  4WXH A;  5BNG A;  5HVQ C;  2IP2 A;  4UUS B;  3ULQ B;  2ID6 A;  2E35 A;  4IOC F;  3TO9 A;  3CUO A;  3CUQ A;  2DQR A;  1V54 H;  3V8K A;  1XGM A;  2WTE A;  3HOT A;  2PI0 A;  4M6V A;  5F1R A;  3TGN A;  1JJ6 C;  1SD4 A;  1FMW A;  3LSH A;  2MC4 A;  2L9S A;  1WZ2 A;  4BQN A;  1MBF A;  2A07 F;  1D5Y A;  1ERD A;  3P9C A;  2CU7 A;  2XKP A;  4NHJ A;  2NOG A;  2P7C B;  2HTS A;  1SD5 A;  4O6J A;  5IOY A;  1XCV A;  3ERE D;  3DBR B;  3DLL F;  2HXO A;  2KIM A;  2DA2 A;  2KMU A;  2TCT A;  2X51 A;  3KP5 A;  4QPO A;  2PFB A;  4HQE A;  1R36 A;  4X0G A;  1WJD A;  4CYD A;  4IPA A;  1W1W E;  3VB2 A;  1J9I A;  2XDV A;  3K70 D;  1ZG1 A;  3Q0W A;  5EZH A;  1R9T J;  1XDU A;  2VQH A;  4BL0 B;  3S2D J;  4UV8 A;  3KCC A;  2H6C A;  2MFZ A;  2EV0 A;  1SVM A;  2M34 A;  2UV1 A;  1DP3 A;  5FD6 A;  4XNF A;  4OMY A;  2LTP A;  1Y0N A;  3ERM A;  1A6Q A;  4HX7 A;  2KDO A;  3QRF F;  2GWR A;  1TP4 A;  1LEB A;  3ABK H;  1GV5 A;  4P55 A;  1T0F A;  5HOD A;  5D4R A;  2EZL A;  1PP8 F;  5CVU A;  3IP4 B;  2M4G A;  4C2M J;  1OCP A;  2O3F A;  4BGD A;  4OWR B;  1K79 A;  1K78 A;  1XCB A;  3OYI A;  2XB5 A;  3OYA A;  1B8I A;  1TT5 B;  3PJR A;  4D0P A;  1U3E M;  2XVC A;  3TO6 A;  3TL4 X;  1K83 J;  4NUB A;  1X2M A;  1DP7 P;  2IXS A;  2JWT A;  1OPC A;  1U2W A;  3E6M A;  1K4T A;  2ZSI B;  2OC6 A;  4M9S A;  3TOB A;  1BA5 A;  2V7F A;  4IEJ A;  4QSH A;  1VQK I;  5D6E A;  1BBY A;  4RBO A;  2HVR A;  3CF5 F;  1I39 A;  4UVB A;  4XRS A;  5C4X J;  4JX6 A;  1MH3 A;  2JRT A;  3L7W A;  2L02 A;  4ITV A;  5K7Z A;  2QQ8 A;  1JT6 A;  4DBQ A;  1B9M A;  2P8T A;  1MND A;  2DBB A;  3S3M A;  2FXA A;  3ZMZ A;  5A2Q K;  3QPL A;  1QGP A;  4BHB A;  2MC3 A;  3ABM H;  2CUJ A;  2OF7 A;  2HDW A;  4Z6Y A;  5LLQ A;  4ZYG A;  2IGM A;  4IHX A;  1YFH A;  5B66 C;  3L9F A;  4II3 A;  5FRM A;  2DDA A;  2FML A;  2X4H A;  3HOV J;  4LG3 A;  2QBY A;  2YX7 A;  1FPQ A;  4G8X A;  4D9J A;  5ED4 A;  2R7V A;  5FO5 A;  3LQR A;  4HF2 A;  1R1V A;  2IS4 A;  3QWL A;  4RLQ A;  2CG4 A;  3ZR8 X;  3KP6 A;  1ETW A;  3SQN A;  3K70 C;  1SD7 A;  3CP2 A;  2DK5 A;  4I7H A;  4KT6 A;  3JAM K;  3K1P A;  3IRR A;  1I27 A;  1ZKG A;  2VT2 A;  