1S8NA

Crystal structure of rv1626 from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
190
structure length
190
Chain Sequence
AVPRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords putative antiterminator
total genus 74
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s8nA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s8nA01
2QYOA 4XRFA 3OQMA 1BIAA 4ZJPA 3E6CC 2ZBKA 1B59A 5F6FA 4QWQA 1BN5A 5L3BA 5ABPA 3KTOA 4W5QA 1TLFA 4IJAA 1I27A 3TGNA 3EODA 1PP8F 3QLUA 5D8LB 1OYWA 4EVRA 5DGCA 1B9MA 2A07F 3OM1A 2HQNA 3EAFA 3F23A 1DBQA 2YX4A 2QQ9A 3V8KA 3E5UA 4LK0F 5E20A 4MQEA 3H1GA 5E17F 2H0AA 2PQ8A 5E3JA 3WTXC 2FW0A 4D0PA 2R48A 4EY3A 4RGXA 4LRQA 2PBIA 3T0YA 3P7NA 2NAZA 2Y75A 3LUHA 1FT9A 2QWWA 1QZZA 1J59A 4RGUA 4RY9A 2PMUA 5ILUA 2LP4Y 3O2JA 2L3DA 1PP7U 4IGAA 2G9WA 2R7DA 5FWXA 2TDXA 3H5WA 2IP2A 3E97A 4KUMA 3EQ2A 1KRWA 3T5XA 5LHGA 3LUDA 1V4RA 2E4YA 1R22A 3QU3A 1VTNC 1JDNA 3IC7A 1J56A 2VBWA 1XDSA 4IXAA 1MB3A 1W7PA 1ZLJA 3WE2A 5ICFA 3OLZA 1QNTA 4NCAA 4LFUA 1DRKA 2JRTA 2LDUA 2A6HF 3QP5A 3RH0A 2ZO4A 3FWEA 3JTHA 3AAFA 3MA0A 3E3VA 3KYJB 3FGZA 4MGRA 2XAGA 2VT2A 2VBXA 1I5ZA 2HTJA 4IMJB 4PZJA 1E6KA 2YHAA 2P6SA 2X0LA 2NT3A 1I3CA 4I7HA 2UZKA 4A0XA 2E7WA 2Q8KA 1ZN2A 2IW5A 5T3YA 1L0OC 2KJCA 4GO1A 3DXJF 2PLYA 3HV2A 2F8SA 5F1RA 1ODDA 4BHPA 1CYEA 5FFXA 2PL1A 1YS7A 1B00A 3G3ZA 4YFXF 3O74A 5LRSA 4MS3B 4ZYGA 4G0XA 5IUJC 3I71A 1NXVA 3CO7C 2A6EF 1NXXA 1F51E 4MR9B 3MEXA 3K69A 5D5WB 3V8JA 2O0YA 4KIGA 3EYYA 3DQVC 3EUHA 5A2QK 3EQLF 5D4SA 3SFZA 2H3HA 3OQNA 4MRMB 2XDYA 3HEBA 3MZYA 3URMA 1QQAA 3GT7A 5DV5A 4ESJA 3EDCA 4Z99A 3DPLC 3WE3A 4KFCA 1DC7A 3HDVA 4LGWA 1S3JA 1MZBA 3CG0A 2KYRA 3I09A 1CF7A 2FXIA 3FXQA 2E1CA 2RV8A 4O5AA 5ICEA 3N97A 3DPTA 3MYYA 4RXUA 3HO1A 2BE5F 1PUXA 4LG0A 1Z91A 2M45A 2ACJA 4P96A 4WT7A 4P98A 4BQAA 2LSOA 2M98A 3LTEA 5TQ0B 3HTUA 2VOOA 1JL3A 3ELKA 2FMIA 3HOSA 4BHCA 1RIOH 2D1VA 1M5UA 4KIBA 4HNQA 4EJUA 1L5ZA 4L0ZB 3LKVA 4ZYDA 4F11A 1D1PA 1SRRA 3IKTA 1YYVA 2Y48A 5LLQA 3T8TA 1ABEA 5JNSA 3QLTA 4MHGA 4S05A 4Z0NA 2HQRA 1YW9A 4DN6A 3I64A 1LDJA 2IOYA 3RVQA 4DADA 3OQOA 2JTVA 3N75A 1DRJA 1FLIA 3UUGA 2QUFA 5ERIA 3VFZA 2W42A 4CGZA 3N8IA 4D74A 1ZRCA 3G1WA 2WWVD 3CJNA 4P55A 3C6QA 4CBVA 1SFXA 4L0YB 1F4KA 2FMHA 1ONVA 4R1HA 1LJLA 3GFIA 2PLNA 1BOAA 3QOPA 4HYEA 4W5RA 1ZH4A 2IPQX 3FM3A 2M1BA 4LDAA 8ABPA 4NB5A 1DBWA 1FBSA 1Z16A 4A12A 2A9OA 1QO0A 2GKGA 2EB7A 4U0WA 4PCQA 1FSHA 4W5OA 2P4WA 2P8TA 1TM2A 1LVAA 5ICGA 3S2WA 3L00A 3J80K 1LEAA 2PUDA 1A2OA 1RPJA 1YG2A 2VE8A 4XXHA 2HGCA 2QZJA 2R7FA 3DV8A 2FN9A 3TB6A 4JB2A 1QO0D 3NHMA 1ZLKA 1J9IA 2VUIB 4G6QA 5E1ZB 2KRFA 3LAJA 4ZH4F 2XRNA 3KLOA 4BAYA 2FMLA 3W6KB 5CNJA 2GX6A 4Q47A 4WUTA 2GIVA 1EH6A 2HYGD 2QV0A 5AIPA 2CQKA 4WXMA 1U5TA 3VB2A 3BDDA 4OTZA 2YX7A 1H9TA 3RVKA 1TLHB 1CHNA 2JZYA 2W84A 3VNBA 2FLWA 3RQIA 1ZGJA 1T6SA 2ZCWA 3DF8A 2F5CA 5CVVA 1GCGA 3E6DA 3LUGA 4EJOA 4YRZA 2B4AA 1SD4A 2A9QA 4UHTA 1QQBA 2WMYA 3N6VA 2R25B 1F1ZA 3JAMK 3I59B 4MLCA 1G4DA 2FLKA 3RPUA 1IXSB 3KG2A 2JVKA 5TPWB 2LNBA 1U6GA 5TPZD 3C18A 2DPUA 2JVJA 1B6AA 2E4ZA 3NNSA 1JHZA 2JPBA 3J7AO 3KSMA 3KP5A 3C97A 5BPDA 4F8JA 1DP4A 4YP9A 3H5IA 4KNYA 3F22A 2FEPA 1JHFA 1YO5C 2FMKA 2P5VA 3CU5A 1HEYA 4EM1A 3GF2A 2FN8A 1E6LA 5LHHA 5TQJA 5KQMA 1F5TA 3NNDA 4N76A 2WC2A 2IYNA 2KKOA 1YMUA 3H5VA 2A9RA 1LDKB 4YIIA 5JNWA 4HLXA 1R23A 3LUJA 5LGNA 2DK5A 4I2OA 1D8KA 2YR2A 1W7PB 4OLAA 3OMWA 2WV0A 2FMYA 1BM9A 1K7AA 4EYGA 4I09A 5KC9A 3C7JA 1BDJA 1ISSA 4RU1A 1JHHA 4KMUX 2ZNYA 1O3RA 1P4AA 4HF1A 4Y9TA 2FQXA 2VT3A 2GZWA 2HZTA 1PNTA 4GYGA 4F7ZA 1FBUA 3BJ6A 3QPHA 4OG2A 3QEMA 2FEKA 4D6XA 4MTEA 1SD5A 3TKYA 1QP0A 4GCVA 4HOBA 4IVNA 1OXKB 1I1GA 4CDGA 5EWLB 3Q9SA 5FBHA 3HUUA 3V8LA 1HKSA 3IWFA 2XKOA 5IUNC 4ZPJA 1TW3A 3KP2A 4MS1A 1U5TB 2EFNA 2KIMA 3U1DA 3T95A 2YPRA 5DD8A 1DBPA 3DFGA 1XN7A 1GLGA 3HHHA 5CVIA 3A0RB 2HFHA 2MLKA 1P4WA 1XSDA 1TBXA 2O6GE 2V9VA 3ZP5A 3FXUA 3BBLA 3E6MA 3ABUA 1FPQA 4BNCA 2FMFA 2R47A 4RK5A 3BREA 1LJUA 4XLPF 4HNRA 3Q15C 5HDGA 3B02A 1XD7A 1JFVA 2NT4A 3O1IC 3S99A 1BI1A 1ZH5A 3I5UA 1HKQA 3R4KA 4RWEA 3MWMA 2DK8A 1O7LA 2C6YA 1REPC 4MTDA 3LA2A 4LE2A 4Z2YA 2JRLA 2HQBA 1KQ9A 1VPWA 3MCZA 3L09A 1Z9CA 3B2NA 2VC0A 3MQ4A 3O21A 4MEXF 2JB9A 3BILA 3HSEA 2FNAA 4MQVA 3P9YA 4KICA 2QVOA 3WTSC 1O3QA 3W9SA 5L3GA 2DT5A 2IA2A 3D0SA 2WY2D 2QR3A 2ZFWA 3MM4A 4ZMSA 4XBFA 5HLGA 3CZCA 5CYVA 3LUKA 3LA3A 3DBIA 1ABFA 2DTRA 3RIRA 2GXGA 5D6FA 1D2AA 1IXCA 2FRHA 1HW5A 3F8CA 2OU2A 4HNSA 1S7OA 1M2FA 4MQFB 1P6UA 2Q0OA 1O3TA 2QVCA 2IKSA 1LQ1A 4P1ZA 1K68A 3QX8A 1JFTA 3HSRA 2DBBA 4RZSA 1MDMB 2MLGA 4MS4B 3REOA 4G6DA 4LJZF 5E1XA 4IHSA 4OIQF 4YGXB 1OYYA 1U78A 4G0MA 2E1NA 3TD9A 2FTKE 5BQ3A 4MS1B 2Z3YA 1KQ8A 4A0YA 4BHBA 2VK2A 3I54A 1Z6RA 5IT3A 1ZG3A 2IPLA 3GA5A 2EFPA 1RXIA 2B0LA 4HZFA 1TQIA 2DLLA 2D45A 1YIOA 2HWVA 2VBZA 3IDOA 4YWHA 1D5VA 2PUFA 3CTAA 5HLHA 1YMVA 1TW2A 2UXNA 3F6OA 4RAYA 4KQCA 3IWZA 3TOAA 4QICA 4Y17A 1BIBA 1W5SA 3HRMA 4L9JA 2W85A 4RK6A 5JS1A 2EFOA 4U0YA 1Z1DA 2MH2A 1TVMA 4KK3A 1WWXA 3E3MA 4QYWA 4RS8A 1KU9A 2MA3A 4IRXA 4Q4ZF 2M30A 1B9NA 2H6CA 1KGSA 3SY8A 2ZJ2A 3HXMA 2CG4A 1BAPA 