1S8NA

Crystal structure of rv1626 from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
190
structure length
190
Chain Sequence
AVPRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords putative antiterminator
total genus 74
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s8nA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s8nA01
3KE2A 1T34A 2X0LA 1DP7P 1S7OA 5DKFA 4YFXF 4WX9A 3FFWA 2YX4A 5DUIA 3H5LA 4M74A 2PLNA 3DGFC 1FQWA 1F9NA 3KSMA 4R79A 2ELHA 2LDUA 3LWFA 3JY6A 4BQAA 1T2KA 3F6CA 3WU0A 3WTXC 3F8MA 4RXMA 4WZZA 2WV0A 2IPNA 3KG2A 1B6AA 4WT7A 3IKVA 1EWKA 3WTZA 1GXPA 4MR8B 5EWMA 3KLOA 3A0RB 5BR1A 5TJJA 1O3TA 4ETNA 3CNBA 3RYRA 3GUDA 4NICA 1EAYA 3Q7SA 5K5OA 1HW1A 4Q6BA 1GUDA 5JHUA 5L3CA 5ILUA 3WE3A 1I1SA 3JPWA 2P9HA 2FA5A 1O3QA 3FHZA 3L2CA 1W7PA 1W5SA 4MLCA 2KRFA 3HSEA 3TB6A 4FX0A 2GZWA 3DGEC 1S6LA 4YIIA 1YTUA 4G0MA 1FYMA 3TDUC 3T95A 1Z12A 5CVJA 1CHNA 5DV5A 2V9VA 2BE5F 1DJMA 1ZAOA 4MS1A 2A68F 3LA3A 4M9ZA 2FVYA 3U9GA 3LA2A 4RGSA 4U88A 1NY5A 3C7JA 3CKMA 3N53A 1BA2A 3ERED 4PEVA 3E61A 5D6EA 1MJAA 1B4AA 4YFKF 4YS6A 1Z6TA 1RIOH 1DC7A 4RV5A 2IJLA 2K27A 2Z3YA 2H0AA 2YR2A 1TW3A 3LSTA 1NXWA 3OMXA 1IRGA 5KI6A 4Z0NA 3BZ6A 2PUAA 2M5WA 3EUHA 5DCLA 1USIA 4L9JA 4R1HA 1OXKB 1PEYA 5IULC 3HVRA 2C6YA 4UNOA 3REOA 3GVAA 3OOPA 3HO1A 1IN4A 1G3SA 1SFEA 1CF7B 3HIFA 4RY9A 2IW5A 1OR7A 1CEYA 3QU6A 4LMYA 1TLHB 1ZAYA 1QZZA 1U3EM 1EH6A 3H5IA 1SXGA 3FFTA 5KQLA 1VTNC 2PJPA 3EETA 4RS8A 3U1DA 3QLTA 4ZYHA 1DP4A 2CG4A 2GWRA 4KDPA 5FLXZ 2YHBA 3ZP5A 3ZQ7A 4L4UA 1C4WA 4N41A 3BPXA 1ZGZA 1IN5A 1T39A 2JRLA 5BRJA 1DBQA 3URMA 2GKGA 5K1YA 2R47A 4YLEA 3GFIA 4EV0A 2IRFG 4F06A 3R60A 2ZBKA 1R5GA 1YQAA 2H94A 1Z25A 3I4PA 3FM5A 1ON1A 5LGUA 3GFLA 1R1VA 3E3VA 4BHBA 1UCRA 1Q1HA 2L01A 4OIOF 4G0QA 4KN7X 3DLBA 2PLYA 1NXVA 1W4MA 1E6KA 3O2QB 1YS7A 2UZKA 5IC5A 2XAQA 4O5VA 1JX6A 3KZYA 1FSHA 1I3CA 4W5QA 2E1NA 1K7AA 1Z9CA 4HLXA 3RYPA 4XARA 2R3SA 1Z2EA 4D6YA 3L7WA 3OQOA 2V1UA 3RTRA 5PNTA 3NNNA 4KNYA 7ABPA 2VONA 3CJNA 3KEOA 3OM1A 2K7LA 5D5WB 3HRSA 3CUQB 1H9TA 3OLXA 5D5UB 2HTJA 2H3HA 3BJAA 3T38A 3C3MA 3SM9A 1E17A 2LKPA 2M98A 1ZG3A 5JNUA 4JB2A 4CBVA 3D02A 1BVHA 4KRFA 4EJTA 2AXLA 1MDMB 1EWTA 3HCWA 1TNSA 2LF8A 1C0WA 4LJZF 4WXDA 1HKQA 4KIBA 1FFSA 2M30A 5LHHA 5HSGA 2WJAA 2MYNA 3ABTA 2HKOA 3N0XA 3C3WA 2XHKA 3W9SA 3MIZA 4K2EA 4KT5C 2JK1A 5IT3A 3OQNA 5B3JA 4FE4A 5TQ2A 3FM3A 1D5WA 1L0OC 1YVUA 3WTYC 1WQ2A 4ZYDA 1CF7A 2FEKA 4RK0A 3ABUA 1D4ZA 1URPA 4HBLA 3O1HB 2HOEA 2W85A 2OAZA 3GYHX 4F8JA 4AD9A 1JHZA 4XFKA 3MCZA 5HLHA 4YWHA 3F3XA 2BGGA 3DF8A 2QM3A 1YIOA 2L4AA 1HKTA 4MQEB 4HA8A 1ZDMA 2PG4A 4ZH4F 2F5DA 4MQEA 4KICA 2MYUA 3FWEA 5JVTA 2VT2A 1VKRA 4EJVA 2L2QA 4RGRA 4PE5B 1HSTA 5IUJC 5LGTA 2QLZA 1I27A 1E6LA 4MTEA 4HF1A 2CHFA 4M9SA 2WJWA 2FQ3A 1TM2A 1XGSA 4DQDA 4KVFA 3JS5A 4IHSA 4H0EA 1JGSA 1IN6A 1G3WA 3QLVA 4JQFA 1MD0A 4Q47A 4RKQA 1R36A 5HM6A 2LBPA 4BH9A 3GA5A 1QQBA 3KP5A 5IX8A 3IKTA 1W7PD 1B59A 4RZSA 1JHFA 2CO5A 4YRZA 2D1HA 1J2XA 5HDGA 4JK1X 4MEYF 3CO6C 5CNIA 4G6QA 3O1IC 2PUCA 3FZVA 4KMRA 4W5RA 1V4RA 1JHHA 2CFXA 2FMKA 1BBYA 5BMZA 3KHTA 1OYWA 4RB3C 5DD4A 1NHAA 3CUQA 4BHPA 4RK4A 5FWXB 1U8RA 2EV5A 1K78B 3IPCA 4RXUA 3KYIB 1FFWA 1D8KA 2MSLA 4N0PA 3TMYA 2NZVG 3GXOA 3JSOA 4OIQF 3IWZA 2FU4A 3QRFF 2PUDA 2KJCA 3N0WA 1UFMA 1MB0A 1E2BA 3I59A 2DU9A 1ZH2A 2QWWA 3ZN1A 3E97A 4RK5A 2E4WA 3HM9A 1HKSA 2L17A 4HYEA 1ZG1A 5BOXA 4KZKA 1S7AA 3V8KA 4CO8A 4BXUA 2YX7A 5FD5A 5FBHA 1O3SA 2A6HF 1QPMA 4IGAA 3LUDA 1YFHA 3H5WA 1XN7A 4RB1A 3DP7A 2LNBA 3QAHA 3D5LA 5DEQA 4OIPF 1QQIA 3SHFA 4MGRA 3MAJA 3S99A 2JRTA 3GX4X 3TO5A 3G73A 1NXXA 2GBPA 3H6GA 5TQ0B 4G94A 5EWJB 4TLMB 3ZMUA 2RDPA 2XAJA 3F7NA 2DK8A 2NRAC 1Z16A 2FMYA 2FW0A 1SAXA 3QOPA 5F64A 2H6CA 2DI3A 3IC7A 3BY6A 4MQ9F 5IBQA 5ERIA 2VBWA 1IXSB 4L0ZB 1E6MA 2H27A 1UDRA 3VNAA 1YG2A 1Z18A 1SD4A 3HOSA 2OZ6A 4MS3B 3H3UA 4A0YA 1XDSA 1MAVA 1KU2A 2IPAB 1KQ8A 3HRMA 4L18B 5DCMB 2VODA 1GCGA 1IIBA 4M88A 5CLSA 1VRVA 2QBYB 1ISRA 3TDZC 1SXHA 5D4RA 1IN8A 2FNPA 2PE5A 2XIGA 2FMFA 3RIRA 4AIHA 4EYOA 3VOEA 2HQOA 4MGEA 3T5XA 2AS5F 1TTYA 2PBIA 4N47A 4PGGA 3Q15C 1SD5A 3JTHA 5E20A 3HSYA 3QEMA 3LA7A 4Z9BA 2KIMA 4EMSA 2M1ZA 2L4MA 4WXHA 3TO6A 2GXGA 1Z17A 2JPCA 4I02A 3C1DA 5AIPA 1FSEA 1W9HA 4RB0A 3HDVA 5JNRA 2VUHB 3CRNA 4Y17A 4FX4A 1BI3A 1U78A 4TMYA 2HZTA 4WXEA 5CJ9A 4LZLA 3K9CA 4RS3A 4Z99A 2ZMEA 1IUYA 3OLYA 3NNSA 1LJUA 5IUNC 3RKYA 1ZGJA 1FOKA 2E7WA 3HOTA 1ZVVA 5J8FA 2IPMA 4MS4B 4HOBA 4I01A 5DGCA 2PUEA 3H75A 3ZMVA 2FTKE 5TPWA 1IXRC 1R22A 1B9NA 4UVCA 4OBBA 1QZYA 3DV8A 3GRCA 3HUUA 3B2NA 2EV6A 2LUOA 6ABPA 3WE2A 5JR3A 2P6TA 3GF2A 3MWMA 3IP6A 1R23A 3GEZA 5LGNA 5GQSA 2R7DA 2FEWB 2FMHA 4BYYA 5KVRA 2OENG 3OMWA 1BDIA 5IUKC 2EA4A 3B02A 4M71A 5LRRA 4Z4FA 5B3JC 4ETSA 4YCSA 3BOQA 1JLKA 3UUGA 2O0YA 2V6CA 1R1TA 3SFZA 3UK0A 4IPAA 4WWCA 3I45A 1D1PA 2QR3A 1R8JA 1CGPA 3CG0A 2B0LA 2AYZA 3DZDA 1Z1DA 3H5TA 2FNAA 3IPAA 4WCGA 1WETA 3BPVA 4U0WA 4NB5A 4XAQA 1U6GA 2IPLA 1USKA 3UKJA 3M1EA 1TQMA 3FMQA 2HQRA 2DLLA 1B00A 3NRVA 2JBAB 4XLTA 2L54A 3QPTA 2WC2A 1P8AA 3H1EA 3QP6A 2UWMA 2OD5A 4G0ZA 4FE7A 4MQFB 1M2EA 5FWYA 