2KJCA

Solution structure of czra in the zn(ii) state
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CzrA protein
publication title Solution structure of a paradigm ArsR family zinc sensor in the DNA-bound state
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcription regulator
total genus 19
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2kjcA00
1KU9A 4FHTA 1YLFA 4WXHA 2FNAA 4GXOA 2XAGA 2K27A 1T0FA 2EK5A 1YS7A 2NNYA 3EDPA 4M72A 1HW2A 2NYXA 1YS6A 1LEAA 2DT5A 2MH2A 3N4MA 2KIFA 5F6FA 4L0ZB 3WTWC 3FF5A 1LDKB 3WTVC 3JTGA 1JHHA 2C6YA 1W5TA 4HAMA 4AIKA 1Z7UA 2VT3A 5DD4A 3L7WA 2CQKA 2P4WA 4HDUA 4L9JA 3V4GA 2DW4A 1YYVA 5E18F 1RUNA 4ESJA 3V7RA 1F4KA 4Y13A 2HS5A 3F3XA 1V4RA 4UUVA 4AWXB 1TW3A 4LJZF 3ZMSA 2GWRA 3C7JA 4XBFA 5JFRA 2MH9A 1DUXC 3QAHA 2IA2A 3M7GA 1K7AA 2WV0A 4P9FA 1Q1HA 2FF4A 2G7HA 1MJAA 5L3CA 3J7AO 2DLLA 1GXPA 2UXNA 4LFUA 4EJUA 4EQQA 2XAHA 4AD9A 3KEQA 2E7XA 1FLIA 2PFBA 1OKRA 2L54A 5BQTA 4GCVA 3ISPA 5ILVA 2A6HF 1FOKA 2HTSA 4KFCA 1S7OA 5L3BA 1K6OA 2ETHA 5LRRA 2K4JA 3KCCA 4MQ9F 5DD8A 1ONVA 4Y17A 5ICEA 1CF7A 3IC7A 1MZBA 1KYZA 2DFIA 2XRNA 1KYWA 4RB1A 4EJTA 2HYGD 2Z5UA 2RKHA 2FEZA 3HTUA 3CUQA 4M9ZA 2BE5F 3HOSA 3F21A 5L3DA 1XMKA 4U7BA 2BYVE 4CYDA 4BH9A 3P7NA 3WODF 5BOXA 4WXCA 3OV8A 4PCQA 2E1NA 3GFJA 2X4HA 5H6RA 3R0JA 1FNNA 2P5LC 1Z1DA 2FOKA 1K79A 1BI0A 5LEJA 2XAQA 1K78A 4FT8A 5KK1A 4YFKF 3I58A 1O3SA 2HFHA 2VBZA 4ZH4F 3RIRA 3JAMZ 3RYRA 4H0EA 3TQNA 2Z9OA 5ICCA 3DPLC 3MAJA 1J59A 1I5ZA 4WF2A 3L00A 3COAC 2LNBA 1FYKA 5DYMA 3VOEA 1IN7A 2QYOA 5CVIA 3J80K 3KP7A 4GYGA 3EETA 4UV9A 5HLIA 5LBQA 2FRHA 4MQVA 4B09A 2JRTA 3GUDA 4M6YA 3TOBA 5IT3A 1ZRCA 2HWVA 1TNSA 1SD5A 2VE9A 4YIIA 4CO8A 3GF2A 1FY7A 1EV7A 2O8XA 3RKYA 3Q9SA 2ESNA 4RAZA 4ZYGA 3JSOA 4HOBA 2KIMA 4CICA 4M9XA 4UVCA 2K7LA 3T5XA 4HF2A 2EFOA 1BOAA 2QLZA 5E17F 2O03A 3QPHA 1IZ1A 3HUGA 1HKQA 4KIFA 2GQQA 1XD7A 1GXQA 3ZMDA 1E17A 4RB3C 1MKMA 1RNLA 1BC8C 2GA1A 4I7HA 1IF1A 1D5VA 2EJRA 5LGTA 2HYFA 4A0ZA 3I0TA 5LGNA 1ZRDA 2H27A 4LLNA 2M1BA 2F5EA 1AOYA 1Y0UA 5BMZA 3WG9A 1T98A 2M8EA 1PP7U 4L18B 1U5TC 2W84A 1U78A 4R8HA 3R0AA 2OBPA 1SFUA 2GZWA 4RGRA 2ZBKA 2RQPA 1BI2A 1SAXA 1R5GA 5HVQC 1BI3A 1FP2A 3E6MA 3F8NA 3K1MA 1JHFA 4L0YB 2L4MA 3WGIA 2BBYA 1R23A 1XGSA 4IVNA 3KZYA 4EJOA 5F1RA 1GVJA 5CVUA 1JE8A 4P5OA 4L9NA 3DPTA 4MHGA 1EH7A 2KRFA 3JTHA 2PN6A 5D4SA 1DPUA 2L4AA 3IRRA 4LD5A 3ZPLA 1YFHA 1P92A 2EV0A 2DQRA 4RGUA 4LK0F 3CTAA 3KP3A 5J6XA 5D5UB 4IHSA 3I53A 2STWA 1ZG5A 1IW7F 4IXAA 4DNCA 1RI7A 1YW7A 2KKOA 5HS7A 2HOEA 1P4WA 2W57A 3LQQA 3MFKA 1SFEA 2XUBA 2WC2A 3DP7A 4EMSA 1TBXA 1CF7B 2W25A 1U3EM 1FT9A 3LA7A 3FWEA 1XGNA 1BN5A 3MEXA 3N97A 2NS0A 5A2QZ 3DKWA 5D5VB 3CUQB 4HF0A 3V7CA 2V79A 2HQRA 3F6OA 3RTRA 1IAWA 1C0WA 3IWZA 1F9NA 2D1HA 3BWGA 3CDHA 2VBYA 1I27A 5FGMA 4KIGA 1A04A 1H9GA 4HV5A 5IT9K 2OZUA 3ZQ7A 1Z91A 1K78B 2P6TA 5J8FA 1J7KA 3F72A 2QQBA 4CXFA 2DBBA 3NRVA 3ZMUA 3H3UA 3BROA 2K02A 1JXSA 5LHGA 2BV6A 1B9NA 2EFQA 1L3LA 4BNCA 3EUHA 3FXUA 3TO7A 5HDNA 3ECOA 2UZKA 2ZO4A 4OMYA 4A0YA 3IL2A 3FZVA 3K2ZA 1DPRA 4ENNA 1ON2A 1R5HA 1KU7A 4BXUA 4WWCA 4OOIA 3BZ6A 5HLGA 3QPTA 3E6BA 6PAXA 1B4AA 3U1DA 1YO5C 4G8XA 3WU1B 3HIFA 1WQ2A 1ZG1A 2H94A 1UHWA 5HDKA 4KN7X 2DAOA 2ELHA 4I09A 3DV8A 4OMZA 4Y15A 2LF7A 5LRSA 3PQJA 3SZTA 1FYMA 2BEOA 1PP8F 1FPQA 3L9FA 3LAPA 1Z6RA 1ULYA 4KIBA 4EVIA 1P4XA 1F1ZA 2CO5A 2FBHA 4U0WA 4ESBA 3E6CC 4NQWA 1MGTA 3KEOA 4UVBA 2R7FA 3KP2A 3OOPA 2UXXA 2DO7A 2PQ8A 1LJ9A 3JAMK 1FP1D 4ESFA 2FMYA 5HLHA 4RB0A 3CO6C 1F5TA 3HHHA 2XIGA 4LG0A 5FLXK 2IA0A 1OMIA 2Y48A 4A12A 2VONA 4ZYHA 3IHUA 3Q5FA 2NAZA 3NQOA 4OIRF 4ZZDA 4Z2YA 3QU6A 2FA5A 3IKVA 2OAZA 2ADUA 3ZN1A 1S8NA 2ESHA 2YX4A 4KDPA 1XB4A 2STTA 2ISYA 2XAJA 2XASA 4L5JA 3IWFA 3TGNA 5DEQA 1TW2A 5D8LB 3LA2A 4UNOA 5LGUA 4HX4A 2CYYA 2P5VA 5DDGA 3WTSC 3EQLF 1ZG3A 3WTTC 4CHUA 4OIOF 2RDPA 4QWQA 2EFPA 2W24A 4HLXA 3HRSA 3ECHA 3HRUA 3V8JA 3LWFA 4MTEA 4EM0B 1ZAOA 3VFZA 5DCFA 2L01A 4HA8A 1S3JA 2RNJA 1REPC 3HHGA 3KLNA 2HKXA 1X3UA 1E2XA 1S6LA 1G4DA 2EFNA 1MD0A 2Z3YA 5J8CA 1G6NA 2O61A 1JGSA 2VOOA 2QUFA 1D3YA 3WU0A 2MBFA 3GZ6A 1HSTA 1TNTA 3SXYA 3ABTA 4EM1A 4G7OF 3O6BB 1USTA 2WWYA 1L0OC 1HKTA 3ABUA 3BJ6A 3PQKA 2PJPA 5ILUA 1ZH5A 3H3ZA 4FX0A 2FU4A 3M8FA 3E5QA 3KLOA 1BIBA 1O3QA 4B8XA 1SFXA 4S04A 2HKOA 1H9TA 1LEBA 3DF8A 3T8RA 3G3ZA 3I64A 4L5IA 5AIPA 1BJAA 3P9IA 3T0YA 3KE2A 3RI4A 4I01A 2MC3A 4G7HF 5ICFA 1OYYA 4EGYA 4GO1A 2TDXA 3O3KA 2O6GE 3I71A 1T38A 2VBWA 1IUYA 3FMQA 1XCVA 3V8LA 2CW0F 3HRTA 1KGSA 1QPMA 2M45A 5CYVA 2K86A 1B9MA 4XLPF 3FMRA 5DV5A 2EA2A 1R1UA 3I54A 1XDSA 4KT5C 1J9IA 4M9SA 5EEHA 3L2CA 4RS8A 2B0LA 5CJ9A 2FQ3A 4HYEA 1Z6TA 3QP6A 4EGZA 4NHJA 2JSCA 2JPBA 4WX9A 5ILSA 2QQAA 3BP8A 2O3FA 4KMUX 3VODA 3K1PA 5L3GA 4Q4ZF 3E5XA 3Q9VA 5AIQA 2VE8A 3CO7C 2UWMA 1RZ4A 5DCMA 2COMA 2ZMEA 1TLHB 2XKPA 5LEKA 1ZGJA 5K5RA 2F5FA 3WE3A 3KETA 2H09A 4ASNA 2Q0OA 5BPDA 1WKMA 3ZMTA 3LFKA 2DU9A 2RV8A 1J5YA 1FBQA 3GFLA 1MJ9A 3W6JB 3HSRA 1UCRA 1R36A 3I5UA 1IRGA 3MCZA 4LG0B 2CGPA 2MLKA 3RPQA 3C1DA 1RIOH 2VOPA 1B59A 3F8CA 3HSFA 4MEXF 5HS8A 2H6BA 4P96A 2FMLA 1LB2A 1PDNC 3P9CA 1ODDA 5E8IA 2HGCA 2IT0A 2XKOA 2QQ9A 3E5UA 1XSXA 1HW1A 3M1EA 1BBYA 3BPVA 4G94A 3RJPA 4U7DA 5ICGA 1QZZA 4G7ZF 4HDVA 1FBUA 4F7ZA 5LHHA 3HOTA 1GHCA 1TQPA 3FXRA 1FSHA 1R22A 1MDMA 1YIOA 5E20A 3IRQA 1KU3A 1IXRC 3T8TA 2CSOA 1B1BA 2A68F 1U5TA 2P7VB 3DFGA 2YPRA 5F64A 2Z99A 1ZARA 4UXNA 4ENKA 1IN6A 4KA4A 2IP2A 1XCBA 2YX7A 2IVMA 4G9YA 2AS5F 1UHMA 1YW9A 2VC0A 1OR7A 5HDGA 3FXQA 2XVCA 2FBKA 4RGXA 1BI1A 3I4PA 3R61A 3FM5A 3B02A 4I02A 3QRFF 2PMUA 2D45A 3F23A 1SD6A 1VTNC 1ZGAA 3M8EA 3BJAA 3LQRA 1XN7A 3TOAA 4RAYA 3F8MA 4N9IA 2D1VA 2YU3A 5D5XB 2GXGA 4CZZA 1Z9CA 4R79A 2OQRA 1FSEA 1LDJA 1O7LA 3WE2A 4M6XA 1NHAA 1G3TA 2AXLA 4BHPA 3J80Z 1ZLKA 4E70A 5DUIA 2GXBA 1HSJA 1D8KA 2D2WA 2GA2A 3SHFA 2MA3A 1WWXA 2WTEA 2HEOA 1HKSA 4I0AA 2Y75A 5E1XA 4CGZA 1XSVA 4MTDA 4U0VA 4L9TA 4ZYEA 3D5LA 1S29A 4EM2A 5CVVA 4AVPA 4A6DA 4OU0A 2FNPA 1R00A 4IRGA 4BAYA 2LKPA 3ROUA 1SMYF 2PI0A 1Z05A 3FX3A 2A3SA 3GYHX 5K1YA 4EV0A 5L3FA 1YG2A 2NRAC 2EFWA 5DCMB 1QNTA 2ZMEB 3H92A 3AAFA 4JBAA 2BGCA 3R60A 2PLYA 2F5CA 1IXCA 2F5DA 5D8KB 4UVAA 1BIAA 2XROA 1R7JA 2P6SA 2KIUA 4HQMA 4HZFA 4FX4A 1XMAA 2M5WA 3EYYA 2FXAA 3EYIA 2VT2A 1TTYA 1W7PA 1USSA 5K5QA 4GGGA 5JVTA 3HYIA 1KQ0A 3IKTA 1J0RA 3I59A 2V1UA 3TKYA 3RKXA 1H0MA 2NNNA 4N0BA 3GEZA 1FWZA 5L3EA 5AONA 3S2WA 2HTJA 3E97A 1B6AA 1R1TA 4M73A 1IN4A 5FB2A 1IRFA 3BY6A 4KYWA 3WGHA 3KP4A 4CDGA 5D4RA 2QVOA 4JQFA 3QU3A 2JT1A 3BPXA 2DTRA 3SFZA 1T2KA 2YR2A 2ACJA 5DUKA 5CVJA 3J81Z 1SD4A 4LB6B 1UB9A 2ZKZA 1BC7C 3B73A 3SQNA 4IHTA 1XSDA 3K69A 2QENA 1QZYA 4Q47A 3MZHA 1MDMB 4KICA 1W4MA 4I0BA 3RKWA 4O6JA 2V1DA 4GYIA 5E8GA 2V6CA 1O3RA 2JTVA 5K5OA 3TDUC 1U5TB 1ZRFA 4NB5A 3T1BA 4BQAA 2FSWA 2RGVA 1WRJA 4A2UA 3BOQA 4BHBA 2G9WA 3GZ5A 1KQ9A 4A5MA 4ON0A 2PBIA 3WTYC 2ZCWA 2M87A 3RPUA 1W5SA 4HBLA 4LLGF 2IRFG 5FD5A 3KP6A 1HQCA 2CWEA 2OZ6A 1QO0D 1EH6A 2A07F 3ZMVA 5IT9Z 3GW2A 4OIQF 2JPCA 1WSUA 3FM3A 3SZPA 4BHCA 4WXDA 1TQMA 1YTYA 3GVAA 3CUQC 3ZMZA 4EJWA 1T6SA 2EV5A 3D0SA 4L9VA 1R1VA 5FD6A 1I1SA 5BS6A 1ZN2A 4DQ2A 2EWNA 1EH8A 2ZFWA 3VB2A 5KVRA 1ZLJA 2XAFA 4PZJA 3U9GA 3HRMA 4HW0A 1HXDA 2CG4A 3C18A 1O57A 4Q48A 1OYIA 3TDZC 2OQGA 3GX4X 1PUEE 1V3FA 4EJVA 4XRFA 4IRIA 4HV6A 2E1CA 4YG2F 4TV7A 3FMSA 3K0LA 3E3VA 2GAUA 5D5WB 5JI6A 2EV6A 4RB2C 3ULQB 1SMTA 4BYYA 2R3SA 1S7AA 4XSXF 3WTXC 2L3DA 3U2RA 4I2OA 1P6RA 2XGXA 3HSEA 4LLLA 1WI9A 5BPIA 3WTZA 2FE3A 2QBYA 4PGHA 4I98B 5A2QK 2DQLA 3JW4A 3K9TA 2PMHA 1YQAA 4UV8A 2QWWA 3C3WA 3REOA 3MZYA 3R6SA 4UHTA 4HLYA 4K2EA 2LSOA 3NEUA 2OD5A 5HS9A 2MD5A 4A0XA 5H20A 4IF4A 4ENJA 3DQVC 2XHKA 4IJAA 1AWCA 4HF1A 3ERED 2ZJ2A 1FZPB 2A6EF 5FLXZ 2V9VA 3CLOA 1J2XA 3K1NA 5ED4A 1W7PB 2DK5A 4R1HA 5JHUA 4HX7A 4MNUA 3CUOA 2VN2A 3PFIA 2LDUA 1XGOA 5E1WA 3I59B 2M30A 2J5PA 4XSZF 2QZ8A 4ZZLA 2VC1A 3G73A 4OINF 4YFXF 4LB5A 3WTUC 4N9HA 2KJCA 3RDIA 2E7WA 2GIVA 2P7CB 1DP7P 1ON1A 5FFZA 4OIPF 1RUOA 2J5OA 4P9UA 4A6EA 2X0LA 3GFIA 3F8BA 3QP5A 1XDUA 3L09A 1G3SA 1U8RA 1T39A 2ZXJA 1XGMA 3GO5A 4QLCU 2RVCA 5CVRA 2HR3A 2OU2A 1QBJA 2IW5A 2VBXA 2DPUA 1LNWA 4ZYDA 4M74A 3ML6A 4KN4X 2RC4A 3TO6A 3W6KB 2IA1A 4PGGA 3F22A 3DEUA 4KMFA 4ENMA 1ZREA 3M9AA 4G6QA 2MLGA 4YIFA 4LMYA 1QGPA 4MEYF 1FYLA 4O5VA 4U0YA 2RN7A 1G3YA 5H6QA 3WGGA 2PEXA 5HOOA 2KJBA 3BJOA 1QQIA 1TQIA 1G3WA 1LVAA 2Q8KA 2JZYA 4LK1F 3LAJA 4A5NA 3E6DA 1FBSA 1UFMA 3ZN0A 4PDKA 1HBXG 2F2EA 1FC3A 5E1ZB 1KA8A 2CFXA 4IRHA 5LLQA 1U2WA 4AIJA 2QM3A 1R58A 2DI3A 4G6DA 3R4KA 3CJNA 3LSTA 4HX8A 4XLNF 1FX7A 2P8TA 1IN5A 2VXZA 3J81K 4RGSA 3GXOA 2Y0MA 1W7PD 5CLSA 4Q5SF 4YFNF 2HQNA 1U6GA 3FHZA 2ISZA 4KUMA 2A5YB 1CGPA 2HZTA 1MJBA 5LHIA 3KP5A 5D6FA 4S05A 1KU2A 4HQEA 1STZA 3KZZA 3HTSB 4M71A 5TRDA 1OPCA 2LF8A 1D8JA 2V1XA 3V8KA 4JK1X 3V7SA 1I6XA 3VEPA 2YSRA 1P2FA 5D6EA 1IXSB 1J75A 2R7DA 4O3MA 1KQ8A 2EB7A 1P4AA 5TJJA 3JSPA 4AIHA 3QOPA 2EA4A 3TO9A 4WK8F 2HDCA 3GWZA 4KNYA 4P55A 2QBYB 3MQ0A 1YW8A 2O0YA 3F6VA 2A69F 4ETSA 1BM9A 2ZNZA 4WCGA 1OYWA 2Q2EA 3LA3A 1LDDA 2K4BA 5ERIA 2DK8A 3DXJF 2XV4S 3KFWX 2L02A 3O2PE 1ZHFA 1IN8A 2VODA 1O3TA 3ELKA 1SD7A 1O7FA 3RYPA 5FFXA 2A61A 1ZYRF 2P5KA 1HW5A 3MWMA 1I1GA 4MGRA 2IJLA 2FBIA 4LGWA 3ZP5A 3GLXA 2OA4A 5JR3A 2DPDA 2G7UA 2ZNYA 5FO5A 2Z33A 3P9KA 2H6CA 4U88A 2PG4A 3F8FA 2IPQX 3GFMA 4D0PA 1LQ1A 1DDNA 4IPAA 2W85A 3BDDA 5EEGA
chains in the Genus database with same CATH superfamily
4AU7A 1KU9A 2FOWA 4DOZA 2DMPA 3H0DA 1T8IA 2QA4I 2X1EA 4FHTA 1YLFA 4WXHA 3ZRGA 3J7YJ 2FNAA 3GTOJ 4GXOA 1R71A 2XAGA 2K27A 2V6EA 1T0FA 2EK5A 1YS7A 3RCOA 3EDPA 2NNYA 1X2MA 4M72A 3RQIA 3VYTB 2NYXA 1HW2A 1MNDA 2R7XA 1XC5A 1YS6A 2KQRA 4I99C 3BC8A 3AKZA 2LK2A 2KDOA 3Q0WA 3OYBA 1X4OA 1LEAA 2DT5A 2MH2A 2Y69H 3N4MA 1LKXA 2KIFA 1WVRA 3JRGA 3E1SA 5F6FA 4L0ZB 3WTWC 3FF5A 3FIWA 1LDKB 3VWBA 5E3OA 3OYJA 4E7ZA 3WTVC 2E2IJ 2BXYA 2L7MP 5IOYA 2H8RA 5HNHA 3JTGA 1JHHA 3OSGA 4Y7NJ 4LIUA 2C6YA 1T56A 3G1MA 2H1KA 1W5TA 4QPOA 4XORA 4HAMA 1VQNI 5EG0B 4XN3A 4AIKA 2HQ5A 2EH3A 3K4MA 2DOAA 1Z7UA 4NC6A 3M3YJ 3ZQQA 2VT3A 5DTDA 1BL0A 5DD4A 5FRNA 3L7WA 2CQKA 2P4WA 1IO2A 4HDUA 4N4NB 4L9JA 3V4GA 2DW4A 2CUFA 1YYVA 5E18F 1RUNA 1VZ0A 4ANJA 2M7BA 2K85A 1SAUA 1FEXA 4E7KA 4ESJA 3V7RA 4P1WA 1F4KA 4Y13A 1MMDA 2HS5A 2VB6A 3ASOH 3F3XA 1V4RA 3ZCOA 4UUVA 4AWXB 1TW3A 4LJZF 2NVUB 1X1DA 2TRTA 1ZTRA 3ZMSA 2R5ZA 1NK2P 4A93J 1S5LC 1SFOJ 2GWRA 2XPWA 3C7JA 4XBFA 5JFRA 1POGA 2E5NA 2MH9A 3EUKL 2R5YA 1DUXC 3QAHA 2IA2A 3M7GA 1K7AA 3SJMA 3K4BA 2OPTA 5J4VA 2WV0A 2HVRA 4CYCA 2E2HJ 3HC7A 4P9FA 3K6GA 4XMYA 1Q1HA 1WJDA 5K7FA 2FF4A 4PJNA 2G7HA 1OCCH 2A6TA 1MJAA 5L3CA 3J7AO 2DLLA 1GXPA 3MN2A 2UXNA 3PUBA 5FLMJ 2K9LA 2H8WA 3LSIA 1X1AA 1PYVA 4LFUA 4EJUA 4II2A 2E1MB 3GTJJ 3LSJA 4EQQA 1A5JA 1MNMC 2XAHA 2EILH 5J3LA 4AD9A 3KEQA 2E7XA 1ZR2A 1XX5A 3M07A 3SFIA 1FLIA 2PFBA 1OKRA 2L54A 4XR6A 5BQTA 3DEEA 4GCVA 4J01A 3ISPA 4Y4RA 5ILVA 2A6HF 2Q1ZB 2DA7A 1FOKA 2HTSA 3JRDA 1SC7A 4KFCA 1S7OA 5L3BA 4YELA 2KZVA 4XOTA 2CS3A 3PL8A 1WJEA 2CUJA 3CCQI 3QPSA 1K6OA 2BOLA 1XS9A 2ETHA 2ZXWH 2DMQA 5LRRA 2K4JA 3KCCA 3VYSB 3CC7I 4MQ9F 4CCNA 4CCJA 5EJCA 5DD8A 1ONVA 4Y17A 5ICEA 3WU2C 2VKDA 2VJIA 1CF7A 3HG9A 1MZBA 3IC7A 1KYZA 3OYFA 2DFIA 4H4KC 2XRNA 1OCRH 1KYWA 3BG9A 4RB1A 2L9SA 4EJTA 2HYGD 2LMDA 2Z5UA 2RKHA 2FEZA 1WJAA 3HTUA 3SYTA 2WAQA 2HOSA 4DW6A 3CUQA 4G6TB 4M9ZA 2BE5F 2DA4A 4B48A 2X51A 3HOSA 3F21A 1EA3A 3VSKA 3GCMA 1U8BA 2OCCH 3N05A 1XMKA 5L3DA 4U7BA 2DXIA 4AYBA 1R4MB 5F04A 4MLOA 2BYVE 4CYDA 2XB5A 4LITA 4BH9A 3P7NA 3WODF 3RKQA 5BOXA 4WXCA 3S8PA 4C3HJ 2VIXA 2L9RA 3J7ZI 3OV8A 4PCQA 2E1NA 2Q2EB 3GFJA 2X4HA 4ABZA 3ABKH 5H6RA 1LFBA 3BR0A 3AG3H 2DYSH 4CCKA 1B8IA 3W2VA 2ZJQF 3RZDJ 2P0WA 3R0JA 5FKLA 2EQRA 4D1QA 1FNNA 3FKIJ 5KCMA 