2LY2A

Nmr structure of the second and third lotus domains of tudor domain-containing protein 7 (nmr ensemble overlay for lotus #3)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
180
structure length
180
Chain Sequence
GHMDEVQNRIKEILDKHNNGIWISKLPHFYKEFYKEDLNQGVLQQFEHWPHICTVEKPCGGGQDSLLYPARREQPLKSDQDPEKELPPPPPAPKQEVPSQGSPAVMPDVKEKVAELLGKYSSGLWASALPKAFEDMYKVKFPEDALKNLASLSDVCTINYISGNTQKAILYAKLPLPTDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title NMR structure of the second and third lotus domains of tudor domain-containing protein 7
rcsb
source organism Mus musculus
molecule tags Rna binding protein
molecule keywords Tudor domain-containing protein 7
total genus 35
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2012-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2ly2A01
1.10.10.1880 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2ly2A03
2LH9A 2LY1A 2KPMA 2LY2A 3RCOA 3S93A 2KZVA
chains in the Genus database with same CATH superfamily
1G59A 1JT0A 5E8GA 4I09A 3V42A 3IAM2 4XLPF 1HDDC 3F22A 1K4TA 1ON2A 1FPQA 2L4MA 1HQCA 1LQ1A 4IJAA 4V2FA 2IGOA 2NOGA 3S8PA 3HHHA 1IDYA 2X1DA 1E3HA 4KFCA 4AUXA 3LA3A 4XQFA 2CJJA 2MH2A 1Y39A 4MTDA 3K4NA 4M3EA 1Z05A 1NHAA 1VQLI 3F8BA 1Y8RB 2E2IJ 1FTTA 2R7UA 4M6VA 1T08B 3K10A 2ZXJA 3E5QA 3I59B 5BNGA 4B8XA 3HBLA 4IXAA 2Y9ZA 4BHCA 2H8RA 1D8KA 4ZYGA 5K5RA 5CQEA 2EV0A 4AVPA 4XIDA 1EJ9A 4NC7A 3QWLA 1LE8A 2CRGA 2O61A 3ISPA 5D4RA 3PIOF 3RI4A 3JAMZ 4ESJA 1YJWI 2WY7Q 2B63J 5AIPA 1LVKA 5EGOA 3V7CA 2UWMA 5HLIA 2Y69H 1I1SA 3P7NA 2A69F 2V1XA 1MGTA 3MQ0A 1T95A 1S5LC 3HRMA 4M9SA 2R7OA 2CH0A 1KGSA 1YJ9I 1MBKA 2HOAA 2HYJA 2IVMA 2XGEA 4BQOA 1I6XA 2E5ZA 2GZWA 4IHVA 4XKVA 5DM6F 3LSKA 4E70A 1ULYA 2ID6A 3GTGJ 2DJIA 3DTEA 3X2QH 2LC2A 5JLXA 3J80K 4V2GA 4XBFA 5TRDA 1IRXA 1U5TA 2NNNA 3FF5A 4MGRA 3KYLA 2VBZA 5FLMJ 2JVHA 3RTRA 1TNSA 3OYAA 2XSJC 1D5YA 1BOBA 1OQYA 4L5EA 4NC6A 3HXLA 4AIHA 3JRIA 3OY9A 1EH6A 4KMUX 5F04A 3ZMVA 2D1HA 5H6QA 2WV0A 1UJ8A 2BHYA 3DF8A 2WA0A 4ETSA 2R7SA 2ZSHB 4HBLA 3WTSC 3PM1A 2K9SA 1ZRCA 3ZQLA 1FBSA 2DK5A 5HLGA 1RUOA 5EG0B 2UZKA 2XDVA 3EUAA 1W7PB 1YO5C 3E5UA 1WWXA 2OD5A 3J7ZI 1W0TA 3K70D 4L9JA 2XC7A 3CC4I 3I55I 2ZC2A 2JA7J 4RGRA 4M3DA 1XSVA 1Y56A 3P5JA 2XPVA 5LRSA 4EV0A 1W0UA 4L0ZB 1FSHA 4D7MA 4BY7J 3TP3A 3MWMA 4HF1A 2CGPA 1ZLJA 3SZGA 2WAQA 1FSEA 1XDSA 4OIRF 1BBYA 1MIJA 4QIWN 4Q4ZF 2XKPA 3H92A 4RM3A 4RM2A 4DBRA 2HTSA 2EWNA 3GO5A 1WJBA 3ASNH 1VTNC 1R4MB 2QKMB 2VT2A 2IEKA 2J5PA 3GUDA 3FXOA 2JSCA 3ZMZA 1S3JA 1I39A 1OCZH 4PFPA 2DOEA 5D5VB 2E71A 1TWHJ 4IOAF 1IN6A 3E6DA 3NWSA 2DDAA 4KT5C 1HC8A 5EZHA 4F55A 1A36A 3M3YJ 2STWA 5JHUA 1Z7LA 5FKNA 2X6YA 3PNVA 4MO7A 1G2HA 2PMUA 1B72B 4BBSJ 4J00A 1BIAA 1XGSA 3WTZA 3C2BA 3BG6A 3GTLJ 3HOUJ 3IWFA 1HLVA 4BHPA 4MFDA 2BVLA 4ON0A 1N75A 1TP4A 2R5YB 3FX3A 1ZRFA 3PQJA 4PFOA 4MFEA 1WH5A 4PSWA 3OS0A 2E2JJ 3HDDA 2IS1A 3Q0VA 3O8HA 3F8MA 3KYCB 3LSGA 4LK0F 3HC7A 2K9NA 2CV2A 3HSRA 2XUBA 2HDCA 2HTJA 2D5VA 1GDTA 2WBMA 2IPQX 3M8JA 1VQ8I 2LKXA 1SMYF 3TMOA 3W2WA 4IL6C 2LSOA 1NK2P 3K7AJ 3K4JA 5IYCJ 1B4AA 3H3VK 1FBQA 5ILUA 1TWGJ 2WWYA 3RKXA 5IY5H 3BJAA 4ZZLA 1T8IA 4HNVA 3SYTA 4D0PA 4E7HA 3FK7A 2JQ7A 2EV5A 1FOYA 3ZMSA 3L2UA 5CQGA 2OF7A 1R9TJ 3LSPA 4HLXA 3RDIA 4MIMA 4HV6A 1BW5A 1AHDP 5FRNA 1W7PA 1ONVA 1B72A 3V7RA 2DOFA 2KT0A 4AYBN 4RAGA 3F8NA 4GFBA 2WTEA 3MKZA 3U21A 3O3KA 3K4BA 2C6YA 5EGOB 1ETQA 1XDUA 3FXLA 4UVAA 5ED4A 1QA6A 5K7FA 3U9GA 3ZPLA 3FM3A 2HNHA 4UXNA 1KQ8A 2R7DA 1CGPA 1S6LA 4E7JA 1AOYA 2FBHA 3E7LA 4G6QA 1V55H 3FXKA 4IQ4A 3QYFA 4QTRA 2KIMA 3I53A 3I5UA 4CSWA 1IW7F 1HKSA 4YEJA 2BXYA 3ROUA 5A2QZ 1M1EB 5J40A 4YFNF 4OMZA 1OCPA 4RGSA 1WJEA 1Z7UA 1SFKA 4FQGA 3DP7A 2XPUA 4XOPA 1Z21A 5CPRB 4OAZA 2XF5A 3DWLE 3KP4A 3HEFA 4LIVA 1U6GA 3FHZA 3Q5FA 5EYRA 2LRDA 4HQEA 1YIOA 2Z2SB 4ITVA 2VONA 1SMTA 1EA3A 2EFQA 1ZK8A 3OMYA 2R7WA 1Z3YA 2ZO4A 4I98B 3I3LA 4LD5A 5HOOA 2HXOA 3RYRA 2O6GE 2KKOA 5BPDA 3O2PE 2R5YA 2HDWA 4A3LJ 5FRMA 1OCTC 4Y13A 1F4KA 1XTAA 2CQKA 4LFUA 5B66C 1LNWA 2A5YB 4N0BA 1XX5A 3EDPA 4XLNF 2ZNYA 3I9V2 5H6RA 3OYJA 4XKBA 4KIFA 1SD7A 4YIRX 1W1WE 1XMXA 3GTPJ 2K3FA 1QPMA 3LSHA 2Z33A 3JRBA 1LVAA 1X1BA 4S05A 1BR2A 2G9WA 4XN0A 1RIOH 4M9ZA 2UV1A 3JTGA 2KIQA 3I56I 3LMMA 3GMEA 3W6KB 3SDBA 3JSOA 3HHGA 4YFXF 3M4OJ 5DCMB 4U0WA 3CMYA 2FA5A 1XB4A 4LJZF 3DEEA 1WQ2A 2JTVA 1QQIA 1I3QJ 2X48A 4PJMA 4ANJA 1O3QA 3I54A 3U1DA 1MZBA 2W1OA 3AG2H 3HSFA 5FFXA 1XCBA 1IXSB 2OTLI 3E3VA 4I2OA 2HGCA 1T56A 4OIOF 1Y8QB 5IT3A 1MMDA 1NK3P 3CUOA 1EF4A 3FM5A 3ULQB 3ZQCA 3S3MA 3JW4A 3E1SA 1VQKI 1SD5A 2F4IA 2MC4A 2FXAA 1P9QC 3QYBA 2VODA 4A3DJ 3M1CA 4KT6A 4R8HA 2QQAA 3CJTB 3KLNA 4HSTA 5GAEJ 1XSDA 2KRCA 3IC7A 4O5VA 1U9OA 4XRSG 4TV7A 5D8KB 3M1EA 1R58A 2VASA 3CCUI 1X19A 4P9UA 4WWCA 1NG6A 2XRNA 4GGGA 2RN7A 3FBNB 1K78A 3ZMUA 5H2FC 1HOMA 2BY2A 3AG4H 3NWTA 1JUSA 2P81A 3S1QJ 1SVMA 1MH3A 2E2HJ 4EGZA 1WKMA 2Z3YA 4YIIA 3ZQHA 1D3YA 2EFWA 1LEAA 3RIRA 2NS0A 3ZQGA 4I76A 4A0XA 2PMZA 1BR4A 3Q9SA 4MNUA 4A69C 3IV5A 2O5RA 2CSOA 4LIUA 1X1DA 3WGGA 4C2MJ 1R1UA 3ZQQA 3HZJA 4GYGA 4GDFA 2M3AA 2O03A 2UXXA 1OPCA 1G6NA 3MMYB 1G3YA 2EJRA 3FWEA 1IRFA 3OWTA 3OYGA 4CCLA 3SJMA 2JK3A 2I8DA 4HOBA 3A03A 5J4VA 1BR1A 2KP6A 2BZTA 4B3AA 2ZKZA 4M3FA 5C3EJ 2E1CA 4BNCA 2IS4A 1V5GA 3FKIJ 4I0AA 2WB1N 1ZTRA 3ASOH 3BC8A 3IL2A 1K79A 2IXSA 5CJ9A 3R0JA 3L2QA 1J2XA 1MMNA 2B9SA 1ZELA 1HKTA 3BG5A 2HOEA 1UMQA 5GP9A 1QZZA 2HFHA 3GFJA 1UZCA 2L54A 2K02A 2W85A 2Z99A 3ZOBA 2XAQA 3LQQA 3NEUA 5D5XB 3FHNA 3ABMH 3OIPA 1J59A 1FYMA 1BIBA 1P6RA 3FBIB 2H6CA 5DS9A 5IT9Z 1JKPC 4IEJA 2M30A 3C7JA 2EQRA 3K4MA 4PUSA 2V79A 1HW1A 4A6EA 2FX0A 3RQ4A 4WCGA 2HVSA 4EM2A 1ENHA 3CCJI 3F21A 5DD8A 4A3IJ 3WGIA 4LK1F 2YU9J 3GZ5A 4B4CA 3GXOA 5CVUA 4WX9A 1P2FA 1XPXA 1ZG3A 3H5AA 4G7OF 2NRAC 4XLFA 2CWEA 2CYYA 3Q0WA 4HX4A 1F36A 2ELJA 3HM5A 1LFBA 3C18A 2PEXA 2M9HA 2Y75A 4LITA 2NVTJ 1FP2A 5FD6A 3V8KA 5D8LB 3D0SA 2QQ8A 2P5LC 3RJPA 5FD5A 4EM1A 1S8NA 3MN2A 4A12A 5ILSA 2Q2EA 1J75A 2HPMA 5KK1A 1LB2A 1JKQC 1R7JA 1U3EM 2MH9A 3GTQJ 2FBIA 1FMWA 3GFIA 1FBUA 4RLQA 3F0CA 1USSA 1AA7A 3JRFA 2DLLA 3LSRA 2Y30A 3ECOA 3TW7A 2VB6A 2VKHA 2L9NA 3BY6A 3OOPA 2WV1A 3VSKA 3MFKA 1WSUA 2VJ5A 1SFOJ 2HYFA 4FCYA 2PFBA 5J1UA 4RB1A 2L2OA 4E7SA 3I58A 1UCRA 1YG2A 2DA2A 3H9GA 2DBBA 2ICWG 4P55A 2BW3A 3KLOA 5E20A 5FLXZ 2Y0SA 4NB5A 3CDHA 1JHHA 2R7RA 4U88A 5EF6A 4B09A 1BJZA 5HVQC 2QWWA 2A68F 3TGNA 4EGYA 1GV5A 4KA4A 3CDLA 5ILVA 4FTHA 2YX4A 5JHFA 1QPIA 1TNTA 1V5EA 2TDXA 3LAPA 4ENNA 2I10A 2CUEA 3DU5A 1SANA 4M9XA 1GHCA 4BE2A 2DMUA 1Z6TA 2DN0A 3E6MA 1T0FC 2CUJA 2DA4A 3HRUA 2M4GA 1C0WA 4A3GJ 3OYHA 4KN7X 2FD5A 1WZ2A 4FHTA 4I01A 4PJJA 3UKGA 1UAAA 4OIQF 3RZOJ 1FTZA 1IDZA 2FJ1A 1EV7A 4HA8A 1GVDA 3M07A 4JP0A 3CP2A 3KP7A 4OINF 1BM9A 2QVOA 3FISA 4CCNA 2ZSIB 2DI3A 1PP8F 5LHHA 1ETKA 2R3SA 2L7MP 4BUPA 4CICA 1ZN2A 3SHFA 3GEZA 3KE2A 5DCMA 3I59A 5A2QK 1FWZA 2PMZN 4RAZA 4IF4A 4B1RA 2GQQA 5GTHC 4OIPF 1E0EA 2O0YA 4IHTA 2JA2A 2X1EA 5D5WB 2XRLA 4UVCA 3LOCA 1YI2I 3JREA 2XF7A 2XIGA 4D7NA 4RB2C 3HOYJ 5E1XA 3WODF 3H9JA 3TO9A 5HS8A 1ZH5A 3HOZJ 3V7SA 2XAGA 3W3CA 1IN4A 4OOIA 2W00A 1LEBA 5GADJ 5HS9A 3I4MJ 1JKRC 5F0HA 2IGNA 3OYNA 4AIJA 3L9FA 2L9RA 2DA1A 2VPLA 3FK6A 3CJNA 2FBKA 4JBAA 2EH3A 4JK1X 2IRFG 2XAJA 3P9KA 2ZFUA 2ZBKA 2HQNA 4KN4X 1AU7A 3CMMA 4XN3A 1ZR4A 2G7HA 5CYVA 2QGUA 5LHIA 2M5WA 3MAJA 5LGTA 1SVLA 2JSPA 4I02A 1OCRH 2IP2A 4E4HA 2MBFA 1Y6IA 4E7KA 3QOEA 4CGZA 3DPLC 2R7TA 2AQFA 3WTVC 2VOPA 4KJZA 5JVTA 4LLGF 4JYKA 3RKWA 5FLVA 1KU3A 2M7BA 1X1CA 2MGQA 2R7VA 2BOLA 5IOYA 2JUGA 4CUGA 4BHBA 3FMSA 