2A61A

The crystal structure of transcriptional regulator tm0710 from thermotoga maritima
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
142
structure length
142
Chain Sequence
KQPFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKITSDLGKEKSSKILDYLKELKGVMERNFSKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transcriptional regulator Tm0710
publication title The crystal structure of transcriptional regulator Tm0710 from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Transcription
total genus 54
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2a61A00
4ENJA 4P5OA 4JK1X 2JZYA 4B09A 3RJPA 4I0BA 2D1VA 1L3LA 2QBYA 1BI1A 2FU4A 2F5DA 3LAPA 4G7ZF 4IHSA 2YX7A 2GWRA 4EJOA 3VB2A 3G73A 2UXNA 1U78A 2L3DA 3KFWX 5FD5A 4PGGA 5LBQA 4NB5A 5A2QK 2ZFWA 4KIBA 5KK1A 4M9XA 4LB6B 3MQ0A 3QAHA 3N4MA 4U7DA 1IXRC 2STWA 1EH8A 2L54A 1IW7F 4M74A 5HS7A 2EFNA 4G8XA 4AIKA 2BEOA 2HGCA 1NHAA 2DW4A 3B02A 4MNUA 2IPQX 1HQCA 1Y0UA 2RDPA 3PFIA 5D5UB 1R1VA 1JE8A 2EV6A 4IPAA 3ML6A 2HDCA 3QU3A 3WGHA 3V8LA 1UHWA 4PDKA 2WV0A 2A3SA 3O2PE 1CGPA 2P5VA 1ZN2A 2D2WA 2Q8KA 3R4KA 4XSXF 2Y48A 3GLXA 1REPC 3KP4A 4KICA 2HZTA 2K86A 2L4AA 1U5TA 4KA4A 1W7PB 3L00A 2DTRA 1K78A 3IL2A 3ROUA 5D5VB 3ERED 2E7XA 3WGIA 1TNSA 4ZYEA 1MJAA 3NEUA 3FXRA 5FD6A 3WTUC 2FOKA 4WF2A 1UFMA 2P7CB 5HOOA 4EM2A 3LQRA 4UV8A 5AONA 1ZYRF 4M73A 2IP2A 2O3FA 3GO5A 4HLYA 2DLLA 3R6SA 2QWWA 5A2QZ 1B59A 1ZLJA 3TO7A 5DD4A 3ZMZA 1KU2A 1KYWA 3FZVA 4HF1A 2EFWA 4P9UA 1MDMB 1WRJA 2BV6A 1J5YA 4JQFA 1FYLA 3RYPA 2WWYA 3S2WA 3CO6C 4HDVA 2C6YA 2GXGA 3BOQA 4OINF 5LHIA 3F8MA 5DUIA 3KLNA 2Z9OA 2LKPA 4O5VA 5HDGA 1XSXA 3GF2A 4HLXA 4XLPF 2RGVA 5DD8A 3V8JA 4WCGA 1J9IA 4HF0A 2ESHA 1QGPA 4KNYA 1XGNA 2OA4A 4YIFA 2HKXA 1FYMA 2EK5A 1FSHA 5DCMA 1I6XA 2GA1A 4HX7A 5E20A 4HF2A 1TW2A 1U8RA 1W7PA 3KP6A 4ESFA 1ZG5A 4MGRA 2FEZA 4LJZF 1W4MA 5HLIA 2HYFA 1W7PD 1OYWA 4MEXF 4L5JA 3P9KA 2Z3YA 3HHHA 3DQVC 1ZARA 3BZ6A 3F23A 4L9JA 3HIFA 2O6GE 4BH9A 4LLGF 3TKYA 2ZKZA 2HFHA 3C7JA 1RNLA 4G94A 1I1GA 1Z05A 2NNYA 4OMYA 3I5UA 2ZJ2A 2ACJA 4ETSA 3COAC 2EWNA 3HUGA 1XMKA 3JW4A 3O3KA 4A12A 1MDMA 2P4WA 4EM1A 5ICGA 1P4XA 3L09A 2YPRA 3HSEA 3W6KB 2OQGA 2DBBA 2XAFA 5LGUA 3F8BA 2O0YA 1YW8A 3ZP5A 5HS8A 2XROA 1LDJA 1FP1D 2O61A 2DK5A 2YSRA 1U2WA 3HRSA 4EVIA 1WWXA 4OU0A 4AVPA 3F3XA 3KETA 3GZ6A 2VBXA 3IRQA 5K5OA 1I27A 4O3MA 5ILUA 3T8RA 3JTHA 4L9VA 2QQ9A 4M6YA 2ZNZA 3BPVA 2BBYA 4DNCA 2NRAC 1D3YA 3J7AO 3J81K 1S7AA 2VT2A 1RUNA 2FBHA 5BOXA 3GYHX 5ICFA 1FOKA 4GXOA 1DUXC 2VONA 2UWMA 3FMSA 4U0YA 4A2UA 1TQMA 3R60A 1IN4A 4WXDA 3HTUA 2G7UA 5AIQA 4WX9A 3H3ZA 1SFEA 1K79A 1K6OA 4WXCA 3TO9A 3LA2A 4HX4A 5H6RA 4XLNF 3M8EA 2HKOA 2GXBA 3KP7A 2VN2A 2KIFA 3G3ZA 4I01A 1HBXG 1STZA 4ZYGA 4IRIA 4WWCA 1XD7A 2NYXA 3VODA 3LQQA 1TLHB 5L3BA 3QOPA 4L9TA 2ETHA 3KP2A 3CUQC 2M8EA 1K7AA 4LD5A 4AD9A 2ZXJA 3I59B 2EFQA 4RGSA 3GXOA 3RIRA 3CO7C 1T0FA 1Z9CA 3EYIA 4L5IA 5F1RA 2CGPA 2M1BA 4Y13A 2CSOA 1FYKA 3ULQB 3D0SA 4O6JA 5EEHA 1KU3A 4HOBA 1IRGA 3VEPA 4RAYA 4EV0A 3I54A 3FX3A 2PMUA 3J81Z 2ISYA 1T39A 2FBKA 1V4RA 3E97A 1G3YA 2HS5A 3CUQB 4EJVA 1BN5A 1EH6A 3K1NA 1MGTA 2YU3A 1USSA 2J5OA 2W84A 2XVCA 3K2ZA 1IN6A 2W25A 3WGGA 2VBYA 4HV5A 2L4MA 2P8TA 1ON2A 4RAZA 4UHTA 1J7KA 3ZN1A 3F72A 4Y15A 2E1CA 1YS7A 2CYYA 2PLYA 3W6JB 1G4DA 1XSVA 4S05A 1D8KA 4LMYA 1KYZA 4H0EA 1IXSB 4UVBA 2MLKA 4L9NA 1Z1DA 3IKTA 1LVAA 1MZBA 1P4AA 1CF7A 4KN4X 1YW7A 3DPLC 5CYVA 4A5MA 3I71A 4E70A 3FHZA 1JXSA 3F8FA 1IRFA 2XGXA 2BE5F 1TQPA 5HVQC 3C3WA 1D5VA 2RV8A 3I59A 2VE9A 3BROA 3HYIA 1S6LA 2QQAA 2ADUA 2XKOA 5L3GA 4XBFA 4HDUA 2JRTA 3NQOA 1HSTA 3FXQA 2M30A 3GWZA 1XCVA 1FPQA 1UCRA 5IT3A 2EFOA 5CVVA 2V9VA 3GW2A 3I58A 1E17A 2PMHA 1S3JA 1HKTA 4EJWA 1KQ8A 1KGSA 4N9HA 4UUVA 1LEAA 1TBXA 2K4JA 4M6XA 1ZRCA 3RTRA 4LLLA 2GA2A 4ZYHA 3FM3A 1QO0D 3P7NA 1W5SA 2R7FA 5TJJA 4HX8A 4KT5C 5J8CA 2IA1A 5D8KB 2IA2A 2JPBA 3BJ6A 3WTTC 3GEZA 3GFMA 2YX4A 4N0BA 1KQ0A 3DKWA 1L0OC 1XGOA 1S8NA 1USTA 3F21A 3HRMA 2V1XA 2Z99A 2H6CA 3GVAA 3T1BA 3BY6A 2DFIA 5ILVA 2PBIA 2ZMEB 4GO1A 2M45A 3C18A 5CVIA 2XHKA 3CTAA 2CWEA 2QLZA 3DXJF 3SQNA 4CYDA 4U7BA 2K02A 1FBSA 4KMFA 4I98B 3D5LA 3RPUA 1UHMA 4JBAA 5FFZA 1QZYA 1Z6TA 2PQ8A 2FQ3A 3K69A 4ENNA 1YYVA 2HEOA 1IUYA 4RB2C 2V1DA 2VOPA 2MD5A 3K1MA 1XGMA 4ESBA 3IWZA 4CHUA 3E5QA 2IT0A 1XCBA 2WTEA 1BC8C 4UNOA 2RNJA 4YFXF 1MJ9A 2DI3A 1KU9A 5BS6A 2OZ6A 3U2RA 3WTVC 2EFPA 1Z6RA 2F5CA 2XAHA 3U9GA 2FRHA 2M5WA 5CVJA 4A0YA 2H94A 5CJ9A 3MCZA 1G3TA 1BBYA 1T38A 2XAQA 2VBZA 4KYWA 4HYEA 1FT9A 1KU7A 3N97A 4PCQA 4HAMA 2X4HA 3FMRA 2FF4A 3NRVA 5FB2A 3MZYA 2O8XA 3FMQA 5CVRA 3T0YA 3VOEA 3V7CA 3MWMA 3TOBA 5LRSA 1YLFA 2NNNA 2QZ8A 2IRFG 3J80K 3BPXA 4R1HA 1IN7A 3GFIA 4PGHA 2ZNYA 4IVNA 4I0AA 3V7RA 5JVTA 2M87A 4ZH4F 4Y17A 2H09A 2VODA 1YIOA 5LHGA 5E1ZB 5J6XA 1S7OA 2OU2A 3EQLF 1HKQA 2DK8A 3JSPA 2XV4S 3WTZA 2D1HA 3HOTA 1BM9A 2CG4A 3F8CA 4QLCU 1PP8F 2E7WA 2HR3A 3ZMUA 2EV0A 4M71A 1R1TA 1ZLKA 3E6MA 5CLSA 4MHGA 4L18B 4P9FA 5F64A 2HWVA 2CQKA 4D0PA 5FO5A 1SD5A 1OR7A 4ESJA 1D8JA 1PDNC 2DAOA 2P6TA 5LGNA 1SD4A 5IT9Z 1F5TA 1P4WA 4AIJA 1TQIA 4M9SA 2PFBA 4MQVA 5D5XB 4NQWA 2PG4A 2F2EA 5K5RA 3DV8A 2KJCA 1FWZA 4IF4A 1O7LA 3WTSC 1BC7C 2Z33A 3F6VA 3I4PA 2A5YB 1X3UA 2HYGD 2FBIA 1F9NA 4KIGA 1LDKB 1O3TA 2QQBA 2XRNA 4Q5SF 2LF7A 3FXUA 1G3WA 1VTNC 2GAUA 4A5NA 4EGYA 1O3QA 1IAWA 3J80Z 1PP7U 4KDPA 5LEJA 2V79A 5E8GA 4K2EA 1A04A 4UXNA 2AS5F 3TOAA 1R22A 5LRRA 4ENMA 3SFZA 2BGCA 3Q5FA 2RKHA 4EM0B 3WTYC 1IN8A 3WTXC 2P7VB 1Z91A 3F6OA 3TO6A 2AXLA 5E8IA 1P2FA 2A07F 1QPMA 3DFGA 1J59A 2OAZA 4HA8A 1YFHA 1ZGJA 3GUDA 5E1WA 5K5QA 1RIOH 4BQAA 2CO5A 1S29A 4L0ZB 2FA5A 2R7DA 2A6HF 4LLNA 5JFRA 1R58A 3QP5A 4KN7X 1J75A 1AWCA 3LA3A 3VFZA 3BJOA 2QENA 1LDDA 1R5HA 1FZPB 4A0ZA 1LEBA 2B0LA 3TQNA 1G6NA 3EUHA 2VXZA 3I53A 3RKWA 1XMAA 3BP8A 3IRRA 5EEGA 4BHCA 4LG0B 4P55A 3F8NA 2ZO4A 1RZ4A 4CXFA 1SMYF 3FM5A 1B9NA 3L9FA 2ZBKA 3E3VA 1OYYA 5H6QA 4ZZLA 5ED4A 3CUOA 5LGTA 2QBYB 3TDUC 1V3FA 2A69F 4IRHA 1GXQA 5E1XA 1IF1A 4IRGA 2E1NA 2ISZA 2LSOA 4GGGA 4UVAA 2IA0A 4HQMA 4YFNF 2HQRA 4OMZA 3ZMTA 1OPCA 2RQPA 3ELKA 1B6AA 5BPDA 1F4KA 4YIIA 1F1ZA 3MEXA 2OD5A 4LK1F 3KEQA 4QWQA 3DPTA 2OBPA 5ILSA 2QUFA 3GFLA 1DPUA 2F5FA 1WI9A 2EV5A 3WODF 2UZKA 4F7ZA 2GIVA 4CO8A 1J2XA 2VE8A 3KE2A 3CLOA 3WG9A 3BWGA 2K27A 2MH9A 2KJBA 5DCFA 4RB3C 2ESNA 2HOEA 3T5XA 5DV5A 5D6EA 3E5XA 1R5GA 2DQRA 4HQEA 4G9YA 1XB4A 4PZJA 4EGZA 3IHUA 2XAJA 3WE2A 4OIQF 4A6DA 5DYMA 1YTYA 4Q48A 4HZFA 4LGWA 4Q4ZF 1OMIA 3GFJA 1OYIA 2RN7A 3DP7A 2VC0A 2K4BA 4AWXB 1K78B 2XUBA 1AOYA 2MA3A 1FSEA 1QNTA 1T2KA 1ZHFA 5HLGA 2P5LC 2DPDA 3Q9SA 1BI2A 2GZWA 1QBJA 4G6QA 1XGSA 3QU6A 1O7FA 1BIBA 3HHGA 3RYRA 2A6EF 1R36A 3V4GA 2J5PA 1ULYA 4U0WA 1WQ2A 2OZUA 3EETA 3PQJA 4KUMA 2DPUA 2ELHA 3IWFA 3K9TA 4FHTA 5KVRA 4ZYDA 1RUOA 1YG2A 3PQKA 1YS6A 4I09A 3H92A 5K1YA 2A68F 1O3SA 2PJPA 1OKRA 2VT3A 2IW5A 4OOIA 2TDXA 3KP3A 1R7JA 3C1DA 2V1UA 4AIHA 4CGZA 2UXXA 4FT8A 1TNTA 3MZHA 4A0XA 1SMTA 2HTSA 2JSCA 3JAMZ 4Z2YA 4MTEA 3CUQA 1MKMA 4HBLA 4FX0A 1B9MA 1BJAA 3LSTA 1TTYA 1KQ9A 3RDIA 1EV7A 1U6GA 1HKSA 2FNPA 3FWEA 2EA4A 5H20A 3RKXA 4WXHA 5DUKA 2FXAA 2DU9A 1ZREA 3ZN0A 3K0LA 4G7HF 2G7HA 3ZMDA 3M9AA 2LDUA 2DT5A 2JTVA 5AIPA 1H9GA 3B73A 2Z5UA 5LHHA 1YW9A 1C0WA 5DCMB 3REOA 4G7OF 1T6SA 4G6DA 1ZRFA 2K7LA 3LFKA 3KP5A 1B1BA 3ZPLA 2EJRA 1ON1A 3CJNA 1ZG3A 2D45A 2L01A 5JI6A 3M7GA 5BQTA 2O03A 5L3DA 1Q1HA 2Y0MA 3TGNA 4HW0A 2XKPA 3TDZC 1ZAOA 2XAGA 1QQIA 5D8LB 5ICCA 3LAJA 5ERIA 1BIAA 1R23A 4OIRF 1I1SA 5IT9K 3BDDA 4WK8F 3Q9VA 2XIGA 1PUEE 3K1PA 4YG2F 2DO7A 1SAXA 4CZZA 3MAJA 4ASNA 3DEUA 1I5ZA 1DDNA 3M8FA 4R79A 3ZQ7A 3R0JA 4OIOF 1HW1A 4P96A 2KKOA 3CDHA 3LWFA 2RVCA 5J8FA 2VBWA 5JR3A 2MLGA 1U3EM 2WC2A 4BAYA 2HQNA 4RGRA 3V8KA 1RI7A 5LLQA 3M1EA 5DDGA 2ZMEA 3ZMSA 4DQ2A 2DQLA 4RB0A 4ENKA 1FC3A 2FMYA 4CDGA 1BI0A 3EDPA 4LK0F 5E17F 2FNAA 1LQ1A 2HTJA 3E6DA 4CICA 1UB9A 2L02A 4YFKF 1HXDA 1SD7A 4I7HA 4MQ9F 4B8XA 2FMLA 2XASA 5HS9A 2STTA 3V7SA 5LEKA 3U1DA 4OIPF 1ZRDA 3KZZA 5FLXK 3KZYA 3QPHA 2W85A 2QM3A 4TV7A 2V6CA 4BHPA 2IJLA 2IVMA 1LB2A 3IC7A 1MJBA 2R3SA 1TW3A 5HLHA 1LNWA 2A61A 4RGUA 1GXPA 1XN7A 1HW5A 1WKMA 2H6BA 1JHHA 3KCCA 4RGXA 1P92A 3SXYA 4LB5A 3RI4A 2QVOA 4KIFA 4BNCA 2PN6A 3WE3A 2CW0F 4GCVA 3JTGA 1R1UA 2NAZA 4L0YB 1J0RA 1LJ9A 2KIUA 4BYYA 3E5UA 3ISPA 1G3SA 2W57A 1MD0A 5BMZA 1ZG1A 2LNBA 2NS0A 3O6BB 3OOPA 1HW2A 4UV9A 3SZTA 2JT1A 5F6FA 4RB1A 4Q47A 1FP2A 4EMSA 3QPTA 1DPRA 6PAXA 3R0AA 3KEOA 5FGMA 3BJAA 3E6CC 1JGSA 2MBFA 4HV6A 4FX4A 5E18F 1H0MA 4XRFA 3SZPA 3MFKA 5L3CA 4S04A 1IN5A 4N9IA 2OQRA 2BYVE 1T98A 1YO5C 2YR2A 5D4RA 3HSFA 5D6FA 1Z7UA 1XDUA 1IZ1A 1GVJA 4ON0A 2PEXA 3I0TA 3OV8A 1FLIA 5FLXZ 1W5TA 1BI3A 1SFXA 3HTSB 2VC1A 1FNNA 3E6BA 2P6SA 1BOAA 1FX7A 3H3UA 3QRFF 1B4AA 2VOOA 1GHCA 1EH7A 4XSZF 4U88A 2FSWA 3AAFA 2LF8A 2KRFA 2EA2A 2F5EA 3T8TA 3GX4X 4IHTA 4IJAA 4I02A 4GYGA 5DEQA 3L7WA 5D5WB 3LA7A 3GZ5A 5ICEA 1O57A 2ZCWA 4EJUA 2JPCA 4LFUA 1YQAA 3ABUA 1H9TA 3HRUA 1CF7B 5L3EA 3RPQA 3HOSA 3JSOA 4GYIA 4R8HA 2H27A 3WU0A 5HDKA 1KA8A 3HRTA 5D4SA 2G9WA 3RKYA 4MTDA 4RS8A 3R61A 2P5KA 1XSDA 4EJTA 4IXAA 1FBQA 1IXCA 3ABTA 1P6RA 1FBUA 5CVUA 4BXUA 5JHUA 2PI0A 4ZZDA 2FE3A 1SD6A 4U0VA 2RC4A 1DP7P 3P9IA 1WSUA 3EYYA 3QP6A 2MC3A 5FFXA 1ZH5A 2W24A 1XDSA 2Y75A 3SHFA 2Q2EA 1U5TC 3DF8A 1HSJA 1O3RA 4UVCA 3HSRA 3JAMK 3L2CA 3ECOA 5BPIA 1ONVA 2X0LA 2KIMA 4KFCA 4M9ZA 4EQQA 1QZZA 5L3FA 4BHBA 1SFUA 3ZMVA 1ODDA 4M72A 2COMA 1E2XA 3IKVA 3WTWC 5TRDA 1FY7A 4KMUX 2GQQA 3ECHA 4NHJA 3KLOA 2CFXA 1ZGAA 3P9CA 5HDNA 1U5TB 2EB7A 3FF5A 4LG0A 3I64A 1R00A 4I2OA 2MH2A 4MEYF 3WU1B 2Q0OA 1JHFA 2QYOA 4A6EA 3F22A
chains in the Genus database with same CATH superfamily
4ENJA 4D5FA 5H2FC 4P5OA 2LRDA 4BEHA 4XNFA 2QF7A 4JK1X 2JZYA 2R7VA 4IQ4A 4B09A 1ZGWA 3RJPA 4I0BA 5M5YJ 2D1VA 1L3LA 3OS0A 4B3XA 3CCSI 1JTYA 2QBYA 1BI1A 2FU4A 2COBA 2JRMA 5M5WJ 2GLOA 2F5DA 1GVDA 3LAPA 4G7ZF 2XC7A 1Y6IA 2HPMA 2KIQA 3QODA 4IHSA 4D7NA 2E1OA 2YX7A 2KQRA 2GWRA 4EJOA 4XONA 3VB2A 2Z16A 1Y8QB 2XPUA 3G73A 2UXNA 2QEXI 1U78A 2L3DA 3KFWX 5FD5A 4PGGA 2OPTA 5LBQA 4NB5A 4BUPA 5A2QK 1X2MA 2ZFWA 4KIBA 3CCMI 2WA0A 1T33A 5KK1A 1I3AA 3S1MJ 2GOMA 3BC8A 3CCJI 4M9XA 3KYLA 4LB6B 2VQCA 3MQ0A 3QAHA 5FKLA 3N4MA 1Z21A 4U7DA 2XGCA 3FXKA 1IXRC 3CP8A 1DU0A 2STWA 1EH8A 4B4CA 3S1NJ 2L54A 1IW7F 4M74A 2HU9A 2EFNA 4G8XA 4PJLA 5HS7A 4AIKA 2BEOA 5FKOA 2OTJI 2HGCA 1NHAA 5FJ8J 2DW4A 3B02A 3SYTA 4JOMA 4NBQA 4MNUA 2M34A 2CJJA 2IPQX 1HQCA 1Y0UA 3EPZA 2RDPA 3PFIA 3N05A 3CMYA 1B72B 3K10A 1P7IA 1R1VA 2M8GX 5D5UB 1JE8A 2PJRA 2EV6A 4IPAA 3ML6A 1WHUA 2HDCA 5F0CA 4CCOA 2NOJB 2VASA 3FK7A 3QU3A 4RM3A 3WGHA 3L2WA 3V8LA 1UHWA 3QWLA 1BL0A 3JRFA 4PDKA 2WV0A 2FD5A 2A3SA 2FX0A 1ETKA 3O2PE 2X1EA 2TRTA 2F6CA 1CGPA 2I10A 2P5VA 2P81A 1ZN2A 1JI8A 2D2WA 4EEFG 2Q8KA 2L0KA 1MBJA 3BQZA 3R4KA 3FIWA 4XSXF 2Y48A 1HDPA 2VKEA 3GLXA 1REPC 3KP4A 4KICA 2V6EA 2HZTA 4IHXA 2H1LA 2HDWA 2K86A 1MBEA 4UB8C 5C4JJ 2L4AA 3SDGA 1U5TA 4KA4A 1W7PB 3L00A 2DTRA 1AKHA 1K78A 4V2GA 3IL2A 3BTIA 4XKVA 1JKQC 2MYSA 3ROUA 5D5VB 3ERED 2E7XA 3WGIA 1TNSA 3PIPF 4ZYEA 1JJ6C 4E7KA 1MJAA 1MSFC 3OYNA 1R9TJ 3JRBA 1QRYA 3KIOA 1IC8A 3ERMA 3NEUA 3FXRA 5F04A 2K9QA 5FD6A 5KAIC 3ABKH 3OYKA 1HA8A 4GDFA 3WTUC 1FMVA 2FOKA 4WF2A 1UFMA 2P7CB 1G59A 2AXTC 5HOOA 3PSIA 4EM2A 3LQRA 4UV8A 3H0DA 5AONA 1ZYRF 4M73A 3CCLI 2DMQA 2IP2A 2O3FA 2K9NA 3HKZA 4CCKA 3GO5A 4HLYA 1F36A 2BW3B 2CQQA 2DLLA 3R6SA 2QWWA 3VYRB 5A2QZ 1EJ9A 1B59A 3ONQA 1Z0XA 1ZLJA 1W0UA 4XL9A 4YEJA 3TO7A 1MNEA 9ANTA 3ZQLA 5DD4A 3Q0WA 3JRCA 2WADA 3ZMZA 1KU2A 1KYWA 4HNVA 1XS9A 4XICA 2AQEA 3S3MA 4ANJA 2LFBA 3FKJA 3FZVA 4HF1A 2EFWA 2WAQN 3G1OA 1WRJA 5EZHA 1WJFA 3HC7A 4P9UA 4YELA 1BW6A 2BV6A 1GUUA 4NQWB 3CP2A 2DA3A 1TL8A 1OCTC 1J5YA 4JQFA 2H8RA 1FYLA 3RYPA 2WWYA 3S2WA 3CO6C 1FMWA 4XLHA 