3OIOA

Crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
112
structure length
112
Chain Sequence
NAGSQPKLTEAVSLMEANIEEPLSTDDIAYYVGVSRRQLERLFKQYLGTVPSKYYLELRLNRARQLLQQTSKSIVQIGLACGFSSGPHFSSTYRNHFNITPREERAQRAQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator (AraC-type DNA-binding domain-cont
publication title Crystal structure of transcriptional regulator (AraC-type DNA-binding domain-containing proteins) from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Transcription regulator
total genus 40
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2010-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12833 HTH_18 Helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3oioA00
2XGEA 1ETWA 1XC5A 9ANTA 5IP9J 3ZOBA 4A69C 3PO3J 4B4CA 1ORKA 1B72B 1ZGWA 4BKXA 1FTZA 1H88C 3OOUA 1QVTA 1F43A 1IGNA 2R92J 1ETXA 2XRLA 2R5YA 2IAIA 2X9DA 2JN6A 1SANA 2L7MP 2X6OA 1BW5A 4D5FA 3UKGA 1BA5A 1XG1A 5F1JA 3G1OA 5EDNA 2DMNA 1ZR2A 1MBGA 3NAUA 3QQAA 1K61A 4BXXJ 3HEFA 3S17J 5FKLA 2MW8A 1A5JA 1NTCA 4IHWA 4NDLA 1WCMJ 3VPRA 4M3EA 4C2MJ 3CDLA 2QCOA 3BG5A 5F04A 1UHSA 1LE8B 4DYQA 3LSGA 5M3FJ 2EH3A 4IEJA 4D7MA 2VPRA 2DJNA 5F0FA 4RDUA 2N8GA 1TWFJ 3GTJJ 1YRNA 2O7OA 1ENHA 3IV5A 2G0EA 3RZOJ 1U9OA 5FLVA 2EZIA 2L7FP 1MH4A 2HOTA 5F08A 4D5CA 4UUTA 1OCTC 1GT0C 1Y1VJ 1CQTA 3MKLA 4A3JJ 4QTRA 5E3LA 2XPUA 4ABZA 1JUPA 5E3NA 5E3OA 2ELKA 3TP0A 2WV1A 3Q3SA 3G1MA 1ITYA 1WH7A 5F0CA 4C3JJ 1D5YA 1QRYA 1VNDA 2JA7J 2CJJA 3GTKJ 3HM5A 1WI3A 2EZKA 3HBLA 1R9TJ 3OSGA 2TCTA 1P7JA 1IG7A 5C3EJ 3FK7A 2KDZA 1AKHB 5EGOA 2GM4A 1JJ8C 2E19A 1ZTRA 4FISA 5C4XJ 2EBIA 4XICA 4A3LJ 2K9NA 1A6IA 5F0HA 4XK4A 5J3LA 2NOGA 2NS8A 5EG0B 1K83J 2XGCA 5E3MA 4A3CJ 1TWHJ 2COBA 5FKOA 4BBSJ 1G2HA 2JJ7A 1IC8A 4MFDA 3GTOJ 1ZKGA 3S1NJ 3C2BA 1TC3C 2E2JJ 2LFBA 4JX6A 2ECBA 1BL0A 1FIAA 4JYKA 1Y1WJ 1PUFB 1S7EA 3BT9A 4MIMA 4BY1J 1VF9A 2FQ4A 5M5XJ 3JRHA 3ZQCA 2D5VA 1HDDC 2HI3A 1Z0XA 3S1QJ 3K2AA 2ECCA 4AUXA 3TW7A 2CRGA 2EQRA 4XRMA 1I50J 2QF7A 2HOSA 4QIWN 4CYCB 3D1NI 2JMWA 3BR2A 5FKNA 1IDYA 4BBRJ 2FJ1A 2LP0A 3A01B 2MGQA 2ID6A 2E1OA 4BY7J 4EEFG 1GV2A 4B1RA 4DYCA 2LKXA 2CUEA 2H8RA 2NVTJ 4A3BJ 5GPCA 3S2HJ 3S14J 5J1YA 4W1UA 5C44J 3A02A 3WHBA 3JREA 1VFCA 1OFCX 1LFUP 5EZHA 3GBGA 2X48A 1IRZA 2CU7A 2NVYJ 4UUSB 4GFBA 1O4XA 3Q0UA 1AU7A 2ME6A 3IH3A 1MSEC 2CQXA 4M3BA 2DMPA 2Y30A 5GP9A 2R7ZJ 4C3HJ 3F0CA 3DEWA 1WPKA 4MO7A 5EZGA 1HCRA 2JK3A 2B63J 1EF4A 3HOWJ 2CUFA 1HLVA 2HOAA 2O8KA 2AO9A 2LD5A 2VUMJ 2L0KA 2LTPA 1DU0A 2DA1A 1B72A 1T56A 3O8HA 1H89C 2K40A 3HOVJ 2E2IJ 1IV6A 3H3VK 2YS9A 4LOCA 5M5YJ 1JGGA 1BJZA 2DA3A 2M34A 3GTGJ 1MH3A 2TRTA 3TEDA 1OCPA 2FD5A 3LSJA 1RPWA 4MFEA 2HYJA 4M3GA 2XB5A 3HOXJ 3LNQA 3TP3A 3JR9A 3K7AJ 4I76A 2PMZN 5F27A 1VI0A 2DMUA 5IPAA 2NS7A 1X2MA 1BW6A 3MVPA 1JJ6C 2LY9A 4Y52J 3PM1A 1LE8A 2XPWA 4AC0A 3CMYA 1SFOJ 1APLC 2DA6A 5K7HA 1JKQC 2IBDA 2ID3A 3RZDJ 4X1EA 4A3IJ 1NK2P 4V2GA 1JKPC 5FLMJ 3IH2A 2GLOA 2JA6J 3BG3A 4FCYA 3GTLJ 3GTPJ 2L7ZA 2Y2ZA 5GPAA 1RR7A 3JRCA 2DA4A 3HB9A 3O8GA 1ETQA 3WHCA 4IHVA 2XSDC 2R5ZB 2M0CA 1H8AC 2NVQJ 3SJMA 2M8GX 1TWAJ 3BR5A 1U78A 1I6HJ 1FIPA 3BR3A 3ZQGA 3M3YJ 3JRFA 1FJLA 1T33A 1AKHA 4DW6A 1ETVA 3BQZA 3Q0VA 4M3FA 2DMQA 5M3MJ 4A3GJ 4IHXA 1JTYA 2W48A 5EG0A 3HGGA 4S0HB 1NK3P 3M4OJ 3QPLA 3Q0WA 2LR8A 1GDTA 1ETKA 1U9NA 1AHDP 4AYBN 3SDGA 1RKWA 2VI6A 5BNGA 2I10A 3JRIA 1B8IB 2CQQA 2OPTA 4QSHA 3ZQIA 1PUFA 2DN0A 2RAEA 4A3KJ 2XB0X 4I6ZA 3QPSA 5DS9A 4V2FA 1JKRC 3BQYA 1UG2A 1OJLA 5J1RA 4W97A 4X6AJ 5EYRA 2Y9YA 1RETA 2R5YB 4FE4A 2R93J 2ZB9A 4G12A 4B3AA 4CYCA 2Y31A 1Z77A 3CCYA 4M3DA 2IEKA 1GUUA 1Q1VA 3BTCA 4L5EA 1HF0A 2JA8J 3A01A 3ZQFA 2L9RA 1WGXA 3FKIJ 3I4MJ 3BR1A 1MBFA 3IH4A 3W6VA 1RESA 3BR6A 4FTHA 4JX5A 5IYDJ 2DA7A 2FX0A 3S16J 4DZJA 4A93J 3SFIA 3ZQHA 3NARA 1ETOA 4A3MJ 3OIOA 3S1MJ 4C3IJ 3MN2A 5FKKA 3BR0A 4RBOA 2WAQN 1UMQA 1TWCJ 3RQIA 5FKMA 1GV5A 4UUSA 2NVXJ 4MLOA 1JUSA 1YRNB 1QPIA 1HOMA 5JLWA 3LOCA 2E2HJ 5IP7J 5IP6A 1MBEA 2MG4A 4J19A 3HDDA 2K9SA 4Y7NJ 3E7LA 2H1KA 1F36A 1ETYA 4A3EJ 3B6CA 1ZR4A 4HNVA 1W0TA 1FTTA 2DA5A 1E3OC 3FIWA 4DYRA 2DTZA 1W0UA 2Y0SN 5IOZA 2JA5J 1RKTA 3CQZJ 3HKZN 3GTMJ 3HOUJ 4M6VA 1MSFC 4A3DJ 3H0GJ 5EEAA 1JTXA 2EZHA 5IOYA 1MNMC 2DMTA 3FISA 1X2NA 4FE7A 5K7FA 5EGOB 3JRBA 3S1RJ 3JRDA 4XIDA 3G1LA 1X58A 5JLXA 3S15J 2LLKA 1GVDA 5DTDA 3LSPA 3S2DJ 3JRGA 4IHYA 2LK2A 2M2EA 3DCFA 1IUFA 2M9HA 2VKEA 2DA2A 4XRSA 3JRAA 2LVSA 2HXOA 2HXIA 1JUMA 3HOZJ 2GBYA 2XGDA 2KT0A 1MBJA 2MSYA 2O9LA 1ZK8A 3HGYA 5K7ZA 3BTLA 3L1PA 3LSRA 1MBHA 3HOYJ 2Y9ZA 1IDZA 2R0QC 2HQ5A 1POGA 2R5ZA 2K9QA 2JWTA 3FK6A 4D7NA 1JT6A 2AHQA 3BG9A 3B6AA 1XS9A 1I3QJ 4A3FJ 1U8BA 3ZQLA 1JT0A 2VKVA 1MBKA 2YU9J 2EZLA 1HDPA 1DU6A 3TW6A 3GTQJ 5C4JJ 3I4NJ 1P7IA 4JX4A 2OF7A 3RKQA 5J1UA 5M5WJ 2XPVA 1JKOC 2YUSA 1TWGJ 3BTJA 4DZPA 2P81A 4JP0A 1WH5A 3A03A 2WB1N 3OSFA 1QVUA 1ZQ3P 4XRSG 3BTIA 5IYBJ 1IJWC 5FJ8J 2HDDA 1B8IA 2ME0A 5EF6A 1FEXA 5IYCJ 3PO2J 1LFBA 5HODA
chains in the Genus database with same CATH superfamily
4P96A 1WRJA 1Y8RB 3V4GA 4CXFA 1XC5A 1TZLA 1VQMI 4CHUA 5CVJA 3ZOBA 2LH9A 1OR7C 4A69C 4XSXF 1ZGWA 2X6XA 2XGXA 3C18A 1QVTA 3K4MA 2JA2A 1G6NA 4XRFA 5LRSA 4N9IA 1F43A 2H94A 4OOIA 2R5YA 2IAIA 3LQRA 1YX3A 3GWZA 2W82A 1YW7A 2L4MA 3AG3H 5ICCA 3OIPA 2VXZA 2LYCA 3KZYA 2JZYA 2QLZA 4HG2A 3BJAA 4RAYA 3F22A 3UKGA 4ZTFA 2DMNA 5D8KB 1SFEA 1JGSA 2XF5A 1VTNC 3NAUA 5FFXA 1Z3YA 2QGUA 3HEFA 3CCJI 2ZJQF 4BH9A 3E6DA 5GAGJ 1F9NA 4P9FA 1JHHA 2W24A 4C2MJ 1JI8A 3BG5A 5DUIA 2VT2A 4PGHA 4DYQA 4ZJZA 5ICGA 3SHFA 3NEUA 4IEJA 4JBAA 4D7MA 2HEOA 2F5FA 1YG2A 3GTJJ 5J8FA 2O7OA 3KPHA 3COAC 1X4PA 2JRTA 2RC4A 3HUGA 5TJJA 4DGWB 1XX5A 3RZOJ 2EZIA 2HOTA 4M9XA 2BY2A 2NOJB 3DXJF 1Y1VJ 4CO8A 3FBIB 3KYCB 3DPUA 3NWTA 2XPUA 3J7ZI 1STZA 2KRCA 3MZ8A 4GGGA 1R6RA 2IGOA 4ANJA 4ZDOA 2ELKA 2VASA 2IXSA 1FP1D 3TP0A 3K4JA 4QPQA 2HKXA 2IA0A 3N4MA 1ZRDA 1HA8A 2O8XA 4HOBA 2OCCH 4V19K 1ZG5A 3O3KA 1MDMA 1YTYA 2FOWA 3EYYA 1T39A 2RV8A 1BI3A 5AIPA 2GAUA 2NAZA 2A5WA 1K78B 1HKSA 2EZKA 4HBLA 4UB6C 5DV5A 2TCTA 1HXDA 1P7JA 3RCOA 1IG7A 5HDGA 4PZJA 2DPDA 4FISA 2FOKA 3MAJA 4QLCU 1S7OA 2EBIA 2PMHA 4OWRB 2DW4A 5F0HA 1D1CA 2CUZA 2NOGA 2H09A 2NS8A 3W2VA 4U7BA 2XAJA 2Z3YA 3EETA 4HEA2 3WTUC 2IS6A 2Y69H 4A3CJ 1G2HA 4BBSJ 2JJ7A 3DPTA 2Z99A 2FE3A 4MFDA 3V7SA 2XV4S 5JVTA 3S1NJ 4WWCA 1B6AA 3WTXC 1TC3C 2LFBA 1D8KA 2ECBA 1XSXA 4GXOA 1GXPA 4JYKA 1RUNA 2EIKH 1PUFB 1S7EA 3BT9A 3Q9VA 4MIMA 4BY1J 4PDKA 1WKMA 2D5VA 2VOOA 5M5XJ 1MW7A 3S2WA 2HI3A 1MZBA 2Y0SA 2ETHA 4L5IA 2WAFA 3ULQB 4EM2A 5E1XA 1B9NA 1I50J 2QKMB 4QIWN 2J5PA 1FBQA 3D1NI 4RGRA 2MABA 3EUKL 5AONA 2XKPA 2A61A 3A01B 2KJBA 3OYKA 4NC7A 5E1ZB 1BC7C 4JK1X 5JHFA 3BZ6A 1HSJA 3CCQI 2CQ7A 1J75A 3H5NA 1PJRA 1VQOI 4IL6C 2CUEA 3M9AA 3S3MA 2H8RA 1YLFA 3S14J 1H9GA 2EFWA 1B59A 3KFWX 1VFCA 3TQNA 5FB2A 4RB2C 5CQGA 4KJZA 2NVYJ 1QZEA 2RQQA 2V9KA 2B9SA 1O4XA 4CYDA 4IRHA 1IF1A 3WTVC 3I64A 4DBRA 4KNYA 2R7ZJ 4U7DA 3DEWA 5CQEA 1GHCA 2FUG2 2DTRA 3I58A 2JK3A 1E3HA 2B63J 1EF4A 1HLVA 2ZSIB 3R60A 5H20A 3IWZA 4EATA 6PAXA 1YJWI 4LFUA 2DA1A 5KNLA 3CJNA 5GADJ 5BQTA 1K4SA 1F4KA 1SAUA 2YS9A 3LSHA 3FZVA 3QYEA 1Y8QB 2M34A 2OTJI 4MEYF 3GTGJ 1J2XA 1QZZA 2FD5A 3HSRA 1RPWA 4D0PA 1XN7A 2XSJC 3KEYA 4QPOA 3LNQA 1JE8A 3TP3A 5BS6A 4HQMA 4GYGA 2L02A 1NHAA 3OR2C 5IPAA 2PMZN 3KEOA 2DMUA 3AFHA 3ERMA 2LNBA 2BXZA 1LVKA 3IKVA 2LY9A 2GOMA 1VZ0A 1XSDA 1U6GA 2EFOA 2EV6A 1I6XA 2NNNA 3M8JA 4F7ZA 1G3WA 4LLLA 4BHPA 1LE8A 1QBJA 2JT1A 4L0ZB 3G71I 3K6GA 4FHTA 4L9VA 2DQLA 1APLC 2QBYA 1DUXC 2V1UA 4E7KA 4EJTA 3TOBA 1O7FA 5A2QZ 1EH6A 5D6EA 2KRHA 1HKTA 2BW3A 3RYPA 3M8FA 1JKPC 5FLXZ 2GLOA 3AAFA 2QSHX 2JA6J 4F92B 4FCYA 4R8HA 2L7ZA 1G59A 2P5KA 2X1EA 4F52A 1GXQA 3MEXA 5K5RA 3FWEA 3U1DA 1PVEA 2DYSH 3HB9A 1XDUA 2DFIA 4I0AA 4RLFA 2R4GA 1YJ9I 4C2UA 2XSDC 3G4SI 2E1MB 2M0CA 3R6SA 1FC3A 5DD4A 2QVOA 4ESBA 4WX9A 2ZSHB 3WTTC 4UXNA 3ZMSA 1MJAA 3SJMA 3WG9A 4I2OA 2MD5A 1I6HJ 3TBIA 2K3FA 3BR3A 3ZQGA 4MTEA 3JRFA 4E7ZA 5B1BH 1FJLA 3CDHA 4H4KC 4DW6A 2HZDA 1W7PB 4HDUA 1C0WA 2A5YB 2E1MC 2LC2A 2VBWA 3LMMA 5M3MJ 3EDPA 4A3GJ 3CC2I 3QU6A 3F72A 1TT0A 1QO0D 3H0DA 3HGGA 1NK3P 5A2QK 3WTWC 4OMYA 2HTJA 4BDZA 2LR8A 1GDTA 1W4MA 4NNJA 4CCOA 1RKWA 2GOXB 2VI6A 4HF2A 3FXJA 5BPIA 3H3ZA 4AU7A 4IX7A 2CQQA 3K1MA 1B8IB 3TKYA 2E5NA 4GRIA 4BHCA 4II2A 1V54H 2CFOA 1BM9A 3WU2C 1OISA 1SFUA 2MYSA 4UY8I 5KAFC 4V2FA 2VJ4A 4E7SA 3WU0A 3K69A 4RM3A 2FEZA 1IUYA 4W97A 3ABLH 4X6AJ 2HYGD 1R5ID 4ZYDA 4NC8A 2K86A 3FXKA 1P92A 3RKXA 4CYCA 3OYGA 1QHGA 4OINF 1Z77A 3CCYA 4U88A 2OC6A 3R0AA 4B09A 1X1CA 4LITA 1Q1VA 1F5TA 3IAS2 3FBNB 3PNVA 1OCCH 1IW7F 3H92A 2L9RA 1P4XA 4XN3A 2ZXJA 3S8PA 2JPBA 1MBFA 3IH4A 2JPCA 2GWRA 3K0LA 1OKRA 5IYDJ 1P2FA 2G9WA 3MQ0A 2HGCA 2FX0A 4DZJA 2HS5A 3KP3A 2KIQA 3NARA 4A3MJ 3S1MJ 3H5AA 3DTKA 3HIFA 5FKKA 3RKWA 1UMQA 4ON0A 