4AWXB

Moonlighting functions of feoc in the regulation of ferrous iron transport in feo
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
63
Chain Sequence
PLGSMASLMEVRDMLALQGRMEAKQLSARLQTPQPLIDAMLERMEAMGKVVRISEQEWWALRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords FERROUS IRON TRANSPORT PROTEIN B
publication title Crystal Structure of the Klebsiella Pneumoniae Nfeob/Feoc Complex and Roles of Feoc in Regulation of Fe2+ Transport by the Bacterial Feo System.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 17
structure length 63
sequence length 84
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09012 FeoC FeoC like transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4awxB00
2VT2A 2IPQX 5L3BA 4R79A 5E8GA 3QOPA 2VE8A 3FX3A 4Q48A 2QENA 2JSCA 2KJCA 3CLOA 3WTSC 1IN4A 2E7WA 5ILSA 2OAZA 3U1DA 1T0FA 2QWWA 4G9YA 1IN6A 2QBYB 4WK8F 3PQJA 2FF4A 4JBAA 2L01A 5L3CA 1IAWA 1YTYA 1O7FA 3G73A 5LEJA 2IW5A 1FC3A 2RN7A 1L3LA 2MLGA 4L18B 4HF0A 3GO5A 4EJUA 4WXDA 2RVCA 3LA2A 1W7PA 2X0LA 1FBQA 3FWEA 4PGHA 3K9TA 5D6EA 4M73A 3GXOA 1XSVA 1Z6RA 2CFXA 1LQ1A 2GXBA 1USTA 1KA8A 3IKTA 2O6GE 1W5TA 3DP7A 4WWCA 4UVAA 5CVIA 1D8JA 4UXNA 2QUFA 2VE9A 4RB3C 1BC7C 4U7DA 2DO7A 2NRAC 1ZG5A 5HLHA 4OIPF 2K27A 4MEXF 1U5TB 2DAOA 2WV0A 3LQQA 4XSXF 5LEKA 4KNYA 3WTZA 1G3SA 4OIRF 1JGSA 1O7LA 3M9AA 3O6BB 3GUDA 3QP5A 6PAXA 2Q0OA 2EJRA 4MQ9F 1JHFA 4F7ZA 3D5LA 1LDDA 1RUNA 3K1MA 2G9WA 1IRGA 1S7OA 1HW1A 2ZFWA 5D8LB 2VBZA 1U78A 4I01A 2L54A 4YFNF 2V79A 2F2EA 4CO8A 4B09A 2K02A 2HTJA 4KIBA 3P9IA 4PDKA 1FP1D 3TO7A 4FHTA 4IJAA 1TBXA 3SZTA 3W6KB 5D5VB 5DV5A 2HQRA 1ZARA 3K69A 4ENNA 3BPVA 1T6SA 2HYGD 3WGHA 3KEQA 3BPXA 3WODF 4JQFA 2M30A 3D0SA 3KP4A 1MKMA 2EA2A 4LG0A 2P7VB 3NEUA 3COAC 1K78A 4Q4ZF 2BYVE 2A69F 1MD0A 2DQLA 4PCQA 2Y75A 3HOTA 2VOPA 3SHFA 2B0LA 3REOA 1FNNA 3BOQA 3GFJA 5L3GA 3JSPA 4M6XA 5D5XB 5E1XA 1RUOA 3GLXA 1TLHB 2M5WA 2XAJA 4HX4A 1SFUA 1P92A 2LSOA 1E17A 4KUMA 5AIQA 5BPDA 1OPCA 1YW8A 5D8KB 2VC0A 5BMZA 2QYOA 1ZRCA 2D2WA 3B02A 4RGUA 4KN4X 2DPUA 5HS8A 2DLLA 5L3FA 3WE2A 2EFOA 1ZLJA 1U3EM 2MD5A 4ON0A 4ESFA 3L09A 1ZYRF 4EJWA 2NS0A 4G6DA 3VEPA 4TV7A 3HRSA 5FD6A 2EA4A 1XGOA 3QP6A 3JTHA 1KU7A 1T98A 5ICEA 2PN6A 3TGNA 2VBYA 4Q47A 3F23A 2L4MA 5LGUA 3V7SA 3BROA 3ERED 2IRFG 1MGTA 4Y15A 2MH2A 3HUGA 1GHCA 3T1BA 4P55A 3JAMZ 4EVIA 3KETA 3L7WA 3V7CA 1WKMA 3LWFA 4LD5A 3O2PE 3KE2A 1C0WA 5HOOA 3E5QA 2YU3A 5K1YA 1T2KA 2GWRA 4ETSA 5K5OA 3I4PA 4RB0A 1IZ1A 3K2ZA 5IT9Z 1OR7A 5E8IA 4WXCA 3EYYA 5E17F 1ZREA 1XN7A 5FD5A 1J7KA 4CICA 4AD9A 2LKPA 3E5XA 5CVJA 4IF4A 5LHHA 2ETHA 1RIOH 3DV8A 1QO0D 2ZBKA 1G3YA 5TJJA 2DK8A 2QVOA 3FXUA 4OMYA 4EMSA 5LBQA 4A0XA 3DKWA 1JXSA 3HTUA 1B9MA 5HDNA 3WTYC 1HSJA 3SXYA 5DD8A 5DCMA 3TOAA 1OKRA 1HKSA 4AIKA 1FYKA 2ZJ2A 2HGCA 2CYYA 2BBYA 3CUQB 3IWZA 3GYHX 5FB2A 4HX8A 2C6YA 1Z7UA 2HZTA 2VN2A 4NQWA 1R23A 1B4AA 4M6YA 3KP2A 1K6OA 3BWGA 2YX4A 3GFIA 3QRFF 4IHTA 4KMFA 1YFHA 4XRFA 1I5ZA 3DXJF 1IXSB 3I59B 3CJNA 2HKOA 5FFZA 4WXHA 3HRTA 2CWEA 3M8FA 3F72A 2ZXJA 1RZ4A 1BI1A 2YSRA 2R3SA 2HS5A 1U8RA 3TKYA 4IRHA 5LGNA 4A6DA 1JE8A 1BN5A 2P8TA 4IPAA 3JAMK 4HF1A 1YYVA 1XGSA 2Y48A 5CVVA 4A2UA 4H0EA 3FF5A 3LA3A 3IRRA 1G6NA 4UVBA 3GWZA 2A61A 1PP7U 1B59A 2ZCWA 1R1TA 2XGXA 2D1VA 1Y0UA 3BY6A 2PMHA 4XLPF 2XKOA 4NB5A 5BS6A 3MZYA 4I02A 1TW2A 5FO5A 3F8NA 3V8KA 2KJBA 2Z9OA 3DQVC 2K4BA 1KGSA 5HS7A 4MQVA 1YO5C 1USSA 5E1WA 4RAYA 1YIOA 3M1EA 3I54A 2W25A 2PJPA 5BPIA 2M45A 4E70A 1YW9A 3VOEA 4P96A 1ZRFA 1BOAA 2ZO4A 3E6CC 1D5VA 3V8LA 1KU3A 1JHHA 5JR3A 2RKHA 1HW5A 2DTRA 3HHHA 1QZZA 4M74A 2A6EF 1TQIA 3P9KA 4ENMA 2VXZA 2CG4A 3F8BA 1WSUA 2FRHA 2FU4A 4KA4A 1U5TC 5DYMA 4UUVA 2DFIA 2Q2EA 3FMSA 1U6GA 1QQIA 4ZH4F 1IRFA 3HHGA 2YX7A 4I0BA 4N9IA 3JW4A 5FGMA 3ZMSA 3E97A 1EH7A 2AS5F 3MAJA 1BC8C 3IC7A 1ON2A 3ECHA 4CYDA 3R0AA 2QQ9A 4EJTA 4HDVA 1Z05A 4UV9A 2ADUA 3WGGA 1HKTA 1ODDA 2Y0MA 2J5PA 1FWZA 4A0ZA 4ENJA 1O3TA 1KQ8A 4QLCU 4FX4A 5DUKA 2ELHA 3DFGA 1V3FA 5JHUA 1FP2A 1IN7A 2D1HA 3S2WA 2XHKA 2CO5A 2O61A 5HS9A 3TOBA 3MZHA 3IWFA 2Z3YA 2PLYA 2QM3A 2EB7A 2BE5F 1SD7A 5A2QZ 2H6BA 2OZUA 2DBBA 3ZN0A 1D3YA 3I71A 3F8FA 2IJLA 2JPBA 4M9SA 3TQNA 3U9GA 3C3WA 3L00A 3WTXC 5L3EA 2JZYA 1TQPA 2ZMEB 2FNPA 3ZMVA 2GZWA 3H92A 3H3ZA 4OOIA 3ZMUA 2W84A 3KLNA 2MLKA 3SFZA 2IP2A 3VFZA 1K7AA 2FOKA 2OA4A 2X4HA 4GCVA 4A6EA 3CTAA 3E6BA 5LRRA 3DEUA 4RGXA 5DCFA 1DPUA 4EGZA 5D4RA 3KEOA 3ZP5A 5BQTA 2UXNA 2EFWA 2FNAA 4G7HF 4YIFA 3TO6A 5ED4A 2V1UA 3IL2A 3QPHA 5LGTA 3KP7A 4ZZLA 3F3XA 4KN7X 1F1ZA 1LDJA 1MDMA 4I2OA 3M7GA 3V8JA 4EM2A 5F1RA 4S04A 2P6TA 2PG4A 1XDSA 4G94A 1ZLKA 5K5RA 1FLIA 4U0YA 1LNWA 3NRVA 3R0JA 2IA2A 1I6XA 2PI0A 4L0ZB 4AWXB 1XGMA 3BJ6A 3HIFA 1ZG3A 1P4XA 2L3DA 4G8XA 2MA3A 4HYEA 1LJ9A 5F6FA 5BOXA 1O3SA 3KP5A 3J81K 2XVCA 5DUIA 3P9CA 4HBLA 2HTSA 2XKPA 2M1BA 2CQKA 4YFXF 3AAFA 4ZYGA 4MTEA 5H6RA 5A2QK 1O3RA 2G7HA 4OU0A 1OYWA 4M9XA 1FSHA 4K2EA 3H3UA 2RC4A 1R5HA 5HDGA 2GAUA 2A6HF 3RKYA 4XBFA 4LGWA 3V7RA 2V1DA 2HYFA 1DPRA 1KYWA 3FXQA 3T8RA 5K5QA 4Y13A 5CVUA 2IVMA 3KCCA 1F9NA 2DPDA 1W7PB 3KFWX 3I58A 4L9VA 4LLNA 3FXRA 2Q8KA 3FM3A 5HLIA 4G7ZF 1R36A 1TQMA 5ERIA 4LJZF 4I0AA 3LQRA 1J75A 3CUQC 2KIUA 2E1NA 2HWVA 3ZN1A 2V6CA 2O8XA 2R7FA 3GF2A 4A5MA 3SQNA 2XIGA 1S6LA 2D45A 1CF7A 3J80K 2FE3A 5EEHA 1J0RA 1DUXC 3J7AO 4XSZF 3LSTA 5J8FA 1MJAA 3TDZC 2IT0A 2F5EA 2W85A 2AXLA 2GQQA 1KQ9A 5ICCA 1FZPB 1G3TA 4D0PA 4Z2YA 2IA0A 2MH9A 4RAZA 4U0VA 1P6RA 5IT3A 2QLZA 1L0OC 4RGRA 1FBSA 1GXQA 2BV6A 1R22A 3ECOA 4BYYA 2UXXA 2UWMA 1QNTA 2VOOA 2CGPA 4U88A 1YG2A 4KYWA 2EV0A 1UHMA 3TO9A 1T39A 2ZKZA 4HAMA 4HLXA 3GFLA 3NQOA 2XV4S 4IHSA 4BQAA 1R7JA 1W5SA 5ICFA 2DU9A 5ICGA 4LG0B 1K78B 4MGRA 1ZAOA 3VB2A 4P5OA 2JT1A 4B8XA 3W6JB 2EK5A 1QPMA 2OU2A 1FOKA 2H94A 4I7HA 1HSTA 4DNCA 2CSOA 4A5NA 2NNYA 4P9FA 3B73A 5D4SA 3ELKA 4U0WA 2FSWA 4BHPA 3WE3A 1YLFA 4HW0A 5HLGA 3E6MA 3BJAA 4BXUA 3ULQB 2V9VA 4BNCA 1P4AA 4BHBA 2RDPA 3BP8A 2YPRA 3F6VA 3FMRA 4EJVA 2VBWA 2NAZA 1BI0A 4EQQA 1NHAA 3Q9VA 3BJOA 1WQ2A 2ISZA 2LF8A 1SD4A 3E5UA 2QBYA 5F64A 1YW7A 2K7LA 2W24A 4OMZA 1T38A 1OYYA 1XMAA 3L9FA 4ASNA 4R1HA 1BIAA 1PP8F 4G6QA 1MJ9A 4HX7A 4IVNA 2JTVA 4ZZDA 2M87A 2ESHA 3MWMA 2E7XA 3IHUA 5AONA 4HF2A 2YR2A 3L2CA 3T8TA 4LLGF 2RNJA 3KZYA 1P2FA 4ZYDA 4ESJA 1ZG1A 3IKVA 5AIPA 2A07F 2LNBA 3EDPA 3FM5A 3K1PA 1Z9CA 4KICA 2RV8A 2Z5UA 2XASA 1RI7A 4KIFA 4BAYA 5LHIA 1TNSA 2XRNA 2J5OA 4Y17A 1TW3A 1AWCA 1SFEA 3HYIA 1UFMA 5LRSA 1BM9A 1U5TA 4YG2F 2ESNA 4IXAA 1KU9A 2MC3A 3GZ5A 3CO6C 1F4KA 2H6CA 4R8HA 2F5CA 4MEYF 5DD4A 1J9IA 3LFKA 1R00A 2PQ8A 3R61A 1BI2A 4O6JA 2EV6A 2O3FA 3RJPA 3E6DA 3WTTC 4XLNF 5ILVA 2V1XA 3E3VA 4N0BA 2WC2A 1G4DA 4AIHA 4EJOA 2K4JA 4GYGA 1YS6A 1A04A 5DCMB 2XAQA 3TDUC 1IN8A 3GZ6A 3JSOA 4LFUA 3RTRA 4GXOA 2MBFA 4LK1F 1EH6A 2O03A 3FZVA 2HEOA 1D8KA 1FPQA 4HA8A 3WGIA 5HVQC 2EFNA 3DPTA 1ZH5A 2E1CA 3HRUA 1ZGAA 4KIGA 4LB6B 4M72A 4IRGA 3Q5FA 2TDXA 1XSXA 1IUYA 2RGVA 1J5YA 2QZ8A 4BH9A 4O3MA 4YFKF 3EYIA 4L5JA 4S05A 3CUOA 1MZBA 4L5IA 3J81Z 1SFXA 5HDKA 3QU6A 4DQ2A 2FEZA 1WI9A 2KIFA 3BDDA 4EM0B 4EGYA 3EUHA 4OINF 3KZZA 4EM1A 3RI4A 1B9NA 4KMUX 4AIJA 2WWYA 1LEBA 2H27A 1QZYA 5EEGA 1IXRC 3RDIA 2PBIA 3V4GA 2DT5A 4RGSA 4L9TA 3RKWA 4LK0F 3F21A 3U2RA 2JPCA 4HZFA 2EFQA 3PFIA 1X3UA 1E2XA 4A0YA 2JRTA 2LF7A 5L3DA 2NYXA 1S29A 4A12A 4GGGA 4LB5A 3ABTA 2KKOA 1SD5A 3MQ0A 3F8CA 1S8NA 1KYZA 4L0YB 1Z91A 4P9UA 2A5YB 2L02A 4NHJA 2EWNA 4WF2A 2DK5A 3J80Z 2A68F 4CXFA 2P5VA 4U7BA 4HQEA 2QQBA 4UHTA 2ZNYA 2HOEA 3HTSB 4CGZA 3DF8A 1WWXA 4JK1X 1ONVA 2XROA 2WTEA 4QWQA 1XCVA 2COMA 4OIOF 2HDCA 1UCRA 5D5WB 2P4WA 3LA7A 1O3QA 3OOPA 2VODA 2R7DA 1PDNC 5KVRA 4L9JA 2G7UA 3WTUC 1AOYA 5DEQA 3M8EA 1FYLA 4WCGA 4KFCA 2P7CB 3GW2A 3WG9A 2FBKA 1W7PD 2DW4A 1BIBA 4UV8A 2ISYA 3RIRA 2XUBA 1B6AA 4RB1A 2OD5A 1ZRDA 1UHWA 3QPTA 2OBPA 4EV0A 1W4MA 3Q9SA 2STWA 3KP3A 1I1SA 1WRJA 1ZGJA 1ZHFA 4FT8A 4KT5C 3KP6A 1LEAA 2XAHA 3CUQA 2Z33A 1LVAA 1F5TA 1DP7P 2EFPA 2IA1A 1K79A 3ZMTA 1U2WA 3OV8A 4MTDA 4KDPA 4OIQF 5JFRA 2K86A 1IXCA 5E18F 2DI3A 1FSEA 3I5UA 3I59A 4LMYA 5CVRA 5CLSA 4ENKA 4HV6A 1H9TA 4GYIA 3HRMA 3ROUA 2OZ6A 1R5GA 1BI3A 2NNNA 3MEXA 1XCBA 1EV7A 4PGGA 1YQAA 1GXPA 1OMIA 3MCZA 4M9ZA 2L4AA 3ABUA 2HQNA 2EV5A 2FBHA 4UVCA 1DDNA 1IF1A 4AVPA 1PUEE 2UZKA 2RQPA 1R1UA 3BZ6A 1QBJA 1XSDA 2W57A 3R60A 2Z99A 2M8EA 2GIVA 3GFMA 2STTA 5CJ9A 3GX4X 1UB9A 1XDUA 1IN5A 3ZMZA 4HQMA 3LAJA 3K0LA 2HFHA 3RPQA 2O0YA 4L9NA 3HSEA 5E20A 3WTVC 5D6FA 2VC1A 4I09A 4ZYEA 4LLLA 3I53A 4HV5A 2BEOA 3MFKA 4GO1A 2A3SA 1MDMB 2H09A 1SAXA 3IRQA 3ZQ7A 2BGCA 4UNOA 1KU2A 3RYPA 2VBXA 3R4KA 1SD6A 5J8CA 2FMLA 3N4MA 4FX0A 1HBXG 1BBYA 3VODA 1R58A 4CHUA 1MJBA 3RYRA 1QGPA 2FA5A 3HSRA 5FLXZ 4WX9A 1S7AA 2F5DA 2HR3A 1IW7F 2KIMA 3ZMDA 3HSFA 3RKXA 1HQCA 5H20A 5KK1A 1I27A 5J6XA 4IRIA 2XAGA 3R6SA 5TRDA 3HOSA 3ZPLA 4RS8A 2VT3A 4N9HA 1REPC 1GVJA 2ZNZA 1J2XA 3P7NA 1S3JA 2GA1A 3C18A 4HDUA 1VTNC 4CZZA 3ML6A 2QQAA 3RPUA 5LHGA 1RNLA 1J59A 3DPLC 2HKXA 5FFXA 3C7JA 4CDGA 3KLOA 3O3KA 1FYMA 1Q1HA 4RB2C 1TNTA 1LDKB 5CYVA 5D5UB 4ESBA 2KRFA 2PEXA 4ZYHA 2PMUA 3LAPA 3CO7C 1XGNA 1P4WA 1ZN2A 1G3WA 2CW0F 1HXDA 4MNUA 5JI6A 3FMQA 2PFBA 2FQ3A 1I1GA 3QAHA 3I0TA 3WU1B 5ILUA 1CF7B 2OQGA 1FY7A 3N97A 1HW2A 1H9GA 3F8MA 2VONA 3K1NA 3GEZA 3T5XA 4I98B 3F22A 1V4RA 2DQRA 1FX7A 1Z1DA 1SMYF 3PQKA 5IT9K 1STZA 2ZMEA 4PZJA 3EETA 1SMTA 3C1DA 1B1BA 1KQ0A 1FBUA 1BJAA 5LLQA 2GA2A 5E1ZB 1Z6TA 3ISPA 1HKQA 5H6QA 3G3ZA 4MHGA 5FLXK 2ACJA 2P5LC 1XMKA 3F6OA 1OYIA 3JTGA 1ON1A 4G7OF 4HOBA 2FBIA 5JVTA 2LDUA 2XAFA 3QU3A 4YIIA 2P6SA 2FMYA 3I64A 1YS7A 2P5KA 1EH8A 1TTYA 3WU0A 1FT9A 1R1VA 1ULYA 3T0YA 1H0MA 3EQLF 5DDGA 3GVAA 2GXGA 1XB4A 2FXAA 1XD7A 1O57A 3CDHA 4HLYA 3FHZA 4M71A 4BHCA 4Q5SF 3WTWC 2F5FA 3SZPA 1LB2A 2OQRA 1CGPA 4O5VA
chains in the Genus database with same CATH superfamily
1U9NA 4XN0A 2VT2A 3J7AY 3DBLB 4XL9A 4M3BA 3TW7A 2IPQX 5L3BA 4R79A 3HOZJ 5E8GA 3QOPA 4BUPA 2VE8A 3LNQA 3FX3A 1FTZA 3BG5A 3GTGJ 4Q48A 1YJ9I 2QENA 3H5AA 1OCPA 3DCFA 4DBQA 1ETVA 2JSCA 1Z77A 2KJCA 3CLOA 3WTSC 1IN4A 2E7WA 5ILSA 2OAZA 4ZDOA 3U1DA 1T0FA 2MG4A 2QWWA 4G9YA 1IN6A 2QBYB 1TT0A 2NVYJ 3SDBA 4WK8F 3PQJA 2FF4A 4JBAA 4I76A 2K9NA 2L01A 3CQZJ 4CUGA 2M4GA 2LC2A 2CUZA 3MKLA 4NBQA 1FIAA 1K83J 1XC5A 5L3CA 1YTYA 3FXOA 1IAWA 1MBEA 2R5ZB 5F1JA 1O7FA 3G73A 3J7YJ 1NH3A 4F3QA 5LEJA 2IW5A 1FC3A 2RN7A 2CUEA 1L3LA 2MLGA 4L18B 2BY2A 2WV1A 4PJJA 4HF0A 1FOWA 3GO5A 4EJUA 4WXDA 4XLHA 2JVGA 1F36A 3OYDA 2IS6A 2OUMA 2ZXIA 4NUBA 2RVCA 2OTJI 1ETQA 3LA2A 4DOZA 1RC9A 1W7PA 2X0LA 1FBQA 3LSGA 3FWEA 1ETXA 3L2WA 3AG1H 4PGHA 1SFOJ 2K9SA 4UB6C 3K9TA 2HU9A 5D6EA 1YRNB 2LREA 4D1QA 3TP3A 4ITVA 4M73A 3GXOA 5JHFA 3OYHA 3ZQHA 4I6ZA 1RPWA 1XSVA 3MVPA 1Z6RA 2ECCA 4C3JJ 3BZCA 4DGWB 2QSHX 1JKPC 2LG4A 2CFXA 2XF6A 1LQ1A 2GXBA 1USTA 2ECBA 3CCLI 1KA8A 1MMNA 1MH3A 1X4PA 3IKTA 2O6GE 1W5TA 3DP7A 4WWCA 3PNVA 5K7HA 1ZKGA 5JVGF 4UVAA 5CVIA 2N8GA 3HXLA 1D8JA 1TWFJ 2VJIA 4B3XA 4CSWA 4UXNA 2QUFA 3OYGA 2NOGA 2VE9A 5E3LA 4RB3C 2CQNA 4U7DA 4YELA 1BC7C 2DO7A 4XKWA 2NRAC 1ZG5A 3CP8A 3DU6A 5HLHA 2K27A 4OIPF 4MEXF 4DZPA 2M7BA 1U5TB 2DAOA 3TL4X 2OC6A 1ETOA 3AFHA 5B66C 2WV0A 5FKNA 3HOYJ 1AHDP 3LQQA 3IAM2 4XSXF 4E7ZA 1QA6A 5LEKA 2VL8A 4KNYA 3WTZA 1ZGWA 1G3SA 4OIRF 4BXFA 4C9YA 1JGSA 1O7LA 2L9SA 1Y6IA 3M9AA 4LIUA 3O6BB 1B72A 4ZJZA 3GUDA 3QP5A 3JR9A 6PAXA 2KFDA 2Q1ZB 2Q0OA 2EJRA 4MQ9F 1JHFA 4F7ZA 3D5LA 2VXDA 1LDDA 1RUNA 1P9QC 3MKZA 2ZXWH 3K1MA 2G9WA 4KJZA 1IRGA 4BU2A 3BR3A 1S7OA 1HW1A 1HDDC 3GZNB 2ZFWA 5D8LB 3M8JA 4HRIA 2VBZA 4XLFA 1U78A 3RZDJ 4I01A 3FDYA 3H1CA 2L54A 4YFNF 2V79A 2F2EA 3VWBA 2JA6J 4CO8A 4B09A 2K02A 2HTJA 4KIBA 3CCRI 3P9IA 4PDKA 2R7QA 1FP1D 3A1YA 1IUFA 4JOMA 3TO7A 4FHTA 4IJAA 1TBXA 3SZTA 3W6KB 3K6GA 5D5VB 5DV5A 2HQRA 1A31A 3D5RC 1ZARA 3K69A 2WAQN 3BPVA 1T6SA 3WGHA 2HYGD 2W48A 