4CYDA 1YFHA 5FGMA 5JR3A 1YTYA 1PDNC 3EUHC 2CQQA 2XKOA 3PQKA 3S32A 5C44J 9ANTA 2DQLA 3NAUA 2P4WA 3S1NJ 1R4NB 4R79A 2NNYA 2BE5F 4RLFA 1PUFA 5HNFA 3QPLA 2BY3A 2MLGA 1G3SA 4A3JJ 2DJNA 3D5LA 4B3XA 3TKYA 2V9KA 4D5CA 1K78B 3VYRB 4W1UA 1W4MA 2RGVA 3ECHA 3OYMA 2NOJB 3A01B 3L09A 4CXFA 1U8RA 1MBHA 3CZ6A 2CQNA 3KETA 3ZQ7A 2M87A 2KRHA 1LDJA 4EATA 2H27A 2WADA 1U78A 1PYVA 2KL4A 3KZIC 3OYLA 2ZMEB 1HA8A 3BPXA 4BYYA 2A6TA 2X51A 2XAFA 2QBYA 2K9MA 4NHJA 1OKRA 4LG0A 4HX8A 5H20A 3GBGA 2LH9A 4M3BA 3MKYB 3TQNA 1MDMB 2DYRH 2ZXHA 1G4DA 3L2CA 5EEAA 1I6HJ 1V54H 4Y17A 3J81K 2CQXA 2M1BA 1USTA 1ZLKA 3F6OA 4L9NA 1B8IA 2RC4A 1Y0NA 2OPTA 3PUFA 2JN6A 4B48A 1RZ4A 3CCVI 1MJAA 3K6GA 2JA8J 3QAHA 2GIVA 2G7UA 5K1YA 2FEZA 4AIKA 4XRFA 2IA0A 4HG2A 4O6JA 1L3LA 4JOMA 5DEQA 3PJRA 3S3OA 2HQAA 2BV6A 2GBYA 4DGWB 3AAFA 2V9VA 1TQMA 4NBQA 4Y33A 4F92B 4HNTA 2YU3A 1T38A 2ZMEA 1MD0A 2OZ6A 1K83J 5CVVA 1DPRA 2Y0SN 3DV8A 4DNCA 3JCUC 2H6BA 1P7IA 1WPKA 5DYMA 1MKMA 4XORA 4X0GA 1ITYA 4ENKA 4HYEA 4HF2A 5E3OA 2L0KA 3T0YA 4A2UA 4ZYDA 5JI6A 2IGKA 2DT6A 2QLZA 4XR6A 5FJ8J 2D1VA 4PJ0C 3VDXA 2MABA 3WTUC 5FKLA 2COMA 3LA2A 3PFYA 1IN5A 3BTLA 3C2GA 4G8XA 4RAFA 1GXQA 2DFIA 4YFKF 3H5NA 4YIFA 1O3SA 2IS2A 3CUQA 1YW8A 1IGNA 3S2DJ 4KUMA 1OYWA 2GOMA 1S7OA 1MMAA 2QQBA 4L9TA 5HS7A 1RR7A 3H1CA 2VQHA 3GVAA 3ERMA 5L3CA 5DUIA 1SEUA 1WVRA 2STTA 1PJRA 1X2NA 2CQ7A 2A6EF 4HAMA 4MEXF 1XC5A 5AIQA 2ZXIA 5B5EC 2WAQN 4AD9A 4Y3OA 1B8IB 2E34A 1ZGWA 1IV8A 3G6EI 2F5FA 2VPRA 1ZGJA 3KP3A 1F43A 4BKXA 1TWCJ 5CVJA 4NNJA 1GUUA 4RGUA 3SXYA 2EB7A 4CYCA 1TW2A 4A0YA 2X0LA 3H36A 5E3MA 3CD6I 3I4NJ 2QYOA 1T0FA 1T39A 2L01A 1EH7A 1RKTA 2MC3A 2B7EA 3CCYA 2LY1A 1VI0A 2IA2A 2OCEA 2HR3A 4G94A 4EM0B 3AG1H 4XLCA 3U1KA 4XSZF 4I0BA 3CCEI 2FNPA 5KHDA 4IKFA 3M9AA 3H35A 4XLHA 2Z1DA 5L3EA 3CUQB 1R5HA 5B3SH 2YSRA 5KNLA 2IS6A 1HF0A 3ABTA 3LWFA 1XN7A 1TZLA 1X2MA 1K6YA 2A5WA 2X4HA 3GFLA 4UY8I 3OYBA 4BACA 5E1WA 1DDNA 2BVMA 2JT1A 3IWZA 2HEOA 3BR6A 3LA7A 4YRVA 3A02A 1IN8A 3NARA 1TT0A 3WTTC 3CCRI 4FE4A 2EFNA 3IH2A 4B47A 3CDIA 5K5OA 5DD4A 2F48A 3OYKA 2L3DA 2L7ZA 1YQAA 2L7KA 3HRTA 4XICA 1YOVB 1DGRM 3BCAA 4HDUA 2VKVA 5CKTA 2L5QA 3GYHX 1IUYA 4HQMA 1B6AA 1KU7A 4FX0A 1FIAA 2P7VB 3R0AA 2RNJA 3NQOA 3HOWJ 2WY8Q 3S2HJ 3HPGA 3IHUA 3KEYA 3TO7A 1R5GA 3U2RA 3J81Z 2O7OA 4NUBA 1FOKA 2AHQA 1KZHA 2KJCA 3JRHA 4XNFA 1XMAA 4ZC3A 1VNDA 4D9JA 2LF8A 1POGA 3KYDB 2P5KA 3KP6A 3GF2A 2MLKA 3Q0UA 3BTJA 3WHCA 2BXZA 4UVBA 1RESA 3DBHB 4PJLA 2F5EA 5DV5A 2W7NA 3QODA 3L7WA 3D1NI 4IHYA 1U0JA 1JGGA 3WE2A 2F2EA 3R61A 3HG9A 2JPBA 2W24A 3KFWX 3BG9A 1A6IA 1R1VA 4JX5A 2W84A 2VXDA 1ETWA 3HB9A 4II3A 3PUBA 1BC8C 4AVZA 1A5JA 5GPCA 4AC0A 1TTYA 3A1YA 1YRNA 3N4MA 2KHMA 1YX5A 2ME0A 3BG7A 4GYIA 2FOKA 3BOQA 1REPC 3F8CA 3HOSA 1GV2A 3B02A 4QPOA 3CCSI 2DAOA 1FZPB 1U2WA 1LPQA 4CO8A 1FIPA 1I27A 2OA4A 3GCMA 3M8EA 3GTJJ 4UUVA 4LG0B 1YW7A 5AONA 2IBDA 3OSGA 5GPAA 3S17J 4GXOA 1N78A 2HYGD 2L02A 1ODDA 1WH7A 3ZMTA 3B6CA 2DA6A 4BQAA 4DYRA 2R0QC 3PL8A 4LLNA 5IYDJ 4IRIA 2DU9A 4K2EA 5D6FA 4RAYA 4DIQA 1SFXA 1S7EA 2TCTA 2RVCA 5J8CA 1WHUA 1SFUA 2K86A 2CUZA 1H9TA 2D2WA 2QKLB 1WRJA 4XONA 2KQRA 1UELB 5E79C 3CO6C 3LFUA 2BEOA 2X1CA 4ESBA 2VQCA 3VODA 4QSHA 1KYWA 5IP7J 3ZXSA 1O3RA 4IRHA 4PSXA 3R60A 3TW6A 2JZYA 2V1UA 3IH3A 1P92A 1VZ0A 5J1YA 5IPAA 2ZJ2A 1R1TA 3BZCA 3MKWB 1Y1VJ 3F3XA 5B1BH 1MBJA 4FX4A 2ZMEC 3EPZA 1FYLA 3G3ZA 2QBYB 2K4JA 2DDBA 3BLYA 1ZHFA 2KISA 2DYSH 1VQ5I 4IHXA 2RREA 4B43A 5M5WJ 1UHWA 2EIJH 4CA0A 1J0RA 2YUSA 4XRMA 1QBJA 4BJ6C 2QF7A 4U87A 4BU2A 1X3ZB 2NVUB 3SEQA 3VEPA 2DODA 2R7FA 3AL0C 2ACJA 3VSLA 2R7QA 3HGYA 5IYBJ 2VXZA 3HUGB 4WXCA 3H3UA 4Q48A 2VBWA 4M73A 3E97A 4MTEA 2QCOA 4R1HA 2W4SA 1Z77A 2ECCA 1P4AA 2ZJPF 3CCLI 1K6OA 1AWCA 3HTUA 2XSDC 3DPUA 2AXLA 2ESHA 1W5TA 2BHZA 4HRIA 2F6CA 5LEJA 1RC9A 1DP7P 5LHGA 3OR1C 2MG4A 1QNTA 2VJJA 1WFXA 4NQWA 4OMYA 2A61A 3BQZA 3CCMI 1SAXA 3J7AY 5D5UB 5HLHA 2HI3A 4ENMA 1G3WA 2NXNB 1QRYA 4HV5A 1H89C 3OL3A 5DUKA 3TOBA 1F1ZA 4XKWA 5IP9J 1OJLA 2ECBA 4AYBA 4C3HJ 3H0DA 4A93J 3E5XA 4CYCB 3J7AO 1SD4A 1IF1A 1BI1A 4DBQA 4KISA 1UHSA 3FIWA 3ZN1A 4OWRB 1JJ8C 4V19K 3DFGA 1VQOI 4JX4A 4IZZA 2JRMA 2PX9A 1W5CC 2D45A 2V1DA 5FB2A 4MLOA 1ZREA 2K7LA 2E1OA 1T6SA 3WTXC 2PN6A 4CHUA 2BY0A 1MBEA 4LB6B 1FOWA 1KU2A 5D4SA 4IQJA 3CLQA 4XOTA 1E17A 5DDGA 1FT9A 3DCFA 1XG1A 3TDUC 1BJAA 2M2EA 1WJFA 3CCQI 2EIMH 4GRIA 5HDGA 1STZA 3PSIA 3GFMA 3LSTA 4ZDOA 1K4SA 4BDZA 1PP7U 2X85A 5M3MJ 5JLWA 2CFOA 3JRDA 3BTCA 5FO5A 4IX7A 2R93J 3JR9A 1B9NA 3TP0A 1UG0A 4O3MA 2FMLA 1HDPA 4ZYEA 3L2WA 3MZHA 4BXXJ 3ELKA 1S7AA 1X4PA 5J3LA 3OIQA 1LDDA 4UB8C 4BY1J 1IRZA 3DTKA 3GW2A 1YS7A 2ETHA 3LAJA 1ERDA 2E1NA 4Z2YA 1UG2A 1RI7A 1KYZA 2XAUA 4A6DA 4B44A 2N8GA 2K9QA 4HX7A 3JRGA 3A4CA 4UHTA 2EK5A 1KONA 3J80Z 3OYFA 3HPHA 3DXJF 5GTIC 3S14J 2VE9A 2OU2A 1FYKA 2YS9A 2LK2A 4BS9A 3G73A 1BOAA 2CW0F 3BR2A 1XCVA 4P5OA 1MJ9A 3S2WA 3MZ8A 3TBIA 3WU0A 4BL0B 2P6TA 5J4YA 2P0WA 2EPFA 3I64A 5L3DA 3ZCOA 4Y4RA 3T1BA 1Y0UA 2FMYA 3HIFA 2BBYA 3P9IA 5FKKA 1OFCX 2YX7A 4WXDA 3WU2C 2DW4A 4BJTA 3CC2I 1TQPA 1VQ6I 3SFZA 2LTPA 1QGPA 3F8FA 2DFEA 1D1CA 1TWAJ 3KCCA 3CLOA 1VQNI 4EJWA 4HNUA 4XK4A 2R7XA 2RAEA 3DQVC 3LL7A 1P4WA 1YITI 4H0EA 2JA5J 1DU6A 3Q9VA 2V4JC 2GXBA 2G0EA 2HS5A 4HPQA 5LEKA 3DTIA 1DP3A 4PCQA 1WGXA 3GLLA 3QPHA 2VBXA 3HSEA 1U5TC 1HBXG 4YELA 3E0JB 4M74A 1O7LA 3CJQB 3H9QA 2ELHA 1FMVA 3M7GA 3WG9A 2VJ4A 2L4AA 3FXUA 3OS1A 2K40A 1YHQI 3QU3A 4XKCA 2XGCA 1F5TA 1XD7A 2MFZA 4DYQA 5LGNA 2COBA 3ABLH 4L18B 3A2KA 5L3GA 4DW6A 4U0YA 3DLAA 1HSTA 1TT5B 1W7PD 4ZDPA 3F9KA 4Y7NJ 1XMKA 2E1MB 3NRVA 3FMQA 4EJOA 3L2VA 2R5ZA 4NQWB 2CS3A 3T8RA 4G7HF 5KCMA 2R7ZJ 2DOAA 3GX4X 1ETXA 4BH9A 1R00A 4NC8A 3N05A 4FE7A 3BR0A 4NDLA 2R92J 4D5FA 3CJRB 1UHMA 1A6QA 3EETA 1VQ9I 1WI3A 4IVNA 3OSFA 2JWTA 5HLTA 4CCJA 1OCCH 3EYYA 5E8IA 1R23A 2ME6A 2ZFWA 4N4OB 1SD6A 3L1PA 1G3TA 2DT7B 1N25A 3E6BA 2RV8A 3TEDA 4CCOA 4XLEA 1NH3A 3BTIA 5CVIA 1RUNA 3VYUB 2XPWA 2IGMA 2OJED 1W36C 4C2UA 5LD2C 3D5RC 4HF0A 3OR2C 2XGXA 2OQGA 2WB1A 4RMNA 1LUJB 2FQ4A 5DM7F 1AKHB 1YJNI 3GLXA 1XSXA 2YPRA 4IHSA 2FQ3A 2LDUA 5FLXK 4DJAA 3FMRA 1MMSA 2ELKA 3CC7I 1IAWA 4FT8A 1IV6A 1RPWA 2E19A 3D5SC 4HEA2 5FKMA 5HDNA 3RYPA 1FJLA 1GXPA 4KNYA 1T33A 3KP5A 3S16J 2LNBA 2ZCWA 4LMYA 2DO7A 3BR3A 3L2RA 2RQQA 2VIXA 2KPMA 3RPQA 4KDPA 2CW8A 2ISZA 1OCOH 3FXMA 3REOA 4F93B 1OISA 3TO6A 4M71A 2DTRA 5KAIC 5B1AH 3BDDA 2BY1A 2VQGA 1Z9CA 4BQQA 2HVQA 1SVOA 4EEFG 2VJIA 2VL8A 2XHKA 3FZVA 3V8LA 3A01A 2XAHA 2KJBA 2PJRB 2Q0OA 3O6BB 5KAFC 2EZKA 3JSPA 1S72I 2H8WA 1RR8C 2EA4A 3RPUD 3W2AA 1HKQA 1MMGA 2IA1A 3KZZA 2LOOA 1YYVA 1LKXA 2VT3A 3ZQFA 2E5NA 1KQ0A 3A0BC 5LFAA 4L0YB 1G8XA 4C3JJ 4Z6YA 5GAGJ 1JI8A 2EA2A 3DKXA 1NTCA 2NYXA 2QSGX 1OR7A 3MKLA 3ERED 4ZTFA 5C4XJ 3UR3C 2XVCA 2OC6A 1PUFB 1HCRA 5FKOA 1NG7A 1JTXA 2E36A 4A3KJ 4A3MJ 1MNDA 2ADUA 2Y9YA 3G4SI 2MA3A 2P7CB 2DMTA 1PUEE 2AS5F 3BR1A 3ZP5A 2PJPA 1WJ5A 1BW6A 4M6YA 4C30A 1OLTA 1FOXA 1APLC 4WXHA 5E17F 1IN7A 1WCMJ 4ZYHA 1MNEA 2DT5A 3F23A 4J19A 1TLHB 3ML6A 1QVTA 2GXGA 3DBLB 4UUSA 1RRJA 2KDZA 3KPHA 3G1LA 3L00A 1ETOA 2ID3A 2VKDA 4BQNA 3AFHA 4X1EA 1TWFJ 2H09A 1MBFA 3GZNB 2HPIA 3VYTB 2JPCA 2LR8A 4S0HB 2DA3A 3E6CC 1GT0C 4E7ZA 5HNHA 2GOXB 2XV4S 3P9CA 5E18F 2OV7A 2HWVA 4UNOA 2LBFB 1ZYRF 3JRCA 1Y1WJ 2XF6A 2PBIA 3BCBA 2LBFA 1N77A 2F5CA 1MSFC 3LSIA 4CCMA 2K9LA 3QPTA 1O3TA 3MZYA 3R6SA 1MW7A 2LD5A 2ESNA 2LKSA 4QLCU 2QQ9A 1Z1DA 2PQ8A 2GM4A 3ABKH 3LQRA 4CCKA 4X6AJ 2ZJQF 2QA4I 1E3OC 1D0ZA 4H4KC 4UV9A 1W5SA 2VN2A 2Q2EB 4IRGA 3OOUA 2DMQA 4BEHA 3KP2A 4ZYAA 3OS2A 2CMPA 3FXQA 2L9VA 2X6OA 3K2ZA 2FF4A 