4UNOA 2CH0A 4F91B 2NVXJ 2K02A 2V9VA 2XRNA 3I53A 2GA2A 3H9JA 4M71A 3BROA 3FXLA 4J19A 5B3SH 4ESJA 4B8XA 3MZYA 5LEJA 5TGTA 2K9SA 2H1KA 1F36A 3QOPA 4XQFA 4ZZLA 1ZG1A 1UZCA 4A3EJ 3CUOA 1ZR4A 2DA5A 4IRIA 2BVMA 4O3MA 2Y0SN 5L3DA 1RKTA 3CQZJ 4KT6A 1SFKA 5D6FA 3JCUC 1OCOH 4M6VA 4OIRF 4GO1A 1ZH5A 1YW8A 4NUBA 1X3WB 5LGNA 1DPUA 4DQ2A 4ESFA 1IN6A 2OCEA 4UV8A 1WJDA 4LIVA 3EPZA 2V79A 2E7WA 4L9NA 2EINH 2L5QA 1OYWA 5F1RA 5LHGA 2XIGA 3C2GA 2EILH 1UJ8A 1X2NA 2CS3A 3A0HC 3F6OA 3CD6I 1UCRA 5EGOB 5JFRA 2BV6A 5HLGA 1XCBA 1PDNC 3JRBA 3A4CA 4AIDA 3TDZC 2LLKA 1GVDA 2CFXA 4MGRA 5DTDA 1UFMA 4Q47A 3LSPA 1WWXA 2IGMA 3H36A 3I4PA 1EH7A 2LK2A 1Z6TA 2VKEA 4XRSA 2BHZA 2CWEA 3VOEA 1JUMA 2BBYA 3I55I 4I09A 1KQ0A 4YELA 4YFNF 1G3TA 4BUPA 3FHNA 2W00A 4Y15A 4HNUA 5LEKA 4KIFA 1BR1A 3MCZA 1ZN2A 3O2PE 4P1WA 4BQOA 1R49A 3BTLA 1YX5A 4U0WA 1MBHA 2DOFA 2FBHA 2RVCA 2R0QC 1FSHA 5FFZA 3AKZA 4XLEA 2WAQA 1A36A 2R5ZA 2K9QA 2JWTA 3FK6A 1EJ9A 2NRAC 2PFBA 2DT5A 2KPMA 1YO5C 2WA0A 2HVQA 4A3FJ 2WADA 2VKVA 1KYZA 1BR2A 4RA2A 1YI2I 2QSGX 2BYVE 1VQ7I 2D2WA 2Z1DA 3VYRB 3DKYA 1DU6A 2KKOA 2MH2A 5C4JJ 3GZ6A 3GTQJ 2V6CA 2Y48A 2DDAA 1IN4A 1FP2A 4NBQA 1WJBA 2DOAA 5D5VB 2Q2EA 2L9SA 3K70D 3W3CA 3VYTB 3L2RA 1JKOC 1TQIA 1R5GA 2PQ8A 2D1HA 2IJLA 1IAWA 1LUJB 2OQRA 1BI2A 4RAGA 2IT0A 3GXOA 2VJ5A 3GUDA 5J40A 1KU2A 5IYBJ 3DTEA 2X1CA 5FJ8J 2AXTC 4HV5A 3PL8A 1FOKA 4CZZA 1X4OA 2DLLA 4DJAA 4XMYA 5EF6A 4YIRX 2WAEA 5IYCJ 3ISPA 2E2IJ 3CUQA 3EQLF 4HF1A 1MNEA 3LWFA 1X3UA 3PO3J 4B4CA 1ORKA 2Z33A 4RB0A 4DOZA 1B72B 1FTZA 1PP7U 3DU5A 4YFKF 4B47A 5CJ9A 3E6CC 2R92J 5LFAA 1ERDA 3KYLA 4ZH4F 2JN6A 3FXMA 2DXIA 1T0FA 2X6OA 2EFNA 1FWZA 3LSMA 4LG0A 3MD2A 4AVPA 2A07F 1XG1A 3J81Z 5F1JA 3I5UA 3D0SA 1MBGA 4E7HA 3QQAA 1R22A 1D5VA 2H8WA 1KU7A 4IHWA 1A5JA 3GFLA 4UV9A 3G3ZA 3VPRA 1MJBA 3CJRB 4FQGA 4F93B 3IKTA 3IRRA 2FMLA 3CDLA 4KMUX 2R7TA 5HVQC 1ZARA 1ULYA 1I1GA 2EH3A 3K9TA 5F0FA 4LLNA 3CCMI 4Z2YA 2PG4A 2IRFG 2Q0OA 1K6YA 4AIHA 1ENHA 3ZPLA 2V1XA 2G0EA 2OQGA 4XKWA 1U9OA 5FLVA 1MH4A 2UUZA 1V5EA 1HSTA 5DD8A 2VODA 3H1CA 1G3SA 3JSPA 3EUAA 2IA1A 3A0BC 1Y39A 2XF6A 1CQTA 4XKCA 1X1PA 4A3JJ 4WXCA 5E3LA 1P4AA 1SVOA 4ABZA 3A1YA 3LSKA 1DGWY 2ZXHA 4DNCA 3T0YA 1QQIA 1RI7A 3HTUA 3ZN1A 3Q3SA 4CH7A 1PUEE 4CA0A 5F0CA 4WCGA 4C3JJ 2ADUA 2A05A 1N77A 3F8BA 1VNDA 1U0JA 2ISYA 2HPIA 5LLQA 2JA7J 3F8NA 3J81K 2I8DA 4E7IA 1WJAA 2RGVA 2OBPA 4XOTA 4GDFA 3VYUB 3OYIA 2Y0MA 3FK7A 2YX7A 4XSZF 3FMRA 1YIJI 1AKHB 2R7VA 4AIKA 2E19A 2EIMH 1ZTRA 2H6BA 2WY8Q 3J7YJ 2W85A 5HS8A 4PUSA 1HC8A 2K9NA 2FBKA 3B73A 2ZMEB 4A0ZA 2VJJA 5J3LA 3GFJA 3HYIA 1K83J 2FA5A 3V8KA 1X19A 1IN8A 3T1BA 5E3MA 3CJQB 1W36D 3QRFF 1IC8A 2AQFA 2JQ7A 1W5TA 1ZKGA 2EPFA 4PJMA 4JX6A 2VQCA 2UZKA 1Y1WJ 3K4CA 3D5LA 3GZ5A 2ZMEC 4Q48A 4XONA 4BJTA 2F48A 1VF9A 3AG4H 3JRHA 1M1EB 2KP6A 1FYKA 4EJOA 1A35A 1Z0XA 2QQBA 2VKHA 2L54A 3S1QJ 1Z91A 3K2AA 1QZYA 4XOPA 2XASA 2W7NA 3TW7A 4HX4A 2EQRA 2L01A 4XRMA 2VC1A 2QF7A 3FXUA 4IQJA 3G6EI 5BOXA 2EA2A 1Z9CA 2ACJA 2LG4A 3BR2A 3HZJA 4BBRJ 1QPMA 2LP0A 3BWGA 2WWYA 2QUFA 3GVAA 2MGQA 2ID6A 3BP8A 1BN5A 3I59A 4DYCA 4A3BJ 3PNTA 3TMOA 3S2HJ 2VBZA 5C44J 1KQ8A 1IN5A 2V1DA 4HQEA 1W5CC 2X0LA 2KLOA 4RGXA 2E60A 2ICWG 4B48A 5EZHA 3CMEI 4PJNA 3E97A 2KIUA 4BYYA 1AU7A 3CUQC 4M73A 2ME6A 3IH3A 4N4NB 2BY3A 3SZGA 3P5JA 4CICA 1T2KA 2DMPA 3RPUA 3WE2A 3E5UA 2IGNA 5H6QA 4KDPA 1B9MA 3LQQA 1WPKA 2UXNA 3TL4X 5EZGA 1SMTA 2ZBKA 5ILVA 1HCRA 3D5SC 4U0YA 4XLFA 2LDUA 4RM2A 2HOAA 3ONQA 3ERED 2UXXA 1WJEA 5HNHA 2VUMJ 2LTPA 1DU0A 1T56A 1H89C 2ELHA 4IHTA 3LFKA 5KCMA 1XMAA 1GVJA 4KYWA 1R23A 5M5YJ 4LOCA 4O6JA 1BJZA 2MH9A 2DA3A 2PN6A 3CCEI 2D45A 5GAHJ 1SFXA 1K7AA 4HSTA 4XKBA 2Z2SB 2ZFUA 3IP4B 1MH3A 4FT8A 3IL2A 2DFEA 1K79A 2JVHA 3LSJA 4KN4X 1ON1A 4MFEA 4L5JA 4M74A 2HVSA 3LA2A 4M3GA 4WXDA 2XB5A 3HOXJ 3RDIA 3GMEA 4X0GA 5L3FA 3ZMTA 4A6EA 2DCEA 2NS7A 3IWFA 3P9KA 3OYJA 3MKZA 3G73A 1ZGAA 4MHGA 2UV1A 1T95A 2HFHA 2YSRA 2ISZA 1BIBA 2DYRH 5FD5A 3E6MA 4J01A 1UAAA 2XVCA 4Y17A 3V8JA 2XPWA 3MZHA 1UB9A 1X1DA 1O3QA 2DA6A 2DAOA 1JKQC 2IBDA 2ID3A 3U9GA 3RZDJ 4X1EA 1I5ZA 3SFZA 3GLLA 1H0MA 4F55A 5FLMJ 2OU2A 2P7CB 2VQLA 1MKMA 4A5MA 1MMAA 2OAZA 5CKTA 5K1YA 3WTYC 3M07A 3JRCA 4BGDA 1N78A 3SZPA 1S8NA 1D1AA 3O8GA 3WE3A 4HV6A 1R1UA 2A68F 2XAHA 4BEHB 2ZJRF 1Z67A 1G3YA 2M8GX 4YFXF 4IHSA 3OL3A 2AXLA 4I99C 1FIPA 3H9GA 1T38A 2BVLA 1ODDA 3CLQA 4CDGA 2F5CA 2IA2A 2CV1A 1T33A 5HDKA 2XAFA 1LEAA 3DKWA 3DQVC 5JHUA 2K5CA 4EGYA 3HSEA 4XLNF 1O3RA 2E1CA 1R4MB 2XAUA 1T6SA 1UHMA 3JTHA 5HLIA 4PFPA 2W25A 3QP6A 1Z21A 5EG0A 4PFOA 5LBQA 3L2UA 4LJZF 3M4OJ 3QPLA 4IOAF 2GXBA 2CUJA 1XSVA 2XAQA 4Z6YA 2M4GA 3DBRB 1U9NA 2X4HA 5TRDA 3SDGA 3P7NA 1QHHD 1Y0NA 3ABMH 1TL8A 3DEUA 3OY9A 2ZFWA 3ABKH 2RAEA 4I6ZA 1KU9A 3PUFA 4ENKA 1JKRC 3VDXA 5ILUA 1TBXA 3DKXA 2HQNA 3DBHB 3DBLB 3CO6C 5EYRA 3FXRA 3J7AY 4UVBA 1RETA 3KCCA 2C6YA 2R5YB 4FE4A 3HSFA 1USTA 4G12A 2Y31A 3CF5F 3N97A 4M3DA 4AIJA 3TOAA 1GUUA 1HF0A 2E35A 1I27A 3HG9A 2HOEA 5E1WA 4H0EA 3KYDB 3M1EA 3BCAA 1D0YA 1LJ9A 3BR6A 4P55A 2DA7A 5FROA 3DV8A 2VJIA 4NC6A 5JVGF 1XB4A 2VXDA 1ETOA 4YRVA 3IAM2 4KN7X 4C3IJ 1KYWA 2WY7Q 3BR0A 2FU4A 1TWCJ 2BXYA 2LBFA 2KIFA 5E18F 4UUSA 4MLOA 3OYHA 3K1PA 5JLWA 2E2HJ 3HUGB 3DFGA 2ZXIA 4KITB 3VWBA 3HDDA 3U21A 3RJPA 4BE0A 4PK4A 3E7LA 2XKOA 4A0YA 3V7CA 5L3EA 4BJ5C 3TDUC 2FXAA 1W0TA 1FTTA 1R7JA 3I71A 4DYRA 3TO7A 1W0UA 4ENJA 3OYCA 2JA5J 1I39A 3S93A 4L9JA 4Y33A 1T8IA 1NH3A 3HRUA 1LQ1A 3SQNA 1FNNA 3ZP5A 4AYBA 1ZAOA 2FRHA 4E70A 3G2BA 1MDMB 1YE9A 4IKFA 2EZHA 4C9YA 3PUBA 5ERIA 4XBFA 5IOYA 1MNMC 3BY6A 1WJCA 3ZCOA 2O03A 3FISA 2GXGA 3F8CA 4HPQA 4Y3OA 1R4NB 4YG2F 1X58A 5JLXA 1SVMA 3U1KA 5HOOA 3S15J 2PLYA 1VQ5I 2KQRA 1FMVA 3L7WA 2M2EA 3DCFA 1Z7LA 2Q1ZB 1T08B 4DIQA 1OYIA 2HXIA 1S72I 4Q5SF 2KJCA 2ESHA 2FF4A 4GCVA 2IS4A 3DU6A 2UWMA 2ZNZA 3SDBA 2XGDA 1KGSA 3CCLI 3I9V2 1RIOH 5FRNA 2MSYA 1LVAA 4FETA 2P6TA 1FZPB 3LSRA 3L1PA 2EIJH 2HTSA 3FDYA 1MMGA 1O57A 4CCJA 3FX3A 3QPHA 2PEXA 1N25A 2CV2A 1D0XA 2A3SA 2DFHA 5D5XB 4RMNA 1I3QJ 1XS9A 1U8BA 2STTA 3MMYB 1A04A 2J5OA 1HDPA 2IW5A 5E20A 1FY7A 1P7IA 4G94A 3HPGA 3DWLE 5J1UA 5DCMA 2EFQA 3GF2A 2XPVA 3OS0A 2MA3A 2YUSA 1TQPA 2M45A 2ZKZA 3TGNA 4DZPA 2P81A 3OYMA 1BC8C 1BOBA 1WH5A 3FKJA 2QQ8A 4KIBA 2O6GE 2VT3A 2F4OB 4XRSG 3BTIA 1MD0A 1ZREA 2RREA 2L2OA 5DCFA 3BPVA 2HDDA 3HJEA 2K85A 5CVUA 1DDNA 5HODA 1R36A 1ETWA 4K2EA 1U8RA 1X1BA 5AIQA 3KLOA 5ICEA 3LAJA 3AL0C 1PP8F 5EJCA 3K4KA 1ETXA 2XRLA 2X9DA 4NQWA 2EK5A 5IT3A 2V4JC 1IO2A 4YIIA 4BXFA 1BW5A 1R71A 3ABTA 5FO5A 3SXYA 3G1OA 3CESA 5EDNA 3S3OA 1ZR2A 3BG7A 3VSLA 2LMDA 4IF4A 1K61A 2X1DA 3K1NA 3ZMUA 3RSNA 4ZZDA 2R7WA 3S17J 1FLIA 5FKLA 1YS6A 2MW8A 2PJRA 1NTCA 4XL9A 5FRMA 1OLTA 1WCMJ 4M3EA 2QCOA 3HXLA 1LB2A 2HU9A 2HNHA 3QP5A 4S05A 1ZHFA 1LE8B 5DUKA 3TO9A 3LSGA 5M3FJ 3L09A 1R1VA 2QBYB 1DP3A 2YU3A 4RDUA 3KX2A 2M7BA 2DFFA 4EJUA 3ZR8X 1YRNA 3CC4I 1FYMA 3IV5A 3CP8A 2BW3B 3JTGA 2M8EA 1SAXA 1CF7A 1E2XA 3L2WA 2PBIA 4D5CA 4EQQA 1GT0C 2NVUB 3UNGC 3V8LA 3KP6A 3HRSA 4CGZA 3FF5A 4QTRA 4OU0A 3C2HA 3PFYA 3F6VA 2JSPA 2DK5A 5D5UB 3B02A 5J8CA 4XLPF 5E3OA 4PJLA 1Q1HA 4Y4RA 3GFIA 2WV1A 1NG7A 4IJAA 3G1MA 1ITYA 1L3LA 1REPC 1V4RA 2HZTA 1D5YA 4HZFA 3GCMA 1QRYA 3GTKJ 3JW4A 3HM5A 3LSIA 2W4SA 3OSGA 3CTAA 3M7GA 5C3EJ 1MJ9A 3OMYA 3L2CA 3O6BB 2HYFA 4EM1A 4CCKA 3S32A 2KISA 2KDZA 1JJ8C 2GM4A 1VQ6I 1JXSA 1DP7P 5C4XJ 1RZ4A 4BE1A 3CF2A 1R5HA 4XICA 4A3LJ 1YS7A 2V26A 2VBXA 3I3LA 1A6IA 5FD6A 4EMSA 5FGMA 4BAYA 4D1QA 3HRTA 1ZRFA 2LKSA 1IV8A 1W5SA 2COBA 2XDVA 1DPRA 3ASOH 3KP7A 4BL0B 4UUVA 1BL0A 1FIAA 2P7VB 2BZTA 3BCBA 3F8FA 4B3XA 2YPRA 1Y0UA 3RIRA 2VB6A 5J4VA 1HDDC 4M6YA 3HKZA 3ZN0A 2ECCA 3DLAA 4AUXA 2RDPA 2CRGA 5L3BA 4IXAA 3UR3C 3EYIA 4KUMA 2X6YA 3OWTA 3JSOA 4CYCB 4LGWA 2JMWA 1U5TA 1PYVA 5FKNA 1IDYA 3RKYA 1FBUA 2FJ1A 3CO7C 2QA4I 4XR6A 1SEUA 3FHZA 4EEFG 4B1RA 1SD5A 4HF0A 1JHFA 1U2WA 3RI4A 2V7FA 2F5EA 4W1UA 1LPQA 5KVRA 2KZGA 3WGIA 3A02A 3JREA 4RGUA 4MQVA 1QGPA 1SD6A 1YW9A 3KIOA 3L2QA 1LFUP 3L00A 4HAMA 3FM3A 4KICA 1U3EM 2H6CA 3GBGA 2L7KA 3Q0UA 4ZDPA 1MSEC 4G6DA 2L3DA 2R7XA 4M3BA 2A6EF 2CSOA 3E3VA 4OAZA 3ESWB 4C3HJ 3F0CA 3OYDA 4MO7A 2FBIA 2F4MB 3HOWJ 1Z05A 3PQKA 1F1ZA 2KDOA 4BQNA 2MLKA 3X2QH 2LD5A 5TISC 3K4NA 3OYFA 4M6XA 1IV6A 5E8GA 2COMA 4MEXF 4AD9A 4LK1F 3H3VK 1JGGA 1VQ4I 3DTIA 1XPXA 1DQUA 2A6TA 2TRTA 2R7QA 2E7XA 4XKVA 5CVIA 1WHUA 1G4DA 2HVRA 4UHTA 3JR9A 3K7AJ 2P0WA 3ZMDA 1BW6A 2LKPA 1KONA 2YX4A 5E8IA 5HNFA 4Y52J 4M72A 4IOCF 5BMZA 4BE2A 2ZXWH 1WJFA 1IRGA 3PM1A 1TTYA 1L0OC 3CMYA 4XLCA 2WB1A 5DEQA 4HDVA 2XAGA 2IS2A 4I98B 5KAIC 3I56I 4MNUA 4A3IJ 1GLNA 1XGMA 1IXRC 2M87A 3HOTA 2NNYA 2ZC2A 4N4OB 2PX9A 5DM7F 1V5GA 4HYEA 3GTPJ 3SEQA 4HX7A 1MIJA 4BHBA 3PQJA 1RR7A 2FNPA 2DA4A 1BI1A 2L4AA 4WXHA 2V6EA 2VPLA 1ETQA 3QYBA 2GIZA 2P6SA 2Z16A 2R5ZB 3CCVI 1H8AC 4N9HA 3BLYA 