4AWXB

Moonlighting functions of feoc in the regulation of ferrous iron transport in feo
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
63
Chain Sequence
PLGSMASLMEVRDMLALQGRMEAKQLSARLQTPQPLIDAMLERMEAMGKVVRISEQEWWALRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERROUS IRON TRANSPORT PROTEIN B
publication title Crystal Structure of the Klebsiella Pneumoniae Nfeob/Feoc Complex and Roles of Feoc in Regulation of Fe2+ Transport by the Bacterial Feo System.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Metal transport
total genus 17
structure length 63
sequence length 84
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09012 FeoC FeoC like transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4awxB00
5LBQA 4EGYA 2V79A 3D0SA 5ICCA 1O3SA 3ZMDA 2XAFA 1MZBA 3IWFA 1BI2A 2DQRA 4IXAA 4AWXB 4LG0B 1FYLA 2K27A 1FT9A 4I01A 3GW2A 1PDNC 3BWGA 2UXNA 1ON2A 2EFOA 5D5WB 4FHTA 3KP4A 2OZUA 4U0YA 2LSOA 1E17A 3B02A 3TO9A 2MD5A 3REOA 1ODDA 3WU1B 1P4WA 2W25A 3JAMK 1FBUA 2HOEA 2KJCA 4ESFA 3VB2A 1SFUA 3KP3A 5D6FA 4Q47A 4LD5A 2HDCA 1Z9CA 4EM0B 4BH9A 4CGZA 1S3JA 2UXXA 2V6CA 1OKRA 1S6LA 4WF2A 3ABTA 2V9VA 3MFKA 5CVVA 4IHSA 1I6XA 2CFXA 3NRVA 3HYIA 2ZMEB 3SHFA 1T6SA 4XSXF 4UVBA 1XB4A 2VODA 2PFBA 2FSWA 3RPUA 2Y75A 2NS0A 2AXLA 2M1BA 4N9HA 1R1UA 5HS9A 4LB6B 4LK1F 2DO7A 2M5WA 1CF7B 4LJZF 3KZYA 4YFNF 2GQQA 4FX4A 3IWZA 3E5UA 3BDDA 2H6CA 3VFZA 1MKMA 4HBLA 1C0WA 3RKWA 3E6CC 2FOKA 2ZKZA 4JK1X 1K78A 1IAWA 3WG9A 4HLYA 4Q5SF 2R7FA 3JAMZ 3H3ZA 3BPXA 2LDUA 2EV5A 4RGRA 1MDMB 3GUDA 1XDUA 5DYMA 4UV8A 3QPHA 1O3TA 3B73A 5K5QA 4R1HA 2P6SA 2IA1A 2LF8A 4BHPA 4G7OF 3ML6A 4HV6A 5K5OA 3DEUA 4WXHA 3HTUA 4G6QA 5DEQA 3K0LA 1SMTA 4MEYF 4ZYHA 3GVAA 4G6DA 2NRAC 2QBYB 1BBYA 1EH8A 4QWQA 4M72A 4F7ZA 1R58A 1ZG3A 4L0ZB 4AIHA 3F23A 2HYGD 2P6TA 3MWMA 3HSRA 2DTRA 3Q9SA 4RGUA 2XUBA 2J5OA 5K5RA 3GEZA 2KIUA 2RV8A 5LHGA 3JSPA 2IJLA 3MZYA 2H6BA 2VC1A 2UZKA 3F21A 1R7JA 4GGGA 5JVTA 1JXSA 3KEOA 1HW5A 4EJWA 1YW7A 2W84A 1T0FA 5AIPA 4I0BA 3J81K 5E18F 3T8RA 3FWEA 1VTNC 5L3CA 4HX8A 2XRNA 3I58A 4U0WA 2HTJA 2ZFWA 2FNAA 3DP7A 3M1EA 2DBBA 5LHIA 4WK8F 1ZLKA 2PJPA 1IXRC 4ENNA 2DI3A 2QENA 5ERIA 3V8KA 1O3RA 3HUGA 2A6HF 4HW0A 1EH7A 2IA0A 2HZTA 1YTYA 3FMRA 2EA4A 3Q9VA 4OIRF 4I09A 1IZ1A 1LB2A 4XSZF 3DPTA 1FZPB 2DT5A 2RVCA 2F5EA 1MGTA 2F2EA 3L9FA 2QM3A 2D2WA 1XMAA 4OIQF 1IW7F 2H94A 3K2ZA 1I1GA 3F72A 5CVRA 2O03A 4NHJA 4EMSA 1GXQA 4P9FA 2M45A 1JHFA 5IT9K 5DD4A 1KU3A 2YR2A 1LDDA 4Q4ZF 3O2PE 3BOQA 3EUHA 2H27A 3E5QA 4AVPA 1AOYA 2IW5A 4EJVA 5E1ZB 2G9WA 5E17F 3WTVC 1BJAA 3HSFA 2W85A 2WC2A 2K4JA 3KCCA 3V7CA 2YX4A 2FMYA 4S05A 5K1YA 2A3SA 4KFCA 4OMZA 4MQ9F 3ZP5A 2AS5F 3KP2A 1LDJA 1BN5A 4U88A 1REPC 4LG0A 3WGHA 4ZYDA 1O57A 1G3WA 3FXUA 4IRGA 4HLXA 3F8BA 3RI4A 3SXYA 5IT3A 2L4MA 3Q5FA 1J59A 3ZPLA 1OMIA 4GO1A 1J0RA 4WXDA 2STWA 5DDGA 1IN8A 1SD5A 3LA2A 4UUVA 2VBWA 4KIGA 4A0XA 4L0YB 3F8FA 4ENJA 3GLXA 1FOKA 2MLGA 3F22A 2P7VB 4A12A 5HLIA 1TBXA 5BMZA 5CLSA 4P55A 4M9SA 2BV6A 2NNYA 1RUNA 3FM3A 3F8NA 4IJAA 4L5IA 1DPRA 2ZMEA 1LNWA 3WTTC 4P96A 4A5NA 1IUYA 5LLQA 1QZZA 4ETSA 2QZ8A 1TTYA 2OU2A 1FLIA 2OQGA 1B9MA 1FC3A 3WTSC 5D5VB 4MTEA 1FY7A 3ECOA 1KQ0A 1XCBA 3M8FA 4ENMA 1OYYA 2P4WA 2J5PA 1IN4A 2MLKA 2TDXA 1CF7A 4RGSA 2O6GE 1R1VA 3RIRA 2FBKA 2GIVA 2V1UA 3KETA 5BOXA 3ZMZA 3WU0A 2FRHA 3R4KA 1B6AA 3HOSA 2BE5F 3GO5A 4M73A 2EV6A 3HHGA 4XLPF 2FU4A 2VBZA 1IXCA 4TV7A 1ZG1A 4HV5A 3WE2A 1MJ9A 5LGTA 2ACJA 1MDMA 4RB1A 5EEHA 2FMLA 3RYRA 1YS6A 4ZYEA 3LQQA 2Y48A 3GXOA 3F8MA 5HS7A 3J80K 1IF1A 2FNPA 3V7SA 5F6FA 1S7OA 5ILVA 5CVJA 1IN6A 3WTYC 4IVNA 2GXBA 2IT0A 2MH2A 1ZN2A 2CYYA 5DCFA 3ZMTA 4M6YA 3MCZA 1FP1D 5HS8A 2L54A 3ROUA 4UVAA 4KIFA 2QBYA 2ZJ2A 3KP6A 5LGUA 1FPQA 3R0AA 5AIQA 1DDNA 3ISPA 4IRIA 3VOEA 2M8EA 5JI6A 2VOPA 3BPVA 4LMYA 1P6RA 1FYKA 5D4SA 3LAJA 3EYIA 4A5MA 1Z6RA 3ERED 5DUIA 4Q48A 3K1PA 2C6YA 5F64A 2QQ9A 2E1NA 2CQKA 2Z5UA 4MGRA 1TQMA 3RPQA 5HDNA 1FSHA 2D1VA 2EK5A 3E97A 4AD9A 2DW4A 2STTA 1A04A 4MEXF 5JHUA 2VN2A 5FB2A 2VE8A 1W7PB 5HOOA 2K7LA 4M71A 1FX7A 1KQ9A 2O8XA 1D3YA 3M9AA 1HSJA 3DXJF 3IRQA 3F6OA 1U8RA 3SQNA 2HR3A 2PBIA 4O5VA 3OV8A 5ICGA 2W57A 4R79A 4YG2F 3WTXC 2HYFA 1RIOH 2BBYA 3RJPA 1IN5A 2OZ6A 3ULQB 4GYGA 3L7WA 3T8TA 1ZAOA 2ESHA 3H92A 2XKPA 5DV5A 4N0BA 4ESBA 1JHHA 2RGVA 1P4AA 1YYVA 3KLOA 1B4AA 2KIFA 3ZMUA 2DLLA 4RB0A 4KUMA 1RI7A 2JPBA 1BOAA 3DV8A 4KIBA 1XD7A 2L01A 1YG2A 3TQNA 3HRSA 2WV0A 4P9UA 1TNSA 2HFHA 4YIFA 2QQBA 2VBYA 4WCGA 1KU2A 3E6DA 3GFJA 5J8CA 2ZNYA 2K02A 3GFLA 1G4DA 4KN7X 2HS5A 3WODF 3GFIA 3TDUC 1IN7A 3F8CA 3OOPA 3FM5A 3CJNA 2HEOA 1KGSA 1DUXC 1XCVA 3G3ZA 3I5UA 2F5CA 1WSUA 4O3MA 3GF2A 5HLGA 3FZVA 5E8GA 1YFHA 3E6BA 4HX7A 2PEXA 4L5JA 4L18B 4MQVA 2RNJA 4IPAA 2ESNA 1TQPA 2P5VA 1J7KA 3EQLF 3LA3A 1G3TA 2FE3A 4I7HA 3JTHA 1QGPA 1IRGA 4BAYA 4Y13A 1K7AA 4JQFA 4HF2A 1MD0A 4MNUA 1S7AA 4G9YA 3BJAA 5CVUA 5JFRA 4A0ZA 1I5ZA 2OQRA 1BC8C 2ZNZA 2X4HA 4PGHA 2VC0A 3DQVC 3V8LA 1YS7A 3E6MA 1YW8A 4RB3C 6PAXA 4KN4X 3HOTA 3P9KA 3CUQB 2JPCA 5D8KB 2PN6A 2P8TA 1HW1A 1HSTA 3DFGA 2JZYA 1YIOA 2K86A 5FD5A 1Z7UA 2RN7A 2XROA 3ZMSA 2H09A 1RNLA 2XHKA 3ZN0A 5CYVA 1D8JA 1L3LA 4ENKA 1EH6A 1K79A 3KP7A 4G94A 3H3UA 1I27A 2CSOA 2EA2A 2GAUA 4RS8A 4ZZLA 1W7PD 2O61A 4K2EA 3FF5A 3BZ6A 3FHZA 2Q2EA 3TGNA 2E7WA 2YSRA 3M7GA 2Y0MA 3P9IA 2DK8A 2VT3A 3C3WA 1T2KA 1D8KA 1HXDA 1P92A 1Z1DA 2L4AA 1ZRFA 1FP2A 1L0OC 3DKWA 4KDPA 3QOPA 2FF4A 5E1XA 3DF8A 4EV0A 3QU6A 1NHAA 1JGSA 1YLFA 2JT1A 3J81Z 2A61A 2KJBA 2KRFA 1ULYA 4D0PA 1BI3A 5CJ9A 5KVRA 4LLGF 2FBHA 3HIFA 1W4MA 2QLZA 5LEKA 1LEAA 1J5YA 2IA2A 2VT2A 3GZ6A 1WRJA 4YIIA 5TJJA 1XMKA 4HOBA 5FD6A 1ZGJA 1KYWA 2XKOA 3CUOA 4M9ZA 1B1BA 3RTRA 1U2WA 2XIGA 3DPLC 3FXQA 3TKYA 2HQRA 4OINF 2W24A 1LDKB 5FO5A 4E70A 1U6GA 3FMSA 2ZBKA 4B09A 3QAHA 5L3BA 1WQ2A 5HLHA 3I64A 3JTGA 2A69F 4CZZA 5ILSA 5HDKA 1ZRCA 1ZGAA 1QQIA 2KKOA 2PG4A 2BEOA 1W7PA 5HDGA 1BIAA 2XVCA 4G7HF 2HQNA 1SAXA 4HX4A 3K1NA 2GWRA 3SZPA 2X0LA 3ELKA 3GFMA 4EJOA 1MJBA 2GZWA 5IT9Z 4DQ2A 4OMYA 2ISYA 1LJ9A 3HRMA 4UV9A 1TNTA 1H9GA 1R23A 2G7HA 1FBQA 2RQPA 2F5DA 4QLCU 1LQ1A 3HRTA 1DP7P 3LA7A 2P5KA 2IVMA 1UHMA 4A0YA 3CO6C 1P2FA 2PLYA 4RB2C 5L3GA 4KNYA 1F5TA 1U5TB 1FBSA 3T5XA 2HKXA 1OPCA 4AIKA 3ABUA 3R60A 1XSDA 2A68F 1T98A 1DPUA 4KYWA 1BM9A 1G3SA 2Q0OA 1TW3A 3KFWX 4IF4A 1UCRA 4UXNA 1HKSA 2MBFA 3C7JA 5H6QA 2HKOA 1S8NA 4M9XA 4EM2A 3PFIA 2PQ8A 1ZARA 1ON1A 2VOOA 4BHCA 1FWZA 2KIMA 1ZLJA 2F5FA 4A6DA 2O0YA 1Y0UA 4UNOA 3SFZA 4JBAA 4R8HA 1XSXA 2E7XA 4YFKF 2V1XA 4U7DA 1MJAA 2ETHA 3ZQ7A 3TOAA 3U1DA 1RZ4A 5ICFA 2EB7A 2BYVE 1B59A 2QQAA 4LFUA 4YFXF 3R6SA 5BPDA 1OR7A 3VODA 3QRFF 3J7AO 1J9IA 1Z05A 4LK0F 1B9NA 2RC4A 1SD7A 4XRFA 4EM1A 4FX0A 1QBJA 3PQKA 5DUKA 1V3FA 4BXUA 2Q8KA 4NQWA 2ISZA 1WKMA 3KP5A 4WX9A 4PGGA 2OAZA 3MQ0A 2M87A 2EFNA 2P5LC 1IXSB 4L9NA 4HDUA 3KZZA 3LQRA 2IRFG 2A5YB 3CUQA 3P7NA 5FFXA 3BY6A 3KLNA 3J80Z 3JW4A 2YX7A 5ED4A 2IPQX 1XGNA 1QPMA 4CICA 2NAZA 2VONA 2XAHA 1XDSA 5DD8A 3HHHA 5BS6A 1BI1A 1J2XA 2EFPA 3O6BB 2DAOA 1EV7A 4Z2YA 3V8JA 3QPTA 3W6KB 3S2WA 3BJOA 5EEGA 1HQCA 2FEZA 2EWNA 3IC7A 5D5XB 5CVIA 1GVJA 4PCQA 2BGCA 1PP7U 5H20A 4OOIA 4LGWA 1H0MA 2Z9OA 3RYPA 5AONA 3K1MA 4OU0A 3LFKA 1R22A 3HRUA 2OA4A 5LHHA 2UWMA 2Z99A 1ZREA 4ASNA 3TO6A 1W5TA 4GYIA 1YO5C 2Z3YA 3QU3A 3SZTA 1G3YA 5DCMB 1T38A 2QUFA 2LF7A 5ILUA 3RKXA 3EYYA 4HZFA 3I53A 2RDPA 1HBXG 3HSEA 1KU7A 2ZO4A 2EV0A 2CGPA 1D5VA 2DU9A 5E8IA 1O3QA 2LNBA 2L3DA 3O3KA 3R61A 2NYXA 1J75A 2Z33A 4P5OA 3PQJA 1F1ZA 3L09A 2K4BA 5JR3A 4LB5A 2FQ3A 2JSCA 2YPRA 3T0YA 4KMUX 1KYZA 3N97A 2MH9A 4HQEA 2XAGA 2OD5A 4Y15A 1X3UA 3KE2A 5FLXK 4CXFA 2XAQA 5LRRA 3WTWC 2E1CA 4L9TA 4MTDA 4HQMA 2YU3A 1Z91A 3FX3A 3BP8A 2DPUA 5J8FA 1CGPA 5FGMA 1U78A 3CTAA 1TQIA 2JRTA 1FNNA 1SMYF 4FT8A 1ZHFA 2MC3A 3I59B 4DNCA 5D5UB 4LLNA 3T1BA 1ZG5A 2HGCA 4HF1A 4ON0A 1WWXA 3TO7A 3EETA 4M74A 4RGXA 2EFWA 3I71A 3C1DA 1ZH5A 3IKTA 1IRFA 1O7LA 2GXGA 4G8XA 4CO8A 3AAFA 1USSA 1YQAA 2ADUA 4U0VA 2V1DA 2WTEA 1U5TC 2LKPA 4KICA 2DPDA 1HKQA 3I4PA 4OIOF 1R00A 1SFXA 2CG4A 1ZYRF 4EJTA 4NB5A 1UB9A 4EVIA 1R5GA 1HW2A 5BPIA 1LVAA 4HA8A 1YW9A 1F9NA 1V4RA 2VE9A 1BI0A 5A2QK 4ESJA 3EDPA 2QWWA 4I2OA 1U5TA 5FLXZ 1WI9A 4I0AA 4EGZA 2ZXJA 4IRHA 2RKHA 3ZMVA 3WE3A 2OBPA 2CW0F 4L9JA 3ZN1A 1F4KA 4XLNF 2PMUA 4RAZA 4WXCA 3CDHA 1W5SA 5J6XA 3P9CA 2B0LA 5TRDA 5FFZA 4L9VA 2FXAA 3L00A 3RKYA 4UVCA 2CWEA 3HTSB 4A6EA 3W6JB 3BROA 5LGNA 3F6VA 3R0JA 2M30A 2QYOA 4HDVA 4ZYGA 3E5XA 4ZZDA 2NNNA 2DFIA 2HTSA 5L3FA 5LEJA 3IHUA 2FA5A 3NQOA 3FMQA 4Y17A 1Q1HA 5BQTA 5A2QZ 3TDZC 1PUEE 3MAJA 3V4GA 4CDGA 3CO7C 4OIPF 2A07F 5H6RA 1KA8A 4UHTA 1STZA 3QP5A 3IRRA 1Z6TA 4AIJA 4HF0A 2CO5A 3U9GA 4BQAA 1GXPA 3COAC 1K78B 4A2UA 3I54A 1XSVA 1FYMA 3ECHA 3C18A 1P4XA 3WTZA 4EJUA 3G73A 1R1TA 1XN7A 1GHCA 3GZ5A 4I02A 3E3VA 4PZJA 2XGXA 1FSEA 3L2CA 1S29A 1ONVA 1UHWA 2DK5A 4KA4A 4I98B 1OYWA 2JTVA 1I1SA 5ICEA 1XGMA 3VEPA 1K6OA 1PP8F 4BNCA 3LSTA 2ELHA 2R3SA 2GA1A 1U3EM 1T39A 1SD4A 4GCVA 4LLLA 5E20A 3GWZA 2ZCWA 5HVQC 2WWYA 2R7DA 3GX4X 1TW2A 2XASA 3NEUA 3QP6A 4O6JA 2PI0A 5LRSA 4H0EA 4RAYA 1O7FA 4CYDA 1OYIA 3U2RA 2XAJA 2PMHA 4GXOA 4CHUA 3M8EA 2L02A 3F3XA 4XBFA 1TLHB 4KT5C 5D6EA 3WTUC 4G7ZF 1BC7C 2GA2A 3K9TA 1HKTA 1AWCA 1BIBA 1LEBA 1UFMA 3I0TA 2MA3A 3JSOA 3N4MA 4M6XA 4BHBA 4MHGA 1XGSA 2VXZA 5D8LB 1QO0D 4N9IA 5DCMA 1G6NA 1QZYA 3WGIA 4WWCA 2EFQA 4IHTA 2VBXA 4S04A 1SD6A 4HYEA 1ZRDA 1XGOA 3IL2A 3MEXA 4U7BA 2FBIA 2P7CB 4BYYA 1KU9A 5D4RA 2D1HA 2EJRA 3LWFA 2A6EF 3LAPA 3TOBA 3D5LA 4KMFA 2D45A 1USTA 1KQ8A 3KEQA 3K69A 4EQQA 3MZHA 4B8XA 3CLOA 1SFEA 3V7RA 3BJ6A 5KK1A 4ZH4F 2DQLA 3FXRA 3IKVA 2QVOA 4HAMA 3I59A 5L3EA 3GYHX 1E2XA 2IP2A 1R5HA 2HWVA 5F1RA 3CUQC 1H9TA 2XV4S 3RDIA 2COMA 1JE8A 4PDKA 5E1WA 3WGGA 2O3FA 2G7UA 1R36A 1QNTA 5L3DA 1RUOA
chains in the Genus database with same CATH superfamily
5LBQA 2QQ8A 4EGYA 2V79A 3D0SA 5ICCA 2IXSA 1O3SA 3IAM2 3ZMDA 5GPAA 1IO2A 2XAFA 5GP9A 3LSJA 3TP0A 4CCLA 3H9QA 2K3PA 1MZBA 4ZDPA 5IYDJ 4AU7A 3IWFA 3SEZA 1S5LC 1BI2A 2QF7A 4C3IJ 3CDIA 2DQRA 4IXAA 2L7KA 3FK7A 4PFOA 1IGNA 4AWXB 4LG0B 2RQQA 1FYLA 1V55H 2M7BA 5M5YJ 3CJTB 2K27A 2L7ZA 3AKZA 4A3FJ 3M3YJ 1FT9A 5KAIC 4I01A 4QPOA 3GW2A 3QOEA 1PDNC 5EG0A 3BWGA 2NOJB 2UXNA 1ON2A 2EFOA 4XRSA 5D5WB 4F92B 3L1PA 4FHTA 3KP4A 2OZUA 3BT9A 4U0YA 2LSOA 1E17A 3ZQGA 3B02A 3TO9A 2MD5A 1MIJA 2DOEA 3AG1H 3N05A 3REOA 1ODDA 3WU1B 1P4WA 1OLTA 2W25A 3GMEA 3VYRB 3JAMK 1FBUA 1QHGA 2HOEA 2KJCA 4ESFA 1NG7A 3H9JA 3VB2A 1SFUA 1OCOH 4A3EJ 4C3JJ 3ZQLA 3KP3A 5D6FA 1ZGWA 4Q47A 4PK4A 4LD5A 3W6VA 2HDCA 1Z9CA 4EM0B 4BH9A 1LE8A 4CGZA 2HDDA 5KAFC 1S3JA 2KMUA 5J4YA 2XSDC 2UXXA 5J1YA 2ZJRF 2V6CA 3IP4B 1OKRA 1S6LA 4WF2A 3ABTA 1N77A 1RC9A 1X4PA 1ETKA 2V9VA 3MFKA 5CVVA 4IHSA 1I6XA 3GLLA 2M4KA 2EZHA 5C4JJ 2CFXA 4HSRA 3NRVA 3HYIA 4E4HA 2QGUA 2M9HA 2ZMEB 3FXLA 2ZB9A 3SHFA 1T6SA 2Z1DA 5FKNA 3BR3A 4XSXF 2IGMA 4BXXJ 4UVBA 3PUFA 4NC8A 2DA3A 1XB4A 3ZQQA 1WHUA 2VODA 2PFBA 2FSWA 3RPUA 3OL3A 4D5FA 2Y75A 2NS0A 1R6RA 4Y33A 2R7VA 2AXLA 2M1BA 2LOOA 2OUMA 3IH2A 4N9HA 1R1UA 3NWSA 1UJ8A 5HS9A 4LB6B 2I10A 4LK1F 3HDDA 2DO7A 2M5WA 4BXFA 1CF7B 4LJZF 3KZYA 3DKYA 4YFNF 2GQQA 1X1DA 3S1MJ 1R4NB 4FX4A 3IWZA 3E5UA 2BHYA 4XONA 5CKTA 1SC7A 1A31A 1HC8A 3BDDA 3FHNA 5FJ8J 2H6CA 2MFZA 3VFZA 1MKMA 1WJCA 1UZCA 4HBLA 3LSPA 3S1NJ 1C0WA 3RKWA 3E6CC 2CQXA 2FOKA 2ZKZA 2BY1A 2W1OA 4JK1X 2K9MA 5F04A 1K78A 4B43A 1IAWA 3WG9A 4HLYA 5LD2C 2R7FA 3JAMZ 4Q5SF 3H3ZA 4FTHA 3BPXA 2LDUA 4RDUA 2EV5A 4RGRA 2R5ZB 1MDMB 3GUDA 3OOUA 3QPSA 3BTIA 1XDUA 2DJIA 5DYMA 4UV8A 3QPHA 1O3TA 3K4NA 3B73A 3TBIA 3FXMA 5K5QA 4R1HA 3KZIC 2BXYA 2P6SA 1Y56A 2CUEA 3GBGA 2KIQA 4XN3A 2IA1A 2XPUA 3ZQCA 2LF8A 3GCMA 1FIAA 4ZC3A 3VDXA 1XPXA 1ZELA 4B4CA 3OS0A 2R7OA 1JGGA 3CCEI 1LKXA 4BHPA 4G7OF 3ML6A 2WB1N 4HV6A 5K5OA 2P0WA 3DEUA 3CCLI 1LFBA 