3IAS2 1TBXA 3HOTA 4BE1A 4AWXB 3S1RJ 1WJCA 4PJNA 1KA8A 1XS9A 5FFZA 4QPQA 2DPDA 4RBOA 1V3FA 3DKYA 2IT0A 2CU7A 2IAIA 1JE8A 3IP4B 2XASA 3G1OA 1UB9A 1ON1A 1Z67A 2CFXA 5IP6A 4KMFA 4D1QA 1VFCA 4ZDLA 1SAUA 2AQEA 2EBIA 2XB5A 3FKJA 4RGXA 3CMAI 3KEQA 3HYIA 1OYIA 3CMEI 5F6FA 2GWRA 1MJBA 2DFHA 4EJVA 1VQ7I 5EJCA 4EJUA 4F52A 4J01A 5LBQA 2O9LA 3ZGKA 2LREA 2Q8KA 1FP1D 2DK8A 2H1KA 3MCZA 2HU9A 2PI0A 2QSFX 3TDZC 3HL2A 1CQTA 2O8XA 4C9YA 4A3FJ 2NS7A 3DEUA 1FNNA 2HZTA 2PLYA 1R49A 3I71A 3W6JB 3HOVJ 1Z3XA 3K1NA 3QU6A 4L5IA 5K7HA 1FEXA 4UUTA 1X58A 4BXUA 5FROA 1W36D 3CTAA 3T5XA 4EVIA 4IO9F 5LLQA 2WAEA 2KIUA 3VFZA 5F64A 1VQMI 1I5ZA 2V6EA 3RCOA 5M3FJ 2A05A 4XSXF 5HODA 3OYDA 2Y31A 1V5FA 1FLIA 1HW2A 5HDKA 3O8GA 4LOCA 3DPTA 5E1ZB 4FISA 2E7WA 5F0CA 5EEHA 5LGUA 2DMNA 1AKHA 1U9NA 4P9FA 5CVRA 3UNGC 1YW9A 1R5ID 2M0MA 2E1MC 4RB3C 1BI0A 2NVQJ 4U0VA 1Q1HA 4LLLA 3K4KA 6PAXA 1S29A 3QRFF 3PO3J 3RQIA 4YG2F 2GAUA 1H88C 1F9NA 4DOZA 1XGNA 1I1GA 2E60A 3Q3SA 3W2VA 2B0LA 4PGGA 4EJTA 3IRQA 3LFKA 3SEZA 1YRNB 3G1MA 2K85A 3BPVA 4E7IA 2GA2A 1K7AA 1DUXC 3T8TA 3QP5A 4PDKA 4JX6A 2LLKA 3PSFA 3SFIA 4AM3A 2EFOA 5D6EA 1PVEA 1ZKGA 5F27A 3SDGA 3V8JA 2ZB9A 3F6VA 1HSJA 1ZQ3P 3BR5A 4XMYA 4BXFA 3S15J 2L7FP 5IT9K 1MDMA 5DCFA 4A3EJ 3QPSA 4HW0A 3PIPF 2BYVE 3R4KA 3S93A 1IG7A 4ABZA 4CDGA 5M5XJ 3TL4X 1JHFA 1YS6A 3IUOA 3TOAA 1A31A 2F5VA 1IC8A 2PJRA 4G6DA 3AL0B 4MHGA 2QM3A 3HKZN 1BA5A 2CV1A 1P7JA 2GXAA 3ZN0A 1FY7A 4RA2A 3RKYA 3GTKJ 4PGHA 2XGDA 5BPIA 5ICGA 4DZJA 1RETA 3EUKL 3BT9A 2KDOA 2X6WA 2QENA 1OR7C 4A0ZA 3RKQA 1HXDA 5M5YJ 4LG3A 2Y2ZA 1ZG5A 1BC7C 2E35A 2HOSA 2V9PA 1TC3C 3SZPA 2AO9A 4N9HA 3ZR8X 3PNYA 1KQ9A 1IZ1A 4EMSA 2A3SA 5J47A 3COAC 5TGTA 5TJJA 1QHGA 4IOCF 4ENJA 4FETA 3JAMK 3AKZA 2QSHX 4BAYA 4G12A 1QO0D 1DU0A 3I4PA 2WAFA 4P96A 3S3NA 4LB5A 2OBPA 3EQLF 5CLSA 2HQ5A 2BGCA 4M3GA 3WU1B 2CO5A 3OL4A 3OYIA 3PFIA 5E3LA 1KU9A 1X1AA 2EZLA 2K3PA 1D0YA 1QHHD 3K4CA 1ETYA 4F91B 2J5OA 5BS6A 2DXIA 1YLFA 5K7ZA 1I50J 2MSYA 1MH4A 4GCVA 2KZGA 4E7LA 2EILH 3CESA 3WHBA 2LY2A 2VUMJ 4BBRJ 2E7XA 1Z91A 1QU3A 3J7YJ 3VWBA 1UFMA 3F72A 3SQNA 4ZH4F 2FRHA 1X3UA 1ZAOA 4RS8A 1MBGA 2MD0A 2Y48A 2EV6A 3CP8A 4LGWA 3M8FA 3HTSB 1D1BA 3BROA 3QYEA 3VPRA 3C1DA 3WTYC 1RKWA 2VI6A 3BP8A 2M4KA 4A5NA 1LDKB 4DZPA 1ORKA 2VQLA 4W97A 1ZGAA 1BI2A 1O4XA 2GIZA 2V1NA 4E6KG 3ZRGA 1MNMC 5JVGF 3BJOA 3JTHA 2HVRA 2X9DA 4QWQA 1O57A 3S1MJ 2IW5A 4WF2A 1H8AC 3C3WA 1E2XA 4BGDA 2M34A 3BZ6A 2FE3A 1JUPA 1OMIA 1V4RA 2DA7A 4XM3A 4U7DA 4BJ5C 4UV8A 3JRAA 4A5MA 2JVGA 3VB2A 1P4XA 4WK8F 3HKZA 1U5TB 3VYSB 1CF7A 1H9GA 1FX7A 1D5VA 2OUMA 4ESFA 1A35A 3HUGA 2VE8A 4F7ZA 2EFPA 4G7ZF 3PNTA 1SC7A 1DPUA 4BE0A 4AU7A 1JGSA 3ABUA 1WJDA 3CF2A 2GLOA 3DLLF 2M7AA 1O7FA 5EDNA 3KIOA 3LSMA 2FU4A 2WC2A 4XL9A 3CO7C 2EZHA 2KLOA 1K61A 2HOTA 4FASD 3BQYA 2P8TA 3H5RA 3ZMDA 1DGWY 1A04A 1ZR2A 3C2HA 3BG3A 3OYEA 1YX3A 1XGOA 3GTMJ 2Z5UA 1ACIA 4MQ9F 5ICEA 1D1AA 2F5DA 4OAYA 2X6XA 1ZG1A 1LFUP 1BL0A 4XLAA 5KVRA 4EQQA 4I6ZA 2K27A 1HW5A 2M45A 5J6XA 2W57A 2OCCH 4HZFA 2LY9A 4M72A 3B6AA 2CV0A 2XB0X 2W48A 3OIOA 2UXNA 2NVXJ 2JMWA 3W6VA 4IHWA 5F0FA 4RB0A 4C3IJ 3WE3A 2VOOA 2KIFA 2TRTA 3CQZJ 5L3FA 2JJ7A 3IKTA 3MEXA 1SFEA 2LFBA 3QP6A 2A6HF 1CF7B 2H1LA 2RNGA 3H0GJ 1B59A 5J1RA 2KRFA 1FC3A 4JQFA 3FXRA 2O8KA 4HDVA 3HOXJ 3QQAA 4G6TB 2FUG2 3K2AA 2PMHA 2ZJRF 1VQPI 3DU6A 1MSEC 5ICCA 2GA1A 3FXJA 5JFRA 2LG4A 2OZUA 1TL8A 4A3BJ 1T2KA 3RSNA 1TQIA 4G9YA 4L5JA 2W25A 4L9VA 1D0XA 2R5ZB 1OYYA 2UUZA 3EUHA 3ESWB 5EEGA 2EZIA 1H0MA 2DCEA 5EG0A 1VF9A 4II2A 2Y0MA 2XROA 1I3AA 5BOXA 1X4OA 2KZVA 2P6SA 2DA5A 3FDYA 2CG4A 4XRSA 3G71I 2M8EA 1R36A 2HQRA 1B1BA 3BWGA 2LF7A 3K1PA 4HSRA 3GZ6A 3K0LA 4I7HA 2MD5A 4PZJA 3K1MA 1VQ4I 1JTYA 2FSWA 4P1WA 5J8FA 3MD2A 2ZNZA 3K70C 1ETVA 2R4GA 2V26A 2V6CA 1X1PA 2EIKH 5GAHJ 3AG3H 1U8BA 1IO2A 2IJLA 3BZKA 1R71A 2LYCA 2HDDA 2EINH 2ISYA 2QUFA 4UUSB 1RNLA 2VLAA 4KYWA 5DTDA 2KFDA 2M8GX 3H3ZA 3PO2J 1S9HA 2BW3B 5BQTA 3V4GA 3OYCA 3IRRA 2FOWA 3QOPA 4KIGA 2CUFA 1B9MA 2AXTC 2MYSA 3DBRB 2I5UA 4ZZDA 4Q47A 5F1JA 1BN5A 3LSJA 2PG4A 2CW7A 2Z16A 4N4NB 2LP0A 2O3FA 1GLNA 2DQRA 2HKXA 3K69A 4U7BA 4IPAA 2VKEA 2VC0A 3KX2A 1XGMA 3CF5F 3K9TA 4S04A 1J09A 1JT6A 4Y15A 2DTZA 1BI3A 2H94A 1QVUA 3OV8A 2ZXWH 4ZTJA 1E3PA 5IOZA 3A0HC 2Z9OA 1T98A 2DPUA 2NAZA 3DKWA 4KIBA 1EH8A 5ICFA 1JKOC 2MW8A 3SZTA 4DQ2A 2JA6J 2VBYA 4MEYF 2F4MB 1EKEA 4N9IA 1D8JA 2V7FA 2QZ8A 1GVJA 3N97A 3BJ6A 1Z6RA 1DQUA 2HKOA 1J9IA 1WI9A 2FNAA 4F3QA 5F1RA 1JJ6C 3RZDJ 2QEXI 3IKVA 4Q5SF 2HXIA 3KZYA 2K4BA 5BMZA 2HZDA 3GWZA 4I99C 4ZJZA 2K5CA 1Z0XA 2RQPA 1TW3A 2DMPA 2NS8A 1R6RA 1IRGA 3HRSA 5EZGA 3ONQA 1LFPA 2M0CA 5TISC 5F08A 3WGHA 3ZQIA 3GTOJ 2JRTA 2KMUA 3B73A 4UB6C 2JUCA 4MQVA 3K4LA 2W82A 3HJEA 5K5QA 2P5VA 1X3WB 1JUMA 1Q1VA 1IJWC 4PK4A 1LJ9A 5L3BA 1QZYA 2YR2A 4BEHB 1YE9A 3G2BA 3KEOA 1JXSA 2VC1A 4KICA 1L0OC 5LRRA 2OTJI 3WG7H 4RDUA 3CUQC 5ERIA 1J5YA 4KITB 1R22A 1WJAA 1YIJI 2NVYJ 2A07F 2LKPA 3DEWA 2F4OB 4AIDA 3I0TA 4M6XA 1IXCA 3IH4A 4HLYA 1QZEA 2OAZA 4DYCA 4A3CJ 2Q1ZB 3WTWC 3VOEA 4C2TA 4GO1A 2LVSA 2DFFA 4CZZA 4Y52J 1IUFA 1IXRC 3HGGA 1LE8B 1ZRDA 1ZARA 2OQRA 1J7KA 4ASNA 3LNQA 2RKHA 4OU0A 5C4JJ 4CZCA 5E3NA 2RDPA 3RPUA 3EYIA 2L9SA 4CH7A 4BDYA 3MVPA 2LMDA
chains in the Genus database with same CATH topology
4LITA 1G59A 3ZGKA 2LREA 3V42A 3IAM2 4PSXA 2HU9A 3HL2A 1VZ0A 4C9YA 2HPMA 3MKWB 2IGOA 3S8PA 3EPZA 1Z3XA 2X1DA 3BLYA 1FMWA 4XQFA 4RLQA 5FROA 1W36D 1AA7A 2WAEA 3K4NA 2VB6A 2RREA 3RCOA 2V6EA 2VKHA 2L9NA 4B43A 3VSKA 2R7UA 2VJ5A 3K10A 3OYDA 4CA0A 1V5FA 4BJ6C 4U87A 4BU2A 3SEQA 2L2OA 4E7SA 3AL0C 3DPTA 3VSLA 2R7QA 3HUGB 2VXZA 3H9GA 5CQEA 2BW3A 2Y0SA 3UNGC 2M0MA 4NC7A 2W4SA 2E1MC 2R7RA 5HVQC 3DPUA 3K4KA 2WY7Q 4HRIA 2F6CA 5JHFA 1LVKA 1V5EA 2UWMA 3OR1C 4DOZA 1WFXA 2VJJA 2E60A 3W2VA 3DU5A 3J7AY 1T95A 4BE2A 2R7OA 2CH0A 3OL3A 3SEZA 4XKWA 1T0FC 2CUJA 2M4GA 4AYBA 4E7IA 4BQOA 3OYHA 3H0DA 2E5ZA 4XKVA 3LSKA 4PJJA 1UAAA 3PSFA 2DJIA 3DTEA 4DBQA 4KISA 2LC2A 3CP2A 4OWRB 4XMYA 4BXFA 4CCNA 2ZSIB 1IRXA 3KYLA 4IZZA 3S93A 4BUPA 2JVHA 3RTRA 4MLOA 3TL4X 3IUOA 3OYAA 2PJRA 2F5VA 3AL0B 2XSJC 1BOBA 3HXLA 3OY9A 2CV1A 1E0EA 2JA2A 2X1EA 4IQJA 2XF7A 4XOTA 2WA0A 2R7SA 2ZSHB 3H9JA 3EUKL 3W3CA 2KDOA 2X6WA 1OR7C 2W00A 4LG3A 3EUAA 2XDVA 1WJFA 4GRIA 3ZR8X 3K70D 2XC7A 3PNYA 3PSIA 4ZDOA 4BDZA 2IGNA 3OYNA 5TGTA 1Y56A 1QHGA 2VPLA 2X85A 4FETA 3AKZA 3SZGA 2CFOA 2WAQA 2ZFUA 4IX7A 2WAFA 1UG0A 3S3NA 3L2WA 4RM3A 4RM2A 4DBRA 3OL4A 3OYIA 1X4PA 1WJBA 3CMMA 4XN3A 2QKMB 3OIQA 1X1AA 2K3PA 1D0YA 3DTKA 1ERDA 1QHHD 4PFPA 3K4CA 4F91B 2DXIA 2JSPA 2XAUA 3NWSA 4B44A 4E4HA 1Y6IA 3A4CA 3QOEA 4F55A 4E7KA 3DPLC 2R7TA 2AQFA 1KONA 1Z7LA 2X6YA 3PNVA 3HPHA 4KJZA 3OYFA 4E7LA 3CESA 2M7BA 2LY2A 1X1CA 4J00A 2R7VA 2BOLA 1QU3A 2JUGA 4CUGA 3VWBA 3BG6A 3EUHC 3S32A 2BVLA 2MD0A 1N75A 4BS9A 3CP8A 4R79A 4PFOA 1D1BA 3QYEA 4PSWA 3OS0A 2IS1A 4P5OA 4RLFA 2M4KA 3TBIA 1LDKB 5HNFA 2VQLA 4BL0B 2P0WA 3LSGA 3HC7A 3D5LA 3ZCOA 4B3XA 4Y4RA 4E6KG 2V1NA 3ZRGA 2V9KA 2CV2A 3VYRB 4BJTA 2WBMA 2HVRA 3M8JA 3OYMA 2NOJB 3TMOA 3W2WA 3CZ6A 3K4JA 4BGDA 1D1CA 2KRHA 4XM3A 4EATA 4HNUA 2WADA 2R7XA 4BJ5C 1PYVA 2KL4A 3DQVC 3LL7A 3OYLA 1HA8A 2A6TA 2X51A 2JVGA 2K9MA 3SYTA 3HKZA 2V4JC 3VYSB 3GBGA 2LH9A 4HPQA 2OUMA 4E7HA 3DTIA 3MKYB 1DP3A 2ZXHA 4YELA 3E0JB 3CJQB 3H9QA 1FMVA 3L2UA 5CQGA 2VJ4A 3PNTA 3OS1A 4XKCA 4BE0A 4AU7A 2MFZA 1WJDA 3CF2A 5FRNA 2M7AA 3A2KA 4B48A 3LSMA 3DLAA 4XL9A 4ZDPA 3F9KA 2KLOA 3K6GA 3MKZA 2E1MB 3U21A 4FASD 3K4BA 3L2VA 4NQWB 2CS3A 5KCMA 2DOAA 4HG2A 4NC8A 3H5RA 3N05A 1DGWY 4JOMA 3PJRA 3C2HA 2HNHA 3S3OA 2HQAA 3CJRB 3OYEA 