1S8NA

Crystal structure of rv1626 from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
190
structure length
190
Chain Sequence
AVPRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords putative antiterminator
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 74
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s8nA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s8nA01
3OO0A 4R1HA 5IT3A 2KJBA 1B9NA 4G0ZA 4UHJA 2K7LA 4HF2A 2GKGA 1W5SA 3BJOA 1EHCA 2OA4A 1VTNC 2M45A 3VFZA 3Q15C 2EFQA 5ICFA 1DPRA 1YK1A 3GZ6A 2AYZA 3O2QB 5ILVA 1GUDA 5KC8A 4DNCA 3HSFA 3WODF 4IRGA 4BHCA 2RV8A 5IC5A 1DP7P 4L5JA 4DN6A 1J5YA 1A04A 1IXRC 1ZHHA 4JK1X 5IUKC 3RVJA 5LBQA 3G3ZA 4HBLA 6PAXA 1VPWA 1TVMA 2NS0A 3COAC 1Z6RA 3LKBA 2NZVG 1F51E 4MRMA 1F4VA 3GRCA 5KVRA 3F8MA 1SFXA 3KTOA 4JB0A 4O5AA 4ASNA 1Z05A 1BDIA 2Q5CA 3IWZA 3EODA 1PUXA 2R47A 1ZG1A 1U78A 1KA8A 5FBKA 3WGHA 2FEPA 3KETA 1ZH4A 2FN8A 2EV5A 3FGZA 4LB6B 4MQFA 2VN2A 1SFUA 4IPAA 1GLGA 1ZN2A 3HTUA 3Q41A 4LRQA 2DT5A 5E17F 4F8JA 2ADUA 3M9WA 2WC2A 2LKPA 3HTSB 2YX4A 3REOA 1DPUA 2DO7A 4BAYA 3KG2A 2PJPA 3UUGA 3GFMA 4OLAA 4OBBA 5CNKA 3FDFA 1CF7A 2DTRA 2VODA 4N9HA 3LA2A 5TPWA 3OMXA 1ON1A 2K27A 1JX6A 3I42A 3TMYA 3HSYA 2IPAB 3GA5A 4TV7A 3RVQA 1CYEA 2P9HA 2DI3A 4EYKA 4RK1A 3F8CA 2FNAA 3HS3A 4EJUA 3IWFA 3O74A 2W84A 1ISSA 2FEWB 2KIFA 3CKMA 4P96A 3E5QA 1R1TA 3HOSA 1SXHA 4EV0A 3LUGA 4EY3A 2L54A 2MSLA 2QZ8A 3LA3A 4OOIA 3Q9VA 2WWYA 4I0AA 3WGIA 1M5TA 4WXDA 3T8RA 1JWLA 1ZDMA 3MMNA 2RDPA 2NZUG 4N03A 3G85A 1IF1A 2XKOA 1Z1DA 4CO8A 1SXGA 2IDMA 4HYEA 3JW4A 4O1HA 4EVRA 3DZDA 3W6JB 4ZYEA 2OU2A 3ZN0A 1H9TA 3DFGA 1XGNA 4ZYLA 1R7JA 4HNQA 5JS1A 1FC3A 1SD7A 1J0RA 2HYGD 2Z99A 1EWKA 4KQ9A 1TQPA 3K1PA 3N6VA 2QBYA 4G8XA 4E7PA 5KWSA 2LPMA 4RU1A 3WGGA 3RVPA 3BDDA 1IN6A 2IOYA 2L4AA 2PEXA 4JBAA 5HS8A 1QQAA 1K7AA 2QUFA 4I09A 1O3TA 4OG2A 1IXCA 2LNBA 2DPDA 1FY7A 3HUGA 4WX9A 3RVKA 3F22A 2VYCA 1FSHA 2ISYA 2K86A 2ZBKA 3KEQA 1KU7A 1HW5A 1YQAA 1E6KA 1GHCA 4YFXF 3E3VA 4IVNA 4IRHA 3Q5FA 4PE5B 2O6GE 2HQBA 2PMUA 4O3MA 2Y0MA 3M8FA 3VNAA 4LG0A 3BP8A 1IN4A 2WMYA 3K69A 2XRNA 3TO5A 2RGVA 2M30A 2QYOA 1MB0A 4NCAA 5BPDA 4PDKA 1QQIA 5LEJA 1JXSA 2TDXA 1B00A 4WXEA 2IPLA 3FMQA 2GA2A 4EM0B 3C6QA 3TX6A 4TLLB 5IUNC 4BHBA 1O7LA 1JYFA 3H75A 1B4AA 2E7WA 3C3WA 1YS6A 5JHUA 1XB4A 3VB2A 1LQ1A 4L9JA 4WXMA 1ONVA 3N0WA 4N41A 4BH9A 1Z17A 4IMIB 2F5CA 3P9IA 4FX4A 1SFEA 1V4RA 4HQEA 3RQIA 2PUCA 3I64A 3C7JA 4LMYA 2VXZA 3R4KA 1WSUA 4NV3A 3JTEA 2VE9A 2COMA 1U8RA 1U2QA 1LDKB 3H92A 3GO5A 3V8KA 2IA2A 2XUBA 4GYIA 1TQIA 1PEYA 2QW1A 4Z4CA 3OLXA 2YHAA 2JK1A 3EUHA 4ENKA 2CYYA 3GUDA 3WE3A 1BDJA 3BROA 1LNWA 1T98A 3CDHA 3F8FA 2F5DA 3WE2A 1QO0A 3KHTA 4RY9A 5C5EA 3CUQB 3ROFA 3K1MA 5L3EA 1A2OA 3WTZA 2PUGA 4QLCU 5TQ0B 5BQ3A 3IRRA 4ETMA 5L3FA 1G3SA 4OTZA 5HDKA 2P6SA 3GLXA 3L09A 4MR8B 5CVVA 3T38A 3DBIA 3TOBA 2UXNA 3H5WA 1GCGA 1ZRCA 3ILHA 1REPC 4CBVA 4U0WA 1DC8A 2FEKA 3BRSA 5DKFA 2ZXJA 3N8IA 1GVJA 4M9XA 3H1FA 3H1EA 2HWVA 5L3BA 1BC7C 3I59B 5E20A 2JRLA 3RYRA 1HXDA 3I59A 2WRZA 4LD5A 5K5QA 3IPAA 3RVMA 1E2BA 3AAFA 4EYGA 3LUCA 3M7GA 5CJ9A 3ECOA 3NRVA 3TDZC 2E4ZA 3FWEA 4U0VA 4Q6WA 1O3QA 4OIQF 1D5VA 4EM2A 4AIJA 3U2RA 4ZYGA 3IKVA 1USTA 1MIHA 3TOAA 2CHEA 1OXBB 3BPXA 4I7HA 2L2QA 3E6CC 1I1GA 1LK0A 2XDYA 2HTJA 1YMUA 1U5TA 4Q6BA 4RB0A 1GUBA 5LEKA 3KLNA 1SD5A 2XHKA 5JNTA 1RZ4A 4H3HB 2FNPA 1BI0A 1FT9A 1RIOH 4PGGA 1K78B 3GFLA 4N0QA 2CW0F 2OENG 1JFSA 4ML3A 3GYBA 5D5UB 5E3JA 3ZQ7A 2FN9A 4H3KB 2PI0A 4ZH4F 2MH9A 3RDIA 1BJAA 4S04A 4UUVA 3M9XA 5KK1A 5PNTA 2BBYA 1UFMA 3IHUA 4YO7A 5HOOA 3LMKA 4CYDA 1MAVA 1RXIA 3FMVA 4LGWA 3ULQB 3MAJA 3H3ZA 3E6MA 1RZRA 5FWXA 4F3TA 5LLQA 3MQ4A 3W6KB 3E6DA 4YWHA 1XSXA 3ISPA 3FXRA 3H5OA 5FGMA 4Y9TA 5L3CA 1NXOA 3QLVA 1UCRA 4G0PA 1TLHB 2ZWMA 1U3EM 4ETNA 2VUIB 1BI3A 3LA7A 3QX8A 2P8TA 1I6XA 5DCLA 1KQ9A 3HYIA 1IN8A 1LBHA 2DRIA 2QWWA 2XAHA 3R0JA 3GT7A 1E6LA 4G94A 2ACJA 1BM9A 3DF8A 5ILSA 5AIQA 1PHRA 2A9RA 1EWVA 3KE2A 4PGHA 4TN5A 3MZHA 2OZUA 1LJLA 1TTYA 2FBHA 5I4CA 5T3YA 4EQQA 3K9CA 3HDGA 2GBPA 4UVAA 4UVBA 2QM3A 4OINF 1D5WA 4LLNA 2L19A 3DLBA 5HKOA 3SHFA 3H6GA 5K5OA 1DC7A 2NNNA 4L5IA 4I98B 2R3SA 2B4AA 4CGZA 1G4DA 3RVNA 1JYEA 2QQBA 1XMKA 4AWXB 4LE2A 2GIVA 2EFNA 4MLDA 5CNMA 3MYYA 5FWYA 1FQWA 1W7PA 1YTUA 5BPIA 4DQDA 2ESNA 3SXYA 1IIBA 1CHNA 2QV0A 4YIIA 2D2WA 3LTEA 4HZFA 4NQRA 4RXUA 3K2ZA 1L5YA 2W25A 2HEOA 4HNRA 4EYQA 2HOEA 2P7VB 2QSJA 1QP7A 1JFVA 4A6EA 2VC1A 3P7NA 3CUQC 1LVAA 4W5QA 4UV8A 1DUXC 3HUTA 4AIHA 1R36A 5E8GA 1P2FA 3NNDA 2GQQA 4RKQA 2VOPA 4JAVC 2GA1A 2JVJA 3E5XA 5IBQA 2J48A 2STTA 1KU9A 1WETA 5EWMB 3RVLA 3NNSA 4HV5A 2A69F 2MH2A 2X4HA 3QX9A 2ELHA 2ISZA 4YRZA 2J5PA 1D2AA 1WI9A 4PCQA 4IILA 1R1UA 2F5EA 3HRMA 5TPZD 2A68F 2J5OA 1AOYA 2FSPA 3D8UA 1IRGA 4RB2C 3L6UA 4Z4FA 1BIBA 2P4WA 3QU6A 2L17A 1S8NA 2DW4A 2XV4S 1FBUA 3LQQA 3A0RB 3H5IA 2NT4A 3CTPA 4P55A 2FW0A 3J7AO 3SZPA 5HSGA 4KZKA 2Q8KA 2V1DA 3R0AA 3JAMZ 3S99A 1IAWA 1SXIA 2A61A 2YU3A 4CHUA 1KRWA 2V1UA 5J8CA 5D5WB 2O03A 5JVTA 1LDDA 3HM9A 2HYFA 2NNYA 5BR1A 5E18F 5CVIA 1WWXA 4ENJA 1USKA 2Z33A 1DBWA 3K0LA 1NY5A 3F72A 4WT7A 3M6MD 