1S8NA

Crystal structure of rv1626 from mycobacterium tuberculosis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
190
structure length
190
Chain Sequence
AVPRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal and Solution Structure of a Putative Transcriptional Antiterminator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Structural genomics, unknown function
molecule keywords putative antiterminator
total genus 74
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF03861 ANTAR ANTAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s8nA02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1s8nA01
4CICA 3CG4A 1UHMA 2L54A 1GCAA 5H6QA 4WUTA 4KQCA 4DQ2A 2P7CB 1HW1A 3Q41A 3O75A 2P8TA 3CO7C 3FGZA 1SD4A 1K7AA 2L4AA 4LRQA 4A5MA 5ICFA 4Q47A 2JVJA 3RDIA 5LGNA 2PUAA 5KC9A 3G73A 5CLSA 1DZ3A 1CF7A 3P9YA 3FXRA 4EJWA 1CHNA 5JNVA 3IWZA 5FB2A 2D1HA 4D0PA 2EA2A 2UXNA 3I5AA 4F8JA 3JAMZ 1FC3A 5CYVA 3C6QA 4IGAA 2DO7A 1MDMB 4EM0B 3R60A 2FA5A 3ZN0A 2ESNA 3HUTA 3H5OA 4G94A 4KNYA 1HQCA 1R5HA 2FNPA 4MS1A 4W5OA 4S04A 4RAYA 1XDSA 3I59B 4KK3A 3M9XA 3MQ4A 3LA2A 4UVAA 1SFEA 2PN6A 2XAFA 5DCMA 4I98B 1DUXC 6PAXA 3O6BB 4A6DA 2P6TA 3DV8A 2VN2A 1U2WA 4LX8A 2GI4A 1ZGAA 1IXSB 1F9NA 3WTWC 5CVIA 1OXBB 1RZRA 1D3YA 1J7KA 1EWKA 4LB5A 3EGCA 1JBEA 3F6VA 1QP4A 4A0ZA 4G6QA 1NXVA 1RXEA 1JF8A 1E2BA 1ZLKA 1TQPA 3OQMA 2H6BA 4NICA 1W5TA 2DLLA 4D74A 1D5VA 3C3WA 3CUQB 3BJ6A 3JAMK 4JQFA 5J8FA 4A0YA 2FN8A 3IRRA 5CNMA 5BR1A 5GOTA 6ABPA 4TLLB 1J5YA 2HTSA 1FSPA 3N53A 1Y1LA 3B73A 1TBXA 4FE7A 5EWLB 4ETSA 3E6CC 4M6YA 5TQ2B 1JDPA 1IXCA 2E1CA 3H5VA 3R0JA 4DN6A 2HYGD 2XIGA 1GLGA 3OLXA 2JZYA 2VK2A 3HRMA 4KICA 5DV5A 3G3ZA 2XAQA 1QQBA 4WXEA 1QKKA 2FBKA 4KUMA 4KIBA 4MGEA 4WWCA 2QBYA 1TQIA 2QM3A 4RK0A 1R58A 5H20A 2M30A 2FBHA 1Z18A 4M9XA 2HYFA 5IC5A 3T6KA 3K2ZA 3O74A 3QK7A 2IA0A 4MHGA 4N03A 2MH9A 5L3BA 3BWGA 3IRQA 3QRFF 2VODA 3I53A 3V8JA 5DKFA 2ZMEB 3CNBA 3CHYA 1F1ZA 5K5OA 2IPNA 1YW7A 3LFKA 4ESFA 4AIKA 1GUBA 3M8FA 1YIOA 4RK7A 1H0MA 1K68A 5EWMB 4YCSA 3T5XA 1UFMA 5IEBA 2XUBA 2R25B 1L5YA 4Q6BA 1LVAA 2NAZA 1FY7A 2HSGA 1IAWA 1GXPA 4MR8A 4HOBA 1DBWA 2FTKE 5TJJA 3RH0A 3RVNA 4FHTA 5FGMA 1TMYA 2COMA 3WGGA 3LAJA 3L49A 2ID7A 1P4XA 3LUAA 1MKMA 4BHCA 3PFIA 1IN5A 4EJVA 2FMIA 1BVHA 1HKTA 4RV5A 5EWLA 1ZHFA 1MDMA 4HZFA 1LK0A 2M45A 5KWSA 3UUGA 1P4WA 3DFGA 2WJWA 3CUOA 2PQ8A 3GVAA 3M8EA 2M98A 3HZHA 3I59A 1WSUA 5GQSA 4EUKA 2KIFA 3RYPA 4A5NA 1ZRFA 4F7ZA 4G0YA 3BPVA 3JPYA 4ZZLA 5IUJC 1AB6A 2JB9A 3WTUC 4RZSA 4OIQF 3LUFA 3A0UA 1URPA 4IMJB 2L19A 2ZXJA 1ZH4A 2K4JA 1JFVA 1XHEA 4Y13A 3TGNA 3DQVC 3ROUA 3QEMA 5AIQA 4LDZA 3KLNA 2I6FA 3GUDA 1U04A 3DF8A 1NATA 2K7LA 5LHGA 1FPQA 3N75A 3TDUC 2HR3A 5ILUA 1P6UA 4MEXF 1D4ZA 1FYKA 2FW0A 4FE4A 5KC8A 3KS9A 4P96A 1ZDMA 2O6GE 3NNDA 3T38A 4MNUA 2A3SA 5ICCA 4UUVA 1STZA 4RGSA 5JS1A 5IT9K 1L0OC 4Y17A 2FNAA 2VXZA 2ELHA 4GCVA 3OLWA 1C4WA 4IILA 1R00A 5HS7A 2FEZA 3V7CA 1DG9A 5LEKA 3BRQA 3JY6A 2HPHA 1T0FA 4U0YA 4RY9A 3F23A 1W7PA 3SG0A 2QV0A 3Q7RA 5DGCA 3CDHA 3DKWA 2DQLA 2MSKA 1U6GA 1T39A 4W5TA 1OYWA 2E7WA 2N9UA 3LKVA 5BOXA 3TDZC 3F3XA 4QPJC 3KEOA 5A2QK 1KYZA 4I01A 3I0TA 3ZQ7A 3FMSA 5LHIA 3FM3A 1K79A 5HLHA 1R8JA 2VOOA 3JTEA 1GHCA 1USKA 3F8BA 2F8SA 2FEKA 4KMUX 3LUGA 2DQRA 1KA8A 4NQRA 3SZPA 5FBHA 5JVTA 3BZ6A 4FX0A 1LBIA 2DBBA 1TW3A 4KIFA 5IT3A 2UWMA 2EFWA 1JXSA 2XKOA 4WK8F 2D45A 2JBAA 3C3MA 4RKQA 1ZGZA 3FMRA 3BY6A 3O2JA 2E4VA 3T8TA 2V9VA 1DCFA 4ZYHA 2MD5A 4ETIA 1NXXA 2QLZA 5FFXA 1FP1D 1M2EA 3LMKA 5BPIA 3CTAA 1DPRA 2ZAYA 4U7DA 3LQQA 3F73A 2HJ9A 2BGGA 3GWGA 5D8LB 2CHFA 4G0PA 1ZG1A 1JYEA 3I09A 1Z91A 5DD4A 3LA7A 2RJNA 4MQ9F 3OQNA 4NQWA 1ZGJA 4EM1A 2QVGA 2HKXA 2HZTA 1MJAA 3QAHA 3PQJA 1KQ8A 1YW9A 1USTA 4ZPJA 1APBA 3E5XA 4G0ZA 1QP0A 1SAXA 2QW1A 1XGSA 4KPYA 1SD7A 3HK2A 5L3GA 1G3SA 1FYMA 1FP2A 5LGTA 4OINF 3CU5A 4N47A 3TD9A 2MLKA 1Z6TA 4HNSA 1YS6A 5HDNA 1F4VA 4HV5A 2NUBA 2O8XA 4MR9B 2A69F 1RIOH 3M9AA 2A9RA 4HX7A 1PUXA 1XSVA 5IX8A 2NRAC 3W6KB 3FFTA 2RKHA 4EYKA 3WODF 3KZYA 2RVCA 1ZRDA 4M73A 1NXTA 1BI2A 4BHBA 4LLGF 5JS2A 3EODA 2NNNA 3HO1A 9ABPA 4HX4A 4KT5C 5PNTA 4A2UA 1EFAA 2DK5A 3VOEA 3N97A 4O6JA 1XN7A 2JVKA 2MYTA 2ETHA 1G4DA 4EVIA 3HRSA 4P9FA 4EVQA 2Q5CA 4GPAA 2EV6A 1QMPA 3Q15C 2NT3A 1M5TA 1P92A 5ERIA 4LG0B 3DBIA 3T8RA 3QEKA 4PGGA 4O1HA 1ZG5A 2QZ8A 2FEWB 2Z99A 1BDHA 2KKOA 4HLYA 3UKJA 3RVOA 3DPTA 3O2PE 3RPUA 4EQQA 2IYNA 2ZMEA 1ISRA 4LE1A 3W9SA 4L5JA 5LLQA 2VUIB 5FLXZ 2FQWA 4OMYA 5JR3A 1H9TA 1ZREA 4HA8A 5KQGA 4HYEA 2VT2A 3KCNA 4KIGA 1XCVA 5DUIA 1MZBA 4MQFA 3QELA 4QWQA 5E1ZB 2JPBA 3F21A 2GIVA 2L02A 4KN7X 2F5EA 1EWTA 1U5TA 5IUNC 2OQRA 5E1XA 1YYVA 3R61A 4Z4IA 4AIJA 1OYIA 4OU0A 2GA1A 2FQ3A 3WTXC 1HBXG 3TMYA 2A6EF 2QYOA 2GA2A 4WCGA 1B00A 4EJTA 3ILYA 1T38A 2LBPA 3EDCA 5JI6A 4IRGA 4IRXA 2XKPA 3WTZA 3EQZA 3HM9A 4KREA 3CLOA 4ZJPA 2YHBA 1F5TA 4Z0NA 4OIPF 4W5RA 5D4SA 1SFUA 5EWMA 3TOAA 3OO0A 1Z6RA 1PEAA 3SM9A 4EJOA 1YQAA 4L5IA 3F6PA 3KE2A 3BOQA 2RGYA 4O3MA 3IKTA 3JPWA 5B3JC 1KU2A 1TVMA 5TPWA 2E1NA 2VC0A 4Y9TA 5ICEA 1OR7A 4U88A 5ED4A 4ESJA 3K1PA 2STWA 1O7LA 1BI1A 5CVJA 1Z9CA 4WWHA 2IDMA 5HS8A 4YO7A 4ZYLA 4HF2A 3GV0A 