4DGWB 4E7JA 1YX3A 4IQ4A 3QYFA 4Y33A 4F92B 4CCJA 4HNTA 5HLTA 1D1AA 4CSWA 4OAYA 4YEJA 2X6XA 4N4OB 4XLAA 2DT7B 1WJEA 4XORA 4X0GA 1SFKA 4CCOA 4XOPA 1Z21A 4XLEA 2IGKA 2CV0A 5CPRB 4OAZA 2DT6A 4XR6A 2XF5A 3DWLE 3VYUB 4LIVA 2MABA 3VDXA 3PFYA 2IGMA 3C2GA 2LRDA 2Z2SB 1W36C 4C2UA 3H5NA 4ITVA 5LD2C 3D5RC 2IS2A 1EA3A 3OMYA 3OR2C 2R7WA 2WB1A 2RNGA 4RMNA 2GOMA 1MMAA 1Z3YA 4JQFA 2VQHA 3I3LA 5HOOA 1PJRA 4G6TB 4DJAA 2FUG2 2ZXIA 3DU6A 2HDWA 5FRMA 2LG4A 3D5SC 4Y3OA 4HEA2 3RSNA 1D0XA 2UUZA 3L2RA 2RQQA 2DCEA 2VIXA 2KPMA 4II2A 3I9V2 4NNJA 4XKBA 3OYJA 2CW8A 1X4OA 2KZVA 3FDYA 4F93B 3LSHA 1X1BA 4HSRA 1BR2A 4XN0A 2UV1A 2VQGA 2LY1A 4BQQA 3LMMA 2HVQA 3SDBA 4XLCA 2VJIA 2VL8A 4P1WA 3MD2A 2PJRB 3K70C 5KHDA 2R4GA 2V26A 4IKFA 3H35A 4XLHA 2Z1DA 3DEEA 3RPUD 3W2AA 1MMGA 4ANJA 4PJMA 2LYCA 5KNLA 2IS6A 2LOOA 1LKXA 2E5NA 2W1OA 2VLAA 5LFAA 1TZLA 2A5WA 1K6YA 1G8XA 3OYBA 4BACA 2BVMA 1JI8A 1S9HA 3DKXA 2BW3B 4YRVA 3OYCA 1MMDA 1TT0A 2MYSA 4ZTFA 3S3MA 3UR3C 3E1SA 2F4IA 2MC4A 2OC6A 1P9QC 3QYBA 2CW7A 3M1CA 4B47A 2Z16A 4KT6A 4N4NB 1NG7A 4HSTA 1GLNA 2KRCA 1MNDA 4U7BA 3OYKA 2VASA 3KX2A 1WJ5A 1X19A 2L7KA 4C30A 1J09A 1OLTA 1DGRM 1NG6A 3BCAA 3FBNB 4ZTJA 5CKTA 2L5QA 3NWTA 1MNEA 2WY8Q 3HPGA 3KEYA 4NUBA 2V7FA 4XNFA 4ZC3A 1DQUA 4D9JA 2PMZA 1BR4A 2VKDA 4BQNA 2O5RA 3AFHA 4F3QA 4LIUA 1X1DA 2HPIA 3VYTB 2HZDA 3ZQQA 4PJLA 2M3AA 2W7NA 3QODA 3MMYB 4ZJZA 4E7ZA 5HNHA 2GOXB 3OWTA 1U0JA 3OYGA 2K5CA 4CCLA 2OV7A 2I8DA 3HG9A 2LBFB 1BR1A 2KP6A 2XF6A 1R6RA 3BCBA 2LBFA 1N77A 2VXDA 4II3A 3PUBA 3LSIA 1V5GA 4AVZA 4CCMA 2K9LA 2IS4A 3BC8A 3A1YA 1LFPA 3ONQA 2IXSA 1MW7A 2KMUA 2KHMA 3L2QA 1MMNA 1YX5A 1ZELA 3K4LA 2W82A 3BG7A 4CCKA 3HOSA 4QPOA 1D0ZA 4H4KC 4PK4A 2Q2EB 4BEHB 3OOUA 1YE9A 3G2BA 4BEHA 4ZYAA 3OS2A 2CMPA 3FHNA 3OIPA 3FBIB 3IAS2 1WJAA 4KITB 3HOTA 4BE1A 1N78A 1WJCA 4PJNA 3K4MA 4PUSA 4QPQA 3PL8A 3DKYA 3RQ4A 2Q1ZB 3IP4B 2HVSA 4DIQA 4C2TA 4D1QA 4ZDLA 1SAUA 2AQEA 3FKJA 2CUZA 2QKLB 3H5AA 4XONA 4CZCA 4XLFA 2KQRA 1UELB 2L9SA 4CH7A 3LFUA 2X1CA 2VQCA 4BDYA 2ELJA 4F52A 4J01A 3ZXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LH9 A;  2LY1 A;  2KPM A;  2LY2 A;  3RCO A;  3S93 A;  2KZV A; 
#chains in the Genus database with same CATH topology
 1G59 A;  1JT0 A;  5E8G A;  4I09 A;  3V42 A;  3IAM 2;  4XLP F;  1HDD C;  3F22 A;  1K4T A;  1ON2 A;  1FPQ A;  2L4M A;  1HQC A;  1LQ1 A;  4IJA A;  4V2F A;  2IGO A;  2NOG A;  3S8P A;  3HHH A;  1IDY A;  2X1D A;  1E3H A;  4KFC A;  4AUX A;  3LA3 A;  4XQF A;  2CJJ A;  2MH2 A;  1Y39 A;  4MTD A;  3K4N A;  4M3E A;  1Z05 A;  1NHA A;  1VQL I;  3F8B A;  1Y8R B;  2E2I J;  1FTT A;  2R7U A;  4M6V A;  1T08 B;  3K10 A;  2ZXJ A;  3E5Q A;  3I59 B;  5BNG A;  4B8X A;  3HBL A;  4IXA A;  2Y9Z A;  4BHC A;  2H8R A;  1D8K A;  4ZYG A;  5K5R A;  5CQE A;  2EV0 A;  4AVP A;  4XID A;  1EJ9 A;  4NC7 A;  3QWL A;  1LE8 A;  2CRG A;  2O61 A;  3ISP A;  5D4R A;  3PIO F;  3RI4 A;  3JAM Z;  4ESJ A;  1YJW I;  2WY7 Q;  2B63 J;  5AIP A;  1LVK A;  5EGO A;  3V7C A;  2UWM A;  5HLI A;  2Y69 H;  1I1S A;  3P7N A;  2A69 F;  2V1X A;  1MGT A;  3MQ0 A;  1T95 A;  1S5L C;  3HRM A;  4M9S A;  2R7O A;  2CH0 A;  1KGS A;  1YJ9 I;  1MBK A;  2HOA A;  2HYJ A;  2IVM A;  2XGE A;  4BQO A;  1I6X A;  2E5Z A;  2GZW A;  4IHV A;  4XKV A;  5DM6 F;  3LSK A;  4E70 A;  1ULY A;  2ID6 A;  3GTG J;  2DJI A;  3DTE A;  3X2Q H;  2LC2 A;  5JLX A;  3J80 K;  4V2G A;  4XBF A;  5TRD A;  1IRX A;  1U5T A;  2NNN A;  3FF5 A;  4MGR A;  3KYL A;  2VBZ A;  5FLM J;  2JVH A;  3RTR A;  1TNS A;  3OYA A;  2XSJ C;  1D5Y A;  1BOB A;  1OQY A;  4L5E A;  4NC6 A;  3HXL A;  4AIH A;  3JRI A;  3OY9 A;  1EH6 A;  4KMU X;  5F04 A;  3ZMV A;  2D1H A;  5H6Q A;  2WV0 A;  1UJ8 A;  2BHY A;  3DF8 A;  2WA0 A;  4ETS A;  2R7S A;  2ZSH B;  4HBL A;  3WTS C;  3PM1 A;  2K9S A;  1ZRC A;  3ZQL A;  1FBS A;  2DK5 A;  5HLG A;  1RUO A;  5EG0 B;  2UZK A;  2XDV A;  3EUA A;  1W7P B;  1YO5 C;  3E5U A;  1WWX A;  2OD5 A;  3J7Z I;  1W0T A;  3K70 D;  4L9J A;  2XC7 A;  3CC4 I;  3I55 I;  2ZC2 A;  2JA7 J;  4RGR A;  4M3D A;  1XSV A;  1Y56 A;  3P5J A;  2XPV A;  5LRS A;  4EV0 A;  1W0U A;  4L0Z B;  1FSH A;  4D7M A;  4BY7 J;  3TP3 A;  3MWM A;  4HF1 A;  2CGP A;  1ZLJ A;  3SZG A;  2WAQ A;  1FSE A;  1XDS A;  4OIR F;  1BBY A;  1MIJ A;  4QIW N;  4Q4Z F;  2XKP A;  3H92 A;  4RM3 A;  4RM2 A;  4DBR A;  2HTS A;  2EWN A;  3GO5 A;  1WJB A;  3ASN H;  1VTN C;  1R4M B;  2QKM B;  2VT2 A;  2IEK A;  2J5P A;  3GUD A;  3FXO A;  2JSC A;  3ZMZ A;  1S3J A;  1I39 A;  1OCZ H;  4PFP A;  2DOE A;  5D5V B;  2E71 A;  1TWH J;  4IOA F;  1IN6 A;  3E6D A;  3NWS A;  2DDA A;  4KT5 C;  1HC8 A;  5EZH A;  4F55 A;  1A36 A;  3M3Y J;  2STW A;  5JHU A;  1Z7L A;  5FKN A;  2X6Y A;  3PNV A;  4MO7 A;  1G2H A;  2PMU A;  1B72 B;  4BBS J;  4J00 A;  1BIA A;  1XGS A;  3WTZ A;  3C2B A;  3BG6 A;  3GTL J;  3HOU J;  3IWF A;  1HLV A;  4BHP A;  4MFD A;  2BVL A;  4ON0 A;  1N75 A;  1TP4 A;  2R5Y B;  3FX3 A;  1ZRF A;  3PQJ A;  4PFO A;  4MFE A;  1WH5 A;  4PSW A;  3OS0 A;  2E2J J;  3HDD A;  2IS1 A;  3Q0V A;  3O8H A;  3F8M A;  3KYC B;  3LSG A;  4LK0 F;  3HC7 A;  2K9N A;  2CV2 A;  3HSR A;  2XUB A;  2HDC A;  2HTJ A;  2D5V A;  1GDT A;  2WBM A;  2IPQ X;  3M8J A;  1VQ8 I;  2LKX A;  1SMY F;  3TMO A;  3W2W A;  4IL6 C;  2LSO A;  1NK2 P;  3K7A J;  3K4J A;  5IYC J;  1B4A A;  3H3V K;  1FBQ A;  5ILU A;  1TWG J;  2WWY A;  3RKX A;  5IY5 H;  3BJA A;  4ZZL A;  1T8I A;  4HNV A;  3SYT A;  4D0P A;  4E7H A;  3FK7 A;  2JQ7 A;  2EV5 A;  1FOY A;  3ZMS A;  3L2U A;  5CQG A;  2OF7 A;  1R9T J;  3LSP A;  4HLX A;  3RDI A;  4MIM A;  4HV6 A;  1BW5 A;  1AHD P;  5FRN A;  1W7P A;  1ONV A;  1B72 A;  3V7R A;  2DOF A;  2KT0 A;  4AYB N;  4RAG A;  3F8N A;  4GFB A;  2WTE A;  3MKZ A;  3U21 A;  3O3K A;  3K4B A;  2C6Y A;  5EGO B;  1ETQ A;  1XDU A;  3FXL A;  4UVA A;  5ED4 A;  1QA6 A;  5K7F A;  3U9G A;  3ZPL A;  3FM3 A;  2HNH A;  4UXN A;  1KQ8 A;  2R7D A;  1CGP A;  1S6L A;  4E7J A;  1AOY A;  2FBH A;  3E7L A;  4G6Q A;  1V55 H;  3FXK A;  4IQ4 A;  3QYF A;  4QTR A;  2KIM A;  3I53 A;  3I5U A;  4CSW A;  1IW7 F;  1HKS A;  4YEJ A;  2BXY A;  3ROU A;  5A2Q Z;  1M1E B;  5J40 A;  4YFN F;  4OMZ A;  1OCP A;  4RGS A;  1WJE A;  1Z7U A;  1SFK A;  4FQG A;  3DP7 A;  2XPU A;  4XOP A;  1Z21 A;  5CPR B;  4OAZ A;  2XF5 A;  3DWL E;  3KP4 A;  3HEF A;  4LIV A;  1U6G A;  3FHZ A;  3Q5F A;  5EYR A;  2LRD A;  4HQE A;  1YIO A;  2Z2S B;  4ITV A;  2VON A;  1SMT A;  1EA3 A;  2EFQ A;  1ZK8 A;  3OMY A;  2R7W A;  1Z3Y A;  2ZO4 A;  4I98 B;  3I3L A;  4LD5 A;  5HOO A;  2HXO A;  3RYR A;  2O6G E;  2KKO A;  5BPD A;  3O2P E;  2R5Y A;  2HDW A;  4A3L J;  5FRM A;  1OCT C;  4Y13 A;  1F4K A;  1XTA A;  2CQK A;  4LFU A;  5B66 C;  1LNW A;  2A5Y B;  4N0B A;  1XX5 A;  3EDP A;  4XLN F;  2ZNY A;  3I9V 2;  5H6R A;  3OYJ A;  4XKB A;  4KIF A;  1SD7 A;  4YIR X;  1W1W E;  1XMX A;  3GTP J;  2K3F A;  1QPM A;  3LSH A;  2Z33 A;  3JRB A;  1LVA A;  1X1B A;  4S05 A;  1BR2 A;  2G9W A;  4XN0 A;  1RIO H;  4M9Z A;  2UV1 A;  3JTG A;  2KIQ A;  3I56 I;  3LMM A;  3GME A;  3W6K B;  3SDB A;  3JSO A;  3HHG A;  4YFX F;  3M4O J;  5DCM B;  4U0W A;  3CMY A;  2FA5 A;  1XB4 A;  4LJZ F;  3DEE A;  1WQ2 A;  2JTV A;  1QQI A;  1I3Q J;  2X48 A;  4PJM A;  4ANJ A;  1O3Q A;  3I54 A;  3U1D A;  1MZB A;  2W1O A;  3AG2 H;  3HSF A;  5FFX A;  1XCB A;  1IXS B;  2OTL I;  3E3V A;  4I2O A;  2HGC A;  1T56 A;  4OIO F;  1Y8Q B;  5IT3 A;  1MMD A;  1NK3 P;  3CUO A;  1EF4 A;  3FM5 A;  3ULQ B;  3ZQC A;  3S3M A;  3JW4 A;  3E1S A;  1VQK I;  1SD5 A;  2F4I A;  