2A61A

The crystal structure of transcriptional regulator tm0710 from thermotoga maritima
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
142
structure length
142
Chain Sequence
KQPFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKITSDLGKEKSSKILDYLKELKGVMERNFSKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords transcriptional regulator Tm0710
publication title The crystal structure of transcriptional regulator Tm0710 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
total genus 54
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2a61A00
5L3CA 3DKWA 3JSOA 1ODDA 3PFIA 2Z3YA 2FRHA 4HX7A 4R8HA 1O7FA 3LWFA 5LEJA 2A3SA 2MLKA 4U7BA 4HBLA 5DV5A 1K7AA 1I27A 1R23A 2Z99A 2B0LA 2PG4A 3RKYA 3P7NA 1ZRDA 5K5RA 4R1HA 2VOPA 1UHMA 2FSWA 2VBXA 2HKXA 5ICCA 1T38A 5DCMB 1FYMA 3HRTA 1J0RA 3T0YA 5DYMA 4U7DA 1PUEE 2K02A 2FF4A 4AWXB 1SMTA 4GCVA 1FYKA 3QRFF 1G3SA 1W7PD 4G7HF 5CLSA 3TOAA 3ZN1A 4UVAA 2L4MA 5DD8A 3LSTA 3KP5A 4KA4A 3JAMK 5DUIA 1F4KA 4EMSA 2JRTA 4ENMA 2HQNA 3HTUA 2QQBA 1R22A 5TJJA 2LF7A 1L3LA 3FWEA 2L54A 6PAXA 1LNWA 3WTTC 1U2WA 1YYVA 3ZN0A 4A0YA 1TQMA 4RAYA 3KZZA 1OKRA 4NHJA 5AONA 5EEHA 4U88A 3WTUC 2E1CA 1P4AA 1P4WA 3HIFA 1ZARA 4I2OA 3WTWC 4AIHA 4E70A 4HOBA 2KIFA 1V3FA 1SFUA 4ZYGA 4I0BA 1FYLA 4BHCA 1I5ZA 2UWMA 2PEXA 2COMA 3DP7A 1LVAA 2QQ9A 2O0YA 2M30A 1ZG3A 5HS7A 1DP7P 1AWCA 1BIAA 3HTSB 1BM9A 1YS6A 3QAHA 1LJ9A 5CVRA 2OA4A 4KNYA 5DEQA 3GFJA 2F5CA 1GXQA 5ILSA 3CO6C 3T5XA 2G9WA 2LDUA 4I7HA 1ZH5A 4OIOF 1HW2A 4MNUA 3RPUA 2QWWA 2Y75A 4A2UA 4KDPA 3FM3A 5LGTA 2P6SA 3HRSA 2FE3A 4ZYDA 1O7LA 3IC7A 1RUOA 4JQFA 4IHTA 3RPQA 5ICFA 2MA3A 2DU9A 1R1UA 2ISZA 4ZH4F 2DW4A 2W85A 1XB4A 4KIFA 4HX4A 2ISYA 4KIGA 2P6TA 3LA2A 2V1DA 4M74A 4XSZF 4TV7A 1UHWA 3GEZA 1U5TB 1F1ZA 5L3GA 2HTJA 1ZG5A 4GYIA 3GWZA 3GVAA 3KP4A 1D8KA 2IA1A 4BYYA 5ILVA 3PQKA 4AIKA 3RYPA 2Z9OA 3SHFA 4WXHA 2EK5A 2PMUA 5D4SA 1IAWA 4EVIA 3EYYA 2V6CA 5TRDA 1D3YA 2OQRA 2JPCA 3WODF 1DPRA 4I0AA 2JPBA 4P5OA 2XUBA 3R6SA 4ENKA 3KETA 2Q0OA 4RGXA 1K6OA 5LBQA 1B9MA 5BPDA 2DK8A 3F8MA 3W6KB 1QZZA 2HR3A 2P5KA 4LB5A 4IVNA 3E5QA 2CO5A 3EQLF 2D1VA 2F5DA 3EYIA 4F7ZA 4UUVA 4GGGA 4N9HA 5FLXZ 4N9IA 1XGNA 2RV8A 3G73A 2ACJA 1MDMA 5CVUA 3CUQB 4Y17A 2VBZA 1H0MA 1YFHA 1QBJA 4YIFA 2HZTA 3KP7A 2H27A 3I59A 4YFKF 4HLXA 1Z05A 4OU0A 1I6XA 1FOKA 1WSUA 3JTGA 5CVIA 4OIPF 2A6EF 4GO1A 3R0JA 4MGRA 5A2QK 5E17F 2RNJA 1XDSA 1J9IA 3DPTA 5LRRA 2H94A 4KICA 1ON2A 1W7PA 4L5JA 4BXUA 3FX3A 3MEXA 1BI1A 1KQ9A 3LA3A 2HOEA 4ENJA 1DPUA 4BHBA 3S2WA 4FX0A 4YIIA 2NS0A 4ZZLA 1RI7A 1YO5C 2P8TA 1R1TA 4CICA 2F5EA 5L3BA 1BI3A 4CYDA 2DBBA 3E6MA 3U2RA 4XSXF 4GXOA 2HFHA 1Z6RA 3ABTA 4PCQA 4O5VA 2IPQX 3M8FA 1KQ0A 1S29A 2BE5F 5HS9A 3J81K 1AOYA 3F22A 1EH6A 4WF2A 2IW5A 3J80K 4LD5A 2YX7A 3Q9SA 3WG9A 5HDKA 1T39A 2CGPA 5F64A 2FBHA 1R00A 1ZYRF 2NNYA 3IKTA 3K69A 3KE2A 4LK0F 1H9GA 1LEBA 3CUQC 3E5XA 1O3QA 3GFIA 3V7CA 3E6BA 3TDZC 4RAZA 1R5HA 4YG2F 4OINF 4AIJA 1LDKB 2ZCWA 3M9AA 3O6BB 3CUQA 1ZGJA 1YLFA 2V9VA 4EJTA 1J7KA 2W25A 1ZAOA 4UNOA 1S6LA 2FBIA 1OMIA 4P55A 1T2KA 2VBYA 1U8RA 4MQVA 4EM2A 4M71A 1KU3A 2FBKA 2UXXA 3AAFA 4ETSA 4A5MA 1IN8A 1G4DA 4P9UA 4U0VA 5D4RA 4M9ZA 4UHTA 5IT9K 2FQ3A 1MJ9A 3E6CC 1FLIA 2MC3A 5LEKA 2A61A 3LQRA 3CJNA 1Z9CA 3MQ0A 1G6NA 2Z33A 1WI9A 1ONVA 1SD6A 4ENNA 1HW1A 1O57A 1JGSA 2L01A 3HOTA 1REPC 1T98A 3RDIA 4RB2C 1IZ1A 2VN2A 3V7RA 3K1NA 3F8BA 1YQAA 3I58A 4L9VA 2W24A 1FBQA 1P6RA 3FZVA 1B59A 3COAC 2ADUA 1V4RA 2ZMEA 4PGGA 3ZQ7A 2BV6A 2GA1A 1STZA 3EDPA 4M9SA 1YW9A 1Z6TA 4KYWA 5J8CA 1UB9A 4I98B 2MH2A 2PFBA 3TO9A 3LQQA 2Z5UA 5D8KB 3BWGA 2HYGD 3JAMZ 3HOSA 2CQKA 4BH9A 4CXFA 1BC8C 1LEAA 3W6JB 4LK1F 4XLNF 2HS5A 4LLLA 4U0WA 5BS6A 1FWZA 1IUYA 2FA5A 4G94A 3L9FA 1T0FA 1PP8F 2H6BA 3HHGA 4LB6B 2YSRA 1HKQA 1XN7A 3TO7A 4RGSA 4MHGA 4HLYA 1B1BA 3EETA 3K9TA 1ZN2A 1HKTA 2A69F 1USSA 1LDJA 2OD5A 3HSRA 4G7OF 1XD7A 2OU2A 1IN7A 5HS8A 1IXCA 2M1BA 2EV6A 4EM1A 1XSXA 2GZWA 5LGUA 4A6EA 2STTA 2F5FA 2OQGA 1P92A 1IXRC 3DFGA 3IRQA 2PMHA 4GYGA 3N4MA 2DT5A 1MKMA 5FGMA 2M45A 2ZNYA 2XVCA 3ZMTA 4RB1A 2BBYA 4OOIA 4S04A 5LGNA 2EJRA 3MWMA 4D0PA 5KVRA 1FY7A 1JHFA 2X0LA 4IRIA 5HOOA 4RGUA 2XAGA 5E8IA 3MFKA 5K5OA 1KGSA 2P4WA 5FFXA 4MEXF 2VBWA 4KN4X 5CJ9A 5BMZA 4AD9A 3E5UA 4L9JA 5IT3A 1J5YA 2CYYA 5ED4A 1J59A 3KEOA 3REOA 2BEOA 2NYXA 1I1SA 2EFWA 1Z7UA 3WTZA 2OZUA 4IF4A 4HQMA 4UXNA 2Y0MA 3PQJA 1MDMB 1RZ4A 2MLGA 3T1BA 5FB2A 3CDHA 3C3WA 4BHPA 3I59B 3KZYA 1HQCA 3GUDA 3SZPA 1E17A 3OOPA 3CUOA 1YW8A 3BY6A 2F2EA 5FFZA 2P5VA 3GX4X 4RB3C 2E1NA 2IP2A 5F6FA 3GYHX 2E7XA 2JSCA 2MBFA 2BGCA 1YW7A 2QQAA 3BZ6A 3B02A 4IPAA 3L09A 2IA2A 1W7PB 4HA8A 2HTSA 1U3EM 2E7WA 5L3EA 3WGIA 2ESHA 1XMAA 3WTSC 2LNBA 2X4HA 1IN6A 5JR3A 3V8JA 2HEOA 2A6HF 2UXNA 3NRVA 1QNTA 2QZ8A 3ERED 3TKYA 2WWYA 5J8FA 1TNTA 1YIOA 2XASA 2KJBA 1XMKA 2UZKA 2VC0A 2ZJ2A 1F5TA 4P96A 3B73A 3ULQB 2BYVE 4HYEA 3O3KA 3RKWA 2KIUA 3F21A 4HAMA 4LJZF 1UCRA 2NAZA 3GZ6A 3F8NA 1GXPA 2IJLA 3G3ZA 3RJPA 2XV4S 4ZZDA 3GO5A 1S8NA 2MD5A 3F8FA 1S7AA 1SMYF 4HF2A 3E97A 1ZRCA 1O3RA 3V8KA 1YG2A 4I02A 2XAFA 4KFCA 1D8JA 4I01A 2XKPA 4IXAA 4KIBA 4R79A 2FOKA 2G7UA 2D45A 1KU9A 1U78A 5D6EA 3ZMVA 4EGZA 3J81Z 3DPLC 5DCFA 1OYYA 1K79A 3J80Z 1JXSA 4NQWA 3GW2A 1BC7C 5E18F 2EFNA 4HX8A 5LHIA 2O8XA 1XCVA 3ROUA 2VOOA 4M6XA 1MD0A 5E1XA 3M1EA 1KYWA 1OYWA 3FXRA 2ZKZA 2HDCA 1FC3A 4EJOA 3KEQA 3GF2A 5H6QA 4QWQA 4YFNF 4MTDA 2NRAC 2EV5A 1B9NA 3DV8A 1EV7A 3M7GA 3QU3A 3NQOA 3VODA 2IA0A 4RGRA 1KA8A 1LQ1A 1TLHB 5JHUA 2VC1A 3I71A 2GIVA 3LA7A 2FU4A 3P9IA 1SFXA 1XCBA 1HXDA 4UV9A 4HV6A 4FX4A 4EJVA 3K0LA 2FNPA 4XRFA 3NEUA 3WGHA 2R7DA 3V8LA 4G8XA 2ZNZA 2ZBKA 1BN5A 2FXAA 2EA2A 1IW7F 1TQIA 4Q47A 1ZRFA 3VFZA 2IT0A 2QM3A 2A07F 3HHHA 5IT9Z 3FM5A 3MAJA 3QU6A 4JK1X 2P7CB 2ZMEB 3EUHA 3ZMDA 1SD4A 3ABUA 1ZLKA 3FXQA 3WTYC 3VEPA 3ZP5A 1IN5A 4RS8A 2RDPA 2HYFA 3C1DA 1FBUA 1HKSA 3JTHA 4QLCU 5L3DA 3N97A 2CWEA 3DQVC 1GVJA 1KU2A 2XROA 1WQ2A 1LB2A 3H92A 1T6SA 1LDDA 1FSEA 2CW0F 4CGZA 4A0ZA 2M5WA 1FX7A 2WV0A 1SAXA 2XRNA 4B09A 4YFXF 2KJCA 5HDNA 3HRMA 2PLYA 2DI3A 4UVBA 3LAPA 3IKVA 1Z1DA 1QPMA 2ZXJA 2GQQA 1MJBA 3CLOA 3BP8A 1MZBA 1G3TA 1PP7U 1BBYA 3RIRA 1GHCA 4M9XA 3HSEA 1Q1HA 2QVOA 4RB0A 3GFMA 3LAJA 3RTRA 2DFIA 3QP5A 3BDDA 2VT3A 2PI0A 1DUXC 4Q5SF 5CVVA 3BJOA 1WKMA 1MGTA 1HW5A 1TQPA 3TOBA 1HBXG 2DLLA 4HF0A 3Q5FA 5H20A 2EB7A 3L7WA 2DPUA 2KKOA 3K1PA 3HUGA 4U0YA 1D5VA 2K27A 2W57A 1JHHA 1CGPA 2FMLA 2OBPA 1P2FA 2J5OA 3GLXA 1IN4A 2L3DA 4B8XA 1FBSA 4L0ZB 1G3YA 1J2XA 2XHKA 1XGOA 2K86A 1F9NA 1R1VA 3ISPA 3ML6A 3R61A 3VOEA 3F72A 2P7VB 2GWRA 1CF7B 1S7OA 4LGWA 1Z91A 1QO0D 4M72A 3T8TA 3IWZA 4L9TA 2M8EA 1QGPA 3U9GA 2TDXA 3BJAA 4IRHA 2RC4A 3GXOA 1FT9A 3FXUA 1ZG1A 3MCZA 4OIQF 3BPXA 4XLPF 1IRGA 1HSJA 1DDNA 4S05A 1SD7A 4ON0A 1BI0A 2H09A 3BJ6A 2YPRA 2XIGA 4ESJA 1K78A 1S3JA 5AIQA 3HRUA 4MTEA 1YTYA 2XAJA 3BROA 4BNCA 4I09A 2DO7A 2EFOA 2VXZA 1XGSA 3I54A 4EM0B 2RKHA 1OR7A 2CSOA 4KT5C 4N0BA 3T8RA 2EWNA 1W4MA 3ECOA 3K2ZA 2OAZA 3SXYA 5ICGA 3C18A 4WCGA 3IRRA 4IHSA 2V1XA 3H3UA 2W84A 3WU0A 2VODA 4DNCA 3E3VA 2DPDA 2DQRA 3WE2A 4LLNA 2G7HA 3FF5A 2M87A 4ZYHA 2O03A 3KFWX 3I0TA 3KP2A 1A04A 4WWCA 2O6GE 3E6DA 3Q9VA 1R5GA 1I1GA 3IL2A 4ESBA 2DTRA 2MH9A 1UFMA 4CZZA 3JW4A 3IHUA 4CO8A 2AXLA 1CF7A 4G6DA 2DQLA 3WTVC 2LF8A 1NHAA 2JT1A 2PN6A 4L0YB 2HQRA 4WX9A 1XDUA 2L02A 3KLOA 4WXDA 2GXGA 4EQQA 2JTVA 3MZHA 5LRSA 1RIOH 5FO5A 5JVTA 3QOPA 3VB2A 5HVQC 1FP2A 3F6OA 2J5PA 1R36A 4HW0A 2QUFA 1KYZA 1BJAA 3SQNA 1IXSB 3J7AO 2H6CA 3TGNA 4EV0A 1PDNC 4HF1A 3DEUA 4WXCA 2HGCA 1ZLJA 5K5QA 3D0SA 4UVCA 5DCMA 2DK5A 3R60A 5AIPA 4G6QA 5FD5A 2VE8A 1G3WA 4HQEA 3WTXC 2XAQA 4K2EA 1E2XA 1ULYA 3WU1B 4LLGF 2QBYB 3ZMSA 4PZJA 1WRJA 5DD4A 3ZMUA 1KU7A 4L5IA 1EH8A 4EJWA 3ZPLA 3BPVA 2RVCA 3I4PA 1ZHFA 1XSDA 2QYOA 1ZGAA 3I64A 2JZYA 2IRFG 4L9NA 1O3SA 2RGVA 2GA2A 2EA4A 4Q48A 2PJPA 2A5YB 5A2QZ 1O3TA 3GZ5A 1JE8A 2CG4A 4MQ9F 2QLZA 2ESNA 2YX4A 4Y13A 5E8GA 2HKOA 3F3XA 3HYIA 3RYRA 4Z2YA 3BOQA 4ASNA 3M8EA 2O61A 4L18B 3SFZA 2VE9A 2LSOA 3L00A 3V7SA 2Q2EA 4HDUA 1U6GA 3WGGA 5F1RA 5HDGA 2FMYA 2STWA 3TO6A 2C6YA 2D2WA 3KP6A 3GFLA 4MEYF 2EFPA 3JSPA 4NB5A 5KK1A 2NNNA 2LKPA 4A12A 3KLNA 2L4AA 2O3FA 3I5UA 1BI2A 4Y15A 3K1MA 2IVMA 4G9YA 2ZO4A 4BQAA 1L0OC 2VONA 3R0AA 1BIBA 5ERIA 1MJAA 2K4BA 4H0EA 4A6DA 2DAOA 3KCCA 1TW3A 4HDVA 2D1HA 2KRFA 2HWVA 5JI6A 4ZYEA 4XBFA 4A0XA 1USTA 2XGXA 3V4GA 3I53A 1B6AA 4AVPA 2A68F 5L3FA 4HZFA 2FNAA 1TTYA 1FNNA 4M6YA 5K1YA 5LHHA 5CYVA 1RUNA 4DQ2A 2OZ6A 2QBYA 1Y0UA 3D5LA 5BPIA 5BOXA 5D8LB 2R3SA 4HV5A 3SZTA 2K7LA 1EH7A 5DUKA 1U5TC 1IRFA 2RQPA 2YR2A 4O6JA 3FMRA 4LG0B 2VT2A 4Q4ZF 1TBXA 1XSVA 1RNLA 3P9CA 1SFEA 3QP6A 3KP3A 4FHTA 3O2PE 2WTEA 1U5TA 1R7JA 3QPTA 5FLXK 1KQ8A 4KUMA 2P5LC 4PDKA 4IRGA 1XGMA 2PBIA 5E1ZB 2ELHA 1SD5A 5ILUA 3DXJF 1QZYA 2QENA 4EJUA 3TDUC 1P4XA 4BAYA 2PQ8A 5ICEA 5FD6A 1HSTA 5H6RA 1W5SA 5CVJA 1C0WA 3QPHA 2Y48A 1FPQA 4IJAA 1B4AA 1W5TA 4M73A 3ELKA 4LMYA 5D5VB 3H3ZA 4KMFA 3TQNA 1ZREA 4JBAA 2EFQA 3P9KA 5E20A 4PGHA 3F8CA 1FSHA 3CO7C 1BOAA 3RI4A 3CTAA 2RN7A 5D5XB 4KMUX 3F23A 5LHGA 4UV8A 2ZFWA 4O3MA 2AS5F 1IF1A 2KIMA 3ZMZA 1FZPB 1K78B 5D6FA 2V1UA 4CHUA 3FMQA 3WE3A 3OV8A 5JFRA 3F6VA 5E1WA 1FP1D 3HSFA 3C7JA 4EGYA 2R7FA 2FEZA 4LFUA 4OMZA 1QQIA 3LFKA 4KN7X 2GXBA 1TNSA 2XKOA 4LG0A 5HLIA 2K4JA 4P9FA 1OPCA 1J75A 3FMSA 2V79A 2Q8KA 4ESFA 3IWFA 5HLGA 5EEGA 3R4KA 5D5UB 4G7ZF 5J6XA 4A5NA 2ETHA 1YS7A 5LLQA 2EV0A 1WWXA 3L2CA 3RKXA 2GAUA 5DDGA 2WC2A 4WK8F 1X3UA 1TW2A 1R58A 3MZYA 3FHZA 2YU3A 2CFXA 5BQTA 5D5WB 4CDGA 1ON1A 3ECHA 1VTNC 1OYIA 1H9TA 3U1DA 2XAHA 4FT8A 4OIRF 4OMYA 3DF8A 5HLHA
chains in the Genus database with same CATH superfamily
4XK4A 5L3CA 3DKWA 3JSOA 1ODDA 3PFIA 2Z3YA 2FRHA 1AHDP 1RR7A 4HX7A 4R8HA 1O7FA 2KFDA 3LWFA 2NOJB 3HC7A 5LEJA 2A3SA 2MLKA 4U7BA 4HBLA 5DV5A 1K7AA 1I27A 1R23A 2WY8Q 2Z99A 4X1EA 1NG6A 2B0LA 2PG4A 3CDLA 4A3CJ 3RKYA 1TT5B 4FASD 1OCRH 3P7NA 1ZRDA 5K5RA 4R1HA 2VOPA 3MVPA 4AM3A 3I4MJ 1UAAA 1MW7A 2WV1A 2ZXIA 2VQCA 3AG3H 1UHMA 2FSWA 2VBXA 3W2WA 2HKXA 5ICCA 3FKIJ 1E3OC 1MBGA 4Y4RA 1D1CA 4ZC3A 1T38A 3OYHA 5K7HA 5DCMB 3I55I 1FYMA 4CYCA 3B6CA 3HRTA 2M9HA 3DCFA 1J0RA 3T0YA 1Y6IA 3CP2A 1VQ9I 5DYMA 2VJIA 4U7DA 1WCMJ 4CUGA 1PUEE 2K02A 2FF4A 4AWXB 4XLEA 3S1RJ 1RR8C 1X1CA 2KT0A 3BR3A 3JRDA 1QA6A 4YRVA 1SMTA 2K40A 4GCVA 4BACA 1FYKA 4HPQA 4M3DA 1ZKGA 1POGA 3QRFF 3K6GA 4BKXA 1G3SA 1W7PD 3AL0C 4G7HF 1D1AA 1D0XA 2OCEA 3ZR8X 5CLSA 4PJMA 5EGOA 3HBLA 3JRFA 3TOAA 3ZN1A 2CUZA 5DM6F 4UVAA 2L4MA 5DD8A 3K2AA 3LSTA 2V6EA 3KP5A 1ETWA 4DIQA 4KA4A 3L2QA 3JAMK 5DUIA 1F4KA 3BCBA 1S9HA 2JRTA 3K4NA 4EMSA 4ENMA 2HQNA 1FJLA 3HTUA 2QQBA 2R7UA 1R22A 5TJJA 3MN2A 2FJ1A 2LF7A 2ZXHA 4XM3A 1L3LA 5JLWA 3FWEA 2L54A 6PAXA 3CQZJ 3L2RA 2DYSH 3C2HA 1LNWA 3BT9A 3WTTC 4A3IJ 2MW8A 3PNVA 1IRXA 1U2WA 1YYVA 2DA1A 3ZN0A 4A0YA 1TQMA 2RAEA 4RAYA 3KZZA 2XDVA 4BQOA 2R92J 3QOEA 1OKRA 4NDLA 4NHJA 5TISC 5AONA 5EEHA 4U88A 3WTUC 2E1CA 1P4AA 1P4WA 4B44A 1MNDA 3HIFA 1ZARA 2Q2EB 4I2OA 3WTWC 4AIHA 2QA4I 4E70A 3BG3A 4HOBA 4FE7A 4ZTFA 4OWRB 2KIFA 1V3FA 1SFUA 2F5VA 4ZYGA 4I0BA 3IP4B 1APLC 3KZIC 1FYLA 4BHCA 1I5ZA 3CJQB 1ORKA 2PEXA 2UWMA 2COMA 3M07A 1WI3A 3W3CA 2ZXWH 3DP7A 1LVAA 2L2OA 2EIMH 2QQ9A 3MKWB 1KONA 3AG1H 1T08B 2O0YA 3HG9A 2M30A 4B3XA 1ZG3A 5HS7A 4XLFA 1DP7P 1AWCA 3G1OA 1BIAA 2XPVA 1W1WE 2E5ZA 3HTSB 1BM9A 3HGYA 1VFCA 1YS6A 3QAHA 1EA3A 4PJJA 3S3MA 3DKXA 3JRGA 1VQ8I 1LJ9A 5CVRA 5GPCA 2OA4A 1B8IA 2DOAA 4A3BJ 4KNYA 5DEQA 3GFJA 2F5CA 1WJFA 1GXQA 5ILSA 3CO6C 3T5XA 4BJ5C 4BS9A 1IRZA 2G9WA 2LDUA 4NNJA 4I7HA 3S16J 2DA6A 1ZH5A 1MMSA 4DJAA 4OIOF 3QODA 1HW2A 4S0HB 4MNUA 2DA3A 3RPUA 2QWWA 2Y75A 4A2UA 4D1QA 4KDPA 3FM3A 5J47A 5LGTA 2P6SA 2X6OA 2M8GX 1TWFJ 2F48A 4CCMA 2VPRA 3HRSA 2FE3A 1HLVA 4Z6YA 4ZYDA 1O7LA 3IC7A 3NWTA 4XQFA 1RUOA 