5FFXA

S. aureus mepr g34k mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
138
structure length
138
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQKHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title S. aureus MepR G34K Mutant
rcsb
source organism Staphylococcus aureus
molecule tags Transcription regulator
molecule keywords MarR family regulatory protein
total genus 54
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5ffxA00
1R7JA 2V1UA 3WTWC 2QVOA 5L3EA 2XRNA 1SD6A 2EA4A 1SD4A 6PAXA 4RB2C 5K5QA 1W7PA 4G7OF 4Q48A 1FP2A 2DO7A 5CVRA 3SFZA 2JPBA 4U7BA 3RPUA 5K5RA 3L7WA 3C18A 3E97A 2A68F 5J8FA 2XIGA 4P55A 2EV6A 1IW7F 5K5OA 1KU3A 3JTHA 4FX0A 4I0BA 3ECHA 3HOTA 3GUDA 4DQ2A 4WF2A 2L02A 1Y0UA 1GXQA 5H6RA 4A5MA 3JAMZ 2DQLA 5K1YA 3AAFA 1L3LA 2P6TA 2EJRA 3F21A 3U1DA 1IUYA 2ISZA 3KZZA 1B9MA 1KQ9A 5DCMB 3GZ5A 1ODDA 4G6QA 4ASNA 1T39A 1RZ4A 1RI7A 4I98B 4YG2F 1X3UA 4IHTA 4MTDA 3BY6A 1ZH5A 4UNOA 4LGWA 2QQBA 5HLHA 2JPCA 3CDHA 1NHAA 3WTVC 2NYXA 4A6EA 5LEKA 4I0AA 4WCGA 2CWEA 5BPIA 4OINF 3MCZA 3LWFA 2GIVA 4HF2A 2M8EA 2QENA 3P9IA 3MFKA 5ICFA 4BYYA 5CYVA 1YIOA 4O6JA 2ISYA 2LF8A 1XGNA 4CGZA 3FXRA 4GO1A 1GVJA 3VOEA 2TDXA 4KFCA 2PBIA 4IRIA 1EH7A 3DKWA 2QLZA 1W7PB 5CVVA 4XLNF 5FD6A 4AIJA 4LG0B 2HKOA 1STZA 3CO7C 1HXDA 2EWNA 3J80K 3L00A 2ACJA 4YFNF 1BJAA 1FSHA 4PGHA 2IT0A 5HDKA 2ZBKA 3B02A 4CYDA 1BI0A 1MZBA 3MZHA 4XRFA 4IVNA 1O7LA 4UV8A 2E7XA 5ILUA 4M6YA 3F8BA 2MA3A 2DQRA 2A6EF 1RIOH 5LGTA 1FZPB 3FM3A 4GXOA 4LB6B 4I2OA 2XAHA 3W6KB 4AD9A 5HDGA 2ZKZA 4IF4A 3F8CA 2FNPA 2YX4A 2COMA 3G73A 1K78B 2ZMEB 1P4WA 3LQQA 2P6SA 3WE2A 4U0VA 4R1HA 4A0YA 1YLFA 2P5KA 2CW0F 3WU0A 3R4KA 1S6LA 4YIFA 2FMYA 5CVIA 3F8NA 1YTYA 1O3RA 3TOAA 4H0EA 3CUQB 1H9TA 2H6BA 4KYWA 4HDUA 3GFIA 5JHUA 3G3ZA 3LSTA 2YPRA 1MDMA 3KEQA 2B0LA 3TQNA 3BZ6A 2DK8A 3HRMA 5HS9A 4MEXF 1XD7A 4JQFA 2CQKA 5ILSA 2V6CA 2OU2A 2L54A 2ETHA 2W24A 3WTTC 4M9XA 4FHTA 4EM2A 4ESBA 4RB0A 3EYYA 2GXBA 1BI1A 4A6DA 3RYPA 4Y13A 1J75A 3VFZA 3VEPA 2ZMEA 2H27A 5EEGA 1DPRA 1WI9A 3T1BA 2IRFG 5HLIA 3TGNA 4IPAA 4M71A 5D8LB 2XV4S 1TQIA 2XVCA 3FHZA 2A69F 1RNLA 1BIAA 3WTZA 2XROA 4KIFA 3KP4A 4RAZA 4HW0A 4BAYA 1U5TC 2A07F 5KVRA 3I5UA 2DLLA 4KIGA 4A5NA 4UHTA 3WTUC 4A0ZA 4U0WA 3DF8A 1OR7A 5D8KB 3GWZA 3WG9A 