5FFXA

S. aureus mepr g34k mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
138
structure length
138
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQKHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords MarR family regulatory protein
publication title S. aureus MepR G34K Mutant
rcsb
source organism Staphylococcus aureus
total genus 54
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5ffxA00
3D0SA 1IF1A 3R4KA 2STTA 3KFWX 3HYIA 4JK1X 3C18A 4HF0A 4RGXA 4HX8A 1DP7P 2PMUA 1RIOH 1TQIA 2KJCA 2F5DA 3HHHA 1PP7U 5BS6A 2MLKA 1TNTA 4RGRA 3CJNA 1O7LA 3WTTC 3MWMA 2XUBA 2L54A 1R23A 5E8GA 1XGNA 2NS0A 1F4KA 3O3KA 5LRSA 1YTYA 4YFNF 4UVAA 5EEGA 4EQQA 3WODF 2VBZA 5LLQA 2Y75A 3TDZC 3TKYA 5HLIA 4M72A 1TLHB 2P6TA 4KMUX 1T38A 2MH9A 2M8EA 2MA3A 3KE2A 4RS8A 3HOSA 1JHHA 4G9YA 2PG4A 3HHGA 2JZYA 2EFQA 2KIUA 1FYLA 1O3TA 1B9NA 2EFWA 3JSOA 3KP6A 1YO5C 1RI7A 4UV8A 4WXHA 2MH2A 3VB2A 5F1RA 1T2KA 1B4AA 4A6DA 5DCFA 3LA2A 3MFKA 1H9TA 2V9VA 1WKMA 1EH6A 3WG9A 1QZZA 2VE9A 2VBYA 3I64A 4KIFA 1HXDA 2GWRA 1USSA 1ZRFA 2ZXJA 3M8EA 3QRFF 1BOAA 2LF7A 3WTUC 1KU9A 3GO5A 3F6VA 2ZBKA 1D3YA 4P9UA 2O61A 3MZYA 4L0YB 3J81K 5L3BA 5CVRA 1XGOA 2DU9A 2IA2A 1B59A 2Y0MA 4BHPA 1BI1A 3J7AO 5E8IA 1WWXA 2ISZA 4EJTA 2PMHA 1U8RA 2OZUA 1ZAOA 1S7AA 2M1BA 3RKWA 4Q5SF 3HSRA 1O3QA 2STWA 4BHCA 3LQRA 3CO7C 1YW9A 1ZG1A 4S04A 3ZN1A 3I53A 3GZ5A 5DUIA 3RTRA 2DAOA 5E1WA 2P5KA 1RNLA 4GXOA 1HKQA 2EK5A 2J5PA 3I54A 1FPQA 1W7PD 5E20A 4S05A 1L3LA 2JT1A 5D8LB 4IRHA 2EV6A 1SFEA 2RC4A 5DDGA 3T1BA 1S3JA 3WU1B 3ZPLA 4PGGA 3N4MA 3FWEA 3GW2A 2CW0F 3QP6A 3K1NA 3GFMA 4FX0A 1QQIA 1IN5A 2BBYA 5IT9K 2PN6A 3HRTA 5J8FA 2XASA 4F7ZA 3OOPA 3QU6A 1I6XA 4E70A 4U0VA 1ZG3A 4N0BA 1FNNA 1YLFA 3KP3A 4HA8A 1PDNC 4LG0A 5H20A 1KA8A 4H0EA 4UXNA 1U6GA 3P9KA 3GWZA 1KU2A 2J5OA 2XHKA 1HSJA 3BWGA 2EV5A 1ON1A 3V8KA 2O6GE 1FSHA 4MEXF 1LVAA 4I7HA 3E6MA 4BXUA 1ZYRF 4ZYEA 1R36A 1WRJA 2GZWA 2RN7A 1FBUA 3PFIA 1NHAA 1MZBA 2FBKA 3O2PE 3VFZA 3J80Z 1P92A 5FLXK 3ELKA 2DW4A 5AIQA 1Q1HA 4EM0B 1O3SA 5L3DA 3RPQA 2NNNA 3JTGA 1IN6A 1IW7F 2A6EF 3G3ZA 3BY6A 3LWFA 4IXAA 2DK8A 2X0LA 2QUFA 3KZZA 2IA0A 4ZZDA 1F5TA 1AOYA 3K69A 2P5VA 3FMRA 4OIRF 1R5GA 1FWZA 5ERIA 4LK1F 4Q4ZF 1Z9CA 2E7XA 1QPMA 4HLXA 5ILVA 1R1VA 1FBSA 3FMSA 3P7NA 3DP7A 1JE8A 1I27A 4EJVA 2LSOA 1DDNA 3SQNA 2A6HF 4U7DA 2WC2A 5DCMA 3JAMK 2UXXA 4AVPA 2HR3A 1J75A 1RUNA 1W5SA 1XB4A 1KU7A 1Z6TA 4A12A 4XLPF 1DPRA 5LEKA 4MTDA 2FU4A 3V7SA 2M87A 3SZTA 2VXZA 3HTUA 3BPVA 5FFZA 4MTEA 4HF1A 1GXPA 1KYWA 3BDDA 1MKMA 2O0YA 1FP2A 4LB6B 4UNOA 2Z9OA 2XIGA 2L4MA 1QGPA 5ILUA 2BE5F 3IRQA 3SFZA 1F1ZA 4ESJA 3HRUA 1MDMA 2HQRA 4EJUA 1B9MA 4L5JA 5F64A 2CSOA 2KRFA 2PLYA 4EGYA 1BM9A 3L9FA 3RYPA 4A5MA 1EV7A 4BH9A 3WTWC 2VT3A 2VC0A 1O57A 2E1CA 5DUKA 3OV8A 2ZNZA 1UFMA 1BI2A 3K2ZA 4Z2YA 4LG0B 4U0YA 3U1DA 5E18F 2DBBA 2FBIA 4LK0F 4G7ZF 1T6SA 3B73A 1PUEE 3LA3A 3IWZA 2Z33A 1XMAA 4ZH4F 1HQCA 2QQ9A 3I59A 4HBLA 1XSDA 3WU0A 3JW4A 1DPUA 1ULYA 4HQMA 4I0AA 3F8MA 1FY7A 1F9NA 2W57A 4HF2A 1K6OA 3ECOA 1IN4A 2FA5A 4Q48A 3ABUA 3ISPA 1YQAA 3CLOA 4U0WA 3P9IA 2RVCA 2ACJA 2FNPA 2HTSA 1UB9A 1OPCA 3J81Z 2OQGA 3IKTA 3K9TA 3GFJA 2G7UA 3K1PA 4LLNA 3KEOA 1IXCA 4I02A 1J7KA 4Y17A 3FXQA 3MAJA 2FQ3A 3RPUA 4YG2F 4N9IA 2FRHA 1OYYA 4I98B 4GYIA 5A2QK 2GXBA 2W25A 3QOPA 5KK1A 2QQBA 4HW0A 1Y0UA 4IF4A 3HIFA 1ZN2A 3E6DA 4PDKA 4L9NA 3LFKA 5D6FA 2XV4S 3RKYA 4RB3C 4KDPA 4KT5C 4HV6A 4FX4A 5DCMB 2D1VA 3W6KB 1QNTA 1FT9A 1ZHFA 1SD5A 2V79A 1ON2A 2WTEA 3M8FA 3ML6A 4EJWA 2O3FA 3FZVA 1FC3A 1R58A 4XSXF 5K5RA 1VTNC 3HSFA 2WWYA 2YSRA 3NQOA 1HW1A 4U7BA 4HYEA 4D0PA 2F5EA 2K86A 3GLXA 3H92A 2LF8A 1OKRA 3K0LA 1UHWA 2D45A 2IRFG 2BEOA 2QBYA 4M73A 1Z1DA 1XCVA 1USTA 3F22A 1MDMB 1FBQA 1X3UA 3C7JA 2P7CB 1IRFA 2K27A 1TW2A 1AWCA 5LGUA 1SFUA 1KQ0A 2NRAC 4HX4A 2FNAA 1J0RA 2O8XA 4AWXB 2CGPA 2BGCA 2QLZA 2Y48A 3LQQA 5ED4A 1BIBA 3WGGA 2XAGA 2Q2EA 4OOIA 1XDUA 5D5WB 5FGMA 2Z99A 4ENMA 1O3RA 5FLXZ 5D4RA 1L0OC 1ZARA 3I59B 3V7RA 2PBIA 2VE8A 2OAZA 2DLLA 3EDPA 2CO5A 2ESNA 4O3MA 3KCCA 3IRRA 2VOOA 1BBYA 4B8XA 1MJ9A 1K79A 1IRGA 4G8XA 3L00A 3V4GA 3ZMDA 2VT2A 2ZKZA 1Z05A 3BP8A 4PCQA 2VODA 2EFNA 2G7HA 4I0BA 4UHTA 3WE2A 3B02A 3DQVC 2TDXA 5D5VB 3E97A 1FYMA 2ELHA 2DQLA 2MD5A 2KJBA 3LAPA 1STZA 2L02A 2DPUA 3JAMZ 4LB5A 1I1SA 1XCBA 1T39A 3GYHX 4CZZA 1R1UA 5LEJA 1P4XA 2EFPA 1IN7A 4ZYGA 3L2CA 2CYYA 2H6BA 4ON0A 4MQ9F 2IVMA 5ICEA 2MBFA 1S8NA 1YIOA 4PGHA 1BC8C 4ASNA 2QENA 4ZYDA 2CFXA 5FB2A 2H09A 3Q9VA 3AAFA 3HRSA 4BQAA 4AD9A 3MQ0A 4KIBA 1MD0A 3BJAA 2COMA 3TO6A 4U88A 5D8KB 2VOPA 1YS7A 4LJZF 2JTVA 2IW5A 3QPHA 4XSZF 3U2RA 4EV0A 5LHGA 1HW5A 4EM1A 5FFXA 4LLGF 1FZPB 5JI6A 3KZYA 5FO5A 2ZFWA 4KNYA 5HS8A 2QQAA 4UVBA 3TQNA 3LA7A 4UUVA 5BMZA 1LDKB 4O6JA 4L9JA 4BAYA 2QBYB 4I2OA 3HRMA 2FEZA 3SHFA 4UV9A 2A68F 4IHSA 2PJPA 5DEQA 1KQ9A 2XAHA 2XRNA 1BN5A 4L18B 5H6QA 2OQRA 3KLOA 4CDGA 4M9ZA 5JHUA 5HLGA 1G3YA 2R7FA 4HAMA 5D4SA 4KA4A 3GVAA 2JPBA 3QAHA 4ENJA 3T5XA 3C1DA 2MC3A 1R22A 3JSPA 3ROUA 2UWMA 3DPTA 1LDJA 4IRIA 2G9WA 3H3ZA 2VBXA 4HOBA 2BV6A 3HUGA 4G6DA 1D8KA 2RGVA 2HZTA 2QVOA 5LBQA 5KVRA 4ZZLA 5IT3A 4RAYA 5J6XA 4K2EA 1YFHA 2YU3A 3K1MA 5LGTA 2GIVA 2LDUA 3WGIA 3L7WA 2ZMEA 2A07F 1J5YA 1PP8F 2W24A 5A2QZ 4ENNA 2RV8A 3WE3A 3FM5A 2P6SA 2RQPA 3FHZA 3M1EA 2W84A 3E6CC 1ZLKA 4P96A 1FLIA 4I01A 4BHBA 1GVJA 5CVIA 2XGXA 2A5YB 2XAFA 5AIPA 3FXRA 4Q47A 4IVNA 5L3EA 2E7WA 2ZCWA 1W7PA 3WTSC 2HTJA 3DPLC 4N9HA 1Z6RA 3LAJA 4G7OF 4CGZA 1RUOA 4CICA 1W5TA 2ZJ2A 1ZG5A 2OZ6A 1J2XA 1P6RA 5FD6A 1B1BA 1D5VA 2PI0A 1FSEA 2X4HA 5L3FA 3RKXA 2M30A 2H94A 1SAXA 2YX4A 4RB0A 3NRVA 1E2XA 2JPCA 3Q9SA 4JBAA 2V1XA 3IWFA 1IXRC 5D5UB 1I1GA 2PQ8A 1OR7A 1BI3A 4YIIA 3EUHA 3E3VA 1P2FA 3KEQA 3MCZA 5K5OA 1LB2A 2R7DA 1G4DA 3CO6C 1R7JA 3NEUA 3FMQA 1MJAA 1A04A 2ISYA 2RNJA 1LJ9A 4GGGA 4M74A 4R1HA 1J9IA 1LQ1A 2K4JA 2OU2A 2L3DA 3F8NA 2YPRA 2FSWA 1Z7UA 5AONA 4A0ZA 1CF7A 1ZREA 4B09A 1BI0A 4KN4X 1V3FA 2EA2A 2XAQA 4AIHA 2HKOA 2VBWA 1U3EM 5BPIA 4QWQA 4JQFA 4A0YA 3R0JA 3T0YA 2HFHA 2AS5F 1G6NA 3CUQC 3E5QA 1WI9A 2DPDA 1XN7A 3KP7A 2L4AA 1IUYA 5J8CA 2ADUA 3FXUA 2EV0A 4OU0A 3S2WA 1S6LA 4WX9A 2F5FA 4L5IA 3R6SA 1O7FA 2M45A 4HZFA 4OIPF 4XRFA 2XVCA 3QPTA 5CJ9A 3GUDA 2VONA 4M71A 1IXSB 4P5OA 3U9GA 2CWEA 3KP4A 2PEXA 3DF8A 3KLNA 2XKPA 5DD8A 4OINF 3DKWA 3Q5FA 3CUQA 3ZQ7A 2V6CA 4M6YA 3T8RA 1MJBA 2ZMEB 3ZMTA 2WV0A 3R0AA 4P9FA 3GFIA 3QU3A 1C0WA 4A6EA 3E5UA 4LGWA 1QZYA 4L9TA 3WTVC 2P8TA 4MGRA 4YFKF 3GF2A 1WQ2A 4WXDA 4AIJA 1P4WA 4GCVA 4O5VA 1W7PB 1SMYF 4RGSA 5CVJA 4DNCA 3HTSB 1YG2A 5HDNA 4FT8A 1T98A 2EWNA 3ZN0A 1ONVA 4CXFA 4MNUA 5IT9Z 2O03A 3T8TA 2XROA 4R79A 2DFIA 3BOQA 3M9AA 2UZKA 3L09A 3PQJA 4KFCA 4G7HF 4HV5A 2A61A 3VODA 5ICGA 4RB2C 2IPQX 2FF4A 3QP5A 1U2WA 2HS5A 4PZJA 5HOOA 2EA4A 5E17F 2CG4A 5HDGA 3WGHA 3REOA 5JVTA 5DD4A 2QYOA 1LEBA 3W6JB 1BC7C 5D6EA 1XSXA 3ZMSA 2H27A 2XKOA 5K1YA 4ESBA 1HKSA 2ZO4A 3BPXA 3F8CA 1XD7A 2VC1A 2P5LC 5L3GA 2V1DA 2BYVE 4I09A 3RYRA 1FYKA 3DXJF 2HQNA 4MHGA 4WWCA 4Y13A 1XGSA 1CF7B 3I4PA 4WK8F 3TOBA 4RAZA 2IP2A 4EGZA 1R00A 3IC7A 2IT0A 3DV8A 4R8HA 2FXAA 1KGSA 5ILSA 3F3XA 4HX7A 4EM2A 5E1XA 4CHUA 3SZPA 1DUXC 1GXQA 1JGSA 2IJLA 2MLGA 2R3SA 3R61A 2W85A 3IHUA 3I5UA 1S29A 3HSEA 4MQVA 2Q0OA 6PAXA 3EETA 3ECHA 1J59A 1E17A 5BOXA 1JHFA 2DI3A 2YX7A 1FP1D 2HOEA 4LFUA 3CTAA 3GEZA 4OIOF 1SFXA 5DYMA 5ICCA 3CUQB 1V4RA 2DO7A 1H9GA 2DTRA 5CLSA 1ODDA 4ETSA 4DQ2A 3G73A 1BIAA 2FE3A 5LGNA 4WXCA 3F8BA 3TGNA 4WF2A 1K78A 1TBXA 1FOKA 3LSTA 1K7AA 3I58A 4KICA 4WCGA 1G3SA 1ZRDA 4GYGA 2Z3YA 4EJOA 1TNSA 1TTYA 4ZYHA 1HSTA 2NAZA 3BJOA 1B6AA 2RKHA 4NQWA 2B0LA 2NNYA 3I0TA 4HQEA 3SXYA 3RI4A 1LDDA 3VOEA 2OD5A 5E1ZB 3ZMZA 3VEPA 5F6FA 3KETA 4NHJA 3TO9A 2GAUA 2A69F 3TDUC 2D1HA 2GXGA 4IHTA 1TQMA 5LHIA 3F72A 2HEOA 5K5QA 3RJPA 3V8JA 4KYWA 1U5TC 2K02A 3KP5A 3RDIA 2C6YA 4M6XA 2CQKA 3IL2A 2VN2A 4CO8A 3F23A 1W4MA 4NB5A 2EFOA 4KIGA 2JSCA 4KN7X 1GHCA 1G3WA 3FF5A 3BROA 5TJJA 4A2UA 3PQKA 2M5WA 3HOTA 1SD6A 4ENKA 1UHMA 1YYVA 2L01A 2PFBA 2KIMA 2HGCA 1U5TA 3TO7A 1YW8A 2F5CA 3H3UA 5CYVA 3O6BB 4HLYA 2H6CA 4HDVA 4RB1A 3GFLA 2K7LA 1ZGAA 4KMFA 1LNWA 1G3TA 1WSUA 5BQTA 3F8FA 4M9XA 4YIFA 2QWWA 3DFGA 1XMKA 1ZLJA 2D2WA 1QBJA 3V8LA 2HYFA 4GO1A 1ZRCA 1UCRA 3E6BA 1ZGJA 1T0FA 3KP2A 5JR3A 3MEXA 2Z5UA 5DV5A 4YFXF 2FMYA 2P4WA 3BJ6A 4OMYA 2E1NA 1SMTA 5HLHA 1QO0D 4G6QA 4LMYA 5HVQC 3ERED 4A5NA 4TV7A 1P4AA 3WTXC 2EB7A 3M7GA 5ICFA 2FBHA 1LEAA 3R60A 2YR2A 2V1UA 2KIFA 3C3WA 5TRDA 3ABTA 4OIQF 1OMIA 5HS9A 1K78B 5HS7A 4OMZA 2XAJA 3WTYC 2GA2A 3I71A 1Z91A 3IKVA 2LNBA 1KQ8A 1SD7A 2P7VB 4EMSA 2HDCA 4IPAA 4XLNF 1D8JA 2QZ8A 3ULQB 1KU3A 4IRGA 1BJAA 4P55A 4IJAA 2GQQA 1OYIA 5EEHA 2QM3A 5L3CA 3FX3A 2K4BA 5FD5A 2NYXA 4XBFA 2GA1A 1MGTA 3EYYA 1SD4A 1YS6A 1YW7A 2DT5A 3V7CA 4AIKA 4G94A 3F21A 1R1TA 5HDKA 1IAWA 3WTZA 3F6OA 1JXSA 2EJRA 1ZH5A 1XSVA 2HYGD 2HKXA 5CVUA 3EQLF 1OYWA 1FX7A 2KKOA 3ZP5A 1KYZA 4A0XA 1XDSA 3EYIA 4LD5A 1HW2A 4UVCA 3N97A 3TOAA 4BNCA 4RGUA 3D5LA 1IN8A 2FMLA 2FOKA 2ETHA 2OA4A 4CYDA 2DQRA 4M9SA 2OBPA 1CGPA 3COAC 4EVIA 3DEUA 4FHTA 1H0MA 4HDUA 1HKTA 4KUMA 1U5TB 1EH8A 4LLLA 3GZ6A 2ZNYA 4L0ZB 3RIRA 2DK5A 5LRRA 3CUOA 2ESHA 3BZ6A 1EH7A 2F2EA 5D5XB 3MZHA 3ZMVA 5H6RA 5CVVA 4Y15A 2AXLA 2RDPA 4MEYF 3J80K 2HWVA 1TW3A 2UXNA 1XGMA 3GX4X 1HBXG 3FM3A 3CDHA 3E5XA 2A3SA 2LKPA 2JRTA 3JTHA 4ESFA 1REPC 3P9CA 4L9VA 2IA1A 4QLCU 1I5ZA 1R5HA 1S7OA 1TQPA 3GXOA 1RZ4A 5LHHA 3ZMUA 2Q8KA 5JFRA 1IZ1A 1U78A 4BYYA 5BPDA
chains in the Genus database with same CATH superfamily
3D0SA 1IF1A 4IKFA 3R4KA 1D1BA 1U8BA 4P1WA 2STTA 3KFWX 4LIUA 3CZ6A 3HYIA 3C18A 4JK1X 4HF0A 4PSXA 3WHBA 2H1KA 1IUFA 4RGXA 1JJ6C 1TWFJ 3NAUA 1FTZA 4HX8A 3A01B 1BR1A 2HXOA 1E3PA 3CJTB 1DP7P 3JRGA 4A3IJ 2R7XA 2PMUA 2EZHA 1RIOH 3S15J 3DU6A 1TQIA 4FTHA 2KJCA 2F5DA 3HHHA 1PP7U 5BS6A 2MLKA 3GTJJ 1UAAA 2UUZA 1TNTA 3W3CA 2DYSH 4AIDA 3M1CA 2K9SA 4RGRA 2X9DA 3CJNA 3WU2C 5M3FJ 5K7FA 4F91B 2IGKA 2CW8A 1HDPA 2ZSHB 4IL6C 3ONQA 4IQ4A 1O7LA 3DBLB 3WTTC 2VKVA 3MWMA 3GLLA 1A5JA 2XUBA 2L54A 2NS7A 2CU7A 1R23A 3SDGA 2DA1A 5E8GA 1XGNA 3M3YJ 2MD0A 2NS0A 1F4KA 1BA5A 3O3KA 2E19A 5LRSA 3OIQA 1Z7LA 3VPRA 1N25A 1R4MB 2MC4A 1YTYA 3FKJA 1ZKGA 4YFNF 1YITI 4UVAA 2GOXB 5EEGA 4A93J 2DOEA 4EQQA 3WODF 3PO2J 3BCBA 3AG4H 2VBZA 3S3NA 3ZRGA 1MBGA 2X6WA 1HDDC 3HOVJ 2AQEA 1AKHB 1JI8A 1VNDA 5LLQA 2Y75A 3TDZC 3K6GA 3TKYA 2ZJRF 2E71A 5HLIA 4M72A 1TLHB 3TP0A 2P6TA 1MH4A 4KMUX 5J1YA 1T38A 3LL7A 4LIVA 3H5RA 2Z2SB 4XRSG 2MH9A 2M8EA 3GMEA 1SEUA 1Y0NA 3HJEA 2MA3A 2BY1A 3CP2A 2QSHX 2DA5A 3KE2A 4RS8A 2JUGA 3HOSA 4HNVA 1JHHA 1WJCA 2IGMA 2DYRH 2XSDC 4G9YA 2KMUA 2PG4A 3HHGA 5C4JJ 1ZTRA 5F0FA 2JZYA 2EFQA 2KIUA 4XL9A 1FYLA 1O3TA 1IGNA 3GTLJ 1B9NA 2EFWA 4DBQA 2XF6A 2DTZA 4C3IJ 3JSOA 3KP6A 1YO5C 4C2TA 1RI7A 4UV8A 2DMNA 4WXHA 2MH2A 3VB2A 5F1RA 1T2KA 3K4JA 1B4AA 4A6DA 2K3FA 2W00A 4Y4RA 2ZJQF 3QODA 2F4MB 5DCFA 2QCOA 3LA2A 3MFKA 1R5ID 1H9TA 2LMDA 1VQ5I 2V9VA 2M0MA 4NNJA 1WKMA 1EH6A 3WG9A 2KP6A 1QZZA 2VE9A 2VBYA 3I64A 1VQ6I 5GAGJ 4KIFA 3DTKA 5FKOA 1FOYA 2KDOA 3CCRI 4DJAA 1HXDA 4NC8A 2GWRA 1USSA 1ZRFA 2DA2A 2ZXJA 3BR2A 2JQ7A 3M8EA 3QRFF 1T33A 1BOAA 2LF7A 3WTUC 1KU9A 2PX9A 3K4LA 3GO5A 3H1CA 3F6VA 2ZBKA 1D3YA 4P9UA 2E1OA 1WJ5A 3MZYA 2O61A 3U21A 4L0YB 3J81K 2MG4A 3MN2A 4BKXA 5L3BA 1YRNB 1J09A 5CVRA 1XGOA 4Y3OA 3E1SA 3HOZJ 1MMAA 2DU9A 2HNHA 3SFIA 1H8AC 2IA2A 1B59A 2Y0MA 4BHPA 3M07A 1BI1A 4BQNA 3J7AO 5E8IA 4UUSA 1WWXA 3FDYA 3BR1A 2ISZA 2ECCA 4EJTA 2PMHA 1U8RA 1KONA 2OZUA 1ZAOA 4BXFA 1S7AA 1UMQA 2M1BA 2QKMB 5TGTA 1G2HA 2JJ7A 3RKWA 4Q5SF 3HSRA 1O3QA 2STWA 4ZTFA 1MNMC 4BHCA 2OUMA 3LQRA 3CO7C 1YW9A 4BBSJ 1NK3P 2R93J 4DZPA 2E36A 1ZG1A 2X1EA 3IUOA 1D1AA 4S04A 3ZN1A 4CCLA 4DGWB 3I53A 3GZ5A 3Q0UA 2AO9A 4XLAA 3J7AY 4NUBA 5DUIA 2DT6A 4E7SA 2DA3A 3RTRA 2ELJA 