5J47A 4WXHA 3CMEI 5K7ZA 4BDYA 3HTUA 2YUSA 4PFPA 4G6QA 5DEQA 3K0LA 1SMTA 4ZYAA 4MEYF 3CJRB 4ZYHA 2NXNB 3GVAA 4G6DA 2NRAC 2EH3A 2QBYB 4A3GJ 2K9NA 1BBYA 2EZKA 3IV5A 1LUJB 1EH8A 3MD2A 1X2NA 4E6KG 4QWQA 4M72A 2LY1A 4F7ZA 1R58A 1ZG3A 3VWBA 1MMNA 1E3PA 4L0ZB 1Y0NA 3CESA 4AIHA 1WJ5A 3F23A 2HYGD 4UB6C 2WB1A 2P6TA 4DYQA 3MWMA 3HSRA 2DTRA 3Q9SA 2KHMA 4RGUA 2XUBA 2J5OA 5K5RA 4CSWA 2ZJQF 3GEZA 1VF9A 2KIUA 2RV8A 3CQZJ 5LHGA 3OYLA 3BQYA 3JSPA 2IJLA 4A3BJ 2JA2A 3MZYA 2H6BA 2VC1A 2BXZA 2VKHA 4M3BA 5IP7J 2CUZA 2UZKA 4F93B 4BL0B 4BDZA 3F21A 4XLHA 1R7JA 2R7UA 1Z0XA 3C2GA 4GGGA 3D5RC 5JVTA 1JXSA 3KEOA 1HW5A 2X6OA 4EJWA 1HLVA 1YW7A 3PIPF 2KDOA 2W84A 1T0FA 5AIPA 1WJAA 5E3MA 4V2FA 4I0BA 3J81K 2ZC2A 1X1BA 5E18F 3T8RA 2E1MC 3FWEA 4MLOA 3FDYA 1VTNC 2DFFA 5L3CA 4E7IA 5LFAA 4HX8A 4B3AA 2XRNA 1VQOI 3A02A 2ZSIB 3I58A 4U0WA 2HTJA 2ZFWA 2E35A 4BE0A 2FNAA 3DP7A 1MSFC 3M1EA 2DBBA 2V26A 5LHIA 3G1LA 4WK8F 4NDLA 1ZLKA 2PJPA 3ONQA 1IXRC 4ENNA 2DI3A 2QENA 5ERIA 3V8KA 1MMGA 3NWTA 3S14J 5EGOA 5FLMJ 1O3RA 3HUGA 2A6HF 4HW0A 2CFOA 2V1NA 1BOBA 1EH7A 2IA0A 2HZTA 3MKLA 3FMRA 2WY8Q 4RAFA 4YRVA 1YTYA 3H3VK 2EA4A 3BG7A 3Q9VA 4OIRF 4I09A 1IZ1A 1ACIA 1LB2A 4XSZF 3DPTA 3HKZN 1FZPB 4PJJA 4C30A 2R5YB 4C2TA 4DW6A 3L2UA 3HOVJ 2DT5A 3RQ4A 5IOZA 4BJ6C 1JJ6C 2HDWA 3K4KA 2RVCA 3HM5A 2F5EA 2XAUA 1BJZA 1K6YA 1MGTA 2X1DA 2P81A 2F2EA 3D5SC 3L9FA 2K40A 3FBIB 3K6GA 3EUHC 2QM3A 2D2WA 4RBOA 1XMAA 2O7OA 4BJ5C 4OIQF 1IW7F 2VKDA 1R5ID 3GTQJ 2M0MA 2H94A 3K2ZA 1I1GA 3F72A 5CVRA 2XC7A 1VNDA 2O03A 3HKZA 3KX2A 4Y7NJ 2WAQN 4NHJA 2LH9A 4BGDA 1A36A 5J40A 4EMSA 1GXQA 3FISA 4P9FA 1UELB 2IAIA 2M45A 3SJMA 4CH7A 4MFDA 3OY9A 1JHFA 5IT9K 5DD4A 1KU3A 4XRSG 2YR2A 5C4XJ 1LDDA 4A3DJ 2X51A 3CD6I 4Q4ZF 3O2PE 2AO9A 4BKXA 1WH7A 3BOQA 3EUHA 4DZJA 2H27A 3E5QA 3BTJA 4IHXA 1OCTC 4AVPA 1AOYA 2IW5A 3ESWB 4EJVA 5E1ZB 2G9WA 4N4OB 5E17F 3WTVC 3GTKJ 1BJAA 3HSFA 2W85A 2WC2A 4UUSB 2BY0A 2K4JA 4YIRX 3OYDA 2ELKA 3KCCA 4XLAA 2KQRA 3V7CA 2XB0X 1G2HA 1TWAJ 2YX4A 3G1OA 4B1RA 4G12A 4AYBN 1JT0A 1B8IB 4IOCF 2OV7A 2FMYA 5KNLA 4S05A 2X48A 4CCOA 2VJ5A 1EA3A 5K1YA 2MC4A 3J7YJ 2A3SA 4KFCA 4OMZA 4GRIA 3MKYB 4MQ9F 3ZP5A 2AS5F 1V5FA 4B47A 3CCJI 3KP2A 3JRGA 5J1UA 1LDJA 2EZIA 2ZSHB 1BN5A 2ID3A 2XF7A 4U88A 1REPC 3BCAA 3JRBA 4LG0A 4II2A 3WGHA 4ZYDA 5B1BH 1O57A 1G3WA 3FXUA 4IRGA 5GAEJ 3DKXA 5JHFA 4KISA 3DTEA 4HLXA 2WAFA 3HEFA 1MNDA 3RKQA 2KL4A 2JSPA 3F8BA 3RI4A 1PYVA 3SXYA 5IT3A 2L4MA 4P1WA 3Q5FA 1J59A 3ZPLA 3S1QJ 1SANA 1OMIA 5K7HA 2HQAA 4GO1A 2LMDA 2MD0A 2F4MB 1MH4A 2DOAA 1J0RA 2HZDA 4WXDA 2VJIA 5DDGA 1IN8A 2L9RA 2B9SA 2STWA 1SD5A 3LA2A 1VQ6I 4XORA 4UUVA 2VBWA 4KIGA 4A0XA 4CCJA 4V2GA 4L0YB 2X1EA 3F8FA 1APLC 3GLXA 3SEQA 2XGCA 3IH3A 4ENJA 4LITA 1FOKA 2MLGA 3F22A 4Y52J 1A6QA 4CCNA 2VB6A 1VQ8I 2P7VB 4A12A 3OSFA 5HLIA 3I55I 4BY7J 1TBXA 3S93A 5BMZA 5CLSA 3KYLA 4P55A 1QPIA 4M9SA 2BV6A 2KRCA 4M3GA 4JYKA 2NNYA 2BW3A 1RUNA 4IQ4A 2OTLI 3FM3A 3ERMA 1WCMJ 3F8NA 4IJAA 4L5IA 1DPRA 2ZMEA 1LNWA 3BTCA 4PJLA 3WTTC 4P96A 1EJ9A 4AM3A 4A5NA 1IUYA 5LLQA 1QZZA 1BA5A 4ZJZA 2CQQA 4ETSA 3K2AA 2QZ8A 2GM4A 1IV8A 1TTYA 2OU2A 1FLIA 2OQGA 1B9MA 1FC3A 4PUSA 3WTSC 5D5VB 4MTEA 1FY7A 3ECOA 1KQ0A 1XCBA 4A3KJ 4E7SA 3M8FA 4ENMA 2LY2A 4F3QA 2Y9ZA 1OQYA 2CJJA 2DDBA 1OYYA 2P4WA 4MO7A 2J5PA 3HB9A 4J00A 2R7XA 1OFCX 1IN4A 2HVQA 2MLKA 1ETVA 4I99C 3DEWA 2TDXA 1CF7A 5FKOA 4RGSA 2DT6A 1YE9A 4IHVA 3CCQI 2O6GE 1R1VA 2K9QA 4XKBA 3RIRA 2FBKA 2GIVA 2V1UA 4GDFA 3KETA 5BOXA 3C2BA 3ZMZA 3WU0A 4DOZA 2FRHA 3BR5A 3R4KA 4RAGA 4RA2A 2VPLA 1B6AA 3HOSA 2BE5F 2DN0A 2E19A 3GO5A 4M73A 2EV6A 1PUFB 1F36A 3HHGA 4XLPF 2FU4A 2EBIA 2VBZA 2Q2EB 1IXCA 4TV7A 5HNHA 2F4IA 1ZG1A 2L9NA 2OPTA 2R7WA 3MMYB 4HV5A 3WE2A 1OCCH 1MJ9A 4BQOA 5LGTA 2ACJA 1MDMA 2R5ZA 4RB1A 1XTAA 5EEHA 3K4CA 1YX3A 2DJNA 1DU6A 2FMLA 3RYRA 3HOZJ 1YS6A 1TWCJ 1UAAA 4ZYEA 2OJED 2Y48A 3CMMA 3GXOA 3LQQA 1JKOC 3F8MA 5HS7A 3J80K 3G2BA 1IF1A 2FNPA 3V7SA 2MW8A 5F6FA 1S7OA 2W48A 3ZQFA 5ILVA 1A6IA 5CVJA 3S8PA 1IN6A 1KONA 3KIOA 4IVNA 3WTYC 2GXBA 2IT0A 2MH2A 5F1JA 2KDZA 1GDTA 1ZN2A 4E7JA 2CYYA 5DCFA 3ZMTA 2QSFX 4M6YA 3MCZA 4B3XA 1FP1D 3L2WA 1OJLA 2VKVA 4E7LA 4HPQA 3HOWJ 5HS8A 2L54A 5DM6F 1TWHJ 3ROUA 4UVAA 1HCRA 2LKSA 4KIFA 2E2HJ 1P7JA 2QBYA 3BR1A 4C2MJ 2A5WA 2ZJ2A 3KP6A 5LGUA 1FPQA 3R0AA 5AIQA 1DDNA 3ISPA 5HLTA 4IRIA 1NG6A 2M8EA 3VOEA 5JI6A 3LNQA 2GIZA 3S16J 2VOPA 3RPUD 1SEUA 3UR3C 3PM1A 3BPVA 4LMYA 1O4XA 3CMYA 1P6RA 1FYKA 2RREA 3AL0C 4IHWA 5D4SA 3LAJA 3EYIA 3OMYA 4A5MA 4HNVA 1Z6RA 2CRGA 3ERED 5DUIA 4Q48A 1RESA 3HPGA 2AQFA 4C9YA 2VL8A 3S2DJ 3K1PA 2D5VA 2LD5A 2EIKH 2C6YA 5B5EC 5F64A 2QQ9A 2E1NA 3S1RJ 2CQKA 2Z5UA 3SZGA 1IDYA 4JX4A 4J19A 4MGRA 1TQMA 1IRXA 3RPQA 5HDNA 1FSHA 2D1VA 3SYTA 4BQQA 2EK5A 2IGKA 5J1RA 3E97A 4ABZA 4AD9A 2DW4A 3ZRGA 2STTA 3CLQA 4JOMA 4QPQA 5EDNA 1A04A 4MEXF 1GV2A 1TT5B 5GAHJ 5JHUA 2VN2A 4OWRB 3AG4H 3WHCA 5JLXA 3BQZA 5FB2A 4X1EA 2VE8A 1EKEA 1W7PB 2ZXIA 3TW6A 4M3EA 4YELA 4ANJA 2R0QC 1VQ5I 5HOOA 3BG9A 1H88C 2K7LA 2O9LA 4M71A 1FX7A 5EYRA 1KQ9A 2O8XA 2BVMA 2XGDA 1D3YA 3A0HC 3M9AA 2JK3A 1HSJA 3DXJF 1Y6IA 2LVSA 3NARA 3IRQA 3I4MJ 3OYIA 3F6OA 4HNTA 1E3OC 2HYJA 4HSTA 2DA2A 4ITVA 4A3JJ 1U8RA 1GVDA 4AIDA 3SQNA 2JA7J 2CV2A 1UG2A 1R71A 2HR3A 2XRLA 2PBIA 2V7FA 2M0CA 4X6AJ 2Y31A 2Y0SN 1JUSA 2NVYJ 4QIWN 4O5VA 2JVGA 2M34A 3OV8A 3PNYA 5ICGA 2W57A 1T8IA 2R5YA 3OR1C 4R79A 2NVQJ 4YG2F 1JUPA 3WTXC 2HYFA 4B48A 4DIQA 1RIOH 2BBYA 3RJPA 4CA0A 1JKQC 1IN5A 3W3CA 1FMVA 2OZ6A 3ULQB 2R7SA 4GYGA 3L7WA 3T8TA 1ZAOA 3QODA 3A01B 5IP9J 1T08B 2ESHA 3H92A 1K61A 2XKPA 5DV5A 1NTCA 1HA8A 4N0BA 3S15J 4ESBA 1XC5A 2Y0SA 3BZKA 1JHHA 1VZ0A 2RGVA 1P4AA 1YYVA 2F4OB 3MN2A 3JRHA 3HGYA 4KT6A 2DMTA 3KLOA 1B4AA 2KIFA 5TISC 3ZMUA 3EUAA 1LFUP 1RR8C 5M3FJ 2DLLA 4NC7A 4RB0A 4F55A 4KUMA 1RI7A 3PIOF 2JPBA 1BOAA 1MBGA 3B6AA 3DV8A 4KIBA 1XD7A 2KFDA 3OL4A 2FX0A 2M2EA 4FETA 2L01A 1YG2A 2MABA 3TQNA 3HRSA 2WV0A 4P9UA 4E7KA 1OCZH 1TNSA 2HFHA 4YIFA 2QQBA 2VBYA 3M07A 2JMWA 4WCGA 4A3MJ 2JA6J 3BLYA 4Z6YA 1KU2A 1RKTA 3JRIA 4BBSJ 3E6DA 3GFJA 2L2OA 2LP0A 5J8CA 1N78A 2ZNYA 2K02A 3GFLA 4UUSA 1G4DA 4KN7X 3TEDA 2RAEA 2HS5A 2WBMA 2LK2A 3WODF 2FUG2 3GFIA 3TDUC 3DTKA 1X19A 5FKLA 1IN7A 2A05A 2HI3A 3F8CA 3OOPA 3FM5A 4BUPA 2E5NA 1B8IA 2H1KA 3CJNA 3OYMA 2HEOA 1KGSA 4BE1A 3J7ZI 1DUXC 1BW5A 1XCVA 3HG9A 3G3ZA 3I5UA 1P7IA 3FIWA 2F5CA 1WSUA 4O3MA 3GF2A 2VKEA 2BY3A 4MFEA 3FZVA 5E8GA 5HLGA 3E6BA 5HNFA 3U21A 1YFHA 1MH3A 1ETWA 4AUXA 4HX7A 2PEXA 2VJ4A 4L5JA 5CQEA 4L18B 3HXLA 4MQVA 2RNJA 1GLNA 3K4BA 2JVHA 4BY1J 4IPAA 1T0FC 2WADA 2ESNA 3LSKA 1TQPA 1UG0A 2P5VA 1J7KA 5KHDA 2DOFA 3EQLF 3LA3A 3CMAI 1G3TA 3LMMA 2FE3A 3K70D 4I7HA 1Z67A 3JTHA 2KZGA 5F0HA 4KITB 1QGPA 2NVUB 3ZQIA 1IRGA 4BAYA 4Y13A 2TCTA 1K7AA 4IKFA 1S9HA 2Q1ZB 1D1AA 5E3OA 3CC2I 3HBLA 1DGWY 4JQFA 4HF2A 3RZDJ 1MD0A 4MNUA 1S7AA 1X3WB 2XF6A 3BJAA 4G9YA 2IS1A 2B7EA 5CVUA 5JFRA 2K9LA 4A0ZA 1I5ZA 2LBFB 2OQRA 1BC8C 3G71I 3BTLA 1MSEC 4DGWB 1W0UA 3JRCA 4NQWB 4X0GA 2ZNZA 2X4HA 4PGHA 1Y8QB 2VC0A 3JR9A 3DQVC 1YX5A 1YS7A 4XLCA 3E6MA 3H5RA 3V8LA 1R49A 1YW8A 4RB3C 3K4LA 1ZQ3P 6PAXA 4KN4X 3HOTA 4RLFA 2VQLA 1VQ9I 4OAYA 3P9KA 3CUQB 3CCRI 2JPCA 5D8KB 1SVMA 1FOYA 2PN6A 2P8TA 2DDAA 2DYSH 1HW1A 1HSTA 3DFGA 4G6TB 2W82A 2CUFA 2ID6A 1Z3XA 1JUMA 1VQKI 2JZYA 1YIOA 2K86A 2VJJA 5FD5A 3JCUC 1Z7UA 2RN7A 1QZEA 3DLAA 2XROA 1ETXA 3ZMSA 3K70C 2JA8J 2H09A 1YIJI 1RNLA 2XHKA 3ZN0A 3CJQB 5CYVA 3SFIA 1SFOJ 1D8JA 1L3LA 4ENKA 3KPHA 1EH6A 1U0JA 1K79A 4NBQA 3ZGKA 2DTZA 5B66C 3KP7A 4G94A 3JRAA 3H3UA 1I27A 2JUCA 2CSOA 2EA2A 2GAUA 5GAGJ 1NH3A 1GUUA 3K7AJ 4RS8A 2CS3A 2R7QA 2LREA 4ZZLA 4IL6C 1W7PD 2O61A 1PUFA 3RQIA 4K2EA 3FF5A 3BZ6A 2XB5A 3FHZA 2Q2EA 1WPKA 3TGNA 2E7WA 2YSRA 1MBKA 3KYCB 1I6HJ 1FIPA 2Y0MA 3M7GA 3P9IA 3WHBA 3Q3SA 2AXTC 3I3LA 2DK8A 1PVEA 3ZOBA 4HNUA 2VT3A 3C3WA 1T2KA 1YRNB 1DP3A 2NVXJ 4A3CJ 1D8KA 1HXDA 1P92A 4A3LJ 2OTJI 1Z1DA 4I76A 3BC8A 2L4AA 1ZRFA 2NVTJ 3FKJA 1FP2A 1L0OC 3DKWA 3GTLJ 3CDLA 4KDPA 3QOPA 2FF4A 1X1CA 5E1XA 2UV1A 3DF8A 4EV0A 3QU6A 1NHAA 1JGSA 1YLFA 2IBDA 2JT1A 2PJRB 3J81Z 1KZHA 3E0JB 3QWLA 1Y39A 2A61A 4C3HJ 4H4KC 2X6YA 2KJBA 4LG3A 2KRFA 2ELJA 2DA5A 1ULYA 4D0PA 1BI3A 3RSNA 5CJ9A 4XLEA 5KVRA 4LLGF 3ZCOA 3KEYA 4XK4A 2FBHA 3HIFA 1W4MA 1LPQA 2HQ5A 1Y8RB 2QLZA 5LEKA 1LEAA 1J5YA 1H89C 1VQLI 2QSGX 5K7FA 1DU0A 2IA2A 2VT2A 3GZ6A 1WRJA 4ZDLA 4YIIA 5TJJA 3OIOA 1XMKA 1YITI 2E34A 4HOBA 1AKHB 5FD6A 1IV6A 1X1AA 2LKXA 3CP2A 1FJLA 3H5AA 1ZGJA 4XOTA 1OCPA 1KYWA 1WI3A 2XKOA 3CUOA 1G8XA 1SFKA 4M9ZA 1B1BA 2F5VA 2KZVA 1U2WA 4LIVA 2XIGA 3RTRA 3DPLC 2PMZA 3FXQA 2BVLA 3TKYA 2HQRA 5M5XJ 2LTPA 3TL4X 4OINF 2W24A 1LDKB 5FO5A 4E70A 3CCVI 1U6GA 1XS9A 4FE7A 3FMSA 2ZBKA 4B09A 3QAHA 5L3BA 1WQ2A 5HLHA 2QEXI 3I64A 3JTGA 2HXOA 3DU6A 2A69F 3LSMA 4CZZA 5ILSA 5HDKA 3BCBA 5TGTA 2EZLA 1ZRCA 2HOTA 1ZGAA 5JLWA 1QQIA 2KKOA 2PG4A 2BEOA 1W7PA 3BR0A 2JN6A 4XR6A 3OS2A 5HDGA 1HOMA 1BIAA 2XVCA 4G7HF 2HQNA 2ZMEC 1SAXA 4HX4A 3OYEA 2DYRH 1Q1VA 2X1CA 4J01A 2Z16A 5C44J 2K85A 3K1NA 1XMXA 2GWRA 3SZPA 2X0LA 3ELKA 3GFMA 3D1NI 1D0YA 4EJOA 2CV0A 2QCOA 3EUKL 4FASD 5HODA 5FRMA 1DQUA 1K83J 1MJBA 2GZWA 5IT9Z 1ZR2A 4DQ2A 4OMYA 4V19K 2ISYA 3MKZA 1LJ9A 3HRMA 5CPRB 4UV9A 3FXJA 4XRMA 1LVKA 1TNTA 1H9GA 3DCFA 1R23A 1MBJA 4MIMA 2G7HA 3A1YA 5H2FC 1FBQA 2L7MP 2LLKA 2RQPA 2F5DA 3QQAA 4QLCU 1LQ1A 2FJ1A 3HRTA 3Q0UA 1DP7P 3LA7A 3GTJJ 2P5KA 2DXIA 2IVMA 1UHMA 4A0YA 3CO6C 1FTTA 1P2FA 4A93J 2KRHA 2LY9A 1JKPC 2COBA 1VQPI 2PLYA 4RB2C 3FBNB 4JX6A 5L3GA 3UKGA 2EIMH 4KNYA 3A01A 1AHDP 1F5TA 2M7AA 4D7MA 1U5TB 1FBSA 3T5XA 3GTMJ 5GTIC 2HKXA 1OPCA 4AIKA 2CV1A 2O5RA 3ABUA 4JX5A 4XQFA 3R60A 5FKKA 1XSDA 2A68F 2N8GA 4FCYA 2WAEA 1T98A 1WVRA 1DPUA 4BACA 3OYFA 5EJCA 4KYWA 3HOYJ 2JWTA 1BM9A 1G3SA 1QVUA 2Q0OA 1TW3A 1JTYA 1MBFA 1A35A 3KFWX 2O8KA 2KP6A 2W4SA 1TWFJ 3HZJA 4NNJA 2QKLB 1YJNI 4IF4A 4IOAF 1UCRA 4UXNA 1N25A 1HKSA 3I56I 2MBFA 4ZTJA 3C7JA 5H6QA 2E1OA 2HKOA 1S8NA 3IUOA 2IGOA 4M9XA 3FKIJ 1XX5A 4FISA 4EM2A 2HPMA 3VSKA 3PFIA 2CQ7A 2DA7A 2GOMA 1JI8A 2PQ8A 1ZARA 1ON1A 3OS1A 2E1MB 2ZXWH 1W5CC 5IY5H 1U8BA 2VOOA 2V4JC 4BHCA 1FWZA 3OIQA 3FK6A 2KIMA 3UNGC 4D5CA 4ZTFA 1ZLJA 2F5FA 2L9SA 4A6DA 2O0YA 1Y0UA 3E1SA 4F52A 2VQCA 3LSIA 4UNOA 1FOXA 3GTPJ 2M4GA 3SFZA 3BR6A 3SDBA 4JBAA 4PJ0C 3H5NA 4R8HA 3PSFA 1F43A 1XSXA 2E7XA 2MGQA 3DBLB 3DPUA 1WFXA 3HOUJ 4YFKF 3FXKA 1RR7A 2V1XA 2GBYA 4U7DA 5JVGF 2JA5J 3JREA 1MJAA 2JJ7A 2ETHA 3ZQ7A 3S3MA 4BBRJ 2E36A 1V5GA 3TOAA 3SDGA 3U1DA 1RZ4A 5ICFA 2HVRA 2EB7A 2BYVE 1B59A 2QQAA 3Q0WA 4W1UA 2ICWG 4I6ZA 4LFUA 1TC3C 1MMDA 5F08A 4YFXF 3R6SA 1SVLA 5BPDA 1OR7A 2V9KA 3VODA 2EINH 3QRFF 3J7AO 1PJRA 1WJDA 1J9IA 1B72B 2BHZA 1BW6A 1OCRH 3DBRB 3M8JA 1Z05A 2M3AA 4LK0F 1B9NA 2RC4A 1FOWA 1SD7A 2Y30A 4XRFA 4EM1A 4FX0A 1SVOA 3M4OJ 2L5QA 4RM3A 1IRZA 1MW7A 1YJWI 1QBJA 3S3OA 4GFBA 3PQKA 5E3NA 2LG4A 2LBFA 3JRFA 2RNGA 2R93J 2VPRA 3QPLA 4C2UA 1VQNI 5DUKA 1V3FA 4BXUA 3M1CA 2Q8KA 4NQWA 2ISZA 3LFUA 1WKMA 3KP5A 4WX9A 2FQ4A 2Y2ZA 4PGGA 2VLAA 2OAZA 4B44A 2QA4I 3PUBA 2OCEA 3LSGA 3A2KA 2VASA 2M87A 3MQ0A 5EZGA 2EFNA 2P5LC 1IXSB 4L9NA 4HDUA 1I39A 3PSIA 3CCMI 3KZZA 3VSLA 3LQRA 2ZXHA 3ASOH 2IRFG 2DA6A 4E7HA 2A5YB 3CUQA 3H0GJ 2DFHA 3P7NA 5FFXA 3BY6A 3KLNA 2X85A 4LOCA 3ZR8X 4FQGA 3J80Z 2DA4A 1N75A 2UUZA 3JW4A 4XN0A 3RCOA 2YX7A 3I9V2 4PJMA 5ED4A 4CCMA 4DBRA 3AG3H 2IPQX 1XGNA 1QPMA 3PO3J 2VIXA 4CICA 3A0BC 3B6CA 1TWGJ 2GLOA 2NAZA 2VONA 1Z7LA 2XAHA 3G4SI 1XDSA 5DD8A 1SAUA 1W1WE 3HHHA 3VPRA 5BS6A 1BI1A 3DBHB 3DWLE 5FRNA 1J2XA 3VYTB 4BU2A 2EFPA 3O6BB 2DAOA 1EV7A 2H8RA 2HOSA 4Z2YA 3V8JA 3L2VA 1TZLA 3QPTA 3W6KB 1D1CA 3S2WA 3BG6A 3BJOA 5EEGA 1HQCA 2FEZA 3JRDA 2EWNA 4DYCA 3IC7A 5D5XB 2H8WA 1GVJA 4PCQA 2BGCA 4XOPA 5CVIA 1PP7U 3U1KA 1H8AC 5H20A 2CW7A 1D0XA 3DEEA 4LGWA 4OOIA 4BS9A 1H0MA 4RM2A 2Z9OA 2NS7A 3RYPA 5AONA 2R7ZJ 2BW3B 4XKCA 