1EH6A 3ZMTA 4HLXA 2A5YB 1E2XA 1FFWA 1Z26A 5LRRA 4PYRA 4QYWA 1XD7A 3GT7A 2RN7A 1VLZA 5B3JA 2DFIA 1AOYA 4LD5A 2QUFA 1BDIA 4EYGA 5FWYA 5KK1A 3LKBA 3V7RA 3NNNA 4Z9AA 4RB2C 3Q7SA 3JW4A 2Y0MA 2FMHA 4JBAA 4XSZF 3QP6A 5FD6A 4EJUA 4QYMA 1BN5A 4LK1F 2GAUA 2XAGA 5DLEA 3E3VA 1T6SA 2E7XA 4RS8A 4UHJA 3WTTC 2LPMA 1IZ1A 3OLZA 3G1WA 2OZ6A 3LOPA 5TQJA 1R22A 4I0BA 2V79A 4MQVA 1JDNA 4OIRF 4W5QA 4M71A 1H9CA 3KP2A 2B1JA 3Q7TA 3LWFA 1DP7P 4OOIA 1TNSA 1EH7A 3HRTA 2FLKA 5CVUA 1FQWA 2H3HA 3OM1A 1YK0A 2L01A 3I4PA 2IKSA 5BQTA 2XHKA 2J5PA 1R7JA 2Y75A 1B9MA 5DYMA 1Z05A 4M9ZA 2JBAB 3GRCA 1HKQA 1A04A 4R1HA 1OKRA 2EFPA 4RAZA 1OXKB 3M6MD 4HDVA 4HNRA 5FBKA 4DNCA 2E4WA 5L3CA 3ULQB 2HQOA 3BDDA 2FMYA 4L9VA 4ZMRA 1KQ0A 3MM4A 2QQBA 1GCGA 2MYUA 3KYJB 3HXMA 4IHSA 3ILHA 3HYIA 3RVSA 3F8FA 1U5TB 2OAZA 3Q9VA 4LMYA 4KMRA 4TLMB 1P6QA 1BJAA 2VBZA 3C18A 3TOBA 3BILA 3WE2A 2KJBA 3RIRA 3GA5A 3RPQA 4WF2A 3P9IA 1ON2A 3QEMB 2BYVE 2EV0A 3FDFA 3QOPA 5LGUA 3LAPA 1BM9A 1DC8A 2PL1A 4OATA 5CVVA 1USGA 2PBIA 3DPLC 4MEYF 3GLXA 1LJLA 3WU0A 4EV0A 3QU6A 1U3EM 4Y15A 2LF7A 4RGUA 4UVBA 1UB9A 4ZZDA 3WU1B 3FX3A 4Z4GA 1PHRA 3SFZA 4MLDA 4GGGA 1HXDA 5D4RA 4RKRA 1ZN2A 3EAFA 4W5NA 3KTOA 5TQ0B 2DU9A 3MYYA 2RNJA 1QNLA 1D5WA 1XHFA 4UXNA 2KYRA 1PDNC 1JWLA 3L00A 3M7GA 4HX8A 3RVQA 3CRNA 1SFXA 2RJOA 2F5CA 3FFXA 3U1DA 4YP9A 2R7DA 3CUQA 3MA0A 5CNJA 4GO1A 1Y0UA 7ABPA 1DRKA 3RJPA 3ROTA 3KP6A 2YR2A 2QVOA 3NBMA 1YTYA 4L9JA 4PZJA 1YW8A 2J48A 2A61A 1BAPA 3JTGA 1GUDA 3HUGA 4EM2A 3LUDA 3CUQC 3RYRA 2P7VB 1S6LA 3P7NA 2H6CA 2HQNA 2QQ9A 2CFXA 3WGHA 4P55A 3DXJF 1R36A 3ECHA 2JSCA 1I6XA 4KZKA 4G7HF 3DLHA 1VRVA 3V8LA 5A2QZ 2K27A 5J8CA 3I42A 3ELKA 2ZO4A 4M9SA 4PZ0A 4G7OF 2PEXA 1NTRA 1MJBA 1C0WA 3O21A 3B2NA 4RY8A 1JHFA 3CJNA 1DDNA 1OPCA 3S99A 1LB2A 1PNRA 1IN7A 1MIHA 5HVQC 4PCQA 2M5WA 2P5VA 3CO6C 3KG2A 1YTUA 1BIBA 4IRHA 2M1ZA 1R1TA 4MR8B 3QLVC 1HKSA 1IF1A 2Q2EA 3ZP5A 2K02A 3WGIA 2PJUA 3FXUA 3HSEA 3CTPA 2VONA 3C1DA 3FFWA 1JGSA 1X3UA 4FB4A 4D6XA 2PMHA 1BI0A 1SRRA 2FF4A 3J80K 5DCMB 2VBXA 4ENMA 5AIPA 2EK5A 2PJPA 2ZJ2A 3BROA 3LSTA 4HBLA 5JNTA 2CWEA 2AYXA 2JCGA 2YPRA 1ZVVA 3CZ5A 2FU4A 2FLWA 1VPWA 2G7HA 1FOKA 4KA4A 2MH2A 3A3KA 4BQAA 2ISZA 1O57A 4XSXF 3SQNA 1QPMA 4PICA 3E5UA 2LIVA 3I64A 3DGFC 2HTJA 4ML3A 3GX4X 3IP7A 1WRJA 1NXOA 3C3KA 4WXMA 4BHPA 3NHZA 3OO1A 3BREA 1IUYA 2ISYA 3HUUA 2BE5F 4YWHA 1TTYA 2HQRA 3MFKA 3HIFA 4GNRA 4XXHA 1W7PB 3U9GA 1FSHA 1S7AA 1LBHA 5D8KB 3H92A 5HDKA 3NQOA 3HTUA 1JLKA 3TX6A 2IPAB 1IN4A 2JTVA 3J81K 1L3LA 4EMSA 4MYRA 1CGPA 1S8NA 4CYDA 5JNUA 1Z16A 2FOKA 3GO5A 1E6MA 4YIIA 3O1HB 2EFQA 2PUEA 4CO8A 2YSRA 1SMYF 2VBYA 4ENNA 2PKXA 5E8IA 4UHTA 3K9CA 4M88A 3NNSA 2A9PA 2JK1A 3D02A 2F5FA 5JNWA 4HW0A 3HS3A 3SNKA 5ILSA 1RUOA 2L2QA 3I5UA 2PMUA 3ML6A 1MD0A 3L09A 1NXWA 2W85A 1U2QA 4IXAA 2DRIA 2ID9A 4RXMA 4N9IA 2GKGA 4Q7EA 3E6DA 2QSJA 1V3FA 5IUKC 1KU9A 1QZZA 5E18F 1ISSA 1DRJA 4XARA 2C6YA 5TPWB 4G86A 5K5QA 1OYYA 2IA2A 3HTSB 4IRIA 2E4XA 3O2QB 2OD5A 2H94A 3IC7A 3V7SA 2O0YA 2VOPA 3EQLF 4YFXF 2F8TA 5F1RA 2ZFWA 3E5QA 4EYQA 4IPAA 3EDPA 2UZKA 3MAJA 2X4HA 5HS9A 4UV9A 5BRAA 3FHZA 1K78A 2A9QA 3KSMA 2WY2D 3CG0A 3R4KA 4LZLA 1SXGA 3EULA 1MB0A 5FWXA 4ASNA 2W84A 1QGPA 2E4UA 4RWEA 4WT7A 1FWZA 1YG2A 5IULC 1MJ9A 4XLTA 4RK6A 2BEOA 3RVLA 2KRFA 4RY0A 3REOA 1EV7A 2GQQA 2RDMA 1JH9A 3K9TA 2F2EA 1B59A 1FFGA 1ZH2A 4P5OA 3T0YA 1FBUA 4MR7B 4MQEB 2R47A 2RV8A 4G0MA 4UHKA 5EWJB 3RVKA 1KMIY 4YGXB 1DC7A 3H1FA 2E4YA 4Z4CA 3HHHA 3OLYA 1DCMA 2D2WA 2PUFA 2FQXA 3GXOA 1FBSA 3MMNA 3IDOA 3TB6A 2P4WA 4YV7A 3E61A 3DEUA 4GYIA 1QZYA 1MVOA 4QICA 2PE5A 4XAQA 2CSOA 1LJUA 1XGNA 3GZ5A 1XCBA 1QBJA 2FMFA 2YU3A 2MC3A 4WZZA 1IIBA 1O7FA 1KU3A 5CJ9A 1Z1DA 4Z4EA 2HWVA 4I7HA 1TJYA 1Z7UA 4H60A 3IL2A 4F12A 5D6EA 3K1NA 2ADUA 5DDGA 2IOYA 3K4HA 5HM6A 3HOTA 2LP4Y 2VT3A 3QPTA 1Z2EA 3O1JC 1CYEA 4L0YB 2JRTA 3KFWX 4XBFA 2XV4S 1ZH5A 2QXYA 5JNRA 1ONVA 3MCZA 3LUKA 3MIZA 3HHGA 3URMA 2FQYA 1LEAA 2VE8A 2MSLA 2EJRA 3BRSA 2JRLA 1U8RA 3E97A 2ZBKA 5FWYB 1W5SA 1EHCA 3KP3A 5D5XB 3GYBA 3E6MA 3GF2A 3KP7A 4EYOA 3QP5A 1F51E 1M5UA 3ZN1A 1S3JA 1PEYA 4G0XA 1DCKA 1O3QA 2V0NA 2QENA 4O5VA 3KHTA 1FLIA 1W4MA 2VC1A 4JB2A 3V4GA 5FLXK 2FSPA 2AXLA 4OG2A 4RB1A 5D2CA 4YG2F 3KP4A 5D6FA 1B1BA 3JTHA 3CFYA 2P4UA 4RS3A 3JVDA 3DLBA 4U0WA 2VYCA 5F6FA 1XWWA 4MS1B 4HDUA 3GL9A 3N0RA 2WB4A 4N9HA 1ZYRF 3EQ2A 1HW5A 3CKMA 2Z33A 2YX4A 2OQGA 4Q48A 4NHJA 2FXAA 2UXXA 4D6YA 5BS6A 3KJXA 1QO0D 2NYXA 4TMYA 4G7ZF 2VUHB 4P98A 5E17F 5LBQA 3RVJA 3PQKA 1YK1A 2IA1A 1JL3A 1JFTA 4Q6WA 1SMTA 4N0BA 4BNCA 1PP8F 3RVPA 1IXRC 4CHUA 3VNBA 2LDUA 1LEBA 4K2EA 2CW0F 2IVMA 4ENKA 5C5CA 3ABUA 2FEPA 5DCLA 4YIFA 2KIMA 3QU3A 4HQEA 3QELB 2D1VA 3MZHA 1JFSA 4PGHA 1H9GA 3H5WA 5CVRA 3GWZA 2IRFG 2IPLA 3MQ0A 2DK8A 2HKOA 4G0QA 3KEQA 5EWJA 1DP4A 5BRJA 2NS0A 3QX9A 1ULYA 1JX6A 2FXIA 2TDXA 5IBQA 3RVMA 4KDPA 4M6XA 4Z4HA 2B4AA 1A2OA 3H1GA 4XRFA 1J75A 1J2XA 3TKYA 3N8IA 1TNTA 2V6CA 3SXYA 1RPJA 5D5WB 4E7PA 1M2FA 2FE3A 3L2CA 2R48A 5J6XA 3FF5A 2HGCA 3WG9A 1NXSA 4G6DA 3CZCA 3GFJA 2H0AA 2JT1A 3KZZA 1QQIA 1E17A 5E20A 1Z13A 5TQ0A 4IHTA 1W25A 2STTA 1V4RA 4FX4A 1IN8A 3ISPA 4H3HB 2R7FA 5K5RA 4GYGA 5FO5A 2W57A 