3OIOA

Crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
112
structure length
112
Chain Sequence
NAGSQPKLTEAVSLMEANIEEPLSTDDIAYYVGVSRRQLERLFKQYLGTVPSKYYLELRLNRARQLLQQTSKSIVQIGLACGFSSGPHFSSTYRNHFNITPREERAQRAQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of transcriptional regulator (AraC-type DNA-binding domain-containing proteins) from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Transcription regulator
molecule keywords Transcriptional regulator (AraC-type DNA-binding domain-cont
total genus 40
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3oioA00
4M3BA 3O8GA 2M8GX 2N8GA 1BA5A 2XPWA 3G1LA 5M5WJ 2X48A 3BG5A 1ETQA 3ZQCA 3GTLJ 3SDGA 1MBJA 1YRNA 3I4MJ 1U78A 2LVSA 3JRAA 3HOXJ 5C4JJ 4D7NA 2ID3A 2CUFA 1AKHB 4A3MJ 1RPWA 4V2GA 2KDZA 1A6IA 1RKWA 2MW8A 2ECCA 4JX6A 3PM1A 4M6VA 2CU7A 2XSDC 1X2NA 4DYRA 5FKMA 1IG7A 4XRSG 2R5ZA 5K7HA 1GUUA 5FJ8J 3HOWJ 4DW6A 4ABZA 2EZKA 2NS7A 4S0HB 2L0KA 2NS8A 3OSGA 1OJLA 3BTIA 1JTXA 1P7IA 3CQZJ 2DA6A 5M5XJ 2LK2A 2E2IJ 1ZQ3P 3CCYA 4FE7A 3I4NJ 5DTDA 3C2BA 5M5YJ 1TWHJ 1GVDA 1TC3C 3S1NJ 2QCOA 5EGOA 2NVXJ 5F0HA 2R5ZB 1FIAA 5FKKA 1UHSA 1I3QJ 2DTZA 4DYQA 3S16J 2DA1A 1BW6A 1E3OC 2HOSA 3IH4A 2XB5A 5IP9J 2M34A 4B1RA 4JYKA 1AKHA 5C44J 1IC8A 5K7FA 2E19A 2B63J 2COBA 1OFCX 3WHCA 1A5JA 1YRNB 4AUXA 1MSEC 4EEFG 4FTHA 2H1KA 2I10A 4FISA 1GV5A 1ORKA 1JUSA 2JMWA 3JRIA 3JRDA 5E3NA 5EZHA 2ZB9A 2R0QC 1Y1VJ 2KT0A 1RESA 2EBIA 2JA5J 3HM5A 1APLC 2AO9A 3G1MA 3HGGA 5GP9A 1IUFA 1UMQA 2DA3A 2MGQA 2R7ZJ 4L5EA 4XRMA 2TCTA 4FE4A 1MH3A 1GV2A 3BR1A 5EEAA 1TWCJ 4GFBA 2ID6A 2EQRA 1Y1WJ 1JKRC 2XRLA 3QPSA 2R93J 5E3OA 4QTRA 1WI3A 4JX4A 3S17J 3ZQGA 2JK3A 3A01B 5J1RA 5FLVA 2JA6J 2R5YB 1BW5A 3GTJJ 3HEFA 5IYBJ 1FTTA 1U9OA 3M4OJ 5E3MA 1JJ8C 4A3GJ 1S7EA 2R92J 2RAEA 1MH4A 2MSYA 2AHQA 2VI6A 2K9SA 2M9HA 4MFEA 3F0CA 3Q0WA 2HOTA 1LE8B 2HXIA 4C2MJ 4UUTA 3MVPA 1K61A 4A3EJ 3RZDJ 2VUMJ 2VKEA 3BG9A 3S14J 1F43A 3IV5A 1IDZA 1MSFC 1MNMC 4A3LJ 1T56A 2LFBA 3TP3A 3GTKJ 1FIPA 1AU7A 3DCFA 3JR9A 1MBEA 1IV6A 2E2HJ 2LP0A 3GTMJ 2L7FP 4UUSA 3S2HJ 5GPAA 1ZTRA 1CQTA 5F1JA 9ANTA 1JGGA 2XPUA 1OCPA 3JRHA 5JLXA 3O8HA 1ITYA 5FLMJ 3B6CA 2FJ1A 2QF7A 1RR7A 1JKQC 1Q1VA 1RETA 3PO2J 2LY9A 5FKLA 3ZQIA 1HF0A 1ZR4A 3HGYA 2LR8A 3BR3A 2O7OA 5F08A 4D5FA 2ELKA 3BQZA 2DMPA 1ZKGA 3GTQJ 3HOYJ 2K9QA 2LKXA 4C3JJ 2CQXA 3BR0A 5DS9A 5J3LA 3S1MJ 5F0CA 4D7MA 1MBKA 2IEKA 1ETYA 4C3HJ 3BTLA 2E2JJ 1B8IA 3ZOBA 3A02A 1POGA 2CRGA 2LD5A 4BY1J 4MO7A 2X6OA 2NOGA 3VPRA 3A01A 2H8RA 2XGEA 3JRGA 2K40A 2HQ5A 4I6ZA 1JJ6C 2K9NA 4NDLA 4IHXA 1H8AC 3HOVJ 4M3EA 5C4XJ 2O8KA 3CDLA 2DMNA 1DU0A 2XB0X 2GM4A 1ETKA 1PUFB 1IDYA 2HYJA 3MKLA 3OIOA 2D5VA 3LOCA 2DA7A 2Y0SN 3S15J 2IAIA 3K7AJ 1HCRA 3RZOJ 3OOUA 1GDTA 4G12A 2JJ7A 3GTOJ 2CUEA 2W48A 2L7ZA 2EZHA 2MG4A 1WH7A 4QSHA 4Y7NJ 3S1RJ 3SFIA 1LFBA 1X2MA 1BL0A 5IOYA 3LSGA 3HKZN 5EF6A 1RKTA 4XRSA 5J1UA 1R9TJ 1P7JA 1D5YA 2NVQJ 2DA4A 4MLOA 5JLWA 1MBHA 3JRFA 1FTZA 1I6HJ 2Y30A 3SJMA 1NK2P 2DMUA 3MN2A 5IP6A 3LSRA 2M2EA 2DA5A 1T33A 2O9LA 1JT0A 3S1QJ 4A3DJ 5EDNA 2NVYJ 3DEWA 2GLOA 2XGCA 2M0CA 2GBYA 3LSPA 1MBFA 1K83J 3K2AA 1JTYA 4M3DA 4MIMA 5M3MJ 1QPIA 4J19A 4RBOA 2YU9J 4AYBN 2DJNA 3E7LA 2L7MP 4JP0A 1JT6A 2FX0A 3ZQFA 4HNVA 1AHDP 2L9RA 4FCYA 1FJLA 4XIDA 3A03A 2HI3A 2LLKA 1IJWC 4A3BJ 2E1OA 3HDDA 4CYCA 3PO3J 2VKVA 1OCTC 3B6AA 4M3GA 1B8IB 1HDDC 2EH3A 2EZLA 2JWTA 3BTCA 1NK3P 1JUPA 2OPTA 1ETXA 4C3IJ 2Y9YA 2DMQA 2EZIA 2JN6A 3GTPJ 5E3LA 2WAQN 2YUSA 1HOMA 4A3JJ 1QVUA 3JRCA 2R5YA 1ZR2A 3LSJA 1TWFJ 3Q0UA 2ECBA 3BR2A 5GPCA 1WCMJ 1XC5A 1F36A 2YS9A 3BR6A 3M3YJ 1NTCA 1SANA 3ZQHA 2CJJA 4BY7J 5EYRA 3S2DJ 5F0FA 4IHVA 2LTPA 3QPLA 1ETWA 2HOAA 3CMYA 3RQIA 3WHBA 2WV1A 3FK6A 1PUFA 3OSFA 1LE8A 1VI0A 5F04A 4X1EA 2ME0A 1QRYA 3HB9A 2HDDA 2IBDA 3GBGA 2Y9ZA 3W6VA 3RKQA 1UG2A 3H3VK 1XS9A 4CYCB 5EZGA 2CQQA 1H88C 2HXOA 3G1OA 4DYCA 1WH5A 1IRZA 1VNDA 1ENHA 2Y2ZA 4X6AJ 4MFDA 3ZQLA 2ME6A 2DA2A 1O4XA 5F27A 2TRTA 4BKXA 3IH3A 3JRBA 1IGNA 2DN0A 4A3IJ 3H0GJ 3IH2A 3GTGJ 4W97A 1ZK8A 1QVTA 4Y52J 4DZPA 1DU6A 2PMZN 3NAUA 5FKNA 4RDUA 1XG1A 5IPAA 4A3FJ 4IHYA 3BQYA 1Z0XA 4A93J 5HODA 2WB1N 4UUSB 4M3FA 3BTJA 3Q3SA 4BBSJ 4AC0A 1EF4A 4B3AA 3TEDA 1B72B 5BNGA 5M3FJ 3TP0A 3HOZJ 3L1PA 1JUMA 3NARA 1X58A 1Z77A 3BT9A 1WGXA 5FKOA 5EGOB 3LNQA 1VF9A 2Y31A 3D1NI 1BJZA 5IOZA 3HBLA 1LFUP 5K7ZA 2P81A 1TWGJ 4A69C 1JKOC 1ETOA 3FKIJ 1U9NA 1U8BA 3JREA 4W1UA 4B4CA 1ETVA 1GT0C 1MBGA 1TWAJ 2XPVA 4BXXJ 5EG0B 2XGDA 2FD5A 4IEJA 3QQAA 1WPKA 1B72A 2JA8J 2NVTJ 2X9DA 4IHWA 4BBRJ 3BG3A 4XK4A 4I76A 3UKGA 3TW7A 3Q0VA 3BR5A 1G2HA 5J1YA 3FISA 4JX5A 4DZJA 3HOUJ 4D5CA 4LOCA 1HDPA 1VFCA 2OF7A 2DMTA 1H89C 3FK7A 1SFOJ 4V2FA 1FEXA 1I50J 1ZGWA 4A3KJ 2FQ4A 1JKPC 5C3EJ 2G0EA 1W0TA 2VPRA 5EG0A 3TW6A 5IYDJ 5IYCJ 4QIWN 2JA7J 1HLVA 5IP7J 4XICA 3FIWA 1W0UA 4A3CJ
chains in the Genus database with same CATH superfamily
3RTRA 3FM5A 3H1CA 2QKMB 3OYMA 2N8GA 3G1LA 1J59A 2CW8A 1F9NA 2VXZA 2X48A 1IN4A 1TNTA 3WTXC 3JAMK 1VQMI 1ETQA 2UXXA 3DPUA 1MBJA 1EKEA 4FETA 1LPQA 2Q8KA 2EV5A 4CICA 2ID3A 1AOYA 5GAGJ 4M9ZA 2CUFA 3H36A 3OWTA 4LB5A 2Z5UA 2CU7A 2P6SA 2QENA 4LLGF 4EVIA 4Y4RA 1I5ZA 1K4TA 5GAHJ 4C2TA 4JQFA 4ZYAA 4S0HB 5E1ZB 3M7GA 4EJVA 2KRFA 1OJLA 3BJ6A 3OSGA 5M5XJ 1IXRC 3IAM2 5DYMA 2ZCWA 3FXJA 3I71A 4I2OA 1MJ9A 5M5YJ 2OTLI 3F6VA 1TC3C 2E5ZA 2FBHA 4EMSA 2WADA 4CA0A 2OCEA 4UV8A 3PUFA 2DTZA 2ADUA 5FKKA 4BNCA 3A0BC 1BW6A 2XV4S 2VQHA 2W57A 1FLIA 4ZZDA 2GXBA 2R7RA 2M34A 2M4GA 4JYKA 1AKHA 2W24A 5C44J 5K7FA 2DFFA 2V6EA 2VBYA 3O6BB 3WHCA 3KZIC 4QWQA 1A5JA 2H1KA 1YS7A 2P6TA 2I10A 4FISA 5LLQA 1T39A 3QYBA 2JMWA 4PSWA 3OYJA 3N05A 4O3MA 1T0FC 5CQEA 3ZMUA 1Y1VJ 2STWA 4LG3A 4B43A 2AXTC 3HM5A 2AO9A 3I58A 3HGGA 1YI2I 1PYVA 3DBHB 2IS2A 2MGQA 2DBBA 3K4LA 5EEHA 5D4SA 5JVGF 1MJAA 3G73A 2OZ6A 1GV2A 3BR1A 3U2RA 4RGUA 5FO5A 5IY5H 5LD2C 3WGHA 2XRNA 1TQMA 1Y1WJ 1JKRC 3DF8A 2R93J 1Z21A 2KMUA 2MYSA 2XKOA 3A01B 5FLVA 2D1VA 1TW2A 3CC4I 3M4OJ 4A3GJ 3ZN1A 1S7EA 3TOAA 2RAEA 4II3A 3ZGKA 3JTHA 4XLNF 5E17F 1J09A 5H2FC 2K9SA 2JQ7A 1WJBA 1LE8B 4L18B 4IX7A 2VE8A 3EUAA 4ZYGA 5HS9A 1QNTA 3MVPA 1SMYF 4RB2C 2VKEA 1F43A 1DP7P 3RYRA 1FT9A 2H27A 2RKHA 3J80K 4A3LJ 1DP3A 3TP3A 1RZ4A 2LFBA 1KQ0A 4UVCA 4U0YA 4KN4X 4OAYA 4HLYA 1MBEA 2M4KA 2IVMA 2LP0A 4PJMA 3GTMJ 2OJED 4UUSA 2XF6A 3S2HJ 1ZTRA 2V7FA 1S9HA 3TQNA 1Z1DA 3KPHA 3DLAA 3ZRGA 2RVCA 1G59A 2XPUA 1OCPA 2V9PA 4GYGA 3DBLB 3LA3A 1MMNA 3B6CA 3H3UA 2FJ1A 1RUNA 1USTA 4A6DA 1QBJA 2CH0A 5IT3A 4CDGA 1IRGA 3I0TA 2F5FA 5FKLA 2DPDA 3H92A 2LF8A 2HOEA 4AIDA 3K4JA 2BVLA 5CVJA 2JVHA 4LJZF 2ZXWH 1FYMA 2R3SA 1UG0A 3SDBA 3BCAA 4YIFA 1R5ID 3GTQJ 4KIBA 1BJAA 3V8LA 4U88A 3DV8A 5E20A 3BR0A 1Z7LA 4PJLA 5LHIA 1LJ9A 3S1MJ 4EGYA 1MBKA 3HL2A 3CCRI 1BIAA 3V7SA 5H6QA 1ZRFA 2O61A 2X4HA 1O7FA 3RJPA 2CV2A 5HLIA 1R7JA 2VJ4A 4MO7A 3IKTA 3BOQA 3VPRA 5B1AH 4ZTFA 2XGEA 2CV0A 4A5NA 2D1HA 4I6ZA 4AM3A 2XVCA 2K9NA 1JXSA 3CO7C 4NDLA 1OYYA 2VC0A 3HOVJ 2DOFA 3PQJA 4HRIA 3PNYA 3CZ6A 1Z67A 4LD5A 3ZQ7A 2LKPA 4EM2A 5CYVA 3ISPA 5KVRA 1PUFB 2EFWA 3KX2A 5L3DA 3OIOA 2D5VA 4WK8F 3LWFA 2DA7A 1YHQI 1QZZA 4EJTA 5HOOA 1EH8A 2CW0F 3HRTA 2K3FA 3KCCA 3U9GA 1GDTA 1FBQA 2BE5F 4MTDA 2CUEA 2ACJA 1D0ZA 2L7ZA 3GWZA 2Z1DA 4Y7NJ 3S1RJ 3SFIA 4E7SA 5DD8A 5DEQA 2XAJA 1SFXA 2GA1A 3HKZN 2CMPA 1ZAOA 4N4OB 5EF6A 1LQ1A 1P7JA 1X1DA 4HF2A 4AU7A 4R79A 2IRFG 2NVQJ 3AFHA 1MBHA 2L9NA 4RGSA 2LH9A 1AWCA 4RLFA 1I6HJ 3UNGC 2K02A 3MN2A 1BM9A 2L4AA 4ESJA 3LSRA 2M2EA 4A6EA 5EDNA 3KP2A 3AAFA 4CUGA 1O57A 3F72A 1WKMA 4IHTA 2GLOA 5E8GA 1BIBA 3LSPA 5M3MJ 3F23A 4J19A 2DJNA 2VT2A 3FXMA 3E1SA 2VBXA 3TO9A 1HA8A 2DK8A 2HR3A 3ZQFA 2K3PA 2Y0MA 2L9RA 2STTA 1FJLA 5HLHA 3OY9A 2GIVA 1OPCA 2LRDA 4IQJA 1IXSB 4A3BJ 2WTEA 4ZYEA 4M3GA 2HU9A 4IRHA 2EZLA 3DTKA 1TQPA 2OD5A 4C3IJ 4HQMA 3ESWB 2EB7A 1IN8A 1Y39A 2X1CA 3FXUA 1K79A 4P1WA 4PUSA 2EIJH 1P92A 3F21A 1YO5C 5IT9K 2WAQN 1HOMA 1GVJA 3JRCA 1VQLI 2HQRA 4XLFA 1X4OA 1TWFJ 1XGMA 3BR2A 2A6HF 2VN2A 1F36A 4CCNA 3ABKH 1Z3XA 3BR6A 1H9TA 1FP1D 1SAUA 1Y0NA 4LITA 2KZVA 1SANA 3BWGA 5B66C 2G7HA 4IRIA 1VQ4I 5CVUA 3MCZA 1T0FA 3GX4X 3HOSA 2OUMA 2VBZA 3QPLA 2CQNA 3X2QH 4OIPF 2MFZA 4BQAA 5KK1A 3ZMSA 1PUFA 2WA0A 4LGWA 5F04A 1QRYA 1R23A 3HRMA 2XDVA 2IBDA 1Z91A 3HB9A 3GBGA 5CQGA 3SHFA 3W6JB 2Y9ZA 5HDNA 2V4JC 1IRXA 4WX9A 2OA4A 5D5XB 3CF2A 3H3VK 2BW3B 1M1EB 3CDIA 1O3RA 3FX3A 4M6YA 2E7WA 1WH5A 1IRZA 2QSGX 3IAS2 3ZQLA 2QEXI 2VQGA 4LB6B 4XRFA 4BKXA 2ZMEA 3IH3A 3JRBA 3C3WA 3BLYA 2MBFA 4ZC3A 1R1VA 2FF4A 3GTGJ 3GZ5A 1XCVA 4ESFA 1OR7C 3DQVC 3WGGA 2PBIA 2VQLA 4DZPA 1TL8A 3E6DA 1DU6A 4H4KC 5L3BA 3WTVC 5EJCA 3CCQI 3RKXA 3V8JA 1XG1A 5IPAA 3G4SI 4E7KA 3BQYA 5HODA 2WB1N 1WWXA 3NWSA 3G71I 3Q9SA 5ICFA 2O0YA 1VQ9I 3ELKA 4EATA 3SYTA 4BHBA 5BNGA 2ZXHA 4N9HA 3GVAA 1R1TA 1VQ6I 1MMSA 3L1PA 3HKZA 3ABLH 2VJ5A 