2MC4 A;  2FXA A;  1P9Q C;  3QYB A;  2VOD A;  4A3D J;  3M1C A;  4KT6 A;  4R8H A;  2QQA A;  3CJT B;  3KLN A;  4HST A;  5GAE J;  1XSD A;  2KRC A;  3IC7 A;  4O5V A;  1U9O A;  4XRS G;  4TV7 A;  5D8K B;  3M1E A;  1R58 A;  2VAS A;  3CCU I;  1X19 A;  4P9U A;  4WWC A;  1NG6 A;  2XRN A;  4GGG A;  2RN7 A;  3FBN B;  1K78 A;  3ZMU A;  5H2F C;  1HOM A;  2BY2 A;  3AG4 H;  3NWT A;  1JUS A;  2P81 A;  3S1Q J;  1SVM A;  1MH3 A;  2E2H J;  4EGZ A;  1WKM A;  2Z3Y A;  4YII A;  3ZQH A;  1D3Y A;  2EFW A;  1LEA A;  3RIR A;  2NS0 A;  3ZQG A;  4I76 A;  4A0X A;  2PMZ A;  1BR4 A;  3Q9S A;  4MNU A;  4A69 C;  3IV5 A;  2O5R A;  2CSO A;  4LIU A;  1X1D A;  3WGG A;  4C2M J;  1R1U A;  3ZQQ A;  3HZJ A;  4GYG A;  4GDF A;  2M3A A;  2O03 A;  2UXX A;  1OPC A;  1G6N A;  3MMY B;  1G3Y A;  2EJR A;  3FWE A;  1IRF A;  3OWT A;  3OYG A;  4CCL A;  3SJM A;  2JK3 A;  2I8D A;  4HOB A;  3A03 A;  5J4V A;  1BR1 A;  2KP6 A;  2BZT A;  4B3A A;  2ZKZ A;  4M3F A;  5C3E J;  2E1C A;  4BNC A;  2IS4 A;  1V5G A;  3FKI J;  4I0A A;  2WB1 N;  1ZTR A;  3ASO H;  3BC8 A;  3IL2 A;  1K79 A;  2IXS A;  5CJ9 A;  3R0J A;  3L2Q A;  1J2X A;  1MMN A;  2B9S A;  1ZEL A;  1HKT A;  3BG5 A;  2HOE A;  1UMQ A;  5GP9 A;  1QZZ A;  2HFH A;  3GFJ A;  1UZC A;  2L54 A;  2K02 A;  2W85 A;  2Z99 A;  3ZOB A;  2XAQ A;  3LQQ A;  3NEU A;  5D5X B;  3FHN A;  3ABM H;  3OIP A;  1J59 A;  1FYM A;  1BIB A;  1P6R A;  3FBI B;  2H6C A;  5DS9 A;  5IT9 Z;  1JKP C;  4IEJ A;  2M30 A;  3C7J A;  2EQR A;  3K4M A;  4PUS A;  2V79 A;  1HW1 A;  4A6E A;  2FX0 A;  3RQ4 A;  4WCG A;  2HVS A;  4EM2 A;  1ENH A;  3CCJ I;  3F21 A;  5DD8 A;  4A3I J;  3WGI A;  4LK1 F;  2YU9 J;  3GZ5 A;  4B4C A;  3GXO A;  5CVU A;  4WX9 A;  1P2F A;  1XPX A;  1ZG3 A;  3H5A A;  4G7O F;  2NRA C;  4XLF A;  2CWE A;  2CYY A;  3Q0W A;  4HX4 A;  1F36 A;  2ELJ A;  3HM5 A;  1LFB A;  3C18 A;  2PEX A;  2M9H A;  2Y75 A;  4LIT A;  2NVT J;  1FP2 A;  5FD6 A;  3V8K A;  5D8L B;  3D0S A;  2QQ8 A;  2P5L C;  3RJP A;  5FD5 A;  4EM1 A;  1S8N A;  3MN2 A;  4A12 A;  5ILS A;  2Q2E A;  1J75 A;  2HPM A;  5KK1 A;  1LB2 A;  1JKQ C;  1R7J A;  1U3E M;  2MH9 A;  3GTQ J;  2FBI A;  1FMW A;  3GFI A;  1FBU A;  4RLQ A;  3F0C A;  1USS A;  1AA7 A;  3JRF A;  2DLL A;  3LSR A;  2Y30 A;  3ECO A;  3TW7 A;  2VB6 A;  2VKH A;  2L9N A;  3BY6 A;  3OOP A;  2WV1 A;  3VSK A;  3MFK A;  1WSU A;  2VJ5 A;  1SFO J;  2HYF A;  4FCY A;  2PFB A;  5J1U A;  4RB1 A;  2L2O A;  4E7S A;  3I58 A;  1UCR A;  1YG2 A;  2DA2 A;  3H9G A;  2DBB A;  2ICW G;  4P55 A;  2BW3 A;  3KLO A;  5E20 A;  5FLX Z;  2Y0S A;  4NB5 A;  3CDH A;  1JHH A;  2R7R A;  4U88 A;  5EF6 A;  4B09 A;  1BJZ A;  5HVQ C;  2QWW A;  2A68 F;  3TGN A;  4EGY A;  1GV5 A;  4KA4 A;  3CDL A;  5ILV A;  4FTH A;  2YX4 A;  5JHF A;  1QPI A;  1TNT A;  1V5E A;  2TDX A;  3LAP A;  4ENN A;  2I10 A;  2CUE A;  3DU5 A;  1SAN A;  4M9X A;  1GHC A;  4BE2 A;  2DMU A;  1Z6T A;  2DN0 A;  3E6M A;  1T0F C;  2CUJ A;  2DA4 A;  3HRU A;  2M4G A;  1C0W A;  4A3G J;  3OYH A;  4KN7 X;  2FD5 A;  1WZ2 A;  4FHT A;  4I01 A;  4PJJ A;  3UKG A;  1UAA A;  4OIQ F;  3RZO J;  1FTZ A;  1IDZ A;  2FJ1 A;  1EV7 A;  4HA8 A;  1GVD A;  3M07 A;  4JP0 A;  3CP2 A;  3KP7 A;  4OIN F;  1BM9 A;  2QVO A;  3FIS A;  4CCN A;  2ZSI B;  2DI3 A;  1PP8 F;  5LHH A;  1ETK A;  2R3S A;  2L7M P;  4BUP A;  4CIC A;  1ZN2 A;  3SHF A;  3GEZ A;  3KE2 A;  5DCM A;  3I59 A;  5A2Q K;  1FWZ A;  2PMZ N;  4RAZ A;  4IF4 A;  4B1R A;  2GQQ A;  5GTH C;  4OIP F;  1E0E A;  2O0Y A;  4IHT A;  2JA2 A;  2X1E A;  5D5W B;  2XRL A;  4UVC A;  3LOC A;  1YI2 I;  3JRE A;  2XF7 A;  2XIG A;  4D7N A;  4RB2 C;  3HOY J;  5E1X A;  3WOD F;  3H9J A;  3TO9 A;  5HS8 A;  1ZH5 A;  3HOZ J;  3V7S A;  2XAG A;  3W3C A;  1IN4 A;  4OOI A;  2W00 A;  1LEB A;  5GAD J;  5HS9 A;  3I4M J;  1JKR C;  5F0H A;  2IGN A;  3OYN A;  4AIJ A;  3L9F A;  2L9R A;  2DA1 A;  2VPL A;  3FK6 A;  3CJN A;  2FBK A;  4JBA A;  2EH3 A;  4JK1 X;  2IRF G;  2XAJ A;  3P9K A;  2ZFU A;  2ZBK A;  2HQN A;  4KN4 X;  1AU7 A;  3CMM A;  4XN3 A;  1ZR4 A;  2G7H A;  5CYV A;  2QGU A;  5LHI A;  2M5W A;  3MAJ A;  5LGT A;  1SVL A;  2JSP A;  4I02 A;  1OCR H;  2IP2 A;  4E4H A;  2MBF A;  1Y6I A;  4E7K A;  3QOE A;  4CGZ A;  3DPL C;  2R7T A;  2AQF A;  3WTV C;  2VOP A;  4KJZ A;  5JVT A;  4LLG F;  4JYK A;  3RKW A;  5FLV A;  1KU3 A;  2M7B A;  1X1C A;  2MGQ A;  2R7V A;  2BOL A;  5IOY A;  2JUG A;  4CUG A;  4BHB A;  3FMS A;  4CYD A;  1YFH A;  5FGM A;  5JR3 A;  1YTY A;  1PDN C;  3EUH C;  2CQQ A;  2XKO A;  3PQK A;  3S32 A;  5C44 J;  9ANT A;  2DQL A;  3NAU A;  2P4W A;  3S1N J;  1R4N B;  4R79 A;  2NNY A;  2BE5 F;  4RLF A;  1PUF A;  5HNF A;  3QPL A;  2BY3 A;  2MLG A;  1G3S A;  4A3J J;  2DJN A;  3D5L A;  4B3X A;  3TKY A;  2V9K A;  4D5C A;  1K78 B;  3VYR B;  4W1U A;  1W4M A;  2RGV A;  3ECH A;  3OYM A;  2NOJ B;  3A01 B;  3L09 A;  4CXF A;  1U8R A;  1MBH A;  3CZ6 A;  2CQN A;  3KET A;  3ZQ7 A;  2M87 A;  2KRH A;  1LDJ A;  4EAT A;  2H27 A;  2WAD A;  1U78 A;  1PYV A;  2KL4 A;  3KZI C;  3OYL A;  2ZME B;  1HA8 A;  3BPX A;  4BYY A;  2A6T A;  2X51 A;  2XAF A;  2QBY A;  2K9M A;  4NHJ A;  1OKR A;  4LG0 A;  4HX8 A;  5H20 A;  3GBG A;  2LH9 A;  4M3B A;  3MKY B;  3TQN A;  1MDM B;  2DYR H;  2ZXH A;  1G4D A;  3L2C A;  5EEA A;  1I6H J;  1V54 H;  4Y17 A;  3J81 K;  2CQX A;  2M1B A;  1UST A;  1ZLK A;  3F6O A;  4L9N A;  1B8I A;  2RC4 A;  1Y0N A;  2OPT A;  3PUF A;  2JN6 A;  4B48 A;  1RZ4 A;  3CCV I;  1MJA A;  3K6G A;  2JA8 J;  3QAH A;  2GIV A;  2G7U A;  5K1Y A;  2FEZ A;  4AIK A;  4XRF A;  2IA0 A;  4HG2 A;  4O6J A;  1L3L A;  4JOM A;  5DEQ A;  3PJR A;  3S3O A;  2HQA A;  2BV6 A;  2GBY A;  4DGW B;  3AAF A;  2V9V A;  1TQM A;  4NBQ A;  4Y33 A;  4F92 B;  4HNT A;  2YU3 A;  1T38 A;  2ZME A;  1MD0 A;  2OZ6 A;  1K83 J;  5CVV A;  1DPR A;  2Y0S N;  3DV8 A;  4DNC A;  3JCU C;  2H6B A;  1P7I A;  1WPK A;  5DYM A;  1MKM A;  4XOR A;  4X0G A;  1ITY A;  4ENK A;  4HYE A;  4HF2 A;  5E3O A;  2L0K A;  3T0Y A;  4A2U A;  4ZYD A;  5JI6 A;  2IGK A;  2DT6 A;  2QLZ A;  4XR6 A;  5FJ8 J;  2D1V A;  4PJ0 C;  3VDX A;  2MAB A;  3WTU C;  5FKL A;  2COM A;  3LA2 A;  3PFY A;  1IN5 A;  3BTL A;  3C2G A;  4G8X A;  4RAF A;  1GXQ A;  2DFI A;  4YFK F;  3H5N A;  4YIF A;  1O3S A;  2IS2 A;  3CUQ A;  1YW8 A;  1IGN A;  3S2D J;  4KUM A;  1OYW A;  2GOM A;  1S7O A;  1MMA A;  2QQB A;  4L9T A;  5HS7 A;  1RR7 A;  3H1C A;  2VQH A;  3GVA A;  3ERM A;  5L3C A;  5DUI A;  1SEU A;  1WVR A;  2STT A;  1PJR A;  1X2N A;  2CQ7 A;  2A6E F;  4HAM A;  4MEX F;  1XC5 A;  5AIQ A;  2ZXI A;  5B5E C;  2WAQ N;  4AD9 A;  4Y3O A;  1B8I B;  2E34 A;  1ZGW A;  1IV8 A;  3G6E I;  2F5F A;  2VPR A;  1ZGJ A;  3KP3 A;  1F43 A;  4BKX A;  1TWC J;  5CVJ A;  4NNJ A;  1GUU A;  4RGU A;  3SXY A;  2EB7 A;  4CYC A;  1TW2 A;  4A0Y A;  2X0L A;  3H36 A;  5E3M A;  3CD6 I;  3I4N J;  2QYO A;  1T0F A;  1T39 A;  2L01 A;  1EH7 A;  1RKT A;  2MC3 A;  2B7E A;  3CCY A;  2LY1 A;  1VI0 A;  2IA2 A;  2OCE A;  2HR3 A;  4G94 A;  4EM0 B;  3AG1 H;  4XLC A;  3U1K A;  4XSZ F;  4I0B A;  3CCE I;  2FNP A;  5KHD A;  4IKF A;  3M9A A;  3H35 A;  4XLH A;  2Z1D A;  5L3E A;  3CUQ B;  1R5H A;  5B3S H;  2YSR A;  5KNL A;  2IS6 A;  1HF0 A;  3ABT A;  3LWF A;  1XN7 A;  1TZL A;  1X2M A;  1K6Y A;  2A5W A;  2X4H A;  3GFL A;  4UY8 I;  3OYB A;  4BAC A;  5E1W A;  1DDN A;  2BVM A;  2JT1 A;  3IWZ A;  2HEO A;  3BR6 A;  3LA7 A;  4YRV A;  3A02 A;  1IN8 A;  3NAR A;  1TT0 A;  3WTT C;  3CCR I;  4FE4 A;  2EFN A;  3IH2 A;  4B47 A;  3CDI A;  5K5O A;  5DD4 A;  2F48 