2WWVD 4BXUA 4RGXA 4QLCU 3H3ZA 3GFLA 2YX7A 2B0LA 2QWWA 4A0XA 3KP5A 3FWEA 1FX7A 3NRVA 5HLIA 5ICGA 2NZVG 1KRWA 3O2SB 2FMKA 3EJWA 3Q5FA 5CNKA 4MTDA 3FM5A 1WWXA 4TN5A 2ZNZA 1KRXA 3UK0A 4A12A 4U7BA 3V8KA 3RI4A 2O61A 1EH8A 2RQPA 2WMYA 1MGTA 2BBYA 1BOAA 1J0RA 1FBQA 3P9CA 1LJ9A 4LGWA 1U8TA 4Z99A 3CLKA 3FXQA 1XGOA 3BP8A 3QLTA 3KETA 3GYHX 1L5ZA 3QLUA 1ODDA 3FZVA 4LK0F 1CEYA 1K6OA 1BI3A 1EAYA 4LE0A 4NCAA 1IRGA 2ESHA 4NV3A 2HOEA 1RI7A 3H3UA 5EEGA 4L9NA 3I45A 3O3KA 3H5TA 2IP2A 2OU2A 3TO5A 4ZYGA 1NXPA 1OMIA 3QLUC 4MR9A 4EY3A 3NEUA 1YLFA 4Q5SF 1U0SY 1WETA 1T2KA 1FFSA 1QO0A 1IN6A 2PL9A 1B4AA 2P5KA 2DPUA 3OV8A 4EVRA 1J59A 2FSWA 5EEHA 4KQ9A 2W42A 1TW2A 2DI3A 4XASA 2P9HA 4KYWA 5T3YA 5HLGA 5IEJA 1D8JA 2ZNYA 1FYLA 3OOPA 3F72A 2XASA 4YFKF 2A68F 2AYZA 1ZLJA 1PNTA 4IJAA 3N4MA 4UVCA 5AONA 4A6EA 1I3CA 4LB6B 3RVRA 1TQMA 2CQKA 1TLFA 4LE2A 2HS5A 2GZWA 3K0LA 3I58A 1G3TA 4RDCA 3LUHA 1D1PA 3KYIB 1HW2A 3HSYA 1IRFA 3JVIA 1F4KA 4IVNA 1ZG3A 4EGYA 3HV2A 3KLOA 4RSMA 3LQRA 5FD5A 2QVCA 3RTRA 1I1SA 4L9TA 3EUHA 3I71A 4CDGA 3HSRA 2HQBA 4HQMA 3ZMUA 5BPDA 2DT5A 4MQFB 3SY8A 3TQNA 4ETNA 1UCRA 4G9YA 2PUCA 1KYWA 3T8YA 1J9IA 1S7OA 3N0WA 1XMAA 4WXHA 4GXOA 4U0VA 2A6HF 3MWMA 4HF0A 4B09A 1YO5C 4ZH4F 2EWNA 8ABPA 2OA4A 5CNIA 2P5LC 1KGSA 1WKMA 3IHUA 3MF4A 1KU7A 1ZY2A 5KQMA 5DUKA 3R6SA 4I0AA 4Z4FA 3ZPLA 2A07F 5HDGA 4O5AA 1O3TA 5L3DA 4RK5A 4JOQA 2DAOA 1CF7B 4NCBA 1DJMA 2Z9OA 4YLEA 2QBYB 4ZYDA 2ZWMA 2IPMA 4G0OA 2JVIA 4JA2A 5E1WA 2LSOA 3M9WA 1K78B 5F64A 2J5OA 1D8KA 2CWDA 4TV7A 2OZUA 2M1BA 1LNWA 1EWVA 2PMCA 4EGZA 1FNNA 3VFZA 1REPC 5DTEA 1JE8A 4UV8A 4KRFA 2PG4A 4JASB 1Z2DA 3OMXA 3T1BA 4NB5A 3VODA 4MTEA 2OBPA 3IPAA 2L4MA 3KKEA 2WTEA 3GFIA 3F6CA 5HSGA 2GXGA 4UNOA 3G85A 1XSXA 5TPZD 3TO6A 3IP9A 4KFCA 1XB4A 4N41A 2IW5A 5E8GA 1VKRA 4CXFA 1UDRA 2CG4A 2IJLA 3E3MA 3DZDA 2EA4A 3OQOA 3GEZA 2X7XA 3OM0A 2LF8A 4PEVA 3F8MA 2FRHA 1XDUA 1J56A 4RK4A 2GXBA 4R79A 1PUEE 5LEJA 2NT4A 4LLLA 1U5TC 2CGPA 1G3YA 1VTNC 1BA2A 1ON1A 4F3TA 4MLCA 2O03A 2FBIA 4I09A 4I02A 1ZRCA 1Z15A 1FSEA 3L9FA 2PLYA 5IT9Z 2JPCA 2L18A 3MEXA 3M1EA 2IPQX 1JHHA 3J81Z 3WTVC 3D0SA 2Q8KA 2Z5UA 3JS5A 1ABFA 3ECOA 2KIUA 3RQIA 1B9NA 1ZITA 3HDGA 1G6NA 5KI6A 1UHWA 1LDDA 2HFHA 3LA3A 4OBBA 1R1UA 2TMYA 3DP7A 2K86A 5L3FA 5TE9A 4CBVA 3ABTA 2NNYA 3EYIA 2ZKZA 3F6OA 4RU1A 4E7OA 1RNLA 4ETMA 4ZYEA 3SZTA 4IMIB 3IPCA 4MQEA 4M74A 3O1IC 1I27A 3GZ6A 3H75A 4ON0A 1AWCA 1BBYA 2RC4A 4OLBA 4M72A 2WV0A 4AWXB 1KQ9A 4S05A 3A10A 2G7UA 2P6SA 2XAJA 4HF1A 1U78A 2GX6A 2M87A 1YS7A 4Z9BA 3JSPA 1FT9A 2XROA 2EFNA 2G9WA 1YVUA 4XFKA 4YFNF 3H6GA 3I54A 2BGCA 1D1QA 2QQAA 4RK1A 4E70A 1YMVA 2O20A 2EV5A 2XVCA 2R4QA 2FMLA 1S29A 2M8EA 4ENJA 4WX9A 1TM2A 3OMWA 1P4AA 2LNBA 2Y48A 1T34A 1PP7U 4Q4ZF 1USIA 1TLHB 2Q0OA 4MS3B 4MS4B 3JSOA 4HAMA 2L17A 2V1UA 3QX8A 1RZRD 2PFBA 3WTSC 4MRMB 1USSA 3K1MA 2PLNA 1HSJA 4P9UA 3OLVA 2GWRA 3H6HA 2RDPA 4B8XA 2A9OA 3C7JA 2DW4A 3WTYC 5H6RA 3HJFA 4CGZA 2WWYA 4F06A 3IP6A 2EB7A 4Z2YA 5JHUA 1GVJA 3COAC 4DADA 2XAHA 1NY5A 2X0LA 4LLNA 4MR7A 3N6VA 2IT0A 1O3SA 1W9HA 3LUCA 4MS3A 1YFHA 1U2PA 1T98A 3GFMA 4RB0A 2FN9A 1I1GA 1ZARA 4BYYA 4P1ZA 4RXTA 4F11A 2PUDA 1P6RA 4BH9A 1XSDA 4JK1X 3ZMSA 1JHZA 1WI9A 3IP5A 2CO5A 3F7NA 4YS6A 5I4CA 2PUBA 1HSTA 3J7AO 1R5GA 1AB5A 2BV6A 4OMZA 3HOSA 4DQDA 2QU7A 2O3FA 3N0XA 4AVPA 3D8UA 2RGVA 5T7BA 2L3DA 4L18B 4KVFA 2MA3A 1IW7F 2K4BA 2KJCA 5K1YA 1LQ1A 3BJOA 4OLAA 3QPHA 1QQAA 2MSWA 2VE9A 4PDKA 4KK4A 3LUJA 1GXQA 3BBLA 2FKAA 1LDKB 4WXCA 5KQPA 2XDYA 3QLVA 1B6AA 1W7PD 2MBFA 4N76A 4MGRA 1ZHHA 5HOOA 1ZAYA 5HQJA 2LKPA 4G97A 3DGEC 5TQ2A 3FMQA 2MLGA 4O1IA 5KQLA 2V1XA 3GBPA 1SXHA 4L0ZB 5TPZA 3ERED 2MYNA 1QP7A 4JAVC 2QR3A 4OIOF 3SHFA 3SAJA 1RZ4A 1SD5A 5BMZA 4MRMA 2F5DA 1ABEA 1O3RA 1QPZA 2E4ZA 2PAFA 2WC2A 1FZPB 5HKOA 2HDCA 3RKWA 5D5UB 2PI0A 2CHEA 1YMUA 1ZAOA 5DCFA 1DBQA 5E3JA 2XRNA 1DPUA 5JNSA 4XLNF 3VEPA 3VNAA 1R23A 4ZMSA 5CHYA 4LG0A 4ESBA 2FVYA 3D5LA 2QZJA 3Q9SA 4BAYA 4N0QA 4KN4X 4HV6A 1SD6A 1BC7C 1P8AA 5FFZA 3F8NA 3L7WA 3LFTA 4XLPF 1Z12A 3EETA 4MS4A 3H1EA 2HEOA 3J80Z 1Z25A 4JP1A 4MPTA 2ACJA 3ZMZA 3LTEA 4YR7A 2DTRA 5LHHA 5LRSA 2AS5F 1R1VA 3EYYA 1C0EA 1G3WA 4PE5B 1QNTA 2WJAA 4R8HA 2WRZA 2NZUG 1BIAA 4RB3C 4LFUA 4N0PA 3TO9A 3K69A 2YHAA 3ROFA 1E6KA 3L6UA 5C5EA 3AAFA 1K66A 3C97A 1RUNA 3T95A 3HVRA 3HSFA 4RGRA 3VB2A 2OENG 1DBPA 4CZZA 4H3KB 1BDJA 3W6JB 1MB3A 3A0RB 1D2AA 3U2RA 2GBPA 2W25A 1Q1HA 2XGXA 1MAVA 1RXIA 2H27A 4KV7A 1XMKA 3BJAA 3ZMVA 1HEYA 2VBWA 2R3SA 3NHMA 4IF4A 2MYPA 1ZESA 3KCCA 2LUOA 5BQ3A 2H09A 3E6BA 2CYYA 3RKYA 3HCWA 5ABPA 3S2WA 4G8XA 4H0EA 4LJZF 3H5IA 1A0OA 4L85A 3CS3A 3BPXA 1JYFA 4L4UA 1XGMA 4JB0A 3WE3A 2ZCWA 1WQ2A 1LDJA 1BC8C 4AIHA 4I2OA 3HEBA 5ILVA 3IKVA 4AD9A 3TO7A 1E6LA 1NHAA 4WXDA 4FT8A 4MAAA 4RXUA 2Z3YA 4EGSA 1Z17A 5D5VB 1SXIA 5DEQA 4KMFA 2PUGA 5TRDA 5FWXB 2EFOA 1ZGGA 3F8CA 1I5ZA 3B02A 3IWFA 2DPDA 3H5LA 4EVSA 1P2FA 3P9KA 5DD8A 3ZMDA 3GBVA 4HNQA 3F22A 3HDVA 3HRUA 5KVRA 4LDAA 3R0AA 6CHYA 5JFRA 5L3EA 3FMVA 3MZYA 4YRZA 2CD7A 2W24A 3RKXA 4OTZA 2V1DA 3GW2A
chains in the Genus database with same CATH superfamily
