1HKTA

Solution structure of the dna-binding domain of drosophila heat shock transcription factor
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
106
structure length
106
Chain Sequence
GSGVPAFLAKLWRLVDDADTNRLICWTKDGQSFVIQNQAQFAKELLPLNYKHNNMASFIRQLNMYGFHKITSIDNGGLRFDRDEIEFSHPFFKRNSPFLLDQIKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords HEAT-SHOCK TRANSCRIPTION FACTOR
publication title Solution structure of the DNA-binding domain of Drosophila heat shock transcription factor.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 9
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1994-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00447 HSF_DNA-bind HSF-type DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hktA00
2ZMEB 5ILVA 2DK8A 5IT9K 4BQAA 4LMYA 4M71A 2Z33A 1K7AA 5CYVA 2ZFWA 2XROA 2XAGA 3I54A 4OIPF 2PLYA 1TQPA 3GFLA 2MH9A 1XMAA 4I7HA 4L9VA 5FB2A 3I0TA 1SAXA 3OOPA 5LEKA 4GXOA 1XSDA 3BROA 1YS6A 5J8FA 2VODA 1YW8A 3GW2A 3K2ZA 3SHFA 4FX0A 1IN8A 1ZYRF 1ZGJA 4EM1A 2P6SA 1D3YA 3K69A 1LQ1A 4A6EA 1Z6RA 5HS7A 1T98A 1PP8F 2Y0MA 3WTVC 1YQAA 4TV7A 1E2XA 1U5TA 2H27A 2FNAA 3IWFA 2XV4S 5BPIA 5LRRA 1USSA 4A6DA 2EK5A 3AAFA 1UFMA 3FWEA 1FWZA 1KU9A 4PZJA 3T1BA 4L9TA 2P5KA 5FFZA 5JI6A 4HF1A 4HLYA 1YIOA 4MTEA 4N9HA 1AOYA 3RYRA 1EH6A 1K78A 1J75A 4OMZA 2BGCA 2DAOA 2OQRA 1QZZA 4JK1X 1J7KA 3F6OA 1HW5A 1JGSA 2L4AA 3S2WA 1W7PA 4HA8A 4UVBA 3GYHX 2HWVA 5BOXA 2HQRA 2IA0A 2KJCA 2NAZA 3ZMZA 1ZRDA 3HYIA 4KIFA 1SMYF 4I02A 4CDGA 2DQRA 3B02A 4ESJA 1YO5C 2Q0OA 4WXHA 2HKOA 1RUNA 1T6SA 2PG4A 2A6HF 2JPCA 1RI7A 2QQBA 1NHAA 2ZXJA 4HDVA 4RB2C 1LVAA 4EMSA 2A6EF 2DW4A 1ZG3A 5ICGA 1J9IA 2V1XA 1ZLKA 2QQAA 4BYYA 2FBKA 4R8HA 3CUQB 3TKYA 4M74A 4M6XA 3KP7A 2E7WA 4IPAA 1B59A 2M45A 4HV6A 3O2PE 1JHFA 1ULYA 5AONA 1K79A 2O0YA 5AIPA 5LGTA 3FM3A 3RPQA 5FFXA 2K4BA 2YSRA 2Q8KA 1RIOH 1KQ9A 3BZ6A 4WXDA 4KMUX 2GA1A 2IT0A 3P9IA 3JAMK 2M30A 2FSWA 3L09A 2V1DA 4U0VA 2XGXA 3I53A 3GUDA 4M72A 3T8TA 4EJUA 3BWGA 3E6CC 1FLIA 1R22A 3MEXA 3K1NA 1IN7A 2CWEA 2G9WA 2MC3A 1V4RA 4G9YA 4HW0A 2A61A 5HDNA 1R00A 3J81Z 3WTZA 1O3RA 2W25A 2YX4A 2W84A 3H3UA 1Z9CA 3WU0A 3V7SA 1RZ4A 2ESNA 4LJZF 5F6FA 5LBQA 2VT3A 2STWA 3HRUA 1ZREA 4NHJA 5E1XA 1ZH5A 3RTRA 1XMKA 1XGMA 2ADUA 3F72A 3ZMUA 4Y15A 5K1YA 1B1BA 5ICCA 3P9KA 5IT3A 4IJAA 2ZKZA 3L2CA 4QWQA 1FNNA 3GXOA 4FX4A 4HZFA 1PUEE 2CFXA 3L9FA 3V8LA 5LHHA 1JE8A 1P2FA 3W6JB 4N9IA 3VOEA 1FYMA 3ERED 1EV7A 3D0SA 3LSTA 3RKXA 3F8FA 4A0ZA 4WWCA 2P7VB 5FLXK 3BP8A 2GA2A 2WC2A 3T0YA 3K1PA 2CGPA 1I1GA 1ZRFA 1REPC 2RQPA 4GO1A 3EDPA 2OD5A 4IF4A 4IRHA 2GXBA 4HF2A 1AWCA 2OBPA 3V7CA 1E17A 2DLLA 3U9GA 4EJTA 3QP6A 5EEGA 1L3LA 1GVJA 3HSEA 4ZYEA 1UB9A 2PMHA 4CO8A 1BOAA 3KP4A 3J7AO 1QBJA 1XDSA 4HAMA 3G73A 1YW9A 3WTSC 2ZO4A 1G6NA 2LKPA 4U7BA 2DBBA 3P9CA 1W7PD 3MCZA 2MH2A 3WE3A 3TO9A 5D4RA 4I0BA 1FBSA 5L3GA 1OR7A 3CLOA 3MWMA 3GZ6A 4UUVA 2EFNA 1QGPA 1XN7A 4LLNA 2R7FA 3HOTA 4IRIA 2RDPA 4IVNA 3QPHA 2J5PA 2MLGA 3COAC 1KYWA 1H9GA 3ZMTA 2DO7A 3WE2A 4HF0A 3FF5A 4XSXF 5D6EA 1V3FA 5HLIA 1DPRA 2L01A 3GF2A 4YFNF 1RNLA 2A5YB 2XVCA 1YTYA 1LEBA 1IW7F 2P5VA 1ZG5A 4ZZLA 2IRFG 2PN6A 2ACJA 3TDZC 1T2KA 3H3ZA 1S7AA 1LDKB 3EYYA 4LFUA 5FO5A 3ULQB 2ESHA 3TQNA 5D8KB 1TBXA 1R23A 3B73A 4BH9A 5DD4A 4PCQA 2XKPA 4ZYDA 3FMQA 3HUGA 4L0YB 4M6YA 2D2WA 1R1VA 4AIKA 2RN7A 2OU2A 1J2XA 1J5YA 1BI2A 1KQ0A 1IN5A 4WXCA 2GXGA 2HFHA 4AVPA 4E70A 3R60A 5ICEA 2IW5A 1MDMA 1F1ZA 4CXFA 2ZCWA 4KICA 2UZKA 2E1CA 4PGGA 2X0LA 4Y17A 4MEYF 3QPTA 5JR3A 1FPQA 3REOA 4Q47A 3IWZA 2F5FA 1HQCA 1XD7A 2PI0A 3I59B 2P6TA 4GCVA 4A0YA 3DP7A 4MNUA 1LDJA 4A2UA 1IRGA 2DPDA 2DU9A 3RPUA 1XB4A 2RKHA 2QYOA 2LSOA 4WK8F 2EFPA 2BYVE 5F64A 4WF2A 2EA2A 1QPMA 2XASA 5DCFA 2DFIA 5E18F 3DPLC 4YIFA 1BIAA 1SMTA 2JZYA 3WTWC 3BOQA 1WI9A 4FT8A 3Q9SA 2XAQA 4XSZF 1HSTA 2VC1A 1F4KA 2EA4A 2KRFA 1S7OA 1OMIA 5BMZA 1EH7A 2UWMA 2EV0A 1ON2A 3PQKA 3LFKA 3V8JA 3J80Z 2FMYA 1O3TA 4L5IA 1XCBA 5HOOA 1U5TC 2QWWA 5EEHA 4YIIA 1P4WA 3GFIA 2RNJA 5J8CA 6PAXA 1G4DA 5HVQC 5HS8A 4HX8A 5A2QK 4LG0A 2LDUA 2ZMEA 4B8XA 1D5VA 4CHUA 2RV8A 3ELKA 2EFWA 2KIUA 2FOKA 2OZUA 1YYVA 2AS5F 2R3SA 3KP2A 3JSPA 1B9MA 4CYDA 2M8EA 3C1DA 3DFGA 5F1RA 2L54A 4L9JA 3MZYA 1QNTA 2JTVA 1ZLJA 2AXLA 3HHGA 3GX4X 2CQKA 2QBYB 3M7GA 4A5NA 5IT9Z 1WSUA 5LHIA 5H6RA 4N0BA 2D45A 1U5TB 3WTYC 4G94A 4UXNA 4LLLA 5JHUA 4EM2A 1WQ2A 1W5SA 1TNSA 4I01A 4UVCA 4MGRA 3KE2A 4Q48A 2K4JA 4OOIA 1Z6TA 2HTJA 2IPQX 4UHTA 1I1SA 1HBXG 1UHWA 1USTA 2O3FA 4HQEA 4IXAA 1T39A 3SZPA 2V9VA 2XRNA 3ZMSA 4KIBA 2IP2A 4ZH4F 1K78B 1DP7P 4L0ZB 1G3WA 4QLCU 1BC7C 3TO6A 2F5CA 2GIVA 2H6BA 4KUMA 2EFQA 4AWXB 1W7PB 3WGGA 1OPCA 3ZPLA 4F7ZA 4OU0A 2MBFA 4G8XA 4M9XA 4OINF 3RJPA 2QENA 4G7ZF 1R7JA 2EB7A 1XGSA 3M1EA 4M9ZA 1XGOA 4HBLA 4U7DA 1F9NA 5TRDA 1SD6A 2K02A 3GLXA 2P8TA 2J5OA 3HRMA 1LNWA 2O61A 3I71A 5CLSA 5HDGA 2F5DA 3K1MA 2TDXA 5CVVA 4IHSA 1YG2A 3Q9VA 2MD5A 3JTGA 3EETA 1JHHA 3DV8A 4RAZA 4UVAA 2OQGA 3M8EA 2C6YA 4GGGA 3BPXA 3V4GA 1MKMA 3JW4A 4I98B 3CUQA 2D1HA 1HKTA 2O8XA 3DKWA 3E6MA 3TDUC 1BI3A 1SFUA 1KU2A 1K6OA 1I5ZA 2BV6A 3FM5A 3HRSA 3KEOA 5FD6A 2HR3A 4D0PA 2NS0A 4M9SA 2HQNA 4EV0A 3F8BA 5D5VB 4L9NA 3LQRA 3CO6C 2VE9A 2NYXA 1HXDA 3HRTA 1HKQA 5CVUA 2HTSA 2Z3YA 2XAFA 3HOSA 4B09A 4YFXF 2WTEA 4G6DA 1R5HA 3KP5A 1FP1D 3ZP5A 2F5EA 3LAPA 4LD5A 3BPVA 5E17F 3DQVC 2NNYA 4ON0A 1O3SA 2H09A 1D8JA 5DV5A 4YFKF 2PJPA 3KP6A 2YU3A 3MFKA 4NB5A 3RKWA 1X3UA 2EWNA 1B4AA 2O03A 3C3WA 5E8GA 2BBYA 2Z99A 4WCGA 3DPTA 4LB5A 3D5LA 4G6QA 1FX7A 2X4HA 2LF7A 1W5TA 3KCCA 4ZYHA 4MQVA 4IHTA 5D5WB 3K0LA 1LEAA 3LA3A 2FU4A 4EJWA 2GQQA 1TQIA 1U78A 1R1UA 1FBQA 5JVTA 3JTHA 5HLHA 1KU7A 2YR2A 1ON1A 3RI4A 5LGNA 2DPUA 1ZRCA 3I4PA 3F6VA 1O3QA 2FEZA 4IRGA 1Y0UA 2G7HA 5HDKA 1IN4A 2WWYA 3VEPA 4XRFA 5FLXZ 3SQNA 1XDUA 1T0FA 2XUBA 1XSVA 4H0EA 3GVAA 3ISPA 3WTXC 3KZYA 4ENMA 2FBIA 2L02A 1A04A 5CVRA 2CYYA 3F8MA 2P7CB 4EGZA 4AIHA 2O6GE 1FZPB 3NQOA 5LEJA 2VT2A 1ZHFA 1P4XA 2FRHA 3E97A 2JT1A 3I5UA 3ZMVA 5JFRA 3GEZA 4ESFA 3R0JA 2M5WA 1C0WA 1UHMA 2HYFA 3F8CA 3RKYA 3I64A 3LA2A 5ED4A 4O5VA 1CF7B 1HKSA 3N4MA 2MA3A 1XSXA 4P96A 3TOBA 3K9TA 1KQ8A 4OIQF 2K27A 2DTRA 4Z2YA 5DYMA 2CW0F 4LB6B 2UXNA 1TNTA 3F3XA 4BHCA 1GXQA 2OAZA 4ASNA 1DDNA 2HEOA 1DPUA 4Q5SF 4ETSA 2QM3A 3CO7C 5J6XA 3F23A 1KYZA 1ZAOA 2Z9OA 1MDMB 4Y13A 2D1VA 4EM0B 3SZTA 1P6RA 5DCMB 3EQLF 3DXJF 4AIJA 4GYGA 3E5UA 4RGXA 3FX3A 3R6SA 1IXCA 4MTDA 2H94A 2Q2EA 2XAJA 4EJVA 5E1ZB 1G3TA 4U88A 3ECOA 1IRFA 2IA1A 4HLXA 4ENKA 4WX9A 3SFZA 4KDPA 1MD0A 3MQ0A 1ZG1A 3I59A 1J0RA 2DK5A 3HSRA 3HTUA 2HS5A 1CGPA 3Q5FA 4PGHA 1LDDA 1IF1A 3MZHA 4FHTA 3QRFF 4YG2F 3GWZA 2NRAC 4OMYA 2FQ3A 2LF8A 1BI1A 2V79A 2W24A 5LLQA 3WODF 2UXXA 1SD5A 5K5RA 1MJ9A 2PMUA 3F22A 1OYYA 4LG0B 4G7HF 1G3SA 2FXAA 3T5XA 2CG4A 2FBHA 5DUKA 5L3DA 3IL2A 2B0LA 4MQ9F 2FNPA 3PFIA 1T38A 1Z7UA 5LGUA 2VBXA 2VONA 1I27A 5CJ9A 4L18B 1BM9A 5D5UB 4KT5C 3EYIA 3DEUA 4O3MA 5AIQA 1VTNC 1BJAA 4CGZA 4MHGA 1SFXA 5ILUA 4KYWA 1LJ9A 1KGSA 1BC8C 1KU3A 2RVCA 2VN2A 3FMRA 2XKOA 2LNBA 4HOBA 4LLGF 1R58A 4LK0F 5BQTA 5DD8A 2JSCA 2MLKA 5A2QZ 3FXUA 4KA4A 4RB0A 4BAYA 2L4MA 2QBYA 4A5MA 2PQ8A 3P7NA 1TW3A 3WGHA 2ZJ2A 4I0AA 3E6BA 3BY6A 4K2EA 1ZGAA 3HHHA 1EH8A 4JQFA 2YPRA 3KP3A 3MAJA 1UCRA 2E1NA 1B9NA 1HW1A 4ZZDA 1QQIA 4BNCA 5DDGA 5KVRA 3GZ5A 3OV8A 2L3DA 1ZN2A 2ELHA 1S29A 2M87A 5K5OA 1DUXC 4UV8A 1Q1HA 2K86A 5ICFA 1MJAA 2RGVA 3ZQ7A 3WGIA 3RDIA 5D5XB 1OYWA 4HX7A 2DQLA 3LQQA 4ENNA 2VXZA 4R79A 4RB3C 1O7FA 1FP2A 1JXSA 3TOAA 4KN4X 3GO5A 3PQJA 3CUQC 3R4KA 2VOPA 4I09A 3RIRA 4XBFA 2EFOA 3QAHA 3BJAA 4MEXF 4UNOA 3R61A 2Z5UA 3JSOA 1S3JA 3E5XA 5TJJA 1O7LA 5L3CA 3FXQA 1U6GA 2ETHA 5E8IA 4RB1A 1Z91A 1GHCA 3QU6A 4L5JA 3CDHA 1FSEA 3VB2A 5CVIA 1GXPA 1IAWA 2ISZA 1P92A 2JRTA 2V6CA 3E6DA 3M8FA 1STZA 2W57A 4EJOA 5D6FA 4P55A 4BXUA 3J81K 1FOKA 4BHPA 1U8RA 4U0YA 2FMLA 2XAHA 3M9AA 3WTTC 2ZNYA 2DT5A 2RC4A 3O3KA 1J59A 1FSHA 2VBZA 1H0MA 1Z1DA 3IKTA 5FGMA 4RS8A 1SFEA 2GAUA 5KK1A 3BJ6A 3CUOA 5DEQA 2GZWA 3HIFA 4BHBA 5D4SA 3EUHA 2QQ9A 3L00A 4RGUA 3TO7A 5HLGA 2CSOA 2HGCA 4OIOF 4JBAA 4XLNF 3JAMZ 1SD7A 1U2WA 3ZN1A 1KA8A 3NEUA 1D8KA 1OKRA 3VODA 5L3FA 2R7DA 1IZ1A 1R5GA 1FC3A 1S6LA 3KZZA 5D8LB 4RGRA 4EQQA 2A3SA 5L3BA 1G3YA 1R36A 5BS6A 4A0XA 4AD9A 4KIGA 2HDCA 4PDKA 3H92A 2EV5A 2VC0A 2E7XA 3CJNA 2XHKA 1XGNA 1PDNC 4ENJA 4R1HA 4Q4ZF 1P4AA 4I2OA 2PFBA 1ZARA 3QP5A 4P9UA 4HX4A 1S8NA 5LRSA 3FMSA 4A12A 3LWFA 3LAJA 2PEXA 3NRVA 1Z05A 3I58A 3C18A 4KN7X 3WG9A 3IRQA 3ABTA 1IN6A 3V8KA 3ZN0A 2ISYA 3U1DA 3FZVA 1XCVA 2K7LA 1ONVA 4CZZA 1YW7A 1YFHA 4GYIA 4HQMA 4O6JA 2IVMA 3TGNA 2CO5A 3IKVA 4ESBA 4LK1F 1BI0A 3E3VA 2Y75A 1HSJA 3ZMDA 4EVIA 4S04A 2STTA 1TTYA 3KLOA 5FD5A 1WKMA 2ZBKA 4LGWA 4EGYA 1B6AA 4P5OA 4CICA 2PBIA 3BDDA 3VFZA 3FHZA 1IXSB 2KIFA 1LB2A 5CVJA 1W4MA 4OIRF 3GFMA 5LHGA 2EV6A 3O6BB 5K5QA 2A68F 1FT9A 1OYIA 2OA4A 3BJOA 3V7RA 3N97A 3WTUC 1FYKA 3FXRA 5H20A 3U2RA 3GFJA 3IC7A 1IUYA 2VBYA 3IRRA 3KLNA 1WWXA 2FA5A 4KFCA 1ODDA 1TQMA 2HKXA 3WU1B 2A69F 3QU3A 4ZYGA 4KNYA 2W85A 2WV0A 4DNCA 2HZTA 1BN5A 3CTAA 3R0AA 1RUOA 5H6QA 5E1WA 3HTSB 4NQWA 1YLFA 1CF7A 3E5QA 2QVOA 2OZ6A 2VBWA 1WRJA 2H6CA 2P4WA 2A07F 1I6XA 2F2EA 2IA2A 2QLZA 4HDUA 5L3EA 4P9FA 2VOOA 3KFWX 4XLPF 2KIMA 4G7OF 2M1BA 3HSFA 2G7UA 2NNNA 1H9TA 5BPDA 1FYLA 1YS7A 2KJBA 3G3ZA 3C7JA 2FE3A 1L0OC 1O57A 3LA7A 2XIGA 4M73A 4UV9A 1PP7U 1FY7A 5DCMA 3F8NA 4RGSA 4HV5A 1MGTA 1R1TA 1QZYA 2JPBA 1IXRC 2HOEA 4HYEA 2YX7A 3SXYA 1BIBA 2QZ8A 3L7WA 4KMFA 2DI3A 3W6KB 2Y48A 2HYGD 2QUFA 3J80K 2BEOA 1U3EM 2P5LC 3KEQA 1SD4A 3T8RA 2EJRA 1MJBA 3ECHA 4DQ2A 3F21A 2COMA 2KKOA 2ZNZA 4U0WA 1QO0D 2BE5F 3ML6A 2V1UA 5DUIA 3QOPA 3ROUA 1TLHB 2FF4A 2GWRA 3KETA 3ABUA 4S05A 5ILSA 3IHUA 3RYPA 5E20A 1BBYA 1TW2A 3DF8A 2VE8A 1F5TA 5ERIA 5HS9A 2IJLA 4RAYA 1FBUA 1MZBA 1HW2A
chains in the Genus database with same CATH superfamily
2ZMEB 2LBFA 3RCOA 5ILVA 2DK8A 5IT9K 2M7BA 3HOXJ 1I39A 2L0KA 1B72B 2JWTA 2V9PA 1G2HA 4BQAA 4LMYA 1N78A 4E7ZA 3FK6A 4M71A 2Z33A 4BQOA 1K7AA 5CYVA 1BW5A 2ZFWA 1FMWA 2CQXA 1RETA 2XROA 1K61A 2XAGA 2VPRA 3I54A 3EPZA 4OIPF 2QKLB 4C3JJ 2PLYA 1TQPA 1Z77A 3BTLA 3GFLA 1YRNB 4BE2A 3B6AA 2MH9A 1D1CA 1XMAA 3BLYA 4I7HA 3FXLA 4L9VA 5FB2A 2L2OA 3C2GA 3CJTB 5F04A 3I0TA 2JVHA 1MBKA 4CCJA 3W3CA 1VQ4I 1SAXA 3IH4A 3OOPA 5LEKA 3OYCA 4GXOA 1XSDA 3BROA 1YS6A 5J8FA 2VODA 1YW8A 4IO9F 1W1WE 3GW2A 4CCKA 3K2ZA 3IH2A 3SHFA 4FX0A 1HC8A 4UUSA 1IN8A 2E2HJ 1ZYRF 1ZGJA 2LMDA 2P6SA 1D3YA 3DTIA 2R4GA 3K69A 4BEHB 4XOTA 4A6EA 2LKXA 1LQ1A 1Z6RA 1OCRH 5HS7A 4AU7A 3OL3A 3H5AA 3LL7A 1T98A 1PP8F 4RM3A 2Y0MA 1H8AC 3WTVC 1YQAA 1Y1WJ 4TV7A 2L9VA 1E2XA 5E3MA 1U5TA 3S3OA 1BJZA 4PJJA 4X1EA 2H27A 2FNAA 2HNHA 4BY1J 3IWFA 2VKEA 2XV4S 3MZ8A 4H4KC 3CJQB 3SFIA 2KHMA 5BPIA 2DTZA 2ME6A 5LRRA 3OYEA 1USSA 4A6DA 1W5CC 2LY9A 2EK5A 2Z16A 1GT0C 2DA4A 3AAFA 2ZXHA 1UFMA 2JQ7A 2VPLA 1DP3A 1MBFA 3FWEA 1FWZA 1KU9A 2DFFA 3OR1C 3UNGC 3FBIB 2CV2A 2Y0SN 4PZJA 4LIVA 3T1BA 2JA7J 3HGYA 2MFZA 4L9TA 3B6CA 3H35A 2XC7A 2P5KA 4ZDLA 5FFZA 1YITI 5JI6A 4HF1A 4HLYA 1I50J 2BY1A 1YIOA 3HOYJ 4MTEA 2JK3A 2O8KA 2DA7A 4N9HA 4M3FA 1AOYA 3RYRA 3VYUB 5EGOA 3W2WA 1EH6A 1K78A 2WAEA 1J75A 4OMZA 4IX7A 2BGCA 2DAOA 2OQRA 1QZZA 4JK1X 1J7KA 3F6OA 4Y7NJ 3OYMA 4RMNA 1HW5A 1JGSA 2L4AA 3S2WA 1OCPA 2VLAA 1W7PA 3OY9A 2M34A 4HA8A 4XONA 3CP8A 4UVBA 3GYHX 2VJIA 2HWVA 5BOXA 1BR1A 2HQRA 2IA0A 3H0DA 3GTKJ 3I55I 2KJCA 2EIMH 2NAZA 2HPIA 3ZMZA 3OYIA 1ZRDA 3HYIA 4KIFA 1PJRA 1SMYF 1ZK8A 2JRMA 2UUZA 2LKSA 4I02A 4CDGA 4C9YA 2DQRA 4II3A 3B02A 4IOCF 4ESJA 1YO5C 1TZLA 3M3YJ 2Q0OA 4WXHA 2HKOA 1RUNA 2CU7A 3CCJI 2LP0A 1T6SA 2PG4A 2A6HF 1E3PA 2JPCA 1NH3A 4D7MA 1RI7A 2QQBA 1YX5A 1NHAA 2ZXJA 4HDVA 4RB2C 3GTJJ 2VJ4A 1LVAA 4EMSA 2A6EF 2DW4A 1ZG3A 5ICGA 5EZHA 1J9IA 2ZSHB 2V1XA 1DGRM 1ZLKA 2LK2A 1SEUA 2QQAA 4BYYA 2FBKA 