2KJCA

Solution structure of czra in the zn(ii) state
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
NTDTLERVTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMIYSLDDIHVATMLKQAIHHANHPKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords CzrA protein
publication title Solution structure of a paradigm ArsR family zinc sensor in the DNA-bound state
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 19
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2kjcA00
2ZXJA 2R7FA 2FBHA 3CO6C 3BJOA 3HUGA 4DQ2A 4AWXB 4KFCA 2O8XA 4ZZDA 3RJPA 1FP2A 2F2EA 1U2WA 1T98A 2L4MA 4IXAA 1XN7A 4JQFA 4HF0A 2FF4A 2P5LC 3KP4A 1FBSA 4P96A 3BPXA 1S6LA 5FFXA 3ZQ7A 1ZH5A 2ZBKA 5FD6A 3F8CA 1YFHA 4BYYA 4A6DA 2EFWA 2K02A 2ESHA 2Z9OA 4LGWA 1YG2A 3ZMDA 3I5UA 1LNWA 3C3WA 3U2RA 1XDSA 1Z6RA 2GXBA 3ERED 4MQ9F 4NB5A 3F6OA 2OZUA 2DU9A 1UB9A 3V8JA 3GF2A 2A07F 3IC7A 2VE9A 4KIFA 4FX0A 3FMQA 2H6BA 5L3FA 2OZ6A 4EJUA 1QGPA 4XSZF 5FGMA 3BDDA 3DXJF 1G3SA 4RGSA 4E70A 1FLIA 4AIHA 1XSDA 1YIOA 4MNUA 5DUKA 2GWRA 2OD5A 3ULQB 3J7AO 4LJZF 4A5NA 2XKPA 3SFZA 3HOTA 4R8HA 2HOEA 3RPUA 4XSXF 2ISZA 4M71A 4CICA 5E1WA 5D4SA 1ON1A 4HAMA 2VBXA 2VBYA 4CDGA 1R5GA 2Y0MA 1P6RA 2W24A 3KZZA 4CYDA 2P6SA 5L3DA 5BQTA 5TJJA 1LDDA 3JAMZ 3LAPA 2K86A 3I54A 2ISYA 1HKSA 1TNSA 4S05A 3QOPA 4LD5A 4U0YA 4Q47A 3CLOA 2NYXA 5BPDA 4L0YB 3NRVA 4ZYDA 2F5DA 1P4XA 5IT9K 4A0YA 4IHTA 3MCZA 1FOKA 2RKHA 5IT3A 2CW0F 5DUIA 3F8NA 4I01A 2O6GE 1BIBA 2G7UA 5LLQA 1BIAA 3HRMA 1R1VA 3BJAA 1XGMA 2DT5A 3I0TA 3ZN0A 4JBAA 2P7VB 3V7CA 2STTA 1Z7UA 4M72A 3QP5A 2UXXA 4NQWA 3EYYA 4B8XA 2ADUA 3DPTA 5H20A 2FBIA 1ZLKA 1KA8A 3VOEA 2RGVA 3DP7A 4IF4A 2KIFA 1IAWA 4HV6A 1B1BA 3RIRA 2M8EA 2GQQA 3WTSC 1ON2A 4OMYA 1SD5A 1WSUA 5FLXZ 2Z33A 3MQ0A 3PQJA 3VFZA 1IN4A 5D4RA 1MDMB 4UHTA 1R5HA 4RGUA 4YIFA 3FM5A 2GA2A 1WRJA 2IA0A 5D5UB 3KCCA 3R6SA 3R0AA 5K1YA 4UUVA 2QZ8A 3M8EA 3E6DA 3ECHA 1ODDA 4L9VA 1XDUA 4I0AA 1YQAA 1IN5A 1TW3A 2PN6A 2EV5A 4LK0F 2ZNYA 5DV5A 4ENNA 3T8TA 2EA4A 4KUMA 4G7ZF 4WK8F 2RC4A 3G3ZA 4EJVA 5LHGA 2QQ9A 4Y13A 2KJBA 3ELKA 2HR3A 4EM0B 4HX7A 4EGZA 5HS7A 3OOPA 2XRNA 3F23A 4ESFA 3VB2A 2Q2EA 3KP7A 3F22A 4ZYGA 1B6AA 1SFEA 2GAUA 5CLSA 2QYOA 4WWCA 2ZNZA 2WC2A 1DUXC 1D5VA 1BC7C 2ZMEA 3TO7A 2NRAC 4NHJA 2ELHA 5J8FA 1J2XA 4OIRF 3GZ6A 2PG4A 5ICEA 2DW4A 3HSEA 3HTUA 4U7DA 1KU2A 3D0SA 3HOSA 5LEJA 2KKOA 2ACJA 4AIKA 5CVVA 3O3KA 4IVNA 1GXPA 2QWWA 3ZMSA 4P55A 2L4AA 2MLGA 1OMIA 1UHMA 2OU2A 2ZMEB 5EEHA 4QLCU 5TRDA 3KEQA 4FHTA 1ZG5A 3HSFA 1T6SA 2PMUA 1S3JA 4L5IA 4ESBA 2Q0OA 2J5PA 2AS5F 1B9MA 4RB2C 1IW7F 5AIPA 2OAZA 2Q8KA 5LEKA 2RDPA 4ENKA 2DFIA 2HFHA 2XAGA 1TLHB 4HZFA 4FT8A 4A6EA 1L0OC 2MA3A 2XVCA 3HHGA 1W4MA 1W5SA 4A12A 1QZZA 2IVMA 2PBIA 1WQ2A 4GO1A 2CWEA 3WG9A 4UXNA 3KP5A 2IA1A 3REOA 2EFQA 4XLPF 2PFBA 3I64A 5L3GA 2G9WA 4BHCA 1LEAA 4OU0A 2Z3YA 3GYHX 2K4JA 2D45A 4HDUA 2A6HF 2XAQA 4RB1A 1PP7U 5CVJA 3QAHA 4EQQA 2DPUA 1MKMA 3L00A 4PDKA 1FZPB 3GVAA 2P6TA 4Q4ZF 3IKVA 3B02A 3DKWA 3F3XA 2FXAA 4M6XA 1DP7P 2XIGA 2YX4A 3I53A 4YIIA 3Q5FA 3KEOA 2R7DA 3P9CA 5D5WB 1HSTA 1U6GA 4LK1F 5E1XA 3J81K 2K4BA 1HKTA 3K1NA 1ZG3A 3F6VA 1C0WA 2FBKA 4ETSA 4IRGA 4PZJA 3GO5A 1OYWA 1R7JA 2HKOA 4ZYEA 3ZPLA 3IRQA 1BI0A 2LF8A 5EEGA 3V7SA 2F5FA 3RKWA 2YR2A 1EH6A 1K79A 4CZZA 4WCGA 5ICGA 2OQGA 3ABTA 4K2EA 4CGZA 4N9HA 2M30A 3W6KB 3QP6A 5LBQA 1EH8A 2V9VA 2E7WA 4A2UA 2XGXA 4JK1X 1UHWA 5LRRA 2H6CA 5A2QZ 3TGNA 1T2KA 4BAYA 4EJWA 1UCRA 4IPAA 1F5TA 2VOPA 2EWNA 2XV4S 3SXYA 2A68F 1HQCA 3RYPA 2VN2A 3FX3A 1L3LA 1CGPA 1BN5A 4UNOA 4U0VA 4ENMA 1CF7A 3N97A 5DEQA 1SFUA 4LB6B 4BHBA 2WWYA 1QPMA 2VONA 4PGGA 1BI3A 3CDHA 1I27A 2COMA 3SZPA 1O3SA 3GFIA 2W25A 3HRTA 3L09A 2JSCA 2DBBA 4FX4A 4KIBA 3KP2A 1CF7B 1XD7A 3V7RA 1K78A 2FOKA 5HDKA 3HTSB 1XGOA 3E6CC 5E8IA 4M6YA 1D3YA 2IJLA 4G6DA 4IRIA 4U0WA 1ZREA 1FPQA 4HLXA 3I59A 3LA7A 2L02A 4HQMA 4D0PA 1LDJA 4EMSA 4HW0A 3CUQA 2NAZA 4XBFA 1DPUA 4KMUX 2PLYA 4ASNA 2JZYA 4UVCA 2WV0A 3E5QA 4GXOA 1GVJA 6PAXA 1USTA 2Z99A 2QENA 5JFRA 3LA2A 4G8XA 3R61A 3GLXA 1IF1A 1D8KA 1KQ0A 5CVUA 1H9GA 4A0XA 3RKYA 1F4KA 2HZTA 1TW2A 3M9AA 1R36A 3QRFF 3I59B 3LQRA 4CXFA 4KT5C 1O3TA 1LVAA 1H0MA 2QUFA 4O3MA 1DPRA 2CQKA 5LHIA 3GFLA 3D5LA 1GXQA 1HSJA 1F1ZA 2EV0A 1IN6A 4S04A 4KNYA 4UV8A 5E1ZB 2IT0A 2ETHA 3EYIA 5E8GA 5DYMA 4I0BA 4PCQA 4BHPA 2F5CA 4KICA 3L7WA 3L9FA 4L9NA 1WI9A 1AWCA 2PJPA 5HDNA 4OINF 2XASA 1W5TA 3P7NA 2H27A 2OA4A 3E5XA 2DK8A 5CVRA 3TDUC 1VTNC 4HX4A 4M9SA 3C1DA 3GW2A 3BP8A 1W7PA 2E7XA 2XAFA 5AONA 2A3SA 3PQKA 4O5VA 5FB2A 1Y0UA 3NQOA 2HQNA 1EH7A 2K7LA 2QM3A 1Z1DA 3RPQA 3QU6A 1JHFA 3P9IA 1IXCA 1J7KA 2FMYA 1YW9A 1KQ9A 2QVOA 4L5JA 2DK5A 2XUBA 2Y75A 2FA5A 5F64A 1HXDA 1JE8A 3SHFA 5JR3A 1W7PB 2FNAA 2A6EF 2GA1A 4LLLA 2FE3A 4HBLA 1SD6A 2K27A 2KJCA 2XHKA 1U5TA 2M1BA 4GYIA 4U88A 5K5QA 3L2CA 1KGSA 2LDUA 3EQLF 2X4HA 2DQRA 2KRFA 3CO7C 2NNNA 5ICFA 4RAYA 5HS8A 2BEOA 3JSOA 2BE5F 5BS6A 5J6XA 3ZN1A 3BROA 2O03A 3T0YA 1FYLA 1QQIA 3U1DA 2QQBA 1U5TB 3F72A 3BOQA 1PDNC 1YYVA 4TV7A 5K5OA 5D5XB 2DQLA 1J75A 1IN7A 4EJOA 5FO5A 1F9NA 2DO7A 1R00A 1SMTA 2C6YA 1SD4A 3QPHA 3WTVC 5ILVA 4IHSA 3J80K 2FRHA 2YX7A 1I1SA 1TQMA 4G7HF 3KP3A 3JTGA 2P8TA 3WTWC 1XCBA 4EM2A 2HGCA 4KA4A 1YS7A 5DCFA 3WTYC 5F1RA 3E5UA 1KYZA 3FHZA 4RGRA 3M7GA 3WE3A 2MLKA 5HVQC 2PEXA 2V1DA 1Z9CA 3I4PA 1P4AA 2FNPA 4WX9A 2ZJ2A 2KIUA 1PUEE 1Z05A 1FSEA 2GIVA 3MZHA 2V6CA 3H3ZA 2W57A 3KE2A 4U7BA 4Q5SF 2FEZA 3GXOA 4KN7X 3K0LA 4WXHA 1STZA 5E20A 2LSOA 3LAJA 1IRGA 3M1EA 1MGTA 3ZMUA 4LB5A 2QLZA 5DCMA 2O61A 2YSRA 1O3RA 2DPDA 2VOOA 2M45A 1OYYA 1BBYA 1U8RA 3O6BB 2HDCA 1D8JA 3NEUA 1WWXA 1JXSA 2FMLA 2VT3A 2EFPA 4HA8A 2MH2A 2QBYA 2P4WA 1P92A 1J0RA 1SMYF 3WTXC 2RVCA 5H6RA 3FZVA 4N9IA 4ON0A 2VE8A 3V8KA 4L9JA 5DCMB 1S8NA 4ZH4F 1RUOA 3VODA 4G9YA 2AXLA 4UVAA 5E17F 2KIMA 1HW1A 4AIJA 3ABUA 1ZRFA 2YU3A 1XGSA 3ML6A 3EETA 2RN7A 3IRRA 2DAOA 2L3DA 2D1HA 3LSTA 3DV8A 4G94A 4L18B 3JTHA 4EGYA 2D1VA 4BQAA 2XAHA 1AOYA 2HYGD 1R1UA 2P5VA 3R0JA 4LFUA 1V4RA 1LDKB 1FYKA 1XMAA 2PMHA 3JAMK 1G6NA 1TQIA 2PI0A 2CO5A 4M74A 5IT9Z 4GGGA 2LF7A 1XMKA 1IZ1A 3WE2A 3CUQC 2DTRA 4BNCA 1KU7A 3Q9VA 4OIOF 2RV8A 1Q1HA 3DFGA 4OIQF 1O57A 1BJAA 5CYVA 5KK1A 3WU0A 1ZG1A 2Z5UA 4UVBA 5KVRA 1I6XA 2R3SA 1O3QA 2CYYA 2MBFA 2H94A 4O6JA 1V3FA 4H0EA 3WTZA 1S7OA 1HW5A 3SQNA 2EB7A 2BV6A 3S2WA 5FFZA 3T8RA 2HWVA 4EV0A 1X3UA 5L3EA 3IWZA 4MEXF 3FWEA 3K1MA 2CSOA 2MC3A 5BPIA 2CG4A 3LFKA 3IKTA 1ZAOA 2P7CB 3TKYA 4MHGA 4OIPF 3C7JA 2W85A 1FX7A 2M5WA 3DQVC 5FLXK 1YTYA 3FM3A 3FMRA 2GZWA 2LKPA 1FSHA 1R22A 5HDGA 2H09A 4KN4X 3KFWX 3CJNA 1FBUA 2B0LA 1H9TA 4UV9A 4L0ZB 1J9IA 3HYIA 4HLYA 4XRFA 2ZFWA 4P9UA 4HX8A 3F8MA 4F7ZA 3TO6A 5K5RA 1OR7A 1E2XA 3B73A 4ESJA 1G3YA 3K9TA 4EJTA 3BZ6A 1IXRC 2A5YB 1U5TC 2W84A 4Z2YA 3GX4X 3GZ5A 1O7LA 3R4KA 4KYWA 4RGXA 3K69A 4PGHA 2LNBA 5FD5A 2FSWA 1NHAA 1YLFA 5BOXA 2BYVE 4QWQA 3VEPA 1FC3A 1DDNA 1RZ4A 3H3UA 5HS9A 5LGTA 4YFKF 3U9GA 2A61A 3FMSA 2X0LA 5HLIA 1MJAA 3O2PE 1FBQA 4LMYA 4LG0A 2BGCA 3FXUA 4RB3C 3H92A 4WXCA 3AAFA 2EA2A 1ZARA 1XSXA 4A0ZA 1QBJA 4HQEA 4RAZA 1BI1A 2V1UA 1U78A 2IP2A 3K2ZA 3WGGA 3RDIA 1IUYA 3GUDA 4BXUA 1ULYA 5JVTA 1KU3A 4LG0B 2YPRA 4I98B 3GFJA 3FXRA 2OBPA 1K78B 3ZMTA 4I7HA 3V4GA 4HF2A 4KIGA 3BJ6A 3E6BA 3M8FA 2XKOA 1FY7A 3TOAA 4A5MA 1KQ8A 2HTSA 3MFKA 3HSRA 3MWMA 1YS6A 2JRTA 4OMZA 2VBZA 4R1HA 3GFMA 1T0FA 3CUQB 3LQQA 2VODA 4P9FA 3E97A 5ICCA 3WTTC 1ZYRF 3TDZC 3ROUA 3C18A 1FNNA 3IWFA 5DDGA 3E6MA 5JI6A 1ZRCA 3HIFA 1B59A 2EV6A 1TQPA 4I09A 1HW2A 3KP6A 1R23A 1B4AA 1FYMA 1QZYA 3QU3A 5BMZA 1HKQA 1ONVA 1Z91A 1FWZA 3ZMZA 2JPBA 1OKRA 5HOOA 1BOAA 1LB2A 2L01A 2IW5A 2V1XA 2P5KA 3BPVA 2BBYA 3J81Z 4B09A 4GYGA 4WF2A 2ZKZA 3BY6A 3ZMVA 4CHUA 1KYWA 3I58A 3IL2A 4HV5A 5LRSA 1J5YA 3SZTA 4RB0A 2NS0A 3KETA 3RI4A 3WGHA 2EFOA 3TO9A 3F8FA 2UZKA 5D8LB 2ESNA 2QQAA 3BWGA 1MDMA 3EUHA 5D6FA 3CTAA 4ENJA 1MZBA 3HRUA 1O7FA 2HTJA 2OQRA 2XAJA 2ZCWA 3EDPA 3ZP5A 1R1TA 2D2WA 4YFXF 3I71A 2EJRA 3TOBA 1K6OA 3GEZA 1S29A 2HS5A 4MTDA 4AVPA 2VBWA 2IPQX 3CUOA 1FP1D 1BM9A 2HQRA 4Q48A 1S7AA 1ZGJA 2J5OA 2UWMA 1OYIA 2Y48A 3GWZA 2CGPA 4CO8A 5F6FA 1RI7A 1ZN2A 1W7PD 2E1CA 4XLNF 3T5XA 3LWFA 5H6QA 1ZRDA 1I5ZA 1IXSB 2DI3A 5DD8A 1LQ1A 3F8BA 5D6EA 1LEBA 1E17A 1TTYA 3HRSA 5LGUA 1J59A 5AIQA 3DEUA 5A2QK 4KDPA 1YW7A 2STWA 4M73A 5L3CA 3KLNA 1USSA 2MD5A 2JT1A 1P4WA 3JW4A 3ECOA 1QNTA 4LLGF 5E18F 1G4DA 5L3BA 1EV7A 1YO5C 1HBXG 4G6QA 3IHUA 5HLGA 1Z6TA 3RTRA 1B9NA 3KLOA 2M87A 1T38A 5LGNA 4G7OF 4L9TA 3Q9SA 5CJ9A 1BC8C 2EFNA 5CVIA 3E3VA 2RNJA 2FU4A 2L54A 2VT2A 4MGRA 5D5VB 2UXNA 4Y15A 1BI2A 1G3TA 3WGIA 4ZZLA 2NNYA 4MQVA 1YW8A 4MEYF 1QO0D 4EM1A 4IJAA 1KU9A 3RYRA 4LLNA 2HKXA 4OOIA 3MEXA 2TDXA 4YG2F 1JGSA 1XGNA 2PQ8A 5ILUA 3LA3A 2VC1A 1RIOH 1WKMA 2WTEA 4IRHA 5JHUA 2IRFG 1SAXA 2VXZA 2F5EA 3R60A 2QBYB 4P5OA 1RNLA 1OPCA 2O3FA 2EK5A 1A04A 5J8CA 3WTUC 3ISPA 1K7AA 1ZLJA 2JTVA 3TQNA 3N4MA 3HHHA 5ERIA 1UFMA 1IN8A 4N0BA 1JHHA 3COAC 3T1BA 2XROA 2HYFA 2V79A 4GCVA 4BH9A 3MAJA 3RKXA 5LHHA 2DLLA 3G73A 4MTEA 2MH9A 3DF8A 4HDVA 4Y17A 1FT9A 4M9ZA 4HYEA 4EVIA 3FF5A 4ZYHA 1U3EM 1MD0A 1PP8F 3P9KA 1ZGAA 5ED4A 3DPLC 5DD4A 1LJ9A 1REPC 4KMFA 2O0YA 3W6JB 1G3WA 3F21A 5D8KB 4I2OA 2IA2A 2RQPA 1I1GA 1XB4A 3FXQA 1R58A 3WU1B 1SD7A 4WXDA 4AD9A 5HLHA 3WODF 4HF1A 4M9XA 1XCVA 1ZHFA 1T39A 3MZYA 3KZYA 2E1NA 4I02A 1SFXA 1RUNA 2G7HA 1TBXA 2JPCA 1TNTA 3OV8A 2A69F 3JSPA 3K1PA 3PFIA 4HOBA 4RS8A 1XSVA 4R79A 5ILSA 1P2FA 3V8LA 1GHCA 4DNCA 1MJ9A 3J80Z 2FQ3A 2VC0A 1IRFA 3QPTA 4YFNF 2ZO4A 1MJBA 2CFXA 2HEOA 2GXGA
chains in the Genus database with same CATH superfamily
4A3EJ 1D0YA 2GIZA 1K4SA 2D5VA 1MH4A 2ZXJA 1YX3A 2R7FA 2FBHA 3CO6C 4BDZA 3ZQGA 3BJOA 3HUGA 4DQ2A 4AWXB 4IHYA 2LR8A 4KFCA 5GAHJ 2O8XA 5F04A 3EUHC 3WU2C 3RJPA 1FP2A 4ZZDA 2O7OA 2F2EA 3L2VA 5M5XJ 1U2WA 1ERDA 1T98A 3VPRA 2L4MA 2DOAA 4IXAA 2OPTA 1XN7A 3PNTA 1JUSA 4JQFA 1ETWA 4HF0A 2FF4A 4QPOA 3GCMA 4BGDA 1K83J 2P5LC 4XRSG 5M3FJ 3KP4A 4HEA2 1FBSA 4P96A 3WG7H 2M9HA 3ABKH 3BPXA 3JRCA 2VASA 1S6LA 1MSFC 1YJNI 1WJ5A 1LFBA 5FFXA 3PL8A 3ZQ7A 1ZH5A 2ZBKA 2DCEA 3ZQFA 3A03A 4MO7A 1KONA 5FD6A 3F8CA 1QPIA 1YFHA 3W2VA 1MBGA 5J1UA 4BYYA 4A6DA 4HRIA 3G1MA 2K9QA 2EFWA 2B7EA 2LH9A 2K02A 2ESHA 2PMZN 2Z9OA 4LGWA 1YG2A 1W0UA 3ZMDA 4F93B 4Z6YA 3I5UA 2G0EA 1WJFA 3RZOJ 1M1EB 4W1UA 1UJ8A 3CC2I 5J4VA 1LNWA 3C3WA 2HI3A 3U2RA 1K6YA 2F4OB 1XDSA 2LRDA 3ESWB 3IP4B 1Z6RA 4MFDA 2DA5A 2GXBA 1R71A 3ERED 1WJCA 4MQ9F 4NB5A 3F6OA 2OZUA 2DU9A 2E36A 1UB9A 5TISC 3V8JA 3GF2A 3HGGA 5JLWA 2A07F 1V55H 5C3EJ 4XICA 3IC7A 2ELJA 3J7ZI 2TRTA 2LFBA 2VE9A 4KIFA 2ME6A 1FIAA 3BR0A 3ZXSA 4FX0A 3FMQA 2Z1DA 2H6BA 5L3FA 2OZ6A 4EJUA 4E7HA 3ABMH 1MBFA 1HCRA 2HVSA 1QGPA 4BS9A 3CP2A 1PJRA 4XSZF 5FGMA 3BDDA 3DXJF 1B72A 4DIQA 1G3SA 2EZKA 1ZTRA 4RGSA 4E70A 1FLIA 2KMUA 3F0CA 5IOZA 4AIHA 1XSDA 1YIOA 5FKOA 3GTOJ 1DQUA 3CCRI 3GTPJ 4MNUA 5DUKA 2GWRA 2OD5A 5J40A 3FXMA 3ULQB 5B5EC 3HOXJ 1JTYA 3J7AO 4LJZF 1WI3A 5EDNA 2OTJI 4A5NA 5EG0A 2XKPA 3SFZA 3HOTA 3FXOA 4R8HA 2HOEA 3RPUA 2CQQA 3S3NA 4XSXF 1ZR2A 2ISZA 1X3WB 5F0FA 3CCLI 2R0QC 4E7IA 4M71A 2L0KA 2WAFA 5E1WA 4CICA 1Z7LA 2WA0A 2GOMA 5D4SA 1ON1A 2CW7A 1B72B 1ENHA 4HAMA 2R5YA 1VFCA 3JRHA 2DT7B 5FKLA 5FLVA 1OCCH 1T33A 2VBXA 2VBYA 4CDGA 1YRNA 4LIUA 4BQOA 1R5GA 1DP3A 2MFZA 1POGA 4IX7A 1JKQC 2Y0MA 1P6RA 1TWFJ 2W24A 3KZZA 4CYDA 5EG0B 2ZC2A 2P6SA 5L3DA 5BQTA 5TJJA 1LDDA 3JAMZ 3LAPA 1X3ZB 2K86A 5J1RA 3I54A 1I50J 2ISYA 2KIQA 5EYRA 3PIOF 3OYJA 3OYKA 4E6KG 1HKSA 1TNSA 4S05A 2QA4I 3QOPA 4LD5A 4U0YA 4Q47A 2DOFA 2R5YB 3CLOA 2NYXA 1HC8A 5BPDA 4L0YB 3G1LA 3NRVA 2JA5J 2E60A 3HOZJ 4ZYDA 1YRNB 3CJQB 2DTZA 2F5DA 1P4XA 5IT9K 1WVRA 4A0YA 1X1CA 2NVUB 4DOZA 4IHTA 3MCZA 1YITI 1FOKA 2RKHA 5IT3A 2CW0F 5DUIA 3F8NA 4I01A 3J7YJ 3IUOA 4DYQA 2O6GE 1BIBA 2G7UA 3BQZA 5LLQA 1BIAA 3HRMA 