2DA1A 3LOCA 2WAQN 2P5LC 1Z1DA 2FOKA 1K79A 1BI0A 2X48A 3HPHA 5LEJA 3VYRB 2XAQA 1K78A 4E7IA 4FT8A 2L9VA 2L0KA 4CUGA 4AYBN 5KK1A 1TP4A 5IYCJ 4YFKF 3I58A 2ZMEC 3HBLA 3VYUB 1O3SA 2HFHA 2VBZA 4ZH4F 1TC3C 3RIRA 2OF7A 3GLLA 3JAMZ 3RYRA 1JUMA 1V5FA 5F27A 4H0EA 3A2KA 3TQNA 3VPRA 2Z9OA 5ICCA 5FKKA 3DPLC 3MAJA 1BW6A 1MBJA 3OOUA 5J1RA 1J59A 4M3BA 1LFUP 3S2DJ 1I5ZA 4WF2A 2WAEA 3L00A 2OC6A 3MKYB 2R7QA 3COAC 2CW8A 2LNBA 1FMWA 1Z3YA 2XC7A 1FYKA 5DYMA 3VOEA 1NH3A 1RKWA 5IP7J 1AKHB 4FE7A 1IN7A 2QYOA 5CVIA 3J80K 3KP7A 1R49A 4GYGA 2HOTA 2WB1N 5GPAA 2DODA 1I39A 5FKOA 2ZFUA 3K7AJ 4XONA 3I4NJ 3DU5A 3EETA 3CMAI 4RBOA 4UV9A 3H5RA 5HLIA 1F36A 5LBQA 2FRHA 4M3DA 2ZJPF 4MQVA 4B09A 2EZHA 2JRTA 4IO9F 3GUDA 4IEJA 4M6YA 3TOBA 3BR6A 5IT3A 2DA3A 1ZRCA 5C3EJ 1T08B 2Z2SB 1E3HA 2HWVA 1TNSA 3K4JA 1SD5A 2VJ4A 3BZCA 3OYNA 2VE9A 4YIIA 2NOJB 3G1LA 4CO8A 3GF2A 1FY7A 1EV7A 2O8XA 3RKYA 2X6OA 3Q9SA 2DDAA 3CDLA 3HOUJ 1BA5A 2LLKA 2ESNA 4RAZA 3BR1A 4ZYGA 4C2TA 3JSOA 3HOZJ 4BKXA 4HOBA 1ETQA 4D5FA 3H0GJ 2KIMA 4CICA 4M9XA 4UVCA 2K7LA 3T5XA 4XLCA 5CQEA 4HF2A 2EFOA 1A6IA 1BOAA 2QLZA 5E17F 2O03A 3QPHA 1GV5A 1IZ1A 3SDBA 3HUGA 4AIDA 1HKQA 1MBHA 4KIFA 2GQQA 1XD7A 1GXQA 3ZMDA 1E17A 1YOVB 2XF6A 4RB3C 4UUTA 3PUFA 1MKMA 1RNLA 1KZHA 1BC8C 2GA1A 3AG2H 4I7HA 1IF1A 1MBGA 4C9YA 1D5VA 1TWAJ 2DFEA 4A3LJ 2EJRA 5LGTA 2K5CA 2HYFA 2XPUA 4A0ZA 3I0TA 3NWTA 5LGNA 1ZRDA 3HZJA 1YI2I 2H27A 4LLNA 2M1BA 3C2GA 2F5EA 3NARA 1AOYA 1TT5B 3OYMA 5KAIC 1Y0UA 5BMZA 3WG9A 1T98A 2M8EA 1PP7U 3G2BA 2QQ8A 4L18B 1U5TC 2W84A 5IPAA 1U78A 4R8HA 3R0AA 2OBPA 1SFUA 4OAYA 2GZWA 1UMQA 4RGRA 1VQ6I 2ZBKA 2RQPA 1BI2A 3S1MJ 1IV8A 1VQ9I 1ETKA 2BW3A 3K4KA 1SAXA 2R5ZB 1R5GA 5HVQC 1BI3A 2EBIA 1FP2A 3E6MA 3F8NA 2R5YB 1RC9A 3K1MA 2KPMA 5DS9A 1JHFA 2E34A 4L0YB 3RZOJ 2L4MA 3WGIA 2BBYA 1R23A 4CYCB 2CQNA 3W2AA 1MMSA 1XGSA 2Z16A 4E7JA 3LNQA 4IVNA 3KZYA 3IAM2 4EJOA 5F1RA 1GVJA 5CVUA 1JE8A 2DOFA 4P5OA 4L9NA 3DPTA 4MHGA 4DGWB 1XPXA 4BJTA 1EH7A 2DJNA 2V26A 2KRFA 1Y1VJ 3JTHA 2PN6A 3PIOF 5D4SA 1DPUA 2L4AA 1OR7C 3IRRA 4LD5A 3ZPLA 1YFHA 3LSHA 1W1WE 4JYKA 3CCMI 2M0CA 1P92A 2EV0A 2DQRA 4RGUA 4LK0F 3CTAA 2E71A 3KP3A 4E7HA 4A3IJ 4A3GJ 1YJWI 5J6XA 5D5UB 4IHSA 3I53A 3I56I 2I8DA 4DYQA 5EDNA 2STWA 1O4XA 1ZG5A 3OIOA 1IW7F 4IXAA 4DNCA 4BGDA 1RI7A 5JVGF 4C30A 1H89C 2V7FA 1YW7A 2PJRA 2HXOA 2KKOA 5HS7A 2XF7A 2HDDA 2HOEA 1P4WA 2W57A 5IP6A 1TWFJ 2R7UA 3LQQA 4W1UA 3MFKA 2LOOA 5IYBJ 1SFEA 2XUBA 2WC2A 3DP7A 5FKMA 1WPKA 4EMSA 3ZQHA 3UNGC 1TBXA 3KPHA 1CF7B 3OY9A 2W25A 1U3EM 1FT9A 3LA7A 3FWEA 4XLHA 1XGNA 2KP6A 4G12A 1BN5A 3MEXA 3N97A 2NS0A 5A2QZ 4YIRX 3DKWA 1R5ID 1WHUA 5EZHA 3W2WA 5D5VB 3CUQB 3GBGA 4HF0A 4D7MA 4BY7J 3HJEA 3V7CA 2V79A 1DQUA 2HQRA 3OSFA 3F6OA 1YX3A 2GLOA 3RTRA 4Z6YA 3ZR8X 5IP9J 1IAWA 1MIJA 2LY9A 1C0WA 3FK7A 2V9KA 3IWZA 3AL0C 2AQFA 4XLAA 1F9NA 2D1HA 2P81A 1BR1A 3BWGA 3CDHA 1ACIA 1U9OA 2VBYA 2OTLI 1I27A 1QVTA 5FGMA 1IJWC 3EUHC 4HG2A 3DKYA 1OFCX 1A04A 4KIGA 1B8IB 2KZGA 1H9GA 4HV5A 2Z1DA 4II3A 2IGOA 3GTLJ 1HA8A 4J00A 2QCOA 5IT9K 3K4LA 2OZUA 2W00A 3U1KA 3ZQ7A 1Z91A 2CUEA 1VQ4I 4XKBA 3W3CA 4GRIA 1TL8A 2QSHX 1K78B 2VJ5A 3TEDA 1V55H 2P6TA 5J8FA 5J1YA 1J7KA 4AVZA 2XGCA 3F72A 3OYDA 5E3LA 2VKEA 2B63J 1NG7A 2QQBA 3HGGA 4CXFA 3ZGKA 2DBBA 1JTYA 2VI6A 4ZDLA 4XRMA 2JA8J 2HVQA 3OR1C 5F0HA 3NRVA 3ZMUA 3H3UA 2LBFA 2JA5J 2M3AA 3BROA 2O7OA 2K02A 5B1AH 1JXSA 2E19A 4FISA 4F52A 5LHGA 1D0ZA 2BV6A 1GV2A 3JRCA 1B9NA 2EFQA 3A0HC 3DTKA 4MO7A 1L3LA 5K7ZA 4BNCA 3EUHA 3FXUA 3TO7A 5HDNA 2VLAA 3ECOA 1LPQA 2UZKA 2ZO4A 4OMYA 4A0YA 3IL2A 3FZVA 3K2ZA 4HNVA 4ZTJA 3IH2A 3EUAA 5B1BH 1ETVA 4XL9A 5FROA 3UR3C 4IHVA 3ASNH 3S2HJ 1DPRA 4ENNA 2ICWG 3RQ4A 1LUJB 1ON2A 3BG6A 4IQ4A 1HF0A 2O8KA 1R5HA 2L2OA 4F91B 4BXUA 1KU7A 4WWCA 4OWRB 2LTPA 2KDZA 4UY8I 2DT7B 4OOIA 2DTZA 3BZ6A 5HLGA 3QPTA 5J4YA 3E6BA 6PAXA 1DGWY 1JJ6C 3Q0VA 1B4AA 3QOEA 3U1DA 2KHMA 3PNYA 5EF6A 3F0CA 4PJLA 5CKTA 5LD2C 2NXNB 1YO5C 2VL8A 4G8XA 3WU1B 4XOPA 3HIFA 3HL2A 1WQ2A 1ZG1A 2H94A 1GT0C 3BG3A 1UHWA 5HDKA 4KN7X 1VF9A 2DAOA 2ELHA 4I09A 4NNJA 2QSGX 3DV8A 4OMZA 4Y15A 2LF7A 3Q0UA 5LRSA 5GTIC 3PQJA 2XF5A 3L2RA 3SZTA 4XRSA 1FYMA 2BEOA 2HXIA 5BNGA 1PP8F 1FPQA 1OCZH 3L9FA 4F93B 3LAPA 2IS2A 3PFYA 3PO3J 1Z6RA 1VQKI 3CC2I 1ULYA 4KIBA 3HUGB 2EZKA 4EVIA 5GAHJ 1P4XA 3CP2A 4AC0A 1F1ZA 2CO5A 2HVSA 5B5EC 2FBHA 2O5RA 4FETA 4U0WA 2JRMA 5E3NA 4ESBA 1JUPA 3E6CC 3SEQA 4AUXA 2AHQA 4NQWA 1MGTA 3KEOA 4UVBA 2R7FA 3EPZA 3KP2A 2VQGA 3OOPA 1XG1A 4YRVA 2EIMH 2UXXA 2DO7A 2PQ8A 1LJ9A 3JAMK 4ZDOA 1FP1D 4ESFA 5CQGA 1K61A 2DCEA 2FMYA 3U21A 5HLHA 4RB0A 3CO6C 2LD5A 3CF2A 1F5TA 3HHHA 4Y52J 2A05A 2XIGA 3TW6A 5KNLA 2XGEA 1D5YA 3A0BC 2RQQA 3M1CA 3BG7A 4RAFA 2LH9A 1QU3A 4PK4A 2GIZA 4LG0A 1YHQI 2NVTJ 3CD6I 4IZZA 5FLXK 3SEZA 2IA0A 1OMIA 1VQ7I 1WJCA 2ECCA 2Y48A 4A12A 2VONA 3DCFA 4ZYHA 3IHUA 1WJFA 4CSWA 3Q5FA 2NAZA 3NQOA 4OIRF 4ZZDA 1IDZA 2IGNA 2R7OA 5HLTA 4Z2YA 2F48A 3ERMA 4CCLA 3QU6A 2MC4A 2FA5A 1W0UA 3OR2C 1A31A 3IKVA 3FXKA 2OAZA 2ADUA 5FRMA 3ZN1A 3OYGA 1T33A 4UUSB 2GOMA 4BXXJ 1S8NA 2ESHA 3I3LA 1JUSA 2YX4A 2IEKA 4KDPA 1XB4A 3A03A 2CV1A 2STTA 2ISYA 1UHSA 2XAJA 2XASA 2R7ZJ 4L5JA 3I55I 3DLAA 2MG4A 2JA6J 3IWFA 4MFDA 3TGNA 5DEQA 1TW2A 5D8LB 2DA2A 2JA2A 1ITYA 2CH0A 3PSFA 3LA2A 4UNOA 5LGUA 4HX4A 2CYYA 2P5VA 5DDGA 3WTSC 3EQLF 3DBRB 4A3FJ 4BDYA 1ZG3A 4HSTA 3WTTC 4CHUA 4OIOF 4C3IJ 2RDPA 2ZXHA 4QWQA 2EFPA 2W24A 4XNFA 4HLXA 3HRSA 1EKEA 4HPQA 3ECHA 3HRUA 3V8JA 1W5CC 1SVLA 3LWFA 2QKLB 4MTEA 2BHZA 3DEWA 4EM0B 1U9NA 1ZAOA 3VFZA 5DCFA 2L01A 3GTGJ 2Y30A 2OV7A 1WCMJ 4HA8A 1S3JA 3KX2A 1ZK8A 3HOXJ 4JX6A 4BJ5C 2RNJA 1REPC 2FQ4A 3CDIA 2PJRB 3HHGA 3KLNA 1MSFC 2HKXA 4BBRJ 1X3UA 2VASA 1B72A 3JRIA 2DA6A 4HSRA 1E2XA 1S6LA 2ZSIB 4F55A 2CW7A 2BY2A 2WADA 1G4DA 5GTHC 2EFNA 1MD0A 1E3PA 2Z3YA 5J8CA 3FHNA 1G6NA 2O61A 1JGSA 2VOOA 2QUFA 1D3YA 3WU0A 2MBFA 1QRYA 2LREA 3GZ6A 5F0CA 1HSTA 1TNTA 1OCOH 4F92B 3FISA 3SXYA 2DFHA 3ABTA 4EM1A 4G7OF 5FKNA 3O6BB 3E0JB 1Z21A 1USTA 1PUFA 2WV1A 3BG5A 2WWYA 1L0OC 5GAGJ 1HKTA 3ABUA 3BJ6A 5B3SH 3PQKA 2PJPA 1X58A 5ILUA 2R4GA 2R7WA 3QODA 1ZH5A 3H3ZA 4FX0A 2FU4A 2V4JC 1YX5A 3M8FA 3E5QA 3KLOA 2JA7J 2KL4A 3OYKA 1BIBA 1O3QA 4IHYA 4B8XA 1SFXA 2X1DA 4KITB 4S04A 1MSEC 3ZOBA 2HKOA 1SFKA 1H9TA 1LEBA 3DF8A 3FDYA 3T8RA 2COBA 1WGXA 2GOXB 3G3ZA 3OMYA 3OYHA 4RMNA 3I64A 2EINH 2Y31A 1FIAA 1K83J 1X3ZB 4L5IA 5AIPA 3S15J 2MW8A 1BJAA 2O9LA 5GAEJ 2VKVA 3P9IA 3T0YA 1JKRC 3KE2A 1N25A 1VFCA 2D5VA 3RI4A 4I01A 2MC3A 4G7HF 3KYDB 5ICFA 1OYYA 4EGYA 3WHBA 4GO1A 3CJQB 2TDXA 4DJAA 2R7SA 2BY3A 2K9NA 4J19A 3O3KA 5KAFC 2LBFB 3H9JA 2O6GE 1N77A 2IAIA 3I71A 1T38A 2VBWA 5H2FC 1IUYA 3MKLA 3FMQA 1XCVA 3V8LA 2CW0F 2M2EA 3BTCA 3HPGA 3HRTA 1KGSA 2GM4A 1QPMA 2M45A 5CYVA 3FKJA 1G2HA 4B44A 2ZC2A 2K86A 1I3AA 1IDYA 3H5AA 5HODA 3IP4B 3V42A 1B9MA 3FMRA 4XLPF 5DV5A 2EA2A 1R1UA 1IGNA 3D5RC 3I54A 1XDSA 1DU0A 4KT5C 1J9IA 4M9SA 5EEHA 1HLVA 3L2CA 3Q3SA 4U87A 4RS8A 3OYLA 2B0LA 2MSYA 2PMZA 5CJ9A 1BR2A 5DM7F 2FQ3A 2KRCA 1OCPA 3DWLE 1Z6TA 4HYEA 2WY8Q 3QP6A 4DBRA 1X1CA 3LMMA 1XTAA 4EGZA 4NHJA 2JSCA 3BTJA 3MKZA 2JPBA 4WX9A 1ZKGA 5ILSA 3JRBA 4XQFA 1RR7A 4ZDPA 2QQAA 3BP8A 4DZPA 4C2UA 2MGQA 2O3FA 4KMUX 3VODA 3K1PA 3S1QJ 1JJ8C 4DIQA 2H1LA 5L3GA 2F4MB 4XN0A 3LSPA 3O8HA 4I6ZA 4Q4ZF 3E5XA 3Q9VA 4ZYAA 2OJED 3M8JA 5AIQA 2LKSA 2VE8A 3CO7C 2UWMA 1RZ4A 1I50J 3FBIB 1HC8A 5DCMA 1X19A 2COMA 2ZMEA 1TLHB 1JTXA 2JVHA 2XKPA 5LEKA 1ZGJA 2E60A 2IS6A 5K5RA 2F5FA 1VQLI 2DYRH 3CLQA 3WE3A 3KETA 2H09A 2R7RA 4ASNA 4M3FA 2PMZN 3I9V2 1K4SA 3QWLA 3ZQIA 4HEA2 2Q0OA 2K9QA 4N4OB 4A3JJ 5BPDA 1AU7A 4NQWB 1WKMA 3ZMTA 1WZ2A 1Z7LA 1SEUA 5TISC 3LFKA 2DU9A 1GLNA 3PNTA 1D1CA 5K7HA 2RV8A 2YS9A 3S1RJ 2F6CA 1J5YA 1FBQA 4L5EA 4XKCA 3DPUA 2I5UA 3GZNB 3GFLA 4A3CJ 1G8XA 1MJ9A 4LG3A 3GTPJ 3W6JB 1MW7A 3H3VK 2HDWA 3HSRA 1UCRA 5DM6F 1R36A 3L2UA 3I5UA 4E4HA 1IRGA 3MCZA 1RR8C 4PJMA 4LG0B 3OYCA 2CGPA 2MLKA 3RPQA 3C1DA 1RIOH 4RDUA 2VOPA 3FK6A 1B59A 3F8CA 3HSFA 2XSJC 1VQ8I 1JI8A 4BACA 4MEXF 5HS8A 3K70D 2DJIA 1T95A 2H6BA 4XM3A 2EIJH 4P96A 2FMLA 1IC8A 2V9PA 1LB2A 2W4SA 2R93J 1PDNC 3BTLA 2YU9J 3P9CA 1ODDA 2JN6A 5E8IA 3PO2J 2E36A 3CJTB 2HGCA 3WG7H 2IT0A 2XKOA 2CQQA 2R92J 2QQ9A 3E5UA 1XSXA 1HW1A 3M1EA 4C2MJ 1BBYA 2LFBA 3BPVA 4G94A 3RJPA 2ME0A 4U7DA 3IAS2 4XRSG 2CV0A 2DOEA 4PUSA 4BDZA 5ICGA 1QZZA 4V2GA 4G7ZF 3NAUA 1OISA 4HDVA 5M3MJ 2JVGA 1FOYA 3RSNA 2DA5A 1FBUA 4F7ZA 5LHHA 4CCOA 4HRIA 4CCMA 3HOTA 2DFFA 3QYBA 1GHCA 1TQPA 2PX9A 3CMMA 1XMXA 4EATA 3FXRA 1QHGA 1FSHA 1Y8RB 3OIPA 1R22A 1MDMA 3L1PA 1YIOA 2L9NA 5E20A 4RM3A 2XDVA 2LYCA 1JGGA 2IGMA 3IRQA 2LG4A 3JRAA 1FJLA 1KU3A 1ETXA 1IXRC 1PVEA 3T8TA 2TCTA 2CSOA 3H1CA 3LSRA 1B1BA 3BR3A 3HB9A 4D5CA 1B72B 5GP9A 1N75A 2A68F 3BR2A 1U5TA 3LL7A 2P7VB 3DFGA 4RM2A 2E1MC 3DTEA 3ONQA 1H88C 2BXZA 2YPRA 3A4CA 5F64A 4I76A 3F9KA 2Z99A 1ZARA 2CQXA 4UXNA 4NBQA 1U0JA 4ENKA 1IN6A 4KA4A 4RAGA 2IP2A 3TBIA 1GVDA 1XCBA 4BJ6C 4M6VA 4KT6A 3GTMJ 3TW7A 4XKVA 2KRHA 4ZTFA 1DGRM 2YX7A 2EIKH 2OTJI 2IVMA 4G9YA 5FJ8J 4LOCA 2KISA 3MD2A 2AS5F 1QVUA 3CCYA 2K9SA 1W36D 5FLVA 1PUFB 1UHMA 4XLFA 2X6XA 2IBDA 3S14J 3H36A 2IXSA 2NS7A 2HQAA 2JSPA 1YW9A 2VC0A 1VI0A 4B47A 1OR7A 2Y0SA 5HDGA 2W7NA 3FXQA 1AA7A 2XVCA 4M3GA 2FBKA 4PFPA 4RGXA 1BI1A 3I4PA 3ZQFA 1H8AC 3R61A 2YUSA 4XLEA 4KISA 3FM5A 1D1BA 3B02A 4I02A 1HOMA 3QRFF 2PMUA 4Y33A 2D45A 3F23A 4HNTA 4XICA 1SD6A 3G6EI 1MMAA 3C2HA 1ZGAA 1VTNC 3M8EA 3BJAA 3LQRA 2R7TA 1XN7A 3TOAA 4BQOA 3OS0A 2FUG2 4RAYA 1G59A 3F8MA 1NK3P 4N9IA 4OAZA 2D1VA 2ZSHB 2YU3A 3CQZJ 3OIQA 3OYAA 5D5XB 2GXGA 4CZZA 2ELJA 1Z9CA 3OS2A 4R79A 2OQRA 1FSEA 1LDJA 1O7LA 3WE2A 1Y56A 4M6XA 3SZGA 1NHAA 3QPLA 1G3TA 2AXLA 5EGOA 4BHPA 2LY1A 4BUPA 2Y0SN 3CF5F 1BW5A 3J80Z 2K3FA 1ZLKA 1X3WB 2F4OB 4E70A 4UB6C 5DUIA 3CC4I 2GXBA 1HSJA 1D8KA 2M8GX 4JP0A 2D2WA 2GA2A 1FMVA 2MA3A 3SHFA 1WWXA 2WTEA 2HEOA 3ZXSA 1HKSA 2M7AA 4I0AA 2Y75A 3OYEA 5M3FJ 5E1XA 2RNGA 1KONA 4CGZA 1XSVA 4MTDA 4U0VA 4L9TA 4LIVA 1MNEA 1NTCA 5F1JA 4ZYEA 3D5LA 1S29A 4EM2A 5CVVA 2EZIA 3D5SC 3HGYA 2M34A 4AVPA 4A6DA 4OU0A 4JOMA 2FNPA 1R00A 5M5XJ 1X4PA 2AXTC 4IRGA 4BAYA 2LKPA 3ROUA 1ERDA 4A3BJ 1SMYF 3HDDA 2PI0A 2K9MA 1YJNI 1Z05A 3FX3A 2A3SA 4S0HB 2XGDA 1GDTA 4BQQA 3GYHX 4KJZA 5K1YA 4RA2A 4EV0A 5L3FA 3BR5A 3FXOA 1RKTA 3G71I 9ANTA 1A6QA 1YG2A 2NRAC 2EFWA 5DCMB 1QNTA 2VQLA 1EF4A 3JRHA 3OWTA 4MFEA 4A3MJ 2ZMEB 3H92A 3AAFA 4JBAA 2BGCA 1LFPA 3BZKA 5M5YJ 1T0FC 2WY7Q 3R60A 4PJ0C 2PLYA 2AQEA 1WH5A 2NS8A 2DN0A 2F5CA 1IXCA 2F5DA 2WAFA 5D8KB 4UVAA 1BIAA 2ZJRF 2XROA 1R7JA 2P6SA 4RLFA 2KIUA 4HQMA 4HZFA 3OL3A 2A5WA 4FX4A 1XMAA 2M5WA 3EYYA 2HPIA 2MYSA 3JCUC 2FXAA 1MBFA 3EYIA 4ZC3A 2VT2A 1TTYA 1W7PA 1USSA 1UG0A 5K5QA 3AG4H 4GGGA 3CMYA 5JVTA 3HYIA 1KQ0A 3IKTA 1J0RA 3I59A 2V1UA 3TKYA 3OYIA 3DBLB 2CRGA 3RKXA 4JX5A 5CPRB 1H0MA 5E3MA 2NNNA 2BZTA 4N0BA 3GEZA 1FWZA 5L3EA 5AONA 1D0YA 4BXFA 3S2WA 2HTJA 3E97A 3KIOA 1B6AA 1R1TA 2OCEA 4M73A 1IN4A 4BBSJ 2LVSA 4NUBA 5FB2A 3FBNB 1IRFA 3BY6A 4KYWA 2JMWA 4UB8C 3WGHA 3DLLF 3KP4A 4CDGA 3LFUA 5D4RA 5M5WJ 3BTIA 2HZDA 2QVOA 4JQFA 3QU3A 3GTKJ 2JT1A 4BE2A 2FD5A 3BPXA 2DTRA 3TP0A 1MBEA 3SFZA 1T2KA 3KZIC 2BW3B 2YR2A 2ACJA 5DUKA 5CVJA 1MH4A 3HXLA 3J81Z 1SD4A 4LB6B 1UB9A 2ZKZA 1BC7C 3B73A 3SQNA 1IRXA 4ZJZA 3OL4A 2VQCA 1A36A 5IY5H 4IHTA 1XSDA 3IH3A 2QSFX 1FTTA 3W6VA 3K69A 3UKGA 4A3DJ 2QENA 1Z0XA 1QZYA 5JHFA 4Q47A 3B6AA 2CJJA 2L7ZA 4C3JJ 4XIDA 3MZHA 2DDBA 3B6CA 1MDMB 1JT6A 4KICA 1W4MA 3H5NA 1QZEA 1TWHJ 4I0BA 1Z67A 1BJZA 4NC8A 3RKWA 4HNUA 3S32A 4DYCA 3CMEI 1PJRA 4V2FA 4O6JA 2G0EA 2V1DA 2QF7A 4GYIA 5E8GA 2V6CA 1O3RA 3H9QA 3S17J 2IGKA 4B3XA 2JQ7A 2JTVA 1Z77A 3NWSA 3TDUC 1U5TB 1X1BA 2HYJA 5K5OA 1ZRFA 4BE0A 4NB5A 2W1OA 1MH3A 2V1NA 3T1BA 4BQAA 2FSWA 2BVLA 2RGVA 1YJ9I 1WRJA 1OCTC 4A2UA 2NVXJ 4B3AA 3BOQA 1JKQC 