2PUGA 3ML6A 1XWWA 2FEWB 2FSPA 5F64A 2QW1A 3VODA 3M7GA 5D8KB 4U7DA 4ON0A 4LK1F 4NQWA 5IC5A 2RJOA 2HEOA 3ROTA 4MRMA 1URPA 1G3YA 2RDPA 4FHTA 1F9NA 4M71A 3JTEA 1P4XA 3HHGA 3KLNA 2GAUA 2VYCA 1USIA 3CS3A 3DGEC 3ZMZA 3HUTA 2V0NA 1YVUA 3NEUA 2J5PA 2P7CB 1Z7UA 3O2PE 3HZHA 5HM6A 1JWLA 5IT9Z 2A68F 1AB5A 5DDGA 2NYXA 1TNSA 5IEBA 2O3FA 1ZGZA 3HDGA 2RNJA 4EGSA 1YW8A 1K78A 4ZYLA 3EQZA 1LBIA 4GYIA 4MQFA 1XSXA 3F3XA 2WTEA 1DCFA 3CKMA 3DLBA 1R1UA 3WU1B 4F3TA 2BGCA 3ECOA 5FLXZ 4L5JA 2ZWMA 4TLLB 1LEBA 3ZMDA 1OXBB 3WTTC 3TMYA 6ABPA 2J5OA 5CNKA 2ESNA 2VN2A 4Q7EA 1QP4A 1TMYA 1H9CA 2KIFA 1IRGA 4JK1X 1DPUA 1MB0A 2XVCA 3GL9A 2HS5A 5DCMB 1UCRA 1Z6TA 3KZZA 4QLCU 3KETA 2FBHA 4N0BA 5LBQA 1I1SA 1ZAOA 3HJFA 5KQLA 1GUDA 1JFSA 2M5WA 3RVOA 5CVJA 1L5YA 4FE4A 3GVAA 5DLEA 2Z9OA 3D02A 4OIRF 1ZYRF 5L3EA 3FDFA 2FF4A 1JF8A 3SNKA 3I59A 1E17A 3TOBA 6CHYA 2RKHA 3EYIA 3UKJA 3KHTA 4RV5A 2MSLA 1T38A 4YG2F 3F73A 1YQAA 1MKMA 2EV5A 4TLMB 2QQBA 3RKXA 4CICA 2PI0A 4KT5C 2QENA 1U8RA 2LF7A 3V7CA 3SQNA 2NZUG 3OLVA 1KRXA 1C0EA 3QELA 1IF1A 1VRVA 2F5EA 5L3DA 4G7ZF 3Q7RA 2DPDA 4KN4X 4DQ2A 5PNTA 2B1JA 2I6FA 4R79A 3BOQA 4RGSA 4U0VA 4RB0A 3G73A 3F72A 3MF4A 1QMPA 4KN7X 1BA2A 3ZPLA 2E4VA 4M72A 1ZAYA 2XUBA 2P6TA 3I53A 1M2EA 1MDMA 1XMAA 4XASA 2CGPA 4E70A 4RXTA 4NHJA 4UVAA 1Z25A 2PJUA 1IN7A 3RYRA 5EWMB 3O6BB 5JS2A 2FEZA 5D5UB 3L49A 2FU4A 4BXUA 4F06A 1E2BA 1U04A 5TPZA 2XAFA 1WRJA 5H6QA 2K4BA 1LJ9A 1QBJA 4I02A 4OATA 3CUQA 2OA4A 2X7XA 1Z15A 3DLHA 1HKTA 4O1HA 5BMZA 2P5LC 4EVQA 4GPAA 5DYMA 3C3WA 2A69F 3M8EA 1QP7A 2HYFA 4NICA 2FVYA 1KYZA 3QLVA 1IXRC 3GZ6A 4Q5SF 2XKPA 5JI6A 2W57A 3LSTA 2KIUA 5EWLA 2FQYA 2RC4A 4W5NA 4IF4A 3GV0A 2FBKA 4AIKA 4KQ9A 4WX9A 3FMSA 1SMTA 5L3FA 3K1MA 5KI6A 4R8HA 3P9CA 4ESBA 1OMIA 2IA0A 5FGMA 3P9IA 1ZGAA 1P8AA 3HSYA 2JBAA 4ZYEA 5DD4A 4LG0B 3N0WA 2PUAA 2PE5A 3GYBA 4Y13A 3HRTA 4RSMA 2PUEA 5I4CA 3HOTA 3TO5A 1PDNC 5TQ0A 1H0MA 1NATA 3R60A 5AONA 3GFMA 2VONA 3F7NA 3SAJA 1T98A 4NCBA 4ETSA 3PQKA 4MGEA 5L3CA 4OINF 4XAQA 2IPMA 4L9NA 2CHEA 5CNMA 4Z9BA 4WXEA 1ZY2A 2OENG 1FZPB 3R6SA 1P6RA 2VODA 2Z5UA 3K4HA 3JAMZ 5DCFA 2G7UA 4GXOA 2HKXA 5FFZA 3GBPA 4L4UA 1C4WA 3LWFA 4EJWA 1HW1A 1DDNA 5BR1A 3BRQA 4OIPF 3HM9A 3IHUA 1O57A 4HBLA 1QNLA 5HS7A 4U7BA 3FFWA 1O7FA 4N9HA 1W9HA 4M6XA 1RZRD 4P9FA 3LA7A 4QPJC 3O2QB 1FP1D 4CXFA 1UDRA 1XCVA 3WU0A 4WK8F 1SXIA 1FSEA 1G3SA 2P5KA 4OMZA 4UVBA 4AWXB 2WWYA 2W24A 1NXWA 3RVMA 2CO5A 4RK7A 1EH8A 1QQIA 5BRJA 5IEJA 3WTWC 1ZITA 3IPAA 3GLXA 4UVCA 2A61A 3F8NA 2GWRA 3GWGA 3F6VA 5DEQA 2A9PA 1TNTA 2YU3A 3GYHX 2CYYA 1YS6A 1A04A 5CVRA 3WODF 5LEKA 3FXRA 3MAJA 4LB5A 3IRQA 5HDKA 5ED4A 1OKRA 4G94A 3GWZA 1IN4A 1U2WA 3RDIA 3H6HA 2RQPA 1SFEA 5DUIA 2QVGA 5CVUA 2BBYA 2PL9A 3QLUC 4YFNF 5J8CA 2DQLA 2VUHB 2R4QA 4OIOF 5KWSA 2EK5A 4TMYA 4O3MA 5GQSA 1KMIY 1IUYA 3ROFA 4XSZF 3R0AA 1JDPA 5ICCA 1ZHFA 1IN5A 2O61A 4O1IA 2XHKA 4EM0B 3H5LA 2XASA 3RTRA 4JA2A 2NUBA 3TQNA 1UHMA 2HJ9A 1XGSA 3KE2A 3FHZA 3KFWX 3SZPA 3KZYA 3O1HB 5BOXA 3JY6A 4RK1A 1V3FA 2EA4A 2KJBA 1DCKA 3ULQB 2DAOA 1H9GA 4HDVA 2BV6A 3T38A 4ZMRA 1K66A 3BROA 2XAQA 4O6JA 3CO6C 2QM3A 4CYDA 4M9SA 3GFJA 3LMKA 3UK0A 3WTZA 4HLYA 5J8FA 3OMXA 5FD5A 1SAXA 3OO1A 4RS3A 1S6LA 1NXOA 3LUCA 1KYWA 2ADUA 1GXPA 2LIVA 3DZDA 4G0QA 3FMVA 1DUXC 4KMFA 4YFKF 2OQRA 1FX7A 3ZMSA 2QBYB 2OQGA 4G9YA 1XGMA 3KP6A 2PMCA 3M6MD 2PAFA 5DCMA 3JS5A 3CUOA 4I01A 1IRFA 2STWA 1U2PA 2YSRA 4N41A 3ZMUA 1QKKA 2EJRA 3IRRA 3F8FA 5D6EA 3T1BA 1Z2DA 5IULC 3ABTA 3M8FA 1KU7A 5K5OA 4OU0A 2HPHA 4Z4EA 2DI3A 3CHYA 2ZNZA 3H3UA 1OPCA 3JVDA 3GXOA 5FWYA 1D5WA 1ZESA 1BC8C 3VOEA 4A0ZA 4HAMA 3T8YA 4EVIA 4M74A 2XIGA 3K9TA 1MD0A 1STZA 3CTPA 2E4WA 2MBFA 4PGGA 5A2QZ 3HRSA 3EDPA 4EQQA 2M1ZA 4RXMA 2EA2A 4BYYA 1R8JA 4G8XA 2QU7A 1EAYA 5D5VB 4KVFA 3DP7A 1U3EM 4KZKA 3V7SA 1IAWA 1F4VA 4IRHA 2V6CA 3O1JC 3F6CA 2AYZA 3N0RA 3LFKA 4EUKA 1WKMA 4F12A 3COAC 4WWHA 5HOOA 3KEQA 3OV8A 3QPTA 1AOYA 3C3KA 3EJWA 2ELHA 3O3KA 1BDHA 3BPXA 4JQFA 2STTA 4HQMA 3M9AA 1GXQA 1XHEA 2MSKA 5D2CA 1HSJA 5KQPA 5HDNA 3L7WA 3QK7A 3MZHA 1ZGGA 3CFYA 3A0UA 1KA8A 1TJYA 3LKBA 2DQRA 3CG4A 5KK1A 1R36A 4CO8A 1FOKA 3SXYA 4KDPA 4LLLA 2PKXA 1J5YA 5HLIA 3FMQA 3N0XA 4HV5A 2IJLA 3KCCA 5TJJA 3CNBA 2L4AA 5FWXB 2JPCA 1GUBA 1CGPA 2HR3A 3H6GA 2HTSA 5DTEA 1Z18A 4RGRA 3FZVA 3E5XA 3L2CA 3JPWA 3RI4A 3F8BA 2J48A 3K1PA 4KA4A 2K4JA 3JTGA 4WF2A 3RPQA 1EWTA 4G0YA 5ILSA 3A10A 5HS8A 2L02A 3BJAA 4FX0A 5JFRA 4IHTA 5B3JC 4YLEA 2QZ8A 1ZG1A 1T0FA 3NQOA 2WJWA 2PJPA 4TN5A 1P6QA 2MSWA 4Q6WA 4KPYA 3QLVC 4KK4A 2FSWA 1U2QA 4ASNA 1SXGA 3KJXA 1FSPA 4Z4CA 3HUGA 4UHJA 5BPIA 5K5QA 4ML3A 4YV7A 3CZ5A 2HQOA 2XROA 4PEVA 2JCGA 2H09A 4MQEB 5C5EA 3BZ6A 1WETA 4Z4FA 4GNRA 3RVLA 1K79A 5EWJB 2ID7A 3KCNA 1BI3A 5JNTA 2E7XA 1NTRA 3IP9A 3V4GA 1RXEA 1IIBA 4WXHA 2P4UA 1FFSA 4JOQA 4G0PA 2LPMA 3OLYA 1IZ1A 4ENKA 1O3SA 1BC7C 3LFTA 2XAHA 2Y0MA 1NXSA 1HW2A 4M73A 4MR7A 3H3ZA 4NV3A 4HF0A 4RK4A 2CW0F 1ISRA 4M9ZA 3HRUA 3GUDA 3JW4A 4HQEA 1U8TA 1YFHA 4LB6B 1KQ0A 1ZARA 4GGGA 4UXNA 3DGFC 4H3HB 4Z4IA 6PAXA 3NHZA 2K27A 3F21A 3FX3A 5LEJA 4AD9A 2BGGA 3W6JB 1K78B 4P9UA 1FP2A 3ZMTA 3ISPA 3IL2A 1Y1LA 3WGGA 3BWGA 