2F2EA 4NQWA 3FXQA 4EM1A 4FT8A 4LK1F 4FB4A 3T8YA 2H6CA 5KQMA 3T1BA 2HKXA 5JR3A 2IRFG 4RK4A 4EVQA 3F6OA 4OMZA 4KK3A 2FU4A 1S7AA 3F6PA 2JSCA 3DXJF 3MFKA 4G9YA 4ESFA 1F9NA 2WWVD 2BGGA 1XCVA 2ESHA 4RSMA 2G9WA 1TMYA 3BREA 5DGCA 2XAQA 1YFHA 5B3JC 2DLLA 1S6LA 5KQLA 3MIZA 4B8XA 5CNIA 4S05A 2ZNYA 1YIOA 1ISRA 1KYWA 1HKTA 3ZMUA 3WG9A 4YR7A 4WCGA 1YVUA 3LKVA 1FOKA 3C97A 4RWEA 6ABPA 2NYXA 2WY2D 3JAMK 5DCFA 2LP4Y 2A9QA 3FMSA 4MRMB 3TB6A 1L3LA 3RVRA 4L9VA 1IUYA 3NBMA 4KVFA 4MR9A 1YW8A 1LJ9A 3SZTA 4BQAA 4G7OF 3OQNA 4HX4A 1MDMA 1UHWA 4EVIA 3HHHA 1UDRA 2VBZA 4MGRA 1I5ZA 4HF1A 2VONA 4MQFB 1YLFA 2JBAA 1FP1D 3IP9A 4RY8A 2B0LA 2M87A 3MQ0A 4HX8A 4EVSA 1G3WA 3KZYA 2P5LC 4KRFA 2GI4A 1RNLA 4M9SA 4KNYA 1QGPA 2HKOA 2IVMA 4MHGA 4UNOA 3RVSA 1IN5A 4M71A 2P4UA 1DRJA 1DP4A 1VRVA 3OMWA 4OIRF 3LQRA 1SD4A 1FBSA 1B1BA 2EV6A 3HRSA 3JPYA 4A5NA 1U2PA 3MF4A 3C3MA 4G7ZF 4Z2YA 1ZH2A 4FX0A 1CF7B 1NXVA 5DTEA 3HDVA 3QEMA 5TPWB 1EH7A 1XCBA 1J7KA 3PFIA 2IT0A 2YR2A 5JNUA 3V8JA 4NCBA 3WTXC 1D4ZA 3SY8A 2LF7A 2O61A 1UB9A 1Y0UA 5IT9Z 3NNNA 4MLCA 2PUDA 2C6YA 3KP5A 4GPAA 1ZARA 3HIFA 1NTRA 2XASA 4RGUA 2EFOA 3NHMA 5D2CA 2FMKA 4G7HF 1X3UA 2RKHA 1LBIA 4GCVA 3QELB 1KU3A 3NEUA 3QELA 3CZCA 1XHFA 5HQJA 3Q9SA 2NUBA 1P6UA 5GQSA 4EUKA 5HVQC 4G6QA 2E4UA 2Z5UA 3ELKA 1U2WA 3LAJA 3LUJA 2E4WA 5EWLA 2EJRA 3KSMA 4RAYA 4RXTA 1HW2A 2A9OA 2FSWA 3KS9A 2JZYA 1KU2A 3FFWA 2FMLA 1K66A 2XGXA 2AYXA 5ICGA 1QQBA 3I53A 1Z9CA 4MTEA 2E7XA 3H6HA 2QBYB 3KP6A 4MQVA 3HUUA 1Z16A 4PEVA 5HLGA 1OMIA 1QNLA 1R1VA 3CLOA 3MZYA 1F5TA 3C3KA 4Z4EA 3FM3A 5EWJA 2HTSA 5D4SA 1D3YA 5LGUA 5DYMA 2FRHA 1YW9A 3T6KA 1IN7A 1S7OA 1Z2DA 4ESBA 2MLGA 4K2EA 1NXSA 5TQJA 3F3XA 1O3RA 4RGXA 1ZREA 1D8KA 4R8HA 2O3FA 5D4RA 2OQRA 4G97A 3QU3A 5IT9K 2A6HF 3R6SA 1MVOA 3GFJA 3P9CA 5BRJA 2KIMA 4IJAA 5EEHA 3I71A 1YG2A 2M1BA 2FQXA 2VUHB 1K6OA 5JNWA 2V6CA 2IPNA 4L85A 1TLFA 3E5UA 3PQJA 2CQKA 1QO0D 1H9GA 2ZAYA 4ENNA 3CHYA 4LG0B 3DGEC 4LE1A 4Z4GA 4WXHA 5DCMA 4MEYF 4GNRA 4XAQA 2ZO4A 1D8JA 2E1NA 1V3FA 3IP5A 2FKAA 4PZJA 4QYWA 1PP8F 1APBA 3FF5A 2IPMA 4Q4ZF 1S3JA 2JTVA 1MJBA 5KI6A 1SAXA 4O6JA 3L9FA 1QP0A 1T38A 4WXCA 3I45A 4W5NA 3IKTA 2IKSA 2PUBA 3WTSC 2PUFA 2L01A 1BC8C 1GXQA 5DLEA 1J59A 5BS6A 4JP1A 2STWA 5JS2A 5DDGA 1QZZA 3EULA 2O20A 3KP2A 2W42A 3LAPA 1SMTA 3TKYA 5LHHA 3BY6A 2RQPA 1D1QA 3TD9A 3H1GA 2K02A 3P9KA 5ICCA 2H6BA 5J6XA 1ZVVA 5CYVA 4KK4A 1IRFA 3CRNA 1Y1LA 4R79A 2VT2A 4A0YA 4EGZA 4MS3A 4N47A 2H3HA 2FA5A 3FXUA 2RN7A 1IZ1A 1B9MA 2CFXA 3I09A 3ROUA 1ZG5A 2ZCWA 4XLTA 3CU5A 1JHFA 3HRTA 1AWCA 4KFCA 1P4WA 3OO1A 3WTWC 2LSOA 1W5TA 4Y13A 2VT3A 1DCMA 4Q7EA 2CGPA 2P7CB 5ED4A 2FEZA 4FHTA 3EYYA 4Y17A 4W5RA 3EDPA 3Q7RA 2FMIA 1KQ0A 2V1XA 4RKRA 1RZRD 2XVCA 4I02A 3WU0A 4YV7A 2FE3A 1IXSB 4Q47A 4IHTA 1M5UA 3ERED 4O5VA 5BMZA 4KDPA 1YMVA 1DCKA 4M6YA 1FZPB 4MS4A 4FE7A 2LDUA 3HZHA 5CVUA 1ZESA 5F64A 4OMYA 1I3CA 1TM2A 3WTUC 5F6FA 5H6QA 1TJYA 2M1ZA 1JLKA 2A9PA 3LFTA 2JVIA 1G6NA 1U5TB 1VKRA 1MZBA 4WUTA 4HOBA 2HDCA 2P6TA 2FMFA 1OPCA 4KQCA 4N9IA 4AIKA 2VE8A 3U9GA 2ZJ2A 5LRRA 3RPUA 3K4HA 4EMSA 2KIUA 1R23A 2BEOA 5DUIA 3JS5A 2P5KA 5KQGA 2YPRA 1Z13A 3VODA 1LDJA 5L3GA 2PUEA 3J81Z 2FBKA 1Z7UA 5D5XB 1OR7A 1OYIA 5E1WA 4D0PA 1W7PD 2YSRA 2MSKA 5FWXB 5FLXZ 4LDZA 1U6GA 3GWZA 2W57A 3JY6A 5JI6A 1BA2A 8ABPA 6CHYA 3KLOA 1K79A 1HKQA 1Z15A 2F8TA 3D5LA 2OBPA 2UWMA 4L4UA 1OYWA 2O0YA 1R22A 3O21A 1ZRFA 3KP4A 2L18A 4ETSA 3CLKA 3KZZA 1FFGA 3N53A 3OV8A 4WWCA 5JNVA 4H60A 1DDNA 1QBJA 4HA8A 4G0QA 4MS1A 3T5XA 2Y48A 1F4KA 4OIPF 4E7OA 1ZYRF 5LGTA 5TJJA 2VOOA 2ID9A 2JB9A 3KYIB 1ZLJA 1AB6A 2V0NA 3CS3A 1NXTA 4XSZF 1Z25A 4Z9BA 5E8IA 4IRXA 3E61A 2FQWA 2VK2A 2XAGA 5ICEA 3K1NA 4MAAA 1EWTA 5LHGA 1YW7A 1JFTA 1R58A 3HO1A 4LZLA 1P8AA 3BJAA 3JVDA 3RH0A 1KQ8A 3MEXA 4RK0A 4KPYA 1H9CA 1J9IA 1BI1A 4TMYA 1HW1A 2HGCA 4JB2A 5EEGA 1DBQA 4G86A 3S2WA 5E1ZB 5AIPA 3FX3A 5FWYB 1EV7A 1W7PB 4LK0F 3W9SA 3J81K 1NXXA 1YS7A 1LEBA 4RDCA 1O7FA 1RPJA 3I0TA 2XROA 1FSPA 5FD5A 2ID7A 2QR3A 4KIFA 5FLXK 3QP6A 1HEYA 2F5FA 3KFWX 2HQOA 1U04A 2O8XA 2PN6A 2PJUA 5BOXA 1FPQA 2IW5A 4LFUA 2K4JA 3CG0A 4NHJA 1SRRA 3C1DA 1P6RA 4LX8A 1MJ9A 3ZMZA 2UXXA 4GYGA 2X0LA 4Q48A 4JOQA 1Z12A 2VC0A 3B2NA 4KMRA 1JDPA 4CDGA 4MYRA 3QLUA 4WWHA 4YGXB 2JCGA 3O2JA 4RK6A 1QNTA 2WV0A 5C5CA 3DGFC 4Z4IA 5L3DA 3SFZA 1MKMA 2ZMEA 5J8FA 3EQLF 1FYLA 2JVKA 1NXWA 5JNRA 4JASB 4TLMB 4KUMA 3V7SA 1YYVA 2NAZA 4ZYHA 4HQMA 1RUNA 4CZZA 2LUOA 1Z18A 3QPTA 3A0UA 1T2KA 4XSXF 3PQKA 3ABTA 2DBBA 7ABPA 3N4MA 3NHZA 3HK2A 2EWNA 4QWQA 4IHSA 4IF4A 2DK5A 1T34A 3N0XA 1G3TA 2LIVA 3GX4X 3CO7C 3OLZA 1U5TC 4L0YB 3VNBA 3SQNA 4GGGA 4G6DA 1EAYA 5D6FA 2GXBA 2RNJA 4PZ0A 1R00A 1J56A 4XASA 1G3YA 1XDSA 3CTAA 4RB1A 2XAJA 1USGA 5TQ2A 1UHMA 1HQCA 1P4AA 2FQ3A 3RPQA 5IUJC 3EAFA 3GBVA 3DPTA 5IULC 3OQMA 3GFIA 3HJFA 4D6YA 3O2SB 2MD5A 2M98A 2RVCA 2LBPA 3KCNA 2B1JA 4MQEA 2DFIA 4LLGF 5HLIA 9ABPA 1NXPA 1TNTA 1FYMA 1PEAA 3R60A 1JHHA 2PL1A 4H0EA 4UV9A 1C0WA 5D6EA 4A0XA 5FB2A 2GZWA 3QLVC 3RIRA 4O1IA 2EV0A 2RC4A 4ENMA 2FVYA 2MYNA 1XGOA 4XARA 3KJXA 1MD0A 2GWRA 1C4WA 2A6EF 4MR7A 2VBYA 1WKMA 2MYUA 1FFSA 3RVOA 3GW2A 5DEQA 5D5VB 3HVRA 