4AWXB

Moonlighting functions of feoc in the regulation of ferrous iron transport in feo
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
63
Chain Sequence
PLGSMASLMEVRDMLALQGRMEAKQLSARLQTPQPLIDAMLERMEAMGKVVRISEQEWWALRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERROUS IRON TRANSPORT PROTEIN B
publication title Crystal Structure of the Klebsiella Pneumoniae Nfeob/Feoc Complex and Roles of Feoc in Regulation of Fe2+ Transport by the Bacterial Feo System.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Metal transport
total genus 17
structure length 63
sequence length 84
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09012 FeoC FeoC like transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4awxB00
4KIBA 2EA2A 3B73A 3ECOA 5H20A 2FBHA 4EV0A 3FHZA 2MBFA 4MEYF 2O3FA 2FU4A 4UUVA 1V4RA 4WCGA 1LEAA 1G3SA 1ON2A 4M71A 4L0YB 3L9FA 5E8IA 3ULQB 1SMTA 1UFMA 1YFHA 2VOOA 4U0WA 3IC7A 3W6KB 3HOSA 3WGGA 1I1SA 1EH6A 4QLCU 3L2CA 4EM2A 4PGGA 3WGIA 4M72A 4O5VA 3NEUA 4S04A 2VBZA 1U2WA 1J5YA 5ICCA 1SFEA 3FX3A 2CWEA 3W6JB 2ZMEA 4ZYGA 1WSUA 5BMZA 5FGMA 5LEKA 4EJVA 1IZ1A 2J5OA 1FBQA 1IN8A 1LJ9A 4RAYA 1FSHA 3N97A 4XSZF 1D5VA 2HQRA 5CVVA 2BYVE 2CSOA 3GUDA 4MTDA 3T8TA 4FX4A 1I6XA 3DXJF 5JFRA 2VC0A 3ZP5A 4U7BA 3GO5A 5E20A 2V6CA 1SD5A 1KQ9A 1L0OC 5TJJA 1YS6A 1HW5A 1FYMA 2M5WA 3LQQA 4Z2YA 4RAZA 3SZPA 1IAWA 1OKRA 3I53A 3FM5A 3Q9SA 5BS6A 2CYYA 4AD9A 2RKHA 5K1YA 2OQRA 1MD0A 1F1ZA 3MWMA 2M30A 4A0YA 1A04A 1ZLJA 2XAJA 1ZRDA 3NQOA 1ZYRF 3L7WA 2GZWA 5LGUA 3J80K 1XSDA 2PN6A 1ON1A 3ABTA 1B9NA 1TW2A 4EM0B 2O8XA 5FFZA 4BNCA 3CLOA 5F6FA 2VONA 3ML6A 2VBXA 1KYZA 3I59A 1QZYA 2FE3A 3E6DA 5K5OA 2FA5A 1IUYA 2V1DA 5L3EA 4HV5A 1XGOA 1K78A 3PFIA 3TQNA 1PUEE 5BPDA 4XSXF 4P5OA 2EWNA 3HSRA 5K5QA 3K9TA 3P9KA 2JT1A 1AWCA 4KMFA 4WWCA 4UHTA 3ERED 4EJOA 5D5UB 2VC1A 3PQJA 5AONA 4AVPA 4HF1A 4RS8A 2JZYA 4LB6B 4B8XA 2ESNA 5HDKA 2G9WA 5FLXK 1J59A 5D8LB 1ONVA 3C7JA 1L3LA 1G3YA 1TW3A 2K02A 2QQAA 1GXPA 2DW4A 2GIVA 3CTAA 3LAPA 3BJOA 5LGNA 3N4MA 1PP7U 1FP1D 5DCMB 3KCCA 5ILSA 4XLNF 4UV9A 4XLPF 4G6DA 2L3DA 2L02A 1H9GA 3GX4X 1XB4A 1B4AA 2M45A 5AIPA 3F8FA 2HGCA 1R22A 1QNTA 1TNTA 2W84A 3F3XA 1Z91A 3SZTA 4GYGA 2KJBA 3MZYA 3AAFA 1T6SA 2A61A 4PCQA 1UHWA 1BI0A 4R8HA 5IT9Z 3J81Z 1K6OA 1ZGAA 3HHHA 2RGVA 3M7GA 5HS9A 5LHHA 1V3FA 5JHUA 3V8KA 1P92A 1LEBA 1SMYF 4G8XA 4RB0A 4MEXF 4L9JA 3CO7C 1YYVA 3TO7A 3LA7A 1JHFA 5HLHA 3IRQA 3M1EA 3HSFA 1OYWA 5DUIA 3P9IA 2CO5A 4O3MA 5D5VB 2JPCA 3DP7A 4YIIA 3KLNA 3EQLF 1SD4A 5HVQC 3K2ZA 3E6BA 5TRDA 2W85A 4Q4ZF 3FXQA 4UXNA 3HOTA 2HTJA 3D5LA 1BC8C 1ZLKA 4TV7A 3RTRA 1KU7A 2X4HA 2PJPA 2KJCA 1FWZA 4OIPF 5BOXA 1X3UA 1XD7A 4GCVA 2VOPA 4ASNA 3M8EA 3ROUA 1D8JA 4M73A 4KFCA 2PI0A 5D8KB 4CO8A 4Q47A 3ZPLA 4RB2C 3KLOA 4PDKA 1Q1HA 4IJAA 4ZH4F 4FHTA 4U0VA 4G7HF 3KP4A 5LEJA 4EMSA 2MA3A 1USTA 3RPQA 1Y0UA 3DV8A 4G9YA 2HYFA 4JBAA 4DNCA 4RGSA 1ZG5A 3GZ6A 5D4RA 2XVCA 4I0BA 4CYDA 4L18B 1FY7A 4CDGA 5EEGA 2EFOA 2W57A 4ZYHA 1BOAA 1BI3A 5HS7A 2IPQX 3G73A 2XAFA 4P55A 2WTEA 2XROA 1XCBA 4JK1X 4KIGA 1Z05A 5HOOA 4IXAA 2HR3A 2QBYB 4G7OF 1E2XA 5L3GA 2DK5A 3KETA 2H27A 3RYPA 3LSTA 4UVCA 1J9IA 1J7KA 2LSOA 5ICEA 4HZFA 1LVAA 2EFQA 1CF7B 1F9NA 2RVCA 4BH9A 2L01A 3E6MA 1OMIA 4M6XA 2EB7A 3DPTA 5E1ZB 3RJPA 5EEHA 5E1XA 2MLGA 4OOIA 4CICA 3MEXA 1R1UA 2QQBA 4IVNA 1KQ0A 3DKWA 1ZG3A 4R79A 1LQ1A 1ZHFA 2A07F 3ZMSA 4UNOA 4L9NA 3GFMA 4LG0A 2Q0OA 1IXRC 3HUGA 2IJLA 3FWEA 1GHCA 2GXGA 1NHAA 3LQRA 3M9AA 5HLIA 2P7VB 3ELKA 4BAYA 1XCVA 1KGSA 4HF0A 3V8JA 4OIRF 4HW0A 5FO5A 3E3VA 2Z9OA 5AIQA 1R1TA 2CG4A 2P6SA 3KP5A 2GQQA 4YFKF 1OYYA 3REOA 3DEUA 3I5UA 1SD7A 4N9HA 3F72A 2NRAC 4I01A 2C6YA 3EYIA 3CUQB 2ZJ2A 1P2FA 3F8CA 2EFNA 3LFKA 4L0ZB 2ZNZA 2WC2A 5ILUA 2HWVA 3I58A 1WKMA 1AOYA 1MGTA 2F5DA 2YR2A 6PAXA 2MC3A 1XGSA 2DU9A 2STWA 2DQLA 5A2QK 2YX4A 2IVMA 4EQQA 5KK1A 3F8BA 2O61A 1R7JA 2VBWA 4LD5A 4O6JA 4NHJA 4ENJA 4I02A 2ZFWA 2V9VA 3ZN0A 4BQAA 3KFWX 3E5QA 1RZ4A 1LDJA 2LNBA 2QVOA 1MDMA 3R0JA 2CW0F 2QENA 2LF8A 3TOBA 1JGSA 2PBIA 3F8NA 4Y17A 2Z5UA 4WXDA 1O3QA 5DEQA 4M9ZA 4BHPA 5LLQA 3ZMVA 3M8FA 3RKXA 1HXDA 5DD8A 1QGPA 4HX8A 2DTRA 3IKTA 3JAMZ 1Z6TA 2F5EA 4RGUA 3WE2A 3RI4A 2JPBA 5D5XB 2QWWA 3R4KA 3FXRA 1IN5A 3ZMDA 2FNPA 2NAZA 2K86A 4LLGF 1U5TB 5ICFA 1FSEA 2VT3A 4HQMA 3U2RA 3LAJA 2R7FA 1YG2A 3KZYA 2FXAA 2ZBKA 3K69A 2D2WA 2ETHA 2RQPA 2ELHA 2JTVA 3HIFA 3V7CA 5ERIA 1R5GA 1YW7A 1IW7F 3ZMUA 5ED4A 2O0YA 1U78A 2K4BA 5D6FA 2FF4A 3HYIA 1WRJA 1WWXA 2OU2A 2XKPA 4OIQF 4WF2A 5BQTA 3GW2A 3IWFA 2DPUA 1O3SA 4M9SA 4L9VA 3V7RA 2EV5A 1OYIA 1S7AA 3KEQA 5L3CA 2KIMA 2VODA 1P4AA 2PQ8A 3C3WA 5FD5A 3GFJA 3VOEA 3TDZC 2QQ9A 3H92A 5E8GA 2PFBA 1BBYA 1TNSA 3WTYC 2IRFG 2CGPA 4IRGA 1W7PA 4XRFA 1O3TA 4ZZLA 4Y15A 2DAOA 3RKYA 3MZHA 2XRNA 4KN4X 1BN5A 1RUNA 1UB9A 4ETSA 3WTSC 3R0AA 4U88A 1Z7UA 1QO0D 3VEPA 1B9MA 2DQRA 4KYWA 4N0BA 2RNJA 4EVIA 3BPVA 1XGNA 3WTZA 2EV6A 4IHSA 4EM1A 1KU3A 4RB1A 2NNYA 3WG9A 1XGMA 2XHKA 3ZMTA 2P8TA 4U7DA 3GYHX 1KU2A 3DF8A 4HQEA 2E1CA 1LDDA 2RC4A 2DO7A 2VT2A 3HSEA 1C0WA 2HS5A 2KIFA 4BHCA 3D0SA 1FP2A 1HBXG 4A0ZA 3I4PA 4BXUA 3GXOA 1P4WA 3ECHA 5FB2A 3QOPA 1T39A 2AS5F 3FMRA 2D1HA 2ISYA 1MZBA 5LBQA 5E18F 1RI7A 3U1DA 1MJ9A 5BPIA 4I2OA 5L3BA 2FQ3A 3GLXA 2LF7A 2ISZA 4S05A 3BJAA 2EJRA 3E5XA 3L09A 1I27A 3GVAA 3C18A 4MQ9F 2HTSA 2X0LA 5IT9K 2NNNA 3J81K 2Y0MA 1XDUA 2P5KA 2PMUA 2DPDA 1XSXA 4A0XA 5CVUA 4A6EA 4HOBA 3G3ZA 3T0YA 2Y75A 1FLIA 2H6BA 1UHMA 3C1DA 5ILVA 4GO1A 5JVTA 2ZMEB 2OZUA 4D0PA 2V79A 3WTXC 3KZZA 5HS8A 4CXFA 3V8LA 2UZKA 3TO9A 3GFIA 2XAHA 2D45A 2A3SA 2DI3A 5LRRA 2PG4A 3QAHA 5KVRA 5J8CA 1D8KA 5CYVA 1P6RA 1USSA 1ZGJA 2Q2EA 4B09A 1IF1A 1R58A 2FSWA 1T38A 3L00A 1FC3A 3I71A 5DV5A 2MH9A 3MCZA 4WK8F 1RUOA 2EA4A 3ISPA 3HRUA 2GXBA 1IRFA 3VFZA 1H0MA 3K1NA 2HOEA 4GYIA 3PQKA 1IN7A 1O7FA 2JSCA 1GVJA 1DP7P 3IHUA 2QZ8A 1TTYA 2A5YB 2MD5A 2MH2A 4HX7A 4A5NA 4HDVA 2XUBA 3V7SA 1DPRA 1ZREA 3BOQA 2A69F 4HA8A 2A6HF 4IRIA 4ESJA 4P9UA 2TDXA 1YW9A 4EJUA 4MHGA 1DUXC 1T98A 1Z6RA 1ZN2A 2UXNA 4G94A 3VODA 4I98B 1IN6A 3F6VA 4M74A 3SFZA 3WTWC 3FMSA 4YIFA 1XSVA 3QPHA 2L4AA 1R5HA 2HZTA 4BYYA 3QPTA 1R36A 2QM3A 2XAQA 3T5XA 3WTTC 2YSRA 3IRRA 3SHFA 4HF2A 2FMLA 2K27A 3SQNA 5DYMA 3RIRA 4LMYA 3I0TA 4QWQA 3K0LA 3I64A 3E6CC 3I59B 1Z9CA 1BIBA 4Y13A 1K78B 1XMKA 2PLYA 5H6QA 4I0AA 3VB2A 4OIOF 3OOPA 1OPCA 1LDKB 1RIOH 1STZA 3QU3A 4HDUA 1QBJA 1BI1A 4GXOA 1O3RA 1HKSA 2K4JA 1FX7A 1T0FA 1S8NA 4U0YA 1YS7A 4NQWA 3ZMZA 1QQIA 2Z33A 1IXCA 1YTYA 4KA4A 2HKXA 3BP8A 2BGCA 2HDCA 4ENKA 1D3YA 2E7XA 4ENNA 2M8EA 2KRFA 4KICA 3BWGA 1SAXA 2VE8A 1B6AA 1WQ2A 4PZJA 5DCMA 4UVBA 2OAZA 1MJBA 2ADUA 2IP2A 2W25A 4CHUA 1PP8F 2QLZA 4P9FA 2M87A 4CGZA 4GGGA 1JHHA 5J8FA 3GF2A 3CUQC 5CLSA 4JQFA 3BDDA 2HFHA 1P4XA 1XMAA 2XIGA 3HRMA 1FYLA 4DQ2A 2G7HA 1BC7C 3TKYA 4R1HA 1BJAA 1K79A 4Q48A 3JSOA 1HSJA 2Q8KA 2PMHA 3GEZA 1WI9A 2H09A 1G3TA 1RNLA 2UXXA 4ZZDA 5DUKA 1HKTA 1VTNC 1Z1DA 4F7ZA 4IF4A 5FD6A 4MTEA 5HDNA 1HQCA 3WU0A 2WV0A 2FOKA 1U8RA 2XKOA 3K1MA 2P5LC 4RGXA 3JSPA 5JI6A 3R61A 2ZCWA 1F4KA 4ESFA 4K2EA 4KNYA 4WXHA 2HKOA 3RYRA 2BE5F 4HLXA 1ODDA 1G4DA 3WODF 3LA3A 3RDIA 3F22A 3HHGA 5DCFA 2P4WA 1G6NA 1ZRFA 2XASA 3JW4A 2WWYA 1T2KA 1YQAA 4KIFA 3O6BB 2E7WA 1U5TC 4HBLA 1TQPA 1I1GA 3BY6A 3BPXA 2A6EF 1IRGA 4M9XA 2YU3A 4BHBA 2Z99A 5FFXA 3BJ6A 5D4SA 3RPUA 4HYEA 1S7OA 3J80Z 3R6SA 1J2XA 1I5ZA 3JAMK 2V1XA 2NYXA 1EH7A 3GWZA 4LK1F 1BM9A 3F21A 3IKVA 2P7CB 1ZAOA 1IXSB 2J5PA 4M6YA 5IT3A 3CO6C 5CJ9A 3K1PA 2RV8A 2XGXA 4L9TA 2NS0A 2H6CA 2VE9A 2CFXA 4H0EA 5E1WA 1OR7A 2OQGA 3DQVC 3F23A 2PEXA 2F2EA 5CVJA 2QBYA 3Q5FA 3QU6A 5DDGA 3KP6A 1PDNC 1FOKA 1DPUA 1E17A 3O3KA 4KN7X 2KKOA 5LRSA 2FBIA 2FBKA 4FT8A 4LFUA 4LB5A 4RB3C 1KQ8A 3ZQ7A 1CF7A 4YG2F 3WTUC 1S6LA 4I7HA 3FMQA 5FLXZ 5D6EA 4ZYEA 2OD5A 1W4MA 4AIHA 4L5IA 3DPLC 2STTA 2KIUA 3S2WA 1ZH5A 4HAMA 4YFNF 4AWXB 4LG0B 4MGRA 1G3WA 2XV4S 2DLLA 3F8MA 2YX7A 3BROA 2E1NA 1HSTA 3EDPA 5E17F 3TOAA 2Y48A 3HTSB 2Z3YA 2RDPA 3TDUC 2DT5A 2MLKA 2DFIA 1BIAA 4LLLA 1REPC 2FNAA 1O7LA 3CUOA 3R60A 4AIKA 3KP7A 4A5MA 4LJZF 2P5VA 3EYYA 1YIOA 2F5CA 4ZYDA 2YPRA 3KP2A 4OMYA 2P6TA 2O03A 2EK5A 3BZ6A 3EETA 1YLFA 2F5FA 1W5TA 3WGHA 1QZZA 4EGZA 3QP6A 3E97A 5K5RA 5HDGA 4A6DA 3RKWA 4WX9A 3I54A 1FNNA 3CUQA 5DD4A 2UWMA 3U9GA 5L3DA 1R1VA 2CQKA 2V1UA 2ZKZA 3IL2A 2GA1A 2LDUA 2LKPA 3MQ0A 1SFXA 1H9TA 3H3ZA 2BV6A 3QP5A 5CVIA 5J6XA 2RN7A 4EGYA 4ENMA 3JTHA 1MDMB 1ULYA 2OZ6A 1QPMA 4IHTA 3WTVC 1R00A 1O57A 2BEOA 3TGNA 4MNUA 2ACJA 3B02A 5LHGA 1MJAA 1DDNA 2ESHA 3V4GA 3KE2A 2L54A 4OINF 1XDSA 2GWRA 1B1BA 4I09A 2FRHA 4AIJA 3HRSA 1FBSA 4P96A 2OBPA 2IW5A 4E70A 3H3UA 4N9IA 2VXZA 1ZARA 2QYOA 2M1BA 1FZPB 1LNWA 1W5SA 2O6GE 1KU9A 4EJWA 2IA0A 3P9CA 3T1BA 4FX0A 1LB2A 1UCRA 5ICGA 2HQNA 3NRVA 3F6OA 3CDHA 2B0LA 4ON0A 3DFGA 4OU0A 2L4MA 1ZRCA 1BI2A 1U5TA 5HLGA 2IT0A 4EJTA 4RGRA 3HTUA 1B59A 4IPAA 1KYWA 3WE3A 1J75A 2EV0A 3FF5A 5D5WB 4L5JA 1W7PD 1K7AA 2W24A 3SXYA 4PGHA 3FM3A 5H6RA 4A2UA 3TO6A 4HLYA 2BBYA 4A12A 1S29A 2QUFA 1GXQA 2DK8A 4MQVA 2FMYA 3KEOA 1F5TA 2COMA 3CJNA 2EFPA 2GA2A 1J0RA 2H94A 3O2PE 3MFKA 1SFUA 1TQIA 2G7UA 4LLNA 1U3EM 3COAC 3KP3A 2R7DA 5L3FA 2HEOA 2ZXJA 3GZ5A 4WXCA 2DBBA 1FBUA 4UV8A 4CZZA 4KMUX 3Q9VA 1FYKA 3EUHA 1W7PB 3IWZA 4LGWA 2AXLA 5F64A 1FT9A 1EV7A 2XAGA 1JXSA 3GFLA 4KT5C 1JE8A 1TLHB 4LK0F 1EH8A 3LA2A 4G7ZF 1XN7A 2VBYA 4HX4A 2EFWA 3OV8A 3LWFA 3MAJA 3P7NA 5JR3A 5CVRA 5LGTA 3ABUA 3T8RA 4HV6A 4IRHA 2VN2A 4KUMA 4XBFA 4ESBA 3QRFF 1MKMA 1YW8A 2GAUA 3WU1B 2FEZA 1ZG1A 3E5UA 5F1RA 1IN4A 2JRTA 4NB5A 4UVAA 3FZVA 1U6GA 3ZN1A 2R3SA 1S3JA 4Q5SF 5A2QZ 1SD6A 4YFXF 4G6QA 1HW1A 3JTGA 3HRTA 2ZO4A 1TQMA 2IA2A 1HKQA 1HW2A 2D1VA 1YO5C 2OA4A 1FPQA 2ZNYA 1TBXA 3J7AO 1KA8A 2A68F 5LHIA 2HYGD 2K7LA 3FXUA 4KDPA 1R23A 4OMZA 1CGPA 2IA1A
chains in the Genus database with same CATH superfamily
4XORA 4KIBA 2EA2A 3FBNB 3B73A 2MYSA 1MNMC 2JSPA 3ECOA 4LOCA 5H20A 2HI3A 2FBHA 3DKYA 4EV0A 5EZGA 3HOZJ 3FHZA 2MBFA 4MEYF 2O3FA 2FU4A 4HNVA 3HJEA 4UUVA 1MNEA 2DMQA 1V4RA 4WCGA 2ELJA 1LEAA 3ZQQA 5FKLA 1JI8A 1G3SA 2BXZA 1ON2A 1VQ9I 2FQ4A 4E6KG 4M71A 4L0YB 2M2EA 3L9FA 3CCLI 5E8IA 4BGDA 1FOWA 2JK3A 2CMPA 3ULQB 1SMTA 1UFMA 1YFHA 2DMTA 1S72I 2IXSA 2VOOA 2X1CA 4U0WA 1WVRA 3PIPF 4DJAA 1OCRH 3IC7A 3W6KB 3HOSA 1Z67A 3WGGA 4XL9A 3GTQJ 1EH6A 1I1SA 4QLCU 3L2CA 1FTZA 4RDUA 4EM2A 5K7HA 4PGGA 4V2GA 1BOBA 1S7EA 3CJTB 3WGIA 4M72A 4O5VA 1WH5A 3NEUA 2HXOA 2R7WA 4S04A 2VBZA 3BTIA 1U2WA 1J5YA 5ICCA 1SFEA 3WG7H 3S1RJ 3FX3A 4ZTJA 2CWEA 3W6JB 4A3DJ 2ZMEA 3BR3A 4ZYGA 4IOAF 2ZSHB 1WSUA 5BMZA 1W0UA 2Q2EB 2OTJI 1DU0A 1Z7LA 1RPWA 5FGMA 5LEKA 3I9V2 4EJVA 2HOSA 1IZ1A 2J5OA 2ELKA 4FQGA 1FBQA 4NNJA 1IN8A 3O8GA 1O4XA 1LJ9A 3CCVI 4RAYA 1VQ8I 4C3JJ 1FSHA 3N97A 4XSZF 3F0CA 4JP0A 1V54H 4OAZA 1D5VA 1JTYA 2HQRA 1FJLA 5CVVA 1VQKI 4GFBA 2CV0A 2BYVE 3A0BC 5B66C 2CSOA 2KPMA 2EIKH 1D1BA 2P0WA 3GUDA 4MTDA 1LPQA 2LG4A 2XF6A 3T8TA 4FX4A 1I6XA 3DXJF 2LFBA 5F1JA 1JUPA 5JFRA 2VC0A 5FKNA 2XSJC 4DOZA 4U7BA 3GO5A 3ZP5A 5E20A 1NK2P 3W2AA 2V6CA 1SD5A 4BACA 1KQ9A 1L0OC 1IC8A 2XPWA 5TJJA 3JRCA 1YS6A 2K3PA 1HW5A 2MC4A 1FYMA 4JX4A 2M5WA 3LQQA 1IGNA 4Z2YA 3UKGA 3FK7A 3S32A 3ZCOA 5IOYA 2ZJRF 4RAZA 1LUJB 4IX7A 1MNDA 2NOJB 3SZPA 1ZTRA 1IAWA 2M4GA 3L2WA 3AG1H 2PX9A 1UMQA 1KZHA 2DXIA 1OKRA 5FLMJ 3I53A 3FM5A 1U8BA 3Q9SA 5BS6A 1H8AC 2CYYA 1POGA 2R0QC 4AD9A 4BE0A 4A3IJ 2QKLB 1PUFB 3OOUA 2RKHA 1X1BA 5K1YA 2OQRA 5EF6A 4N4NB 1MD0A 1E3OC 3K4NA 1F1ZA 2DFFA 2H1LA 1APLC 3MWMA 4UB6C 2M30A 4A0YA 1A04A 1ZLJA 2XAJA 5GAHJ 5J1YA 1ZRDA 3OIPA 5J4YA 3S17J 5C3EJ 1R5ID 3NQOA 4BUPA 3A0HC 5DM6F 1ZYRF 4NDLA 3L7WA 2GZWA 5LGUA 3GTMJ 3J80K 1XSDA 2KDZA 2PN6A 1ON1A 4GDFA 2WY8Q 2YUSA 4CCOA 4X6AJ 3ZXSA 2WA0A 3ABTA 2YS9A 1B9NA 1SFOJ 1TW2A 2BXYA 4EM0B 2O8XA 5FFZA 2BW3A 4XN0A 4BQOA 1M1EB 4BNCA 3CLOA 4XM3A 