1S8NA

Crystal structure of rv1626 from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
190
structure length
190
Chain Sequence
AVPRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative antiterminator
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
total genus 74
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s8nA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s8nA01
3HTUA 2V1UA 2V79A 1LBHA 5BMZA 4EVSA 5JVTA 3BROA 3QELA 3BPVA 1T39A 4EYOA 2DLLA 4EVIA 1ON2A 5E1WA 3W6JB 4MGRA 5E1ZB 2M1BA 1QQBA 2V6CA 2MA3A 1B9MA 1DC7A 4LDZA 4D6XA 2FQXA 4XSXF 2HKOA 3LOPA 4LE1A 2ZBKA 1W7PB 3EGCA 5CNMA 3JSPA 4HW0A 3GLXA 4JB0A 1V3FA 4Q47A 4S04A 5D5VB 1DRJA 3EDCA 4Q7EA 1DBQA 1JH9A 4IJAA 3IRQA 5BOXA 4WXHA 1JYEA 4H3KB 1DUXC 1YW9A 1M2EA 2RC4A 5F6FA 3QK7A 1J75A 1RNLA 1ZRFA 2QW1A 1E2BA 2BBYA 4K2EA 5K1YA 3C18A 3CTPA 5JNVA 3HRUA 1P6UA 1DG9A 1ZDMA 2GI4A 2QQ9A 4EJWA 5JNWA 3QP5A 3Q9VA 3LUKA 2EFQA 2RQPA 2EK5A 4MR8B 2PE5A 3CS3A 5FFXA 2XV4S 1G3WA 3J7AO 1P6QA 4PGGA 3F6VA 1D1QA 1L0OC 2GAUA 1Q1HA 2ESNA 4U88A 2MSKA 2A07F 4XBFA 4RK1A 1JE8A 4QICA 2VYCA 1T6SA 1APBA 2PUEA 4P1ZA 1CYEA 3OV8A 3O75A 4F7ZA 1MDMA 1XGNA 4H3HB 2HQRA 1FNNA 2MC3A 3SNKA 4GPAA 3KYIB 1RXIA 3HOSA 4KPYA 3S2WA 4ENMA 3TOBA 2RKHA 1JGSA 2FSWA 5DCMB 4I7HA 2NUBA 4MLCA 1QQIA 1HKTA 1DCKA 3KSMA 1XDSA 2FXAA 2LF7A 4D6YA 2OA4A 4LDAA 2L3DA 4N03A 2Z9OA 1IAWA 4XARA 4HOBA 2EJRA 3O6BB 4CHUA 2WC2A 2OQRA 4IF4A 1NXSA 1MB3A 2CQKA 1KU3A 5D4SA 2MBFA 4LMYA 2VUIB 4QYWA 1UB9A 2RDMA 2ID7A 1FOKA 4TLLB 4F12A 2W85A 1MVOA 4P5OA 6ABPA 1FT9A 3HSRA 4YS6A 1HKQA 3AAFA 3GF2A 1QGPA 1TBXA 2MH2A 4KVFA 1GXPA 4D74A 2VT2A 2WTEA 4CXFA 4WT7A 3WG9A 1LEAA 2BV6A 1QP4A 3N97A 5HM6A 1I27A 3E3VA 1LJLA 4EM1A 2RN7A 4IILA 3RVSA 4UHJA 1L5ZA 5JFRA 3VFZA 1GVJA 2F5EA 4MS4A 3QEKA 4B09A 2XROA 1IN5A 2IKSA 4MR7A 3RVJA 3M7GA 2B1JA 3HM9A 3RVLA 3FXUA 4IHSA 2VE8A 4RY9A 4UVCA 2AS5F 2FRHA 1W7PA 5I4CA 1MGTA 5KWSA 3ISPA 2NNYA 4L9TA 3V7CA 1J2XA 3IKTA 5D6FA 3F6CA 1YG2A 5HS7A 1TM2A 5BPDA 2FKAA 1XGSA 3P9YA 2E7WA 3GWZA 3F8FA 1J56A 3I71A 4RGSA 3R6SA 4N0PA 2FBKA 1PEAA 2ETHA 4PZJA 1UDRA 3DLBA 1E6MA 3CLOA 5IUKC 2WY2D 4RY8A 1IIBA 1D2AA 2FNPA 1BM9A 4W5TA 1USTA 3GVAA 4L9JA 4O6JA 2DU9A 4I09A 1ZHFA 2HYFA 4RAZA 1EH6A 5FLXK 2HYGD 3OLVA 4MQFB 3JPYA 1JWLA 1KA8A 2IJLA 2UXXA 4S05A 4IRXA 2OZUA 5FGMA 3HV2A 1GCAA 1P6RA 3IWFA 1PHRA 3HYIA 4R8HA 2ZWMA 4CZZA 1Z05A 3IC7A 4O3MA 3LUCA 1D4ZA 3IP9A 3DXJF 3F8BA 1NATA 3JS5A 2JVIA 3EYIA 2ESHA 3GV0A 5JR3A 5DCMA 1SXGA 3VNAA 1C4WA 5TQ0B 1XCBA 2EV6A 2CWEA 5AONA 2L4MA 2CD7A 4U7BA 1R1VA 1QPZA 4P55A 4L85A 3QPHA 3LFTA 5DD8A 4YLEA 2R48A 4L4UA 5J8FA 2QVGA 4ETNA 2PJPA 3E5QA 3GZ5A 4Z4GA 2M30A 1F1ZA 3TDUC 2PUCA 3CRNA 3V8JA 4N0QA 1UHMA 2PBIA 1F4KA 4LGWA 5H6RA 2QLZA 2W57A 2ZNZA 2FEPA 2LUOA 1DCFA 3BRQA 3T6KA 4NCAA 1DPRA 4IGAA 3IP5A 1HW5A 4U0YA 3HOTA 3F73A 3JVIA 5DEQA 4YFKF 1FBSA 1R36A 1USSA 2G7UA 4JASB 4KYWA 1O3SA 2R47A 1EV7A 2VN2A 4MAAA 1W7PD 1TNSA 3MM4A 2X4HA 2VC0A 2OU2A 4N0BA 2WB4A 4KRFA 1MJ9A 4HX8A 1YS7A 4G8XA 2RJOA 3F3XA 5BR1A 1BIAA 1R22A 3O1JC 3R4KA 3KETA 1QMPA 1TW3A 1ZYRF 2VBYA 1ZITA 1F4VA 1OPCA 3T8YA 4A0XA 5GQSA 4AD9A 2YX4A 1RUOA 2NS0A 3WGIA 4FE7A 2QM3A 1XMKA 3QU3A 5HOOA 2L17A 2O0YA 5LGUA 4HDUA 2GKGA 3Q41A 1ZLJA 4PYRA 3FM5A 3H5IA 3DFGA 3RTRA 1FYKA 5CNKA 1SRRA 1T2KA 5JS2A 4ETMA 3LUFA 1ZAYA 4TN5A 3E6BA 1HW1A 3NEUA 4JK1X 2PMUA 3ZMZA 3L00A 1W5TA 3U1DA 4NICA 4KNYA 1JFSA 4HLYA 3EUHA 1EAYA 3A10A 4OIQF 5ERIA 3NBMA 2OBPA 2MLGA 4NB5A 3F8NA 2E4UA 5BPIA 5HKOA 1QKKA 3BJAA 1KQ8A 4XSZF 1SXHA 3IRRA 1S7OA 3BBLA 3KYJB 5D5XB 2ACJA 5L3FA 2M87A 1FP2A 5FD6A 1F9NA 3GEZA 1K68A 3PQKA 1GUDA 3QLVA 3OQNA 5IT9Z 4F06A 2FVYA 2L54A 3M8FA 3I0TA 1KU2A 1DCMA 3I09A 2HGCA 3BDDA 1LDDA 2O6GE 5FO5A 4Z4EA 1KU7A 6CHYA 2HDCA 1G3TA 1DP4A 1VRVA 1XDUA 3H1GA 5F1RA 2VT3A 2P7CB 2XKOA 3ZMUA 2H3HA 4G94A 1HSTA 5CNIA 5EWJA 1F51E 2ISYA 2EFPA 4RKRA 3HRTA 4KDPA 4A12A 3I58A 4UHTA 1FSPA 4PZ0A 1BI1A 4PEVA 4IHTA 1XN7A 3CDHA 2MD5A 2FQWA 3BJOA 2NAZA 4E7OA 3FF5A 1ZG3A 3GUDA 4MR9B 3B73A 2M8EA 4HNSA 2CYYA 2LP4Y 4MPTA 1IZ1A 2JCGA 1BVHA 4GO1A 1CHNA 3DLHA 4MEXF 2AYZA 3GX4X 4ESJA 3N0RA 4DQDA 1JXSA 4M6XA 2FQ3A 3ULQB 4XLNF 4U0VA 4A0YA 2NT4A 3FGZA 2DO7A 2N9UA 3L49A 2GIVA 4HF1A 2QYOA 1TVMA 3FMSA 2A9QA 4RGUA 2C6YA 2FXIA 1I5ZA 1U5TA 3QELB 2BE5F 1YIOA 4FX4A 3QLVC 1YQAA 2QUFA 3R0JA 1YLFA 2DQRA 2Z99A 5DCLA 1HSJA 1M2FA 4MQEB 2DFIA 5K5QA 1D5VA 2L01A 1QBJA 3LWFA 3JVDA 3DPLC 2FEWB 5TQ2B 2FN8A 3EQ2A 4L9NA 4P96A 1WRJA 1I1GA 2ZJ2A 3Q9SA 5IT3A 3Q7SA 3P7NA 2PLNA 3GFJA 4ENNA 4GXOA 3HEBA 3QRFF 1D5WA 4WZZA 2NT3A 1JHZA 4H60A 5KC8A 1SFEA 3A0UA 3MA0A 1YW7A 4Y13A 2OZ6A 3DF8A 5K5OA 5BQTA 1KRWA 1BDIA 1MB0A 3A3KA 4A2UA 3DP7A 4M71A 4RXUA 3H3ZA 1L5YA 4LG0A 5L3CA 1J59A 3GT7A 3H75A 4OIPF 4KZKA 1G6NA 4G7HF 4MS1B 3COAC 4RDCA 5FWXA 5J8CA 3LA7A 2H6CA 4GGGA 1E2XA 3D5LA 3WGHA 3H1EA 4L9VA 1BI2A 4ZMRA 1ZARA 5ABPA 1FYLA 3JPWA 3H5WA 3EULA 5KQPA 3O1IC 3HUTA 3KP5A 4IMIB 3T0YA 4ZYEA 5T7BA 4M73A 4RKQA 5TE9A 5E18F 4HA8A 1QNLA 3KP7A 5BRAA 2JPCA 3E61A 3OMXA 3S99A 1H9GA 4HX7A 2EFNA 2A5YB 2UWMA 2PUAA 3WE3A 4UNOA 3EDPA 3P9KA 3EQLF 3WE2A 