1X58A 1WGXA 4MEYF 2CSOA 3S32A 3LNQA 3VDXA 3CP8A 1MMGA 2Y31A 2P5VA 1AA7A 2H8WA 2FNAA 1LFUP 4NQWA 4I09A 3QOPA 4HPQA 3SZTA 2GOMA 2B7EA 4BGDA 1U8BA 3JREA 1W5CC 4E7IA 1TWAJ 3QP5A 2K9MA 5D6FA 2IGKA 4BXXJ 3KP4A 3KP6A 1OYWA 4IEJA 1MMDA 2W25A 4XONA 3QYFA 2Y48A 2BW3A 3LFKA 3GLLA 3AG4H 1YJNI 2H09A 4NC8A 2JSPA 4ENNA 1B9NA 4B8XA 3LSKA 3ERED 1ZGAA 4E4HA 1TLHB 3TW7A 2QLZA 3BR5A 5F64A 1G2HA 2PEXA 3D5SC 4JX5A 1Z7UA 3HOUJ 4LOCA 1VFCA 2OF7A 2DMTA 4RAFA 1FMVA 2A07F 3BZKA 4E70A 2A61A 1ZGWA 2DOEA 5BMZA 2O5RA 5C3EJ 1QO0D 3I5UA 1ZREA 1J7KA 4L5JA 5LHGA 2G9WA 3EUKL 2G0EA 4M71A 3KYLA 4IZZA 1IUYA 5HLTA 1XMKA 1J9IA 4HA8A 1F5TA 5IP7J 3FIWA 3HUGA 3BP8A 4M3BA 1NHAA 2M8GX 5BPIA 2PX9A 2XPWA 2WWYA 1U0JA 1IAWA 2QKLB 2HDCA 1T6SA 5J40A 3OYAA 1XN7A 3H5RA 1P4XA 3E97A 2EV6A 2F5CA 1YX5A 2NAZA 2ZJ2A 3BDDA 2P5KA 2M7BA 2F5DA 1U78A 2LVSA 2PMZA 2VB6A 2OQRA 2YU3A 1AKHB 4XKBA 1RPWA 4C9YA 2KDZA 1RKWA 1RI7A 1VQ7I 4XN3A 3O2PE 4JX6A 3PM1A 5KAFC 1LFPA 1P4WA 1XSXA 1X3WB 1IG7A 2OTJI 1IN5A 4IPAA 3FKJA 1R22A 5K7HA 3OIQA 3EQLF 1LDDA 3HOWJ 4ABZA 2CW7A 2EZKA 4G7ZF 4HF0A 2DA6A 3WG9A 2E2IJ 3CJRB 2EA4A 4FE7A 3I54A 4L9VA 4LK0F 5DTDA 3I4NJ 3C2BA 5LEJA 1TWHJ 1XSDA 3S1NJ 4EGZA 1FIAA 1R36A 2ZKZA 1UHSA 1I3QJ 3S16J 3ROUA 4N4NB 2WY8Q 2HOSA 3IH4A 3OYDA 2X0LA 4XMYA 4WXCA 3COAC 2KZGA 2F4IA 2ZBKA 3A2KA 4DQ2A 4CYDA 1ZH5A 2IA2A 3WGIA 4Q47A 2ETHA 2VC1A 1IC8A 3E6CC 3HSFA 1OFCX 4QLCU 2UV1A 2XAUA 4FTHA 2G7UA 2KPMA 1JUSA 3JRDA 5E3NA 2NNNA 1OR7A 3LQQA 3CMEI 1FOKA 2KT0A 1RESA 1P9QC 5FGMA 3BROA 3C7JA 3REOA 3CC2I 1QZYA 1Z05A 2IXSA 5GP9A 2MH9A 2MH2A 1UMQA 2DT6A 5KCMA 4XRMA 4IF4A 4E7LA 2BOLA 4FE4A 3FWEA 4I01A 1MH3A 5EEAA 5D5VB 4GFBA 2ID6A 2EQRA 3Q5FA 2DLLA 2JPBA 2BV6A 3CP2A 3QPSA 3S17J 3CUQB 1D1AA 4RGXA 4RS8A 1SMTA 2BZTA 3QWLA 2JA6J 2R5YB 3U1DA 1QGPA 3T0YA 2JVGA 2RV8A 1U5TC 3NEUA 2DJIA 2ZFWA 2R4GA 3E3VA 3BY6A 2R92J 2XUBA 1MH4A 1IZ1A 1ZELA 2YPRA 2DYRH 4ZYHA 4KITB 2M9HA 3PIOF 2HOTA 5GADJ 1PP8F 3EPZA 3GUDA 2IGOA 1VQ5I 4UUTA 3IKVA 4HV5A 4ZYDA 1N78A 5ILSA 2VUMJ 2DI3A 2AXLA 3VYTB 1MNMC 3CUQC 5LFAA 1U3EM 1IO2A 1R49A 2VODA 3DCFA 3J81Z 4GDFA 3E6BA 4R8HA 1U2WA 3EYYA 4GO1A 5FD6A 3D5LA 3HTSB 1E0EA 1ZLJA 2BVMA 3C18A 1KA8A 1R4MB 1MDMA 2RNGA 4HOBA 4DJAA 1S7OA 4GCVA 1USSA 2KL4A 4LK1F 4P5OA 5FFXA 4ENKA 1ULYA 3ZP5A 2H94A 4M6XA 2KIFA 2QF7A 1SEUA 1BI3A 3W2VA 1FP2A 1FMWA 2ZJPF 2CQ7A 3RPUA 1ZG1A 1FYLA 3IRQA 1Q1VA 2JT1A 4KMFA 1HF0A 5J47A 1ZR4A 1FPQA 2LR8A 1I3AA 4Q4ZF 2EIKH 1R6RA 4LMYA 3HTUA 4BUPA 1UJ8A 3SEZA 4OAZA 1BR1A 3TKYA 4D5FA 2IA0A 3BQZA 1CF7B 5ICCA 3DU5A 1SD7A 4FX4A 3TDUC 4FQGA 2K9QA 4HZFA 5H6RA 2CQXA 2E36A 5CPRB 3WTZA 5J3LA 3GZ6A 4D7MA 3FM3A 2IEKA 1ETYA 2E2JJ 1MNDA 3ZOBA 3A02A 2LD5A 3TO7A 1W5SA 1W5TA 3CD6I 2X6OA 2XASA 3L9FA 1HQCA 3MD2A 3WTUC 1A36A 1D1BA 2HQ5A 5B5EC 1OCZH 3NWTA 1QQIA 2F4OB 4BS9A 3CMAI 2P8TA 3WTWC 2WAFA 2WAEA 1QA6A 2CQKA 3R6SA 1NH3A 2L9SA 2X1DA 1S3JA 3DWLE 3KP3A 5ED4A 3T1BA 5HLGA 4PK4A 4HQEA 3E5XA 3GFLA 3NQOA 5BOXA 3U1KA 3LOCA 4NB5A 3S15J 2RN7A 2VOOA 4PJ0C 2IAIA 3LSIA 1HW1A 4XN0A 3RZOJ 4BXUA 3ECOA 3K1MA 2QQBA 1FX7A 1KGSA 5A2QZ 1H9GA 1SC7A 4UB8C 1E3PA 2L9VA 4M9SA 4QSHA 1WH7A 1OISA 1G8XA 3E0JB 4HYEA 5GTIC 3B73A 4XLAA 1R9TJ 1D5YA 3H9JA 1HKSA 4EV0A 1VZ0A 2ZSHB 1KZHA 5HVQC 3WU1B 1K6YA 1S8NA 2Y30A 4PFPA 2XAHA 5K5OA 1O7LA 3PL8A 3E6MA 3OYKA 2O9LA 2BXZA 1JT0A 4XKWA 5L3FA 3WE2A 4BJ6C 3DEWA 1QHGA 2HZTA 2GBYA 3I4PA 3M8EA 1MBFA 4M3DA 4MIMA 4CZZA 4RBOA 2YU9J 2JTVA 4OIRF 3P5JA 4I99C 5J8CA 2KISA 1SAXA 4JP0A 1JT6A 3ABMH 4OMZA 2IP2A 2W85A 1Y6IA 3PSIA 4L9JA 1OMIA 1W7PD 1HKTA 4XIDA 3MMYB 1K6OA 1Z6RA 2HI3A 2LLKA 3F9KA 1IJWC 1TZLA 2IPQX 1XD7A 1IXCA 3QYEA 3AKZA 1DPRA 1YX3A 4CYCA 2LG4A 2VKVA 3B6AA 5A2QK 1B8IB 1OCTC 2A3SA 2JWTA 3BTCA 4UVBA 1T08B 4CSWA 1MD0A 3S93A 2Y9YA 1FYKA 2IS1A 1HC8A 2KIMA 2RGVA 3GTPJ 1X1AA 2R5YA 2AQFA 3LSJA 4I02A 3RSNA 1Z3YA 2ESNA 1XX5A 1KYZA 3L2CA 2ZMEC 1WCMJ 3MKWB 2RQPA 2EILH 1EV7A 3KEYA 1I1GA 1MKMA 3I64A 3I9V2 3HYIA 3BG6A 2XAFA 4ZH4F 1WJAA 2CJJA 2JRMA 4IHVA 5AONA 2NOJB 3VOEA 2LYCA 5DCMA 1WVRA 4MNUA 3GZNB 2LY1A 2WV1A 4RM2A 1LE8A 2W7NA 1J0RA 4X1EA 2HDDA 4U87A 5LGTA 3K6GA 3PNTA 3ASOH 3LSMA 1Y8RB 2EFPA 4DBQA 2Z9OA 2LKSA 1ONVA 4CYCB 4M74A 5L3EA 3LMMA 4UVAA 3TOBA 5FB2A 3RPQA 4DYCA 3RKYA 1VNDA 4X6AJ 4MFDA 2HTJA 2V9VA 5F27A 2HYFA 2OC6A 2DN0A 1T95A 1SD6A 3IH2A 4F55A 2BXYA 2LY2A 5D8KB 1ZK8A 4Y52J 3MKZA 3N97A 1UELB 4YFXF 3M07A 1SFEA 2FMYA 1KYWA 3DPLC 3V8KA 3K4KA 4S04A 1HKQA 5LRSA 3OYHA 4OU0A 2IJLA 4RDUA 2K5CA 4CXFA 5GTHC 1R71A 4IOAF 2FNPA 3E5UA 3L2QA 4CCKA 4U7BA 4A12A 2CGPA 4FHTA 5HNFA 4A93J 1GLNA 1R1UA 2QWWA 4C2UA 2ICWG 4AIJA 4M3FA 2HGCA 4UB6C 5CJ9A 3K4BA 2JPCA 5B1BH 3RQ4A 1Y0UA 2EINH 4HX4A 3ZMDA 3J7ZI 1XGNA 2FE3A 1F4KA 2PMUA 3VSKA 3DFGA 1JUMA 4KIFA 3BT9A 1QPMA 1X19A 4ZJZA 4AVPA 5EGOB 3I59A 2FSWA 3D1NI 3PIPF 4KDPA 1WJCA 2XHKA 5IOZA 3HBLA 1ZARA 2QSHX 2D2WA 1SVOA 4L9TA 1B59A 5K7ZA 2ZJRF 1TWGJ 2XAGA 4A69C 4PCQA 4G7HF 1BR2A 4B4CA 1ETVA 3EDPA 4S05A 2C6YA 2DDBA 2MA3A 1MBGA 3ONQA 1V4RA 4MHGA 2L54A 2XPVA 2KIUA 2E71A 4Y13A 2FUG2 2NYXA 3KZYA 2XGDA 2HVRA 3SZPA 3BZCA 1WPKA 4BQQA 1B72A 2JA8J 2O03A 2NVTJ 3BG3A 1L0OC 2UUZA 2W1OA 3T8TA 2ZNZA 4M9XA 2Y0SA 2XF5A 4CCMA 3K70C 3UKGA 3HJEA 3CDHA 4HNTA 4N9IA 2WC2A 3RYPA 5J1YA 3GFJA 4DZJA 4D5CA 2M45A 3JW4A 4BDZA 3G2BA 2A6EF 4HSRA 5HDGA 4M73A 2FQ4A 1R5GA 1JKPC 2DQLA 1HBXG 5DCMB 1FOWA 1X4PA 4PSXA 3TW6A 2MABA 1B9MA 2Q1ZB 2JA7J 1RIOH 4C30A 4EM1A 2F2EA 2ESHA 4XICA 4A3CJ 3A1YA 5FFZA 2ELJA 1BA5A 1A35A 3SQNA 2Z33A 2ZC2A 2V1NA 5M5WJ 3R4KA 2FRHA 2NVUB 1FBUA 3KEQA 5LRRA 2NRAC 2QSFX 3PFIA 4UHTA 3LA7A 3BG5A 1GXQA 4MEXF 3EYIA 4P9UA 1T8IA 2HYGD 4NC6A 3CCUI 3SDGA 3J7AO 3JRAA 5E1XA 3HOXJ 1SFKA 4D7NA 3ECHA 1TNSA 3CMMA 3ABTA 3K70D 4Q5SF 1YLFA 1A6IA 2MW8A 3T5XA 2ECCA 4DBRA 3CCEI 4M6VA 1BR4A 4CZCA 2XSDC 4HX8A 1X2NA 1FOXA 1LNWA 1WJFA 1KU3A 1W1WE 5DV5A 2IS4A 2HVQA 5TISC 3S2WA 4X0GA 2VKDA 2JRTA 2NS7A 3ASNH 3CJNA 4F7ZA 2L0KA 5L3CA 2NS8A 4EJOA 1JTXA 3GCMA 3CQZJ 4XBFA 3WG7H 2LK2A 1ZQ3P 3CCYA 3NRVA 3HG9A 2XROA 1GVDA 1A31A 1ZG5A 5EGOA 2IGNA 2XF7A 2R5ZB 2CUJA 4WWCA 1RRJA 2DA1A 1FOYA 1E3OC 4UUVA 1TQIA 4IHSA 2E1NA 5JI6A 4Z2YA 2ZXJA 4B1RA 3R0AA 4LIUA 3QRFF 1WFXA 2DU9A 4XR6A 5L3GA 2B0LA 3L09A 4XLPF 1YRNB 1QHHD 4EEFG 3BG7A 3KZZA 2A6TA 1GV5A 2QYOA 3JRIA 4MQVA 2HDWA 5EZHA 2ZB9A 2E5NA 3OS0A 1YFHA 3ZMTA 2JA5J 1APLC 3VWBA 2VL8A 2FMLA 2QQAA 3CLQA 1I6XA 3Q9VA 2XC7A 3F8MA 5CVRA 2UXNA 5FD5A 2PJRA 3W2AA 4LLLA 1NG7A 1YW7A 2DA3A 4XM3A 2K7LA 2DT5A 4L5EA 1ODDA 3FDYA 3OYEA 3HSRA 2DCEA 4KT6A 5JFRA 4EQQA 3LL7A 1YIJI 2P5LC 1G3TA 3M1EA 4GGGA 1TWCJ 3VYSB 3JSPA 1DQUA 4G9YA 2OCCH 2WB1A 5E3OA 1MMAA 1WI3A 3P7NA 3ZQGA 2JK3A 5ICGA 5J1RA 2ZJQF 3EUHA 3GTJJ 1BW5A 3V42A 5IYBJ 3CCMI 1U9OA 1BI0A 2MLKA 3L2WA 5J6XA 3FHZA 2KKOA 2MSYA 1EH7A 4R1HA 5DDGA 3C1DA 4AVZA 2AHQA 2GXAA 1DGRM 2VI6A 4ENJA 3B02A 4MFEA 2YSRA 3RIRA 2JZYA 3DPTA 2XKPA 1KU9A 2HXIA 2LBFA 1B4AA 4L0ZB 1P2FA 1E2XA 4BHCA 1K61A 4ITVA 3RZDJ 5J8FA 3FBIB 2GA2A 1E3HA 3BG9A 4HSTA 3IV5A 1O3SA 1SFUA 2EV0A 1IDZA 1MSFC 1FSEA 4BAYA 1XB4A 4A0XA 3SZGA 1T56A 2QBYB 3CJQB 3J7YJ 1FIPA 2HZDA 4BEHA 1BN5A 3K1PA 3I55I 1BC8C 2ELHA 2E2HJ 2Q2EB 4ANJA 4WXHA 3ZXSA 2L7FP 1CQTA 4BYYA 1V5FA 4OOIA 3K69A 5F1JA 5DUKA 4IVNA 1JGGA 2R7SA 9ANTA 3WE3A 4OMYA 1L3LA 1T98A 2J5PA 2O8XA 2EWNA 2CS3A 3ZMZA 2XAQA 3O8HA 5FLMJ 3C2HA 3IP4B 5BQTA 4XLHA 1U5TA 1TP4A 3RPUD 3OYBA 3H3ZA 1VQ8I 2IW5A 1JKQC 2HQNA 5DCFA 4KFCA 2IS6A 2LY9A 3AL0C 1PVEA 5DD4A 1SVMA 3HGYA 4MGRA 4UY8I 4DNCA 4B09A 1N75A 2O7OA 3K0LA 2E60A 2M87A 4CCJA 1KQ9A 2H1LA 2LNBA 4NNJA 2QQ9A 2ELKA 4ZDOA 3MFKA 2JSCA 4XKVA 4F91B 4BE0A 2DMPA 2VPLA 1T38A 1Z9CA 1ZKGA 1FNNA 2L3DA 3QODA 4I98B 2OQGA 5H20A 1V5EA 1MNEA 2BHZA 2HS5A 4C3HJ 3BTLA 4F92B 1REPC 4GXOA 2EA2A 1WZ2A 1JHHA 2CRGA 4ZDLA 1VQPI 2NOGA 2H8RA 2XGXA 3JRGA 2BY2A 3MEXA 3SXYA 5KNLA 4A5MA 2QM3A 3KLOA 2FA5A 3UR3C 1ERDA 3JSOA 4BACA 4IHXA 1H8AC 3HOTA 4KYWA 5C4XJ 2O8KA 1EA3A 1ON2A 4LG0B 4Z6YA 3KP5A 1DU0A 2M8EA 1W4MA 1J2XA 1G3YA 3S3NA 3LAPA 2KFDA 2XB0X 4YG2F 2GM4A 1ETKA 3PNVA 3S3OA 1HXDA 2QVOA 3MKLA 4O5VA 2Y0SN 1F1ZA 1OLTA 2FOWA 2GAUA 4UV9A 4XSXF 1HCRA 5AIPA 1E17A 3OOUA 1HSTA 4HX7A 3ZR8X 2BEOA 3IWZA 4BHPA 3GTOJ 1D1CA 3C2GA 3K1NA 2W48A 2VOPA 2EZHA 2MG4A 1QU3A 2LSOA 1OCRH 1X2MA 2M1BA 1BL0A 2OV7A 2V79A 1OCOH 3CTAA 3LSGA 1RKTA 4HG2A 4XORA 5J1UA 4H0EA 1YJ9I 2YX4A 5JLWA 4WF2A 1FTZA 4CCLA 3SJMA 4IOCF 2DMUA 3IL2A 1G6NA 2P0WA 4PDKA 2LC2A 2DA5A 3R60A 1WRJA 5KAIC 4PGGA 2NVYJ 4F3QA 2KJBA 2DO7A 2K85A 2XGCA 2D45A 2PN6A 4L5IA 4RAGA 3K2AA 1K83J 3DKXA 1JTYA 2V26A 4LG0A 5FLXZ 2V9KA 4AYBN 1HSJA 2L7MP 5KHDA 4G6DA 4BE1A 2HVSA 3AL0B 1ZRCA 3GFMA 1NG6A 3QU6A 4PFOA 4JBAA 1J5YA 4XOPA 4ASNA 4HAMA 1FC3A 2V1DA 4V19K 2RC4A 2E1OA 4DGWB 1UB9A 5DUIA 3PO3J 1JHFA 4BH9A 5ICEA 1BC7C 1HDDC 3TL4X 3JTGA 2EH3A 1NK3P 