4ENNA 3KEQA 2KDZA 2LH9A 3BPXA 2AXTC 3WODF 4V2FA 4JQFA 2M30A 3VYRB 3D5SC 1D0ZA 3D0SA 3KP4A 2E34A 3OYNA 1MKMA 2ME0A 4XRSA 2EA2A 4LG0A 2P7VB 3NEUA 3COAC 1K78A 4XRSG 1IO2A 4Q4ZF 2BYVE 2A69F 1MD0A 2DQLA 2IAIA 2R4GA 1BL0A 4PCQA 5EGOB 1ZQ3P 2Y75A 1MBFA 4FASD 4S0HB 3JRIA 1ITYA 3HOTA 2VOPA 3DU5A 3SHFA 2B0LA 3REOA 3ZGKA 1FNNA 1MMSA 2BHZA 1HOMA 3BOQA 3GFJA 5L3GA 3DTKA 3JSPA 4M6XA 1X58A 5GTHC 5D5XB 5E1XA 1RUOA 3GLXA 4DYRA 1APLC 4FISA 1WJ5A 1TLHB 2M5WA 2XAJA 1VQ8I 4HX4A 4RAFA 1SFUA 1P92A 2A6TA 2LSOA 3BZKA 1W36D 2V7FA 1E17A 4KUMA 3HJEA 5AIQA 5BPDA 1OPCA 1YW8A 3CJTB 3ZXSA 3QYBA 3OYFA 5D8KB 2VC0A 5BMZA 2QYOA 1ZRCA 2D2WA 2JUGA 4E4HA 3B02A 5DS9A 5J1YA 4RGUA 1JI8A 5J40A 2TCTA 4KN4X 2DPUA 2EH3A 5HS8A 3QYFA 3HL2A 3BR5A 2DLLA 2Z16A 5L3FA 4JX5A 1IC8A 2W4SA 2BVMA 3DKXA 1XX5A 3PIPF 3WE2A 2EFOA 1ZLJA 1U3EM 2MD5A 1LFPA 4ON0A 3E1SA 5EZGA 4ESFA 3BR1A 3L09A 3OYLA 1ZYRF 4EJWA 4M3DA 2NS0A 2NOJB 4G6DA 3VEPA 4TV7A 3HRSA 1GV2A 1YE9A 5FD6A 1TZLA 2EA4A 4GFBA 1XGOA 1O4XA 5KNLA 1F43A 5E3OA 3QP6A 4UUSA 2NS7A 3S14J 3JTHA 4MFDA 1PYVA 2X6OA 1KU7A 2I10A 2HOAA 5M5XJ 1T98A 5ICEA 2PN6A 3TGNA 2VBYA 3OWTA 4Q47A 3JRBA 3F23A 2L4MA 4E7SA 1OCRH 3CJRB 3V7SA 5LGUA 1NG6A 3BROA 3BT9A 3ERED 2VQCA 1B8IB 2KRCA 2IRFG 4XN3A 1MGTA 5GP9A 4Y15A 3JRGA 2HYJA 2MH2A 3S1MJ 3CC2I 3HUGA 1GHCA 3T1BA 4P55A 1Y0NA 1Y1VJ 4CCOA 3JAMZ 4EVIA 2HZDA 3KETA 1ORKA 1TT5B 3L7WA 3V7CA 1WH7A 3BQYA 4B3AA 1WKMA 3LWFA 4LD5A 2PMZN 3KE2A 3O2PE 1XMXA 3HKZA 1C0WA 5HOOA 3WHBA 1D1BA 1X1AA 1RKWA 3TBIA 4W1UA 3E5QA 4C3IJ 2YU3A 3AG3H 5K1YA 2R7VA 3P5JA 1T2KA 2GWRA 3QWLA 4ETSA 5K5OA 3I4PA 4RB0A 1IZ1A 4XLEA 2WB1A 3K2ZA 5IT9Z 2ELKA 1OR7A 1VNDA 5E8IA 4WXCA 2ZSIB 4PUSA 2ZJRF 3EYYA 5E17F 1ZREA 4BJTA 3W2VA 4RAGA 3ZOBA 1XN7A 5FD5A 2MW8A 1LE8B 1E3HA 1J7KA 4CICA 4CCJA 4AD9A 2LKPA 2M34A 3E5XA 3K7AJ 5CVJA 4EATA 4IF4A 5LHHA 3ZQCA 3BG7A 5FRNA 5IYBJ 2ETHA 2XB5A 2EQRA 3PJRA 1RIOH 3DV8A 4KITB 1QO0D 3FKJA 2ZBKA 1G3YA 4NC6A 5TJJA 1WHUA 2DK8A 2QVOA 3FXUA 2E1MB 3G1OA 4EMSA 4OMYA 1HLVA 5LBQA 1G59A 4A0XA 2CUFA 3DKWA 1JXSA 2K9QA 3HTUA 1B9MA 5HDNA 3WTYC 2VKHA 1HSJA 3SXYA 3AKZA 2IBDA 5DD8A 2GOMA 5DCMA 2WADA 3TOAA 3DBHB 3CC4I 2QSFX 1OKRA 1R9TJ 1FMWA 1HKSA 5TISC 4AIKA 1FYKA 2ZJ2A 2HGCA 2JSPA 2CYYA 2BBYA 3CUQB 3IWZA 4NNJA 3GYHX 5FB2A 4HX8A 2C6YA 1Z7UA 1JKQC 2HZTA 2VN2A 2JK3A 5BNGA 2ZC2A 4NQWA 3LSPA 1R23A 1S5LC 1B4AA 4HSTA 2L9VA 4M6YA 3KP2A 2I8DA 1K6OA 1PUFA 3BWGA 4PK4A 2YX4A 4P1WA 1LKXA 3GFIA 1TL8A 3QRFF 4IHTA 4F52A 3OS1A 4KMFA 2IGNA 5E3NA 1YFHA 1YITI 4XRFA 1I5ZA 3DXJF 2R93J 4MFEA 2E2HJ 1IXSB 5CQEA 3I59B 3CJNA 3HEFA 2HKOA 5FFZA 2LR8A 4WXHA 5J4YA 2MD0A 2VLAA 3FBNB 3HRTA 4YEJA 2AQFA 2CWEA 3M8FA 3F72A 3G1MA 2ZXJA 5FROA 1NK2P 1RZ4A 1EF4A 1BI1A 2YSRA 2R3SA 4D9JA 2HS5A 4DIQA 1U8RA 1VI0A 3TKYA 3IH3A 3H0DA 4IRHA 3GTPJ 1VZ0A 2E5NA 5LGNA 4A6DA 4J01A 4BEHB 1JE8A 1BN5A 2P8TA 4IPAA 1WCMJ 3JAMK 4HF1A 4QIWN 1YYVA 2XDVA 1XGSA 1K6YA 2WAQA 2Y48A 1LVKA 1JTYA 4Y3OA 5CVVA 4A2UA 2I5UA 1X3WB 4H0EA 2VQHA 3FF5A 3LA3A 4Y52J 2M7AA 3IRRA 3IAS2 1G6NA 4UVBA 3CDIA 3GWZA 4ZC3A 2A61A 3FXMA 3DPUA 1PP7U 1B59A 1DQUA 2ZCWA 1R1TA 2XGXA 2D1VA 2BHYA 3IP4B 4DYQA 1Y0UA 1A6IA 2DYSH 3FBIB 3BY6A 4BACA 2PMHA 4XLPF 2XKOA 4NB5A 5BS6A 2IS4A 1PVEA 3MZYA 1H8AC 4I02A 1TW2A 5FO5A 4EEFG 2E35A 3F8NA 3V8KA 2KJBA 2FUG2 1E3PA 2Z9OA 4CYCB 3DQVC 3L1PA 3KYDB 3K4CA 2K4BA 1KGSA 5HS7A 4M3EA 4MQVA 1YO5C 1USSA 1RKTA 1AKHA 5E1WA 5LD2C 4RAYA 1YIOA 3M1EA 3VSKA 3I54A 2E1OA 2BW3B 1RR7A 2W25A 1WZ2A 2PJPA 2CRGA 4ZTFA 3OYCA 2V9PA 5BPIA 3PUFA 2M45A 4E70A 3OY9A 5IYCJ 3CCVI 1YW9A 3VOEA 4P96A 1ZRFA 1BOAA 4ZDLA 2ZO4A 4C2UA 4BDZA 2X51A 1LFUP 1Y39A 3E6CC 1D5VA 3V8LA 1KU3A 3ZCOA 4FETA 1JHHA 5JR3A 3G4SI 2RKHA 1HW5A 2DTRA 1NK3P 2KIQA 2XPUA 4AYBA 3PSIA 4PSWA 5HNHA 3HHHA 1QZZA 4M74A 3VYUB 1RRJA 3DBRB 2A6EF 1TQIA 2ICWG 3P9KA 4ENMA 2VXZA 2CG4A 1VQ4I 2NXNB 5EG0A 3F8BA 4RDUA 1WSUA 2DJIA 5FLMJ 3DKYA 4XICA 3I55I 1IRZA 2FRHA 2FU4A 2NVXJ 4KA4A 4A3DJ 2BY1A 4E7LA 4OAYA 5IY5H 2M9HA 1U5TC 4RM3A 5DYMA 2X6XA 4UUVA 1Z3YA 1X2MA 2DFFA 2DFIA 4E7KA 2Q2EA 5EF6A 3FMSA 3KYLA 1SVOA 1U6GA 3A01B 2DOEA 4J00A 1QQIA 2MSYA 4ZH4F 4IZZA 1IRFA 3HHGA 2Y30A 2YX7A 3GTLJ 1JTXA 2Y69H 4I0BA 3ASOH 4N9IA 1IV8A 3JW4A 1MBHA 1MW7A 5J47A 5FGMA 3ZMSA 2HI3A 4BQOA 3E97A 1EH7A 2AS5F 3MAJA 1BC8C 5JLWA 2KPMA 4XMYA 3K4BA 3IC7A 1UHSA 4HEA2 2PJRA 5FKOA 1ON2A 3ECHA 4CYDA 3R0AA 1TP4A 2QQ9A 2E2IJ 4EJTA 1VQOI 4HDVA 2M3AA 1Z05A 1Z0XA 4UV9A 3H35A 2ADUA 1JUSA 2L7FP 3WGGA 1HKTA 1X2NA 3HOVJ 5IP6A 1ODDA 1WGXA 2CH0A 2Y0MA 2J5PA 1FWZA 3CESA 4A0ZA 1JJ8C 1I3QJ 3CLQA 3OMYA 2KRHA 3A2KA 4ENJA 3HPHA 1O3TA 2HQ5A 4B4CA 4BDYA 1KQ8A 4QLCU 4FX4A 1BW5A 5DUKA 2ELHA 4JYKA 4N4OB 3DFGA 1V3FA 2Z1DA 1FP2A 5JHUA 5HLTA 1IN7A 2D1HA 3S2WA 2KISA 4B43A 2XHKA 2W1OA 2CO5A 2IEKA 3SZGA 1VQNI 2QCOA 2O61A 5HS9A 3TOBA 3SYTA 3MZHA 3IH4A 3IWFA 2Z3YA 2PLYA 1EJ9A 1HC8A 1FOYA 2QM3A 1Z3XA 1G8XA 1MMAA 3BC8A 2EB7A 1IG7A 2BE5F 1SD7A 5A2QZ 2H6BA 1YI2I 2OZUA 2DBBA 3ZN0A 3PNYA 1D3YA 2O7OA 4A3BJ 2H8RA 1DGWY 3I71A 3F8FA 1IRXA 4BKXA 2IJLA 3BLYA 2JPBA 4M9SA 3TQNA 1T08B 4HNUA 1OCCH 3U9GA 1E0EA 1HCRA 3C3WA 1POGA 2KHMA 3L00A 3WTXC 5L3EA 2JZYA 1TQPA 3OIQA 3MN2A 2ZMEB 2FNPA 3KX2A 1W0TA 3ZMVA 2GZWA 3H92A 2CQ7A 3H3ZA 3K10A 4OOIA 2XSDC 4BGDA 3ZMUA 3CCJI 4XOPA 2HPMA 2IS1A 2W84A 3KLNA 2MLKA 4N4NB 3SFZA 2IP2A 3VFZA 4HNVA 1P7JA 1V5EA 2FOKA 1K7AA 3H36A 2CV2A 2OA4A 2X4HA 4GCVA 4A6EA 3CTAA 3E6BA 1ETKA 5LRRA 3DEUA 4RGXA 2W7NA 1K61A 5DCFA 3EUHC 2W82A 4X1EA 1DPUA 2HNHA 1DGRM 2LOOA 4EGZA 5D4RA 3JRFA 4GRIA 3HZJA 3KEOA 3ZP5A 2KP6A 5BQTA 1SC7A 3NAUA 4PJ0C 2UXNA 2EFWA 2LY1A 5F0HA 4IHXA 1QVUA 2FNAA 4G7HF 3S1QJ 3RZOJ 4II3A 2LBFB 1EKEA 4AC0A 4YIFA 3KZIC 5GPCA 1JJ6C 2VQLA 3TO6A 5J3LA 5ED4A 2WAEA 2V1UA 1IDZA 3DWLE 3C2BA 5F0FA 4BL0B 3IL2A 3QPHA 1VQKI 5LGTA 3OL3A 3KP7A 3O8HA 3VSLA 4ZZLA 1D0YA 3F3XA 2F4IA 1X1DA 4D5CA 4I99C 4KN7X 3UNGC 1X1BA 1MBKA 3HPGA 1F1ZA 2F4OB 4YRVA 1LDJA 2XAUA 2PX9A 1MDMA 4I2OA 1M1EB 3M7GA 3FIWA 3PM1A 2E71A 1TC3C 3V8JA 3HDDA 4EM2A 5F1RA 4ZDPA 4S04A 3BG3A 2P6TA 2PG4A 1XDSA 2Y0SN 4G94A 1ZLKA 3LSHA 5K5RA 1FLIA 4U0YA 5IOYA 1I3AA 4XKCA 1LNWA 2DMTA 2MYSA 1UZCA 3NRVA 3R0JA 2IA2A 3L2QA 1I6XA 4BE0A 2PI0A 4HNTA 4L0ZB 4AWXB 1XGMA 2E60A 3BJ6A 5DM6F 3HIFA 1ZG3A 1P4XA 2L3DA 4G8XA 1SAUA 2MA3A 4HYEA 1LJ9A 5F6FA 4XONA 3JRHA 5BOXA 3M1CA 3F9KA 1O3SA 3KP5A 3TP0A 3J81K 2VASA 1R4NB 4MO7A 3SJMA 2XVCA 5IYDJ 1BR1A 2LVSA 5DUIA 3P9CA 4HBLA 2HTSA 1JKRC 1JUPA 1A35A 2XKPA 2M1BA 2CQKA 4YFXF 3AAFA 2R7UA 2DMQA 1QU3A 4ZYGA 4MTEA 1VQLI 5H6RA 5GAGJ 5A2QK 1O3RA 2M4KA 2IGKA 3D1NI 2BY0A 4IOCF 3HM5A 2B63J 2G7HA 4OU0A 1VFCA 3NWTA 1OYWA 4UUTA 2BZTA 4L5EA 4M9XA 5TGTA 2KDOA 1FSHA 1I39A 1WI3A 4K2EA 3H3UA 4IQJA 3LSRA 2RC4A 3OYJA 1R5HA 5HDGA 1W1WE 3Q0UA 4DW6A 1DP3A 2GAUA 2R5YB 2A6HF 3RKYA 4XBFA 4LGWA 3V7RA 3RSNA 2F6CA 2V1DA 1JGGA 2HYFA 1DPRA 5DM7F 4A3KJ 1KYWA 3FXQA 3PFYA 3T8RA 3DLLF 5K5QA 3PO3J 4Y13A 2L9NA 2NVTJ 5IP9J 2XRLA 2E1MC 5CVUA 2IVMA 3KCCA 1F9NA 2DPDA 1T95A 1W7PB 3KFWX 5J1RA 1J09A 3DTIA 3I58A 4L9VA 5GPAA 1IJWC 4U87A 2BXYA 1SEUA 2CFOA 3CDLA 4LLNA 3FXRA 2Q8KA 3BG6A 3FM3A 3NARA 1MMGA 5HLIA 4ANJA 4G7ZF 1R36A 1TQMA 4XLAA 2DFHA 1GT0C 5ERIA 4LJZF 4I0AA 3VPRA 3LQRA 1J75A 2JN6A 4XM3A 3CUQC 2KIUA 4IO9F 1E3OC 2E1NA 1JT6A 2HWVA 3ZN1A 3JRAA 2V6CA 1WVRA 2O8XA 4Z6YA 2V9KA 3OIOA 4ABZA 2R7FA 2EZKA 3GF2A 4BE2A 4A3IJ 4A5MA 2XGCA 1U8BA 3SQNA 1QHGA 2XIGA 2VJ5A 2RREA 2VKVA 1ZR2A 1S6LA 2D45A 1CF7A 4BS9A 3J80K 2QKLB 3G2BA 1HDPA 3HB9A 2FE3A 2V6EA 3U21A 5EEHA 1J0RA 1DUXC 5HODA 3J7AO 2E2JJ 4J19A 4XSZF 3I56I 3OS0A 3CMEI 3LSTA 2DJNA 4XKBA 2F4MB 5KCMA 5J8FA 1MJAA 3TDZC 3CCEI 3W6VA 2IT0A 3S3MA 1YIJI 2BOLA 2F5EA 1MMDA 2K3PA 1B72B 2LKSA 2IXSA 2W85A 2AXLA 4GDFA 2GQQA 1KQ9A 2JA8J 5FKMA 2EIMH 5ICCA 1FZPB 1G3TA 3OOUA 2GIZA 5C4XJ 4CYCA 4D0PA 4Z2YA 3EUKL 2IA0A 2R7WA 2MH9A 4RAZA 4U0VA 2HOSA 3PUBA 1P6RA 2H8WA 5IT3A 2F48A 2QLZA 1L0OC 1MBGA 4E6KG 2O9LA 3UKGA 1QPIA 2DCEA 1S9HA 2DT6A 4RGRA 1FBSA 2QQ8A 1GXQA 2BV6A 1WJFA 1R22A 3ECOA 5DTDA 4BYYA 2UXXA 5GADJ 3GTJJ 2RQQA 5K7ZA 3L2RA 3GTKJ 1X1PA 4LIVA 2UWMA 1QNTA 2VOOA 2CGPA 4U88A 1YG2A 4KYWA 3LOCA 3CCUI 2EV0A 1UHMA 3TO9A 1WJAA 1T39A 3X2QH 2CMPA 3CF2A 2ZKZA 1Y8QB 3S1NJ 4HAMA 4HLXA 2CJJA 2VPLA 3GFLA 4ZYAA 4RLFA 2L7ZA 1AA7A 3NQOA 2XV4S 4IHSA 4BQAA 2H1LA 1HA8A 3O8GA 1R7JA 1W5SA 5ICFA 4XQFA 2HVRA 3CCMI 2DU9A 3GTMJ 3MZ8A 5ICGA 1VF9A 1D5YA 4LG0B 2CUJA 1K78B 4MGRA 1ZAOA 4IOAF 3VB2A 4P5OA 2JT1A 1SVLA 2KZVA 4B8XA 3G6EI 3W6JB 2EK5A 1QPMA 2OU2A 2ZXHA 2H94A 1FOKA 4I7HA 3ZQFA 1HSTA 3MMYB 4DNCA 3ZQLA 2CSOA 3CC7I 1XS9A 1UG0A 3ZR8X 4FE4A 2E36A 4A5NA 2NNYA 3S15J 4NC7A 3CD6I 4P9FA 2CW8A 3M07A 3B73A 2Y9ZA 3CF5F 1OR7C 4JX4A 5FLVA 5D4SA 2EZLA 3ELKA 1TWHJ 4U0WA 1OCOH 2DA6A 2FSWA 3WE3A 4BHPA 3WG7H 2K9MA 1YLFA 4HW0A 5HLGA 2FD5A 1N77A 3E6MA 3BJAA 3LSIA 1X3ZB 4BXUA 3ULQB 4ZTJA 2QGUA 2V9VA 4BNCA 1P4AA 4BHBA 5B1AH 1YJWI 3AG2H 2RDPA 3BP8A 2YPRA 4LG3A 3CCYA 3F6VA 3FMRA 4EJVA 2VBWA 2NAZA 3CZ6A 1BI0A 3QOEA 4EQQA 1IDYA 1NHAA 3Q9VA 1MSEC 5B5EC 3BJOA 2LYCA 1Z7LA 1A5JA 1U0JA 1WQ2A 3BR2A 4BXXJ 1I50J 3FKIJ 3KEYA 1R5ID 2ISZA 2LF8A 1SD4A 3E5UA 2QBYA 2VI6A 5F64A 1JKOC 1ZELA 1OCTC 1YW7A 1ACIA 2K7LA 2W24A 5FKKA 4OMZA 1T38A 1V54H 1OYYA 1XMAA 1ZTRA 1IGNA 3L9FA 4ASNA 9ANTA 1GVDA 2GOXB 2R5ZA 1V5FA 1U9OA 4R1HA 1BIAA 3E7LA 1PP8F 4G6QA 1MJ9A 4HX7A 2WAFA 4IVNA 4UUSB 2JTVA 1Y56A 3RCOA 2VB6A 4AUXA 2IGOA 4QTRA 4ZZDA 1VQ5I 2R7OA 2M87A 2ESHA 3MWMA 2E7XA 3IHUA 5AONA 4HF2A 1OCZH 2YR2A 3L2CA 4G12A 3HBLA 4LLGF 3I9V2 3T8TA 5FRMA 3QPSA 2RNJA 3KZYA 1YRNA 1P2FA 4QSHA 3BTLA 4ZYDA 4ESJA 5E79C 5EDNA 1QZEA 3HUGB 1ZG1A 3OYKA 1W0UA 3IKVA 5AIPA 2A07F 2VIXA 2LNBA 3OYBA 1BR4A 3S8PA 3BCAA 3EDPA 3FM5A 2O8KA 3K1PA 1Z9CA 3ONQA 4KICA 2RV8A 4JP0A 2Z5UA 5JLXA 4A3GJ 2XASA 1RI7A 2DN0A 4KIFA 4BAYA 5M3MJ 3K4MA 1BR2A 5LHIA 3K4LA 1TNSA 5IP7J 4BBSJ 2XRNA 2J5OA 4Y17A 5F04A 1TW3A 1ETWA 1AWCA 4CCKA 1JUMA 3FHNA 3HYIA 1UFMA 2XF5A 5LRSA 1BM9A 1BW6A 1U5TA 4YG2F 2ESNA 4IXAA 4IKFA 1KU9A 2MC3A 3S1RJ 4BQQA 2OTLI 5FKLA 3GZ5A 3CO6C 3RPUD 2LTPA 1W5CC 1F4KA 2M8GX 3ZQQA 2H6CA 4R8HA 2F5CA 3JREA 2XGDA 4MEYF 5DD4A 1YHQI 1J9IA 3LFKA 1R00A 1H88C 2PQ8A 3A03A 4BY1J 3R61A 1R49A 1BI2A 1UJ8A 2ZMEC 4O6JA 2JA5J 2EV6A 2O3FA 3QODA 3G71I 3RJPA 3E6DA 3WTTC 2AQEA 4XLNF 5ILVA 4M6VA 4CCLA 2V1XA 3E3VA 2YU9J 4E7HA 4N0BA 2WC2A 4RBOA 1CQTA 1T33A 2DA1A 2QA4I 1G4DA 2L7MP 2ZB9A 4AIHA 3FXJA 3GMEA 4EJOA 2K4JA 4GYGA 2HDDA 1YS6A 1A04A 5DCMB 1D1AA 2DT7B 2EINH 4O5VA 2XAQA 1DU6A 2GM4A 3TDUC 2YS9A 3I4MJ 4PFOA 4BBRJ 3H9GA 4C2MJ 1IN8A 3ABKH 4II2A 2COBA 1VQ6I 2Z2SB 4W97A 3GZ6A 4CCNA 3JSOA 4PJMA 4X6AJ 2LK2A 4LFUA 3RTRA 3HG9A 4GXOA 2MBFA 4LK1F 2PMZA 2WY8Q 1EH6A 2EIKH 2O03A 2OJED 3FZVA 2HEOA 4NQWB 1D8KA 1FMVA 3DEWA 1PUFB 2IGMA 3QYEA 1ETYA 1FPQA 1K4TA 4HA8A 1H89C 3WGIA 5HVQC 2EFNA 3DPTA 3HC7A 4A3JJ 1ZH5A 1HF0A 3ESWB 2KLOA 2E1CA 2BVLA 2XGEA 2MC4A 2GXAA 5EGOA 1IV6A 4XK4A 1Y8RB 3IH2A 3HRUA 3NWSA 1ZGAA 4V2GA 2MGQA 4KIGA 1QVTA 5CKTA 1N78A 2XPVA 4LB6B 4M72A 1I6HJ 3PL8A 5KAIC 1DU0A 4IRGA 1QHHD 3Q5FA 4IEJA 2TDXA 1XSXA 1IUYA 1YOVB 2RGVA 1X1CA 1J5YA 2QZ8A 4BH9A 4O3MA 4YFKF 4B1RA 2HXIA 3K4KA 4L5JA 4S05A 1RR8C 3EYIA 3H3VK 1MIJA 1VQMI 2DOFA 3CUOA 3L2VA 1MZBA 3HKZN 4L5IA 5IOZA 3J81Z 3TEDA 3OSGA 2FQ4A 4DZJA 1SFXA 5HDKA 2K85A 3S3OA 1R71A 2X85A 3QU6A 2R5YA 4HPQA 4DQ2A 4XIDA 2BXZA 2FEZA 4CCMA 3S93A 2JQ7A 1OISA 3EPZA 2IS2A 1ERDA 1WI9A 1BOBA 2KIFA 3BDDA 4EM0B 4EGYA 2RNGA 3EUHA 2M2EA 2WB1N 2FJ1A 3KZZA 4OINF 4EM1A 3H9JA 3K70C 3RI4A 1B9NA 4KMUX 4AIJA 3FK6A 2WWYA 2ELJA 1LEBA 2H27A 1QZYA 2R7XA 2KZGA 5EEGA 4PJLA 2P81A 1IXRC 3RDIA 1MNMC 2VUMJ 2PBIA 2M0MA 2W00A 2DT5A 3V4GA 3G1LA 4RGSA 5F08A 4L9TA 3RKWA 1VQ9I 1T0FC 4LK0F 3F21A 2D5VA 3U2RA 2JPCA 2X1DA 1D0XA 1OLTA 2LY2A 2EFQA 2EZIA 2K40A 4HZFA 3SFIA 4HSRA 3S2DJ 3PFIA 4F91B 1S7EA 1X3UA 1E2XA 4A0YA 