2DAOA 3G2BA 5E1WA 2P5KA 1TP4A 1RNLA 3GBGA 4GXOA 2ME0A 4A3KJ 1ETXA 2BZTA 1HKQA 2I5UA 3BTIA 2KLOA 5EYRA 2EK5A 2MFZA 5J47A 2J5PA 2R0QC 2CUFA 3I54A 5IYBJ 1QVTA 1FPQA 1W7PD 1N78A 5E20A 4S05A 4A69C 2XPUA 4RAFA 1L3LA 2JT1A 4XORA 5D8LB 4XIDA 4IRHA 3JRBA 4C30A 3H0DA 2EV6A 4I76A 3ZXSA 4BS9A 1IRZA 1LFUP 1SFEA 1JKQC 2RC4A 1JUMA 3T1BA 5DDGA 2CH0A 4FISA 1S3JA 3WU1B 3ZPLA 2HOSA 4ZYAA 1OCOH 4PGGA 3N4MA 2HVRA 3FWEA 2GBYA 2CW0F 3GW2A 3QP6A 2ZJPF 3K1NA 3GFMA 4FX0A 4RDUA 1QQIA 3C2HA 1IN5A 2BBYA 5IT9K 2PN6A 3HRTA 5J8FA 4IOAF 1Y1VJ 2XASA 3QPLA 3OWTA 4F7ZA 5FKLA 3OOPA 2DDBA 4II2A 1TWGJ 3QU6A 2XAUA 1I6XA 3AG1H 5K7ZA 4E70A 1K4TA 4U0VA 1ZG3A 3GTGJ 4N0BA 2LVSA 1FNNA 1RRJA 3CC2I 1YLFA 3KP3A 4HA8A 2DOAA 1PDNC 3RKQA 3QYFA 9ANTA 3OS2A 4LG0A 5H20A 1KA8A 5J4YA 4H0EA 4UXNA 4KITB 1JT6A 1U6GA 2R5YA 3P9KA 3L2RA 3GWZA 2LP0A 1KU2A 3OYBA 1A31A 2J5OA 2XHKA 4MFEA 1R6RA 1PVEA 1Z67A 2ZSIB 1HSJA 3CMYA 2DJNA 2VXDA 3BWGA 2EV5A 2HDWA 1ON1A 3V8KA 2KRHA 5B66C 1Z77A 2O6GE 1FSHA 4MEXF 1LVAA 4AC0A 2H8WA 3KX2A 3HG9A 2GLOA 4I7HA 4MFDA 5EGOA 5M3MJ 5EF6A 1UJ8A 3E6MA 4BXUA 2F4OB 1ZYRF 4ZYEA 4F52A 2PJRB 1R36A 3CCUI 1ZR2A 3FK6A 1WRJA 2GZWA 2ZXIA 2RN7A 4KISA 1FBUA 3PFIA 2CV2A 2XGCA 1NHAA 1MZBA 3K4KA 2FBKA 3O2PE 3VFZA 1APLC 3J80Z 1P92A 4E7JA 1XTAA 5FLXK 3ELKA 2DW4A 3VYSB 1WJBA 5AIQA 1Q1HA 4EM0B 1O3SA 3LOCA 2CQXA 5L3DA 3RPQA 2NNNA 1ZK8A 1U0JA 1ZELA 2XB0X 5GADJ 3JTGA 1IN6A 1W1WE 2NVUB 1IW7F 2A6EF 3G3ZA 1VQ9I 3BY6A 1EF4A 1YIJI 1OCTC 3LWFA 4IXAA 3CCSI 2DK8A 2IGNA 2NVQJ 2X0LA 2QUFA 3KZZA 2IA0A 4ZZDA 1GV2A 1F5TA 3CF5F 1AOYA 2VQGA 4ITVA 3K69A 2P5VA 3FMRA 1TT0A 4YIRX 4OIRF 4QPOA 1R5GA 3BR0A 4B43A 1B72A 3GTMJ 4G6TB 3FXKA 4C3HJ 1FWZA 5ERIA 4LK1F 1RPWA 4Q4ZF 1Z9CA 2IEKA 3I9V2 2E7XA 2HOTA 2JMWA 1TWHJ 3CMEI 2TRTA 2VQLA 4UUSB 1QPMA 3I4NJ 4HLXA 5FROA 1A6QA 5ILVA 5FJ8J 1R1VA 3N05A 2L7KA 1FBSA 3BZKA 3FMSA 1WHUA 3P7NA 3DP7A 2GM4A 1JE8A 3Q0WA 1I27A 4EJVA 1E3OC 2LSOA 1DDNA 3SQNA 2A6HF 4U7DA 1ZR4A 4PUSA 2XF7A 4A3LJ 2WC2A 1IV6A 4BJ5C 2M4GA 5DCMA 3JAMK 2UXXA 5EZHA 4DIQA 1JKOC 3MKZA 1FIPA 4AVPA 2HR3A 3K7AJ 3BQYA 1J75A 1RUNA 3ABLH 3ZQHA 1W5SA 1XB4A 3H9JA 1KU7A 1Z6TA 1VF9A 4A12A 3BG7A 2M3AA 4XLPF 1DPRA 4BQQA 5LEKA 4MTDA 2M2EA 2FU4A 2PMZN 2IXSA 3V7SA 1VZ0A 2Y30A 3DLAA 2LKSA 2M87A 3SZTA 2VXZA 4HG2A 3HTUA 3BPVA 5FFZA 4MTEA 1WJFA 2XF5A 3QWLA 4HF1A 4AM3A 2OCEA 5E3NA 1GXPA 1KYWA 3BDDA 1ETYA 2R7TA 1MKMA 1X2MA 4KT6A 4ZTJA 3ZQLA 2O0YA 1FP2A 4LB6B 4RBOA 2HPMA 1H89C 4UNOA 2Z9OA 2G0EA 2XIGA 3QOEA 2L4MA 1T8IA 3CP8A 3ASNH 4XKBA 1QGPA 4AUXA 5ILUA 2ID3A 2UV1A 2Y0SN 3IV5A 2BE5F 2M7BA 3IRQA 3SFZA 3ZQCA 5IP6A 2M4KA 1F1ZA 2OV7A 2EQRA 1NTCA 4ESJA 3HRUA 1MDMA 2HQRA 4EJUA 1B9MA 2KZVA 1MBKA 2VJJA 3L2QA 4L5JA 3HOWJ 1FEXA 3KZIC 5F64A 3L2UA 3PO3J 1RETA 2CSOA 2KRFA 2PLYA 2R7WA 1BM9A 3L9FA 3RYPA 4A5MA 4EGYA 1EV7A 4BH9A 3CMAI 3SZGA 4PFOA 3WTWC 2OTJI 4B3AA 2VT3A 2VC0A 1O57A 2E1CA 4LOCA 2NVXJ 4CSWA 5DUKA 4BGDA 3OV8A 1X1AA 2ZNZA 2DMPA 1UFMA 2VJ5A 1BI2A 5F27A 2Y69H 1GLNA 3K2ZA 4Z2YA 1LUJB 4M3EA 3FIWA 4LG0B 2TCTA 4U0YA 3U1DA 5E3OA 3CCQI 5E18F 4ANJA 4BQOA 3OL3A 2R5YB 3CDIA 2DBBA 2FBIA 4LK0F 4G7ZF 1T6SA 4UUTA 3B73A 5JHFA 1PUEE 3LA3A 3IWZA 2GIZA 2Z33A 1XMAA 3OYNA 4ZH4F 1X4PA 1Y8QB 1HQCA 3CF2A 3D5SC 2QQ9A 3I59A 4HBLA 5HLTA 1XSDA 4E7IA 3WU0A 1HF0A 2OC6A 1OJLA 3JW4A 1DPUA 1ULYA 4HQMA 4I0AA 4E7HA 3F8MA 5EGOB 1VQPI 1FY7A 1F9NA 2W57A 4HF2A 1K6OA 3MVPA 3ECOA 2HDDA 1IN4A 2FA5A 1OISA 5IY5H 4Q48A 4Y33A 3ABUA 3ISPA 5HNFA 3S1NJ 1YQAA 2DN0A 1TT5B 4XLCA 3CLOA 3OYJA 2JVGA 4XKVA 4U0WA 3P9IA 2RVCA 2KIQA 2ACJA 5FLVA 2FNPA 2AHQA 2KFDA 2JSPA 2HTSA 1UB9A 1OPCA 3J81Z 2IBDA 4GDFA 2OQGA 5DM7F 1LFBA 3O8GA 3IKTA 2NVYJ 4CCOA 1LVKA 1JTYA 3W6VA 3K9TA 2NS8A 3CCMI 1ZGWA 4CCMA 1FMVA 3VWBA 3J7ZI 3GFJA 2G7UA 3K1PA 2R7UA 4B4CA 4LLNA 3C2GA 3KEOA 1IXCA 2F6CA 4I02A 3CCLI 3CD6I 1I39A 3B6AA 1J7KA 4Y17A 3OMYA 1XG1A 3FXQA 3AKZA 4A3BJ 1MBEA 2L2OA 2QSFX 3DPUA 3AFHA 2LREA 4EATA 3MAJA 2FQ3A 1B72B 4X6AJ 3RPUA 4YG2F 4N9IA 2FRHA 1OYYA 4I98B 3CC7I 2Z16A 4GYIA 1F36A 5A2QK 2KDZA 4JOMA 2GXBA 2FX0A 2FQ4A 2W25A 3H0GJ 3QOPA 3GCMA 4IHYA 3E0JB 5KK1A 4A3EJ 2W1OA 2QQBA 1Z0XA 1D0YA 4EEFG 2LYCA 4HW0A 4F55A 3OOUA 1Y0UA 2K85A 4IF4A 3HIFA 4XLHA 1JKPC 1ZN2A 3E6DA 4PDKA 5GAEJ 2COBA 5C4XJ 4L9NA 3LFKA 2K9NA 5D6FA 2XV4S 1UELB 3RKYA 3OS0A 4RB3C 4CH7A 4KDPA 4KT5C 4HV6A 4FX4A 5DCMB 2D1VA 3W6KB 3RZOJ 5GTHC 1QNTA 4MLOA 3JRCA 1FT9A 1ZHFA 1SD5A 2V79A 1ON2A 2WTEA 1X19A 3LSHA 3HOYJ 1DQUA 3M8FA 1A6IA 1MNEA 2O3FA 3FZVA 3ML6A 2X6YA 4EJWA 2VUMJ 5F0HA 1ZQ3P 3I3LA 1FC3A 4BXXJ 1R58A 2ZXWH 4XSXF 5BNGA 3LSPA 5K5RA 2LD5A 1QU3A 1VTNC 3HSFA 5GAHJ 2YSRA 3NQOA 2WWYA 4XOPA 1HW1A 4U7BA 5B1AH 4J19A 4HYEA 4D0PA 3RZDJ 2F5EA 4PJ0C 2K86A 3GLXA 3H92A 4D5FA 5GPCA 4LG3A 3NWTA 2R4GA 2LF8A 1OKRA 3FKIJ 1DGRM 4A3DJ 4A3GJ 4BY1J 1UG0A 3AG3H 3K0LA 1UHWA 2R7SA 2DDAA 2D45A 2IRFG 3KYDB 2BEOA 2NXNB 1ENHA 2LKXA 2H1LA 4BE0A 4XKWA 2QBYA 3QYEA 2BW3A 4M73A 1D0XA 3BZCA 1Z1DA 3OSGA 5J40A 1XCVA 1WJEA 1USTA 3K70D 3F22A 3JREA 1OLTA 1MDMB 3A02A 3A0HC 1FBQA 1X3UA 2ECBA 2WV1A 3C7JA 3O8HA 4AYBA 2P7CB 4JX5A 3HZJA 1IRFA 2K27A 1SVOA 3A4CA 3EPZA 1TW2A 1AWCA 5LGUA 1SFUA 3VYRB 1KQ0A 2ZFUA 5M5YJ 1VQMI 2NRAC 3HB9A 5M5XJ 1X2NA 3S32A 5FKKA 3I55I 4JX6A 1XC5A 4HX4A 2FNAA 4XM3A 1J0RA 3H9QA 2B7EA 2O8XA 2LK2A 4AWXB 2CGPA 2BGCA 3PIOF 1FIAA 2QLZA 2Y48A 2QA4I 3LQQA 5ED4A 1BIBA 3WGGA 2XAGA 3HGYA 2Q2EA 2X6XA 4G12A 1XDUA 4OOIA 4A3JJ 5D5WB 3PNTA 3GZNB 5FGMA 2FOWA 2Z99A 3H35A 4ENMA 2X1CA 1O3RA 5FLXZ 5D4RA 2E34A 1L0OC 2M8GX 2OF7A 3LNQA 1ZARA 1D5YA 3I59B 3V7RA 2PBIA 2VE8A 5F1JA 2OAZA 4V2GA 3KIOA 4X1EA 3FXMA 4E7KA 1GVDA 2DLLA 1MH3A 2L9RA 3CDLA 2MYSA 3S3MA 3EDPA 5IPAA 2CO5A 2KPMA 2ESNA 4O3MA 3KCCA 2K9LA 1WH7A 2DMUA 3IRRA 2VOOA 1BBYA 4B8XA 1MJ9A 1K79A 1G8XA 4M3FA 1T56A 1R71A 1KZHA 1IRGA 4G8XA 3L00A 3V4GA 3ZMDA 2VT2A 2DMTA 4IHVA 2ZKZA 1MW7A 1Z05A 3JRFA 3BP8A 5B3SH 2F5VA 3DU5A 3CCYA 3H36A 4PCQA 2VODA 1T08B 2WB1A 2EFNA 2G7HA 4H4KC 4I0BA 4UHTA 3WE2A 3VSLA 3B02A 3DQVC 1YJNI 4RAGA 2Y2ZA 3LSRA 2E2IJ 3PSIA 2EIKH 2TDXA 4B48A 1XPXA 3S2HJ 4BE1A 5D5VB 3E97A 3OSFA 3JRHA 1FYMA 1TWAJ 2ELHA 3BG6A 2O5RA 5GP9A 1DGWY 2DQLA 2MD5A 2E60A 2KJBA 3LAPA 3L2WA 3NARA 2LOOA 1STZA 4RM2A 4HSTA 2L02A 3G6EI 2DPUA 3JAMZ 4LB5A 1I1SA 1WPKA 2KL4A 5J3LA 1DU0A 1XCBA 1T39A 2V9KA 2EZIA 4CZZA 3GYHX 1VQKI 4D1QA 4FQGA 1R1UA 1Y8RB 3LSGA 5LEJA 1P4XA 2VPRA 2EFPA 1IN7A 3PNVA 1MNDA 4ZYGA 3L2CA 1AA7A 2CYYA 2H6BA 1HC8A 5LFAA 3Q3SA 4ON0A 1X1PA 2QF7A 4MQ9F 2IVMA 3TW6A 5ICEA 4YEJA 2WAEA 2MBFA 1S8NA 1YIOA 4PGHA 1BC8C 1IRXA 2EIJH 4N4NB 2QENA 4ASNA 1Y6IA 4MIMA 2CFXA 4ZYDA 5FB2A 2IS6A 3S1QJ 4BDYA 2H09A 3HBLA 4E4HA 3Q9VA 3AAFA 2E1MC 3HRSA 4BQAA 4AD9A 3MQ0A 3OR2C 4KIBA 1MD0A 3BJAA 1NG7A 2COMA 1MMNA 2LY1A 3TO6A 1X3ZB 4U88A 5D8KB 4F92B 3MD2A 2VOPA 1YS7A 4DW6A 2I8DA 2KISA 4LJZF 2CQQA 3ZQIA 1RR8C 2JTVA 2IW5A 3QPHA 4XSZF 1GDTA 2EZLA 3U2RA 4M3DA 2MABA 4EV0A 5LHGA 3JRIA 1HW5A 4ZDPA 2K9MA 4GRIA 2MGQA 5FFXA 4EM1A 4ABZA 2OCCH 4XMYA 3RQIA 4LLGF 1FZPB 5JI6A 5K7HA 3KZYA 5FO5A 2LRDA 2ZFWA 2CMPA 4KNYA 5HS8A 1BOBA 2EZKA 2QQAA 1IJWC 5DS9A 2V1NA 3A1YA 4UVBA 3TQNA 3LA7A 2E2HJ 4UUVA 5BMZA 1YJ9I 4D5CA 4RM3A 1LDKB 2LTPA 4O6JA 4XR6A 4DYCA 4L9JA 3PIPF 4BAYA 2QBYB 4I2OA 2BW3B 2O8KA 3HRMA 2FEZA 1ORKA 3SHFA 4UV9A 2DFEA 2ZC2A 3ZQFA 1FTTA 4N4OB 2A68F 1H88C 4IHSA 2PJPA 5DEQA 3M8JA 1KQ9A 2XAHA 2XRNA 1BN5A 4L18B 2X1DA 2DFHA 2DOFA 5H6QA 5IOZA 2OQRA 3KLOA 3W2VA 1W0TA 3LMMA 4DBRA 1BR2A 4CDGA 1P7JA 4M9ZA 3OYHA 4XONA 3DBRB 5JHUA 5HLGA 2NVTJ 4XLEA 1G3YA 4ZDLA 2R7FA 2E2JJ 5EEAA 4HAMA 2V4JC 4XN0A 2VASA 2KT0A 5D4SA 4KA4A 2ELKA 2YS9A 2WY8Q 3GVAA 1TWCJ 2JPBA 3QAHA 2JA2A 3G4SI 3HXLA 4ENJA 3T5XA 1PUFA 3C1DA 3K4CA 2MC3A 1R22A 2ZMEC 3JSPA 4F93B 2Q2EB 3ROUA 2UWMA 3DPTA 1LDJA 2OTLI 2H8RA 4AVZA 1WI3A 4IRIA 4M3BA 2IS4A 3EUKL 2G9WA 3OYIA 3BR6A 3H3ZA 3K4MA 2VBXA 4HOBA 2BV6A 5FRNA 4CCJA 1TZLA 3HUGA 2QEXI 4G6DA 3CLQA 3ASOH 1D8KA 2RGVA 2HZTA 4NBQA 2QVOA 5LBQA 2XPVA 5KVRA 3OIPA 2AXTC 4ZZLA 5IT3A 2VI6A 4RAYA 5J6XA 3LSIA 4K2EA 1YFHA 2YU3A 3F0CA 3K1MA 2JA6J 1W36D 5LGTA 2L7FP 2GIVA 5EJCA 2LDUA 3HM5A 3WGIA 3GTPJ 1UHSA 3CMMA 4Y7NJ 1JTXA 2CV0A 3L7WA 1IC8A 2ZMEA 1WJDA 2A07F 3X2QH 1J5YA 3WG7H 3J7YJ 1V5FA 1PP8F 2W24A 5A2QZ 4ENNA 2RV8A 3MKLA 3WE3A 3FM5A 4Z6YA 2P6SA 3SJMA 2RQPA 2WB1N 2A5WA 2VLAA 3BG9A 3FHZA 3M1EA 4DYQA 2W84A 3E6CC 3OS1A 1ZLKA 2HVSA 1JUPA 3W2WA 4P96A 1Z3XA 1LPQA 1FLIA 2BOLA 1V5GA 4I01A 4BHBA 1GVJA 2VQCA 3OYKA 5CVIA 2DT7B 1V54H 2XGXA 4ZDOA 4B1RA 2A5YB 2XAFA 4IHXA 3DTIA 5AIPA 3FXRA 1Q1VA 4IOCF 2WA0A 4QTRA 4PJLA 4Q47A 2V7FA 3P5JA 4IVNA 5L3EA 2E7WA 2ZCWA 4BY7J 1W7PA 4CUGA 3WTSC 2L9SA 5IOYA 2HTJA 3IP4B 3DPLC 3PUBA 4N9HA 2IGOA 1Z6RA 3HPGA 3LAJA 4G7OF 2EPFA 3E7LA 4CGZA 3A2KA 1RUOA 4QSHA 4S0HB 4CICA 5C3EJ 1W5TA 1OR7C 2ZJ2A 4B3XA 4V2FA 1W0UA 3EUHC 4I99C 2ZXHA 4HNUA 4IX7A 1ZG5A 1GT0C 1QPIA 2EIMH 4RLQA 3GTKJ 2OZ6A 4CCNA 1WH5A 4IO9F 2WADA 1J2XA 2KRCA 1YOVB 1P6RA 5FD6A 3BLYA 2CQ7A 1B1BA 4BACA 1XS9A 1D5VA 2F4IA 2CUJA 3CJQB 2PI0A 1FSEA 2X4HA 5L3FA 3RKXA 2M30A 2H94A 2M9HA 5H2FC 1SAXA 2YX4A 1I3AA 4RB0A 3NRVA 1E2XA 2JPCA 3Q9SA 1LFPA 4JBAA 5FRMA 2V1XA 2RAEA 3IWFA 3VDXA 1IXRC 1Y56A 4FASD 1R49A 4NDLA 3AL0C 5D5UB 3HDDA 2QGUA 1U9NA 4D7NA 1I1GA 3U1KA 2GOMA 4PJMA 2PQ8A 1OR7A 1IDYA 1BI3A 4YIIA 3EUHA 3E3VA 5IYCJ 1P2FA 1POGA 3KEQA 3JCUC 1QRYA 3MCZA 5KHDA 5K5OA 1LB2A 1K61A 2R7DA 1G4DA 3CO6C 3OIOA 2ZB9A 4HPQA 1R7JA 3ZOBA 3NEUA 3FMQA 3LSKA 1MJAA 1RR7A 1A04A 3H3VK 2ISYA 3ZR8X 4LITA 4BL0B 2RNJA 4KJZA 2R92J 2BXYA 1LJ9A 3S14J 1MBFA 2E1MB 1Z3YA 4GGGA 4M74A 4R1HA 3PFYA 5KCMA 1N75A 3S1MJ 1LQ1A 1J9IA 2K4JA 2OU2A 2L3DA 3F8NA 5CPRB 3OYLA 2YPRA 2FSWA 3V42A 3FXLA 1Z7UA 2BHYA 5AONA 4PFPA 4II3A 4A0ZA 1CF7A 1WJAA 1ZREA 4FCYA 4B09A 3G1LA 1BI0A 4U87A 3H5NA 4KN4X 1V3FA 2EA2A 5F0CA 2XAQA 4AIHA 1VQLI 4BEHA 3W2AA 2HKOA 3MKWB 2VBWA 1U3EM 5BPIA 2V26A 4QWQA 4JQFA 4NC7A 4A0YA 1I50J 3R0JA 3T0YA 2HFHA 2AS5F 1QHHD 5TISC 1G6NA 3AG2H 3CUQC 2CW7A 2X48A 3E5QA 1PUFB 1WI9A 2DPDA 1XN7A 3KP7A 2L4AA 1IUYA 4BJTA 5J8CA 2ADUA 1VI0A 3FXUA 2EV0A 2JVHA 4OU0A 5CQEA 5FKMA 3S2WA 1S6LA 4WX9A 2F5FA 4L5IA 3R6SA 2M7AA 4JYKA 1O7FA 2M45A 4HZFA 4OIPF 4XRFA 2XVCA 3QPTA 5CJ9A 1HA8A 2JRMA 3Q0VA 3GUDA 4M6VA 4OAZA 2VONA 4M71A 1IXSB 4P5OA 2V9PA 2BHZA 2CWEA 3U9GA 3OYFA 4I6ZA 3KP4A 2N8GA 1VQOI 1Z21A 3FBIB 3DCFA 4RMNA 2PEXA 3DF8A 3KLNA 5B1BH 2WY7Q 2XKPA 4XRSA 4B44A 3HOUJ 3MZ8A 1WVRA 5DD8A 4OINF 3DKWA 3Q5FA 1YRNA 3CUQA 4PK4A 4UB6C 1S5LC 3ZQ7A 3G1OA 2V6CA 4DYRA 4M6YA 3F9KA 3T8RA 1MJBA 2ZMEB 3ZMTA 2Q1ZB 2WV0A 3R0AA 3NWSA 3PSFA 2JA7J 4P9FA 3GFIA 3QU3A 2XSJC 1C0WA 1U9OA 3B6CA 5GTIC 2LY9A 4A6EA 3E5UA 3S16J 3KPHA 4LGWA 1RKTA 1QZYA 1RKWA 4L9TA 3DTEA 2XPWA 1M1EB 3WTVC 2P8TA 2E35A 4MGRA 4YFKF 3GF2A 1WQ2A 4WXDA 4AIJA 2FJ1A 4QPQA 1P4WA 4GCVA 4ZJZA 2R7OA 3CJRB 2VKDA 1B8IA 2FD5A 4XICA 5C44J 4IZZA 3OYGA 1X58A 1W7PB 4O5VA 1SMYF 2L9VA 5E3MA 4RGSA 4BUPA 4NC6A 5CVJA 2JWTA 4DNCA 3HTSB 1HLVA 1OQYA 1FOWA 1YG2A 3DKXA 1IO2A 5HDNA 1F43A 4FT8A 1T98A 4M3GA 2MW8A 3EUAA 2EWNA 2NOJB 5JLWA 3ZN0A 4FETA 1ONVA 2CFOA 4PJNA 2A05A 3JRAA 5FKNA 3TW7A 3PJRA 4XNFA 4CXFA 4MNUA 5IT9Z 2O03A 3ERMA 2BY3A 3ZQGA 1P9QC 1VQ8I 2AQFA 3T8TA 2XROA 4R79A 3CCJI 2X85A 2DFIA 3BOQA 3M9AA 1A35A 2UZKA 1D1CA 4QIWN 1WGXA 3L09A 4MO7A 4XK4A 2GXAA 1S9HA 3PQJA 4KFCA 4G7HF 4HV5A 4V19K 2A61A 3VODA 5ICGA 4RB2C 2XB5A 2IPQX 2FF4A 1EKEA 2VKEA 3QP5A 1U2WA 2HS5A 4PZJA 5HOOA 2O7OA 3HEFA 2EA4A 1CQTA 2OPTA 3CCVI 2LR8A 5E17F 1JKRC 2CG4A 5HDGA 2R7ZJ 3WGHA 3S2DJ 3REOA 5JVTA 4X0GA 5DD4A 4W1UA 2DA6A 1HOMA 2QYOA 1SANA 1LEBA 3PUFA 1I6HJ 3ZQQA 3W6JB 1BC7C 1ETKA 3H5AA 4UB8C 2RNGA 2VKHA 3BC8A 5HNHA 1S7EA 5D6EA 2D5VA 1XSXA 3ZMSA 1V5EA 2H27A 1MMDA 2XKOA 5K1YA 4ESBA 1HKSA 2Y9ZA 2EBIA 1QZEA 2VJIA 2ZO4A 3BPXA 3ZGKA 4CYCA 3F8CA 3BT9A 2L0KA 