3WSWA 5BSWA 1VIDA 3Q87B 4ALMA 1GAQA 3OBIA 2P6MA 3WX0A 3HDTA 3V5NA 1ZD9A 1T9BA 3Q6MA 1JR2A 1UHMA 2BKUA 3FVVA 1SC3A 4E03A 3KIPA 3X44A 1AGXA 4HRXA 2Z8ZA 4X8LA 4LF6B 2F1JA 2QL5A 3UANA 4ZICA 3OX3A 1UDAA 3JVUA 5KOYA 1V35A 3PJRA 1XEFA 2Q62A 1SD4A 1M7HA 2C82A 3FGZA 1ETKA 1HOMA 5HKAA 1K4TA 4QUBA 5G1NA 4A5MA 2IXSA 4Q47A 1RADA 3K73O 5KHDA 1T9GS 4QO7A 4RF5A 4ZQFA 3ABLH 1YJQA 3FPBA 3MBOA 3EH1A 5HZHA 1CF7A 4P7GA 1P1IA 1DQZA 2HSEA 2ZJ5A 3DEHA 3LXUX 4ENUA 1CHNA 4P7KA 4R31A 3IWZA 5FB2A 2DPGA 4G1MB 3RWBA 1YFJA 1HFJA 4E5SA 2CE7A 4M3GA 2VIIA 3ENWA 5EFOA 5BWCA 1A5SB 4W8OA 1SC9A 3DL7A 2P5YA 3UGKA 1FC3A 3FTEA 1I2ZA 4FQ5A 1TWHJ 3B8EA 3OYAA 1YR6A 4MDYA 4OI4A 5DLQC 1JPUA 5CLJA 4DV7B 2DKOA 3C7KA 3UHFA 4IGAA 2X5JO 5MGNA 1DTWB 1JQ3A 5KYXA 4WZBA 2DLCX 2XUFA 3R60A 2YIJA 3KB2A 2FGKA 3T1NA 4KR2A 2FA5A 4C4ZA 4D0LB 2HRCA 4I55B 3R7WB 1JTEA 4O4IF 1ENPA 4NMHA 3T5GA 3T5PA 1JP7A 1Z35A 5BYAA 2WUDA 5B7GA 3L4BA 3OE4A 3R6LA 3EVFA 4HG2A 5I9TA 2JIMA 2ZBPA 1QFXA 5F04A 4RAYA 5DZSA 4PR3A 1SC4A 4OKSA 2JFQA 2C2YA 1O87A 1Y8AA 2N46A 2IEDA 2O0JA 3O8BA 4A9AA 3MQ4A 3HEAA 1D1TA 1UBOS 2EL9A 2GNOA 1SFEA 2F9MA 2IU3A 5SYAA 3E84A 4CM9A 1DUXC 2XUZA 4B3XA 1F2TA 5L9AA 1QUEA 1WHTA 4NXMB 1JHPA 3DV8A 3ECAA 2XBLA 1ZGBA 3BDVA 1Y4ZA 2IODA 4WOKA 5T3UA 1G8YA 4CFSA 2DFHA 1GQRA 2WI8A 3GQBB 4H7DA 1F9NA 4MINA 2C7GA 2BW3B 3BTJA 2FWPA 4C2BA 5I3CA 4AQYB 5HMMA 2CW7A 3AVOA 4LB5A 1MH1A 3EGCA 3U3DA 4CIDA 1VCMA 3IEPA 4YIHA 2GPAA 2W6CX 2FN4A 1K8ZB 3UV7A 2PRIA 4R2IA 3K9HA 1R6VA 2PWPA 1NXVA 4F9EA 2PZLA 4WFIA 1ZM9A 1RXEA 2FMXA 4QNNA 3OCZA 2WM2A 1JF8A 1VDMA 1WWKA 1ZLKA 1TQPA 3BEOA 2H6BA 1D9XA 1FSGA 3G2LA 4QO8A 1W5TA 1R5OA 4FILA 4CM9D 1D5VA 4RL4A 1XTRA 4G6ZA 1DV2A 1PJTA 1XD2A 3BDAA 2B61A 2MGQA 3DF7A 3DXZA 5KPDA 2QJWA 3JAMK 3QNMA 3QPUA 2I3AA 5J8FA 5CNMA 5TT1A 3BRCA 3UKDA 3ZWMA 2LD5A 1BS9A 3S14J 1E9RA 1XFAA 1LTKA 3MILA 1RMYA 2JI9A 2P79A 5DTIA 5DLPA 3OOWA 3OZFA 3PYMA 3HFRA 4I6JA 3WGTA 2PT7A 3ZU3A 1ZVJA 3D6AA 1YC2A 2HTSA 1ZVMA 2FY8A 2H18A 2R1VA 1OCOH 1ZNZA 1Y1LA 3A1FA 3INGA 3V46A 3ZV4A 3KTAB 2UU9B 1YAJA 2A86A 1AF4A 1ZZEA 2FWIA 3JQAD 3W8RA 4F3RA 4FFRA 4M0EA 3PK0A 3OZXA 2IU6A 4WBNB 1QDLB 5K03A 2BZ0A 4Y18A 2EJUA 1H6AA 2IEAA 3P2KA 4RQBA 2BKEA 5AD1A 1RZ3A 2PANA 2H1FA 3JQ9C 3N58A 3QNUA 3R0JA 1ZOLA 2FSVC 1MNQA 1MDFA 1D1CA 1UMDA 3L43A 4KICA 1MJNA 4FEEA 3G3ZA 1T5BA 2EV9A 1D5YA 2QT9A 2YCLA 4FWIB 3QP9A 4WXEA 4P4UA 4LYFA 4KQHA 5ALHA 2ZFUA 4HWKA 4KUMA 4C6TB 4WERA 1NMSA 5C8XA 5HUJA 4FOSA 3RFVA 3STUA 3KYCB 1BC5A 2QBYA 4K6MA 2PJDA 2QM3A 1Z75A 1GZ6A 1MXHA 1PQWA 2ABWA 1DIHA 5FA5A 2OYCA 3TDKA 3WAKA 3M70A 1ZK4A 1CIPA 1KKMA 5BYKA 3H42B 3GHYA 2OZEA 2ZANA 3R5XA 1LH0A 2VJLA 3ULKA 4EP1A 4XR4A 1GTVA 1XB2A 1CRWG 3REQA 1CUYA 1OTHA 3UG6A 3W34A 3DMFA 3IR6A 2W2OA 2F67A 5EPOA 5DM1A 3NWEA 5IC5A 2PX4A 2XYRA 2GO7A 5CX4A 1E77A 3QK7A 1XN4A 1M34E 4QDTA 3C3JA 5H1YA 5DHPA 3RIHA 5JVDB 1PVDA 1GCUA 3RYIB 3VKUA 3BR5A 3ZW8A 2JWTA 2MH9A 2COUA 2ODNA 3E22A 3HHPA 4AD8A 1YA6A 4NV1A 2Z6UA 3BWGA 4LOKA 4UATA 1Z4IA 2CDNA 4JT2A 2Y69H 1OT5A 1SBIA 2VODA 1W85B 3K3PA 5IZCC 4DV0B 3V8JA 1JT0A 1XPOA 2NOJB 2C2OA 3VU9A 5KOHB 4YP6A 3BZCA 2QJOA 1YW7A 3K6SB 4LBYA 5HZMA 3PPVA 2C83A 1Q50A 4D4JA 4YUWA 1ID8A 1O5IA 3DCYA 3IAM1 4HX9A 1V7CA 4B3FX 3QE2A 1K68A 3TIVA 4YCSA 1H65A 2P62A 2LG4A 3BKXA 1TM5E 3M6LA 5G02A 2D1SA 4XGIA 2I7XA 1UFMA 5IEBA 3VNQA 1WXGA 4EHBA 2XGEA 2VKEA 2ZXIA 4NDAA 3J7AC 1XAHA 1LVAA 4PG7A 2NAZA 3L0IB 2XMCA 1PT9A 2X85A 3IDAA 5AJWA 3VPFA 1FY7A 1NSTA 5AVKA 4XCQA 1OWNA 1NV8A 4K2HA 4REOA 4WCFC 5K0NA 5JRDS 1HTWA 5LM3A 1NVDA 2PD3A 1D2RA 5IZCA 4HO1X 3JTMA 3TD2A 2GD1O 4XN0A 1OH7A 1HYBA 3VH2A 3BMNB 5BURA 3RVNA 3VHXB 4TKMA 1HRKA 2BHSA 2ZRDA 1I24A 3M81A 1IQRA 1JXMA 4UCFA 4I2VA 3JSXA 4OCZA 2PEZA 5I47A 5JBQA 2ID7A 4DLUA 1DU4A 1JT2A 1P4XA 2X1DA 3CYFA 2EBWA 1TCAA 2C00A 1VP9A 5M5WJ 1T35A 4TXJA 1LNZA 1FP4B 3AHGA 3RKQA 3BA6A 1TVKB 1X70A 2YQZA 3K05A 1A98A 3NFRA 4OK5A 5H3HA 5BV1A 1E2UA 5FQNA 4XWOA 5A4KA 3CD6I 2QG4A 3GUYA 2J3HA 5DU2A 2FMIA 4WCFA 5FUWA 3WZMA 2F48A 2QD3A 5ECDA 1U7WA 4KQWA 2LOOA 2V03A 3C8UA 3L84A 4IZOA 4RFLA 2P11A 1ZM7A 2EZTA 2I54A 2PXHA 5IJWA 3TPZA 2AG1A 7REQB 1UIMA 4L57A 2M45A 3RS0A 1RKUA 5EINA 5KWSA 3ADBA 4PTYA 3SK0A 3I2HA 1AG9A 4NNJA 2J7PA 4HWGA 3DULA 3TQIA 5B58C 1R7RA 2WWXA 2QRVB 1AZLA 1RQPA 1SBHA 2WDZA 2RHJA 2Q3EA 1A8PA 2PQ8A 2XF2A 3PD0A 4JC4A 4PCUA 3WWEA 1DU0A 2M98A 3TIIA 3JAMA 1QRSA 4KN8A 3I59A 1WSUA 4RVHA 3E1SA 3VDQA 3WTCA 2JAHA 2HQ1A 2KIFA 2D1RA 2UVPA 3D64A 5EKXA 4CFZA 1UXGA 3ZC3A 4QSMA 3CJRB 3PM1A 1RAIA 4HN9A 5H83A 4UDXX 5BV7A 1YJCA 3LPDA 3EASA 3PXDA 2OGUA 3BXZA 4G0YA 5B3JC 2BT4A 4BGDA 3MIIA 3UMBA 3QV1A 1I4EB 2VNHA 1GFWA 3ZLTA 3NWSA 1OA0A 4C88A 2FW8A 4YRTA 1RP1A 5C1BA 5AI9A 2EIHA 4GPD1 4OIQF 1REQB 4QRIA 3LUFA 1HE3A 5DWQA 1URPA 4F86A 3N2NA 3HBAA 4I4NA 3DE5X 4M98A 3SE7A 4F9FA 2O0LA 4KQ6A 1KYQA 2N8GA 2FX3A 2MR6A 5HBRA 4QQFA 1YRQA 2QUJA 5A5GA 1I6HJ 1PG0A 1GPJA 1ZH4A 2CXQA 2O2CA 4IR7A 1JFVA 1XTKA 3KKLA 4PCLA 5THKA 3RPUD 4LYAA 2BM1A 3DHEA 1RLOA 3ESAA 4ND5A 2CQ7A 2R6CA 3QFFA 2FRDC 2P0EA 1V71A 5CA1F 4LDZA 3LT1A 1PCXA 3KLNA 1P5FA 1HURA 4HY3A 1RW4A 3ZLUA 3HBFA 3O8QB 4UNIA 4FCCA 1NATA 1VG0B 4YY3B 2K7LA 3UWOA 2R85A 1K6YA 2GETA 2WVAA 5EFZA 4ZAVA 4E07A 4ZIRB 