4CZCA 4BHBA 4GFBA 1JKPC 1QPIA 2G9WA 3GZ5A 1KQ9A 3MVPA 2XAUA 4CA0A 5EEAA 3L2QA 2MD0A 4A5MA 4ON0A 2PBIA 3WTYC 1R9TJ 1WI3A 2ZCWA 2M87A 3H35A 3RPUA 1W5SA 4FE4A 3CCJI 4HBLA 2GBYA 4LLGF 2IRFG 3K10A 1CQTA 5FD5A 1X1PA 5J1UA 3KP6A 1HQCA 2CWEA 2OZ6A 1QO0D 1EH6A 2A07F 5J47A 3ZMVA 4AM3A 5IT9Z 3GW2A 1RPWA 2JPCA 1WSUA 1HCRA 1MBKA 4OIQF 1N78A 3OS1A 3PJRA 2JK3A 2ZXIA 3FM3A 2DMNA 3CCEI 3BCAA 3SZPA 4BHCA 1VQMI 1MMGA 2BVMA 4WXDA 1TQMA 1UZCA 1YTYA 3GVAA 1Y1WJ 3CUQC 3ZMZA 3CCUI 1NG6A 4EJWA 4D7NA 3CCRI 1T6SA 2EV5A 3D0SA 1V5EA 2KLOA 2LY2A 1R1VA 4L9VA 5FD6A 3FXLA 1P9QC 1I1SA 1BR4A 5BS6A 1E0EA 1ZN2A 4DQ2A 1UELB 2EWNA 1EH8A 2ZFWA 2X1CA 3VB2A 5KVRA 4MIMA 1ZLJA 4BS9A 4QTRA 2XAFA 4PZJA 3PM1A 3U9GA 3HRMA 4HW0A 5EYRA 1HXDA 2CG4A 3C18A 1O57A 4Q48A 1OYIA 4IX7A 3TDZC 2HI3A 1FOWA 2OQGA 2BHYA 3S3MA 3GX4X 1YRNA 1PUEE 1V3FA 5EGOB 4EJVA 4XRFA 2QEXI 4IRIA 3DKXA 4YEJA 2K40A 4HV6A 3QYEA 3HEFA 1I3QJ 3GMEA 3A01A 2CMPA 1BOBA 1TT0A 2E1CA 3MKWB 1I6HJ 4YG2F 1S72I 4TV7A 3FMSA 3K0LA 3ZQGA 3E3VA 2GXAA 4BEHA 1WH7A 2GAUA 5D5WB 5C44J 2LR8A 5JI6A 2EV6A 3ZQCA 4RB2C 3ULQB 3LSGA 1SMTA 3AL0B 2E1OA 2R3SA 3DU6A 4BYYA 1S7AA 1FIPA 2EZLA 4XSXF 1E3OC 3L2WA 3WTXC 2L3DA 3L2VA 3U2RA 4I2OA 1TWCJ 1P6RA 3IH4A 2XGXA 2L7KA 1WJBA 2JJ7A 2L7FP 4A3EJ 3HSEA 4LLLA 3VSLA 2ELKA 1WI9A 3TMOA 2KT0A 5BPIA 3WTZA 2FE3A 5B66C 2QBYA 4PGHA 4I98B 5A2QK 2DQLA 3BLYA 3BT9A 4ITVA 2WB1A 4IL6C 1ETWA 3JW4A 5HNFA 4FQGA 2CUZA 3K9TA 3M4OJ 2PMHA 1YQAA 3H9GA 5IYDJ 4UV8A 2QWWA 3C3WA 3REOA 4PJJA 3MZYA 2VQHA 5EZGA 4Y3OA 4X0GA 3R6SA 4IKFA 4UHTA 1V5GA 2MFZA 4D9JA 1HDDC 4HLYA 4K2EA 2LSOA 3IV5A 4E7SA 4XK4A 3PIPF 3NEUA 3BCBA 2DT6A 2OD5A 2WBMA 1MMNA 5HS9A 3KYLA 2MD5A 4A0XA 2L5QA 3O8GA 5H20A 1UAAA 4IF4A 5F08A 4ENJA 1IV6A 1VQ5I 3DQVC 3CZ6A 2XHKA 4IJAA 4DBQA 1AWCA 4PSXA 4HF1A 3ERED 2ZJ2A 1FZPB 1TWGJ 2A6EF 5FLXZ 2V9VA 3CLOA 1R6RA 1J2XA 1Y0NA 3K1NA 3LSMA 5ED4A 2JUCA 1W7PB 2W48A 1AHDP 2DK5A 4R1HA 5JHUA 2R0QC 5TGTA 4HX7A 4X1EA 4QIWN 4MNUA 2ME6A 3CUOA 2VN2A 3PFIA 1J09A 2LDUA 3DBHB 1XGOA 5E1WA 3J7AY 3I59B 2M30A 2J5PA 4XSZF 2VKHA 1YIJI 2QZ8A 3ABMH 4ZZLA 2VC1A 4FASD 3G73A 4OINF 4YFXF 2FX0A 4LB5A 3WTUC 4NC7A 1SVMA 4N9HA 3HKZA 5LFAA 2KJCA 3RDIA 5IOZA 2E7WA 2I10A 2GIVA 1S7EA 3KEYA 4B43A 1LE8A 4BU2A 3S93A 2P7CB 1DP7P 1ON1A 5FFZA 5J40A 4OIPF 1RUOA 2J5OA 2WA0A 1IG7A 1APLC 4P9UA 4V19K 1DP3A 1WFXA 4A6EA 1RESA 2BY1A 2X0LA 4QSHA 3GFIA 3F8BA 3QP5A 3D1NI 1XDUA 3L09A 1G3SA 1U8RA 1T39A 2ZXJA 1XGMA 3P5JA 5GPCA 1ZELA 1IRZA 3G1OA 1ZGWA 2HOAA 3GO5A 4QLCU 2RVCA 5CVRA 2HR3A 2OU2A 2ID6A 3A1YA 2N8GA 3CCSI 1QBJA 2IW5A 2VBXA 2DPUA 1LNWA 3K2AA 2IS4A 4ZYDA 4M74A 3ML6A 3CJRB 3HKZN 4KN4X 2Y9ZA 1TZLA 2RC4A 3TO6A 5KHDA 1P7JA 3W6KB 2IA1A 3CCVI 4PGGA 3F22A 3DEUA 4KMFA 3GTQJ 4ENMA 1ENHA 2M4KA 3AG1H 3K4CA 3HOYJ 3FXMA 2UV1A 1ZREA 2KFDA 4GDFA 3M9AA 4G6QA 2MLGA 4YIFA 4LMYA 2XRLA 2JWTA 1QGPA 4RLQA 4MEYF 1FYLA 1HDPA 1QHHD 4O5VA 4U0YA 3JR9A 2RN7A 5EG0A 2R7VA 1W0TA 1G3YA 1DU6A 5H6QA 3WGGA 2HU9A 3AFHA 2KIQA 3LSKA 2PEXA 5HOOA 4FCYA 2KJBA 3BJOA 5E79C 1D0XA 4W97A 1QQIA 5C4JJ 3A02A 1TQIA 4IOCF 2JUGA 1G3WA 1LVAA 1Y8QB 2RREA 2Q8KA 2JZYA 4LK1F 1K6YA 4E6KG 3LAJA 2LRDA 4UUSA 1ZR4A 3TP3A 1WJ5A 2CV2A 1GUUA 3TL4X 4A5NA 2HPMA 3E6DA 2NVQJ 1FBSA 3JRFA 1SVOA 4PFOA 1UFMA 3PSIA 3ZN0A 4XKWA 4PDKA 2K3PA 4QPQA 1HBXG 2F2EA 3QYFA 4IOAF 2QKMB 4X6AJ 1R4NB 1FC3A 4B4CA 5E1ZB 1KA8A 2CFXA 2QGUA 4IRHA 2X85A 5LLQA 4CH7A 1U2WA 4AIJA 2QM3A 1R58A 4PSWA 2DI3A 4G6DA 2CU7A 2X9DA 3R4KA 3CJNA 3BQYA 5JLXA 3LSTA 4HX8A 2VUMJ 4XLNF 2B7EA 1FX7A 2VPRA 2P8TA 1IN5A 2VXZA 3J81K 2XB0X 4RGSA 2E5ZA 1FTZA 3DTIA 2LP0A 3GXOA 3VDXA 3S1NJ 3SDGA 1JKOC 2Y0MA 3MZ8A 4IHWA 1W7PD 2M0MA 5CLSA 3K4NA 4Q5SF 4M3EA 4YFNF 2HQNA 1U6GA 2E35A 3QQAA 4B1RA 3FHZA 3E7LA 2ISZA 4KUMA 1YITI 2A5YB 1CGPA 2HZTA 1MJBA 3IUOA 1LVKA 4JX4A 3K70C 2Y9YA 5LHIA 5JLWA 2LKXA 1D1AA 1YRNB 3X2QH 1VQOI 3KP5A 5D6FA 3S3OA 5C4XJ 4S05A 1KU2A 2M4GA 2IS1A 2DMUA 4HQEA 2W82A 1P7IA 1STZA 2MABA 3KZZA 3HTSB 1QA6A 2KMUA 2Y2ZA 4BY1J 2ZB9A 3A01B 2VJJA 3I4MJ 2BY0A 4BL0B 1X2NA 4M71A 5TRDA 1OPCA 4BE1A 3WHCA 3ABLH 1M1EB 2CQ7A 2M9HA 3ESWB 2LF8A 3HOVJ 4BEHB 1VNDA 3JREA 1D8JA 2V1XA 2VXDA 1OJLA 3V8KA 1YE9A 4JK1X 4A3KJ 1FOXA 2UUZA 5GADJ 1UG2A 3KYCB 2XSDC 3V7SA 1I6XA 2VPLA 3S16J 2X6YA 2YSRA 1P2FA 5D6EA 1IXSB 3VEPA 4E7LA 2B9SA 4A69C 1J75A 2R7DA 4O3MA 2OUMA 2EB7A 1P4AA 3MMYB 1KQ8A 5TJJA 3JSPA 4AIHA 3QOPA 2EA4A 1SANA 2ECBA 1ETYA 2FJ1A 4DZJA 3CCLI 1EJ9A 3TO9A 3HM5A 4WK8F 2HDCA 1JT0A 3GWZA 4KNYA 3CP8A 4P55A 3MQ0A 2QBYB 3HOWJ 1K4TA 2DMTA 1YW8A 2O0YA 3F6VA 2A69F 4ETSA 1BM9A 2ZNZA 4WCGA 2F5VA 2ID3A 3ZQLA 2X6WA 1OYWA 1OLTA 1V54H 2NOGA 1OQYA 1VQPI 2Q2EA 3LA3A 1LDDA 2K4BA 1Q1VA 5ERIA 2DK8A 3DXJF 2XV4S 3KFWX 2L02A 1UJ8A 3O2PE 1ZHFA 3G4SI 1IN8A 2VODA 1O3TA 3ELKA 1S9HA 1SD7A 2F4IA 4IHXA 1O7FA 4NDLA 3RYPA 1ETOA 3C2BA 5FFXA 2A61A 1Y6IA 1IUFA 5F0FA 3FXJA 1RRJA 1ZYRF 2P5KA 1HW5A 1ZQ3P 4DYRA 1W36C 3MWMA 1I1GA 2HNHA 3CESA 4MGRA 3RPUD 2IJLA 2FBIA 4LGWA 3ZP5A 3GLXA 2OA4A 2CFOA 1RETA 5JR3A 2DPDA 1ORKA 2G7UA 2RAEA 2ZNYA 2EPFA 1F43A 2AO9A 5FO5A 4BQNA 2Z33A 3BQZA 3P9KA 2E2JJ 1Z3XA 2H6CA 4U88A 3S3NA 4IQJA 2PG4A 3F8FA 2IPQX 2XPVA 3GFMA 4D0PA 1LQ1A 1A35A 1AKHA 4EEFG 1LE8B 1Y39A 1DDNA 3PNVA 4IPAA 4FTHA 2LC2A 2W85A 3BDDA 2NVYJ 4F3QA 5EEGA
chains in the Genus database with same CATH topology
1KU9A 4FHTA 1YLFA 4WXHA 2FNAA 4GXOA 2XAGA 2K27A 1T0FA 2EK5A 1YS7A 2NNYA 3EDPA 4M72A 1HW2A 2NYXA 1YS6A 1LEAA 2DT5A 2MH2A 3N4MA 2KIFA 5F6FA 4L0ZB 3WTWC 3FF5A 1LDKB 3WTVC 3JTGA 1JHHA 2C6YA 1W5TA 4HAMA 4AIKA 1Z7UA 2VT3A 5DD4A 3L7WA 2CQKA 2P4WA 4HDUA 4L9JA 3V4GA 2DW4A 1YYVA 5E18F 1RUNA 4ESJA 3V7RA 1F4KA 4Y13A 2HS5A 3F3XA 1V4RA 4UUVA 4AWXB 1TW3A 4LJZF 3ZMSA 2GWRA 3C7JA 4XBFA 5JFRA 2MH9A 1DUXC 3QAHA 2IA2A 3M7GA 1K7AA 2WV0A 4P9FA 1Q1HA 2FF4A 2G7HA 1MJAA 5L3CA 3J7AO 2DLLA 1GXPA 2UXNA 4LFUA 4EJUA 4EQQA 2XAHA 4AD9A 3KEQA 2E7XA 1FLIA 2PFBA 1OKRA 2L54A 5BQTA 4GCVA 3ISPA 5ILVA 2A6HF 1FOKA 2HTSA 4KFCA 1S7OA 5L3BA 1K6OA 2ETHA 5LRRA 2K4JA 3KCCA 4MQ9F 5DD8A 1ONVA 4Y17A 5ICEA 1CF7A 3IC7A 1MZBA 1KYZA 2DFIA 2XRNA 1KYWA 4RB1A 4EJTA 2HYGD 2Z5UA 2RKHA 2FEZA 3HTUA 3CUQA 4M9ZA 2BE5F 3HOSA 3F21A 5L3DA 1XMKA 4U7BA 2BYVE 4CYDA 4BH9A 3P7NA 3WODF 5BOXA 4WXCA 3OV8A 4PCQA 2E1NA 3GFJA 2X4HA 5H6RA 3R0JA 1FNNA 2P5LC 1Z1DA 2FOKA 1K79A 1BI0A 5LEJA 2XAQA 1K78A 4FT8A 5KK1A 4YFKF 3I58A 1O3SA 2HFHA 2VBZA 4ZH4F 3RIRA 3JAMZ 3RYRA 4H0EA 3TQNA 2Z9OA 5ICCA 3DPLC 3MAJA 1J59A 1I5ZA 4WF2A 3L00A 3COAC 2LNBA 1FYKA 5DYMA 3VOEA 1IN7A 2QYOA 5CVIA 3J80K 3KP7A 4GYGA 3EETA 4UV9A 5HLIA 5LBQA 2FRHA 4MQVA 4B09A 2JRTA 3GUDA 4M6YA 3TOBA 5IT3A 1ZRCA 2HWVA 1TNSA 1SD5A 2VE9A 4YIIA 4CO8A 3GF2A 1FY7A 1EV7A 2O8XA 3RKYA 3Q9SA 2ESNA 4RAZA 4ZYGA 3JSOA 4HOBA 2KIMA 4CICA 4M9XA 4UVCA 2K7LA 3T5XA 4HF2A 2EFOA 1BOAA 2QLZA 5E17F 2O03A 3QPHA 1IZ1A 3HUGA 1HKQA 4KIFA 2GQQA 1XD7A 1GXQA 3ZMDA 1E17A 4RB3C 1MKMA 1RNLA 1BC8C 2GA1A 4I7HA 1IF1A 1D5VA 2EJRA 5LGTA 2HYFA 4A0ZA 3I0TA 5LGNA 1ZRDA 2H27A 4LLNA 2M1BA 2F5EA 1AOYA 1Y0UA 5BMZA 3WG9A 1T98A 2M8EA 1PP7U 4L18B 1U5TC 2W84A 1U78A 4R8HA 3R0AA 2OBPA 1SFUA 2GZWA 4RGRA 2ZBKA 2RQPA 1BI2A 1SAXA 1R5GA 5HVQC 1BI3A 1FP2A 3E6MA 3F8NA 3K1MA 1JHFA 4L0YB 2L4MA 3WGIA 2BBYA 1R23A 1XGSA 4IVNA 3KZYA 4EJOA 5F1RA 1GVJA 5CVUA 1JE8A 4P5OA 4L9NA 3DPTA 4MHGA 1EH7A 2KRFA 3JTHA 2PN6A 5D4SA 1DPUA 2L4AA 3IRRA 4LD5A 3ZPLA 1YFHA 1P92A 2EV0A 2DQRA 4RGUA 4LK0F 3CTAA 3KP3A 5J6XA 5D5UB 4IHSA 3I53A 2STWA 1ZG5A 1IW7F 4IXAA 4DNCA 1RI7A 1YW7A 2KKOA 5HS7A 2HOEA 1P4WA 2W57A 3LQQA 3MFKA 1SFEA 2XUBA 2WC2A 3DP7A 4EMSA 1TBXA 1CF7B 2W25A 1U3EM 1FT9A 3LA7A 3FWEA 1XGNA 1BN5A 3MEXA 3N97A 2NS0A 5A2QZ 3DKWA 5D5VB 3CUQB 4HF0A 3V7CA 2V79A 2HQRA 3F6OA 3RTRA 1IAWA 1C0WA 3IWZA 1F9NA 2D1HA 3BWGA 3CDHA 2VBYA 1I27A 5FGMA 4KIGA 1A04A 1H9GA 4HV5A 5IT9K 2OZUA 3ZQ7A 1Z91A 1K78B 2P6TA 5J8FA 1J7KA 3F72A 2QQBA 4CXFA 2DBBA 3NRVA 3ZMUA 3H3UA 3BROA 2K02A 1JXSA 5LHGA 2BV6A 1B9NA 2EFQA 1L3LA 4BNCA 3EUHA 3FXUA 3TO7A 5HDNA 3ECOA 2UZKA 2ZO4A 4OMYA 4A0YA 3IL2A 3FZVA 3K2ZA 1DPRA 4ENNA 1ON2A 1R5HA 1KU7A 4BXUA 4WWCA 4OOIA 3BZ6A 5HLGA 3QPTA 3E6BA 6PAXA 1B4AA 3U1DA 1YO5C 4G8XA 3WU1B 3HIFA 1WQ2A 1ZG1A 2H94A 1UHWA 5HDKA 4KN7X 2DAOA 2ELHA 4I09A 3DV8A 4OMZA 4Y15A 2LF7A 5LRSA 3PQJA 3SZTA 1FYMA 2BEOA 1PP8F 1FPQA 3L9FA 3LAPA 1Z6RA 1ULYA 4KIBA 4EVIA 1P4XA 1F1ZA 2CO5A 2FBHA 4U0WA 4ESBA 3E6CC 4NQWA 1MGTA 3KEOA 4UVBA 2R7FA 3KP2A 3OOPA 2UXXA 2DO7A 2PQ8A 1LJ9A 3JAMK 1FP1D 4ESFA 2FMYA 5HLHA 4RB0A 3CO6C 1F5TA 3HHHA 2XIGA 4LG0A 5FLXK 2IA0A 1OMIA 2Y48A 4A12A 2VONA 4ZYHA 3IHUA 3Q5FA 2NAZA 3NQOA 4OIRF 4ZZDA 4Z2YA 3QU6A 2FA5A 3IKVA 2OAZA 2ADUA 3ZN1A 1S8NA 2ESHA 2YX4A 4KDPA 1XB4A 2STTA 2ISYA 2XAJA 2XASA 4L5JA 3IWFA 3TGNA 5DEQA 1TW2A 5D8LB 3LA2A 4UNOA 5LGUA 4HX4A 2CYYA 2P5VA 5DDGA 3WTSC 3EQLF 1ZG3A 3WTTC 4CHUA 4OIOF 2RDPA 4QWQA 2EFPA 2W24A 4HLXA 3HRSA 3ECHA 3HRUA 3V8JA 3LWFA 4MTEA 4EM0B 1ZAOA 3VFZA 5DCFA 2L01A 4HA8A 1S3JA 2RNJA 1REPC 3HHGA 3KLNA 2HKXA 1X3UA 1E2XA 1S6LA 1G4DA 2EFNA 1MD0A 2Z3YA 5J8CA 1G6NA 2O61A 1JGSA 2VOOA 2QUFA 1D3YA 3WU0A 2MBFA 3GZ6A 1HSTA 1TNTA 3SXYA 3ABTA 4EM1A 4G7OF 3O6BB 1USTA 2WWYA 1L0OC 1HKTA 3ABUA 3BJ6A 3PQKA 2PJPA 5ILUA 1ZH5A 3H3ZA 4FX0A 2FU4A 3M8FA 3E5QA 3KLOA 1BIBA 1O3QA 4B8XA 1SFXA 4S04A 2HKOA 1H9TA 1LEBA 3DF8A 3T8RA 3G3ZA 3I64A 4L5IA 5AIPA 1BJAA 3P9IA 3T0YA 3KE2A 3RI4A 4I01A 2MC3A 4G7HF 5ICFA 1OYYA 4EGYA 4GO1A 2TDXA 3O3KA 2O6GE 3I71A 1T38A 2VBWA 1IUYA 3FMQA 1XCVA 3V8LA 2CW0F 3HRTA 1KGSA 1QPMA 2M45A 5CYVA 2K86A 1B9MA 4XLPF 3FMRA 5DV5A 2EA2A 1R1UA 3I54A 1XDSA 4KT5C 1J9IA 4M9SA 5EEHA 3L2CA 4RS8A 2B0LA 5CJ9A 2FQ3A 4HYEA 1Z6TA 3QP6A 4EGZA 4NHJA 2JSCA 2JPBA 4WX9A 5ILSA 2QQAA 3BP8A 2O3FA 4KMUX 3VODA 3K1PA 5L3GA 4Q4ZF 3E5XA 3Q9VA 5AIQA 2VE8A 3CO7C 2UWMA 1RZ4A 5DCMA 2COMA 2ZMEA 1TLHB 2XKPA 5LEKA 1ZGJA 5K5RA 2F5FA 3WE3A 3KETA 2H09A 4ASNA 2Q0OA 5BPDA 1WKMA 3ZMTA 3LFKA 2DU9A 2RV8A 1J5YA 1FBQA 3GFLA 1MJ9A 3W6JB 3HSRA 1UCRA 1R36A 3I5UA 1IRGA 3MCZA 4LG0B 2CGPA 2MLKA 3RPQA 3C1DA 1RIOH 2VOPA 1B59A 3F8CA 3HSFA 4MEXF 5HS8A 2H6BA 4P96A 2FMLA 1LB2A 1PDNC 3P9CA 1ODDA 5E8IA 2HGCA 2IT0A 2XKOA 2QQ9A 3E5UA 1XSXA 1HW1A 3M1EA 1BBYA 3BPVA 4G94A 3RJPA 4U7DA 5ICGA 1QZZA 4G7ZF 4HDVA 1FBUA 4F7ZA 5LHHA 3HOTA 1GHCA 1TQPA 3FXRA 1FSHA 1R22A 1MDMA 1YIOA 5E20A 3IRQA 1KU3A 1IXRC 3T8TA 2CSOA 1B1BA 2A68F 1U5TA 2P7VB 3DFGA 2YPRA 5F64A 2Z99A 1ZARA 4UXNA 4ENKA 1IN6A 4KA4A 2IP2A 1XCBA 2YX7A 2IVMA 4G9YA 2AS5F 1UHMA 1YW9A 2VC0A 1OR7A 5HDGA 3FXQA 2XVCA 2FBKA 4RGXA 1BI1A 3I4PA 3R61A 3FM5A 3B02A 4I02A 3QRFF 2PMUA 2D45A 3F23A 1SD6A 1VTNC 1ZGAA 3M8EA 3BJAA 3LQRA 1XN7A 3TOAA 4RAYA 3F8MA 4N9IA 2D1VA 2YU3A 5D5XB 2GXGA 4CZZA 1Z9CA 4R79A 2OQRA 1FSEA 1LDJA 1O7LA 3WE2A 4M6XA 1NHAA 1G3TA 2AXLA 4BHPA 3J80Z 1ZLKA 4E70A 5DUIA 2GXBA 1HSJA 1D8KA 2D2WA 2GA2A 3SHFA 2MA3A 1WWXA 2WTEA 2HEOA 1HKSA 4I0AA 2Y75A 5E1XA 4CGZA 1XSVA 4MTDA 4U0VA 4L9TA 4ZYEA 3D5LA 1S29A 4EM2A 5CVVA 4AVPA 4A6DA 4OU0A 2FNPA 1R00A 4IRGA 4BAYA 2LKPA 3ROUA 1SMYF 2PI0A 1Z05A 3FX3A 2A3SA 3GYHX 5K1YA 4EV0A 5L3FA 1YG2A 2NRAC 2EFWA 5DCMB 1QNTA 2ZMEB 3H92A 3AAFA 4JBAA 2BGCA 3R60A 2PLYA 2F5CA 1IXCA 2F5DA 5D8KB 4UVAA 1BIAA 2XROA 1R7JA 2P6SA 2KIUA 4HQMA 4HZFA 4FX4A 1XMAA 2M5WA 3EYYA 2FXAA 3EYIA 2VT2A 1TTYA 1W7PA 1USSA 5K5QA 4GGGA 5JVTA 3HYIA 1KQ0A 3IKTA 1J0RA 3I59A 2V1UA 3TKYA 3RKXA 1H0MA 2NNNA 4N0BA 3GEZA 1FWZA 5L3EA 5AONA 3S2WA 2HTJA 3E97A 1B6AA 1R1TA 4M73A 1IN4A 5FB2A 1IRFA 3BY6A 4KYWA 3WGHA 3KP4A 4CDGA 5D4RA 2QVOA 4JQFA 3QU3A 2JT1A 3BPXA 2DTRA 3SFZA 1T2KA 2YR2A 2ACJA 5DUKA 5CVJA 3J81Z 1SD4A 4LB6B 1UB9A 2ZKZA 1BC7C 3B73A 3SQNA 4IHTA 1XSDA 3K69A 2QENA 1QZYA 4Q47A 3MZHA 1MDMB 4KICA 1W4MA 4I0BA 3RKWA 4O6JA 2V1DA 4GYIA 5E8GA 2V6CA 1O3RA 2JTVA 5K5OA 3TDUC 1U5TB 1ZRFA 4NB5A 3T1BA 4BQAA 2FSWA 2RGVA 1WRJA 