2HVQA 1T56A 4ITVA 3LSJA 4HDVA 2C6YA 2GXGA 1A6QA 4OWRB 3BOQA 2CW7A 2VJIA 3D1NI 3ZQHA 4MLOA 2FQ4A 3AG4H 4OINF 5LHIA 3F8MA 2XB5A 5DUIA 3KLNA 2Z9OA 2XAUA 1MMAA 4NC8A 2LD5A 2M7BA 2LKPA 3M1CA 1TWFJ 2X6YA 1VQOI 2VQHA 4O5VA 4XLEA 5HDGA 1XSXA 1RRJA 3GF2A 3CDLA 4HLXA 4XLPF 2RGVA 5DD8A 3V8JA 2R93J 4D1QA 4WCGA 1J9IA 4HF0A 1XMXA 3G1MA 2XSDC 2K85A 2ESHA 1QGPA 3GTLJ 1QVUA 4KNYA 1XGNA 3GCMA 3M3YJ 2OA4A 2XDVA 4YIFA 1A5JA 2HKXA 1FYMA 2EK5A 2OTLI 1YOVB 3DKYA 1WH5A 2M4GA 1FSHA 5DCMA 1I6XA 3RZOJ 3S2DJ 2GA1A 3IUOA 4HX7A 5E20A 4HF2A 1TW2A 3C2BA 2E1MC 2R7QA 2ZXHA 1W7PA 1QVTA 2GIZA 1U8RA 3KP6A 5B1BH 4ESFA 2L7KA 1ZG5A 2E2HJ 1MBKA 2FEZA 4MGRA 5J40A 4ABZA 2R0QC 4XKCA 4LJZF 1W4MA 5HLIA 3TP0A 2CV1A 2HYFA 3GMEA 1W7PD 4PJ0C 1N77A 2DA7A 1OYWA 2WB1N 5GTHC 2HOAA 3BLYA 4HNUA 4L5JA 4MEXF 2NVQJ 2DMTA 3S14J 3P9KA 2Z3YA 3HHHA 3DLAA 4JX6A 3DQVC 1ZARA 4N4NB 3BZ6A 3S1QJ 1QA6A 3BZCA 3F23A 1GV5A 4L9JA 4AC0A 3HIFA 3OIPA 2O6GE 4BH9A 2VL8A 3GTPJ 4A3LJ 4LLGF 1XX5A 3TKYA 2DMPA 1VQ4I 2ICWG 3OYBA 2ZKZA 4RDUA 2HFHA 3C7JA 4CCMA 1RNLA 4G94A 3PO2J 1I1GA 1IDYA 1Q1VA 1Z05A 5JHFA 3SEQA 2NNYA 3QPLA 4OMYA 2EZIA 1OJLA 1T95A 3I4MJ 3I5UA 3LSPA 2ZJ2A 2ACJA 2E1MB 4ETSA 3COAC 3A0HC 2EWNA 3HUGA 1XMKA 1T08B 3JW4A 5C3EJ 3QPSA 3O3KA 2HOSA 4M3FA 1WJAA 5EDNA 5FRMA 4A12A 1MDMA 3PFYA 1JT0A 2P4WA 2W7NA 1W5CC 2ECBA 4EM1A 5ICGA 1P4XA 2W4SA 4E6KG 3LMMA 2DJNA 1LE8B 3L09A 2YPRA 1WCMJ 3HSEA 2OV7A 3W6KB 2OQGA 2DBBA 2XAFA 5LGUA 3F8BA 4IHVA 2O0YA 1YW8A 2EIJH 3ZP5A 4B44A 3UR3C 5HS8A 2XROA 2MABA 3OY9A 2KRCA 2JUGA 1LDJA 4RM2A 2XB0X 1FP1D 4A3EJ 2O61A 2DK5A 2YSRA 1U2WA 4AUXA 4F92B 4DJAA 2X6OA 3HRSA 4EVIA 1WWXA 5EZGA 4OU0A 2R7ZJ 2DOAA 4PFOA 3EUKL 5JVGF 3S16J 4AVPA 3K7AJ 3F3XA 4J00A 3KETA 1S9HA 2DCEA 3GZ6A 4GFBA 3GTKJ 2R5YB 3K4MA 4AM3A 2VBXA 3HG9A 3IRQA 3OWTA 1OCZH 5K5OA 1I27A 4O3MA 5ILUA 3O8GA 3T8RA 1BR1A 3JTHA 3J7ZI 4L9VA 2QQ9A 2RAEA 4M6YA 2ZNZA 3BPVA 5HNHA 4J01A 2BBYA 1X58A 5IP7J 4DNCA 4X0GA 3HXLA 2NRAC 3OR2C 4KISA 1D3YA 2E19A 3J7AO 5IOYA 2VLAA 3J81K 2CW8A 2Z1DA 1Z77A 3P5JA 1S7AA 2VT2A 3BR0A 2OJED 1H8AC 2R92J 1RUNA 3IH2A 1RPWA 2FBHA 5BOXA 5ICFA 1Y56A 3GYHX 1FOKA 4GXOA 1NK2P 2PMZA 4UUTA 3JR9A 1DUXC 3HDDA 4HRIA 2NVTJ 4BQQA 1WFXA 1XPXA 2VONA 2UWMA 3JREA 3FMSA 4U0YA 3W2AA 4A2UA 1P9QC 1TQMA 3VYTB 3R60A 3DKXA 2EZLA 1IN4A 4WXDA 3HTUA 4BS9A 2G7UA 5AIQA 4WX9A 5EJCA 3H3ZA 1SFEA 4C30A 1K79A 1JKPC 4XOPA 2E71A 4WXCA 1K6OA 3TO9A 1YITI 1JKOC 4E7SA 3LA2A 4HX4A 5H6RA 4XLNF 1Z7LA 3WHCA 2L5QA 3K70D 1ETVA 3M8EA 2HKOA 2GXBA 3G1LA 2VN2A 3KP7A 3I56I 3Q3SA 1YX3A 4LG3A 3CESA 2IGMA 2RNGA 1MBGA 5M5XJ 1HF0A 2KIFA 4RLQA 2LBFA 4DYQA 3G3ZA 4I01A 1HBXG 1STZA 4ZYGA 4FISA 4IRIA 3H36A 4WWCA 3HZJA 1XD7A 2NYXA 3VODA 3HOYJ 4KITB 2CS3A 3LQQA 4BY1J 3RQ4A 4DIQA 4ZTJA 3H0GJ 3A4CA 2JJ7A 1OCCH 1TLHB 5L3BA 3QOPA 4L9TA 2ETHA 3KP2A 3PUFA 3CUQC 2M8EA 4BY7J 1K7AA 3ASOH 4LD5A 2DFFA 4AD9A 1A31A 2ZXJA 3QYBA 3IH3A 1VQ5I 1UMQA 3I59B 2EFQA 3BTJA 3C2GA 2LOOA 4RGSA 5E79C 2CH0A 2O9LA 3GXOA 3RIRA 1GLNA 3ZR8X 4HG2A 1BA5A 3CO7C 4AVZA 1T0FA 3HPHA 1Z9CA 4IOCF 1WI3A 3CC7I 4NC7A 2VIXA 2ME6A 1LFUP 4BACA 3EYIA 1NG6A 2VUMJ 1ZK8A 4DYCA 4L5IA 2B63J 4BXXJ 5F1RA 2R4GA 2CGPA 5B1AH 1WJCA 2M1BA 4A3DJ 1GDTA 4Y13A 1S72I 2CSOA 2BXZA 1FYKA 3ULQB 3D0SA 4O6JA 3TP3A 5EEHA 2F5VA 5DM6F 1KU3A 4HOBA 1IRGA 4E7IA 3VEPA 4A3FJ 1YRNB 4RAYA 3L2RA 2MD0A 3CJQB 4EV0A 3HKZN 3I54A 3BTLA 3FX3A 4M3DA 2PMUA 3K4KA 3IAM2 3J81Z 3CF5F 2ISYA 3W2VA 2M4KA 1V5FA 1T39A 4A3GJ 2FBKA 5F08A 1V4RA 1P7JA 3E97A 1G3YA 2HS5A 3CUQB 4EJVA 2DMUA 1BN5A 2KLOA 1I39A 3BG3A 4G6TB 1MMNA 2ZC2A 1EH6A 1Y8RB 5GAEJ 3K1NA 1MGTA 2YU3A 1USSA 2OC6A 2J5OA 1VI0A 2W84A 2XVCA 4FE7A 1MNMC 2X85A 5F0HA 4CCJA 3K2ZA 1IN6A 2W25A 3WGGA 4BJ6C 2VBYA 4HV5A 2DDAA 2L4MA 4JX5A 4DZJA 2CV2A 1NG7A 2P8TA 4ZC3A 5K7ZA 1ON2A 2K9MA 3RZDJ 4RAZA 4UHTA 4C2UA 4IZZA 4S0HB 1MW7A 3RSNA 1J7KA 3ZN1A 1TWHJ 4OAZA 4FCYA 3SFIA 3F0CA 1ETOA 3F72A 3U21A 4Y15A 1WZ2A 2E1CA 3HOZJ 1YS7A 1VQPI 2CYYA 2DA4A 3A1YA 3BT9A 2PLYA 5GADJ 2VKHA 4HSTA 3W6JB 1A6IA 1G4DA 1XSVA 4S05A 1D8KA 1N75A 5B66C 4LMYA 1KYZA 1U9OA 4H0EA 1IXSB 4UVBA 4QPQA 2JA5J 2MLKA 4L9NA 5C44J 3KEYA 1Z1DA 3IKTA 1LVAA 1MZBA 3LSKA 1P4AA 1CF7A 1UG0A 4KN4X 1YW7A 4XRSA 3DPLC 5CYVA 4A5MA 4DBQA 1SVLA 2KL4A 4LOCA 4MFEA 3I71A 4E70A 2R7TA 3FHZA 5IP9J 2HVSA 2JWTA 1JXSA 3W2WA 3F8FA 3DLLF 1IRFA 3I9V2 5TISC 2XGXA 4RBOA 2I5UA 1A35A 1UZCA 3OSGA 2BE5F 3WU2C 3I4NJ 1TQPA 5HVQC 1R4NB 2XSJC 4X6AJ 2V4JC 3C3WA 1D5VA 2IEKA 2RV8A 3HGYA 3I59A 3M4OJ 2VE9A 2Y9ZA 3BROA 3HYIA 1PUFB 1E3PA 1S6LA 4NUBA 2H8WA 2QQAA 2ADUA 3FXMA 1VFCA 4B48A 3S32A 2XKOA 5L3GA 4XKWA 1W36C 4XBFA 4HDUA 2XPVA 1OISA 2JRTA 3NQOA 4IO9F 1HSTA 3FXQA 3QQAA 4BE2A 2M30A 3ZQGA 2QSGX 2IGOA 2H1KA 3GWZA 1XCVA 1FPQA 1UCRA 2WY7Q 2EFOA 5CVVA 2V9VA 5IT3A 1V5GA 3GW2A 3I58A 2ZMEC 2PMHA 2DN0A 2QGUA 4V19K 4A3KJ 1E17A 4BKXA 1S3JA 3LSHA 1HKTA 3PL8A 4EJWA 5EGOA 1KGSA 4N9HA 4UUVA 1KQ8A 4JP0A 1LEAA 1TBXA 2BVMA 2K4JA 3FXOA 3LL7A 2LK2A 4M6XA 5KCMA 1W1WE 3RTRA 3VPRA 1ZRCA 5FRNA 4LLLA 2GA2A 3IP4B 2BY0A 5IOZA 2XGDA 2HNHA 2MGQA 4ZYHA 2R7UA 3FM3A 1QO0D 3P7NA 3HOXJ 1IDZA 1W5SA 2R7FA 5TJJA 4CYCA 2ZB9A 2CUEA 4F55A 4HX8A 4KT5C 5J8CA 2IA1A 5D8KB 1UG2A 3UKGA 2IA2A 1IV8A 2JPBA 3BJ6A 3WTTC 3GEZA 1Y1VJ 4XMYA 2Y2ZA 3GFMA 3PNTA 2KMUA 2YX4A 4RAFA 4N0BA 1Z3YA 1JUPA 3ASNH 4M3BA 1WGXA 3V42A 4F93B 1KQ0A 1ETWA 3AG3H 3DKWA 1K6YA 1L0OC 1XGOA 1S8NA 2NVYJ 2CUZA 1USTA 3F21A 2BY3A 3HRMA 1OR7C 2V1XA 2Z99A 2H6CA 3GVAA 1OCOH 3K4JA 2MSYA 3TW7A 3T1BA 3BY6A 2DFIA 5ILVA 2DT7B 1A36A 2PBIA 1Y39A 2ZMEB 4GO1A 2M45A 3ZXSA 3CDIA 3C18A 5CVIA 2XHKA 1I50J 1CQTA 3CTAA 4ZJZA 2CWEA 1V54H 4XQFA 2QLZA 3DXJF 3SQNA 3IH4A 2IXSA 4CYDA 4U7BA 2K02A 2CRGA 3D5SC 1FBSA 4KMFA 4I98B 3D5LA 2LTPA 4PJNA 3RPUA 3NAUA 5K7FA 1UHMA 4JBAA 5FFZA 2MFZA 1QZYA 1Z6TA 2WBMA 1FEXA 2PQ8A 1T8IA 3GLLA 2FQ3A 3K69A 4ENNA 2DA5A 1YYVA 2WV1A 2HEOA 1IUYA 3RPUD 4RB2C 3KYDB 2V1DA 2VOPA 2MD5A 2NXNB 3BCAA 3K1MA 1XGMA 1RESA 1VNDA 4ESBA 1YE9A 3IWZA 2L7ZA 1MSEC 4CHUA 3E5QA 2IT0A 1XCBA 3OYMA 2M9HA 2WTEA 1BC8C 4BE1A 1VQ7I 4I6ZA 2YS9A 2JUCA 4UNOA 2RNJA 4YFXF 1MJ9A 1X3WB 2DI3A 1KU9A 3K4NA 5BS6A 3LSRA 2OZ6A 3U2RA 2PMZN 3WTVC 2EFPA 1Z6RA 2XAHA 1WJEA 2F5CA 2VXDA 4Y7NJ 2Y69H 4HEA2 2GOXB 3U9GA 2FRHA 1ETYA 2M5WA 5CVJA 3OL4A 4A0YA 1X19A 3VSLA 2H94A 5CJ9A 1X2NA 1FJLA 1LFPA 1ZQ3P 3MCZA 1G3TA 3HGGA 2XF7A 4PSXA 1BBYA 1T38A 2XAQA 2VBZA 1IO2A 4LIUA 1B72A 4IHYA 2LLKA 4BBRJ 4KYWA 4HYEA 1FT9A 1KU7A 3N97A 2Y0SA 4PCQA 4ZYAA 4HAMA 2X4HA 3FMRA 5LFAA 2FF4A 3NRVA 5FB2A 3MZYA 3OOUA 2O8XA 2LMDA 1YJNI 3WG7H 3FMQA 5CVRA 3K6GA 3BG7A 3T0YA 3V7CA 3VOEA 1FTTA 3MWMA 3TOBA 5LRSA 1YLFA 2NNNA 2QZ8A 2IRFG 3J80K 5EEAA 1FIPA 3BPXA 3AL0C 1EKEA 4MO7A 2KZGA 2WAEA 4R1HA 1IN7A 3GFIA 4QIWN 4PGHA 2E2JJ 4MIMA 2ZNYA 3EUHC 4IVNA 4D5CA 2FUG2 4I0AA 3V7RA 5JVTA 2M87A 2CUFA 2Z2SB 4ZH4F 4Y17A 2H09A 3GBGA 3I3LA 3NWTA 3HOVJ 3RQIA 2VODA 1PYVA 1YIOA 5LHGA 5E1ZB 3BR3A 5EF6A 5J6XA 3H5NA 2QSHX 2V7FA 1S7OA 2OU2A 3EQLF 3TMOA 1HLVA 1HKQA 2DK8A 3JSPA 2XV4S 4L5EA 2D1HA 3WTZA 3HOTA 3CC4I 3MMYB 5F1JA 1BM9A 2CG4A 1BR4A 2CU7A 1RR8C 4V2FA 1DQUA 3F8CA 4QLCU 1PP8F 2HQ5A 2E7WA 2HR3A 4Z6YA 3J7AY 3ZMUA 2EV0A 2KPMA 2KZVA 5E3NA 4XRMA 4M71A 1R1TA 3CCVI 1ZLKA 3E6MA 3K2AA 5CLSA 4MHGA 4L18B 4P9FA 3E1SA 2X6WA 5F64A 3AL0B 1JT6A 2R7SA 2HWVA 3AG2H 2CQKA 2BW3A 4D0PA 5FO5A 1SD5A 4KT6A 1OR7A 5BNGA 4ESJA 1PDNC 1D8JA 4E7LA 2DAOA 1R71A 2A05A 1VQ8I 1X1AA 2P6TA 5LGNA 2AQFA 3VYSB 1VQ6I 5HLTA 1SD4A 4CCNA 5IT9Z 4MFDA 1F5TA 1P4WA 5E3OA 4HSRA 4AIJA 2V9KA 1TQIA 3OR1C 4LITA 3Q0UA 5IYDJ 3W6VA 5J3LA 4M9SA 5F27A 2PFBA 4MQVA 5EG0B 5D5XB 4II2A 4NQWA 2PG4A 3C2HA 1ZELA 1YJWI 2W48A 2F2EA 2BVLA 2VPLA 3CCQI 5K5RA 2EH3A 3DV8A 2KJCA 2TCTA 1FWZA 2DYRH 1WPKA 4IF4A 2LKSA 3HPGA 4XM3A 1O7LA 2K9SA 3WTSC 1BC7C 4IQJA 2KISA 2Z33A 3F6VA 3I4PA 2A5YB 5J1YA 1X3UA 2DODA 2HYGD 2FBIA 1F9NA 4KIGA 4XLCA 1LDKB 2VKVA 1U9NA 2X1CA 1O3TA 2QQBA 2XRNA 3ESWB 2KRHA 4BE0A 4Q5SF 1SFKA 2LF7A 3FXUA 3CCYA 5CQGA 1G3WA 2JA6J 1VTNC 2GAUA 1D0XA 4A5NA 4EGYA 1O3QA 4IL6C 4E7ZA 4PUSA 5FROA 1IAWA 3J80Z 5GAHJ 4DZPA 1PP7U 3S93A 4KDPA 2VJ4A 5LEJA 2V79A 2CUJA 3KYCB 5E8GA 3JCUC 4K2EA 1A04A 3BQYA 4BQOA 1EA3A 3X2QH 1V5EA 4UXNA 3TOAA 2AS5F 3K4CA 1R22A 5LRRA 1OFCX 4ENMA 1Z3XA 3DTEA 3SFZA 4DOZA 2V1NA 1AHDP 3HEFA 2BGCA 3Q5FA 1HDDC 3H1CA 5KAFC 2RKHA 1SC7A 4EM0B 3L2UA 3DU6A 2K3FA 3FHNA 3WTYC 1RKWA 1IN8A 1LKXA 3GZNB 3H5AA 3WTXC 2Q2EB 4UUSB 1ZTRA 1QHHD 2P7VB 1Z91A 3F6OA 2ECCA 3TO6A 2AXLA 5E8IA 1ZR4A 1P2FA 4BXFA 4II3A 2A07F 1QPMA 3DFGA 3S2HJ 1J59A 2OAZA 2LR8A 2KT0A 4HA8A 1YFHA 1KZHA 2M0MA 2UUZA 2MW8A 1ZGJA 3GUDA 5E1WA 5K5QA 1RIOH 4BQAA 2CO5A 1S29A 4L0ZB 2FA5A 2EPFA 2R7DA 4CCLA 4W97A 2A6HF 3M8JA 4RLFA 4LLNA 3HOWJ 5JFRA 1H89C 3QOEA 1R58A 3VDXA 5GTIC 3QP5A 1E3HA 4GRIA 2BHYA 3JRIA 4KN7X 1U0JA 1J75A 2NVXJ 1AWCA 3LA3A 1OLTA 3BJOA 1RR7A 3VFZA 2QENA 1LDDA 1D1CA 5EYRA 1D0ZA 1R5HA 4BU2A 2M3AA 2JK3A 1FZPB 4A0ZA 4C3JJ 1LEBA 2B0LA 3TQNA 2NS8A 1G6NA 2R5ZB 3EUHA 2VXZA 4RA2A 1MBHA 5FLVA 2DFEA 3DEWA 3ZRGA 4CSWA 2DOEA 1IV6A 3OYIA 3I53A 2N8GA 3RKWA 1IUFA 1XMAA 3BR6A 1DGWY 1VQKI 3BP8A 1S7EA 1QHGA 3IRRA 4M3EA 3NARA 5EEGA 4UB6C 2WY8Q 4BHCA 3NWSA 4LG0B 4P55A 1DGRM 3F8NA 2ZO4A 5J47A 1RZ4A 5IP6A 2BHZA 1SVOA 4N4OB 4DBRA 4C3HJ 2HQAA 1LE8A 4CXFA 1VQ9I 4M6VA 3S3NA 5LD2C 1LVKA 1SMYF 3FM5A 1B9NA 2L9RA 4C9YA 3L9FA 3QYFA 2ZBKA 3E3VA 3G6EI 2M7AA 1YX5A 5JLWA 1OYYA 5H6QA 4ZZLA 5ED4A 3JRDA 3CUOA 3PNVA 2DJIA 5LGTA 2HXOA 2QBYB 3TDUC 1V3FA 2A69F 4IRHA 1OCRH 3A0BC 2NVUB 1GXQA 4QTRA 2Y31A 5E1XA 1IF1A 1XC5A 4IRGA 4A3BJ 2E1NA 2ISZA 2OF7A 2LSOA 5DTDA 4GGGA 4UVAA 2Y9YA 2IA0A 4HQMA 2MC4A 4YFNF 5CPRB 4UY8I 1VF9A 1K61A 4C3IJ 2HQRA 4OMZA 1X1BA 3ZMTA 1TZLA 1OPCA 2RQPA 1KONA 1ZR2A 2XGEA 4PFPA 2HZDA 2KP6A 4XLAA 2XRLA 2R5YA 1ERDA 1E0EA 3ELKA 1B6AA 5BPDA 4X1EA 2HI3A 2L9SA 1F4KA 2IS2A 2ZFUA 2KDZA 4YIIA 1F1ZA 3MEXA 2OD5A 4LK1F 1YHQI 4ZDPA 3KEQA 4QWQA 2BOLA 2E35A 4BDZA 3F9KA 3DPTA 3FBNB 2OBPA 3LSIA 3MD2A 4CH7A 2JMWA 1SFOJ 5ILSA 2QUFA 3GFLA 1E3OC 1DPUA 2EQRA 4B1RA 2F5FA 1HOMA 5GPAA 1WI9A 2EV5A 3WODF 2LG4A 2ID6A 4XOTA 2UZKA 2EZKA 4F7ZA 3AG1H 3DCFA 3MKWB 2GIVA 2X51A 4CO8A 1J2XA 2VE8A 3KE2A 3CLOA 3WG9A 3BWGA 2K27A 2MH9A 4B43A 5B3SH 2KJBA 2PJRB 5DCFA 4RB3C 2ESNA 2HOEA 3B6CA 3OYDA 1LPQA 3T5XA 1UAAA 2W1OA 5DV5A 4D9JA 5D6EA 3MKLA 3OYGA 3E5XA 2O8KA 1R5GA 2DQRA 1U8BA 2CMPA 1YJ9I 3CMEI 3PM1A 4CA0A 4HQEA 4Y4RA 4G9YA 1UELB 1XB4A 4PZJA 2DXIA 4Y52J 5FKKA 4EGZA 1J09A 2AHQA 1SAUA 3KZIC 3IHUA 3CF2A 2HYJA 2XAJA 3CMMA 1D1BA 2O5RA 3FXJA 3WE2A 3K4LA 4OIQF 2R5ZA 4A6DA 5DYMA 3H3VK 2Y0SN 2ID3A 1MDMB 3CZ6A 2X6XA 4Q48A 1YTYA 4HZFA 4LGWA 4Q4ZF 3LNQA 1OMIA 5J1RA 3GFJA 1OYIA 5CKTA 2RN7A 3DP7A 2JVHA 1IRXA 2VC0A 1TWAJ 2K4BA 2K5CA 1AKHB 4AWXB 1K78B 2XUBA 4HNTA 1DU6A 1AOYA 2MA3A 4M3GA 4RAGA 2EZHA 5JLXA 4NDLA 3CQZJ 4XR6A 1FSEA 1QNTA 3S8PA 1T2KA 1ZHFA 5HLGA 2P5LC 2DPDA 3Q9SA 5DS9A 1BI2A 3A01B 2YU9J 2GZWA 1QBJA 4HPQA 4YIRX 2QSFX 4G6QA 2LC2A 1XGSA 1Z67A 2EIMH 1O7FA 3QU6A 1APLC 4ZDOA 1MIJA 1BIBA 3HHGA 4NC6A 1WH7A 3RYRA 5IY5H 5GP9A 2A6EF 3OYAA 1R36A 2L9VA 3V4GA 2J5PA 1ULYA 4C2MJ 3IV5A 4U0WA 1WQ2A 3FDYA 2OZUA 3EETA 3PQJA 4KUMA 3OMYA 3BR5A 1IGNA 2DPUA 2ELHA 1RKTA 3IWFA 3K9TA 4FHTA 4BJTA 5KVRA 4ZYDA 1NH3A 1RUOA 1YG2A 4BQNA 3PQKA 1YS6A 4I09A 2LY1A 3H92A 5K1YA 1ACIA 1VQNI 2A68F 3CD6I 4H4KC 1O3SA 2PJPA 3ZOBA 1OKRA 2VT3A 3G4SI 2IW5A 3OYFA 4OOIA 1VZ0A 3CCRI 2TDXA 3KP3A 5IPAA 3E7LA 1R7JA 2ELKA 3C1DA 2FJ1A 1YRNA 1TP4A 2V1UA 4AIHA 4CGZA 2K3PA 2VQLA 2UXXA 2RREA 4FT8A 1TNTA 5IYBJ 4A0XA 3MZHA 4XN3A 1SMTA 2HTSA 2JSCA 1ENHA 3OIOA 1X4OA 2DDBA 3G2BA 3JAMZ 5GPCA 2R7XA 3ZCOA 4Z2YA 3LOCA 4MTEA 1YI2I 3CUQA 3A03A 1MKMA 2QKLB 4FX0A 4HBLA 1B9MA 3PIOF 1BJAA 3LSTA 4F91B 5M3MJ 2X1DA 3KPHA 1FOXA 1TTYA 1KQ9A 3RDIA 3LFUA 3MVPA 1EV7A 1U6GA 1HKSA 2FNPA 3FWEA 2EA4A 1BR2A 