1BR2A 3SEZA 4JQFA 4IHTA 1RC9A 5TGTA 2F4MB 3RPQA 5ICFA 2MA3A 2DT6A 2DU9A 1H89C 4C9YA 1R1UA 2ISZA 4M6VA 4ZH4F 2DW4A 2CQXA 1OJLA 2W85A 1XB4A 1SEUA 3BG5A 4KIFA 2CQNA 4HX4A 3ZQCA 4M3FA 4A69C 2W48A 2VQGA 2ISYA 1A6QA 4PFPA 4KIGA 2P6TA 3LA2A 2V1DA 4M74A 2IGNA 3TP0A 1VQ4I 4XSZF 3ZQIA 4TV7A 1OCTC 1QHHD 2XPUA 1UHWA 3GEZA 2NVTJ 2M0MA 1U5TB 1YE9A 1F1ZA 5L3GA 2VIXA 2HTJA 2CW7A 2LLKA 2ZC2A 4A3KJ 1MMDA 1ZG5A 5JHFA 3LSJA 4GYIA 3GWZA 3GVAA 1RESA 3KP4A 2DN0A 1EKEA 3J7ZI 4E7IA 4F52A 1D8KA 2IA1A 2VXDA 5JLXA 3VWBA 3HOUJ 4BYYA 5ILVA 3PQKA 3TL4X 4AIKA 3RYPA 2Z9OA 2XGEA 3M3YJ 3H0DA 3SHFA 1V54H 4II3A 3DBLB 4WXHA 3K4BA 2EK5A 2PMUA 3GTGJ 2DT7B 5D4SA 1IAWA 2HDDA 2GBYA 4EVIA 3EYYA 2V6CA 5TRDA 1D3YA 2OQRA 2JPCA 3WODF 1DPRA 4G12A 4XNFA 4ZYAA 1A6IA 4I0AA 3UR3C 2JPBA 2DMPA 1X4PA 4W1UA 4NC7A 4P5OA 3FBIB 3HB9A 2XUBA 5J3LA 3R6SA 3OYFA 4ENKA 3KETA 3UKGA 4KT6A 2Q0OA 4RGXA 1YHQI 1K6OA 5LBQA 3BTLA 1B9MA 5BPDA 3DU5A 2BXYA 3SZGA 3DTEA 4BQNA 2PMZA 2IGMA 3AG4H 1WJDA 2DK8A 3F8MA 3W6KB 2R5YB 2DMNA 2ID6A 1QZZA 2HR3A 1I3QJ 2P5KA 4LB5A 1U0JA 2E35A 4IVNA 3E5QA 2CO5A 1ZQ3P 1MH4A 3EQLF 2KL4A 4F3QA 1X4OA 2D1VA 2X1EA 2F5DA 5B3SH 3EYIA 4F7ZA 3FHNA 4FCYA 4UUVA 2O8KA 4GGGA 1UHSA 4N9HA 2I5UA 5FLXZ 4N9IA 1XGNA 2RV8A 5FLVA 3G73A 2ACJA 1MDMA 5CVUA 3CUQB 4ITVA 1SC7A 4Y17A 4X6AJ 2MYSA 2VBZA 2MGQA 1TL8A 1H0MA 1YFHA 5FKMA 5GPAA 1QBJA 4YIFA 5CKTA 5DM7F 2HZTA 3MMYB 4C30A 1F36A 3KP7A 3ZXSA 2H27A 3J7AY 3CF2A 4HSRA 3S17J 2ELKA 1MBHA 2DA4A 3JRAA 2L0KA 3I59A 4YFKF 4HLXA 1Z05A 4CCOA 4OU0A 1I6XA 3E1SA 1XPXA 1FOKA 4PSWA 1SFKA 5IY5H 1WSUA 3JTGA 5CVIA 4OIPF 2A6EF 1UJ8A 1ETQA 4GO1A 3R0JA 2BOLA 4MGRA 1YIJI 3B6AA 5A2QK 4RAFA 4JX4A 1JKPC 1PVEA 5E17F 1V5EA 2RNJA 1XDSA 3DLAA 1J9IA 3DPTA 2M3AA 5LRRA 5F27A 4J00A 2H94A 2JSPA 5GAEJ 2X48A 4KICA 1ON2A 1W7PA 4L5JA 4BXUA 3FX3A 3MEXA 1BI1A 1KQ9A 3LA3A 3S1MJ 2HOEA 4KISA 2E34A 4ENJA 1DPUA 2VQLA 3DEEA 4BHBA 1MBEA 3S2WA 4FX0A 3CC2I 4YIIA 1X58A 2NS0A 4ZZLA 1RI7A 3BLYA 3KX2A 1YO5C 3FK7A 4J19A 1WJBA 2H8RA 5GAGJ 1FOWA 1DQUA 1MNEA 2Y9YA 4N4NB 1Q1VA 2P8TA 1R1TA 3OYEA 4CICA 2F5EA 2HYJA 3K7AJ 5L3BA 1BI3A 4PUSA 2I8DA 2KQRA 4CYDA 1FIAA 1FMVA 4E7KA 2DBBA 3E6MA 4BY1J 3U2RA 4XSXF 4GXOA 2HFHA 4C2UA 1Z6RA 3ABTA 4PCQA 4O5VA 1XG1A 2IPQX 3M8FA 1KQ0A 1P9QC 1S29A 1X1DA 2BE5F 3RZDJ 5HS9A 3J81K 1AOYA 3F22A 1EH6A 4MFDA 4WF2A 2IW5A 3J80K 2VL8A 2K3PA 4LD5A 1QVTA 4BJ6C 1I6HJ 2YX7A 2CV2A 3Q9SA 3WG9A 5HDKA 1T39A 3K4KA 2CGPA 3LSHA 2B63J 5E79C 4P1WA 1GV5A 2E1MC 3GTJJ 4XKCA 3HEFA 3FIWA 2OTJI 3C2BA 3KYCB 5F64A 2FBHA 1R00A 3K10A 1ZYRF 3JRIA 1JT6A 2NNYA 4B48A 2RNGA 3IKTA 3K69A 2R5YA 3KE2A 4LK0F 3LSRA 1J09A 2E2HJ 2M4KA 4DYRA 5M3MJ 2Y2ZA 1SVMA 1MIJA 1RKTA 4A3MJ 3Q0VA 4LIVA 1H9GA 1IV6A 1LEBA 3CUQC 3E5XA 1O3QA 4M3EA 3GFIA 1B72A 3V7CA 3E6BA 2L7ZA 3TDZC 4RAZA 1HA8A 3HOWJ 1AKHA 1R5HA 4DOZA 4YG2F 4OINF 1JI8A 1NTCA 4AIJA 1LDKB 2ZCWA 2W1OA 3M9AA 3O6BB 2L5QA 1BW5A 3CUQA 2DFHA 1ZGJA 2LY1A 1YLFA 4I6ZA 3NAUA 3A0HC 2V9VA 4EJTA 1J7KA 2W25A 1ZAOA 4BE2A 1BR1A 4LIUA 4CSWA 4XN3A 4UNOA 2VKVA 1S6LA 5M3FJ 2FBIA 1OMIA 1OFCX 3LOCA 4P55A 1T2KA 2VBYA 1U8RA 1PUFB 4AIDA 1W36C 1OISA 2DDAA 3OMYA 4MQVA 4EM2A 1Z3YA 1ZK8A 2UUZA 4M71A 1KU3A 2FBKA 3TMOA 2UXXA 3M1CA 3RKQA 3HXLA 1GDTA 4XR6A 3AAFA 3DTKA 4ETSA 2HPMA 4CYCB 4A5MA 1A35A 1IN8A 3W2VA 2O7OA 4P9UA 1G4DA 4U0VA 5D4RA 2XPWA 4M9ZA 4UHTA 5J4YA 1TWCJ 5IT9K 2FQ3A 1MJ9A 1X2MA 2R5ZA 4E7ZA 3E6CC 1FLIA 2MC3A 5LEKA 1ETYA 4JYKA 2A61A 1OCZH 3ABMH 3LQRA 1WPKA 2NVXJ 3CJNA 3BR1A 4HRIA 1Z9CA 3MQ0A 4DBRA 1G6NA 2KHMA 2Z33A 2JVHA 1WHUA 2ZSHB 1WI9A 5EGOB 1QPIA 1H8AC 1ONVA 3SEQA 1SD6A 4ENNA 1HW1A 1HF0A 1O57A 1D1BA 1JGSA 2L01A 4XKVA 2EINH 2IS1A 3HOTA 4C2TA 4A3LJ 1REPC 1T98A 3RDIA 3BQZA 2K9LA 4RB2C 2OUMA 1IZ1A 2VN2A 5J1RA 3V7RA 3K1NA 3F8BA 1YQAA 3MKLA 3I58A 4J01A 2IBDA 3LSPA 4L9VA 4HNTA 2W24A 1FBQA 4IKFA 1P6RA 5F0CA 3ABKH 3OY9A 3FZVA 1OLTA 3FKJA 2DMTA 2TRTA 1B59A 1MBJA 3COAC 2ADUA 3OIPA 1V4RA 4FTHA 5J1UA 2ZMEA 2K3FA 3OYIA 4PGGA 3ZQ7A 1YX3A 2BV6A 4UUTA 3ZQHA 2GA1A 2QKLB 2DXIA 1STZA 3ZQFA 1T95A 3EDPA 4H4KC 1PJRA 2B7EA 4M9SA 1YW9A 5GP9A 1Z6TA 4KYWA 5J8CA 1UB9A 4I98B 2MH2A 2PFBA 3TO9A 1JUPA 3G1MA 3LQQA 2Z5UA 3SDGA 5D8KB 4JX5A 5FLMJ 3BWGA 2COBA 2HYGD 4XRSG 3JAMZ 3I3LA 3HOSA 2CQKA 4BH9A 4CXFA 1BC8C 4XONA 5J1YA 1LEAA 3W6JB 1T0FC 2AQFA 1TWAJ 1I50J 2G0EA 4LK1F 2ZFUA 4XLNF 1H88C 2HS5A 4LLLA 4U0WA 4NUBA 4XOTA 3FXMA 3Q3SA 5BS6A 1MMNA 2JA6J 1FWZA 2DOFA 3GTKJ 1IUYA 2DMQA 2FA5A 2DA7A 3Q0WA 1VQLI 3IAS2 1QVUA 4G94A 3L9FA 1T0FA 1PP8F 1B8IB 2H6BA 3HHGA 2ECCA 4LB6B 1ZTRA 2YSRA 1HKQA 1X3WB 3PUBA 1XN7A 1PUFA 3BC8A 3HOZJ 2L7MP 3TO7A 3CJRB 4KITB 4RGSA 2KDOA 3D5SC 4MHGA 4HLYA 1YJNI 5B66C 3GTQJ 1B1BA 5FJ8J 9ANTA 3EETA 3K9TA 1ZN2A 2ECBA 2HXIA 2BXZA 2A69F 2E5NA 1ZR4A 1HKTA 1USSA 1LDJA 3IV5A 3I56I 5F08A 1JGGA 1FTZA 4HNVA 2W4SA 3BG7A 2OD5A 1X1BA 5LD2C 3HSRA 4G7OF 3GZNB 1XC5A 1XD7A 3OYAA 2OU2A 3DEWA 1IN7A 5HS8A 1IXCA 2M1BA 2EV6A 3RZOJ 2VKDA 2EIKH 4A3FJ 3FXJA 3CCJI 2IGOA 4EM1A 1XSXA 2GZWA 3GLLA 1R9TJ 5LGUA 4A6EA 2BHYA 2OTLI 4PJ0C 2STTA 4IQJA 2F5FA 2OQGA 1P92A 1IXRC 4IO9F 2NVYJ 3DFGA 2KISA 3HL2A 1GV2A 4A93J 1U9NA 3IRQA 2PMHA 4IOCF 3AFHA 2A6TA 1IUFA 3C2GA 2EH3A 1XTAA 3DU6A 4GYGA 3ZCOA 3N4MA 4Y3OA 2MD0A 4RLFA 3CCRI 5E3LA 4F93B 4F92B 2DT5A 1MKMA 1WZ2A 4BDZA 1ETVA 3HM5A 1LE8A 3SJMA 5FGMA 2H8WA 2M45A 2ZNYA 2XVCA 5B1BH 3ZMTA 4RB1A 2BBYA 4OOIA 5EJCA 4A3JJ 4S04A 1LUJB 5LGNA 5E3MA 4DYQA 2EJRA 3CDIA 3MWMA 3OYLA 5J4VA 2JUCA 4D0PA 5KVRA 3IH2A 1FY7A 1JHFA 2X0LA 4IRIA 5FROA 4RGUA 2XAGA 5HOOA 5E8IA 4PFOA 4LOCA 1ZR2A 4N4OB 3MFKA 5K5OA 1KGSA 2P4WA 2QCOA 2MC4A 2K5CA 5FFXA 1GT0C 4MEXF 2VBWA 5EDNA 4CH7A 2CRGA 4KN4X 5CJ9A 1A31A 2AHQA 2EPFA 3H9GA 2K85A 2FOWA 5BMZA 4AD9A 3E5UA 2EILH 3F0CA 4XLCA 3HPGA 5B1AH 4L9JA 2CUFA 3LSMA 4AYBA 5IT3A 1NG7A 2LREA 1J5YA 2CYYA 5ED4A 1J59A 3KEOA 3REOA 5KCMA 4DYCA 2BEOA 2NYXA 2FX0A 1I1SA 2EFWA 1Z7UA 2P0WA 3WTZA 3VSLA 2OZUA 4IF4A 4HQMA 4UXNA 1DGRM 3FXKA 2BHZA 3WHCA 1UMQA 2KLOA 2Y0MA 3PQJA 2O5RA 1MDMB 1RZ4A 2MLGA 2NS7A 3T1BA 3S8PA 2LC2A 3F9KA 3PNYA 2CH0A 4YELA 5FB2A 4XICA 1YJWI 3DPUA 2CV0A 3CDHA 3RCOA 3C3WA 4U87A 4BHPA 4CCJA 1P7IA 2CMPA 3GCMA 3I59B 2R4GA 3ZQGA 3KZYA 1HQCA 3GUDA 3SZPA 4PSXA 1SAUA 3GBGA 1E17A 3OOPA 3CUOA 1YW8A 3BY6A 2CUEA 2F2EA 1Z21A 4BUPA 5FFZA 2P5VA 2EZLA 1S72I 1ETXA 3GX4X 4BL0B 4RB3C 2OV7A 2E1NA 2IP2A 5F6FA 3GYHX 2E7XA 2JSCA 5IYBJ 2MBFA 2BGCA 1YW7A 2QQAA 3WG7H 3BZ6A 2WBMA 2WB1A 1T8IA 3B02A 2M7AA 3NWSA 3A01A 4IPAA 5CPRB 3L09A 2L9RA 2CS3A 2DA2A 2IA2A 1W7PB 2OC6A 4HA8A 4AYBN 1Y8QB 2HTSA 1U8BA 4ZDOA 2D5VA 1U3EM 2I10A 5J40A 3H3VK 1E3HA 2E7WA 2QQ8A 5L3EA 1MNMC 3PNTA 2MG4A 3RQIA 3WGIA 3LFUA 2ESHA 4E7JA 2JVGA 2XF6A 1ETKA 1FMWA 2LD5A 1XMAA 3WTSC 3H36A 2LNBA 2LFBA 1IN6A 2X4HA 4KJZA 1Y0NA 3BQYA 3PJRA 5JR3A 3V8JA 3VYRB 2HEOA 2R7QA 2A6HF 2UXNA 2VKHA 3NRVA 1D0ZA 1QNTA 2QZ8A 4B3AA 3ERED 4IHWA 3TKYA 5C3EJ 2K9NA 2JUGA 2OF7A 2WWYA 5J8FA 1TNTA 1YIOA 4BY7J 2XASA 2VKEA 2KJBA 1XMKA 2UZKA 2VC0A 4V2FA 2ZJ2A 1F5TA 4P96A 4B1RA 4MFEA 3B73A 3ULQB 2BYVE 2W82A 4HYEA 1Z0XA 3O3KA 3RKWA 2WB1N 1VQKI 1UG2A 1XX5A 2KIUA 4QSHA 3F21A 1MSFC 2Y69H 4HAMA 3K4MA 4IEJA 2WADA 4ANJA 4UB8C 1UG0A 2JA2A 4LJZF 1HCRA 2Y9ZA 4UUSB 2KZGA 1UCRA 2NAZA 3GZ6A 1JTXA 3F8NA 5FRMA 1GXPA 2IJLA 4V2GA 3G3ZA 2HVSA 3RJPA 2LYCA 2XV4S 4C2MJ 4ZZDA 3DWLE 3GO5A 1S8NA 2LR8A 3G2BA 4RM2A 3K70D 2MD5A 2AO9A 2E1MB 4MIMA 3F8FA 5IPAA 2WAEA 3H35A 1S7AA 3KIOA 3U21A 1SMYF 1I3AA 3DLLF 3ZGKA 4E7LA 1OCCH 4HF2A 1X1PA 3E97A 1B72B 2KMUA 2XF7A 3OL4A 5CQGA 1ZRCA 2VJ5A 2Y30A 1O3RA 2F4IA 3V8KA 3OS1A 1YG2A 1AKHB 1Z67A 3VYSB 5KAFC 2DA5A 4E4HA 1W5CC 3A1YA 4I02A 2KRCA 3MKZA 5C44J 5IP9J 2XAFA 4KFCA 1D8JA 4BE0A 2L9SA 4I01A 2XKPA 4IXAA 4KIBA 2V26A 3IH4A 4R79A 2FOKA 2G7UA 1BOBA 2D45A 3H9JA 1KU9A 1U78A 5D6EA 3ZMVA 4EGZA 3J81Z 3OR2C 1HC8A 3DPLC 2HU9A 5DCFA 1OYYA 1K79A 3J80Z 1JXSA 4NQWA 3FK6A 4EEFG 4XKBA 3GW2A 1BC7C 5E18F 2EFNA 2ID3A 2MFZA 2PJRA 1Z7LA 2LP0A 4HX8A 4RMNA 5LHIA 2V7FA 4DZJA 2O8XA 1XCVA 1VQMI 3ROUA 1DU0A 2VOOA 4M6XA 1MD0A 5E1XA 3M1EA 3QPLA 1KYWA 1OYWA 1Y8RB 2PMZN 2HVRA 2DJIA 2TCTA 2ZKZA 3FXRA 2HDCA 1FC3A 4EJOA 3KEQA 3GF2A 5H6QA 4B4CA 4QWQA 4YFNF 4MTDA 3VSKA 4DW6A 2NRAC 2R5ZB 2EV5A 1B9NA 2E1OA 3DV8A 4G6TB 2VQHA 1EV7A 1ERDA 3BZKA 2EQRA 3AG2H 3M7GA 3QU3A 5E3OA 1W0TA 3G4SI 3NQOA 5IYDJ 2KIQA 2X1CA 3P5JA 3VODA 2IA0A 3VYTB 4BU2A 4RGRA 2LRDA 1KA8A 2MSYA 1TLHB 1LQ1A 3KPHA 5JHUA 2LMDA 2VC1A 3I71A 2GIVA 3LA7A 2VJJA 4XRMA 2FU4A 3P9IA 1SFXA 2O9LA 1XCBA 1HXDA 4UV9A 4MO7A 3FBNB 4HV6A 1R71A 3S3OA 1TP4A 4FX4A 4EJVA 3HOVJ 1LVKA 3K0LA 2FNPA 2R7RA 3FXOA 4BE1A 4XRFA 1K6YA 4PK4A 2EBIA 3NEUA 1BJZA 3LNQA 5JVGF 2K9MA 3WGHA 1NK3P 2R7DA 4DBQA 2XAUA 1YOVB 3V8LA 4G8XA 5HNFA 2KZVA 2ZNZA 2QSGX 1ZELA 2ZBKA 4CCLA 1BN5A 4B47A 2FXAA 3EUHC 2EA2A 1IW7F 1QRYA 1TQIA 4Q47A 5EEAA 1ZRFA 3VFZA 2IT0A 2BVMA 2HZDA 2QM3A 1IO2A 2NVUB 3CMEI 2A07F 3HHHA 5IT9Z 2NXNB 2W7NA 3FM5A 3MAJA 3QU6A 3QYBA 4BBRJ 5GADJ 3H9QA 4JK1X 4UUSA 2ZMEB 1N75A 2P7CB 3EUHA 5EZGA 3ZMDA 3QWLA 2IGKA 1SD4A 3ABUA 2LG4A 3ZRGA 3LSGA 3PO3J 1ZLKA 2HNHA 2B9SA 2QKMB 3W6VA 3FXQA 3WTYC 3VEPA 3ZP5A 1IN5A 4RS8A 4AU7A 4CA0A 2RDPA 3HDDA 1DGWY 2JA7J 3KEYA 1X2NA 3CJTB 2HYFA 3C1DA 5B5EC 1FBUA 1HKSA 4BEHA 5HNHA 5IP7J 2QGUA 3JTHA 4QLCU 5L3DA 2UV1A 3N97A 2CWEA 3DQVC 1GVJA 1KU2A 2L7FP 4UY8I 2XROA 1WQ2A 4LG3A 1WJEA 1LB2A 4E7HA 3H92A 1T6SA 1LDDA 1SFOJ 3MKYB 3OSGA 2WAQA 1FSEA 2CW0F 1ETOA 2VB6A 4ZTJA 2XGDA 4CGZA 3CLQA 4A0ZA 3S32A 2M5WA 2LY9A 4RAGA 1FX7A 5GTHC 5KAIC 3LSIA 2WV0A 1SVLA 2E36A 1SAXA 2X1DA 2XRNA 4B09A 4YFXF 2KJCA 2ME0A 5HDNA 3HRMA 2PLYA 1VZ0A 2CU7A 2DI3A 4UVBA 3HJEA 2LK2A 3LAPA 3IKVA 1G59A 1Z1DA 1QPMA 2ZXJA 2IS2A 4D5CA 2GQQA 1MJBA 3CLOA 3S2HJ 4XN0A 3BP8A 4CCNA 1MZBA 2HQ5A 2WY7Q 2V9PA 3BR5A 1VQNI 1G3TA 1PP7U 1HDDC 4DZPA 3A02A 1BBYA 3RIRA 1GHCA 4M9XA 5IOYA 5KNLA 3HSEA 4FETA 2WA0A 1Q1HA 3JRCA 2QVOA 3S93A 3CC7I 4RB0A 2BVLA 1RPWA 5CQEA 2VLAA 3GFMA 4Y52J 1T33A 3BG9A 3DKYA 3LAJA 3RTRA 2DFIA 3QP5A 3BDDA 1IG7A 1ITYA 2VT3A 2PI0A 4ZDLA 2HVQA 4HNUA 1DUXC 3QQAA 4YEJA 2VASA 1LFPA 3KYDB 4Q5SF 1HOMA 5CVVA 3BJOA 2NOGA 1WKMA 3VDXA 1MGTA 5E3NA 1HW5A 3CMMA 1TQPA 1KZHA 3W2AA 3TOBA 1HBXG 2DLLA 1YX5A 4HF0A 3Q5FA 5H20A 3M4OJ 4NC6A 2EB7A 2M4GA 2JQ7A 3JCUC 2R7OA 3OS2A 2ZJPF 3L7WA 1X19A 1JJ6C 2L7KA 1D0YA 5KHDA 2DPUA 2KKOA 2ZMEC 3BTIA 3K1PA 3HUGA 4U0YA 1LE8B 1BA5A 1D5VA 2LY2A 2K27A 2LKSA 2W57A 3CESA 1JHHA 3IH3A 3K4JA 1CGPA 2M34A 5GAHJ 4HEA2 3K70C 2FMLA 2OBPA 1P2FA 1UELB 2J5OA 3LL7A 2NS8A 3IUOA 2XB5A 3GLXA 3ZQQA 2GOMA 2R7ZJ 3U1KA 4XLAA 1IN4A 4LITA 2L3DA 2HOSA 4B8XA 1FBSA 4L0ZB 1G3YA 2E71A 2HXOA 1Y56A 1J2XA 5C4JJ 2XHKA 1XGOA 1JT0A 2CJJA 2K86A 1JUMA 1F9NA 1R1VA 3HPHA 3ISPA 3ML6A 3R61A 3VOEA 1TWGJ 3F72A 3S3NA 5EG0A 1WJ5A 2P7VB 2GWRA 2JWTA 4M3BA 1CF7B 1S7OA 4LGWA 3JR9A 1Z91A 1QO0D 4M72A 3T8TA 3IWZA 3L2VA 4L9TA 3PL8A 2M8EA 5DTDA 1BR4A 2XSDC 1QGPA 3U9GA 1EJ9A 2EIJH 2TDXA 5M5WJ 4QPOA 3BJAA 2XF5A 3L1PA 1U9OA 2R7SA 4IRHA 2RC4A 3GXOA 1FT9A 3FXUA 5FRNA 3CCSI 1RRJA 4JP0A 3CCVI 4IL6C 4QIWN 1ZG1A 4W97A 3MCZA 2W00A 4OIQF 3BPXA 1AA7A 5EF6A 1CQTA 4XLPF 2Z16A 1JUSA 2XRLA 1IRGA 4BGDA 1HSJA 2V4JC 1DDNA 4S05A 5GTIC 1SD7A 4CZCA 4ON0A 3HKZA 2LBFB 1BI0A 1WJCA 2H09A 2VJ4A 1QHGA 2JA5J 2BY0A 3A01B 1IV8A 3BJ6A 2OJED 2YPRA 2XIGA 4B43A 3A4CA 4ESJA 1IJWC 1S3JA 1K78A 5AIQA 1VQ7I 3HRUA 1VF9A 1BW6A 1OR7C 2KPMA 2VPLA 4MTEA 2HOAA 1YTYA 2XAJA 2BW3A 3BROA 2GIZA 4BNCA 1V55H 4I09A 1IC8A 2DO7A 2EFOA 1YJ9I 2VXZA 1XGSA 2RQQA 1OCPA 3I54A 3TBIA 4EM0B 3OYJA 2RKHA 1OR7A 2XB0X 2CSOA 3OIQA 4KT5C 4N0BA 3T8RA 2EWNA 3G6EI 1UZCA 1W4MA 2LOOA 3ECOA 2HQAA 5FKOA 1K61A 3K2ZA 2R93J 2VUMJ 2OAZA 3SXYA 5ICGA 3C18A 4WCGA 3IRRA 4IHSA 2V1XA 3H3UA 3OR1C 1IDZA 2W84A 1RKWA 1OQYA 3HZJA 1HDPA 3WU0A 3SDBA 2VODA 4DNCA 1A5JA 3E3VA 3BG6A 1VQPI 1FOXA 4QPQA 2DPDA 