3OYNA 4R8HA 2HQAA 3NAUA 3CUQB 3TKYA 4CCMA 4M74A 2DCEA 4M6XA 5GADJ 3KP7A 2E7WA 4IPAA 1B59A 1LFUP 2E1OA 1IV6A 2K9LA 2R93J 1YOVB 3OYDA 2M45A 4HV6A 2WAQA 4IHWA 3O2PE 2DJIA 4EEFG 3EUHC 1JHFA 3SYTA 1ULYA 1SFKA 1F43A 5AONA 2DJNA 4RBOA 1GUUA 1RR7A 2A5WA 3HOWJ 1JTYA 1K79A 2VL8A 2HPMA 2O0YA 5AIPA 1OISA 3IAS2 5LGTA 3SEQA 3FM3A 3RPQA 4XLEA 5FFXA 2K4BA 2YSRA 2Q8KA 3AL0C 2NOJB 1RIOH 4C2TA 1KQ9A 3BZ6A 5J4VA 4NC7A 4IHVA 3ZOBA 3L1PA 2W48A 4WXDA 4KMUX 3CLQA 5KAFC 5EG0B 2GA1A 2IT0A 3P9IA 2ZJPF 3MMYB 1FOWA 1IGNA 2KISA 3JAMK 2M30A 2FSWA 3L09A 2V1DA 2IGKA 4U0VA 2W82A 2XGXA 3I53A 3GUDA 2WA0A 3BR0A 2R7TA 4GFBA 2R7RA 4RLFA 3BCBA 4M72A 3JRGA 1YE9A 3T8TA 2DT6A 4EJUA 3BWGA 3E6CC 1FLIA 4BKXA 1R22A 5LD2C 3MEXA 3K1NA 1IN7A 2CWEA 2G9WA 2MC3A 1V4RA 3NARA 5TISC 4E7KA 3BG6A 4G9YA 2A61A 4HW0A 1I3QJ 1R00A 5HDNA 3J81Z 2CUJA 3WTZA 1O3RA 2W25A 2VKVA 2YX4A 2W84A 3H3UA 1Z9CA 3WU0A 3V7SA 3HJEA 1Y8QB 4LG3A 4BL0B 1RZ4A 2ESNA 4LJZF 5F6FA 5LBQA 2GIZA 2VT3A 2STWA 2R7WA 3HRUA 3CQZJ 1ZREA 2IBDA 5E1XA 4NHJA 4FETA 1TWGJ 2VASA 1OCOH 1RPWA 3RTRA 1ZH5A 1NG6A 2XB5A 3GTGJ 1XMKA 4BS9A 2CUEA 1XGMA 2ADUA 2V9KA 2RNGA 3F72A 3ZMUA 2V4JC 4Y15A 5K1YA 3OIQA 2ZC2A 5FROA 5E3NA 1B1BA 5ICCA 5FLMJ 3HDDA 1MBHA 3P9KA 5IT3A 4IJAA 1WJFA 2JA8J 3JRFA 2ZKZA 2ZJQF 4E7IA 1VQ7I 3L2CA 3CF5F 4QWQA 1FNNA 1R5ID 3JR9A 3GXOA 1V5FA 4FX4A 3K4KA 4HZFA 2W1OA 3O8GA 2Q1ZB 1PUEE 2CFXA 3L9FA 3V8LA 2R0QC 1GV5A 3BTJA 5LHHA 2KDOA 1JE8A 1P2FA 3LSIA 4FASD 2DYSH 1QRYA 3BTIA 3CC4I 2HVRA 2V1NA 4D1QA 3W6JB 3HEFA 4N9IA 5GPAA 3VYRB 5GAEJ 3VOEA 3K10A 1FYMA 3ERED 3L2QA 1EV7A 3D0SA 4XLFA 3LSTA 4PJNA 3L2UA 3RKXA 3M1CA 4JOMA 3F8FA 4A0ZA 2H8RA 3LSJA 4WWCA 3K6GA 1ZKGA 2X85A 2P7VB 3S3NA 5FLXK 1WJDA 3BP8A 2GA2A 1XMXA 3OSGA 2CS3A 3L2RA 1A6IA 2M9HA 2WC2A 3T0YA 3K1PA 2CGPA 1I1GA 3DTKA 2MSYA 1ZRFA 1REPC 2RQPA 2NVXJ 5HLTA 4GO1A 3EDPA 3FKIJ 2ICWG 2OD5A 4IF4A 3HXLA 4IRHA 2Y0SA 2GXBA 1T33A 4HF2A 1AWCA 2LG4A 1OR7C 2OBPA 2WB1N 2R5ZA 1MNEA 3VWBA 3V7CA 4B3XA 1E17A 2DLLA 3U9GA 4EJTA 2DMQA 5JLXA 1CQTA 2KIQA 1SAUA 3QP6A 4CCOA 5EEGA 3HB9A 1L3LA 1GVJA 1LUJB 3HSEA 1TC3C 4ZYEA 1UB9A 3CCLI 2PMHA 3MKWB 2NS8A 4CO8A 1D0XA 1BOAA 1OQYA 3KP4A 3CP2A 2L7MP 1X19A 4MFEA 1T8IA 3J7AO 1QBJA 2XGEA 2VKHA 3S1RJ 3Q0WA 4ZDOA 1XDSA 2OTJI 1D5YA 1WI3A 4HAMA 3G73A 1P7IA 2PMZN 3HKZA 2IGMA 1YW9A 3ONQA 2IGOA 3WTSC 2ZO4A 1G6NA 2LKPA 4U7BA 2DBBA 3P9CA 1W7PD 3MCZA 2MH2A 3WE3A 3S3MA 1ZGWA 3TO9A 2R7XA 5D4RA 4I0BA 1FBSA 5L3GA 2BY3A 1OR7A 1WH7A 2FUG2 2CUZA 3CLOA 3MWMA 1NTCA 3GZ6A 3KZIC 4UUVA 3RKQA 5KAIC 4FTHA 2DA1A 2EFNA 1TL8A 1QGPA 1XN7A 4LLNA 2R7FA 5F0HA 3HOTA 4IRIA 2NVYJ 2RDPA 3KX2A 4IVNA 3QPHA 4DJAA 2LOOA 2W7NA 2J5PA 2YU9J 2MLGA 2VUMJ 3COAC 4ANJA 2GOMA 1KYWA 4NC6A 2IXSA 1H9GA 5IP7J 3J7AY 3ZMTA 2VQCA 2VB6A 2DO7A 1V55H 3WE2A 2E1MC 4HF0A 1ETQA 3FF5A 2H1KA 4XSXF 5D6EA 1V3FA 4CCNA 2VJJA 3PIOF 5HLIA 1DPRA 3HGGA 2L01A 3GF2A 3KPHA 4NNJA 5H2FC 5KNLA 5J1YA 4YFNF 4A3DJ 1B8IA 4ABZA 4XRSA 5M5WJ 1RNLA 2A5YB 4ITVA 2XVCA 4BQNA 1YTYA 4D9JA 3OYLA 1LEBA 1DGWY 2MYSA 2CUFA 3A01A 1IW7F 1ETWA 1Y8RB 2WAFA 3DEWA 2P5VA 5J1UA 1FEXA 1ZG5A 1Z3YA 4ZZLA 2O5RA 2IRFG 2PN6A 2ACJA 2PX9A 3TDZC 1T2KA 3H3ZA 1PYVA 1S7AA 1JTXA 4NQWB 1LDKB 3EYYA 3CMEI 3ERMA 4LFUA 5FO5A 1OLTA 3ULQB 2BW3B 2KMUA 5FKMA 2AQEA 3OYFA 2ESHA 3TQNA 1ZELA 4GDFA 5D8KB 1TBXA 3X2QH 1O4XA 1R23A 2M7AA 3B73A 3LFUA 5J3LA 4BH9A 3PNVA 5DD4A 3QPLA 3MVPA 4PCQA 2XKPA 3OL4A 4ZYDA 3FMQA 2EIKH 3HUGA 4L0YB 4M6YA 3Q3SA 3CCVI 1N77A 2JA6J 2D2WA 1R1VA 4AIKA 2RN7A 2D5VA 3DPUA 2OU2A 1IRZA 2QKMB 1J2XA 1J5YA 1OCZH 2ZXWH 1BI2A 1KQ0A 1IN5A 4WXCA 5GAGJ 2GXGA 2HFHA 3W2VA 2V7FA 4AVPA 2DOAA 2ELKA 1VF9A 4E70A 1S7EA 3QOEA 3FHNA 1MMAA 3R60A 4IKFA 2ID3A 2IW5A 5ICEA 3QQAA 2KQRA 4XORA 1MDMA 1F1ZA 4CXFA 2K9SA 1D0ZA 2X6XA 3BR6A 1TP4A 2ZCWA 5EF6A 4KICA 2UZKA 4YEJA 2E1CA 2CV1A 2OTLI 4A3MJ 5M5XJ 4PGGA 4I6ZA 2X0LA 3A1YA 1JKPC 4Y17A 3FXOA 1ENHA 3A0HC 2NVTJ 3IAM2 4MEYF 3QPTA 5JR3A 1FPQA 3REOA 4Q47A 3IWZA 1M1EB 1MH4A 1HQCA 2F5FA 1XD7A 5B3SH 2PI0A 3I59B 2JN6A 2P6TA 4GCVA 4A0YA 3DP7A 4MNUA 1LDJA 2CQQA 2M2EA 4A2UA 3OYKA 1IRGA 4BDYA 1JT0A 2DPDA 2L7KA 2DU9A 3RPUA 1FTZA 1XB4A 2RKHA 2QYOA 2LSOA 1A6QA 4WK8F 2EFPA 1DU6A 4PJ0C 2BYVE 3FIWA 4J01A 5F64A 4WF2A 2EA2A 4Z6YA 3LMMA 1QPMA 3S2HJ 3PNYA 4B1RA 1V54H 2XASA 5DCFA 2DFIA 5E18F 1IV8A 1UZCA 1RKWA 3DPLC 4YIFA 4XM3A 2LYCA 2RAEA 1BIAA 1SMTA 5J1RA 2JZYA 3WTWC 3BOQA 1WI9A 1D1BA 3AG1H 4FT8A 3Q9SA 2XAQA 4XSZF 1I3AA 4DZPA 1HSTA 3BZCA 2QEXI 2VC1A 1F4KA 1UHSA 2OPTA 1T56A 2EA4A 2KRFA 3K4JA 1IJWC 3I4NJ 2BXZA 1BA5A 1MMGA 1S7OA 4HSRA 2DFHA 1OMIA 5BMZA 2MW8A 3CC2I 1EH7A 2DA6A 3FXKA 3H3VK 2UWMA 2LVSA 2EV0A 3M07A 2I8DA 1ON2A 3DBHB 3PQKA 3IP4B 2BZTA 1WFXA 3LFKA 2ID6A 3CCEI 1X4OA 2E35A 2CQ7A 4BDZA 3V8JA 3J80Z 1W0UA 2CH0A 2FMYA 4KT6A 1XCBA 2DDBA 4L5IA 5CQGA 2VQGA 5FKOA 4C3IJ 1U5TC 2QWWA 2QA4I 3UKGA 1UAAA 5EEHA 4YIIA 1P4WA 3GFIA 3FKJA 2RNJA 1PUFA 5J8CA 6PAXA 2WB1A 1G4DA 2DA3A 5HVQC 4RDUA 5HS8A 4HX8A 5A2QK 4LG0A 3ABMH 2LDUA 2ZMEA 3ZXSA 2B63J 3CJRB 5IOZA 3ASOH 4B8XA 5HNFA 1VZ0A 1B72A 1D5VA 4CHUA 2RV8A 4XL9A 3ELKA 4A69C 2FQ4A 2KIUA 2EFWA 2BHZA 2FOKA 2OZUA 1YYVA 2AS5F 1HDDC 2L7FP 2R3SA 3KP2A 4DOZA 3JSPA 4A3CJ 1B9MA 4CYDA 2M8EA 5JHFA 2MC4A 3C1DA 3DFGA 5F1RA 2L54A 4L9JA 3CF2A 1QNTA 3MZYA 2JTVA 1E3OC 1ZLJA 2M4KA 2PMZA 2AXLA 3HHGA 3SDGA 3GX4X 1HCRA 1JUPA 2CQKA 2QBYB 5FJ8J 3M7GA 4A5NA 2JA5J 3QWLA 5LHIA 3H36A 5H6RA 1YIJI 4N0BA 1WSUA 5IT9Z 2D45A 4L5EA 1U5TB 3WTYC 4G94A 4UXNA 4LLLA 5JHUA 1LFPA 4EM2A 3OIPA 1WQ2A 1W5SA 1TNSA 3K70C 4I01A 4UVCA 2DMTA 3CCUI 1LE8B 1SVMA 3QYEA 4MGRA 5CKTA 5IP9J 3KE2A 4Q48A 1EKEA 2CW8A 2K4JA 4J00A 4OOIA 4Y33A 1MBGA 1Z6TA 2HTJA 1F36A 2YUSA 2IPQX 4UHTA 2EILH 2MABA 1I1SA 3CMAI 1HBXG 3DLAA 4BBSJ 3VDXA 2OJED 1UHWA 2WY8Q 5M3MJ 1USTA 2O3FA 4HQEA 3H5RA 4IXAA 1T39A 3SZPA 2V9VA 2XRNA 4Y3OA 3ZMSA 4C2MJ 2L9SA 4KIBA 2IP2A 3M4OJ 4ZH4F 1K78B 3S1MJ 2MD0A 1DP7P 2K40A 2AHQA 4L0ZB 1G3WA 2HU9A 4QLCU 4DYQA 3OSFA 1BC7C 3TO6A 4CYCB 2F5CA 3AG2H 2GIVA 2H6BA 4KUMA 4V2GA 1BR4A 2EFQA 4AWXB 1W7PB 3WGGA 4QPOA 4QIWN 4LIUA 1OPCA 3ZPLA 4F7ZA 4XN3A 1Z0XA 3U1KA 2BVLA 4OU0A 2MBFA 4G8XA 4M9XA 1HOMA 4HPQA 1U9OA 3S14J 4MLOA 4OINF 4JYKA 5IPAA 3IV5A 3RJPA 1UG0A 5BNGA 2QENA 3RZOJ 3ZRGA 4A3EJ 2X6YA 3ZQGA 4G7ZF 1XPXA 1R6RA 1R7JA 1X1AA 1MW7A 2EB7A 3BR3A 3FISA 1XGSA 3M1EA 4M9ZA 4BXXJ 1S5LC 3ZR8X 4MO7A 1XGOA 4HBLA 4U7DA 4C2UA 1F9NA 5EZGA 2R5YB 1WJAA 2KFDA 4N4OB 2E60A 5TRDA 3G6EI 5CQEA 1SD6A 2TCTA 4J19A 2F6CA 1P9QC 2K02A 3GLXA 2OV7A 2CMPA 2P8TA 2HDWA 1MBJA 2J5OA 3LNQA 3HRMA 1LNWA 1ZTRA 2DOFA 2X51A 5K7HA 2O61A 3I71A 5CLSA 5HDGA 2F5DA 3K1MA 2TDXA 3KEYA 4UUTA 5CVVA 4HNVA 4IHSA 1YG2A 1VQ6I 3Q9VA 2MD5A 3S15J 3S1QJ 3S16J 2V6EA 5HOOA 3JTGA 4PJMA 2DMNA 3DTEA 1OCCH 3BG3A 1MNDA 3EETA 5F0CA 1JHHA 3DV8A 4RAZA 1A35A 1ETYA 3HZJA 3PM1A 4UVAA 2BXYA 3HPHA 4XRMA 2OQGA 3M8EA 2NVUB 2C6YA 4GGGA 3BPXA 2O9LA 1HA8A 5C4XJ 4HSTA 3V4GA 1MKMA 3JW4A 3S32A 3VSLA 4F93B 4I98B 3CUQA 2TRTA 4PUSA 4XKBA 5IOYA 3OYAA 3CCMI 2D1HA 3CMMA 1MMSA 1HKTA 3BG7A 2O8XA 3BG5A 3DKWA 3E6MA 3TDUC 3PSIA 4M6VA 1BI3A 2QQ8A 4A93J 1E3HA 2RREA 1SFUA 2IEKA 3D5RC 1V5GA 5GPCA 1KU2A 3GTMJ 1K6OA 1I5ZA 2ECBA 4CZCA 3E1SA 2BV6A 4F3QA 2H1LA 2L5QA 4A3BJ 3FK7A 3ASNH 3FM5A 3DU5A 3HRSA 1QU3A 3KIOA 3KEOA 1SFOJ 5FD6A 2HR3A 5GP9A 4D0PA 2NS0A 1Z21A 4M9SA 2HQNA 2JA2A 2B9SA 1GVDA 2DMUA 2AXTC 5HODA 2HVSA 4EV0A 3VYSB 4XKWA 4EATA 5CPRB 2E5ZA 3F8BA 5D5VB 1G59A 4L9NA 1APLC 4BJ6C 1G8XA 1SVOA 3LQRA 3CO6C 2VE9A 2KZVA 2NYXA 4I99C 2ZB9A 3Q0VA 1HXDA 3HRTA 4E7SA 1HKQA 5CVUA 3AL0B 2HTSA 2Z3YA 3PUFA 4P1WA 2XAFA 1SVLA 3HOSA 1Y0NA 4B09A 1XG1A 4YFXF 3PIPF 1A31A 1X2NA 2WTEA 5B5EC 4G6DA 4ZTFA 2XGDA 1R5HA 3KP5A 3VSKA 1FP1D 2E34A 2M0MA 2NOGA 1JI8A 3ZP5A 4BE1A 2F5EA 2A05A 3LAPA 4LD5A 3CCRI 3BPVA 5E17F 3DQVC 2NNYA 4ON0A 3OS2A 1QA6A 1O3SA 1WGXA 1VQLI 2H09A 1D8JA 5DV5A 3QPSA 4YFKF 1H89C 3W6VA 3GTLJ 4MFDA 2PJPA 3LSHA 2DT7B 3KP6A 1ITYA 2YU3A 4W1UA 3MFKA 4NB5A 1YJNI 4XKVA 2LREA 3UR3C 2M8GX 3BQZA 4XR6A 3RKWA 1X3UA 2EWNA 1B4AA 3MKZA 2O03A 3C3WA 5E8GA 2LFBA 1BL0A 3TBIA 2BBYA 2YS9A 2X1CA 4BUPA 4DW6A 3BQYA 2Z99A 3NWTA 2NXNB 3DCFA 3HM5A 3DPTA 3PL8A 4WCGA 4LB5A 4HG2A 1WJ5A 5C44J 2LH9A 3D5LA 2QSHX 4JX4A 1FJLA 1YHQI 4G6QA 1FX7A 2X1DA 1ACIA 2AO9A 1BR2A 2X4HA 5IP6A 2LF7A 3ZQCA 1A5JA 1W5TA 3KCCA 4ZYHA 1X3WB 3GBGA 2CV0A 4MQVA 2R5ZB 5M5YJ 4IHTA 1ORKA 5D5WB 3K0LA 5JVGF 1JJ8C 1LEAA 2CW7A 2XRLA 3DEEA 3LA3A 2FU4A 4EJWA 2GQQA 1TQIA 1U78A 2LD5A 3QYBA 3OWTA 1R1UA 1FBQA 4PSWA 1NK2P 5JVTA 3JTHA 4PSXA 1KZHA 2BY2A 3BC8A 5HLHA 1AKHB 2EINH 1KU7A 2YR2A 3TMOA 1ON1A 3P5JA 3RI4A 3GZNB 5LGNA 3N05A 1NK3P 2DPUA 1ZRCA 4BACA 3I4PA 3F6VA 5F08A 5LFAA 2EZLA 3GTQJ 1GV2A 1LVKA 1O3QA 2FEZA 4IRGA 3ZGKA 1Y0UA 5GTIC 2G7HA 5HDKA 1IN4A 3BR1A 4HNUA 2HDDA 2WWYA 3VEPA 4XRFA 5FLXZ 3CMYA 2Y9ZA 3SQNA 1XDUA 3K70D 1Z67A 1T0FA 2KPMA 2M0CA 2JUGA 2XUBA 1XSVA 4F55A 3GVAA 3ISPA 3WTXC 4H0EA 3KZYA 3G2BA 1JJ6C 4ENMA 1ETOA 2FBIA 2L02A 1X2MA 2WBMA 2X6WA 1A04A 5CVRA 4DGWB 5KCMA 2CYYA 3F8MA 2P7CB 4EGZA 1O3TA 4AIHA 2DMPA 2X9DA 5EJCA 2O6GE 3FBNB 4II2A 1FZPB 3NWSA 3NQOA 4QPQA 3VPRA 5LEJA 3PNTA 3G71I 2VT2A 2DXIA 1QVUA 1ZHFA 2KL4A 1P4XA 2IAIA 2FRHA 3E97A 2F4OB 2JT1A 4JX5A 4BJTA 3I5UA 3ZMVA 5JFRA 3GEZA 4PJLA 4ESFA 3R0JA 2V26A 4QTRA 2LRDA 2M5WA 1C0WA 4C30A 4IHXA 1UHMA 3K4NA 2HYFA 1X4PA 3DLLF 3F8CA 5GTHC 2L7ZA 4YIRX 1Y1VJ 3RKYA 2KLOA 2WY7Q 2F48A 1X1BA 3I64A 4EM1A 3LA2A 2VQHA 5ED4A 1WZ2A 1IRXA 3BR5A 4O5VA 1X1PA 1CF7B 1HKSA 3N4MA 2MA3A 2FX0A 1XSXA 3OMYA 4P96A 3TOBA 3K9TA 1U8BA 1KQ8A 4UB6C 1VFCA 4HRIA 4F91B 2K27A 4OIQF 1Y6IA 3H0GJ 2DTRA 2CFOA 2VIXA 4M3GA 4Z2YA 4U87A 4B43A 2E1MB 5DYMA 3PJRA 2CW0F 4LB6B 2UXNA 4S0HB 1TNTA 3F3XA 5J47A 4BHCA 1GXQA 2OAZA 1VQ5I 3KYCB 1IG7A 2XAUA 1MBEA 2FJ1A 4ASNA 4DBRA 1DDNA 2HEOA 4XRSG 2HOTA 2BW3A 4Q5SF 1XC5A 3BG9A 1DPUA 4ETSA 2QGUA 2QM3A 1HLVA 3CO7C 5J6XA 3E7LA 3F23A 2JUCA 1H88C 2VI6A 1OCTC 1KYZA 3U21A 4BQQA 3HOZJ 1ZAOA 2Z9OA 1MDMB 1TT0A 4Y13A 1D1AA 2ZFUA 2D1VA 2RQQA 3H9JA 3ZQQA 4EM0B 3SZTA 5DM7F 1P6RA 5DCMB 3JRIA 3EQLF 2LLKA 3MN2A 3DXJF 4AIJA 3S1NJ 4GYGA 3E5UA 4RGXA 3FX3A 5IYBJ 1HF0A 2XDVA 1J09A 3R6SA 4FE7A 2OCEA 1IXCA 1U9NA 2L9NA 2Y31A 4MTDA 2H94A 2Q2EA 2XAJA 2GXAA 5DTDA 4EJVA 4D5FA 3K2AA 1X1DA 1WJEA 5DM6F 5E1ZB 1G3TA 4U88A 3ECOA 3ZQIA 3K4BA 1IRFA 2IA1A 4YRVA 2VXDA 2W00A 4HLXA 2KP6A 4WX9A 4ENKA 3SFZA 2PJRB 5HNHA 4QSHA 1MMDA 3PFYA 4KDPA 1MD0A 4B4CA 1OFCX 4KITB 3MQ0A 1UG2A 1ZG1A 3I59A 1S72I 1J0RA 2DK5A 1OJLA 1AHDP 4UY8I 3DKYA 2ZMEC 1FOXA 3HSRA 1Z3XA 3HTUA 1N25A 2DDAA 3C2BA 2NS7A 3AKZA 2HS5A 3E0JB 1CGPA 3Q5FA 1JKQC 4PGHA 2EPFA 1JGGA 1BW6A 1LDDA 1IF1A 3MZHA 2HYJA 4FHTA 3D1NI 3QRFF 3ZCOA 2EBIA 2LBFB 4ZDPA 4YG2F 3ESWB 3GWZA 2NRAC 4OMYA 4RM2A 1T08B 2M4GA 2FQ3A 3HC7A 1GDTA 2H8WA 2LF8A 2MGQA 2LR8A 1BI1A 2V79A 2W24A 4IQ4A 2KZGA 4X6AJ 3H9QA 4XKCA 5LLQA 3WODF 2XF6A 2UXXA 2KRCA 3F9KA 1SD5A 5K5RA 1MJ9A 2PMUA 3F22A 2A6TA 3TW6A 2Y69H 1OYYA 4OWRB 4LG0B 3O8HA 2OC6A 1G3SA 4G7HF 2FXAA 2QSFX 3T5XA 4C3HJ 1SC7A 2CG4A 2FBHA 5DUKA 3PUBA 5L3DA 4D5CA 3IL2A 2B0LA 4MQ9F 2FNPA 1VQMI 3LSKA 3D5SC 3PFIA 2DFEA 3JRDA 4B3AA 4NBQA 1ZR4A 1T38A 1ETXA 1Z7UA 5LGUA 2VBXA 1ETVA 3VYTB 2VONA 1I27A 5F1JA 3LSRA 5CJ9A 4L18B 1QVTA 1BM9A 5B1AH 5D5UB 1EF4A 2UV1A 4KT5C 4UUSB 1ZQ3P 3EYIA 3DEUA 4O3MA 5AIQA 4V19K 1VTNC 4D7NA 1BJAA 4CGZA 1YRNA 3W2AA 2N8GA 4MHGA 2K85A 1SFXA 1UJ8A 5ILUA 4KYWA 1LJ9A 2I10A 4B48A 1KGSA 2GOXB 1BC8C 1VQPI 1KU3A 2RVCA 2VN2A 3FMRA 3CC7I 2WADA 2XKOA 2B7EA 3HBLA 4RAGA 3ZQFA 3I3LA 4DIQA 5FLVA 4G6TB 3RQIA 2LNBA 3H1CA 2R7UA 4HOBA 4LLGF 1QZEA 1R58A 4LK0F 5BQTA 5DD8A 2EZHA 2JSCA 3IH3A 2MLKA 2X1EA 4PFPA 4BEHA 4B47A 5A2QZ 3FXUA 4KA4A 2GLOA 4RB0A 4BAYA 2L4MA 2QBYA 4XOPA 3A03A 4A5MA 1QHGA 2PQ8A 3P7NA 2Z2SB 1IUFA 1W36D 1TW3A 3WGHA 1WPKA 2ZJ2A 4I0AA 3E6BA 3PSFA 3BY6A 4K2EA 1R4NB 1ZGAA 3HHHA 