4AWXB

Moonlighting functions of feoc in the regulation of ferrous iron transport in feo
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
63
Chain Sequence
b'PLGSMASLMEVRDMLALQGRMEAKQLSARLQTPQPLIDAMLERMEAMGKVVRISEQEWWALRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERROUS IRON TRANSPORT PROTEIN B
publication title Crystal Structure of the Klebsiella Pneumoniae Nfeob/Feoc Complex and Roles of Feoc in Regulation of Fe2+ Transport by the Bacterial Feo System.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Metal transport
total genus 17
structure length 63
sequence length 84
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09012 FeoC FeoC like transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4awxB00
3KP7A 3PQJA 3K0LA 1IW7F 2RC4A 4A6DA 2DLLA 1ZRDA 1FOKA 1ZGAA 2D1VA 3TDZC 3WTVC 2LNBA 2CSOA 4HAMA 5DD8A 3DPLC 4YIIA 1FZPB 1ON1A 3FZVA 2P4WA 3NRVA 3HRUA 4M6XA 1K78B 3WGIA 4AIHA 3O3KA 2NYXA 2XGXA 1I1GA 4L0ZB 3WTWC 1ZG1A 1TQIA 4BHPA 1RI7A 2DW4A 1HW1A 3HRSA 3WE2A 5L3BA 2DI3A 1MDMB 4Y17A 3FF5A 5LBQA 3WTXC 1J75A 2VT3A 3ISPA 5JHUA 2ACJA 2ZO4A 2FNPA 4ENJA 1W7PA 4NB5A 3VODA 1K6OA 3KE2A 3BPXA 2L02A 2OAZA 1TW2A 1KU9A 4HV6A 4L9NA 3HUGA 2PMHA 2HWVA 4HX7A 4HW0A 1FY7A 2GIVA 1FP2A 2RQPA 2TDXA 4R1HA 3IWFA 5E8IA 5F6FA 3WGGA 2LF7A 4OMZA 3HOSA 4BHBA 3I59A 2L4AA 1KU7A 4Y15A 3M8FA 3HSRA 2NNNA 1KGSA 4HQEA 1V3FA 3O6BB 1T0FA 1W5TA 1T2KA 2IVMA 3RTRA 1KQ9A 5L3FA 2IPQX 5FD5A 5BMZA 1YW9A 2FBHA 2OD5A 2IT0A 2XROA 4UV9A 4G7HF 1XMKA 5D8KB 3P9CA 1T98A 2NNYA 4ENNA 1BI1A 4BAYA 3F21A 4HF2A 4LFUA 2FBKA 2FXAA 3HHHA 1YFHA 1IXSB 2A6EF 5J8CA 4L18B 5J6XA 3KP2A 3B02A 3HHGA 3GFLA 4KN4X 2EK5A 4G94A 3GUDA 4RGXA 3OOPA 4MTEA 1AOYA 1ONVA 3VB2A 4BH9A 2MA3A 4S05A 4Z2YA 2VBYA 4MQVA 1Z1DA 2O0YA 5LHHA 4FX0A 5LLQA 2OA4A 4ZH4F 4GYIA 1LB2A 2FF4A 4ZZLA 4WXDA 3KEOA 4EJVA 3LA2A 4BHCA 4HZFA 1P92A 4ZYHA 2HYGD 4I0AA 1J59A 4EVIA 2E7XA 4Q5SF 1JE8A 3LSTA 4MEYF 3RJPA 3V8KA 4YFXF 2VE8A 4ESFA 2O3FA 5DCFA 2V6CA 5HS7A 2PBIA 1E17A 3FWEA 5J8FA 4P9FA 3WTUC 5D6EA 3W6JB 2DTRA 4OIRF 1ODDA 2JT1A 3DP7A 5LRRA 2QBYB 2HKOA 2E1CA 4HX4A 4MGRA 3I4PA 2PLYA 2EA4A 5AIQA 2DPUA 5HS8A 2Y75A 1BIAA 1USSA 2JTVA 1U5TB 4EM1A 1YS7A 1STZA 3IKVA 4OIQF 1IZ1A 2F5EA 3BY6A 3L9FA 1IN8A 4I02A 4RB1A 4I98B 5HS9A 3IKTA 5HLIA 5E1XA 3REOA 4G9YA 2XASA 2P6TA 1T6SA 3M9AA 3WTSC 2KIUA 4UVCA 3GVAA 1KYZA 1O3QA 2IA2A 2RN7A 1IUYA 1LQ1A 2H94A 1FSEA 2ZBKA 3I58A 1KQ0A 2HOEA 4EGZA 1ON2A 3CUQB 4L5JA 4RB2C 5JR3A 1LDDA 4A0ZA 1XGOA 2LDUA 2MH9A 5DEQA 1R58A 3IRQA 2A68F 2DPDA 1IN5A 3KCCA 1MJ9A 3MZHA 4EQQA 3IHUA 2QENA 3QU3A 2IP2A 1YW8A 5ICGA 2HTSA 3AAFA 2W57A 2ZNYA 2KKOA 3SHFA 2H27A 2ZMEB 3TGNA 4CICA 2VC1A 4I2OA 3SXYA 3CUQC 1YQAA 2XAJA 1IXRC 4ZYEA 1XGSA 2OQRA 3EYIA 3C1DA 2P7VB 4WXHA 3P7NA 4LG0B 4AD9A 4MHGA 1LDKB 4ON0A 4RGSA 4O6JA 3F8MA 4U88A 1GXPA 2F5FA 2AS5F 1T39A 4RAZA 2YX4A 3NQOA 3T0YA 2VBXA 1OPCA 2Q0OA 3GWZA 1SD4A 4KIGA 4E70A 5E17F 1HQCA 2FOKA 1R5HA 4RAYA 5BPIA 2KJCA 4RS8A 1D8JA 1F1ZA 3I0TA 1R22A 1H9TA 1XSVA 3IL2A 1SFUA 5ERIA 4JQFA 2XKPA 1BN5A 1UCRA 1FLIA 5D6FA 4Y13A 1ZHFA 1PP8F 4EM0B 1SFXA 3QPTA 2FNAA 3MEXA 4CXFA 3K1MA 2M5WA 4A2UA 2GA1A 1KYWA 2Y48A 3ULQB 3ZPLA 4KMUX 3QP6A 4I0BA 1YTYA 1S7OA 3I53A 2COMA 4M9XA 1V4RA 1ZRFA 2G7HA 4XLPF 4O5VA 1F4KA 1K78A 1QZZA 1TNSA 2HYFA 4OMYA 3LFKA 3KEQA 3K2ZA 4LLGF 2LF8A 3DEUA 4BQAA 4U7DA 2JRTA 2A6HF 4XLNF 1P2FA 3ZMTA 3F8BA 2HFHA 1XGNA 3GEZA 1BIBA 5LGUA 4CYDA 1MDMA 2GZWA 4KIFA 4WWCA 4MTDA 3FXUA 1IRGA 1ZG5A 1I6XA 1R7JA 1F5TA 1U2WA 1LEAA 3L2CA 2V1XA 5BPDA 4F7ZA 4A0XA 3DFGA 1ZGJA 5D4RA 1TBXA 4CO8A 1WI9A 3KLNA 5DCMB 3ECOA 3EETA 4A5MA 1BI3A 3R61A 4BNCA 4EV0A 1MD0A 2HR3A 3GW2A 1QGPA 1KU2A 2FMYA 4UHTA 4IHSA 1FX7A 4EM2A 2A61A 3MWMA 1ZN2A 2HEOA 3L00A 4M6YA 2M87A 1CF7A 2A07F 3BJAA 4LB6B 4N9HA 4XRFA 1SMYF 4KNYA 1ULYA 4UNOA 2ZJ2A 3WE3A 1HKQA 1BC8C 2ZKZA 3CUOA 3JSOA 5L3EA 1LEBA 5CVJA 5ICFA 4IRHA 2QLZA 4LJZF 1KQ8A 3ZMDA 5LEKA 1OMIA 4ESJA 1MKMA 5F1RA 1DDNA 5LGTA 4WF2A 4EGYA 1ZH5A 1GXQA 3ZN1A 5FO5A 1P4AA 3LQQA 1O3SA 4ETSA 1G3TA 1BI0A 3V7CA 1JGSA 2Z5UA 3KZYA 2ISYA 5CVRA 1B59A 1Z91A 1TLHB 3TOAA 2W85A 1P4XA 1O7LA 2MH2A 2OZ6A 4LLLA 4KMFA 3F8FA 1TW3A 2MD5A 5ICEA 3KP4A 1KU3A 3CJNA 3CO7C 2K4BA 3MZYA 4L9VA 2CO5A 3LAPA 4IPAA 2MLKA 3TDUC 1JHFA 2X0LA 1OYWA 4BXUA 3SFZA 2FQ3A 4RB3C 2NRAC 3FHZA 1S3JA 4HA8A 3WU1B 3R0JA 5FLXZ 1L3LA 3Q5FA 4Q47A 2H6BA 2FSWA 5HDGA 1Z6RA 2DQLA 4PZJA 1BM9A 5D5XB 3GXOA 1WKMA 2QQ9A 4HLYA 1SD6A 3J7AO 2GXGA 3M1EA 1BBYA 4A0YA 3F22A 3GF2A 5D5VB 3DXJF 4AWXB 2HGCA 2V9VA 3QRFF 4ZYGA 5D5UB 2D2WA 4ZZDA 5FLXK 3IRRA 3FM3A 3HSEA 3N97A 1GHCA 5LGNA 5EEHA 3D5LA 4P5OA 2EV6A 5D4SA 1IXCA 2IW5A 1YYVA 2XHKA 3GO5A 3HRMA 2ESNA 5DUIA 1O57A 3S2WA 3WG9A 4GXOA 1MJBA 2QM3A 4PCQA 4I7HA 2PG4A 2MC3A 1U5TA 2OU2A 2A3SA 1IAWA 1H0MA 1WSUA 3V7SA 3I71A 5D5WB 2FRHA 1I5ZA 2FBIA 3JTHA 2YSRA 1RNLA 4RGRA 1G4DA 2GA2A 3KFWX 4IRIA 2F5DA 3LA3A 4EJWA 2WTEA 1ZREA 1FNNA 3BZ6A 2VBZA 5E20A 4LGWA 3U1DA 3BPVA 2WC2A 3FM5A 3MFKA 1FP1D 3QOPA 2IA0A 5DDGA 1FYKA 4P96A 5LHGA 3GYHX 4KYWA 3ZMUA 4UVBA 3D0SA 2HS5A 2O6GE 1NHAA 3JW4A 1S29A 4LLNA 2ESHA 1R36A 3CTAA 1UFMA 2CGPA 4G6DA 2IJLA 2VOOA 5EEGA 2YX7A 5BOXA 2ZNZA 4EMSA 4YFKF 2DK8A 3GZ5A 4A6EA 5K1YA 2G7UA 1J7KA 4OOIA 1DP7P 4QLCU 4GGGA 2CWEA 2YPRA 3H3ZA 2GWRA 3RPQA 1SMTA 2Y0MA 2ZXJA 5H20A 5H6QA 4CGZA 1XCVA 3NEUA 1K7AA 1Q1HA 1IRFA 1X3UA 3ML6A 4KFCA 5E1WA 2QYOA 4N0BA 1BI2A 4FHTA 1OYIA 4AIJA 1OKRA 2A5YB 5AONA 1D5VA 1TQMA 1LVAA 3CLOA 5D8LB 1ZG3A 4KICA 4CDGA 1XD7A 2V1DA 2R7DA 1PDNC 1SFEA 4M9ZA 2XRNA 5IT3A 2L54A 1IN6A 2PI0A 2Z99A 2OZUA 1HKTA 3DKWA 1J9IA 1R00A 2FA5A 2KIMA 2XKOA 1FBUA 4KUMA 3RKYA 2H09A 4EJUA 2K27A 3VEPA 1QPMA 2PN6A 4HBLA 1IN7A 2ISZA 3ZMSA 3WTZA 2Z3YA 4HYEA 4MQ9F 1IF1A 2HZTA 2NAZA 1B4AA 3TQNA 2DFIA 2EA2A 1TQPA 2KJBA 3SQNA 3BOQA 2FMLA 2R3SA 2ZFWA 2K7LA 4KN7X 4KT5C 5ICCA 3L09A 3RYRA 3LQRA 5CVIA 1WRJA 4M9SA 1RIOH 4GCVA 1J2XA 3TO9A 3J81Z 3RKXA 3BP8A 5A2QZ 2OQGA 5L3GA 4XSXF 4UXNA 1EH6A 3TO6A 2G9WA 1YW7A 3V4GA 2F2EA 4L9JA 2DU9A 3F8NA 4EJOA 2RVCA 2WWYA 4QWQA 4PDKA 3H92A 5JFRA 3F3XA 5FFXA 1EH7A 1RUNA 3K69A 1W5SA 3J81K 3LAJA 5E18F 1UHMA 4OIPF 4G8XA 1YLFA 3F6VA 5A2QK 3O2PE 3QU6A 3BJ6A 1A04A 4ENMA 2P8TA 1ZARA 3KLOA 1SD7A 3DF8A 2K02A 5H6RA 2XVCA 1Z7UA 3BDDA 1YS6A 5F64A 5DV5A 2P7CB 4WXCA 1U78A 2XAHA 3KP5A 2UWMA 1U6GA 2JSCA 3V7RA 3T5XA 3C3WA 4MEXF 1QNTA 3I54A 4GO1A 4LD5A 1FYLA 2PQ8A 4JK1X 5BQTA 2ADUA 1U8RA 4A12A 2L3DA 2W24A 4Q4ZF 4KIBA 3V8JA 2VN2A 1J5YA 1KA8A 2P5KA 2ZCWA 2EFOA 2JZYA 3F8CA 2Z9OA 1ZLKA 1FBQA 2ELHA 5FGMA 3E6DA 2D1HA 3JSPA 4M72A 3EQLF 4IXAA 5HLGA 1G3YA 2CG4A 4CZZA 1R1VA 4ENKA 4DNCA 3E5UA 1EH8A 1IN4A 2NS0A 4WK8F 2RKHA 4OIOF 4UV8A 3GZ6A 5JI6A 5K5QA 1SD5A 4IF4A 3CDHA 2E7WA 4S04A 2QQAA 2RV8A 2LKPA 2UXXA 3B73A 1YG2A 3WTYC 2STTA 4U7BA 1ZLJA 3ECHA 1S6LA 4HDUA 1OYYA 2KIFA 4A5NA 2GXBA 5TJJA 5KK1A 1B6AA 5ED4A 2XIGA 2FE3A 3WODF 2Q2EA 2MLGA 1R5GA 5LRSA 1DPUA 3CO6C 2M8EA 1FSHA 2YR2A 3I5UA 2YU3A 1DPRA 4CHUA 3U2RA 3T8TA 2F5CA 1O3RA 2VT2A 1XMAA 4NHJA 4HDVA 3HTSB 3LA7A 1LJ9A 3M7GA 2XAGA 3ZN0A 1J0RA 2BE5F 2M30A 2P5VA 2A69F 1XSXA 4LK0F 6PAXA 2VBWA 3GX4X 4HX8A 4IHTA 4R79A 2HDCA 4OU0A 1XN7A 2O61A 1CGPA 2STWA 4ESBA 2GQQA 3J80Z 2L01A 1HW2A 3RI4A 3ABTA 5K5OA 1FT9A 3IWZA 1K79A 1SAXA 1FPQA 2BV6A 1HSTA 3TOBA 1W7PD 4UVAA 4U0WA 3L7WA 1R23A 1O3TA 5FD6A 4I01A 3V8LA 2D45A 4L9TA 1PUEE 4IRGA 2UZKA 3J80K 3F72A 2QQBA 4K2EA 5AIPA 1WQ2A 5L3DA 4G7ZF 2RNJA 3JAMZ 2W25A 2XV4S 1I27A 3G3ZA 2CYYA 4PGGA 1CF7B 2QWWA 4PGHA 2EFWA 2M1BA 1BOAA 3IC7A 3E5QA 2Z33A 1Y0UA 1VTNC 4D0PA 2VODA 4LB5A 3GFMA 5K5RA 2M45A 2O8XA 4ASNA 4N9IA 3KZZA 4LK1F 4G7OF 5ILVA 1F9NA 2QBYA 5TRDA 4L5IA 4H0EA 3JAMK 4TV7A 3HYIA 1B1BA 3MAJA 1W7PB 3I64A 2B0LA 1QO0D 5ILUA 1TNTA 1XCBA 1XB4A 1ZRCA 1T38A 1MZBA 3HOTA 1D8KA 5CLSA 1P4WA 3QAHA 2DO7A 5E1ZB 1FWZA 2XAFA 1Z6TA 3RDIA 4U0YA 3KETA 4KDPA 1PP7U 3KP3A 3I59B 2BYVE 2BGCA 1XDSA 4R8HA 5DUKA 1MGTA 3U9GA 2RDPA 4B8XA 2VONA 2W84A 5HOOA 3EYYA 1REPC 4ZYDA 4XBFA 3FXRA 5CJ9A 1YO5C 3BROA 2DAOA 2FU4A 1RZ4A 3HIFA 1HKSA 5IT9Z 3CUQA 3TKYA 1I1SA 2E1NA 4LMYA 2CW0F 3ZMVA 1O7FA 1P6RA 2WV0A 2HQRA 2HQNA 2GAUA 3N4MA 3K9TA 2EWNA 1XDUA 5CVVA 5DD4A 4B09A 2CQKA 2EJRA 1MJAA 3FMRA 2MBFA 3HTUA 3T1BA 3PFIA 3KP6A 5CYVA 2ZMEA 4WCGA 3ZMZA 3FXQA 2P5LC 4JBAA 4MNUA 5IT9K 2KRFA 2QZ8A 1QZYA 1USTA 4M73A 4AVPA 3TO7A 1XSDA 4IJAA 3R6SA 2DT5A 3QP5A 1ZYRF 4LG0A 4HV5A 2V79A 4RGUA 3E97A 2JPBA 2O03A 3HSFA 4DQ2A 3VOEA 5HLHA 3ZP5A 3RYPA 3SZTA 1W4MA 3WTTC 4BYYA 5CVUA 4HOBA 4WX9A 3LWFA 3P9KA 1FC3A 4NQWA 2JPCA 1U5TC 1QBJA 3RKWA 3ELKA 1B9NA 3FX3A 4P55A 1E2XA 2PJPA 2EFPA 2X4HA 1U3EM 2VXZA 3VFZA 1RUOA 1LNWA 1FBSA 2PMUA 3FMSA 3RPUA 2PEXA 4HLXA 2VC0A 2L4MA 3E3VA 2PFBA 5LHIA 1TTYA 5FB2A 1R1TA 2UXNA 1R1UA 3GFIA 3R4KA 3JTGA 5L3CA 4KA4A 3BJOA 3E6CC 4FX4A 4FT8A 2BEOA 2QUFA 3EUHA 4HF0A 4U0VA 2VOPA 2EFNA 5BS6A 3H3UA 3HRTA 2H6CA 2LSOA 1UHWA 1DUXC 2EFQA 1JHHA 3GFJA 2HKXA 1Z05A 1HBXG 5DYMA 3K1NA 2HTJA 3DPTA 4EJTA 4YIFA 3DV8A 2R7FA 1G6NA 2P6SA 1G3WA 3E6MA 3DQVC 1FYMA 1EV7A 2K86A 3K1PA 4Q48A 3BWGA 3FMQA 1Z9CA 1S8NA 1UB9A 5KVRA 4XSZF 2XUBA 1HSJA 2VE9A 4HQMA 2DK5A 3ZQ7A 2DQRA 1B9MA 2RGVA 5E8GA 2EV0A 1QQIA 2QVOA 3M8EA 3C7JA 2V1UA 3EDPA 3P9IA 5DCMA 4GYGA 4HF1A 3F23A 5HVQC 1JXSA 3PQKA 4I09A 1H9GA 3E6BA 5FFZA 3MCZA 1OR7A 4L0YB 2C6YA 2DBBA 2XAQA 4AIKA 3ABUA 3COAC 1AWCA 1G3SA 5ILSA 5HDKA 3SZPA 3OV8A 2OBPA 3QPHA 3WGHA 3ERED 3R0AA 2CFXA 2J5OA 1ZAOA 2ETHA 3ROUA 2IRFG 3E5XA 4RB0A 3F6OA 5LEJA 1YIOA 2J5PA 1C0WA 1WWXA 2K4JA 3GLXA 1L0OC 4OINF 1XGMA 2EB7A 2AXLA 3RIRA 4IVNA 1BC7C 1HW5A 1HXDA 1GVJA 4M71A 3R60A 5JVTA 4YFNF 1D3YA 3WU0A 3G73A 2Q8KA 2IA1A 4YG2F 4UUVA 3MQ0A 4O3MA 1LDJA 4P9UA 2FEZA 3C18A 1BJAA 3Q9VA 3Q9SA 2EV5A 3W6KB 5HDNA 1S7AA 4M74A 3T8RA 2BBYA 4G6QA
chains in the Genus database with same CATH superfamily
3KP7A 1JJ8C 1HDPA 3PQJA 3CZ6A 3K0LA 4X1EA 3W3CA 5EZGA 3CP8A 1IW7F 2RC4A 1AA7A 3ZQIA 4A6DA 2DLLA 1ZRDA 3BT9A 1FOKA 1ZGAA 2D1VA 1UJ8A 2EBIA 3TDZC 3C2BA 3WTVC 2LNBA 2XRLA 2CSOA 4HAMA 2YS9A 5DD8A 3DPLC 1S7EA 2LMDA 4YIIA 1FZPB 2E2IJ 1ON1A 3FZVA 1VQKI 1BA5A 3LOCA 3HG9A 4HNTA 2V9KA 2P4WA 3NRVA 3CDLA 3HRUA 1RETA 4M6XA 1K78B 3WGIA 4AIHA 2DFHA 2M4GA 3O3KA 2NYXA 4YIRX 2XGXA 2IGKA 3GMEA 2HYJA 1KZHA 1ETVA 2DMTA 4E7KA 2IS4A 2CH0A 2JVGA 1I1GA 2W00A 4L0ZB 3WTWC 3SFIA 1ZG1A 1I6HJ 2WAEA 2E1MC 1TQIA 2HQAA 2AQEA 1VI0A 2LKXA 4BHPA 4DJAA 3DCFA 2LBFB 1RI7A 1E3PA 4XR6A 2DW4A 1HW1A 1SEUA 3HRSA 4I76A 1DP3A 1N77A 3WE2A 5L3BA 2DI3A 3J7YJ 1MDMB 4Y17A 3E1SA 2BW3A 3ERMA 3FF5A 3CDIA 5LBQA 5C4JJ 2DYRH 3WTXC 4IX7A 1J75A 3DLLF 2VT3A 3ISPA 3Q0VA 2JSPA 5JHUA 2ACJA 1SC7A 2ZO4A 2FNPA 4ENJA 1W7PA 3QOEA 4NB5A 3CD6I 2WADA 3VODA 1R9TJ 1K6OA 3KE2A 1TWHJ 2ZJRF 3BPXA 3K4BA 2L02A 2OAZA 4XQFA 3DBRB 1TW2A 2EQRA 1KU9A 2W48A 3OYAA 1HA8A 4HV6A 3FK6A 2VQCA 4L9NA 3HUGA 2DA6A 2HWVA 2PMHA 4HX7A 4OAZA 4HW0A 2R7UA 5B3SH 3I4NJ 1FY7A 1BW5A 2GIVA 3QYFA 1FP2A 2RQPA 2TDXA 2LP0A 4R1HA 1Y56A 3IWFA 5E8IA 5F6FA 4BY7J 3WGGA 2LF7A 3CJRB 4OMZA 3HOSA 2Y0SA 4BHBA 2XSJC 3CLQA 3I59A 4E4HA 3I9V2 3K6GA 2L4AA 1KU7A 2CUZA 4Y15A 3M8FA 1VFCA 3HSRA 2CW7A 1H8AC 3O8HA 2Q2EB 2NNNA 3WHCA 1KGSA 1BR1A 4HQEA 1TWCJ 1V3FA 2MFZA 3O6BB 4ZTJA 2DFFA 1T0FA 1W5TA 1T2KA 1HOMA 1YJ9I 3OS0A 2IVMA 3RTRA 1KQ9A 5L3FA 2IPQX 1AKHA 5FD5A 2X1DA 4QSHA 1IG7A 2XGEA 3A01B 5BMZA 2QSFX 1YW9A 2FBHA 2OD5A 2IT0A 1ETKA 1VQ4I 4ANJA 2XROA 2CFOA 4UV9A 4G7HF 4MLOA 1XMKA 5D8KB 4A93J 3P9CA 3HOXJ 1Z3XA 2MW8A 1T98A 3ASNH 4PUSA 4IQ4A 2NNYA 4ENNA 1BI1A 1EKEA 4BAYA 3F21A 4HF2A 1MIJA 1X2NA 4LFUA 5F27A 1B8IA 4F52A 1WJAA 2FBKA 2EZLA 2FXAA 3SYTA 3HHHA 2E5ZA 2L9RA 4B3XA 1YFHA 1IXSB 2M34A 2A6EF 5J8CA 3W2AA 5JLXA 5J6XA 3KP2A 4L18B 1S5LC 3B02A 3HDDA 1OJLA 3HHGA 4XLEA 3WHBA 3GFLA 4E7JA 4KN4X 2EK5A 4G94A 3GUDA 4RGXA 3OOPA 1I3AA 1R4NB 4MTEA 