3CTPA 5EEGA 1NXOA 4MR7B 2HSGA 5BQTA 4D0PA 5CNKA 2XDYA 4IRIA 4S04A 5L3GA 2PL9A 4CYDA 2YSRA 3OLZA 2ID9A 1YK0A 3DPLC 2HYFA 5ICEA 1BDHA 3KETA 4MR9B 3P9CA 2FBHA 5HDNA 3MZHA 5JNWA 1P6RA 2GI4A 2JPBA 4ENJA 1LBIA 6PAXA 5CNMA 1KRWA 4HQEA 4NV3A 2J5PA 1OMIA 1AOYA 1LQ1A 3P7NA 2F5CA 1PNTA 2Y0MA 3GLXA 3G3ZA 1RZRD 3WGHA 4JP1A 2GXBA 1GLGA 2QZ8A 5D8KB 4WUTA 2XAFA 1ZRCA 5DYMA 5D5XB 4P5OA 3R6SA 4OU0A 1LDJA 2JZYA 5KWSA 4RXTA 1BI1A 2B1JA 1G6NA 1RPJA 2XRNA 3P9IA 1ZLJA 1FBQA 3ECHA 1S8NA 3DXJF 2CGPA 2NNYA 1RUOA 4JA2A 2B4AA 5DTEA 2D2WA 1DPUA 1Z7UA 2HEOA 4PYRA 2W42A 1YW7A 5D8LB 2NT3A 1J75A 4XLNF 1GHCA 4NCAA 2GA1A 3V8JA 4HV6A 1TMYA 1PP7U 4UHTA 2QENA 1ZH5A 1XHFA 2Y48A 1BDJA 3HHGA 3RVLA 3IP9A 1JYFA 3C18A 4NQRA 1T0FA 1DCMA 3I54A 3HZHA 4OIRF 1ZHFA 1H0MA 3QEMB 4A5NA 5TE9A 1R7JA 3K9TA 4U7BA 4HDVA 3KFWX 1U2PA 3BP8A 3EGCA 4ESFA 5ICCA 4TN5A 1SMTA 1XGMA 3D0SA 3RJPA 5IT9Z 4H60A 2IA0A 2A9OA 1ZLKA 1TVMA 4XLPF 3K0LA 2V1XA 1IN7A 1T38A 3SG0A 3GBVA 4LK0F 4MQVA 4F7ZA 3COAC 1SXIA 3EJWA 4O6JA 3QP5A 4DN6A 3C3KA 1G3YA 1FYLA 2FQYA 5F6FA 5DD8A 2QYOA 1ABEA 5I4CA 4NHJA 4Y13A 1YW9A 2YU3A 5F1RA 2O3FA 2RNJA 4ZPJA 3E6DA 1FBSA 1DCKA 3V7RA 2IOYA 3VODA 2JTVA 4PZJA 5HLGA 3QPHA 4HV5A 2N9UA 1ZY2A 1B9MA 2A3SA 1QO0A 2MLGA 1QNLA 3ML6A 4O3MA 3TO9A 4HDUA 1R58A 2IA2A 2ETHA 2ZNZA 4G0YA 2VBYA 3K69A 3H1FA 2RDMA 4CZZA 4CHUA 4G0OA 3ZMTA 3NNDA 3KKEA 4NCBA 3QK7A 1BIBA 3OO0A 3OO1A 1WKMA 1W5TA 5FGMA 5E1XA 4YIFA 2W84A 3H1GA 3DEUA 5E17F 3KP3A 4MR8A 5EWMB 1IXCA 3J80Z 3SXYA 2WWYA 1QMPA 1RZ4A 3JPYA 4IXAA 4XBFA 3A3KA 4ZMSA 2A07F 2J48A 4L9VA 1Z13A 5FFZA 3FXRA 3GFMA 3I71A 2R25B 1I1GA 3ROTA 1C0EA 3LUFA 5T7BA 2MSWA 3MM4A 1R00A 4KV7A 3MA0A 3WTSC 1JE8A 1QKKA 4EGYA 4WXCA 3F72A 5J6XA 1LJLA 1DCFA 2DO7A 4JBAA 5EWLB 3U2RA 2OQGA 2H6BA 3QLUA 2STWA 1JH9A 1ZRDA 1LNWA 5EEHA 2IA1A 2CW0F 3ROFA 4TLLB 3I5AA 2CWEA 2PMUA 3EODA 3M8EA 4OTZA 3F21A 1DZ3A 1SMYF 2LPMA 2CSOA 1BC8C 3FX3A 3MF4A 5KC9A 2RGVA 1PUXA 1BC7C 3LTEA 5TPZA 2G7UA 2P4WA 3RQIA 4Q7EA 4L5JA 3O21A 1ZYRF 1O57A 1OKRA 4GO1A 2A9PA 2HQBA 3ISPA 1JDNA 1Z15A 1F4KA 1AWCA 2IYNA 4MAAA 3K1MA 1XSVA 3RVPA 1I6XA 1DBPA 2P5KA 1FP1D 4AIJA 2FN8A 2NUBA 3CFYA 3I09A 3OLVA 4QICA 1QPZA 3ZMDA 4QLCU 3J80K 1QNTA 2PKXA 3IDOA 5AONA 3ZMZA 3W6KB 1TLFA 2QUFA 3P9YA 1ONVA 1XGNA 3Q9SA 4ESJA 4KYWA 1FSPA 1I5ZA 4N9IA 4IRXA 1FC3A 2L18A 4UHKA 4GYGA 4HF2A 5ILVA 4M6YA 2ZAYA 4KIGA 3T0YA 3EDPA 4UVAA 3HK2A 2HQNA 1Z91A 2ISZA 3BROA 1IZ1A 4LDAA 5E8GA 2A9QA 1JWLA 1BOAA 3LUCA 3KP6A 4A0XA 1YO5C 1VLZA 3KCCA 1MZBA 3L9FA 5IEBA 3LUHA 4CDGA 5HQJA 2R48A 2OA4A 3DQVC 1PEAA 2PMHA 4LLLA 2ADUA 4HQMA 3K4HA 4MTDA 4EVSA 3LAJA 3EDCA 1D8JA 2WRZA 1BN5A 3ILYA 2E4VA 3HUGA 2NNNA 3A0UA 4TV7A 2LSOA 4KIFA 5KK1A 2VC0A 1FY7A 4AWXB 3TOBA 3E6BA 3RKXA 2RC4A 3GBPA 2WY2D 4IJAA 3CDHA 4MS1B 5E1WA 3RVRA 1KMIY 1QO0D 1LEAA 2PUBA 4G6DA 4UV8A 3WTVC 2MD5A 4WWHA 3ECOA 2DBBA 4ZMRA 2K02A 3LUAA 4G0XA 1JDPA 4IRGA 2PQ8A 3FMSA 1L5YA 4Y15A 1SFUA 1XB4A 3KP7A 2JSCA 2HS5A 4QPJC 3ILHA 2M8EA 4EYGA 2G9WA 2KKOA 1H9GA 1J0RA 4O1HA 2F2EA 2I6FA 3JAMZ 1A04A 2QU7A 2QVCA 3HSFA 2XASA 1YTYA 2EJRA 3QELB 1DUXC 2DPDA 1P92A 1JF8A 4PDKA 2ZKZA 2VUIB 2KIUA 4ENNA 1ZREA 4HX7A 4A6DA 2COMA 3J7AO 3JTGA 2HWVA 4P1ZA 4WK8F 3QU3A 3JVIA 3DBIA 4B8XA 3M9WA 4YV7A 3GT7A 4HNSA 3T6KA 4ZZLA 5LRSA 2R7FA 1V3FA 4G8XA 5ICFA 3OM0A 3WGIA 4BHCA 2QBYA 4QYWA 4Z2YA 3VNBA 4RAZA 3E5XA 1MB3A 2ZWMA 2Z5UA 1U0SY 1LJ9A 2WMYA 2E1CA 3VFZA 3WU1B 3HDGA 3FXQA 1GXQA 4E7PA 3HRTA 5E1ZB 3TOAA 2P5LC 2ZXJA 2QSJA 4D6XA 1XMAA 5DCFA 1XCVA 4IMIB 3HTSB 2FRHA 3GV0A 3R0AA 1KRXA 4EQQA 4O5AA 3K1NA 5JNVA 4KFCA 5CVUA 3BDDA 1RXIA 4I0BA 1FNNA 5HS8A 3CLKA 4N0QA 4HW0A 3V7SA 1SFXA 3M6MD 2MBFA 4MR9A 2EFQA 1ZGGA 3VEPA 4RWEA 3O3KA 3T1BA 1W25A 4I09A 3MMNA 2JVKA 1YMVA 2QQAA 5ABPA 1IF1A 1A0OA 3QX9A 3IRRA 2ZO4A 3HTUA 4D74A 4EJWA 3JAMK 2FEZA 5TPZD 3G1WA 3KZZA 4F12A 4HLYA 1J5YA 3J81K 4OLAA 4XXHA 3E6MA 4Z4GA 3KYJB 1QQAA 2YHAA 5L3FA 3RKWA 2ESNA 3TD9A 4RB2C 1HW2A 1M5UA 3CZ5A 5E8IA 2GA2A 2JBAA 4Q6WA 4IRHA 2FSPA 4G7ZF 2GX6A 1Z26A 3SZPA 1YK1A 2NAZA 3H5OA 2BEOA 1LDDA 3N4MA 2ZCWA 2DW4A 3DFGA 2IPQX 2Q2EA 2KYRA 3BREA 5ILSA 4AIKA 1IAWA 4KQCA 3Q7RA 3JTEA 3HSRA 5A2QZ 3L09A 1K78A 2STTA 5BS6A 5FWXA 4W5OA 1XWWA 2EK5A 3L00A 2VBZA 3B73A 3Q41A 4YGXB 2L3DA 5TQJA 2MYTA 4PCQA 5DCMA 2IP2A 2P4UA 2Q5CA 4YR7A 2K4JA 1FX7A 3GO5A 2NZUG 4JAVC 4UHJA 1ZRFA 4KK4A 1ZARA 5L3EA 5HVQC 3CU5A 1MGTA 4N0BA 5T3YA 2EFWA 1F1ZA 2E7XA 2J5OA 3PQKA 3V8LA 4KMFA 4OMYA 3IP7A 1M5TA 1DBWA 3ROUA 4MQFA 3KJXA 3PQJA 2QVOA 5H20A 3N97A 3F8BA 2DT5A 1TQIA 1ZH4A 3FDFA 2DQRA 2XAHA 2FLWA 3BRSA 3C6QA 1G4DA 3K1PA 3V4GA 4DADA 4L9NA 2MH9A 5BQ3A 1RI7A 3J81Z 4LE0A 2A69F 1K68A 1HSJA 4KA4A 3HJFA 3T8TA 4A6EA 3I53A 5HS9A 2ID7A 8ABPA 2RJNA 2BYVE 4P96A 2Y75A 4GNRA 2FBIA 4I98B 1ULYA 2PUFA 1ZHHA 3F6OA 4OG2A 5FLXK 3QEKA 2A5YB 2V0NA 4LRQA 4IVNA 4M6XA 3LUGA 3HS3A 4IF4A 3E3MA 2Z9OA 1R5HA 3R61A 2CHEA 1Z2DA 2PJUA 4M9XA 4ZYGA 1XMKA 1AB6A 2MSKA 1KYZA 3TGNA 1ODDA 1MJBA 2W57A 3RI4A 1B1BA 1J59A 1TNTA 3A10A 2E4XA 3M7GA 2VK2A 1NTRA 4GXOA 1APBA 3IHUA 4EGSA 5JNSA 1JFSA 4XSXF 4G0PA 3I0TA 2ZNYA 1K6OA 2XAGA 3BILA 3NHMA 1SD6A 1XHEA 