5H20A 3RKXA 3MKZA 4WXHA 1FOYA 5DUKA 1I6HJ 2FXAA 3H5RA 1WJDA 2DU9A 2LREA 1ZREA 2G0EA 3ZQQA 3ZN0A 4DGWB 3K0LA 1RC9A 2B9SA 1X1DA 1MBFA 4G7HF 2G7HA 1K83J 4E7JA 3ZMDA 4JX4A 3M9AA 2LDUA 2DT5A 1LFBA 3TEDA 2JTVA 3S1RJ 5AIPA 1H9GA 2E34A 3B73A 2Z5UA 4BL0B 5K7HA 5LHHA 1YW9A 1C0WA 2ZXWH 1PVEA 3L2QA 2CFOA 2VI6A 4IHWA 5DCMB 3I55I 3PO3J 3REOA 4G7OF 1T6SA 4G6DA 1ZRFA 2K7LA 3LFKA 3KP5A 1B1BA 1IRZA 2EILH 3DPUA 2EBIA 1JJ8C 3H9JA 4AYBA 4PJJA 2JN6A 3ZPLA 2EJRA 1ON1A 3HB9A 3CJNA 2LYCA 4OAYA 2JA8J 1ZG3A 2A5WA 1YIJI 1JKRC 4YRVA 2D45A 2L01A 5JI6A 5DM7F 3SJMA 3EUAA 3M7GA 5BQTA 5J4VA 3A01A 2O03A 3S15J 2ZSIB 5L3DA 4EATA 1LUJB 1F43A 1Q1HA 2F4IA 2Y0MA 2XF5A 3TGNA 4HW0A 1H88C 3DEEA 2WAFA 2XKPA 1K4TA 3TDZC 1PJRA 3GTOJ 1ETQA 1ZAOA 3E0JB 3AFHA 1W0TA 4IX7A 1PUFA 2XAGA 1QQIA 5D8LB 4A3JJ 3H35A 3KX2A 5ICCA 3LAJA 3MZ8A 5ERIA 3L1PA 1VQMI 1BIAA 1R23A 2L9NA 4OIRF 3PUBA 1K4SA 5IT9K 1I1SA 3BDDA 2CQNA 4WK8F 3Q9VA 2XIGA 2ZJPF 1XTAA 1PUEE 3BCBA 4FE4A 3ZQFA 3K1PA 2M0CA 3HOUJ 1MNDA 4YG2F 3ABMH 1OQYA 4A93J 1TWGJ 3ZQCA 1AA7A 1NK3P 2JVGA 3SDBA 2DO7A 2K40A 1SAXA 4CZZA 3MAJA 4U87A 4ASNA 5GAGJ 3DEUA 1I5ZA 1D1AA 4QSHA 1DDNA 2GBYA 3HUGB 3M8FA 4R79A 1X4PA 1I3QJ 4A69C 3ZQ7A 3Q0VA 1UHSA 3U1KA 3R0JA 4OIOF 1TWCJ 4W1UA 2LVSA 2W82A 1HW1A 4P96A 2KKOA 2R7OA 3CCEI 3CDHA 3OYJA 3LWFA 2LH9A 2RVCA 3S17J 3OIQA 4I99C 5IYCJ 4ZTFA 5J8FA 3GTGJ 2VBWA 4A3CJ 3OYEA 2IAIA 5JR3A 2MLGA 1U3EM 1AU7A 2WC2A 4BAYA 2HQNA 4RGRA 3V8KA 4FASD 1WJ5A 1RI7A 4XIDA 1QU3A 2AO9A 2BY1A 2VJJA 5LLQA 4E4HA 3VWBA 2ZSHB 1S5LC 1WJBA 3M1EA 3DBLB 1W36D 5DDGA 3H9QA 5TGTA 2ZMEA 3ZMSA 2V26A 3A02A 4DQ2A 3OS1A 2DQLA 4RB0A 4ENKA 1FC3A 2FMYA 2VPRA 3K70C 4CDGA 1BI0A 3EDPA 2O7OA 2F4OB 2HOTA 4LK0F 5E17F 3ZGKA 1TC3C 2FNAA 1LQ1A 2HTJA 4G12A 5E3MA 3E6DA 4CICA 1UB9A 2L02A 4YFKF 1HXDA 2F4MB 1SD7A 4I7HA 4MQ9F 4B8XA 2E60A 1ITYA 2FMLA 2XASA 2HVRA 2KDOA 2QA4I 3H9GA 3MKYB 3ZQIA 5HS9A 4DYRA 2BXYA 2STTA 4CUGA 3V7SA 2NOGA 2E5NA 5LEKA 2VKDA 2W00A 3K4BA 2QQ8A 2VJ5A 3U1DA 1X1PA 1Y1WJ 3CJRB 4OIPF 1ZRDA 1N78A 3KZZA 5FLXK 3KZYA 3QPHA 2W85A 2QM3A 4TV7A 2V6CA 4BHPA 5FKMA 2IJLA 2IVMA 1LB2A 3ABLH 4A3MJ 3IC7A 3AKZA 1MJBA 2R3SA 1TW3A 5HLHA 1LNWA 2BY2A 4B47A 3GTJJ 2A61A 4RGUA 1T0FC 4LIVA 1GXPA 1FOWA 1XN7A 1HW5A 2VQGA 2ZJRF 1WKMA 4RMNA 2LP0A 2H6BA 1JHHA 3KCCA 3S3OA 3FISA 4RGXA 1P92A 2EINH 4NNJA 3SXYA 3OYHA 3GTMJ 2P0WA 4LB5A 3RI4A 2QVOA 4KIFA 5FLMJ 4BNCA 2PN6A 2RQQA 2CQ7A 3JRAA 1V55H 2R7WA 2OUMA 3WE3A 3RKQA 3PNYA 2LBFB 5E3LA 2CW0F 4GCVA 4BGDA 4PSWA 5HODA 3JTGA 1R1UA 2DFHA 3TW6A 4IOAF 1DP3A 3SZGA 3OL3A 2NAZA 4L0YB 2OCCH 1UJ8A 2FOWA 1J0RA 1LJ9A 2EIKH 2KIUA 4BYYA 3E5UA 1R49A 3ISPA 2XPWA 1G3SA 2W57A 3BR2A 1MD0A 1JUSA 2ZJQF 5BMZA 1ZG1A 2LNBA 2NS0A 3O6BB 3OOPA 5CQEA 2LKXA 2IS6A 4XKBA 1HW2A 4UV9A 3IAS2 3SZTA 4FQGA 2JT1A 5F6FA 4FETA 4RB1A 4Q47A 1FP2A 3JRHA 4E7HA 3DWLE 4EMSA 1R5ID 3QPTA 1DPRA 6PAXA 1MMGA 3R0AA 3KEOA 4I76A 1GT0C 2QCOA 1R6RA 2GXAA 1NTCA 3DTIA 5FGMA 3BJAA 3E6CC 1JGSA 2HDDA 5KHDA 2MBFA 4HV6A 1JGGA 1X3ZB 2B7EA 4FX4A 5E18F 1H0MA 2K9LA 4XRFA 2DTZA 3UNGC 3SZPA 5J4YA 3DBRB 4F52A 1D0YA 5B5EC 5L3CA 3MFKA 4S04A 1IN5A 4N9IA 2UV1A 3CCUI 2OQRA 4XORA 2BYVE 3DTKA 3WHBA 3CLQA 1T98A 3HM5A 3RCOA 1YO5C 1IG7A 2YR2A 5D4RA 3HSFA 1TT5B 3QYEA 5D6FA 1ZKGA 2LY2A 1Z7UA 1XDUA 1IZ1A 1GVJA 4ON0A 2PEXA 3I0TA 2E2IJ 3OV8A 4XN0A 1FLIA 1SEUA 1HCRA 2ME0A 1W5TA 5FLXZ 2E5ZA 2D5VA 2VB6A 1BI3A 4AIDA 4CZCA 3G71I 1B8IB 1SFXA 1R4MB 5F0FA 3HTSB 2VC1A 1FNNA 2E36A 4PJMA 3E6BA 2P6SA 3BR1A 2WAQA 1BJZA 3D5RC 1BOAA 1FX7A 3H3UA 1OCPA 3OSFA 3QRFF 1B4AA 3BZKA 2VOOA 1GHCA 1EH7A 2IBDA 3BG6A 2JSPA 4XSZF 4IKFA 1GV2A 4U88A 3GTQJ 1SVMA 2FSWA 2HPIA 3AAFA 2LF8A 4Y3OA 1EF4A 1POGA 3BG9A 2KRFA 2Q1ZB 2YUSA 2EA2A 2F5EA 3T8TA 3GX4X 4IHTA 2IGNA 2QKMB 4IJAA 4I02A 2DA1A 4GYGA 3DBHB 5DEQA 3L7WA 4B3AA 2DOFA 3LA7A 5D5WB 3A2KA 3GZ5A 5ICEA 1O57A 2ZCWA 2HXIA 5EG0A 4Y33A 4EJUA 2JPCA 4LFUA 1ORKA 1QPIA 1YQAA 3ABUA 3DU5A 1H9TA 2DYSH 3TL4X 1G2HA 3HRUA 1CF7B 3HBLA 4AU7A 2I8DA 1VQLI 2XF6A 5L3EA 3PJRA 2KHMA 4BEHB 2KFDA 3RPQA 3HOSA 3JSOA 4GYIA 3CMAI 1QZEA 4R8HA 2H27A 3WU0A 1FTZA 5HDKA 5FKNA 2JQ7A 1KA8A 4FTHA 3O8HA 3CC2I 3HRTA 5KNLA 5D4SA 2G9WA 3RKYA 4MTDA 4PK4A 4RS8A 3R61A 1BOBA 2P5KA 1G8XA 1XSDA 4EJTA 1MH4A 1SANA 4IXAA 1MMSA 1FBQA 2IS1A 2BZTA 1IXCA 3MN2A 3ABTA 1P6RA 1FBUA 5CVUA 4F3QA 3VYUB 1FIAA 4QPOA 4BXUA 2OCEA 2DA2A 4ZDLA 5JHUA 2PI0A 4ZZDA 1HC8A 3W3CA 2FE3A 1SD6A 1JUMA 1O4XA 4U0VA 3BTCA 2RC4A 4AYBN 1DP7P 2ELJA 3P9IA 3L2VA 3LSGA 1WSUA 3EYYA 4P1WA 4DW6A 2MG4A 2WB1A 3QP6A 1D5YA 2DT6A 2MC3A 5FFXA 2NS7A 1ZH5A 4IEJA 4J19A 3FXLA 2IS4A 2W24A 1XDSA 4C2TA 2JA7J 3TBIA 2Y75A 3SHFA 2Q2EA 5M3FJ 1U5TC 3M07A 4UUSA 3DF8A 3CJTB 1HSJA 1O3RA 4UVCA 3OYLA 2R7RA 5EGOB 2V9PA 4KJZA 3HSRA 3JAMK 1RETA 4BDYA 3VSKA 4D7MA 2Y30A 1IJWC 3L2CA 4XK4A 3ECOA 2LY9A 1BW5A 5BPIA 1ONVA 2GM4A 2X0LA 2DA6A 1MMDA 3PSFA 1JTXA 2KIMA 4XRSG 4KFCA 4M9ZA 4EQQA 4CYCB 1QZZA 5L3FA 1XG1A 3SEZA 2X48A 4BHBA 1SFUA 1N25A 3OS2A 2IGKA 4A3IJ 2X9DA 3LSMA 3ZMVA 3B6AA 1ODDA 4M72A 3J7YJ 1B8IA 3HL2A 2COMA 3BG5A 1E2XA 3IKVA 3FBIB 3WTWC 2JA2A 2CV0A 5TRDA 4BJ5C 1FY7A 2L2OA 1Y0NA 5J1UA 4KMUX 2GQQA 3ECHA 4JYKA 4NHJA 2M2EA 5C4XJ 2ZXIA 3KLOA 3FK6A 2CFXA 1ZGAA 2CQXA 3FKIJ 3P9CA 5HDNA 1U5TB 2EB7A 3FF5A 1MH3A 1M1EB 4BBSJ 1WVRA 4XLFA 3OYCA 4LG0A 3I64A 1R00A 2A6TA 3JRGA 4I2OA 2L7FP 2MH2A 4MEYF 2DMNA 5HNFA 3WU1B 2Q0OA 2L7MP 1JHFA 2PX9A 2F48A 2QYOA 3HJEA 1ETXA 4A6EA 3F22A 1TT0A 1X1CA
chains in the Genus database with same CATH topology
4ENJA 4P5OA 4JK1X 2JZYA 4B09A 3RJPA 4I0BA 2D1VA 1L3LA 2QBYA 1BI1A 2FU4A 2F5DA 3LAPA 4G7ZF 4IHSA 2YX7A 2GWRA 4EJOA 3VB2A 3G73A 2UXNA 1U78A 2L3DA 3KFWX 5FD5A 4PGGA 5LBQA 4NB5A 5A2QK 2ZFWA 4KIBA 5KK1A 4M9XA 4LB6B 3MQ0A 3QAHA 3N4MA 4U7DA 1IXRC 2STWA 1EH8A 2L54A 1IW7F 4M74A 5HS7A 2EFNA 4G8XA 4AIKA 2BEOA 2HGCA 1NHAA 2DW4A 3B02A 4MNUA 2IPQX 1HQCA 1Y0UA 2RDPA 3PFIA 5D5UB 1R1VA 1JE8A 2EV6A 4IPAA 3ML6A 2HDCA 3QU3A 3WGHA 3V8LA 1UHWA 4PDKA 2WV0A 2A3SA 3O2PE 1CGPA 2P5VA 1ZN2A 2D2WA 2Q8KA 3R4KA 4XSXF 2Y48A 3GLXA 1REPC 3KP4A 4KICA 2HZTA 2K86A 2L4AA 1U5TA 4KA4A 1W7PB 3L00A 2DTRA 1K78A 3IL2A 3ROUA 5D5VB 3ERED 2E7XA 3WGIA 1TNSA 4ZYEA 1MJAA 3NEUA 3FXRA 5FD6A 3WTUC 2FOKA 4WF2A 1UFMA 2P7CB 5HOOA 4EM2A 3LQRA 4UV8A 5AONA 1ZYRF 4M73A 2IP2A 2O3FA 3GO5A 4HLYA 2DLLA 3R6SA 2QWWA 5A2QZ 1B59A 1ZLJA 3TO7A 5DD4A 3ZMZA 1KU2A 1KYWA 3FZVA 4HF1A 2EFWA 4P9UA 1MDMB 1WRJA 2BV6A 1J5YA 4JQFA 1FYLA 3RYPA 2WWYA 3S2WA 3CO6C 4HDVA 2C6YA 2GXGA 3BOQA 4OINF 5LHIA 3F8MA 5DUIA 3KLNA 2Z9OA 2LKPA 4O5VA 5HDGA 1XSXA 3GF2A 4HLXA 4XLPF 2RGVA 5DD8A 3V8JA 4WCGA 1J9IA 4HF0A 2ESHA 1QGPA 4KNYA 1XGNA 2OA4A 4YIFA 2HKXA 1FYMA 2EK5A 1FSHA 5DCMA 1I6XA 2GA1A 4HX7A 5E20A 4HF2A 1TW2A 1U8RA 1W7PA 3KP6A 4ESFA 1ZG5A 4MGRA 2FEZA 4LJZF 1W4MA 5HLIA 2HYFA 1W7PD 1OYWA 4MEXF 4L5JA 3P9KA 2Z3YA 3HHHA 3DQVC 1ZARA 3BZ6A 3F23A 4L9JA 3HIFA 2O6GE 4BH9A 4LLGF 3TKYA 2ZKZA 2HFHA 3C7JA 1RNLA 4G94A 1I1GA 1Z05A 2NNYA 4OMYA 3I5UA 2ZJ2A 2ACJA 4ETSA 3COAC 2EWNA 3HUGA 1XMKA 3JW4A 3O3KA 4A12A 1MDMA 2P4WA 4EM1A 5ICGA 1P4XA 3L09A 2YPRA 3HSEA 3W6KB 2OQGA 2DBBA 2XAFA 5LGUA 3F8BA 2O0YA 1YW8A 3ZP5A 5HS8A 2XROA 1LDJA 1FP1D 2O61A 2DK5A 2YSRA 1U2WA 3HRSA 4EVIA 1WWXA 4OU0A 4AVPA 3F3XA 3KETA 3GZ6A 2VBXA 3IRQA 5K5OA 1I27A 4O3MA 5ILUA 3T8RA 3JTHA 4L9VA 2QQ9A 4M6YA 2ZNZA 3BPVA 2BBYA 4DNCA 2NRAC 1D3YA 3J7AO 3J81K 1S7AA 2VT2A 1RUNA 2FBHA 5BOXA 3GYHX 5ICFA 1FOKA 4GXOA 1DUXC 2VONA 2UWMA 3FMSA 4U0YA 4A2UA 1TQMA 3R60A 1IN4A 4WXDA 3HTUA 2G7UA 5AIQA 4WX9A 3H3ZA 1SFEA 1K79A 1K6OA 4WXCA 3TO9A 3LA2A 4HX4A 5H6RA 4XLNF 3M8EA 2HKOA 2GXBA 3KP7A 2VN2A 2KIFA 3G3ZA 4I01A 1HBXG 1STZA 4ZYGA 4IRIA 4WWCA 1XD7A 2NYXA 3VODA 3LQQA 1TLHB 5L3BA 3QOPA 4L9TA 2ETHA 3KP2A 3CUQC 2M8EA 1K7AA 4LD5A 4AD9A 2ZXJA 3I59B 2EFQA 4RGSA 3GXOA 3RIRA 3CO7C 1T0FA 1Z9CA 3EYIA 4L5IA 5F1RA 2CGPA 2M1BA 4Y13A 2CSOA 1FYKA 3ULQB 3D0SA 4O6JA 5EEHA 1KU3A 4HOBA 1IRGA 3VEPA 4RAYA 4EV0A 3I54A 3FX3A 2PMUA 3J81Z 2ISYA 1T39A 2FBKA 1V4RA 3E97A 1G3YA 2HS5A 3CUQB 4EJVA 1BN5A 1EH6A 3K1NA 1MGTA 2YU3A 1USSA 2J5OA 2W84A 2XVCA 3K2ZA 1IN6A 2W25A 3WGGA 2VBYA 4HV5A 2L4MA 2P8TA 1ON2A 4RAZA 4UHTA 1J7KA 3ZN1A 3F72A 4Y15A 2E1CA 1YS7A 2CYYA 2PLYA 3W6JB 1G4DA 1XSVA 4S05A 1D8KA 4LMYA 1KYZA 4H0EA 1IXSB 4UVBA 2MLKA 4L9NA 1Z1DA 3IKTA 1LVAA 1MZBA 1P4AA 1CF7A 4KN4X 1YW7A 3DPLC 5CYVA 4A5MA 3I71A 4E70A 3FHZA 1JXSA 3F8FA 1IRFA 2XGXA 2BE5F 1TQPA 5HVQC 3C3WA 1D5VA 2RV8A 3I59A 2VE9A 3BROA 3HYIA 1S6LA 2QQAA 2ADUA 2XKOA 5L3GA 4XBFA 4HDUA 2JRTA 3NQOA 1HSTA 3FXQA 2M30A 3GWZA 1XCVA 1FPQA 1UCRA 5IT3A 2EFOA 5CVVA 2V9VA 3GW2A 3I58A 1E17A 2PMHA 1S3JA 1HKTA 4EJWA 1KQ8A 1KGSA 4N9HA 4UUVA 1LEAA 1TBXA 2K4JA 4M6XA 1ZRCA 3RTRA 4LLLA 2GA2A 4ZYHA 3FM3A 1QO0D 3P7NA 1W5SA 2R7FA 5TJJA 4HX8A 4KT5C 5J8CA 2IA1A 5D8KB 2IA2A 2JPBA 3BJ6A 3WTTC 3GEZA 3GFMA 2YX4A 4N0BA 1KQ0A 3DKWA 1L0OC 1XGOA 1S8NA 1USTA 3F21A 3HRMA 2V1XA 2Z99A 2H6CA 3GVAA 3T1BA 3BY6A 2DFIA 5ILVA 2PBIA 2ZMEB 4GO1A 2M45A 3C18A 5CVIA 2XHKA 3CTAA 2CWEA 2QLZA 3DXJF 3SQNA 4CYDA 4U7BA 2K02A 1FBSA 4KMFA 4I98B 3D5LA 3RPUA 1UHMA 4JBAA 5FFZA 1QZYA 1Z6TA 2PQ8A 2FQ3A 3K69A 4ENNA 1YYVA 2HEOA 1IUYA 4RB2C 2V1DA 2VOPA 2MD5A 3K1MA 1XGMA 4ESBA 3IWZA 4CHUA 3E5QA 2IT0A 1XCBA 2WTEA 1BC8C 4UNOA 2RNJA 4YFXF 1MJ9A 2DI3A 1KU9A 5BS6A 2OZ6A 3U2RA 3WTVC 2EFPA 1Z6RA 2F5CA 2XAHA 3U9GA 2FRHA 2M5WA 5CVJA 4A0YA 2H94A 5CJ9A 3MCZA 1G3TA 1BBYA 1T38A 2XAQA 2VBZA 4KYWA 4HYEA 1FT9A 1KU7A 3N97A 4PCQA 4HAMA 2X4HA 3FMRA 2FF4A 3NRVA 5FB2A 3MZYA 2O8XA 3FMQA 5CVRA 3T0YA 3VOEA 3V7CA 3MWMA 3TOBA 5LRSA 1YLFA 2NNNA 2QZ8A 2IRFG 3J80K 3BPXA 4R1HA 1IN7A 3GFIA 4PGHA 2ZNYA 4IVNA 4I0AA 3V7RA 5JVTA 2M87A 4ZH4F 4Y17A 2H09A 2VODA 1YIOA 5LHGA 5E1ZB 5J6XA 1S7OA 2OU2A 3EQLF 1HKQA 2DK8A 3JSPA 2XV4S 3WTZA 2D1HA 3HOTA 1BM9A 2CG4A 3F8CA 4QLCU 1PP8F 2E7WA 2HR3A 3ZMUA 2EV0A 4M71A 1R1TA 1ZLKA 3E6MA 5CLSA 4MHGA 4L18B 4P9FA 5F64A 2HWVA 2CQKA 4D0PA 5FO5A 1SD5A 1OR7A 4ESJA 1D8JA 1PDNC 2DAOA 2P6TA 5LGNA 1SD4A 5IT9Z 1F5TA 1P4WA 4AIJA 1TQIA 4M9SA 2PFBA 4MQVA 5D5XB 4NQWA 2PG4A 2F2EA 5K5RA 3DV8A 2KJCA 1FWZA 4IF4A 1O7LA 3WTSC 1BC7C 2Z33A 3F6VA 3I4PA 2A5YB 1X3UA 2HYGD 2FBIA 1F9NA 4KIGA 1LDKB 1O3TA 2QQBA 2XRNA 4Q5SF 2LF7A 3FXUA 1G3WA 1VTNC 2GAUA 4A5NA 4EGYA 1O3QA 1IAWA 3J80Z 1PP7U 4KDPA 5LEJA 2V79A 5E8GA 4K2EA 1A04A 4UXNA 2AS5F 3TOAA 1R22A 5LRRA 4ENMA 3SFZA 2BGCA 3Q5FA 2RKHA 4EM0B 3WTYC 1IN8A 3WTXC 2P7VB 1Z91A 3F6OA 3TO6A 2AXLA 5E8IA 1P2FA 2A07F 1QPMA 3DFGA 1J59A 2OAZA 4HA8A 1YFHA 1ZGJA 3GUDA 5E1WA 5K5QA 1RIOH 4BQAA 2CO5A 1S29A 4L0ZB 2FA5A 2R7DA 2A6HF 4LLNA 5JFRA 1R58A 3QP5A 4KN7X 1J75A 1AWCA 3LA3A 3VFZA 3BJOA 2QENA 1LDDA 1R5HA 1FZPB 4A0ZA 1LEBA 2B0LA 3TQNA 1G6NA 3EUHA 2VXZA 3I53A 3RKWA 1XMAA 3BP8A 3IRRA 5EEGA 4BHCA 4LG0B 4P55A 3F8NA 2ZO4A 1RZ4A 4CXFA 1SMYF 3FM5A 1B9NA 3L9FA 2ZBKA 3E3VA 1OYYA 5H6QA 4ZZLA 5ED4A 3CUOA 5LGTA 2QBYB 3TDUC 1V3FA 2A69F 4IRHA 1GXQA 5E1XA 1IF1A 4IRGA 2E1NA 2ISZA 2LSOA 4GGGA 4UVAA 2IA0A 4HQMA 4YFNF 2HQRA 4OMZA 3ZMTA 1OPCA 2RQPA 3ELKA 1B6AA 5BPDA 1F4KA 4YIIA 1F1ZA 3MEXA 2OD5A 4LK1F 3KEQA 4QWQA 3DPTA 2OBPA 5ILSA 2QUFA 3GFLA 1DPUA 2F5FA 1WI9A 2EV5A 3WODF 2UZKA 4F7ZA 2GIVA 4CO8A 1J2XA 2VE8A 3KE2A 3CLOA 3WG9A 3BWGA 2K27A 2MH9A 2KJBA 5DCFA 4RB3C 2ESNA 2HOEA 3T5XA 5DV5A 5D6EA 3E5XA 1R5GA 2DQRA 4HQEA 4G9YA 1XB4A 4PZJA 4EGZA 3IHUA 2XAJA 3WE2A 4OIQF 4A6DA 5DYMA 1YTYA 4Q48A 4HZFA 4LGWA 4Q4ZF 1OMIA 3GFJA 1OYIA 2RN7A 3DP7A 2VC0A 2K4BA 4AWXB 1K78B 2XUBA 1AOYA 2MA3A 1FSEA 1QNTA 1T2KA 1ZHFA 5HLGA 2P5LC 2DPDA 3Q9SA 1BI2A 2GZWA 1QBJA 4G6QA 1XGSA 3QU6A 1O7FA 1BIBA 3HHGA 3RYRA 2A6EF 1R36A 3V4GA 2J5PA 1ULYA 4U0WA 1WQ2A 2OZUA 3EETA 3PQJA 4KUMA 2DPUA 2ELHA 3IWFA 3K9TA 4FHTA 5KVRA 4ZYDA 1RUOA 1YG2A 3PQKA 1YS6A 4I09A 3H92A 5K1YA 2A68F 1O3SA 2PJPA 1OKRA 2VT3A 2IW5A 4OOIA 2TDXA 3KP3A 1R7JA 