3DZDA 2VC1A 2D1VA 3HDGA 5D6EA 1D1PA 2VE9A 4N76A 2NYXA 3HIFA 3WTVC 1JYFA 2IW5A 1H9TA 1R1TA 2BGGA 4ZYGA 4HQEA 2QENA 2MYUA 3T95A 2PUGA 2M98A 5HVQC 1ZLKA 1P4AA 2LKPA 1HKSA 1FWZA 2GXBA 2XAQA 2KRFA 3QU6A 3IP6A 3WGGA 2ZXJA 3BY6A 2L2QA 5HDNA 3O3KA 1K78B 2O61A 1ZGAA 5DLEA 2HZTA 2QWWA 3OM0A 3GL9A 5L3DA 2JRTA 4MQEA 3ECHA 4MS4B 1EHCA 1BOAA 4MR7B 5TJJA 1I6XA 2PEXA 4OLAA 2FF4A 5TQ2A 4G6QA 1RZRD 2PUFA 4XXHA 1ZESA 3OQMA 1MJBA 3I54A 4M72A 2GX6A 2E4VA 4ON0A 3O2QB 4L18B 4W5RA 3ZMTA 3RKXA 4M6YA 4N9HA 3LAJA 2MYPA 2CG4A 1DJMA 3H5LA 4EM2A 1Z25A 4HBLA 1TQPA 2A9OA 4G86A 4CDGA 3RVMA 1D8JA 3DGFC 3BZ6A 2FOKA 1E6KA 1EWTA 3IPAA 3M6MD 4RK6A 1T34A 2F8TA 4XRFA 4YO7A 2G9WA 3CJNA 2JTVA 5H6QA 5DUIA 1LQ1A 3DQVC 5CVVA 4OIOF 2JVKA 1OYYA 2YX7A 3T5XA 4MS1A 2HSGA 1UCRA 4R1HA 2O20A 2HWVA 2EFOA 3C97A 3SXYA 4EYGA 1C0WA 3NHMA 1UHWA 2RDPA 3HDVA 2YU3A 3C3WA 3WTZA 1BDHA 3VNBA 1HXDA 2FMIA 2OQGA 4B8XA 4EUKA 2CW0F 2KIMA 2IPQX 1ZH4A 2FSPA 2VBZA 3ZMVA 3LAPA 1NHAA 5LLQA 2PUDA 5KQMA 2IA0A 3LQRA 3EAFA 4A6EA 4LRQA 3ZP5A 2P5LC 5HQJA 5DCFA 3CU5A 1AOYA 3SM9A 2QZ8A 4UHKA 4RSMA 4M9SA 1BI0A 5TPZD 1PP8F 1U04A 2H09A 2BEOA 5J6XA 3H6GA 4G0YA 2K02A 4HNRA 2QXYA 1SFXA 2DK8A 1R5GA 2RV8A 1IXSB 9ABPA 4Z4CA 5LRSA 4EQQA 4UVAA 4KMUX 2VBXA 1NXPA 1RXEA 3TMYA 4KIGA 2ZKZA 4ZJPA 2KIUA 2GA1A 1QO0A 5DV5A 1Z26A 3N6VA 4GYGA 1R5HA 1MAVA 3ECOA 4HF0A 1LJUA 1U3EM 4W5NA 4RU1A 3LMKA 4XFKA 1TMYA 1REPC 3HRSA 1GHCA 1K78A 3GFLA 4AIJA 1KYZA 1O7LA 1USGA 3RVPA 4F8JA 1BI3A 2W84A 1WKMA 4OMYA 4OOIA 2YPRA 1PEYA 2QVCA 1KYWA 1OMIA 1U0SY 3CG0A 3N75A 1FP1D 1IXCA 4CBVA 3OQOA 2ZCWA 3CKMA 4P98A 3HSFA 3L7WA 4EJVA 2KKOA 3C6QA 4LLGF 2Z5UA 1ZH5A 4OATA 2VK2A 4KIBA 3GW2A 3ZN0A 5HDGA 3OLYA 4Z9BA 1K7AA 2M1ZA 1VLZA 2K4JA 1QP7A 1U8RA 1XSXA 5IT9K 2GBPA 3M9AA 3MYYA 3E3MA 3H5VA 2FMFA 2PUBA 1H0MA 2PKXA 2IT0A 3OLZA 3C1DA 1B4AA 2YR2A 5FBKA 2ADUA 4N47A 4EV0A 4HDVA 2AXLA 3UKJA 3Q7RA 5L3EA 4EJUA 2Y75A 5TPWA 3IP7A 3EETA 1WETA 4EGYA 1ABEA 4YIIA 2H6BA 4ENJA 3HRMA 3H92A 1YK0A 2PL1A 3ROUA 5CVIA 2V1XA 3FX3A 4O5AA 4UV8A 2JZYA 5D8KB 4NV3A 4Q6WA 1F5TA 2PMHA 3U2RA 4P9FA 5CVUA 1USIA 4EVQA 4I01A 1D3YA 1WQ2A 3ROFA 3QOPA 3M8EA 3K4HA 4R79A 1IN7A 1ZH2A 1XMAA 4MLDA 4JP1A 4A6DA 5E8IA 4Z4FA 4BXUA 2OD5A 2PI0A 2JBAA 4E7PA 5DYMA 1DBPA 2YHAA 3J81K 3SAJA 4KFCA 5T3YA 2W42A 1DBWA 4FT8A 4WX9A 3OOPA 3RYPA 1FSHA 4MRMB 1Z9CA 3RVOA 3PFIA 5C5EA 5EWJB 3J80Z 3UK0A 3KCCA 2TDXA 3MMNA 2A61A 5HLIA 5LHHA 2KIFA 4MGEA 1G3YA 2PAFA 5EWMB 2QVOA 1JDPA 3ILYA 4WUTA 1YTUA 3H6HA 2HS5A 3LTEA 3CO7C 2STWA 3KKEA 1JLKA 3K2ZA 4OG2A 1QZYA 4L0ZB 4TMYA 3OO0A 2HR3A 1P2FA 2WWYA 3SFZA 5AIQA 2MYTA 3N0WA 2L4AA 3CO6C 2EV0A 4RXTA 5KI6A 3R60A 4W5QA 2E7XA 4AVPA 1Z18A 3O2PE 1T0FA 3K9TA 3KHTA 2RJNA 1G3SA 3B02A 3UUGA 2NRAC 2EV5A 4ESBA 1XD7A 5ICCA 1W5SA 2OENG 1FY7A 2BGCA 4RB2C 2LPMA 4NQRA 3V7RA 3ERED 1NXWA 1U5TB 2R7FA 1O3RA 1JHFA 5LGTA 1SMTA 5BRJA 7ABPA 1NXVA 2HOEA 1ISSA 5D8LB 2HQOA 2J5OA 2IOYA 5B3JA 4KK3A 4LZLA 2Z33A 3G73A 5JNRA 3ABUA 3JTEA 3E6DA 5ILUA 2P5VA 5ILVA 4MNUA 1ONVA 2FE3A 3WTXC 4JBAA 4OINF 3WU1B 3T8RA 2XAHA 3HS3A 1KU9A 3ROTA 3F6PA 3QLUA 3O2JA 5JNUA 1U2PA 3LUAA 1LB2A 3I45A 3VODA 4QLCU 2A6EF 2CGPA 5HSGA 3P9IA 5E8GA 2M5WA 4LG0B 4A5NA 1IUYA 3CZ5A 4RAYA 5PNTA 3K1MA 3TO6A 1RPJA 2DW4A 2JVJA 2TMYA 1S3JA 5FWXB 1FBUA 1S29A 1BA2A 4HQMA 3WTSC 1U2QA 1XSDA 4ZYDA 3F8CA 1IRGA 4NCBA 5EEHA 3EJWA 1NY5A 2KJCA 1OXKB 3I59B 2X0LA 3TQNA 3CNBA 3FMVA 2IA2A 4UVBA 1JBEA 2CHEA 5KC9A 4MRMA 1PDNC 3HHGA 3M1EA 4BQAA 2HKXA 3LUJA 1EWKA 2VONA 2FMLA 1K79A 2V1DA 1HW2A 5CNJA 4YCSA 4XLPF 1QP0A 4RK0A 3SZTA 1J0RA 5EWMA 1MD0A 2DTRA 5CLSA 1JDNA 2EFWA 1AB6A 4DQ2A 3WTYC 5LBQA 2DAOA 3MAJA 3I42A 5B3JC 1KRXA 4Y15A 1FLIA 3HCWA 3O21A 2JSCA 1C0EA 8ABPA 5JNTA 1ZVVA 3GZ6A 1R23A 2ZMEB 2HPHA 4IMJB 3BRSA 4KIFA 3E6MA 1IN4A 4M9XA 2F5CA 2RNJA 3GXOA 2CSOA 4Z4HA 1OR7A 1DPUA 3IDOA 4HV5A 4ETSA 4RB3C 3IWZA 3HHHA 1EH7A 1YO5C 5E20A 4U7DA 3L6UA 1QPMA 3H5OA 3DPTA 2HJ9A 4YGXB 3LFKA 5HS8A 4G0MA 2ZO4A 4RK7A 4EYQA 3GBVA 3D8UA 1FPQA 5A2QZ 4AIKA 3GRCA 1EWVA 2MYNA 3WU0A 1LDKB 2XASA 2IPAB 1U6GA 1ZGZA 4L0YB 4KREA 4BNCA 1CGPA 2ELHA 4FE4A 3BREA 2IPNA 1U78A 3C3KA 4OIRF 2AYXA 3GYHX 4KN4X 2BYVE 3BOQA 4RGXA 1ON1A 3ILHA 3KZZA 4Z4IA 4ZYLA 1YMVA 1LVAA 1Y1LA 2XDYA 3KLNA 3G85A 3R61A 2B0LA 1Z6RA 1Z15A 4LX8A 2DI3A 2VUHB 2R7DA 4LFUA 1DRKA 2J48A 2Q5CA 2DT5A 3CUOA 1RZ4A 2EA2A 3RDIA 2E1NA 5JI6A 5D5UB 3ELKA 2QU7A 3I5UA 4JB2A 4MEYF 4Z0NA 4F3TA 3I64A 4G9YA 1LDJA 1A04A 2FNAA 2P6SA 3JTGA 4G0XA 4H0EA 3RVRA 4MQVA 1DC8A 2P5KA 3FZVA 3I59A 2QV0A 1D8KA 1IXRC 1XB4A 4N41A 1U5TC 1QNTA 3NRVA 1XGMA 5ICEA 3I53A 1CF7B 2MLKA 1SD7A 1O7FA 4XASA 3PQJA 2P4WA 2LNBA 4YRZA 1ZGGA 5HLGA 2WV0A 1ZRCA 1FFWA 3ZN1A 4HYEA 3H5TA 3KEOA 2A69F 1EH8A 1YW8A 3SZPA 1GXQA 3W9SA 3ABTA 1Z1DA 1FZPB 2A3SA 3CZCA 1KGSA 4Q5SF 2ZMEA 4WXCA 1B9NA 2JRLA 1ISRA 1KQ9A 2E4YA 4AIHA 4ASNA 1HBXG 4ZMSA 3HUGA 3HJFA 5IX8A 1U8TA 1GUBA 1JL3A 1ULYA 2R3SA 1TLFA 2IVMA 4I2OA 3A0RB 1URPA 4MS3A 4LE2A 5E3JA 3E97A 2P8TA 1XHEA 5DDGA 2FMKA 5FB2A 2L19A 2DK5A 5DUKA 3KZYA 1GLGA 1TTYA 1RUNA 3TO9A 2ZFWA 2PG4A 2H0AA 1JFTA 3VB2A 4E70A 1O3QA 3LUGA 4TLMB 2FBIA 4CYDA 1P4XA 