2B63J 1AOYA 3SEQA 2QEXI 1RKWA 4XM3A 1ONVA 3K4MA 3VB2A 4BH9A 2MA3A 4S05A 1Q1VA 4Z2YA 1T33A 2VBYA 1VNDA 4MQVA 1Z1DA 3CCLI 1WJ5A 1TL8A 2O0YA 3B6CA 5LHHA 4FX0A 1D1BA 3PUFA 5LLQA 4GFBA 2R93J 3JRFA 2R7VA 2EZHA 2OA4A 4IKFA 3U1KA 4ZH4F 4GYIA 1W0TA 1LB2A 4XKWA 2FF4A 1JGGA 3OYIA 4ZZLA 4WXDA 3KEOA 4EJVA 2CV0A 2Y31A 3LA2A 2BHZA 2KMUA 3CC7I 3OYJA 2I8DA 4BHCA 4HZFA 3U21A 2R7SA 1P92A 1X2MA 3K10A 4ZYHA 3K70D 2HYGD 4I0AA 1J59A 1PUFB 3CJTB 1ERDA 3IV5A 3OS1A 3ZQQA 4Y52J 4EVIA 2JA2A 2E7XA 3J7AY 2HNHA 4CCMA 4Q5SF 4BQOA 4CCKA 1JE8A 3PL8A 5FJ8J 1ETOA 2M0CA 3FXMA 2GOMA 2L5QA 4N4OB 3CJQB 1IDZA 3LSTA 4MEYF 3RJPA 3V8KA 4YFXF 2VE8A 2ECCA 4ESFA 1WVRA 2O3FA 5DCFA 4UUSA 2V6CA 5KAFC 3CCRI 5HS7A 2KZGA 2PBIA 1E17A 3BCAA 3FWEA 5J8FA 4P9FA 1BR2A 3WTUC 5D6EA 4FCYA 1TC3C 3W6JB 2O9LA 4V2FA 2JQ7A 4YELA 1FMWA 2DTRA 4OIRF 4F91B 3M8JA 1ODDA 1VQPI 2JT1A 2XF5A 3DP7A 4CA0A 5LRRA 1DU6A 1UG0A 1CQTA 2QBYB 2HKOA 2R5ZB 2E1CA 4HX4A 4M3BA 2MYSA 4MGRA 1H89C 5CKTA 4XIDA 3I4PA 2PLYA 3H36A 1DU0A 2K85A 2EA4A 5AIQA 2NOGA 2DPUA 3FKJA 5HS8A 4DIQA 5CQEA 2Y75A 3AKZA 1BIAA 1USSA 2R7WA 2JTVA 1U5TB 4XOPA 4EM1A 1YS7A 2DJIA 2Y9YA 5IYBJ 3ABMH 3CESA 2CMPA 5EG0A 2ZB9A 3KZIC 1LE8A 1STZA 4A3FJ 3IKVA 4OIQF 5DM6F 1LFUP 1IZ1A 2WV1A 2F5EA 2CV1A 4IOCF 3BY6A 3RZDJ 3L9FA 1IN8A 4I02A 4E7HA 4RB1A 5J4YA 2A5WA 4QTRA 4I98B 1F36A 3AG2H 2V4JC 5HS9A 3IKTA 3ZR8X 5HLIA 5E1XA 1WJBA 2CU7A 5J1UA 1FOWA 3H35A 3REOA 1WHUA 2HXOA 1XMXA 4G9YA 4E6KG 3A4CA 3IUOA 2XASA 1V54H 2P6TA 1T6SA 5EGOA 3M9AA 4S0HB 2PJRA 3VYTB 3WTSC 4BACA 2KIUA 2A6TA 4UVCA 1XG1A 3GVAA 4RM3A 1KYZA 1O3QA 2F6CA 1N75A 2IA2A 3MKYB 2RN7A 1IUYA 2ZJPF 1RC9A 1LQ1A 3LNQA 1IV8A 1FSEA 2H94A 4ZDPA 5LFAA 2V7FA 5C3EJ 1MBJA 2ZBKA 1APLC 3OYMA 3I58A 1M1EB 1D5YA 1KQ0A 2HOEA 4EGZA 1ON2A 1SFOJ 3CUQB 2QSGX 2KL4A 4L5JA 4XN0A 4RB2C 5JR3A 3A0BC 1LDDA 4PJLA 4A0ZA 1XGOA 3H0DA 2LDUA 2MH9A 5DEQA 1R58A 3IRQA 2ZJQF 3LSMA 2CUFA 2A68F 2DPDA 3ONQA 1UZCA 1IN5A 3OYGA 3KCCA 1MJ9A 3MZHA 2R7ZJ 2VJ5A 3ABKH 2HVRA 4EQQA 3IHUA 4F55A 4BE0A 5FRNA 1RKTA 2QENA 2R0QC 3QU3A 2IP2A 1YW8A 5ICGA 2HTSA 3AAFA 2W57A 4B43A 1X1CA 4H4KC 2ZNYA 2KKOA 3SHFA 2H27A 2ZMEB 2E34A 2FD5A 3TGNA 1BW6A 1FTTA 4CICA 5JHFA 2VC1A 3HPHA 2M7BA 3MKLA 3SXYA 4I2OA 3CUQC 1I3QJ 1YQAA 2IS1A 2XAJA 4BKXA 1AHDP 1S9HA 1IXRC 4Y3OA 4ZYEA 5M5YJ 1OCOH 1XGSA 4YRVA 3S1RJ 2OQRA 3EYIA 3C1DA 4DZJA 2P7VB 4WXHA 3P7NA 4LG0B 4AD9A 1FOYA 3P5JA 4MHGA 1LDKB 4ON0A 2Y9ZA 3FXJA 4RGSA 3Q0UA 4O6JA 2TCTA 3F8MA 4U88A 4XRSG 1V5FA 4DBRA 2LLKA 1GXPA 2F5FA 3CC4I 2AS5F 1T39A 3K2AA 2ZMEC 3VYUB 4RAZA 3OIPA 3OYEA 4RLQA 2YX4A 4JX4A 2WBMA 3NQOA 5KNLA 3T0YA 2VBXA 4G12A 2WY8Q 5E3NA 3BR2A 3ESWB 2GIZA 4BXXJ 1Y0NA 1OPCA 4XNFA 1MNDA 2L9VA 2Q0OA 3GWZA 1SD4A 4KIGA 2MD0A 4NQWB 5IY5H 4E70A 5E17F 1HQCA 3HKZA 2FOKA 4CCNA 2DFEA 1R5HA 5FKOA 4RAYA 5BPIA 2A05A 2K9SA 2KJCA 2AXTC 4RS8A 1D8JA 2WA0A 3H5RA 1F1ZA 5GTIC 4IL6C 3I0TA 1R22A 1H9TA 3S1NJ 1XSVA 3IL2A 1SFUA 5ERIA 3HXLA 2OJED 4JQFA 2XKPA 3BQYA 3W2WA 1BN5A 2DODA 1UCRA 1FLIA 5D6FA 4P1WA 2FOWA 4Y13A 1ZHFA 2H8WA 2Y2ZA 3HEFA 4PJ0C 5J1YA 1PP8F 3CCYA 1B72A 4EM0B 4BJ5C 4E7LA 2JK3A 2L9SA 4EATA 1SFXA 3QPTA 2CQQA 2FNAA 3QODA 4NC7A 5F0FA 3MEXA 3K4JA 4CXFA 2E60A 1S72I 1Z21A 3K1MA 2M5WA 2WY7Q 4A2UA 3DLAA 2GA1A 4KT6A 3ABLH 3ZOBA 3FBIB 1KYWA 2Y48A 3KX2A 3ULQB 2KQRA 3ZPLA 3S2DJ 4KMUX 3QP6A 1OFCX 2MC4A 3BTLA 4I0BA 2WAFA 1YTYA 1EJ9A 1S7OA 3I53A 3D1NI 4IHWA 2COMA 4M9XA 1V4RA 5B1BH 2LY1A 1ZRFA 2G7HA 4XLPF 3CCMI 4O5VA 2K40A 2NOJB 3AFHA 1F4KA 1K78A 1MBEA 2R7RA 5B5EC 1QZZA 1TNSA 2HYFA 1QVUA 4OMYA 2JA7J 3LFKA 4J01A 4ZC3A 4E7IA 3BR1A 4MFDA 1RPWA 2ZSIB 2W7NA 1FEXA 3KEQA 1HC8A 3K2ZA 2JUGA 3EUHC 1MH4A 3CQZJ 4LLGF 3L2WA 2VJIA 2LBFA 4HNVA 2LF8A 3DEUA 4BQAA 4U7DA 1D1CA 2JRTA 2A6HF 4XLNF 1P2FA 3ZMTA 3F8BA 5IP7J 2HFHA 1XGNA 3GEZA 3PM1A 3S1MJ 1BIBA 3CCEI 2ME0A 5LGUA 4CYDA 5KHDA 1MDMA 2GZWA 4V2GA 4KIFA 1A5JA 2QQ8A 4WWCA 4ZTFA 2JN6A 3N05A 2VI6A 1K4TA 4MTDA 3QYEA 3FXUA 1IRGA 5KAIC 1EF4A 1ZG5A 1I6XA 3TW6A 4A3CJ 1R7JA 4XOTA 1F5TA 1U2WA 1Y8RB 1LEAA 2VKEA 4B47A 1IV6A 2FX0A 3L2CA 2V1XA 5BPDA 4F7ZA 4A0XA 3DFGA 1ZGJA 5IOYA 5D4RA 4DOZA 5F1JA 4RM2A 1TBXA 4CO8A 5J1RA 3RQ4A 3PNTA 1WI9A 3KLNA 4BDYA 2DTZA 2E1MB 5DCMB 3ECOA 2B7EA 4HEA2 3HOYJ 3EETA 4D5FA 2JVHA 4A5MA 1G59A 3V42A 4A3IJ 2HU9A 1LPQA 2LYCA 4XMYA 1BI3A 1HCRA 2XF6A 3R61A 4BNCA 3FK7A 5BNGA 4EV0A 2E36A 4B48A 1MD0A 5B66C 2EPFA 2HR3A 2DDAA 3OYCA 3GTPJ 3GW2A 4G6TB 4A3GJ 1QGPA 1KU2A 2HZDA 2FMYA 3GBGA 2DOEA 4UHTA 1YI2I 3TP3A 1R49A 2OF7A 2X9DA 3MKWB 3FBNB 3JRGA 4IHSA 1Y6IA 1FX7A 4EM2A 2A61A 3DEEA 3MWMA 1DGRM 3A2KA 1ZN2A 3S1QJ 2V1NA 1P7JA 1JT6A 4IHVA 3HBLA 2HEOA 5J3LA 2JWTA 3PIPF 2F5VA 1XS9A 2HPMA 3L00A 4M6YA 2M87A 2VL8A 1CF7A 2A07F 3BJAA 1GVDA 2V26A 4LB6B 5GAGJ 3BG9A 4N9HA 2AQFA 4XRFA 1SMYF 4KNYA 1ULYA 5TISC 2ZJ2A 4UNOA 3WE3A 1HKQA 1BC8C 2ZKZA 3CUOA 2P0WA 3JSOA 5L3EA 4FISA 1FMVA 1LEBA 5CVJA 1VQ8I 3QYBA 5ICFA 4IRHA 2QLZA 4Y7NJ 1OR7C 2IAIA 4LJZF 3RSNA 1MMAA 1VF9A 1QZEA 1VQ6I 3HOZJ 1KQ8A 3ZMDA 5LEKA 1OMIA 4ESJA 1JJ6C 1MKMA 2HI3A 5F1RA 1DDNA 3JR9A 4EEFG 4HG2A 5LGTA 3PO2J 2LY2A 2KISA 5DS9A 3ZRGA 4WF2A 1PYVA 3JRDA 4OWRB 4EGYA 1TT5B 1ZH5A 1GXQA 3ZN1A 3CMAI 5FO5A 1P4AA 1YHQI 2X48A 3LQQA 4CYCB 1O3SA 4ETSA 1G3TA 3M07A 1BI0A 2VLAA 3OL4A 1GV5A 3V7CA 1JGSA 2Z5UA 3KZYA 2ISYA 5CVRA 5KCMA 3I56I 1B59A 1V5EA 1Z91A 1TLHB 4II2A 5TGTA 1MSFC 3TOAA 2W85A 1P4XA 3CC2I 2H1KA 1O7LA 1A31A 2MH2A 2OZ6A 4LLLA 4AVZA 1Y39A 1WH5A 4A3MJ 4KMFA 3IH2A 2RNGA 3F8FA 1GLNA 1TW3A 1SVLA 1A6QA 2MD5A 5ICEA 3KP4A 3OS2A 1IGNA 1KU3A 3CJNA 2K4BA 3MZYA 4L9VA 3CO7C 2CO5A 4IPAA 2MLKA 3TDUC 3LAPA 1JHFA 2X0LA 1OYWA 1LVKA 3PIOF 3I55I 3GTOJ 4BXUA 3SFZA 2FQ3A 1QHHD 4RB3C 1QVTA 2NRAC 3FHZA 1S3JA 4HA8A 3WU1B 1JKRC 3OOUA 3R0JA 5FLXZ 1L3LA 3Q5FA 2XGCA 4ITVA 4FE4A 4Q47A 4JP0A 2H6BA 1PUFA 2FSWA 2CV2A 5HDGA 2IBDA 1Z6RA 2DQLA 4PZJA 1BM9A 5D5XB 4XORA 3BQZA 3GXOA 2R92J 1WKMA 3VSLA 3SEZA 2HVQA 2QQ9A 4HLYA 1SD6A 3J7AO 4XKBA 2IGNA 3JRHA 4C3IJ 1E0EA 4Y4RA 2K9MA 3EUKL 2GXGA 2L2OA 3M1EA 1BBYA 4A0YA 3F22A 3GF2A 5D5VB 2JRMA 3DXJF 4LG3A 4AWXB 2HGCA 2V9VA 1JUPA 4D1QA 3QRFF 2DOAA 4ZYGA 5D5UB 2M4KA 1VQLI 3K4NA 2D2WA 3L2QA 3X2QH 4ZZDA 5FLXK 3IRRA 3FM3A 2R4GA 1Z3YA 3HSEA 3N97A 1GV2A 1GHCA 5LGNA 3HKZN 4BDZA 5EEHA 2KDOA 1WJDA 3D5LA 4P5OA 2IXSA 3UNGC 2EV6A 5D4SA 1IXCA 3AG3H 1U9OA 3Q0WA 1MBGA 2IW5A 1YYVA 3ZQFA 2XHKA 4AUXA 1YJNI 3GO5A 2R5ZA 5M3MJ 2R5YB 2JA5J 3HRMA 2ESNA 3VWBA 1XX5A 4LOCA 2VB6A 5DUIA 1O57A 3OSGA 3S2WA 1BOBA 2X1CA 3WG9A 4GXOA 1OCZH 1MJBA 1OISA 2QM3A 4PCQA 4I7HA 2PG4A 2MC3A 3G2BA 1U5TA 2OU2A 2KRCA 2A3SA 1NG7A 3MZ8A 1IAWA 1H0MA 4B1RA 1WSUA 3V7SA 3HUGB 3I71A 5D5WB 1YIJI 2FRHA 1I5ZA 3OYFA 5EDNA 2FBIA 3JTHA 2YSRA 2LG4A 2XGDA 1RNLA 2XB0X 2DMNA 4MFEA 3SZGA 4OAYA 2DA7A 1WCMJ 1XPXA 2VQLA 5JLWA 4RGRA 1G4DA 1WZ2A 2GA2A 3KFWX 4IRIA 3OR2C 2F5DA 3LA3A 2XPUA 4EJWA 5FKNA 2WTEA 4W97A 3ZQGA 1ZREA 1FNNA 3BZ6A 2VBZA 5E20A 3SDGA 4LGWA 3U1DA 3BPVA 2JA6J 2WC2A 3OYBA 3FM5A 3MFKA 5JVGF 1SVOA 4HSRA 3CP2A 2HXIA 1FP1D 1JTXA 3QOPA 2IA0A 2BXYA 1UELB 5DDGA 1FYKA 1WJEA 4P96A 1KONA 4XONA 2M0MA 1AKHB 4KITB 5LHGA 1UAAA 4CUGA 2NVTJ 1MMNA 2BVMA 3LMMA 3GYHX 4KYWA 2VUMJ 1RR7A 1X1PA 2JUCA 1YX5A 3ZMUA 4UVBA 3FXLA 3GTKJ 3JREA 2EZIA 3D0SA 2HS5A 2O6GE 2DA3A 1NHAA 3JW4A 3OMYA 2X6OA 1S29A 2ICWG 1OCPA 2MABA 4LLNA 4KJZA 4AM3A 4PSXA 4XRSA 2ESHA 1R36A 3CTAA 4QPQA 2B9SA 1UFMA 1B8IB 4NUBA 3W2VA 2CGPA 1FOXA 1MBKA 3MKZA 3DEWA 4IOAF 4G6DA 1MH3A 4A69C 2V9PA 1OCRH 2IJLA 2VOOA 5DM7F 1T0FC 2YX7A 3C2GA 5EEGA 4JX6A 3TBIA 1LFBA 5BOXA 3UR3C 1Z77A 2ZNZA 4EMSA 4YFKF 2DK8A 3GZ5A 4A6EA 5K1YA 3G71I 2G7UA 1J7KA 4OOIA 3BZCA 3J7ZI 1DP7P 4HRIA 2DT7B 4QLCU 4BE2A 1Y8QB 4GGGA 2CWEA 2YPRA 3H3ZA 3LSKA 3BTCA 2GWRA 3F0CA 3RPQA 4CCOA 2IS2A 3KPHA 1SMTA 5M5XJ 4RA2A 5B1AH 2Y0MA 1YE9A 2ZXJA 5H20A 5H6QA 4A3JJ 2ME6A 4PFPA 4CZCA 1MSEC 1IC8A 4CGZA 2EIJH 1XCVA 2DMQA 3OYDA 3BTIA 3NEUA 3KYCB 1K7AA 1Q1HA 1IRFA 1X3UA 1MNMC 3ML6A 1E3OC 4KFCA 5E1WA 2QYOA 3CF2A 4N0BA 9ANTA 1BI2A 4FHTA 3HOUJ 1OYIA 1WI3A 3FXOA 5C44J 4AIJA 1OKRA 3BR5A 2F4IA 4DGWB 2A5YB 2IS6A 5AONA 1D5VA 2VJ4A 1TQMA 5GPAA 2NVQJ 4QPOA 1LVAA 5GAEJ 3HZJA 2D5VA 3CLOA 5D8LB 2BY0A 1ZG3A 4KICA 2NVUB 1E3HA 1FIPA 2EH3A 4CDGA 1XD7A 3DTIA 1ETXA 2OC6A 2H8RA 4NC6A 4MIMA 3DU5A 4BUPA 1ZELA 2CQ7A 2V1DA 3RQIA 1IUFA 1UHSA 3K70C 2R7DA 1PDNC 3GTGJ 2DA4A 4FTHA 1SFEA 4M9ZA 4AYBN 4ZJZA 4UUSB 2XRNA 4C3HJ 5IT3A 4I6ZA 2HDWA 2AHQA 2L54A 4XLAA 5IP6A 1IN6A 2PI0A 2Z99A 3F9KA 2OZUA 1HKTA 1X1DA 1HF0A 3DKWA 1J9IA 3G4SI 5M3FJ 3GTLJ 3H5AA 1BL0A 1R00A 2FA5A 4F93B 2M2EA 4C30A 2QSHX 2KIMA 3RCOA 4UB6C 2XKOA 3A1YA 2OUMA 1D0ZA 1FBUA 3G6EI 3G1LA 4KUMA 3RKYA 2H09A 4BEHB 4EJUA 2K27A 3TMOA 3VEPA 1QPMA 2BHYA 3L2UA 1I50J 2PN6A 2QGUA 4HBLA 1F43A 1IN7A 2ISZA 3SJMA 2NVYJ 1POGA 3ZMSA 1JUSA 3WTZA 3JRBA 2TRTA 2WAQN 2Z3YA 4HYEA 4MQ9F 1IF1A 3GZNB 4L5EA 1LE8B 2HZTA 2NAZA 3GTJJ 4W1UA 1B4AA 4AC0A 3TQNA 2DFIA 4XK4A 3DKXA 2EA2A 4C9YA 1TQPA 2KJBA 3K7AJ 3SQNA 3BOQA 2FMLA 2R3SA 2ZFWA 1TT0A 2K7LA 4KN7X 4BJTA 1W0UA 3S8PA 4KT5C 3EPZA 4GDFA 4XL9A 5ICCA 3L09A 3RYRA 5FKKA 3LQRA 2ZFUA 5CVIA 1ORKA 1A35A 1WRJA 5EGOB 4PJMA 2DA2A 4M9SA 1ENHA 1RIOH 2PJRB 3KYDB 4GCVA 4XLHA 1J2XA 2L7KA 3TO9A 2O7OA 3AG1H 3J81Z 2DYSH 3RKXA 2YUSA 2LFBA 3BP8A 4XRMA 2Z1DA 5A2QZ 2O5RA 5GTHC 2OQGA 4RDUA 5L3GA 4XSXF 4UXNA 1EH6A 1JKPC 4FETA 3TO6A 3QPSA 2G9WA 1OCCH 3HGGA 1D1AA 1YW7A 3FDYA 1X3ZB 1MW7A 1MMGA 3V4GA 3ZQHA 2F2EA 3BLYA 4L9JA 1JUMA 1Z7LA 2DU9A 3F8NA 4EJOA 4QIWN 1ZR4A 2QKLB 2RVCA 2WWYA 2BVLA 2L7MP 1WH7A 4QWQA 4PDKA 3H92A 3GCMA 5JFRA 3F3XA 5FFXA 3S15J 2VKVA 1EH7A 1MMDA 1RUNA 2VPLA 1QU3A 5HODA 2LRDA 2RREA 3K69A 1W5SA 3J81K 3LAJA 5E18F 4NNJA 1UHMA 4OIPF 3AL0B 4G8XA 3BR6A 1YLFA 2BXZA 3ZGKA 3F6VA 2E1OA 5A2QK 3O2PE 3QU6A 3BJ6A 3NWTA 1A04A 4ENMA 2P8TA 1ZARA 3KLOA 2VKDA 1SD7A 4XLFA 3DF8A 5HNHA 1Y1WJ 2UUZA 4BQQA 4UUTA 2P81A 2K02A 2DA5A 5H6RA 2XVCA 2W82A 4BQNA 2E35A 1Z7UA 3BDDA 5FKMA 1YS6A 3D5SC 5F64A 2IGOA 5DV5A 2P7CB 4WXCA 1U78A 2LY9A 2W1OA 5F04A 2XAHA 4DBQA 3JRCA 3KP5A 2UWMA 1U6GA 1YJWI 4UY8I 2K3PA 2JSCA 3V7RA 3T5XA 2N8GA 2M9HA 3C3WA 5IYDJ 3AL0C 2IGMA 4MEXF 1QNTA 2CUEA 3I54A 4GO1A 4LD5A 1FYLA 2PQ8A 2LK2A 2K9NA 1UMQA 4JK1X 5BQTA 2CW8A 2ADUA 1MNEA 1U8RA 4A12A 2L3DA 2W24A 2DN0A 4Q4ZF 4KIBA 2L7FP 1YITI 3V8JA 4XN3A 2XSDC 1TZLA 1WJFA 1YRNB 2VN2A 1J5YA 1KA8A 1YX3A 2DMUA 1D0XA 2Z16A 5C4XJ 4M3EA 2P5KA 3K4KA 2ZCWA 2LOOA 2EFOA 4V19K 2JZYA 3F8CA 3CCSI 2Z9OA 1ZLKA 3ZQCA 1GDTA 1FBQA 1I39A 4ZDLA 2ELHA 1T95A 3E6DA 5FGMA 2D1HA 2H1LA 3JSPA 2EILH 4IZZA 2L0KA 1G8XA 4M72A 3EQLF 3BC8A 2XF7A 4IXAA 5HLGA 1G3YA 1NTCA 2CG4A 4CZZA 1R1VA 4ENKA 2FQ4A 4DNCA 4NDLA 3E5UA 5GADJ 1EH8A 1IN4A 2NS0A 2E5NA 4WK8F 2RKHA 4OIOF 1R6RA 4UV8A 3GZ6A 2VQHA 5JI6A 5LD2C 5K5QA 4A3BJ 1SD5A 4IF4A 3TL4X 2GXAA 3CDHA 2E7WA 4S04A 3H5NA 4NBQA 2QQAA 2RV8A 4HNUA 4F3QA 4D5CA 2LKPA 2UXXA 3B73A 1YG2A 3WTYC 3JRIA 4LIUA 2STTA 3LSRA 3VPRA 4U7BA 1ZLJA 3ECHA 1ETQA 1S6LA 4HDUA 4LIVA 3QQAA 4HSTA 4BL0B 1OYYA 4BU2A 3HOVJ 5E3MA 2KIFA 3NARA 1NK2P 2XDVA 2CQXA 1SFKA 4A5NA 2GXBA 5TJJA 3TEDA 4RMNA 5KK1A 1W36C 3CCJI 1B6AA 2M8GX 3PJRA 5ED4A 3IP4B 3HGYA 3GTQJ 1R4MB 2XIGA 4AIDA 2FE3A 3WODF 2Q2EA 2MLGA 1ZR2A 1R5GA 5LRSA 2VXDA 1JKOC 4BXFA 5EF6A 2ZXWH 3G1OA 3OYHA 1HLVA 1UG2A 1DPUA 2CUJA 3CO6C 2DCEA 2M8EA 1FSHA 4PFOA 2YR2A 3BG7A 2QA4I 3H9QA 3I5UA 2YU3A 1DPRA 4CHUA 3LFUA 3U2RA 3T8TA 1OLTA 3CMYA 2CRGA 5FRMA 2ZXIA 3A01A 1LKXA 3OYKA 4M3FA 3L1PA 4E7ZA 2EINH 2F5CA 2Z2SB 1O3RA 4A3KJ 3JCUC 4D7MA 4AYBA 2VT2A 2XAUA 2HOAA 1XMAA 3I4MJ 4NHJA 3K4CA 4HDVA 3HB9A 5F08A 4FQGA 3HTSB 4PJNA 3LA7A 1LJ9A 2ZC2A 2HVSA 3M7GA 4PSWA 2XAGA 3ZN0A 1J0RA 2BE5F 2V6EA 2M30A 1P7IA 2P5VA 2A69F 1XSXA 4J00A 2DA1A 4LK0F 2R7QA 3PO3J 1X1AA 3MVPA 6PAXA 1YOVB 2R7TA 2VBWA 4C2TA 3K4LA 3GX4X 2X6WA 2ZSHB 1VZ0A 4HX8A 4IHTA 1LFPA 2XPWA 4BBSJ 4R79A 