1A36A 1AKHB 2JRTA 2LF7A 5L3DA 2QSGX 2NYXA 4Y33A 1S29A 3K4JA 1MSFC 4A12A 3TMOA 4GGGA 3V42A 2V1NA 2JA7J 4RLQA 4CH7A 2DXIA 1WFXA 5C44J 4LB5A 2OCEA 3A0BC 5E3MA 3KYCB 5GAHJ 3AL0C 3ABTA 4BJ6C 2KKOA 1SD5A 3MQ0A 1B8IA 4IHVA 3FXLA 3HOWJ 3F8CA 4AIDA 1GUUA 1S8NA 3S3NA 2HQAA 1KYZA 4L0YB 1Z91A 4P9UA 3H5NA 2A5YB 4FTHA 2L02A 4NHJA 2EWNA 3K70D 4WF2A 2DK5A 3ERMA 2NVQJ 1Z67A 4OWRB 1UG2A 2A68F 3J80Z 3B6CA 4CXFA 3ZRGA 2P5VA 4U7BA 4HQEA 2QQBA 4UHTA 3I3LA 3M4OJ 2ZNYA 2DA7A 2HOEA 4A3MJ 2R7RA 1ENHA 3OR2C 1GDTA 3HTSB 3OR1C 4CGZA 5J1UA 1WWXA 3DF8A 1ONVA 4JK1X 2XROA 2WTEA 4QWQA 1XCVA 2COMA 1SANA 4NDLA 2XC7A 5EG0B 5M5WJ 1S72I 2L5QA 2HDCA 4OIOF 4A3EJ 2HVSA 3H5RA 1UCRA 2VKDA 3HGGA 5D5WB 3VYSB 3OYMA 2P4WA 3LA7A 1O3QA 3OOPA 4LOCA 2VODA 4CZCA 2R7DA 2O5RA 2UV1A 1PDNC 5KVRA 3W3CA 4L9JA 2LD5A 2G7UA 3PIOF 4Y7NJ 3WTUC 1LE8A 1AOYA 2Q2EB 3A4CA 5DEQA 1OQYA 3M8EA 1FYLA 3CCSI 4WCGA 4IX7A 2X6WA 4KFCA 2LRDA 1W36C 2P7CB 3GW2A 3WG9A 2FBKA 4DYCA 2DA3A 4C3HJ 2EPFA 4D7NA 1W7PD 2DFEA 2DW4A 2B9SA 1BIBA 4UV8A 1FJLA 2ISYA 4BJ5C 3RIRA 4PSXA 3HOXJ 2XUBA 1B6AA 2DA4A 4RB1A 2OD5A 1ZRDA 1UHWA 3GTOJ 3S16J 3QPTA 5KAFC 3OYEA 2OBPA 2R7TA 2KT0A 4EV0A 1W4MA 3Q9SA 2STWA 3KP3A 2RAEA 2PJRB 1NG7A 1I1SA 1WRJA 3EUAA 2P0WA 1ZGJA 1ZHFA 4FT8A 5K7FA 4KT5C 3KP6A 4IL6C 2X6YA 1LEAA 1UMQA 3IUOA 4QPOA 4XORA 2XAHA 2LFBA 2VJJA 2X48A 1LVAA 3CUQA 4BQNA 2Z33A 3FXKA 1F5TA 1DP7P 3GLLA 2EFPA 1Z21A 3M3YJ 2LLKA 2IA1A 1K79A 3ZMTA 3VYTB 4BE1A 1U2WA 3OV8A 1XTAA 1TWCJ 5C3EJ 4MTDA 5EEAA 4KDPA 4OIQF 1TWAJ 3AG4H 3BTIA 3AL0B 2GLOA 5JFRA 4LITA 2K86A 3UR3C 3ZQGA 1IXCA 2TRTA 5E18F 3GCMA 2DI3A 1VQ7I 1FSEA 1WJEA 2XF7A 3I5UA 3I59A 4LMYA 2Y31A 1A6QA 4AU7A 5CVRA 5CLSA 3A0HC 3BG9A 4ENKA 1V55H 4HV6A 1H9TA 4Y4RA 4GYIA 3SDGA 2E5ZA 3HRMA 3ROUA 1BJZA 2JUCA 2CQQA 2OZ6A 4G6TB 1LFBA 2ME6A 1T8IA 1R5GA 3ASNH 1BI3A 2NNNA 4M3FA 4F93B 3MEXA 5EJCA 4OAZA 1XCBA 4BEHA 1Y1WJ 3OYAA 1EV7A 4PGGA 3IV5A 1YQAA 1GXPA 1OMIA 3MCZA 2V4JC 4M9ZA 4AYBN 2A5WA 2L4AA 3ABUA 4XLCA 2HQNA 2WY7Q 2CU7A 2XPWA 2EV5A 2FBHA 3WHCA 4UVCA 2HVQA 1DDNA 5M5YJ 3CMMA 1FTTA 1IF1A 3L2UA 4AVPA 1T56A 4A3CJ 4H4KC 1PUEE 5FJ8J 2XB0X 4D7MA 2UZKA 1OFCX 2RQPA 1R1UA 3BZ6A 1QBJA 3H0GJ 4AVZA 1R4MB 3JRCA 1XSDA 2K3FA 1N75A 2MABA 2W57A 3F0CA 3R60A 2H1KA 4A69C 2V26A 2R7ZJ 2Z99A 4IHWA 2M8EA 2GIVA 3GFMA 2STTA 1YX3A 5CJ9A 3GX4X 3LMMA 2DTZA 3DTEA 1UB9A 2K9LA 2F5VA 1XDUA 1IN5A 2QEXI 3ZMZA 5C4JJ 3CCQI 4HQMA 3LAJA 3W2AA 2CW7A 3K0LA 2HFHA 3S17J 3RPQA 2O0YA 4L9NA 2OV7A 3HSEA 5E20A 2GBYA 2KQRA 3DEEA 3GBGA 3LL7A 1MH4A 5D6FA 5F27A 3WTVC 2R0QC 5CPRB 5M3FJ 2VC1A 4I09A 4ZYEA 3E0JB 3MKWB 4LLLA 2QF7A 3ABMH 4D5FA 3I53A 4HV5A 1GV5A 4PJNA 1RESA 2B7EA 2VQGA 2BEOA 4B48A 2FOWA 4KT6A 4B47A 2BW3A 3Q0WA 3MFKA 4GO1A 1K4SA 2A3SA 1MDMB 1WH5A 1WJBA 2H09A 4XOTA 2X1CA 1SAXA 3IRQA 3GTQJ 3ZQ7A 5GAEJ 2LKXA 2DA2A 2BGCA 3N05A 1KU2A 3RYPA 3OS2A 4UNOA 2VBXA 3R4KA 1SD6A 2ZJQF 2DYRH 2VPRA 5J8CA 4A93J 2VKEA 3KIOA 4A3LJ 2HDWA 2R7SA 2DMNA 2FMLA 3N4MA 4FX0A 1X4OA 2M0CA 2AHQA 5F0CA 1HBXG 1BBYA 3LSKA 3VODA 1R58A 1LUJB 2L7KA 2QKMB 3C2HA 2KMUA 4CHUA 3OYIA 1YX5A 5LFAA 1MJBA 1X19A 3RYRA 3LFUA 1QGPA 2FA5A 4XR6A 3H9QA 1BA5A 1EA3A 3HSRA 5FLXZ 4RM2A 1LPQA 2EBIA 3S2HJ 2CS3A 3QQAA 4WX9A 1S7AA 2F5DA 2HR3A 1IW7F 2KIMA 1WPKA 3RQIA 3HSFA 3WU2C 3ZMDA 3RKXA 1HQCA 2E19A 2DOAA 5H20A 2G0EA 2DDAA 5KK1A 1I27A 4CA0A 5J6XA 3FISA 2Y2ZA 4IRIA 2XAGA 3R6SA 5TRDA 3HOSA 2R92J 3RKQA 3KPHA 3BR6A 3LSMA 2Y9YA 3LSJA 3ZPLA 4RS8A 3VDXA 1P7IA 2VT3A 3ZQIA 3A01A 1R6RA 2K5CA 4N9HA 3BR0A 3BTCA 1REPC 1GVJA 1FIPA 2WA0A 2ZNZA 3JCUC 1YJNI 3HOUJ 1J2XA 3P7NA 1S3JA 2GA1A 2ZFUA 3W2WA 2YUSA 3C18A 4HDUA 5IPAA 1VTNC 4CZZA 3ML6A 2QQAA 3RPUA 5J4VA 5LHGA 1KZHA 2JVHA 3SEQA 2KL4A 1RNLA 3CP2A 2VJ4A 1J59A 1MNDA 3DPLC 2HKXA 5FFXA 5B3SH 1WJCA 3C7JA 3JRDA 4CDGA 4A3FJ 2EZHA 3KLOA 3O3KA 2UUZA 2FX0A 2DODA 1FYMA 4PFPA 4X0GA 4YIRX 2CV1A 3TW6A 4E7IA 1Q1HA 4XRMA 2AO9A 4RB2C 1TNTA 1XG1A 1N25A 2NS8A 1LDKB 5CYVA 3SEZA 5D5UB 4ESBA 3DLAA 2KRFA 2PEXA 4ZYHA 2PMUA 1UELB 2Y0SA 3LAPA 1OJLA 2MFZA 3CO7C 1XGNA 2HOTA 3CJQB 1P4WA 1ZN2A 2DMUA 2JA2A 2CV0A 3HGYA 1G3WA 4MLOA 5EZHA 2JMWA 3QPLA 2CW0F 4RA2A 5GTIC 1HXDA 1XPXA 2CQXA 2OPTA 4FCYA 4MNUA 3BCBA 3FMQA 5JI6A 2LP0A 2PFBA 4C30A 3CMAI 1UAAA 2FQ3A 1I1GA 3QAHA 5EYRA 1MNEA 4HG2A 2DMPA 4E7JA 3I0TA 2HPIA 1FEXA 3WU1B 2OCCH 5ILUA 1CF7B 4F92B 3A02A 4DBRA 1GLNA 2OQGA 1FY7A 3N97A 1D1CA 1HW2A 1H9GA 1AU7A 3F8MA 2L2OA 4DJAA 2VONA 4NC8A 3K1NA 3GEZA 4IHYA 1ZR4A 4V19K 3T5XA 2DA5A 4I98B 3F22A 1V4RA 2DQRA 1FX7A 1Z1DA 1SMYF 1VQPI 4MIMA 3PQKA 5IT9K 1STZA 2ZMEA 2NVUB 2JJ7A 4PZJA 2OF7A 3EETA 1SMTA 3C1DA 3RQ4A 4C2TA 1B1BA 1KQ0A 3K4NA 1FBUA 1BJAA 5LLQA 4BY7J 1KONA 1RETA 2ID6A 1JT0A 2GA2A 5E1ZB 2JWTA 4UB8C 4QPQA 4XNFA 1Z6TA 3ISPA 3OSFA 1HKQA 3Q3SA 5H6QA 2X1EA 4KISA 4F55A 3K2AA 3G3ZA 4MHGA 2ZSHB 3J7ZI 5FLXK 2ACJA 2P5LC 1XMKA 3F6OA 5B1BH 1OYIA 3BTJA 1WJDA 3FK7A 1ON1A 3JTGA 4G7OF 1V5GA 1NTCA 4HOBA 2FBIA 2L9RA 4XKVA 5JVTA 1FOXA 2LDUA 2LY9A 1G2HA 4IQ4A 1QRYA 2XAFA 2A05A 3OIPA 3ABLH 2ID3A 3CMYA 2BY3A 3I4NJ 3QU3A 2ZJPF 4AM3A 2LBFA 1ZK8A 3C2GA 4YIIA 2P6SA 2FMYA 3I64A 1YS7A 2P5KA 3BQZA 4UY8I 1Q1VA 1EH8A 4M3GA 5KHDA 4RMNA 2EIJH 1TTYA 4FE7A 3Q0VA 3WU0A 2JRMA 1FT9A 5CQGA 5HNFA 1R1VA 3PNTA 2X9DA 3MD2A 1ULYA 3MKYB 1PJRA 3T0YA 1H0MA 3PO2J 3EQLF 5DDGA 3OL4A 1TWGJ 3GVAA 1SVMA 2DDBA 5H2FC 2WBMA 4B44A 2GXGA 1XB4A 1MBJA 3B6AA 3PSFA 2XSJC 2FXAA 4FQGA 3U1KA 1XD7A 1O57A 2HXOA 3CDHA 2L0KA 3FHZA 4M71A 4HLYA 1SFKA 2LMDA 4BHCA 4Q5SF 3WTWC 2F5FA 3SZPA 1LB2A 2OQRA 4JX6A 1CGPA 2EILH 3S32A 1SFEA
chains in the Genus database with same CATH topology
2VT2A 2IPQX 5L3BA 4R79A 5E8GA 3QOPA 2VE8A 3FX3A 4Q48A 2QENA 2JSCA 2KJCA 3CLOA 3WTSC 1IN4A 2E7WA 5ILSA 2OAZA 3U1DA 1T0FA 2QWWA 4G9YA 1IN6A 2QBYB 4WK8F 3PQJA 2FF4A 4JBAA 2L01A 5L3CA 1IAWA 1YTYA 1O7FA 3G73A 5LEJA 2IW5A 1FC3A 2RN7A 1L3LA 2MLGA 4L18B 4HF0A 3GO5A 4EJUA 4WXDA 2RVCA 3LA2A 1W7PA 2X0LA 1FBQA 3FWEA 4PGHA 3K9TA 5D6EA 4M73A 3GXOA 1XSVA 1Z6RA 2CFXA 1LQ1A 2GXBA 1USTA 1KA8A 3IKTA 2O6GE 1W5TA 3DP7A 4WWCA 4UVAA 5CVIA 1D8JA 4UXNA 2QUFA 2VE9A 4RB3C 1BC7C 4U7DA 2DO7A 2NRAC 1ZG5A 5HLHA 4OIPF 2K27A 4MEXF 1U5TB 2DAOA 2WV0A 3LQQA 4XSXF 5LEKA 4KNYA 3WTZA 1G3SA 4OIRF 1JGSA 1O7LA 3M9AA 3O6BB 3GUDA 3QP5A 6PAXA 2Q0OA 2EJRA 4MQ9F 1JHFA 4F7ZA 3D5LA 1LDDA 1RUNA 3K1MA 2G9WA 1IRGA 1S7OA 1HW1A 2ZFWA 5D8LB 2VBZA 1U78A 4I01A 2L54A 4YFNF 2V79A 2F2EA 4CO8A 4B09A 2K02A 2HTJA 4KIBA 3P9IA 4PDKA 1FP1D 3TO7A 4FHTA 4IJAA 1TBXA 3SZTA 3W6KB 5D5VB 5DV5A 2HQRA 1ZARA 3K69A 4ENNA 3BPVA 1T6SA 2HYGD 3WGHA 3KEQA 3BPXA 3WODF 4JQFA 2M30A 3D0SA 3KP4A 1MKMA 2EA2A 4LG0A 2P7VB 3NEUA 3COAC 1K78A 4Q4ZF 2BYVE 2A69F 1MD0A 2DQLA 4PCQA 2Y75A 3HOTA 2VOPA 3SHFA 2B0LA 3REOA 1FNNA 3BOQA 3GFJA 5L3GA 3JSPA 4M6XA 5D5XB 5E1XA 1RUOA 3GLXA 1TLHB 2M5WA 2XAJA 4HX4A 1SFUA 1P92A 2LSOA 1E17A 4KUMA 5AIQA 5BPDA 1OPCA 1YW8A 5D8KB 2VC0A 5BMZA 2QYOA 1ZRCA 2D2WA 3B02A 4RGUA 4KN4X 2DPUA 5HS8A 2DLLA 5L3FA 3WE2A 2EFOA 1ZLJA 1U3EM 2MD5A 4ON0A 4ESFA 3L09A 1ZYRF 4EJWA 2NS0A 4G6DA 3VEPA 4TV7A 3HRSA 5FD6A 2EA4A 1XGOA 3QP6A 3JTHA 1KU7A 1T98A 5ICEA 2PN6A 3TGNA 2VBYA 4Q47A 3F23A 2L4MA 5LGUA 3V7SA 3BROA 3ERED 2IRFG 1MGTA 4Y15A 2MH2A 3HUGA 1GHCA 3T1BA 4P55A 3JAMZ 4EVIA 3KETA 3L7WA 3V7CA 1WKMA 3LWFA 4LD5A 3O2PE 3KE2A 1C0WA 5HOOA 3E5QA 2YU3A 5K1YA 1T2KA 2GWRA 4ETSA 5K5OA 3I4PA 4RB0A 1IZ1A 3K2ZA 5IT9Z 1OR7A 5E8IA 4WXCA 3EYYA 5E17F 1ZREA 1XN7A 5FD5A 1J7KA 4CICA 4AD9A 2LKPA 3E5XA 5CVJA 4IF4A 5LHHA 2ETHA 1RIOH 3DV8A 1QO0D 2ZBKA 1G3YA 5TJJA 2DK8A 2QVOA 3FXUA 4OMYA 4EMSA 5LBQA 4A0XA 3DKWA 1JXSA 3HTUA 1B9MA 5HDNA 3WTYC 1HSJA 3SXYA 5DD8A 5DCMA 3TOAA 1OKRA 1HKSA 4AIKA 1FYKA 2ZJ2A 2HGCA 2CYYA 2BBYA 3CUQB 3IWZA 3GYHX 5FB2A 4HX8A 2C6YA 1Z7UA 2HZTA 2VN2A 4NQWA 1R23A 1B4AA 4M6YA 3KP2A 1K6OA 3BWGA 2YX4A 3GFIA 3QRFF 4IHTA 4KMFA 1YFHA 4XRFA 1I5ZA 3DXJF 1IXSB 3I59B 3CJNA 2HKOA 5FFZA 4WXHA 3HRTA 2CWEA 3M8FA 3F72A 2ZXJA 1RZ4A 1BI1A 2YSRA 2R3SA 2HS5A 1U8RA 3TKYA 4IRHA 5LGNA 4A6DA 1JE8A 1BN5A 2P8TA 4IPAA 3JAMK 4HF1A 1YYVA 1XGSA 2Y48A 5CVVA 4A2UA 4H0EA 3FF5A 3LA3A 3IRRA 1G6NA 4UVBA 3GWZA 2A61A 1PP7U 1B59A 2ZCWA 1R1TA 2XGXA 2D1VA 1Y0UA 3BY6A 2PMHA 4XLPF 2XKOA 4NB5A 5BS6A 3MZYA 4I02A 1TW2A 5FO5A 3F8NA 3V8KA 2KJBA 2Z9OA 3DQVC 2K4BA 1KGSA 5HS7A 4MQVA 1YO5C 1USSA 5E1WA 4RAYA 1YIOA 3M1EA 3I54A 2W25A 2PJPA 5BPIA 2M45A 4E70A 1YW9A 3VOEA 4P96A 1ZRFA 1BOAA 2ZO4A 3E6CC 1D5VA 3V8LA 1KU3A 1JHHA 5JR3A 2RKHA 1HW5A 2DTRA 3HHHA 1QZZA 4M74A 2A6EF 1TQIA 3P9KA 4ENMA 2VXZA 2CG4A 3F8BA 1WSUA 2FRHA 2FU4A 4KA4A 1U5TC 5DYMA 4UUVA 2DFIA 2Q2EA 3FMSA 1U6GA 1QQIA 4ZH4F 1IRFA 3HHGA 2YX7A 4I0BA 4N9IA 3JW4A 5FGMA 3ZMSA 3E97A 1EH7A 2AS5F 3MAJA 1BC8C 3IC7A 1ON2A 3ECHA 4CYDA 3R0AA 2QQ9A 4EJTA 4HDVA 1Z05A 4UV9A 2ADUA 3WGGA 1HKTA 1ODDA 2Y0MA 2J5PA 1FWZA 4A0ZA 4ENJA 1O3TA 1KQ8A 4QLCU 4FX4A 5DUKA 2ELHA 3DFGA 1V3FA 5JHUA 1FP2A 1IN7A 2D1HA 3S2WA 2XHKA 2CO5A 2O61A 5HS9A 3TOBA 3MZHA 3IWFA 2Z3YA 2PLYA 2QM3A 2EB7A 2BE5F 1SD7A 5A2QZ 2H6BA 2OZUA 2DBBA 3ZN0A 1D3YA 3I71A 3F8FA 2IJLA 2JPBA 4M9SA 3TQNA 3U9GA 3C3WA 3L00A 3WTXC 5L3EA 2JZYA 1TQPA 2ZMEB 2FNPA 3ZMVA 2GZWA 3H92A 3H3ZA 4OOIA 3ZMUA 2W84A 3KLNA 2MLKA 3SFZA 2IP2A 3VFZA 1K7AA 2FOKA 2OA4A 2X4HA 4GCVA 4A6EA 3CTAA 3E6BA 5LRRA 3DEUA 4RGXA 5DCFA 1DPUA 4EGZA 5D4RA 3KEOA 3ZP5A 5BQTA 2UXNA 2EFWA 2FNAA 4G7HF 4YIFA 3TO6A 5ED4A 2V1UA 3IL2A 3QPHA 5LGTA 3KP7A 4ZZLA 3F3XA 4KN7X 1F1ZA 1LDJA 1MDMA 4I2OA 3M7GA 3V8JA 4EM2A 5F1RA 4S04A 2P6TA 2PG4A 1XDSA 4G94A 1ZLKA 5K5RA 1FLIA 4U0YA 1LNWA 3NRVA 3R0JA 2IA2A 1I6XA 2PI0A 4L0ZB 4AWXB 1XGMA 3BJ6A 3HIFA 1ZG3A 1P4XA 2L3DA 4G8XA 2MA3A 4HYEA 1LJ9A 5F6FA 5BOXA 1O3SA 3KP5A 3J81K 2XVCA 5DUIA 3P9CA 4HBLA 2HTSA 2XKPA 2M1BA 2CQKA 4YFXF 3AAFA 4ZYGA 4MTEA 5H6RA 5A2QK 1O3RA 2G7HA 4OU0A 1OYWA 4M9XA 1FSHA 4K2EA 3H3UA 2RC4A 1R5HA 5HDGA 2GAUA 2A6HF 3RKYA 4XBFA 4LGWA 3V7RA 2V1DA 2HYFA 1DPRA 1KYWA 3FXQA 3T8RA 5K5QA 4Y13A 5CVUA 2IVMA 3KCCA 1F9NA 2DPDA 1W7PB 3KFWX 3I58A 4L9VA 4LLNA 3FXRA 2Q8KA 3FM3A 5HLIA 4G7ZF 1R36A 1TQMA 5ERIA 4LJZF 4I0AA 3LQRA 1J75A 3CUQC 2KIUA 2E1NA 2HWVA 3ZN1A 2V6CA 2O8XA 2R7FA 3GF2A 4A5MA 3SQNA 2XIGA 1S6LA 2D45A 1CF7A 3J80K 2FE3A 5EEHA 1J0RA 1DUXC 3J7AO 4XSZF 3LSTA 5J8FA 1MJAA 3TDZC 2IT0A 2F5EA 2W85A 2AXLA 2GQQA 1KQ9A 5ICCA 1FZPB 1G3TA 4D0PA 4Z2YA 2IA0A 2MH9A 4RAZA 4U0VA 1P6RA 5IT3A 2QLZA 1L0OC 4RGRA 1FBSA 1GXQA 2BV6A 1R22A 3ECOA 4BYYA 2UXXA 2UWMA 1QNTA 2VOOA 2CGPA 4U88A 1YG2A 4KYWA 2EV0A 1UHMA 3TO9A 1T39A 2ZKZA 4HAMA 4HLXA 3GFLA 3NQOA 2XV4S 4IHSA 4BQAA 1R7JA 1W5SA 5ICFA 2DU9A 5ICGA 4LG0B 1K78B 4MGRA 1ZAOA 3VB2A 4P5OA 2JT1A 4B8XA 3W6JB 2EK5A 1QPMA 2OU2A 1FOKA 2H94A 4I7HA 1HSTA 4DNCA 2CSOA 4A5NA 2NNYA 4P9FA 3B73A 5D4SA 3ELKA 4U0WA 2FSWA 4BHPA 3WE3A 1YLFA 4HW0A 5HLGA 3E6MA 3BJAA 4BXUA 3ULQB 2V9VA 4BNCA 1P4AA 4BHBA 2RDPA 3BP8A 2YPRA 3F6VA 3FMRA 4EJVA 2VBWA 2NAZA 1BI0A 4EQQA 1NHAA 3Q9VA 3BJOA 1WQ2A 2ISZA 2LF8A 1SD4A 3E5UA 2QBYA 5F64A 1YW7A 2K7LA 2W24A 4OMZA 1T38A 1OYYA 1XMAA 3L9FA 4ASNA 4R1HA 1BIAA 1PP8F 4G6QA 1MJ9A 4HX7A 4IVNA 2JTVA 4ZZDA 2M87A 2ESHA 3MWMA 2E7XA 3IHUA 5AONA 4HF2A 2YR2A 3L2CA 3T8TA 4LLGF 2RNJA 3KZYA 1P2FA 4ZYDA 4ESJA 1ZG1A 3IKVA 5AIPA 2A07F 2LNBA 3EDPA 3FM5A 3K1PA 1Z9CA 4KICA 2RV8A 2Z5UA 2XASA 1RI7A 4KIFA 4BAYA 5LHIA 1TNSA 2XRNA 2J5OA 4Y17A 1TW3A 1AWCA 1SFEA 3HYIA 1UFMA 5LRSA 1BM9A 1U5TA 4YG2F 2ESNA 4IXAA 1KU9A 2MC3A 3GZ5A 3CO6C 1F4KA 2H6CA 4R8HA 2F5CA 4MEYF 5DD4A 1J9IA 3LFKA 1R00A 2PQ8A 3R61A 1BI2A 4O6JA 2EV6A 2O3FA 3RJPA 3E6DA 3WTTC 4XLNF 5ILVA 2V1XA 3E3VA 4N0BA 2WC2A 1G4DA 4AIHA 4EJOA 2K4JA 4GYGA 1YS6A 1A04A 5DCMB 2XAQA 3TDUC 1IN8A 3GZ6A 3JSOA 4LFUA 3RTRA 4GXOA 2MBFA 4LK1F 1EH6A 2O03A 3FZVA 2HEOA 1D8KA 1FPQA 4HA8A 3WGIA 5HVQC 2EFNA 3DPTA 1ZH5A 2E1CA 3HRUA 1ZGAA 4KIGA 4LB6B 4M72A 4IRGA 3Q5FA 2TDXA 1XSXA 1IUYA 2RGVA 1J5YA 2QZ8A 4BH9A 