5C5EA 2ISYA 1F4VA 3F8NA 4XSZF 2VOPA 4N03A 1REPC 3WTUC 2PFBA 5CVRA 1BI0A 2DQLA 1KA8A 4L9TA 4WF2A 5E18F 3D8UA 1MJ9A 3RVMA 2YPRA 2PN6A 4W5TA 4KQ9A 2EV0A 5IEJA 1XCBA 1ZG5A 3H5VA 4EYKA 1U2WA 5L3BA 3SZTA 4S05A 1O7LA 1J7KA 4P98A 4JB0A 2DPUA 4YG2F 2PUGA 4I7HA 2X4HA 2OZUA 4DQ2A 2WTEA 1YMUA 1F51E 5KQGA 1AB5A 1P6QA 3GW2A 4A12A 3LQRA 2GIVA 1Z6RA 5K5RA 4E70A 2V1DA 2O8XA 3BJOA 4JOQA 4Q4ZF 2WWVD 3I59B 5LHIA 1FP2A 3R4KA 4LK1F 2A61A 3IL2A 3QX8A 3AAFA 2FKAA 2VXZA 4FB4A 3RVOA 4OATA 4RY0A 4UUVA 5JS2A 3LAPA 1SD7A 3BRQA 2P8TA 1H9CA 1U04A 1BI2A 4FT8A 4ZZDA 3NEUA 2FLKA 3RVSA 1SRRA 3SQNA 2D45A 4YP9A 3MFKA 4EM0B 4L0YB 3MZYA 4LG0A 1U5TB 1QBJA 2JCGA 5JI6A 1DC8A 4UXNA 4HNQA 5EWLA 3MQ0A 2W25A 1DRJA 2FN9A 3SY8A 1O3RA 2CQKA 5HDKA 2M1BA 4LFUA 3KLNA 1FLIA 3KCNA 4HF0A 5TQ2B 5FWYB 3E5UA 1YYVA 2MH2A 2XUBA 2LIVA 2UXNA 2FE3A 5IT9K 3LUKA 2H09A 1EV7A 2KJBA 4G7HF 4EM2A 1GCAA 4HNRA 3DPTA 3LKVA 3RH0A 1XSXA 5ED4A 1LK0A 3IP5A 5DDGA 4Q48A 1KU3A 2VC1A 3E6CC 2FEPA 4MLDA 3EQLF 3KS9A 1EH7A 2ZMEB 2O6GE 2OQRA 2MYPA 3DKWA 2CWDA 3O74A 4GPAA 1IRFA 4EJUA 3M9AA 1K79A 1LB2A 4W5NA 4P9FA 3QLVC 3PFIA 2GAUA 3ZMSA 4A2UA 2HFHA 5H6QA 3RPQA 3EAFA 3KEQA 3CG4A 4YO7A 5AIQA 4EVRA 3RVJA 3OLWA 3TQNA 4RK1A 3F8CA 2BBYA 3NQOA 5BPDA 2Z33A 1M2FA 4DNCA 4RSMA 3HV2A 3GWZA 2Q0OA 3I5UA 2E4YA 3O2JA 4F3TA 1P2FA 4Z9AA 4Y9TA 2HPHA 1J9IA 4ZYEA 4KPYA 1USGA 3CTAA 1QP4A 2M45A 5LBQA 1A2OA 3QELA 4LB6B 4RY8A 3WG9A 1FT9A 2BV6A 3TO7A 4PZ0A 1W7PB 4OMZA 1T98A 1YLFA 4ETIA 1OXBB 4FHTA 1S29A 2F5FA 2ZFWA 5LHGA 1USTA 4WXMA 4RGUA 1WI9A 1Y0UA 2VE9A 3WGGA 3F6PA 2XKOA 3CO7C 2D1VA 4MR7A 3VB2A 2A9RA 2QVGA 1FWZA 2CD7A 2XGXA 3TKYA 4I2OA 3Q9VA 1EWVA 1WWXA 3CUQC 4NQWA 2O61A 2P7CB 4EVQA 4MHGA 1J56A 2E4ZA 4GYIA 2IT0A 1PUEE 1LDKB 1JFVA 5D2CA 1X3UA 5HLIA 3RVQA 1YW8A 5LEKA 1P4XA 5LEJA 1YS6A 1WRJA 4OLBA 3FMRA 2NT4A 2G7HA 2PAFA 3G85A 2P5VA 3ULQB 4G97A 4PICA 5FO5A 1D2AA 3E5QA 4P9UA 4ESBA 2FMLA 1KU9A 2RVCA 5DUKA 4ETMA 5FB2A 4G86A 4MS3A 2DTRA 2Z99A 3HRUA 3RPUA 2HYGD 3H6HA 2L19A 3O6BB 3LQQA 1Y1LA 4XASA 1FBUA 2DRIA 5CVVA 3V7CA 2PMCA 3L49A 4L85A 4MEXF 2EB7A 2MLKA 2K86A 1EFAA 1ZESA 1VPWA 4N76A 5HOOA 2TDXA 4EJOA 1MIHA 2RN7A 3RVNA 2P7VB 2O20A 3JVDA 1EHCA 4ML3A 2HR3A 1XGOA 3KP2A 2NYXA 3N6VA 4G7OF 2JVIA 1XDUA 4KK3A 4EYQA 3N75A 1KQ9A 2HDCA 2NS0A 4A0ZA 1U5TC 3HHHA 1TBXA 4RU1A 2RGYA 3GL9A 3Q7TA 1FYKA 5TQ0A 2VN2A 4A5MA 1RZRA 4H3KB 6CHYA 3GZ5A 4UV9A 4KN4X 2CYYA 3RVKA 3SNKA 3GYBA 3O2SB 1LVAA 2FQXA 2E4UA 1UB9A 2IDMA 4LG0B 4RGXA 1FFGA 1E2XA 1MKMA 1PNRA 1HXDA 4LD5A 3N8IA 1U5TA 1UHWA 3JW4A 5BRAA 2QV0A 2O03A 5CHYA 4YFNF 2W24A 3HEBA 4MPTA 1XD7A 1RXEA 4CXFA 4UVBA 4HZFA 1WSUA 1R1UA 4Z4EA 5L3DA 3CHYA 2FXIA 4ZYLA 4LGWA 4L5IA 5CYVA 5ICGA 4RK6A 4ASNA 1T6SA 2IKSA 1BJAA 2Q8KA 2ESHA 2UXXA 4RDCA 4EVIA 1HEYA 2RKHA 3KP4A 4RAYA 3KTOA 4PGHA 3LOPA 4MRMB 1F5TA 4RK7A 2PEXA 4HAMA 4IMJB 5KQPA 4U0YA 2JT1A 2VBXA 3ZN0A 3C97A 1DRKA 1OYYA 3CUOA 3I42A 1GVJA 1XSDA 3WODF 2FF4A 2L02A 3GWGA 4Z4HA 3FXUA 3O1JC 2OU2A 2BGCA 4ENMA 2JB9A 3IWFA 4LE2A 4G9YA 3NHZA 5CVIA 1BIAA 2ZJ2A 4KMUX 1ZGAA 4IILA 1ON2A 3R0JA 2AYXA 2DK5A 5D4SA 1NXTA 1PDNC 5BPIA 2EFOA 5FD6A 2HTSA 2P6SA 3F8FA 4KREA 4Z4IA 4JASB 1QP7A 4I0AA 3MEXA 1TJYA 1LEBA 5TPWB 4M73A 1USSA 4ZJPA 2FSWA 1LBHA 3FF5A 4MNUA 1NATA 4Z4CA 1DG9A 5E3JA 3LFKA 4N9HA 4LLNA 3LMKA 2A6EF 1RUNA 3LKBA 3O75A 2LF7A 3GZ6A 3EYIA 2JVJA 5KC8A 2XKPA 1JXSA 5FBKA 1Z05A 2VOOA 2FOKA 5JNTA 1DDNA 4BAYA 1HW5A 2RV8A 2QQ9A 1BM9A 4O1IA 4ENKA 2VT3A 4EM1A 5J8CA 4BNCA 4B09A 1TW2A 4Q5SF 2KIFA 3F73A 3T8YA 2XV4S 3F23A 3L6UA 2HKXA 4P55A 4U7DA 2QXYA 4MYRA 2MA3A 2EA2A 4XRFA 2HJ9A 3OV8A 4ON0A 4LE1A 3WTWC 1ZN2A 2F8TA 1D1QA 3P9KA 1D3YA 1PHRA 2V79A 5K5QA 4QYMA 3MYYA 3O2PE 2F5EA 4EGZA 5LLQA 4HX4A 4LB5A 1HBXG 3LUJA 3F6VA 3BWGA 3HXMA 4RKRA 1STZA 3I58A 3BJ6A 1FPQA 3EYYA 2F8SA 4CGZA 2EFPA 3MQ4A 5D5VB 1KU7A 2PL1A 1MDMA 4MS4A 2XROA 3T8RA 2QW1A 4LX8A 1NXPA 4LDZA 3EQ2A 4U0VA 4GGGA 2FXAA 4EUKA 3NBMA 3N0RA 1KQ0A 5HKOA 1KYWA 3EQZA 5HS7A 3F22A 1HQCA 5DLEA 1FZPB 3M9XA 3Q5FA 1BAPA 2M87A 5FFXA 2X7XA 1G3TA 4GCVA 3FMVA 3EULA 3M8FA 3IRQA 3GFJA 2DFIA 2GQQA 1NXSA 3CLOA 5C5CA 2OBPA 4MRMA 1JBEA 5A2QK 2WB4A 1K66A 3QLUC 3ELKA 3CS3A 1TQPA 4M72A 5JS1A 5JFRA 3HYIA 4LLGF 9ABPA 1U8TA 2HGCA 5EWJA 2FQWA 2LP4Y 3OQMA 2DAOA 5KQMA 2R4QA 3K2ZA 1RNLA 2IVMA 1D5VA 2VYCA 3CZCA 4H3HB 1QP0A 2QZJA 2EFNA 1KGSA 5H6RA 3RDIA 4IHTA 1PP8F 1QGPA 1S3JA 1OPCA 4QWQA 2FMIA 3BBLA 1UHMA 1ABFA 1L5ZA 4EY3A 1DPRA 2ACJA 5TRDA 1P4WA 3FGZA 1MVOA 4F11A 3I64A 4R8HA 3S2WA 3JSPA 3ZPLA 2MC3A 4HX8A 4KUMA 1EH8A 3TX6A 3W6JB 1O7FA 1JYEA 3H3ZA 2XVCA 4OOIA 3DLHA 2QQBA 2EWNA 4CICA 5D6FA 5CNJA 3FFXA 1JFTA 3HUTA 5GOTA 2TMYA 1ISSA 1GUBA 1P4AA 4OINF 1OYIA 1IW7F 2RQPA 1JL3A 1L3LA 3H92A 2K4BA 1U2QA 2FBKA 2PI0A 1ZITA 2VE8A 3SAJA 4E7OA 3WTTC 1P6UA 3LFTA 4AVPA 2RJOA 1CYEA
chains in the Genus database with same CATH superfamily