2HDCA 1FIAA 2R5YA 4OU0A 2VPRA 2OV7A 3H0GJ 2KLOA 1XN7A 3SDBA 2O61A 1CGPA 2STWA 2WAQA 4J19A 4ESBA 1IRZA 2GQQA 3J80Z 2L7ZA 2MSYA 2OTLI 2L01A 1HW2A 3RI4A 3ABTA 2OPTA 3NWSA 1FT9A 5K5OA 1SANA 1DGWY 3IWZA 3O8GA 1VQNI 1K79A 3A02A 3M4OJ 1SAXA 1FPQA 2BV6A 4B4CA 1HSTA 1XTAA 3TOBA 1W7PD 4UVAA 4U0WA 3L7WA 1RRJA 4DYCA 1R23A 3TW7A 4IHXA 1O3TA 4C3JJ 5FD6A 4I01A 3V8LA 2D45A 4L9TA 1IJWC 1PUEE 3Q3SA 4IRGA 2UZKA 3HC7A 1XC5A 2E19A 3J80K 3F72A 2QQBA 4K2EA 5AIPA 4BBRJ 2DMPA 1WQ2A 1JT0A 5L3DA 4G7ZF 1ZK8A 2RNJA 3JAMZ 2YU9J 2W25A 2XV4S 3L2VA 1I27A 2Y30A 3G3ZA 3RZOJ 2CYYA 4YEJA 2HPIA 2VJJA 2GM4A 5J40A 1ETWA 3EUAA 5K7FA 1JKQC 4PGGA 1IRXA 2K3FA 1CF7B 1LUJB 2QWWA 4PGHA 4BE1A 3L2RA 2EFWA 1N78A 2M1BA 2HOTA 1FJLA 4A3LJ 1BOAA 2Y69H 3IC7A 4AU7A 3E5QA 2Z33A 5FROA 1Y0UA 1H88C 2LREA 1VTNC 4D0PA 2VODA 4LB5A 3GLLA 2M45A 3GFMA 5K5RA 2O8XA 4ASNA 4N9IA 3KZZA 4LK1F 2RAEA 2QKMB 2BW3B 4G7OF 5ILVA 2ECBA 4I99C 1F9NA 2QBYA 5TRDA 4L5IA 4H0EA 3JAMK 3FKIJ 1OCTC 4TV7A 3HYIA 1B1BA 3MAJA 1ZKGA 1K6YA 2GBYA 1W7PB 3I64A 3HM5A 2B0LA 3OWTA 1QO0D 5ILUA 1T08B 1TNTA 2F4OB 1XCBA 1XB4A 1ZRCA 1T38A 4B44A 3E7LA 1MZBA 1PJRA 3LSIA 1RR8C 1JTYA 4E7SA 3VYRB 3HOTA 1D8KA 5CLSA 1P4WA 2BZTA 3BG3A 2G0EA 1N25A 1T8IA 3QAHA 3OSFA 1QPIA 2K5CA 2DO7A 3PUBA 1X4PA 5E1ZB 3VYSB 4CCLA 1FWZA 2XAFA 1Z6TA 3IAM2 3A03A 3RDIA 4U0YA 3KETA 4KDPA 1PP7U 1W5CC 3KP3A 3I59B 2DT6A 2BYVE 2BGCA 2L9NA 1V55H 2BOLA 2KIQA 5EJCA 1WFXA 1XDSA 1QA6A 2MGQA 1R5ID 3C2HA 3M3YJ 2LVSA 4FE7A 4R8HA 5DUKA 1MGTA 4CSWA 3QPLA 3U9GA 2DDBA 3DPUA 3QWLA 1ITYA 2OTJI 1NH3A 2CS3A 2RDPA 4B8XA 5H2FC 2LC2A 2VONA 3FIWA 2W84A 5HOOA 3EYYA 4D9JA 1REPC 3PSIA 4ZYDA 4XBFA 3BCBA 3G1MA 3FXRA 5CJ9A 1YO5C 3BROA 3DTKA 4C2UA 2XPVA 2DAOA 2FU4A 1TP4A 1RZ4A 3HIFA 1HKSA 2LH9A 4NC8A 5IT9Z 3MN2A 3CUQA 1OQYA 1IDYA 3TKYA 1I1SA 2E1NA 1Z0XA 3LSJA 4LMYA 2CW0F 3ZMVA 1O7FA 1P6RA 1D0YA 1RESA 2MG4A 2WV0A 3OY9A 5GPCA 2HQRA 2HQNA 2KZVA 4G6QA 1VQ7I 4A3DJ 2GAUA 2CJJA 5FLVA 3S2HJ 1JI8A 1ZQ3P 2HQ5A 3N4MA 2X6XA 3K9TA 4DYRA 2EWNA 1MMSA 1XDUA 5CVVA 5DD4A 4B09A 4XKVA 2CQKA 2EJRA 1MJAA 3FMRA 2MBFA 3HTUA 3T1BA 5K7ZA 1DQUA 2FUG2 1WJCA 3PFIA 3KP6A 2LKSA 5CYVA 3ZQLA 1ETYA 5HLTA 2ZMEA 4WCGA 3ZMZA 3FXQA 2F48A 2X6YA 4UB8C 2VASA 2P5LC 2PMZN 2QCOA 4JBAA 4MNUA 5IT9K 2JMWA 2KRFA 3BTJA 5IPAA 2QZ8A 1QZYA 1WPKA 4BEHA 1USTA 4M73A 4AVPA 4M3DA 5IOZA 3CCUI 3TO7A 1TWGJ 3W6VA 1PVEA 1XSDA 2OCEA 1VQ9I 3FHNA 4IJAA 4Y33A 3R6SA 2DT5A 3QP5A 1K61A 1ZYRF 2LTPA 2HOSA 5J4VA 2KHMA 4LG0A 3CMEI 4HV5A 4PJJA 2V79A 5IP9J 3BG6A 3CMMA 2M3AA 4RGUA 5K7HA 4DW6A 3E97A 1K83J 2JPBA 3HOWJ 2O03A 1GUUA 1NG6A 3S16J 5DTDA 1GT0C 3HJEA 2K9QA 2WB1N 3HSFA 4DQ2A 3DBLB 3VOEA 1R71A 2JJ7A 1W1WE 1A6IA 5HLHA 3ZP5A 3RYPA 1FTZA 3SZTA 1W4MA 3M1CA 3WTTC 2LR8A 4XLCA 3VDXA 2ID6A 4BYYA 2KDZA 5CVUA 1QHGA 4HOBA 4WX9A 3LWFA 3P9KA 2EZKA 3WU2C 2XC7A 1FC3A 2DXIA 2KP6A 4NQWA 2JPCA 1U5TC 3S3MA 5FLMJ 2Q1ZB 4XICA 3HL2A 1SVMA 3NAUA 5M5WJ 3OYNA 1QBJA 2NXNB 2CQNA 3RKWA 3IH4A 3ELKA 3KEYA 1B9NA 2VQGA 3FX3A 1E2XA 2ELKA 3PFYA 4P55A 5EEAA 2XB5A 4BS9A 2PJPA 2EFPA 1HDDC 4M3GA 3KIOA 3ZXSA 2X4HA 1U3EM 2VXZA 3VFZA 1RUOA 1LNWA 4JX5A 1FBSA 2PMUA 2PX9A 4BJ6C 3FMSA 3RPUA 3A0HC 2PEXA 3DKYA 5F0HA 4HLXA 2VC0A 1P9QC 2L4MA 3E3VA 3LSHA 2PFBA 4RBOA 5LHIA 4IHYA 4RAGA 2HDDA 1TTYA 5FB2A 1R1TA 4BY1J 2UXNA 1R1UA 3MMYB 3GFIA 3R4KA 3JTGA 2GLOA 5L3CA 1ZTRA 2NS8A 1Y1VJ 4KA4A 3RPUD 5GAHJ 4ZDOA 3BJOA 3E6CC 4FX4A 1ACIA 2LD5A 4FT8A 2BEOA 2QUFA 1Z67A 4HPQA 1X3WB 3EUHA 1WGXA 1ZGWA 5EG0B 3PNVA 5F0CA 5EYRA 2X85A 4HF0A 3OIQA 4B3AA 2BY1A 4U0VA 5EZHA 2VOPA 2EFNA 5BS6A 1MBFA 3IH3A 3TP0A 3JRAA 3H3UA 3HRTA 3CF5F 2H6CA 2NVXJ 2LSOA 1UHWA 1DUXC 2EFQA 2EIMH 3FISA 1JHHA 3GFJA 2IEKA 2Y0SN 2HKXA 4RLFA 3UKGA 1Z05A 5J47A 1HBXG 5DYMA 5E3LA 3K1NA 4N4NB 2HTJA 3DPTA 4A3EJ 4EJTA 4YIFA 2BY2A 3DV8A 2R7FA 1YRNA 1G6NA 2P6SA 1X1BA 2FJ1A 1TWAJ 1J09A 4F92B 1G3WA 2VKHA 2RQQA 5FKLA 2M7AA 3E6MA 3BR3A 3DQVC 1FYMA 2DOFA 3S93A 3S17J 1EV7A 2K86A 2QF7A 3K1PA 4Q48A 3BWGA 3FMQA 1Z9CA 4KISA 1S8NA 3OIOA 1UB9A 1X4OA 3S14J 5KVRA 4XSZF 2XUBA 1IO2A 1HSJA 2VE9A 4HQMA 2DK5A 1QRYA 3KYLA 4X6AJ 3ZQ7A 2DQRA 2UV1A 1B9MA 3BZKA 2RGVA 5IYCJ 5E8GA 2EV0A 1QQIA 2QVOA 3RKQA 4ABZA 1U0JA 4IEJA 3M8EA 2NS7A 4FASD 3CCVI 1AU7A 3C7JA 2V1UA 3H3VK 3GTMJ 3LL7A 1SAUA 2KFDA 2DJNA 1W36D 2GOXB 4U87A 4BGDA 4MO7A 3H1CA 3H9GA 3EDPA 3P9IA 5DCMA 1K4SA 4GYGA 1VQOI 4HF1A 3FXKA 3F23A 1BJZA 5HVQC 1JXSA 3PQKA 4I09A 3H9JA 1H9GA 4X0GA 4PK4A 3E6BA 3MD2A 5FFZA 3MCZA 3PNYA 1G2HA 2E2HJ 2COBA 1OR7A 4JYKA 3LSGA 4L0YB 3WG7H 3S3NA 3OYLA 5GP9A 2C6YA 2DBBA 1O4XA 4CCJA 3DBHB 2JA8J 2XAQA 3AG4H 3BR0A 1MBHA 3OR1C 4DZPA 4AIKA 3ABUA 3COAC 1AWCA 4Z6YA 1G3SA 1BR4A 5ILSA 3LSPA 3DU6A 5HDKA 2X51A 3SZPA 3OV8A 3S32A 2OBPA 3QPHA 2R7OA 1TWFJ 4ZYAA 3BG5A 3DWLE 3WGHA 4C2MJ 3ERED 3D5RC 4JOMA 3R0AA 2CFXA 2ZXHA 2J5OA 2E2JJ 1ZAOA 2ETHA 3HPGA 3ROUA 2E71A 2IRFG 3I3LA 3E5XA 1V5GA 4RB0A 3F6OA 2KT0A 1EA3A 5LEJA 1YIOA 2ELJA 2J5PA 3PSFA 4CH7A 1WWXA 1C0WA 2O8KA 2K4JA 3VSKA 5E79C 3GLXA 5HNFA 1L0OC 4OINF 1XGMA 2F4MB 1VQMI 2EB7A 1U8BA 2AXLA 2BY3A 3DTEA 1VQ5I 3B6AA 3RIRA 4IVNA 4XKCA 1BC7C 1HW5A 3OL3A 1T56A 1HXDA 2R7XA 2PMZA 4GRIA 4CYCA 1GVJA 4M71A 3R60A 4LITA 3ZCOA 5JVTA 4YFNF 1D3YA 4DYQA 3WU0A 3G73A 2Q8KA 2ID3A 3CCQI 2KPMA 2IA1A 4YG2F 1U9NA 3S3OA 1NK3P 4UUVA 3MQ0A 2OCCH 4II3A 2I10A 1A36A 4O3MA 1LDJA 2I5UA 4P9UA 2FEZA 4IO9F 1B72B 5CQGA 3C18A 1X19A 2W4SA 4D7NA 2X1EA 2EIKH 5E3OA 1BJAA 1X58A 3Q9VA 3Q9SA 2EV5A 2KRHA 2K9LA 2AO9A 3ASOH 3E0JB 4IQJA 3W6KB 5HDNA 4RAFA 1S7AA 2WB1A 4M74A 4M6VA 3T8RA 5CPRB 2BBYA 2VIXA 3IAS2
chains in the Genus database with same CATH topology
3KP7A 3PQJA 3K0LA 1IW7F 2RC4A 4A6DA 2DLLA 1ZRDA 1FOKA 1ZGAA 2D1VA 3TDZC 3WTVC 2LNBA 2CSOA 4HAMA 5DD8A 3DPLC 4YIIA 1FZPB 1ON1A 3FZVA 2P4WA 3NRVA 3HRUA 4M6XA 1K78B 3WGIA 4AIHA 3O3KA 2NYXA 2XGXA 1I1GA 4L0ZB 3WTWC 1ZG1A 1TQIA 4BHPA 1RI7A 2DW4A 1HW1A 3HRSA 3WE2A 5L3BA 2DI3A 1MDMB 4Y17A 3FF5A 5LBQA 3WTXC 1J75A 2VT3A 3ISPA 5JHUA 2ACJA 2ZO4A 2FNPA 4ENJA 1W7PA 4NB5A 3VODA 1K6OA 3KE2A 3BPXA 2L02A 2OAZA 1TW2A 1KU9A 4HV6A 4L9NA 3HUGA 2PMHA 2HWVA 4HX7A 4HW0A 1FY7A 2GIVA 1FP2A 2RQPA 2TDXA 4R1HA 3IWFA 5E8IA 5F6FA 3WGGA 2LF7A 4OMZA 3HOSA 4BHBA 3I59A 2L4AA 1KU7A 4Y15A 3M8FA 3HSRA 2NNNA 1KGSA 4HQEA 1V3FA 3O6BB 1T0FA 1W5TA 1T2KA 2IVMA 3RTRA 1KQ9A 5L3FA 2IPQX 5FD5A 5BMZA 1YW9A 2FBHA 2OD5A 2IT0A 2XROA 4UV9A 4G7HF 1XMKA 5D8KB 3P9CA 1T98A 2NNYA 4ENNA 1BI1A 4BAYA 3F21A 4HF2A 4LFUA 2FBKA 2FXAA 3HHHA 1YFHA 1IXSB 2A6EF 5J8CA 4L18B 5J6XA 3KP2A 3B02A 3HHGA 3GFLA 4KN4X 2EK5A 4G94A 3GUDA 4RGXA 3OOPA 4MTEA 1AOYA 1ONVA 3VB2A 4BH9A 2MA3A 4S05A 4Z2YA 2VBYA 4MQVA 1Z1DA 2O0YA 5LHHA 4FX0A 5LLQA 2OA4A 4ZH4F 4GYIA 1LB2A 2FF4A 4ZZLA 4WXDA 3KEOA 4EJVA 3LA2A 4BHCA 4HZFA 1P92A 4ZYHA 2HYGD 4I0AA 1J59A 4EVIA 2E7XA 4Q5SF 1JE8A 3LSTA 4MEYF 3RJPA 3V8KA 4YFXF 2VE8A 4ESFA 2O3FA 5DCFA 2V6CA 5HS7A 2PBIA 1E17A 3FWEA 5J8FA 4P9FA 3WTUC 5D6EA 3W6JB 2DTRA 4OIRF 1ODDA 2JT1A 3DP7A 5LRRA 2QBYB 2HKOA 2E1CA 4HX4A 4MGRA 3I4PA 2PLYA 2EA4A 5AIQA 2DPUA 5HS8A 2Y75A 1BIAA 1USSA 2JTVA 1U5TB 4EM1A 1YS7A 1STZA 3IKVA 4OIQF 1IZ1A 2F5EA 3BY6A 3L9FA 1IN8A 4I02A 4RB1A 4I98B 5HS9A 3IKTA 5HLIA 5E1XA 3REOA 4G9YA 2XASA 2P6TA 1T6SA 3M9AA 3WTSC 2KIUA 4UVCA 3GVAA 1KYZA 1O3QA 2IA2A 2RN7A 1IUYA 1LQ1A 2H94A 1FSEA 2ZBKA 3I58A 1KQ0A 2HOEA 4EGZA 1ON2A 3CUQB 4L5JA 4RB2C 5JR3A 1LDDA 4A0ZA 1XGOA 2LDUA 2MH9A 5DEQA 1R58A 3IRQA 2A68F 2DPDA 1IN5A 3KCCA 1MJ9A 3MZHA 4EQQA 3IHUA 2QENA 3QU3A 2IP2A 1YW8A 5ICGA 2HTSA 3AAFA 2W57A 2ZNYA 2KKOA 3SHFA 2H27A 2ZMEB 3TGNA 4CICA 2VC1A 4I2OA 3SXYA 3CUQC 1YQAA 2XAJA 1IXRC 4ZYEA 1XGSA 2OQRA 3EYIA 3C1DA 2P7VB 4WXHA 3P7NA 4LG0B 4AD9A 4MHGA 1LDKB 4ON0A 4RGSA 4O6JA 3F8MA 4U88A 1GXPA 2F5FA 2AS5F 1T39A 4RAZA 2YX4A 3NQOA 3T0YA 2VBXA 1OPCA 2Q0OA 3GWZA 1SD4A 4KIGA 4E70A 5E17F 1HQCA 2FOKA 1R5HA 4RAYA 5BPIA 2KJCA 4RS8A 1D8JA 1F1ZA 3I0TA 1R22A 1H9TA 1XSVA 3IL2A 1SFUA 5ERIA 4JQFA 2XKPA 1BN5A 1UCRA 1FLIA 5D6FA 4Y13A 1ZHFA 1PP8F 4EM0B 1SFXA 3QPTA 2FNAA 3MEXA 4CXFA 3K1MA 2M5WA 4A2UA 2GA1A 1KYWA 2Y48A 3ULQB 3ZPLA 4KMUX 3QP6A 4I0BA 1YTYA 1S7OA 3I53A 2COMA 4M9XA 1V4RA 1ZRFA 2G7HA 4XLPF 4O5VA 1F4KA 1K78A 1QZZA 1TNSA 2HYFA 4OMYA 3LFKA 3KEQA 3K2ZA 4LLGF 2LF8A 3DEUA 4BQAA 4U7DA 2JRTA 2A6HF 4XLNF 1P2FA 3ZMTA 3F8BA 2HFHA 1XGNA 3GEZA 1BIBA 5LGUA 4CYDA 1MDMA 2GZWA 4KIFA 4WWCA 4MTDA 3FXUA 1IRGA 1ZG5A 1I6XA 1R7JA 1F5TA 1U2WA 1LEAA 3L2CA 2V1XA 5BPDA 4F7ZA 4A0XA 3DFGA 1ZGJA 5D4RA 1TBXA 4CO8A 1WI9A 3KLNA 5DCMB 3ECOA 3EETA 4A5MA 1BI3A 3R61A 4BNCA 4EV0A 1MD0A 2HR3A 3GW2A 1QGPA 1KU2A 2FMYA 4UHTA 4IHSA 1FX7A 4EM2A 2A61A 3MWMA 1ZN2A 2HEOA 3L00A 4M6YA 2M87A 1CF7A 2A07F 3BJAA 4LB6B 4N9HA 4XRFA 1SMYF 4KNYA 1ULYA 4UNOA 2ZJ2A 3WE3A 1HKQA 1BC8C 2ZKZA 3CUOA 3JSOA 5L3EA 1LEBA 5CVJA 5ICFA 4IRHA 2QLZA 4LJZF 1KQ8A 3ZMDA 5LEKA 1OMIA 4ESJA 1MKMA 5F1RA 1DDNA 5LGTA 4WF2A 4EGYA 1ZH5A 1GXQA 3ZN1A 5FO5A 1P4AA 3LQQA 1O3SA 4ETSA 1G3TA 1BI0A 3V7CA 1JGSA 2Z5UA 3KZYA 2ISYA 5CVRA 1B59A 1Z91A 1TLHB 3TOAA 2W85A 1P4XA 1O7LA 2MH2A 2OZ6A 4LLLA 4KMFA 3F8FA 1TW3A 2MD5A 5ICEA 3KP4A 1KU3A 3CJNA 3CO7C 2K4BA 3MZYA 4L9VA 2CO5A 3LAPA 4IPAA 2MLKA 3TDUC 1JHFA 2X0LA 1OYWA 4BXUA 3SFZA 2FQ3A 4RB3C 2NRAC 3FHZA 1S3JA 4HA8A 3WU1B 3R0JA 5FLXZ 1L3LA 3Q5FA 4Q47A 2H6BA 2FSWA 5HDGA 1Z6RA 2DQLA 4PZJA 1BM9A 5D5XB 3GXOA 1WKMA 2QQ9A 4HLYA 1SD6A 3J7AO 2GXGA 3M1EA 1BBYA 4A0YA 3F22A 3GF2A 5D5VB 3DXJF 4AWXB 2HGCA 2V9VA 3QRFF 4ZYGA 5D5UB 2D2WA 4ZZDA 5FLXK 3IRRA 3FM3A 3HSEA 3N97A 1GHCA 5LGNA 5EEHA 3D5LA 4P5OA 2EV6A 5D4SA 1IXCA 2IW5A 1YYVA 2XHKA 3GO5A 3HRMA 2ESNA 5DUIA 1O57A 3S2WA 3WG9A 4GXOA 1MJBA 2QM3A 4PCQA 4I7HA 2PG4A 2MC3A 1U5TA 2OU2A 2A3SA 1IAWA 1H0MA 1WSUA 3V7SA 3I71A 5D5WB 2FRHA 1I5ZA 2FBIA 3JTHA 2YSRA 1RNLA 4RGRA 1G4DA 2GA2A 3KFWX 4IRIA 2F5DA 3LA3A 4EJWA 2WTEA 1ZREA 1FNNA 3BZ6A 2VBZA 5E20A 4LGWA 3U1DA 3BPVA 2WC2A 3FM5A 3MFKA 1FP1D 3QOPA 2IA0A 5DDGA 1FYKA 4P96A 5LHGA 3GYHX 4KYWA 3ZMUA 4UVBA 3D0SA 2HS5A 2O6GE 1NHAA 3JW4A 1S29A 4LLNA 2ESHA 1R36A 3CTAA 1UFMA 2CGPA 4G6DA 2IJLA 2VOOA 5EEGA 2YX7A 5BOXA 2ZNZA 4EMSA 4YFKF 2DK8A 3GZ5A 4A6EA 5K1YA 2G7UA 1J7KA 4OOIA 1DP7P 4QLCU 4GGGA 2CWEA 2YPRA 3H3ZA 2GWRA 3RPQA 1SMTA 2Y0MA 2ZXJA 5H20A 5H6QA 4CGZA 1XCVA 3NEUA 1K7AA 1Q1HA 1IRFA 1X3UA 3ML6A 4KFCA 5E1WA 2QYOA 4N0BA 1BI2A 4FHTA 1OYIA 4AIJA 1OKRA 2A5YB 5AONA 1D5VA 1TQMA 1LVAA 3CLOA 5D8LB 1ZG3A 4KICA 4CDGA 1XD7A 2V1DA 2R7DA 1PDNC 1SFEA 4M9ZA 2XRNA 5IT3A 2L54A 1IN6A 2PI0A 2Z99A 2OZUA 1HKTA 3DKWA 1J9IA 1R00A 2FA5A 2KIMA 2XKOA 1FBUA 4KUMA 3RKYA 2H09A 4EJUA 2K27A 3VEPA 1QPMA 2PN6A 4HBLA 1IN7A 2ISZA 3ZMSA 3WTZA 2Z3YA 4HYEA 4MQ9F 1IF1A 2HZTA 2NAZA 1B4AA 3TQNA 2DFIA 2EA2A 1TQPA 2KJBA 3SQNA 3BOQA 2FMLA 2R3SA 2ZFWA 2K7LA 4KN7X 4KT5C 5ICCA 3L09A 3RYRA 3LQRA 5CVIA 1WRJA 4M9SA 1RIOH 4GCVA 1J2XA 3TO9A 3J81Z 3RKXA 3BP8A 5A2QZ 2OQGA 5L3GA 4XSXF 4UXNA 1EH6A 3TO6A 2G9WA 1YW7A 3V4GA 2F2EA 4L9JA 2DU9A 3F8NA 4EJOA 2RVCA 2WWYA 4QWQA 4PDKA 3H92A 5JFRA 3F3XA 5FFXA 1EH7A 1RUNA 3K69A 1W5SA 3J81K 3LAJA 5E18F 1UHMA 4OIPF 4G8XA 1YLFA 3F6VA 5A2QK 3O2PE 3QU6A 3BJ6A 1A04A 4ENMA 2P8TA 1ZARA 3KLOA 1SD7A 3DF8A 2K02A 5H6RA 2XVCA 1Z7UA 3BDDA 1YS6A 5F64A 5DV5A 2P7CB 4WXCA 1U78A 2XAHA 3KP5A 2UWMA 1U6GA 2JSCA 3V7RA 3T5XA 3C3WA 4MEXF 1QNTA 3I54A 4GO1A 4LD5A 1FYLA 2PQ8A 4JK1X 5BQTA 2ADUA 1U8RA 4A12A 2L3DA 2W24A 4Q4ZF 4KIBA 3V8JA 2VN2A 1J5YA 1KA8A 2P5KA 2ZCWA 2EFOA 2JZYA 3F8CA 2Z9OA 1ZLKA 1FBQA 2ELHA 5FGMA 3E6DA 2D1HA 3JSPA 4M72A 3EQLF 4IXAA 5HLGA 1G3YA 2CG4A 4CZZA 1R1VA 4ENKA 4DNCA 3E5UA 1EH8A 1IN4A 2NS0A 4WK8F 2RKHA 4OIOF 4UV8A 3GZ6A 5JI6A 5K5QA 1SD5A 4IF4A 3CDHA 2E7WA 4S04A 2QQAA 2RV8A 2LKPA 2UXXA 3B73A 1YG2A 3WTYC 2STTA 4U7BA 1ZLJA 3ECHA 1S6LA 4HDUA 1OYYA 2KIFA 4A5NA 2GXBA 5TJJA 5KK1A 1B6AA 5ED4A 2XIGA 2FE3A 3WODF 2Q2EA 2MLGA 1R5GA 5LRSA 1DPUA 3CO6C 2M8EA 1FSHA 