2BY0A 1RESA 1LE8A 3ZQHA 1EH8A 2YPRA 1K83J 3KP3A 3MAJA 4JQFA 1UCRA 2E1NA 3K4CA 3BCAA 1B9NA 1HW1A 4AIDA 3F0CA 2K9NA 4ZZDA 5EGOB 3OYBA 1Q1VA 1QQIA 4A3FJ 4BNCA 5DDGA 4CUGA 1K4TA 5KVRA 3GZ5A 3LSGA 3HPGA 1D0YA 3OV8A 1IDYA 3JCUC 1TWCJ 3BR2A 2L3DA 1ZN2A 2ELHA 1S29A 2M87A 3BTCA 5K5OA 3JRHA 2ZJRF 4UV8A 1DUXC 1Q1HA 2K86A 1Y56A 3DWLE 5ICFA 1MJAA 2RGVA 3ZQ7A 3WGIA 1S9HA 3RDIA 5D5XB 1OYWA 1WJBA 4HX7A 2NVQJ 3S2DJ 4E7HA 2DQLA 3LQQA 2I5UA 4ENNA 2VXZA 4R79A 4RB3C 1O7FA 1RKTA 4AVZA 1FMVA 4CYCA 1FP2A 2MG4A 1JXSA 1E0EA 3TOAA 4Y52J 4KN4X 3GO5A 3ABKH 4HEA2 3PQJA 2E19A 3CUQC 3R4KA 3HKZN 1X58A 3A0BC 3K4LA 2VOPA 4I09A 1I6HJ 1XS9A 2LY1A 3RIRA 4XBFA 2EFOA 3QAHA 3BJAA 2Y9YA 4MEXF 4UNOA 3R61A 2Z5UA 3JSOA 1S3JA 1TWFJ 3E5XA 5TJJA 1O7LA 2R7OA 4IHYA 2XPVA 2K3FA 3CESA 3G1LA 2F5VA 4UB8C 5L3CA 4NUBA 3FXQA 1U6GA 2ETHA 3PO2J 5E8IA 4RB1A 5E3LA 3AG3H 2L9RA 1Z91A 2XF7A 1GHCA 1K4SA 3QU6A 4L5JA 2F4IA 3CZ6A 3CDHA 3JRAA 2IS2A 2R5YA 4XLHA 1FSEA 3VB2A 5CVIA 3I9V2 4ZYAA 1GXPA 1IAWA 2ISZA 1P92A 2JRTA 2V6CA 5DS9A 2DN0A 1BOBA 1P7JA 3L2VA 1X3ZB 3E6DA 3FXMA 3V42A 3M8FA 3K7AJ 4OAYA 3SJMA 2JJ7A 1STZA 3KYDB 5FKLA 2W57A 2F4MB 4XN0A 4EJOA 2HI3A 3GMEA 3OOUA 1QHHD 3BT9A 3QODA 3OS0A 3HOUJ 3DBRB 3J7YJ 5D6FA 3LSMA 4BXFA 4P55A 4BXUA 3J81K 1FOKA 2R92J 2VKDA 2DOEA 1FOYA 3RPUD 3SZGA 1Y39A 3Q0UA 4DYRA 4BHPA 1JT6A 1N75A 3H5NA 1U8RA 4RA2A 4U0YA 2FMLA 3CCQI 2G0EA 1MIJA 4DBQA 1R9TJ 2XAHA 3BZKA 5FRMA 1FIPA 3M9AA 3WTTC 2ZNYA 2DT5A 1WH5A 2RC4A 4IL6C 2QF7A 3O3KA 1J59A 2DA2A 1T95A 1FSHA 4F52A 5EG0A 4FE4A 3LOCA 2VBZA 1VQNI 2EIJH 1H0MA 5J4YA 4FCYA 1TWAJ 1Z1DA 3G1OA 5C3EJ 3IKTA 2R7QA 5M3FJ 1RRJA 2R7ZJ 3FXJA 1K6YA 4RLQA 2CJJA 3DBLB 1LPQA 5FGMA 1YI2I 1NG7A 2E2JJ 2VQLA 4RS8A 5K7FA 1SFEA 2GAUA 4N4NB 4BGDA 4A3IJ 3OR2C 2COBA 3JRBA 5KK1A 3S93A 3BJ6A 2KRHA 3CUOA 4M3EA 4PK4A 5DEQA 2GZWA 3HIFA 4B44A 2X48A 4BHBA 5D4SA 3EUHA 2QQ9A 3FDYA 3L00A 4RGUA 3TO7A 1GLNA 5J40A 4ZJZA 3ABLH 5HLGA 2ME0A 4XIDA 2CSOA 2HGCA 2Z1DA 4OIOF 4XMYA 4JBAA 4XLNF 3JAMZ 1SD7A 1DU0A 5GAHJ 2M3AA 1U2WA 3ZN1A 1KA8A 2FOWA 2LC2A 3NEUA 1D8KA 1OKRA 5JLWA 3VODA 3OYGA 5L3FA 1ERDA 1AU7A 5FRNA 2R7DA 2XPUA 3AG4H 1QPIA 1IZ1A 1R5GA 2R7VA 1FC3A 4LITA 5B66C 1JKOC 3I56I 1S6LA 1YJWI 5E79C 5IY5H 3KZZA 1MSFC 1EA3A 4CSWA 5D8LB 3J7ZI 4RGRA 4EQQA 2A3SA 5L3BA 1TT5B 2Y2ZA 1G3YA 1R36A 2EQRA 5BS6A 2O7OA 3SEZA 2CQNA 2GM4A 1U0JA 4XLAA 3LSPA 4A0XA 4XNFA 1A36A 4AD9A 4CCLA 5TGTA 3A02A 4ZC3A 4W97A 3MKYB 4KIGA 3WG7H 2HDCA 4PDKA 3H92A 2EV5A 2VC0A 2E7XA 3HL2A 1IC8A 3CJNA 2XHKA 2WV1A 1XGNA 1PDNC 4ENJA 4R1HA 4Q4ZF 1P4AA 4I2OA 2PFBA 1ZARA 3QP5A 4P9UA 4HX4A 1LKXA 1T0FC 2EZKA 1UMQA 1S8NA 5LRSA 3FMSA 4A12A 1ETKA 3LWFA 3LAJA 2PEXA 3JREA 1MSEC 3NRVA 2VJ5A 4CH7A 2CRGA 5C4JJ 4AYBN 1W36C 4XK4A 1Z05A 1EJ9A 3A4CA 3I58A 3C18A 4KN7X 3WG9A 3IRQA 4XLCA 2QSGX 3ABTA 5FKNA 2E71A 3G1MA 2KDZA 3TEDA 1IN6A 3WHCA 3V8KA 3WHBA 3WU2C 3ZN0A 2ISYA 2IS1A 4G12A 3U1DA 3FZVA 1XCVA 3A2KA 3GTPJ 2K7LA 2BHYA 3GLLA 1ONVA 2HOSA 2E2IJ 4CZZA 1YW7A 1YFHA 4NDLA 4GYIA 1AA7A 4HQMA 3TW7A 4O6JA 5EDNA 3KYLA 2K5CA 2XSDC 4BJ5C 3I4MJ 1AKHA 4A3GJ 2IVMA 3TGNA 4AM3A 2P0WA 2CO5A 3IKVA 4ESBA 2OUMA 4A3KJ 4LK1F 3CCYA 3DKXA 4BU2A 1BI0A 2LY2A 3E3VA 2Y75A 2BVMA 4IOAF 4Y4RA 1HSJA 1JKRC 3ZMDA 4EVIA 1VQ9I 3AFHA 4S04A 2E5NA 2K9QA 2STTA 1TTYA 3KLOA 3OYHA 5FD5A 2HVQA 3CD6I 1WKMA 2ZBKA 4LGWA 4EGYA 1B6AA 4P5OA 4E7JA 1VNDA 4CICA 2PBIA 3BDDA 4JX6A 1VQ8I 5K7ZA 3VFZA 3FHZA 4FQGA 1IXSB 2KIFA 1LB2A 5CVJA 3H9GA 1ZR2A 3MD2A 1R71A 4V2FA 1MNMC 1W4MA 2ZXIA 2AQFA 3GFMA 4OIRF 2K9MA 2EV6A 5LHGA 3G4SI 1B8IB 3GCMA 3O6BB 5K5QA 2A68F 4IQJA 2OCCH 1FT9A 3MKLA 3GTOJ 2R7SA 2JMWA 1VQOI 1OYIA 3TP0A 3A01B 2ECCA 5IYDJ 2OA4A 5FKKA 3BJOA 4E6KG 3V7RA 1XX5A 3N97A 3WTUC 3TL4X 1FYKA 3CDLA 3FXRA 4PFOA 5H20A 3U2RA 1WVRA 4AC0A 4A3LJ 3GFJA 2K3PA 3IC7A 1IUYA 1WCMJ 2VBYA 5EYRA 3IRRA 3KLNA 1WWXA 2FA5A 1R49A 4KFCA 4I76A 1ODDA 2Y30A 4JP0A 1MH3A 2XB0X 4A3JJ 1LFBA 1TQMA 1VI0A 2HKXA 2HXIA 2A69F 3WU1B 3OYJA 2XPWA 3K4MA 2JVGA 3QU3A 4ZYGA 4KNYA 2W85A 3QYFA 2WV0A 4DNCA 2X6OA 3L2WA 2BOLA 3RZDJ 4ZTJA 2HZTA 1BN5A 1RC9A 3CTAA 3R0AA 3RSNA 1RUOA 3HUGB 5H6QA 5E1WA 2XSJC 3HTSB 4NQWA 1YLFA 1CF7A 1MMNA 4HNTA 3E5QA 2QVOA 2OZ6A 2VBWA 3CCSI 2XGCA 1WRJA 4KJZA 2H6CA 5EEAA 2P4WA 2A07F 1I6XA 2KT0A 2ELJA 1DQUA 2F2EA 4NC8A 2IA2A 1JUMA 2QLZA 4HDUA 3EUKL 5L3EA 4P9FA 1YJ9I 2VOOA 3KFWX 1TWHJ 3OIOA 4XLPF 1PVEA 2KIMA 4G7OF 1HDPA 2M1BA 3HSFA 4DYCA 4BY7J 2G7UA 2NNNA 1H9TA 4KISA 2DODA 4IEJA 5BPDA 1FYLA 1YS7A 1Z7LA 2EZIA 2KJBA 4BBRJ 2Q2EB 3G3ZA 3C7JA 4M3BA 9ANTA 2OF7A 3IUOA 4F92B 2P81A 3JRCA 2W4SA 1IO2A 2XF5A 2FE3A 4DZJA 1L0OC 3SDBA 4YELA 2IS4A 1VQKI 3EUAA 1O57A 3OS1A 3LA7A 3RQ4A 4XQFA 2XIGA 2GBYA 4M73A 4LOCA 4UV9A 1PP7U 1FY7A 2ZSIB 5DCMA 1SANA 3F8NA 4RGSA 1FTTA 4HV5A 2HQ5A 1MGTA 1R1TA 1WJCA 1QZYA 2JPBA 1IXRC 2HOEA 3DU6A 4GRIA 4HYEA 2WAQN 2YX7A 2E36A 3ZQLA 2EH3A 4FISA 1BIBA 2QZ8A 3SXYA 3L7WA 1RR8C 2HXOA 4RAFA 4KMFA 4E4HA 1POGA 2DI3A 3W6KB 4E7LA 2Y48A 3HG9A 2HYGD 2LTPA 2QUFA 1JUSA 3J80K 2BEOA 2IGNA 2FD5A 1W0TA 1U3EM 3PO3J 2IS6A 1UELB 4CA0A 1R4MB 2P5LC 1IDZA 3KEQA 5F27A 1SD4A 2JSPA 3T8RA 1XTAA 2EJRA 3CDIA 1MJBA 1V5EA 2PJRA 3ECHA 2HZDA 2HOAA 4DQ2A 5IYCJ 3F21A 5KHDA 2DYRH 1YX3A 4X0GA 3TP3A 2COMA 2KKOA 5E3OA 2ZNZA 2QCOA 4U0WA 1QO0D 3S8PA 2BE5F 3ML6A 4IZZA 2V1UA 5DUIA 3QOPA 4OAZA 3ROUA 2DA5A 1TLHB 2FF4A 2GWRA 4BE0A 4XICA 1FIAA 3KETA 3ABUA 4S05A 4MIMA 5F0FA 5B1BH 5ILSA 3M8JA 3IHUA 4AUXA 3S17J 3RYPA 5E20A 3HOVJ 1BBYA 1TW2A 1PUFB 3DF8A 2VE8A 1F5TA 5ERIA 5HS9A 2IJLA 4RAYA 3C2HA 1FBUA 1WHUA 1X1CA 4M3DA 1KONA 1MZBA 1HW2A 4AYBA
chains in the Genus database with same CATH topology
2ZMEB 5ILVA 2DK8A 5IT9K 4BQAA 4LMYA 4M71A 2Z33A 1K7AA 5CYVA 2ZFWA 2XROA 2XAGA 3I54A 4OIPF 2PLYA 1TQPA 3GFLA 2MH9A 1XMAA 4I7HA 4L9VA 5FB2A 3I0TA 1SAXA 3OOPA 5LEKA 4GXOA 1XSDA 3BROA 1YS6A 5J8FA 2VODA 1YW8A 3GW2A 3K2ZA 3SHFA 4FX0A 1IN8A 1ZYRF 1ZGJA 4EM1A 2P6SA 1D3YA 3K69A 1LQ1A 4A6EA 1Z6RA 5HS7A 1T98A 1PP8F 2Y0MA 3WTVC 1YQAA 4TV7A 1E2XA 1U5TA 2H27A 2FNAA 3IWFA 2XV4S 5BPIA 5LRRA 1USSA 4A6DA 2EK5A 3AAFA 1UFMA 3FWEA 1FWZA 1KU9A 4PZJA 3T1BA 4L9TA 2P5KA 5FFZA 5JI6A 4HF1A 4HLYA 1YIOA 4MTEA 4N9HA 1AOYA 3RYRA 1EH6A 1K78A 1J75A 4OMZA 2BGCA 2DAOA 2OQRA 1QZZA 4JK1X 1J7KA 3F6OA 1HW5A 1JGSA 2L4AA 3S2WA 1W7PA 4HA8A 4UVBA 3GYHX 2HWVA 5BOXA 2HQRA 2IA0A 2KJCA 2NAZA 3ZMZA 1ZRDA 3HYIA 4KIFA 1SMYF 4I02A 4CDGA 2DQRA 3B02A 4ESJA 1YO5C 2Q0OA 4WXHA 2HKOA 1RUNA 1T6SA 2PG4A 2A6HF 2JPCA 1RI7A 2QQBA 1NHAA 2ZXJA 4HDVA 4RB2C 1LVAA 4EMSA 2A6EF 2DW4A 1ZG3A 5ICGA 1J9IA 2V1XA 1ZLKA 2QQAA 4BYYA 2FBKA 4R8HA 3CUQB 3TKYA 4M74A 4M6XA 3KP7A 2E7WA 4IPAA 1B59A 2M45A 4HV6A 3O2PE 1JHFA 1ULYA 5AONA 1K79A 2O0YA 5AIPA 5LGTA 3FM3A 3RPQA 5FFXA 2K4BA 2YSRA 2Q8KA 1RIOH 1KQ9A 3BZ6A 4WXDA 4KMUX 2GA1A 2IT0A 3P9IA 3JAMK 2M30A 2FSWA 3L09A 2V1DA 4U0VA 2XGXA 3I53A 3GUDA 4M72A 3T8TA 4EJUA 3BWGA 3E6CC 1FLIA 1R22A 3MEXA 3K1NA 1IN7A 2CWEA 2G9WA 2MC3A 1V4RA 4G9YA 4HW0A 2A61A 5HDNA 1R00A 3J81Z 3WTZA 1O3RA 2W25A 2YX4A 2W84A 3H3UA 1Z9CA 3WU0A 3V7SA 1RZ4A 2ESNA 4LJZF 5F6FA 5LBQA 2VT3A 2STWA 3HRUA 1ZREA 4NHJA 5E1XA 1ZH5A 3RTRA 1XMKA 1XGMA 2ADUA 3F72A 3ZMUA 4Y15A 5K1YA 1B1BA 5ICCA 3P9KA 5IT3A 4IJAA 2ZKZA 3L2CA 4QWQA 1FNNA 3GXOA 4FX4A 4HZFA 1PUEE 2CFXA 3L9FA 3V8LA 5LHHA 1JE8A 1P2FA 3W6JB 4N9IA 3VOEA 1FYMA 3ERED 1EV7A 3D0SA 3LSTA 3RKXA 3F8FA 4A0ZA 4WWCA 2P7VB 5FLXK 3BP8A 2GA2A 2WC2A 3T0YA 3K1PA 2CGPA 1I1GA 1ZRFA 1REPC 2RQPA 4GO1A 3EDPA 2OD5A 4IF4A 4IRHA 2GXBA 4HF2A 1AWCA 2OBPA 3V7CA 1E17A 2DLLA 3U9GA 4EJTA 3QP6A 5EEGA 1L3LA 1GVJA 3HSEA 4ZYEA 1UB9A 2PMHA 4CO8A 1BOAA 3KP4A 3J7AO 1QBJA 1XDSA 4HAMA 3G73A 1YW9A 3WTSC 2ZO4A 1G6NA 2LKPA 4U7BA 2DBBA 3P9CA 1W7PD 3MCZA 2MH2A 3WE3A 3TO9A 5D4RA 4I0BA 1FBSA 5L3GA 1OR7A 3CLOA 3MWMA 3GZ6A 4UUVA 2EFNA 1QGPA 1XN7A 4LLNA 2R7FA 3HOTA 4IRIA 2RDPA 4IVNA 3QPHA 2J5PA 2MLGA 3COAC 1KYWA 1H9GA 3ZMTA 2DO7A 3WE2A 4HF0A 3FF5A 4XSXF 5D6EA 1V3FA 5HLIA 1DPRA 2L01A 3GF2A 4YFNF 1RNLA 2A5YB 2XVCA 1YTYA 1LEBA 1IW7F 2P5VA 1ZG5A 4ZZLA 2IRFG 2PN6A 2ACJA 3TDZC 1T2KA 3H3ZA 1S7AA 1LDKB 3EYYA 4LFUA 5FO5A 3ULQB 2ESHA 3TQNA 5D8KB 1TBXA 1R23A 3B73A 4BH9A 5DD4A 4PCQA 2XKPA 4ZYDA 3FMQA 3HUGA 4L0YB 4M6YA 2D2WA 1R1VA 4AIKA 2RN7A 2OU2A 1J2XA 1J5YA 1BI2A 1KQ0A 1IN5A 4WXCA 2GXGA 2HFHA 4AVPA 4E70A 3R60A 5ICEA 2IW5A 1MDMA 1F1ZA 4CXFA 2ZCWA 4KICA 2UZKA 2E1CA 4PGGA 2X0LA 4Y17A 4MEYF 3QPTA 5JR3A 1FPQA 3REOA 4Q47A 3IWZA 2F5FA 1HQCA 1XD7A 2PI0A 3I59B 2P6TA 4GCVA 4A0YA 3DP7A 4MNUA 1LDJA 4A2UA 1IRGA 2DPDA 2DU9A 3RPUA 1XB4A 2RKHA 2QYOA 2LSOA 4WK8F 2EFPA 2BYVE 5F64A 4WF2A 2EA2A 1QPMA 2XASA 5DCFA 2DFIA 5E18F 3DPLC 4YIFA 1BIAA 1SMTA 2JZYA 3WTWC 3BOQA 1WI9A 4FT8A 3Q9SA 2XAQA 4XSZF 1HSTA 2VC1A 1F4KA 2EA4A 2KRFA 1S7OA 1OMIA 5BMZA 1EH7A 2UWMA 2EV0A 1ON2A 3PQKA 3LFKA 3V8JA 3J80Z 2FMYA 1O3TA 4L5IA 1XCBA 5HOOA 1U5TC 2QWWA 5EEHA 4YIIA 1P4WA 3GFIA 2RNJA 5J8CA 6PAXA 1G4DA 5HVQC 5HS8A 4HX8A 5A2QK 4LG0A 2LDUA 2ZMEA 4B8XA 1D5VA 4CHUA 2RV8A 3ELKA 2EFWA 2KIUA 2FOKA 2OZUA 1YYVA 2AS5F 2R3SA 3KP2A 3JSPA 1B9MA 4CYDA 2M8EA 3C1DA 3DFGA 5F1RA 2L54A 4L9JA 3MZYA 1QNTA 2JTVA 1ZLJA 2AXLA 3HHGA 3GX4X 2CQKA 2QBYB 3M7GA 4A5NA 5IT9Z 1WSUA 5LHIA 5H6RA 4N0BA 2D45A 1U5TB 3WTYC 4G94A 4UXNA 4LLLA 5JHUA 4EM2A 1WQ2A 1W5SA 1TNSA 4I01A 4UVCA 4MGRA 3KE2A 4Q48A 2K4JA 4OOIA 1Z6TA 2HTJA 2IPQX 4UHTA 1I1SA 1HBXG 1UHWA 1USTA 2O3FA 4HQEA 4IXAA 1T39A 3SZPA 2V9VA 2XRNA 3ZMSA 4KIBA 2IP2A 4ZH4F 1K78B 1DP7P 4L0ZB 1G3WA 4QLCU 1BC7C 3TO6A 2F5CA 2GIVA 2H6BA 4KUMA 2EFQA 4AWXB 1W7PB 3WGGA 1OPCA 3ZPLA 4F7ZA 4OU0A 2MBFA 4G8XA 4M9XA 4OINF 3RJPA 2QENA 4G7ZF 1R7JA 2EB7A 1XGSA 3M1EA 4M9ZA 1XGOA 4HBLA 4U7DA 1F9NA 5TRDA 1SD6A 2K02A 3GLXA 2P8TA 2J5OA 3HRMA 1LNWA 2O61A 3I71A 5CLSA 5HDGA 2F5DA 3K1MA 2TDXA 5CVVA 4IHSA 1YG2A 3Q9VA 2MD5A 3JTGA 3EETA 1JHHA 3DV8A 4RAZA 4UVAA 2OQGA 3M8EA 2C6YA 4GGGA 3BPXA 3V4GA 1MKMA 3JW4A 4I98B 3CUQA 2D1HA 1HKTA 2O8XA 3DKWA 3E6MA 3TDUC 1BI3A 1SFUA 1KU2A 1K6OA 1I5ZA 2BV6A 3FM5A 3HRSA 3KEOA 5FD6A 2HR3A 4D0PA 2NS0A 4M9SA 2HQNA 4EV0A 3F8BA 5D5VB 4L9NA 3LQRA 3CO6C 2VE9A 2NYXA 1HXDA 3HRTA 1HKQA 5CVUA 2HTSA 2Z3YA 2XAFA 3HOSA 4B09A 4YFXF 2WTEA 4G6DA 1R5HA 3KP5A 1FP1D 3ZP5A 2F5EA 3LAPA 4LD5A 3BPVA 5E17F 3DQVC 2NNYA 4ON0A 1O3SA 2H09A 1D8JA 5DV5A 4YFKF 2PJPA 3KP6A 2YU3A 3MFKA 4NB5A 3RKWA 1X3UA 2EWNA 1B4AA 2O03A 3C3WA 5E8GA 2BBYA 2Z99A 4WCGA 3DPTA 4LB5A 3D5LA 4G6QA 1FX7A 2X4HA 2LF7A 1W5TA 3KCCA 4ZYHA 4MQVA 4IHTA 5D5WB 3K0LA 1LEAA 3LA3A 2FU4A 4EJWA 2GQQA 1TQIA 1U78A 1R1UA 1FBQA 5JVTA 3JTHA 5HLHA 1KU7A 2YR2A 1ON1A 3RI4A 5LGNA 2DPUA 1ZRCA 3I4PA 3F6VA 1O3QA 2FEZA 4IRGA 1Y0UA 2G7HA 5HDKA 1IN4A 2WWYA 3VEPA 4XRFA 5FLXZ 3SQNA 1XDUA 1T0FA 2XUBA 1XSVA 4H0EA 3GVAA 3ISPA 3WTXC 3KZYA 4ENMA 2FBIA 2L02A 1A04A 5CVRA 2CYYA 3F8MA 2P7CB 4EGZA 4AIHA 2O6GE 1FZPB 3NQOA 5LEJA 2VT2A 1ZHFA 1P4XA 2FRHA 3E97A 2JT1A 3I5UA 3ZMVA 5JFRA 3GEZA 4ESFA 3R0JA 2M5WA 1C0WA 1UHMA 2HYFA 3F8CA 3RKYA 3I64A 3LA2A 5ED4A 4O5VA 1CF7B 1HKSA 3N4MA 2MA3A 1XSXA 4P96A 3TOBA 3K9TA 1KQ8A 4OIQF 2K27A 2DTRA 4Z2YA 5DYMA 2CW0F 4LB6B 2UXNA 1TNTA 3F3XA 4BHCA 1GXQA 2OAZA 4ASNA 1DDNA 2HEOA 1DPUA 4Q5SF 4ETSA 2QM3A 3CO7C 5J6XA 3F23A 1KYZA 1ZAOA 2Z9OA 1MDMB 4Y13A 2D1VA 4EM0B 3SZTA 1P6RA 5DCMB 3EQLF 3DXJF 4AIJA 4GYGA 3E5UA 4RGXA 3FX3A 3R6SA 1IXCA 4MTDA 2H94A 2Q2EA 2XAJA 4EJVA 5E1ZB 1G3TA 4U88A 3ECOA 1IRFA 2IA1A 4HLXA 4ENKA 4WX9A 3SFZA 4KDPA 1MD0A 3MQ0A 1ZG1A 3I59A 1J0RA 2DK5A 3HSRA 3HTUA 2HS5A 1CGPA 3Q5FA 4PGHA 1LDDA 1IF1A 3MZHA 4FHTA 3QRFF 4YG2F 3GWZA 2NRAC 4OMYA 2FQ3A 2LF8A 1BI1A 2V79A 2W24A 5LLQA 3WODF 2UXXA 1SD5A 5K5RA 1MJ9A 2PMUA 3F22A 1OYYA 4LG0B 4G7HF 1G3SA 2FXAA 3T5XA 2CG4A 2FBHA 5DUKA 5L3DA 3IL2A 2B0LA 4MQ9F 2FNPA 3PFIA 1T38A 1Z7UA 5LGUA 2VBXA 2VONA 1I27A 5CJ9A 4L18B 1BM9A 5D5UB 4KT5C 3EYIA 3DEUA 4O3MA 5AIQA 1VTNC 1BJAA 4CGZA 4MHGA 1SFXA 5ILUA 