5F04A 2DQRA 3WE2A 1P7JA 4LLNA 2G7HA 3FF5A 2H1LA 1Y1WJ 2HOTA 2M87A 3HKZN 4ZYHA 3JRBA 2O03A 3KFWX 1YRNB 3CMYA 3I0TA 4AUXA 1ACIA 4UB6C 1OCOH 3KP2A 2H1KA 1A04A 3I4NJ 4X0GA 4WWCA 2O6GE 3EUKL 1GLNA 1X3ZB 3M8JA 3X2QH 2ME6A 4F55A 3E6DA 1QU3A 3Q9VA 1R5GA 1WH7A 3BR6A 3A0BC 1R4NB 2HI3A 3LSKA 2IEKA 1MH3A 1I1GA 3ABLH 5F0FA 4ESBA 3IL2A 2DTRA 2MH9A 1UFMA 4CZZA 3CZ6A 2N8GA 3PIOF 1NK2P 1WJAA 3JW4A 3IHUA 3GTMJ 4CO8A 5HODA 2AXLA 1CF7A 4XKWA 1GUUA 3TEDA 4G6DA 3HOYJ 2DQLA 1FTTA 3WTVC 2LF8A 3QYFA 1NHAA 2JT1A 5IOZA 5K7ZA 2PN6A 5H2FC 1R49A 4L0YB 3A03A 2HQRA 4WX9A 4IHVA 1XDUA 2L02A 3KLOA 4WXDA 4ZDPA 1N78A 2GXGA 2R7VA 4EQQA 2JTVA 3MZHA 2OPTA 5LRSA 3EPZA 4HSTA 2BZTA 1RIOH 3K4CA 5C4XJ 3OS0A 5FO5A 3ASOH 3PUFA 5JVTA 3QOPA 3ONQA 3OYCA 4NQWB 3VB2A 1JKOC 5HVQC 1FP2A 2LVSA 3F6OA 2IS6A 2L9VA 4FE4A 3A2KA 2J5PA 1LFUP 3OOUA 2PJRB 1R36A 2WAFA 4HW0A 4A3DJ 2QUFA 5EYRA 1KYZA 1BJAA 2LBFA 4II2A 1IXSB 5EZHA 3SQNA 3J7AO 4F91B 2H6CA 2X85A 4IOAF 4L5EA 1Y39A 1XS9A 1VQ6I 3TGNA 4JX6A 4EV0A 1WGXA 1PDNC 4HF1A 2ICWG 3DEUA 3I9V2 4WXCA 2QSHX 2HGCA 1SVOA 1ZLJA 5K5QA 3D0SA 4RLQA 4UVCA 5DCMA 2DK5A 2E60A 3R60A 1I39A 2PX9A 4G6QA 5AIPA 5FD5A 2VE8A 1G3WA 4HQEA 3WTXC 2IXSA 2XAQA 4K2EA 1ZGWA 1E2XA 1ULYA 3H5RA 2X6YA 3BCAA 3OYNA 3WU1B 4XOPA 4LLGF 4Y7NJ 3JREA 2QBYB 3ZMSA 4PZJA 1WRJA 5DD4A 1W36D 3ZMUA 2E2IJ 1KU7A 1K4SA 2L9NA 4L5IA 1EH8A 3BTJA 4EJWA 3J7YJ 3ZPLA 1RETA 3BPVA 2RVCA 2E2JJ 2JA8J 1VI0A 3I4PA 1ZHFA 3OYGA 4BDYA 1XSDA 2QYOA 4EATA 1ZGAA 3I64A 1VQOI 2JZYA 2IRFG 4AC0A 4YIRX 3CF5F 4L9NA 1O3SA 1JJ8C 2RGVA 2GA2A 2MABA 2EA4A 4Q48A 2PJPA 1TT0A 2Y0SA 2A5YB 2K9QA 4GDFA 5FKLA 5A2QZ 1YRNA 4RA2A 1O3TA 1TZLA 3GZ5A 1VQ5I 1JE8A 2X6XA 2CG4A 4MQ9F 3KYLA 4ABZA 1S5LC 3TP3A 2QLZA 2ESNA 1MMAA 2YX4A 4PJLA 5E8GA 1X1AA 4Y13A 3RQ4A 2LH9A 3SYTA 3HOXJ 2E19A 2HKOA 3F3XA 2BY2A 2AQEA 3HYIA 2HDWA 3RYRA 2ELJA 4Z2YA 2DOEA 3BOQA 4ASNA 1ENHA 2JK3A 3M8EA 4RM3A 1PYVA 2ZSIB 1TC3C 2O61A 5BNGA 2FD5A 3CCLI 1A36A 4L18B 3SFZA 2VE9A 1GVDA 3HGGA 3S2DJ 2LSOA 4BEHB 2A5WA 3VPRA 1WVRA 3L00A 3V7SA 2Q2EA 4HDUA 4OAYA 1W0UA 2JRMA 1U6GA 3WGGA 5F1RA 1JKQC 5HDGA 4PJNA 2FMYA 5FKKA 2STWA 3TO6A 1M1EB 2C6YA 2X6WA 2D2WA 3CP8A 2YU9J 3KP6A 3GFLA 5F1JA 3CCUI 4MEYF 2EFPA 3H5NA 2KDZA 1R6RA 1MMGA 3JSPA 3RSNA 2Y0SN 1V5GA 3PSFA 1Z77A 4NB5A 5KK1A 2NNNA 2LKPA 3OYKA 4A12A 3KLNA 2L4AA 2O3FA 3I5UA 1BI2A 2VI6A 1MSEC 4Y15A 3K1MA 2IVMA 4G9YA 3GTLJ 2ZO4A 4BQQA 1XMXA 4BQAA 5FKNA 1L0OC 2VONA 3R0AA 1BIBA 3QPSA 5ERIA 1MJAA 3OYDA 2R7TA 3OWTA 2K4BA 4H0EA 4A6DA 2Z1DA 2DAOA 3PFYA 3KCCA 4XRSA 1TW3A 3D1NI 1FEXA 4HDVA 2D1HA 4A3GJ 2KRFA 2HWVA 2DDBA 5JI6A 1VNDA 4ZYEA 3H5AA 4RDUA 3MZ8A 4XBFA 4A0XA 2V9KA 1USTA 2QSFX 3OIOA 2XGXA 1YI2I 4D7NA 3FISA 2DFFA 3V4GA 3I53A 5LFAA 1WH5A 1B6AA 4AVPA 4BXXJ 2A68F 1BL0A 2Z2SB 5L3FA 4HZFA 2K9SA 3PM1A 2FNAA 1TTYA 1DP3A 2QF7A 1FNNA 3WU2C 4M6YA 5K1YA 5LHHA 5CYVA 5M5YJ 1RUNA 1LPQA 4DQ2A 2OZ6A 2QBYA 2JJ7A 2AXTC 2CV1A 1Y0UA 3D5LA 3JRHA 3BZCA 5BPIA 5BOXA 1MBKA 1E3PA 4E6KG 1AU7A 2XC7A 1E0EA 5D8LB 2R0QC 5K7FA 2R3SA 4HV5A 4D7MA 3E7LA 4XIDA 3UNGC 3SZTA 2K7LA 3K4LA 3AKZA 3CD6I 4XORA 1EH7A 3GTPJ 2HPIA 1U5TC 5DUKA 1IRFA 2RQPA 4C3JJ 2YR2A 4O6JA 3FMRA 1N25A 4LG0B 3FDYA 2VT2A 4Q4ZF 3CCYA 1D5YA 1TBXA 2GXAA 1XSVA 1RNLA 3P9CA 1SFEA 3QP6A 4CCKA 1Y1VJ 3KP3A 4FHTA 4IQ4A 3HUGB 2WTEA 3O2PE 1U5TA 3DBRB 2GOXB 1NH3A 3H1CA 1R7JA 3QPTA 5FLXK 4XMYA 3H0GJ 1DU6A 5HLTA 3ESWB 1KQ8A 2F6CA 4KUMA 3G1LA 2YS9A 1LFBA 4BBSJ 3O8GA 2P5LC 3L2WA 3SFIA 4PDKA 1YITI 4IRGA 1XGMA 2PBIA 5E1ZB 3OYMA 1FOYA 2ELHA 1R4MB 1SD5A 4V19K 4XLHA 3GTOJ 5ILUA 3DXJF 3BTCA 3MD2A 1QZYA 4I99C 2CQ7A 4GRIA 4QTRA 2QENA 4EJUA 2YUSA 3EUAA 5EG0B 3TDUC 1IGNA 3O8HA 2M7BA 3D5RC 1P4XA 3CCQI 4BAYA 5DS9A 2PQ8A 3OSFA 5ICEA 3ZQLA 1LKXA 5IP6A 3TW6A 4E7SA 5FD6A 1HSTA 5H6RA 1W5SA 5CVJA 3OYBA 1C0WA 3QPHA 2A05A 2Y48A 1WFXA 2IAIA 1FPQA 2EZHA 2V1NA 4IJAA 1B4AA 1SANA 3IAM2 2EZKA 3WHBA 1W5TA 1R5ID 4M73A 2F4OB 2DCEA 3S14J 3FXLA 2DTZA 3QYEA 4DGWB 3ELKA 4LMYA 5D5VB 1S7EA 2ZB9A 3H3ZA 2NVQJ 4KMFA 3TQNA 1ZREA 4JBAA 2EFQA 2BY3A 3P9KA 4C3IJ 5E20A 4PGHA 3S15J 3F8CA 1FSHA 4FISA 3CO7C 1BOAA 2DJNA 2EZIA 1F43A 4D9JA 2DFEA 1V5FA 4HG2A 3RI4A 3CTAA 2GM4A 3LMMA 2RN7A 2Y31A 5D5XB 2JN6A 4KMUX 3F23A 1T56A 5LHGA 1FIPA 2X9DA 4UV8A 2ZFWA 4RBOA 4O3MA 2AS5F 3DBHB 4A3EJ 4M3GA 1IF1A 3ERMA 2KIMA 3ZMZA 1O4XA 1FZPB 3PO2J 4XL9A 5IYCJ 1K78B 5D6FA 4Y33A 3N05A 4NC8A 4IHXA 3V42A 2V1UA 3BR2A 3E0JB 4C3HJ 1K4TA 4CHUA 3FMQA 2BW3B 3WE3A 4BJTA 3OV8A 2WAQN 5JFRA 2P81A 3F6VA 2GLOA 3CCEI 3CMAI 3RPUD 5E1WA 1FP1D 2OCCH 3HSFA 3C7JA 3VYUB 3L2UA 5M5XJ 5F0HA 4EGYA 4IHYA 2X51A 2XGCA 2R7FA 3S1QJ 2FEZA 4LFUA 4OMZA 1QQIA 2RREA 1N77A 3LFKA 4KN7X 2GXBA 1JTYA 2ZJQF 2XKOA 1TNSA 4LG0A 5HLIA 1MBFA 2K4JA 4P9FA 4OAZA 3CC4I 4IZZA 1OPCA 1J75A 4I76A 1G8XA 2FQ4A 2JMWA 2V79A 3ASNH 3FMSA 2Q8KA 4ESFA 3CCMI 1EF4A 3IWFA 2XSJC 4GFBA 3AL0B 5HLGA 5EEGA 3R4KA 5D5UB 4G7ZF 3S1NJ 3Q0UA 5J6XA 4A5NA 2ETHA 4FQGA 1YS7A 2DODA 2CW8A 1QZEA 1K83J 2LKXA 2CQQA 5LLQA 2EV0A 1WWXA 2R7WA 1G2HA 3PIPF 4IX7A 2CFOA 2KRHA 4BXFA 3NARA 3L2CA 3G71I 3RKXA 2QEXI 2GAUA 3BR0A 2M0CA 2KP6A 2CUJA 1JKRC 5DDGA 1TWHJ 2WC2A 1Z3XA 2FUG2 2R7XA 4WK8F 4MLOA 4AVZA 4NBQA 4ZJZA 1X3UA 2BY1A 2ZJRF 1TW2A 1R58A 4JOMA 2DMUA 3MZYA 3FHZA 2Q1ZB 2YU3A 2CFXA 1IDYA 3DTIA 5BQTA 3GMEA 4CDGA 5D5WB 3TW7A 1ON1A 3PSIA 3ZOBA 3ECHA 2IS4A 1VTNC 2LTPA 2DYRH 4D5FA 1OYIA 1H9TA 3U1DA 2XAHA 4FT8A 2M2EA 4OIRF 4OMYA 3DF8A 3OL3A 5HLHA
chains in the Genus database with same CATH topology
5L3CA 3DKWA 3JSOA 1ODDA 3PFIA 2Z3YA 2FRHA 4HX7A 4R8HA 1O7FA 3LWFA 5LEJA 2A3SA 2MLKA 4U7BA 4HBLA 5DV5A 1K7AA 1I27A 1R23A 2Z99A 2B0LA 2PG4A 3RKYA 3P7NA 1ZRDA 5K5RA 4R1HA 2VOPA 1UHMA 2FSWA 2VBXA 2HKXA 5ICCA 1T38A 5DCMB 1FYMA 3HRTA 1J0RA 3T0YA 5DYMA 4U7DA 1PUEE 2K02A 2FF4A 4AWXB 1SMTA 4GCVA 1FYKA 3QRFF 1G3SA 1W7PD 4G7HF 5CLSA 3TOAA 3ZN1A 4UVAA 2L4MA 5DD8A 3LSTA 3KP5A 4KA4A 3JAMK 5DUIA 1F4KA 4EMSA 2JRTA 4ENMA 2HQNA 3HTUA 2QQBA 1R22A 5TJJA 2LF7A 1L3LA 3FWEA 2L54A 6PAXA 1LNWA 3WTTC 1U2WA 1YYVA 3ZN0A 4A0YA 1TQMA 4RAYA 3KZZA 1OKRA 4NHJA 5AONA 5EEHA 4U88A 3WTUC 2E1CA 1P4AA 1P4WA 3HIFA 1ZARA 4I2OA 3WTWC 4AIHA 4E70A 4HOBA 2KIFA 1V3FA 1SFUA 4ZYGA 4I0BA 1FYLA 4BHCA 1I5ZA 2UWMA 2PEXA 2COMA 3DP7A 1LVAA 2QQ9A 2O0YA 2M30A 1ZG3A 5HS7A 1DP7P 1AWCA 1BIAA 3HTSB 1BM9A 1YS6A 3QAHA 1LJ9A 5CVRA 2OA4A 4KNYA 5DEQA 3GFJA 2F5CA 1GXQA 5ILSA 3CO6C 3T5XA 2G9WA 2LDUA 4I7HA 1ZH5A 4OIOF 1HW2A 4MNUA 3RPUA 2QWWA 2Y75A 4A2UA 4KDPA 3FM3A 5LGTA 2P6SA 3HRSA 2FE3A 4ZYDA 1O7LA 3IC7A 1RUOA 4JQFA 4IHTA 3RPQA 5ICFA 2MA3A 2DU9A 1R1UA 2ISZA 4ZH4F 2DW4A 2W85A 1XB4A 4KIFA 4HX4A 2ISYA 4KIGA 2P6TA 3LA2A 2V1DA 4M74A 4XSZF 4TV7A 1UHWA 3GEZA 1U5TB 1F1ZA 5L3GA 2HTJA 1ZG5A 4GYIA 3GWZA 3GVAA 3KP4A 1D8KA 2IA1A 4BYYA 5ILVA 3PQKA 4AIKA 3RYPA 2Z9OA 3SHFA 4WXHA 2EK5A 2PMUA 5D4SA 1IAWA 4EVIA 3EYYA 2V6CA 5TRDA 1D3YA 2OQRA 2JPCA 3WODF 1DPRA 4I0AA 2JPBA 4P5OA 2XUBA 3R6SA 4ENKA 3KETA 2Q0OA 4RGXA 1K6OA 5LBQA 1B9MA 5BPDA 2DK8A 3F8MA 3W6KB 1QZZA 2HR3A 2P5KA 4LB5A 4IVNA 3E5QA 2CO5A 3EQLF 2D1VA 2F5DA 3EYIA 4F7ZA 4UUVA 4GGGA 4N9HA 5FLXZ 4N9IA 1XGNA 2RV8A 3G73A 2ACJA 1MDMA 5CVUA 3CUQB 4Y17A 2VBZA 1H0MA 1YFHA 1QBJA 4YIFA 2HZTA 3KP7A 2H27A 3I59A 4YFKF 4HLXA 1Z05A 4OU0A 1I6XA 1FOKA 1WSUA 3JTGA 5CVIA 4OIPF 2A6EF 4GO1A 3R0JA 4MGRA 5A2QK 5E17F 2RNJA 1XDSA 1J9IA 3DPTA 5LRRA 2H94A 4KICA 1ON2A 1W7PA 4L5JA 4BXUA 3FX3A 3MEXA 1BI1A 1KQ9A 3LA3A 2HOEA 4ENJA 1DPUA 4BHBA 3S2WA 4FX0A 4YIIA 2NS0A 4ZZLA 1RI7A 1YO5C 2P8TA 1R1TA 4CICA 2F5EA 5L3BA 1BI3A 4CYDA 2DBBA 3E6MA 3U2RA 4XSXF 4GXOA 2HFHA 1Z6RA 3ABTA 4PCQA 4O5VA 2IPQX 3M8FA 1KQ0A 1S29A 2BE5F 5HS9A 3J81K 1AOYA 3F22A 1EH6A 4WF2A 2IW5A 3J80K 4LD5A 2YX7A 3Q9SA 3WG9A 5HDKA 1T39A 2CGPA 5F64A 2FBHA 1R00A 1ZYRF 2NNYA 3IKTA 3K69A 3KE2A 4LK0F 1H9GA 1LEBA 3CUQC 3E5XA 1O3QA 3GFIA 3V7CA 3E6BA 3TDZC 4RAZA 1R5HA 4YG2F 4OINF 4AIJA 1LDKB 2ZCWA 3M9AA 3O6BB 3CUQA 1ZGJA 1YLFA 2V9VA 4EJTA 1J7KA 2W25A 1ZAOA 4UNOA 1S6LA 2FBIA 1OMIA 4P55A 1T2KA 2VBYA 1U8RA 4MQVA 4EM2A 4M71A 1KU3A 2FBKA 2UXXA 3AAFA 4ETSA 4A5MA 1IN8A 1G4DA 4P9UA 4U0VA 5D4RA 4M9ZA 4UHTA 5IT9K 2FQ3A 1MJ9A 3E6CC 1FLIA 2MC3A 5LEKA 2A61A 3LQRA 3CJNA 1Z9CA 3MQ0A 1G6NA 2Z33A 1WI9A 1ONVA 1SD6A 4ENNA 1HW1A 1O57A 1JGSA 2L01A 3HOTA 1REPC 1T98A 3RDIA 4RB2C 1IZ1A 2VN2A 3V7RA 3K1NA 3F8BA 1YQAA 3I58A 4L9VA 2W24A 1FBQA 1P6RA 3FZVA 1B59A 3COAC 2ADUA 1V4RA 2ZMEA 4PGGA 3ZQ7A 2BV6A 2GA1A 1STZA 3EDPA 4M9SA 1YW9A 1Z6TA 4KYWA 5J8CA 1UB9A 4I98B 2MH2A 2PFBA 3TO9A 3LQQA 2Z5UA 5D8KB 3BWGA 2HYGD 3JAMZ 3HOSA 2CQKA 4BH9A 4CXFA 1BC8C 1LEAA 3W6JB 4LK1F 4XLNF 2HS5A 4LLLA 4U0WA 5BS6A 1FWZA 1IUYA 2FA5A 4G94A 3L9FA 1T0FA 1PP8F 2H6BA 3HHGA 4LB6B 2YSRA 1HKQA 1XN7A 3TO7A 4RGSA 4MHGA 4HLYA 1B1BA 3EETA 3K9TA 1ZN2A 1HKTA 2A69F 1USSA 1LDJA 2OD5A 3HSRA 4G7OF 1XD7A 2OU2A 1IN7A 5HS8A 1IXCA 2M1BA 2EV6A 4EM1A 1XSXA 2GZWA 5LGUA 4A6EA 2STTA 2F5FA 2OQGA 1P92A 1IXRC 3DFGA 3IRQA 2PMHA 4GYGA 3N4MA 2DT5A 1MKMA 5FGMA 2M45A 2ZNYA 2XVCA 3ZMTA 4RB1A 2BBYA 4OOIA 4S04A 5LGNA 2EJRA 3MWMA 4D0PA 5KVRA 1FY7A 1JHFA 2X0LA 4IRIA 5HOOA 4RGUA 2XAGA 5E8IA 3MFKA 5K5OA 1KGSA 2P4WA 5FFXA 4MEXF 2VBWA 4KN4X 5CJ9A 5BMZA 4AD9A 3E5UA 4L9JA 5IT3A 1J5YA 2CYYA 5ED4A 1J59A 3KEOA 3REOA 2BEOA 2NYXA 1I1SA 2EFWA 1Z7UA 3WTZA 2OZUA 4IF4A 4HQMA 4UXNA 2Y0MA 3PQJA 1MDMB 1RZ4A 2MLGA 3T1BA 5FB2A 3CDHA 3C3WA 4BHPA 3I59B 3KZYA 1HQCA 3GUDA 3SZPA 1E17A 3OOPA 3CUOA 1YW8A 3BY6A 2F2EA 5FFZA 2P5VA 3GX4X 4RB3C 2E1NA 2IP2A 5F6FA 3GYHX 2E7XA 2JSCA 2MBFA 2BGCA 1YW7A 2QQAA 3BZ6A 3B02A 4IPAA 3L09A 2IA2A 1W7PB 4HA8A 2HTSA 1U3EM 2E7WA 5L3EA 3WGIA 2ESHA 1XMAA 3WTSC 2LNBA 2X4HA 1IN6A 5JR3A 3V8JA 2HEOA 2A6HF 2UXNA 3NRVA 1QNTA 2QZ8A 3ERED 3TKYA 2WWYA 5J8FA 1TNTA 1YIOA 2XASA 2KJBA 1XMKA 2UZKA 2VC0A 2ZJ2A 1F5TA 4P96A 3B73A 3ULQB 2BYVE 4HYEA 3O3KA 3RKWA 2KIUA 3F21A 4HAMA 4LJZF 1UCRA 2NAZA 3GZ6A 3F8NA 1GXPA 2IJLA 3G3ZA 3RJPA 2XV4S 4ZZDA 3GO5A 1S8NA 2MD5A 3F8FA 1S7AA 1SMYF 4HF2A 3E97A 1ZRCA 1O3RA 3V8KA 1YG2A 4I02A 2XAFA 4KFCA 1D8JA 4I01A 2XKPA 4IXAA 4KIBA 4R79A 2FOKA 2G7UA 2D45A 1KU9A 1U78A 5D6EA 3ZMVA 4EGZA 3J81Z 3DPLC 5DCFA 1OYYA 1K79A 3J80Z 1JXSA 4NQWA 3GW2A 1BC7C 5E18F 2EFNA 4HX8A 5LHIA 2O8XA 1XCVA 3ROUA 2VOOA 4M6XA 1MD0A 5E1XA 3M1EA 1KYWA 1OYWA 3FXRA 2ZKZA 2HDCA 1FC3A 4EJOA 3KEQA 3GF2A 5H6QA 4QWQA 4YFNF 4MTDA 2NRAC 2EV5A 1B9NA 3DV8A 1EV7A 3M7GA 3QU3A 3NQOA 3VODA 2IA0A 4RGRA 1KA8A 1LQ1A 1TLHB 5JHUA 2VC1A 3I71A 2GIVA 3LA7A 2FU4A 3P9IA 1SFXA 1XCBA 1HXDA 4UV9A 4HV6A 4FX4A 4EJVA 3K0LA 2FNPA 4XRFA 3NEUA 3WGHA 2R7DA 3V8LA 4G8XA 2ZNZA 2ZBKA 1BN5A 2FXAA 2EA2A 1IW7F 1TQIA 4Q47A 1ZRFA 3VFZA 2IT0A 2QM3A 2A07F 3HHHA 5IT9Z 3FM5A 3MAJA 3QU6A 4JK1X 2P7CB 2ZMEB 3EUHA 3ZMDA 1SD4A 3ABUA 1ZLKA 3FXQA 3WTYC 3VEPA 3ZP5A 1IN5A 4RS8A 2RDPA 2HYFA 3C1DA 1FBUA 1HKSA 3JTHA 4QLCU 5L3DA 3N97A 2CWEA 3DQVC 1GVJA 1KU2A 2XROA 1WQ2A 1LB2A 3H92A 1T6SA 1LDDA 1FSEA 2CW0F 4CGZA 4A0ZA 2M5WA 1FX7A 2WV0A 1SAXA 2XRNA 4B09A 4YFXF 2KJCA 5HDNA 3HRMA 2PLYA 2DI3A 4UVBA 3LAPA 3IKVA 1Z1DA 1QPMA 2ZXJA 2GQQA 1MJBA 3CLOA 3BP8A 1MZBA 1G3TA 1PP7U 1BBYA 3RIRA 1GHCA 4M9XA 3HSEA 1Q1HA 2QVOA 4RB0A 3GFMA 3LAJA 3RTRA 2DFIA 3QP5A 3BDDA 2VT3A 2PI0A 1DUXC 4Q5SF 5CVVA 3BJOA 1WKMA 1MGTA 1HW5A 1TQPA 3TOBA 1HBXG 2DLLA 4HF0A 3Q5FA 5H20A 2EB7A 3L7WA 2DPUA 2KKOA 3K1PA 3HUGA 4U0YA 1D5VA 2K27A 2W57A 1JHHA 1CGPA 2FMLA 2OBPA 1P2FA 2J5OA 3GLXA 1IN4A 2L3DA 4B8XA 1FBSA 4L0ZB 1G3YA 1J2XA 2XHKA 1XGOA 2K86A 1F9NA 1R1VA 3ISPA 3ML6A 3R61A 3VOEA 3F72A 2P7VB 2GWRA 1CF7B 1S7OA 4LGWA 1Z91A 1QO0D 4M72A 3T8TA 3IWZA 4L9TA 2M8EA 1QGPA 3U9GA 2TDXA 3BJAA 4IRHA 2RC4A 3GXOA 1FT9A 3FXUA 1ZG1A 3MCZA 4OIQF 3BPXA 4XLPF 1IRGA 1HSJA 1DDNA 4S05A 1SD7A 4ON0A 1BI0A 2H09A 3BJ6A 2YPRA 2XIGA 4ESJA 1K78A 1S3JA 5AIQA 3HRUA 4MTEA 1YTYA 2XAJA 3BROA 4BNCA 4I09A 2DO7A 2EFOA 2VXZA 