A;  3OYK A;  2L3D A;  2L7Z A;  1YQA A;  2L7K A;  3HRT A;  4XIC A;  1YOV B;  1DGR M;  3BCA A;  4HDU A;  2VKV A;  5CKT A;  2L5Q A;  3GYH X;  1IUY A;  4HQM A;  1B6A A;  1KU7 A;  4FX0 A;  1FIA A;  2P7V B;  3R0A A;  2RNJ A;  3NQO A;  3HOW J;  2WY8 Q;  3S2H J;  3HPG A;  3IHU A;  3KEY A;  3TO7 A;  1R5G A;  3U2R A;  3J81 Z;  2O7O A;  4NUB A;  1FOK A;  2AHQ A;  1KZH A;  2KJC A;  3JRH A;  4XNF A;  1XMA A;  4ZC3 A;  1VND A;  4D9J A;  2LF8 A;  1POG A;  3KYD B;  2P5K A;  3KP6 A;  3GF2 A;  2MLK A;  3Q0U A;  3BTJ A;  3WHC A;  2BXZ A;  4UVB A;  1RES A;  3DBH B;  4PJL A;  2F5E A;  5DV5 A;  2W7N A;  3QOD A;  3L7W A;  3D1N I;  4IHY A;  1U0J A;  1JGG A;  3WE2 A;  2F2E A;  3R61 A;  3HG9 A;  2JPB A;  2W24 A;  3KFW X;  3BG9 A;  1A6I A;  1R1V A;  4JX5 A;  2W84 A;  2VXD A;  1ETW A;  3HB9 A;  4II3 A;  3PUB A;  1BC8 C;  4AVZ A;  1A5J A;  5GPC A;  4AC0 A;  1TTY A;  3A1Y A;  1YRN A;  3N4M A;  2KHM A;  1YX5 A;  2ME0 A;  3BG7 A;  4GYI A;  2FOK A;  3BOQ A;  1REP C;  3F8C A;  3HOS A;  1GV2 A;  3B02 A;  4QPO A;  3CCS I;  2DAO A;  1FZP B;  1U2W A;  1LPQ A;  4CO8 A;  1FIP A;  1I27 A;  2OA4 A;  3GCM A;  3M8E A;  3GTJ J;  4UUV A;  4LG0 B;  1YW7 A;  5AON A;  2IBD A;  3OSG A;  5GPA A;  3S17 J;  4GXO A;  1N78 A;  2HYG D;  2L02 A;  1ODD A;  1WH7 A;  3ZMT A;  3B6C A;  2DA6 A;  4BQA A;  4DYR A;  2R0Q C;  3PL8 A;  4LLN A;  5IYD J;  4IRI A;  2DU9 A;  4K2E A;  5D6F A;  4RAY A;  4DIQ A;  1SFX A;  1S7E A;  2TCT A;  2RVC A;  5J8C A;  1WHU A;  1SFU A;  2K86 A;  2CUZ A;  1H9T A;  2D2W A;  2QKL B;  1WRJ A;  4XON A;  2KQR A;  1UEL B;  5E79 C;  3CO6 C;  3LFU A;  2BEO A;  2X1C A;  4ESB A;  2VQC A;  3VOD A;  4QSH A;  1KYW A;  5IP7 J;  3ZXS A;  1O3R A;  4IRH A;  4PSX A;  3R60 A;  3TW6 A;  2JZY A;  2V1U A;  3IH3 A;  1P92 A;  1VZ0 A;  5J1Y A;  5IPA A;  2ZJ2 A;  1R1T A;  3BZC A;  3MKW B;  1Y1V J;  3F3X A;  5B1B H;  1MBJ A;  4FX4 A;  2ZME C;  3EPZ A;  1FYL A;  3G3Z A;  2QBY B;  2K4J A;  2DDB A;  3BLY A;  1ZHF A;  2KIS A;  2DYS H;  1VQ5 I;  4IHX A;  2RRE A;  4B43 A;  5M5W J;  1UHW A;  2EIJ H;  4CA0 A;  1J0R A;  2YUS A;  4XRM A;  1QBJ A;  4BJ6 C;  2QF7 A;  4U87 A;  4BU2 A;  1X3Z B;  2NVU B;  3SEQ A;  3VEP A;  2DOD A;  2R7F A;  3AL0 C;  2ACJ A;  3VSL A;  2R7Q A;  3HGY A;  5IYB J;  2VXZ A;  3HUG B;  4WXC A;  3H3U A;  4Q48 A;  2VBW A;  4M73 A;  3E97 A;  4MTE A;  2QCO A;  4R1H A;  2W4S A;  1Z77 A;  2ECC A;  1P4A A;  2ZJP F;  3CCL I;  1K6O A;  1AWC A;  3HTU A;  2XSD C;  3DPU A;  2AXL A;  2ESH A;  1W5T A;  2BHZ A;  4HRI A;  2F6C A;  5LEJ A;  1RC9 A;  1DP7 P;  5LHG A;  3OR1 C;  2MG4 A;  1QNT A;  2VJJ A;  1WFX A;  4NQW A;  4OMY A;  2A61 A;  3BQZ A;  3CCM I;  1SAX A;  3J7A Y;  5D5U B;  5HLH A;  2HI3 A;  4ENM A;  1G3W A;  2NXN B;  1QRY A;  4HV5 A;  1H89 C;  3OL3 A;  5DUK A;  3TOB A;  1F1Z A;  4XKW A;  5IP9 J;  1OJL A;  2ECB A;  4AYB A;  4C3H J;  3H0D A;  4A93 J;  3E5X A;  4CYC B;  3J7A O;  1SD4 A;  1IF1 A;  1BI1 A;  4DBQ A;  4KIS A;  1UHS A;  3FIW A;  3ZN1 A;  4OWR B;  1JJ8 C;  4V19 K;  3DFG A;  1VQO I;  4JX4 A;  4IZZ A;  2JRM A;  2PX9 A;  1W5C C;  2D45 A;  2V1D A;  5FB2 A;  4MLO A;  1ZRE A;  2K7L A;  2E1O A;  1T6S A;  3WTX C;  2PN6 A;  4CHU A;  2BY0 A;  1MBE A;  4LB6 B;  1FOW A;  1KU2 A;  5D4S A;  4IQJ A;  3CLQ A;  4XOT A;  1E17 A;  5DDG A;  1FT9 A;  3DCF A;  1XG1 A;  3TDU C;  1BJA A;  2M2E A;  1WJF A;  3CCQ I;  2EIM H;  4GRI A;  5HDG A;  1STZ A;  3PSI A;  3GFM A;  3LST A;  4ZDO A;  1K4S A;  4BDZ A;  1PP7 U;  2X85 A;  5M3M J;  5JLW A;  2CFO A;  3JRD A;  3BTC A;  5FO5 A;  4IX7 A;  2R93 J;  3JR9 A;  1B9N A;  3TP0 A;  1UG0 A;  4O3M A;  2FML A;  1HDP A;  4ZYE A;  3L2W A;  3MZH A;  4BXX J;  3ELK A;  1S7A A;  1X4P A;  5J3L A;  3OIQ A;  1LDD A;  4UB8 C;  4BY1 J;  1IRZ A;  3DTK A;  3GW2 A;  1YS7 A;  2ETH A;  3LAJ A;  1ERD A;  2E1N A;  4Z2Y A;  1UG2 A;  1RI7 A;  1KYZ A;  2XAU A;  4A6D A;  4B44 A;  2N8G A;  2K9Q A;  4HX7 A;  3JRG A;  3A4C A;  4UHT A;  2EK5 A;  1KON A;  3J80 Z;  3OYF A;  3HPH A;  3DXJ F;  5GTI C;  3S14 J;  2VE9 A;  2OU2 A;  1FYK A;  2YS9 A;  2LK2 A;  4BS9 A;  3G73 A;  1BOA A;  2CW0 F;  3BR2 A;  1XCV A;  4P5O A;  1MJ9 A;  3S2W A;  3MZ8 A;  3TBI A;  3WU0 A;  4BL0 B;  2P6T A;  5J4Y A;  2P0W A;  2EPF A;  3I64 A;  5L3D A;  3ZCO A;  4Y4R A;  3T1B A;  1Y0U A;  2FMY A;  3HIF A;  2BBY A;  3P9I A;  5FKK A;  1OFC X;  2YX7 A;  4WXD A;  3WU2 C;  2DW4 A;  4BJT A;  3CC2 I;  1TQP A;  1VQ6 I;  3SFZ A;  2LTP A;  1QGP A;  3F8F A;  2DFE A;  1D1C A;  1TWA J;  3KCC A;  3CLO A;  1VQN I;  4EJW A;  4HNU A;  4XK4 A;  2R7X A;  2RAE A;  3DQV C;  3LL7 A;  1P4W A;  1YIT I;  4H0E A;  2JA5 J;  1DU6 A;  3Q9V A;  2V4J C;  2GXB A;  2G0E A;  2HS5 A;  4HPQ A;  5LEK A;  3DTI A;  1DP3 A;  4PCQ A;  1WGX A;  3GLL A;  3QPH A;  2VBX A;  3HSE A;  1U5T C;  1HBX G;  4YEL A;  3E0J B;  4M74 A;  1O7L A;  3CJQ B;  3H9Q A;  2ELH A;  1FMV A;  3M7G A;  3WG9 A;  2VJ4 A;  2L4A A;  3FXU A;  3OS1 A;  2K40 A;  1YHQ I;  3QU3 A;  4XKC A;  2XGC A;  1F5T A;  1XD7 A;  2MFZ A;  4DYQ A;  5LGN A;  2COB A;  3ABL H;  4L18 B;  3A2K A;  5L3G A;  4DW6 A;  4U0Y A;  3DLA A;  1HST A;  1TT5 B;  1W7P D;  4ZDP A;  3F9K A;  4Y7N J;  1XMK A;  2E1M B;  3NRV A;  3FMQ A;  4EJO A;  3L2V A;  2R5Z A;  4NQW B;  2CS3 A;  3T8R A;  4G7H F;  5KCM A;  2R7Z J;  2DOA A;  3GX4 X;  1ETX A;  4BH9 A;  1R00 A;  4NC8 A;  3N05 A;  4FE7 A;  3BR0 A;  4NDL A;  2R92 J;  4D5F A;  3CJR B;  1UHM A;  1A6Q A;  3EET A;  1VQ9 I;  1WI3 A;  4IVN A;  3OSF A;  2JWT A;  5HLT A;  4CCJ A;  1OCC H;  3EYY A;  5E8I A;  1R23 A;  2ME6 A;  2ZFW A;  4N4O B;  1SD6 A;  3L1P A;  1G3T A;  2DT7 B;  1N25 A;  3E6B A;  2RV8 A;  3TED A;  4CCO A;  4XLE A;  1NH3 A;  3BTI A;  5CVI A;  1RUN A;  3VYU B;  2XPW A;  2IGM A;  2OJE D;  1W36 C;  4C2U A;  5LD2 C;  3D5R C;  4HF0 A;  3OR2 C;  2XGX A;  2OQG A;  2WB1 A;  4RMN A;  1LUJ B;  2FQ4 A;  5DM7 F;  1AKH B;  1YJN I;  3GLX A;  1XSX A;  2YPR A;  4IHS A;  2FQ3 A;  2LDU A;  5FLX K;  4DJA A;  3FMR A;  1MMS A;  2ELK A;  3CC7 I;  1IAW A;  4FT8 A;  1IV6 A;  1RPW A;  2E19 A;  3D5S C;  4HEA 2;  5FKM A;  5HDN A;  3RYP A;  1FJL A;  1GXP A;  4KNY A;  1T33 A;  3KP5 A;  3S16 J;  2LNB A;  2ZCW A;  4LMY A;  2DO7 A;  3BR3 A;  3L2R A;  2RQQ A;  2VIX A;  2KPM A;  3RPQ A;  4KDP A;  2CW8 A;  2ISZ A;  1OCO H;  3FXM A;  3REO A;  4F93 B;  1OIS A;  3TO6 A;  4M71 A;  2DTR A;  5KAI C;  5B1A H;  3BDD A;  2BY1 A;  2VQG A;  1Z9C A;  4BQQ A;  2HVQ A;  1SVO A;  4EEF G;  2VJI A;  2VL8 A;  2XHK A;  3FZV A;  3V8L A;  3A01 A;  2XAH A;  2KJB A;  2PJR B;  2Q0O A;  3O6B B;  5KAF C;  2EZK A;  3JSP A;  1S72 I;  2H8W A;  1RR8 C;  2EA4 A;  3RPU D;  3W2A A;  1HKQ A;  1MMG A;  2IA1 A;  3KZZ A;  2LOO A;  1YYV A;  1LKX A;  2VT3 A;  3ZQF A;  2E5N A;  1KQ0 A;  3A0B C;  5LFA A;  4L0Y B;  1G8X A;  4C3J J;  4Z6Y A;  5GAG J;  1JI8 A;  2EA2 A;  3DKX A;  1NTC A;  2NYX A;  2QSG X;  1OR7 A;  3MKL A;  3ERE D;  4ZTF A;  5C4X J;  3UR3 C;  2XVC A;  2OC6 A;  1PUF B;  1HCR A;  5FKO A;  1NG7 A;  1JTX A;  2E36 A;  4A3K J;  4A3M J;  1MND A;  2ADU A;  2Y9Y A;  3G4S I;  2MA3 A;  2P7C B;  2DMT A;  1PUE E;  2AS5 F;  3BR1 A;  3ZP5 A;  2PJP A;  1WJ5 A;  1BW6 A;  4M6Y A;  4C30 A;  1OLT A;  1FOX A;  1APL C;  4WXH A;  5E17 F;  1IN7 A;  1WCM J;  4ZYH A;  1MNE A;  2DT5 A;  3F23 A;  4J19 A;  1TLH B;  3ML6 A;  1QVT A;  2GXG A;  3DBL B;  4UUS A;  1RRJ A;  2KDZ A;  3KPH A;  3G1L A;  3L00 A;  1ETO A;  2ID3 A;  2VKD A;  4BQN A;  3AFH A;  4X1E A;  1TWF J;  2H09 A;  1MBF A;  3GZN B;  2HPI