1R1VA 1VQ6I 5C4XJ 3BJAA 2ZJPF 3SJMA 1XGMA 4CZCA 2DT5A 3AKZA 3I0TA 1B8IB 3ZN0A 3DBHB 4JBAA 3HOVJ 2P7VB 1D1AA 3K4LA 3V7CA 2STTA 1Z7UA 4M72A 2P81A 2W1OA 2JA6J 2CS3A 3QP5A 3VYSB 4A3MJ 3S2DJ 3H9QA 2DYSH 3RPUD 1Z77A 2UXXA 4NQWA 5M5YJ 3EYYA 4B8XA 2ADUA 3DPTA 5H20A 2FBIA 2ECCA 1ZLKA 2BXYA 1KA8A 1EJ9A 3VOEA 2RGVA 3DP7A 4IF4A 2KIFA 1IAWA 2HDDA 2WAEA 4HV6A 1B1BA 3RIRA 2M8EA 2GQQA 3WTSC 1ON2A 2VJIA 1MSEC 1PUFA 4OMYA 2CRGA 1MMNA 1T08B 1SD5A 1WSUA 5FLXZ 2M7AA 2Z33A 3MQ0A 2XGDA 3G1OA 3PQJA 3VFZA 1IN4A 5D4RA 1MDMB 4UHTA 3O8GA 4QPQA 3SDGA 1W36C 2CV1A 1R5HA 2OV7A 3EPZA 4RGUA 4YIFA 4N4NB 1A5JA 2X6OA 2LG4A 2GA2A 3FM5A 3OR2C 1WRJA 2IA0A 5D5UB 3A1YA 2HVQA 3KCCA 3R0AA 3R6SA 4ANJA 5K1YA 4UUVA 2QZ8A 5J1YA 3M8EA 4F55A 1J09A 4B44A 3E6DA 4BQNA 3ECHA 1ODDA 4L9VA 5EJCA 2JN6A 2E5NA 1XDUA 1TWGJ 4I0AA 1LFUP 3OYAA 1PUFB 3OYLA 1YQAA 4AM3A 4XKBA 1IDZA 2E5ZA 2LD5A 1R4NB 3I9V2 1IN5A 5DM6F 1OJLA 1TW3A 2PN6A 3HKZN 5IYBJ 4PJMA 2H8RA 2R7TA 3HM5A 2EV5A 2CJJA 4LK0F 2ZNYA 2X9DA 5DV5A 4IKFA 2VJ5A 4ENNA 3T8TA 2EA4A 4PJNA 1OCTC 4BE2A 2R7WA 2MC4A 4KUMA 4G7ZF 4WK8F 2RC4A 4B47A 3G3ZA 4EJVA 1UG0A 3GBGA 5LHGA 2QQ9A 3E1SA 4Y13A 2WADA 3RQIA 4KISA 1FMVA 2KJBA 3ELKA 1IJWC 2HR3A 4EM0B 4HX7A 2V9PA 4EGZA 5HS7A 2LREA 3OOPA 2AXTC 2XRNA 3F23A 2OJED 3CCQI 5HLTA 2XGCA 4OAYA 1WHUA 3QYBA 3BZCA 4ESFA 3VB2A 2Q2EA 4XRMA 3KP7A 2ZFUA 3CMAI 3F22A 2XPWA 4ZYGA 1B6AA 1SFEA 2CQXA 2GAUA 2BW3A 5CLSA 4IZZA 4C2UA 2QYOA 2XDVA 4WWCA 2ZNZA 2WC2A 1LKXA 1DUXC 1D5VA 1BC7C 3JR9A 2ZMEA 3TO7A 3AFHA 2KRHA 2E2HJ 2NRAC 2XSJC 1IC8A 4NHJA 2ELHA 4FCYA 2DODA 5GTIC 5J8FA 3VSLA 3MKZA 1J2XA 4PFOA 4OIRF 1Z0XA 2UUZA 3GZ6A 3KYDB 2PG4A 5ICEA 3HC7A 2DW4A 3HSEA 3HTUA 3IH4A 2AO9A 4U7DA 1KU2A 3D0SA 3HOSA 2BHZA 2M3AA 3H5NA 1T56A 3NWTA 5LEJA 1VQ4I 2KKOA 5KHDA 4AIKA 2ACJA 4AIDA 4QTRA 4FQGA 5CVVA 3O3KA 2CUEA 3L2QA 4IVNA 2B63J 1GXPA 2QWWA 3H9GA 3ZMSA 4P55A 2L4AA 2MLGA 1OMIA 1UHMA 1Y0NA 2OU2A 2Y2ZA 5FRNA 2ZMEB 2LTPA 4DBRA 3DEEA 4C9YA 5EEHA 4CA0A 4QLCU 5TRDA 3OL3A 5EGOA 3KEQA 4FHTA 1ZG5A 3S17J 3OL4A 1X1PA 3HSFA 3QYFA 2OC6A 3N05A 3JCUC 3LSGA 1T6SA 2PMUA 2HPIA 1S3JA 4L5IA 4ESBA 2Q0OA 2J5PA 2AS5F 1OCRH 1PYVA 4FE4A 2NS8A 1B9MA 4RB2C 3DPUA 2BZTA 1IW7F 5AIPA 1BR2A 2DMQA 2OAZA 2Q8KA 1ITYA 5LEKA 2RDPA 3TP3A 3FK6A 4BKXA 4ENKA 2KQRA 2DFIA 2HFHA 1WH7A 4CUGA 2WAQN 2XAGA 2V4JC 1TLHB 4HZFA 2R7ZJ 2IGNA 1VZ0A 4FT8A 2L7ZA 4A6EA 5EGOB 1L0OC 3A4CA 3CMEI 2MA3A 2HVRA 2XVCA 4XORA 5GPCA 2CFOA 5J4YA 3OY9A 1N78A 3AG4H 5FLMJ 3C2HA 4LIVA 3S15J 3HHGA 1W4MA 1RETA 4X6AJ 4XONA 5FKMA 1W5SA 4A12A 1QZZA 2IVMA 2PBIA 2KHMA 1WQ2A 4GO1A 2CWEA 2QSFX 3WG9A 5IP6A 4UXNA 2V1NA 2IA1A 3KP5A 2JVGA 3VDXA 3M07A 3REOA 3TW7A 2EFQA 4XLPF 4BUPA 2PFBA 3I64A 2K40A 1LPQA 5L3GA 2G9WA 5EF6A 1WCMJ 4W97A 1NTCA 2QSGX 2H1LA 4XK4A 1NK2P 4BHCA 1LEAA 4OU0A 2Y9YA 3I3LA 3A01A 2Z3YA 3HG9A 2XF7A 1S72I 4E7ZA 3GYHX 2K4JA 2D45A 4YEJA 4M3FA 3ZQHA 3MKWB 2EIKH 4HDUA 2EIMH 2A6HF 2IGOA 2XAQA 2YUSA 3EUKL 4RB1A 1JKOC 1QHGA 1PP7U 5CVJA 3LSKA 3QAHA 2JK3A 4XR6A 4EQQA 2DPUA 1MKMA 1QVUA 2BHYA 2N8GA 2XB5A 3L00A 4PDKA 1FZPB 1LFPA 4RAGA 3GVAA 3PM1A 2P6TA 1F43A 1GUUA 4Q4ZF 3IKVA 5IOYA 3B02A 3DKWA 3F3XA 2RAEA 2FXAA 1IO2A 4M6XA 1DP7P 2XIGA 2IAIA 2W4SA 4NC6A 3L2UA 2LKSA 1MH3A 2V6EA 2YX4A 1U9OA 3FISA 3I53A 3BCBA 1FOWA 3FXLA 3M4OJ 4YIIA 3Q5FA 3KEOA 3M1CA 1OLTA 2R7DA 1JJ8C 3V42A 1G59A 3P9CA 3BTLA 1ETVA 1HSTA 5D5WB 1U6GA 2KDZA 3H35A 3QOEA 4NC7A 2LBFB 4LK1F 2NVTJ 5E1XA 1MNMC 3J81K 2K4BA 3HB9A 1HKTA 3K1NA 1ZG3A 2K3FA 3F6VA 5FKNA 1C0WA 2FBKA 4ETSA 4IRGA 2K5CA 3RCOA 1YHQI 4PZJA 3GO5A 3Q3SA 2BXZA 1A31A 1OYWA 5E3LA 1R7JA 3CCMI 3TBIA 2HKOA 4FTHA 1BJZA 1ZK8A 5F08A 1MMAA 1ZR4A 1JKRC 3LSHA 4FASD 3ZOBA 4ZYEA 3ZPLA 3H0GJ 3IRQA 5GP9A 1P7JA 2B9SA 1BI0A 4F91B 2LF8A 4NBQA 3OYMA 1Y39A 5EEGA 3V7SA 2DMTA 3OS2A 2F5FA 4C2TA 3RKWA 3G71I 1G2HA 3JRGA 1H88C 2YR2A 1EH6A 1K79A 3WHBA 5F27A 2O8KA 1OFCX 1E3PA 3OMYA 1BOBA 2JQ7A 4CZZA 4WCGA 1V54H 5ICGA 3ZGKA 5IP7J 2OQGA 3ABTA 4K2EA 2Y0SA 4CGZA 3DTKA 3MZ8A 4N9HA 4N4OB 4BL0B 2R7VA 1XPXA 2O9LA 1RC9A 3ZR8X 2M30A 3W6KB 3QP6A 1X4PA 5LBQA 2NOGA 1EH8A 2CUJA 1HDPA 3Q0WA 2V9VA 2E7WA 2I5UA 4A2UA 2XGXA 4JK1X 2KT0A 1UHWA 3BTJA 3QWLA 5JHFA 5LRRA 5LD2C 1VQ7I 2DMUA 5FJ8J 2LY1A 2ICWG 2UV1A 2H6CA 5A2QZ 2HOTA 3TGNA 1T2KA 2XF5A 1OCOH 3SDBA 3M8JA 4BAYA 4EJWA 3MMYB 3HBLA 3BR3A 2PMZA 1UCRA 4IPAA 4YELA 1F5TA 2VOPA 2EWNA 2XV4S 4CCKA 4FETA 3SXYA 5KAFC 2X51A 2A68F 9ANTA 1HQCA 3RYPA 2VN2A 3FX3A 1L3LA 1CGPA 1ACIA 1BN5A 3RSNA 1MW7A 2X6YA 4XKWA 5B1BH 1KZHA 4UNOA 2M2EA 3TP0A 4U0VA 4A3GJ 3KX2A 1GLNA 1E3HA 2YS9A 5HODA 4ENMA 1CF7A 3LL7A 4BQQA 2DYRH 4DJAA 3N97A 5DEQA 2HZDA 1QZEA 3HUGB 3LMMA 1SFUA 1UAAA 2DFFA 2WBMA 4LB6B 4BHBA 3HOWJ 2WWYA 2VPLA 2V9KA 3GTQJ 3GTLJ 2CW8A 2W00A 3IH2A 1QPMA 2VONA 2DJNA 3SEQA 4BBRJ 3K6GA 3EUAA 4PGGA 3G6EI 1BI3A 3CDHA 1I27A 1TWHJ 2COMA 3SZPA 1O3SA 3GFIA 2W25A 3HRTA 3L09A 2JSCA 4BE1A 3B6AA 2Y30A 2DBBA 1OCZH 4FX4A 3FK7A 4KIBA 3KP2A 1CF7B 1XD7A 2X6WA 3V7RA 2FOKA 2WB1N 4HNUA 5HDKA 1K78A 3HTSB 2XC7A 1XGOA 3E6CC 5E8IA 3L2RA 2XPUA 4M3GA 3K4BA 4M6YA 1D3YA 3CCEI 1XTAA 2OUMA 2X1CA 1EKEA 2IJLA 4B43A 4G6DA 4IRIA 4U0WA 2E2JJ 1ZREA 3BG6A 1SANA 3CJTB 1FPQA 3VYUB 4HLXA 3I59A 3LA7A 3S32A 2L02A 4HQMA 2CQNA 4D0PA 1JTXA 1LDJA 3FXJA 4EMSA 4HW0A 3CUQA 2NAZA 4XBFA 1DPUA 2GM4A 4KMUX 2PLYA 2E34A 4ASNA 2JZYA 3NWSA 4UVCA 4B48A 2WV0A 2XPVA 3E5QA 4GXOA 1GVJA 1CQTA 2JA8J 6PAXA 1USTA 2K9LA 2Z99A 2QENA 2E1OA 3S1RJ 5DTDA 5JFRA 3K2AA 3LA2A 2DN0A 4G8XA 3R61A 3GLXA 1IF1A 2V26A 4D1QA 1D8KA 1KQ0A 5CVUA 1H9GA 4A0XA 2R5ZA 4CCMA 2V7FA 2W7NA 3PSIA 3RKYA 5B3SH 1F4KA 2HZTA 2DMNA 4F92B 1TW2A 2CU7A 3M9AA 1R36A 1FIPA 3QRFF 3I59B 4IOAF 2ZMEC 3LQRA 4CXFA 1F36A 4KT5C 3OOUA 1MNDA 3CCVI 1O3TA 1LVAA 1H0MA 2QUFA 4O3MA 1DPRA 2CQKA 2JUGA 5LHIA 1MBKA 4XL9A 3GFLA 3D5LA 2HU9A 1S5LC 4G6TB 4HPQA 2IGMA 1MNEA 1GXQA 2EILH 4ZDPA 2MW8A 1TP4A 1HSJA 1F1ZA 2EV0A 4CYCA 3VYTB 1U0JA 3S3OA 1IN6A 3O8HA 3BQYA 4S04A 2VQCA 4KNYA 1VQNI 1VQ8I 4UV8A 3HPGA 5E1ZB 2IT0A 2BY0A 4E7SA 2ETHA 1VNDA 4KJZA 3EYIA 5E8GA 5DYMA 4I0BA 4PCQA 1XC5A 3BC8A 1ZKGA 3HPHA 3KYCB 2F5CA 1ZELA 4BHPA 5IYCJ 4KICA 3TL4X 3L7WA 3L9FA 4L9NA 1WI9A 1AWCA 2PJPA 1YJWI 2DOEA 5HDNA 4OINF 1A6QA 2XASA 4MFEA 1W5TA 1XG1A 3GTJJ 3P7NA 2H27A 2OA4A 3E5XA 4CYCB 2DK8A 1R5ID 3H3VK 1IRZA 5CVRA 2K9MA 2DA3A 4XM3A 3TDUC 1VTNC 4BU2A 4HX4A 4M9SA 3UR3C 2QCOA 3C1DA 3GW2A 3BP8A 3H9JA 4AVZA 1W7PA 2E7XA 4V19K 4G12A 2XAFA 3ZRGA 1FTTA 5AONA 2A3SA 3QPLA 4A3JJ 3PQKA 2GBYA 3A0BC 4O5VA 3B6CA 5FB2A 1Y0UA 1I39A 3HGYA 3NQOA 2HQNA 4AUXA 1EH7A 2K7LA 3FKJA 2QM3A 5J47A 1Z1DA 3RPQA 4HNVA 2QKMB 2XRLA 3QU6A 1JHFA 3P9IA 1IXCA 1VQ5I 1J7KA 3OSGA 2FMYA 4Y7NJ 1MIJA 1YW9A 1KQ9A 3CESA 3DKYA 4UB6C 2BY3A 1HOMA 2QVOA 4GRIA 3RQ4A 4L5JA 2DK5A 2XUBA 2Y75A 2X1EA 3AG2H 3ZQQA 2FA5A 5F64A 1HXDA 1JE8A 2OCCH 3SHFA 5JR3A 3CQZJ 1W7PB 2FNAA 2A6EF 2GA1A 1IRXA 4LLLA 1R49A 2FE3A 4HBLA 1SD6A 2K27A 2KJCA 2XHKA 1U5TA 2NVQJ 4LOCA 3A0HC 4UUSA 2ZJRF 2M1BA 4GYIA 5J3LA 3HKZA 4U88A 3IV5A 5K5QA 2Y9ZA 3L2CA 1KGSA 3C2GA 2LDUA 3CCSI 3EQLF 2HOAA 2X4HA 2JJ7A 2DQRA 3QQAA 4BY1J 3G2BA 2KRFA 3CO7C 4UY8I 4EATA 1A36A 2NNNA 5ICFA 4RAYA 5HS8A 2BEOA 3JSOA 2BE5F 2AQFA 4GDFA 1IDYA 5BS6A 2MG4A 2CV0A 4ITVA 4C2MJ 5J6XA 3ZN1A 3BROA 4NQWB 2O03A 1AHDP 3T0YA 1MBHA 3D5RC 3H1CA 1FYLA 2CUZA 1E3OC 4J00A 4DW6A 3HJEA 1QQIA 3U1DA 2IBDA 2QQBA 1U5TB 4CH7A 2KLOA 3BOQA 3F72A 4UUSB 1PDNC 1YYVA 4TV7A 4A93J 5K5OA 5D5XB 3I4MJ 1QRYA 2DQLA 2LOOA 2A5WA 1Y6IA 1J75A 4A69C 3TW6A 1IN7A 4EJOA 2KPMA 2VQLA 5FO5A 1X1DA 1F9NA 2DO7A 1R00A 3PSFA 1SMTA 4B3XA 3A02A 4D7MA 4XRSA 1SD4A 2C6YA 2KDOA 3QPHA 2A05A 3WTVC 5ILVA 1DU0A 2VIXA 2F48A 3JRFA 1VQKI 4IHSA 4XLEA 3J80K 2FRHA 1HDDC 3K70C 2YX7A 1I1SA 2IEKA 1TQMA 2JUCA 4CSWA 3OIPA 4RMNA 4IO9F 1LE8A 4IQ4A 1X19A 4G7HF 2ZSHB 3KP3A 3JTGA 4C3JJ 2P8TA 3L2WA 3WTWC 1XCBA 3E7LA 3SZGA 4EM2A 2HGCA 1I6HJ 4KA4A 1YS7A 3FBIB 5DCFA 3WTYC 5F1RA 3E5UA 4QSHA 3AG3H 1KYZA 1OQYA 3FHZA 1SVLA 4RGRA 3U1KA 3OYBA 3K4NA 1WZ2A 3M7GA 2KZVA 3WE3A 1VF9A 2MLKA 5HVQC 2PEXA 2H8WA 2V1DA 3CC4I 3LSRA 3JRIA 1JUMA 2RNGA 3I4PA 1Z9CA 4M3BA 3BLYA 2R4GA 4BEHA 1RR7A 3BT9A 2DA4A 4D5CA 1P4AA 2FNPA 4RM3A 4WX9A 4M6VA 2ZJ2A 2GXAA 4PFPA 2KIUA 1Y8RB 3HXLA 5F0HA 1PUEE 3I56I 1MMDA 1Z05A 2HXOA 4JX4A 1FSEA 2GIVA 3MZHA 2V6CA 3BG3A 3H3ZA 4DBQA 3OS1A 2W57A 4A3FJ 3S8PA 1APLC 3KE2A 2DDBA 4U7BA 4Q5SF 1SEUA 2FEZA 1Z21A 3GXOA 4II3A 1XMXA 2Q2EB 4KN7X 2L7KA 4PJ0C 3W3CA 3K0LA 4WXHA 4UB8C 2VPRA 1D1CA 2BW3B 3H0DA 1STZA 2ZSIB 5E20A 2LSOA 4KT6A 4BEHB 3LAJA 1RRJA 1IRGA 3M1EA 1UHSA 4BE0A 1MGTA 2MGQA 3ZMUA 1T8IA 2QLZA 5DCMA 4LB5A 2O61A 4XKCA 2YSRA 4V2FA 1SC7A 1O3RA 2DPDA 2VOOA 4XNFA 2M45A 1OYYA 4IHXA 3PNYA 2LLKA 2ME0A 1BBYA 1U8RA 3O6BB 4RA2A 3BTIA 2HDCA 1D8JA 3NEUA 3OYDA 2WY7Q 1WWXA 1JXSA 2FMLA 2VT3A 2EFPA 4HA8A 4X1EA 4B1RA 2MH2A 4Y33A 3SYTA 2QBYA 2P4WA 1P92A 1VQ9I 1J0RA 1SMYF 3WTXC 2RVCA 1X1AA 4LITA 5H6RA 3FZVA 4N9IA 4OWRB 4ON0A 2VE8A 3V8KA 4L9JA 5DCMB 1S8NA 4ZH4F 1RUOA 3VODA 4G9YA 2AXLA 2EZHA 4XOPA 1T95A 1I3QJ 1GDTA 2DA2A 1W1WE 5CKTA 3SFIA 3ABLH 4XMYA 2COBA 4UVAA 5E17F 2KIMA 5K7ZA 1HW1A 4AC0A 4AIJA 1RPWA 2VB6A 3ABUA 1ZRFA 2YU3A 1WH5A 1XGSA 3ML6A 3GZNB 3EETA 2RN7A 5FRMA 2KP6A 3IRRA 3HOUJ 2DAOA 3LSMA 1NG6A 2L3DA 2D1HA 3LSTA 3DV8A 4G94A 4JX6A 4II2A 4DZPA 4L18B 3CF2A 1Z3XA 3JTHA 4EGYA 2D1VA 2HYJA 2XAHA 4BQAA 1AOYA 5C4JJ 3AG1H 2W82A 2HYGD 4U87A 2EZIA 1JI8A 2A6TA 2PJRA 1R1UA 3H36A 2P5VA 3BR2A 3CMMA 4BJ6C 3R0JA 4LFUA 2K3PA 4PSWA 2TCTA 1V4RA 2I8DA 4S0HB 1MBEA 2XSDC 1LDKB 1FYKA 1XMAA 2PMHA 3JAMK 2VJJA 2JRMA 1G6NA 1TQIA 2EH3A 2CO5A 2PI0A 4M74A 5IT9Z 4GGGA 3TMOA 2LF7A 1FJLA 1XMKA 1IZ1A 3WE2A 1OISA 1HF0A 2F5VA 2CUFA 3CUQC 2DTRA 4BNCA 3ZQLA 2IS4A 3S1NJ 1K4TA 3G4SI 3OYIA 5B66C 1KU7A 3A01B 1D1BA 3D5SC 4E4HA 3Q9VA 4I6ZA 3BTCA 3RZDJ 1WJAA 4OIOF 3OSFA 2RV8A 1Q1HA 3JRAA 4B3AA 3DFGA 4OIQF 1YIJI 1O57A 1BJAA 2IXSA 5CYVA 4BJ5C 5LFAA 5KK1A 2DFEA 4HSRA 3WU0A 1ZG1A 1JJ6C 2Z5UA 4UVBA 5KVRA 3FIWA 4I99C 1I6XA 2R3SA 1O3QA 2CYYA 1K61A 2MBFA 4DGWB 2H94A 4AYBA 1I3AA 4O6JA 2L9RA 1V3FA 5EZGA 3L1PA 4H0EA 3WTZA 1S7OA 1Y1WJ 2LMDA 3FHNA 1JKPC 2R92J 3H5AA 4GFBA 1HW5A 3SQNA 2QSHX 4RLFA 1AKHA 2EB7A 2R7UA 2BV6A 2MSYA 3BCAA 3DU6A 4A3DJ 3S2WA 1S9HA 2GOXB 5FFZA 2JA2A 1WJBA 1N75A 3T8RA 2KISA 3ASOH 2HWVA 2CQ7A 1BW6A 4NDLA 4EV0A 4A3CJ 4RM2A 3CDLA 1X3UA 5L3EA 3IWZA 4MEXF 3FWEA 3K1MA 2CSOA 2MC3A 2R7RA 2K85A 5BPIA 2CG4A 1HLVA 3BG9A 2NVYJ 3HEFA 3LFKA 3IKTA 1ZAOA 2P7CB 3TKYA 4MHGA 5FKKA 4OIPF 3C7JA 4L5EA 2W85A 1FX7A 2E1MB 2M5WA 3OYNA 2HQAA 3DQVC 4BJTA 3BR6A 5FLXK 2LVSA 1YTYA 1QHHD 1WPKA 3S2HJ 2R7QA 3FM3A 1AKHB 3FMRA 1V5GA 4H4KC 2HQ5A 4MLOA 1ETXA 2DA1A 2GZWA 5GPAA 2LKPA 1FSHA 3HL2A 1R22A 4AU7A 2LYCA 5HDGA 2BOLA 2H09A 3MN2A 4KN4X 3KFWX 3LFUA 3CJNA 1G8XA 1FBUA 2B0LA 1H9TA 4UV9A 2JMWA 4L0ZB 1J9IA 3HYIA 1DGRM 4HLYA 4XRFA 2ZFWA 1RR8C 1FOXA 1BA5A 2XAUA 2QKLB 4P9UA 2FUG2 4HX8A 2RREA 3OYEA 1QA6A 3F8MA 4F7ZA 3TO6A 2VKVA 5K5RA 1OR7A 1E2XA 2GLOA 3JRBA 3B73A 4ESJA 2QQ8A 2FOWA 1G3YA 2QGUA 3K9TA 4EJTA 1QVTA 2WB1A 3K70D 3BZ6A 1IXRC 2A5YB 1VQPI 2HNHA 1U5TC 2W84A 4Z2YA 3GX4X 2NOJB 3GZ5A 1O7LA 3R4KA 1H8AC 3ZQCA 2FQ4A 2LC2A 4RGXA 3K69A 4PGHA 2LNBA 5FD5A 3KIOA 5E3MA 3IH3A 2FSWA 2MYSA 2Y0SN 3HZJA 2ZB9A 3CCYA 3K4KA 1GV5A 1NHAA 3W6VA 1YLFA 5BOXA 2BYVE 4QWQA 3VEPA 1FC3A 1DDNA 1RZ4A 1SAUA 3H3UA 5HS9A 5LGTA 3S16J 4YFKF 1IG7A 1EA3A 3U9GA 2A61A 2IS1A 3FMSA 4BY7J 2X0LA 5HLIA 5C44J 2MABA 1MJAA 3O2PE 1FBQA 4LMYA 1IGNA 3PJRA 1V5EA 2QF7A 4LG0A 4ZDOA 1FOYA 2BGCA 1BL0A 4CCJA 3FXUA 2VJ4A 4RB3C 4PJJA 2R7OA 3H92A 4WXCA 3AAFA 1TL8A 4RLQA 2EA2A 1R6RA 4XLAA 1ZARA 1XSXA 4A0ZA 1QBJA 1R9TJ 4HQEA 1IUFA 4RAZA 1BI1A 1TWAJ 2HXIA 2V1UA 5KAIC 2E71A 3GLLA 2M0MA 3OR1C 4HG2A 1U78A 5JLXA 3S93A 2IP2A 3K2ZA 2L2OA 2DT6A 3WGGA 3NARA 3RDIA 4KYWA 2ZXWH 