1XGSA 3I54A 4EM0B 2RKHA 1OR7A 2CSOA 4KT5C 4N0BA 3T8RA 2EWNA 1W4MA 3ECOA 3K2ZA 2OAZA 3SXYA 5ICGA 3C18A 4WCGA 3IRRA 4IHSA 2V1XA 3H3UA 2W84A 3WU0A 2VODA 4DNCA 3E3VA 2DPDA 2DQRA 3WE2A 4LLNA 2G7HA 3FF5A 2M87A 4ZYHA 2O03A 3KFWX 3I0TA 3KP2A 1A04A 4WWCA 2O6GE 3E6DA 3Q9VA 1R5GA 1I1GA 3IL2A 4ESBA 2DTRA 2MH9A 1UFMA 4CZZA 3JW4A 3IHUA 4CO8A 2AXLA 1CF7A 4G6DA 2DQLA 3WTVC 2LF8A 1NHAA 2JT1A 2PN6A 4L0YB 2HQRA 4WX9A 1XDUA 2L02A 3KLOA 4WXDA 2GXGA 4EQQA 2JTVA 3MZHA 5LRSA 1RIOH 5FO5A 5JVTA 3QOPA 3VB2A 5HVQC 1FP2A 3F6OA 2J5PA 1R36A 4HW0A 2QUFA 1KYZA 1BJAA 3SQNA 1IXSB 3J7AO 2H6CA 3TGNA 4EV0A 1PDNC 4HF1A 3DEUA 4WXCA 2HGCA 1ZLJA 5K5QA 3D0SA 4UVCA 5DCMA 2DK5A 3R60A 5AIPA 4G6QA 5FD5A 2VE8A 1G3WA 4HQEA 3WTXC 2XAQA 4K2EA 1E2XA 1ULYA 3WU1B 4LLGF 2QBYB 3ZMSA 4PZJA 1WRJA 5DD4A 3ZMUA 1KU7A 4L5IA 1EH8A 4EJWA 3ZPLA 3BPVA 2RVCA 3I4PA 1ZHFA 1XSDA 2QYOA 1ZGAA 3I64A 2JZYA 2IRFG 4L9NA 1O3SA 2RGVA 2GA2A 2EA4A 4Q48A 2PJPA 2A5YB 5A2QZ 1O3TA 3GZ5A 1JE8A 2CG4A 4MQ9F 2QLZA 2ESNA 2YX4A 4Y13A 5E8GA 2HKOA 3F3XA 3HYIA 3RYRA 4Z2YA 3BOQA 4ASNA 3M8EA 2O61A 4L18B 3SFZA 2VE9A 2LSOA 3L00A 3V7SA 2Q2EA 4HDUA 1U6GA 3WGGA 5F1RA 5HDGA 2FMYA 2STWA 3TO6A 2C6YA 2D2WA 3KP6A 3GFLA 4MEYF 2EFPA 3JSPA 4NB5A 5KK1A 2NNNA 2LKPA 4A12A 3KLNA 2L4AA 2O3FA 3I5UA 1BI2A 4Y15A 3K1MA 2IVMA 4G9YA 2ZO4A 4BQAA 1L0OC 2VONA 3R0AA 1BIBA 5ERIA 1MJAA 2K4BA 4H0EA 4A6DA 2DAOA 3KCCA 1TW3A 4HDVA 2D1HA 2KRFA 2HWVA 5JI6A 4ZYEA 4XBFA 4A0XA 1USTA 2XGXA 3V4GA 3I53A 1B6AA 4AVPA 2A68F 5L3FA 4HZFA 2FNAA 1TTYA 1FNNA 4M6YA 5K1YA 5LHHA 5CYVA 1RUNA 4DQ2A 2OZ6A 2QBYA 1Y0UA 3D5LA 5BPIA 5BOXA 5D8LB 2R3SA 4HV5A 3SZTA 2K7LA 1EH7A 5DUKA 1U5TC 1IRFA 2RQPA 2YR2A 4O6JA 3FMRA 4LG0B 2VT2A 4Q4ZF 1TBXA 1XSVA 1RNLA 3P9CA 1SFEA 3QP6A 3KP3A 4FHTA 3O2PE 2WTEA 1U5TA 1R7JA 3QPTA 5FLXK 1KQ8A 4KUMA 2P5LC 4PDKA 4IRGA 1XGMA 2PBIA 5E1ZB 2ELHA 1SD5A 5ILUA 3DXJF 1QZYA 2QENA 4EJUA 3TDUC 1P4XA 4BAYA 2PQ8A 5ICEA 5FD6A 1HSTA 5H6RA 1W5SA 5CVJA 1C0WA 3QPHA 2Y48A 1FPQA 4IJAA 1B4AA 1W5TA 4M73A 3ELKA 4LMYA 5D5VB 3H3ZA 4KMFA 3TQNA 1ZREA 4JBAA 2EFQA 3P9KA 5E20A 4PGHA 3F8CA 1FSHA 3CO7C 1BOAA 3RI4A 3CTAA 2RN7A 5D5XB 4KMUX 3F23A 5LHGA 4UV8A 2ZFWA 4O3MA 2AS5F 1IF1A 2KIMA 3ZMZA 1FZPB 1K78B 5D6FA 2V1UA 4CHUA 3FMQA 3WE3A 3OV8A 5JFRA 3F6VA 5E1WA 1FP1D 3HSFA 3C7JA 4EGYA 2R7FA 2FEZA 4LFUA 4OMZA 1QQIA 3LFKA 4KN7X 2GXBA 1TNSA 2XKOA 4LG0A 5HLIA 2K4JA 4P9FA 1OPCA 1J75A 3FMSA 2V79A 2Q8KA 4ESFA 3IWFA 5HLGA 5EEGA 3R4KA 5D5UB 4G7ZF 5J6XA 4A5NA 2ETHA 1YS7A 5LLQA 2EV0A 1WWXA 3L2CA 3RKXA 2GAUA 5DDGA 2WC2A 4WK8F 1X3UA 1TW2A 1R58A 3MZYA 3FHZA 2YU3A 2CFXA 5BQTA 5D5WB 4CDGA 1ON1A 3ECHA 1VTNC 1OYIA 1H9TA 3U1DA 2XAHA 4FT8A 4OIRF 4OMYA 3DF8A 5HLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L3C A;  3DKW A;  3JSO A;  1ODD A;  3PFI A;  2Z3Y A;  2FRH A;  4HX7 A;  4R8H A;  1O7F A;  3LWF A;  5LEJ A;  2A3S A;  2MLK A;  4U7B A;  4HBL A;  5DV5 A;  1K7A A;  1I27 A;  1R23 A;  2Z99 A;  2B0L A;  2PG4 A;  3RKY A;  3P7N A;  1ZRD A;  5K5R A;  4R1H A;  2VOP A;  1UHM A;  2FSW A;  2VBX A;  2HKX A;  5ICC A;  1T38 A;  5DCM B;  1FYM A;  3HRT A;  1J0R A;  3T0Y A;  5DYM A;  4U7D A;  1PUE E;  2K02 A;  2FF4 A;  4AWX B;  1SMT A;  4GCV A;  1FYK A;  3QRF F;  1G3S A;  1W7P D;  4G7H F;  5CLS A;  3TOA A;  3ZN1 A;  4UVA A;  2L4M A;  5DD8 A;  3LST A;  3KP5 A;  4KA4 A;  3JAM K;  5DUI A;  1F4K A;  4EMS A;  2JRT A;  4ENM A;  2HQN A;  3HTU A;  2QQB A;  1R22 A;  5TJJ A;  2LF7 A;  1L3L A;  3FWE A;  2L54 A;  6PAX A;  1LNW A;  3WTT C;  1U2W A;  1YYV A;  3ZN0 A;  4A0Y A;  1TQM A;  4RAY A;  3KZZ A;  1OKR A;  4NHJ A;  5AON A;  5EEH A;  4U88 A;  3WTU C;  2E1C A;  1P4A A;  1P4W A;  3HIF A;  1ZAR A;  4I2O A;  3WTW C;  4AIH A;  4E70 A;  4HOB A;  2KIF A;  1V3F A;  1SFU A;  4ZYG A;  4I0B A;  1FYL A;  4BHC A;  1I5Z A;  2UWM A;  2PEX A;  2COM A;  3DP7 A;  1LVA A;  2QQ9 A;  2O0Y A;  2M30 A;  1ZG3 A;  5HS7 A;  1DP7 P;  1AWC A;  1BIA A;  3HTS B;  1BM9 A;  1YS6 A;  3QAH A;  1LJ9 A;  5CVR A;  2OA4 A;  4KNY A;  5DEQ A;  3GFJ A;  2F5C A;  1GXQ A;  5ILS A;  3CO6 C;  3T5X A;  2G9W A;  2LDU A;  4I7H A;  1ZH5 A;  4OIO F;  1HW2 A;  4MNU A;  3RPU A;  2QWW A;  2Y75 A;  4A2U A;  4KDP A;  3FM3 A;  5LGT A;  2P6S A;  3HRS A;  2FE3 A;  4ZYD A;  1O7L A;  3IC7 A;  1RUO A;  4JQF A;  4IHT A;  3RPQ A;  5ICF A;  2MA3 A;  2DU9 A;  1R1U A;  2ISZ A;  4ZH4 F;  2DW4 A;  2W85 A;  1XB4 A;  4KIF A;  4HX4 A;  2ISY A;  4KIG A;  2P6T A;  3LA2 A;  2V1D A;  4M74 A;  4XSZ F;  4TV7 A;  1UHW A;  3GEZ A;  1U5T B;  1F1Z A;  5L3G A;  2HTJ A;  1ZG5 A;  4GYI A;  3GWZ A;  3GVA A;  3KP4 A;  1D8K A;  2IA1 A;  4BYY A;  5ILV A;  3PQK A;  4AIK A;  3RYP A;  2Z9O A;  3SHF A;  4WXH A;  2EK5 A;  2PMU A;  5D4S A;  1IAW A;  4EVI A;  3EYY A;  2V6C A;  5TRD A;  1D3Y A;  2OQR A;  2JPC A;  3WOD F;  1DPR A;  4I0A A;  2JPB A;  4P5O A;  2XUB A;  3R6S A;  4ENK A;  3KET A;  2Q0O A;  4RGX A;  1K6O A;  5LBQ A;  1B9M A;  5BPD A;  2DK8 A;  3F8M A;  3W6K B;  1QZZ A;  2HR3 A;  2P5K A;  4LB5 A;  4IVN A;  3E5Q A;  2CO5 A;  3EQL F;  2D1V A;  2F5D A;  3EYI A;  4F7Z A;  4UUV A;  4GGG A;  4N9H A;  5FLX Z;  4N9I A;  1XGN A;  2RV8 A;  3G73 A;  2ACJ A;  1MDM A;  5CVU A;  3CUQ B;  4Y17 A;  2VBZ A;  1H0M A;  1YFH A;  1QBJ A;  4YIF A;  2HZT A;  3KP7 A;  2H27 A;  3I59 A;  4YFK F;  4HLX A;  1Z05 A;  4OU0 A;  1I6X A;  1FOK A;  1WSU A;  3JTG A;  5CVI A;  4OIP F;  2A6E F;  4GO1 A;  3R0J A;  4MGR A;  5A2Q K;  5E17 F;  2RNJ A;  1XDS A;  1J9I A;  3DPT A;  5LRR A;  2H94 A;  4KIC A;  1ON2 A;  1W7P A;  4L5J A;  4BXU A;  3FX3 A;  3MEX A;  1BI1 A;  1KQ9 A;  3LA3 A;  2HOE A;  4ENJ A;  1DPU A;  4BHB A;  3S2W A;  4FX0 A;  4YII A;  2NS0 A;  4ZZL A;  1RI7 A;  1YO5 C;  2P8T A;  1R1T A;  4CIC A;  2F5E A;  5L3B A;  1BI3 A;  4CYD A;  2DBB A;  3E6M A;  3U2R A;  4XSX F;  4GXO A;  2HFH A;  1Z6R A;  3ABT A;  4PCQ A;  4O5V A;  2IPQ X;  3M8F A;  1KQ0 A;  1S29 A;  2BE5 F;  5HS9 A;  3J81 K;  1AOY A;  3F22 A;  1EH6 A;  4WF2 A;  2IW5 A;  3J80 K;  4LD5 A;  2YX7 A;  3Q9S A;  3WG9 A;  5HDK A;  1T39 A;  2CGP A;  5F64 A;  2FBH A;  1R00 A;  1ZYR F;  2NNY A;  3IKT A;  3K69 A;  3KE2 A;  4LK0 F;  1H9G A;  1LEB A;  3CUQ C;  3E5X A;  1O3Q A;  3GFI A;  3V7C A;  3E6B A;  3TDZ C;  4RAZ A;  1R5H A;  4YG2 F;  4OIN F;  4AIJ A;  1LDK B;  2ZCW A;  3M9A A;  3O6B B;  3CUQ A;  1ZGJ A;  1YLF A;  2V9V A;  4EJT A;  1J7K A;  2W25 A;  1ZAO A;  4UNO A;  1S6L A;  2FBI A;  1OMI A;  4P55 A;  1T2K A;  2VBY A;  1U8R A;  4MQV A;  4EM2 A;  4M71 A;  1KU3 A;  2FBK A;  2UXX A;  3AAF A;  4ETS A;  4A5M A;  1IN8 A;  1G4D A;  4P9U A;  4U0V A;  5D4R A;  4M9Z A;  4UHT A;  5IT9 K;  2FQ3 A;  1MJ9 A;  3E6C C;  1FLI A;  2MC3 A;  5LEK A;  2A61 A;  3LQR A;  3CJN A;  1Z9C A;  3MQ0 A;  1G6N A;  2Z33 A;  1WI9 A;  1ONV A;  1SD6 A;  4ENN A;  1HW1 A;  1O57 A;  1JGS A;  2L01 A;  3HOT A;  1REP C;  1T98 A;  3RDI A;  4RB2 C;  1IZ1 A;  2VN2 A;  3V7R A;  3K1N A;  3F8B A;  1YQA A;  3I58 A;  4L9V A;  2W24 A;  1FBQ A;  1P6R A;  3FZV A;  1B59 A;  3COA C;  2ADU A;  1V4R A;  2ZME A;  4PGG A;  3ZQ7 A;  2BV6 A;  2GA1 A;  1STZ A;  3EDP A;  4M9S A;  1YW9 A;  1Z6T A;  4KYW A;  5J8C A;  1UB9 A;  4I98 B;  2MH2 A;  2PFB A;  3TO9 A;  3LQQ A;  2Z5U A;  5D8K B;  3BWG A;  2HYG D;  3JAM Z;  3HOS A;  2CQK A;  4BH9 A;  4CXF A;  1BC8 C;  1LEA A;  3W6J B;  4LK1 F;  4XLN F;  2HS5 A;  4LLL A;  4U0W A;  5BS6 A;  1FWZ A;  1IUY A;  2FA5 A;  4G94 A;  3L9F A;  1T0F A;  1PP8 F;  2H6B A;  3HHG A;  4LB6 B;  2YSR A;  1HKQ A;  1XN7 A;  3TO7 A;  4RGS A;  4MHG A;  4HLY A;  1B1B A;  3EET A;  3K9T A;  1ZN2 A;  1HKT A;  2A69 F;  1USS A;  1LDJ A;  2OD5 A;  3HSR A;  4G7O F;  1XD7 A;  2OU2 A;  1IN7 A;  5HS8 A;  1IXC A;  2M1B A;  2EV6 A;  4EM1 A;  1XSX A;  2GZW A;  5LGU A;  4A6E A;  2STT A;  2F5F A;  2OQG A;  1P92 A;  1IXR C;  3DFG A;  3IRQ A;  2PMH A;  4GYG A;  3N4M A;  2DT5 A;  1MKM A;  5FGM A;  2M45 A;  2ZNY A;  2XVC A;  3ZMT A;  4RB1 A;  2BBY A;  4OOI A;  4S04 A;  5LGN A;  2EJR A;  3MWM A;  4D0P A;  5KVR A;  1FY7 A;  1JHF A;  2X0L A;  4IRI A;  5HOO A;  4RGU A;  2XAG A;  5E8I A;  3MFK A;  5K5O A;  1KGS A;  2P4W A;  5FFX A;  4MEX F;  2VBW A;  4KN4 X;  5CJ9 A;  5BMZ A;  4AD9 A;  3E5U A;  4L9J A;  5IT3 A;  1J5Y A;  2CYY A;  5ED4 A;  1J59 A;  3KEO A;  3REO A;  2BEO A;  2NYX A;  1I1S A;  2EFW A;  1Z7U A;  3WTZ A;  2OZU A;  4IF4 A;  4HQM A;  4UXN A;  2Y0M A;  3PQJ A;  1MDM B;  1RZ4 A;  2MLG A;  3T1B A;  5FB2 A;  3CDH A;  3C3W A;  4BHP A;  3I59 B;  3KZY A;  1HQC A;  3GUD A;  3SZP A;  1E17 A;  3OOP A;  3CUO A;  1YW8 A;  3BY6 A;  2F2E A;  5FFZ A;  2P5V A;  3GX4 X;  4RB3 C;  2E1N A;  2IP2 A;  5F6F A;  3GYH X;  2E7X A;  2JSC A;  2MBF A;  2BGC A;  1YW7 A;  2QQA A;  3BZ6 A;  3B02 A;  4IPA A;  3L09 A;  2IA2 A;  1W7P B;  4HA8 A;  2HTS A;  1U3E M;  2E7W A;  5L3E A;  3WGI A;  2ESH A;  1XMA A;  3WTS C;  2LNB A;  2X4H A;  1IN6 A;  5JR3 A;  3V8J A;  2HEO A;  2A6H F;  2UXN A;  3NRV A;  1QNT A;  2QZ8 A;  3ERE D;  3TKY A;  2WWY A;  5J8F A;  1TNT A;  1YIO A;  2XAS A;  2KJB A;  1XMK A;  2UZK A;  2VC0 A;  2ZJ2 A;  1F5T A;  4P96 A;  3B73 A;  3ULQ B;  2BYV E;  4HYE A;  3O3K A;  3RKW A;  2KIU A;  3F21 A;  4HAM A;  4LJZ F;  1UCR A;  2NAZ A;  3GZ6 A;  3F8N A;  1GXP A;  2IJL A;  3G3Z A;  3RJP A;  2XV4 S;  4ZZD A;  3GO5 A;  1S8N A;  2MD5 A;  3F8F A;  1S7A A;  1SMY F;  4HF2 A;  3E97 A;  1ZRC A;  1O3R A;  3V8K A;  1YG2 A;  4I02 A;  2XAF A;  4KFC A;  1D8J A;  4I01 A;  2XKP A;  4IXA A;  4KIB A;  4R79 A;  2FOK A;  2G7U A;  2D45 A;  1KU9 A;  1U78 A;  5D6E A;  3ZMV A;  4EGZ A;  3J81 Z;  3DPL C;  5DCF A;  1OYY A;  1K79 A;  3J80 Z;  1JXS A;  4NQW A;  3GW2 A;  1BC7 C;  5E18 F;  2EFN A;  4HX8 A;  5LHI A;  2O8X A;  1XCV A;  3ROU A;  2VOO A;  4M6X A;  1MD0 A;  5E1X A;  3M1E A;  1KYW A;  1OYW A;  3FXR A;  2ZKZ A;  2HDC A;  1FC3 A;  4EJO A;  3KEQ A;  3GF2 A;  5H6Q A;  4QWQ A;  4YFN F;  4MTD A;  2NRA C;  2EV5 A;  1B9N A;  3DV8 A;  1EV7 A;  3M7G A;  3QU3 A;  3NQO A;  3VOD A;  2IA0 A;  4RGR A;  1KA8 A;  1LQ1 A;  1TLH B;  5JHU A;  2VC1 A;  3I71 A;  2GIV A;  3LA7 A;  2FU4 A;  3P9I A;  1SFX A;  1XCB A;  1HXD A;  4UV9 A;  4HV6 A;  4FX4 A;  4EJV A;  3K0L A;  2FNP A;  4XRF A;  3NEU A;  3WGH A;  2R7D A;  3V8L A;  4G8X A;  2ZNZ A;  2ZBK A;  1BN5 A;  2FXA A;  2EA2 A;  1IW7 F;  1TQI A;  4Q47 A;  1ZRF A;  3VFZ A;  2IT0 A;  2QM3 A;  2A07 F;  3HHH A;  5IT9 Z;  3FM5 A;  3MAJ A;  3QU6 A;  4JK1 X;  2P7C B;  2ZME B;  3EUH A;  3ZMD A;  1SD4 A;  3ABU A;  1ZLK A;  3FXQ A;  3WTY C;  3VEP A;  3ZP5 A;  1IN5 A;  4RS8 A;  2RDP A;  2HYF A;  3C1D A;  1FBU A;  1HKS A;  3JTH A;  4QLC U;  5L3D A;  3N97 A;  2CWE A;  3DQV C;  1GVJ A;  1KU2 A;  2XRO A;  1WQ2 A;  1LB2 A;  3H92 A;  1T6S A;  1LDD A;  1FSE A;  2CW0 F;  4CGZ A;  4A0Z A;  2M5W A;  1FX7 A;  2WV0 A;  1SAX A;  2XRN A;  4B09 A;  4YFX F;  2KJC A;  5HDN A;  3HRM A;  2PLY A;  2DI3 A;  4UVB A;  3LAP A;  3IKV A;  1Z1D A;  1QPM A;  2ZXJ A;  2GQQ A;  1MJB A;  3CLO A;  3BP8 A;  1MZB A;  1G3T A;  1PP7 U;  1BBY A;  3RIR A;  1GHC A;  4M9X A;  3HSE A;  1Q1H A;  2QVO A;  4RB0 A;  3GFM A;  3LAJ A;  3RTR A;  2DFI A;  3QP5 A;  3BDD A;  2VT3 A;  2PI0 A;  1DUX C;  4Q5S F;  5CVV A;  3BJO A;  1WKM A;  1MGT A;  1HW5 A;  1TQP A;  3TOB A;  1HBX G;  2DLL A;  4HF0 A;  3Q5F A;  5H20 A;  2EB7 A;  3L7W A;  2DPU A;  2KKO A;  3K1P A;  3HUG A;  4U0Y A;  1D5V A;  2K27 A;  2W57 A;  1JHH A;  1CGP A;  2FML A;  2OBP A;  1P2F A;  2J5O A;  3GLX A;  1IN4 A;  2L3D A;  4B8X A;  1FBS A;  4L0Z B;  1G3Y A;  1J2X A;  2XHK A;  1XGO A;  2K86 A;  1F9N A;  1R1V A;  3ISP A;  3ML6 A;  3R61 A;  3VOE A;  3F72 A;  2P7V B;  2GWR A;  1CF7 B;  1S7O A;  4LGW A;  1Z91 A;  1QO0 D;  4M72 A;  3T8T A;  3IWZ A;  4L9T A;  2M8E A;  1QGP A;  3U9G A;  2TDX A;  3BJA A;  4IRH A;  2RC4 A;  3GXO A;  1FT9 A;  3FXU A;  1ZG1 A;  3MCZ A;  4OIQ F;  3BPX A;  4XLP F;  1IRG A;  1HSJ A;  1DDN A;  4S05 A;  1SD7 A;  4ON0 A;  1BI0 A;  2H09 A;  3BJ6 A;  2YPR A;  2XIG A;  4ESJ A;  1K78 A;  1S3J A;  5AIQ A;  3HRU A;  4MTE A;  1YTY A;  2XAJ A;  3BRO A;  4BNC A;  4I09 A;  2DO7 A;  2EFO A;  2VXZ A;  1XGS A;  3I54 A;  4EM0 B;  2RKH A;  1OR7 A;  2CSO A;  4KT5 C;  4N0B A;  3T8R A;  2EWN A;  1W4M A;  3ECO A;  3K2Z A;  2OAZ A;  3SXY A;  5ICG A;  3C18 A;  4WCG A;  3IRR A;  4IHS A;  2V1X A;  3H3U A;  2W84 A;  3WU0 A;  2VOD A;  4DNC A;  3E3V A;  2DPD A;  2DQR A;  3WE2 A;  4LLN A;  2G7H A;  3FF5 A;  2M87 A;  4ZYH A;  2O03 A;  3KFW X;  3I0T A;  3KP2 A;  1A04 A;  4WWC A;  2O6G E;  3E6D A;  3Q9V A;  1R5G A;  1I1G A;  3IL2 A;  4ESB A;  2DTR A;  2MH9 A;  1UFM A;  4CZZ A;  3JW4 A;  3IHU A;  4CO8 A;  2AXL A;  1CF7 A;  4G6D A;  2DQL A;  3WTV C;  2LF8 A;  1NHA A;  2JT1 A;  2PN6 A;  4L0Y B;  2HQR A;  4WX9 A;  1XDU A;  2L02 A;  3KLO A;  4WXD A;  2GXG A;  4EQQ A;  2JTV A;  3MZH A;  5LRS A;  1RIO H;  5FO5 A;  5JVT A;  3QOP A;  3VB2 A;  5HVQ C;  1FP2 A;  3F6O A;  2J5P A;  1R36 A;  4HW0 A;  2QUF A;  1KYZ A;  1BJA A;  3SQN A;  1IXS B;  3J7A O;  2H6C A;  3TGN A;  4EV0 A;  1PDN C;  4HF1 A;  3DEU A;  4WXC A;  2HGC A;  1ZLJ A;  5K5Q A;  3D0S A;  4UVC A;  5DCM A;  2DK5 A;  3R60 A;  5AIP A;  4G6Q A;  5FD5 A;  2VE8 A;  1G3W A;  4HQE A;  3WTX C;  2XAQ A;  4K2E A;  1E2X A;  1ULY A;  3WU1 B;  4LLG F;  2QBY B;  3ZMS A;  4PZJ A;  1WRJ A;  5DD4 A;  3ZMU A;  1KU7 A;  4L5I A;  1EH8 A;  4EJW A;  3ZPL A;  3BPV A;  2RVC A;  3I4P A;  1ZHF A;  1XSD A;  2QYO A;  1ZGA A;  3I64 A;  2JZY A;  2IRF G;  4L9N A;  1O3S A;  2RGV A;  2GA2 A;  2EA4 A;  4Q48 A;  2PJP A;  2A5Y B;  5A2Q Z;  1O3T A;  3GZ5 A;  1JE8 A;  2CG4 A;  4MQ9 F;  2QLZ A;  2ESN A;  2YX4 A;  4Y13 A;  5E8G A;  2HKO A;  3F3X A;  3HYI A;  3RYR A;  4Z2Y A;  3BOQ A;  4ASN A;  3M8E A;  2O61 A;  4L18 B;  3SFZ A;  2VE9 A;  2LSO A;  3L00 A;  3V7S A;  2Q2E A;  4HDU A;  1U6G A;  3WGG A;  5F1R A;  5HDG A;  2FMY A;  2STW A;  3TO6 A;  2C6Y A;  2D2W A;  3KP6 A;  3GFL A;  4MEY F;  2EFP A;  3JSP A;  4NB5 A;  5KK1 A;  2NNN A;  2LKP A;  4A12 A;  3KLN A;  2L4A A;  2O3F A;  3I5U A;  1BI2 A;  4Y15 A;  3K1M A;  2IVM A;  4G9Y A;  2ZO4 A;  4BQA A;  1L0O C;  2VON A;  3R0A A;  1BIB A;  5ERI A;  1MJA A;  2K4B A;  4H0E A;  4A6D A;  2DAO A;  3KCC A;  1TW3 A;  4HDV A;  2D1H A;  2KRF A;  2HWV A;  5JI6 A;  4ZYE A;  4XBF A;  4A0X A;  1UST A;  2XGX A;  3V4G A;  3I53 A;  1B6A A;  4AVP A;  2A68 F;  5L3F A;  4HZF A;  2FNA A;  1TTY A;  1FNN A;  4M6Y A;  5K1Y A;  5LHH A;  5CYV A;  1RUN A;  4DQ2 A;  2OZ6 A;  2QBY A;  1Y0U A;  3D5L A;  5BPI A;  5BOX A;  5D8L B;  2R3S A;  4HV5 A;  3SZT A;  2K7L A;  1EH7 A;  5DUK A;  1U5T C;  1IRF A;  2RQP A;  2YR2 A;  4O6J A;  3FMR A;  4LG0 B;  2VT2 A;  4Q4Z F;  1TBX A;  1XSV A;  1RNL A;  3P9C A;  1SFE A;  3QP6 A;  3KP3 A;  4FHT A;  3O2P E;  2WTE A;  1U5T A;  1R7J A;  3QPT A;  5FLX K;  1KQ8 A;  4KUM A;  2P5L C;  4PDK A;  4IRG A;  1XGM A;  2PBI A;  5E1Z B;  2ELH A;  1SD5 A;  5ILU A;  3DXJ F;  1QZY A;  2QEN A;  4EJU A;  3TDU C;  1P4X A;  4BAY A;  2PQ8 A;  5ICE A;  5FD6 A;  1HST A;  5H6R A;  1W5S A;  5CVJ A;  1C0W A;  3QPH A;  2Y48 A;  1FPQ A;  4IJA A;  1B4A A;  1W5T A;  4M73 A;  3ELK A;  4LMY A;  5D5V B;  3H3Z A;  4KMF A;  3TQN A;  1ZRE A;  4JBA A;  2EFQ A;  3P9K A;  5E20 A;  4PGH A;  3F8C A;  1FSH A;  3CO7 C;  1BOA A;  3RI4 A;  3CTA A;  2RN7 A;  5D5X B;  4KMU X;  3F23 A;  5LHG A;  4UV8 A;  2ZFW A;  4O3M A;  2AS5 F;  1IF1 A;  2KIM A;  3ZMZ A;  1FZP B;  1K78 B;  5D6F A;  2V1U A;  4CHU A;  3FMQ A;  3WE3 A;  3OV8 A;  5JFR A;  3F6V A;  5E1W A;  1FP1 D;  3HSF A;  3C7J A;  4EGY A;  2R7F A;  2FEZ A;  4LFU A;  4OMZ A;  1QQI A;  3LFK A;  4KN7 X;  2GXB A;  1TNS A;  2XKO A;  4LG0 A;  5HLI A;  2K4J A;  4P9F A;  1OPC A;  1J75 A;  3FMS A;  2V79 A;  2Q8K A;  4ESF A;  3IWF A;  5HLG A;  5EEG A;  3R4K A;  5D5U B;  4G7Z F;  5J6X A;  4A5N A;  2ETH A;  1YS7 A;  5LLQ A;  2EV0 A;  1WWX A;  3L2C A;  3RKX A;  2GAU A;  5DDG A;  2WC2 A;  4WK8 F;  1X3U A;  1TW2 A;  1R58 A;  3MZY A;  3FHZ A;  2YU3 A;  2CFX A;  5BQT A;  5D5W B;  4CDG A;  1ON1 A;  3ECH A;  1VTN C;  1OYI A;  1H9T A;  3U1D A;  2XAH A;  4FT8 A;  4OIR F;  4OMY A;  3DF8 A;  5HLH A; 
#chains in the Genus database with same CATH topology
 4XK4 A;  5L3C A;  3DKW A;  3JSO A;  1ODD A;  3PFI A;  2Z3Y A;  2FRH A;  1AHD P;  1RR7 A;  4HX7 A;  4R8H A;  1O7F A;  2KFD A;  3LWF A;  2NOJ B;  3HC7 A;  5LEJ A;  2A3S A;  2MLK A;  4U7B A;  4HBL A;  5DV5 A;  1K7A A;  1I27 A;  1R23 A;  2WY8 Q;  2Z99 A;  4X1E A;  1NG6 A;  2B0L A;  2PG4 A;  3CDL A;  4A3C J;  3RKY A;  1TT5 B;  4FAS D;  1OCR H;  3P7N A;  1ZRD A;  5K5R A;  4R1H A;  2VOP A;  3MVP A;  4AM3 A;  3I4M J;  1UAA A;  1MW7 A;  2WV1 A;  2ZXI A;  2VQC A;  3AG3 H;  1UHM A;  2FSW A;  2VBX A;  3W2W A;  2HKX A;  5ICC A;  3FKI J;  1E3O C;  1MBG A;  4Y4R A;  1D1C A;  4ZC3 A;  1T38 A;  3OYH A;  5K7H A;  5DCM B;  3I55 I;  1FYM A;  4CYC A;  3B6C A;  3HRT A;  2M9H A;  3DCF A;  1J0R A;  3T0Y A;  1Y6I A;  3CP2 A;  1VQ9 I;  5DYM A;  2VJI A;  4U7D A;  1WCM J;  4CUG A;  1PUE E;  2K02 A;  2FF4 A;  4AWX B;  4XLE A;  3S1R J;  1RR8 C;  1X1C A;  2KT0 A;  3BR3 A;  3JRD A;  1QA6 A;  4YRV A;  1SMT A;  2K40 A;  4GCV A;  4BAC A;  1FYK A;  4HPQ A;  4M3D A;  1ZKG A;  1POG A;  3QRF F;  3K6G A;  4BKX A;  1G3S A;  1W7P D;  3AL0 C;  4G7H F;  1D1A A;  1D0X A;  2OCE A;  3ZR8 X;  5CLS A;  4PJM A;  5EGO A;  3HBL A;  3JRF A;  3TOA A;  3ZN1 A;  2CUZ A;  5DM6 F;  4UVA A;  2L4M A;  5DD8 A;  3K2A A;  3LST A;  2V6E A;  3KP5 A;  1ETW A;  4DIQ A;  4KA4 A;  3L2Q A;  3JAM K;  5DUI A;  1F4K A;  3BCB A;  1S9H A;  2JRT A;  3K4N A;  4EMS A;  4ENM A;  2HQN A;  1FJL A;  3HTU A;  2QQB A;  2R7U A;  1R22 A;  5TJJ A;  3MN2 A;  2FJ1 A;  2LF7 A;  2ZXH A;  4XM3 A;  1L3L A;  5JLW A;  3FWE A;  2L54 A;  6PAX A;  3CQZ J;  3L2R A;  2DYS H;  3C2H A;  1LNW A;  3BT9 A;  3WTT C;  4A3I J;  2MW8 A;  3PNV A;  1IRX A;  1U2W A;  1YYV A;  2DA1 A;  3ZN0 A;  4A0Y A;  1TQM A;  2RAE A;  4RAY A;  3KZZ A;  2XDV A;  4BQO A;  2R92 J;  3QOE A;  1OKR A;  4NDL A;  4NHJ A;  5TIS C;  5AON A;  5EEH A;  4U88 A;  3WTU C;  2E1C A;  1P4A A;  1P4W A;  4B44 A;  1MND A;  3HIF A;  1ZAR A;  2Q2E B;  4I2O A;  3WTW C;  4AIH A;  2QA4 I;  4E70 A;  3BG3 A;  4HOB A;  4FE7 A;  4ZTF A;  4OWR B;  2KIF A;  1V3F A;  1SFU A;  2F5V A;  4ZYG A;  4I0B A;  3IP4 B;  1APL C;  3KZI C;  1FYL A;  4BHC A;  1I5Z A;  3CJQ B;  1ORK A;  2PEX A;  2UWM A;  2COM A;  3M07 A;  1WI3 A;  3W3C A;  2ZXW H;  3DP7 A;  1LVA A;  2L2O A;  2EIM H;  2QQ9 A;  3MKW B;  1KON A;  3AG1 H;  1T08 B;  2O0Y A;  3HG9 A;  2M30 A;  4B3X A;  1ZG3 A;  5HS7 A;  4XLF A;  1DP7 P;  1AWC A;  3G1O A;  1BIA A;  2XPV A;  1W1W E;  2E5Z A;  3HTS B;  1BM9 A;  3HGY A;  1VFC A;  1YS6 A;  3QAH A;  1EA3 A;  4PJJ A;  3S3M A;  3DKX A;  3JRG A;  1VQ8 I;  1LJ9 A;  5CVR A;  5GPC A;  2OA4 A;  1B8I A;  2DOA A;  4A3B J;  4KNY A;  5DEQ A;  3GFJ A;  2F5C A;  1WJF A;  1GXQ A;  5ILS A;  3CO6 C;  3T5X A;  4BJ5 C;  4BS9 A;  1IRZ A;  2G9W A;  2LDU A;  4NNJ A;  4I7H A;  3S16 J;  2DA6 A;  1ZH5 A;  1MMS A;  4DJA A;  4OIO F;  3QOD A;  1HW2 A;  4S0H B;  4MNU A;  2DA3 A;  3RPU A;  2QWW A;  2Y75 A;  4A2U A;  4D1Q A;  4KDP A;  3FM3 A;  5J47 A;  5LGT A;  2P6S A;  2X6O A;  2M8G X;  1TWF J;  2F48 A;  4CCM A;  2VPR A;  3HRS A;  2FE3 A;  1HLV A;  4Z6Y A;  4ZYD A;  1O7L A;  3IC7 A;  3NWT A;  4XQF A;  1RUO A;  1BR2 A;  3SEZ A;  4JQF A;  4IHT A;  1RC9 A;  5TGT A;  2F4M B;  3RPQ A;  5ICF A;  2MA3 A;  2DT6 A;  2DU9 A;  1H89 C;  4C9Y A;  1R1U A;  2ISZ A;  4M6V A;  4ZH4 F;  2DW4 A;  2CQX A;  1OJL A;  2W85 A;  1XB4 A;  1SEU A;  3BG5 A;  4KIF A;  2CQN A;  4HX4 A;  3ZQC A;  4M3F A;  4A69 C;  2W48 A;  2VQG A;  2ISY A;  1A6Q A;  4PFP A;  4KIG A;  2P6T A;  3LA2 A;  2V1D A;  4M74 A;  2IGN A;  3TP0 A;  1VQ4 I;  4XSZ F;  3ZQI A;  4TV7 A;  1OCT C;  1QHH D;  2XPU A;  1UHW A;  3GEZ A;  2NVT J;  2M0M A;  1U5T B;  1YE9 A;  1F1Z A;  5L3G A;  2VIX A;  2HTJ A;  2CW7 A;  2LLK A;  2ZC2 A;  4A3K J;  1MMD A;  1ZG5 A;  5JHF A;  3LSJ A;  4GYI A;  3GWZ A;  3GVA A;  1RES A;  3KP4 A;  2DN0 A;  1EKE A;  3J7Z I;  4E7I A;  4F52 A;  1D8K A;  2IA1 A;  2VXD A;  5JLX A;  3VWB A;  3HOU J;  4BYY A;  5ILV A;  3PQK A;  3TL4 X;  4AIK A;  3RYP A;  2Z9O A;  2XGE A;  3M3Y J;  3H0D A;  3SHF A;  1V54 H;  4II3 A;  3DBL B;  4WXH A;  3K4B A;  2EK5 A;  2PMU A;  3GTG J;  2DT7 B;  5D4S A;  1IAW A;  2HDD A;  2GBY A;  4EVI A;  3EYY A;  2V6C A;  5TRD A;  1D3Y A;  2OQR A;  2JPC A;  3WOD F;  1DPR A;  4G12 A;  4XNF A;  4ZYA A;  1A6I A;  4I0A A;  3UR3 C;  2JPB A;  2DMP A;  1X4P A;  4W1U A;  4NC7 A;  4P5O A;  3FBI B;  3HB9 A;  2XUB A;  5J3L A;  3R6S A;  3OYF A;  4ENK A;  3KET A;  3UKG A;  4KT6 A;  2Q0O A;  4RGX A;  1YHQ I;  1K6O A;  5LBQ A;  3BTL A;  1B9M A;  5BPD A;  3DU5 A;  2BXY A;  3SZG A;  3DTE A;  4BQN A;  2PMZ A;  2IGM A;  3AG4 H;  1WJD A;  2DK8 A;  3F8M A;  3W6K B;  2R5Y B;  2DMN A;  2ID6 A;  1QZZ A;  2HR3 A;  1I3Q J;  2P5K A;  4LB5 A;  1U0J A;  2E35 A;  4IVN A;  3E5Q A;  2CO5 A;  1ZQ3 P;  1MH4 A;  3EQL F;  2KL4 A;  4F3Q A;  1X4O A;  2D1V A;  2X1E A;  2F5D A;  5B3S H;  3EYI A;  4F7Z A;  3FHN A;  4FCY A;  4UUV A;  2O8K A;  4GGG A;  1UHS A;  4N9H A;  2I5U A;  5FLX Z;  4N9I A;  1XGN A;  2RV8 A;  5FLV A;  3G73 A;  2ACJ A;  1MDM A;  5CVU A;  3CUQ B;  4ITV A;  1SC7 A;  4Y17 A;  4X6A J;  2MYS A;  2VBZ A;  2MGQ A;  1TL8 A;  1H0M A;  1YFH A;  5FKM A;  5GPA A;  1QBJ A;  4YIF A;  5CKT A;  5DM7 F;  2HZT A;  3MMY B;  4C30 A;  1F36 A;  3KP7 A;  3ZXS A;  2H27 A;  3J7A Y;  3CF2 A;  4HSR A;  3S17 J;  2ELK A;  1MBH A;  2DA4 A;  3JRA A;  2L0K A;  3I59 A;  4YFK F;  4HLX A;  1Z05 A;  4CCO A;  4OU0 A;  1I6X A;  3E1S A;  1XPX A;  1FOK A;  4PSW A;  1SFK A;  5IY5 H;  1WSU A;  3JTG A;  5CVI A;  4OIP F;  2A6E F;  1UJ8 A;  1ETQ A;  4GO1 A;  3R0J A;  2BOL A;  4MGR A;  1YIJ I;  3B6A A;  5A2Q K;  4RAF A;  4JX4 A;  1JKP C;  1PVE A;  5E17 F;  1V5E A;  2RNJ A;  1XDS A;  3DLA A;  1J9I A;  3DPT A;  2M3A A;  5LRR A;  5F27 A;  4J00 A;  2H94 A;  2JSP A;  5GAE J;  2X48 A;  4KIC A;  1ON2 A;  1W7P A;  4L5J A;  4BXU A;  3FX3 A;  3MEX A;  1BI1 A;  1KQ9 A;  3LA3 A;  3S1M J;  2HOE A;  4KIS A;  2E34 A;  4ENJ A;  1DPU A;  2VQL A;  3DEE A;  4BHB A;  1MBE A;  3S2W A;  4FX0 A;  3CC2 I;  4YII A;  1X58 A;  2NS0 A;  4ZZL A;  1RI7 A;  3BLY A;  3KX2 A;  1YO5 C;  3FK7 A;  4J19 A;  1WJB A;  2H8R A;  5GAG J;  1FOW A;  1DQU A;  1MNE A;  2Y9Y A;  4N4N B;  1Q1V A;  2P8T A;  1R1T A;  3OYE A;  4CIC A;  2F5E A;  2HYJ A;  3K7A J;  5L3B A;  1BI3 A;  4PUS A;  2I8D A;  2KQR A;  4CYD A;  1FIA A;  1FMV A;  4E7K A;  2DBB A;  3E6M A;  4BY1 J;  3U2R A;  4XSX F;  4GXO A;  2HFH A;  4C2U A;  1Z6R A;  3ABT A;  4PCQ A;  4O5V A;  1XG1 A;  2IPQ X;  3M8F A;  1KQ0 A;  1P9Q C;  1S29 A;  1X1D A;  2BE5 F;  3RZD J;  5HS9 A;  3J81 K;  1AOY A;  3F22 A;  1EH6 A;  4MFD A;  4WF2 A;  2IW5 A;  3J80 K;  2VL8 A;  2K3P A;  4LD5 A;  1QVT A;  4BJ6 C;  1I6H J;  2YX7 A;  2CV2 A;  3Q9S A;  3WG9 A;  5HDK A;  1T39 A;  3K4K A;  2CGP A;  3LSH A;  2B63 J;  5E79 C;  4P1W A;  1GV5 A;  2E1M C;  3GTJ J;  4XKC A;  3HEF A;  3FIW A;  2OTJ I;  3C2B A;  3KYC B;  5F64 A;  2FBH A;  1R00 A;  3K10 A;  1ZYR F;  3JRI A;  1JT6 A;  2NNY A;  4B48 A;  2RNG A;  3IKT A;  3K69 A;  2R5Y A;  3KE2 A;  4LK0 F;  3LSR A;  1J09 A;  2E2H J;  2M4K A;  4DYR A;  5M3M J;  2Y2Z A;  1SVM A;  1MIJ A;  1RKT A;  4A3M J;  3Q0V A;  4LIV A;  1H9G