4ENJA 1NXPA 2WJAA 1LNWA 4IILA 2F5DA 4UUVA 1FFGA 3LQQA 4IPAA 2L19A 1EHCA 3NNNA 3CUQB 4K2EA 1FY7A 1FYKA 1ON1A 2JK1A 1Q1HA 3HCWA 3E61A 2CWEA 4G97A 5E1WA 3PQJA 2PUBA 1WI9A 4PDKA 1DG9A 3C3MA 1ULYA 2L17A 4L9TA 5E8GA 1JH9A 2P9HA 5K5RA 2AXLA 4I98B 2EV0A 1FBQA 3H1FA 1D8JA 2LF8A 2CWDA 4RB1A 2ZMEA 4QYMA 3HSFA 1JGSA 2RVCA 2HDCA 1LDDA 3WTYC 2OBPA 4MR8B 3N53A 5E8IA 3LQRA 3U9GA 3K0LA 4EV0A 3M1EA 3B73A 2FKAA 3KS9A 1B4AA 2E4UA 3JPYA 5AIQA 1PHRA 3IKVA 2BEOA 5BS6A 1JBEA 2RDMA 5TE9A 5TQ2B 3GX4X 3EGCA 3L6UA 1YTUA 2PUCA 1UB9A 1DPRA 2LBPA 3OLWA 2NNNA 1G6NA 2NZVG 2O8XA 1NY5A 3SG0A 1VLZA 1FYMA 4OBBA 4H60A 2MH9A 3IP5A 3H92A 2D1HA 5LRRA 3OLXA 3I45A 3ILYA 1G3TA 5FWYB 4MPTA 4RY0A 3GRCA 2IPAB 2VBYA 1HBXG 3NRVA 1Z2EA 4P5OA 3Q7SA 3HIFA 5CHYA 3CDHA 1M5TA 5T7BA 2DRIA 2V1XA 3MQ0A 2EFWA 1W25A 4L85A 3R0JA 5B3JA 4MR7B 5LGUA 1ZDMA 4NQRA 2FQ3A 2L4MA 3OM0A 2NRAC 1BI2A 2ETHA 4EYOA 3BP8A 2O20A 1A0OA 4G0OA 3TDZC 4ETIA 2VXZA 3H5TA 2GA2A 4JP1A 2HKOA 3HVRA 4G7OF 2PFBA 1NXTA 4EGYA 1XGOA 4AVPA 1HXDA 5IBQA 1MVOA 4N03A 2JBAB 4KRFA 2H94A 4N9IA 4XARA 4KYWA 2RGYA 2F8TA 1DC8A 3WTUC 2VE9A 4UHKA 1PEAA 3E6BA 3ECHA 1OYIA 3T6KA 1R00A 2QQAA 1ZH2A 1UHWA 3N4MA 2QXYA 3BJOA 2QBYA 3RKWA 3JSOA 3RVPA 1UFMA 2M87A 4PE5B 2P7VB 1RZRA 2GBPA 1AWCA 1JYFA 1QGPA 1GHCA 3A3KA 1P2FA 1EWKA 5HVQC 3IPCA 4XFKA 4KV7A 2ZXJA 4RDCA 3WTVC 3U2RA 1W4MA 1SXHA 1Z12A 1XDUA 3LUFA 1R5GA 5DCLA 4D6YA 4AIJA 2YHBA 1K6OA 5TQ2A 2BYVE 2V1UA 4ENNA 1RNLA 4ESFA 1LB2A 3QEKA 5IX8A 4LD5A 2MC3A 3I5AA 2COMA 2ESHA 4TV7A 5JR3A 3J81Z 5EWMA 3KP3A 4JASB 3J81K 1ON2A 2ZKZA 4B8XA 4UNOA 4I0AA 3HS3A 3IP6A 3NBMA 2V1DA 3TX6A 2IPNA 2R3SA 3C1DA 3SZTA 3CLKA 4MAAA 3PFIA 4HW0A 3P9KA 1ZREA 2RN7A 3FFXA 4N47A 3D5LA 3RVSA 4KIFA 1G3WA 2ID9A 2ISZA 3QAHA 2OAZA 2VC1A 3JSPA 2PN6A 4L9VA 2F5FA 2UXXA 3QELB 5H6RA 1XCBA 1KU3A 1JLKA 5JVTA 3O2SB 4YCSA 4JAVC 4UV8A 5D5XB 4LLNA 3TO6A 2IDMA 3GO5A 1NHAA 1T34A 2IRFG 2FBIA 4LE0A 4LZLA 1R5HA 5DKFA 4A2UA 2DW4A 3RVJA 4FT8A 2L01A 3RJPA 3K2ZA 2MYPA 3TO7A 1JX6A 1FC3A 1J7KA 2FE3A 4EYQA 5FBKA 3WGIA 4WXCA 1Z13A 3M9WA 4MQ9F 1XMKA 2JT1A 4Q48A 1QPZA 2DO7A 1R1TA 4M6YA 4RK0A 3LOPA 1E6MA 4LDZA 2Z33A 3K1NA 3HK2A 2FA5A 1R1VA 2K02A 4FE7A 5E18F 2RJNA 9ABPA 4ZZLA 4E7PA 5IT9K 3I4PA 2MYNA 1T2KA 2CSOA 2A3SA 4YR7A 4HX4A 3KKEA 3EULA 3MFKA 3Q41A 1MJBA 2G7HA 4RY8A 4IMIB 3GZ5A 3KP7A 5FO5A 3BRSA 3V7RA 3FM5A 4G86A 3RVRA 2LKPA 2XGXA 2K7LA 3LAPA 5EEGA 2XAJA 3HYIA 4RKQA 3R61A 2IA1A 2ZMEB 4H3KB 4G7HF 1U0SY 4ZZDA 4WZZA 5HKOA 4LMYA 3ZQ7A 1Z05A 2E4XA 3ZMVA 2Q2EA 1D3YA 2PG4A 1USKA 1MGTA 3G85A 4LX8A 2K86A 1RUOA 5C5CA 2LUOA 3QX9A 2ISYA 1WQ2A 5IUKC 3EETA 4IRGA 3CUQC 4A5NA 2GXBA 4EJTA 1KU2A 3DEUA 3ROUA 5TPWA 1IW7F 1FWZA 1I6XA 1ZVVA 4M9XA 3WGHA 4I0BA 2OZUA 2UWMA 4DNCA 1RI7A 2H6BA 1ZRFA 1YTYA 3RVNA 1Z17A 3T8RA 1ZG5A 1R7JA 1ZHHA 2NS0A 1FFWA 1VKRA 1SD7A 1XGNA 1Y0UA 2GI4A 3KYIB 2WRZA 4PZ0A 1WSUA 5FLXK 4E7OA 1ZRDA 1MAVA 2FOKA 1MJ9A 2FXAA 4ENMA 2M8EA 1J75A 4MR9A 1BJAA 4U88A 1AB6A 1W7PD 3ZN0A 4RKRA 3O75A 1T39A 1E2XA 1JE8A 3SHFA 4Q6BA 7ABPA 5HQJA 4BH9A 1BBYA 1S8NA 4MS4A 3L9FA 3HTSB 4KMRA 2MYTA 3QEMB 2ZAYA 4OMYA 5HS9A 3VEPA 3GW2A 3OOPA 2IT0A 1DZ3A 3GBVA 4RB2C 5HSGA 3BY6A 4HX7A 2Q5CA 5CJ9A 3FMRA 2CFXA 4JBAA 3RYPA 1PNRA 5EWJA 1LBHA 1FNNA 1DP7P 2L54A 3QU6A 5BQTA 1R58A 1SMYF 4Y15A 4B09A 3QP6A 4UV9A 3MIZA 5JNUA 5CLSA 5FD6A 4ETMA 3F8MA 1OR7A 1SFUA 1J0RA 2CD7A 4EM2A 5JNRA 2GA1A 4A6EA 3IP7A 2NNYA 4EVSA 3WG9A 3QRFF 3ERED 4OLBA 1SD6A 1CEYA 1EH7A 4PGHA 1HQCA 1EWVA 3E5QA 4PYRA 1DJMA 1S29A 2AS5F 1Z26A 3FFTA 4Z9AA 2DU9A 1U5TC 1YLFA 1EV7A 3GFLA 3F6PA 1GCAA 1X3UA 2XV4S 4S04A 4XLTA 1RUNA 1RZ4A 1USTA 2H27A 2QSJA 3FF5A 2VOPA 4EYKA 2DFIA 2MD5A 4W5TA 2N9UA 5KVRA 4A6DA 4N0QA 1GVJA 2RGVA 4O5VA 4HDUA 1LK0A 3KP4A 5CNIA 4Z4GA 2PEXA 4JB0A 4A5MA 1FYLA 5ILVA 3H5OA 5BRAA 5LHIA 3LUAA 1S7AA 4WXDA 2OZ6A 2HOEA 2L18A 1YK1A 4HA8A 1B1BA 1EFAA 1BI0A 4EMSA 2FNPA 2IVMA 4OOIA 2O03A 4MEYF 3TO9A 1MIHA 1P92A 5GOTA 2PMHA 2V79A 3J80Z 1TTYA 4Z4HA 3H75A 2D2WA 1DCMA 1HSTA 1J2XA 2GQQA 4EJVA 2W25A 4MNUA 3RKYA 3ZN1A 1TQPA 2Z99A 1FQWA 4HX8A 2A5YB 5D4RA 5H20A 1XSVA 4HV6A 3Q9VA 5TRDA 3JVIA 1CF7B 3I42A 4AIHA 3OO0A 2EFQA 4MR8A 3D8UA 3SM9A 3VNAA 2F2EA 3I58A 3CRNA 2L2QA 1L3LA 5LGTA 4HF2A 2EV6A 5FB2A 2CHFA 2X4HA 3H1EA 4YIFA 1BVHA 5K1YA 1C0WA 1IN8A 4FB4A 2WB4A 4M88A 3TDUC 3KEOA 3DKWA 1XHFA 1BDIA 4CZZA 4DQDA 1IN6A 1USSA 5EEHA 1MJAA 2JSCA 5KQGA 4G0ZA 1D1QA 3I0TA 1PEYA 4RAZA 1PUEE 4CHUA 1TQMA 4ETNA 2FQWA 1APBA 5JHUA 3M9XA 2AYXA 2TMYA 5DUKA 4LLGF 1W5TA 3GEZA 4ZYHA 4YS6A 2QLZA 1USGA 5J6XA 4L5IA 4XSXF 5KC8A 2EWNA 2JVIA 4H0EA 4XLNF 4L18B 4LE1A 3ILHA 4PICA 4FX4A 4MLDA 1JYEA 4IRIA 5JNVA 4MYRA 3BPVA 4KREA 1QZYA 3K9CA 3Q7TA 1XB4A 1D4ZA 1JXSA 1YK0A 3CLOA 3Q5FA 4YO7A 2MYUA 3MMNA 4WWCA 4RB3C 1YW7A 4EGZA 4N0PA 1QPMA 2OD5A 4MS3A 4WCGA 2HSGA
chains in the Genus database with same CATH superfamily