3GLHA 5FNZA 3V8NA 1EHIA 1K88A 3IVGA 4KJZA 3RK4A 2ANCA 4OBWA 2GR9A 4EH1A 1OH5A 1OROA 2P1DA 1LDNA 5DKFA 4OHWA 5IBPA 3MFYA 3KQPA 5I7SA 1WX1A 5IWAB 1UXGA 2Q3LA 3BJIC 3ET4A 3EG9A 2HRDA 2PRKA 4YQYA 2WE7A 3T9FA 1HKHA 3WU2C 3HCPA 2SKCA 1G8SA 4P4GA 3VU0A 3RYHB 2QKLB 3BXEA 1FQWA 3X3HA 1MJGM 1N2BA 1DE0A 1RAAA 3BS4A 4IHYA 3KZMA 4BV9A 3ZEAA 2ELHA 2K9NA 4HQ0A 4KPFC 1Z37A 5L9AA 4I9NA 3VVCA 5G0WA 4P58A 4B4CA 3NI2A 4BQAA 1GN9A 3OHPA 4PHFA 4XB1A 2M2EA 2H5LA 5HF8A 4JEHA 1T2KA 5KAMA 3UQZA 3MOSA 2DZDA 1OIVA 4GFDA 3VR0A 1RQXA 1EFHA 4OOFA 4WZZA 2CFIA 1P1RA 3KG2A 1RZ3A 3PUHA 4XCVA 5HF9A 1EVLA 2D5CA 4OEHA 4JLUA 4XFDA 4A9AA 1YVPA 1VQ8I 4ZU1X 4QTRA 5KYVA 3WTZA 1LBEA 1RFLA 1UIRA 2DSNA 2I8AA 1AS0A 1XTIA 2GEFA 2R1TA 3DEJA 1VQKI 4R40A 4UTNA 5EXDA 1M8FA 1J4AA 2XTMA 1GXPA 4IKFA 1EI9A 4MR8B 2CW8A 3IAM2 1JEEA 5EF6A 1LPPA 1ZQ1A 3C7DB 2NOAA 2VB6A 2OXRA 1JJAA 2ZROA 3L04A 3MZ0A 3QXGA 4JIMA 4PG7A 5D01A 3RYIB 4DCGA 3CNBA 3GUDA 1KE1A 4LIVA 2P3SA 2QRJA 1FNCA 5K5OA 3CF4G 4WERA 5IASA 4GQBA 1XNRB 3OIUA 1XQVA 3I2HA 2O4UX 1L4HA 2H4HA 3HA3A 5L3CA 1SUBA 1VDZA 2O6HA 5ILUA 2OSBA 3X44A 5BNWA 4BFWA 2NZ8A 5E6RB 3DJYA 5C52B 1QJ4A 2J3QA 2EARA 3GLIB 3P4UA 4J3JA 1U3FA 3O0TA 3FHZA 1DKPA 2E1RA 3PBKA 2NM0A 3HABA 4KIJA 3PQ4A 4UVHA 1U0OC 5FNVF 4MLCA 3KKNA 1JGGA 1FTZA 1HZZC 3DDSA 4L8FA 2JA7J 1VHQA 2IYQA 5F12A 2YINC 1SPBS 3HZRA 3COWA 5JCZA 2X6WA 1RYFA 3I9NA 2I7VA 3I39X 4YMVA 1FYMA 3T95A 3TNYA 1Z12A 2EP8A 3U7IA 4MDEA 4XSVA 3DD5A 1RZUA 5CVJA 4NU8X 1QV7A 2AVNA 2RI0A 2ZYUX 4CCNA 1CHNA 1J0DA 1V3TA 2QF7A 2HU2A 4FLFA 1MRNA 4KQKA 2Q0XA 1ZAOA 2D5VA 3OPYB 3HDYA 3ZY4A 4C06A 1W48A 3N5KA 1P1HA 3E53A 4ZXFA 3ESYA 3PD0A 4INOA 4D9KA 2EQ5A 2DY1A 3FROA 3M2TA 4LJ9A 1VDMA 4P82A 3TLMA 5I3CA 1H4QA 3PSIA 4K6FA 4C4OA 2XADA 3NTUA 4U7JA 1VLMA 3DCYA 1FUIA 1KORA 3GLTA 1L7MA 4U88A 3KB1A 3G0CA 1IEWA 1LX6A 3TYXA 4BP1A 2WNSA 3ABLH 2GH1A 2QXTA 4ZCLA 2ILVA 1PYDA 2XE8A 4PEVA 1D2RA 3E61A 2PQ2A 1T1EA 5EVCA 4TN1A 1A1VA 1B4AA 2HO5A 4UQOA 1RJ9B 3F7OA 3LNQA 1X94A 2A3NA 3OJCA 3BIFA 4WZBB 3UMMA 4XA8A 2IYTA 1XDWA 2C59A 2EKDA 3K35A 4WXYB 3HEAA 4LVUA 2IJLA 1R6TA 2K27A 2Z3YA 2QMHA 4EG3A 4HL6A 13PKA 1L8AA 1RADA 221PA 1VMIA 2CJYA 3OMXA 3QJ5A 4GR5A 4RHEA 5KI6A 2JFPA 3G0IA 1SPXA 4MYUA 3BZ6A 4DZJA 2M5WA 2QUAA 2PUAA 1VHWA 5DCLA 3HVJA 2OCPA 3DBRA 4QVKA 5IULC 1XZDA 2DYSH 4UNOA 3OEHA 2LYCA 3PM1A 1D6JA 2ANBA 3OOPA 2WJ4A 2ZIWB 4MRVA 3HO1A 1T6NA 2FX3A 3KUDA 1Z38A 4C7JA 1CF7B 2A6TA 1FY2A 2RCNA 2Q9BA 2FUG2 1BE6A 2RGBA 3EDOA 3HCNA 1U2GA 2OYSA 2RJ3A 2C7VA 4G1BA 4NX2A 4RY9A 4WOCA 1CEYA 3QU6A 2R7MA 1MLDA 4BV3A 2ZS8A 4YV0A 4RTKA 2E1MC 1HNNA 3HM2A 3V3KA 4L7QA 5FLMJ 2OGSA 3GN2A 4ZRMA 3FNEA 5LXTF 5JSYA 1UZAA 2O2ZA 2Z2YA 1WXWA 4OFZA 1SVNA 4XM1A 4FGZA 1NV8A 4DA4A 1IC8A 2QRMA 4BBAA 4IY1A 3V6LA 2QTGA 2XXAB 1U7WA 4WDRA 4WOBA 4IQGA 3FIWA 3UUWA 2G0EA 3MYRA 4D98A 1VKHA 2D1FA 4W1SA 2PJPA 1XMOB 1I2BA 4CR7A 1JWBB 1F8GA 1ODKA 4BNNA 3EETA 1EA7A 1OIWA 1TMKA 3Q3HA 3QLTA 2NXNA 4HTAA 5I8WA 3NVKI 2H65A 3C3XA 3L43A 4HDRA 4EJ0A 2RFLA 2GWRA 4KDPA 2QA5A 2QN1A 5FLXZ 4PY2A 1IJFA 1VJTA 2O2GA 5DBEX 4EA8A 1T5HX 4EG8A 4L4UA 4DR7B 4KGVA 4IZOA 3V7WA 1MQSA 2A9FA 2R6GA 2VRCA 1HWYA 4PR0A 4EKNB 4TMZA 4F3KA 5L51A 5JXIA 4N41A 3ENZA 4E7SA 1YRNA 4G4IA 1T0IA 4PAQA 4PRZA 4QX6A 4YVFA 1CW2B 1K61A 1MEJA 1N2OA 4KUGA 5DP2A 2X7JA 4G07A 3H1TA 5GJCA 2IZ1A 1XX6A 2Q7OE 1U0TA 3G5TA 3M6LA 1EYZA 1QX4A 4PAWA 5FBWB 2V7FA 3O8RA 3OTIA 1E9EA 3BXXA 2FZCA 3CUTA 4AKSA 3TXXA 4F06A 2ZBKA 4XX1A 5FUWA 2JIZA 4IUDS 4ER3A 5KKNB 1W36B 1J20A 3RREA 1AHDP 1Y1TA 3EXEB 4DV2B 4A2QA 2HVRA 3E18A 5DM1A 2DB3A 1ON1A 2QP4A 2O8NA 3EEIA 3EXIA 4W6QA 4EGJA 4ZIRA 1R1VA 1II8B 1JHDA 3W8FA 3IX7A 1BXRA 4OIOF 4GXNA 4KN7X 4HZUB 3I4LA 4PO9A 5BQXA 1W4MA 5J3LA 3L2OB 3I8SA 3RT1A 4B82A 1NI4A 5B5SA 4FZRA 3M6FA 4IO1A 5IC5A 2ASEA 4ODIA 2VIIA 3FMPB 1DBIA 1C30A 4BACA 2B5WA 3HGMA 2EYQA 4L3VA 1FSHA 3FMGA 1LUAA 1NPTO 1SA0A 2P9GA 3BVPA 2GCIA 5GJVC 3W2GA 3BSSA 3K4KA 2A3RA 1GPMA 4XARA 1AGNA 5JPIA 1MX3A 2Q6VA 2ZSHB 4NDAA 5IYCJ 2WK1A 5E4YA 5TF4A 4WVLA 3WVNA 2F62A 1H8HD 1NTCA 1PZNA 4FFBA 3M49A 3N2IA 2P67A 1N7IA 3EGOA 4N12A 4HAXA 3U48A 2DLCX 4KNYA 3EVGA 4GG1A 2O8CA 2HCFA 4B1FA 1SU4A 2ASVA 3CJNA 3BERA 3GMSA 1DXYA 4AMBA 3KQNA 2ZUVA 4DG9A 5E3OA 5DLYA 2K7LA 2QV7A 2EBHX 4OYLA 1H9TA 4CJXA 3OLXA 3ERMA 3K4NA 1FZQA 3L8ZA 2HTJA 1VCNA 1UT8A 4KLZA 3C3MA 2GRAA 1E17A 4ES6A 1X80A 1K27A 4OBEA 4QDJA 5DULA 2PX5A 4XNFA 1E4OA 1DDIA 3H2GA 3V97A 1NF3A 3OQVA 5DI3A 3ZU3A 2VBGA 2QN2A 1G5FA 1HLDA 1NNUA 2V55B 3LUPA 1TX4B 5FTKA 4JI7B 4GU5A 4MDFA 2W98A 3V1MA 3QG5A 3V46A 2JA8J 3GAMA 3D81A 4YIKA 1P62B 4WBNA 1RVV1 2B1QA 3O8OA 4O2RA 5HNKA 3TQQA 3G2QA 4CPDA 3NVAA 3PUFA 2RGXA 3GMIA 3HB1A 5EA2A 1GGEA 3NWPA 3M6UA 3G8AA 4FUQA 4MVJG 2KJQA 4LJZF 1PT9A 1LZKA 1SG6A 2AJBA 2XVAA 1MB2A 1WF6A 1HKQA 2OR3A 3Q2KA 4P33A 2PS0A 1U98A 3FTFA 1HQDA 5EKTA 5KCMA 1R2QA 2HRZA 2WHRA 2ZVQX 3SN6A 3OURA 3UTDA 4BBZA 3GDFA 4M3EA 2WBMA 4XKCA 1QUEA 2DWPA 2WJAA 2ZZKA 4G23A 5G1OA 3EZ9A 4NV0A 1LI4A 5DM6F 1J42A 2PFSA 3LIPA 4OMCA 1BCSB 3BB1A 3HGQA 3N0XA 1V4BA 2DOAA 1P91A 1T0UA 2EATA 3W9SA 1AN0A 4G0UA 4DY4A 4MDYA 4K2EA 4KT5C 4CIYA 2M0MA 1NMXA 2Q2NA 2L7ZA 1P1JA 2RGWA 3I9KA 2JK1A 3MMPA 4QWWA 3LP5A 3RJZA 3K5PA 1PTKA 4FE4A 1A8QA 1D6SA 4XN0A 1TVKA 3FM3A 4QG3A 1XJCA 1D5WA 1UELB 1QQ5A 1OOEA 1D0YA 5IPAA 2YWHA 1YOBA 4WOKA 4ND8B 4F2GA 5LQJA 4QUKA 5GONB 