2R5Y B;  1MKM A;  5IY5 H;  4CCL A;  3SEZ A;  5BMZ A;  2I5U A;  2JPB A;  3LSG A;  1FBQ A;  2EBI A;  2M0C A;  1EV7 A;  3CCU I;  4ZYH A;  3O3K A;  4S0H B;  2LBF B;  3CDI A;  3ZMS A;  2IA1 A;  5J47 A;  2WWY A;  2QWW A;  3F8N A;  3V7R A;  1VQP I;  1QZZ A;  2FMY A;  3FKI J;  4HST A;  4J00 A;  1R49 A;  1Z3Y A;  2YU3 A;  4JP0 A;  1F5T A;  1FT9 A;  4CZZ A;  4AC0 A;  2BY1 A;  1X4O A;  1FYM A;  3A02 A;  2NYX A;  2DK8 A;  3Q9V A;  1H8A C;  1GV2 A;  3NEU A;  1ZRD A;  2VUM J;  5HS7 A;  1TWA J;  4N0B A;  1A04 A;  3F6V A;  3GFM A;  4PUS A;  4ESF A;  1ZRF A;  4KIS A;  2ZXH A;  1IRX A;  1MZB A;  2VAS A;  2DA1 A;  1LQ1 A;  2KJB A;  1D1A A;  1TQM A;  3BJO A;  4Y13 A;  2PBI A;  3I54 A;  4ESJ A;  1GHC A;  3ABL H;  3U1K A;  3C2H A;  2NS7 A;  2QCO A;  2PMZ N;  4BE1 A;  5F08 A;  3B6A A;  1GVD A;  3MQ0 A;  3HRS A;  3ZPL A;  3MKW B;  3I5U A;  1OR7 A;  3HSF A;  3S3O A;  3D0S A;  3F8C A;  2BVM A;  2DN0 A;  3WG7 H;  2COM A;  2X1D A;  4Q48 A;  4YRV A;  2CWE A;  3J81 Z;  4M74 A;  1BOB A;  2DDB A;  5FJ8 J;  2MG4 A;  1E3O C;  4IRI A;  2DMU A;  4HA8 A;  1TW2 A;  2XRL A;  4DYC A;  4DOZ A;  1MSF C;  1GXP A;  3IC7 A;  2EV5 A;  2FE3 A;  3QYF A;  2R7Q A;  5L3D A;  4IHY A;  1KA8 A;  4NB5 A;  4C9Y A;  1U5T B;  1Z91 A;  4MLO A;  2W7N A;  2DFH A;  1IDY A;  2QA4 I;  2P4W A;  4ENK A;  2DJI A;  4P5O A;  2Q8K A;  5DM6 F;  3BDD A;  5JR3 A;  5AIQ A;  4YIR X;  1KQ9 A;  1V4R A;  2EIM H;  3CCL I;  3OL4 A;  4JX5 A;  4L9J A;  1HKT A;  1Y8R B;  2ECC A;  1F9N A;  2B0L A;  1TNS A;  2L7K A;  3PQJ A;  3REO A;  3KYL A;  1RUN A;  1EH8 A;  2E7W A;  2VJI A;  4I6Z A;  2O9L A;  1EJ9 A;  2W85 A;  1R71 A;  3JRH A;  5JVG F;  1NK3 P;  3P9I A;  3ZQG A;  3BR3 A;  3BTL A;  2FBI A;  2RNG A;  5AIP A;  4AWX B;  2ME0 A;  3ZCO A;  2HPM A;  1IXR C;  4EM0 B;  2Z2S B;  1OCC H;  4HX4 A;  1UJ8 A;  3HOW J;  2LKX A;  1R1U A;  4LMY A;  2FOW A;  5L3E A;  5IYC J;  4M72 A;  1IV6 A;  2ICW G;  1YS6 A;  4G6Q A;  3OYM A;  3LFK A;  2PMZ A;  1YS7 A;  2HOA A;  2K9L A;  3S3N A;  2K3P A;  3B6C A;  3PFI A;  4QTR A;  4AIJ A;  2E1C A;  2XAQ A;  4PJM A;  4XOR A;  5JFR A;  1E0E A;  1O4X A;  3CCQ I;  2L4A A;  1SAN A;  4JQF