5F6FA 3S2DJ 2EZKA 4BXXJ 2VONA 2JUCA 2A6TA 3ML6A 2V6EA 1UAAA 1XX5A 2VBXA 4BDYA 1SVMA 1KYZA 2VQLA 4UUSA 3I59A 3FXLA 1QZYA 2FE3A 2QGUA 3E6DA 4XOPA 5K5OA 2FA5A 2X51A 2QKMB 1IUYA 2IS2A 2V1DA 3DCFA 5L3EA 4HV5A 1XGOA 1K78A 2VJ4A 3SDBA 3PFIA 3TQNA 3P5JA 1PUEE 5BPDA 1XC5A 2E35A 5J4VA 3MKWB 4XSXF 2LKXA 4P5OA 3BTLA 1MMGA 3LSGA 2EWNA 3HSRA 5K5QA 3K9TA 5HLTA 3P9KA 2JT1A 4NQWB 2VQGA 1AWCA 2DA4A 1D5YA 1BW6A 4DZPA 4KMFA 4WWCA 2EZLA 4UHTA 1NG6A 3ERED 3ESWB 2ID6A 5F0FA 2QSGX 4EJOA 3TMOA 5D5UB 1WZ2A 2VC1A 3SYTA 3AL0C 3PQJA 5AONA 4AVPA 4HF1A 1ETXA 4RS8A 2JZYA 4LB6B 4B8XA 2GLOA 2ESNA 2B63J 5HDKA 2G9WA 3JRAA 5FLXK 1J59A 1X19A 1ONVA 2X9DA 3C7JA 3HBLA 5D8LB 1L3LA 1G3YA 1TW3A 2K02A 2QQAA 1MMSA 2ID3A 1GXPA 2HNHA 4BDZA 2DW4A 2GIVA 3CTAA 2DMNA 3BJOA 3VYSB 5LGNA 3LAPA 3HL2A 3N4MA 1BL0A 1PP7U 1FP1D 3FXMA 5DCMB 1OCOH 1ETOA 3KCCA 5ILSA 4XLNF 1B72A 4UV9A 3MZ8A 4XLPF 4G6DA 4B3XA 3H0DA 1MSEC 2L3DA 3I4NJ 2L02A 3K4BA 3PM1A 5JLXA 1H9GA 2WADA 3GX4X 3JRBA 1XB4A 1B4AA 3H5RA 2M45A 5AIPA 3F8FA 3ASOH 2QEXI 2HGCA 1R22A 1QNTA 1TNTA 3BCBA 2JN6A 2L0KA 2W84A 3F3XA 2AXTC 1Z91A 2WB1A 3SZTA 2CRGA 2D5VA 3QYFA 4GYGA 2KJBA 2JA6J 3MZYA 3AAFA 1T6SA 4CCNA 2A61A 4RLFA 3ERMA 4PCQA 4LIUA 4RM2A 1XPXA 1UHWA 3W2WA 3TW6A 1BI0A 4R8HA 5IT9Z 3J81Z 3CZ6A 1K6OA 2JVGA 1ZGAA 2FOWA 2RQQA 1FMVA 3HHHA 1I50J 4PSXA 2FUG2 2NXNB 2RGVA 3M7GA 5HS9A 1OJLA 1S5LC 5LHHA 1V3FA 2CQ7A 5JHUA 2VQCA 1HDDC 3V8KA 1P92A 1LEBA 1U0JA 1SMYF 4G8XA 1WHUA 2VJ5A 5B5EC 4RB0A 2WBMA 3NWSA 4L9JA 1ZGWA 3CO7C 4MEXF 2JA8J 1Y8RB 1YYVA 3CC4I 3TEDA 3TO7A 1IV6A 1WPKA 3LA7A 1JHFA 5HLHA 3IRQA 3M1EA 5FRNA 3HSFA 1OYWA 4C3IJ 3P9IA 5DUIA 3W6VA 2NVTJ 1UELB 1OQYA 1A35A 2CO5A 4O3MA 3BG9A 1LE8B 3OR1C 4E7ZA 5D5VB 1ACIA 3S1QJ 2JPCA 3DP7A 4YIIA 3KLNA 3EQLF 4C3HJ 1SD4A 2KDOA 1VQNI 1HLVA 5HVQC 3K2ZA 3E6BA 1U9NA 2W85A 5TRDA 1Z3XA 2QA4I 3S15J 3OMYA 1XMXA 1X2NA 3N05A 4Q4ZF 3EUAA 3FXQA 4IL6C 4UXNA 3HOTA 2HTJA 3S8PA 3D5LA 2EPFA 4DW6A 1BC8C 1ZLKA 2HPMA 4DYQA 4TV7A 3RTRA 1QA6A 1KU7A 4BE1A 1VFCA 2X4HA 3PNVA 2PJPA 4IHYA 1S9HA 3OYLA 2KJCA 1FWZA 4OIPF 5BOXA 2ECBA 1RESA 2L9RA 3J7YJ 1X3UA 2VI6A 2M34A 4DBRA 1XD7A 3LSKA 4GCVA 4PFPA 4ASNA 2VOPA 3M8EA 3ROUA 1FOXA 1D1AA 3CCRI 1D8JA 4M73A 2VJJA 1DP3A 4KFCA 2PI0A 5D8KB 9ANTA 3OWTA 3B6AA 4Q47A 4CO8A 1ETVA 5H2FC 4YRVA 3VPRA 4RB2C 2VASA 3KLOA 1Q1HA 1TWCJ 2B7EA 4PDKA 3ZPLA 4IJAA 4RLQA 4ZH4F 2MD0A 4FHTA 2Y0SA 1AA7A 1E3HA 4DYCA 4U0VA 2E5NA 1WCMJ 4G7HF 1TWFJ 3KP4A 1GDTA 5LEJA 2JA2A 3ZQHA 2RREA 3PNYA 4EMSA 3HKZA 2WAQN 4A69C 2MA3A 1USTA 2E2IJ 1YX3A 3RPQA 1Y0UA 3QODA 3VYTB 3DV8A 4E7JA 2GOXB 4G9YA 4RAFA 1GLNA 2HYFA 5FKKA 1B8IA 4JBAA 2V26A 4PFOA 4DNCA 2JMWA 4RGSA 1ZG5A 3GZ6A 1YITI 1Y6IA 2O7OA 3E7LA 2CQQA 3OYJA 5D4RA 4ZDOA 4PSWA 4FE4A 3J7ZI 2XVCA 4I0BA 4CYDA 2LTPA 4L18B 1FY7A 2HVQA 3A4CA 4CDGA 2KRCA 1EA3A 2EBIA 1E3PA 4YEJA 5EEGA 4D5CA 2E1MC 1PJRA 2EFOA 3S93A 4CYCB 4IZZA 2W57A 2EZHA 4ZYHA 1BOAA 1BI3A 5HS7A 3LSIA 2IPQX 1EJ9A 1OISA 3WU2C 2AO9A 3BR2A 1R71A 3G73A 2W7NA 2XAFA 3M1CA 3RZOJ 4P55A 2WTEA 2XROA 1XCBA 4XRMA 1ZKGA 1YJ9I 3OSFA 4PK4A 4JK1X 4A3BJ 3MKLA 4KIGA 1Z05A 5HOOA 4IXAA 2HR3A 4ZDLA 2QBYB 4XOTA 1E2XA 1PUFA 4G7OF 2M3AA 5L3GA 2DK5A 3TP3A 3KETA 2H27A 3RYPA 3GTKJ 3LSTA 4XQFA 2CW8A 4UVCA 1J9IA 1J7KA 4BXFA 3BQZA 4KJZA 2LSOA 3S14J 5ICEA 2IS1A 4XLFA 1Z3YA 1ETKA 1HOMA 1WGXA 3K4JA 1R9TJ 2NS7A 3CC7I 4HZFA 3RQIA 1LVAA 3OYIA 2EFQA 1CF7B 1F9NA 2W1OA 2RVCA 1N75A 4BH9A 2GM4A 3D1NI 1VQLI 2IEKA 2KLOA 5GAGJ 3E0JB 5EGOB 2KIQA 1MBGA 1WJAA 2DT6A 2L01A 2DTZA 3E6MA 1ZQ3P 1OMIA 2DFEA 4M6XA 3A2KA 4PJ0C 1WJBA 2EB7A 3DPTA 3DLLF 5E1ZB 3RJPA 3HOXJ 4G6TB 2KT0A 5K7ZA 5EEHA 1SC7A 5E1XA 2MLGA 4OOIA 1TT0A 4CICA 4M6VA 1X3WB 3MEXA 1R1UA 4A3CJ 4FTHA 2E1OA 2QQBA 4QPQA 4IVNA 1KQ0A 1ZR2A 3DKWA 4ITVA 2HDWA 1ZG3A 4R79A 2WAFA 2Y9ZA 3J7AY 1GUUA 1T08B 2L7KA 1LQ1A 3HM5A 3S16J 3VDXA 1ZHFA 4B1RA 2A07F 3ZMSA 1MIJA 4UNOA 2I5UA 4IHXA 4L9NA 4D7NA 3GFMA 2BHYA 4LG0A 3HOVJ 2BY3A 2Q0OA 4V19K 1P7IA 1IXRC 3C2BA 1BR1A 4FASD 4QTRA 3HUGA 2IJLA 3FWEA 4C2UA 1GHCA 2GXGA 3FISA 3HPHA 2JRMA 1NHAA 3LQRA 1X1PA 1FMWA 3M9AA 5HLIA 3LFUA 3IH3A 2P7VB 1QVTA 3LSMA 4KITB 3TBIA 3ELKA 1VQ4I 3KEYA 4BAYA 1XCVA 1KGSA 5J47A 4HF0A 4I99C 4OIRF 3V8JA 4HW0A 3L2QA 5FO5A 3E3VA 2Z9OA 3FBIB 5AIQA 3EPZA 1R1TA 2CG4A 4YELA 2P6SA 2Z16A 3KP5A 1QVUA 2GQQA 1W1WE 2K9LA 4YFKF 2R7QA 1OYYA 2IBDA 4HPQA 3REOA 1QPIA 3DEUA 3I5UA 4PJNA 4A3KJ 1SD7A 4N9HA 5B1AH 3F72A 2XB0X 2NRAC 4I01A 2C6YA 3EYIA 3CUQB 4IKFA 2IGNA 2ZJ2A 3OYFA 2DA2A 4XLCA 1N78A 1P2FA 3F8CA 3RKQA 2EFNA 2VKVA 3Q0WA 3LFKA 4IO9F 2ZNZA 4L0ZB 1MMAA 2WC2A 5ILUA 2Q1ZB 2CW7A 2HWVA 2Y9YA 3BC8A 3I58A 1WKMA 2ZXHA 3FXOA 1AOYA 1MGTA 2F5DA 2YR2A 2DYSH 3BR5A 6PAXA 2QSFX 5GPCA 2DODA 1W36C 3MVPA 2MC3A 1XGSA 2DU9A 3RSNA 2STWA 3PSIA 2DQLA 4XKVA 5A2QK 2WY7Q 1GV2A 4MLOA 2YX4A 2GXAA 2IVMA 4EQQA 5KK1A 3F8BA 2O61A 1P7JA 4XLAA 1UZCA 1R7JA 2MGQA 2VBWA 3C2HA 4LD5A 4O6JA 4NHJA 1VZ0A 4ENJA 4I02A 2ZFWA 4QIWN 4BJ5C 3OYEA 2V9VA 3I3LA 3CP2A 3ZN0A 4BQAA 2V4JC 3KFWX 3E5QA 1RZ4A 1LDJA 2KHMA 1G8XA 2G0EA 4XN3A 4J00A 2ZC2A 4AVZA 2LNBA 1DGWY 4W1UA 2QVOA 4D1QA 4BY1J 1QZEA 2PMZA 3W2VA 1MDMA 3R0JA 3JRIA 2CW0F 2WAEA 2BY2A 2QENA 1TT5B 4D9JA 2LF8A 1F36A 2VJIA 3SDGA 1JGSA 3TOBA 2PBIA 3H3VK 3F8NA 3L2RA 4Y17A 2X6YA 2DN0A 4DIQA 1OCTC 1V5FA 3WHCA 4XNFA 2K9SA 1NH3A 2M9HA 2Z5UA 4XRSG 3HXLA 2E2HJ 4WXDA 1O3QA 5DEQA 1X1AA 4M9ZA 3OYMA 4BHPA 3H9JA 5LLQA 2OJED 3ZMVA 1SVOA 3M8FA 3RKXA 5C44J 1HXDA 5DD8A 1QGPA 4I76A 1G2HA 3BG5A 4HX8A 3HOWJ 2DTRA 2VKDA 1SFKA 2F4MB 4BS9A 3IKTA 4M3BA 2LK2A 3VYRB 3JAMZ 3H1CA 1Z6TA 2F5EA 2VPRA 4RGUA 3I56I 3WE2A 2LVSA 2VUMJ 3D5RC 3JRFA 4BEHB 1AKHA 3RI4A 2JA7J 2JPBA 5D5XB 1A5JA 2QWWA 3R4KA 2HZDA 2B9SA 1VQ7I 2LKSA 1A36A 3FXRA 1IN5A 3OYDA 4E7KA 2M4KA 3ZMDA 2FNPA 2NAZA 2K86A 2PJRB 4LLGF 1U5TB 3ABKH 5ICFA 1JT6A 1FSEA 2VT3A 3GLLA 4E4HA 4HQMA 2K85A 3U2RA 3LAJA 3DWLE 3S2HJ 2R7FA 2LP0A 1YG2A 2HQAA 1YHQI 3KZYA 2FXAA 4NUBA 5LD2C 1TWHJ 4G12A 2ZBKA 2XSDC 3K69A 3WHBA 2D2WA 2ETHA 1I6HJ 3K4CA 2RQPA 2ELHA 2JTVA 3KIOA 5JVGF 1ZR4A 5IYDJ 3HIFA 3V7CA 5ERIA 1R5GA 1YW7A 1IW7F 4M3GA 3K70D 1OCZH 3DBHB 3ZQLA 2XGEA 3ZMUA 5ED4A 2O0YA 1U78A 2K4BA 3DBRB 5D6FA 1R4MB 1MMNA 2M0MA 2FF4A 3HYIA 1WRJA 1WWXA 2OU2A 2XKPA 1HC8A 4OIQF 1QU3A 4B3AA 2R7VA 2EQRA 4WF2A 2KRHA 2EINH 2MSYA 5BQTA 3GW2A 5IYBJ 4CCLA 2ZSIB 5DM7F 1VQ6I 3IWFA 2R7SA 1LFPA 1TWAJ 2DPUA 2DA3A 2MW8A 1O3SA 4M9SA 1GV5A 2DDAA 4L9VA 3V7RA 2EV5A 2VIXA 4PJMA 2JUGA 2X48A 3BLYA 1OYIA 1S7AA 4LIVA 3KEQA 3FHNA 2KIMA 5L3CA 2VODA 1P4AA 2PQ8A 3C3WA 2R7RA 5FD5A 3GFJA 3VOEA 3TDZC 3IH4A 2QQ9A 3AKZA 3H92A 4C30A 3DTIA 2R5YA 5E8GA 1WJDA 2PFBA 4EATA 1BBYA 5FLVA 5B1BH 1MBHA 3DTEA 2CQXA 1FIAA 1TNSA 3WTYC 2NVQJ 2IRFG 2CGPA 2Y30A 4IRGA 3H0GJ 1ORKA 1T0FC 4F3QA 5E3NA 3X2QH 1W7PA 4XRFA 4PJLA 3EUKL 3HOUJ 1O3TA 4ZZLA 4Y15A 2DAOA 3RKYA 4BKXA 3MZHA 2XRNA 4I6ZA 4AIDA 3DU5A 4KN4X 1HCRA 1BN5A 1RUNA 1UB9A 4ETSA 3WTSC 3R0AA 4NC8A 4U88A 4ANJA 1Z7UA 2E36A 1EF4A 1QO0D 3VEPA 1IDZA 1B9MA 1ITYA 3C2GA 3FKJA 4F93B 2DQRA 3AG2H 4KYWA 2OV7A 4N0BA 2DA6A 3DTKA 1YRNB 2RNJA 1V5GA 4EVIA 5GTHC 2QQ8A 4RM3A 3BPVA 5EG0B 2R5ZA 1XGNA 3E1SA 3WTZA 4A93J 2EV6A 3OYBA 4IHSA 4EM1A 1KU3A 4RB1A 2NNYA 3WG9A 4JOMA 3LSRA 2HOTA 1XGMA 2R92J 2HU9A 2XHKA 3ZMTA 2P8TA 4FETA 5FKOA 2X85A 4U7DA 3GYHX 1KU2A 3DF8A 4V2FA 4HQEA 4HEA2 2E1CA 1LDDA 2RC4A 4A3LJ 1Z77A 3IP4B 2LBFB 2DO7A 1WJCA 5IYCJ 1Y1WJ 2VT2A 2F6CA 2MG4A 3HSEA 3ABLH 1G59A 1C0WA 2VKEA 5KAIC 2HS5A 2Z2SB 4C2MJ 3K4LA 2KIFA 4BHCA 3D0SA 1FP2A 2LOOA 1HBXG 2XGDA 4A0ZA 2W82A 2HVSA 3I4PA 2R7XA 4BXUA 3GXOA 4IHVA 3IH2A 4W97A 1F43A 1P4WA 3A01B 3ECHA 5FB2A 2XAUA 3QOPA 1Q1VA 4J19A 1VQOI 2LY9A 2CUZA 1Z21A 1BA5A 4CZCA 1T39A 2AS5F 2E60A 2FD5A 3FMRA 2D1HA 2ISYA 4NC7A 1MZBA 1T95A 5LBQA 5E18F 5FRMA 1RI7A 3U1DA 1MJ9A 3V42A 3A02A 5BPIA 4OAYA 1H89C 4I2OA 1MH3A 1JTXA 5F04A 5JHFA 3CDLA 3Q3SA 5L3BA 4P1WA 2FQ3A 3GLXA 2WAQA 3GMEA 2LF7A 2CQNA 2ISZA 4S05A 3BJAA 3OY9A 2EJRA 5GADJ 3E5XA 3L09A 2O8KA 1I27A 3GVAA 3C18A 4MQ9F 1JUMA 2HTSA 3DBLB 3LNQA 4Y4RA 1UJ8A 2X0LA 3KYDB 2MABA 4AU7A 5IT9K 2NNNA 3J81K 4JX5A 4C9YA 3HG9A 2Y0MA 1XDUA 2XF5A 4XKCA 2P5KA 2PMUA 2DPDA 2DDBA 5J1RA 3LSPA 1XSXA 4A0XA 5EYRA 4E7HA 5CVUA 4A3FJ 4A6EA 4HOBA 3G3ZA 3T0YA 1TP4A 2Y75A 2H6BA 5KAFC 1FLIA 1UHMA 1IJWC 3C1DA 5ILVA 5M3FJ 4GO1A 2VLAA 2V9PA 2K40A 1X1DA 3H35A 1MW7A 5JVTA 1A31A 2F4IA 2ZMEB 5E79C 2OZUA 4D0PA 2V79A 3WTXC 3KZZA 2ZMEC 5HS8A 4CXFA 3V8LA 1TL8A 2E71A 1WI3A 1IG7A 2JVHA 2UZKA 3TO9A 4IOCF 3GFIA 2XAHA 2D45A 2A3SA 2DI3A 5LRRA 2PG4A 3QAHA 5KVRA 5J8CA 4QSHA 1E0EA 1OFCX 1LFBA 3U1KA 1D8KA 5KNLA 1JT0A 3JCUC 5CYVA 2TRTA 3KZIC 1P6RA 1USSA 1ZGJA 2Q2EA 4B09A 1IF1A 1R58A 2FSWA 1T38A 3L00A 3CCSI 1VQMI 1FC3A 1QHHD 3I71A 5DV5A 3BT9A 4E7LA 2MH9A 2FJ1A 3MCZA 3UR3C 4WK8F 2L7ZA 3TP0A 4AC0A 2EIMH 1RUOA 2L5QA 2EA4A 3ISPA 3HRUA 2GXBA 3GTJJ 1IRFA 1Y8QB 4XR6A 3VFZA 1H0MA 1VQ5I 3K1NA 2HOEA 3SEZA 4GYIA 1MMDA 3DEEA 1FOYA 1RRJA 3CCEI 2HPIA 3PQKA 3H9GA 1IN7A 1O7FA 1I3QJ 2JSCA 1YE9A 1GVJA 1DP7P 3IHUA 3HEFA 3BR6A 4FE7A 2BVLA 5IPAA 2QZ8A 2HDDA 1TTYA 2A5YB 2MD5A 2R7UA 2MH2A 2CFOA 4HX7A 4A5NA 4HDVA 1XG1A 2XUBA 3V7SA 1DPRA 1ZREA 1K4SA 2HQ5A 2BY1A 3BOQA 2E2JJ 2A69F 4Y52J 4DBQA 4HA8A 1PYVA 2A6HF 1WFXA 4DZJA 4IRIA 4ESJA 3CD6I 4Z6YA 2CU7A 2TDXA 2M0CA 1YW9A 4EJUA 4P9UA 4MHGA 1DUXC 3G71I 3DPUA 1T98A 1Z6RA 1ZN2A 1OR7C 2UXNA 4Y33A 4G94A 3VODA 4I98B 3JR9A 4KISA 1IN6A 3F6VA 4M74A 3SFZA 3WTWC 3FMSA 4YIFA 1XSVA 3QPHA 2L4AA 1R5HA 2HZTA 1A6QA 4BYYA 4U87A 2VPLA 3PFYA 3QPTA 1R36A 3JRDA 2QM3A 2XAQA 4X1EA 3T5XA 3WTTC 2YSRA 1D0XA 3IRRA 3SHFA 2LRDA 2FMLA 4HF2A 2BW3B 2K27A 3SQNA 2LD5A 5DYMA 3RIRA 2ME0A 3SFIA 4LMYA 2KQRA 1SANA 3I0TA 1UG2A 4QWQA 3OYHA 2O5RA 3K0LA 1LKXA 4M3DA 3I64A 3PIOF 3CCYA 4UUSB 3E6CC 3I59B 2GIZA 1Z9CA 3FKIJ 3HPGA 1BIBA 3VWBA 4D7MA 2AQEA 1VI0A 2IGMA 1PVEA 4Y13A 2CUFA 1K78B 1XMKA 4BJTA 2PLYA 1RR8C 5H6QA 4CH7A 4I0AA 3VB2A 4OIOF 3OOPA 2E5ZA 1OPCA 1LDKB 3CMAI 2IGOA 4MFEA 5JLWA 1AHDP 2I10A 1STZA 3QU3A 4HDUA 1RIOH 1QBJA 1X4PA 3OS2A 3OYAA 1BI1A 4B48A 3L2UA 2OCEA 2QCOA 4GXOA 1O3RA 1HKSA 2K4JA 1FX7A 5M3MJ 1DGRM 3S3NA 1T0FA 3PO2J 1S8NA 3G1OA 4M3EA 4U0YA 2CS3A 3L1PA 1I39A 4N4OB 1YS7A 3ZQGA 2HXIA 2M8GX 3CDIA 4NQWA 3ZMZA 1N77A 1Y39A 1QQIA 2Z33A 1IXCA 2M7BA 3DKXA 4II2A 4LG3A 1YTYA 1YIJI 4KA4A 4ZJZA 5BNGA 3IAM2 2HKXA 3BP8A 2BGCA 2HDCA 4ENKA 4HNTA 2LH9A 2TCTA 1D3YA 2P81A 1B72B 4F92B 3CQZJ 2E7XA 4J01A 4ENNA 2M8EA 2KRFA 2MFZA 4KICA 3BWGA 1SAXA 2VE8A 1K83J 1B6AA 1WJEA 1YI2I 3TL4X 4XONA 4II3A 1WQ2A 4PZJA 5DCMA 4BBSJ 5GTIC 3A03A 4UVBA 2NVUB 3VSLA 2OAZA 5IP6A 1MJBA 2DMPA 2ADUA 2QSHX 2IP2A 2W25A 3CC2I 4CHUA 3G2BA 1IRZA 1IDYA 3CMYA 1PP8F 2XGCA 4B44A 3CJRB 2QLZA 4P9FA 2M87A 4BJ6C 4CGZA 2CV1A 4GGGA 1VQPI 3FDYA 1JHHA 5J40A 3ZQIA 2OUMA 1JKPC 4B47A 5J8FA 3GF2A 3PUFA 3M8JA 3CUQC 3FXKA 1BR4A 2XDVA 5CLSA 4JQFA 5IOZA 3BDDA 2HFHA 1P4XA 1XMAA 3SJMA 3HZJA 2XIGA 3HRMA 2F5VA 3HDDA 1FYLA 1J09A 5FKMA 3ZRGA 2NOGA 4DQ2A 2G7HA 1BC7C 3TKYA 4R1HA 2KISA 1BJAA 5TISC 1K79A 2QF7A 2W4SA 4Q48A 3GZNB 3K10A 1HSJA 2Q8KA 5KHDA 3JSOA 1JJ6C 2F48A 2PMHA 3GEZA 3OIQA 4A3MJ 2F4OB 2RNGA 3LSHA 3MMYB 3NARA 1WI9A 2H09A 1G3TA 3K4KA 1RNLA 2Y69H 2UXXA 4ZZDA 3G6EI 1W5CC 4HG2A 2L7MP 2ZJQF 3RCOA 1LE8A 5DUKA 1HKTA 1VTNC 1Z1DA 4F7ZA 4IF4A 4CCKA 4IHWA 2WV1A 2EIJH 4MTEA 4B43A 5FD6A 5HDNA 1HQCA 2BVMA 3WU0A 3ABMH 2WV0A 2FOKA 2ZFUA 1U8RA 4BQQA 2NVXJ 2XKOA 3K1MA 2ICWG 4MFDA 2P5LC 5F0CA 4A3JJ 4AYBN 4RGXA 3JSPA 5JI6A 3Q0UA 1IRXA 3R61A 3DLAA 2ZCWA 1F4KA 4ESFA 3SZGA 4D5FA 2KP6A 2CH0A 2CJJA 1D1CA 3PL8A 4BY7J 3CCMI 1VF9A 3M3YJ 2EH3A 1ZK8A 3BG7A 2L2OA 4K2EA 4KNYA 4WXHA 2HKOA 3RYRA 2LC2A 2DFHA 5EZHA 2BE5F 4XRSA 4HLXA 1H88C 3S1MJ 1ODDA 2H1KA 3S1NJ 3ZQCA 1G4DA 1UHSA 4MIMA 3WODF 3LA3A 5J1UA 3RDIA 3F22A 3CJQB 3HHGA 2K9MA 2AQFA 2IS6A 1QHGA 2OCCH 5DCFA 2P4WA 2R93J 1G6NA 