1AZLA 3NBKA 1CF7A 1ZSVA 3GD5A 4DJTA 3I4MJ 1NJ5A 1XQ9A 1ZOOA 4RF2A 2RHJA 1NT2A 4FD3A 4MUGA 1D4ZA 1RM5A 2PZMA 1YZNA 5DOVA 2FZLA 2YQ4A 3VX4A 1X8XA 2WFLA 3WMXA 3ETDA 1KK1A 2WADA 2G28A 2OV2A 3I6BA 3LYLA 4F8JA 4AD9A 3UFXA 1ZN9A 1JHZA 3DEWA 4KKXB 4XFKA 1XO1A 5HLHA 4YWHA 4E3ZA 5CM8B 3CF2A 5LZ9A 3UKOA 5G41A 2HM7A 1UPXA 3AM5A 4ZH4F 2QRVA 3W2EA 4AY6A 1WW2A 5K7ZA 4ZGGA 1VQNI 1X1EA 3EJ6A 4OSOA 1FB5A 4PNPA 1MW9X 4C43A 4KICA 1U4OA 1DMRA 2MYUA 3FWEA 2O2YA 3HKDA 1UKZA 1RWOA 3L0PA 5FI0B 4B3FX 2PD3A 4YP6A 4ALMA 4CTOA 4M3FA 3BWVA 1T5DX 1VKRA 3ECSA 3IODA 1XC5A 2XLCA 4EJVA 2L2QA 1E2IA 1QYIA 2GCOB 4S0HB 2WD9A 1I5EA 1GL7A 2Q3BA 2VP0A 3F6BX 4IZIA 2I5UA 4NE2A 4DC9A 3FOFC 3GP8A 1JAHA 2ZSAA 1GAEO 3FBWA 1W5EA 2QTMA 1OWMA 3BTOA 3II6X 1ODFA 5LB2A 2ONJA 1UBLS 1P72A 1JLMA 1NRXA 3VC3A 5E0OA 4CMBA 2A59A 1NMYA 1TK3A 1O6ZA 1VP3A 1A77A 1DADA 1P3Y1 1IQ0A 1CQIB 1Q44A 1QIJA 4OYYA 4D3FA 3RC3A 4F2WA 4DLZA 4JT4A 3Q0WA 1H4SA 2EINH 4H1TA 1XLWA 1J0EA 1H5UA 1XEWY 3M4OJ 1GCOA 3H3JA 1QVAA 3NTLA 4NBWA 4Q9JA 3VZCA 5GVSA 3U60B 1MKYA 2BHRA 1P18A 2Y0SN 3KQKA 2BEUA 3ZS8A 2PU7A 4DTIA 2CCKA 3PE6A 2ROQA 4HDNB 4IIYA 3S8EA 1R36A 3KVRA 3TSOA 2WKPA 4F5DA 1RYMA 1FMVA 1WZIA 3OPQA 5H80A 5K0TA 3HCFA 4MW6A 3SKVA 1M10A 2ZSFA 4PX3A 3GZNB 3SX4A 5FHQA 4WESA 5C1PA 1IO2A 3F49S 2PX0A 4NCKA 3IKTA 3MLBA 1B59A 4AO6A 1HR0B 1JHFA 2CO5A 2HT1A 1LVKA 1J2XA 2O3SA 4ZVTA 2P6OA 1EXWA 3B3AA 4RIIA 3G0HA 4MEYF 3CO6C 3O1IC 2REQA 3P32A 1H6CA 1ZCAA 4IQ8A 3FXMA 1USVA 2Y4OA 5AK5A 3FF4A 2CFXA 1CF9A 1BBYA 3PFGA 2VT6A 4FEYA 1I4OA 3PSHA 5IKEA 1MMDA 3ESWB 5CXUA 3IDSA 4HS4A 3KHTA 2L0XA 3HR7A 1JBKA 1JEJA 3AYZB 2H2GA 5ALMA 2E6UX 4C3VA 3CQZJ 4EG5A 4MHTA 2QMEA 2X0IA 4C0BA 4BHPA 1IHDA 3ZHYA 2BVMA 4ZREA 1PVVA 1F4LA 2YVKA 3REFA 5F3DA 3E27A 1V5IA 1GNVA 1RBYA 2O2DA 3A9RA 3SYNA 3L7AA 3RAJA 3IWZA 3V2UA 5B1BH 2IBTA 1POGA 2XGDA 2F48A 3PR3A 1BMQA 3QRFF 4JK3A 1U0FA 3CN9A 2C4WA 2C5BA 4AJ9A 5FPKA 4JXZA 3ITEA 3WB0A 4L8LA 3UAOA 1NHGA 2Y67A 1YZHA 4MUAA 5EC8A 4Z6YA 1MB0A 2VRBA 1YB7A 3T4PA 2C9OA 1TYBE 4V0OA 1ETYA 1MOQA 1U8YA 2QCOA 1JT2A 3FR8A 1IYZA 2E89A 4KGZA 4EYEA 2DA3A 3HKCB 4DSOA 1YL7A 2WUFA 2QHXA 2I03A 1HKSA 2C99A 3MINB 1O9HA 4DCCA 4HYEA 4URYR 3IP4B 4UUTA 1ZCFA 1IGNA 1B0PA 1KVSA 4HADA 4KP7A 1C9MA 5B7QA 4OXQA 2YX7A 4E7KA 3KZNA 3NHUA 1EG2A 4J2HA 2R8ZA 4J0JA 5K6TA 5LQCA 3ZWAA 5LDDC 4AF8A 4IH4A 3MOIA 2A4KA 2HA0A 3NDJA 3KXLA 3T0IA 5KCZA 2VL7A 1C3EA 3H5WA 4KODA 1T1IA 2QZZA 1N1DA 2HH9A 1KZ6A 1UPTA 2YXLA 5ECDA 2ZE5A 3D5QA 4XGQA 1HF3A 3EWNA 1SRQA 2D7CA 3D0OA 3DP7A 3R7LA 5F2OA 3QAHA 3K0BA 4F3NA 2LG4A 2BJWA 3NW9A 4OIPF 5BURA 1DP3A 1SKQA 4EHJA 4MGRA 3B8EA 3S99A 2J5XA 3O8QA 1U0RA 2IOHA 3DKKA 1AVTA 3KJGA 3DDCA 3PS9A 5BQ5A 3TO5A 2IF0A 1E0JA 1Z34A 3V8VA 1IC6A 2AOTA 3DE3X 2Z04A 1NXXA 4U8HA 5D1NA 2AI3A 4GPEA 3U49A 4AMUA 1UBKS 3CZ9A 4CEHA 1B2LA 2QYSA 3ZMUA 2GEKA 1APLC 1WXFA 1XZKA 3O4HA 1ETHA 4Q1DA 4ZQGA 1MHTA 4KIWA 2B2NA 3VSKA 4DMHA 2C8KA 2IQIA 4QXQA 1WDWB 3NKFA 3F7NA 3CXUA 5JXHA 3FZQA 4YPOA 1ZQ9A 3ZKAA 1ERDA 2D8AA 3IIEA 4KN9S 1OWLA 4OUDA 2NU9B 2DK8A 4XQFA 4NS4A 2IFTA 1FLDA 1SHUX 1Z16A 4HEQA 5T64A 4BJ3A 1MO2A 3KKQA 1H0SA 1Q1GA 1G8GA 5FOWA 2VEDA 3BR2A 3IHKA 3PHBE 3GIDA 4QO8A 3GFOA 1T5IA 4TXHA 3UEOA 1WOYA 1PBNA 2CVFA 4M6VA 5F64A 1NMEA 3BFXA 4W1PA 5EIFA 2H6CA 2FR8C 2WVJA 3UUEA 4AZWA 2HXYA 1IBSA 3DO6A 3LGSA 1R9NA 3KKOA 5IBQA 5ERIA 5IVPA 3A6LA 3PFBA 4Y2GA 1PR0A 3Q6MA 5F21A 1UMCB 2IU4A 5GZ6A 4AWAA 5EHIA 2Q3EA 3MBKA 4OXRA 5ALTA 3ASVA 1ADCA 1I33A 3IUEA 4KR2A 2VJQA 2PNFA 5KVCA 3ROPA 2J3EA 1F14A 2G04A 1BQ3A 1N6RA 2PZLA 1KAQA 3D3WB 3FKSA 2QX4A 1KPIA 1RQRA 4MS3B 5BMVF 1FMJA 3CUYA 3HPHA 3HRMA 3UAZA 5KVAA 2WG0A 3MCAA 4K9KA 2OFFA 1YI1A 5I7AA 1GCGA 2H2FA 1J8VA 1O95C 4EPTA 4CSWA 4P6VF 3OFNA 1SQ6A 4PS0A 2CLDX 4UBKA 3TGWA 1R10A 2O57A 5JAUA 4ASUA 3AY0A 5B5EC 3WRXC 3VSDA 1GSOA 1SXHA 4ENTA 1XDZA 1U9NA 1UKCA 2XXJA 3OIDA 1P7IA 4FYIA 4QPQA 2HR1A 1P9OA 1UBSB 1CS0B 4TUYA 3TXAA 2I7XA 1ST3A 2RGGA 2TS1A 2V5AA 4M87A 1W4CA 4PSWA 1JJ8C 2GIZA 3AVPA 3JW8A 2XWPA 3CGGA 1EQ2A 4EYOA 4AXBA 1IMOA 1UBNA 2HQOA 4JKOA 1K89A 4QDZA 2BYTA 1KJ8A 2I6XA 2J6CA 2P2ZA 2JHPA 3ZU6A 2RHBA 5IWCA 2IXTA 4ZHQB 5K0FA 3GLGE 1P2TA 3N8NA 2PRZA 1BWRA 4Z9BA 3RC8A 1ORKA 3OYLA 3ZHBA 4EELA 3ER6A 5IOYA 5GAJA 2ISQA 4NJMB 1JLLA 2JD0A 1Z17A 2QMQA 3OFND 3BAZA 1KI4A 3DMFA 3NATA 3U3MA 4A0RA 4UREA 4KFRA 3FAKA 4RB0A 3AX6A 2AW3A 2V7BA 2HOSA 4M86A 3VHXA 2RGDA 5HA5A 3O90A 4KW7A 3OKPA 1COWA 1DBRA 1EK2A 4WKCA 1UXJA 1JYSA 3FCEA 3TTYA 3CRNA 4A8JC 4C0LA 4F60A 1I3MA 3WRVA 3Q3SA 4KXUA 4FX4A 1RMYA 2W5UA 2BDUA 4YXWD 4IRUB 5J1YA 2YUSA 4GW3A 5AOCA 3RIXA 4Z99A 2RI6A 1NFRA 1XYYA 3I2YX 4QFDA 1ZWLA 4NBTA 2QTLA 1U2EA 2VPYA 3NNSA 4J94A 5EPEA 1XTVA 4F8YA 3SVLA 3RKYA 4I9UA 5DM70 4L78A 1FOKA 4Y6QA 3HOTA 3SK0A 4ZEVA 3AHHA 1YRYE 3TMOA 2HI0A 2OWEA 1I3AA 2VCYA 5G3YA 5DGCA 4HWTA 3P1JA 2WTNA 1JU3A 4I36A 4JQCA 2RE8A 2V0GA 5KU7A 3JQFC 3KSDO 4EUHA 5BR7A 1OVGA 4GDFA 3RAPR 1BHO1 1KQPA 4IFTA 1JP7A 2PVSA 4ARVA 3OC0A 1XEFA 1E3TA 4URWR 3EUWA 2GGSA 2J59A 5JARA 1A6QA 4OBBA 4KN6A 1QZYA 2FZWA 5TT0A 1LLQA 4F04A 4Y0NA 5LNK6 2EV6A 2HWXA 3VDMA 2BFDB 3RSNA 1CJSA 