1K4SA 2OPTA 3EUHC 1HW5A 4FT8A 1MDMB 1IN6A 2P7VB 3FMRA 2E35A 2JN6A 2F5EA 2HWVA 5E3LA 2A5WA 3P9IA 2YUSA 2EJRA 3PUBA 4XLEA 3KFWX 1ZR2A 1PJRA 4YFKF 3HSEA 3FF5A 5EEGA 5F1RA 2ECBA 2L7KA 5GPCA 2HKXA 3AG2H 3D5RC 2EPFA 4FX0A 1WJDA 3M3YJ 3HUGB 1NTCA 3VYRB 1XCBA 1SVLA 3OL3A 3ZQHA 3ML6A 4PJNA 3HXLA 6PAXA 4XSZF 3M8FA 5EYRA 1W36C 2PLYA 5F0FA 2VXDA 1RNLA 5AIQA 2LTPA 1LB2A 3QP6A 3RI4A 1PDNC 1ETWA 4RM3A 2L2OA 3WHBA 3P9CA 2YR2A 1BI1A 2E1CA 1VI0A 4HDVA 3LSTA 3KYCB 3FMQA 3CO6C 3W6VA 1B6AA 3F8FA 3J81K 3RKQA 4HEA2 1S6LA 2X51A 5ILUA 3ZCOA 2KJCA 1XS9A 4WCGA 5EZGA 2CQQA 1B1BA 1G3WA 2W82A 4TV7A 2R7OA 4AIHA 2QBYA 3DTEA 1XGOA 2Y2ZA 3E5QA 1LEAA 5FROA 1UHMA 1P6RA 2HPMA 1P4AA 1UHWA 2R7WA 3HIFA 2DA2A 1O4XA 4AD9A 1IGNA 2R7DA 3K9TA 4A3IJ 3H0GJ 2L5QA 1W7PB 4JK1X 5TGTA 2CUZA 2LBFB 2I8DA 4KMUX 2L02A 1QVTA 2HPIA 3CUOA 3RDIA 3JAMZ 2PMZN 3HPHA 4ON0A 5LEKA 4D1QA 1WSUA 1D0YA 4Q48A 4XKCA 2VKHA 5FKNA 1U6GA 1R5HA 3HZJA 4HF1A 5CVVA 5TJJA 4NQWB 2DW4A 1Z0XA 1YW9A 2DYSH 3PJRA 2J5OA 1S29A 3GLXA 1ON1A 1OKRA 2DFEA 2MD0A 3L00A 3V7RA 3BTJA 2E1MC 3Q3SA 4BBSJ 1Q1HA 3WTYC 2QQ8A 4B3AA 3TEDA 1XMAA 2HQAA 3AG3H 1B72B 3I53A 2VE9A 1ACIA 1H0MA 5M3FJ 3TP0A 1IF1A 3J80Z 4I0BA 1YTYA 2R7UA 5FRMA 2Y75A 1Z77A 3NARA 3K2ZA 1DPUA 2VJJA 4E7HA 3W3CA 1BJZA 2BBYA 4ESBA 2KRHA 2IT0A 1OQYA 1X1CA 2HNHA 4N0BA 2DTRA 2P7CB 3ABUA 2VJIA 1JKOC 4PZJA 1XTAA 3CCLI 1MZBA 1ETOA 3BZ6A 1U9NA 3OOPA 4W1UA 4BDYA 1K7AA 2COMA 5D4RA 1UAAA 4ZTJA 1UFMA 3FXKA 1ZN2A 3W2WA 5EG0B 3F8BA 2JA2A 2FD5A 3CUQA 4E7ZA 2EK5A 5CLSA 1WI9A 4KICA 3QAHA 4B44A 4XK4A 4I76A 1KQ8A 2BY1A 2YX7A 2Z99A 3Q0VA 3VODA 4BE2A 4Y3OA 4YIIA 4YELA 3FISA 2A5YB 1FZPB 2M0MA 3HC7A 2MC3A 3BPXA 1CGPA 5K5RA 3FK7A 3SFZA 4AYBA 1H89C 2EFOA 2EFQA 2WBMA 3MZYA 4V2FA 1K78B 4CH7A 1WHUA 3R0JA 1EJ9A 4PJJA 5B3SH 4RA2A 3I56I 1R58A 4B48A 2LDUA 3PSFA 3CCVI 4BQNA 3MZ8A 2W00A 3KE2A 4G94A 4QIWN 1I1SA 2HKOA 2WY7Q 2FBKA 4I0AA 1VQNI 1X1BA 3O8GA 4LFUA 1YG2A 2DQRA 2GWRA 2V6CA 3GXOA 2PJRB 4KJZA 2WV0A 3TDZC 4RMNA 2K27A 1GXPA 1ZLKA 1U5TB 2A69F 3FXQA 3ZN0A 3H5AA 5CVIA 3ZQCA 2KRCA 3GTLJ 4O6JA 3DKWA 1YRNA 3I4MJ 3OYCA 2LMDA 3W6KB 2B9SA 5C4JJ 1PP7U 1YYVA 2Q2EA 4A3MJ 4V2GA 1JI8A 5ERIA 5J4YA 4LIVA 4XLCA 2EFNA 4BEHB 5TRDA 2H6CA 3FBNB 3IWFA 5K5QA 4DYRA 5FKMA 4HLXA 4XRSG 2R5ZA 1J75A 1EH6A 1GUUA 5FJ8J 4DW6A 1C0WA 4U0VA 4PGHA 3ZMVA 3BTIA 2JUGA 1P7IA 5DM7F 1S5LC 1MW7A 2PI0A 2QGUA 1XPXA 2KQRA 2RDPA 1XGSA 1KONA 3DP7A 5F6FA 2Y69H 1MJBA 2QCOA 3BJAA 2NVXJ 2M5WA 2TDXA 5F0HA 1V5GA 1LVKA 2DFIA 2ZO4A 4DYQA 2F48A 2CFOA 2K86A 5JHFA 1QZEA 4D9JA 2BY0A 1STZA 3BC8A 3M9AA 3IRRA 2XB5A 5IP9J 2UWMA 4UXNA 1T2KA 1VQKI 3HPGA 2E19A 2B63J 2COBA 1BOBA 2BY3A 4I7HA 4QPOA 4AUXA 1MSEC 3MAJA 3H9GA 1YW8A 3CF5F 1I39A 1TT5B 1ORKA 5E8IA 4XQFA 2R0QC 4EJWA 2CO5A 4HV6A 2ZSIB 4A0YA 1UZCA 2NXNB 2EBIA 4MQ9F 3WU0A 1W36D 3OYLA 3G1MA 1X1PA 1IUFA 3I59B 2BHYA 3DTIA 3DBRB 3OYFA 2R7ZJ 2M30A 3OMYA 4EJUA 2V1XA 1W7PA 3M1CA 2TCTA 4QPQA 3WODF 3VB2A 1X3UA 1LKXA 4OIOF 2A05A 3OS2A 2KP6A 4II2A 3CCJI 3A4CA 4AIKA 2XRLA 4QTRA 4JX4A 1TTYA 2O3FA 3H0DA 3KP7A 4YIRX 4RAZA 3HEFA 1FTTA 2VBWA 1G3SA 3G3ZA 3ULQB 5E3MA 2KLOA 1JJ8C 3GF2A 4HBLA 2ZFUA 3QPHA 3VFZA 4ETSA 5D5UB 2IA1A 1ZYRF 3BJOA 1OYIA 4G7OF 1D0XA 1ZG3A 3F0CA 3Q0WA 2KHMA 1KU2A 4C2MJ 3VSLA 2CFXA 4M72A 1D8JA 2UZKA 1R4NB 3K4NA 2QUFA 4A3EJ 2F4MB 4F52A 3S14J 2K9LA 5GAEJ 5LGUA 3GTKJ 4AWXB 1AU7A 3JR9A 3QU3A 1IV6A 3HRSA 4IKFA 1S72I 1Y8QB 4OWRB 4U0WA 5GPAA 3IHUA 2RQQA 1XDSA 2GIZA 1V3FA 3TGNA 3FXOA 3LA2A 3JRHA 2DAOA 3CCSI 1BBYA 3OR1C 5JLXA 4OINF 3J7AY 3VEPA 1ITYA 2NNYA 3F3XA 3QOEA 1RR7A 1TT0A 4RGRA 2ZXIA 4P55A 4BQOA 3DXJF 3FHNA 2Z3YA 4RB3C 3H9QA 2MLGA 4BL0B 3F8CA 2DXIA 1RETA 3PO2J 4U7DA 5BS6A 3RKWA 2MC4A 3ZQIA 2ZMEB 4A2UA 5E79C 1SD4A 2Z16A 3DLLF 1WJEA 2KIQA 4CGZA 4YEJA 3BR3A 2PJPA 2OU2A 3GW2A 4NUBA 1RR8C 1XSVA 3KETA 5F08A 3OS1A 2CV1A 2CG4A 3D0SA 3GO5A 4RLQA 1LVAA 1ZRDA 1KU7A 3A0HC 3H35A 4B47A 3OIPA 4JOMA 4NBQA 2NS0A 3HOYJ 2LKXA 3PQKA 4C3JJ 1RC9A 2HEOA 5D5WB 5DS9A 1YJWI 3F22A 5F0CA 3P9KA 3T8RA 3V7CA 1B8IA 3DEEA 4J01A 1G4DA 4YRVA 1POGA 4KT5C 4BY1J 5LBQA 4D0PA 3A01A 3KLNA 2K40A 2V1UA 2VIXA 4HNUA 1JJ6C 1WJ5A 2DPUA 2LREA 1SD5A 3TBIA 4E6KG 3WTSC 3ZPLA 1MIJA 3ERMA 4M3EA 3CDLA 1N77A 2DMNA 1YS6A 5J4VA 3S3MA 2PMHA 5FLXK 4RAYA 5LGNA 2O6GE 1IDYA 2HYJA 1FSHA 1I27A 3LSHA 3K4CA 4BJ5C 1HW2A 2GOXB 4IJAA 3K7AJ 2FQ3A 4IQ4A 2DT7B 4G12A 2JJ7A 3DKYA 1XDUA 4OIQF 1ZHFA 3K10A 1YIOA 4K2EA 2CYYA 4NHJA 4HW0A 1LFBA 5ILVA 2X85A 4J00A 2X1EA 3ZQQA 2ISZA 3HHHA 5IOYA 5D8LB 5IT9Z 4XRSA 2DA4A 2X6YA 4MLOA 1BI2A 2RREA 1FBSA 3JRFA 3OYNA 1NK2P 2AS5F 3MZHA 3KEOA 1LEBA 3BPVA 4NC7A 4KIGA 5IP6A 5E18F 3S1QJ 1T33A 4A3DJ 2BYVE 5FRNA 2DOAA 3MWMA 1VTNC 4BJTA 2M0CA 1YITI 2R7TA 1QPIA 5JVTA 3HRUA 3E7LA 4GYIA 3OYIA 1O3TA 4Y17A 3L2VA 2FX0A 2Z2SB 2HTSA 4KNYA 2F6CA 4HNVA 1AHDP 4MTEA 4FCYA 3S8PA 3A03A 3WU2C 4XNFA 2XIGA 4G8XA 5HS7A 3MQ0A 2H6BA 1S7AA 4ZDPA 3HDDA 1WQ2A 1D5VA 4BU2A 4YFNF 1JUPA 1ETXA 2OZUA 2DMQA 3KYDB 4ZZLA 5D6EA 1N25A 3OYGA 2OBPA 2EZIA 2WAQA 1TBXA 1IN7A 4RB1A 4A3JJ 1QVUA 1Y56A 4B3XA 1YOVB 3TO6A 1UCRA 3FXLA 3Q0UA 3MKYB 4RB0A 3O3KA 1XC5A 1A6QA 2VONA 3DEUA 2ZNYA 2YS9A 2M3AA 3L7WA 2LF7A 5K1YA 3M8JA 2M7AA 1RUOA 1IW7F 4BY7J 3S2DJ 3GFIA 3SEQA 1JE8A 1FWZA 1TW3A 2VLAA 2L4MA 2HOAA 5HS8A 1V54H 3TMOA 5JR3A 3CMYA 4L0YB 3RQIA 3FK6A 3OSFA 1A04A 3JCUC 5HDKA 2PG4A 1XMXA 2BGCA 2ME0A 2IGMA 1V55H 1YQAA 3U21A 1D3YA 2FBIA 1UG2A 2DODA 2ISYA 3FXRA 1FY7A 2R7VA 4F93B 1H88C 1U8RA 2HXOA 4BXFA 4A0ZA 2I5UA 3G1OA 4XOTA 4Y33A 4CO8A 3KIOA 3HHGA 2F5VA 1ENHA 3BCBA 4IL6C 1X3ZB 2FEZA 2ME6A 4IO9F 2TRTA 3LAJA 1YE9A 3LQRA 1GHCA 4W97A 5HNHA 3QPTA 2GQQA 2VASA 3LFUA 4KISA 2QA4I 4ENMA 2R7FA 3PFYA 3FZVA 2E34A 1IV8A 4E7JA 1Z6TA 3OR2C 4KN7X 2RNJA 3NAUA 2XSJC 2JUCA 1ZGJA 3GMEA 4A3FJ 4IHYA 2GXGA 3R61A 3OV8A 2W84A 5E1WA 2DFHA 1BOAA 1D8KA 2R7XA 3G6EI 3F8NA 5JHUA 2Q0OA 4UUSB 4P9FA 4UNOA 3CLOA 4AC0A 1EF4A 2FU4A 2W4SA 3I3LA 1LDKB 4G6TB 4KUMA 2DK5A 3HOZJ 3GYHX 3CJTB 2X6XA 4WXDA 2X6WA 4XL9A 2LOOA 5FKOA 3IUOA 1VF9A 3AG1H 1JGSA 3CC7I 2E7XA 4EM0B 2FXAA 1IRFA 2A68F 3CESA 2VQCA 1PUEE 1R00A 2P81A 2OAZA 3L2RA 2GZWA 4IXAA 3FKIJ 2P4WA 2PQ8A 3F6OA 4L9NA 4G6QA 1OCCH 1GT0C 2EIMH 4HDUA 2FOKA 2KDOA 3EETA 1MGTA 3OL4A 2VT3A 3IC7A 5DM6F 1DDNA 5BPDA 2HFHA 3QQAA 4KA4A 4DOZA 3H5NA 2X9DA 1K78A 4IHWA 4BBRJ 2K4JA 2L01A 1DUXC 2CWEA 4LLNA 2E1MB 1LUJB 2DDAA 3DU6A 3WTTC 1HDPA 1DGWY 1LDJA 1SFOJ 3K4MA 4Y15A 4CHUA 1FEXA 1I50J 4P96A 4A3KJ 1CF7A 4GRIA 4IRGA 5LHHA 2R7QA 4DIQA 1W0TA 3GEZA 2VPRA 5EG0A 2AQEA 3V4GA 3RCOA 5IYDJ 3VYUB 5IYCJ 2MD5A 2QZ8A 1VQOI 3L2UA 2K4BA 5CKTA 4CCOA 2PFBA 1O3QA 3FMSA 1HLVA 1W0UA 4FASD 3N4MA
chains in the Genus database with same CATH topology
4M3BA 3O8GA 2M8GX 2N8GA 1BA5A 2XPWA 3G1LA 5M5WJ 2X48A 3BG5A 1ETQA 3ZQCA 3GTLJ 3SDGA 1MBJA 1YRNA 3I4MJ 1U78A 2LVSA 3JRAA 3HOXJ 5C4JJ 4D7NA 2ID3A 2CUFA 1AKHB 4A3MJ 1RPWA 4V2GA 2KDZA 1A6IA 1RKWA 2MW8A 2ECCA 4JX6A 3PM1A 4M6VA 2CU7A 2XSDC 1X2NA 4DYRA 5FKMA 1IG7A 4XRSG 2R5ZA 5K7HA 1GUUA 5FJ8J 3HOWJ 4DW6A 4ABZA 2EZKA 2NS7A 4S0HB 2L0KA 2NS8A 3OSGA 1OJLA 3BTIA 1JTXA 1P7IA 3CQZJ 2DA6A 5M5XJ 2LK2A 2E2IJ 1ZQ3P 3CCYA 4FE7A 3I4NJ 5DTDA 3C2BA 5M5YJ 1TWHJ 1GVDA 1TC3C 3S1NJ 2QCOA 5EGOA 2NVXJ 5F0HA 2R5ZB 1FIAA 5FKKA 1UHSA 1I3QJ 2DTZA 4DYQA 3S16J 2DA1A 1BW6A 1E3OC 2HOSA 3IH4A 2XB5A 5IP9J 2M34A 4B1RA 4JYKA 1AKHA 5C44J 1IC8A 5K7FA 2E19A 2B63J 2COBA 1OFCX 3WHCA 1A5JA 1YRNB 4AUXA 1MSEC 4EEFG 4FTHA 2H1KA 2I10A 4FISA 1GV5A 1ORKA 1JUSA 2JMWA 3JRIA 3JRDA 5E3NA 5EZHA 2ZB9A 2R0QC 1Y1VJ 2KT0A 1RESA 2EBIA 2JA5J 3HM5A 1APLC 2AO9A 3G1MA 3HGGA 5GP9A 1IUFA 1UMQA 2DA3A 2MGQA 2R7ZJ 4L5EA 4XRMA 2TCTA 4FE4A 1MH3A 1GV2A 3BR1A 5EEAA 1TWCJ 4GFBA 2ID6A 2EQRA 1Y1WJ 1JKRC 2XRLA 3QPSA 2R93J 5E3OA 4QTRA 1WI3A 4JX4A 3S17J 3ZQGA 2JK3A 3A01B 5J1RA 5FLVA 2JA6J 2R5YB 1BW5A 3GTJJ 3HEFA 5IYBJ 1FTTA 1U9OA 3M4OJ 5E3MA 1JJ8C 4A3GJ 1S7EA 2R92J 2RAEA 1MH4A 2MSYA 2AHQA 2VI6A 2K9SA 2M9HA 4MFEA 3F0CA 3Q0WA 2HOTA 1LE8B 2HXIA 4C2MJ 4UUTA 3MVPA 1K61A 4A3EJ 3RZDJ 2VUMJ 2VKEA 3BG9A 3S14J 1F43A 3IV5A 1IDZA 1MSFC 1MNMC 4A3LJ 1T56A 2LFBA 3TP3A 3GTKJ 1FIPA 1AU7A 3DCFA 3JR9A 1MBEA 1IV6A 2E2HJ 2LP0A 3GTMJ 2L7FP 4UUSA 3S2HJ 5GPAA 1ZTRA 1CQTA 5F1JA 9ANTA 1JGGA 2XPUA 1OCPA 3JRHA 5JLXA 3O8HA 1ITYA 5FLMJ 3B6CA 2FJ1A 2QF7A 1RR7A 1JKQC 1Q1VA 1RETA 3PO2J 2LY9A 5FKLA 3ZQIA 1HF0A 1ZR4A 3HGYA 2LR8A 3BR3A 2O7OA 5F08A 4D5FA 2ELKA 3BQZA 2DMPA 1ZKGA 3GTQJ 3HOYJ 2K9QA 2LKXA 4C3JJ 2CQXA 3BR0A 5DS9A 5J3LA 3S1MJ 5F0CA 4D7MA 1MBKA 2IEKA 1ETYA 4C3HJ 3BTLA 2E2JJ 1B8IA 3ZOBA 3A02A 1POGA 2CRGA 2LD5A 4BY1J 4MO7A 2X6OA 2NOGA 3VPRA 3A01A 2H8RA 2XGEA 3JRGA 2K40A 2HQ5A 4I6ZA 1JJ6C 2K9NA 4NDLA 4IHXA 1H8AC 3HOVJ 4M3EA 5C4XJ 2O8KA 3CDLA 2DMNA 1DU0A 2XB0X 2GM4A 1ETKA 1PUFB 1IDYA 2HYJA 3MKLA 3OIOA 2D5VA 3LOCA 2DA7A 2Y0SN 