1S8NA

Crystal structure of rv1626 from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
190
structure length
190
Chain Sequence
b'AVPRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative antiterminator
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 74
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s8nA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s8nA01
1HW1A 3CLOA 3ZPLA 1ZGJA 3RTRA 1RNLA 3CO7C 3SNKA 1MGTA 3ZMVA 4G0PA 3KSMA 4TLMB 3ZQ7A 4GPAA 1F1ZA 1GLGA 1J5YA 4M9SA 1B6AA 3KZZA 5L3FA 4WWHA 4M88A 3J7AO 3K2ZA 5HLHA 3M6MD 2L2QA 1S29A 3ELKA 3JAMZ 1K7AA 5TPWB 4MTEA 5L3CA 5A2QZ 1ODDA 2MD5A 3G1WA 1MD0A 1GUDA 5TQ0B 3H6HA 3ZP5A 5E3JA 2LBPA 3U1DA 3OV8A 2ZJ2A 3EODA 4LLLA 4WK8F 1T98A 4F11A 2PQ8A 2ZNZA 2C6YA 2FBHA 3P7NA 1DP7P 2P4UA 3LOPA 3V8JA 2GQQA 3L9FA 3MM4A 4F8JA 4EY3A 5FWXB 1REPC 3NRVA 4F12A 2MH2A 2MYTA 2LIVA 3E5UA 4PICA 2LF7A 2DT5A 2QBYB 1ISSA 5TE9A 3ZN0A 3WTXC 3N0XA 1EV7A 5JNUA 2FE3A 4FT8A 4WUTA 3L09A 1CEYA 2QVCA 5CNMA 3WG9A 4MPTA 4XSXF 1IN6A 1W5SA 2A6EF 3MCZA 2QV0A 3CNBA 4G7OF 3HDVA 2GA2A 1EWVA 2HQBA 1R22A 1WI9A 3K9TA 5J6XA 1M5UA 1PNRA 3L49A 3LUFA 4Q48A 2K4BA 4MHGA 1FBUA 1CYEA 1C0EA 3GV0A 2YX7A 4L5JA 5D5VB 5DLEA 4ENKA 2FSPA 3PQJA 3WTTC 4BHPA 1M5TA 2HOEA 3KE2A 3VNAA 5HS8A 1Z26A 3GBPA 5EEHA 2WWYA 2M1ZA 3ZMSA 5LGTA 3WTVC 1K6OA 3EDPA 5A2QK 2MYUA 4OOIA 3EUHA 3R61A 4O5VA 2JB9A 2BV6A 2NS0A 1R1VA 5LEJA 4LB5A 1YMVA 3ULQB 2V0NA 3C6QA 5IC5A 3VOEA 4JOQA 1QNLA 2IKSA 1DBQA 2FA5A 3IP6A 4FX4A 4CZZA 2Q2EA 2TDXA 3J81Z 5EWMA 1J2XA 2H27A 3SFZA 1JF8A 5HDNA 3IKTA 1KGSA 4MLDA 2HTJA 3CTAA 1DBPA 1NXPA 2CFXA 2DPDA 4WXCA 1PEYA 1ZY2A 3RYRA 3JSOA 3HSEA 2W42A 3HEBA 4UV8A 2XHKA 4KFCA 3KP5A 3IRQA 1X3UA 3KCCA 3LAPA 2A68F 1JXSA 2Z99A 1V4RA 4UUVA 2CG4A 3E61A 2NNYA 1FX7A 3EQLF 1SAXA 3EQZA 1KU3A 1W9HA 2P4WA 4F06A 1MVOA 2V6CA 1CHNA 1AB5A 5E18F 2L01A 1RI7A 5F64A 4A0XA 4RB2C 2O3FA 1P4XA 1Z13A 3OQMA 2PUBA 4UHTA 3RPQA 3OLYA 3TO5A 2P5VA 2FMFA 4MR8A 1XSDA 4EM2A 5CVJA 1W7PB 2M30A 3LFKA 4HNRA 1U5TB 1OYWA 2HS5A 2JPBA 3H92A 1UB9A 1D2AA 5CHYA 3MZYA 3HRSA 4G97A 5IUJC 4AVPA 3N4MA 3OQNA 1P2FA 2LKPA 2NYXA 4RWEA 2O03A 1TNSA 2JT1A 2OU2A 3P9KA 4LLGF 2DO7A 5TPWA 3N53A 1USGA 1TM2A 1ZARA 3LFTA 1VPWA 2P6TA 2XKOA 4KV7A 2D1HA 3DGFC 3EAFA 1XMAA 1Z1DA 1J59A 3J80Z 1J75A 3IP9A 2XAHA 3V4GA 2WY2D 3OMWA 4Y13A 3HUGA 3VFZA 4RU1A 2QW1A 1DC7A 3RKWA 2H94A 3ILYA 4XRFA 3U2RA 3GZ5A 3EJWA 4O1HA 2L54A 1FQWA 2XAQA 4HX7A 3TD9A 2E4XA 3F6OA 2P9HA 3TO9A 1ZGAA 3LA3A 1FC3A 2M5WA 4D0PA 1R5HA 2ID7A 2EFOA 1O3RA 2QBYA 4YFKF 4RXTA 1CGPA 1JHZA 4HOBA 1JDPA 1SD5A 2ELHA 4B09A 3LUKA 3B2NA 3JTHA 2XIGA 2IPMA 4YLEA 3M8FA 3BRSA 4KVFA 2FEWB 3HM9A 1NATA 1ISRA 2E1CA 5DDGA 4QICA 5LGUA 3IPCA 2J5OA 2A9QA 4AWXB 3IDOA 4L9VA 1B00A 2PLNA 3DEUA 3ML6A 4MEXF 2HGCA 4XLPF 1T6SA 2JSCA 4EM1A 2GIVA 3OMXA 2GBPA 3JPWA 2NRAC 2PBIA 3HHHA 3KP3A 3QEMA 3PFIA 4CYDA 1YW7A 4JB0A 1NHAA 1QQAA 3SZTA 3HHGA 4N03A 3C3KA 2L4MA 5FBHA 4FE4A 4S04A 4KMFA 3HO1A 1IAWA 5J8CA 5LRSA 3A0UA 1T39A 3EYYA 3FMQA 2MYPA 4A5NA 4HA8A 3GRCA 4W5QA 2VYCA 2EV5A 3LTEA 2R7DA 1YS7A 3CHYA 3F8NA 4QLCU 5BS6A 2BEOA 2FRHA 2ZWMA 3FFWA 3HV2A 3FMVA 3GBVA 4ZYLA 2Z3YA 2Z9OA 1FWZA 5H20A 5DCLA 4H3KB 2O6GE 4KN4X 1T2KA 2NAZA 1W4MA 2RKHA 1XSXA 2UXNA 3K4HA 3NHZA 3C18A 3K69A 2JVKA 4ML3A 2VBXA 4FB4A 3KKEA 2OQGA 5HDKA 1PNTA 2OENG 4NCAA 4P1ZA 2IA2A 1LQ1A 3GLXA 1Z6RA 4CBVA 2E4VA 5BR1A 4GYIA 1F4KA 2VK2A 4NQWA 2DAOA 1VRVA 2PMCA 1LVAA 4L4UA 2WC2A 2ZFWA 4RS8A 1F9NA 4LDAA 3G3ZA 4O5AA 2HYGD 2ZNYA 3IP7A 2KJCA 3H5IA 3DKWA 1QO0D 1UFMA 3O2PE 5DUIA 3FFTA 4D74A 4Q6BA 3Q7TA 5BQTA 2FTKE 1FFWA 2XASA 2FLWA 1VLZA 1MKMA 1XHFA 1PUEE 3OO1A 2OZUA 3BOQA 3G73A 3GYBA 3KLOA 1YVUA 4KYWA 3MMNA 1OKRA 3KLNA 3BPVA 5DUKA 4EJUA 3QX8A 4EJTA 4UVCA 3T8TA 4I02A 3IC7A 2VOPA 4OIRF 2E4YA 2FQXA 1Z05A 1XWWA 3GVAA 1NXTA 4OLBA 4PEVA 2HQOA 3HZHA 1FT9A 4BQAA 4O1IA 4Y9TA 1GCGA 3RQIA 3B73A 5ICFA 3GUDA 4IXAA 5BRAA 3ISPA 4UVAA 4S05A 1BBYA 3G85A 2RGVA 1U2WA 3ILHA 1FSPA 1LEBA 3QPTA 1Z91A 5LLQA 2OBPA 2WJAA 5KQGA 1GUBA 3WU1B 1HBXG 5JNWA 3N97A 3M8EA 4JP1A 4W5TA 2FNPA 5AIPA 4D6YA 3F72A 1FSHA 1R1UA 2PL9A 1LJUA 3RVQA 2VBYA 5EWLB 4OIPF 2BBYA 2TMYA 2Y0MA 2I6FA 4OG2A 5KQLA 3QP6A 2HZTA 2QYOA 2X7XA 4M6XA 1VKRA 3OLZA 3BY6A 4CHUA 3FXUA 3LUJA 4LK0F 2QQBA 3DGEC 1DCMA 3IKVA 3M9WA 4N41A 1FFGA 3TMYA 1E6LA 3SAJA 1QQIA 1R5GA 5LHHA 4UVBA 5KK1A 3LUGA 1ZVVA 5C5CA 2EFNA 2HTSA 1R7JA 3TKYA 3CRNA 1ZLJA 1ZH4A 2XRNA 2OAZA 4HNSA 3ROTA 1ZHHA 1EAYA 4KQCA 2PMUA 2A9OA 3GEZA 4CGZA 2MYNA 1IXCA 5AONA 5L3GA 3BDDA 2R47A 5CVUA 4WX9A 4MLCA 1QO0A 2XAJA 2B4AA 2LNBA 5LEKA 3F73A 3E5XA 4KIFA 3D8UA 4RY8A 4U7DA 1D3YA 4L0YB 3ROFA 4ZZDA 5JNSA 4KUMA 2NZVG 3HVRA 4YIIA 1ZHFA 2DQLA 5K5OA 4KN7X 5TRDA 1OXKB 3OLWA 2E7XA 2CW0F 2UWMA 2AYXA 3O2JA 4ZJPA 8ABPA 4RAZA 3CG0A 3EQ2A 3F8BA 1URPA 3HRUA 1P6QA 1BA2A 2IPQX 1ZH5A 2YPRA 2FEZA 1YQAA 4Z4HA 4DQDA 1DPRA 4HDVA 2ZCWA 4CICA 4I0BA 3GT7A 1KQ8A 1MIHA 4EYQA 2JTVA 5EEGA 1DUXC 2EJRA 2FKAA 1ZRCA 1TMYA 1BC7C 1XCVA 4PYRA 2JRTA 5IEBA 3T6KA 1HQCA 1EWKA 5EWMB 5CVVA 1O3SA 4HF0A 1P4AA 3JPYA 2M1BA 4RS3A 1SFUA 1Z12A 4YP9A 3NHMA 3CO6C 1JWLA 