1EH8A 2FBIA 4KA4A 2VBXA 2D45A 3BBLA 4PICA 1D1PA 3L7WA 1Z6TA 1Z26A 2Z3YA 3F23A 4MGEA 4A0ZA 2E4XA 3BJ6A 3NQOA 2DQLA 4MR9B 4HDUA 4UVCA 3OM1A 1EFAA 4ON0A 4CICA 2WTEA 4NB5A 2R7FA 1HBXG 3GF2A 1ZY2A 4Z99A 1SMYF 1MDMB 2QU7A 1RI7A 3QK7A 3IL2A 2RJNA 2VBWA 2HR3A 2JBAB 3R61A 2QLZA 2OQGA 4W5TA 1PNTA 4F7ZA 5CVJA 3P9YA 2EA4A 3ZP5A 4M74A 2P5VA 3VOEA 1USSA 1QPMA 3A10A 3JTHA 2ETHA 2HS5A 4M6XA 4QYMA 2QXYA 3J80Z 2CWEA 2KRFA 2PBIA 3O75A 3HHGA 2EFWA 1E6MA 4HAMA 2HPHA 2Q2EA 1JHZA 4P9FA 3QEMB 1OYYA 4YG2F 1Z91A 4HDVA 2R4QA 3LUAA 3LUHA 1BI2A 1O3SA 2AS5F 3EYIA 2UZKA 3ML6A 3K9TA 4AVPA 2CWDA 3N0RA 1R8JA 3QLUC 2ZNZA 4LE0A 3GEZA 3RKXA 1ZH5A 1WRJA 3D02A 2W85A 1KGSA 5DD4A 2OZ6A 1GXPA 5JNSA 3VEPA 3RI4A 1IW7F 1ZITA 3DP7A 2CSOA 1R5HA 2FTKE 2EK5A 3M9AA 1VLZA 3BWGA 3KP7A 3KKEA 4I01A 2JPBA 2A07F 2D1HA 3OLVA 1ZAOA 5HLHA 5EWLB 3CJNA 2E4YA 1NHAA 2DAOA 1M2FA 3N75A 2PLYA 4QICA 3FHZA 1FFWA 4EGYA 4KICA 1JE8A 4M73A 5A2QZ 1DJMA 1ZGAA 5FO5A 5EWJB 4HLXA 5CLSA 2CG4A 3ZPLA 5CHYA 4BXUA 3J80K 5TRDA 3BRQA 4D74A 5DV5A 1I1SA 5JFRA 2A3SA 1BN5A 3CUOA 1B59A 3UKJA 3M1EA 1URPA 4RK5A 3UK0A 2QQAA 4WZZA 2QVCA 1XWWA 4UHTA 5FBHA 4RXMA 2D1VA 1HSJA 1E2XA 2I6FA 4KT5C 2HFHA 2H09A 4RV5A 3F8BA 2FXIA 3MM4A 2MC3A 5IX8A 1TBXA 3DEUA 3I58A 2X7XA 1RXEA 1GCAA 3LOPA 3EGCA 3F8NA 4IGAA 3E6BA 4YLEA 2HZTA 3MWMA 2XAFA 2KJCA 4RS8A 2V9VA 1T39A 5LHIA 1Q1HA 3HCWA 1RUOA 3SG0A 5DCMB 3MA0A 1QMPA 2PLNA 4A5MA 2DQRA 3F21A 5DD8A 2FMYA 3E97A 1DBPA 3O2PE 5HDGA 3T0YA 4BNCA 3QOPA 4RZSA 3GZ5A 3DLHA 1T0FA 3D0SA 4XXHA 1XGSA 3ZMVA 3G73A 3JVIA 2H27A 1ZLKA 2PAFA 1BVHA 4I2OA 3GXOA 3WTYC 2E1CA 1MB3A 4DQ2A 1ABEA 3ROTA 4G0YA 3SNKA 1PNRA 4LB5A 2TMYA 4HF0A 5A2QK 1W4MA 3FM5A 4HW0A 5LGNA 4M9ZA 3ECHA 3EDCA 3RKYA 3B73A 4Z4HA 1KRXA 3LUKA 1TW3A 3HRUA 3ABUA 5CVRA 3Q7TA 4WF2A 4PYRA 3BZ6A 3O1JC 2QENA 2PFBA 1TNSA 2ZFWA 4ZYDA 4ZJPA 3TGNA 4UXNA 4XBFA 2PQ8A 5D8KB 4EJOA 3A3KA 3G1WA 3F6CA 4U7BA 4L18B 1U0SY 3EJWA 1XD7A 4A2UA 4ZMSA 3QRFF 4OLBA 3QP5A 2HQNA 1LJUA 4MS3B 3WTTC 4B09A 2JPCA 1XSDA 4L9NA 1DZ3A 5E1XA 4KV7A 5T7BA 4AD9A 3TO6A 5TE9A 3GVAA 1QZYA 1M2EA 5HS9A 4YS6A 4OU0A 3SM9A 1MGTA 3LSTA 5IEJA 3JSOA 1FYKA 1DG9A 3IDOA 1W9HA 2JT1A 4Z9AA 3BILA 1STZA 3O3KA 2CHFA 3GL9A 1SD6A 3I54A 2L02A 3L2CA 5BRAA 1JF8A 4A12A 2YHBA 5DUKA 4I0BA 3DPLC 2BV6A 2MLKA 4JA2A 4JQFA 2YX7A 3HSRA 1JBEA 1BAPA 2HJ9A 3OM0A 2KKOA 1BDHA 1WQ2A 5FFXA 3CUQA 2HSGA 2FLKA 2MBFA 5TQ0A 2QVGA 1J2XA 2EB7A 2PMCA 3QLTA 2W24A 2BYVE 4UHKA 4MS4B 2WJWA 5HDNA 3OQOA 2FLWA 3E3MA 4MR8A 2IYNA 3H5LA 2PMHA 4W5OA 4KMUX 3JTGA 1I27A 1A0OA 2JRTA 1XGMA 1J75A 2FMHA 2GXGA 3BPVA 3L00A 2GX6A 3ILYA 3OLYA 1FX7A 4LDAA 1BBYA 4KMFA 4KN4X 3EQZA 3O6BB 4N76A 3GV0A 2Z9OA 4WK8F 4F11A 2ZKZA 1DCFA 1P4XA 4GO1A 1ZHFA 2MSWA 4HX7A 3EQ2A 3ZMTA 2N9UA 1FP2A 2R25B 1YTYA 4EGSA 4XLPF 4LLLA 5H20A 2CD7A 4GXOA 3CNBA 3IP7A 2E4VA 4MEXF 4HV6A 5ABPA 4U88A 2IA0A 2R7DA 3H3UA 4XLNF 4ZMRA 4YP9A 2FOKA 1W25A 2GAUA 4MTDA 1K78A 3IRQA 1PP7U 3HXMA 3HOTA 1BOAA 4N0PA 1JL3A 2BE5F 4E70A 5GOTA 1C0EA 3TDUC 2QQ9A 1F1ZA 4U7DA 2V79A 1ZGGA 3I5AA 3GWGA 1ZRDA 4P98A 1P92A 5HS7A 4EJWA 4KYWA 4N0BA 4OATA 2G7HA 2M8EA 4KIBA 3V7RA 4RB3C 4MS1B 4XRFA 1K68A 3H5TA 1R5GA 3L49A 4HNSA 3I5UA 3CG4A 4G0MA 3ZMSA 5BQTA 2PUAA 4KREA 1ODDA 3LFKA 4Y15A 2NRAC 3WTVC 3V7CA 2PG4A 4YIFA 1CEYA 4P5OA 5D8LB 1KYZA 5H6RA 4RGRA 2PL9A 1YK0A 3B02A 2LF8A 2IA1A 5B3JA 2DPUA 4XFKA 1USIA 2QVOA 4EYOA 4ESJA 1OXKB 4RY0A 4F12A 3TO9A 3JSPA 3IP6A 1ULYA 4RS3A 3HEBA 5ILUA 1DRKA 4NICA 3FFXA 2EFPA 5IEBA 3N97A 4A6DA 5K5RA 4D6XA 4P1ZA 2R48A 2WJAA 3F6VA 3OOPA 1FBQA 3MCZA 4LJZF 3FZVA 1JH9A 2HQRA 1FWZA 1XSVA 1TQMA 4KIGA 4BHPA 5F1RA 2CO5A 5KQPA 1FNNA 4CXFA 1HSTA 3TQNA 3DV8A 5HM6A 1FSEA 3FMRA 5CNJA 4QPJC 2FXAA 2PE5A 1E17A 3RJPA 3LUFA 4EJVA 2IP2A 1KMIY 4MPTA 2EA2A 3F7NA 4KN7X 5LRSA 4IXAA 4ZZDA 3LWFA 5KC9A 3QEKA 1MJAA 3TO7A 3FFTA 4EJTA 4L0ZB 2M5WA 3JPWA 2H0AA 4YFNF 4RK7A 1ZGJA 1OKRA 1LEAA 4Q5SF 2NT3A 3T95A 1JGSA 2BGCA 2ZMEB 1L0OC 3RKWA 3HSEA 1EH6A 1H0MA 5K1YA 2OD5A 3KYJB 4F06A 1B6AA 1PDNC 3GBPA 4U0YA 3IC7A 2WB4A 2MA3A 3KCCA 1T6SA 4G0XA 5EWMA 1ZG3A 5ERIA 4HLYA 3IPCA 3HV2A 1QPZA 2L4MA 2XIGA 1XDUA 3URMA 3WU1B 1ABFA 2IJLA 3H5VA 4M72A 2F8SA 3KP3A 4ETIA 5AONA 3Q7SA 1ON2A 4IRIA 4OIOF 4BYYA 2DK8A 5FFZA 3RYPA 2FF4A 3M8EA 2KYRA 2PKXA 1U8TA 3GYHX 2DU9A 3CZ5A 4Z0NA 2K4BA 4ZZLA 3C18A 2H94A 2XKPA 1YO5C 1XMAA 2QZJA 4M88A 1NATA 1XN7A 2RGYA 3ZMDA 4YCSA 1AB5A 2L3DA 3V4GA 4MNUA 4YFKF 5TQ2B 1TW2A 2IPQX 1JDNA 3ZN1A 4RAZA 3LUDA 2FQYA 1LB2A 1FLIA 2Y75A 2MYTA 3SAJA 3O1HB 2RDMA 4MQEB 4DADA 3BOQA 1ZAYA 3DQVC 1PUEE 2Q0OA 3CFYA 1Z2EA 3I4PA 3QPHA 3RTRA 3T8TA 2A5YB 3KEOA 4P9UA 4MQ9F 4G0OA 1ZGZA 2AXLA 1P6QA 4L9TA 3EETA 3V8LA 1O57A 4ZPJA 3QAHA 4IMJB 4RGSA 2RJOA 4FE4A 1QP4A 1CGPA 3U1DA 1S29A 1BIAA 2OAZA 5FD6A 4MR7B 1L5ZA 3OLWA 1XHEA 1HKSA 3O1IC 5TPZA 3DKWA 3F73A 3CO6C 1QKKA 2G7UA 2MYPA
chains in the Genus database with same CATH superfamily