4XRFA 3GFFA 4KO1S 4OXRA 1THMA 4ZJPA 2ZBKA 3A0HC 4DV6B 1MR3F 2ZYTX 4GYWA 3V4FA 3DHVA 2ORWA 1ZD2P 4FDTA 4M1SA 3KQKA 3TGNA 3EODA 4D8TA 2H1HA 3MFQA 5ESXA 4XTRA 2DT6A 3P9PA 4CM8B 2Q5IA 1ZUNB 2EHJA 3JQAD 4Y1FA 4OHVA 2EW8A 1DMRA 1QAQA 4NYJR 4WAUA 5LYJF 1OAAA 1UANA 1Z2CA 5DGCA 2A07F 3OM1A 3M6LA 3PKJA 4E4RA 4EMUA 3JD3A 2BONA 2HQNA 4MCAA 3VV2A 3ZH9B 2JLZA 2M0MA 1KAHA 3B13B 4AIRA 4F3QA 1EEXB 5KB3A 1VQ9I 1QLJA 1A8PA 3HDTA 4M1WA 4EUNA 1X0VA 4DQXA 1LSJA 3GLFE 5I9MA 2ZWAA 5K7ZA 1CUIA 3DBLB 1XQWA 1PQPA 1KA9H 5DNYB 4DZRA 1U9IC 3MHPA 3PHHA 2H17A 3LNCA 3HOUJ 2R85A 4LJLA 1HDRA 4RQUA 1RCUA 3W3AD 4AG6A 4DMMA 3CY6A 2FW0A 5KTPA 5KDLA 2L2OA 2J87A 4GX1A 4D0PA 1JQDA 2R48A 2VF5X 4QOJA 4UM8B 2C99A 4ALLA 4I3HA 4R9RA 3GVIA 4B6GA 2JAQA 5FQNA 3P7NA 5IU6A 1KJNA 1Y8QB 1X9HA 3LUHA 2QWWA 2FY8A 1QZZA 1SBTA 3RSZA 4K7JA 2PMUA 5ILUA 3L04A 3AW8A 4D42A 4K1XA 1VHDA 3O2JA 1NBHA 1PP7U 1G7RA 4MI9A 1ISFA 4E5SA 2ZTMA 3DMNA 3K94A 4M7PA 2YHIA 1I51A 4LZWA 4R8MA 2QX8A 3H7AA 1MENA 1CG6A 1OROA 2YJ5A 3GGGA 3OCCA 3GEEA 3LW8A 4NENB 4GZMA 4R0NA 2GYUA 1GT91 2MW8A 5EHNA 5CPFA 4ZYWA 1RCFA 1D6NA 1FJLA 1Z82A 5U4XA 1KRWA 1F12A 3T5XA 3W7AA 2I3GA 3D0OA 3LUDA 2GVDC 1D6SA 4FX2A 3BH0A 9MHTA 1CY6A 4N6OA 3SKVA 1K4YA 1VTNC 1JDNA 4DR7B 3Q9UA 1S8AA 4NC8A 2FUEA 1GAJA 3LXXA 2VBWA 4M3NA 4IXAA 4P31A 2HL6A 5KO2A 4BYMA 2ZXEA 5EP2A 4BACA 2WEKA 3BDIA 4LRYA 3ORSA 1YZKA 5EJ4A 1ZLJA 4UAUA 4PG8A 4LMBA 5IJ9B 4UVEA 1QG0A 1JKQC 3FB4A 2DERA 3COYA 1MIOA 1VG1A 4YMHA 4UMVA 3WFIA 4M8IA 2L5QA 2JRTA 4EYSA 3S2YA 5TMBA 2Q6LA 2VWQA 3AK4A 3LXMA 5B3LA 1ZISA 1XYGA 2WNIA 2A6HF 5DBOA 2Z16A 1Q0LA 4WNAA 1P1IA 5EPOA 5KNBD 2IS2A 4DSAA 3BHMA 4QDKA 5E6UB 3ROKA 3ND5A 1KU0A 1OUMA 1CY1A 2B6NA 4WH0A 3TBIA 2OUMA 4BXXJ 1SUPA 5GPAA 1EK6A 2EGGA 2VDPB 4PC1A 4D8UA 2YUTA 5A5VA 2EW1A 1F0NA 2HTJA 4ZD6A 1I7SB 1R10A 4MWGA 4NNOA 5EAIA 1QZXA 2EVWX 4ZJZA 2X0LA 1XP5A 2OWDA 2GK3A 2PIAA 1PWYE 2GBIA 3H18A 3PFBA 4RZIA 5LCXA 2CZQA 5CDFE 3PUKA 4ND4A 1I3CA 4I7HA 2IU6A 2VP3A 3ABIA 3FI9A 4PXYA 4A0XA 3K9FC 2E7WA 1XMOB 2ZXUA 1J9EA 3DFMA 4DDVA 5CH8A 1L0OC 1PJCA 1UFVA 3N07A 3NGMA 5FOWA 5T3YA 2QDKA 3TCXB 2WVGA 5LL6P 3UQZA 3PEEA 2ATXA 3L4BA 4M9UA 4DILA 3QFFA 2V26A 1ODDA 1T5DX 3R6DA 1BXZA 2HLNA 1CYEA 1RHRA 1V35A 4TWRA 2PL1A 4KGDA 4JL8A 5HOEA 3THWA 3L6EA 3SR4A 5I45A 4EGQA 2H16A 1EVLA 1NXVA 3QU9A 1RACA 4LPKA 5HFAA 4RAGA 3KLMX 3RYFB 5BVHA 5LMCA 2AEMA 2DU8A 2XZLA 3I3OA 1WCYA 1N7HA 4DNPA 2O8BA 2OP0A 4PLCA 5D5WB 4ZVTA 2ECCA 3S1MJ 4QWWA 3MMZA 3V8JA 5EJFA 4U5QA 4KIGA 3MWJA 4ZVUA 4N8SA 4B4DA 3ZCVA 1K63A 2VP4A 1HE4A 4J0JA 5IXJA 3D2AA 1UPXA 3QXSA 1Z0DA 2ZE6A 5GVRA 1VLLA 3RRNA 4A8JC 3EUHA 5A2QK 2VKDA 4EM6A 1WJAA 4OFWA 4GOLD 5AVTA 4ZFNA 2H3HA 4QPPA 1WMAA 1O08A 3K09A 4NCIA 2QLMA 3LM8A 4RBOA 2QUBA 3I9V6 2ECOA 3Q6NA 4U2CA 3I2GA 4ZODA 3ZVKA 3MZYA 3OX2A 3V4OA 5CDHA 4BKPA 1T2VA 4LXUA 3HOVJ 2D5LA 1NW9B 3F98A 2ECKA 4OUKX 4JA0A 2QGNA 1IAVA 1GGEA 4Y7CA 4DJDC 5AJTA 4V0NA 2RKBA 4G0WA 2FP4A 1QIGA 2FJPA 3DPLC 1KPGA 1XRMA 3AF4A 3F4BA 4J0DA 2X14A 4U1RA 4BJ5A 4WJLA 2ZVQX 4LGWA 1Y6JA 2WIFA 4ROTA 2GPSA 3S8YA 1MZBA 3RRBA 3AJAA 3U4IA 4KXVA 3I5YA 2I2CA 4YRKA 4DBVO 3G2PA 3FOWA 3QM1A 4ZALA 1Z5ZA 2QL6A 2CEAA 4DBQA 1ZRSA 2CXTA 2LKDA 2IEZA 5IH3A 2R1UA 1G8HA 2RV8A 4A3CJ 1QGDA 3N97A 2G9RA 1EE1A 3FKSD 3G9ZA 3IOBA 4KLNA 4O5AA 2HRZA 2XNDA 1KNQA 4IFBA 4PYIA 4RXUA 1IZZA 3NEJA 4B40A 1I2MA 1S2NA 1PVVA 2IC5A 4REQA 3UJDA 2CQQA 2YVUA 2ZJ1A 4UM7A 4TRRA 5IF9A 1EEHA 3ABOB 3QVLA 3FX2A 2Q1ZB 1CJUC 3BWVA 5FOXA 4KB5A 1PSDA 2LSOA 1G21A 2M98A 2V7PA 2WUEA 3LTEA 4QGBA 2W8BB 2LRDA 1XC5A 1TUEA 1SQ6A 2DWPA 4Y0NA 2VTVA 1C1YA 4XGKA 1FIPA 2BTQB 2FRXA 3OTOB 4YREA 1DQNA 5FPYA 2FZKA 5GONF 3V3TA 4PO8A 5TMPA 1LPMA 3HOSA 4BHCA 1P7CA 2GTIA 1BU8A 2OD7A 1LK5A 1WY7A 3LT1A 5FNVF 5H1YA 1T5IA 4HNQA 2CT8A 1YJBA 3MPOA 4FYJA 1S7EA 3K4QA 3PSIA 3LQ2A 1SRQA 2R2AA 1C7EA 1GG5A 2WOJA 2V7XA 1JLHA 4BO8A 2WAQN 1WTAA 4CM3A 1OBFO 3IKTA 2Y48A 1MBZA 2CBZA 3KWLA 3ROPA 3RG2A 4G8JA 3D8NA 3F8WA 1EUQA 2VKTA 3BTJA 1YW9A 1Z7BA 4I1PA 3VTKA 4DN6A 3F6SA 3I64A 4OWRB 5EKXA 5BN5A 4FJ2A 3OZFA 1LDJA 4D9JA 1UAYA 3SWWA 4A3GJ 2C2HA 4EF5A 4RYLA 3SBDA 3RVQA 2QR5A 4DADA 4NIMA 1Y8CA 4FYVA 3CCMI 1YUMA 4G5YA 3T9AA 4A8TA 3ME5A 4F1JA 3W6UA 3JAMA 1DRJA 2IS1A 1EFKA 2QUFA 4GLOA 3CCYA 1VDMA 2Y1KA 2GPWA 1L4NA 3OSGA 2AFHE 2W42A 3EARA 1RC9A 2Z1NA 3N8IA 1WZ2A 2IZ5A 5COBA 3WWOA 3CJNA 2ID6A 4P55A 1BHQ1 1E1QD 5K2MA 1SFXA 3T0IA 2CSXA 5L4LA 1QU3A 3FZGA 3O73A 2DA5A 2FX5A 3NDIA 2PLNA 5EXXA 1B3BA 2UZ1B 3ZJ4A 4L8YA 4UREA 1BOAA 3H11B 4UUOA 3KAJA 2VIIA 2GN0A 3LRXA 5BPHA 2BMAA 4YCNA 1PR6A 4B2PA 4IXTA 4WNCA 3RYTC 2XUJA 2RH5A 4PWZA 4A3SA 2JSPA 1Z16A 3EVAA 1PWHA 2RAEA 1I10A 1ZW1A 4KDCA 1FYXA 1YA8A 1FSHA 4PZLA 1I94B 3TNYA 4M46A 4QXPA 2P8TA 3DBHB 1TM2A 1LGYA 2P9FA 4XWGA 5EJ2A 1RADA 4CDMA 3NWSA 3S2WA 4DZTA 2JGLA 3CLVA 4AN1A 5J2UF 3J80K 5HQ3B 5BN4A 2ZYDA 1IK6A 3ESZA 1J24A 3GOHA 4ID9A 4OHUA 3LC7O 5LD2B 4YJ3A 1YI0A 5DHTA 1GTRA 2ZI3A 2OFFA 1PDOA 4XXHA 3JYPA 3L7YA 1KSJA 3H0DA 1N3LA 4FEGA 3EIXA 1A9RA 3TQFA 3DMFA 3K4BA 3TKLA 1EMDA 2JZNA 4GGPA 1GRRA 2OUKA 4QULA 3DV8A 2OO5A 3NVDA 5LUBA 1QRAA 3FNBA 4N5MA 4QOHA 1P8JA 4W63A 521PA 8GPBA 4F52A 3AY7A 4JB2A 4LYAA 3NORA 1J39A 4CIXA 5FWYA 3DLBA 4IIJB 5U9CA 2G5CA 2VUIB 2PUWA 4WESB 4G63A 2KRFA 3QVKA 4NK5A 4P08A 3OQBA 3GPCA 3OWHA 2G1UA 4CCKA 1JJ8C 4PONA 1IDOA 3KLOA 4A1FA 4BAYA 1ZZEA 3UFXB 2CY0A 4RDHA 2FMLA 1T0UA 6NULA 4F7DA 2QM7A 4E33A 3DCFA 1II8A 5JMWA 2C7OA 2DVMA 1WCMJ 3IUOA 2GIVA 1EH6A 2P35A 2VJOA 1W52X 2HYGD 3CUVA 3F2VA 1U0FA 1AKRA 2GLXA 2RMKA 2ILTA 2QV0A 3E7WA 1AKNA 3D1JA 3HCAA 2IH4A 5FT9A 4JR0A 1AY0A 1U6JA 2EKDA 2ZJAA 3QRWA 5CTAA 4C7OB 4ENUA 2GA8A 1TU4A 2V65A 2ZYGA 1H9TA 3H8WA 5GOZA 4ZCSA 4CMHA 1Y6FA 3TIIA 1HE2A 1KDOA 3IERA 4JX9A 5EZYB 4RA6B 2ZJ4A 1DS6A 2HPAA 3KEYA 1Y0BA 2UZ3A 4HNGA 4HUJA 3TTWA 3RQIA 3O95A 1ZI9A 2FOIA 3KVOA 4R1TA 3REGA 3TSAA 4CFYA 1GV1A 5AK5A 3L82B 2F5CA 1XK7A 4XIYA 5CVVA 3FHNA 3OQIA 3TKAA 3E6DA 3I9V2 1NJGA 2D8MA 3GTMJ 5HF5A 1B6GA 4R2HA 5G40A 1WSBA 4BUJA 1B72A 4Z0TA 5CB0A 3RWBA 1L4MA 4XJSA 5GTHC 2WIKA 3CONA 4YJHB 5H5JA 1GNVA 2C3UA 2ZAMA 4HDSA 4M98A 5SZKB 2PGLA 5JD5A 2E1MB 5DRYA 1QK5A 4R83A 4ZDPA 4DARA 1J4AA 1BHSA 3BD9A 1BS2A 2RKOA 1HDIA 2C92A 2XNCA 3DQPA 3MLBA 4QUBA 1XKQA 4AY2A 1CR4A 1JDVA 2J5BA 2POQX 3GPDG 4NENA 3CKYA 5TGDA 4GMDA 3TLCA 3I59B 3FHJA 1V11B 1VHWA 1Z6AA 4U7PB 3KR0A 1G4DA 3ET5A 4DDMA 2RHJA 1E20A 1HY3A 3RPUA 1IXSB 2WJIA 5COQA 4Z49A 2NVWA 3L3BA 2H2GA 1DKMA 3O9MA 4JUAA 2VK8A 5EGOA 4WFJA 4HCJA 3LWBA 4WK2B 1IULA 3I8XA 3C18A 2JBHA 2JVJA 1KXZA 3OYLA 4QPCA 2EEPA 4KACA 4LTDA 3MVEA 3WB1A 1AKVA 2EZ4A 4YPFA 2HJWA 5ENDA 2JPBA 3KSMA 1EGHA 4H0FA 3EF3A 7MDHA 2OC4A 2PT7A 2F43B 4G1BA 1GOTA 4YP9A 1HORA 4JP2A 2BFCB 1E3OC 5KSYA 3V7YA 3DZKA 3AEUB 4PR0A 1YO5C 1ESZA 5EGNA 3ZGNA 2B30A 3QJYA 3SF0A 2P5VA 2X22A 1C7JA 3ZGLA 4J7XA 2X0JA 5SYMA 4AUNA 2FUNB 4MA0A 2CGEA 2ELJA 4QUGA 1FP7A 3FXMA 3CMEI 1U3DA 3RAGA 1M76A 3UH1A 3WLHA 3C14C 3ZHQA 5ITZA 5K3OA 1HR0B 1F5TA 1QO9A 3B78A 1FEZA 2JUGA 1L3CA 1ZJ4A 3IV9A 4G3XA 2WC2A 4ZZ2A 1GR1A 1GPAA 3H8SA 1NRXA 2IPXA 4M8SA 4F0JA 1Y9EA 3RS4A 3WJAA 3BQNB 4YIIA 5KYXA 1YNOA 2BEWA 3OYGA 2W6OA 4WZAE 2AQ8A 1ZUNA 1R23A 2C9ZA 3NAMA 4JVOA 4L4YA 3DLIA 1Y9ZA 3T3PB 4AD8A 4CM7A 3X1DA 4RHEA 4I2OA 3VZRA 1D8KA 2KS6A 3WC4A 5ICMA 4TVOA 2YR2A 1UBLS 3N7AA 1JT9A 3T0FA 3ZXXA 1DB3A 1W8IA 3NWBA 2FMYA 1BM9A 2OHOA 3DTVD 4OLAA 2B2NA 2WQZA 3ACBA 4E7IA 3BORA 1QIMA 1YL7A 4JBLA 1C3OA 2WADA 3DE1X 4KR0A 1P1HA 5B1HA 4RAQA 3WL7A 4BTLA 2WSSA 1SB9A 3ZOBA 1HDEA 4AROA 9ANTA 4BLTA 1IFXA 2JEYA 4MUFA 3PXEA 2IL1A 4DLTA 5KC9A 1V7CA 1XYVA 4LY3A 1PD1A 5E0OA 1BDJA 1N2GA 3TAHA 3IH5A 4L4ZA 4KMUX 5B4UA 4FZJA 2ZNYA 2I3AA 1P4AA 1I7PA 1WHUA 3MKYB 3D31A 2BWJA 3WOHA 1DLIA 4FEAA 2BUBA 1HUQA 1O8CA 1P18A 1U3CA 2ZJYA 2HKIA 1GSHA 3MJFA 3Q7EA 2BHRA 5H59A 3ZXIA 1Z77A 1BS1A 2VT3A 2ZCVA 4JELA 1IBLB 5C4MA 2GZWA 5AW0A 3HI6A 1A97A 4FJ1A 3M89A 2AXPA 5ER6A 4O25A 2O7QA 3ENWA 2JGAA 3RG8A 3R8CA 3ZIAD 4IX9A 1UR5A 1EVJA 2B36A 2F67A 1SAYA 3UJCA 5HK9A 1MX3A 1MJ5A 3KQTA 1SNYA 3KZNA 4HFMA 3RIEA 4G5SA 3VJLA 5FLXA 3MJHA 3OIOA 1O94C 3FSRA 3U3ZA 2AJTA 1YL6A 2B5WA 1DWPA 3QUCA 3GDGA 3QXJA 4FLFA 4CDGA 4WBSA 3UOWA 4HNTA 3WGOA 3WO1A 4ZDKA 3GLTA 2WY7Q 4LOAA 5FBHA 3ZY3A 1Q44A 3O9VA 4IJWA 1V16B 4QTXA 2IY8A 2C31A 2NO4A 3DONA 4PXAA 4XI9A 4OQMA 3KZMA 2GWHA 2BFMA 5FLYA 1T56A 2H1SA 3U4DA 3LKZA 5BR4A 1X1PA 1TW3A 2QJFA 1Z4LA 3AVQA 3D3NA 4ZPJA 1I2ZA 1U5TB 2YS9A 1MO5A 1NVXQ 2C1EA 3PS9A 2WB2A 4L8GA 3ZVLA 4NDAA 1XAJA 3G6WA 2ROQA 2FP4B 3KUUA 1P0QA 3PQ2A 4BNUA 3GLGB 2VF8A 5DD8A 1T9ZA 1DBPA 1N25A 3CWQA 3F3YA 4RF2A 4JHXA 3A01B 4HYQA 2YYZA 3HHHA 1FFXB 3HJBA 4JMLA 2W2PA 4A9AA 1TBXA 1MG5A 1P7YA 1WQ4A 3FDYA 3H04A 2DT7B 3I52A 3GDFA 3WICA 5F21A 3JQ6A 1JI0A 3MB5A 1VSQA 3EXHC 1TZLA 4V0OA 1DUVG 3H9GA 3Q3CA 3VU0A 3BBLA 4HDSB 4NCNA 1P5JA 1ZINA 2FE1A 3M5CA 4LJSA 4DYDA 3UWSA 3LFUA 1ZCAA 5CB4F 2H9IA 3T7AA 4FSDA 2GOXB 3IIKA 3LO8A 3A36A 4KKVA 3WKEA 5F3RA 4A8JA 4AVZA 4IIUA 1E79A 3TSCA 3B02A 1XD7A 1C9DB 3AU9A 2FSFA 3LT4A 1JFVA 5GJBA 2UU9B 4IXNA 4WZAA 3K09C 3S99A 4CWAA 2GF2A 4D1QA 1VKHA 3QFRA 2BI7A 2FUG1 1XLUA 1J42A 4LV8B 4M1KA 3K4LA 4RWEA 1CUUA 3VKFA 4BBPA 2W83A 4MA4A 3VSEA 3IAS6 3ZN2A 4I99C 4Q4AB 2PZ8A 4MTDA 2HXOA 2LD4A 4QIHA 1B8UA 2ERCA 5TNXA 1QZTA 2HQBA 1NTCA 4WVFA 3MCZA 2BFPA 2K9NA 1VPWA 1L4GA 4LQDA 4IJ5A 3KBBA 3KEGA 1BROA 1H9BA 3L4JA 1G2QA 1H2XA 1F5SA 2H7XA 2OZLB 2WT8A 4L8WB 4XRGA 5KUTA 3TL6A 3EUEA 3O21A 4ZN6A 4FUTA 4MEXF 2ODWA 3HEAA 1I5EA 2JB9A 2A7QA 3AZQA 3F71A 3WHCA 5BOVA 2GJ4A 3OICA 5DBGA 2HRRA 4MXDA 4H7PA 4ZQIA 1CUHA 1GGKA 4WKCA 5A5GA 4D3DA 2AW3A 3T54A 2ODEA 1O3QA 2PD4A 2DMNA 1PX2A 4H9GA 4OMUA 3BGIA 1F4LA 3A6PC 4DIQA 1Z9BA 3D0SA 5TQVA 5ECWA 4OHPA 1OGYA 1VCHA 3F8TA 4L0DA 2WY2D 2PDAA 1DAGA 1GP2A 1BWQA 1MBEA 3LYUA 2R7UA 4WN9B 4OAQA 4HEHA 4RZUA 4B73A 2GS9A 2P90A 4QYIB 4UBIA 4D8YA 2PZKA 3U13A 2D5CA 4BB0A 4TKUA 3O4IA 4H35A 4DLSA 3LUKA 4CTKA 5C51B 1CQXA 2DA2A 4EGAA 3WMFA 2FPUA 2NZYA 1QFYA 5ALVA 3QBJA 3EBPA 1RM3A 4EY8A 4IL6C 4Y0AA 2H7YA 4Z1MA 2EGHA 4FE3A 4XWKA 3R0VA 5D6FA 3MW8A 4B82A 1UJCA 3RS2A 4LHSA 1IXCA 2CL7X 3N8HA 1V37A 4O0MA 2AN4A 3T3IA 1DBIA 4BFVA 5KHLB 2O5EA 1LUJB 5LXTB 3LQ4A 1UXKA 2GK4A 2WJYA 1E2PA 4MX8A 5EERA 4ND3A 2Q0OA 2A5JA 3PIIA 1XU7A 3UGKA 4DMKA 4QYXA 2GPNA 2V98A 3SQWA 2IOFK 2HA0A 1IB6A 1VCIA 2QY6A 1NASA 1E5QA 2XBUA 3S3NA 2K9LA 1HQYE 1KEUA 1EDZA 3RCOA 3CQ9A 3U5ZB 4FU0A 2QRHA 1JA0A 4O4LF 3CZRA 3EY4A 3KWMA 4JWTA 5FQOA 5E4YA 2E19A 1SBHA 1VI5A 2WAYA 2WPNA 2CQNA 