2YR2A 3I5UA 2YU3A 1DPRA 4CHUA 3U2RA 3T8TA 2F5CA 1O3RA 2VT2A 1XMAA 4NHJA 4HDVA 3HTSB 3LA7A 1LJ9A 3M7GA 2XAGA 3ZN0A 1J0RA 2BE5F 2M30A 2P5VA 2A69F 1XSXA 4LK0F 6PAXA 2VBWA 3GX4X 4HX8A 4IHTA 4R79A 2HDCA 4OU0A 1XN7A 2O61A 1CGPA 2STWA 4ESBA 2GQQA 3J80Z 2L01A 1HW2A 3RI4A 3ABTA 5K5OA 1FT9A 3IWZA 1K79A 1SAXA 1FPQA 2BV6A 1HSTA 3TOBA 1W7PD 4UVAA 4U0WA 3L7WA 1R23A 1O3TA 5FD6A 4I01A 3V8LA 2D45A 4L9TA 1PUEE 4IRGA 2UZKA 3J80K 3F72A 2QQBA 4K2EA 5AIPA 1WQ2A 5L3DA 4G7ZF 2RNJA 3JAMZ 2W25A 2XV4S 1I27A 3G3ZA 2CYYA 4PGGA 1CF7B 2QWWA 4PGHA 2EFWA 2M1BA 1BOAA 3IC7A 3E5QA 2Z33A 1Y0UA 1VTNC 4D0PA 2VODA 4LB5A 3GFMA 5K5RA 2M45A 2O8XA 4ASNA 4N9IA 3KZZA 4LK1F 4G7OF 5ILVA 1F9NA 2QBYA 5TRDA 4L5IA 4H0EA 3JAMK 4TV7A 3HYIA 1B1BA 3MAJA 1W7PB 3I64A 2B0LA 1QO0D 5ILUA 1TNTA 1XCBA 1XB4A 1ZRCA 1T38A 1MZBA 3HOTA 1D8KA 5CLSA 1P4WA 3QAHA 2DO7A 5E1ZB 1FWZA 2XAFA 1Z6TA 3RDIA 4U0YA 3KETA 4KDPA 1PP7U 3KP3A 3I59B 2BYVE 2BGCA 1XDSA 4R8HA 5DUKA 1MGTA 3U9GA 2RDPA 4B8XA 2VONA 2W84A 5HOOA 3EYYA 1REPC 4ZYDA 4XBFA 3FXRA 5CJ9A 1YO5C 3BROA 2DAOA 2FU4A 1RZ4A 3HIFA 1HKSA 5IT9Z 3CUQA 3TKYA 1I1SA 2E1NA 4LMYA 2CW0F 3ZMVA 1O7FA 1P6RA 2WV0A 2HQRA 2HQNA 2GAUA 3N4MA 3K9TA 2EWNA 1XDUA 5CVVA 5DD4A 4B09A 2CQKA 2EJRA 1MJAA 3FMRA 2MBFA 3HTUA 3T1BA 3PFIA 3KP6A 5CYVA 2ZMEA 4WCGA 3ZMZA 3FXQA 2P5LC 4JBAA 4MNUA 5IT9K 2KRFA 2QZ8A 1QZYA 1USTA 4M73A 4AVPA 3TO7A 1XSDA 4IJAA 3R6SA 2DT5A 3QP5A 1ZYRF 4LG0A 4HV5A 2V79A 4RGUA 3E97A 2JPBA 2O03A 3HSFA 4DQ2A 3VOEA 5HLHA 3ZP5A 3RYPA 3SZTA 1W4MA 3WTTC 4BYYA 5CVUA 4HOBA 4WX9A 3LWFA 3P9KA 1FC3A 4NQWA 2JPCA 1U5TC 1QBJA 3RKWA 3ELKA 1B9NA 3FX3A 4P55A 1E2XA 2PJPA 2EFPA 2X4HA 1U3EM 2VXZA 3VFZA 1RUOA 1LNWA 1FBSA 2PMUA 3FMSA 3RPUA 2PEXA 4HLXA 2VC0A 2L4MA 3E3VA 2PFBA 5LHIA 1TTYA 5FB2A 1R1TA 2UXNA 1R1UA 3GFIA 3R4KA 3JTGA 5L3CA 4KA4A 3BJOA 3E6CC 4FX4A 4FT8A 2BEOA 2QUFA 3EUHA 4HF0A 4U0VA 2VOPA 2EFNA 5BS6A 3H3UA 3HRTA 2H6CA 2LSOA 1UHWA 1DUXC 2EFQA 1JHHA 3GFJA 2HKXA 1Z05A 1HBXG 5DYMA 3K1NA 2HTJA 3DPTA 4EJTA 4YIFA 3DV8A 2R7FA 1G6NA 2P6SA 1G3WA 3E6MA 3DQVC 1FYMA 1EV7A 2K86A 3K1PA 4Q48A 3BWGA 3FMQA 1Z9CA 1S8NA 1UB9A 5KVRA 4XSZF 2XUBA 1HSJA 2VE9A 4HQMA 2DK5A 3ZQ7A 2DQRA 1B9MA 2RGVA 5E8GA 2EV0A 1QQIA 2QVOA 3M8EA 3C7JA 2V1UA 3EDPA 3P9IA 5DCMA 4GYGA 4HF1A 3F23A 5HVQC 1JXSA 3PQKA 4I09A 1H9GA 3E6BA 5FFZA 3MCZA 1OR7A 4L0YB 2C6YA 2DBBA 2XAQA 4AIKA 3ABUA 3COAC 1AWCA 1G3SA 5ILSA 5HDKA 3SZPA 3OV8A 2OBPA 3QPHA 3WGHA 3ERED 3R0AA 2CFXA 2J5OA 1ZAOA 2ETHA 3ROUA 2IRFG 3E5XA 4RB0A 3F6OA 5LEJA 1YIOA 2J5PA 1C0WA 1WWXA 2K4JA 3GLXA 1L0OC 4OINF 1XGMA 2EB7A 2AXLA 3RIRA 4IVNA 1BC7C 1HW5A 1HXDA 1GVJA 4M71A 3R60A 5JVTA 4YFNF 1D3YA 3WU0A 3G73A 2Q8KA 2IA1A 4YG2F 4UUVA 3MQ0A 4O3MA 1LDJA 4P9UA 2FEZA 3C18A 1BJAA 3Q9VA 3Q9SA 2EV5A 3W6KB 5HDNA 1S7AA 4M74A 3T8RA 2BBYA 4G6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP7 A;  3PQJ A;  3K0L A;  1IW7 F;  2RC4 A;  4A6D A;  2DLL A;  1ZRD A;  1FOK A;  1ZGA A;  2D1V A;  3TDZ C;  3WTV C;  2LNB A;  2CSO A;  4HAM A;  5DD8 A;  3DPL C;  4YII A;  1FZP B;  1ON1 A;  3FZV A;  2P4W A;  3NRV A;  3HRU A;  4M6X A;  1K78 B;  3WGI A;  4AIH A;  3O3K A;  2NYX A;  2XGX A;  1I1G A;  4L0Z B;  3WTW C;  1ZG1 A;  1TQI A;  4BHP A;  1RI7 A;  2DW4 A;  1HW1 A;  3HRS A;  3WE2 A;  5L3B A;  2DI3 A;  1MDM B;  4Y17 A;  3FF5 A;  5LBQ A;  3WTX C;  1J75 A;  2VT3 A;  3ISP A;  5JHU A;  2ACJ A;  2ZO4 A;  2FNP A;  4ENJ A;  1W7P A;  4NB5 A;  3VOD A;  1K6O A;  3KE2 A;  3BPX A;  2L02 A;  2OAZ A;  1TW2 A;  1KU9 A;  4HV6 A;  4L9N A;  3HUG A;  2PMH A;  2HWV A;  4HX7 A;  4HW0 A;  1FY7 A;  2GIV A;  1FP2 A;  2RQP A;  2TDX A;  4R1H A;  3IWF A;  5E8I A;  5F6F A;  3WGG A;  2LF7 A;  4OMZ A;  3HOS A;  4BHB A;  3I59 A;  2L4A A;  1KU7 A;  4Y15 A;  3M8F A;  3HSR A;  2NNN A;  1KGS A;  4HQE A;  1V3F A;  3O6B B;  1T0F A;  1W5T A;  1T2K A;  2IVM A;  3RTR A;  1KQ9 A;  5L3F A;  2IPQ X;  5FD5 A;  5BMZ A;  1YW9 A;  2FBH A;  2OD5 A;  2IT0 A;  2XRO A;  4UV9 A;  4G7H F;  1XMK A;  5D8K B;  3P9C A;  1T98 A;  2NNY A;  4ENN A;  1BI1 A;  4BAY A;  3F21 A;  4HF2 A;  4LFU A;  2FBK A;  2FXA A;  3HHH A;  1YFH A;  1IXS B;  2A6E F;  5J8C A;  4L18 B;  5J6X A;  3KP2 A;  3B02 A;  3HHG A;  3GFL A;  4KN4 X;  2EK5 A;  4G94 A;  3GUD A;  4RGX A;  3OOP A;  4MTE A;  1AOY A;  1ONV A;  3VB2 A;  4BH9 A;  2MA3 A;  4S05 A;  4Z2Y A;  2VBY A;  4MQV A;  1Z1D A;  2O0Y A;  5LHH A;  4FX0 A;  5LLQ A;  2OA4 A;  4ZH4 F;  4GYI A;  1LB2 A;  2FF4 A;  4ZZL A;  4WXD A;  3KEO A;  4EJV A;  3LA2 A;  4BHC A;  4HZF A;  1P92 A;  4ZYH A;  2HYG D;  4I0A A;  1J59 A;  4EVI A;  2E7X A;  4Q5S F;  1JE8 A;  3LST A;  4MEY F;  3RJP A;  3V8K A;  4YFX F;  2VE8 A;  4ESF A;  2O3F A;  5DCF A;  2V6C A;  5HS7 A;  2PBI A;  1E17 A;  3FWE A;  5J8F A;  4P9F A;  3WTU C;  5D6E A;  3W6J B;  2DTR A;  4OIR F;  1ODD A;  2JT1 A;  3DP7 A;  5LRR A;  2QBY B;  2HKO A;  2E1C A;  4HX4 A;  4MGR A;  3I4P A;  2PLY A;  2EA4 A;  5AIQ A;  2DPU A;  5HS8 A;  2Y75 A;  1BIA A;  1USS A;  2JTV A;  1U5T B;  4EM1 A;  1YS7 A;  1STZ A;  3IKV A;  4OIQ F;  1IZ1 A;  2F5E A;  3BY6 A;  3L9F A;  1IN8 A;  4I02 A;  4RB1 A;  4I98 B;  5HS9 A;  3IKT A;  5HLI A;  5E1X A;  3REO A;  4G9Y A;  2XAS A;  2P6T A;  1T6S A;  3M9A A;  3WTS C;  2KIU A;  4UVC A;  3GVA A;  1KYZ A;  1O3Q A;  2IA2 A;  2RN7 A;  1IUY A;  1LQ1 A;  2H94 A;  1FSE A;  2ZBK A;  3I58 A;  1KQ0 A;  2HOE A;  4EGZ A;  1ON2 A;  3CUQ B;  4L5J A;  4RB2 C;  5JR3 A;  1LDD A;  4A0Z A;  1XGO A;  2LDU A;  2MH9 A;  5DEQ A;  1R58 A;  3IRQ A;  2A68 F;  2DPD A;  1IN5 A;  3KCC A;  1MJ9 A;  3MZH A;  4EQQ A;  3IHU A;  2QEN A;  3QU3 A;  2IP2 A;  1YW8 A;  5ICG A;  2HTS A;  3AAF A;  2W57 A;  2ZNY A;  2KKO A;  3SHF A;  2H27 A;  2ZME B;  3TGN A;  4CIC A;  2VC1 A;  4I2O A;  3SXY A;  3CUQ C;  1YQA A;  2XAJ A;  1IXR C;  4ZYE A;  1XGS A;  2OQR A;  3EYI A;  3C1D A;  2P7V B;  4WXH A;  3P7N A;  4LG0 B;  4AD9 A;  4MHG A;  1LDK B;  4ON0 A;  4RGS A;  4O6J A;  3F8M A;  4U88 A;  1GXP A;  2F5F A;  2AS5 F;  1T39 A;  4RAZ A;  2YX4 A;  3NQO A;  3T0Y A;  2VBX A;  1OPC A;  2Q0O A;  3GWZ A;  1SD4 A;  4KIG A;  4E70 A;  5E17 F;  1HQC A;  2FOK A;  1R5H A;  4RAY A;  5BPI A;  2KJC A;  4RS8 A;  1D8J A;  1F1Z A;  3I0T A;  1R22 A;  1H9T A;  1XSV A;  3IL2 A;  1SFU A;  5ERI A;  4JQF A;  2XKP A;  1BN5 A;  1UCR A;  1FLI A;  5D6F A;  4Y13 A;  1ZHF A;  1PP8 F;  4EM0 B;  1SFX A;  3QPT A;  2FNA A;  3MEX A;  4CXF A;  3K1M A;  2M5W A;  4A2U A;  2GA1 A;  1KYW A;  2Y48 A;  3ULQ B;  3ZPL A;  4KMU X;  3QP6 A;  4I0B A;  1YTY A;  1S7O A;  3I53 A;  2COM A;  4M9X A;  1V4R A;  1ZRF A;  2G7H A;  4XLP F;  4O5V A;  1F4K A;  1K78 A;  1QZZ A;  1TNS A;  2HYF A;  4OMY A;  3LFK A;  3KEQ A;  3K2Z A;  4LLG F;  2LF8 A;  3DEU A;  4BQA A;  4U7D A;  2JRT A;  2A6H F;  4XLN F;  1P2F A;  3ZMT A;  3F8B A;  2HFH A;  1XGN A;  3GEZ A;  1BIB A;  5LGU A;  4CYD A;  1MDM A;  2GZW A;  4KIF A;  4WWC A;  4MTD A;  3FXU A;  1IRG A;  1ZG5 A;  1I6X A;  1R7J A;  1F5T A;  1U2W A;  1LEA A;  3L2C A;  2V1X A;  5BPD A;  4F7Z A;  4A0X A;  3DFG A;  1ZGJ A;  5D4R A;  1TBX A;  4CO8 A;  1WI9 A;  3KLN A;  5DCM B;  3ECO A;  3EET A;  4A5M A;  1BI3 A;  3R61 A;  4BNC A;  4EV0 A;  1MD0 A;  2HR3 A;  3GW2 A;  1QGP A;  1KU2 A;  2FMY A;  4UHT A;  4IHS A;  1FX7 A;  4EM2 A;  2A61 A;  3MWM A;  1ZN2 A;  2HEO A;  3L00 A;  4M6Y A;  2M87 A;  1CF7 A;  2A07 F;  3BJA A;  4LB6 B;  4N9H A;  4XRF A;  1SMY F;  4KNY A;  1ULY A;  4UNO A;  2ZJ2 A;  3WE3 A;  1HKQ A;  1BC8 C;  2ZKZ A;  3CUO A;  3JSO A;  5L3E A;  1LEB A;  5CVJ A;  5ICF A;  4IRH A;  2QLZ A;  4LJZ F;  1KQ8 A;  3ZMD A;  5LEK A;  1OMI A;  4ESJ A;  1MKM A;  5F1R A;  1DDN A;  5LGT A;  4WF2 A;  4EGY A;  1ZH5 A;  1GXQ A;  3ZN1 A;  5FO5 A;  1P4A A;  3LQQ A;  1O3S A;  4ETS A;  1G3T A;  1BI0 A;  3V7C A;  1JGS A;  2Z5U A;  3KZY A;  2ISY A;  5CVR A;  1B59 A;  1Z91 A;  1TLH B;  3TOA A;  2W85 A;  1P4X A;  1O7L A;  2MH2 A;  2OZ6 A;  4LLL A;  4KMF A;  3F8F A;  1TW3 A;  2MD5 A;  5ICE A;  3KP4 A;  1KU3 A;  3CJN A;  3CO7 C;  2K4B A;  3MZY A;  4L9V A;  2CO5 A;  3LAP A;  4IPA A;  2MLK A;  3TDU C;  1JHF A;  2X0L A;  1OYW A;  4BXU A;  3SFZ A;  2FQ3 A;  4RB3 C;  2NRA C;  3FHZ A;  1S3J A;  4HA8 A;  3WU1 B;  3R0J A;  5FLX Z;  1L3L A;  3Q5F A;  4Q47 A;  2H6B A;  2FSW A;  5HDG A;  1Z6R A;  2DQL A;  4PZJ A;  1BM9 A;  5D5X B;  3GXO A;  1WKM A;  2QQ9 A;  4HLY A;  1SD6 A;  3J7A O;  2GXG A;  3M1E A;  1BBY A;  4A0Y A;  3F22 A;  3GF2 A;  5D5V B;  3DXJ F;  4AWX B;  2HGC A;  2V9V A;  3QRF F;  4ZYG A;  5D5U B;  2D2W A;  4ZZD A;  5FLX K;  3IRR A;  3FM3 A;  3HSE A;  3N97 A;  1GHC A;  5LGN A;  5EEH A;  3D5L A;  4P5O A;  2EV6 A;  5D4S A;  1IXC A;  2IW5 A;  1YYV A;  2XHK A;  3GO5 A;  3HRM A;  2ESN A;  5DUI A;  1O57 A;  3S2W A;  3WG9 A;  4GXO A;  1MJB A;  2QM3 A;  4PCQ A;  4I7H A;  2PG4 A;  2MC3 A;  1U5T A;  2OU2 A;  2A3S A;  1IAW A;  1H0M A;  1WSU A;  3V7S A;  3I71 A;  5D5W B;  2FRH A;  1I5Z A;  2FBI A;  3JTH A;  2YSR A;  1RNL A;  4RGR A;  1G4D A;  2GA2 A;  3KFW X;  4IRI A;  2F5D A;  3LA3 A;  4EJW A;  2WTE A;  1ZRE A;  1FNN A;  3BZ6 A;  2VBZ A;  5E20 A;  4LGW A;  3U1D A;  3BPV A;  2WC2 A;  3FM5 A;  3MFK A;  1FP1 D;  3QOP A;  2IA0 A;  5DDG A;  1FYK A;  4P96 A;  5LHG A;  3GYH X;  4KYW A;  3ZMU A;  4UVB A;  3D0S A;  2HS5 A;  2O6G E;  1NHA A;  3JW4 A;  1S29 A;  4LLN A;  2ESH A;  1R36 A;  3CTA A;  1UFM A;  2CGP A;  4G6D A;  2IJL A;  2VOO A;  5EEG A;  2YX7 A;  5BOX A;  2ZNZ A;  4EMS A;  4YFK F;  2DK8 A;  3GZ5 A;  4A6E A;  5K1Y A;  2G7U A;  1J7K A;  4OOI A;  1DP7 P;  4QLC U;  4GGG A;  2CWE A;  2YPR A;  3H3Z A;  2GWR A;  3RPQ A;  1SMT A;  2Y0M A;  2ZXJ A;  5H20 A;  5H6Q A;  4CGZ A;  1XCV A;  3NEU A;  1K7A A;  1Q1H A;  1IRF A;  1X3U A;  3ML6 A;  4KFC A;  5E1W A;  2QYO A;  4N0B A;  1BI2 A;  4FHT A;  1OYI A;  4AIJ A;  1OKR A;  2A5Y B;  5AON A;  1D5V A;  1TQM A;  1LVA A;  3CLO A;  5D8L B;  1ZG3 A;  4KIC A;  4CDG A;  1XD7 A;  2V1D A;  2R7D A;  1PDN C;  1SFE A;  4M9Z A;  2XRN A;  5IT3 A;  2L54 A;  1IN6 A;  2PI0 A;  2Z99 A;  2OZU A;  1HKT A;  3DKW A;  1J9I A;  1R00 A;  2FA5 A;  2KIM A;  2XKO A;  1FBU A;  4KUM A;  3RKY A;  2H09 A;  4EJU A;  2K27 A;  3VEP A;  1QPM A;  2PN6 A;  4HBL A;  1IN7 A;  2ISZ A;  3ZMS A;  3WTZ A;  2Z3Y A;  4HYE A;  4MQ9 F;  1IF1 A;  2HZT A;  2NAZ A;  1B4A A;  3TQN A;  2DFI A;  2EA2 A;  1TQP A;  2KJB A;  3SQN A;  3BOQ A;  2FML A;  2R3S A;  2ZFW A;  2K7L A;  4KN7 X;  4KT5 C;  5ICC A;  3L09 A;  3RYR A;  3LQR A;  5CVI A;  1WRJ A;  4M9S A;  1RIO H;  4GCV A;  1J2X A;  3TO9 A;  3J81 Z;  3RKX A;  3BP8 A;  5A2Q Z;  2OQG A;  5L3G A;  4XSX F;  4UXN A;  1EH6 A;  3TO6 A;  2G9W A;  1YW7 A;  3V4G A;  2F2E A;  4L9J A;  2DU9 A;  3F8N A;  4EJO A;  2RVC A;  2WWY A;  4QWQ A;  4PDK A;  3H92 A;  5JFR A;  3F3X A;  5FFX A;  1EH7 A;  1RUN A;  3K69 A;  1W5S A;  3J81 K;  3LAJ A;  5E18 F;  1UHM A;  4OIP F;  4G8X A;  1YLF A;  3F6V A;  5A2Q K;  3O2P E;  3QU6 A;  3BJ6 A;  1A04 A;  4ENM A;  2P8T A;  1ZAR A;  3KLO A;  1SD7 A;  3DF8 A;  2K02 A;  5H6R A;  2XVC A;  1Z7U A;  3BDD A;  1YS6 A;  5F64 A;  5DV5 A;  2P7C B;  4WXC A;  1U78 A;  2XAH A;  3KP5 A;  2UWM A;  1U6G A;  2JSC A;  3V7R A;  3T5X A;  3C3W A;  4MEX F;  1QNT A;  3I54 A;  4GO1 A;  4LD5 A;  1FYL A;  2PQ8 A;  4JK1 X;  5BQT A;  2ADU A;  1U8R A;  4A12 A;  2L3D A;  2W24 A;  4Q4Z F;  4KIB A;  3V8J A;  2VN2 A;  1J5Y A;  1KA8 A;  2P5K A;  2ZCW A;  2EFO A;  2JZY A;  3F8C A;  2Z9O A;  1ZLK A;  1FBQ A;  2ELH A;  5FGM A;  3E6D A;  2D1H A;  3JSP A;  4M72 A;  3EQL F;  4IXA A;  5HLG A;  1G3Y A;  2CG4 A;  4CZZ A;  1R1V A;  4ENK A;  4DNC A;  3E5U A;  1EH8 A;  1IN4 A;  2NS0 A;  4WK8 F;  2RKH A;  4OIO F;  4UV8 A;  3GZ6 A;  5JI6 A;  5K5Q A;  1SD5 A;  4IF4 A;  3CDH A;  