3IRQA 4O3MA 4MGRA 4HX7A 1FNNA 1FOKA 3PQKA 4OU0A 3RTRA 5CVJA 1ZLKA 4ESJA 1W4MA 2P8TA 3EQLF 1MJAA 4CO8A 1QO0D 2DT5A 1J59A 1HKSA 1JXSA 5EEHA 1F1ZA 4AIKA 2M30A 1XSXA 3JTGA 2DU9A 4ZYHA 4L5IA 4OIQF 2RQPA 4BXUA 1FY7A 1OPCA 3NQOA 2XAGA 1O3QA 3E5QA 2GA1A 4RS8A 2ZJ2A 2VBXA 3T0YA 3FMQA 1XSDA 2G7UA 2HDCA 3TDUC 5JVTA 4LB5A 1IF1A 4B8XA 3V4GA 5FLXK 3L09A 2C6YA 3EYIA 2P7VB 4L18B 2OAZA 4BHBA 2MLGA 1ZAOA 1T2KA 2D45A 2AS5F 2QBYA 1QNTA 1WRJA 4P9FA 3J81K 3TO7A 1B1BA 1WQ2A 2QYOA 1YFHA 3DPLC 5HOOA 4N0BA 1XN7A 3BPVA 1XGSA 1ZYRF 3OOPA 4Q4ZF 4BHCA 2FE3A 3K1MA 3M1EA 3GW2A 3CUOA 4EJWA 3N97A 2LKPA 3FXUA 4I02A 3ECOA 2HZTA 4HV6A 1J7KA 2PEXA 2VBZA 3BDDA 2KIMA 1FPQA 1HSTA 2F2EA 3KP6A 5H20A 1YO5C 2DTRA 3GFLA 4RAYA 2RC4A 2GWRA 4G7ZF 2R7DA 3ML6A 2Y75A 3IWFA 3ZQ7A 2HEOA 3GO5A 4WXDA 1TQMA 2VT2A 4IRHA 1YYVA 1Z9CA 4EMSA 2CYYA 4LD5A 5BPDA 2G9WA 1OYIA 3Q9VA 2UWMA 1PUEE 2YU3A 4G8XA 3E6BA 2JSCA 2NNYA 3KP7A 4EJTA 2IP2A 2ZFWA 2NRAC 2D1VA 3T8RA 5L3DA 5A2QK 2ZO4A 3HSFA 2K4JA 1KA8A 2K7LA 2OBPA 1T38A 4EJOA 2WTEA 2KKOA 3WU1B 1MGTA 2ADUA 5LHHA 2IA0A 3F3XA 3WODF 1B6AA 2H09A 1SAXA 5DEQA 2A61A 4EJVA 5E17F 3RKWA 4I09A 2DFIA 2KJBA 4OOIA 4TV7A 4CXFA 2NAZA 4P9UA 2K4BA 4EM0B 3DV8A 2WC2A 1LDJA 4KUMA 4MQVA 2DBBA 2Q2EA 4LK1F 2QWWA 3MAJA 5L3FA 3H92A 3ABTA 2XAFA 2L4AA 1TQPA 4O5VA 4A0XA 3CUQA 2GQQA 2P5VA 2CSOA 1BI3A 5HS7A 1XGOA 4XSZF 1HQCA 4A2UA 1SFEA 4KN4X 3JSPA 5AIPA 4UVBA 1R1TA 1IN5A 1AOYA 1G6NA 3K1NA 2KJCA 2R3SA 4HF1A 1XDUA 2EFNA 2MC3A 4LLLA 1ZARA 4ENMA 4PGGA 3NEUA 2QQ9A 1BC8C 3KCCA 2GXGA 4GGGA 3O2PE 3EUHA 2BBYA 2X4HA 1I6XA 4F7ZA 2Z5UA 1U3EM 1W5SA 1HW5A 2Q8KA 1Q1HA 3U2RA 2IPQX 2LDUA 1AWCA 4MEYF 2O61A 5AIQA 4M9SA 1L0OC 3IHUA 2P7CB 3PQJA 3BPXA 1IN8A 3V8LA 1U5TB 3CJNA 2YSRA 3C1DA 3FXQA 4RGSA 5D6EA 4FX4A 1VTNC 5LBQA 1TNSA 2PJPA 5HVQC 4HLXA 2VBYA 3MEXA 2STTA 3GVAA 4GYGA 1R58A 2FXAA 3E6DA 2EV5A 4CZZA 5D4SA 4YFXF 1K79A 1MD0A 3DXJF 1T0FA 3BJOA 2YR2A 4FT8A 1S29A 4E70A 3NRVA 2PMUA 2J5OA 1IXRC 2MH9A 5FO5A 1OMIA 1S8NA 1SMYF 3LFKA 4LG0A 3IKTA 3E6MA 4Q5SF 1KGSA 4HOBA 2ELHA 1RUOA 2MBFA 3WGGA 4GCVA 5CJ9A 3HTUA 4ZZDA 1D8KA 1UFMA 2WWYA 1LDDA 4Q47A 2HGCA 1IZ1A 3O3KA 1ZREA 5DUKA 1KQ0A 3KFWX 3ZMUA 4M9ZA 4ENKA 4ZYDA 5DD4A 1T98A 1TNTA 1ZRDA 3HHGA 2BGCA 2DAOA 1V4RA 1XDSA 1HBXG 4A12A 1FBUA 1S3JA 