A;  2IEK A;  5FLX K;  2LG4 A;  2CMP A;  4PFO A;  4WXD A;  2K3F A;  5IYB J;  2O8X A;  1YLF A;  5JLW A;  3EQL F;  4CYC B;  3BR5 A;  1R5G A;  2IT0 A;  5DCM B;  5D5U B;  1SAX A;  2J5P A;  2LOO A;  3SYT A;  3S16 J;  4ENJ A;  4Y52 J;  2HKX A;  5DUI A;  1QPM A;  1SFK A;  1BOA A;  1WSU A;  5E20 A;  1KU9 A;  2XSD C;  1BW6 A;  4CUG A;  3OYJ A;  2K4B A;  3R60 A;  2X6O A;  2Y75 A;  3RPU A;  3K2A A;  2V9P A;  2F5V A;  2HPI A;  4IL6 C;  3MZ8 A;  2OQG A;  1VI0 A;  3MKY B;  1ETQ A;  3OIP A;  4IXA A;  4OMZ A;  1N25 A;  1IF1 A;  1T39 A;  1BJA A;  1MGT A;  4Y17 A;  1VQL I;  2KDZ A;  2WC2 A;  3KZI C;  3EET A;  1SVL A;  3KEQ A;  1ZG3 A;  1YIO A;  2F5E A;  3TDZ C;  3PO3 J;  1TBX A;  2FF4 A;  3C18 A;  4MTE A;  1P4X A;  2K7L A;  1AA7 A;  2GBY A;  3FM5 A;  3DU5 A;  3PSF A;  4FIS A;  1W7P B;  1XGS A;  1T2K A;  2L7Z A;  2AO9 A;  3QPT A;  2HDD A;  3CMA I;  1F43 A;  3HXL A;  4KIT B;  2CS3 A;  2CSO A;  3H9J A;  1U78 A;  1MMS A;  1DU0 A;  3MD2 A;  4HDU A;  2CYY A;  3K1M A;  4RAY A;  1V5G A;  3DEU A;  5J4V A;  2HQN A;  2IGK A;  3CLO A;  1F4K A;  4OOI A;  5GTH C;  4LK0 F;  4BDZ A;  4M3B A;  3BG9 A;  1JGS A;  3EUH C;  2HYJ A;  3DBH B;  3W2V A;  4B3A A;  1VQ7 I;  1QVU A;  4ZYE A;  4P9F A;  4XIC A;  1ZG5 A;  3C1D A;  5D5V B;  3DKY A;  4AVP A;  3L2C A;  1W5T A;  2QYO A;  4RGU A;  2VKV A;  1WH5 A;  2V1U A;  4AIH A;  2DMP A;  4BY1 J;  1LE8 A;  2L3D A;  1T95 A;  2FRH A;  3DPU A;  1BIB A;  2CV0 A;  3BZ6 A;  3K4K A;  1DGW Y;  2HWV A;  4KIB A;  4YEL A;  1HW2 A;  2RN7 A;  4MIM A;  1Z1D A;  4FQG A;  2VON A;  5CKT A;  3RKQ A;  4XSX F;  3BG3 A;  3V8L A;  1YJN I;  3OIO A;  2L7M P;  3CC4 I;  5EEA A;  1S29 A;  2XUB A;  5LD2 C;  1X3Z B;  2WAF A;  5LGT A;  1WQ2 A;  3FK7 A;  4II2 A;  3IWZ A;  1G3Y A;  2XB0 X;  3DWL E;  2ZFW A;  5F0F A;  4N4N B;  3GW2 A;  4RDU A;  2NVX J;  3HB9 A;  5E8I A;  2PJP A;  2GQQ A;  4M6Y A;  5IPA A;  4I09 A;  4RB0 A;  1QRY A;  2QVO A;  2ZJ2 A;  2O5R A;  3C2B A;  2DPD A;  3QAH A;  1Z3X A;  3H35 A;  2ZME A;  5J8C A;  1ZAR A;  4KN7 X;  3SEQ A;  2W57 A;  1ETV A;  4QLC U;  5HDN A;  1JXS A;  4I76 A;  2BW3 B;  2VI6 A;  4HF0 A;  1FIP A;  1YW8 A;  1UB9 A;  