4KYWA 1LJ9A 1KGSA 1BC8C 1KU3A 2RVCA 2VN2A 3FMRA 2XKOA 2LNBA 4HOBA 4LLGF 1R58A 4LK0F 5BQTA 5DD8A 2JSCA 2MLKA 5A2QZ 3FXUA 4KA4A 4RB0A 4BAYA 2L4MA 2QBYA 4A5MA 2PQ8A 3P7NA 1TW3A 3WGHA 2ZJ2A 4I0AA 3E6BA 3BY6A 4K2EA 1ZGAA 3HHHA 1EH8A 4JQFA 2YPRA 3KP3A 3MAJA 1UCRA 2E1NA 1B9NA 1HW1A 4ZZDA 1QQIA 4BNCA 5DDGA 5KVRA 3GZ5A 3OV8A 2L3DA 1ZN2A 2ELHA 1S29A 2M87A 5K5OA 1DUXC 4UV8A 1Q1HA 2K86A 5ICFA 1MJAA 2RGVA 3ZQ7A 3WGIA 3RDIA 5D5XB 1OYWA 4HX7A 2DQLA 3LQQA 4ENNA 2VXZA 4R79A 4RB3C 1O7FA 1FP2A 1JXSA 3TOAA 4KN4X 3GO5A 3PQJA 3CUQC 3R4KA 2VOPA 4I09A 3RIRA 4XBFA 2EFOA 3QAHA 3BJAA 4MEXF 4UNOA 3R61A 2Z5UA 3JSOA 1S3JA 3E5XA 5TJJA 1O7LA 5L3CA 3FXQA 1U6GA 2ETHA 5E8IA 4RB1A 1Z91A 1GHCA 3QU6A 4L5JA 3CDHA 1FSEA 3VB2A 5CVIA 1GXPA 1IAWA 2ISZA 1P92A 2JRTA 2V6CA 3E6DA 3M8FA 1STZA 2W57A 4EJOA 5D6FA 4P55A 4BXUA 3J81K 1FOKA 4BHPA 1U8RA 4U0YA 2FMLA 2XAHA 3M9AA 3WTTC 2ZNYA 2DT5A 2RC4A 3O3KA 1J59A 1FSHA 2VBZA 1H0MA 1Z1DA 3IKTA 5FGMA 4RS8A 1SFEA 2GAUA 5KK1A 3BJ6A 3CUOA 5DEQA 2GZWA 3HIFA 4BHBA 5D4SA 3EUHA 2QQ9A 3L00A 4RGUA 3TO7A 5HLGA 2CSOA 2HGCA 4OIOF 4JBAA 4XLNF 3JAMZ 1SD7A 1U2WA 3ZN1A 1KA8A 3NEUA 1D8KA 1OKRA 3VODA 5L3FA 2R7DA 1IZ1A 1R5GA 1FC3A 1S6LA 3KZZA 5D8LB 4RGRA 4EQQA 2A3SA 5L3BA 1G3YA 1R36A 5BS6A 4A0XA 4AD9A 4KIGA 2HDCA 4PDKA 3H92A 2EV5A 2VC0A 2E7XA 3CJNA 2XHKA 1XGNA 1PDNC 4ENJA 4R1HA 4Q4ZF 1P4AA 4I2OA 2PFBA 1ZARA 3QP5A 4P9UA 4HX4A 1S8NA 5LRSA 3FMSA 4A12A 3LWFA 3LAJA 2PEXA 3NRVA 1Z05A 3I58A 3C18A 4KN7X 3WG9A 3IRQA 3ABTA 1IN6A 3V8KA 3ZN0A 2ISYA 3U1DA 3FZVA 1XCVA 2K7LA 1ONVA 4CZZA 1YW7A 1YFHA 4GYIA 4HQMA 4O6JA 2IVMA 3TGNA 2CO5A 3IKVA 4ESBA 4LK1F 1BI0A 3E3VA 2Y75A 1HSJA 3ZMDA 4EVIA 4S04A 2STTA 1TTYA 3KLOA 5FD5A 1WKMA 2ZBKA 4LGWA 4EGYA 1B6AA 4P5OA 4CICA 2PBIA 3BDDA 3VFZA 3FHZA 1IXSB 2KIFA 1LB2A 5CVJA 1W4MA 4OIRF 3GFMA 5LHGA 2EV6A 3O6BB 5K5QA 2A68F 1FT9A 1OYIA 2OA4A 3BJOA 3V7RA 3N97A 3WTUC 1FYKA 3FXRA 5H20A 3U2RA 3GFJA 3IC7A 1IUYA 2VBYA 3IRRA 3KLNA 1WWXA 2FA5A 4KFCA 1ODDA 1TQMA 2HKXA 3WU1B 2A69F 3QU3A 4ZYGA 4KNYA 2W85A 2WV0A 4DNCA 2HZTA 1BN5A 3CTAA 3R0AA 1RUOA 5H6QA 5E1WA 3HTSB 4NQWA 1YLFA 1CF7A 3E5QA 2QVOA 2OZ6A 2VBWA 1WRJA 2H6CA 2P4WA 2A07F 1I6XA 2F2EA 2IA2A 2QLZA 4HDUA 5L3EA 4P9FA 2VOOA 3KFWX 4XLPF 2KIMA 4G7OF 2M1BA 3HSFA 2G7UA 2NNNA 1H9TA 5BPDA 1FYLA 1YS7A 2KJBA 3G3ZA 3C7JA 2FE3A 1L0OC 1O57A 3LA7A 2XIGA 4M73A 4UV9A 1PP7U 1FY7A 5DCMA 3F8NA 4RGSA 4HV5A 1MGTA 1R1TA 1QZYA 2JPBA 1IXRC 2HOEA 4HYEA 2YX7A 3SXYA 1BIBA 2QZ8A 3L7WA 4KMFA 2DI3A 3W6KB 2Y48A 2HYGD 2QUFA 3J80K 2BEOA 1U3EM 2P5LC 3KEQA 1SD4A 3T8RA 2EJRA 1MJBA 3ECHA 4DQ2A 3F21A 2COMA 2KKOA 2ZNZA 4U0WA 1QO0D 2BE5F 3ML6A 2V1UA 5DUIA 3QOPA 3ROUA 1TLHB 2FF4A 2GWRA 3KETA 3ABUA 4S05A 5ILSA 3IHUA 3RYPA 5E20A 1BBYA 1TW2A 3DF8A 2VE8A 1F5TA 5ERIA 5HS9A 2IJLA 4RAYA 1FBUA 1MZBA 1HW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZME B;  5ILV A;  2DK8 A;  5IT9 K;  4BQA A;  4LMY A;  4M71 A;  2Z33 A;  1K7A A;  5CYV A;  2ZFW A;  2XRO A;  2XAG A;  3I54 A;  4OIP F;  2PLY A;  1TQP A;  3GFL A;  2MH9 A;  1XMA A;  4I7H A;  4L9V A;  5FB2 A;  3I0T A;  1SAX A;  3OOP A;  5LEK A;  4GXO A;  1XSD A;  3BRO A;  1YS6 A;  5J8F A;  2VOD A;  1YW8 A;  3GW2 A;  3K2Z A;  3SHF A;  4FX0 A;  1IN8 A;  1ZYR F;  1ZGJ A;  4EM1 A;  2P6S A;  1D3Y A;  3K69 A;  1LQ1 A;  4A6E A;  1Z6R A;  5HS7 A;  1T98 A;  1PP8 F;  2Y0M A;  3WTV C;  1YQA A;  4TV7 A;  1E2X A;  1U5T A;  2H27 A;  2FNA A;  3IWF A;  2XV4 S;  5BPI A;  5LRR A;  1USS A;  4A6D A;  2EK5 A;  3AAF A;  1UFM A;  3FWE A;  1FWZ A;  1KU9 A;  4PZJ A;  3T1B A;  4L9T A;  2P5K A;  5FFZ A;  5JI6 A;  4HF1 A;  4HLY A;  1YIO A;  4MTE A;  4N9H A;  1AOY A;  3RYR A;  1EH6 A;  1K78 A;  1J75 A;  4OMZ A;  2BGC A;  2DAO A;  2OQR A;  1QZZ A;  4JK1 X;  1J7K A;  3F6O A;  1HW5 A;  1JGS A;  2L4A A;  3S2W A;  1W7P A;  4HA8 A;  4UVB A;  3GYH X;  2HWV A;  5BOX A;  2HQR A;  2IA0 A;  2KJC A;  2NAZ A;  3ZMZ A;  1ZRD A;  3HYI A;  4KIF A;  1SMY F;  4I02 A;  4CDG A;  2DQR A;  3B02 A;  4ESJ A;  1YO5 C;  2Q0O A;  4WXH A;  2HKO A;  1RUN A;  1T6S A;  2PG4 A;  2A6H F;  2JPC A;  1RI7 A;  2QQB A;  1NHA A;  2ZXJ A;  4HDV A;  4RB2 C;  1LVA A;  4EMS A;  2A6E F;  2DW4 A;  1ZG3 A;  5ICG A;  1J9I A;  2V1X A;  1ZLK A;  2QQA A;  4BYY A;  2FBK A;  4R8H A;  3CUQ B;  3TKY A;  4M74 A;  4M6X A;  3KP7 A;  2E7W A;  4IPA A;  1B59 A;  2M45 A;  4HV6 A;  3O2P E;  1JHF A;  1ULY A;  5AON A;  1K79 A;  2O0Y A;  5AIP A;  5LGT A;  3FM3 A;  3RPQ A;  5FFX A;  2K4B A;  2YSR A;  2Q8K A;  1RIO H;  1KQ9 A;  3BZ6 A;  4WXD A;  4KMU X;  2GA1 A;  2IT0 A;  3P9I A;  3JAM K;  2M30 A;  2FSW A;  3L09 A;  2V1D A;  4U0V A;  2XGX A;  3I53 A;  3GUD A;  4M72 A;  3T8T A;  4EJU A;  3BWG A;  3E6C C;  1FLI A;  1R22 A;  3MEX A;  3K1N A;  1IN7 A;  2CWE A;  2G9W A;  2MC3 A;  1V4R A;  4G9Y A;  4HW0 A;  2A61 A;  5HDN A;  1R00 A;  3J81 Z;  3WTZ A;  1O3R A;  2W25 A;  2YX4 A;  2W84 A;  3H3U A;  1Z9C A;  3WU0 A;  3V7S A;  1RZ4 A;  2ESN A;  4LJZ F;  5F6F A;  5LBQ A;  2VT3 A;  2STW A;  3HRU A;  1ZRE A;  4NHJ A;  5E1X A;  1ZH5 A;  3RTR A;  1XMK A;  1XGM A;  2ADU A;  3F72 A;  3ZMU A;  4Y15 A;  5K1Y A;  1B1B A;  5ICC A;  3P9K A;  5IT3 A;  4IJA A;  2ZKZ A;  3L2C A;  4QWQ A;  1FNN A;  3GXO A;  4FX4 A;  4HZF A;  1PUE E;  2CFX A;  3L9F A;  3V8L A;  5LHH A;  1JE8 A;  1P2F A;  3W6J B;  4N9I A;  3VOE A;  1FYM A;  3ERE D;  1EV7 A;  3D0S A;  3LST A;  3RKX A;  3F8F A;  4A0Z A;  4WWC A;  2P7V B;  5FLX K;  3BP8 A;  2GA2 A;  2WC2 A;  3T0Y A;  3K1P A;  2CGP A;  1I1G A;  1ZRF A;  1REP C;  2RQP A;  4GO1 A;  3EDP A;  2OD5 A;  4IF4 A;  4IRH A;  2GXB A;  4HF2 A;  1AWC A;  2OBP A;  3V7C A;  1E17 A;  2DLL A;  3U9G A;  4EJT A;  3QP6 A;  5EEG A;  1L3L A;  1GVJ A;  3HSE A;  4ZYE A;  1UB9 A;  2PMH A;  4CO8 A;  1BOA A;  3KP4 A;  3J7A O;  1QBJ A;  1XDS A;  4HAM A;  3G73 A;  1YW9 A;  3WTS C;  2ZO4 A;  1G6N A;  2LKP A;  4U7B A;  2DBB A;  3P9C A;  1W7P D;  3MCZ A;  2MH2 A;  3WE3 A;  3TO9 A;  5D4R A;  4I0B A;  1FBS A;  5L3G A;  1OR7 A;  3CLO A;  3MWM A;  3GZ6 A;  4UUV A;  2EFN A;  1QGP A;  1XN7 A;  4LLN A;  2R7F A;  3HOT A;  4IRI A;  2RDP A;  4IVN A;  3QPH A;  2J5P A;  2MLG A;  3COA C;  1KYW A;  1H9G A;  3ZMT A;  2DO7 A;  3WE2 A;  4HF0 A;  3FF5 A;  4XSX F;  5D6E A;  1V3F A;  5HLI A;  1DPR A;  2L01 A;  3GF2 A;  4YFN F;  1RNL A;  2A5Y B;  2XVC A;  1YTY A;  1LEB A;  1IW7 F;  2P5V A;  1ZG5 A;  4ZZL A;  2IRF G;  2PN6 A;  2ACJ A;  3TDZ C;  1T2K A;  3H3Z A;  1S7A A;  1LDK B;  3EYY A;  4LFU A;  5FO5 A;  3ULQ B;  2ESH A;  3TQN A;  5D8K B;  1TBX A;  1R23 A;  3B73 A;  4BH9 A;  5DD4 A;  4PCQ A;  2XKP A;  4ZYD A;  3FMQ A;  3HUG A;  4L0Y B;  4M6Y A;  2D2W A;  1R1V A;  4AIK A;  2RN7 A;  2OU2 A;  1J2X A;  1J5Y A;  1BI2 A;  1KQ0 A;  1IN5 A;  4WXC A;  2GXG A;  2HFH A;  4AVP A;  4E70 A;  3R60 A;  5ICE A;  2IW5 A;  1MDM A;  1F1Z A;  4CXF A;  2ZCW A;  4KIC A;  2UZK A;  2E1C A;  4PGG A;  2X0L A;  4Y17 A;  4MEY F;  3QPT A;  5JR3 A;  1FPQ A;  3REO A;  4Q47 A;  3IWZ A;  2F5F A;  1HQC A;  1XD7 A;  2PI0 A;  3I59 B;  2P6T A;  4GCV A;  4A0Y A;  3DP7 A;  4MNU A;  1LDJ A;  4A2U A;  1IRG A;  2DPD A;  2DU9 A;  3RPU A;  1XB4 A;  2RKH A;  2QYO A;  2LSO A;  4WK8 F;  2EFP A;  2BYV E;  5F64 A;  4WF2 A;  2EA2 A;  1QPM A;  2XAS A;  5DCF A;  2DFI A;  5E18 F;  3DPL C;  4YIF A;  1BIA A;  1SMT A;  2JZY A;  3WTW C;  3BOQ A;  1WI9 A;  4FT8 A;  3Q9S A;  2XAQ A;  4XSZ F;  1HST A;  2VC1 A;  1F4K A;  2EA4 A;  2KRF A;  1S7O A;  1OMI A;  5BMZ A;  1EH7 A;  2UWM A;  2EV0 A;  1ON2 A;  3PQK A;  3LFK A;  3V8J A;  3J80 Z;  2FMY A;  1O3T A;  4L5I A;  1XCB A;  5HOO A;  1U5T C;  2QWW A;  5EEH A;  4YII A;  1P4W A;  3GFI A;  2RNJ A;  5J8C A;  6PAX A;  1G4D A;  5HVQ C;  5HS8 A;  4HX8 A;  5A2Q K;  4LG0 A;  2LDU A;  2ZME A;  4B8X A;  1D5V A;  4CHU A;  2RV8 A;  3ELK A;  2EFW A;  2KIU A;  2FOK A;  2OZU A;  1YYV A;  2AS5 F;  2R3S A;  3KP2 A;  3JSP A;  1B9M A;  4CYD A;  2M8E A;  3C1D A;  3DFG A;  5F1R A;  2L54 A;  4L9J A;  3MZY A;  1QNT A;  2JTV A;  1ZLJ A;  2AXL A;  3HHG A;  3GX4 X;  2CQK A;  2QBY B;  3M7G A;  4A5N A;  5IT9 Z;  1WSU A;  5LHI A;  5H6R A;  4N0B A;  2D45 A;  1U5T B;  3WTY C;  4G94 A;  4UXN A;  4LLL A;  5JHU A;  4EM2 A;  1WQ2 A;  1W5S A;  1TNS A;  4I01 A;  4UVC A;  4MGR A;  3KE2 A;  4Q48 A;  2K4J A;  4OOI A;  1Z6T A;  2HTJ A;  2IPQ X;  4UHT A;  1I1S A;  1HBX G;  1UHW A;  1UST A;  2O3F A;  4HQE A;  4IXA A;  1T39 A;  3SZP A;  2V9V A;  2XRN A;  3ZMS A;  4KIB A;  2IP2 A;  4ZH4 F;  1K78 B;  1DP7 P;  4L0Z B;  1G3W A;  4QLC U;  1BC7 C;  3TO6 A;  2F5C A;  2GIV A;  2H6B A;  4KUM A;  2EFQ A;  4AWX B;  1W7P B;  3WGG A;  1OPC A;  3ZPL A;  4F7Z A;  4OU0 A;  2MBF A;  4G8X A;  4M9X A;  4OIN F;  3RJP A;  2QEN A;  4G7Z F;  1R7J A;  2EB7 A;  1XGS A;  3M1E A;  4M9Z A;  1XGO A;  4HBL A;  4U7D A;  1F9N A;  5TRD A;  1SD6 A;  2K02 A;  3GLX A;  2P8T A;  2J5O A;  3HRM A;  1LNW A;  2O61 A;  3I71 A;  5CLS A;  5HDG A;  2F5D A;  3K1M A;  2TDX A;  5CVV A;  4IHS A;  1YG2 A;  3Q9V A;  2MD5 A;  3JTG A;  3EET A;  1JHH A;  3DV8 A;  4RAZ A;  4UVA A;  2OQG A;  3M8E A;  2C6Y A;  4GGG A;  3BPX A;  3V4G A;  1MKM A;  3JW4 A;  4I98 B;  3CUQ A;  2D1H A;  1HKT A;  2O8X A;  3DKW A;  3E6M A;  3TDU C;  1BI3 A;  1SFU A;  1KU2 A;  1K6O A;  1I5Z A;  2BV6 A;  3FM5 A;  3HRS A;  3KEO A;  5FD6 A;  2HR3 A;  4D0P A;  2NS0 A;  4M9S A;  2HQN A;  4EV0 A;  3F8B A;  5D5V B;  4L9N A;  3LQR A;  3CO6 C;  2VE9 A;  2NYX A;  1HXD A;  3HRT A;  1HKQ A;  5CVU A;  2HTS A;  2Z3Y A;  2XAF A;  3HOS A;  4B09 A;  4YFX F;  2WTE A;  4G6D A;  1R5H A;  3KP5 A;  1FP1 D;  3ZP5 A;  2F5E A;  3LAP A;  4LD5 A;  3BPV A;  5E17 F;  3DQV C;  2NNY A;  4ON0 A;  1O3S A;  2H09 A;  1D8J A;  5DV5 A;  4YFK F;  2PJP A;  3KP6 A;  2YU3 A;  3MFK A;  4NB5 A;  3RKW A;  1X3U A;  2EWN A;  1B4A A;  2O03 A;  3C3W A;  5E8G A;  2BBY A;  2Z99 A;  4WCG A;  3DPT A;  4LB5 A;  3D5L A;  4G6Q A;  1FX7 A;  2X4H A;  2LF7 A;  1W5T A;  3KCC A;  4ZYH A;  4MQV A;  4IHT A;  5D5W B;  3K0L A;  1LEA A;  3LA3 A;  2FU4 A;  4EJW A;  2GQQ A;  1TQI A;  1U78 A;  1R1U A;  1FBQ A;  5JVT A;  3JTH A;  5HLH A;  1KU7 A;  2YR2 A;  1ON1 A;  3RI4 A;  5LGN A;  2DPU A;  1ZRC A;  3I4P A;  3F6V A;  1O3Q A;  2FEZ A;  4IRG A;  1Y0U A;  2G7H A;  5HDK A;  1IN4 A;  2WWY A;  3VEP A;  4XRF A;  5FLX Z;  3SQN A;  1XDU A;  1T0F A;  2XUB A;  1XSV A;  4H0E A;  3GVA A;  3ISP A;  3WTX C;  3KZY A;  4ENM A;  2FBI A;  2L02 A;  1A04 A;  5CVR A;  2CYY A;  3F8M A;  2P7C B;  4EGZ A;  4AIH A;  2O6G E;  1FZP B;  3NQO A;  5LEJ A;  2VT2 A;  1ZHF A;  1P4X A;  2FRH A;  3E97 A;  2JT1 A;  3I5U A;  3ZMV A;  5JFR A;  3GEZ A;  4ESF A;  3R0J A;  2M5W A;  1C0W A;  1UHM A;  2HYF A;  3F8C A;  3RKY A;  3I64 A;  3LA2 A;  5ED4 A;  4O5V A;  1CF7 B;  1HKS A;  3N4M A;  2MA3 A;  1XSX A;  4P96 A;  3TOB A;  3K9T A;  1KQ8 A;  4OIQ F;  2K27 A;  2DTR A;  4Z2Y A;  5DYM A;  2CW0 F;  4LB6 B;  2UXN A;  1TNT A;  3F3X A;  4BHC A;  1GXQ A;  2OAZ A;  4ASN A;  1DDN A;  2HEO A;  1DPU A;  4Q5S F;  4ETS A;  2QM3 A;  3CO7 C;  5J6X A;  3F23 A;  1KYZ A;  1ZAO A;  2Z9O A;  1MDM B;  4Y13 A;  2D1V A;  4EM0 B;  3SZT A;  1P6R A;  5DCM B;  3EQL F;  3DXJ F;  4AIJ A;  4GYG A;  3E5U A;  4RGX A;  3FX3 A;  3R6S A;  1IXC A;  4MTD A;  2H94 A;  2Q2E A;  2XAJ A;  4EJV A;  5E1Z B;  1G3T A;  4U88 A;  3ECO A;  1IRF A;  2IA1 A;  4HLX A;  4ENK A;  4WX9 A;  3SFZ A;  4KDP A;  1MD0 A;  3MQ0 A;  1ZG1 A;  3I59 A;  1J0R A;  2DK5 A;  3HSR A;  3HTU A;  2HS5 A;  1CGP A;  3Q5F A;  4PGH A;  1LDD A;  1IF1 A;  3MZH A;  4FHT A;  3QRF F;  4YG2 F;  3GWZ A;  2NRA C;  4OMY A;  2FQ3 A;  2LF8 A;  1BI1 A;  2V79 A;  2W24 A;  5LLQ A;  3WOD F;  2UXX A;  1SD5 A;  5K5R A;  1MJ9 A;  2PMU A;  3F22 A;  1OYY A;  4LG0 B;  