1IUYA 3GUDA 4BXUA 1ULYA 5JVTA 1ORKA 1KU3A 4LG0B 2YPRA 2VLAA 1Q1VA 5B1AH 4BXFA 2LK2A 5TGTA 4I98B 3GFJA 3FXRA 1GV2A 2OBPA 2AQEA 1K78B 2F4MB 3ZMTA 4I7HA 3V4GA 4HF2A 3KPHA 1JT6A 3C2BA 1UG2A 2CMPA 2YU9J 4KIGA 3BJ6A 3E6BA 3M8FA 2XKOA 1HA8A 4HSTA 1FY7A 3TOAA 1NK3P 4A3KJ 4A5MA 2L9NA 3CF5F 1KQ8A 2JVHA 2HTSA 2E19A 3MFKA 3HSRA 3MWMA 5CQEA 1YS6A 2JRTA 1YE9A 4OMZA 2HOSA 3W2WA 2VBZA 4R1HA 3GFMA 4EEFG 1T0FA 3CUQB 3P5JA 3LQQA 2VODA 4P9FA 5M5WJ 2OF7A 4M3DA 1PVEA 3E97A 5ICCA 3BR5A 2R7SA 4OAZA 2MD0A 3KZIC 3WTTC 3M3YJ 1S7EA 4HNTA 1ZYRF 3LOCA 3ZQIA 3TDZC 4YIRX 3ROUA 3C18A 3CZ6A 1FNNA 3E0JB 2R5ZB 1YOVB 3IAS2 3IWFA 3MKLA 4MIMA 1X2MA 5DDGA 2QEXI 2XB0X 3E6MA 4DZJA 2R93J 5JI6A 1ETKA 4A3BJ 1ZRCA 3OYCA 3HIFA 5H2FC 1B59A 3CDIA 1VQMI 3DLLF 4X0GA 2EV6A 1TQPA 2FX0A 4I09A 1SVOA 1HW2A 5E3OA 3KP6A 5K7HA 2DMPA 2CV2A 1R23A 3OYFA 1B4AA 3CJRB 1FYMA 1QZYA 2XF6A 3I55I 1UELB 3QU3A 5BMZA 2L7FP 4PK4A 4XQFA 1HKQA 2FD5A 4A3LJ 1ONVA 2DDAA 4XLCA 1Z91A 1FWZA 1TZLA 2KRCA 2M0CA 3ZMZA 3QYEA 2JPBA 1YX5A 2E2IJ 1B8IA 1OKRA 3K10A 5HOOA 1BOAA 1LB2A 2L01A 2IW5A 1VQOI 2V1XA 4NUBA 2W48A 3CCUI 2LY2A 2P5KA 2X48A 3BPVA 2EINH 2BBYA 3FXKA 4XN3A 4ZC3A 4J19A 3J81Z 4B09A 3VWBA 4GYGA 1GVDA 4WF2A 5K7FA 2ZKZA 3BY6A 3ZMVA 4CHUA 1X58A 1KYWA 3I58A 4D5FA 2VQHA 3PUBA 3IL2A 4HV5A 3Q0UA 2K9NA 5LRSA 1J5YA 3HOYJ 3K7AJ 5KCMA 3SZTA 4RB0A 2NS0A 4F52A 3KETA 3RI4A 3WGHA 3GTGJ 2EFOA 1MMSA 3W2AA 2BY1A 3TO9A 3F8FA 1Z67A 2UZKA 5D8LB 2ESNA 3PNVA 2QQAA 2Y31A 3QODA 3BWGA 1MDMA 3EUHA 4QIWN 5D6FA 1MBJA 3BG5A 4E7KA 1SVMA 3CTAA 4XIDA 2X1DA 1MZBA 3BR1A 3DWLE 3CCJI 1Y56A 4I76A 3K4CA 4ENJA 3S1MJ 1ETYA 3HRUA 3LSIA 3SEZA 1Y8QB 1O7FA 2HTJA 2M4KA 2OQRA 2IGKA 2XAJA 2KZGA 2ZCWA 4RAFA 3EDPA 1NG7A 3ZP5A 1XX5A 1R1TA 2D2WA 3LSJA 4E7JA 4YFXF 2I10A 3K4JA 4IHWA 2EPFA 3I71A 3NAUA 2VI6A 2EJRA 3TOBA 1K6OA 3ERMA 3GEZA 2ID6A 1RESA 1S29A 2VKEA 3JRDA 1WGXA 2HS5A 5IYDJ 4MTDA 4RDUA 1D0XA 4AVPA 1YJ9I 2VBWA 3QPSA 1P7IA 2NVXJ 2IPQX 3CUOA 1FP1D 1BM9A 1VI0A 2HQRA 1S7AA 1ZGJA 2J5OA 4Q48A 3VSKA 2UWMA 1OYIA 2Y48A 3GWZA 3AL0C 4KITB 1Y1VJ 2Z16A 2CGPA 4CO8A 5F6FA 5HNHA 3DBLB 5F0CA 5GADJ 2KL4A 1RI7A 1A6IA 1W7PD 1ZN2A 2E1CA 4XLNF 3T5XA 3MD2A 3LWFA 5H6QA 4RBOA 4IOCF 2EBIA 1ZRDA 3JREA 1I5ZA 1N25A 1IXSB 1U9NA 4JYKA 2DI3A 1JUPA 3OYHA 1H89C 3DBRB 5DD8A 1LQ1A 4D7NA 3F8BA 1YI2I 4Y3OA 5D6EA 1LEBA 1E17A 1TTYA 3HRSA 5LGUA 1J59A 2EQRA 3ONQA 2E1MC 2DA6A 5AIQA 3DEUA 1JGGA 5A2QK 2ZXIA 4KDPA 3DTIA 2RQQA 1YW7A 2STWA 4M3EA 3GMEA 3PO3J 4M73A 3DKXA 5L3CA 3KLNA 1USSA 2MD5A 5CQGA 4ZTFA 2AHQA 3S14J 2IS2A 2VKDA 5GTHC 2JT1A 1ZGWA 1X2NA 2L9VA 5FROA 4P1WA 1P4WA 3FDYA 3JW4A 4PSXA 3ECOA 1QNTA 4JX5A 4LLGF 5E18F 3KEYA 1G4DA 4JP0A 2HPMA 4V2GA 5M3MJ 4F3QA 2H1KA 5L3BA 3FBNB 1WFXA 5IPAA 1EV7A 1X1BA 4YRVA 1YO5C 1LE8B 3MKYB 4BACA 1HBXG 1GT0C 1QU3A 4G6QA 2OCEA 3IHUA 4UUTA 4E7LA 5HLGA 1Z6TA 4ZYAA 3RTRA 3PIPF 1B9NA 2M34A 1WJEA 3S3MA 1IV8A 4ZDLA 2VUMJ 1V5FA 3KLOA 2M87A 1T38A 3DLAA 4DYRA 5LGNA 1BW5A 4G7OF 2WAQA 4L9TA 3Q9SA 5CJ9A 1BC8C 4C3HJ 5BNGA 3OWTA 2EFNA 5CVIA 5EZHA 3GTMJ 4CCOA 3E3VA 2RNJA 2FU4A 3MVPA 2L54A 5EEAA 2VT2A 4MGRA 5D5VB 2UXNA 4XOTA 4Y15A 1BI2A 1G3TA 3WGIA 3CD6I 4ZZLA 2WY8Q 3BZKA 2NNYA 2F6CA 3CMYA 2DA7A 2E35A 1JT0A 3I4NJ 2VKHA 2ZXHA 4MQVA 5GAGJ 4IL6C 1YW8A 4MEYF 3OS0A 1QO0D 4EM1A 5HNFA 5JVGF 4IJAA 1KU9A 1AU7A 1RKWA 3GTKJ 3CLQA 1OR7C 3RYRA 4NNJA 4LLNA 2HKXA 4Y52J 2VXDA 5F1JA 3H5RA 1SFOJ 4BBSJ 4OOIA 4XLFA 3CC7I 1P9QC 3ASNH 3MEXA 2L9SA 4IQJA 5DS9A 4ZJZA 2TDXA 4YG2F 1JGSA 2Q1ZB 1XGNA 2PQ8A 5ILUA 3LA3A 1A35A 4BXXJ 1DU6A 1UZCA 5IP9J 1D5YA 2BVMA 2ECBA 3ZCOA 2Y69H 1W5CC 2VC1A 1RIOH 1WKMA 2WTEA 1W0TA 2DFHA 3OIOA 1X4OA 2WV1A 4DYCA 2FJ1A 2JWTA 3PUFA 4IRHA 5JHUA 2NXNB 5GAEJ 2CH0A 2IRFG 3PO2J 1SAXA 1SFKA 5CPRB 2VXZA 1TT0A 2F5EA 3R60A 1ETOA 3K4MA 2QBYB 4P5OA 4FE7A 2VQGA 1RNLA 1OPCA 2DJIA 2O3FA 2EK5A 2JA7J 2M4GA 1A04A 1AA7A 5J8CA 3WTUC 3CP8A 3HDDA 3ISPA 2BVLA 1K7AA 5E3NA 1MMGA 2Z2SB 1ZLJA 2JTVA 2EIJH 4CCLA 3TQNA 3N4MA 3HHHA 5ERIA 1UFMA 1IN8A 3U21A 4N0BA 1JHHA 2M7BA 2IS6A 3COAC 2XGEA 3DU5A 4XN0A 3T1BA 4C30A 3TEDA 2L7MP 2XROA 2HYFA 2V79A 4GCVA 4BH9A 2ZJQF 1EF4A 4PUSA 1ETQA 4Y4RA 2O5RA 3MAJA 3RKXA 5LHHA 2DLLA 2ID3A 3KYLA 1IV6A 2HDWA 2LY9A 3BG7A 2JSPA 3OYGA 1ZQ3P 3G73A 4MTEA 2MH9A 3Q0VA 2LBFA 3DF8A 4HDVA 2LKXA 4LG3A 4Y17A 5IY5H 1FT9A 2OTLI 3DTEA 2X6XA 4M9ZA 3X2QH 2EZLA 2DXIA 3VYRB 4HYEA 4EVIA 2PJRB 1LVKA 4JOMA 3FF5A 4ZYHA 1U3EM 1MD0A 2P0WA 1XS9A 1U8BA 1UMQA 4C3IJ 1WJDA 3DEWA 3LNQA 2L5QA 2VL8A 1PP8F 4BDYA 1Z3YA 1BR1A 3A2KA 4IHVA 3P9KA 4NC8A 4CCNA 1ZGAA 3S1QJ 1T0FC 5ED4A 3IAM2 3DPLC 5DD4A 3LSPA 1LJ9A 4A3IJ 3UNGC 3OIQA 1OCPA 2NS7A 2PX9A 1TC3C 3AL0B 1REPC 4KMFA 1R4MB 1TT5B 1BR4A 2R7XA 2O0YA 3F9KA 1VQLI 3W6JB 4D9JA 1G3WA 3F21A 5D8KB 3UKGA 4I2OA 2IA2A 3D1NI 5KNLA 3DCFA 2RQPA 1I1GA 1XB4A 3FXQA 3J7AY 2M8GX 1R58A 2BY2A 1FEXA 3WU1B 1SD7A 2F4IA 4WXDA 4AD9A 4IEJA 3WODF 5HLHA 1D0ZA 4HF1A 4M9XA 2ELKA 1FMWA 1XCVA 1ZHFA 1E0EA 1O4XA 1T39A 3MZYA 3KZYA 3PFYA 5E79C 2E1NA 4I02A 1SFXA 1RUNA 2LP0A 2G7HA 4PJLA 1TBXA 1LUJB 2JPCA 1TNTA 3OV8A 1DGWY 2KFDA 2A69F 3RKQA 1RKTA 3FKIJ 3JSPA 1TWCJ 4FISA 3K1PA 1FTZA 1W36D 5DM7F 3PFIA 4ZTJA 4HOBA 4J01A 4RS8A 1XSVA 4AYBN 4R79A 5ILSA 1P2FA 1N77A 3V8LA 2X85A 4XLHA 1GHCA 4DNCA 1MJ9A 3J80Z 2FQ3A 1NH3A 2VC0A 4XKVA 1IRFA 3QPTA 4YFNF 2ZO4A 1MJBA 4B4CA 2K9SA 2CFXA 3WHCA 2HEOA 2GXGA 4ABZA
chains in the Genus database with same CATH topology
2ZXJA 2R7FA 2FBHA 3CO6C 3BJOA 3HUGA 4DQ2A 4AWXB 4KFCA 2O8XA 4ZZDA 3RJPA 1FP2A 2F2EA 1U2WA 1T98A 2L4MA 4IXAA 1XN7A 4JQFA 4HF0A 2FF4A 2P5LC 3KP4A 1FBSA 4P96A 3BPXA 1S6LA 5FFXA 3ZQ7A 1ZH5A 2ZBKA 5FD6A 3F8CA 1YFHA 4BYYA 4A6DA 2EFWA 2K02A 2ESHA 2Z9OA 4LGWA 1YG2A 3ZMDA 3I5UA 1LNWA 3C3WA 3U2RA 1XDSA 1Z6RA 2GXBA 3ERED 4MQ9F 4NB5A 3F6OA 2OZUA 2DU9A 1UB9A 3V8JA 3GF2A 2A07F 3IC7A 2VE9A 4KIFA 4FX0A 3FMQA 2H6BA 5L3FA 2OZ6A 4EJUA 1QGPA 4XSZF 5FGMA 3BDDA 3DXJF 1G3SA 4RGSA 4E70A 1FLIA 4AIHA 1XSDA 1YIOA 4MNUA 5DUKA 2GWRA 2OD5A 3ULQB 3J7AO 4LJZF 4A5NA 2XKPA 3SFZA 3HOTA 4R8HA 2HOEA 3RPUA 4XSXF 2ISZA 4M71A 4CICA 5E1WA 5D4SA 1ON1A 4HAMA 2VBXA 2VBYA 4CDGA 1R5GA 2Y0MA 1P6RA 2W24A 3KZZA 4CYDA 2P6SA 5L3DA 5BQTA 5TJJA 1LDDA 3JAMZ 3LAPA 2K86A 3I54A 2ISYA 1HKSA 1TNSA 4S05A 3QOPA 4LD5A 4U0YA 4Q47A 3CLOA 2NYXA 5BPDA 4L0YB 3NRVA 4ZYDA 2F5DA 1P4XA 5IT9K 4A0YA 4IHTA 3MCZA 1FOKA 2RKHA 5IT3A 2CW0F 5DUIA 3F8NA 4I01A 2O6GE 1BIBA 2G7UA 5LLQA 1BIAA 3HRMA 1R1VA 3BJAA 1XGMA 2DT5A 3I0TA 3ZN0A 4JBAA 2P7VB 3V7CA 2STTA 1Z7UA 4M72A 3QP5A 2UXXA 4NQWA 3EYYA 4B8XA 2ADUA 3DPTA 5H20A 2FBIA 1ZLKA 1KA8A 3VOEA 2RGVA 3DP7A 4IF4A 2KIFA 1IAWA 4HV6A 1B1BA 3RIRA 2M8EA 2GQQA 3WTSC 1ON2A 4OMYA 1SD5A 1WSUA 5FLXZ 2Z33A 3MQ0A 3PQJA 3VFZA 1IN4A 5D4RA 1MDMB 4UHTA 1R5HA 4RGUA 4YIFA 3FM5A 2GA2A 1WRJA 2IA0A 5D5UB 3KCCA 3R6SA 3R0AA 5K1YA 4UUVA 2QZ8A 3M8EA 3E6DA 3ECHA 1ODDA 4L9VA 1XDUA 4I0AA 1YQAA 1IN5A 1TW3A 2PN6A 2EV5A 4LK0F 2ZNYA 5DV5A 4ENNA 3T8TA 2EA4A 4KUMA 4G7ZF 4WK8F 2RC4A 3G3ZA 4EJVA 5LHGA 2QQ9A 4Y13A 2KJBA 3ELKA 2HR3A 4EM0B 4HX7A 4EGZA 5HS7A 3OOPA 2XRNA 3F23A 4ESFA 3VB2A 2Q2EA 3KP7A 3F22A 4ZYGA 1B6AA 1SFEA 2GAUA 5CLSA 2QYOA 4WWCA 2ZNZA 2WC2A 1DUXC 1D5VA 1BC7C 2ZMEA 3TO7A 2NRAC 4NHJA 2ELHA 5J8FA 1J2XA 4OIRF 3GZ6A 2PG4A 5ICEA 2DW4A 3HSEA 3HTUA 4U7DA 1KU2A 3D0SA 3HOSA 5LEJA 2KKOA 2ACJA 4AIKA 5CVVA 3O3KA 4IVNA 1GXPA 2QWWA 3ZMSA 4P55A 2L4AA 2MLGA 1OMIA 1UHMA 2OU2A 2ZMEB 5EEHA 4QLCU 5TRDA 3KEQA 4FHTA 1ZG5A 3HSFA 1T6SA 2PMUA 1S3JA 4L5IA 4ESBA 2Q0OA 2J5PA 2AS5F 1B9MA 4RB2C 1IW7F 5AIPA 2OAZA 2Q8KA 5LEKA 2RDPA 4ENKA 2DFIA 2HFHA 2XAGA 1TLHB 4HZFA 4FT8A 4A6EA 1L0OC 2MA3A 2XVCA 3HHGA 1W4MA 1W5SA 4A12A 1QZZA 2IVMA 2PBIA 1WQ2A 4GO1A 2CWEA 3WG9A 4UXNA 3KP5A 2IA1A 3REOA 2EFQA 4XLPF 2PFBA 3I64A 5L3GA 2G9WA 4BHCA 1LEAA 4OU0A 2Z3YA 3GYHX 2K4JA 2D45A 4HDUA 2A6HF 2XAQA 4RB1A 1PP7U 5CVJA 3QAHA 4EQQA 2DPUA 1MKMA 3L00A 4PDKA 1FZPB 3GVAA 2P6TA 4Q4ZF 3IKVA 3B02A 3DKWA 3F3XA 2FXAA 4M6XA 1DP7P 2XIGA 2YX4A 3I53A 4YIIA 3Q5FA 3KEOA 2R7DA 3P9CA 5D5WB 1HSTA 1U6GA 4LK1F 5E1XA 3J81K 2K4BA 1HKTA 3K1NA 1ZG3A 3F6VA 1C0WA 2FBKA 4ETSA 4IRGA 4PZJA 3GO5A 1OYWA 1R7JA 2HKOA 4ZYEA 3ZPLA 3IRQA 1BI0A 2LF8A 5EEGA 3V7SA 2F5FA 3RKWA 2YR2A 1EH6A 1K79A 4CZZA 4WCGA 5ICGA 2OQGA 3ABTA 4K2EA 4CGZA 4N9HA 2M30A 3W6KB 3QP6A 5LBQA 1EH8A 2V9VA 2E7WA 4A2UA 2XGXA 4JK1X 1UHWA 5LRRA 2H6CA 5A2QZ 3TGNA 1T2KA 4BAYA 4EJWA 1UCRA 4IPAA 1F5TA 2VOPA 2EWNA 2XV4S 3SXYA 2A68F 1HQCA 3RYPA 2VN2A 3FX3A 1L3LA 1CGPA 1BN5A 4UNOA 4U0VA 4ENMA 1CF7A 3N97A 5DEQA 1SFUA 4LB6B 4BHBA 2WWYA 1QPMA 2VONA 4PGGA 1BI3A 3CDHA 1I27A 2COMA 3SZPA 1O3SA 3GFIA 2W25A 3HRTA 3L09A 2JSCA 2DBBA 4FX4A 4KIBA 3KP2A 1CF7B 1XD7A 3V7RA 1K78A 2FOKA 5HDKA 3HTSB 1XGOA 3E6CC 5E8IA 4M6YA 1D3YA 2IJLA 4G6DA 4IRIA 4U0WA 1ZREA 1FPQA 4HLXA 3I59A 3LA7A 2L02A 4HQMA 4D0PA 1LDJA 4EMSA 4HW0A 3CUQA 2NAZA 4XBFA 1DPUA 4KMUX 2PLYA 4ASNA 2JZYA 4UVCA 2WV0A 3E5QA 4GXOA 1GVJA 6PAXA 1USTA 2Z99A 2QENA 5JFRA 3LA2A 4G8XA 3R61A 3GLXA 1IF1A 1D8KA 1KQ0A 5CVUA 1H9GA 4A0XA 3RKYA 1F4KA 2HZTA 1TW2A 3M9AA 1R36A 3QRFF 3I59B 3LQRA 4CXFA 4KT5C 1O3TA 1LVAA 1H0MA 2QUFA 4O3MA 1DPRA 2CQKA 5LHIA 3GFLA 3D5LA 1GXQA 1HSJA 1F1ZA 2EV0A 1IN6A 4S04A 4KNYA 4UV8A 5E1ZB 2IT0A 2ETHA 3EYIA 5E8GA 5DYMA 4I0BA 4PCQA 4BHPA 2F5CA 4KICA 3L7WA 3L9FA 4L9NA 1WI9A 1AWCA 2PJPA 5HDNA 4OINF 2XASA 1W5TA 3P7NA 2H27A 2OA4A 3E5XA 2DK8A 5CVRA 3TDUC 1VTNC 4HX4A 4M9SA 3C1DA 3GW2A 3BP8A 1W7PA 2E7XA 2XAFA 5AONA 2A3SA 3PQKA 4O5VA 5FB2A 1Y0UA 3NQOA 2HQNA 1EH7A 2K7LA 2QM3A 1Z1DA 3RPQA 3QU6A 1JHFA 3P9IA 1IXCA 1J7KA 2FMYA 1YW9A 1KQ9A 2QVOA 4L5JA 2DK5A 2XUBA 2Y75A 2FA5A 5F64A 1HXDA 1JE8A 3SHFA 5JR3A 1W7PB 2FNAA 2A6EF 2GA1A 4LLLA 2FE3A 4HBLA 1SD6A 2K27A 2KJCA 2XHKA 1U5TA 2M1BA 4GYIA 4U88A 5K5QA 3L2CA 1KGSA 2LDUA 3EQLF 2X4HA 2DQRA 2KRFA 3CO7C 2NNNA 5ICFA 4RAYA 5HS8A 2BEOA 3JSOA 2BE5F 5BS6A 5J6XA 3ZN1A 3BROA 2O03A 3T0YA 1FYLA 1QQIA 3U1DA 2QQBA 1U5TB 3F72A 3BOQA 1PDNC 1YYVA 4TV7A 5K5OA 5D5XB 2DQLA 1J75A 1IN7A 4EJOA 5FO5A 1F9NA 2DO7A 1R00A 1SMTA 2C6YA 1SD4A 3QPHA 3WTVC 5ILVA 4IHSA 3J80K 2FRHA 2YX7A 1I1SA 1TQMA 4G7HF 3KP3A 3JTGA 2P8TA 3WTWC 1XCBA 4EM2A 2HGCA 4KA4A 1YS7A 5DCFA 3WTYC 5F1RA 3E5UA 1KYZA 3FHZA 4RGRA 3M7GA 3WE3A 2MLKA 5HVQC 2PEXA 2V1DA 1Z9CA 3I4PA 1P4AA 2FNPA 4WX9A 2ZJ2A 2KIUA 1PUEE 1Z05A 1FSEA 2GIVA 3MZHA 2V6CA 3H3ZA 2W57A 3KE2A 4U7BA 4Q5SF 2FEZA 3GXOA 4KN7X 3K0LA 4WXHA 1STZA 5E20A 2LSOA 3LAJA 1IRGA 3M1EA 1MGTA 3ZMUA 4LB5A 2QLZA 5DCMA 2O61A 2YSRA 1O3RA 2DPDA 2VOOA 2M45A 1OYYA 1BBYA 1U8RA 3O6BB 2HDCA 1D8JA 3NEUA 1WWXA 1JXSA 2FMLA 2VT3A 2EFPA 4HA8A 2MH2A 2QBYA 2P4WA 1P92A 1J0RA 1SMYF 3WTXC 2RVCA 5H6RA 3FZVA 4N9IA 4ON0A 2VE8A 3V8KA 4L9JA 5DCMB 1S8NA 4ZH4F 1RUOA 3VODA 4G9YA 2AXLA 4UVAA 5E17F 2KIMA 1HW1A 4AIJA 3ABUA 1ZRFA 2YU3A 1XGSA 3ML6A 3EETA 2RN7A 3IRRA 2DAOA 2L3DA 2D1HA 3LSTA 3DV8A 4G94A 4L18B 3JTHA 4EGYA 2D1VA 4BQAA 2XAHA 1AOYA 2HYGD 1R1UA 2P5VA 3R0JA 4LFUA 1V4RA 1LDKB 1FYKA 1XMAA 2PMHA 3JAMK 1G6NA 1TQIA 2PI0A 2CO5A 4M74A 5IT9Z 4GGGA 2LF7A 1XMKA 1IZ1A 3WE2A 3CUQC 2DTRA 4BNCA 1KU7A 3Q9VA 4OIOF 2RV8A 1Q1HA 3DFGA 4OIQF 1O57A 1BJAA 5CYVA 5KK1A 3WU0A 1ZG1A 2Z5UA 4UVBA 5KVRA 1I6XA 2R3SA 1O3QA 2CYYA 2MBFA 2H94A 4O6JA 1V3FA 4H0EA 3WTZA 1S7OA 1HW5A 3SQNA 2EB7A 2BV6A 3S2WA 5FFZA 3T8RA 2HWVA 4EV0A 1X3UA 5L3EA 3IWZA 4MEXF 3FWEA 3K1MA 2CSOA 2MC3A 5BPIA 2CG4A 3LFKA 3IKTA 1ZAOA 2P7CB 3TKYA 4MHGA 4OIPF 3C7JA 2W85A 1FX7A 2M5WA 3DQVC 5FLXK 1YTYA 3FM3A 3FMRA 2GZWA 2LKPA 1FSHA 1R22A 5HDGA 2H09A 4KN4X 3KFWX 3CJNA 1FBUA 2B0LA 1H9TA 4UV9A 4L0ZB 1J9IA 3HYIA 4HLYA 4XRFA 2ZFWA 4P9UA 4HX8A 3F8MA 4F7ZA 3TO6A 5K5RA 1OR7A 1E2XA 3B73A 4ESJA 1G3YA 3K9TA 4EJTA 3BZ6A 1IXRC 2A5YB 1U5TC 2W84A 4Z2YA 3GX4X 3GZ5A 1O7LA 3R4KA 4KYWA 4RGXA 3K69A 4PGHA 2LNBA 5FD5A 2FSWA 1NHAA 1YLFA 5BOXA 2BYVE 4QWQA 