2E7W A;  4S04 A;  2QQA A;  2RV8 A;  2LKP A;  2UXX A;  3B73 A;  1YG2 A;  3WTY C;  2STT A;  4U7B A;  1ZLJ A;  3ECH A;  1S6L A;  4HDU A;  1OYY A;  2KIF A;  4A5N A;  2GXB A;  5TJJ A;  5KK1 A;  1B6A A;  5ED4 A;  2XIG A;  2FE3 A;  3WOD F;  2Q2E A;  2MLG A;  1R5G A;  5LRS A;  1DPU A;  3CO6 C;  2M8E A;  1FSH A;  2YR2 A;  3I5U A;  2YU3 A;  1DPR A;  4CHU A;  3U2R A;  3T8T A;  2F5C A;  1O3R A;  2VT2 A;  1XMA A;  4NHJ A;  4HDV A;  3HTS B;  3LA7 A;  1LJ9 A;  3M7G A;  2XAG A;  3ZN0 A;  1J0R A;  2BE5 F;  2M30 A;  2P5V A;  2A69 F;  1XSX A;  4LK0 F;  6PAX A;  2VBW A;  3GX4 X;  4HX8 A;  4IHT A;  4R79 A;  2HDC A;  4OU0 A;  1XN7 A;  2O61 A;  1CGP A;  2STW A;  4ESB A;  2GQQ A;  3J80 Z;  2L01 A;  1HW2 A;  3RI4 A;  3ABT A;  5K5O A;  1FT9 A;  3IWZ A;  1K79 A;  1SAX A;  1FPQ A;  2BV6 A;  1HST A;  3TOB A;  1W7P D;  4UVA A;  4U0W A;  3L7W A;  1R23 A;  1O3T A;  5FD6 A;  4I01 A;  3V8L A;  2D45 A;  4L9T A;  1PUE E;  4IRG A;  2UZK A;  3J80 K;  3F72 A;  2QQB A;  4K2E A;  5AIP A;  1WQ2 A;  5L3D A;  4G7Z F;  2RNJ A;  3JAM Z;  2W25 A;  2XV4 S;  1I27 A;  3G3Z A;  2CYY A;  4PGG A;  1CF7 B;  2QWW A;  4PGH A;  2EFW A;  2M1B A;  1BOA A;  3IC7 A;  3E5Q A;  2Z33 A;  1Y0U A;  1VTN C;  4D0P A;  2VOD A;  4LB5 A;  3GFM A;  5K5R A;  2M45 A;  2O8X A;  4ASN A;  4N9I A;  3KZZ A;  4LK1 F;  4G7O F;  5ILV A;  1F9N A;  2QBY A;  5TRD A;  4L5I A;  4H0E A;  3JAM K;  4TV7 A;  3HYI A;  1B1B A;  3MAJ A;  1W7P B;  3I64 A;  2B0L A;  1QO0 D;  5ILU A;  1TNT A;  1XCB A;  1XB4 A;  1ZRC A;  1T38 A;  1MZB A;  3HOT A;  1D8K A;  5CLS A;  1P4W A;  3QAH A;  2DO7 A;  5E1Z B;  1FWZ A;  2XAF A;  1Z6T A;  3RDI A;  4U0Y A;  3KET A;  4KDP A;  1PP7 U;  3KP3 A;  3I59 B;  2BYV E;  2BGC A;  1XDS A;  4R8H A;  5DUK A;  1MGT A;  3U9G A;  2RDP A;  4B8X A;  2VON A;  2W84 A;  5HOO A;  3EYY A;  1REP C;  4ZYD A;  4XBF A;  3FXR A;  5CJ9 A;  1YO5 C;  3BRO A;  2DAO A;  2FU4 A;  1RZ4 A;  3HIF A;  1HKS A;  5IT9 Z;  3CUQ A;  3TKY A;  1I1S A;  2E1N A;  4LMY A;  2CW0 F;  3ZMV A;  1O7F A;  1P6R A;  2WV0 A;  2HQR A;  2HQN A;  2GAU A;  3N4M A;  3K9T A;  2EWN A;  1XDU A;  5CVV A;  5DD4 A;  4B09 A;  2CQK A;  2EJR A;  1MJA A;  3FMR A;  2MBF A;  3HTU A;  3T1B A;  3PFI A;  3KP6 A;  5CYV A;  2ZME A;  4WCG A;  3ZMZ A;  3FXQ A;  2P5L C;  4JBA A;  4MNU A;  5IT9 K;  2KRF A;  2QZ8 A;  1QZY A;  1UST A;  4M73 A;  4AVP A;  3TO7 A;  1XSD A;  4IJA A;  3R6S A;  2DT5 A;  3QP5 A;  1ZYR F;  4LG0 A;  4HV5 A;  2V79 A;  4RGU A;  3E97 A;  2JPB A;  2O03 A;  3HSF A;  4DQ2 A;  3VOE A;  5HLH A;  3ZP5 A;  3RYP A;  3SZT A;  1W4M A;  3WTT C;  4BYY A;  5CVU A;  4HOB A;  4WX9 A;  3LWF A;  3P9K A;  1FC3 A;  4NQW A;  2JPC A;  1U5T C;  1QBJ A;  3RKW A;  3ELK A;  1B9N A;  3FX3 A;  4P55 A;  1E2X A;  2PJP A;  2EFP A;  2X4H A;  1U3E M;  2VXZ A;  3VFZ A;  1RUO A;  1LNW A;  1FBS A;  2PMU A;  3FMS A;  3RPU A;  2PEX A;  4HLX A;  2VC0 A;  2L4M A;  3E3V A;  2PFB A;  5LHI A;  1TTY A;  5FB2 A;  1R1T A;  2UXN A;  1R1U A;  3GFI A;  3R4K A;  3JTG A;  5L3C A;  4KA4 A;  3BJO A;  3E6C C;  4FX4 A;  4FT8 A;  2BEO A;  2QUF A;  3EUH A;  4HF0 A;  4U0V A;  2VOP A;  2EFN A;  5BS6 A;  3H3U A;  3HRT A;  2H6C A;  2LSO A;  1UHW A;  1DUX C;  2EFQ A;  1JHH A;  3GFJ A;  2HKX A;  1Z05 A;  1HBX G;  5DYM A;  3K1N A;  2HTJ A;  3DPT A;  4EJT A;  4YIF A;  3DV8 A;  2R7F A;  1G6N A;  2P6S A;  1G3W A;  3E6M A;  3DQV C;  1FYM A;  1EV7 A;  2K86 A;  3K1P A;  4Q48 A;  3BWG A;  3FMQ A;  1Z9C A;  1S8N A;  1UB9 A;  5KVR A;  4XSZ F;  2XUB A;  1HSJ A;  2VE9 A;  4HQM A;  2DK5 A;  3ZQ7 A;  2DQR A;  1B9M A;  2RGV A;  5E8G A;  2EV0 A;  1QQI A;  2QVO A;  3M8E A;  3C7J A;  2V1U A;  3EDP A;  3P9I A;  5DCM A;  4GYG A;  4HF1 A;  3F23 A;  5HVQ C;  1JXS A;  3PQK A;  4I09 A;  1H9G A;  3E6B A;  5FFZ A;  3MCZ A;  1OR7 A;  4L0Y B;  2C6Y A;  2DBB A;  2XAQ A;  4AIK A;  3ABU A;  3COA C;  1AWC A;  1G3S A;  5ILS A;  5HDK A;  3SZP A;  3OV8 A;  2OBP A;  3QPH A;  3WGH A;  3ERE D;  3R0A A;  2CFX A;  2J5O A;  1ZAO A;  2ETH A;  3ROU A;  2IRF G;  3E5X A;  4RB0 A;  3F6O A;  5LEJ A;  1YIO A;  2J5P A;  1C0W A;  1WWX A;  2K4J A;  3GLX A;  1L0O C;  4OIN F;  1XGM A;  2EB7 A;  2AXL A;  3RIR A;  4IVN A;  1BC7 C;  1HW5 A;  1HXD A;  1GVJ A;  4M71 A;  3R60 A;  5JVT A;  4YFN F;  1D3Y A;  3WU0 A;  3G73 A;  2Q8K A;  2IA1 A;  4YG2 F;  4UUV A;  3MQ0 A;  4O3M A;  1LDJ A;  4P9U A;  2FEZ A;  3C18 A;  1BJA A;  3Q9V A;  3Q9S A;  2EV5 A;  3W6K B;  5HDN A;  1S7A A;  4M74 A;  3T8R A;  2BBY A;  4G6Q A; 
#chains in the Genus database with same CATH topology
 3KP7 A;  1JJ8 C;  1HDP A;  3PQJ A;  3CZ6 A;  3K0L A;  4X1E A;  3W3C A;  5EZG A;  3CP8 A;  1IW7 F;  2RC4 A;  1AA7 A;  3ZQI A;  4A6D A;  2DLL A;  1ZRD A;  3BT9 A;  1FOK A;  1ZGA A;  2D1V A;  1UJ8 A;  2EBI A;  3TDZ C;  3C2B A;  3WTV C;  2LNB A;  2XRL A;  2CSO A;  4HAM A;  2YS9 A;  5DD8 A;  3DPL C;  1S7E A;  2LMD A;  4YII A;  1FZP B;  2E2I J;  1ON1 A;  3FZV A;  1VQK I;  1BA5 A;  3LOC A;  3HG9 A;  4HNT A;  2V9K A;  2P4W A;  3NRV A;  3CDL A;  3HRU A;  1RET A;  4M6X A;  1K78 B;  3WGI A;  4AIH A;  2DFH A;  2M4G A;  3O3K A;  2NYX A;  4YIR X;  2XGX A;  2IGK A;  3GME A;  2HYJ A;  1KZH A;  1ETV A;  2DMT A;  4E7K A;  2IS4 A;  2CH0 A;  2JVG A;  1I1G A;  2W00 A;  4L0Z B;  3WTW C;  3SFI A;  1ZG1 A;  1I6H J;  2WAE A;  2E1M C;  1TQI A;  2HQA A;  2AQE A;  1VI0 A;  2LKX A;  4BHP A;  4DJA A;  3DCF A;  2LBF B;  1RI7 A;  1E3P A;  4XR6 A;  2DW4 A;  1HW1 A;  1SEU A;  3HRS A;  4I76 A;  1DP3 A;  1N77 A;  3WE2 A;  5L3B A;  2DI3 A;  3J7Y J;  1MDM B;  4Y17 A;  3E1S A;  2BW3 A;  3ERM A;  3FF5 A;  3CDI A;  5LBQ A;  5C4J J;  2DYR H;  3WTX C;  4IX7 A;  1J75 A;  3DLL F;  2VT3 A;  3ISP A;  3Q0V A;  2JSP A;  5JHU A;  2ACJ A;  1SC7 A;  2ZO4 A;  2FNP A;  4ENJ A;  1W7P A;  3QOE A;  4NB5 A;  3CD6 I;  2WAD A;  3VOD A;  1R9T J;  1K6O A;  3KE2 A;  1TWH J;  2ZJR F;  3BPX A;  3K4B A;  2L02 A;  2OAZ A;  4XQF A;  3DBR B;  1TW2 A;  2EQR A;  1KU9 A;  2W48 A;  3OYA A;  1HA8 A;  4HV6 A;  3FK6 A;  2VQC A;  4L9N A;  3HUG A;  2DA6 A;  2HWV A;  2PMH A;  4HX7 A;  4OAZ A;  4HW0 A;  2R7U A;  5B3S H;  3I4N J;  1FY7 A;  1BW5 A;  2GIV A;  3QYF A;  1FP2 A;  2RQP A;  2TDX A;  2LP0 A;  4R1H A;  1Y56 A;  3IWF A;  5E8I A;  5F6F A;  4BY7 J;  3WGG A;  2LF7 A;  3CJR B;  4OMZ A;  3HOS A;  2Y0S A;  4BHB A;  2XSJ C;  3CLQ A;  3I59 A;  4E4H A;  3I9V 2;  3K6G A;  2L4A A;  1KU7 A;  2CUZ A;  4Y15 A;  3M8F A;  1VFC A;  3HSR A;  2CW7 A;  1H8A C;  3O8H A;  2Q2E B;  2NNN A;  3WHC A;  1KGS A;  1BR1 A;  4HQE A;  1TWC J;  1V3F A;  2MFZ A;  3O6B B;  4ZTJ A;  2DFF A;  1T0F A;  1W5T A;  1T2K A;  1HOM A;  1YJ9 I;  3OS0 A;  2IVM A;  3RTR A;  1KQ9 A;  5L3F A;  2IPQ X;  1AKH A;  5FD5 A;  2X1D A;  4QSH A;  1IG7 A;  2XGE A;  3A01 B;  5BMZ A;  2QSF X;  1YW9 A;  2FBH A;  2OD5 A;  2IT0 A;  1ETK A;  1VQ4 I;  4ANJ A;  2XRO A;  2CFO A;  4UV9 A;  4G7H F;  4MLO A;  1XMK A;  5D8K B;  4A93 J;  3P9C A;  3HOX J;  1Z3X A;  2MW8 A;  1T98 A;  3ASN H;  4PUS A;  4IQ4 A;  2NNY A;  4ENN A;  1BI1 A;  1EKE A;  4BAY A;  3F21 A;  4HF2 A;  1MIJ A;  1X2N A;  4LFU A;  5F27 A;  1B8I A;  4F52 A;  1WJA A;  2FBK A;  2EZL A;  2FXA A;  3SYT A;  3HHH A;  2E5Z A;  2L9R A;  4B3X A;  1YFH A;  1IXS B;  2M34 A;  2A6E F;  5J8C A;  3W2A A;  5JLX A;  5J6X A;  3KP2 A;  4L18 B;  1S5L C;  3B02 A;  3HDD A;  1OJL A;  3HHG A;  4XLE A;  3WHB A;  3GFL A;  4E7J A;  4KN4 X;  2EK5 A;  4G94 A;  3GUD A;  4RGX A;  3OOP A;  1I3A A;  1R4N B;  4MTE A;  2B63 J;  1AOY A;  3SEQ A;  2QEX I;  1RKW A;  4XM3 A;  1ONV A;  3K4M A;  3VB2 A;  4BH9 A;  2MA3 A;  4S05 A;  1Q1V A;  4Z2Y A;  1T33 A;  2VBY A;  1VND A;  4MQV A;  1Z1D A;  3CCL I;  1WJ5 A;  1TL8 A;  2O0Y A;  3B6C A;  5LHH A;  4FX0 A;  1D1B A;  3PUF A;  5LLQ A;  4GFB A;  2R93 J;  3JRF A;  2R7V A;  2EZH A;  2OA4 A;  4IKF A;  3U1K A;  4ZH4 F;  4GYI A;  1W0T A;  1LB2 A;  4XKW A;  2FF4 A;  1JGG A;  3OYI A;  4ZZL A;  4WXD A;  3KEO A;  4EJV A;  2CV0 A;  2Y31 A;  3LA2 A;  2BHZ A;  2KMU A;  3CC7 I;  3OYJ A;  2I8D A;  4BHC A;  4HZF A;  3U21 A;  2R7S A;  1P92 A;  1X2M A;  3K10 A;  4ZYH A;  3K70 D;  2HYG D;  4I0A A;  1J59 A;  1PUF B;  3CJT B;  1ERD A;  3IV5 A;  3OS1 A;  3ZQQ A;  4Y52 J;  4EVI A;  2JA2 A;  2E7X A;  3J7A Y;  2HNH A;  4CCM A;  4Q5S F;  4BQO A;  4CCK A;  1JE8 A;  3PL8 A;  5FJ8 J;  1ETO A;  2M0C A;  3FXM A;  2GOM A;  2L5Q A;  4N4O B;  3CJQ B;  1IDZ A;  3LST A;  4MEY F;  3RJP A;  3V8K A;  4YFX F;  2VE8 A;  2ECC A;  4ESF A;  1WVR A;  2O3F A;  5DCF A;  4UUS A;  2V6C A;  5KAF C;  3CCR I;  5HS7 A;  2KZG A;  2PBI A;  1E17 A;  3BCA A;  3FWE A;  5J8F A;  4P9F A;  1BR2 A;  3WTU C;  5D6E A;  4FCY A;  1TC3 C;  3W6J B;  2O9L A;  4V2F A;  2JQ7 A;  4YEL A;  1FMW A;  2DTR A;  4OIR F;  4F91 B;  3M8J A;  1ODD A;  1VQP I;  2JT1 A;  2XF5 A;  3DP7 A;  4CA0 A;  5LRR A;  1DU6 A;  1UG0 A;  1CQT A;  2QBY B;  2HKO A;  2R5Z B;  2E1C A;  4HX4 A;  4M3B A;  2MYS A;  4MGR A;  1H89 C;  5CKT A;  4XID A;  3I4P A;  2PLY A;  3H36 A;  1DU0 A;  2K85 A;  2EA4 A;  5AIQ A;  2NOG A;  2DPU A;  3FKJ A;  5HS8 A;  4DIQ A;  5CQE A;  2Y75 A;  3AKZ A;  1BIA A;  1USS A;  2R7W A;  2JTV A;  1U5T B;  4XOP A;  4EM1 A;  1YS7 A;  2DJI A;  2Y9Y A;  5IYB J;  3ABM H;  3CES A;  2CMP A;  5EG0 A;  2ZB9 A;  3KZI C;  1LE8 A;  1STZ A;  4A3F J;  3IKV A;  4OIQ F;  5DM6 F;  1LFU P;  1IZ1 A;  2WV1 A;  2F5E A;  2CV1 A;  4IOC F;  3BY6 A;  3RZD J;  3L9F A;  1IN8 A;  4I02 A;  4E7H A;  4RB1 A;  5J4Y A;  2A5W A;  4QTR A;  4I98 B;  1F36 A;  3AG2 H;  2V4J C;  5HS9 A;  3IKT A;  3ZR8 X;  5HLI A;  5E1X A;  1WJB A;  2CU7 A;  5J1U A;  1FOW A;  3H35 A;  3REO A;  1WHU A;  2HXO A;  1XMX A;  4G9Y A;  4E6K G;  3A4C A;  3IUO A;  2XAS A;  1V54 H;  2P6T A;  1T6S A;  5EGO A;  3M9A A;  4S0H B;  2PJR A;  3VYT B;  3WTS C;  4BAC A;  2KIU A;  2A6T A;  4UVC A;  1XG1 A;  3GVA A;  4RM3 A;  1KYZ A;  1O3Q A;  2F6C A;  1N75 A;  2IA2 A;  3MKY B;  2RN7 A;  1IUY A;  2ZJP F;  1RC9 A;  1LQ1 A;  3LNQ A;  1IV8 A;  1FSE A;  2H94 A;  4ZDP A;  5LFA A;  2V7F A;  5C3E J;  1MBJ A;  2ZBK A;  1APL C;  3OYM A;  3I58 A;  1M1E B;  1D5Y A;  1KQ0 A;  2HOE A;  4EGZ A;  1ON2 A;  1SFO J;  3CUQ B;  2QSG X;  2KL4 A;  4L5J A;  4XN0 A;  4RB2 C;  5JR3 A;  3A0B C;  1LDD A;  4PJL A;  4A0Z A;  1XGO A;  3H0D A;  2LDU A;  2MH9 A;  5DEQ A;  1R58 A;  3IRQ A;  2ZJQ F;  3LSM A;  2CUF A;  2A68 F;  2DPD A;  3ONQ A;  1UZC A;  1IN5 A;  3OYG A;  3KCC A;  1MJ9 A;  3MZH A;  2R7Z J;  2VJ5 A;  3ABK H;  2HVR A;  4EQQ A;  3IHU A;  4F55 A;  4BE0 A;  5FRN A;  1RKT A;  2QEN A;  2R0Q C;  3QU3 A;  2IP2 A;  1YW8 A;  5ICG A;  2HTS A;  3AAF A;  2W57 A;  4B43 A;  1X1C A;  4H4K C;  2ZNY A;  2KKO A;  3SHF A;  2H27 A;  2ZME B;  2E34 A;  2FD5 A;  3TGN A;  1BW6 A;  1FTT A;  4CIC A;  5JHF A;  2VC1 A;  3HPH A;  2M7B A;  3MKL A;  3SXY A;  4I2O A;  3CUQ C;  1I3Q J;  1YQA A;  2IS1 A;  2XAJ A;  4BKX A;  1AHD P;  1S9H A;  1IXR C;  4Y3O A;  4ZYE A;  5M5Y J;  1OCO H;  1XGS A;  4YRV A;  3S1R J;  2OQR A;  3EYI A;  3C1D A;  4DZJ A;  2P7V B;  4WXH A;  3P7N A;  4LG0 B;  4AD9 A;  1FOY A;  3P5J A;  4MHG A;  1LDK B;  4ON0 A;  2Y9Z A;  3FXJ A;  4RGS A;  3Q0U A;  4O6J A;  2TCT A;  3F8M A;  4U88 A;  4XRS G;  1V5F A;  4DBR A;  2LLK A;  1GXP A;  2F5F A;  3CC4 I;  2AS5 F;  1T39 A;  3K2A A;  2ZME C;  3VYU B;  4RAZ A;  3OIP A;  3OYE A;  4RLQ A;  2YX4 A;  4JX4 A;  2WBM A;  3NQO A;  5KNL A;  3T0Y A;  2VBX A;  4G12 A;  2WY8 Q;  5E3N A;  3BR2 A;  3ESW B;  2GIZ A;  4BXX J;  1Y0N A;  1OPC A;  4XNF A;  1MND A;  2L9V A;  2Q0O A;  3GWZ A;  1SD4 A;  4KIG A;  2MD0 A;  4NQW B;  5IY5 H;  4E70 A;  5E17 F;  1HQC A;  3HKZ A;  2FOK A;  4CCN A;  2DFE A;  1R5H A;  5FKO A;  4RAY A;  5BPI A;  2A05 