3ASNH 1ZRFA 2XASA 2Y31A 3JW4A 4XMYA 2H8RA 2NVYJ 1B8IB 2WWYA 1T2KA 1RETA 1Z0XA 3D5SC 3F9KA 1YQAA 4KIFA 3O6BB 2E7WA 1U5TC 4JX6A 2VKHA 4HBLA 1GT0C 1TQPA 4ZYAA 1I1GA 3BY6A 1KONA 3GBGA 3BPXA 3LSJA 2A6EF 2IS4A 2R7ZJ 1IRGA 4M9XA 2YU3A 4BHBA 2Z99A 5FFXA 3BJ6A 3W3CA 3B6CA 2K3FA 3RPUA 4HYEA 5D4SA 1S7OA 3J80Z 1X4OA 5J3LA 3KPHA 3BTCA 3HGYA 2PMZN 3R6SA 1J2XA 1I5ZA 3JAMK 3QOEA 3O8HA 4L5EA 2V1XA 4CUGA 2NYXA 1EH7A 3GWZA 2N8GA 1BW5A 4LK1F 1BM9A 1Y56A 3F21A 3IKVA 2P7CB 3CCQI 3JRGA 3AFHA 4CYCA 1ZAOA 1IXSB 4Y7NJ 2J5PA 3HC7A 4M6YA 4FISA 3I55I 1TZLA 5IT3A 3CO6C 5GP9A 5CJ9A 4CCMA 3K1PA 5DTDA 2XPUA 2RV8A 2XGXA 1NG7A 4L9TA 4RA2A 2NS0A 2H6CA 2ME6A 2VE9A 2CFXA 4XLHA 1MBEA 4H0EA 3GTGJ 1ETWA 5E1WA 1OR7A 1K4TA 2GOMA 1N25A 2OQGA 1HA8A 2W48A 3DQVC 3FXJA 4XICA 4GRIA 3F23A 2PEXA 2EILH 3NAUA 4Y3OA 2DA7A 2F2EA 3M07A 5CVJA 5IP9J 4XLEA 2QBYA 3Q5FA 3QU6A 3BTJA 4E7SA 5DDGA 3KP6A 5EDNA 3IAS2 1PDNC 2JWTA 1FOKA 2HOAA 4IEJA 1DPUA 3G4SI 1E17A 3O3KA 4JYKA 2ZB9A 4KN7X 3JRHA 2KKOA 5LRSA 2W00A 2FBIA 3PUBA 2FBKA 4FT8A 4LFUA 1IV8A 3EUHC 4RB3C 4LB5A 1KQ8A 2CUEA 3ZQ7A 5HNHA 1CF7A 4AUXA 4YG2F 4M3FA 3WTUC 1S6LA 3K70C 4I7HA 2HVRA 3FMQA 5FLXZ 5EGOA 3VSKA 5D6EA 4ZYEA 2XC7A 4F52A 3ZQFA 2OD5A 3KX2A 5GAEJ 3NWTA 1W4MA 4AIHA 4XKWA 3QPSA 3CLQA 4L5IA 3DPLC 2STTA 2KIUA 3S2WA 1ZH5A 2GBYA 1JKOC 4A3GJ 3DEWA 4HAMA 1X2MA 4YFNF 4BE2A 3ONQA 1MH4A 4AWXB 4CCJA 4LG0B 3TW7A 4MGRA 1G3WA 2XV4S 1YJWI 2DLLA 2DYRH 3F8MA 2YX7A 3BROA 2E1NA 3HUGB 2ZJPF 3AL0B 1HSTA 1YJNI 3EDPA 2JJ7A 5E17F 5HNFA 3TOAA 2Y48A 3HTSB 2Z3YA 2RDPA 3TDUC 1VNDA 4BL0B 5F0HA 3BR0A 1SAUA 2DT5A 2DFIA 2MLKA 1BIAA 4LLLA 2IGKA 5E3OA 1REPC 2FNAA 3MD2A 1O7LA 3CUOA 2X1DA 2LY2A 4F91B 2LYCA 5IP7J 3R60A 4AIKA 5CPRB 3KP7A 3Q0VA 4A5MA 5F27A 4LJZF 2P5VA 3GTPJ 2A5WA 4XK4A 3EYYA 3OYNA 2OF7A 5FJ8J 1FTTA 1YIOA 2F5CA 3OYCA 4ZYDA 3IV5A 2YPRA 3OR2C 2DA1A 3KP2A 4LITA 2Z1DA 4OMYA 3K7AJ 2ZXWH 4PJJA 2P6TA 3LMMA 4RAGA 1FEXA 2O03A 2EK5A 3CP8A 3K6GA 3BZ6A 3EETA 1YLFA 2F5FA 4CSWA 1W5TA 3WGHA 2DOAA 1NK3P 1QZZA 3SEQA 4EGZA 5TGTA 3CMEI 3QP6A 3E97A 5K5RA 4RMNA 3CF5F 5HDGA 4A6DA 1LVKA 2K9NA 3RKWA 4WX9A 3I54A 1FNNA 3H5AA 2H8WA 3CUQA 3QPLA 1X3ZB 5KCMA 5DD4A 3KYLA 1JJ8C 3G1LA 2UWMA 3U9GA 3LL7A 1JUSA 2KMUA 2EZIA 2E34A 5L3DA 3BG3A 5DS9A 2X1EA 3OYKA 1R1VA 2CQKA 2V1UA 2ZKZA 1IO2A 3DU6A 3IL2A 2GA1A 2LDUA 5GPAA 2LKPA 5EJCA 3MQ0A 1SFXA 3JREA 1H9TA 1U9OA 2BV6A 3H3ZA 3QP5A 5CVIA 2RN7A 5J6XA 4EGYA 4ENMA 2UV1A 5M5XJ 2VB6A 4ZDPA 3JTHA 1MDMB 1ULYA 2OZ6A 1QPMA 4C2TA 4IHTA 2X6OA 3WTVC 4HNUA 2OPTA 1R00A 1WH7A 1O57A 1RC9A 2BEOA 3TGNA 4MNUA 3H5NA 1XTAA 4NBQA 5CQEA 2OC6A 2ACJA 3B02A 1X58A 1CQTA 3G1MA 1T33A 2IAIA 5LHGA 1XS9A 1T8IA 4RBOA 1MJAA 1WJ5A 4F55A 5B3SH 2COBA 1DDNA 2R7TA 2ESHA 3V4GA 3KE2A 2WB1N 2L54A 3RPUD 4OINF 1XDSA 2GWRA 5HODA 1B1BA 1TWGJ 3HB9A 2FRHA 4I09A 2JQ7A 4AIJA 5M5YJ 3OL4A 3HRSA 1FBSA 2BOLA 4P96A 4E7IA 3ZR8X 2OBPA 2IW5A 4ABZA 2LMDA 3M4OJ 2K5CA 1V5EA 4E70A 3OS0A 3H3UA 4N9IA 2VXZA 5K7FA 5EEAA 3FK6A 1ZARA 4ZTFA 2QYOA 1TC3C 4DYRA 3MKZA 2M1BA 2KL4A 1AKHB 2LY1A 4KT6A 1FZPB 4B4CA 1K61A 1LNWA 3OIOA 1W5SA 2O6GE 2R7OA 3GTLJ 1KU9A 3PNTA 4EJWA 1V55H 5CKTA 2IA0A 3P9CA 1R49A 2DMUA 2XPVA 3T1BA 4FX0A 1LB2A 1HDPA 3PJRA 1T56A 1UCRA 1Y0NA 2XB5A 1ERDA 1UG0A 5ICGA 4BEHA 2HQNA 1BR2A 3NRVA 1QRYA 3F6OA 3CDHA 2B0LA 4ON0A 3DFGA 2V9KA 1I3AA 4OU0A 2L4MA 4BBRJ 1ZRCA 3OL3A 1BI2A 2PJRA 2VXDA 2YU9J 4UY8I 1YOVB 1U5TA 5HLGA 2JA5J 2IT0A 3S3MA 4RGRA 4EEFG 4EJTA 2O9LA 4UB8C 4MO7A 4CA0A 2K9QA 3OYGA 2CUJA 3HTUA 1B59A 4IPAA 3OS1A 1LFUP 3BG6A 3HGGA 1KYWA 3WE3A 4A3EJ 1J75A 2E1MB 2V7FA 5FROA 1BJZA 4HRIA 2DOEA 2EV0A 5IY5H 3FF5A 1P9QC 5D5WB 4NC6A 4HSRA 4L5JA 3OSGA 1W7PD 2I8DA 1K7AA 2W24A 1ETQA 3BQYA 2ZXIA 1RR7A 2E19A 2A05A 3SXYA 4PGHA 3FM3A 5H6RA 1MBKA 4BU2A 3U21A 4A2UA 1AU7A 4AM3A 3TO6A 4HLYA 2UUZA 2BBYA 4A12A 2CV2A 1JKRC 1S29A 2QUFA 1GXQA 3UNGC 4DGWB 2DK8A 4MQVA 5E3LA 2FMYA 3KEOA 1F5TA 1NTCA 2COMA 3CJNA 2EFPA 3GCMA 2GA2A 2Y0SN 3GTOJ 1J0RA 2H94A 3O2PE 4S0HB 5C4JJ 3MFKA 1MSFC 1SFUA 4IQ4A 2KFDA 2DCEA 4HSTA 4BQNA 1TQIA 2G7UA 2R5YB 3HKZN 2R4GA 5C4XJ 4LLNA 3KYCB 1U3EM 3RQ4A 3COAC 3QYBA 3KP3A 3QYEA 3BZKA 4XIDA 2R7DA 3QQAA 2Y2ZA 5L3FA 2HEOA 2ZXJA 3GZ5A 4QPOA 2X6WA 3S3OA 1D0ZA 1OLTA 4WXCA 2DBBA 1EKEA 1FBUA 1Y1VJ 2L7FP 3LOCA 1W0TA 4UV8A 4CZZA 2HYJA 4KMUX 3Q9VA 1FYKA 3EUHA 1W7PB 3IWZA 2V1NA 4LGWA 2AXLA 1JGGA 3H36A 1SEUA 1OCPA 5F64A 1R6RA 1FT9A 2OTLI 1EV7A 2XAGA 3ZOBA 1JXSA 3GFLA 4KT5C 3BCAA 1TLHB 4LK0F 1JE8A 1EH8A 3K4MA 3LA2A 2BHZA 1IUFA 3MKYB 4G7ZF 1XN7A 2VBYA 4HX4A 2EFWA 4FCYA 1YX5A 3OV8A 1ENHA 3LWFA 3MAJA 3P7NA 5E3MA 5JR3A 1K6YA 5CVRA 2FX0A 5LGTA 3ABUA 3CMMA 5CQGA 3T8RA 2R5ZB 2BZTA 2LREA 2L9VA 2DT7B 2KZGA 3MN2A 4HV6A 2VN2A 4IRHA 4KUMA 4XBFA 3CESA 2LLKA 4ZC3A 1MBFA 3IUOA 4ESBA 3QRFF 1MKMA 1YW8A 2GAUA 3WU1B 2ECCA 2FEZA 5M5WJ 1YRNA 1FIPA 4XKBA 3AG3H 1ZG1A 1JKQC 4UUTA 1W36D 3E5UA 5EG0A 3I4MJ 2BY0A 1X1CA 5F1RA 3VYUB 4X0GA 3L2VA 1IN4A 2JRTA 4NB5A 4UVAA 2L9NA 3FZVA 1RKTA 1RKWA 1ZELA 1U6GA 3ZGKA 3ZN1A 2M7AA 1R4NB 2DA5A 1ETYA 2R3SA 2DJIA 2NS8A 3CF2A 1DQUA 1S3JA 3BZCA 2VL8A 3HOYJ 4Q5SF 5A2QZ 1SD6A 4YFXF 3PO3J 2XF7A 3K2AA 4G6QA 1HW1A 2DOFA 2XRLA 3JTGA 3HRTA 4PUSA 4AYBA 2ZO4A 2LBFA 3QWLA 4YIRX 1TQMA 2IA2A 1MBJA 1HKQA 1HW2A 1DU6A 2D1VA 2L9SA 2DJNA 3H9QA 1YO5C 2OA4A 3CCUI 2KZVA 1FPQA 2ZNYA 2LR8A 1TBXA 3J7AO 1GVDA 3A1YA 1KA8A 2AHQA 2RAEA 3PSFA 2A68F 1OCCH 4OWRB 2HYGD 2K7LA 5LHIA 3A01A 3FXUA 1HF0A 3RZDJ 4IQJA 1A6IA 5LFAA 4KDPA 3AG4H 1R23A 4OMZA 1WJFA 5F08A 1CGPA 1SVLA 2X6XA 3CCJI 1D0YA 2VQHA 3BR1A 3FIWA 4H4KC 2IA1A
chains in the Genus database with same CATH topology
4KIBA 2EA2A 3B73A 3ECOA 5H20A 2FBHA 4EV0A 3FHZA 2MBFA 4MEYF 2O3FA 2FU4A 4UUVA 1V4RA 4WCGA 1LEAA 1G3SA 1ON2A 4M71A 4L0YB 3L9FA 5E8IA 3ULQB 1SMTA 1UFMA 1YFHA 2VOOA 4U0WA 3IC7A 3W6KB 3HOSA 3WGGA 1I1SA 1EH6A 4QLCU 3L2CA 4EM2A 4PGGA 3WGIA 4M72A 4O5VA 3NEUA 4S04A 2VBZA 1U2WA 1J5YA 5ICCA 1SFEA 3FX3A 2CWEA 3W6JB 2ZMEA 4ZYGA 1WSUA 5BMZA 5FGMA 5LEKA 4EJVA 1IZ1A 2J5OA 1FBQA 1IN8A 1LJ9A 4RAYA 1FSHA 3N97A 4XSZF 1D5VA 2HQRA 5CVVA 2BYVE 2CSOA 3GUDA 4MTDA 3T8TA 4FX4A 1I6XA 3DXJF 5JFRA 2VC0A 3ZP5A 4U7BA 3GO5A 5E20A 2V6CA 1SD5A 1KQ9A 1L0OC 5TJJA 1YS6A 1HW5A 1FYMA 2M5WA 3LQQA 4Z2YA 4RAZA 3SZPA 1IAWA 1OKRA 3I53A 3FM5A 3Q9SA 5BS6A 2CYYA 4AD9A 2RKHA 5K1YA 2OQRA 1MD0A 1F1ZA 3MWMA 2M30A 4A0YA 1A04A 1ZLJA 2XAJA 1ZRDA 3NQOA 1ZYRF 3L7WA 2GZWA 5LGUA 3J80K 1XSDA 2PN6A 1ON1A 3ABTA 1B9NA 1TW2A 4EM0B 2O8XA 5FFZA 4BNCA 3CLOA 5F6FA 2VONA 3ML6A 2VBXA 1KYZA 3I59A 1QZYA 2FE3A 3E6DA 5K5OA 2FA5A 1IUYA 2V1DA 5L3EA 4HV5A 1XGOA 1K78A 3PFIA 3TQNA 1PUEE 5BPDA 4XSXF 4P5OA 2EWNA 3HSRA 5K5QA 3K9TA 3P9KA 2JT1A 1AWCA 4KMFA 4WWCA 4UHTA 3ERED 4EJOA 5D5UB 2VC1A 3PQJA 5AONA 4AVPA 4HF1A 4RS8A 2JZYA 4LB6B 4B8XA 2ESNA 5HDKA 2G9WA 5FLXK 1J59A 5D8LB 1ONVA 3C7JA 1L3LA 1G3YA 1TW3A 2K02A 2QQAA 1GXPA 2DW4A 2GIVA 3CTAA 3LAPA 3BJOA 5LGNA 3N4MA 1PP7U 1FP1D 5DCMB 3KCCA 5ILSA 4XLNF 4UV9A 4XLPF 4G6DA 2L3DA 2L02A 1H9GA 3GX4X 1XB4A 1B4AA 2M45A 5AIPA 3F8FA 2HGCA 1R22A 1QNTA 1TNTA 2W84A 3F3XA 1Z91A 3SZTA 4GYGA 2KJBA 3MZYA 3AAFA 1T6SA 2A61A 4PCQA 1UHWA 1BI0A 4R8HA 5IT9Z 3J81Z 1K6OA 1ZGAA 3HHHA 2RGVA 3M7GA 5HS9A 5LHHA 1V3FA 5JHUA 3V8KA 1P92A 1LEBA 1SMYF 4G8XA 4RB0A 4MEXF 4L9JA 3CO7C 1YYVA 3TO7A 3LA7A 1JHFA 5HLHA 3IRQA 3M1EA 3HSFA 1OYWA 5DUIA 3P9IA 2CO5A 4O3MA 5D5VB 2JPCA 3DP7A 4YIIA 3KLNA 3EQLF 1SD4A 5HVQC 3K2ZA 3E6BA 5TRDA 2W85A 4Q4ZF 3FXQA 4UXNA 3HOTA 2HTJA 3D5LA 1BC8C 1ZLKA 4TV7A 3RTRA 1KU7A 2X4HA 2PJPA 2KJCA 1FWZA 4OIPF 5BOXA 1X3UA 1XD7A 4GCVA 2VOPA 4ASNA 3M8EA 3ROUA 1D8JA 4M73A 4KFCA 2PI0A 5D8KB 4CO8A 4Q47A 3ZPLA 4RB2C 3KLOA 4PDKA 1Q1HA 4IJAA 4ZH4F 4FHTA 4U0VA 4G7HF 3KP4A 5LEJA 4EMSA 2MA3A 1USTA 3RPQA 1Y0UA 3DV8A 4G9YA 2HYFA 4JBAA 4DNCA 4RGSA 1ZG5A 3GZ6A 5D4RA 2XVCA 4I0BA 4CYDA 4L18B 1FY7A 4CDGA 5EEGA 2EFOA 2W57A 4ZYHA 1BOAA 1BI3A 5HS7A 2IPQX 3G73A 2XAFA 4P55A 2WTEA 2XROA 1XCBA 4JK1X 4KIGA 1Z05A 5HOOA 4IXAA 2HR3A 2QBYB 4G7OF 1E2XA 5L3GA 2DK5A 3KETA 2H27A 3RYPA 3LSTA 4UVCA 1J9IA 1J7KA 2LSOA 5ICEA 4HZFA 1LVAA 2EFQA 1CF7B 1F9NA 2RVCA 4BH9A 2L01A 3E6MA 1OMIA 4M6XA 2EB7A 3DPTA 5E1ZB 3RJPA 5EEHA 5E1XA 2MLGA 4OOIA 4CICA 3MEXA 1R1UA 2QQBA 4IVNA 1KQ0A 3DKWA 1ZG3A 4R79A 1LQ1A 1ZHFA 2A07F 3ZMSA 4UNOA 4L9NA 3GFMA 4LG0A 2Q0OA 1IXRC 3HUGA 2IJLA 3FWEA 1GHCA 2GXGA 1NHAA 3LQRA 3M9AA 5HLIA 2P7VB 3ELKA 4BAYA 1XCVA 1KGSA 4HF0A 3V8JA 4OIRF 4HW0A 5FO5A 3E3VA 2Z9OA 5AIQA 1R1TA 2CG4A 2P6SA 3KP5A 2GQQA 4YFKF 1OYYA 3REOA 3DEUA 3I5UA 1SD7A 4N9HA 3F72A 2NRAC 4I01A 2C6YA 3EYIA 3CUQB 2ZJ2A 1P2FA 3F8CA 2EFNA 3LFKA 4L0ZB 2ZNZA 2WC2A 5ILUA 2HWVA 3I58A 1WKMA 1AOYA 1MGTA 2F5DA 2YR2A 6PAXA 2MC3A 1XGSA 2DU9A 2STWA 2DQLA 5A2QK 2YX4A 2IVMA 4EQQA 5KK1A 3F8BA 2O61A 1R7JA 2VBWA 4LD5A 4O6JA 4NHJA 4ENJA 4I02A 2ZFWA 2V9VA 3ZN0A 4BQAA 3KFWX 3E5QA 1RZ4A 1LDJA 2LNBA 2QVOA 1MDMA 3R0JA 2CW0F 2QENA 2LF8A 3TOBA 1JGSA 2PBIA 3F8NA 4Y17A 2Z5UA 4WXDA 1O3QA 5DEQA 4M9ZA 4BHPA 5LLQA 3ZMVA 3M8FA 3RKXA 1HXDA 5DD8A 1QGPA 4HX8A 2DTRA 3IKTA 3JAMZ 1Z6TA 2F5EA 4RGUA 3WE2A 3RI4A 2JPBA 5D5XB 2QWWA 3R4KA 3FXRA 1IN5A 3ZMDA 2FNPA 2NAZA 2K86A 4LLGF 1U5TB 5ICFA 1FSEA 2VT3A 4HQMA 3U2RA 3LAJA 2R7FA 1YG2A 3KZYA 2FXAA 2ZBKA 3K69A 2D2WA 2ETHA 2RQPA 2ELHA 2JTVA 3HIFA 3V7CA 5ERIA 1R5GA 1YW7A 1IW7F 3ZMUA 5ED4A 2O0YA 1U78A 2K4BA 5D6FA 2FF4A 3HYIA 1WRJA 1WWXA 2OU2A 2XKPA 4OIQF 4WF2A 5BQTA 3GW2A 3IWFA 2DPUA 1O3SA 4M9SA 4L9VA 3V7RA 2EV5A 1OYIA 1S7AA 3KEQA 5L3CA 2KIMA 2VODA 1P4AA 2PQ8A 3C3WA 5FD5A 3GFJA 3VOEA 3TDZC 2QQ9A 3H92A 5E8GA 2PFBA 1BBYA 1TNSA 3WTYC 2IRFG 2CGPA 4IRGA 1W7PA 4XRFA 1O3TA 4ZZLA 4Y15A 2DAOA 3RKYA 3MZHA 2XRNA 4KN4X 1BN5A 1RUNA 1UB9A 4ETSA 3WTSC 3R0AA 4U88A 1Z7UA 1QO0D 3VEPA 1B9MA 2DQRA 4KYWA 4N0BA 2RNJA 4EVIA 3BPVA 1XGNA 3WTZA 2EV6A 4IHSA 4EM1A 1KU3A 4RB1A 2NNYA 3WG9A 1XGMA 2XHKA 3ZMTA 2P8TA 4U7DA 3GYHX 1KU2A 3DF8A 4HQEA 2E1CA 1LDDA 2RC4A 2DO7A 2VT2A 3HSEA 1C0WA 2HS5A 2KIFA 4BHCA 3D0SA 1FP2A 1HBXG 4A0ZA 3I4PA 4BXUA 3GXOA 1P4WA 3ECHA 5FB2A 3QOPA 1T39A 2AS5F 3FMRA 2D1HA 2ISYA 1MZBA 5LBQA 5E18F 1RI7A 3U1DA 1MJ9A 5BPIA 4I2OA 5L3BA 2FQ3A 3GLXA 2LF7A 2ISZA 4S05A 3BJAA 2EJRA 3E5XA 3L09A 1I27A 3GVAA 3C18A 4MQ9F 2HTSA 2X0LA 5IT9K 2NNNA 3J81K 2Y0MA 1XDUA 2P5KA 2PMUA 2DPDA 1XSXA 4A0XA 5CVUA 4A6EA 4HOBA 3G3ZA 3T0YA 2Y75A 1FLIA 2H6BA 1UHMA 3C1DA 5ILVA 4GO1A 5JVTA 2ZMEB 2OZUA 4D0PA 2V79A 3WTXC 3KZZA 5HS8A 4CXFA 3V8LA 2UZKA 3TO9A 3GFIA 2XAHA 2D45A 2A3SA 2DI3A 5LRRA 2PG4A 3QAHA 5KVRA 5J8CA 1D8KA 5CYVA 1P6RA 1USSA 1ZGJA 2Q2EA 4B09A 1IF1A 1R58A 2FSWA 1T38A 3L00A 1FC3A 3I71A 5DV5A 2MH9A 3MCZA 4WK8F 1RUOA 2EA4A 3ISPA 3HRUA 2GXBA 1IRFA 3VFZA 1H0MA 3K1NA 2HOEA 4GYIA 3PQKA 1IN7A 1O7FA 2JSCA 1GVJA 1DP7P 3IHUA 2QZ8A 1TTYA 2A5YB 2MD5A 2MH2A 4HX7A 4A5NA 4HDVA 2XUBA 3V7SA 1DPRA 1ZREA 3BOQA 2A69F 4HA8A 2A6HF 4IRIA 4ESJA 4P9UA 2TDXA 1YW9A 4EJUA 4MHGA 1DUXC 1T98A 1Z6RA 1ZN2A 2UXNA 4G94A 3VODA 4I98B 1IN6A 3F6VA 4M74A 3SFZA 3WTWC 3FMSA 4YIFA 1XSVA 3QPHA 2L4AA 1R5HA 2HZTA 4BYYA 3QPTA 1R36A 2QM3A 2XAQA 3T5XA 3WTTC 2YSRA 3IRRA 3SHFA 4HF2A 2FMLA 2K27A 3SQNA 5DYMA 3RIRA 4LMYA 3I0TA 4QWQA 3K0LA 3I64A 3E6CC 3I59B 1Z9CA 1BIBA 4Y13A 1K78B 1XMKA 2PLYA 5H6QA 4I0AA 3VB2A 4OIOF 3OOPA 1OPCA 1LDKB 1RIOH 1STZA 3QU3A 4HDUA 1QBJA 1BI1A 4GXOA 1O3RA 1HKSA 2K4JA 1FX7A 1T0FA 1S8NA 4U0YA 1YS7A 4NQWA 3ZMZA 1QQIA 2Z33A 1IXCA 1YTYA 4KA4A 2HKXA 3BP8A 2BGCA 2HDCA 4ENKA 1D3YA 2E7XA 4ENNA 2M8EA 2KRFA 4KICA 3BWGA 1SAXA 2VE8A 1B6AA 1WQ2A 4PZJA 5DCMA 4UVBA 2OAZA 1MJBA 2ADUA 2IP2A 2W25A 4CHUA 1PP8F 2QLZA 4P9FA 2M87A 4CGZA 4GGGA 1JHHA 5J8FA 3GF2A 3CUQC 5CLSA 4JQFA 3BDDA 2HFHA 1P4XA 1XMAA 2XIGA 3HRMA 1FYLA 4DQ2A 2G7HA 1BC7C 3TKYA 4R1HA 1BJAA 1K79A 4Q48A 3JSOA 1HSJA 2Q8KA 2PMHA 3GEZA 1WI9A 2H09A 1G3TA 1RNLA 2UXXA 4ZZDA 5DUKA 1HKTA 1VTNC 1Z1DA 4F7ZA 4IF4A 5FD6A 