4MQEA 1W5TA 4UHKA 2X4HA 3BPXA 5JNTA 3LQRA 1BI2A 3RPUA 4IRGA 4A6EA 1YO5C 9ABPA 1ABFA 4RXUA 3EYIA 2LP4Y 2GX6A 2WMYA 1XB4A 3FF5A 1I6XA 3K0LA 4YO7A 1WKMA 2VT3A 4ENJA 2D1VA 2IA0A 1SFEA 6PAXA 2HQRA 1MAVA 2XAFA 4HDUA 1Z9CA 3LUAA 4MR8B 3N6VA 3V7CA 4BHBA 2FXIA 3GFIA 5DCMA 2P7VB 3LKVA 1JGSA 2H3HA 1HW2A 4L9TA 3CS3A 2QQ9A 1LDJA 2K4JA 3I4PA 5FWYB 2MSKA 2NUBA 1YW9A 5FD5A 3GWGA 3RVMA 1UDRA 4JA2A 4YFNF 3F7NA 2XDYA 4HF2A 3DZDA 5KQMA 1BIBA 5EWLA 2O8XA 2HDCA 2PJUA 3COAC 2QLZA 2RC4A 1SMTA 3JW4A 5DD4A 2O20A 4R1HA 3I71A 4OBBA 5IULC 5FBKA 2COMA 4N47A 3QLVC 4IJAA 2RDPA 2G7UA 5JVTA 2IPAB 1B59A 1NXWA 1YW8A 5FD6A 5H6RA 4Q6WA 4AIHA 5DTEA 3HSYA 1USIA 3M7GA 1Y1LA 5KVRA 4N9HA 2EA4A 4A0ZA 2PUCA 2HYFA 5K5QA 3O2SB 3T1BA 1ONVA 2DRIA 2MH9A 3DLBA 1QQBA 1FBQA 2HQNA 1ZREA 5T7BA 1KRXA 2Y48A 3QP5A 3IP5A 1AOYA 2YHBA 2A69F 4U0WA 1SD4A 4U0VA 1JYFA 4O3MA 3MAJA 1TLFA 3E6DA 3NNDA 3KEQA 4M9XA 4GO1A 2NNNA 2E4UA 3QEMB 1I27A 4ZYGA 3EULA 3ECOA 3W9SA 2CHEA 4Z4CA 1ZRDA 3NEUA 1UCRA 4N0QA 3TOAA 3H1GA 5CYVA 3A0RB 1LJ9A 1WSUA 1J9IA 2GKGA 3KP6A 1RZRA 4HBLA 2KIUA 4LRQA 1ZGZA 2GXGA 1FPQA 3C97A 1IXSB 3DF8A 3MYYA 4Z9BA 1LB2A 3Q5FA 1QPZA 2QZ8A 2EV6A 2K7LA 3E97A 3OLXA 2WTEA 1RUNA 1TQIA 3TGNA 4E7PA 4ETIA 1V3FA 2E7WA 1PUXA 1S7OA 4HZFA 1TQMA 2R25B 2J48A 4ETMA 1FBSA 3H3UA 4QPJC 1JHFA 3ZMUA 5DD8A 2D45A 2K02A 4QYWA 2CGPA 1RIOH 5EWJA 3MFKA 4RV5A 3I53A 1ZITA 4BH9A 3O2QB 5D2CA 1P4WA 2FXAA 3FM5A 4G0OA 3WTWC 1U6GA 2FQWA 3WTUC 4GYGA 2Z33A 1QBJA 1MB0A 4RK6A 2Z5UA 3W6JB 4BYYA 4RY9A 1BDHA 3I09A 4A12A 3P9IA 4WXDA 5LRRA 5E17F 1FLIA 5D4SA 3RI4A 1Y0UA 5FWYA 1YFHA 1FOKA 4F7ZA 2FF4A 1DCFA 2MLKA 3L7WA 4KIBA 5TQ2A 5HVQC 2VBZA 3KYIB 2VC0A 1FP1D 3WODF 1BDIA 1ON2A 2PEXA 5JI6A 4Y17A 3I42A 2Y75A 2JRLA 1BC8C 1F4VA 2QUFA 3Q41A 2NZUG 1LBIA 4TMYA 1QZYA 1E2BA 4WCGA 3W6KB 2W84A 2F5CA 1PP7U 5LGNA 3FHZA 5HOOA 2FMYA 1XGOA 3MA0A 5F6FA 2O0YA 4Z2YA 1QGPA 4Y15A 1OYIA 4TN5A 4JBAA 2IVMA 3JS5A 2VE8A 4PGGA 4G9YA 2VT2A 1WRJA 4DQ2A 3BBLA 4ZH4F 2NT3A 1TLHB 4YCSA 3SM9A 5FGMA 1G3WA 3WGHA 2CQKA 4U0YA 4EGYA 4KNYA 3I64A 1RXEA 1IN8A 2YHAA 3H1EA 1TW2A 3SZPA 1Q1HA 4WXEA 1S7AA 2B1JA 1WQ2A 4AD9A 2RJOA 5TQJA 2GZWA 3F23A 1ZG1A 4LE0A 2FU4A 4RK4A 2DI3A 3KYJB 4ESJA 4AIKA 3GFMA 3GXOA 5F1RA 3NNNA 2PKXA 3GF2A 1SD7A 3DQVC 1H0MA 4OATA 3E3VA 4MS4B 1DP4A 4LGWA 1IRGA 2K86A 2PN6A 2YR2A 2ID9A 3CKMA 3QAHA 4JB2A 3Q9SA 3UKJA 2P5KA 1R8JA 2FOKA 4LG0A 1JX6A 5K5RA 4P5OA 5BQ3A 1HKTA 1GXPA 2IW5A 1D5VA 4EYKA 3DP7A 5ILVA 4TLLB 2DK5A 3KG2A 4NV3A 1O57A 1OMIA 4M71A 3IL2A 4HNQA 4EJVA 2FN9A 4MQFA 5HS7A 1HKQA 2D2WA 5BPDA 1QP7A 3KP7A 4LMYA 2VONA 5D6EA 1JBEA 5E8IA 1TTYA 2QU7A 3DFGA 4KK3A 2A3SA 1L0OC 3QEKA 3S2WA 2NT4A 4NICA 1DCKA 4XFKA 4I98B 1BI0A 3WE2A 2L17A 4UHJA 1YMUA 2KIMA 3LUCA 2PAFA 1MZBA 2VXZA 1ZLKA 1SRRA 4IRIA 2XROA 4XARA 3ZMDA 4FE7A 2ZMEA 3DBIA 5GOTA 1ON1A 1IN7A 2V1UA 1D5WA 1L5YA 1QZZA 1JE8A 3FGZA 2V9VA 1G3SA 1XMKA 1RXIA 1D4ZA 4EMSA 3F6PA 1SXGA 5ED4A 2L18A 5H6QA 1ZGGA 4OINF 3GA5A 6CHYA 3QPHA 2EWNA 4FHTA 2JVIA 4ZYEA 4Z0NA 3KZYA 2FW0A 4XLTA 4ZMRA 4DN6A 5DV5A 1A0OA 4KPYA 2JPCA 1HSJA 1HXDA 3MQ4A 2P8TA 1H9TA 4QYMA 4CXFA 1J0RA 3HDGA 1SXHA 4MR7B 1D1PA 4EQQA 2EFWA 1NTRA 4WF2A 1PP8F 3K9CA 1B4AA 3LUHA 3O21A 3RVSA 2MLGA 2W57A 2UZKA 4ZMSA 3N0RA 2A9PA 1Z25A 5JFRA 4HLYA 2QQAA 4Q4ZF 3TDUC 2KYRA 3M9AA 5K1YA 2IYNA 4IILA 1R58A 2PFBA 3D0SA 4YWHA 4HX8A 4HF1A 2ADUA 4R79A 1DJMA 2IPLA 3FZVA 3VB2A 5JHUA 4W5OA 3H5OA 2VOOA 4MQEB 2LUOA 2CYYA 3F8CA 2EFPA 1B1BA 3HOTA 1PHRA 3RDIA 1FFSA 1MJBA 3JVDA 1E17A 5D5XB 1H9CA 1FYMA 1BIAA 1QPMA 3QLTA 3QLUA 1KQ0A 2F8SA 3T8YA 4B8XA 2M87A 5IT9K 1HSTA 3DV8A 1AWCA 2CWDA 1BI1A 5CNKA 5BMZA 3K1MA 5DCMB 4QWQA 4W5NA 1UHMA 3FFXA 5FFZA 2E4ZA 3WGIA 2FMLA 4TV7A 3IHUA 4G0QA 1KU2A 4EGSA 4MS4A 1A04A 5I4CA 1KMIY 1FY7A 3KP4A 4LB6B 2FVYA 5HM6A 1ZRFA 3TX6A 3RKYA 3MWMA 4I09A 5JS2A 3MEXA 5D5UB 3GFJA 2L19A 1Z6TA 3O6BB 4G86A 5HSGA 5C5EA 4PZ0A 5KWSA 2A61A 4A6DA 3CG4A 3WTYC 5IEJA 2F5FA 2VN2A 2ZBKA 3FXRA 4RSMA 2JZYA 3T8RA 4RK1A 4L0ZB 2P5LC 2IPNA 1B9NA 4Z4IA 2HKOA 4L9JA 2BGGA 2EFQA 2PG4A 3URMA 2K27A 2VUIB 4WZZA 3L2CA 3M9XA 1E2XA 1NY5A 4MTDA 3REOA 4F3TA 4WXHA 3RVJA 4XLNF 2RV8A 4CO8A 3EETA 3A3KA 3IPAA 3NBMA 4AIJA 1GCAA 2GI4A 5IUKC 3UUGA 3H3ZA 2DW4A 2FBKA 1SXIA 1MJAA 1U8TA 4L9NA 1APBA 3WTSC 2PJPA 4LLNA 4M73A 3MF4A 4LDZA 4KDPA 1EHCA 5FLXZ 3I58A 5CVRA 1EWTA 3E6BA 1DBWA 2AXLA 2PUFA 3I5UA 3BWGA 5ABPA 4L5IA 2OQRA 1LEAA 3BP8A 5D8KB 2MA3A 4RK0A 5LBQA 4Z4EA 2HEOA 3QLUC 2RN7A 5D4RA 3SG0A 2G9WA 4EV0A 3MZHA 1J7KA 3JY6A 4NQRA 3U9GA 3HUTA 5LHIA 3DLHA 5DEQA 3F3XA 1YS6A 3QLVA 2OD5A 4MR7A 2LF8A 2GA1A 5D5WB 3LUDA 5PNTA 1O7LA 2WRZA 5FO5A 2KKOA 3JSPA 3DPLC 4G7HF 4RDCA 1Z7UA 3E3MA 5DCFA 4G0MA 1ZESA 2VC1A 1P8AA 4MS1B 4MGRA 1U8RA 4G6QA 1TQPA 2HJ9A 3A10A 3GYHX 3CUQC 4EVRA 2JK1A 2QVOA 3HIFA 2LPMA 4G0XA 4Q47A 1YK0A 4YRZA 2FSWA 1J56A 2CHFA 4KA4A 4I2OA 4RKRA 4RAYA 1K79A 1JLKA 4EYGA 4XASA 1KQ9A 2STWA 4EUKA 3HK2A 1BI3A 3BROA 1BN5A 4OIQF 3MIZA 2P6SA 3TO6A 4RB3C 1LJLA 2RNJA 1P92A 2ETHA 1F51E 2JBAA 3LMKA 3BRQA 4HW0A 5HDGA 1ZYRF 5EWJB 3T38A 4GXOA 3HRMA 4JAVC 5GQSA 1AB6A 1G3TA 2DK8A 3CJNA 4CDGA 1JYEA 1QP0A 