2K86A 1IF1A 2V0NA 2XIGA 4EGZA 4IRIA 3FFWA 4BHPA 1V4RA 3HZHA 3FXQA 5IBQA 4HNQA 3LUDA 3D0SA 1SXIA 1MKMA 3D02A 4I0BA 3HXMA 3ZMDA 4O1IA 4PDKA 3O2SB 2PN6A 1G4DA 1B00A 4U0WA 3M9WA 4GNRA 1YK1A 5LHIA 2HEOA 2IPLA 1LNWA 1VPWA 1T38A 3CG4A 3RYRA 2WRZA 2F5DA 3E6CC 1ZREA 2QZJA 4ZYHA 2FTKE 2XVCA 3J80K 3ZPLA 3NNDA 1Z2EA 5KK1A 5TPWB 2XRNA 1P4WA 1PUEE 4HV6A 4WK8F 3P9CA 3FFXA 1USKA 3G3ZA 2O8XA 5LHGA 3FFTA 1ODDA 4M74A 1EFAA 2F2EA 1KQ0A 1OYIA 3JAMZ 2FN9A 2A68F 3HSEA 1CF7A 3KP3A 3ZQ7A 1M5TA 1LK0A 4EJTA 2KJBA 4MTEA 1FQWA 2W25A 4EGSA 3MWMA 1ZAOA 5CJ9A 3OMWA 2QBYB 3MF4A 4MYRA 4FHTA 1JF8A 2D1HA 3WODF 1W25A 1XGOA 2GWRA 3VEPA 2JBAB 1ABFA 4NQWA 3EYYA 5CVJA 4PE5B 5JS1A 3KP6A 4MHGA 2ID9A 5L3BA 3QP6A 4EMSA 4OBBA 1NTRA 5IUNC 3FDFA 4KQCA 5D2CA 4G0OA 3T38A 1SAXA 4W5OA 1CEYA 5EWLA 3GFMA 3O74A 2GXGA 4RK4A 2Q2EA 3LUHA 1VTNC 3WTTC 3TGNA 5KVRA 1RIOH 3U9GA 3SY8A 3IKVA 2RVCA 5DTEA 3CUQB 2JT1A 3RH0A 2Z3YA 1Z13A 3FXRA 4DADA 5IUJC 4GCVA 5JNSA 2EWNA 2COMA 2FA5A 4IVNA 1T98A 2FMHA 1Z12A 2FLKA 3BJ6A 3N0XA 2W24A 4YP9A 1ZG5A 3GFIA 3GYBA 3CFYA 3URMA 2Y0MA 1WWXA 4Z99A 4RV5A 1XSVA 2DQLA 3F8MA 3DBIA 1AB5A 2LF8A 4LE0A 5BQ3A 4Q6BA 1BDJA 4RY0A 1Z91A 1J9IA 1BBYA 2K7LA 3REOA 4LJZF 1YMUA 1FC3A 2HFHA 2H94A 2VOOA 4FB4A 3TO5A 5K5RA 3I4PA 3K1PA 2PFBA 1PNTA 2VBWA 2PMCA 3MQ4A 5E17F 3GA5A 3RQIA 4LB6B 4ZZDA 3LKVA 4KN7X 4WXDA 2PL9A 2P4UA 4IXAA 1IW7F 4L5IA 4LLLA 3SHFA 3QEMB 4JA2A 4Q48A 3RIRA 2R4QA 1H9CA 2J5PA 4EVRA 2WMYA 1MZBA 2IYNA 4YIFA 3V8LA 3OM1A 2YSRA 5DKFA 4JQFA 2CWDA 3JY6A 3QPTA 1SD5A 2G7HA 2RGYA 3LA3A 3DGEC 4MR8A 4WXEA 4Z9AA 4LB5A 3BWGA 3MQ0A 2A6HF 3RI4A 1R00A 1LBIA 5LEKA 3FM3A 4CICA 1FYMA 2EA4A 1I1SA 4RS3A 1JHHA 1NXOA 2IA1A 3BPXA 3Q5FA 5CYVA 2QBYA 5FBHA 2E4WA 1M5UA 2Q8KA 2MSLA 3K1NA 3HTSB 2K27A 5EEGA 3MFKA 5LRRA 3N53A 4CO8A 3QAHA 3OLXA 1SD6A 4HAMA 1PP7U 3GBPA 1RI7A 4ESFA 3JTHA 3WTWC 3Q7TA 3W6KB 2MH9A 1VKRA 1QO0D 4EYKA 3EODA 5ICFA 3QX9A 3C7JA 2Q0OA 3V8KA 3SG0A 1AWCA 5IC5A 1L3LA 2M45A 5A2QK 4HX4A 1HEYA 2XHKA 3KS9A 1UFMA 4RZSA 2VXZA 4PCQA 1KMIY 5ICGA 1WSUA 3BILA 3CUQA 3F22A 2FLWA 1J7KA 3MEXA 5D5WB 2P6TA 2QR3A 5FFZA 4BAYA 3CLKA 4OMZA 4BH9A 1FBQA 4KUMA 4O1HA 3TD9A 3BP8A 3MZYA 1DDNA 2WJWA 2DRIA 4RXMA 4CGZA 3V7SA 1YYVA 1Z6TA 5H20A 3TOAA 4RWEA 2CFXA 3C3MA 1B59A 3KP2A 5JHUA 2ZAYA 3MIZA 4OTZA 4HF2A 2JB9A 3KP4A 3KTOA 4IPAA 3DEUA 2FEZA 2FMYA 5DGCA 4YV7A 2A9PA 2ISZA 5BS6A 4ZZLA 3LQQA 5KQLA 1W4MA 3HO1A 5HLHA 1YFHA 2B4AA 4DNCA 2QSJA 3Q15C 3OO1A 1PNRA 5FD5A 3GWGA 5CVRA 4GYIA 2YHBA 3RVKA 1SMYF 3E5XA 4PICA 3MZHA 2A9RA 3N8IA 1B1BA 4JAVC 2PQ8A 2CHFA 2FQYA 3QEMA 4G0ZA 4Z2YA 5AIPA 1P8AA 4NHJA 2VODA 4QYMA 2K4BA 2D45A 2E4XA 3NHZA 3HK2A 3IPCA 2XKPA 2XUBA 4G7ZF 2IRFG 2L02A 1U2WA 1BJAA 3SQNA 5TQJA 3CUQC 1PUXA 1TW2A 4MQFA 4ENKA 4UUVA 1R8JA 4YFNF 2GZWA 3G1WA 4KK4A 3VOEA 2FBHA 1SFUA 1NXTA 2UZKA 2LDUA 4BYYA 3F7NA 2R25B 4EM0B 3TDZC 5L3GA 4DN6A 2F8SA 3FWEA 3K0LA 5FWYB 4OU0A 1JFVA 5GOTA 4AWXB 1FX7A 4LK0F 3FMQA 3KCNA 4ML3A 1Z2DA 3KEQA 2I6FA 4IRHA 4MQ9F 3T8TA 3EQZA 3F6OA 1YVUA 1DP7P 4JOQA 1SD4A 5TQ0A 4EY3A 3B2NA 2FU4A 2XAFA 5TRDA 3F21A 2CO5A 2GQQA 3L09A 2VOPA 2KYRA 3RVQA 3RPUA 4RB1A 2D2WA 4Y17A 1Z16A 1K6OA 2HQNA 3RVNA 2DBBA 4Y9TA 3RKYA 5HS9A 3QX8A 2Y48A 3WTUC 4A5MA 5LGNA 1ZRDA 3NQOA 2QQAA 1LEBA 2DPUA 1I3CA 1K66A 1DZ3A 2JPBA 1MJAA 2L18A 4WXMA 2HTSA 3JSOA 2E1CA 2NNNA 1Z17A 4MTDA 4Q4ZF 1XWWA 1ZG1A 1XHFA 5IEJA 5FLXZ 3F72A 4QWQA 5ED4A 1FSEA 3LSTA 1E17A 1XCVA 3K9CA 2UXNA 2NZUG 5D4RA 3FHZA 4YWHA 3H1FA 4M9ZA 2LIVA 5F64A 3L2CA 1Y0UA 1TQIA 1QQAA 1TQMA 2V9VA 4L5JA 3QLUC 1B6AA 4WWCA 1IRFA 1TNTA 3R0AA 2IPMA 1GCGA 4ZH4F 3RKWA 3LKBA 4ETIA 2HTJA 4MS3B 1X3UA 3NNSA 4BHCA 4UV9A 3RPQA 1R58A 4N9IA 4LK1F 2LBPA 1BC7C 5HDKA 4A0ZA 3JAMK 1JX6A 5IULC 4G97A 3RJPA 2XGXA 1E6LA 4WWHA 2O03A 4I02A 3J81Z 1S6LA 1A0OA 3KG2A 2F5FA 5IEBA 1ZGJA 4G7OF 4IRGA 2LSOA 3HUUA 1YS6A 4XLTA 4EJOA 3TB6A 5DD4A 2MSWA 3KJXA 4KICA 1OKRA 2O3FA 3TO7A 3CHYA 1BIBA 1RZRA 3TKYA 2FEKA 3HVRA 4RB0A 1IN8A 4YR7A 2HQBA 5FWYA 1LJ9A 1W9HA 2P9HA 3DKWA 3KE2A 3F23A 3K69A 1BC8C 1FFGA 1OXBB 3FMRA 1A2OA 3OLWA 2DPDA 2E4ZA 3V4GA 5E1XA 2STTA 4I0AA 1QZZA 1NXXA 2P7VB 3QLTA 2ZNYA 3L9FA 2OAZA 3GO5A 2JK1A 1TLHB 3H3UA 4HZFA 4LD5A 1IN6A 2IP2A 2RGVA 3ML6A 1ZY2A 4F11A 1FFSA 1MIHA 4WF2A 3LA2A 4G6DA 4RGRA 4XAQA 4YFXF 4WCGA 4BHBA 3T1BA 1YTYA 4PGHA 1S7AA 4G0QA 1OYWA 4OLBA 4KMFA 1MDMB 1BN5A 3HSYA 1R7JA 5ILSA 1R1UA 4O5VA 4P9UA 4LLNA 1ZN2A 3DV8A 3ZMSA 3JW4A 4ZPJA 3M9XA 4UXNA 4RS8A 3TX6A 3O1HB 1S8NA 3MCZA 4I98B 3IHUA 1TJYA 5CHYA 2XAJA 4KA4A 1STZA 1Z7UA 4FX0A 2PJUA 4RK5A 2X7XA 1HQCA 1J5YA 5EWLB 4D0PA 1ZHHA 2XAGA 2NZVG 4KMRA 5TPZA 6PAXA 2EB7A 4MR9A 4TV7A 3N4MA 2H27A 4KT5C 3CTAA 1WI9A 5LEJA 3IL2A 3NNNA 4YG2F 4G0PA 4KQ9A 4M88A 2PLYA 1P92A 4HLXA 2FW0A 4KV7A 5KQGA 5C5CA 1O57A 3KLOA 1BAPA 4QPJC 2WWVD 2WJAA 3E5UA 1O3TA 2IDMA 3I5AA 2GA2A 2QQBA 3KFWX
chains in the Genus database with same CATH superfamily