A;  2K9S A;  2KJC A;  2AXT C;  4RS8 A;  1D8J A;  2WA0 A;  3H5R A;  1F1Z A;  5GTI C;  4IL6 C;  3I0T A;  1R22 A;  1H9T A;  3S1N J;  1XSV A;  3IL2 A;  1SFU A;  5ERI A;  3HXL A;  2OJE D;  4JQF A;  2XKP A;  3BQY A;  3W2W A;  1BN5 A;  2DOD A;  1UCR A;  1FLI A;  5D6F A;  4P1W A;  2FOW A;  4Y13 A;  1ZHF A;  2H8W A;  2Y2Z A;  3HEF A;  4PJ0 C;  5J1Y A;  1PP8 F;  3CCY A;  1B72 A;  4EM0 B;  4BJ5 C;  4E7L A;  2JK3 A;  2L9S A;  4EAT A;  1SFX A;  3QPT A;  2CQQ A;  2FNA A;  3QOD A;  4NC7 A;  5F0F A;  3MEX A;  3K4J A;  4CXF A;  2E60 A;  1S72 I;  1Z21 A;  3K1M A;  2M5W A;  2WY7 Q;  4A2U A;  3DLA A;  2GA1 A;  4KT6 A;  3ABL H;  3ZOB A;  3FBI B;  1KYW A;  2Y48 A;  3KX2 A;  3ULQ B;  2KQR A;  3ZPL A;  3S2D J;  4KMU X;  3QP6 A;  1OFC X;  2MC4 A;  3BTL A;  4I0B A;  2WAF A;  1YTY A;  1EJ9 A;  1S7O A;  3I53 A;  3D1N I;  4IHW A;  2COM A;  4M9X A;  1V4R A;  5B1B H;  2LY1 A;  1ZRF A;  2G7H A;  4XLP F;  3CCM I;  4O5V A;  2K40 A;  2NOJ B;  3AFH A;  1F4K A;  1K78 A;  1MBE A;  2R7R A;  5B5E C;  1QZZ A;  1TNS A;  2HYF A;  1QVU A;  4OMY A;  2JA7 J;  3LFK A;  4J01 A;  4ZC3 A;  4E7I A;  3BR1 A;  4MFD A;  1RPW A;  2ZSI B;  2W7N A;  1FEX A;  3KEQ A;  1HC8 A;  3K2Z A;  2JUG A;  3EUH C;  1MH4 A;  3CQZ J;  4LLG F;  3L2W A;  2VJI A;  2LBF A;  4HNV A;  2LF8 A;  3DEU A;  4BQA A;  4U7D A;  1D1C A;  2JRT A;  2A6H F;  4XLN F;  1P2F A;  3ZMT A;  3F8B A;  5IP7 J;  2HFH A;  1XGN A;  3GEZ A;  3PM1 A;  3S1M J;  1BIB A;  3CCE I;  2ME0 A;  5LGU A;  4CYD A;  5KHD A;  1MDM A;  2GZW A;  4V2G A;  4KIF A;  1A5J A;  2QQ8 A;  4WWC A;  4ZTF A;  2JN6 A;  3N05 A;  2VI6 A;  1K4T A;  4MTD A;  3QYE A;  3FXU A;  1IRG A;  5KAI C;  1EF4 A;  1ZG5 A;  1I6X A;  3TW6 A;  4A3C J;  1R7J A;  4XOT A;  1F5T A;  1U2W A;  1Y8R B;  1LEA A;  2VKE A;  4B47 A;  1IV6 A;  2FX0 A;  3L2C A;  2V1X A;  5BPD A;  4F7Z A;  4A0X A;  3DFG A;  1ZGJ A;  5IOY A;  5D4R A;  4DOZ A;  5F1J A;  4RM2 A;  1TBX A;  4CO8 A;  5J1R A;  3RQ4 A;  3PNT A;  1WI9 A;  3KLN A;  4BDY A;  2DTZ A;  2E1M B;  5DCM B;  3ECO A;  2B7E A;  4HEA 2;  3HOY J;  3EET A;  4D5F A;  2JVH A;  4A5M A;  1G59 A;  3V42 A;  4A3I J;  2HU9 A;  1LPQ A;  2LYC A;  4XMY A;  1BI3 A;  1HCR A;  2XF6 A;  3R61 A;  4BNC A;  3FK7 A;  5BNG A;  4EV0 A;  2E36 A;  4B48 A;  1MD0 A;  5B66 C;  2EPF A;  2HR3 A;  2DDA A;  3OYC A;  3GTP J;  3GW2 A;  4G6T B;  4A3G J;  1QGP A;  1KU2 A;  2HZD A;  2FMY A;  3GBG A;  2DOE A;  4UHT A;  1YI2 I;  3TP3 A;  1R49 A;  2OF7 A;  2X9D A;  3MKW B;  3FBN B;  3JRG A;  4IHS A;  1Y6I A;  1FX7 A;  4EM2 A;  2A61 A;  3DEE A;  3MWM A;  1DGR M;  3A2K A;  1ZN2 A;  3S1Q J;  2V1N A;  1P7J A;  1JT6 A;  4IHV A;  3HBL A;  2HEO A;  5J3L A;  2JWT A;  3PIP F;  2F5V A;  1XS9 A;  2HPM A;  3L00 A;  4M6Y A;  2M87 A;  2VL8 A;  1CF7 A;  2A07 F;  3BJA A;  1GVD A;  2V26 A;  4LB6 B;  5GAG J;  3BG9 A;  4N9H A;  2AQF A;  4XRF A;  1SMY F;  4KNY A;  1ULY A;  5TIS C;  2ZJ2 A;  4UNO A;  3WE3 A;  1HKQ A;  1BC8 C;  2ZKZ A;  3CUO A;  2P0W A;  3JSO A;  5L3E A;  4FIS A;  1FMV A;  1LEB A;  5CVJ A;  1VQ8 I;  3QYB A;  5ICF A;  4IRH A;  2QLZ A;  4Y7N J;  1OR7 C;  2IAI A;  4LJZ F;  3RSN A;  1MMA A;  1VF9 A;  1QZE A;  1VQ6 I;  3HOZ J;  1KQ8 A;  3ZMD A;  5LEK A;  1OMI A;  4ESJ A;  1JJ6 C;  1MKM A;  2HI3 A;  5F1R A;  1DDN A;  3JR9 A;  4EEF G;  4HG2 A;  5LGT A;  3PO2 J;  2LY2 A;  2KIS A;  5DS9 A;  3ZRG A;  4WF2 A;  1PYV A;  3JRD A;  4OWR B;  4EGY A;  1TT5 B;  1ZH5 A;  1GXQ A;  3ZN1 A;  3CMA I;  5FO5 A;  1P4A A;  1YHQ I;  2X48 A;  3LQQ A;  4CYC B;  1O3S A;  4ETS A;  1G3T A;  3M07 A;  1BI0 A;  2VLA A;  3OL4 A;  1GV5 A;  3V7C A;  1JGS A;  2Z5U A;  3KZY A;  2ISY A;  5CVR A;  5KCM A;  3I56 I;  1B59 A;  1V5E A;  1Z91 A;  1TLH B;  4II2 A;  5TGT A;  1MSF C;  3TOA A;  2W85 A;  1P4X A;  3CC2 I;  2H1K A;  1O7L A;  1A31 A;  2MH2 A;  2OZ6 A;  4LLL A;  4AVZ A;  1Y39 A;  1WH5 A;  4A3M J;  4KMF A;  3IH2 A;  2RNG A;  3F8F A;  1GLN A;  1TW3 A;  1SVL A;  1A6Q A;  2MD5 A;  5ICE A;  3KP4 A;  3OS2 A;  1IGN A;  1KU3 A;  3CJN A;  2K4B A;  3MZY A;  4L9V A;  3CO7 C;  2CO5 A;  4IPA A;  2MLK A;  3TDU C;  3LAP A;  1JHF A;  2X0L A;  1OYW A;  1LVK A;  3PIO F;  3I55 I;  3GTO J;  4BXU A;  3SFZ A;  2FQ3 A;  1QHH D;  4RB3 C;  1QVT A;  2NRA C;  3FHZ A;  1S3J A;  4HA8 A;  3WU1 B;  1JKR C;  3OOU A;  3R0J A;  5FLX Z;  1L3L A;  3Q5F A;  2XGC A;  4ITV A;  4FE4 A;  4Q47 A;  4JP0 A;  2H6B A;  1PUF A;  2FSW A;  2CV2 A;  5HDG A;  2IBD A;  1Z6R A;  2DQL A;  4PZJ A;  1BM9 A;  5D5X B;  4XOR A;  3BQZ A;  3GXO A;  2R92 J;  1WKM A;  3VSL A;  3SEZ A;  2HVQ A;  2QQ9 A;  4HLY A;  1SD6 A;  3J7A O;  4XKB A;  2IGN A;  3JRH A;  4C3I J;  1E0E A;  4Y4R A;  2K9M A;  3EUK L;  2GXG A;  2L2O A;  3M1E A;  1BBY A;  4A0Y A;  3F22 A;  3GF2 A;  5D5V B;  2JRM A;  3DXJ F;  4LG3 A;  4AWX B;  2HGC A;  2V9V A;  1JUP A;  4D1Q A;  3QRF F;  2DOA A;  4ZYG A;  5D5U B;  2M4K A;  1VQL I;  3K4N A;  2D2W A;  3L2Q A;  3X2Q H;  4ZZD A;  5FLX K;  3IRR A;  3FM3 A;  2R4G A;  1Z3Y A;  3HSE A;  3N97 A;  1GV2 A;  1GHC A;  5LGN A;  3HKZ N;  4BDZ A;  5EEH A;  2KDO A;  1WJD A;  3D5L A;  4P5O A;  2IXS A;  3UNG C;  2EV6 A;  5D4S A;  1IXC A;  3AG3 H;  1U9O A;  3Q0W A;  1MBG A;  2IW5 A;  1YYV A;  3ZQF A;  2XHK A;  4AUX A;  1YJN I;  3GO5 A;  2R5Z A;  5M3M J;  2R5Y B;  2JA5 J;  3HRM A;  2ESN A;  3VWB A;  1XX5 A;  4LOC A;  2VB6 A;  5DUI A;  1O57 A;  3OSG A;  3S2W A;  1BOB A;  2X1C A;  3WG9 A;  4GXO A;  1OCZ H;  1MJB A;  1OIS A;  2QM3 A;  4PCQ A;  4I7H A;  2PG4 A;  2MC3 A;  3G2B A;  1U5T A;  2OU2 A;  2KRC A;  2A3S A;  1NG7 A;  3MZ8 A;  1IAW A;  1H0M A;  4B1R A;  1WSU A;  3V7S A;  3HUG B;  3I71 A;  5D5W B;  1YIJ I;  2FRH A;  1I5Z A;  3OYF A;  5EDN A;  2FBI A;  3JTH A;  2YSR A;  2LG4 A;  2XGD A;  1RNL A;  2XB0 X;  2DMN A;  4MFE A;  3SZG A;  4OAY A;  2DA7 A;  1WCM J;  1XPX A;  2VQL A;  5JLW A;  4RGR A;  1G4D A;  1WZ2 A;  2GA2 A;  3KFW X;  4IRI A;  3OR2 C;  2F5D A;  3LA3 A;  2XPU A;  4EJW A;  5FKN A;  2WTE A;  4W97 A;  3ZQG A;  1ZRE A;  1FNN A;  3BZ6 A;  2VBZ A;  5E20 A;  3SDG A;  4LGW A;  3U1D A;  3BPV A;  2JA6 J;  2WC2 A;  3OYB A;  3FM5 A;  3MFK A;  5JVG F;  1SVO A;  4HSR A;  3CP2 A;  2HXI A;  1FP1 D;  1JTX A;  3QOP A;  2IA0 A;  2BXY A;  1UEL B;  5DDG A;  1FYK A;  1WJE A;  4P96 A;  1KON A;  4XON A;  2M0M A;  1AKH B;  4KIT B;  5LHG A;  1UAA A;  4CUG A;  2NVT J;  1MMN A;  2BVM A;  3LMM A;  3GYH X;  4KYW A;  2VUM J;  1RR7 A;  1X1P A;  2JUC A;  1YX5 A;  3ZMU A;  4UVB A;  3FXL A;  3GTK J;  3JRE A;  2EZI A;  3D0S A;  2HS5 A;  2O6G E;  2DA3 A;  1NHA A;  3JW4 A;  3OMY A;  2X6O A;  1S29 A;  2ICW G;  1OCP A;  2MAB A;  4LLN A;  4KJZ A;  4AM3 A;  4PSX A;  4XRS A;  2ESH A;  1R36 A;  3CTA A;  4QPQ A;  2B9S A;  1UFM A;  1B8I B;  4NUB A;  3W2V A;  2CGP A;  1FOX A;  1MBK A;  3MKZ A;  3DEW A;  4IOA F;  4G6D A;  1MH3 A;  4A69 C;  2V9P A;  1OCR H;  2IJL A;  2VOO A;  5DM7 F;  1T0F C;  2YX7 A;  3C2G A;  5EEG A;  4JX6 A;  3TBI A;  1LFB A;  5BOX A;  3UR3 C;  1Z77 A;  2ZNZ A;  4EMS A;  4YFK F;  2DK8 A;  3GZ5 A;  4A6E A;  5K1Y A;  3G71 I;  2G7U A;  1J7K A;  4OOI A;  3BZC A;  3J7Z I;  1DP7 P;  4HRI A;  2DT7 B;  4QLC U;  4BE2 A;  1Y8Q B;  4GGG A;  2CWE A;  2YPR A;  3H3Z A;  3LSK A;  3BTC A;  2GWR A;  3F0C A;  3RPQ A;  4CCO A;  2IS2 A;  3KPH A;  1SMT A;  5M5X J;  4RA2 A;  5B1A H;  2Y0M A;  1YE9 A;  2ZXJ A;  5H20 A;  5H6Q A;  4A3J J;  2ME6 A;  4PFP A;  4CZC A;  1MSE C;  1IC8 A;  4CGZ A;  2EIJ H;  1XCV A;  2DMQ A;  3OYD A;  3BTI A;  3NEU A;  3KYC B;  1K7A A;  1Q1H A;  1IRF A;  1X3U A;  1MNM C;  3ML6 A;  1E3O C;  4KFC A;  5E1W A;  2QYO A;  3CF2 A;  4N0B A;  9ANT A;  1BI2 A;  4FHT A;  3HOU J;  1OYI A;  1WI3 A;  3FXO A;  5C44 J;  4AIJ A;  1OKR A;  3BR5 A;  2F4I A;  4DGW B;  2A5Y B;  2IS6 A;  5AON A;  1D5V A;  2VJ4 A;  1TQM A;  5GPA A;  2NVQ J;  4QPO A;  1LVA A;  5GAE J;  3HZJ A;  2D5V A;  3CLO A;  5D8L B;  2BY0 A;  1ZG3 A;  4KIC A;  2NVU B;  1E3H A;  1FIP A;  2EH3 A;  4CDG A;  1XD7 A;  3DTI A;  1ETX A;  2OC6 A;  2H8R A;  4NC6 A;  4MIM A;  3DU5 A;  4BUP A;  1ZEL A;  2CQ7 A;  2V1D A;  3RQI A;  1IUF A;  1UHS A;  3K70 C;  2R7D A;  1PDN C;  3GTG J;  2DA4 A;  4FTH A;  1SFE A;  4M9Z A;  4AYB N;  4ZJZ A;  4UUS B;  2XRN A;  4C3H J;  5IT3 A;  4I6Z A;  2HDW A;  2AHQ A;  2L54 A;  4XLA A;  5IP6 A;  1IN6 A;  2PI0 A;  2Z99 A;  3F9K A;  2OZU A;  1HKT A;  1X1D A;  1HF0 A;  3DKW A;  1J9I A;  3G4S I;  5M3F J;  3GTL J;  3H5A A;  1BL0 A;  1R00 A;  2FA5 A;  4F93 B;  2M2E A;  4C30 A;  2QSH X;  2KIM A;  3RCO A;  4UB6 C;  2XKO A;  3A1Y A;  2OUM A;  1D0Z A;  1FBU A;  3G6E I;  3G1L A;  4KUM A;  3RKY A;  2H09 A;  4BEH B;  4EJU A;  2K27 A;  3TMO A;  3VEP A;  1QPM A;  2BHY A;  3L2U A;  1I50 J;  2PN6 A;  2QGU A;  4HBL A;  1F43 A;  1IN7 A;  2ISZ A;  3SJM A;  2NVY J;  1POG A;  3ZMS A;  1JUS A;  3WTZ A;  3JRB A;  2TRT A;  2WAQ N;  2Z3Y A;  4HYE A;  4MQ9 F;  1IF1 A;  3GZN B;  4L5E A;  1LE8 B;  2HZT A;  2NAZ A;  3GTJ J;  4W1U A;  1B4A A;  4AC0 A;  3TQN A;  2DFI A;  4XK4 A;  3DKX A;  2EA2 A;  4C9Y A;  1TQP A;  2KJB A;  3K7A J;  3SQN A;  3BOQ A;  2FML A;  2R3S A;  2ZFW A;  1TT0 A;  2K7L A;  4KN7 X;  4BJT A;  1W0U A;  3S8P A;  4KT5 C;  3EPZ A;  4GDF A;  4XL9 A;  5ICC A;  3L09 A;  3RYR A;  5FKK A;  3LQR A;  2ZFU A;  5CVI A;  1ORK A;  1A35 A;  1WRJ A;  5EGO B;  4PJM A;  2DA2 A;  4M9S A;  1ENH A;  1RIO H;  2PJR B;  3KYD B;  4GCV A;  4XLH A;  1J2X A;  2L7K A;  3TO9 A;  2O7O A;  3AG1 H;  3J81 Z;  2DYS H;  3RKX A;  2YUS A;  2LFB A;  3BP8 A;  4XRM A;  2Z1D A;  5A2Q Z;  2O5R A;  5GTH C;  2OQG A;  4RDU A;  5L3G A;  4XSX F;  4UXN A;  1EH6 A;  1JKP C;  4FET A;  3TO6 A;  3QPS A;  2G9W A;  1OCC H;  3HGG A;  1D1A A;  1YW7 A;  3FDY A;  1X3Z B;  1MW7 A;  1MMG A;  3V4G A;  3ZQH A;  2F2E A;  3BLY A;  4L9J A;  1JUM A;  1Z7L A;  2DU9 A;  3F8N A;  4EJO A;  4QIW N;  1ZR4 A;  2QKL B;  2RVC A;  2WWY A;  2BVL A;  2L7M P;  1WH7 A;  4QWQ A;  4PDK A;  3H92 A;  3GCM A;  5JFR A;  3F3X A;  5FFX A;  3S15 J;  2VKV A;  1EH7 A;  1MMD A;  1RUN A;  2VPL A;  1QU3 A;  5HOD A;  2LRD A;  2RRE A;  3K69 A;  1W5S A;  3J81 K;  3LAJ A;  5E18 F;  4NNJ A;  1UHM A;  4OIP F;  3AL0 B;  4G8X A;  3BR6 A;  1YLF A;  2BXZ A;  3ZGK A;  3F6V A;  2E1O A;  5A2Q K;  3O2P E;  3QU6 A;  3BJ6 A;  3NWT A;  1A04 A;  4ENM A;  2P8T A;  1ZAR A;  3KLO A;  2VKD A;  1SD7 A;  4XLF A;  3DF8 A;  5HNH A;  1Y1W J;  2UUZ A;  4BQQ A;  4UUT A;  2P81 A;  2K02 A;  2DA5 A;  5H6R A;  2XVC A;  2W82 A;  4BQN A;  2E35 A;  1Z7U A;  3BDD A;  5FKM A;  1YS6 A;  3D5S C;  5F64 A;  2IGO A;  5DV5 A;  2P7C B;  4WXC A;  1U78 A;  2LY9 A;  2W1O A;  5F04 A;  2XAH A;  4DBQ A;  3JRC A;  3KP5 A;  2UWM A;  1U6G A;  1YJW I;  4UY8 I;  2K3P A;  2JSC A;  3V7R A;  3T5X A;  2N8G A;  2M9H A;  3C3W A;  5IYD J;  3AL0 C;  2IGM A;  4MEX F;  1QNT A;  2CUE A;  3I54 A;  4GO1 A;  4LD5 A;  1FYL A;  2PQ8 A;  2LK2 A;  2K9N A;  1UMQ A;  4JK1 X;  5BQT A;  2CW8 A;  2ADU A;  1MNE A;  1U8R A;  4A12 A;  2L3D A;  2W24 A;  2DN0 A;  4Q4Z F;  4KIB A;  2L7F P;  1YIT I;  3V8J A;  4XN3 A;  2XSD C;  1TZL A;  1WJF A;  1YRN B;  2VN2 A;  1J5Y A;  1KA8 A;  1YX3 A;  2DMU A;  1D0X A;  2Z16 A;  5C4X J;  4M3E A;  2P5K A;  3K4K A;  2ZCW A;  2LOO A;  2EFO A;  4V19 K;  2JZY A;  3F8C A;  3CCS I;  2Z9O A;  1ZLK A;  3ZQC A;  1GDT A;  1FBQ A;  1I39 A;  4ZDL A;  2ELH A;  1T95 A;  3E6D A;  5FGM A;  2D1H A;  2H1L A;  3JSP A;  2EIL H;  4IZZ A;  2L0K A;  1G8X A;  4M72 A;  3EQL F;  3BC8 A;  2XF7 A;  4IXA A;  5HLG A;  1G3Y A;  1NTC A;  2CG4 A;  4CZZ A;  1R1V A;  4ENK A;  2FQ4 A;  4DNC A;  4NDL A;  3E5U A;  5GAD J;  1EH8 A;  1IN4 A;  2NS0 A;  2E5N A;  4WK8 F;  2RKH A;  4OIO F;  1R6R A;  4UV8 A;  3GZ6 A;  2VQH A;  