3C1DA 2V1UA 4AIHA 4CGZA 2UXXA 4FT8A 1TNTA 3MZHA 4A0XA 1SMTA 2HTSA 2JSCA 3JAMZ 4Z2YA 4MTEA 3CUQA 1MKMA 4HBLA 4FX0A 1B9MA 1BJAA 3LSTA 1TTYA 1KQ9A 3RDIA 1EV7A 1U6GA 1HKSA 2FNPA 3FWEA 2EA4A 5H20A 3RKXA 4WXHA 5DUKA 2FXAA 2DU9A 1ZREA 3ZN0A 3K0LA 4G7HF 2G7HA 3ZMDA 3M9AA 2LDUA 2DT5A 2JTVA 5AIPA 1H9GA 3B73A 2Z5UA 5LHHA 1YW9A 1C0WA 5DCMB 3REOA 4G7OF 1T6SA 4G6DA 1ZRFA 2K7LA 3LFKA 3KP5A 1B1BA 3ZPLA 2EJRA 1ON1A 3CJNA 1ZG3A 2D45A 2L01A 5JI6A 3M7GA 5BQTA 2O03A 5L3DA 1Q1HA 2Y0MA 3TGNA 4HW0A 2XKPA 3TDZC 1ZAOA 2XAGA 1QQIA 5D8LB 5ICCA 3LAJA 5ERIA 1BIAA 1R23A 4OIRF 1I1SA 5IT9K 3BDDA 4WK8F 3Q9VA 2XIGA 1PUEE 3K1PA 4YG2F 2DO7A 1SAXA 4CZZA 3MAJA 4ASNA 3DEUA 1I5ZA 1DDNA 3M8FA 4R79A 3ZQ7A 3R0JA 4OIOF 1HW1A 4P96A 2KKOA 3CDHA 3LWFA 2RVCA 5J8FA 2VBWA 5JR3A 2MLGA 1U3EM 2WC2A 4BAYA 2HQNA 4RGRA 3V8KA 1RI7A 5LLQA 3M1EA 5DDGA 2ZMEA 3ZMSA 4DQ2A 2DQLA 4RB0A 4ENKA 1FC3A 2FMYA 4CDGA 1BI0A 3EDPA 4LK0F 5E17F 2FNAA 1LQ1A 2HTJA 3E6DA 4CICA 1UB9A 2L02A 4YFKF 1HXDA 1SD7A 4I7HA 4MQ9F 4B8XA 2FMLA 2XASA 5HS9A 2STTA 3V7SA 5LEKA 3U1DA 4OIPF 1ZRDA 3KZZA 5FLXK 3KZYA 3QPHA 2W85A 2QM3A 4TV7A 2V6CA 4BHPA 2IJLA 2IVMA 1LB2A 3IC7A 1MJBA 2R3SA 1TW3A 5HLHA 1LNWA 2A61A 4RGUA 1GXPA 1XN7A 1HW5A 1WKMA 2H6BA 1JHHA 3KCCA 4RGXA 1P92A 3SXYA 4LB5A 3RI4A 2QVOA 4KIFA 4BNCA 2PN6A 3WE3A 2CW0F 4GCVA 3JTGA 1R1UA 2NAZA 4L0YB 1J0RA 1LJ9A 2KIUA 4BYYA 3E5UA 3ISPA 1G3SA 2W57A 1MD0A 5BMZA 1ZG1A 2LNBA 2NS0A 3O6BB 3OOPA 1HW2A 4UV9A 3SZTA 2JT1A 5F6FA 4RB1A 4Q47A 1FP2A 4EMSA 3QPTA 1DPRA 6PAXA 3R0AA 3KEOA 5FGMA 3BJAA 3E6CC 1JGSA 2MBFA 4HV6A 4FX4A 5E18F 1H0MA 4XRFA 3SZPA 3MFKA 5L3CA 4S04A 1IN5A 4N9IA 2OQRA 2BYVE 1T98A 1YO5C 2YR2A 5D4RA 3HSFA 5D6FA 1Z7UA 1XDUA 1IZ1A 1GVJA 4ON0A 2PEXA 3I0TA 3OV8A 1FLIA 5FLXZ 1W5TA 1BI3A 1SFXA 3HTSB 2VC1A 1FNNA 3E6BA 2P6SA 1BOAA 1FX7A 3H3UA 3QRFF 1B4AA 2VOOA 1GHCA 1EH7A 4XSZF 4U88A 2FSWA 3AAFA 2LF8A 2KRFA 2EA2A 2F5EA 3T8TA 3GX4X 4IHTA 4IJAA 4I02A 4GYGA 5DEQA 3L7WA 5D5WB 3LA7A 3GZ5A 5ICEA 1O57A 2ZCWA 4EJUA 2JPCA 4LFUA 1YQAA 3ABUA 1H9TA 3HRUA 1CF7B 5L3EA 3RPQA 3HOSA 3JSOA 4GYIA 4R8HA 2H27A 3WU0A 5HDKA 1KA8A 3HRTA 5D4SA 2G9WA 3RKYA 4MTDA 4RS8A 3R61A 2P5KA 1XSDA 4EJTA 4IXAA 1FBQA 1IXCA 3ABTA 1P6RA 1FBUA 5CVUA 4BXUA 5JHUA 2PI0A 4ZZDA 2FE3A 1SD6A 4U0VA 2RC4A 1DP7P 3P9IA 1WSUA 3EYYA 3QP6A 2MC3A 5FFXA 1ZH5A 2W24A 1XDSA 2Y75A 3SHFA 2Q2EA 1U5TC 3DF8A 1HSJA 1O3RA 4UVCA 3HSRA 3JAMK 3L2CA 3ECOA 5BPIA 1ONVA 2X0LA 2KIMA 4KFCA 4M9ZA 4EQQA 1QZZA 5L3FA 4BHBA 1SFUA 3ZMVA 1ODDA 4M72A 2COMA 1E2XA 3IKVA 3WTWC 5TRDA 1FY7A 4KMUX 2GQQA 3ECHA 4NHJA 3KLOA 2CFXA 1ZGAA 3P9CA 5HDNA 1U5TB 2EB7A 3FF5A 4LG0A 3I64A 1R00A 4I2OA 2MH2A 4MEYF 3WU1B 2Q0OA 1JHFA 2QYOA 4A6EA 3F22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ENJ A;  4P5O A;  4JK1 X;  2JZY A;  4B09 A;  3RJP A;  4I0B A;  2D1V A;  1L3L A;  2QBY A;  1BI1 A;  2FU4 A;  2F5D A;  3LAP A;  4G7Z F;  4IHS A;  2YX7 A;  2GWR A;  4EJO A;  3VB2 A;  3G73 A;  2UXN A;  1U78 A;  2L3D A;  3KFW X;  5FD5 A;  4PGG A;  5LBQ A;  4NB5 A;  5A2Q K;  2ZFW A;  4KIB A;  5KK1 A;  4M9X A;  4LB6 B;  3MQ0 A;  3QAH A;  3N4M A;  4U7D A;  1IXR C;  2STW A;  1EH8 A;  2L54 A;  1IW7 F;  4M74 A;  5HS7 A;  2EFN A;  4G8X A;  4AIK A;  2BEO A;  2HGC A;  1NHA A;  2DW4 A;  3B02 A;  4MNU A;  2IPQ X;  1HQC A;  1Y0U A;  2RDP A;  3PFI A;  5D5U B;  1R1V A;  1JE8 A;  2EV6 A;  4IPA A;  3ML6 A;  2HDC A;  3QU3 A;  3WGH A;  3V8L A;  1UHW A;  4PDK A;  2WV0 A;  2A3S A;  3O2P E;  1CGP A;  2P5V A;  1ZN2 A;  2D2W A;  2Q8K A;  3R4K A;  4XSX F;  2Y48 A;  3GLX A;  1REP C;  3KP4 A;  4KIC A;  2HZT A;  2K86 A;  2L4A A;  1U5T A;  4KA4 A;  1W7P B;  3L00 A;  2DTR A;  1K78 A;  3IL2 A;  3ROU A;  5D5V B;  3ERE D;  2E7X A;  3WGI A;  1TNS A;  4ZYE A;  1MJA A;  3NEU A;  3FXR A;  5FD6 A;  3WTU C;  2FOK A;  4WF2 A;  1UFM A;  2P7C B;  5HOO A;  4EM2 A;  3LQR A;  4UV8 A;  5AON A;  1ZYR F;  4M73 A;  2IP2 A;  2O3F A;  3GO5 A;  4HLY A;  2DLL A;  3R6S A;  2QWW A;  5A2Q Z;  1B59 A;  1ZLJ A;  3TO7 A;  5DD4 A;  3ZMZ A;  1KU2 A;  1KYW A;  3FZV A;  4HF1 A;  2EFW A;  4P9U A;  1MDM B;  1WRJ A;  2BV6 A;  1J5Y A;  4JQF A;  1FYL A;  3RYP A;  2WWY A;  3S2W A;  3CO6 C;  4HDV A;  2C6Y A;  2GXG A;  3BOQ A;  4OIN F;  5LHI A;  3F8M A;  5DUI A;  3KLN A;  2Z9O A;  2LKP A;  4O5V A;  5HDG A;  1XSX A;  3GF2 A;  4HLX A;  4XLP F;  2RGV A;  5DD8 A;  3V8J A;  4WCG A;  1J9I A;  4HF0 A;  2ESH A;  1QGP A;  4KNY A;  1XGN A;  2OA4 A;  4YIF A;  2HKX A;  1FYM A;  2EK5 A;  1FSH A;  5DCM A;  1I6X A;  2GA1 A;  4HX7 A;  5E20 A;  4HF2 A;  1TW2 A;  1U8R A;  1W7P A;  3KP6 A;  4ESF A;  1ZG5 A;  4MGR A;  2FEZ A;  4LJZ F;  1W4M A;  5HLI A;  2HYF A;  1W7P D;  1OYW A;  4MEX F;  4L5J A;  3P9K A;  2Z3Y A;  3HHH A;  3DQV C;  1ZAR A;  3BZ6 A;  3F23 A;  4L9J A;  3HIF A;  2O6G E;  4BH9 A;  4LLG F;  3TKY A;  2ZKZ A;  2HFH A;  3C7J A;  1RNL A;  4G94 A;  1I1G A;  1Z05 A;  2NNY A;  4OMY A;  3I5U A;  2ZJ2 A;  2ACJ A;  4ETS A;  3COA C;  2EWN A;  3HUG A;  1XMK A;  3JW4 A;  3O3K A;  4A12 A;  1MDM A;  2P4W A;  4EM1 A;  5ICG A;  1P4X A;  3L09 A;  2YPR A;  3HSE A;  3W6K B;  2OQG A;  2DBB A;  2XAF A;  5LGU A;  3F8B A;  2O0Y A;  1YW8 A;  3ZP5 A;  5HS8 A;  2XRO A;  1LDJ A;  1FP1 D;  2O61 A;  2DK5 A;  2YSR A;  1U2W A;  3HRS A;  4EVI A;  1WWX A;  4OU0 A;  4AVP A;  3F3X A;  3KET A;  3GZ6 A;  2VBX A;  3IRQ A;  5K5O A;  1I27 A;  4O3M A;  5ILU A;  3T8R A;  3JTH A;  4L9V A;  2QQ9 A;  4M6Y A;  2ZNZ A;  3BPV A;  2BBY A;  4DNC A;  2NRA C;  1D3Y A;  3J7A O;  3J81 K;  1S7A A;  2VT2 A;  1RUN A;  2FBH A;  5BOX A;  3GYH X;  5ICF A;  1FOK A;  4GXO A;  1DUX C;  2VON A;  2UWM A;  3FMS A;  4U0Y A;  4A2U A;  1TQM A;  3R60 A;  1IN4 A;  4WXD A;  3HTU A;  2G7U A;  5AIQ A;  4WX9 A;  3H3Z A;  1SFE A;  1K79 A;  1K6O A;  4WXC A;  3TO9 A;  3LA2 A;  4HX4 A;  5H6R A;  4XLN F;  3M8E A;  2HKO A;  2GXB A;  3KP7 A;  2VN2 A;  2KIF A;  3G3Z A;  4I01 A;  1HBX G;  1STZ A;  4ZYG A;  4IRI A;  4WWC A;  1XD7 A;  2NYX A;  3VOD A;  3LQQ A;  1TLH B;  5L3B A;  3QOP A;  4L9T A;  2ETH A;  3KP2 A;  3CUQ C;  2M8E A;  1K7A A;  4LD5 A;  4AD9 A;  2ZXJ A;  3I59 B;  2EFQ A;  4RGS A;  3GXO A;  3RIR A;  3CO7 C;  1T0F A;  1Z9C A;  3EYI A;  4L5I A;  5F1R A;  2CGP A;  2M1B A;  4Y13 A;  2CSO A;  1FYK A;  3ULQ B;  3D0S A;  4O6J A;  5EEH A;  1KU3 A;  4HOB A;  1IRG A;  3VEP A;  4RAY A;  4EV0 A;  3I54 A;  3FX3 A;  2PMU A;  3J81 Z;  2ISY A;  1T39 A;  2FBK A;  1V4R A;  3E97 A;  1G3Y A;  2HS5 A;  3CUQ B;  4EJV A;  1BN5 A;  1EH6 A;  3K1N A;  1MGT A;  2YU3 A;  1USS A;  2J5O A;  2W84 A;  2XVC A;  3K2Z A;  1IN6 A;  2W25 A;  3WGG A;  2VBY A;  4HV5 A;  2L4M A;  2P8T A;  1ON2 A;  4RAZ A;  4UHT A;  1J7K A;  3ZN1 A;  3F72 A;  4Y15 A;  2E1C A;  1YS7 A;  2CYY A;  2PLY A;  3W6J B;  1G4D A;  1XSV A;  4S05 A;  1D8K A;  4LMY A;  1KYZ A;  4H0E A;  1IXS B;  4UVB A;  2MLK A;  4L9N A;  1Z1D A;  3IKT A;  1LVA A;  1MZB A;  1P4A A;  1CF7 A;  4KN4 X;  1YW7 A;  3DPL C;  5CYV A;  4A5M A;  3I71 A;  4E70 A;  3FHZ A;  1JXS A;  3F8F A;  1IRF A;  2XGX A;  2BE5 F;  1TQP A;  5HVQ C;  3C3W A;  1D5V A;  2RV8 A;  3I59 A;  2VE9 A;  3BRO A;  3HYI A;  1S6L A;  2QQA A;  2ADU A;  2XKO A;  5L3G A;  4XBF A;  4HDU A;  2JRT A;  3NQO A;  1HST A;  3FXQ A;  2M30 A;  3GWZ A;  1XCV A;  1FPQ A;  1UCR A;  5IT3 A;  2EFO A;  5CVV A;  2V9V A;  3GW2 A;  3I58 A;  1E17 A;  2PMH A;  1S3J A;  1HKT A;  4EJW A;  1KQ8 A;  1KGS A;  4N9H A;  4UUV A;  1LEA A;  1TBX A;  2K4J A;  4M6X A;  1ZRC A;  3RTR A;  4LLL A;  2GA2 A;  4ZYH A;  3FM3 A;  1QO0 D;  3P7N A;  1W5S A;  2R7F A;  5TJJ A;  4HX8 A;  4KT5 C;  5J8C A;  2IA1 A;  5D8K B;  2IA2 A;  2JPB A;  3BJ6 A;  3WTT C;  3GEZ A;  3GFM A;  2YX4 A;  4N0B A;  1KQ0 A;  3DKW A;  1L0O C;  1XGO A;  1S8N A;  1UST A;  3F21 A;  3HRM A;  2V1X A;  2Z99 A;  2H6C A;  3GVA A;  3T1B A;  3BY6 A;  2DFI A;  5ILV A;  2PBI A;  2ZME B;  4GO1 A;  2M45 A;  3C18 A;  5CVI A;  2XHK A;  3CTA A;  2CWE A;  2QLZ A;  3DXJ F;  3SQN A;  4CYD A;  4U7B A;  2K02 A;  1FBS A;  4KMF A;  4I98 B;  3D5L A;  3RPU A;  1UHM A;  4JBA A;  5FFZ A;  1QZY A;  1Z6T A;  2PQ8 A;  2FQ3 A;  3K69 A;  4ENN A;  1YYV A;  2HEO A;  1IUY A;  4RB2 C;  2V1D A;  2VOP A;  2MD5 A;  3K1M A;  1XGM A;  4ESB A;  3IWZ A;  4CHU A;  3E5Q A;  2IT0 A;  1XCB A;  2WTE A;  1BC8 C;  4UNO A;  2RNJ A;  4YFX F;  1MJ9 A;  2DI3 A;  1KU9 A;  5BS6 A;  2OZ6 A;  3U2R A;  3WTV C;  2EFP A;  1Z6R A;  2F5C A;  2XAH A;  3U9G A;  2FRH A;  2M5W A;  5CVJ A;  4A0Y A;  2H94 A;  5CJ9 A;  3MCZ A;  1G3T A;  1BBY A;  1T38 A;  2XAQ A;  2VBZ A;  4KYW A;  4HYE A;  1FT9 A;  1KU7 A;  3N97 A;  4PCQ A;  4HAM A;  2X4H A;  3FMR A;  2FF4 A;  3NRV A;  5FB2 A;  3MZY A;  2O8X A;  3FMQ A;  5CVR A;  3T0Y A;  3VOE A;  3V7C A;  3MWM A;  3TOB A;  5LRS A;  1YLF A;  2NNN A;  2QZ8 A;  2IRF G;  3J80 K;  3BPX A;  4R1H A;  1IN7 A;  3GFI A;  4PGH A;  2ZNY A;  4IVN A;  4I0A A;  3V7R A;  5JVT A;  2M87 A;  4ZH4 F;  4Y17 A;  2H09 A;  2VOD A;  1YIO A;  5LHG A;  5E1Z B;  5J6X A;  1S7O A;  2OU2 A;  3EQL F;  1HKQ A;  2DK8 A;  3JSP A;  2XV4 S;  3WTZ A;  2D1H A;  3HOT A;  1BM9 A;  2CG4 A;  3F8C A;  4QLC U;  1PP8 F;  2E7W A;  2HR3 A;  3ZMU A;  2EV0 A;  4M71 A;  1R1T A;  1ZLK A;  3E6M A;  5CLS A;  4MHG A;  4L18 B;  4P9F A;  5F64 A;  2HWV A;  2CQK A;  4D0P A;  5FO5 A;  1SD5 A;  1OR7 A;  4ESJ A;  1D8J A;  1PDN C;  2DAO A;  2P6T A;  5LGN A;  1SD4 A;  5IT9 Z;  1F5T A;  1P4W A;  4AIJ A;  1TQI A;  4M9S A;  2PFB A;  4MQV A;  5D5X B;  4NQW A;  2PG4 A;  2F2E A;  5K5R A;  3DV8 A;  2KJC A;  1FWZ A;  4IF4 A;  1O7L A;  3WTS C;  1BC7 C;  2Z33 A;  3F6V A;  3I4P A;  2A5Y B;  1X3U A;  2HYG D;  2FBI A;  1F9N A;  4KIG A;  1LDK B;  1O3T A;  2QQB A;  2XRN A;  4Q5S F;  2LF7 A;  3FXU A;  1G3W A;  1VTN C;  2GAU A;  4A5N A;  4EGY A;  1O3Q A;  1IAW A;  3J80 Z;  1PP7 U;  4KDP A;  5LEJ A;  2V79 A;  5E8G A;  4K2E A;  1A04 A;  4UXN A;  2AS5 F;  3TOA A;  1R22 A;  5LRR A;  4ENM A;  3SFZ A;  2BGC A;  3Q5F A;  2RKH A;  4EM0 B;  3WTY C;  1IN8 A;  3WTX C;  2P7V B;  1Z91 A;  3F6O A;  3TO6 A;  2AXL A;  5E8I A;  1P2F A;  2A07 F;  1QPM A;  3DFG A;  1J59 A;  2OAZ A;  4HA8 A;  1YFH A;  1ZGJ A;  3GUD A;  5E1W A;  5K5Q A;  1RIO H;  4BQA A;  2CO5 A;  1S29 A;  4L0Z B;  2FA5 A;  2R7D A;  2A6H F;  4LLN A;  5JFR A;  1R58 A;  3QP5 A;  4KN7 X;  1J75 A;  1AWC A;  3LA3 A;  3VFZ A;  3BJO A;  2QEN A;  1LDD A;  1R5H A;  1FZP B;  4A0Z A;  1LEB A;  2B0L A;  3TQN A;  1G6N A;  3EUH A;  2VXZ A;  3I53 A;  3RKW A;  1XMA A;  3BP8 A;  3IRR A;  5EEG A;  4BHC A;  4LG0 B;  4P55 A;  3F8N A;  2ZO4 A;  1RZ4 A;  4CXF A;  1SMY F;  3FM5 A;  1B9N A;  3L9F A;  2ZBK A;  3E3V A;  1OYY A;  5H6Q A;  4ZZL A;  5ED4 A;  3CUO A;  5LGT A;  2QBY B;  3TDU C;  1V3F A;  2A69 F;  4IRH A;  1GXQ A;  5E1X A;  1IF1 A;  4IRG A;  2E1N A;  2ISZ A;  2LSO A;  4GGG A;  4UVA A;  2IA0 A;  4HQM A;  4YFN F;  2HQR A;  4OMZ A;  3ZMT A;  1OPC A;  2RQP A;  3ELK A;  1B6A A;  5BPD A;  1F4K A;  4YII A;  1F1Z A;  3MEX A;  2OD5 A;  4LK1 F;  3KEQ A;  4QWQ A;  3DPT A;  2OBP A;  5ILS A;  2QUF A;  3GFL A;  1DPU A;  2F5F A;  1WI9 A;  2EV5 A;  3WOD F;  2UZK A;  4F7Z A;  2GIV A;  4CO8 A;  1J2X A;  2VE8 A;  3KE2 A;  3CLO A;  3WG9 A;  3BWG A;  2K27 A;  2MH9 A;  2KJB A;  5DCF A;  4RB3 C;  2ESN A;  2HOE A;  3T5X A;  5DV5 A;  5D6E A;  3E5X A;  1R5G A;  2DQR A;  4HQE A;  4G9Y A;  1XB4 A;  4PZJ A;  4EGZ A;  3IHU A;  2XAJ A;  3WE2 A;  4OIQ F;  4A6D A;  5DYM A;  1YTY A;  4Q48 A;  4HZF A;  4LGW A;  4Q4Z F;  1OMI A;  3GFJ A;  1OYI A;  2RN7 A;  3DP7 A;  2VC0 A;  2K4B A;  4AWX B;  1K78 B;  2XUB A;  1AOY A;  2MA3 A;  1FSE A;  1QNT A;  1T2K A;  1ZHF A;  5HLG A;  2P5L C;  2DPD A;  3Q9S A;  1BI2 A;  2GZW A;  1QBJ A;  4G6Q