A;  1IV6 A;  1LEB A;  3CUQ C;  3E5X A;  1O3Q A;  4M3E A;  3GFI A;  1B72 A;  3V7C A;  3E6B A;  2L7Z A;  3TDZ C;  4RAZ A;  1HA8 A;  3HOW J;  1AKH A;  1R5H A;  4DOZ A;  4YG2 F;  4OIN F;  1JI8 A;  1NTC A;  4AIJ A;  1LDK B;  2ZCW A;  2W1O A;  3M9A A;  3O6B B;  2L5Q A;  1BW5 A;  3CUQ A;  2DFH A;  1ZGJ A;  2LY1 A;  1YLF A;  4I6Z A;  3NAU A;  3A0H C;  2V9V A;  4EJT A;  1J7K A;  2W25 A;  1ZAO A;  4BE2 A;  1BR1 A;  4LIU A;  4CSW A;  4XN3 A;  4UNO A;  2VKV A;  1S6L A;  5M3F J;  2FBI A;  1OMI A;  1OFC X;  3LOC A;  4P55 A;  1T2K A;  2VBY A;  1U8R A;  1PUF B;  4AID A;  1W36 C;  1OIS A;  2DDA A;  3OMY A;  4MQV A;  4EM2 A;  1Z3Y A;  1ZK8 A;  2UUZ A;  4M71 A;  1KU3 A;  2FBK A;  3TMO A;  2UXX A;  3M1C A;  3RKQ A;  3HXL A;  1GDT A;  4XR6 A;  3AAF A;  3DTK A;  4ETS A;  2HPM A;  4CYC B;  4A5M A;  1A35 A;  1IN8 A;  3W2V A;  2O7O A;  4P9U A;  1G4D A;  4U0V A;  5D4R A;  2XPW A;  4M9Z A;  4UHT A;  5J4Y A;  1TWC J;  5IT9 K;  2FQ3 A;  1MJ9 A;  1X2M A;  2R5Z A;  4E7Z A;  3E6C C;  1FLI A;  2MC3 A;  5LEK A;  1ETY A;  4JYK A;  2A61 A;  1OCZ H;  3ABM H;  3LQR A;  1WPK A;  2NVX J;  3CJN A;  3BR1 A;  4HRI A;  1Z9C A;  3MQ0 A;  4DBR A;  1G6N A;  2KHM A;  2Z33 A;  2JVH A;  1WHU A;  2ZSH B;  1WI9 A;  5EGO B;  1QPI A;  1H8A C;  1ONV A;  3SEQ A;  1SD6 A;  4ENN A;  1HW1 A;  1HF0 A;  1O57 A;  1D1B A;  1JGS A;  2L01 A;  4XKV A;  2EIN H;  2IS1 A;  3HOT A;  4C2T A;  4A3L J;  1REP C;  1T98 A;  3RDI A;  3BQZ A;  2K9L A;  4RB2 C;  2OUM A;  1IZ1 A;  2VN2 A;  5J1R A;  3V7R A;  3K1N A;  3F8B A;  1YQA A;  3MKL A;  3I58 A;  4J01 A;  2IBD A;  3LSP A;  4L9V A;  4HNT A;  2W24 A;  1FBQ A;  4IKF A;  1P6R A;  5F0C A;  3ABK H;  3OY9 A;  3FZV A;  1OLT A;  3FKJ A;  2DMT A;  2TRT A;  1B59 A;  1MBJ A;  3COA C;  2ADU A;  3OIP A;  1V4R A;  4FTH A;  5J1U A;  2ZME A;  2K3F A;  3OYI A;  4PGG A;  3ZQ7 A;  1YX3 A;  2BV6 A;  4UUT A;  3ZQH A;  2GA1 A;  2QKL B;  2DXI A;  1STZ A;  3ZQF A;  1T95 A;  3EDP A;  4H4K C;  1PJR A;  2B7E A;  4M9S A;  1YW9 A;  5GP9 A;  1Z6T A;  4KYW A;  5J8C A;  1UB9 A;  4I98 B;  2MH2 A;  2PFB A;  3TO9 A;  1JUP A;  3G1M A;  3LQQ A;  2Z5U A;  3SDG A;  5D8K B;  4JX5 A;  5FLM J;  3BWG A;  2COB A;  2HYG D;  4XRS G;  3JAM Z;  3I3L A;  3HOS A;  2CQK A;  4BH9 A;  4CXF A;  1BC8 C;  4XON A;  5J1Y A;  1LEA A;  3W6J B;  1T0F C;  2AQF A;  1TWA J;  1I50 J;  2G0E A;  4LK1 F;  2ZFU A;  4XLN F;  1H88 C;  2HS5 A;  4LLL A;  4U0W A;  4NUB A;  4XOT A;  3FXM A;  3Q3S A;  5BS6 A;  1MMN A;  2JA6 J;  1FWZ A;  2DOF A;  3GTK J;  1IUY A;  2DMQ A;  2FA5 A;  2DA7 A;  3Q0W A;  1VQL I;  3IAS 2;  1QVU A;  4G94 A;  3L9F A;  1T0F A;  1PP8 F;  1B8I B;  2H6B A;  3HHG A;  2ECC A;  4LB6 B;  1ZTR A;  2YSR A;  1HKQ A;  1X3W B;  3PUB A;  1XN7 A;  1PUF A;  3BC8 A;  3HOZ J;  2L7M P;  3TO7 A;  3CJR B;  4KIT B;  4RGS A;  2KDO A;  3D5S C;  4MHG A;  4HLY A;  1YJN I;  5B66 C;  3GTQ J;  1B1B A;  5FJ8 J;  9ANT A;  3EET A;  3K9T A;  1ZN2 A;  2ECB A;  2HXI A;  2BXZ A;  2A69 F;  2E5N A;  1ZR4 A;  1HKT A;  1USS A;  1LDJ A;  3IV5 A;  3I56 I;  5F08 A;  1JGG A;  1FTZ A;  4HNV A;  2W4S A;  3BG7 A;  2OD5 A;  1X1B A;  5LD2 C;  3HSR A;  4G7O F;  3GZN B;  1XC5 A;  1XD7 A;  3OYA A;  2OU2 A;  3DEW A;  1IN7 A;  5HS8 A;  1IXC A;  2M1B A;  2EV6 A;  3RZO J;  2VKD A;  2EIK H;  4A3F J;  3FXJ A;  3CCJ I;  2IGO A;  4EM1 A;  1XSX A;  2GZW A;  3GLL A;  1R9T J;  5LGU A;  4A6E A;  2BHY A;  2OTL I;  4PJ0 C;  2STT A;  4IQJ A;  2F5F A;  2OQG A;  1P92 A;  1IXR C;  4IO9 F;  2NVY J;  3DFG A;  2KIS A;  3HL2 A;  1GV2 A;  4A93 J;  1U9N A;  3IRQ A;  2PMH A;  4IOC F;  3AFH A;  2A6T A;  1IUF A;  3C2G A;  2EH3 A;  1XTA A;  3DU6 A;  4GYG A;  3ZCO A;  3N4M A;  4Y3O A;  2MD0 A;  4RLF A;  3CCR I;  5E3L A;  4F93 B;  4F92 B;  2DT5 A;  1MKM A;  1WZ2 A;  4BDZ A;  1ETV A;  3HM5 A;  1LE8 A;  3SJM A;  5FGM A;  2H8W A;  2M45 A;  2ZNY A;  2XVC A;  5B1B H;  3ZMT A;  4RB1 A;  2BBY A;  4OOI A;  5EJC A;  4A3J J;  4S04 A;  1LUJ B;  5LGN A;  5E3M A;  4DYQ A;  2EJR A;  3CDI A;  3MWM A;  3OYL A;  5J4V A;  2JUC A;  4D0P A;  5KVR A;  3IH2 A;  1FY7 A;  1JHF A;  2X0L A;  4IRI A;  5FRO A;  4RGU A;  2XAG A;  5HOO A;  5E8I A;  4PFO A;  4LOC A;  1ZR2 A;  4N4O B;  3MFK A;  5K5O A;  1KGS A;  2P4W A;  2QCO A;  2MC4 A;  2K5C A;  5FFX A;  1GT0 C;  4MEX F;  2VBW A;  5EDN A;  4CH7 A;  2CRG A;  4KN4 X;  5CJ9 A;  1A31 A;  2AHQ A;  2EPF A;  3H9G A;  2K85 A;  2FOW A;  5BMZ A;  4AD9 A;  3E5U A;  2EIL H;  3F0C A;  4XLC A;  3HPG A;  5B1A H;  4L9J A;  2CUF A;  3LSM A;  4AYB A;  5IT3 A;  1NG7 A;  2LRE A;  1J5Y A;  2CYY A;  5ED4 A;  1J59 A;  3KEO A;  3REO A;  5KCM A;  4DYC A;  2BEO A;  2NYX A;  2FX0 A;  1I1S A;  2EFW A;  1Z7U A;  2P0W A;  3WTZ A;  3VSL A;  2OZU A;  4IF4 A;  4HQM A;  4UXN A;  1DGR M;  3FXK A;  2BHZ A;  3WHC A;  1UMQ A;  2KLO A;  2Y0M A;  3PQJ A;  2O5R A;  1MDM B;  1RZ4 A;  2MLG A;  2NS7 A;  3T1B A;  3S8P A;  2LC2 A;  3F9K A;  3PNY A;  2CH0 A;  4YEL A;  5FB2 A;  4XIC A;  1YJW I;  3DPU A;  2CV0 A;  3CDH A;  3RCO A;  3C3W A;  4U87 A;  4BHP A;  4CCJ A;  1P7I A;  2CMP A;  3GCM A;  3I59 B;  2R4G A;  3ZQG A;  3KZY A;  1HQC A;  3GUD A;  3SZP A;  4PSX A;  1SAU A;  3GBG A;  1E17 A;  3OOP A;  3CUO A;  1YW8 A;  3BY6 A;  2CUE A;  2F2E A;  1Z21 A;  4BUP A;  5FFZ A;  2P5V A;  2EZL A;  1S72 I;  1ETX A;  3GX4 X;  4BL0 B;  4RB3 C;  2OV7 A;  2E1N A;  2IP2 A;  5F6F A;  3GYH X;  2E7X A;  2JSC A;  5IYB J;  2MBF A;  2BGC A;  1YW7 A;  2QQA A;  3WG7 H;  3BZ6 A;  2WBM A;  2WB1 A;  1T8I A;  3B02 A;  2M7A A;  3NWS A;  3A01 A;  4IPA A;  5CPR B;  3L09 A;  2L9R A;  2CS3 A;  2DA2 A;  2IA2 A;  1W7P B;  2OC6 A;  4HA8 A;  4AYB N;  1Y8Q B;  2HTS A;  1U8B A;  4ZDO A;  2D5V A;  1U3E M;  2I10 A;  5J40 A;  3H3V K;  1E3H A;  2E7W A;  2QQ8 A;  5L3E A;  1MNM C;  3PNT A;  2MG4 A;  3RQI A;  3WGI A;  3LFU A;  2ESH A;  4E7J A;  2JVG A;  2XF6 A;  1ETK A;  1FMW A;  2LD5 A;  1XMA A;  3WTS C;  3H36 A;  2LNB A;  2LFB A;  1IN6 A;  2X4H A;  4KJZ A;  1Y0N A;  3BQY A;  3PJR A;  5JR3 A;  3V8J A;  3VYR B;  2HEO A;  2R7Q A;  2A6H F;  2UXN A;  2VKH A;  3NRV A;  1D0Z A;  1QNT A;  2QZ8 A;  4B3A A;  3ERE D;  4IHW A;  3TKY A;  5C3E J;  2K9N A;  2JUG A;  2OF7 A;  2WWY A;  5J8F A;  1TNT A;  1YIO A;  4BY7 J;  2XAS A;  2VKE A;  2KJB A;  1XMK A;  2UZK A;  2VC0 A;  4V2F A;  2ZJ2 A;  1F5T A;  4P96 A;  4B1R A;  4MFE A;  3B73 A;  3ULQ B;  2BYV E;  2W82 A;  4HYE A;  1Z0X A;  3O3K A;  3RKW A;  2WB1 N;  1VQK I;  1UG2 A;  1XX5 A;  2KIU A;  4QSH A;  3F21 A;  1MSF C;  2Y69 H;  4HAM A;  3K4M A;  4IEJ A;  2WAD A;  4ANJ A;  4UB8 C;  1UG0 A;  2JA2 A;  4LJZ F;  1HCR A;  2Y9Z A;  4UUS B;  2KZG A;  1UCR A;  2NAZ A;  3GZ6 A;  1JTX A;  3F8N A;  5FRM A;  1GXP A;  2IJL A;  4V2G A;  3G3Z A;  2HVS A;  3RJP A;  2LYC A;  2XV4 S;  4C2M J;  4ZZD A;  3DWL E;  3GO5 A;  1S8N A;  2LR8 A;  3G2B A;  4RM2 A;  3K70 D;  2MD5 A;  2AO9 A;  2E1M B;  4MIM A;  3F8F A;  5IPA A;  2WAE A;  3H35 A;  1S7A A;  3KIO A;  3U21 A;  1SMY F;  1I3A A;  3DLL F;  3ZGK A;  4E7L A;  1OCC H;  4HF2 A;  1X1P A;  3E97 A;  1B72 B;  2KMU A;  2XF7 A;  3OL4 A;  5CQG A;  1ZRC A;  2VJ5 A;  2Y30 A;  1O3R A;  2F4I A;  3V8K A;  3OS1 A;  1YG2 A;  1AKH B;  1Z67 A;  3VYS B;  5KAF C;  2DA5 A;  4E4H A;  1W5C C;  3A1Y A;  4I02 A;  2KRC A;  3MKZ A;  5C44 J;  5IP9 J;  2XAF A;  4KFC A;  1D8J A;  4BE0 A;  2L9S A;  4I01 A;  2XKP A;  4IXA A;  4KIB A;  2V26 A;  3IH4 A;  4R79 A;  2FOK A;  2G7U A;  1BOB A;  2D45 A;  3H9J A;  1KU9 A;  1U78 A;  5D6E A;  3ZMV A;  4EGZ A;  3J81 Z;  3OR2 C;  1HC8 A;  3DPL C;  2HU9 A;  5DCF A;  1OYY A;  1K79 A;  3J80 Z;  1JXS A;  4NQW A;  3FK6 A;  4EEF G;  4XKB A;  3GW2 A;  1BC7 C;  5E18 F;  2EFN A;  2ID3 A;  2MFZ A;  2PJR A;  1Z7L A;  2LP0 A;  4HX8 A;  4RMN A;  5LHI A;  2V7F A;  4DZJ A;  2O8X A;  1XCV A;  1VQM I;  3ROU A;  1DU0 A;  2VOO A;  4M6X A;  1MD0 A;  5E1X A;  3M1E A;  3QPL A;  1KYW A;  1OYW A;  1Y8R B;  2PMZ N;  2HVR A;  2DJI A;  2TCT A;  2ZKZ A;  3FXR A;  2HDC A;  1FC3 A;  4EJO A;  3KEQ A;  3GF2 A;  5H6Q A;  4B4C A;  4QWQ A;  4YFN F;  4MTD A;  3VSK A;  4DW6 A;  2NRA C;  2R5Z B;  2EV5 A;  1B9N A;  2E1O A;  3DV8 A;  4G6T B;  2VQH A;  1EV7 A;  1ERD A;  3BZK A;  2EQR A;  3AG2 H;  3M7G A;  3QU3 A;  5E3O A;  1W0T A;  3G4S I;  3NQO A;  5IYD J;  2KIQ A;  2X1C A;  3P5J A;  3VOD A;  2IA0 A;  3VYT B;  4BU2 A;  4RGR A;  2LRD A;  1KA8 A;  2MSY A;  1TLH B;  1LQ1 A;  3KPH A;  5JHU A;  2LMD A;  2VC1 A;  3I71 A;  2GIV A;  3LA7 A;  2VJJ A;  4XRM A;  2FU4 A;  3P9I A;  1SFX A;  2O9L A;  1XCB A;  1HXD A;  4UV9 A;  4MO7 A;  3FBN B;  4HV6 A;  1R71 A;  3S3O A;  1TP4 A;  4FX4 A;  4EJV A;  3HOV J;  1LVK A;  3K0L A;  2FNP A;  2R7R A;  3FXO A;  4BE1 A;  4XRF A;  1K6Y A;  4PK4 A;  2EBI A;  3NEU A;  1BJZ A;  3LNQ A;  5JVG F;  2K9M A;  3WGH A;  1NK3 P;  2R7D A;  4DBQ A;  2XAU A;  1YOV B;  3V8L A;  4G8X A;  5HNF A;  2KZV A;  2ZNZ A;  2QSG X;  1ZEL A;  2ZBK A;  4CCL A;  1BN5 A;  4B47 A;  2FXA A;  3EUH C;  2EA2 A;  1IW7 F;  1QRY A;  1TQI A;  4Q47 A;  5EEA A;  1ZRF A;  3VFZ A;  2IT0 A;  2BVM A;  2HZD A;  2QM3 A;  1IO2 A;  2NVU B;  3CME I;  2A07 F;  3HHH A;  5IT9 Z;  2NXN B;  2W7N A;  3FM5 A;  3MAJ A;  3QU6 A;  3QYB A;  4BBR J;  5GAD J;  3H9Q A;  4JK1 X;  4UUS A;  2ZME B;  1N75 A;  2P7C B;  3EUH A;  5EZG A;  3ZMD A;  3QWL A;  2IGK A;  1SD4 A;  3ABU A;  2LG4 A;  3ZRG A;  3LSG A;  3PO3 J;  1ZLK A;  2HNH A;  2B9S A;  2QKM B;  3W6V A;  3FXQ A;  3WTY C;  3VEP A;  3ZP5 A;  1IN5 A;  4RS8 A;  4AU7 A;  4CA0 A;  2RDP A;  3HDD A;  1DGW Y;  2JA7 J;  3KEY A;  1X2N A;  3CJT B;  2HYF A;  3C1D A;  5B5E C;  1FBU A;  1HKS A;  4BEH A;  5HNH A;  5IP7 J;  2QGU A;  3JTH A;  4QLC U;  5L3D A;  2UV1 A;  3N97 A;  2CWE A;  3DQV C;  1GVJ A;  1KU2 A;  2L7F P;  4UY8 I;  2XRO A;  1WQ2 A;  4LG3 A;  1WJE A;  1LB2 A;  4E7H A;  3H92 A;  1T6S A;  1LDD A;  1SFO J;  3MKY B;  3OSG A;  2WAQ A;  1FSE A;  2CW0 F;  1ETO A;  2VB6 A;  4ZTJ A;  2XGD A;  4CGZ A;  3CLQ A;  4A0Z A;  3S32 A;  2M5W A;  2LY9 A;  4RAG A;  1FX7 A;  5GTH C;  5KAI C;  3LSI A;  2WV0 A;  1SVL A;  2E36 A;  1SAX A;  2X1D A;  2XRN A;  4B09 A;  4YFX F;  2KJC A;  2ME0 A;  5HDN A;  3HRM A;  2PLY A;  1VZ0 A;  2CU7 A;  2DI3 A;  4UVB A;  3HJE A;  2LK2 A;  3LAP A;  3IKV A;  1G59 A;  1Z1D A;  1QPM A;  2ZXJ A;  2IS2 A;  4D5C A;  2GQQ A;  1MJB A;  3CLO A;  3S2H J;  4XN0 A;  3BP8 A;  4CCN A;  1MZB A;  2HQ5 A;  2WY7 Q;  2V9P A;  3BR5 A;  1VQN I;  1G3T A;  1PP7 U;  1HDD C;  4DZP A;  3A02 A;  1BBY A;  3RIR A;  1GHC A;  4M9X A;  5IOY A;  5KNL A;  3HSE A;  4FET A;  2WA0 A;  1Q1H A;  3JRC A;  2QVO A;  3S93 A;  3CC7 I;  4RB0 A;  2BVL A;  1RPW A;  5CQE A;  2VLA A;  3GFM A;  4Y52 J;  1T33 A;  3BG9 A;  3DKY A;  3LAJ A;  3RTR A;  2DFI A;  3QP5 A;  3BDD A;  1IG7 A;  1ITY A;  2VT3 A;  2PI0 A;  4ZDL A;  2HVQ A;  4HNU A;  1DUX C;  3QQA A;  4YEJ A;  2VAS A;  1LFP A;  3KYD B;  4Q5S F;  1HOM A;  5CVV A;  3BJO A;  2NOG A;  1WKM A;  3VDX A;  1MGT A;  5E3N A;  1HW5 A;  3CMM A;  1TQP A;  1KZH A;  3W2A A;  3TOB A;  1HBX G;  2DLL A;  1YX5 A;  4HF0 A;  3Q5F A;  5H20 A;  3M4O J;  4NC6 A;  2EB7 A;  2M4G A;  2JQ7 A;  3JCU C;  2R7O A;  3OS2 A;  2ZJP F;  3L7W A;  1X19 A;  1JJ6 C;  2L7K A;  1D0Y A;  5KHD A;  2DPU A;  2KKO A;  2ZME C;  3BTI A;  3K1P A;  3HUG A;  4U0Y A;  1LE8 B;  1BA5 A;  1D5V A;  2LY2 A;  2K27 A;  2LKS A;  2W57 A;  3CES A;  1JHH A;  3IH3 A;  3K4J A;  1CGP A;  2M34 A;  5GAH J;  4HEA 2;  3K70 C;  2FML A;  2OBP A;  1P2F A;  1UEL B;  2J5O A;  3LL7 A;  2NS8 A;  3IUO A;  2XB5 A;  3GLX A;  3ZQQ A;  2GOM A;  2R7Z J;  3U1K A;  4XLA A;  1IN4 A;  4LIT A;  2L3D A;  2HOS A;  4B8X A;  1FBS A;  4L0Z B;  1G3Y A;  2E71 