4XLFA 5F27A 3K1MA 4OU0A 3LFKA 4CYCB 1R22A 4F91B 3HRUA 2BZTA 2OA4A 5LHHA 3LSRA 2UWMA 2OF7A 2Z99A 1YRNA 4XIDA 1ZREA 4ASNA 3TO6A 3DU5A 3O8GA 1W5TA 2I5UA 2XDVA 4GYIA 1YO5C 2Z3YA 3MKWB 3H9GA 5FROA 1LFPA 2EQRA 3QU3A 3SZTA 3GZNB 3QYEA 3MVPA 2R7TA 1G3YA 4IZZA 5DCMB 4M3FA 1T38A 2QUFA 1VFCA 2R92J 2LF7A 5ILUA 4BEHB 3LSHA 3RKXA 3EYYA 2IS2A 3PNVA 4HZFA 2PJRA 4OAZA 3I53A 1ORKA 2RDPA 1HBXG 3HSEA 1KU7A 2QKMB 2ZO4A 2EV0A 4E7ZA 2CGPA 1D5VA 2DU9A 2JUGA 3NAUA 4IX7A 5E8IA 1RPWA 2BOLA 1O3QA 2LNBA 2L3DA 3O3KA 3R61A 5BNGA 3ZQHA 2DT7B 3H1CA 2NYXA 1J75A 4IO9F 2Z33A 1IC8A 4P5OA 3PQJA 1F1ZA 3L09A 2K4BA 5JR3A 4LB5A 1V5EA 2FQ3A 2JSCA 1WJBA 2YPRA 4YEJA 3T0YA 4KMUX 4S0HB 1I3AA 1KYZA 5DM7F 3N97A 2MH9A 3TW7A 3PFYA 1AKHA 3HPHA 4HQEA 2XAGA 2OD5A 4Y15A 1X3UA 2L9VA 3KE2A 5M3MJ 5FLXK 1ZTRA 3RZOJ 4CXFA 2Y9YA 2E71A 1ETQA 2XAQA 3CC7I 5LRRA 3WTWC 2E1CA 5F0CA 3W2VA 3OR2C 4L9TA 4MTDA 2F6CA 4HQMA 2YU3A 1S72I 1Z91A 9ANTA 3FX3A 1IG7A 2V9PA 4A69C 5GADJ 3BP8A 2DPUA 4Y3OA 5J8FA 1CGPA 3ASNH 5FGMA 1U78A 2GXAA 1E3HA 1Z77A 3CTAA 1TQIA 2JRTA 1FNNA 1SMYF 4FT8A 1IUFA 1ZHFA 2MC3A 3CCSI 4IHYA 3I59B 4DNCA 5D5UB 4LLNA 3T1BA 1ZG5A 2HGCA 2WY7Q 2XSJC 2ZFUA 3QYFA 1Z3YA 4M6VA 4ON0A 4HF1A 1WWXA 2KPMA 4XMYA 2YU9J 5F0FA 5CQGA 3S3NA 3CZ6A 3TO7A 3C2HA 3EETA 2KISA 4M74A 4RGXA 2EFWA 3I71A 3C1DA 4RMNA 3L2RA 1ZH5A 1I50J 2I8DA 2K3FA 3IKTA 3CF5F 1IRFA 1O7LA 2GXGA 4G8XA 3DTIA 4CO8A 1UMQA 1USSA 3OYCA 3AAFA 1OISA 1YQAA 2L7FP 5B1AH 2IS4A 1MMAA 2E5ZA 4XNFA 2ADUA 4U0VA 2V1DA 2WTEA 1U5TC 2LKPA 4KICA 3QYBA 2DPDA 3X2QH 1HKQA 2MG4A 1NK2P 3I4PA 4OIOF 1R00A 1SFXA 2CG4A 1ZYRF 4EJTA 3BR2A 4NB5A 1UB9A 4EVIA 2DMUA 1R5GA 4NUBA 4KJZA 1HW2A 5BPIA 2CMPA 4DZPA 1VQ7I 1LVAA 4XL9A 3A4CA 2ECBA 2X6XA 4HA8A 5IYBJ 1BL0A 2CQNA 3V42A 1YW9A 1F9NA 2YS9A 1V4RA 2VE9A 3EPZA 1BI0A 5A2QK 3J7AY 2HNHA 4ESJA 1T95A 3EDPA 2AHQA 2OC6A 2XF5A 5EG0B 3S17J 2QWWA 5GTHC 4UUTA 4I2OA 1U5TA 5FLXZ 3WU2C 1WI9A 3H36A 3AL0B 3H35A 1W36D 4I0AA 4EGZA 2Y69H 1QU3A 4ZDOA 5J3LA 2ZXJA 5EF6A 4IRHA 2RKHA 4AC0A 3ZMVA 3WE3A 2OBPA 4D7NA 2DCEA 4RLQA 2CW0F 4L9JA 3ZN1A 1F4KA 4XLNF 2V6EA 2PMUA 4RAZA 2K9SA 4WXCA 1QRYA 1R9TJ 3CDHA 4CCKA 1W5SA 5J6XA 3P9CA 2B0LA 1I3QJ 5FFZA 5TRDA 3F0CA 4HG2A 1LE8B 4L9VA 2EPFA 5B3SH 2FXAA 3L00A 2IEKA 4PJNA 3RKYA 4II3A 4UVCA 4XKWA 2CWEA 3S2HJ 1M1EB 5EEAA 1VQ4I 5IPAA 1D0ZA 2E2JJ 3HTSB 4A6EA 2NOGA 4LIUA 2JRMA 4A3IJ 1V54H 3W6JB 2KT0A 3BROA 5LGNA 2IGNA 1T56A 3F6VA 1RRJA 3R0JA 2M30A 2E60A 1IDZA 2QYOA 1RETA 4UB8C 1VQMI 4HDVA 4EEFG 3IAS2 4ZYGA 3E5XA 1JJ8C 5KCMA 4ZZDA 2VUMJ 1D1BA 4QTRA 3HC7A 2NNNA 5M5WJ 2DFIA 2HTSA 5DTDA 5L3FA 5LEJA 2ZJPF 3IHUA 1EF4A 1ETOA 1FMWA 2FA5A 1ERDA 4DBQA 2Z2SB 4W97A 1HDDC 3NQOA 1W36C 2HU9A 3H0DA 3OYGA 3FMQA 4Y17A 1K4SA 4AVZA 1Q1HA 5IOYA 5BQTA 5A2QZ 1DGRM 4HEA2 3K4MA 3GTOJ 4IEJA 1P9QC 1WH5A 3TDZC 4CZCA 1X4OA 2PMZN 3CC4I 1X3ZB 1PUEE 3MAJA 3V4GA 4CDGA 3CO7C 1Z21A 2CU7A 4IQJA 1W0TA 2A07F 4OIPF 1JT6A 3OIPA 3CCUI 5H6RA 3HL2A 4HRIA 1KA8A 4UHTA 1STZA 1TT0A 3QP5A 3IRRA 1Z6TA 1YOVB 3VYSB 3L2QA 4AIJA 4HF0A 1R4MB 2CO5A 3U9GA 1HDPA 4BQAA 1GXPA 3COAC 3OYNA 2L0KA 1B72A 1K78B 4A2UA 1VI0A 3I54A 1XSVA 2HXIA 1FYMA 2WAQA 2LYCA 3ECHA 3C18A 1ETYA 1QHHD 2FD5A 2B63J 1P4XA 3WTZA 4EJUA 2CUJA 1WJFA 2X9DA 3G73A 3BG5A 1R1TA 2CH0A 4DJAA 3G1MA 1QVTA 1XN7A 1GHCA 3GZ5A 4I02A 3E3VA 4PZJA 2R7RA 1T33A 1BR1A 1CQTA 2XGXA 1NK3P 1FSEA 3ABMH 3L2CA 1S29A 2CW8A 2VQHA 5GPCA 1WZ2A 1ONVA 1QA6A 3A03A 1UHWA 2DK5A 4KA4A 4I98B 2WA0A 3IH4A 1BR4A 4CUGA 3PO2J 1MMSA 1OYWA 2JTVA 2VXDA 3PL8A 4EATA 5IYCJ 3HOXJ 2JQ7A 1I1SA 5ICEA 1GV5A 1XGMA 3VEPA 1K6OA 2XGEA 1PP8F 1E0EA 4BNCA 2ECCA 3LSTA 2ELHA 2R3SA 2GA1A 1D5YA 3BZCA 2DMNA 1U3EM 3DLLF 1YJ9I 1YHQI 1SD4A 1T39A 2HVSA 4AYBA 2H1LA 2BY2A 2OCCH 2XPWA 4GCVA 4LLLA 2GOXB 2LC2A 3CP8A 3WG7H 1X2MA 5E20A 3GWZA 1FEXA 3OYKA 2PX9A 1AA7A 2ZCWA 3LOCA 5HVQC 4D9JA 1RKWA 2WV1A 1XG1A 5DS9A 3PJRA 2WWYA 4M3DA 2LR8A 2R7DA 3G6EI 1TP4A 3MZ8A 2QSHX 3GX4X 3AFHA 1TW2A 4QSHA 2XASA 3NEUA 2DFEA 4N4NB 1G59A 3QP6A 4O6JA 2PI0A 5LRSA 4H0EA 4RAYA 1O7FA 4CYDA 3VYUB 3CCYA 4XM3A 1OYIA 1HF0A 3OYBA 3HGGA 3U2RA 2XAJA 2G0EA 2PMHA 5E3LA 4GXOA 4CHUA 3M8EA 2IS6A 4XKVA 2L02A 2VQGA 3F3XA 2FOWA 4XBFA 1TLHB 4KT5C 5D6EA 3ZXSA 4FE4A 3WTUC 5FKMA 3I4NJ 4G7ZF 1GT0C 1K4TA 1BC7C 2R4GA 2HOAA 3Q0VA 3P5JA 1WGXA 2GA2A 3K9TA 1U9OA 1HKTA 1AWCA 4CYCA 1BIBA 1LEBA 1YI2I 1UFMA 4BJTA 3W2AA 1WJEA 3CF2A 3I0TA 2MA3A 1Y1WJ 3JSOA 4L5EA 1IJWC 1FTZA 4D1QA 4DYRA 2DA1A 3N4MA 4M6XA 4BHBA 4MHGA 2M8GX 2EIJH 1XGSA 2VXZA 3ABLH 5D8LB 5J4VA 1QO0D 4N9IA 5DCMA 1G6NA 3K4JA 1UHSA 4BEHA 1QZYA 1TL8A 5FLVA 4NC6A 3WGIA 3BG3A 2MSYA 4PSXA 4WWCA 2EFQA 4IHTA 5EGOB 3HUGB 3K10A 2VBXA 4S04A 2ME0A 1SD6A 3ABKH 2HPIA 4HYEA 3OYJA 1ZRDA 1XGOA 2XPVA 3MEXA 4U7BA 3OYHA 2W00A 3IL2A 1AU7A 2FBIA 2AQEA 4PSWA 2P7CB 4BYYA 1KU9A 1X1PA 5D4RA 2D1HA 3S32A 3F9KA 2EJRA 1U9NA 2DODA 1ZR4A 2TRTA 3O8HA 3OYAA 4BE2A 4UY8I 1OR7C 3GTGJ 3LWFA 2KLOA 2VI6A 2A6EF 3W2WA 3LAPA 1ZK8A 3TOBA 3TP3A 3KYDB 3HJEA 3D5LA 4KMFA 2D45A 2LFBA 1S7EA 1ITYA 3LL7A 2DMQA 2MYSA 1USTA 1MNEA 1KQ8A 1Y1VJ 3KEQA 3K69A 1MNMC 4EQQA 3MZHA 4B8XA 3CLOA 1A5JA 2A6TA 1BR2A 1ZKGA 1SFEA 3V7RA 3BJ6A 5KK1A 1POGA 3FXOA 4ZH4F 2ME6A 2DQLA 3FXRA 3OSGA 1X58A 3IKVA 1JTXA 2QVOA 4HAMA 1J09A 3AG2H 3I59A 2NS8A 5L3EA 4Y4RA 3GYHX 1E2XA 2IP2A 1JKRC 2K5CA 3OWTA 1R5HA 2HWVA 4BQNA 5F1RA 3TMOA 5EZHA 2LRDA 3CUQC 1H9TA 2XV4S 2E2IJ 1MBHA 2DMPA 1MBEA 2EILH 3E7LA 5IP6A 2F48A 3RDIA 2COMA 2X6WA 1JE8A 4PDKA 5E1WA 3WGGA 2O3FA 5C3EJ 2G7UA 4JP0A 1R36A 1ENHA 4XICA 4U87A 1QNTA 5L3DA 1RUOA 3PNTA 5E79C 2W7NA
chains in the Genus database with same CATH topology
5LBQA 4EGYA 2V79A 3D0SA 5ICCA 1O3SA 3ZMDA 2XAFA 1MZBA 3IWFA 1BI2A 2DQRA 4IXAA 4AWXB 4LG0B 1FYLA 2K27A 1FT9A 4I01A 3GW2A 1PDNC 3BWGA 2UXNA 1ON2A 2EFOA 5D5WB 4FHTA 3KP4A 2OZUA 4U0YA 2LSOA 1E17A 3B02A 3TO9A 2MD5A 3REOA 1ODDA 3WU1B 1P4WA 2W25A 3JAMK 1FBUA 2HOEA 2KJCA 4ESFA 3VB2A 1SFUA 3KP3A 5D6FA 4Q47A 4LD5A 2HDCA 1Z9CA 4EM0B 4BH9A 4CGZA 1S3JA 2UXXA 2V6CA 1OKRA 1S6LA 4WF2A 3ABTA 2V9VA 3MFKA 5CVVA 4IHSA 1I6XA 2CFXA 3NRVA 3HYIA 2ZMEB 3SHFA 1T6SA 4XSXF 4UVBA 1XB4A 2VODA 2PFBA 2FSWA 3RPUA 2Y75A 2NS0A 2AXLA 2M1BA 4N9HA 1R1UA 5HS9A 4LB6B 4LK1F 2DO7A 2M5WA 1CF7B 4LJZF 3KZYA 4YFNF 2GQQA 4FX4A 3IWZA 3E5UA 3BDDA 2H6CA 3VFZA 1MKMA 4HBLA 1C0WA 3RKWA 3E6CC 2FOKA 2ZKZA 4JK1X 1K78A 1IAWA 3WG9A 4HLYA 4Q5SF 2R7FA 3JAMZ 3H3ZA 3BPXA 2LDUA 2EV5A 4RGRA 1MDMB 3GUDA 1XDUA 5DYMA 4UV8A 3QPHA 1O3TA 3B73A 5K5QA 4R1HA 2P6SA 2IA1A 2LF8A 4BHPA 4G7OF 3ML6A 4HV6A 5K5OA 3DEUA 4WXHA 3HTUA 4G6QA 5DEQA 3K0LA 1SMTA 4MEYF 4ZYHA 3GVAA 4G6DA 2NRAC 2QBYB 1BBYA 1EH8A 4QWQA 4M72A 4F7ZA 1R58A 1ZG3A 4L0ZB 4AIHA 3F23A 2HYGD 2P6TA 3MWMA 3HSRA 2DTRA 3Q9SA 4RGUA 2XUBA 2J5OA 5K5RA 3GEZA 2KIUA 2RV8A 5LHGA 3JSPA 2IJLA 3MZYA 2H6BA 2VC1A 2UZKA 3F21A 1R7JA 4GGGA 5JVTA 1JXSA 3KEOA 1HW5A 4EJWA 1YW7A 2W84A 1T0FA 5AIPA 4I0BA 3J81K 5E18F 3T8RA 3FWEA 1VTNC 5L3CA 4HX8A 2XRNA 3I58A 4U0WA 2HTJA 2ZFWA 2FNAA 3DP7A 3M1EA 2DBBA 5LHIA 4WK8F 1ZLKA 2PJPA 1IXRC 4ENNA 2DI3A 2QENA 5ERIA 3V8KA 1O3RA 3HUGA 2A6HF 4HW0A 1EH7A 2IA0A 2HZTA 1YTYA 3FMRA 2EA4A 3Q9VA 4OIRF 4I09A 1IZ1A 1LB2A 4XSZF 3DPTA 1FZPB 2DT5A 2RVCA 2F5EA 1MGTA 2F2EA 3L9FA 2QM3A 2D2WA 1XMAA 4OIQF 1IW7F 2H94A 3K2ZA 1I1GA 3F72A 5CVRA 2O03A 4NHJA 4EMSA 1GXQA 4P9FA 2M45A 1JHFA 5IT9K 5DD4A 1KU3A 2YR2A 1LDDA 4Q4ZF 3O2PE 3BOQA 3EUHA 2H27A 3E5QA 4AVPA 1AOYA 2IW5A 4EJVA 5E1ZB 2G9WA 5E17F 3WTVC 1BJAA 3HSFA 2W85A 2WC2A 2K4JA 3KCCA 3V7CA 2YX4A 2FMYA 4S05A 5K1YA 2A3SA 4KFCA 4OMZA 4MQ9F 3ZP5A 2AS5F 3KP2A 1LDJA 1BN5A 4U88A 1REPC 4LG0A 3WGHA 4ZYDA 1O57A 1G3WA 3FXUA 4IRGA 4HLXA 3F8BA 3RI4A 3SXYA 5IT3A 2L4MA 3Q5FA 1J59A 3ZPLA 1OMIA 4GO1A 1J0RA 4WXDA 2STWA 5DDGA 1IN8A 1SD5A 3LA2A 4UUVA 2VBWA 4KIGA 4A0XA 4L0YB 3F8FA 4ENJA 3GLXA 1FOKA 2MLGA 3F22A 2P7VB 4A12A 5HLIA 1TBXA 5BMZA 5CLSA 4P55A 4M9SA 2BV6A 2NNYA 1RUNA 3FM3A 3F8NA 4IJAA 4L5IA 1DPRA 2ZMEA 1LNWA 3WTTC 4P96A 4A5NA 1IUYA 5LLQA 1QZZA 4ETSA 2QZ8A 1TTYA 2OU2A 1FLIA 2OQGA 1B9MA 1FC3A 3WTSC 5D5VB 4MTEA 1FY7A 3ECOA 1KQ0A 1XCBA 3M8FA 4ENMA 1OYYA 2P4WA 2J5PA 1IN4A 2MLKA 2TDXA 1CF7A 4RGSA 2O6GE 1R1VA 3RIRA 2FBKA 2GIVA 2V1UA 3KETA 5BOXA 3ZMZA 3WU0A 2FRHA 3R4KA 1B6AA 3HOSA 2BE5F 3GO5A 4M73A 2EV6A 3HHGA 4XLPF 2FU4A 2VBZA 1IXCA 4TV7A 1ZG1A 4HV5A 3WE2A 1MJ9A 5LGTA 2ACJA 1MDMA 4RB1A 5EEHA 2FMLA 3RYRA 1YS6A 4ZYEA 3LQQA 2Y48A 3GXOA 3F8MA 5HS7A 3J80K 1IF1A 2FNPA 3V7SA 5F6FA 1S7OA 5ILVA 5CVJA 1IN6A 3WTYC 4IVNA 2GXBA 2IT0A 2MH2A 1ZN2A 2CYYA 5DCFA 3ZMTA 4M6YA 3MCZA 1FP1D 5HS8A 2L54A 3ROUA 4UVAA 4KIFA 2QBYA 2ZJ2A 3KP6A 5LGUA 1FPQA 3R0AA 5AIQA 1DDNA 3ISPA 4IRIA 3VOEA 2M8EA 5JI6A 2VOPA 3BPVA 4LMYA 1P6RA 1FYKA 5D4SA 3LAJA 3EYIA 4A5MA 1Z6RA 3ERED 5DUIA 4Q48A 3K1PA 2C6YA 5F64A 2QQ9A 2E1NA 2CQKA 2Z5UA 4MGRA 1TQMA 3RPQA 5HDNA 1FSHA 2D1VA 2EK5A 3E97A 4AD9A 2DW4A 2STTA 1A04A 4MEXF 5JHUA 2VN2A 5FB2A 2VE8A 1W7PB 5HOOA 2K7LA 4M71A 1FX7A 1KQ9A 2O8XA 1D3YA 3M9AA 1HSJA 3DXJF 3IRQA 3F6OA 1U8RA 3SQNA 2HR3A 2PBIA 4O5VA 3OV8A 5ICGA 2W57A 4R79A 4YG2F 3WTXC 2HYFA 1RIOH 2BBYA 3RJPA 1IN5A 2OZ6A 3ULQB 4GYGA 3L7WA 3T8TA 1ZAOA 2ESHA 3H92A 2XKPA 5DV5A 4N0BA 4ESBA 1JHHA 2RGVA 1P4AA 1YYVA 3KLOA 1B4AA 2KIFA 3ZMUA 2DLLA 4RB0A 4KUMA 1RI7A 2JPBA 1BOAA 3DV8A 4KIBA 1XD7A 2L01A 1YG2A 3TQNA 3HRSA 2WV0A 4P9UA 1TNSA 2HFHA 4YIFA 2QQBA 2VBYA 4WCGA 1KU2A 3E6DA 3GFJA 5J8CA 2ZNYA 2K02A 3GFLA 1G4DA 4KN7X 2HS5A 3WODF 3GFIA 3TDUC 1IN7A 3F8CA 3OOPA 3FM5A 3CJNA 2HEOA 1KGSA 1DUXC 1XCVA 3G3ZA 3I5UA 2F5CA 1WSUA 4O3MA 3GF2A 5HLGA 3FZVA 5E8GA 1YFHA 3E6BA 4HX7A 2PEXA 4L5JA 4L18B 4MQVA 2RNJA 4IPAA 2ESNA 1TQPA 2P5VA 1J7KA 3EQLF 3LA3A 1G3TA 2FE3A 4I7HA 3JTHA 1QGPA 1IRGA 4BAYA 4Y13A 1K7AA 4JQFA 4HF2A 1MD0A 4MNUA 1S7AA 4G9YA 3BJAA 5CVUA 5JFRA 4A0ZA 1I5ZA 2OQRA 1BC8C 2ZNZA 2X4HA 4PGHA 2VC0A 3DQVC 3V8LA 1YS7A 3E6MA 1YW8A 4RB3C 6PAXA 4KN4X 3HOTA 3P9KA 3CUQB 2JPCA 5D8KB 2PN6A 2P8TA 1HW1A 1HSTA 3DFGA 2JZYA 1YIOA 2K86A 5FD5A 1Z7UA 2RN7A 2XROA 3ZMSA 2H09A 1RNLA 2XHKA 3ZN0A 5CYVA 1D8JA 1L3LA 4ENKA 1EH6A 1K79A 3KP7A 4G94A 3H3UA 1I27A 2CSOA 2EA2A 2GAUA 4RS8A 4ZZLA 1W7PD 2O61A 4K2EA 3FF5A 3BZ6A 3FHZA 2Q2EA 3TGNA 2E7WA 2YSRA 3M7GA 2Y0MA 3P9IA 2DK8A 2VT3A 3C3WA 1T2KA 1D8KA 1HXDA 1P92A 1Z1DA 2L4AA 1ZRFA 1FP2A 1L0OC 3DKWA 4KDPA 3QOPA 2FF4A 5E1XA 3DF8A 4EV0A 3QU6A 1NHAA 1JGSA 1YLFA 2JT1A 3J81Z 2A61A 2KJBA 2KRFA 1ULYA 4D0PA 1BI3A 5CJ9A 5KVRA 4LLGF 2FBHA 3HIFA 1W4MA 2QLZA 5LEKA 1LEAA 1J5YA 2IA2A 2VT2A 3GZ6A 1WRJA 4YIIA 5TJJA 1XMKA 4HOBA 5FD6A 1ZGJA 1KYWA 2XKOA 3CUOA 4M9ZA 1B1BA 3RTRA 1U2WA 2XIGA 3DPLC 3FXQA 3TKYA 2HQRA 4OINF 2W24A 1LDKB 5FO5A 4E70A 1U6GA 3FMSA 2ZBKA 4B09A 3QAHA 5L3BA 1WQ2A 5HLHA 3I64A 3JTGA 2A69F 4CZZA 5ILSA 5HDKA 1ZRCA 1ZGAA 1QQIA 2KKOA 2PG4A 2BEOA 1W7PA 5HDGA 1BIAA 2XVCA 4G7HF 2HQNA 1SAXA 4HX4A 3K1NA 2GWRA 3SZPA 2X0LA 3ELKA 3GFMA 4EJOA 1MJBA 2GZWA 5IT9Z 4DQ2A 4OMYA 2ISYA 1LJ9A 3HRMA 4UV9A 1TNTA 1H9GA 1R23A 2G7HA 1FBQA 2RQPA 2F5DA 4QLCU 1LQ1A 3HRTA 1DP7P 3LA7A 2P5KA 2IVMA 1UHMA 4A0YA 3CO6C 1P2FA 2PLYA 4RB2C 5L3GA 4KNYA 1F5TA 1U5TB 1FBSA 3T5XA 2HKXA 1OPCA 4AIKA 3ABUA 3R60A 1XSDA 2A68F 1T98A 1DPUA 4KYWA 1BM9A 1G3SA 2Q0OA 1TW3A 3KFWX 4IF4A 1UCRA 4UXNA 1HKSA 2MBFA 3C7JA 5H6QA 2HKOA 1S8NA 4M9XA 4EM2A 3PFIA 2PQ8A 1ZARA 1ON1A 2VOOA 4BHCA 1FWZA 2KIMA 1ZLJA 2F5FA 4A6DA 2O0YA 1Y0UA 4UNOA 3SFZA 4JBAA 4R8HA 1XSXA 2E7XA 4YFKF 2V1XA 4U7DA 1MJAA 2ETHA 3ZQ7A 3TOAA 3U1DA 1RZ4A 5ICFA 2EB7A 2BYVE 1B59A 2QQAA 4LFUA 4YFXF 3R6SA 5BPDA 1OR7A 3VODA 3QRFF 3J7AO 1J9IA 1Z05A 4LK0F 1B9NA 2RC4A 1SD7A 4XRFA 4EM1A 4FX0A 1QBJA 3PQKA 5DUKA 1V3FA 4BXUA 2Q8KA 4NQWA 2ISZA 1WKMA 3KP5A 4WX9A 4PGGA 2OAZA 3MQ0A 2M87A 2EFNA 2P5LC 1IXSB 4L9NA 4HDUA 3KZZA 3LQRA 2IRFG 2A5YB 3CUQA 3P7NA 5FFXA 3BY6A 3KLNA 3J80Z 3JW4A 2YX7A 5ED4A 2IPQX 1XGNA 1QPMA 4CICA 2NAZA 2VONA 