4E03A 2ZE7A 1PFQA 4HEA6 3G8BA 3OE7D 3BJOA 5KYUA 3HU5A 3Q15C 1GAXA 2PZEA 2SICE 3W5DA 4TLAA 4KO3S 2RV8A 4DN6A 4FT4A 1KZ1A 3IEMA 3V4ZA 3N6XA 1MV5A 1DUSA 3DOHA 4HDSA 4IX9A 4XVUA 3PLAE 4ASNA 1UK6A 1Z5UA 1SZDA 3T1YB 1U78A 4I1RA 2ZT5A 2GZ2A 2G1JA 2VBFA 3HR7A 1XD2A 2QTVA 2A9VA 3GJ4A 1T1IA 2IDJA 3R75A 1XTRA 4GC5A 3K9LA 3I01M 4JJ4A 4JLBA 4KXXA 4A1OA 2OFOA 4X1KA 3ZYZA 2YVLA 3MS4A 3OZRA 4QUHA 4EF5A 5MF6A 1UKZA 1GZ5A 2H8GA 3B6IA 5HIMA 3E5QA 3K6SA 2L54A 1Y80A 2MSLA 2QZ8A 2NXWA 1MORA 3CA8A 3WGIA 4GF5A 4TM8A 2E3JA 2EZKA 2DA2A 2GAIA 2XKOA 4AJ2A 3PQ5A 4ZYEA 1DX6A 3DFGA 4I08A 2HBZA 2C03A 3NV9A 4ZCIA 3C24A 3V4VB 3A9TA 1J0RA 3VKWA 4ND6A 5I4BA 2XDQB 4BNUA 1AURA 4FXOA 4YDSA 4QRHA 3RVPA 2OHFA 5AM4A 2Q5EA 2L4AA 1GADO 3HWX1 5KNCD 2CNWA 5HG0A 4CQLA 4WIAA 1U63A 3CX3A 4U5QA 1CW2B 4GDFA 4DQVA 2G5TA 4TM7A 1FSHA 2I7XA 5SYMA 4MVJM 3I9FA 3B2EA 1O95C 5DM2A 4CMGA 3E15A 4XWKA 1KO4A 1CEQA 3INYA 3BXXA 2PANA 5DV9A 4O3MA 1TMGE 4TTQA 2H5JA 4A2QA 1YUNA 2W6CX 3UHAA 4RCZA 4PDKA 1QQIA 1JXSA 1NULA 1GFWA 4JEUA 1SO8A 3W3ZB 4DLLA 1K8XB 3O8HA 1L7OA 1JG6A 5JD5A 4IIJB 4FHZA 1DINA 1LI5A 1VHDA 3CJQB 3N0WA 4YRRA 2HXYA 4JQZA 4JROA 3PDJA 5EIWA 2JPDA 1JUPA 5H02A 5F33A 2OBNA 2HZBA 3WQQA 2ZJPF 1JEQB 4M38A 3R7DA 4UXIA 3GO5A 4QPOA 1TQIA 1P77A 3RFCA 1ZJ6A 4OAYA 4AYXA 5L45A 2KISA 4ND2A 1PVEA 3D4OA 2XEXA 4KWCA 2EKZA 3H0KA 2DQKA 1MSEC 2HY7A 3UK7A 1V8PA 1Z2CA 4A2WA 2FPXA 2ZR0A 4B3FX 5KYTA 1G3SA 2XPVA 2QL7A 1I1OA 2QYSA 1HEIA 4L27A 2VYQA 2I34A 3LPDA 3X1JA 4LDRA 2GSWA 4XWAA 3NHJA 3BRSA 2GN8A 3I59B 3RW9A 3CJTB 1WCIA 3DBVO 3FUWA 3K9FC 3M7GA 2JIQA 4U0VA 4Q6WA 4EGQA 3U1BA 4ARZA 3T3PB 3QPLA 1PKEA 4O5OA 3U80A 4NMXB 4JL6A 3WAJA 3FDZB 4YHHB 1KVUA 2QQ5A 2BW3A 3CGWA 3ENVA 2WWWA 2RD2A 2Z8ZA 1SD5A 4RENA 4RKWA 1CUHA 1E2LA 5EZHA 1M54A 2GMWA 2V7WA 2ZUFA 4HKTA 4ZHSA 3FVRA 2J87A 4V0RA 4UUVA 3PXUA 1UZAA 2Q3BA 2I6GA 5PNTA 4B17A 1R64A 4LG3A 4CMKA 4LGWA 2MR5A 5KOJB 3F9RA 4KQ6A 2PRSA 3LIPA 3W6KB 5AVSA 3CVYA 4BDYA 4G67A 1IBSA 4B87A 4Y1GA 2DFLA 3WB0A 3HP1A 3Q88A 4LN1A 4Y2RA 4ZYZA 2C2MA 5DCLA 2DRIA 4Y6LA 2JEZA 1T1GA 3NARA 3R0JA 3CF4A 4C3UA 2GH1A 4KKVA 2IGTA 3HKCA 2A9RA 3C8UA 1E1QA 4EPWA 1MJ5A 1HE5A 1P80A 3ORQA 2Y9MB 3K9CA 3U26A 3K7AJ 3W1EA 4BNWA 4TLCA 3DLBA 3OSFA 4LF5B 2PVCA 4L5IA 3I4CA 3EPKA 5KHDA 1XMKA 4RETA 4ZVOA 2KP6A 1XYVA 1NNSA 3ZWVA 5CB0A 1YQEA 1LSSA 5K3BA 1YC2A 2NVXJ 5IOYA 3CB2A 5CIWA 1YB6A 2WAOA 3U44B 4ERXA 2A9JA 1ZKMA 4YBZA 3ID6C 2QRPA 2EIKH 1P62B 4RACA 3FGPA 3AUFA 3RSLA 1WPRA 1COWD 1HG0A 5G0TA 4IQJA 2DPXA 3B6ZA 3FLMA 3PFBA 5CM2Z 1Y5RA 5KNDD 4PZAA 3DU5A 4HZUB 3UAZA 1R1UA 2J5OA 4GLBA 1PI3A 3V9AA 1E2NA 3VTAA 4LQDA 5KCMA 4FYJA 1I10A 2J3IA 3NKFA 4O4IB 3UZUA 3OF2A 4QOIA 4Z1MA 3DOJA 3DMTC 3H11B 5C1PA 3ONFA 4UARA 4DG5A 2UZIR 4MIMA 1X80A 4HAYA 4QGSA 3QXHA 3LA8A 5BR1A 2HHJA 4LK2A 5CVIA 3EWSA 4QKQA 4B8YA 2AOTA 2HO5A 4ZQHA 2DETA 4ISCA 2V9PA 3AEUB 4NXMB 3UICA 2IRFG 5DN6D 3ZTTA 4EVQA 3NBKA 2GO7A 3DEHA 3FWKA 2OP0A 1JSCA 1R2QA 4XRSA 2XNDD 3HDYA 3HBNA 3CMAI 4Z7QB 2XGDA 4GMFA 1QM5A 5GIPE 2NO9A 3FKJA 2KQUA 3PQEA 3PNLA 4HFNA 5HHTA 3G79A 3DL0A 4YP7A 4WCGA 4X95A 3GFSA 4GFDA 6ABPA 3HY3A 4TUYB 4EPYA 2WY2D 4MI3A 5EINA 3WS7A 5EYRA 1ENPA 4B5KA 5DZSA 3O8NA 3I1FA 1CZRA 3L46A 3D2AA 4U3JB 4ENRA 3ROZA 3M1CA 4HX4A 2E1RA 1V7PC 2XUPA 4EFDA 3OQBA 3FVTA 2JIPA 4H1HA 1DJQA 1NV9A 3IP9A 5AVYA 2M87A 2CXSA 2P9EA 2VLBA 4KRFA 4YMWA 1RNLA 1PCXA 4Y2GA 1LV8A 1R4MB 3V1LA 1OZFA 3GJRA 3JPYA 3R0ZA 4DTCA 2D0OB 4TKLA 4NPAA 1XCBA 2PX6A 2CDCA 1KOJA 1QPIA 1CR6A 3BTLA 2C6YA 3IVRA 2K9SA 2ZJRF 2RKHA 4PNPA 1PSDA 4EMUA 221PA 3QELA 1Y1TA 1F8GA 1Y7HA 1C9NA 4TV9B 3SBOA 2E4UA 1GFSA 4E6KG 1LLFA 2E4WA 1SHKA 3QMPA 2EJRA 4PPQA 1WJGA 2JHCA 4CN8A 1A9TA 1UIMA 3L0PA 2AUMA 2DHRA 1Z9CA 3BMNB 1ESMA 1E5TA 5AK4A 3KVVA 1OWPA 3FK7A 1ATZA 2JZCA 3S3NA 2R68A 5KAPA 3TLKA 1R0YA 1V11A 3H2HA 3MWLA 1E92A 3TMKA 5L3QA 4MVJH 3ZE7A 4O4LA 5BN5A 1J42A 2VPRA 2VKVA 3HKBA 5D6NA 1SH7A 4C76A 4IJAA 2OYSA 1YA4A 3N0VA 4U5XA 2VUHB 2AE1A 1TLFA 5JUWA 5KDDA 1YDHA 1VECA 4D8YA 2JGFA 1Q44A 4Z4GA 5B57C 3CISA 2ZO4A 3AR3A 1D8JA 4HGOA 4PZJA 1V6AA 3CKLA 5DEIA 1DKLA 4MQ5A 3HB4X 3NALA 3O4GA 3K9NA 3CUUA 1YZGA 1VJGA 1CS0A 1X3SA 1RPZA 1QE0A 4JP1A 1WIWA 2AXNA 2SKCA 3GHHA 1QHEA 3ECSA 2X9GA 2M7BA 3NBXX 4PJJA 1Z3YA 5CYVA 3AHIA 4A10A 4Y0VA 4CV1A 1T9GR 5C46F 1ZM7A 1DKOA 4F9FA 1YR3A 4EZBA 4KFCA 4H7EA 1F8YA 4C7VA 1Z4KA 2PWYA 2CGPA 3DWIA 3BFVA 4KMOA 1QHSA 4EB8A 3E3LA 1BXGA 3Q7RA 2V1XA 1P9LA 2XVCA 3RT1A 1NSYA 4FQ7A 4AC9A 3C14C 3RTGA 4QIHA 1I80A 5A3QA 2YJTD 4E7JA 3BDAA 2YINC 3IAUA 4WKGA 1U11A 3GGSA 2C0CA 1UQTA 1PN3A 3OJXA 2P5SA 5HQ3B 4NYMR 1WZEA 2QL9A 2A9PA 2LK2A 4L9RA 2PL3A 2CF6A 4HUJA 3G0OA 2CB0A 1NQWA 4QELA 3I6ZA 2WKRA 4JBXA 4HRVA 2YYSA 5K3DA 1P7CA 3CC8A 4F96A 1YBVA 2AG0A 4UVDA 5K5EA 4P4UA 1CV2A 3U0VA 4H4KC 4YCJA 2B4TO 3VZDA 2YFQA 4TZTA 1N77A 5T8KA 2FFJA 1P1BA 4EUFA 4CCMA 4YX9A 3A6KA 1C3EA 2BSXA 4RD1A 3AETB 3E5MA 4TWAA 4EO7A 1K79A 5JQGF 2VA8A 5IC4A 4NBSA 3DYIA 2H65A 2L18A 2OG1A 4FKBA 2RGNC 1FU4A 3VSCA 1E79D 3TSCA 4F85A 2TSYB 3DW1X 4COOA 1NFRA 1MDBA 3RWBA 1E3WB 3H2SA 4ENPA 1KXJA 2UV1A 3F46A 3HKDB 2Q1SA 3H8SA 1JDVA 2YZ7A 4RDCA 1SBYA 1M1NB 4MV0A 2HWYA 2ZYUX 2ID7A 2ILVA 3EUHC 3W5VA 5ESWA 1A7KA 1QPBA 4XD7D 1HDXA 5KSOA 2ZRHA 1FPQA 4EF4A 1JXAA 5ADHA 3B3QA 5COBA 4CEIB 5EFZA 2K4JA 3LP6A 1SRRA 3C85A 3H9CA 5AT1A 2ZTVA 2WBMA 5D3KA 