1XD7A 2RREA 2WAQA 2VC1A 1EJ9A 2P5LC 5L3GA 2V1DA 3IAM2 4YELA 2BYVE 4I09A 1X1BA 3RYRA 3OY9A 1YJWI 3DXJF 3PNYA 1FYKA 4A3FJ 3A03A 2HQNA 4MHGA 4WWCA 4Y13A 3AL0B 2IAIA 2M0CA 3I56I 1XGSA 4D9JA 1EA3A 2K9QA 3I4PA 4WK8F 1CF7B 3TOBA 2B9SA 2EINH 1VFCA 4RAZA 3D1NI 3S3OA 4BEHB 1BW5A 2IP2A 4EGZA 2PJRA 1R00A 2CRGA 1OCPA 3IC7A 2IT0A 4BBRJ 3DV8A 4R8HA 2FXAA 1R4NB 2LLKA 1KGSA 5ILSA 3F3XA 4HX7A 1IDZA 4EM2A 2JN6A 2LC2A 5E1XA 5EZGA 1LKXA 4CHUA 2VIXA 3RSNA 3S93A 4XN3A 3SZPA 1JGGA 1DUXC 1GXQA 1JGSA 4C9YA 1MBHA 2IJLA 1BW6A 2MLGA 2HI3A 3TL4X 2KQRA 2R3SA 2XRLA 2LFBA 5CKTA 4FE4A 2DODA 3R61A 2DJIA 2W85A 3IHUA 3K4NA 2W7NA 3I5UA 1S29A 3HSEA 4MQVA 4CA0A 3GTQJ 5HODA 2Q0OA 6PAXA 3EETA 2I10A 3ECHA 1J59A 2B63J 1E17A 2DXIA 5BOXA 1JHFA 2DI3A 2YX7A 1FP1D 3GTOJ 2HOEA 1T95A 4FE7A 4LFUA 3CTAA 3GEZA 4OIOF 1SFXA 5DYMA 5ICCA 3CUQB 3DLLF 2XDVA 3OYCA 1V4RA 2DO7A 1H9GA 2DTRA 2L7ZA 2RQQA 5CLSA 1GUUA 1ODDA 4BU2A 4JX4A 4ETSA 4E7LA 3FISA 1OCCH 3KYCB 2HQ5A 4DQ2A 3G73A 2HU9A 3ESWB 1PYVA 2DCEA 3UNGC 3BCAA 1BIAA 4XLFA 2FE3A 5LGNA 4WXCA 1ETOA 5F04A 1YHQI 1BR4A 3F8BA 4IEJA 1ETVA 3KYLA 3K70C 3TGNA 1MSFC 4WF2A 1K78A 1TBXA 1FOKA 1E0EA 1QVUA 3LSTA 1IV8A 1K7AA 3I58A 3QQAA 5KNLA 4XOTA 1B8IB 2DFFA 2ID6A 3FK7A 4KICA 4WCGA 2LY2A 1YX5A 1D0ZA 1G3SA 3DBHB 1ZRDA 3IH2A 4GYGA 2Z3YA 1I3QJ 4EJOA 4XKCA 5J1UA 5J1RA 2IS2A 1MSEC 1TNSA 1TTYA 4ZYHA 1HSTA 2PMZA 2NAZA 2Y9YA 3BJOA 1PJRA 2R7VA 1B6AA 5LD2C 1WFXA 1LE8A 2RKHA 4NQWA 2B0LA 2X6OA 3KEYA 2NNYA 3I0TA 2ME6A 2CV1A 4HQEA 3SXYA 1AU7A 2L9NA 2VQHA 2QQ8A 3RI4A 1LDDA 3VOEA 2OD5A 2LG4A 5E1ZB 3BG5A 3ZMZA 3CCEI 3VEPA 4Y52J 5F6FA 3KETA 4NHJA 3TO9A 2GAUA 2Y0SA 1UG2A 1UZCA 2A69F 5FLMJ 3TDUC 1X1DA 2D1HA 2GXGA 4IHTA 1TQMA 5LHIA 2JA5J 1JUSA 3F72A 2HEOA 5EDNA 5K5QA 2LBFA 2HPIA 3RJPA 2O9LA 3V8JA 1HCRA 4KYWA 1U5TC 2HQAA 2K02A 3KP5A 3RDIA 2C6YA 3MMYB 4M6XA 1WCMJ 2W48A 3HKZA 2HZDA 4OWRB 1W5CC 3BG3A 2CQKA 1ETWA 3IL2A 4AYBN 2VN2A 1YE9A 4CO8A 1BL0A 3F23A 2CJJA 1W4MA 4NB5A 2L5QA 3K2AA 1E3HA 2EFOA 3TBIA 5KAIC 4KIGA 2VPLA 2JSCA 1R9TJ 4KN7X 5E3LA 1GHCA 1G3WA 3FF5A 4HSRA 3BROA 5E79C 3HC7A 5JVGF 5TJJA 4A2UA 4CYCB 2P0WA 3PQKA 2A6TA 1SVLA 2M5WA 2OJED 3DEEA 3HOTA 2WAQN 2K3PA 3VSKA 4BJ6C 3M4OJ 3BTCA 1SD6A 4D7MA 2EILH 1JJ8C 4ENKA 1UHMA 1YYVA 2CUEA 2L01A 1OFCX 2PFBA 2KIMA 2HGCA 1U5TA 3TO7A 4F3QA 1G59A 1T0FC 1P7IA 1YW8A 4RA2A 4E6KG 2F5CA 2HYJA 3H3UA 5CYVA 3O6BB 4BE2A 3I4MJ 1X1CA 4HLYA 3LSJA 2X51A 2H6CA 4HDVA 1OCRH 1N77A 4RB1A 3PM1A 4E7ZA 3GFLA 3FHNA 3OL4A 3UR3C 2K7LA 2BVMA 1ZGAA 5JLXA 2JK3A 1LNWA 4KMFA 5EG0A 4IQJA 1G3TA 2WAFA 1WSUA 4HNTA 5BQTA 3F8FA 1TC3C 1JT0A 4M9XA 4A3CJ 3OYEA 2R7QA 4YIFA 2DA4A 2KZGA 1MIJA 1V55H 2QWWA 3DFGA 4GFBA 1XMKA 1ZLJA 2D2WA 1QBJA 1VQ7I 3V8LA 2HYFA 2NOGA 2E5NA 4GO1A 3S17J 1ZRCA 1UCRA 4XRMA 1A36A 2MSYA 3E6BA 1X4OA 2YU9J 1ZGJA 1T0FA 3KP2A 3BTLA 3QYBA 5IP9J 5JR3A 3TP3A 3MEXA 2Z5UA 4CCKA 1Y1WJ 3FXOA 5DV5A 3VYTB 4YFXF 2FMYA 2VB6A 2P4WA 3BJ6A 3FBNB 1AHDP 4OMYA 2E1NA 1SMTA 4C2UA 2R5ZA 2QKLB 1QO0D 5HLHA 1ACIA 4G6QA 3RCOA 3SYTA 2CS3A 2V6EA 4ZC3A 4LMYA 1ETQA 5HVQC 3ERED 2L7MP 2XGEA 4A5NA 4C2MJ 3HL2A 3LSMA 4TV7A 1SFKA 1P4AA 3BTJA 3WTXC 2EB7A 3M7GA 1OCZH 5ICFA 2JUCA 3IH3A 2HVQA 2K5CA 2FBHA 1LEAA 3R60A 2CQNA 2HOAA 4CZCA 2DA7A 2BY2A 1RC9A 2YR2A 5IP7J 5CQGA 5IYDJ 2V1UA 2YUSA 4BDZA 2KIFA 3C3WA 3A01A 5TRDA 3ABTA 1O4XA 4OIQF 1VQ4I 1OMIA 2BY0A 4YRVA 3CC4I 5HS9A 1K6YA 1K78B 5HS7A 4OMZA 3RPUD 2XAJA 3WTYC 2GA2A 3I71A 1Z91A 2R7RA 1K83J 3S1RJ 3IKVA 3H9GA 2LNBA 1KQ8A 4PJJA 1SD7A 2P7VB 4EMSA 1MBJA 2HDCA 2IS1A 2LH9A 2W82A 4IPAA 3K4BA 1Y39A 1NH3A 3OYDA 3IAS2 4XLNF 4HRIA 1D8JA 2QZ8A 4W97A 3ULQB 3FXJA 5B5EC 3HGGA 3L2VA 2HXIA 1KU3A 4IRGA 3SEZA 5GPAA 4DOZA 4NQWB 3PL8A 3SDBA 1BJAA 3TEDA 1SFOJ 1LE8B 4P55A 4IJAA 2ICWG 2Y31A 2GQQA 1OYIA 5EEHA 3OYAA 2VJ4A 2QM3A 5L3CA 3FX3A 5KAFC 3DWLE 2F48A 2K4BA 5FD5A 2NYXA 4XBFA 4B47A 4C3JJ 2GA1A 1MGTA 4AU7A 1BJZA 2M34A 3MKYB 3EYYA 3HOXJ 3JR9A 1SD4A 1YS6A 1GV5A 2E5ZA 1YW7A 3S8PA 3QPSA 2DT5A 3V7CA 4AIKA 4G94A 1S72I 3K10A 1AKHA 1XX5A 3F21A 1YI2I 1R1TA 5HDKA 1IAWA 3WTZA 3F6OA 1JXSA 3JRDA 2EJRA 1W36C 1XSVA 2HYGD 2LBFB 2K40A 1ZH5A 3UKGA 2EH3A 2HKXA 5CVUA 3EQLF 3DKYA 1OYWA 1FX7A 2KKOA 4IHWA 3ZP5A 5DTDA 1ERDA 1KYZA 2W4SA 1SC7A 4A0XA 1XDSA 2XGDA 3EYIA 4LD5A 3C2BA 3HKZN 1HW2A 4UVCA 5J4VA 3LFUA 3N97A 3TOAA 1DU6A 4BNCA 2BXZA 4RGUA 2CUZA 3CESA 3D5LA 1DP3A 1IN8A 2FMLA 2FOKA 1TL8A 2BVLA 2ETHA 3VYUB 1SAUA 2OA4A 4CYDA 3ZCOA 2DQRA 2XC7A 4M9SA 2OBPA 4DZJA 1CGPA 3COAC 4EVIA 3L1PA 1MMGA 3DEUA 3DEWA 1QA6A 2DMQA 4FHTA 1H0MA 4HDUA 1HKTA 4KUMA 3TMOA 1VQNI 1SVMA 3D5RC 1U5TB 5DM6F 4J01A 1EH8A 4LLLA 3GZ6A 2ZNYA 4L0ZB 3RIRA 2WBMA 2DK5A 5LRRA 1FMWA 5F08A 3G71I 3CUOA 1K4SA 2ESHA 1X3WB 3HUGB 1FOXA 3BZ6A 1EH7A 4J00A 2F2EA 1QHGA 4OAYA 5D5XB 5EG0B 3MZHA 3ZMVA 1RESA 5H6RA 5CVVA 4Y15A 3ABMH 2AXLA 2RDPA 1YX3A 2HWVA 4MEYF 1TW3A 3J80K 1FJLA 2FUG2 2UXNA 1XGMA 3GX4X 1HBXG 3FM3A 3CDHA 2VL8A 1NG6A 2Z1DA 3E5XA 2A3SA 3OR1C 4PSWA 2KHMA 1IG7A 3BR3A 2QSGX 2LKPA 4L5EA 2JRTA 4RLFA 5M5WJ 3JTHA 4ESFA 1REPC 4JP0A 2JA8J 3A0BC 3RQ4A 3HPHA 3P9CA 1WZ2A 4L9VA 1XMXA 4HEA2 1ITYA 1MMSA 2IA1A 4QLCU 1I5ZA 1R5HA 1S7OA 1TQPA 3GXOA 1RZ4A 3OYMA 5LHHA 4UY8I 3SEQA 3CQZJ 3WHCA 3ZMUA 2Q8KA 5JFRA 1IZ1A 3ABKH 3BQZA 2R5ZB 1NK2P 1U78A 3BR5A 4A3MJ 3G1MA 4BYYA 4XQFA 2P81A 3IH4A 5BPDA
chains in the Genus database with same CATH topology
3D0SA 1IF1A 3R4KA 2STTA 3KFWX 3HYIA 4JK1X 3C18A 4HF0A 4RGXA 4HX8A 1DP7P 2PMUA 1RIOH 1TQIA 2KJCA 2F5DA 3HHHA 1PP7U 5BS6A 2MLKA 1TNTA 4RGRA 3CJNA 1O7LA 3WTTC 3MWMA 2XUBA 2L54A 1R23A 5E8GA 1XGNA 2NS0A 1F4KA 3O3KA 5LRSA 1YTYA 4YFNF 4UVAA 5EEGA 4EQQA 3WODF 2VBZA 5LLQA 2Y75A 3TDZC 3TKYA 5HLIA 4M72A 1TLHB 2P6TA 4KMUX 1T38A 2MH9A 2M8EA 2MA3A 3KE2A 4RS8A 3HOSA 1JHHA 4G9YA 2PG4A 3HHGA 2JZYA 2EFQA 2KIUA 1FYLA 1O3TA 1B9NA 2EFWA 3JSOA 3KP6A 1YO5C 1RI7A 4UV8A 4WXHA 2MH2A 3VB2A 5F1RA 1T2KA 1B4AA 4A6DA 5DCFA 3LA2A 3MFKA 1H9TA 2V9VA 1WKMA 1EH6A 3WG9A 1QZZA 2VE9A 2VBYA 3I64A 4KIFA 1HXDA 2GWRA 1USSA 1ZRFA 2ZXJA 3M8EA 3QRFF 1BOAA 2LF7A 3WTUC 1KU9A 3GO5A 3F6VA 2ZBKA 1D3YA 4P9UA 2O61A 3MZYA 4L0YB 3J81K 5L3BA 5CVRA 1XGOA 2DU9A 2IA2A 1B59A 2Y0MA 4BHPA 1BI1A 3J7AO 5E8IA 1WWXA 2ISZA 4EJTA 2PMHA 1U8RA 2OZUA 1ZAOA 1S7AA 2M1BA 3RKWA 4Q5SF 3HSRA 1O3QA 2STWA 4BHCA 3LQRA 3CO7C 1YW9A 1ZG1A 4S04A 3ZN1A 3I53A 3GZ5A 5DUIA 3RTRA 2DAOA 5E1WA 2P5KA 1RNLA 4GXOA 1HKQA 2EK5A 2J5PA 3I54A 1FPQA 1W7PD 5E20A 4S05A 1L3LA 2JT1A 5D8LB 4IRHA 2EV6A 1SFEA 2RC4A 5DDGA 3T1BA 1S3JA 3WU1B 3ZPLA 4PGGA 3N4MA 3FWEA 3GW2A 2CW0F 3QP6A 3K1NA 3GFMA 4FX0A 1QQIA 1IN5A 2BBYA 5IT9K 2PN6A 3HRTA 5J8FA 2XASA 4F7ZA 3OOPA 3QU6A 1I6XA 4E70A 4U0VA 1ZG3A 4N0BA 1FNNA 1YLFA 3KP3A 4HA8A 1PDNC 4LG0A 5H20A 1KA8A 4H0EA 4UXNA 1U6GA 3P9KA 3GWZA 1KU2A 2J5OA 2XHKA 1HSJA 3BWGA 2EV5A 1ON1A 3V8KA 2O6GE 1FSHA 4MEXF 1LVAA 4I7HA 3E6MA 4BXUA 1ZYRF 4ZYEA 1R36A 1WRJA 2GZWA 2RN7A 1FBUA 3PFIA 1NHAA 1MZBA 2FBKA 3O2PE 3VFZA 3J80Z 1P92A 5FLXK 3ELKA 2DW4A 5AIQA 1Q1HA 4EM0B 1O3SA 5L3DA 3RPQA 2NNNA 3JTGA 1IN6A 1IW7F 2A6EF 3G3ZA 3BY6A 3LWFA 4IXAA 2DK8A 2X0LA 2QUFA 3KZZA 2IA0A 4ZZDA 1F5TA 1AOYA 3K69A 2P5VA 3FMRA 4OIRF 1R5GA 1FWZA 5ERIA 4LK1F 4Q4ZF 1Z9CA 2E7XA 1QPMA 4HLXA 5ILVA 1R1VA 1FBSA 3FMSA 3P7NA 3DP7A 1JE8A 1I27A 4EJVA 2LSOA 1DDNA 3SQNA 2A6HF 4U7DA 2WC2A 5DCMA 3JAMK 2UXXA 4AVPA 2HR3A 1J75A 1RUNA 1W5SA 1XB4A 1KU7A 1Z6TA 4A12A 4XLPF 1DPRA 5LEKA 4MTDA 2FU4A 3V7SA 2M87A 3SZTA 2VXZA 3HTUA 3BPVA 5FFZA 4MTEA 4HF1A 1GXPA 1KYWA 3BDDA 1MKMA 2O0YA 1FP2A 4LB6B 4UNOA 2Z9OA 2XIGA 2L4MA 1QGPA 5ILUA 2BE5F 3IRQA 3SFZA 1F1ZA 4ESJA 3HRUA 1MDMA 2HQRA 4EJUA 1B9MA 4L5JA 5F64A 2CSOA 2KRFA 2PLYA 4EGYA 1BM9A 3L9FA 3RYPA 4A5MA 1EV7A 4BH9A 3WTWC 2VT3A 2VC0A 1O57A 2E1CA 5DUKA 3OV8A 2ZNZA 1UFMA 1BI2A 3K2ZA 4Z2YA 4LG0B 4U0YA 3U1DA 5E18F 2DBBA 2FBIA 4LK0F 4G7ZF 1T6SA 3B73A 1PUEE 3LA3A 3IWZA 2Z33A 1XMAA 4ZH4F 1HQCA 2QQ9A 3I59A 4HBLA 1XSDA 3WU0A 3JW4A 1DPUA 1ULYA 4HQMA 4I0AA 3F8MA 1FY7A 1F9NA 2W57A 4HF2A 1K6OA 3ECOA 1IN4A 2FA5A 4Q48A 3ABUA 3ISPA 1YQAA 3CLOA 4U0WA 3P9IA 2RVCA 2ACJA 2FNPA 2HTSA 1UB9A 1OPCA 3J81Z 2OQGA 3IKTA 3K9TA 3GFJA 2G7UA 3K1PA 4LLNA 3KEOA 1IXCA 4I02A 1J7KA 4Y17A 3FXQA 3MAJA 2FQ3A 3RPUA 4YG2F 4N9IA 2FRHA 1OYYA 4I98B 4GYIA 5A2QK 2GXBA 2W25A 3QOPA 5KK1A 2QQBA 4HW0A 1Y0UA 4IF4A 3HIFA 1ZN2A 3E6DA 4PDKA 4L9NA 3LFKA 5D6FA 2XV4S 3RKYA 4RB3C 4KDPA 4KT5C 4HV6A 4FX4A 5DCMB 2D1VA 3W6KB 1QNTA 1FT9A 1ZHFA 1SD5A 2V79A 1ON2A 2WTEA 3M8FA 3ML6A 4EJWA 2O3FA 3FZVA 1FC3A 1R58A 4XSXF 5K5RA 1VTNC 3HSFA 2WWYA 2YSRA 3NQOA 1HW1A 4U7BA 4HYEA 4D0PA 2F5EA 2K86A 3GLXA 3H92A 2LF8A 1OKRA 3K0LA 1UHWA 2D45A 2IRFG 2BEOA 2QBYA 4M73A 1Z1DA 1XCVA 1USTA 3F22A 1MDMB 1FBQA 1X3UA 3C7JA 2P7CB 1IRFA 2K27A 1TW2A 1AWCA 5LGUA 1SFUA 1KQ0A 2NRAC 4HX4A 2FNAA 1J0RA 2O8XA 4AWXB 2CGPA 2BGCA 2QLZA 2Y48A 3LQQA 5ED4A 1BIBA 3WGGA 2XAGA 2Q2EA 4OOIA 1XDUA 5D5WB 5FGMA 2Z99A 4ENMA 1O3RA 5FLXZ 5D4RA 1L0OC 1ZARA 3I59B 3V7RA 2PBIA 2VE8A 2OAZA 2DLLA 3EDPA 2CO5A 2ESNA 4O3MA 3KCCA 3IRRA 2VOOA 1BBYA 4B8XA 1MJ9A 1K79A 1IRGA 4G8XA 3L00A 3V4GA 3ZMDA 2VT2A 2ZKZA 1Z05A 3BP8A 4PCQA 2VODA 2EFNA 2G7HA 4I0BA 4UHTA 3WE2A 3B02A 3DQVC 2TDXA 5D5VB 3E97A 1FYMA 2ELHA 2DQLA 2MD5A 2KJBA 3LAPA 1STZA 2L02A 2DPUA 3JAMZ 4LB5A 1I1SA 1XCBA 1T39A 3GYHX 4CZZA 1R1UA 5LEJA 1P4XA 2EFPA 1IN7A 4ZYGA 3L2CA 2CYYA 2H6BA 4ON0A 4MQ9F 2IVMA 5ICEA 2MBFA 1S8NA 1YIOA 4PGHA 1BC8C 4ASNA 2QENA 4ZYDA 2CFXA 5FB2A 2H09A 3Q9VA 3AAFA 3HRSA 4BQAA 4AD9A 3MQ0A 4KIBA 1MD0A 3BJAA 2COMA 3TO6A 4U88A 5D8KB 2VOPA 1YS7A 4LJZF 2JTVA 2IW5A 3QPHA 4XSZF 3U2RA 4EV0A 5LHGA 1HW5A 4EM1A 5FFXA 4LLGF 1FZPB 5JI6A 3KZYA 5FO5A 2ZFWA 4KNYA 5HS8A 2QQAA 4UVBA 3TQNA 3LA7A 4UUVA 5BMZA 1LDKB 4O6JA 4L9JA 4BAYA 2QBYB 4I2OA 3HRMA 2FEZA 3SHFA 4UV9A 2A68F 4IHSA 2PJPA 5DEQA 1KQ9A 2XAHA 2XRNA 1BN5A 4L18B 5H6QA 2OQRA 3KLOA 4CDGA 4M9ZA 5JHUA 5HLGA 1G3YA 2R7FA 4HAMA 5D4SA 4KA4A 3GVAA 2JPBA 3QAHA 4ENJA 3T5XA 3C1DA 2MC3A 1R22A 3JSPA 3ROUA 2UWMA 3DPTA 1LDJA 4IRIA 2G9WA 3H3ZA 2VBXA 4HOBA 2BV6A 3HUGA 4G6DA 1D8KA 2RGVA 2HZTA 2QVOA 5LBQA 5KVRA 4ZZLA 5IT3A 4RAYA 5J6XA 4K2EA 1YFHA 2YU3A 3K1MA 5LGTA 2GIVA 2LDUA 3WGIA 3L7WA 2ZMEA 2A07F 1J5YA 1PP8F 2W24A 5A2QZ 4ENNA 2RV8A 3WE3A 3FM5A 2P6SA 2RQPA 3FHZA 3M1EA 2W84A 3E6CC 1ZLKA 4P96A 1FLIA 4I01A 4BHBA 1GVJA 5CVIA 2XGXA 2A5YB 2XAFA 5AIPA 3FXRA 4Q47A 4IVNA 5L3EA 2E7WA 2ZCWA 1W7PA 3WTSC 2HTJA 3DPLC 4N9HA 1Z6RA 3LAJA 4G7OF 4CGZA 1RUOA 4CICA 1W5TA 2ZJ2A 1ZG5A 2OZ6A 1J2XA 1P6RA 5FD6A 1B1BA 1D5VA 2PI0A 1FSEA 2X4HA 5L3FA 3RKXA 2M30A 2H94A 1SAXA 2YX4A 4RB0A 3NRVA 1E2XA 2JPCA 3Q9SA 4JBAA 2V1XA 3IWFA 1IXRC 5D5UB 1I1GA 2PQ8A 1OR7A 1BI3A 4YIIA 3EUHA 3E3VA 1P2FA 3KEQA 3MCZA 5K5OA 1LB2A 2R7DA 1G4DA 3CO6C 1R7JA 3NEUA 3FMQA 1MJAA 1A04A 2ISYA 2RNJA 1LJ9A 4GGGA 4M74A 4R1HA 1J9IA 1LQ1A 2K4JA 2OU2A 2L3DA 3F8NA 2YPRA 2FSWA 1Z7UA 5AONA 4A0ZA 1CF7A 1ZREA 4B09A 1BI0A 4KN4X 1V3FA 2EA2A 2XAQA 4AIHA 2HKOA 2VBWA 1U3EM 5BPIA 4QWQA 4JQFA 4A0YA 3R0JA 3T0YA 2HFHA 2AS5F 1G6NA 3CUQC 3E5QA 1WI9A 2DPDA 1XN7A 3KP7A 2L4AA 1IUYA 5J8CA 2ADUA 3FXUA 2EV0A 4OU0A 3S2WA 1S6LA 4WX9A 2F5FA 4L5IA 3R6SA 1O7FA 2M45A 4HZFA 4OIPF 4XRFA 2XVCA 3QPTA 5CJ9A 3GUDA 2VONA 4M71A 1IXSB 4P5OA 3U9GA 2CWEA 3KP4A 2PEXA 3DF8A 3KLNA 2XKPA 5DD8A 4OINF 3DKWA 3Q5FA 3CUQA 3ZQ7A 2V6CA 4M6YA 3T8RA 1MJBA 2ZMEB 3ZMTA 2WV0A 3R0AA 4P9FA 3GFIA 3QU3A 1C0WA 4A6EA 3E5UA 4LGWA 1QZYA 4L9TA 3WTVC 2P8TA 4MGRA 4YFKF 3GF2A 1WQ2A 4WXDA 4AIJA 1P4WA 4GCVA 4O5VA 1W7PB 1SMYF 4RGSA 5CVJA 4DNCA 3HTSB 1YG2A 5HDNA 4FT8A 1T98A 2EWNA 3ZN0A 1ONVA 4CXFA 4MNUA 5IT9Z 2O03A 3T8TA 2XROA 4R79A 2DFIA 3BOQA 3M9AA 2UZKA 3L09A 3PQJA 4KFCA 4G7HF 4HV5A 2A61A 3VODA 5ICGA 4RB2C 2IPQX 2FF4A 3QP5A 1U2WA 2HS5A 4PZJA 5HOOA 2EA4A 5E17F 2CG4A 5HDGA 3WGHA 3REOA 5JVTA 5DD4A 2QYOA 1LEBA 3W6JB 1BC7C 