3VEPA 1FC3A 1DDNA 1RZ4A 3H3UA 5HS9A 5LGTA 4YFKF 3U9GA 2A61A 3FMSA 2X0LA 5HLIA 1MJAA 3O2PE 1FBQA 4LMYA 4LG0A 2BGCA 3FXUA 4RB3C 3H92A 4WXCA 3AAFA 2EA2A 1ZARA 1XSXA 4A0ZA 1QBJA 4HQEA 4RAZA 1BI1A 2V1UA 1U78A 2IP2A 3K2ZA 3WGGA 3RDIA 1IUYA 3GUDA 4BXUA 1ULYA 5JVTA 1KU3A 4LG0B 2YPRA 4I98B 3GFJA 3FXRA 2OBPA 1K78B 3ZMTA 4I7HA 3V4GA 4HF2A 4KIGA 3BJ6A 3E6BA 3M8FA 2XKOA 1FY7A 3TOAA 4A5MA 1KQ8A 2HTSA 3MFKA 3HSRA 3MWMA 1YS6A 2JRTA 4OMZA 2VBZA 4R1HA 3GFMA 1T0FA 3CUQB 3LQQA 2VODA 4P9FA 3E97A 5ICCA 3WTTC 1ZYRF 3TDZC 3ROUA 3C18A 1FNNA 3IWFA 5DDGA 3E6MA 5JI6A 1ZRCA 3HIFA 1B59A 2EV6A 1TQPA 4I09A 1HW2A 3KP6A 1R23A 1B4AA 1FYMA 1QZYA 3QU3A 5BMZA 1HKQA 1ONVA 1Z91A 1FWZA 3ZMZA 2JPBA 1OKRA 5HOOA 1BOAA 1LB2A 2L01A 2IW5A 2V1XA 2P5KA 3BPVA 2BBYA 3J81Z 4B09A 4GYGA 4WF2A 2ZKZA 3BY6A 3ZMVA 4CHUA 1KYWA 3I58A 3IL2A 4HV5A 5LRSA 1J5YA 3SZTA 4RB0A 2NS0A 3KETA 3RI4A 3WGHA 2EFOA 3TO9A 3F8FA 2UZKA 5D8LB 2ESNA 2QQAA 3BWGA 1MDMA 3EUHA 5D6FA 3CTAA 4ENJA 1MZBA 3HRUA 1O7FA 2HTJA 2OQRA 2XAJA 2ZCWA 3EDPA 3ZP5A 1R1TA 2D2WA 4YFXF 3I71A 2EJRA 3TOBA 1K6OA 3GEZA 1S29A 2HS5A 4MTDA 4AVPA 2VBWA 2IPQX 3CUOA 1FP1D 1BM9A 2HQRA 4Q48A 1S7AA 1ZGJA 2J5OA 2UWMA 1OYIA 2Y48A 3GWZA 2CGPA 4CO8A 5F6FA 1RI7A 1ZN2A 1W7PD 2E1CA 4XLNF 3T5XA 3LWFA 5H6QA 1ZRDA 1I5ZA 1IXSB 2DI3A 5DD8A 1LQ1A 3F8BA 5D6EA 1LEBA 1E17A 1TTYA 3HRSA 5LGUA 1J59A 5AIQA 3DEUA 5A2QK 4KDPA 1YW7A 2STWA 4M73A 5L3CA 3KLNA 1USSA 2MD5A 2JT1A 1P4WA 3JW4A 3ECOA 1QNTA 4LLGF 5E18F 1G4DA 5L3BA 1EV7A 1YO5C 1HBXG 4G6QA 3IHUA 5HLGA 1Z6TA 3RTRA 1B9NA 3KLOA 2M87A 1T38A 5LGNA 4G7OF 4L9TA 3Q9SA 5CJ9A 1BC8C 2EFNA 5CVIA 3E3VA 2RNJA 2FU4A 2L54A 2VT2A 4MGRA 5D5VB 2UXNA 4Y15A 1BI2A 1G3TA 3WGIA 4ZZLA 2NNYA 4MQVA 1YW8A 4MEYF 1QO0D 4EM1A 4IJAA 1KU9A 3RYRA 4LLNA 2HKXA 4OOIA 3MEXA 2TDXA 4YG2F 1JGSA 1XGNA 2PQ8A 5ILUA 3LA3A 2VC1A 1RIOH 1WKMA 2WTEA 4IRHA 5JHUA 2IRFG 1SAXA 2VXZA 2F5EA 3R60A 2QBYB 4P5OA 1RNLA 1OPCA 2O3FA 2EK5A 1A04A 5J8CA 3WTUC 3ISPA 1K7AA 1ZLJA 2JTVA 3TQNA 3N4MA 3HHHA 5ERIA 1UFMA 1IN8A 4N0BA 1JHHA 3COAC 3T1BA 2XROA 2HYFA 2V79A 4GCVA 4BH9A 3MAJA 3RKXA 5LHHA 2DLLA 3G73A 4MTEA 2MH9A 3DF8A 4HDVA 4Y17A 1FT9A 4M9ZA 4HYEA 4EVIA 3FF5A 4ZYHA 1U3EM 1MD0A 1PP8F 3P9KA 1ZGAA 5ED4A 3DPLC 5DD4A 1LJ9A 1REPC 4KMFA 2O0YA 3W6JB 1G3WA 3F21A 5D8KB 4I2OA 2IA2A 2RQPA 1I1GA 1XB4A 3FXQA 1R58A 3WU1B 1SD7A 4WXDA 4AD9A 5HLHA 3WODF 4HF1A 4M9XA 1XCVA 1ZHFA 1T39A 3MZYA 3KZYA 2E1NA 4I02A 1SFXA 1RUNA 2G7HA 1TBXA 2JPCA 1TNTA 3OV8A 2A69F 3JSPA 3K1PA 3PFIA 4HOBA 4RS8A 1XSVA 4R79A 5ILSA 1P2FA 3V8LA 1GHCA 4DNCA 1MJ9A 3J80Z 2FQ3A 2VC0A 1IRFA 3QPTA 4YFNF 2ZO4A 1MJBA 2CFXA 2HEOA 2GXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXJ A;  2R7F A;  2FBH A;  3CO6 C;  3BJO A;  3HUG A;  4DQ2 A;  4AWX B;  4KFC A;  2O8X A;  4ZZD A;  3RJP A;  1FP2 A;  2F2E A;  1U2W A;  1T98 A;  2L4M A;  4IXA A;  1XN7 A;  4JQF A;  4HF0 A;  2FF4 A;  2P5L C;  3KP4 A;  1FBS A;  4P96 A;  3BPX A;  1S6L A;  5FFX A;  3ZQ7 A;  1ZH5 A;  2ZBK A;  5FD6 A;  3F8C A;  1YFH A;  4BYY A;  4A6D A;  2EFW A;  2K02 A;  2ESH A;  2Z9O A;  4LGW A;  1YG2 A;  3ZMD A;  3I5U A;  1LNW A;  3C3W A;  3U2R A;  1XDS A;  1Z6R A;  2GXB A;  3ERE D;  4MQ9 F;  4NB5 A;  3F6O A;  2OZU A;  2DU9 A;  1UB9 A;  3V8J A;  3GF2 A;  2A07 F;  3IC7 A;  2VE9 A;  4KIF A;  4FX0 A;  3FMQ A;  2H6B A;  5L3F A;  2OZ6 A;  4EJU A;  1QGP A;  4XSZ F;  5FGM A;  3BDD A;  3DXJ F;  1G3S A;  4RGS A;  4E70 A;  1FLI A;  4AIH A;  1XSD A;  1YIO A;  4MNU A;  5DUK A;  2GWR A;  2OD5 A;  3ULQ B;  3J7A O;  4LJZ F;  4A5N A;  2XKP A;  3SFZ A;  3HOT A;  4R8H A;  2HOE A;  3RPU A;  4XSX F;  2ISZ A;  4M71 A;  4CIC A;  5E1W A;  5D4S A;  1ON1 A;  4HAM A;  2VBX A;  2VBY A;  4CDG A;  1R5G A;  2Y0M A;  1P6R A;  2W24 A;  3KZZ A;  4CYD A;  2P6S A;  5L3D A;  5BQT A;  5TJJ A;  1LDD A;  3JAM Z;  3LAP A;  2K86 A;  3I54 A;  2ISY A;  1HKS A;  1TNS A;  4S05 A;  3QOP A;  4LD5 A;  4U0Y A;  4Q47 A;  3CLO A;  2NYX A;  5BPD A;  4L0Y B;  3NRV A;  4ZYD A;  2F5D A;  1P4X A;  5IT9 K;  4A0Y A;  4IHT A;  3MCZ A;  1FOK A;  2RKH A;  5IT3 A;  2CW0 F;  5DUI A;  3F8N A;  4I01 A;  2O6G E;  1BIB A;  2G7U A;  5LLQ A;  1BIA A;  3HRM A;  1R1V A;  3BJA A;  1XGM A;  2DT5 A;  3I0T A;  3ZN0 A;  4JBA A;  2P7V B;  3V7C A;  2STT A;  1Z7U A;  4M72 A;  3QP5 A;  2UXX A;  4NQW A;  3EYY A;  4B8X A;  2ADU A;  3DPT A;  5H20 A;  2FBI A;  1ZLK A;  1KA8 A;  3VOE A;  2RGV A;  3DP7 A;  4IF4 A;  2KIF A;  1IAW A;  4HV6 A;  1B1B A;  3RIR A;  2M8E A;  2GQQ A;  3WTS C;  1ON2 A;  4OMY A;  1SD5 A;  1WSU A;  5FLX Z;  2Z33 A;  3MQ0 A;  3PQJ A;  3VFZ A;  1IN4 A;  5D4R A;  1MDM B;  4UHT A;  1R5H A;  4RGU A;  4YIF A;  3FM5 A;  2GA2 A;  1WRJ A;  2IA0 A;  5D5U B;  3KCC A;  3R6S A;  3R0A A;  5K1Y A;  4UUV A;  2QZ8 A;  3M8E A;  3E6D A;  3ECH A;  1ODD A;  4L9V A;  1XDU A;  4I0A A;  1YQA A;  1IN5 A;  1TW3 A;  2PN6 A;  2EV5 A;  4LK0 F;  2ZNY A;  5DV5 A;  4ENN A;  3T8T A;  2EA4 A;  4KUM A;  4G7Z F;  4WK8 F;  2RC4 A;  3G3Z A;  4EJV A;  5LHG A;  2QQ9 A;  4Y13 A;  2KJB A;  3ELK A;  2HR3 A;  4EM0 B;  4HX7 A;  4EGZ A;  5HS7 A;  3OOP A;  2XRN A;  3F23 A;  4ESF A;  3VB2 A;  2Q2E A;  3KP7 A;  3F22 A;  4ZYG A;  1B6A A;  1SFE A;  2GAU A;  5CLS A;  2QYO A;  4WWC A;  2ZNZ A;  2WC2 A;  1DUX C;  1D5V A;  1BC7 C;  2ZME A;  3TO7 A;  2NRA C;  4NHJ A;  2ELH A;  5J8F A;  1J2X A;  4OIR F;  3GZ6 A;  2PG4 A;  5ICE A;  2DW4 A;  3HSE A;  3HTU A;  4U7D A;  1KU2 A;  3D0S A;  3HOS A;  5LEJ A;  2KKO A;  2ACJ A;  4AIK A;  5CVV A;  3O3K A;  4IVN A;  1GXP A;  2QWW A;  3ZMS A;  4P55 A;  2L4A A;  2MLG A;  1OMI A;  1UHM A;  2OU2 A;  2ZME B;  5EEH A;  4QLC U;  5TRD A;  3KEQ A;  4FHT A;  1ZG5 A;  3HSF A;  1T6S A;  2PMU A;  1S3J A;  4L5I A;  4ESB A;  2Q0O A;  2J5P A;  2AS5 F;  1B9M A;  4RB2 C;  1IW7 F;  5AIP A;  2OAZ A;  2Q8K A;  5LEK A;  2RDP A;  4ENK A;  2DFI A;  2HFH A;  2XAG A;  1TLH B;  4HZF A;  4FT8 A;  4A6E A;  1L0O C;  2MA3 A;  2XVC A;  3HHG A;  1W4M A;  1W5S A;  4A12 A;  1QZZ A;  2IVM A;  2PBI A;  1WQ2 A;  4GO1 A;  2CWE A;  3WG9 A;  4UXN A;  3KP5 A;  2IA1 A;  3REO A;  2EFQ A;  4XLP F;  2PFB A;  3I64 A;  5L3G A;  2G9W A;  4BHC A;  1LEA A;  4OU0 A;  2Z3Y A;  3GYH X;  2K4J A;  2D45 A;  4HDU A;  2A6H F;  2XAQ A;  4RB1 A;  1PP7 U;  5CVJ A;  3QAH A;  4EQQ A;  2DPU A;  1MKM A;  3L00 A;  4PDK A;  1FZP B;  3GVA A;  2P6T A;  4Q4Z F;  3IKV A;  3B02 A;  3DKW A;  3F3X A;  2FXA A;  4M6X A;  1DP7 P;  2XIG A;  2YX4 A;  3I53 A;  4YII A;  3Q5F A;  3KEO A;  2R7D A;  3P9C A;  5D5W B;  1HST A;  1U6G A;  4LK1 F;  5E1X A;  3J81 K;  2K4B A;  1HKT A;  3K1N A;  1ZG3 A;  3F6V A;  1C0W A;  2FBK A;  4ETS A;  4IRG A;  4PZJ A;  3GO5 A;  1OYW A;  1R7J A;  2HKO A;  4ZYE A;  3ZPL A;  3IRQ A;  1BI0 A;  2LF8 A;  5EEG A;  3V7S A;  2F5F A;  3RKW A;  2YR2 A;  1EH6 A;  1K79 A;  4CZZ A;  4WCG A;  5ICG A;  2OQG A;  3ABT A;  4K2E A;  4CGZ A;  4N9H A;  2M30 A;  3W6K B;  3QP6 A;  5LBQ A;  1EH8 A;  2V9V A;  2E7W A;  4A2U A;  2XGX A;  4JK1 X;  1UHW A;  5LRR A;  2H6C A;  5A2Q Z;  3TGN A;  1T2K A;  4BAY A;  4EJW A;  1UCR A;  4IPA A;  1F5T A;  2VOP A;  2EWN A;  2XV4 S;  3SXY A;  2A68 F;  1HQC A;  3RYP A;  2VN2 A;  3FX3 A;  1L3L A;  1CGP A;  1BN5 A;  4UNO A;  4U0V A;  4ENM A;  1CF7 A;  3N97 A;  5DEQ A;  1SFU A;  4LB6 B;  4BHB A;  2WWY A;  1QPM A;  2VON A;  4PGG A;  1BI3 A;  3CDH A;  1I27 A;  2COM A;  3SZP A;  1O3S A;  3GFI A;  2W25 A;  3HRT A;  3L09 A;  2JSC A;  2DBB A;  4FX4 A;  4KIB A;  3KP2 A;  1CF7 B;  1XD7 A;  3V7R A;  1K78 A;  2FOK A;  5HDK A;  3HTS B;  1XGO A;  3E6C C;  5E8I A;  4M6Y A;  1D3Y A;  2IJL A;  4G6D A;  4IRI A;  4U0W A;  1ZRE A;  1FPQ A;  4HLX A;  3I59 A;  3LA7 A;  2L02 A;  4HQM A;  4D0P A;  1LDJ A;  4EMS A;  4HW0 A;  3CUQ A;  2NAZ A;  4XBF A;  1DPU A;  4KMU X;  2PLY A;  4ASN A;  2JZY A;  4UVC A;  2WV0 A;  3E5Q A;  4GXO A;  1GVJ A;  6PAX A;  1UST A;  2Z99 A;  2QEN A;  5JFR A;  3LA2 A;  4G8X A;  3R61 A;  3GLX A;  1IF1 A;  1D8K A;  1KQ0 A;  5CVU A;  1H9G A;  4A0X A;  3RKY A;  1F4K A;  2HZT A;  1TW2 A;  3M9A A;  1R36 A;  3QRF F;  3I59 B;  3LQR A;  4CXF A;  4KT5 C;  1O3T A;  1LVA A;  1H0M A;  2QUF A;  4O3M A;  1DPR A;  2CQK A;  5LHI A;  3GFL A;  3D5L A;  1GXQ A;  1HSJ A;  1F1Z A;  2EV0 A;  1IN6 A;  4S04 A;  4KNY A;  4UV8 A;  5E1Z B;  2IT0 A;  2ETH A;  3EYI A;  5E8G A;  5DYM A;  4I0B A;  4PCQ A;  4BHP A;  2F5C A;  4KIC A;  3L7W A;  3L9F A;  4L9N A;  1WI9 A;  1AWC A;  2PJP A;  5HDN A;  4OIN F;  2XAS A;  1W5T A;  3P7N A;  2H27 A;  2OA4 A;  3E5X A;  2DK8 A;  5CVR A;  3TDU C;  1VTN C;  4HX4 A;  4M9S A;  3C1D A;  3GW2 A;  3BP8 A;  1W7P A;  2E7X A;  2XAF A;  5AON A;  2A3S A;  3PQK A;  4O5V A;  5FB2 A;  1Y0U A;  3NQO A;  2HQN A;  1EH7 A;  2K7L A;  2QM3 A;  1Z1D A;  3RPQ A;  3QU6 A;  1JHF A;  3P9I A;  1IXC A;  1J7K A;  2FMY A;  1YW9 A;  1KQ9 A;  2QVO A;  4L5J A;  2DK5 A;  2XUB A;  2Y75 A;  2FA5 A;  5F64 A;  1HXD A;  1JE8 A;  3SHF A;  5JR3 A;  1W7P B;  2FNA A;  2A6E F;  2GA1 A;  4LLL A;  2FE3 A;  4HBL A;  1SD6 A;  2K27 A;  2KJC A;  2XHK A;  1U5T A;  2M1B A;  4GYI A;  4U88 A;  5K5Q A;  3L2C A;  1KGS A;  2LDU A;  3EQL F;  2X4H A;  2DQR A;  2KRF A;  3CO7 C;  2NNN A;  5ICF A;  4RAY A;  5HS8 A;  2BEO A;  3JSO A;  2BE5 F;  5BS6 A;  5J6X A;  3ZN1 A;  3BRO A;  2O03 A;  3T0Y A;  1FYL A;  1QQI A;  3U1D A;  2QQB A;  1U5T B;  3F72 A;  3BOQ A;  1PDN C;  1YYV A;  4TV7 A;  5K5O A;  5D5X B;  2DQL A;  1J75 A;  1IN7 A;  4EJO A;  5FO5 A;  1F9N A;  2DO7 A;  1R00 A;  1SMT A;  2C6Y A;  1SD4 A;  3QPH A;  3WTV C;  5ILV A;  4IHS A;  3J80 K;  2FRH A;  2YX7 A;  1I1S A;  1TQM A;  4G7H F;  3KP3 A;  3JTG A;  2P8T A;  3WTW C;  1XCB A;  4EM2 A;  2HGC A;  4KA4 A;  1YS7 A;  5DCF A;  3WTY C;  5F1R A;  3E5U A;  1KYZ A;  3FHZ A;  4RGR A;  3M7G A;  3WE3 A;  2MLK A;  5HVQ C;  2PEX A;  2V1D A;  1Z9C A;  3I4P A;  1P4A A;  2FNP A;  4WX9 A;  2ZJ2 A;  2KIU A;  1PUE E;  1Z05 A;  1FSE A;  2GIV A;  3MZH A;  2V6C A;  3H3Z A;  2W57 A;  3KE2 A;  4U7B A;  4Q5S F;  2FEZ A;  3GXO A;  4KN7 X;  3K0L A;  4WXH A;  1STZ A;  5E20 A;  2LSO A;  3LAJ A;  1IRG A;  3M1E A;  1MGT A;  3ZMU A;  4LB5 A;  2QLZ A;  5DCM A;  2O61 A;  2YSR A;  1O3R A;  2DPD A;  2VOO A;  2M45 A;  1OYY A;  1BBY A;  1U8R A;  3O6B B;  2HDC A;  1D8J A;  3NEU A;  1WWX A;  1JXS A;  2FML A;  2VT3 A;  2EFP A;  4HA8 A;  2MH2 A;  2QBY A;  2P4W A;  1P92 A;  1J0R A;  1SMY F;  3WTX C;  2RVC A;  5H6R A;  3FZV A;  4N9I A;  4ON0 A;  2VE8 A;  3V8K A;  4L9J A;  5DCM B;  1S8N A;  4ZH4 F;  1RUO A;  3VOD A;  4G9Y A;  2AXL A;  4UVA A;  5E17 F;  2KIM A;  1HW1 A;  4AIJ A;  3ABU A;  1ZRF A;  2YU3 A;  1XGS A;  3ML6 A;  3EET A;  2RN7 A;  3IRR A;  2DAO A;  2L3D A;  2D1H A;  3LST A;  3DV8 A;  4G94 A;  4L18 B;  3JTH A;  4EGY A;  2D1V A;  4BQA A;  2XAH A;  1AOY A;  2HYG D;  1R1U A;  2P5V A;  3R0J A;  4LFU A;  1V4R A;  1LDK B;  1FYK A;  1XMA A;  2PMH A;  3JAM K;  1G6N A;  1TQI A;  2PI0 A;  2CO5 A;  4M74 A;  5IT9 Z;  4GGG A;  2LF7 A;  1XMK A;  1IZ1 A;  3WE2 A;  3CUQ C;  2DTR A;  4BNC A;  1KU7 A;  3Q9V A;  4OIO F;  2RV8 A;  1Q1H A;  3DFG A;  4OIQ F;  1O57 A;  1BJA A;  5CYV A;  5KK1 A;  3WU0 A;  1ZG1 A;  2Z5U A;  4UVB A;  5KVR A;  1I6X A;  2R3S A;  1O3Q A;  2CYY A;  2MBF A;  2H94 A;  4O6J A;  1V3F A;  4H0E A;  3WTZ A;  1S7O A;  1HW5 A;  3SQN A;  2EB7 A;  2BV6 A;  3S2W A;  5FFZ A;  3T8R A;  2HWV A;  4EV0 A;  1X3U A;  5L3E A;  3IWZ A;  4MEX F;  3FWE A;  3K1M A;  2CSO A;  2MC3 A;  5BPI A;  2CG4 A;  3LFK A;  3IKT A;  1ZAO A;  2P7C B;  3TKY A;  4MHG A;  4OIP F;  3C7J A;  2W85 A;  1FX7 A;  2M5W A;  3DQV C;  5FLX K;  1YTY A;  3FM3 A;  3FMR A;  2GZW A;  2LKP A;  1FSH A;  1R22 A;  5HDG A;  2H09 A;  4KN4 X;  3KFW X;  