2XAHA 1XDSA 5DD8A 3HHHA 5BS6A 1BI1A 1J2XA 2EFPA 3O6BB 2DAOA 1EV7A 4Z2YA 3V8JA 3QPTA 3W6KB 3S2WA 3BJOA 5EEGA 1HQCA 2FEZA 2EWNA 3IC7A 5D5XB 5CVIA 1GVJA 4PCQA 2BGCA 1PP7U 5H20A 4OOIA 4LGWA 1H0MA 2Z9OA 3RYPA 5AONA 3K1MA 4OU0A 3LFKA 1R22A 3HRUA 2OA4A 5LHHA 2UWMA 2Z99A 1ZREA 4ASNA 3TO6A 1W5TA 4GYIA 1YO5C 2Z3YA 3QU3A 3SZTA 1G3YA 5DCMB 1T38A 2QUFA 2LF7A 5ILUA 3RKXA 3EYYA 4HZFA 3I53A 2RDPA 1HBXG 3HSEA 1KU7A 2ZO4A 2EV0A 2CGPA 1D5VA 2DU9A 5E8IA 1O3QA 2LNBA 2L3DA 3O3KA 3R61A 2NYXA 1J75A 2Z33A 4P5OA 3PQJA 1F1ZA 3L09A 2K4BA 5JR3A 4LB5A 2FQ3A 2JSCA 2YPRA 3T0YA 4KMUX 1KYZA 3N97A 2MH9A 4HQEA 2XAGA 2OD5A 4Y15A 1X3UA 3KE2A 5FLXK 4CXFA 2XAQA 5LRRA 3WTWC 2E1CA 4L9TA 4MTDA 4HQMA 2YU3A 1Z91A 3FX3A 3BP8A 2DPUA 5J8FA 1CGPA 5FGMA 1U78A 3CTAA 1TQIA 2JRTA 1FNNA 1SMYF 4FT8A 1ZHFA 2MC3A 3I59B 4DNCA 5D5UB 4LLNA 3T1BA 1ZG5A 2HGCA 4HF1A 4ON0A 1WWXA 3TO7A 3EETA 4M74A 4RGXA 2EFWA 3I71A 3C1DA 1ZH5A 3IKTA 1IRFA 1O7LA 2GXGA 4G8XA 4CO8A 3AAFA 1USSA 1YQAA 2ADUA 4U0VA 2V1DA 2WTEA 1U5TC 2LKPA 4KICA 2DPDA 1HKQA 3I4PA 4OIOF 1R00A 1SFXA 2CG4A 1ZYRF 4EJTA 4NB5A 1UB9A 4EVIA 1R5GA 1HW2A 5BPIA 1LVAA 4HA8A 1YW9A 1F9NA 1V4RA 2VE9A 1BI0A 5A2QK 4ESJA 3EDPA 2QWWA 4I2OA 1U5TA 5FLXZ 1WI9A 4I0AA 4EGZA 2ZXJA 4IRHA 2RKHA 3ZMVA 3WE3A 2OBPA 2CW0F 4L9JA 3ZN1A 1F4KA 4XLNF 2PMUA 4RAZA 4WXCA 3CDHA 1W5SA 5J6XA 3P9CA 2B0LA 5TRDA 5FFZA 4L9VA 2FXAA 3L00A 3RKYA 4UVCA 2CWEA 3HTSB 4A6EA 3W6JB 3BROA 5LGNA 3F6VA 3R0JA 2M30A 2QYOA 4HDVA 4ZYGA 3E5XA 4ZZDA 2NNNA 2DFIA 2HTSA 5L3FA 5LEJA 3IHUA 2FA5A 3NQOA 3FMQA 4Y17A 1Q1HA 5BQTA 5A2QZ 3TDZC 1PUEE 3MAJA 3V4GA 4CDGA 3CO7C 4OIPF 2A07F 5H6RA 1KA8A 4UHTA 1STZA 3QP5A 3IRRA 1Z6TA 4AIJA 4HF0A 2CO5A 3U9GA 4BQAA 1GXPA 3COAC 1K78B 4A2UA 3I54A 1XSVA 1FYMA 3ECHA 3C18A 1P4XA 3WTZA 4EJUA 3G73A 1R1TA 1XN7A 1GHCA 3GZ5A 4I02A 3E3VA 4PZJA 2XGXA 1FSEA 3L2CA 1S29A 1ONVA 1UHWA 2DK5A 4KA4A 4I98B 1OYWA 2JTVA 1I1SA 5ICEA 1XGMA 3VEPA 1K6OA 1PP8F 4BNCA 3LSTA 2ELHA 2R3SA 2GA1A 1U3EM 1T39A 1SD4A 4GCVA 4LLLA 5E20A 3GWZA 2ZCWA 5HVQC 2WWYA 2R7DA 3GX4X 1TW2A 2XASA 3NEUA 3QP6A 4O6JA 2PI0A 5LRSA 4H0EA 4RAYA 1O7FA 4CYDA 1OYIA 3U2RA 2XAJA 2PMHA 4GXOA 4CHUA 3M8EA 2L02A 3F3XA 4XBFA 1TLHB 4KT5C 5D6EA 3WTUC 4G7ZF 1BC7C 2GA2A 3K9TA 1HKTA 1AWCA 1BIBA 1LEBA 1UFMA 3I0TA 2MA3A 3JSOA 3N4MA 4M6XA 4BHBA 4MHGA 1XGSA 2VXZA 5D8LB 1QO0D 4N9IA 5DCMA 1G6NA 1QZYA 3WGIA 4WWCA 2EFQA 4IHTA 2VBXA 4S04A 1SD6A 4HYEA 1ZRDA 1XGOA 3IL2A 3MEXA 4U7BA 2FBIA 2P7CB 4BYYA 1KU9A 5D4RA 2D1HA 2EJRA 3LWFA 2A6EF 3LAPA 3TOBA 3D5LA 4KMFA 2D45A 1USTA 1KQ8A 3KEQA 3K69A 4EQQA 3MZHA 4B8XA 3CLOA 1SFEA 3V7RA 3BJ6A 5KK1A 4ZH4F 2DQLA 3FXRA 3IKVA 2QVOA 4HAMA 3I59A 5L3EA 3GYHX 1E2XA 2IP2A 1R5HA 2HWVA 5F1RA 3CUQC 1H9TA 2XV4S 3RDIA 2COMA 1JE8A 4PDKA 5E1WA 3WGGA 2O3FA 2G7UA 1R36A 1QNTA 5L3DA 1RUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LBQ A;  4EGY A;  2V79 A;  3D0S A;  5ICC A;  1O3S A;  3ZMD A;  2XAF A;  1MZB A;  3IWF A;  1BI2 A;  2DQR A;  4IXA A;  4AWX B;  4LG0 B;  1FYL A;  2K27 A;  1FT9 A;  4I01 A;  3GW2 A;  1PDN C;  3BWG A;  2UXN A;  1ON2 A;  2EFO A;  5D5W B;  4FHT A;  3KP4 A;  2OZU A;  4U0Y A;  2LSO A;  1E17 A;  3B02 A;  3TO9 A;  2MD5 A;  3REO A;  1ODD A;  3WU1 B;  1P4W A;  2W25 A;  3JAM K;  1FBU A;  2HOE A;  2KJC A;  4ESF A;  3VB2 A;  1SFU A;  3KP3 A;  5D6F A;  4Q47 A;  4LD5 A;  2HDC A;  1Z9C A;  4EM0 B;  4BH9 A;  4CGZ A;  1S3J A;  2UXX A;  2V6C A;  1OKR A;  1S6L A;  4WF2 A;  3ABT A;  2V9V A;  3MFK A;  5CVV A;  4IHS A;  1I6X A;  2CFX A;  3NRV A;  3HYI A;  2ZME B;  3SHF A;  1T6S A;  4XSX F;  4UVB A;  1XB4 A;  2VOD A;  2PFB A;  2FSW A;  3RPU A;  2Y75 A;  2NS0 A;  2AXL A;  2M1B A;  4N9H A;  1R1U A;  5HS9 A;  4LB6 B;  4LK1 F;  2DO7 A;  2M5W A;  1CF7 B;  4LJZ F;  3KZY A;  4YFN F;  2GQQ A;  4FX4 A;  3IWZ A;  3E5U A;  3BDD A;  2H6C A;  3VFZ A;  1MKM A;  4HBL A;  1C0W A;  3RKW A;  3E6C C;  2FOK A;  2ZKZ A;  4JK1 X;  1K78 A;  1IAW A;  3WG9 A;  4HLY A;  4Q5S F;  2R7F A;  3JAM Z;  3H3Z A;  3BPX A;  2LDU A;  2EV5 A;  4RGR A;  1MDM B;  3GUD A;  1XDU A;  5DYM A;  4UV8 A;  3QPH A;  1O3T A;  3B73 A;  5K5Q A;  4R1H A;  2P6S A;  2IA1 A;  2LF8 A;  4BHP A;  4G7O F;  3ML6 A;  4HV6 A;  5K5O A;  3DEU A;  4WXH A;  3HTU A;  4G6Q A;  5DEQ A;  3K0L A;  1SMT A;  4MEY F;  4ZYH A;  3GVA A;  4G6D A;  2NRA C;  2QBY B;  1BBY A;  1EH8 A;  4QWQ A;  4M72 A;  4F7Z A;  1R58 A;  1ZG3 A;  4L0Z B;  4AIH A;  3F23 A;  2HYG D;  2P6T A;  3MWM A;  3HSR A;  2DTR A;  3Q9S A;  4RGU A;  2XUB A;  2J5O A;  5K5R A;  3GEZ A;  2KIU A;  2RV8 A;  5LHG A;  3JSP A;  2IJL A;  3MZY A;  2H6B A;  2VC1 A;  2UZK A;  3F21 A;  1R7J A;  4GGG A;  5JVT A;  1JXS A;  3KEO A;  1HW5 A;  4EJW A;  1YW7 A;  2W84 A;  1T0F A;  5AIP A;  4I0B A;  3J81 K;  5E18 F;  3T8R A;  3FWE A;  1VTN C;  5L3C A;  4HX8 A;  2XRN A;  3I58 A;  4U0W A;  2HTJ A;  2ZFW A;  2FNA A;  3DP7 A;  3M1E A;  2DBB A;  5LHI A;  4WK8 F;  1ZLK A;  2PJP A;  1IXR C;  4ENN A;  2DI3 A;  2QEN A;  5ERI A;  3V8K A;  1O3R A;  3HUG A;  2A6H F;  4HW0 A;  1EH7 A;  2IA0 A;  2HZT A;  1YTY A;  3FMR A;  2EA4 A;  3Q9V A;  4OIR F;  4I09 A;  1IZ1 A;  1LB2 A;  4XSZ F;  3DPT A;  1FZP B;  2DT5 A;  2RVC A;  2F5E A;  1MGT A;  2F2E A;  3L9F A;  2QM3 A;  2D2W A;  1XMA A;  4OIQ F;  1IW7 F;  2H94 A;  3K2Z A;  1I1G A;  3F72 A;  5CVR A;  2O03 A;  4NHJ A;  4EMS A;  1GXQ A;  4P9F A;  2M45 A;  1JHF A;  5IT9 K;  5DD4 A;  1KU3 A;  2YR2 A;  1LDD A;  4Q4Z F;  3O2P E;  3BOQ A;  3EUH A;  2H27 A;  3E5Q A;  4AVP A;  1AOY A;  2IW5 A;  4EJV A;  5E1Z B;  2G9W A;  5E17 F;  3WTV C;  1BJA A;  3HSF A;  2W85 A;  2WC2 A;  2K4J A;  3KCC A;  3V7C A;  2YX4 A;  2FMY A;  4S05 A;  5K1Y A;  2A3S A;  4KFC A;  4OMZ A;  4MQ9 F;  3ZP5 A;  2AS5 F;  3KP2 A;  1LDJ A;  1BN5 A;  4U88 A;  1REP C;  4LG0 A;  3WGH A;  4ZYD A;  1O57 A;  1G3W A;  3FXU A;  4IRG A;  4HLX A;  3F8B A;  3RI4 A;  3SXY A;  5IT3 A;  2L4M A;  3Q5F A;  1J59 A;  3ZPL A;  1OMI A;  4GO1 A;  1J0R A;  4WXD A;  2STW A;  5DDG A;  1IN8 A;  1SD5 A;  3LA2 A;  4UUV A;  2VBW A;  4KIG A;  4A0X A;  4L0Y B;  3F8F A;  4ENJ A;  3GLX A;  1FOK A;  2MLG A;  3F22 A;  2P7V B;  4A12 A;  5HLI A;  1TBX A;  5BMZ A;  5CLS A;  4P55 A;  4M9S A;  2BV6 A;  2NNY A;  1RUN A;  3FM3 A;  3F8N A;  4IJA A;  4L5I A;  1DPR A;  2ZME A;  1LNW A;  3WTT C;  4P96 A;  4A5N A;  1IUY A;  5LLQ A;  1QZZ A;  4ETS A;  2QZ8 A;  1TTY A;  2OU2 A;  1FLI A;  2OQG A;  1B9M A;  1FC3 A;  3WTS C;  5D5V B;  4MTE A;  1FY7 A;  3ECO A;  1KQ0 A;  1XCB A;  3M8F A;  4ENM A;  1OYY A;  2P4W A;  2J5P A;  1IN4 A;  2MLK A;  2TDX A;  1CF7 A;  4RGS A;  2O6G E;  1R1V A;  3RIR A;  2FBK A;  2GIV A;  2V1U A;  3KET A;  5BOX A;  3ZMZ A;  3WU0 A;  2FRH A;  3R4K A;  1B6A A;  3HOS A;  2BE5 F;  3GO5 A;  4M73 A;  2EV6 A;  3HHG A;  4XLP F;  2FU4 A;  2VBZ A;  1IXC A;  4TV7 A;  1ZG1 A;  4HV5 A;  3WE2 A;  1MJ9 A;  5LGT A;  2ACJ A;  1MDM A;  4RB1 A;  5EEH A;  2FML A;  3RYR A;  1YS6 A;  4ZYE A;  3LQQ A;  2Y48 A;  3GXO A;  3F8M A;  5HS7 A;  3J80 K;  1IF1 A;  2FNP A;  3V7S A;  5F6F A;  1S7O A;  5ILV A;  5CVJ A;  1IN6 A;  3WTY C;  4IVN A;  2GXB A;  2IT0 A;  2MH2 A;  1ZN2 A;  2CYY A;  5DCF A;  3ZMT A;  4M6Y A;  3MCZ A;  1FP1 D;  5HS8 A;  2L54 A;  3ROU A;  4UVA A;  4KIF A;  2QBY A;  2ZJ2 A;  3KP6 A;  5LGU A;  1FPQ A;  3R0A A;  5AIQ A;  1DDN A;  3ISP A;  4IRI A;  3VOE A;  2M8E A;  5JI6 A;  2VOP A;  3BPV A;  4LMY A;  1P6R A;  1FYK A;  5D4S A;  3LAJ A;  3EYI A;  4A5M A;  1Z6R A;  3ERE D;  5DUI A;  4Q48 A;  3K1P A;  2C6Y A;  5F64 A;  2QQ9 A;  2E1N A;  2CQK A;  2Z5U A;  4MGR A;  1TQM A;  3RPQ A;  5HDN A;  1FSH A;  2D1V A;  2EK5 A;  3E97 A;  4AD9 A;  2DW4 A;  2STT A;  1A04 A;  4MEX F;  5JHU A;  2VN2 A;  5FB2 A;  2VE8 A;  1W7P B;  5HOO A;  2K7L A;  4M71 A;  1FX7 A;  1KQ9 A;  2O8X A;  1D3Y A;  3M9A A;  1HSJ A;  3DXJ F;  3IRQ A;  3F6O A;  1U8R A;  3SQN A;  2HR3 A;  2PBI A;  4O5V A;  3OV8 A;  5ICG A;  2W57 A;  4R79 A;  4YG2 F;  3WTX C;  2HYF A;  1RIO H;  2BBY A;  3RJP A;  1IN5 A;  2OZ6 A;  3ULQ B;  4GYG A;  3L7W A;  3T8T A;  1ZAO A;  2ESH A;  3H92 A;  2XKP A;  5DV5 A;  4N0B A;  4ESB A;  1JHH A;  2RGV A;  1P4A A;  1YYV A;  3KLO A;  1B4A A;  2KIF A;  3ZMU A;  2DLL A;  4RB0 A;  4KUM A;  1RI7 A;  2JPB A;  1BOA A;  3DV8 A;  4KIB A;  1XD7 A;  2L01 A;  1YG2 A;  3TQN A;  3HRS A;  2WV0 A;  4P9U A;  1TNS A;  2HFH A;  4YIF A;  2QQB A;  2VBY A;  4WCG A;  1KU2 A;  3E6D A;  3GFJ A;  5J8C A;  2ZNY A;  2K02 A;  3GFL A;  1G4D A;  4KN7 X;  2HS5 A;  3WOD F;  3GFI A;  3TDU C;  1IN7 A;  3F8C A;  3OOP A;  3FM5 A;  3CJN A;  2HEO A;  1KGS A;  1DUX C;  1XCV A;  3G3Z A;  3I5U A;  2F5C A;  1WSU A;  4O3M A;  3GF2 A;  5HLG A;  3FZV A;  5E8G A;  1YFH A;  3E6B A;  4HX7 A;  2PEX A;  4L5J A;  4L18 B;  4MQV A;  2RNJ A;  4IPA A;  2ESN A;  1TQP A;  2P5V A;  1J7K A;  3EQL F;  3LA3 A;  1G3T A;  2FE3 A;  4I7H A;  3JTH A;  1QGP A;  1IRG A;  4BAY A;  4Y13 A;  1K7A A;  4JQF A;  4HF2 A;  1MD0 A;  4MNU A;  1S7A A;  4G9Y A;  3BJA A;  5CVU A;  5JFR A;  4A0Z A;  1I5Z A;  2OQR A;  1BC8 C;  2ZNZ A;  2X4H A;  4PGH A;  2VC0 A;  3DQV C;  3V8L A;  1YS7 A;  3E6M A;  1YW8 A;  4RB3 C;  6PAX A;  4KN4 X;  3HOT A;  3P9K A;  3CUQ B;  2JPC A;  5D8K B;  2PN6 A;  2P8T A;  1HW1 A;  1HST A;  3DFG A;  2JZY A;  1YIO A;  2K86 A;  5FD5 A;  1Z7U A;  2RN7 A;  2XRO A;  3ZMS A;  2H09 A;  1RNL A;  2XHK A;  3ZN0 A;  5CYV A;  1D8J A;  1L3L A;  4ENK A;  1EH6 A;  1K79 A;  3KP7 A;  4G94 A;  3H3U A;  1I27 A;  2CSO A;  2EA2 A;  2GAU A;  4RS8 A;  4ZZL A;  1W7P D;  2O61 A;  4K2E A;  3FF5 A;  3BZ6 A;  3FHZ A;  2Q2E A;  3TGN A;  2E7W A;  2YSR A;  3M7G A;  2Y0M A;  3P9I A;  2DK8 A;  2VT3 A;  3C3W A;  1T2K A;  1D8K A;  1HXD A;  1P92 A;  1Z1D A;  2L4A A;  1ZRF A;  1FP2 A;  1L0O C;  3DKW A;  4KDP A;  3QOP A;  2FF4 A;  5E1X A;  3DF8 A;  4EV0 A;  3QU6 A;  1NHA A;  1JGS A;  1YLF A;  2JT1 A;  3J81 Z;  2A61 A;  2KJB A;  2KRF A;  1ULY A;  4D0P A;  1BI3 A;  5CJ9 A;  5KVR A;  4LLG F;  2FBH A;  3HIF A;  1W4M A;  2QLZ A;  5LEK A;  1LEA A;  1J5Y A;  2IA2 A;  2VT2 A;  3GZ6 A;  1WRJ A;  4YII A;  5TJJ A;  1XMK A;  4HOB A;  5FD6 A;  1ZGJ A;  1KYW A;  2XKO A;  3CUO A;  4M9Z A;  1B1B A;  3RTR A;  1U2W A;  2XIG A;  3DPL C;  3FXQ A;  3TKY A;  2HQR A;  4OIN F;  2W24 A;  1LDK B;  5FO5 A;  4E70 A;  1U6G A;  3FMS A;  2ZBK A;  4B09 A;  3QAH A;  5L3B A;  1WQ2 A;  5HLH A;  3I64 A;  3JTG A;  2A69 F;  4CZZ A;  5ILS A;  5HDK A;  1ZRC A;  1ZGA A;  1QQI A;  2KKO A;  2PG4 A;  2BEO A;  1W7P A;  5HDG A;  1BIA A;  2XVC A;  4G7H F;  2HQN A;  1SAX A;  4HX4 A;  3K1N A;  2GWR A;  3SZP A;  2X0L A;  3ELK A;  3GFM A;  4EJO A;  1MJB A;  2GZW A;  5IT9 Z;  4DQ2 A;  4OMY A;  2ISY A;  1LJ9 A;  3HRM A;  4UV9 A;  1TNT A;  1H9G A;  1R23 A;  2G7H A;  1FBQ A;  2RQP A;  2F5D A;  4QLC U;  1LQ1 A;  3HRT A;  1DP7 P;  3LA7 A;  2P5K A;  2IVM A;  1UHM A;  4A0Y A;  3CO6 C;  1P2F A;  2PLY A;  4RB2 C;  5L3G A;  4KNY A;  1F5T A;  1U5T B;  1FBS A;  3T5X A;  2HKX A;  1OPC A;  4AIK A;  3ABU A;  3R60 A;  1XSD A;  2A68 F;  1T98 A;  1DPU A;  4KYW A;  1BM9 A;  1G3S A;  2Q0O A;  1TW3 A;  3KFW X;  4IF4 A;  1UCR A;  4UXN A;  1HKS A;  2MBF A;  3C7J A;  5H6Q A;  2HKO A;  1S8N A;  4M9X A;  4EM2 A;  3PFI A;  2PQ8 A;  1ZAR A;  1ON1 A;  2VOO A;  4BHC A;  1FWZ A;  2KIM A;  1ZLJ A;  2F5F A;  4A6D A;  2O0Y A;  1Y0U A;  4UNO A;  3SFZ A;  4JBA A;  4R8H A;  1XSX A;  2E7X A;  4YFK F;  2V1X A;  4U7D A;  1MJA A;  2ETH A;  3ZQ7 A;  3TOA A;  3U1D A;  1RZ4 A;  5ICF A;  2EB7 A;  2BYV E;  1B59 A;  2QQA A;  4LFU A;  4YFX F;  3R6S A;  5BPD A;  1OR7 A;  3VOD A;  3QRF F;  3J7A O;  1J9I A;  1Z05 A;  4LK0 F;  1B9N A;  2RC4 A;  1SD7 A;  4XRF A;  4EM1 A;  4FX0 A;  1QBJ A;  3PQK A;  5DUK A;  1V3F A;  4BXU A;  