4O3MA 4YFKF 3EYIA 4L5JA 4S05A 3CUOA 1MZBA 4L5IA 3J81Z 1SFXA 5HDKA 3QU6A 4DQ2A 2FEZA 1WI9A 2KIFA 3BDDA 4EM0B 4EGYA 3EUHA 4OINF 3KZZA 4EM1A 3RI4A 1B9NA 4KMUX 4AIJA 2WWYA 1LEBA 2H27A 1QZYA 5EEGA 1IXRC 3RDIA 2PBIA 3V4GA 2DT5A 4RGSA 4L9TA 3RKWA 4LK0F 3F21A 3U2RA 2JPCA 4HZFA 2EFQA 3PFIA 1X3UA 1E2XA 4A0YA 2JRTA 2LF7A 5L3DA 2NYXA 1S29A 4A12A 4GGGA 4LB5A 3ABTA 2KKOA 1SD5A 3MQ0A 3F8CA 1S8NA 1KYZA 4L0YB 1Z91A 4P9UA 2A5YB 2L02A 4NHJA 2EWNA 4WF2A 2DK5A 3J80Z 2A68F 4CXFA 2P5VA 4U7BA 4HQEA 2QQBA 4UHTA 2ZNYA 2HOEA 3HTSB 4CGZA 3DF8A 1WWXA 4JK1X 1ONVA 2XROA 2WTEA 4QWQA 1XCVA 2COMA 4OIOF 2HDCA 1UCRA 5D5WB 2P4WA 3LA7A 1O3QA 3OOPA 2VODA 2R7DA 1PDNC 5KVRA 4L9JA 2G7UA 3WTUC 1AOYA 5DEQA 3M8EA 1FYLA 4WCGA 4KFCA 2P7CB 3GW2A 3WG9A 2FBKA 1W7PD 2DW4A 1BIBA 4UV8A 2ISYA 3RIRA 2XUBA 1B6AA 4RB1A 2OD5A 1ZRDA 1UHWA 3QPTA 2OBPA 4EV0A 1W4MA 3Q9SA 2STWA 3KP3A 1I1SA 1WRJA 1ZGJA 1ZHFA 4FT8A 4KT5C 3KP6A 1LEAA 2XAHA 3CUQA 2Z33A 1LVAA 1F5TA 1DP7P 2EFPA 2IA1A 1K79A 3ZMTA 1U2WA 3OV8A 4MTDA 4KDPA 4OIQF 5JFRA 2K86A 1IXCA 5E18F 2DI3A 1FSEA 3I5UA 3I59A 4LMYA 5CVRA 5CLSA 4ENKA 4HV6A 1H9TA 4GYIA 3HRMA 3ROUA 2OZ6A 1R5GA 1BI3A 2NNNA 3MEXA 1XCBA 1EV7A 4PGGA 1YQAA 1GXPA 1OMIA 3MCZA 4M9ZA 2L4AA 3ABUA 2HQNA 2EV5A 2FBHA 4UVCA 1DDNA 1IF1A 4AVPA 1PUEE 2UZKA 2RQPA 1R1UA 3BZ6A 1QBJA 1XSDA 2W57A 3R60A 2Z99A 2M8EA 2GIVA 3GFMA 2STTA 5CJ9A 3GX4X 1UB9A 1XDUA 1IN5A 3ZMZA 4HQMA 3LAJA 3K0LA 2HFHA 3RPQA 2O0YA 4L9NA 3HSEA 5E20A 3WTVC 5D6FA 2VC1A 4I09A 4ZYEA 4LLLA 3I53A 4HV5A 2BEOA 3MFKA 4GO1A 2A3SA 1MDMB 2H09A 1SAXA 3IRQA 3ZQ7A 2BGCA 4UNOA 1KU2A 3RYPA 2VBXA 3R4KA 1SD6A 5J8CA 2FMLA 3N4MA 4FX0A 1HBXG 1BBYA 3VODA 1R58A 4CHUA 1MJBA 3RYRA 1QGPA 2FA5A 3HSRA 5FLXZ 4WX9A 1S7AA 2F5DA 2HR3A 1IW7F 2KIMA 3ZMDA 3HSFA 3RKXA 1HQCA 5H20A 5KK1A 1I27A 5J6XA 4IRIA 2XAGA 3R6SA 5TRDA 3HOSA 3ZPLA 4RS8A 2VT3A 4N9HA 1REPC 1GVJA 2ZNZA 1J2XA 3P7NA 1S3JA 2GA1A 3C18A 4HDUA 1VTNC 4CZZA 3ML6A 2QQAA 3RPUA 5LHGA 1RNLA 1J59A 3DPLC 2HKXA 5FFXA 3C7JA 4CDGA 3KLOA 3O3KA 1FYMA 1Q1HA 4RB2C 1TNTA 1LDKB 5CYVA 5D5UB 4ESBA 2KRFA 2PEXA 4ZYHA 2PMUA 3LAPA 3CO7C 1XGNA 1P4WA 1ZN2A 1G3WA 2CW0F 1HXDA 4MNUA 5JI6A 3FMQA 2PFBA 2FQ3A 1I1GA 3QAHA 3I0TA 3WU1B 5ILUA 1CF7B 2OQGA 1FY7A 3N97A 1HW2A 1H9GA 3F8MA 2VONA 3K1NA 3GEZA 3T5XA 4I98B 3F22A 1V4RA 2DQRA 1FX7A 1Z1DA 1SMYF 3PQKA 5IT9K 1STZA 2ZMEA 4PZJA 3EETA 1SMTA 3C1DA 1B1BA 1KQ0A 1FBUA 1BJAA 5LLQA 2GA2A 5E1ZB 1Z6TA 3ISPA 1HKQA 5H6QA 3G3ZA 4MHGA 5FLXK 2ACJA 2P5LC 1XMKA 3F6OA 1OYIA 3JTGA 1ON1A 4G7OF 4HOBA 2FBIA 5JVTA 2LDUA 2XAFA 3QU3A 4YIIA 2P6SA 2FMYA 3I64A 1YS7A 2P5KA 1EH8A 1TTYA 3WU0A 1FT9A 1R1VA 1ULYA 3T0YA 1H0MA 3EQLF 5DDGA 3GVAA 2GXGA 1XB4A 2FXAA 1XD7A 1O57A 3CDHA 4HLYA 3FHZA 4M71A 4BHCA 4Q5SF 3WTWC 2F5FA 3SZPA 1LB2A 2OQRA 1CGPA 4O5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VT2 A;  2IPQ X;  5L3B A;  4R79 A;  5E8G A;  3QOP A;  2VE8 A;  3FX3 A;  4Q48 A;  2QEN A;  2JSC A;  2KJC A;  3CLO A;  3WTS C;  1IN4 A;  2E7W A;  5ILS A;  2OAZ A;  3U1D A;  1T0F A;  2QWW A;  4G9Y A;  1IN6 A;  2QBY B;  4WK8 F;  3PQJ A;  2FF4 A;  4JBA A;  2L01 A;  5L3C A;  1IAW A;  1YTY A;  1O7F A;  3G73 A;  5LEJ A;  2IW5 A;  1FC3 A;  2RN7 A;  1L3L A;  2MLG A;  4L18 B;  4HF0 A;  3GO5 A;  4EJU A;  4WXD A;  2RVC A;  3LA2 A;  1W7P A;  2X0L A;  1FBQ A;  3FWE A;  4PGH A;  3K9T A;  5D6E A;  4M73 A;  3GXO A;  1XSV A;  1Z6R A;  2CFX A;  1LQ1 A;  2GXB A;  1UST A;  1KA8 A;  3IKT A;  2O6G E;  1W5T A;  3DP7 A;  4WWC A;  4UVA A;  5CVI A;  1D8J A;  4UXN A;  2QUF A;  2VE9 A;  4RB3 C;  1BC7 C;  4U7D A;  2DO7 A;  2NRA C;  1ZG5 A;  5HLH A;  4OIP F;  2K27 A;  4MEX F;  1U5T B;  2DAO A;  2WV0 A;  3LQQ A;  4XSX F;  5LEK A;  4KNY A;  3WTZ A;  1G3S A;  4OIR F;  1JGS A;  1O7L A;  3M9A A;  3O6B B;  3GUD A;  3QP5 A;  6PAX A;  2Q0O A;  2EJR A;  4MQ9 F;  1JHF A;  4F7Z A;  3D5L A;  1LDD A;  1RUN A;  3K1M A;  2G9W A;  1IRG A;  1S7O A;  1HW1 A;  2ZFW A;  5D8L B;  2VBZ A;  1U78 A;  4I01 A;  2L54 A;  4YFN F;  2V79 A;  2F2E A;  4CO8 A;  4B09 A;  2K02 A;  2HTJ A;  4KIB A;  3P9I A;  4PDK A;  1FP1 D;  3TO7 A;  4FHT A;  4IJA A;  1TBX A;  3SZT A;  3W6K B;  5D5V B;  5DV5 A;  2HQR A;  1ZAR A;  3K69 A;  4ENN A;  3BPV A;  1T6S A;  2HYG D;  3WGH A;  3KEQ A;  3BPX A;  3WOD F;  4JQF A;  2M30 A;  3D0S A;  3KP4 A;  1MKM A;  2EA2 A;  4LG0 A;  2P7V B;  3NEU A;  3COA C;  1K78 A;  4Q4Z F;  2BYV E;  2A69 F;  1MD0 A;  2DQL A;  4PCQ A;  2Y75 A;  3HOT A;  2VOP A;  3SHF A;  2B0L A;  3REO A;  1FNN A;  3BOQ A;  3GFJ A;  5L3G A;  3JSP A;  4M6X A;  5D5X B;  5E1X A;  1RUO A;  3GLX A;  1TLH B;  2M5W A;  2XAJ A;  4HX4 A;  1SFU A;  1P92 A;  2LSO A;  1E17 A;  4KUM A;  5AIQ A;  5BPD A;  1OPC A;  1YW8 A;  5D8K B;  2VC0 A;  5BMZ A;  2QYO A;  1ZRC A;  2D2W A;  3B02 A;  4RGU A;  4KN4 X;  2DPU A;  5HS8 A;  2DLL A;  5L3F A;  3WE2 A;  2EFO A;  1ZLJ A;  1U3E M;  2MD5 A;  4ON0 A;  4ESF A;  3L09 A;  1ZYR F;  4EJW A;  2NS0 A;  4G6D A;  3VEP A;  4TV7 A;  3HRS A;  5FD6 A;  2EA4 A;  1XGO A;  3QP6 A;  3JTH A;  1KU7 A;  1T98 A;  5ICE A;  2PN6 A;  3TGN A;  2VBY A;  4Q47 A;  3F23 A;  2L4M A;  5LGU A;  3V7S A;  3BRO A;  3ERE D;  2IRF G;  1MGT A;  4Y15 A;  2MH2 A;  3HUG A;  1GHC A;  3T1B A;  4P55 A;  3JAM Z;  4EVI A;  3KET A;  3L7W A;  3V7C A;  1WKM A;  3LWF A;  4LD5 A;  3O2P E;  3KE2 A;  1C0W A;  5HOO A;  3E5Q A;  2YU3 A;  5K1Y A;  1T2K A;  2GWR A;  4ETS A;  5K5O A;  3I4P A;  4RB0 A;  1IZ1 A;  3K2Z A;  5IT9 Z;  1OR7 A;  5E8I A;  4WXC A;  3EYY A;  5E17 F;  1ZRE A;  1XN7 A;  5FD5 A;  1J7K A;  4CIC A;  4AD9 A;  2LKP A;  3E5X A;  5CVJ A;  4IF4 A;  5LHH A;  2ETH A;  1RIO H;  3DV8 A;  1QO0 D;  2ZBK A;  1G3Y A;  5TJJ A;  2DK8 A;  2QVO A;  3FXU A;  4OMY A;  4EMS A;  5LBQ A;  4A0X A;  3DKW A;  1JXS A;  3HTU A;  1B9M A;  5HDN A;  3WTY C;  1HSJ A;  3SXY A;  5DD8 A;  5DCM A;  3TOA A;  1OKR A;  1HKS A;  4AIK A;  1FYK A;  2ZJ2 A;  2HGC A;  2CYY A;  2BBY A;  3CUQ B;  3IWZ A;  3GYH X;  5FB2 A;  4HX8 A;  2C6Y A;  1Z7U A;  2HZT A;  2VN2 A;  4NQW A;  1R23 A;  1B4A A;  4M6Y A;  3KP2 A;  1K6O A;  3BWG A;  2YX4 A;  3GFI A;  3QRF F;  4IHT A;  4KMF A;  1YFH A;  4XRF A;  1I5Z A;  3DXJ F;  1IXS B;  3I59 B;  3CJN A;  2HKO A;  5FFZ A;  4WXH A;  3HRT A;  2CWE A;  3M8F A;  3F72 A;  2ZXJ A;  1RZ4 A;  1BI1 A;  2YSR A;  2R3S A;  2HS5 A;  1U8R A;  3TKY A;  4IRH A;  5LGN A;  4A6D A;  1JE8 A;  1BN5 A;  2P8T A;  4IPA A;  3JAM K;  4HF1 A;  1YYV A;  1XGS A;  2Y48 A;  5CVV A;  4A2U A;  4H0E A;  3FF5 A;  3LA3 A;  3IRR A;  1G6N A;  4UVB A;  3GWZ A;  2A61 A;  1PP7 U;  1B59 A;  2ZCW A;  1R1T A;  2XGX A;  2D1V A;  1Y0U A;  3BY6 A;  2PMH A;  4XLP F;  2XKO A;  4NB5 A;  5BS6 A;  3MZY A;  4I02 A;  1TW2 A;  5FO5 A;  3F8N A;  3V8K A;  2KJB A;  2Z9O A;  3DQV C;  2K4B A;  1KGS A;  5HS7 A;  4MQV A;  1YO5 C;  1USS A;  5E1W A;  4RAY A;  1YIO A;  3M1E A;  3I54 A;  2W25 A;  2PJP A;  5BPI A;  2M45 A;  4E70 A;  1YW9 A;  3VOE A;  4P96 A;  1ZRF A;  1BOA A;  2ZO4 A;  3E6C C;  1D5V A;  3V8L A;  1KU3 A;  1JHH A;  5JR3 A;  2RKH A;  1HW5 A;  2DTR A;  3HHH A;  1QZZ A;  4M74 A;  2A6E F;  1TQI A;  3P9K A;  4ENM A;  2VXZ A;  2CG4 A;  3F8B A;  1WSU A;  2FRH A;  2FU4 A;  4KA4 A;  1U5T C;  5DYM A;  4UUV A;  2DFI A;  2Q2E A;  3FMS A;  1U6G A;  1QQI A;  4ZH4 F;  1IRF A;  3HHG A;  2YX7 A;  4I0B A;  4N9I A;  3JW4 A;  5FGM A;  3ZMS A;  3E97 A;  1EH7 A;  2AS5 F;  3MAJ A;  1BC8 C;  3IC7 A;  1ON2 A;  3ECH A;  4CYD A;  3R0A A;  2QQ9 A;  4EJT A;  4HDV A;  1Z05 A;  4UV9 A;  2ADU A;  3WGG A;  1HKT A;  1ODD A;  2Y0M A;  2J5P A;  1FWZ A;  4A0Z A;  4ENJ A;  1O3T A;  1KQ8 A;  4QLC U;  4FX4 A;  5DUK A;  2ELH A;  3DFG A;  1V3F A;  5JHU A;  1FP2 A;  1IN7 A;  2D1H A;  3S2W A;  2XHK A;  2CO5 A;  2O61 A;  5HS9 A;  3TOB A;  3MZH A;  3IWF A;  2Z3Y A;  2PLY A;  2QM3 A;  2EB7 A;  2BE5 F;  1SD7 A;  5A2Q Z;  2H6B A;  2OZU A;  2DBB A;  3ZN0 A;  1D3Y A;  3I71 A;  3F8F A;  2IJL A;  2JPB A;  4M9S A;  3TQN A;  3U9G A;  3C3W A;  3L00 A;  3WTX C;  5L3E A;  2JZY A;  1TQP A;  2ZME B;  2FNP A;  3ZMV A;  2GZW A;  3H92 A;  3H3Z A;  4OOI A;  3ZMU A;  2W84 A;  3KLN A;  2MLK A;  3SFZ A;  2IP2 A;  3VFZ A;  1K7A A;  2FOK A;  2OA4 A;  2X4H A;  4GCV A;  4A6E A;  3CTA A;  3E6B A;  5LRR A;  3DEU A;  4RGX A;  5DCF A;  1DPU A;  4EGZ A;  5D4R A;  3KEO A;  3ZP5 A;  5BQT A;  2UXN A;  2EFW A;  2FNA A;  4G7H F;  4YIF A;  3TO6 A;  5ED4 A;  2V1U A;  3IL2 A;  3QPH A;  5LGT A;  3KP7 A;  4ZZL A;  3F3X A;  4KN7 X;  1F1Z A;  1LDJ A;  1MDM A;  4I2O A;  3M7G A;  3V8J A;  4EM2 A;  5F1R A;  4S04 A;  2P6T A;  2PG4 A;  1XDS A;  4G94 A;  1ZLK A;  5K5R A;  1FLI A;  4U0Y A;  1LNW A;  3NRV A;  3R0J A;  2IA2 A;  1I6X A;  2PI0 A;  4L0Z B;  4AWX B;  1XGM A;  3BJ6 A;  3HIF A;  1ZG3 A;  1P4X A;  2L3D A;  4G8X A;  2MA3 A;  4HYE A;  1LJ9 A;  5F6F A;  5BOX A;  1O3S A;  3KP5 A;  3J81 K;  2XVC A;  5DUI A;  3P9C A;  4HBL A;  2HTS A;  2XKP A;  2M1B A;  2CQK A;  4YFX F;  3AAF A;  4ZYG A;  4MTE A;  5H6R A;  5A2Q K;  1O3R A;  2G7H A;  4OU0 A;  1OYW A;  4M9X A;  1FSH A;  4K2E A;  3H3U A;  2RC4 A;  1R5H A;  5HDG A;  2GAU A;  2A6H F;  3RKY A;  4XBF A;  4LGW A;  3V7R A;  2V1D A;  2HYF A;  1DPR A;  1KYW A;  3FXQ A;  3T8R A;  5K5Q A;  4Y13 A;  5CVU A;  2IVM A;  3KCC A;  1F9N A;  2DPD A;  1W7P B;  3KFW X;  3I58 A;  4L9V A;  4LLN A;  3FXR A;  2Q8K A;  3FM3 A;  5HLI A;  4G7Z F;  1R36 A;  1TQM A;  5ERI A;  4LJZ F;  4I0A A;  3LQR A;  1J75 A;  3CUQ C;  2KIU A;  2E1N A;  2HWV A;  3ZN1 A;  2V6C A;  2O8X A;  2R7F A;  3GF2 A;  4A5M A;  3SQN A;  2XIG A;  1S6L A;  2D45 A;  1CF7 A;  3J80 K;  2FE3 A;  5EEH A;  1J0R A;  1DUX C;  3J7A O;  4XSZ F;  3LST A;  5J8F A;  1MJA A;  3TDZ C;  2IT0 A;  2F5E A;  2W85 A;  2AXL A;  2GQQ A;  1KQ9 A;  5ICC A;  1FZP B;  1G3T A;  4D0P A;  4Z2Y A;  2IA0 A;  2MH9 A;  4RAZ A;  4U0V A;  1P6R A;  5IT3 A;  2QLZ A;  1L0O C;  4RGR A;  1FBS A;  1GXQ A;  2BV6 A;  1R22 A;  3ECO A;  4BYY A;  2UXX A;  2UWM A;  1QNT A;  2VOO A;  2CGP A;  4U88 A;  1YG2 A;  4KYW A;  2EV0 A;  1UHM A;  3TO9 A;  1T39 A;  2ZKZ A;  4HAM A;  4HLX A;  3GFL A;  3NQO A;  2XV4 S;  4IHS A;  4BQA A;  1R7J A;  1W5S A;  5ICF A;  2DU9 A;  5ICG A;  4LG0 B;  1K78 B;  4MGR A;  1ZAO A;  3VB2 A;  4P5O A;  2JT1 A;  4B8X A;  3W6J B;  2EK5 A;  1QPM A;  2OU2 A;  1FOK A;  2H94 A;  4I7H A;  1HST A;  4DNC A;  2CSO A;  4A5N A;  2NNY A;  4P9F A;  3B73 A;  5D4S A;  3ELK A;  4U0W A;  2FSW A;  4BHP A;  3WE3 A;  1YLF A;  4HW0 A;  5HLG A;  3E6M A;  3BJA A;  4BXU A;  3ULQ B;  2V9V A;  4BNC A;  1P4A A;  4BHB A;  2RDP A;  3BP8 A;  2YPR A;  3F6V A;  3FMR A;  4EJV A;  2VBW A;  2NAZ A;  1BI0 A;  4EQQ A;  1NHA A;  3Q9V A;  3BJO A;  1WQ2 A;  2ISZ A;  2LF8 A;  1SD4 A;  3E5U A;  2QBY A;  5F64 A;  1YW7 A;  2K7L A;  2W24 A;  4OMZ A;  1T38 A;  1OYY A;  1XMA A;  3L9F A;  4ASN A;  4R1H A;  1BIA A;  1PP8 F;  4G6Q A;  1MJ9 A;  4HX7 A;  4IVN A;  2JTV A;  4ZZD A;  2M87 A;  2ESH A;  3MWM A;  2E7X A;  3IHU A;  5AON A;  4HF2 A;  2YR2 A;  3L2C A;  3T8T A;  4LLG F;  2RNJ A;  3KZY A;  1P2F A;  4ZYD A;  4ESJ A;  1ZG1 A;  3IKV A;  5AIP A;  2A07 F;  2LNB A;  3EDP A;  3FM5 A;  3K1P A;  1Z9C A;  4KIC A;  2RV8 A;  2Z5U A;  2XAS A;  1RI7 A;  4KIF A;  4BAY A;  5LHI A;  1TNS A;  2XRN A;  2J5O A;  4Y17 A;  1TW3 A;  1AWC A;  1SFE A;  3HYI A;  1UFM A;  5LRS A;  1BM9 A;  1U5T A;  4YG2 F;  2ESN A;  4IXA A;  1KU9 A;  2MC3 A;  3GZ5 A;  3CO6 C;  1F4K A;  2H6C A;  4R8H A;  2F5C A;  4MEY F;  5DD4 A;  1J9I A;  3LFK A;  1R00 A;  2PQ8 A;  3R61 A;  1BI2 A;  4O6J A;  2EV6 A;  2O3F A;  3RJP A;  3E6D A;  3WTT C;  4XLN F;  5ILV A;  2V1X A;  3E3V A;  4N0B A;  2WC2 A;  1G4D A;  4AIH A;  4EJO A;  2K4J A;  4GYG A;  1YS6 A;  1A04 A;  5DCM B;  2XAQ A;  3TDU