4MTEA 5HDNA 1HQCA 3WU0A 2WV0A 2FOKA 1U8RA 2XKOA 3K1MA 2P5LC 4RGXA 3JSPA 5JI6A 3R61A 2ZCWA 1F4KA 4ESFA 4K2EA 4KNYA 4WXHA 2HKOA 3RYRA 2BE5F 4HLXA 1ODDA 1G4DA 3WODF 3LA3A 3RDIA 3F22A 3HHGA 5DCFA 2P4WA 1G6NA 1ZRFA 2XASA 3JW4A 2WWYA 1T2KA 1YQAA 4KIFA 3O6BB 2E7WA 1U5TC 4HBLA 1TQPA 1I1GA 3BY6A 3BPXA 2A6EF 1IRGA 4M9XA 2YU3A 4BHBA 2Z99A 5FFXA 3BJ6A 5D4SA 3RPUA 4HYEA 1S7OA 3J80Z 3R6SA 1J2XA 1I5ZA 3JAMK 2V1XA 2NYXA 1EH7A 3GWZA 4LK1F 1BM9A 3F21A 3IKVA 2P7CB 1ZAOA 1IXSB 2J5PA 4M6YA 5IT3A 3CO6C 5CJ9A 3K1PA 2RV8A 2XGXA 4L9TA 2NS0A 2H6CA 2VE9A 2CFXA 4H0EA 5E1WA 1OR7A 2OQGA 3DQVC 3F23A 2PEXA 2F2EA 5CVJA 2QBYA 3Q5FA 3QU6A 5DDGA 3KP6A 1PDNC 1FOKA 1DPUA 1E17A 3O3KA 4KN7X 2KKOA 5LRSA 2FBIA 2FBKA 4FT8A 4LFUA 4LB5A 4RB3C 1KQ8A 3ZQ7A 1CF7A 4YG2F 3WTUC 1S6LA 4I7HA 3FMQA 5FLXZ 5D6EA 4ZYEA 2OD5A 1W4MA 4AIHA 4L5IA 3DPLC 2STTA 2KIUA 3S2WA 1ZH5A 4HAMA 4YFNF 4AWXB 4LG0B 4MGRA 1G3WA 2XV4S 2DLLA 3F8MA 2YX7A 3BROA 2E1NA 1HSTA 3EDPA 5E17F 3TOAA 2Y48A 3HTSB 2Z3YA 2RDPA 3TDUC 2DT5A 2MLKA 2DFIA 1BIAA 4LLLA 1REPC 2FNAA 1O7LA 3CUOA 3R60A 4AIKA 3KP7A 4A5MA 4LJZF 2P5VA 3EYYA 1YIOA 2F5CA 4ZYDA 2YPRA 3KP2A 4OMYA 2P6TA 2O03A 2EK5A 3BZ6A 3EETA 1YLFA 2F5FA 1W5TA 3WGHA 1QZZA 4EGZA 3QP6A 3E97A 5K5RA 5HDGA 4A6DA 3RKWA 4WX9A 3I54A 1FNNA 3CUQA 5DD4A 2UWMA 3U9GA 5L3DA 1R1VA 2CQKA 2V1UA 2ZKZA 3IL2A 2GA1A 2LDUA 2LKPA 3MQ0A 1SFXA 1H9TA 3H3ZA 2BV6A 3QP5A 5CVIA 5J6XA 2RN7A 4EGYA 4ENMA 3JTHA 1MDMB 1ULYA 2OZ6A 1QPMA 4IHTA 3WTVC 1R00A 1O57A 2BEOA 3TGNA 4MNUA 2ACJA 3B02A 5LHGA 1MJAA 1DDNA 2ESHA 3V4GA 3KE2A 2L54A 4OINF 1XDSA 2GWRA 1B1BA 4I09A 2FRHA 4AIJA 3HRSA 1FBSA 4P96A 2OBPA 2IW5A 4E70A 3H3UA 4N9IA 2VXZA 1ZARA 2QYOA 2M1BA 1FZPB 1LNWA 1W5SA 2O6GE 1KU9A 4EJWA 2IA0A 3P9CA 3T1BA 4FX0A 1LB2A 1UCRA 5ICGA 2HQNA 3NRVA 3F6OA 3CDHA 2B0LA 4ON0A 3DFGA 4OU0A 2L4MA 1ZRCA 1BI2A 1U5TA 5HLGA 2IT0A 4EJTA 4RGRA 3HTUA 1B59A 4IPAA 1KYWA 3WE3A 1J75A 2EV0A 3FF5A 5D5WB 4L5JA 1W7PD 1K7AA 2W24A 3SXYA 4PGHA 3FM3A 5H6RA 4A2UA 3TO6A 4HLYA 2BBYA 4A12A 1S29A 2QUFA 1GXQA 2DK8A 4MQVA 2FMYA 3KEOA 1F5TA 2COMA 3CJNA 2EFPA 2GA2A 1J0RA 2H94A 3O2PE 3MFKA 1SFUA 1TQIA 2G7UA 4LLNA 1U3EM 3COAC 3KP3A 2R7DA 5L3FA 2HEOA 2ZXJA 3GZ5A 4WXCA 2DBBA 1FBUA 4UV8A 4CZZA 4KMUX 3Q9VA 1FYKA 3EUHA 1W7PB 3IWZA 4LGWA 2AXLA 5F64A 1FT9A 1EV7A 2XAGA 1JXSA 3GFLA 4KT5C 1JE8A 1TLHB 4LK0F 1EH8A 3LA2A 4G7ZF 1XN7A 2VBYA 4HX4A 2EFWA 3OV8A 3LWFA 3MAJA 3P7NA 5JR3A 5CVRA 5LGTA 3ABUA 3T8RA 4HV6A 4IRHA 2VN2A 4KUMA 4XBFA 4ESBA 3QRFF 1MKMA 1YW8A 2GAUA 3WU1B 2FEZA 1ZG1A 3E5UA 5F1RA 1IN4A 2JRTA 4NB5A 4UVAA 3FZVA 1U6GA 3ZN1A 2R3SA 1S3JA 4Q5SF 5A2QZ 1SD6A 4YFXF 4G6QA 1HW1A 3JTGA 3HRTA 2ZO4A 1TQMA 2IA2A 1HKQA 1HW2A 2D1VA 1YO5C 2OA4A 1FPQA 2ZNYA 1TBXA 3J7AO 1KA8A 2A68F 5LHIA 2HYGD 2K7LA 3FXUA 4KDPA 1R23A 4OMZA 1CGPA 2IA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KIB A;  2EA2 A;  3B73 A;  3ECO A;  5H20 A;  2FBH A;  4EV0 A;  3FHZ A;  2MBF A;  4MEY F;  2O3F A;  2FU4 A;  4UUV A;  1V4R A;  4WCG A;  1LEA A;  1G3S A;  1ON2 A;  4M71 A;  4L0Y B;  3L9F A;  5E8I A;  3ULQ B;  1SMT A;  1UFM A;  1YFH A;  2VOO A;  4U0W A;  3IC7 A;  3W6K B;  3HOS A;  3WGG A;  1I1S A;  1EH6 A;  4QLC U;  3L2C A;  4EM2 A;  4PGG A;  3WGI A;  4M72 A;  4O5V A;  3NEU A;  4S04 A;  2VBZ A;  1U2W A;  1J5Y A;  5ICC A;  1SFE A;  3FX3 A;  2CWE A;  3W6J B;  2ZME A;  4ZYG A;  1WSU A;  5BMZ A;  5FGM A;  5LEK A;  4EJV A;  1IZ1 A;  2J5O A;  1FBQ A;  1IN8 A;  1LJ9 A;  4RAY A;  1FSH A;  3N97 A;  4XSZ F;  1D5V A;  2HQR A;  5CVV A;  2BYV E;  2CSO A;  3GUD A;  4MTD A;  3T8T A;  4FX4 A;  1I6X A;  3DXJ F;  5JFR A;  2VC0 A;  3ZP5 A;  4U7B A;  3GO5 A;  5E20 A;  2V6C A;  1SD5 A;  1KQ9 A;  1L0O C;  5TJJ A;  1YS6 A;  1HW5 A;  1FYM A;  2M5W A;  3LQQ A;  4Z2Y A;  4RAZ A;  3SZP A;  1IAW A;  1OKR A;  3I53 A;  3FM5 A;  3Q9S A;  5BS6 A;  2CYY A;  4AD9 A;  2RKH A;  5K1Y A;  2OQR A;  1MD0 A;  1F1Z A;  3MWM A;  2M30 A;  4A0Y A;  1A04 A;  1ZLJ A;  2XAJ A;  1ZRD A;  3NQO A;  1ZYR F;  3L7W A;  2GZW A;  5LGU A;  3J80 K;  1XSD A;  2PN6 A;  1ON1 A;  3ABT A;  1B9N A;  1TW2 A;  4EM0 B;  2O8X A;  5FFZ A;  4BNC A;  3CLO A;  5F6F A;  2VON A;  3ML6 A;  2VBX A;  1KYZ A;  3I59 A;  1QZY A;  2FE3 A;  3E6D A;  5K5O A;  2FA5 A;  1IUY A;  2V1D A;  5L3E A;  4HV5 A;  1XGO A;  1K78 A;  3PFI A;  3TQN A;  1PUE E;  5BPD A;  4XSX F;  4P5O A;  2EWN A;  3HSR A;  5K5Q A;  3K9T A;  3P9K A;  2JT1 A;  1AWC A;  4KMF A;  4WWC A;  4UHT A;  3ERE D;  4EJO A;  5D5U B;  2VC1 A;  3PQJ A;  5AON A;  4AVP A;  4HF1 A;  4RS8 A;  2JZY A;  4LB6 B;  4B8X A;  2ESN A;  5HDK A;  2G9W A;  5FLX K;  1J59 A;  5D8L B;  1ONV A;  3C7J A;  1L3L A;  1G3Y A;  1TW3 A;  2K02 A;  2QQA A;  1GXP A;  2DW4 A;  2GIV A;  3CTA A;  3LAP A;  3BJO A;  5LGN A;  3N4M A;  1PP7 U;  1FP1 D;  5DCM B;  3KCC A;  5ILS A;  4XLN F;  4UV9 A;  4XLP F;  4G6D A;  2L3D A;  2L02 A;  1H9G A;  3GX4 X;  1XB4 A;  1B4A A;  2M45 A;  5AIP A;  3F8F A;  2HGC A;  1R22 A;  1QNT A;  1TNT A;  2W84 A;  3F3X A;  1Z91 A;  3SZT A;  4GYG A;  2KJB A;  3MZY A;  3AAF A;  1T6S A;  2A61 A;  4PCQ A;  1UHW A;  1BI0 A;  4R8H A;  5IT9 Z;  3J81 Z;  1K6O A;  1ZGA A;  3HHH A;  2RGV A;  3M7G A;  5HS9 A;  5LHH A;  1V3F A;  5JHU A;  3V8K A;  1P92 A;  1LEB A;  1SMY F;  4G8X A;  4RB0 A;  4MEX F;  4L9J A;  3CO7 C;  1YYV A;  3TO7 A;  3LA7 A;  1JHF A;  5HLH A;  3IRQ A;  3M1E A;  3HSF A;  1OYW A;  5DUI A;  3P9I A;  2CO5 A;  4O3M A;  5D5V B;  2JPC A;  3DP7 A;  4YII A;  3KLN A;  3EQL F;  1SD4 A;  5HVQ C;  3K2Z A;  3E6B A;  5TRD A;  2W85 A;  4Q4Z F;  3FXQ A;  4UXN A;  3HOT A;  2HTJ A;  3D5L A;  1BC8 C;  1ZLK A;  4TV7 A;  3RTR A;  1KU7 A;  2X4H A;  2PJP A;  2KJC A;  1FWZ A;  4OIP F;  5BOX A;  1X3U A;  1XD7 A;  4GCV A;  2VOP A;  4ASN A;  3M8E A;  3ROU A;  1D8J A;  4M73 A;  4KFC A;  2PI0 A;  5D8K B;  4CO8 A;  4Q47 A;  3ZPL A;  4RB2 C;  3KLO A;  4PDK A;  1Q1H A;  4IJA A;  4ZH4 F;  4FHT A;  4U0V A;  4G7H F;  3KP4 A;  5LEJ A;  4EMS A;  2MA3 A;  1UST A;  3RPQ A;  1Y0U A;  3DV8 A;  4G9Y A;  2HYF A;  4JBA A;  4DNC A;  4RGS A;  1ZG5 A;  3GZ6 A;  5D4R A;  2XVC A;  4I0B A;  4CYD A;  4L18 B;  1FY7 A;  4CDG A;  5EEG A;  2EFO A;  2W57 A;  4ZYH A;  1BOA A;  1BI3 A;  5HS7 A;  2IPQ X;  3G73 A;  2XAF A;  4P55 A;  2WTE A;  2XRO A;  1XCB A;  4JK1 X;  4KIG A;  1Z05 A;  5HOO A;  4IXA A;  2HR3 A;  2QBY B;  4G7O F;  1E2X A;  5L3G A;  2DK5 A;  3KET A;  2H27 A;  3RYP A;  3LST A;  4UVC A;  1J9I A;  1J7K A;  2LSO A;  5ICE A;  4HZF A;  1LVA A;  2EFQ A;  1CF7 B;  1F9N A;  2RVC A;  4BH9 A;  2L01 A;  3E6M A;  1OMI A;  4M6X A;  2EB7 A;  3DPT A;  5E1Z B;  3RJP A;  5EEH A;  5E1X A;  2MLG A;  4OOI A;  4CIC A;  3MEX A;  1R1U A;  2QQB A;  4IVN A;  1KQ0 A;  3DKW A;  1ZG3 A;  4R79 A;  1LQ1 A;  1ZHF A;  2A07 F;  3ZMS A;  4UNO A;  4L9N A;  3GFM A;  4LG0 A;  2Q0O A;  1IXR C;  3HUG A;  2IJL A;  3FWE A;  1GHC A;  2GXG A;  1NHA A;  3LQR A;  3M9A A;  5HLI A;  2P7V B;  3ELK A;  4BAY A;  1XCV A;  1KGS A;  4HF0 A;  3V8J A;  4OIR F;  4HW0 A;  5FO5 A;  3E3V A;  2Z9O A;  5AIQ A;  1R1T A;  2CG4 A;  2P6S A;  3KP5 A;  2GQQ A;  4YFK F;  1OYY A;  3REO A;  3DEU A;  3I5U A;  1SD7 A;  4N9H A;  3F72 A;  2NRA C;  4I01 A;  2C6Y A;  3EYI A;  3CUQ B;  2ZJ2 A;  1P2F A;  3F8C A;  2EFN A;  3LFK A;  4L0Z B;  2ZNZ A;  2WC2 A;  5ILU A;  2HWV A;  3I58 A;  1WKM A;  1AOY A;  1MGT A;  2F5D A;  2YR2 A;  6PAX A;  2MC3 A;  1XGS A;  2DU9 A;  2STW A;  2DQL A;  5A2Q K;  2YX4 A;  2IVM A;  4EQQ A;  5KK1 A;  3F8B A;  2O61 A;  1R7J A;  2VBW A;  4LD5 A;  4O6J A;  4NHJ A;  4ENJ A;  4I02 A;  2ZFW A;  2V9V A;  3ZN0 A;  4BQA A;  3KFW X;  3E5Q A;  1RZ4 A;  1LDJ A;  2LNB A;  2QVO A;  1MDM A;  3R0J A;  2CW0 F;  2QEN A;  2LF8 A;  3TOB A;  1JGS A;  2PBI A;  3F8N A;  4Y17 A;  2Z5U A;  4WXD A;  1O3Q A;  5DEQ A;  4M9Z A;  4BHP A;  5LLQ A;  3ZMV A;  3M8F A;  3RKX A;  1HXD A;  5DD8 A;  1QGP A;  4HX8 A;  2DTR A;  3IKT A;  3JAM Z;  1Z6T A;  2F5E A;  4RGU A;  3WE2 A;  3RI4 A;  2JPB A;  5D5X B;  2QWW A;  3R4K A;  3FXR A;  1IN5 A;  3ZMD A;  2FNP A;  2NAZ A;  2K86 A;  4LLG F;  1U5T B;  5ICF A;  1FSE A;  2VT3 A;  4HQM A;  3U2R A;  3LAJ A;  2R7F A;  1YG2 A;  3KZY A;  2FXA A;  2ZBK A;  3K69 A;  2D2W A;  2ETH A;  2RQP A;  2ELH A;  2JTV A;  3HIF A;  3V7C A;  5ERI A;  1R5G A;  1YW7 A;  1IW7 F;  3ZMU A;  5ED4 A;  2O0Y A;  1U78 A;  2K4B A;  5D6F A;  2FF4 A;  3HYI A;  1WRJ A;  1WWX A;  2OU2 A;  2XKP A;  4OIQ F;  4WF2 A;  5BQT A;  3GW2 A;  3IWF A;  2DPU A;  1O3S A;  4M9S A;  4L9V A;  3V7R A;  2EV5 A;  1OYI A;  1S7A A;  3KEQ A;  5L3C A;  2KIM A;  2VOD A;  1P4A A;  2PQ8 A;  3C3W A;  5FD5 A;  3GFJ A;  3VOE A;  3TDZ C;  2QQ9 A;  3H92 A;  5E8G A;  2PFB A;  1BBY A;  1TNS A;  3WTY C;  2IRF G;  2CGP A;  4IRG A;  1W7P A;  4XRF A;  1O3T A;  4ZZL A;  4Y15 A;  2DAO A;  3RKY A;  3MZH A;  2XRN A;  4KN4 X;  1BN5 A;  1RUN A;  1UB9 A;  4ETS A;  3WTS C;  3R0A A;  4U88 A;  1Z7U A;  1QO0 D;  3VEP A;  1B9M A;  2DQR A;  4KYW A;  4N0B A;  2RNJ A;  4EVI A;  3BPV A;  1XGN A;  3WTZ A;  2EV6 A;  4IHS A;  4EM1 A;  1KU3 A;  4RB1 A;  2NNY A;  3WG9 A;  1XGM A;  2XHK A;  3ZMT A;  2P8T A;  4U7D A;  3GYH X;  1KU2 A;  3DF8 A;  4HQE A;  2E1C A;  1LDD A;  2RC4 A;  2DO7 A;  2VT2 A;  3HSE A;  1C0W A;  2HS5 A;  2KIF A;  4BHC A;  3D0S A;  1FP2 A;  1HBX G;  4A0Z A;  3I4P A;  4BXU A;  3GXO A;  1P4W A;  3ECH A;  5FB2 A;  3QOP A;  1T39 A;  2AS5 F;  3FMR A;  2D1H A;  2ISY A;  1MZB A;  5LBQ A;  5E18 F;  1RI7 A;  3U1D A;  1MJ9 A;  5BPI A;  4I2O A;  5L3B A;  2FQ3 A;  3GLX A;  2LF7 A;  2ISZ A;  4S05 A;  3BJA A;  2EJR A;  3E5X A;  3L09 A;  1I27 A;  3GVA A;  3C18 A;  4MQ9 F;  2HTS A;  2X0L A;  5IT9 K;  2NNN A;  3J81 K;  2Y0M A;  1XDU A;  2P5K A;  2PMU A;  2DPD A;  1XSX A;  4A0X A;  5CVU A;  4A6E A;  4HOB A;  3G3Z A;  3T0Y A;  2Y75 A;  1FLI A;  2H6B A;  1UHM A;  3C1D A;  5ILV A;  4GO1 A;  5JVT A;  2ZME B;  2OZU A;  4D0P A;  2V79 A;  3WTX C;  3KZZ A;  5HS8 A;  4CXF A;  3V8L A;  2UZK A;  3TO9 A;  3GFI A;  2XAH A;  2D45 A;  2A3S A;  2DI3 A;  5LRR A;  2PG4 A;  3QAH A;  5KVR A;  5J8C A;  1D8K A;  5CYV A;  1P6R A;  1USS A;  1ZGJ A;  2Q2E A;  4B09 A;  1IF1 A;  1R58 A;  2FSW A;  1T38 A;  3L00 A;  1FC3 A;  3I71 A;  5DV5 A;  2MH9 A;  3MCZ A;  4WK8 F;  1RUO A;  2EA4 A;  3ISP A;  3HRU A;  2GXB A;  1IRF A;  3VFZ A;  1H0M A;  3K1N A;  2HOE A;  4GYI A;  3PQK A;  1IN7 A;  1O7F A;  2JSC A;  1GVJ A;  1DP7 P;  3IHU A;  2QZ8 A;  1TTY A;  2A5Y B;  2MD5 A;  2MH2 A;  4HX7 A;  4A5N A;  4HDV A;  2XUB A;  3V7S A;  1DPR A;  1ZRE A;  3BOQ A;  2A69 F;  4HA8 A;  2A6H F;  4IRI A;  4ESJ A;  4P9U A;  2TDX A;  1YW9 A;  4EJU A;  4MHG A;  1DUX C;  1T98 A;  1Z6R A;  1ZN2 A;  2UXN A;  4G94 A;  3VOD A;  4I98 B;  1IN6 A;  3F6V A;  4M74 A;  3SFZ A;  3WTW C;  3FMS A;  4YIF A;  1XSV A;  3QPH A;  2L4A A;  1R5H A;  2HZT A;  4BYY A;  3QPT A;  1R36 A;  2QM3 A;  2XAQ A;  3T5X A;  3WTT C;  2YSR A;  3IRR A;  3SHF A;  4HF2 A;  2FML A;  2K27 A;  3SQN A;  5DYM A;  3RIR A;  4LMY A;  3I0T A;  4QWQ A;  3K0L A;  3I64 A;  3E6C C;  3I59 B;  1Z9C A;  1BIB A;  4Y13 A;  1K78 B;  1XMK A;  2PLY A;  5H6Q A;  4I0A A;  3VB2 A;  4OIO F;  3OOP A;  1OPC A;  1LDK B;  1RIO H;  1STZ A;  3QU3 A;  4HDU A;  1QBJ A;  1BI1 A;  4GXO A;  1O3R A;  1HKS A;  2K4J A;  1FX7 A;  1T0F A;  1S8N A;  4U0Y A;  1YS7 A;  4NQW A;  3ZMZ A;  1QQI A;  2Z33 A;  1IXC A;  1YTY A;  4KA4 A;  2HKX A;  3BP8 A;  2BGC A;  2HDC A;  4ENK A;  1D3Y A;  2E7X A;  4ENN A;  2M8E A;  2KRF A;  4KIC A;  3BWG A;  1SAX A;  2VE8 A;  1B6A A;  1WQ2 A;  4PZJ A;  5DCM A;  4UVB A;  2OAZ A;  1MJB A;  2ADU A;  2IP2 A;  2W25 A;  4CHU A;  1PP8 F;  2QLZ A;  4P9F A;  2M87 A;  4CGZ A;  4GGG A;  1JHH A;  5J8F A;  3GF2 A;  3CUQ C;  5CLS A;  