2F2EA 2P7CB 2X0LA 1TNTA 1O3QA 3K1NA 5FLXK 1QKKA 4H0EA 4RGUA 1IXRC 2EK5A 3RVLA 4R8HA 1MB3A 2PUAA 5ERIA 4PDKA 2FQ3A 2OZ6A 4MNUA 5TQ2B 4RGSA 5CLSA 1G3YA 3C3MA 2XVCA 1MDMA 1DRKA 4OLAA 2BE5F 4MS3A 3N75A 2DLLA 1L3LA 3OM0A 4EJOA 1XGMA 2XGXA 3HCWA 2FEPA 4NCBA 2ESNA 5ILSA 3QELA 4Z4GA 1OPCA 2R48A 1NXVA 2QXYA 1E6KA 3GW2A 2FN8A 4ESFA 2IRFG 3QU6A 3F21A 1R23A 5E8GA 3SQNA 5KC8A 1XDSA 3H75A 1S6LA 3N8IA 3RVKA 3OOPA 5J8FA 3Q15C 3BZ6A 2QZJA 3FMSA 3KP2A 5JR3A 1YLFA 1Z2DA 1SFXA 2CSOA 3HSRA 1DZ3A 2ZAYA 4EVIA 1C0WA 5KC9A 1S8NA 2GXBA 3BJAA 4ZZLA 2DPUA 3RVRA 2WWVD 4ETSA 1RUOA 1VTNC 2E4WA 2FEKA 1EH7A 4HQEA 1NXOA 1LK0A 2H0AA 1D8JA 1STZA 3ROUA 5ICEA 3GX4X 1BVHA 1KU9A 4ENMA 2DFIA 1O3TA 5ICGA 4MGEA 2A07F 3O75A 1I1GA 4DADA 2PUEA 4HYEA 3BILA 3RYPA 4LG0B 3FM3A 4EYOA 2RDMA 4RGXA 1XGSA 1KU7A 3GL9A 2V1XA 2HPHA 3QX9A 4P55A 3TB6A 4HAMA 4N0PA 4MRMB 4MQFB 2IT0A 2EB7A 3CUOA 2PMHA 1USTA 5ICCA 2H09A 2IOYA 3KCNA 1C4WA 1CF7B 3V7SA 4YFXF 1QP4A 1SMYF 4MS1A 4Z9AA 2F5DA 4P96A 1WETA 3F22A 1H9GA 1NXXA 3GFLA 2FMKA 1RZ4A 4A0YA 1SD6A 4U88A 1YIOA 4OMZA 1FNNA 4BXUA 1G4DA 3JAMK 3N0WA 2R4QA 4E70A 1IN4A 2ZMEB 3M1EA 4OTZA 2WV0A 2UXXA 1FYLA 3KTOA 3H5VA 4YGXB 2Q0OA 4MR9B 5KI6A 4EVSA 1F5TA 1K66A 4LE2A 2PI0A 2W24A 5JNVA 1YK1A 1WWXA 3VODA 3CLKA 1K68A 2H6BA 4RY0A 4KZKA 2LDUA 4LZLA 1XDUA 1PEAA 1ZG3A 3TOBA 4WWCA 4EJWA 3BJOA 2DU9A 4N9IA 3WTZA 2BGCA 4WXMA 5HQJA 3KFWX 1IRFA 2FBIA 4KT5C 1BAPA 4JASB 1GVJA 2MC3A 4G94A 1XD7A 3RKXA 4RB1A 2M8EA 2KIFA 3E5QA 4PZJA 2KRFA 4I01A 4LD5A 4YG2F 1I1SA 5BRJA 3KJXA 4MQVA 4LX8A 1JFTA 3OO0A 2ESHA 4KMUX 4I7HA 5HLGA 1KYZA 1PDNC 5B3JA 4IHTA 3H5TA 4ON0A 1HW5A 2IJLA 5T3YA 4YIFA 3CTPA 4IF4A 3CFYA 4G7ZF 4MEYF 4ESBA 3GZ6A 2Q8KA 4OMYA 2DTRA 3WGGA 3I54A 3TQNA 2FNAA 3JTGA 3OLVA 1ZAOA 1XHEA 3JVIA 4RZSA 4L18B 3E6CC 1XGNA 2HWVA 3WE3A 3HXMA 3FXQA 2ZO4A 4H60A 3HTSB 2O61A 1FYKA 3VEPA 3RVPA 4HQMA 4ASNA 1Z15A 3KHTA 4G8XA 4Q7EA 2MSLA 4P9UA 2MSWA 4YV7A 2HR3A 1U78A 1T38A 5TQ0A 2ZKZA 2YSRA 3V8KA 2MBFA 2JVJA 3E6MA 3HJFA 4ENNA 1W7PD 3J81K 2JCGA 3H1FA 2PUGA 5BOXA 1IN5A 1IUYA 3L6UA 3OM1A 3RH0A 2XAGA 1JHHA 2ISYA 6ABPA 5HS9A 3F6VA 3R6SA 2EA2A 4MQ9F 4ZYHA 3OQOA 1D8KA 5FWXA 2DQRA 4KQ9A 1JH9A 4IMJB 5JNRA 4D6XA 3ZN1A 1OXBB 3Q9VA 2FLKA 4KRFA 2R7FA 2PE5A 5CVIA 1A2OA 4G6DA 4P98A 4BHCA 1P6UA 2R3SA 1ZH2A 3CUQB 3C1DA 2KJBA 4YR7A 2CD7A 3WU0A 1USKA 4E7OA 3IRRA 2ACJA 1HKSA 1TVMA 4MRMA 2FQYA 4M74A 1BJAA 4K2EA 1YYVA 4RGRA 4IPAA 1ULYA 2M98A 1YTUA 2V1DA 1FP2A 4Q5SF 1JL3A 5B3JC 1M2EA 5LHGA 1CF7A 3FMRA 4PE5B 3V8LA 4XXHA 3C7JA 1XSVA 2QWWA 3AAFA 1B9MA 2XV4S 3D02A 3F6CA 1JDNA 4LJZF 3ZMTA 1ZDMA 4BNCA 5ILUA 2QM3A 2B0LA 1EH6A 4M72A 5L3EA 5E20A 1R1TA 3SXYA 5DGCA 4O6JA 4A2UA 3FWEA 1EFAA 2WJWA 4MR9A 4RXMA 3ABTA 3BJ6A 5IT9Z 3J80K 4KMRA 3ABUA 4EVQA 5D8LB 3SY8A 3K1PA 4IMIB 2FMIA 3ECHA 1IIBA 3CZCA 3DXJF 4NB5A 2LSOA 3RIRA 3LSTA 1K78B 1DRJA 4PGHA 1JFVA 1LNWA 5TJJA 2N9UA 4L85A 3O1HB 2QENA 3KETA 2PL1A 3R0AA 4P9FA 3QU3A 2YU3A 3I59B 1UHWA 4HLXA 2W85A 3HSFA 4M6YA 1QMPA 5E1WA 2VODA 3QOPA 1W25A 4WT7A 1IW7F 5FFXA 2Q5CA 4RB0A 4DNCA 1W7PA 4ZYDA 4Z4FA 1U5TA 4Z99A 4HV6A 3EDCA 1Z18A 4MAAA 4YS6A 4LK1F 1GHCA 5IBQA 2A9RA 5TPZD 3RVOA 1USSA 4U7BA 3P9YA 2AS5F 4KIGA 2JBAB 2G7HA 4ETNA 1GXQA 4G0ZA 7ABPA 1I5ZA 2GAUA 3HOSA 3F8FA 3O1IC 1U04A 3HUUA 4PCQA 5FB2A 4ZPJA 2ISZA 2YX4A 2A5YB 3I0TA 1T0FA 1DPUA 1BM9A 2GWRA 3R0JA 3H5LA 3BREA 1KYWA 3R4KA 1RPJA 4GCVA 1KRWA 3T5XA 3P9CA 5IT3A 5BPIA 1ZAYA 5HKOA 4A5MA 3JTEA 1MDMB 1P6RA 1Z16A 4M9ZA 4BAYA 1YG2A 2IDMA 4MS3B 5IUNC 2IP2A 3Q7RA 3CDHA 2RGYA 1QNTA 3CUQA 5E1ZB 2W25A 2OA4A 2RVCA 3H6GA 3O1JC 1Z2EA 3VNBA 4RK7A 3QELB 4XSZF 4RKQA 4I0AA 2HSGA 2BYVE 2RQPA 3HYIA 3LAJA 1LDDA 3O3KA 1XCBA 3TO7A 3PQKA 4GGGA 1I3CA 3S99A 2XKPA 1D1QA 5AIQA 5L3BA 3V7RA 2PLYA 3RJPA 1E6MA 5DKFA 2PUDA 4KREA 4IRXA 3T95A 3KS9A 4XBFA 1DC8A 1R00A 3LA7A 3UK0A 1LBHA 2FMHA 4G0YA 2M45A 5CNJA 3L00A 1U5TC 4IGAA 3LWFA 2CO5A 3I45A 4H3HB 1EH8A 1HEYA 2XUBA 2QR3A 1OYYA 1YTYA 1FZPB 2F8TA 4OIOF 3T0YA 4MYRA 1U0SY 1TW3A 1IZ1A 4UV9A 4EGZA 3CU5A 2CWEA 4IRHA 1K78A 2AYZA 1FSEA 3LA2A 1T34A 1XN7A 4XAQA 1TBXA 2VUHB 4IVNA 3QRFF 1U2QA 4KICA 1IF1A 4JK1X 4UXNA 1BDJA 1S3JA 3SHFA 3EGCA 5TPZA 4W5RA 1DDNA 5HLIA 4GNRA 2ZXJA 5JS1A 3DPTA 3I59A 5CNIA 1KA8A 3NQOA 3ERED 4LE1A 2HFHA 4IHSA 1ABEA 3GO5A 1U2PA 3FX3A 4HV5A 1M2FA 2E1NA 3D5LA 1R36A 5DYMA 2J5PA 1OR7A 4OU0A 1G6NA 3KEOA 2IA1A 3NNSA 4N76A 3FDFA 2L4AA 1JFSA 2H6CA 3H5WA 3O74A 2QSJA 2HKXA 1Z17A 4NHJA 2WB4A 5IX8A 2V79A 3HS3A 2L3DA 2RJNA 2EV0A 1LDKB 2VE9A 1TJYA 3RVNA 1MJ9A 3QK7A 4N0BA 1U3EM 3HTUA 3B02A 3C3WA 3TDZC 3LKBA 4JQFA 2VBWA 1ZG5A 1BOAA 2A6HF 3MQ0A 3I5AA 5CJ9A 3GWZA 2F5EA 2DBBA 4RK5A 2L02A 3LQQA 3IWZA 5KQPA 1L5ZA 4FX0A 3Q7SA 1NXSA 4EM0B 2STTA 3F8MA 3IWFA 3HRTA 1DG9A 4LFUA 2QVGA 4KK4A 1RZRD 4UNOA 1O7FA 5L3DA 3ZMZA 3CZ5A 3R60A 5D6FA 4HX4A 5E1XA 1ZN2A
chains in the Genus database with same CATH superfamily