3S15J 2IAIA 3K7AJ 1HCRA 3RZOJ 3OOUA 1GDTA 4G12A 2JJ7A 3GTOJ 2CUEA 2W48A 2L7ZA 2EZHA 2MG4A 1WH7A 4QSHA 4Y7NJ 3S1RJ 3SFIA 1LFBA 1X2MA 1BL0A 5IOYA 3LSGA 3HKZN 5EF6A 1RKTA 4XRSA 5J1UA 1R9TJ 1P7JA 1D5YA 2NVQJ 2DA4A 4MLOA 5JLWA 1MBHA 3JRFA 1FTZA 1I6HJ 2Y30A 3SJMA 1NK2P 2DMUA 3MN2A 5IP6A 3LSRA 2M2EA 2DA5A 1T33A 2O9LA 1JT0A 3S1QJ 4A3DJ 5EDNA 2NVYJ 3DEWA 2GLOA 2XGCA 2M0CA 2GBYA 3LSPA 1MBFA 1K83J 3K2AA 1JTYA 4M3DA 4MIMA 5M3MJ 1QPIA 4J19A 4RBOA 2YU9J 4AYBN 2DJNA 3E7LA 2L7MP 4JP0A 1JT6A 2FX0A 3ZQFA 4HNVA 1AHDP 2L9RA 4FCYA 1FJLA 4XIDA 3A03A 2HI3A 2LLKA 1IJWC 4A3BJ 2E1OA 3HDDA 4CYCA 3PO3J 2VKVA 1OCTC 3B6AA 4M3GA 1B8IB 1HDDC 2EH3A 2EZLA 2JWTA 3BTCA 1NK3P 1JUPA 2OPTA 1ETXA 4C3IJ 2Y9YA 2DMQA 2EZIA 2JN6A 3GTPJ 5E3LA 2WAQN 2YUSA 1HOMA 4A3JJ 1QVUA 3JRCA 2R5YA 1ZR2A 3LSJA 1TWFJ 3Q0UA 2ECBA 3BR2A 5GPCA 1WCMJ 1XC5A 1F36A 2YS9A 3BR6A 3M3YJ 1NTCA 1SANA 3ZQHA 2CJJA 4BY7J 5EYRA 3S2DJ 5F0FA 4IHVA 2LTPA 3QPLA 1ETWA 2HOAA 3CMYA 3RQIA 3WHBA 2WV1A 3FK6A 1PUFA 3OSFA 1LE8A 1VI0A 5F04A 4X1EA 2ME0A 1QRYA 3HB9A 2HDDA 2IBDA 3GBGA 2Y9ZA 3W6VA 3RKQA 1UG2A 3H3VK 1XS9A 4CYCB 5EZGA 2CQQA 1H88C 2HXOA 3G1OA 4DYCA 1WH5A 1IRZA 1VNDA 1ENHA 2Y2ZA 4X6AJ 4MFDA 3ZQLA 2ME6A 2DA2A 1O4XA 5F27A 2TRTA 4BKXA 3IH3A 3JRBA 1IGNA 2DN0A 4A3IJ 3H0GJ 3IH2A 3GTGJ 4W97A 1ZK8A 1QVTA 4Y52J 4DZPA 1DU6A 2PMZN 3NAUA 5FKNA 4RDUA 1XG1A 5IPAA 4A3FJ 4IHYA 3BQYA 1Z0XA 4A93J 5HODA 2WB1N 4UUSB 4M3FA 3BTJA 3Q3SA 4BBSJ 4AC0A 1EF4A 4B3AA 3TEDA 1B72B 5BNGA 5M3FJ 3TP0A 3HOZJ 3L1PA 1JUMA 3NARA 1X58A 1Z77A 3BT9A 1WGXA 5FKOA 5EGOB 3LNQA 1VF9A 2Y31A 3D1NI 1BJZA 5IOZA 3HBLA 1LFUP 5K7ZA 2P81A 1TWGJ 4A69C 1JKOC 1ETOA 3FKIJ 1U9NA 1U8BA 3JREA 4W1UA 4B4CA 1ETVA 1GT0C 1MBGA 1TWAJ 2XPVA 4BXXJ 5EG0B 2XGDA 2FD5A 4IEJA 3QQAA 1WPKA 1B72A 2JA8J 2NVTJ 2X9DA 4IHWA 4BBRJ 3BG3A 4XK4A 4I76A 3UKGA 3TW7A 3Q0VA 3BR5A 1G2HA 5J1YA 3FISA 4JX5A 4DZJA 3HOUJ 4D5CA 4LOCA 1HDPA 1VFCA 2OF7A 2DMTA 1H89C 3FK7A 1SFOJ 4V2FA 1FEXA 1I50J 1ZGWA 4A3KJ 2FQ4A 1JKPC 5C3EJ 2G0EA 1W0TA 2VPRA 5EG0A 3TW6A 5IYDJ 5IYCJ 4QIWN 2JA7J 1HLVA 5IP7J 4XICA 3FIWA 1W0UA 4A3CJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3B A;  3O8G A;  2M8G X;  2N8G A;  1BA5 A;  2XPW A;  3G1L A;  5M5W J;  2X48 A;  3BG5 A;  1ETQ A;  3ZQC A;  3GTL J;  3SDG A;  1MBJ A;  1YRN A;  3I4M J;  1U78 A;  2LVS A;  3JRA A;  3HOX J;  5C4J J;  4D7N A;  2ID3 A;  2CUF A;  1AKH B;  4A3M J;  1RPW A;  4V2G A;  2KDZ A;  1A6I A;  1RKW A;  2MW8 A;  2ECC A;  4JX6 A;  3PM1 A;  4M6V A;  2CU7 A;  2XSD C;  1X2N A;  4DYR A;  5FKM A;  1IG7 A;  4XRS G;  2R5Z A;  5K7H A;  1GUU A;  5FJ8 J;  3HOW J;  4DW6 A;  4ABZ A;  2EZK A;  2NS7 A;  4S0H B;  2L0K A;  2NS8 A;  3OSG A;  1OJL A;  3BTI A;  1JTX A;  1P7I A;  3CQZ J;  2DA6 A;  5M5X J;  2LK2 A;  2E2I J;  1ZQ3 P;  3CCY A;  4FE7 A;  3I4N J;  5DTD A;  3C2B A;  5M5Y J;  1TWH J;  1GVD A;  1TC3 C;  3S1N J;  2QCO A;  5EGO A;  2NVX J;  5F0H A;  2R5Z B;  1FIA A;  5FKK A;  1UHS A;  1I3Q J;  2DTZ A;  4DYQ A;  3S16 J;  2DA1 A;  1BW6 A;  1E3O C;  2HOS A;  3IH4 A;  2XB5 A;  5IP9 J;  2M34 A;  4B1R A;  4JYK A;  1AKH A;  5C44 J;  1IC8 A;  5K7F A;  2E19 A;  2B63 J;  2COB A;  1OFC X;  3WHC A;  1A5J A;  1YRN B;  4AUX A;  1MSE C;  4EEF G;  4FTH A;  2H1K A;  2I10 A;  4FIS A;  1GV5 A;  1ORK A;  1JUS A;  2JMW A;  3JRI A;  3JRD A;  5E3N A;  5EZH A;  2ZB9 A;  2R0Q C;  1Y1V J;  2KT0 A;  1RES A;  2EBI A;  2JA5 J;  3HM5 A;  1APL C;  2AO9 A;  3G1M A;  3HGG A;  5GP9 A;  1IUF A;  1UMQ A;  2DA3 A;  2MGQ A;  2R7Z J;  4L5E A;  4XRM A;  2TCT A;  4FE4 A;  1MH3 A;  1GV2 A;  3BR1 A;  5EEA A;  1TWC J;  4GFB A;  2ID6 A;  2EQR A;  1Y1W J;  1JKR C;  2XRL A;  3QPS A;  2R93 J;  5E3O A;  4QTR A;  1WI3 A;  4JX4 A;  3S17 J;  3ZQG A;  2JK3 A;  3A01 B;  5J1R A;  5FLV A;  2JA6 J;  2R5Y B;  1BW5 A;  3GTJ J;  3HEF A;  5IYB J;  1FTT A;  1U9O A;  3M4O J;  5E3M A;  1JJ8 C;  4A3G J;  1S7E A;  2R92 J;  2RAE A;  1MH4 A;  2MSY A;  2AHQ A;  2VI6 A;  2K9S A;  2M9H A;  4MFE A;  3F0C A;  3Q0W A;  2HOT A;  1LE8 B;  2HXI A;  4C2M J;  4UUT A;  3MVP A;  1K61 A;  4A3E J;  3RZD J;  2VUM J;  2VKE A;  3BG9 A;  3S14 J;  1F43 A;  3IV5 A;  1IDZ A;  1MSF C;  1MNM C;  4A3L J;  1T56 A;  2LFB A;  3TP3 A;  3GTK J;  1FIP A;  1AU7 A;  3DCF A;  3JR9 A;  1MBE A;  1IV6 A;  2E2H J;  2LP0 A;  3GTM J;  2L7F P;  4UUS A;  3S2H J;  5GPA A;  1ZTR A;  1CQT A;  5F1J A;  9ANT A;  1JGG A;  2XPU A;  1OCP A;  3JRH A;  5JLX A;  3O8H A;  1ITY A;  5FLM J;  3B6C A;  2FJ1 A;  2QF7 A;  1RR7 A;  1JKQ C;  1Q1V A;  1RET A;  3PO2 J;  2LY9 A;  5FKL A;  3ZQI A;  1HF0 A;  1ZR4 A;  3HGY A;  2LR8 A;  3BR3 A;  2O7O A;  5F08 A;  4D5F A;  2ELK A;  3BQZ A;  2DMP A;  1ZKG A;  3GTQ J;  3HOY J;  2K9Q A;  2LKX A;  4C3J J;  2CQX A;  3BR0 A;  5DS9 A;  5J3L A;  3S1M J;  5F0C A;  4D7M A;  1MBK A;  2IEK A;  1ETY A;  4C3H J;  3BTL A;  2E2J J;  1B8I A;  3ZOB A;  3A02 A;  1POG A;  2CRG A;  2LD5 A;  4BY1 J;  4MO7 A;  2X6O A;  2NOG A;  3VPR A;  3A01 A;  2H8R A;  2XGE A;  3JRG A;  2K40 A;  2HQ5 A;  4I6Z A;  1JJ6 C;  2K9N A;  4NDL A;  4IHX A;  1H8A C;  3HOV J;  4M3E A;  5C4X J;  2O8K A;  3CDL A;  2DMN A;  1DU0 A;  2XB0 X;  2GM4 A;  1ETK A;  1PUF B;  1IDY A;  2HYJ A;  3MKL A;  3OIO A;  2D5V A;  3LOC A;  2DA7 A;  2Y0S N;  3S15 J;  2IAI A;  3K7A J;  1HCR A;  3RZO J;  3OOU A;  1GDT A;  4G12 A;  2JJ7 A;  3GTO J;  2CUE A;  2W48 A;  2L7Z A;  2EZH A;  2MG4 A;  1WH7 A;  4QSH A;  4Y7N J;  3S1R J;  3SFI A;  1LFB A;  1X2M A;  1BL0 A;  5IOY A;  3LSG A;  3HKZ N;  5EF6 A;  1RKT A;  4XRS A;  5J1U A;  1R9T J;  1P7J A;  1D5Y A;  2NVQ J;  2DA4 A;  4MLO A;  5JLW A;  1MBH A;  3JRF A;  1FTZ A;  1I6H J;  2Y30 A;  3SJM A;  1NK2 P;  2DMU A;  3MN2 A;  5IP6 A;  3LSR A;  2M2E A;  2DA5 A;  1T33 A;  2O9L A;  1JT0 A;  3S1Q J;  4A3D J;  5EDN A;  2NVY J;  3DEW A;  2GLO A;  2XGC A;  2M0C A;  2GBY A;  3LSP A;  1MBF A;  1K83 J;  3K2A A;  1JTY A;  4M3D A;  4MIM A;  5M3M J;  1QPI A;  4J19 A;  4RBO A;  2YU9 J;  4AYB N;  2DJN A;  3E7L A;  2L7M P;  4JP0 A;  1JT6 A;  2FX0 A;  3ZQF A;  4HNV A;  1AHD P;  2L9R A;  4FCY A;  1FJL A;  4XID A;  3A03 A;  2HI3 A;  2LLK A;  1IJW C;  4A3B J;  2E1O A;  3HDD A;  4CYC A;  3PO3 J;  2VKV A;  1OCT C;  3B6A A;  4M3G A;  1B8I B;  1HDD C;  2EH3 A;  2EZL A;  2JWT A;  3BTC A;  1NK3 P;  1JUP A;  2OPT A;  1ETX A;  4C3I J;  2Y9Y A;  2DMQ A;  2EZI A;  2JN6 A;  3GTP J;  5E3L A;  2WAQ N;  2YUS A;  1HOM A;  4A3J J;  1QVU A;  3JRC A;  2R5Y A;  1ZR2 A;  3LSJ A;  1TWF J;  3Q0U A;  2ECB A;  3BR2 A;  5GPC A;  1WCM J;  1XC5 A;  1F36 A;  2YS9 A;  3BR6 A;  3M3Y J;  1NTC A;  1SAN A;  3ZQH A;  2CJJ A;  4BY7 J;  5EYR A;  3S2D J;  5F0F A;  4IHV A;  2LTP A;  3QPL A;  1ETW A;  2HOA A;  3CMY A;  3RQI A;  3WHB A;  2WV1 A;  3FK6 A;  1PUF A;  3OSF A;  1LE8 A;  1VI0 A;  5F04 A;  4X1E A;  2ME0 A;  1QRY A;  3HB9 A;  2HDD A;  2IBD A;  3GBG A;  2Y9Z A;  3W6V A;  3RKQ A;  1UG2 A;  3H3V K;  1XS9 A;  4CYC B;  5EZG A;  2CQQ A;  1H88 C;  2HXO A;  3G1O A;  4DYC A;  1WH5 A;  1IRZ A;  1VND A;  1ENH A;  2Y2Z A;  4X6A J;  4MFD A;  3ZQL A;  2ME6 A;  2DA2 A;  1O4X A;  5F27 A;  2TRT A;  4BKX A;  3IH3 A;  3JRB A;  1IGN A;  2DN0 A;  4A3I J;  3H0G J;  3IH2 A;  3GTG J;  4W97 A;  1ZK8 A;  1QVT A;  4Y52 J;  4DZP A;  1DU6 A;  2PMZ N;  3NAU A;  5FKN A;  4RDU A;  1XG1 A;  5IPA A;  4A3F J;  4IHY A;  3BQY A;  1Z0X A;  4A93 J;  5HOD A;  2WB1 N;  4UUS B;  4M3F A;  3BTJ A;  3Q3S A;  4BBS J;  4AC0 A;  1EF4 A;  4B3A A;  3TED A;  1B72 B;  5BNG A;  5M3F J;  3TP0 A;  3HOZ J;  3L1P A;  1JUM A;  3NAR A;  1X58 A;  1Z77 A;  3BT9 A;  1WGX A;  5FKO A;  5EGO B;  3LNQ A;  1VF9 A;  2Y31 A;  3D1N I;  1BJZ A;  5IOZ A;  3HBL A;  1LFU P;  5K7Z A;  2P81 A;  1TWG J;  4A69 C;  1JKO C;  1ETO A;  3FKI J;  1U9N A;  1U8B A;  3JRE A;  4W1U A;  4B4C A;  1ETV A;  1GT0 C;  1MBG A;  1TWA J;  2XPV A;  4BXX J;  5EG0 B;  2XGD A;  2FD5 A;  4IEJ A;  3QQA A;  1WPK A;  1B72 A;  2JA8 J;  2NVT J;  2X9D A;  4IHW A;  4BBR J;  3BG3 A;  4XK4 A;  4I76 A;  3UKG A;  3TW7 A;  3Q0V A;  3BR5 A;  1G2H A;  5J1Y A;  3FIS A;  4JX5 A;  4DZJ A;  3HOU J;  4D5C A;  4LOC A;  1HDP A;  1VFC A;  2OF7 A;  2DMT A;  1H89 C;  3FK7 A;  1SFO J;  4V2F A;  1FEX A;  1I50 J;  1ZGW A;  4A3K J;  2FQ4 A;  1JKP C;  5C3E J;  2G0E A;  1W0T A;  2VPR A;  5EG0 A;  3TW6 A;  5IYD J;  5IYC J;  4QIW N;  2JA7 J;  1HLV A;  5IP7 J;  4XIC A;  3FIW A;  1W0U A;  4A3C J; 
#chains in the Genus database with same CATH topology