4JQF A;  3BDD A;  2HFH A;  1P4X A;  1XMA A;  2XIG A;  3HRM A;  1FYL A;  4DQ2 A;  2G7H A;  1BC7 C;  3TKY A;  4R1H A;  1BJA A;  1K79 A;  4Q48 A;  3JSO A;  1HSJ A;  2Q8K A;  2PMH A;  3GEZ A;  1WI9 A;  2H09 A;  1G3T A;  1RNL A;  2UXX A;  4ZZD A;  5DUK A;  1HKT A;  1VTN C;  1Z1D A;  4F7Z A;  4IF4 A;  5FD6 A;  4MTE A;  5HDN A;  1HQC A;  3WU0 A;  2WV0 A;  2FOK A;  1U8R A;  2XKO A;  3K1M A;  2P5L C;  4RGX A;  3JSP A;  5JI6 A;  3R61 A;  2ZCW A;  1F4K A;  4ESF A;  4K2E A;  4KNY A;  4WXH A;  2HKO A;  3RYR A;  2BE5 F;  4HLX A;  1ODD A;  1G4D A;  3WOD F;  3LA3 A;  3RDI A;  3F22 A;  3HHG A;  5DCF A;  2P4W A;  1G6N A;  1ZRF A;  2XAS A;  3JW4 A;  2WWY A;  1T2K A;  1YQA A;  4KIF A;  3O6B B;  2E7W A;  1U5T C;  4HBL A;  1TQP A;  1I1G A;  3BY6 A;  3BPX A;  2A6E F;  1IRG A;  4M9X A;  2YU3 A;  4BHB A;  2Z99 A;  5FFX A;  3BJ6 A;  5D4S A;  3RPU A;  4HYE A;  1S7O A;  3J80 Z;  3R6S A;  1J2X A;  1I5Z A;  3JAM K;  2V1X A;  2NYX A;  1EH7 A;  3GWZ A;  4LK1 F;  1BM9 A;  3F21 A;  3IKV A;  2P7C B;  1ZAO A;  1IXS B;  2J5P A;  4M6Y A;  5IT3 A;  3CO6 C;  5CJ9 A;  3K1P A;  2RV8 A;  2XGX A;  4L9T A;  2NS0 A;  2H6C A;  2VE9 A;  2CFX A;  4H0E A;  5E1W A;  1OR7 A;  2OQG A;  3DQV C;  3F23 A;  2PEX A;  2F2E A;  5CVJ A;  2QBY A;  3Q5F A;  3QU6 A;  5DDG A;  3KP6 A;  1PDN C;  1FOK A;  1DPU A;  1E17 A;  3O3K A;  4KN7 X;  2KKO A;  5LRS A;  2FBI A;  2FBK A;  4FT8 A;  4LFU A;  4LB5 A;  4RB3 C;  1KQ8 A;  3ZQ7 A;  1CF7 A;  4YG2 F;  3WTU C;  1S6L A;  4I7H A;  3FMQ A;  5FLX Z;  5D6E A;  4ZYE A;  2OD5 A;  1W4M A;  4AIH A;  4L5I A;  3DPL C;  2STT A;  2KIU A;  3S2W A;  1ZH5 A;  4HAM A;  4YFN F;  4AWX B;  4LG0 B;  4MGR A;  1G3W A;  2XV4 S;  2DLL A;  3F8M A;  2YX7 A;  3BRO A;  2E1N A;  1HST A;  3EDP A;  5E17 F;  3TOA A;  2Y48 A;  3HTS B;  2Z3Y A;  2RDP A;  3TDU C;  2DT5 A;  2MLK A;  2DFI A;  1BIA A;  4LLL A;  1REP C;  2FNA A;  1O7L A;  3CUO A;  3R60 A;  4AIK A;  3KP7 A;  4A5M A;  4LJZ F;  2P5V A;  3EYY A;  1YIO A;  2F5C A;  4ZYD A;  2YPR A;  3KP2 A;  4OMY A;  2P6T A;  2O03 A;  2EK5 A;  3BZ6 A;  3EET A;  1YLF A;  2F5F A;  1W5T A;  3WGH A;  1QZZ A;  4EGZ A;  3QP6 A;  3E97 A;  5K5R A;  5HDG A;  4A6D A;  3RKW A;  4WX9 A;  3I54 A;  1FNN A;  3CUQ A;  5DD4 A;  2UWM A;  3U9G A;  5L3D A;  1R1V A;  2CQK A;  2V1U A;  2ZKZ A;  3IL2 A;  2GA1 A;  2LDU A;  2LKP A;  3MQ0 A;  1SFX A;  1H9T A;  3H3Z A;  2BV6 A;  3QP5 A;  5CVI A;  5J6X A;  2RN7 A;  4EGY A;  4ENM A;  3JTH A;  1MDM B;  1ULY A;  2OZ6 A;  1QPM A;  4IHT A;  3WTV C;  1R00 A;  1O57 A;  2BEO A;  3TGN A;  4MNU A;  2ACJ A;  3B02 A;  5LHG A;  1MJA A;  1DDN A;  2ESH A;  3V4G A;  3KE2 A;  2L54 A;  4OIN F;  1XDS A;  2GWR A;  1B1B A;  4I09 A;  2FRH A;  4AIJ A;  3HRS A;  1FBS A;  4P96 A;  2OBP A;  2IW5 A;  4E70 A;  3H3U A;  4N9I A;  2VXZ A;  1ZAR A;  2QYO A;  2M1B A;  1FZP B;  1LNW A;  1W5S A;  2O6G E;  1KU9 A;  4EJW A;  2IA0 A;  3P9C A;  3T1B A;  4FX0 A;  1LB2 A;  1UCR A;  5ICG A;  2HQN A;  3NRV A;  3F6O A;  3CDH A;  2B0L A;  4ON0 A;  3DFG A;  4OU0 A;  2L4M A;  1ZRC A;  1BI2 A;  1U5T A;  5HLG A;  2IT0 A;  4EJT A;  4RGR A;  3HTU A;  1B59 A;  4IPA A;  1KYW A;  3WE3 A;  1J75 A;  2EV0 A;  3FF5 A;  5D5W B;  4L5J A;  1W7P D;  1K7A A;  2W24 A;  3SXY A;  4PGH A;  3FM3 A;  5H6R A;  4A2U A;  3TO6 A;  4HLY A;  2BBY A;  4A12 A;  1S29 A;  2QUF A;  1GXQ A;  2DK8 A;  4MQV A;  2FMY A;  3KEO A;  1F5T A;  2COM A;  3CJN A;  2EFP A;  2GA2 A;  1J0R A;  2H94 A;  3O2P E;  3MFK A;  1SFU A;  1TQI A;  2G7U A;  4LLN A;  1U3E M;  3COA C;  3KP3 A;  2R7D A;  5L3F A;  2HEO A;  2ZXJ A;  3GZ5 A;  4WXC A;  2DBB A;  1FBU A;  4UV8 A;  4CZZ A;  4KMU X;  3Q9V A;  1FYK A;  3EUH A;  1W7P B;  3IWZ A;  4LGW A;  2AXL A;  5F64 A;  1FT9 A;  1EV7 A;  2XAG A;  1JXS A;  3GFL A;  4KT5 C;  1JE8 A;  1TLH B;  4LK0 F;  1EH8 A;  3LA2 A;  4G7Z F;  1XN7 A;  2VBY A;  4HX4 A;  2EFW A;  3OV8 A;  3LWF A;  3MAJ A;  3P7N A;  5JR3 A;  5CVR A;  5LGT A;  3ABU A;  3T8R A;  4HV6 A;  4IRH A;  2VN2 A;  4KUM A;  4XBF A;  4ESB A;  3QRF F;  1MKM A;  1YW8 A;  2GAU A;  3WU1 B;  2FEZ A;  1ZG1 A;  3E5U A;  5F1R A;  1IN4 A;  2JRT A;  4NB5 A;  4UVA A;  3FZV A;  1U6G A;  3ZN1 A;  2R3S A;  1S3J A;  4Q5S F;  5A2Q Z;  1SD6 A;  4YFX F;  4G6Q A;  1HW1 A;  3JTG A;  3HRT A;  2ZO4 A;  1TQM A;  2IA2 A;  1HKQ A;  1HW2 A;  2D1V A;  1YO5 C;  2OA4 A;  1FPQ A;  2ZNY A;  1TBX A;  3J7A O;  1KA8 A;  2A68 F;  5LHI A;  2HYG D;  2K7L A;  3FXU A;  4KDP A;  1R23 A;  4OMZ A;  1CGP A;  2IA1 A; 
#chains in the Genus database with same CATH topology
 4XOR A;  4KIB A;  2EA2 A;  3FBN B;  3B73 A;  2MYS A;  1MNM C;  2JSP A;  3ECO A;  4LOC A;  5H20 A;  2HI3 A;  2FBH A;  3DKY A;  4EV0 A;  5EZG A;  3HOZ J;  3FHZ A;  2MBF A;  4MEY F;  2O3F A;  2FU4 A;  4HNV A;  3HJE A;  4UUV A;  1MNE A;  2DMQ A;  1V4R A;  4WCG A;  2ELJ A;  1LEA A;  3ZQQ A;  5FKL A;  1JI8 A;  1G3S A;  2BXZ A;  1ON2 A;  1VQ9 I;  2FQ4 A;  4E6K G;  4M71 A;  4L0Y B;  2M2E A;  3L9F A;  3CCL I;  5E8I A;  4BGD A;  1FOW A;  2JK3 A;  2CMP A;  3ULQ B;  1SMT A;  1UFM A;  1YFH A;  2DMT A;  1S72 I;  2IXS A;  2VOO A;  2X1C A;  4U0W A;  1WVR A;  3PIP F;  4DJA A;  1OCR H;  3IC7 A;  3W6K B;  3HOS A;  1Z67 A;  3WGG A;  4XL9 A;  3GTQ J;  1EH6 A;  1I1S A;  4QLC U;  3L2C A;  1FTZ A;  4RDU A;  4EM2 A;  5K7H A;  4PGG A;  4V2G A;  1BOB A;  1S7E A;  3CJT B;  3WGI A;  4M72 A;  4O5V A;  1WH5 A;  3NEU A;  2HXO A;  2R7W A;  4S04 A;  2VBZ A;  3BTI A;  1U2W A;  1J5Y A;  5ICC A;  1SFE A;  3WG7 H;  3S1R J;  3FX3 A;  4ZTJ A;  2CWE A;  3W6J B;  4A3D J;  2ZME A;  3BR3 A;  4ZYG A;  4IOA F;  2ZSH B;  1WSU A;  5BMZ A;  1W0U A;  2Q2E B;  2OTJ I;  1DU0 A;  1Z7L A;  1RPW A;  5FGM A;  5LEK A;  3I9V 2;  4EJV A;  2HOS A;  1IZ1 A;  2J5O A;  2ELK A;  4FQG A;  1FBQ A;  4NNJ A;  1IN8 A;  3O8G A;  1O4X A;  1LJ9 A;  3CCV I;  4RAY A;  1VQ8 I;  4C3J J;  1FSH A;  3N97 A;  4XSZ F;  3F0C A;  4JP0 A;  1V54 H;  4OAZ A;  1D5V A;  1JTY A;  2HQR A;  1FJL A;  5CVV A;  1VQK I;  4GFB A;  2CV0 A;  2BYV E;  3A0B C;  5B66 C;  2CSO A;  2KPM A;  2EIK H;  1D1B A;  2P0W A;  3GUD A;  4MTD A;  1LPQ A;  2LG4 A;  2XF6 A;  3T8T A;  4FX4 A;  1I6X A;  3DXJ F;  2LFB A;  5F1J A;  1JUP A;  5JFR A;  2VC0 A;  5FKN A;  2XSJ C;  4DOZ A;  4U7B A;  3GO5 A;  3ZP5 A;  5E20 A;  1NK2 P;  3W2A A;  2V6C A;  1SD5 A;  4BAC A;  1KQ9 A;  1L0O C;  1IC8 A;  2XPW A;  5TJJ A;  3JRC A;  1YS6 A;  2K3P A;  1HW5 A;  2MC4 A;  1FYM A;  4JX4 A;  2M5W A;  3LQQ A;  1IGN A;  4Z2Y A;  3UKG A;  3FK7 A;  3S32 A;  3ZCO A;  5IOY A;  2ZJR F;  4RAZ A;  1LUJ B;  4IX7 A;  1MND A;  2NOJ B;  3SZP A;  1ZTR A;  1IAW A;  2M4G A;  3L2W A;  3AG1 H;  2PX9 A;  1UMQ A;  1KZH A;  2DXI A;  1OKR A;  5FLM J;  3I53 A;  3FM5 A;  1U8B A;  3Q9S A;  5BS6 A;  1H8A C;  2CYY A;  1POG A;  2R0Q C;  4AD9 A;  4BE0 A;  4A3I J;  2QKL B;  1PUF B;  3OOU A;  2RKH A;  1X1B A;  5K1Y A;  2OQR A;  5EF6 A;  4N4N B;  1MD0 A;  1E3O C;  3K4N A;  1F1Z A;  2DFF A;  2H1L A;  1APL C;  3MWM A;  4UB6 C;  2M30 A;  4A0Y A;  1A04 A;  1ZLJ A;  2XAJ A;  5GAH J;  5J1Y A;  1ZRD A;  3OIP A;  5J4Y A;  3S17 J;  5C3E J;  1R5I D;  3NQO A;  4BUP A;  3A0H C;  5DM6 F;  1ZYR F;  4NDL A;  3L7W A;  2GZW A;  5LGU A;  3GTM J;  3J80 K;  1XSD A;  2KDZ A;  2PN6 A;  1ON1 A;  4GDF A;  2WY8 Q;  2YUS A;  4CCO A;  4X6A J;  3ZXS A;  2WA0 A;  3ABT A;  2YS9 A;  1B9N A;  1SFO J;  1TW2 A;  2BXY A;  4EM0 B;  2O8X A;  5FFZ A;  2BW3 A;  4XN0 A;  4BQO A;  1M1E B;  4BNC A;  3CLO A;  4XM3 A;  5F6F A;  3S2D J;  2EZK A;  4BXX J;  2VON A;  2JUC A;  2A6T A;  3ML6 A;  2V6E A;  1UAA A;  1XX5 A;  2VBX A;  4BDY A;  1SVM A;  1KYZ A;  2VQL A;  4UUS A;  3I59 A;  3FXL A;  1QZY A;  2FE3 A;  2QGU A;  3E6D A;  4XOP A;  5K5O A;  2FA5 A;  2X51 A;  2QKM B;  1IUY A;  2IS2 A;  2V1D A;  3DCF A;  5L3E A;  4HV5 A;  1XGO A;  1K78 A;  2VJ4 A;  3SDB A;  3PFI A;  3TQN A;  3P5J A;  1PUE E;  5BPD A;  1XC5 A;  2E35 A;  5J4V A;  3MKW B;  4XSX F;  2LKX A;  4P5O A;  3BTL A;  1MMG A;  3LSG A;  2EWN A;  3HSR A;  5K5Q A;  3K9T A;  5HLT A;  3P9K A;  2JT1 A;  4NQW B;  2VQG A;  1AWC A;  2DA4 A;  1D5Y A;  1BW6 A;  4DZP A;  4KMF A;  4WWC A;  2EZL A;  4UHT A;  1NG6 A;  3ERE D;  3ESW B;  2ID6 A;  5F0F A;  2QSG X;  4EJO A;  3TMO A;  5D5U B;  1WZ2 A;  2VC1 A;  3SYT A;  3AL0 C;  3PQJ A;  5AON A;  4AVP A;  4HF1 A;  1ETX A;  4RS8 A;  2JZY A;  4LB6 B;  4B8X A;  2GLO A;  2ESN A;  2B63 J;  5HDK A;  2G9W A;  3JRA A;  5FLX K;  1J59 A;  1X19 A;  1ONV A;  2X9D A;  3C7J A;  3HBL A;  5D8L B;  1L3L A;  1G3Y A;  1TW3 A;  2K02 A;  2QQA A;  1MMS A;  2ID3 A;  1GXP A;  2HNH A;  4BDZ A;  2DW4 A;  2GIV A;  3CTA A;  2DMN A;  3BJO A;  3VYS B;  5LGN A;  3LAP A;  3HL2 A;  3N4M A;  1BL0 A;  1PP7 U;  1FP1 D;  3FXM A;  5DCM B;  1OCO H;  1ETO A;  3KCC A;  5ILS A;  4XLN F;  1B72 A;  4UV9 A;  3MZ8 A;  4XLP F;  4G6D A;  4B3X A;  3H0D A;  1MSE C;  2L3D A;  3I4N J;  2L02 A;  3K4B A;  3PM1 A;  5JLX A;  1H9G A;  2WAD A;  3GX4 X;  3JRB A;  1XB4 A;  1B4A A;  3H5R A;  2M45 A;  5AIP A;  3F8F A;  3ASO H;  2QEX I;  2HGC A;  1R22 A;  1QNT A;  1TNT A;  3BCB A;  2JN6 A;  2L0K A;  2W84 A;  3F3X A;  2AXT C;  1Z91 A;  2WB1 A;  3SZT A;  2CRG A;  2D5V A;  3QYF A;  4GYG A;  2KJB A;  2JA6 J;  3MZY A;  3AAF A;  1T6S A;  4CCN A;  2A61 A;  4RLF A;  3ERM A;  4PCQ A;  4LIU A;  4RM2 A;  1XPX A;  1UHW A;  3W2W A;  3TW6 A;  1BI0 A;  4R8H A;  5IT9 Z;  3J81 Z;  3CZ6 A;  1K6O A;  2JVG A;  1ZGA A;  2FOW A;  2RQQ A;  1FMV A;  3HHH A;  1I50 J;  4PSX A;  2FUG 2;  2NXN B;  2RGV A;  3M7G A;  5HS9 A;  1OJL A;  1S5L C;  5LHH A;  1V3F A;  2CQ7 A;  5JHU A;  2VQC A;  1HDD C;  3V8K A;  1P92 A;  1LEB A;  1U0J A;  1SMY F;  4G8X A;  1WHU A;  2VJ5 A;  5B5E C;  4RB0 A;  2WBM A;  3NWS A;  4L9J A;  1ZGW A;  3CO7 C;  4MEX F;  2JA8 J;  1Y8R B;  1YYV A;  3CC4 I;  3TED A;  3TO7 A;  1IV6 A;  1WPK A;  3LA7 A;  1JHF A;  5HLH A;  3IRQ A;  3M1E A;  5FRN A;  3HSF A;  1OYW A;  4C3I J;  3P9I A;  5DUI A;  3W6V A;  2NVT J;  1UEL B;  1OQY A;  1A35 A;  2CO5 A;  4O3M A;  3BG9 A;  1LE8 B;  3OR1 C;  4E7Z A;  5D5V B;  1ACI A;  3S1Q J;  2JPC A;  3DP7 A;  4YII A;  3KLN A;  3EQL F;  4C3H J;  1SD4 A;  2KDO A;  1VQN I;  1HLV A;  5HVQ C;  3K2Z A;  3E6B A;  1U9N A;  2W85 A;  5TRD A;  1Z3X A;  2QA4 I;  3S15 J;  3OMY A;  1XMX A;  1X2N A;  3N05 A;  4Q4Z F;  3EUA A;  3FXQ A;  4IL6 C;  4UXN A;  3HOT A;  2HTJ A;  3S8P A;  3D5L A;  2EPF A;  4DW6 A;  1BC8 C;  1ZLK A;  2HPM A;  4DYQ A;  4TV7 A;  3RTR A;  1QA6 A;  1KU7 A;  4BE1 A;  1VFC A;  2X4H A;  3PNV A;  2PJP A;  4IHY A;  1S9H A;  3OYL A;  2KJC A;  1FWZ A;  4OIP F;  5BOX A;  2ECB A;  1RES A;  2L9R A;  3J7Y J;  1X3U A;  2VI6 A;  2M34 A;  4DBR A;  1XD7 A;  3LSK A;  4GCV A;  4PFP A;  4ASN A;  2VOP A;  3M8E A;  3ROU A;  1FOX A;  1D1A A;  3CCR I;  1D8J A;  4M73 A;  2VJJ A;  1DP3 A;  4KFC A;  2PI0 A;  5D8K B;  9ANT A;  3OWT A;  3B6A A;  4Q47 A;  4CO8 A;  1ETV A;  5H2F C;  4YRV A;  3VPR A;  4RB2 C;  2VAS A;  3KLO A;  1Q1H A;  1TWC J;  2B7E A;  4PDK A;  3ZPL A;  4IJA A;  4RLQ A;  4ZH4 F;  2MD0 A;  4FHT A;  2Y0S A;  1AA7 A;  1E3H A;  4DYC A;  4U0V A;  2E5N A;  1WCM J;  4G7H F;  1TWF J;  3KP4 A;  1GDT A;  5LEJ A;  2JA2 A;  3ZQH A;  2RRE A;  3PNY A;  4EMS A;  3HKZ A;  2WAQ N;  4A69 C;  2MA3 A;  1UST A;  2E2I J;  1YX3 A;  3RPQ A;  1Y0U A;  3QOD A;  3VYT B;  3DV8 A;  4E7J A;  2GOX B;  4G9Y A;  4RAF A;  1GLN A;  2HYF A;  5FKK A;  1B8I A;  4JBA A;  2V26 A;  4PFO A;  4DNC A;  2JMW A;  4RGS A;  1ZG5 A;  3GZ6 A;  1YIT I;  1Y6I A;  2O7O A;  3E7L A;  2CQQ A;  3OYJ A;  5D4R A;  4ZDO A;  4PSW A;  4FE4 A;  3J7Z I;  2XVC A;  4I0B A;  4CYD A;  2LTP A;  4L18 B;  1FY7 A;  2HVQ A;  3A4C A;  4CDG A;  2KRC A;  1EA3 