3EWSA 3WV5A 3ZHCA 2W1OA 5EJCA 2PHZA 1G20B 2ZYRA 2DCUA 5EIAA 3U3MA 1K5DA 2I9PA 3ZS8A 2DFNA 4A3BJ 4HLUA 5L6MB 2K6GA 1ZMTA 5IVIA 4I55F 1BEEA 1ZDMA 3OQPA 1IBRA 3KFVA 3NNDA 1O97D 4KV9A 4KO2S 1V26A 4FYVA 5IT9K 2BLNA 3HSSA 5CX1B 4BC0A 4DDUA 4MO7A 3B13B 1FE8A 1N32B 1Z7YA 3SYKA 5EVCA 4EG8A 4DZPA 5HFNA 4YRNA 2MWMA 5IABA 4XLCA 1G5RA 1Z74A 3LFHA 1R00A 1FFXA 3OIDA 4FXPA 3KQMA 3P45A 2FEZA 2EWWA 4GI3A 4LXUA 1SC7A 1A9QA 1IDOA 4PC6A 4CMIB 2G06A 2P5SA 1YKFA 1GUFA 3GA0A 3C85A 5LEKA 4X7BA 1BW9B 2CRGA 4LISA 2UYYA 2HYJA 2BHYA 1ZJ4A 3N28A 3OAAD 4I19A 4UHDA 4U0YA 5GM1A 4KOEC 4BU0A 4IPTA 3SNHA 1NBHA 2H2DA 4LVNA 1ZD3A 4AUMA 2W8BA 3G3EA 1IEVA 2MHCA 4K9PA 3PUIA 4M0FA 1LW7A 5A3VA 2J4FA 2QMUA 4BVGA 5CB0A 3L4JA 4AKSA 3ND9A 3DKWA 4OHFA 2PBLA 4Q3KA 4ZYAA 1WJBA 1TQ6A 3QWLA 4RWZA 3GEPA 3IVAA 3HKBB 3VOAA 3ZYZA 4QM6A 1GR1A 5AK6A 5FO0A 4MMZB 2F43B 2N9UA 4PZYA 1BMDA 5C3UA 1KFCB 4KN5A 2O54A 1PN3A 1KYZA 1H42A 1ODSA 3ZQ7A 1NU6A 2HF8A 5H3LA 5BSTA 4OXRA 3QA9A 4EECA 1TLLA 3PUHA 4ZAWA 5LHIA 4KQ1A 1K79A 4L72A 3DZIA 2RREA 3HPGA 5HLHA 1CR6A 1U7HA 2O3SA 3JYHA 4K03A 5ENZA 3VBCA 4TZ6A 3OYFA 2Q5LA 1OJ7A 2C5GA 3LNQA 3H18A 2YXLA 1QQ7A 1XTUA 2WY7Q 1USKA 2VHZA 3IOCA 2V3WA 3E1KA 5DH9A 4IUYA 1FJLA 1EX1A 3UM9A 2HJWA 3R75A 3SZPA 2CV0A 2G0AA 2XNDA 2ZJAA 3NM4A 1MO6A 4QHTA 3G0IA 3IS3A 5JVTA 1ILWA 2X0IA 1LBIA 1SQ6A 3C8DA 1R3UA 4X20A 4Y0VA 4CM4A 3CZRA 3GLGE 3CCSI 4H16A 5JPCA 4QPOA 5CFNA 1M8KA 4LRWA 3QOYA 5BN1A 2EFWA 3EXIB 1J2YA 3OCWA 2JBAA 1LPSA 4KHPB 3AJAA 3PX2A 2VZ9A 4MJLA 4RKQA 5REQB 1YOVB 5GADJ 2OL4A 3TZ6A 2VASA 1BJZA 2OCIA 1UBKS 4LZAA 2DBQA 4YRKA 1L7VC 4JCCA 1E2HA 3LIPA 4XWYA 3EBLA 5ARCA 5HE8A 3CUEF 1HLGA 4BE1A 3C74A 4QT4A 2PZ8A 2G1JA 3CVYA 1DCFA 4TM7A 4PSAA 4FGKA 2QLZA 3AL0B 3RAEC 4E5MA 3BOSA 1RAAA 2ZOSA 4QBTA 3TE6A 5BPIA 4GNKA 2ODAA 2H7CA 4F9TA 5C5IA 4DBVO 2O7OA 4Y2PA 1F43A 4DE5A 4JQOA 2M0CA 1QANA 1ZD5A 2CHFA 3BD9A 3DZKA 3GWGA 4QDKA 2YFKA 5AXBA 3RUAA 5AVZA 1CB7A 2RJNA 4G5RA 2NV6A 3RO7A 2XNCA 3BCRA 1LE8B 1UK6A 3OQNA 5BPFA 1ZGJA 1BS2A 1R10A 2QVGA 2A2ZA 2ZB2A 5IVPA 5H81A 3SSNA 1EB8A 1KQ8A 1NASA 3NAGA 3ENNA 3V7FA 3OS0A 4WY2A 3EPZA 1ST2A 1UAAA 1ZKDA 4F45A 1R64A 1OIWA 2A3NA 2HBYA 3MGCA 5KTMA 3Q7EA 3ZK8A 4Z7QB 5C4JJ 1FA9A 3U31A 1I4TD 2WHQA 3LYAA 3PFNA 3HJRA 1XGSA 4O2BF 1WAMA 5J2TF 2RHDA 1Y6QA 1EP1B 3THXB 2A0YA 4OINF 3CU5A 3NHAA 3TD9A 5FLMJ 4QQNA 1QIMA 1Z6TA 4FZJA 4GIBA 3K2IA 4HNSA 1E79A 1R6DA 4PHTA 2AVDA 4WZAE 3VR5A 1R6XA 3L7DA 5HDNA 3GEBA 4HV5A 1NLFA 4ESVA 2VF5X 4EA8A 1DKUA 4TV9A 2NUBA 1Z6XA 1C30A 4MR9B 4KXMA 4TV8A 2I91A 2A5LA 1K8XB 3H9CA 2ZI7A 2A92A 2PL5A 4C1BA 5EKDA 4C2AA 5TVGA 4BP8A 1BCRB 1PUXA 4YJ2A 5EHQA 2XXJA 3GXBA 3PNKA 1KK3A 1UBNA 4WFQA 2NRAC 1F4PA 4PZEA 3W6KB 3FFTA 1TP4A 4KAJA 3TDNA 2RKHA 3VJLA 1CK4A 1MUUA 2IYRA 3NP7A 1PW5A 1U3GA 2AG5A 1UEIA 4XUCA 4CLOA 4LIUA 3ZVMA 1DEXA 1OI2A 2REBA 1Z4MA 1ECCA 3VSDA 1T2EA 3NPAA 3S2HJ 3ZPXA 4CU2A 3GDOA 3CF4G 4KUGA 4M1OA 4PC2A 3VUFA 1J33A 1U7XA 3WQSB 5E9WA 4BO8A 5DX1A 3ZVNA 1PQYA 4BMVA 1GPNA 5F77A 2WV7A 4F56A 1IDYA 3G1TA 3K0FB 2JS7A 5E3MA 3FM9A 2O6HA 3CSDA 4RH0A 3THOA 2HSWA 4FGJA 9ABPA 1OCTC 3OLQA 1XP5A 4KIUA 5ILQA 3VTFA 5AUQA 2V9CA 1VPLA 2YIVX 3BMCB 2J85A 6AT1A 4URYR 3UBMA 2K85A 3VOEA 3N97A 1XN7A 1OAKA 1U1CA 1HA8A 1W46A 4EVIA 1BMFD 1LBEA 4LBVA 4ESOA 1IC6A 5JVDF 2I87A 4MUNA 4P54A 1SRQA 4CZ2A 5ALZA 1WGXA 1UT6A 1CB0A 2HU8A 2EV6A 1JG3A 1QMPA 2NACA 1PJBA 2WG2A 3Q15C 1GRNA 3Q88A 4EJFA 5KYKA 1P92A 2ID6A 2VRCA 3MRXA 1Z0XA 3UJDA 3JRFA 3DBIA 2LH9A 2ESRA 4F7WA 4M3DA 4S2EA 3N59A 4JC5A 4PGGA 5TVKA 4BNNA 1ZG5A 1Y80A 1YL7A 3E6AA 2QZSA 2EQBA 3DE2X 1QH1A 3LQ1A 5L40A 5F9MA 3A31A 2GBFA 2QNBA 3OZGA 1BA5A 2V1NA 1OFVA 4C0QC 3RPUA 1IPFA 5JZVA 2K9SA 4LE1A 4JUDX 1ZEJA 4L5JA 5LLQA 3SDBA 2C4VA 2ECFA 2XMQA 1DJPA 2H85A 3OIYA 5H3CA 1P9NA 1TJNA 1X7DA 2ADFA 3EXG2 4Z9XA 5FOXA 1D4OA 3HBMA 4N4NB 5M3MJ 3ZU2A 4CTNA 2PUWA 1XRSB 1W36D 2D13A 1W4LA 2GN1A 3AV0B 5DEIA 5CEFA 5DUIA 2EKBA 4LJ9A 4Q3BA 1QTRA 4QWQA 3BGOS 5HNKA 4DV2B 2CUKA 1IH8A 2EYQA 4J8PA 1UPUA 3CLUD 4DMMA 1F2DA 3QMMA 4QTTB 1JTYA 2L02A 1ICEA 2LY1A 4WBNF 1R0RE 4KN7X 2WJJA 3DPSA 4J91A 5CT4A 1U8EA 3R6WA 3CC4I 4JLWA 4MP6A 2F3QA 4YCMA 2ZE6A 2JGEA 3CH6A 4L73A 3GH3A 1DWUA 4KN9S 4L78A 5CJPA 1JB1A 2W5UA 3NGLA 4NR0A 2DA4A 4AIJA 1YB4A 1LVUA 2J3QA 4U6NA 3V9PA 3I55I 4OU0A 1IHDA 2Y1FA 3OQIB 1PYDA 3NGMA 4XX1A 4AMYA 4BO5A 4RTPA 1J9GA 1HBXG 3QA3E 2A6EF 2CQXA 2Q2EB 3KUCA 2GVNA 1T6BY 1XZAA 1XQ9A 1A2QA 3GLUA 5F0HA 1QIGA 1CQJB 4J6EA 4MI1A 5G1OA 3ESZA 2O8FA 4FJ0A 2NGRA 1QYCA 3ILYA 4QWWA 4DFDA 3JVVA 4PVCA 4UQOA 2W2XA 3L0YA 2PYDA 3EDCA 3I6MA 4IRGA 1CCWA 1RHMA 1S2IA 1Y8CA 3R09A 4IRXA 4LMAA 1ZRSA 3D7NA 2X22A 3EQZA 5CIWA 3BGIA 3EFOA 3SS7X 1D6JA 2WHXA 4HRYA 1P2UA 1RQ2A 3CLOA 4W4TA 4C7VA 2OLKA 5D00A 4ZJPA 5F2NA 4C29A 3CJTA 4W5RA 5EWMA 5FHRA 1DXHA 4BLOA 2Y99A 1LB1B 1XQVA 1Z56C 1CY7A 2TRSB 3NBYC 4A0GA 1V8PA 1TM7E 1GO2A 5FLXA 4L5IA 1P29A 4ZVVA 3UH1A 4LPKA 3DFZA 1A7UA 2RGYA 3JWGA 2VHXA 2ZBQA 2B34A 1U1EA 2ZRPA 3RGGA 1KE2A 1LFPA 2WTXA 3IP4B 1NURA 3K94A 4KQGA 4U2EA 1E3MA 2FEXA 4Y9SA 3SVLA 4C0WA 2YY7A 1RS0A 1OI7A 4ZC1A 3S5JA 3KSDO 4U88A 1MC4A 3CLSD 4GQBA 3OZRA 1BI1A 5CVJA 