3MCZ A;  3MKL A;  5FRN A;  3GTJ J;  3GO5 A;  2VKH A;  4PZJ A;  5ICF A;  4FCY A;  2NXN B;  3F3X A;  1RR7 A;  2A68 F;  5J6X A;  3K4L A;  3K1N A;  4ZZD A;  3QU3 A;  4PDK A;  3IKT A;  5FLV A;  3MWM A;  4N9I A;  2DA5 A;  3BOQ A;  3GXO A;  3PQK A;  3QYE A;  3GTP J;  4XLE A;  4LG0 B;  2LKP A;  3LMM A;  5LRS A;  4HF1 A;  1X1P A;  1S72 I;  3HKZ A;  1XGN A;  2A05 A;  2LC2 A;  3OR2 C;  3EPZ A;  3P7N A;  1W36 D;  4GXO A;  3GUD A;  4R1H A;  3H0D A;  2R7F A;  2H8R A;  3W2W A;  3LSP A;  4LK1 F;  2IAI A;  1GXQ A;  2VJ5 A;  4XRF A;  1OJL A;  1VQ4 I;  1TTY A;  4XLC A;  1KU7 A;  1HW5 A;  1IRZ A;  1QPI A;  4L0Y B;  1UHM A;  2RQQ A;  1U6G A;  4ZDL A;  3TDU C;  2VBW A;  2ZME B;  3LNQ A;  3TQN A;  2BGC A;  1LEA A;  2IS6 A;  2Z3Y A;  4E6K G;  1MIJ A;  2KRC A;  3FK6 A;  2Z99 A;  4HOB A;  3HHG A;  5CLS A;  3CUQ C;  2A6T A;  1K6Y A;  1YQA A;  3I3L A;  4I99 C;  4BXU A;  3CJN A;  2FQ4 A;  1OCO H;  1SFU A;  3KZY A;  4N9H A;  4DYR A;  2MH2 A;  3DKW A;  3LOC A;  3M07 A;  4XRM A;  5LBQ A;  2VXZ A;  3CJT B;  4L9V A;  2X85 A;  2WBM A;  5F0C A;  3E97 A;  3CMM A;  1MMA A;  3QOE A;  3G4S I;  2DCE A;  2B9S A;  5F6F A;  2HOS A;  3A2K A;  1YJW I;  2M8G X;  2XF6 A;  3G1L A;  3V7S A;  5JHF A;  1LE8 B;  4YIF A;  5ICE A;  4CIC A;  4KT5 C;  5KCM A;  4UB6 C;  1FEX A;  1FX7 A;  3DTE A;  4XKW A;  2VPR A;  2RKH A;  1JKQ C;  1D0Z A;  2MSY A;  3ZQH A;  3JTH A;  1U8R A;  3NRV A;  5CQE A;  4E70 A;  3VSK A;  4MO7 A;  5J1U A;  4BE0 A;  1JKP C;  5L3G A;  2PQ8 A;  2LVS A;  3I71 A;  1Z21 A;  4BY7 J;  4IHS A;  3L2U A;  2AXL A;  3AG1 H;  3WTW C;  4ZYD A;  1S9H A;  3DQV C;  3PM1 A;  1ZGA A;  3E6C C;  5CVJ A;  2L7F P;  3S32 A;  3JR9 A;  1FYK A;  2RAE A;  1QQI A;  2F6C A;  3MZY A;  5EZG A;  4D5F A;  4EM2 A;  5M3M J;  1FP2 A;  4GCV A;  1BI1 A;  5IP6 A;  5DV5 A;  2V6C A;  3ZXS A;  1ONV A;  5D5W B;  1MDM A;  2BOL A;  2H94 A;  4ENM A;  3BJ6 A;  2EJR A;  1FSE A;  4PSW A;  1O7F A;  4A3K J;  3A03 A;  1J0R A;  1TQI A;  3HPH A;  1X3W B;  4ZZL A;  5KVR A;  4HAM A;  4HW0 A;  1P4A A;  3M3Y J;  3CF2 A;  4B43 A;  4IHT A;  1CQT A;  2GA1 A;  2O03 A;  3MZH A;  3R6S A;  4NNJ A;  2JA7 J;  5DDG A;  