A;  2EBI A;  1E3P A;  4YEJ A;  5EEG A;  4D5C A;  2E1M C;  1PJR A;  2EFO A;  3S93 A;  4CYC B;  4IZZ A;  2W57 A;  2EZH A;  4ZYH A;  1BOA A;  1BI3 A;  5HS7 A;  3LSI A;  2IPQ X;  1EJ9 A;  1OIS A;  3WU2 C;  2AO9 A;  3BR2 A;  1R71 A;  3G73 A;  2W7N A;  2XAF A;  3M1C A;  3RZO J;  4P55 A;  2WTE A;  2XRO A;  1XCB A;  4XRM A;  1ZKG A;  1YJ9 I;  3OSF A;  4PK4 A;  4JK1 X;  4A3B J;  3MKL A;  4KIG A;  1Z05 A;  5HOO A;  4IXA A;  2HR3 A;  4ZDL A;  2QBY B;  4XOT A;  1E2X A;  1PUF A;  4G7O F;  2M3A A;  5L3G A;  2DK5 A;  3TP3 A;  3KET A;  2H27 A;  3RYP A;  3GTK J;  3LST A;  4XQF A;  2CW8 A;  4UVC A;  1J9I A;  1J7K A;  4BXF A;  3BQZ A;  4KJZ A;  2LSO A;  3S14 J;  5ICE A;  2IS1 A;  4XLF A;  1Z3Y A;  1ETK A;  1HOM A;  1WGX A;  3K4J A;  1R9T J;  2NS7 A;  3CC7 I;  4HZF A;  3RQI A;  1LVA A;  3OYI A;  2EFQ A;  1CF7 B;  1F9N A;  2W1O A;  2RVC A;  1N75 A;  4BH9 A;  2GM4 A;  3D1N I;  1VQL I;  2IEK A;  2KLO A;  5GAG J;  3E0J B;  5EGO B;  2KIQ A;  1MBG A;  1WJA A;  2DT6 A;  2L01 A;  2DTZ A;  3E6M A;  1ZQ3 P;  1OMI A;  2DFE A;  4M6X A;  3A2K A;  4PJ0 C;  1WJB A;  2EB7 A;  3DPT A;  3DLL F;  5E1Z B;  3RJP A;  3HOX J;  4G6T B;  2KT0 A;  5K7Z A;  5EEH A;  1SC7 A;  5E1X A;  2MLG A;  4OOI A;  1TT0 A;  4CIC A;  4M6V A;  1X3W B;  3MEX A;  1R1U A;  4A3C J;  4FTH A;  2E1O A;  2QQB A;  4QPQ A;  4IVN A;  1KQ0 A;  1ZR2 A;  3DKW A;  4ITV A;  2HDW A;  1ZG3 A;  4R79 A;  2WAF A;  2Y9Z A;  3J7A Y;  1GUU A;  1T08 B;  2L7K A;  1LQ1 A;  3HM5 A;  3S16 J;  3VDX A;  1ZHF A;  4B1R A;  2A07 F;  3ZMS A;  1MIJ A;  4UNO A;  2I5U A;  4IHX A;  4L9N A;  4D7N A;  3GFM A;  2BHY A;  4LG0 A;  3HOV J;  2BY3 A;  2Q0O A;  4V19 K;  1P7I A;  1IXR C;  3C2B A;  1BR1 A;  4FAS D;  4QTR A;  3HUG A;  2IJL A;  3FWE A;  4C2U A;  1GHC A;  2GXG A;  3FIS A;  3HPH A;  2JRM A;  1NHA A;  3LQR A;  1X1P A;  1FMW A;  3M9A A;  5HLI A;  3LFU A;  3IH3 A;  2P7V B;  1QVT A;  3LSM A;  4KIT B;  3TBI A;  3ELK A;  1VQ4 I;  3KEY A;  4BAY A;  1XCV A;  1KGS A;  5J47 A;  4HF0 A;  4I99 C;  4OIR F;  3V8J A;  4HW0 A;  3L2Q A;  5FO5 A;  3E3V A;  2Z9O A;  3FBI B;  5AIQ A;  3EPZ A;  1R1T A;  2CG4 A;  4YEL A;  2P6S A;  2Z16 A;  3KP5 A;  1QVU A;  2GQQ A;  1W1W E;  2K9L A;  4YFK F;  2R7Q A;  1OYY A;  2IBD A;  4HPQ A;  3REO A;  1QPI A;  3DEU A;  3I5U A;  4PJN A;  4A3K J;  1SD7 A;  4N9H A;  5B1A H;  3F72 A;  2XB0 X;  2NRA C;  4I01 A;  2C6Y A;  3EYI A;  3CUQ B;  4IKF A;  2IGN A;  2ZJ2 A;  3OYF A;  2DA2 A;  4XLC A;  1N78 A;  1P2F A;  3F8C A;  3RKQ A;  2EFN A;  2VKV A;  3Q0W A;  3LFK A;  4IO9 F;  2ZNZ A;  4L0Z B;  1MMA A;  2WC2 A;  5ILU A;  2Q1Z B;  2CW7 A;  2HWV A;  2Y9Y A;  3BC8 A;  3I58 A;  1WKM A;  2ZXH A;  3FXO A;  1AOY A;  1MGT A;  2F5D A;  2YR2 A;  2DYS H;  3BR5 A;  6PAX A;  2QSF X;  5GPC A;  2DOD A;  1W36 C;  3MVP A;  2MC3 A;  1XGS A;  2DU9 A;  3RSN A;  2STW A;  3PSI A;  2DQL A;  4XKV A;  5A2Q K;  2WY7 Q;  1GV2 A;  4MLO A;  2YX4 A;  2GXA A;  2IVM A;  4EQQ A;  5KK1 A;  3F8B A;  2O61 A;  1P7J A;  4XLA A;  1UZC A;  1R7J A;  2MGQ A;  2VBW A;  3C2H A;  4LD5 A;  4O6J A;  4NHJ A;  1VZ0 A;  4ENJ A;  4I02 A;  2ZFW A;  4QIW N;  4BJ5 C;  3OYE A;  2V9V A;  3I3L A;  3CP2 A;  3ZN0 A;  4BQA A;  2V4J C;  3KFW X;  3E5Q A;  1RZ4 A;  1LDJ A;  2KHM A;  1G8X A;  2G0E A;  4XN3 A;  4J00 A;  2ZC2 A;  4AVZ A;  2LNB A;  1DGW Y;  4W1U A;  2QVO A;  4D1Q A;  4BY1 J;  1QZE A;  2PMZ A;  3W2V A;  1MDM A;  3R0J A;  3JRI A;  2CW0 F;  2WAE A;  2BY2 A;  2QEN A;  1TT5 B;  4D9J A;  2LF8 A;  1F36 A;  2VJI A;  3SDG A;  1JGS A;  3TOB A;  2PBI A;  3H3V K;  3F8N A;  3L2R A;  4Y17 A;  2X6Y A;  2DN0 A;  4DIQ A;  1OCT C;  1V5F A;  3WHC A;  4XNF A;  2K9S A;  1NH3 A;  2M9H A;  2Z5U A;  4XRS G;  3HXL A;  2E2H J;  4WXD A;  1O3Q A;  5DEQ A;  1X1A A;  4M9Z A;  3OYM A;  4BHP A;  3H9J A;  5LLQ A;  2OJE D;  3ZMV A;  1SVO A;  3M8F A;  3RKX A;  5C44 J;  1HXD A;  5DD8 A;  1QGP A;  4I76 A;  1G2H A;  3BG5 A;  4HX8 A;  3HOW J;  2DTR A;  2VKD A;  1SFK A;  2F4M B;  4BS9 A;  3IKT A;  4M3B A;  2LK2 A;  3VYR B;  3JAM Z;  3H1C A;  1Z6T A;  2F5E A;  2VPR A;  4RGU A;  3I56 I;  3WE2 A;  2LVS A;  2VUM J;  3D5R C;  3JRF A;  4BEH B;  1AKH A;  3RI4 A;  2JA7 J;  2JPB A;  5D5X B;  1A5J A;  2QWW A;  3R4K A;  2HZD A;  2B9S A;  1VQ7 I;  2LKS A;  1A36 A;  3FXR A;  1IN5 A;  3OYD A;  4E7K A;  2M4K A;  3ZMD A;  2FNP A;  2NAZ A;  2K86 A;  2PJR B;  4LLG F;  1U5T B;  3ABK H;  5ICF A;  1JT6 A;  1FSE A;  2VT3 A;  3GLL A;  4E4H A;  4HQM A;  2K85 A;  3U2R A;  3LAJ A;  3DWL E;  3S2H J;  2R7F A;  2LP0 A;  1YG2 A;  2HQA A;  1YHQ I;  3KZY A;  2FXA A;  4NUB A;  5LD2 C;  1TWH J;  4G12 A;  2ZBK A;  2XSD C;  3K69 A;  3WHB A;  2D2W A;  2ETH A;  1I6H J;  3K4C A;  2RQP A;  2ELH A;  2JTV A;  3KIO A;  5JVG F;  1ZR4 A;  5IYD J;  3HIF A;  3V7C A;  5ERI A;  1R5G A;  1YW7 A;  1IW7 F;  4M3G A;  3K70 D;  1OCZ H;  3DBH B;  3ZQL A;  2XGE A;  3ZMU A;  5ED4 A;  2O0Y A;  1U78 A;  2K4B A;  3DBR B;  5D6F A;  1R4M B;  1MMN A;  2M0M A;  2FF4 A;  3HYI A;  1WRJ A;  1WWX A;  2OU2 A;  2XKP A;  1HC8 A;  4OIQ F;  1QU3 A;  4B3A A;  2R7V A;  2EQR A;  4WF2 A;  2KRH A;  2EIN H;  2MSY A;  5BQT A;  3GW2 A;  5IYB J;  4CCL A;  2ZSI B;  5DM7 F;  1VQ6 I;  3IWF A;  2R7S A;  1LFP A;  1TWA J;  2DPU A;  2DA3 A;  2MW8 A;  1O3S A;  4M9S A;  1GV5 A;  2DDA A;  4L9V A;  3V7R A;  2EV5 A;  2VIX A;  4PJM A;  2JUG A;  2X48 A;  3BLY A;  1OYI A;  1S7A A;  4LIV A;  3KEQ A;  3FHN A;  2KIM A;  5L3C A;  2VOD A;  1P4A A;  2PQ8 A;  3C3W A;  2R7R A;  5FD5 A;  3GFJ A;  3VOE A;  3TDZ C;  3IH4 A;  2QQ9 A;  3AKZ A;  3H92 A;  4C30 A;  3DTI A;  2R5Y A;  5E8G A;  1WJD A;  2PFB A;  4EAT A;  1BBY A;  5FLV A;  5B1B H;  1MBH A;  3DTE A;  2CQX A;  1FIA A;  1TNS A;  3WTY C;  2NVQ J;  2IRF G;  2CGP A;  2Y30 A;  4IRG A;  3H0G J;  1ORK A;  1T0F C;  4F3Q A;  5E3N A;  3X2Q H;  1W7P A;  4XRF A;  4PJL A;  3EUK L;  3HOU J;  1O3T A;  4ZZL A;  4Y15 A;  2DAO A;  3RKY A;  4BKX A;  3MZH A;  2XRN A;  4I6Z A;  4AID A;  3DU5 A;  4KN4 X;  1HCR A;  1BN5 A;  1RUN A;  1UB9 A;  4ETS A;  3WTS C;  3R0A A;  4NC8 A;  4U88 A;  4ANJ A;  1Z7U A;  2E36 A;  1EF4 A;  1QO0 D;  3VEP A;  1IDZ A;  1B9M A;  1ITY A;  3C2G A;  3FKJ A;  4F93 B;  2DQR A;  3AG2 H;  4KYW A;  2OV7 A;  4N0B A;  2DA6 A;  3DTK A;  1YRN B;  2RNJ A;  1V5G A;  4EVI A;  5GTH C;  2QQ8 A;  4RM3 A;  3BPV A;  5EG0 B;  2R5Z A;  1XGN A;  3E1S A;  3WTZ A;  4A93 J;  2EV6 A;  3OYB A;  4IHS A;  4EM1 A;  1KU3 A;  4RB1 A;  2NNY A;  3WG9 A;  4JOM A;  3LSR A;  2HOT A;  1XGM A;  2R92 J;  2HU9 A;  2XHK A;  3ZMT A;  2P8T A;  4FET A;  5FKO A;  2X85 A;  4U7D A;  3GYH X;  1KU2 A;  3DF8 A;  4V2F A;  4HQE A;  4HEA 2;  2E1C A;  1LDD A;  2RC4 A;  4A3L J;  1Z77 A;  3IP4 B;  2LBF B;  2DO7 A;  1WJC A;  5IYC J;  1Y1W J;  2VT2 A;  2F6C A;  2MG4 A;  3HSE A;  3ABL H;  1G59 A;  1C0W A;  2VKE A;  5KAI C;  2HS5 A;  2Z2S B;  4C2M J;  3K4L A;  2KIF A;  4BHC A;  3D0S A;  1FP2 A;  2LOO A;  1HBX G;  2XGD A;  4A0Z A;  2W82 A;  2HVS A;  3I4P A;  2R7X A;  4BXU A;  3GXO A;  4IHV A;  3IH2 A;  4W97 A;  1F43 A;  1P4W A;  3A01 B;  3ECH A;  5FB2 A;  2XAU A;  3QOP A;  1Q1V A;  4J19 A;  1VQO I;  2LY9 A;  2CUZ A;  1Z21 A;  1BA5 A;  4CZC A;  1T39 A;  2AS5 F;  2E60 A;  2FD5 A;  3FMR A;  2D1H A;  2ISY A;  4NC7 A;  1MZB A;  1T95 A;  5LBQ A;  5E18 F;  5FRM A;  1RI7 A;  3U1D A;  1MJ9 A;  3V42 A;  3A02 A;  5BPI A;  4OAY A;  1H89 C;  4I2O A;  1MH3 A;  1JTX A;  5F04 A;  5JHF A;  3CDL A;  3Q3S A;  5L3B A;  4P1W A;  2FQ3 A;  3GLX A;  2WAQ A;  3GME A;  2LF7 A;  2CQN A;  2ISZ A;  4S05 A;  3BJA A;  3OY9 A;  2EJR A;  5GAD J;  3E5X A;  3L09 A;  2O8K A;  1I27 A;  3GVA A;  3C18 A;  4MQ9 F;  1JUM A;  2HTS A;  3DBL B;  3LNQ A;  4Y4R A;  1UJ8 A;  2X0L A;  3KYD B;  2MAB A;  4AU7 A;  5IT9 K;  2NNN A;  3J81 K;  4JX5 A;  4C9Y A;  3HG9 A;  2Y0M A;  1XDU A;  2XF5 A;  4XKC A;  2P5K A;  2PMU A;  2DPD A;  2DDB A;  5J1R A;  3LSP A;  1XSX A;  4A0X A;  5EYR A;  4E7H A;  5CVU A;  4A3F J;  4A6E A;  4HOB A;  3G3Z A;  3T0Y A;  1TP4 A;  2Y75 A;  2H6B A;  5KAF C;  1FLI A;  1UHM A;  1IJW C;  3C1D A;  5ILV A;  5M3F J;  4GO1 A;  2VLA A;  2V9P A;  2K40 A;  1X1D A;  3H35 A;  1MW7 A;  5JVT A;  1A31 A;  2F4I A;  2ZME B;  5E79 C;  2OZU A;  4D0P A;  2V79 A;  3WTX C;  3KZZ A;  2ZME C;  5HS8 A;  4CXF A;  3V8L A;  1TL8 A;  2E71 A;  1WI3 A;  1IG7 A;  2JVH A;  2UZK A;  3TO9 A;  4IOC F;  3GFI A;  2XAH A;  2D45 A;  2A3S A;  2DI3 A;  5LRR A;  2PG4 A;  3QAH A;  5KVR A;  5J8C A;  4QSH A;  1E0E A;  1OFC X;  1LFB A;  3U1K A;  1D8K A;  5KNL A;  1JT0 A;  3JCU C;  5CYV A;  2TRT A;  3KZI C;  1P6R A;  1USS A;  1ZGJ A;  2Q2E A;  4B09 A;  1IF1 A;  1R58 A;  2FSW A;  1T38 A;  3L00 A;  3CCS I;  1VQM I;  1FC3 A;  1QHH D;  3I71 A;  5DV5 A;  3BT9 A;  4E7L A;  2MH9 A;  2FJ1 A;  3MCZ A;  3UR3 C;  4WK8 F;  2L7Z A;  3TP0 A;  4AC0 A;  2EIM H;  1RUO A;  2L5Q A;  2EA4 A;  3ISP A;  3HRU A;  2GXB A;  3GTJ J;  1IRF A;  1Y8Q B;  4XR6 A;  3VFZ A;  1H0M A;  1VQ5 I;  3K1N A;  2HOE A;  3SEZ A;  4GYI A;  1MMD A;  3DEE A;  1FOY A;  1RRJ A;  3CCE I;  2HPI A;  3PQK A;  3H9G A;  1IN7 A;  1O7F A;  1I3Q J;  2JSC A;  1YE9 A;  1GVJ A;  1DP7 P;  3IHU A;  3HEF A;  3BR6 A;  4FE7 A;  2BVL A;  5IPA A;  2QZ8 A;  2HDD A;  1TTY A;  2A5Y B;  2MD5 A;  2R7U A;  2MH2 A;  2CFO A;  4HX7 A;  4A5N A;  4HDV A;  1XG1 A;  2XUB A;  3V7S A;  1DPR A;  1ZRE A;  1K4S A;  2HQ5 A;  2BY1 A;  3BOQ A;  2E2J J;  2A69 F;  4Y52 J;  4DBQ A;  4HA8 A;  1PYV A;  2A6H F;  1WFX A;  4DZJ A;  4IRI A;  4ESJ A;  3CD6 I;  4Z6Y A;  2CU7 A;  2TDX A;  2M0C A;  1YW9 A;  4EJU A;  4P9U A;  4MHG A;  1DUX C;  3G71 I;  3DPU A;  1T98 A;  1Z6R A;  1ZN2 A;  1OR7 C;  2UXN A;  4Y33 A;  4G94 A;  3VOD A;  4I98 B;  3JR9 A;  4KIS A;  1IN6 A;  3F6V A;  4M74 A;  3SFZ A;  3WTW C;  3FMS A;  4YIF A;  1XSV A;  3QPH A;  2L4A A;  1R5H A;  2HZT A;  1A6Q A;  4BYY A;  4U87 A;  2VPL A;  3PFY A;  3QPT A;  1R36 A;  3JRD A;  2QM3 A;  2XAQ A;  4X1E A;  3T5X A;  3WTT C;  2YSR A;  1D0X A;  3IRR A;  3SHF A;  2LRD A;  2FML A;  4HF2 A;  2BW3 B;  2K27 A;  3SQN A;  2LD5 A;  5DYM A;  3RIR A;  2ME0 A;  3SFI A;  4LMY A;  2KQR A;  1SAN A;  3I0T A;  1UG2 A;  4QWQ A;  3OYH A;  2O5R A;  3K0L A;  1LKX A;  4M3D A;  3I64 A;  3PIO F;  3CCY A;  4UUS B;  3E6C C;  3I59 B;  2GIZ A;  1Z9C A;  3FKI J;  3HPG A;  1BIB A;  3VWB A;  4D7M A;  2AQE A;  1VI0 A;  2IGM A;  1PVE A;  4Y13 A;  2CUF A;  1K78 B;  1XMK A;  4BJT A;  2PLY A;  1RR8 C;  5H6Q A;  4CH7 A;  4I0A A;  3VB2 A;  4OIO F;  3OOP A;  2E5Z A;  1OPC A;  1LDK B;  3CMA I;  2IGO A;  4MFE A;  5JLW A;  1AHD P;  2I10 A;  1STZ A;  3QU3 A;  4HDU A;  1RIO H;  1QBJ A;  1X4P A;  3OS2 A;  3OYA A;  1BI1 A;  4B48 A;  3L2U A;  2OCE A;  2QCO A;  4GXO A;  1O3R A;  1HKS A;  2K4J A;  1FX7 A;  5M3M J;  1DGR M;  3S3N A;  1T0F A;  3PO2 J;  1S8N A;  3G1O A;  4M3E A;  4U0Y A;  2CS3 A;  3L1P A;  1I39 A;  4N4O B;  1YS7 A;  3ZQG A;  2HXI A;  2M8G X;  3CDI A;  4NQW A;  3ZMZ A;  1N77 A;  1Y39 A;  1QQI A;  2Z33 A;  1IXC A;  2M7B A;  3DKX A;  4II2 A;  4LG3 A;  1YTY A;  1YIJ I;  4KA4 A;  4ZJZ A;  5BNG A;  3IAM 2;  2HKX A;  3BP8 A;  2BGC A;  2HDC A;  4ENK A;  4HNT A;  2LH9 A;  2TCT A;  1D3Y A;  2P81 A;  1B72 B;  4F92 B;  3CQZ J;  2E7X A;  4J01 A;  4ENN A;  2M8E A;  2KRF A;  2MFZ A;  4KIC A;  3BWG A;  1SAX A;  2VE8 A;  1K83 J;  1B6A A;  1WJE A;  1YI2 I;  3TL4 X;  4XON A;  4II3 A;  1WQ2 A;  4PZJ A;  5DCM A;  4BBS J;  5GTI C;  3A03 A;  4UVB A;  2NVU B;  3VSL A;  2OAZ A;  5IP6 A;  1MJB A;  2DMP A;  2ADU A;  2QSH X;  2IP2 A;  2W25 A;  3CC2 I;  4CHU A;  3G2B A;  1IRZ A;  1IDY A;  3CMY A;  1PP8 F;  2XGC A;  4B44 A;  3CJR B;  2QLZ A;  4P9F A;  2M87 A;  4BJ6 C;  4CGZ A;  2CV1 A;  