 3RTR A;  3FM5 A;  3H1C A;  2QKM B;  3OYM A;  2N8G A;  3G1L A;  1J59 A;  2CW8 A;  1F9N A;  2VXZ A;  2X48 A;  1IN4 A;  1TNT A;  3WTX C;  3JAM K;  1VQM I;  1ETQ A;  2UXX A;  3DPU A;  1MBJ A;  1EKE A;  4FET A;  1LPQ A;  2Q8K A;  2EV5 A;  4CIC A;  2ID3 A;  1AOY A;  5GAG J;  4M9Z A;  2CUF A;  3H36 A;  3OWT A;  4LB5 A;  2Z5U A;  2CU7 A;  2P6S A;  2QEN A;  4LLG F;  4EVI A;  4Y4R A;  1I5Z A;  1K4T A;  5GAH J;  4C2T A;  4JQF A;  4ZYA A;  4S0H B;  5E1Z B;  3M7G A;  4EJV A;  2KRF A;  1OJL A;  3BJ6 A;  3OSG A;  5M5X J;  1IXR C;  3IAM 2;  5DYM A;  2ZCW A;  3FXJ A;  3I71 A;  4I2O A;  1MJ9 A;  5M5Y J;  2OTL I;  3F6V A;  1TC3 C;  2E5Z A;  2FBH A;  4EMS A;  2WAD A;  4CA0 A;  2OCE A;  4UV8 A;  3PUF A;  2DTZ A;  2ADU A;  5FKK A;  4BNC A;  3A0B C;  1BW6 A;  2XV4 S;  2VQH A;  2W57 A;  1FLI A;  4ZZD A;  2GXB A;  2R7R A;  2M34 A;  2M4G A;  4JYK A;  1AKH A;  2W24 A;  5C44 J;  5K7F A;  2DFF A;  2V6E A;  2VBY A;  3O6B B;  3WHC A;  3KZI C;  4QWQ A;  1A5J A;  2H1K A;  1YS7 A;  2P6T A;  2I10 A;  4FIS A;  5LLQ A;  1T39 A;  3QYB A;  2JMW A;  4PSW A;  3OYJ A;  3N05 A;  4O3M A;  1T0F C;  5CQE A;  3ZMU A;  1Y1V J;  2STW A;  4LG3 A;  4B43 A;  2AXT C;  3HM5 A;  2AO9 A;  3I58 A;  3HGG A;  1YI2 I;  1PYV A;  3DBH B;  2IS2 A;  2MGQ A;  2DBB A;  3K4L A;  5EEH A;  5D4S A;  5JVG F;  1MJA A;  3G73 A;  2OZ6 A;  1GV2 A;  3BR1 A;  3U2R A;  4RGU A;  5FO5 A;  5IY5 H;  5LD2 C;  3WGH A;  2XRN A;  1TQM A;  1Y1W J;  1JKR C;  3DF8 A;  2R93 J;  1Z21 A;  2KMU A;  2MYS A;  2XKO A;  3A01 B;  5FLV A;  2D1V A;  1TW2 A;  3CC4 I;  3M4O J;  4A3G J;  3ZN1 A;  1S7E A;  3TOA A;  2RAE A;  4II3 A;  3ZGK A;  3JTH A;  4XLN F;  5E17 F;  1J09 A;  5H2F C;  2K9S A;  2JQ7 A;  1WJB A;  1LE8 B;  4L18 B;  4IX7 A;  2VE8 A;  3EUA A;  4ZYG A;  5HS9 A;  1QNT A;  3MVP A;  1SMY F;  4RB2 C;  2VKE A;  1F43 A;  1DP7 P;  3RYR A;  1FT9 A;  2H27 A;  2RKH A;  3J80 K;  4A3L J;  1DP3 A;  3TP3 A;  1RZ4 A;  2LFB A;  1KQ0 A;  4UVC A;  4U0Y A;  4KN4 X;  4OAY A;  4HLY A;  1MBE A;  2M4K A;  2IVM A;  2LP0 A;  4PJM A;  3GTM J;  2OJE D;  4UUS A;  2XF6 A;  3S2H J;  1ZTR A;  2V7F A;  1S9H A;  3TQN A;  1Z1D A;  3KPH A;  3DLA A;  3ZRG A;  2RVC A;  1G59 A;  2XPU A;  1OCP A;  2V9P A;  4GYG A;  3DBL B;  3LA3 A;  1MMN A;  3B6C A;  3H3U A;  2FJ1 A;  1RUN A;  1UST A;  4A6D A;  1QBJ A;  2CH0 A;  5IT3 A;  4CDG A;  1IRG A;  3I0T A;  2F5F A;  5FKL A;  2DPD A;  3H92 A;  2LF8 A;  2HOE A;  4AID A;  3K4J A;  2BVL A;  5CVJ A;  2JVH A;  4LJZ F;  2ZXW H;  1FYM A;  2R3S A;  1UG0 A;  3SDB A;  3BCA A;  4YIF A;  1R5I D;  3GTQ J;  4KIB A;  1BJA A;  3V8L A;  4U88 A;  3DV8 A;  5E20 A;  3BR0 A;  1Z7L A;  4PJL A;  5LHI A;  1LJ9 A;  3S1M J;  4EGY A;  1MBK A;  3HL2 A;  3CCR I;  1BIA A;  3V7S A;  5H6Q A;  1ZRF A;  2O61 A;  2X4H A;  1O7F A;  3RJP A;  2CV2 A;  5HLI A;  1R7J A;  2VJ4 A;  4MO7 A;  3IKT A;  3BOQ A;  3VPR A;  5B1A H;  4ZTF A;  2XGE A;  2CV0 A;  4A5N A;  2D1H A;  4I6Z A;  4AM3 A;  2XVC A;  2K9N A;  1JXS A;  3CO7 C;  4NDL A;  1OYY A;  2VC0 A;  3HOV J;  2DOF A;  3PQJ A;  4HRI A;  3PNY A;  3CZ6 A;  1Z67 A;  4LD5 A;  3ZQ7 A;  2LKP A;  4EM2 A;  5CYV A;  3ISP A;  5KVR A;  1PUF B;  2EFW A;  3KX2 A;  5L3D A;  3OIO A;  2D5V A;  4WK8 F;  3LWF A;  2DA7 A;  1YHQ I;  1QZZ A;  4EJT A;  5HOO A;  1EH8 A;  2CW0 F;  3HRT A;  2K3F A;  3KCC A;  3U9G A;  1GDT A;  1FBQ A;  2BE5 F;  4MTD A;  2CUE A;  2ACJ A;  1D0Z A;  2L7Z A;  3GWZ A;  2Z1D A;  4Y7N J;  3S1R J;  3SFI A;  4E7S A;  5DD8 A;  5DEQ A;  2XAJ A;  1SFX A;  2GA1 A;  3HKZ N;  2CMP A;  1ZAO A;  4N4O B;  5EF6 A;  1LQ1 A;  1P7J A;  1X1D A;  4HF2 A;  4AU7 A;  4R79 A;  2IRF G;  2NVQ J;  3AFH A;  1MBH A;  2L9N A;  4RGS A;  2LH9 A;  1AWC A;  4RLF A;  1I6H J;  3UNG C;  2K02 A;  3MN2 A;  1BM9 A;  2L4A A;  4ESJ A;  3LSR A;  2M2E A;  4A6E A;  5EDN A;  3KP2 A;  3AAF A;  4CUG A;  1O57 A;  3F72 A;  1WKM A;  4IHT A;  2GLO A;  5E8G A;  1BIB A;  3LSP A;  5M3M J;  3F23 A;  4J19 A;  2DJN A;  2VT2 A;  3FXM A;  3E1S A;  2VBX A;  3TO9 A;  1HA8 A;  2DK8 A;  2HR3 A;  3ZQF A;  2K3P A;  2Y0M A;  2L9R A;  2STT A;  1FJL A;  5HLH A;  3OY9 A;  2GIV A;  1OPC A;  2LRD A;  4IQJ A;  1IXS B;  4A3B J;  2WTE A;  4ZYE A;  4M3G A;  2HU9 A;  4IRH A;  2EZL A;  3DTK A;  1TQP A;  2OD5 A;  4C3I J;  4HQM A;  3ESW B;  2EB7 A;  1IN8 A;  1Y39 A;  2X1C A;  3FXU A;  1K79 A;  4P1W A;  4PUS A;  2EIJ H;  1P92 A;  3F21 A;  1YO5 C;  5IT9 K;  2WAQ N;  1HOM A;  1GVJ A;  3JRC A;  1VQL I;  2HQR A;  4XLF A;  1X4O A;  1TWF J;  1XGM A;  3BR2 A;  2A6H F;  2VN2 A;  1F36 A;  4CCN A;  3ABK H;  1Z3X A;  3BR6 A;  1H9T A;  1FP1 D;  1SAU A;  1Y0N A;  4LIT A;  2KZV A;  1SAN A;  3BWG A;  5B66 C;  2G7H A;  4IRI A;  1VQ4 I;  5CVU A;  3MCZ A;  1T0F A;  3GX4 X;  3HOS A;  2OUM A;  2VBZ A;  3QPL A;  2CQN A;  3X2Q H;  4OIP F;  2MFZ A;  4BQA A;  5KK1 A;  3ZMS A;  1PUF A;  2WA0 A;  4LGW A;  5F04 A;  1QRY A;  1R23 A;  3HRM A;  2XDV A;  2IBD A;  1Z91 A;  3HB9 A;  3GBG A;  5CQG A;  3SHF A;  3W6J B;  2Y9Z A;  5HDN A;  2V4J C;  1IRX A;  4WX9 A;  2OA4 A;  5D5X B;  3CF2 A;  3H3V K;  2BW3 B;  1M1E B;  3CDI A;  1O3R A;  3FX3 A;  4M6Y A;  2E7W A;  1WH5 A;  1IRZ A;  2QSG X;  3IAS 2;  3ZQL A;  2QEX I;  2VQG A;  4LB6 B;  4XRF A;  4BKX A;  2ZME A;  3IH3 A;  3JRB A;  3C3W A;  3BLY A;  2MBF A;  4ZC3 A;  1R1V A;  2FF4 A;  3GTG J;  3GZ5 A;  1XCV A;  4ESF A;  1OR7 C;  3DQV C;  3WGG A;  2PBI A;  2VQL A;  4DZP A;  1TL8 A;  3E6D A;  1DU6 A;  4H4K C;  5L3B A;  3WTV C;  5EJC A;  3CCQ I;  3RKX A;  3V8J A;  1XG1 A;  5IPA A;  3G4S I;  4E7K A;  3BQY A;  5HOD A;  2WB1 N;  1WWX A;  3NWS A;  3G71 I;  3Q9S A;  5ICF A;  2O0Y A;  1VQ9 I;  3ELK A;  4EAT A;  3SYT A;  4BHB A;  5BNG A;  2ZXH A;  4N9H A;  3GVA A;  1R1T A;  1VQ6 I;  1MMS A;  3L1P A;  3HKZ A;  3ABL H;  2VJ5 A;  1X58 A;  1WGX A;  4MEY F;  2CSO A;  3S32 A;  3LNQ A;  3VDX A;  3CP8 A;  1MMG A;  2Y31 A;  2P5V A;  1AA7 A;  2H8W A;  2FNA A;  1LFU P;  4NQW A;  4I09 A;  3QOP A;  4HPQ A;  3SZT A;  2GOM A;  2B7E A;  4BGD A;  1U8B A;  3JRE A;  1W5C C;  4E7I A;  1TWA J;  3QP5 A;  2K9M A;  5D6F A;  2IGK A;  4BXX J;  3KP4 A;  3KP6 A;  1OYW A;  4IEJ A;  1MMD A;  2W25 A;  4XON A;  3QYF A;  2Y48 A;  2BW3 A;  3LFK A;  3GLL A;  3AG4 H;  1YJN I;  2H09 A;  4NC8 A;  2JSP A;  4ENN A;  1B9N A;  4B8X A;  3LSK A;  3ERE D;  1ZGA A;  4E4H A;  1TLH B;  3TW7 A;  2QLZ A;  3BR5 A;  5F64 A;  1G2H A;  2PEX A;  3D5S C;  4JX5 A;  1Z7U A;  3HOU J;  4LOC A;  1VFC A;  2OF7 A;  2DMT A;  4RAF A;  1FMV A;  2A07 F;  3BZK A;  4E70 A;  2A61 A;  1ZGW A;  2DOE A;  5BMZ A;  2O5R A;  5C3E J;  1QO0 D;  3I5U A;  1ZRE A;  1J7K A;  4L5J A;  5LHG A;  2G9W A;  3EUK L;  2G0E A;  4M71 A;  3KYL A;  4IZZ A;  1IUY A;  5HLT A;  1XMK A;  1J9I A;  4HA8 A;  1F5T A;  5IP7 J;  3FIW A;  3HUG A;  3BP8 A;  4M3B A;  1NHA A;  2M8G X;  5BPI A;  2PX9 A;  2XPW A;  2WWY A;  1U0J A;  1IAW A;  2QKL B;  2HDC A;  1T6S A;  5J40 A;  3OYA A;  1XN7 A;  3H5R A;  1P4X A;  3E97 A;  2EV6 A;  2F5C A;  1YX5 A;  2NAZ A;  2ZJ2 A;  3BDD A;  2P5K A;  2M7B A;  2F5D A;  1U78 A;  2LVS A;  2PMZ A;  2VB6 A;  2OQR A;  2YU3 A;  1AKH B;  4XKB A;  1RPW A;  4C9Y A;  2KDZ A;  1RKW A;  1RI7 A;  1VQ7 I;  4XN3 A;  3O2P E;  4JX6 A;  3PM1 A;  5KAF C;  1LFP A;  1P4W A;  1XSX A;  1X3W B;  1IG7 A;  2OTJ I;  1IN5 A;  4IPA A;  3FKJ A;  1R22 A;  5K7H A;  3OIQ A;  3EQL F;  1LDD A;  3HOW J;  4ABZ A;  2CW7 A;  2EZK A;  4G7Z F;  4HF0 A;  2DA6 A;  3WG9 A;  2E2I J;  3CJR B;  2EA4 A;  4FE7 A;  3I54 A;  4L9V A;  4LK0 F;  5DTD A;  3I4N J;  3C2B A;  5LEJ A;  1TWH J;  1XSD A;  3S1N J;  4EGZ A;  1FIA A;  1R36 A;  2ZKZ A;  1UHS A;  1I3Q J;  3S16 J;  3ROU A;  4N4N B;  2WY8 Q;  2HOS A;  3IH4 A;  3OYD A;  2X0L A;  4XMY A;  4WXC A;  3COA C;  2KZG A;  2F4I A;  2ZBK A;  3A2K A;  4DQ2 A;  4CYD A;  1ZH5 A;  2IA2 A;  3WGI A;  4Q47 A;  2ETH A;  2VC1 A;  1IC8 A;  3E6C C;  3HSF A;  1OFC X;  4QLC U;  2UV1 A;  2XAU A;  4FTH A;  2G7U A;  2KPM A;  1JUS A;  3JRD A;  5E3N A;  2NNN A;  1OR7 A;  3LQQ A;  3CME I;  1FOK A;  2KT0 A;  1RES A;  1P9Q C;  5FGM A;  3BRO A;  3C7J A;  3REO A;  3CC2 I;  1QZY A;  1Z05 A;  2IXS A;  5GP9 A;  2MH9 A;  2MH2 A;  1UMQ A;  2DT6 A;  5KCM A;  4XRM A;  4IF4 A;  4E7L A;  2BOL A;  4FE4 A;  3FWE A;  4I01 A;  1MH3 A;  5EEA A;  5D5V B;  4GFB A;  2ID6 A;  2EQR A;  3Q5F A;  2DLL A;  2JPB A;  2BV6 A;  3CP2 A;  3QPS A;  3S17 J;  3CUQ B;  1D1A A;  4RGX A;  4RS8 A;  1SMT A;  2BZT A;  3QWL A;  2JA6 J;  2R5Y B;  3U1D A;  1QGP A;  3T0Y A;  2JVG A;  2RV8 A;  1U5T C;  3NEU A;  2DJI A;  2ZFW A;  2R4G A;  3E3V A;  3BY6 A;  2R92 J;  2XUB A;  1MH4 A;  1IZ1 A;  1ZEL A;  2YPR A;  2DYR H;  4ZYH A;  4KIT B;  2M9H A;  3PIO F;  2HOT A;  5GAD J;  1PP8 F;  3EPZ A;  3GUD A;  2IGO A;  1VQ5 I;  4UUT A;  3IKV A;  4HV5 A;  4ZYD A;  1N78 A;  5ILS A;  2VUM J;  2DI3 A;  2AXL A;  3VYT B;  1MNM C;  3CUQ C;  5LFA A;  1U3E M;  1IO2 A;  1R49 A;  2VOD A;  3DCF A;  3J81 Z;  4GDF A;  3E6B A;  4R8H