C;  1IN8 A;  3GZ6 A;  3JSO A;  4LFU A;  3RTR A;  4GXO A;  2MBF A;  4LK1 F;  1EH6 A;  2O03 A;  3FZV A;  2HEO A;  1D8K A;  1FPQ A;  4HA8 A;  3WGI A;  5HVQ C;  2EFN A;  3DPT A;  1ZH5 A;  2E1C A;  3HRU A;  1ZGA A;  4KIG A;  4LB6 B;  4M72 A;  4IRG A;  3Q5F A;  2TDX A;  1XSX A;  1IUY A;  2RGV A;  1J5Y A;  2QZ8 A;  4BH9 A;  4O3M A;  4YFK F;  3EYI A;  4L5J A;  4S05 A;  3CUO A;  1MZB A;  4L5I A;  3J81 Z;  1SFX A;  5HDK A;  3QU6 A;  4DQ2 A;  2FEZ A;  1WI9 A;  2KIF A;  3BDD A;  4EM0 B;  4EGY A;  3EUH A;  4OIN F;  3KZZ A;  4EM1 A;  3RI4 A;  1B9N A;  4KMU X;  4AIJ A;  2WWY A;  1LEB A;  2H27 A;  1QZY A;  5EEG A;  1IXR C;  3RDI A;  2PBI A;  3V4G A;  2DT5 A;  4RGS A;  4L9T A;  3RKW A;  4LK0 F;  3F21 A;  3U2R A;  2JPC A;  4HZF A;  2EFQ A;  3PFI A;  1X3U A;  1E2X A;  4A0Y A;  2JRT A;  2LF7 A;  5L3D A;  2NYX A;  1S29 A;  4A12 A;  4GGG A;  4LB5 A;  3ABT A;  2KKO A;  1SD5 A;  3MQ0 A;  3F8C A;  1S8N A;  1KYZ A;  4L0Y B;  1Z91 A;  4P9U A;  2A5Y B;  2L02 A;  4NHJ A;  2EWN A;  4WF2 A;  2DK5 A;  3J80 Z;  2A68 F;  4CXF A;  2P5V A;  4U7B A;  4HQE A;  2QQB A;  4UHT A;  2ZNY A;  2HOE A;  3HTS B;  4CGZ A;  3DF8 A;  1WWX A;  4JK1 X;  1ONV A;  2XRO A;  2WTE A;  4QWQ A;  1XCV A;  2COM A;  4OIO F;  2HDC A;  1UCR A;  5D5W B;  2P4W A;  3LA7 A;  1O3Q A;  3OOP A;  2VOD A;  2R7D A;  1PDN C;  5KVR A;  4L9J A;  2G7U A;  3WTU C;  1AOY A;  5DEQ A;  3M8E A;  1FYL A;  4WCG A;  4KFC A;  2P7C B;  3GW2 A;  3WG9 A;  2FBK A;  1W7P D;  2DW4 A;  1BIB A;  4UV8 A;  2ISY A;  3RIR A;  2XUB A;  1B6A A;  4RB1 A;  2OD5 A;  1ZRD A;  1UHW A;  3QPT A;  2OBP A;  4EV0 A;  1W4M A;  3Q9S A;  2STW A;  3KP3 A;  1I1S A;  1WRJ A;  1ZGJ A;  1ZHF A;  4FT8 A;  4KT5 C;  3KP6 A;  1LEA A;  2XAH A;  3CUQ A;  2Z33 A;  1LVA A;  1F5T A;  1DP7 P;  2EFP A;  2IA1 A;  1K79 A;  3ZMT A;  1U2W A;  3OV8 A;  4MTD A;  4KDP A;  4OIQ F;  5JFR A;  2K86 A;  1IXC A;  5E18 F;  2DI3 A;  1FSE A;  3I5U A;  3I59 A;  4LMY A;  5CVR A;  5CLS A;  4ENK A;  4HV6 A;  1H9T A;  4GYI A;  3HRM A;  3ROU A;  2OZ6 A;  1R5G A;  1BI3 A;  2NNN A;  3MEX A;  1XCB A;  1EV7 A;  4PGG A;  1YQA A;  1GXP A;  1OMI A;  3MCZ A;  4M9Z A;  2L4A A;  3ABU A;  2HQN A;  2EV5 A;  2FBH A;  4UVC A;  1DDN A;  1IF1 A;  4AVP A;  1PUE E;  2UZK A;  2RQP A;  1R1U A;  3BZ6 A;  1QBJ A;  1XSD A;  2W57 A;  3R60 A;  2Z99 A;  2M8E A;  2GIV A;  3GFM A;  2STT A;  5CJ9 A;  3GX4 X;  1UB9 A;  1XDU A;  1IN5 A;  3ZMZ A;  4HQM A;  3LAJ A;  3K0L A;  2HFH A;  3RPQ A;  2O0Y A;  4L9N A;  3HSE A;  5E20 A;  3WTV C;  5D6F A;  2VC1 A;  4I09 A;  4ZYE A;  4LLL A;  3I53 A;  4HV5 A;  2BEO A;  3MFK A;  4GO1 A;  2A3S A;  1MDM B;  2H09 A;  1SAX A;  3IRQ A;  3ZQ7 A;  2BGC A;  4UNO A;  1KU2 A;  3RYP A;  2VBX A;  3R4K A;  1SD6 A;  5J8C A;  2FML A;  3N4M A;  4FX0 A;  1HBX G;  1BBY A;  3VOD A;  1R58 A;  4CHU A;  1MJB A;  3RYR A;  1QGP A;  2FA5 A;  3HSR A;  5FLX Z;  4WX9 A;  1S7A A;  2F5D A;  2HR3 A;  1IW7 F;  2KIM A;  3ZMD A;  3HSF A;  3RKX A;  1HQC A;  5H20 A;  5KK1 A;  1I27 A;  5J6X A;  4IRI A;  2XAG A;  3R6S A;  5TRD A;  3HOS A;  3ZPL A;  4RS8 A;  2VT3 A;  4N9H A;  1REP C;  1GVJ A;  2ZNZ A;  1J2X A;  3P7N A;  1S3J A;  2GA1 A;  3C18 A;  4HDU A;  1VTN C;  4CZZ A;  3ML6 A;  2QQA A;  3RPU A;  5LHG A;  1RNL A;  1J59 A;  3DPL C;  2HKX A;  5FFX A;  3C7J A;  4CDG A;  3KLO A;  3O3K A;  1FYM A;  1Q1H A;  4RB2 C;  1TNT A;  1LDK B;  5CYV A;  5D5U B;  4ESB A;  2KRF A;  2PEX A;  4ZYH A;  2PMU A;  3LAP A;  3CO7 C;  1XGN A;  1P4W A;  1ZN2 A;  1G3W A;  2CW0 F;  1HXD A;  4MNU A;  5JI6 A;  3FMQ A;  2PFB A;  2FQ3 A;  1I1G A;  3QAH A;  3I0T A;  3WU1 B;  5ILU A;  1CF7 B;  2OQG A;  1FY7 A;  3N97 A;  1HW2 A;  1H9G A;  3F8M A;  2VON A;  3K1N A;  3GEZ A;  3T5X A;  4I98 B;  3F22 A;  1V4R A;  2DQR A;  1FX7 A;  1Z1D A;  1SMY F;  3PQK A;  5IT9 K;  1STZ A;  2ZME A;  4PZJ A;  3EET A;  1SMT A;  3C1D A;  1B1B A;  1KQ0 A;  1FBU A;  1BJA A;  5LLQ A;  2GA2 A;  5E1Z B;  1Z6T A;  3ISP A;  1HKQ A;  5H6Q A;  3G3Z A;  4MHG A;  5FLX K;  2ACJ A;  2P5L C;  1XMK A;  3F6O A;  1OYI A;  3JTG A;  1ON1 A;  4G7O F;  4HOB A;  2FBI A;  5JVT A;  2LDU A;  2XAF A;  3QU3 A;  4YII A;  2P6S A;  2FMY A;  3I64 A;  1YS7 A;  2P5K A;  1EH8 A;  1TTY A;  3WU0 A;  1FT9 A;  1R1V A;  1ULY A;  3T0Y A;  1H0M A;  3EQL F;  5DDG A;  3GVA A;  2GXG A;  1XB4 A;  2FXA A;  1XD7 A;  1O57 A;  3CDH A;  4HLY A;  3FHZ A;  4M71 A;  4BHC A;  4Q5S F;  3WTW C;  2F5F A;  3SZP A;  1LB2 A;  2OQR A;  1CGP A;  4O5V A; 
#chains in the Genus database with same CATH topology
 1U9N A;  4XN0 A;  2VT2 A;  3J7A Y;  3DBL B;  4XL9 A;  4M3B A;  3TW7 A;  2IPQ X;  5L3B A;  4R79 A;  3HOZ J;  5E8G A;  3QOP A;  4BUP A;  2VE8 A;  3LNQ A;  3FX3 A;  1FTZ A;  3BG5 A;  3GTG J;  4Q48 A;  1YJ9 I;  2QEN A;  3H5A A;  1OCP A;  3DCF A;  4DBQ A;  1ETV A;  2JSC A;  1Z77 A;  2KJC A;  3CLO A;  3WTS C;  1IN4 A;  2E7W A;  5ILS A;  2OAZ A;  4ZDO A;  3U1D A;  1T0F A;  2MG4 A;  2QWW A;  4G9Y A;  1IN6 A;  2QBY B;  1TT0 A;  2NVY J;  3SDB A;  4WK8 F;  3PQJ A;  2FF4 A;  4JBA A;  4I76 A;  2K9N A;  2L01 A;  3CQZ J;  4CUG A;  2M4G A;  2LC2 A;  2CUZ A;  3MKL A;  4NBQ A;  1FIA A;  1K83 J;  1XC5 A;  5L3C A;  1YTY A;  3FXO A;  1IAW A;  1MBE A;  2R5Z B;  5F1J A;  1O7F A;  3G73 A;  3J7Y J;  1NH3 A;  4F3Q A;  5LEJ A;  2IW5 A;  1FC3 A;  2RN7 A;  2CUE A;  1L3L A;  2MLG A;  4L18 B;  2BY2 A;  2WV1 A;  4PJJ A;  4HF0 A;  1FOW A;  3GO5 A;  4EJU A;  4WXD A;  4XLH A;  2JVG A;  1F36 A;  3OYD A;  2IS6 A;  2OUM A;  2ZXI A;  4NUB A;  2RVC A;  2OTJ I;  1ETQ A;  3LA2 A;  4DOZ A;  1RC9 A;  1W7P A;  2X0L A;  1FBQ A;  3LSG A;  3FWE A;  1ETX A;  3L2W A;  3AG1 H;  4PGH A;  1SFO J;  2K9S A;  4UB6 C;  3K9T A;  2HU9 A;  5D6E A;  1YRN B;  2LRE A;  4D1Q A;  3TP3 A;  4ITV A;  4M73 A;  3GXO A;  5JHF A;  3OYH A;  3ZQH A;  4I6Z A;  1RPW A;  1XSV A;  3MVP A;  1Z6R A;  2ECC A;  4C3J J;  3BZC A;  4DGW B;  2QSH X;  1JKP C;  2LG4 A;  2CFX A;  2XF6 A;  1LQ1 A;  2GXB A;  1UST A;  2ECB A;  3CCL I;  1KA8 A;  1MMN A;  1MH3 A;  1X4P A;  3IKT A;  2O6G E;  1W5T A;  3DP7 A;  4WWC A;  3PNV A;  5K7H A;  1ZKG A;  5JVG F;  4UVA A;  5CVI A;  2N8G A;  3HXL A;  1D8J A;  1TWF J;  2VJI A;  4B3X A;  4CSW A;  4UXN A;  2QUF A;  3OYG A;  2NOG A;  2VE9 A;  5E3L A;  4RB3 C;  2CQN A;  4U7D A;  4YEL A;  1BC7 C;  2DO7 A;  4XKW A;  2NRA C;  1ZG5 A;  3CP8 A;  3DU6 A;  5HLH A;  2K27 A;  4OIP F;  4MEX F;  4DZP A;  2M7B A;  1U5T B;  2DAO A;  3TL4 X;  2OC6 A;  1ETO A;  3AFH A;  5B66 C;  2WV0 A;  5FKN A;  3HOY J;  1AHD P;  3LQQ A;  3IAM 2;  4XSX F;  4E7Z A;  1QA6 A;  5LEK A;  2VL8 A;  4KNY A;  3WTZ A;  1ZGW A;  1G3S A;  4OIR F;  4BXF A;  4C9Y A;  1JGS A;  1O7L A;  2L9S A;  1Y6I A;  3M9A A;  4LIU A;  3O6B B;  1B72 A;  4ZJZ A;  3GUD A;  3QP5 A;  3JR9 A;  6PAX A;  2KFD A;  2Q1Z B;  2Q0O A;  2EJR A;  4MQ9 F;  1JHF A;  4F7Z A;  3D5L A;  2VXD A;  1LDD A;  1RUN A;  1P9Q C;  3MKZ A;  2ZXW H;  3K1M A;  2G9W A;  4KJZ A;  1IRG A;  4BU2 A;  3BR3 A;  1S7O A;  1HW1 A;  1HDD C;  3GZN B;  2ZFW A;  5D8L B;  3M8J A;  4HRI A;  2VBZ A;  4XLF A;  1U78 A;  3RZD J;  4I01 A;  3FDY A;  3H1C A;  2L54 A;  4YFN F;  2V79 A;  2F2E A;  3VWB A;  2JA6 J;  4CO8 A;  4B09 A;  2K02 A;  2HTJ A;  4KIB A;  3CCR I;  3P9I A;  4PDK A;  2R7Q A;  1FP1 D;  3A1Y A;  1IUF A;  4JOM A;  3TO7 A;  4FHT A;  4IJA A;  1TBX A;  3SZT A;  3W6K B;  3K6G A;  5D5V B;  5DV5 A;  2HQR A;  1A31 A;  3D5R C;  1ZAR A;  3K69 A;  2WAQ N;  3BPV A;  1T6S A;  3WGH A;  2HYG D;  2W48 A;  4ENN A;  3KEQ A;  2KDZ A;  2LH9 A;  3BPX A;  2AXT C;  3WOD F;  4V2F A;  4JQF A;  2M30 A;  3VYR B;  3D5S C;  1D0Z A;  3D0S A;  3KP4 A;  2E34 A;  3OYN A;  1MKM A;  2ME0 A;  4XRS A;  2EA2 A;  4LG0 A;  2P7V B;  3NEU A;  3COA C;  1K78 A;  4XRS G;  1IO2 A;  4Q4Z F;  2BYV E;  2A69 F;  1MD0 A;  2DQL A;  2IAI A;  2R4G A;  1BL0 A;  4PCQ A;  5EGO B;  1ZQ3 P;  2Y75 A;  1MBF A;  4FAS D;  4S0H B;  3JRI A;  1ITY A;  3HOT A;  2VOP A;  3DU5 A;  3SHF A;  2B0L A;  3REO A;  3ZGK A;  1FNN A;  1MMS A;  2BHZ A;  1HOM A;  3BOQ A;  3GFJ A;  5L3G A;  3DTK A;  3JSP A;  4M6X A;  1X58 A;  5GTH C;  5D5X B;  5E1X A;  1RUO A;  3GLX A;  4DYR A;  1APL C;  4FIS A;  1WJ5 A;  1TLH B;  2M5W A;  2XAJ A;  1VQ8 I;  4HX4 A;  4RAF A;  1SFU A;  1P92 A;  2A6T A;  2LSO A;  3BZK A;  1W36 D;  2V7F A;  1E17 A;  4KUM A;  3HJE A;  5AIQ A;  5BPD A;  1OPC A;  1YW8 A;  3CJT B;  3ZXS A;  3QYB A;  3OYF A;  5D8K B;  2VC0 A;  5BMZ A;  2QYO A;  1ZRC A;  2D2W A;  2JUG A;  4E4H A;  3B02 A;  5DS9 A;  5J1Y A;  4RGU A;  1JI8 A;  5J40 A;  2TCT A;  4KN4 X;  2DPU A;  2EH3 A;  5HS8 A;  3QYF A;  3HL2 A;  3BR5 A;  2DLL A;  2Z16 A;  5L3F A;  4JX5 A;  1IC8 A;  2W4S A;  2BVM A;  3DKX A;  1XX5 A;  3PIP F;  3WE2 A;  2EFO A;  1ZLJ A;  1U3E M;  2MD5 A;  1LFP A;  4ON0 A;  3E1S A;  5EZG A;  4ESF A;  3BR1 A;  3L09 A;  3OYL A;  1ZYR F;  4EJW A;  4M3D A;  2NS0 A;  2NOJ B;  4G6D A;  3VEP A;  4TV7 A;  3HRS A;  1GV2 A;  1YE9 A;  5FD6 A;  1TZL A;  2EA4 A;  4GFB A;  1XGO A;  1O4X A;  5KNL A;  1F43 A;  5E3O A;  3QP6 A;  4UUS A;  2NS7 A;  3S14 J;  3JTH A;  4MFD A;  1PYV A;  2X6O A;  1KU7 A;  2I10 A;  2HOA A;  5M5X J;  1T98 A;  5ICE A;  2PN6 A;  3TGN A;  2VBY A;  3OWT A;  4Q47 A;  3JRB A;  3F23 A;  2L4M A;  4E7S A;  1OCR H;  3CJR B;  3V7S A;  5LGU A;  1NG6 A;  3BRO A;  3BT9 A;  3ERE D;  2VQC A;  1B8I B;  2KRC A;  2IRF G;  4XN3 A;  1MGT A;  5GP9 A;  4Y15 A;  3JRG A;  2HYJ A;  2MH2 A;  3S1M J;  3CC2 I;  3HUG A;  1GHC A;  3T1B A;  4P55 A;  1Y0N A;  1Y1V J;  4CCO A;  3JAM Z;  4EVI A;  2HZD A;  3KET A;  1ORK A;  1TT5 B;  3L7W A;  3V7C A;  1WH7 A;  3BQY A;  4B3A A;  1WKM A;  3LWF A;  4LD5 A;  2PMZ N;  3KE2 A;  3O2P E;  1XMX A;  3HKZ A;  1C0W A;  5HOO A;  3WHB A;  1D1B A;  1X1A A;  1RKW A;  3TBI A;  4W1U A;  3E5Q A;  4C3I J;  2YU3 A;  3AG3 H;  5K1Y A;  2R7V A;  3P5J A;  1T2K A;  2GWR A;  3QWL A;  4ETS A;  5K5O A;  3I4P A;  4RB0 A;  1IZ1 A;  4XLE A;  2WB1 A;  3K2Z A;  5IT9 Z;  2ELK A;  1OR7 A;  1VND A;  5E8I A;  4WXC A;  2ZSI B;  4PUS A;  2ZJR F;  3EYY A;  5E17 F;  1ZRE A;  4BJT A;  3W2V A;  4RAG A;  3ZOB A;  1XN7 A;  5FD5 A;  2MW8 A;  1LE8 B;  1E3H A;  1J7K A;  4CIC A;  4CCJ A;  4AD9 A;  2LKP A;  2M34 A;  3E5X A;  3K7A J;  5CVJ A;  4EAT A;  4IF4 A;  5LHH A;  3ZQC A;  3BG7 A;  5FRN A;  5IYB J;  2ETH A;  2XB5 A;  2EQR A;  3PJR A;  1RIO H;  3DV8 A;  4KIT B;  1QO0 D;  3FKJ A;  2ZBK A;  1G3Y A;  4NC6 A;  5TJJ A;  1WHU A;  2DK8 A;  2QVO A;  3FXU A;  2E1M B;  3G1O A;  4EMS A;  4OMY A;  1HLV A;  5LBQ A;  1G59 A;  4A0X A;  2CUF A;  3DKW A;  1JXS A;  2K9Q A;  3HTU A;  1B9M A;  5HDN A;  3WTY C;  2VKH A;  1HSJ A;  3SXY A;  3AKZ A;  2IBD A;  5DD8 A;  2GOM A;  5DCM A;  2WAD A;  3TOA A;  3DBH B;  3CC4 I;  2QSF X;  1OKR A;  1R9T J;  1FMW A;  1HKS A;  5TIS C;  4AIK A;  1FYK A;  2ZJ2 A;  2HGC A;  2JSP A;  2CYY A;  2BBY A;  3CUQ B;  3IWZ A;  4NNJ A;  3GYH X;  5FB2 A;  4HX8 A;  2C6Y A;  1Z7U A;  1JKQ C;  2HZT A;  2VN2 A;  2JK3 A;  5BNG A;  2ZC2 A;  4NQW A;  3LSP A;  1R23 A;  1S5L C;  1B4A A;  4HST A;  2L9V A;  4M6Y A;  3KP2 A;  2I8D A;  1K6O A;  1PUF A;  3BWG A;  4PK4 A;  2YX4 A;  4P1W A;  1LKX A;  3GFI A;  1TL8 A;  3QRF F;  4IHT A;  4F52 A;  3OS1 A;  4KMF A;  2IGN A;  5E3N A;  1YFH A;  1YIT I;  4XRF A;  1I5Z A;  3DXJ F;  2R93 J;  4MFE A;  2E2H J;  1IXS B;  5CQE A;  3I59 B;  3CJN A;  3HEF A;  2HKO A;  5FFZ A;  2LR8 A;  4WXH A;  5J4Y A;  2MD0 A;  2VLA A;  3FBN B;  3HRT A;  4YEJ A;  2AQF A;  2CWE A;  3M8F A;  3F72 A;  3G1M A;  2ZXJ A;  5FRO A;  1NK2 P;  1RZ4 A;  1EF4 A;  1BI1 A;  2YSR A;  2R3S A;  4D9J A;  2HS5 A;  4DIQ A;  1U8R A;  1VI0 A;  3TKY A;  3IH3 A;  3H0D A;  4IRH A;  3GTP J;  1VZ0 