4GGG A;  1VQP I;  3FDY A;  1JHH A;  5J40 A;  3ZQI A;  2OUM A;  1JKP C;  4B47 A;  5J8F A;  3GF2 A;  3PUF A;  3M8J A;  3CUQ C;  3FXK A;  1BR4 A;  2XDV A;  5CLS A;  4JQF A;  5IOZ A;  3BDD A;  2HFH A;  1P4X A;  1XMA A;  3SJM A;  3HZJ A;  2XIG A;  3HRM A;  2F5V A;  3HDD A;  1FYL A;  1J09 A;  5FKM A;  3ZRG A;  2NOG A;  4DQ2 A;  2G7H A;  1BC7 C;  3TKY A;  4R1H A;  2KIS A;  1BJA A;  5TIS C;  1K79 A;  2QF7 A;  2W4S A;  4Q48 A;  3GZN B;  3K10 A;  1HSJ A;  2Q8K A;  5KHD A;  3JSO A;  1JJ6 C;  2F48 A;  2PMH A;  3GEZ A;  3OIQ A;  4A3M J;  2F4O B;  2RNG A;  3LSH A;  3MMY B;  3NAR A;  1WI9 A;  2H09 A;  1G3T A;  3K4K A;  1RNL A;  2Y69 H;  2UXX A;  4ZZD A;  3G6E I;  1W5C C;  4HG2 A;  2L7M P;  2ZJQ F;  3RCO A;  1LE8 A;  5DUK A;  1HKT A;  1VTN C;  1Z1D A;  4F7Z A;  4IF4 A;  4CCK A;  4IHW A;  2WV1 A;  2EIJ H;  4MTE A;  4B43 A;  5FD6 A;  5HDN A;  1HQC A;  2BVM A;  3WU0 A;  3ABM H;  2WV0 A;  2FOK A;  2ZFU A;  1U8R A;  4BQQ A;  2NVX J;  2XKO A;  3K1M A;  2ICW G;  4MFD A;  2P5L C;  5F0C A;  4A3J J;  4AYB N;  4RGX A;  3JSP A;  5JI6 A;  3Q0U A;  1IRX A;  3R61 A;  3DLA A;  2ZCW A;  1F4K A;  4ESF A;  3SZG A;  4D5F A;  2KP6 A;  2CH0 A;  2CJJ A;  1D1C A;  3PL8 A;  4BY7 J;  3CCM I;  1VF9 A;  3M3Y J;  2EH3 A;  1ZK8 A;  3BG7 A;  2L2O A;  4K2E A;  4KNY A;  4WXH A;  2HKO A;  3RYR A;  2LC2 A;  2DFH A;  5EZH A;  2BE5 F;  4XRS A;  4HLX A;  1H88 C;  3S1M J;  1ODD A;  2H1K A;  3S1N J;  3ZQC A;  1G4D A;  1UHS A;  4MIM A;  3WOD F;  3LA3 A;  5J1U A;  3RDI A;  3F22 A;  3CJQ B;  3HHG A;  2K9M A;  2AQF A;  2IS6 A;  1QHG A;  2OCC H;  5DCF A;  2P4W A;  2R93 J;  1G6N A;  3ASN H;  1ZRF A;  2XAS A;  2Y31 A;  3JW4 A;  4XMY A;  2H8R A;  2NVY J;  1B8I B;  2WWY A;  1T2K A;  1RET A;  1Z0X A;  3D5S C;  3F9K A;  1YQA A;  4KIF A;  3O6B B;  2E7W A;  1U5T C;  4JX6 A;  2VKH A;  4HBL A;  1GT0 C;  1TQP A;  4ZYA A;  1I1G A;  3BY6 A;  1KON A;  3GBG A;  3BPX A;  3LSJ A;  2A6E F;  2IS4 A;  2R7Z J;  1IRG A;  4M9X A;  2YU3 A;  4BHB A;  2Z99 A;  5FFX A;  3BJ6 A;  3W3C A;  3B6C A;  2K3F A;  3RPU A;  4HYE A;  5D4S A;  1S7O A;  3J80 Z;  1X4O A;  5J3L A;  3KPH A;  3BTC A;  3HGY A;  2PMZ N;  3R6S A;  1J2X A;  1I5Z A;  3JAM K;  3QOE A;  3O8H A;  4L5E A;  2V1X A;  4CUG A;  2NYX A;  1EH7 A;  3GWZ A;  2N8G A;  1BW5 A;  4LK1 F;  1BM9 A;  1Y56 A;  3F21 A;  3IKV A;  2P7C B;  3CCQ I;  3JRG A;  3AFH A;  4CYC A;  1ZAO A;  1IXS B;  4Y7N J;  2J5P A;  3HC7 A;  4M6Y A;  4FIS A;  3I55 I;  1TZL A;  5IT3 A;  3CO6 C;  5GP9 A;  5CJ9 A;  4CCM A;  3K1P A;  5DTD A;  2XPU A;  2RV8 A;  2XGX A;  1NG7 A;  4L9T A;  4RA2 A;  2NS0 A;  2H6C A;  2ME6 A;  2VE9 A;  2CFX A;  4XLH A;  1MBE A;  4H0E A;  3GTG J;  1ETW A;  5E1W A;  1OR7 A;  1K4T A;  2GOM A;  1N25 A;  2OQG A;  1HA8 A;  2W48 A;  3DQV C;  3FXJ A;  4XIC A;  4GRI A;  3F23 A;  2PEX A;  2EIL H;  3NAU A;  4Y3O A;  2DA7 A;  2F2E A;  3M07 A;  5CVJ A;  5IP9 J;  4XLE A;  2QBY A;  3Q5F A;  3QU6 A;  3BTJ A;  4E7S A;  5DDG A;  3KP6 A;  5EDN A;  3IAS 2;  1PDN C;  2JWT A;  1FOK A;  2HOA A;  4IEJ A;  1DPU A;  3G4S I;  1E17 A;  3O3K A;  4JYK A;  2ZB9 A;  4KN7 X;  3JRH A;  2KKO A;  5LRS A;  2W00 A;  2FBI A;  3PUB A;  2FBK A;  4FT8 A;  4LFU A;  1IV8 A;  3EUH C;  4RB3 C;  4LB5 A;  1KQ8 A;  2CUE A;  3ZQ7 A;  5HNH A;  1CF7 A;  4AUX A;  4YG2 F;  4M3F A;  3WTU C;  1S6L A;  3K70 C;  4I7H A;  2HVR A;  3FMQ A;  5FLX Z;  5EGO A;  3VSK A;  5D6E A;  4ZYE A;  2XC7 A;  4F52 A;  3ZQF A;  2OD5 A;  3KX2 A;  5GAE J;  3NWT A;  1W4M A;  4AIH A;  4XKW A;  3QPS A;  3CLQ A;  4L5I A;  3DPL C;  2STT A;  2KIU A;  3S2W A;  1ZH5 A;  2GBY A;  1JKO C;  4A3G J;  3DEW A;  4HAM A;  1X2M A;  4YFN F;  4BE2 A;  3ONQ A;  1MH4 A;  4AWX B;  4CCJ A;  4LG0 B;  3TW7 A;  4MGR A;  1G3W A;  2XV4 S;  1YJW I;  2DLL A;  2DYR H;  3F8M A;  2YX7 A;  3BRO A;  2E1N A;  3HUG B;  2ZJP F;  3AL0 B;  1HST A;  1YJN I;  3EDP A;  2JJ7 A;  5E17 F;  5HNF A;  3TOA A;  2Y48 A;  3HTS B;  2Z3Y A;  2RDP A;  3TDU C;  1VND A;  4BL0 B;  5F0H A;  3BR0 A;  1SAU A;  2DT5 A;  2DFI A;  2MLK A;  1BIA A;  4LLL A;  2IGK A;  5E3O A;  1REP C;  2FNA A;  3MD2 A;  1O7L A;  3CUO A;  2X1D A;  2LY2 A;  4F91 B;  2LYC A;  5IP7 J;  3R60 A;  4AIK A;  5CPR B;  3KP7 A;  3Q0V A;  4A5M A;  5F27 A;  4LJZ F;  2P5V A;  3GTP J;  2A5W A;  4XK4 A;  3EYY A;  3OYN A;  2OF7 A;  5FJ8 J;  1FTT A;  1YIO A;  2F5C A;  3OYC A;  4ZYD A;  3IV5 A;  2YPR A;  3OR2 C;  2DA1 A;  3KP2 A;  4LIT A;  2Z1D A;  4OMY A;  3K7A J;  2ZXW H;  4PJJ A;  2P6T A;  3LMM A;  4RAG A;  1FEX A;  2O03 A;  2EK5 A;  3CP8 A;  3K6G A;  3BZ6 A;  3EET A;  1YLF A;  2F5F A;  4CSW A;  1W5T A;  3WGH A;  2DOA A;  1NK3 P;  1QZZ A;  3SEQ A;  4EGZ A;  5TGT A;  3CME I;  3QP6 A;  3E97 A;  5K5R A;  4RMN A;  3CF5 F;  5HDG A;  4A6D A;  1LVK A;  2K9N A;  3RKW A;  4WX9 A;  3I54 A;  1FNN A;  3H5A A;  2H8W A;  3CUQ A;  3QPL A;  1X3Z B;  5KCM A;  5DD4 A;  3KYL A;  1JJ8 C;  3G1L A;  2UWM A;  3U9G A;  3LL7 A;  1JUS A;  2KMU A;  2EZI A;  2E34 A;  5L3D A;  3BG3 A;  5DS9 A;  2X1E A;  3OYK A;  1R1V A;  2CQK A;  2V1U A;  2ZKZ A;  1IO2 A;  3DU6 A;  3IL2 A;  2GA1 A;  2LDU A;  5GPA A;  2LKP A;  5EJC A;  3MQ0 A;  1SFX A;  3JRE A;  1H9T A;  1U9O A;  2BV6 A;  3H3Z A;  3QP5 A;  5CVI A;  2RN7 A;  5J6X A;  4EGY A;  4ENM A;  2UV1 A;  5M5X J;  2VB6 A;  4ZDP A;  3JTH A;  1MDM B;  1ULY A;  2OZ6 A;  1QPM A;  4C2T A;  4IHT A;  2X6O A;  3WTV C;  4HNU A;  2OPT A;  1R00 A;  1WH7 A;  1O57 A;  1RC9 A;  2BEO A;  3TGN A;  4MNU A;  3H5N A;  1XTA A;  4NBQ A;  5CQE A;  2OC6 A;  2ACJ A;  3B02 A;  1X58 A;  1CQT A;  3G1M A;  1T33 A;  2IAI A;  5LHG A;  1XS9 A;  1T8I A;  4RBO A;  1MJA A;  1WJ5 A;  4F55 A;  5B3S H;  2COB A;  1DDN A;  2R7T A;  2ESH A;  3V4G A;  3KE2 A;  2WB1 N;  2L54 A;  3RPU D;  4OIN F;  1XDS A;  2GWR A;  5HOD A;  1B1B A;  1TWG J;  3HB9 A;  2FRH A;  4I09 A;  2JQ7 A;  4AIJ A;  5M5Y J;  3OL4 A;  3HRS A;  1FBS A;  2BOL A;  4P96 A;  4E7I A;  3ZR8 X;  2OBP A;  2IW5 A;  4ABZ A;  2LMD A;  3M4O J;  2K5C A;  1V5E A;  4E70 A;  3OS0 A;  3H3U A;  4N9I A;  2VXZ A;  5K7F A;  5EEA A;  3FK6 A;  1ZAR A;  4ZTF A;  2QYO A;  1TC3 C;  4DYR A;  3MKZ A;  2M1B A;  2KL4 A;  1AKH B;  2LY1 A;  4KT6 A;  1FZP B;  4B4C A;  1K61 A;  1LNW A;  3OIO A;  1W5S A;  2O6G E;  2R7O A;  3GTL J;  1KU9 A;  3PNT A;  4EJW A;  1V55 H;  5CKT A;  2IA0 A;  3P9C A;  1R49 A;  2DMU A;  2XPV A;  3T1B A;  4FX0 A;  1LB2 A;  1HDP A;  3PJR A;  1T56 A;  1UCR A;  1Y0N A;  2XB5 A;  1ERD A;  1UG0 A;  5ICG A;  4BEH A;  2HQN A;  1BR2 A;  3NRV A;  1QRY A;  3F6O A;  3CDH A;  2B0L A;  4ON0 A;  3DFG A;  2V9K A;  1I3A A;  4OU0 A;  2L4M A;  4BBR J;  1ZRC A;  3OL3 A;  1BI2 A;  2PJR A;  2VXD A;  2YU9 J;  4UY8 I;  1YOV B;  1U5T A;  5HLG A;  2JA5 J;  2IT0 A;  3S3M A;  4RGR A;  4EEF G;  4EJT A;  2O9L A;  4UB8 C;  4MO7 A;  4CA0 A;  2K9Q A;  3OYG A;  2CUJ A;  3HTU A;  1B59 A;  4IPA A;  3OS1 A;  1LFU P;  3BG6 A;  3HGG A;  1KYW A;  3WE3 A;  4A3E J;  1J75 A;  2E1M B;  2V7F A;  5FRO A;  1BJZ A;  4HRI A;  2DOE A;  2EV0 A;  5IY5 H;  3FF5 A;  1P9Q C;  5D5W B;  4NC6 A;  4HSR A;  4L5J A;  3OSG A;  1W7P D;  2I8D A;  1K7A A;  2W24 A;  1ETQ A;  3BQY A;  2ZXI A;  1RR7 A;  2E19 A;  2A05 A;  3SXY A;  4PGH A;  3FM3 A;  5H6R A;  1MBK A;  4BU2 A;  3U21 A;  4A2U A;  1AU7 A;  4AM3 A;  3TO6 A;  4HLY A;  2UUZ A;  2BBY A;  4A12 A;  2CV2 A;  1JKR C;  1S29 A;  2QUF A;  1GXQ A;  3UNG C;  4DGW B;  2DK8 A;  4MQV A;  5E3L A;  2FMY A;  3KEO A;  1F5T A;  1NTC A;  2COM A;  3CJN A;  2EFP A;  3GCM A;  2GA2 A;  2Y0S N;  3GTO J;  1J0R A;  2H94 A;  3O2P E;  4S0H B;  5C4J J;  3MFK A;  1MSF C;  1SFU A;  4IQ4 A;  2KFD A;  2DCE A;  4HST A;  4BQN A;  1TQI A;  2G7U A;  2R5Y B;  3HKZ N;  2R4G A;  5C4X J;  4LLN A;  3KYC B;  1U3E M;  3RQ4 A;  3COA C;  3QYB A;  3KP3 A;  3QYE A;  3BZK A;  4XID A;  2R7D A;  3QQA A;  2Y2Z A;  5L3F A;  2HEO A;  2ZXJ A;  3GZ5 A;  4QPO A;  2X6W A;  3S3O A;  1D0Z A;  1OLT A;  4WXC A;  2DBB A;  1EKE A;  1FBU A;  1Y1V J;  2L7F P;  3LOC A;  1W0T A;  4UV8 A;  4CZZ A;  2HYJ A;  4KMU X;  3Q9V A;  1FYK A;  3EUH A;  1W7P B;  3IWZ A;  2V1N A;  4LGW A;  2AXL A;  1JGG A;  3H36 A;  1SEU A;  1OCP A;  5F64 A;  1R6R A;  1FT9 A;  2OTL I;  1EV7 A;  2XAG A;  3ZOB A;  1JXS A;  3GFL A;  4KT5 C;  3BCA A;  1TLH B;  4LK0 F;  1JE8 A;  1EH8 A;  3K4M A;  3LA2 A;  2BHZ A;  1IUF A;  3MKY B;  4G7Z F;  1XN7 A;  2VBY A;  4HX4 A;  2EFW A;  4FCY A;  1YX5 A;  3OV8 A;  1ENH A;  3LWF A;  3MAJ A;  3P7N A;  5E3M A;  5JR3 A;  1K6Y A;  5CVR A;  2FX0 A;  5LGT A;  3ABU A;  3CMM A;  5CQG A;  3T8R A;  2R5Z B;  2BZT A;  2LRE A;  2L9V A;  2DT7 B;  2KZG A;  3MN2 A;  4HV6 A;  2VN2 A;  4IRH A;  4KUM A;  4XBF A;  3CES A;  2LLK A;  4ZC3 A;  1MBF A;  3IUO A;  4ESB A;  3QRF F;  1MKM A;  1YW8 A;  2GAU A;  3WU1 B;  2ECC A;  2FEZ A;  5M5W J;  1YRN A;  1FIP A;  4XKB A;  3AG3 H;  1ZG1 A;  1JKQ C;  4UUT A;  1W36 D;  3E5U A;  5EG0 A;  3I4M J;  2BY0 A;  1X1C A;  5F1R A;  3VYU B;  4X0G A;  3L2V A;  1IN4 A;  2JRT A;  4NB5 A;  4UVA A;  2L9N A;  3FZV A;  1RKT A;  1RKW A;  1ZEL A;  1U6G A;  3ZGK A;  3ZN1 A;  2M7A A;  1R4N B;  2DA5 A;  1ETY A;  2R3S A;  2DJI A;  2NS8 A;  3CF2 A;  1DQU A;  1S3J A;  3BZC A;  2VL8 A;  3HOY J;  4Q5S F;  5A2Q Z;  1SD6 A;  4YFX F;  3PO3 J;  2XF7 A;  3K2A A;  4G6Q A;  1HW1 A;  2DOF A;  2XRL A;  3JTG A;  3HRT A;  4PUS A;  4AYB A;  2ZO4 A;  2LBF A;  3QWL A;  4YIR X;  1TQM A;  2IA2 A;  1MBJ A;  1HKQ A;  1HW2 A;  1DU6 A;  2D1V A;  2L9S A;  2DJN A;  3H9Q A;  1YO5 C;  2OA4 A;  3CCU I;  2KZV A;  1FPQ A;  2ZNY A;  2LR8 A;  1TBX A;  3J7A O;  1GVD A;  3A1Y A;  1KA8 A;  2AHQ A;  2RAE A;  3PSF A;  2A68 F;  1OCC H;  4OWR B;  2HYG D;  2K7L A;  5LHI A;  3A01 A;  3FXU A;  1HF0 A;  3RZD J;  4IQJ A;  1A6I A;  5LFA A;  4KDP A;  3AG4 H;  1R23 A;  4OMZ A;  1WJF A;  5F08 A;  1CGP A;  1SVL A;  2X6X A;  3CCJ I;  1D0Y A;  2VQH A;  3BR1 A;  3FIW A;  4H4K C;  2IA1 A; 
#chains in the Genus database with same CATH homology