2VSXA 2KLBA 2PH3A 3QFSA 4L50A 4QPNA 4C7MA 4YO7A 4ZOCA 4L75A 4JLAA 5AHXA 1VL6A 5TMDA 1SIBE 4LHVA 3OPNA 2E5ZA 1Z5OA 3F3KA 3I1JA 4WINA 3ZGYA 2MG4A 1OZAA 4DN6A 2JLXA 1XEWY 3ASUA 3VKHA 1JKQC 1CY8A 2AC2A 3C14C 4XDGA 3CPJB 5LRRA 1T4DA 3ZQFA 2JFXA 1VRCA 3HRHA 3IAS2 2ZWOA 3NONA 2RN7A 1Q77A 1V9SA 4ZAZA 4TLBA 3QOFA 4H15A 1Z6PA 4V0RA 3EUFA 2CYCA 4BKQA 1FIUA 1AZTA 2E49A 1JILA 2B3DA 3RRJA 4HX5A 4AJ2A 4CEIA 4KPGA 3QODA 4EG4A 4EYGA 3AL3A 3GGPA 3LY7A 1TUGA 3VWBA 2ODQA 2FJ0A 4TS3A 5B7NA 2OVBA 1ISJA 4KE7A 5LYJB 1L5OA 1LUAA 1NZDA 2PGOA 2Z09A 4PLPA 3V55A 3DUFA 5EA2A 1D03A 3ROQA 1NN0A 2P40A 2Q6TA 3IPXA 4CKWB 1X2MA 2Y0MA 3JW4A 2H8RA 1MVLA 1P2GA 1RWWA 2ERXA 2F4NA 4JBAA 2ZB7A 3HDJA 1AHPA 4U1RA 1ZISA 4F5ZA 4MEAA 2BLLA 1QP0A 5C7OO 1KH3A 3GRUA 1XXHB 2E1PA 3AEUA 1OT3A 2XUKA 2ZI3A 3WGYA 2PK3A 5GIPE 2WMNB 3R3ZA 5KTYA 2VYQA 2E7XA 2WHEA 3DE3X 3L8MA 2Z5VA 1CPYA 4M1SA 2OF7A 3P2IA 3P0JA 1IZ1A 4RAQA 1NT2A 2YWCA 4KYIB 3OPYA 2PWAA 3LOPA 1E99A 2EBIA 3EVDA 2DQYA 2ENUA 3MRTA 3OZUA 1XNJA 4JODA 1R22A 4I0BA 1AUVA 2FN3A 2V7XA 1ZM2A 3S16J 3NKFA 4MQVA 4TUYB 5T6BA 5CBPA 5E1MA 4W5QA 3BWBA 4M71A 1QGED 4Y3OA 3GFRA 2CUEA 3CCLI 2R7RA 3FG9A 3PC2A 4R98A 5H16A 5H02A 1ZRNA 5JYCA 3QWHA 2G40A 4RESA 4CDNA 5FL7A 3H4VA 3Q7TA 5BQOA 4CQLA 4RPJA 1R8QA 1HE2A 4BNGA 5HTOA 4LYHA 1AQNA 1EH7A 4FS3A 1RRMA 1Y0BA 1Z0KA 4ZI7B 1M7BA 1P33A 1QK4A 1MH4A 3JQPA 4MVJI 1O4WA 4CI0B 4F4IA 2RC5A 5HIKA 1LA2A 2C7BA 1M54A 4ZC8A 2Z9DA 2XB5A 3WLPA 1CUFA 5BQTA 2Q8PA 4K26A 4NESA 4P4SA 1TTQB 5AHWA 5AUOB 2Z56A 2VOEA 1R7JA 1JB9A 1R0YA 1OY1A 3WDKA 1VSTA 2NUTB 4MVJM 5JCJD 5JDIC 1T36B 4I4IA 4M9ZA 2QJTA 3BB1A 2P7IA 3NBUA 4HAUA 1FJXA 4LSGA 1L5VA 1NVEA 3AYXB 2PZFA 3VSBA 1A04A 4R1HA 1ZK3A 3R41A 1XJQA 4RAZA 3S29A 1KBZA 4URXR 5A6SB 3MJSA 5FBKA 1B8OA 3MZ0A 1UZCA 1J97A 2E4WA 3TEDA 1P62B 5L3CA 2EZ9A 2Q3MA 3NEYA 3ULQB 5K09A 3PHHA 1SA0B 1TKBA 3HPQA 3NT2A 1E8MA 4ZMRA 3K7AJ 3RT9A 1JU3A 4M38A 4JJFA 3SKYA 2JEOA 5ALVA 4AQDA 1ACLA 5JAHA 2G5TA 2MYUA 4E33A 2HI3A 2HQSA 2V58A 1P39A 2Q27A 2GAOA 1FXUA 2BSQA 1FS6A 5E7MA 4US2R 4EKGA 1D4AA 5F3DA 1NIJA 3UNGC 1C50A 2NXEA 1WJCA 1ITZA 1ODTC 1JEJA 3CUUA 1DMSA 3DWFA 2YR0A 3LECA 4ME6A 4MUYA 5FXMA 5TJHA 4EG1A 2VJPA 3STWA 4DBLC 5CAEB 1GUYA 1BRMA 1JSXA 3AHDA 4NNOA 4WKGA 5AKLA 3HE3A 4LMYA 2LVBA 3WTBA 2RD2A 2CB9A 1YRNB 2C9YA 2K2WA 3ANTA 4YI5A 3KL2A 2PE5A 3CO0S 4RMGA 5EPEA 3QKIA 4ERNA 4AMBA 2VBZA 3C18A 3BILA 4R83A 3GJ8A 2KJBA 5BMVB 1N3BA 1V1MA 2BFPA 2DQ4A 1RWNA 4OHUA 2BCGY 1W5EA 3BD8A 1R0KA 1HA3A 1EIWA 3GA5A 1U2SA 5DK6A 4TS1A 3LVBA 5B1IA 3QEMB 1O54A 2G5PA 3HN7A 3W06A 3W8NA 2EV0A 4LK3A 1IBKB 2V4UA 3G8AA 1XTPA 1QNFA 4ER0A 2J67A 4HR7A 5LGUA 3LAPA 5CH3A 3VHXA 1RMQA 1DC8A 1E92A 2WYIA 3IUYA 4NK5A 3CLQA 2PBIA 3G0GA 4AJ9A 4J0IA 3GLXA 2FVXA 3LV8A 2RHCA 3O4FA 4XGKA 4CV3A 5A06A 3NR2A 1U3EM 5LXTA 3KKZA 3G8CA 1JIIA 3KJIA 4TVBA 3U7JA 3O8DA 4RPHA 1XA0A 1HCRA 1KI8A 5ECGC 5JYEA 4MW7A 4ZVUA 1LCIA 4MP3A 2XKAA 3CNQS 1NJ8A 4L5YA 2VPYA 1X7WB 3K4BA 2NZXA 1T33A 1OWLA 3DT9A 3RSQA 1YBFA 2VSQA 4W1QA 1FMLA 1JFLA 1HXDA 4FUTA 2I5UA 1ZN2A 1U7TA 3H0CA 4KI0A 1V39A 4XGRA 5HFJA 1KKUA 5LOVA 1KOJA 4IQJA 3KTOA 2LRDA 2R6HA 4UZEA 5TQ0B 4ARAA 5K0JA 2RNJA 3F8TA 5IZ4A 1D5WA 2PSSA 3TCNA 1OB5A 2PT5A 5FJIA 1AKHB 2HI0A 3NWOA 2XR1A 4RD2A 2KYRA 5DGHA 5EAIA 3UUFA 2FRXA 2YIMA 3V8NA 4BWGA 2FUNB 2AGVA 3CRNA 4BZXA 1SFXA 3S1AB 3G6EI 1XAJA 2G5CA 4G5XA 2CF6A 4UPVA 4NSNA 4Y1GA 1HMPA 2XF5A 3PIOF 1LBSA 4EYEA 4DYCA 4HH4A 4O8ZA 2P1ZA 5BW8A 2JGIA 3MRSA 4GE3A 5LYYA 4BNKA 4LF7B 1HFKA 2RGXA 1Y0UA 1E5TA 2QSUA 3PPYA 4LJAA 2XKJE 4DAOA 4F46A 2HLHA 1IJWC 1GLVA 1KAQA 5K3DA 3H2GA 1Z39A 1P3Y1 4IFBA 4XZ3A 2QVOA 3BPSA 4V0QA 1P77A 4NBNA 5GJCA 1COWA 2FZWA 5GP1A 1YRYE 4C0AC 4Q4HB 2LKSA 4RBOA 5T5QA 3U4MA 2JA7J 1ORIA 2FEAA 3WL4A 4MV0A 1A2BA 2X3YA 1FTSA 3LU1A 3MJFA 4OBXA 2A61A 1ZD8A 1OFTA 1U81A 2GQ0A 2VDKB 2XZDA 4PYOA 2XGOA 1AS0A 4BJ6A 4ED9A 1TPZA 2QF7A 1IK4A 4GE0A 5FAXA 3DBRB 4ZMBA 2VUSA 2CCJA 1VSUA 1UBSB 2DBRA 2ZRMA 3BHJA 3KCQA 4IDCA 3H9JA 1H3FA 4BNZA 2NP6A 1YS4A 1S6LA 1UMDB 4EENA 2Q3CA 3TFWA 2FPRA 5JWHA 1KEWA 2QUAA 3L2OB 3N2KA 3PEUA 3VC3A 2I4RA 2QQ9A 2CFXA 2H9YA 3VI3B 3Q5GA 4F55A 1LNQA 4JVSB 2JI7A 4QRHA 3DXJF 1P9RA 2JSCA 3KB1A 4I0WB 4N9WA 4TM8A 3STHA 4D9GA 3ES9A 4BEWA 1VRVA 5FUVA 1U5AA 4EO4A 5A2QZ 3G9XA 1MEJA 4QGFA 4B40A 3OFVA 2JKVA 1TZLA 1LD3A 1RWKA 1XIVA 1QYDA 3CM0A 2BVMA 3FUUA 3I2JA 1GNQA 1E9BA 3INNA 1F5NA 2L5QA 3ELKA 2ISSD 2RK4A 2ATXA 2FPIB 4M9SA 3L7NA 4QDJA 1AQLA 4QQRA 4PZ0A 5BMVF 2RGGA 5I7SA 2NLOA 5FPKA 1GSAA 3O9VA 1V95A 2GJKA 2ZJ1A 2G8LA 1Z6ZA 3F9KA 2X6QA 1DDNA 3O21A 4QYXA 1JDJA 4A91A 1LB2A 4PCQA 3JD1A 1YTUA 4C4AA 4A73A 3PFBA 3KD3A 1BIBA 1GG8A 2DHQA 1SO8A 1W88A 3ZP5A 1WJFA 2JHFA 2QQ0A 3HNRA 4I8XA 3U1VA 2FUKA 3BZBA 3MYRA 2NU9B 3G4SI 1BXZA 1EZ4A 1GDDA 2V5VA 5GPBA 2ZPTX 2HUNA 2WAYA 1N1MA 4EL0A 3KEYA 4JQZA 2X76A 3ZEAA 2IVZA 3C1DA 4IX7A 1Q74A 1YOBA 2F8MA 1DZIA 4PX2A 3A4YA 3LS2A 4BKRA 3E48A 5L4LA 2PMHA 2XWJI 1AU9A 1YHZA 1BI0A 3QKSA 2HGZA 1ETQA 4W8HA 7MHTA 1AKYA 4KGXA 4D79A 3MMPA 1X8LA 5K8IA 1E3EA 3L7AA 5D3MA 3WZLA 3HGTA 4ENMA 1N2GA 2LV8A 5AOAA 4RZ3A 1F2TB 3F6EX 4WDRA 1IZYA 3BROA 2W6JD 1DEOA 1DLIA 