1O3R A;  1J2X A;  3OSG A;  2WA0 A;  2HOE A;  3HSE A;  2FSW A;  1B1B A;  1B72 B;  5TRD A;  4A3B J;  1HC8 A;  2ELK A;  2E19 A;  4LIU A;  3S15 J;  1ZH5 A;  5CJ9 A;  1S5L C;  1JUM A;  1LDD A;  1RUO A;  2DMN A;  2E1N A;  3ECO A;  4XR6 A;  3LSJ A;  5EDN A;  3L1P A;  3GWZ A;  2VOP A;  3A1Y A;  4M9Z A;  2Z5U A;  2XAF A;  1APL C;  1HLV A;  4UXN A;  2ESN A;  1R5I D;  2B7E A;  2VPL A;  3SFI A;  4A3M J;  3HTS B;  2EZH A;  2JSP A;  2QUF A;  2JVG A;  3FHN A;  1D0X A;  1PUF A;  5H6R A;  2X6X A;  5E18 F;  3OV8 A;  4CDG A;  3F6O A;  1MNM C;  3J7A O;  2GXG A;  3N05 A;  1I5Z A;  2LR8 A;  2E1M C;  4E7Z A;  4HV5 A;  2VBZ A;  3MMY B;  2DPU A;  1T33 A;  3GFJ A;  2X48 A;  1DPU A;  1HKQ A;  4KIC A;  4RLF A;  1UHS A;  2OTJ I;  4HQM A;  3WGG A;  1ETK A;  2UXX A;  4L9N A;  4MGR A;  2DFI A;  3QQA A;  1FJL A;  2LF7 A;  2HQ5 A;  5LEJ A;  2QBY B;  4A3G J;  3AL0 B;  4MQV A;  1LVK A;  2VQL A;  4PCQ A;  4L9T A;  1X1D A;  4B44 A;  2LK2 A;  1J7K A;  4BDY A;  3ECH A;  2JMW A;  2XSJ C;  3LFU A;  1ZEL A;  3CO6 C;  2DOE A;  1YIT I;  3FX3 A;  2E71 A;  1OLT A;  1MJ9 A;  2OD5 A;  3WU1 B;  2WV1 A;  2KRF A;  5GAG J;  4XKV A;  3AG3 H;  2ADU A;  1RC9 A;  2X0L A;  1I3Q J;  1ON2 A;  5DD8 A;  5H6Q A;  4M73 A;  1DU6 A;  4IF4 A;  3Q5F A;  2AQF A;  2DQL A;  5CQG A;  4QPQ A;  3CCJ I;  1ZR2 A;  1YRN B;  2STW A;  4UY8 I;  2K5C A;  1MNE A;  3NQO A;  2F5D A;  3IH2 A;  5FFX A;  3H3U A;  2LLK A;  1IRF A;  4HNU A;  2HKO A;  4PJN A;  3MFK A;  1HF0 A;  1IRG A;  4P1W A;  3DLA A;  3HGG A;  1RZ4 A;  4LOC A;  1X19 A;  3WTU C;  3OMY A;  1X1B A;  2R92 J;  4PJL A;  3JRF A;  3JRA A;  3BR6 A;  4ZYA A;  2Q0O A;  3CCS I;  2HS5 A;  2OPT A;  2YR2 A;  4FT8 A;  3RYR A;  2CGP A;  3E7L A;  1UCR A;  2ZBK A;  2CO5 A;  1P7I A;  2JN6 A;  1MH4 A;  2PEX A;  3HOY J;  2E36 A;  4U0W A;  4A12 A;  2JA2 A;  4F55 A;  1Y8Q B;  2E5Z A;  3LWF A;  2LF8 A;  4G6D A;  2VT3 A;  4LIV A;  3Q0V A;  4CHU A;  4OIQ F;  3BT9 A;  1VQN I;  4EGZ A;  4HV6 A;  2R7W A;  2D45 A;  3FKJ A;  4AU7 A;  2ME6 A;  3NWS A;  3OYH A;  3L2Q A;  1XB4 A;  3TOA A;  2ZJQ F;  3F72 A;  2DMT A;  3CME I;  3DCF A;  2ZSH B;  3ZMU A;  2D2W A;  2V1X A;  2IGN A;  2MBF A;  3FWE A;  3BPV A;  4JBA A;  4EMS A;  1XG1 A;  3CCM I;  1SFO J;  2O61 A;  1MJA A;  3DPL C;  2Y9Y A;  1MDM B;  4N4O B;  1DGR M;  1XSD A;  1W4M A;  2G7H A;  5KAF C;  4BJ6 C; 