1YB5A 2GM3A 3BXEA 5CB4A 1TT5A 3SHTA 3M0EA 2MLGA 1RFGE 5DSXA 1L5NA 1RVDA 4KP7A 3QIVA 5ECDA 1ETVA 2R7RA 4JFRA 2A92A 3NWPA 1NC3A 1K27A 1JZSA 4FZVA 3S1AA 2ACWA 4PRLA 4XLLA 4DRYA 5BQ3A 4WKNA 2D0PB 5J1YA 1CWUA 4BY7J 3A1SA 3LBNA 1CQIA 1Z74A 4PNEA 5LJIA 1M34E 5IT3A 2ORYA 1D5YA 1OREA 2IPLA 1CZHA 3I9MA 4LHXA 1G18A 4MW7A 4NOJA 2OTCA 3G9UA 5FIUA 2AZDA 2V4ZA 3EA0A 1KDYA 2Z8YM 2VPTA 3WGJA 4CQLA 5C5EA 2GZHA 1IUFA 2R5ZA 2Q4BA 4DDKA 4F5ZA 1K7SN 3STUA 1D5VA 5FCDA 3FPKA 4JNCA 2Z58A 4NJEB 3IVRA 3M5PA 2PSFA 1J2EA 1RYFA 2ENWA 1V4VA 3EH2A 2CJWA 4YIKA 1DGQA 1R5BA 2IODA 2DWCA 5A5DA 4KXQA 1I3MA 4GX2A 1TWAJ 4Q4HA 3W3ZB 4K6OA 4AJNA 1IJFA 1D8AA 3WB2A 3FSJX 5JS1A 5HHTA 4GGMX 3ZQHA 3FNEA 1DC3A 3OWTA 1LDNA 2FSHA 3A4VA 4JROA 4US1R 5CGZA 4C08A 4D3SA 3H2IA 4IH4A 4FCTA 1LZLA 4D4IA 1SU4A 2MH2A 1RYDA 5E1DA 2COBA 2FOWA 4UNQA 4B9EA 4UB8C 1KU9A 3RBXA 4CTOA 3P19A 2MA3A 1R49A 3C48A 1B9NA 3M4XA 1ZK3A 4IRXA 4XB1A 3G68A 3V48A 2ZRHA 3NM5A 1B26A 2VZLA 1D1AA 2OBXA 1Q7BA 1QZUA 4FOSA 4KQIA 2XZTA 4OPMA 1C81A 2WKRA 3M7IA 2OYCA 2Y2UA 4M54A 5D51S 4ZQCB 3RSGA 4Z1MD 5L4NA 2YFKA 4RMHA 2ZSIB 3PCRB 3SZUA 3T1OA 4M3DA 2FSPA 5F64A 3N2NA 4HX9A 1QCZA 2HQSA 2XMDA 4EI8A 1KOFA 1NPTO 2NUAB 1ACJA 3LIPA 3VODA 3M7GA 1MG0A 1DO2A 4ON0A 1Q83A 2NAPA 2GASA 1DWQA 4OK5A 2HEOA 3OPYB 4NVRA 2JFXA 3ROTA 3WK4A 1WDWB 3KR2A 3G2MA 3I1IA 5ILOA 4FHTA 2ZMEC 2KDZA 3EPLA 1TK9A 1F9NA 3RUPA 3ES9A 3JTEA 4KVAA 1L9XA 3E9CA 3TLXA 3GAFA 1NR7A 1SM4A 4UDXX 2JJQA 4ZVSA 2NP6A 1USIA 5H81A 2VQSA 4TL6A 4BNJA 3CS3A 3DTYA 3ZMZA 2ZIFA 2V0NA 1DJNA 2W6JA 3O38A 5CXSA 4WY2A 2IH5A 1MRNA 2XPWA 4NC6A 2X1VA 3HZHA 3ML1A 4HGOA 4ZEWA 3VHQA 4X7PA 5L3QB 2O5RA 4NZ9A 4AWAA 3I39X 5JXJA 4NZNA 1N2IA 1BCRB 3EIOA 1JUMA 5J1UA 1E3TA 1UWKA 3C3CA 3LRTA 3PEUA 3LBAA 3BJEA 3R6GA 3RB8A 2WF7A 4MARA 2AR0A 2C3YA 3TTUA 1YW8A 1K78A 5BUSA 4IIBA 2W2MA 4PG4A 4BVGA 4E46A 5K8VA 3ABRB 1SCUA 3B85A 4U87A 2AZTA 1SKMA 2EBWA 4M8NE 2UAGA 3TZLA 3NAUA 1KMHB 2NPIA 2PZAA 2W7NA 4BY1J 1X70A 1T2UA 3DL2A 3IAM1 2IHKA 1TX4B 2PKRA 3F9CA 1DCFA 4L6CA 4LOKA 3UUWA 1R1UA 1TVEA 1XDWA 2ILVA 4P0QB 2PAAA 1NOJA 2PMZN 2ZTLA 4IIYA 4LN1A 1NYRA 5BR8B 3OZRA 1NNI1 3GMIA 3NQ41 5EI5A 5JVDA 1K3FA 1WGXA 1WZEA 5KYUB 4WLVA 4AO8A 3ZWNA 5B53A 2J5OA 4FW8A 4OHFA 3BCRA 1OVMA 1QP4A 1FDVA 4H4CA 2ZWPA 4HBGA 4Y4RA 4A7PA 1O96B 3PBKA 2ZKLA 1TMYA 3VO1A 4R1SA 4DIUA 3CJTB 4CR8A 1R8XA 3OESA 4W7SA 2H63A 3GQBA 4A03A 3VC7A 1KS9A 5CAEB 4PSVA 3V8QA 4Q39A 1H9CA 4IFTA 2KIFA 1IRGA 3E9MA 1DPUA 3K9GA 1N7JA 4Q1BA 2WG2A 4EHBA 3SHWA 2AL7A 4J0QA 4J9VA 3GL9A 2KP6A 2GH1A 1XFAA 5DCMB 2NYAA 3BF8A 3P94A 4LXGA 3RYHB 3SXPA 5EE1A 4MHSA 1U8FO 5DEIA 2GPAA 4CMKA 1XTRA 1NUAA 3IDZA 5D1HA 1Z6TA 1AMNA 2R6FA 4QLCU 1QG4A 4RVSA 3KETA 2PM8A 3G7NA 3JZFA 4TTTS 4EKYA 1W9MA 2HU5A 3AERA 1E3SA 1I1SA 1KI6A 1RAAA 3EIQA 3JQQA 4I1UA 3I9JA 3F1KA 1JG7A 1XS9A 1J97A 3T3HA 5B64A 2O23A 1GUDA 2HA5A 2KW5A 4X0GA 4RPCA 4MGIR 2UYOA 3KU4A 2B92A 3DZ8A 1C0KA 4P35A 4BFYA 4RABA 5JZ9A 1ONBA 2DTEA 4IDDA 4ALNA 4BMDA 3DLLF 2VHJA 4CRWB 3DSRA 4YP0A 1JMVA 1T2CA 5C7IO 4QU8A 3MN1A 2JGNA 3SS7X 1W36B 2JJ1D 2PQ0A 2FFBA 2H85A 3W4KA 3I59A 1W88B 3TOBA 3NVKI 2IVZA 3GD7A 1ECPA 3KHTA 2MSLA 1T38A 4YG2F 3CLHA 1GZ3A 2KLOA 1OI2A 3D7SA 3E84A 3PR3A 2EV5A 2BKEA 2QLFA 2I3ZA 4TLMB 3P0HA 3RKXA 1AQYA 1PTJA 1XZFA 3DEIA 2PI0A 1OY1A 4MPDA 3DCNA 2Q3HA 2GCOB 1HTTA 5K0ZA 1U8RA 1STOA 3OLVA 3CP2A 3ED5A 3C7TA 3P20A 1UOEA 4LJ9A 3WNZA 1KRXA 2PRIA 4D80A 1IF1A 3I0NA 4NBTA 2AFHB 1JV2B 2QSGX 4OQYA 4B7CA 3WA7A 2G36A 3CGGA 1YS2X 3Q7RA 4KN4X 4WIAA 4BQNA 4C7OA 2E34A 3ZE7A 2OV2A 2XCQA 4RANA 1W85B 3DKYA 1QMPA 2P8JA 2OO5C 1SAUA 2VRCA 3VYSB 4WOBA 4M72A 3IKLA 3UMMA 4RZQA 1EXNA 2BKLA 4TYYA 1DAMA 2XUPA 4ACBA 2OCEA 2BMDA 3GZNA 3JR7A 4GRDA 1AO0A 4UCQA 1YFJA 221PA 3DEFA 1TM4E 2HPVA 5CFZA 1YJCA 2GNPA 2PJUA 4LEIA 2WV9A 4JT4A 5EWMB 3CJRB 2I33A 3O6BB 3GW8A 1ZW6A 1J23A 2WF9A 3N74A 4CKBA 4DNFA 3ZUGA 1GFZA 4FW9A 4PX2A 1MX9A 2GFHA 3WGTA 1WHTB 1IO2A 4BXUA 3BWEA 4FR5A 5LLDA 4RX1A 2AQEA 4ISBA 3I5MA 4MO9A 4YXWA 2VNIA 4IOCF 2YOHA 3LUPA 3TI9A 3U48A 1L1QA 3RUCA 1Y3HA 4AM3A 2Y1OA 5JQGB 2AZMA 1T9KA 5BWLA 3QHQA 1VPTA 3O3MB 1CZKA 4LXQA 4S3MA 5DIFA 3CUQA 1XCJA 3DXFA 3OEED 3UMJA 3GUZA 2I66A 3VKWA 4BAGA 3LDGA 4C9BA 1LNSA 4JLKA 2GO1A 4O1HA 5EA2A 1LF0A 2EILH 5BMZA 2P5LC 2IUTA 1KDPA 1N8KA 1ULAA 3R7SA 5K8CA 3A1WA 1KRHA 2A69F 1KZ6A 4IRUB 3AHEA 4L4XA 4ARZA 1MZPA 1V1RA 3VOBA 4EEFG 3DTEA 4LXYA 1HLVA 2DQZA 3NUZA 3NCHA 3PRKE 5D5QA 2M9MA 4B6EA 3V7NA 3QLVA 1IXRC 2XKPA 1GQRA 3I73A 1I14A 1U2DC 1Y5IA 3GFBA 4XTCS 4PFPA 5JI6A 7YASA 3GJTA 1OT5A 4P1WA 5HNFA 1J0CA 3N8KA 1ORRA 2KIUA 1VE1A 1LWOA 2JFYA 4N7JA 2RGCA 2RC4A 1JDBB 1DXYA 3H17A 1M6YA 1TFUA 4ZT2A 1JXAA 3OZVA 1POGA 3CF5F 3B2EA 3QUBA 4PRYA 1OFCX 1UKVY 2V6GA 3K92A 1UZMA 2SNIE 5KAFC 1UK9A 4XNFA 4EJSC 4A3JJ 3L8YA 3FMSA 4LI0A 4PTLA 2O8FA 1G60A 3TZKA 4BP8A 5K0TA 5KI6A 5HP4A 3BCHA 5JSYA 6LDHA 4TKVB 5FGMA 3FHTA 5FTNA 1XPUA 4F6LA 4MHOA 1ZGAA 1P8AA 2A59A 5DD4A 2NN3C 4OHRA 2AOUB 2Y2VA 2W1OA 3I32A 2PUAA 4J19A 2O05A 4HNUA 1QE3A 4O2RA 3E22A 4C2AA 3HJRA 3OU6A 3TDKA 2NVUA 1P0FA 3U6BA 4GHWA 3VSKA 2G25A 4QPOA 1NATA 2H1KA 