3OS1A 1OFTA 2FRDC 1T0IA 1KSFX 2UVDA 3KTDA 5C5CA 1N75A 1K4MA 4V3CA 1TM1E 2D5AA 3QJGA 1GLVA 1DJOA 4UXJA 1QR2A 1T8RA 5TC4A 1YX5A 5CA1B 4ZYHA 4HQMA 3C3AA 3QKRB 4BO1A 5EQDA 4E31A 1E2HA 3OEED 1KS9A 3AQ4A 4IF4A 5M5YJ 1T34A 1XQWA 1ZGBA 1U7WA 3OLZA 5CVTA 1KWKA 3FOAA 2L69A 5C8ZA 1ORIA 3KVRA 5L4NA 3QQPA 4PZ0A 2BGWA 3GHYA 1XDSA 4IICA 1HH4A 4B3SB 2XOXA 1MG5A 5ED0A 3QVXA 2R7TA 1T1JA 3GBVA 3ZWXA 3JYPA 4C7OB 1NXPA 5E0OA 1YVPA 1BXRB 4H0EA 4G07A 4A23A 3I9LA 4RH0A 4FVTA 4YRFA 2O7SA 4J3JA 4FR5A 1O5TA 1AQ6A 2A2ZA 2H08A 3CZ9A 2GA9A 2VATA 4KAJA 1YJCA 4TXLA 4S0HB 4Y2PA 3VOBA 4WH0A 1W59A 4A3IJ 4QVGA 4C0KA 3AHHA 3ISVA 4E46A 1A8IA 4YPFA 2GPJA 3W1VA 1UOPA 2C9CA 4RTOA 3DBHB 2QWXA 2DECA 2PFKA 1NF2A 2FN7A 4ZAVA 2XSDC 3KPUA 3N07A 2EJTA 5AVKA 1P9QC 2H31A 1HNNA 2WW8A 4Z0HO 1E60A 1V7CA 1QFXA 4AO6A 2OCLA 1S2NA 5CCXA 1NHGA 2OFXA 2QGFA 3OF3A 3TRIA 4QDZA 1BROA 3J7AY 4LE0A 3QFFA 1WRJA 3NS7A 2PXAA 3GUZA 5BW6B 3EF1A 1TWGJ 3DP7A 5M5XJ 3VR6A 4Z3OA 4GRAA 3ETLA 1PJTA 2JPBA 2JARA 3NIWA 3AL0C 1WZUA 1TK2A 3Q3EA 2F17A 2Q1YA 5AHRA 3VR0A 4B4UA 2W6NA 4BGVA 1EX9A 4EB3A 1EJ9A 4IL6C 5F35A 3ZCSA 1R66A 3H5RA 5A0TA 5DYTA 1TFRA 1ODCA 3S2UA 2NVYJ 3G7NA 4QTUB 1MQ9A 5DV5A 5JFRA 3GLHE 4I6JA 3CUOA 1T8TA 2JN6A 3TEMA 1DT5A 1E2XA 3KEGA 3ZVNA 4OA8A 4RV5A 5E4YA 5BN4A 3ESCA 1J97A 3DEUA 3ZOBA 1CUGA 4W4TA 2JFNA 2PGIA 3QZUA 1FDTA 3L1HA 5ITZB 2KJCA 4J7AA 5FKNA 1KQFA 5AKJA 3DHWC 2NP7A 4NESA 4KT6A 1G3RA 3PQ7A 2WTMA 1K98A 3ZCTA 5HDGA 4BNCA 5J58A 3QOPA 3ZMVA 4F2DA 4HNUA 2W4QA 1CQXA 2HPMA 3WBFA 1OI2A 1YIDA 3COSA 4BQPA 2FI1A 1BEUB 4YJKA 3FTQA 4CG1A 2CDRA 2NTJA 3C1OA 1IUNA 4UXNA 5I7WA 2ZIFA 4CCKA 5KKNB 1YQ9A 1VBKA 4UHHA 3QVTA 1XMSA 5B58C 2G07A 1PQ4A 3OLQA 5TR9A 3CXRA 2ZTLA 1HFJA 5F7ZA 1B15A 4YJHB 1FIAA 2ECQA 1V5EA 3VPGA 3UT5A 3IDOA 1NTCA 3RPUD 5KTSA 2R85A 5B4VA 2RK3A 4RH1A 1WXQA 3M5CA 4L0QA 4X6XA 2IHKA 3GGPA 2PVPA 4AIRA 3L06A 5E3OA 4IHYA 3EC1A 3HO6A 1M0EA 2FZ4A 4MKXA 1NW6A 3RHTA 1DIBA 4WW0A 3FB4A 1I7DA 1T08B 4B6OA 1Q16A 3R24A 1WMSA 4CM4A 3L1KA 4GP6A 1RYHA 1VYHA 1FS5A 2HI0A 4YUVA 2MSWA 3N7UA 2UVPB 2Q27A 1JMVA 4EHBA 3F67A 2YY7A 4K6OA 1KNXA 2V6BA 3G5MA 3MRXA 3EXHB 3RC1A 3UGTA 1W96A 2FWRA 2GK6A 4C0XA 5J1TB 4RKYA 4II3A 2N42A 2BE5F 3EIUA 4A7PA 5U9CA 1BA3A 2M8EA 4KIBA 1GP2A 4RQUA 3WISA 1RRPA 5DDIP 2V74B 1SUEA 3F71A 4UE6A 5EYPB 2K85A 4A8HA 1U1IA 4KREA 1ODDA 2NRAC 4PAOA 1ZQ3P 3LHKA 5E4JA 4JYAB 2J09A 4DJ5X 4GXQA 4ZANA 2COUA 4ESJA 2QTZA 3HDDA 1IC8A 4C29A 1Z07A 3JSPA 4JL8A 4RS3A 3UNGC 1CXZA 3T9EA 2RI1A 1DRKA 4U6NA 4ME6A 4EO4A 3G59A 4JP2A 4FQGA 3GYGA 2C4MA 2ORIA 1G5FA 1BR2A 3U7QA 3M3YJ 4JBIA 3SQLA 3C3DA 3GCXA 4CXFA 3ZWKA 2WJ6A 4GPBA 3ZVLA 4PLPA 4O8ZA 3VYVA 2PGOA 4NG4A 4ERNA 5B53A 2BTOA 3TD6A 1IJEA 3PS9A 4PLZA 4EJVA 2ZQZA 3LWFA 1PV1A 3WLNA 5EGOA 4TSRA 3KZKA 3OLCX 1NM5C 4ZCTA 1A5SB 2VWQA 4B7UA 1L7RA 4FDMA 3U5TA 3TW8A 1HE1C 4UUMA 1SU6A 2YFYA 3WLIA 3QFRA 5BP7A 1IG3A 3L7KA 4HX2A 3HOZJ 5K8IA 5BW4A 2X0IA 3O7MA 1QIDA 2XIGA 1YTLA 4NVRA 1KOLA 1CUVA 1AIPA 3CGGA 2PMDA 2WHRA 2PKXA 4L5YA 4MQBA 1KO7A 1II8B 2WLTA 4QGAA 3WAKA 3S8PA 4MNUA 2GOXB 2ZGVA 1PD1A 4KCGA 2PR2A 3WBKA 1FLIA 1OI3A 2G0TA 1Z74A 1XNJA 2OCAA 1I50J 1XTIA 3T7RA 4FM9A 5TIIA 2VPTA 1X8JA 3OYNA 4MV7A 4ZPJA 1T6BY 5ALUA 2BIFA 2F9MA 5LN1A 4EHFA 3O3NB 1DQNA 3DCNA 4HF2A 2JAHA 3DDWA 8GPBA 3DF7A 4IJQA 1SKYB 4AURA 1YK1A 3DTVD 3GZ6A 5EERA 4MVJF 3HSFA 4ZDKA 1J5YA 2I7CA 1RYYA 3FSJX 4HQLA 2NS0A 4NE7A 3LKBA 5CIYA 1UOQA 4O02B 2QRVA 5KVRA 1SURA 5KTYA 2P65A 4I8DA 4B3IA 1BDIA 2WMDA 4XZ3A 3ZZ0A 4K3VA 5FBKA 4RGBA 2K9NA 2Q2EB 1MTOA 4AECA 1KI8A 1W8DA 2Q0SA 4U02A 4P2BA 1SRQA 3HTUA 3Q5DA 2CHGA 2RC6A 4HQKA 5BYBA 4HQRA 2OUMA 1W4LA 2P6MA 1VIVA 4RADA 1WVRA 1TM3E 4BBPA 4PTYA 3VBCA 4JL5A 3IEKA 1L5HB 1GZ4A 2UDPA 3TAXA 2JASA 5I9NA 4TV7A 3PXAA 4BLUA 4EJUA 2GF0A 3KYBA 4HTFA 3NC0C 2BEVA 4KPFC 4FMDF 1FTYA 1SIUA 3QXJA 4I55A 4ZDWA 5I48A 4RNCA 2O2SA 5F98A 2RDPA 3G85A 3OZ7A 1VSUA 4HYEA 3JW4A 4M87A 3DZDA 1PZEA 3WLRA 1XGNA 3GF4A 2PLFA 4HNQA 1QWSA 4MUFA 1VZ2A 2QN6A 5B1DA 3K1PA 4ZVSA 1UL1X 2FPLA 3MCAA 4E7PA 3FSGD 3D59A 4RU1A 3WGGA 4CKWA 4ER0A 1DELA 4MB6A 3HABA 1LX6A 4OJQA 4XQGA 5HS8A 4LMRA 3BIWA 5HR5A 5AI4A 2A78A 1RCFA 4BU1A 3CN9A 1HE2A 2GA8A 3AHDA 4IDGA 3AFHA 3AH8A 1U8XX 4RSRA 2DKNA 4O0LA 3HYNA 1I3NA 2OT3B 1Q1AA 2J08A 1G7TA 4JP5A 1Y8QA 2ZUSA 4CTJA 1Z5NA 2B69A 1OCCH 1SQGA 3ZQJA 2CNLA 1X2MA 2WMYA 5AHXA 4BFUA 2E9SA 2DPYA 3IILA 2DSNA 3KBBA 3HN6A 2ZJ7A 2OZLB 1NVBA 2FHPA 4N3GA 1Z9BA 4LHZA 1GZDA 2YVKA 8MHTA 1ORRA 1YQWA 1JDTA 1E7QA 4I1YA 4LQLA 3LJKA 1NVTA 1SFEA 3L9WA 5CB6A 3D5TA 5M3MJ 1XVLA 1RLUA 1EUDA 4L7VA 3JTEA 3O8OA 4X24A 5TX7A 3OLXA 2JK1A 3EXIA 2VJCA 4R5HA 1V6CA 4JFRA 1ZONA 2NVQJ 2DFFA 3S2ZA 4YCMA 3JZDA 5D01A 2NAFA 2WHPA 2O1SA 4R9RA 5DWVA 3EE6A 3LT5A 2J9ZB 2I2BA 2AOUA 3ZWQA 3TOBA 4HNHA 4HS9A 3BXPA 1PEKE 4BLSA 4YASA 4XFJA 3SE0A 1AKEA 4TWIA 4ESEA 2A6PA 1WUHS 3NM6B 4WCFC 1Y7TA 1B6TA 1A97A 2P0AA 1QRUA 5ES4B 5JAQA 3CCSI 2IYQA 2Z2YA 1QHIA 4AJNA 4RV9A 3ABIA 3AO0B 2JCYA 4JR1A 3WYCA 4I7HA 2L2QA 5AK0A 3E6CC 5TJHA 2C4NA 4URFA 2F8MA 4L8YA 4RB0A 2A1IA 4URYR 4PLFA 4LRTB 1RZ4A 2FNPA 4XIFA 3ODGA 1K78B 3K35A 2OENG 