A;  1U2W A;  3EYY A;  4GO1 A;  5FD6 A;  3D5L A;  3HTS B;  1E0E A;  1ZLJ A;  2BVM A;  3C18 A;  1KA8 A;  1R4M B;  1MDM A;  2RNG A;  4HOB A;  4DJA A;  1S7O A;  4GCV A;  1USS A;  2KL4 A;  4LK1 F;  4P5O A;  5FFX A;  4ENK A;  1ULY A;  3ZP5 A;  2H94 A;  4M6X A;  2KIF A;  2QF7 A;  1SEU A;  1BI3 A;  3W2V A;  1FP2 A;  1FMW A;  2ZJP F;  2CQ7 A;  3RPU A;  1ZG1 A;  1FYL A;  3IRQ A;  1Q1V A;  2JT1 A;  4KMF A;  1HF0 A;  5J47 A;  1ZR4 A;  1FPQ A;  2LR8 A;  1I3A A;  4Q4Z F;  2EIK H;  1R6R A;  4LMY A;  3HTU A;  4BUP A;  1UJ8 A;  3SEZ A;  4OAZ A;  1BR1 A;  3TKY A;  4D5F A;  2IA0 A;  3BQZ A;  1CF7 B;  5ICC A;  3DU5 A;  1SD7 A;  4FX4 A;  3TDU C;  4FQG A;  2K9Q A;  4HZF A;  5H6R A;  2CQX A;  2E36 A;  5CPR B;  3WTZ A;  5J3L A;  3GZ6 A;  4D7M A;  3FM3 A;  2IEK A;  1ETY A;  2E2J J;  1MND A;  3ZOB A;  3A02 A;  2LD5 A;  3TO7 A;  1W5S A;  1W5T A;  3CD6 I;  2X6O A;  2XAS A;  3L9F A;  1HQC A;  3MD2 A;  3WTU C;  1A36 A;  1D1B A;  2HQ5 A;  5B5E C;  1OCZ H;  3NWT A;  1QQI A;  2F4O B;  4BS9 A;  3CMA I;  2P8T A;  3WTW C;  2WAF A;  2WAE A;  1QA6 A;  2CQK A;  3R6S A;  1NH3 A;  2L9S A;  2X1D A;  1S3J A;  3DWL E;  3KP3 A;  5ED4 A;  3T1B A;  5HLG A;  4PK4 A;  4HQE A;  3E5X A;  3GFL A;  3NQO A;  5BOX A;  3U1K A;  3LOC A;  4NB5 A;  3S15 J;  2RN7 A;  2VOO A;  4PJ0 C;  2IAI A;  3LSI A;  1HW1 A;  4XN0 A;  3RZO J;  4BXU A;  3ECO A;  3K1M A;  2QQB A;  1FX7 A;  1KGS A;  5A2Q Z;  1H9G A;  1SC7 A;  4UB8 C;  1E3P A;  2L9V A;  4M9S A;  4QSH A;  1WH7 A;  1OIS A;  1G8X A;  3E0J B;  4HYE A;  5GTI C;  3B73 A;  4XLA A;  1R9T J;  1D5Y A;  3H9J A;  1HKS A;  4EV0 A;  1VZ0 A;  2ZSH B;  1KZH A;  5HVQ C;  3WU1 B;  1K6Y A;  1S8N A;  2Y30 A;  4PFP A;  2XAH A;  5K5O A;  1O7L A;  3PL8 A;  3E6M A;  3OYK A;  2O9L A;  2BXZ A;  1JT0 A;  4XKW A;  5L3F A;  3WE2 A;  4BJ6 C;  3DEW A;  1QHG A;  2HZT A;  2GBY A;  3I4P A;  3M8E A;  1MBF A;  4M3D A;  4MIM A;  4CZZ A;  4RBO A;  2YU9 J;  2JTV A;  4OIR F;  3P5J A;  4I99 C;  5J8C A;  2KIS A;  1SAX A;  4JP0 A;  1JT6 A;  3ABM H;  4OMZ A;  2IP2 A;  2W85 A;  1Y6I A;  3PSI A;  4L9J A;  1OMI A;  1W7P D;  1HKT A;  4XID A;  3MMY B;  1K6O A;  1Z6R A;  2HI3 A;  2LLK A;  3F9K A;  1IJW C;  1TZL A;  2IPQ X;  1XD7 A;  1IXC A;  3QYE A;  3AKZ A;  1DPR A;  1YX3 A;  4CYC A;  2LG4 A;  2VKV A;  3B6A A;  5A2Q K;  1B8I B;  1OCT C;  2A3S A;  2JWT A;  3BTC A;  4UVB A;  1T08 B;  4CSW A;  1MD0 A;  3S93 A;  2Y9Y A;  1FYK A;  2IS1 A;  1HC8 A;  2KIM A;  2RGV A;  3GTP J;  1X1A A;  2R5Y A;  2AQF A;  3LSJ A;  4I02 A;  3RSN A;  1Z3Y A;  2ESN A;  1XX5 A;  1KYZ A;  3L2C A;  2ZME C;  1WCM J;  3MKW B;  2RQP A;  2EIL H;  1EV7 A;  3KEY A;  1I1G A;  1MKM A;  3I64 A;  3I9V 2;  3HYI A;  3BG6 A;  2XAF A;  4ZH4 F;  1WJA A;  2CJJ A;  2JRM A;  4IHV A;  5AON A;  2NOJ B;  3VOE A;  2LYC A;  5DCM A;  1WVR A;  4MNU A;  3GZN B;  2LY1 A;  2WV1 A;  4RM2 A;  1LE8 A;  2W7N A;  1J0R A;  4X1E A;  2HDD A;  4U87 A;  5LGT A;  3K6G A;  3PNT A;  3ASO H;  3LSM A;  1Y8R B;  2EFP A;  4DBQ A;  2Z9O A;  2LKS A;  1ONV A;  4CYC B;  4M74 A;  5L3E A;  3LMM A;  4UVA A;  3TOB A;  5FB2 A;  3RPQ A;  4DYC A;  3RKY A;  1VND A;  4X6A J;  4MFD A;  2HTJ A;  2V9V A;  5F27 A;  2HYF A;  2OC6 A;  2DN0 A;  1T95 A;  1SD6 A;  3IH2 A;  4F55 A;  2BXY A;  2LY2 A;  5D8K B;  1ZK8 A;  4Y52 J;  3MKZ A;  3N97 A;  1UEL B;  4YFX F;  3M07 A;  1SFE A;  2FMY A;  1KYW A;  3DPL C;  3V8K A;  3K4K A;  4S04 A;  1HKQ A;  5LRS A;  3OYH A;  4OU0 A;  2IJL A;  4RDU A;  2K5C A;  4CXF A;  5GTH C;  1R71 A;  4IOA F;  2FNP A;  3E5U A;  3L2Q A;  4CCK A;  4U7B A;  4A12 A;  2CGP A;  4FHT A;  5HNF A;  4A93 J;  1GLN A;  1R1U A;  2QWW A;  4C2U A;  2ICW G;  4AIJ A;  4M3F A;  2HGC A;  4UB6 C;  5CJ9 A;  3K4B A;  2JPC A;  5B1B H;  3RQ4 A;  1Y0U A;  2EIN H;  4HX4 A;  3ZMD A;  3J7Z I;  1XGN A;  2FE3 A;  1F4K A;  2PMU A;  3VSK A;  3DFG A;  1JUM A;  4KIF A;  3BT9 A;  1QPM A;  1X19 A;  4ZJZ A;  4AVP A;  5EGO B;  3I59 A;  2FSW A;  3D1N I;  3PIP F;  4KDP A;  1WJC A;  2XHK A;  5IOZ A;  3HBL A;  1ZAR A;  2QSH X;  2D2W A;  1SVO A;  4L9T A;  1B59 A;  5K7Z A;  2ZJR F;  1TWG J;  2XAG A;  4A69 C;  4PCQ A;  4G7H F;  1BR2 A;  4B4C A;  1ETV A;  3EDP A;  4S05 A;  2C6Y A;  2DDB A;  2MA3 A;  1MBG A;  3ONQ A;  1V4R A;  4MHG A;  2L54 A;  2XPV A;  2KIU A;  2E71 A;  4Y13 A;  2FUG 2;  2NYX A;  3KZY A;  2XGD A;  2HVR A;  3SZP A;  3BZC A;  1WPK A;  4BQQ A;  1B72 A;  2JA8 J;  2O03 A;  2NVT J;  3BG3 A;  1L0O C;  2UUZ A;  2W1O A;  3T8T A;  2ZNZ A;  4M9X A;  2Y0S A;  2XF5 A;  4CCM A;  3K70 C;  3UKG A;  3HJE A;  3CDH A;  4HNT A;  4N9I A;  2WC2 A;  3RYP A;  5J1Y A;  3GFJ A;  4DZJ A;  4D5C A;  2M45 A;  3JW4 A;  4BDZ A;  3G2B A;  2A6E F;  4HSR A;  5HDG A;  4M73 A;  2FQ4 A;  1R5G A;  1JKP C;  2DQL A;  1HBX G;  5DCM B;  1FOW A;  1X4P A;  4PSX A;  3TW6 A;  2MAB A;  1B9M A;  2Q1Z B;  2JA7 J;  1RIO H;  4C30 A;  4EM1 A;  2F2E A;  2ESH A;  4XIC A;  4A3C J;  3A1Y A;  5FFZ A;  2ELJ A;  1BA5 A;  1A35 A;  3SQN A;  2Z33 A;  2ZC2 A;  2V1N A;  5M5W J;  3R4K A;  2FRH A;  2NVU B;  1FBU A;  3KEQ A;  5LRR A;  2NRA C;  2QSF X;  3PFI A;  4UHT A;  3LA7 A;  3BG5 A;  1GXQ A;  4MEX F;  3EYI A;  4P9U A;  1T8I A;  2HYG D;  4NC6 A;  3CCU I;  3SDG A;  3J7A O;  3JRA A;  5E1X A;  3HOX J;  1SFK A;  4D7N A;  3ECH A;  1TNS A;  3CMM A;  3ABT A;  3K70 D;  4Q5S F;  1YLF A;  1A6I A;  2MW8 A;  3T5X A;  2ECC A;  4DBR A;  3CCE I;  4M6V A;  1BR4 A;  4CZC A;  2XSD C;  4HX8 A;  1X2N A;  1FOX A;  1LNW A;  1WJF A;  1KU3 A;  1W1W E;  5DV5 A;  2IS4 A;  2HVQ A;  5TIS C;  3S2W A;  4X0G A;  2VKD A;  2JRT A;  2NS7 A;  3ASN H;  3CJN A;  4F7Z A;  2L0K A;  5L3C A;  2NS8 A;  4EJO A;  1JTX A;  3GCM A;  3CQZ J;  4XBF A;  3WG7 H;  2LK2 A;  1ZQ3 P;  3CCY A;  3NRV A;  3HG9 A;  2XRO A;  1GVD A;  1A31 A;  1ZG5 A;  5EGO A;  2IGN A;  2XF7 A;  2R5Z B;  2CUJ A;  4WWC A;  1RRJ A;  2DA1 A;  1FOY A;  1E3O C;  4UUV A;  1TQI A;  4IHS A;  2E1N A;  5JI6 A;  4Z2Y A;  2ZXJ A;  4B1R A;  3R0A A;  4LIU A;  3QRF F;  1WFX A;  2DU9 A;  4XR6 A;  5L3G A;  2B0L A;  3L09 A;  4XLP F;  1YRN B;  1QHH D;  4EEF G;  3BG7 A;  3KZZ A;  2A6T A;  1GV5 A;  2QYO A;  3JRI A;  4MQV A;  2HDW A;  5EZH A;  2ZB9 A;  2E5N A;  3OS0 A;  1YFH A;  3ZMT A;  2JA5 J;  1APL C;  3VWB A;  2VL8 A;  2FML A;  2QQA A;  3CLQ A;  1I6X A;  3Q9V A;  2XC7 A;  3F8M A;  5CVR A;  2UXN A;  5FD5 A;  2PJR A;  3W2A A;  4LLL A;  1NG7 A;  1YW7 A;  2DA3 A;  4XM3 A;  2K7L A;  2DT5 A;  4L5E A;  1ODD A;  3FDY A;  3OYE A;  3HSR A;  2DCE A;  4KT6 A;  5JFR A;  4EQQ A;  3LL7 A;  1YIJ I;  2P5L C;  1G3T A;  3M1E A;  4GGG A;  1TWC J;  3VYS B;  3JSP A;  1DQU A;  4G9Y A;  2OCC H;  2WB1 A;  5E3O A;  1MMA A;  1WI3 A;  3P7N A;  3ZQG A;  2JK3 A;  5ICG A;  5J1R A;  2ZJQ F;  3EUH A;  3GTJ J;  1BW5 A;  3V42 A;  5IYB J;  3CCM I;  1U9O A;  1BI0 A;  2MLK A;  3L2W A;  5J6X A;  3FHZ A;  2KKO A;  2MSY A;  1EH7 A;  4R1H A;  5DDG A;  3C1D A;  4AVZ A;  2AHQ A;  2GXA A;  1DGR M;  2VI6 A;  4ENJ A;  3B02 A;  4MFE A;  2YSR A;  3RIR A;  2JZY A;  3DPT A;  2XKP A;  1KU9 A;  2HXI A;  2LBF A;  1B4A A;  4L0Z B;  1P2F A;  1E2X A;  4BHC A;  1K61 A;  4ITV A;  3RZD J;  5J8F A;  3FBI B;  2GA2 A;  1E3H A;  3BG9 A;  4HST A;  3IV5 A;  1O3S A;  1SFU A;  2EV0 A;  1IDZ A;  1MSF C;  1FSE A;  4BAY A;  1XB4 A;  4A0X A;  3SZG A;  1T56 A;  2QBY B;  3CJQ B;  3J7Y J;  1FIP A;  2HZD A;  4BEH A;  1BN5 A;  3K1P A;  3I55 I;  1BC8 C;  2ELH A;  2E2H J;  2Q2E B;  4ANJ A;  4WXH A;  3ZXS A;  2L7F P;  1CQT A;  4BYY A;  1V5F A;  4OOI A;  3K69 A;  5F1J A;  5DUK A;  4IVN A;  1JGG A;  2R7S A;  9ANT A;  3WE3 A;  4OMY A;  1L3L A;  1T98 A;  2J5P A;  2O8X A;  2EWN A;  2CS3 A;  3ZMZ A;  2XAQ A;  3O8H A;  5FLM J;  3C2H A;  3IP4 B;  5BQT A;  4XLH A;  1U5T A;  1TP4 A;  3RPU D;  3OYB A;  3H3Z A;  1VQ8 I;  2IW5 A;  1JKQ C;  2HQN A;  5DCF A;  4KFC A;  2IS6 A;  2LY9 A;  3AL0 C;  1PVE A;  5DD4 A;  1SVM A;  3HGY A;  4MGR A;  4UY8 I;  4DNC A;  4B09 A;  1N75 A;  2O7O A;  3K0L A;  2E60 A;  2M87 A;  4CCJ A;  1KQ9 A;  2H1L A;  2LNB A;  4NNJ A;  2QQ9 A;  2ELK A;  4ZDO A;  3MFK A;  2JSC A;  4XKV A;  4F91 B;  4BE0 A;  2DMP A;  2VPL A;  1T38 A;  1Z9C A;  1ZKG A;  1FNN A;  2L3D A;  3QOD A;  4I98 B;  2OQG A;  5H20 A;  1V5E A;  1MNE A;  2BHZ A;  2HS5 A;  4C3H J;  3BTL A;  4F92 B;  1REP C;  4GXO A;  2EA2 A;  1WZ2 A;  1JHH A;  2CRG A;  4ZDL A;  1VQP I;  2NOG A;  2H8R A;  2XGX A;  3JRG A;  2BY2 A;  3MEX A;  3SXY A;  5KNL A;  4A5M A;  2QM3 A;  3KLO A;  2FA5 A;  3UR3 C;  1ERD A;  3JSO A;  4BAC A;  4IHX A;  1H8A C;  3HOT A;  4KYW A;  5C4X J;  2O8K A;  1EA3 A;  1ON2 A;  4LG0 B;  4Z6Y A;  3KP5 A;  1DU0 A;  2M8E A;  1W4M A;  1J2X A;  1G3Y A;  3S3N A;  3LAP A;  2KFD A;  