A;  2E5N A;  5LGN A;  4A6D A;  4J01 A;  4BEH B;  1JE8 A;  1BN5 A;  2P8T A;  4IPA A;  1WCM J;  3JAM K;  4HF1 A;  4QIW N;  1YYV A;  2XDV A;  1XGS A;  1K6Y A;  2WAQ A;  2Y48 A;  1LVK A;  1JTY A;  4Y3O A;  5CVV A;  4A2U A;  2I5U A;  1X3W B;  4H0E A;  2VQH A;  3FF5 A;  3LA3 A;  4Y52 J;  2M7A A;  3IRR A;  3IAS 2;  1G6N A;  4UVB A;  3CDI A;  3GWZ A;  4ZC3 A;  2A61 A;  3FXM A;  3DPU A;  1PP7 U;  1B59 A;  1DQU A;  2ZCW A;  1R1T A;  2XGX A;  2D1V A;  2BHY A;  3IP4 B;  4DYQ A;  1Y0U A;  1A6I A;  2DYS H;  3FBI B;  3BY6 A;  4BAC A;  2PMH A;  4XLP F;  2XKO A;  4NB5 A;  5BS6 A;  2IS4 A;  1PVE A;  3MZY A;  1H8A C;  4I02 A;  1TW2 A;  5FO5 A;  4EEF G;  2E35 A;  3F8N A;  3V8K A;  2KJB A;  2FUG 2;  1E3P A;  2Z9O A;  4CYC B;  3DQV C;  3L1P A;  3KYD B;  3K4C A;  2K4B A;  1KGS A;  5HS7 A;  4M3E A;  4MQV A;  1YO5 C;  1USS A;  1RKT A;  1AKH A;  5E1W A;  5LD2 C;  4RAY A;  1YIO A;  3M1E A;  3VSK A;  3I54 A;  2E1O A;  2BW3 B;  1RR7 A;  2W25 A;  1WZ2 A;  2PJP A;  2CRG A;  4ZTF A;  3OYC A;  2V9P A;  5BPI A;  3PUF A;  2M45 A;  4E70 A;  3OY9 A;  5IYC J;  3CCV I;  1YW9 A;  3VOE A;  4P96 A;  1ZRF A;  1BOA A;  4ZDL A;  2ZO4 A;  4C2U A;  4BDZ A;  2X51 A;  1LFU P;  1Y39 A;  3E6C C;  1D5V A;  3V8L A;  1KU3 A;  3ZCO A;  4FET A;  1JHH A;  5JR3 A;  3G4S I;  2RKH A;  1HW5 A;  2DTR A;  1NK3 P;  2KIQ A;  2XPU A;  4AYB A;  3PSI A;  4PSW A;  5HNH A;  3HHH A;  1QZZ A;  4M74 A;  3VYU B;  1RRJ A;  3DBR B;  2A6E F;  1TQI A;  2ICW G;  3P9K A;  4ENM A;  2VXZ A;  2CG4 A;  1VQ4 I;  2NXN B;  5EG0 A;  3F8B A;  4RDU A;  1WSU A;  2DJI A;  5FLM J;  3DKY A;  4XIC A;  3I55 I;  1IRZ A;  2FRH A;  2FU4 A;  2NVX J;  4KA4 A;  4A3D J;  2BY1 A;  4E7L A;  4OAY A;  5IY5 H;  2M9H A;  1U5T C;  4RM3 A;  5DYM A;  2X6X A;  4UUV A;  1Z3Y A;  1X2M A;  2DFF A;  2DFI A;  4E7K A;  2Q2E A;  5EF6 A;  3FMS A;  3KYL A;  1SVO A;  1U6G A;  3A01 B;  2DOE A;  4J00 A;  1QQI A;  2MSY A;  4ZH4 F;  4IZZ A;  1IRF A;  3HHG A;  2Y30 A;  2YX7 A;  3GTL J;  1JTX A;  2Y69 H;  4I0B A;  3ASO H;  4N9I A;  1IV8 A;  3JW4 A;  1MBH A;  1MW7 A;  5J47 A;  5FGM A;  3ZMS A;  2HI3 A;  4BQO A;  3E97 A;  1EH7 A;  2AS5 F;  3MAJ A;  1BC8 C;  5JLW A;  2KPM A;  4XMY A;  3K4B A;  3IC7 A;  1UHS A;  4HEA 2;  2PJR A;  5FKO A;  1ON2 A;  3ECH A;  4CYD A;  3R0A A;  1TP4 A;  2QQ9 A;  2E2I J;  4EJT A;  1VQO I;  4HDV A;  2M3A A;  1Z05 A;  1Z0X A;  4UV9 A;  3H35 A;  2ADU A;  1JUS A;  2L7F P;  3WGG A;  1HKT A;  1X2N A;  3HOV J;  5IP6 A;  1ODD A;  1WGX A;  2CH0 A;  2Y0M A;  2J5P A;  1FWZ A;  3CES A;  4A0Z A;  1JJ8 C;  1I3Q J;  3CLQ A;  3OMY A;  2KRH A;  3A2K A;  4ENJ A;  3HPH A;  1O3T A;  2HQ5 A;  4B4C A;  4BDY A;  1KQ8 A;  4QLC U;  4FX4 A;  1BW5 A;  5DUK A;  2ELH A;  4JYK A;  4N4O B;  3DFG A;  1V3F A;  2Z1D A;  1FP2 A;  5JHU A;  5HLT A;  1IN7 A;  2D1H A;  3S2W A;  2KIS A;  4B43 A;  2XHK A;  2W1O A;  2CO5 A;  2IEK A;  3SZG A;  1VQN I;  2QCO A;  2O61 A;  5HS9 A;  3TOB A;  3SYT A;  3MZH A;  3IH4 A;  3IWF A;  2Z3Y A;  2PLY A;  1EJ9 A;  1HC8 A;  1FOY A;  2QM3 A;  1Z3X A;  1G8X A;  1MMA A;  3BC8 A;  2EB7 A;  1IG7 A;  2BE5 F;  1SD7 A;  5A2Q Z;  2H6B A;  1YI2 I;  2OZU A;  2DBB A;  3ZN0 A;  3PNY A;  1D3Y A;  2O7O A;  4A3B J;  2H8R A;  1DGW Y;  3I71 A;  3F8F A;  1IRX A;  4BKX A;  2IJL A;  3BLY A;  2JPB A;  4M9S A;  3TQN A;  1T08 B;  4HNU A;  1OCC H;  3U9G A;  1E0E A;  1HCR A;  3C3W A;  1POG A;  2KHM A;  3L00 A;  3WTX C;  5L3E A;  2JZY A;  1TQP A;  3OIQ A;  3MN2 A;  2ZME B;  2FNP A;  3KX2 A;  1W0T A;  3ZMV A;  2GZW A;  3H92 A;  2CQ7 A;  3H3Z A;  3K10 A;  4OOI A;  2XSD C;  4BGD A;  3ZMU A;  3CCJ I;  4XOP A;  2HPM A;  2IS1 A;  2W84 A;  3KLN A;  2MLK A;  4N4N B;  3SFZ A;  2IP2 A;  3VFZ A;  4HNV A;  1P7J A;  1V5E A;  2FOK A;  1K7A A;  3H36 A;  2CV2 A;  2OA4 A;  2X4H A;  4GCV A;  4A6E A;  3CTA A;  3E6B A;  1ETK A;  5LRR A;  3DEU A;  4RGX A;  2W7N A;  1K61 A;  5DCF A;  3EUH C;  2W82 A;  4X1E A;  1DPU A;  2HNH A;  1DGR M;  2LOO A;  4EGZ A;  5D4R A;  3JRF A;  4GRI A;  3HZJ A;  3KEO A;  3ZP5 A;  2KP6 A;  5BQT A;  1SC7 A;  3NAU A;  4PJ0 C;  2UXN A;  2EFW A;  2LY1 A;  5F0H A;  4IHX A;  1QVU A;  2FNA A;  4G7H F;  3S1Q J;  3RZO J;  4II3 A;  2LBF B;  1EKE A;  4AC0 A;  4YIF A;  3KZI C;  5GPC A;  1JJ6 C;  2VQL A;  3TO6 A;  5J3L A;  5ED4 A;  2WAE A;  2V1U A;  1IDZ A;  3DWL E;  3C2B A;  5F0F A;  4BL0 B;  3IL2 A;  3QPH A;  1VQK I;  5LGT A;  3OL3 A;  3KP7 A;  3O8H A;  3VSL A;  4ZZL A;  1D0Y A;  3F3X A;  2F4I A;  1X1D A;  4D5C A;  4I99 C;  4KN7 X;  3UNG C;  1X1B A;  1MBK A;  3HPG A;  1F1Z A;  2F4O B;  4YRV A;  1LDJ A;  2XAU A;  2PX9 A;  1MDM A;  4I2O A;  1M1E B;  3M7G A;  3FIW A;  3PM1 A;  2E71 A;  1TC3 C;  3V8J A;  3HDD A;  4EM2 A;  5F1R A;  4ZDP A;  4S04 A;  3BG3 A;  2P6T A;  2PG4 A;  1XDS A;  2Y0S N;  4G94 A;  1ZLK A;  3LSH A;  5K5R A;  1FLI A;  4U0Y A;  5IOY A;  1I3A A;  4XKC A;  1LNW A;  2DMT A;  2MYS A;  1UZC A;  3NRV A;  3R0J A;  2IA2 A;  3L2Q A;  1I6X A;  4BE0 A;  2PI0 A;  4HNT A;  4L0Z B;  4AWX B;  1XGM A;  2E60 A;  3BJ6 A;  5DM6 F;  3HIF A;  1ZG3 A;  1P4X A;  2L3D A;  4G8X A;  1SAU A;  2MA3 A;  4HYE A;  1LJ9 A;  5F6F A;  4XON A;  3JRH A;  5BOX A;  3M1C A;  3F9K A;  1O3S A;  3KP5 A;  3TP0 A;  3J81 K;  2VAS A;  1R4N B;  4MO7 A;  3SJM A;  2XVC A;  5IYD J;  1BR1 A;  2LVS A;  5DUI A;  3P9C A;  4HBL A;  2HTS A;  1JKR C;  1JUP A;  1A35 A;  2XKP A;  2M1B A;  2CQK A;  4YFX F;  3AAF A;  2R7U A;  2DMQ A;  1QU3 A;  4ZYG A;  4MTE A;  1VQL I;  5H6R A;  5GAG J;  5A2Q K;  1O3R A;  2M4K A;  2IGK A;  3D1N I;  2BY0 A;  4IOC F;  3HM5 A;  2B63 J;  2G7H A;  4OU0 A;  1VFC A;  3NWT A;  1OYW A;  4UUT A;  2BZT A;  4L5E A;  4M9X A;  5TGT A;  2KDO A;  1FSH A;  1I39 A;  1WI3 A;  4K2E A;  3H3U A;  4IQJ A;  3LSR A;  2RC4 A;  3OYJ A;  1R5H A;  5HDG A;  1W1W E;  3Q0U A;  4DW6 A;  1DP3 A;  2GAU A;  2R5Y B;  2A6H F;  3RKY A;  4XBF A;  4LGW A;  3V7R A;  3RSN A;  2F6C A;  2V1D A;  1JGG A;  2HYF A;  1DPR A;  5DM7 F;  4A3K J;  1KYW A;  3FXQ A;  3PFY A;  3T8R A;  3DLL F;  5K5Q A;  3PO3 J;  4Y13 A;  2L9N A;  2NVT J;  5IP9 J;  2XRL A;  2E1M C;  5CVU A;  2IVM A;  3KCC A;  1F9N A;  2DPD A;  1T95 A;  1W7P B;  3KFW X;  5J1R A;  1J09 A;  3DTI A;  3I58 A;  4L9V A;  5GPA A;  1IJW C;  4U87 A;  2BXY A;  1SEU A;  2CFO A;  3CDL A;  4LLN A;  3FXR A;  2Q8K A;  3BG6 A;  3FM3 A;  3NAR A;  1MMG A;  5HLI A;  4ANJ A;  4G7Z F;  1R36 A;  1TQM A;  4XLA A;  2DFH A;  1GT0 C;  5ERI A;  4LJZ F;  4I0A A;  3VPR A;  3LQR A;  1J75 A;  2JN6 A;  4XM3 A;  3CUQ C;  2KIU A;  4IO9 F;  1E3O C;  2E1N A;  1JT6 A;  2HWV A;  3ZN1 A;  3JRA A;  2V6C A;  1WVR A;  2O8X A;  4Z6Y A;  2V9K A;  3OIO A;  4ABZ A;  2R7F A;  2EZK A;  3GF2 A;  4BE2 A;  4A3I J;  4A5M A;  2XGC A;  1U8B A;  3SQN A;  1QHG A;  2XIG A;  2VJ5 A;  2RRE A;  2VKV A;  1ZR2 A;  1S6L A;  2D45 A;  1CF7 A;  4BS9 A;  3J80 K;  2QKL B;  3G2B A;  1HDP A;  3HB9 A;  2FE3 A;  2V6E A;  3U21 A;  5EEH A;  1J0R A;  1DUX C;  5HOD A;  3J7A O;  2E2J J;  4J19 A;  4XSZ F;  3I56 I;  3OS0 A;  3CME I;  3LST A;  2DJN A;  4XKB A;  2F4M B;  5KCM A;  5J8F A;  1MJA A;  3TDZ C;  3CCE I;  3W6V A;  2IT0 A;  3S3M A;  1YIJ I;  2BOL A;  2F5E A;  1MMD A;  2K3P A;  1B72 B;  2LKS A;  2IXS A;  2W85 A;  2AXL A;  4GDF A;  2GQQ A;  1KQ9 A;  2JA8 J;  5FKM A;  2EIM H;  5ICC A;  1FZP B;  1G3T A;  3OOU A;  2GIZ A;  5C4X J;  4CYC A;  4D0P A;  4Z2Y A;  3EUK L;  2IA0 A;  2R7W A;  2MH9 A;  4RAZ A;  4U0V A;  2HOS A;  3PUB A;  1P6R A;  2H8W A;  5IT3 A;  2F48 A;  2QLZ A;  1L0O C;  1MBG A;  4E6K G;  2O9L A;  3UKG A;  1QPI A;  2DCE A;  1S9H A;  2DT6 A;  4RGR A;  1FBS A;  2QQ8 A;  1GXQ A;  2BV6 A;  1WJF A;  1R22 A;  3ECO A;  5DTD A;  4BYY A;  2UXX A;  5GAD J;  3GTJ J;  2RQQ A;  5K7Z A;  3L2R A;  3GTK J;  1X1P A;  4LIV A;  2UWM A;  1QNT A;  2VOO A;  2CGP A;  4U88 A;  1YG2 A;  4KYW A;  3LOC A;  3CCU I;  2EV0 A;  1UHM A;  3TO9 A;  1WJA A;  1T39 A;  3X2Q H;  2CMP A;  3CF2 A;  2ZKZ A;  1Y8Q B;  3S1N J;  4HAM A;  4HLX A;  2CJJ A;  2VPL A;  3GFL A;  4ZYA A;  4RLF A;  2L7Z A;  1AA7 A;  3NQO A;  2XV4 S;  4IHS A;  4BQA A;  2H1L A;  1HA8 A;  3O8G A;  1R7J A;  1W5S A;  5ICF A;  4XQF A;  2HVR A;  3CCM I;  2DU9 A;  3GTM J;  3MZ8 A;  5ICG A;  1VF9 A;  1D5Y A;  4LG0 B;  2CUJ A;  1K78 B;  4MGR A;  1ZAO A;  4IOA F;  3VB2 A;  4P5O A;  2JT1 A;  1SVL A;  2KZV A;  4B8X A;  3G6E I;  3W6J B;  2EK5 A;  1QPM A;  2OU2 A;  2ZXH A;  2H94 A;  1FOK A;  4I7H A;  3ZQF A;  1HST A;  3MMY B;  4DNC A;  3ZQL A;  2CSO A;  3CC7 I;  1XS9 A;  1UG0 A;  3ZR8 X;  4FE4 A;  2E36 A;  4A5N A;  2NNY A;  3S15 J;  4NC7 A;  3CD6 I;  4P9F A;  2CW8 A;  3M07 A;  3B73 A;  2Y9Z A;  3CF5 F;  1OR7 C;  4JX4 A;  5FLV A;  5D4S A;  2EZL A;  3ELK A;  1TWH J;  4U0W A;  1OCO H;  2DA6 A;  2FSW A;  3WE3 A;  4BHP A;  3WG7 H;  2K9M A;  1YLF A;  4HW0 A;  5HLG A;  2FD5 A;  1N77 A;  3E6M A;  3BJA A;  3LSI A;  1X3Z B;  4BXU A;  3ULQ B;  4ZTJ A;  2QGU A;  2V9V A;  4BNC A;  1P4A A;  4BHB A;  5B1A H;  1YJW I;  3AG2 H;  2RDP A;  3BP8 A;  2YPR A;  4LG3 A;  3CCY A;  3F6V A;  3FMR A;  4EJV A;  2VBW A;  2NAZ A;  3CZ6 A;  1BI0 A;  3QOE A;  4EQQ A;  1IDY A;  1NHA A;  3Q9V A;  1MSE C;  5B5E C;  3BJO A;  2LYC A;  1Z7L A;  1A5J A;  1U0J A;  1WQ2 A;  3BR2 A;  4BXX J;  1I50 J;  3FKI J;  3KEY A;  1R5I D;  2ISZ A;  2LF8 A;  1SD4 A;  3E5U A;  2QBY A;  2VI6 A;  5F64 A;  1JKO C;  1ZEL A;  1OCT C;  1YW7 A;  1ACI A;  2K7L A;  2W24 A;  5FKK A;  4OMZ A;  1T38 A;  1V54 H;  1OYY A;  1XMA A;  1ZTR A;  1IGN A;  3L9F A;  4ASN A;  9ANT A;  1GVD A;  2GOX B;  2R5Z A;  1V5F A;  1U9O A;  4R1H A;  1BIA A;  3E7L A;  1PP8 F;  4G6Q A;  1MJ9 A;  4HX7 A;  2WAF A;  4IVN A;  4UUS B;  2JTV A;  1Y56 A;  3RCO A;  2VB6 A;  4AUX A;  2IGO A;  4QTR A;  4ZZD A;  1VQ5 I;  2R7O A;  2M87 A;  2ESH A;  3MWM A;  2E7X A;  3IHU A;  5AON A;  4HF2 A;  1OCZ H;  2YR2 A;  3L2C A;  4G12 A;  3HBL A;  4LLG F;  3I9V 2;  3T8T A;  5FRM A;  3QPS A;  2RNJ A;  3KZY A;  1YRN A;  1P2F A;  4QSH A;  3BTL A;  4ZYD A;  4ESJ A;  5E79 C;  5EDN A;  1QZE A;  3HUG B;  1ZG1 A;  3OYK A;  1W0U A;  3IKV A;  5AIP A;  2A07 F;  2VIX A;  2LNB A;  3OYB A;  1BR4 A;  3S8P A;  3BCA A;  3EDP A;  3FM5 A;  2O8K A;  3K1P A;  1Z9C A;  3ONQ A;  4KIC A;  2RV8 A;  4JP0 A;  2Z5U A;  5JLX A;  4A3G J;  2XAS A;  1RI7 A;  2DN0 A;  4KIF A;  4BAY A;  5M3M J;  3K4M A;  1BR2 A;  5LHI A;  3K4L A;  1TNS A;  5IP7 J;  4BBS J;  2XRN A;  2J5O A;  4Y17 A;  5F04 A;  1TW3 A;  1ETW A;  1AWC A;  4CCK A;  1JUM A;  3FHN A;  3HYI A;  1UFM A;  2XF5 A;  5LRS A;  1BM9 A;  1BW6 A;  1U5T A;  4YG2 F;  2ESN A;  4IXA A;  4IKF A;  1KU9 A;  2MC3 A;  3S1R J;  4BQQ A;  2OTL I;  5FKL A;  3GZ5 A;  3CO6 C;  3RPU D;  2LTP A;  1W5C C;  1F4K A;  2M8G X;  3ZQQ A;  2H6C A;  4R8H A;  2F5C A;  3JRE A;  2XGD A;  4MEY F;  5DD4 A;  1YHQ I;  1J9I A;  3LFK A;  1R00 A;  1H88 C;  2PQ8 A;  3A03 A;  4BY1 J;  3R61 A;  1R49 A;  1BI2 A;  1UJ8 A;  2ZME C;  4O6J A;  2JA5 J;  2EV6 A;  2O3F A;  3QOD A;  3G71 I;  3RJP A;  3E6D A;  3WTT C;  2AQE A;  4XLN F;  5ILV A;  4M6V A;  4CCL A;  2V1X A;  3E3V A;  2YU9 J;  4E7H A;  4N0B A;  2WC2 A;  4RBO A;  1CQT A;  1T33 A;  2DA1 A;  2QA4 I;  1G4D A;  2L7M P;  2ZB9 A;  4AIH A;  3FXJ A;  3GME A;  4EJO A;  2K4J A;  4GYG A;  2HDD A;  1YS6 A;  1A04 A;  5DCM B;  1D1A A;  2DT7 B;  2EIN H;  4O5V A;  2XAQ A;  1DU6 A;  2GM4 A;  3TDU C;  2YS9 A;  3I4M J;  4PFO A;  4BBR J;  3H9G A;  4C2M J;  1IN8 A;  3ABK H;  4II2 A;  2COB A;  1VQ6 I;  2Z2S B;  4W97 A;  3GZ6 A;  4CCN A;  3JSO A;  4PJM A;  4X6A J;  2LK2 A;  4LFU A;  3RTR A;  3HG9 A;  4GXO A;  2MBF A;  4LK1 F;  2PMZ A;  2WY8 Q;  1EH6 A;  2EIK H;  2O03 A;  2OJE D;  3FZV A;  2HEO A;  4NQW