3K4BA 2XC7A 4OIOF 2NVQJ 3K2ZA 3BPXA 2AQEA 5HS7A 2GXAA 3BR5A 1W1WE 1H9TA 4EV0A 4XLHA 1K78A 2O3FA 3P9IA 2G7HA 3LSTA 3BC8A 3RYRA 1YFHA 4A2UA 1VQKI 3BQZA 2Q2EB 2DMQA 1E0EA 2EJRA 2HDCA 1TNTA 5D8LB 5CVRA 4LMYA 4ZDLA 1XCVA 1JTYA 2W48A 1E17A 1IN7A 2XUBA 4CZCA 4S0HB 3HOSA 1J9IA 2W57A 2P8TA 3SEZA 3OYBA 3Q0WA 3W2AA 3OYEA 2CGPA 3JRIA 1SMYF 3CZ6A 2OPTA 4QSHA 3ZQIA 1PUFA 1W7PD 3CUQB 3FXOA 1S5LC 3QOEA 2K3PA 5F64A 3VYSB 2BGCA 3BQYA 3OL4A 4B44A 1UG2A 4PSWA 1P6RA 1U5TC 4WF2A 1OJLA 2GA1A 4UVAA 1WSUA 2K4JA 2Y9YA 2QENA 4NHJA 3QODA 2R93J 3LAPA 3W2WA 3C3WA 1SC7A 4LG0B 3I4MJ 2MD0A 3BTCA 3Q9SA 3HL2A 2QQ9A 3A01A 2ZJ2A 3ZQFA 2O61A 2CW8A 1Y6IA 4R79A 1XGNA 1IXSB 4JX5A 1T98A 4A5NA 3S16J 3KLNA 4RB3C 3OR1C 3ZQHA 2IS1A 1T0FC 3H3UA 1J59A 1D3YA 1HKQA 1UHWA 3MN2A 5D4RA 2H1LA 4RBOA 3U2RA 2WAQN 4I02A 3RQIA 2KIMA 5FKMA 3RQ4A 5KHDA 1JUSA 3WTSC 2EA4A 3LOCA 2FSWA 2RKHA 3RPQA 3WGGA 3BZCA 3QAHA 1MBEA 3PJRA 4IPAA 2F6CA 1XGOA 2I5UA 4AWXB 1YHQI 3J7AO 1EH8A 4P5OA 5CLSA 2W1OA 3PSIA 3B6CA 3CC7I 1LDDA 1YJNI 4NB5A 1E3OC 3FIWA 2DTZA 2LOOA 5CVVA 4CCMA 3AG1H 1FT9A 3HKZN 1S9HA 2DJIA 2LF8A 4LG3A 2Q8KA 3HOUJ 4L0YB 3CJTB 2BY1A 3SYTA 4ZYAA 5ILSA 4EM0B 2DU9A 5LD2C 1ACIA 4BNCA 4A3DJ 3H0GJ 5EEAA 1JTXA 5B66C 2LREA 3F21A 2DPUA 2DMTA 2F5DA 2K7LA 2CW0F 2DO7A 4ASNA 4OAYA 2Y75A 5K7FA 1D1BA 1YYVA 4ZYEA 3S1RJ 4JOMA 3JRDA 3G1LA 1KA8A 2E34A 1Y56A 5HS9A 2NS0A 1G8XA 2QYOA 3VEPA 2DI3A 1J7KA 4ZYGA 2X85A 4FASD 2X51A 4IHYA 4G7ZF 1IUFA 3QPTA 1NG6A 4Y13A 2LVSA 1FSEA 4IQ4A 1AA7A 2JUCA 3BOQA 2BY0A 3C7JA 1MBJA 3EUHA 3ZQQA 2OZUA 4MTDA 1ZK8A 3GO5A 2P4WA 4RS8A 3GFMA 5K7ZA 4FX4A 2Y9ZA 1Z7UA 2A6HF 2HQ5A 3QYFA 2MC4A 2R7FA 4BQQA 4ITVA 1JT6A 2AHQA 3BG9A 3VSKA 2OTLI 3WU1B 1VQNI 1SD7A 2M7AA 1MBKA 3KETA 2NYXA 3ZRGA 5LRRA 3I59B 3REOA 4G7HF 2DODA 3W6JB 3MKYB 3K70C 3I4NJ 1ZYRF 4JX4A 1W7PA 2L9VA 2XROA 3RKQA 2OZ6A 2ZNYA 5M5WJ 2M0MA 2Z9OA 3P9CA 1HW5A 3DP7A 3CDIA 2RQPA 1TWGJ 4LB5A 3BTJA 4KFCA 2B7EA 4KT5C 4JP0A 4BACA 1P9QC 3E1SA 4BQAA 3A03A 1EKEA 2WB1N 4UVCA 4RB1A 5E17F 4XLAA 4BU2A 3BG6A 1ZQ3P 2QZ8A 1ONVA 3CCRI 1B8IA 2X6WA 2ME0A 1J5YA 4PCQA 4ZYHA 3BDDA 1LFBA 4E4HA 3NRVA 2XGEA 4RAFA 3LFUA 9ANTA 5IP9J 1TLHB 2CYYA 1N75A 3T5XA 3CCSI 1BJAA 3ASNH 4BKXA 4HNTA 1H88C 3OOUA 3I0TA 1RR8C 1IGNA 3NQOA 2M5WA 1TT5B 2O5RA 1V5FA 1SANA 4M9ZA 2L7MP 2DBBA 5HLHA 5D5WB 1FMWA 3IRQA 3HTSB 4D5FA 1IRXA 1BA5A 4UB8C 4YIFA 2A69F 1WJ5A 4PJ0C 2IVMA 2DDBA 3OIQA 4BXXJ 2W84A 1J09A 4NDLA 3VODA 3OYAA 5DDGA 5F04A 1K6OA 2EV0A 1UHSA 2VOPA 4OIQF 2OV7A 2VPRA 2DJNA 3IC7A 4HRIA 5B5EC 2N8GA 1TWFJ 3OS2A 1BI0A 1O7LA 1S7AA 2R7OA 3F9KA 2KZVA 5GTHC 2VQGA 2L7FP 4I0BA 1KZHA 5F08A 4BJ6C 3GX4X 1HW1A 1LFPA 2JRMA 4UUTA 1OCTC 5JR3A 1FOXA 3ROUA 2K4BA 3MKLA 4XM3A 1R58A 2M3AA 4DBQA 3BJOA 1JUPA 4EJWA 2FQ3A 5E3NA 5GTIC 3RTRA 3T8RA 1A6QA 4Q4ZF 2QSFX 4HLXA 4P9UA 2VE8A 1WH7A 5HDNA 4E7JA 5KK1A 1QNTA 2CJJA 3H9QA 3W6KB 3D5RC 1XMXA 2VE9A 3NWSA 1WI3A 1R9TJ 3HBLA 5HLTA 1R00A 4LK0F 1DGRM 3GZNB 5EGOA 1J0RA 2WTEA 3OOPA 1V55H 4U0VA 3VFZA 3CP2A 2Z5UA 4EGZA 1HW2A 3QWLA 3ML6A 4XK4A 4C30A 1W36C 5EG0B 2K9LA 1S3JA 2XGCA 1TWHJ 1WI9A 3I54A 5FKOA 2R7UA 3EUHC 4E6KG 3GTOJ 3S3NA 2MC3A 4L9TA 1AOYA 1IZ1A 2QKLB 5EEHA 2R7RA 3C2BA 2MFZA 2E2JJ 4ETSA 1ZLKA 2WBMA 1MMNA 2FQ4A 3ZQCA 3FMSA 1CGPA 1LDKB 4TV7A 3GEZA 1USSA 3ZQ7A 2IPQX 1FOWA 2HOSA 5LHIA 1WQ2A 2HQRA 4E7LA 1RUOA 2CW7A 3HC7A 2CQNA 5CYVA 3AL0B 1QU3A 5FLXK 4EVIA 4IVNA 4WK8F 5K5QA 3QU3A 1OYYA 3H5RA 1EV7A 1RC9A 3ZMVA 3L9FA 2E1OA 1LDJA 4BY7J 1GV2A 2CG4A 2NVTJ 2LKXA 2KFDA 2HQAA 5GPCA 4CSWA 1Z6RA 4IZZA 3WTZA 5J1YA 3CMAI 5BPDA 3WHBA 1OFCX 3FMQA 4KIGA 5D4SA 5L3GA 1FPQA 2X48A 2LBFB 1IRZA 2CU7A 4QWQA 5GAEJ 3K10A 4UUSB 4GFBA 1R1TA 2CQXA 1FYLA 3E0JB 2Y30A 5GP9A 4AM3A 4G7OF 1S6LA 4AVZA 2GQQA 3WODF 3JAMZ 4XN0A 5ED4A 4XORA 1XTAA 1BBYA 2CUFA 1MMDA 2JSCA 3IUOA 5J4YA 2O8KA 2AO9A 2M4KA 1KQ9A 2L0KA 1B72A 2CQKA 3GYHX 3O8HA 4ENNA 3H35A 3MKWB 2K40A 4GYIA 4OMZA 3HOVJ 2E71A 4PJJA 2P5LC 3ECOA 3A2KA 2GZWA 2RNJA 3TEDA 1OCPA 4M9SA 2DT7B 1BOAA 2HYJA 3K4LA 3KE2A 4FX0A 2VLAA 3M1CA 4I76A 2WV0A 1VI0A 1XDSA 5F27A 1RRJA 4KMFA 4LD5A 1X2MA 3MVPA 1BIAA 3TO6A 1JJ6C 1Z3XA 1D8JA 2K9MA 4S04A 2EFPA 2D1VA 4C2TA 4G6QA 1I1SA 5K5OA 2HR3A 4AC0A 1OMIA 1SFOJ 2HWVA 5H2FC 4HX8A 1QA6A 5K7HA 2MLGA 4HA8A 3CCUI 3ECHA 4RAZA 5ICFA 2LSOA 1WFXA 5F6FA 1BR4A 1XGSA 1NK2P 2G7UA 3FM5A 4V2GA 1AWCA 3JAMK 3Q5FA 1TW2A 1TQMA 3IH2A 4CCLA 3BG3A 1E3PA 1A31A 1ON2A 3ZXSA 5J47A 3GTLJ 3BJ6A 1VQLI 4J00A 1IRFA 2LRDA 2Y2ZA 5GPAA 3C1DA 3PIPF 3F8MA 2BOLA 2R7DA 4BS9A 2AS5F 1MMSA 3WHCA 4R1HA 2TDXA 2BHYA 1ZG3A 1RNLA 4IHVA 2ZO4A 3IHUA 1HQCA 1TWAJ 2OA4A 1YIOA 2PJPA 1U78A 3HPHA 5B1AH 2CMPA 4G9YA 1S29A 1YOVB 2V1NA 3R4KA 4A6DA 2KHMA 3M3YJ 1AKHA 4U87A 1ETVA 3Q0VA 4M3FA 5DCMB 3M8EA 2ZMEA 2VKDA 4IHXA 1OPCA 2V9PA 2ELJA 3DPLC 2ESNA 2YR2A 3PNYA 4XNFA 2QEXI 5IY5H 4II3A 4ENMA 1TP4A 2RNGA 1FOYA 1ETKA 2L9NA 4D9JA 1AHDP 4AYBN 2JVGA 5BNGA 2CV0A 5DM6F 2I10A 4RGSA 4IRGA 2PMUA 1WVRA 2XHKA 2XF7A 2DN0A 2STWA 4A3KJ 2F5VA 2LF7A 2XB0X 2ZCWA 3QPSA 2CO5A 3LA7A 1YQAA 5DS9A 4JQFA 3KZIC 4IO9F 3WGHA 2HKOA 2VIXA 5LHHA 3J80Z 5J1RA 2DK8A 1KU3A 1OR7A 4A12A 2ZB9A 4NQWB 4B3AA 2IP2A 4G6TB 2R3SA 2IEKA 4B43A 3E5QA 4L5EA 5E79C 5IT9Z 2JA8J 4ZTJA 2FMYA 2VC0A 3HRMA 3DF8A 1WGXA 3DEEA 2QM3A 2QQAA 3FKIJ 3BR1A 4BDYA 1OCRH 3W6VA 3VB2A 1RESA 5LGUA 1VQ8I 1TNSA 1XMKA 2E36A 3LL7A 1OQYA 4FTHA 2PJRB 2EV5A 4YEJA 3OYLA 3KP5A 2M30A 4HSRA 4A93J 3SFIA 2ZJPF 2H27A 3OS1A 4EJVA 2P5VA 2VL8A 2JTVA 3OIOA 1ZRCA 2DOEA 4G8XA 2F2EA 2VONA 1GV5A 4RLQA 4PGGA 3RPUD 1YRNB 1QPIA 3CLOA 3OYNA 1HOMA 5DYMA 5CPRB 3ZGKA 3PIOF 3DLLF 5IP7J 5IP6A 2MG4A 2LY1A 4CUGA 1CF7B 3ZMZA 1VQ9I 4Y7NJ 1SVLA 1ETYA 2PI0A 3R0JA 4HNVA 4LIUA 2IGKA 3J80K 3ELKA 4ZC3A 5IOZA 5LGTA 1X1AA 5EEGA 1UELB 3GTMJ 3AG2H 4I7HA 4A0XA 1MSFC 3CMMA 5IT9K 3E5XA 1ZGJA 1LEBA 3L2VA 2E1NA 3LA3A 5JI6A 2R7SA 4L18B 3N05A 1O3TA 1EA3A 1HBXG 5L3CA 4FE7A 1IXCA 2HDWA 1MGTA 1FBSA 3R61A 3F23A 4XIDA 3OV8A 3MWMA 3GW2A 1XD7A 4F3QA 1D0ZA 2BEOA 2RN7A 3S2DJ 3JRGA 2MBFA 2JUGA 2M9HA 2VBYA 2FNAA 2E5ZA 2DA2A 3JRAA 3SZTA 2HXOA 3E6BA 3FXQA 3T8TA 2O0YA 3HOZJ 2WC2A 1MNDA 2HPMA 2GBYA 2KMUA 1FX7A 2KT0A 4I01A 4PSXA 2K27A 1WZ2A 3MFKA 2O9LA 2BE5F 2KRFA 3ABUA 3HGYA 1TW3A 3GLXA 1YITI 2KL4A 4LLGF 3HOYJ 4BXUA 3V7RA 1IDZA 2EWNA 4KA4A 2GIVA 3KZZA 1POGA 2DT6A 2OUMA 3KP4A 4D7NA 3KEQA 4BEHA 4N0BA 4O5VA 1B4AA 3HHGA 1LNWA 4OIPF 3V42A 3B6AA 1LKXA 1OCZH 1U5TB 3ZQLA 1K4TA 1JT0A 1B1BA 5J6XA 3KP2A 4LB6B 2LY2A 2OJED 3BZKA 2YU9J 1ZELA 2EZLA 1I3AA 2PMZA 1X3ZB 3HHHA 4MQ9F 1SD4A 1UG0A 2DQRA 3PSFA 3TW6A 1O3SA 3WG7H 2OF7A 2EB7A 2VQHA 4HW0A 1ZLJA 2B0LA 5H6RA 1V3FA 4CCNA 2NXNB 2VN2A 4HLYA 4KISA 2QWWA 3OSFA 2M1BA 1QVUA 3F3XA 1VQPI 1IJWC 2OD5A 2F4IA 3PFIA 1Z1DA 1P4WA 1FEXA 3PO2J
chains in the Genus database with same CATH topology
2XGEA 1ETWA 1XC5A 9ANTA 5IP9J 3ZOBA 4A69C 3PO3J 4B4CA 1ORKA 1B72B 1ZGWA 4BKXA 1FTZA 1H88C 3OOUA 1QVTA 1F43A 1IGNA 2R92J 1ETXA 2XRLA 2R5YA 2IAIA 2X9DA 2JN6A 1SANA 2L7MP 2X6OA 1BW5A 4D5FA 3UKGA 1BA5A 1XG1A 5F1JA 3G1OA 5EDNA 2DMNA 1ZR2A 1MBGA 3NAUA 3QQAA 1K61A 4BXXJ 3HEFA 3S17J 5FKLA 2MW8A 1A5JA 1NTCA 4IHWA 4NDLA 1WCMJ 3VPRA 4M3EA 4C2MJ 3CDLA 2QCOA 3BG5A 5F04A 1UHSA 1LE8B 4DYQA 3LSGA 5M3FJ 2EH3A 4IEJA 4D7MA 2VPRA 2DJNA 5F0FA 4RDUA 2N8GA 1TWFJ 3GTJJ 1YRNA 2O7OA 1ENHA 3IV5A 2G0EA 3RZOJ 1U9OA 5FLVA 2EZIA 2L7FP 1MH4A 2HOTA 5F08A 4D5CA 4UUTA 1OCTC 1GT0C 1Y1VJ 1CQTA 3MKLA 4A3JJ 4QTRA 5E3LA 2XPUA 4ABZA 1JUPA 5E3NA 5E3OA 2ELKA 3TP0A 2WV1A 3Q3SA 3G1MA 1ITYA 1WH7A 5F0CA 4C3JJ 1D5YA 1QRYA 1VNDA 2JA7J 2CJJA 3GTKJ 3HM5A 1WI3A 2EZKA 3HBLA 1R9TJ 3OSGA 2TCTA 1P7JA 1IG7A 5C3EJ 3FK7A 2KDZA 1AKHB 5EGOA 2GM4A 1JJ8C 2E19A 1ZTRA 4FISA 5C4XJ 2EBIA 4XICA 4A3LJ 2K9NA 1A6IA 5F0HA 4XK4A 5J3LA 2NOGA 2NS8A 5EG0B 1K83J 2XGCA 5E3MA 4A3CJ 1TWHJ 2COBA 5FKOA 4BBSJ 1G2HA 2JJ7A 1IC8A 4MFDA 3GTOJ 1ZKGA 3S1NJ 3C2BA 1TC3C 2E2JJ 2LFBA 4JX6A 2ECBA 1BL0A 1FIAA 4JYKA 1Y1WJ 1PUFB 1S7EA 3BT9A 4MIMA 4BY1J 1VF9A 2FQ4A 5M5XJ 3JRHA 3ZQCA 2D5VA 1HDDC 2HI3A 1Z0XA 3S1QJ 3K2AA 2ECCA 4AUXA 3TW7A 2CRGA 2EQRA 4XRMA 1I50J 2QF7A 2HOSA 4QIWN 4CYCB 3D1NI 2JMWA 3BR2A 5FKNA 1IDYA 4BBRJ 2FJ1A 2LP0A 3A01B 2MGQA 2ID6A 2E1OA 4BY7J 4EEFG 1GV2A 4B1RA 4DYCA 2LKXA 2CUEA 2H8RA 2NVTJ 4A3BJ 5GPCA 3S2HJ 3S14J 5J1YA 4W1UA 5C44J 3A02A 3WHBA 3JREA 1VFCA 1OFCX 1LFUP 5EZHA 3GBGA 2X48A 1IRZA 2CU7A 2NVYJ 4UUSB 4GFBA 1O4XA 3Q0UA 1AU7A 2ME6A 3IH3A 1MSEC 2CQXA 4M3BA 2DMPA 2Y30A 5GP9A 2R7ZJ 4C3HJ 3F0CA 3DEWA 1WPKA 4MO7A 5EZGA 1HCRA 2JK3A 2B63J 1EF4A 3HOWJ 2CUFA 1HLVA 2HOAA 2O8KA 2AO9A 2LD5A 2VUMJ 2L0KA 2LTPA 1DU0A 2DA1A 1B72A 1T56A 3O8HA 1H89C 2K40A 3HOVJ 2E2IJ 1IV6A 3H3VK 2YS9A 4LOCA 5M5YJ 1JGGA 1BJZA 2DA3A 2M34A 3GTGJ 1MH3A 2TRTA 3TEDA 1OCPA 2FD5A 3LSJA 1RPWA 4MFEA 2HYJA 4M3GA 2XB5A 3HOXJ 3LNQA 3TP3A 3JR9A 3K7AJ 4I76A 