5FDFA 4HATA 2ZRNA 4B6JA 3ADBA 3ZDAA 1A4UA 3H36A 3KYDB 1RKQA 3WE2A 2R62A 1C1DA 3GF2A 3O4IA 1PNOA 2C61A 1J2JA 4V2UA 4JKYA 2CBXA 1T26A 4M99A 3FNBA 3GEZA 5KSYA 4KJXA 3E1SA 1WTAA 5DYWA 1Q19A 1U7UA 2FH5B 2XXBA 2FEWB 2A4MA 1P5ZB 4L1KA 2JLUA 5KVRA 1JUPA 1YZGA 2DM6A 2OENG 3UICA 1BDIA 5L95A 2JHAA 3B02A 4M71A 4BNYA 3A32A 3L0ZA 4YCSA 5B58C 1XS9A 1QONA 3O84A 3UUGA 3BF8A 1AZTA 1LCIA 3EISA 2PMFA 1L4LA 4IXMA 4MRRA 3FIUA 4DJFC 5CA1B 2QNRA 2GPBA 2QD2A 3CCBA 3FH0A 4OGGA 4WWCA 5AW6A 3ZVKA 1O8CA 4G8CA 2F90A 1RWNA 2E48A 2QL7A 3JASB 2Y69H 3JARB 4ZCRA 9ATCA 1IPEA 4Q66C 1Y1VJ 1PS0A 2GZRA 4M1OA 4AZ0B 3PKJA 1EFVB 3CEJA 3I6IA 3T1YB 3H5TA 2FNAA 2CLFB 1AT1A 1RXSA 2DH5A 4NC8A 2CUTA 3IHTA 4RFSA 2Q07A 4ACAA 4BGUA 3H87A 3O9ZA 1KSJA 4IJKA 2C4NA 1FFEA 4HGNA 1J2EA 2E71A 1JNXX 3SE7A 1K3FA 4NB5A 4ZCQA 1MAWA 4BNKA 2Q7XA 4G5XA 4K6GA 4PLFA 3ZR4B 5I7WA 2FJ1A 2A57A 4FGWA 4PO8A 1Z0JA 2D0IA 4XAQA 3K6RA 2YXNA 3EGWA 4AF6A 1BVYF 2FF7A 1WJFA 2JA2A 2P0WA 2YJZA 3UKJA 4A4DA 5FUMA 1YONA 3ADDA 2TYSB 3S1SA 1NOJA 4LSGA 3SYKA 1LVUA 3WWYA 2HQRA 5ALXA 5B2EA 3OU2A 3I62A 2VKDA 1PS8A 3U4QB 2L54A 5AXDA 5AI4A 3VSLA 2BBSA 1P8AA 3H1EA 3SJZA 4E6KG 2OD5A 1Z8FA 3FOAA 3PITA 4URUR 4OAPA 2H1SA 1V5EA 5DFAA 5K3OA 1FCJA 3VYRB 4MQFB 4DVGA 1JKQC 4GKBA 3ABKH 2VDQB 4BE7B 1HGXA 4MVWA 2PXHA 1NKTA 5A9SA 4GPBA 2QZ9A 3ZK9A 3QE3A 4MR7B 3EEQA 3ADPA 4RDXA 1L5SA 3MSXA 5BQTA 5EJ4A 1GG5A 2XPCA 5IP6A 3G4SI 2BR5A 5AYVA 3M70A 3RF7A 4JYAB 2HA3A 4I1PA 3ZN2A 3IMGA 2OKCA 3HVKA 3THWB 4KBFA 4MO9A 1ESMA 4OKNA 1FMCA 3LBIA 3VR6H 1I6WA 1UBMS 2O05A 4S04A 2POCA 4IIBA 3K3PA 4JX4A 1YJCA 4CYDA 2YSRA 1KMHB 3CMAI 1R64A 2ZWOA 3MJSA 2AKAB 3OLZA 4KWHA 4KQMA 3LZ6A 4YACA 5A3JA 5KNLA 2ID9A 1D6MA 5E2IA 2XUIA 2YN2A 3S32A 2IYUA 3DTTA 1KZ4A 3DPLC 2BKAA 3R7WB 2YIVX 4CIWA 5JZ9A 2RD2A 2R93J 3PPXA 1OI3A 9LDBA 1BDHA 2CHVA 3KETA 1T6YA 2WMNB 3VYWA 4CTJA 2UZ1A 4D3SA 4WNYA 3L8GA 4AI6A 4QQFA 2ECBA 1VLQA 1I6LA 1NN5A 2Q49A 1FXSA 3BXHA 3FPGA 4FMDF 2GI4A 3EF1A 4Y2SA 4AYBN 4KGXA 4YGYA 5DSZA 2WVGA 3RS3A 4ENJA 1P2SA 2GHIA 4EWLA 2FPIA 4GT1A 2D59A 1AU7A 2H08A 4DL9A 3T61A 1CX9B 1WW3A 4UPEA 1EFRD 2OCIA 2CXQA 3GFQA 3T1QA 3LY7A 4K9DA 2J5PA 1OMIA 2XZTA 2PIDA 4F9TA 2NTNA 2K3FA 4BKRA 1E1CB 4BL0B 1AQIA 1OGIA 2G72A 3P7NA 2F5CA 4G25A 1E3LA 1G21A 1VYHA 1SVLA 3WLQA 1PGOA 3OOYA 2G1KA 3BD8A 3JR3A 4ZWNA 3WGHA 3AEQB 4NULA 3D6UA 4WUTA 5IHXA 5AW9A 1JJVA 1G1AA 1V25A 3VPXA 4ICIA 3E7LA 1JKXA 4IJUA 3UJPA 5M04A 4MLZA 4PBTA 3VHRA 4A2CA 4DIMA 2WTXA 2ATIA 4TV9A 4DDMA 1SVIA 3G6EI 1W49A 1XCOA 2VQFB 4S0XA 1RHQA 3ABMH 4N54A 1ZLJA 1I9GA 1U8FO 5F33A 3JU3A 1BHSA 1K5HA 1ZOPA 2VP4A 3FJOA 4FASD 3BH6A 4ALKA 5T4EA 1AGXA 3DXJF 2GK6A 5DDIP 3BTVA 1Y6ZA 5DN6A 2AK3A 3ULKA 5BWOA 4JEUA 4IX7A 4LBVA 4Y1RA 3TFOA 3S2HJ 1AOXA 1A5SB 5EP2A 1ZVKA 2CLCX 3U7GA 1XZGA 3IAHA 3PIRA 3AR2A 4CFZA 1YW7A 5IJXA 4BBPA 6LDHA 3EXHB 4MWZA 5BORA 5AUPB 2AZDA 2PO7A 3ICPA 4CM9D 5CCXA 1T1GA 2G9RA 2PT6A 4B7ZA 3TIFA 2DR2A 1AHIA 2Z0MA 3OP4A 2ZTUA 4RZ3A 2HWUA 2QGNA 2XKAA 3AJ9A 2VG8A 3HPQA 5EP1A 4NCAA 4ENUA 4UE2A 3OOEA 3OE5A 4HV6A 1JG7A 3K9BA 3DMYA 3I9LA 3RU9A 2W7NA 2AO9A 2H48A 5LQAA 4ALNA 3GLLA 1XHFA 4ALIA 3GCXA 1YJBA 2J9GA 2P9FA 3RVLA 2BMFA 5H4HA 1FJHA 3GHHA 4BO7A 4NQRA 2YWDA 3L07A 3LC1O 4BCCA 3UJ7A 5FO1A 4BLWA 5H68A 1CUDA 3AB3A 3KQQA 4FQ7A 2FFJA 3I8OA 3VSBA 5L4LA 1T9GS 2X9LA 3DXFA 3IUOA 1SUDA 1UOOA 2P2CA 4RFLA 1EE2A 1R5JA 2CJWB 5TE9A 3VKVA 4U7BA 4HDVA 1Z3IX 3E15A 2XWBF 4KAAA 1GQFA 3L7IA 4KPUA 1T9DA 1W75A 4M1EA 3S1QJ 3TOXA 1Y3IA 1P4HA 2GT1A 3DE5X 1RLIA 1XVTA 4QRHA 3S70A 1BWPA 1P1BA 5A62A 3MJVA 3BGVA 2QT9A 3SIPA 2Z58A 4A3EJ 2HD4A 3B89A 2YRXA 2CQ7A 2OZLA 2M8GX 4GM4A 2RG1A 4O2BF 1XGMA 5IT9Z 1G3UA 4H60A 1JGTA 1AV6A 2L7MP 4BWFB 3O2NA 2QTCA 1A9OA 2B4TO 3CRRA 2NVUA 3KDPA 5EHGA 1NR5A 1TVMA 3TZ6A 3LVBA 2FP4B 4M8LA 4AKEA 2ZITA 3OSFA 3CF4A 4HX5A 1JTXA 5LDGA 4JT2A 2V1XA 3S8YA 4MW1A 1IN7A 2BKUA 2R00C 4MNTA 1FOXA 4BMYA 5BNZA 2CH0A 1WEKA 1K97A 3KEFA 3OJWA 1M2VB 2MMGA 2XD9A 4OI2A 4YMLA 1V2HE 3WRWA 4F7ZA 1SXIA 4ROTA 3WLJA 4O6JA 1GD1O 1JEOA 1MG5A 4QC2A 3TFWA 4RTNA 1XZPA 2D2FA 3ZV7A 3FPAA 1YRWA 5B4VA 3QUBA 1G3YA 3UCFA 1ECFA 2GSWA 4IS3A 2IWHA 2I6UA 1PUJA 1P1KA 1ABEA 2BBWA 3HKCA 3JSXA 3KQSA 3O4RA 1EBBA 1QOPB 1IUFA 2H0QA 5F1RA 7MHTA 2R8PA 4MWOA 1N33B 3N28A 1UOEA 3TTXA 3DZKA 2H9YA 2AZMA 5JRDS 3ED1A 5JZOA 1T36A 2XD4A 3ANNA 5AUOB 1CDZA 4M3NA 1OASA 3EXG2 3UJ6A 1IZ0A 4CCKA 4IHXA 2FDXA 3E5NA 1DRVA 3IO5A 3RDPA 4EDFA 3C7AA 2JTVA 5IJZA 1C29B 4PZJA 5JD4A 2NV0A 3D3NA 3FK6A 2P6NA 1D8TA 1UMBA 1ESCA 2O3RA 4PN3A 2J0UA 5HZKA 1MX9A 3DEEA 3H2SA 2A3SA 2IVFA 3WK5A 5KNCH 1UXHA 2MLGA 1KDPA 1HLGA 1QNLA 1ECCA 3BT9A 4Y6PA 4ZC8A 2ZXUA 3ML6A 5EQTA 4OQFA 5EJIA 4HDUA 1V43A 3RUDA 4CCOA 1R58A 5KQRA 3DCIA 4JJZA 4F84A 5KNBD 3PEUA 2C84A 3M6VA 3TNJA 3W6VA 1YR1A 1DAMA 3W6UA 3FK7A 2GLOA 1AO3A 2W6JD 2WZQA 2LKCA 2P68A 3H1FA 1DGWY 2CNBA 1IM8A 2AHOA 4P3YA 1FDSA 2RREA 3IUPA 4CMKA 1U1EA 1DOHA 1L4FA 4CCJA 3OPXA 1AQUA 1DC4A 2X15A 4QXRA 3OSGA 3I04M 3TIVA 4BXOB 1YX3A 4US2R 1JIXA 2PT9A 1DKUA 3OO0A 1MOZA 1WKMA 2BTQA 3ASUA 3BGSA 5FGMA 3CNEA 5E1XA 2YBEA 4JB3A 4X1YA 4YIFA 3OY9A 5EJMA 3SR3A 