B;  1D8K A;  1FMV A;  3DEW A;  1PUF B;  2IGM A;  3QYE A;  1ETY A;  1FPQ A;  1K4T A;  4HA8 A;  1H89 C;  3WGI A;  5HVQ C;  2EFN A;  3DPT A;  3HC7 A;  4A3J J;  1ZH5 A;  1HF0 A;  3ESW B;  2KLO A;  2E1C A;  2BVL A;  2XGE A;  2MC4 A;  2GXA A;  5EGO A;  1IV6 A;  4XK4 A;  1Y8R B;  3IH2 A;  3HRU A;  3NWS A;  1ZGA A;  4V2G A;  2MGQ A;  4KIG A;  1QVT A;  5CKT A;  1N78 A;  2XPV A;  4LB6 B;  4M72 A;  1I6H J;  3PL8 A;  5KAI C;  1DU0 A;  4IRG A;  1QHH D;  3Q5F A;  4IEJ A;  2TDX A;  1XSX A;  1IUY A;  1YOV B;  2RGV A;  1X1C A;  1J5Y A;  2QZ8 A;  4BH9 A;  4O3M A;  4YFK F;  4B1R A;  2HXI A;  3K4K A;  4L5J A;  4S05 A;  1RR8 C;  3EYI A;  3H3V K;  1MIJ A;  1VQM I;  2DOF A;  3CUO A;  3L2V A;  1MZB A;  3HKZ N;  4L5I A;  5IOZ A;  3J81 Z;  3TED A;  3OSG A;  2FQ4 A;  4DZJ A;  1SFX A;  5HDK A;  2K85 A;  3S3O A;  1R71 A;  2X85 A;  3QU6 A;  2R5Y A;  4HPQ A;  4DQ2 A;  4XID A;  2BXZ A;  2FEZ A;  4CCM A;  3S93 A;  2JQ7 A;  1OIS A;  3EPZ A;  2IS2 A;  1ERD A;  1WI9 A;  1BOB A;  2KIF A;  3BDD A;  4EM0 B;  4EGY A;  2RNG A;  3EUH A;  2M2E A;  2WB1 N;  2FJ1 A;  3KZZ A;  4OIN F;  4EM1 A;  3H9J A;  3K70 C;  3RI4 A;  1B9N A;  4KMU X;  4AIJ A;  3FK6 A;  2WWY A;  2ELJ A;  1LEB A;  2H27 A;  1QZY A;  2R7X A;  2KZG A;  5EEG A;  4PJL A;  2P81 A;  1IXR C;  3RDI A;  1MNM C;  2VUM J;  2PBI A;  2M0M A;  2W00 A;  2DT5 A;  3V4G A;  3G1L A;  4RGS A;  5F08 A;  4L9T A;  3RKW A;  1VQ9 I;  1T0F C;  4LK0 F;  3F21 A;  2D5V A;  3U2R A;  2JPC A;  2X1D A;  1D0X A;  1OLT A;  2LY2 A;  2EFQ A;  2EZI A;  2K40 A;  4HZF A;  3SFI A;  4HSR A;  3S2D J;  3PFI A;  4F91 B;  1S7E A;  1X3U A;  1E2X A;  4A0Y A;  1A36 A;  1AKH B;  2JRT A;  2LF7 A;  5L3D A;  2QSG X;  2NYX A;  4Y33 A;  1S29 A;  3K4J A;  1MSF C;  4A12 A;  3TMO A;  4GGG A;  3V42 A;  2V1N A;  2JA7 J;  4RLQ A;  4CH7 A;  2DXI A;  1WFX A;  5C44 J;  4LB5 A;  2OCE A;  3A0B C;  5E3M A;  3KYC B;  5GAH J;  3AL0 C;  3ABT A;  4BJ6 C;  2KKO A;  1SD5 A;  3MQ0 A;  1B8I A;  4IHV A;  3FXL A;  3HOW J;  3F8C A;  4AID A;  1GUU A;  1S8N A;  3S3N A;  2HQA A;  1KYZ A;  4L0Y B;  1Z91 A;  4P9U A;  3H5N A;  2A5Y B;  4FTH A;  2L02 A;  4NHJ A;  2EWN A;  3K70 D;  4WF2 A;  2DK5 A;  3ERM A;  2NVQ J;  1Z67 A;  4OWR B;  1UG2 A;  2A68 F;  3J80 Z;  3B6C A;  4CXF A;  3ZRG A;  2P5V A;  4U7B A;  4HQE A;  2QQB A;  4UHT A;  3I3L A;  3M4O J;  2ZNY A;  2DA7 A;  2HOE A;  4A3M J;  2R7R A;  1ENH A;  3OR2 C;  1GDT A;  3HTS B;  3OR1 C;  4CGZ A;  5J1U A;  1WWX A;  3DF8 A;  1ONV A;  4JK1 X;  2XRO A;  2WTE A;  4QWQ A;  1XCV A;  2COM A;  1SAN A;  4NDL A;  2XC7 A;  5EG0 B;  5M5W J;  1S72 I;  2L5Q A;  2HDC A;  4OIO F;  4A3E J;  2HVS A;  3H5R A;  1UCR A;  2VKD A;  3HGG A;  5D5W B;  3VYS B;  3OYM A;  2P4W A;  3LA7 A;  1O3Q A;  3OOP A;  4LOC A;  2VOD A;  4CZC A;  2R7D A;  2O5R A;  2UV1 A;  1PDN C;  5KVR A;  3W3C A;  4L9J A;  2LD5 A;  2G7U A;  3PIO F;  4Y7N J;  3WTU C;  1LE8 A;  1AOY A;  2Q2E B;  3A4C A;  5DEQ A;  1OQY A;  3M8E A;  1FYL A;  3CCS I;  4WCG A;  4IX7 A;  2X6W A;  4KFC A;  2LRD A;  1W36 C;  2P7C B;  3GW2 A;  3WG9 A;  2FBK A;  4DYC A;  2DA3 A;  4C3H J;  2EPF A;  4D7N A;  1W7P D;  2DFE A;  2DW4 A;  2B9S A;  1BIB A;  4UV8 A;  1FJL A;  2ISY A;  4BJ5 C;  3RIR A;  4PSX A;  3HOX J;  2XUB A;  1B6A A;  2DA4 A;  4RB1 A;  2OD5 A;  1ZRD A;  1UHW A;  3GTO J;  3S16 J;  3QPT A;  5KAF C;  3OYE A;  2OBP A;  2R7T A;  2KT0 A;  4EV0 A;  1W4M A;  3Q9S A;  2STW A;  3KP3 A;  2RAE A;  2PJR B;  1NG7 A;  1I1S A;  1WRJ A;  3EUA A;  2P0W A;  1ZGJ A;  1ZHF A;  4FT8 A;  5K7F A;  4KT5 C;  3KP6 A;  4IL6 C;  2X6Y A;  1LEA A;  1UMQ A;  3IUO A;  4QPO A;  4XOR A;  2XAH A;  2LFB A;  2VJJ A;  2X48 A;  1LVA A;  3CUQ A;  4BQN A;  2Z33 A;  3FXK A;  1F5T A;  1DP7 P;  3GLL A;  2EFP A;  1Z21 A;  3M3Y J;  2LLK A;  2IA1 A;  1K79 A;  3ZMT A;  3VYT B;  4BE1 A;  1U2W A;  3OV8 A;  1XTA A;  1TWC J;  5C3E J;  4MTD A;  5EEA A;  4KDP A;  4OIQ F;  1TWA J;  3AG4 H;  3BTI A;  3AL0 B;  2GLO A;  5JFR A;  4LIT A;  2K86 A;  3UR3 C;  3ZQG A;  1IXC A;  2TRT A;  5E18 F;  3GCM A;  2DI3 A;  1VQ7 I;  1FSE A;  1WJE A;  2XF7 A;  3I5U A;  3I59 A;  4LMY A;  2Y31 A;  1A6Q A;  4AU7 A;  5CVR A;  5CLS A;  3A0H C;  3BG9 A;  4ENK A;  1V55 H;  4HV6 A;  1H9T A;  4Y4R A;  4GYI A;  3SDG A;  2E5Z A;  3HRM A;  3ROU A;  1BJZ A;  2JUC A;  2CQQ A;  2OZ6 A;  4G6T B;  1LFB A;  2ME6 A;  1T8I A;  1R5G A;  3ASN H;  1BI3 A;  2NNN A;  4M3F A;  4F93 B;  3MEX A;  5EJC A;  4OAZ A;  1XCB A;  4BEH A;  1Y1W J;  3OYA A;  1EV7 A;  4PGG A;  3IV5 A;  1YQA A;  1GXP A;  1OMI A;  3MCZ A;  2V4J C;  4M9Z A;  4AYB N;  2A5W A;  2L4A A;  3ABU A;  4XLC A;  2HQN A;  2WY7 Q;  2CU7 A;  2XPW A;  2EV5 A;  2FBH A;  3WHC A;  4UVC A;  2HVQ A;  1DDN A;  5M5Y J;  3CMM A;  1FTT A;  1IF1 A;  3L2U A;  4AVP A;  1T56 A;  4A3C J;  4H4K C;  1PUE E;  5FJ8 J;  2XB0 X;  4D7M A;  2UZK A;  1OFC X;  2RQP A;  1R1U A;  3BZ6 A;  1QBJ A;  3H0G J;  4AVZ A;  1R4M B;  3JRC A;  1XSD A;  2K3F A;  1N75 A;  2MAB A;  2W57 A;  3F0C A;  3R60 A;  2H1K A;  4A69 C;  2V26 A;  2R7Z J;  2Z99 A;  4IHW A;  2M8E A;  2GIV A;  3GFM A;  2STT A;  1YX3 A;  5CJ9 A;  3GX4 X;  3LMM A;  2DTZ A;  3DTE A;  1UB9 A;  2K9L A;  2F5V A;  1XDU A;  1IN5 A;  2QEX I;  3ZMZ A;  5C4J J;  3CCQ I;  4HQM A;  3LAJ A;  3W2A A;  2CW7 A;  3K0L A;  2HFH A;  3S17 J;  3RPQ A;  2O0Y A;  4L9N A;  2OV7 A;  3HSE A;  5E20 A;  2GBY A;  2KQR A;  3DEE A;  3GBG A;  3LL7 A;  1MH4 A;  5D6F A;  5F27 A;  3WTV C;  2R0Q C;  5CPR B;  5M3F J;  2VC1 A;  4I09 A;  4ZYE A;  3E0J B;  3MKW B;  4LLL A;  2QF7 A;  3ABM H;  4D5F A;  3I53 A;  4HV5 A;  1GV5 A;  4PJN A;  1RES A;  2B7E A;  2VQG A;  2BEO A;  4B48 A;  2FOW A;  4KT6 A;  4B47 A;  2BW3 A;  3Q0W A;  3MFK A;  4GO1 A;  1K4S A;  2A3S A;  1MDM B;  1WH5 A;  1WJB A;  2H09 A;  4XOT A;  2X1C A;  1SAX A;  3IRQ A;  3GTQ J;  3ZQ7 A;  5GAE J;  2LKX A;  2DA2 A;  2BGC A;  3N05 A;  1KU2 A;  3RYP A;  3OS2 A;  4UNO A;  2VBX A;  3R4K A;  1SD6 A;  2ZJQ F;  2DYR H;  2VPR A;  5J8C A;  4A93 J;  2VKE A;  3KIO A;  4A3L J;  2HDW A;  2R7S A;  2DMN A;  2FML A;  3N4M A;  4FX0 A;  1X4O A;  2M0C A;  2AHQ A;  5F0C A;  1HBX G;  1BBY A;  3LSK A;  3VOD A;  1R58 A;  1LUJ B;  2L7K A;  2QKM B;  3C2H A;  2KMU A;  4CHU A;  3OYI A;  1YX5 A;  5LFA A;  1MJB A;  1X19 A;  3RYR A;  3LFU A;  1QGP A;  2FA5 A;  4XR6 A;  3H9Q A;  1BA5 A;  1EA3 A;  3HSR A;  5FLX Z;  4RM2 A;  1LPQ A;  2EBI A;  3S2H J;  2CS3 A;  3QQA A;  4WX9 A;  1S7A A;  2F5D A;  2HR3 A;  1IW7 F;  2KIM A;  1WPK A;  3RQI A;  3HSF A;  3WU2 C;  3ZMD A;  3RKX A;  1HQC A;  2E19 A;  2DOA A;  5H20 A;  2G0E A;  2DDA A;  5KK1 A;  1I27 A;  4CA0 A;  5J6X A;  3FIS A;  2Y2Z A;  4IRI A;  2XAG A;  3R6S A;  5TRD A;  3HOS A;  2R92 J;  3RKQ A;  3KPH A;  3BR6 A;  3LSM A;  2Y9Y A;  3LSJ A;  3ZPL A;  4RS8 A;  3VDX A;  1P7I A;  2VT3 A;  3ZQI A;  3A01 A;  1R6R A;  2K5C A;  4N9H A;  3BR0 A;  3BTC A;  1REP C;  1GVJ A;  1FIP A;  2WA0 A;  2ZNZ A;  3JCU C;  1YJN I;  3HOU J;  1J2X A;  3P7N A;  1S3J A;  2GA1 A;  2ZFU A;  3W2W A;  2YUS A;  3C18 A;  4HDU A;  5IPA A;  1VTN C;  4CZZ A;  3ML6 A;  2QQA A;  3RPU A;  5J4V A;  5LHG A;  1KZH A;  2JVH A;  3SEQ A;  2KL4 A;  1RNL A;  3CP2 A;  2VJ4 A;  1J59 A;  1MND A;  3DPL C;  2HKX A;  5FFX A;  5B3S H;  1WJC A;  3C7J A;  3JRD A;  4CDG A;  4A3F J;  2EZH A;  3KLO A;  3O3K A;  2UUZ A;  2FX0 A;  2DOD A;  1FYM A;  4PFP A;  4X0G A;  4YIR X;  2CV1 A;  3TW6 A;  4E7I A;  1Q1H A;  4XRM A;  2AO9 A;  4RB2 C;  1TNT A;  1XG1 A;  1N25 A;  2NS8 A;  1LDK B;  5CYV A;  3SEZ A;  5D5U B;  4ESB A;  3DLA A;  2KRF A;  2PEX A;  4ZYH A;  2PMU A;  1UEL B;  2Y0S A;  3LAP A;  1OJL A;  2MFZ A;  3CO7 C;  1XGN A;  2HOT A;  3CJQ B;  1P4W A;  1ZN2 A;  2DMU A;  2JA2 A;  2CV0 A;  3HGY A;  1G3W A;  4MLO A;  5EZH A;  2JMW A;  3QPL A;  2CW0 F;  4RA2 A;  5GTI C;  1HXD A;  1XPX A;  2CQX A;  2OPT A;  4FCY A;  4MNU A;  3BCB A;  3FMQ A;  5JI6 A;  2LP0 A;  2PFB A;  4C30 A;  3CMA I;  1UAA A;  2FQ3 A;  1I1G A;  3QAH A;  5EYR A;  1MNE A;  4HG2 A;  2DMP A;  4E7J A;  3I0T A;  2HPI A;  1FEX A;  3WU1 B;  2OCC H;  5ILU A;  1CF7 B;  4F92 B;  3A02 A;  4DBR A;  1GLN A;  2OQG A;  1FY7 A;  3N97 A;  1D1C A;  1HW2 A;  1H9G A;  1AU7 A;  3F8M A;  2L2O A;  4DJA A;  2VON A;  4NC8 A;  3K1N A;  3GEZ A;  4IHY A;  1ZR4 A;  4V19 K;  3T5X A;  2DA5 A;  4I98 B;  3F22 A;  1V4R A;  2DQR A;  1FX7 A;  1Z1D A;  1SMY F;  1VQP I;  4MIM A;  3PQK A;  5IT9 K;  1STZ A;  2ZME A;  2NVU B;  2JJ7 A;  4PZJ A;  2OF7 A;  3EET A;  1SMT A;  3C1D A;  3RQ4 A;  4C2T A;  1B1B A;  1KQ0 A;  3K4N A;  1FBU A;  1BJA A;  5LLQ A;  4BY7 J;  1KON A;  1RET A;  2ID6 A;  1JT0 A;  2GA2 A;  5E1Z B;  2JWT A;  4UB8 C;  4QPQ A;  4XNF A;  1Z6T A;  3ISP A;  3OSF A;  1HKQ A;  3Q3S A;  5H6Q A;  2X1E A;  4KIS A;  4F55 A;  3K2A A;  3G3Z A;  4MHG A;  2ZSH B;  3J7Z I;  5FLX K;  2ACJ A;  2P5L C;  1XMK A;  3F6O A;  5B1B H;  1OYI A;  3BTJ A;  1WJD A;  3FK7 A;  1ON1 A;  3JTG A;  4G7O F;  1V5G A;  1NTC A;  4HOB A;  2FBI A;  2L9R A;  4XKV A;  5JVT A;  1FOX A;  2LDU A;  2LY9 A;  1G2H A;  4IQ4 A;  1QRY A;  2XAF A;  2A05 A;  3OIP A;  3ABL H;  2ID3 A;  3CMY A;  2BY3 A;  3I4N J;  3QU3 A;  2ZJP F;  4AM3 A;  2LBF A;  1ZK8 A;  3C2G A;  4YII A;  2P6S A;  2FMY A;  3I64 A;  1YS7 A;  2P5K A;  3BQZ A;  4UY8 I;  1Q1V A;  1EH8 A;  4M3G A;  5KHD A;  4RMN A;  2EIJ H;  1TTY A;  4FE7 A;  3Q0V A;  3WU0 A;  2JRM A;  1FT9 A;  5CQG A;  5HNF A;  1R1V A;  3PNT A;  2X9D A;  3MD2 A;  1ULY A;  3MKY B;  1PJR A;  3T0Y A;  1H0M A;  3PO2 J;  3EQL F;  5DDG A;  3OL4 A;  1TWG J;  3GVA A;  1SVM A;  2DDB A;  5H2F C;  2WBM A;  4B44 A;  2GXG A;  1XB4 A;  1MBJ A;  3B6A A;  3PSF A;  2XSJ C;  2FXA A;  4FQG A;  3U1K A;  1XD7 A;  1O57 A;  2HXO A;  3CDH A;  2L0K A;  3FHZ A;  4M71 A;  4HLY A;  1SFK A;  2LMD A;  4BHC A;  4Q5S F;  3WTW C;  2F5F A;  3SZP A;  1LB2 A;  2OQR A;  4JX6 A;  1CGP A;  2EIL H;  3S32 A;  1SFE A; 
#chains in the Genus database with same CATH homology