A;  1XGS A;  3QU6 A;  1O7F A;  1BIB A;  3HHG A;  3RYR A;  2A6E F;  1R36 A;  3V4G A;  2J5P A;  1ULY A;  4U0W A;  1WQ2 A;  2OZU A;  3EET A;  3PQJ A;  4KUM A;  2DPU A;  2ELH A;  3IWF A;  3K9T A;  4FHT A;  5KVR A;  4ZYD A;  1RUO A;  1YG2 A;  3PQK A;  1YS6 A;  4I09 A;  3H92 A;  5K1Y A;  2A68 F;  1O3S A;  2PJP A;  1OKR A;  2VT3 A;  2IW5 A;  4OOI A;  2TDX A;  3KP3 A;  1R7J A;  3C1D A;  2V1U A;  4AIH A;  4CGZ A;  2UXX A;  4FT8 A;  1TNT A;  3MZH A;  4A0X A;  1SMT A;  2HTS A;  2JSC A;  3JAM Z;  4Z2Y A;  4MTE A;  3CUQ A;  1MKM A;  4HBL A;  4FX0 A;  1B9M A;  1BJA A;  3LST A;  1TTY A;  1KQ9 A;  3RDI A;  1EV7 A;  1U6G A;  1HKS A;  2FNP A;  3FWE A;  2EA4 A;  5H20 A;  3RKX A;  4WXH A;  5DUK A;  2FXA A;  2DU9 A;  1ZRE A;  3ZN0 A;  3K0L A;  4G7H F;  2G7H A;  3ZMD A;  3M9A A;  2LDU A;  2DT5 A;  2JTV A;  5AIP A;  1H9G A;  3B73 A;  2Z5U A;  5LHH A;  1YW9 A;  1C0W A;  5DCM B;  3REO A;  4G7O F;  1T6S A;  4G6D A;  1ZRF A;  2K7L A;  3LFK A;  3KP5 A;  1B1B A;  3ZPL A;  2EJR A;  1ON1 A;  3CJN A;  1ZG3 A;  2D45 A;  2L01 A;  5JI6 A;  3M7G A;  5BQT A;  2O03 A;  5L3D A;  1Q1H A;  2Y0M A;  3TGN A;  4HW0 A;  2XKP A;  3TDZ C;  1ZAO A;  2XAG A;  1QQI A;  5D8L B;  5ICC A;  3LAJ A;  5ERI A;  1BIA A;  1R23 A;  4OIR F;  1I1S A;  5IT9 K;  3BDD A;  4WK8 F;  3Q9V A;  2XIG A;  1PUE E;  3K1P A;  4YG2 F;  2DO7 A;  1SAX A;  4CZZ A;  3MAJ A;  4ASN A;  3DEU A;  1I5Z A;  1DDN A;  3M8F A;  4R79 A;  3ZQ7 A;  3R0J A;  4OIO F;  1HW1 A;  4P96 A;  2KKO A;  3CDH A;  3LWF A;  2RVC A;  5J8F A;  2VBW A;  5JR3 A;  2MLG A;  1U3E M;  2WC2 A;  4BAY A;  2HQN A;  4RGR A;  3V8K A;  1RI7 A;  5LLQ A;  3M1E A;  5DDG A;  2ZME A;  3ZMS A;  4DQ2 A;  2DQL A;  4RB0 A;  4ENK A;  1FC3 A;  2FMY A;  4CDG A;  1BI0 A;  3EDP A;  4LK0 F;  5E17 F;  2FNA A;  1LQ1 A;  2HTJ A;  3E6D A;  4CIC A;  1UB9 A;  2L02 A;  4YFK F;  1HXD A;  1SD7 A;  4I7H A;  4MQ9 F;  4B8X A;  2FML A;  2XAS A;  5HS9 A;  2STT A;  3V7S A;  5LEK A;  3U1D A;  4OIP F;  1ZRD A;  3KZZ A;  5FLX K;  3KZY A;  3QPH A;  2W85 A;  2QM3 A;  4TV7 A;  2V6C A;  4BHP A;  2IJL A;  2IVM A;  1LB2 A;  3IC7 A;  1MJB A;  2R3S A;  1TW3 A;  5HLH A;  1LNW A;  2A61 A;  4RGU A;  1GXP A;  1XN7 A;  1HW5 A;  1WKM A;  2H6B A;  1JHH A;  3KCC A;  4RGX A;  1P92 A;  3SXY A;  4LB5 A;  3RI4 A;  2QVO A;  4KIF A;  4BNC A;  2PN6 A;  3WE3 A;  2CW0 F;  4GCV A;  3JTG A;  1R1U A;  2NAZ A;  4L0Y B;  1J0R A;  1LJ9 A;  2KIU A;  4BYY A;  3E5U A;  3ISP A;  1G3S A;  2W57 A;  1MD0 A;  5BMZ A;  1ZG1 A;  2LNB A;  2NS0 A;  3O6B B;  3OOP A;  1HW2 A;  4UV9 A;  3SZT A;  2JT1 A;  5F6F A;  4RB1 A;  4Q47 A;  1FP2 A;  4EMS A;  3QPT A;  1DPR A;  6PAX A;  3R0A A;  3KEO A;  5FGM A;  3BJA A;  3E6C C;  1JGS A;  2MBF A;  4HV6 A;  4FX4 A;  5E18 F;  1H0M A;  4XRF A;  3SZP A;  3MFK A;  5L3C A;  4S04 A;  1IN5 A;  4N9I A;  2OQR A;  2BYV E;  1T98 A;  1YO5 C;  2YR2 A;  5D4R A;  3HSF A;  5D6F A;  1Z7U A;  1XDU A;  1IZ1 A;  1GVJ A;  4ON0 A;  2PEX A;  3I0T A;  3OV8 A;  1FLI A;  5FLX Z;  1W5T A;  1BI3 A;  1SFX A;  3HTS B;  2VC1 A;  1FNN A;  3E6B A;  2P6S A;  1BOA A;  1FX7 A;  3H3U A;  3QRF F;  1B4A A;  2VOO A;  1GHC A;  1EH7 A;  4XSZ F;  4U88 A;  2FSW A;  3AAF A;  2LF8 A;  2KRF A;  2EA2 A;  2F5E A;  3T8T A;  3GX4 X;  4IHT A;  4IJA A;  4I02 A;  4GYG A;  5DEQ A;  3L7W A;  5D5W B;  3LA7 A;  3GZ5 A;  5ICE A;  1O57 A;  2ZCW A;  4EJU A;  2JPC A;  4LFU A;  1YQA A;  3ABU A;  1H9T A;  3HRU A;  1CF7 B;  5L3E A;  3RPQ A;  3HOS A;  3JSO A;  4GYI A;  4R8H A;  2H27 A;  3WU0 A;  5HDK A;  1KA8 A;  3HRT A;  5D4S A;  2G9W A;  3RKY A;  4MTD A;  4RS8 A;  3R61 A;  2P5K A;  1XSD A;  4EJT A;  4IXA A;  1FBQ A;  1IXC A;  3ABT A;  1P6R A;  1FBU A;  5CVU A;  4BXU A;  5JHU A;  2PI0 A;  4ZZD A;  2FE3 A;  1SD6 A;  4U0V A;  2RC4 A;  1DP7 P;  3P9I A;  1WSU A;  3EYY A;  3QP6 A;  2MC3 A;  5FFX A;  1ZH5 A;  2W24 A;  1XDS A;  2Y75 A;  3SHF A;  2Q2E A;  1U5T C;  3DF8 A;  1HSJ A;  1O3R A;  4UVC A;  3HSR A;  3JAM K;  3L2C A;  3ECO A;  5BPI A;  1ONV A;  2X0L A;  2KIM A;  4KFC A;  4M9Z A;  4EQQ A;  1QZZ A;  5L3F A;  4BHB A;  1SFU A;  3ZMV A;  1ODD A;  4M72 A;  2COM A;  1E2X A;  3IKV A;  3WTW C;  5TRD A;  1FY7 A;  4KMU X;  2GQQ A;  3ECH A;  4NHJ A;  3KLO A;  2CFX A;  1ZGA A;  3P9C A;  5HDN A;  1U5T B;  2EB7 A;  3FF5 A;  4LG0 A;  3I64 A;  1R00 A;  4I2O A;  2MH2 A;  4MEY F;  3WU1 B;  2Q0O A;  1JHF A;  2QYO A;  4A6E A;  3F22 A; 
#chains in the Genus database with same CATH topology
 4ENJ A;  4D5F A;  5H2F C;  4P5O A;  2LRD A;  4BEH A;  4XNF A;  2QF7 A;  4JK1 X;  2JZY A;  2R7V A;  4IQ4 A;  4B09 A;  1ZGW A;  3RJP A;  4I0B A;  5M5Y J;  2D1V A;  1L3L A;  3OS0 A;  4B3X A;  3CCS I;  1JTY A;  2QBY A;  1BI1 A;  2FU4 A;  2COB A;  2JRM A;  5M5W J;  2GLO A;  2F5D A;  1GVD A;  3LAP A;  4G7Z F;  2XC7 A;  1Y6I A;  2HPM A;  2KIQ A;  3QOD A;  4IHS A;  4D7N A;  2E1O A;  2YX7 A;  2KQR A;  2GWR A;  4EJO A;  4XON A;  3VB2 A;  2Z16 A;  1Y8Q B;  2XPU A;  3G73 A;  2UXN A;  2QEX I;  1U78 A;  2L3D A;  3KFW X;  5FD5 A;  4PGG A;  2OPT A;  5LBQ A;  4NB5 A;  4BUP A;  5A2Q K;  1X2M A;  2ZFW A;  4KIB A;  3CCM I;  2WA0 A;  1T33 A;  5KK1 A;  1I3A A;  3S1M J;  2GOM A;  3BC8 A;  3CCJ I;  4M9X A;  3KYL A;  4LB6 B;  2VQC A;  3MQ0 A;  3QAH A;  5FKL A;  3N4M A;  1Z21 A;  4U7D A;  2XGC A;  3FXK A;  1IXR C;  3CP8 A;  1DU0 A;  2STW A;  1EH8 A;  4B4C A;  3S1N J;  2L54 A;  1IW7 F;  4M74 A;  2HU9 A;  2EFN A;  4G8X A;  4PJL A;  5HS7 A;  4AIK A;  2BEO A;  5FKO A;  2OTJ I;  2HGC A;  1NHA A;  5FJ8 J;  2DW4 A;  3B02 A;  3SYT A;  4JOM A;  4NBQ A;  4MNU A;  2M34 A;  2CJJ A;  2IPQ X;  1HQC A;  1Y0U A;  3EPZ A;  2RDP A;  3PFI A;  3N05 A;  3CMY A;  1B72 B;  3K10 A;  1P7I A;  1R1V A;  2M8G X;  5D5U B;  1JE8 A;  2PJR A;  2EV6 A;  4IPA A;  3ML6 A;  1WHU A;  2HDC A;  5F0C A;  4CCO A;  2NOJ B;  2VAS A;  3FK7 A;  3QU3 A;  4RM3 A;  3WGH A;  3L2W A;  3V8L A;  1UHW A;  3QWL A;  1BL0 A;  3JRF A;  4PDK A;  2WV0 A;  2FD5 A;  2A3S A;  2FX0 A;  1ETK A;  3O2P E;  2X1E A;  2TRT A;  2F6C A;  1CGP A;  2I10 A;  2P5V A;  2P81 A;  1ZN2 A;  1JI8 A;  2D2W A;  4EEF G;  2Q8K A;  2L0K A;  1MBJ A;  3BQZ A;  3R4K A;  3FIW A;  4XSX F;  2Y48 A;  1HDP A;  2VKE A;  3GLX A;  1REP C;  3KP4 A;  4KIC A;  2V6E A;  2HZT A;  4IHX A;  2H1L A;  2HDW A;  2K86 A;  1MBE A;  4UB8 C;  5C4J J;  2L4A A;  3SDG A;  1U5T A;  4KA4 A;  1W7P B;  3L00 A;  2DTR A;  1AKH A;  1K78 A;  4V2G A;  3IL2 A;  3BTI A;  4XKV A;  1JKQ C;  2MYS A;  3ROU A;  5D5V B;  3ERE D;  2E7X A;  3WGI A;  1TNS A;  3PIP F;  4ZYE A;  1JJ6 C;  4E7K A;  1MJA A;  1MSF C;  3OYN A;  1R9T J;  3JRB A;  1QRY A;  3KIO A;  1IC8 A;  3ERM A;  3NEU A;  3FXR A;  5F04 A;  2K9Q A;  5FD6 A;  5KAI C;  3ABK H;  3OYK A;  1HA8 A;  4GDF A;  3WTU C;  1FMV A;  2FOK A;  4WF2 A;  1UFM A;  2P7C B;  1G59 A;  2AXT C;  5HOO A;  3PSI A;  4EM2 A;  3LQR A;  4UV8 A;  3H0D A;  5AON A;  1ZYR F;  4M73 A;  3CCL I;  2DMQ A;  2IP2 A;  2O3F A;  2K9N A;  3HKZ A;  4CCK A;  3GO5 A;  4HLY A;  1F36 A;  2BW3 B;  2CQQ A;  2DLL A;  3R6S A;  2QWW A;  3VYR B;  5A2Q Z;  1EJ9 A;  1B59 A;  3ONQ A;  1Z0X A;  1ZLJ A;  1W0U A;  4XL9 A;  4YEJ A;  3TO7 A;  1MNE A;  9ANT A;  3ZQL A;  5DD4 A;  3Q0W A;  3JRC A;  2WAD A;  3ZMZ A;  1KU2 A;  1KYW A;  4HNV A;  1XS9 A;  4XIC A;  2AQE A;  3S3M A;  4ANJ A;  2LFB A;  3FKJ A;  3FZV A;  4HF1 A;  2EFW A;  2WAQ N;  3G1O A;  1WRJ A;  5EZH A;  1WJF A;  3HC7 A;  4P9U A;  4YEL A;  1BW6 A;  2BV6 A;  1GUU A;  4NQW B;  3CP2 A;  2DA3 A;  1TL8 A;  1OCT C;  1J5Y A;  4JQF A;  2H8R A;  1FYL A;  3RYP A;  2WWY A;  3S2W A;  3CO6 C;  1FMW A;  4XLH A;  2HVQ A;  1T56 A;  4ITV A;  3LSJ A;  4HDV A;  2C6Y A;  2GXG A;  1A6Q A;  4OWR B;  3BOQ A;  2CW7 A;  2VJI A;  3D1N I;  3ZQH A;  4MLO A;  2FQ4 A;  3AG4 H;  4OIN F;  5LHI A;  3F8M A;  2XB5 A;  5DUI A;  3KLN A;  2Z9O A;  2XAU A;  1MMA A;  4NC8 A;  2LD5 A;  2M7B A;  2LKP A;  3M1C A;  1TWF J;  2X6Y A;  1VQO I;  2VQH A;  4O5V A;  4XLE A;  5HDG A;  1XSX A;  1RRJ A;  3GF2 A;  3CDL A;  4HLX A;  4XLP F;  2RGV A;  5DD8 A;  3V8J A;  2R93 J;  4D1Q A;  4WCG A;  1J9I A;  4HF0 A;  1XMX A;  3G1M A;  2XSD C;  2K85 A;  2ESH A;  1QGP A;  3GTL J;  1QVU A;  4KNY A;  1XGN A;  3GCM A;  3M3Y J;  2OA4 A;  2XDV A;  4YIF A;  1A5J A;  2HKX A;  1FYM A;  2EK5 A;  2OTL I;  1YOV B;  3DKY A;  1WH5 A;  2M4G A;  1FSH A;  5DCM A;  1I6X A;  3RZO J;  3S2D J;  2GA1 A;  3IUO A;  4HX7 A;  5E20 A;  4HF2 A;  1TW2 A;  3C2B A;  2E1M C;  2R7Q A;  2ZXH A;  1W7P A;  1QVT A;  2GIZ A;  1U8R A;  3KP6 A;  5B1B H;  4ESF A;  2L7K A;  1ZG5 A;  2E2H J;  1MBK A;  2FEZ A;  4MGR A;  5J40 A;  4ABZ A;  2R0Q C;  4XKC A;  4LJZ F;  1W4M A;  5HLI A;  3TP0 A;  2CV1 A;  2HYF A;  3GME A;  1W7P D;  4PJ0 C;  1N77 A;  2DA7 A;  1OYW A;  2WB1 N;  5GTH C;  2HOA A;  3BLY A;  4HNU A;  4L5J A;  4MEX F;  2NVQ J;  2DMT A;  3S14 J;  3P9K A;  2Z3Y A;  3HHH A;  3DLA A;  4JX6 A;  3DQV C;  1ZAR A;  4N4N B;  3BZ6 A;  3S1Q J;  1QA6 A;  3BZC A;  3F23 A;  1GV5 A;  4L9J A;  4AC0 A;  3HIF A;  3OIP A;  2O6G E;  4BH9 A;  2VL8 A;  3GTP J;  4A3L J;  4LLG F;  1XX5 A;  3TKY A;  2DMP A;  1VQ4 I;  2ICW G;  3OYB A;  2ZKZ A;  4RDU A;  2HFH A;  3C7J A;  4CCM A;  1RNL A;  4G94 A;  3PO2 J;  1I1G A;  1IDY A;  1Q1V A;  1Z05 A;  5JHF A;  3SEQ A;  2NNY A;  3QPL A;  4OMY A;  2EZI A;  1OJL A;  1T95 A;  3I4M J;  3I5U A;  3LSP A;  2ZJ2 A;  2ACJ A;  2E1M B;  4ETS A;  3COA C;  3A0H C;  2EWN A;  3HUG A;  1XMK A;  1T08 B;  3JW4 A;  5C3E J;  3QPS A;  3O3K A;  2HOS A;  4M3F A;  1WJA A;  5EDN A;  5FRM A;  4A12 A;  1MDM A;  3PFY A;  1JT0 A;  2P4W A;  2W7N A;  1W5C C;  2ECB A;  4EM1 A;  5ICG A;  1P4X A;  2W4S A;  4E6K G;  3LMM A;  2DJN A;  1LE8 B;  3L09 A;  2YPR A;  1WCM J;  3HSE A;  2OV7 A;  3W6K B;  2OQG A;  2DBB A;  2XAF A;  5LGU A;  3F8B A;  4IHV A;  2O0Y A;  1YW8 A;  2EIJ H;  3ZP5 A;  4B44 A;  3UR3 C;  5HS8 A;  2XRO A;  2MAB A;  3OY9 A;  2KRC A;  2JUG A;  1LDJ A;  4RM2 A;  2XB0 X;  1FP1 D;  4A3E J;  2O61 A;  2DK5 A;  2YSR A;  1U2W A;  4AUX A;  4F92 B;  4DJA A;  2X6O A;  3HRS A;  4EVI A;  1WWX A;  5EZG A;  4OU0 A;  2R7Z J;  2DOA A;  4PFO A;  3EUK L;  5JVG F;  3S16 J;  4AVP A;  3K7A J;  3F3X A;  4J00 A;  3KET A;  1S9H A;  2DCE A;  3GZ6 A;  4GFB A;  3GTK J;  2R5Y B;  3K4M A;  4AM3 A;  2VBX A;  3HG9 A;  3IRQ A;  3OWT A;  1OCZ H;  5K5O A;  1I27 A;  4O3M A;  5ILU A;  3O8G A;  3T8R A;  1BR1 A;  3JTH A;  3J7Z I;  4L9V A;  2QQ9 A;  2RAE A;  4M6Y A;  2ZNZ A;  3BPV A;  5HNH A;  4J01 A;  2BBY A;  1X58 A;  5IP7 J;  4DNC A;  4X0G A;  3HXL A;  2NRA C;  3OR2 C;  4KIS A;  1D3Y A;  2E19 A;  3J7A O;  5IOY A;  2VLA A;  3J81 K;  2CW8 A;  2Z1D A;  1Z77 A;  3P5J A;  1S7A A;  2VT2 A;  3BR0 A;  2OJE D;  1H8A C;  2R92 J;  1RUN A;  3IH2 A;  1RPW A;  2FBH A;  5BOX A;  5ICF A;  1Y56 A;  3GYH X;  1FOK A;  4GXO A;  1NK2 P;  2PMZ A;  4UUT A;  3JR9 A;  1DUX C;  3HDD A;  4HRI A;  2NVT J;  4BQQ A;  1WFX A;  1XPX A;  2VON A;  2UWM A;  3JRE A;  3FMS A;  4U0Y A;  3W2A A;  4A2U A;  1P9Q C;  1TQM A;  3VYT B;  3R60 A;  3DKX A;  2EZL A;  1IN4 A;  4WXD A;  3HTU A;  4BS9 A;  2G7U A;  5AIQ A;  4WX9 A;  5EJC A;  3H3Z A;  1SFE A;  4C30 A;  1K79 A;  1JKP C;  4XOP A;  2E71 A;  4WXC A;  1K6O A;  3TO9 A;  1YIT I;  1JKO C;  4E7S A;  3LA2 A;  4HX4 A;  5H6R A;  4XLN F;  1Z7L A;  3WHC A;  2L5Q A;  3K70 D;  1ETV A;  3M8E A;  2HKO A;  2GXB A;  3G1L A;  2VN2 A;  3KP7 A;  3I56 I;  3Q3S A;  1YX3 A;  4LG3 A;  3CES A;  2IGM A;  2RNG A;  1MBG A;  5M5X J;  1HF0 A;  2KIF A;  4RLQ A;  2LBF A;  4DYQ A;  3G3Z A;  4I01 A;  1HBX G;  1STZ A;  4ZYG A;  4FIS A;  4IRI A;  3H36 A;  4WWC A;  3HZJ A;  1XD7 A;  2NYX A;  3VOD A;  3HOY J;  4KIT B;  