3V7NA 3OCWA 2WAQN 2FJPA 3EZXA 2DDAA 3DEUA 4N82A 1JE1A 5DXFA 5FUVA 3RG2A 4B6OA 4ATNA 2O7NA 5E17F 2QE6A 4QGBA 3IP1A 4G4JA 3J80Z 5GADl 1T6XA 3SXYA 3PNSA 1JKPC 1NSTA 2A9VA 1QMPA 2FFAA 2WHQA 4D6PA 1RM3A 2VJ5A 4IXAA 4XBFA 1C2TA 2VQHA 2A07F 1VL1A 2C9DA 3INGA 4LQ4A 4WKNA 5A3QA 1NVMB 1QOQB 2J6HA 3K31A 1NU6A 4XR6A 3QU9A 3EEOA 1PG2A 2OQIA 4MGHA 4XD7D 4CGYA 2FUNB 2VN8A 3ZNNA 1X2BA 4L7VA 1WR8A 4DR6B 2CE2X 4Y2YA 2C5FA 3U2QA 3ABIA 3D2LA 3LUFA 4ZAVA 5T7BA 4I7EA 2MSWA 2NTVA 3L3BA 1E8DA 2G77B 2F6RA 3K53A 3WTSC 1JE8A 3I30X 1YI8A 1QKKA 1NYTA 2IOQA 2PT7A 2VSYA 4MHSA 1PZXA 2DQZA 3LSJA 2XMRA 3SJBA 4AN0A 1C7IA 1BGWA 1DCFA 1TCBA 3ESRA 3O8QB 3OETA 4QJ3A 1X2NA 2M9HA 4A3BJ 2O14A 3TBIA 3O8CA 4JVSB 2XB4A 2YIDA 2OQGA 3GFGA 3VDNB 2GBFA 2B5VA 3DMTA 3K8YA 3Q3GE 2XOKA 3ZCVA 5JQGF 1U5BA 4IXDA 2FE4A 2OVBA 1ZRDA 2VDKB 5EEHA 4AMGA 3J7AC 5DM60 3HMQA 2ZBGA 2G25A 3L0YA 2DQKA 1E2LA 2DJNA 2FGJA 2PMUA 4Y2RA 2DN0A 1KP3A 2JIDA 3U9SA 3U56A 1MNEA 2AQ8A 2P0YA 3HN6A 4U7PB 1UXIA 5EE9A 5KHAA 3ZCRA 1DZ3A 3CVJA 3UFXB 2VKQA 5JSHA 5C2JB 3IV9A 3HNOA 2CSOA 1BC8C 4DWWA 3MF4A 1FRQA 5ANRB 4Z5XA 5IZCC 4HVAA 1WJCA 3GRKA 2RAPA 5BNTA 1MRZA 1E2GA 3QIAA 3NUQA 4JGGA 3PUXA 4BU1A 1NR7A 5KC9A 3HWX1 2ZKIA 4KYIB 5LP6A 4C5AA 5DNUA 2ZJ0A 3EYWA 2HCBA 3B5EA 2G7UA 4ZJZA 4YP9A 1WJAA 2I4IA 2ZEJA 4LI0A 5HIIA 1ZGWA 4U7WA 2V4MA 3DWGA 1RD4A 2X0DA 5HMMA 4RKWA 3WZLA 5A71A 4U7FA 3VXKA 3SC2B 2A9PA 3ZKWB 3OZAA 4PR3A 4BFCA 1WB6A 2HHLA 3WLLA 1SVSA 1TD9A 2BY1A 2WM2A 3JCUC 1AWCA 1SOVA 2IYNA 1XSVA 1Z4PX 1AHNA 4MAAA 1ANKA 2KW5A 3W4KA 5C5IA 3I9V2 2P5KA 1CZHA 2FN8A 3I34X 1W2WB 2NUBA 4IGFA 5FWNA 4BDTA 2DOKA 3ZMDA 3THSA 2GTPA 2E0IA 4TTQA 3RFFA 2XMBA 3FTEA 1U9CA 1QNTA 3BZWA 4L22A 4F1JA 1PT5A 2Q28A 3BH0A 3ZQQA 1GLVA 3ZUPA 5I9LA 2I6QA 2IQ5A 5ADWA 4KYWA 1FSPA 1DIGA 3KBBA 3PC2A 3OYHA 4NHOA 4R2WA 3SLKA 3RTCA 4AL4A 4BNLA 1M66A 3RSOA 3FKQA 2BC9A 3C6BA 2NQ2C 1JT0A 4Q4HB 4KIGA 1T91A 1XYGA 4JCCA 2MABA 2C07A 3EDPA 4UVAA 1GTVA 1WOMA 2X9QA 3BHMA 3CNLA 3EAQA 1P0FA 2ZBFA 5T41A 3T3MB 2ISZA 2WVHA 1ZSNA 3ZXSA 4FSHA 1DWOA 1JWLA 1BOAA 2OZKA 2VHWA 3PVSA 4NY1A 3K6SA 5IEBA 9ANTA 2ZB8A 3VZRA 4PGFA 3C1UA 4KR6A 4D26A 3KPWA 2JGFA 2JH3A 4QM6A 2R7WA 5FROA 4PUSA 2OA4A 3DOJA 4CF7A 1MAAA 1THGA 1YRAA 4J9UE 5JH7F 2ADUA 3CW9A 4HN9A 1WWKA 1UFQA 1J39A 3KVNA 1Z5GA 3D1NI 2HXOA 1WXEA 2VSFA 3OIWA 4Q3OA 3LAJA 2Y9PB 4FFBB 4L07A 4Z1MA 1Q6ZA 1X9HA 3G8BA 3NIFB 1BN5A 1PIWA 1BJKA 2E4VA 3U17A 1DHRA 3U9LA 5DM0A 4FXPA 5B3AA 3A0UA 1EGQA 3AF3A 2HPMA 3PXAA 5E4FA 5KK1A 4AWXB 5A6SB 1E2KA 5H9VA 2R1VA 4CMAA 4YHBA 1UC8A 1V1MA 2JCVA 1SXPA 3TIIA 1Q0HA 3WR5A 1I2AA 3RKXA 1JSXA 2GBIA 5JMTA 2RC4A 5A6SA 3M1AA 1BXGA 3JD1A 3LZCA 2X4GA 2IHZA 1XBTA 2YX1A 3IAXA 3O3NB 1Z8NA 4IJAA 2BFAA 1TTTA 4BV8A 4MS1B 1PL8A 3QX3A 4YRNA 1EJ6A 3LW8A 4KC0A 3OZUA 1O6FA 4BCDA 3BA6A 1O58A 3UT6A 1MO6A 3VSCA 5IS2A 5IZ4A 3E9YA 1V55H 1BE8A 4U0KA 5IVHA 3OUZA 1JQBA 3WTVC 2OK7A 4FT2A 4RGQA 5EYPB 4WWHA 5TMBA 3A01A 2OVFA 3Q3IA 1YTLA 2PX8A 4HWOA 4BU0A 2WB2A 1OILA 2G63A 2EH3A 3OWHA 2C3OA 4M7RA 4OO3A 1JDPA 4QLAA 3RV4A 3GJ5A 4A1OA 1A7AA 1NW6A 5A06A 1RC9A 1DUVG 1ZH0A 5KJ6A 2PQ8A 1K6JA 1HV8A 4FLMA 4KQ1A 4ANFA 1WZUA 3FUVA 4UBLA 3LWZA 3JZAA 3CR7A 4M83A 4JBYA 4MW9A 4OKSA 2GLUA 1NYLA 4MCJA 3U3XA 4DGSA 1AK9A 3ILHA 2EZ9A 2ZYSA 1N1MA 1K2WA 2VBFA 3F6RA 4FHFA 5EJAA 5TVGA 3MZ8A 2G9WA 3TCKA 1XLVA 4EG4A 1H9GA 1PD1A 2YU9J 3MRSA 3ZE7A 4D9HA 4H7HA 4GOMD 4RKEA 1IAVA 1XKTA 2I6FA 2EFYA 4IMPA 3JAMZ 1VHLA 2QU7A 2QVCA 5C34B 5DSTA 4AG3A 2XTJA 5FA8A 3NS7A 4BRSA 1ICEA 1K9VF 1DSSG 4J16C 3QELB 2ZSBA 1BA3A 4Q1FA 1LWNA 5FPYA 4TVKA 1LRKA 1N0VC 4QOIA 4QZVA 4UQLA 3ZH9B 2YV2A 2M34A 2DPDA 4LF7B 1P92A 3KXPA 4PDKA 2ZKZA 5EZYF 2WKQA 3I73A 5KMGB 2ZYTX 2A6PA 1QDEA 2M9MA 1G4HA 5GADJ 1SVKA 5KYYA 4FDUA 3AMVA 3JR9A 2BFNA 3UW1A 4Z7OB 2OP1A 3IBYA 3JTGA 2XECA 2XMDA 2NSLA 3B3GA 3G8CA 1LLFA 1KMQA 2YZGA 1G20A 3ZGLA 4CKEA 1Q0TA 4MV9A 2QRZA 1ZK4A 2VNJA 3NAQA 4MGZR 4B8XA 4LZJA 3UV3A 4ZI7A 3BWBA 4HNSA 2XT6A 5K4AA 2IUUA 2DPXA 3LQ2A 4ZZLA 1OXUA 3PLRA 2FLVA 3GVPA 4GL4A 2E21A 4AX8A 2PDAA 5A2GA 3KALA 3PFCA 3VTKA 3OM0A 3TZLA 3BR5A 4ZC1A 3WWCA 2YOFA 2YQZA 4QYWA 4Z2YA 2R00A 2C2XA 3L8EA 4PHTA 2NO4A 2ZP1A 4ZVMA 3VNBA 4B8WA 2ZWMA 3WKEA 3WNDA 2VLAA 4C4TA 5F9HA 3D7RA 4JITA 3Q5EA 1R0BA 1PR1A 3WU1B 1XAIA 3FXQA 1FDUA 2RONA 3GF4A 3PPVA 3HRTA 3HJHA 1L3CA 3A1VA 1NKSA 1X1SA 3N58A 2K5UA 1N0IA 3LF2A 4KXXA 3WTCA 5C5DA 4R4JA 2XGEA 3ZBQA 1E9RA 4XEUA 4ZAXA 1BHQ1 2ZUBA 4IUYA 1SKUA 2I3DA 1J2TA 2ZB9A 1UPAA 3FDXA 1A8SA 1XK6A 5ESRA 4MGYR 4MWBA 2XYQA 3F46A 1MBEA 2O06A 4OMUA 3R7FA 3U3RA 3W1WA 4EFLA 4IMIB 2AWOA 2BM1A 1KZ9A 4N3AA 3HKZA 4XQ0A 3U13A 4DE5A 2H8GA 1EK6A 2XH8A 3Q85A 4EQQA 3IUQA 4ZRDA 1P81A 1JG4A 1VYUA 5D3QA 3HB0A 4L8YA 5KYWA 1GV0A 3W2AA 4XJXA 2PX4A 1OLTA 3FBNB 4X64B 5AK4A 1GTG1 2IITA 4RTSA 2DT8A 3PE3A 1K4YA 1WBJB 4IVRA 4DIUA 1E61A 3RPUD 1DS6A 3SLGA 3CO5A 1DXQA 1RXIA 3Q6NA 2EXXA 3U1VA 5LOVA 1DQNA 3HR8A 4N0QA 3M5DA 4S1OA 2XXAA 3DHWC 3V7SA 3ND5A 2A88A 1SFXA 1V7CA 2H8WA 2D06A 1E59A 3CF6R 3GFBA 4UM8B 3U7JA 1DTEA 3AZOA 3FOCA 4MR9A 5G2OA 4BKUA 3RM3A 4X1KA 3O3KA 3T1BA 1E7YA 1L9KA 1M73E 