5JI6 A;  5LD2 C;  5K5Q A;  4A3B J;  1SD5 A;  4IF4 A;  3TL4 X;  2GXA A;  3CDH A;  2E7W A;  4S04 A;  3H5N A;  4NBQ A;  2QQA A;  2RV8 A;  4HNU A;  4F3Q A;  4D5C A;  2LKP A;  2UXX A;  3B73 A;  1YG2 A;  3WTY C;  3JRI A;  4LIU A;  2STT A;  3LSR A;  3VPR A;  4U7B A;  1ZLJ A;  3ECH A;  1ETQ A;  1S6L A;  4HDU A;  4LIV A;  3QQA A;  4HST A;  4BL0 B;  1OYY A;  4BU2 A;  3HOV J;  5E3M A;  2KIF A;  3NAR A;  1NK2 P;  2XDV A;  2CQX A;  1SFK A;  4A5N A;  2GXB A;  5TJJ A;  3TED A;  4RMN A;  5KK1 A;  1W36 C;  3CCJ I;  1B6A A;  2M8G X;  3PJR A;  5ED4 A;  3IP4 B;  3HGY A;  3GTQ J;  1R4M B;  2XIG A;  4AID A;  2FE3 A;  3WOD F;  2Q2E A;  2MLG A;  1ZR2 A;  1R5G A;  5LRS A;  2VXD A;  1JKO C;  4BXF A;  5EF6 A;  2ZXW H;  3G1O A;  3OYH A;  1HLV A;  1UG2 A;  1DPU A;  2CUJ A;  3CO6 C;  2DCE A;  2M8E A;  1FSH A;  4PFO A;  2YR2 A;  3BG7 A;  2QA4 I;  3H9Q A;  3I5U A;  2YU3 A;  1DPR A;  4CHU A;  3LFU A;  3U2R A;  3T8T A;  1OLT A;  3CMY A;  2CRG A;  5FRM A;  2ZXI A;  3A01 A;  1LKX A;  3OYK A;  4M3F A;  3L1P A;  4E7Z A;  2EIN H;  2F5C A;  2Z2S B;  1O3R A;  4A3K J;  3JCU C;  4D7M A;  4AYB A;  2VT2 A;  2XAU A;  2HOA A;  1XMA A;  3I4M J;  4NHJ A;  3K4C A;  4HDV A;  3HB9 A;  5F08 A;  4FQG A;  3HTS B;  4PJN A;  3LA7 A;  1LJ9 A;  2ZC2 A;  2HVS A;  3M7G A;  4PSW A;  2XAG A;  3ZN0 A;  1J0R A;  2BE5 F;  2V6E A;  2M30 A;  1P7I A;  2P5V A;  2A69 F;  1XSX A;  4J00 A;  2DA1 A;  4LK0 F;  2R7Q A;  3PO3 J;  1X1A A;  3MVP A;  6PAX A;  1YOV B;  2R7T A;  2VBW A;  4C2T A;  3K4L A;  3GX4 X;  2X6W A;  2ZSH B;  1VZ0 A;  4HX8 A;  4IHT A;  1LFP A;  2XPW A;  4BBS J;  4R79 A;  2HDC A;  1FIA A;  2R5Y A;  4OU0 A;  2VPR A;  2OV7 A;  3H0G J;  2KLO A;  1XN7 A;  3SDB A;  2O61 A;  1CGP A;  2STW A;  2WAQ A;  4J19 A;  4ESB A;  1IRZ A;  2GQQ A;  3J80 Z;  2L7Z A;  2MSY A;  2OTL I;  2L01 A;  1HW2 A;  3RI4 A;  3ABT A;  2OPT A;  3NWS A;  1FT9 A;  5K5O A;  1SAN A;  1DGW Y;  3IWZ A;  3O8G A;  1VQN I;  1K79 A;  3A02 A;  3M4O J;  1SAX A;  1FPQ A;  2BV6 A;  4B4C A;  1HST A;  1XTA A;  3TOB A;  1W7P D;  4UVA A;  4U0W A;  3L7W A;  1RRJ A;  4DYC A;  1R23 A;  3TW7 A;  4IHX A;  1O3T A;  4C3J J;  5FD6 A;  4I01 A;  3V8L A;  2D45 A;  4L9T A;  1IJW C;  1PUE E;  3Q3S A;  4IRG A;  2UZK A;  3HC7 A;  1XC5 A;  2E19 A;  3J80 K;  3F72 A;  2QQB A;  4K2E A;  5AIP A;  4BBR J;  2DMP A;  1WQ2 A;  1JT0 A;  5L3D A;  4G7Z F;  1ZK8 A;  2RNJ A;  3JAM Z;  2YU9 J;  2W25 A;  2XV4 S;  3L2V A;  1I27 A;  2Y30 A;  3G3Z A;  3RZO J;  2CYY A;  4YEJ A;  2HPI A;  2VJJ A;  2GM4 A;  5J40 A;  1ETW A;  3EUA A;  5K7F A;  1JKQ C;  4PGG A;  1IRX A;  2K3F A;  1CF7 B;  1LUJ B;  2QWW A;  4PGH A;  4BE1 A;  3L2R A;  2EFW A;  1N78 A;  2M1B A;  2HOT A;  1FJL A;  4A3L J;  1BOA A;  2Y69 H;  3IC7 A;  4AU7 A;  3E5Q A;  2Z33 A;  5FRO A;  1Y0U A;  1H88 C;  2LRE A;  1VTN C;  4D0P A;  2VOD A;  4LB5 A;  3GLL A;  2M45 A;  3GFM A;  5K5R A;  2O8X A;  4ASN A;  4N9I A;  3KZZ A;  4LK1 F;  2RAE A;  2QKM B;  2BW3 B;  4G7O F;  5ILV A;  2ECB A;  4I99 C;  1F9N A;  2QBY A;  5TRD A;  4L5I A;  4H0E A;  3JAM K;  3FKI J;  1OCT C;  4TV7 A;  3HYI A;  1B1B A;  3MAJ A;  1ZKG A;  1K6Y A;  2GBY A;  1W7P B;  3I64 A;  3HM5 A;  2B0L A;  3OWT A;  1QO0 D;  5ILU A;  1T08 B;  1TNT A;  2F4O B;  1XCB A;  1XB4 A;  1ZRC A;  1T38 A;  4B44 A;  3E7L A;  1MZB A;  1PJR A;  3LSI A;  1RR8 C;  1JTY A;  4E7S A;  3VYR B;  3HOT A;  1D8K A;  5CLS A;  1P4W A;  2BZT A;  3BG3 A;  2G0E A;  1N25 A;  1T8I A;  3QAH A;  3OSF A;  1QPI A;  2K5C A;  2DO7 A;  3PUB A;  1X4P A;  5E1Z B;  3VYS B;  4CCL A;  1FWZ A;  2XAF A;  1Z6T A;  3IAM 2;  3A03 A;  3RDI A;  4U0Y A;  3KET A;  4KDP A;  1PP7 U;  1W5C C;  3KP3 A;  3I59 B;  2DT6 A;  2BYV E;  2BGC A;  2L9N A;  1V55 H;  2BOL A;  2KIQ A;  5EJC A;  1WFX A;  1XDS A;  1QA6 A;  2MGQ A;  1R5I D;  3C2H A;  3M3Y J;  2LVS A;  4FE7 A;  4R8H A;  5DUK A;  1MGT A;  4CSW A;  3QPL A;  3U9G A;  2DDB A;  3DPU A;  3QWL A;  1ITY A;  2OTJ I;  1NH3 A;  2CS3 A;  2RDP A;  4B8X A;  5H2F C;  2LC2 A;  2VON A;  3FIW A;  2W84 A;  5HOO A;  3EYY A;  4D9J A;  1REP C;  3PSI A;  4ZYD A;  4XBF A;  3BCB A;  3G1M A;  3FXR A;  5CJ9 A;  1YO5 C;  3BRO A;  3DTK A;  4C2U A;  2XPV A;  2DAO A;  2FU4 A;  1TP4 A;  1RZ4 A;  3HIF A;  1HKS A;  2LH9 A;  4NC8 A;  5IT9 Z;  3MN2 A;  3CUQ A;  1OQY A;  1IDY A;  3TKY A;  1I1S A;  2E1N A;  1Z0X A;  3LSJ A;  4LMY A;  2CW0 F;  3ZMV A;  1O7F A;  1P6R A;  1D0Y A;  1RES A;  2MG4 A;  2WV0 A;  3OY9 A;  5GPC A;  2HQR A;  2HQN A;  2KZV A;  4G6Q A;  1VQ7 I;  4A3D J;  2GAU A;  2CJJ A;  5FLV A;  3S2H J;  1JI8 A;  1ZQ3 P;  2HQ5 A;  3N4M A;  2X6X A;  3K9T A;  4DYR A;  2EWN A;  1MMS A;  1XDU A;  5CVV A;  5DD4 A;  4B09 A;  4XKV A;  2CQK A;  2EJR A;  1MJA A;  3FMR A;  2MBF A;  3HTU A;  3T1B A;  5K7Z A;  1DQU A;  2FUG 2;  1WJC A;  3PFI A;  3KP6 A;  2LKS A;  5CYV A;  3ZQL A;  1ETY A;  5HLT A;  2ZME A;  4WCG A;  3ZMZ A;  3FXQ A;  2F48 A;  2X6Y A;  4UB8 C;  2VAS A;  2P5L C;  2PMZ N;  2QCO A;  4JBA A;  4MNU A;  5IT9 K;  2JMW A;  2KRF A;  3BTJ A;  5IPA A;  2QZ8 A;  1QZY A;  1WPK A;  4BEH A;  1UST A;  4M73 A;  4AVP A;  4M3D A;  5IOZ A;  3CCU I;  3TO7 A;  1TWG J;  3W6V A;  1PVE A;  1XSD A;  2OCE A;  1VQ9 I;  3FHN A;  4IJA A;  4Y33 A;  3R6S A;  2DT5 A;  3QP5 A;  1K61 A;  1ZYR F;  2LTP A;  2HOS A;  5J4V A;  2KHM A;  4LG0 A;  3CME I;  4HV5 A;  4PJJ A;  2V79 A;  5IP9 J;  3BG6 A;  3CMM A;  2M3A A;  4RGU A;  5K7H A;  4DW6 A;  3E97 A;  1K83 J;  2JPB A;  3HOW J;  2O03 A;  1GUU A;  1NG6 A;  3S16 J;  5DTD A;  1GT0 C;  3HJE A;  2K9Q A;  2WB1 N;  3HSF A;  4DQ2 A;  3DBL B;  3VOE A;  1R71 A;  2JJ7 A;  1W1W E;  1A6I A;  5HLH A;  3ZP5 A;  3RYP A;  1FTZ A;  3SZT A;  1W4M A;  3M1C A;  3WTT C;  2LR8 A;  4XLC A;  3VDX A;  2ID6 A;  4BYY A;  2KDZ A;  5CVU A;  1QHG A;  4HOB A;  4WX9 A;  3LWF A;  3P9K A;  2EZK A;  3WU2 C;  2XC7 A;  1FC3 A;  2DXI A;  2KP6 A;  4NQW A;  2JPC A;  1U5T C;  3S3M A;  5FLM J;  2Q1Z B;  4XIC A;  3HL2 A;  1SVM A;  3NAU A;  5M5W J;  3OYN A;  1QBJ A;  2NXN B;  2CQN A;  3RKW A;  3IH4 A;  3ELK A;  3KEY A;  1B9N A;  2VQG A;  3FX3 A;  1E2X A;  2ELK A;  3PFY A;  4P55 A;  5EEA A;  2XB5 A;  4BS9 A;  2PJP A;  2EFP A;  1HDD C;  4M3G A;  3KIO A;  3ZXS A;  2X4H A;  1U3E M;  2VXZ A;  3VFZ A;  1RUO A;  1LNW A;  4JX5 A;  1FBS A;  2PMU A;  2PX9 A;  4BJ6 C;  3FMS A;  3RPU A;  3A0H C;  2PEX A;  3DKY A;  5F0H A;  4HLX A;  2VC0 A;  1P9Q C;  2L4M A;  3E3V A;  3LSH A;  2PFB A;  4RBO A;  5LHI A;  4IHY A;  4RAG A;  2HDD A;  1TTY A;  5FB2 A;  1R1T A;  4BY1 J;  2UXN A;  1R1U A;  3MMY B;  3GFI A;  3R4K A;  3JTG A;  2GLO A;  5L3C A;  1ZTR A;  2NS8 A;  1Y1V J;  4KA4 A;  3RPU D;  5GAH J;  4ZDO A;  3BJO A;  3E6C C;  4FX4 A;  1ACI A;  2LD5 A;  4FT8 A;  2BEO A;  2QUF A;  1Z67 A;  4HPQ A;  1X3W B;  3EUH A;  1WGX A;  1ZGW A;  5EG0 B;  3PNV A;  5F0C A;  5EYR A;  2X85 A;  4HF0 A;  3OIQ A;  4B3A A;  2BY1 A;  4U0V A;  5EZH A;  2VOP A;  2EFN A;  5BS6 A;  1MBF A;  3IH3 A;  3TP0 A;  3JRA A;  3H3U A;  3HRT A;  3CF5 F;  2H6C A;  2NVX J;  2LSO A;  1UHW A;  1DUX C;  2EFQ A;  2EIM H;  3FIS A;  1JHH A;  3GFJ A;  2IEK A;  2Y0S N;  2HKX A;  4RLF A;  3UKG A;  1Z05 A;  5J47 A;  1HBX G;  5DYM A;  5E3L A;  3K1N A;  4N4N B;  2HTJ A;  3DPT A;  4A3E J;  4EJT A;  4YIF A;  2BY2 A;  3DV8 A;  2R7F A;  1YRN A;  1G6N A;  2P6S A;  1X1B A;  2FJ1 A;  1TWA J;  1J09 A;  4F92 B;  1G3W A;  2VKH A;  2RQQ A;  5FKL A;  2M7A A;  3E6M A;  3BR3 A;  3DQV C;  1FYM A;  2DOF A;  3S93 A;  3S17 J;  1EV7 A;  2K86 A;  2QF7 A;  3K1P A;  4Q48 A;  3BWG A;  3FMQ A;  1Z9C A;  4KIS A;  1S8N A;  3OIO A;  1UB9 A;  1X4O A;  3S14 J;  5KVR A;  4XSZ F;  2XUB A;  1IO2 A;  1HSJ A;  2VE9 A;  4HQM A;  2DK5 A;  1QRY A;  3KYL A;  4X6A J;  3ZQ7 A;  2DQR A;  2UV1 A;  1B9M A;  3BZK A;  2RGV A;  5IYC J;  5E8G A;  2EV0 A;  1QQI A;  2QVO A;  3RKQ A;  4ABZ A;  1U0J A;  4IEJ A;  3M8E A;  2NS7 A;  4FAS D;  3CCV I;  1AU7 A;  3C7J A;  2V1U A;  3H3V K;  3GTM J;  3LL7 A;  1SAU A;  2KFD A;  2DJN A;  1W36 D;  2GOX B;  4U87 A;  4BGD A;  4MO7 A;  3H1C A;  3H9G A;  3EDP A;  3P9I A;  5DCM A;  1K4S A;  4GYG A;  1VQO I;  4HF1 A;  3FXK A;  3F23 A;  1BJZ A;  5HVQ C;  1JXS A;  3PQK A;  4I09 A;  3H9J A;  1H9G A;  4X0G A;  4PK4 A;  3E6B A;  3MD2 A;  5FFZ A;  3MCZ A;  3PNY A;  1G2H A;  2E2H J;  2COB A;  1OR7 A;  4JYK A;  3LSG A;  4L0Y B;  3WG7 H;  3S3N A;  3OYL A;  5GP9 A;  2C6Y A;  2DBB A;  1O4X A;  4CCJ A;  3DBH B;  2JA8 J;  2XAQ A;  3AG4 H;  3BR0 A;  1MBH A;  3OR1 C;  4DZP A;  4AIK A;  3ABU A;  3COA C;  1AWC A;  4Z6Y A;  1G3S A;  1BR4 A;  5ILS A;  3LSP A;  3DU6 A;  5HDK A;  2X51 A;  3SZP A;  3OV8 A;  3S32 A;  2OBP A;  3QPH A;  2R7O A;  1TWF J;  4ZYA A;  3BG5 A;  3DWL E;  3WGH A;  4C2M J;  3ERE D;  3D5R C;  4JOM A;  3R0A A;  2CFX A;  2ZXH A;  2J5O A;  2E2J J;  1ZAO A;  2ETH A;  3HPG A;  3ROU A;  2E71 A;  2IRF G;  3I3L A;  3E5X A;  1V5G A;  4RB0 A;  3F6O A;  2KT0 A;  1EA3 A;  5LEJ A;  1YIO A;  2ELJ A;  2J5P A;  3PSF A;  4CH7 A;  1WWX A;  1C0W A;  2O8K A;  2K4J A;  3VSK A;  5E79 C;  3GLX A;  5HNF A;  1L0O C;  4OIN F;  1XGM A;  2F4M B;  1VQM I;  2EB7 A;  1U8B A;  2AXL A;  2BY3 A;  3DTE A;  1VQ5 I;  3B6A A;  3RIR A;  4IVN A;  4XKC A;  1BC7 C;  1HW5 A;  3OL3 A;  1T56 A;  1HXD A;  2R7X A;  2PMZ A;  4GRI A;  4CYC A;  1GVJ A;  4M71 A;  3R60 A;  4LIT A;  3ZCO A;  5JVT A;  4YFN F;  1D3Y A;  4DYQ A;  3WU0 A;  3G73 A;  2Q8K A;  2ID3 A;  3CCQ I;  2KPM A;  2IA1 A;  4YG2 F;  1U9N A;  3S3O A;  1NK3 P;  4UUV A;  3MQ0 A;  2OCC H;  4II3 A;  2I10 A;  1A36 A;  4O3M A;  1LDJ A;  2I5U A;  4P9U A;  2FEZ A;  4IO9 F;  1B72 B;  5CQG A;  3C18 A;  1X19 A;  2W4S A;  4D7N A;  2X1E A;  2EIK H;  5E3O A;  1BJA A;  1X58 A;  3Q9V A;  3Q9S A;  2EV5 A;  2KRH A;  2K9L A;  2AO9 A;  3ASO H;  3E0J B;  4IQJ A;  3W6K B;  5HDN A;  4RAF A;  1S7A A;  2WB1 A;  4M74 A;  4M6V A;  3T8R A;  5CPR B;  2BBY A;  2VIX A;  3IAS 2; 
#chains in the Genus database with same CATH homology