2Q8K A;  4NQW A;  2ISZ A;  1WKM A;  3KP5 A;  4WX9 A;  4PGG A;  2OAZ A;  3MQ0 A;  2M87 A;  2EFN A;  2P5L C;  1IXS B;  4L9N A;  4HDU A;  3KZZ A;  3LQR A;  2IRF G;  2A5Y B;  3CUQ A;  3P7N A;  5FFX A;  3BY6 A;  3KLN A;  3J80 Z;  3JW4 A;  2YX7 A;  5ED4 A;  2IPQ X;  1XGN A;  1QPM A;  4CIC A;  2NAZ A;  2VON A;  2XAH A;  1XDS A;  5DD8 A;  3HHH A;  5BS6 A;  1BI1 A;  1J2X A;  2EFP A;  3O6B B;  2DAO A;  1EV7 A;  4Z2Y A;  3V8J A;  3QPT A;  3W6K B;  3S2W A;  3BJO A;  5EEG A;  1HQC A;  2FEZ A;  2EWN A;  3IC7 A;  5D5X B;  5CVI A;  1GVJ A;  4PCQ A;  2BGC A;  1PP7 U;  5H20 A;  4OOI A;  4LGW A;  1H0M A;  2Z9O A;  3RYP A;  5AON A;  3K1M A;  4OU0 A;  3LFK A;  1R22 A;  3HRU A;  2OA4 A;  5LHH A;  2UWM A;  2Z99 A;  1ZRE A;  4ASN A;  3TO6 A;  1W5T A;  4GYI A;  1YO5 C;  2Z3Y A;  3QU3 A;  3SZT A;  1G3Y A;  5DCM B;  1T38 A;  2QUF A;  2LF7 A;  5ILU A;  3RKX A;  3EYY A;  4HZF A;  3I53 A;  2RDP A;  1HBX G;  3HSE A;  1KU7 A;  2ZO4 A;  2EV0 A;  2CGP A;  1D5V A;  2DU9 A;  5E8I A;  1O3Q A;  2LNB A;  2L3D A;  3O3K A;  3R61 A;  2NYX A;  1J75 A;  2Z33 A;  4P5O A;  3PQJ A;  1F1Z A;  3L09 A;  2K4B A;  5JR3 A;  4LB5 A;  2FQ3 A;  2JSC A;  2YPR A;  3T0Y A;  4KMU X;  1KYZ A;  3N97 A;  2MH9 A;  4HQE A;  2XAG A;  2OD5 A;  4Y15 A;  1X3U A;  3KE2 A;  5FLX K;  4CXF A;  2XAQ A;  5LRR A;  3WTW C;  2E1C A;  4L9T A;  4MTD A;  4HQM A;  2YU3 A;  1Z91 A;  3FX3 A;  3BP8 A;  2DPU A;  5J8F A;  1CGP A;  5FGM A;  1U78 A;  3CTA A;  1TQI A;  2JRT A;  1FNN A;  1SMY F;  4FT8 A;  1ZHF A;  2MC3 A;  3I59 B;  4DNC A;  5D5U B;  4LLN A;  3T1B A;  1ZG5 A;  2HGC A;  4HF1 A;  4ON0 A;  1WWX A;  3TO7 A;  3EET A;  4M74 A;  4RGX A;  2EFW A;  3I71 A;  3C1D A;  1ZH5 A;  3IKT A;  1IRF A;  1O7L A;  2GXG A;  4G8X A;  4CO8 A;  3AAF A;  1USS A;  1YQA A;  2ADU A;  4U0V A;  2V1D A;  2WTE A;  1U5T C;  2LKP A;  4KIC A;  2DPD A;  1HKQ A;  3I4P A;  4OIO F;  1R00 A;  1SFX A;  2CG4 A;  1ZYR F;  4EJT A;  4NB5 A;  1UB9 A;  4EVI A;  1R5G A;  1HW2 A;  5BPI A;  1LVA A;  4HA8 A;  1YW9 A;  1F9N A;  1V4R A;  2VE9 A;  1BI0 A;  5A2Q K;  4ESJ A;  3EDP A;  2QWW A;  4I2O A;  1U5T A;  5FLX Z;  1WI9 A;  4I0A A;  4EGZ A;  2ZXJ A;  4IRH A;  2RKH A;  3ZMV A;  3WE3 A;  2OBP A;  2CW0 F;  4L9J A;  3ZN1 A;  1F4K A;  4XLN F;  2PMU A;  4RAZ A;  4WXC A;  3CDH A;  1W5S A;  5J6X A;  3P9C A;  2B0L A;  5TRD A;  5FFZ A;  4L9V A;  2FXA A;  3L00 A;  3RKY A;  4UVC A;  2CWE A;  3HTS B;  4A6E A;  3W6J B;  3BRO A;  5LGN A;  3F6V A;  3R0J A;  2M30 A;  2QYO A;  4HDV A;  4ZYG A;  3E5X A;  4ZZD A;  2NNN A;  2DFI A;  2HTS A;  5L3F A;  5LEJ A;  3IHU A;  2FA5 A;  3NQO A;  3FMQ A;  4Y17 A;  1Q1H A;  5BQT A;  5A2Q Z;  3TDZ C;  1PUE E;  3MAJ A;  3V4G A;  4CDG A;  3CO7 C;  4OIP F;  2A07 F;  5H6R A;  1KA8 A;  4UHT A;  1STZ A;  3QP5 A;  3IRR A;  1Z6T A;  4AIJ A;  4HF0 A;  2CO5 A;  3U9G A;  4BQA A;  1GXP A;  3COA C;  1K78 B;  4A2U A;  3I54 A;  1XSV A;  1FYM A;  3ECH A;  3C18 A;  1P4X A;  3WTZ A;  4EJU A;  3G73 A;  1R1T A;  1XN7 A;  1GHC A;  3GZ5 A;  4I02 A;  3E3V A;  4PZJ A;  2XGX A;  1FSE A;  3L2C A;  1S29 A;  1ONV A;  1UHW A;  2DK5 A;  4KA4 A;  4I98 B;  1OYW A;  2JTV A;  1I1S A;  5ICE A;  1XGM A;  3VEP A;  1K6O A;  1PP8 F;  4BNC A;  3LST A;  2ELH A;  2R3S A;  2GA1 A;  1U3E M;  1T39 A;  1SD4 A;  4GCV A;  4LLL A;  5E20 A;  3GWZ A;  2ZCW A;  5HVQ C;  2WWY A;  2R7D A;  3GX4 X;  1TW2 A;  2XAS A;  3NEU A;  3QP6 A;  4O6J A;  2PI0 A;  5LRS A;  4H0E A;  4RAY A;  1O7F A;  4CYD A;  1OYI A;  3U2R A;  2XAJ A;  2PMH A;  4GXO A;  4CHU A;  3M8E A;  2L02 A;  3F3X A;  4XBF A;  1TLH B;  4KT5 C;  5D6E A;  3WTU C;  4G7Z F;  1BC7 C;  2GA2 A;  3K9T A;  1HKT A;  1AWC A;  1BIB A;  1LEB A;  1UFM A;  3I0T A;  2MA3 A;  3JSO A;  3N4M A;  4M6X A;  4BHB A;  4MHG A;  1XGS A;  2VXZ A;  5D8L B;  1QO0 D;  4N9I A;  5DCM A;  1G6N A;  1QZY A;  3WGI A;  4WWC A;  2EFQ A;  4IHT A;  2VBX A;  4S04 A;  1SD6 A;  4HYE A;  1ZRD A;  1XGO A;  3IL2 A;  3MEX A;  4U7B A;  2FBI A;  2P7C B;  4BYY A;  1KU9 A;  5D4R A;  2D1H A;  2EJR A;  3LWF A;  2A6E F;  3LAP A;  3TOB A;  3D5L A;  4KMF A;  2D45 A;  1UST A;  1KQ8 A;  3KEQ A;  3K69 A;  4EQQ A;  3MZH A;  4B8X A;  3CLO A;  1SFE A;  3V7R A;  3BJ6 A;  5KK1 A;  4ZH4 F;  2DQL A;  3FXR A;  3IKV A;  2QVO A;  4HAM A;  3I59 A;  5L3E A;  3GYH X;  1E2X A;  2IP2 A;  1R5H A;  2HWV A;  5F1R A;  3CUQ C;  1H9T A;  2XV4 S;  3RDI A;  2COM A;  1JE8 A;  4PDK A;  5E1W A;  3WGG A;  2O3F A;  2G7U A;  1R36 A;  1QNT A;  5L3D A;  1RUO A; 
#chains in the Genus database with same CATH topology
 5LBQ A;  2QQ8 A;  4EGY A;  2V79 A;  3D0S A;  5ICC A;  2IXS A;  1O3S A;  3IAM 2;  3ZMD A;  5GPA A;  1IO2 A;  2XAF A;  5GP9 A;  3LSJ A;  3TP0 A;  4CCL A;  3H9Q A;  2K3P A;  1MZB A;  4ZDP A;  5IYD J;  4AU7 A;  3IWF A;  3SEZ A;  1S5L C;  1BI2 A;  2QF7 A;  4C3I J;  3CDI A;  2DQR A;  4IXA A;  2L7K A;  3FK7 A;  4PFO A;  1IGN A;  4AWX B;  4LG0 B;  2RQQ A;  1FYL A;  1V55 H;  2M7B A;  5M5Y J;  3CJT B;  2K27 A;  2L7Z A;  3AKZ A;  4A3F J;  3M3Y J;  1FT9 A;  5KAI C;  4I01 A;  4QPO A;  3GW2 A;  3QOE A;  1PDN C;  5EG0 A;  3BWG A;  2NOJ B;  2UXN A;  1ON2 A;  2EFO A;  4XRS A;  5D5W B;  4F92 B;  3L1P A;  4FHT A;  3KP4 A;  2OZU A;  3BT9 A;  4U0Y A;  2LSO A;  1E17 A;  3ZQG A;  3B02 A;  3TO9 A;  2MD5 A;  1MIJ A;  2DOE A;  3AG1 H;  3N05 A;  3REO A;  1ODD A;  3WU1 B;  1P4W A;  1OLT A;  2W25 A;  3GME A;  3VYR B;  3JAM K;  1FBU A;  1QHG A;  2HOE A;  2KJC A;  4ESF A;  1NG7 A;  3H9J A;  3VB2 A;  1SFU A;  1OCO H;  4A3E J;  4C3J J;  3ZQL A;  3KP3 A;  5D6F A;  1ZGW A;  4Q47 A;  4PK4 A;  4LD5 A;  3W6V A;  2HDC A;  1Z9C A;  4EM0 B;  4BH9 A;  1LE8 A;  4CGZ A;  2HDD A;  5KAF C;  1S3J A;  2KMU A;  5J4Y A;  2XSD C;  2UXX A;  5J1Y A;  2ZJR F;  2V6C A;  3IP4 B;  1OKR A;  1S6L A;  4WF2 A;  3ABT A;  1N77 A;  1RC9 A;  1X4P A;  1ETK A;  2V9V A;  3MFK A;  5CVV A;  4IHS A;  1I6X A;  3GLL A;  2M4K A;  2EZH A;  5C4J J;  2CFX A;  4HSR A;  3NRV A;  3HYI A;  4E4H A;  2QGU A;  2M9H A;  2ZME B;  3FXL A;  2ZB9 A;  3SHF A;  1T6S A;  2Z1D A;  5FKN A;  3BR3 A;  4XSX F;  2IGM A;  4BXX J;  4UVB A;  3PUF A;  4NC8 A;  2DA3 A;  1XB4 A;  3ZQQ A;  1WHU A;  2VOD A;  2PFB A;  2FSW A;  3RPU A;  3OL3 A;  4D5F A;  2Y75 A;  2NS0 A;  1R6R A;  4Y33 A;  2R7V A;  2AXL A;  2M1B A;  2LOO A;  2OUM A;  3IH2 A;  4N9H A;  1R1U A;  3NWS A;  1UJ8 A;  5HS9 A;  4LB6 B;  2I10 A;  4LK1 F;  3HDD A;  2DO7 A;  2M5W A;  4BXF A;  1CF7 B;  4LJZ F;  3KZY A;  3DKY A;  4YFN F;  2GQQ A;  1X1D A;  3S1M J;  1R4N B;  4FX4 A;  3IWZ A;  3E5U A;  2BHY A;  4XON A;  5CKT A;  1SC7 A;  1A31 A;  1HC8 A;  3BDD A;  3FHN A;  5FJ8 J;  2H6C A;  2MFZ A;  3VFZ A;  1MKM A;  1WJC A;  1UZC A;  4HBL A;  3LSP A;  3S1N J;  1C0W A;  3RKW A;  3E6C C;  2CQX A;  2FOK A;  2ZKZ A;  2BY1 A;  2W1O A;  4JK1 X;  2K9M A;  5F04 A;  1K78 A;  4B43 A;  1IAW A;  3WG9 A;  4HLY A;  5LD2 C;  2R7F A;  3JAM Z;  4Q5S F;  3H3Z A;  4FTH A;  3BPX A;  2LDU A;  4RDU A;  2EV5 A;  4RGR A;  2R5Z B;  1MDM B;  3GUD A;  3OOU A;  3QPS A;  3BTI A;  1XDU A;  2DJI A;  5DYM A;  4UV8 A;  3QPH A;  1O3T A;  3K4N A;  3B73 A;  3TBI A;  3FXM A;  5K5Q A;  4R1H A;  3KZI C;  2BXY A;  2P6S A;  1Y56 A;  2CUE A;  3GBG A;  2KIQ A;  4XN3 A;  2IA1 A;  2XPU A;  3ZQC A;  2LF8 A;  3GCM A;  1FIA A;  4ZC3 A;  3VDX A;  1XPX A;  1ZEL A;  4B4C A;  3OS0 A;  2R7O A;  1JGG A;  3CCE I;  1LKX A;  4BHP A;  4G7O F;  3ML6 A;  2WB1 N;  4HV6 A;  5K5O A;  2P0W A;  3DEU A;  3CCL I;  1LFB A;  5J47 A;  4WXH A;  3CME I;  5K7Z A;  4BDY A;  3HTU A;  2YUS A;  4PFP A;  4G6Q A;  5DEQ A;  3K0L A;  1SMT A;  4ZYA A;  4MEY F;  3CJR B;  4ZYH A;  2NXN B;  3GVA A;  4G6D A;  2NRA C;  2EH3 A;  2QBY B;  4A3G J;  2K9N A;  1BBY A;  2EZK A;  3IV5 A;  1LUJ B;  1EH8 A;  3MD2 A;  1X2N A;  4E6K G;  4QWQ A;  4M72 A;  2LY1 A;  4F7Z A;  1R58 A;  1ZG3 A;  3VWB A;  1MMN A;  1E3P A;  4L0Z B;  1Y0N A;  3CES A;  4AIH A;  1WJ5 A;  3F23 A;  2HYG D;  4UB6 C;  2WB1 A;  2P6T A;  4DYQ A;  3MWM A;  3HSR A;  2DTR A;  3Q9S A;  2KHM A;  4RGU A;  2XUB A;  2J5O A;  5K5R A;  4CSW A;  2ZJQ F;  3GEZ A;  1VF9 A;  2KIU A;  2RV8 A;  3CQZ J;  5LHG A;  3OYL A;  3BQY A;  3JSP A;  2IJL A;  4A3B J;  2JA2 A;  3MZY A;  2H6B A;  2VC1 A;  2BXZ A;  2VKH A;  4M3B A;  5IP7 J;  2CUZ A;  2UZK A;  4F93 B;  4BL0 B;  4BDZ A;  3F21 A;  4XLH A;  1R7J A;  2R7U A;  1Z0X A;  3C2G A;  4GGG A;  3D5R C;  5JVT A;  1JXS A;  3KEO A;  1HW5 A;  2X6O A;  4EJW A;  1HLV A;  1YW7 A;  3PIP F;  2KDO A;  2W84 A;  1T0F A;  5AIP A;  1WJA A;  5E3M A;  4V2F A;  4I0B A;  3J81 K;  2ZC2 A;  1X1B A;  5E18 F;  3T8R A;  2E1M C;  3FWE A;  4MLO A;  3FDY A;  1VTN C;  2DFF A;  5L3C A;  4E7I A;  5LFA A;  4HX8 A;  4B3A A;  2XRN A;  1VQO I;  3A02 A;  2ZSI B;  3I58 A;  4U0W A;  2HTJ A;  2ZFW A;  2E35 A;  4BE0 A;  2FNA A;  3DP7 A;  1MSF C;  3M1E A;  2DBB A;  2V26 A;  5LHI A;  3G1L A;  4WK8 F;  4NDL A;  1ZLK A;  2PJP A;  3ONQ A;  1IXR C;  4ENN A;  2DI3 A;  2QEN A;  5ERI A;  3V8K A;  1MMG A;  3NWT A;  3S14 J;  5EGO A;  5FLM J;  1O3R A;  3HUG A;  2A6H F;  4HW0 A;  2CFO A;  2V1N A;  1BOB A;  1EH7 A;  2IA0 A;  2HZT A;  3MKL A;  3FMR A;  2WY8 Q;  4RAF A;  4YRV A;  1YTY A;  3H3V K;  2EA4 A;  3BG7 A;  3Q9V A;  4OIR F;  4I09 A;  1IZ1 A;  1ACI A;  1LB2 A;  4XSZ F;  3DPT A;  3HKZ N;  1FZP B;  4PJJ A;  4C30 A;  2R5Y B;  4C2T A;  4DW6 A;  3L2U A;  3HOV J;  2DT5 A;  3RQ4 A;  5IOZ A;  4BJ6 C;  1JJ6 C;  2HDW A;  3K4K A;  2RVC A;  3HM5 A;  2F5E A;  2XAU A;  1BJZ A;  1K6Y A;  1MGT A;  2X1D A;  2P81 A;  2F2E A;  3D5S C;  3L9F A;  2K40 A;  3FBI B;  3K6G A;  3EUH C;  2QM3 A;  2D2W A;  4RBO A;  1XMA A;  2O7O A;  4BJ5 C;  4OIQ F;  1IW7 F;  2VKD A;  1R5I D;  3GTQ J;  2M0M A;  2H94 A;  3K2Z A;  1I1G A;  3F72 A;  5CVR A;  2XC7 A;  1VND A;  2O03 A;  3HKZ A;  3KX2 A;  4Y7N J;  2WAQ N;  4NHJ A;  2LH9 A;  4BGD A;  1A36 A;  5J40 A;  4EMS A;  1GXQ A;  3FIS A;  4P9F A;  1UEL B;  2IAI A;  2M45 A;  3SJM A;  4CH7 A;  4MFD A;  3OY9 A;  1JHF A;  5IT9 K;  5DD4 A;  1KU3 A;  4XRS G;  2YR2 A;  5C4X J;  1LDD A;  4A3D J;  2X51 A;  3CD6 I;  4Q4Z F;  3O2P E;  2AO9 A;  4BKX A;  1WH7 A;  3BOQ A;  3EUH A;  4DZJ A;  2H27 A;  3E5Q A;  3BTJ A;  4IHX A;  1OCT C;  4AVP A;  1AOY A;  2IW5 A;  3ESW B;  4EJV A;  5E1Z B;  2G9W A;  4N4O B;  5E17 F;  3WTV C;  3GTK J;  1BJA A;  3HSF A;  2W85 A;  2WC2 A;  4UUS B;  2BY0 A;  2K4J A;  4YIR X;  3OYD A;  2ELK A;  3KCC A;  4XLA A;  2KQR A;  3V7C A;  2XB0 X;  1G2H A;  1TWA J;  2YX4 A;  3G1O A;  4B1R A;  4G12 A;  4AYB N;  1JT0 A;  1B8I B;  4IOC F;  2OV7 A;  2FMY A;  5KNL A;  4S05 A;  2X48 A;  4CCO A;  2VJ5 A;  1EA3 A;  5K1Y A;  2MC4 A;  3J7Y J;  2A3S A;  4KFC A;  4OMZ A;  4GRI A;  3MKY B;  4MQ9 F;  3ZP5 A;  2AS5 F;  1V5F A;  4B47 A;  3CCJ I;  3KP2 A;  3JRG A;  5J1U A;  1LDJ A;  2EZI A;  2ZSH B;  1BN5 A;  2ID3 A;  2XF7 A;  4U88 A;  1REP C;  3BCA A;  3JRB A;  4LG0 A;  4II2 A;  3WGH A;  4ZYD A;  5B1B H;  1O57 A;  1G3W A;  3FXU A;  4IRG A;  5GAE J;  3DKX A;  5JHF A;  4KIS A;  3DTE A;  4HLX A;  2WAF A;  3HEF A;  1MND A;  3RKQ A;  2KL4 A;  2JSP A;  3F8B A;  3RI4 A;  1PYV A;  3SXY A;  5IT3 A;  2L4M A;  4P1W A;  3Q5F A;  1J59 A;  3ZPL A;  3S1Q J;  1SAN A;  1OMI A;  5K7H A;  2HQA A;  4GO1 A;  2LMD A;  2MD0 A;  2F4M B;  1MH4 A;  2DOA A;  1J0R A;  2HZD A;  4WXD A;  2VJI A;  5DDG A;  1IN8 A;  2L9R A;  2B9S A;  2STW A;  1SD5 A;  3LA2 A;  1VQ6 I;  4XOR A;  4UUV A;  2VBW A;  4KIG A;  4A0X A;  4CCJ A;  4V2G A;  4L0Y B;  2X1E A;  3F8F A;  1APL C;  3GLX A;  3SEQ A;  2XGC A;  3IH3 A;  4ENJ A;  4LIT A;  1FOK A;  2MLG A;  3F22 A;  4Y52 J;  1A6Q A;  4CCN A;  2VB6 A;  1VQ8 I;  2P7V B;  4A12 A;  3OSF A;  5HLI A;  3I55 I;  4BY7 