4JJ8A 4XKJA 5F0FA 4F2HA 3RTRA 1RNLA 3C5HA 4G0PA 3WGTA 1PQUA 2OG2A 2IUUA 2DC1A 5HBRA 3KZZA 2PNJA 2MR6A 3FZGA 5HLHA 3BFKA 3NHSA 3FWPA 1K7AA 4XRSG 1GPWB 5BQ5A 4PGAA 1H3EA 2FUNB 4LFBB 1GTVA 1ISPA 2MD5A 1GGFA 4QDOA 1YJAA 4LBZA 3R8FA 1GUDA 5FJJA 1QGAA 2B8EA 2FZCA 1H5UA 4PG4A 3D7RA 2NZJA 5DM7F 5EZYA 4DPLA 5J40A 1KFCB 4RSHA 5DTMA 2VA8A 4B31A 3O8QA 4YAIA 4LGYA 5DTIA 1UC9A 1AK2A 1XMOB 4HRAA 2H7YA 4N54A 1EWVA 2PUVA 4ZAWA 2XUAA 3K9TA 1A50B 2YWGA 3FVWA 1O89A 1E9RA 3AERA 2O2HA 1TWAJ 4NCXA 4H59A 3C3CA 1L1EA 1T8PA 1PT7A 5J47A 3K9BA 5JECA 5TS2A 3V32A 4DUGD 4QPOA 1Z26A 3CLQA 5C4MA 4UEQA 2NU6B 4AJOA 2MYUA 1KSGA 3KQNA 3F5QA 3WE7A 3V1TC 1DO2A 4DJTA 5A5VA 2W71A 3EZYA 3TM4A 3C6QA 5FAKA 2FA5A 3AQIA 2C4NA 3HYSA 3R0ZA 3MTEA 4TRRA 1PJLA 4WXCA 5K6TA 3RYRA 4G3XA 2W42A 2CCGA 4RELA 2H1CA 2ZP1A 5KMGA 2RNGA 1WR8A 1X3UA 1RQPA 1GPMA 2XUFA 4AY3A 2NNYA 1DB3A 2YJ3A 4ZDIA 1KU3A 3V8RA 3COSA 3V3KA 3HMQA 4DR2B 1ZUHA 3VSBA 3SLRA 1V6CA 4BNLA 3QMPA 2G1KA 1SUEA 3DE3X 1QQ6A 2Q3CA 2ELJA 1COZA 1W96A 5T6MA 4D9NA 4CL0A 3CC4I 1I24A 1XZAA 4JI2B 4XE5A 3HPGA 4G97A 2LKPA 2NYXA 4G4SO 3ETDA 2AD1A 3N74A 3AHDA 1TM2A 4UDOA 4DMCA 1UF9A 3GTQJ 4MQ5A 4KSYA 1G5FA 2P6NA 3EXAA 1T2CA 3IODA 1RZUA 1J59A 4YA6A 1G8FA 4OMUA 3AR6A 4BC0A 1N2CB 3NVDA 5LZ8A 3D8BA 2XAQA 3IILA 5CXSA 4QC2A 1SZPA 2GD6A 2XWSA 1JPVA 3PGKA 2QTCA 2Q8QA 3D4IA 2GXQA 4J0EA 2X7HA 4FILA 2V6GA 4C0LA 3AF6A 4HUTA 2IYTA 4JBHA 1G3IA 1R16A 4CMAA 2PKWA 1D2EA 3VU1A 3UT6A 3W3ZB 1MIOB 1QJCA 4EM1A 1I51A 2W82A 2HLHA 3OMXA 1DPFA 2WB1A 5DI9A 4XYBA 1VJTA 1SA0B 4JLMA 3SHWA 3VU9B 2FUG2 1LKXA 1NZFA 1SOWA 4YQYA 2HH9A 1TL8A 2X58A 4O4HA 2OHIA 5FOQA 2Z9OA 4U2FA 2H5JA 1JYSA 5H20A 2O6GE 2W0SA 1S0UA 3WK7A 1NMXA 2XDQA 1FFHA 2XDAA 2C78A 5E3HA 4U9HS 4E31A 2H07A 4ML3A 5KKAA 1PV2A 3O8DA 1KYIA 4KSBA 4DLBA 4R7GA 3PDHA 4D74A 1EVJA 5SYAA 1UAAA 2W43A 4I3HA 1ERDA 1U3TA 3ZVKA 3GYBA 3IAS1 2O2XA 4ZZ0A 4HAZA 1PYVA 3KLNA 2C5EA 3D3JA 3UUWA 1OZHA 2WSSA 2CBXA 3R6LA 4LXYA 3JQFC 1GCGA 3O9VA 3WS7A 2OVFA 3GUDA 4S05A 3EXFA 3ONNA 2QKMB 5BMVB 1NN0A 1M1NB 4ZVSA 4HQKA 1KU6A 1ZOPA 4B8WA 1HEIA 4CEIB 2HPIA 2PL9A 4BZQA 3D5SC 3QKRB 2Y0MA 1RE0A 5EZYF 1IY2A 4Y52J 1CUSA 6REQA 3LUJA 5LQAA 4JT2A 2GERA 1IJBA 1NOIA 3U7JA 1R5GA 1J49A 3WHBA 2ZULA 3IJ5A 1EJ0A 3ANNA 3ICEA 5HQ3B 2WMNB 3R7SA 2PMUA 3D2LA 4CGZA 3MWEA 3TX2A 1AT1A 1C8BA 4FDVA 3V9AA 3OYKA 2NVBA 4LCEA 1M2KA 2C0PA 3KYCB 1A3CA 3HPQA 8ABPA 1SQSA 1XZNA 5ESWA 3EQ2A 3W5VA 5AVYA 1V6SA 4DWOA 2BR3A 4FW9A 5CA0F 1M0TA 2BW0A 5JXIA 3CXRA 4MIEA 3O83A 2O57A 3DBLA 4WEOA 3DNMA 4OX9B 1C9DB 2EP5A 1YD7A 2B9EA 4UREA 1SFUA 1YBAA 1M83A 2CNKA 2ZRIA 2IU3A 4GLLA 2WMYA 1POXA 1C30B 1NQXA 5JY6A 1SFEA 3LY9A 2ZB2A 3M4NA 1Z5OA 3HFSA 2HQRA 3SWWA 3RANA 3N6VA 1J39A 3GFIA 4P0QB 3DTTA 3QX7A 4PNHA 1SAUA 4YRBA 4KXVA 4J3NA 2FSHA 4HMPA 4D8VA 3L6OO 3LL4A 1L5FA 5KQMA 2JJMA 3KUXA 2HDCA 1NVXQ 2VH1A 3COAC 3FCSB 2EIJH 4Q4JA 3FRIA 4HRVA 3HBNA 3ZLTA 1QB8A 1SKYE 3EVDA 1OIWA 4KMOA 1WABA 4RS4A 4N47A 1LK7A 1YR3A 5AVUA 3ST7A 1KSHA 4PUSA 2Q2NA 5JCXA 3CH4B 4FNGA 2NXWA 1QVWA 1NXWA 2EX1A 2PSDA 4ECEA 1AV6A 3M3PA 1IMJA 3IXMA 4CDNA 4D82A 3T1BA 1Z2AA 3B6ZA 3DLBA 1GU1A 4LPSA 2ZVPX 5D3MB 2C2KA 2ILTA 1MNEA 1G8HA 3EDMA 3VYUB 1WUHS 2XDVA 2WJHA 2PVCA 5A3QA 1R6TA 3OUTA 4JLSA 3WQSB 2DPMA 2WFMA 2ZUWA 1YC2A 4A6PA 3VSEA 4O4HF 4PRZA 2CVHA 1I6HJ 1LUAA 3HYTA 4HQRA 2A4KA 1HYHA 2EV6A 3U13A 1RI5A 1HR0B 2W8BA 2AWOA 1JECA 4BBPA 3DXFA 1N3IA 1X7ZB 1TQMA 1P2VA 4ZAXA 3ZMUA 5G4KB 4CV1A 4M8LA 3QG5A 3N8NA 3AFHA 1QIMA 5E1DA 5AM5A 1KDRA 3FM5A 3O3CA 5IJAA 1ZOSA 1VGVA 4FHZA 5LFAA 1HZJA 4LV8B 2FPXA 3V6LA 2IE8A 2WTXA 4BTEA 1C8VB 5GAJA 3RI4A 3U3JA 4A9AA 2HLDA 4EHBA 2FG5A 3THXA 1UBEA 2R79A 4AULA 2J46A 2EBFX 3HYCA 1PVDA 1K1EA 3IJRA 3KQYA 3WA7A 5BR8B 4C06A 1M7GA 4ODIA 3I9LA 3HH8A 1A69A 3UTCA 3KEYA 6ADHA 2O8EB 1ZGHA 3CGGA 2Y1OA 3DPIA 3GUZA 4U0YA 3I64A 1H2WA 1TW2A 2WU4A 4L8YA 4L08A 2RHWA 3GXOA 4Q3KA 3GF2A 1AURA 1U0OC 4JB2A 5CT9A 1ZZEA 2CZCA 2P5KA 1XAGA 5G0TA 5BW4A 4XLFA 3NWOA 5EXEA 2IW5A 4CF4A 2W6OA 1AN9A 4NARA 1K61A 3KG2A 4LMPA 1T5DX 1KP3A 3T7RA 5EZSA 1YA6A 1HSOA 1L7VC 3IDQA 1YMUA 5TDHA 3HTXA 4H18A 4G0UA 1PVOA 1X1EA 3FKSA 4ZO4A 2I2DA 4C9YA 2PZJA 1OSNA 3DBIA 4ND2A 1D5WA 4H77A 5LR6A 2D2EA 2EW2A 4AP6A 4XQ0A 2GF0A 1T6ZA 1Z34A 1JLHA 4HWTA 1NMEA 1U2GA 3DHNA 4XJVA 3MVEA 3RYTC 4U8HA 4RTMA 3H0DA 3GA5A 4BZWA 4CM4A 1J07A 2JI9A 1ZCJA 5CRIA 1PGOA 1UFVA 1J5XA 3GLVA 1OBCA 2J45A 3DLPX 4CT4B 1SXHA 5CK5A 1JU4A 3TQCA 3KUDA 5IVDA 3KQUA 3AIKA 2W4SA 5E7JA 2CHVA 2OYRA 4W1SA 3FR8A 1PFUA 4X1KB 1YFKA 4C4XA 4NDLA 1QIGA 2Y30A 4BJHB 2X7JA 3ELBA 1WKBA 2A0XA 1I9GA 4J9UE 4NXNB 2L7KA 1T15A 1CY8A 3K5IA 2GPJA 3HOTA 1R12A 3JAKA 4QDJA 2PSSA 3CP8A 3DKKA 3PSHA 1H42A 4TKLA 4E5UA 3V9PA 1J9GA 4RW0A 1KQ0A 1M1UA 3GRZA 2O50A 1FUEA 4ZA2A 1ZD4A 2J31A 3GBGA 2ZRBA 2FR8C 1HWYA 2ADMA 3PQ7A 2YFYA 3NWTA 1J8VA 1AZSC 1WJFA 1SVKA 3IOCA 4LXGA 2R7NA 1S01A 1PTKA 5AQEA 4ZTUB 3L0SA 1TT0A 2BGTA 3EVGA 4EKDA 1Q77A 1CY4A 4BPRA 3H4IA 3P7MA 1XNQB 3VPBA 4NPHA 5DYWA 4Q4HB 2HTEA 2F5FA 1CZNA 1T4BA 1E9CA 1BGWA 1YO6A 2YWEA 3GAZA 5GVSA 1Z0IA 2C4UA 3NHFA 2PRYA 3MLEA 1MRSA 3L1JA 3THYA 1CEXA 2GBCA 2PJPA 5D6NA 1FU4A 1R18A 3NV7A 2AB0A 1L4MA 1Z88A 1M3SA 4AU1A 2BAGA 3E6BA 4N4OB 3BMCA 2CY0A 5DM0A 5D8KB 4Q5IA 3TDMA 4R9RA 3HCEA 3JY6A 4JX9A 3DLHA 4UEKA 2AVNA 1YS6A 2IQ5A 3PUVA 4I08A 2KKOA 4F52A 4C2MJ 4JJZA 