5D6EA 1XSXA 3ZMSA 2H27A 2XKOA 5K1YA 4ESBA 1HKSA 2ZO4A 3BPXA 3F8CA 1XD7A 2VC1A 2P5LC 5L3GA 2V1DA 2BYVE 4I09A 3RYRA 1FYKA 3DXJF 2HQNA 4MHGA 4WWCA 4Y13A 1XGSA 1CF7B 3I4PA 4WK8F 3TOBA 4RAZA 2IP2A 4EGZA 1R00A 3IC7A 2IT0A 3DV8A 4R8HA 2FXAA 1KGSA 5ILSA 3F3XA 4HX7A 4EM2A 5E1XA 4CHUA 3SZPA 1DUXC 1GXQA 1JGSA 2IJLA 2MLGA 2R3SA 3R61A 2W85A 3IHUA 3I5UA 1S29A 3HSEA 4MQVA 2Q0OA 6PAXA 3EETA 3ECHA 1J59A 1E17A 5BOXA 1JHFA 2DI3A 2YX7A 1FP1D 2HOEA 4LFUA 3CTAA 3GEZA 4OIOF 1SFXA 5DYMA 5ICCA 3CUQB 1V4RA 2DO7A 1H9GA 2DTRA 5CLSA 1ODDA 4ETSA 4DQ2A 3G73A 1BIAA 2FE3A 5LGNA 4WXCA 3F8BA 3TGNA 4WF2A 1K78A 1TBXA 1FOKA 3LSTA 1K7AA 3I58A 4KICA 4WCGA 1G3SA 1ZRDA 4GYGA 2Z3YA 4EJOA 1TNSA 1TTYA 4ZYHA 1HSTA 2NAZA 3BJOA 1B6AA 2RKHA 4NQWA 2B0LA 2NNYA 3I0TA 4HQEA 3SXYA 3RI4A 1LDDA 3VOEA 2OD5A 5E1ZB 3ZMZA 3VEPA 5F6FA 3KETA 4NHJA 3TO9A 2GAUA 2A69F 3TDUC 2D1HA 2GXGA 4IHTA 1TQMA 5LHIA 3F72A 2HEOA 5K5QA 3RJPA 3V8JA 4KYWA 1U5TC 2K02A 3KP5A 3RDIA 2C6YA 4M6XA 2CQKA 3IL2A 2VN2A 4CO8A 3F23A 1W4MA 4NB5A 2EFOA 4KIGA 2JSCA 4KN7X 1GHCA 1G3WA 3FF5A 3BROA 5TJJA 4A2UA 3PQKA 2M5WA 3HOTA 1SD6A 4ENKA 1UHMA 1YYVA 2L01A 2PFBA 2KIMA 2HGCA 1U5TA 3TO7A 1YW8A 2F5CA 3H3UA 5CYVA 3O6BB 4HLYA 2H6CA 4HDVA 4RB1A 3GFLA 2K7LA 1ZGAA 4KMFA 1LNWA 1G3TA 1WSUA 5BQTA 3F8FA 4M9XA 4YIFA 2QWWA 3DFGA 1XMKA 1ZLJA 2D2WA 1QBJA 3V8LA 2HYFA 4GO1A 1ZRCA 1UCRA 3E6BA 1ZGJA 1T0FA 3KP2A 5JR3A 3MEXA 2Z5UA 5DV5A 4YFXF 2FMYA 2P4WA 3BJ6A 4OMYA 2E1NA 1SMTA 5HLHA 1QO0D 4G6QA 4LMYA 5HVQC 3ERED 4A5NA 4TV7A 1P4AA 3WTXC 2EB7A 3M7GA 5ICFA 2FBHA 1LEAA 3R60A 2YR2A 2V1UA 2KIFA 3C3WA 5TRDA 3ABTA 4OIQF 1OMIA 5HS9A 1K78B 5HS7A 4OMZA 2XAJA 3WTYC 2GA2A 3I71A 1Z91A 3IKVA 2LNBA 1KQ8A 1SD7A 2P7VB 4EMSA 2HDCA 4IPAA 4XLNF 1D8JA 2QZ8A 3ULQB 1KU3A 4IRGA 1BJAA 4P55A 4IJAA 2GQQA 1OYIA 5EEHA 2QM3A 5L3CA 3FX3A 2K4BA 5FD5A 2NYXA 4XBFA 2GA1A 1MGTA 3EYYA 1SD4A 1YS6A 1YW7A 2DT5A 3V7CA 4AIKA 4G94A 3F21A 1R1TA 5HDKA 1IAWA 3WTZA 3F6OA 1JXSA 2EJRA 1ZH5A 1XSVA 2HYGD 2HKXA 5CVUA 3EQLF 1OYWA 1FX7A 2KKOA 3ZP5A 1KYZA 4A0XA 1XDSA 3EYIA 4LD5A 1HW2A 4UVCA 3N97A 3TOAA 4BNCA 4RGUA 3D5LA 1IN8A 2FMLA 2FOKA 2ETHA 2OA4A 4CYDA 2DQRA 4M9SA 2OBPA 1CGPA 3COAC 4EVIA 3DEUA 4FHTA 1H0MA 4HDUA 1HKTA 4KUMA 1U5TB 1EH8A 4LLLA 3GZ6A 2ZNYA 4L0ZB 3RIRA 2DK5A 5LRRA 3CUOA 2ESHA 3BZ6A 1EH7A 2F2EA 5D5XB 3MZHA 3ZMVA 5H6RA 5CVVA 4Y15A 2AXLA 2RDPA 4MEYF 3J80K 2HWVA 1TW3A 2UXNA 1XGMA 3GX4X 1HBXG 3FM3A 3CDHA 3E5XA 2A3SA 2LKPA 2JRTA 3JTHA 4ESFA 1REPC 3P9CA 4L9VA 2IA1A 4QLCU 1I5ZA 1R5HA 1S7OA 1TQPA 3GXOA 1RZ4A 5LHHA 3ZMUA 2Q8KA 5JFRA 1IZ1A 1U78A 4BYYA 5BPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0S A;  1IF1 A;  3R4K A;  2STT A;  3KFW X;  3HYI A;  4JK1 X;  3C18 A;  4HF0 A;  4RGX A;  4HX8 A;  1DP7 P;  2PMU A;  1RIO H;  1TQI A;  2KJC A;  2F5D A;  3HHH A;  1PP7 U;  5BS6 A;  2MLK A;  1TNT A;  4RGR A;  3CJN A;  1O7L A;  3WTT C;  3MWM A;  2XUB A;  2L54 A;  1R23 A;  5E8G A;  1XGN A;  2NS0 A;  1F4K A;  3O3K A;  5LRS A;  1YTY A;  4YFN F;  4UVA A;  5EEG A;  4EQQ A;  3WOD F;  2VBZ A;  5LLQ A;  2Y75 A;  3TDZ C;  3TKY A;  5HLI A;  4M72 A;  1TLH B;  2P6T A;  4KMU X;  1T38 A;  2MH9 A;  2M8E A;  2MA3 A;  3KE2 A;  4RS8 A;  3HOS A;  1JHH A;  4G9Y A;  2PG4 A;  3HHG A;  2JZY A;  2EFQ A;  2KIU A;  1FYL A;  1O3T A;  1B9N A;  2EFW A;  3JSO A;  3KP6 A;  1YO5 C;  1RI7 A;  4UV8 A;  4WXH A;  2MH2 A;  3VB2 A;  5F1R A;  1T2K A;  1B4A A;  4A6D A;  5DCF A;  3LA2 A;  3MFK A;  1H9T A;  2V9V A;  1WKM A;  1EH6 A;  3WG9 A;  1QZZ A;  2VE9 A;  2VBY A;  3I64 A;  4KIF A;  1HXD A;  2GWR A;  1USS A;  1ZRF A;  2ZXJ A;  3M8E A;  3QRF F;  1BOA A;  2LF7 A;  3WTU C;  1KU9 A;  3GO5 A;  3F6V A;  2ZBK A;  1D3Y A;  4P9U A;  2O61 A;  3MZY A;  4L0Y B;  3J81 K;  5L3B A;  5CVR A;  1XGO A;  2DU9 A;  2IA2 A;  1B59 A;  2Y0M A;  4BHP A;  1BI1 A;  3J7A O;  5E8I A;  1WWX A;  2ISZ A;  4EJT A;  2PMH A;  1U8R A;  2OZU A;  1ZAO A;  1S7A A;  2M1B A;  3RKW A;  4Q5S F;  3HSR A;  1O3Q A;  2STW A;  4BHC A;  3LQR A;  3CO7 C;  1YW9 A;  1ZG1 A;  4S04 A;  3ZN1 A;  3I53 A;  3GZ5 A;  5DUI A;  3RTR A;  2DAO A;  5E1W A;  2P5K A;  1RNL A;  4GXO A;  1HKQ A;  2EK5 A;  2J5P A;  3I54 A;  1FPQ A;  1W7P D;  5E20 A;  4S05 A;  1L3L A;  2JT1 A;  5D8L B;  4IRH A;  2EV6 A;  1SFE A;  2RC4 A;  5DDG A;  3T1B A;  1S3J A;  3WU1 B;  3ZPL A;  4PGG A;  3N4M A;  3FWE A;  3GW2 A;  2CW0 F;  3QP6 A;  3K1N A;  3GFM A;  4FX0 A;  1QQI A;  1IN5 A;  2BBY A;  5IT9 K;  2PN6 A;  3HRT A;  5J8F A;  2XAS A;  4F7Z A;  3OOP A;  3QU6 A;  1I6X A;  4E70 A;  4U0V A;  1ZG3 A;  4N0B A;  1FNN A;  1YLF A;  3KP3 A;  4HA8 A;  1PDN C;  4LG0 A;  5H20 A;  1KA8 A;  4H0E A;  4UXN A;  1U6G A;  3P9K A;  3GWZ A;  1KU2 A;  2J5O A;  2XHK A;  1HSJ A;  3BWG A;  2EV5 A;  1ON1 A;  3V8K A;  2O6G E;  1FSH A;  4MEX F;  1LVA A;  4I7H A;  3E6M A;  4BXU A;  1ZYR F;  4ZYE A;  1R36 A;  1WRJ A;  2GZW A;  2RN7 A;  1FBU A;  3PFI A;  1NHA A;  1MZB A;  2FBK A;  3O2P E;  3VFZ A;  3J80 Z;  1P92 A;  5FLX K;  3ELK A;  2DW4 A;  5AIQ A;  1Q1H A;  4EM0 B;  1O3S A;  5L3D A;  3RPQ A;  2NNN A;  3JTG A;  1IN6 A;  1IW7 F;  2A6E F;  3G3Z A;  3BY6 A;  3LWF A;  4IXA A;  2DK8 A;  2X0L A;  2QUF A;  3KZZ A;  2IA0 A;  4ZZD A;  1F5T A;  1AOY A;  3K69 A;  2P5V A;  3FMR A;  4OIR F;  1R5G A;  1FWZ A;  5ERI A;  4LK1 F;  4Q4Z F;  1Z9C A;  2E7X A;  1QPM A;  4HLX A;  5ILV A;  1R1V A;  1FBS A;  3FMS A;  3P7N A;  3DP7 A;  1JE8 A;  1I27 A;  4EJV A;  2LSO A;  1DDN A;  3SQN A;  2A6H F;  4U7D A;  2WC2 A;  5DCM A;  3JAM K;  2UXX A;  4AVP A;  2HR3 A;  1J75 A;  1RUN A;  1W5S A;  1XB4 A;  1KU7 A;  1Z6T A;  4A12 A;  4XLP F;  1DPR A;  5LEK A;  4MTD A;  2FU4 A;  3V7S A;  2M87 A;  3SZT A;  2VXZ A;  3HTU A;  3BPV A;  5FFZ A;  4MTE A;  4HF1 A;  1GXP A;  1KYW A;  3BDD A;  1MKM A;  2O0Y A;  1FP2 A;  4LB6 B;  4UNO A;  2Z9O A;  2XIG A;  2L4M A;  1QGP A;  5ILU A;  2BE5 F;  3IRQ A;  3SFZ A;  1F1Z A;  4ESJ A;  3HRU A;  1MDM A;  2HQR A;  4EJU A;  1B9M A;  4L5J A;  5F64 A;  2CSO A;  2KRF A;  2PLY A;  4EGY A;  1BM9 A;  3L9F A;  3RYP A;  4A5M A;  1EV7 A;  4BH9 A;  3WTW C;  2VT3 A;  2VC0 A;  1O57 A;  2E1C A;  5DUK A;  3OV8 A;  2ZNZ A;  1UFM A;  1BI2 A;  3K2Z A;  4Z2Y A;  4LG0 B;  4U0Y A;  3U1D A;  5E18 F;  2DBB A;  2FBI A;  4LK0 F;  4G7Z F;  1T6S A;  3B73 A;  1PUE E;  3LA3 A;  3IWZ A;  2Z33 A;  1XMA A;  4ZH4 F;  1HQC A;  2QQ9 A;  3I59 A;  4HBL A;  1XSD A;  3WU0 A;  3JW4 A;  1DPU A;  1ULY A;  4HQM A;  4I0A A;  3F8M A;  1FY7 A;  1F9N A;  2W57 A;  4HF2 A;  1K6O A;  3ECO A;  1IN4 A;  2FA5 A;  4Q48 A;  3ABU A;  3ISP A;  1YQA A;  3CLO A;  4U0W A;  3P9I A;  2RVC A;  2ACJ A;  2FNP A;  2HTS A;  1UB9 A;  1OPC A;  3J81 Z;  2OQG A;  3IKT A;  3K9T A;  3GFJ A;  2G7U A;  3K1P A;  4LLN A;  3KEO A;  1IXC A;  4I02 A;  1J7K A;  4Y17 A;  3FXQ A;  3MAJ A;  2FQ3 A;  3RPU A;  4YG2 F;  4N9I A;  2FRH A;  1OYY A;  4I98 B;  4GYI A;  5A2Q K;  2GXB A;  2W25 A;  3QOP A;  5KK1 A;  2QQB A;  4HW0 A;  1Y0U A;  4IF4 A;  3HIF A;  1ZN2 A;  3E6D A;  4PDK A;  4L9N A;  3LFK A;  5D6F A;  2XV4 S;  3RKY A;  4RB3 C;  4KDP A;  4KT5 C;  4HV6 A;  4FX4 A;  5DCM B;  2D1V A;  3W6K B;  1QNT A;  1FT9 A;  1ZHF A;  1SD5 A;  2V79 A;  1ON2 A;  2WTE A;  3M8F A;  3ML6 A;  4EJW A;  2O3F A;  3FZV A;  1FC3 A;  1R58 A;  4XSX F;  5K5R A;  1VTN C;  3HSF A;  2WWY A;  2YSR A;  3NQO A;  1HW1 A;  4U7B A;  4HYE A;  4D0P A;  2F5E A;  2K86 A;  3GLX A;  3H92 A;  2LF8 A;  1OKR A;  3K0L A;  1UHW A;  2D45 A;  2IRF G;  2BEO A;  2QBY A;  4M73 A;  1Z1D A;  1XCV A;  1UST A;  3F22 A;  1MDM B;  1FBQ A;  1X3U A;  3C7J A;  2P7C B;  1IRF A;  2K27 A;  1TW2 A;  1AWC A;  5LGU A;  1SFU A;  1KQ0 A;  2NRA C;  4HX4 A;  2FNA A;  1J0R A;  2O8X A;  4AWX B;  2CGP A;  2BGC A;  2QLZ A;  2Y48 A;  3LQQ A;  5ED4 A;  1BIB A;  3WGG A;  2XAG A;  2Q2E A;  4OOI A;  1XDU A;  5D5W B;  5FGM A;  2Z99 A;  4ENM A;  1O3R A;  5FLX Z;  5D4R A;  1L0O C;  1ZAR A;  3I59 B;  3V7R A;  2PBI A;  2VE8 A;  2OAZ A;  2DLL A;  3EDP A;  2CO5 A;  2ESN A;  4O3M A;  3KCC A;  3IRR A;  2VOO A;  1BBY A;  4B8X A;  1MJ9 A;  1K79 A;  1IRG A;  4G8X A;  3L00 A;  3V4G A;  3ZMD A;  2VT2 A;  2ZKZ A;  1Z05 A;  3BP8 A;  4PCQ A;  2VOD A;  2EFN A;  2G7H A;  4I0B A;  4UHT A;  3WE2 A;  3B02 A;  3DQV C;  2TDX A;  5D5V B;  3E97 A;  1FYM A;  2ELH A;  2DQL A;  2MD5 A;  2KJB A;  3LAP A;  1STZ A;  2L02 A;  2DPU A;  3JAM Z;  4LB5 A;  1I1S A;  1XCB A;  1T39 A;  3GYH X;  4CZZ A;  1R1U A;  5LEJ A;  1P4X A;  2EFP A;  1IN7 A;  4ZYG A;  3L2C A;  2CYY A;  2H6B A;  4ON0 A;  4MQ9 F;  2IVM A;  5ICE A;  2MBF A;  1S8N A;  1YIO A;  4PGH A;  1BC8 C;  4ASN A;  2QEN A;  4ZYD A;  2CFX A;  5FB2 A;  2H09 A;  3Q9V A;  3AAF A;  3HRS A;  4BQA A;  4AD9 A;  3MQ0 A;  4KIB A;  1MD0 A;  3BJA A;  2COM A;  3TO6 A;  4U88 A;  5D8K B;  2VOP A;  1YS7 A;  4LJZ F;  2JTV A;  2IW5 A;  3QPH A;  4XSZ F;  3U2R A;  4EV0 A;  5LHG A;  1HW5 A;  4EM1 A;  5FFX A;  4LLG F;  1FZP B;  5JI6 A;  3KZY A;  5FO5 A;  2ZFW A;  4KNY A;  5HS8 A;  2QQA A;  4UVB A;  3TQN A;  3LA7 A;  4UUV A;  5BMZ A;  1LDK B;  4O6J A;  4L9J A;  4BAY A;  2QBY B;  4I2O A;  3HRM A;  2FEZ A;  3SHF A;  4UV9 A;  2A68 F;  4IHS A;  2PJP A;  5DEQ A;  1KQ9 A;  2XAH A;  2XRN A;  1BN5 A;  4L18 B;  5H6Q A;  2OQR A;  3KLO A;  4CDG A;  4M9Z A;  5JHU A;  5HLG A;  1G3Y A;  2R7F A;  4HAM A;  5D4S A;  4KA4 A;  3GVA A;  2JPB A;  3QAH A;  4ENJ A;  3T5X A;  3C1D A;  2MC3 A;  1R22 A;  3JSP A;  3ROU A;  2UWM A;  3DPT A;  1LDJ A;  4IRI A;  2G9W A;  3H3Z A;  2VBX A;  4HOB A;  2BV6 A;  3HUG A;  4G6D A;  1D8K A;  2RGV A;  2HZT A;  2QVO A;  5LBQ A;  5KVR A;  4ZZL A;  5IT3 A;  4RAY A;  5J6X A;  4K2E A;  1YFH A;  2YU3 A;  3K1M A;  5LGT A;  2GIV A;  2LDU A;  3WGI A;  3L7W A;  2ZME A;  2A07 F;  1J5Y A;  1PP8 F;  2W24 A;  5A2Q Z;  4ENN A;  2RV8 A;  3WE3 A;  3FM5 A;  2P6S A;  2RQP A;  3FHZ A;  3M1E A;  2W84 A;  3E6C C;  1ZLK A;  4P96 A;  1FLI A;  4I01 A;  4BHB A;  1GVJ A;  5CVI A;  2XGX A;  2A5Y B;  2XAF A;  5AIP A;  3FXR A;  4Q47 A;  4IVN A;  5L3E A;  2E7W A;  2ZCW A;  1W7P A;  3WTS C;  2HTJ A;  3DPL C;  4N9H A;  1Z6R A;  3LAJ A;  4G7O F;  4CGZ A;  1RUO A;  4CIC A;  1W5T A;  2ZJ2 A;  1ZG5 A;  2OZ6 A;  1J2X A;  1P6R A;  5FD6 A;  1B1B A;  1D5V A;  2PI0 A;  1FSE A;  2X4H A;  5L3F A;  3RKX A;  2M30 A;  2H94 A;  1SAX A;  2YX4 A;  4RB0 A;  3NRV A;  1E2X A;  2JPC A;  3Q9S A;  4JBA A;  2V1X A;  3IWF A;  1IXR C;  5D5U B;  1I1G A;  2PQ8 A;  1OR7 A;  1BI3 A;  4YII A;  3EUH A;  3E3V A;  1P2F A;  3KEQ A;  3MCZ A;  5K5O A;  1LB2 A;  2R7D A;  1G4D A;  3CO6 C;  1R7J A;  3NEU A;  3FMQ A;  1MJA A;  1A04 A;  2ISY A;  2RNJ A;  1LJ9 A;  4GGG A;  4M74 A;  4R1H A;  1J9I A;  1LQ1 A;  2K4J A;  2OU2 A;  2L3D A;  3F8N A;  2YPR A;  2FSW A;  1Z7U A;  5AON A;  4A0Z A;  1CF7 A;  1ZRE A;  4B09 A;  1BI0 A;  4KN4 X;  1V3F A;  2EA2 A;  2XAQ A;  4AIH A;  2HKO A;  2VBW A;  1U3E M;  5BPI A;  4QWQ A;  4JQF A;  4A0Y A;  3R0J A;  3T0Y A;  2HFH A;  2AS5 F;  1G6N A;  3CUQ C;  3E5Q A;  1WI9 A;  2DPD A;  1XN7 A;  3KP7 A;  2L4A A;  1IUY A;  5J8C A;  2ADU A;  3FXU A;  2EV0 A;  4OU0 A;  3S2W A;  1S6L A;  4WX9 A;  2F5F A;  4L5I A;  3R6S A;  1O7F A;  2M45 A;  4HZF A;  4OIP F;  4XRF A;  2XVC A;  3QPT A;  5CJ9 A;  3GUD A;  2VON A;  4M71 A;  1IXS B;  4P5O A;  3U9G A;  2CWE A;  3KP4 A;  2PEX A;  3DF8 A;  3KLN A;  2XKP A;  5DD8 A;  4OIN F;  3DKW A;  3Q5F A;  3CUQ A;  3ZQ7 A;  2V6C A;  4M6Y A;  3T8R A;  1MJB A;  2ZME B;  3ZMT A;  2WV0 A;  3R0A A;  4P9F A;  3GFI A;  3QU3 A;  1C0W A;  4A6E A;  3E5U A;  4LGW A;  1QZY A;  4L9T A;  3WTV C;  2P8T A;  4MGR A;  4YFK F;  3GF2 A;  1WQ2 A;  4WXD A;  4AIJ A;  1P4W A;  4GCV A;  4O5V A;  1W7P B;  1SMY F;  4RGS A;  