A;  3VYT B;  2JPC A;  2LR8 A;  4S0H B;  2DA3 A;  3E6C C;  1GT0 C;  4E7Z A;  5HNH A;  2GOX B;  2XV4 S;  3P9C A;  5E18 F;  2OV7 A;  2HWV A;  4UNO A;  2LBF B;  1ZYR F;  3JRC A;  1Y1W J;  2XF6 A;  2PBI A;  3BCB A;  2LBF A;  1N77 A;  2F5C A;  1MSF C;  3LSI A;  4CCM A;  2K9L A;  3QPT A;  1O3T A;  3MZY A;  3R6S A;  1MW7 A;  2LD5 A;  2ESN A;  2LKS A;  4QLC U;  2QQ9 A;  1Z1D A;  2PQ8 A;  2GM4 A;  3ABK H;  3LQR A;  4CCK A;  4X6A J;  2ZJQ F;  2QA4 I;  1E3O C;  1D0Z A;  4H4K C;  4UV9 A;  1W5S A;  2VN2 A;  2Q2E B;  4IRG A;  3OOU A;  2DMQ A;  4BEH A;  3KP2 A;  4ZYA A;  3OS2 A;  2CMP A;  3FXQ A;  2L9V A;  2X6O A;  3K2Z A;  2FF4 A;  3IAS 2;  1TBX A;  3HOT A;  4BE1 A;  4AWX B;  3S1R J;  1WJC A;  4PJN A;  1KA8 A;  1XS9 A;  5FFZ A;  4QPQ A;  2DPD A;  4RBO A;  1V3F A;  3DKY A;  2IT0 A;  2CU7 A;  2IAI A;  1JE8 A;  3IP4 B;  2XAS A;  3G1O A;  1UB9 A;  1ON1 A;  1Z67 A;  2CFX A;  5IP6 A;  4KMF A;  4D1Q A;  1VFC A;  4ZDL A;  1SAU A;  2AQE A;  2EBI A;  2XB5 A;  3FKJ A;  4RGX A;  3CMA I;  3KEQ A;  3HYI A;  1OYI A;  3CME I;  5F6F A;  2GWR A;  1MJB A;  2DFH A;  4EJV A;  1VQ7 I;  5EJC A;  4EJU A;  4F52 A;  4J01 A;  5LBQ A;  2O9L A;  3ZGK A;  2LRE A;  2Q8K A;  1FP1 D;  2DK8 A;  2H1K A;  3MCZ A;  2HU9 A;  2PI0 A;  2QSF X;  3TDZ C;  3HL2 A;  1CQT A;  2O8X A;  4C9Y A;  4A3F J;  2NS7 A;  3DEU A;  1FNN A;  2HZT A;  2PLY A;  1R49 A;  3I71 A;  3W6J B;  3HOV J;  1Z3X A;  3K1N A;  3QU6 A;  4L5I A;  5K7H A;  1FEX A;  4UUT A;  1X58 A;  4BXU A;  5FRO A;  1W36 D;  3CTA A;  3T5X A;  4EVI A;  4IO9 F;  5LLQ A;  2WAE A;  2KIU A;  3VFZ A;  5F64 A;  1VQM I;  1I5Z A;  2V6E A;  3RCO A;  5M3F J;  2A05 A;  4XSX F;  5HOD A;  3OYD A;  2Y31 A;  1V5F A;  1FLI A;  1HW2 A;  5HDK A;  3O8G A;  4LOC A;  3DPT A;  5E1Z B;  4FIS A;  2E7W A;  5F0C A;  5EEH A;  5LGU A;  2DMN A;  1AKH A;  1U9N A;  4P9F A;  5CVR A;  3UNG C;  1YW9 A;  1R5I D;  2M0M A;  2E1M C;  4RB3 C;  1BI0 A;  2NVQ J;  4U0V A;  1Q1H A;  4LLL A;  3K4K A;  6PAX A;  1S29 A;  3QRF F;  3PO3 J;  3RQI A;  4YG2 F;  2GAU A;  1H88 C;  1F9N A;  4DOZ A;  1XGN A;  1I1G A;  2E60 A;  3Q3S A;  3W2V A;  2B0L A;  4PGG A;  4EJT A;  3IRQ A;  3LFK A;  3SEZ A;  1YRN B;  3G1M A;  2K85 A;  3BPV A;  4E7I A;  2GA2 A;  1K7A A;  1DUX C;  3T8T A;  3QP5 A;  4PDK A;  4JX6 A;  2LLK A;  3PSF A;  3SFI A;  4AM3 A;  2EFO A;  5D6E A;  1PVE A;  1ZKG A;  5F27 A;  3SDG A;  3V8J A;  2ZB9 A;  3F6V A;  1HSJ A;  1ZQ3 P;  3BR5 A;  4XMY A;  4BXF A;  3S15 J;  2L7F P;  5IT9 K;  1MDM A;  5DCF A;  4A3E J;  3QPS A;  4HW0 A;  3PIP F;  2BYV E;  3R4K A;  3S93 A;  1IG7 A;  4ABZ A;  4CDG A;  5M5X J;  3TL4 X;  1JHF A;  1YS6 A;  3IUO A;  3TOA A;  1A31 A;  2F5V A;  1IC8 A;  2PJR A;  4G6D A;  3AL0 B;  4MHG A;  2QM3 A;  3HKZ N;  1BA5 A;  2CV1 A;  1P7J A;  2GXA A;  3ZN0 A;  1FY7 A;  4RA2 A;  3RKY A;  3GTK J;  4PGH A;  2XGD A;  5BPI A;  5ICG A;  4DZJ A;  1RET A;  3EUK L;  3BT9 A;  2KDO A;  2X6W A;  2QEN A;  1OR7 C;  4A0Z A;  3RKQ A;  1HXD A;  5M5Y J;  4LG3 A;  2Y2Z A;  1ZG5 A;  1BC7 C;  2E35 A;  2HOS A;  2V9P A;  1TC3 C;  3SZP A;  2AO9 A;  4N9H A;  3ZR8 X;  3PNY A;  1KQ9 A;  1IZ1 A;  4EMS A;  2A3S A;  5J47 A;  3COA C;  5TGT A;  5TJJ A;  1QHG A;  4IOC F;  4ENJ A;  4FET A;  3JAM K;  3AKZ A;  2QSH X;  4BAY A;  4G12 A;  1QO0 D;  1DU0 A;  3I4P A;  2WAF A;  4P96 A;  3S3N A;  4LB5 A;  2OBP A;  3EQL F;  5CLS A;  2HQ5 A;  2BGC A;  4M3G A;  3WU1 B;  2CO5 A;  3OL4 A;  3OYI A;  3PFI A;  5E3L A;  1KU9 A;  1X1A A;  2EZL A;  2K3P A;  1D0Y A;  1QHH D;  3K4C A;  1ETY A;  4F91 B;  2J5O A;  5BS6 A;  2DXI A;  1YLF A;  5K7Z A;  1I50 J;  2MSY A;  1MH4 A;  4GCV A;  2KZG A;  4E7L A;  2EIL H;  3CES A;  3WHB A;  2LY2 A;  2VUM J;  4BBR J;  2E7X A;  1Z91 A;  1QU3 A;  3J7Y J;  3VWB A;  1UFM A;  3F72 A;  3SQN A;  4ZH4 F;  2FRH A;  1X3U A;  1ZAO A;  4RS8 A;  1MBG A;  2MD0 A;  2Y48 A;  2EV6 A;  3CP8 A;  4LGW A;  3M8F A;  3HTS B;  1D1B A;  3BRO A;  3QYE A;  3VPR A;  3C1D A;  3WTY C;  1RKW A;  2VI6 A;  3BP8 A;  2M4K A;  4A5N A;  1LDK B;  4DZP A;  1ORK A;  2VQL A;  4W97 A;  1ZGA A;  1BI2 A;  1O4X A;  2GIZ A;  2V1N A;  4E6K G;  3ZRG A;  1MNM C;  5JVG F;  3BJO A;  3JTH A;  2HVR A;  2X9D A;  4QWQ A;  1O57 A;  3S1M J;  2IW5 A;  4WF2 A;  1H8A C;  3C3W A;  1E2X A;  4BGD A;  2M34 A;  3BZ6 A;  2FE3 A;  1JUP A;  1OMI A;  1V4R A;  2DA7 A;  4XM3 A;  4U7D A;  4BJ5 C;  4UV8 A;  3JRA A;  4A5M A;  2JVG A;  3VB2 A;  1P4X A;  4WK8 F;  3HKZ A;  1U5T B;  3VYS B;  1CF7 A;  1H9G A;  1FX7 A;  1D5V A;  2OUM A;  4ESF A;  1A35 A;  3HUG A;  2VE8 A;  4F7Z A;  2EFP A;  4G7Z F;  3PNT A;  1SC7 A;  1DPU A;  4BE0 A;  4AU7 A;  1JGS A;  3ABU A;  1WJD A;  3CF2 A;  2GLO A;  3DLL F;  2M7A A;  1O7F A;  5EDN A;  3KIO A;  3LSM A;  2FU4 A;  2WC2 A;  4XL9 A;  3CO7 C;  2EZH A;  2KLO A;  1K61 A;  2HOT A;  4FAS D;  3BQY A;  2P8T A;  3H5R A;  3ZMD A;  1DGW Y;  1A04 A;  1ZR2 A;  3C2H A;  3BG3 A;  3OYE A;  1YX3 A;  1XGO A;  3GTM J;  2Z5U A;  1ACI A;  4MQ9 F;  5ICE A;  1D1A A;  2F5D A;  4OAY A;  2X6X A;  1ZG1 A;  1LFU P;  1BL0 A;  4XLA A;  5KVR A;  4EQQ A;  4I6Z A;  2K27 A;  1HW5 A;  2M45 A;  5J6X A;  2W57 A;  2OCC H;  4HZF A;  2LY9 A;  4M72 A;  3B6A A;  2CV0 A;  2XB0 X;  2W48 A;  3OIO A;  2UXN A;  2NVX J;  2JMW A;  3W6V A;  4IHW A;  5F0F A;  4RB0 A;  4C3I J;  3WE3 A;  2VOO A;  2KIF A;  2TRT A;  3CQZ J;  5L3F A;  2JJ7 A;  3IKT A;  3MEX A;  1SFE A;  2LFB A;  3QP6 A;  2A6H F;  1CF7 B;  2H1L A;  2RNG A;  3H0G J;  1B59 A;  5J1R A;  2KRF A;  1FC3 A;  4JQF A;  3FXR A;  2O8K A;  4HDV A;  3HOX J;  3QQA A;  4G6T B;  2FUG 2;  3K2A A;  2PMH A;  2ZJR F;  1VQP I;  3DU6 A;  1MSE C;  5ICC A;  2GA1 A;  3FXJ A;  5JFR A;  2LG4 A;  2OZU A;  1TL8 A;  4A3B J;  1T2K A;  3RSN A;  1TQI A;  4G9Y A;  4L5J A;  2W25 A;  4L9V A;  1D0X A;  2R5Z B;  1OYY A;  2UUZ A;  3EUH A;  3ESW B;  5EEG A;  2EZI A;  1H0M A;  2DCE A;  5EG0 A;  1VF9 A;  4II2 A;  2Y0M A;  2XRO A;  1I3A A;  5BOX A;  1X4O A;  2KZV A;  2P6S A;  2DA5 A;  3FDY A;  2CG4 A;  4XRS A;  3G71 I;  2M8E A;  1R36 A;  2HQR A;  1B1B A;  3BWG A;  2LF7 A;  3K1P A;  4HSR A;  3GZ6 A;  3K0L A;  4I7H A;  2MD5 A;  4PZJ A;  3K1M A;  1VQ4 I;  1JTY A;  2FSW A;  4P1W A;  5J8F A;  3MD2 A;  2ZNZ A;  3K70 C;  1ETV A;  2R4G A;  2V26 A;  2V6C A;  1X1P A;  2EIK H;  5GAH J;  3AG3 H;  1U8B A;  1IO2 A;  2IJL A;  3BZK A;  1R71 A;  2LYC A;  2HDD A;  2EIN H;  2ISY A;  2QUF A;  4UUS B;  1RNL A;  2VLA A;  4KYW A;  5DTD A;  2KFD A;  2M8G X;  3H3Z A;  3PO2 J;  1S9H A;  2BW3 B;  5BQT A;  3V4G A;  3OYC A;  3IRR A;  2FOW A;  3QOP A;  4KIG A;  2CUF A;  1B9M A;  2AXT C;  2MYS A;  3DBR B;  2I5U A;  4ZZD A;  4Q47 A;  5F1J A;  1BN5 A;  3LSJ A;  2PG4 A;  2CW7 A;  2Z16 A;  4N4N B;  2LP0 A;  2O3F A;  1GLN A;  2DQR A;  2HKX A;  3K69 A;  4U7B A;  4IPA A;  2VKE A;  2VC0 A;  3KX2 A;  1XGM A;  3CF5 F;  3K9T A;  4S04 A;  1J09 A;  1JT6 A;  4Y15 A;  2DTZ A;  1BI3 A;  2H94 A;  1QVU A;  3OV8 A;  2ZXW H;  4ZTJ A;  1E3P A;  5IOZ A;  3A0H C;  2Z9O A;  1T98 A;  2DPU A;  2NAZ A;  3DKW A;  4KIB A;  1EH8 A;  5ICF A;  1JKO C;  2MW8 A;  3SZT A;  4DQ2 A;  2JA6 J;  2VBY A;  4MEY F;  2F4M B;  1EKE A;  4N9I A;  1D8J A;  2V7F A;  2QZ8 A;  1GVJ A;  3N97 A;  3BJ6 A;  1Z6R A;  1DQU A;  2HKO A;  1J9I A;  1WI9 A;  2FNA A;  4F3Q A;  5F1R A;  1JJ6 C;  3RZD J;  2QEX I;  3IKV A;  4Q5S F;  2HXI A;  3KZY A;  2K4B A;  5BMZ A;  2HZD A;  3GWZ A;  4I99 C;  4ZJZ A;  2K5C A;  1Z0X A;  2RQP A;  1TW3 A;  2DMP A;  2NS8 A;  1R6R A;  1IRG A;  3HRS A;  5EZG A;  3ONQ A;  1LFP A;  2M0C A;  5TIS C;  5F08 A;  3WGH A;  3ZQI A;  3GTO J;  2JRT A;  2KMU A;  3B73 A;  4UB6 C;  2JUC A;  4MQV A;  3K4L A;  2W82 A;  3HJE A;  5K5Q A;  2P5V A;  1X3W B;  1JUM A;  1Q1V A;  1IJW C;  4PK4 A;  1LJ9 A;  5L3B A;  1QZY A;  2YR2 A;  4BEH B;  1YE9 A;  3G2B A;  3KEO A;  1JXS A;  2VC1 A;  4KIC A;  1L0O C;  5LRR A;  2OTJ I;  3WG7 H;  4RDU A;  3CUQ C;  5ERI A;  1J5Y A;  4KIT B;  1R22 A;  1WJA A;  1YIJ I;  2NVY J;  2A07 F;  2LKP A;  3DEW A;  2F4O B;  4AID A;  3I0T A;  4M6X A;  1IXC A;  3IH4 A;  4HLY A;  1QZE A;  2OAZ A;  4DYC A;  4A3C J;  2Q1Z B;  3WTW C;  3VOE A;  4C2T A;  4GO1 A;  2LVS A;  2DFF A;  4CZZ A;  4Y52 J;  1IUF A;  1IXR C;  3HGG A;  1LE8 B;  1ZRD A;  1ZAR A;  2OQR A;  1J7K A;  4ASN A;  3LNQ A;  2RKH A;  4OU0 A;  5C4J J;  4CZC A;  5E3N A;  2RDP A;  3RPU A;  3EYI A;  2L9S A;  4CH7 A;  4BDY A;  3MVP A;  2LMD A; 