2PMZN 5F27A 1VI0A 2DMUA 5IPAA 2NS7A 1X2MA 1BW6A 3MVPA 1JJ6C 2LY9A 4Y52J 3PM1A 1LE8A 2XPWA 4AC0A 3CMYA 1SFOJ 1APLC 2DA6A 5K7HA 1JKQC 2IBDA 2ID3A 3RZDJ 4X1EA 4A3IJ 1NK2P 4V2GA 1JKPC 5FLMJ 3IH2A 2GLOA 2JA6J 3BG3A 4FCYA 3GTLJ 3GTPJ 2L7ZA 2Y2ZA 5GPAA 1RR7A 3JRCA 2DA4A 3HB9A 3O8GA 1ETQA 3WHCA 4IHVA 2XSDC 2R5ZB 2M0CA 1H8AC 2NVQJ 3SJMA 2M8GX 1TWAJ 3BR5A 1U78A 1I6HJ 1FIPA 3BR3A 3ZQGA 3M3YJ 3JRFA 1FJLA 1T33A 1AKHA 4DW6A 1ETVA 3BQZA 3Q0VA 4M3FA 2DMQA 5M3MJ 4A3GJ 4IHXA 1JTYA 2W48A 5EG0A 3HGGA 4S0HB 1NK3P 3M4OJ 3QPLA 3Q0WA 2LR8A 1GDTA 1ETKA 1U9NA 1AHDP 4AYBN 3SDGA 1RKWA 2VI6A 5BNGA 2I10A 3JRIA 1B8IB 2CQQA 2OPTA 4QSHA 3ZQIA 1PUFA 2DN0A 2RAEA 4A3KJ 2XB0X 4I6ZA 3QPSA 5DS9A 4V2FA 1JKRC 3BQYA 1UG2A 1OJLA 5J1RA 4W97A 4X6AJ 5EYRA 2Y9YA 1RETA 2R5YB 4FE4A 2R93J 2ZB9A 4G12A 4B3AA 4CYCA 2Y31A 1Z77A 3CCYA 4M3DA 2IEKA 1GUUA 1Q1VA 3BTCA 4L5EA 1HF0A 2JA8J 3A01A 3ZQFA 2L9RA 1WGXA 3FKIJ 3I4MJ 3BR1A 1MBFA 3IH4A 3W6VA 1RESA 3BR6A 4FTHA 4JX5A 5IYDJ 2DA7A 2FX0A 3S16J 4DZJA 4A93J 3SFIA 3ZQHA 3NARA 1ETOA 4A3MJ 3OIOA 3S1MJ 4C3IJ 3MN2A 5FKKA 3BR0A 4RBOA 2WAQN 1UMQA 1TWCJ 3RQIA 5FKMA 1GV5A 4UUSA 2NVXJ 4MLOA 1JUSA 1YRNB 1QPIA 1HOMA 5JLWA 3LOCA 2E2HJ 5IP7J 5IP6A 1MBEA 2MG4A 4J19A 3HDDA 2K9SA 4Y7NJ 3E7LA 2H1KA 1F36A 1ETYA 4A3EJ 3B6CA 1ZR4A 4HNVA 1W0TA 1FTTA 2DA5A 1E3OC 3FIWA 4DYRA 2DTZA 1W0UA 2Y0SN 5IOZA 2JA5J 1RKTA 3CQZJ 3HKZN 3GTMJ 3HOUJ 4M6VA 1MSFC 4A3DJ 3H0GJ 5EEAA 1JTXA 2EZHA 5IOYA 1MNMC 2DMTA 3FISA 1X2NA 4FE7A 5K7FA 5EGOB 3JRBA 3S1RJ 3JRDA 4XIDA 3G1LA 1X58A 5JLXA 3S15J 2LLKA 1GVDA 5DTDA 3LSPA 3S2DJ 3JRGA 4IHYA 2LK2A 2M2EA 3DCFA 1IUFA 2M9HA 2VKEA 2DA2A 4XRSA 3JRAA 2LVSA 2HXOA 2HXIA 1JUMA 3HOZJ 2GBYA 2XGDA 2KT0A 1MBJA 2MSYA 2O9LA 1ZK8A 3HGYA 5K7ZA 3BTLA 3L1PA 3LSRA 1MBHA 3HOYJ 2Y9ZA 1IDZA 2R0QC 2HQ5A 1POGA 2R5ZA 2K9QA 2JWTA 3FK6A 4D7NA 1JT6A 2AHQA 3BG9A 3B6AA 1XS9A 1I3QJ 4A3FJ 1U8BA 3ZQLA 1JT0A 2VKVA 1MBKA 2YU9J 2EZLA 1HDPA 1DU6A 3TW6A 3GTQJ 5C4JJ 3I4NJ 1P7IA 4JX4A 2OF7A 3RKQA 5J1UA 5M5WJ 2XPVA 1JKOC 2YUSA 1TWGJ 3BTJA 4DZPA 2P81A 4JP0A 1WH5A 3A03A 2WB1N 3OSFA 1QVUA 1ZQ3P 4XRSG 3BTIA 5IYBJ 1IJWC 5FJ8J 2HDDA 1B8IA 2ME0A 5EF6A 1FEXA 5IYCJ 3PO2J 1LFBA 5HODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGE A;  1ETW A;  1XC5 A;  9ANT A;  5IP9 J;  3ZOB A;  4A69 C;  3PO3 J;  4B4C A;  1ORK A;  1B72 B;  1ZGW A;  4BKX A;  1FTZ A;  1H88 C;  3OOU A;  1QVT A;  1F43 A;  1IGN A;  2R92 J;  1ETX A;  2XRL A;  2R5Y A;  2IAI A;  2X9D A;  2JN6 A;  1SAN A;  2L7M P;  2X6O A;  1BW5 A;  4D5F A;  3UKG A;  1BA5 A;  1XG1 A;  5F1J A;  3G1O A;  5EDN A;  2DMN A;  1ZR2 A;  1MBG A;  3NAU A;  3QQA A;  1K61 A;  4BXX J;  3HEF A;  3S17 J;  5FKL A;  2MW8 A;  1A5J A;  1NTC A;  4IHW A;  4NDL A;  1WCM J;  3VPR A;  4M3E A;  4C2M J;  3CDL A;  2QCO A;  3BG5 A;  5F04 A;  1UHS A;  1LE8 B;  4DYQ A;  3LSG A;  5M3F J;  2EH3 A;  4IEJ A;  4D7M A;  2VPR A;  2DJN A;  5F0F A;  4RDU A;  2N8G A;  1TWF J;  3GTJ J;  1YRN A;  2O7O A;  1ENH A;  3IV5 A;  2G0E A;  3RZO J;  1U9O A;  5FLV A;  2EZI A;  2L7F P;  1MH4 A;  2HOT A;  5F08 A;  4D5C A;  4UUT A;  1OCT C;  1GT0 C;  1Y1V J;  1CQT A;  3MKL A;  4A3J J;  4QTR A;  5E3L A;  2XPU A;  4ABZ A;  1JUP A;  5E3N A;  5E3O A;  2ELK A;  3TP0 A;  2WV1 A;  3Q3S A;  3G1M A;  1ITY A;  1WH7 A;  5F0C A;  4C3J J;  1D5Y A;  1QRY A;  1VND A;  2JA7 J;  2CJJ A;  3GTK J;  3HM5 A;  1WI3 A;  2EZK A;  3HBL A;  1R9T J;  3OSG A;  2TCT A;  1P7J A;  1IG7 A;  5C3E J;  3FK7 A;  2KDZ A;  1AKH B;  5EGO A;  2GM4 A;  1JJ8 C;  2E19 A;  1ZTR A;  4FIS A;  5C4X J;  2EBI A;  4XIC A;  4A3L J;  2K9N A;  1A6I A;  5F0H A;  4XK4 A;  5J3L A;  2NOG A;  2NS8 A;  5EG0 B;  1K83 J;  2XGC A;  5E3M A;  4A3C J;  1TWH J;  2COB A;  5FKO A;  4BBS J;  1G2H A;  2JJ7 A;  1IC8 A;  4MFD A;  3GTO J;  1ZKG A;  3S1N J;  3C2B A;  1TC3 C;  2E2J J;  2LFB A;  4JX6 A;  2ECB A;  1BL0 A;  1FIA A;  4JYK A;  1Y1W J;  1PUF B;  1S7E A;  3BT9 A;  4MIM A;  4BY1 J;  1VF9 A;  2FQ4 A;  5M5X J;  3JRH A;  3ZQC A;  2D5V A;  1HDD C;  2HI3 A;  1Z0X A;  3S1Q J;  3K2A A;  2ECC A;  4AUX A;  3TW7 A;  2CRG A;  2EQR A;  4XRM A;  1I50 J;  2QF7 A;  2HOS A;  4QIW N;  4CYC B;  3D1N I;  2JMW A;  3BR2 A;  5FKN A;  1IDY A;  4BBR J;  2FJ1 A;  2LP0 A;  3A01 B;  2MGQ A;  2ID6 A;  2E1O A;  4BY7 J;  4EEF G;  1GV2 A;  4B1R A;  4DYC A;  2LKX A;  2CUE A;  2H8R A;  2NVT J;  4A3B J;  5GPC A;  3S2H J;  3S14 J;  5J1Y A;  4W1U A;  5C44 J;  3A02 A;  3WHB A;  3JRE A;  1VFC A;  1OFC X;  1LFU P;  5EZH A;  3GBG A;  2X48 A;  1IRZ A;  2CU7 A;  2NVY J;  4UUS B;  4GFB A;  1O4X A;  3Q0U A;  1AU7 A;  2ME6 A;  3IH3 A;  1MSE C;  2CQX A;  4M3B A;  2DMP A;  2Y30 A;  5GP9 A;  2R7Z J;  4C3H J;  3F0C A;  3DEW A;  1WPK A;  4MO7 A;  5EZG A;  1HCR A;  2JK3 A;  2B63 J;  1EF4 A;  3HOW J;  2CUF A;  1HLV A;  2HOA A;  2O8K A;  2AO9 A;  2LD5 A;  2VUM J;  2L0K A;  2LTP A;  1DU0 A;  2DA1 A;  1B72 A;  1T56 A;  3O8H A;  1H89 C;  2K40 A;  3HOV J;  2E2I J;  1IV6 A;  3H3V K;  2YS9 A;  4LOC A;  5M5Y J;  1JGG A;  1BJZ A;  2DA3 A;  2M34 A;  3GTG J;  1MH3 A;  2TRT A;  3TED A;  1OCP A;  2FD5 A;  3LSJ A;  1RPW A;  4MFE A;  2HYJ A;  4M3G A;  2XB5 A;  3HOX J;  3LNQ A;  3TP3 A;  3JR9 A;  3K7A J;  4I76 A;  2PMZ N;  5F27 A;  1VI0 A;  2DMU A;  5IPA A;  2NS7 A;  1X2M A;  1BW6 A;  3MVP A;  1JJ6 C;  2LY9 A;  4Y52 J;  3PM1 A;  1LE8 A;  2XPW A;  4AC0 A;  3CMY A;  1SFO J;  1APL C;  2DA6 A;  5K7H A;  1JKQ C;  2IBD A;  2ID3 A;  3RZD J;  4X1E A;  4A3I J;  1NK2 P;  4V2G A;  1JKP C;  5FLM J;  3IH2 A;  2GLO A;  2JA6 J;  3BG3 A;  4FCY A;  3GTL J;  3GTP J;  2L7Z A;  2Y2Z A;  5GPA A;  1RR7 A;  3JRC A;  2DA4 A;  3HB9 A;  3O8G A;  1ETQ A;  3WHC A;  4IHV A;  2XSD C;  2R5Z B;  2M0C A;  1H8A C;  2NVQ J;  3SJM A;  2M8G X;  1TWA J;  3BR5 A;  1U78 A;  1I6H J;  1FIP A;  3BR3 A;  3ZQG A;  3M3Y J;  3JRF A;  1FJL A;  1T33 A;  1AKH A;  4DW6 A;  1ETV A;  3BQZ A;  3Q0V A;  4M3F A;  2DMQ A;  5M3M J;  4A3G J;  4IHX A;  1JTY A;  2W48 A;  5EG0 A;  3HGG A;  4S0H B;  1NK3 P;  3M4O J;  3QPL A;  3Q0W A;  2LR8 A;  1GDT A;  1ETK A;  1U9N A;  1AHD P;  4AYB N;  3SDG A;  1RKW A;  2VI6 A;  5BNG A;  2I10 A;  3JRI A;  1B8I B;  2CQQ A;  2OPT A;  4QSH A;  3ZQI A;  1PUF A;  2DN0 A;  2RAE A;  4A3K J;  2XB0 X;  4I6Z A;  3QPS A;  5DS9 A;  4V2F A;  1JKR C;  3BQY A;  1UG2 A;  1OJL A;  5J1R A;  4W97 A;  4X6A J;  5EYR A;  2Y9Y A;  1RET A;  2R5Y B;  4FE4 A;  2R93 J;  2ZB9 A;  4G12 A;  4B3A A;  4CYC A;  2Y31 A;  1Z77 A;  3CCY A;  4M3D A;  2IEK A;  1GUU A;  1Q1V A;  3BTC A;  4L5E A;  1HF0 A;  2JA8 J;  3A01 A;  3ZQF A;  2L9R A;  1WGX A;  3FKI J;  3I4M J;  3BR1 A;  1MBF A;  3IH4 A;  3W6V A;  1RES A;  3BR6 A;  4FTH A;  4JX5 A;  5IYD J;  2DA7 A;  2FX0 A;  3S16 J;  4DZJ A;  4A93 J;  3SFI A;  3ZQH A;  3NAR A;  1ETO A;  4A3M J;  3OIO A;  3S1M J;  4C3I J;  3MN2 A;  5FKK A;  3BR0 A;  4RBO A;  2WAQ N;  1UMQ A;  1TWC J;  3RQI A;  5FKM A;  1GV5 A;  4UUS A;  2NVX J;  4MLO A;  1JUS A;  1YRN B;  1QPI A;  1HOM A;  5JLW A;  3LOC A;  2E2H J;  5IP7 J;  5IP6 A;  1MBE A;  2MG4 A;  4J19 A;  3HDD A;  2K9S A;  4Y7N J;  3E7L A;  2H1K A;  1F36 A;  1ETY A;  4A3E J;  3B6C A;  1ZR4 A;  4HNV A;  1W0T A;  1FTT A;  2DA5 A;  1E3O C;  3FIW A;  4DYR A;  2DTZ A;  1W0U A;  2Y0S N;  5IOZ A;  2JA5 J;  1RKT A;  3CQZ J;  3HKZ N;  3GTM J;  3HOU J;  4M6V A;  1MSF C;  4A3D J;  3H0G J;  5EEA A;  1JTX A;  2EZH A;  5IOY A;  1MNM C;  2DMT A;  3FIS A;  1X2N A;  4FE7 A;  5K7F A;  5EGO B;  3JRB A;  3S1R J;  3JRD A;  4XID A;  3G1L A;  1X58 A;  5JLX A;  3S15 J;  2LLK A;  1GVD A;  5DTD A;  3LSP A;  3S2D J;  3JRG A;  4IHY A;  2LK2 A;  2M2E A;  3DCF A;  1IUF A;  2M9H A;  2VKE A;  2DA2 A;  4XRS A;  3JRA A;  2LVS A;  2HXO A;  2HXI A;  1JUM A;  3HOZ J;  2GBY A;  2XGD A;  2KT0 A;  1MBJ A;  2MSY A;  2O9L A;  1ZK8 A;  3HGY A;  5K7Z A;  3BTL A;  3L1P A;  3LSR A;  1MBH A;  3HOY J;  2Y9Z A;  1IDZ A;  2R0Q C;  2HQ5 A;  1POG A;  2R5Z A;  2K9Q A;  2JWT A;  3FK6 A;  4D7N A;  1JT6 A;  2AHQ A;  3BG9 A;  3B6A A;  1XS9 A;  1I3Q J;  4A3F J;  1U8B A;  3ZQL A;  1JT0 A;  2VKV A;  1MBK A;  2YU9 J;  2EZL A;  1HDP A;  1DU6 A;  3TW6 A;  3GTQ J;  5C4J J;  3I4N J;  1P7I A;  4JX4 A;  2OF7 A;  3RKQ A;  5J1U A;  5M5W J;  2XPV A;  1JKO C;  2YUS A;  1TWG J;  3BTJ A;  4DZP A;  2P81 A;  4JP0 A;  1WH5 A;  3A03 A;  2WB1 N;  3OSF A;  1QVU A;  1ZQ3 P;  4XRS G;  3BTI A;  5IYB J;  1IJW C;  5FJ8 J;  2HDD A;  1B8I A;  2ME0 A;  5EF6 A;  1FEX A;  5IYC J;  3PO2 J;  1LFB A;  5HOD A; 
#chains in the Genus database with same CATH topology