3R60A 1JJAA 1BS9A 2VONA 1R5NA 2B9EA 1T98A 2WYWA 3EG5A 2VASA 3MXOA 4HH3C 1J1IA 4ETSA 5AQEA 3R7FA 3DV9A 3HA7A 3V9PA 1D03A 1LPAB 1E89A 3O6VA 2H8WA 4V03A 5JYCA 1AMUA 3E9RA 3PC4A 4X97A 2O59A 1LY1A 3LD9A 2IPMA 1TB4A 2I1QA 3EEIA 1KK3A 1GZSA 5AT1A 1TAGA 2OCDA 2P0YA 2DKNA 5CNMA 4Z9BA 3F7OA 4EABA 1ZNWA 2QRKA 2VODA 5TS2A 3L0PA 4UASA 3QOXA 3HPHA 4RIEA 4B4WA 5AMXA 4RCYA 3GBPA 3K6SB 2DOAA 1NBEA 5KAPA 1DFHA 4C0KA 3QVJA 2XZPA 4G4SP 3LSGA 1MH9A 4WDRA 1VKOA 3R0XA 1LB1B 3FRIA 3FBNB 4ZIRA 1T9CA 2Q46A 3HDHA 5F4ZA 3SXUB 4O29A 4ZGBA 3CRW1 4BV8A 1O57A 1NI4A 2F1IA 1P2UA 1OHHA 5HS7A 1CR6A 1X2BA 2IDZA 2PKEA 3L92A 4J90A 1DDIA 3TSOA 1NVEA 3QA3E 1JJFA 4H1WA 2XQGA 2J3DA 1K06A 3NYRA 2OXIA 3GLIA 3V4LA 4QTUB 1WM1A 4W1RA 4N9HA 5JATA 1B3RA 4A36A 3D4OA 3ANXA 1NYLA 1JJ6C 1IJWC 1N6KA 1W9HA 3P45A 3IEUA 1HM5A 3IDSA 4X84A 1WD5A 1RZRD 2D6FA 2VNSA 4QPJC 1FP1D 5AJWA 4IPTA 4L5YA 2FMUA 3N28A 5KWEA 4HVLA 2QSHX 1WSDA 4CR7A 4QUEA 3RYCA 5KCZA 2FP3A 4TMTA 2P5KA 4OMZA 2XB5A 1R9TJ 2NUAA 1XPJA 2OKGA 2XB6A 1YDHA 2PXHA 1W8DA 2YV1A 3P9SA 3RVMA 5CLGA 2JK0A 3X1KA 2G80A 1DNPA 2W8ZA 4JLBA 1KDTA 4U9UA 2XE4A 2CDCA 1QKJA 1T35A 3WTWC 1ZVQA 2PEZA 1ZITA 2UZ0A 3TUJC 4ZV4A 3ZZNA 2A61A 1KVSA 6PFKA 1NM5A 2R7ZJ 1RQNA 4M8KA 4ME6A 5DEQA 5IARA 1XZHA 4XKCA 3GYHX 2ISQA 4FGLA 3N2LA 4BS9A 4C4AA 5I47A 1VL2A 1AGXA 1WS6A 1U7OA 1A04A 5HGJA 1E8MA 3TBKA 3AP1A 1KORA 3W78A 5CVRA 3O8GA 2H1IA 3GIWA 2A8YA 4YCMA 2W6PA 3DKXA 2I80A 3L8EA 4JENA 4YP6A 4YWJA 1BOOA 4B7AA 4MUIA 5ED4A 4PZAA 5CDUA 1E1CA 1Y4UA 3H6HA 4FHFA 4TROA 3QYBA 1G17A 1K92A 3HKEA 3OF5A 1ZMOA 3OEHD 1Q3TA 3DM5A 3OY7A 1G4UR 5J8CA 3WMXA 1TADA 4OIOF 2VRNA 3I1JA 4URUR 5KWSA 1R0RE 2BFDB 2VL7A 3HDQA 2L0KA 3MWYW 4QODA 4B3CA 1KDZA 4N4NB 1VZ2A 4EK9A 3R5XA 3E70C 2O0JA 4YMWA 3DKRA 3UYLA 3U7EB 1EM8B 2JG3A 3HYRA 3R0AA 1JDPA 3M2TA 1BEUB 3BAZA 3P0IA 3QE2A 3K4JA 1U0GA 2QMZA 3B36A 2OO7A 3LGSA 2YVKA 4O1IA 4TWIA 4XVHA 1C9KA 4D02A 1T8YA 5DO9A 3SVLA 2YY6A 1V55H 7GPBA 1S3FA 3ZQFA 3CW8X 2EKQA 5AKGA 3U5TA 2IKQA 4RZ3A 1C41A 2CE2X 3QPUA 2NUBA 1YR3A 3P5BA 5K3DA 4C01A 2VQFB 1OX4B 3IS3A 4OP3A 2BFEA 3RFVA 2GIZA 1IM8A 4D7NA 1D7OA 2V6MA 1BH2A 3GCGA 3H3XA 3PG5A 5CCXA 2HIAA 1N1MA 4JJ7A 3O1HB 1E9FA 1FMTA 2LFBA 1HT0A 1OZGA 2QTWB 2VZ0A 2CLLB 3B1KA 2KJBA 3TZHA 4EOGA 4EY6A 1P1JA 3W0LB 4DC0A 5A7FA 1U7DA 1SELA 1JN0A 2ZYAA 3ETNA 3T38A 4DMRA 3TP3A 2ZJRF 3W6NA 1EP2B 1H2WA 4O6JA 3CO6C 2CVHA 4UOEA 4WA8A 1B6RA 1QJ4A 1W85A 1CQTA 3WKBA 2NSHA 1FYEA 1NW4A 4X61A 1D5CA 1O4WA 2J6BA 1OCOH 1VQ5I 1OBCA 5IT5A 4HLYA 2C2MA 3BOSA 4Y6QA 4EAQA 3FIWA 5FD5A 1UIRA 3AT1A 3OO1A 3U1TA 3LUCA 1WXHA 1Y6IA 1KYWA 2ADUA 4G0QA 3DZDA 1SG9A 4B46A 1RLOA 5LD2C 3C8ZA 4TMKA 5EE0A 4KMFA 1SC7A 1UMBA 3INGA 4W1PA 3S5JA 3NWTA 4YFKF 1HV8A 1WWKA 4IL5A 4BMZA 1EG7A 4AJ1A 4UPDA 3MKLA 1VBNA 1WSAA 2E2WA 1REQB 4QBIA 4Q7MB 1H2AS 3CCRI 1UDBA 5FI5A 1GPH1 2QBYB 3CCQI 4UEOA 1BE0A 4L5CA 5AKJA 1H8EA 3HN2A 4Q9DA 5AVXA 3UHOA 4A1OA 3CN9A 2G04A 3TMAA 4FCWA 4CODB 4F04A 1EH5A 1IIRA 1N2ZA 2OCXA 2RH9B 4KOEC 1LCIA 4QRIA 5A05A 2XVAA 1G8GA 2HCBA 1VJCA 4A5SA 5KREA 3Q10A 3G8AA 1RC8A 1NF9A 3CUOA 1DXOA 1NZDA 2QJTA 4YLGA 2XB9A 3JARB 1AA9A 3UOAB 3IVAA 4RLFA 1BCRA 2NYVA 3HB1A 5A6SB 3EZFA 4BN5A 4XN3A 3ZQGA 5FLVA 1QKKA 1Q7TA 1TU0A 2XVZA 1VQ6I 2PTHA 1WI3A 3HY4A 4GVPA 4ZDWA 5ALMA 1FBNA 3V8EA 3ZDBA 1R4MA 1CY0A 2RHRA 1UJ8A 3BSWA 3NT2A 2Z8ZA 3L77A 1ULBA 1J2YA 1DGRM 1PFWA 1ZJYA 2DH5A 2JKZA 2DDBA 1QRRA 2HPHA 2NVOA 5EZQA 3PVCA 3JRBA 3CHYA 2Q6TA 4EENA 1FTQA 2X1MA 3H3UA 1VXOA 2VNAA 3MJ4A 3SZLA 1E2MA 4RC9A 4C88A 4M38A 2GPJA 1JRLA 4OHCA 3ZEIA 4I08A 1ZESA 1BC8C 4IJKA 4MRSA 4XYMA 5G02A 4HAMA 1DL5A 2FW9A 5IPAA 5M5XJ 1LPQA 2VZ8A 3G1LA 4EVIA 2GCOA 4ZU1X 3WIVA 5EUBA 3BDAA 4W7IA 1LBEA 1RI4A 4GBGA 1MD0A 3CCSI 4IO0A 3C7CB 4JQZA 4WTOA 2X9QA 4CLOA 1FUIA 1GPKA 5CIQA 2G0NA 4CKXA 2E4WA 2TMKA 2Q3FA 4PGGA 1WHSB 5T4BA 2GCPA 1F06A 1M8GA 2ATEA 3T9FA 4Z0PA 1K8RA 1OFGA 2M1ZA 4PLYA 4DB4A 1Q0UA 5JHFA 3BG9A 4KH0A 4G8XA 3VH4A 1UJ2A 2QU7A 3Q88A 2QVYX 1Q2UA 5EC8A 4MPJA 3GRKA 1TYZA 1DQUA 1EUCA 1GRQA 1X1TA 5AI4A 3ZZ1A 2PT6A 2ID3A 4BZPA 1JYSA 4DLPA 3PL1A 4IFEA 2EP8A 2QA4I 4AZ3B 1EFLA 3LFKA 2HBYA 1C0LA 3AG6A 3HR7A 3I2JA 3KKPA 3JD0A 3VH1A 3ANTA 4KL8S 4EUKA 2PFGA 3GBSA 1O87A 1TM7E 2CVZA 1ML4A 4WZBA 3V8PA 3E8SA 3NIBA 3KEQA 1OXXK 3OV8A 4DYRA 1M33A 1U8ZA 3C3KA 3G9XA 3R20A 4MV5A 1HOMA 3WV4A 1RAIA 4MYDA 3BPXA 1GKYA 2FZLA 4HT3B 1A6QA 1SZPA 2WAOA 3II6X 1GFWA 1C9EA 2GBCA 1GXQA 4QPZA 2XMSA 2V3WA 1HSJA 3R3ZA 4KXUA 1DBRA 3AX6A 5D2CA 1ZPDA 1XA4A 2B2XA 1Z56C 2J0VA 3F78A 3PRHA 5J63A 1XDZA 1W2WB 2ZRGA 3CFYA 3A0UA 1KA8A 2ZIVB 4PPYA 1TJYA 1JI8A 3LKBA 5G0VA 3IIIA 2FPIB 4LBWA 1EJBA 1MO4A 4BB5A 4CO8A 1LU9A 1QDLB 4DBLE 4KDPA 4J07A 3DU5A 2R66A 3GZJA 4QFBA 5L40A 3WBBA 4A91A 5LBUA 1J5YA 2JGJA 2QSYA 5DEOA 3RK0A 1IMOA 4MWCA 4ZO7A 1LRKA 3URKA 4XCXA 2H6EA 5FFFA 1J1UA 1LRJA 1W0CA 5DMHA 3MGAA 1ODJA 2OXCA 5TJJA 3CNBA 4ZVVA 3SKYA 2L4AA 3M3YJ 3USCS 4DUPA 3DZHA 2ZJ5A 2A33A 4GI2A 2KM1A 3T7TA 1NUPA 1J21A 3CZ4A 3ELDA 3ON5A 1E7RA 1GUBA 1JTYA 4ACAA 2JA5J 2MTBA 2HR3A 3W4JA 5JPIA 3OAAD 3CPHA 1ENHA 2HTSA 2GLUA 5CX1B 4ZICA 1GNPA 1U81A 