3CJN A;  1FBU A;  2B0L A;  1H9T A;  4UV9 A;  4L0Z B;  1J9I A;  3HYI A;  4HLY A;  4XRF A;  2ZFW A;  4P9U A;  4HX8 A;  3F8M A;  4F7Z A;  3TO6 A;  5K5R A;  1OR7 A;  1E2X A;  3B73 A;  4ESJ A;  1G3Y A;  3K9T A;  4EJT A;  3BZ6 A;  1IXR C;  2A5Y B;  1U5T C;  2W84 A;  4Z2Y A;  3GX4 X;  3GZ5 A;  1O7L A;  3R4K A;  4KYW A;  4RGX A;  3K69 A;  4PGH A;  2LNB A;  5FD5 A;  2FSW A;  1NHA A;  1YLF A;  5BOX A;  2BYV E;  4QWQ A;  3VEP A;  1FC3 A;  1DDN A;  1RZ4 A;  3H3U A;  5HS9 A;  5LGT A;  4YFK F;  3U9G A;  2A61 A;  3FMS A;  2X0L A;  5HLI A;  1MJA A;  3O2P E;  1FBQ A;  4LMY A;  4LG0 A;  2BGC A;  3FXU A;  4RB3 C;  3H92 A;  4WXC A;  3AAF A;  2EA2 A;  1ZAR A;  1XSX A;  4A0Z A;  1QBJ A;  4HQE A;  4RAZ A;  1BI1 A;  2V1U A;  1U78 A;  2IP2 A;  3K2Z A;  3WGG A;  3RDI A;  1IUY A;  3GUD A;  4BXU A;  1ULY A;  5JVT A;  1KU3 A;  4LG0 B;  2YPR A;  4I98 B;  3GFJ A;  3FXR A;  2OBP A;  1K78 B;  3ZMT A;  4I7H A;  3V4G A;  4HF2 A;  4KIG A;  3BJ6 A;  3E6B A;  3M8F A;  2XKO A;  1FY7 A;  3TOA A;  4A5M A;  1KQ8 A;  2HTS A;  3MFK A;  3HSR A;  3MWM A;  1YS6 A;  2JRT A;  4OMZ A;  2VBZ A;  4R1H A;  3GFM A;  1T0F A;  3CUQ B;  3LQQ A;  2VOD A;  4P9F A;  3E97 A;  5ICC A;  3WTT C;  1ZYR F;  3TDZ C;  3ROU A;  3C18 A;  1FNN A;  3IWF A;  5DDG A;  3E6M A;  5JI6 A;  1ZRC A;  3HIF A;  1B59 A;  2EV6 A;  1TQP A;  4I09 A;  1HW2 A;  3KP6 A;  1R23 A;  1B4A A;  1FYM A;  1QZY A;  3QU3 A;  5BMZ A;  1HKQ A;  1ONV A;  1Z91 A;  1FWZ A;  3ZMZ A;  2JPB A;  1OKR A;  5HOO A;  1BOA A;  1LB2 A;  2L01 A;  2IW5 A;  2V1X A;  2P5K A;  3BPV A;  2BBY A;  3J81 Z;  4B09 A;  4GYG A;  4WF2 A;  2ZKZ A;  3BY6 A;  3ZMV A;  4CHU A;  1KYW A;  3I58 A;  3IL2 A;  4HV5 A;  5LRS A;  1J5Y A;  3SZT A;  4RB0 A;  2NS0 A;  3KET A;  3RI4 A;  3WGH A;  2EFO A;  3TO9 A;  3F8F A;  2UZK A;  5D8L B;  2ESN A;  2QQA A;  3BWG A;  1MDM A;  3EUH A;  5D6F A;  3CTA A;  4ENJ A;  1MZB A;  3HRU A;  1O7F A;  2HTJ A;  2OQR A;  2XAJ A;  2ZCW A;  3EDP A;  3ZP5 A;  1R1T A;  2D2W A;  4YFX F;  3I71 A;  2EJR A;  3TOB A;  1K6O A;  3GEZ A;  1S29 A;  2HS5 A;  4MTD A;  4AVP A;  2VBW A;  2IPQ X;  3CUO A;  1FP1 D;  1BM9 A;  2HQR A;  4Q48 A;  1S7A A;  1ZGJ A;  2J5O A;  2UWM A;  1OYI A;  2Y48 A;  3GWZ A;  2CGP A;  4CO8 A;  5F6F A;  1RI7 A;  1ZN2 A;  1W7P D;  2E1C A;  4XLN F;  3T5X A;  3LWF A;  5H6Q A;  1ZRD A;  1I5Z A;  1IXS B;  2DI3 A;  5DD8 A;  1LQ1 A;  3F8B A;  5D6E A;  1LEB A;  1E17 A;  1TTY A;  3HRS A;  5LGU A;  1J59 A;  5AIQ A;  3DEU A;  5A2Q K;  4KDP A;  1YW7 A;  2STW A;  4M73 A;  5L3C A;  3KLN A;  1USS A;  2MD5 A;  2JT1 A;  1P4W A;  3JW4 A;  3ECO A;  1QNT A;  4LLG F;  5E18 F;  1G4D A;  5L3B A;  1EV7 A;  1YO5 C;  1HBX G;  4G6Q A;  3IHU A;  5HLG A;  1Z6T A;  3RTR A;  1B9N A;  3KLO A;  2M87 A;  1T38 A;  5LGN A;  4G7O F;  4L9T A;  3Q9S A;  5CJ9 A;  1BC8 C;  2EFN A;  5CVI A;  3E3V A;  2RNJ A;  2FU4 A;  2L54 A;  2VT2 A;  4MGR A;  5D5V B;  2UXN A;  4Y15 A;  1BI2 A;  1G3T A;  3WGI A;  4ZZL A;  2NNY A;  4MQV A;  1YW8 A;  4MEY F;  1QO0 D;  4EM1 A;  4IJA A;  1KU9 A;  3RYR A;  4LLN A;  2HKX A;  4OOI A;  3MEX A;  2TDX A;  4YG2 F;  1JGS A;  1XGN A;  2PQ8 A;  5ILU A;  3LA3 A;  2VC1 A;  1RIO H;  1WKM A;  2WTE A;  4IRH A;  5JHU A;  2IRF G;  1SAX A;  2VXZ A;  2F5E A;  3R60 A;  2QBY B;  4P5O A;  1RNL A;  1OPC A;  2O3F A;  2EK5 A;  1A04 A;  5J8C A;  3WTU C;  3ISP A;  1K7A A;  1ZLJ A;  2JTV A;  3TQN A;  3N4M A;  3HHH A;  5ERI A;  1UFM A;  1IN8 A;  4N0B A;  1JHH A;  3COA C;  3T1B A;  2XRO A;  2HYF A;  2V79 A;  4GCV A;  4BH9 A;  3MAJ A;  3RKX A;  5LHH A;  2DLL A;  3G73 A;  4MTE A;  2MH9 A;  3DF8 A;  4HDV A;  4Y17 A;  1FT9 A;  4M9Z A;  4HYE A;  4EVI A;  3FF5 A;  4ZYH A;  1U3E M;  1MD0 A;  1PP8 F;  3P9K A;  1ZGA A;  5ED4 A;  3DPL C;  5DD4 A;  1LJ9 A;  1REP C;  4KMF A;  2O0Y A;  3W6J B;  1G3W A;  3F21 A;  5D8K B;  4I2O A;  2IA2 A;  2RQP A;  1I1G A;  1XB4 A;  3FXQ A;  1R58 A;  3WU1 B;  1SD7 A;  4WXD A;  4AD9 A;  5HLH A;  3WOD F;  4HF1 A;  4M9X A;  1XCV A;  1ZHF A;  1T39 A;  3MZY A;  3KZY A;  2E1N A;  4I02 A;  1SFX A;  1RUN A;  2G7H A;  1TBX A;  2JPC A;  1TNT A;  3OV8 A;  2A69 F;  3JSP A;  3K1P A;  3PFI A;  4HOB A;  4RS8 A;  1XSV A;  4R79 A;  5ILS A;  1P2F A;  3V8L A;  1GHC A;  4DNC A;  1MJ9 A;  3J80 Z;  2FQ3 A;  2VC0 A;  1IRF A;  3QPT A;  4YFN F;  2ZO4 A;  1MJB A;  2CFX A;  2HEO A;  2GXG A; 
#chains in the Genus database with same CATH topology
 4A3E J;  1D0Y A;  2GIZ A;  1K4S A;  2D5V A;  1MH4 A;  2ZXJ A;  1YX3 A;  2R7F A;  2FBH A;  3CO6 C;  4BDZ A;  3ZQG A;  3BJO A;  3HUG A;  4DQ2 A;  4AWX B;  4IHY A;  2LR8 A;  4KFC A;  5GAH J;  2O8X A;  5F04 A;  3EUH C;  3WU2 C;  3RJP A;  1FP2 A;  4ZZD A;  2O7O A;  2F2E A;  3L2V A;  5M5X J;  1U2W A;  1ERD A;  1T98 A;  3VPR A;  2L4M A;  2DOA A;  4IXA A;  2OPT A;  1XN7 A;  3PNT A;  1JUS A;  4JQF A;  1ETW A;  4HF0 A;  2FF4 A;  4QPO A;  3GCM A;  4BGD A;  1K83 J;  2P5L C;  4XRS G;  5M3F J;  3KP4 A;  4HEA 2;  1FBS A;  4P96 A;  3WG7 H;  2M9H A;  3ABK H;  3BPX A;  3JRC A;  2VAS A;  1S6L A;  1MSF C;  1YJN I;  1WJ5 A;  1LFB A;  5FFX A;  3PL8 A;  3ZQ7 A;  1ZH5 A;  2ZBK A;  2DCE A;  3ZQF A;  3A03 A;  4MO7 A;  1KON A;  5FD6 A;  3F8C A;  1QPI A;  1YFH A;  3W2V A;  1MBG A;  5J1U A;  4BYY A;  4A6D A;  4HRI A;  3G1M A;  2K9Q A;  2EFW A;  2B7E A;  2LH9 A;  2K02 A;  2ESH A;  2PMZ N;  2Z9O A;  4LGW A;  1YG2 A;  1W0U A;  3ZMD A;  4F93 B;  4Z6Y A;  3I5U A;  2G0E A;  1WJF A;  3RZO J;  1M1E B;  4W1U A;  1UJ8 A;  3CC2 I;  5J4V A;  1LNW A;  3C3W A;  2HI3 A;  3U2R A;  1K6Y A;  2F4O B;  1XDS A;  2LRD A;  3ESW B;  3IP4 B;  1Z6R A;  4MFD A;  2DA5 A;  2GXB A;  1R71 A;  3ERE D;  1WJC A;  4MQ9 F;  4NB5 A;  3F6O A;  2OZU A;  2DU9 A;  2E36 A;  1UB9 A;  5TIS C;  3V8J A;  3GF2 A;  3HGG A;  5JLW A;  2A07 F;  1V55 H;  5C3E J;  4XIC A;  3IC7 A;  2ELJ A;  3J7Z I;  2TRT A;  2LFB A;  2VE9 A;  4KIF A;  2ME6 A;  1FIA A;  3BR0 A;  3ZXS A;  4FX0 A;  3FMQ A;  2Z1D A;  2H6B A;  5L3F A;  2OZ6 A;  4EJU A;  4E7H A;  3ABM H;  1MBF A;  1HCR A;  2HVS A;  1QGP A;  4BS9 A;  3CP2 A;  1PJR A;  4XSZ F;  5FGM A;  3BDD A;  3DXJ F;  1B72 A;  4DIQ A;  1G3S A;  2EZK A;  1ZTR A;  4RGS A;  4E70 A;  1FLI A;  2KMU A;  3F0C A;  5IOZ A;  4AIH A;  1XSD A;  1YIO A;  5FKO A;  3GTO J;  1DQU A;  3CCR I;  3GTP J;  4MNU A;  5DUK A;  2GWR A;  2OD5 A;  5J40 A;  3FXM A;  3ULQ B;  5B5E C;  3HOX J;  1JTY A;  3J7A O;  4LJZ F;  1WI3 A;  5EDN A;  2OTJ I;  4A5N A;  5EG0 A;  2XKP A;  3SFZ A;  3HOT A;  3FXO A;  4R8H A;  2HOE A;  3RPU A;  2CQQ A;  3S3N A;  4XSX F;  1ZR2 A;  2ISZ A;  1X3W B;  5F0F A;  3CCL I;  2R0Q C;  4E7I A;  4M71 A;  2L0K A;  2WAF A;  5E1W A;  4CIC A;  1Z7L A;  2WA0 A;  2GOM A;  5D4S A;  1ON1 A;  2CW7 A;  1B72 B;  1ENH A;  4HAM A;  2R5Y A;  1VFC A;  3JRH A;  2DT7 B;  5FKL A;  5FLV A;  1OCC H;  1T33 A;  2VBX A;  2VBY A;  4CDG A;  1YRN A;  4LIU A;  4BQO A;  1R5G A;  1DP3 A;  2MFZ A;  1POG A;  4IX7 A;  1JKQ C;  2Y0M A;  1P6R A;  1TWF J;  2W24 A;  3KZZ A;  4CYD A;  5EG0 B;  2ZC2 A;  2P6S A;  5L3D A;  5BQT A;  5TJJ A;  1LDD A;  3JAM Z;  3LAP A;  1X3Z B;  2K86 A;  5J1R A;  3I54 A;  1I50 J;  2ISY A;  2KIQ A;  5EYR A;  3PIO F;  3OYJ A;  3OYK A;  4E6K G;  1HKS A;  1TNS A;  4S05 A;  2QA4 I;  3QOP A;  4LD5 A;  4U0Y A;  4Q47 A;  2DOF A;  2R5Y B;  3CLO A;  2NYX A;  1HC8 A;  5BPD A;  4L0Y B;  3G1L A;  3NRV A;  2JA5 J;  2E60 A;  3HOZ J;  4ZYD A;  1YRN B;  3CJQ B;  2DTZ A;  2F5D A;  1P4X A;  5IT9 K;  1WVR A;  4A0Y A;  1X1C A;  2NVU B;  4DOZ A;  4IHT A;  3MCZ A;  1YIT I;  1FOK A;  2RKH A;  5IT3 A;  2CW0 F;  5DUI A;  3F8N A;  4I01 A;  3J7Y J;  3IUO A;  4DYQ A;  2O6G E;  1BIB A;  2G7U A;  3BQZ A;  5LLQ A;  1BIA A;  3HRM A;  1R1V A;  1VQ6 I;  5C4X J;  3BJA A;  2ZJP F;  3SJM A;  1XGM A;  4CZC A;  2DT5 A;  3AKZ A;  3I0T A;  1B8I B;  3ZN0 A;  3DBH B;  4JBA A;  3HOV J;  2P7V B;  1D1A A;  3K4L A;  3V7C A;  2STT A;  1Z7U A;  4M72 A;  2P81 A;  2W1O A;  2JA6 J;  2CS3 A;  3QP5 A;  3VYS B;  4A3M J;  3S2D J;  3H9Q A;  2DYS H;  3RPU D;  1Z77 A;  2UXX A;  4NQW A;  5M5Y J;  3EYY A;  4B8X A;  2ADU A;  3DPT A;  5H20 A;  2FBI A;  2ECC A;  1ZLK A;  2BXY A;  1KA8 A;  1EJ9 A;  3VOE A;  2RGV A;  3DP7 A;  4IF4 A;  2KIF A;  1IAW A;  2HDD A;  2WAE A;  4HV6 A;  1B1B A;  3RIR A;  2M8E A;  2GQQ A;  3WTS C;  1ON2 A;  2VJI A;  1MSE C;  1PUF A;  4OMY A;  2CRG A;  1MMN A;  1T08 B;  1SD5 A;  1WSU A;  5FLX Z;  2M7A A;  2Z33 A;  3MQ0 A;  2XGD A;  3G1O A;  3PQJ A;  3VFZ A;  1IN4 A;  5D4R A;  1MDM B;  4UHT A;  3O8G A;  4QPQ A;  3SDG A;  1W36 C;  2CV1 A;  1R5H A;  2OV7 A;  3EPZ A;  4RGU A;  4YIF A;  4N4N B;  1A5J A;  2X6O A;  2LG4 A;  2GA2 A;  3FM5 A;  3OR2 C;  1WRJ A;  2IA0 A;  5D5U B;  3A1Y A;  2HVQ A;  3KCC A;  3R0A A;  3R6S A;  4ANJ A;  5K1Y A;  4UUV A;  2QZ8 A;  5J1Y A;  3M8E A;  4F55 A;  1J09 A;  4B44 A;  3E6D A;  4BQN A;  3ECH A;  1ODD A;  4L9V A;  5EJC A;  2JN6 A;  2E5N A;  1XDU A;  1TWG J;  4I0A A;  1LFU P;  3OYA A;  1PUF B;  3OYL A;  1YQA A;  4AM3 A;  4XKB A;  1IDZ A;  2E5Z A;  2LD5 A;  1R4N B;  3I9V 2;  1IN5 A;  5DM6 F;  1OJL A;  1TW3 A;  2PN6 A;  3HKZ N;  5IYB J;  4PJM A;  2H8R A;  2R7T A;  3HM5 A;  2EV5 A;  2CJJ A;  4LK0 F;  2ZNY A;  2X9D A;  5DV5 A;  4IKF A;  2VJ5 A;  4ENN A;  3T8T A;  2EA4 A;  4PJN A;  1OCT C;  4BE2 A;  2R7W A;  2MC4 A;  4KUM A;  4G7Z F;  4WK8 F;  2RC4 A;  4B47 A;  3G3Z A;  4EJV A;  1UG0 A;  3GBG A;  5LHG A;  2QQ9 A;  3E1S A;  4Y13 A;  2WAD A;  3RQI A;  4KIS A;  1FMV A;  2KJB A;  3ELK A;  1IJW C;  2HR3 A;  4EM0 B;  4HX7 A;  2V9P A;  4EGZ A;  5HS7 A;  2LRE A;  3OOP A;  2AXT C;  2XRN A;  3F23 A;  2OJE D;  3CCQ I;  5HLT A;  2XGC A;  4OAY A;  1WHU A;  3QYB A;  3BZC A;  4ESF A;  3VB2 A;  2Q2E A;  4XRM A;  3KP7 A;  2ZFU A;  3CMA I;  3F22 A;  2XPW A;  4ZYG A;  1B6A A;  1SFE A;  2CQX A;  2GAU A;  2BW3 A;  5CLS A;  4IZZ A;  4C2U A;  2QYO A;  2XDV A;  4WWC A;  2ZNZ A;  2WC2 A;  1LKX A;  1DUX C;  1D5V A;  1BC7 C;  3JR9 A;  2ZME A;  3TO7 A;  3AFH A;  2KRH A;  2E2H J;  2NRA C;  2XSJ C;  1IC8 A;  4NHJ A;  2ELH A;  4FCY A;  2DOD A;  5GTI C;  5J8F A;  3VSL A;  3MKZ A;  1J2X A;  4PFO A;  4OIR F;  1Z0X A;  2UUZ A;  3GZ6 A;  3KYD B;  2PG4 A;  5ICE A;  3HC7 A;  2DW4 A;  3HSE A;  3HTU A;  3IH4 A;  2AO9 A;  4U7D A;  1KU2 A;  3D0S A;  3HOS A;  2BHZ A;  2M3A A;  3H5N A;  1T56 A;  3NWT A;  5LEJ A;  1VQ4 I;  2KKO A;  5KHD A;  4AIK A;  2ACJ A;  4AID A;  4QTR A;  4FQG A;  5CVV A;  3O3K A;  2CUE A;  3L2Q A;  4IVN A;  2B63 J;  1GXP A;  2QWW A;  3H9G A;  3ZMS A;  4P55 A;  2L4A A;  2MLG A;  1OMI A;  1UHM A;  1Y0N A;  2OU2 A;  2Y2Z A;  5FRN A;  2ZME B;  2LTP A;  4DBR A;  3DEE A;  4C9Y A;  5EEH A;  4CA0 A;  4QLC U;  5TRD A;  3OL3 A;  5EGO A;  3KEQ A;  4FHT A;  1ZG5 A;  3S17 J;  3OL4 A;  1X1P A;  3HSF A;  3QYF A;  2OC6 A;  3N05 A;  3JCU C;  3LSG A;  1T6S A;  2PMU A;  2HPI A;  1S3J A;  4L5I A;  4ESB A;  2Q0O A;  2J5P A;  2AS5 F;  1OCR H;  1PYV A;  4FE4 A;  2NS8 A;  1B9M A;  4RB2 C;  3DPU A;  2BZT A;  1IW7 F;  5AIP A;  1BR2 A;  2DMQ A;  2OAZ A;  2Q8K A;  1ITY A;  5LEK A;  2RDP A;  3TP3 A;  3FK6 A;  4BKX A;  4ENK A;  2KQR A;  2DFI A;  2HFH A;  1WH7 A;  4CUG A;  2WAQ N;  2XAG A;  2V4J C;  1TLH B;  4HZF A;  2R7Z J;  2IGN A;  1VZ0 A;  4FT8 A;  2L7Z A;  4A6E A;  5EGO B;  1L0O C;  3A4C A;  3CME I;  2MA3 A;  2HVR A;  2XVC A;  4XOR A;  5GPC A;  2CFO A;  5J4Y A;  3OY9 A;  1N78 A;  3AG4 H;  5FLM J;  3C2H A;  4LIV A;  3S15 J;  3HHG A;  1W4M A;  1RET A;  4X6A J;  4XON A;  5FKM A;  1W5S A;  4A12 A;  1QZZ A;  2IVM A;  2PBI A;  2KHM A;  1WQ2 A;  4GO1 A;  2CWE A;  2QSF X;  3WG9 A;  5IP6 A;  4UXN A;  2V1N A;  2IA1 A;  3KP5 A;  2JVG A;  