#chains in the Genus database with same CATH homology
 3BR1 A;  4I6Z A;  2O9L A;  3JRH A;  2JA6 J;  1NK3 P;  3ZQG A;  3BR3 A;  1POG A;  1WGX A;  3BTL A;  2XGC A;  3I4N J;  4A3C J;  2ME0 A;  2KT0 A;  4M3E A;  4A3J J;  5JLX A;  3GBG A;  4JX4 A;  3HOW J;  3S1R J;  3BG5 A;  2AHQ A;  2LY9 A;  5J3L A;  2LKX A;  1ZR4 A;  5IYC J;  1NK2 P;  2LD5 A;  1HDD C;  1IV6 A;  4IHW A;  2WB1 N;  3O8G A;  1JTX A;  2HOA A;  1GUU A;  3B6C A;  4QTR A;  1GT0 C;  4D5C A;  1W0U A;  1O4X A;  2P81 A;  4BXX J;  1IC8 A;  1SAN A;  1TWH J;  4HNV A;  2IEK A;  4A93 J;  4AUX A;  3TP3 A;  5IYB J;  1WI3 A;  1VND A;  1H89 C;  5JLW A;  5FKK A;  4CYC B;  3JRG A;  3BR5 A;  1ZGW A;  2E2J J;  3BQZ A;  1JUP A;  2XGD A;  5IYD J;  4DW6 A;  3S16 J;  4Y52 J;  1JKO C;  1LFB A;  3SDG A;  4V2G A;  2XSD C;  1YRN A;  2YUS A;  1BW6 A;  5J1R A;  2XPW A;  2DTZ A;  2X6O A;  3BTJ A;  3IV5 A;  3K2A A;  3A01 B;  1VI0 A;  2JJ7 A;  1ETQ A;  2MW8 A;  4A3E J;  2IBD A;  2NVQ J;  3S1M J;  2X9D A;  1LFU P;  5EGO B;  2KDZ A;  3CDL A;  4A69 C;  4M3G A;  4NDL A;  3PO3 J;  2JA8 J;  2B63 J;  3SJM A;  3Q0U A;  5K7F A;  2GBY A;  3NAU A;  4C3J J;  4FIS A;  1FTZ A;  2NVT J;  1G2H A;  4XID A;  2L7Z A;  4JYK A;  4QIW N;  1BL0 A;  2AO9 A;  2DA6 A;  2HDD A;  3TW6 A;  1F43 A;  4MFE A;  1U78 A;  1DU0 A;  1JGG A;  3FIW A;  1A6I A;  1TWC J;  1UMQ A;  3HOZ J;  1HCR A;  5C4J J;  4M3B A;  4A3I J;  3BG9 A;  1ITY A;  4B3A A;  2CJJ A;  2HYJ A;  3IH4 A;  4XK4 A;  1QVU A;  1IDZ A;  1JJ8 C;  2L9R A;  4XIC A;  2GM4 A;  4BKX A;  1X58 A;  1AU7 A;  2DMQ A;  5F0H A;  2VKV A;  1Y1V J;  1WH5 A;  3DEW A;  1ETO A;  2MGQ A;  1AKH B;  3HOX J;  2DMP A;  4BY1 J;  1LE8 A;  1F36 A;  1RKW A;  2L0K A;  2R7Z J;  3TP0 A;  3GTQ J;  4X1E A;  3S1N J;  4MIM A;  1OCT C;  3RKQ A;  3F0C A;  1JTY A;  3ZQI A;  1AKH A;  3BG3 A;  4GFB A;  3OIO A;  1IUF A;  2L7M P;  4D7M A;  4EEF G;  4J19 A;  5EEA A;  1U8B A;  2K9Q A;  3FK7 A;  2XB0 X;  3K7A J;  3S2H J;  5F0F A;  