 4P96 A;  1WRJ A;  1Y8R B;  3V4G A;  4CXF A;  1XC5 A;  1TZL A;  1VQM I;  4CHU A;  5CVJ A;  3ZOB A;  2LH9 A;  1OR7 C;  4A69 C;  4XSX F;  1ZGW A;  2X6X A;  2XGX A;  3C18 A;  1QVT A;  3K4M A;  2JA2 A;  1G6N A;  4XRF A;  5LRS A;  4N9I A;  1F43 A;  2H94 A;  4OOI A;  2R5Y A;  2IAI A;  3LQR A;  1YX3 A;  3GWZ A;  2W82 A;  1YW7 A;  2L4M A;  3AG3 H;  5ICC A;  3OIP A;  2VXZ A;  2LYC A;  3KZY A;  2JZY A;  2QLZ A;  4HG2 A;  3BJA A;  4RAY A;  3F22 A;  3UKG A;  4ZTF A;  2DMN A;  5D8K B;  1SFE A;  1JGS A;  2XF5 A;  1VTN C;  3NAU A;  5FFX A;  1Z3Y A;  2QGU A;  3HEF A;  3CCJ I;  2ZJQ F;  4BH9 A;  3E6D A;  5GAG J;  1F9N A;  4P9F A;  1JHH A;  2W24 A;  4C2M J;  1JI8 A;  3BG5 A;  5DUI A;  2VT2 A;  4PGH A;  4DYQ A;  4ZJZ A;  5ICG A;  3SHF A;  3NEU A;  4IEJ A;  4JBA A;  4D7M A;  2HEO A;  2F5F A;  1YG2 A;  3GTJ J;  5J8F A;  2O7O A;  3KPH A;  3COA C;  1X4P A;  2JRT A;  2RC4 A;  3HUG A;  5TJJ A;  4DGW B;  1XX5 A;  3RZO J;  2EZI A;  2HOT A;  4M9X A;  2BY2 A;  2NOJ B;  3DXJ F;  1Y1V J;  4CO8 A;  3FBI B;  3KYC B;  3DPU A;  3NWT A;  2XPU A;  3J7Z I;  1STZ A;  2KRC A;  3MZ8 A;  4GGG A;  1R6R A;  2IGO A;  4ANJ A;  4ZDO A;  2ELK A;  2VAS A;  2IXS A;  1FP1 D;  3TP0 A;  3K4J A;  4QPQ A;  2HKX A;  2IA0 A;  3N4M A;  1ZRD A;  1HA8 A;  2O8X A;  4HOB A;  2OCC H;  4V19 K;  1ZG5 A;  3O3K A;  1MDM A;  1YTY A;  2FOW A;  3EYY A;  1T39 A;  2RV8 A;  1BI3 A;  5AIP A;  2GAU A;  2NAZ A;  2A5W A;  1K78 B;  1HKS A;  2EZK A;  4HBL A;  4UB6 C;  5DV5 A;  2TCT A;  1HXD A;  1P7J A;  3RCO A;  1IG7 A;  5HDG A;  4PZJ A;  2DPD A;  4FIS A;  2FOK A;  3MAJ A;  4QLC U;  1S7O A;  2EBI A;  2PMH A;  4OWR B;  2DW4 A;  5F0H A;  1D1C A;  2CUZ A;  2NOG A;  2H09 A;  2NS8 A;  3W2V A;  4U7B A;  2XAJ A;  2Z3Y A;  3EET A;  4HEA 2;  3WTU C;  2IS6 A;  2Y69 H;  4A3C J;  1G2H A;  4BBS J;  2JJ7 A;  3DPT A;  2Z99 A;  2FE3 A;  4MFD A;  3V7S A;  2XV4 S;  5JVT A;  3S1N J;  4WWC A;  1B6A A;  3WTX C;  1TC3 C;  2LFB A;  1D8K A;  2ECB A;  1XSX A;  4GXO A;  1GXP A;  4JYK A;  1RUN A;  2EIK H;  1PUF B;  1S7E A;  3BT9 A;  3Q9V A;  4MIM A;  4BY1 J;  4PDK A;  1WKM A;  2D5V A;  2VOO A;  5M5X J;  1MW7 A;  3S2W A;  2HI3 A;  1MZB A;  2Y0S A;  2ETH A;  4L5I A;  2WAF A;  3ULQ B;  4EM2 A;  5E1X A;  1B9N A;  1I50 J;  2QKM B;  4QIW N;  2J5P A;  1FBQ A;  3D1N I;  4RGR A;  2MAB A;  3EUK L;  5AON A;  2XKP A;  2A61 A;  3A01 B;  2KJB A;  3OYK A;  4NC7 A;  5E1Z B;  1BC7 C;  4JK1 X;  5JHF A;  3BZ6 A;  1HSJ A;  3CCQ I;  2CQ7 A;  1J75 A;  3H5N A;  1PJR A;  1VQO I;  4IL6 C;  2CUE A;  3M9A A;  3S3M A;  2H8R A;  1YLF A;  3S14 J;  1H9G A;  2EFW A;  1B59 A;  3KFW X;  1VFC A;  3TQN A;  5FB2 A;  4RB2 C;  5CQG A;  4KJZ A;  2NVY J;  1QZE A;  2RQQ A;  2V9K A;  2B9S A;  1O4X A;  4CYD A;  4IRH A;  1IF1 A;  3WTV C;  3I64 A;  4DBR A;  4KNY A;  2R7Z J;  4U7D A;  3DEW A;  5CQE A;  1GHC A;  2FUG 2;  2DTR A;  3I58 A;  2JK3 A;  1E3H A;  2B63 J;  1EF4 A;  1HLV A;  2ZSI B;  3R60 A;  5H20 A;  3IWZ A;  4EAT A;  6PAX A;  1YJW I;  4LFU A;  2DA1 A;  5KNL A;  3CJN A;  5GAD J;  5BQT A;  1K4S A;  1F4K A;  1SAU A;  2YS9 A;  3LSH A;  3FZV A;  3QYE A;  1Y8Q B;  2M34 A;  2OTJ I;  4MEY F;  3GTG J;  1J2X A;  1QZZ A;  2FD5 A;  3HSR A;  1RPW A;  4D0P A;  1XN7 A;  2XSJ C;  3KEY A;  4QPO A;  3LNQ A;  1JE8 A;  3TP3 A;  5BS6 A;  4HQM A;  4GYG A;  2L02 A;  1NHA A;  3OR2 C;  5IPA A;  2PMZ N;  3KEO A;  2DMU A;  3AFH A;  3ERM A;  2LNB A;  2BXZ A;  1LVK A;  3IKV A;  2LY9 A;  2GOM A;  1VZ0 A;  1XSD A;  1U6G A;  2EFO A;  2EV6 A;  1I6X A;  2NNN A;  3M8J A;  4F7Z A;  1G3W A;  4LLL A;  4BHP A;  1LE8 A;  1QBJ A;  2JT1 A;  4L0Z B;  3G71 I;  3K6G A;  4FHT A;  4L9V A;  2DQL A;  1APL C;  2QBY A;  1DUX C;  2V1U A;  4E7K A;  4EJT A;  3TOB A;  1O7F A;  5A2Q Z;  1EH6 A;  5D6E A;  2KRH A;  1HKT A;  2BW3 A;  3RYP A;  3M8F A;  1JKP C;  5FLX Z;  2GLO A;  3AAF A;  2QSH X;  2JA6 J;  4F92 B;  4FCY A;  4R8H A;  2L7Z A;  1G59 A;  2P5K A;  2X1E A;  4F52 A;  1GXQ A;  3MEX A;  5K5R A;  3FWE A;  3U1D A;  1PVE A;  2DYS H;  3HB9 A;  1XDU A;  2DFI A;  4I0A A;  4RLF A;  2R4G A;  1YJ9 I;  4C2U A;  2XSD C;  3G4S I;  2E1M B;  2M0C A;  3R6S A;  1FC3 A;  5DD4 A;  2QVO A;  4ESB A;  4WX9 A;  2ZSH B;  3WTT C;  4UXN A;  3ZMS A;  1MJA A;  3SJM A;  3WG9 A;  4I2O A;  2MD5 A;  1I6H J;  3TBI A;  2K3F A;  3BR3 A;  3ZQG A;  4MTE A;  3JRF A;  4E7Z A;  5B1B H;  1FJL A;  3CDH A;  4H4K C;  4DW6 A;  2HZD A;  1W7P B;  4HDU A;  1C0W A;  2A5Y B;  2E1M C;  2LC2 A;  2VBW A;  3LMM A;  5M3M J;  3EDP A;  4A3G J;  3CC2 I;  3QU6 A;  3F72 A;  1TT0 A;  1QO0 D;  3H0D A;  3HGG A;  1NK3 P;  5A2Q K;  3WTW C;  4OMY A;  2HTJ A;  4BDZ A;  2LR8 A;  1GDT A;  1W4M A;  4NNJ A;  4CCO A;  1RKW A;  2GOX B;  2VI6 A;  4HF2 A;  3FXJ A;  5BPI A;  3H3Z A;  4AU7 A;  4IX7 A;  2CQQ A;  3K1M A;  1B8I B;  3TKY A;  2E5N A;  4GRI A;  4BHC A;  4II2 A;  1V54 H;  2CFO A;  1BM9 A;  3WU2 C;  1OIS A;  1SFU A;  2MYS A;  4UY8 I;  5KAF C;  4V2F A;  2VJ4 A;  4E7S A;  3WU0 A;  3K69 A;  4RM3 A;  2FEZ A;  1IUY A;  4W97 A;  3ABL H;  4X6A J;  2HYG D;  1R5I D;  4ZYD A;  4NC8 A;  2K86 A;  3FXK A;  1P92 A;  3RKX A;  4CYC A;  3OYG A;  1QHG A;  4OIN F;  1Z77 A;  3CCY A;  4U88 A;  2OC6 A;  3R0A A;  4B09 A;  1X1C A;  4LIT A;  1Q1V A;  1F5T A;  3IAS 2;  3FBN B;  3PNV A;  1OCC H;  1IW7 F;  3H92 A;  2L9R A;  1P4X A;  4XN3 A;  2ZXJ A;  3S8P A;  2JPB A;  1MBF A;  3IH4 A;  2JPC A;  2GWR A;  3K0L A;  1OKR A;  5IYD J;  1P2F A;  2G9W A;  3MQ0 A;  2HGC A;  2FX0 A;  4DZJ A;  2HS5 A;  3KP3 A;  2KIQ A;  3NAR A;  4A3M J;  3S1M J;  3H5A A;  3DTK A;  3HIF A;  5FKK A;  3RKW A;  1UMQ A;  4ON0 A;  4UNO A;  2CH0 A;  4F91 B;  2NVX J;  2K02 A;  2V9V A;  2XRN A;  3I53 A;  2GA2 A;  3H9J A;  4M71 A;  3BRO A;  3FXL A;  4J19 A;  5B3S H;  4ESJ A;  4B8X A;  3MZY A;  5LEJ A;  5TGT A;  2K9S A;  2H1K A;  1F36 A;  3QOP A;  4XQF A;  4ZZL A;  1ZG1 A;  1UZC A;  4A3E J;  3CUO A;  1ZR4 A;  2DA5 A;  4IRI A;  2BVM A;  4O3M A;  2Y0S N;  5L3D A;  1RKT A;  3CQZ J;  4KT6 A;  1SFK A;  5D6F A;  3JCU C;  1OCO H;  4M6V A;  4OIR F;  4GO1 A;  1ZH5 A;  1YW8 A;  4NUB A;  1X3W B;  5LGN A;  1DPU A;  4DQ2 A;  4ESF A;  1IN6 A;  2OCE A;  4UV8 A;  1WJD A;  4LIV A;  3EPZ A;  2V79 A;  2E7W A;  4L9N A;  2EIN H;  2L5Q A;  1OYW A;  5F1R A;  5LHG A;  2XIG A;  3C2G A;  2EIL H;  1UJ8 A;  1X2N A;  2CS3 A;  3A0H C;  3F6O A;  3CD6 I;  1UCR A;  5EGO B;  5JFR A;  2BV6 A;  5HLG A;  1XCB A;  1PDN C;  3JRB A;  3A4C A;  4AID A;  3TDZ C;  2LLK A;  1GVD A;  2CFX A;  4MGR A;  5DTD A;  1UFM A;  4Q47 A;  3LSP A;  1WWX A;  2IGM A;  3H36 A;  3I4P A;  1EH7 A;  2LK2 A;  1Z6T A;  2VKE A;  4XRS A;  2BHZ A;  2CWE A;  3VOE A;  1JUM A;  2BBY A;  3I55 I;  4I09 A;  1KQ0 A;  4YEL A;  4YFN F;  1G3T A;  4BUP A;  3FHN A;  2W00 A;  4Y15 A;  4HNU A;  5LEK A;  4KIF A;  1BR1 A;  3MCZ A;  1ZN2 A;  3O2P E;  4P1W A;  4BQO A;  1R49 A;  3BTL A;  1YX5 A;  4U0W A;  1MBH A;  2DOF A;  2FBH A;  2RVC A;  2R0Q C;  1FSH A;  5FFZ A;  3AKZ A;  4XLE A;  2WAQ A;  1A36 A;  2R5Z A;  2K9Q A;  2JWT A;  3FK6 A;  1EJ9 A;  2NRA C;  2PFB A;  2DT5 A;  2KPM A;  1YO5 C;  2WA0 A;  2HVQ A;  4A3F J;  2WAD A;  2VKV A;  1KYZ A;  1BR2 A;  4RA2 A;  1YI2 I;  2QSG X;  2BYV E;  1VQ7 I;  2D2W A;  2Z1D A;  3VYR B;  3DKY A;  1DU6 A;  2KKO A;  2MH2 A;  5C4J J;  3GZ6 A;  3GTQ J;  2V6C A;  2Y48 A;  2DDA A;  1IN4 A;  1FP2 A;  4NBQ A;  1WJB A;  2DOA A;  5D5V B;  2Q2E A;  2L9S A;  3K70 D;  3W3C A;  3VYT B;  3L2R A;  1JKO C;  1TQI A;  1R5G A;  2PQ8 A;  2D1H A;  2IJL A;  1IAW A;  1LUJ B;  2OQR A;  1BI2 A;  4RAG A;  2IT0 A;  3GXO A;  2VJ5 A;  3GUD A;  5J40 A;  1KU2 A;  5IYB J;  3DTE A;  2X1C A;  5FJ8 J;  2AXT C;  4HV5 A;  3PL8 A;  1FOK A;  4CZZ A;  1X4O A;  2DLL A;  4DJA A;  4XMY A;  5EF6 A;  4YIR X;  2WAE A;  5IYC J;  3ISP A;  2E2I J;  3CUQ A;  3EQL F;  4HF1 A;  1MNE A;  3LWF A;  1X3U A;  3PO3 J;  4B4C A;  1ORK A;  2Z33 A;  4RB0 A;  4DOZ A;  1B72 B;  1FTZ A;  1PP7 U;  3DU5 A;  4YFK F;  4B47 A;  5CJ9 A;  3E6C C;  2R92 J;  5LFA A;  1ERD A;  3KYL A;  4ZH4 F;  2JN6 A;  3FXM A;  2DXI A;  1T0F A;  2X6O A;  2EFN A;  1FWZ A;  3LSM A;  4LG0 A;  3MD2 A;  4AVP A;  2A07 F;  1XG1 A;  3J81 Z;  5F1J A;  3I5U A;  3D0S A;  1MBG A;  4E7H A;  3QQA A;  1R22 A;  1D5V A;  2H8W A;  1KU7 A;  4IHW A;  1A5J A;  3GFL A;  4UV9 A;  3G3Z A;  3VPR A;  1MJB A;  3CJR B;  4FQG A;  4F93 B;  3IKT A;  3IRR A;  2FML A;  3CDL A;  4KMU X;  2R7T A;  5HVQ C;  1ZAR A;  1ULY A;  1I1G A;  2EH3 A;  3K9T A;  5F0F A;  4LLN A;  3CCM I;  4Z2Y A;  2PG4 A;  2IRF G;  2Q0O A;  1K6Y A;  4AIH A;  1ENH A;  3ZPL A;  2V1X A;  2G0E A;  2OQG A;  4XKW A;  1U9O A;  5FLV A;  1MH4 A;  2UUZ A;  1V5E A;  1HST A;  5DD8 A;  2VOD A;  3H1C A;  1G3S A;  3JSP A;  3EUA A;  2IA1 A;  3A0B C;  1Y39 A;  2XF6 A;  1CQT A;  4XKC A;  1X1P A;  4A3J J;  4WXC A;  5E3L A;  1P4A A;  1SVO A;  4ABZ A;  3A1Y A;  3LSK A;  1DGW Y;  2ZXH A;  4DNC A;  