4K8OA 2XB9A 1TVEA 1MZPA 3C5HA 5CA1F 2XLCA 4CF7A 4UD2A 1ON2A 1DG3A 2MA3A 3S81A 4RHFA 4Q34A 2ADFA 5G1OA 1W7PB 3GLXA 2C97A 2CXSA 1X7HA 4E7ZA 1WXXA 1MXFA 5DS9A 1G7SA 4ZU1X 1EB8A 2QQ8A 1PGOA 3S8MA 2NO6A 3NU1A 2HI0A 2BMDA 2VTKA 3C6MA 5DFAA 5JNWA 1BXRA 3CS3A 1RCTE 1MJGM 2CVZA 3FIWA 3D0KA 3PIIA 1BXKA 5KOHA 1LE8A 1CUSA 1MDMA 4M1KA 4LG1A 3KYIB 1L1RA 4ENMA 4U3JB 2RKHA 1Q16A 1SQSA 1VMAA 4HLUC 1YBAA 4D6YA 1OASA 2WU1A 2HFKA 3OTQA 3AU9A 1QQTA 2YYZA 4J8PA 5DSTA 1XLVA 1YQXA 4NDAA 4EHFA 4CHUA 5L3SA 2OQRA 3JWGA 3HJUA 4PX5A 2VUIB 1MH3A 3EG9A 1LWNA 2AOXA 2XKKA 4XSGA 3AW9A 1CS0A 3WX0A 1GDDA 1Q0PA 3C74A 1G3QA 1ZC4A 1JMKC 1E1LA 1OILA 4QQ8A 4NV0A 5DM1A 2HYJA 4LFAB 3ZZ0A 4FC7A 1UMCA 1LXCA 5A5DA 3K5HA 4HDNA 2WILA 5AWFC 4OFZA 4MI6A 4RF4A 2XMGA 5BN4B 1E2DA 2AJLI 1BMFA 3GLUA 5M34A 1NQOA 5AO9A 1UJ5A 2QXTA 3H8VA 4ZT5A 5FR2A 2WAYA 3WLJA 3ETLA 2QAIA 1E1CB 1NF9A 1KWGA 3DNFA 5IUKC 2BCEA 1XNQB 3DO8A 5UKDA 1QIJA 4NJEA 3G6KA 4PCVA 4L9JA 2HQ5A 1ZHFA 1CVLA 4AKGA 1KKLA 3FK6A 5TGDA 2O1WA 2BT4A 2EBWA 3DMTC 4J0DA 4IIXA 1I14A 1WH5A 1CEEA 3MJTA 3H2IA 1Z05A 3F8BA 2X4DA 3TIFA 3GV0A 5DCMA 3QPVA 4BQEA 3AYZB 3VAZA 4K9SA 2QLBA 5ALIA 3CDIA 4ZDPA 1CVIA 4U7BA 1E1NA 3LFTA 3RTGA 4YLEA 4ALNA 1UBLS 1Q3KA 2RB4A 3P9ZA 3ZCTA 2VATA 3TGPA 4M37A 5TC4A 1ECGA 2ZBVA 2NXWA 2NVTJ 4DIKA 2UZ3A 4YELA 1UKAA 2ZRQA 4MA5A 1HW5A 3P8ZA 2EYUA 4TS4A 5IKXA 2G7UA 3CRVA 1N7JA 4U2BA 2KQRA 4YTEA 5C8XA 3R9IA 3LPCA 4LF7B 3GBGA 3P2KA 3LSMA 5EZYF 3EQ6A 1AGNA 1Y7PA 1JDVA 1HMYA 1KY2A 2GN4A 1XV5A 2PKCA 1ZYRF 4G1UC 2RGUA 3FUCA 5MN5A 2IZ0A 1HK7A 2BSQA 4TV9A 3K0FA 3ZU5A 2YW9A 4AFNA 1C3OA 3FM5A 2QRNA 3LCRA 1PGJA 2CFCA 4GXRA 4UXHA 3CV3A 3ZW9A 2VEDA 2WM9B 1DKMA 3RBXA 3W8DA 4C3IJ 1UEXC 5K3FB 3TEDA 4A1OA 4D41A 3B53X 1WHUA 1RM5A 2NU7A 2R6AA 1HTTA 2AJDA 1ZX1A 8ADHA 1F5NA 1WAMA 3CF4A 3FY4A 2QTCA 1K5DA 1S7OA 3BBLA 1Y1QA 1KR2A 3OZBA 1FP2A 2R7TA 2ZS7A 3V8MA 4E1AA 5TV2A 3GFPA 3CJTA 3AI1A 3M8FA 5DGDA 4LXXA 2OM6A 2O1EA 4Z4EA 6CHYA 4GFBA 2OBNA 5H7XA 3CW9A 4YX9A 3PUWA 3WLMA 4HDRB 1NVVR 1YJAA 4OH1A 1DTWA 1V54H 2NAZA 4UB8C 4JT2A 4KMMA 1KJ9A 5EXEA 2HXGA 2EIMH 2DA4A 2VKDA 3GVCA 4PBTA 1GGNA 1WZEA 4C1NA 1AHHA 2OCGA 1TYZA 1F20A 4G36A 4X7PA 5GPAA 4LF6B 4F96A 3DE7X 1XRJA 1N36B 3NOOA 2QMEA 3HA5A 4MO9A 2CLMB 2QG4A 1E5TA 1N5DA 3OEHA 3CA8A 3D31A 2VNIA 4DHWA 5DW0A 4EGQA 1X74A 4CM9D 3ESZA 4TSKA 3U1TA 3PHLA 3HKDA 3EQ2A 2VLIA 2KDZA 2WTBA 3AR4A 3HDJA 2ERCA 2J4CA 4JYPA 1YZHA 4OJMX 2JLZA 4KGVA 3UW1A 1H6CA 3P2IA 3HOUJ 2I6UA 4M9UA 2GXSA 4E7SA 3A1YA 1LSJA 2X9LA 3CNNA 3Q40A 4OJNA 1VIMA 1KYIA 2OJED 4CMAA 3QHQA 3GJ3A 3PDHA 3F98A 3TZCA 1PYGA 3KJEA 3PUIA 3SE7A 1SXJC 1SQFA 1Z0DA 4X6XA 4LYDA 1SQ0A 3KP7A 2YJ3A 1GTVA 4KDFA 1DQSA 2RAPA 1H9GA 4HX7A 1ADFA 3BMQB 2AGVA 3VYUB 5EJ8A 4OXQA 4WX2B 5J58A 1JYFA 1TVCA 1H9TA 1XZIA 4CUGA 1A98A 1FWZA 3HL2A 3CZ9A 1NVAA 3KUUA 2XMZA 1T6BY 4XM1A 2NZXA 3PLRA 4HEQA 2ZXJA 4Q9JA 5LQKA 3BX1A 3PTZA 5TMEA 4BMYA 4NSNA 5ESRA 2AUTA 4CKWB 1NW8A 2E36A 3DDZX 1M8PA 2BWJA 1LPMA 3RFCA 3U26A 1XYGA 3LKDA 2EXXA 4ATNA 1ZESA 1T4CA 4ON0A 4H4DA 4BFSA 3V1TC 4NYJQ 1HDRA 2MYPA 5AHWA 4PLTA 4I8IA 1VMIA 2FWAA 1GFIA 1BOFA 3ZXUB 1B8NA 3RUCA 3NGMA 2E2JJ 3ZQ4A 1CP2A 4XRFA 1UJ2A 4S0ZA 3K1ZA 1CW2B 3K8ZA 4F1WA 1M7HA 5A3RA 3HCPA 3ZWYA 1RYNA 4LY6A 4C88A 1UHWA 1PRYA 2IVFA 3HDVA 4AZ0B 1KC1A 3OYKA 5F1KA 4XEUA 5CXXA 1UJ8A 2O3UA 2BFEA 5DCWA 3ZP5A 1YCGA 4YAGA 1E4OA 4GSKA 1KK3A 3TVYA 1KSGA 3AUUA 4BMXA 2FF7A 5ED0A 3ZCSA 4EFNA 3FSJX 2JFGA 2DCEA 3G7UA 4UVAA 4KZPA 2H1SA 2XF2A 3UAGA 5KYVA 2Q6LA 1FOYA 1Z6GA 2M34A 4JITA 4QU8A 3T1OA 4HF0A 3HCBA 2CCGA 3A36A 2XYHA 3T9CA 2LDBA 1TMYA 3BA1A 5LFAA 1TZBA 3PFWO 1OX4B 3NTQA 2W1OA 4MKZA 4GWKA 1ULZA 2RKWA 1U2TA 1W47A 1NUHA 1AZLA 2DECA 3PEYA 3IALA 3STXA 2FVXA 2HJWA 1FRVA 1QGOA 3OLYA 1U4OA 2GBPA 4IVPA 2VF4X 2QGZA 1XZAA 3MUFA 2C58A 1GT91 3UBMA 3TW4A 4HHEA 3DEIA 4B79A 1RYHA 3O83A 3C2QA 3SX0A 3ZGYA 1LD3A 3FR7A 1A9XA 5H8WA 1M1NB 2VYQA 5L3EA 2AB0A 4EJUA 5G0SA 4PZYA 1T5HX 3F1KA 4DM3A 1U9ZA 3M5CA 1YK0A 1FNSA 4GP6A 2PQ2A 3SN6A 2WIGA 4RBOA 1IY8A 4WKCA 1FLDA 1X7XA 3S1AB 5FBVB 4BZXA 4RLSA 2FPRA 4JP1A 2FQ1A 4A6DA 2H52A 2GZHA 3DXYA 4Z4FA 3OEYA 2IZ6A 2ZBDA 4E7PA 1LFUP 1JWAB 3G7SA 3IDFA 3U1VA 1KY3A 5IKOA 3CNEA 4N4AA 2HTFA 1BJTA 1C1DB 4C0XA 4HH0A 1HORA 4JC8A 5IT0A 3LLVA 3FLBA 3G0GA 3KCCA 1YI1A 3JXEA 5A0VA 1WPRA 4MKGA 2KIFA 3C3CA 4HNAA 2HS5A 5CK5A 1PTJC 5I7HA 5HLTA 4F84A 3K2ZA 4TMYA 3UWMA 3G2MA 2IOQA 1K5PA 3ZVMA 1DUIA 2BRUC 4L9AA 1NK3P 2WA0A 2WSSA 4PYKA 1Q1AA 4DMFA 4NK5A 2KRHA 2VHTA 3X2FA 3QU9A 3HFJA 1T0FA 2AMYA 4NH0A 4LZZA 1OWPA 3QWBA 1KHHA 1DWUA 2I22A 2VHEA 2Z1NA 5HK9A 3RODA 4B3HA 4A8TA 2AUNA 2FX0A 2KB0A 4JOMA 2P2NA 3SQLA 1WWKA 4OQEA 1ISSA 4DBZA 3W5VA 4BU2A 4A8JA 1BD4A 4BNLA 2C07A 4JC4A 1T9GR 1IONA 1QG6A 2GJKA 5EE5B 4BMNA 4MHSA 4GP7A 5JH7A 3ZKWA 1J5EB 2XAHA 5IASA 3NP9A 3F6PA 4FHGA 5JNUA 2P62A 3AU8A 1HTBA 2Q6TA 3ZX5A 3UGKA 5ILGA 3M70A 1T2CA 4O0MA 1RPJA 1LZKA 4KIJA 1E61A 5GP1A 2BF4A 3HXTA 5B1IA 2A5DA 4K3UA 3V5NA 4NAHA 1TK9A 3CNBA 5HDQA 1VHTA 4YT8A 3O3OB 1YHZA 1UC8A 4Z54A 4GQBA 5G4LA 4KMSA 3WZLA 1G5FA 2EFWA 1NLUA 2YWCA 2VK4A 3ZHYA 3I42A 2X85A 4L4XA 7REQB 5SV2A 4ZYYA 2J1LA 4QNNA 3AB3A 1P9NA 4JB3A 3VWBA 3D8HA 2F4NA 4XD2A 2IHZA 4AY3A 3N2IA 2PO5A 2H17A 2HWWA 2M2EA 4LQDA 4OQPA 4RFSA 2X1CA 3ONDA 2EX4A 2JI4A 1N5KA 2PJRB 3AP1A 2HMSA 4EYQA 2DJNA 3TNJA 4PINA 1OCTC 