5CVJ A;  4DNC A;  3HTS B;  1YG2 A;  5HDN A;  4FT8 A;  1T98 A;  2EWN A;  3ZN0 A;  1ONV A;  4CXF A;  4MNU A;  5IT9 Z;  2O03 A;  3T8T A;  2XRO A;  4R79 A;  2DFI A;  3BOQ A;  3M9A A;  2UZK A;  3L09 A;  3PQJ A;  4KFC A;  4G7H F;  4HV5 A;  2A61 A;  3VOD A;  5ICG A;  4RB2 C;  2IPQ X;  2FF4 A;  3QP5 A;  1U2W A;  2HS5 A;  4PZJ A;  5HOO A;  2EA4 A;  5E17 F;  2CG4 A;  5HDG A;  3WGH A;  3REO A;  5JVT A;  5DD4 A;  2QYO A;  1LEB A;  3W6J B;  1BC7 C;  5D6E A;  1XSX A;  3ZMS A;  2H27 A;  2XKO A;  5K1Y A;  4ESB A;  1HKS A;  2ZO4 A;  3BPX A;  3F8C A;  1XD7 A;  2VC1 A;  2P5L C;  5L3G A;  2V1D A;  2BYV E;  4I09 A;  3RYR A;  1FYK A;  3DXJ F;  2HQN A;  4MHG A;  4WWC A;  4Y13 A;  1XGS A;  1CF7 B;  3I4P A;  4WK8 F;  3TOB A;  4RAZ A;  2IP2 A;  4EGZ A;  1R00 A;  3IC7 A;  2IT0 A;  3DV8 A;  4R8H A;  2FXA A;  1KGS A;  5ILS A;  3F3X A;  4HX7 A;  4EM2 A;  5E1X A;  4CHU A;  3SZP A;  1DUX C;  1GXQ A;  1JGS A;  2IJL A;  2MLG A;  2R3S A;  3R61 A;  2W85 A;  3IHU A;  3I5U A;  1S29 A;  3HSE A;  4MQV A;  2Q0O A;  6PAX A;  3EET A;  3ECH A;  1J59 A;  1E17 A;  5BOX A;  1JHF A;  2DI3 A;  2YX7 A;  1FP1 D;  2HOE A;  4LFU A;  3CTA A;  3GEZ A;  4OIO F;  1SFX A;  5DYM A;  5ICC A;  3CUQ B;  1V4R A;  2DO7 A;  1H9G A;  2DTR A;  5CLS A;  1ODD A;  4ETS A;  4DQ2 A;  3G73 A;  1BIA A;  2FE3 A;  5LGN A;  4WXC A;  3F8B A;  3TGN A;  4WF2 A;  1K78 A;  1TBX A;  1FOK A;  3LST A;  1K7A A;  3I58 A;  4KIC A;  4WCG A;  1G3S A;  1ZRD A;  4GYG A;  2Z3Y A;  4EJO A;  1TNS A;  1TTY A;  4ZYH A;  1HST A;  2NAZ A;  3BJO A;  1B6A A;  2RKH A;  4NQW A;  2B0L A;  2NNY A;  3I0T A;  4HQE A;  3SXY A;  3RI4 A;  1LDD A;  3VOE A;  2OD5 A;  5E1Z B;  3ZMZ A;  3VEP A;  5F6F A;  3KET A;  4NHJ A;  3TO9 A;  2GAU A;  2A69 F;  3TDU C;  2D1H A;  2GXG A;  4IHT A;  1TQM A;  5LHI A;  3F72 A;  2HEO A;  5K5Q A;  3RJP A;  3V8J A;  4KYW A;  1U5T C;  2K02 A;  3KP5 A;  3RDI A;  2C6Y A;  4M6X A;  2CQK A;  3IL2 A;  2VN2 A;  4CO8 A;  3F23 A;  1W4M A;  4NB5 A;  2EFO A;  4KIG A;  2JSC A;  4KN7 X;  1GHC A;  1G3W A;  3FF5 A;  3BRO A;  5TJJ A;  4A2U A;  3PQK A;  2M5W A;  3HOT A;  1SD6 A;  4ENK A;  1UHM A;  1YYV A;  2L01 A;  2PFB A;  2KIM A;  2HGC A;  1U5T A;  3TO7 A;  1YW8 A;  2F5C A;  3H3U A;  5CYV A;  3O6B B;  4HLY A;  2H6C A;  4HDV A;  4RB1 A;  3GFL A;  2K7L A;  1ZGA A;  4KMF A;  1LNW A;  1G3T A;  1WSU A;  5BQT A;  3F8F A;  4M9X A;  4YIF A;  2QWW A;  3DFG A;  1XMK A;  1ZLJ A;  2D2W A;  1QBJ A;  3V8L A;  2HYF A;  4GO1 A;  1ZRC A;  1UCR A;  3E6B A;  1ZGJ A;  1T0F A;  3KP2 A;  5JR3 A;  3MEX A;  2Z5U A;  5DV5 A;  4YFX F;  2FMY A;  2P4W A;  3BJ6 A;  4OMY A;  2E1N A;  1SMT A;  5HLH A;  1QO0 D;  4G6Q A;  4LMY A;  5HVQ C;  3ERE D;  4A5N A;  4TV7 A;  1P4A A;  3WTX C;  2EB7 A;  3M7G A;  5ICF A;  2FBH A;  1LEA A;  3R60 A;  2YR2 A;  2V1U A;  2KIF A;  3C3W A;  5TRD A;  3ABT A;  4OIQ F;  1OMI A;  5HS9 A;  1K78 B;  5HS7 A;  4OMZ A;  2XAJ A;  3WTY C;  2GA2 A;  3I71 A;  1Z91 A;  3IKV A;  2LNB A;  1KQ8 A;  1SD7 A;  2P7V B;  4EMS A;  2HDC A;  4IPA A;  4XLN F;  1D8J A;  2QZ8 A;  3ULQ B;  1KU3 A;  4IRG A;  1BJA A;  4P55 A;  4IJA A;  2GQQ A;  1OYI A;  5EEH A;  2QM3 A;  5L3C A;  3FX3 A;  2K4B A;  5FD5 A;  2NYX A;  4XBF A;  2GA1 A;  1MGT A;  3EYY A;  1SD4 A;  1YS6 A;  1YW7 A;  2DT5 A;  3V7C A;  4AIK A;  4G94 A;  3F21 A;  1R1T A;  5HDK A;  1IAW A;  3WTZ A;  3F6O A;  1JXS A;  2EJR A;  1ZH5 A;  1XSV A;  2HYG D;  2HKX A;  5CVU A;  3EQL F;  1OYW A;  1FX7 A;  2KKO A;  3ZP5 A;  1KYZ A;  4A0X A;  1XDS A;  3EYI A;  4LD5 A;  1HW2 A;  4UVC A;  3N97 A;  3TOA A;  4BNC A;  4RGU A;  3D5L A;  1IN8 A;  2FML A;  2FOK A;  2ETH A;  2OA4 A;  4CYD A;  2DQR A;  4M9S A;  2OBP A;  1CGP A;  3COA C;  4EVI A;  3DEU A;  4FHT A;  1H0M A;  4HDU A;  1HKT A;  4KUM A;  1U5T B;  1EH8 A;  4LLL A;  3GZ6 A;  2ZNY A;  4L0Z B;  3RIR A;  2DK5 A;  5LRR A;  3CUO A;  2ESH A;  3BZ6 A;  1EH7 A;  2F2E A;  5D5X B;  3MZH A;  3ZMV A;  5H6R A;  5CVV A;  4Y15 A;  2AXL A;  2RDP A;  4MEY F;  3J80 K;  2HWV A;  1TW3 A;  2UXN A;  1XGM A;  3GX4 X;  1HBX G;  3FM3 A;  3CDH A;  3E5X A;  2A3S A;  2LKP A;  2JRT A;  3JTH A;  4ESF A;  1REP C;  3P9C A;  4L9V A;  2IA1 A;  4QLC U;  1I5Z A;  1R5H A;  1S7O A;  1TQP A;  3GXO A;  1RZ4 A;  5LHH A;  3ZMU A;  2Q8K A;  5JFR A;  1IZ1 A;  1U78 A;  4BYY A;  5BPD A; 
#chains in the Genus database with same CATH topology
 3D0S A;  1IF1 A;  4IKF A;  3R4K A;  1D1B A;  1U8B A;  4P1W A;  2STT A;  3KFW X;  4LIU A;  3CZ6 A;  3HYI A;  3C18 A;  4JK1 X;  4HF0 A;  4PSX A;  3WHB A;  2H1K A;  1IUF A;  4RGX A;  1JJ6 C;  1TWF J;  3NAU A;  1FTZ A;  4HX8 A;  3A01 B;  1BR1 A;  2HXO A;  1E3P A;  3CJT B;  1DP7 P;  3JRG A;  4A3I J;  2R7X A;  2PMU A;  2EZH A;  1RIO H;  3S15 J;  3DU6 A;  1TQI A;  4FTH A;  2KJC A;  2F5D A;  3HHH A;  1PP7 U;  5BS6 A;  2MLK A;  3GTJ J;  1UAA A;  2UUZ A;  1TNT A;  3W3C A;  2DYS H;  4AID A;  3M1C A;  2K9S A;  4RGR A;  2X9D A;  3CJN A;  3WU2 C;  5M3F J;  5K7F A;  4F91 B;  2IGK A;  2CW8 A;  1HDP A;  2ZSH B;  4IL6 C;  3ONQ A;  4IQ4 A;  1O7L A;  3DBL B;  3WTT C;  2VKV A;  3MWM A;  3GLL A;  1A5J A;  2XUB A;  2L54 A;  2NS7 A;  2CU7 A;  1R23 A;  3SDG A;  2DA1 A;  5E8G A;  1XGN A;  3M3Y J;  2MD0 A;  2NS0 A;  1F4K A;  1BA5 A;  3O3K A;  2E19 A;  5LRS A;  3OIQ A;  1Z7L A;  3VPR A;  1N25 A;  1R4M B;  2MC4 A;  1YTY A;  3FKJ A;  1ZKG A;  4YFN F;  1YIT I;  4UVA A;  2GOX B;  5EEG A;  4A93 J;  2DOE A;  4EQQ A;  3WOD F;  3PO2 J;  3BCB A;  3AG4 H;  2VBZ A;  3S3N A;  3ZRG A;  1MBG A;  2X6W A;  1HDD C;  3HOV J;  2AQE A;  1AKH B;  1JI8 A;  1VND A;  5LLQ A;  2Y75 A;  3TDZ C;  3K6G A;  3TKY A;  2ZJR F;  2E71 A;  5HLI A;  4M72 A;  1TLH B;  3TP0 A;  2P6T A;  1MH4 A;  4KMU X;  5J1Y A;  1T38 A;  3LL7 A;  4LIV A;  3H5R A;  2Z2S B;  4XRS G;  2MH9 A;  2M8E A;  3GME A;  1SEU A;  1Y0N A;  3HJE A;  2MA3 A;  2BY1 A;  3CP2 A;  2QSH X;  2DA5 A;  3KE2 A;  4RS8 A;  2JUG A;  3HOS A;  4HNV A;  1JHH A;  1WJC A;  2IGM A;  2DYR H;  2XSD C;  4G9Y A;  2KMU A;  2PG4 A;  3HHG A;  5C4J J;  1ZTR A;  5F0F A;  2JZY A;  2EFQ A;  2KIU A;  4XL9 A;  1FYL A;  1O3T A;  1IGN A;  3GTL J;  1B9N A;  2EFW A;  4DBQ A;  2XF6 A;  2DTZ A;  4C3I J;  3JSO A;  3KP6 A;  1YO5 C;  4C2T A;  1RI7 A;  4UV8 A;  2DMN A;  4WXH A;  2MH2 A;  3VB2 A;  5F1R A;  1T2K A;  3K4J A;  1B4A A;  4A6D A;  2K3F A;  2W00 A;  4Y4R A;  2ZJQ F;  3QOD A;  2F4M B;  5DCF A;  2QCO A;  3LA2 A;  3MFK A;  1R5I D;  1H9T A;  2LMD A;  1VQ5 I;  2V9V A;  2M0M A;  4NNJ A;  1WKM A;  1EH6 A;  3WG9 A;  2KP6 A;  1QZZ A;  2VE9 A;  2VBY A;  3I64 A;  1VQ6 I;  5GAG J;  4KIF A;  3DTK A;  5FKO A;  1FOY A;  2KDO A;  3CCR I;  4DJA A;  1HXD A;  4NC8 A;  2GWR A;  1USS A;  1ZRF A;  2DA2 A;  2ZXJ A;  3BR2 A;  2JQ7 A;  3M8E A;  3QRF F;  1T33 A;  1BOA A;  2LF7 A;  3WTU C;  1KU9 A;  2PX9 A;  3K4L A;  3GO5 A;  3H1C A;  3F6V A;  2ZBK A;  1D3Y A;  4P9U A;  2E1O A;  1WJ5 A;  3MZY A;  2O61 A;  3U21 A;  4L0Y B;  3J81 K;  2MG4 A;  3MN2 A;  4BKX A;  5L3B A;  1YRN B;  1J09 A;  5CVR A;  1XGO A;  4Y3O A;  3E1S A;  3HOZ J;  1MMA A;  2DU9 A;  2HNH A;  3SFI A;  1H8A C;  2IA2 A;  1B59 A;  2Y0M A;  4BHP A;  3M07 A;  1BI1 A;  4BQN A;  3J7A O;  5E8I A;  4UUS A;  1WWX A;  3FDY A;  3BR1 A;  2ISZ A;  2ECC A;  4EJT A;  2PMH A;  1U8R A;  1KON A;  2OZU A;  1ZAO A;  4BXF A;  1S7A A;  1UMQ A;  2M1B A;  2QKM B;  5TGT A;  1G2H A;  2JJ7 A;  3RKW A;  4Q5S F;  3HSR A;  1O3Q A;  2STW A;  4ZTF A;  1MNM C;  4BHC A;  2OUM A;  3LQR A;  3CO7 C;  1YW9 A;  4BBS J;  1NK3 P;  2R93 J;  4DZP A;  2E36 A;  1ZG1 A;  2X1E A;  3IUO A;  1D1A A;  4S04 A;  3ZN1 A;  4CCL A;  4DGW B;  3I53 A;  3GZ5 A;  3Q0U A;  2AO9 A;  4XLA A;  3J7A Y;  4NUB A;  5DUI A;  2DT6 A;  4E7S A;  2DA3 A;  3RTR A;  2ELJ A;  2DAO A;  3G2B A;  5E1W A;  2P5K A;  1TP4 A;  1RNL A;  3GBG A;  4GXO A;  2ME0 A;  4A3K J;  1ETX A;  2BZT A;  1HKQ A;  2I5U A;  3BTI A;  2KLO A;  5EYR A;  2EK5 A;  2MFZ A;  5J47 A;  2J5P A;  2R0Q C;  2CUF A;  3I54 A;  5IYB J;  1QVT A;  1FPQ A;  1W7P D;  1N78 A;  5E20 A;  4S05 A;  4A69 C;  2XPU A;  4RAF A;  1L3L A;  2JT1 A;  4XOR A;  5D8L B;  4XID A;  4IRH A;  3JRB A;  4C30 A;  3H0D A;  2EV6 A;  4I76 A;  3ZXS A;  4BS9 A;  1IRZ A;  1LFU P;  1SFE A;  1JKQ C;  2RC4 A;  1JUM A;  3T1B A;  5DDG A;  2CH0 A;  4FIS A;  1S3J A;  3WU1 B;  3ZPL A;  2HOS A;  4ZYA A;  1OCO H;  4PGG A;  3N4M A;  2HVR A;  3FWE A;  2GBY A;  2CW0 F;  3GW2 A;  3QP6 A;  2ZJP F;  3K1N A;  3GFM A;  4FX0 A;  4RDU A;  1QQI A;  3C2H A;  1IN5 A;  2BBY A;  5IT9 K;  2PN6 A;  3HRT A;  5J8F A;  4IOA F;  1Y1V J;  2XAS A;  3QPL A;  3OWT A;  4F7Z A;  5FKL A;  3OOP A;  2DDB A;  4II2 A;  1TWG J;  3QU6 A;  2XAU A;  1I6X A;  3AG1 H;  5K7Z A;  4E70 A;  1K4T A;  4U0V A;  1ZG3 A;  3GTG J;  4N0B A;  2LVS A;  1FNN A;  1RRJ A;  3CC2 I;  1YLF A;  3KP3 A;  4HA8 A;  2DOA A;  1PDN C;  3RKQ A;  3QYF A;  9ANT A;  3OS2 A;  4LG0 A;  5H20 A;  1KA8 A;  5J4Y A;  4H0E A;  4UXN A;  4KIT B;  1JT6 A;  1U6G A;  2R5Y A;  3P9K A;  3L2R A;  3GWZ A;  2LP0 A;  1KU2 A;  3OYB A;  1A31 A;  2J5O A;  2XHK A;  4MFE A;  1R6R A;  1PVE A;  1Z67 A;  2ZSI B;  1HSJ A;  3CMY A;  2DJN A;  2VXD A;  3BWG A;  2EV5 A;  2HDW A;  1ON1 A;  3V8K A;  2KRH A;  5B66 C;  1Z77 A;  2O6G E;  1FSH A;  4MEX F;  1LVA A;  4AC0 A;  2H8W A;  3KX2 A;  3HG9 A;  2GLO A;  4I7H A;  4MFD A;  5EGO A;  5M3M J;  5EF6 A;  1UJ8 A;  3E6M A;  4BXU A;  2F4O B;  1ZYR F;  4ZYE A;  4F52 A;  2PJR B;  1R36 A;  3CCU I;  1ZR2 A;  3FK6 A;  1WRJ A;  2GZW A;  2ZXI A;  2RN7 A;  4KIS A;  1FBU A;  3PFI A;  2CV2 A;  2XGC A;  1NHA A;  1MZB A;  3K4K A;  2FBK A;  3O2P E;  3VFZ A;  1APL C;  3J80 Z;  1P92 A;  4E7J A;  1XTA A;  5FLX K;  3ELK A;  2DW4 A;  3VYS B;  1WJB A;  5AIQ A;  1Q1H A;  4EM0 B;  1O3S A;  3LOC A;  2CQX A;  5L3D A;  3RPQ A;  2NNN A;  1ZK8 A;  1U0J A;  1ZEL A;  2XB0 X;  5GAD J;  3JTG A;  1IN6 A;  1W1W E;  2NVU B;  1IW7 F;  2A6E F;  3G3Z A;  1VQ9 I;  3BY6 A;  1EF4 A;  1YIJ I;  1OCT C;  3LWF A;  4IXA A;  3CCS I;  2DK8 A;  2IGN A;  2NVQ J;  2X0L A;  2QUF A;  3KZZ A;  2IA0 A;  4ZZD A;  1GV2 A;  1F5T A;  3CF5 F;  1AOY A;  2VQG A;  4ITV A;  3K69 A;  2P5V A;  3FMR A;  1TT0 A;  4YIR X;  4OIR F;  4QPO A;  1R5G A;  3BR0 A;  4B43 A;  1B72 A;  3GTM J;  4G6T B;  3FXK A;  4C3H J;  1FWZ A;  5ERI A;  4LK1 F;  1RPW A;  4Q4Z F;  1Z9C A;  2IEK A;  3I9V 2;  2E7X A;  2HOT A;  2JMW A;  1TWH J;  3CME I;  2TRT A;  2VQL A;  4UUS B;  1QPM A;  3I4N J;  4HLX A;  5FRO A;  1A6Q A;  5ILV A;  5FJ8 J;  1R1V A;  3N05 A;  2L7K A;  1FBS A;  3BZK A;  3FMS A;  1WHU A;  3P7N A;  3DP7 A;  2GM4 A;  1JE8 A;  3Q0W A;  1I27 A;  4EJV A;  1E3O C;  2LSO A;  1DDN A;  3SQN A;  2A6H F;  4U7D A;  1ZR4 A;  4PUS A;  2XF7 A;  4A3L J;  2WC2 A;  1IV6 A;  4BJ5 C;  2M4G A;  5DCM A;  3JAM K;  2UXX A;  5EZH A;  4DIQ A;  1JKO C;  3MKZ A;  1FIP A;  4AVP A;  2HR3 A;  3K7A J;  3BQY A;  1J75 A;  1RUN A;  3ABL H;  3ZQH A;  1W5S A;  1XB4 A;  3H9J A;  1KU7 A;  1Z6T A;  1VF9 A;  4A12 A;  3BG7 A;  2M3A A;  4XLP F;  1DPR A;  4BQQ A;  5LEK A;  4MTD A;  2M2E A;  2FU4 A;  2PMZ N;  2IXS A;  3V7S A;  1VZ0 A;  2Y30 A;  3DLA A;  2LKS A;  2M87 A;  3SZT A;  2VXZ A;  4HG2 A;  3HTU A;  3BPV A;  5FFZ A;  4MTE A;  1WJF A;  2XF5 A;  3QWL A;  4HF1 A;  4AM3 A;  2OCE A;  5E3N A;  1GXP A;  1KYW A;  3BDD A;  1ETY A;  2R7T A;  1MKM A;  1X2M A;  4KT6 A;  4ZTJ A;  3ZQL A;  2O0Y A;  1FP2 A;  4LB6 B;  4RBO A;  2HPM A;  1H89 C;  4UNO A;  2Z9O A;  2G0E A;  2XIG A;  3QOE A;  2L4M A;  1T8I A;  3CP8 A;  3ASN H;  4XKB A;  1QGP A;  4AUX A;  5ILU A;  2ID3 A;  2UV1 A;  2Y0S N;  3IV5 A;  2BE5 F;  2M7B A;  3IRQ A;  3SFZ A;  3ZQC A;  5IP6 