1NJ1A 1SAYA 3I8SA 1QPBA 2GEBA 3FCYA 4DOZA 1WXEA 2AUTA 2R8BA 2JCGA 2RAUA 4BX9A 4R7ZA 4H1HA 4KGDA 2GTPA 3MKYB 2P4HX 2ZQYA 3SIWA 2FU4A 3GCZA 1W87A 1JT6A 4HXGA 5JXIA 1DTEA 3LP6A 3O8QA 3D7RA 5G40A 4B7ZA 2G7HA 1JHXA 4CQMA 1FOKA 4MLPA 3TW8A 4YJ3B 4LY9A 3A3KA 4LV6A 3T3NA 1XEXA 4CN8A 1O57A 3CMAI 4PBTA 1SHJA 4ZI3A 1HL3A 2OAQ1 4JFAA 1A6QA 1S96A 2CLCX 4ENWA 3SEAA 1QPMA 2XCLA 4MROA 1C9JA 3E03A 3PDHA 4QPDA 3OL3A 1W5AA 5F9HA 2FQ1A 4JHLA 4ML3A 3CURA 4D5EA 4KLAA 4V3CA 1IY2A 4WXMA 4YJGB 1EE2A 3PHIA 2ERCA 4MYUA 2EIJH 4MVJH 5MDHA 1EBFA 2ACKA 4HT3B 5EG5A 5BN4B 1FYFA 3K9FC 1VJGA 1CVRA 3JASA 3HYRA 3WU2C 3M1CA 3RCOA 1BKYA 2ZYHA 3RTBA 2X1VA 2XW6A 2OB2A 1ZBDA 3KKQA 4MPRA 4A3SA 4PY2A 3OHPA 4YAIA 1MC1A 1E6WA 3C3CA 1EK6A 2H2GA 2HQRA 2K7ZA 4X71A 3HIFA 4NYIQ 4OA8A 1A9RA 3U9GA 1FSHA 1ZUD1 1XCGB 2AHRA 3JARB 3MGAA 4GGPA 3R76A 1R4ZA 3P71T 1RHRA 3ZU6A 4CCSA 4URFA 3E8SA 1OBFO 5J2UB 1BWQA 4OFZA 5E6RB 4LQLA 1GPWB 1NF9A 3DAFA 3NRJA 4B0OA 3RCBA 1F8GA 3IV6A 3HTUA 2E2JJ 1OLTA 2D5VA 2JJ7A 1JLKA 2A84A 3TAHA 2DH5A 3TX6A 3BX1A 2JTVA 3J81K 1MT3A 4EMSA 2J0UB 4MYRA 2J6IA 2DA3A 1CGPA 4GL4A 1NTCA 1Y7PA 1C8VB 4HVAA 5CLGA 4G12A 5KNDA 2HA2A 3DCJA 1YBMA 1SC6A 1L7OA 1ST3A 2AQEA 2CLSA 1Z8DA 3DD1A 2ORVA 5C8VA 2PUEA 4G4GA 4CO8A 2Q0QA 4JB3A 4YAFA 2VQLA 4PO3X 4RA9B 3STXA 2KIQA 3TWOA 1WXIA 4NULA 2Z5LA 5C1DA 2M2IA 2WTBA 2ZIUB 4ENNA 3KVVA 5FI0B 4Q7KA 2PKXA 3QKTA 1IWPB 3R7NA 4UHTA 1FOXA 2XPUA 1L4HA 2AO9A 5JJLA 4DCJA 3TTUA 4M88A 1OLXA 3H2SA 1UBLS 1K86A 3JQRA 1YDWA 4MMYB 3OOYA 1AV6A 2F5FA 1MEEA 1WP9A 2XKBA 2C2KA 2BGWA 1R15A 2GDZA 3SNKA 3K1JA 2GVDC 3ZV3A 4B6OA 5KKCA 2B8WA 4RTOA 1U7PA 2WJ6A 3NVMB 3F74A 3R7LA 3RU7A 3BK1A 4CF7A 1W5FA 1NXWA 1ZR2A 4P36A 5AIAA 3EZLA 3BZWA 4IHQA 2DFPA 3R24A 1QGUB 5CTAA 4IXAA 1ACJA 4DSNA 4GECA 2YWRA 1H94A 1T1GA 1K7EB 2I9KA 1Z0DA 4IHJA 3SIRA 1CDOA 2Z98A 3EUEA 4I1SA 3LRXA 4IM7A 3SS8A 4ZEVA 3WLQA 1UH5A 2PN1A 1DFGA 3PNLA 4AM8A 1ISSA 3B7PA 2CHUA 4M0MA 3JWPA 5IHPA 2VSNA 3ZDDA 4A0HA 1MMFB 1Z2CA 5TPWB 1PJSA 3IRVA 5E4TA 4E7SA 5K5QA 4PZAA 1ZK0A 3GN1A 5KHAA 3A6FA 1KBQA 2JLCA 2PY6A 4C01A 2IA2A 2EX0A 4ANFA 2AMJA 5DGDA 2A0WA 3DKRA 2NVTJ 1AKTA 3Q3JB 3NQ41 4ZARA 1RM0A 1C3LA 2QLMA 4R3NA 3UJPA 4BNUA 3IC7A 1G291 3K96A 3A03A 3ZXSA 4FTWA 1Q1AA 2J45A 2O2XA 3UPDA 1D6NA 5F1RA 2ZFWA 1DC6A 1UPCA 1FX0A 3FUVA 3JV7A 4O6VA 2AI3A 4BFZA 3HFJA 4MYSA 2A0KA 2IZ7A 4UV9A 5FJJA 4EF5A 2G9NA 1BR2A 3S17J 3BB3A 1SXQA 1XL1A 3VR6A 3FR7A 1MD9A 3CG0A 2WY2D 1HT3A 1ZI6A 3VMFA 1IM2A 4Z3OA 4X6AJ 3NAMA 4CLDA 1SOAA 2YINC 1OGJA 1YU6A 4BP9A 1WUKS 2VSYA 1PBTA 4PNEA 2W84A 4I4TB 4I55A 3QF7A 2P0YA 4WT7A 5BT9A 3R7WA 4AJ4A 1T6ZA 5DP1A 1FWZA 3P9RA 4WFJA 3BAZA 2JLWA 5ALXA 3ZVKA 3KXPA 3M4XA 1RJ9B 4RK6A 2BEOA 2C97A 4O1MA 1JV2B 4L0DA 2IELA 3RVLA 3ZNOA 2EGHA 3REOA 3LDFA 4MI3A 3TZBA 3DFKA 2G72A 2OAGA 2V7TA 2KJQA 5HF6A 2XGJA 1PVOA 1QCZA 1TKRA 1JSLA 2JBWA 4OYYA 4D9EA 1RACA 1RC8A 5JEDA 4HH0A 4L9WA 3JRAA 5AJZA 4RLHA 4XTRA 2VUMJ 3CC7I 1Z38A 3ESWB 1ZH2A 2RHHA 2J08A 2WKQA 3O3NB 4I81A 5JH7B 3A36A 1GD1O 3T0YA 1GL7A 1V96A 4HGRA 4J75A 3IUQA 3OCVA 4OAPA 1S6YA 2D1TA 2BH9A 3NH6A 1DIOB 3AUKA 4OB6A 4MR7B 4OY3A 4UQPA 1ARZA 5M04A 4Z0TA 1N75A 2WSSD 5F23A 2KB0A 1EVYA 5LKRA 4MW6A 4UVEA 1DC7A 1OTXA 1CJKC 1DOAA 2E4YA 1H2YA 2HOSA 3H1FA 3H87A 2WD7A 1WPGA 3T7KA 4J3FA 1LRKA 2Y9MB 2ZRAA 5J63A 3BWCA 2D2WA 3BT9A 1BYUA 4FUQA 4YJFB 1CQJA 4U2GA 4PHHA 3GXOA 2EZLA 1EVIA 3OYGA 3IDOA 1Q5PA 4I3HA 3TB6A 4YV7A 3V6LA 5A3JA 4MRVA 1C1YA 1NMEA 2QAGC 5ERYA 5L3VA 2X1EA 1S0UA 1KO8A 3RRFA 4OEHA 1QVWA 2BGJA 2L7MP 1LDBA 1V2GA 3THYB 1JHQA 1RJEA 3DTEA 2VCYA 4HZUA 1RWMA 2I2FA 2Y6VA 4Q3OA 1TVKA 2FPOA 2FWJA 3GZ5A 4FC7A 1L5GB 3GJ7A 3RJ9A 3RLFA 4ZYXA 5K05A 3JATA 2A7QA 1CUJA 2FMFA 5IU6A 3WMEA 2EPFA 4D1YA 3FVQA 2MC3A 3WR5A 1T8PA 3M1AA 4UVHA 2D4HA 5CB8A 3MD2A 1XJ0A 1KU3A 2W4IA 3TVDA 2WA0A 3NH9A 4DARA 1SFOJ 5EUCA 1TJYA 5EMMA 1W47A 3AM1A 2R1TA 3SXUB 3X0DA 4EG5A 4E5DA 1NPYA 1EUDB 3H7AA 3TPFA 1PSDA 5D6EA 3CCQI 1BD3A 1SBQA 2GN8A 3NCHA 2ADUA 4RPGA 4OQFA 3G5MA 3NIFB 2WYUA 1CXZA 1KJQA 4HAXA 1Z0ZA 4X1KB 4GOOD 5J59A 2P6UA 3L7IA 4V03A 3A1DA 2NO1A 3MLAA 4PYIA 2C61A 3EG9B 3OSUA 2Y2VA 3QPTA 4YRGA 5IASA 1EUQA 4BKMA 4KR6A 5H9WA 4IXWA 1NWCA 4PHGA 2O5EA 1A9SA 5H7XA 1UJ2A 3Q7IA 2XV4S 4LSWA 1Z9BA 2FW7A 2MJLA 1ONVA 2QQFA 2QTBA 3EQ8A 3OTGA 4RADA 3E0JB 1W52X 2EU8A 1KS9A 3LMMA 1FQJA 3H9GA 1GKYA 2PBRA 3LUKA 4Q9DA 3WK5A 4M7WA 2ECBA 4F4CA 2CHVA 2WQ6A 2FQYA 4KEAA 3ORQA 4UJ3A 2F7SA 1H05A 3GJSA 2PU5A 2WSSA 3O3MB 5GGYA 3SZGA 2EFGA 2JRLA 4R84A 5AM4A 1H2EA 3W0LB 3QF4A 4UQLA 2ZBKA 3DZGA 1IPHA 2QCOA 3AZPA 3I56I 4U7TB 3ZHZA 2XQFA 3AOGA 3PA6A 2DYSH 5D5XB 2J5QA 3NIBA 1N6OA 4IG9A 4TTTS 2C7PA 3PQ2A 4DG5A 2JMWA 5CLHA 5FYDA 3QP5A 2ZETA 1F51E 2PZGA 2QYHA 4JENA 4NBLA 4R9UC 2B9EA 1MRZA 3QUCA 2XUGA 2R5YB 2AJCA 3ISVA 4UBKA 3IEUA 5IJAA 4Q7QA 4DGSA 1NYLA 2V9KA 1NOKA 1ZRHA 4GXQA 4TT3A 5AM2A 1Z47A 1KHHA 3I9FA 5F7OA 1H9AA 3TBIA 2XVMA 3CGGA 2GJ8A 2C2WA 3EFEA 4TMVA 3SZLA 2QENA 2XRYA 2ZVQX 4I50A 3TDMA 3CJRA 4MV9A 5LQCA 3LLSA 1P9QC 2DA5A 1ZIYA 2E5FA 1ISMA 2ZUUA 3HKCA 5CB6A 2ZBGA 1UQRA 2IYPA 2O0MA 3A6HA 4BLQA 4V0NA 4CXMA 3QG5A 2CFIA 4RB1A 1J2TA 1OCEA 1US8A 1E2JA 