4UVIA 2BELA 1M8KA 5EMMA 2Y27A 1VI5A 5BSMA 1ZIPA 2W2LA 4PK4A 4B3JA 4CRWB 3CJTA 4DLLA 1HQDA 1KVSA 4BCDA 1T5LA 2BGKA 1TZMA 2R96A 1QLHA 4F93B 4HO1X 3Q6NA 1TF7A 4JC0A 4QXAA 3LMKA 2DKFA 5HDGA 4JC5A 4N0DA 4F1WA 2GPYA 4JAVC 5GQSA 2EW1A 2CHGA 2BEVB 3RIMA 3F3SA 2DFVA 4YCLA 1G6Q1 5IYCJ 2VH5R 3ZNQA 1LBQA 1J70A 3WLTA 2EK5A 2R7TA 1MB3A 2FZLA 3AI1A 4XQGA 3RHSA 2UVPB 2QUJA 2FN7A 4KISA 2YV1A 1RJGA 3K72B 3B6CA 1YA8A 2B20A 1I94B 3V8MA 1J0AA 4OLAA 4J91A 1CY2A 2FEPA 2ZRPA 2H18A 5DFAA 2ESNA 1EGMB 4PX9A 1VM6A 2R48A 4ESFA 4V38A 3DKVA 1DTSA 1CRZA 1K5PA 1E4YA 2HSEA 5GV8A 5CDHA 2H1WA 4GKJB 3K10A 3O8RA 1BGXT 2ZJ0A 5EZGA 2LVBA 4HDKB 2O7OA 4G84A 1IRIA 1YQXA 1YZTA 4HZGA 4ZI7A 3SYTA 4YV1A 2DFIA 2EGGA 4K87A 1O3TA 3HN7A 1HH4A 1U28C 4EA7A 1YH3A 2D1TA 1FK8A 2JH9A 1K6JA 4BV9A 3L8FA 3JU3A 3LC0A 4N0PA 4F7WA 1FW8A 2IXDA 1LDYA 2PMHA 4B79A 3E9NA 2EDCA 4RH0A 4MWSA 2ZUUA 3ORRA 3JAMK 3WGKA 2PU5A 2JLVA 1E2MA 4GOJA 2XW6A 2OOSA 2OZLB 4I4TB 3TF5A 1DWPA 1KQFA 1HDZA 1GZ5A 4KZKA 1QANA 2KMLA 4KWCA 5HQJA 4K0KB 1KMMA 4IUCS 2VQDA 5F3DA 1I30A 1ZN9A 3B6MA 2KIFA 3KJXA 3MD9A 4MDFA 4HDAA 4DWVA 3L1PA 2I78A 3I37X 5B2FA 1W47A 2L2OA 1TT5B 1IV6A 1LUJB 1JDJA 2SKDA 3OZAA 3GZ6A 1DIHA 2OAEA 3I54A 3JTGA 4NZYA 4RZSA 2DLNA 1M8GA 3RWOA 3OBBA 1YQDA 2H4ZA 4DCUA 3HU3A 5CJPA 2QX9A 4DTIA 3STTA 3TMKA 1ODFA 4JXKA 4LNUB 1H6AA 1JI3A 3KHTA 4G8XA 2J5RA 4YMHA 4YRPA 2R4TA 4JUCA 5BYAA 4AYBN 2ID8A 4L2IB 3LRXA 1GARA 5BYKA 4ENNA 4MPPA 1YI1A 3EUHC 3RH0A 5BN5A 3DEAA 4AKHA 1JZQA 1O5OA 1U1IA 1G3QA 4IMJB 1DRVA 3B6EA 2C3OA 1MO3A 2YXDA 4FDLA 4OOFA 5TGDA 1RRGA 4YCAA 2CZGA 1FYXA 5M3MJ 4MWOA 3NVMB 4W8HA 5AVTA 1HKSA 5IJZA 4DT1B 1EXWA 2LKCA 3RTGA 3SZGA 1H2XA 4D4IA 3B51X 1SKQA 3HI6A 3UMCA 3AAFA 1B9MA 5HGXA 3IA2A 2XVMA 3CF4G 4DWJA 4KNVA 1RRVA 3V2GA 5T4FA 5BOSA 4BNCA 2VHXA 3BWYA 1R1TA 3KSUA 3KPJA 2DHQA 4MW7A 2PX9A 3ABTA 3LQ1A 1AKNA 3CCYA 3KLPX 3L6CA 4RV9A 2LSOA 5BORA 4G8DA 2JIMA 1P61B 4D4GA 1VI6A 2C9ZA 5ERXA 3KUUA 4WOBA 1FFXA 3ABOB 4N65A 3DAYA 3U3RA 5DPMA 4B33A 3CVYA 1B1CA 4FETA 1TWHJ 4ZCMA 2O5CA 3DYVA 5E1WA 4W97A 4KQIA 1W25A 2RHRA 2RHCA 2LG4A 1VYHA 1LGYA 2MSEB 1Z18A 5DN6A 3DTYA 3DU6A 2DXIA 5TPZD 3FCUB 1JEQB 2FZVA 1E1RA 4B3TB 3J7ZI 1FMCA 1ZVMA 4WN9A 1DIOB 3PLNA 2LBFA 1DAGA 2WA1A 3ZZMA 2OFXA 1RC0A 1PFWA 3ELDA 3NAGA 3CKYA 4P0TA 3I0TA 3NDRA 4LA4A 1B0AA 4Q4LA 2CHUA 5MN5A 5EIEA 3G88A 2Q3EA 3M6AA 1EBUA 1T8SA 1W4CA 4FFDA 3BJMA 3WKAA 5DNEA 3UT0A 1XK6A 1A82A 5CB0A 4MPRA 3IMGA 3ACDA 3D5TA 4ZT3A 3BWBA 2AMFA 2ZETA 2O8CB 4F4UA 2NXCA 3AO0B 3G71I 3PTAA 3VTFA 3OZBA 2IFTA 4D45A 1RHRA 3OZEA 2VB6A 5K51A 2RBGA 2QN1A 4QTRA 2BW3B 4ZI7F 1PP4A 4UBIA 4HG2A 4XBFA 2UVQA 2K9LA 2WWXA 4ENRA 5FORA 2ORYA 3LWFA 4F38A 5DYYA 1EA5A 1EP1B 1S3IA 5EPEA 2ZE7A 3JARA 2FSFA 1M1ZA 2ZWVA 3KZKA 2V7UA 4RTKA 1U0FA 5BUZA 2ODTX 3DZFA 3SHFA 1ZD8A 4AZ3B 5M29A 1ZX1A 5JS1A 1N8SA 3PJRA 4NIMA 1SC7A 3OSGA 2FH5B 1RCTE 3WLRA 4CF3A 4EENA 5F1PA 4YDHB 3IH2A 2DY1A 3KEOA 3L0ZA 2GEDA 4MFEA 2H1HA 3SJBA 5K9ZA 3V7NA 1RKTA 4NHJA 1PGQA 4N9WA 3WAKA 1LDKB 1Y4SA 2XCUA 2CXUA 4ITRC 5E9WA 2QA5A 1ZG5A 3QFFA 5JFGA 4A5OA 2J8ZA 3L07A 2FSVC 4XCXA 1E96A 3H9UA 4FX0A 2ME6A 3HR7A 4YR9A 1XWIA 1FX0B 2GPAA 1MABB 3U7RA 4PBRA 4PNZA 4KDRA 4I46A 2VC2B 1ODCA 3U7IA 3GX1A 3M4JA 1J5YA 3FD8A 5IG2A 1TKRA 3F5DA 2JGDB 4WWHA 4GR5A 1KAMA 4J0HA 4DJFC 4MAMA 2GBLA 2PQ0A 1ODDA 1IM2A 3L3BA 4ZQIA 4AY5A 4R6WA 2P30A 1MJFA 4X63A 5LL6P 3SVTA 1T2DA 1YZUA 4ZHQB 2P4UA 3V8JA 2CF6A 2BKEA 5EE5B 3T3OA 3D5RC 1RR7A 3TZHA 2PR2A 4ER6A 2Z1NA 1CEYA 2Q6IA 5A9TA 3A58B 3WG9A 4N5MA 4IIDA 5JD3A 2X9VA 3MCZA 2X1VA 1SUSA 2BZ1A 2GA2A 3A4NA 4O4LA 2YIMA 3NASA 4X95A 4OP1A 4IUBS 1PGPA 3AL0B 1C0EA 3JRDA 2YX7A 3IPLA 3I23A 3HA2A 1I36A 3WTTC 2FK7A 3VNAA 2MFZA 3ZS8A 2I71A 3NM6B 4ZU3A 4RBOA 5A2QK 3WWYA 2AVDA 3ASNH 2I1VB 3HZZA 4NBWA 1E2UA 4BKRA 4V24A 1R1VA 2DPXA 4J3FA 4A03A 3RR2A 4ZCLA 1I0IA 3P19A 1HC7A 5AI5A 1DKUA 1U8UA 3CBQA 4BU2A 2IL1A 3UQYS 3U62A 1E5LA 1U4SA 1JXSA 1P5RA 2A57A 1ULHA 5AVJA 1Q0QA 2AG6A 4HH0A 3T12A 1MVOA 5E6UB 1JKJB 5M7EA 3U7QA 1Y3BE 1P1IA 3RPQA 3U31A 1KWGA 2GS9A 2C00A 4EHFA 2Y05A 4RPHA 3UAVA 1QS0B 2VNKA 3AINA 3TPZA 1GQYA 2AFHA 3VPGA 3O0TA 3M8KA 5DOZA 3A3YA 4G37A 1D2AA 4GSKA 4EPTA 2XCOA 2FF7A 4LLGF 3BTJA 3UYKA 3KAPA 4I6JA 2EZUA 4ALKA 4O8CA 2R7XA 4QVKA 2KISA 1HNWB 4M1WA 1KEPA 2ERCA 4YV2A 3X1XA 1KHTA 4BRWA 2YIDA 2Q29A 2O3RA 1VQ1A 3VZRA 3ZZTA 5A3SA 2V96A 4U6NA 4HX7A 1Y39A 1ZYUA 4JIMA 4PTZA 4MVJI 3I04M 4EHIA 4J1SA 5H7XA 2D5BA 2YW2A 2V6MA 1QJ4A 1GM5A 3B5JA 2IPMA 4HN9A 4GUDA 2E5FA 4LUCA 5GY7A 3WSVA 5CURA 2E0IA 4NEGA 4IIXA 4B4UA 4QPPA 4IR7A 3NFYA 1Y7LA 4FT2A 2WJYA 2WF9A 4KXYA 2IBTA 4M3DA 1NHAA 3SYMA 2OF7A 3AG2H 5FULA 4R05A 3TZQA 3GFOA 4Z1OA 3OT4A 3CHYA 3LT0A 4LISA 2HCJB 4BDZA 1FWZA 3RJMA 3JR9A 1F8YA 1I2BA 3UAOA 2W2KA 2G7MC 3WL7A 4YAGA 1Y8CA 1CR1A 3IR6A 2L9VA 3MHTA 4I5EA 2IEGA 4B76A 1RW4A 3BA1A 4JX8A 5KJEA 2IEDA 3GQVA 4MW4A 2Z6UA 2GEUA 3AVUA 5BQOA 1FDSA 2JIDA 4C2AA 4JXZA 1SQ6A 2PGLA 4OU5A 5KOHA 1VLZA 1MKMA 1LSSA 1LFPA 2CB9A 5AW6A 3UANA 4CQJA 3BPVA 2D1SA 3Q0WA 2YFHA 1QLWA 4NMHA 1G9SA 4XVHA 1DPGA 1KVRA 3FI9A 2PX4A 3MJCA 4I36A 1GGJA 1KVQA 3B60A 4NKRA 