2LK2A 3F74A 4QM6A 2QTAA 2GJ4A 3EBLA 2K4MA 1SOAA 3TRFA 1DT3A 10MHA 3WRXC 4CZCA 2UYCA 2IGBA 3I3LA 3GMEA 3FCCA 3RS4A 2B0LA 1UC5B 2AJBA 2QP3A 1RPAA 2J48A 2HNAA 4AWXA 4AZSA 3ELKA 1NP6A 1AKUA 2BOLA 2B69A 3DVRX 4Z1OA 4P7FA 4G0XA 3GHHA 3SSNA 3NEPX 3AR9A 4N41A 2YINC 5BQXA 1SUBA 4FILA 1SIWA 5IVPA 1EIZA 1C7ZA 4OB7A 3EWNA 4NBWA 4OQMA 1GXQA 4B73A 3NARA 4X61A 3ZIUA 1FXWA 5FKJA 1T43A 2FN4A 2AO9A 3CUYA 2HN9A 4D56A 5LQNA 3IUBA 4RDHA 5B6JA 1BYIA 3RCOA 3MN2A 3HXOA 1E9EA 5ALJA 2ZSJA 4AUKA 4IZZA 2DFFA 3WQQA 1PZMA 4J3NA 4PUSA 4V0LA 1F2VA 1S0UA 5BORA 3KAPA 2Q45A 221PA 4UNIA 3AJAA 5EL0A 5HRUA 2QUKA 3GP3A 3G17A 3MKLA 3Q6IA 1Z68A 3FYUC 5JIBA 2WV9A 3OE5A 4ZVKA 3V2UA 5HFJA 3PFNA 4CQLA 3RNOA 4XFJA 2CXUA 3FTEA 2P3LA 1QQ7A 3AMVA 3S2ZA 2VTBA 3MKYB 1CDDA 3O2SB 4U0WA 3VNUA 2FWIA 2IPLA 2A5GA 4MW6A 4CIDA 3H87A 2XVCA 1HNNA 4UQLA 3UHPA 3J80K 1NVBA 3HM5A 2I33A 3JU3A 1LS1A 4R2WA 3ZY3A 3ZHOA 2BJHA 5F7JA 1ODDA 2NVQJ 1JBQA 4OSPA 3C6ZA 4X8MA 1AX9A 5DYGA 1RMYA 1W36B 1X13A 1CUVA 2WJ6A 2X40A 4PBSA 4FHFA 3QVXA 4FHTA 3RLFA 1QGZA 4G8BA 2Y0PA 5I5GA 3AUXA 1J39A 4DJFC 3CF5F 3AI2A 4BO0A 5EJ5A 4J00A 3JREA 1J07A 2BEVB 3FNEA 2V03A 4QPCA 3EGXA 3CCVI 5JNSA 1ZSVA 1FP6A 1XDZA 3P4YA 3OJLA 1UMBA 4Y2YA 5CG1A 4EHBA 4A2PA 3FRHA 2QB5A 1ZG5A 3V7YA 3S14J 3URMA 1NG9A 1V5EA 3KVNA 5LWQA 3DBIA 4U6QA 5CDFE 1MMFB 3QE4A 4HLQB 2RG7A 1T95A 2C31A 3H9JA 2LD5A 2PMCA 1TTHA 5EZGA 2PVSA 4CZ2A 2ZSEA 4IICA 1N9GB 2OYRA 5KYXB 3HB1A 3A1FA 3ZE0B 2QQ0A 3LFHA 3BD7A 1FQOA 2YL2A 1B0UA 3JY6A 5FD8A 4TXHA 1AU9A 4PLZA 3BUSA 3OHSX 3SX4A 4CICA 1FYMA 2Z04A 4U1RA 5IY5H 2ZSBA 4DSZA 1BGWA 1RC0A 2V6EA 3I0NA 2JIMA 3EA5A 5AVVA 4U3JA 1NURA 1QUFA 2ZTLA 5JAPA 3OLXA 2A7XA 5LZ2A 3FWYA 2GM4A 3QX9A 1B73A 2Q0OA 2O0KA 4M1OA 1AZSC 2HZ7A 1MDBA 1T0BA 4EW6A 2OO5C 2OILA 3RRMA 4JEHA 3TDNA 1SVKA 3IODA 3RT1A 4BH9A 3ZE1B 4U6SA 3L84A 5HZHA 3CEJA 2CUZA 5I6DA 4B75A 5GZ1A 3U3ZA 2C29D 4DV0B 2VK8A 5GADl 1JHDA 3HBAA 1KFBB 2HSDA 3KTOA 3R77A 4K9RA 4JB8A 4E5VA 2KQUA 3RHTA 3A70A 4EPWA 4EO7A 5IDXA 4C2UA 1QGYA 3AF6A 3STUA 3A11A 1VKZA 3PSIA 3MZHA 1TMOA 3A32A 4JAVC 4G0ZA 1PFUA 1E1CA 5K5EA 1P45A 5CAEB 4C14A 4ANJA 3HCRA 4DIQA 3I2IA 1QV6A 2NOGA 1K2VN 3G49A 1W76A 1SG6A 3L1UA 1UP7A 1P72A 3STVA 4H0NA 5GOTA 3WYFA 1FX7A 1N25A 4LK0F 3SJMA 4I1YA 2MGQA 1N9ZA 4R1NA 5EJ9A 3LO5A 1XRLA 2AOUA 5K3BA 3T7RA 2CUJA 1BU8A 2CF5A 2CN1A 1C30A 4A5MA 4I9NA 5CP8A 1ZRDA 1M8FA 2QQAA 3OOJA 4XWTA 4I2VA 1N75A 2JPBA 3H9GA 3OM8A 1NV9A 4TRNA 1E1YA 4UFOA 3TLXA 3IE0A 1ZS9A 1H42A 5GM1A 3FHTA 3CD6I 1U3FA 3FBWA 2Z5VA 4EY4A 3H4MA 1QIFA 4YQZA 1ZM9A 7AT1A 1IXYA 3NR2A 1X1DA 2O0JA 2O2DA 1ACMA 1IZ8A 3MC1A 4TKLA 3HNPA 1PFGA 1UK7A 4HAWA 1OBCA 5TR9A 4I55B 1CRQA 4Y6OA 4LI3X 2WF5A 4D1YA 1ZGJA 2CDCA 4KQKA 3TB6A 4UEKA 4OK5A 1WXWA 2J0QA 3T7AA 3A9RA 4X1IA 1PNVA 1SCJA 1SFOJ 3F5SA 2B0JA 1E59A 3OS2A 3TKYA 1G6HA 2C0CA 5K3FA 4NPAA 1PU2A 3FAKA 4M98A 1IUFA 2HT6A 5C2JB 4IJ6A 4YMSA 1O87A 4BFUA 3GRFA 3OLWA 1WF3A 4P5PA 1ZHOA 3E48A 3H17A 1NXXA 3QLTA 2ZNYA 3R44A 2BDEA 1BXRB 1KEWA 3SC4A 5JARA 2YUSA 2IVZA 1E7QA 4DCMA 1F2TB 2CEAA 2P77A 2G0AA 2WYIA 2IQIA 1FP7A 2WWTA 1LE8B 4KMFA 1MDMB 1WW2A 2D13A 4GFDA 4YALA 3LSHA 1S8NA 1QONA 4I98B 1J8DA 5ADVA 4E5NA 2ZUTA 3ZGNA 1F2UA 1WV0A 2HHLA 2PJUA 3LHIA 5TPZA 3OZIA 3WB0A 3I5XA 2Q2EB 3ST7A 5L3SB 2XT0A 1HEUA 1WI9A 4TYQA 4JP3A 2BTOA 2Q0HA 3ZS8A 1NAIA 1CS0B 4GKVA 1VBKA 3U9SA 5CFPA 4IHQA 4F91B 1O3TA 2MSNA 4RM3A 3WMRA 4MCHA 2ZDHA 1QKIA 3GFBA 5BMZA 1UMCB 1MH9A 2J3QA 2J9ZB 3SZOA 4TRRA 3L82B 3PPYA 5BNGA 2W58A 1BWSA 2JBWA 1Y1KE 3EDCA 1CJBA 3K0CA 2HMAA 1YW9A 1M2EA 5IFLA 4EITA 1V8DA 4BVLA 3QK7A 5C4XJ 4JLUA 1ZRFA 2D1TA 4UASA 5JNVA 1DIHA 4Q3BA 3OZ7A 3N8KA 3DLTA 1RIFA 3A37A 3RFFA 2ME0A 2H1VA 4D9GA 3GLIE 2JGDA 2RMKA 2H48A 1QAQA 2JPDA 2Q27A 1YAJA 4TV8F 2J4FA 2VYCA 1XGNA 1MGPA 1JGSA 5IXSA 1P91A 5DCMB 4DYHA 1OUMA 3TXXA 4IP0A 3C4QA 5G4KA 2R4TA 4K9QA 1WDTA 2O3TA 5A6SA 2ID7A 3BD6A 4OMFG 1KK1A 5LXTF 2PYDA 2UYOA 3IA2A 4UUQA 3SGLA 3DFZA 1UWVA 3AAFA 2HD4A 4BLOA 4D74A 2VHXA 3NMUF 4CYMA 3S2GA 3TH5A 3JALB 2B8JA 5DNUA 2RN7A 3OZTA 3LCCA 4CKWA 2D0PB 5BYBA 1IN5A 1RQPA 2C9OA 5J43A 4DQKA 1WXFA 1UBEA 3PP8A 3LHSA 3BHIA 3BMOB 4BL5A 2ZETA 5GJWC 4GBGA 5JV5A 4Q5IA 2B25A 4YMVA 4FMDB 1WB4A 1HGXA 2V6FA 5FFFA 4LXGA 1BM9A 2OLEA 4TV9B 1T9AA 3DULA 1C3OB 2COUA 4V39A 3KKZA 5GAJA 4XQFA 4MQFB 4QFMA 4CNBA 2HCFA 2BTQA 2UXXA 1VFNA 3WOVA 3LT5A 4PFJA 4CZZA 2CVQA 2NU7B 4M0DA 4X84A 2Y2VA 4IKFA 2YXLA 2JVIA 2Z3ZA 3EYIA 5DTIA 4DQXA 1PR5A 3HZRA 2ZJ7A 4BAUA 1Q7GA 3V6MA 3T61A 2C7BA 3CLVA 2A9KA 5DNYB 1R9TJ 4YT4A 4RPGA 3BCHA 1QPZA 4P55A 4RLHA 1VG0B 4BKOA 2FFAA 3IRVA 4O08A 1Q5PA 3T9FA 3MS2A 3L0IB 3TDUC 5JE8A 3E2PA 2PUCA 2VIIA 1JGTA 4X54A 5TNXA 5IYBJ 4OXRA 1I3OA 3IP5A 2AWNA 2YNMA 2QRUA 3I8OA 3PEFA 1F43A 1XB2A 1ORKA 4TTSA 3DP9A 2PX5A 3PB3A 1DTWB 1ORDA 1OX4A 2CZGA 3TIXB 5LBUA 2VN2A 4MAAA 1OU0A 1RKWA 1T1EA 4ND8B 1K8RA 1OJ7A 2X4HA 4N0BA 1XTJA 1HDPA 2IUUA 4ALMA 4DCPA 1TUBB 3DEKA 1YRYE 2RJOA 1XWFA 4OL9A 4PCUA 1ZPDA 2ZUBA 1K6XA 3WLAA 1GLNA 4AUMA 4IPTA 1F4VA 3RRJA 2LE0A 1K3TA 4IXNA 2ZTUA 5CH3A 1ZH8A 1WNFA 2NNLD 1XMKA 2W8BA 4TN1A 2GPNA 3CLSC 2EAUA 1G0NA 