3VDX A;  3M07 A;  3REO A;  3TW7 A;  2EFQ A;  4XLP F;  4BUP A;  2PFB A;  3I64 A;  2K40 A;  1LPQ A;  5L3G A;  2G9W A;  5EF6 A;  1WCM J;  4W97 A;  1NTC A;  2QSG X;  2H1L A;  4XK4 A;  1NK2 P;  4BHC A;  1LEA A;  4OU0 A;  2Y9Y A;  3I3L A;  3A01 A;  2Z3Y A;  3HG9 A;  2XF7 A;  1S72 I;  4E7Z A;  3GYH X;  2K4J A;  2D45 A;  4YEJ A;  4M3F A;  3ZQH A;  3MKW B;  2EIK H;  4HDU A;  2EIM H;  2A6H F;  2IGO A;  2XAQ A;  2YUS A;  3EUK L;  4RB1 A;  1JKO C;  1QHG A;  1PP7 U;  5CVJ A;  3LSK A;  3QAH A;  2JK3 A;  4XR6 A;  4EQQ A;  2DPU A;  1MKM A;  1QVU A;  2BHY A;  2N8G A;  2XB5 A;  3L00 A;  4PDK A;  1FZP B;  1LFP A;  4RAG A;  3GVA A;  3PM1 A;  2P6T A;  1F43 A;  1GUU A;  4Q4Z F;  3IKV A;  5IOY A;  3B02 A;  3DKW A;  3F3X A;  2RAE A;  2FXA A;  1IO2 A;  4M6X A;  1DP7 P;  2XIG A;  2IAI A;  2W4S A;  4NC6 A;  3L2U A;  2LKS A;  1MH3 A;  2V6E A;  2YX4 A;  1U9O A;  3FIS A;  3I53 A;  3BCB A;  1FOW A;  3FXL A;  3M4O J;  4YII A;  3Q5F A;  3KEO A;  3M1C A;  1OLT A;  2R7D A;  1JJ8 C;  3V42 A;  1G59 A;  3P9C A;  3BTL A;  1ETV A;  1HST A;  5D5W B;  1U6G A;  2KDZ A;  3H35 A;  3QOE A;  4NC7 A;  2LBF B;  4LK1 F;  2NVT J;  5E1X A;  1MNM C;  3J81 K;  2K4B A;  3HB9 A;  1HKT A;  3K1N A;  1ZG3 A;  2K3F A;  3F6V A;  5FKN A;  1C0W A;  2FBK A;  4ETS A;  4IRG A;  2K5C A;  3RCO A;  1YHQ I;  4PZJ A;  3GO5 A;  3Q3S A;  2BXZ A;  1A31 A;  1OYW A;  5E3L A;  1R7J A;  3CCM I;  3TBI A;  2HKO A;  4FTH A;  1BJZ A;  1ZK8 A;  5F08 A;  1MMA A;  1ZR4 A;  1JKR C;  3LSH A;  4FAS D;  3ZOB A;  4ZYE A;  3ZPL A;  3H0G J;  3IRQ A;  5GP9 A;  1P7J A;  2B9S A;  1BI0 A;  4F91 B;  2LF8 A;  4NBQ A;  3OYM A;  1Y39 A;  5EEG A;  3V7S A;  2DMT A;  3OS2 A;  2F5F A;  4C2T A;  3RKW A;  3G71 I;  1G2H A;  3JRG A;  1H88 C;  2YR2 A;  1EH6 A;  1K79 A;  3WHB A;  5F27 A;  2O8K A;  1OFC X;  1E3P A;  3OMY A;  1BOB A;  2JQ7 A;  4CZZ A;  4WCG A;  1V54 H;  5ICG A;  3ZGK A;  5IP7 J;  2OQG A;  3ABT A;  4K2E A;  2Y0S A;  4CGZ A;  3DTK A;  3MZ8 A;  4N9H A;  4N4O B;  4BL0 B;  2R7V A;  1XPX A;  2O9L A;  1RC9 A;  3ZR8 X;  2M30 A;  3W6K B;  3QP6 A;  1X4P A;  5LBQ A;  2NOG A;  1EH8 A;  2CUJ A;  1HDP A;  3Q0W A;  2V9V A;  2E7W A;  2I5U A;  4A2U A;  2XGX A;  4JK1 X;  2KT0 A;  1UHW A;  3BTJ A;  3QWL A;  5JHF A;  5LRR A;  5LD2 C;  1VQ7 I;  2DMU A;  5FJ8 J;  2LY1 A;  2ICW G;  2UV1 A;  2H6C A;  5A2Q Z;  2HOT A;  3TGN A;  1T2K A;  2XF5 A;  1OCO H;  3SDB A;  3M8J A;  4BAY A;  4EJW A;  3MMY B;  3HBL A;  3BR3 A;  2PMZ A;  1UCR A;  4IPA A;  4YEL A;  1F5T A;  2VOP A;  2EWN A;  2XV4 S;  4CCK A;  4FET A;  3SXY A;  5KAF C;  2X51 A;  2A68 F;  9ANT A;  1HQC A;  3RYP A;  2VN2 A;  3FX3 A;  1L3L A;  1CGP A;  1ACI A;  1BN5 A;  3RSN A;  1MW7 A;  2X6Y A;  4XKW A;  5B1B H;  1KZH A;  4UNO A;  2M2E A;  3TP0 A;  4U0V A;  4A3G J;  3KX2 A;  1GLN A;  1E3H A;  2YS9 A;  5HOD A;  4ENM A;  1CF7 A;  3LL7 A;  4BQQ A;  2DYR H;  4DJA A;  3N97 A;  5DEQ A;  2HZD A;  1QZE A;  3HUG B;  3LMM A;  1SFU A;  1UAA A;  2DFF A;  2WBM A;  4LB6 B;  4BHB A;  3HOW J;  2WWY A;  2VPL A;  2V9K A;  3GTQ J;  3GTL J;  2CW8 A;  2W00 A;  3IH2 A;  1QPM A;  2VON A;  2DJN A;  3SEQ A;  4BBR J;  3K6G A;  3EUA A;  4PGG A;  3G6E I;  1BI3 A;  3CDH A;  1I27 A;  1TWH J;  2COM A;  3SZP A;  1O3S A;  3GFI A;  2W25 A;  3HRT A;  3L09 A;  2JSC A;  4BE1 A;  3B6A A;  2Y30 A;  2DBB A;  1OCZ H;  4FX4 A;  3FK7 A;  4KIB A;  3KP2 A;  1CF7 B;  1XD7 A;  2X6W A;  3V7R A;  2FOK A;  2WB1 N;  4HNU A;  5HDK A;  1K78 A;  3HTS B;  2XC7 A;  1XGO A;  3E6C C;  5E8I A;  3L2R A;  2XPU A;  4M3G A;  3K4B A;  4M6Y A;  1D3Y A;  3CCE I;  1XTA A;  2OUM A;  2X1C A;  1EKE A;  2IJL A;  4B43 A;  4G6D A;  4IRI A;  4U0W A;  2E2J J;  1ZRE A;  3BG6 A;  1SAN A;  3CJT B;  1FPQ A;  3VYU B;  4HLX A;  3I59 A;  3LA7 A;  3S32 A;  2L02 A;  4HQM A;  2CQN A;  4D0P A;  1JTX A;  1LDJ A;  3FXJ A;  4EMS A;  4HW0 A;  3CUQ A;  2NAZ A;  4XBF A;  1DPU A;  2GM4 A;  4KMU X;  2PLY A;  2E34 A;  4ASN A;  2JZY A;  3NWS A;  4UVC A;  4B48 A;  2WV0 A;  2XPV A;  3E5Q A;  4GXO A;  1GVJ A;  1CQT A;  2JA8 J;  6PAX A;  1UST A;  2K9L A;  2Z99 A;  2QEN A;  2E1O A;  3S1R J;  5DTD A;  5JFR A;  3K2A A;  3LA2 A;  2DN0 A;  4G8X A;  3R61 A;  3GLX A;  1IF1 A;  2V26 A;  4D1Q A;  1D8K A;  1KQ0 A;  5CVU A;  1H9G A;  4A0X A;  2R5Z A;  4CCM A;  2V7F A;  2W7N A;  3PSI A;  3RKY A;  5B3S H;  1F4K A;  2HZT A;  2DMN A;  4F92 B;  1TW2 A;  2CU7 A;  3M9A A;  1R36 A;  1FIP A;  3QRF F;  3I59 B;  4IOA F;  2ZME C;  3LQR A;  4CXF A;  1F36 A;  4KT5 C;  3OOU A;  1MND A;  3CCV I;  1O3T A;  1LVA A;  1H0M A;  2QUF A;  4O3M A;  1DPR A;  2CQK A;  2JUG A;  5LHI A;  1MBK A;  4XL9 A;  3GFL A;  3D5L A;  2HU9 A;  1S5L C;  4G6T B;  4HPQ A;  2IGM A;  1MNE A;  1GXQ A;  2EIL H;  4ZDP A;  2MW8 A;  1TP4 A;  1HSJ A;  1F1Z A;  2EV0 A;  4CYC A;  3VYT B;  1U0J A;  3S3O A;  1IN6 A;  3O8H A;  3BQY A;  4S04 A;  2VQC A;  4KNY A;  1VQN I;  1VQ8 I;  4UV8 A;  3HPG A;  5E1Z B;  2IT0 A;  2BY0 A;  4E7S A;  2ETH A;  1VND A;  4KJZ A;  3EYI A;  5E8G A;  5DYM A;  4I0B A;  4PCQ A;  1XC5 A;  3BC8 A;  1ZKG A;  3HPH A;  3KYC B;  2F5C A;  1ZEL A;  4BHP A;  5IYC J;  4KIC A;  3TL4 X;  3L7W A;  3L9F A;  4L9N A;  1WI9 A;  1AWC A;  2PJP A;  1YJW I;  2DOE A;  5HDN A;  4OIN F;  1A6Q A;  2XAS A;  4MFE A;  1W5T A;  1XG1 A;  3GTJ J;  3P7N A;  2H27 A;  2OA4 A;  3E5X A;  4CYC B;  2DK8 A;  1R5I D;  3H3V K;  1IRZ A;  5CVR A;  2K9M A;  2DA3 A;  4XM3 A;  3TDU C;  1VTN C;  4BU2 A;  4HX4 A;  4M9S A;  3UR3 C;  2QCO A;  3C1D A;  3GW2 A;  3BP8 A;  3H9J A;  4AVZ A;  1W7P A;  2E7X A;  4V19 K;  4G12 A;  2XAF A;  3ZRG A;  1FTT A;  5AON A;  2A3S A;  3QPL A;  4A3J J;  3PQK A;  2GBY A;  3A0B C;  4O5V A;  3B6C A;  5FB2 A;  1Y0U A;  1I39 A;  3HGY A;  3NQO A;  2HQN A;  4AUX A;  1EH7 A;  2K7L A;  3FKJ A;  2QM3 A;  5J47 A;  1Z1D A;  3RPQ A;  4HNV A;  2QKM B;  2XRL A;  3QU6 A;  1JHF A;  3P9I A;  1IXC A;  1VQ5 I;  1J7K A;  3OSG A;  2FMY A;  4Y7N J;  1MIJ A;  1YW9 A;  1KQ9 A;  3CES A;  3DKY A;  4UB6 C;  2BY3 A;  1HOM A;  2QVO A;  4GRI A;  3RQ4 A;  4L5J A;  2DK5 A;  2XUB A;  2Y75 A;  2X1E A;  3AG2 H;  3ZQQ A;  2FA5 A;  5F64 A;  1HXD A;  1JE8 A;  2OCC H;  3SHF A;  5JR3 A;  3CQZ J;  1W7P B;  2FNA A;  2A6E F;  2GA1 A;  1IRX A;  4LLL A;  1R49 A;  2FE3 A;  4HBL A;  1SD6 A;  2K27 A;  2KJC A;  2XHK A;  1U5T A;  2NVQ J;  4LOC A;  3A0H C;  4UUS A;  2ZJR F;  2M1B A;  4GYI A;  5J3L A;  3HKZ A;  4U88 A;  3IV5 A;  5K5Q A;  2Y9Z A;  3L2C A;  1KGS A;  3C2G A;  2LDU A;  3CCS I;  3EQL F;  2HOA A;  2X4H A;  2JJ7 A;  2DQR A;  3QQA A;  4BY1 J;  3G2B A;  2KRF A;  3CO7 C;  4UY8 I;  4EAT A;  1A36 A;  2NNN A;  5ICF A;  4RAY A;  5HS8 A;  2BEO A;  3JSO A;  2BE5 F;  2AQF A;  4GDF A;  1IDY A;  5BS6 A;  2MG4 A;  2CV0 A;  4ITV A;  4C2M J;  5J6X A;  3ZN1 A;  3BRO A;  4NQW B;  2O03 A;  1AHD P;  3T0Y A;  1MBH A;  3D5R C;  3H1C A;  1FYL A;  2CUZ A;  1E3O C;  4J00 A;  4DW6 A;  3HJE A;  1QQI A;  3U1D A;  2IBD A;  2QQB A;  1U5T B;  4CH7 A;  2KLO A;  3BOQ A;  3F72 A;  4UUS B;  1PDN C;  1YYV A;  4TV7 A;  4A93 J;  5K5O A;  5D5X B;  3I4M J;  1QRY A;  2DQL A;  2LOO A;  2A5W A;  1Y6I A;  1J75 A;  4A69 C;  3TW6 A;  1IN7 A;  4EJO A;  2KPM A;  2VQL A;  5FO5 A;  1X1D A;  1F9N A;  2DO7 A;  1R00 A;  3PSF A;  1SMT A;  4B3X A;  3A02 A;  4D7M A;  4XRS A;  1SD4 A;  2C6Y A;  2KDO A;  3QPH A;  2A05 A;  3WTV C;  5ILV A;  1DU0 A;  2VIX A;  2F48 A;  3JRF A;  1VQK I;  4IHS A;  4XLE A;  3J80 K;  2FRH A;  1HDD C;  3K70 C;  2YX7 A;  1I1S A;  2IEK A;  1TQM A;  2JUC A;  4CSW A;  3OIP A;  4RMN A;  4IO9 F;  1LE8 A;  4IQ4 A;  1X19 A;  4G7H F;  2ZSH B;  3KP3 A;  3JTG A;  4C3J J;  2P8T A;  3L2W A;  3WTW C;  1XCB A;  3E7L A;  3SZG A;  4EM2 A;  2HGC A;  1I6H J;  4KA4 A;  1YS7 A;  3FBI B;  5DCF A;  3WTY C;  5F1R A;  3E5U A;  4QSH A;  3AG3 H;  1KYZ A;  1OQY A;  3FHZ A;  1SVL A;  4RGR A;  3U1K A;  3OYB A;  3K4N A;  1WZ2 A;  3M7G A;  2KZV A;  3WE3 A;  1VF9 A;  2MLK A;  5HVQ C;  2PEX A;  2H8W A;  2V1D A;  3CC4 I;  3LSR A;  3JRI A;  1JUM A;  2RNG A;  3I4P A;  1Z9C A;  4M3B A;  3BLY A;  2R4G A;  4BEH A;  1RR7 A;  3BT9 A;  2DA4 A;  4D5C A;  1P4A A;  2FNP A;  4RM3 A;  4WX9 A;  4M6V A;  2ZJ2 A;  2GXA A;  4PFP A;  2KIU A;  1Y8R B;  3HXL A;  5F0H A;  1PUE E;  3I56 I;  1MMD A;  1Z05 A;  2HXO A;  4JX4 A;  1FSE A;  2GIV A;  3MZH A;  2V6C A;  3BG3 A;  3H3Z A;  4DBQ A;  3OS1 A;  2W57 A;  4A3F J;  3S8P A;  1APL C;  3KE2 A;  2DDB A;  4U7B A;  4Q5S F;  1SEU A;  2FEZ A;  1Z21 A;  3GXO A;  4II3 A;  1XMX A;  2Q2E B;  4KN7 X;  2L7K A;  4PJ0 C;  3W3C A;  3K0L A;  4WXH A;  4UB8 C;  2VPR A;  1D1C A;  2BW3 B;  3H0D A;  1STZ A;  2ZSI B;  5E20 A;  2LSO A;  4KT6 A;  4BEH B;  3LAJ A;  1RRJ A;  1IRG A;  3M1E A;  1UHS A;  4BE0 A;  1MGT A;  2MGQ A;  3ZMU A;  1T8I A;  2QLZ A;  5DCM A;  4LB5 A;  2O61 A;  4XKC A;  2YSR A;  4V2F A;  1SC7 A;  1O3R A;  2DPD A;  2VOO A;  4XNF A;  2M45 A;  1OYY A;  4IHX A;  3PNY A;  2LLK A;  2ME0 A;  1BBY A;  1U8R A;  3O6B B;  4RA2 A;  3BTI A;  2HDC A;  1D8J A;  3NEU A;  3OYD A;  2WY7 Q;  1WWX A;  1JXS A;  2FML A;  2VT3 A;  2EFP A;  4HA8 A;  4X1E A;  4B1R A;  2MH2 A;  4Y33 A;  3SYT A;  2QBY A;  2P4W A;  1P92 A;  1VQ9 I;  1J0R A;  1SMY F;  3WTX C;  2RVC A;  1X1A A;  4LIT A;  5H6R A;  3FZV A;  4N9I A;  4OWR B;  4ON0 A;  2VE8 A;  3V8K A;  4L9J A;  5DCM B;  1S8N A;  4ZH4 F;  1RUO A;  3VOD A;  4G9Y A;  2AXL A;  2EZH A;  4XOP A;  1T95 A;  1I3Q J;  1GDT A;  2DA2 A;  1W1W E;  5CKT A;  3SFI A;  3ABL H;  4XMY A;  2COB A;  4UVA A;  5E17 F;  2KIM A;  5K7Z A;  1HW1 A;  4AC0 A;  4AIJ A;  1RPW A;  2VB6 A;  3ABU A;  1ZRF A;  2YU3 A;  1WH5 A;  1XGS A;  3ML6 A;  3GZN B;  3EET A;  2RN7 A;  5FRM A;  2KP6 A;  3IRR A;  3HOU J;  2DAO A;  3LSM A;  1NG6 A;  2L3D A;  2D1H A;  3LST A;  3DV8 A;  4G94 A;  4JX6 A;  4II2 A;  4DZP A;  4L18 B;  3CF2 A;  1Z3X A;  3JTH A;  4EGY A;  2D1V A;  2HYJ A;  2XAH A;  4BQA A;  1AOY A;  5C4J J;  3AG1 H;  2W82 A;  2HYG D;  4U87 A;  2EZI A;  1JI8 A;  2A6T A;  2PJR A;  1R1U A;  3H36 A;  2P5V A;  3BR2 A;  3CMM A;  4BJ6 C;  3R0J A;  4LFU A;  2K3P A;  4PSW A;  2TCT A;  1V4R A;  2I8D A;  4S0H B;  1MBE A;  2XSD C;  1LDK B;  1FYK A;  1XMA A;  2PMH A;  3JAM K;  2VJJ A;  2JRM A;  1G6N A;  1TQI A;  2EH3 A;  2CO5 A;  2PI0 A;  4M74 A;  5IT9 Z;  4GGG A;  3TMO A;  2LF7 A;  1FJL A;  1XMK A;  1IZ1 A;  3WE2 A;  1OIS A;  1HF0 A;  2F5V A;  2CUF A;  3CUQ C;  2DTR A;  4BNC A;  3ZQL A;  2IS4 A;  3S1N J;  1K4T A;  3G4S I;  3OYI A;  5B66 C;  1KU7 A;  3A01 B;  1D1B A;  3D5S C;  4E4H A;  3Q9V A;  4I6Z A;  3BTC A;  3RZD J;  1WJA A;  4OIO F;  3OSF A;  2RV8 A;  1Q1H A;  3JRA A;  4B3A A;  3DFG A;  4OIQ F;  1YIJ I;  1O57 A;  1BJA A;  2IXS A;  5CYV A;  4BJ5 C;  5LFA A;  5KK1 A;  2DFE A;  4HSR A;  3WU0 A;  1ZG1 A;  1JJ6 C;  2Z5U A;  4UVB A;  5KVR A;  3FIW A;  4I99 C;  1I6X A;  2R3S A;  1O3Q A;  2CYY A;  1K61 A;  2MBF A;  4DGW B;  2H94 A;  4AYB A;  1I3A A;  4O6J A;  2L9R A;  1V3F A;  5EZG A;  3L1P A;  4H0E A;  3WTZ A;  1S7O A;  1Y1W J;  2LMD A;  3FHN A;  1JKP C;  2R92 J;  3H5A A;  4GFB A;  1HW5 A;  3SQN A;  2QSH X;  4RLF A;  1AKH A;  2EB7 A;  2R7U A;  2BV6 A;  2MSY A;  3BCA A;  3DU6 A;  4A3D J;  3S2W A;  1S9H A;  2GOX B;  5FFZ A;  2JA2 A;  1WJB A;  1N75 A;  3T8R A;  2KIS A;  3ASO H;  2HWV A;  2CQ7 A;  1BW6 A;  4NDL A;  4EV0 A;  4A3C J;  4RM2 A;  3CDL A;  1X3U A;  5L3E A;  3IWZ A;  4MEX F;  3FWE A;  3K1M A;  2CSO A;  2MC3 A;  2R7R A;  2K85 A;  5BPI A;  2CG4 A;  1HLV A;  3BG9 A;  2NVY J;  3HEF A;  3LFK A;  3IKT A;  1ZAO A;  2P7C B;  3TKY A;  4MHG A;  5FKK A;  4OIP F;  3C7J A;  4L5E A;  2W85 A;  1FX7 A;  2E1M B;  2M5W A;  3OYN A;  2HQA A;  