2O8FA 3PFWO 2HWKA 2P1RA 1C3XA 4KYTA 4C01A 1WJCA 2AF3C 3EVBA 2ZUCA 1UPBA 2PWAA 2ZRFA 3E6MA 1UFVA 4OJTA 5T5QA 2H29A 4UPEA 4YROA 4PSUA 1K4KA 4DA9A 3GRAA 4LJ5A 2EFCB 4RMNA 5C3UA 1BI3A 4AO7A 3WB9A 4M0LA 4GZ5A 2CZGA 2C7QA 1BL0A 2KM1A 1E6LA 3KHUA 2YXBA 2C82A 5LBIA 3GUYA 1C8BA 3MXTA 4TN5A 2ACEA 2FBHA 1ML4A 5CAEB 1G98A 5LL6P 3H6GA 4I98B 1ZXXA 2NO6A 1NUPA 2HCTA 4A0HA 2FPWA 2FR0A 4DQDA 3PEYA 3SXYA 4I8XA 1GQQA 5IT9A 1U0FA 5EE0A 1IJKA 4HZFA 1E3PA 1HQKA 3GFFA 4XCVA 1QP7A 4URWR 2YHIA 4AX8A 4UM5A 4D1YA 3SPXA 1OZGA 4KDFA 4RPKA 5DXFA 4KXVA 4P54A 2FDCA 1DB3A 1II0A 2XE8A 2STTA 3VPHA 3L4BA 3RG8A 4DV4B 3NNSA 4BCDA 4LXXA 2A69F 3H1BA 2YJGA 1NJ1A 1J9ZA 5F27A 5JAUA 3LIIA 4UUNA 4Z4FA 1P9RA 2NT4A 4I1IA 4NFSA 4M99A 4HDNA 2F3RA 2IE0A 3COYA 3JAMZ 1QZTA 5AJZA 3ZK7A 1YB1A 3JQGB 1S8AA 1T5SA 3P7MA 3FPHA 5J8CA 1POXA 1RZ3A 1E99A 3FTFA 3SMVA 2A5WA 1ORTA 3I92A 1KYQA 4JX4A 5CR9A 1DBWA 1TA9A 4PWYA 4FB5A 1YXMA 5IDWA 2WWTA 4CLDA 5KNDA 3A1WA 3A31A 5FLEX 1RI4A 4IS3A 1Q1VA 4LNUB 1V8ZA 1H2HA 4AKSA 4N6NA 1PJ2A 1DC3A 3HB0A 3PDIB 2BGGA 3I61A 2CE7A 3T06B 4I66A 1JPVA 2B92A 4ZO6A 2XB0X 2L7ZA 2IYVA 1X14A 1NU6A 2CL7X 3OYDA 4Q4AB 1RKTA 2R7WA 4QQFA 3HN7A 5LDDC 5JT1A 2R7LA 1M1UA 3AONB 4G7OF 4PONA 3K2BA 3G17A 4J0CA 2CMKA 3BZKA 1QGPA 2XVYA 2WNSA 1WM1A 4GGMX 1Q1QA 1UANA 1XA0A 3BE5A 3RV4A 2AN5A 3DVAB 4GWLA 3LVFO 1CCWA 2QS9A 4G7ZF 1X7ZB 1FW8A 4HDQB 4RQAA 5DTEA 1AKMA 5EE5B 1ZH8A 3PICA 1U6JA 3ANTA 1FMTA 2AI1A 3WTXC 1UB9A 1Y0UA 2BUBA 1DTSA 4OU4A 4PFOA 2E1MC 3G1UA 2PYZA 4DMUB 1S9HA 2JI7A 4C05A 2NUBA 3IT1A 1VLQA 3V8BA 4D8UA 3RQSA 4YIHA 2VBGA 5J5CA 3LAJA 1YR8A 1B4DA 4KIJA 1PD0A 1NH3A 6GPBA 4L6IA 1UPTA 2JZYA 3DXXA 3FFWA 2FMLA 4LMAA 4OGFA 4EEXA 2WT4A 1OLUA 2EFDB 1XLWA 3RKSA 3H6HA 2B8EA 1I0IA 4HY3A 4A0SA 2HPZA 4EW1A 1T15A 5EHXA 1P0PA 1W4AA 4GX5A 1RESA 1MIOA 1U80A 1GDHA 5F4ZA 1NJ5A 5LZ5A 4R83A 6YASA 3AUAA 4MYHA 1NXSA 4ADSG 1NBOA 2XCRB 2XECA 3NEPX 1UG0A 1RABA 3PF8A 4NCIA 1VLMA 4GZMA 1QSGA 1E8NA 4BEHB 4A3BJ 4GPZA 3I71A 1YG2A 2M1BA 5JNWA 4G4GA 4I0WB 4CKYA 3TP3A 5C1DA 4RVFA 1KXZA 3CHYA 1FFAA 3W4IA 3IAM6 4HH0A 1S3JA 4I6ZA 3A6PC 3UAYA 2BLLA 4OUKX 4IFIA 1CVIA 1B1CA 3L4EA 2I10A 1DXQA 2L01A 1X7YB 5HVNA 1TVCA 2OXFA 2H07A 3GDFA 2V58A 3SZ3A 3X2FA 1SFOJ 1QZZA 3CZ4A 3EULA 4MRAA 4PAGA 1CZHA 3NT5A 4OB6A 3RI3A 3N8GA 1S8OA 5ELLA 4JU9A 4I4TA 2NUAB 5KTTA 1PGQA 1ZVVA 5KKAA 1FB5A 5E6SB 4B35A 3SEAA 3ADCA 1U9JA 4LF4B 2YYZA 2K87A 2VBCA 1JEEA 4HNAB 4CGYA 4ZC3A 2BFFB 1YE8A 1YDFA 4C1NA 121PA 4PC1A 1SVOA 4DDKA 4IH9A 4OI0A 2FCAA 2KHMA 5JMTA 3HACA 3F0TA 3QWIA 3WGQA 1XPRA 3SDZA 4BEVA 2WBLC 2M6KA 1EP1B 2IC5A 4JNKA 3GARA 1ZUD1 4WUTA 3R7FA 3KKOA 3C3XA 1U1EA 4AIKA 3AF2A 2VE8A 1SOMA 4Z9XA 5L3GA 1UKAA 1OR7A 4PBTA 1F1JA 5KUTA 1NF9A 4HVCA 3WNQA 3KIPA 3OZXA 1HKQA 4J0JA 3WNZA 5EE9A 3PSIA 1PFUA 3DTNA 1QBJA 4QD3A 4G0QA 2FOLA 3K2IA 2C9MA 2WAQN 5FRDA 3KYIB 2V0NA 2UUZA 5JRDS 4IIHA 4UCFA 2WU3A 4NLLA 1L6IA 5E9JA 2O7OA 3B20A 2YNMD 2HMWA 3H0CA 3RH0A 1UQRA 2GT1A 3NOQA 1Z2AA 3DO5A 4DLYA 4KPEC 3L1VA 4A8JC 4R16A 1ZIDA 5AIPA 2ZJAA 3PQ8A 4C2AA 2WNHA 5FJJA 1G2HA 1JIXA 3KFLA 4QUEA 3RYFB 4LGYA 3T9AA 2WVGA 4TWZA 4DT1A 3K1AA 3FIJA 4H9GA 4RFLA 3FTCA 4KR9A 2P0YA 2NSLA 3C2GA 1JDJA 3U9TA 1CJSA 5CFOA 4BHTA 2GTIA 4JLAA 4JOQA 4Q48A 4LDPA 3W6PA 2FUEA 2IU3A 4YGXB 2LFBA 5HNFA 3H2YA 4PSVA 1X1EA 2VXDA 2ZMEA 3HPQA 3EDYA 2JVKA 1DAOA 1NZDA 4IPTA 1FTTA 2QL5A 2PYIA 1MH9A 3OEYA 3SZLA 5J2TB 2RHCA 2P2CA 1WZNA 3NHZA 3HHPA 5HK8A 3S2FA 3UMMA 2BFPA 3PWZA 2AA3A 1IUFA 4ND8B 3L0ZA 3TR6A 5D5PA 4GGGA 2AXEA 4LVOA 4M36A 3GDHA 3QE9Y 1ISMA 1J8MF 2H8RA 1AV7A 3SLKA 2EKQA 1VGVA 1DTWB 4HAVA 5BN1A 3N76A 4FX5A 2FQ3A 2VKDA 4O4JB 1ZH0A 1WW8A 2D62A 2Y0CA 3ESYA 3JR9A 3QEBZ 3GFIA 5K6TA 4W8GA 3V8MA 3EPLA 3DLAA 4XD2A 3JVUA 3SIWA 4XJSA 1UK9A 4UM9B 4DWVA 5THXA 3QLVC 1KO1A 3TFQA 5GPBA 3BQYA 1ZNYA 4TGLA 2GCGA 5EJFA 2NG1A 3Q0VA 2PUWA 4F8EA 1A5BB 4A0ZA 4P3XA 2OGSA 2ZIWB 2IUEA 2GRJA 1M0TA 5F1KA 3GFPA 4M8NE 2O54A 2BZGA 3IL2A 4RAGA 2HDOA 3L8FA 1VI5A 1P91A 3JV7A 3R20A 3VU0A 1WW2A 1MNAA 2G88A 4W5TA 1PNTA 2Y9ZA 2NU6B 4KPGA 4BL0B 3MPUA 4QYMA 1QFZA 1GZHB 5DTIA 4AVZA 4RHTA 4ZJYA 2CBXA 4K05A 1PU2A 3IDZA 3DZCA 2G9QA 1R8JA 2ZNZA 4M0EA 4FZ3A 1A4UA 3G0IA 2OZ6A 3CF0A 1GXPA 3VZRA 5FQNA 3GJ0A 4J94A 4JVLA 4WZAA 2HBRA 3NGMA 1E7WA 1NK2P 3ESDA 2ZKLA 3LLMA 4B6JA 2JCXA 2WWIA 1H9BA 4RMIA 4QRIA 1P8JA 1KZGB 1QFMA 4D8XA 3NAZA 3ZPLA 4QDKA 4R6XA 4YRJA 1PT9A 4RDUA 1YBAA 4JENA 1B59A 3M1EA 1PX2A 3LKDA 5CH8A 2QVCA 4BX9A 3LBHA 3FPBA 3B2QA 5K03A 2VPWA 1E3QA 1I1NA 4RPGA 3REQB 3RRXA 3EGCA 2HZTA 1SCBA 4BNFA 2QAIA 1YCFA 1VLHA 3HEFA 5C7OO 1VLVA 2V9VA 1OQAA 4KXNA 2O8BB 4B45A 1A9XB 2IVFA 1RKQA 3K32A 4CHTA 3MWDA 3GH3A 1X7XA 3BTCA 1TKCA 4A27A 2PAFA 4ZCPA 1R9MA 5CJJA 2R84A 1E3SA 4RTMA 3RGWS 1ZJ4A 3EPJA 3ECHA 3GTKJ 3TNDA 3GDOA 2PU5A 3MRSA 2AXTC 4DZZA 4PM4A 2OBFA 2PFBA 1TNSA 2QTLA 5KINB 2QMZA 4IJVA 3REFA 3M3HA 3ABQB 2QZSA 4NNOA 3JQ8A 3PLRA 2OWDA 3TDNA 1K6IA 3VVMA 5EJ4A 1OCZH 3ITDA 4C9YA 3HB9A 3LSTA 1ENOA 1G21E 2Q2OA 1MRZA 2JT1A 3WQBA 4D4LA 4RFSB 3FPSA 1LFDB 4C03A 3ZRGA 1BMDA 1PTJC 2GF2A 2WSMA 4A12A 1K86A 2BKAA 3K71B 3RIXA 4BMYA 4KZPA 1CR1A 