3S14 J;  4RDU A;  1HOM A;  1HDP A;  2NVX J;  3HB9 A;  1MSE C;  5IPA A;  1QRY A;  2R5Y A;  2NS8 A;  3C2B A;  3UKG A;  2FJ1 A;  3GTG J;  3BQY A;  5M5Y J;  5M3F J;  1ETV A;  2CUE A;  1RKT A;  4I76 A;  2VI6 A;  1FIP A;  2CQQ A;  2HXI A;  4DZP A;  1BJZ A;  3CMY A;  2COB A;  2YU9 J;  4B1R A;  3MKL A;  4DYQ A;  3HM5 A;  3NAR A;  1RES A;  3GTJ J;  3BTC A;  1ZTR A;  4M3D A;  4FCY A;  1H88 C;  1RR7 A;  2FX0 A;  5DTD A;  3IH3 A;  2CUF A;  5FLV A;  4X6A J;  1MBK A;  2W48 A;  3CCY A;  5F27 A;  2DA5 A;  4C3I J;  1Z77 A;  3MN2 A;  5FKN A;  4BBR J;  1Z0X A;  4FTH A;  3GTP J;  2M2E A;  2DA7 A;  3JRD A;  5GP9 A;  3OSF A;  4DZJ A;  3CQZ J;  2VKE A;  2H8R A;  5E3L A;  2GLO A;  3G1O A;  4A3F J;  3ZOB A;  3LSP A;  2IAI A;  5E3N A;  1IG7 A;  1OJL A;  1TWF J;  4XRS G;  3JRE A;  4AYB N;  1IRZ A;  1QPI A;  3BTI A;  3H0G J;  1GDT A;  3GTM J;  5DS9 A;  5IOZ A;  3VPR A;  3LNQ A;  4A3D J;  2E1O A;  3Q3S A;  3FK6 A;  2R93 J;  5BNG A;  4UUS B;  2ID6 A;  2HOT A;  5FKM A;  2Y2Z A;  1WPK A;  2R5Z B;  4M6V A;  1MBH A;  2FQ4 A;  2I10 A;  1Y1W J;  4DYR A;  3LOC A;  5C3E J;  4XRM A;  1JJ6 C;  2K9S A;  2EZI A;  2K9N A;  1ETY A;  3LSR A;  3HGY A;  2ZB9 A;  1U9N A;  4UUT A;  5F0C A;  1MBF A;  1D5Y A;  2JK3 A;  2CU7 A;  2HOS A;  2NOG A;  3HKZ N;  1MBG A;  1ORK A;  2M9H A;  2M8G X;  3G1L A;  1LE8 B;  5IOY A;  5M5W J;  2Y30 A;  2HXO A;  2DA2 A;  3H3V K;  2TCT A;  5FKO A;  4UUS A;  2O8K A;  1FEX A;  2VPR A;  1JKQ C;  3ZQH A;  2MSY A;  1EF4 A;  3Q0W A;  5EZH A;  1R9T J;  3RZD J;  1BW5 A;  1U9O A;  3S2D J;  4MO7 A;  5J1U A;  5C44 J;  1JKP C;  2LVS A;  2DA4 A;  1K61 A;  2M34 A;  4V2F A;  1FTT A;  4BY7 J;  4IHV A;  1UG2 A;  5FLM J;  1I50 J;  4FE4 A;  2LTP A;  4M3F A;  1P7J A;  2Y0S N;  3PM1 A;  5E3O A;  1MBJ A;  1VF9 A;  3QPS A;  2L7F P;  2XPU A;  1GV5 A;  5HOD A;  3JR9 A;  2EZL A;  2TRT A;  5EF6 A;  1Q1V A;  2RAE A;  1MBE A;  4C2M J;  1OCP A;  1B72 A;  4C3H J;  5EZG A;  4D5F A;  5M3M J;  2XB5 A;  1B8I A;  5IP6 A;  3ZQL A;  3G1M A;  1K83 J;  1X2M A;  2JWT A;  5FKL A;  3JRB A;  1S7E A;  4A3K J;  5E3M A;  2JA5 J;  3A03 A;  1WCM J;  2FD5 A;  1BA5 A;  5K7H A;  3HDD A;  