3DQV C;  4BJT A;  3BR6 A;  5FLX K;  2LVS A;  1YTY A;  1QHH D;  1WPK A;  3S2H J;  2R7Q A;  3FM3 A;  1AKH B;  3FMR A;  1V5G A;  4H4K C;  2HQ5 A;  4MLO A;  1ETX A;  2DA1 A;  2GZW A;  5GPA A;  2LKP A;  1FSH A;  3HL2 A;  1R22 A;  4AU7 A;  2LYC A;  5HDG A;  2BOL A;  2H09 A;  3MN2 A;  4KN4 X;  3KFW X;  3LFU A;  3CJN A;  1G8X A;  1FBU A;  2B0L A;  1H9T A;  4UV9 A;  2JMW A;  4L0Z B;  1J9I A;  3HYI A;  1DGR M;  4HLY A;  4XRF A;  2ZFW A;  1RR8 C;  1FOX A;  1BA5 A;  2XAU A;  2QKL B;  4P9U A;  2FUG 2;  4HX8 A;  2RRE A;  3OYE A;  1QA6 A;  3F8M A;  4F7Z A;  3TO6 A;  2VKV A;  5K5R A;  1OR7 A;  1E2X A;  2GLO A;  3JRB A;  3B73 A;  4ESJ A;  2QQ8 A;  2FOW A;  1G3Y A;  2QGU A;  3K9T A;  4EJT A;  1QVT A;  2WB1 A;  3K70 D;  3BZ6 A;  1IXR C;  2A5Y B;  1VQP I;  2HNH A;  1U5T C;  2W84 A;  4Z2Y A;  3GX4 X;  2NOJ B;  3GZ5 A;  1O7L A;  3R4K A;  1H8A C;  3ZQC A;  2FQ4 A;  2LC2 A;  4RGX A;  3K69 A;  4PGH A;  2LNB A;  5FD5 A;  3KIO A;  5E3M A;  3IH3 A;  2FSW A;  2MYS A;  2Y0S N;  3HZJ A;  2ZB9 A;  3CCY A;  3K4K A;  1GV5 A;  1NHA A;  3W6V A;  1YLF A;  5BOX A;  2BYV E;  4QWQ A;  3VEP A;  1FC3 A;  1DDN A;  1RZ4 A;  1SAU A;  3H3U A;  5HS9 A;  5LGT A;  3S16 J;  4YFK F;  1IG7 A;  1EA3 A;  3U9G A;  2A61 A;  2IS1 A;  3FMS A;  4BY7 J;  2X0L A;  5HLI A;  5C44 J;  2MAB A;  1MJA A;  3O2P E;  1FBQ A;  4LMY A;  1IGN A;  3PJR A;  1V5E A;  2QF7 A;  4LG0 A;  4ZDO A;  1FOY A;  2BGC A;  1BL0 A;  4CCJ A;  3FXU A;  2VJ4 A;  4RB3 C;  4PJJ A;  2R7O A;  3H92 A;  4WXC A;  3AAF A;  1TL8 A;  4RLQ A;  2EA2 A;  1R6R A;  4XLA A;  1ZAR A;  1XSX A;  4A0Z A;  1QBJ A;  1R9T J;  4HQE A;  1IUF A;  4RAZ A;  1BI1 A;  1TWA J;  2HXI A;  2V1U A;  5KAI C;  2E71 A;  3GLL A;  2M0M A;  3OR1 C;  4HG2 A;  1U78 A;  5JLX A;  3S93 A;  2IP2 A;  3K2Z A;  2L2O A;  2DT6 A;  3WGG A;  3NAR A;  3RDI A;  4KYW A;  2ZXW H;  1IUY A;  3GUD A;  4BXU A;  1ULY A;  5JVT A;  1ORK A;  1KU3 A;  4LG0 B;  2YPR A;  2VLA A;  1Q1V A;  5B1A H;  4BXF A;  2LK2 A;  5TGT A;  4I98 B;  3GFJ A;  3FXR A;  1GV2 A;  2OBP A;  2AQE A;  1K78 B;  2F4M B;  3ZMT A;  4I7H A;  3V4G A;  4HF2 A;  3KPH A;  1JT6 A;  3C2B A;  1UG2 A;  2CMP A;  2YU9 J;  4KIG A;  3BJ6 A;  3E6B A;  3M8F A;  2XKO A;  1HA8 A;  4HST A;  1FY7 A;  3TOA A;  1NK3 P;  4A3K J;  4A5M A;  2L9N A;  3CF5 F;  1KQ8 A;  2JVH A;  2HTS A;  2E19 A;  3MFK A;  3HSR A;  3MWM A;  5CQE A;  1YS6 A;  2JRT A;  1YE9 A;  4OMZ A;  2HOS A;  3W2W A;  2VBZ A;  4R1H A;  3GFM A;  4EEF G;  1T0F A;  3CUQ B;  3P5J A;  3LQQ A;  2VOD A;  4P9F A;  5M5W J;  2OF7 A;  4M3D A;  1PVE A;  3E97 A;  5ICC A;  3BR5 A;  2R7S A;  4OAZ A;  2MD0 A;  3KZI C;  3WTT C;  3M3Y J;  1S7E A;  4HNT A;  1ZYR F;  3LOC A;  3ZQI A;  3TDZ C;  4YIR X;  3ROU A;  3C18 A;  3CZ6 A;  1FNN A;  3E0J B;  2R5Z B;  1YOV B;  3IAS 2;  3IWF A;  3MKL A;  4MIM A;  1X2M A;  5DDG A;  2QEX I;  2XB0 X;  3E6M A;  4DZJ A;  2R93 J;  5JI6 A;  1ETK A;  4A3B J;  1ZRC A;  3OYC A;  3HIF A;  5H2F C;  1B59 A;  3CDI A;  1VQM I;  3DLL F;  4X0G A;  2EV6 A;  1TQP A;  2FX0 A;  4I09 A;  1SVO A;  1HW2 A;  5E3O A;  3KP6 A;  5K7H A;  2DMP A;  2CV2 A;  1R23 A;  3OYF A;  1B4A A;  3CJR B;  1FYM A;  1QZY A;  2XF6 A;  3I55 I;  1UEL B;  3QU3 A;  5BMZ A;  2L7F P;  4PK4 A;  4XQF A;  1HKQ A;  2FD5 A;  4A3L J;  1ONV A;  2DDA A;  4XLC A;  1Z91 A;  1FWZ A;  1TZL A;  2KRC A;  2M0C A;  3ZMZ A;  3QYE A;  2JPB A;  1YX5 A;  2E2I J;  1B8I A;  1OKR A;  3K10 A;  5HOO A;  1BOA A;  1LB2 A;  2L01 A;  2IW5 A;  1VQO I;  2V1X A;  4NUB A;  2W48 A;  3CCU I;  2LY2 A;  2P5K A;  2X48 A;  3BPV A;  2EIN H;  2BBY A;  3FXK A;  4XN3 A;  4ZC3 A;  4J19 A;  3J81 Z;  4B09 A;  3VWB A;  4GYG A;  1GVD A;  4WF2 A;  5K7F A;  2ZKZ A;  3BY6 A;  3ZMV A;  4CHU A;  1X58 A;  1KYW A;  3I58 A;  4D5F A;  2VQH A;  3PUB A;  3IL2 A;  4HV5 A;  3Q0U A;  2K9N A;  5LRS A;  1J5Y A;  3HOY J;  3K7A J;  5KCM A;  3SZT A;  4RB0 A;  2NS0 A;  4F52 A;  3KET A;  3RI4 A;  3WGH A;  3GTG J;  2EFO A;  1MMS A;  3W2A A;  2BY1 A;  3TO9 A;  3F8F A;  1Z67 A;  2UZK A;  5D8L B;  2ESN A;  3PNV A;  2QQA A;  2Y31 A;  3QOD A;  3BWG A;  1MDM A;  3EUH A;  4QIW N;  5D6F A;  1MBJ A;  3BG5 A;  4E7K A;  1SVM A;  3CTA A;  4XID A;  2X1D A;  1MZB A;  3BR1 A;  3DWL E;  3CCJ I;  1Y56 A;  4I76 A;  3K4C A;  4ENJ A;  3S1M J;  1ETY A;  3HRU A;  3LSI A;  3SEZ A;  1Y8Q B;  1O7F A;  2HTJ A;  2M4K A;  2OQR A;  2IGK A;  2XAJ A;  2KZG A;  2ZCW A;  4RAF A;  3EDP A;  1NG7 A;  3ZP5 A;  1XX5 A;  1R1T A;  2D2W A;  3LSJ A;  4E7J A;  4YFX F;  2I10 A;  3K4J A;  4IHW A;  2EPF A;  3I71 A;  3NAU A;  2VI6 A;  2EJR A;  3TOB A;  1K6O A;  3ERM A;  3GEZ A;  2ID6 A;  1RES A;  1S29 A;  2VKE A;  3JRD A;  1WGX A;  2HS5 A;  5IYD J;  4MTD A;  4RDU A;  1D0X A;  4AVP A;  1YJ9 I;  2VBW A;  3QPS A;  1P7I A;  2NVX J;  2IPQ X;  3CUO A;  1FP1 D;  1BM9 A;  1VI0 A;  2HQR A;  1S7A A;  1ZGJ A;  2J5O A;  4Q48 A;  3VSK A;  2UWM A;  1OYI A;  2Y48 A;  3GWZ A;  3AL0 C;  4KIT B;  1Y1V J;  2Z16 A;  2CGP A;  4CO8 A;  5F6F A;  5HNH A;  3DBL B;  5F0C A;  5GAD J;  2KL4 A;  1RI7 A;  1A6I A;  1W7P D;  1ZN2 A;  2E1C A;  4XLN F;  3T5X A;  3MD2 A;  3LWF A;  5H6Q A;  4RBO A;  4IOC F;  2EBI A;  1ZRD A;  3JRE A;  1I5Z A;  1N25 A;  1IXS B;  1U9N A;  4JYK A;  2DI3 A;  1JUP A;  3OYH A;  1H89 C;  3DBR B;  5DD8 A;  1LQ1 A;  4D7N A;  3F8B A;  1YI2 I;  4Y3O A;  5D6E A;  1LEB A;  1E17 A;  1TTY A;  3HRS A;  5LGU A;  1J59 A;  2EQR A;  3ONQ A;  2E1M C;  2DA6 A;  5AIQ A;  3DEU A;  1JGG A;  5A2Q K;  2ZXI A;  4KDP A;  3DTI A;  2RQQ A;  1YW7 A;  2STW A;  4M3E A;  3GME A;  3PO3 J;  4M73 A;  3DKX A;  5L3C A;  3KLN A;  1USS A;  2MD5 A;  5CQG A;  4ZTF A;  2AHQ A;  3S14 J;  2IS2 A;  2VKD A;  5GTH C;  2JT1 A;  1ZGW A;  1X2N A;  2L9V A;  5FRO A;  4P1W A;  1P4W A;  3FDY A;  3JW4 A;  4PSX A;  3ECO A;  1QNT A;  4JX5 A;  4LLG F;  5E18 F;  3KEY A;  1G4D A;  4JP0 A;  2HPM A;  4V2G A;  5M3M J;  4F3Q A;  2H1K A;  5L3B A;  3FBN B;  1WFX A;  5IPA A;  1EV7 A;  1X1B A;  4YRV A;  1YO5 C;  1LE8 B;  3MKY B;  4BAC A;  1HBX G;  1GT0 C;  1QU3 A;  4G6Q A;  2OCE A;  3IHU A;  4UUT A;  4E7L A;  5HLG A;  1Z6T A;  4ZYA A;  3RTR A;  3PIP F;  1B9N A;  2M34 A;  1WJE A;  3S3M A;  1IV8 A;  4ZDL A;  2VUM J;  1V5F A;  3KLO A;  2M87 A;  1T38 A;  3DLA A;  4DYR A;  5LGN A;  1BW5 A;  4G7O F;  2WAQ A;  4L9T A;  3Q9S A;  5CJ9 A;  1BC8 C;  4C3H J;  5BNG A;  3OWT A;  2EFN A;  5CVI A;  5EZH A;  3GTM J;  4CCO A;  3E3V A;  2RNJ A;  2FU4 A;  3MVP A;  2L54 A;  5EEA A;  2VT2 A;  4MGR A;  5D5V B;  2UXN A;  4XOT A;  4Y15 A;  1BI2 A;  1G3T A;  3WGI A;  3CD6 I;  4ZZL A;  2WY8 Q;  3BZK A;  2NNY A;  2F6C A;  3CMY A;  2DA7 A;  2E35 A;  1JT0 A;  3I4N J;  2VKH A;  2ZXH A;  4MQV A;  5GAG J;  4IL6 C;  1YW8 A;  4MEY F;  3OS0 A;  1QO0 D;  4EM1 A;  5HNF A;  5JVG F;  4IJA A;  1KU9 A;  1AU7 A;  1RKW A;  3GTK J;  3CLQ A;  1OR7 C;  3RYR A;  4NNJ A;  4LLN A;  2HKX A;  4Y52 J;  2VXD A;  5F1J A;  3H5R A;  1SFO J;  4BBS J;  4OOI A;  4XLF A;  3CC7 I;  1P9Q C;  3ASN H;  3MEX A;  2L9S A;  4IQJ A;  5DS9 A;  4ZJZ A;  2TDX A;  4YG2 F;  1JGS A;  2Q1Z B;  1XGN A;  2PQ8 A;  5ILU A;  3LA3 A;  1A35 A;  4BXX J;  1DU6 A;  1UZC A;  5IP9 J;  1D5Y A;  2BVM A;  2ECB A;  3ZCO A;  2Y69 H;  1W5C C;  2VC1 A;  1RIO H;  1WKM A;  2WTE A;  1W0T A;  2DFH A;  3OIO A;  1X4O A;  2WV1 A;  4DYC A;  2FJ1 A;  2JWT A;  3PUF A;  4IRH A;  5JHU A;  2NXN B;  5GAE J;  2CH0 A;  2IRF G;  3PO2 J;  1SAX A;  1SFK A;  5CPR B;  2VXZ A;  1TT0 A;  2F5E A;  3R60 A;  1ETO A;  3K4M A;  2QBY B;  4P5O A;  4FE7 A;  2VQG A;  1RNL A;  1OPC A;  2DJI A;  2O3F A;  2EK5 A;  2JA7 J;  2M4G A;  1A04 A;  1AA7 A;  5J8C A;  3WTU C;  3CP8 A;  3HDD A;  3ISP A;  2BVL A;  1K7A A;  5E3N A;  1MMG A;  2Z2S B;  1ZLJ A;  2JTV A;  2EIJ H;  4CCL A;  3TQN A;  3N4M A;  3HHH A;  5ERI A;  1UFM A;  1IN8 A;  3U21 A;  4N0B A;  1JHH A;  2M7B A;  2IS6 A;  3COA C;  2XGE A;  3DU5 A;  4XN0 A;  3T1B A;  4C30 A;  3TED A;  2L7M P;  2XRO A;  2HYF A;  2V79 A;  4GCV A;  4BH9 A;  2ZJQ F;  1EF4 A;  4PUS A;  1ETQ A;  4Y4R A;  2O5R A;  3MAJ A;  3RKX A;  5LHH A;  2DLL A;  2ID3 A;  3KYL A;  1IV6 A;  2HDW A;  2LY9 A;  3BG7 A;  2JSP A;  3OYG A;  1ZQ3 P;  3G73 A;  4MTE A;  2MH9 A;  3Q0V A;  2LBF A;  3DF8 A;  4HDV A;  2LKX A;  4LG3 A;  4Y17 A;  5IY5 H;  1FT9 A;  2OTL I;  3DTE A;  2X6X A;  4M9Z A;  3X2Q H;  2EZL A;  2DXI A;  3VYR B;  4HYE A;  4EVI A;  2PJR B;  1LVK A;  4JOM A;  3FF5 A;  4ZYH A;  1U3E M;  1MD0 A;  2P0W A;  1XS9 A;  1U8B A;  1UMQ A;  4C3I J;  1WJD A;  3DEW A;  3LNQ A;  2L5Q A;  2VL8 A;  1PP8 F;  4BDY A;  1Z3Y A;  1BR1 A;  3A2K A;  4IHV A;  3P9K A;  4NC8 A;  4CCN A;  1ZGA A;  3S1Q J;  1T0F C;  5ED4 A;  3IAM 2;  3DPL C;  5DD4 A;  3LSP A;  1LJ9 A;  4A3I J;  3UNG C;  3OIQ A;  1OCP A;  2NS7 A;  2PX9 A;  1TC3 C;  3AL0 B;  1REP C;  4KMF A;  1R4M B;  1TT5 B;  1BR4 A;  2R7X A;  2O0Y A;  3F9K A;  1VQL I;  3W6J B;  4D9J A;  1G3W A;  3F21 A;  5D8K B;  3UKG A;  4I2O A;  2IA2 A;  3D1N I;  5KNL A;  3DCF A;  2RQP A;  1I1G A;  1XB4 A;  3FXQ A;  3J7A Y;  2M8G X;  1R58 A;  2BY2 A;  1FEX A;  3WU1 B;  1SD7 A;  2F4I A;  4WXD A;  4AD9 A;  4IEJ A;  3WOD F;  5HLH A;  1D0Z A;  4HF1 A;  4M9X A;  2ELK A;  1FMW A;  1XCV A;  1ZHF A;  1E0E A;  1O4X A;  1T39 A;  3MZY A;  3KZY A;  3PFY A;  5E79 C;  2E1N A;  4I02 A;  1SFX A;  1RUN A;  2LP0 A;  2G7H A;  4PJL A;  1TBX A;  1LUJ B;  2JPC A;  1TNT A;  3OV8 A;  1DGW Y;  2KFD A;  2A69 F;  3RKQ A;  1RKT A;  3FKI J;  3JSP A;  1TWC J;  4FIS A;  3K1P A;  1FTZ A;  1W36 D;  5DM7 F;  3PFI A;  4ZTJ A;  4HOB A;  4J01 A;  4RS8 A;  1XSV A;  4AYB N;  4R79 A;  5ILS A;  1P2F A;  1N77 A;  3V8L A;  2X85 A;  4XLH A;  1GHC A;  4DNC A;  1MJ9 A;  3J80 Z;  2FQ3 A;  1NH3 A;  2VC0 A;  4XKV A;  1IRF A;  3QPT A;  4YFN F;  2ZO4 A;  1MJB A;  4B4C A;  2K9S A;  2CFX A;  3WHC A;  2HEO A;  2GXG A;  4ABZ A; 
#chains in the Genus database with same CATH homology
 2ZXJ A;  2R7F A;  2FBH A;  3CO6 C;  3BJO A;  3HUG A;  4DQ2 A;  4AWX B;  4KFC A;  2O8X A;  4ZZD A;  3RJP A;  1FP2 A;  2F2E A;  1U2W A;  1T98 A;  2L4M A;  4IXA A;  1XN7 A;  4JQF A;  4HF0 A;  2FF4 A;  2P5L C;  3KP4 A;  1FBS A;  4P96 A;  3BPX A;  1S6L A;  5FFX A;  3ZQ7 A;  1ZH5 A;  2ZBK A;  5FD6 A;  3F8C A;  1YFH A;  4BYY A;  4A6D A;  2EFW A;  2K02 A;  2ESH A;  2Z9O A;  4LGW A;  1YG2 A;  3ZMD A;  3I5U A;  1LNW A;  3C3W A;  3U2R A;  1XDS A;  1Z6R A;  2GXB A;  3ERE D;  4MQ9 F;  4NB5 A;  3F6O A;  2OZU A;  2DU9 A;  1UB9 A;  3V8J A;  3GF2 A;  2A07 F;  3IC7 A;  2VE9 A;  4KIF A;  4FX0 A;  3FMQ A;  2H6B A;  5L3F A;  2OZ6 A;  4EJU A;  1QGP A;  4XSZ F;  5FGM A;  3BDD A;  3DXJ F;  1G3S A;  4RGS A;  4E70 A;  1FLI A;  4AIH A;  1XSD A;  1YIO A;  4MNU A;  5DUK A;  2GWR A;  2OD5 A;  3ULQ B;  3J7A O;  4LJZ F;  4A5N A;  2XKP A;  3SFZ A;  3HOT A;  4R8H A;  2HOE A;  3RPU A;  4XSX F;  2ISZ A;  4M71 A;  4CIC A;  5E1W A;  5D4S A;  1ON1 A;  4HAM A;  2VBX A;  2VBY A;  4CDG A;  1R5G A;  2Y0M A;  1P6R A;  2W24 A;  3KZZ A;  4CYD A;  2P6S A;  5L3D A;  5BQT A;  5TJJ A;  1LDD A;  3JAM Z;  3LAP A;  2K86 A;  3I54 A;  2ISY A;  1HKS A;  1TNS A;  4S05 A;  3QOP A;  4LD5 A;  4U0Y A;  4Q47 A;  3CLO A;  2NYX A;  5BPD A;  4L0Y B;  3NRV A;  4ZYD A;  2F5D A;  1P4X A;  5IT9 K;  4A0Y A;  4IHT A;  3MCZ A;  1FOK A;  2RKH A;  5IT3 A;  2CW0 F;  5DUI A;  3F8N A;  4I01 A;  2O6G E;  1BIB A;  2G7U A;  5LLQ A;  1BIA A;  3HRM A;  1R1V A;  3BJA A;  1XGM A;  2DT5 A;  3I0T A;  3ZN0 A;  4JBA A;  2P7V B;  3V7C A;  2STT A;  1Z7U A;  4M72 A;  3QP5 A;  2UXX A;  4NQW A;  3EYY A;  4B8X A;  2ADU A;  3DPT A;  5H20 A;  2FBI A;  1ZLK A;  1KA8 A;  3VOE A;  2RGV A;  3DP7 A;  4IF4 A;  2KIF A;  1IAW