2VHWA 5H1YA 2W37A 2FW9A 4XW2A 1R71A 1H85A 3OP4A 3R5XA 2QVGA 2W24A 1YH3A 1CEEA 4UHKA 5K51A 1ENZA 3WLQA 4PLHA 4PC3A 4PJ0C 1F0NA 3ILYA 4FZ5A 3HUFA 1KONA 2CUZA 2CKMA 1V96A 1IQRA 5JO0A 4F11A 4BNMA 2O8DB 2VQGA 4IQ0A 5DNEA 1Q3KA 4Q9LA 1HQYE 4ZTFA 1C7IA 5FTWA 2MWMA 4QM7A 1PR4A 2FQ1A 2VJNA 2I3GA 3B51X 1VOTA 3LDUA 4EZIA 2VTBB 4FYYA 3NWPA 3PB3A 4BN4A 3HXMA 4FOSA 4N0PA 2BHYA 1RXUA 2UUPA 4GECA 1BVYF 1S4MA 1EQ2A 3DE3X 3ESQA 2G7HA 4MS1B 4DCJA 4XGNA 2Z9BA 2QTAA 1WPKA 3I5UA 2YMPA 3BG7A 3M5PA 3WYBA 5ANRB 4F3YA 4LJ7A 3OOJA 1QR6A 4BY1J 1W1IA 4FGZA 2Q4TA 4JB3A 3CQZJ 4NMWA 3CKYA 3CLSD 3SYTA 2AS0A 4WDRA 3GTQJ 3ADKA 3SBDA 3RNOA 5AP9A 4NICA 5AVZA 1AKYA 4A6DA 5K5RA 3BG6A 3JRCA 1PUFB 5ARDA 2WV7A 1V43A 2WOJA 3LY5A 5BWMA 5KYGA 2NTVA 4KIGA 3N2IA 1KK3A 1EJ0A 2H1RA 1TT5A 1UG2A 1NSFA 4PTZA 1Q15A 3JAKA 2V5UA 1KMIY 4V02A 2O0LA 5DVZA 4HOYA 4J6FA 3OIGA 1AQUA 4HB3A 3H97A 2CT8A 4P83A 1J09A 1KH1A 4RK7A 5CMLA 2YWGA 4U4AA 1JHQA 3VJRA 1SVLA 1KI2A 5ALXA 2GYVA 5FUXA 3KKNA 3A2KA 1SD2A 4XLEA 3B6AA 1RZVA 1I9GA 1TYEB 1MX9A 1LX7A 1WOMA 3URMA 2QLBA 3WLEA 9ATCA 1MDFA 2F8SA 4ETIA 1DAFA 4NTZA 3IAM1 1OYVA 1GFIA 1U8TA 4JJZA 3IR6A 2H94A 2ZSHB 4M88A 5MGBA 3LK7A 5AUPB 3ZMDA 4YCSA 5DWDA 1ND5A 5JS7A 1LZLA 2QRZA 5IFKA 3HYLA 1K4TA 2FQYA 1HYHA 2Y75A 3CUYA 2BM0A 4RABA 2NNLD 2BFCA 1KH3A 4KE6A 4CG2A 2Q0OA 1OT3A 2KHZA 4JVSB 4MQ9F 2KBFA 5JDIA 1BFUA 2CXXA 5K3FB 2ZJFA 3PFCA 5IAAA 2FWBA 1JHVA 3IEUA 4LHEA 1RACA 2BV3A 2YN4A 3C0KA 4PZZA 3A4CA 3I9V6 1KI7A 3MW8A 3O03A 1HKSA 1R6UA 3OPYA 3DKWA 2XCOA 3WK6A 2LR8A 5LZ7A 3NTRA 1N5RA 3L7OA 1JRLA 5GP1A 3MZ8A 1JN0A 4KG7A 5CYFA 1T4DA 3KAJA 3DLPX 4F7WA 1H2WA 1GUDA 4ZO4A 5JH7F 1IXRC 5AXCA 5IUKC 2WWHA 3L79A 2FPKA 4V0OA 2UXBB 3COAC 2ZM6B 3BC1A 3FVWA 4B8WA 4DOZA 4E88A 3GRCA 4I8IA 4FFNA 2W6MA 1PAUA 1SJ9A 4PYOA 5JY6A 4LZOA 4AKHA 5LBUA 1KA8A 2PEZA 1L4UA 5HIIA 2YV1A 3FZGA 4LHWA 4E5PA 2P0EA 3BCSA 2XXAB 4QUDA 5J2UB 5JI2E 2DO7A 2RAEA 3H4TA 5AW7A 1VHTA 1WMEA 3K0KA 2QUZA 4EFLA 4F1JA 4P9NA 4DLZA 4QATA 3DTVA 4ZJUA 1M8JA 3TMYA 5LZ4A 2ZRJA 3AEQB 3F8CA 2FNAA 3QNMA 4QC2A 5LQRA 1DGQA 3Q0EA 5FTMA 2PLWA 1R1TA 3B9QA 1XQVA 3ZH2A 1GUFA 1TQDA 2WWYA 1F20A 1D2HA 1XELA 2VJJA 5L4LA 2F4NA 1YE9A 4YMHA 3V80A 4HSEA 1U2EA 4WMLA 1NASA 1WOYA 5K7SA 1JBQA 3VR1A 4H27A 1L0BA 4ZKEA 1U8EA 4JLKA 2YMLA 2EWWA 3M4ZA 4OD0A 3ZEAA 4L5BA 1KOFA 2AEEA 1SCDA 2RB5A 3D4LA 4YELA 2AHOA 4CMBA 1B93A 1SULA 2ZBKA 3KEQA 1G2IA 4YFXF 1G66A 3BD6A 4BFTA 4IRHA 4Q1VA 2LTAA 2Y1XA 2LKCA 2GZHA 1XMIA 2PGAA 4LCEA 1EG2A 3DZIA 4AUMA 4PGFA 3EVNA 1R74A 3EBPA 5ECWA 2F3PA 3ZI0A 1GTJ1 4CMAA 2C5GA 2E7WA 1WPQA 2JEYA 2C20A 1OCPA 3I4FA 3UGQA 4NR0A 2FYTA 3QVMA 1B6RA 4DCPA 1V4RA 2VXZA 3Q7PA 2R4TA 4X97A 1CYDA 4KQEA 1JQAA 1ZNXA 3HCOA 2C2WA 2DYSH 3L02A 5KOIA 3JWEA 3VPFA 2D1TA 4X41A 1WVGA 2V7GA 3MCVA 1NKVA 3BR3A 3GEMA 1CY0A 4X6AJ 1U90A 1T6ZA 4EFNA 1JDUA 2ECFA 3OJOA 1TJPB 4GVPA 1VQ7I 1GVJA 3AESA 3FNQA 4NK4A 1QS0B 1HDGO 1ZUHA 1CUEA 1DRWA 2JC3A 4O2BF 1JJBA 3P19A 2WWGA 4H6WA 1NXQA 1ISIA 2PHZA 4US1R 3TOAA 4HEA1 4HDKA 1FDRA 4B7AA 4K46A 3BQMB 1C1YA 5FBQB 1BCRB 3JYLA 2PJRA 4GFBA 4XLLA 4W97A 1P81A 1MOPA 2NYVA 2OZPA 1QKIA 2H7VA 1I4OA 3CLQA 3IHUA 3FMVA 3CVUA 4IO1A 3UCEA 3H4MA 4ITRC 2C2OA 2ECOA 3AFOA 2EW2A 3BSFA 3W6ZA 5FH9A 4B4KA 2QIPA 4ZOCA 1O94A 4FSHA 2HA3A 4IDQA 3A2MA 4KBYA 1N3IA 5DLYA 4G2TA 1WDLA 1CIVA 4BZXA 3K92A 3HTXA 4A8TA 5ALNA 5IKMA 1SVMA 3BIOA 5I4CA 5T3YA 4LLNA 2NU9B 1R9JA 4WBNB 2HCBA 1VFNA 4CF4A 4L73A 2R3SA 4BTEA 4DLWA 4BBAA 2R7SA 2R60A 5E9AA 1EM8A 4W5WA 3KOWA 5BQOA 1CHNA 2QV0A 5AQEA 3QV2A 1BMFA 2NQ8A 4AZTA 3WXMA 5EZYA 7YASA 1H8HD 5IJ9B 2Y1GA 5HP4A 3BPSA 1JQ5A 3DFFA 3HUTA 4AIHA 1AS2A 2VPIA 1ODLA 4DBLC 2R1VB 4IGIA 4WKOA 1XRRA 4P7BA 4MI6A 5EWMB 2RMKA 2ELHA 2VAWA 1FOXA 1L5QA 4IILA 2ZXIA 4DCOA 5TPZD 2A68F 3FNFA 3TLZA 4U0KA 4TKVB 3DE0X 4YEDA 3NAGA 2DW4A 1J24A 1RJEA 4KPUB 2G67A 1UOOA 2YFKA 3AWDA 3GJTA 1P1KA 2I2AA 4UNRA 2JVHA 2O3SA 3S99A 1FXSA 3TR0A 5JHGB 1V5FA 2FPIA 4NEHB 4DYVA 4YB8A 2HWWA 1T36A 1TAHA 1EXDA 4JJFA 4DRZA 1I2MA 1JA0A 2KJQA 3ZG6A 4XYGA 4L4XA 1M2KA 4AB1A 4W9MC 1WWXA 5EG5A 2XQKA 4H77A 3RUCA 3K0LA 1HDRA 2BFDB 3VTFA 1LFAA 3QPSA 4Z1OA 1NI5A 4TRRA 5TEWA 3FXQA 4OHZA 1VQKI 3CVXA 3OM8A 4O4IF 2ZETA 4WINA 5LDHA 1LI7A 3OAAA 1J7JA 3FDJA 3KP1A 3BMOA 3MFKA 3HBMA 4MUAA 4G81A 4FMBB 4Y4RA 2M1XA 1C3OB 4B0OA 2NNWB 4R0VA 2CVPA 3EYWA 1JEYA 3DBRA 2VF4X 4KRYA 3LKVA 2DFEA 1EF4A 2Q6VA 4I3HA 1B16A 1CD5A 2H59A 5CVDA 3OWOA 3OPMA 3A0BC 3P5JA 4XX0B 4IJUA 3R5FA 4C0BA 2GZ1A 4WRRA 5CEEA 3WDLA 1F06A 4HX8A 1FA9A 2QNRA 1ZGWA 1B8PA 2GI4A 1ELOA 4AN4A 2RK4A 1SC9A 1U7DA 1G6Q1 1XWFA 1SD4A 1V16B 3D0KA 1REQB 4KMMA 1T8IA 3R1IA 1ZH2A 1CF7B 1NXVA 1Z8DA 5EXPA 1MRSA 3BLYA 1ETYA 4PCAA 2IT0A 3PRKE 4B6PA 5DH9A 3ZHRA 3WQHA 3PUWA 4BOYA 5D87A 2BUAA 2R6GA 4R0MA 3QUQA 4GCVA 4Y9RA 5IYDJ 4FR0A 4EJFA 1AOXA 4TL7A 4MVJP 2DAPA 3BSWA 3BFXA 1Y4UA 3JYQA 1MR3F 1E0AA 2Z8YA 2FJPA 4FNMA 2H2HA 3QKSB 2FUG6 1K66A 1AQJA 2XI4A 3ZGLA 3KC2A 1FXUA 1LRJA 1DV1A 4PF1A 5HLGA 1G0OA 4UHEA 1JLHA 1O0SA 2C3YA 4GMKA 3ASOH 1RRGA 2ZJYA 5ARCA 3SMQA 2F3UA 5LZ8A 1NVUQ 4DBLE 1CP3A 3D9QX 5IT9K 1MO4A 1CDZA 2G77B 5HNHA 