4A2UA 3BOQA 4BHBA 2G9WA 3GZ5A 1KQ9A 4A5MA 4ON0A 2PBIA 3WTYC 2ZCWA 2M87A 3RPUA 1W5SA 4HBLA 4LLGF 2IRFG 5FD5A 3KP6A 1HQCA 2CWEA 2OZ6A 1QO0D 1EH6A 2A07F 3ZMVA 5IT9Z 3GW2A 4OIQF 2JPCA 1WSUA 3FM3A 3SZPA 4BHCA 4WXDA 1TQMA 1YTYA 3GVAA 3CUQC 3ZMZA 4EJWA 1T6SA 2EV5A 3D0SA 4L9VA 1R1VA 5FD6A 1I1SA 5BS6A 1ZN2A 4DQ2A 2EWNA 1EH8A 2ZFWA 3VB2A 5KVRA 1ZLJA 2XAFA 4PZJA 3U9GA 3HRMA 4HW0A 1HXDA 2CG4A 3C18A 1O57A 4Q48A 1OYIA 3TDZC 2OQGA 3GX4X 1PUEE 1V3FA 4EJVA 4XRFA 4IRIA 4HV6A 2E1CA 4YG2F 4TV7A 3FMSA 3K0LA 3E3VA 2GAUA 5D5WB 5JI6A 2EV6A 4RB2C 3ULQB 1SMTA 4BYYA 2R3SA 1S7AA 4XSXF 3WTXC 2L3DA 3U2RA 4I2OA 1P6RA 2XGXA 3HSEA 4LLLA 1WI9A 5BPIA 3WTZA 2FE3A 2QBYA 4PGHA 4I98B 5A2QK 2DQLA 3JW4A 3K9TA 2PMHA 1YQAA 4UV8A 2QWWA 3C3WA 3REOA 3MZYA 3R6SA 4UHTA 4HLYA 4K2EA 2LSOA 3NEUA 2OD5A 5HS9A 2MD5A 4A0XA 5H20A 4IF4A 4ENJA 3DQVC 2XHKA 4IJAA 1AWCA 4HF1A 3ERED 2ZJ2A 1FZPB 2A6EF 5FLXZ 2V9VA 3CLOA 1J2XA 3K1NA 5ED4A 1W7PB 2DK5A 4R1HA 5JHUA 4HX7A 4MNUA 3CUOA 2VN2A 3PFIA 2LDUA 1XGOA 5E1WA 3I59B 2M30A 2J5PA 4XSZF 2QZ8A 4ZZLA 2VC1A 3G73A 4OINF 4YFXF 4LB5A 3WTUC 4N9HA 2KJCA 3RDIA 2E7WA 2GIVA 2P7CB 1DP7P 1ON1A 5FFZA 4OIPF 1RUOA 2J5OA 4P9UA 4A6EA 2X0LA 3GFIA 3F8BA 3QP5A 1XDUA 3L09A 1G3SA 1U8RA 1T39A 2ZXJA 1XGMA 3GO5A 4QLCU 2RVCA 5CVRA 2HR3A 2OU2A 1QBJA 2IW5A 2VBXA 2DPUA 1LNWA 4ZYDA 4M74A 3ML6A 4KN4X 2RC4A 3TO6A 3W6KB 2IA1A 4PGGA 3F22A 3DEUA 4KMFA 4ENMA 1ZREA 3M9AA 4G6QA 2MLGA 4YIFA 4LMYA 1QGPA 4MEYF 1FYLA 4O5VA 4U0YA 2RN7A 1G3YA 5H6QA 3WGGA 2PEXA 5HOOA 2KJBA 3BJOA 1QQIA 1TQIA 1G3WA 1LVAA 2Q8KA 2JZYA 4LK1F 3LAJA 4A5NA 3E6DA 1FBSA 1UFMA 3ZN0A 4PDKA 1HBXG 2F2EA 1FC3A 5E1ZB 1KA8A 2CFXA 4IRHA 5LLQA 1U2WA 4AIJA 2QM3A 1R58A 2DI3A 4G6DA 3R4KA 3CJNA 3LSTA 4HX8A 4XLNF 1FX7A 2P8TA 1IN5A 2VXZA 3J81K 4RGSA 3GXOA 2Y0MA 1W7PD 5CLSA 4Q5SF 4YFNF 2HQNA 1U6GA 3FHZA 2ISZA 4KUMA 2A5YB 1CGPA 2HZTA 1MJBA 5LHIA 3KP5A 5D6FA 4S05A 1KU2A 4HQEA 1STZA 3KZZA 3HTSB 4M71A 5TRDA 1OPCA 2LF8A 1D8JA 2V1XA 3V8KA 4JK1X 3V7SA 1I6XA 3VEPA 2YSRA 1P2FA 5D6EA 1IXSB 1J75A 2R7DA 4O3MA 1KQ8A 2EB7A 1P4AA 5TJJA 3JSPA 4AIHA 3QOPA 2EA4A 3TO9A 4WK8F 2HDCA 3GWZA 4KNYA 4P55A 2QBYB 3MQ0A 1YW8A 2O0YA 3F6VA 2A69F 4ETSA 1BM9A 2ZNZA 4WCGA 1OYWA 2Q2EA 3LA3A 1LDDA 2K4BA 5ERIA 2DK8A 3DXJF 2XV4S 3KFWX 2L02A 3O2PE 1ZHFA 1IN8A 2VODA 1O3TA 3ELKA 1SD7A 1O7FA 3RYPA 5FFXA 2A61A 1ZYRF 2P5KA 1HW5A 3MWMA 1I1GA 4MGRA 2IJLA 2FBIA 4LGWA 3ZP5A 3GLXA 2OA4A 5JR3A 2DPDA 2G7UA 2ZNYA 5FO5A 2Z33A 3P9KA 2H6CA 4U88A 2PG4A 3F8FA 2IPQX 3GFMA 4D0PA 1LQ1A 1DDNA 4IPAA 2W85A 3BDDA 5EEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KU9 A;  4FHT A;  1YLF A;  4WXH A;  2FNA A;  4GXO A;  2XAG A;  2K27 A;  1T0F A;  2EK5 A;  1YS7 A;  2NNY A;  3EDP A;  4M72 A;  1HW2 A;  2NYX A;  1YS6 A;  1LEA A;  2DT5 A;  2MH2 A;  3N4M A;  2KIF A;  5F6F A;  4L0Z B;  3WTW C;  3FF5 A;  1LDK B;  3WTV C;  3JTG A;  1JHH A;  2C6Y A;  1W5T A;  4HAM A;  4AIK A;  1Z7U A;  2VT3 A;  5DD4 A;  3L7W A;  2CQK A;  2P4W A;  4HDU A;  4L9J A;  3V4G A;  2DW4 A;  1YYV A;  5E18 F;  1RUN A;  4ESJ A;  3V7R A;  1F4K A;  4Y13 A;  2HS5 A;  3F3X A;  1V4R A;  4UUV A;  4AWX B;  1TW3 A;  4LJZ F;  3ZMS A;  2GWR A;  3C7J A;  4XBF A;  5JFR A;  2MH9 A;  1DUX C;  3QAH A;  2IA2 A;  3M7G A;  1K7A A;  2WV0 A;  4P9F A;  1Q1H A;  2FF4 A;  2G7H A;  1MJA A;  5L3C A;  3J7A O;  2DLL A;  1GXP A;  2UXN A;  4LFU A;  4EJU A;  4EQQ A;  2XAH A;  4AD9 A;  3KEQ A;  2E7X A;  1FLI A;  2PFB A;  1OKR A;  2L54 A;  5BQT A;  4GCV A;  3ISP A;  5ILV A;  2A6H F;  1FOK A;  2HTS A;  4KFC A;  1S7O A;  5L3B A;  1K6O A;  2ETH A;  5LRR A;  2K4J A;  3KCC A;  4MQ9 F;  5DD8 A;  1ONV A;  4Y17 A;  5ICE A;  1CF7 A;  3IC7 A;  1MZB A;  1KYZ A;  2DFI A;  2XRN A;  1KYW A;  4RB1 A;  4EJT A;  2HYG D;  2Z5U A;  2RKH A;  2FEZ A;  3HTU A;  3CUQ A;  4M9Z A;  2BE5 F;  3HOS A;  3F21 A;  5L3D A;  1XMK A;  4U7B A;  2BYV E;  4CYD A;  4BH9 A;  3P7N A;  3WOD F;  5BOX A;  4WXC A;  3OV8 A;  4PCQ A;  2E1N A;  3GFJ A;  2X4H A;  5H6R A;  3R0J A;  1FNN A;  2P5L C;  1Z1D A;  2FOK A;  1K79 A;  1BI0 A;  5LEJ A;  2XAQ A;  1K78 A;  4FT8 A;  5KK1 A;  4YFK F;  3I58 A;  1O3S A;  2HFH A;  2VBZ A;  4ZH4 F;  3RIR A;  3JAM Z;  3RYR A;  4H0E A;  3TQN A;  2Z9O A;  5ICC A;  3DPL C;  3MAJ A;  1J59 A;  1I5Z A;  4WF2 A;  3L00 A;  3COA C;  2LNB A;  1FYK A;  5DYM A;  3VOE A;  1IN7 A;  2QYO A;  5CVI A;  3J80 K;  3KP7 A;  4GYG A;  3EET A;  4UV9 A;  5HLI A;  5LBQ A;  2FRH A;  4MQV A;  4B09 A;  2JRT A;  3GUD A;  4M6Y A;  3TOB A;  5IT3 A;  1ZRC A;  2HWV A;  1TNS A;  1SD5 A;  2VE9 A;  4YII A;  4CO8 A;  3GF2 A;  1FY7 A;  1EV7 A;  2O8X A;  3RKY A;  3Q9S A;  2ESN A;  4RAZ A;  4ZYG A;  3JSO A;  4HOB A;  2KIM A;  4CIC A;  4M9X A;  4UVC A;  2K7L A;  3T5X A;  4HF2 A;  2EFO A;  1BOA A;  2QLZ A;  5E17 F;  2O03 A;  3QPH A;  1IZ1 A;  3HUG A;  1HKQ A;  4KIF A;  2GQQ A;  1XD7 A;  1GXQ A;  3ZMD A;  1E17 A;  4RB3 C;  1MKM A;  1RNL A;  1BC8 C;  2GA1 A;  4I7H A;  1IF1 A;  1D5V A;  2EJR A;  5LGT A;  2HYF A;  4A0Z A;  3I0T A;  5LGN A;  1ZRD A;  2H27 A;  4LLN A;  2M1B A;  2F5E A;  1AOY A;  1Y0U A;  5BMZ A;  3WG9 A;  1T98 A;  2M8E A;  1PP7 U;  4L18 B;  1U5T C;  2W84 A;  1U78 A;  4R8H A;  3R0A A;  2OBP A;  1SFU A;  2GZW A;  4RGR A;  2ZBK A;  2RQP A;  1BI2 A;  1SAX A;  1R5G A;  5HVQ C;  1BI3 A;  1FP2 A;  3E6M A;  3F8N A;  3K1M A;  1JHF A;  4L0Y B;  2L4M A;  3WGI A;  2BBY A;  1R23 A;  1XGS A;  4IVN A;  3KZY A;  4EJO A;  5F1R A;  1GVJ A;  5CVU A;  1JE8 A;  4P5O A;  4L9N A;  3DPT A;  4MHG A;  1EH7 A;  2KRF A;  3JTH A;  2PN6 A;  5D4S A;  1DPU A;  2L4A A;  3IRR A;  4LD5 A;  3ZPL A;  1YFH A;  1P92 A;  2EV0 A;  2DQR A;  4RGU A;  4LK0 F;  3CTA A;  3KP3 A;  5J6X A;  5D5U B;  4IHS A;  3I53 A;  2STW A;  1ZG5 A;  1IW7 F;  4IXA A;  4DNC A;  1RI7 A;  1YW7 A;  2KKO A;  5HS7 A;  2HOE A;  1P4W A;  2W57 A;  3LQQ A;  3MFK A;  1SFE A;  2XUB A;  2WC2 A;  3DP7 A;  4EMS A;  1TBX A;  1CF7 B;  2W25 A;  1U3E M;  1FT9 A;  3LA7 A;  3FWE A;  1XGN A;  1BN5 A;  3MEX A;  3N97 A;  2NS0 A;  5A2Q Z;  3DKW A;  5D5V B;  3CUQ B;  4HF0 A;  3V7C A;  2V79 A;  2HQR A;  3F6O A;  3RTR A;  1IAW A;  1C0W A;  3IWZ A;  1F9N A;  2D1H A;  3BWG A;  3CDH A;  2VBY A;  1I27 A;  5FGM A;  4KIG A;  1A04 A;  1H9G A;  4HV5 A;  5IT9 K;  2OZU A;  3ZQ7 A;  1Z91 A;  1K78 B;  2P6T A;  5J8F A;  1J7K A;  3F72 A;  2QQB A;  4CXF A;  2DBB A;  3NRV A;  3ZMU A;  3H3U A;  3BRO A;  2K02 A;  1JXS A;  5LHG A;  2BV6 A;  1B9N A;  2EFQ A;  1L3L A;  4BNC A;  3EUH A;  3FXU A;  3TO7 A;  5HDN A;  3ECO A;  2UZK A;  2ZO4 A;  4OMY A;  4A0Y A;  3IL2 A;  3FZV A;  3K2Z A;  1DPR A;  4ENN A;  1ON2 A;  1R5H A;  1KU7 A;  4BXU A;  4WWC A;  4OOI A;  3BZ6 A;  5HLG A;  3QPT A;  3E6B A;  6PAX A;  1B4A A;  3U1D A;  1YO5 C;  4G8X A;  3WU1 B;  3HIF A;  1WQ2 A;  1ZG1 A;  2H94 A;  1UHW A;  5HDK A;  4KN7 X;  2DAO A;  2ELH A;  4I09 A;  3DV8 A;  4OMZ A;  4Y15 A;  2LF7 A;  5LRS A;  3PQJ A;  3SZT A;  1FYM A;  2BEO A;  1PP8 F;  1FPQ A;  3L9F A;  3LAP A;  1Z6R A;  1ULY A;  4KIB A;  4EVI A;  1P4X A;  1F1Z A;  2CO5 A;  2FBH A;  4U0W A;  4ESB A;  3E6C C;  4NQW A;  1MGT A;  3KEO A;  4UVB A;  2R7F A;  3KP2 A;  3OOP A;  2UXX A;  2DO7 A;  2PQ8 A;  1LJ9 A;  3JAM K;  1FP1 D;  4ESF A;  2FMY A;  5HLH A;  4RB0 A;  3CO6 C;  1F5T A;  3HHH A;  2XIG A;  4LG0 A;  5FLX K;  2IA0 A;  1OMI A;  2Y48 A;  4A12 A;  2VON A;  4ZYH A;  3IHU A;  3Q5F A;  2NAZ A;  3NQO A;  4OIR F;  4ZZD A;  4Z2Y A;  3QU6 A;  2FA5 A;  3IKV A;  2OAZ A;  2ADU A;  3ZN1 A;  1S8N A;  2ESH A;  2YX4 A;  4KDP A;  1XB4 A;  2STT A;  2ISY A;  2XAJ A;  2XAS A;  4L5J A;  3IWF A;  3TGN A;  5DEQ A;  1TW2 A;  5D8L B;  3LA2 A;  4UNO A;  5LGU A;  4HX4 A;  2CYY A;  2P5V A;  5DDG A;  3WTS C;  3EQL F;  1ZG3 A;  3WTT C;  4CHU A;  4OIO F;  2RDP A;  4QWQ A;  2EFP A;  2W24 A;  4HLX A;  3HRS A;  3ECH A;  3HRU A;  3V8J A;  3LWF A;  4MTE A;  4EM0 B;  1ZAO A;  3VFZ A;  5DCF A;  2L01 A;  4HA8 A;  1S3J A;  2RNJ A;  1REP C;  3HHG A;  3KLN A;  2HKX A;  1X3U A;  1E2X A;  1S6L A;  1G4D A;  2EFN A;  1MD0 A;  2Z3Y A;  5J8C A;  1G6N A;  2O61 A;  1JGS A;  2VOO A;  2QUF A;  1D3Y A;  3WU0 A;  2MBF A;  3GZ6 A;  1HST A;  1TNT A;  3SXY A;  3ABT A;  4EM1 A;  4G7O F;  3O6B B;  1UST A;  2WWY A;  1L0O C;  1HKT A;  3ABU A;  3BJ6 A;  3PQK A;  2PJP A;  5ILU A;  1ZH5 A;  3H3Z A;  4FX0 A;  2FU4 A;  3M8F A;  3E5Q A;  3KLO A;  1BIB A;  1O3Q A;  4B8X A;  1SFX A;  4S04 A;  2HKO A;  1H9T A;  1LEB A;  3DF8 A;  3T8R A;  3G3Z A;  3I64 A;  4L5I A;  5AIP A;  1BJA A;  3P9I A;  3T0Y A;  3KE2 A;  3RI4 A;  4I01 A;  2MC3 A;  4G7H F;  5ICF A;  1OYY A;  4EGY A;  4GO1 A;  2TDX A;  3O3K A;  2O6G E;  3I71 A;  1T38 A;  2VBW A;  1IUY A;  3FMQ A;  1XCV A;  3V8L A;  2CW0 F;  3HRT A;  1KGS A;  1QPM A;  2M45 A;  5CYV A;  2K86 A;  1B9M A;  4XLP F;  3FMR A;  5DV5 A;  2EA2 A;  1R1U A;  3I54 A;  1XDS A;  4KT5 C;  1J9I A;  4M9S A;  5EEH A;  3L2C A;  4RS8 A;  2B0L A;  5CJ9 A;  2FQ3 A;  4HYE A;  1Z6T A;  3QP6 A;  4EGZ A;  4NHJ A;  2JSC A;  2JPB A;  4WX9 A;  5ILS A;  2QQA A;  3BP8 A;  2O3F A;  4KMU X;  3VOD A;  3K1P A;  5L3G A;  4Q4Z F;  3E5X A;  3Q9V A;  5AIQ A;  2VE8 A;  3CO7 C;  2UWM A;  1RZ4 A;  5DCM A;  2COM A;  2ZME A;  1TLH B;  2XKP A;  5LEK A;  1ZGJ A;  5K5R A;  2F5F A;  3WE3 A;  3KET A;  2H09 A;  4ASN A;  2Q0O A;  5BPD A;  1WKM A;  3ZMT A;  3LFK A;  2DU9 A;  2RV8 A;  1J5Y A;  1FBQ A;  3GFL A;  1MJ9 A;  3W6J B;  3HSR A;  1UCR A;  1R36 A;  3I5U A;  1IRG A;  3MCZ A;  4LG0 B;  2CGP A;  2MLK A;  3RPQ A;  3C1D A;  1RIO H;  2VOP A;  1B59 A;  3F8C A;  3HSF A;  4MEX F;  5HS8 A;  2H6B A;  4P96 A;  2FML A;  1LB2 A;  1PDN C;  3P9C A;  1ODD A;  5E8I A;  2HGC A;  2IT0 A;  2XKO A;  2QQ9 A;  3E5U A;  1XSX A;  1HW1 A;  3M1E A;  1BBY A;  3BPV A;  4G94 A;  3RJP A;  4U7D A;  5ICG A;  1QZZ A;  4G7Z F;  4HDV A;  1FBU A;  4F7Z A;  5LHH A;  3HOT A;  1GHC A;  1TQP A;  3FXR A;  1FSH A;  1R22 A;  1MDM A;  1YIO A;  5E20 A;  3IRQ A;  1KU3 A;  1IXR C;  3T8T A;  2CSO A;  1B1B A;  2A68 F;  1U5T A;  2P7V B;  3DFG A;  2YPR A;  5F64 A;  2Z99 A;  1ZAR A;  4UXN A;  4ENK A;  1IN6 A;  4KA4 A;  2IP2 A;  1XCB A;  2YX7 A;  2IVM A;  4G9Y A;  2AS5 F;  1UHM A;  1YW9 A;  2VC0 A;  1OR7 A;  5HDG A;  3FXQ A;  2XVC A;  2FBK A;  4RGX A;  1BI1 A;  3I4P A;  3R61 A;  3FM5 A;  3B02 A;  4I02 A;  3QRF F;  2PMU A;  2D45 A;  3F23 A;  1SD6 A;  1VTN C;  1ZGA A;  3M8E A;  3BJA A;  3LQR A;  1XN7 A;  3TOA A;  4RAY A;  3F8M A;  4N9I A;  2D1V A;  2YU3 A;  5D5X B;  2GXG A;  4CZZ A;  1Z9C A;  4R79 A;  2OQR A;  1FSE A;  1LDJ A;  1O7L A;  3WE2 A;  4M6X A;  1NHA A;  1G3T A;  2AXL A;  4BHP A;  3J80 Z;  1ZLK A;  4E70 A;  5DUI A;  2GXB A;  1HSJ A;  1D8K A;  2D2W A;  2GA2 A;  3SHF A;  2MA3 A;  1WWX A;  2WTE A;  2HEO A;  1HKS A;  4I0A A;  2Y75 A;  5E1X A;  4CGZ A;  1XSV A;  4MTD A;  4U0V A;  4L9T A;  4ZYE A;  3D5L A;  1S29 A;  4EM2 A;  5CVV A;  4AVP A;  4A6D A;  4OU0 A;  2FNP A;  1R00 A;  4IRG A;  4BAY A;  2LKP A;  3ROU A;  1SMY F;  2PI0 A;  1Z05 A;  3FX3 A;  2A3S A;  3GYH X;  5K1Y A;  4EV0 A;  5L3F A;  1YG2 A;  2NRA C;  2EFW A;  5DCM B;  1QNT A;  2ZME B;  3H92 A;  3AAF A;  4JBA A;  2BGC A;  3R60 A;  2PLY A;  2F5C A;  1IXC A;  2F5D A;  5D8K B;  4UVA A;  1BIA A;  2XRO A;  1R7J A;  2P6S A;  2KIU A;  4HQM A;  4HZF A;  4FX4 A;  1XMA A;  2M5W A;  3EYY A;  2FXA A;  3EYI A;  2VT2 A;  1TTY A;  1W7P A;  1USS A;  5K5Q A;  4GGG A;  5JVT A;  3HYI A;  1KQ0 A;  3IKT A;  1J0R A;  3I59 A;  2V1U A;  3TKY A;  3RKX A;  1H0M A;  2NNN A;  4N0B A;  3GEZ A;  1FWZ A;  5L3E A;  5AON A;  3S2W A;  2HTJ A;  3E97 A;  1B6A A;  1R1T A;  4M73 A;  1IN4 A;  5FB2 A;  1IRF A;  3BY6 A;  4KYW A;  3WGH