4G7H F;  1G3S A;  2FXA A;  3T5X A;  2CG4 A;  2FBH A;  5DUK A;  5L3D A;  3IL2 A;  2B0L A;  4MQ9 F;  2FNP A;  3PFI A;  1T38 A;  1Z7U A;  5LGU A;  2VBX A;  2VON A;  1I27 A;  5CJ9 A;  4L18 B;  1BM9 A;  5D5U B;  4KT5 C;  3EYI A;  3DEU A;  4O3M A;  5AIQ A;  1VTN C;  1BJA A;  4CGZ A;  4MHG A;  1SFX A;  5ILU A;  4KYW A;  1LJ9 A;  1KGS A;  1BC8 C;  1KU3 A;  2RVC A;  2VN2 A;  3FMR A;  2XKO A;  2LNB A;  4HOB A;  4LLG F;  1R58 A;  4LK0 F;  5BQT A;  5DD8 A;  2JSC A;  2MLK A;  5A2Q Z;  3FXU A;  4KA4 A;  4RB0 A;  4BAY A;  2L4M A;  2QBY A;  4A5M A;  2PQ8 A;  3P7N A;  1TW3 A;  3WGH A;  2ZJ2 A;  4I0A A;  3E6B A;  3BY6 A;  4K2E A;  1ZGA A;  3HHH A;  1EH8 A;  4JQF A;  2YPR A;  3KP3 A;  3MAJ A;  1UCR A;  2E1N A;  1B9N A;  1HW1 A;  4ZZD A;  1QQI A;  4BNC A;  5DDG A;  5KVR A;  3GZ5 A;  3OV8 A;  2L3D A;  1ZN2 A;  2ELH A;  1S29 A;  2M87 A;  5K5O A;  1DUX C;  4UV8 A;  1Q1H A;  2K86 A;  5ICF A;  1MJA A;  2RGV A;  3ZQ7 A;  3WGI A;  3RDI A;  5D5X B;  1OYW A;  4HX7 A;  2DQL A;  3LQQ A;  4ENN A;  2VXZ A;  4R79 A;  4RB3 C;  1O7F A;  1FP2 A;  1JXS A;  3TOA A;  4KN4 X;  3GO5 A;  3PQJ A;  3CUQ C;  3R4K A;  2VOP A;  4I09 A;  3RIR A;  4XBF A;  2EFO A;  3QAH A;  3BJA A;  4MEX F;  4UNO A;  3R61 A;  2Z5U A;  3JSO A;  1S3J A;  3E5X A;  5TJJ A;  1O7L A;  5L3C A;  3FXQ A;  1U6G A;  2ETH A;  5E8I A;  4RB1 A;  1Z91 A;  1GHC A;  3QU6 A;  4L5J A;  3CDH A;  1FSE A;  3VB2 A;  5CVI A;  1GXP A;  1IAW A;  2ISZ A;  1P92 A;  2JRT A;  2V6C A;  3E6D A;  3M8F A;  1STZ A;  2W57 A;  4EJO A;  5D6F A;  4P55 A;  4BXU A;  3J81 K;  1FOK A;  4BHP A;  1U8R A;  4U0Y A;  2FML A;  2XAH A;  3M9A A;  3WTT C;  2ZNY A;  2DT5 A;  2RC4 A;  3O3K A;  1J59 A;  1FSH A;  2VBZ A;  1H0M A;  1Z1D A;  3IKT A;  5FGM A;  4RS8 A;  1SFE A;  2GAU A;  5KK1 A;  3BJ6 A;  3CUO A;  5DEQ A;  2GZW A;  3HIF A;  4BHB A;  5D4S A;  3EUH A;  2QQ9 A;  3L00 A;  4RGU A;  3TO7 A;  5HLG A;  2CSO A;  2HGC A;  4OIO F;  4JBA A;  4XLN F;  3JAM Z;  1SD7 A;  1U2W A;  3ZN1 A;  1KA8 A;  3NEU A;  1D8K A;  1OKR A;  3VOD A;  5L3F A;  2R7D A;  1IZ1 A;  1R5G A;  1FC3 A;  1S6L A;  3KZZ A;  5D8L B;  4RGR A;  4EQQ A;  2A3S A;  5L3B A;  1G3Y A;  1R36 A;  5BS6 A;  4A0X A;  4AD9 A;  4KIG A;  2HDC A;  4PDK A;  3H92 A;  2EV5 A;  2VC0 A;  2E7X A;  3CJN A;  2XHK A;  1XGN A;  1PDN C;  4ENJ A;  4R1H A;  4Q4Z F;  1P4A A;  4I2O A;  2PFB A;  1ZAR A;  3QP5 A;  4P9U A;  4HX4 A;  1S8N A;  5LRS A;  3FMS A;  4A12 A;  3LWF A;  3LAJ A;  2PEX A;  3NRV A;  1Z05 A;  3I58 A;  3C18 A;  4KN7 X;  3WG9 A;  3IRQ A;  3ABT A;  1IN6 A;  3V8K A;  3ZN0 A;  2ISY A;  3U1D A;  3FZV A;  1XCV A;  2K7L A;  1ONV A;  4CZZ A;  1YW7 A;  1YFH A;  4GYI A;  4HQM A;  4O6J A;  2IVM A;  3TGN A;  2CO5 A;  3IKV A;  4ESB A;  4LK1 F;  1BI0 A;  3E3V A;  2Y75 A;  1HSJ A;  3ZMD A;  4EVI A;  4S04 A;  2STT A;  1TTY A;  3KLO A;  5FD5 A;  1WKM A;  2ZBK A;  4LGW A;  4EGY A;  1B6A A;  4P5O A;  4CIC A;  2PBI A;  3BDD A;  3VFZ A;  3FHZ A;  1IXS B;  2KIF A;  1LB2 A;  5CVJ A;  1W4M A;  4OIR F;  3GFM A;  5LHG A;  2EV6 A;  3O6B B;  5K5Q A;  2A68 F;  1FT9 A;  1OYI A;  2OA4 A;  3BJO A;  3V7R A;  3N97 A;  3WTU C;  1FYK A;  3FXR A;  5H20 A;  3U2R A;  3GFJ A;  3IC7 A;  1IUY A;  2VBY A;  3IRR A;  3KLN A;  1WWX A;  2FA5 A;  4KFC A;  1ODD A;  1TQM A;  2HKX A;  3WU1 B;  2A69 F;  3QU3 A;  4ZYG A;  4KNY A;  2W85 A;  2WV0 A;  4DNC A;  2HZT A;  1BN5 A;  3CTA A;  3R0A A;  1RUO A;  5H6Q A;  5E1W A;  3HTS B;  4NQW A;  1YLF A;  1CF7 A;  3E5Q A;  2QVO A;  2OZ6 A;  2VBW A;  1WRJ A;  2H6C A;  2P4W A;  2A07 F;  1I6X A;  2F2E A;  2IA2 A;  2QLZ A;  4HDU A;  5L3E A;  4P9F A;  2VOO A;  3KFW X;  4XLP F;  2KIM A;  4G7O F;  2M1B A;  3HSF A;  2G7U A;  2NNN A;  1H9T A;  5BPD A;  1FYL A;  1YS7 A;  2KJB A;  3G3Z A;  3C7J A;  2FE3 A;  1L0O C;  1O57 A;  3LA7 A;  2XIG A;  4M73 A;  4UV9 A;  1PP7 U;  1FY7 A;  5DCM A;  3F8N A;  4RGS A;  4HV5 A;  1MGT A;  1R1T A;  1QZY A;  2JPB A;  1IXR C;  2HOE A;  4HYE A;  2YX7 A;  3SXY A;  1BIB A;  2QZ8 A;  3L7W A;  4KMF A;  2DI3 A;  3W6K B;  2Y48 A;  2HYG D;  2QUF A;  3J80 K;  2BEO A;  1U3E M;  2P5L C;  3KEQ A;  1SD4 A;  3T8R A;  2EJR A;  1MJB A;  3ECH A;  4DQ2 A;  3F21 A;  2COM A;  2KKO A;  2ZNZ A;  4U0W A;  1QO0 D;  2BE5 F;  3ML6 A;  2V1U A;  5DUI A;  3QOP A;  3ROU A;  1TLH B;  2FF4 A;  2GWR A;  3KET A;  3ABU A;  4S05 A;  5ILS A;  3IHU A;  3RYP A;  5E20 A;  1BBY A;  1TW2 A;  3DF8 A;  2VE8 A;  1F5T A;  5ERI A;  5HS9 A;  2IJL A;  4RAY A;  1FBU A;  1MZB A;  1HW2 A; 
#chains in the Genus database with same CATH topology
 2ZME B;  2LBF A;  3RCO A;  5ILV A;  2DK8 A;  5IT9 K;  2M7B A;  3HOX J;  1I39 A;  2L0K A;  1B72 B;  2JWT A;  2V9P A;  1G2H A;  4BQA A;  4LMY A;  1N78 A;  4E7Z A;  3FK6 A;  4M71 A;  2Z33 A;  4BQO A;  1K7A A;  5CYV A;  1BW5 A;  2ZFW A;  1FMW A;  2CQX A;  1RET A;  2XRO A;  1K61 A;  2XAG A;  2VPR A;  3I54 A;  3EPZ A;  4OIP F;  2QKL B;  4C3J J;  2PLY A;  1TQP A;  1Z77 A;  3BTL A;  3GFL A;  1YRN B;  4BE2 A;  3B6A A;  2MH9 A;  1D1C A;  1XMA A;  3BLY A;  4I7H A;  3FXL A;  4L9V A;  5FB2 A;  2L2O A;  3C2G A;  3CJT B;  5F04 A;  3I0T A;  2JVH A;  1MBK A;  4CCJ A;  3W3C A;  1VQ4 I;  1SAX A;  3IH4 A;  3OOP A;  5LEK A;  3OYC A;  4GXO A;  1XSD A;  3BRO A;  1YS6 A;  5J8F A;  2VOD A;  1YW8 A;  4IO9 F;  1W1W E;  3GW2 A;  4CCK A;  3K2Z A;  3IH2 A;  3SHF A;  4FX0 A;  1HC8 A;  4UUS A;  1IN8 A;  2E2H J;  1ZYR F;  1ZGJ A;  2LMD A;  2P6S A;  1D3Y A;  3DTI A;  2R4G A;  3K69 A;  4BEH B;  4XOT A;  4A6E A;  2LKX A;  1LQ1 A;  1Z6R A;  1OCR H;  5HS7 A;  4AU7 A;  3OL3 A;  3H5A A;  3LL7 A;  1T98 A;  1PP8 F;  4RM3 A;  2Y0M A;  1H8A C;  3WTV C;  1YQA A;  1Y1W J;  4TV7 A;  2L9V A;  1E2X A;  5E3M A;  1U5T A;  3S3O A;  1BJZ A;  4PJJ A;  4X1E A;  2H27 A;  2FNA A;  2HNH A;  4BY1 J;  3IWF A;  2VKE A;  2XV4 S;  3MZ8 A;  4H4K C;  3CJQ B;  3SFI A;  2KHM A;  5BPI A;  2DTZ A;  2ME6 A;  5LRR A;  3OYE A;  1USS A;  4A6D A;  1W5C C;  2LY9 A;  2EK5 A;  2Z16 A;  1GT0 C;  2DA4 A;  3AAF A;  2ZXH A;  1UFM A;  2JQ7 A;  2VPL A;  1DP3 A;  1MBF A;  3FWE A;  1FWZ A;  1KU9 A;  2DFF A;  3OR1 C;  3UNG C;  3FBI B;  2CV2 A;  2Y0S N;  4PZJ A;  4LIV A;  3T1B A;  2JA7 J;  3HGY A;  2MFZ A;  4L9T A;  3B6C A;  3H35 A;  2XC7 A;  2P5K A;  4ZDL A;  5FFZ A;  1YIT I;  5JI6 A;  4HF1 A;  4HLY A;  1I50 J;  2BY1 A;  1YIO A;  3HOY J;  4MTE A;  2JK3 A;  2O8K A;  2DA7 A;  4N9H A;  4M3F A;  1AOY A;  3RYR A;  3VYU B;  5EGO A;  3W2W A;  1EH6 A;  1K78 A;  2WAE A;  1J75 A;  4OMZ A;  4IX7 A;  2BGC A;  2DAO A;  2OQR A;  1QZZ A;  4JK1 X;  1J7K A;  3F6O A;  4Y7N J;  3OYM A;  4RMN A;  1HW5 A;  1JGS A;  2L4A A;  3S2W A;  1OCP A;  2VLA A;  1W7P A;  3OY9 A;  2M34 A;  4HA8 A;  4XON A;  3CP8 A;  4UVB A;  3GYH X;  2VJI A;  2HWV A;  5BOX A;  1BR1 A;  2HQR A;  2IA0 A;  3H0D A;  3GTK J;  3I55 I;  2KJC A;  2EIM H;  2NAZ A;  2HPI A;  3ZMZ A;  3OYI A;  1ZRD A;  3HYI A;  4KIF A;  1PJR A;  1SMY F;  1ZK8 A;  2JRM A;  2UUZ A;  2LKS A;  4I02 A;  4CDG A;  4C9Y A;  2DQR A;  4II3 A;  3B02 A;  4IOC F;  4ESJ A;  1YO5 C;  1TZL A;  3M3Y J;  2Q0O A;  4WXH A;  2HKO A;  1RUN A;  2CU7 A;  3CCJ I;  2LP0 A;  1T6S A;  2PG4 A;  2A6H F;  1E3P A;  2JPC A;  1NH3 A;  4D7M A;  1RI7 A;  2QQB A;  1YX5 A;  1NHA A;  2ZXJ A;  4HDV A;  4RB2 C;  3GTJ J;  2VJ4 A;  1LVA A;  4EMS A;  2A6E F;  2DW4 A;  1ZG3 A;  5ICG A;  5EZH A;  1J9I A;  2ZSH B;  2V1X A;  1DGR M;  1ZLK A;  2LK2 A;  1SEU A;  2QQA A;  4BYY A;  2FBK A;  3OYN A;  4R8H A;  2HQA A;  3NAU A;  3CUQ B;  3TKY A;  4CCM A;  4M74 A;  2DCE A;  4M6X A;  5GAD J;  3KP7 A;  2E7W A;  4IPA A;  1B59 A;  1LFU P;  2E1O A;  1IV6 A;  2K9L A;  2R93 J;  1YOV B;  3OYD A;  2M45 A;  4HV6 A;  2WAQ A;  4IHW A;  3O2P E;  2DJI A;  4EEF G;  3EUH C;  1JHF A;  3SYT A;  1ULY A;  1SFK A;  1F43 A;  5AON A;  2DJN A;  4RBO A;  1GUU A;  1RR7 A;  2A5W A;  3HOW J;  1JTY A;  1K79 A;  2VL8 A;  2HPM A;  2O0Y A;  5AIP A;  1OIS A;  3IAS 2;  5LGT A;  3SEQ A;  3FM3 A;  3RPQ A;  4XLE A;  5FFX A;  2K4B A;  2YSR A;  2Q8K A;  3AL0 C;  2NOJ B;  1RIO H;  4C2T A;  1KQ9 A;  3BZ6 A;  5J4V A;  4NC7 A;  4IHV A;  3ZOB A;  3L1P A;  2W48 A;  4WXD A;  4KMU X;  3CLQ A;  5KAF C;  5EG0 B;  2GA1 A;  2IT0 A;  3P9I A;  2ZJP F;  3MMY B;  1FOW A;  1IGN A;  2KIS A;  3JAM K;  2M30 A;  2FSW A;  3L09 A;  2V1D A;  2IGK A;  4U0V A;  2W82 A;  2XGX A;  3I53 A;  3GUD A;  2WA0 A;  3BR0 A;  2R7T A;  4GFB A;  2R7R A;  4RLF A;  3BCB A;  4M72 A;  3JRG A;  1YE9 A;  3T8T A;  2DT6 A;  4EJU A;  3BWG A;  3E6C C;  1FLI A;  4BKX A;  1R22 A;  5LD2 C;  3MEX A;  3K1N A;  1IN7 A;  2CWE A;  2G9W A;  2MC3 A;  1V4R A;  3NAR A;  5TIS C;  4E7K A;  3BG6 A;  4G9Y A;  2A61 A;  4HW0 A;  1I3Q J;  1R00 A;  5HDN A;  3J81 Z;  2CUJ A;  3WTZ A;  1O3R A;  2W25 A;  2VKV A;  2YX4 A;  2W84 A;  3H3U A;  1Z9C A;  3WU0 A;  3V7S A;  3HJE A;  1Y8Q B;  4LG3 A;  4BL0 B;  1RZ4 A;  2ESN A;  4LJZ F;  5F6F A;  5LBQ A;  2GIZ A;  2VT3 A;  2STW A;  2R7W A;  3HRU A;  3CQZ J;  1ZRE A;  2IBD A;  5E1X A;  4NHJ A;  4FET A;  1TWG J;  2VAS A;  1OCO H;  1RPW A;  3RTR A;  1ZH5 A;  1NG6 A;  2XB5 A;  3GTG J;  1XMK A;  4BS9 A;  2CUE A;  1XGM A;  2ADU A;  2V9K A;  2RNG A;  3F72 A;  3ZMU A;  2V4J C;  4Y15 A;  5K1Y A;  3OIQ A;  2ZC2 A;  5FRO A;  5E3N A;  1B1B A;  5ICC A;  5FLM J;  3HDD A;  1MBH A;  3P9K A;  5IT3 A;  4IJA A;  1WJF A;  2JA8 J;  3JRF A;  2ZKZ A;  2ZJQ F;  4E7I A;  1VQ7 I;  3L2C A;  3CF5 F;  4QWQ A;  1FNN A;  1R5I D;  3JR9 A;  3GXO A;  1V5F A;  4FX4 A;  3K4K A;  4HZF A;  2W1O A;  3O8G A;  2Q1Z B;  1PUE E;  2CFX A;  3L9F A;  3V8L A;  2R0Q C;  1GV5 A;  3BTJ A;  5LHH A;  2KDO A;  1JE8 A;  1P2F A;  3LSI A;  4FAS D;  2DYS H;  1QRY A;  3BTI A;  3CC4 I;  2HVR A;  2V1N A;  4D1Q A;  3W6J B;  3HEF A;  4N9I A;  5GPA A;  3VYR B;  5GAE J;  3VOE A;  3K10 A;  1FYM A;  3ERE D;  3L2Q A;  1EV7 A;  3D0S A;  4XLF A;  3LST A;  4PJN A;  3L2U A;  3RKX A;  3M1C A;  4JOM A;  3F8F A;  4A0Z A;  2H8R A;  3LSJ A;  4WWC A;  3K6G A;  1ZKG A;  2X85 A;  2P7V B;  3S3N A;  5FLX K;  1WJD A;  3BP8 A;  2GA2 A;  1XMX A;  3OSG A;  2CS3 A;  3L2R A;  1A6I A;  2M9H A;  2WC2 A;  3T0Y A;  3K1P A;  2CGP A;  1I1G A;  3DTK A;  2MSY A;  1ZRF A;  1REP C;  2RQP A;  2NVX J;  5HLT A;  4GO1 A;  3EDP A;  3FKI J;  2ICW G;  2OD5 A;  4IF4 A;  3HXL A;  4IRH A;  2Y0S A;  2GXB A;  1T33 A;  4HF2 A;  1AWC A;  2LG4 A;  1OR7 C;  2OBP A;  2WB1 N;  2R5Z A;  1MNE A;  3VWB A;  3V7C A;  4B3X A;  1E17 A;  2DLL A;  3U9G A;  4EJT A;  2DMQ A;  5JLX A;  1CQT A;  2KIQ A;  1SAU A;  3QP6 A;  4CCO A;  5EEG A;  3HB9 A;  1L3L A;  1GVJ A;  1LUJ B;  3HSE A;  1TC3 C;  4ZYE A;  1UB9 A;  3CCL I;  2PMH A;  3MKW B;  2NS8 A;  4CO8 A;  1D0X A;  1BOA A;  1OQY A;  3KP4 A;  3CP2 A;  2L7M P;  1X19 A;  4MFE A;  1T8I A;  3J7A O;  1QBJ A;  2XGE A;  2VKH A;  3S1R J;  3Q0W A;  4ZDO A;  1XDS A;  2OTJ I;  1D5Y A;  1WI3 A;  4HAM A;  3G73 A;  1P7I A;  2PMZ N;  3HKZ A;  2IGM A;  1YW9 A;  3ONQ A;  2IGO A;  3WTS C;  2ZO4 A;  1G6N A;  2LKP A;  4U7B A;  2DBB A;  3P9C A;  1W7P D;  3MCZ A;  2MH2 A;  3WE3 A;  3S3M A;  1ZGW A;  3TO9 A;  2R7X A;  5D4R A;  4I0B A;  1FBS A;  5L3G A;  2BY3 A;  1OR7 A;  1WH7 A;  2FUG 2;  2CUZ A;  3CLO A;  3MWM A;  1NTC A;  3GZ6 A;  3KZI C;  4UUV A;  3RKQ A;  5KAI C;  4FTH A;  2DA1 A;  2EFN A;  1TL8 A;  1QGP A;  1XN7 A;  4LLN A;  2R7F A;  5F0H A;  3HOT A;  4IRI A;  2NVY J;  2RDP A;  3KX2 A;  4IVN A;  3QPH A;  4DJA A;  2LOO A;  2W7N A;  2J5P A;  2YU9 J;  2MLG A;  2VUM J;  3COA C;  4ANJ A;  2GOM A;  1KYW A;  4NC6 A;  2IXS A;  1H9G A;  5IP7 J;  3J7A Y;  3ZMT A;  2VQC A;  2VB6 A;  2DO7 A;  1V55 H;  3WE2 A;  2E1M C;  4HF0 A;  1ETQ A;  3FF5 A;  2H1K A;  4XSX F;  5D6E A;  1V3F