3T0Y A;  1QQI A;  1RI7 A;  3HTU A;  3ZN1 A;  3Q3S A;  4CH7 A;  1PUE E;  4CA0 A;  5F0C A;  4WCG A;  4C3J J;  2ADU A;  2A05 A;  1N77 A;  3F8B A;  1VND A;  1U0J A;  2ISY A;  2HPI A;  5LLQ A;  2JA7 J;  3F8N A;  3J81 K;  2I8D A;  4E7I A;  1WJA A;  2RGV A;  2OBP A;  4XOT A;  4GDF A;  3VYU B;  3OYI A;  2Y0M A;  3FK7 A;  2YX7 A;  4XSZ F;  3FMR A;  1YIJ I;  1AKH B;  2R7V A;  4AIK A;  2E19 A;  2EIM H;  1ZTR A;  2H6B A;  2WY8 Q;  3J7Y J;  2W85 A;  5HS8 A;  4PUS A;  1HC8 A;  2K9N A;  2FBK A;  3B73 A;  2ZME B;  4A0Z A;  2VJJ A;  5J3L A;  3GFJ A;  3HYI A;  1K83 J;  2FA5 A;  3V8K A;  1X19 A;  1IN8 A;  3T1B A;  5E3M A;  3CJQ B;  1W36 D;  3QRF F;  1IC8 A;  2AQF A;  2JQ7 A;  1W5T A;  1ZKG A;  2EPF A;  4PJM A;  4JX6 A;  2VQC A;  2UZK A;  1Y1W J;  3K4C A;  3D5L A;  3GZ5 A;  2ZME C;  4Q48 A;  4XON A;  4BJT A;  2F48 A;  1VF9 A;  3AG4 H;  3JRH A;  1M1E B;  2KP6 A;  1FYK A;  4EJO A;  1A35 A;  1Z0X A;  2QQB A;  2VKH A;  2L54 A;  3S1Q J;  1Z91 A;  3K2A A;  1QZY A;  4XOP A;  2XAS A;  2W7N A;  3TW7 A;  4HX4 A;  2EQR A;  2L01 A;  4XRM A;  2VC1 A;  2QF7 A;  3FXU A;  4IQJ A;  3G6E I;  5BOX A;  2EA2 A;  1Z9C A;  2ACJ A;  2LG4 A;  3BR2 A;  3HZJ A;  4BBR J;  1QPM A;  2LP0 A;  3BWG A;  2WWY A;  2QUF A;  3GVA A;  2MGQ A;  2ID6 A;  3BP8 A;  1BN5 A;  3I59 A;  4DYC A;  4A3B J;  3PNT A;  3TMO A;  3S2H J;  2VBZ A;  5C44 J;  1KQ8 A;  1IN5 A;  2V1D A;  4HQE A;  1W5C C;  2X0L A;  2KLO A;  4RGX A;  2E60 A;  2ICW G;  4B48 A;  5EZH A;  3CME I;  4PJN A;  3E97 A;  2KIU A;  4BYY A;  1AU7 A;  3CUQ C;  4M73 A;  2ME6 A;  3IH3 A;  4N4N B;  2BY3 A;  3SZG A;  3P5J A;  4CIC A;  1T2K A;  2DMP A;  3RPU A;  3WE2 A;  3E5U A;  2IGN A;  5H6Q A;  4KDP A;  1B9M A;  3LQQ A;  1WPK A;  2UXN A;  3TL4 X;  5EZG A;  1SMT A;  2ZBK A;  5ILV A;  1HCR A;  3D5S C;  4U0Y A;  4XLF A;  2LDU A;  4RM2 A;  2HOA A;  3ONQ A;  3ERE D;  2UXX A;  1WJE A;  5HNH A;  2VUM J;  2LTP A;  1DU0 A;  1T56 A;  1H89 C;  2ELH A;  4IHT A;  3LFK A;  5KCM A;  1XMA A;  1GVJ A;  4KYW A;  1R23 A;  5M5Y J;  4LOC A;  4O6J A;  1BJZ A;  2MH9 A;  2DA3 A;  2PN6 A;  3CCE I;  2D45 A;  5GAH J;  1SFX A;  1K7A A;  4HST A;  4XKB A;  2Z2S B;  2ZFU A;  3IP4 B;  1MH3 A;  4FT8 A;  3IL2 A;  2DFE A;  1K79 A;  2JVH A;  3LSJ A;  4KN4 X;  1ON1 A;  4MFE A;  4L5J A;  4M74 A;  2HVS A;  3LA2 A;  4M3G A;  4WXD A;  2XB5 A;  3HOX J;  3RDI A;  3GME A;  4X0G A;  5L3F A;  3ZMT A;  4A6E A;  2DCE A;  2NS7 A;  3IWF A;  3P9K A;  3OYJ A;  3MKZ A;  3G73 A;  1ZGA A;  4MHG A;  2UV1 A;  1T95 A;  2HFH A;  2YSR A;  2ISZ A;  1BIB A;  2DYR H;  5FD5 A;  3E6M A;  4J01 A;  1UAA A;  2XVC A;  4Y17 A;  3V8J A;  2XPW A;  3MZH A;  1UB9 A;  1X1D A;  1O3Q A;  2DA6 A;  2DAO A;  1JKQ C;  2IBD A;  2ID3 A;  3U9G A;  3RZD J;  4X1E A;  1I5Z A;  3SFZ A;  3GLL A;  1H0M A;  4F55 A;  5FLM J;  2OU2 A;  2P7C B;  2VQL A;  1MKM A;  4A5M A;  1MMA A;  2OAZ A;  5CKT A;  5K1Y A;  3WTY C;  3M07 A;  3JRC A;  4BGD A;  1N78 A;  3SZP A;  1S8N A;  1D1A A;  3O8G A;  3WE3 A;  4HV6 A;  1R1U A;  2A68 F;  2XAH A;  4BEH B;  2ZJR F;  1Z67 A;  1G3Y A;  2M8G X;  4YFX F;  4IHS A;  3OL3 A;  2AXL A;  4I99 C;  1FIP A;  3H9G A;  1T38 A;  2BVL A;  1ODD A;  3CLQ A;  4CDG A;  2F5C A;  2IA2 A;  2CV1 A;  1T33 A;  5HDK A;  2XAF A;  1LEA A;  3DKW A;  3DQV C;  5JHU A;  2K5C A;  4EGY A;  3HSE A;  4XLN F;  1O3R A;  2E1C A;  1R4M B;  2XAU A;  1T6S A;  1UHM A;  3JTH A;  5HLI A;  4PFP A;  2W25 A;  3QP6 A;  1Z21 A;  5EG0 A;  4PFO A;  5LBQ A;  3L2U A;  4LJZ F;  3M4O J;  3QPL A;  4IOA F;  2GXB A;  2CUJ A;  1XSV A;  2XAQ A;  4Z6Y A;  2M4G A;  3DBR B;  1U9N A;  2X4H A;  5TRD A;  3SDG A;  3P7N A;  1QHH D;  1Y0N A;  3ABM H;  1TL8 A;  3DEU A;  3OY9 A;  2ZFW A;  3ABK H;  2RAE A;  4I6Z A;  1KU9 A;  3PUF A;  4ENK A;  1JKR C;  3VDX A;  5ILU A;  1TBX A;  3DKX A;  2HQN A;  3DBH B;  3DBL B;  3CO6 C;  5EYR A;  3FXR A;  3J7A Y;  4UVB A;  1RET A;  3KCC A;  2C6Y A;  2R5Y B;  4FE4 A;  3HSF A;  1UST A;  4G12 A;  2Y31 A;  3CF5 F;  3N97 A;  4M3D A;  4AIJ A;  3TOA A;  1GUU A;  1HF0 A;  2E35 A;  1I27 A;  3HG9 A;  2HOE A;  5E1W A;  4H0E A;  3KYD B;  3M1E A;  3BCA A;  1D0Y A;  1LJ9 A;  3BR6 A;  4P55 A;  2DA7 A;  5FRO A;  3DV8 A;  2VJI A;  4NC6 A;  5JVG F;  1XB4 A;  2VXD A;  1ETO A;  4YRV A;  3IAM 2;  4KN7 X;  4C3I J;  1KYW A;  2WY7 Q;  3BR0 A;  2FU4 A;  1TWC J;  2BXY A;  2LBF A;  2KIF A;  5E18 F;  4UUS A;  4MLO A;  3OYH A;  3K1P A;  5JLW A;  2E2H J;  3HUG B;  3DFG A;  2ZXI A;  4KIT B;  3VWB A;  3HDD A;  3U21 A;  3RJP A;  4BE0 A;  4PK4 A;  3E7L A;  2XKO A;  4A0Y A;  3V7C A;  5L3E A;  4BJ5 C;  3TDU C;  2FXA A;  1W0T A;  1FTT A;  1R7J A;  3I71 A;  4DYR A;  3TO7 A;  1W0U A;  4ENJ A;  3OYC A;  2JA5 J;  1I39 A;  3S93 A;  4L9J A;  4Y33 A;  1T8I A;  1NH3 A;  3HRU A;  1LQ1 A;  3SQN A;  1FNN A;  3ZP5 A;  4AYB A;  1ZAO A;  2FRH A;  4E70 A;  3G2B A;  1MDM B;  1YE9 A;  4IKF A;  2EZH A;  4C9Y A;  3PUB A;  5ERI A;  4XBF A;  5IOY A;  1MNM C;  3BY6 A;  1WJC A;  3ZCO A;  2O03 A;  3FIS A;  2GXG A;  3F8C A;  4HPQ A;  4Y3O A;  1R4N B;  4YG2 F;  1X58 A;  5JLX A;  1SVM A;  3U1K A;  5HOO A;  3S15 J;  2PLY A;  1VQ5 I;  2KQR A;  1FMV A;  3L7W A;  2M2E A;  3DCF A;  1Z7L A;  2Q1Z B;  1T08 B;  4DIQ A;  1OYI A;  2HXI A;  1S72 I;  4Q5S F;  2KJC A;  2ESH A;  2FF4 A;  4GCV A;  2IS4 A;  3DU6 A;  2UWM A;  2ZNZ A;  3SDB A;  2XGD A;  1KGS A;  3CCL I;  3I9V 2;  1RIO H;  5FRN A;  2MSY A;  1LVA A;  4FET A;  2P6T A;  1FZP B;  3LSR A;  3L1P A;  2EIJ H;  2HTS A;  3FDY A;  1MMG A;  1O57 A;  4CCJ A;  3FX3 A;  3QPH A;  2PEX A;  1N25 A;  2CV2 A;  1D0X A;  2A3S A;  2DFH A;  5D5X B;  4RMN A;  1I3Q J;  1XS9 A;  1U8B A;  2STT A;  3MMY B;  1A04 A;  2J5O A;  1HDP A;  2IW5 A;  5E20 A;  1FY7 A;  1P7I A;  4G94 A;  3HPG A;  3DWL E;  5J1U A;  5DCM A;  2EFQ A;  3GF2 A;  2XPV A;  3OS0 A;  2MA3 A;  2YUS A;  1TQP A;  2M45 A;  2ZKZ A;  3TGN A;  4DZP A;  2P81 A;  3OYM A;  1BC8 C;  1BOB A;  1WH5 A;  3FKJ A;  2QQ8 A;  4KIB A;  2O6G E;  2VT3 A;  2F4O B;  4XRS G;  3BTI A;  1MD0 A;  1ZRE A;  2RRE A;  2L2O A;  5DCF A;  3BPV A;  2HDD A;  3HJE A;  2K85 A;  5CVU A;  1DDN A;  5HOD A;  1R36 A;  1ETW A;  4K2E A;  1U8R A;  1X1B A;  5AIQ A;  3KLO A;  5ICE A;  3LAJ A;  3AL0 C;  1PP8 F;  5EJC A;  3K4K A;  1ETX A;  2XRL A;  2X9D A;  4NQW A;  2EK5 A;  5IT3 A;  2V4J C;  1IO2 A;  4YII A;  4BXF A;  1BW5 A;  1R71 A;  3ABT A;  5FO5 A;  3SXY A;  3G1O A;  3CES A;  5EDN A;  3S3O A;  1ZR2 A;  3BG7 A;  3VSL A;  2LMD A;  4IF4 A;  1K61 A;  2X1D A;  3K1N A;  3ZMU A;  3RSN A;  4ZZD A;  2R7W A;  3S17 J;  1FLI A;  5FKL A;  1YS6 A;  2MW8 A;  2PJR A;  1NTC A;  4XL9 A;  5FRM A;  1OLT A;  1WCM J;  4M3E A;  2QCO A;  3HXL A;  1LB2 A;  2HU9 A;  2HNH A;  3QP5 A;  4S05 A;  1ZHF A;  1LE8 B;  5DUK A;  3TO9 A;  3LSG A;  5M3F J;  3L09 A;  1R1V A;  2QBY B;  1DP3 A;  2YU3 A;  4RDU A;  3KX2 A;  2M7B A;  2DFF A;  4EJU A;  3ZR8 X;  1YRN A;  3CC4 I;  1FYM A;  3IV5 A;  3CP8 A;  2BW3 B;  3JTG A;  2M8E A;  1SAX A;  1CF7 A;  1E2X A;  3L2W A;  2PBI A;  4D5C A;  4EQQ A;  1GT0 C;  2NVU B;  3UNG C;  3V8L A;  3KP6 A;  3HRS A;  4CGZ A;  3FF5 A;  4QTR A;  4OU0 A;  3C2H A;  3PFY A;  3F6V A;  2JSP A;  2DK5 A;  5D5U B;  3B02 A;  5J8C A;  4XLP F;  5E3O A;  4PJL A;  1Q1H A;  4Y4R A;  3GFI A;  2WV1 A;  1NG7 A;  4IJA A;  3G1M A;  1ITY A;  1L3L A;  1REP C;  1V4R A;  2HZT A;  1D5Y A;  4HZF A;  3GCM A;  1QRY A;  3GTK J;  3JW4 A;  3HM5 A;  3LSI A;  2W4S A;  3OSG A;  3CTA A;  3M7G A;  5C3E J;  1MJ9 A;  3OMY A;  3L2C A;  3O6B B;  2HYF A;  4EM1 A;  4CCK A;  3S32 A;  2KIS A;  2KDZ A;  1JJ8 C;  2GM4 A;  1VQ6 I;  1JXS A;  1DP7 P;  5C4X J;  1RZ4 A;  4BE1 A;  3CF2 A;  1R5H A;  4XIC A;  4A3L J;  1YS7 A;  2V26 A;  2VBX A;  3I3L A;  1A6I A;  5FD6 A;  4EMS A;  5FGM A;  4BAY A;  4D1Q A;  3HRT A;  1ZRF A;  2LKS A;  1IV8 A;  1W5S A;  2COB A;  2XDV A;  1DPR A;  3ASO H;  3KP7 A;  4BL0 B;  4UUV A;  1BL0 A;  1FIA A;  2P7V B;  2BZT A;  3BCB A;  3F8F A;  4B3X A;  2YPR A;  1Y0U A;  3RIR A;  2VB6 A;  5J4V A;  1HDD C;  4M6Y A;  3HKZ A;  3ZN0 A;  2ECC A;  3DLA A;  4AUX A;  2RDP A;  2CRG A;  5L3B A;  4IXA A;  3UR3 C;  3EYI A;  4KUM A;  2X6Y A;  3OWT A;  3JSO A;  4CYC B;  4LGW A;  2JMW A;  1U5T A;  1PYV A;  5FKN A;  1IDY A;  3RKY A;  1FBU A;  2FJ1 A;  3CO7 C;  2QA4 I;  4XR6 A;  1SEU A;  3FHZ A;  4EEF G;  4B1R A;  1SD5 A;  4HF0 A;  1JHF A;  1U2W A;  3RI4 A;  2V7F A;  2F5E A;  4W1U A;  1LPQ A;  5KVR A;  2KZG A;  3WGI A;  3A02 A;  3JRE A;  4RGU A;  4MQV A;  1QGP A;  1SD6 A;  1YW9 A;  3KIO A;  3L2Q A;  1LFU P;  3L00 A;  4HAM A;  3FM3 A;  4KIC A;  1U3E M;  2H6C A;  3GBG A;  2L7K A;  3Q0U A;  4ZDP A;  1MSE C;  4G6D A;  2L3D A;  2R7X A;  4M3B A;  2A6E F;  2CSO A;  3E3V