J;  1TBX A;  3S93 A;  5BMZ A;  5CLS A;  3KYL A;  4P55 A;  1QPI A;  4M9S A;  2BV6 A;  2KRC A;  4M3G A;  4JYK A;  2NNY A;  2BW3 A;  1RUN A;  4IQ4 A;  2OTL I;  3FM3 A;  3ERM A;  1WCM J;  3F8N A;  4IJA A;  4L5I A;  1DPR A;  2ZME A;  1LNW A;  3BTC A;  4PJL A;  3WTT C;  4P96 A;  1EJ9 A;  4AM3 A;  4A5N A;  1IUY A;  5LLQ A;  1QZZ A;  1BA5 A;  4ZJZ A;  2CQQ A;  4ETS A;  3K2A A;  2QZ8 A;  2GM4 A;  1IV8 A;  1TTY A;  2OU2 A;  1FLI A;  2OQG A;  1B9M A;  1FC3 A;  4PUS A;  3WTS C;  5D5V B;  4MTE A;  1FY7 A;  3ECO A;  1KQ0 A;  1XCB A;  4A3K J;  4E7S A;  3M8F A;  4ENM A;  2LY2 A;  4F3Q A;  2Y9Z A;  1OQY A;  2CJJ A;  2DDB A;  1OYY A;  2P4W A;  4MO7 A;  2J5P A;  3HB9 A;  4J00 A;  2R7X A;  1OFC X;  1IN4 A;  2HVQ A;  2MLK A;  1ETV A;  4I99 C;  3DEW A;  2TDX A;  1CF7 A;  5FKO A;  4RGS A;  2DT6 A;  1YE9 A;  4IHV A;  3CCQ I;  2O6G E;  1R1V A;  2K9Q A;  4XKB A;  3RIR A;  2FBK A;  2GIV A;  2V1U A;  4GDF A;  3KET A;  5BOX A;  3C2B A;  3ZMZ A;  3WU0 A;  4DOZ A;  2FRH A;  3BR5 A;  3R4K A;  4RAG A;  4RA2 A;  2VPL A;  1B6A A;  3HOS A;  2BE5 F;  2DN0 A;  2E19 A;  3GO5 A;  4M73 A;  2EV6 A;  1PUF B;  1F36 A;  3HHG A;  4XLP F;  2FU4 A;  2EBI A;  2VBZ A;  2Q2E B;  1IXC A;  4TV7 A;  5HNH A;  2F4I A;  1ZG1 A;  2L9N A;  2OPT A;  2R7W A;  3MMY B;  4HV5 A;  3WE2 A;  1OCC H;  1MJ9 A;  4BQO A;  5LGT A;  2ACJ A;  1MDM A;  2R5Z A;  4RB1 A;  1XTA A;  5EEH A;  3K4C A;  1YX3 A;  2DJN A;  1DU6 A;  2FML A;  3RYR A;  3HOZ J;  1YS6 A;  1TWC J;  1UAA A;  4ZYE A;  2OJE D;  2Y48 A;  3CMM A;  3GXO A;  3LQQ A;  1JKO C;  3F8M A;  5HS7 A;  3J80 K;  3G2B A;  1IF1 A;  2FNP A;  3V7S A;  2MW8 A;  5F6F A;  1S7O A;  2W48 A;  3ZQF A;  5ILV A;  1A6I A;  5CVJ A;  3S8P A;  1IN6 A;  1KON A;  3KIO A;  4IVN A;  3WTY C;  2GXB A;  2IT0 A;  2MH2 A;  5F1J A;  2KDZ A;  1GDT A;  1ZN2 A;  4E7J A;  2CYY A;  5DCF A;  3ZMT A;  2QSF X;  4M6Y A;  3MCZ A;  4B3X A;  1FP1 D;  3L2W A;  1OJL A;  2VKV A;  4E7L A;  4HPQ A;  3HOW J;  5HS8 A;  2L54 A;  5DM6 F;  1TWH J;  3ROU A;  4UVA A;  1HCR A;  2LKS A;  4KIF A;  2E2H J;  1P7J A;  2QBY A;  3BR1 A;  4C2M J;  2A5W A;  2ZJ2 A;  3KP6 A;  5LGU A;  1FPQ A;  3R0A A;  5AIQ A;  1DDN A;  3ISP A;  5HLT A;  4IRI A;  1NG6 A;  2M8E A;  3VOE A;  5JI6 A;  3LNQ A;  2GIZ A;  3S16 J;  2VOP A;  3RPU D;  1SEU A;  3UR3 C;  3PM1 A;  3BPV A;  4LMY A;  1O4X A;  3CMY A;  1P6R A;  1FYK A;  2RRE A;  3AL0 C;  4IHW A;  5D4S A;  3LAJ A;  3EYI A;  3OMY A;  4A5M A;  4HNV A;  1Z6R A;  2CRG A;  3ERE D;  5DUI A;  4Q48 A;  1RES A;  3HPG A;  2AQF A;  4C9Y A;  2VL8 A;  3S2D J;  3K1P A;  2D5V A;  2LD5 A;  2EIK H;  2C6Y A;  5B5E C;  5F64 A;  2QQ9 A;  2E1N A;  3S1R J;  2CQK A;  2Z5U A;  3SZG A;  1IDY A;  4JX4 A;  4J19 A;  4MGR A;  1TQM A;  1IRX A;  3RPQ A;  5HDN A;  1FSH A;  2D1V A;  3SYT A;  4BQQ A;  2EK5 A;  2IGK A;  5J1R A;  3E97 A;  4ABZ A;  4AD9 A;  2DW4 A;  3ZRG A;  2STT A;  3CLQ A;  4JOM A;  4QPQ A;  5EDN A;  1A04 A;  4MEX F;  1GV2 A;  1TT5 B;  5GAH J;  5JHU A;  2VN2 A;  4OWR B;  3AG4 H;  3WHC A;  5JLX A;  3BQZ A;  5FB2 A;  4X1E A;  2VE8 A;  1EKE A;  1W7P B;  2ZXI A;  3TW6 A;  4M3E A;  4YEL A;  4ANJ A;  2R0Q C;  1VQ5 I;  5HOO A;  3BG9 A;  1H88 C;  2K7L A;  2O9L A;  4M71 A;  1FX7 A;  5EYR A;  1KQ9 A;  2O8X A;  2BVM A;  2XGD A;  1D3Y A;  3A0H C;  3M9A A;  2JK3 A;  1HSJ A;  3DXJ F;  1Y6I A;  2LVS A;  3NAR A;  3IRQ A;  3I4M J;  3OYI A;  3F6O A;  4HNT A;  1E3O C;  2HYJ A;  4HST A;  2DA2 A;  4ITV A;  4A3J J;  1U8R A;  1GVD A;  4AID A;  3SQN A;  2JA7 J;  2CV2 A;  1UG2 A;  1R71 A;  2HR3 A;  2XRL A;  2PBI A;  2V7F A;  2M0C A;  4X6A J;  2Y31 A;  2Y0S N;  1JUS A;  2NVY J;  4QIW N;  4O5V A;  2JVG A;  2M34 A;  3OV8 A;  3PNY A;  5ICG A;  2W57 A;  1T8I A;  2R5Y A;  3OR1 C;  4R79 A;  2NVQ J;  4YG2 F;  1JUP A;  3WTX C;  2HYF A;  4B48 A;  4DIQ A;  1RIO H;  2BBY A;  3RJP A;  4CA0 A;  1JKQ C;  1IN5 A;  3W3C A;  1FMV A;  2OZ6 A;  3ULQ B;  2R7S A;  4GYG A;  3L7W A;  3T8T A;  1ZAO A;  3QOD A;  3A01 B;  5IP9 J;  1T08 B;  2ESH A;  3H92 A;  1K61 A;  2XKP A;  5DV5 A;  1NTC A;  1HA8 A;  4N0B A;  3S15 J;  4ESB A;  1XC5 A;  2Y0S A;  3BZK A;  1JHH A;  1VZ0 A;  2RGV A;  1P4A A;  1YYV A;  2F4O B;  3MN2 A;  3JRH A;  3HGY A;  4KT6 A;  2DMT A;  3KLO A;  1B4A A;  2KIF A;  5TIS C;  3ZMU A;  3EUA A;  1LFU P;  1RR8 C;  5M3F J;  2DLL A;  4NC7 A;  4RB0 A;  4F55 A;  4KUM A;  1RI7 A;  3PIO F;  2JPB A;  1BOA A;  1MBG A;  3B6A A;  3DV8 A;  4KIB A;  1XD7 A;  2KFD A;  3OL4 A;  2FX0 A;  2M2E A;  4FET A;  2L01 A;  1YG2 A;  2MAB A;  3TQN A;  3HRS A;  2WV0 A;  4P9U A;  4E7K A;  1OCZ H;  1TNS A;  2HFH A;  4YIF A;  2QQB A;  2VBY A;  3M07 A;  2JMW A;  4WCG A;  4A3M J;  2JA6 J;  3BLY A;  4Z6Y A;  1KU2 A;  1RKT A;  3JRI A;  4BBS J;  3E6D A;  3GFJ A;  2L2O A;  2LP0 A;  5J8C A;  1N78 A;  2ZNY A;  2K02 A;  3GFL A;  4UUS A;  1G4D A;  4KN7 X;  3TED A;  2RAE A;  2HS5 A;  2WBM A;  2LK2 A;  3WOD F;  2FUG 2;  3GFI A;  3TDU C;  3DTK A;  1X19 A;  5FKL A;  1IN7 A;  2A05 A;  2HI3 A;  3F8C A;  3OOP A;  3FM5 A;  4BUP A;  2E5N A;  1B8I A;  2H1K A;  3CJN A;  3OYM A;  2HEO A;  1KGS A;  4BE1 A;  3J7Z I;  1DUX C;  1BW5 A;  1XCV A;  3HG9 A;  3G3Z A;  3I5U A;  1P7I A;  3FIW A;  2F5C A;  1WSU A;  4O3M A;  3GF2 A;  2VKE A;  2BY3 A;  4MFE A;  3FZV A;  5E8G A;  5HLG A;  3E6B A;  5HNF A;  3U21 A;  1YFH A;  1MH3 A;  1ETW A;  4AUX A;  4HX7 A;  2PEX A;  2VJ4 A;  4L5J A;  5CQE A;  4L18 B;  3HXL A;  4MQV A;  2RNJ A;  1GLN A;  3K4B A;  2JVH A;  4BY1 J;  4IPA A;  1T0F C;  2WAD A;  2ESN A;  3LSK A;  1TQP A;  1UG0 A;  2P5V A;  1J7K A;  5KHD A;  2DOF A;  3EQL F;  3LA3 A;  3CMA I;  1G3T A;  3LMM A;  2FE3 A;  3K70 D;  4I7H A;  1Z67 A;  3JTH A;  2KZG A;  5F0H A;  4KIT B;  1QGP A;  2NVU B;  3ZQI A;  1IRG A;  4BAY A;  4Y13 A;  2TCT A;  1K7A A;  4IKF A;  1S9H A;  2Q1Z B;  1D1A A;  5E3O A;  3CC2 I;  3HBL A;  1DGW Y;  4JQF A;  4HF2 A;  3RZD J;  1MD0 A;  4MNU A;  1S7A A;  1X3W B;  2XF6 A;  3BJA A;  4G9Y A;  2IS1 A;  2B7E A;  5CVU A;  5JFR A;  2K9L A;  4A0Z A;  1I5Z A;  2LBF B;  2OQR A;  1BC8 C;  3G71 I;  3BTL A;  1MSE C;  4DGW B;  1W0U A;  3JRC A;  4NQW B;  4X0G A;  2ZNZ A;  2X4H A;  4PGH A;  1Y8Q B;  2VC0 A;  3JR9 A;  3DQV C;  1YX5 A;  1YS7 A;  4XLC A;  3E6M A;  3H5R A;  3V8L A;  1R49 A;  1YW8 A;  4RB3 C;  3K4L A;  1ZQ3 P;  6PAX A;  4KN4 X;  3HOT A;  4RLF A;  2VQL A;  1VQ9 I;  4OAY A;  3P9K A;  3CUQ B;  3CCR I;  2JPC A;  5D8K B;  1SVM A;  1FOY A;  2PN6 A;  2P8T A;  2DDA A;  2DYS H;  1HW1 A;  1HST A;  3DFG A;  4G6T B;  2W82 A;  2CUF A;  2ID6 A;  1Z3X A;  1JUM A;  1VQK I;  2JZY A;  1YIO A;  2K86 A;  2VJJ A;  5FD5 A;  3JCU C;  1Z7U A;  2RN7 A;  1QZE A;  3DLA A;  2XRO A;  1ETX A;  3ZMS A;  3K70 C;  2JA8 J;  2H09 A;  1YIJ I;  1RNL A;  2XHK A;  3ZN0 A;  3CJQ B;  5CYV A;  3SFI A;  1SFO J;  1D8J A;  1L3L A;  4ENK A;  3KPH A;  1EH6 A;  1U0J A;  1K79 A;  4NBQ A;  3ZGK A;  2DTZ A;  5B66 C;  3KP7 A;  4G94 A;  3JRA A;  3H3U A;  1I27 A;  2JUC A;  2CSO A;  2EA2 A;  2GAU A;  5GAG J;  1NH3 A;  1GUU A;  3K7A J;  4RS8 A;  2CS3 A;  2R7Q A;  2LRE A;  4ZZL A;  4IL6 C;  1W7P D;  2O61 A;  1PUF A;  3RQI A;  4K2E A;  3FF5 A;  3BZ6 A;  2XB5 A;  3FHZ A;  2Q2E A;  1WPK A;  3TGN A;  2E7W A;  2YSR A;  1MBK A;  3KYC B;  1I6H J;  1FIP A;  2Y0M A;  3M7G A;  3P9I A;  3WHB A;  3Q3S A;  2AXT C;  3I3L A;  2DK8 A;  1PVE A;  3ZOB A;  4HNU A;  2VT3 A;  3C3W A;  1T2K A;  1YRN B;  1DP3 A;  2NVX J;  4A3C J;  1D8K A;  1HXD A;  1P92 A;  4A3L J;  2OTJ I;  1Z1D A;  4I76 A;  3BC8 A;  2L4A A;  1ZRF A;  2NVT J;  3FKJ A;  1FP2 A;  1L0O C;  3DKW A;  3GTL J;  3CDL A;  4KDP A;  3QOP A;  2FF4 A;  1X1C A;  5E1X A;  2UV1 A;  3DF8 A;  4EV0 A;  3QU6 A;  1NHA A;  1JGS A;  1YLF A;  2IBD A;  2JT1 A;  2PJR B;  3J81 Z;  1KZH A;  3E0J B;  3QWL A;  1Y39 A;  2A61 A;  4C3H J;  4H4K C;  2X6Y A;  2KJB A;  4LG3 A;  2KRF A;  2ELJ A;  2DA5 A;  1ULY A;  4D0P A;  1BI3 A;  3RSN A;  5CJ9 A;  4XLE A;  5KVR A;  4LLG F;  3ZCO A;  3KEY A;  4XK4 A;  2FBH A;  3HIF A;  1W4M A;  1LPQ A;  2HQ5 A;  1Y8R B;  2QLZ A;  5LEK A;  1LEA A;  1J5Y A;  1H89 C;  1VQL I;  2QSG X;  5K7F A;  1DU0 A;  2IA2 A;  2VT2 A;  3GZ6 A;  1WRJ A;  4ZDL A;  4YII A;  5TJJ A;  3OIO A;  1XMK A;  1YIT I;  2E34 A;  4HOB A;  1AKH B;  5FD6 A;  1IV6 A;  1X1A A;  2LKX A;  3CP2 A;  1FJL A;  3H5A A;  1ZGJ A;  4XOT A;  1OCP A;  1KYW A;  1WI3 A;  2XKO A;  3CUO A;  1G8X A;  1SFK A;  4M9Z A;  1B1B A;  2F5V A;  2KZV A;  1U2W A;  4LIV A;  2XIG A;  3RTR A;  3DPL C;  2PMZ A;  3FXQ A;  2BVL A;  3TKY A;  2HQR A;  5M5X J;  2LTP A;  3TL4 X;  4OIN F;  2W24 A;  1LDK B;  5FO5 A;  4E70 A;  3CCV I;  1U6G A;  1XS9 A;  4FE7 A;  3FMS A;  2ZBK A;  4B09 A;  3QAH A;  5L3B A;  1WQ2 A;  5HLH A;  2QEX I;  3I64 A;  3JTG A;  2HXO A;  3DU6 A;  2A69 F;  3LSM A;  4CZZ A;  5ILS A;  5HDK A;  3BCB A;  5TGT A;  2EZL A;  1ZRC A;  2HOT A;  1ZGA A;  5JLW A;  1QQI A;  2KKO A;  2PG4 A;  2BEO A;  1W7P A;  3BR0 A;  2JN6 A;  4XR6 A;  3OS2 A;  5HDG A;  1HOM A;  1BIA A;  2XVC A;  4G7H F;  2HQN A;  2ZME C;  1SAX A;  4HX4 A;  3OYE A;  2DYR H;  1Q1V A;  2X1C A;  4J01 A;  2Z16 A;  5C44 J;  2K85 A;  3K1N A;  1XMX A;  2GWR A;  3SZP A;  2X0L A;  3ELK A;  3GFM A;  3D1N I;  1D0Y A;  4EJO A;  2CV0 A;  2QCO A;  3EUK L;  4FAS D;  5HOD A;  5FRM A;  1DQU A;  1K83 J;  1MJB A;  2GZW A;  5IT9 Z;  1ZR2 A;  4DQ2 A;  4OMY A;  4V19 K;  2ISY A;  3MKZ A;  1LJ9 A;  3HRM A;  5CPR B;  4UV9 A;  3FXJ A;  4XRM A;  1LVK A;  1TNT A;  1H9G A;  3DCF A;  1R23 A;  1MBJ A;  4MIM A;  2G7H A;  3A1Y A;  5H2F C;  1FBQ A;  2L7M P;  2LLK A;  2RQP A;  2F5D A;  3QQA A;  4QLC U;  1LQ1 A;  2FJ1 A;  3HRT A;  3Q0U A;  1DP7 P;  3LA7 A;  3GTJ J;  2P5K A;  2DXI A;  2IVM A;  1UHM A;  4A0Y A;  3CO6 C;  1FTT A;  1P2F A;  4A93 J;  2KRH A;  2LY9 A;  1JKP C;  2COB A;  1VQP I;  2PLY A;  4RB2 C;  3FBN B;  4JX6 A;  5L3G A;  3UKG A;  2EIM H;  4KNY A;  3A01 A;  1AHD P;  1F5T A;  2M7A A;  4D7M A;  1U5T B;  1FBS A;  3T5X A;  3GTM J;  5GTI C;  2HKX A;  1OPC A;  4AIK A;  2CV1 A;  2O5R A;  3ABU A;  4JX5 A;  4XQF A;  3R60 A;  5FKK A;  1XSD A;  2A68 F;  2N8G A;  4FCY A;  2WAE A;  1T98 A;  1WVR A;  1DPU A;  4BAC A;  3OYF A;  5EJC A;  4KYW A;  3HOY J;  2JWT A;  1BM9 A;  1G3S A;  1QVU A;  2Q0O A;  1TW3 A;  1JTY A;  1MBF A;  1A35 A;  3KFW X;  2O8K A;  2KP6 A;  2W4S A;  1TWF J;  3HZJ A;  4NNJ A;  2QKL B;  1YJN I;  4IF4 A;  4IOA F;  1UCR A;  4UXN A;  1N25 A;  1HKS A;  3I56 I;  2MBF A;  4ZTJ A;  3C7J A;  5H6Q A;  2E1O A;  2HKO A;  1S8N A;  3IUO A;  2IGO A;  4M9X A;  3FKI J;  1XX5 A;  4FIS A;  4EM2 A;  2HPM A;  3VSK A;  3PFI A;  2CQ7 A;  2DA7 A;  2GOM A;  1JI8 A;  2PQ8 A;  1ZAR A;  1ON1 A;  3OS1 A;  2E1M B;  2ZXW H;  1W5C C;  5IY5 H;  1U8B A;  2VOO A;  2V4J C;  4BHC A;  1FWZ A;  3OIQ A;  3FK6 A;  2KIM A;  3UNG C;  4D5C A;  4ZTF A;  1ZLJ A;  2F5F A;  2L9S A;  4A6D A;  2O0Y A;  1Y0U A;  3E1S A;  4F52 A;  2VQC A;  3LSI A;  4UNO A;  1FOX A;  3GTP J;  2M4G A;  3SFZ A;  3BR6 A;  3SDB A;  4JBA A;  4PJ0 C;  3H5N A;  4R8H A;  3PSF A;  1F43 A;  1XSX A;  2E7X A;  2MGQ A;  3DBL B;  3DPU A;  1WFX A;  3HOU J;  4YFK F;  3FXK A;  1RR7 A;  2V1X A;  2GBY A;  4U7D A;  5JVG F;  2JA5 J;  3JRE A;  1MJA A;  2JJ7 A;  2ETH A;  3ZQ7 A;  3S3M A;  4BBR J;  2E36 A;  1V5G A;  3TOA A;  3SDG A;  3U1D A;  1RZ4 A;  5ICF A;  2HVR A;  2EB7 A;  2BYV E;  1B59 A;  2QQA A;  3Q0W A;  4W1U A;  2ICW G;  4I6Z A;  4LFU A;  1TC3 C;  1MMD A;  5F08 A;  4YFX F;  3R6S A;  1SVL A;  5BPD A;  1OR7 A;  2V9K A;  3VOD A;  2EIN H;  3QRF F;  3J7A O;  1PJR A;  1WJD A;  1J9I A;  1B72 B;  2BHZ A;  1BW6 A;  1OCR H;  3DBR B;  3M8J A;  1Z05 A;  2M3A A;  4LK0 F;  1B9N A;  2RC4 A;  1FOW A;  