2CS3 A;  3LQQ A;  4BY1 J;  3RQ4 A;  4DIQ A;  4ZTJ A;  3H0G J;  3A4C A;  2JJ7 A;  1OCC H;  1TLH B;  5L3B A;  3QOP A;  4L9T A;  2ETH A;  3KP2 A;  3PUF A;  3CUQ C;  2M8E A;  4BY7 J;  1K7A A;  3ASO H;  4LD5 A;  2DFF A;  4AD9 A;  1A31 A;  2ZXJ A;  3QYB A;  3IH3 A;  1VQ5 I;  1UMQ A;  3I59 B;  2EFQ A;  3BTJ A;  3C2G A;  2LOO A;  4RGS A;  5E79 C;  2CH0 A;  2O9L A;  3GXO A;  3RIR A;  1GLN A;  3ZR8 X;  4HG2 A;  1BA5 A;  3CO7 C;  4AVZ A;  1T0F A;  3HPH A;  1Z9C A;  4IOC F;  1WI3 A;  3CC7 I;  4NC7 A;  2VIX A;  2ME6 A;  1LFU P;  4BAC A;  3EYI A;  1NG6 A;  2VUM J;  1ZK8 A;  4DYC A;  4L5I A;  2B63 J;  4BXX J;  5F1R A;  2R4G A;  2CGP A;  5B1A H;  1WJC A;  2M1B A;  4A3D J;  1GDT A;  4Y13 A;  1S72 I;  2CSO A;  2BXZ A;  1FYK A;  3ULQ B;  3D0S A;  4O6J A;  3TP3 A;  5EEH A;  2F5V A;  5DM6 F;  1KU3 A;  4HOB A;  1IRG A;  4E7I A;  3VEP A;  4A3F J;  1YRN B;  4RAY A;  3L2R A;  2MD0 A;  3CJQ B;  4EV0 A;  3HKZ N;  3I54 A;  3BTL A;  3FX3 A;  4M3D A;  2PMU A;  3K4K A;  3IAM 2;  3J81 Z;  3CF5 F;  2ISY A;  3W2V A;  2M4K A;  1V5F A;  1T39 A;  4A3G J;  2FBK A;  5F08 A;  1V4R A;  1P7J A;  3E97 A;  1G3Y A;  2HS5 A;  3CUQ B;  4EJV A;  2DMU A;  1BN5 A;  2KLO A;  1I39 A;  3BG3 A;  4G6T B;  1MMN A;  2ZC2 A;  1EH6 A;  1Y8R B;  5GAE J;  3K1N A;  1MGT A;  2YU3 A;  1USS A;  2OC6 A;  2J5O A;  1VI0 A;  2W84 A;  2XVC A;  4FE7 A;  1MNM C;  2X85 A;  5F0H A;  4CCJ A;  3K2Z A;  1IN6 A;  2W25 A;  3WGG A;  4BJ6 C;  2VBY A;  4HV5 A;  2DDA A;  2L4M A;  4JX5 A;  4DZJ A;  2CV2 A;  1NG7 A;  2P8T A;  4ZC3 A;  5K7Z A;  1ON2 A;  2K9M A;  3RZD J;  4RAZ A;  4UHT A;  4C2U A;  4IZZ A;  4S0H B;  1MW7 A;  3RSN A;  1J7K A;  3ZN1 A;  1TWH J;  4OAZ A;  4FCY A;  3SFI A;  3F0C A;  1ETO A;  3F72 A;  3U21 A;  4Y15 A;  1WZ2 A;  2E1C A;  3HOZ J;  1YS7 A;  1VQP I;  2CYY A;  2DA4 A;  3A1Y A;  3BT9 A;  2PLY A;  5GAD J;  2VKH A;  4HST A;  3W6J B;  1A6I A;  1G4D A;  1XSV A;  4S05 A;  1D8K A;  1N75 A;  5B66 C;  4LMY A;  1KYZ A;  1U9O A;  4H0E A;  1IXS B;  4UVB A;  4QPQ A;  2JA5 J;  2MLK A;  4L9N A;  5C44 J;  3KEY A;  1Z1D A;  3IKT A;  1LVA A;  1MZB A;  3LSK A;  1P4A A;  1CF7 A;  1UG0 A;  4KN4 X;  1YW7 A;  4XRS A;  3DPL C;  5CYV A;  4A5M A;  4DBQ A;  1SVL A;  2KL4 A;  4LOC A;  4MFE A;  3I71 A;  4E70 A;  2R7T A;  3FHZ A;  5IP9 J;  2HVS A;  2JWT A;  1JXS A;  3W2W A;  3F8F A;  3DLL F;  1IRF A;  3I9V 2;  5TIS C;  2XGX A;  4RBO A;  2I5U A;  1A35 A;  1UZC A;  3OSG A;  2BE5 F;  3WU2 C;  3I4N J;  1TQP A;  5HVQ C;  1R4N B;  2XSJ C;  4X6A J;  2V4J C;  3C3W A;  1D5V A;  2IEK A;  2RV8 A;  3HGY A;  3I59 A;  3M4O J;  2VE9 A;  2Y9Z A;  3BRO A;  3HYI A;  1PUF B;  1E3P A;  1S6L A;  4NUB A;  2H8W A;  2QQA A;  2ADU A;  3FXM A;  1VFC A;  4B48 A;  3S32 A;  2XKO A;  5L3G A;  4XKW A;  1W36 C;  4XBF A;  4HDU A;  2XPV A;  1OIS A;  2JRT A;  3NQO A;  4IO9 F;  1HST A;  3FXQ A;  3QQA A;  4BE2 A;  2M30 A;  3ZQG A;  2QSG X;  2IGO A;  2H1K A;  3GWZ A;  1XCV A;  1FPQ A;  1UCR A;  2WY7 Q;  2EFO A;  5CVV A;  2V9V A;  5IT3 A;  1V5G A;  3GW2 A;  3I58 A;  2ZME C;  2PMH A;  2DN0 A;  2QGU A;  4V19 K;  4A3K J;  1E17 A;  4BKX A;  1S3J A;  3LSH A;  1HKT A;  3PL8 A;  4EJW A;  5EGO A;  1KGS A;  4N9H A;  4UUV A;  1KQ8 A;  4JP0 A;  1LEA A;  1TBX A;  2BVM A;  2K4J A;  3FXO A;  3LL7 A;  2LK2 A;  4M6X A;  5KCM A;  1W1W E;  3RTR A;  3VPR A;  1ZRC A;  5FRN A;  4LLL A;  2GA2 A;  3IP4 B;  2BY0 A;  5IOZ A;  2XGD A;  2HNH A;  2MGQ A;  4ZYH A;  2R7U A;  3FM3 A;  1QO0 D;  3P7N A;  3HOX J;  1IDZ A;  1W5S A;  2R7F A;  5TJJ A;  4CYC A;  2ZB9 A;  2CUE A;  4F55 A;  4HX8 A;  4KT5 C;  5J8C A;  2IA1 A;  5D8K B;  1UG2 A;  3UKG A;  2IA2 A;  1IV8 A;  2JPB A;  3BJ6 A;  3WTT C;  3GEZ A;  1Y1V J;  4XMY A;  2Y2Z A;  3GFM A;  3PNT A;  2KMU A;  2YX4 A;  4RAF A;  4N0B A;  1Z3Y A;  1JUP A;  3ASN H;  4M3B A;  1WGX A;  3V42 A;  4F93 B;  1KQ0 A;  1ETW A;  3AG3 H;  3DKW A;  1K6Y A;  1L0O C;  1XGO A;  1S8N A;  2NVY J;  2CUZ A;  1UST A;  3F21 A;  2BY3 A;  3HRM A;  1OR7 C;  2V1X A;  2Z99 A;  2H6C A;  3GVA A;  1OCO H;  3K4J A;  2MSY A;  3TW7 A;  3T1B A;  3BY6 A;  2DFI A;  5ILV A;  2DT7 B;  1A36 A;  2PBI A;  1Y39 A;  2ZME B;  4GO1 A;  2M45 A;  3ZXS A;  3CDI A;  3C18 A;  5CVI A;  2XHK A;  1I50 J;  1CQT A;  3CTA A;  4ZJZ A;  2CWE A;  1V54 H;  4XQF A;  2QLZ A;  3DXJ F;  3SQN A;  3IH4 A;  2IXS A;  4CYD A;  4U7B A;  2K02 A;  2CRG A;  3D5S C;  1FBS A;  4KMF A;  4I98 B;  3D5L A;  2LTP A;  4PJN A;  3RPU A;  3NAU A;  5K7F A;  1UHM A;  4JBA A;  5FFZ A;  2MFZ A;  1QZY A;  1Z6T A;  2WBM A;  1FEX A;  2PQ8 A;  1T8I A;  3GLL A;  2FQ3 A;  3K69 A;  4ENN A;  2DA5 A;  1YYV A;  2WV1 A;  2HEO A;  1IUY A;  3RPU D;  4RB2 C;  3KYD B;  2V1D A;  2VOP A;  2MD5 A;  2NXN B;  3BCA A;  3K1M A;  1XGM A;  1RES A;  1VND A;  4ESB A;  1YE9 A;  3IWZ A;  2L7Z A;  1MSE C;  4CHU A;  3E5Q A;  2IT0 A;  1XCB A;  3OYM A;  2M9H A;  2WTE A;  1BC8 C;  4BE1 A;  1VQ7 I;  4I6Z A;  2YS9 A;  2JUC A;  4UNO A;  2RNJ A;  4YFX F;  1MJ9 A;  1X3W B;  2DI3 A;  1KU9 A;  3K4N A;  5BS6 A;  3LSR A;  2OZ6 A;  3U2R A;  2PMZ N;  3WTV C;  2EFP A;  1Z6R A;  2XAH A;  1WJE A;  2F5C A;  2VXD A;  4Y7N J;  2Y69 H;  4HEA 2;  2GOX B;  3U9G A;  2FRH A;  1ETY A;  2M5W A;  5CVJ A;  3OL4 A;  4A0Y A;  1X19 A;  3VSL A;  2H94 A;  5CJ9 A;  1X2N A;  1FJL A;  1LFP A;  1ZQ3 P;  3MCZ A;  1G3T A;  3HGG A;  2XF7 A;  4PSX A;  1BBY A;  1T38 A;  2XAQ A;  2VBZ A;  1IO2 A;  4LIU A;  1B72 A;  4IHY A;  2LLK A;  4BBR J;  4KYW A;  4HYE A;  1FT9 A;  1KU7 A;  3N97 A;  2Y0S A;  4PCQ A;  4ZYA A;  4HAM A;  2X4H A;  3FMR A;  5LFA A;  2FF4 A;  3NRV A;  5FB2 A;  3MZY A;  3OOU A;  2O8X A;  2LMD A;  1YJN I;  3WG7 H;  3FMQ A;  5CVR A;  3K6G A;  3BG7 A;  3T0Y A;  3V7C A;  3VOE A;  1FTT A;  3MWM A;  3TOB A;  5LRS A;  1YLF A;  2NNN A;  2QZ8 A;  2IRF G;  3J80 K;  5EEA A;  1FIP A;  3BPX A;  3AL0 C;  1EKE A;  4MO7 A;  2KZG A;  2WAE A;  4R1H A;  1IN7 A;  3GFI A;  4QIW N;  4PGH A;  2E2J J;  4MIM A;  2ZNY A;  3EUH C;  4IVN A;  4D5C A;  2FUG 2;  4I0A A;  3V7R A;  5JVT A;  2M87 A;  2CUF A;  2Z2S B;  4ZH4 F;  4Y17 A;  2H09 A;  3GBG A;  3I3L A;  3NWT A;  3HOV J;  3RQI A;  2VOD A;  1PYV A;  1YIO A;  5LHG A;  5E1Z B;  3BR3 A;  5EF6 A;  5J6X A;  3H5N A;  2QSH X;  2V7F A;  1S7O A;  2OU2 A;  3EQL F;  3TMO A;  1HLV A;  1HKQ A;  2DK8 A;  3JSP A;  2XV4 S;  4L5E A;  2D1H A;  3WTZ A;  3HOT A;  3CC4 I;  3MMY B;  5F1J A;  1BM9 A;  2CG4 A;  1BR4 A;  2CU7 A;  1RR8 C;  4V2F A;  1DQU A;  3F8C A;  4QLC U;  1PP8 F;  2HQ5 A;  2E7W A;  2HR3 A;  4Z6Y A;  3J7A Y;  3ZMU A;  2EV0 A;  2KPM A;  2KZV A;  5E3N A;  4XRM A;  4M71 A;  1R1T A;  3CCV I;  1ZLK A;  3E6M A;  3K2A A;  5CLS A;  4MHG A;  4L18 B;  4P9F A;  3E1S A;  2X6W A;  5F64 A;  3AL0 B;  1JT6 A;  2R7S A;  2HWV A;  3AG2 H;  2CQK A;  2BW3 A;  4D0P A;  5FO5 A;  1SD5 A;  4KT6 A;  1OR7 A;  5BNG A;  4ESJ A;  1PDN C;  1D8J A;  4E7L A;  2DAO A;  1R71 A;  2A05 A;  1VQ8 I;  1X1A A;  2P6T A;  5LGN A;  2AQF A;  3VYS B;  1VQ6 I;  5HLT A;  1SD4 A;  4CCN A;  5IT9 Z;  4MFD A;  1F5T A;  1P4W A;  5E3O A;  4HSR A;  4AIJ A;  2V9K A;  1TQI A;  3OR1 C;  4LIT A;  3Q0U A;  5IYD J;  3W6V A;  5J3L A;  4M9S A;  5F27 A;  2PFB A;  4MQV A;  5EG0 B;  5D5X B;  4II2 A;  4NQW A;  2PG4 A;  3C2H A;  1ZEL A;  1YJW I;  2W48 A;  2F2E A;  2BVL A;  2VPL A;  3CCQ I;  5K5R A;  2EH3 A;  3DV8 A;  2KJC A;  2TCT A;  1FWZ A;  2DYR H;  1WPK A;  4IF4 A;  2LKS A;  3HPG A;  4XM3 A;  1O7L A;  2K9S A;  3WTS C;  1BC7 C;  4IQJ A;  2KIS A;  2Z33 A;  3F6V A;  3I4P A;  2A5Y B;  5J1Y A;  1X3U A;  2DOD A;  2HYG D;  2FBI A;  1F9N A;  4KIG A;  4XLC A;  1LDK B;  2VKV A;  1U9N A;  2X1C A;  1O3T A;  2QQB A;  2XRN A;  3ESW B;  2KRH A;  4BE0 A;  4Q5S F;  1SFK A;  2LF7 A;  3FXU A;  3CCY A;  5CQG A;  1G3W A;  2JA6 J;  1VTN C;  2GAU A;  1D0X A;  4A5N A;  4EGY A;  1O3Q A;  4IL6 C;  4E7Z A;  4PUS A;  5FRO A;  1IAW A;  3J80 Z;  5GAH J;  4DZP A;  1PP7 U;  3S93 A;  4KDP A;  2VJ4 A;  5LEJ A;  2V79 A;  2CUJ A;  3KYC B;  5E8G A;  3JCU C;  4K2E A;  1A04 A;  3BQY A;  4BQO A;  1EA3 A;  3X2Q H;  1V5E A;  4UXN A;  3TOA A;  2AS5 F;  3K4C A;  1R22 A;  5LRR A;  1OFC X;  4ENM A;  1Z3X A;  3DTE A;  3SFZ A;  4DOZ A;  2V1N A;  1AHD P;  3HEF A;  2BGC A;  3Q5F A;  1HDD C;  3H1C A;  5KAF C;  2RKH A;  1SC7 A;  4EM0 B;  3L2U A;  3DU6 A;  2K3F A;  3FHN A;  3WTY C;  1RKW A;  1IN8 A;  1LKX A;  3GZN B;  3H5A A;  3WTX C;  2Q2E B;  4UUS B;  1ZTR A;  1QHH D;  2P7V B;  1Z91 A;  3F6O A;  2ECC A;  3TO6 A;  2AXL A;  5E8I A;  1ZR4 A;  1P2F A;  4BXF A;  4II3 A;  2A07 F;  1QPM A;  3DFG A;  3S2H J;  1J59 A;  2OAZ A;  2LR8 A;  2KT0 A;  4HA8 A;  1YFH A;  1KZH A;  2M0M A;  2UUZ A;  2MW8 A;  1ZGJ A;  3GUD A;  5E1W A;  5K5Q A;  1RIO H;  4BQA A;  2CO5 A;  1S29 A;  4L0Z B;  2FA5 A;  2EPF A;  2R7D A;  4CCL A;  4W97 A;  2A6H F;  3M8J A;  4RLF A;  4LLN A;  3HOW J;  5JFR A;  1H89 C;  3QOE A;  1R58 A;  3VDX A;  5GTI C;  3QP5 A;  1E3H A;  4GRI A;  2BHY A;  3JRI A;  4KN7 X;  1U0J A;  1J75 A;  2NVX J;  1AWC A;  3LA3 A;  1OLT A;  3BJO A;  1RR7 A;  3VFZ A;  2QEN A;  1LDD A;  1D1C A;  5EYR A;  1D0Z A;  1R5H A;  4BU2 A;  2M3A A;  2JK3 A;  1FZP B;  4A0Z A;  4C3J J;  1LEB A;  2B0L A;  3TQN A;  2NS8 A;  1G6N A;  2R5Z B;  3EUH A;  2VXZ A;  4RA2 A;  1MBH A;  5FLV A;  2DFE A;  3DEW A;  3ZRG A;  4CSW A;  2DOE A;  1IV6 A;  3OYI A;  3I53 A;  2N8G A;  3RKW A;  1IUF A;  1XMA A;  3BR6 A;  1DGW Y;  1VQK I;  3BP8 A;  1S7E A;  1QHG A;  3IRR A;  4M3E A;  3NAR A;  5EEG A;  4UB6 C;  2WY8 Q;  4BHC A;  3NWS A;  4LG0 B;  4P55 A;  1DGR M;  3F8N A;  2ZO4 A;  5J47 A;  1RZ4 A;  5IP6 A;  2BHZ A;  1SVO A;  4N4O B;  4DBR A;  4C3H J;  2HQA A;  1LE8 A;  4CXF A;  1VQ9 I;  4M6V A;  3S3N A;  5LD2 C;  1LVK A;  1SMY F;  3FM5 A;  1B9N A;  2L9R A;  4C9Y A;  3L9F A;  3QYF A;  2ZBK A;  3E3V A;  3G6E I;  2M7A A;  1YX5 A;  5JLW A;  1OYY A;  5H6Q A;  4ZZL A;  5ED4 A;  3JRD A;  3CUO A;  3PNV A;  2DJI A;  5LGT A;  2HXO A;  2QBY B;  3TDU C;  1V3F A;  2A69 F;  4IRH A;  1OCR H;  3A0B C;  2NVU B;  1GXQ A;  4QTR A;  2Y31 A;  5E1X A;  1IF1 A;  1XC5 A;  4IRG A;  4A3B J;  2E1N A;  2ISZ A;  2OF7 A;  2LSO A;  5DTD A;  4GGG A;  4UVA A;  2Y9Y A;  2IA0 A;  4HQM A;  2MC4 A;  4YFN F;  5CPR B;  4UY8 I;  1VF9 A;  1K61 A;  4C3I J;  2HQR A;  4OMZ A;  1X1B A;  3ZMT A;  1TZL A;  1OPC A;  2RQP A;  1KON A;  1ZR2 A;  2XGE A;  4PFP A;  2HZD A;  2KP6 A;  4XLA A;  2XRL A;  2R5Y A;  1ERD A;  1E0E A;  3ELK A;  1B6A A;  5BPD A;  4X1E A;  2HI3 A;  2L9S A;  1F4K A;  2IS2 A;  2ZFU A;  2KDZ A;  4YII A;  1F1Z A;  3MEX A;  2OD5 A;  4LK1 F;  1YHQ I;  4ZDP A;  3KEQ A;  4QWQ A;  2BOL A;  2E35 A;  4BDZ A;  3F9K A;  3DPT A;  3FBN B;  2OBP A;  3LSI A;  3MD2 A;  4CH7 A;  2JMW A;  1SFO J;  5ILS A;  2QUF A;  3GFL A;  1E3O C;  1DPU A;  2EQR A;  4B1R A;  2F5F A;  1HOM A;  5GPA A;  1WI9 A;  2EV5 A;  3WOD F;  2LG4 A;  2ID6 A;  4XOT A;  2UZK A;  2EZK A;  4F7Z A;  3AG1 H;  3DCF A;  3MKW B;  2GIV A;  2X51 A;  4CO8 A;  1J2X A;  2VE8 A;  3KE2 A;  3CLO A;  3WG9 A;  3BWG A;  2K27 A;  2MH9 A;  4B43 A;  5B3S H;  2KJB A;  2PJR B;  5DCF A;  4RB3 C;  2ESN A;  2HOE A;  3B6C A;  3OYD A;  1LPQ A;  3T5X A;  1UAA A;  2W1O A;  5DV5 A;  4D9J A;  5D6E A;  3MKL A;  3OYG A;  3E5X A;  2O8K A;  1R5G A;  2DQR A;  1U8B A;  2CMP A;  1YJ9 I;  3CME I;  3PM1 A;  4CA0 A;  4HQE A;  4Y4R A;  4G9Y A;  1UEL B;  1XB4 A;  4PZJ A;  2DXI A;  4Y52 J;  5FKK A;  4EGZ A;  1J09 A;  2AHQ A;  1SAU A;  3KZI C;  3IHU A;  3CF2 A;  2HYJ A;  2XAJ A;  3CMM A;  1D1B A;  2O5R A;  3FXJ A;  3WE2 A;  3K4L A;  4OIQ F;  2R5Z A;  4A6D A;  5DYM A;  3H3V K;  2Y0S N;  2ID3 A;  1MDM B;  3CZ6 A;  2X6X A;  4Q48 A;  1YTY A;  