2TRSB 2SNIE 1M1NA 3HKDB 4H7PA 1T1IA 5JQGA 1SRRA 1E5VA 3AKDA 2NP7A 2QDXA 4B6JA 3L00A 1W5TA 3W3AA 5ANRB 1XMQB 1KDPA 4AROA 2R44A 2FPIB 2ZRFA 1L3IA 3ORYA 4YC7A 1DKUA 3WDSA 1O4VA 4JBNA 2ROQA 3K09A 1IVSA 2CB0A 2YRWA 5L3FA 1K68A 1KU2A 3FZNA 3I09A 2AZDA 2AZTA 1EGMB 2O6GE 4Y9SA 4PSAA 2MWMA 4RO0A 5FBWB 2H3HA 4ZRMA 3KZVA 4DUGA 3VPAA 2KLHA 4FU0A 3VUEA 1L7PA 4BE9A 2Y66A 1ZG3A 6Q21A 1CUDA 4BJ1A 2O2HA 2AN9A 2D62A 3VDXA 1HYGA 2N3ZA 3HWSA 3ZGOA 3VZDA 3OYNA 2DO7A 2IITA 1JLMA 2HV8A 4MQUA 1I5ZA 3JD0A 3G1TA 2JRCA 1QX4A 2ZZKA 1E66A 1M2FA 5K5QA 2I2FA 1UBHS 3SE0A 5AJTA 4X60A 2KX7A 4XIFA 2WUEA 5GGYA 2H1RA 3ZBUA 2JS7A 1J0DA 4L9NA 3L05A 1FFHA 1TK2A 2A67A 1T4CB 4AZTA 4PG8A 2KL4A 1ES9A 2XWSA 4LDNA 4BB5A 3S8EA 4DM4A 3Q1KA 1RI1A 4WY5A 4IOLA 4MRSA 2LCIA 3TJMA 5BR4A 4IRUB 1R0ZA 3CH7A 5C7YA 2XEDA 3BOSA 1QH9A 3TW6A 4M4SA 3ZXYA 1P0QA 3OWOA 3WB2A 3GT7A 1J59A 4BB0A 3WL4A 3BZKA 2A58A 3ETGA 2Z4SA 4W7SA 4L9VA 2I91A 1X14A 3T0IA 5ABPA 2EINH 1YR2A 4YACA 4Q7LA 1JJVA 1XEWX 5IVHA 1ZJJA 5AK6A 3RC8A 4XR4A 1XCOA 3VU1A 4BFZA 1NA5A 3NORA 3GP5A 2ZGVA 1T6ZA 2UUZA 2EFNA 1NLFA 1WRBA 3HEMA 1PJZA 1YZGA 4UNOA 5EGNA 2UV1A 3DZDA 7REQA 2VKEA 3QYFA 3DLIA 4L8LA 3WTVC 4I1OA 5E8RA 2MYUA 4OYHA 3ZV6A 1WX1A 4L5CA 1DXQA 2JWTA 4XGNA 2XAQA 4LVNA 3H19A 3IP6A 3BY6A 5AI9A 1L8AA 1NRIA 5DLEA 2QGFA 2G1AA 3JV7A 3JCZA 3NO4A 5AT1A 4A2WA 4BFYA 1H8AC 3PEUA 3H11A 3IKLA 4JP2A 2N46A 3O2QB 1O95D 2XQFA 4N9HA 4NTZA 3T5CA 5JZBA 3E9NA 1NJ2A 3OOSA 3DGFC 4CCNA 5AJUA 1ZR2A 1O97C 1OFIA 3WB1A 3VNSA 1A9XB 1T0IA 4EPXA 2VK1A 2O20A 1J8VA 5I7OA 5LA6B 1SKBA 4A03A 3MGGA 2WYVA 3WTZA 3TKLA 3IR7A 3DM9B 5I7SA 4XI9A 4EUKA 4DMMA 1J20A 2I2XB 2Y0CA 5EI5A 1Y63A 4N5NA 1DLJA 2CXOA 1X7XB 4UHKA 3QV1A 1M6HA 1DDIA 1UBSB 5FXMA 4F4HA 4C4YA 2WV7A 3HG7A 2RV8A 4UEWA 5D51S 1A4IA 1Y5RA 1QV9A 4AWAA 4DMLA 2GN6A 1XMOB 4JV5B 1LDEA 1H0KA 4UBJA 4HNAB 1O5IA 2W9XA 3GDHA 4F5YA 2L9SA 4QDJA 4TXMA 3NUZA 3CG0A 1PQYA 4JYKA 1NJ6A 1Y98A 1R15A 2DR2A 4H4CA 1P5ZB 3PGMA 2WAOA 3ZN0A 2VF2A 4PZPA 1DEHA 1PQUA 4S0HB 4MP3A 2PUBA 3OKAA 3DOCA 1Z75A 5IDQA 4A8JB 1OZ0A 4QOJA 3EETA 1UOOA 2JAOA 4EGAA 1MHPA 1ABEA 3A03A 1J22A 3D4LA 2D2XA 1NYLA 1JI3A 3HZZA 1KAQA 4OYYA 1HYQA 1U3TA 3GY0A 5JH7B 5CVUA 3JYOA 4K26A 2BP7B 2QMHA 2ZJQF 3QG5A 1HE4A 4RDIA 2QJOA 3LX4A 3I6MA 1NLZA 1QFZA 5B5EC 1ZOPA 2ACKA 2FETA 2ZKIA 3D43A 4EHLA 2RONA 2Q46A 4ZTFA 3H5AA 3S5UA 4EEKA 4EYEA 1JKQC 1IOZA 3MLEA 1T9CA 5LZ4A 4WX9A 4YRJA 4CIVA 1UC9A 4HOYA 3RYPA 1FSHA 1YJ9I 3CRZA 3BTUA 3HXKA 5K0GA 4OHWA 2TDXA 4KIWA 2A61A 4A82A 3L5KA 4ESHA 2A0WA 1E7RA 2D2FA 2DY1A 2PAFA 4GSLA 5B64A 2QRZA 3RC3A 1HV8A 2AH5A 3IVMA 1BMFD 2ZWVA 4LBWA 2A0KA 1Y82A 4X7RA 2KI5A 2ZJOA 1XZMA 2W0SA 4C7OA 4B0OA 1YQEA 4H4KC 4PZEA 3QKUA 3KPUA 1UKBA 3MZ0A 1KKMA 3UJ9A 3B02A 2LG4A 2ES4A 1E6UA 2NRAC 2PT5A 1J1UA 1IBKB 3H35A 2VZ8A 3GNTA 2HADA 2FRXA 3BC8A 4KRYA 1CEXA 1B6RA 4O2LA 3DB2A 1XDBA 2HOEA 2HQOA 5HMLA 1AD2A 1CF9A 3BIXA 3A9UA 3QBVA 2IS6A 3E6DA 4ZU6X 4GH5A 1RABA 3T5DA 4IDPA 1W5FA 5J2UF 4ENVA 2L2OA 5LZ5A 2CVHA 3I9NA 4MTLA 4QRDA 3LUAA 4IQ4A 1NONA 1P7IA 4ENTA 1L4UA 1DZIA 1C0KA 1ZL2A 2WZQA 3WBBA 5IT4A 3BJMA 3UKGA 1Y8ZA 1E1RA 3WP1B 4DWVA 1SBHA 4IBOA 2O07A 5MGBA 1NY5A 2BV3A 5I4BA 3DQPA 3B7GA 2ZZNA 2OB1A 4IJ5A 4HPJB 4MOWA 1UK6A 1MO2A 3FCOA 4E14A 3R9KA 3O21A 3V42A 4NCJA 1PKXA 5L3RA 1UQTA 1IY2A 3SJBA 3ZDXB 1Y1SA 3D7LA 1Z4JA 3RYCB 4D0LB 2R85A 3E4CA 2FPOA 1L7MA 1RRMA 5BSVA 3LF2A 5JRDS 1ENPA 5HCIA 1RYZA 4S1NA 5HZMA 3LO8A 1YHYA 4YRAA 5JMPA 4N3BA 5HKLA 3D8UA 1FPQA 2OXIA 1E6CA 1JTFA 3RWOA 1CDZA 4G4JA 2IPNA 1XVIA 3KEYA 1WQ4A 3DLCA 1I9GA 3TRHA 4LCEA 2V6JA 4FW9A 3RRBA 2O2CA 4ZYLA 3CF4G 3D1VA 1Y1LA 3FPHA 5FV4A 2VUHB 1JPJA 1GKUB 2ZUSA 3EFOA 4FBGA 1UBNA 1L6IA 1JKIA 4WESB 3PEVA 1XU7A 1LDJA 1A04A 5JYDA 3JTGA 2YFQA 4E6PA 1H6AA 2W2VA 4LHXA 1VE7A 1CJSA 1DBSA 1Z07A 2P4WA 2LNBA 4QDUA 1BEUB 4X71A 3KEOA 1G8AA 3KNZA 3SZPA 2EVWX 1II9A 3JYQA 2R2GA 5LVAA 4BWYA 3H2KA 1ZM4A 4LECA 2XYGA 3DKPA 2GK6A 1DKPA 3BFXA 4AIHA 2QX8A 3B51X 3L4BA 3DBVO 1CZUA 1CNFA 1U8TA 4Q16A 4B7CA 4Q9LA 1JPVA 1FFEA 1OZFA 5EF6A 4JC0A 3IUPA 3E97A 1XHEA 1U94A 5YASA 3EGXB 2GTPA 1ESMA 4ESOA 4RLQA 4XKWA 1NW4A 4E7IA 5HF5A 1MKYA 4G24A 3V48A 2GRUA 3ZQUA 4ZI3A 1H9AA 1IF1A 4X1YA 1G7CA 4QJ4A 3VFDA 1YFLA 5A5FA 1TZJA 4IDGA 2IH4A 3AUJB 1B3RA 2I6TA 4Q9DA 5AUQA 2PANA 1XCGB 4Q24A 2JCXA 2AE1A 4BNJA 2FTKE 3EZXA 3P96A 4WY8A 1GGMA 3DDUA 3QVUA 1R6DA 5T6MA 3QNWA 1BEZA 4M22A 3QVGB 4MW9A 4Y33A 5AM3A 5A5GA 1ZK2A 1ZGBA 4MEJA 4KFUA 4YRNA 3HSEA 1YJQA 4KLCA 4BFXA 1FQWA 1F2TA 4KI0A 5L40A 1H4TA 3SR0A 3LBHA 3OQBA 3G59A 4GZ3A 4G2TA 4J4BA 4MFDA 2NQ8A 3PYLA 3ZLBA 1VKJA 3RTDA 1FYXA 4FCTA 5DU2A 3PGVA 4QDKA 1N6PA 3MWLA 2J3LA 4AZ3A 2Q2EA 2VNKA 1FU4A 2QV7A 3QKSA 2FPKA 3FXRA 4DUPA 1SURA 3MPUA 1HSOA 1PJTA 3C5CA 1J49A 2V97A 3UTCA 5H59A 3EDQA 5THKA 2WSMA 3K4BA 1HI9A 5ESDA 4JZKA 4QJ3A 1DC3A 1UBGA 4Y1FA 5IPFA 4QUJA 2WG2A 1LLUA 4RY0A 1KJ8A 1KYQA 2BFAA 2H94A 3LP6A 1QAMA 3HTXA 3QTLA 1V6SA 3BJIC 3I9KA 4GYYA 1EE9A 1PNTA 3C7KA 4AJIA 4C6TB 5I51A 4X62B 3LKVA 4ON9A 2DT7B 1CWUA 1E5QA 3CNQS 3C8DA 1Z0SA 1D1CA 3FH0A 3AZPA 4LLLA 4FR0A 3ZU3A 2R92J 3K70D 3L1HA 4HFMA 1QZEA 