1SD7 A;  2Y30 A;  4XRF A;  4EM1 A;  4FX0 A;  1SVO A;  3M4O J;  2L5Q A;  4RM3 A;  1IRZ A;  1MW7 A;  1YJW I;  1QBJ A;  3S3O A;  4GFB A;  3PQK A;  5E3N A;  2LG4 A;  2LBF A;  3JRF A;  2RNG A;  2R93 J;  2VPR A;  3QPL A;  4C2U A;  1VQN I;  5DUK A;  1V3F A;  4BXU A;  3M1C A;  2Q8K A;  4NQW A;  2ISZ A;  3LFU A;  1WKM A;  3KP5 A;  4WX9 A;  2FQ4 A;  2Y2Z A;  4PGG A;  2VLA A;  2OAZ A;  4B44 A;  2QA4 I;  3PUB A;  2OCE A;  3LSG A;  3A2K A;  2VAS A;  2M87 A;  3MQ0 A;  5EZG A;  2EFN A;  2P5L C;  1IXS B;  4L9N A;  4HDU A;  1I39 A;  3PSI A;  3CCM I;  3KZZ A;  3VSL A;  3LQR A;  2ZXH A;  3ASO H;  2IRF G;  2DA6 A;  4E7H A;  2A5Y B;  3CUQ A;  3H0G J;  2DFH A;  3P7N A;  5FFX A;  3BY6 A;  3KLN A;  2X85 A;  4LOC A;  3ZR8 X;  4FQG A;  3J80 Z;  2DA4 A;  1N75 A;  2UUZ A;  3JW4 A;  4XN0 A;  3RCO A;  2YX7 A;  3I9V 2;  4PJM A;  5ED4 A;  4CCM A;  4DBR A;  3AG3 H;  2IPQ X;  1XGN A;  1QPM A;  3PO3 J;  2VIX A;  4CIC A;  3A0B C;  3B6C A;  1TWG J;  2GLO A;  2NAZ A;  2VON A;  1Z7L A;  2XAH A;  3G4S I;  1XDS A;  5DD8 A;  1SAU A;  1W1W E;  3HHH A;  3VPR A;  5BS6 A;  1BI1 A;  3DBH B;  3DWL E;  5FRN A;  1J2X A;  3VYT B;  4BU2 A;  2EFP A;  3O6B B;  2DAO A;  1EV7 A;  2H8R A;  2HOS A;  4Z2Y A;  3V8J A;  3L2V A;  1TZL A;  3QPT A;  3W6K B;  1D1C A;  3S2W A;  3BG6 A;  3BJO A;  5EEG A;  1HQC A;  2FEZ A;  3JRD A;  2EWN A;  4DYC A;  3IC7 A;  5D5X B;  2H8W A;  1GVJ A;  4PCQ A;  2BGC A;  4XOP A;  5CVI A;  1PP7 U;  3U1K A;  1H8A C;  5H20 A;  2CW7 A;  1D0X A;  3DEE A;  4LGW A;  4OOI A;  4BS9 A;  1H0M A;  4RM2 A;  2Z9O A;  2NS7 A;  3RYP A;  5AON A;  2R7Z J;  2BW3 B;  4XKC A;  4XLF A;  5F27 A;  3K1M A;  4OU0 A;  3LFK A;  4CYC B;  1R22 A;  4F91 B;  3HRU A;  2BZT A;  2OA4 A;  5LHH A;  3LSR A;  2UWM A;  2OF7 A;  2Z99 A;  1YRN A;  4XID A;  1ZRE A;  4ASN A;  3TO6 A;  3DU5 A;  3O8G A;  1W5T A;  2I5U A;  2XDV A;  4GYI A;  1YO5 C;  2Z3Y A;  3MKW B;  3H9G A;  5FRO A;  1LFP A;  2EQR A;  3QU3 A;  3SZT A;  3GZN B;  3QYE A;  3MVP A;  2R7T A;  1G3Y A;  4IZZ A;  5DCM B;  4M3F A;  1T38 A;  2QUF A;  1VFC A;  2R92 J;  2LF7 A;  5ILU A;  4BEH B;  3LSH A;  3RKX A;  3EYY A;  2IS2 A;  3PNV A;  4HZF A;  2PJR A;  4OAZ A;  3I53 A;  1ORK A;  2RDP A;  1HBX G;  3HSE A;  1KU7 A;  2QKM B;  2ZO4 A;  2EV0 A;  4E7Z A;  2CGP A;  1D5V A;  2DU9 A;  2JUG A;  3NAU A;  4IX7 A;  5E8I A;  1RPW A;  2BOL A;  1O3Q A;  2LNB A;  2L3D A;  3O3K A;  3R61 A;  5BNG A;  3ZQH A;  2DT7 B;  3H1C A;  2NYX A;  1J75 A;  4IO9 F;  2Z33 A;  1IC8 A;  4P5O A;  3PQJ A;  1F1Z A;  3L09 A;  2K4B A;  5JR3 A;  4LB5 A;  1V5E A;  2FQ3 A;  2JSC A;  1WJB A;  2YPR A;  4YEJ A;  3T0Y A;  4KMU X;  4S0H B;  1I3A A;  1KYZ A;  5DM7 F;  3N97 A;  2MH9 A;  3TW7 A;  3PFY A;  1AKH A;  3HPH A;  4HQE A;  2XAG A;  2OD5 A;  4Y15 A;  1X3U A;  2L9V A;  3KE2 A;  5M3M J;  5FLX K;  1ZTR A;  3RZO J;  4CXF A;  2Y9Y A;  2E71 A;  1ETQ A;  2XAQ A;  3CC7 I;  5LRR A;  3WTW C;  2E1C A;  5F0C A;  3W2V A;  3OR2 C;  4L9T A;  4MTD A;  2F6C A;  4HQM A;  2YU3 A;  1S72 I;  1Z91 A;  9ANT A;  3FX3 A;  1IG7 A;  2V9P A;  4A69 C;  5GAD J;  3BP8 A;  2DPU A;  4Y3O A;  5J8F A;  1CGP A;  3ASN H;  5FGM A;  1U78 A;  2GXA A;  1E3H A;  1Z77 A;  3CTA A;  1TQI A;  2JRT A;  1FNN A;  1SMY F;  4FT8 A;  1IUF A;  1ZHF A;  2MC3 A;  3CCS I;  4IHY A;  3I59 B;  4DNC A;  5D5U B;  4LLN A;  3T1B A;  1ZG5 A;  2HGC A;  2WY7 Q;  2XSJ C;  2ZFU A;  3QYF A;  1Z3Y A;  4M6V A;  4ON0 A;  4HF1 A;  1WWX A;  2KPM A;  4XMY A;  2YU9 J;  5F0F A;  5CQG A;  3S3N A;  3CZ6 A;  3TO7 A;  3C2H A;  3EET A;  2KIS A;  4M74 A;  4RGX A;  2EFW A;  3I71 A;  3C1D A;  4RMN A;  3L2R A;  1ZH5 A;  1I50 J;  2I8D A;  2K3F A;  3IKT A;  3CF5 F;  1IRF A;  1O7L A;  2GXG A;  4G8X A;  3DTI A;  4CO8 A;  1UMQ A;  1USS A;  3OYC A;  3AAF A;  1OIS A;  1YQA A;  2L7F P;  5B1A H;  2IS4 A;  1MMA A;  2E5Z A;  4XNF A;  2ADU A;  4U0V A;  2V1D A;  2WTE A;  1U5T C;  2LKP A;  4KIC A;  3QYB A;  2DPD A;  3X2Q H;  1HKQ A;  2MG4 A;  1NK2 P;  3I4P A;  4OIO F;  1R00 A;  1SFX A;  2CG4 A;  1ZYR F;  4EJT A;  3BR2 A;  4NB5 A;  1UB9 A;  4EVI A;  2DMU A;  1R5G A;  4NUB A;  4KJZ A;  1HW2 A;  5BPI A;  2CMP A;  4DZP A;  1VQ7 I;  1LVA A;  4XL9 A;  3A4C A;  2ECB A;  2X6X A;  4HA8 A;  5IYB J;  1BL0 A;  2CQN A;  3V42 A;  1YW9 A;  1F9N A;  2YS9 A;  1V4R A;  2VE9 A;  3EPZ A;  1BI0 A;  5A2Q K;  3J7A Y;  2HNH A;  4ESJ A;  1T95 A;  3EDP A;  2AHQ A;  2OC6 A;  2XF5 A;  5EG0 B;  3S17 J;  2QWW A;  5GTH C;  4UUT A;  4I2O A;  1U5T A;  5FLX Z;  3WU2 C;  1WI9 A;  3H36 A;  3AL0 B;  3H35 A;  1W36 D;  4I0A A;  4EGZ A;  2Y69 H;  1QU3 A;  4ZDO A;  5J3L A;  2ZXJ A;  5EF6 A;  4IRH A;  2RKH A;  4AC0 A;  3ZMV A;  3WE3 A;  2OBP A;  4D7N A;  2DCE A;  4RLQ A;  2CW0 F;  4L9J A;  3ZN1 A;  1F4K A;  4XLN F;  2V6E A;  2PMU A;  4RAZ A;  2K9S A;  4WXC A;  1QRY A;  1R9T J;  3CDH A;  4CCK A;  1W5S A;  5J6X A;  3P9C A;  2B0L A;  1I3Q J;  5FFZ A;  5TRD A;  3F0C A;  4HG2 A;  1LE8 B;  4L9V A;  2EPF A;  5B3S H;  2FXA A;  3L00 A;  2IEK A;  4PJN A;  3RKY A;  4II3 A;  4UVC A;  4XKW A;  2CWE A;  3S2H J;  1M1E B;  5EEA A;  1VQ4 I;  5IPA A;  1D0Z A;  2E2J J;  3HTS B;  4A6E A;  2NOG A;  4LIU A;  2JRM A;  4A3I J;  1V54 H;  3W6J B;  2KT0 A;  3BRO A;  5LGN A;  2IGN A;  1T56 A;  3F6V A;  1RRJ A;  3R0J A;  2M30 A;  2E60 A;  1IDZ A;  2QYO A;  1RET A;  4UB8 C;  1VQM I;  4HDV A;  4EEF G;  3IAS 2;  4ZYG A;  3E5X A;  1JJ8 C;  5KCM A;  4ZZD A;  2VUM J;  1D1B A;  4QTR A;  3HC7 A;  2NNN A;  5M5W J;  2DFI A;  2HTS A;  5DTD A;  5L3F A;  5LEJ A;  2ZJP F;  3IHU A;  1EF4 A;  1ETO A;  1FMW A;  2FA5 A;  1ERD A;  4DBQ A;  2Z2S B;  4W97 A;  1HDD C;  3NQO A;  1W36 C;  2HU9 A;  3H0D A;  3OYG A;  3FMQ A;  4Y17 A;  1K4S A;  4AVZ A;  1Q1H A;  5IOY A;  5BQT A;  5A2Q Z;  1DGR M;  4HEA 2;  3K4M A;  3GTO J;  4IEJ A;  1P9Q C;  1WH5 A;  3TDZ C;  4CZC A;  1X4O A;  2PMZ N;  3CC4 I;  1X3Z B;  1PUE E;  3MAJ A;  3V4G A;  4CDG A;  3CO7 C;  1Z21 A;  2CU7 A;  4IQJ A;  1W0T A;  2A07 F;  4OIP F;  1JT6 A;  3OIP A;  3CCU I;  5H6R A;  3HL2 A;  4HRI A;  1KA8 A;  4UHT A;  1STZ A;  1TT0 A;  3QP5 A;  3IRR A;  1Z6T A;  1YOV B;  3VYS B;  3L2Q A;  4AIJ A;  4HF0 A;  1R4M B;  2CO5 A;  3U9G A;  1HDP A;  4BQA A;  1GXP A;  3COA C;  3OYN A;  2L0K A;  1B72 A;  1K78 B;  4A2U A;  1VI0 A;  3I54 A;  1XSV A;  2HXI A;  1FYM A;  2WAQ A;  2LYC A;  3ECH A;  3C18 A;  1ETY A;  1QHH D;  2FD5 A;  2B63 J;  1P4X A;  3WTZ A;  4EJU A;  2CUJ A;  1WJF A;  2X9D A;  3G73 A;  3BG5 A;  1R1T A;  2CH0 A;  4DJA A;  3G1M A;  1QVT A;  1XN7 A;  1GHC A;  3GZ5 A;  4I02 A;  3E3V A;  4PZJ A;  2R7R A;  1T33 A;  1BR1 A;  1CQT A;  2XGX A;  1NK3 P;  1FSE A;  3ABM H;  3L2C A;  1S29 A;  2CW8 A;  2VQH A;  5GPC A;  1WZ2 A;  1ONV A;  1QA6 A;  3A03 A;  1UHW A;  2DK5 A;  4KA4 A;  4I98 B;  2WA0 A;  3IH4 A;  1BR4 A;  4CUG A;  3PO2 J;  1MMS A;  1OYW A;  2JTV A;  2VXD A;  3PL8 A;  4EAT A;  5IYC J;  3HOX J;  2JQ7 A;  1I1S A;  5ICE A;  1GV5 A;  1XGM A;  3VEP A;  1K6O A;  2XGE A;  1PP8 F;  1E0E A;  4BNC A;  2ECC A;  3LST A;  2ELH A;  2R3S A;  2GA1 A;  1D5Y A;  3BZC A;  2DMN A;  1U3E M;  3DLL F;  1YJ9 I;  1YHQ I;  1SD4 A;  1T39 A;  2HVS A;  4AYB A;  2H1L A;  2BY2 A;  2OCC H;  2XPW A;  4GCV A;  4LLL A;  2GOX B;  2LC2 A;  3CP8 A;  3WG7 H;  1X2M A;  5E20 A;  3GWZ A;  1FEX A;  3OYK A;  2PX9 A;  1AA7 A;  2ZCW A;  3LOC A;  5HVQ C;  4D9J A;  1RKW A;  2WV1 A;  1XG1 A;  5DS9 A;  3PJR A;  2WWY A;  4M3D A;  2LR8 A;  2R7D A;  3G6E I;  1TP4 A;  3MZ8 A;  2QSH X;  3GX4 X;  3AFH A;  1TW2 A;  4QSH A;  2XAS A;  3NEU A;  2DFE A;  4N4N B;  1G59 A;  3QP6 A;  4O6J A;  2PI0 A;  5LRS A;  4H0E A;  4RAY A;  1O7F A;  4CYD A;  3VYU B;  3CCY A;  4XM3 A;  1OYI A;  1HF0 A;  3OYB A;  3HGG A;  3U2R A;  2XAJ A;  2G0E A;  2PMH A;  5E3L A;  4GXO A;  4CHU A;  3M8E A;  2IS6 A;  4XKV A;  2L02 A;  2VQG A;  3F3X A;  2FOW A;  4XBF A;  1TLH B;  4KT5 C;  5D6E A;  3ZXS A;  4FE4 A;  3WTU C;  5FKM A;  3I4N J;  4G7Z F;  1GT0 C;  1K4T A;  1BC7 C;  2R4G A;  2HOA A;  3Q0V A;  3P5J A;  1WGX A;  2GA2 A;  3K9T A;  1U9O A;  1HKT A;  1AWC A;  4CYC A;  1BIB A;  1LEB A;  1YI2 I;  1UFM A;  4BJT A;  3W2A A;  1WJE A;  3CF2 A;  3I0T A;  2MA3 A;  1Y1W J;  3JSO A;  4L5E A;  1IJW C;  1FTZ A;  4D1Q A;  4DYR A;  2DA1 A;  3N4M A;  4M6X A;  4BHB A;  4MHG A;  2M8G X;  2EIJ H;  1XGS A;  2VXZ A;  3ABL H;  5D8L B;  5J4V A;  1QO0 D;  4N9I A;  5DCM A;  1G6N A;  3K4J A;  1UHS A;  4BEH A;  1QZY A;  1TL8 A;  5FLV A;  4NC6 A;  3WGI A;  3BG3 A;  2MSY A;  4PSX A;  4WWC A;  2EFQ A;  4IHT A;  5EGO B;  3HUG B;  3K10 A;  2VBX A;  4S04 A;  2ME0 A;  1SD6 A;  3ABK H;  2HPI A;  4HYE A;  3OYJ A;  1ZRD A;  1XGO A;  2XPV A;  3MEX A;  4U7B A;  3OYH A;  2W00 A;  3IL2 A;  1AU7 A;  2FBI A;  2AQE A;  4PSW A;  2P7C B;  4BYY A;  1KU9 A;  1X1P A;  5D4R A;  2D1H A;  3S32 A;  3F9K A;  2EJR A;  1U9N A;  2DOD A;  1ZR4 A;  2TRT A;  3O8H A;  3OYA A;  4BE2 A;  4UY8 I;  1OR7 C;  3GTG J;  3LWF A;  2KLO A;  2VI6 A;  2A6E F;  3W2W A;  3LAP A;  1ZK8 A;  3TOB A;  3TP3 A;  3KYD B;  3HJE A;  3D5L A;  4KMF A;  2D45 A;  2LFB A;  1S7E A;  1ITY A;  3LL7 A;  2DMQ A;  2MYS A;  1UST A;  1MNE A;  1KQ8 A;  1Y1V J;  3KEQ A;  3K69 A;  1MNM C;  4EQQ A;  3MZH A;  4B8X A;  3CLO A;  1A5J A;  2A6T A;  1BR2 A;  1ZKG A;  1SFE A;  3V7R A;  3BJ6 A;  5KK1 A;  1POG A;  3FXO A;  4ZH4 F;  2ME6 A;  2DQL A;  3FXR A;  3OSG A;  1X58 A;  3IKV A;  1JTX A;  2QVO A;  4HAM A;  1J09 A;  3AG2 H;  3I59 A;  2NS8 A;  5L3E A;  4Y4R A;  3GYH X;  1E2X A;  2IP2 A;  1JKR C;  2K5C A;  3OWT A;  1R5H A;  2HWV A;  4BQN A;  5F1R A;  3TMO A;  5EZH A;  2LRD A;  3CUQ C;  1H9T A;  2XV4 S;  2E2I J;  1MBH A;  2DMP A;  1MBE A;  2EIL H;  3E7L A;  5IP6 A;  2F48 A;  3RDI A;  2COM A;  2X6W A;  1JE8 A;  4PDK A;  5E1W A;  3WGG A;  2O3F A;  5C3E J;  2G7U A;  4JP0 A;  1R36 A;  1ENH A;  4XIC A;  4U87 A;  1QNT A;  5L3D A;  1RUO A;  3PNT A;  5E79 C;  2W7N A; 
#chains in the Genus database with same CATH homology