#chains in the Genus database with same CATH homology
 4LIT A;  1G59 A;  3ZGK A;  2LRE A;  3V42 A;  3IAM 2;  4PSX A;  2HU9 A;  3HL2 A;  1VZ0 A;  4C9Y A;  2HPM A;  3MKW B;  2IGO A;  3S8P A;  3EPZ A;  1Z3X A;  2X1D A;  3BLY A;  1FMW A;  4XQF A;  4RLQ A;  5FRO A;  1W36 D;  1AA7 A;  2WAE A;  3K4N A;  2VB6 A;  2RRE A;  3RCO A;  2V6E A;  2VKH A;  2L9N A;  4B43 A;  3VSK A;  2R7U A;  2VJ5 A;  3K10 A;  3OYD A;  4CA0 A;  1V5F A;  4BJ6 C;  4U87 A;  4BU2 A;  3SEQ A;  2L2O A;  4E7S A;  3AL0 C;  3DPT A;  3VSL A;  2R7Q A;  3HUG B;  2VXZ A;  3H9G A;  5CQE A;  2BW3 A;  2Y0S A;  3UNG C;  2M0M A;  4NC7 A;  2W4S A;  2E1M C;  2R7R A;  5HVQ C;  3DPU A;  3K4K A;  2WY7 Q;  4HRI A;  2F6C A;  5JHF A;  1LVK A;  1V5E A;  2UWM A;  3OR1 C;  4DOZ A;  1WFX A;  2VJJ A;  2E60 A;  3W2V A;  3DU5 A;  3J7A Y;  1T95 A;  4BE2 A;  2R7O A;  2CH0 A;  3OL3 A;  3SEZ A;  4XKW A;  1T0F C;  2CUJ A;  2M4G A;  4AYB A;  4E7I A;  4BQO A;  3OYH A;  3H0D A;  2E5Z A;  4XKV A;  3LSK A;  4PJJ A;  1UAA A;  3PSF A;  2DJI A;  3DTE A;  4DBQ A;  4KIS A;  2LC2 A;  3CP2 A;  4OWR B;  4XMY A;  4BXF A;  4CCN A;  2ZSI B;  1IRX A;  3KYL A;  4IZZ A;  3S93 A;  4BUP A;  2JVH A;  3RTR A;  4MLO A;  3TL4 X;  3IUO A;  3OYA A;  2PJR A;  2F5V A;  3AL0 B;  2XSJ C;  1BOB A;  3HXL A;  3OY9 A;  2CV1 A;  1E0E A;  2JA2 A;  2X1E A;  4IQJ A;  2XF7 A;  4XOT A;  2WA0 A;  2R7S A;  2ZSH B;  3H9J A;  3EUK L;  3W3C A;  2KDO A;  2X6W A;  1OR7 C;  2W00 A;  4LG3 A;  3EUA A;  2XDV A;  1WJF A;  4GRI A;  3ZR8 X;  3K70 D;  2XC7 A;  3PNY A;  3PSI A;  4ZDO A;  4BDZ A;  2IGN A;  3OYN A;  5TGT A;  1Y56 A;  1QHG A;  2VPL A;  2X85 A;  4FET A;  3AKZ A;  3SZG A;  2CFO A;  2WAQ A;  2ZFU A;  4IX7 A;  2WAF A;  1UG0 A;  3S3N A;  3L2W A;  4RM3 A;  4RM2 A;  4DBR A;  3OL4 A;  3OYI A;  1X4P A;  1WJB A;  3CMM A;  4XN3 A;  2QKM B;  3OIQ A;  1X1A A;  2K3P A;  1D0Y A;  3DTK A;  1ERD A;  1QHH D;  4PFP A;  3K4C A;  4F91 B;  2DXI A;  2JSP A;  2XAU A;  3NWS A;  4B44 A;  4E4H A;  1Y6I A;  3A4C A;  3QOE A;  4F55 A;  4E7K A;  3DPL C;  2R7T A;  2AQF A;  1KON A;  1Z7L A;  2X6Y A;  3PNV A;  3HPH A;  4KJZ A;  3OYF A;  4E7L A;  3CES A;  2M7B A;  2LY2 A;  1X1C A;  4J00 A;  2R7V A;  2BOL A;  1QU3 A;  2JUG A;  4CUG A;  3VWB A;  3BG6 A;  3EUH C;  3S32 A;  2BVL A;  2MD0 A;  1N75 A;  4BS9 A;  3CP8 A;  4R79 A;  4PFO A;  1D1B A;  3QYE A;  4PSW A;  3OS0 A;  2IS1 A;  4P5O A;  4RLF A;  2M4K A;  3TBI A;  1LDK B;  5HNF A;  2VQL A;  4BL0 B;  2P0W A;  3LSG A;  3HC7 A;  3D5L A;  3ZCO A;  4B3X A;  4Y4R A;  4E6K G;  2V1N A;  3ZRG A;  2V9K A;  2CV2 A;  3VYR B;  4BJT A;  2WBM A;  2HVR A;  3M8J A;  3OYM A;  2NOJ B;  3TMO A;  3W2W A;  3CZ6 A;  3K4J A;  4BGD A;  1D1C A;  2KRH A;  4XM3 A;  4EAT A;  4HNU A;  2WAD A;  2R7X A;  4BJ5 C;  1PYV A;  2KL4 A;  3DQV C;  3LL7 A;  3OYL A;  1HA8 A;  2A6T A;  2X51 A;  2JVG A;  2K9M A;  3SYT A;  3HKZ A;  2V4J C;  3VYS B;  3GBG A;  2LH9 A;  4HPQ A;  2OUM A;  4E7H A;  3DTI A;  3MKY B;  1DP3 A;  2ZXH A;  4YEL A;  3E0J B;  3CJQ B;  3H9Q A;  1FMV A;  3L2U A;  5CQG A;  2VJ4 A;  3PNT A;  3OS1 A;  4XKC A;  4BE0 A;  4AU7 A;  2MFZ A;  1WJD A;  3CF2 A;  5FRN A;  2M7A A;  3A2K A;  4B48 A;  3LSM A;  3DLA A;  4XL9 A;  4ZDP A;  3F9K A;  2KLO A;  3K6G A;  3MKZ A;  2E1M B;  3U21 A;  4FAS D;  3K4B A;  3L2V A;  4NQW B;  2CS3 A;  5KCM A;  2DOA A;  4HG2 A;  4NC8 A;  3H5R A;  3N05 A;  1DGW Y;  4JOM A;  3PJR A;  3C2H A;  2HNH A;  3S3O A;  2HQA A;  3CJR B;  3OYE A;  4DGW B;  4E7J A;  1YX3 A;  4IQ4 A;  3QYF A;  4Y33 A;  4F92 B;  4CCJ A;  4HNT A;  5HLT A;  1D1A A;  4CSW A;  4OAY A;  4YEJ A;  2X6X A;  4N4O B;  4XLA A;  2DT7 B;  1WJE A;  4XOR A;  4X0G A;  1SFK A;  4CCO A;  4XOP A;  1Z21 A;  4XLE A;  2IGK A;  2CV0 A;  5CPR B;  4OAZ A;  2DT6 A;  4XR6 A;  2XF5 A;  3DWL E;  3VYU B;  4LIV A;  2MAB A;  3VDX A;  3PFY A;  2IGM A;  3C2G A;  2LRD A;  2Z2S B;  1W36 C;  4C2U A;  3H5N A;  4ITV A;  5LD2 C;  3D5R C;  2IS2 A;  1EA3 A;  3OMY A;  3OR2 C;  2R7W A;  2WB1 A;  2RNG A;  4RMN A;  2GOM A;  1MMA A;  1Z3Y A;  4JQF A;  2VQH A;  3I3L A;  5HOO A;  1PJR A;  4G6T B;  4DJA A;  2FUG 2;  2ZXI A;  3DU6 A;  2HDW A;  5FRM A;  2LG4 A;  3D5S C;  4Y3O A;  4HEA 2;  3RSN A;  1D0X A;  2UUZ A;  3L2R A;  2RQQ A;  2DCE A;  2VIX A;  2KPM A;  4II2 A;  3I9V 2;  4NNJ A;  4XKB A;  3OYJ A;  2CW8 A;  1X4O A;  2KZV A;  3FDY A;  4F93 B;  3LSH A;  1X1B A;  4HSR A;  1BR2 A;  4XN0 A;  2UV1 A;  2VQG A;  2LY1 A;  4BQQ A;  3LMM A;  2HVQ A;  3SDB A;  4XLC A;  2VJI A;  2VL8 A;  4P1W A;  3MD2 A;  2PJR B;  3K70 C;  5KHD A;  2R4G A;  2V26 A;  4IKF A;  3H35 A;  4XLH A;  2Z1D A;  3DEE A;  3RPU D;  3W2A A;  1MMG A;  4ANJ A;  4PJM A;  2LYC A;  5KNL A;  2IS6 A;  2LOO A;  1LKX A;  2E5N A;  2W1O A;  2VLA A;  5LFA A;  1TZL A;  2A5W A;  1K6Y A;  1G8X A;  3OYB A;  4BAC A;  2BVM A;  1JI8 A;  1S9H A;  3DKX A;  2BW3 B;  4YRV A;  3OYC A;  1MMD A;  1TT0 A;  2MYS A;  4ZTF A;  3S3M A;  3UR3 C;  3E1S A;  2F4I A;  2MC4 A;  2OC6 A;  1P9Q C;  3QYB A;  2CW7 A;  3M1C A;  4B47 A;  2Z16 A;  4KT6 A;  4N4N B;  1NG7 A;  4HST A;  1GLN A;  2KRC A;  1MND A;  4U7B A;  3OYK A;  2VAS A;  3KX2 A;  1WJ5 A;  1X19 A;  2L7K A;  4C30 A;  1J09 A;  1OLT A;  1DGR M;  1NG6 A;  3BCA A;  3FBN B;  4ZTJ A;  5CKT A;  2L5Q A;  3NWT A;  1MNE A;  2WY8 Q;  3HPG A;  3KEY A;  4NUB A;  2V7F A;  4XNF A;  4ZC3 A;  1DQU A;  4D9J A;  2PMZ A;  1BR4 A;  2VKD A;  4BQN A;  2O5R A;  3AFH A;  4F3Q A;  4LIU A;  1X1D A;  2HPI A;  3VYT B;  2HZD A;  3ZQQ A;  4PJL A;  2M3A A;  2W7N A;  3QOD A;  3MMY B;  4ZJZ A;  4E7Z A;  5HNH A;  2GOX B;  3OWT A;  1U0J A;  3OYG A;  2K5C A;  4CCL A;  2OV7 A;  2I8D A;  3HG9 A;  2LBF B;  1BR1 A;  2KP6 A;  2XF6 A;  1R6R A;  3BCB A;  2LBF A;  1N77 A;  2VXD A;  4II3 A;  3PUB A;  3LSI A;  1V5G A;  4AVZ A;  4CCM A;  2K9L A;  2IS4 A;  3BC8 A;  3A1Y A;  1LFP A;  3ONQ A;  2IXS A;  1MW7 A;  2KMU A;  2KHM A;  3L2Q A;  1MMN A;  1YX5 A;  1ZEL A;  3K4L A;  2W82 A;  3BG7 A;  4CCK A;  3HOS A;  4QPO A;  1D0Z A;  4H4K C;  4PK4 A;  2Q2E B;  4BEH B;  3OOU A;  1YE9 A;  3G2B A;  4BEH A;  4ZYA A;  3OS2 A;  2CMP A;  3FHN A;  3OIP A;  3FBI B;  3IAS 2;  1WJA A;  4KIT B;  3HOT A;  4BE1 A;  1N78 A;  1WJC A;  4PJN A;  3K4M A;  4PUS A;  4QPQ A;  3PL8 A;  3DKY A;  3RQ4 A;  2Q1Z B;  3IP4 B;  2HVS A;  4DIQ A;  4C2T A;  4D1Q A;  4ZDL A;  1SAU A;  2AQE A;  3FKJ A;  2CUZ A;  2QKL B;  3H5A A;  4XON A;  4CZC A;  4XLF A;  2KQR A;  1UEL B;  2L9S A;  4CH7 A;  3LFU A;  2X1C A;  2VQC A;  4BDY A;  2ELJ A;  4F52 A;  4J01 A;  3ZXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...