A;  3KP4 A;  4CDG A;  5D4R A;  2QVO A;  4JQF A;  3QU3 A;  2JT1 A;  3BPX A;  2DTR A;  3SFZ A;  1T2K A;  2YR2 A;  2ACJ A;  5DUK A;  5CVJ A;  3J81 Z;  1SD4 A;  4LB6 B;  1UB9 A;  2ZKZ A;  1BC7 C;  3B73 A;  3SQN A;  4IHT A;  1XSD A;  3K69 A;  2QEN A;  1QZY A;  4Q47 A;  3MZH A;  1MDM B;  4KIC A;  1W4M A;  4I0B A;  3RKW A;  4O6J A;  2V1D A;  4GYI A;  5E8G A;  2V6C A;  1O3R A;  2JTV A;  5K5O A;  3TDU C;  1U5T B;  1ZRF A;  4NB5 A;  3T1B A;  4BQA A;  2FSW A;  2RGV A;  1WRJ A;  4A2U A;  3BOQ A;  4BHB A;  2G9W A;  3GZ5 A;  1KQ9 A;  4A5M A;  4ON0 A;  2PBI A;  3WTY C;  2ZCW A;  2M87 A;  3RPU A;  1W5S A;  4HBL A;  4LLG F;  2IRF G;  5FD5 A;  3KP6 A;  1HQC A;  2CWE A;  2OZ6 A;  1QO0 D;  1EH6 A;  2A07 F;  3ZMV A;  5IT9 Z;  3GW2 A;  4OIQ F;  2JPC A;  1WSU A;  3FM3 A;  3SZP A;  4BHC A;  4WXD A;  1TQM A;  1YTY A;  3GVA A;  3CUQ C;  3ZMZ A;  4EJW A;  1T6S A;  2EV5 A;  3D0S A;  4L9V A;  1R1V A;  5FD6 A;  1I1S A;  5BS6 A;  1ZN2 A;  4DQ2 A;  2EWN A;  1EH8 A;  2ZFW A;  3VB2 A;  5KVR A;  1ZLJ A;  2XAF A;  4PZJ A;  3U9G A;  3HRM A;  4HW0 A;  1HXD A;  2CG4 A;  3C18 A;  1O57 A;  4Q48 A;  1OYI A;  3TDZ C;  2OQG A;  3GX4 X;  1PUE E;  1V3F A;  4EJV A;  4XRF A;  4IRI A;  4HV6 A;  2E1C A;  4YG2 F;  4TV7 A;  3FMS A;  3K0L A;  3E3V A;  2GAU A;  5D5W B;  5JI6 A;  2EV6 A;  4RB2 C;  3ULQ B;  1SMT A;  4BYY A;  2R3S A;  1S7A A;  4XSX F;  3WTX C;  2L3D A;  3U2R A;  4I2O A;  1P6R A;  2XGX A;  3HSE A;  4LLL A;  1WI9 A;  5BPI A;  3WTZ A;  2FE3 A;  2QBY A;  4PGH A;  4I98 B;  5A2Q K;  2DQL A;  3JW4 A;  3K9T A;  2PMH A;  1YQA A;  4UV8 A;  2QWW A;  3C3W A;  3REO A;  3MZY A;  3R6S A;  4UHT A;  4HLY A;  4K2E A;  2LSO A;  3NEU A;  2OD5 A;  5HS9 A;  2MD5 A;  4A0X A;  5H20 A;  4IF4 A;  4ENJ A;  3DQV C;  2XHK A;  4IJA A;  1AWC A;  4HF1 A;  3ERE D;  2ZJ2 A;  1FZP B;  2A6E F;  5FLX Z;  2V9V A;  3CLO A;  1J2X A;  3K1N A;  5ED4 A;  1W7P B;  2DK5 A;  4R1H A;  5JHU A;  4HX7 A;  4MNU A;  3CUO A;  2VN2 A;  3PFI A;  2LDU A;  1XGO A;  5E1W A;  3I59 B;  2M30 A;  2J5P A;  4XSZ F;  2QZ8 A;  4ZZL A;  2VC1 A;  3G73 A;  4OIN F;  4YFX F;  4LB5 A;  3WTU C;  4N9H A;  2KJC A;  3RDI A;  2E7W A;  2GIV A;  2P7C B;  1DP7 P;  1ON1 A;  5FFZ A;  4OIP F;  1RUO A;  2J5O A;  4P9U A;  4A6E A;  2X0L A;  3GFI A;  3F8B A;  3QP5 A;  1XDU A;  3L09 A;  1G3S A;  1U8R A;  1T39 A;  2ZXJ A;  1XGM A;  3GO5 A;  4QLC U;  2RVC A;  5CVR A;  2HR3 A;  2OU2 A;  1QBJ A;  2IW5 A;  2VBX A;  2DPU A;  1LNW A;  4ZYD A;  4M74 A;  3ML6 A;  4KN4 X;  2RC4 A;  3TO6 A;  3W6K B;  2IA1 A;  4PGG A;  3F22 A;  3DEU A;  4KMF A;  4ENM A;  1ZRE A;  3M9A A;  4G6Q A;  2MLG A;  4YIF A;  4LMY A;  1QGP A;  4MEY F;  1FYL A;  4O5V A;  4U0Y A;  2RN7 A;  1G3Y A;  5H6Q A;  3WGG A;  2PEX A;  5HOO A;  2KJB A;  3BJO A;  1QQI A;  1TQI A;  1G3W A;  1LVA A;  2Q8K A;  2JZY A;  4LK1 F;  3LAJ A;  4A5N A;  3E6D A;  1FBS A;  1UFM A;  3ZN0 A;  4PDK A;  1HBX G;  2F2E A;  1FC3 A;  5E1Z B;  1KA8 A;  2CFX A;  4IRH A;  5LLQ A;  1U2W A;  4AIJ A;  2QM3 A;  1R58 A;  2DI3 A;  4G6D A;  3R4K A;  3CJN A;  3LST A;  4HX8 A;  4XLN F;  1FX7 A;  2P8T A;  1IN5 A;  2VXZ A;  3J81 K;  4RGS A;  3GXO A;  2Y0M A;  1W7P D;  5CLS A;  4Q5S F;  4YFN F;  2HQN A;  1U6G A;  3FHZ A;  2ISZ A;  4KUM A;  2A5Y B;  1CGP A;  2HZT A;  1MJB A;  5LHI A;  3KP5 A;  5D6F A;  4S05 A;  1KU2 A;  4HQE A;  1STZ A;  3KZZ A;  3HTS B;  4M71 A;  5TRD A;  1OPC A;  2LF8 A;  1D8J A;  2V1X A;  3V8K A;  4JK1 X;  3V7S A;  1I6X A;  3VEP A;  2YSR A;  1P2F A;  5D6E A;  1IXS B;  1J75 A;  2R7D A;  4O3M A;  1KQ8 A;  2EB7 A;  1P4A A;  5TJJ A;  3JSP A;  4AIH A;  3QOP A;  2EA4 A;  3TO9 A;  4WK8 F;  2HDC A;  3GWZ A;  4KNY A;  4P55 A;  2QBY B;  3MQ0 A;  1YW8 A;  2O0Y A;  3F6V A;  2A69 F;  4ETS A;  1BM9 A;  2ZNZ A;  4WCG A;  1OYW A;  2Q2E A;  3LA3 A;  1LDD A;  2K4B A;  5ERI A;  2DK8 A;  3DXJ F;  2XV4 S;  3KFW X;  2L02 A;  3O2P E;  1ZHF A;  1IN8 A;  2VOD A;  1O3T A;  3ELK A;  1SD7 A;  1O7F A;  3RYP A;  5FFX A;  2A61 A;  1ZYR F;  2P5K A;  1HW5 A;  3MWM A;  1I1G A;  4MGR A;  2IJL A;  2FBI A;  4LGW A;  3ZP5 A;  3GLX A;  2OA4 A;  5JR3 A;  2DPD A;  2G7U A;  2ZNY A;  5FO5 A;  2Z33 A;  3P9K A;  2H6C A;  4U88 A;  2PG4 A;  3F8F A;  2IPQ X;  3GFM A;  4D0P A;  1LQ1 A;  1DDN A;  4IPA A;  2W85 A;  3BDD A;  5EEG A; 
#chains in the Genus database with same CATH topology
 4AU7 A;  1KU9 A;  2FOW A;  4DOZ A;  2DMP A;  3H0D A;  1T8I A;  2QA4 I;  2X1E A;  4FHT A;  1YLF A;  4WXH A;  3ZRG A;  3J7Y J;  2FNA A;  3GTO J;  4GXO A;  1R71 A;  2XAG A;  2K27 A;  2V6E A;  1T0F A;  2EK5 A;  1YS7 A;  3RCO A;  3EDP A;  2NNY A;  1X2M A;  4M72 A;  3RQI A;  3VYT B;  2NYX A;  1HW2 A;  1MND A;  2R7X A;  1XC5 A;  1YS6 A;  2KQR A;  4I99 C;  3BC8 A;  3AKZ A;  2LK2 A;  2KDO A;  3Q0W A;  3OYB A;  1X4O A;  1LEA A;  2DT5 A;  2MH2 A;  2Y69 H;  3N4M A;  1LKX A;  2KIF A;  1WVR A;  3JRG A;  3E1S A;  5F6F A;  4L0Z B;  3WTW C;  3FF5 A;  3FIW A;  1LDK B;  3VWB A;  5E3O A;  3OYJ A;  4E7Z A;  3WTV C;  2E2I J;  2BXY A;  2L7M P;  5IOY A;  2H8R A;  5HNH A;  3JTG A;  1JHH A;  3OSG A;  4Y7N J;  4LIU A;  2C6Y A;  1T56 A;  3G1M A;  2H1K A;  1W5T A;  4QPO A;  4XOR A;  4HAM A;  1VQN I;  5EG0 B;  4XN3 A;  4AIK A;  2HQ5 A;  2EH3 A;  3K4M A;  2DOA A;  1Z7U A;  4NC6 A;  3M3Y J;  3ZQQ A;  2VT3 A;  5DTD A;  1BL0 A;  5DD4 A;  5FRN A;  3L7W A;  2CQK A;  2P4W A;  1IO2 A;  4HDU A;  4N4N B;  4L9J A;  3V4G A;  2DW4 A;  2CUF A;  1YYV A;  5E18 F;  1RUN A;  1VZ0 A;  4ANJ A;  2M7B A;  2K85 A;  1SAU A;  1FEX A;  4E7K A;  4ESJ A;  3V7R A;  4P1W A;  1F4K A;  4Y13 A;  1MMD A;  2HS5 A;  2VB6 A;  3ASO H;  3F3X A;  1V4R A;  3ZCO A;  4UUV A;  4AWX B;  1TW3 A;  4LJZ F;  2NVU B;  1X1D A;  2TRT A;  1ZTR A;  3ZMS A;  2R5Z A;  1NK2 P;  4A93 J;  1S5L C;  1SFO J;  2GWR A;  2XPW A;  3C7J A;  4XBF A;  5JFR A;  1POG A;  2E5N A;  2MH9 A;  3EUK L;  2R5Y A;  1DUX C;  3QAH A;  2IA2 A;  3M7G A;  1K7A A;  3SJM A;  3K4B A;  2OPT A;  5J4V A;  2WV0 A;  2HVR A;  4CYC A;  2E2H J;  3HC7 A;  4P9F A;  3K6G A;  4XMY A;  1Q1H A;  1WJD A;  5K7F A;  2FF4 A;  4PJN A;  2G7H A;  1OCC H;  2A6T A;  1MJA A;  5L3C A;  3J7A O;  2DLL A;  1GXP A;  3MN2 A;  2UXN A;  3PUB A;  5FLM J;  2K9L A;  2H8W A;  3LSI A;  1X1A A;  1PYV A;  4LFU A;  4EJU A;  4II2 A;  2E1M B;  3GTJ J;  3LSJ A;  4EQQ A;  1A5J A;  1MNM C;  2XAH A;  2EIL H;  5J3L A;  4AD9 A;  3KEQ A;  2E7X A;  1ZR2 A;  1XX5 A;  3M07 A;  3SFI A;  1FLI A;  2PFB A;  1OKR A;  2L54 A;  4XR6 A;  5BQT A;  3DEE A;  4GCV A;  4J01 A;  3ISP A;  4Y4R A;  5ILV A;  2A6H F;  2Q1Z B;  2DA7 A;  1FOK A;  2HTS A;  3JRD A;  1SC7 A;  4KFC A;  1S7O A;  5L3B A;  4YEL A;  2KZV A;  4XOT A;  2CS3 A;  3PL8 A;  1WJE A;  2CUJ A;  3CCQ I;  3QPS A;  1K6O A;  2BOL A;  1XS9 A;  2ETH A;  2ZXW H;  2DMQ A;  5LRR A;  2K4J A;  3KCC A;  3VYS B;  3CC7 I;  4MQ9 F;  4CCN A;  4CCJ A;  5EJC A;  5DD8 A;  1ONV A;  4Y17 A;  5ICE A;  3WU2 C;  2VKD A;  2VJI A;  1CF7 A;  3HG9 A;  1MZB A;  3IC7 A;  1KYZ A;  3OYF A;  2DFI A;  4H4K C;  2XRN A;  1OCR H;  1KYW A;  3BG9 A;  4RB1 A;  2L9S A;  4EJT A;  2HYG D;  2LMD A;  2Z5U A;  2RKH A;  2FEZ A;  1WJA A;  3HTU A;  3SYT A;  2WAQ A;  2HOS A;  4DW6 A;  3CUQ A;  4G6T B;  4M9Z A;  2BE5 F;  2DA4 A;  4B48 A;  2X51 A;  3HOS A;  3F21 A;  1EA3 A;  3VSK A;  3GCM A;  1U8B A;  2OCC H;  3N05 A;  1XMK A;  5L3D A;  4U7B A;  2DXI A;  4AYB A;  1R4M B;  5F04 A;  4MLO A;  2BYV E;  4CYD A;  2XB5 A;  4LIT A;  4BH9 A;  3P7N A;  3WOD F;  3RKQ A;  5BOX A;  4WXC A;  3S8P A;  4C3H J;  2VIX A;  2L9R A;  3J7Z I;  3OV8 A;  4PCQ A;  2E1N A;  2Q2E B;  3GFJ A;  2X4H A;  4ABZ A;  3ABK H;  5H6R A;  1LFB A;  3BR0 A;  3AG3 H;  2DYS H;  4CCK A;  1B8I A;  3W2V A;  2ZJQ F;  3RZD J;  2P0W A;  3R0J A;  5FKL A;  2EQR A;  4D1Q A;  1FNN A;  3FKI J;  5KCM A;  2DA1 A;  3LOC A;  2WAQ N;  2P5L C;  1Z1D A;  2FOK A;  1K79 A;  1BI0 A;  2X48 A;  3HPH A;  5LEJ A;  3VYR B;  2XAQ A;  1K78 A;  4E7I A;  4FT8 A;  2L9V A;  2L0K A;  4CUG A;  4AYB N;  5KK1 A;  1TP4 A;  5IYC J;  4YFK F;  3I58 A;  2ZME C;  3HBL A;  3VYU B;  1O3S A;  2HFH A;  2VBZ A;  4ZH4 F;  1TC3 C;  3RIR A;  2OF7 A;  3GLL A;  3JAM Z;  3RYR A;  1JUM A;  1V5F A;  5F27 A;  4H0E A;  3A2K A;  3TQN A;  3VPR A;  2Z9O A;  5ICC A;  5FKK A;  3DPL C;  3MAJ A;  1BW6 A;  1MBJ A;  3OOU A;  5J1R A;  1J59 A;  4M3B A;  1LFU P;  3S2D J;  1I5Z A;  4WF2 A;  2WAE A;  3L00 A;  2OC6 A;  3MKY B;  2R7Q A;  3COA C;  2CW8 A;  2LNB A;  1FMW A;  1Z3Y A;  2XC7 A;  1FYK A;  5DYM A;  3VOE A;  1NH3 A;  1RKW A;  5IP7 J;  1AKH B;  4FE7 A;  1IN7 A;  2QYO A;  5CVI A;  3J80 K;  3KP7 A;  1R49 A;  4GYG A;  2HOT A;  2WB1 N;  5GPA A;  2DOD A;  1I39 A;  5FKO A;  2ZFU A;  3K7A J;  4XON A;  3I4N J;  3DU5 A;  3EET A;  3CMA I;  4RBO A;  4UV9 A;  3H5R A;  5HLI A;  1F36 A;  5LBQ A;  2FRH A;  4M3D A;  2ZJP F;  4MQV A;  4B09 A;  2EZH A;  2JRT A;  4IO9 F;  3GUD A;  4IEJ A;  4M6Y A;  3TOB A;  3BR6 A;  5IT3 A;  2DA3 A;  1ZRC A;  5C3E J;  1T08 B;  2Z2S B;  1E3H A;  2HWV A;  1TNS A;  3K4J A;  1SD5 A;  2VJ4 A;  3BZC A;  3OYN A;  2VE9 A;  4YII A;  2NOJ B;  3G1L A;  4CO8 A;  3GF2 A;  1FY7 A;  1EV7 A;  2O8X A;  3RKY A;  2X6O A;  3Q9S A;  2DDA A;  3CDL A;  3HOU J;  1BA5 A;  2LLK A;  2ESN A;  4RAZ A;  3BR1 A;  4ZYG A;  4C2T A;  3JSO A;  3HOZ J;  4BKX A;  4HOB A;  1ETQ A;  4D5F A;  3H0G J;  2KIM A;  4CIC A;  4M9X A;  4UVC A;  2K7L A;  3T5X A;  4XLC A;  5CQE A;  4HF2 A;  2EFO A;  1A6I A;  1BOA A;  2QLZ A;  5E17 F;  2O03 A;  3QPH A;  1GV5 A;  1IZ1 A;  3SDB A;  3HUG A;  4AID A;  1HKQ A;  1MBH A;  4KIF A;  2GQQ A;  1XD7 A;  1GXQ A;  3ZMD A;  1E17 A;  1YOV B;  2XF6 A;  4RB3 C;  4UUT A;  3PUF A;  1MKM A;  1RNL A;  1KZH A;  1BC8 C;  2GA1 A;  3AG2 H;  4I7H A;  1IF1 A;  1MBG A;  4C9Y A;  1D5V A;  1TWA J;  2DFE A;  4A3L J;  2EJR A;  5LGT A;  2K5C A;  2HYF A;  2XPU A;  4A0Z A;  3I0T A;  3NWT A;  5LGN A;  1ZRD A;  3HZJ A;  1YI2 I;  2H27 A;  4LLN A;  2M1B A;  3C2G A;  2F5E A;  3NAR A;  1AOY A;  1TT5 B;  3OYM A;  5KAI C;  1Y0U A;  5BMZ A;  3WG9 A;  1T98 A;  2M8E A;  1PP7 U;  3G2B A;  2QQ8 A;  4L18 B;  1U5T C;  2W84 A;  5IPA A;  1U78 A;  4R8H A;  3R0A A;  2OBP A;  1SFU A;  4OAY A;  2GZW A;  1UMQ A;  4RGR A;  1VQ6 I;  2ZBK A;  2RQP A;  1BI2 A;  3S1M J;  1IV8 A;  1VQ9 I;  1ETK A;  2BW3 A;  3K4K A;  1SAX A;  2R5Z B;  1R5G A;  5HVQ C;  1BI3 A;  2EBI A;  1FP2 A;  3E6M A;  3F8N A;  2R5Y B;  1RC9 A;  3K1M A;  2KPM A;  5DS9 A;  1JHF A;  2E34 A;  4L0Y B;  3RZO J;  2L4M A;  3WGI A;  2BBY A;  1R23 A;  4CYC B;  2CQN A;  3W2A A;  1MMS A;  1XGS A;  2Z16 A;  4E7J A;  3LNQ A;  4IVN A;  3KZY A;  3IAM 2;  4EJO A;  5F1R A;  1GVJ A;  5CVU A;  1JE8 A;  2DOF A;  4P5O A;  4L9N A;  3DPT A;  4MHG A;  4DGW B;  1XPX A;  4BJT A;  1EH7 A;  2DJN A;  2V26 A;  2KRF A;  1Y1V J;  3JTH A;  2PN6 A;  3PIO F;  5D4S A;  1DPU A;  2L4A A;  1OR7 C;  3IRR A;  4LD5 A;  3ZPL A;  1YFH A;  3LSH A;  1W1W E;  4JYK A;  3CCM I;  2M0C A;  1P92 A;  2EV0 A;  2DQR A;  4RGU A;  4LK0 F;  3CTA A;  2E71 A;  3KP3 A;  4E7H A;  4A3I J;  4A3G J;  1YJW I;  5J6X A;  5D5U B;  4IHS A;  3I53 A;  3I56 I;  2I8D A;  4DYQ A;  5EDN A;  2STW A;  1O4X A;  1ZG5 A;  3OIO A;  1IW7 F;  4IXA A;  4DNC A;  4BGD A;  1RI7 A;  5JVG F;  4C30 A;  1H89 C;  2V7F A;  1YW7 A;  2PJR A;  2HXO A;  2KKO A;  5HS7 A;  2XF7 A;  2HDD A;  2HOE A;  1P4W A;  2W57 A;  5IP6 A;  1TWF J;  2R7U A;  3LQQ A;  4W1U A;  3MFK A;  2LOO A;  5IYB J;  1SFE A;  2XUB A;  2WC2 A;  3DP7 A;  5FKM A;  1WPK A;  4EMS A;  3ZQH A;  3UNG C;  1TBX A;  3KPH A;  1CF7 B;  3OY9 A;  2W25 A;  1U3E M;  1FT9 A;  3LA7 A;  3FWE A;  4XLH A;  1XGN A;  2KP6 A;  4G12 A;  