2XB0 X;  4YG2 F;  2GM4 A;  1ETK A;  3PNV A;  3S3O A;  1HXD A;  2QVO A;  3MKL A;  4O5V A;  2Y0S N;  1F1Z A;  1OLT A;  2FOW A;  2GAU A;  4UV9 A;  4XSX F;  1HCR A;  5AIP A;  1E17 A;  3OOU A;  1HST A;  4HX7 A;  3ZR8 X;  2BEO A;  3IWZ A;  4BHP A;  3GTO J;  1D1C A;  3C2G A;  3K1N A;  2W48 A;  2VOP A;  2EZH A;  2MG4 A;  1QU3 A;  2LSO A;  1OCR H;  1X2M A;  2M1B A;  1BL0 A;  2OV7 A;  2V79 A;  1OCO H;  3CTA A;  3LSG A;  1RKT A;  4HG2 A;  4XOR A;  5J1U A;  4H0E A;  1YJ9 I;  2YX4 A;  5JLW A;  4WF2 A;  1FTZ A;  4CCL A;  3SJM A;  4IOC F;  2DMU A;  3IL2 A;  1G6N A;  2P0W A;  4PDK A;  2LC2 A;  2DA5 A;  3R60 A;  1WRJ A;  5KAI C;  4PGG A;  2NVY J;  4F3Q A;  2KJB A;  2DO7 A;  2K85 A;  2XGC A;  2D45 A;  2PN6 A;  4L5I A;  4RAG A;  3K2A A;  1K83 J;  3DKX A;  1JTY A;  2V26 A;  4LG0 A;  5FLX Z;  2V9K A;  4AYB N;  1HSJ A;  2L7M P;  5KHD A;  4G6D A;  4BE1 A;  2HVS A;  3AL0 B;  1ZRC A;  3GFM A;  1NG6 A;  3QU6 A;  4PFO A;  4JBA A;  1J5Y A;  4XOP A;  4ASN A;  4HAM A;  1FC3 A;  2V1D A;  4V19 K;  2RC4 A;  2E1O A;  4DGW B;  1UB9 A;  5DUI A;  3PO3 J;  1JHF A;  4BH9 A;  5ICE A;  1BC7 C;  1HDD C;  3TL4 X;  3JTG A;  2EH3 A;  1NK3 P;  1K4S A;  2OPT A;  3EUH C;  1HW5 A;  4FT8 A;  1MDM B;  1IN6 A;  2P7V B;  3FMR A;  2E35 A;  2JN6 A;  2F5E A;  2HWV A;  5E3L A;  2A5W A;  3P9I A;  2YUS A;  2EJR A;  3PUB A;  4XLE A;  3KFW X;  1ZR2 A;  1PJR A;  4YFK F;  3HSE A;  3FF5 A;  5EEG A;  5F1R A;  2ECB A;  2L7K A;  5GPC A;  2HKX A;  3AG2 H;  3D5R C;  2EPF A;  4FX0 A;  1WJD A;  3M3Y J;  3HUG B;  1NTC A;  3VYR B;  1XCB A;  1SVL A;  3OL3 A;  3ZQH A;  3ML6 A;  4PJN A;  3HXL A;  6PAX A;  4XSZ F;  3M8F A;  5EYR A;  1W36 C;  2PLY A;  5F0F A;  2VXD A;  1RNL A;  5AIQ A;  2LTP A;  1LB2 A;  3QP6 A;  3RI4 A;  1PDN C;  1ETW A;  4RM3 A;  2L2O A;  3WHB A;  3P9C A;  2YR2 A;  1BI1 A;  2E1C A;  1VI0 A;  4HDV A;  3LST A;  3KYC B;  3FMQ A;  3CO6 C;  3W6V A;  1B6A A;  3F8F A;  3J81 K;  3RKQ A;  4HEA 2;  1S6L A;  2X51 A;  5ILU A;  3ZCO A;  2KJC A;  1XS9 A;  4WCG A;  5EZG A;  2CQQ A;  1B1B A;  1G3W A;  2W82 A;  4TV7 A;  2R7O A;  4AIH A;  2QBY A;  3DTE A;  1XGO A;  2Y2Z A;  3E5Q A;  1LEA A;  5FRO A;  1UHM A;  1P6R A;  2HPM A;  1P4A A;  1UHW A;  2R7W A;  3HIF A;  2DA2 A;  1O4X A;  4AD9 A;  1IGN A;  2R7D A;  3K9T A;  4A3I J;  3H0G J;  2L5Q A;  1W7P B;  4JK1 X;  5TGT A;  2CUZ A;  2LBF B;  2I8D A;  4KMU X;  2L02 A;  1QVT A;  2HPI A;  3CUO A;  3RDI A;  3JAM Z;  2PMZ N;  3HPH A;  4ON0 A;  5LEK A;  4D1Q A;  1WSU A;  1D0Y A;  4Q48 A;  4XKC A;  2VKH A;  5FKN A;  1U6G A;  1R5H A;  3HZJ A;  4HF1 A;  5CVV A;  5TJJ A;  4NQW B;  2DW4 A;  1Z0X A;  1YW9 A;  2DYS H;  3PJR A;  2J5O A;  1S29 A;  3GLX A;  1ON1 A;  1OKR A;  2DFE A;  2MD0 A;  3L00 A;  3V7R A;  3BTJ A;  2E1M C;  3Q3S A;  4BBS J;  1Q1H A;  3WTY C;  2QQ8 A;  4B3A A;  3TED A;  1XMA A;  2HQA A;  3AG3 H;  1B72 B;  3I53 A;  2VE9 A;  1ACI A;  1H0M A;  5M3F J;  3TP0 A;  1IF1 A;  3J80 Z;  4I0B A;  1YTY A;  2R7U A;  5FRM A;  2Y75 A;  1Z77 A;  3NAR A;  3K2Z A;  1DPU A;  2VJJ A;  4E7H A;  3W3C A;  1BJZ A;  2BBY A;  4ESB A;  2KRH A;  2IT0 A;  1OQY A;  1X1C A;  2HNH A;  4N0B A;  2DTR A;  2P7C B;  3ABU A;  2VJI A;  1JKO C;  4PZJ A;  1XTA A;  3CCL I;  1MZB A;  1ETO A;  3BZ6 A;  1U9N A;  3OOP A;  4W1U A;  4BDY A;  1K7A A;  2COM A;  5D4R A;  1UAA A;  4ZTJ A;  1UFM A;  3FXK A;  1ZN2 A;  3W2W A;  5EG0 B;  3F8B A;  2JA2 A;  2FD5 A;  3CUQ A;  4E7Z A;  2EK5 A;  5CLS A;  1WI9 A;  4KIC A;  3QAH A;  4B44 A;  4XK4 A;  4I76 A;  1KQ8 A;  2BY1 A;  2YX7 A;  2Z99 A;  3Q0V A;  3VOD A;  4BE2 A;  4Y3O A;  4YII A;  4YEL A;  3FIS A;  2A5Y B;  1FZP B;  2M0M A;  3HC7 A;  2MC3 A;  3BPX A;  1CGP A;  5K5R A;  3FK7 A;  3SFZ A;  4AYB A;  1H89 C;  2EFO A;  2EFQ A;  2WBM A;  3MZY A;  4V2F A;  1K78 B;  4CH7 A;  1WHU A;  3R0J A;  1EJ9 A;  4PJJ A;  5B3S H;  4RA2 A;  3I56 I;  1R58 A;  4B48 A;  2LDU A;  3PSF A;  3CCV I;  4BQN A;  3MZ8 A;  2W00 A;  3KE2 A;  4G94 A;  4QIW N;  1I1S A;  2HKO A;  2WY7 Q;  2FBK A;  4I0A A;  1VQN I;  1X1B A;  3O8G A;  4LFU A;  1YG2 A;  2DQR A;  2GWR A;  2V6C A;  3GXO A;  2PJR B;  4KJZ A;  2WV0 A;  3TDZ C;  4RMN A;  2K27 A;  1GXP A;  1ZLK A;  1U5T B;  2A69 F;  3FXQ A;  3ZN0 A;  3H5A A;  5CVI A;  3ZQC A;  2KRC A;  3GTL J;  4O6J A;  3DKW A;  1YRN A;  3I4M J;  3OYC A;  2LMD A;  3W6K B;  2B9S A;  5C4J J;  1PP7 U;  1YYV A;  2Q2E A;  4A3M J;  4V2G A;  1JI8 A;  5ERI A;  5J4Y A;  4LIV A;  4XLC A;  2EFN A;  4BEH B;  5TRD A;  2H6C A;  3FBN B;  3IWF A;  5K5Q A;  4DYR A;  5FKM A;  4HLX A;  4XRS G;  2R5Z A;  1J75 A;  1EH6 A;  1GUU A;  5FJ8 J;  4DW6 A;  1C0W A;  4U0V A;  4PGH A;  3ZMV A;  3BTI A;  2JUG A;  1P7I A;  5DM7 F;  1S5L C;  1MW7 A;  2PI0 A;  2QGU A;  1XPX A;  2KQR A;  2RDP A;  1XGS A;  1KON A;  3DP7 A;  5F6F A;  2Y69 H;  1MJB A;  2QCO A;  3BJA A;  2NVX J;  2M5W A;  2TDX A;  5F0H A;  1V5G A;  1LVK A;  2DFI A;  2ZO4 A;  4DYQ A;  2F48 A;  2CFO A;  2K86 A;  5JHF A;  1QZE A;  4D9J A;  2BY0 A;  1STZ A;  3BC8 A;  3M9A A;  3IRR A;  2XB5 A;  5IP9 J;  2UWM A;  4UXN A;  1T2K A;  1VQK I;  3HPG A;  2E19 A;  2B63 J;  2COB A;  1BOB A;  2BY3 A;  4I7H A;  4QPO A;  4AUX A;  1MSE C;  3MAJ A;  3H9G A;  1YW8 A;  3CF5 F;  1I39 A;  1TT5 B;  1ORK A;  5E8I A;  4XQF A;  2R0Q C;  4EJW A;  2CO5 A;  4HV6 A;  2ZSI B;  4A0Y A;  1UZC A;  2NXN B;  2EBI A;  4MQ9 F;  3WU0 A;  1W36 D;  3OYL A;  3G1M A;  1X1P A;  1IUF A;  3I59 B;  2BHY A;  3DTI A;  3DBR B;  3OYF A;  2R7Z J;  2M30 A;  3OMY A;  4EJU A;  2V1X A;  1W7P A;  3M1C A;  2TCT A;  4QPQ A;  3WOD F;  3VB2 A;  1X3U A;  1LKX A;  4OIO F;  2A05 A;  3OS2 A;  2KP6 A;  4II2 A;  3CCJ I;  3A4C A;  4AIK A;  2XRL A;  4QTR A;  4JX4 A;  1TTY A;  2O3F A;  3H0D A;  3KP7 A;  4YIR X;  4RAZ A;  3HEF A;  1FTT A;  2VBW A;  1G3S A;  3G3Z A;  3ULQ B;  5E3M A;  2KLO A;  1JJ8 C;  3GF2 A;  4HBL A;  2ZFU A;  3QPH A;  3VFZ A;  4ETS A;  5D5U B;  2IA1 A;  1ZYR F;  3BJO A;  1OYI A;  4G7O F;  1D0X A;  1ZG3 A;  3F0C A;  3Q0W A;  2KHM A;  1KU2 A;  4C2M J;  3VSL A;  2CFX A;  4M72 A;  1D8J A;  2UZK A;  1R4N B;  3K4N A;  2QUF A;  4A3E J;  2F4M B;  4F52 A;  3S14 J;  2K9L A;  5GAE J;  5LGU A;  3GTK J;  4AWX B;  1AU7 A;  3JR9 A;  3QU3 A;  1IV6 A;  3HRS A;  4IKF A;  1S72 I;  1Y8Q B;  4OWR B;  4U0W A;  5GPA A;  3IHU A;  2RQQ A;  1XDS A;  2GIZ A;  1V3F A;  3TGN A;  3FXO A;  3LA2 A;  3JRH A;  2DAO A;  3CCS I;  1BBY A;  3OR1 C;  5JLX A;  4OIN F;  3J7A Y;  3VEP A;  1ITY A;  2NNY A;  3F3X A;  3QOE A;  1RR7 A;  1TT0 A;  4RGR A;  2ZXI A;  4P55 A;  4BQO A;  3DXJ F;  3FHN A;  2Z3Y A;  4RB3 C;  3H9Q A;  2MLG A;  4BL0 B;  3F8C A;  2DXI A;  1RET A;  3PO2 J;  4U7D A;  5BS6 A;  3RKW A;  2MC4 A;  3ZQI A;  2ZME B;  4A2U A;  5E79 C;  1SD4 A;  2Z16 A;  3DLL F;  1WJE A;  2KIQ A;  4CGZ A;  4YEJ A;  3BR3 A;  2PJP A;  2OU2 A;  3GW2 A;  4NUB A;  1RR8 C;  1XSV A;  3KET A;  5F08 A;  3OS1 A;  2CV1 A;  2CG4 A;  3D0S A;  3GO5 A;  4RLQ A;  1LVA A;  1ZRD A;  1KU7 A;  3A0H C;  3H35 A;  4B47 A;  3OIP A;  4JOM A;  4NBQ A;  2NS0 A;  3HOY J;  2LKX A;  3PQK A;  4C3J J;  1RC9 A;  2HEO A;  5D5W B;  5DS9 A;  1YJW I;  3F22 A;  5F0C A;  3P9K A;  3T8R A;  3V7C A;  1B8I A;  3DEE A;  4J01 A;  1G4D A;  4YRV A;  1POG A;  4KT5 C;  4BY1 J;  5LBQ A;  4D0P A;  3A01 A;  3KLN A;  2K40 A;  2V1U A;  2VIX A;  4HNU A;  1JJ6 C;  1WJ5 A;  2DPU A;  2LRE A;  1SD5 A;  3TBI A;  4E6K G;  3WTS C;  3ZPL A;  1MIJ A;  3ERM A;  4M3E A;  3CDL A;  1N77 A;  2DMN A;  1YS6 A;  5J4V A;  3S3M A;  2PMH A;  5FLX K;  4RAY A;  5LGN A;  2O6G E;  1IDY A;  2HYJ A;  1FSH A;  1I27 A;  3LSH A;  3K4C A;  4BJ5 C;  1HW2 A;  2GOX B;  4IJA A;  3K7A J;  2FQ3 A;  4IQ4 A;  2DT7 B;  4G12 A;  2JJ7 A;  3DKY A;  1XDU A;  4OIQ F;  1ZHF A;  3K10 A;  1YIO A;  4K2E A;  2CYY A;  4NHJ A;  4HW0 A;  1LFB A;  5ILV A;  2X85 A;  4J00 A;  2X1E A;  3ZQQ A;  2ISZ A;  3HHH A;  5IOY A;  5D8L B;  5IT9 Z;  4XRS A;  2DA4 A;  2X6Y A;  4MLO A;  1BI2 A;  2RRE A;  1FBS A;  3JRF A;  3OYN A;  1NK2 P;  2AS5 F;  3MZH A;  3KEO A;  1LEB A;  3BPV A;  4NC7 A;  4KIG A;  5IP6 A;  5E18 F;  3S1Q J;  1T33 A;  4A3D J;  2BYV E;  5FRN A;  2DOA A;  3MWM A;  1VTN C;  4BJT A;  2M0C A;  1YIT I;  2R7T A;  1QPI A;  5JVT A;  3HRU A;  3E7L A;  4GYI A;  3OYI A;  1O3T A;  4Y17 A;  3L2V A;  2FX0 A;  2Z2S B;  2HTS A;  4KNY A;  2F6C A;  4HNV A;  1AHD P;  4MTE A;  4FCY A;  3S8P A;  3A03 A;  3WU2 C;  4XNF A;  2XIG A;  4G8X A;  5HS7 A;  3MQ0 A;  2H6B A;  1S7A A;  4ZDP A;  3HDD A;  1WQ2 A;  1D5V A;  4BU2 A;  4YFN F;  1JUP A;  1ETX A;  2OZU A;  2DMQ A;  3KYD B;  4ZZL A;  5D6E A;  1N25 A;  3OYG A;  2OBP A;  2EZI A;  2WAQ A;  1TBX A;  1IN7 A;  4RB1 A;  4A3J J;  1QVU A;  1Y56 A;  4B3X