A;  2M4K A;  1F1Z A;  2OV7 A;  2EQR A;  1NTC A;  4ESJ A;  3HRU A;  1MDM A;  2HQR A;  4EJU A;  1B9M A;  2KZV A;  1MBK A;  2VJJ A;  3L2Q A;  4L5J A;  3HOW J;  1FEX A;  3KZI C;  5F64 A;  3L2U A;  3PO3 J;  1RET A;  2CSO A;  2KRF A;  2PLY A;  2R7W A;  1BM9 A;  3L9F A;  3RYP A;  4A5M A;  4EGY A;  1EV7 A;  4BH9 A;  3CMA I;  3SZG A;  4PFO A;  3WTW C;  2OTJ I;  4B3A A;  2VT3 A;  2VC0 A;  1O57 A;  2E1C A;  4LOC A;  2NVX J;  4CSW A;  5DUK A;  4BGD A;  3OV8 A;  1X1A A;  2ZNZ A;  2DMP A;  1UFM A;  2VJ5 A;  1BI2 A;  5F27 A;  2Y69 H;  1GLN A;  3K2Z A;  4Z2Y A;  1LUJ B;  4M3E A;  3FIW A;  4LG0 B;  2TCT A;  4U0Y A;  3U1D A;  5E3O A;  3CCQ I;  5E18 F;  4ANJ A;  4BQO A;  3OL3 A;  2R5Y B;  3CDI A;  2DBB A;  2FBI A;  4LK0 F;  4G7Z F;  1T6S A;  4UUT A;  3B73 A;  5JHF A;  1PUE E;  3LA3 A;  3IWZ A;  2GIZ A;  2Z33 A;  1XMA A;  3OYN A;  4ZH4 F;  1X4P A;  1Y8Q B;  1HQC A;  3CF2 A;  3D5S C;  2QQ9 A;  3I59 A;  4HBL A;  5HLT A;  1XSD A;  4E7I A;  3WU0 A;  1HF0 A;  2OC6 A;  1OJL A;  3JW4 A;  1DPU A;  1ULY A;  4HQM A;  4I0A A;  4E7H A;  3F8M A;  5EGO B;  1VQP I;  1FY7 A;  1F9N A;  2W57 A;  4HF2 A;  1K6O A;  3MVP A;  3ECO A;  2HDD A;  1IN4 A;  2FA5 A;  1OIS A;  5IY5 H;  4Q48 A;  4Y33 A;  3ABU A;  3ISP A;  5HNF A;  3S1N J;  1YQA A;  2DN0 A;  1TT5 B;  4XLC A;  3CLO A;  3OYJ A;  2JVG A;  4XKV A;  4U0W A;  3P9I A;  2RVC A;  2KIQ A;  2ACJ A;  5FLV A;  2FNP A;  2AHQ A;  2KFD A;  2JSP A;  2HTS A;  1UB9 A;  1OPC A;  3J81 Z;  2IBD A;  4GDF A;  2OQG A;  5DM7 F;  1LFB A;  3O8G A;  3IKT A;  2NVY J;  4CCO A;  1LVK A;  1JTY A;  3W6V A;  3K9T A;  2NS8 A;  3CCM I;  1ZGW A;  4CCM A;  1FMV A;  3VWB A;  3J7Z I;  3GFJ A;  2G7U A;  3K1P A;  2R7U A;  4B4C A;  4LLN A;  3C2G A;  3KEO A;  1IXC A;  2F6C A;  4I02 A;  3CCL I;  3CD6 I;  1I39 A;  3B6A A;  1J7K A;  4Y17 A;  3OMY A;  1XG1 A;  3FXQ A;  3AKZ A;  4A3B J;  1MBE A;  2L2O A;  2QSF X;  3DPU A;  3AFH A;  2LRE A;  4EAT A;  3MAJ A;  2FQ3 A;  1B72 B;  4X6A J;  3RPU A;  4YG2 F;  4N9I A;  2FRH A;  1OYY A;  4I98 B;  3CC7 I;  2Z16 A;  4GYI A;  1F36 A;  5A2Q K;  2KDZ A;  4JOM A;  2GXB A;  2FX0 A;  2FQ4 A;  2W25 A;  3H0G J;  3QOP A;  3GCM A;  4IHY A;  3E0J B;  5KK1 A;  4A3E J;  2W1O A;  2QQB A;  1Z0X A;  1D0Y A;  4EEF G;  2LYC A;  4HW0 A;  4F55 A;  3OOU A;  1Y0U A;  2K85 A;  4IF4 A;  3HIF A;  4XLH A;  1JKP C;  1ZN2 A;  3E6D A;  4PDK A;  5GAE J;  2COB A;  5C4X J;  4L9N A;  3LFK A;  2K9N A;  5D6F A;  2XV4 S;  1UEL B;  3RKY A;  3OS0 A;  4RB3 C;  4CH7 A;  4KDP A;  4KT5 C;  4HV6 A;  4FX4 A;  5DCM B;  2D1V A;  3W6K B;  3RZO J;  5GTH C;  1QNT A;  4MLO A;  3JRC A;  1FT9 A;  1ZHF A;  1SD5 A;  2V79 A;  1ON2 A;  2WTE A;  1X19 A;  3LSH A;  3HOY J;  1DQU A;  3M8F A;  1A6I A;  1MNE A;  2O3F A;  3FZV A;  3ML6 A;  2X6Y A;  4EJW A;  2VUM J;  5F0H A;  1ZQ3 P;  3I3L A;  1FC3 A;  4BXX J;  1R58 A;  2ZXW H;  4XSX F;  5BNG A;  3LSP A;  5K5R A;  2LD5 A;  1QU3 A;  1VTN C;  3HSF A;  5GAH J;  2YSR A;  3NQO A;  2WWY A;  4XOP A;  1HW1 A;  4U7B A;  5B1A H;  4J19 A;  4HYE A;  4D0P A;  3RZD J;  2F5E A;  4PJ0 C;  2K86 A;  3GLX A;  3H92 A;  4D5F A;  5GPC A;  4LG3 A;  3NWT A;  2R4G A;  2LF8 A;  1OKR A;  3FKI J;  1DGR M;  4A3D J;  4A3G J;  4BY1 J;  1UG0 A;  3AG3 H;  3K0L A;  1UHW A;  2R7S A;  2DDA A;  2D45 A;  2IRF G;  3KYD B;  2BEO A;  2NXN B;  1ENH A;  2LKX A;  2H1L A;  4BE0 A;  4XKW A;  2QBY A;  3QYE A;  2BW3 A;  4M73 A;  1D0X A;  3BZC A;  1Z1D A;  3OSG A;  5J40 A;  1XCV A;  1WJE A;  1UST A;  3K70 D;  3F22 A;  3JRE A;  1OLT A;  1MDM B;  3A02 A;  3A0H C;  1FBQ A;  1X3U A;  2ECB A;  2WV1 A;  3C7J A;  3O8H A;  4AYB A;  2P7C B;  4JX5 A;  3HZJ A;  1IRF A;  2K27 A;  1SVO A;  3A4C A;  3EPZ A;  1TW2 A;  1AWC A;  5LGU A;  1SFU A;  3VYR B;  1KQ0 A;  2ZFU A;  5M5Y J;  1VQM I;  2NRA C;  3HB9 A;  5M5X J;  1X2N A;  3S32 A;  5FKK A;  3I55 I;  4JX6 A;  1XC5 A;  4HX4 A;  2FNA A;  4XM3 A;  1J0R A;  3H9Q A;  2B7E A;  2O8X A;  2LK2 A;  4AWX B;  2CGP A;  2BGC A;  3PIO F;  1FIA A;  2QLZ A;  2Y48 A;  2QA4 I;  3LQQ A;  5ED4 A;  1BIB A;  3WGG A;  2XAG A;  3HGY A;  2Q2E A;  2X6X A;  4G12 A;  1XDU A;  4OOI A;  4A3J J;  5D5W B;  3PNT A;  3GZN B;  5FGM A;  2FOW A;  2Z99 A;  3H35 A;  4ENM A;  2X1C A;  1O3R A;  5FLX Z;  5D4R A;  2E34 A;  1L0O C;  2M8G X;  2OF7 A;  3LNQ A;  1ZAR A;  1D5Y A;  3I59 B;  3V7R A;  2PBI A;  2VE8 A;  5F1J A;  2OAZ A;  4V2G A;  3KIO A;  4X1E A;  3FXM A;  4E7K A;  1GVD A;  2DLL A;  1MH3 A;  2L9R A;  3CDL A;  2MYS A;  3S3M A;  3EDP A;  5IPA A;  2CO5 A;  2KPM A;  2ESN A;  4O3M A;  3KCC A;  2K9L A;  1WH7 A;  2DMU A;  3IRR A;  2VOO A;  1BBY A;  4B8X A;  1MJ9 A;  1K79 A;  1G8X A;  4M3F A;  1T56 A;  1R71 A;  1KZH A;  1IRG A;  4G8X A;  3L00 A;  3V4G A;  3ZMD A;  2VT2 A;  2DMT A;  4IHV A;  2ZKZ A;  1MW7 A;  1Z05 A;  3JRF A;  3BP8 A;  5B3S H;  2F5V A;  3DU5 A;  3CCY A;  3H36 A;  4PCQ A;  2VOD A;  1T08 B;  2WB1 A;  2EFN A;  2G7H A;  4H4K C;  4I0B A;  4UHT A;  3WE2 A;  3VSL A;  3B02 A;  3DQV C;  1YJN I;  4RAG A;  2Y2Z A;  3LSR A;  2E2I J;  3PSI A;  2EIK H;  2TDX A;  4B48 A;  1XPX A;  3S2H J;  4BE1 A;  5D5V B;  3E97 A;  3OSF A;  3JRH A;  1FYM A;  1TWA J;  2ELH A;  3BG6 A;  2O5R A;  5GP9 A;  1DGW Y;  2DQL A;  2MD5 A;  2E60 A;  2KJB A;  3LAP A;  3L2W A;  3NAR A;  2LOO A;  1STZ A;  4RM2 A;  4HST A;  2L02 A;  3G6E I;  2DPU A;  3JAM Z;  4LB5 A;  1I1S A;  1WPK A;  2KL4 A;  5J3L A;  1DU0 A;  1XCB A;  1T39 A;  2V9K A;  2EZI A;  4CZZ A;  3GYH X;  1VQK I;  4D1Q A;  4FQG A;  1R1U A;  1Y8R B;  3LSG A;  5LEJ A;  1P4X A;  2VPR A;  2EFP A;  1IN7 A;  3PNV A;  1MND A;  4ZYG A;  3L2C A;  1AA7 A;  2CYY A;  2H6B A;  1HC8 A;  5LFA A;  3Q3S A;  4ON0 A;  1X1P A;  2QF7 A;  4MQ9 F;  2IVM A;  3TW6 A;  5ICE A;  4YEJ A;  2WAE A;  2MBF A;  1S8N A;  1YIO A;  4PGH A;  1BC8 C;  1IRX A;  2EIJ H;  4N4N B;  2QEN A;  4ASN A;  1Y6I A;  4MIM A;  2CFX A;  4ZYD A;  5FB2 A;  2IS6 A;  3S1Q J;  4BDY A;  2H09 A;  3HBL A;  4E4H A;  3Q9V A;  3AAF A;  2E1M C;  3HRS A;  4BQA A;  4AD9 A;  3MQ0 A;  3OR2 C;  4KIB A;  1MD0 A;  3BJA A;  1NG7 A;  2COM A;  1MMN A;  2LY1 A;  3TO6 A;  1X3Z B;  4U88 A;  5D8K B;  4F92 B;  3MD2 A;  2VOP A;  1YS7 A;  4DW6 A;  2I8D A;  2KIS A;  4LJZ F;  2CQQ A;  3ZQI A;  1RR8 C;  2JTV A;  2IW5 A;  3QPH A;  4XSZ F;  1GDT A;  2EZL A;  3U2R A;  4M3D A;  2MAB A;  4EV0 A;  5LHG A;  3JRI A;  1HW5 A;  4ZDP A;  2K9M A;  4GRI A;  2MGQ A;  5FFX A;  4EM1 A;  4ABZ A;  2OCC H;  4XMY A;  3RQI A;  4LLG F;  1FZP B;  5JI6 A;  5K7H A;  3KZY A;  5FO5 A;  2LRD A;  2ZFW A;  2CMP A;  4KNY A;  5HS8 A;  1BOB A;  2EZK A;  2QQA A;  1IJW C;  5DS9 A;  2V1N A;  3A1Y A;  4UVB A;  3TQN A;  3LA7 A;  2E2H J;  4UUV A;  5BMZ A;  1YJ9 I;  4D5C A;  4RM3 A;  1LDK B;  2LTP A;  4O6J A;  4XR6 A;  4DYC A;  4L9J A;  3PIP F;  4BAY A;  2QBY B;  4I2O A;  2BW3 B;  2O8K A;  3HRM A;  2FEZ A;  1ORK A;  3SHF A;  4UV9 A;  2DFE A;  2ZC2 A;  3ZQF A;  1FTT A;  4N4O B;  2A68 F;  1H88 C;  4IHS A;  2PJP A;  5DEQ A;  3M8J A;  1KQ9 A;  2XAH A;  2XRN A;  1BN5 A;  4L18 B;  2X1D A;  2DFH A;  2DOF A;  5H6Q A;  5IOZ A;  2OQR A;  3KLO A;  3W2V A;  1W0T A;  3LMM A;  4DBR A;  1BR2 A;  4CDG A;  1P7J A;  4M9Z A;  3OYH A;  4XON A;  3DBR B;  5JHU A;  5HLG A;  2NVT J;  4XLE A;  1G3Y A;  4ZDL A;  2R7F A;  2E2J J;  5EEA A;  4HAM A;  2V4J C;  4XN0 A;  2VAS A;  2KT0 A;  5D4S A;  4KA4 A;  2ELK A;  2YS9 A;  2WY8 Q;  3GVA A;  1TWC J;  2JPB A;  3QAH A;  2JA2 A;  3G4S I;  3HXL A;  4ENJ A;  3T5X A;  1PUF A;  3C1D A;  3K4C A;  2MC3 A;  1R22 A;  2ZME C;  3JSP A;  4F93 B;  2Q2E B;  3ROU A;  2UWM A;  3DPT A;  1LDJ A;  2OTL I;  2H8R A;  4AVZ A;  1WI3 A;  4IRI A;  4M3B A;  2IS4 A;  3EUK L;  2G9W A;  3OYI A;  3BR6 A;  3H3Z A;  3K4M A;  2VBX A;  4HOB A;  2BV6 A;  5FRN A;  4CCJ A;  1TZL A;  3HUG A;  2QEX I;  4G6D A;  3CLQ A;  3ASO H;  1D8K A;  2RGV A;  2HZT A;  4NBQ A;  2QVO A;  5LBQ A;  2XPV A;  5KVR A;  3OIP A;  2AXT C;  4ZZL A;  5IT3 A;  2VI6 A;  4RAY A;  5J6X A;  3LSI A;  4K2E A;  1YFH A;  2YU3 A;  3F0C A;  3K1M A;  2JA6 J;  1W36 D;  5LGT A;  2L7F P;  2GIV A;  5EJC A;  2LDU A;  3HM5 A;  3WGI A;  3GTP J;  1UHS A;  3CMM A;  4Y7N J;  1JTX A;  2CV0 A;  3L7W A;  1IC8 A;  2ZME A;  1WJD A;  2A07 F;  3X2Q H;  1J5Y A;  3WG7 H;  3J7Y J;  1V5F A;  1PP8 F;  2W24 A;  5A2Q Z;  4ENN A;  2RV8 A;  3MKL A;  3WE3 A;  3FM5 A;  4Z6Y A;  2P6S A;  3SJM A;  2RQP A;  2WB1 N;  2A5W A;  2VLA A;  3BG9 A;  3FHZ A;  3M1E A;  4DYQ A;  2W84 A;  3E6C C;  3OS1 A;  1ZLK A;  2HVS A;  1JUP A;  3W2W A;  4P96 A;  1Z3X A;  1LPQ A;  1FLI A;  2BOL A;  1V5G A;  4I01 A;  4BHB A;  1GVJ A;  2VQC A;  3OYK A;  5CVI A;  2DT7 B;  1V54 H;  2XGX A;  4ZDO A;  4B1R A;  2A5Y B;  2XAF A;  4IHX A;  3DTI A;  5AIP A;  3FXR A;  1Q1V A;  4IOC F;  2WA0 A;  4QTR A;  4PJL A;  4Q47 A;  2V7F A;  3P5J A;  4IVN A;  5L3E A;  2E7W A;  2ZCW A;  4BY7 J;  1W7P A;  4CUG A;  3WTS C;  2L9S A;  5IOY A;  2HTJ A;  3IP4 B;  3DPL C;  3PUB A;  4N9H A;  2IGO A;  1Z6R A;  3HPG A;  3LAJ A;  4G7O F;  2EPF A;  3E7L A;  4CGZ A;  3A2K A;  1RUO A;  4QSH A;  4S0H B;  4CIC A;  5C3E J;  1W5T A;  1OR7 C;  2ZJ2 A;  4B3X A;  4V2F A;  1W0U A;  3EUH C;  4I99 C;  2ZXH A;  4HNU A;  4IX7 A;  1ZG5 A;  1GT0 C;  1QPI A;  2EIM H;  4RLQ A;  3GTK J;  2OZ6 A;  4CCN A;  1WH5 A;  4IO9 F;  2WAD A;  1J2X A;  2KRC A;  1YOV B;  1P6R A;  5FD6 A;  3BLY A;  2CQ7 A;  1B1B A;  4BAC A;  1XS9 A;  1D5V A;  2F4I A;  2CUJ A;  3CJQ B;  2PI0 A;  1FSE A;  2X4H A;  5L3F A;  3RKX A;  2M30 A;  2H94 A;  2M9H A;  5H2F C;  1SAX A;  2YX4 A;  1I3A A;  4RB0 A;  3NRV A;  1E2X A;  2JPC A;  3Q9S A;  1LFP A;  4JBA A;  5FRM A;  2V1X A;  2RAE A;  3IWF A;  3VDX A;  1IXR C;  1Y56 A;  4FAS D;  1R49 A;  4NDL A;  3AL0 C;  5D5U B;  3HDD A;  2QGU A;  1U9N A;  4D7N A;  1I1G A;  3U1K A;  2GOM A;  4PJM A;  2PQ8 A;  1OR7 A;  1IDY A;  1BI3 A;  4YII A;  3EUH A;  3E3V A;  5IYC J;  1P2F A;  1POG A;  3KEQ A;  3JCU C;  1QRY A;  3MCZ A;  5KHD A;  5K5O A;  1LB2 A;  1K61 A;  2R7D A;  1G4D A;  3CO6 C;  3OIO A;  2ZB9 A;  4HPQ A;  1R7J A;  3ZOB A;  3NEU A;  3FMQ A;  3LSK A;  1MJA A;  1RR7 A;  1A04 A;  3H3V K;  2ISY A;  3ZR8 X;  4LIT A;  4BL0 B;  2RNJ A;  4KJZ A;  2R92 J;  2BXY A;  1LJ9 A;  3S14 J;  1MBF A;  2E1M B;  1Z3Y A;  4GGG A;  4M74 A;  4R1H A;  3PFY A;  5KCM A;  1N75 A;  3S1M J;  1LQ1 A;  1J9I A;  2K4J A;  2OU2 A;  2L3D A;  3F8N A;  5CPR B;  3OYL A;  2YPR A;  2FSW A;  3V42 A;  3FXL A;  1Z7U A;  2BHY A;  5AON A;  4PFP A;  4II3 A;  4A0Z A;  1CF7 A;  1WJA A;  1ZRE A;  4FCY A;  4B09 A;  3G1L A;  1BI0 A;  4U87 A;  3H5N A;  4KN4 X;  1V3F A;  2EA2 A;  5F0C A;  2XAQ A;  4AIH A;  1VQL I;  4BEH A;  3W2A A;  2HKO A;  3MKW B;  2VBW A;  1U3E M;  5BPI A;  2V26 A;  4QWQ A;  4JQF A;  4NC7 A;  4A0Y A;  1I50 J;  3R0J A;  3T0Y A;  2HFH A;  2AS5 F;  1QHH D;  5TIS C;  1G6N A;  3AG2 H;  3CUQ C;  2CW7 A;  2X48 A;  3E5Q A;  1PUF B;  1WI9 A;  2DPD A;  1XN7 A;  3KP7 A;  2L4A A;  1IUY A;  4BJT A;  5J8C A;  2ADU A;  1VI0 A;  3FXU A;  2EV0 A;  2JVH A;  4OU0 A;  5CQE A;  5FKM A;  3S2W A;  1S6L A;  4WX9 A;  2F5F A;  4L5I A;  3R6S A;  2M7A A;  4JYK A;  1O7F A;  2M45 A;  4HZF A;  4OIP F;  4XRF A;  2XVC A;  3QPT A;  5CJ9 A;  1HA8 A;  2JRM A;  3Q0V A;  3GUD A;  4M6V A;  4OAZ A;  2VON A;  4M71 A;  1IXS B;  4P5O A;  2V9P A;  2BHZ A;  2CWE A;  3U9G A;  3OYF A;  4I6Z A;  3KP4 A;  2N8G A;  1VQO I;  1Z21 A;  3FBI B;  3DCF A;  4RMN A;  2PEX A;  3DF8 A;  3KLN A;  5B1B H;  2WY7 Q;  2XKP A;  4XRS A;  4B44 A;  3HOU J;  3MZ8 A;  1WVR A;  5DD8 A;  4OIN F;  3DKW A;  3Q5F A;  1YRN A;  3CUQ A;  4PK4 A;  4UB6 C;  1S5L C;  3ZQ7 A;  3G1O A;  2V6C A;  4DYR