 2VT2 A;  2IPQ X;  5L3B A;  4R79 A;  5E8G A;  3QOP A;  2VE8 A;  3FX3 A;  4Q48 A;  2QEN A;  2JSC A;  2KJC A;  3CLO A;  3WTS C;  1IN4 A;  2E7W A;  5ILS A;  2OAZ A;  3U1D A;  1T0F A;  2QWW A;  4G9Y A;  1IN6 A;  2QBY B;  4WK8 F;  3PQJ A;  2FF4 A;  4JBA A;  2L01 A;  5L3C A;  1IAW A;  1YTY A;  1O7F A;  3G73 A;  5LEJ A;  2IW5 A;  1FC3 A;  2RN7 A;  1L3L A;  2MLG A;  4L18 B;  4HF0 A;  3GO5 A;  4EJU A;  4WXD A;  2RVC A;  3LA2 A;  1W7P A;  2X0L A;  1FBQ A;  3FWE A;  4PGH A;  3K9T A;  5D6E A;  4M73 A;  3GXO A;  1XSV A;  1Z6R A;  2CFX A;  1LQ1 A;  2GXB A;  1UST A;  1KA8 A;  3IKT A;  2O6G E;  1W5T A;  3DP7 A;  4WWC A;  4UVA A;  5CVI A;  1D8J A;  4UXN A;  2QUF A;  2VE9 A;  4RB3 C;  1BC7 C;  4U7D A;  2DO7 A;  2NRA C;  1ZG5 A;  5HLH A;  4OIP F;  2K27 A;  4MEX F;  1U5T B;  2DAO A;  2WV0 A;  3LQQ A;  4XSX F;  5LEK A;  4KNY A;  3WTZ A;  1G3S A;  4OIR F;  1JGS A;  1O7L A;  3M9A A;  3O6B B;  3GUD A;  3QP5 A;  6PAX A;  2Q0O A;  2EJR A;  4MQ9 F;  1JHF A;  4F7Z A;  3D5L A;  1LDD A;  1RUN A;  3K1M A;  2G9W A;  1IRG A;  1S7O A;  1HW1 A;  2ZFW A;  5D8L B;  2VBZ A;  1U78 A;  4I01 A;  2L54 A;  4YFN F;  2V79 A;  2F2E A;  4CO8 A;  4B09 A;  2K02 A;  2HTJ A;  4KIB A;  3P9I A;  4PDK A;  1FP1 D;  3TO7 A;  4FHT A;  4IJA A;  1TBX A;  3SZT A;  3W6K B;  5D5V B;  5DV5 A;  2HQR A;  1ZAR A;  3K69 A;  4ENN A;  3BPV A;  1T6S A;  2HYG D;  3WGH A;  3KEQ A;  3BPX A;  3WOD F;  4JQF A;  2M30 A;  3D0S A;  3KP4 A;  1MKM A;  2EA2 A;  4LG0 A;  2P7V B;  3NEU A;  3COA C;  1K78 A;  4Q4Z F;  2BYV E;  2A69 F;  1MD0 A;  2DQL A;  4PCQ A;  2Y75 A;  3HOT A;  2VOP A;  3SHF A;  2B0L A;  3REO A;  1FNN A;  3BOQ A;  3GFJ A;  5L3G A;  3JSP A;  4M6X A;  5D5X B;  5E1X A;  1RUO A;  3GLX A;  1TLH B;  2M5W A;  2XAJ A;  4HX4 A;  1SFU A;  1P92 A;  2LSO A;  1E17 A;  4KUM A;  5AIQ A;  5BPD A;  1OPC A;  1YW8 A;  5D8K B;  2VC0 A;  5BMZ A;  2QYO A;  1ZRC A;  2D2W A;  3B02 A;  4RGU A;  4KN4 X;  2DPU A;  5HS8 A;  2DLL A;  5L3F A;  3WE2 A;  2EFO A;  1ZLJ A;  1U3E M;  2MD5 A;  4ON0 A;  4ESF A;  3L09 A;  1ZYR F;  4EJW A;  2NS0 A;  4G6D A;  3VEP A;  4TV7 A;  3HRS A;  5FD6 A;  2EA4 A;  1XGO A;  3QP6 A;  3JTH A;  1KU7 A;  1T98 A;  5ICE A;  2PN6 A;  3TGN A;  2VBY A;  4Q47 A;  3F23 A;  2L4M A;  5LGU A;  3V7S A;  3BRO A;  3ERE D;  2IRF G;  1MGT A;  4Y15 A;  2MH2 A;  3HUG A;  1GHC A;  3T1B A;  4P55 A;  3JAM Z;  4EVI A;  3KET A;  3L7W A;  3V7C A;  1WKM A;  3LWF A;  4LD5 A;  3O2P E;  3KE2 A;  1C0W A;  5HOO A;  3E5Q A;  2YU3 A;  5K1Y A;  1T2K A;  2GWR A;  4ETS A;  5K5O A;  3I4P A;  4RB0 A;  1IZ1 A;  3K2Z A;  5IT9 Z;  1OR7 A;  5E8I A;  4WXC A;  3EYY A;  5E17 F;  1ZRE A;  1XN7 A;  5FD5 A;  1J7K A;  4CIC A;  4AD9 A;  2LKP A;  3E5X A;  5CVJ A;  4IF4 A;  5LHH A;  2ETH A;  1RIO H;  3DV8 A;  1QO0 D;  2ZBK A;  1G3Y A;  5TJJ A;  2DK8 A;  2QVO A;  3FXU A;  4OMY A;  4EMS A;  5LBQ A;  4A0X A;  3DKW A;  1JXS A;  3HTU A;  1B9M A;  5HDN A;  3WTY C;  1HSJ A;  3SXY A;  5DD8 A;  5DCM A;  3TOA A;  1OKR A;  1HKS A;  4AIK A;  1FYK A;  2ZJ2 A;  2HGC A;  2CYY A;  2BBY A;  3CUQ B;  3IWZ A;  3GYH X;  5FB2 A;  4HX8 A;  2C6Y A;  1Z7U A;  2HZT A;  2VN2 A;  4NQW A;  1R23 A;  1B4A A;  4M6Y A;  3KP2 A;  1K6O A;  3BWG A;  2YX4 A;  3GFI A;  3QRF F;  4IHT A;  4KMF A;  1YFH A;  4XRF A;  1I5Z A;  3DXJ F;  1IXS B;  3I59 B;  3CJN A;  2HKO A;  5FFZ A;  4WXH A;  3HRT A;  2CWE A;  3M8F A;  3F72 A;  2ZXJ A;  1RZ4 A;  1BI1 A;  2YSR A;  2R3S A;  2HS5 A;  1U8R A;  3TKY A;  4IRH A;  5LGN A;  4A6D A;  1JE8 A;  1BN5 A;  2P8T A;  4IPA A;  3JAM K;  4HF1 A;  1YYV A;  1XGS A;  2Y48 A;  5CVV A;  4A2U A;  4H0E A;  3FF5 A;  3LA3 A;  3IRR A;  1G6N A;  4UVB A;  3GWZ A;  2A61 A;  1PP7 U;  1B59 A;  2ZCW A;  1R1T A;  2XGX A;  2D1V A;  1Y0U A;  3BY6 A;  2PMH A;  4XLP F;  2XKO A;  4NB5 A;  5BS6 A;  3MZY A;  4I02 A;  1TW2 A;  5FO5 A;  3F8N A;  3V8K A;  2KJB A;  2Z9O A;  3DQV C;  2K4B A;  1KGS A;  5HS7 A;  4MQV A;  1YO5 C;  1USS A;  5E1W A;  4RAY A;  1YIO A;  3M1E A;  3I54 A;  2W25 A;  2PJP A;  5BPI A;  2M45 A;  4E70 A;  1YW9 A;  3VOE A;  4P96 A;  1ZRF A;  1BOA A;  2ZO4 A;  3E6C C;  1D5V A;  3V8L A;  1KU3 A;  1JHH A;  5JR3 A;  2RKH A;  1HW5 A;  2DTR A;  3HHH A;  1QZZ A;  4M74 A;  2A6E F;  1TQI A;  3P9K A;  4ENM A;  2VXZ A;  2CG4 A;  3F8B A;  1WSU A;  2FRH A;  2FU4 A;  4KA4 A;  1U5T C;  5DYM A;  4UUV A;  2DFI A;  2Q2E A;  3FMS A;  1U6G A;  1QQI A;  4ZH4 F;  1IRF A;  3HHG A;  2YX7 A;  4I0B A;  4N9I A;  3JW4 A;  5FGM A;  3ZMS A;  3E97 A;  1EH7 A;  2AS5 F;  3MAJ A;  1BC8 C;  3IC7 A;  1ON2 A;  3ECH A;  4CYD A;  3R0A A;  2QQ9 A;  4EJT A;  4HDV A;  1Z05 A;  4UV9 A;  2ADU A;  3WGG A;  1HKT A;  1ODD A;  2Y0M A;  2J5P A;  1FWZ A;  4A0Z A;  4ENJ A;  1O3T A;  1KQ8 A;  4QLC U;  4FX4 A;  5DUK A;  2ELH A;  3DFG A;  1V3F A;  5JHU A;  1FP2 A;  1IN7 A;  2D1H A;  3S2W A;  2XHK A;  2CO5 A;  2O61 A;  5HS9 A;  3TOB A;  3MZH A;  3IWF A;  2Z3Y A;  2PLY A;  2QM3 A;  2EB7 A;  2BE5 F;  1SD7 A;  5A2Q Z;  2H6B A;  2OZU A;  2DBB A;  3ZN0 A;  1D3Y A;  3I71 A;  3F8F A;  2IJL A;  2JPB A;  4M9S A;  3TQN A;  3U9G A;  3C3W A;  3L00 A;  3WTX C;  5L3E A;  2JZY A;  1TQP A;  2ZME B;  2FNP A;  3ZMV A;  2GZW A;  3H92 A;  3H3Z A;  4OOI A;  3ZMU A;  2W84 A;  3KLN A;  2MLK A;  3SFZ A;  2IP2 A;  3VFZ A;  1K7A A;  2FOK A;  2OA4 A;  2X4H A;  4GCV A;  4A6E A;  3CTA A;  3E6B A;  5LRR A;  3DEU A;  4RGX A;  5DCF A;  1DPU A;  4EGZ A;  5D4R A;  3KEO A;  3ZP5 A;  5BQT A;  2UXN A;  2EFW A;  2FNA A;  4G7H F;  4YIF A;  3TO6 A;  5ED4 A;  2V1U A;  3IL2 A;  3QPH A;  5LGT A;  3KP7 A;  4ZZL A;  3F3X A;  4KN7 X;  1F1Z A;  1LDJ A;  1MDM A;  4I2O A;  3M7G A;  3V8J A;  4EM2 A;  5F1R A;  4S04 A;  2P6T A;  2PG4 A;  1XDS A;  4G94 A;  1ZLK A;  5K5R A;  1FLI A;  4U0Y A;  1LNW A;  3NRV A;  3R0J A;  2IA2 A;  1I6X A;  2PI0 A;  4L0Z B;  4AWX B;  1XGM A;  3BJ6 A;  3HIF A;  1ZG3 A;  1P4X A;  2L3D A;  4G8X A;  2MA3 A;  4HYE A;  1LJ9 A;  5F6F A;  5BOX A;  1O3S A;  3KP5 A;  3J81 K;  2XVC A;  5DUI A;  3P9C A;  4HBL A;  2HTS A;  2XKP A;  2M1B A;  2CQK A;  4YFX F;  3AAF A;  4ZYG A;  4MTE A;  5H6R A;  5A2Q K;  1O3R A;  2G7H A;  4OU0 A;  1OYW A;  4M9X A;  1FSH A;  4K2E A;  3H3U A;  2RC4 A;  1R5H A;  5HDG A;  2GAU A;  2A6H F;  3RKY A;  4XBF A;  4LGW A;  3V7R A;  2V1D A;  2HYF A;  1DPR A;  1KYW A;  3FXQ A;  3T8R A;  5K5Q A;  4Y13 A;  5CVU A;  2IVM A;  3KCC A;  1F9N A;  2DPD A;  1W7P B;  3KFW X;  3I58 A;  4L9V A;  4LLN A;  3FXR A;  2Q8K A;  3FM3 A;  5HLI A;  4G7Z F;  1R36 A;  1TQM A;  5ERI A;  4LJZ F;  4I0A A;  3LQR A;  1J75 A;  3CUQ C;  2KIU A;  2E1N A;  2HWV A;  3ZN1 A;  2V6C A;  2O8X A;  2R7F A;  3GF2 A;  4A5M A;  3SQN A;  2XIG A;  1S6L A;  2D45 A;  1CF7 A;  3J80 K;  2FE3 A;  5EEH A;  1J0R A;  1DUX C;  3J7A O;  4XSZ F;  3LST A;  5J8F A;  1MJA A;  3TDZ C;  2IT0 A;  2F5E A;  2W85 A;  2AXL A;  2GQQ A;  1KQ9 A;  5ICC A;  1FZP B;  1G3T A;  4D0P A;  4Z2Y A;  2IA0 A;  2MH9 A;  4RAZ A;  4U0V A;  1P6R A;  5IT3 A;  2QLZ A;  1L0O C;  4RGR A;  1FBS A;  1GXQ A;  2BV6 A;  1R22 A;  3ECO A;  4BYY A;  2UXX A;  2UWM A;  1QNT A;  2VOO A;  2CGP A;  4U88 A;  1YG2 A;  4KYW A;  2EV0 A;  1UHM A;  3TO9 A;  1T39 A;  2ZKZ A;  4HAM A;  4HLX A;  3GFL A;  3NQO A;  2XV4 S;  4IHS A;  4BQA A;  1R7J A;  1W5S A;  5ICF A;  2DU9 A;  5ICG A;  4LG0 B;  1K78 B;  4MGR A;  1ZAO A;  3VB2 A;  4P5O A;  2JT1 A;  4B8X A;  3W6J B;  2EK5 A;  1QPM A;  2OU2 A;  1FOK A;  2H94 A;  4I7H A;  1HST A;  4DNC A;  2CSO A;  4A5N A;  2NNY A;  4P9F A;  3B73 A;  5D4S A;  3ELK A;  4U0W A;  2FSW A;  4BHP A;  3WE3 A;  1YLF A;  4HW0 A;  5HLG A;  3E6M A;  3BJA A;  4BXU A;  3ULQ B;  2V9V A;  4BNC A;  1P4A A;  4BHB A;  2RDP A;  3BP8 A;  2YPR A;  3F6V A;  3FMR A;  4EJV A;  2VBW A;  2NAZ A;  1BI0 A;  4EQQ A;  1NHA A;  3Q9V A;  3BJO A;  1WQ2 A;  2ISZ A;  2LF8 A;  1SD4 A;  3E5U A;  2QBY A;  5F64 A;  1YW7 A;  2K7L A;  2W24 A;  4OMZ A;  1T38 A;  1OYY A;  1XMA A;  3L9F A;  4ASN A;  4R1H A;  1BIA A;  1PP8 F;  4G6Q A;  1MJ9 A;  4HX7 A;  4IVN A;  2JTV A;  4ZZD A;  2M87 A;  2ESH A;  3MWM A;  2E7X A;  3IHU A;  5AON A;  4HF2 A;  2YR2 A;  3L2C A;  3T8T A;  4LLG F;  2RNJ A;  3KZY A;  1P2F A;  4ZYD A;  4ESJ A;  1ZG1 A;  3IKV A;  5AIP A;  2A07 F;  2LNB A;  3EDP A;  3FM5 A;  3K1P A;  1Z9C A;  4KIC A;  2RV8 A;  2Z5U A;  2XAS A;  1RI7 A;  4KIF A;  4BAY A;  5LHI A;  1TNS A;  2XRN A;  2J5O A;  4Y17 A;  1TW3 A;  1AWC A;  1SFE A;  3HYI A;  1UFM A;  5LRS A;  1BM9 A;  1U5T A;  4YG2 F;  2ESN A;  4IXA A;  1KU9 A;  2MC3 A;  3GZ5 A;  3CO6 C;  1F4K A;  2H6C A;  4R8H A;  2F5C A;  4MEY F;  5DD4 A;  1J9I A;  3LFK A;  1R00 A;  2PQ8 A;  3R61 A;  1BI2 A;  4O6J A;  2EV6 A;  2O3F A;  3RJP A;  3E6D A;  3WTT C;  4XLN F;  5ILV A;  2V1X A;  3E3V A;  4N0B A;  2WC2 A;  1G4D A;  4AIH A;  4EJO A;  2K4J A;  4GYG A;  1YS6 A;  1A04 A;  5DCM B;  2XAQ A;  3TDU C;  1IN8 A;  3GZ6 A;  3JSO A;  4LFU A;  3RTR A;  4GXO A;  2MBF A;  4LK1 F;  1EH6 A;  2O03 A;  3FZV A;  2HEO A;  1D8K A;  1FPQ A;  4HA8 A;  3WGI A;  5HVQ C;  2EFN A;  3DPT A;  1ZH5 A;  2E1C A;  3HRU A;  1ZGA A;  4KIG A;  4LB6 B;  4M72 A;  4IRG A;  3Q5F A;  2TDX A;  1XSX A;  1IUY A;  2RGV A;  1J5Y A;  2QZ8 A;  4BH9 A;  4O3M A;  4YFK F;  3EYI A;  4L5J A;  4S05 A;  3CUO A;  1MZB A;  4L5I A;  3J81 Z;  1SFX A;  5HDK A;  3QU6 A;  4DQ2 A;  2FEZ A;  1WI9 A;  2KIF A;  3BDD A;  4EM0 B;  4EGY A;  3EUH A;  4OIN F;  3KZZ A;  4EM1 A;  3RI4 A;  1B9N A;  4KMU X;  4AIJ A;  2WWY A;  1LEB A;  2H27 A;  1QZY A;  5EEG A;  1IXR C;  3RDI A;  2PBI A;  3V4G A;  2DT5 A;  4RGS A;  4L9T A;  3RKW A;  4LK0 F;  3F21 A;  3U2R A;  2JPC A;  4HZF A;  2EFQ A;  3PFI A;  1X3U A;  1E2X A;  4A0Y A;  2JRT A;  2LF7 A;  5L3D A;  2NYX A;  1S29 A;  4A12 A;  4GGG A;  4LB5 A;  3ABT A;  2KKO A;  1SD5 A;  3MQ0 A;  3F8C A;  1S8N A;  1KYZ A;  4L0Y B;  1Z91 A;  4P9U A;  2A5Y B;  2L02 A;  4NHJ A;  2EWN A;  4WF2 A;  2DK5 A;  3J80 Z;  2A68 F;  4CXF A;  2P5V A;  4U7B A;  4HQE A;  2QQB A;  4UHT A;  2ZNY A;  2HOE A;  3HTS B;  4CGZ A;  3DF8 A;  1WWX A;  4JK1 X;  1ONV A;  2XRO A;  2WTE A;  4QWQ A;  1XCV A;  2COM A;  4OIO F;  2HDC A;  1UCR A;  5D5W B;  2P4W A;  3LA7 A;  1O3Q A;  3OOP A;  2VOD A;  2R7D A;  1PDN C;  5KVR A;  4L9J A;  2G7U A;  3WTU C;  1AOY A;  5DEQ A;  3M8E A;  1FYL A;  4WCG A;  4KFC A;  2P7C B;  3GW2 A;  3WG9 A;  2FBK A;  1W7P D;  2DW4 A;  1BIB A;  4UV8 A;  2ISY A;  3RIR A;  2XUB A;  1B6A A;  4RB1 A;  2OD5 A;  1ZRD A;  1UHW A;  3QPT A;  2OBP A;  4EV0 A;  1W4M A;  3Q9S A;  2STW A;  3KP3 A;  1I1S A;  1WRJ A;  1ZGJ A;  1ZHF A;  4FT8 A;  4KT5 C;  3KP6 A;  1LEA A;  2XAH A;  3CUQ A;  2Z33 A;  1LVA A;  1F5T A;  1DP7 P;  2EFP A;  2IA1 A;  1K79 A;  3ZMT A;  1U2W A;  3OV8 A;  4MTD A;  4KDP A;  4OIQ F;  5JFR A;  2K86 A;  1IXC A;  5E18 F;  2DI3 A;  1FSE A;  3I5U A;  3I59 A;  4LMY A;  5CVR A;  5CLS A;  4ENK A;  4HV6 A;  1H9T A;  4GYI A;  3HRM A;  3ROU A;  2OZ6 A;  1R5G A;  1BI3 A;  2NNN A;  3MEX A;  1XCB A;  1EV7 A;  4PGG A;  1YQA A;  1GXP A;  1OMI A;  3MCZ A;  4M9Z A;  2L4A A;  3ABU A;  2HQN A;  2EV5 A;  2FBH A;  4UVC A;  1DDN A;  1IF1 A;  4AVP A;  1PUE E;  2UZK A;  2RQP A;  1R1U A;  3BZ6 A;  1QBJ A;  1XSD A;  2W57 A;  3R60 A;  2Z99 A;  2M8E A;  2GIV A;  3GFM A;  2STT A;  5CJ9 A;  3GX4 X;  1UB9 A;  1XDU A;  1IN5 A;  3ZMZ A;  4HQM A;  3LAJ A;  3K0L A;  2HFH A;  3RPQ A;  2O0Y A;  4L9N A;  3HSE A;  5E20 A;  3WTV C;  5D6F A;  2VC1 A;  4I09 A;  4ZYE A;  4LLL A;  3I53 A;  4HV5 A;  2BEO A;  3MFK A;  4GO1 A;  2A3S A;  1MDM B;  2H09 A;  1SAX A;  3IRQ A;  3ZQ7 A;  2BGC A;  4UNO A;  1KU2 A;  3RYP A;  2VBX A;  3R4K A;  1SD6 A;  5J8C A;  2FML A;  3N4M A;  4FX0 A;  1HBX G;  1BBY A;  3VOD A;  1R58 A;  4CHU A;  1MJB A;  3RYR A;  1QGP A;  2FA5 A;  3HSR A;  5FLX Z;  4WX9 A;  1S7A A;  2F5D A;  2HR3 A;  1IW7 F;  2KIM A;  3ZMD A;  3HSF A;  3RKX A;  1HQC A;  5H20 A;  5KK1 A;  1I27 A;  5J6X A;  4IRI A;  2XAG A;  3R6S A;  5TRD A;  3HOS A;  3ZPL A;  4RS8 A;  2VT3 A;  4N9H A;  1REP C;  1GVJ A;  2ZNZ A;  1J2X A;  3P7N A;  1S3J A;  2GA1 A;  3C18 A;  4HDU A;  1VTN C;  4CZZ A;  3ML6 A;  2QQA A;  3RPU A;  5LHG A;  1RNL A;  1J59 A;  3DPL C;  2HKX A;  5FFX A;  3C7J A;  4CDG A;  3KLO A;  3O3K A;  1FYM A;  1Q1H A;  4RB2 C;  1TNT A;  1LDK B;  5CYV A;  5D5U B;  4ESB A;  2KRF A;  2PEX A;  4ZYH A;  2PMU A;  3LAP A;  3CO7 C;  1XGN A;  1P4W A;  1ZN2 A;  1G3W A;  2CW0 F;  1HXD A;  4MNU A;  5JI6 A;  3FMQ A;  2PFB A;  2FQ3 A;  1I1G A;  3QAH A;  3I0T A;  3WU1 B;  5ILU A;  1CF7 B;  2OQG A;  1FY7 A;  3N97 A;  1HW2 A;  1H9G A;  3F8M A;  2VON A;  3K1N A;  3GEZ A;  3T5X A;  4I98 B;  3F22 A;  1V4R A;  2DQR A;  1FX7 A;  1Z1D A;  1SMY F;  3PQK A;  5IT9 K;  1STZ A;  2ZME A;  4PZJ A;  3EET A;  1SMT A;  3C1D A;  1B1B A;  1KQ0 A;  1FBU A;  1BJA A;  5LLQ A;  2GA2 A;  5E1Z B;  1Z6T A;  3ISP A;  1HKQ A;  5H6Q A;  3G3Z A;  4MHG A;  5FLX K;  2ACJ A;  2P5L C;  1XMK A;  3F6O A;  1OYI A;  3JTG A;  1ON1 A;  4G7O F;  4HOB A;  2FBI A;  5JVT A;  2LDU A;  2XAF A;  3QU3 A;  4YII A;  2P6S A;  2FMY A;  3I64 A;  1YS7 A;  2P5K A;  1EH8 A;  1TTY A;  3WU0 A;  1FT9 A;  1R1V A;  1ULY A;  3T0Y A;  1H0M A;  3EQL F;  5DDG A;  3GVA A;  2GXG A;  1XB4 A;  2FXA A;  1XD7 A;  1O57 A;  3CDH A;  4HLY A;  3FHZ A;  4M71 A;  4BHC A;  4Q5S F;  3WTW C;  2F5F A;  3SZP A;  1LB2 A;  2OQR A;  1CGP A;  4O5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...