1BN5 A;  3MEX A;  3N97 A;  2NS0 A;  5A2Q Z;  4YIR X;  3DKW A;  1R5I D;  1WHU A;  5EZH A;  3W2W A;  5D5V B;  3CUQ B;  3GBG A;  4HF0 A;  4D7M A;  4BY7 J;  3HJE A;  3V7C A;  2V79 A;  1DQU A;  2HQR A;  3OSF A;  3F6O A;  1YX3 A;  2GLO A;  3RTR A;  4Z6Y A;  3ZR8 X;  5IP9 J;  1IAW A;  1MIJ A;  2LY9 A;  1C0W A;  3FK7 A;  2V9K A;  3IWZ A;  3AL0 C;  2AQF A;  4XLA A;  1F9N A;  2D1H A;  2P81 A;  1BR1 A;  3BWG A;  3CDH A;  1ACI A;  1U9O A;  2VBY A;  2OTL I;  1I27 A;  1QVT A;  5FGM A;  1IJW C;  3EUH C;  4HG2 A;  3DKY A;  1OFC X;  1A04 A;  4KIG A;  1B8I B;  2KZG A;  1H9G A;  4HV5 A;  2Z1D A;  4II3 A;  2IGO A;  3GTL J;  1HA8 A;  4J00 A;  2QCO A;  5IT9 K;  3K4L A;  2OZU A;  2W00 A;  3U1K A;  3ZQ7 A;  1Z91 A;  2CUE A;  1VQ4 I;  4XKB A;  3W3C A;  4GRI A;  1TL8 A;  2QSH X;  1K78 B;  2VJ5 A;  3TED A;  1V55 H;  2P6T A;  5J8F A;  5J1Y A;  1J7K A;  4AVZ A;  2XGC A;  3F72 A;  3OYD A;  5E3L A;  2VKE A;  2B63 J;  1NG7 A;  2QQB A;  3HGG A;  4CXF A;  3ZGK A;  2DBB A;  1JTY A;  2VI6 A;  4ZDL A;  4XRM A;  2JA8 J;  2HVQ A;  3OR1 C;  5F0H A;  3NRV A;  3ZMU A;  3H3U A;  2LBF A;  2JA5 J;  2M3A A;  3BRO A;  2O7O A;  2K02 A;  5B1A H;  1JXS A;  2E19 A;  4FIS A;  4F52 A;  5LHG A;  1D0Z A;  2BV6 A;  1GV2 A;  3JRC A;  1B9N A;  2EFQ A;  3A0H C;  3DTK A;  4MO7 A;  1L3L A;  5K7Z A;  4BNC A;  3EUH A;  3FXU A;  3TO7 A;  5HDN A;  2VLA A;  3ECO A;  1LPQ A;  2UZK A;  2ZO4 A;  4OMY A;  4A0Y A;  3IL2 A;  3FZV A;  3K2Z A;  4HNV A;  4ZTJ A;  3IH2 A;  3EUA A;  5B1B H;  1ETV A;  4XL9 A;  5FRO A;  3UR3 C;  4IHV A;  3ASN H;  3S2H J;  1DPR A;  4ENN A;  2ICW G;  3RQ4 A;  1LUJ B;  1ON2 A;  3BG6 A;  4IQ4 A;  1HF0 A;  2O8K A;  1R5H A;  2L2O A;  4F91 B;  4BXU A;  1KU7 A;  4WWC A;  4OWR B;  2LTP A;  2KDZ A;  4UY8 I;  2DT7 B;  4OOI A;  2DTZ A;  3BZ6 A;  5HLG A;  3QPT A;  5J4Y A;  3E6B A;  6PAX A;  1DGW Y;  1JJ6 C;  3Q0V A;  1B4A A;  3QOE A;  3U1D A;  2KHM A;  3PNY A;  5EF6 A;  3F0C A;  4PJL A;  5CKT A;  5LD2 C;  2NXN B;  1YO5 C;  2VL8 A;  4G8X A;  3WU1 B;  4XOP A;  3HIF A;  3HL2 A;  1WQ2 A;  1ZG1 A;  2H94 A;  1GT0 C;  3BG3 A;  1UHW A;  5HDK A;  4KN7 X;  1VF9 A;  2DAO A;  2ELH A;  4I09 A;  4NNJ A;  2QSG X;  3DV8 A;  4OMZ A;  4Y15 A;  2LF7 A;  3Q0U A;  5LRS A;  5GTI C;  3PQJ A;  2XF5 A;  3L2R A;  3SZT A;  4XRS A;  1FYM A;  2BEO A;  2HXI A;  5BNG A;  1PP8 F;  1FPQ A;  1OCZ H;  3L9F A;  4F93 B;  3LAP A;  2IS2 A;  3PFY A;  3PO3 J;  1Z6R A;  1VQK I;  3CC2 I;  1ULY A;  4KIB A;  3HUG B;  2EZK A;  4EVI A;  5GAH J;  1P4X A;  3CP2 A;  4AC0 A;  1F1Z A;  2CO5 A;  2HVS A;  5B5E C;  2FBH A;  2O5R A;  4FET A;  4U0W A;  2JRM A;  5E3N A;  4ESB A;  1JUP A;  3E6C C;  3SEQ A;  4AUX A;  2AHQ A;  4NQW A;  1MGT A;  3KEO A;  4UVB A;  2R7F A;  3EPZ A;  3KP2 A;  2VQG A;  3OOP A;  1XG1 A;  4YRV A;  2EIM H;  2UXX A;  2DO7 A;  2PQ8 A;  1LJ9 A;  3JAM K;  4ZDO A;  1FP1 D;  4ESF A;  5CQG A;  1K61 A;  2DCE A;  2FMY A;  3U21 A;  5HLH A;  4RB0 A;  3CO6 C;  2LD5 A;  3CF2 A;  1F5T A;  3HHH A;  4Y52 J;  2A05 A;  2XIG A;  3TW6 A;  5KNL A;  2XGE A;  1D5Y A;  3A0B C;  2RQQ A;  3M1C A;  3BG7 A;  4RAF A;  2LH9 A;  1QU3 A;  4PK4 A;  2GIZ A;  4LG0 A;  1YHQ I;  2NVT J;  3CD6 I;  4IZZ A;  5FLX K;  3SEZ A;  2IA0 A;  1OMI A;  1VQ7 I;  1WJC A;  2ECC A;  2Y48 A;  4A12 A;  2VON A;  3DCF A;  4ZYH A;  3IHU A;  1WJF A;  4CSW A;  3Q5F A;  2NAZ A;  3NQO A;  4OIR F;  4ZZD A;  1IDZ A;  2IGN A;  2R7O A;  5HLT A;  4Z2Y A;  2F48 A;  3ERM A;  4CCL A;  3QU6 A;  2MC4 A;  2FA5 A;  1W0U A;  3OR2 C;  1A31 A;  3IKV A;  3FXK A;  2OAZ A;  2ADU A;  5FRM A;  3ZN1 A;  3OYG A;  1T33 A;  4UUS B;  2GOM A;  4BXX J;  1S8N A;  2ESH A;  3I3L A;  1JUS A;  2YX4 A;  2IEK A;  4KDP A;  1XB4 A;  3A03 A;  2CV1 A;  2STT A;  2ISY A;  1UHS A;  2XAJ A;  2XAS A;  2R7Z J;  4L5J A;  3I55 I;  3DLA A;  2MG4 A;  2JA6 J;  3IWF A;  4MFD A;  3TGN A;  5DEQ A;  1TW2 A;  5D8L B;  2DA2 A;  2JA2 A;  1ITY A;  2CH0 A;  3PSF A;  3LA2 A;  4UNO A;  5LGU A;  4HX4 A;  2CYY A;  2P5V A;  5DDG A;  3WTS C;  3EQL F;  3DBR B;  4A3F J;  4BDY A;  1ZG3 A;  4HST A;  3WTT C;  4CHU A;  4OIO F;  4C3I J;  2RDP A;  2ZXH A;  4QWQ A;  2EFP A;  2W24 A;  4XNF A;  4HLX A;  3HRS A;  1EKE A;  4HPQ A;  3ECH A;  3HRU A;  3V8J A;  1W5C C;  1SVL A;  3LWF A;  2QKL B;  4MTE A;  2BHZ A;  3DEW A;  4EM0 B;  1U9N A;  1ZAO A;  3VFZ A;  5DCF A;  2L01 A;  3GTG J;  2Y30 A;  2OV7 A;  1WCM J;  4HA8 A;  1S3J A;  3KX2 A;  1ZK8 A;  3HOX J;  4JX6 A;  4BJ5 C;  2RNJ A;  1REP C;  2FQ4 A;  3CDI A;  2PJR B;  3HHG A;  3KLN A;  1MSF C;  2HKX A;  4BBR J;  1X3U A;  2VAS A;  1B72 A;  3JRI A;  2DA6 A;  4HSR A;  1E2X A;  1S6L A;  2ZSI B;  4F55 A;  2CW7 A;  2BY2 A;  2WAD A;  1G4D A;  5GTH C;  2EFN A;  1MD0 A;  1E3P A;  2Z3Y A;  5J8C A;  3FHN A;  1G6N A;  2O61 A;  1JGS A;  2VOO A;  2QUF A;  1D3Y A;  3WU0 A;  2MBF A;  1QRY A;  2LRE A;  3GZ6 A;  5F0C A;  1HST A;  1TNT A;  1OCO H;  4F92 B;  3FIS A;  3SXY A;  2DFH A;  3ABT A;  4EM1 A;  4G7O F;  5FKN A;  3O6B B;  3E0J B;  1Z21 A;  1UST A;  1PUF A;  2WV1 A;  3BG5 A;  2WWY A;  1L0O C;  5GAG J;  1HKT A;  3ABU A;  3BJ6 A;  5B3S H;  3PQK A;  2PJP A;  1X58 A;  5ILU A;  2R4G A;  2R7W A;  3QOD A;  1ZH5 A;  3H3Z A;  4FX0 A;  2FU4 A;  2V4J C;  1YX5 A;  3M8F A;  3E5Q A;  3KLO A;  2JA7 J;  2KL4 A;  3OYK A;  1BIB A;  1O3Q A;  4IHY A;  4B8X A;  1SFX A;  2X1D A;  4KIT B;  4S04 A;  1MSE C;  3ZOB A;  2HKO A;  1SFK A;  1H9T A;  1LEB A;  3DF8 A;  3FDY A;  3T8R A;  2COB A;  1WGX A;  2GOX B;  3G3Z A;  3OMY A;  3OYH A;  4RMN A;  3I64 A;  2EIN H;  2Y31 A;  1FIA A;  1K83 J;  1X3Z B;  4L5I A;  5AIP A;  3S15 J;  2MW8 A;  1BJA A;  2O9L A;  5GAE J;  2VKV A;  3P9I A;  3T0Y A;  1JKR C;  3KE2 A;  1N25 A;  1VFC A;  2D5V A;  3RI4 A;  4I01 A;  2MC3 A;  4G7H F;  3KYD B;  5ICF A;  1OYY A;  4EGY A;  3WHB A;  4GO1 A;  3CJQ B;  2TDX A;  4DJA A;  2R7S A;  2BY3 A;  2K9N A;  4J19 A;  3O3K A;  5KAF C;  2LBF B;  3H9J A;  2O6G E;  1N77 A;  2IAI A;  3I71 A;  1T38 A;  2VBW A;  5H2F C;  1IUY A;  3MKL A;  3FMQ A;  1XCV A;  3V8L A;  2CW0 F;  2M2E A;  3BTC A;  3HPG A;  3HRT A;  1KGS A;  2GM4 A;  1QPM A;  2M45 A;  5CYV A;  3FKJ A;  1G2H A;  4B44 A;  2ZC2 A;  2K86 A;  1I3A A;  1IDY A;  3H5A A;  5HOD A;  3IP4 B;  3V42 A;  1B9M A;  3FMR A;  4XLP F;  5DV5 A;  2EA2 A;  1R1U A;  1IGN A;  3D5R C;  3I54 A;  1XDS A;  1DU0 A;  4KT5 C;  1J9I A;  4M9S A;  5EEH A;  1HLV A;  3L2C A;  3Q3S A;  4U87 A;  4RS8 A;  3OYL A;  2B0L A;  2MSY A;  2PMZ A;  5CJ9 A;  1BR2 A;  5DM7 F;  2FQ3 A;  2KRC A;  1OCP A;  3DWL E;  1Z6T A;  4HYE A;  2WY8 Q;  3QP6 A;  4DBR A;  1X1C A;  3LMM A;  1XTA A;  4EGZ A;  4NHJ A;  2JSC A;  3BTJ A;  3MKZ A;  2JPB A;  4WX9 A;  1ZKG A;  5ILS A;  3JRB A;  4XQF A;  1RR7 A;  4ZDP A;  2QQA A;  3BP8 A;  4DZP A;  4C2U A;  2MGQ A;  2O3F A;  4KMU X;  3VOD A;  3K1P A;  3S1Q J;  1JJ8 C;  4DIQ A;  2H1L A;  5L3G A;  2F4M B;  4XN0 A;  3LSP A;  3O8H A;  4I6Z A;  4Q4Z F;  3E5X A;  3Q9V A;  4ZYA A;  2OJE D;  3M8J A;  5AIQ A;  2LKS A;  2VE8 A;  3CO7 C;  2UWM A;  1RZ4 A;  1I50 J;  3FBI B;  1HC8 A;  5DCM A;  1X19 A;  2COM A;  2ZME A;  1TLH B;  1JTX A;  2JVH A;  2XKP A;  5LEK A;  1ZGJ A;  2E60 A;  2IS6 A;  5K5R A;  2F5F A;  1VQL I;  2DYR H;  3CLQ A;  3WE3 A;  3KET A;  2H09 A;  2R7R A;  4ASN A;  4M3F A;  2PMZ N;  3I9V 2;  1K4S A;  3QWL A;  3ZQI A;  4HEA 2;  2Q0O A;  2K9Q A;  4N4O B;  4A3J J;  5BPD A;  1AU7 A;  4NQW B;  1WKM A;  3ZMT A;  1WZ2 A;  1Z7L A;  1SEU A;  5TIS C;  3LFK A;  2DU9 A;  1GLN A;  3PNT A;  1D1C A;  5K7H A;  2RV8 A;  2YS9 A;  3S1R J;  2F6C A;  1J5Y A;  1FBQ A;  4L5E A;  4XKC A;  3DPU A;  2I5U A;  3GZN B;  3GFL A;  4A3C J;  1G8X A;  1MJ9 A;  4LG3 A;  3GTP J;  3W6J B;  1MW7 A;  3H3V K;  2HDW A;  3HSR A;  1UCR A;  5DM6 F;  1R36 A;  3L2U A;  3I5U A;  4E4H A;  1IRG A;  3MCZ A;  1RR8 C;  4PJM A;  4LG0 B;  3OYC A;  2CGP A;  2MLK A;  3RPQ A;  3C1D A;  1RIO H;  4RDU A;  2VOP A;  3FK6 A;  1B59 A;  3F8C A;  3HSF A;  2XSJ C;  1VQ8 I;  1JI8 A;  4BAC A;  4MEX F;  5HS8 A;  3K70 D;  2DJI A;  1T95 A;  2H6B A;  4XM3 A;  2EIJ H;  4P96 A;  2FML A;  1IC8 A;  2V9P A;  1LB2 A;  2W4S A;  2R93 J;  1PDN C;  3BTL A;  2YU9 J;  3P9C A;  1ODD A;  2JN6 A;  5E8I A;  3PO2 J;  2E36 A;  3CJT B;  2HGC A;  3WG7 H;  2IT0 A;  2XKO A;  2CQQ A;  2R92 J;  2QQ9 A;  3E5U A;  1XSX A;  1HW1 A;  3M1E A;  4C2M J;  1BBY A;  2LFB A;  3BPV A;  4G94 A;  3RJP A;  2ME0 A;  4U7D A;  3IAS 2;  4XRS G;  2CV0 A;  2DOE A;  4PUS A;  4BDZ A;  5ICG A;  1QZZ A;  4V2G A;  4G7Z F;  3NAU A;  1OIS A;  4HDV A;  5M3M J;  2JVG A;  1FOY A;  3RSN A;  2DA5 A;  1FBU A;  4F7Z A;  5LHH A;  4CCO A;  4HRI A;  4CCM A;  3HOT A;  2DFF A;  3QYB A;  1GHC A;  1TQP A;  2PX9 A;  3CMM A;  1XMX A;  4EAT A;  3FXR A;  1QHG A;  1FSH A;  1Y8R B;  3OIP A;  1R22 A;  1MDM A;  3L1P A;  1YIO A;  2L9N A;  5E20 A;  4RM3 A;  2XDV A;  2LYC A;  1JGG A;  2IGM A;  3IRQ A;  2LG4 A;  3JRA A;  1FJL A;  1KU3 A;  1ETX A;  1IXR C;  1PVE A;  3T8T A;  2TCT A;  2CSO A;  3H1C A;  3LSR A;  1B1B A;  3BR3 A;  3HB9 A;  4D5C A;  1B72 B;  5GP9 A;  1N75 A;  2A68 F;  3BR2 A;  1U5T A;  3LL7 A;  2P7V B;  3DFG A;  4RM2 A;  2E1M C;  3DTE A;  3ONQ A;  1H88 C;  2BXZ A;  2YPR A;  3A4C A;  5F64 A;  4I76 A;  3F9K A;  2Z99 A;  1ZAR A;  2CQX A;  4UXN A;  4NBQ A;  1U0J A;  4ENK A;  1IN6 A;  4KA4 A;  4RAG A;  2IP2 A;  3TBI A;  1GVD A;  1XCB A;  4BJ6 C;  4M6V A;  4KT6 A;  3GTM J;  3TW7 A;  4XKV A;  2KRH A;  4ZTF A;  1DGR M;  2YX7 A;  2EIK H;  2OTJ I;  2IVM A;  4G9Y A;  5FJ8 J;  4LOC A;  2KIS A;  3MD2 A;  2AS5 F;  1QVU A;  3CCY A;  2K9S A;  1W36 D;  5FLV A;  1PUF B;  1UHM A;  4XLF A;  2X6X A;  2IBD A;  3S14 J;  3H36 A;  2IXS A;  2NS7 A;  2HQA A;  2JSP A;  1YW9 A;  2VC0 A;  1VI0 A;  4B47 A;  1OR7 A;  2Y0S A;  5HDG A;  2W7N A;  3FXQ A;  1AA7 A;  2XVC A;  4M3G A;  2FBK A;  4PFP A;  4RGX A;  1BI1 A;  3I4P A;  3ZQF A;  1H8A C;  3R61 A;  2YUS A;  4XLE A;  4KIS A;  3FM5 A;  1D1B A;  3B02 A;  4I02 A;  1HOM A;  3QRF F;  2PMU A;  4Y33 A;  2D45 A;  3F23 A;  4HNT A;  4XIC A;  1SD6 A;  3G6E I;  1MMA A;  3C2H A;  1ZGA A;  1VTN C;  3M8E A;  3BJA A;  3LQR A;  2R7T A;  1XN7 A;  3TOA A;  4BQO A;  3OS0 A;  2FUG 2;  4RAY A;  1G59 A;  3F8M A;  1NK3 P;  4N9I A;  4OAZ A;  2D1V A;  2ZSH B;  2YU3 A;  3CQZ J;  3OIQ A;  3OYA A;  5D5X B;  2GXG A;  4CZZ A;  2ELJ A;  1Z9C A;  3OS2 A;  4R79 A;  2OQR A;  1FSE A;  1LDJ A;  1O7L A;  3WE2 A;  1Y56 A;  4M6X A;  3SZG A;  1NHA A;  3QPL A;  1G3T A;  2AXL A;  5EGO A;  4BHP A;  2LY1 A;  4BUP A;  2Y0S N;  3CF5 F;  1BW5 A;  3J80 Z;  2K3F A;  1ZLK A;  1X3W B;  2F4O B;  4E70 A;  4UB6 C;  5DUI A;  3CC4 I;  2GXB A;  1HSJ A;  1D8K A;  2M8G X;  4JP0 A;  2D2W A;  2GA2 A;  1FMV A;  2MA3 A;  3SHF A;  1WWX A;  2WTE A;  2HEO A;  3ZXS A;  1HKS A;  2M7A A;  4I0A A;  2Y75 A;  3OYE A;  5M3F J;  5E1X A;  2RNG A;  1KON A;  4CGZ A;  1XSV A;  4MTD A;  4U0V A;  4L9T A;  4LIV A;  1MNE A;  1NTC A;  5F1J A;  4ZYE A;  3D5L A;  1S29 A;  4EM2 A;  5CVV A;  2EZI A;  3D5S C;  3HGY A;  2M34 A;  4AVP A;  4A6D A;  4OU0 A;  4JOM A;  2FNP A;  1R00 A;  5M5X J;  1X4P A;  2AXT C;  4IRG A;  4BAY A;  2LKP A;  3ROU A;  1ERD A;  4A3B J;  1SMY F;  3HDD A;  2PI0 A;  2K9M A;  1YJN I;  1Z05 A;  3FX3 A;  2A3S A;  4S0H B;  2XGD A;  1GDT A;  4BQQ A;  3GYH X;  4KJZ A;  5K1Y A;  4RA2 A;  4EV0 A;  5L3F A;  3BR5 A;  3FXO A;  1RKT A;  3G71 I;  9ANT A;  1A6Q A;  1YG2 A;  2NRA C;  2EFW A;  5DCM B;  1QNT A;  2VQL A;  1EF4 A;  3JRH A;  3OWT A;  4MFE A;  4A3M J;  2ZME B;  3H92 A;  3AAF A;  4JBA A;  2BGC A;  1LFP A;  3BZK A;  5M5Y J;  1T0F C;  2WY7 Q;  3R60 A;  4PJ0 C;  2PLY A;  2AQE A;  