4HZF A;  4LGW A;  4Q4Z F;  3LNQ A;  1OMI A;  5J1R A;  3GFJ A;  1OYI A;  5CKT A;  2RN7 A;  3DP7 A;  2JVH A;  1IRX A;  2VC0 A;  1TWA J;  2K4B A;  2K5C A;  1AKH B;  4AWX B;  1K78 B;  2XUB A;  4HNT A;  1DU6 A;  1AOY A;  2MA3 A;  4M3G A;  4RAG A;  2EZH A;  5JLX A;  4NDL A;  3CQZ J;  4XR6 A;  1FSE A;  1QNT A;  3S8P A;  1T2K A;  1ZHF A;  5HLG A;  2P5L C;  2DPD A;  3Q9S A;  5DS9 A;  1BI2 A;  3A01 B;  2YU9 J;  2GZW A;  1QBJ A;  4HPQ A;  4YIR X;  2QSF X;  4G6Q A;  2LC2 A;  1XGS A;  1Z67 A;  2EIM H;  1O7F A;  3QU6 A;  1APL C;  4ZDO A;  1MIJ A;  1BIB A;  3HHG A;  4NC6 A;  1WH7 A;  3RYR A;  5IY5 H;  5GP9 A;  2A6E F;  3OYA A;  1R36 A;  2L9V A;  3V4G A;  2J5P A;  1ULY A;  4C2M J;  3IV5 A;  4U0W A;  1WQ2 A;  3FDY A;  2OZU A;  3EET A;  3PQJ A;  4KUM A;  3OMY A;  3BR5 A;  1IGN A;  2DPU A;  2ELH A;  1RKT A;  3IWF A;  3K9T A;  4FHT A;  4BJT A;  5KVR A;  4ZYD A;  1NH3 A;  1RUO A;  1YG2 A;  4BQN A;  3PQK A;  1YS6 A;  4I09 A;  2LY1 A;  3H92 A;  5K1Y A;  1ACI A;  1VQN I;  2A68 F;  3CD6 I;  4H4K C;  1O3S A;  2PJP A;  3ZOB A;  1OKR A;  2VT3 A;  3G4S I;  2IW5 A;  3OYF A;  4OOI A;  1VZ0 A;  3CCR I;  2TDX A;  3KP3 A;  5IPA A;  3E7L A;  1R7J A;  2ELK A;  3C1D A;  2FJ1 A;  1YRN A;  1TP4 A;  2V1U A;  4AIH A;  4CGZ A;  2K3P A;  2VQL A;  2UXX A;  2RRE A;  4FT8 A;  1TNT A;  5IYB J;  4A0X A;  3MZH A;  4XN3 A;  1SMT A;  2HTS A;  2JSC A;  1ENH A;  3OIO A;  1X4O A;  2DDB A;  3G2B A;  3JAM Z;  5GPC A;  2R7X A;  3ZCO A;  4Z2Y A;  3LOC A;  4MTE A;  1YI2 I;  3CUQ A;  3A03 A;  1MKM A;  2QKL B;  4FX0 A;  4HBL A;  1B9M A;  3PIO F;  1BJA A;  3LST A;  4F91 B;  5M3M J;  2X1D A;  3KPH A;  1FOX A;  1TTY A;  1KQ9 A;  3RDI A;  3LFU A;  3MVP A;  1EV7 A;  1U6G A;  1HKS A;  2FNP A;  3FWE A;  2EA4 A;  1BR2 A;  5H20 A;  3RKX A;  3MKZ A;  4WXH A;  1FOY A;  5DUK A;  1I6H J;  2FXA A;  3H5R A;  1WJD A;  2DU9 A;  2LRE A;  1ZRE A;  2G0E A;  3ZQQ A;  3ZN0 A;  4DGW B;  3K0L A;  1RC9 A;  2B9S A;  1X1D A;  1MBF A;  4G7H F;  2G7H A;  1K83 J;  4E7J A;  3ZMD A;  4JX4 A;  3M9A A;  2LDU A;  2DT5 A;  1LFB A;  3TED A;  2JTV A;  3S1R J;  5AIP A;  1H9G A;  2E34 A;  3B73 A;  2Z5U A;  4BL0 B;  5K7H A;  5LHH A;  1YW9 A;  1C0W A;  2ZXW H;  1PVE A;  3L2Q A;  2CFO A;  2VI6 A;  4IHW A;  5DCM B;  3I55 I;  3PO3 J;  3REO A;  4G7O F;  1T6S A;  4G6D A;  1ZRF A;  2K7L A;  3LFK A;  3KP5 A;  1B1B A;  1IRZ A;  2EIL H;  3DPU A;  2EBI A;  1JJ8 C;  3H9J A;  4AYB A;  4PJJ A;  2JN6 A;  3ZPL A;  2EJR A;  1ON1 A;  3HB9 A;  3CJN A;  2LYC A;  4OAY A;  2JA8 J;  1ZG3 A;  2A5W A;  1YIJ I;  1JKR C;  4YRV A;  2D45 A;  2L01 A;  5JI6 A;  5DM7 F;  3SJM A;  3EUA A;  3M7G A;  5BQT A;  5J4V A;  3A01 A;  2O03 A;  3S15 J;  2ZSI B;  5L3D A;  4EAT A;  1LUJ B;  1F43 A;  1Q1H A;  2F4I A;  2Y0M A;  2XF5 A;  3TGN A;  4HW0 A;  1H88 C;  3DEE A;  2WAF A;  2XKP A;  1K4T A;  3TDZ C;  1PJR A;  3GTO J;  1ETQ A;  1ZAO A;  3E0J B;  3AFH A;  1W0T A;  4IX7 A;  1PUF A;  2XAG A;  1QQI A;  5D8L B;  4A3J J;  3H35 A;  3KX2 A;  5ICC A;  3LAJ A;  3MZ8 A;  5ERI A;  3L1P A;  1VQM I;  1BIA A;  1R23 A;  2L9N A;  4OIR F;  3PUB A;  1K4S A;  5IT9 K;  1I1S A;  3BDD A;  2CQN A;  4WK8 F;  3Q9V A;  2XIG A;  2ZJP F;  1XTA A;  1PUE E;  3BCB A;  4FE4 A;  3ZQF A;  3K1P A;  2M0C A;  3HOU J;  1MND A;  4YG2 F;  3ABM H;  1OQY A;  4A93 J;  1TWG J;  3ZQC A;  1AA7 A;  1NK3 P;  2JVG A;  3SDB A;  2DO7 A;  2K40 A;  1SAX A;  4CZZ A;  3MAJ A;  4U87 A;  4ASN A;  5GAG J;  3DEU A;  1I5Z A;  1D1A A;  4QSH A;  1DDN A;  2GBY A;  3HUG B;  3M8F A;  4R79 A;  1X4P A;  1I3Q J;  4A69 C;  3ZQ7 A;  3Q0V A;  1UHS A;  3U1K A;  3R0J A;  4OIO F;  1TWC J;  4W1U A;  2LVS A;  2W82 A;  1HW1 A;  4P96 A;  2KKO A;  2R7O A;  3CCE I;  3CDH A;  3OYJ A;  3LWF A;  2LH9 A;  2RVC A;  3S17 J;  3OIQ A;  4I99 C;  5IYC J;  4ZTF A;  5J8F A;  3GTG J;  2VBW A;  4A3C J;  3OYE A;  2IAI A;  5JR3 A;  2MLG A;  1U3E M;  1AU7 A;  2WC2 A;  4BAY A;  2HQN A;  4RGR A;  3V8K A;  4FAS D;  1WJ5 A;  1RI7 A;  4XID A;  1QU3 A;  2AO9 A;  2BY1 A;  2VJJ A;  5LLQ A;  4E4H A;  3VWB A;  2ZSH B;  1S5L C;  1WJB A;  3M1E A;  3DBL B;  1W36 D;  5DDG A;  3H9Q A;  5TGT A;  2ZME A;  3ZMS A;  2V26 A;  3A02 A;  4DQ2 A;  3OS1 A;  2DQL A;  4RB0 A;  4ENK A;  1FC3 A;  2FMY A;  2VPR A;  3K70 C;  4CDG A;  1BI0 A;  3EDP A;  2O7O A;  2F4O B;  2HOT A;  4LK0 F;  5E17 F;  3ZGK A;  1TC3 C;  2FNA A;  1LQ1 A;  2HTJ A;  4G12 A;  5E3M A;  3E6D A;  4CIC A;  1UB9 A;  2L02 A;  4YFK F;  1HXD A;  2F4M B;  1SD7 A;  4I7H A;  4MQ9 F;  4B8X A;  2E60 A;  1ITY A;  2FML A;  2XAS A;  2HVR A;  2KDO A;  2QA4 I;  3H9G A;  3MKY B;  3ZQI A;  5HS9 A;  4DYR A;  2BXY A;  2STT A;  4CUG A;  3V7S A;  2NOG A;  2E5N A;  5LEK A;  2VKD A;  2W00 A;  3K4B A;  2QQ8 A;  2VJ5 A;  3U1D A;  1X1P A;  1Y1W J;  3CJR B;  4OIP F;  1ZRD A;  1N78 A;  3KZZ A;  5FLX K;  3KZY A;  3QPH A;  2W85 A;  2QM3 A;  4TV7 A;  2V6C A;  4BHP A;  5FKM A;  2IJL A;  2IVM A;  1LB2 A;  3ABL H;  4A3M J;  3IC7 A;  3AKZ A;  1MJB A;  2R3S A;  1TW3 A;  5HLH A;  1LNW A;  2BY2 A;  4B47 A;  3GTJ J;  2A61 A;  4RGU A;  1T0F C;  4LIV A;  1GXP A;  1FOW A;  1XN7 A;  1HW5 A;  2VQG A;  2ZJR F;  1WKM A;  4RMN A;  2LP0 A;  2H6B A;  1JHH A;  3KCC A;  3S3O A;  3FIS A;  4RGX A;  1P92 A;  2EIN H;  4NNJ A;  3SXY A;  3OYH A;  3GTM J;  2P0W A;  4LB5 A;  3RI4 A;  2QVO A;  4KIF A;  5FLM J;  4BNC A;  2PN6 A;  2RQQ A;  2CQ7 A;  3JRA A;  1V55 H;  2R7W A;  2OUM A;  3WE3 A;  3RKQ A;  3PNY A;  2LBF B;  5E3L A;  2CW0 F;  4GCV A;  4BGD A;  4PSW A;  5HOD A;  3JTG A;  1R1U A;  2DFH A;  3TW6 A;  4IOA F;  1DP3 A;  3SZG A;  3OL3 A;  2NAZ A;  4L0Y B;  2OCC H;  1UJ8 A;  2FOW A;  1J0R A;  1LJ9 A;  2EIK H;  2KIU A;  4BYY A;  3E5U A;  1R49 A;  3ISP A;  2XPW A;  1G3S A;  2W57 A;  3BR2 A;  1MD0 A;  1JUS A;  2ZJQ F;  5BMZ A;  1ZG1 A;  2LNB A;  2NS0 A;  3O6B B;  3OOP A;  5CQE A;  2LKX A;  2IS6 A;  4XKB A;  1HW2 A;  4UV9 A;  3IAS 2;  3SZT A;  4FQG A;  2JT1 A;  5F6F A;  4FET A;  4RB1 A;  4Q47 A;  1FP2 A;  3JRH A;  4E7H A;  3DWL E;  4EMS A;  1R5I D;  3QPT A;  1DPR A;  6PAX A;  1MMG A;  3R0A A;  3KEO A;  4I76 A;  1GT0 C;  2QCO A;  1R6R A;  2GXA A;  1NTC A;  3DTI A;  5FGM A;  3BJA A;  3E6C C;  1JGS A;  2HDD A;  5KHD A;  2MBF A;  4HV6 A;  1JGG A;  1X3Z B;  2B7E A;  4FX4 A;  5E18 F;  1H0M A;  2K9L A;  4XRF A;  2DTZ A;  3UNG C;  3SZP A;  5J4Y A;  3DBR B;  4F52 A;  1D0Y A;  5B5E C;  5L3C A;  3MFK A;  4S04 A;  1IN5 A;  4N9I A;  2UV1 A;  3CCU I;  2OQR A;  4XOR A;  2BYV E;  3DTK A;  3WHB A;  3CLQ A;  1T98 A;  3HM5 A;  3RCO A;  1YO5 C;  1IG7 A;  2YR2 A;  5D4R A;  3HSF A;  1TT5 B;  3QYE A;  5D6F A;  1ZKG A;  2LY2 A;  1Z7U A;  1XDU A;  1IZ1 A;  1GVJ A;  4ON0 A;  2PEX A;  3I0T A;  2E2I J;  3OV8 A;  4XN0 A;  1FLI A;  1SEU A;  1HCR A;  2ME0 A;  1W5T A;  5FLX Z;  2E5Z A;  2D5V A;  2VB6 A;  1BI3 A;  4AID A;  4CZC A;  3G71 I;  1B8I B;  1SFX A;  1R4M B;  5F0F A;  3HTS B;  2VC1 A;  1FNN A;  2E36 A;  4PJM A;  3E6B A;  2P6S A;  3BR1 A;  2WAQ A;  1BJZ A;  3D5R C;  1BOA A;  1FX7 A;  3H3U A;  1OCP A;  3OSF A;  3QRF F;  1B4A A;  3BZK A;  2VOO A;  1GHC A;  1EH7 A;  2IBD A;  3BG6 A;  2JSP A;  4XSZ F;  4IKF A;  1GV2 A;  4U88 A;  3GTQ J;  1SVM A;  2FSW A;  2HPI A;  3AAF A;  2LF8 A;  4Y3O A;  1EF4 A;  1POG A;  3BG9 A;  2KRF A;  2Q1Z B;  2YUS A;  2EA2 A;  2F5E A;  3T8T A;  3GX4 X;  4IHT A;  2IGN A;  2QKM B;  4IJA A;  4I02 A;  2DA1 A;  4GYG A;  3DBH B;  5DEQ A;  3L7W A;  4B3A A;  2DOF A;  3LA7 A;  5D5W B;  3A2K A;  3GZ5 A;  5ICE A;  1O57 A;  2ZCW A;  2HXI A;  5EG0 A;  4Y33 A;  4EJU A;  2JPC A;  4LFU A;  1ORK A;  1QPI A;  1YQA A;  3ABU A;  3DU5 A;  1H9T A;  2DYS H;  3TL4 X;  1G2H A;  3HRU A;  1CF7 B;  3HBL A;  4AU7 A;  2I8D A;  1VQL I;  2XF6 A;  5L3E A;  3PJR A;  2KHM A;  4BEH B;  2KFD A;  3RPQ A;  3HOS A;  3JSO A;  4GYI A;  3CMA I;  1QZE A;  4R8H A;  2H27 A;  3WU0 A;  1FTZ A;  5HDK A;  5FKN A;  2JQ7 A;  1KA8 A;  4FTH A;  3O8H A;  3CC2 I;  3HRT A;  5KNL A;  5D4S A;  2G9W A;  3RKY A;  4MTD A;  4PK4 A;  4RS8 A;  3R61 A;  1BOB A;  2P5K A;  1G8X A;  1XSD A;  4EJT A;  1MH4 A;  1SAN A;  4IXA A;  1MMS A;  1FBQ A;  2IS1 A;  2BZT A;  1IXC A;  3MN2 A;  3ABT A;  1P6R A;  1FBU A;  5CVU A;  4F3Q A;  3VYU B;  1FIA A;  4QPO A;  4BXU A;  2OCE A;  2DA2 A;  4ZDL A;  5JHU A;  2PI0 A;  4ZZD A;  1HC8 A;  3W3C A;  2FE3 A;  1SD6 A;  1JUM A;  1O4X A;  4U0V A;  3BTC A;  2RC4 A;  4AYB N;  1DP7 P;  2ELJ A;  3P9I A;  3L2V A;  3LSG A;  1WSU A;  3EYY A;  4P1W A;  4DW6 A;  2MG4 A;  2WB1 A;  3QP6 A;  1D5Y A;  2DT6 A;  2MC3 A;  5FFX A;  2NS7 A;  1ZH5 A;  4IEJ A;  4J19 A;  3FXL A;  2IS4 A;  2W24 A;  1XDS A;  4C2T A;  2JA7 J;  3TBI A;  2Y75 A;  3SHF A;  2Q2E A;  5M3F J;  1U5T C;  3M07 A;  4UUS A;  3DF8 A;  3CJT B;  1HSJ A;  1O3R A;  4UVC A;  3OYL A;  2R7R A;  5EGO B;  2V9P A;  4KJZ A;  3HSR A;  3JAM K;  1RET A;  4BDY A;  3VSK A;  4D7M A;  2Y30 A;  1IJW C;  3L2C A;  4XK4 A;  3ECO A;  2LY9 A;  1BW5 A;  5BPI A;  1ONV A;  2GM4 A;  2X0L A;  2DA6 A;  1MMD A;  3PSF A;  1JTX A;  2KIM A;  4XRS G;  4KFC A;  4M9Z A;  4EQQ A;  4CYC B;  1QZZ A;  5L3F A;  1XG1 A;  3SEZ A;  2X48 A;  4BHB A;  1SFU A;  1N25 A;  3OS2 A;  2IGK A;  4A3I J;  2X9D A;  3LSM A;  3ZMV A;  3B6A A;  1ODD A;  4M72 A;  3J7Y J;  1B8I A;  3HL2 A;  2COM A;  3BG5 A;  1E2X A;  3IKV A;  3FBI B;  3WTW C;  2JA2 A;  2CV0 A;  5TRD A;  4BJ5 C;  1FY7 A;  2L2O A;  1Y0N A;  5J1U A;  4KMU X;  2GQQ A;  3ECH A;  4JYK A;  4NHJ A;  2M2E A;  5C4X J;  2ZXI A;  3KLO A;  3FK6 A;  2CFX A;  1ZGA A;  2CQX A;  3FKI J;  3P9C A;  5HDN A;  1U5T B;  2EB7 A;  3FF5 A;  1MH3 A;  1M1E B;  4BBS J;  1WVR A;  4XLF A;  3OYC A;  4LG0 A;  3I64 A;  1R00 A;  2A6T A;  3JRG A;  4I2O A;  2L7F P;  2MH2 A;  4MEY F;  2DMN A;  5HNF A;  3WU1 B;  2Q0O A;  2L7M P;  1JHF A;  2PX9 A;  2F48 A;  2QYO A;  3HJE A;  1ETX A;  4A6E A;  3F22 A;  1TT0 A;  1X1C A; 
#chains in the Genus database with same CATH homology