4IEJ A;  3M4O J;  4QSH A;  3I4M J;  3M3Y J;  1QVT A;  2XGE A;  1CQT A;  4RBO A;  4XRS A;  5C4X J;  4JX6 A;  3A01 A;  1MH3 A;  5EG0 B;  1I6H J;  2JA7 J;  1JT0 A;  3GTK J;  3OSG A;  5K7Z A;  3GTL J;  1JT6 A;  1B72 B;  4A3B J;  2ELK A;  5F1J A;  2E19 A;  3QPL A;  2E2H J;  3S15 J;  1T56 A;  1JUM A;  2OF7 A;  2DMN A;  3JRC A;  4IHX A;  3TW7 A;  3LSJ A;  5EDN A;  3L1P A;  3HOV J;  1WH7 A;  2LFB A;  1APL C;  5EGO A;  1HLV A;  2K40 A;  4BBS J;  3FIS A;  3SFI A;  4A3M J;  3S1Q J;  4ABZ A;  2NVY J;  1RPW A;  1FIA A;  2EZH A;  2EZK A;  2ID3 A;  3WHC A;  2R5Z A;  1NTC A;  1ETW A;  4MFD A;  1PUF A;  1W0T A;  2WAQ N;  2CRG A;  5EYR A;  1ZKG A;  2R5Y B;  1XS9 A;  1MNM C;  3LSG A;  2M0C A;  2EBI A;  2LR8 A;  2N8G A;  4S0H B;  2R0Q C;  1AHD P;  5EG0 A;  3HBL A;  3JRI A;  3D1N I;  1T33 A;  4W1U A;  2X48 A;  3GTO J;  1XC5 A;  1UHS A;  3HOU J;  1ETK A;  2CQX A;  2Y31 A;  3TED A;  3QQA A;  3FKI J;  1FJL A;  3WHB A;  2HQ5 A;  3BR2 A;  4A3G J;  4JP0 A;  2LK2 A;  4W97 A;  2QF7 A;  2ECB A;  1A5J A;  2JMW A;  4AC0 A;  3ZQC A;  1ZQ3 P;  5GPC A;  3A02 A;  2EQR A;  1ETX A;  1TWG J;  1H8A C;  1GV2 A;  2VUM J;  3OOU A;  1TWA J;  2WV1 A;  4Y7N J;  1JUS A;  2DJN A;  4B4C A;  2DA1 A;  2LP0 A;  3PO2 J;  1I3Q J;  1DU6 A;  1IGN A;  5IP9 J;  1YRN B;  1ZR2 A;  2O7O A;  3O8H A;  5M5X J;  3IH2 A;  5J1Y A;  5F04 A;  2LLK A;  2NS7 A;  2YS9 A;  2QCO A;  3RQI A;  3ZQF A;  2PMZ N;  5F08 A;  3S17 J;  5GPA A;  3B6A A;  1HF0 A;  1GVD A;  1IJW C;  1PUF B;  2G0E A;  3HGG A;  1OFC X;  4L5E A;  4LOC A;  1ENH A;  2DN0 A;  2R92 J;  3JRF A;  3JRA A;  3BR6 A;  2D5V A;  4A3L J;  1X2N A;  5FJ8 J;  1E3O C;  2MG4 A;  2OPT A;  1B8I B;  3E7L A;  1P7I A;  2JN6 A;  2XPV A;  1MH4 A;  2DMU A;  3HEF A;  3HOY J;  2XRL A;  4DYC A;  1MSF C;  4CYC A;  4D7N A;  2Y9Z A;  3Q0V A;  4FE7 A;  3BT9 A;  3MVP A;  4G12 A;  4IHY A;  2ME6 A;  4MLO A;  9ANT A;  1IDY A;  2DMT A;  3DCF A;  5IP7 J;  2EH3 A;  3W6V A;  2E2I J;  3RZO J;  1SFO J;  1XG1 A;  4JX5 A;  1RET A;  2ECC A;  1JKR C;  2Y9Y A;  2DA3 A;  1ZK8 A;  2HI3 A;  3BR0 A;  1TC3 C;  2H1K A;  1VFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...