A;  4CCN A;  2VJJ A;  3PIO F;  5HLI A;  1DPR A;  3HGG A;  2L01 A;  3GF2 A;  3KPH A;  4NNJ A;  5H2F C;  5KNL A;  5J1Y A;  4YFN F;  4A3D J;  1B8I A;  4ABZ A;  4XRS A;  5M5W J;  1RNL A;  2A5Y B;  4ITV A;  2XVC A;  4BQN A;  1YTY A;  4D9J A;  3OYL A;  1LEB A;  1DGW Y;  2MYS A;  2CUF A;  3A01 A;  1IW7 F;  1ETW A;  1Y8R B;  2WAF A;  3DEW A;  2P5V A;  5J1U A;  1FEX A;  1ZG5 A;  1Z3Y A;  4ZZL A;  2O5R A;  2IRF G;  2PN6 A;  2ACJ A;  2PX9 A;  3TDZ C;  1T2K A;  3H3Z A;  1PYV A;  1S7A A;  1JTX A;  4NQW B;  1LDK B;  3EYY A;  3CME I;  3ERM A;  4LFU A;  5FO5 A;  1OLT A;  3ULQ B;  2BW3 B;  2KMU A;  5FKM A;  2AQE A;  3OYF A;  2ESH A;  3TQN A;  1ZEL A;  4GDF A;  5D8K B;  1TBX A;  3X2Q H;  1O4X A;  1R23 A;  2M7A A;  3B73 A;  3LFU A;  5J3L A;  4BH9 A;  3PNV A;  5DD4 A;  3QPL A;  3MVP A;  4PCQ A;  2XKP A;  3OL4 A;  4ZYD A;  3FMQ A;  2EIK H;  3HUG A;  4L0Y B;  4M6Y A;  3Q3S A;  3CCV I;  1N77 A;  2JA6 J;  2D2W A;  1R1V A;  4AIK A;  2RN7 A;  2D5V A;  3DPU A;  2OU2 A;  1IRZ A;  2QKM B;  1J2X A;  1J5Y A;  1OCZ H;  2ZXW H;  1BI2 A;  1KQ0 A;  1IN5 A;  4WXC A;  5GAG J;  2GXG A;  2HFH A;  3W2V A;  2V7F A;  4AVP A;  2DOA A;  2ELK A;  1VF9 A;  4E70 A;  1S7E A;  3QOE A;  3FHN A;  1MMA A;  3R60 A;  4IKF A;  2ID3 A;  2IW5 A;  5ICE A;  3QQA A;  2KQR A;  4XOR A;  1MDM A;  1F1Z A;  4CXF A;  2K9S A;  1D0Z A;  2X6X A;  3BR6 A;  1TP4 A;  2ZCW A;  5EF6 A;  4KIC A;  2UZK A;  4YEJ A;  2E1C A;  2CV1 A;  2OTL I;  4A3M J;  5M5X J;  4PGG A;  4I6Z A;  2X0L A;  3A1Y A;  1JKP C;  4Y17 A;  3FXO A;  1ENH A;  3A0H C;  2NVT J;  3IAM 2;  4MEY F;  3QPT A;  5JR3 A;  1FPQ A;  3REO A;  4Q47 A;  3IWZ A;  1M1E B;  1MH4 A;  1HQC A;  2F5F A;  1XD7 A;  5B3S H;  2PI0 A;  3I59 B;  2JN6 A;  2P6T A;  4GCV A;  4A0Y A;  3DP7 A;  4MNU A;  1LDJ A;  2CQQ A;  2M2E A;  4A2U A;  3OYK A;  1IRG A;  4BDY A;  1JT0 A;  2DPD A;  2L7K A;  2DU9 A;  3RPU A;  1FTZ A;  1XB4 A;  2RKH A;  2QYO A;  2LSO A;  1A6Q A;  4WK8 F;  2EFP A;  1DU6 A;  4PJ0 C;  2BYV E;  3FIW A;  4J01 A;  5F64 A;  4WF2 A;  2EA2 A;  4Z6Y A;  3LMM A;  1QPM A;  3S2H J;  3PNY A;  4B1R A;  1V54 H;  2XAS A;  5DCF A;  2DFI A;  5E18 F;  1IV8 A;  1UZC A;  1RKW A;  3DPL C;  4YIF A;  4XM3 A;  2LYC A;  2RAE A;  1BIA A;  1SMT A;  5J1R A;  2JZY A;  3WTW C;  3BOQ A;  1WI9 A;  1D1B A;  3AG1 H;  4FT8 A;  3Q9S A;  2XAQ A;  4XSZ F;  1I3A A;  4DZP A;  1HST A;  3BZC A;  2QEX I;  2VC1 A;  1F4K A;  1UHS A;  2OPT A;  1T56 A;  2EA4 A;  2KRF A;  3K4J A;  1IJW C;  3I4N J;  2BXZ A;  1BA5 A;  1MMG A;  1S7O A;  4HSR A;  2DFH A;  1OMI A;  5BMZ A;  2MW8 A;  3CC2 I;  1EH7 A;  2DA6 A;  3FXK A;  3H3V K;  2UWM A;  2LVS A;  2EV0 A;  3M07 A;  2I8D A;  1ON2 A;  3DBH B;  3PQK A;  3IP4 B;  2BZT A;  1WFX A;  3LFK A;  2ID6 A;  3CCE I;  1X4O A;  2E35 A;  2CQ7 A;  4BDZ A;  3V8J A;  3J80 Z;  1W0U A;  2CH0 A;  2FMY A;  4KT6 A;  1XCB A;  2DDB A;  4L5I A;  5CQG A;  2VQG A;  5FKO A;  4C3I J;  1U5T C;  2QWW A;  2QA4 I;  3UKG A;  1UAA A;  5EEH A;  4YII A;  1P4W A;  3GFI A;  3FKJ A;  2RNJ A;  1PUF A;  5J8C A;  6PAX A;  2WB1 A;  1G4D A;  2DA3 A;  5HVQ C;  4RDU A;  5HS8 A;  4HX8 A;  5A2Q K;  4LG0 A;  3ABM H;  2LDU A;  2ZME A;  3ZXS A;  2B63 J;  3CJR B;  5IOZ A;  3ASO H;  4B8X A;  5HNF A;  1VZ0 A;  1B72 A;  1D5V A;  4CHU A;  2RV8 A;  4XL9 A;  3ELK A;  4A69 C;  2FQ4 A;  2KIU A;  2EFW A;  2BHZ A;  2FOK A;  2OZU A;  1YYV A;  2AS5 F;  1HDD C;  2L7F P;  2R3S A;  3KP2 A;  4DOZ A;  3JSP A;  4A3C J;  1B9M A;  4CYD A;  2M8E A;  5JHF A;  2MC4 A;  3C1D A;  3DFG A;  5F1R A;  2L54 A;  4L9J A;  3CF2 A;  1QNT A;  3MZY A;  2JTV A;  1E3O C;  1ZLJ A;  2M4K A;  2PMZ A;  2AXL A;  3HHG A;  3SDG A;  3GX4 X;  1HCR A;  1JUP A;  2CQK A;  2QBY B;  5FJ8 J;  3M7G A;  4A5N A;  2JA5 J;  3QWL A;  5LHI A;  3H36 A;  5H6R A;  1YIJ I;  4N0B A;  1WSU A;  5IT9 Z;  2D45 A;  4L5E A;  1U5T B;  3WTY C;  4G94 A;  4UXN A;  4LLL A;  5JHU A;  1LFP A;  4EM2 A;  3OIP A;  1WQ2 A;  1W5S A;  1TNS A;  3K70 C;  4I01 A;  4UVC A;  2DMT A;  3CCU I;  1LE8 B;  1SVM A;  3QYE A;  4MGR A;  5CKT A;  5IP9 J;  3KE2 A;  4Q48 A;  1EKE A;  2CW8 A;  2K4J A;  4J00 A;  4OOI A;  4Y33 A;  1MBG A;  1Z6T A;  2HTJ A;  1F36 A;  2YUS A;  2IPQ X;  4UHT A;  2EIL H;  2MAB A;  1I1S A;  3CMA I;  1HBX G;  3DLA A;  4BBS J;  3VDX A;  2OJE D;  1UHW A;  2WY8 Q;  5M3M J;  1UST A;  2O3F A;  4HQE A;  3H5R A;  4IXA A;  1T39 A;  3SZP A;  2V9V A;  2XRN A;  4Y3O A;  3ZMS A;  4C2M J;  2L9S A;  4KIB A;  2IP2 A;  3M4O J;  4ZH4 F;  1K78 B;  3S1M J;  2MD0 A;  1DP7 P;  2K40 A;  2AHQ A;  4L0Z B;  1G3W A;  2HU9 A;  4QLC U;  4DYQ A;  3OSF A;  1BC7 C;  3TO6 A;  4CYC B;  2F5C A;  3AG2 H;  2GIV A;  2H6B A;  4KUM A;  4V2G A;  1BR4 A;  2EFQ A;  4AWX B;  1W7P B;  3WGG A;  4QPO A;  4QIW N;  4LIU A;  1OPC A;  3ZPL A;  4F7Z A;  4XN3 A;  1Z0X A;  3U1K A;  2BVL A;  4OU0 A;  2MBF A;  4G8X A;  4M9X A;  1HOM A;  4HPQ A;  1U9O A;  3S14 J;  4MLO A;  4OIN F;  4JYK A;  5IPA A;  3IV5 A;  3RJP A;  1UG0 A;  5BNG A;  2QEN A;  3RZO J;  3ZRG A;  4A3E J;  2X6Y A;  3ZQG A;  4G7Z F;  1XPX A;  1R6R A;  1R7J A;  1X1A A;  1MW7 A;  2EB7 A;  3BR3 A;  3FIS A;  1XGS A;  3M1E A;  4M9Z A;  4BXX J;  1S5L C;  3ZR8 X;  4MO7 A;  1XGO A;  4HBL A;  4U7D A;  4C2U A;  1F9N A;  5EZG A;  2R5Y B;  1WJA A;  2KFD A;  4N4O B;  2E60 A;  5TRD A;  3G6E I;  5CQE A;  1SD6 A;  2TCT A;  4J19 A;  2F6C A;  1P9Q C;  2K02 A;  3GLX A;  2OV7 A;  2CMP A;  2P8T A;  2HDW A;  1MBJ A;  2J5O A;  3LNQ A;  3HRM A;  1LNW A;  1ZTR A;  2DOF A;  2X51 A;  5K7H A;  2O61 A;  3I71 A;  5CLS A;  5HDG A;  2F5D A;  3K1M A;  2TDX A;  3KEY A;  4UUT A;  5CVV A;  4HNV A;  4IHS A;  1YG2 A;  1VQ6 I;  3Q9V A;  2MD5 A;  3S15 J;  3S1Q J;  3S16 J;  2V6E A;  5HOO A;  3JTG A;  4PJM A;  2DMN A;  3DTE A;  1OCC H;  3BG3 A;  1MND A;  3EET A;  5F0C A;  1JHH A;  3DV8 A;  4RAZ A;  1A35 A;  1ETY A;  3HZJ A;  3PM1 A;  4UVA A;  2BXY A;  3HPH A;  4XRM A;  2OQG A;  3M8E A;  2NVU B;  2C6Y A;  4GGG A;  3BPX A;  2O9L A;  1HA8 A;  5C4X J;  4HST A;  3V4G A;  1MKM A;  3JW4 A;  3S32 A;  3VSL A;  4F93 B;  4I98 B;  3CUQ A;  2TRT A;  4PUS A;  4XKB A;  5IOY A;  3OYA A;  3CCM I;  2D1H A;  3CMM A;  1MMS A;  1HKT A;  3BG7 A;  2O8X A;  3BG5 A;  3DKW A;  3E6M A;  3TDU C;  3PSI A;  4M6V A;  1BI3 A;  2QQ8 A;  4A93 J;  1E3H A;  2RRE A;  1SFU A;  2IEK A;  3D5R C;  1V5G A;  5GPC A;  1KU2 A;  3GTM J;  1K6O A;  1I5Z A;  2ECB A;  4CZC A;  3E1S A;  2BV6 A;  4F3Q A;  2H1L A;  2L5Q A;  4A3B J;  3FK7 A;  3ASN H;  3FM5 A;  3DU5 A;  3HRS A;  1QU3 A;  3KIO A;  3KEO A;  1SFO J;  5FD6 A;  2HR3 A;  5GP9 A;  4D0P A;  2NS0 A;  1Z21 A;  4M9S A;  2HQN A;  2JA2 A;  2B9S A;  1GVD A;  2DMU A;  2AXT C;  5HOD A;  2HVS A;  4EV0 A;  3VYS B;  4XKW A;  4EAT A;  5CPR B;  2E5Z A;  3F8B A;  5D5V B;  1G59 A;  4L9N A;  1APL C;  4BJ6 C;  1G8X A;  1SVO A;  3LQR A;  3CO6 C;  2VE9 A;  2KZV A;  2NYX A;  4I99 C;  2ZB9 A;  3Q0V A;  1HXD A;  3HRT A;  4E7S A;  1HKQ A;  5CVU A;  3AL0 B;  2HTS A;  2Z3Y A;  3PUF A;  4P1W A;  2XAF A;  1SVL A;  3HOS A;  1Y0N A;  4B09 A;  1XG1 A;  4YFX F;  3PIP F;  1A31 A;  1X2N A;  2WTE A;  5B5E C;  4G6D A;  4ZTF A;  2XGD A;  1R5H A;  3KP5 A;  3VSK A;  1FP1 D;  2E34 A;  2M0M A;  2NOG A;  1JI8 A;  3ZP5 A;  4BE1 A;  2F5E A;  2A05 A;  3LAP A;  4LD5 A;  3CCR I;  3BPV A;  5E17 F;  3DQV C;  2NNY A;  4ON0 A;  3OS2 A;  1QA6 A;  1O3S A;  1WGX A;  1VQL I;  2H09 A;  1D8J A;  5DV5 A;  3QPS A;  4YFK F;  1H89 C;  3W6V A;  3GTL J;  4MFD A;  2PJP A;  3LSH A;  2DT7 B;  3KP6 A;  1ITY A;  2YU3 A;  4W1U A;  3MFK A;  4NB5 A;  1YJN I;  4XKV A;  2LRE A;  3UR3 C;  2M8G X;  3BQZ A;  4XR6 A;  3RKW A;  1X3U A;  2EWN A;  1B4A A;  3MKZ A;  2O03 A;  3C3W A;  5E8G A;  2LFB A;  1BL0 A;  3TBI A;  2BBY A;  2YS9 A;  2X1C A;  4BUP A;  4DW6 A;  3BQY A;  2Z99 A;  3NWT A;  2NXN B;  3DCF A;  3HM5 A;  3DPT A;  3PL8 A;  4WCG A;  4LB5 A;  4HG2 A;  1WJ5 A;  5C44 J;  2LH9 A;  3D5L A;  2QSH X;  4JX4 A;  1FJL A;  1YHQ I;  4G6Q A;  1FX7 A;  2X1D A;  1ACI A;  2AO9 A;  1BR2 A;  2X4H A;  5IP6 A;  2LF7 A;  3ZQC A;  1A5J A;  1W5T A;  3KCC A;  4ZYH A;  1X3W B;  3GBG A;  2CV0 A;  4MQV A;  2R5Z B;  5M5Y J;  4IHT A;  1ORK A;  5D5W B;  3K0L A;  5JVG F;  1JJ8 C;  1LEA A;  2CW7 A;  2XRL A;  3DEE A;  3LA3 A;  2FU4 A;  4EJW A;  2GQQ A;  1TQI A;  1U78 A;  2LD5 A;  3QYB A;  3OWT A;  1R1U A;  1FBQ A;  4PSW A;  1NK2 P;  5JVT A;  3JTH A;  4PSX A;  1KZH A;  2BY2 A;  3BC8 A;  5HLH A;  1AKH B;  2EIN H;  1KU7 A;  2YR2 A;  3TMO A;  1ON1 A;  3P5J A;  3RI4 A;  3GZN B;  5LGN A;  3N05 A;  1NK3 P;  2DPU A;  1ZRC A;  4BAC A;  3I4P A;  3F6V A;  5F08 A;  5LFA A;  2EZL A;  3GTQ J;  1GV2 A;  1LVK A;  1O3Q A;  2FEZ A;  4IRG A;  3ZGK A;  1Y0U A;  5GTI C;  2G7H A;  5HDK A;  1IN4 A;  3BR1 A;  4HNU A;  2HDD A;  2WWY A;  3VEP A;  4XRF A;  5FLX Z;  3CMY A;  2Y9Z A;  3SQN A;  1XDU A;  3K70 D;  1Z67 A;  1T0F A;  2KPM A;  2M0C A;  2JUG A;  2XUB A;  1XSV A;  4F55 A;  3GVA A;  3ISP A;  3WTX C;  4H0E A;  3KZY A;  3G2B A;  1JJ6 C;  4ENM A;  1ETO A;  2FBI A;  2L02 A;  1X2M A;  2WBM A;  2X6W A;  1A04 A;  5CVR A;  4DGW B;  5KCM A;  2CYY A;  3F8M A;  2P7C B;  4EGZ A;  1O3T A;  4AIH A;  2DMP A;  2X9D A;  5EJC A;  2O6G E;  3FBN B;  4II2 A;  1FZP B;  3NWS A;  3NQO A;  4QPQ A;  3VPR A;  5LEJ A;  3PNT A;  3G71 I;  2VT2 A;  2DXI A;  1QVU A;  1ZHF A;  2KL4 A;  1P4X A;  2IAI A;  2FRH A;  3E97 A;  2F4O B;  2JT1 A;  4JX5 A;  4BJT A;  3I5U A;  3ZMV A;  5JFR A;  3GEZ A;  4PJL A;  4ESF A;  3R0J A;  2V26 A;  4QTR A;  2LRD A;  2M5W A;  1C0W A;  4C30 A;  4IHX A;  1UHM A;  3K4N A;  2HYF A;  1X4P A;  3DLL F;  3F8C A;  5GTH C;  2L7Z A;  4YIR X;  1Y1V J;  3RKY A;  2KLO A;  2WY7 Q;  2F48 A;  1X1B A;  3I64 A;  4EM1 A;  3LA2 A;  2VQH A;  5ED4 A;  1WZ2 A;  1IRX A;  3BR5 A;  4O5V A;  1X1P A;  1CF7 B;  1HKS A;  3N4M A;  2MA3 A;  2FX0 A;  1XSX A;  3OMY A;  4P96 A;  3TOB A;  3K9T A;  1U8B A;  1KQ8 A;  4UB6 C;  1VFC A;  4HRI A;  4F91 B;  2K27 A;  4OIQ F;  1Y6I A;  3H0G J;  2DTR A;  2CFO A;  2VIX A;  4M3G A;  4Z2Y A;  4U87 A;  4B43 A;  2E1M B;  5DYM A;  3PJR A;  2CW0 F;  4LB6 B;  2UXN A;  4S0H B;  1TNT A;  3F3X A;  5J47 A;  4BHC A;  1GXQ A;  2OAZ A;  1VQ5 I;  3KYC B;  1IG7 A;  2XAU A;  1MBE A;  2FJ1 A;  4ASN A;  4DBR A;  1DDN A;  2HEO A;  4XRS G;  2HOT A;  2BW3 A;  4Q5S F;  1XC5 A;  3BG9 A;  1DPU A;  4ETS A;  2QGU A;  2QM3 A;  1HLV A;  3CO7 C;  5J6X A;  3E7L A;  3F23 A;  2JUC A;  1H88 C;  2VI6 A;  1OCT C;  1KYZ A;  3U21 A;  4BQQ A;  3HOZ J;  1ZAO A;  2Z9O A;  1MDM B;  1TT0 A;  4Y13 A;  1D1A A;  2ZFU A;  2D1V A;  2RQQ A;  3H9J A;  3ZQQ A;  4EM0 B;  3SZT A;  5DM7 F;  1P6R A;  5DCM B;  3JRI A;  3EQL F;  2LLK A;  3MN2 A;  3DXJ F;  4AIJ A;  3S1N J;  4GYG A;  3E5U A;  4RGX A;  3FX3 A;  5IYB J;  1HF0 A;  2XDV A;  1J09 A;  3R6S A;  4FE7 A;  2OCE A;  1IXC A;  1U9N A;  2L9N A;  2Y31 A;  4MTD A;  2H94 A;  2Q2E A;  2XAJ A;  2GXA A;  5DTD A;  4EJV A;  4D5F A;  3K2A A;  1X1D A;  1WJE A;  5DM6 F;  5E1Z B;  1G3T A;  4U88 A;  3ECO A;  3ZQI A;  3K4B A;  1IRF A;  2IA1 A;  4YRV A;  2VXD A;  2W00 A;  4HLX A;  2KP6 A;  4WX9 A;  4ENK A;  3SFZ A;  2PJR B;  5HNH A;  4QSH A;  1MMD A;  3PFY A;  4KDP A;  1MD0 A;  4B4C A;  1OFC X;  4KIT B;  3MQ0 A;  1UG2 A;  1ZG1 A;  3I59 A;  1S72 I;  1J0R A;  2DK5 A;  1OJL A;  1AHD P;  4UY8 I;  3DKY A;  2ZME C;  1FOX A;  3HSR A;  1Z3X A;  3HTU A;  1N25 A;  2DDA A;  3C2B A;  2NS7 A;  3AKZ A;  2HS5 A;  3E0J B;  1CGP A;  3Q5F A;  1JKQ C;  4PGH A;  2EPF A;  1JGG A;  1BW6 A;  1LDD A;  1IF1 A;  3MZH A;  2HYJ A;  4FHT A;  3D1N I;  3QRF F;  3ZCO A;  2EBI A;  2LBF B;  4ZDP A;  4YG2 F;  3ESW B;  3GWZ A;  2NRA C;  4OMY A;  4RM2 A;  1T08 B;  2M4G A;  2FQ3 