4HO1X 2X8WA 4ZICA 1V7CA 1GAEO 4E22A 1O94A 5D3ZA 1UJNA 2EGGA 8AT1A 2BMAA 1H0RA 4NCHA 1D0SA 2BGKA 2VPWA 1OE0A 3FVQA 2ZJPF 1IHDA 1UHSA 1TZCA 2DSNA 1R64A 2AOUB 1QWSA 2QN2A 2DWQA 1L3LA 1C30B 1A5ZA 4JJGA 1TCUA 1I7SB 1AC5A 1XQWA 3T35A 1F4LA 2NNWB 2GZDA 5BPHA 3QPCA 4U5XA 4AYBN 3AK4A 2ZRPA 5GIOE 3KKMA 5H20A 5AKHA 2FY8A 1WCMJ 4MUGA 2HI3A 3JALA 1FX0A 4R31A 2OHVA 5G0UA 1EIWA 4OTZA 1P80A 3FVWA 3OYIA 3UICA 4OAYA 2B2CA 3RR2A 5DGCA 4BUCA 4CL2A 5K01A 2F1IA 3DO6A 1DQNA 4C4TA 3BMOA 3E4DA 4E7LA 5B57C 1LS6A 5J4YA 3RVKA 3WSTA 3AF5A 3V7WA 5I4IA 5GOZA 2VDRB 3ZZNA 3L1PA 2COBA 3VR6H 4C9BA 2K4BA 2NV6A 4F9GA 1CJMA 4DB2A 3A1TA 2C2GA 2G8NA 1TZ2A 1PUXA 5KJEA 4MQFA 4X1IB 4BBRJ 1YE5A 1KJQA 1GPYA 4XNFA 1NVDA 3ESWB 3MXTA 4ILEA 4HADA 1YWGO 4BO4A 5M5WJ 1OI3A 1T35A 2OHHA 3SHOA 4AIIA 4JR1A 2E1PA 2BUBA 2XA2A 1S02A 1DP3A 2ME6A 2CS3A 3DOOA 4R71A 4ZCSA 2ZIWB 4BBJA 5HS9A 5AW9A 4DR5B 2BFWA 3UHFA 3KQNA 3IQHX 1TEZA 1ZC3A 3A2LA 1N7HA 4EAQA 1IHXA 1WUIS 1QRDA 3N2ZB 3GH3A 2N0SA 1Z17A 1OQYA 2QX7A 3BDAA 3C15C 2D0DA 4E03A 1F2UB 3VR5A 1E8MA 2O2EA 3PJGA 2LR8A 1TKCA 1DIAA 5IMBA 3QLUC 1JR2A 4CKZA 2ZCJA 4ND8A 1K0UA 3IUQA 2GVDC 4BASA 3IPRA 1ZK4A 2IUFA 3WADA 3V8RA 1TUBA 2DWOA 3WGLA 5AQEA 4F04A 1EUQA 2ALJA 1ZRHA 1MB4A 3WLFA 4DJAA 3MXOA 4EPTA 3X44A 3GEIA 1PJ2A 1EGHA 3O31A 2C4VA 3KJXA 1VYTA 3FXMA 3CHYA 5ULLA 3VOTA 3E1KA 2RGGA 1BIBA 1XFDA 3ZCUA 3CKLA 2JLAA 3HWRA 1JQJC 3UJBA 1U7WA 5FAKA 2VB6A 1C4KA 2P9HA 4GZ5A 4CETA 2G9NA 1XNRB 3IP4B 2WKPA 1K0FA 2FPIA 2JAWA 3Q85A 1IK6A 3UJHA 4MVJF 5FUYA 3V8EA 4XSHA 1Y3DE 2JGDB 1SZCA 2QEXI 5CB0A 1ADYA 3L7AA 3EVFA 3QLEA 1MIHA 4LRYA 4OM8A 4HQLA 2AHQA 1LNZA 4RGRA 4N9WA 4YFXF 3RKRA 1XROA 5E4TA 4BBAA 2HV9A 1QK5A 4OLBA 4UE2A 2H5IA 2XMCA 4DLLA 1WKBA 1XDDA 5EKSA 1O2DA 3BB1A 3ZGVA 4Q3AA 3WNDA 4PN3A 4RK5A 2REXB 1V45E 4B3JA 5G4KB 2XAGA 5G2OA 2J0UA 3AIMA 2FCAA 2WFMA 4TV7A 3DPSA 1HNWB 2BYTA 5A6SB 5DLQC 1K4SA 2W6CX 1GZVA 3NTXA 4J0EA 4G0PA 2QLTA 2M6KA 4QTYA 4G5RA 3W1EA 4PYQA 1L4GA 3TUIC 3UNGC 3HYTA 5I7RA 3KFWX 3HTUA 3RBVA 1CQXA 4PQEA 1LDMA 1BJRE 4EVSA 4ARIA 3P2MA 2CE7A 1T39A 4B1RA 2JNWA 2W2QA 4QPNA 4RTRA 4J9UE 3BC1A 5FOVA 2ZBKA 1O77A 5CNMA 3WWZA 3BFJA 4S04A 4C89A 2C4TA 1USUA 2HO4A 2FN3A 4BLVA 4ZALA 1U1GA 3KBOA 1XCJA 1RNLA 4LHZA 2RREA 2VNJA 2WZCA 2IBDA 4Q19A 2EFQA 2ZCUA 1U0LA 2PE5A 2ZB8A 3P4UA 4EPVA 3DV9A 2BTQB 2C00A 2H0RA 1UXGA 1JE8A 2PPLA 2HQRA 4GOJA 4UCWA 4E4YA 4CCAA 4F72A 1NUUA 4KKVA 1QQIA 1HH4A 1M1UA 1NHGA 2OA4A 4I9GA 1FBTA 2RH9B 3ZD9A 1WBDA 4NYJR 1H3NA 4HAUA 1Z3CA 2LBFA 4L74A 4QYWA 4HI0E 4J07A 2B5OA 4F12A 2V26A 4P5OA 3NAZA 3CP2A 2EQAA 4HDMA 3QGMA 3EVGA 2EZ4A 2PKQO 3HDHA 1J9GA 2GD1O 3DKRA 5DI9A 4WT7A 1LEAA 1EKXA 1KO7A 3K72B 3LZDA 3E3VA 1B15A 1LJLA 4N5LA 2JGRA 4YMLA 3LTNC 1UDAA 2HNHA 3FFAA 3OC0A 3M7GA 3SXPA 5DT2A 3OG9A 5KNCD 2ODQA 4UVCA 4LXQA 3ULKA 5KWSA 2FEOA 4GOLD 4RJ2A 1J2XA 2VUTA 2X48A 4MVJH 4JFAA 2DT6A 1YQDA 1KQOA 1JFLA 2XCTB 1BRMA 3LM8A 2XF8A 3LLCA 1U1EA 2FA9A 4W1RA 3DU5A 2P6MA 1RYFA 1ESCA 3DBLA 2W8BB 1RLJA 1PEDA 2DOEA 5DB4A 1QIHA 5JQGB 5LA6A 1X42A 4LS3A 3RAFC 2OK7A 4OF4A 3DWEX 3LBAA 4C30A 1RHJA 1I0ZA 1D4ZA 5COQA 2VSYA 3E5RA 3HEFA 4UHBA 1R0KA 1NVKA 2BGWA 3ZHCA 1AF4A 2O2GA 3TLAA 5IM4F 1ZIPA 2ZROA 1MV5A 5CFNA 3GZ5A 5B12A 1MHTA 5DNEA 5LOVB 3UENA 1E3IA 3MCTA 2P4QA 3VYVA 4FCYA 2K3PA 5H6RA 4BLUA 4JQCA 2DPYA 1V3QE 1Y8QA 1PK7A 3T6KA 1LNSA 2OV1A 3J7AY 3LY8A 4RKFA 3HOTA 1Q0LA 4P93A 3PGLA 1IO2A 2WLSA 1K61A 4JL5A 2EQBA 1G9TA 5FOUA 1O3SA 4QBIA 2R47A 3NPAA 4MCAA 4RCZA 1W7PD 2OQ2A 2X5KO 2ZS9A 4RAQA 1BKYA 1MAHA 3VPGA 4K87A 3DYBA 4RVSA 2ZULA 3KETA 4C04A 4BQRA 4FWIB 1Y9AA 1VL5A 3VPRA 2NUAA 1SQ6A 1NWCA 1PS9A 2WE8A 3Q41A 1ZLJA 2CMGA 2GSDA 4KIUA 3EUEA 3ASNH 3BAFA 1YB6A 1S2GA 4TN5A 5E7MA 4L3WA 2E37A 2DY0A 1U0EA 4CMJA 4HFRA 1YCDA 3WFIA 3H86A 1UBOS 2BP7A 2HREA 4Q3LA 2WV1A 3GFVA 2DAPA 1GZHB 1I1HA 3QLVA 3FYDA 1ZIDA 3BCAA 1DCMA 3HO6A 2GZAA 2IQ5A 1GCUA 3HPRA 4IGFA 2RBGA 1BQ4A 5BPFA 5AJZA 4JSRA 2BGTA 4FI3C 1H6DA 5FPSA 3S93A 2R1ZA 4NWIA 4PZ0A 4WKNA 4IHTA 3N07A 5E3MA 5EHNA 5J4VA 5EIBC 4HNSA 4YJ3F 3VO1A 5A71A 2MINA 1XTKA 1C4OA 1GM5A 2IYAA 1BVHA 2RHMA 5EJCA 5B4VA 1NYRA 2SCUA 1CDOA 2X1HA 1DU4A 2N9UA 3PJFA 3W5CA 4AJ1A 4RGUA 4TXLA 2C7RA 3OAAD 4QUAA 3LGXA 3QFCA 2KLOA 4PG4A 3KL4A 1D5VA 5E6RB 1QBJA 1U4SA 3H11B 3KAQA 1I3NA 1L3BA 1UK8A 3OZFA 1RR6A 2WE7A 4HWOA 4OA8A 2ILTA 3LOCA 4GPZA 1SFEA 4Q7QA 1YR3A 1U1FA 2OZ6A 1TQ2A 1MB0A 1VQ5I 1XELA 4M71A 2GJ8A 3H3ZA 1IBMB 2DMQA 3L92A 3A8TA 4H7FA 1CUCA 4ZMRA 1LZLA 2GJAA 3GGPA 1GV0A 5JADA 4FOTA 2DBZA 3L0YA 3VKHA 1DEOA 4G4GA 3GUYA 4DQ0A 2JLYA 4BQNA 3LC2O 3F0CA 2EW8A 3M07A 2FFQA 3OZSA 4ZIRB 5T4FA 4MDFA 1XN1A 4Y6LA 3EZ9A 2FV8A 4M0LA 2JN6A 5EQFA 1QHXA 3A26A 2VS1A 4Y2SA 2IU4A 3HIFA 1KIMA 2IY9A 4FPXA 3LPNA 4MVJE 4HQEA 1P4AA 2LKPA 2DHRA 3RYCA 5J1SB 2EHDA 4YMIA 1RYYA 5H0IA 3OFJA 1ZD4A 2XX3A 4TKZA 5A5VA 1MMNA 4KGXA 4IEIA 1IDN1 2IYUA 1EHCA 2EJBA 1GRRA 4TZTA 3FXAA 3VR3D 4XXHA 1ZNZA 2FHPA 1XN4A 5L9AA 3T3OA 3I6ZA 2GYWA 1VPVA 2DBQA 3DC2A 1DJMA 3E9EA 1TQPA 3C2GA 2F1RA 5JZSA 4P3PA 1D8JA 2UU9B 1HDCA 4ZP1A 3M6MD 5T3UA 1KGDA 3IKJA 3KPYA 2F8TA 3IIKA 1P75A 1Q44A 1PUFB 