A;  1YOV B;  3TO6 A;  1UCR A;  3FXL A;  3Q0U A;  3MKY B;  4RB0 A;  3O3K A;  1XC5 A;  1A6Q A;  2VON A;  3DEU A;  2ZNY A;  2YS9 A;  2M3A A;  3L7W A;  2LF7 A;  5K1Y A;  3M8J A;  2M7A A;  1RUO A;  1IW7 F;  4BY7 J;  3S2D J;  3GFI A;  3SEQ A;  1JE8 A;  1FWZ A;  1TW3 A;  2VLA A;  2L4M A;  2HOA A;  5HS8 A;  1V54 H;  3TMO A;  5JR3 A;  3CMY A;  4L0Y B;  3RQI A;  3FK6 A;  3OSF A;  1A04 A;  3JCU C;  5HDK A;  2PG4 A;  1XMX A;  2BGC A;  2ME0 A;  2IGM A;  1V55 H;  1YQA A;  3U21 A;  1D3Y A;  2FBI A;  1UG2 A;  2DOD A;  2ISY A;  3FXR A;  1FY7 A;  2R7V A;  4F93 B;  1H88 C;  1U8R A;  2HXO A;  4BXF A;  4A0Z A;  2I5U A;  3G1O A;  4XOT A;  4Y33 A;  4CO8 A;  3KIO A;  3HHG A;  2F5V A;  1ENH A;  3BCB A;  4IL6 C;  1X3Z B;  2FEZ A;  2ME6 A;  4IO9 F;  2TRT A;  3LAJ A;  1YE9 A;  3LQR A;  1GHC A;  4W97 A;  5HNH A;  3QPT A;  2GQQ A;  2VAS A;  3LFU A;  4KIS A;  2QA4 I;  4ENM A;  2R7F A;  3PFY A;  3FZV A;  2E34 A;  1IV8 A;  4E7J A;  1Z6T A;  3OR2 C;  4KN7 X;  2RNJ A;  3NAU A;  2XSJ C;  2JUC A;  1ZGJ A;  3GME A;  4A3F J;  4IHY A;  2GXG A;  3R61 A;  3OV8 A;  2W84 A;  5E1W A;  2DFH A;  1BOA A;  1D8K A;  2R7X A;  3G6E I;  3F8N A;  5JHU A;  2Q0O A;  4UUS B;  4P9F A;  4UNO A;  3CLO A;  4AC0 A;  1EF4 A;  2FU4 A;  2W4S A;  3I3L A;  1LDK B;  4G6T B;  4KUM A;  2DK5 A;  3HOZ J;  3GYH X;  3CJT B;  2X6X A;  4WXD A;  2X6W A;  4XL9 A;  2LOO A;  5FKO A;  3IUO A;  1VF9 A;  3AG1 H;  1JGS A;  3CC7 I;  2E7X A;  4EM0 B;  2FXA A;  1IRF A;  2A68 F;  3CES A;  2VQC A;  1PUE E;  1R00 A;  2P81 A;  2OAZ A;  3L2R A;  2GZW A;  4IXA A;  3FKI J;  2P4W A;  2PQ8 A;  3F6O A;  4L9N A;  4G6Q A;  1OCC H;  1GT0 C;  2EIM H;  4HDU A;  2FOK A;  2KDO A;  3EET A;  1MGT A;  3OL4 A;  2VT3 A;  3IC7 A;  5DM6 F;  1DDN A;  5BPD A;  2HFH A;  3QQA A;  4KA4 A;  4DOZ A;  3H5N A;  2X9D A;  1K78 A;  4IHW A;  4BBR J;  2K4J A;  2L01 A;  1DUX C;  2CWE A;  4LLN A;  2E1M B;  1LUJ B;  2DDA A;  3DU6 A;  3WTT C;  1HDP A;  1DGW Y;  1LDJ A;  1SFO J;  3K4M A;  4Y15 A;  4CHU A;  1FEX A;  1I50 J;  4P96 A;  4A3K J;  1CF7 A;  4GRI A;  4IRG A;  5LHH A;  2R7Q A;  4DIQ A;  1W0T A;  3GEZ A;  2VPR A;  5EG0 A;  2AQE A;  3V4G A;  3RCO A;  5IYD J;  3VYU B;  5IYC J;  2MD5 A;  2QZ8 A;  1VQO I;  3L2U A;  2K4B A;  5CKT A;  4CCO A;  2PFB A;  1O3Q A;  3FMS A;  1HLV A;  1W0U A;  4FAS D;  3N4M A; 
#chains in the Genus database with same CATH homology
 4M3B A;  3O8G A;  2M8G X;  2N8G A;  1BA5 A;  2XPW A;  3G1L A;  5M5W J;  2X48 A;  3BG5 A;  1ETQ A;  3ZQC A;  3GTL J;  3SDG A;  1MBJ A;  1YRN A;  3I4M J;  1U78 A;  2LVS A;  3JRA A;  3HOX J;  5C4J J;  4D7N A;  2ID3 A;  2CUF A;  1AKH B;  4A3M J;  1RPW A;  4V2G A;  2KDZ A;  1A6I A;  1RKW A;  2MW8 A;  2ECC A;  4JX6 A;  3PM1 A;  4M6V A;  2CU7 A;  2XSD C;  1X2N A;  4DYR A;  5FKM A;  1IG7 A;  4XRS G;  2R5Z A;  5K7H A;  1GUU A;  5FJ8 J;  3HOW J;  4DW6 A;  4ABZ A;  2EZK A;  2NS7 A;  4S0H B;  2L0K A;  2NS8 A;  3OSG A;  1OJL A;  3BTI A;  1JTX A;  1P7I A;  3CQZ J;  2DA6 A;  5M5X J;  2LK2 A;  2E2I J;  1ZQ3 P;  3CCY A;  4FE7 A;  3I4N J;  5DTD A;  3C2B A;  5M5Y J;  1TWH J;  1GVD A;  1TC3 C;  3S1N J;  2QCO A;  5EGO A;  2NVX J;  5F0H A;  2R5Z B;  1FIA A;  5FKK A;  1UHS A;  1I3Q J;  2DTZ A;  4DYQ A;  3S16 J;  2DA1 A;  1BW6 A;  1E3O C;  2HOS A;  3IH4 A;  2XB5 A;  5IP9 J;  2M34 A;  4B1R A;  4JYK A;  1AKH A;  5C44 J;  1IC8 A;  5K7F A;  2E19 A;  2B63 J;  2COB A;  1OFC X;  3WHC A;  1A5J A;  1YRN B;  4AUX A;  1MSE C;  4EEF G;  4FTH A;  2H1K A;  2I10 A;  4FIS A;  1GV5 A;  1ORK A;  1JUS A;  2JMW A;  3JRI A;  3JRD A;  5E3N A;  5EZH A;  2ZB9 A;  2R0Q C;  1Y1V J;  2KT0 A;  1RES A;  2EBI A;  2JA5 J;  3HM5 A;  1APL C;  2AO9 A;  3G1M A;  3HGG A;  5GP9 A;  1IUF A;  1UMQ A;  2DA3 A;  2MGQ A;  2R7Z J;  4L5E A;  4XRM A;  2TCT A;  4FE4 A;  1MH3 A;  1GV2 A;  3BR1 A;  5EEA A;  1TWC J;  4GFB A;  2ID6 A;  2EQR A;  1Y1W J;  1JKR C;  2XRL A;  3QPS A;  2R93 J;  5E3O A;  4QTR A;  1WI3 A;  4JX4 A;  3S17 J;  3ZQG A;  2JK3 A;  3A01 B;  5J1R A;  5FLV A;  2JA6 J;  2R5Y B;  1BW5 A;  3GTJ J;  3HEF A;  5IYB J;  1FTT A;  1U9O A;  3M4O J;  5E3M A;  1JJ8 C;  4A3G J;  1S7E A;  2R92 J;  2RAE A;  1MH4 A;  2MSY A;  2AHQ A;  2VI6 A;  2K9S A;  2M9H A;  4MFE A;  3F0C A;  3Q0W A;  2HOT A;  1LE8 B;  2HXI A;  4C2M J;  4UUT A;  3MVP A;  1K61 A;  4A3E J;  3RZD J;  2VUM J;  2VKE A;  3BG9 A;  3S14 J;  1F43 A;  3IV5 A;  1IDZ A;  1MSF C;  1MNM C;  4A3L J;  1T56 A;  2LFB A;  3TP3 A;  3GTK J;  1FIP A;  1AU7 A;  3DCF A;  3JR9 A;  1MBE A;  1IV6 A;  2E2H J;  2LP0 A;  3GTM J;  2L7F P;  4UUS A;  3S2H J;  5GPA A;  1ZTR A;  1CQT A;  5F1J A;  9ANT A;  1JGG A;  2XPU A;  1OCP A;  3JRH A;  5JLX A;  3O8H A;  1ITY A;  5FLM J;  3B6C A;  2FJ1 A;  2QF7 A;  1RR7 A;  1JKQ C;  1Q1V A;  1RET A;  3PO2 J;  2LY9 A;  5FKL A;  3ZQI A;  1HF0 A;  1ZR4 A;  3HGY A;  2LR8 A;  3BR3 A;  2O7O A;  5F08 A;  4D5F A;  2ELK A;  3BQZ A;  2DMP A;  1ZKG A;  3GTQ J;  3HOY J;  2K9Q A;  2LKX A;  4C3J J;  2CQX A;  3BR0 A;  5DS9 A;  5J3L A;  3S1M J;  5F0C A;  4D7M A;  1MBK A;  2IEK A;  1ETY A;  4C3H J;  3BTL A;  2E2J J;  1B8I A;  3ZOB A;  3A02 A;  1POG A;  2CRG A;  2LD5 A;  4BY1 J;  4MO7 A;  2X6O A;  2NOG A;  3VPR A;  3A01 A;  2H8R A;  2XGE A;  3JRG A;  2K40 A;  2HQ5 A;  4I6Z A;  1JJ6 C;  2K9N A;  4NDL A;  4IHX A;  1H8A C;  3HOV J;  4M3E A;  5C4X J;  2O8K A;  3CDL A;  2DMN A;  1DU0 A;  2XB0 X;  2GM4 A;  1ETK A;  1PUF B;  1IDY A;  2HYJ A;  3MKL A;  3OIO A;  2D5V A;  3LOC A;  2DA7 A;  2Y0S N;  3S15 J;  2IAI A;  3K7A J;  1HCR A;  3RZO J;  3OOU A;  1GDT A;  4G12 A;  2JJ7 A;  3GTO J;  2CUE A;  2W48 A;  2L7Z A;  2EZH A;  2MG4 A;  1WH7 A;  4QSH A;  4Y7N J;  3S1R J;  3SFI A;  1LFB A;  1X2M A;  1BL0 A;  5IOY A;  3LSG A;  3HKZ N;  5EF6 A;  1RKT A;  4XRS A;  5J1U A;  1R9T J;  1P7J A;  1D5Y A;  2NVQ J;  2DA4 A;  4MLO A;  5JLW A;  1MBH A;  3JRF A;  1FTZ A;  1I6H J;  2Y30 A;  3SJM A;  1NK2 P;  2DMU A;  3MN2 A;  5IP6 A;  3LSR A;  2M2E A;  2DA5 A;  1T33 A;  2O9L A;  1JT0 A;  3S1Q J;  4A3D J;  5EDN A;  2NVY J;  3DEW A;  2GLO A;  2XGC A;  2M0C A;  2GBY A;  3LSP A;  1MBF A;  1K83 J;  3K2A A;  1JTY A;  4M3D A;  4MIM A;  5M3M J;  1QPI A;  4J19 A;  4RBO A;  2YU9 J;  4AYB N;  2DJN A;  3E7L A;  2L7M P;  4JP0 A;  1JT6 A;  2FX0 A;  3ZQF A;  4HNV A;  1AHD P;  2L9R A;  4FCY A;  1FJL A;  4XID A;  3A03 A;  2HI3 A;  2LLK A;  1IJW C;  4A3B J;  2E1O A;  3HDD A;  4CYC A;  3PO3 J;  2VKV A;  1OCT C;  3B6A A;  4M3G A;  1B8I B;  1HDD C;  2EH3 A;  2EZL A;  2JWT A;  3BTC A;  1NK3 P;  1JUP A;  2OPT A;  1ETX A;  4C3I J;  2Y9Y A;  2DMQ A;  2EZI A;  2JN6 A;  3GTP J;  5E3L A;  2WAQ N;  2YUS A;  1HOM A;  4A3J J;  1QVU A;  3JRC A;  2R5Y A;  1ZR2 A;  3LSJ A;  1TWF J;  3Q0U A;  2ECB A;  3BR2 A;  5GPC A;  1WCM J;  1XC5 A;  1F36 A;  2YS9 A;  3BR6 A;  3M3Y J;  1NTC A;  1SAN A;  3ZQH A;  2CJJ A;  4BY7 J;  5EYR A;  3S2D J;  5F0F A;  4IHV A;  2LTP A;  3QPL A;  1ETW A;  2HOA A;  3CMY A;  3RQI A;  3WHB A;  2WV1 A;  3FK6 A;  1PUF A;  3OSF A;  1LE8 A;  1VI0 A;  5F04 A;  4X1E A;  2ME0 A;  1QRY A;  3HB9 A;  2HDD A;  2IBD A;  3GBG A;  2Y9Z A;  3W6V A;  3RKQ A;  1UG2 A;  3H3V K;  1XS9 A;  4CYC B;  5EZG A;  2CQQ A;  1H88 C;  2HXO A;  3G1O A;  4DYC A;  1WH5 A;  1IRZ A;  1VND A;  1ENH A;  2Y2Z A;  4X6A J;  4MFD A;  3ZQL A;  2ME6 A;  2DA2 A;  1O4X A;  5F27 A;  2TRT A;  4BKX A;  3IH3 A;  3JRB A;  1IGN A;  2DN0 A;  4A3I J;  3H0G J;  3IH2 A;  3GTG J;  4W97 A;  1ZK8 A;  1QVT A;  4Y52 J;  4DZP A;  1DU6 A;  2PMZ N;  3NAU A;  5FKN A;  4RDU A;  1XG1 A;  5IPA A;  4A3F J;  4IHY A;  3BQY A;  1Z0X A;  4A93 J;  5HOD A;  2WB1 N;  4UUS B;  4M3F A;  3BTJ A;  3Q3S A;  4BBS J;  4AC0 A;  1EF4 A;  4B3A A;  3TED A;  1B72 B;  5BNG A;  5M3F J;  3TP0 A;  3HOZ J;  3L1P A;  1JUM A;  3NAR A;  1X58 A;  1Z77 A;  3BT9 A;  1WGX A;  5FKO A;  5EGO B;  3LNQ A;  1VF9 A;  2Y31 A;  3D1N I;  1BJZ A;  5IOZ A;  3HBL A;  1LFU P;  5K7Z A;  2P81 A;  1TWG J;  4A69 C;  1JKO C;  1ETO A;  3FKI J;  1U9N A;  1U8B A;  3JRE A;  4W1U A;  4B4C A;  1ETV A;  1GT0 C;  1MBG A;  1TWA J;  2XPV A;  4BXX J;  5EG0 B;  2XGD A;  2FD5 A;  4IEJ A;  3QQA A;  1WPK A;  1B72 A;  2JA8 J;  2NVT J;  2X9D A;  4IHW A;  4BBR J;  3BG3 A;  4XK4 A;  4I76 A;  3UKG A;  3TW7 A;  3Q0V A;  3BR5 A;  1G2H A;  5J1Y A;  3FIS A;  4JX5 A;  4DZJ A;  3HOU J;  4D5C A;  4LOC A;  1HDP A;  1VFC A;  2OF7 A;  2DMT A;  1H89 C;  3FK7 A;  1SFO J;  4V2F A;  1FEX A;  1I50 J;  1ZGW A;  4A3K J;  2FQ4 A;  1JKP C;  5C3E J;  2G0E A;  1W0T A;  2VPR A;  5EG0 A;  3TW6 A;  5IYD J;  5IYC J;  4QIW N;  2JA7 J;  1HLV A;  5IP7 J;  4XIC A;  3FIW A;  1W0U A;  4A3C J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...