A;  2HXO A;  1Y56 A;  1J2X A;  5C4J J;  2XHK A;  1XGO A;  1JT0 A;  2CJJ A;  2K86 A;  1JUM A;  1F9N A;  1R1V A;  3HPH A;  3ISP A;  3ML6 A;  3R61 A;  3VOE A;  1TWG J;  3F72 A;  3S3N A;  5EG0 A;  1WJ5 A;  2P7V B;  2GWR A;  2JWT A;  4M3B A;  1CF7 B;  1S7O A;  4LGW A;  3JR9 A;  1Z91 A;  1QO0 D;  4M72 A;  3T8T A;  3IWZ A;  3L2V A;  4L9T A;  3PL8 A;  2M8E A;  5DTD A;  1BR4 A;  2XSD C;  1QGP A;  3U9G A;  1EJ9 A;  2EIJ H;  2TDX A;  5M5W J;  4QPO A;  3BJA A;  2XF5 A;  3L1P A;  1U9O A;  2R7S A;  4IRH A;  2RC4 A;  3GXO A;  1FT9 A;  3FXU A;  5FRN A;  3CCS I;  1RRJ A;  4JP0 A;  3CCV I;  4IL6 C;  4QIW N;  1ZG1 A;  4W97 A;  3MCZ A;  2W00 A;  4OIQ F;  3BPX A;  1AA7 A;  5EF6 A;  1CQT A;  4XLP F;  2Z16 A;  1JUS A;  2XRL A;  1IRG A;  4BGD A;  1HSJ A;  2V4J C;  1DDN A;  4S05 A;  5GTI C;  1SD7 A;  4CZC A;  4ON0 A;  3HKZ A;  2LBF B;  1BI0 A;  1WJC A;  2H09 A;  2VJ4 A;  1QHG A;  2JA5 J;  2BY0 A;  3A01 B;  1IV8 A;  3BJ6 A;  2OJE D;  2YPR A;  2XIG A;  4B43 A;  3A4C A;  4ESJ A;  1IJW C;  1S3J A;  1K78 A;  5AIQ A;  1VQ7 I;  3HRU A;  1VF9 A;  1BW6 A;  1OR7 C;  2KPM A;  2VPL A;  4MTE A;  2HOA A;  1YTY A;  2XAJ A;  2BW3 A;  3BRO A;  2GIZ A;  4BNC A;  1V55 H;  4I09 A;  1IC8 A;  2DO7 A;  2EFO A;  1YJ9 I;  2VXZ A;  1XGS A;  2RQQ A;  1OCP A;  3I54 A;  3TBI A;  4EM0 B;  3OYJ A;  2RKH A;  1OR7 A;  2XB0 X;  2CSO A;  3OIQ A;  4KT5 C;  4N0B A;  3T8R A;  2EWN A;  3G6E I;  1UZC A;  1W4M A;  2LOO A;  3ECO A;  2HQA A;  5FKO A;  1K61 A;  3K2Z A;  2R93 J;  2VUM J;  2OAZ A;  3SXY A;  5ICG A;  3C18 A;  4WCG A;  3IRR A;  4IHS A;  2V1X A;  3H3U A;  3OR1 C;  1IDZ A;  2W84 A;  1RKW A;  1OQY A;  3HZJ A;  1HDP A;  3WU0 A;  3SDB A;  2VOD A;  4DNC A;  1A5J A;  3E3V A;  3BG6 A;  1VQP I;  1FOX A;  4QPQ A;  2DPD A;  5F04 A;  2DQR A;  3WE2 A;  1P7J A;  4LLN A;  2G7H A;  3FF5 A;  2H1L A;  1Y1W J;  2HOT A;  2M87 A;  3HKZ N;  4ZYH A;  3JRB A;  2O03 A;  3KFW X;  1YRN B;  3CMY A;  3I0T A;  4AUX A;  1ACI A;  4UB6 C;  1OCO H;  3KP2 A;  2H1K A;  1A04 A;  3I4N J;  4X0G A;  4WWC A;  2O6G E;  3EUK L;  1GLN A;  1X3Z B;  3M8J A;  3X2Q H;  2ME6 A;  4F55 A;  3E6D A;  1QU3 A;  3Q9V A;  1R5G A;  1WH7 A;  3BR6 A;  3A0B C;  1R4N B;  2HI3 A;  3LSK A;  2IEK A;  1MH3 A;  1I1G A;  3ABL H;  5F0F A;  4ESB A;  3IL2 A;  2DTR A;  2MH9 A;  1UFM A;  4CZZ A;  3CZ6 A;  2N8G A;  3PIO F;  1NK2 P;  1WJA A;  3JW4 A;  3IHU A;  3GTM J;  4CO8 A;  5HOD A;  2AXL A;  1CF7 A;  4XKW A;  1GUU A;  3TED A;  4G6D A;  3HOY J;  2DQL A;  1FTT A;  3WTV C;  2LF8 A;  3QYF A;  1NHA A;  2JT1 A;  5IOZ A;  5K7Z A;  2PN6 A;  5H2F C;  1R49 A;  4L0Y B;  3A03 A;  2HQR A;  4WX9 A;  4IHV A;  1XDU A;  2L02 A;  3KLO A;  4WXD A;  4ZDP A;  1N78 A;  2GXG A;  2R7V A;  4EQQ A;  2JTV A;  3MZH A;  2OPT A;  5LRS A;  3EPZ A;  4HST A;  2BZT A;  1RIO H;  3K4C A;  5C4X J;  3OS0 A;  5FO5 A;  3ASO H;  3PUF A;  5JVT A;  3QOP A;  3ONQ A;  3OYC A;  4NQW B;  3VB2 A;  1JKO C;  5HVQ C;  1FP2 A;  2LVS A;  3F6O A;  2IS6 A;  2L9V A;  4FE4 A;  3A2K A;  2J5P A;  1LFU P;  3OOU A;  2PJR B;  1R36 A;  2WAF A;  4HW0 A;  4A3D J;  2QUF A;  5EYR A;  1KYZ A;  1BJA A;  2LBF A;  4II2 A;  1IXS B;  5EZH A;  3SQN A;  3J7A O;  4F91 B;  2H6C A;  2X85 A;  4IOA F;  4L5E A;  1Y39 A;  1XS9 A;  1VQ6 I;  3TGN A;  4JX6 A;  4EV0 A;  1WGX A;  1PDN C;  4HF1 A;  2ICW G;  3DEU A;  3I9V 2;  4WXC A;  2QSH X;  2HGC A;  1SVO A;  1ZLJ A;  5K5Q A;  3D0S A;  4RLQ A;  4UVC A;  5DCM A;  2DK5 A;  2E60 A;  3R60 A;  1I39 A;  2PX9 A;  4G6Q A;  5AIP A;  5FD5 A;  2VE8 A;  1G3W A;  4HQE A;  3WTX C;  2IXS A;  2XAQ A;  4K2E A;  1ZGW A;  1E2X A;  1ULY A;  3H5R A;  2X6Y A;  3BCA A;  3OYN A;  3WU1 B;  4XOP A;  4LLG F;  4Y7N J;  3JRE A;  2QBY B;  3ZMS A;  4PZJ A;  1WRJ A;  5DD4 A;  1W36 D;  3ZMU A;  2E2I J;  1KU7 A;  1K4S A;  2L9N A;  4L5I A;  1EH8 A;  3BTJ A;  4EJW A;  3J7Y J;  3ZPL A;  1RET A;  3BPV A;  2RVC A;  2E2J J;  2JA8 J;  1VI0 A;  3I4P A;  1ZHF A;  3OYG A;  4BDY A;  1XSD A;  2QYO A;  4EAT A;  1ZGA A;  3I64 A;  1VQO I;  2JZY A;  2IRF G;  4AC0 A;  4YIR X;  3CF5 F;  4L9N A;  1O3S A;  1JJ8 C;  2RGV A;  2GA2 A;  2MAB A;  2EA4 A;  4Q48 A;  2PJP A;  1TT0 A;  2Y0S A;  2A5Y B;  2K9Q A;  4GDF A;  5FKL A;  5A2Q Z;  1YRN A;  4RA2 A;  1O3T A;  1TZL A;  3GZ5 A;  1VQ5 I;  1JE8 A;  2X6X A;  2CG4 A;  4MQ9 F;  3KYL A;  4ABZ A;  1S5L C;  3TP3 A;  2QLZ A;  2ESN A;  1MMA A;  2YX4 A;  4PJL A;  5E8G A;  1X1A A;  4Y13 A;  3RQ4 A;  2LH9 A;  3SYT A;  3HOX J;  2E19 A;  2HKO A;  3F3X A;  2BY2 A;  2AQE A;  3HYI A;  2HDW A;  3RYR A;  2ELJ A;  4Z2Y A;  2DOE A;  3BOQ A;  4ASN A;  1ENH A;  2JK3 A;  3M8E A;  4RM3 A;  1PYV A;  2ZSI B;  1TC3 C;  2O61 A;  5BNG A;  2FD5 A;  3CCL I;  1A36 A;  4L18 B;  3SFZ A;  2VE9 A;  1GVD A;  3HGG A;  3S2D J;  2LSO A;  4BEH B;  2A5W A;  3VPR A;  1WVR A;  3L00 A;  3V7S A;  2Q2E A;  4HDU A;  4OAY A;  1W0U A;  2JRM A;  1U6G A;  3WGG A;  5F1R A;  1JKQ C;  5HDG A;  4PJN A;  2FMY A;  5FKK A;  2STW A;  3TO6 A;  1M1E B;  2C6Y A;  2X6W A;  2D2W A;  3CP8 A;  2YU9 J;  3KP6 A;  3GFL A;  5F1J A;  3CCU I;  4MEY F;  2EFP A;  3H5N A;  2KDZ A;  1R6R A;  1MMG A;  3JSP A;  3RSN A;  2Y0S N;  1V5G A;  3PSF A;  1Z77 A;  4NB5 A;  5KK1 A;  2NNN A;  2LKP A;  3OYK A;  4A12 A;  3KLN A;  2L4A A;  2O3F A;  3I5U A;  1BI2 A;  2VI6 A;  1MSE C;  4Y15 A;  3K1M A;  2IVM A;  4G9Y A;  3GTL J;  2ZO4 A;  4BQQ A;  1XMX A;  4BQA A;  5FKN A;  1L0O C;  2VON A;  3R0A A;  1BIB A;  3QPS A;  5ERI A;  1MJA A;  3OYD A;  2R7T A;  3OWT A;  2K4B A;  4H0E A;  4A6D A;  2Z1D A;  2DAO A;  3PFY A;  3KCC A;  4XRS A;  1TW3 A;  3D1N I;  1FEX A;  4HDV A;  2D1H A;  4A3G J;  2KRF A;  2HWV A;  2DDB A;  5JI6 A;  1VND A;  4ZYE A;  3H5A A;  4RDU A;  3MZ8 A;  4XBF A;  4A0X A;  2V9K A;  1UST A;  2QSF X;  3OIO A;  2XGX A;  1YI2 I;  4D7N A;  3FIS A;  2DFF A;  3V4G A;  3I53 A;  5LFA A;  1WH5 A;  1B6A A;  4AVP A;  4BXX J;  2A68 F;  1BL0 A;  2Z2S B;  5L3F A;  4HZF A;  2K9S A;  3PM1 A;  2FNA A;  1TTY A;  1DP3 A;  2QF7 A;  1FNN A;  3WU2 C;  4M6Y A;  5K1Y A;  5LHH A;  5CYV A;  5M5Y J;  1RUN A;  1LPQ A;  4DQ2 A;  2OZ6 A;  2QBY A;  2JJ7 A;  2AXT C;  2CV1 A;  1Y0U A;  3D5L A;  3JRH A;  3BZC A;  5BPI A;  5BOX A;  1MBK A;  1E3P A;  4E6K G;  1AU7 A;  2XC7 A;  1E0E A;  5D8L B;  2R0Q C;  5K7F A;  2R3S A;  4HV5 A;  4D7M A;  3E7L A;  4XID A;  3UNG C;  3SZT A;  2K7L A;  3K4L A;  3AKZ A;  3CD6 I;  4XOR A;  1EH7 A;  3GTP J;  2HPI A;  1U5T C;  5DUK A;  1IRF A;  2RQP A;  4C3J J;  2YR2 A;  4O6J A;  3FMR A;  1N25 A;  4LG0 B;  3FDY A;  2VT2 A;  4Q4Z F;  3CCY A;  1D5Y A;  1TBX A;  2GXA A;  1XSV A;  1RNL A;  3P9C A;  1SFE A;  3QP6 A;  4CCK A;  1Y1V J;  3KP3 A;  4FHT A;  4IQ4 A;  3HUG B;  2WTE A;  3O2P E;  1U5T A;  3DBR B;  2GOX B;  1NH3 A;  3H1C A;  1R7J A;  3QPT A;  5FLX K;  4XMY A;  3H0G J;  1DU6 A;  5HLT A;  3ESW B;  1KQ8 A;  2F6C A;  4KUM A;  3G1L A;  2YS9 A;  1LFB A;  4BBS J;  3O8G A;  2P5L C;  3L2W A;  3SFI A;  4PDK A;  1YIT I;  4IRG A;  1XGM A;  2PBI A;  5E1Z B;  3OYM A;  1FOY A;  2ELH A;  1R4M B;  1SD5 A;  4V19 K;  4XLH A;  3GTO J;  5ILU A;  3DXJ F;  3BTC A;  3MD2 A;  1QZY A;  4I99 C;  2CQ7 A;  4GRI A;  4QTR A;  2QEN A;  4EJU A;  2YUS A;  3EUA A;  5EG0 B;  3TDU C;  1IGN A;  3O8H A;  2M7B A;  3D5R C;  1P4X A;  3CCQ I;  4BAY A;  5DS9 A;  2PQ8 A;  3OSF A;  5ICE A;  3ZQL A;  1LKX A;  5IP6 A;  3TW6 A;  4E7S A;  5FD6 A;  1HST A;  5H6R A;  1W5S A;  5CVJ A;  3OYB A;  1C0W A;  3QPH A;  2A05 A;  2Y48 A;  1WFX A;  2IAI A;  1FPQ A;  2EZH A;  2V1N A;  4IJA A;  1B4A A;  1SAN A;  3IAM 2;  2EZK A;  3WHB A;  1W5T A;  1R5I D;  4M73 A;  2F4O B;  2DCE A;  3S14 J;  3FXL A;  2DTZ A;  3QYE A;  4DGW B;  3ELK A;  4LMY A;  5D5V B;  1S7E A;  2ZB9 A;  3H3Z A;  2NVQ J;  4KMF A;  3TQN A;  1ZRE A;  4JBA A;  2EFQ A;  2BY3 A;  3P9K A;  4C3I J;  5E20 A;  4PGH A;  3S15 J;  3F8C A;  1FSH A;  4FIS A;  3CO7 C;  1BOA A;  2DJN A;  2EZI A;  1F43 A;  4D9J A;  2DFE A;  1V5F A;  4HG2 A;  3RI4 A;  3CTA A;  2GM4 A;  3LMM A;  2RN7 A;  2Y31 A;  5D5X B;  2JN6 A;  4KMU X;  3F23 A;  1T56 A;  5LHG A;  1FIP A;  2X9D A;  4UV8 A;  2ZFW A;  4RBO A;  4O3M A;  2AS5 F;  3DBH B;  4A3E J;  4M3G A;  1IF1 A;  3ERM A;  2KIM A;  3ZMZ A;  1O4X A;  1FZP B;  3PO2 J;  4XL9 A;  5IYC J;  1K78 B;  5D6F A;  4Y33 A;  3N05 A;  4NC8 A;  4IHX A;  3V42 A;  2V1U A;  3BR2 A;  3E0J B;  4C3H J;  1K4T A;  4CHU A;  3FMQ A;  2BW3 B;  3WE3 A;  4BJT A;  3OV8 A;  2WAQ N;  5JFR A;  2P81 A;  3F6V A;  2GLO A;  3CCE I;  3CMA I;  3RPU D;  5E1W A;  1FP1 D;  2OCC H;  3HSF A;  3C7J A;  3VYU B;  3L2U A;  5M5X J;  5F0H A;  4EGY A;  4IHY A;  2X51 A;  2XGC A;  2R7F A;  3S1Q J;  2FEZ A;  4LFU A;  4OMZ A;  1QQI A;  2RRE A;  1N77 A;  3LFK A;  4KN7 X;  2GXB A;  1JTY A;  2ZJQ F;  2XKO A;  1TNS A;  4LG0 A;  5HLI A;  1MBF A;  2K4J A;  4P9F A;  4OAZ A;  3CC4 I;  4IZZ A;  1OPC A;  1J75 A;  4I76 A;  1G8X A;  2FQ4 A;  2JMW A;  2V79 A;  3ASN H;  3FMS A;  2Q8K A;  4ESF A;  3CCM I;  1EF4 A;  3IWF A;  2XSJ C;  4GFB A;  3AL0 B;  5HLG A;  5EEG A;  3R4K A;  5D5U B;  4G7Z F;  3S1N J;  3Q0U A;  5J6X A;  4A5N A;  2ETH A;  4FQG A;  1YS7 A;  2DOD A;  2CW8 A;  1QZE A;  1K83 J;  2LKX A;  2CQQ A;  5LLQ A;  2EV0 A;  1WWX A;  2R7W A;  1G2H A;  3PIP F;  4IX7 A;  2CFO A;  2KRH A;  4BXF A;  3NAR A;  3L2C A;  3G71 I;  3RKX A;  2QEX I;  2GAU A;  3BR0 A;  2M0C A;  2KP6 A;  2CUJ A;  1JKR C;  5DDG A;  1TWH J;  2WC2 A;  1Z3X A;  2FUG 2;  2R7X A;  4WK8 F;  4MLO A;  4AVZ A;  4NBQ A;  4ZJZ A;  1X3U A;  2BY1 A;  2ZJR F;  1TW2 A;  1R58 A;  4JOM A;  2DMU A;  3MZY A;  3FHZ A;  2Q1Z B;  2YU3 A;  2CFX A;  1IDY A;  3DTI A;  5BQT A;  3GME A;  4CDG A;  5D5W B;  3TW7 A;  1ON1 A;  3PSI A;  3ZOB A;  3ECH A;  2IS4 A;  1VTN C;  2LTP A;  2DYR H;  4D5F A;  1OYI A;  1H9T A;  3U1D A;  2XAH A;  4FT8 A;  2M2E A;  4OIR F;  4OMY A;  3DF8 A;  3OL3 A;  5HLH A; 
#chains in the Genus database with same CATH homology