 3KP7 A;  3PQJ A;  3K0L A;  1IW7 F;  2RC4 A;  4A6D A;  2DLL A;  1ZRD A;  1FOK A;  1ZGA A;  2D1V A;  3TDZ C;  3WTV C;  2LNB A;  2CSO A;  4HAM A;  5DD8 A;  3DPL C;  4YII A;  1FZP B;  1ON1 A;  3FZV A;  2P4W A;  3NRV A;  3HRU A;  4M6X A;  1K78 B;  3WGI A;  4AIH A;  3O3K A;  2NYX A;  2XGX A;  1I1G A;  4L0Z B;  3WTW C;  1ZG1 A;  1TQI A;  4BHP A;  1RI7 A;  2DW4 A;  1HW1 A;  3HRS A;  3WE2 A;  5L3B A;  2DI3 A;  1MDM B;  4Y17 A;  3FF5 A;  5LBQ A;  3WTX C;  1J75 A;  2VT3 A;  3ISP A;  5JHU A;  2ACJ A;  2ZO4 A;  2FNP A;  4ENJ A;  1W7P A;  4NB5 A;  3VOD A;  1K6O A;  3KE2 A;  3BPX A;  2L02 A;  2OAZ A;  1TW2 A;  1KU9 A;  4HV6 A;  4L9N A;  3HUG A;  2PMH A;  2HWV A;  4HX7 A;  4HW0 A;  1FY7 A;  2GIV A;  1FP2 A;  2RQP A;  2TDX A;  4R1H A;  3IWF A;  5E8I A;  5F6F A;  3WGG A;  2LF7 A;  4OMZ A;  3HOS A;  4BHB A;  3I59 A;  2L4A A;  1KU7 A;  4Y15 A;  3M8F A;  3HSR A;  2NNN A;  1KGS A;  4HQE A;  1V3F A;  3O6B B;  1T0F A;  1W5T A;  1T2K A;  2IVM A;  3RTR A;  1KQ9 A;  5L3F A;  2IPQ X;  5FD5 A;  5BMZ A;  1YW9 A;  2FBH A;  2OD5 A;  2IT0 A;  2XRO A;  4UV9 A;  4G7H F;  1XMK A;  5D8K B;  3P9C A;  1T98 A;  2NNY A;  4ENN A;  1BI1 A;  4BAY A;  3F21 A;  4HF2 A;  4LFU A;  2FBK A;  2FXA A;  3HHH A;  1YFH A;  1IXS B;  2A6E F;  5J8C A;  4L18 B;  5J6X A;  3KP2 A;  3B02 A;  3HHG A;  3GFL A;  4KN4 X;  2EK5 A;  4G94 A;  3GUD A;  4RGX A;  3OOP A;  4MTE A;  1AOY A;  1ONV A;  3VB2 A;  4BH9 A;  2MA3 A;  4S05 A;  4Z2Y A;  2VBY A;  4MQV A;  1Z1D A;  2O0Y A;  5LHH A;  4FX0 A;  5LLQ A;  2OA4 A;  4ZH4 F;  4GYI A;  1LB2 A;  2FF4 A;  4ZZL A;  4WXD A;  3KEO A;  4EJV A;  3LA2 A;  4BHC A;  4HZF A;  1P92 A;  4ZYH A;  2HYG D;  4I0A A;  1J59 A;  4EVI A;  2E7X A;  4Q5S F;  1JE8 A;  3LST A;  4MEY F;  3RJP A;  3V8K A;  4YFX F;  2VE8 A;  4ESF A;  2O3F A;  5DCF A;  2V6C A;  5HS7 A;  2PBI A;  1E17 A;  3FWE A;  5J8F A;  4P9F A;  3WTU C;  5D6E A;  3W6J B;  2DTR A;  4OIR F;  1ODD A;  2JT1 A;  3DP7 A;  5LRR A;  2QBY B;  2HKO A;  2E1C A;  4HX4 A;  4MGR A;  3I4P A;  2PLY A;  2EA4 A;  5AIQ A;  2DPU A;  5HS8 A;  2Y75 A;  1BIA A;  1USS A;  2JTV A;  1U5T B;  4EM1 A;  1YS7 A;  1STZ A;  3IKV A;  4OIQ F;  1IZ1 A;  2F5E A;  3BY6 A;  3L9F A;  1IN8 A;  4I02 A;  4RB1 A;  4I98 B;  5HS9 A;  3IKT A;  5HLI A;  5E1X A;  3REO A;  4G9Y A;  2XAS A;  2P6T A;  1T6S A;  3M9A A;  3WTS C;  2KIU A;  4UVC A;  3GVA A;  1KYZ A;  1O3Q A;  2IA2 A;  2RN7 A;  1IUY A;  1LQ1 A;  2H94 A;  1FSE A;  2ZBK A;  3I58 A;  1KQ0 A;  2HOE A;  4EGZ A;  1ON2 A;  3CUQ B;  4L5J A;  4RB2 C;  5JR3 A;  1LDD A;  4A0Z A;  1XGO A;  2LDU A;  2MH9 A;  5DEQ A;  1R58 A;  3IRQ A;  2A68 F;  2DPD A;  1IN5 A;  3KCC A;  1MJ9 A;  3MZH A;  4EQQ A;  3IHU A;  2QEN A;  3QU3 A;  2IP2 A;  1YW8 A;  5ICG A;  2HTS A;  3AAF A;  2W57 A;  2ZNY A;  2KKO A;  3SHF A;  2H27 A;  2ZME B;  3TGN A;  4CIC A;  2VC1 A;  4I2O A;  3SXY A;  3CUQ C;  1YQA A;  2XAJ A;  1IXR C;  4ZYE A;  1XGS A;  2OQR A;  3EYI A;  3C1D A;  2P7V B;  4WXH A;  3P7N A;  4LG0 B;  4AD9 A;  4MHG A;  1LDK B;  4ON0 A;  4RGS A;  4O6J A;  3F8M A;  4U88 A;  1GXP A;  2F5F A;  2AS5 F;  1T39 A;  4RAZ A;  2YX4 A;  3NQO A;  3T0Y A;  2VBX A;  1OPC A;  2Q0O A;  3GWZ A;  1SD4 A;  4KIG A;  4E70 A;  5E17 F;  1HQC A;  2FOK A;  1R5H A;  4RAY A;  5BPI A;  2KJC A;  4RS8 A;  1D8J A;  1F1Z A;  3I0T A;  1R22 A;  1H9T A;  1XSV A;  3IL2 A;  1SFU A;  5ERI A;  4JQF A;  2XKP A;  1BN5 A;  1UCR A;  1FLI A;  5D6F A;  4Y13 A;  1ZHF A;  1PP8 F;  4EM0 B;  1SFX A;  3QPT A;  2FNA A;  3MEX A;  4CXF A;  3K1M A;  2M5W A;  4A2U A;  2GA1 A;  1KYW A;  2Y48 A;  3ULQ B;  3ZPL A;  4KMU X;  3QP6 A;  4I0B A;  1YTY A;  1S7O A;  3I53 A;  2COM A;  4M9X A;  1V4R A;  1ZRF A;  2G7H A;  4XLP F;  4O5V A;  1F4K A;  1K78 A;  1QZZ A;  1TNS A;  2HYF A;  4OMY A;  3LFK A;  3KEQ A;  3K2Z A;  4LLG F;  2LF8 A;  3DEU A;  4BQA A;  4U7D A;  2JRT A;  2A6H F;  4XLN F;  1P2F A;  3ZMT A;  3F8B A;  2HFH A;  1XGN A;  3GEZ A;  1BIB A;  5LGU A;  4CYD A;  1MDM A;  2GZW A;  4KIF A;  4WWC A;  4MTD A;  3FXU A;  1IRG A;  1ZG5 A;  1I6X A;  1R7J A;  1F5T A;  1U2W A;  1LEA A;  3L2C A;  2V1X A;  5BPD A;  4F7Z A;  4A0X A;  3DFG A;  1ZGJ A;  5D4R A;  1TBX A;  4CO8 A;  1WI9 A;  3KLN A;  5DCM B;  3ECO A;  3EET A;  4A5M A;  1BI3 A;  3R61 A;  4BNC A;  4EV0 A;  1MD0 A;  2HR3 A;  3GW2 A;  1QGP A;  1KU2 A;  2FMY A;  4UHT A;  4IHS A;  1FX7 A;  4EM2 A;  2A61 A;  3MWM A;  1ZN2 A;  2HEO A;  3L00 A;  4M6Y A;  2M87 A;  1CF7 A;  2A07 F;  3BJA A;  4LB6 B;  4N9H A;  4XRF A;  1SMY F;  4KNY A;  1ULY A;  4UNO A;  2ZJ2 A;  3WE3 A;  1HKQ A;  1BC8 C;  2ZKZ A;  3CUO A;  3JSO A;  5L3E A;  1LEB A;  5CVJ A;  5ICF A;  4IRH A;  2QLZ A;  4LJZ F;  1KQ8 A;  3ZMD A;  5LEK A;  1OMI A;  4ESJ A;  1MKM A;  5F1R A;  1DDN A;  5LGT A;  4WF2 A;  4EGY A;  1ZH5 A;  1GXQ A;  3ZN1 A;  5FO5 A;  1P4A A;  3LQQ A;  1O3S A;  4ETS A;  1G3T A;  1BI0 A;  3V7C A;  1JGS A;  2Z5U A;  3KZY A;  2ISY A;  5CVR A;  1B59 A;  1Z91 A;  1TLH B;  3TOA A;  2W85 A;  1P4X A;  1O7L A;  2MH2 A;  2OZ6 A;  4LLL A;  4KMF A;  3F8F A;  1TW3 A;  2MD5 A;  5ICE A;  3KP4 A;  1KU3 A;  3CJN A;  3CO7 C;  2K4B A;  3MZY A;  4L9V A;  2CO5 A;  3LAP A;  4IPA A;  2MLK A;  3TDU C;  1JHF A;  2X0L A;  1OYW A;  4BXU A;  3SFZ A;  2FQ3 A;  4RB3 C;  2NRA C;  3FHZ A;  1S3J A;  4HA8 A;  3WU1 B;  3R0J A;  5FLX Z;  1L3L A;  3Q5F A;  4Q47 A;  2H6B A;  2FSW A;  5HDG A;  1Z6R A;  2DQL A;  4PZJ A;  1BM9 A;  5D5X B;  3GXO A;  1WKM A;  2QQ9 A;  4HLY A;  1SD6 A;  3J7A O;  2GXG A;  3M1E A;  1BBY A;  4A0Y A;  3F22 A;  3GF2 A;  5D5V B;  3DXJ F;  4AWX B;  2HGC A;  2V9V A;  3QRF F;  4ZYG A;  5D5U B;  2D2W A;  4ZZD A;  5FLX K;  3IRR A;  3FM3 A;  3HSE A;  3N97 A;  1GHC A;  5LGN A;  5EEH A;  3D5L A;  4P5O A;  2EV6 A;  5D4S A;  1IXC A;  2IW5 A;  1YYV A;  2XHK A;  3GO5 A;  3HRM A;  2ESN A;  5DUI A;  1O57 A;  3S2W A;  3WG9 A;  4GXO A;  1MJB A;  2QM3 A;  4PCQ A;  4I7H A;  2PG4 A;  2MC3 A;  1U5T A;  2OU2 A;  2A3S A;  1IAW A;  1H0M A;  1WSU A;  3V7S A;  3I71 A;  5D5W B;  2FRH A;  1I5Z A;  2FBI A;  3JTH A;  2YSR A;  1RNL A;  4RGR A;  1G4D A;  2GA2 A;  3KFW X;  4IRI A;  2F5D A;  3LA3 A;  4EJW A;  2WTE A;  1ZRE A;  1FNN A;  3BZ6 A;  2VBZ A;  5E20 A;  4LGW A;  3U1D A;  3BPV A;  2WC2 A;  3FM5 A;  3MFK A;  1FP1 D;  3QOP A;  2IA0 A;  5DDG A;  1FYK A;  4P96 A;  5LHG A;  3GYH X;  4KYW A;  3ZMU A;  4UVB A;  3D0S A;  2HS5 A;  2O6G E;  1NHA A;  3JW4 A;  1S29 A;  4LLN A;  2ESH A;  1R36 A;  3CTA A;  1UFM A;  2CGP A;  4G6D A;  2IJL A;  2VOO A;  5EEG A;  2YX7 A;  5BOX A;  2ZNZ A;  4EMS A;  4YFK F;  2DK8 A;  3GZ5 A;  4A6E A;  5K1Y A;  2G7U A;  1J7K A;  4OOI A;  1DP7 P;  4QLC U;  4GGG A;  2CWE A;  2YPR A;  3H3Z A;  2GWR A;  3RPQ A;  1SMT A;  2Y0M A;  2ZXJ A;  5H20 A;  5H6Q A;  4CGZ A;  1XCV A;  3NEU A;  1K7A A;  1Q1H A;  1IRF A;  1X3U A;  3ML6 A;  4KFC A;  5E1W A;  2QYO A;  4N0B A;  1BI2 A;  4FHT A;  1OYI A;  4AIJ A;  1OKR A;  2A5Y B;  5AON A;  1D5V A;  1TQM A;  1LVA A;  3CLO A;  5D8L B;  1ZG3 A;  4KIC A;  4CDG A;  1XD7 A;  2V1D A;  2R7D A;  1PDN C;  1SFE A;  4M9Z A;  2XRN A;  5IT3 A;  2L54 A;  1IN6 A;  2PI0 A;  2Z99 A;  2OZU A;  1HKT A;  3DKW A;  1J9I A;  1R00 A;  2FA5 A;  2KIM A;  2XKO A;  1FBU A;  4KUM A;  3RKY A;  2H09 A;  4EJU A;  2K27 A;  3VEP A;  1QPM A;  2PN6 A;  4HBL A;  1IN7 A;  2ISZ A;  3ZMS A;  3WTZ A;  2Z3Y A;  4HYE A;  4MQ9 F;  1IF1 A;  2HZT A;  2NAZ A;  1B4A A;  3TQN A;  2DFI A;  2EA2 A;  1TQP A;  2KJB A;  3SQN A;  3BOQ A;  2FML A;  2R3S A;  2ZFW A;  2K7L A;  4KN7 X;  4KT5 C;  5ICC A;  3L09 A;  3RYR A;  3LQR A;  5CVI A;  1WRJ A;  4M9S A;  1RIO H;  4GCV A;  1J2X A;  3TO9 A;  3J81 Z;  3RKX A;  3BP8 A;  5A2Q Z;  2OQG A;  5L3G A;  4XSX F;  4UXN A;  1EH6 A;  3TO6 A;  2G9W A;  1YW7 A;  3V4G A;  2F2E A;  4L9J A;  2DU9 A;  3F8N A;  4EJO A;  2RVC A;  2WWY A;  4QWQ A;  4PDK A;  3H92 A;  5JFR A;  3F3X A;  5FFX A;  1EH7 A;  1RUN A;  3K69 A;  1W5S A;  3J81 K;  3LAJ A;  5E18 F;  1UHM A;  4OIP F;  4G8X A;  1YLF A;  3F6V A;  5A2Q K;  3O2P E;  3QU6 A;  3BJ6 A;  1A04 A;  4ENM A;  2P8T A;  1ZAR A;  3KLO A;  1SD7 A;  3DF8 A;  2K02 A;  5H6R A;  2XVC A;  1Z7U A;  3BDD A;  1YS6 A;  5F64 A;  5DV5 A;  2P7C B;  4WXC A;  1U78 A;  2XAH A;  3KP5 A;  2UWM A;  1U6G A;  2JSC A;  3V7R A;  3T5X A;  3C3W A;  4MEX F;  1QNT A;  3I54 A;  4GO1 A;  4LD5 A;  1FYL A;  2PQ8 A;  4JK1 X;  5BQT A;  2ADU A;  1U8R A;  4A12 A;  2L3D A;  2W24 A;  4Q4Z F;  4KIB A;  3V8J A;  2VN2 A;  1J5Y A;  1KA8 A;  2P5K A;  2ZCW A;  2EFO A;  2JZY A;  3F8C A;  2Z9O A;  1ZLK A;  1FBQ A;  2ELH A;  5FGM A;  3E6D A;  2D1H A;  3JSP A;  4M72 A;  3EQL F;  4IXA A;  5HLG A;  1G3Y A;  2CG4 A;  4CZZ A;  1R1V A;  4ENK A;  4DNC A;  3E5U A;  1EH8 A;  1IN4 A;  2NS0 A;  4WK8 F;  2RKH A;  4OIO F;  4UV8 A;  3GZ6 A;  5JI6 A;  5K5Q A;  1SD5 A;  4IF4 A;  3CDH A;  2E7W A;  4S04 A;  2QQA A;  2RV8 A;  2LKP A;  2UXX A;  3B73 A;  1YG2 A;  3WTY C;  2STT A;  4U7B A;  1ZLJ A;  3ECH A;  1S6L A;  4HDU A;  1OYY A;  2KIF A;  4A5N A;  2GXB A;  5TJJ A;  5KK1 A;  1B6A A;  5ED4 A;  2XIG A;  2FE3 A;  3WOD F;  2Q2E A;  2MLG A;  1R5G A;  5LRS A;  1DPU A;  3CO6 C;  2M8E A;  1FSH A;  2YR2 A;  3I5U A;  2YU3 A;  1DPR A;  4CHU A;  3U2R A;  3T8T A;  2F5C A;  1O3R A;  2VT2 A;  1XMA A;  4NHJ A;  4HDV A;  3HTS B;  3LA7 A;  1LJ9 A;  3M7G A;  2XAG A;  3ZN0 A;  1J0R A;  2BE5 F;  2M30 A;  2P5V A;  2A69 F;  1XSX A;  4LK0 F;  6PAX A;  2VBW A;  3GX4 X;  4HX8 A;  4IHT A;  4R79 A;  2HDC A;  4OU0 A;  1XN7 A;  2O61 A;  1CGP A;  2STW A;  4ESB A;  2GQQ A;  3J80 Z;  2L01 A;  1HW2 A;  3RI4 A;  3ABT A;  5K5O A;  1FT9 A;  3IWZ A;  1K79 A;  1SAX A;  1FPQ A;  2BV6 A;  1HST A;  3TOB A;  1W7P D;  4UVA A;  4U0W A;  3L7W A;  1R23 A;  1O3T A;  5FD6 A;  4I01 A;  3V8L A;  2D45 A;  4L9T A;  1PUE E;  4IRG A;  2UZK A;  3J80 K;  3F72 A;  2QQB A;  4K2E A;  5AIP A;  1WQ2 A;  5L3D A;  4G7Z F;  2RNJ A;  3JAM Z;  2W25 A;  2XV4 S;  1I27 A;  3G3Z A;  2CYY A;  4PGG A;  1CF7 B;  2QWW A;  4PGH A;  2EFW A;  2M1B A;  1BOA A;  3IC7 A;  3E5Q A;  2Z33 A;  1Y0U A;  1VTN C;  4D0P A;  2VOD A;  4LB5 A;  3GFM A;  5K5R A;  2M45 A;  2O8X A;  4ASN A;  4N9I A;  3KZZ A;  4LK1 F;  4G7O F;  5ILV A;  1F9N A;  2QBY A;  5TRD A;  4L5I A;  4H0E A;  3JAM K;  4TV7 A;  3HYI A;  1B1B A;  3MAJ A;  1W7P B;  3I64 A;  2B0L A;  1QO0 D;  5ILU A;  1TNT A;  1XCB A;  1XB4 A;  1ZRC A;  1T38 A;  1MZB A;  3HOT A;  1D8K A;  5CLS A;  1P4W A;  3QAH A;  2DO7 A;  5E1Z B;  1FWZ A;  2XAF A;  1Z6T A;  3RDI A;  4U0Y A;  3KET A;  4KDP A;  1PP7 U;  3KP3 A;  3I59 B;  2BYV E;  2BGC A;  1XDS A;  4R8H A;  5DUK A;  1MGT A;  3U9G A;  2RDP A;  4B8X A;  2VON A;  2W84 A;  5HOO A;  3EYY A;  1REP C;  4ZYD A;  4XBF A;  3FXR A;  5CJ9 A;  1YO5 C;  3BRO A;  2DAO A;  2FU4 A;  1RZ4 A;  3HIF A;  1HKS A;  5IT9 Z;  3CUQ A;  3TKY A;  1I1S A;  2E1N A;  4LMY A;  2CW0 F;  3ZMV A;  1O7F A;  1P6R A;  2WV0 A;  2HQR A;  2HQN A;  2GAU A;  3N4M A;  3K9T A;  2EWN A;  1XDU A;  5CVV A;  5DD4 A;  4B09 A;  2CQK A;  2EJR A;  1MJA A;  3FMR A;  2MBF A;  3HTU A;  3T1B A;  3PFI A;  3KP6 A;  5CYV A;  2ZME A;  4WCG A;  3ZMZ A;  3FXQ A;  2P5L C;  4JBA A;  4MNU A;  5IT9 K;  2KRF A;  2QZ8 A;  1QZY A;  1UST A;  4M73 A;  4AVP A;  3TO7 A;  1XSD A;  4IJA A;  3R6S A;  2DT5 A;  3QP5 A;  1ZYR F;  4LG0 A;  4HV5 A;  2V79 A;  4RGU A;  3E97 A;  2JPB A;  2O03 A;  3HSF A;  4DQ2 A;  3VOE A;  5HLH A;  3ZP5 A;  3RYP A;  3SZT A;  1W4M A;  3WTT C;  4BYY A;  5CVU A;  4HOB A;  4WX9 A;  3LWF A;  3P9K A;  1FC3 A;  4NQW A;  2JPC A;  1U5T C;  1QBJ A;  3RKW A;  3ELK A;  1B9N A;  3FX3 A;  4P55 A;  1E2X A;  2PJP A;  2EFP A;  2X4H A;  1U3E M;  2VXZ A;  3VFZ A;  1RUO A;  1LNW A;  1FBS A;  2PMU A;  3FMS A;  3RPU A;  2PEX A;  4HLX A;  2VC0 A;  2L4M A;  3E3V A;  2PFB A;  5LHI A;  1TTY A;  5FB2 A;  1R1T A;  2UXN A;  1R1U A;  3GFI A;  3R4K A;  3JTG A;  5L3C A;  4KA4 A;  3BJO A;  3E6C C;  4FX4 A;  4FT8 A;  2BEO A;  2QUF A;  3EUH A;  4HF0 A;  4U0V A;  2VOP A;  2EFN A;  5BS6 A;  3H3U A;  3HRT A;  2H6C A;  2LSO A;  1UHW A;  1DUX C;  2EFQ A;  1JHH A;  3GFJ A;  2HKX A;  1Z05 A;  1HBX G;  5DYM A;  3K1N A;  2HTJ A;  3DPT A;  4EJT A;  4YIF A;  3DV8 A;  2R7F A;  1G6N A;  2P6S A;  1G3W A;  3E6M A;  3DQV C;  1FYM A;  1EV7 A;  2K86 A;  3K1P A;  4Q48 A;  3BWG A;  3FMQ A;  1Z9C A;  1S8N A;  1UB9 A;  5KVR A;  4XSZ F;  2XUB A;  1HSJ A;  2VE9 A;  4HQM A;  2DK5 A;  3ZQ7 A;  2DQR A;  1B9M A;  2RGV A;  5E8G A;  2EV0 A;  1QQI A;  2QVO A;  3M8E A;  3C7J A;  2V1U A;  3EDP A;  3P9I A;  5DCM A;  4GYG A;  4HF1 A;  3F23 A;  5HVQ C;  1JXS A;  3PQK A;  4I09 A;  1H9G A;  3E6B A;  5FFZ A;  3MCZ A;  1OR7 A;  4L0Y B;  2C6Y A;  2DBB A;  2XAQ A;  4AIK A;  3ABU A;  3COA C;  1AWC A;  1G3S A;  5ILS A;  5HDK A;  3SZP A;  3OV8 A;  2OBP A;  3QPH A;  3WGH A;  3ERE D;  3R0A A;  2CFX A;  2J5O A;  1ZAO A;  2ETH A;  3ROU A;  2IRF G;  3E5X A;  4RB0 A;  3F6O A;  5LEJ A;  1YIO A;  2J5P A;  1C0W A;  1WWX A;  2K4J A;  3GLX A;  1L0O C;  4OIN F;  1XGM A;  2EB7 A;  2AXL A;  3RIR A;  4IVN A;  1BC7 C;  1HW5 A;  1HXD A;  1GVJ A;  4M71 A;  3R60 A;  5JVT A;  4YFN F;  1D3Y A;  3WU0 A;  3G73 A;  2Q8K A;  2IA1 A;  4YG2 F;  4UUV A;  3MQ0 A;  4O3M A;  1LDJ A;  4P9U A;  2FEZ A;  3C18 A;  1BJA A;  3Q9V A;  3Q9S A;  2EV5 A;  3W6K B;  5HDN A;  1S7A A;  4M74 A;  3T8R A;  2BBY A;  4G6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...