2PS9A 3CY6A 3JD0A 3PQ7A 4FFBB 4GICA 2ZEJA 4YG2F 4Q9KA 4QUGA 2JFPA 4HRVA 5EE5B 1V45E 4N5MA 4RSHA 2AVNA 1DAOA 1IHPA 4IDAA 1G38A 1VZ3A 4TUYA 3DOFA 4OMDA 4Y6PA 2WM3A 2C7VA 5TF0A 3X1YA 1ITYA 1EK1A 2W4QA 1T5DX 1ZJ5A 3DLBA 4U0WA 3W4JA 1SBTA 4K40A 4CRWB 1AD2A 1FDIA 4HN2A 3EEOA 4MUEA 4YCLA 5F6FA 1XWWA 3L0DA 3PUBA 4B5LA 2X1CA 3CN9A 1UADA 3GCDA 4RD1A 4Z0PA 2CJWB 1RPWA 2YX4A 2Z33A 1QFSA 4UNPA 5DULA 5IH3A 1N8KA 1XU9A 3DMTC 1R4MB 2HVQA 2JW5A 3HB0A 4JZYA 4AMVA 4DG9A 3DDCA 5TQVA 3SJ7A 2IUFA 4DLTA 2AA3A 1WOMA 3MJ4A 4L6AA 5EHNA 1U3UA 4P5EA 5FULA 5EEAA 1SFRA 1Y6JA 4OGGA 2QORA 4IICA 1IPEA 5IPFA 5J4YA 3HM2A 5L45A 1X87A 3G8DA 4TRMA 4WCVA 3LQ4A 3RVJA 2UUCB 1B1AA 4U6QA 2IA1A 4LJRA 2DQSA 4DBRA 1ZH8A 2HXGA 3I9V1 4KFUA 1YZQA 4D8UA 1KJYA 4LOJA 1U2TA 4HQNA 3VZDA 1NPTO 4K2EA 3I34X 2IVMA 4ENKA 1OF1A 4PU0A 3EPRA 3VPHA 3D2LA 3IVRA 4CF6A 4EW3A 1GVHA 4S24A 4W9NC 2HVSA 1TYEB 3S28A 5ED0A 5JZOA 4INJA 4NNPA 1DDGA 1O3YA 1O8CA 2DKFA 5JAOA 1OUMA 1RR8C 1K8QA 3Q72A 4LFAB 3GQVA 3I0MA 1U11A 4JLOA 5F2KA 2QGNA 4DMKA 1MZPA 1GR0A 1MX1A 2H11A 4IVPA 4P3YA 4ENVA 3G2HA 1NOIA 3LVFO 1QZ3A 2DK8A 3L02A 3MTGA 3VYRB 1Y89A 2H1HA 4G0QA 2FW1A 3U3KA 1L4UA 5GAJA 3RFFA 5BQFA 5JLJA 2VPTA 1ETXA 4MLOA 1UP6A 1ZH6A 1A4RA 4IOMA 2NS0A 2PVPA 3DVLA 3O4RA 2EBHX 4QREA 2TDXA 1XZJA 1QRRA 4OXQA 5JMOA 4LBWA 3DEIA 4KDPA 1GRCA 2ZJZA 5JXJA 4LITA 3JWEA 4P4TA 4E51A 3HLYA 1ONSA 2B4AA 4WEQA 1SU4A 1R6BX 4PO1A 5BWNA 1A8IA 1DT3A 1T2CA 1RHJA 4FINA 3ZVLA 3N8IA 5ER9A 4YA6A 2L0KA 3KT6A 4D25A 1VZ2A 1T25A 4LX0A 4W5WA 4IO9F 3C39A 2G08A 1M2FA 2HK7A 1J0AA 3E0QA 1KZ6A 1NC1A 1QHGA 3FF5A 2JKYA 1DRVA 4ZZ0A 2Q2VA 3EIQA 4C21A 3AX6A 3JYPA 1NFFA 2YMQA 3QITA 1GGMA 3CZCA 4F1JA 4WOJA 1Z63A 3U09A 4JVMA 2CEKA 4M1ZA 3O8NA 1KAMA 1DQNA 1M2OA 3ZDYB 4RM3A 5JY1A 2PZBA 3CX4A 4CR8A 3L6BA 4INPA 4KTVE 4NCNA 2P41A 5TQ0A 4JI8B 5AVXA 1W25A 1ZINA 2STTA 2YNMA 3L7KA 2EJTA 1V4RA 4FX4A 1KP3A 3A4VA 4H6XA 4M76B 4MVXA 4WNCA 4GLLA 3UC5A 4DIOA 5DO9A 3OQ1A 2M4GA 1F8UA 3CVXA 2DT8A 2I76A 3OPYI 1MNDA 2QA5A 2J87A 3I8OA 5AQEA 3TLGB 5FUBA 4YC7A 3N70A 3HOVJ 4A3DJ 3OEHD 4PYRA 1UKZA 1WIWA 3FNIA 4JSYA 3VYSB 2IDKA 5G3ZA 3VR3D 5EJ6A 2ICAA 3BZKA 5ALUA 1X1EA 4CEHB 1WCV1 4R6XA 1ES9A 2XCRB 4QE3A 1AKEA 1E5XA 4RGXA 2AZXA 2YXPX 1E60A 1ZI8A 3GCMA 1QVAA 3GFLA 2YX7A 2OY0A 4YTEA 2FD5A 5LLTA 2V26A 1VSQA 2QL9A 5A02A 2QWWA 1VFCA 4A0XA 4PG5A 5JCOA 4LGYA 4AVYA 1GP2A 1ZMRA 3ZWQA 3NRVA 5JFGA 4H2DA 5HLIA 1L3IA 2XMSA 2UUAB 2E48A 5M5YJ 3O2SB 3OZAA 3ADOA 1U0LA 3EEQA 4OK6A 5DVZA 3Q5FA 2ZWVA 1T9GR 2JI6A 1QKIA 5H80A 3WWOA 4V1CA 5KJFA 1XMQB 3P8ZA 1E6CA 4KMMA 1XTAA 4DGWB 2LCFA 1CUBA 2QUKA 3DV2A 4LRSB 4W97A 5FKLA 2MSEB 3NIDB 2Z30A 3TL3A 3SBEA 3BMOB 5JNLA 3UK0A 1DIAA 5IP6A 1T0UA 2HO5A 5FNVF 1JHDA 2Y4OA 5FBLB 4FFLA 4QG7A 3RI4A 5DV9A 2FG6C 2M4KA 1EEHA 2WMYA 4ECEA 2D54A 1H2BA 2PUJA 1V11A 4E3ZA 4KPUB 1K9SA 4II3A 1Q3HA 1Y1PA 1A9TA 1BOAA 3J7ZI 1J0RA 1KI4A 1XAGA 2QRKA 3N07A 3DOCA 4OQZA 4AMZA 4BVHA 3VDXA 1EP2B 2XVZA 1U8TA 2Z2YA 2BGIA 4Y1EA 2QTNA 3PB3A 4Z99A 2C4MA 1NG7A 3CLKA 5TISC 1XGOA 3QLTA 5FRDA 3GYHX 3L4SO 5DYWA 3QIAA 3LUBA 2JEZA 1T2DA 1UM9B 1ODDA 5EXDA 3EXHB 4N1AA 4HPXB 2W7TA 4LK0F 4UMEA 2BPOA 3RYFA 4K9DA 2VJMB 3S40A 5A6SA 5I9BA 1NMZA 2HBQA 3F3MA 2G4LA 3R1IA 4CKBA 3Q5DA 1KSGA 1OREA 4AZ3B 3CH4B 4KFRA 1QHSA 2VL7A 2ESHA 3OJCA 1T5OA 3OWOA 3BSWA 2BY4A 3E7DA 2HOEA 4A7PA 3GR6A 1DOHA 1GV2A 1GUAA 4DHWA 4L9NA 2OTJI 2L9SA 3KHSA 4F6RA 3H5TA 3MCVA 2IP2A 1FEXA 5DTRA 5I8ZA 1SXJA 1B8VA 4IMPA 3U7HB 1L4FA 2OU2A 3C5HA 4R6WA 2Z58A 4UTNA 3EIHA 4FYJA 4QBKA 1UK7A 2QN1A 3QLUC 4DBZA 1C30B 4MR9A 3GELA 3WGLA 1YLFA 1XZHA 1NNLA 1BOOA 2X8WA 3K0BA 3PNMA 2F1OA 1KEUA 2ZT8A 3OWXA 1G21B 4EG0A 1P72A 2E1OA 1RESA 4N7JA 4JI5B 3VZSA 1QO0A 3LGXA 1Z4PX 2Q4OA 3ICOA 4V2IA 5L3SA 3CA8A 1MBFA 3FPLA 4NCHA 5EN4A 2WAOA 4IDDA 1BE6A 3OV8A 1FRVA 1KO4A 1P7IA 1XTVA 2DULA 3IB6A 3NAZA 2ODEA 3PU6A 3T7CA 5HRCA 1FUYB 1Z7GA 3EHDA 4QXMA 3LPMA 3H19A 1VRWA 4HB3A 4B7AA 1GZHB 1LSSA 3OIPA 1TW2A 4OHPA 2W42A 3TSZA 5M5XJ 1H2XA 4CG2A 3DB2A 4BEHA 3K8OE 3UMRA 3B82A 4AJPA 2XSJC 1CSEE 2JGNA 2RHLA 2H5JA 2Y1KA 3OI7A 4QU8A 2IIVA 4WBXC 5AKIA 3MB8A 5T3YA 1DT5A 1D8JA 3B1JA 3SMQA 4D81A 4BP3A 4DUYB 3RYHA 1NUQA 1HKUA 3OOPA 5JVDA 1NJ2A 4XW2A 1G5IA 1FU4A 4MA4A 2A68F 1AA9A 1CIJA 4R2HA 3PIRA 1R71A 5JRJA 4Q16A 5K0CA 2VLBA 4LXYA 3LP5A 4A5OA 4MX8A 3MJTA 2YY6A 3E9RA 1YZUA 2HVRA 1R0LA 4QA9A 3W1VA 5EDNA 2OK7A 3PX3A 1RTTA 4LB6B 4OXXA 4G5FA 4YMUA 4IFEA 1MFPA 1RWOA 1F2VA 3RSHA 3MJCA 4QOEA 2CQKA 4KWTA 3NVKI 3IJPA 4D3FA 4M3BA 1RQRA 2GZWA 3K0LA 1J49A 2X8JA 1YJ5A 1G3TA 3PJGA 5CT5A 2C03A 2J5BA 1KK2A 2QAJA 4P0PB 3KYIB 3TW4A 4BKUA 3F9RA 2ATVA 2HEIA 1GG2A 4MQUA 1QHIA 3I2YX 3KD2A 5ULLA 5BT8A 2FAXA 6REQA 1EEXB 3UW3A 3OE7D 3WA6A 4PRLA 3TQHA 3AB7A 3DXYA 3U4GA 4ARCA 1U5BB 3AI7A 5PGMA 3N87A 1H3NA 3PXAA 4NEGA 2A5GA 4RSMA 5HIIA 2BKXA 1E1KA 2YVUA 4EO7A 3NARA 2QMHA 4L9TA 4NOMA 5MFPA 2JGRA 1BJTA 4CDGA 4TKUA 5ADVA 2P9QA 1GFIA 3H4IA 5A1JA 4HQMA 3ZMUA 5BPDA 1EGVB 1MNMC 4J1NA 1CF4A 1GPAA 1T4MA 3LZ6A 1JMYA 2F3SA 4AKEA 4LHSA 1GPLA 4ZEMA 2CGEA 2BMJA 4WW0A 3TLCA 4G0WA 1A69A 4TLEA 3AV3A 3A3NA 2PUCA 3S1SA 3QUTA 2BKLA 3T8YA 3M8JA 1J9IA