A;  4HV6 A;  1B1B A;  3RIR A;  2M8E A;  2GQQ A;  3WTS C;  1ON2 A;  4OMY A;  1SD5 A;  1WSU A;  5FLX Z;  2Z33 A;  3MQ0 A;  3PQJ A;  3VFZ A;  1IN4 A;  5D4R A;  1MDM B;  4UHT A;  1R5H A;  4RGU A;  4YIF A;  3FM5 A;  2GA2 A;  1WRJ A;  2IA0 A;  5D5U B;  3KCC A;  3R6S A;  3R0A A;  5K1Y A;  4UUV A;  2QZ8 A;  3M8E A;  3E6D A;  3ECH A;  1ODD A;  4L9V A;  1XDU A;  4I0A A;  1YQA A;  1IN5 A;  1TW3 A;  2PN6 A;  2EV5 A;  4LK0 F;  2ZNY A;  5DV5 A;  4ENN A;  3T8T A;  2EA4 A;  4KUM A;  4G7Z F;  4WK8 F;  2RC4 A;  3G3Z A;  4EJV A;  5LHG A;  2QQ9 A;  4Y13 A;  2KJB A;  3ELK A;  2HR3 A;  4EM0 B;  4HX7 A;  4EGZ A;  5HS7 A;  3OOP A;  2XRN A;  3F23 A;  4ESF A;  3VB2 A;  2Q2E A;  3KP7 A;  3F22 A;  4ZYG A;  1B6A A;  1SFE A;  2GAU A;  5CLS A;  2QYO A;  4WWC A;  2ZNZ A;  2WC2 A;  1DUX C;  1D5V A;  1BC7 C;  2ZME A;  3TO7 A;  2NRA C;  4NHJ A;  2ELH A;  5J8F A;  1J2X A;  4OIR F;  3GZ6 A;  2PG4 A;  5ICE A;  2DW4 A;  3HSE A;  3HTU A;  4U7D A;  1KU2 A;  3D0S A;  3HOS A;  5LEJ A;  2KKO A;  2ACJ A;  4AIK A;  5CVV A;  3O3K A;  4IVN A;  1GXP A;  2QWW A;  3ZMS A;  4P55 A;  2L4A A;  2MLG A;  1OMI A;  1UHM A;  2OU2 A;  2ZME B;  5EEH A;  4QLC U;  5TRD A;  3KEQ A;  4FHT A;  1ZG5 A;  3HSF A;  1T6S A;  2PMU A;  1S3J A;  4L5I A;  4ESB A;  2Q0O A;  2J5P A;  2AS5 F;  1B9M A;  4RB2 C;  1IW7 F;  5AIP A;  2OAZ A;  2Q8K A;  5LEK A;  2RDP A;  4ENK A;  2DFI A;  2HFH A;  2XAG A;  1TLH B;  4HZF A;  4FT8 A;  4A6E A;  1L0O C;  2MA3 A;  2XVC A;  3HHG A;  1W4M A;  1W5S A;  4A12 A;  1QZZ A;  2IVM A;  2PBI A;  1WQ2 A;  4GO1 A;  2CWE A;  3WG9 A;  4UXN A;  3KP5 A;  2IA1 A;  3REO A;  2EFQ A;  4XLP F;  2PFB A;  3I64 A;  5L3G A;  2G9W A;  4BHC A;  1LEA A;  4OU0 A;  2Z3Y A;  3GYH X;  2K4J A;  2D45 A;  4HDU A;  2A6H F;  2XAQ A;  4RB1 A;  1PP7 U;  5CVJ A;  3QAH A;  4EQQ A;  2DPU A;  1MKM A;  3L00 A;  4PDK A;  1FZP B;  3GVA A;  2P6T A;  4Q4Z F;  3IKV A;  3B02 A;  3DKW A;  3F3X A;  2FXA A;  4M6X A;  1DP7 P;  2XIG A;  2YX4 A;  3I53 A;  4YII A;  3Q5F A;  3KEO A;  2R7D A;  3P9C A;  5D5W B;  1HST A;  1U6G A;  4LK1 F;  5E1X A;  3J81 K;  2K4B A;  1HKT A;  3K1N A;  1ZG3 A;  3F6V A;  1C0W A;  2FBK A;  4ETS A;  4IRG A;  4PZJ A;  3GO5 A;  1OYW A;  1R7J A;  2HKO A;  4ZYE A;  3ZPL A;  3IRQ A;  1BI0 A;  2LF8 A;  5EEG A;  3V7S A;  2F5F A;  3RKW A;  2YR2 A;  1EH6 A;  1K79 A;  4CZZ A;  4WCG A;  5ICG A;  2OQG A;  3ABT A;  4K2E A;  4CGZ A;  4N9H A;  2M30 A;  3W6K B;  3QP6 A;  5LBQ A;  1EH8 A;  2V9V A;  2E7W A;  4A2U A;  2XGX A;  4JK1 X;  1UHW A;  5LRR A;  2H6C A;  5A2Q Z;  3TGN A;  1T2K A;  4BAY A;  4EJW A;  1UCR A;  4IPA A;  1F5T A;  2VOP A;  2EWN A;  2XV4 S;  3SXY A;  2A68 F;  1HQC A;  3RYP A;  2VN2 A;  3FX3 A;  1L3L A;  1CGP A;  1BN5 A;  4UNO A;  4U0V A;  4ENM A;  1CF7 A;  3N97 A;  5DEQ A;  1SFU A;  4LB6 B;  4BHB A;  2WWY A;  1QPM A;  2VON A;  4PGG A;  1BI3 A;  3CDH A;  1I27 A;  2COM A;  3SZP A;  1O3S A;  3GFI A;  2W25 A;  3HRT A;  3L09 A;  2JSC A;  2DBB A;  4FX4 A;  4KIB A;  3KP2 A;  1CF7 B;  1XD7 A;  3V7R A;  1K78 A;  2FOK A;  5HDK A;  3HTS B;  1XGO A;  3E6C C;  5E8I A;  4M6Y A;  1D3Y A;  2IJL A;  4G6D A;  4IRI A;  4U0W A;  1ZRE A;  1FPQ A;  4HLX A;  3I59 A;  3LA7 A;  2L02 A;  4HQM A;  4D0P A;  1LDJ A;  4EMS A;  4HW0 A;  3CUQ A;  2NAZ A;  4XBF A;  1DPU A;  4KMU X;  2PLY A;  4ASN A;  2JZY A;  4UVC A;  2WV0 A;  3E5Q A;  4GXO A;  1GVJ A;  6PAX A;  1UST A;  2Z99 A;  2QEN A;  5JFR A;  3LA2 A;  4G8X A;  3R61 A;  3GLX A;  1IF1 A;  1D8K A;  1KQ0 A;  5CVU A;  1H9G A;  4A0X A;  3RKY A;  1F4K A;  2HZT A;  1TW2 A;  3M9A A;  1R36 A;  3QRF F;  3I59 B;  3LQR A;  4CXF A;  4KT5 C;  1O3T A;  1LVA A;  1H0M A;  2QUF A;  4O3M A;  1DPR A;  2CQK A;  5LHI A;  3GFL A;  3D5L A;  1GXQ A;  1HSJ A;  1F1Z A;  2EV0 A;  1IN6 A;  4S04 A;  4KNY A;  4UV8 A;  5E1Z B;  2IT0 A;  2ETH A;  3EYI A;  5E8G A;  5DYM A;  4I0B A;  4PCQ A;  4BHP A;  2F5C A;  4KIC A;  3L7W A;  3L9F A;  4L9N A;  1WI9 A;  1AWC A;  2PJP A;  5HDN A;  4OIN F;  2XAS A;  1W5T A;  3P7N A;  2H27 A;  2OA4 A;  3E5X A;  2DK8 A;  5CVR A;  3TDU C;  1VTN C;  4HX4 A;  4M9S A;  3C1D A;  3GW2 A;  3BP8 A;  1W7P A;  2E7X A;  2XAF A;  5AON A;  2A3S A;  3PQK A;  4O5V A;  5FB2 A;  1Y0U A;  3NQO A;  2HQN A;  1EH7 A;  2K7L A;  2QM3 A;  1Z1D A;  3RPQ A;  3QU6 A;  1JHF A;  3P9I A;  1IXC A;  1J7K A;  2FMY A;  1YW9 A;  1KQ9 A;  2QVO A;  4L5J A;  2DK5 A;  2XUB A;  2Y75 A;  2FA5 A;  5F64 A;  1HXD A;  1JE8 A;  3SHF A;  5JR3 A;  1W7P B;  2FNA A;  2A6E F;  2GA1 A;  4LLL A;  2FE3 A;  4HBL A;  1SD6 A;  2K27 A;  2KJC A;  2XHK A;  1U5T A;  2M1B A;  4GYI A;  4U88 A;  5K5Q A;  3L2C A;  1KGS A;  2LDU A;  3EQL F;  2X4H A;  2DQR A;  2KRF A;  3CO7 C;  2NNN A;  5ICF A;  4RAY A;  5HS8 A;  2BEO A;  3JSO A;  2BE5 F;  5BS6 A;  5J6X A;  3ZN1 A;  3BRO A;  2O03 A;  3T0Y A;  1FYL A;  1QQI A;  3U1D A;  2QQB A;  1U5T B;  3F72 A;  3BOQ A;  1PDN C;  1YYV A;  4TV7 A;  5K5O A;  5D5X B;  2DQL A;  1J75 A;  1IN7 A;  4EJO A;  5FO5 A;  1F9N A;  2DO7 A;  1R00 A;  1SMT A;  2C6Y A;  1SD4 A;  3QPH A;  3WTV C;  5ILV A;  4IHS A;  3J80 K;  2FRH A;  2YX7 A;  1I1S A;  1TQM A;  4G7H F;  3KP3 A;  3JTG A;  2P8T A;  3WTW C;  1XCB A;  4EM2 A;  2HGC A;  4KA4 A;  1YS7 A;  5DCF A;  3WTY C;  5F1R A;  3E5U A;  1KYZ A;  3FHZ A;  4RGR A;  3M7G A;  3WE3 A;  2MLK A;  5HVQ C;  2PEX A;  2V1D A;  1Z9C A;  3I4P A;  1P4A A;  2FNP A;  4WX9 A;  2ZJ2 A;  2KIU A;  1PUE E;  1Z05 A;  1FSE A;  2GIV A;  3MZH A;  2V6C A;  3H3Z A;  2W57 A;  3KE2 A;  4U7B A;  4Q5S F;  2FEZ A;  3GXO A;  4KN7 X;  3K0L A;  4WXH A;  1STZ A;  5E20 A;  2LSO A;  3LAJ A;  1IRG A;  3M1E A;  1MGT A;  3ZMU A;  4LB5 A;  2QLZ A;  5DCM A;  2O61 A;  2YSR A;  1O3R A;  2DPD A;  2VOO A;  2M45 A;  1OYY A;  1BBY A;  1U8R A;  3O6B B;  2HDC A;  1D8J A;  3NEU A;  1WWX A;  1JXS A;  2FML A;  2VT3 A;  2EFP A;  4HA8 A;  2MH2 A;  2QBY A;  2P4W A;  1P92 A;  1J0R A;  1SMY F;  3WTX C;  2RVC A;  5H6R A;  3FZV A;  4N9I A;  4ON0 A;  2VE8 A;  3V8K A;  4L9J A;  5DCM B;  1S8N A;  4ZH4 F;  1RUO A;  3VOD A;  4G9Y A;  2AXL A;  4UVA A;  5E17 F;  2KIM A;  1HW1 A;  4AIJ A;  3ABU A;  1ZRF A;  2YU3 A;  1XGS A;  3ML6 A;  3EET A;  2RN7 A;  3IRR A;  2DAO A;  2L3D A;  2D1H A;  3LST A;  3DV8 A;  4G94 A;  4L18 B;  3JTH A;  4EGY A;  2D1V A;  4BQA A;  2XAH A;  1AOY A;  2HYG D;  1R1U A;  2P5V A;  3R0J A;  4LFU A;  1V4R A;  1LDK B;  1FYK A;  1XMA A;  2PMH A;  3JAM K;  1G6N A;  1TQI A;  2PI0 A;  2CO5 A;  4M74 A;  5IT9 Z;  4GGG A;  2LF7 A;  1XMK A;  1IZ1 A;  3WE2 A;  3CUQ C;  2DTR A;  4BNC A;  1KU7 A;  3Q9V A;  4OIO F;  2RV8 A;  1Q1H A;  3DFG A;  4OIQ F;  1O57 A;  1BJA A;  5CYV A;  5KK1 A;  3WU0 A;  1ZG1 A;  2Z5U A;  4UVB A;  5KVR A;  1I6X A;  2R3S A;  1O3Q A;  2CYY A;  2MBF A;  2H94 A;  4O6J A;  1V3F A;  4H0E A;  3WTZ A;  1S7O A;  1HW5 A;  3SQN A;  2EB7 A;  2BV6 A;  3S2W A;  5FFZ A;  3T8R A;  2HWV A;  4EV0 A;  1X3U A;  5L3E A;  3IWZ A;  4MEX F;  3FWE A;  3K1M A;  2CSO A;  2MC3 A;  5BPI A;  2CG4 A;  3LFK A;  3IKT A;  1ZAO A;  2P7C B;  3TKY A;  4MHG A;  4OIP F;  3C7J A;  2W85 A;  1FX7 A;  2M5W A;  3DQV C;  5FLX K;  1YTY A;  3FM3 A;  3FMR A;  2GZW A;  2LKP A;  1FSH A;  1R22 A;  5HDG A;  2H09 A;  4KN4 X;  3KFW X;  3CJN A;  1FBU A;  2B0L A;  1H9T A;  4UV9 A;  4L0Z B;  1J9I A;  3HYI A;  4HLY A;  4XRF A;  2ZFW A;  4P9U A;  4HX8 A;  3F8M A;  4F7Z A;  3TO6 A;  5K5R A;  1OR7 A;  1E2X A;  3B73 A;  4ESJ A;  1G3Y A;  3K9T A;  4EJT A;  3BZ6 A;  1IXR C;  2A5Y B;  1U5T C;  2W84 A;  4Z2Y A;  3GX4 X;  3GZ5 A;  1O7L A;  3R4K A;  4KYW A;  4RGX A;  3K69 A;  4PGH A;  2LNB A;  5FD5 A;  2FSW A;  1NHA A;  1YLF A;  5BOX A;  2BYV E;  4QWQ A;  3VEP A;  1FC3 A;  1DDN A;  1RZ4 A;  3H3U A;  5HS9 A;  5LGT A;  4YFK F;  3U9G A;  2A61 A;  3FMS A;  2X0L A;  5HLI A;  1MJA A;  3O2P E;  1FBQ A;  4LMY A;  4LG0 A;  2BGC A;  3FXU A;  4RB3 C;  3H92 A;  4WXC A;  3AAF A;  2EA2 A;  1ZAR A;  1XSX A;  4A0Z A;  1QBJ A;  4HQE A;  4RAZ A;  1BI1 A;  2V1U A;  1U78 A;  2IP2 A;  3K2Z A;  3WGG A;  3RDI A;  1IUY A;  3GUD A;  4BXU A;  1ULY A;  5JVT A;  1KU3 A;  4LG0 B;  2YPR A;  4I98 B;  3GFJ A;  3FXR A;  2OBP A;  1K78 B;  3ZMT A;  4I7H A;  3V4G A;  4HF2 A;  4KIG A;  3BJ6 A;  3E6B A;  3M8F A;  2XKO A;  1FY7 A;  3TOA A;  4A5M A;  1KQ8 A;  2HTS A;  3MFK A;  3HSR A;  3MWM A;  1YS6 A;  2JRT A;  4OMZ A;  2VBZ A;  4R1H A;  3GFM A;  1T0F A;  3CUQ B;  3LQQ A;  2VOD A;  4P9F A;  3E97 A;  5ICC A;  3WTT C;  1ZYR F;  3TDZ C;  3ROU A;  3C18 A;  1FNN A;  3IWF A;  5DDG A;  3E6M A;  5JI6 A;  1ZRC A;  3HIF A;  1B59 A;  2EV6 A;  1TQP A;  4I09 A;  1HW2 A;  3KP6 A;  1R23 A;  1B4A A;  1FYM A;  1QZY A;  3QU3 A;  5BMZ A;  1HKQ A;  1ONV A;  1Z91 A;  1FWZ A;  3ZMZ A;  2JPB A;  1OKR A;  5HOO A;  1BOA A;  1LB2 A;  2L01 A;  2IW5 A;  2V1X A;  2P5K A;  3BPV A;  2BBY A;  3J81 Z;  4B09 A;  4GYG A;  4WF2 A;  2ZKZ A;  3BY6 A;  3ZMV A;  4CHU A;  1KYW A;  3I58 A;  3IL2 A;  4HV5 A;  5LRS A;  1J5Y A;  3SZT A;  4RB0 A;  2NS0 A;  3KET A;  3RI4 A;  3WGH A;  2EFO A;  3TO9 A;  3F8F A;  2UZK A;  5D8L B;  2ESN A;  2QQA A;  3BWG A;  1MDM A;  3EUH A;  5D6F A;  3CTA A;  4ENJ A;  1MZB A;  3HRU A;  1O7F A;  2HTJ A;  2OQR A;  2XAJ A;  2ZCW A;  3EDP A;  3ZP5 A;  1R1T A;  2D2W A;  4YFX F;  3I71 A;  2EJR A;  3TOB A;  1K6O A;  3GEZ A;  1S29 A;  2HS5 A;  4MTD A;  4AVP A;  2VBW A;  2IPQ X;  3CUO A;  1FP1 D;  1BM9 A;  2HQR A;  4Q48 A;  1S7A A;  1ZGJ A;  2J5O A;  2UWM A;  1OYI A;  2Y48 A;  3GWZ A;  2CGP A;  4CO8 A;  5F6F A;  1RI7 A;  1ZN2 A;  1W7P D;  2E1C A;  4XLN F;  3T5X A;  3LWF A;  5H6Q A;  1ZRD A;  1I5Z A;  1IXS B;  2DI3 A;  5DD8 A;  1LQ1 A;  3F8B A;  5D6E A;  1LEB A;  1E17 A;  1TTY A;  3HRS A;  5LGU A;  1J59 A;  5AIQ A;  3DEU A;  5A2Q K;  4KDP A;  1YW7 A;  2STW A;  4M73 A;  5L3C A;  3KLN A;  1USS A;  2MD5 A;  2JT1 A;  1P4W A;  3JW4 A;  3ECO A;  1QNT A;  4LLG F;  5E18 F;  1G4D A;  5L3B A;  1EV7 A;  1YO5 C;  1HBX G;  4G6Q A;  3IHU A;  5HLG A;  1Z6T A;  3RTR A;  1B9N A;  3KLO A;  2M87 A;  1T38 A;  5LGN A;  4G7O F;  4L9T A;  3Q9S A;  5CJ9 A;  1BC8 C;  2EFN A;  5CVI A;  3E3V A;  2RNJ A;  2FU4 A;  2L54 A;  2VT2 A;  4MGR A;  5D5V B;  2UXN A;  4Y15 A;  1BI2 A;  1G3T A;  3WGI A;  4ZZL A;  2NNY A;  4MQV A;  1YW8 A;  4MEY F;  1QO0 D;  4EM1 A;  4IJA A;  1KU9 A;  3RYR A;  4LLN A;  2HKX A;  4OOI A;  3MEX A;  2TDX A;  4YG2 F;  1JGS A;  1XGN A;  2PQ8 A;  5ILU A;  3LA3 A;  2VC1 A;  1RIO H;  1WKM A;  2WTE A;  4IRH A;  5JHU A;  2IRF G;  1SAX A;  2VXZ A;  2F5E A;  3R60 A;  2QBY B;  4P5O A;  1RNL A;  1OPC A;  2O3F A;  2EK5 A;  1A04 A;  5J8C A;  3WTU C;  3ISP A;  1K7A A;  1ZLJ A;  2JTV A;  3TQN A;  3N4M A;  3HHH A;  5ERI A;  1UFM A;  1IN8 A;  4N0B A;  1JHH A;  3COA C;  3T1B A;  2XRO A;  2HYF A;  2V79 A;  4GCV A;  4BH9 A;  3MAJ A;  3RKX A;  5LHH A;  2DLL A;  3G73 A;  4MTE A;  2MH9 A;  3DF8 A;  4HDV A;  4Y17 A;  1FT9 A;  4M9Z A;  4HYE A;  4EVI A;  3FF5 A;  4ZYH A;  1U3E M;  1MD0 A;  1PP8 F;  3P9K A;  1ZGA A;  5ED4 A;  3DPL C;  5DD4 A;  1LJ9 A;  1REP C;  4KMF A;  2O0Y A;  3W6J B;  1G3W A;  3F21 A;  5D8K B;  4I2O A;  2IA2 A;  2RQP A;  1I1G A;  1XB4 A;  3FXQ A;  1R58 A;  3WU1 B;  1SD7 A;  4WXD A;  4AD9 A;  5HLH A;  3WOD F;  4HF1 A;  4M9X A;  1XCV A;  1ZHF A;  1T39 A;  3MZY A;  3KZY A;  2E1N A;  4I02 A;  1SFX A;  1RUN A;  2G7H A;  1TBX A;  2JPC A;  1TNT A;  3OV8 A;  2A69 F;  3JSP A;  3K1P A;  3PFI A;  4HOB A;  4RS8 A;  1XSV A;  4R79 A;  5ILS A;  1P2F A;  3V8L A;  1GHC A;  4DNC A;  1MJ9 A;  3J80 Z;  2FQ3 A;  2VC0 A;  1IRF A;  3QPT A;  4YFN F;  2ZO4 A;  1MJB A;  2CFX A;  2HEO A;  2GXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...