A;  4M6Y A;  3F9K A;  3T8R A;  1MJB A;  2ZME B;  3ZMT A;  2Q1Z B;  2WV0 A;  3R0A A;  3NWS A;  3PSF A;  2JA7 J;  4P9F A;  3GFI A;  3QU3 A;  2XSJ C;  1C0W A;  1U9O A;  3B6C A;  5GTI C;  2LY9 A;  4A6E A;  3E5U A;  3S16 J;  3KPH A;  4LGW A;  1RKT A;  1QZY A;  1RKW A;  4L9T A;  3DTE A;  2XPW A;  1M1E B;  3WTV C;  2P8T A;  2E35 A;  4MGR A;  4YFK F;  3GF2 A;  1WQ2 A;  4WXD A;  4AIJ A;  2FJ1 A;  4QPQ A;  1P4W A;  4GCV A;  4ZJZ A;  2R7O A;  3CJR B;  2VKD A;  1B8I A;  2FD5 A;  4XIC A;  5C44 J;  4IZZ A;  3OYG A;  1X58 A;  1W7P B;  4O5V A;  1SMY F;  2L9V A;  5E3M A;  4RGS A;  4BUP A;  4NC6 A;  5CVJ A;  2JWT A;  4DNC A;  3HTS B;  1HLV A;  1OQY A;  1FOW A;  1YG2 A;  3DKX A;  1IO2 A;  5HDN A;  1F43 A;  4FT8 A;  1T98 A;  4M3G A;  2MW8 A;  3EUA A;  2EWN A;  2NOJ B;  5JLW A;  3ZN0 A;  4FET A;  1ONV A;  2CFO A;  4PJN A;  2A05 A;  3JRA A;  5FKN A;  3TW7 A;  3PJR A;  4XNF A;  4CXF A;  4MNU A;  5IT9 Z;  2O03 A;  3ERM A;  2BY3 A;  3ZQG A;  1P9Q C;  1VQ8 I;  2AQF A;  3T8T A;  2XRO A;  4R79 A;  3CCJ I;  2X85 A;  2DFI A;  3BOQ A;  3M9A A;  1A35 A;  2UZK A;  1D1C A;  4QIW N;  1WGX A;  3L09 A;  4MO7 A;  4XK4 A;  2GXA A;  1S9H A;  3PQJ A;  4KFC A;  4G7H F;  4HV5 A;  4V19 K;  2A61 A;  3VOD A;  5ICG A;  4RB2 C;  2XB5 A;  2IPQ X;  2FF4 A;  1EKE A;  2VKE A;  3QP5 A;  1U2W A;  2HS5 A;  4PZJ A;  5HOO A;  2O7O A;  3HEF A;  2EA4 A;  1CQT A;  2OPT A;  3CCV I;  2LR8 A;  5E17 F;  1JKR C;  2CG4 A;  5HDG A;  2R7Z J;  3WGH A;  3S2D J;  3REO A;  5JVT A;  4X0G A;  5DD4 A;  4W1U A;  2DA6 A;  1HOM A;  2QYO A;  1SAN A;  1LEB A;  3PUF A;  1I6H J;  3ZQQ A;  3W6J B;  1BC7 C;  1ETK A;  3H5A A;  4UB8 C;  2RNG A;  2VKH A;  3BC8 A;  5HNH A;  1S7E A;  5D6E A;  2D5V A;  1XSX A;  3ZMS A;  1V5E A;  2H27 A;  1MMD A;  2XKO A;  5K1Y A;  4ESB A;  1HKS A;  2Y9Z A;  2EBI A;  1QZE A;  2VJI A;  2ZO4 A;  3BPX A;  3ZGK A;  4CYC A;  3F8C A;  3BT9 A;  2L0K A;  1XD7 A;  2RRE A;  2WAQ A;  2VC1 A;  1EJ9 A;  2P5L C;  5L3G A;  2V1D A;  3IAM 2;  4YEL A;  2BYV E;  4I09 A;  1X1B A;  3RYR A;  3OY9 A;  1YJW I;  3DXJ F;  3PNY A;  1FYK A;  4A3F J;  3A03 A;  2HQN A;  4MHG A;  4WWC A;  4Y13 A;  3AL0 B;  2IAI A;  2M0C A;  3I56 I;  1XGS A;  4D9J A;  1EA3 A;  2K9Q A;  3I4P A;  4WK8 F;  1CF7 B;  3TOB A;  2B9S A;  2EIN H;  1VFC A;  4RAZ A;  3D1N I;  3S3O A;  4BEH B;  1BW5 A;  2IP2 A;  4EGZ A;  2PJR A;  1R00 A;  2CRG A;  1OCP A;  3IC7 A;  2IT0 A;  4BBR J;  3DV8 A;  4R8H A;  2FXA A;  1R4N B;  2LLK A;  1KGS A;  5ILS A;  3F3X A;  4HX7 A;  1IDZ A;  4EM2 A;  2JN6 A;  2LC2 A;  5E1X A;  5EZG A;  1LKX A;  4CHU A;  2VIX A;  3RSN A;  3S93 A;  4XN3 A;  3SZP A;  1JGG A;  1DUX C;  1GXQ A;  1JGS A;  4C9Y A;  1MBH A;  2IJL A;  1BW6 A;  2MLG A;  2HI3 A;  3TL4 X;  2KQR A;  2R3S A;  2XRL A;  2LFB A;  5CKT A;  4FE4 A;  2DOD A;  3R61 A;  2DJI A;  2W85 A;  3IHU A;  3K4N A;  2W7N A;  3I5U A;  1S29 A;  3HSE A;  4MQV A;  4CA0 A;  3GTQ J;  5HOD A;  2Q0O A;  6PAX A;  3EET A;  2I10 A;  3ECH A;  1J59 A;  2B63 J;  1E17 A;  2DXI A;  5BOX A;  1JHF A;  2DI3 A;  2YX7 A;  1FP1 D;  3GTO J;  2HOE A;  1T95 A;  4FE7 A;  4LFU A;  3CTA A;  3GEZ A;  4OIO F;  1SFX A;  5DYM A;  5ICC A;  3CUQ B;  3DLL F;  2XDV A;  3OYC A;  1V4R A;  2DO7 A;  1H9G A;  2DTR A;  2L7Z A;  2RQQ A;  5CLS A;  1GUU A;  1ODD A;  4BU2 A;  4JX4 A;  4ETS A;  4E7L A;  3FIS A;  1OCC H;  3KYC B;  2HQ5 A;  4DQ2 A;  3G73 A;  2HU9 A;  3ESW B;  1PYV A;  2DCE A;  3UNG C;  3BCA A;  1BIA A;  4XLF A;  2FE3 A;  5LGN A;  4WXC A;  1ETO A;  5F04 A;  1YHQ I;  1BR4 A;  3F8B A;  4IEJ A;  1ETV A;  3KYL A;  3K70 C;  3TGN A;  1MSF C;  4WF2 A;  1K78 A;  1TBX A;  1FOK A;  1E0E A;  1QVU A;  3LST A;  1IV8 A;  1K7A A;  3I58 A;  3QQA A;  5KNL A;  4XOT A;  1B8I B;  2DFF A;  2ID6 A;  3FK7 A;  4KIC A;  4WCG A;  2LY2 A;  1YX5 A;  1D0Z A;  1G3S A;  3DBH B;  1ZRD A;  3IH2 A;  4GYG A;  2Z3Y A;  1I3Q J;  4EJO A;  4XKC A;  5J1U A;  5J1R A;  2IS2 A;  1MSE C;  1TNS A;  1TTY A;  4ZYH A;  1HST A;  2PMZ A;  2NAZ A;  2Y9Y A;  3BJO A;  1PJR A;  2R7V A;  1B6A A;  5LD2 C;  1WFX A;  1LE8 A;  2RKH A;  4NQW A;  2B0L A;  2X6O A;  3KEY A;  2NNY A;  3I0T A;  2ME6 A;  2CV1 A;  4HQE A;  3SXY A;  1AU7 A;  2L9N A;  2VQH A;  2QQ8 A;  3RI4 A;  1LDD A;  3VOE A;  2OD5 A;  2LG4 A;  5E1Z B;  3BG5 A;  3ZMZ A;  3CCE I;  3VEP A;  4Y52 J;  5F6F A;  3KET A;  4NHJ A;  3TO9 A;  2GAU A;  2Y0S A;  1UG2 A;  1UZC A;  2A69 F;  5FLM J;  3TDU C;  1X1D A;  2D1H A;  2GXG A;  4IHT A;  1TQM A;  5LHI A;  2JA5 J;  1JUS A;  3F72 A;  2HEO A;  5EDN A;  5K5Q A;  2LBF A;  2HPI A;  3RJP A;  2O9L A;  3V8J A;  1HCR A;  4KYW A;  1U5T C;  2HQA A;  2K02 A;  3KP5 A;  3RDI A;  2C6Y A;  3MMY B;  4M6X A;  1WCM J;  2W48 A;  3HKZ A;  2HZD A;  4OWR B;  1W5C C;  3BG3 A;  2CQK A;  1ETW A;  3IL2 A;  4AYB N;  2VN2 A;  1YE9 A;  4CO8 A;  1BL0 A;  3F23 A;  2CJJ A;  1W4M A;  4NB5 A;  2L5Q A;  3K2A A;  1E3H A;  2EFO A;  3TBI A;  5KAI C;  4KIG A;  2VPL A;  2JSC A;  1R9T J;  4KN7 X;  5E3L A;  1GHC A;  1G3W A;  3FF5 A;  4HSR A;  3BRO A;  5E79 C;  3HC7 A;  5JVG F;  5TJJ A;  4A2U A;  4CYC B;  2P0W A;  3PQK A;  2A6T A;  1SVL A;  2M5W A;  2OJE D;  3DEE A;  3HOT A;  2WAQ N;  2K3P A;  3VSK A;  4BJ6 C;  3M4O J;  3BTC A;  1SD6 A;  4D7M A;  2EIL H;  1JJ8 C;  4ENK A;  1UHM A;  1YYV A;  2CUE A;  2L01 A;  1OFC X;  2PFB A;  2KIM A;  2HGC A;  1U5T A;  3TO7 A;  4F3Q A;  1G59 A;  1T0F C;  1P7I A;  1YW8 A;  4RA2 A;  4E6K G;  2F5C A;  2HYJ A;  3H3U A;  5CYV A;  3O6B B;  4BE2 A;  3I4M J;  1X1C A;  4HLY A;  3LSJ A;  2X51 A;  2H6C A;  4HDV A;  1OCR H;  1N77 A;  4RB1 A;  3PM1 A;  4E7Z A;  3GFL A;  3FHN A;  3OL4 A;  3UR3 C;  2K7L A;  2BVM A;  1ZGA A;  5JLX A;  2JK3 A;  1LNW A;  4KMF A;  5EG0 A;  4IQJ A;  1G3T A;  2WAF A;  1WSU A;  4HNT A;  5BQT A;  3F8F A;  1TC3 C;  1JT0 A;  4M9X A;  4A3C J;  3OYE A;  2R7Q A;  4YIF A;  2DA4 A;  2KZG A;  1MIJ A;  1V55 H;  2QWW A;  3DFG A;  4GFB A;  1XMK A;  1ZLJ A;  2D2W A;  1QBJ A;  1VQ7 I;  3V8L A;  2HYF A;  2NOG A;  2E5N A;  4GO1 A;  3S17 J;  1ZRC A;  1UCR A;  4XRM A;  1A36 A;  2MSY A;  3E6B A;  1X4O A;  2YU9 J;  1ZGJ A;  1T0F A;  3KP2 A;  3BTL A;  3QYB A;  5IP9 J;  5JR3 A;  3TP3 A;  3MEX A;  2Z5U A;  4CCK A;  1Y1W J;  3FXO A;  5DV5 A;  3VYT B;  4YFX F;  2FMY A;  2VB6 A;  2P4W A;  3BJ6 A;  3FBN B;  1AHD P;  4OMY A;  2E1N A;  1SMT A;  4C2U A;  2R5Z A;  2QKL B;  1QO0 D;  5HLH A;  1ACI A;  4G6Q A;  3RCO A;  3SYT A;  2CS3 A;  2V6E A;  4ZC3 A;  4LMY A;  1ETQ A;  5HVQ C;  3ERE D;  2L7M P;  2XGE A;  4A5N A;  4C2M J;  3HL2 A;  3LSM A;  4TV7 A;  1SFK A;  1P4A A;  3BTJ A;  3WTX C;  2EB7 A;  3M7G A;  1OCZ H;  5ICF A;  2JUC A;  3IH3 A;  2HVQ A;  2K5C A;  2FBH A;  1LEA A;  3R60 A;  2CQN A;  2HOA A;  4CZC A;  2DA7 A;  2BY2 A;  1RC9 A;  2YR2 A;  5IP7 J;  5CQG A;  5IYD J;  2V1U A;  2YUS A;  4BDZ A;  2KIF A;  3C3W A;  3A01 A;  5TRD A;  3ABT A;  1O4X A;  4OIQ F;  1VQ4 I;  1OMI A;  2BY0 A;  4YRV A;  3CC4 I;  5HS9 A;  1K6Y A;  1K78 B;  5HS7 A;  4OMZ A;  3RPU D;  2XAJ A;  3WTY C;  2GA2 A;  3I71 A;  1Z91 A;  2R7R A;  1K83 J;  3S1R J;  3IKV A;  3H9G A;  2LNB A;  1KQ8 A;  4PJJ A;  1SD7 A;  2P7V B;  4EMS A;  1MBJ A;  2HDC A;  2IS1 A;  2LH9 A;  2W82 A;  4IPA A;  3K4B A;  1Y39 A;  1NH3 A;  3OYD A;  3IAS 2;  4XLN F;  4HRI A;  1D8J A;  2QZ8 A;  4W97 A;  3ULQ B;  3FXJ A;  5B5E C;  3HGG A;  3L2V A;  2HXI A;  1KU3 A;  4IRG A;  3SEZ A;  5GPA A;  4DOZ A;  4NQW B;  3PL8 A;  3SDB A;  1BJA A;  3TED A;  1SFO J;  1LE8 B;  4P55 A;  4IJA A;  2ICW G;  2Y31 A;  2GQQ A;  1OYI A;  5EEH A;  3OYA A;  2VJ4 A;  2QM3 A;  5L3C A;  3FX3 A;  5KAF C;  3DWL E;  2F48 A;  2K4B A;  5FD5 A;  2NYX A;  4XBF A;  4B47 A;  4C3J J;  2GA1 A;  1MGT A;  4AU7 A;  1BJZ A;  2M34 A;  3MKY B;  3EYY A;  3HOX J;  3JR9 A;  1SD4 A;  1YS6 A;  1GV5 A;  2E5Z A;  1YW7 A;  3S8P A;  3QPS A;  2DT5 A;  3V7C A;  4AIK A;  4G94 A;  1S72 I;  3K10 A;  1AKH A;  1XX5 A;  3F21 A;  1YI2 I;  1R1T A;  5HDK A;  1IAW A;  3WTZ A;  3F6O A;  1JXS A;  3JRD A;  2EJR A;  1W36 C;  1XSV A;  2HYG D;  2LBF B;  2K40 A;  1ZH5 A;  3UKG A;  2EH3 A;  2HKX A;  5CVU A;  3EQL F;  3DKY A;  1OYW A;  1FX7 A;  2KKO A;  4IHW A;  3ZP5 A;  5DTD A;  1ERD A;  1KYZ A;  2W4S A;  1SC7 A;  4A0X A;  1XDS A;  2XGD A;  3EYI A;  4LD5 A;  3C2B A;  3HKZ N;  1HW2 A;  4UVC A;  5J4V A;  3LFU A;  3N97 A;  3TOA A;  1DU6 A;  4BNC A;  2BXZ A;  4RGU A;  2CUZ A;  3CES A;  3D5L A;  1DP3 A;  1IN8 A;  2FML A;  2FOK A;  1TL8 A;  2BVL A;  2ETH A;  3VYU B;  1SAU A;  2OA4 A;  4CYD A;  3ZCO A;  2DQR A;  2XC7 A;  4M9S A;  2OBP A;  4DZJ A;  1CGP A;  3COA C;  4EVI A;  3L1P A;  1MMG A;  3DEU A;  3DEW A;  1QA6 A;  2DMQ A;  4FHT A;  1H0M A;  4HDU A;  1HKT A;  4KUM A;  3TMO A;  1VQN I;  1SVM A;  3D5R C;  1U5T B;  5DM6 F;  4J01 A;  1EH8 A;  4LLL A;  3GZ6 A;  2ZNY A;  4L0Z B;  3RIR A;  2WBM A;  2DK5 A;  5LRR A;  1FMW A;  5F08 A;  3G71 I;  3CUO A;  1K4S A;  2ESH A;  1X3W B;  3HUG B;  1FOX A;  3BZ6 A;  1EH7 A;  4J00 A;  2F2E A;  1QHG A;  4OAY A;  5D5X B;  5EG0 B;  3MZH A;  3ZMV A;  1RES A;  5H6R A;  5CVV A;  4Y15 A;  3ABM H;  2AXL A;  2RDP A;  1YX3 A;  2HWV A;  4MEY F;  1TW3 A;  3J80 K;  1FJL A;  2FUG 2;  2UXN A;  1XGM A;  3GX4 X;  1HBX G;  3FM3 A;  3CDH A;  2VL8 A;  1NG6 A;  2Z1D A;  3E5X A;  2A3S A;  3OR1 C;  4PSW A;  2KHM A;  1IG7 A;  3BR3 A;  2QSG X;  2LKP A;  4L5E A;  2JRT A;  4RLF A;  5M5W J;  3JTH A;  4ESF A;  1REP C;  4JP0 A;  2JA8 J;  3A0B C;  3RQ4 A;  3HPH A;  3P9C A;  1WZ2 A;  4L9V A;  1XMX A;  4HEA 2;  1ITY A;  1MMS A;  2IA1 A;  4QLC U;  1I5Z A;  1R5H A;  1S7O A;  1TQP A;  3GXO A;  1RZ4 A;  3OYM A;  5LHH A;  4UY8 I;  3SEQ A;  3CQZ J;  3WHC A;  3ZMU A;  2Q8K A;  5JFR A;  1IZ1 A;  3ABK H;  3BQZ A;  2R5Z B;  1NK2 P;  1U78 A;  3BR5 A;  4A3M J;  3G1M A;  4BYY A;  4XQF A;  2P81 A;  3IH4 A;  5BPD A; 
#chains in the Genus database with same CATH homology
 3D0S A;  1IF1 A;  3R4K A;  2STT A;  3KFW X;  3HYI A;  4JK1 X;  3C18 A;  4HF0 A;  4RGX A;  4HX8 A;  1DP7 P;  2PMU A;  1RIO H;  1TQI A;  2KJC A;  2F5D A;  3HHH A;  1PP7 U;  5BS6 A;  2MLK A;  1TNT A;  4RGR A;  3CJN A;  1O7L A;  3WTT C;  3MWM A;  2XUB A;  2L54 A;  1R23 A;  5E8G A;  1XGN A;  2NS0 A;  1F4K A;  3O3K A;  5LRS A;  1YTY A;  4YFN F;  4UVA A;  5EEG A;  4EQQ A;  3WOD F;  2VBZ A;  5LLQ A;  2Y75 A;  3TDZ C;  3TKY A;  5HLI A;  4M72 A;  1TLH B;  2P6T A;  4KMU X;  1T38 A;  2MH9 A;  2M8E A;  2MA3 A;  3KE2 A;  4RS8 A;  3HOS A;  1JHH A;  4G9Y A;  2PG4 A;  3HHG A;  2JZY A;  2EFQ A;  2KIU A;  1FYL A;  1O3T A;  1B9N A;  2EFW A;  3JSO A;  3KP6 A;  1YO5 C;  1RI7 A;  4UV8 A;  4WXH A;  2MH2 A;  3VB2 A;  5F1R A;  1T2K A;  1B4A A;  4A6D A;  5DCF A;  3LA2 A;  3MFK A;  1H9T A;  2V9V A;  1WKM A;  1EH6 A;  3WG9 A;  1QZZ A;  2VE9 A;  2VBY A;  3I64 A;  4KIF A;  1HXD A;  2GWR A;  1USS A;  1ZRF A;  2ZXJ A;  3M8E A;  3QRF F;  1BOA A;  2LF7 A;  3WTU C;  1KU9 A;  3GO5 A;  3F6V A;  2ZBK A;  1D3Y A;  4P9U A;  2O61 A;  3MZY A;  4L0Y B;  3J81 K;  5L3B A;  5CVR A;  1XGO A;  2DU9 A;  2IA2 A;  1B59 A;  2Y0M A;  4BHP A;  1BI1 A;  3J7A O;  5E8I A;  1WWX A;  2ISZ A;  4EJT A;  2PMH A;  1U8R A;  2OZU A;  1ZAO A;  1S7A A;  2M1B A;  3RKW A;  4Q5S F;  3HSR A;  1O3Q A;  2STW A;  4BHC A;  3LQR A;  3CO7 C;  1YW9 A;  1ZG1 A;  4S04 A;  3ZN1 A;  3I53 A;  3GZ5 A;  5DUI A;  3RTR A;  2DAO A;  5E1W A;  2P5K A;  1RNL A;  4GXO A;  1HKQ A;  2EK5 A;  2J5P A;  3I54 A;  1FPQ A;  1W7P D;  5E20 A;  4S05 A;  1L3L A;  2JT1 A;  5D8L B;  4IRH A;  2EV6 A;  1SFE A;  2RC4 A;  5DDG A;  3T1B A;  1S3J A;  3WU1 B;  3ZPL A;  4PGG A;  3N4M A;  3FWE A;  3GW2 A;  2CW0 F;  3QP6 A;  3K1N A;  3GFM A;  4FX0 