1WH5 A;  2NS8 A;  2DN0 A;  2F5C A;  1IXC A;  2F5D A;  2WAF A;  5D8K B;  4UVA A;  1BIA A;  2ZJR F;  2XRO A;  1R7J A;  2P6S A;  4RLF A;  2KIU A;  4HQM A;  4HZF A;  3OL3 A;  2A5W A;  4FX4 A;  1XMA A;  2M5W A;  3EYY A;  2HPI A;  2MYS A;  3JCU C;  2FXA A;  1MBF A;  3EYI A;  4ZC3 A;  2VT2 A;  1TTY A;  1W7P A;  1USS A;  1UG0 A;  5K5Q A;  3AG4 H;  4GGG A;  3CMY A;  5JVT A;  3HYI A;  1KQ0 A;  3IKT A;  1J0R A;  3I59 A;  2V1U A;  3TKY A;  3OYI A;  3DBL B;  2CRG A;  3RKX A;  4JX5 A;  5CPR B;  1H0M A;  5E3M A;  2NNN A;  2BZT A;  4N0B A;  3GEZ A;  1FWZ A;  5L3E A;  5AON A;  1D0Y A;  4BXF A;  3S2W A;  2HTJ A;  3E97 A;  3KIO A;  1B6A A;  1R1T A;  2OCE A;  4M73 A;  1IN4 A;  4BBS J;  2LVS A;  4NUB A;  5FB2 A;  3FBN B;  1IRF A;  3BY6 A;  4KYW A;  2JMW A;  4UB8 C;  3WGH A;  3DLL F;  3KP4 A;  4CDG A;  3LFU A;  5D4R A;  5M5W J;  3BTI A;  2HZD A;  2QVO A;  4JQF A;  3QU3 A;  3GTK J;  2JT1 A;  4BE2 A;  2FD5 A;  3BPX A;  2DTR A;  3TP0 A;  1MBE A;  3SFZ A;  1T2K A;  3KZI C;  2BW3 B;  2YR2 A;  2ACJ A;  5DUK A;  5CVJ A;  1MH4 A;  3HXL A;  3J81 Z;  1SD4 A;  4LB6 B;  1UB9 A;  2ZKZ A;  1BC7 C;  3B73 A;  3SQN A;  1IRX A;  4ZJZ A;  3OL4 A;  2VQC A;  1A36 A;  5IY5 H;  4IHT A;  1XSD A;  3IH3 A;  2QSF X;  1FTT A;  3W6V A;  3K69 A;  3UKG A;  4A3D J;  2QEN A;  1Z0X A;  1QZY A;  5JHF A;  4Q47 A;  3B6A A;  2CJJ A;  2L7Z A;  4C3J J;  4XID A;  3MZH A;  2DDB A;  3B6C A;  1MDM B;  1JT6 A;  4KIC A;  1W4M A;  3H5N A;  1QZE A;  1TWH J;  4I0B A;  1Z67 A;  1BJZ A;  4NC8 A;  3RKW A;  4HNU A;  3S32 A;  4DYC A;  3CME I;  1PJR A;  4V2F A;  4O6J A;  2G0E A;  2V1D A;  2QF7 A;  4GYI A;  5E8G A;  2V6C A;  1O3R A;  3H9Q A;  3S17 J;  2IGK A;  4B3X A;  2JQ7 A;  2JTV A;  1Z77 A;  3NWS A;  3TDU C;  1U5T B;  1X1B A;  2HYJ A;  5K5O A;  1ZRF A;  4BE0 A;  4NB5 A;  2W1O A;  1MH3 A;  2V1N A;  3T1B A;  4BQA A;  2FSW A;  2BVL A;  2RGV A;  1YJ9 I;  1WRJ A;  1OCT C;  4A2U A;  2NVX J;  4B3A A;  3BOQ A;  1JKQ C;  4CZC A;  4BHB A;  4GFB A;  1JKP C;  1QPI A;  2G9W A;  3GZ5 A;  1KQ9 A;  3MVP A;  2XAU A;  4CA0 A;  5EEA A;  3L2Q A;  2MD0 A;  4A5M A;  4ON0 A;  2PBI A;  3WTY C;  1R9T J;  1WI3 A;  2ZCW A;  2M87 A;  3H35 A;  3RPU A;  1W5S A;  4FE4 A;  3CCJ I;  4HBL A;  2GBY A;  4LLG F;  2IRF G;  3K10 A;  1CQT A;  5FD5 A;  1X1P A;  5J1U A;  3KP6 A;  1HQC A;  2CWE A;  2OZ6 A;  1QO0 D;  1EH6 A;  2A07 F;  5J47 A;  3ZMV A;  4AM3 A;  5IT9 Z;  3GW2 A;  1RPW A;  2JPC A;  1WSU A;  1HCR A;  1MBK A;  4OIQ F;  1N78 A;  3OS1 A;  3PJR A;  2JK3 A;  2ZXI A;  3FM3 A;  2DMN A;  3CCE I;  3BCA A;  3SZP A;  4BHC A;  1VQM I;  1MMG A;  2BVM A;  4WXD A;  1TQM A;  1UZC A;  1YTY A;  3GVA A;  1Y1W J;  3CUQ C;  3ZMZ A;  3CCU I;  1NG6 A;  4EJW A;  4D7N A;  3CCR I;  1T6S A;  2EV5 A;  3D0S A;  1V5E A;  2KLO A;  2LY2 A;  1R1V A;  4L9V A;  5FD6 A;  3FXL A;  1P9Q C;  1I1S A;  1BR4 A;  5BS6 A;  1E0E A;  1ZN2 A;  4DQ2 A;  1UEL B;  2EWN A;  1EH8 A;  2ZFW A;  2X1C A;  3VB2 A;  5KVR A;  4MIM A;  1ZLJ A;  4BS9 A;  4QTR A;  2XAF A;  4PZJ A;  3PM1 A;  3U9G A;  3HRM A;  4HW0 A;  5EYR A;  1HXD A;  2CG4 A;  3C18 A;  1O57 A;  4Q48 A;  1OYI A;  4IX7 A;  3TDZ C;  2HI3 A;  1FOW A;  2OQG A;  2BHY A;  3S3M A;  3GX4 X;  1YRN A;  1PUE E;  1V3F A;  5EGO B;  4EJV A;  4XRF A;  2QEX I;  4IRI A;  3DKX A;  4YEJ A;  2K40 A;  4HV6 A;  3QYE A;  3HEF A;  1I3Q J;  3GME A;  3A01 A;  2CMP A;  1BOB A;  1TT0 A;  2E1C A;  3MKW B;  1I6H J;  4YG2 F;  1S72 I;  4TV7 A;  3FMS A;  3K0L A;  3ZQG A;  3E3V A;  2GXA A;  4BEH A;  1WH7 A;  2GAU A;  5D5W B;  5C44 J;  2LR8 A;  5JI6 A;  2EV6 A;  3ZQC A;  4RB2 C;  3ULQ B;  3LSG A;  1SMT A;  3AL0 B;  2E1O A;  2R3S A;  3DU6 A;  4BYY A;  1S7A A;  1FIP A;  2EZL A;  4XSX F;  1E3O C;  3L2W A;  3WTX C;  2L3D A;  3L2V A;  3U2R A;  4I2O A;  1TWC J;  1P6R A;  3IH4 A;  2XGX A;  2L7K A;  1WJB A;  2JJ7 A;  2L7F P;  4A3E J;  3HSE A;  4LLL A;  3VSL A;  2ELK A;  1WI9 A;  3TMO A;  2KT0 A;  5BPI A;  3WTZ A;  2FE3 A;  5B66 C;  2QBY A;  4PGH A;  4I98 B;  5A2Q K;  2DQL A;  3BLY A;  3BT9 A;  4ITV A;  2WB1 A;  4IL6 C;  1ETW A;  3JW4 A;  5HNF A;  4FQG A;  2CUZ A;  3K9T A;  3M4O J;  2PMH A;  1YQA A;  3H9G A;  5IYD J;  4UV8 A;  2QWW A;  3C3W A;  3REO A;  4PJJ A;  3MZY A;  2VQH A;  5EZG A;  4Y3O A;  4X0G A;  3R6S A;  4IKF A;  4UHT A;  1V5G A;  2MFZ A;  4D9J A;  1HDD C;  4HLY A;  4K2E A;  2LSO A;  3IV5 A;  4E7S A;  4XK4 A;  3PIP F;  3NEU A;  3BCB A;  2DT6 A;  2OD5 A;  2WBM A;  1MMN A;  5HS9 A;  3KYL A;  2MD5 A;  4A0X A;  2L5Q A;  3O8G A;  5H20 A;  1UAA A;  4IF4 A;  5F08 A;  4ENJ A;  1IV6 A;  1VQ5 I;  3DQV C;  3CZ6 A;  2XHK A;  4IJA A;  4DBQ A;  1AWC A;  4PSX A;  4HF1 A;  3ERE D;  2ZJ2 A;  1FZP B;  1TWG J;  2A6E F;  5FLX Z;  2V9V A;  3CLO A;  1R6R A;  1J2X A;  1Y0N A;  3K1N A;  3LSM A;  5ED4 A;  2JUC A;  1W7P B;  2W48 A;  1AHD P;  2DK5 A;  4R1H A;  5JHU A;  2R0Q C;  5TGT A;  4HX7 A;  4X1E A;  4QIW N;  4MNU A;  2ME6 A;  3CUO A;  2VN2 A;  3PFI A;  1J09 A;  2LDU A;  3DBH B;  1XGO A;  5E1W A;  3J7A Y;  3I59 B;  2M30 A;  2J5P A;  4XSZ F;  2VKH A;  1YIJ I;  2QZ8 A;  3ABM H;  4ZZL A;  2VC1 A;  4FAS D;  3G73 A;  4OIN F;  4YFX F;  2FX0 A;  4LB5 A;  3WTU C;  4NC7 A;  1SVM A;  4N9H A;  3HKZ A;  5LFA A;  2KJC A;  3RDI A;  5IOZ A;  2E7W A;  2I10 A;  2GIV A;  1S7E A;  3KEY A;  4B43 A;  1LE8 A;  4BU2 A;  3S93 A;  2P7C B;  1DP7 P;  1ON1 A;  5FFZ A;  5J40 A;  4OIP F;  1RUO A;  2J5O A;  2WA0 A;  1IG7 A;  1APL C;  4P9U A;  4V19 K;  1DP3 A;  1WFX A;  4A6E A;  1RES A;  2BY1 A;  2X0L A;  4QSH A;  3GFI A;  3F8B A;  3QP5 A;  3D1N I;  1XDU A;  3L09 A;  1G3S A;  1U8R A;  1T39 A;  2ZXJ A;  1XGM A;  3P5J A;  5GPC A;  1ZEL A;  1IRZ A;  3G1O A;  1ZGW A;  2HOA A;  3GO5 A;  4QLC U;  2RVC A;  5CVR A;  2HR3 A;  2OU2 A;  2ID6 A;  3A1Y A;  2N8G A;  3CCS I;  1QBJ A;  2IW5 A;  2VBX A;  2DPU A;  1LNW A;  3K2A A;  2IS4 A;  4ZYD A;  4M74 A;  3ML6 A;  3CJR B;  3HKZ N;  4KN4 X;  2Y9Z A;  1TZL A;  2RC4 A;  3TO6 A;  5KHD A;  1P7J A;  3W6K B;  2IA1 A;  3CCV I;  4PGG A;  3F22 A;  3DEU A;  4KMF A;  3GTQ J;  4ENM A;  1ENH A;  2M4K A;  3AG1 H;  3K4C A;  3HOY J;  3FXM A;  2UV1 A;  1ZRE A;  2KFD A;  4GDF A;  3M9A A;  4G6Q A;  2MLG A;  4YIF A;  4LMY A;  2XRL A;  2JWT A;  1QGP A;  4RLQ A;  4MEY F;  1FYL A;  1HDP A;  1QHH D;  4O5V A;  4U0Y A;  3JR9 A;  2RN7 A;  5EG0 A;  2R7V A;  1W0T A;  1G3Y A;  1DU6 A;  5H6Q A;  3WGG A;  2HU9 A;  3AFH A;  2KIQ A;  3LSK A;  2PEX A;  5HOO A;  4FCY A;  2KJB A;  3BJO A;  5E79 C;  1D0X A;  4W97 A;  1QQI A;  5C4J J;  3A02 A;  1TQI A;  4IOC F;  2JUG A;  1G3W A;  1LVA A;  1Y8Q B;  2RRE A;  2Q8K A;  2JZY A;  4LK1 F;  1K6Y A;  4E6K G;  3LAJ A;  2LRD A;  4UUS A;  1ZR4 A;  3TP3 A;  1WJ5 A;  2CV2 A;  1GUU A;  3TL4 X;  4A5N A;  2HPM A;  3E6D A;  2NVQ J;  1FBS A;  3JRF A;  1SVO A;  4PFO A;  1UFM A;  3PSI A;  3ZN0 A;  4XKW A;  4PDK A;  2K3P A;  4QPQ A;  1HBX G;  2F2E A;  3QYF A;  4IOA F;  2QKM B;  4X6A J;  1R4N B;  1FC3 A;  4B4C A;  5E1Z B;  1KA8 A;  2CFX A;  2QGU A;  4IRH A;  2X85 A;  5LLQ A;  4CH7 A;  1U2W A;  4AIJ A;  2QM3 A;  1R58 A;  4PSW A;  2DI3 A;  4G6D A;  2CU7 A;  2X9D A;  3R4K A;  3CJN A;  3BQY A;  5JLX A;  3LST A;  4HX8 A;  2VUM J;  4XLN F;  2B7E A;  1FX7 A;  2VPR A;  2P8T A;  1IN5 A;  2VXZ A;  3J81 K;  2XB0 X;  4RGS A;  2E5Z A;  1FTZ A;  3DTI A;  2LP0 A;  3GXO A;  3VDX A;  3S1N J;  3SDG A;  1JKO C;  2Y0M A;  3MZ8 A;  4IHW A;  1W7P D;  2M0M A;  5CLS A;  3K4N A;  4Q5S F;  4M3E A;  4YFN F;  2HQN A;  1U6G A;  2E35 A;  3QQA A;  4B1R A;  3FHZ A;  3E7L A;  2ISZ A;  4KUM A;  1YIT I;  2A5Y B;  1CGP A;  2HZT A;  1MJB A;  3IUO A;  1LVK A;  4JX4 A;  3K70 C;  2Y9Y A;  5LHI A;  5JLW A;  2LKX A;  1D1A A;  1YRN B;  3X2Q H;  1VQO I;  3KP5 A;  5D6F A;  3S3O A;  5C4X J;  4S05 A;  1KU2 A;  2M4G A;  2IS1 A;  2DMU A;  4HQE A;  2W82 A;  1P7I A;  1STZ A;  2MAB A;  3KZZ A;  3HTS B;  1QA6 A;  2KMU A;  2Y2Z A;  4BY1 J;  2ZB9 A;  3A01 B;  2VJJ A;  3I4M J;  2BY0 A;  4BL0 B;  1X2N A;  4M71 A;  5TRD A;  1OPC A;  4BE1 A;  3WHC A;  3ABL H;  1M1E B;  2CQ7 A;  2M9H A;  3ESW B;  2LF8 A;  3HOV J;  4BEH B;  1VND A;  3JRE A;  1D8J A;  2V1X A;  2VXD A;  1OJL A;  3V8K A;  1YE9 A;  4JK1 X;  4A3K J;  1FOX A;  2UUZ A;  5GAD J;  1UG2 A;  3KYC B;  2XSD C;  3V7S A;  1I6X A;  2VPL A;  3S16 J;  2X6Y A;  2YSR A;  1P2F A;  5D6E A;  1IXS B;  3VEP A;  4E7L A;  2B9S A;  4A69 C;  1J75 A;  2R7D A;  4O3M A;  2OUM A;  2EB7 A;  1P4A A;  3MMY B;  1KQ8 A;  5TJJ A;  3JSP A;  4AIH A;  3QOP A;  2EA4 A;  1SAN A;  2ECB A;  1ETY A;  2FJ1 A;  4DZJ A;  3CCL I;  1EJ9 A;  3TO9 A;  3HM5 A;  4WK8 F;  2HDC A;  1JT0 A;  3GWZ A;  4KNY A;  3CP8 A;  4P55 A;  3MQ0 A;  2QBY B;  3HOW J;  1K4T A;  2DMT A;  1YW8 A;  2O0Y A;  3F6V A;  2A69 F;  4ETS A;  1BM9 A;  2ZNZ A;  4WCG A;  2F5V A;  2ID3 A;  3ZQL A;  2X6W A;  1OYW A;  1OLT A;  1V54 H;  2NOG A;  1OQY A;  1VQP I;  2Q2E A;  3LA3 A;  1LDD A;  2K4B A;  1Q1V A;  5ERI A;  2DK8 A;  3DXJ F;  2XV4 S;  3KFW X;  2L02 A;  1UJ8 A;  3O2P E;  1ZHF A;  3G4S I;  1IN8 A;  2VOD A;  1O3T A;  3ELK A;  1S9H A;  1SD7 A;  2F4I A;  4IHX A;  1O7F A;  4NDL A;  3RYP A;  1ETO A;  3C2B A;  5FFX A;  2A61 A;  1Y6I A;  1IUF A;  5F0F A;  3FXJ A;  1RRJ A;  1ZYR F;  2P5K A;  1HW5 A;  1ZQ3 P;  4DYR A;  1W36 C;  3MWM A;  1I1G A;  2HNH A;  3CES A;  4MGR A;  3RPU D;  2IJL A;  2FBI A;  4LGW A;  3ZP5 A;  3GLX A;  2OA4 A;  2CFO A;  1RET A;  5JR3 A;  2DPD A;  1ORK A;  2G7U A;  2RAE A;  2ZNY A;  2EPF A;  1F43 A;  2AO9 A;  5FO5 A;  4BQN A;  2Z33 A;  3BQZ A;  3P9K A;  2E2J J;  1Z3X A;  2H6C A;  4U88 A;  3S3N A;  4IQJ A;  2PG4 A;  3F8F A;  2IPQ X;  2XPV A;  3GFM A;  4D0P A;  1LQ1 A;  1A35 A;  1AKH A;  4EEF G;  1LE8 B;  1Y39 A;  1DDN A;  3PNV A;  4IPA A;  4FTH A;  2LC2 A;  2W85 A;  3BDD A;  2NVY J;  4F3Q A;  5EEG A; 
#chains in the Genus database with same CATH homology
 1KU9 A;  4FHT A;  1YLF A;  4WXH A;  2FNA A;  4GXO A;  2XAG A;  2K27 A;  1T0F A;  2EK5 A;  1YS7 A;  2NNY A;  3EDP A;  4M72 A;  1HW2 A;  2NYX A;  1YS6 A;  1LEA A;  2DT5 A;  2MH2 A;  3N4M A;  2KIF A;  5F6F A;  4L0Z B;  3WTW C;  3FF5 A;  1LDK B;  3WTV C;  3JTG A;  1JHH A;  2C6Y A;  1W5T A;  4HAM A;  4AIK A;  1Z7U A;  2VT3 A;  5DD4 A;  3L7W A;  2CQK A;  2P4W A;  4HDU A;  4L9J A;  3V4G A;  2DW4 A;  1YYV A;  5E18 F;  1RUN A;  4ESJ A;  3V7R A;  1F4K A;  4Y13 A;  2HS5 A;  3F3X A;  1V4R A;  4UUV A;  4AWX B;  1TW3 A;  4LJZ F;  3ZMS A;  2GWR A;  3C7J A;  4XBF A;  5JFR A;  2MH9 A;  1DUX C;  3QAH A;  2IA2 A;  3M7G A;  1K7A A;  2WV0 A;  4P9F A;  1Q1H A;  2FF4 A;  2G7H A;  1MJA A;  5L3C A;  3J7A O;  2DLL A;  1GXP A;  2UXN A;  4LFU A;  4EJU A;  4EQQ A;  2XAH A;  4AD9 A;  3KEQ A;  2E7X A;  1FLI A;  2PFB A;  1OKR A;  2L54 A;  5BQT A;  4GCV A;  3ISP A;  5ILV A;  2A6H F;  1FOK A;  2HTS A;  4KFC A;  1S7O A;  5L3B A;  1K6O A;  2ETH A;  5LRR A;  2K4J A;  3KCC A;  4MQ9 F;  5DD8 A;  1ONV A;  4Y17 A;  5ICE A;  1CF7 A;  3IC7 A;  1MZB A;  1KYZ A;  2DFI A;  2XRN A;  1KYW A;  4RB1 A;  4EJT A;  2HYG D;  2Z5U A;  2RKH A;  2FEZ A;  3HTU A;  3CUQ A;  4M9Z A;  2BE5 F;  3HOS A;  3F21 A;  5L3D A;  1XMK A;  4U7B A;  2BYV E;  4CYD A;  4BH9 A;  3P7N A;  3WOD F;  5BOX A;  4WXC A;  3OV8 A;  4PCQ A;  2E1N A;  3GFJ A;  2X4H A;  5H6R A;  3R0J A;  1FNN A;  2P5L C;  1Z1D A;  2FOK A;  1K79 A;  1BI0 A;  5LEJ A;  2XAQ A;  1K78 A;  4FT8 A;  5KK1 A;  4YFK F;  3I58 A;  1O3S A;  2HFH A;  2VBZ A;  4ZH4 F;  3RIR A;  3JAM Z;  3RYR A;  4H0E A;  3TQN A;  2Z9O A;  5ICC A;  3DPL C;  3MAJ A;  1J59 A;  1I5Z A;  4WF2 A;  3L00 A;  3COA C;  2LNB A;  1FYK A;  5DYM A;  3VOE A;  1IN7 A;  2QYO A;  5CVI A;  