A;  4OAZ A;  3ESW B;  4C3H J;  3F0C A;  3OYD A;  4MO7 A;  2FBI A;  2F4M B;  3HOW J;  1Z05 A;  3PQK A;  1F1Z A;  2KDO A;  4BQN A;  2MLK A;  3X2Q H;  2LD5 A;  5TIS C;  3K4N A;  3OYF A;  4M6X A;  1IV6 A;  5E8G A;  2COM A;  4MEX F;  4AD9 A;  4LK1 F;  3H3V K;  1JGG A;  1VQ4 I;  3DTI A;  1XPX A;  1DQU A;  2A6T A;  2TRT A;  2R7Q A;  2E7X A;  4XKV A;  5CVI A;  1WHU A;  1G4D A;  2HVR A;  4UHT A;  3JR9 A;  3K7A J;  2P0W A;  3ZMD A;  1BW6 A;  2LKP A;  1KON A;  2YX4 A;  5E8I A;  5HNF A;  4Y52 J;  4M72 A;  4IOC F;  5BMZ A;  4BE2 A;  2ZXW H;  1WJF A;  1IRG A;  3PM1 A;  1TTY A;  1L0O C;  3CMY A;  4XLC A;  2WB1 A;  5DEQ A;  4HDV A;  2XAG A;  2IS2 A;  4I98 B;  5KAI C;  3I56 I;  4MNU A;  4A3I J;  1GLN A;  1XGM A;  1IXR C;  2M87 A;  3HOT A;  2NNY A;  2ZC2 A;  4N4O B;  2PX9 A;  5DM7 F;  1V5G A;  4HYE A;  3GTP J;  3SEQ A;  4HX7 A;  1MIJ A;  4BHB A;  3PQJ A;  1RR7 A;  2FNP A;  2DA4 A;  1BI1 A;  2L4A A;  4WXH A;  2V6E A;  2VPL A;  1ETQ A;  3QYB A;  2GIZ A;  2P6S A;  2Z16 A;  2R5Z B;  3CCV I;  1H8A C;  4N9H A;  3BLY A;  3K4B A;  2XC7 A;  4OIO F;  2NVQ J;  3K2Z A;  3BPX A;  2AQE A;  5HS7 A;  2GXA A;  3BR5 A;  1W1W E;  1H9T A;  4EV0 A;  4XLH A;  1K78 A;  2O3F A;  3P9I A;  2G7H A;  3LST A;  3BC8 A;  3RYR A;  1YFH A;  4A2U A;  1VQK I;  3BQZ A;  2Q2E B;  2DMQ A;  1E0E A;  2EJR A;  2HDC A;  1TNT A;  5D8L B;  5CVR A;  4LMY A;  4ZDL A;  1XCV A;  1JTY A;  2W48 A;  1E17 A;  1IN7 A;  2XUB A;  4CZC A;  4S0H B;  3HOS A;  1J9I A;  2W57 A;  2P8T A;  3SEZ A;  3OYB A;  3Q0W A;  3W2A A;  3OYE A;  2CGP A;  3JRI A;  1SMY F;  3CZ6 A;  2OPT A;  4QSH A;  3ZQI A;  1PUF A;  1W7P D;  3CUQ B;  3FXO A;  1S5L C;  3QOE A;  2K3P A;  5F64 A;  3VYS B;  2BGC A;  3BQY A;  3OL4 A;  4B44 A;  1UG2 A;  4PSW A;  1P6R A;  1U5T C;  4WF2 A;  1OJL A;  2GA1 A;  4UVA A;  1WSU A;  2K4J A;  2Y9Y A;  2QEN A;  4NHJ A;  3QOD A;  2R93 J;  3LAP A;  3W2W A;  3C3W A;  1SC7 A;  4LG0 B;  3I4M J;  2MD0 A;  3BTC A;  3Q9S A;  3HL2 A;  2QQ9 A;  3A01 A;  2ZJ2 A;  3ZQF A;  2O61 A;  2CW8 A;  1Y6I A;  4R79 A;  1XGN A;  1IXS B;  4JX5 A;  1T98 A;  4A5N A;  3S16 J;  3KLN A;  4RB3 C;  3OR1 C;  3ZQH A;  2IS1 A;  1T0F C;  3H3U A;  1J59 A;  1D3Y A;  1HKQ A;  1UHW A;  3MN2 A;  5D4R A;  2H1L A;  4RBO A;  3U2R A;  2WAQ N;  4I02 A;  3RQI A;  2KIM A;  5FKM A;  3RQ4 A;  5KHD A;  1JUS A;  3WTS C;  2EA4 A;  3LOC A;  2FSW A;  2RKH A;  3RPQ A;  3WGG A;  3BZC A;  3QAH A;  1MBE A;  3PJR A;  4IPA A;  2F6C A;  1XGO A;  2I5U A;  4AWX B;  1YHQ I;  3J7A O;  1EH8 A;  4P5O A;  5CLS A;  2W1O A;  3PSI A;  3B6C A;  3CC7 I;  1LDD A;  1YJN I;  4NB5 A;  1E3O C;  3FIW A;  2DTZ A;  2LOO A;  5CVV A;  4CCM A;  3AG1 H;  1FT9 A;  3HKZ N;  1S9H A;  2DJI A;  2LF8 A;  4LG3 A;  2Q8K A;  3HOU J;  4L0Y B;  3CJT B;  2BY1 A;  3SYT A;  4ZYA A;  5ILS A;  4EM0 B;  2DU9 A;  5LD2 C;  1ACI A;  4BNC A;  4A3D J;  3H0G J;  5EEA A;  1JTX A;  5B66 C;  2LRE A;  3F21 A;  2DPU A;  2DMT A;  2F5D A;  2K7L A;  2CW0 F;  2DO7 A;  4ASN A;  4OAY A;  2Y75 A;  5K7F A;  1D1B A;  1YYV A;  4ZYE A;  3S1R J;  4JOM A;  3JRD A;  3G1L A;  1KA8 A;  2E34 A;  1Y56 A;  5HS9 A;  2NS0 A;  1G8X A;  2QYO A;  3VEP A;  2DI3 A;  1J7K A;  4ZYG A;  2X85 A;  4FAS D;  2X51 A;  4IHY A;  4G7Z F;  1IUF A;  3QPT A;  1NG6 A;  4Y13 A;  2LVS A;  1FSE A;  4IQ4 A;  1AA7 A;  2JUC A;  3BOQ A;  2BY0 A;  3C7J A;  1MBJ A;  3EUH A;  3ZQQ A;  2OZU A;  4MTD A;  1ZK8 A;  3GO5 A;  2P4W A;  4RS8 A;  3GFM A;  5K7Z A;  4FX4 A;  2Y9Z A;  1Z7U A;  2A6H F;  2HQ5 A;  3QYF A;  2MC4 A;  2R7F A;  4BQQ A;  4ITV A;  1JT6 A;  2AHQ A;  3BG9 A;  3VSK A;  2OTL I;  3WU1 B;  1VQN I;  1SD7 A;  2M7A A;  1MBK A;  3KET A;  2NYX A;  3ZRG A;  5LRR A;  3I59 B;  3REO A;  4G7H F;  2DOD A;  3W6J B;  3MKY B;  3K70 C;  3I4N J;  1ZYR F;  4JX4 A;  1W7P A;  2L9V A;  2XRO A;  3RKQ A;  2OZ6 A;  2ZNY A;  5M5W J;  2M0M A;  2Z9O A;  3P9C A;  1HW5 A;  3DP7 A;  3CDI A;  2RQP A;  1TWG J;  4LB5 A;  3BTJ A;  4KFC A;  2B7E A;  4KT5 C;  4JP0 A;  4BAC A;  1P9Q C;  3E1S A;  4BQA A;  3A03 A;  1EKE A;  2WB1 N;  4UVC A;  4RB1 A;  5E17 F;  4XLA A;  4BU2 A;  3BG6 A;  1ZQ3 P;  2QZ8 A;  1ONV A;  3CCR I;  1B8I A;  2X6W A;  2ME0 A;  1J5Y A;  4PCQ A;  4ZYH A;  3BDD A;  1LFB A;  4E4H A;  3NRV A;  2XGE A;  4RAF A;  3LFU A;  9ANT A;  5IP9 J;  1TLH B;  2CYY A;  1N75 A;  3T5X A;  3CCS I;  1BJA A;  3ASN H;  4BKX A;  4HNT A;  1H88 C;  3OOU A;  3I0T A;  1RR8 C;  1IGN A;  3NQO A;  2M5W A;  1TT5 B;  2O5R A;  1V5F A;  1SAN A;  4M9Z A;  2L7M P;  2DBB A;  5HLH A;  5D5W B;  1FMW A;  3IRQ A;  3HTS B;  4D5F A;  1IRX A;  1BA5 A;  4UB8 C;  4YIF A;  2A69 F;  1WJ5 A;  4PJ0 C;  2IVM A;  2DDB A;  3OIQ A;  4BXX J;  2W84 A;  1J09 A;  4NDL A;  3VOD A;  3OYA A;  5DDG A;  5F04 A;  1K6O A;  2EV0 A;  1UHS A;  2VOP A;  4OIQ F;  2OV7 A;  2VPR A;  2DJN A;  3IC7 A;  4HRI A;  5B5E C;  2N8G A;  1TWF J;  3OS2 A;  1BI0 A;  1O7L A;  1S7A A;  2R7O A;  3F9K A;  2KZV A;  5GTH C;  2VQG A;  2L7F P;  4I0B A;  1KZH A;  5F08 A;  4BJ6 C;  3GX4 X;  1HW1 A;  1LFP A;  2JRM A;  4UUT A;  1OCT C;  5JR3 A;  1FOX A;  3ROU A;  2K4B A;  3MKL A;  4XM3 A;  1R58 A;  2M3A A;  4DBQ A;  3BJO A;  1JUP A;  4EJW A;  2FQ3 A;  5E3N A;  5GTI C;  3RTR A;  3T8R A;  1A6Q A;  4Q4Z F;  2QSF X;  4HLX A;  4P9U A;  2VE8 A;  1WH7 A;  5HDN A;  4E7J A;  5KK1 A;  1QNT A;  2CJJ A;  3H9Q A;  3W6K B;  3D5R C;  1XMX A;  2VE9 A;  3NWS A;  1WI3 A;  1R9T J;  3HBL A;  5HLT A;  1R00 A;  4LK0 F;  1DGR M;  3GZN B;  5EGO A;  1J0R A;  2WTE A;  3OOP A;  1V55 H;  4U0V A;  3VFZ A;  3CP2 A;  2Z5U A;  4EGZ A;  1HW2 A;  3QWL A;  3ML6 A;  4XK4 A;  4C30 A;  1W36 C;  5EG0 B;  2K9L A;  1S3J A;  2XGC A;  1TWH J;  1WI9 A;  3I54 A;  5FKO A;  2R7U A;  3EUH C;  4E6K G;  3GTO J;  3S3N A;  2MC3 A;  4L9T A;  1AOY A;  1IZ1 A;  2QKL B;  5EEH A;  2R7R A;  3C2B A;  2MFZ A;  2E2J J;  4ETS A;  1ZLK A;  2WBM A;  1MMN A;  2FQ4 A;  3ZQC A;  3FMS A;  1CGP A;  1LDK B;  4TV7 A;  3GEZ A;  1USS A;  3ZQ7 A;  2IPQ X;  1FOW A;  2HOS A;  5LHI A;  1WQ2 A;  2HQR A;  4E7L A;  1RUO A;  2CW7 A;  3HC7 A;  2CQN A;  5CYV A;  3AL0 B;  1QU3 A;  5FLX K;  4EVI A;  4IVN A;  4WK8 F;  5K5Q A;  3QU3 A;  1OYY A;  3H5R A;  1EV7 A;  1RC9 A;  3ZMV A;  3L9F A;  2E1O A;  1LDJ A;  4BY7 J;  1GV2 A;  2CG4 A;  2NVT J;  2LKX A;  2KFD A;  2HQA A;  5GPC A;  4CSW A;  1Z6R A;  4IZZ A;  3WTZ A;  5J1Y A;  3CMA I;  5BPD A;  3WHB A;  1OFC X;  3FMQ A;  4KIG A;  5D4S A;  5L3G A;  1FPQ A;  2X48 A;  2LBF B;  1IRZ A;  2CU7 A;  4QWQ A;  5GAE J;  3K10 A;  4UUS B;  4GFB A;  1R1T A;  2CQX A;  1FYL A;  3E0J B;  2Y30 A;  5GP9 A;  4AM3 A;  4G7O F;  1S6L A;  4AVZ A;  2GQQ A;  3WOD F;  3JAM Z;  4XN0 A;  5ED4 A;  4XOR A;  1XTA A;  1BBY A;  2CUF A;  1MMD A;  2JSC A;  3IUO A;  5J4Y A;  2O8K A;  2AO9 A;  2M4K A;  1KQ9 A;  2L0K A;  1B72 A;  2CQK A;  3GYH X;  3O8H A;  4ENN A;  3H35 A;  3MKW B;  2K40 A;  4GYI A;  4OMZ A;  3HOV J;  2E71 A;  4PJJ A;  2P5L C;  3ECO A;  3A2K A;  2GZW A;  2RNJ A;  3TED A;  1OCP A;  4M9S A;  2DT7 B;  1BOA A;  2HYJ A;  3K4L A;  3KE2 A;  4FX0 A;  2VLA A;  3M1C A;  4I76 A;  2WV0 A;  1VI0 A;  1XDS A;  5F27 A;  1RRJ A;  4KMF A;  4LD5 A;  1X2M A;  3MVP A;  1BIA A;  3TO6 A;  1JJ6 C;  1Z3X A;  1D8J A;  2K9M A;  4S04 A;  2EFP A;  2D1V A;  4C2T A;  4G6Q A;  1I1S A;  5K5O A;  2HR3 A;  4AC0 A;  1OMI A;  1SFO J;  2HWV A;  5H2F C;  4HX8 A;  1QA6 A;  5K7H A;  2MLG A;  4HA8 A;  3CCU I;  3ECH A;  4RAZ A;  5ICF A;  2LSO A;  1WFX A;  5F6F A;  1BR4 A;  1XGS A;  1NK2 P;  2G7U A;  3FM5 A;  4V2G A;  1AWC A;  3JAM K;  3Q5F A;  1TW2 A;  1TQM A;  3IH2 A;  4CCL A;  3BG3 A;  1E3P A;  1A31 A;  1ON2 A;  3ZXS A;  5J47 A;  3GTL J;  3BJ6 A;  1VQL I;  4J00 A;  1IRF A;  2LRD A;  2Y2Z A;  5GPA A;  3C1D A;  3PIP F;  3F8M A;  2BOL A;  2R7D A;  4BS9 A;  2AS5 F;  1MMS A;  3WHC A;  4R1H A;  2TDX A;  2BHY A;  1ZG3 A;  1RNL A;  4IHV A;  2ZO4 A;  3IHU A;  1HQC A;  1TWA J;  2OA4 A;  1YIO A;  2PJP A;  1U78 A;  3HPH A;  5B1A H;  2CMP A;  4G9Y A;  1S29 A;  1YOV B;  2V1N A;  3R4K A;  4A6D A;  2KHM A;  3M3Y J;  1AKH A;  4U87 A;  1ETV A;  3Q0V A;  4M3F A;  5DCM B;  3M8E A;  2ZME A;  2VKD A;  4IHX A;  1OPC A;  2V9P A;  2ELJ A;  3DPL C;  2ESN A;  2YR2 A;  3PNY A;  4XNF A;  2QEX I;  5IY5 H;  4II3 A;  4ENM A;  1TP4 A;  2RNG A;  1FOY A;  1ETK A;  2L9N A;  4D9J A;  1AHD P;  4AYB N;  2JVG A;  5BNG A;  2CV0 A;  5DM6 F;  2I10 A;  4RGS A;  4IRG A;  2PMU A;  1WVR A;  2XHK A;  2XF7 A;  2DN0 A;  2STW A;  4A3K J;  2F5V A;  2LF7 A;  2XB0 X;  2ZCW A;  3QPS A;  2CO5 A;  3LA7 A;  1YQA A;  5DS9 A;  4JQF A;  3KZI C;  4IO9 F;  3WGH A;  2HKO A;  2VIX A;  5LHH A;  3J80 Z;  5J1R A;  2DK8 A;  1KU3 A;  1OR7 A;  4A12 A;  2ZB9 A;  4NQW B;  4B3A