 5L3C A;  3DKW A;  3JSO A;  1ODD A;  3PFI A;  2Z3Y A;  2FRH A;  4HX7 A;  4R8H A;  1O7F A;  3LWF A;  5LEJ A;  2A3S A;  2MLK A;  4U7B A;  4HBL A;  5DV5 A;  1K7A A;  1I27 A;  1R23 A;  2Z99 A;  2B0L A;  2PG4 A;  3RKY A;  3P7N A;  1ZRD A;  5K5R A;  4R1H A;  2VOP A;  1UHM A;  2FSW A;  2VBX A;  2HKX A;  5ICC A;  1T38 A;  5DCM B;  1FYM A;  3HRT A;  1J0R A;  3T0Y A;  5DYM A;  4U7D A;  1PUE E;  2K02 A;  2FF4 A;  4AWX B;  1SMT A;  4GCV A;  1FYK A;  3QRF F;  1G3S A;  1W7P D;  4G7H F;  5CLS A;  3TOA A;  3ZN1 A;  4UVA A;  2L4M A;  5DD8 A;  3LST A;  3KP5 A;  4KA4 A;  3JAM K;  5DUI A;  1F4K A;  4EMS A;  2JRT A;  4ENM A;  2HQN A;  3HTU A;  2QQB A;  1R22 A;  5TJJ A;  2LF7 A;  1L3L A;  3FWE A;  2L54 A;  6PAX A;  1LNW A;  3WTT C;  1U2W A;  1YYV A;  3ZN0 A;  4A0Y A;  1TQM A;  4RAY A;  3KZZ A;  1OKR A;  4NHJ A;  5AON A;  5EEH A;  4U88 A;  3WTU C;  2E1C A;  1P4A A;  1P4W A;  3HIF A;  1ZAR A;  4I2O A;  3WTW C;  4AIH A;  4E70 A;  4HOB A;  2KIF A;  1V3F A;  1SFU A;  4ZYG A;  4I0B A;  1FYL A;  4BHC A;  1I5Z A;  2UWM A;  2PEX A;  2COM A;  3DP7 A;  1LVA A;  2QQ9 A;  2O0Y A;  2M30 A;  1ZG3 A;  5HS7 A;  1DP7 P;  1AWC A;  1BIA A;  3HTS B;  1BM9 A;  1YS6 A;  3QAH A;  1LJ9 A;  5CVR A;  2OA4 A;  4KNY A;  5DEQ A;  3GFJ A;  2F5C A;  1GXQ A;  5ILS A;  3CO6 C;  3T5X A;  2G9W A;  2LDU A;  4I7H A;  1ZH5 A;  4OIO F;  1HW2 A;  4MNU A;  3RPU A;  2QWW A;  2Y75 A;  4A2U A;  4KDP A;  3FM3 A;  5LGT A;  2P6S A;  3HRS A;  2FE3 A;  4ZYD A;  1O7L A;  3IC7 A;  1RUO A;  4JQF A;  4IHT A;  3RPQ A;  5ICF A;  2MA3 A;  2DU9 A;  1R1U A;  2ISZ A;  4ZH4 F;  2DW4 A;  2W85 A;  1XB4 A;  4KIF A;  4HX4 A;  2ISY A;  4KIG A;  2P6T A;  3LA2 A;  2V1D A;  4M74 A;  4XSZ F;  4TV7 A;  1UHW A;  3GEZ A;  1U5T B;  1F1Z A;  5L3G A;  2HTJ A;  1ZG5 A;  4GYI A;  3GWZ A;  3GVA A;  3KP4 A;  1D8K A;  2IA1 A;  4BYY A;  5ILV A;  3PQK A;  4AIK A;  3RYP A;  2Z9O A;  3SHF A;  4WXH A;  2EK5 A;  2PMU A;  5D4S A;  1IAW A;  4EVI A;  3EYY A;  2V6C A;  5TRD A;  1D3Y A;  2OQR A;  2JPC A;  3WOD F;  1DPR A;  4I0A A;  2JPB A;  4P5O A;  2XUB A;  3R6S A;  4ENK A;  3KET A;  2Q0O A;  4RGX A;  1K6O A;  5LBQ A;  1B9M A;  5BPD A;  2DK8 A;  3F8M A;  3W6K B;  1QZZ A;  2HR3 A;  2P5K A;  4LB5 A;  4IVN A;  3E5Q A;  2CO5 A;  3EQL F;  2D1V A;  2F5D A;  3EYI A;  4F7Z A;  4UUV A;  4GGG A;  4N9H A;  5FLX Z;  4N9I A;  1XGN A;  2RV8 A;  3G73 A;  2ACJ A;  1MDM A;  5CVU A;  3CUQ B;  4Y17 A;  2VBZ A;  1H0M A;  1YFH A;  1QBJ A;  4YIF A;  2HZT A;  3KP7 A;  2H27 A;  3I59 A;  4YFK F;  4HLX A;  1Z05 A;  4OU0 A;  1I6X A;  1FOK A;  1WSU A;  3JTG A;  5CVI A;  4OIP F;  2A6E F;  4GO1 A;  3R0J A;  4MGR A;  5A2Q K;  5E17 F;  2RNJ A;  1XDS A;  1J9I A;  3DPT A;  5LRR A;  2H94 A;  4KIC A;  1ON2 A;  1W7P A;  4L5J A;  4BXU A;  3FX3 A;  3MEX A;  1BI1 A;  1KQ9 A;  3LA3 A;  2HOE A;  4ENJ A;  1DPU A;  4BHB A;  3S2W A;  4FX0 A;  4YII A;  2NS0 A;  4ZZL A;  1RI7 A;  1YO5 C;  2P8T A;  1R1T A;  4CIC A;  2F5E A;  5L3B A;  1BI3 A;  4CYD A;  2DBB A;  3E6M A;  3U2R A;  4XSX F;  4GXO A;  2HFH A;  1Z6R A;  3ABT A;  4PCQ A;  4O5V A;  2IPQ X;  3M8F A;  1KQ0 A;  1S29 A;  2BE5 F;  5HS9 A;  3J81 K;  1AOY A;  3F22 A;  1EH6 A;  4WF2 A;  2IW5 A;  3J80 K;  4LD5 A;  2YX7 A;  3Q9S A;  3WG9 A;  5HDK A;  1T39 A;  2CGP A;  5F64 A;  2FBH A;  1R00 A;  1ZYR F;  2NNY A;  3IKT A;  3K69 A;  3KE2 A;  4LK0 F;  1H9G A;  1LEB A;  3CUQ C;  3E5X A;  1O3Q A;  3GFI A;  3V7C A;  3E6B A;  3TDZ C;  4RAZ A;  1R5H A;  4YG2 F;  4OIN F;  4AIJ A;  1LDK B;  2ZCW A;  3M9A A;  3O6B B;  3CUQ A;  1ZGJ A;  1YLF A;  2V9V A;  4EJT A;  1J7K A;  2W25 A;  1ZAO A;  4UNO A;  1S6L A;  2FBI A;  1OMI A;  4P55 A;  1T2K A;  2VBY A;  1U8R A;  4MQV A;  4EM2 A;  4M71 A;  1KU3 A;  2FBK A;  2UXX A;  3AAF A;  4ETS A;  4A5M A;  1IN8 A;  1G4D A;  4P9U A;  4U0V A;  5D4R A;  4M9Z A;  4UHT A;  5IT9 K;  2FQ3 A;  1MJ9 A;  3E6C C;  1FLI A;  2MC3 A;  5LEK A;  2A61 A;  3LQR A;  3CJN A;  1Z9C A;  3MQ0 A;  1G6N A;  2Z33 A;  1WI9 A;  1ONV A;  1SD6 A;  4ENN A;  1HW1 A;  1O57 A;  1JGS A;  2L01 A;  3HOT A;  1REP C;  1T98 A;  3RDI A;  4RB2 C;  1IZ1 A;  2VN2 A;  3V7R A;  3K1N A;  3F8B A;  1YQA A;  3I58 A;  4L9V A;  2W24 A;  1FBQ A;  1P6R A;  3FZV A;  1B59 A;  3COA C;  2ADU A;  1V4R A;  2ZME A;  4PGG A;  3ZQ7 A;  2BV6 A;  2GA1 A;  1STZ A;  3EDP A;  4M9S A;  1YW9 A;  1Z6T A;  4KYW A;  5J8C A;  1UB9 A;  4I98 B;  2MH2 A;  2PFB A;  3TO9 A;  3LQQ A;  2Z5U A;  5D8K B;  3BWG A;  2HYG D;  3JAM Z;  3HOS A;  2CQK A;  4BH9 A;  4CXF A;  1BC8 C;  1LEA A;  3W6J B;  4LK1 F;  4XLN F;  2HS5 A;  4LLL A;  4U0W A;  5BS6 A;  1FWZ A;  1IUY A;  2FA5 A;  4G94 A;  3L9F A;  1T0F A;  1PP8 F;  2H6B A;  3HHG A;  4LB6 B;  2YSR A;  1HKQ A;  1XN7 A;  3TO7 A;  4RGS A;  4MHG A;  4HLY A;  1B1B A;  3EET A;  3K9T A;  1ZN2 A;  1HKT A;  2A69 F;  1USS A;  1LDJ A;  2OD5 A;  3HSR A;  4G7O F;  1XD7 A;  2OU2 A;  1IN7 A;  5HS8 A;  1IXC A;  2M1B A;  2EV6 A;  4EM1 A;  1XSX A;  2GZW A;  5LGU A;  4A6E A;  2STT A;  2F5F A;  2OQG A;  1P92 A;  1IXR C;  3DFG A;  3IRQ A;  2PMH A;  4GYG A;  3N4M A;  2DT5 A;  1MKM A;  5FGM A;  2M45 A;  2ZNY A;  2XVC A;  3ZMT A;  4RB1 A;  2BBY A;  4OOI A;  4S04 A;  5LGN A;  2EJR A;  3MWM A;  4D0P A;  5KVR A;  1FY7 A;  1JHF A;  2X0L A;  4IRI A;  5HOO A;  4RGU A;  2XAG A;  5E8I A;  3MFK A;  5K5O A;  1KGS A;  2P4W A;  5FFX A;  4MEX F;  2VBW A;  4KN4 X;  5CJ9 A;  5BMZ A;  4AD9 A;  3E5U A;  4L9J A;  5IT3 A;  1J5Y A;  2CYY A;  5ED4 A;  1J59 A;  3KEO A;  3REO A;  2BEO A;  2NYX A;  1I1S A;  2EFW A;  1Z7U A;  3WTZ A;  2OZU A;  4IF4 A;  4HQM A;  4UXN A;  2Y0M A;  3PQJ A;  1MDM B;  1RZ4 A;  2MLG A;  3T1B A;  5FB2 A;  3CDH A;  3C3W A;  4BHP A;  3I59 B;  3KZY A;  1HQC A;  3GUD A;  3SZP A;  1E17 A;  3OOP A;  3CUO A;  1YW8 A;  3BY6 A;  2F2E A;  5FFZ A;  2P5V A;  3GX4 X;  4RB3 C;  2E1N A;  2IP2 A;  5F6F A;  3GYH X;  2E7X A;  2JSC A;  2MBF A;  2BGC A;  1YW7 A;  2QQA A;  3BZ6 A;  3B02 A;  4IPA A;  3L09 A;  2IA2 A;  1W7P B;  4HA8 A;  2HTS A;  1U3E M;  2E7W A;  5L3E A;  3WGI A;  2ESH A;  1XMA A;  3WTS C;  2LNB A;  2X4H A;  1IN6 A;  5JR3 A;  3V8J A;  2HEO A;  2A6H F;  2UXN A;  3NRV A;  1QNT A;  2QZ8 A;  3ERE D;  3TKY A;  2WWY A;  5J8F A;  1TNT A;  1YIO A;  2XAS A;  2KJB A;  1XMK A;  2UZK A;  2VC0 A;  2ZJ2 A;  1F5T A;  4P96 A;  3B73 A;  3ULQ B;  2BYV E;  4HYE A;  3O3K A;  3RKW A;  2KIU A;  3F21 A;  4HAM A;  4LJZ F;  1UCR A;  2NAZ A;  3GZ6 A;  3F8N A;  1GXP A;  2IJL A;  3G3Z A;  3RJP A;  2XV4 S;  4ZZD A;  3GO5 A;  1S8N A;  2MD5 A;  3F8F A;  1S7A A;  1SMY F;  4HF2 A;  3E97 A;  1ZRC A;  1O3R A;  3V8K A;  1YG2 A;  4I02 A;  2XAF A;  4KFC A;  1D8J A;  4I01 A;  2XKP A;  4IXA A;  4KIB A;  4R79 A;  2FOK A;  2G7U A;  2D45 A;  1KU9 A;  1U78 A;  5D6E A;  3ZMV A;  4EGZ A;  3J81 Z;  3DPL C;  5DCF A;  1OYY A;  1K79 A;  3J80 Z;  1JXS A;  4NQW A;  3GW2 A;  1BC7 C;  5E18 F;  2EFN A;  4HX8 A;  5LHI A;  2O8X A;  1XCV A;  3ROU A;  2VOO A;  4M6X A;  1MD0 A;  5E1X A;  3M1E A;  1KYW A;  1OYW A;  3FXR A;  2ZKZ A;  2HDC A;  1FC3 A;  4EJO A;  3KEQ A;  3GF2 A;  5H6Q A;  4QWQ A;  4YFN F;  4MTD A;  2NRA C;  2EV5 A;  1B9N A;  3DV8 A;  1EV7 A;  3M7G A;  3QU3 A;  3NQO A;  3VOD A;  2IA0 A;  4RGR A;  1KA8 A;  1LQ1 A;  1TLH B;  5JHU A;  2VC1 A;  3I71 A;  2GIV A;  3LA7 A;  2FU4 A;  3P9I A;  1SFX A;  1XCB A;  1HXD A;  4UV9 A;  4HV6 A;  4FX4 A;  4EJV A;  3K0L A;  2FNP A;  4XRF A;  3NEU A;  3WGH A;  2R7D A;  3V8L A;  4G8X A;  2ZNZ A;  2ZBK A;  1BN5 A;  2FXA A;  2EA2 A;  1IW7 F;  1TQI A;  4Q47 A;  1ZRF A;  3VFZ A;  2IT0 A;  2QM3 A;  2A07 F;  3HHH A;  5IT9 Z;  3FM5 A;  3MAJ A;  3QU6 A;  4JK1 X;  2P7C B;  2ZME B;  3EUH A;  3ZMD A;  1SD4 A;  3ABU A;  1ZLK A;  3FXQ A;  3WTY C;  3VEP A;  3ZP5 A;  1IN5 A;  4RS8 A;  2RDP A;  2HYF A;  3C1D A;  1FBU A;  1HKS A;  3JTH A;  4QLC U;  5L3D A;  3N97 A;  2CWE A;  3DQV C;  1GVJ A;  1KU2 A;  2XRO A;  1WQ2 A;  1LB2 A;  3H92 A;  1T6S A;  1LDD A;  1FSE A;  2CW0 F;  4CGZ A;  4A0Z A;  2M5W A;  1FX7 A;  2WV0 A;  1SAX A;  2XRN A;  4B09 A;  4YFX F;  2KJC A;  5HDN A;  3HRM A;  2PLY A;  2DI3 A;  4UVB A;  3LAP A;  3IKV A;  1Z1D A;  1QPM A;  2ZXJ A;  2GQQ A;  1MJB A;  3CLO A;  3BP8 A;  1MZB A;  1G3T A;  1PP7 U;  1BBY A;  3RIR A;  1GHC A;  4M9X A;  3HSE A;  1Q1H A;  2QVO A;  4RB0 A;  3GFM A;  3LAJ A;  3RTR A;  2DFI A;  3QP5 A;  3BDD A;  2VT3 A;  2PI0 A;  1DUX C;  4Q5S F;  5CVV A;  3BJO A;  1WKM A;  1MGT A;  1HW5 A;  1TQP A;  3TOB A;  1HBX G;  2DLL A;  4HF0 A;  3Q5F A;  5H20 A;  2EB7 A;  3L7W A;  2DPU A;  2KKO A;  3K1P A;  3HUG A;  4U0Y A;  1D5V A;  2K27 A;  2W57 A;  1JHH A;  1CGP A;  2FML A;  2OBP A;  1P2F A;  2J5O A;  3GLX A;  1IN4 A;  2L3D A;  4B8X A;  1FBS A;  4L0Z B;  1G3Y A;  1J2X A;  2XHK A;  1XGO A;  2K86 A;  1F9N A;  1R1V A;  3ISP A;  3ML6 A;  3R61 A;  3VOE A;  3F72 A;  2P7V B;  2GWR A;  1CF7 B;  1S7O A;  4LGW A;  1Z91 A;  1QO0 D;  4M72 A;  3T8T A;  3IWZ A;  4L9T A;  2M8E A;  1QGP A;  3U9G A;  2TDX A;  3BJA A;  4IRH A;  2RC4 A;  3GXO A;  1FT9 A;  3FXU A;  1ZG1 A;  3MCZ A;  4OIQ F;  3BPX A;  4XLP F;  1IRG A;  1HSJ A;  1DDN A;  4S05 A;  1SD7 A;  4ON0 A;  1BI0 A;  2H09 A;  3BJ6 A;  2YPR A;  2XIG A;  4ESJ A;  1K78 A;  1S3J A;  5AIQ A;  3HRU A;  4MTE A;  1YTY A;  2XAJ A;  3BRO A;  4BNC A;  4I09 A;  2DO7 A;  2EFO A;  2VXZ A;  1XGS A;  3I54 A;  4EM0 B;  2RKH A;  1OR7 A;  2CSO A;  4KT5 C;  4N0B A;  3T8R A;  2EWN A;  1W4M A;  3ECO A;  3K2Z A;  2OAZ A;  3SXY A;  5ICG A;  3C18 A;  4WCG A;  3IRR A;  4IHS A;  2V1X A;  3H3U A;  2W84 A;  3WU0 A;  2VOD A;  4DNC A;  3E3V A;  2DPD A;  2DQR A;  3WE2 A;  4LLN A;  2G7H A;  3FF5 A;  2M87 A;  4ZYH A;  2O03 A;  3KFW X;  3I0T A;  3KP2 A;  1A04 A;  4WWC A;  2O6G E;  3E6D A;  3Q9V A;  1R5G A;  1I1G A;  3IL2 A;  4ESB A;  2DTR A;  2MH9 A;  1UFM A;  4CZZ A;  3JW4 A;  3IHU A;  4CO8 A;  2AXL A;  1CF7 A;  4G6D A;  2DQL A;  3WTV C;  2LF8 A;  1NHA A;  2JT1 A;  2PN6 A;  4L0Y B;  2HQR A;  4WX9 A;  1XDU A;  2L02 A;  3KLO A;  4WXD A;  2GXG A;  4EQQ A;  2JTV A;  3MZH A;  5LRS A;  1RIO H;  5FO5 A;  5JVT A;  3QOP A;  3VB2 A;  5HVQ C;  1FP2 A;  3F6O A;  2J5P A;  1R36 A;  4HW0 A;  2QUF A;  1KYZ A;  1BJA A;  3SQN A;  1IXS B;  3J7A O;  2H6C A;  3TGN A;  4EV0 A;  1PDN C;  4HF1 A;  3DEU A;  4WXC A;  2HGC A;  1ZLJ A;  5K5Q A;  3D0S A;  4UVC A;  5DCM A;  2DK5 A;  3R60 A;  5AIP A;  4G6Q A;  5FD5 A;  2VE8 A;  1G3W A;  4HQE A;  3WTX C;  2XAQ A;  4K2E A;  1E2X A;  1ULY A;  3WU1 B;  4LLG F;  2QBY B;  3ZMS A;  4PZJ A;  1WRJ A;  5DD4 A;  3ZMU A;  1KU7 A;  4L5I A;  1EH8 A;  4EJW A;  3ZPL A;  3BPV A;  2RVC A;  3I4P A;  1ZHF A;  1XSD A;  2QYO A;  1ZGA A;  3I64 A;  2JZY A;  2IRF G;  4L9N A;  1O3S A;  2RGV A;  2GA2 A;  2EA4 A;  4Q48 A;  2PJP A;  2A5Y B;  5A2Q Z;  1O3T A;  3GZ5 A;  1JE8 A;  2CG4 A;  4MQ9 F;  2QLZ A;  2ESN A;  2YX4 A;  4Y13 A;  5E8G A;  2HKO A;  3F3X A;  3HYI A;  3RYR A;  4Z2Y A;  3BOQ A;  4ASN A;  3M8E A;  2O61 A;  4L18 B;  3SFZ A;  2VE9 A;  2LSO A;  3L00 A;  3V7S A;  2Q2E A;  4HDU A;  1U6G A;  3WGG A;  5F1R A;  5HDG A;  2FMY A;  2STW A;  3TO6 A;  2C6Y A;  2D2W A;  3KP6 A;  3GFL A;  4MEY F;  2EFP A;  3JSP A;  4NB5 A;  5KK1 A;  2NNN A;  2LKP A;  4A12 A;  3KLN A;  2L4A A;  2O3F A;  3I5U A;  1BI2 A;  4Y15 A;  3K1M A;  2IVM A;  4G9Y A;  2ZO4 A;  4BQA A;  1L0O C;  2VON A;  3R0A A;  1BIB A;  5ERI A;  1MJA A;  2K4B A;  4H0E A;  4A6D A;  2DAO A;  3KCC A;  1TW3 A;  4HDV A;  2D1H A;  2KRF A;  2HWV A;  5JI6 A;  4ZYE A;  4XBF A;  4A0X A;  1UST A;  2XGX A;  3V4G A;  3I53 A;  1B6A A;  4AVP A;  2A68 F;  5L3F A;  4HZF A;  2FNA A;  1TTY A;  1FNN A;  4M6Y A;  5K1Y A;  5LHH A;  5CYV A;  1RUN A;  4DQ2 A;  2OZ6 A;  2QBY A;  1Y0U A;  3D5L A;  5BPI A;  5BOX A;  5D8L B;  2R3S A;  4HV5 A;  3SZT A;  2K7L A;  1EH7 A;  5DUK A;  1U5T C;  1IRF A;  2RQP A;  2YR2 A;  4O6J A;  3FMR A;  4LG0 B;  2VT2 A;  4Q4Z F;  1TBX A;  1XSV A;  1RNL A;  3P9C A;  1SFE A;  3QP6 A;  3KP3 A;  4FHT A;  3O2P E;  2WTE A;  1U5T A;  1R7J A;  3QPT A;  5FLX K;  1KQ8 A;  4KUM A;  2P5L C;  4PDK A;  4IRG A;  1XGM A;  2PBI A;  5E1Z B;  2ELH A;  1SD5 A;  5ILU A;  3DXJ F;  1QZY A;  2QEN A;  4EJU A;  3TDU C;  1P4X A;  4BAY A;  2PQ8 A;  5ICE A;  5FD6 A;  1HST A;  5H6R A;  1W5S A;  5CVJ A;  1C0W A;  3QPH A;  2Y48 A;  1FPQ A;  4IJA A;  1B4A A;  1W5T A;  4M73 A;  3ELK A;  4LMY A;  5D5V B;  3H3Z A;  4KMF A;  3TQN A;  1ZRE A;  4JBA A;  2EFQ A;  3P9K A;  5E20 A;  4PGH A;  3F8C A;  1FSH A;  3CO7 C;  1BOA A;  3RI4 A;  3CTA A;  2RN7 A;  5D5X B;  4KMU X;  3F23 A;  5LHG A;  4UV8 A;  2ZFW A;  4O3M A;  2AS5 F;  1IF1 A;  2KIM A;  3ZMZ A;  1FZP B;  1K78 B;  5D6F A;  2V1U A;  4CHU A;  3FMQ A;  3WE3 A;  3OV8 A;  5JFR A;  3F6V A;  5E1W A;  1FP1 D;  3HSF A;  3C7J A;  4EGY A;  2R7F A;  2FEZ A;  4LFU A;  4OMZ A;  1QQI A;  3LFK A;  4KN7 X;  2GXB A;  1TNS A;  2XKO A;  4LG0 A;  5HLI A;  2K4J A;  4P9F A;  1OPC A;  1J75 A;  3FMS A;  2V79 A;  2Q8K A;  4ESF A;  3IWF A;  5HLG A;  5EEG A;  3R4K A;  5D5U B;  4G7Z F;  5J6X A;  4A5N A;  2ETH A;  1YS7 A;  5LLQ A;  2EV0 A;  1WWX A;  3L2C A;  3RKX A;  2GAU A;  5DDG A;  2WC2 A;  4WK8 F;  1X3U A;  1TW2 A;  1R58 A;  3MZY A;  3FHZ A;  2YU3 A;  2CFX A;  5BQT A;  5D5W B;  4CDG A;  1ON1 A;  3ECH A;  1VTN C;  1OYI A;  1H9T A;  3U1D A;  2XAH A;  4FT8 A;  4OIR F;  4OMY A;  3DF8 A;  5HLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...