4GYWA 4UTRA 2PS0A 2B6HA 2OM2A 1WX1A 3DYBA 4URYR 2ZMEC 1M10A 3K9LA 3KLMX 4FNMA 4R8LA 1FRZA 2X0FA 1X1RA 5EY5B 4JP1A 3OKPA 2OOKA 1QC5A 2EZKA 2O07A 3U4HA 4PO8A 3BTLA 1S2OA 1VLVA 5A9SB 3NTLA 3PT9A 4P31A 3P2OA 1SVSA 1PBTA 1VHTA 1GFWA 4LW8A 2VWQA 2DFFA 2RHOA 4NONA 3IKVA 2X76A 3LO5A 2ZCJA 1GUZA 5ICMA 1E6LA 1YITI 2OT3B 4TQUS 1GEEA 3AUXA 1DQYA 3NC1C 2AOUA 4O4LF 1PI3A 1IUOA 4X5OA 4OWRB 2IOFA 2XUIA 2MYNA 4V19K 1QX4A 2F4OB 3KAJA 3FYSA 4QT4A 3ESCA 4XX0B 3E5XA 2P2LA 4KIFA 4YACA 2VJYA 4DIFA 3W3AH 4LQDA 1W5CC 1OI2A 4GP7A 2DQLA 5K5OA 2NNLD 3KELA 3L2QA 2JRCA 3OJEA 1NPYA 1Z4OA 2I4RA 3RRBA 2C42A 3PE4A 3NMUF 2PM8A 1DPRA 2ZCWA 4I0BA 3GT7A 4IOKA 3UWSA 1DUXC 2YXEA 1XA4A 2FKAA 4QTYA 4HL6A 4YJ3B 1E9SA 5ALPA 3FOWA 4PYRA 2JGMA 4R5MA 3UW1A 3I3SR 4TXLA 3DVQX 1O96B 4KYTA 1JS1X 5JLJA 4A3FJ 2JGEA 2BFPA 2VJDA 4B3SB 3AQ4A 4QBKA 2ZBEA 2HXOA 1WCIB 1QAQA 3UYLA 3QPAA 16PKA 2E21A 1JU9A 4RFLA 2XAFA 4HDUA 4LIVA 2AZDA 4JP3A 4KL8S 2QUKA 4RMHA 3KT3A 1TAUA 2NUBA 4ND4A 1WXHA 1HRDA 2O2ZA 3UR3C 5EWLA 1YRYE 4R1HA 4CM3A 2KLHA 4XTCS 1C1DA 2VIIA 3CC8A 2A0KA 2XIJA 4MUBA 3WDKA 4DLWA 1QVZA 2DA7A 3LC1O 3O8HA 1P9RA 2PXAA 3K96A 1MMFB 4RHYA 2O6HA 3QITA 2E1PA 3NHBA 5F9MA 5T7BA 2Y48A 4FXPA 3JD0A 1AOYA 421PA 1P3DA 2UXCB 3NNDA 4MGHA 3VC1A 4G01B 5LMUB 1EP2B 2KDZA 3EC2A 1NYRA 4YXWD 4R8MA 3VYSB 3NEUA 4NAUA 1B0PA 2DBQA 3X1MA 1UP6A 5I9IA 3Q72A 4GWKA 1AC5A 4ES6A 3GPIA 1RZRA 3AL2A 4V1CI 1E63A 2FPPA 1S8FA 1NOKA 3EDQA 4O2LA 3P5BA 3ZHRA 2XNSA 4DUZB 3ZIDA 3HO6A 4WZAE 1V3FA 2XH8A 2XOKD 3CCMI 3IHLA 1THTA 1MH9A 2QZ9A 2D45A 2K02A 3ZCXA 4XWAA 3PUIA 4V39A 1DT3A 1UWVA 5F35A 4QXPA 1WXWA 3UT5B 4LHEA 4EI7A 2V59A 4I3FA 4CETA 3UJPA 1UBJS 4QQ8A 1VE5A 2RIPA 1Y63A 1RC9A 3OR2C 1FNMA 1A4UA 5D4SA 3TJRA 1YFHA 4F7ZA 4K8RB 2XDWA 1BMFA 4FVTA 1EJ9A 1ZUNB 4XUDA 2JRLA 3GTPJ 3UBMA 3OOYA 5DGHA 5E4TA 2GZMA 4O6VA 1BH2A 3UMVA 1IY0A 3Q2OA 4EY6A 5C7OO 2F5CA 3KU4A 2I33A 5BQFA 2PV7A 1L5OA 4Y15A 5BSGA 4M6VA 2G9QA 1IE3A 1U3WA 3JS5A 4PGGA 1KORA 2IK8A 4DQ2A 2H59A 2RARA 1NW9B 2R0QC 3OP4A 1IN8A 4CEHA 3N9IA 3ZWOA 1CS4C 2GZWA 1KS2A 3FBGA 4KUEA 4HNVA 3QEAZ 2QX4A 2Z98A 4OBWA 3DQVC 1MOSA 2PRJA 3E3VA 4EIWA 3OOEA 1UELB 2VDLB 1BG6A 2AYYA 3TCXB 3PC3A 1JX6A 3DP7A 2VJCA 5FTKA 3IL2A 1R0CA 2DLDA 2FN9A 3KP7A 1WD7A 4EY7A 2EDAA 2QU7A 1QHIA 2K7FA 1YRLA 2VJBA 3HEMA 3H2JA 2MINB 1HLVA 3TB4A 3BMXA 4D4KA 1U11A 3F9KA 3WA6A 4JVSB 3DDWA 1T1IA 4INOA 1RETA 4LYHA 4J75A 2XZTA 3EDYA 3F6PA 1H2FA 4DCPA 4URWR 1IU9A 4EY5A 5TR9A 1GZHB 3ND5A 1N78A 1RWQA 2EWNA 3C6BA 3DOJA 5DV5A 3W8DA 1GA1A 4DLYA 1VSUA 3BQMB 1Y81A 4MR7B 1NTRA 5JBNA 4WF2A 1Q7CA 4WLEA 1T8YA 2CDRA 3Q3VA 3G0BA 2A9PA 4YP0A 2Q07A 4Q4ZF 4QPZA 1KZGB 3HKCA 2JGNA 5EPUA 2VJ4A 1FLDA 4RJIA 1QLJA 2FPGB 3DTEA 1OX4A 1FFSA 3Q0IA 4FSHA 1DQPA 5D5XB 1AY0A 1R1DA 4WXRA 3UXEA 1JJ6C 4ZEXA 2QT1A 4RORA 1XZKA 2NO1A 2VHUA 5IT9K 4I9FA 2ZFUA 2BKUA 3UAGA 3EUKL 3RPEA 1H8ED 4W5NA 3EQ8A 1CP2A 4UUPA 4BNYA 1MO4A 3I2HA 3EA5A 1H0RA 4URUR 4Z3DA 2PH7A 3AEUB 1V8PA 4JN6B 4FMCB 4P7JA 1X3SA 1AHHA 1AA9A 3H1PA 3PGLA 1NR7A 2B37A 1U9NA 1DOHA 4BE4A 3NBUA 4R69A 3BX1A 3VX4A 4P82A 5IT5A 5LQRA 3RD5A 1WOYA 4F3KA 4DCJA 2EW8A 4M49A 4RSMA 2JZYA 3LX6A 4PQYA 3ZKWB 2GF2A 5GAEJ 1E4OA 4TLDA 1NBAA 3AP2A 4OU4A 2XV1A 1E2XA 2YJZA 2ZBQA 1T5HX 2MD0A 1GCAA 2ZOSA 1UH5A 1NUTA 3QXCA 1U8TA 4M73A 3U7GA 1EHCA 2C3MA 1JKPC 2E7ZA 3DEJA 1XF9A 3O7WA 1PZGA 3S2IA 4QAQA 1XHLA 5D51S 5LBQA 2RN7A 2BGNA 1X7GA 4NQRA 3GG2A 2JFXA 5GP1A 5DEQA 5JUWA 5CM9C 2WU8A 3QLVA 3ZWAA 2HMSA 3JQGA 3TNLA 2OWEA 1O7LA 3HL2A 5FO5A 4V3CA 2G04A 2Y0EA 3GG9A 3EHDA 1V4NA 4J2OA 4OQQA 3F8WA 3F5FA 3GYHX 1MSFC 4J0QA 4YCNA 3LE8A 3FDXA 1C7RA 1VZ3A 3VU3A 4BQFA 2NAPA 2D1YA 3ICVA 4C0WA 3BMQB 4K8OA 3FUXA 3IDSA 3H99A 5HDBB 3ECSA 2VCHA 1DI0A 3CJNA 3UBTA 3O3OB 1CV2A 3TMAA 2X0LA 4Q4AA 3LQYA 1TD1A 2IBSA 5IJXA 4EG4A 3I9V1 1WVRA 2NTNA 2VF4X 2Z58A 3ILVA 4YK7A 4DBLC 1YBHA 5IVHA 1JEDA 1G4HA 2EGUA 4DCGA 3E3LA 2EFYA 2HYJA 1SKYB 3BQYA 1PUFB 1L7QA 1NXVA 4MYTA 2ZT6A 2FQ1A 3LDFA 3E35A 2H00A 3MKLA 1NY6A 4X91A 3H75A 5C81A 3WG7H 2BVNA 3ZJTA 3OOPA 4JX4A 5JR3A 3VV3A 3C16C 4QRHA 4KQFA 1TQHA 4CYCB 3HXTA 1SQ0A 3L8GA 5D1HA 4KO4S 2F2TA 1NG9A 1JR3A 2EIHA 2PYZA 2QYSA 5TF0A 4MUMA 1JAZA 4HEJA 1D2MA 3TBHA 3R6GA 3A3NA 4JC4A 5JSKA 2ZYHA 2A35A 4HOYA 1W59A 3WL5A 1LBEA 3UMRA 3GMEA 4OXYA 1E94E 2XGSA 1U9IA 3NBFA 5NLLA 1N0VC 3DMNA 3WO1A 2H09A 5HR5A 2Q4TA 1T9BA 4Z9AA 4C76A 1X70A 5G53C 1ADYA 3GFLA 4DMUB 4OMZA 5JVGF 1TO1E 3N0WA 2XUZA 3QQ5A 1Y98A 2WA2A 4RTQA 4O08A 2AL7A 1DO0A 1XYYA 2VJNA 3QE4A 3OP1A 4LE2A 4M1MA 2W24A 1A9PA 2FETA 5CA0A 5JSZA 4U39A 2W9XA 1WDKA 3AKYA 1W9MA 3KSBC 2OHVA 4R3UC 4ANJA 1NX9A 2WABA 1RMTA 2VZ9A 3OIFA 3EOBI 4I01A 1SXPA 2GEJA 1UFOA 3U4GA 5LU8A 2D5CA 1TA9A 3H05A 4K9MA 4LOJA 1QONA 2IJLA 2VASA 3ZWYA 1XRNA 2EU8A 5AW1A 2OLEA 2OCEA 2I9PA 1E0EA 4YASA 5TXGA 1PEKE 4GSYA 3G2OA 3LUPA 3ZNPA 1O5TA 5CT5A 1Y5MA 1D8AA 5LQDA 2QTHA 2E2JJ 2P0YA 4UHEA 2O7NA 3OBIA 1G21B 3AFGA 4YRCA 5TQ0A 1S8AA 2MBFA 1LBSA 3ENNA 1W7PD 1G0NA 3OM1A 2YN4A 6ABPA 4H4EA 1SBZA 3MZ8A 2P67A 2QVZX 1SBTA 4LRSB 2DQRA 5JNRA 2IAIA 4ILKA 2X8AA 5JD6A 1ODTC 3MMZA 3V42A 5JJCA 4EHLA 3L41A 