3DB2A 3Q2KA 3G2HA 4P7JA 4BFZA 1OXMA 2C5AA 3HP4A 3RI4A 4KLRA 5ALRA 3EEYA 4NNJA 3K1PA 3BA1A 1QUFA 3F2IA 3GELA 4BQEA 2OZEA 3LCMA 5I9TA 2YWDA 4TQUS 5E9QA 2OLKA 4HD8A 4HV4A 3LUBA 3VR4D 5JS7A 4MW0A 4OY3A 2YKGA 3T5TA 1MJGM 1PZGA 5CKTA 2L02A 4YJDA 5CK5A 4DCTA 4K6FA 5EDNA 5JCJD 4ZZIA 5KX5F 3H9JA 2GA9A 3TUZC 2CZCA 2X6OA 3KXPA 3QOFA 5C3UA 1JB1A 1Y98A 3G02A 4XOUA 2DMTA 3VYRB 5B57C 4Q82A 5DLPA 3S16J 3HGYA 1RHKA 1J2JA 2Y4OA 4CCOA 3ETHA 4AS1A 5K9ZA 2WE8A 3HCDA 2OXFA 1L7VC 1UXOA 3IPXA 4Z4QA 1D6MA 2AO9A 3L7NA 1P6QA 1Y9DA 3IULA 4MQBA 4KWIA 1KYXA 2ZIXA 5T8KA 3U7FB 4AQDA 1JVBA 3AI2A 2C7QA 4Z53A 4TXLA 5GADJ 1F8UA 4FDLA 4B3AA 4Y30A 4ASNA 4CF4A 1FSPA 4IMPA 2P1DA 3NT4A 1YSCA 5DP1A 4Z4CA 5KNDD 4UHJA 5BPIA 2NQTA 2GZAA 1G21E 3QFCA 5GM1A 3RHZA 1G9SA 1D0YA 1PDWA 5CURA 4MEBA 2Z2ZA 1GTG1 1OQAA 2QUZA 1CVIA 3JAWA 4COOA 1A9XA 4PEVA 1IK4A 2CJYA 3BMNA 4MQEB 1ZD9A 3H5RA 3M1IA 4MGHA 2JDIA 5TSDA 3BTVA 1CXZA 5A9SB 3BZ6A 2QG9A 1Q7EA 4N01A 5C18A 3E5NA 3LPAA 4AG3A 2X51A 1NU6A 4RTQA 1CUYA 1XQXA 2R0QC 2CDRA 1CNFA 2I8CA 3KCNA 4M53A 3SI7A 1SKYE 1V7PC 1BI3A 1DDGA 1V3QE 1V8FA 1YR6A 2E48A 1DU6A 2IEGA 4P8RA 4XFJA 5DI9A 4B0OA 1NTRA 1JT6A 4BO9A 4DT1A 1HE5A 4ENWA 3V4GA 5KPJA 4LS3A 3DEZA 1E1RA 3RJ9A 3P0EA 4WXHA 2HVRA 2DFFA 4EUFA 4H6XA 1GKKA 4UNSA 2B83A 3O83A 1GA6A 1UC4B 3OLYA 1IZ1A 1GT6A 3SQMA 3ZR4B 4AZSA 1JBQA 3NDPA 1LFUP 2IQIA 4H27A 2QAGB 2QAJA 3B51X 5C8ZA 1RVV1 2FI1A 2H0RA 3LFTA 2XAHA 5EE9A 1NPDA 1K6YA 4OHBA 1NXSA 4B6QA 2Z56A 5TMEA 2HCFA 2G07A 4MR7A 4Q3DA 3I83A 5IBPA 4H08A 2UVPA 1GNLA 1ISGA 1U9CA 1ZGBA 2G1KA 1YONA 4OK6A 4WOJA 2PANA 4TM7A 2CW0F 5I9NA 4UUSA 3IOYA 1RI5A 3SFIA 4GVLA 4RA9A 1GU1A 1FUYB 3MFYA 3GUDA 1DEXA 1SCKA 3JW4A 1Y8AA 5E6UA 2GN8A 4FMDB 4BLUA 2GF0A 5KMGB 4BO3A 1AQ6A 2PWBA 3UT0A 4LB6B 2YJ4A 4PLHA 3SJBA 3DDNA 2ZYVX 4PHGA 4OQZA 4UEKA 1XHLA 3NHFA 1CE8A 3KR9A 3USZA 4BWFB 3NHZA 4ZOQI 1W0KD 5CLFA 1TO1E 1UEJA 2ZXWH 5LEJA 1UP4A 2X2OA 2W5UA 3DTNA 1UQUA 3AM5A 3F9IA 3B5EA 4WGGA 5SICE 2R7WA 1T0FC 4L4RA 3RAJA 4P9UA 4YALA 1XZEA 4O2AA 3KFLA 1V43A 1UZUA 4NCXA 4TVKA 1GYQA 4D82A 4J94A 2ORVA 5AVWA 1DARA 1NXPA 1T2EA 2WJAA 3RS0A 3LGXA 5CW1A 5DCYA 5B55A 3FCYA 3TW4A 4BE2A 3D6HA 3DDOA 5J4VA 1IOZA 2IUFA 3LQQA 3UKOA 4XJTA 4IV5A 3AFMA 3H13A 4RZXA 1BQ3A 4FHCA 1J99A 1CS0B 2X8AA 5C7LO 4TXHA 4A3DJ 1Q11A 3HY3A 1MNEA 3S81A 1NIPA 4UULA 2AOXA 4CQMA 2JK1A 3EWIA 5CH3A 2YXEA 3ICEA 3BQZA 1FYFA 1ID1A 3IR5A 3KSBC 1B4DA 3E61A 2ZIWB 1F38A 4G97A 2L69A 3VPDA 1RYEA 3PQJA 4OEHA 4YPVA 2DOFA 1WU8A 3KXKA 3UW3A 1DG9A 2JHPA 3IHWA 2DPYA 4PWYA 3WLIA 2L17A 2AEFA 5G1OA 5I4IA 3VHRA 3HKBA 5IY5H 2RHGB 3U0VA 2JA1A 2UDPA 2ZXIA 1D8JA 2LF8A 4TN1A 1T36B 3DLHA 4Q7QA 2H4XA 5JCXA 1LDMA 5C7OO 2CWWA 3JCUC 1XYYA 3QEAZ 1DV2A 4ND8A 1JGSA 2DYSH 4J0EA 5IBRA 1LDDA 5CT8A 3NTUA 1IPFA 4V0KA 5EZ5A 3X1MA 1N5MA 5AI9A 4B3BA 4MR8B 4YUAA 2CFIA 2OHIA 3BRWD 5JFGA 1TTTA 3K53A 1V8ZA 1UAGA 4EV0A 5FTWA 4F5YA 3B73A 2R751 1JIJA 1B4AA 4QRHA 3BYZA 3E9QA 2GHIA 2GUWA 2Y1CA 1SKUA 2KB0A 3JPYA 4JP5A 5K0LA 3C3BA 3SZMA 4YNBA 1L2TA 1FBTA 2J59A 2LE0A 2YWEA 3OR2C 2D3TA 2H1RA 2BEOA 4LF5B 2AE2A 3FCAA 5BQ5A 1SD1A 2X7HA 3MJDA 2R5FA 4ESVA 4G6ZA 2OK7A 3UUFA 3NV9A 1DPRA 3OYBA 3OLWA 1Y42X 5JC1A 2RHLA 3IEVA 3QEBZ 2O8XA 5LQRA 1V41E 4ESOA 3EQ9A 4UHBA 4DR6B 1J0XO 1RQRA 5DVZA 1LNZA 4MKIA 2I55A 4OBBA 1OH6A 5CT9A 1FE8A 4F2DA 3IAS2 2I1WA 2OCBA 4DM7A 1MMSA 1HOTA 2IU3A 2D1HA 3C5EA 5LRRA 2WQ6A 3KPJA 4IUCS 5DBIA 1Y1TA 3OLXA 4ILKA 1KDVA 1HNXB 1DHRA 1L6IA 3HWSA 3ILYA 4PLPA 4DIMA 2P3QA 3C2HA 1I24A 1ZONA 5GZ1A 1EXDA 4JEUA 3KLPX 3OUUA 4RVUA 3FXOA 2G76A 2ZYUX 5DBEX 3WDMA 4LOHA 5HCUA 2VBYA 3WX0A 1RSZA 3WLTA 1KDRA 4BDYA 1JHYA 1EXWA 2RK4A 2Y2ZA 2ZQYA 3HIFA 3THRA 2HJHA 4TUYF 1W5AA 4HQLA 2RHCA 1HF3A 1M5TA 3G2QA 3T5MA 3BK7A 4GOKA 1JU3A 2V1NA 1BWRA 4E4TA 2ZE7A 1KAQA 4E5UA 4DEVA 1E5TA 4BECA 4UBLA 2WDZA 3HL2A 3MQ0A 3NOQA 2EFWA 1E9AA 3A9VA 1W25A 1FJ2A 4FFDA 2Y27A 3RARA 4CMEC 5JH7F 1G3MA 4MR7B 4ZQEA 3JQFA 1KWGA 5K7FA 1HE3A 1U4SA 3E2IA 1YJ9I 3JYQA 1NBOA 1ZDMA 2BI4A 3DEJA 3GY0A 1Z29A 3R3YA 1R6AA 1IDN1 1I3KA 3GEMA 4AJOA 4C7JA 3T3NA 1NAIA 5GAGJ 3C1OA 3G3EA 5KU1A 4FBGA 2XBMA 1BI2A 1GQYA 2VHZA 3DL0A 1R0LA 4OQFA 4HGRA 3BP8A 2QPLA 2RC6A 3ANLA 5KAMA 5HCIA 4BRWA 1Y3IA 2ZETA 4NBSA 3HGQA 1W2HA 1YRBA 2E6KA 1RKTA 1B14A 1IL0A 1T3SA 2IHUA 3Q2IA 3SDGA 4GH5A 3QKWA 2KHZA 4HX2A 4ETIA 2AF4C 3U7RA 2A5FA 4EA7A 2GA2A 1Z75A 2B61A 5IANA 4H7EA 3TECE 1DQRA 1XX5A 3M70A 4Z1OA 4G7OF 1XR3A 2BBSA 3B9PA 3K0CA 3OZXA 4MDFA 2QX7A 1SGWA 2YUSA 2PFBA 3AERB 3SICE 5K09A 1NXTA 3Q8LA 2VEDA 1F9EA 1Q14A 3KHSA 3D43A 3AF0A 4OB6A 1XGOA 5HDQA 2XT9A 4B6OA 2Y76A 4B9AA 3COZA 1HXDA 5INTA 3QF4B 2EZIA 4YJ2B 4FNMA 4G89A 4TOIA 3DWIA 3SQDA 4G07A 1CJKC 4EJ0A 3DTTA 4JZKA 1ISPA 4PLWA 2X41A 1LFBA 2IBMA 1VYHA 1GA4A 4BFXA 2VP5A 2HIHA 2OECA 2WIDA 4S0XA 3MVPA 5ECYA 4N9IA 4IRMA 2Z5GA 3WNQA 1D2GA 4KYWA 1OFUA 1ZJ6A 3MJVA 2C42A 5L53A 2IHYA 3WTUC 2YN4A 2VE9A 3DV2A 3LYAA 4ND2A 4UHKA 5JCOA 1PEAA 3DVSX 4UFOA 4CM5A 3BG7A 4NZOA 2I3BA 4F6RA 2O9JA 1R00A 2QQAA 3E3LA 5BT8A 5IH7A 2FF7A 1GDHA 5CM2Z 2Q5OA 3V8MA 4BDSA 1UHWA 3TIFA 3GOQA 3WYFA 5J1RA 2Q5HA 2QBYA 2QXYA