 4ENJ A;  4P5O A;  4JK1 X;  2JZY A;  4B09 A;  3RJP A;  4I0B A;  2D1V A;  1L3L A;  2QBY A;  1BI1 A;  2FU4 A;  2F5D A;  3LAP A;  4G7Z F;  4IHS A;  2YX7 A;  2GWR A;  4EJO A;  3VB2 A;  3G73 A;  2UXN A;  1U78 A;  2L3D A;  3KFW X;  5FD5 A;  4PGG A;  5LBQ A;  4NB5 A;  5A2Q K;  2ZFW A;  4KIB A;  5KK1 A;  4M9X A;  4LB6 B;  3MQ0 A;  3QAH A;  3N4M A;  4U7D A;  1IXR C;  2STW A;  1EH8 A;  2L54 A;  1IW7 F;  4M74 A;  5HS7 A;  2EFN A;  4G8X A;  4AIK A;  2BEO A;  2HGC A;  1NHA A;  2DW4 A;  3B02 A;  4MNU A;  2IPQ X;  1HQC A;  1Y0U A;  2RDP A;  3PFI A;  5D5U B;  1R1V A;  1JE8 A;  2EV6 A;  4IPA A;  3ML6 A;  2HDC A;  3QU3 A;  3WGH A;  3V8L A;  1UHW A;  4PDK A;  2WV0 A;  2A3S A;  3O2P E;  1CGP A;  2P5V A;  1ZN2 A;  2D2W A;  2Q8K A;  3R4K A;  4XSX F;  2Y48 A;  3GLX A;  1REP C;  3KP4 A;  4KIC A;  2HZT A;  2K86 A;  2L4A A;  1U5T A;  4KA4 A;  1W7P B;  3L00 A;  2DTR A;  1K78 A;  3IL2 A;  3ROU A;  5D5V B;  3ERE D;  2E7X A;  3WGI A;  1TNS A;  4ZYE A;  1MJA A;  3NEU A;  3FXR A;  5FD6 A;  3WTU C;  2FOK A;  4WF2 A;  1UFM A;  2P7C B;  5HOO A;  4EM2 A;  3LQR A;  4UV8 A;  5AON A;  1ZYR F;  4M73 A;  2IP2 A;  2O3F A;  3GO5 A;  4HLY A;  2DLL A;  3R6S A;  2QWW A;  5A2Q Z;  1B59 A;  1ZLJ A;  3TO7 A;  5DD4 A;  3ZMZ A;  1KU2 A;  1KYW A;  3FZV A;  4HF1 A;  2EFW A;  4P9U A;  1MDM B;  1WRJ A;  2BV6 A;  1J5Y A;  4JQF A;  1FYL A;  3RYP A;  2WWY A;  3S2W A;  3CO6 C;  4HDV A;  2C6Y A;  2GXG A;  3BOQ A;  4OIN F;  5LHI A;  3F8M A;  5DUI A;  3KLN A;  2Z9O A;  2LKP A;  4O5V A;  5HDG A;  1XSX A;  3GF2 A;  4HLX A;  4XLP F;  2RGV A;  5DD8 A;  3V8J A;  4WCG A;  1J9I A;  4HF0 A;  2ESH A;  1QGP A;  4KNY A;  1XGN A;  2OA4 A;  4YIF A;  2HKX A;  1FYM A;  2EK5 A;  1FSH A;  5DCM A;  1I6X A;  2GA1 A;  4HX7 A;  5E20 A;  4HF2 A;  1TW2 A;  1U8R A;  1W7P A;  3KP6 A;  4ESF A;  1ZG5 A;  4MGR A;  2FEZ A;  4LJZ F;  1W4M A;  5HLI A;  2HYF A;  1W7P D;  1OYW A;  4MEX F;  4L5J A;  3P9K A;  2Z3Y A;  3HHH A;  3DQV C;  1ZAR A;  3BZ6 A;  3F23 A;  4L9J A;  3HIF A;  2O6G E;  4BH9 A;  4LLG F;  3TKY A;  2ZKZ A;  2HFH A;  3C7J A;  1RNL A;  4G94 A;  1I1G A;  1Z05 A;  2NNY A;  4OMY A;  3I5U A;  2ZJ2 A;  2ACJ A;  4ETS A;  3COA C;  2EWN A;  3HUG A;  1XMK A;  3JW4 A;  3O3K A;  4A12 A;  1MDM A;  2P4W A;  4EM1 A;  5ICG A;  1P4X A;  3L09 A;  2YPR A;  3HSE A;  3W6K B;  2OQG A;  2DBB A;  2XAF A;  5LGU A;  3F8B A;  2O0Y A;  1YW8 A;  3ZP5 A;  5HS8 A;  2XRO A;  1LDJ A;  1FP1 D;  2O61 A;  2DK5 A;  2YSR A;  1U2W A;  3HRS A;  4EVI A;  1WWX A;  4OU0 A;  4AVP A;  3F3X A;  3KET A;  3GZ6 A;  2VBX A;  3IRQ A;  5K5O A;  1I27 A;  4O3M A;  5ILU A;  3T8R A;  3JTH A;  4L9V A;  2QQ9 A;  4M6Y A;  2ZNZ A;  3BPV A;  2BBY A;  4DNC A;  2NRA C;  1D3Y A;  3J7A O;  3J81 K;  1S7A A;  2VT2 A;  1RUN A;  2FBH A;  5BOX A;  3GYH X;  5ICF A;  1FOK A;  4GXO A;  1DUX C;  2VON A;  2UWM A;  3FMS A;  4U0Y A;  4A2U A;  1TQM A;  3R60 A;  1IN4 A;  4WXD A;  3HTU A;  2G7U A;  5AIQ A;  4WX9 A;  3H3Z A;  1SFE A;  1K79 A;  1K6O A;  4WXC A;  3TO9 A;  3LA2 A;  4HX4 A;  5H6R A;  4XLN F;  3M8E A;  2HKO A;  2GXB A;  3KP7 A;  2VN2 A;  2KIF A;  3G3Z A;  4I01 A;  1HBX G;  1STZ A;  4ZYG A;  4IRI A;  4WWC A;  1XD7 A;  2NYX A;  3VOD A;  3LQQ A;  1TLH B;  5L3B A;  3QOP A;  4L9T A;  2ETH A;  3KP2 A;  3CUQ C;  2M8E A;  1K7A A;  4LD5 A;  4AD9 A;  2ZXJ A;  3I59 B;  2EFQ A;  4RGS A;  3GXO A;  3RIR A;  3CO7 C;  1T0F A;  1Z9C A;  3EYI A;  4L5I A;  5F1R A;  2CGP A;  2M1B A;  4Y13 A;  2CSO A;  1FYK A;  3ULQ B;  3D0S A;  4O6J A;  5EEH A;  1KU3 A;  4HOB A;  1IRG A;  3VEP A;  4RAY A;  4EV0 A;  3I54 A;  3FX3 A;  2PMU A;  3J81 Z;  2ISY A;  1T39 A;  2FBK A;  1V4R A;  3E97 A;  1G3Y A;  2HS5 A;  3CUQ B;  4EJV A;  1BN5 A;  1EH6 A;  3K1N A;  1MGT A;  2YU3 A;  1USS A;  2J5O A;  2W84 A;  2XVC A;  3K2Z A;  1IN6 A;  2W25 A;  3WGG A;  2VBY A;  4HV5 A;  2L4M A;  2P8T A;  1ON2 A;  4RAZ A;  4UHT A;  1J7K A;  3ZN1 A;  3F72 A;  4Y15 A;  2E1C A;  1YS7 A;  2CYY A;  2PLY A;  3W6J B;  1G4D A;  1XSV A;  4S05 A;  1D8K A;  4LMY A;  1KYZ A;  4H0E A;  1IXS B;  4UVB A;  2MLK A;  4L9N A;  1Z1D A;  3IKT A;  1LVA A;  1MZB A;  1P4A A;  1CF7 A;  4KN4 X;  1YW7 A;  3DPL C;  5CYV A;  4A5M A;  3I71 A;  4E70 A;  3FHZ A;  1JXS A;  3F8F A;  1IRF A;  2XGX A;  2BE5 F;  1TQP A;  5HVQ C;  3C3W A;  1D5V A;  2RV8 A;  3I59 A;  2VE9 A;  3BRO A;  3HYI A;  1S6L A;  2QQA A;  2ADU A;  2XKO A;  5L3G A;  4XBF A;  4HDU A;  2JRT A;  3NQO A;  1HST A;  3FXQ A;  2M30 A;  3GWZ A;  1XCV A;  1FPQ A;  1UCR A;  5IT3 A;  2EFO A;  5CVV A;  2V9V A;  3GW2 A;  3I58 A;  1E17 A;  2PMH A;  1S3J A;  1HKT A;  4EJW A;  1KQ8 A;  1KGS A;  4N9H A;  4UUV A;  1LEA A;  1TBX A;  2K4J A;  4M6X A;  1ZRC A;  3RTR A;  4LLL A;  2GA2 A;  4ZYH A;  3FM3 A;  1QO0 D;  3P7N A;  1W5S A;  2R7F A;  5TJJ A;  4HX8 A;  4KT5 C;  5J8C A;  2IA1 A;  5D8K B;  2IA2 A;  2JPB A;  3BJ6 A;  3WTT C;  3GEZ A;  3GFM A;  2YX4 A;  4N0B A;  1KQ0 A;  3DKW A;  1L0O C;  1XGO A;  1S8N A;  1UST A;  3F21 A;  3HRM A;  2V1X A;  2Z99 A;  2H6C A;  3GVA A;  3T1B A;  3BY6 A;  2DFI A;  5ILV A;  2PBI A;  2ZME B;  4GO1 A;  2M45 A;  3C18 A;  5CVI A;  2XHK A;  3CTA A;  2CWE A;  2QLZ A;  3DXJ F;  3SQN A;  4CYD A;  4U7B A;  2K02 A;  1FBS A;  4KMF A;  4I98 B;  3D5L A;  3RPU A;  1UHM A;  4JBA A;  5FFZ A;  1QZY A;  1Z6T A;  2PQ8 A;  2FQ3 A;  3K69 A;  4ENN A;  1YYV A;  2HEO A;  1IUY A;  4RB2 C;  2V1D A;  2VOP A;  2MD5 A;  3K1M A;  1XGM A;  4ESB A;  3IWZ A;  4CHU A;  3E5Q A;  2IT0 A;  1XCB A;  2WTE A;  1BC8 C;  4UNO A;  2RNJ A;  4YFX F;  1MJ9 A;  2DI3 A;  1KU9 A;  5BS6 A;  2OZ6 A;  3U2R A;  3WTV C;  2EFP A;  1Z6R A;  2F5C A;  2XAH A;  3U9G A;  2FRH A;  2M5W A;  5CVJ A;  4A0Y A;  2H94 A;  5CJ9 A;  3MCZ A;  1G3T A;  1BBY A;  1T38 A;  2XAQ A;  2VBZ A;  4KYW A;  4HYE A;  1FT9 A;  1KU7 A;  3N97 A;  4PCQ A;  4HAM A;  2X4H A;  3FMR A;  2FF4 A;  3NRV A;  5FB2 A;  3MZY A;  2O8X A;  3FMQ A;  5CVR A;  3T0Y A;  3VOE A;  3V7C A;  3MWM A;  3TOB A;  5LRS A;  1YLF A;  2NNN A;  2QZ8 A;  2IRF G;  3J80 K;  3BPX A;  4R1H A;  1IN7 A;  3GFI A;  4PGH A;  2ZNY A;  4IVN A;  4I0A A;  3V7R A;  5JVT A;  2M87 A;  4ZH4 F;  4Y17 A;  2H09 A;  2VOD A;  1YIO A;  5LHG A;  5E1Z B;  5J6X A;  1S7O A;  2OU2 A;  3EQL F;  1HKQ A;  2DK8 A;  3JSP A;  2XV4 S;  3WTZ A;  2D1H A;  3HOT A;  1BM9 A;  2CG4 A;  3F8C A;  4QLC U;  1PP8 F;  2E7W A;  2HR3 A;  3ZMU A;  2EV0 A;  4M71 A;  1R1T A;  1ZLK A;  3E6M A;  5CLS A;  4MHG A;  4L18 B;  4P9F A;  5F64 A;  2HWV A;  2CQK A;  4D0P A;  5FO5 A;  1SD5 A;  1OR7 A;  4ESJ A;  1D8J A;  1PDN C;  2DAO A;  2P6T A;  5LGN A;  1SD4 A;  5IT9 Z;  1F5T A;  1P4W A;  4AIJ A;  1TQI A;  4M9S A;  2PFB A;  4MQV A;  5D5X B;  4NQW A;  2PG4 A;  2F2E A;  5K5R A;  3DV8 A;  2KJC A;  1FWZ A;  4IF4 A;  1O7L A;  3WTS C;  1BC7 C;  2Z33 A;  3F6V A;  3I4P A;  2A5Y B;  1X3U A;  2HYG D;  2FBI A;  1F9N A;  4KIG A;  1LDK B;  1O3T A;  2QQB A;  2XRN A;  4Q5S F;  2LF7 A;  3FXU A;  1G3W A;  1VTN C;  2GAU A;  4A5N A;  4EGY A;  1O3Q A;  1IAW A;  3J80 Z;  1PP7 U;  4KDP A;  5LEJ A;  2V79 A;  5E8G A;  4K2E A;  1A04 A;  4UXN A;  2AS5 F;  3TOA A;  1R22 A;  5LRR A;  4ENM A;  3SFZ A;  2BGC A;  3Q5F A;  2RKH A;  4EM0 B;  3WTY C;  1IN8 A;  3WTX C;  2P7V B;  1Z91 A;  3F6O A;  3TO6 A;  2AXL A;  5E8I A;  1P2F A;  2A07 F;  1QPM A;  3DFG A;  1J59 A;  2OAZ A;  4HA8 A;  1YFH A;  1ZGJ A;  3GUD A;  5E1W A;  5K5Q A;  1RIO H;  4BQA A;  2CO5 A;  1S29 A;  4L0Z B;  2FA5 A;  2R7D A;  2A6H F;  4LLN A;  5JFR A;  1R58 A;  3QP5 A;  4KN7 X;  1J75 A;  1AWC A;  3LA3 A;  3VFZ A;  3BJO A;  2QEN A;  1LDD A;  1R5H A;  1FZP B;  4A0Z A;  1LEB A;  2B0L A;  3TQN A;  1G6N A;  3EUH A;  2VXZ A;  3I53 A;  3RKW A;  1XMA A;  3BP8 A;  3IRR A;  5EEG A;  4BHC A;  4LG0 B;  4P55 A;  3F8N A;  2ZO4 A;  1RZ4 A;  4CXF A;  1SMY F;  3FM5 A;  1B9N A;  3L9F A;  2ZBK A;  3E3V A;  1OYY A;  5H6Q A;  4ZZL A;  5ED4 A;  3CUO A;  5LGT A;  2QBY B;  3TDU C;  1V3F A;  2A69 F;  4IRH A;  1GXQ A;  5E1X A;  1IF1 A;  4IRG A;  2E1N A;  2ISZ A;  2LSO A;  4GGG A;  4UVA A;  2IA0 A;  4HQM A;  4YFN F;  2HQR A;  4OMZ A;  3ZMT A;  1OPC A;  2RQP A;  3ELK A;  1B6A A;  5BPD A;  1F4K A;  4YII A;  1F1Z A;  3MEX A;  2OD5 A;  4LK1 F;  3KEQ A;  4QWQ A;  3DPT A;  2OBP A;  5ILS A;  2QUF A;  3GFL A;  1DPU A;  2F5F A;  1WI9 A;  2EV5 A;  3WOD F;  2UZK A;  4F7Z A;  2GIV A;  4CO8 A;  1J2X A;  2VE8 A;  3KE2 A;  3CLO A;  3WG9 A;  3BWG A;  2K27 A;  2MH9 A;  2KJB A;  5DCF A;  4RB3 C;  2ESN A;  2HOE A;  3T5X A;  5DV5 A;  5D6E A;  3E5X A;  1R5G A;  2DQR A;  4HQE A;  4G9Y A;  1XB4 A;  4PZJ A;  4EGZ A;  3IHU A;  2XAJ A;  3WE2 A;  4OIQ F;  4A6D A;  5DYM A;  1YTY A;  4Q48 A;  4HZF A;  4LGW A;  4Q4Z F;  1OMI A;  3GFJ A;  1OYI A;  2RN7 A;  3DP7 A;  2VC0 A;  2K4B A;  4AWX B;  1K78 B;  2XUB A;  1AOY A;  2MA3 A;  1FSE A;  1QNT A;  1T2K A;  1ZHF A;  5HLG A;  2P5L C;  2DPD A;  3Q9S A;  1BI2 A;  2GZW A;  1QBJ A;  4G6Q A;  1XGS A;  3QU6 A;  1O7F A;  1BIB A;  3HHG A;  3RYR A;  2A6E F;  1R36 A;  3V4G A;  2J5P A;  1ULY A;  4U0W A;  1WQ2 A;  2OZU A;  3EET A;  3PQJ A;  4KUM A;  2DPU A;  2ELH A;  3IWF A;  3K9T A;  4FHT A;  5KVR A;  4ZYD A;  1RUO A;  1YG2 A;  3PQK A;  1YS6 A;  4I09 A;  3H92 A;  5K1Y A;  2A68 F;  1O3S A;  2PJP A;  1OKR A;  2VT3 A;  2IW5 A;  4OOI A;  2TDX A;  3KP3 A;  1R7J A;  3C1D A;  2V1U A;  4AIH A;  4CGZ A;  2UXX A;  4FT8 A;  1TNT A;  3MZH A;  4A0X A;  1SMT A;  2HTS A;  2JSC A;  3JAM Z;  4Z2Y A;  4MTE A;  3CUQ A;  1MKM A;  4HBL A;  4FX0 A;  1B9M A;  1BJA A;  3LST A;  1TTY A;  1KQ9 A;  3RDI A;  1EV7 A;  1U6G A;  1HKS A;  2FNP A;  3FWE A;  2EA4 A;  5H20 A;  3RKX A;  4WXH A;  5DUK A;  2FXA A;  2DU9 A;  1ZRE A;  3ZN0 A;  3K0L A;  4G7H F;  2G7H A;  3ZMD A;  3M9A A;  2LDU A;  2DT5 A;  2JTV A;  5AIP A;  1H9G A;  3B73 A;  2Z5U A;  5LHH A;  1YW9 A;  1C0W A;  5DCM B;  3REO A;  4G7O F;  1T6S A;  4G6D A;  1ZRF A;  2K7L A;  3LFK A;  3KP5 A;  1B1B A;  3ZPL A;  2EJR A;  1ON1 A;  3CJN A;  1ZG3 A;  2D45 A;  2L01 A;  5JI6 A;  3M7G A;  5BQT A;  2O03 A;  5L3D A;  1Q1H A;  2Y0M A;  3TGN A;  4HW0 A;  2XKP A;  3TDZ C;  1ZAO A;  2XAG A;  1QQI A;  5D8L B;  5ICC A;  3LAJ A;  5ERI A;  1BIA A;  1R23 A;  4OIR F;  1I1S A;  5IT9 K;  3BDD A;  4WK8 F;  3Q9V A;  2XIG A;  1PUE E;  3K1P A;  4YG2 F;  2DO7 A;  1SAX A;  4CZZ A;  3MAJ A;  4ASN A;  3DEU A;  1I5Z A;  1DDN A;  3M8F A;  4R79 A;  3ZQ7 A;  3R0J A;  4OIO F;  1HW1 A;  4P96 A;  2KKO A;  3CDH A;  3LWF A;  2RVC A;  5J8F A;  2VBW A;  5JR3 A;  2MLG A;  1U3E M;  2WC2 A;  4BAY A;  2HQN A;  4RGR A;  3V8K A;  1RI7 A;  5LLQ A;  3M1E A;  5DDG A;  2ZME A;  3ZMS A;  4DQ2 A;  2DQL A;  4RB0 A;  4ENK A;  1FC3 A;  2FMY A;  4CDG A;  1BI0 A;  3EDP A;  4LK0 F;  5E17 F;  2FNA A;  1LQ1 A;  2HTJ A;  3E6D A;  4CIC A;  1UB9 A;  2L02 A;  4YFK F;  1HXD A;  1SD7 A;  4I7H A;  4MQ9 F;  4B8X A;  2FML A;  2XAS A;  5HS9 A;  2STT A;  3V7S A;  5LEK A;  3U1D A;  4OIP F;  1ZRD A;  3KZZ A;  5FLX K;  3KZY A;  3QPH A;  2W85 A;  2QM3 A;  4TV7 A;  2V6C A;  4BHP A;  2IJL A;  2IVM A;  1LB2 A;  3IC7 A;  1MJB A;  2R3S A;  1TW3 A;  5HLH A;  1LNW A;  2A61 A;  4RGU A;  1GXP A;  1XN7 A;  1HW5 A;  1WKM A;  2H6B A;  1JHH A;  3KCC A;  4RGX A;  1P92 A;  3SXY A;  4LB5 A;  3RI4 A;  2QVO A;  4KIF A;  4BNC A;  2PN6 A;  3WE3 A;  2CW0 F;  4GCV A;  3JTG A;  1R1U A;  2NAZ A;  4L0Y B;  1J0R A;  1LJ9 A;  2KIU A;  4BYY A;  3E5U A;  3ISP A;  1G3S A;  2W57 A;  1MD0 A;  5BMZ A;  1ZG1 A;  2LNB A;  2NS0 A;  3O6B B;  3OOP A;  1HW2 A;  4UV9 A;  3SZT A;  2JT1 A;  5F6F A;  4RB1 A;  4Q47 A;  1FP2 A;  4EMS A;  3QPT A;  1DPR A;  6PAX A;  3R0A A;  3KEO A;  5FGM A;  3BJA A;  3E6C C;  1JGS A;  2MBF A;  4HV6 A;  4FX4 A;  5E18 F;  1H0M A;  4XRF A;  3SZP A;  3MFK A;  5L3C A;  4S04 A;  1IN5 A;  4N9I A;  2OQR A;  2BYV E;  1T98 A;  1YO5 C;  2YR2 A;  5D4R A;  3HSF A;  5D6F A;  1Z7U A;  1XDU A;  1IZ1 A;  1GVJ A;  4ON0 A;  2PEX A;  3I0T A;  3OV8 A;  1FLI A;  5FLX Z;  1W5T A;  1BI3 A;  1SFX A;  3HTS B;  2VC1 A;  1FNN A;  3E6B A;  2P6S A;  1BOA A;  1FX7 A;  3H3U A;  3QRF F;  1B4A A;  2VOO A;  1GHC A;  1EH7 A;  4XSZ F;  4U88 A;  2FSW A;  3AAF A;  2LF8 A;  2KRF A;  2EA2 A;  2F5E A;  3T8T A;  3GX4 X;  4IHT A;  4IJA A;  4I02 A;  4GYG A;  5DEQ A;  3L7W A;  5D5W B;  3LA7 A;  3GZ5 A;  5ICE A;  1O57 A;  2ZCW A;  4EJU A;  2JPC A;  4LFU A;  1YQA A;  3ABU A;  1H9T A;  3HRU A;  1CF7 B;  5L3E A;  3RPQ A;  3HOS A;  3JSO A;  4GYI A;  4R8H A;  2H27 A;  3WU0 A;  5HDK A;  1KA8 A;  3HRT A;  5D4S A;  2G9W A;  3RKY A;  4MTD A;  4RS8 A;  3R61 A;  2P5K A;  1XSD A;  4EJT A;  4IXA A;  1FBQ A;  1IXC A;  3ABT A;  1P6R A;  1FBU A;  5CVU A;  4BXU A;  5JHU A;  2PI0 A;  4ZZD A;  2FE3 A;  1SD6 A;  4U0V A;  2RC4 A;  1DP7 P;  3P9I A;  1WSU A;  3EYY A;  3QP6 A;  2MC3 A;  5FFX A;  1ZH5 A;  2W24 A;  1XDS A;  2Y75 A;  3SHF A;  2Q2E A;  1U5T C;  3DF8 A;  1HSJ A;  1O3R A;  4UVC A;  3HSR A;  3JAM K;  3L2C A;  3ECO A;  5BPI A;  1ONV A;  2X0L A;  2KIM A;  4KFC A;  4M9Z A;  4EQQ A;  1QZZ A;  5L3F A;  4BHB A;  1SFU A;  3ZMV A;  1ODD A;  4M72 A;  2COM A;  1E2X A;  3IKV A;  3WTW C;  5TRD A;  1FY7 A;  4KMU X;  2GQQ A;  3ECH A;  4NHJ A;  3KLO A;  2CFX A;  1ZGA A;  3P9C A;  5HDN A;  1U5T B;  2EB7 A;  3FF5 A;  4LG0 A;  3I64 A;  1R00 A;  4I2O A;  2MH2 A;  4MEY F;  3WU1 B;  2Q0O A;  1JHF A;  2QYO A;  4A6E A;  3F22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...