3FOEC 5NULA 2ZJPF 4IPAA 1RM5A 4YBRA 2V1DA 4MDYA 2NYUA 3M2TA 4U2KA 3U40A 3HJGA 5DW0A 2FK8A 2QWWA 3HZRA 3NH6A 3U26A 1RXWA 1F60A 1IWOA 1RLIA 1OQYA 3TJMA 2G82A 4LV6A 2AOTB 3HFGA 2V55B 1JAYA 3GYGA 4HLQB 4DDHA 3WTCA 2X8JB 5HLTA 3PUFA 5EJFA 3RASA 5I4IA 2EV9A 1X92A 3FMPB 4AVZA 3H4MA 3KV1A 5JJ5A 2NYRA 1Z63A 2CDNA 3BD8A 3G4SI 5FOTA 3HSFA 1C80A 3Q11A 3DUWA 4N39A 1X74A 2DQ4A 5HNFA 2DFKB 1NUPA 3IT1A 4GBJA 1YZYA 4RENA 1EIWA 2XMGA 3F8SA 3HBFA 2BHLA 2YNMA 3BWEA 3EDCA 3K16A 4RO0A 5F5XA 1MORA 3MPUA 2DKOA 1RBMA 4LGCA 2WHYA 2P79A 3WMXA 3WHPA 3Q7PA 5CPRB 5DHAA 2GBFA 1JQ3A 2ZVDA 1P7JA 3R24A 3LK7A 3LW7A 4WESB 4RD3A 3PPYA 1L7MA 5L3SA 1C1XB 3H5LA 3BREA 4BWGA 2VPZA 4U9IS 1UKEA 3HNRA 2Y76A 3EZ2A 3WGQA 2ZS8A 5CB4A 1DELA 2Y66A 3G2PA 3L8ZA 4A27A 4EJSA 2OGUA 3I28A 3V7WA 4ZDWA 1JT2A 4YYZA 3K4BA 3GJYA 5G0UA 1GHTA 5E1ZB 3U4DA 3UQZA 1Y8AA 2IU0A 2GDJA 2QR2A 4QXRA 4I0AA 3FXKA 3J81A 1ZL2A 4RVHA 2WU0A 4Y2HA 3S99A 2YV3A 1D1QA 1YB5A 1XMQB 1XKTA 4GD3Q 3U9LA 2PUDA 5C4IA 4XYEA 1A2QA 5LP6B 3QKSA 4C4PA 2P3QA 1MA3A 4MLPA 3K09A 4CTOA 4AUNA 3QE3A 2FKNA 2A1IA 5AHOA 4A1OA 5GTIC 2P75A 3OU2A 1QHHB 3LWBA 5C9ZA 4OIOF 3K6SA 1TW3A 4QUKA 521PA 4CCAA 1S7CA 1MVLA 3EIWA 2NUPB 1XN7A 1YOVA 4QU9A 4UM7A 3ZBPA 2VDQB 4L50A 1M7HA 2X5XA 4UXNA 1B8NA 4XIIA 2L7ZA 4CLOB 3QXXA 1KA8A 4C87A 2QI9F 2AN3A 4ZQCB 4N49A 1LX7A 2CFIA 4IHXA 3OH8A 1COWD 2J33A 2VUTA 4P32A 1JTXA 3WSWA 4K03A 1R36A 4LJ6A 5DXAA 2X0NA 2XWPA 2RBEA 3UHPA 3HS3A 3IBGA 4HDNB 2CMFA 4H1HA 3CNNA 3QK7A 2ZXHA 3SXUB 1RM3A 3MQ0A 5JHHB 4LOIA 1VJCA 3QJ5A 5HBGA 3HRIA 1T1JA 3MGBA 5LQUA 3R3ZA 1BR4A 1VC2A 1K5HA 3OFVA 4LFUA 4UNOA 3KQSA 2Y0PA 3HGMA 3QMVA 3P94A 1W87A 1NG6A 4L0MA 3W7VA 2G70A 1T6YA 4JY7A 2QHXA 2CUJA 2I4IA 2ICAA 3SOPA 2IELA 1Z33A 2JZOA 5L3FA 2ZB8A 1JG3A 1IBSA 2L2QA 1S29A 3JAMZ 5KEIA 4C3VA 2F48A 4XN3A 3N2NA 3GQBB 5G1NA 4LF9B 3OWHA 5E3JA 4YRIA 3TZEA 1CIPA 5AKHA 5JY1A 3DM9B 3PRKE 3UM9A 3OX4A 3RFFA 4J7CA 5INTA 2UXDB 3N0XA 2WDPA 2DUNA 4QUGA 3L09A 4JLOA 1F2VA 2CXOA 4K26A 4ZO8A 2ZYSA 4MV0A 4IDPA 2BI4A 2N3ZA 1FRNA 4G1MB 4CMJA 1SC9A 5G1PA 4OSOA 4MB6A 2ZIXA 3LA6A 1E1YA 3NYQA 4IGKA 1QRUA 1TEVA 3M2PA 4OJKA 3OU6A 3EIHA 3N2ZB 1W2GA 1Q7EA 1YE3A 3PQFA 4GC5A 2COUA 5C5IA 1Z5VA 3BB3A 3CTAA 2R6FA 2I3BA 3G1OA 1PU2A 2BGUA 4IQJA 3ABSB 1QZXA 3R41A 1DIAA 1V5WA 1WEHA 3PDCA 4L95C 1DTWA 4D3SA 4NU8X 2Z99A 4MVYA 3UAYA 3AY0A 1AKHA 4BKQA 1TCBA 3SHTA 3LXMA 1XVTA 2A1UA 3A7DA 1M2VA 4L9WA 1TGVA 5DYNA 5LDHA 1F9EA 2MC4A 1E99A 2HU2A 4NATA 1NYTA 4AJ9A 2XNDD 3PCRB 2HA3A 4KYVA 3PF8A 3LFKA 1T5OA 1JLRA 5CCDA 1AJEA 3PM1A 1W30A 4KN9S 5IZ4A 4M8SA 1USGA 3BXGA 1RXYA 1Y5RA 2RK6A 4Y33A 1J6UA 4KV7A 5K8CA 2EF1A 5CB4F 1OCRH 1J75A 1UJMA 3C3YA 1NVVQ 2DSTA 4RU1A 3CGWA 3WYBA 3R0XA 2I1WA 3L2VA 1VECA 5EG0A 2R85A 4IIEA 1FQWA 1JDTA 3ZQHA 3BQ9A 3TD9A 3TVYA 4TL8A 2F3TA 3FLBA 4D0PA 2Q3JA 3OF3A 2EFOA 1ZMBA 1TIBA 3LUKA 4WN3A 3MUOA 1SFRA 2B4QA 3HM9A 2C9OA 4ZANA 4BEHB 3NIDB 5FR1A 4Z7JA 3IDOA 3BB1A 3ML6A 4B2LA 4R9VA 2BM0A 5JBIA 4LXIA 4R4JA 1QOQB 4RLFA 4QULA 1NJGA 1R6VA 1RYYA 4MKZA 1ZW6A 2HOQA 1NK2P 4S1VA 2OD9A 3BEOA 3AG6A 1E2EA 3EVCA 2QRLA 2Z5FA 4RQBA 4E1AA 1E3SA 4BWVA 1JLMA 2VHZA 1ZK4A 3EYYA 3GRCA 2VYCA 5IJ0B 4Q37A 3F8NA 4QLCU 5BS6A 3IAEA 1VG1A 1XZDA 4BJTA 3BXFA 4ZYLA 3OOJA 2HK9A 2ZXFA 2QTZA 4NL4H 2D4AA 3AI2A 4WCFA 5FUWA 5BSWA 1XTIA 2QQEA 2JGIA 1ZA2A 3W5BA 1FFEA 2VSYA 4P1ZA 4F1JA 4PCVA 4V0RA 2E4VA 3EGXA 4GYIA 2PJDA 2E9SA 4PAGA 4PSAA 1BO6A 2WC2A 1I0ZA 4HY3A 4J49A 4LDAA 1E20A 3KSDO 3FFTA 1U3UA 3O2PE 2V6JA 3CX4A 1WLYA 2C31A 4DB2A 2FR0A 3PUHA 4PCUA 2Z3WA 4DSTA 4EUEA 2MSDB 2X86A 1GUAA 3WGYA 4DF3A 4KMSA 1YVUA 1OLXA 5L6LB 1H6DA 2QSZA 1T25A 3NXKA 4Y7CA 5FEMA 5HUQA 2ZPTX 1HE4A 1A9RA 1J2UA 3HB1A 4G0NA 3G6KA 2ZRJA 2B1RA 1RQ7A 3A70A 1E7RA 3GRVA 4AQDA 1MAHA 4MINA 3HCRA 1FJ2A 3ZHXA 4M2LA 2VZEA 2UDPA 1WPXA 3TLYA 1BHO1 5AIPA 1L7NA 1PDOA 2E5ZA 2VDMB 3BAZA 5AK4A 5EIWA 2BCJQ 2HZTA 1JR4A 2A0FA 4B3AA 4ZOBA 5FBVB 4F6RB 4PLVA 1Q44A 3WBKA 4MRNA 4K6HA 3OIOA 3P9RA 4XJXA 2W6IA 3LCRA 3RBZA 5K3AA 3BWCA 2NXNB 2Q5EA 3DLTA 3LYLA 4FKZA 1VKHA 1LEHA 2HMTA 2G4LA 5A7HA 2AMVA 3QVTA 1UM9A 4QGGA 3C7TA 3UMBA 2I6XA 4KO8A 2WV7A 3ZBUA 2LNBA 1WVMA 2AF4C 4Y98A 3LVRE 5I8PA 2H0RA 3KTAA 3K4LA 5LZ4A 2A88A 2NTEA 5TRDA 3UJ7A 2RB5A 1JR2A 4ZT4A 3DBOB 2I66A 1BA2A 2XSDC 2FP3A 5FI5A 2YPRA 1A9XB 4NK5A 3NTQA 5DEIA 4UFOA 4HNTA 2EHJA 1BA5A 1WE2A 4G2NA 1USUA 3IR7A 1M66A 4IX1A 4PAWA 4WTOA 1GZ6A 1S7GA 2X4HA 1SCKA 5EA2A 4A6EA 1M1EB 3AG5A 1K8ZB 2ZXWH 4UQOA 5ALSA 1K0UA 3DXYA 1I6XA 2ZS7A 2DH5A 4YQZA 2ZIVB 2VQSA 1Y6FA 2WM2A 4MR8B 1LE8A 3TP0A 4BHBA 1DGRM 2C07A 3DDOA 3ENQA 5H3CA 4JX5A 2IW1A 4WEQA 4U7JA 3F6RA 5FD5A 4P1WA 3HA5A 1K8XB 4HF2A 3DZDA 4CV3A 4DOZA 4BE9A 4N1AA 3EVBA 4ZODA 5DD4A 3W79A 2F1HA 3E7LA 2R66A 1ZC3A 4FM9A 2UUAB 1UMBA 5I7EA 5CFQA 3H7IA 3UK2A 3ONVA 2BF7A 3MWJA 3O84A 4JYMA 2ZI4A 3SYLA 1QRSA 1ZD9A 3TRIA 5BPFA 3JZMA 5D5HA 5CLQA 5AFSA 2WFLA 1Z77A 2GA8A 3U80A 2PGAA 1ACMA 4BIIA 1Y1QA 2HD4A 2QF7A 3ABKH 5KPDA 2HSJA 3O3MB 2IUSA 4FZVA 3K2BA 2IYPA 2VJMB 5JIBA 2TS1A 3OE7A 3U3DA 2H4JA 2XBLA 1Q83A 3NLLA 4QEZA 1IM8A 3A37A 4NBRA 2E4UA 3Q7EA 4F56A 1FMVA 2FZEA 