2H4ZA 3L6RA 2EFOA 4WESA 2W22A 1NASA 4RF5A 4JJEA 4K6MA 5HTOA 1ETXA 2KIMA 3GGSA 4RSRA 4ZMBA 1QFMA 1LWOA 3FKSA 3I8XA 3F90A 2COKA 2OWEA 4Y6RA 2ENWA 3ZQKA 5TPZD 1U04A 2ZT5A 3IBGA 2BEOA 4JHLA 4G0YA 4LHWA 4BQFA 3HPHA 1VBNA 3V55A 3U2QA 1JTXA 1CB7A 4RH0A 3PC3A 3FA2A 4D3FA 4HQKA 4IJWA 1RHUA 2RGXA 4LA4A 1NIJA 3IURA 4LJKA 4XFKA 4M1YA 3D64A 3MS7A 2WC1A 4OOIA 1G1MA 4G25A 1KI8A 4MVYA 1R88A 2IHVA 1Z0UA 3CKMA 5FUXA 4C7OB 2HAEA 2HLPA 3O94A 4JXJA 2FQQA 4NOJA 5FFNA 2CNBA 5HDGA 3KQQA 2ZUUA 4Q3DA 5BNTA 5LD2C 1TQ8A 5HNHA 1KAHA 2H18A 2FOIA 1ZINA 2PKXA 3JAWA 3R7DA 5KSWB 2A86A 1NZFA 1R9NA 4YB8A 1GZSA 3QVGA 2IHYA 1GZ4A 2EFEB 4UV8A 3O4RA 4ZDOA 3SYTA 4QUIA 3KVOA 4G9GA 1LFAA 3G8BA 5C5IA 2CBXA 1L7DA 3PXCX 4CU5A 4IQ8A 1GGJA 5KBYA 2VQFB 3SAJA 1NDHA 2H7YA 1YDWA 1ZJZA 421PA 3K6GA 2GMWA 3K30A 4A2CA 3I04M 1JIIA 4RKEA 5JXJA 2HLDD 3TD2A 4V0ME 4Z53A 4TL9A 2BY4A 3CO6C 1T2AA 2ODEA 5HBGA 1VE6A 4OJKA 2EV0A 1RWBA 1AKWA 3ZTYA 3GT3A 2OFPA 2BFNA 2XUQA 2O9LA 2WUFA 3MN1A 1H2XA 3B7PA 4LKOA 1RKBA 4RB2C 3EGVA 3ERED 2J6HA 1IIRA 1U5TB 4O4IA 1LVGA 3RUHA 3IUNA 1E0JA 2G83A 4BRWA 2X1LA 3RK4A 4C6TA 3HB4X 1ZA1A 4FD2A 1QK3A 4YCLA 4NCKA 2LGJA 1D2MA 1XDGA 5ILUA 4DS3A 3SOPA 3OWTA 4YXWD 4ALJA 2FSVA 3ZDBA 3FB1A 1TTQB 5LLTA 4UUBA 1LVHA 3U1KA 1LK5A 3MJFA 4UPEA 3NUGA 3M82A 2CGPA 3EFOB 3TRKA 2R00C 5PNTA 2VDJA 4WNAA 4REOA 2A0FA 2HOAA 1E3TA 1U2QA 1CUBA 3A1VA 4GKKB 3OX1A 5IARA 2WPDA 1E0SA 1KYYA 1LBTA 1TKRA 3FXLA 1FA9A 5K3SA 4Q15A 2GF0A 3R0IA 1H0HA 3TBFA 1Y4SA 3LUJA 2FMLA 1G7RA 4OIFA 3K9WA 4XLPF 4RK0A 1WTAA 2IJGX 3BTLA 3ZD7A 3QE2A 3OEEA 3EPRA 3BWCA 1O54A 1C0EA 3BMCA 3UC5A 3IC5A 1ISFA 5BSGA 1VLMA 2HPHA 5HJ5A 4FR5A 4KIFA 4KUEA 4ETSA 3M6XA 3SYMA 3NT4A 3D6MA 1G59A 4YPOA 4M49A 2QW0X 1SELA 3EEYA 1BS9A 5DNAA 1A9SA 2XCRB 1SUDA 1ZKGA 4BAGA 5FNZA 4DPKA 3GBVA 2AEJA 2IPAB 4IKOA 1RWNA 1QVUA 1XTRA 2F9LA 4MGKR 2QVZX 4X1YB 5JJBA 2FFBA 3HCOA 3MK31 5BSEA 3ES9A 3ILHA 3KZZA 3HGQA 4YT5A 2FZ5A 3B2QA 1CUJA 2OCDA 1JZSA 3ZZ1A 3SHQA 1RWPA 3W3ZB 3NETA 1QB8A 2XBUA 5TY0A 2CLIB 2E1NA 1O6FA 4G4SO 4JB2A 3NB0A 3IQZA 3V8QA 2H2DA 3I64A 2C78A 1JR3A 1ZGHA 2O52A 2P2SA 2X0FA 3IHKA 1EI9A 3WRVA 3LYHA 3I59A 4V1CI 1XB4A 3PE3A 2G9UA 3UG6A 3S3MA 5DE3A 5FF9A 5GP9A 1BWPA 1J0XO 4MQ5A 3KB1A 1OFUA 2C4NA 1C1YA 3VYSB 4DBRA 1KGSA 1BOOA 3GJSA 2CLFB 4HRAA 2C03A 2YICA 3VHXB 1NP7A 4AZ3B 3QKSB 2IHBA 3U3JA 2P8TA 5H9WA 3F6EX 1SC7A 1P77A 3DS8A 3FW1A 5CH5A 3B5IA 2NS8A 3ANMA 1PD1A 4EW2A 2XMBA 3VOSA 1D03A 3D02A 1BL0A 1D0IA 5TDHA 1G17A 2NPIA 1S4QA 4IJVA 5HODA 1DOAA 4P3OA 3BFPA 4RZHA 2RHDA 1VPWA 3I0ZA 1R49A 2ZYHA 4RZ3A 4ZYHA 3HGMA 3OJWA 4OKSA 1WU8A 1TIPA 4UZEA 3HCFA 5FLXA 1ZIXA 2ZAMA 3N39C 2XRNA 1UK9A 3NHRA 5I3CA 3ZCOA 3N2KB 3LHDA 2FN9A 2EG9A 2AQKA 2X8BA 3D6FA 1Y9EA 3S2HJ 1VHQA 5B5SA 4E5SA 2JL1A 2IYPA 3OS1A 3MF4A 1Z35A 5H3CA 4U7JA 4AO7A 2HXYA 1FVHA 3EYYA 3BG3A 3BG9A 5C31A 4QNMA 3U16A 3WGJA 4TKMA 2CLCX 3DV0B 4GAEA 1UBUS 4X93A 2Q1XA 1PG2A 3TGNA 2ZUFA 1KO8A 1T2FA 2VJLA 1SXJE 3JQ9C 3QKTA 4IO0A 4JJFA 2EWNA 5EIEA 4DNOA 5K8LA 1IOWA 3N0XA 2BHYA 5G0VA 2BVMA 3GFIA 1KYTA 2G06A 2D5BA 2ZYDA 1FX0B 4RV5A 2R7SA 4CF6A 4AMVA 1AB5A 2PT9A 1JHRA 2PSHA 5BQ3A 3K1YA 1C0IA 4A3CJ 3ELBA 1A97A 3I4PA 1SD2A 3V1MA 1VP9A 2HUPA 3JRDA 1LW7A 2B3DA 1DT5A 4KN7X 2ZEJA 4RELA 4IXAA 3MFYA 2FE4A 5ALNA 3G5AA 3VDNB 3UA3A 2BGNA 3BK1A 2VFAA 4GC5A 1H9CA 1YITI 3FOZA 3E5NA 2EP5A 2W90A 4I50F 4Q12A 3LA6A 4LNAA 2RGYA 4F8YA 2G8LA 4QUHA 1F36A 1NQXA 2VXOA 3T3DA 2IA1A 3O84A 3RU3A 4D8YA 2W82A 3PPWA 3PLNA 2K27A 2ZXHA 3MFKA 3O9VA 4UHFA 1QGAA 5F21A 1B43A 4MWSA 1ORIA 2F7SA 5K3AA 5JNLA 1I3MA 3FTPA 1T6YA 2WF9A 1M2OB 3I28A 3RFTA 2UAGA 3V8KA 5A2QK 4OQQA 2AJTA 2Q5FA 2JD0A 2SBTA 3AEUA 3TFWA 2CHVA 2P6TA 3H3FA 2QRHA 4TYWA 4UVEA 3KUCA 4HX2A 2GVNA 5JATA 2IZZA 1L5KA 3TL3A 4KBGA 2DFNA 4B82A 4PTZA 4GXQA 3SF0A 3OFKA 2QM0A 3TOCA 4KL8S 2PR2A 2FEZA 1FTTA 3C3JA 4YV7A 5TX7A 5B1DA 1AKVA 1Z7YA 4ZZLA 5EJ4A 2IELA 1XI2A 2Q4RA 5HLHA 2B4AA 1H22A 4DR1B 2ERXA 1C7FA 3GWGA 4LAFA 1V4VA 2PQMA 4I2NA 3GVIA 2NUPA 3IHTA 2FQYA 3AM5A 5I7UA 4RE5A 2BGIA 1QKJA 1Z2AA 4OV6B 3ZK8A 1W36D 3CUQC 2Q5EA 1D8AA 4UUVA 5IDWA 5IAJA 4KK4A 1Q50A 3C4JA 4LF9B 5HE9A 1N2JA 2R25B 2F8SA 4Y8VA 3T7EA 4OU0A 4M36A 4AP9A 2HVRA 4XQ9A 1W35A 5AHKA 1YVUA 2R6GA 2CNLA 4IFEA 1EFTA 2VOPA 4EGJA 3B48A 4LRXA 5FLVA 2NO9A 1G5TA 1OAKA 4Y17A 4ED9A 2XWJI 1U0BB 3WTUC 5LOVA 5LGNA 1XAGA 2VH5R 1K66A 3RC2A 3D6NB 1XD2B 2BJWA 2ZSAA 3G9UA 3MZ8A 2JJ2D 4QWQA 1EFRD 2QE7D 1H3FA 4YWHA 4DLPA 5KNDH 4I6GA 2J0UB 5CT4A 4YREA 1Z8DA 1N78A 1QRYA 2E21A 1FMJA 1SWWA 5P8WA 4ZH4F 4HUJA 4MS3B 3NNSA 4YEDA 4ZVTA 3FXJA 2P78A 2RG1A 3C3XA 3VV2A 1GT0C 1YS4A 3GXBA 5JVDA 2FB9A 5AKGA 3U81A 3RJPA 1YOBA 4DCJA 4JODA 5F78A 1L5LA 4BFTA 4HXYA 2XVZA 4EJOA 2BE9A 2DERA 1SC3A 1ENHA 5F35A 2YZKA 3OT1A 4ODIA 3D2BA 1MG5A 3Q7QA 1AUPA 3TCNA 1CT9A 3ZU2A 3C16C 1VQOI 1GG8A 4MDEA 1DDOA 2ODNA 2JMWA 1IM5A 1ML3A 1L4BA 5JJKA 4YO8A 1G4HA 4JCOA 5DOZA 1RKVA 5K8CA 1OISA 3GLTA 1VSBA 4YP7A 1RPWA 3BXOA 3S2UA 1WB6A 2OAZA 3M6AA 4GGMX 1S8FA 3AHEA 4DSTA 5M04A 2NAFA 1R0CA 1KZHA 4BHBA 1UMQA 4DNFA 3AYXB 3HI4A 1T13A 4P9UA 4JDPA 4BO8A 3TS1A 4KR6A 1W4AA 2BW0A 5JS8A