A;  2IP2 A;  4G6T B;  2R3S A;  2IEK A;  4B43 A;  3E5Q A;  4L5E A;  5E79 C;  5IT9 Z;  2JA8 J;  4ZTJ A;  2FMY A;  2VC0 A;  3HRM A;  3DF8 A;  1WGX A;  3DEE A;  2QM3 A;  2QQA A;  3FKI J;  3BR1 A;  4BDY A;  1OCR H;  3W6V A;  3VB2 A;  1RES A;  5LGU A;  1VQ8 I;  1TNS A;  1XMK A;  2E36 A;  3LL7 A;  1OQY A;  4FTH A;  2PJR B;  2EV5 A;  4YEJ A;  3OYL A;  3KP5 A;  2M30 A;  4HSR A;  4A93 J;  3SFI A;  2ZJP F;  2H27 A;  3OS1 A;  4EJV A;  2P5V A;  2VL8 A;  2JTV A;  3OIO A;  1ZRC A;  2DOE A;  4G8X A;  2F2E A;  2VON A;  1GV5 A;  4RLQ A;  4PGG A;  3RPU D;  1YRN B;  1QPI A;  3CLO A;  3OYN A;  1HOM A;  5DYM A;  5CPR B;  3ZGK A;  3PIO F;  3DLL F;  5IP7 J;  5IP6 A;  2MG4 A;  2LY1 A;  4CUG A;  1CF7 B;  3ZMZ A;  1VQ9 I;  4Y7N J;  1SVL A;  1ETY A;  2PI0 A;  3R0J A;  4HNV A;  4LIU A;  2IGK A;  3J80 K;  3ELK A;  4ZC3 A;  5IOZ A;  5LGT A;  1X1A A;  5EEG A;  1UEL B;  3GTM J;  3AG2 H;  4I7H A;  4A0X A;  1MSF C;  3CMM A;  5IT9 K;  3E5X A;  1ZGJ A;  1LEB A;  3L2V A;  2E1N A;  3LA3 A;  5JI6 A;  2R7S A;  4L18 B;  3N05 A;  1O3T A;  1EA3 A;  1HBX G;  5L3C A;  4FE7 A;  1IXC A;  2HDW A;  1MGT A;  1FBS A;  3R61 A;  3F23 A;  4XID A;  3OV8 A;  3MWM A;  3GW2 A;  1XD7 A;  4F3Q A;  1D0Z A;  2BEO A;  2RN7 A;  3S2D J;  3JRG A;  2MBF A;  2JUG A;  2M9H A;  2VBY A;  2FNA A;  2E5Z A;  2DA2 A;  3JRA A;  3SZT A;  2HXO A;  3E6B A;  3FXQ A;  3T8T A;  2O0Y A;  3HOZ J;  2WC2 A;  1MND A;  2HPM A;  2GBY A;  2KMU A;  1FX7 A;  2KT0 A;  4I01 A;  4PSX A;  2K27 A;  1WZ2 A;  3MFK A;  2O9L A;  2BE5 F;  2KRF A;  3ABU A;  3HGY A;  1TW3 A;  3GLX A;  1YIT I;  2KL4 A;  4LLG F;  3HOY J;  4BXU A;  3V7R A;  1IDZ A;  2EWN A;  4KA4 A;  2GIV A;  3KZZ A;  1POG A;  2DT6 A;  2OUM A;  3KP4 A;  4D7N A;  3KEQ A;  4BEH A;  4N0B A;  4O5V A;  1B4A A;  3HHG A;  1LNW A;  4OIP F;  3V42 A;  3B6A A;  1LKX A;  1OCZ H;  1U5T B;  3ZQL A;  1K4T A;  1JT0 A;  1B1B A;  5J6X A;  3KP2 A;  4LB6 B;  2LY2 A;  2OJE D;  3BZK A;  2YU9 J;  1ZEL A;  2EZL A;  1I3A A;  2PMZ A;  1X3Z B;  3HHH A;  4MQ9 F;  1SD4 A;  1UG0 A;  2DQR A;  3PSF A;  3TW6 A;  1O3S A;  3WG7 H;  2OF7 A;  2EB7 A;  2VQH A;  4HW0 A;  1ZLJ A;  2B0L A;  5H6R A;  1V3F A;  4CCN A;  2NXN B;  2VN2 A;  4HLY A;  4KIS A;  2QWW A;  3OSF A;  2M1B A;  1QVU A;  3F3X A;  1VQP I;  1IJW C;  2OD5 A;  2F4I A;  3PFI A;  1Z1D A;  1P4W A;  1FEX A;  3PO2 J; 
#chains in the Genus database with same CATH homology
 2XGE A;  1ETW A;  1XC5 A;  9ANT A;  5IP9 J;  3ZOB A;  4A69 C;  3PO3 J;  4B4C A;  1ORK A;  1B72 B;  1ZGW A;  4BKX A;  1FTZ A;  1H88 C;  3OOU A;  1QVT A;  1F43 A;  1IGN A;  2R92 J;  1ETX A;  2XRL A;  2R5Y A;  2IAI A;  2X9D A;  2JN6 A;  1SAN A;  2L7M P;  2X6O A;  1BW5 A;  4D5F A;  3UKG A;  1BA5 A;  1XG1 A;  5F1J A;  3G1O A;  5EDN A;  2DMN A;  1ZR2 A;  1MBG A;  3NAU A;  3QQA A;  1K61 A;  4BXX J;  3HEF A;  3S17 J;  5FKL A;  2MW8 A;  1A5J A;  1NTC A;  4IHW A;  4NDL A;  1WCM J;  3VPR A;  4M3E A;  4C2M J;  3CDL A;  2QCO A;  3BG5 A;  5F04 A;  1UHS A;  1LE8 B;  4DYQ A;  3LSG A;  5M3F J;  2EH3 A;  4IEJ A;  4D7M A;  2VPR A;  2DJN A;  5F0F A;  4RDU A;  2N8G A;  1TWF J;  3GTJ J;  1YRN A;  2O7O A;  1ENH A;  3IV5 A;  2G0E A;  3RZO J;  1U9O A;  5FLV A;  2EZI A;  2L7F P;  1MH4 A;  2HOT A;  5F08 A;  4D5C A;  4UUT A;  1OCT C;  1GT0 C;  1Y1V J;  1CQT A;  3MKL A;  4A3J J;  4QTR A;  5E3L A;  2XPU A;  4ABZ A;  1JUP A;  5E3N A;  5E3O A;  2ELK A;  3TP0 A;  2WV1 A;  3Q3S A;  3G1M A;  1ITY A;  1WH7 A;  5F0C A;  4C3J J;  1D5Y A;  1QRY A;  1VND A;  2JA7 J;  2CJJ A;  3GTK J;  3HM5 A;  1WI3 A;  2EZK A;  3HBL A;  1R9T J;  3OSG A;  2TCT A;  1P7J A;  1IG7 A;  5C3E J;  3FK7 A;  2KDZ A;  1AKH B;  5EGO A;  2GM4 A;  1JJ8 C;  2E19 A;  1ZTR A;  4FIS A;  5C4X J;  2EBI A;  4XIC A;  4A3L J;  2K9N A;  1A6I A;  5F0H A;  4XK4 A;  5J3L A;  2NOG A;  2NS8 A;  5EG0 B;  1K83 J;  2XGC A;  5E3M A;  4A3C J;  1TWH J;  2COB A;  5FKO A;  4BBS J;  1G2H A;  2JJ7 A;  1IC8 A;  4MFD A;  3GTO J;  1ZKG A;  3S1N J;  3C2B A;  1TC3 C;  2E2J J;  2LFB A;  4JX6 A;  2ECB A;  1BL0 A;  1FIA A;  4JYK A;  1Y1W J;  1PUF B;  1S7E A;  3BT9 A;  4MIM A;  4BY1 J;  1VF9 A;  2FQ4 A;  5M5X J;  3JRH A;  3ZQC A;  2D5V A;  1HDD C;  2HI3 A;  1Z0X A;  3S1Q J;  3K2A A;  2ECC A;  4AUX A;  3TW7 A;  2CRG A;  2EQR A;  4XRM A;  1I50 J;  2QF7 A;  2HOS A;  4QIW N;  4CYC B;  3D1N I;  2JMW A;  3BR2 A;  5FKN A;  1IDY A;  4BBR J;  2FJ1 A;  2LP0 A;  3A01 B;  2MGQ A;  2ID6 A;  2E1O A;  4BY7 J;  4EEF G;  1GV2 A;  4B1R A;  4DYC A;  2LKX A;  2CUE A;  2H8R A;  2NVT J;  4A3B J;  5GPC A;  3S2H J;  3S14 J;  5J1Y A;  4W1U A;  5C44 J;  3A02 A;  3WHB A;  3JRE A;  1VFC A;  1OFC X;  1LFU P;  5EZH A;  3GBG A;  2X48 A;  1IRZ A;  2CU7 A;  2NVY J;  4UUS B;  4GFB A;  1O4X A;  3Q0U A;  1AU7 A;  2ME6 A;  3IH3 A;  1MSE C;  2CQX A;  4M3B A;  2DMP A;  2Y30 A;  5GP9 A;  2R7Z J;  4C3H J;  3F0C A;  3DEW A;  1WPK A;  4MO7 A;  5EZG A;  1HCR A;  2JK3 A;  2B63 J;  1EF4 A;  3HOW J;  2CUF A;  1HLV A;  2HOA A;  2O8K A;  2AO9 A;  2LD5 A;  2VUM J;  2L0K A;  2LTP A;  1DU0 A;  2DA1 A;  1B72 A;  1T56 A;  3O8H A;  1H89 C;  2K40 A;  3HOV J;  2E2I J;  1IV6 A;  3H3V K;  2YS9 A;  4LOC A;  5M5Y J;  1JGG A;  1BJZ A;  2DA3 A;  2M34 A;  3GTG J;  1MH3 A;  2TRT A;  3TED A;  1OCP A;  2FD5 A;  3LSJ A;  1RPW A;  4MFE A;  2HYJ A;  4M3G A;  2XB5 A;  3HOX J;  3LNQ A;  3TP3 A;  3JR9 A;  3K7A J;  4I76 A;  2PMZ N;  5F27 A;  1VI0 A;  2DMU A;  5IPA A;  2NS7 A;  1X2M A;  1BW6 A;  3MVP A;  1JJ6 C;  2LY9 A;  4Y52 J;  3PM1 A;  1LE8 A;  2XPW A;  4AC0 A;  3CMY A;  1SFO J;  1APL C;  2DA6 A;  5K7H A;  1JKQ C;  2IBD A;  2ID3 A;  3RZD J;  4X1E A;  4A3I J;  1NK2 P;  4V2G A;  1JKP C;  5FLM J;  3IH2 A;  2GLO A;  2JA6 J;  3BG3 A;  4FCY A;  3GTL J;  3GTP J;  2L7Z A;  2Y2Z A;  5GPA A;  1RR7 A;  3JRC A;  2DA4 A;  3HB9 A;  3O8G A;  1ETQ A;  3WHC A;  4IHV A;  2XSD C;  2R5Z B;  2M0C A;  1H8A C;  2NVQ J;  3SJM A;  2M8G X;  1TWA J;  3BR5 A;  1U78 A;  1I6H J;  1FIP A;  3BR3 A;  3ZQG A;  3M3Y J;  3JRF A;  1FJL A;  1T33 A;  1AKH A;  4DW6 A;  1ETV A;  3BQZ A;  3Q0V A;  4M3F A;  2DMQ A;  5M3M J;  4A3G J;  4IHX A;  1JTY A;  2W48 A;  5EG0 A;  3HGG A;  4S0H B;  1NK3 P;  3M4O J;  3QPL A;  3Q0W A;  2LR8 A;  1GDT A;  1ETK A;  1U9N A;  1AHD P;  4AYB N;  3SDG A;  1RKW A;  2VI6 A;  5BNG A;  2I10 A;  3JRI A;  1B8I B;  2CQQ A;  2OPT A;  4QSH A;  3ZQI A;  1PUF A;  2DN0 A;  2RAE A;  4A3K J;  2XB0 X;  4I6Z A;  3QPS A;  5DS9 A;  4V2F A;  1JKR C;  3BQY A;  1UG2 A;  1OJL A;  5J1R A;  4W97 A;  4X6A J;  5EYR A;  2Y9Y A;  1RET A;  2R5Y B;  4FE4 A;  2R93 J;  2ZB9 A;  4G12 A;  4B3A A;  4CYC A;  2Y31 A;  1Z77 A;  3CCY A;  4M3D A;  2IEK A;  1GUU A;  1Q1V A;  3BTC A;  4L5E A;  1HF0 A;  2JA8 J;  3A01 A;  3ZQF A;  2L9R A;  1WGX A;  3FKI J;  3I4M J;  3BR1 A;  1MBF A;  3IH4 A;  3W6V A;  1RES A;  3BR6 A;  4FTH A;  4JX5 A;  5IYD J;  2DA7 A;  2FX0 A;  3S16 J;  4DZJ A;  4A93 J;  3SFI A;  3ZQH A;  3NAR A;  1ETO A;  4A3M J;  3OIO A;  3S1M J;  4C3I J;  3MN2 A;  5FKK A;  3BR0 A;  4RBO A;  2WAQ N;  1UMQ A;  1TWC J;  3RQI A;  5FKM A;  1GV5 A;  4UUS A;  2NVX J;  4MLO A;  1JUS A;  1YRN B;  1QPI A;  1HOM A;  5JLW A;  3LOC A;  2E2H J;  5IP7 J;  5IP6 A;  1MBE A;  2MG4 A;  4J19 A;  3HDD A;  2K9S A;  4Y7N J;  3E7L A;  2H1K A;  1F36 A;  1ETY A;  4A3E J;  3B6C A;  1ZR4 A;  4HNV A;  1W0T A;  1FTT A;  2DA5 A;  1E3O C;  3FIW A;  4DYR A;  2DTZ A;  1W0U A;  2Y0S N;  5IOZ A;  2JA5 J;  1RKT A;  3CQZ J;  3HKZ N;  3GTM J;  3HOU J;  4M6V A;  1MSF C;  4A3D J;  3H0G J;  5EEA A;  1JTX A;  2EZH A;  5IOY A;  1MNM C;  2DMT A;  3FIS A;  1X2N A;  4FE7 A;  5K7F A;  5EGO B;  3JRB A;  3S1R J;  3JRD A;  4XID A;  3G1L A;  1X58 A;  5JLX A;  3S15 J;  2LLK A;  1GVD A;  5DTD A;  3LSP A;  3S2D J;  3JRG A;  4IHY A;  2LK2 A;  2M2E A;  3DCF A;  1IUF A;  2M9H A;  2VKE A;  2DA2 A;  4XRS A;  3JRA A;  2LVS A;  2HXO A;  2HXI A;  1JUM A;  3HOZ J;  2GBY A;  2XGD A;  2KT0 A;  1MBJ A;  2MSY A;  2O9L A;  1ZK8 A;  3HGY A;  5K7Z A;  3BTL A;  3L1P A;  3LSR A;  1MBH A;  3HOY J;  2Y9Z A;  1IDZ A;  2R0Q C;  2HQ5 A;  1POG A;  2R5Z A;  2K9Q A;  2JWT A;  3FK6 A;  4D7N A;  1JT6 A;  2AHQ A;  3BG9 A;  3B6A A;  1XS9 A;  1I3Q J;  4A3F J;  1U8B A;  3ZQL A;  1JT0 A;  2VKV A;  1MBK A;  2YU9 J;  2EZL A;  1HDP A;  1DU6 A;  3TW6 A;  3GTQ J;  5C4J J;  3I4N J;  1P7I A;  4JX4 A;  2OF7 A;  3RKQ A;  5J1U A;  5M5W J;  2XPV A;  1JKO C;  2YUS A;  1TWG J;  3BTJ A;  4DZP A;  2P81 A;  4JP0 A;  1WH5 A;  3A03 A;  2WB1 N;  3OSF A;  1QVU A;  1ZQ3 P;  4XRS G;  3BTI A;  5IYB J;  1IJW C;  5FJ8 J;  2HDD A;  1B8I A;  2ME0 A;  5EF6 A;  1FEX A;  5IYC J;  3PO2 J;  1LFB A;  5HOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...