A;  3HC7 A;  1GDT A;  2H8W A;  2LF8 A;  2MGQ A;  2LR8 A;  1BI1 A;  2V79 A;  2W24 A;  4IQ4 A;  2KZG A;  4X6A J;  3H9Q A;  4XKC A;  5LLQ A;  3WOD F;  2XF6 A;  2UXX A;  2KRC A;  3F9K A;  1SD5 A;  5K5R A;  1MJ9 A;  2PMU A;  3F22 A;  2A6T A;  3TW6 A;  2Y69 H;  1OYY A;  4OWR B;  4LG0 B;  3O8H A;  2OC6 A;  1G3S A;  4G7H F;  2FXA A;  2QSF X;  3T5X A;  4C3H J;  1SC7 A;  2CG4 A;  2FBH A;  5DUK A;  3PUB A;  5L3D A;  4D5C A;  3IL2 A;  2B0L A;  4MQ9 F;  2FNP A;  1VQM I;  3LSK A;  3D5S C;  3PFI A;  2DFE A;  3JRD A;  4B3A A;  4NBQ A;  1ZR4 A;  1T38 A;  1ETX A;  1Z7U A;  5LGU A;  2VBX A;  1ETV A;  3VYT B;  2VON A;  1I27 A;  5F1J A;  3LSR A;  5CJ9 A;  4L18 B;  1QVT A;  1BM9 A;  5B1A H;  5D5U B;  1EF4 A;  2UV1 A;  4KT5 C;  4UUS B;  1ZQ3 P;  3EYI A;  3DEU A;  4O3M A;  5AIQ A;  4V19 K;  1VTN C;  4D7N A;  1BJA A;  4CGZ A;  1YRN A;  3W2A A;  2N8G A;  4MHG A;  2K85 A;  1SFX A;  1UJ8 A;  5ILU A;  4KYW A;  1LJ9 A;  2I10 A;  4B48 A;  1KGS A;  2GOX B;  1BC8 C;  1VQP I;  1KU3 A;  2RVC A;  2VN2 A;  3FMR A;  3CC7 I;  2WAD A;  2XKO A;  2B7E A;  3HBL A;  4RAG A;  3ZQF A;  3I3L A;  4DIQ A;  5FLV A;  4G6T B;  3RQI A;  2LNB A;  3H1C A;  2R7U A;  4HOB A;  4LLG F;  1QZE A;  1R58 A;  4LK0 F;  5BQT A;  5DD8 A;  2EZH A;  2JSC A;  3IH3 A;  2MLK A;  2X1E A;  4PFP A;  4BEH A;  4B47 A;  5A2Q Z;  3FXU A;  4KA4 A;  2GLO A;  4RB0 A;  4BAY A;  2L4M A;  2QBY A;  4XOP A;  3A03 A;  4A5M A;  1QHG A;  2PQ8 A;  3P7N A;  2Z2S B;  1IUF A;  1W36 D;  1TW3 A;  3WGH A;  1WPK A;  2ZJ2 A;  4I0A A;  3E6B A;  3PSF A;  3BY6 A;  4K2E A;  1R4N B;  1ZGA A;  3HHH A;  2BY0 A;  1RES A;  1LE8 A;  3ZQH A;  1EH8 A;  2YPR A;  1K83 J;  3KP3 A;  3MAJ A;  4JQF A;  1UCR A;  2E1N A;  3K4C A;  3BCA A;  1B9N A;  1HW1 A;  4AID A;  3F0C A;  2K9N A;  4ZZD A;  5EGO B;  3OYB A;  1Q1V A;  1QQI A;  4A3F J;  4BNC A;  5DDG A;  4CUG A;  1K4T A;  5KVR A;  3GZ5 A;  3LSG A;  3HPG A;  1D0Y A;  3OV8 A;  1IDY A;  3JCU C;  1TWC J;  3BR2 A;  2L3D A;  1ZN2 A;  2ELH A;  1S29 A;  2M87 A;  3BTC A;  5K5O A;  3JRH A;  2ZJR F;  4UV8 A;  1DUX C;  1Q1H A;  2K86 A;  1Y56 A;  3DWL E;  5ICF A;  1MJA A;  2RGV A;  3ZQ7 A;  3WGI A;  1S9H A;  3RDI A;  5D5X B;  1OYW A;  1WJB A;  4HX7 A;  2NVQ J;  3S2D J;  4E7H A;  2DQL A;  3LQQ A;  2I5U A;  4ENN A;  2VXZ A;  4R79 A;  4RB3 C;  1O7F A;  1RKT A;  4AVZ A;  1FMV A;  4CYC A;  1FP2 A;  2MG4 A;  1JXS A;  1E0E A;  3TOA A;  4Y52 J;  4KN4 X;  3GO5 A;  3ABK H;  4HEA 2;  3PQJ A;  2E19 A;  3CUQ C;  3R4K A;  3HKZ N;  1X58 A;  3A0B C;  3K4L A;  2VOP A;  4I09 A;  1I6H J;  1XS9 A;  2LY1 A;  3RIR A;  4XBF A;  2EFO A;  3QAH A;  3BJA A;  2Y9Y A;  4MEX F;  4UNO A;  3R61 A;  2Z5U A;  3JSO A;  1S3J A;  1TWF J;  3E5X A;  5TJJ A;  1O7L A;  2R7O A;  4IHY A;  2XPV A;  2K3F A;  3CES A;  3G1L A;  2F5V A;  4UB8 C;  5L3C A;  4NUB A;  3FXQ A;  1U6G A;  2ETH A;  3PO2 J;  5E8I A;  4RB1 A;  5E3L A;  3AG3 H;  2L9R A;  1Z91 A;  2XF7 A;  1GHC A;  1K4S A;  3QU6 A;  4L5J A;  2F4I A;  3CZ6 A;  3CDH A;  3JRA A;  2IS2 A;  2R5Y A;  4XLH A;  1FSE A;  3VB2 A;  5CVI A;  3I9V 2;  4ZYA A;  1GXP A;  1IAW A;  2ISZ A;  1P92 A;  2JRT A;  2V6C A;  5DS9 A;  2DN0 A;  1BOB A;  1P7J A;  3L2V A;  1X3Z B;  3E6D A;  3FXM A;  3V42 A;  3M8F A;  3K7A J;  4OAY A;  3SJM A;  2JJ7 A;  1STZ A;  3KYD B;  5FKL A;  2W57 A;  2F4M B;  4XN0 A;  4EJO A;  2HI3 A;  3GME A;  3OOU A;  1QHH D;  3BT9 A;  3QOD A;  3OS0 A;  3HOU J;  3DBR B;  3J7Y J;  5D6F A;  3LSM A;  4BXF A;  4P55 A;  4BXU A;  3J81 K;  1FOK A;  2R92 J;  2VKD A;  2DOE A;  1FOY A;  3RPU D;  3SZG A;  1Y39 A;  3Q0U A;  4DYR A;  4BHP A;  1JT6 A;  1N75 A;  3H5N A;  1U8R A;  4RA2 A;  4U0Y A;  2FML A;  3CCQ I;  2G0E A;  1MIJ A;  4DBQ A;  1R9T J;  2XAH A;  3BZK A;  5FRM A;  1FIP A;  3M9A A;  3WTT C;  2ZNY A;  2DT5 A;  1WH5 A;  2RC4 A;  4IL6 C;  2QF7 A;  3O3K A;  1J59 A;  2DA2 A;  1T95 A;  1FSH A;  4F52 A;  5EG0 A;  4FE4 A;  3LOC A;  2VBZ A;  1VQN I;  2EIJ H;  1H0M A;  5J4Y A;  4FCY A;  1TWA J;  1Z1D A;  3G1O A;  5C3E J;  3IKT A;  2R7Q A;  5M3F J;  1RRJ A;  2R7Z J;  3FXJ A;  1K6Y A;  4RLQ A;  2CJJ A;  3DBL B;  1LPQ A;  5FGM A;  1YI2 I;  1NG7 A;  2E2J J;  2VQL A;  4RS8 A;  5K7F A;  1SFE A;  2GAU A;  4N4N B;  4BGD A;  4A3I J;  3OR2 C;  2COB A;  3JRB A;  5KK1 A;  3S93 A;  3BJ6 A;  2KRH A;  3CUO A;  4M3E A;  4PK4 A;  5DEQ A;  2GZW A;  3HIF A;  4B44 A;  2X48 A;  4BHB A;  5D4S A;  3EUH A;  2QQ9 A;  3FDY A;  3L00 A;  4RGU A;  3TO7 A;  1GLN A;  5J40 A;  4ZJZ A;  3ABL H;  5HLG A;  2ME0 A;  4XID A;  2CSO A;  2HGC A;  2Z1D A;  4OIO F;  4XMY A;  4JBA A;  4XLN F;  3JAM Z;  1SD7 A;  1DU0 A;  5GAH J;  2M3A A;  1U2W A;  3ZN1 A;  1KA8 A;  2FOW A;  2LC2 A;  3NEU A;  1D8K A;  1OKR A;  5JLW A;  3VOD A;  3OYG A;  5L3F A;  1ERD A;  1AU7 A;  5FRN A;  2R7D A;  2XPU A;  3AG4 H;  1QPI A;  1IZ1 A;  1R5G A;  2R7V A;  1FC3 A;  4LIT A;  5B66 C;  1JKO C;  3I56 I;  1S6L A;  1YJW I;  5E79 C;  5IY5 H;  3KZZ A;  1MSF C;  1EA3 A;  4CSW A;  5D8L B;  3J7Z I;  4RGR A;  4EQQ A;  2A3S A;  5L3B A;  1TT5 B;  2Y2Z A;  1G3Y A;  1R36 A;  2EQR A;  5BS6 A;  2O7O A;  3SEZ A;  2CQN A;  2GM4 A;  1U0J A;  4XLA A;  3LSP A;  4A0X A;  4XNF A;  1A36 A;  4AD9 A;  4CCL A;  5TGT A;  3A02 A;  4ZC3 A;  4W97 A;  3MKY B;  4KIG A;  3WG7 H;  2HDC A;  4PDK A;  3H92 A;  2EV5 A;  2VC0 A;  2E7X A;  3HL2 A;  1IC8 A;  3CJN A;  2XHK A;  2WV1 A;  1XGN A;  1PDN C;  4ENJ A;  4R1H A;  4Q4Z F;  1P4A A;  4I2O A;  2PFB A;  1ZAR A;  3QP5 A;  4P9U A;  4HX4 A;  1LKX A;  1T0F C;  2EZK A;  1UMQ A;  1S8N A;  5LRS A;  3FMS A;  4A12 A;  1ETK A;  3LWF A;  3LAJ A;  2PEX A;  3JRE A;  1MSE C;  3NRV A;  2VJ5 A;  4CH7 A;  2CRG A;  5C4J J;  4AYB N;  1W36 C;  4XK4 A;  1Z05 A;  1EJ9 A;  3A4C A;  3I58 A;  3C18 A;  4KN7 X;  3WG9 A;  3IRQ A;  4XLC A;  2QSG X;  3ABT A;  5FKN A;  2E71 A;  3G1M A;  2KDZ A;  3TED A;  1IN6 A;  3WHC A;  3V8K A;  3WHB A;  3WU2 C;  3ZN0 A;  2ISY A;  2IS1 A;  4G12 A;  3U1D A;  3FZV A;  1XCV A;  3A2K A;  3GTP J;  2K7L A;  2BHY A;  3GLL A;  1ONV A;  2HOS A;  2E2I J;  4CZZ A;  1YW7 A;  1YFH A;  4NDL A;  4GYI A;  1AA7 A;  4HQM A;  3TW7 A;  4O6J A;  5EDN A;  3KYL A;  2K5C A;  2XSD C;  4BJ5 C;  3I4M J;  1AKH A;  4A3G J;  2IVM A;  3TGN A;  4AM3 A;  2P0W A;  2CO5 A;  3IKV A;  4ESB A;  2OUM A;  4A3K J;  4LK1 F;  3CCY A;  3DKX A;  4BU2 A;  1BI0 A;  2LY2 A;  3E3V A;  2Y75 A;  2BVM A;  4IOA F;  4Y4R A;  1HSJ A;  1JKR C;  3ZMD A;  4EVI A;  1VQ9 I;  3AFH A;  4S04 A;  2E5N A;  2K9Q A;  2STT A;  1TTY A;  3KLO A;  3OYH A;  5FD5 A;  2HVQ A;  3CD6 I;  1WKM A;  2ZBK A;  4LGW A;  4EGY A;  1B6A A;  4P5O A;  4E7J A;  1VND A;  4CIC A;  2PBI A;  3BDD A;  4JX6 A;  1VQ8 I;  5K7Z A;  3VFZ A;  3FHZ A;  4FQG A;  1IXS B;  2KIF A;  1LB2 A;  5CVJ A;  3H9G A;  1ZR2 A;  3MD2 A;  1R71 A;  4V2F A;  1MNM C;  1W4M A;  2ZXI A;  2AQF A;  3GFM A;  4OIR F;  2K9M A;  2EV6 A;  5LHG A;  3G4S I;  1B8I B;  3GCM A;  3O6B B;  5K5Q A;  2A68 F;  4IQJ A;  2OCC H;  1FT9 A;  3MKL A;  3GTO J;  2R7S A;  2JMW A;  1VQO I;  1OYI A;  3TP0 A;  3A01 B;  2ECC A;  5IYD J;  2OA4 A;  5FKK A;  3BJO A;  4E6K G;  3V7R A;  1XX5 A;  3N97 A;  3WTU C;  3TL4 X;  1FYK A;  3CDL A;  3FXR A;  4PFO A;  5H20 A;  3U2R A;  1WVR A;  4AC0 A;  4A3L J;  3GFJ A;  2K3P A;  3IC7 A;  1IUY A;  1WCM J;  2VBY A;  5EYR A;  3IRR A;  3KLN A;  1WWX A;  2FA5 A;  1R49 A;  4KFC A;  4I76 A;  1ODD A;  2Y30 A;  4JP0 A;  1MH3 A;  2XB0 X;  4A3J J;  1LFB A;  1TQM A;  1VI0 A;  2HKX A;  2HXI A;  2A69 F;  3WU1 B;  3OYJ A;  2XPW A;  3K4M A;  2JVG A;  3QU3 A;  4ZYG A;  4KNY A;  2W85 A;  3QYF A;  2WV0 A;  4DNC A;  2X6O A;  3L2W A;  2BOL A;  3RZD J;  4ZTJ A;  2HZT A;  1BN5 A;  1RC9 A;  3CTA A;  3R0A A;  3RSN A;  1RUO A;  3HUG B;  5H6Q A;  5E1W A;  2XSJ C;  3HTS B;  4NQW A;  1YLF A;  1CF7 A;  1MMN A;  4HNT A;  3E5Q A;  2QVO A;  2OZ6 A;  2VBW A;  3CCS I;  2XGC A;  1WRJ A;  4KJZ A;  2H6C A;  5EEA A;  2P4W A;  2A07 F;  1I6X A;  2KT0 A;  2ELJ A;  1DQU A;  2F2E A;  4NC8 A;  2IA2 A;  1JUM A;  2QLZ A;  4HDU A;  3EUK L;  5L3E A;  4P9F A;  1YJ9 I;  2VOO A;  3KFW X;  1TWH J;  3OIO A;  4XLP F;  1PVE A;  2KIM A;  4G7O F;  1HDP A;  2M1B A;  3HSF A;  4DYC A;  4BY7 J;  2G7U A;  2NNN A;  1H9T A;  4KIS A;  2DOD A;  4IEJ A;  5BPD A;  1FYL A;  1YS7 A;  1Z7L A;  2EZI A;  2KJB A;  4BBR J;  2Q2E B;  3G3Z A;  3C7J A;  4M3B A;  9ANT A;  2OF7 A;  3IUO A;  4F92 B;  2P81 A;  3JRC A;  2W4S A;  1IO2 A;  2XF5 A;  2FE3 A;  4DZJ A;  1L0O C;  3SDB A;  4YEL A;  2IS4 A;  1VQK I;  3EUA A;  1O57 A;  3OS1 A;  3LA7 A;  3RQ4 A;  4XQF A;  2XIG A;  2GBY A;  4M73 A;  4LOC A;  4UV9 A;  1PP7 U;  1FY7 A;  2ZSI B;  5DCM A;  1SAN A;  3F8N A;  4RGS A;  1FTT A;  4HV5 A;  2HQ5 A;  1MGT A;  1R1T A;  1WJC A;  1QZY A;  2JPB A;  1IXR C;  2HOE A;  3DU6 A;  4GRI A;  4HYE A;  2WAQ N;  2YX7 A;  2E36 A;  3ZQL A;  2EH3 A;  4FIS A;  1BIB A;  2QZ8 A;  3SXY A;  3L7W A;  1RR8 C;  2HXO A;  4RAF A;  4KMF A;  4E4H A;  1POG A;  2DI3 A;  3W6K B;  4E7L A;  2Y48 A;  3HG9 A;  2HYG D;  2LTP A;  2QUF A;  1JUS A;  3J80 K;  2BEO A;  2IGN A;  2FD5 A;  1W0T A;  1U3E M;  3PO3 J;  2IS6 A;  1UEL B;  4CA0 A;  1R4M B;  2P5L C;  1IDZ A;  3KEQ A;  5F27 A;  1SD4 A;  2JSP A;  3T8R A;  1XTA A;  2EJR A;  3CDI A;  1MJB A;  1V5E A;  2PJR A;  3ECH A;  2HZD A;  2HOA A;  4DQ2 A;  5IYC J;  3F21 A;  5KHD A;  2DYR H;  1YX3 A;  4X0G A;  3TP3 A;  2COM A;  2KKO A;  5E3O A;  2ZNZ A;  2QCO A;  4U0W A;  1QO0 D;  3S8P A;  2BE5 F;  3ML6 A;  4IZZ A;  2V1U A;  5DUI A;  3QOP A;  4OAZ A;  3ROU A;  2DA5 A;  1TLH B;  2FF4 A;  2GWR A;  4BE0 A;  4XIC A;  1FIA A;  3KET A;  3ABU A;  4S05 A;  4MIM A;  5F0F A;  5B1B H;  5ILS A;  3M8J A;  3IHU A;  4AUX A;  3S17 J;  3RYP A;  5E20 A;  3HOV J;  1BBY A;  1TW2 A;  1PUF B;  3DF8 A;  2VE8 A;  1F5T A;  5ERI A;  5HS9 A;  2IJL A;  4RAY A;  3C2H A;  1FBU A;  1WHU A;  1X1C A;  4M3D A;  1KON A;  1MZB A;  1HW2 A;  4AYB A; 
#chains in the Genus database with same CATH homology