2IYLD 4G1EB 1GPH1 1ZNWA 4KO2S 4OMFG 3VI3B 4BPRA 4PHCA 4DNOA 2JVKA 5TEWA 2QQAA 4PNEA 2O7SA 2YICA 2J4DA 3IH3A 3K0AB 4RWZA 1J1ZA 2AJLI 3RBXA 1S7CA 3CSUA 1IF1A 3RZOJ 3QX9A 4WD3A 2ZO4A 5JLJA 3L4KA 4EJWA 1I3QJ 3BQ9A 1II9A 4DDWA 1ZD8A 4HLUC 1TF5A 1WD7A 3T12A 3Q0IA 1WE2A 2FEZA 4KYUA 5E1DA 3K0AA 4YAJA 4R9UC 1PL6A 2NU6B 4F12A 1N0WA 8LDHA 5HRCA 5GIOE 3FSGA 4ZJPA 4C03A 3J81K 2YV5A 2ERYA 2P3QA 4PX5A 3E6MA 4AUXA 2QXUA 2P2GA 1LSSA 1QLWA 4XXHA 2H5EA 4HOYA 5CTJA 1OKKA 4ZQFA 4U02A 2WWHA 3D6MA 3GPBA 4JC0A 5IVDA 5JAOA 4ZDIA 1T0HB 4BY7J 3GDOA 4OJTA 1BX1A 4OXYA 3TD9A 4RB2C 1WJGA 1U2TA 3E1GA 4MRAA 1M5UA 2B6HA 4H15A 2Z8XA 3TSYA 2XUKA 1MH3A 3BPSA 4TV9B 2R7LA 5NULA 1U6JA 2CDNA 2FSPA 4FMDB 4G7ZF 4DYRA 2ZTHA 1OTYA 2FSSA 4CKXA 2QAGC 2GZDA 5J4LA 1GR0A 1FTQA 1AUOA 3AF0A 3LC2O 4Q1BA 4N3GA 3R75A 2MJLA 5LVAA 3T7SA 2EL7A 1Q7RA 3DHYA 3F78A 2ZCWA 3GNTA 2YS7A 2MMCA 4ZO7A 4G8JA 2OHIA 4QXMA 5K6RA 2JLAA 5HNFA 2R7OA 1L4KA 5B4TA 1NASA 1IAWA 3P96A 4J0EA 1CZOA 1GQQA 1VCMA 4YXWA 1UFRA 5K8LA 2IBSA 1NUTA 4RV9A 4K0KB 3A1EA 3KAKA 3BN3A 2YV1A 4RDHA 2I1WA 1XWWA 4NBNA 1PLKA 3GG9A 2EJWA 4O4IB 3Q41A 6REQB 2HPIA 4RTMA 2H1RA 3EGDA 4UHBA 3ZTTA 4PCQA 3AEXA 5E3LA 5DCMA 3NM5A 2Y1LA 3ITNA 2IWRA 4CDNA 1FBTA 2VVTA 3BXGA 2P4UA 1PR9A 1BIFA 1CY1A 3KB8A 3MT9A 4LMPA 4P31A 2Q3CA 2K4JA 1FX7A 1I24A 3EMVA 3GO5A 2OQ2A 1J00A 1ZJYA 4JAVC 4XYLA 3OYEA 2D1SA 3OESA 3PDWA 1QC5B 4CQMB 2NPIA 3L1IA 5ALQA 2AMFA 3D8NA 3ZGZA 3W5VA 1ZARA 3EUKL 1L3IA 1OHHD 2Q5JA 5HVQC 3B6ZA 3EB9A 3IEIA 4RPGA 1Y98A 3PQ6A 2DA6A 2H3EA 5JISA 3QEBZ 4ZI7B 2N1BA 4WQMA 3ZOBA 3T3NA 1CYDA 3EXHC 1EVJA 2HZBA 3UVEA 3V1YA 4JC4A 4E12A 1XXHA 2ZJYA 4GIBA 2ECPA 4EYSA 4UE3S 5M3FJ 1VQ1A 3AIOA 3KQYA 2KB0A 3V8LA 2XB6A 1IFXA 1O95D 3U4HA 3WIEA 4KMFA 4OMYA 1CRWG 3IP7A 5IJWA 4LYFA 5IRCD 4ID9A 3M4NA 4LHXA 1TIKA 2O8BA 1JSLA 1GEEA 5L3QA 2WFAA 2ZB2A 3KJXA 1I94B 1TQ8A 4LJYA 3MB5A 4XTCS 1PU2A 5H20A 2AUMA 4B5KA 2XVMA 3LP8A 1TQIA 4X7RA 3FDFA 3ZZ0A 1F3OA 1FXWA 1NG1A 1LPSA 1O9GA 2CV0A 2QT0A 2DQRA 3HOVJ 3KHUA 3N8KA 3CW8X 3K2QA 1YZYA 3NT2A 3OC6A 4DZTA 3RJTA 4PPGA 5I47A 3TZBA 1VC2A 4NC6A 4G37A 2AI1A 5AVJA 2EAUA 1F20A 3DLIA 5JAPA 1QGUB 1QK3A 3MSCA 4AY2A 1L8LA 1V4VA 5IF3A 2YDXA 2ARKA 4L9NA 2MT9A 5BWNA 2MH9A 3EEBA 2W6ZA 3DF9A 4QXPA 5JAIA 2HMSA 2J9RA 4RNDB 3BJRA 2A69F 3OZXA 3GG2A 1W46A 1G5RA 5CFPA 1HSJA 1SOAA 2N1MA 1CVLA 1DKQA 1FFDA 2ZRAA 3A4TA 3HBFA 3OBIA 4L5BA 3I53A 4BQPA 3A6GA 3FDZA 4KR9A 2UUBB 2RJNA 4YRGA 4HK4A 1W4AA 5HZMA 1E4EA 1U0HC 1TT5A 1T5TA 1ZL0A 4G89A 1JQKA 3WK6A 4B83A 3ZGVA 4CYMA 3TTWA 4C7OB 1ULYA 4YUXA 2B0CA 1TT5B 4FWIB 1M74A 1ZHHA 5BOSB 2G17A 3MHTA 4OG2A 2DHDA 2NUPB 2QNIA 2A5YB 1NNSA 3KSUA 4H4KC 4IVNA 3X1DA 1DAEA 3TWOA 3FZGA 5FBVB 4M6XA 1SIBE 2NVUB 4YP5A 1E77A 1GQYA 2ISSD 3C5WP 1YBMA 1M8PA 4NBLA 4YEDA 4IQ4A 1MIOB 5ER9A 2OLKA 5I7RA 2Z9OA 1N6OA 3OS1A 3AL0B 1QNFA 1ZPDA 2CHEA 2WM8A 1I50J 1WB5A 4MUIA 4AVYA 4OU5A 4OHMA 2EZ4A 3F7TA 3B9PA 4M9XA 1WDMA 3EBOA 3FTDA 4L9AA 2ZR9A 4UUOA 5A4DA 1XMKA 4MYSA 4XGNA 1JQAA 3OCYA 4R5HA 1W5AA 2CUNA 1KYZA 5T3UA 5KBYA 1IBCA 2JKYA 4EK9A 2BSQA 3LCUA 2DBRA 1KJ9A 3AL2A 4OCZA 3HE3A 1P77A 1RQ7A 2C58A 2RNGA 2FWBA 2DPMA 3E05A 2EF1A 1EWRA 1DFIA 5D7BA 1LC3A 1VZ0A 3ZHRA 5AVXA 2H31A 2YNMD 3M7GA 1EGMB 2VK2A 1UJ8A 4IOKA 5EUQB 4AY3A 1GKIA 1CJMA 1SD1A 4F4UA 2WB1N 1APBA 3CLQA 3AI3A 4EGSA 2IX9A 5JNSA 1UBRS 4YMIA 1JFSA 2GPWA 3FWNA 3WAGA 4UEKA 1XEAA 2REOA 4G0PA 4PLHA 2HT6A 1HZJA 1ZCZA 4DEXA 4EJ6A 2BI7A 1XELA 4H6VA 1K6OA 3O1LA 1F2UB 4KR3A 1QHHD 1ISIA 1CR2A 3W2VA 2XGSA 1KMMA 1SD6A 1ZS9A 4X61A 4ZZ1A 1KSHA 2X1LA 3L1KA 5C5EA 2XMSA 5JAZA 2OAP1 3KWJA 4JLWA 3SYMA 1RHMA 3AWIA 4M0DA 4N03A 2SICE 1G291 4PRYA 4DREA 1UC9A 3WTUC 1SKYB 4AY4A 2D6FA 4GUDA 5B7NA 2BMWA 2JAPA 2PFBA 2I65A 3DMHA 3PENA 4GRDA 4Q4HA 3HL0A 5CHEA 5IJ9B 1IY1A 2FR8A 1CE8A 2WAFA 4A3DJ 1DDGA 3D8UA 4HRVA 2DODA 5JDCC 4NYIQ 1B7GO 3IAS1 4J0QA 2RKBA 4W5TA 4JI1B 4RVOA 4L73A 4XL9A 3ISTA 1G7TA 2O54A 1XCBA 1B26A 1TQDA 4V24A 2ATXA 4FBLA 3DB2A 3TMAA 4EYKA 4S05A 2QTTA 3WLSA 3DPSA 4R8MA 1O7LA 1SFKA 3AG6A 4H0CA 2X8LA 1J7KA 1E5QA 1LPNA 1OQYA 4CI0B 1A7UA 1XU9A 3HNPA 4RX1A 2MC4A 1C1XB 1A98A 4QEZA 3R3XA 1F51E 4R71A 4EENA 1AB5A 2GCEA 3C2QA 3KOYA 1QB8A 4PGAA 3RARA 2CL7X 3BR6A 4BDZA 2CMKA 4M7PA 2PL3A 1JNYA 3ZJUA 4Q4ZF 4M76B 3O3CA 5LHIA 5J4HA 1S6YA 3QVOA 1FP2A 1NDHA 2EX0A 4DHWA 1XZFA 4GI5A 3RPEA 3LAWA 4E5SA 2HOQA 2W6NA 5IKPA 1EDZA 2VXZA 2C9YA 3G17A 2AGVA 2WF8A 3C6MA 5C8YB 3F98A 4FDTA 2Y0BA 4MV3A 3KQOA 4FSDA 1EQUA 4LMBA 5FV7A 1M34A 1Q5PA 4Q24A 1G5QA 1DIRA 3ZU5A 2Y0EA 2FWIA 1SD7A 3N0TA 1L4NA 3GTKJ 4X41A 2P8TA 2IZZA 5GONA 3RASA 1DU0A 4ZEXA 1U8BA 1BI2A 4FT8A 1TTHA 3NEUA 1K6EA 2G4VA 1N2CB 3SQNA 2D45A 4XIDA 1PJ3A 1SRRA 2JI7A 5EERA 1B3BA 4BEHA 5D00A 5B6JA 3QV2A 3ILVA 4LFAB 1WQ3A 4LG0A 1LFPA 1U5TB 2EKZA 5LBTA 2ZT7A 1JB9A 2UZ0A 1DC8A 4HNQA 4LVCA 3H11B 4V0ME 3MQ0A 5KZMB 3FNGA 1X1BA 4B3DA 4F7DA 4WNAA 1PG5A 2CQKA 5KTKA 3Q0VA 2ZIEA 2O5RA 2CXSA 1KYVA 3O31A 1OAAA 3A1SA 3E22A 3WISA 4CV3A 5F7ZA 5GTIC 2H5JA 4HF0A 1REQA 2X22A 2VBCA 5G02A 2JIPA 2QZPA 3IAAA 5TQ2B 3RS2A 1E1KA 2VJPA 3MMSA 3BG3A 2E7ZA 4TWIA 2ZBEA 3HU2A 4HQNA