3ZY4A 2GTPA 1K6OA 2QDKA 2VP9A 3DXFA 1LTHR 4B34A 3OTOB 4UASA 4HDMB 5GV7A 4DRXA 2J3LA 2JJYA 3RSZA 1LFPA 2PH3A 5HUQA 1Q7TA 1ML3A 3GRUA 1HTWA 1MJBA 1E2EA 3L6CA 3TECE 1SAXA 3ZLBA 3S40A 4G8JA 5BSVA 2R8RA 1RWQA 2IKSA 2GHRA 2PNFA 5KNLA 3FCAA 2L0KA 3AF5A 1MO3A 2G5PA 1G5HA 3FYSA 2ALJA 2ZSUA 1HKUA 2RQPA 4PX2A 1NONA 1ESCA 3DOUA 1RXCA 3IE2A 4D43A 5J6XA 2WYIA 4NE9A 2VHEA 2IS6A 3GLHB 1B9MA 1XROA 2C8JA 3KE9A 1UC5B 4YJGB 2I99A 3ROUA 3SYNA 2ZCWA 3O9ZA 1SAYA 4J0IA 3NTXA 4XDGA 3OI7A 1XAGA 2UV8A 1NYRA 1UPCA 4XIGS 3D6MA 3R3WA 1KQ0A 1W0JA 4Y52J 2BEWB 3WKEA 4Q47A 1E9BA 4PSXA 3OHMA 2FB9A 2DVMA 3AKCA 1TK3A 2XRLA 3I9V1 5F7XA 4KGXA 1WW3A 2HGSA 1XFAA 3Q87B 5L4SA 2YY5A 2Y1DA 1TJYA 1HORA 5D1HA 5ALZA 2QUHA 2FMFA 4HZIA 3KV3O 1MVNA 4F4HA 1N9KA 5LOVF 3ZGVA 4N65A 3TI7A 1AMOA 3JX9A 4ZTZB 5KQGA 1OROA 3CEPB 2WY8Q 2PUEA 1ONSA 5EGNA 4DDHA 2P9TA 1A98A 1O5OA 1Z73A 3D6JA 4IRUB 1U7HA 1GTSA 4JUDX 5JLWA 1QRAA 3B5IA 1YACA 1Z6XA 2V6FA 4OREX 3O21A 1T2CA 2YC2C 3WMXA 2HXIA 1LKXA 3DVSX 3PE3A 3GN1A 3AM5A 3LLUA 4OIPF 2DBVO 1WSAA 3ONNA 5F9FA 4LA4A 4YHBA 5DN9A 1Z7LA 1AB6A 4HB2A 4ZVRA 5LJIA 2I03A 3CW2A 4BDTA 3K10A 3WLAA 3X1MA 5AVVA 2ZREA 3Q0IA 1DEAA 3FUXA 2JGIA 4REMA 4YQEA 2V8BA 4XR9A 3LDGA 2JJ2A 3B6JA 3QV1A 1G8KA 3B6EA 4M9UA 4MWOA 3O8BA 5J1SB 3HYSA 4DMRA 2PN6A 1NBHA 3OPVA 4MW4A 1YR7A 3W5CA 4PGAA 1K6XA 3K4MA 1Z12A 4MHSA 1VQMI 4BDZA 4NZNA 3QTLA 3KU4A 3HJRA 2VHXA 2GCOA 2WE8A 5HJ5A 2V55B 4DM3A 2WJHA 3G9XA 5BQXA 4HEA2 4BMNA 2JA5J 3OEWA 2V7UA 3VU9A 4G6ZA 3AL0B 1JR4A 4D46A 1ZUNA 4H2DA 3RF6A 1YYVA 4TZKA 3PQKA 7ABPA 2BBTA 3T1VA 4N5HX 3N0XA 1W30A 1G3TA 5FKMA 2LIVA 4AFNA 1OZAA 3JWIA 3OT5A 3BCRA 3DCYA 4D4GA 3FNGA 5D6FA 3D3KA 1RCTE 4YO8A 4CU2A 5FUWA 3LGSA 4UE2A 5CA1F 3W8DA 2M6LA 1ZUWA 2CVHA 4ZICA 1XA3A 1A7JA 2JAXA 4DLPA 3GMDA 2FZCA 3PITA 1PEAA 3D3JA 3TIGA 4UV9A 2HDHA 2EV0A 1JSZA 3QLJA 1Z0IA 3K70D 3UXEA 4NC7A 2R6AA 2E2WA 4UE3S 1Y8ZA 3V46A 2DPHA 2M6RA 1FFSA 2F48A 4HUQA 1EH8A 2FBIA 3N8NA 4CCJA 3I6YA 3VVBA 1LRLA 1SXQA 4A3DJ 4OLFA 1P1JA 1RRFA 4OHRA 5GJBA 5LQCA 5B7GA 4K5QA 3AZOA 2R7FA 2A5GA 2NO4A 4MJXA 3HP4A 3VI4B 5CPBA 2R5NA 2BJWA 2QY6A 4F4IA 2EA4A 2VDMB 2Y68A 3GW8A 1IJBA 3EZYA 4P4SB 4KXLA 3DV9A 3WRVA 1GZUA 2V9KA 1WNFA 3CF6R 4JI5B 4Q3AA 1JH8A 1Z91A 1ZMXA 5K3OA 2AS5F 5EE3A 3SM3A 4PHCA 2FZKA 2G70A 3VTKA 2IUTA 3PBKA 1TE2A 2OAP1 2IEBA 2RHOA 4YRQA 3OE7A 1U5CA 3LPAA 4G56A 1NV8A 4IWXA 1JWAB 2OV3A 4UPVA 4HMPA 1RM4A 3ECCA 1POWA 3CJNA 1E9FA 2X41A 2OHJA 3WE7A 3WWPA 2PLYA 2YHUA 3H1AA 3S44A 5HKAA 5A05A 1TZJA 4RFVA 2LIPA 3DTIA 3DOFA 3EUAA 3ETCA 3UY4A 5KSYA 3SFTA 1BW9A 2QJFA 1FNBA 3VZQA 3AOEA 3J80K 2O3UA 1PF7E 1G3IA 4WZZA 3DAYA 4GHWA 2QQFA 2H09A 2OD9A 4I99A 5I9TA 4QJ3A 1RXEA 1GCAA 4Q1BA 4ZK2A 1UINA 3LFHA 1PQYA 2BFMA 2OCDA 2ZE8A 2XGEA 4EJ2A 4HWGA 1HUQA 2EC5A 3A11A 1Y3IA 2XVMA 3LRXA 2GD0A 4RZSA 4F97A 4XM2A 2Y76A 2P77A 4I2OA 2X3UA 2OLEA 2VDWB 4ZVNA 1P3Y1 1RWNA 4DEXA 5AK6A 3L7NA 2PD3A 5EOVA 3OOUA 5IJWA 4AULA 3LUKA 2Z43A 2O2IA 5LQUA 4WPGA 4EQ6A 3TGNA 1EBBA 1QRYA 2VNKA 1ST3A 3LC1O 5TMPA 1D5CA 5KNCA 2A86A 4D3YA 4MS3B 3K8QA 4UDOA 5T7BA 2B2NA 2Q3CA 4FUTA 1KFKB 4BV8A 2GVNA 4BJ1A 4IGKA 1XDDA 1FYKA 3TW0A 2WD9A 3I54A 3T7TA 5GTIC 4CL2A 1O97D 5B1YA 4OHMA 2GKOA 7MDHA 2XWQA 3NHPA 1JT2A 4J8PA 1Z8FA 2YX7A 3D5RC 1LVKA 4QPQA 4XKCA 3CUQA 4V0QA 1QVZA 4I5EA 2DH6A 2VDNB 3LYLA 2F5VA 2ZR9A 2WJWA 4K2AA 1BVRA 4XRGA 4YRAA 4W7IA 3FKSD 2QRQA 4F71A 2W4SA 3IT2A 2PMHA 3M6AA 1I27A 2PR7A 5G3YA 3ZK8A 5JARA 3AIKA 1KFJB 4JSYA 3GMSA 4LDAA 4YPVA 2K3FA 4XEHA 3VX3A 2CXNA 4YQZA 1NQUA 1I2BA 1XQ6A 4ARSA 2BEKA 1YX3A 3E2PA 3RAGA 2GWHA 3DVQX 5DGHA 3U9SA 3MCUA 1ZSYA 3SJUA 4ESVA 4U88A 4CFZA 1M83A 3SJAA 3DEAA 5DU2A 3T3GA 1Y8AA 2IBDA 3CUSA 1V7ZA 4KX5A 1U6IA 1F1ZA 4NARA 4TL9A 4C7MA 2KDOA 5IH7A 4ONEA 3A70A 4OATA 1ZJ5A 2V6EA 1P39A 3EPZA 4EHKA 5AIBA 5IOZA 2PL9A 1GRQA 3P2OA 3X0DA 2WKWA 1YKGA 2IUUA 4D9FA 4MFDA 3V2UA 1N33B 4M3GA 4OP3A 1BYUA 1D0XA 2EFPA 1W88A 3HCFA 5J40A 1RYDA 3FGOA 2Q5IA 1IZ0A 2CNNA 4HXEB 2GUGA 1JH9A 2QXTA 1KAEA 2ZXEA 3R9XB 5CT9A 1Z22A 2FUG1 3ABKH 5DT9A 2YS7A 4QPZA 2PCJA 3LUFA 4F6CA 3FBNB 4LY3A 2EA2A 2PTHA 1B23P 4ZZDA 3D6UA 2WA2A 1VL8A 2HNKA 1TA4A 2H0AA 2Q6KA 3DE6X 2H6EA 3OE5A 5C1IA 4BFVA 2UYHA 3HSEA 4JLPA 5G2OA 3TNYA 1K1EA 4IZ6A 4JUBA 3QWBA 1CVRA 3CZRA 2Y6VA 4G09A 2MIIA 5F1OA 1WX1A 1L7DA 2VAPA 3QH4A 4M72A 4C7KA 2MSCB 2IU0A 5FFZA 4I9HA 2FF4A 2V9CA 1SZPA 2HOAA 4QUIA 3OYMA 2YZ2A 2QMYA 3HSSA 4MVJI 2HR1A 2BTQA 3V2HA 3V4GA 3ONDA 3RIYA 2BXYA 4YJFB 3GEBA 4LJKA 5T8KC 2C97A 4IYJA 1MB4A 5LB2A 3C48A 3NANA 2RB4A 1COWA 2QE7D 4G0OA 3K96A 4EKIA 4HQNA 3NT2A 1NHWA 3CPJB 3TSYA 1RRMA 3CWCA 3PEFA 3LCUA 4DUGD 2VKEA 2ZBGA 1OFGA 3ETNA 1R0RE 2Q6OA 3TDKA 1K6JA 1WPGA 1NQTA 3SYMA 4U2FA 1U1CA 3EXFB 5DM70 5IT3A 3NBZC 2I4MA 3EK2A 5F78A 4UHJA 1R3UA 3FDYA 5BMVB 3LSJA 1EHCA 3AOGA 3X44A 2OTJI 3HCAA 1I4DD 3ZQ6A 2FWJA 1IDN1 3LX6A 1KQOA 1S5PA 1T4CB 3TLGB 1SM4A 2BGLA 1SU7A 3AP3A 1VPWA 3W5JA 4MRMA 3M07A 2IZ7A 4QBGB 1U6KA 5GADl 1E2UA 4RULA 2JLBA 4X94A 2IHNA 2IX9A 1N57A 4O5AA 1H93A 3LC7O 1ZN9A 3EODA 2JGNA 3MNFA 3NV7A 2FWNA 4AZWA 3VR5D 3WGHA 3DW3X 1M6HA 4BZQA 1ZN2A 1HYBA 2NM0A 3F4KA