 2ZME B;  5ILV A;  2DK8 A;  5IT9 K;  4BQA A;  4LMY A;  4M71 A;  2Z33 A;  1K7A A;  5CYV A;  2ZFW A;  2XRO A;  2XAG A;  3I54 A;  4OIP F;  2PLY A;  1TQP A;  3GFL A;  2MH9 A;  1XMA A;  4I7H A;  4L9V A;  5FB2 A;  3I0T A;  1SAX A;  3OOP A;  5LEK A;  4GXO A;  1XSD A;  3BRO A;  1YS6 A;  5J8F A;  2VOD A;  1YW8 A;  3GW2 A;  3K2Z A;  3SHF A;  4FX0 A;  1IN8 A;  1ZYR F;  1ZGJ A;  4EM1 A;  2P6S A;  1D3Y A;  3K69 A;  1LQ1 A;  4A6E A;  1Z6R A;  5HS7 A;  1T98 A;  1PP8 F;  2Y0M A;  3WTV C;  1YQA A;  4TV7 A;  1E2X A;  1U5T A;  2H27 A;  2FNA A;  3IWF A;  2XV4 S;  5BPI A;  5LRR A;  1USS A;  4A6D A;  2EK5 A;  3AAF A;  1UFM A;  3FWE A;  1FWZ A;  1KU9 A;  4PZJ A;  3T1B A;  4L9T A;  2P5K A;  5FFZ A;  5JI6 A;  4HF1 A;  4HLY A;  1YIO A;  4MTE A;  4N9H A;  1AOY A;  3RYR A;  1EH6 A;  1K78 A;  1J75 A;  4OMZ A;  2BGC A;  2DAO A;  2OQR A;  1QZZ A;  4JK1 X;  1J7K A;  3F6O A;  1HW5 A;  1JGS A;  2L4A A;  3S2W A;  1W7P A;  4HA8 A;  4UVB A;  3GYH X;  2HWV A;  5BOX A;  2HQR A;  2IA0 A;  2KJC A;  2NAZ A;  3ZMZ A;  1ZRD A;  3HYI A;  4KIF A;  1SMY F;  4I02 A;  4CDG A;  2DQR A;  3B02 A;  4ESJ A;  1YO5 C;  2Q0O A;  4WXH A;  2HKO A;  1RUN A;  1T6S A;  2PG4 A;  2A6H F;  2JPC A;  1RI7 A;  2QQB A;  1NHA A;  2ZXJ A;  4HDV A;  4RB2 C;  1LVA A;  4EMS A;  2A6E F;  2DW4 A;  1ZG3 A;  5ICG A;  1J9I A;  2V1X A;  1ZLK A;  2QQA A;  4BYY A;  2FBK A;  4R8H A;  3CUQ B;  3TKY A;  4M74 A;  4M6X A;  3KP7 A;  2E7W A;  4IPA A;  1B59 A;  2M45 A;  4HV6 A;  3O2P E;  1JHF A;  1ULY A;  5AON A;  1K79 A;  2O0Y A;  5AIP A;  5LGT A;  3FM3 A;  3RPQ A;  5FFX A;  2K4B A;  2YSR A;  2Q8K A;  1RIO H;  1KQ9 A;  3BZ6 A;  4WXD A;  4KMU X;  2GA1 A;  2IT0 A;  3P9I A;  3JAM K;  2M30 A;  2FSW A;  3L09 A;  2V1D A;  4U0V A;  2XGX A;  3I53 A;  3GUD A;  4M72 A;  3T8T A;  4EJU A;  3BWG A;  3E6C C;  1FLI A;  1R22 A;  3MEX A;  3K1N A;  1IN7 A;  2CWE A;  2G9W A;  2MC3 A;  1V4R A;  4G9Y A;  4HW0 A;  2A61 A;  5HDN A;  1R00 A;  3J81 Z;  3WTZ A;  1O3R A;  2W25 A;  2YX4 A;  2W84 A;  3H3U A;  1Z9C A;  3WU0 A;  3V7S A;  1RZ4 A;  2ESN A;  4LJZ F;  5F6F A;  5LBQ A;  2VT3 A;  2STW A;  3HRU A;  1ZRE A;  4NHJ A;  5E1X A;  1ZH5 A;  3RTR A;  1XMK A;  1XGM A;  2ADU A;  3F72 A;  3ZMU A;  4Y15 A;  5K1Y A;  1B1B A;  5ICC A;  3P9K A;  5IT3 A;  4IJA A;  2ZKZ A;  3L2C A;  4QWQ A;  1FNN A;  3GXO A;  4FX4 A;  4HZF A;  1PUE E;  2CFX A;  3L9F A;  3V8L A;  5LHH A;  1JE8 A;  1P2F A;  3W6J B;  4N9I A;  3VOE A;  1FYM A;  3ERE D;  1EV7 A;  3D0S A;  3LST A;  3RKX A;  3F8F A;  4A0Z A;  4WWC A;  2P7V B;  5FLX K;  3BP8 A;  2GA2 A;  2WC2 A;  3T0Y A;  3K1P A;  2CGP A;  1I1G A;  1ZRF A;  1REP C;  2RQP A;  4GO1 A;  3EDP A;  2OD5 A;  4IF4 A;  4IRH A;  2GXB A;  4HF2 A;  1AWC A;  2OBP A;  3V7C A;  1E17 A;  2DLL A;  3U9G A;  4EJT A;  3QP6 A;  5EEG A;  1L3L A;  1GVJ A;  3HSE A;  4ZYE A;  1UB9 A;  2PMH A;  4CO8 A;  1BOA A;  3KP4 A;  3J7A O;  1QBJ A;  1XDS A;  4HAM A;  3G73 A;  1YW9 A;  3WTS C;  2ZO4 A;  1G6N A;  2LKP A;  4U7B A;  2DBB A;  3P9C A;  1W7P D;  3MCZ A;  2MH2 A;  3WE3 A;  3TO9 A;  5D4R A;  4I0B A;  1FBS A;  5L3G A;  1OR7 A;  3CLO A;  3MWM A;  3GZ6 A;  4UUV A;  2EFN A;  1QGP A;  1XN7 A;  4LLN A;  2R7F A;  3HOT A;  4IRI A;  2RDP A;  4IVN A;  3QPH A;  2J5P A;  2MLG A;  3COA C;  1KYW A;  1H9G A;  3ZMT A;  2DO7 A;  3WE2 A;  4HF0 A;  3FF5 A;  4XSX F;  5D6E A;  1V3F A;  5HLI A;  1DPR A;  2L01 A;  3GF2 A;  4YFN F;  1RNL A;  2A5Y B;  2XVC A;  1YTY A;  1LEB A;  1IW7 F;  2P5V A;  1ZG5 A;  4ZZL A;  2IRF G;  2PN6 A;  2ACJ A;  3TDZ C;  1T2K A;  3H3Z A;  1S7A A;  1LDK B;  3EYY A;  4LFU A;  5FO5 A;  3ULQ B;  2ESH A;  3TQN A;  5D8K B;  1TBX A;  1R23 A;  3B73 A;  4BH9 A;  5DD4 A;  4PCQ A;  2XKP A;  4ZYD A;  3FMQ A;  3HUG A;  4L0Y B;  4M6Y A;  2D2W A;  1R1V A;  4AIK A;  2RN7 A;  2OU2 A;  1J2X A;  1J5Y A;  1BI2 A;  1KQ0 A;  1IN5 A;  4WXC A;  2GXG A;  2HFH A;  4AVP A;  4E70 A;  3R60 A;  5ICE A;  2IW5 A;  1MDM A;  1F1Z A;  4CXF A;  2ZCW A;  4KIC A;  2UZK A;  2E1C A;  4PGG A;  2X0L A;  4Y17 A;  4MEY F;  3QPT A;  5JR3 A;  1FPQ A;  3REO A;  4Q47 A;  3IWZ A;  2F5F A;  1HQC A;  1XD7 A;  2PI0 A;  3I59 B;  2P6T A;  4GCV A;  4A0Y A;  3DP7 A;  4MNU A;  1LDJ A;  4A2U A;  1IRG A;  2DPD A;  2DU9 A;  3RPU A;  1XB4 A;  2RKH A;  2QYO A;  2LSO A;  4WK8 F;  2EFP A;  2BYV E;  5F64 A;  4WF2 A;  2EA2 A;  1QPM A;  2XAS A;  5DCF A;  2DFI A;  5E18 F;  3DPL C;  4YIF A;  1BIA A;  1SMT A;  2JZY A;  3WTW C;  3BOQ A;  1WI9 A;  4FT8 A;  3Q9S A;  2XAQ A;  4XSZ F;  1HST A;  2VC1 A;  1F4K A;  2EA4 A;  2KRF A;  1S7O A;  1OMI A;  5BMZ A;  1EH7 A;  2UWM A;  2EV0 A;  1ON2 A;  3PQK A;  3LFK A;  3V8J A;  3J80 Z;  2FMY A;  1O3T A;  4L5I A;  1XCB A;  5HOO A;  1U5T C;  2QWW A;  5EEH A;  4YII A;  1P4W A;  3GFI A;  2RNJ A;  5J8C A;  6PAX A;  1G4D A;  5HVQ C;  5HS8 A;  4HX8 A;  5A2Q K;  4LG0 A;  2LDU A;  2ZME A;  4B8X A;  1D5V A;  4CHU A;  2RV8 A;  3ELK A;  2EFW A;  2KIU A;  2FOK A;  2OZU A;  1YYV A;  2AS5 F;  2R3S A;  3KP2 A;  3JSP A;  1B9M A;  4CYD A;  2M8E A;  3C1D A;  3DFG A;  5F1R A;  2L54 A;  4L9J A;  3MZY A;  1QNT A;  2JTV A;  1ZLJ A;  2AXL A;  3HHG A;  3GX4 X;  2CQK A;  2QBY B;  3M7G A;  4A5N A;  5IT9 Z;  1WSU A;  5LHI A;  5H6R A;  4N0B A;  2D45 A;  1U5T B;  3WTY C;  4G94 A;  4UXN A;  4LLL A;  5JHU A;  4EM2 A;  1WQ2 A;  1W5S A;  1TNS A;  4I01 A;  4UVC A;  4MGR A;  3KE2 A;  4Q48 A;  2K4J A;  4OOI A;  1Z6T A;  2HTJ A;  2IPQ X;  4UHT A;  1I1S A;  1HBX G;  1UHW A;  1UST A;  2O3F A;  4HQE A;  4IXA A;  1T39 A;  3SZP A;  2V9V A;  2XRN A;  3ZMS A;  4KIB A;  2IP2 A;  4ZH4 F;  1K78 B;  1DP7 P;  4L0Z B;  1G3W A;  4QLC U;  1BC7 C;  3TO6 A;  2F5C A;  2GIV A;  2H6B A;  4KUM A;  2EFQ A;  4AWX B;  1W7P B;  3WGG A;  1OPC A;  3ZPL A;  4F7Z A;  4OU0 A;  2MBF A;  4G8X A;  4M9X A;  4OIN F;  3RJP A;  2QEN A;  4G7Z F;  1R7J A;  2EB7 A;  1XGS A;  3M1E A;  4M9Z A;  1XGO A;  4HBL A;  4U7D A;  1F9N A;  5TRD A;  1SD6 A;  2K02 A;  3GLX A;  2P8T A;  2J5O A;  3HRM A;  1LNW A;  2O61 A;  3I71 A;  5CLS A;  5HDG A;  2F5D A;  3K1M A;  2TDX A;  5CVV A;  4IHS A;  1YG2 A;  3Q9V A;  2MD5 A;  3JTG A;  3EET A;  1JHH A;  3DV8 A;  4RAZ A;  4UVA A;  2OQG A;  3M8E A;  2C6Y A;  4GGG A;  3BPX A;  3V4G A;  1MKM A;  3JW4 A;  4I98 B;  3CUQ A;  2D1H A;  1HKT A;  2O8X A;  3DKW A;  3E6M A;  3TDU C;  1BI3 A;  1SFU A;  1KU2 A;  1K6O A;  1I5Z A;  2BV6 A;  3FM5 A;  3HRS A;  3KEO A;  5FD6 A;  2HR3 A;  4D0P A;  2NS0 A;  4M9S A;  2HQN A;  4EV0 A;  3F8B A;  5D5V B;  4L9N A;  3LQR A;  3CO6 C;  2VE9 A;  2NYX A;  1HXD A;  3HRT A;  1HKQ A;  5CVU A;  2HTS A;  2Z3Y A;  2XAF A;  3HOS A;  4B09 A;  4YFX F;  2WTE A;  4G6D A;  1R5H A;  3KP5 A;  1FP1 D;  3ZP5 A;  2F5E A;  3LAP A;  4LD5 A;  3BPV A;  5E17 F;  3DQV C;  2NNY A;  4ON0 A;  1O3S A;  2H09 A;  1D8J A;  5DV5 A;  4YFK F;  2PJP A;  3KP6 A;  2YU3 A;  3MFK A;  4NB5 A;  3RKW A;  1X3U A;  2EWN A;  1B4A A;  2O03 A;  3C3W A;  5E8G A;  2BBY A;  2Z99 A;  4WCG A;  3DPT A;  4LB5 A;  3D5L A;  4G6Q A;  1FX7 A;  2X4H A;  2LF7 A;  1W5T A;  3KCC A;  4ZYH A;  4MQV A;  4IHT A;  5D5W B;  3K0L A;  1LEA A;  3LA3 A;  2FU4 A;  4EJW A;  2GQQ A;  1TQI A;  1U78 A;  1R1U A;  1FBQ A;  5JVT A;  3JTH A;  5HLH A;  1KU7 A;  2YR2 A;  1ON1 A;  3RI4 A;  5LGN A;  2DPU A;  1ZRC A;  3I4P A;  3F6V A;  1O3Q A;  2FEZ A;  4IRG A;  1Y0U A;  2G7H A;  5HDK A;  1IN4 A;  2WWY A;  3VEP A;  4XRF A;  5FLX Z;  3SQN A;  1XDU A;  1T0F A;  2XUB A;  1XSV A;  4H0E A;  3GVA A;  3ISP A;  3WTX C;  3KZY A;  4ENM A;  2FBI A;  2L02 A;  1A04 A;  5CVR A;  2CYY A;  3F8M A;  2P7C B;  4EGZ A;  4AIH A;  2O6G E;  1FZP B;  3NQO A;  5LEJ A;  2VT2 A;  1ZHF A;  1P4X A;  2FRH A;  3E97 A;  2JT1 A;  3I5U A;  3ZMV A;  5JFR A;  3GEZ A;  4ESF A;  3R0J A;  2M5W A;  1C0W A;  1UHM A;  2HYF A;  3F8C A;  3RKY A;  3I64 A;  3LA2 A;  5ED4 A;  4O5V A;  1CF7 B;  1HKS A;  3N4M A;  2MA3 A;  1XSX A;  4P96 A;  3TOB A;  3K9T A;  1KQ8 A;  4OIQ F;  2K27 A;  2DTR A;  4Z2Y A;  5DYM A;  2CW0 F;  4LB6 B;  2UXN A;  1TNT A;  3F3X A;  4BHC A;  1GXQ A;  2OAZ A;  4ASN A;  1DDN A;  2HEO A;  1DPU A;  4Q5S F;  4ETS A;  2QM3 A;  3CO7 C;  5J6X A;  3F23 A;  1KYZ A;  1ZAO A;  2Z9O A;  1MDM B;  4Y13 A;  2D1V A;  4EM0 B;  3SZT A;  1P6R A;  5DCM B;  3EQL F;  3DXJ F;  4AIJ A;  4GYG A;  3E5U A;  4RGX A;  3FX3 A;  3R6S A;  1IXC A;  4MTD A;  2H94 A;  2Q2E A;  2XAJ A;  4EJV A;  5E1Z B;  1G3T A;  4U88 A;  3ECO A;  1IRF A;  2IA1 A;  4HLX A;  4ENK A;  4WX9 A;  3SFZ A;  4KDP A;  1MD0 A;  3MQ0 A;  1ZG1 A;  3I59 A;  1J0R A;  2DK5 A;  3HSR A;  3HTU A;  2HS5 A;  1CGP A;  3Q5F A;  4PGH A;  1LDD A;  1IF1 A;  3MZH A;  4FHT A;  3QRF F;  4YG2 F;  3GWZ A;  2NRA C;  4OMY A;  2FQ3 A;  2LF8 A;  1BI1 A;  2V79 A;  2W24 A;  5LLQ A;  3WOD F;  2UXX A;  1SD5 A;  5K5R A;  1MJ9 A;  2PMU A;  3F22 A;  1OYY A;  4LG0 B;  4G7H F;  1G3S A;  2FXA A;  3T5X A;  2CG4 A;  2FBH A;  5DUK A;  5L3D A;  3IL2 A;  2B0L A;  4MQ9 F;  2FNP A;  3PFI A;  1T38 A;  1Z7U A;  5LGU A;  2VBX A;  2VON A;  1I27 A;  5CJ9 A;  4L18 B;  1BM9 A;  5D5U B;  4KT5 C;  3EYI A;  3DEU A;  4O3M A;  5AIQ A;  1VTN C;  1BJA A;  4CGZ A;  4MHG A;  1SFX A;  5ILU A;  4KYW A;  1LJ9 A;  1KGS A;  1BC8 C;  1KU3 A;  2RVC A;  2VN2 A;  3FMR A;  2XKO A;  2LNB A;  4HOB A;  4LLG F;  1R58 A;  4LK0 F;  5BQT A;  5DD8 A;  2JSC A;  2MLK A;  5A2Q Z;  3FXU A;  4KA4 A;  4RB0 A;  4BAY A;  2L4M A;  2QBY A;  4A5M A;  2PQ8 A;  3P7N A;  1TW3 A;  3WGH A;  2ZJ2 A;  4I0A A;  3E6B A;  3BY6 A;  4K2E A;  1ZGA A;  3HHH A;  1EH8 A;  4JQF A;  2YPR A;  3KP3 A;  3MAJ A;  1UCR A;  2E1N A;  1B9N A;  1HW1 A;  4ZZD A;  1QQI A;  4BNC A;  5DDG A;  5KVR A;  3GZ5 A;  3OV8 A;  2L3D A;  1ZN2 A;  2ELH A;  1S29 A;  2M87 A;  5K5O A;  1DUX C;  4UV8 A;  1Q1H A;  2K86 A;  5ICF A;  1MJA A;  2RGV A;  3ZQ7 A;  3WGI A;  3RDI A;  5D5X B;  1OYW A;  4HX7 A;  2DQL A;  3LQQ A;  4ENN A;  2VXZ A;  4R79 A;  4RB3 C;  1O7F A;  1FP2 A;  1JXS A;  3TOA A;  4KN4 X;  3GO5 A;  3PQJ A;  3CUQ C;  3R4K A;  2VOP A;  4I09 A;  3RIR A;  4XBF A;  2EFO A;  3QAH A;  3BJA A;  4MEX F;  4UNO A;  3R61 A;  2Z5U A;  3JSO A;  1S3J A;  3E5X A;  5TJJ A;  1O7L A;  5L3C A;  3FXQ A;  1U6G A;  2ETH A;  5E8I A;  4RB1 A;  1Z91 A;  1GHC A;  3QU6 A;  4L5J A;  3CDH A;  1FSE A;  3VB2 A;  5CVI A;  1GXP A;  1IAW A;  2ISZ A;  1P92 A;  2JRT A;  2V6C A;  3E6D A;  3M8F A;  1STZ A;  2W57 A;  4EJO A;  5D6F A;  4P55 A;  4BXU A;  3J81 K;  1FOK A;  4BHP A;  1U8R A;  4U0Y A;  2FML A;  2XAH A;  3M9A A;  3WTT C;  2ZNY A;  2DT5 A;  2RC4 A;  3O3K A;  1J59 A;  1FSH A;  2VBZ A;  1H0M A;  1Z1D A;  3IKT A;  5FGM A;  4RS8 A;  1SFE A;  2GAU A;  5KK1 A;  3BJ6 A;  3CUO A;  5DEQ A;  2GZW A;  3HIF A;  4BHB A;  5D4S A;  3EUH A;  2QQ9 A;  3L00 A;  4RGU A;  3TO7 A;  5HLG A;  2CSO A;  2HGC A;  4OIO F;  4JBA A;  4XLN F;  3JAM Z;  1SD7 A;  1U2W A;  3ZN1 A;  1KA8 A;  3NEU A;  1D8K A;  1OKR A;  3VOD A;  5L3F A;  2R7D A;  1IZ1 A;  1R5G A;  1FC3 A;  1S6L A;  3KZZ A;  5D8L B;  4RGR A;  4EQQ A;  2A3S A;  5L3B A;  1G3Y A;  1R36 A;  5BS6 A;  4A0X A;  4AD9 A;  4KIG A;  2HDC A;  4PDK A;  3H92 A;  2EV5 A;  2VC0 A;  2E7X A;  3CJN A;  2XHK A;  1XGN A;  1PDN C;  4ENJ A;  4R1H A;  4Q4Z F;  1P4A A;  4I2O A;  2PFB A;  1ZAR A;  3QP5 A;  4P9U A;  4HX4 A;  1S8N A;  5LRS A;  3FMS A;  4A12 A;  3LWF A;  3LAJ A;  2PEX A;  3NRV A;  1Z05 A;  3I58 A;  3C18 A;  4KN7 X;  3WG9 A;  3IRQ A;  3ABT A;  1IN6 A;  3V8K A;  3ZN0 A;  2ISY A;  3U1D A;  3FZV A;  1XCV A;  2K7L A;  1ONV A;  4CZZ A;  1YW7 A;  1YFH A;  4GYI A;  4HQM A;  4O6J A;  2IVM A;  3TGN A;  2CO5 A;  3IKV A;  4ESB A;  4LK1 F;  1BI0 A;  3E3V A;  2Y75 A;  1HSJ A;  3ZMD A;  4EVI A;  4S04 A;  2STT A;  1TTY A;  3KLO A;  5FD5 A;  1WKM A;  2ZBK A;  4LGW A;  4EGY A;  1B6A A;  4P5O A;  4CIC A;  2PBI A;  3BDD A;  3VFZ A;  3FHZ A;  1IXS B;  2KIF A;  1LB2 A;  5CVJ A;  1W4M A;  4OIR F;  3GFM A;  5LHG A;  2EV6 A;  3O6B B;  5K5Q A;  2A68 F;  1FT9 A;  1OYI A;  2OA4 A;  3BJO A;  3V7R A;  3N97 A;  3WTU C;  1FYK A;  3FXR A;  5H20 A;  3U2R A;  3GFJ A;  3IC7 A;  1IUY A;  2VBY A;  3IRR A;  3KLN A;  1WWX A;  2FA5 A;  4KFC A;  1ODD A;  1TQM A;  2HKX A;  3WU1 B;  2A69 F;  3QU3 A;  4ZYG A;  4KNY A;  2W85 A;  2WV0 A;  4DNC A;  2HZT A;  1BN5 A;  3CTA A;  3R0A A;  1RUO A;  5H6Q A;  5E1W A;  3HTS B;  4NQW A;  1YLF A;  1CF7 A;  3E5Q A;  2QVO A;  2OZ6 A;  2VBW A;  1WRJ A;  2H6C A;  2P4W A;  2A07 F;  1I6X A;  2F2E A;  2IA2 A;  2QLZ A;  4HDU A;  5L3E A;  4P9F A;  2VOO A;  3KFW X;  4XLP F;  2KIM A;  4G7O F;  2M1B A;  3HSF A;  2G7U A;  2NNN A;  1H9T A;  5BPD A;  1FYL A;  1YS7 A;  2KJB A;  3G3Z A;  3C7J A;  2FE3 A;  1L0O C;  1O57 A;  3LA7 A;  2XIG A;  4M73 A;  4UV9 A;  1PP7 U;  1FY7 A;  5DCM A;  3F8N A;  4RGS A;  4HV5 A;  1MGT A;  1R1T A;  1QZY A;  2JPB A;  1IXR C;  2HOE A;  4HYE A;  2YX7 A;  3SXY A;  1BIB A;  2QZ8 A;  3L7W A;  4KMF A;  2DI3 A;  3W6K B;  2Y48 A;  2HYG D;  2QUF A;  3J80 K;  2BEO A;  1U3E M;  2P5L C;  3KEQ A;  1SD4 A;  3T8R A;  2EJR A;  1MJB A;  3ECH A;  4DQ2 A;  3F21 A;  2COM A;  2KKO A;  2ZNZ A;  4U0W A;  1QO0 D;  2BE5 F;  3ML6 A;  2V1U A;  5DUI A;  3QOP A;  3ROU A;  1TLH B;  2FF4 A;  2GWR A;  3KET A;  3ABU A;  4S05 A;  5ILS A;  3IHU A;  3RYP A;  5E20 A;  1BBY A;  1TW2 A;  3DF8 A;  2VE8 A;  1F5T A;  5ERI A;  5HS9 A;  2IJL A;  4RAY A;  1FBU A;  1MZB A;  1HW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...