 5LBQ A;  4EGY A;  2V79 A;  3D0S A;  5ICC A;  1O3S A;  3ZMD A;  2XAF A;  1MZB A;  3IWF A;  1BI2 A;  2DQR A;  4IXA A;  4AWX B;  4LG0 B;  1FYL A;  2K27 A;  1FT9 A;  4I01 A;  3GW2 A;  1PDN C;  3BWG A;  2UXN A;  1ON2 A;  2EFO A;  5D5W B;  4FHT A;  3KP4 A;  2OZU A;  4U0Y A;  2LSO A;  1E17 A;  3B02 A;  3TO9 A;  2MD5 A;  3REO A;  1ODD A;  3WU1 B;  1P4W A;  2W25 A;  3JAM K;  1FBU A;  2HOE A;  2KJC A;  4ESF A;  3VB2 A;  1SFU A;  3KP3 A;  5D6F A;  4Q47 A;  4LD5 A;  2HDC A;  1Z9C A;  4EM0 B;  4BH9 A;  4CGZ A;  1S3J A;  2UXX A;  2V6C A;  1OKR A;  1S6L A;  4WF2 A;  3ABT A;  2V9V A;  3MFK A;  5CVV A;  4IHS A;  1I6X A;  2CFX A;  3NRV A;  3HYI A;  2ZME B;  3SHF A;  1T6S A;  4XSX F;  4UVB A;  1XB4 A;  2VOD A;  2PFB A;  2FSW A;  3RPU A;  2Y75 A;  2NS0 A;  2AXL A;  2M1B A;  4N9H A;  1R1U A;  5HS9 A;  4LB6 B;  4LK1 F;  2DO7 A;  2M5W A;  1CF7 B;  4LJZ F;  3KZY A;  4YFN F;  2GQQ A;  4FX4 A;  3IWZ A;  3E5U A;  3BDD A;  2H6C A;  3VFZ A;  1MKM A;  4HBL A;  1C0W A;  3RKW A;  3E6C C;  2FOK A;  2ZKZ A;  4JK1 X;  1K78 A;  1IAW A;  3WG9 A;  4HLY A;  4Q5S F;  2R7F A;  3JAM Z;  3H3Z A;  3BPX A;  2LDU A;  2EV5 A;  4RGR A;  1MDM B;  3GUD A;  1XDU A;  5DYM A;  4UV8 A;  3QPH A;  1O3T A;  3B73 A;  5K5Q A;  4R1H A;  2P6S A;  2IA1 A;  2LF8 A;  4BHP A;  4G7O F;  3ML6 A;  4HV6 A;  5K5O A;  3DEU A;  4WXH A;  3HTU A;  4G6Q A;  5DEQ A;  3K0L A;  1SMT A;  4MEY F;  4ZYH A;  3GVA A;  4G6D A;  2NRA C;  2QBY B;  1BBY A;  1EH8 A;  4QWQ A;  4M72 A;  4F7Z A;  1R58 A;  1ZG3 A;  4L0Z B;  4AIH A;  3F23 A;  2HYG D;  2P6T A;  3MWM A;  3HSR A;  2DTR A;  3Q9S A;  4RGU A;  2XUB A;  2J5O A;  5K5R A;  3GEZ A;  2KIU A;  2RV8 A;  5LHG A;  3JSP A;  2IJL A;  3MZY A;  2H6B A;  2VC1 A;  2UZK A;  3F21 A;  1R7J A;  4GGG A;  5JVT A;  1JXS A;  3KEO A;  1HW5 A;  4EJW A;  1YW7 A;  2W84 A;  1T0F A;  5AIP A;  4I0B A;  3J81 K;  5E18 F;  3T8R A;  3FWE A;  1VTN C;  5L3C A;  4HX8 A;  2XRN A;  3I58 A;  4U0W A;  2HTJ A;  2ZFW A;  2FNA A;  3DP7 A;  3M1E A;  2DBB A;  5LHI A;  4WK8 F;  1ZLK A;  2PJP A;  1IXR C;  4ENN A;  2DI3 A;  2QEN A;  5ERI A;  3V8K A;  1O3R A;  3HUG A;  2A6H F;  4HW0 A;  1EH7 A;  2IA0 A;  2HZT A;  1YTY A;  3FMR A;  2EA4 A;  3Q9V A;  4OIR F;  4I09 A;  1IZ1 A;  1LB2 A;  4XSZ F;  3DPT A;  1FZP B;  2DT5 A;  2RVC A;  2F5E A;  1MGT A;  2F2E A;  3L9F A;  2QM3 A;  2D2W A;  1XMA A;  4OIQ F;  1IW7 F;  2H94 A;  3K2Z A;  1I1G A;  3F72 A;  5CVR A;  2O03 A;  4NHJ A;  4EMS A;  1GXQ A;  4P9F A;  2M45 A;  1JHF A;  5IT9 K;  5DD4 A;  1KU3 A;  2YR2 A;  1LDD A;  4Q4Z F;  3O2P E;  3BOQ A;  3EUH A;  2H27 A;  3E5Q A;  4AVP A;  1AOY A;  2IW5 A;  4EJV A;  5E1Z B;  2G9W A;  5E17 F;  3WTV C;  1BJA A;  3HSF A;  2W85 A;  2WC2 A;  2K4J A;  3KCC A;  3V7C A;  2YX4 A;  2FMY A;  4S05 A;  5K1Y A;  2A3S A;  4KFC A;  4OMZ A;  4MQ9 F;  3ZP5 A;  2AS5 F;  3KP2 A;  1LDJ A;  1BN5 A;  4U88 A;  1REP C;  4LG0 A;  3WGH A;  4ZYD A;  1O57 A;  1G3W A;  3FXU A;  4IRG A;  4HLX A;  3F8B A;  3RI4 A;  3SXY A;  5IT3 A;  2L4M A;  3Q5F A;  1J59 A;  3ZPL A;  1OMI A;  4GO1 A;  1J0R A;  4WXD A;  2STW A;  5DDG A;  1IN8 A;  1SD5 A;  3LA2 A;  4UUV A;  2VBW A;  4KIG A;  4A0X A;  4L0Y B;  3F8F A;  4ENJ A;  3GLX A;  1FOK A;  2MLG A;  3F22 A;  2P7V B;  4A12 A;  5HLI A;  1TBX A;  5BMZ A;  5CLS A;  4P55 A;  4M9S A;  2BV6 A;  2NNY A;  1RUN A;  3FM3 A;  3F8N A;  4IJA A;  4L5I A;  1DPR A;  2ZME A;  1LNW A;  3WTT C;  4P96 A;  4A5N A;  1IUY A;  5LLQ A;  1QZZ A;  4ETS A;  2QZ8 A;  1TTY A;  2OU2 A;  1FLI A;  2OQG A;  1B9M A;  1FC3 A;  3WTS C;  5D5V B;  4MTE A;  1FY7 A;  3ECO A;  1KQ0 A;  1XCB A;  3M8F A;  4ENM A;  1OYY A;  2P4W A;  2J5P A;  1IN4 A;  2MLK A;  2TDX A;  1CF7 A;  4RGS A;  2O6G E;  1R1V A;  3RIR A;  2FBK A;  2GIV A;  2V1U A;  3KET A;  5BOX A;  3ZMZ A;  3WU0 A;  2FRH A;  3R4K A;  1B6A A;  3HOS A;  2BE5 F;  3GO5 A;  4M73 A;  2EV6 A;  3HHG A;  4XLP F;  2FU4 A;  2VBZ A;  1IXC A;  4TV7 A;  1ZG1 A;  4HV5 A;  3WE2 A;  1MJ9 A;  5LGT A;  2ACJ A;  1MDM A;  4RB1 A;  5EEH A;  2FML A;  3RYR A;  1YS6 A;  4ZYE A;  3LQQ A;  2Y48 A;  3GXO A;  3F8M A;  5HS7 A;  3J80 K;  1IF1 A;  2FNP A;  3V7S A;  5F6F A;  1S7O A;  5ILV A;  5CVJ A;  1IN6 A;  3WTY C;  4IVN A;  2GXB A;  2IT0 A;  2MH2 A;  1ZN2 A;  2CYY A;  5DCF A;  3ZMT A;  4M6Y A;  3MCZ A;  1FP1 D;  5HS8 A;  2L54 A;  3ROU A;  4UVA A;  4KIF A;  2QBY A;  2ZJ2 A;  3KP6 A;  5LGU A;  1FPQ A;  3R0A A;  5AIQ A;  1DDN A;  3ISP A;  4IRI A;  3VOE A;  2M8E A;  5JI6 A;  2VOP A;  3BPV A;  4LMY A;  1P6R A;  1FYK A;  5D4S A;  3LAJ A;  3EYI A;  4A5M A;  1Z6R A;  3ERE D;  5DUI A;  4Q48 A;  3K1P A;  2C6Y A;  5F64 A;  2QQ9 A;  2E1N A;  2CQK A;  2Z5U A;  4MGR A;  1TQM A;  3RPQ A;  5HDN A;  1FSH A;  2D1V A;  2EK5 A;  3E97 A;  4AD9 A;  2DW4 A;  2STT A;  1A04 A;  4MEX F;  5JHU A;  2VN2 A;  5FB2 A;  2VE8 A;  1W7P B;  5HOO A;  2K7L A;  4M71 A;  1FX7 A;  1KQ9 A;  2O8X A;  1D3Y A;  3M9A A;  1HSJ A;  3DXJ F;  3IRQ A;  3F6O A;  1U8R A;  3SQN A;  2HR3 A;  2PBI A;  4O5V A;  3OV8 A;  5ICG A;  2W57 A;  4R79 A;  4YG2 F;  3WTX C;  2HYF A;  1RIO H;  2BBY A;  3RJP A;  1IN5 A;  2OZ6 A;  3ULQ B;  4GYG A;  3L7W A;  3T8T A;  1ZAO A;  2ESH A;  3H92 A;  2XKP A;  5DV5 A;  4N0B A;  4ESB A;  1JHH A;  2RGV A;  1P4A A;  1YYV A;  3KLO A;  1B4A A;  2KIF A;  3ZMU A;  2DLL A;  4RB0 A;  4KUM A;  1RI7 A;  2JPB A;  1BOA A;  3DV8 A;  4KIB A;  1XD7 A;  2L01 A;  1YG2 A;  3TQN A;  3HRS A;  2WV0 A;  4P9U A;  1TNS A;  2HFH A;  4YIF A;  2QQB A;  2VBY A;  4WCG A;  1KU2 A;  3E6D A;  3GFJ A;  5J8C A;  2ZNY A;  2K02 A;  3GFL A;  1G4D A;  4KN7 X;  2HS5 A;  3WOD F;  3GFI A;  3TDU C;  1IN7 A;  3F8C A;  3OOP A;  3FM5 A;  3CJN A;  2HEO A;  1KGS A;  1DUX C;  1XCV A;  3G3Z A;  3I5U A;  2F5C A;  1WSU A;  4O3M A;  3GF2 A;  5HLG A;  3FZV A;  5E8G A;  1YFH A;  3E6B A;  4HX7 A;  2PEX A;  4L5J A;  4L18 B;  4MQV A;  2RNJ A;  4IPA A;  2ESN A;  1TQP A;  2P5V A;  1J7K A;  3EQL F;  3LA3 A;  1G3T A;  2FE3 A;  4I7H A;  3JTH A;  1QGP A;  1IRG A;  4BAY A;  4Y13 A;  1K7A A;  4JQF A;  4HF2 A;  1MD0 A;  4MNU A;  1S7A A;  4G9Y A;  3BJA A;  5CVU A;  5JFR A;  4A0Z A;  1I5Z A;  2OQR A;  1BC8 C;  2ZNZ A;  2X4H A;  4PGH A;  2VC0 A;  3DQV C;  3V8L A;  1YS7 A;  3E6M A;  1YW8 A;  4RB3 C;  6PAX A;  4KN4 X;  3HOT A;  3P9K A;  3CUQ B;  2JPC A;  5D8K B;  2PN6 A;  2P8T A;  1HW1 A;  1HST A;  3DFG A;  2JZY A;  1YIO A;  2K86 A;  5FD5 A;  1Z7U A;  2RN7 A;  2XRO A;  3ZMS A;  2H09 A;  1RNL A;  2XHK A;  3ZN0 A;  5CYV A;  1D8J A;  1L3L A;  4ENK A;  1EH6 A;  1K79 A;  3KP7 A;  4G94 A;  3H3U A;  1I27 A;  2CSO A;  2EA2 A;  2GAU A;  4RS8 A;  4ZZL A;  1W7P D;  2O61 A;  4K2E A;  3FF5 A;  3BZ6 A;  3FHZ A;  2Q2E A;  3TGN A;  2E7W A;  2YSR A;  3M7G A;  2Y0M A;  3P9I A;  2DK8 A;  2VT3 A;  3C3W A;  1T2K A;  1D8K A;  1HXD A;  1P92 A;  1Z1D A;  2L4A A;  1ZRF A;  1FP2 A;  1L0O C;  3DKW A;  4KDP A;  3QOP A;  2FF4 A;  5E1X A;  3DF8 A;  4EV0 A;  3QU6 A;  1NHA A;  1JGS A;  1YLF A;  2JT1 A;  3J81 Z;  2A61 A;  2KJB A;  2KRF A;  1ULY A;  4D0P A;  1BI3 A;  5CJ9 A;  5KVR A;  4LLG F;  2FBH A;  3HIF A;  1W4M A;  2QLZ A;  5LEK A;  1LEA A;  1J5Y A;  2IA2 A;  2VT2 A;  3GZ6 A;  1WRJ A;  4YII A;  5TJJ A;  1XMK A;  4HOB A;  5FD6 A;  1ZGJ A;  1KYW A;  2XKO A;  3CUO A;  4M9Z A;  1B1B A;  3RTR A;  1U2W A;  2XIG A;  3DPL C;  3FXQ A;  3TKY A;  2HQR A;  4OIN F;  2W24 A;  1LDK B;  5FO5 A;  4E70 A;  1U6G A;  3FMS A;  2ZBK A;  4B09 A;  3QAH A;  5L3B A;  1WQ2 A;  5HLH A;  3I64 A;  3JTG A;  2A69 F;  4CZZ A;  5ILS A;  5HDK A;  1ZRC A;  1ZGA A;  1QQI A;  2KKO A;  2PG4 A;  2BEO A;  1W7P A;  5HDG A;  1BIA A;  2XVC A;  4G7H F;  2HQN A;  1SAX A;  4HX4 A;  3K1N A;  2GWR A;  3SZP A;  2X0L A;  3ELK A;  3GFM A;  4EJO A;  1MJB A;  2GZW A;  5IT9 Z;  4DQ2 A;  4OMY A;  2ISY A;  1LJ9 A;  3HRM A;  4UV9 A;  1TNT A;  1H9G A;  1R23 A;  2G7H A;  1FBQ A;  2RQP A;  2F5D A;  4QLC U;  1LQ1 A;  3HRT A;  1DP7 P;  3LA7 A;  2P5K A;  2IVM A;  1UHM A;  4A0Y A;  3CO6 C;  1P2F A;  2PLY A;  4RB2 C;  5L3G A;  4KNY A;  1F5T A;  1U5T B;  1FBS A;  3T5X A;  2HKX A;  1OPC A;  4AIK A;  3ABU A;  3R60 A;  1XSD A;  2A68 F;  1T98 A;  1DPU A;  4KYW A;  1BM9 A;  1G3S A;  2Q0O A;  1TW3 A;  3KFW X;  4IF4 A;  1UCR A;  4UXN A;  1HKS A;  2MBF A;  3C7J A;  5H6Q A;  2HKO A;  1S8N A;  4M9X A;  4EM2 A;  3PFI A;  2PQ8 A;  1ZAR A;  1ON1 A;  2VOO A;  4BHC A;  1FWZ A;  2KIM A;  1ZLJ A;  2F5F A;  4A6D A;  2O0Y A;  1Y0U A;  4UNO A;  3SFZ A;  4JBA A;  4R8H A;  1XSX A;  2E7X A;  4YFK F;  2V1X A;  4U7D A;  1MJA A;  2ETH A;  3ZQ7 A;  3TOA A;  3U1D A;  1RZ4 A;  5ICF A;  2EB7 A;  2BYV E;  1B59 A;  2QQA A;  4LFU A;  4YFX F;  3R6S A;  5BPD A;  1OR7 A;  3VOD A;  3QRF F;  3J7A O;  1J9I A;  1Z05 A;  4LK0 F;  1B9N A;  2RC4 A;  1SD7 A;  4XRF A;  4EM1 A;  4FX0 A;  1QBJ A;  3PQK A;  5DUK A;  1V3F A;  4BXU A;  2Q8K A;  4NQW A;  2ISZ A;  1WKM A;  3KP5 A;  4WX9 A;  4PGG A;  2OAZ A;  3MQ0 A;  2M87 A;  2EFN A;  2P5L C;  1IXS B;  4L9N A;  4HDU A;  3KZZ A;  3LQR A;  2IRF G;  2A5Y B;  3CUQ A;  3P7N A;  5FFX A;  3BY6 A;  3KLN A;  3J80 Z;  3JW4 A;  2YX7 A;  5ED4 A;  2IPQ X;  1XGN A;  1QPM A;  4CIC A;  2NAZ A;  2VON A;  2XAH A;  1XDS A;  5DD8 A;  3HHH A;  5BS6 A;  1BI1 A;  1J2X A;  2EFP A;  3O6B B;  2DAO A;  1EV7 A;  4Z2Y A;  3V8J A;  3QPT A;  3W6K B;  3S2W A;  3BJO A;  5EEG A;  1HQC A;  2FEZ A;  2EWN A;  3IC7 A;  5D5X B;  5CVI A;  1GVJ A;  4PCQ A;  2BGC A;  1PP7 U;  5H20 A;  4OOI A;  4LGW A;  1H0M A;  2Z9O A;  3RYP A;  5AON A;  3K1M A;  4OU0 A;  3LFK A;  1R22 A;  3HRU A;  2OA4 A;  5LHH A;  2UWM A;  2Z99 A;  1ZRE A;  4ASN A;  3TO6 A;  1W5T A;  4GYI A;  1YO5 C;  2Z3Y A;  3QU3 A;  3SZT A;  1G3Y A;  5DCM B;  1T38 A;  2QUF A;  2LF7 A;  5ILU A;  3RKX A;  3EYY A;  4HZF A;  3I53 A;  2RDP A;  1HBX G;  3HSE A;  1KU7 A;  2ZO4 A;  2EV0 A;  2CGP A;  1D5V A;  2DU9 A;  5E8I A;  1O3Q A;  2LNB A;  2L3D A;  3O3K A;  3R61 A;  2NYX A;  1J75 A;  2Z33 A;  4P5O A;  3PQJ A;  1F1Z A;  3L09 A;  2K4B A;  5JR3 A;  4LB5 A;  2FQ3 A;  2JSC A;  2YPR A;  3T0Y A;  4KMU X;  1KYZ A;  3N97 A;  2MH9 A;  4HQE A;  2XAG A;  2OD5 A;  4Y15 A;  1X3U A;  3KE2 A;  5FLX K;  4CXF A;  2XAQ A;  5LRR A;  3WTW C;  2E1C A;  4L9T A;  4MTD A;  4HQM A;  2YU3 A;  1Z91 A;  3FX3 A;  3BP8 A;  2DPU A;  5J8F A;  1CGP A;  5FGM A;  1U78 A;  3CTA A;  1TQI A;  2JRT A;  1FNN A;  1SMY F;  4FT8 A;  1ZHF A;  2MC3 A;  3I59 B;  4DNC A;  5D5U B;  4LLN A;  3T1B A;  1ZG5 A;  2HGC A;  4HF1 A;  4ON0 A;  1WWX A;  3TO7 A;  3EET A;  4M74 A;  4RGX A;  2EFW A;  3I71 A;  3C1D A;  1ZH5 A;  3IKT A;  1IRF A;  1O7L A;  2GXG A;  4G8X A;  4CO8 A;  3AAF A;  1USS A;  1YQA A;  2ADU A;  4U0V A;  2V1D A;  2WTE A;  1U5T C;  2LKP A;  4KIC A;  2DPD A;  1HKQ A;  3I4P A;  4OIO F;  1R00 A;  1SFX A;  2CG4 A;  1ZYR F;  4EJT A;  4NB5 A;  1UB9 A;  4EVI A;  1R5G A;  1HW2 A;  5BPI A;  1LVA A;  4HA8 A;  1YW9 A;  1F9N A;  1V4R A;  2VE9 A;  1BI0 A;  5A2Q K;  4ESJ A;  3EDP A;  2QWW A;  4I2O A;  1U5T A;  5FLX Z;  1WI9 A;  4I0A A;  4EGZ A;  2ZXJ A;  4IRH A;  2RKH A;  3ZMV A;  3WE3 A;  2OBP A;  2CW0 F;  4L9J A;  3ZN1 A;  1F4K A;  4XLN F;  2PMU A;  4RAZ A;  4WXC A;  3CDH A;  1W5S A;  5J6X A;  3P9C A;  2B0L A;  5TRD A;  5FFZ A;  4L9V A;  2FXA A;  3L00 A;  3RKY A;  4UVC A;  2CWE A;  3HTS B;  4A6E A;  3W6J B;  3BRO A;  5LGN A;  3F6V A;  3R0J A;  2M30 A;  2QYO A;  4HDV A;  4ZYG A;  3E5X A;  4ZZD A;  2NNN A;  2DFI A;  2HTS A;  5L3F A;  5LEJ A;  3IHU A;  2FA5 A;  3NQO A;  3FMQ A;  4Y17 A;  1Q1H A;  5BQT A;  5A2Q Z;  3TDZ C;  1PUE E;  3MAJ A;  3V4G A;  4CDG A;  3CO7 C;  4OIP F;  2A07 F;  5H6R A;  1KA8 A;  4UHT A;  1STZ A;  3QP5 A;  3IRR A;  1Z6T A;  4AIJ A;  4HF0 A;  2CO5 A;  3U9G A;  4BQA A;  1GXP A;  3COA C;  1K78 B;  4A2U A;  3I54 A;  1XSV A;  1FYM A;  3ECH A;  3C18 A;  1P4X A;  3WTZ A;  4EJU A;  3G73 A;  1R1T A;  1XN7 A;  1GHC A;  3GZ5 A;  4I02 A;  3E3V A;  4PZJ A;  2XGX A;  1FSE A;  3L2C A;  1S29 A;  1ONV A;  1UHW A;  2DK5 A;  4KA4 A;  4I98 B;  1OYW A;  2JTV A;  1I1S A;  5ICE A;  1XGM A;  3VEP A;  1K6O A;  1PP8 F;  4BNC A;  3LST A;  2ELH A;  2R3S A;  2GA1 A;  1U3E M;  1T39 A;  1SD4 A;  4GCV A;  4LLL A;  5E20 A;  3GWZ A;  2ZCW A;  5HVQ C;  2WWY A;  2R7D A;  3GX4 X;  1TW2 A;  2XAS A;  3NEU A;  3QP6 A;  4O6J A;  2PI0 A;  5LRS A;  4H0E A;  4RAY A;  1O7F A;  4CYD A;  1OYI A;  3U2R A;  2XAJ A;  2PMH A;  4GXO A;  4CHU A;  3M8E A;  2L02 A;  3F3X A;  4XBF A;  1TLH B;  4KT5 C;  5D6E A;  3WTU C;  4G7Z F;  1BC7 C;  2GA2 A;  3K9T A;  1HKT A;  1AWC A;  1BIB A;  1LEB A;  1UFM A;  3I0T A;  2MA3 A;  3JSO A;  3N4M A;  4M6X A;  4BHB A;  4MHG A;  1XGS A;  2VXZ A;  5D8L B;  1QO0 D;  4N9I A;  5DCM A;  1G6N A;  1QZY A;  3WGI A;  4WWC A;  2EFQ A;  4IHT A;  2VBX A;  4S04 A;  1SD6 A;  4HYE A;  1ZRD A;  1XGO A;  3IL2 A;  3MEX A;  4U7B A;  2FBI A;  2P7C B;  4BYY A;  1KU9 A;  5D4R A;  2D1H A;  2EJR A;  3LWF A;  2A6E F;  3LAP A;  3TOB A;  3D5L A;  4KMF A;  2D45 A;  1UST A;  1KQ8 A;  3KEQ A;  3K69 A;  4EQQ A;  3MZH A;  4B8X A;  3CLO A;  1SFE A;  3V7R A;  3BJ6 A;  5KK1 A;  4ZH4 F;  2DQL A;  3FXR A;  3IKV A;  2QVO A;  4HAM A;  3I59 A;  5L3E A;  3GYH X;  1E2X A;  2IP2 A;  1R5H A;  2HWV A;  5F1R A;  3CUQ C;  1H9T A;  2XV4 S;  3RDI A;  2COM A;  1JE8 A;  4PDK A;  5E1W A;  3WGG A;  2O3F A;  2G7U A;  1R36 A;  1QNT A;  5L3D A;  1RUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...