A;  1QQI A;  1IN5 A;  2BBY A;  5IT9 K;  2PN6 A;  3HRT A;  5J8F A;  2XAS A;  4F7Z A;  3OOP A;  3QU6 A;  1I6X A;  4E70 A;  4U0V A;  1ZG3 A;  4N0B A;  1FNN A;  1YLF A;  3KP3 A;  4HA8 A;  1PDN C;  4LG0 A;  5H20 A;  1KA8 A;  4H0E A;  4UXN A;  1U6G A;  3P9K A;  3GWZ A;  1KU2 A;  2J5O A;  2XHK A;  1HSJ A;  3BWG A;  2EV5 A;  1ON1 A;  3V8K A;  2O6G E;  1FSH A;  4MEX F;  1LVA A;  4I7H A;  3E6M A;  4BXU A;  1ZYR F;  4ZYE A;  1R36 A;  1WRJ A;  2GZW A;  2RN7 A;  1FBU A;  3PFI A;  1NHA A;  1MZB A;  2FBK A;  3O2P E;  3VFZ A;  3J80 Z;  1P92 A;  5FLX K;  3ELK A;  2DW4 A;  5AIQ A;  1Q1H A;  4EM0 B;  1O3S A;  5L3D A;  3RPQ A;  2NNN A;  3JTG A;  1IN6 A;  1IW7 F;  2A6E F;  3G3Z A;  3BY6 A;  3LWF A;  4IXA A;  2DK8 A;  2X0L A;  2QUF A;  3KZZ A;  2IA0 A;  4ZZD A;  1F5T A;  1AOY A;  3K69 A;  2P5V A;  3FMR A;  4OIR F;  1R5G A;  1FWZ A;  5ERI A;  4LK1 F;  4Q4Z F;  1Z9C A;  2E7X A;  1QPM A;  4HLX A;  5ILV A;  1R1V A;  1FBS A;  3FMS A;  3P7N A;  3DP7 A;  1JE8 A;  1I27 A;  4EJV A;  2LSO A;  1DDN A;  3SQN A;  2A6H F;  4U7D A;  2WC2 A;  5DCM A;  3JAM K;  2UXX A;  4AVP A;  2HR3 A;  1J75 A;  1RUN A;  1W5S A;  1XB4 A;  1KU7 A;  1Z6T A;  4A12 A;  4XLP F;  1DPR A;  5LEK A;  4MTD A;  2FU4 A;  3V7S A;  2M87 A;  3SZT A;  2VXZ A;  3HTU A;  3BPV A;  5FFZ A;  4MTE A;  4HF1 A;  1GXP A;  1KYW A;  3BDD A;  1MKM A;  2O0Y A;  1FP2 A;  4LB6 B;  4UNO A;  2Z9O A;  2XIG A;  2L4M A;  1QGP A;  5ILU A;  2BE5 F;  3IRQ A;  3SFZ A;  1F1Z A;  4ESJ A;  3HRU A;  1MDM A;  2HQR A;  4EJU A;  1B9M A;  4L5J A;  5F64 A;  2CSO A;  2KRF A;  2PLY A;  4EGY A;  1BM9 A;  3L9F A;  3RYP A;  4A5M A;  1EV7 A;  4BH9 A;  3WTW C;  2VT3 A;  2VC0 A;  1O57 A;  2E1C A;  5DUK A;  3OV8 A;  2ZNZ A;  1UFM A;  1BI2 A;  3K2Z A;  4Z2Y A;  4LG0 B;  4U0Y A;  3U1D A;  5E18 F;  2DBB A;  2FBI A;  4LK0 F;  4G7Z F;  1T6S A;  3B73 A;  1PUE E;  3LA3 A;  3IWZ A;  2Z33 A;  1XMA A;  4ZH4 F;  1HQC A;  2QQ9 A;  3I59 A;  4HBL A;  1XSD A;  3WU0 A;  3JW4 A;  1DPU A;  1ULY A;  4HQM A;  4I0A A;  3F8M A;  1FY7 A;  1F9N A;  2W57 A;  4HF2 A;  1K6O A;  3ECO A;  1IN4 A;  2FA5 A;  4Q48 A;  3ABU A;  3ISP A;  1YQA A;  3CLO A;  4U0W A;  3P9I A;  2RVC A;  2ACJ A;  2FNP A;  2HTS A;  1UB9 A;  1OPC A;  3J81 Z;  2OQG A;  3IKT A;  3K9T A;  3GFJ A;  2G7U A;  3K1P A;  4LLN A;  3KEO A;  1IXC A;  4I02 A;  1J7K A;  4Y17 A;  3FXQ A;  3MAJ A;  2FQ3 A;  3RPU A;  4YG2 F;  4N9I A;  2FRH A;  1OYY A;  4I98 B;  4GYI A;  5A2Q K;  2GXB A;  2W25 A;  3QOP A;  5KK1 A;  2QQB A;  4HW0 A;  1Y0U A;  4IF4 A;  3HIF A;  1ZN2 A;  3E6D A;  4PDK A;  4L9N A;  3LFK A;  5D6F A;  2XV4 S;  3RKY A;  4RB3 C;  4KDP A;  4KT5 C;  4HV6 A;  4FX4 A;  5DCM B;  2D1V A;  3W6K B;  1QNT A;  1FT9 A;  1ZHF A;  1SD5 A;  2V79 A;  1ON2 A;  2WTE A;  3M8F A;  3ML6 A;  4EJW A;  2O3F A;  3FZV A;  1FC3 A;  1R58 A;  4XSX F;  5K5R A;  1VTN C;  3HSF A;  2WWY A;  2YSR A;  3NQO A;  1HW1 A;  4U7B A;  4HYE A;  4D0P A;  2F5E A;  2K86 A;  3GLX A;  3H92 A;  2LF8 A;  1OKR A;  3K0L A;  1UHW A;  2D45 A;  2IRF G;  2BEO A;  2QBY A;  4M73 A;  1Z1D A;  1XCV A;  1UST A;  3F22 A;  1MDM B;  1FBQ A;  1X3U A;  3C7J A;  2P7C B;  1IRF A;  2K27 A;  1TW2 A;  1AWC A;  5LGU A;  1SFU A;  1KQ0 A;  2NRA C;  4HX4 A;  2FNA A;  1J0R A;  2O8X A;  4AWX B;  2CGP A;  2BGC A;  2QLZ A;  2Y48 A;  3LQQ A;  5ED4 A;  1BIB A;  3WGG A;  2XAG A;  2Q2E A;  4OOI A;  1XDU A;  5D5W B;  5FGM A;  2Z99 A;  4ENM A;  1O3R A;  5FLX Z;  5D4R A;  1L0O C;  1ZAR A;  3I59 B;  3V7R A;  2PBI A;  2VE8 A;  2OAZ A;  2DLL A;  3EDP A;  2CO5 A;  2ESN A;  4O3M A;  3KCC A;  3IRR A;  2VOO A;  1BBY A;  4B8X A;  1MJ9 A;  1K79 A;  1IRG A;  4G8X A;  3L00 A;  3V4G A;  3ZMD A;  2VT2 A;  2ZKZ A;  1Z05 A;  3BP8 A;  4PCQ A;  2VOD A;  2EFN A;  2G7H A;  4I0B A;  4UHT A;  3WE2 A;  3B02 A;  3DQV C;  2TDX A;  5D5V B;  3E97 A;  1FYM A;  2ELH A;  2DQL A;  2MD5 A;  2KJB A;  3LAP A;  1STZ A;  2L02 A;  2DPU A;  3JAM Z;  4LB5 A;  1I1S A;  1XCB A;  1T39 A;  3GYH X;  4CZZ A;  1R1U A;  5LEJ A;  1P4X A;  2EFP A;  1IN7 A;  4ZYG A;  3L2C A;  2CYY A;  2H6B A;  4ON0 A;  4MQ9 F;  2IVM A;  5ICE A;  2MBF A;  1S8N A;  1YIO A;  4PGH A;  1BC8 C;  4ASN A;  2QEN A;  4ZYD A;  2CFX A;  5FB2 A;  2H09 A;  3Q9V A;  3AAF A;  3HRS A;  4BQA A;  4AD9 A;  3MQ0 A;  4KIB A;  1MD0 A;  3BJA A;  2COM A;  3TO6 A;  4U88 A;  5D8K B;  2VOP A;  1YS7 A;  4LJZ F;  2JTV A;  2IW5 A;  3QPH A;  4XSZ F;  3U2R A;  4EV0 A;  5LHG A;  1HW5 A;  4EM1 A;  5FFX A;  4LLG F;  1FZP B;  5JI6 A;  3KZY A;  5FO5 A;  2ZFW A;  4KNY A;  5HS8 A;  2QQA A;  4UVB A;  3TQN A;  3LA7 A;  4UUV A;  5BMZ A;  1LDK B;  4O6J A;  4L9J A;  4BAY A;  2QBY B;  4I2O A;  3HRM A;  2FEZ A;  3SHF A;  4UV9 A;  2A68 F;  4IHS A;  2PJP A;  5DEQ A;  1KQ9 A;  2XAH A;  2XRN A;  1BN5 A;  4L18 B;  5H6Q A;  2OQR A;  3KLO A;  4CDG A;  4M9Z A;  5JHU A;  5HLG A;  1G3Y A;  2R7F A;  4HAM A;  5D4S A;  4KA4 A;  3GVA A;  2JPB A;  3QAH A;  4ENJ A;  3T5X A;  3C1D A;  2MC3 A;  1R22 A;  3JSP A;  3ROU A;  2UWM A;  3DPT A;  1LDJ A;  4IRI A;  2G9W A;  3H3Z A;  2VBX A;  4HOB A;  2BV6 A;  3HUG A;  4G6D A;  1D8K A;  2RGV A;  2HZT A;  2QVO A;  5LBQ A;  5KVR A;  4ZZL A;  5IT3 A;  4RAY A;  5J6X A;  4K2E A;  1YFH A;  2YU3 A;  3K1M A;  5LGT A;  2GIV A;  2LDU A;  3WGI A;  3L7W A;  2ZME A;  2A07 F;  1J5Y A;  1PP8 F;  2W24 A;  5A2Q Z;  4ENN A;  2RV8 A;  3WE3 A;  3FM5 A;  2P6S A;  2RQP A;  3FHZ A;  3M1E A;  2W84 A;  3E6C C;  1ZLK A;  4P96 A;  1FLI A;  4I01 A;  4BHB A;  1GVJ A;  5CVI A;  2XGX A;  2A5Y B;  2XAF A;  5AIP A;  3FXR A;  4Q47 A;  4IVN A;  5L3E A;  2E7W A;  2ZCW A;  1W7P A;  3WTS C;  2HTJ A;  3DPL C;  4N9H A;  1Z6R A;  3LAJ A;  4G7O F;  4CGZ A;  1RUO A;  4CIC A;  1W5T A;  2ZJ2 A;  1ZG5 A;  2OZ6 A;  1J2X A;  1P6R A;  5FD6 A;  1B1B A;  1D5V A;  2PI0 A;  1FSE A;  2X4H A;  5L3F A;  3RKX A;  2M30 A;  2H94 A;  1SAX A;  2YX4 A;  4RB0 A;  3NRV A;  1E2X A;  2JPC A;  3Q9S A;  4JBA A;  2V1X A;  3IWF A;  1IXR C;  5D5U B;  1I1G A;  2PQ8 A;  1OR7 A;  1BI3 A;  4YII A;  3EUH A;  3E3V A;  1P2F A;  3KEQ A;  3MCZ A;  5K5O A;  1LB2 A;  2R7D A;  1G4D A;  3CO6 C;  1R7J A;  3NEU A;  3FMQ A;  1MJA A;  1A04 A;  2ISY A;  2RNJ A;  1LJ9 A;  4GGG A;  4M74 A;  4R1H A;  1J9I A;  1LQ1 A;  2K4J A;  2OU2 A;  2L3D A;  3F8N A;  2YPR A;  2FSW A;  1Z7U A;  5AON A;  4A0Z A;  1CF7 A;  1ZRE A;  4B09 A;  1BI0 A;  4KN4 X;  1V3F A;  2EA2 A;  2XAQ A;  4AIH A;  2HKO A;  2VBW A;  1U3E M;  5BPI A;  4QWQ A;  4JQF A;  4A0Y A;  3R0J A;  3T0Y A;  2HFH A;  2AS5 F;  1G6N A;  3CUQ C;  3E5Q A;  1WI9 A;  2DPD A;  1XN7 A;  3KP7 A;  2L4A A;  1IUY A;  5J8C A;  2ADU A;  3FXU A;  2EV0 A;  4OU0 A;  3S2W A;  1S6L A;  4WX9 A;  2F5F A;  4L5I A;  3R6S A;  1O7F A;  2M45 A;  4HZF A;  4OIP F;  4XRF A;  2XVC A;  3QPT A;  5CJ9 A;  3GUD A;  2VON A;  4M71 A;  1IXS B;  4P5O A;  3U9G A;  2CWE A;  3KP4 A;  2PEX A;  3DF8 A;  3KLN A;  2XKP A;  5DD8 A;  4OIN F;  3DKW A;  3Q5F A;  3CUQ A;  3ZQ7 A;  2V6C A;  4M6Y A;  3T8R A;  1MJB A;  2ZME B;  3ZMT A;  2WV0 A;  3R0A A;  4P9F A;  3GFI A;  3QU3 A;  1C0W A;  4A6E A;  3E5U A;  4LGW A;  1QZY A;  4L9T A;  3WTV C;  2P8T A;  4MGR A;  4YFK F;  3GF2 A;  1WQ2 A;  4WXD A;  4AIJ A;  1P4W A;  4GCV A;  4O5V A;  1W7P B;  1SMY F;  4RGS A;  5CVJ A;  4DNC A;  3HTS B;  1YG2 A;  5HDN A;  4FT8 A;  1T98 A;  2EWN A;  3ZN0 A;  1ONV A;  4CXF A;  4MNU A;  5IT9 Z;  2O03 A;  3T8T A;  2XRO A;  4R79 A;  2DFI A;  3BOQ A;  3M9A A;  2UZK A;  3L09 A;  3PQJ A;  4KFC A;  4G7H F;  4HV5 A;  2A61 A;  3VOD A;  5ICG A;  4RB2 C;  2IPQ X;  2FF4 A;  3QP5 A;  1U2W A;  2HS5 A;  4PZJ A;  5HOO A;  2EA4 A;  5E17 F;  2CG4 A;  5HDG A;  3WGH A;  3REO A;  5JVT A;  5DD4 A;  2QYO A;  1LEB A;  3W6J B;  1BC7 C;  5D6E A;  1XSX A;  3ZMS A;  2H27 A;  2XKO A;  5K1Y A;  4ESB A;  1HKS A;  2ZO4 A;  3BPX A;  3F8C A;  1XD7 A;  2VC1 A;  2P5L C;  5L3G A;  2V1D A;  2BYV E;  4I09 A;  3RYR A;  1FYK A;  3DXJ F;  2HQN A;  4MHG A;  4WWC A;  4Y13 A;  1XGS A;  1CF7 B;  3I4P A;  4WK8 F;  3TOB A;  4RAZ A;  2IP2 A;  4EGZ A;  1R00 A;  3IC7 A;  2IT0 A;  3DV8 A;  4R8H A;  2FXA A;  1KGS A;  5ILS A;  3F3X A;  4HX7 A;  4EM2 A;  5E1X A;  4CHU A;  3SZP A;  1DUX C;  1GXQ A;  1JGS A;  2IJL A;  2MLG A;  2R3S A;  3R61 A;  2W85 A;  3IHU A;  3I5U A;  1S29 A;  3HSE A;  4MQV A;  2Q0O A;  6PAX A;  3EET A;  3ECH A;  1J59 A;  1E17 A;  5BOX A;  1JHF A;  2DI3 A;  2YX7 A;  1FP1 D;  2HOE A;  4LFU A;  3CTA A;  3GEZ A;  4OIO F;  1SFX A;  5DYM A;  5ICC A;  3CUQ B;  1V4R A;  2DO7 A;  1H9G A;  2DTR A;  5CLS A;  1ODD A;  4ETS A;  4DQ2 A;  3G73 A;  1BIA A;  2FE3 A;  5LGN A;  4WXC A;  3F8B A;  3TGN A;  4WF2 A;  1K78 A;  1TBX A;  1FOK A;  3LST A;  1K7A A;  3I58 A;  4KIC A;  4WCG A;  1G3S A;  1ZRD A;  4GYG A;  2Z3Y A;  4EJO A;  1TNS A;  1TTY A;  4ZYH A;  1HST A;  2NAZ A;  3BJO A;  1B6A A;  2RKH A;  4NQW A;  2B0L A;  2NNY A;  3I0T A;  4HQE A;  3SXY A;  3RI4 A;  1LDD A;  3VOE A;  2OD5 A;  5E1Z B;  3ZMZ A;  3VEP A;  5F6F A;  3KET A;  4NHJ A;  3TO9 A;  2GAU A;  2A69 F;  3TDU C;  2D1H A;  2GXG A;  4IHT A;  1TQM A;  5LHI A;  3F72 A;  2HEO A;  5K5Q A;  3RJP A;  3V8J A;  4KYW A;  1U5T C;  2K02 A;  3KP5 A;  3RDI A;  2C6Y A;  4M6X A;  2CQK A;  3IL2 A;  2VN2 A;  4CO8 A;  3F23 A;  1W4M A;  4NB5 A;  2EFO A;  4KIG A;  2JSC A;  4KN7 X;  1GHC A;  1G3W A;  3FF5 A;  3BRO A;  5TJJ A;  4A2U A;  3PQK A;  2M5W A;  3HOT A;  1SD6 A;  4ENK A;  1UHM A;  1YYV A;  2L01 A;  2PFB A;  2KIM A;  2HGC A;  1U5T A;  3TO7 A;  1YW8 A;  2F5C A;  3H3U A;  5CYV A;  3O6B B;  4HLY A;  2H6C A;  4HDV A;  4RB1 A;  3GFL A;  2K7L A;  1ZGA A;  4KMF A;  1LNW A;  1G3T A;  1WSU A;  5BQT A;  3F8F A;  4M9X A;  4YIF A;  2QWW A;  3DFG A;  1XMK A;  1ZLJ A;  2D2W A;  1QBJ A;  3V8L A;  2HYF A;  4GO1 A;  1ZRC A;  1UCR A;  3E6B A;  1ZGJ A;  1T0F A;  3KP2 A;  5JR3 A;  3MEX A;  2Z5U A;  5DV5 A;  4YFX F;  2FMY A;  2P4W A;  3BJ6 A;  4OMY A;  2E1N A;  1SMT A;  5HLH A;  1QO0 D;  4G6Q A;  4LMY A;  5HVQ C;  3ERE D;  4A5N A;  4TV7 A;  1P4A A;  3WTX C;  2EB7 A;  3M7G A;  5ICF A;  2FBH A;  1LEA A;  3R60 A;  2YR2 A;  2V1U A;  2KIF A;  3C3W A;  5TRD A;  3ABT A;  4OIQ F;  1OMI A;  5HS9 A;  1K78 B;  5HS7 A;  4OMZ A;  2XAJ A;  3WTY C;  2GA2 A;  3I71 A;  1Z91 A;  3IKV A;  2LNB A;  1KQ8 A;  1SD7 A;  2P7V B;  4EMS A;  2HDC A;  4IPA A;  4XLN F;  1D8J A;  2QZ8 A;  3ULQ B;  1KU3 A;  4IRG A;  1BJA A;  4P55 A;  4IJA A;  2GQQ A;  1OYI A;  5EEH A;  2QM3 A;  5L3C A;  3FX3 A;  2K4B A;  5FD5 A;  2NYX A;  4XBF A;  2GA1 A;  1MGT A;  3EYY A;  1SD4 A;  1YS6 A;  1YW7 A;  2DT5 A;  3V7C A;  4AIK A;  4G94 A;  3F21 A;  1R1T A;  5HDK A;  1IAW A;  3WTZ A;  3F6O A;  1JXS A;  2EJR A;  1ZH5 A;  1XSV A;  2HYG D;  2HKX A;  5CVU A;  3EQL F;  1OYW A;  1FX7 A;  2KKO A;  3ZP5 A;  1KYZ A;  4A0X A;  1XDS A;  3EYI A;  4LD5 A;  1HW2 A;  4UVC A;  3N97 A;  3TOA A;  4BNC A;  4RGU A;  3D5L A;  1IN8 A;  2FML A;  2FOK A;  2ETH A;  2OA4 A;  4CYD A;  2DQR A;  4M9S A;  2OBP A;  1CGP A;  3COA C;  4EVI A;  3DEU A;  4FHT A;  1H0M A;  4HDU A;  1HKT A;  4KUM A;  1U5T B;  1EH8 A;  4LLL A;  3GZ6 A;  2ZNY A;  4L0Z B;  3RIR A;  2DK5 A;  5LRR A;  3CUO A;  2ESH A;  3BZ6 A;  1EH7 A;  2F2E A;  5D5X B;  3MZH A;  3ZMV A;  5H6R A;  5CVV A;  4Y15 A;  2AXL A;  2RDP A;  4MEY F;  3J80 K;  2HWV A;  1TW3 A;  2UXN A;  1XGM A;  3GX4 X;  1HBX G;  3FM3 A;  3CDH A;  3E5X A;  2A3S A;  2LKP A;  2JRT A;  3JTH A;  4ESF A;  1REP C;  3P9C A;  4L9V A;  2IA1 A;  4QLC U;  1I5Z A;  1R5H A;  1S7O A;  1TQP A;  3GXO A;  1RZ4 A;  5LHH A;  3ZMU A;  2Q8K A;  5JFR A;  1IZ1 A;  1U78 A;  4BYY A;  5BPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...