3J80 K;  3KP7 A;  4GYG A;  3EET A;  4UV9 A;  5HLI A;  5LBQ A;  2FRH A;  4MQV A;  4B09 A;  2JRT A;  3GUD A;  4M6Y A;  3TOB A;  5IT3 A;  1ZRC A;  2HWV A;  1TNS A;  1SD5 A;  2VE9 A;  4YII A;  4CO8 A;  3GF2 A;  1FY7 A;  1EV7 A;  2O8X A;  3RKY A;  3Q9S A;  2ESN A;  4RAZ A;  4ZYG A;  3JSO A;  4HOB A;  2KIM A;  4CIC A;  4M9X A;  4UVC A;  2K7L A;  3T5X A;  4HF2 A;  2EFO A;  1BOA A;  2QLZ A;  5E17 F;  2O03 A;  3QPH A;  1IZ1 A;  3HUG A;  1HKQ A;  4KIF A;  2GQQ A;  1XD7 A;  1GXQ A;  3ZMD A;  1E17 A;  4RB3 C;  1MKM A;  1RNL A;  1BC8 C;  2GA1 A;  4I7H A;  1IF1 A;  1D5V A;  2EJR A;  5LGT A;  2HYF A;  4A0Z A;  3I0T A;  5LGN A;  1ZRD A;  2H27 A;  4LLN A;  2M1B A;  2F5E A;  1AOY A;  1Y0U A;  5BMZ A;  3WG9 A;  1T98 A;  2M8E A;  1PP7 U;  4L18 B;  1U5T C;  2W84 A;  1U78 A;  4R8H A;  3R0A A;  2OBP A;  1SFU A;  2GZW A;  4RGR A;  2ZBK A;  2RQP A;  1BI2 A;  1SAX A;  1R5G A;  5HVQ C;  1BI3 A;  1FP2 A;  3E6M A;  3F8N A;  3K1M A;  1JHF A;  4L0Y B;  2L4M A;  3WGI A;  2BBY A;  1R23 A;  1XGS A;  4IVN A;  3KZY A;  4EJO A;  5F1R A;  1GVJ A;  5CVU A;  1JE8 A;  4P5O A;  4L9N A;  3DPT A;  4MHG A;  1EH7 A;  2KRF A;  3JTH A;  2PN6 A;  5D4S A;  1DPU A;  2L4A A;  3IRR A;  4LD5 A;  3ZPL A;  1YFH A;  1P92 A;  2EV0 A;  2DQR A;  4RGU A;  4LK0 F;  3CTA A;  3KP3 A;  5J6X A;  5D5U B;  4IHS A;  3I53 A;  2STW A;  1ZG5 A;  1IW7 F;  4IXA A;  4DNC A;  1RI7 A;  1YW7 A;  2KKO A;  5HS7 A;  2HOE A;  1P4W A;  2W57 A;  3LQQ A;  3MFK A;  1SFE A;  2XUB A;  2WC2 A;  3DP7 A;  4EMS A;  1TBX A;  1CF7 B;  2W25 A;  1U3E M;  1FT9 A;  3LA7 A;  3FWE A;  1XGN A;  1BN5 A;  3MEX A;  3N97 A;  2NS0 A;  5A2Q Z;  3DKW A;  5D5V B;  3CUQ B;  4HF0 A;  3V7C A;  2V79 A;  2HQR A;  3F6O A;  3RTR A;  1IAW A;  1C0W A;  3IWZ A;  1F9N A;  2D1H A;  3BWG A;  3CDH A;  2VBY A;  1I27 A;  5FGM A;  4KIG A;  1A04 A;  1H9G A;  4HV5 A;  5IT9 K;  2OZU A;  3ZQ7 A;  1Z91 A;  1K78 B;  2P6T A;  5J8F A;  1J7K A;  3F72 A;  2QQB A;  4CXF A;  2DBB A;  3NRV A;  3ZMU A;  3H3U A;  3BRO A;  2K02 A;  1JXS A;  5LHG A;  2BV6 A;  1B9N A;  2EFQ A;  1L3L A;  4BNC A;  3EUH A;  3FXU A;  3TO7 A;  5HDN A;  3ECO A;  2UZK A;  2ZO4 A;  4OMY A;  4A0Y A;  3IL2 A;  3FZV A;  3K2Z A;  1DPR A;  4ENN A;  1ON2 A;  1R5H A;  1KU7 A;  4BXU A;  4WWC A;  4OOI A;  3BZ6 A;  5HLG A;  3QPT A;  3E6B A;  6PAX A;  1B4A A;  3U1D A;  1YO5 C;  4G8X A;  3WU1 B;  3HIF A;  1WQ2 A;  1ZG1 A;  2H94 A;  1UHW A;  5HDK A;  4KN7 X;  2DAO A;  2ELH A;  4I09 A;  3DV8 A;  4OMZ A;  4Y15 A;  2LF7 A;  5LRS A;  3PQJ A;  3SZT A;  1FYM A;  2BEO A;  1PP8 F;  1FPQ A;  3L9F A;  3LAP A;  1Z6R A;  1ULY A;  4KIB A;  4EVI A;  1P4X A;  1F1Z A;  2CO5 A;  2FBH A;  4U0W A;  4ESB A;  3E6C C;  4NQW A;  1MGT A;  3KEO A;  4UVB A;  2R7F A;  3KP2 A;  3OOP A;  2UXX A;  2DO7 A;  2PQ8 A;  1LJ9 A;  3JAM K;  1FP1 D;  4ESF A;  2FMY A;  5HLH A;  4RB0 A;  3CO6 C;  1F5T A;  3HHH A;  2XIG A;  4LG0 A;  5FLX K;  2IA0 A;  1OMI A;  2Y48 A;  4A12 A;  2VON A;  4ZYH A;  3IHU A;  3Q5F A;  2NAZ A;  3NQO A;  4OIR F;  4ZZD A;  4Z2Y A;  3QU6 A;  2FA5 A;  3IKV A;  2OAZ A;  2ADU A;  3ZN1 A;  1S8N A;  2ESH A;  2YX4 A;  4KDP A;  1XB4 A;  2STT A;  2ISY A;  2XAJ A;  2XAS A;  4L5J A;  3IWF A;  3TGN A;  5DEQ A;  1TW2 A;  5D8L B;  3LA2 A;  4UNO A;  5LGU A;  4HX4 A;  2CYY A;  2P5V A;  5DDG A;  3WTS C;  3EQL F;  1ZG3 A;  3WTT C;  4CHU A;  4OIO F;  2RDP A;  4QWQ A;  2EFP A;  2W24 A;  4HLX A;  3HRS A;  3ECH A;  3HRU A;  3V8J A;  3LWF A;  4MTE A;  4EM0 B;  1ZAO A;  3VFZ A;  5DCF A;  2L01 A;  4HA8 A;  1S3J A;  2RNJ A;  1REP C;  3HHG A;  3KLN A;  2HKX A;  1X3U A;  1E2X A;  1S6L A;  1G4D A;  2EFN A;  1MD0 A;  2Z3Y A;  5J8C A;  1G6N A;  2O61 A;  1JGS A;  2VOO A;  2QUF A;  1D3Y A;  3WU0 A;  2MBF A;  3GZ6 A;  1HST A;  1TNT A;  3SXY A;  3ABT A;  4EM1 A;  4G7O F;  3O6B B;  1UST A;  2WWY A;  1L0O C;  1HKT A;  3ABU A;  3BJ6 A;  3PQK A;  2PJP A;  5ILU A;  1ZH5 A;  3H3Z A;  4FX0 A;  2FU4 A;  3M8F A;  3E5Q A;  3KLO A;  1BIB A;  1O3Q A;  4B8X A;  1SFX A;  4S04 A;  2HKO A;  1H9T A;  1LEB A;  3DF8 A;  3T8R A;  3G3Z A;  3I64 A;  4L5I A;  5AIP A;  1BJA A;  3P9I A;  3T0Y A;  3KE2 A;  3RI4 A;  4I01 A;  2MC3 A;  4G7H F;  5ICF A;  1OYY A;  4EGY A;  4GO1 A;  2TDX A;  3O3K A;  2O6G E;  3I71 A;  1T38 A;  2VBW A;  1IUY A;  3FMQ A;  1XCV A;  3V8L A;  2CW0 F;  3HRT A;  1KGS A;  1QPM A;  2M45 A;  5CYV A;  2K86 A;  1B9M A;  4XLP F;  3FMR A;  5DV5 A;  2EA2 A;  1R1U A;  3I54 A;  1XDS A;  4KT5 C;  1J9I A;  4M9S A;  5EEH A;  3L2C A;  4RS8 A;  2B0L A;  5CJ9 A;  2FQ3 A;  4HYE A;  1Z6T A;  3QP6 A;  4EGZ A;  4NHJ A;  2JSC A;  2JPB A;  4WX9 A;  5ILS A;  2QQA A;  3BP8 A;  2O3F A;  4KMU X;  3VOD A;  3K1P A;  5L3G A;  4Q4Z F;  3E5X A;  3Q9V A;  5AIQ A;  2VE8 A;  3CO7 C;  2UWM A;  1RZ4 A;  5DCM A;  2COM A;  2ZME A;  1TLH B;  2XKP A;  5LEK A;  1ZGJ A;  5K5R A;  2F5F A;  3WE3 A;  3KET A;  2H09 A;  4ASN A;  2Q0O A;  5BPD A;  1WKM A;  3ZMT A;  3LFK A;  2DU9 A;  2RV8 A;  1J5Y A;  1FBQ A;  3GFL A;  1MJ9 A;  3W6J B;  3HSR A;  1UCR A;  1R36 A;  3I5U A;  1IRG A;  3MCZ A;  4LG0 B;  2CGP A;  2MLK A;  3RPQ A;  3C1D A;  1RIO H;  2VOP A;  1B59 A;  3F8C A;  3HSF A;  4MEX F;  5HS8 A;  2H6B A;  4P96 A;  2FML A;  1LB2 A;  1PDN C;  3P9C A;  1ODD A;  5E8I A;  2HGC A;  2IT0 A;  2XKO A;  2QQ9 A;  3E5U A;  1XSX A;  1HW1 A;  3M1E A;  1BBY A;  3BPV A;  4G94 A;  3RJP A;  4U7D A;  5ICG A;  1QZZ A;  4G7Z F;  4HDV A;  1FBU A;  4F7Z A;  5LHH A;  3HOT A;  1GHC A;  1TQP A;  3FXR A;  1FSH A;  1R22 A;  1MDM A;  1YIO A;  5E20 A;  3IRQ A;  1KU3 A;  1IXR C;  3T8T A;  2CSO A;  1B1B A;  2A68 F;  1U5T A;  2P7V B;  3DFG A;  2YPR A;  5F64 A;  2Z99 A;  1ZAR A;  4UXN A;  4ENK A;  1IN6 A;  4KA4 A;  2IP2 A;  1XCB A;  2YX7 A;  2IVM A;  4G9Y A;  2AS5 F;  1UHM A;  1YW9 A;  2VC0 A;  1OR7 A;  5HDG A;  3FXQ A;  2XVC A;  2FBK A;  4RGX A;  1BI1 A;  3I4P A;  3R61 A;  3FM5 A;  3B02 A;  4I02 A;  3QRF F;  2PMU A;  2D45 A;  3F23 A;  1SD6 A;  1VTN C;  1ZGA A;  3M8E A;  3BJA A;  3LQR A;  1XN7 A;  3TOA A;  4RAY A;  3F8M A;  4N9I A;  2D1V A;  2YU3 A;  5D5X B;  2GXG A;  4CZZ A;  1Z9C A;  4R79 A;  2OQR A;  1FSE A;  1LDJ A;  1O7L A;  3WE2 A;  4M6X A;  1NHA A;  1G3T A;  2AXL A;  4BHP A;  3J80 Z;  1ZLK A;  4E70 A;  5DUI A;  2GXB A;  1HSJ A;  1D8K A;  2D2W A;  2GA2 A;  3SHF A;  2MA3 A;  1WWX A;  2WTE A;  2HEO A;  1HKS A;  4I0A A;  2Y75 A;  5E1X A;  4CGZ A;  1XSV A;  4MTD A;  4U0V A;  4L9T A;  4ZYE A;  3D5L A;  1S29 A;  4EM2 A;  5CVV A;  4AVP A;  4A6D A;  4OU0 A;  2FNP A;  1R00 A;  4IRG A;  4BAY A;  2LKP A;  3ROU A;  1SMY F;  2PI0 A;  1Z05 A;  3FX3 A;  2A3S A;  3GYH X;  5K1Y A;  4EV0 A;  5L3F A;  1YG2 A;  2NRA C;  2EFW A;  5DCM B;  1QNT A;  2ZME B;  3H92 A;  3AAF A;  4JBA A;  2BGC A;  3R60 A;  2PLY A;  2F5C A;  1IXC A;  2F5D A;  5D8K B;  4UVA A;  1BIA A;  2XRO A;  1R7J A;  2P6S A;  2KIU A;  4HQM A;  4HZF A;  4FX4 A;  1XMA A;  2M5W A;  3EYY A;  2FXA A;  3EYI A;  2VT2 A;  1TTY A;  1W7P A;  1USS A;  5K5Q A;  4GGG A;  5JVT A;  3HYI A;  1KQ0 A;  3IKT A;  1J0R A;  3I59 A;  2V1U A;  3TKY A;  3RKX A;  1H0M A;  2NNN A;  4N0B A;  3GEZ A;  1FWZ A;  5L3E A;  5AON A;  3S2W A;  2HTJ A;  3E97 A;  1B6A A;  1R1T A;  4M73 A;  1IN4 A;  5FB2 A;  1IRF A;  3BY6 A;  4KYW A;  3WGH A;  3KP4 A;  4CDG A;  5D4R A;  2QVO A;  4JQF A;  3QU3 A;  2JT1 A;  3BPX A;  2DTR A;  3SFZ A;  1T2K A;  2YR2 A;  2ACJ A;  5DUK A;  5CVJ A;  3J81 Z;  1SD4 A;  4LB6 B;  1UB9 A;  2ZKZ A;  1BC7 C;  3B73 A;  3SQN A;  4IHT A;  1XSD A;  3K69 A;  2QEN A;  1QZY A;  4Q47 A;  3MZH A;  1MDM B;  4KIC A;  1W4M A;  4I0B A;  3RKW A;  4O6J A;  2V1D A;  4GYI A;  5E8G A;  2V6C A;  1O3R A;  2JTV A;  5K5O A;  3TDU C;  1U5T B;  1ZRF A;  4NB5 A;  3T1B A;  4BQA A;  2FSW A;  2RGV A;  1WRJ A;  4A2U A;  3BOQ A;  4BHB A;  2G9W A;  3GZ5 A;  1KQ9 A;  4A5M A;  4ON0 A;  2PBI A;  3WTY C;  2ZCW A;  2M87 A;  3RPU A;  1W5S A;  4HBL A;  4LLG F;  2IRF G;  5FD5 A;  3KP6 A;  1HQC A;  2CWE A;  2OZ6 A;  1QO0 D;  1EH6 A;  2A07 F;  3ZMV A;  5IT9 Z;  3GW2 A;  4OIQ F;  2JPC A;  1WSU A;  3FM3 A;  3SZP A;  4BHC A;  4WXD A;  1TQM A;  1YTY A;  3GVA A;  3CUQ C;  3ZMZ A;  4EJW A;  1T6S A;  2EV5 A;  3D0S A;  4L9V A;  1R1V A;  5FD6 A;  1I1S A;  5BS6 A;  1ZN2 A;  4DQ2 A;  2EWN A;  1EH8 A;  2ZFW A;  3VB2 A;  5KVR A;  1ZLJ A;  2XAF A;  4PZJ A;  3U9G A;  3HRM A;  4HW0 A;  1HXD A;  2CG4 A;  3C18 A;  1O57 A;  4Q48 A;  1OYI A;  3TDZ C;  2OQG A;  3GX4 X;  1PUE E;  1V3F A;  4EJV A;  4XRF A;  4IRI A;  4HV6 A;  2E1C A;  4YG2 F;  4TV7 A;  3FMS A;  3K0L A;  3E3V A;  2GAU A;  5D5W B;  5JI6 A;  2EV6 A;  4RB2 C;  3ULQ B;  1SMT A;  4BYY A;  2R3S A;  1S7A A;  4XSX F;  3WTX C;  2L3D A;  3U2R A;  4I2O A;  1P6R A;  2XGX A;  3HSE A;  4LLL A;  1WI9 A;  5BPI A;  3WTZ A;  2FE3 A;  2QBY A;  4PGH A;  4I98 B;  5A2Q K;  2DQL A;  3JW4 A;  3K9T A;  2PMH A;  1YQA A;  4UV8 A;  2QWW A;  3C3W A;  3REO A;  3MZY A;  3R6S A;  4UHT A;  4HLY A;  4K2E A;  2LSO A;  3NEU A;  2OD5 A;  5HS9 A;  2MD5 A;  4A0X A;  5H20 A;  4IF4 A;  4ENJ A;  3DQV C;  2XHK A;  4IJA A;  1AWC A;  4HF1 A;  3ERE D;  2ZJ2 A;  1FZP B;  2A6E F;  5FLX Z;  2V9V A;  3CLO A;  1J2X A;  3K1N A;  5ED4 A;  1W7P B;  2DK5 A;  4R1H A;  5JHU A;  4HX7 A;  4MNU A;  3CUO A;  2VN2 A;  3PFI A;  2LDU A;  1XGO A;  5E1W A;  3I59 B;  2M30 A;  2J5P A;  4XSZ F;  2QZ8 A;  4ZZL A;  2VC1 A;  3G73 A;  4OIN F;  4YFX F;  4LB5 A;  3WTU C;  4N9H A;  2KJC A;  3RDI A;  2E7W A;  2GIV A;  2P7C B;  1DP7 P;  1ON1 A;  5FFZ A;  4OIP F;  1RUO A;  2J5O A;  4P9U A;  4A6E A;  2X0L A;  3GFI A;  3F8B A;  3QP5 A;  1XDU A;  3L09 A;  1G3S A;  1U8R A;  1T39 A;  2ZXJ A;  1XGM A;  3GO5 A;  4QLC U;  2RVC A;  5CVR A;  2HR3 A;  2OU2 A;  1QBJ A;  2IW5 A;  2VBX A;  2DPU A;  1LNW A;  4ZYD A;  4M74 A;  3ML6 A;  4KN4 X;  2RC4 A;  3TO6 A;  3W6K B;  2IA1 A;  4PGG A;  3F22 A;  3DEU A;  4KMF A;  4ENM A;  1ZRE A;  3M9A A;  4G6Q A;  2MLG A;  4YIF A;  4LMY A;  1QGP A;  4MEY F;  1FYL A;  4O5V A;  4U0Y A;  2RN7 A;  1G3Y A;  5H6Q A;  3WGG A;  2PEX A;  5HOO A;  2KJB A;  3BJO A;  1QQI A;  1TQI A;  1G3W A;  1LVA A;  2Q8K A;  2JZY A;  4LK1 F;  3LAJ A;  4A5N A;  3E6D A;  1FBS A;  1UFM A;  3ZN0 A;  4PDK A;  1HBX G;  2F2E A;  1FC3 A;  5E1Z B;  1KA8 A;  2CFX A;  4IRH A;  5LLQ A;  1U2W A;  4AIJ A;  2QM3 A;  1R58 A;  2DI3 A;  4G6D A;  3R4K A;  3CJN A;  3LST A;  4HX8 A;  4XLN F;  1FX7 A;  2P8T A;  1IN5 A;  2VXZ A;  3J81 K;  4RGS A;  3GXO A;  2Y0M A;  1W7P D;  5CLS A;  4Q5S F;  4YFN F;  2HQN A;  1U6G A;  3FHZ A;  2ISZ A;  4KUM A;  2A5Y B;  1CGP A;  2HZT A;  1MJB A;  5LHI A;  3KP5 A;  5D6F A;  4S05 A;  1KU2 A;  4HQE A;  1STZ A;  3KZZ A;  3HTS B;  4M71 A;  5TRD A;  1OPC A;  2LF8 A;  1D8J A;  2V1X A;  3V8K A;  4JK1 X;  3V7S A;  1I6X A;  3VEP A;  2YSR A;  1P2F A;  5D6E A;  1IXS B;  1J75 A;  2R7D A;  4O3M A;  1KQ8 A;  2EB7 A;  1P4A A;  5TJJ A;  3JSP A;  4AIH A;  3QOP A;  2EA4 A;  3TO9 A;  4WK8 F;  2HDC A;  3GWZ A;  4KNY A;  4P55 A;  2QBY B;  3MQ0 A;  1YW8 A;  2O0Y A;  3F6V A;  2A69 F;  4ETS A;  1BM9 A;  2ZNZ A;  4WCG A;  1OYW A;  2Q2E A;  3LA3 A;  1LDD A;  2K4B A;  5ERI A;  2DK8 A;  3DXJ F;  2XV4 S;  3KFW X;  2L02 A;  3O2P E;  1ZHF A;  1IN8 A;  2VOD A;  1O3T A;  3ELK A;  1SD7 A;  1O7F A;  3RYP A;  5FFX A;  2A61 A;  1ZYR F;  2P5K A;  1HW5 A;  3MWM A;  1I1G A;  4MGR A;  2IJL A;  2FBI A;  4LGW A;  3ZP5 A;  3GLX A;  2OA4 A;  5JR3 A;  2DPD A;  2G7U A;  2ZNY A;  5FO5 A;  2Z33 A;  3P9K A;  2H6C A;  4U88 A;  2PG4 A;  3F8F A;  2IPQ X;  3GFM A;  4D0P A;  1LQ1 A;  1DDN A;  4IPA A;  2W85 A;  3BDD A;  5EEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...