4DNFA 4K9SA 1POGA 5TJHA 1UEIA 4IEIA 1U8EA 1H5NA 1KMQA 4Q12A 3NEAA 3M81A 8OHMA 4NG4A 2JI6A 1QIHA 4G5GA 2LKXA 3AUKA 5K20A 2K7LA 1KBQA 1XZEA 4UTVA 2QR5A 2R25B 2DETA 1CUVA 4WX2B 4ETMA 1KP2A 4QPJC 1XROA 3OPQA 2XT9A 3WNBA 4E7HA 2D5LA 2FXAA 3ZZNA 5BVHB 3UFXB 3HOVJ 3R9IA 3ZE0B 2VUMJ 4TLEA 3VJMA 1AKMA 3SX0A 1X87A 3UB3A 2PS1A 4M0UA 1BE1A 4F0JA 2WLTA 1NASA 3U4QB 2Q9BA 1XT6A 2RC6A 1U2TA 1Y3FE 1UPUA 1ON2A 2O3TA 1PZHA 2CMDA 4EKYA 1W4ZA 1A6IA 1QZYA 1VP9A 5LGNA 3MA0A 4U7HA 1JMKC 2IZ5A 4UEWA 2JAXA 1DVRA 2HZ7A 3ZJYA 1MT3A 2AXQA 4G9YA 4II7A 3BUSA 3G9ZA 1H69A 4GNKA 1YXMA 2FOXA 3VPHA 3DLLF 5ALYA 1S7AA 1AGYA 2QN9A 1OFVA 2OXTA 2DDBA 1H05A 1I14A 3CR8A 1X2MA 3F3YA 3QYFA 3D8RA 2CJWA 3DH0A 4WOJA 4J3JA 1HKTA 4IG9A 3UJ6A 3S1QJ 2GRAA 2YHIB 4NI5A 4EJVA 2QTVB 1W8IA 4MWTA 1UJBA 5F23A 4JJEA 3AY7A 4KK3A 1QX3A 1D2HA 2VPIA 3OMLA 3DAHA 1G8MA 4BNMA 3E22A 3LUCA 2F00A 2PAFA 2ZWIA 4J0DA 2VXZA 3IT3A 4B0PA 1M1YA 2FD5A 3GOQA 4HAIA 4IJQA 4HXFB 1E5XA 4GECA 5GOTA 4IY1A 4AN4A 3WOHA 2DT6A 1NJ1A 1H2RS 2PJRA 1TKCA 4UEJA 5JD4A 4AQYB 5IN4A 1WW8A 4DQXA 1VQ7I 4OINF 1XNHA 1LSJA 3NIWA 2FU5C 3GFTA 1IDYA 1K06A 2QYTA 3D7SA 4BMPB 1JGTA 2O7SA 1FVHA 2V7PA 1S4QA 3BD7A 2IIBA 1QQ7A 2HPMA 2NXJA 1MH4A 2QE7D 1UL1X 4CUZA 2HVSA 2D62A 3PHHA 2QG6A 4NVRA 2WM8A 1NF8A 2QM0A 1R6AA 3OZSA 4MULA 3DE7X 5FLMJ 1NNI1 1K7YA 2PIDA 1N2IA 1CJKC 4UUSB 3COWA 1TXGA 4L5AA 2YVQA 3NBAA 1WUJS 2CLCX 3F7MA 2IYOA 4YB8A 4B8XA 2VAMA 3L02A 1B0ZA 3AR8A 5CNKA 5BMZA 4YJHB 2Q5QA 3SFTA 3TOCA 1H65A 3M6UA 3R3YA 5DWDA 4EGSA 2R7SA 3QPBA 2OWDA 2PZAA 3M49A 4YAOA 1NVTA 3VR3A 4IFIA 1YZKA 3TL3A 3B3AA 4KN6A 1HF0A 5E7IA 3Q88A 1VYTA 3V48A 4WJKB 2Q50A 2YWHA 4XA8A 5EXSA 4HX5A 3BORA 2PD4A 3TRHA 2A61A 5GM1A 1D1CA 3H2HA 2ZK7A 3S8EA 1Y3DE 5GJVC 2QZZA 5LZ9A 4BXOB 1QE3A 1NY5A 1JDSA 2GJ8A 3RTEA 4PANA 4Q05A 4QHTA 1VHQA 5IDXA 2E18A 3L77A 3R3XA 4M1OA 4N8DA 1MH3A 1G1AA 4JU8A 1XU9A 1HE2A 1XTPA 2C9BA 4Y9RA 2ZYTX 1GPAA 4CDRA 4Y0VA 4RL6A 1VGQA 2F1OA 4P58A 4HEA1 4YP7A 1GR1A 1KYTA 1J7KA 2OHHA 5LHIA 4HMQA 1ENYA 1K5DA 3LUDA 3K5WA 2IYFA 3NTVA 3DPLC 2OKCA 1HRKA 3A2KA 1ZESA 3ZTWA 1ORVA 1A5ZA 2JJ1A 1U8RA 2ZT8A 3PEVA 5DS9A 3DULA 5DLPA 3S1RJ 3UJBA 2M6RA 3T7IA 1RCFA 5BSEA 2AEMA 2ZJ4A 2O1SA 4L02A 4BUCA 5J4LA 4F5WA 5KYYB 3PXAA 4HW0A 1FIPA 1IXRC 1GQRA 3EQ9A 3BCBA 4RMGA 1GV5A 1EHIA 3H2GA 2JNWA 3UHFA 3BPSA 5E7QA 4RNDB 1EVKA 5FJ8J 3NHKA 3E05A 3OESA 4LY3A 4NCBA 2V9CA 3B9QA 3GR6A 2Y2VA 3ZGZA 3BB4A 3PD0A 3EUEA 3B8HA 3I2GA 3BCHA 1KZ7B 3EVEA 3N8IA 2Q1XA 3KPVA 4JJGA 2ZAYA 4EVIA 3NPAA 1WVIA 2IQIA 3N7TA 3G6EI 3LW8A 2YBEA 1NBMD 3LLUA 1M73E 4TTVA 3A2LA 1C1HA 2RH4A 3WWEA 4ARUA 4C9BA 2P0EA 4QOGA 1TUGA 2JL1A 5FAXA 2COEA 1I1GA 1KZ6A 3N2GA 1LPQA 4Q9LA 2GN4A 3CNQS 5C3UA 2RB4A 2HPHA 3QI7A 4IWXA 4XIFA 5P21A 4WW0A 3K2AA 2XNHA 3NRBA 4M53A 2I3DA 2B82A 5I7AA 3E4CA 1RESA 3ZWNA 2NW6A 2FXVA 3OZWA 1L7DA 1YRAA 2BISA 1YZFA 4FFVA 4PVDA 4JU9A 5F3WB 1UBCA 1W29A 4Y7NJ 2WV0A 1GPUA 1V2GA 3ANMA 2BEWA 2VZ8A 5JS6A 4D79A 3OQ1A 3CIOA 1RAIA 4YCJA 1F0PA 1K68A 3BK7A 1ZJJA 2DU9A 4ZO7A 3KFWX 2WUVA 3U56A 5AKXA 3R74A 1SWWA 3TOZA 5BRJA 4TS1A 1J22A 3PXCX 4DIDA 3D0KA 2DU8A 5B3JA 3SZ3A 4DMFA 3GCGA 3TIVA 2YZ2A 3AFIA 1W52X 1FE8A 4UNSA 3BVPA 3GJ5A 1VCHA 4NCIA 2QN2A 2RGEA 2ZO4A 3MT8A 3D5EA 2QM7A 4OMCA 2BEUA 4M7PA 3HFRA 3LQ2A 4JUAA 2MSWA 1U78A 4D3XA 5B3SH 2XYPA 2FE4A 2X6WA 3IAFA 2B4YA 2Y1CA 2O2JA 3NI2A 1K7FB 2EJCA 4YLYA 3H1FA 4HUQA 1IN5A 2NSJA 4FMPA 2V03A 5HS9A 1R0BA 3OQOA 1W0KD 4K1XA 3G0GA 2BI7A 4AJIA 4E15A 2OV6A 3ZN1A 1NNLA 2PFSA 4R1OA 3R9XB 3FSGD 2FWNA 2GBIA 5AI0A 3O03A 5IU6A 2Y71A 1U3CA 4MRMA 4PGFA 4BJ6A 2M8GX 1Y33E 4QTXA 4RGRA 1VCMA 2WYOA 4TZTA 1YTUA 5AVZA 5FPKA 1W88B 10MHA 5B3AA 5J1UA 1X8XA 3RAJA 1YR9A 3C7JA 5FKJA 4GKKB 5MN4A 3HYNA 2A67A 1JVNA 5E20A 4A2UA 2XKJE 1XKXA 4E30A 3KJHA 5IT9Z 1DJQA 4HQFA 4IDQA 4FHDA 4EVQA 5M3BA 1SK9A 3VH3A 3RIGA 2AN1A 1VHLA 5IK2A 1WUIS 1DEAA 2HJGA 4M1QA 1GPDG 2I65A 1GRVA 3QU3A 3TTSA 4HR7A 5IT0A 2PIAA 3LAWA 5DVZA 3MAAC 3AF0A 2YN0A 3MJDA 2BONA 5E79C 2RKWA 1YQGA 2IBMA 4FZ3A 1S6YA 4DNCA 3LKZA 3PD1A 3T9FA 4Z4FA 1XMIA 4ZO6A 1GHCA 1GNQA 2IZ6A 2XGMA 3ENVA 2J9XB 3I61A 3GNLA 4QBTA 1MF7A 3WJ7A 2CUNA 2ODAA 1DPUA 5HTKA 3ZKAA 3K4MA 1OC4A 1WA5A 1LDEA 4Q3NA 1IO2A 3JZDA 2VF2A 2WV1A 1SU6A 3JWJA 3EGDA 2GLTA 3K1AB 4B3GA 4DGQA 1Z0UA 2WYIA 2ZAGA 4ZOLA 4FNOA 3GELA 1UPTA 2MR5A 1LI7A 2XCLA 2W25A 5CKTA 4IH1A 4E5MA 4XGIA 2NS8A 2IH5A 1CY6A 4HTFB 3K0HA 1OI4A 4IJ6A 4CNQA 4AWXA 1LDDA 3NYIA 4LRWA 4AY6A 2GM4A 2I6GA 3JWGA 3P9PA 2NS7A 3C3JA 1WXXA 4IDHA 1VDZA 3KQHA 4JOBA 3HL0A 4YCDA 3DV2A 5CNJA 2RGDA 2RAFA 2KIQA 3S29A 3V4VB 4OPMA 3OIVA 5IP6A 4EI8A 2CFCA 1E8NA 4MYRA 1IZ1A 2MW8A 3HCNA 4R2LA 1BZYA 3OCVA 3RSNA 4PYQA 3TLGA 1JEOA 2AJLI 3JW8A 1MBGA 3SSOA 4OAZA 1XEXA 2PYIA 4B3FX 1C0PA 2VNHA 1DDNA 2NQTA 2JFBA 2QUIA 5K5EA 2R8ZA 1KERA 2JARA 2Y4NA 1ABEA 4WXPA 5BYBA 1CJVC 3TIIA 3UJNA 5KVVA 2GZRA 1M6EX 1T10A 5AUOB 2OZPA 3IOYA 4G1CA 4RQAA 4QWMA 3DFKA 2H6CA 1C9JA 3I8OA 3UWOA 1EDEA 3B1JA 2RJNA 2DFTA 5SZJA 4D7MA 1YCGA 3QPDA 3B02A 4ZYTA 4ZVTA 1KYQA 2Z2KA 1WNTA 3UGJA 2L02A 4C5AA 4L8LA 5CVTA 3H2YA 3LCCA 1K88A 2GKSA 4BEVA 4WY8A 3CXUA 2XLBA