 4KIB A;  2EA2 A;  3B73 A;  3ECO A;  5H20 A;  2FBH A;  4EV0 A;  3FHZ A;  2MBF A;  4MEY F;  2O3F A;  2FU4 A;  4UUV A;  1V4R A;  4WCG A;  1LEA A;  1G3S A;  1ON2 A;  4M71 A;  4L0Y B;  3L9F A;  5E8I A;  3ULQ B;  1SMT A;  1UFM A;  1YFH A;  2VOO A;  4U0W A;  3IC7 A;  3W6K B;  3HOS A;  3WGG A;  1I1S A;  1EH6 A;  4QLC U;  3L2C A;  4EM2 A;  4PGG A;  3WGI A;  4M72 A;  4O5V A;  3NEU A;  4S04 A;  2VBZ A;  1U2W A;  1J5Y A;  5ICC A;  1SFE A;  3FX3 A;  2CWE A;  3W6J B;  2ZME A;  4ZYG A;  1WSU A;  5BMZ A;  5FGM A;  5LEK A;  4EJV A;  1IZ1 A;  2J5O A;  1FBQ A;  1IN8 A;  1LJ9 A;  4RAY A;  1FSH A;  3N97 A;  4XSZ F;  1D5V A;  2HQR A;  5CVV A;  2BYV E;  2CSO A;  3GUD A;  4MTD A;  3T8T A;  4FX4 A;  1I6X A;  3DXJ F;  5JFR A;  2VC0 A;  3ZP5 A;  4U7B A;  3GO5 A;  5E20 A;  2V6C A;  1SD5 A;  1KQ9 A;  1L0O C;  5TJJ A;  1YS6 A;  1HW5 A;  1FYM A;  2M5W A;  3LQQ A;  4Z2Y A;  4RAZ A;  3SZP A;  1IAW A;  1OKR A;  3I53 A;  3FM5 A;  3Q9S A;  5BS6 A;  2CYY A;  4AD9 A;  2RKH A;  5K1Y A;  2OQR A;  1MD0 A;  1F1Z A;  3MWM A;  2M30 A;  4A0Y A;  1A04 A;  1ZLJ A;  2XAJ A;  1ZRD A;  3NQO A;  1ZYR F;  3L7W A;  2GZW A;  5LGU A;  3J80 K;  1XSD A;  2PN6 A;  1ON1 A;  3ABT A;  1B9N A;  1TW2 A;  4EM0 B;  2O8X A;  5FFZ A;  4BNC A;  3CLO A;  5F6F A;  2VON A;  3ML6 A;  2VBX A;  1KYZ A;  3I59 A;  1QZY A;  2FE3 A;  3E6D A;  5K5O A;  2FA5 A;  1IUY A;  2V1D A;  5L3E A;  4HV5 A;  1XGO A;  1K78 A;  3PFI A;  3TQN A;  1PUE E;  5BPD A;  4XSX F;  4P5O A;  2EWN A;  3HSR A;  5K5Q A;  3K9T A;  3P9K A;  2JT1 A;  1AWC A;  4KMF A;  4WWC A;  4UHT A;  3ERE D;  4EJO A;  5D5U B;  2VC1 A;  3PQJ A;  5AON A;  4AVP A;  4HF1 A;  4RS8 A;  2JZY A;  4LB6 B;  4B8X A;  2ESN A;  5HDK A;  2G9W A;  5FLX K;  1J59 A;  5D8L B;  1ONV A;  3C7J A;  1L3L A;  1G3Y A;  1TW3 A;  2K02 A;  2QQA A;  1GXP A;  2DW4 A;  2GIV A;  3CTA A;  3LAP A;  3BJO A;  5LGN A;  3N4M A;  1PP7 U;  1FP1 D;  5DCM B;  3KCC A;  5ILS A;  4XLN F;  4UV9 A;  4XLP F;  4G6D A;  2L3D A;  2L02 A;  1H9G A;  3GX4 X;  1XB4 A;  1B4A A;  2M45 A;  5AIP A;  3F8F A;  2HGC A;  1R22 A;  1QNT A;  1TNT A;  2W84 A;  3F3X A;  1Z91 A;  3SZT A;  4GYG A;  2KJB A;  3MZY A;  3AAF A;  1T6S A;  2A61 A;  4PCQ A;  1UHW A;  1BI0 A;  4R8H A;  5IT9 Z;  3J81 Z;  1K6O A;  1ZGA A;  3HHH A;  2RGV A;  3M7G A;  5HS9 A;  5LHH A;  1V3F A;  5JHU A;  3V8K A;  1P92 A;  1LEB A;  1SMY F;  4G8X A;  4RB0 A;  4MEX F;  4L9J A;  3CO7 C;  1YYV A;  3TO7 A;  3LA7 A;  1JHF A;  5HLH A;  3IRQ A;  3M1E A;  3HSF A;  1OYW A;  5DUI A;  3P9I A;  2CO5 A;  4O3M A;  5D5V B;  2JPC A;  3DP7 A;  4YII A;  3KLN A;  3EQL F;  1SD4 A;  5HVQ C;  3K2Z A;  3E6B A;  5TRD A;  2W85 A;  4Q4Z F;  3FXQ A;  4UXN A;  3HOT A;  2HTJ A;  3D5L A;  1BC8 C;  1ZLK A;  4TV7 A;  3RTR A;  1KU7 A;  2X4H A;  2PJP A;  2KJC A;  1FWZ A;  4OIP F;  5BOX A;  1X3U A;  1XD7 A;  4GCV A;  2VOP A;  4ASN A;  3M8E A;  3ROU A;  1D8J A;  4M73 A;  4KFC A;  2PI0 A;  5D8K B;  4CO8 A;  4Q47 A;  3ZPL A;  4RB2 C;  3KLO A;  4PDK A;  1Q1H A;  4IJA A;  4ZH4 F;  4FHT A;  4U0V A;  4G7H F;  3KP4 A;  5LEJ A;  4EMS A;  2MA3 A;  1UST A;  3RPQ A;  1Y0U A;  3DV8 A;  4G9Y A;  2HYF A;  4JBA A;  4DNC A;  4RGS A;  1ZG5 A;  3GZ6 A;  5D4R A;  2XVC A;  4I0B A;  4CYD A;  4L18 B;  1FY7 A;  4CDG A;  5EEG A;  2EFO A;  2W57 A;  4ZYH A;  1BOA A;  1BI3 A;  5HS7 A;  2IPQ X;  3G73 A;  2XAF A;  4P55 A;  2WTE A;  2XRO A;  1XCB A;  4JK1 X;  4KIG A;  1Z05 A;  5HOO A;  4IXA A;  2HR3 A;  2QBY B;  4G7O F;  1E2X A;  5L3G A;  2DK5 A;  3KET A;  2H27 A;  3RYP A;  3LST A;  4UVC A;  1J9I A;  1J7K A;  2LSO A;  5ICE A;  4HZF A;  1LVA A;  2EFQ A;  1CF7 B;  1F9N A;  2RVC A;  4BH9 A;  2L01 A;  3E6M A;  1OMI A;  4M6X A;  2EB7 A;  3DPT A;  5E1Z B;  3RJP A;  5EEH A;  5E1X A;  2MLG A;  4OOI A;  4CIC A;  3MEX A;  1R1U A;  2QQB A;  4IVN A;  1KQ0 A;  3DKW A;  1ZG3 A;  4R79 A;  1LQ1 A;  1ZHF A;  2A07 F;  3ZMS A;  4UNO A;  4L9N A;  3GFM A;  4LG0 A;  2Q0O A;  1IXR C;  3HUG A;  2IJL A;  3FWE A;  1GHC A;  2GXG A;  1NHA A;  3LQR A;  3M9A A;  5HLI A;  2P7V B;  3ELK A;  4BAY A;  1XCV A;  1KGS A;  4HF0 A;  3V8J A;  4OIR F;  4HW0 A;  5FO5 A;  3E3V A;  2Z9O A;  5AIQ A;  1R1T A;  2CG4 A;  2P6S A;  3KP5 A;  2GQQ A;  4YFK F;  1OYY A;  3REO A;  3DEU A;  3I5U A;  1SD7 A;  4N9H A;  3F72 A;  2NRA C;  4I01 A;  2C6Y A;  3EYI A;  3CUQ B;  2ZJ2 A;  1P2F A;  3F8C A;  2EFN A;  3LFK A;  4L0Z B;  2ZNZ A;  2WC2 A;  5ILU A;  2HWV A;  3I58 A;  1WKM A;  1AOY A;  1MGT A;  2F5D A;  2YR2 A;  6PAX A;  2MC3 A;  1XGS A;  2DU9 A;  2STW A;  2DQL A;  5A2Q K;  2YX4 A;  2IVM A;  4EQQ A;  5KK1 A;  3F8B A;  2O61 A;  1R7J A;  2VBW A;  4LD5 A;  4O6J A;  4NHJ A;  4ENJ A;  4I02 A;  2ZFW A;  2V9V A;  3ZN0 A;  4BQA A;  3KFW X;  3E5Q A;  1RZ4 A;  1LDJ A;  2LNB A;  2QVO A;  1MDM A;  3R0J A;  2CW0 F;  2QEN A;  2LF8 A;  3TOB A;  1JGS A;  2PBI A;  3F8N A;  4Y17 A;  2Z5U A;  4WXD A;  1O3Q A;  5DEQ A;  4M9Z A;  4BHP A;  5LLQ A;  3ZMV A;  3M8F A;  3RKX A;  1HXD A;  5DD8 A;  1QGP A;  4HX8 A;  2DTR A;  3IKT A;  3JAM Z;  1Z6T A;  2F5E A;  4RGU A;  3WE2 A;  3RI4 A;  2JPB A;  5D5X B;  2QWW A;  3R4K A;  3FXR A;  1IN5 A;  3ZMD A;  2FNP A;  2NAZ A;  2K86 A;  4LLG F;  1U5T B;  5ICF A;  1FSE A;  2VT3 A;  4HQM A;  3U2R A;  3LAJ A;  2R7F A;  1YG2 A;  3KZY A;  2FXA A;  2ZBK A;  3K69 A;  2D2W A;  2ETH A;  2RQP A;  2ELH A;  2JTV A;  3HIF A;  3V7C A;  5ERI A;  1R5G A;  1YW7 A;  1IW7 F;  3ZMU A;  5ED4 A;  2O0Y A;  1U78 A;  2K4B A;  5D6F A;  2FF4 A;  3HYI A;  1WRJ A;  1WWX A;  2OU2 A;  2XKP A;  4OIQ F;  4WF2 A;  5BQT A;  3GW2 A;  3IWF A;  2DPU A;  1O3S A;  4M9S A;  4L9V A;  3V7R A;  2EV5 A;  1OYI A;  1S7A A;  3KEQ A;  5L3C A;  2KIM A;  2VOD A;  1P4A A;  2PQ8 A;  3C3W A;  5FD5 A;  3GFJ A;  3VOE A;  3TDZ C;  2QQ9 A;  3H92 A;  5E8G A;  2PFB A;  1BBY A;  1TNS A;  3WTY C;  2IRF G;  2CGP A;  4IRG A;  1W7P A;  4XRF A;  1O3T A;  4ZZL A;  4Y15 A;  2DAO A;  3RKY A;  3MZH A;  2XRN A;  4KN4 X;  1BN5 A;  1RUN A;  1UB9 A;  4ETS A;  3WTS C;  3R0A A;  4U88 A;  1Z7U A;  1QO0 D;  3VEP A;  1B9M A;  2DQR A;  4KYW A;  4N0B A;  2RNJ A;  4EVI A;  3BPV A;  1XGN A;  3WTZ A;  2EV6 A;  4IHS A;  4EM1 A;  1KU3 A;  4RB1 A;  2NNY A;  3WG9 A;  1XGM A;  2XHK A;  3ZMT A;  2P8T A;  4U7D A;  3GYH X;  1KU2 A;  3DF8 A;  4HQE A;  2E1C A;  1LDD A;  2RC4 A;  2DO7 A;  2VT2 A;  3HSE A;  1C0W A;  2HS5 A;  2KIF A;  4BHC A;  3D0S A;  1FP2 A;  1HBX G;  4A0Z A;  3I4P A;  4BXU A;  3GXO A;  1P4W A;  3ECH A;  5FB2 A;  3QOP A;  1T39 A;  2AS5 F;  3FMR A;  2D1H A;  2ISY A;  1MZB A;  5LBQ A;  5E18 F;  1RI7 A;  3U1D A;  1MJ9 A;  5BPI A;  4I2O A;  5L3B A;  2FQ3 A;  3GLX A;  2LF7 A;  2ISZ A;  4S05 A;  3BJA A;  2EJR A;  3E5X A;  3L09 A;  1I27 A;  3GVA A;  3C18 A;  4MQ9 F;  2HTS A;  2X0L A;  5IT9 K;  2NNN A;  3J81 K;  2Y0M A;  1XDU A;  2P5K A;  2PMU A;  2DPD A;  1XSX A;  4A0X A;  5CVU A;  4A6E A;  4HOB A;  3G3Z A;  3T0Y A;  2Y75 A;  1FLI A;  2H6B A;  1UHM A;  3C1D A;  5ILV A;  4GO1 A;  5JVT A;  2ZME B;  2OZU A;  4D0P A;  2V79 A;  3WTX C;  3KZZ A;  5HS8 A;  4CXF A;  3V8L A;  2UZK A;  3TO9 A;  3GFI A;  2XAH A;  2D45 A;  2A3S A;  2DI3 A;  5LRR A;  2PG4 A;  3QAH A;  5KVR A;  5J8C A;  1D8K A;  5CYV A;  1P6R A;  1USS A;  1ZGJ A;  2Q2E A;  4B09 A;  1IF1 A;  1R58 A;  2FSW A;  1T38 A;  3L00 A;  1FC3 A;  3I71 A;  5DV5 A;  2MH9 A;  3MCZ A;  4WK8 F;  1RUO A;  2EA4 A;  3ISP A;  3HRU A;  2GXB A;  1IRF A;  3VFZ A;  1H0M A;  3K1N A;  2HOE A;  4GYI A;  3PQK A;  1IN7 A;  1O7F A;  2JSC A;  1GVJ A;  1DP7 P;  3IHU A;  2QZ8 A;  1TTY A;  2A5Y B;  2MD5 A;  2MH2 A;  4HX7 A;  4A5N A;  4HDV A;  2XUB A;  3V7S A;  1DPR A;  1ZRE A;  3BOQ A;  2A69 F;  4HA8 A;  2A6H F;  4IRI A;  4ESJ A;  4P9U A;  2TDX A;  1YW9 A;  4EJU A;  4MHG A;  1DUX C;  1T98 A;  1Z6R A;  1ZN2 A;  2UXN A;  4G94 A;  3VOD A;  4I98 B;  1IN6 A;  3F6V A;  4M74 A;  3SFZ A;  3WTW C;  3FMS A;  4YIF A;  1XSV A;  3QPH A;  2L4A A;  1R5H A;  2HZT A;  4BYY A;  3QPT A;  1R36 A;  2QM3 A;  2XAQ A;  3T5X A;  3WTT C;  2YSR A;  3IRR A;  3SHF A;  4HF2 A;  2FML A;  2K27 A;  3SQN A;  5DYM A;  3RIR A;  4LMY A;  3I0T A;  4QWQ A;  3K0L A;  3I64 A;  3E6C C;  3I59 B;  1Z9C A;  1BIB A;  4Y13 A;  1K78 B;  1XMK A;  2PLY A;  5H6Q A;  4I0A A;  3VB2 A;  4OIO F;  3OOP A;  1OPC A;  1LDK B;  1RIO H;  1STZ A;  3QU3 A;  4HDU A;  1QBJ A;  1BI1 A;  4GXO A;  1O3R A;  1HKS A;  2K4J A;  1FX7 A;  1T0F A;  1S8N A;  4U0Y A;  1YS7 A;  4NQW A;  3ZMZ A;  1QQI A;  2Z33 A;  1IXC A;  1YTY A;  4KA4 A;  2HKX A;  3BP8 A;  2BGC A;  2HDC A;  4ENK A;  1D3Y A;  2E7X A;  4ENN A;  2M8E A;  2KRF A;  4KIC A;  3BWG A;  1SAX A;  2VE8 A;  1B6A A;  1WQ2 A;  4PZJ A;  5DCM A;  4UVB A;  2OAZ A;  1MJB A;  2ADU A;  2IP2 A;  2W25 A;  4CHU A;  1PP8 F;  2QLZ A;  4P9F A;  2M87 A;  4CGZ A;  4GGG A;  1JHH A;  5J8F A;  3GF2 A;  3CUQ C;  5CLS A;  4JQF A;  3BDD A;  2HFH A;  1P4X A;  1XMA A;  2XIG A;  3HRM A;  1FYL A;  4DQ2 A;  2G7H A;  1BC7 C;  3TKY A;  4R1H A;  1BJA A;  1K79 A;  4Q48 A;  3JSO A;  1HSJ A;  2Q8K A;  2PMH A;  3GEZ A;  1WI9 A;  2H09 A;  1G3T A;  1RNL A;  2UXX A;  4ZZD A;  5DUK A;  1HKT A;  1VTN C;  1Z1D A;  4F7Z A;  4IF4 A;  5FD6 A;  4MTE A;  5HDN A;  1HQC A;  3WU0 A;  2WV0 A;  2FOK A;  1U8R A;  2XKO A;  3K1M A;  2P5L C;  4RGX A;  3JSP A;  5JI6 A;  3R61 A;  2ZCW A;  1F4K A;  4ESF A;  4K2E A;  4KNY A;  4WXH A;  2HKO A;  3RYR A;  2BE5 F;  4HLX A;  1ODD A;  1G4D A;  3WOD F;  3LA3 A;  3RDI A;  3F22 A;  3HHG A;  5DCF A;  2P4W A;  1G6N A;  1ZRF A;  2XAS A;  3JW4 A;  2WWY A;  1T2K A;  1YQA A;  4KIF A;  3O6B B;  2E7W A;  1U5T C;  4HBL A;  1TQP A;  1I1G A;  3BY6 A;  3BPX A;  2A6E F;  1IRG A;  4M9X A;  2YU3 A;  4BHB A;  2Z99 A;  5FFX A;  3BJ6 A;  5D4S A;  3RPU A;  4HYE A;  1S7O A;  3J80 Z;  3R6S A;  1J2X A;  1I5Z A;  3JAM K;  2V1X A;  2NYX A;  1EH7 A;  3GWZ A;  4LK1 F;  1BM9 A;  3F21 A;  3IKV A;  2P7C B;  1ZAO A;  1IXS B;  2J5P A;  4M6Y A;  5IT3 A;  3CO6 C;  5CJ9 A;  3K1P A;  2RV8 A;  2XGX A;  4L9T A;  2NS0 A;  2H6C A;  2VE9 A;  2CFX A;  4H0E A;  5E1W A;  1OR7 A;  2OQG A;  3DQV C;  3F23 A;  2PEX A;  2F2E A;  5CVJ A;  2QBY A;  3Q5F A;  3QU6 A;  5DDG A;  3KP6 A;  1PDN C;  1FOK A;  1DPU A;  1E17 A;  3O3K A;  4KN7 X;  2KKO A;  5LRS A;  2FBI A;  2FBK A;  4FT8 A;  4LFU A;  4LB5 A;  4RB3 C;  1KQ8 A;  3ZQ7 A;  1CF7 A;  4YG2 F;  3WTU C;  1S6L A;  4I7H A;  3FMQ A;  5FLX Z;  5D6E A;  4ZYE A;  2OD5 A;  1W4M A;  4AIH A;  4L5I A;  3DPL C;  2STT A;  2KIU A;  3S2W A;  1ZH5 A;  4HAM A;  4YFN F;  4AWX B;  4LG0 B;  4MGR A;  1G3W A;  2XV4 S;  2DLL A;  3F8M A;  2YX7 A;  3BRO A;  2E1N A;  1HST A;  3EDP A;  5E17 F;  3TOA A;  2Y48 A;  3HTS B;  2Z3Y A;  2RDP A;  3TDU C;  2DT5 A;  2MLK A;  2DFI A;  1BIA A;  4LLL A;  1REP C;  2FNA A;  1O7L A;  3CUO A;  3R60 A;  4AIK A;  3KP7 A;  4A5M A;  4LJZ F;  2P5V A;  3EYY A;  1YIO A;  2F5C A;  4ZYD A;  2YPR A;  3KP2 A;  4OMY A;  2P6T A;  2O03 A;  2EK5 A;  3BZ6 A;  3EET A;  1YLF A;  2F5F A;  1W5T A;  3WGH A;  1QZZ A;  4EGZ A;  3QP6 A;  3E97 A;  5K5R A;  5HDG A;  4A6D A;  3RKW A;  4WX9 A;  3I54 A;  1FNN A;  3CUQ A;  5DD4 A;  2UWM A;  3U9G A;  5L3D A;  1R1V A;  2CQK A;  2V1U A;  2ZKZ A;  3IL2 A;  2GA1 A;  2LDU A;  2LKP A;  3MQ0 A;  1SFX A;  1H9T A;  3H3Z A;  2BV6 A;  3QP5 A;  5CVI A;  5J6X A;  2RN7 A;  4EGY A;  4ENM A;  3JTH A;  1MDM B;  1ULY A;  2OZ6 A;  1QPM A;  4IHT A;  3WTV C;  1R00 A;  1O57 A;  2BEO A;  3TGN A;  4MNU A;  2ACJ A;  3B02 A;  5LHG A;  1MJA A;  1DDN A;  2ESH A;  3V4G A;  3KE2 A;  2L54 A;  4OIN F;  1XDS A;  2GWR A;  1B1B A;  4I09 A;  2FRH A;  4AIJ A;  3HRS A;  1FBS A;  4P96 A;  2OBP A;  2IW5 A;  4E70 A;  3H3U A;  4N9I A;  2VXZ A;  1ZAR A;  2QYO A;  2M1B A;  1FZP B;  1LNW A;  1W5S A;  2O6G E;  1KU9 A;  4EJW A;  2IA0 A;  3P9C A;  3T1B A;  4FX0 A;  1LB2 A;  1UCR A;  5ICG A;  2HQN A;  3NRV A;  3F6O A;  3CDH A;  2B0L A;  4ON0 A;  3DFG A;  4OU0 A;  2L4M A;  1ZRC A;  1BI2 A;  1U5T A;  5HLG A;  2IT0 A;  4EJT A;  4RGR A;  3HTU A;  1B59 A;  4IPA A;  1KYW A;  3WE3 A;  1J75 A;  2EV0 A;  3FF5 A;  5D5W B;  4L5J A;  1W7P D;  1K7A A;  2W24 A;  3SXY A;  4PGH A;  3FM3 A;  5H6R A;  4A2U A;  3TO6 A;  4HLY A;  2BBY A;  4A12 A;  1S29 A;  2QUF A;  1GXQ A;  2DK8 A;  4MQV A;  2FMY A;  3KEO A;  1F5T A;  2COM A;  3CJN A;  2EFP A;  2GA2 A;  1J0R A;  2H94 A;  3O2P E;  3MFK A;  1SFU A;  1TQI A;  2G7U A;  4LLN A;  1U3E M;  3COA C;  3KP3 A;  2R7D A;  5L3F A;  2HEO A;  2ZXJ A;  3GZ5 A;  4WXC A;  2DBB A;  1FBU A;  4UV8 A;  4CZZ A;  4KMU X;  3Q9V A;  1FYK A;  3EUH A;  1W7P B;  3IWZ A;  4LGW A;  2AXL A;  5F64 A;  1FT9 A;  1EV7 A;  2XAG A;  1JXS A;  3GFL A;  4KT5 C;  1JE8 A;  1TLH B;  4LK0 F;  1EH8 A;  3LA2 A;  4G7Z F;  1XN7 A;  2VBY A;  4HX4 A;  2EFW A;  3OV8 A;  3LWF A;  3MAJ A;  3P7N A;  5JR3 A;  5CVR A;  5LGT A;  3ABU A;  3T8R A;  4HV6 A;  4IRH A;  2VN2 A;  4KUM A;  4XBF A;  4ESB A;  3QRF F;  1MKM A;  1YW8 A;  2GAU A;  3WU1 B;  2FEZ A;  1ZG1 A;  3E5U A;  5F1R A;  1IN4 A;  2JRT A;  4NB5 A;  4UVA A;  3FZV A;  1U6G A;  3ZN1 A;  2R3S A;  1S3J A;  4Q5S F;  5A2Q Z;  1SD6 A;  4YFX F;  4G6Q A;  1HW1 A;  3JTG A;  3HRT A;  2ZO4 A;  1TQM A;  2IA2 A;  1HKQ A;  1HW2 A;  2D1V A;  1YO5 C;  2OA4 A;  1FPQ A;  2ZNY A;  1TBX A;  3J7A O;  1KA8 A;  2A68 F;  5LHI A;  2HYG D;  2K7L A;  3FXU A;  4KDP A;  1R23 A;  4OMZ A;  1CGP A;  2IA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...