5D4RA 3GZ6A 5E1ZB 1R36A 5DYMA 4WK8F 3V7CA 2XKPA 2OQRA 2V1XA 5LRSA 1WWXA 4WXCA 1FBSA 3BP8A 4HDVA 1XB4A 1ZHFA 1IRFA 5TJJA 1U8RA 1CF7A 2MD5A 2F5CA 2OZ6A 3HRUA 3J81Z 1TW3A 1Z05A 2HWVA 1ZG5A 1O57A 4G7HF 5FLXZ 2HQRA 1ZG3A 5BMZA 1XCBA 3M9AA 1R5GA 3P9KA 2W57A 3IWZA 2HKXA 3I59A 3QP6A 4HF0A 5FD5A 2VOOA 1D3YA 2E7WA 2O6GE 2VODA 3RJPA 2CO5A 1LDKB 5LEJA 2JT1A 4WWCA 3HSRA 1OKRA 1USSA 3F8FA 5JI6A 4Z2YA 2VONA 2ZCWA 3SXYA 1GXPA 4L9JA 5FB2A 4HQEA 4MTEA 1B4AA 5D5VB 1LEBA 1R1UA 2HS5A 5KK1A 3QRFF 2KIFA 1JE8A 4NB5A 2O03A 2W25A 1U6GA 2M5WA 1G4DA 2LF7A 4ON0A 3SHFA 2F5FA 2GAUA 2HOEA 5BS6A 3OV8A 1P2FA 1KU9A 1R1VA 3ZP5A 3RI4A 3WTYC 1UHWA 2XAJA 1I1SA 1IAWA 2FNAA 4AVPA 1D8JA 4QLCU 2FBKA 4P5OA 4B09A 5L3GA 1FLIA 3GEZA 3BJ6A 1ZG1A 2M45A 4G94A 2J5PA 2FF4A 2IVMA 2QQAA 5AONA 1Z91A 3BWGA 1PDNC 3QPTA 5D5WB 3FWEA 1ON2A 1BBYA 1V3FA 3FF5A 2EFPA 2NS0A 2OD5A 1XMKA 2XKOA 1ZRFA 3GFJA 2E1NA 4BHPA 5LGUA 4AIHA 3ZN0A 3QAHA 2RV8A 1I5ZA 5ICEA 1E2XA 2QM3A 2BV6A 2OZUA 4UVCA 4RB1A 3R61A 1SD7A 2IW5A 4EQQA 2DI3A 1S7AA 1FYMA 5DUIA 3RDIA 5JFRA 3HIFA 5DD8A 3P9CA 4LLNA 5E8GA 1DP7P 1ZRCA 2RDPA 3T8TA 1QBJA 1F4KA 2FEZA 1UB9A 3JAMK 1HW1A 4R79A 2BYVE 2W84A 3ROUA 2VXZA 3J7AO 3HYIA 3FMSA 3T5XA 5CVUA 5JR3A 5LHIA 1R5HA 3FM5A 3R0AA 2K86A 1U2WA 4HBLA 2PLYA 5DCMA 1J9IA 1DDNA 1CGPA 3JSOA 1MDMB 3SZPA 4EJUA 5IT9K 1J2XA 3I71A 5E18F 3GFMA 4M72A 4NQWA 2CGPA 4KN7X 1JGSA 4KMFA 3K69A 3PFIA 1OYWA 3ISPA 2ESHA 4KA4A 3ERED 1K78A 4HYEA 3I64A 4JBAA 4D0PA 5D5XB 5IT9Z 3L9FA 1J0RA 3R60A 1XCVA 1JHFA 1KYWA 5DCFA 2XGXA 2STWA 2UZKA 4HX8A 1Z6RA 2F5DA 1IN7A 2VT3A 1S7OA 1IXSB 1FT9A 2QBYB 1TBXA 2FA5A 3TKYA 2ZNYA 4OIRF 1MJBA 3MWMA 4LK0F 3SQNA 3V8KA 2IA1A 1EH6A 3DPTA 3WE3A 4BQAA 1IRGA 4L0ZB 3K0LA 2K02A 3N4MA 1Z6TA 3I58A 4YFKF 5LLQA 2V1DA 2YX7A 3L2CA 2QZ8A 3DP7A 2ZNZA 3HHHA 2PMHA 2GZWA 5F64A 3EETA 1W7PD 2DW4A 5LRRA 3VB2A 3S2WA 4ZZLA 1G3YA 4L9VA 1FX7A 2X0LA 2ESNA 3CUQC 3GXOA 2A6HF 3I4PA 4NHJA 3HSEA 2G7HA 4OMYA 2L3DA 1ZGJA 2OA4A 2EK5A 4AWXB 1LEAA 1QQIA 2D2WA 2FSWA 1KU2A 2PFBA 1SMTA 4ENJA 3F23A 3QU3A 3BROA 4HQMA 3FMRA 4K2EA 2RNJA 4EV0A 4UVAA 2VN2A 3TOBA 5FFXA 3KEOA 1FYLA 3DQVC 5ICCA 3R6SA 4LMYA 4ENNA 2PG4A 3BJAA 4IJAA 4EGYA 3I59B 1O7FA 4UUVA 3KP3A 3TDZC 4HZFA 3JW4A 2XAQA 3F22A 3WGIA 1G3SA 1CF7B 2Q0OA 4HV5A 3WTSC 5BQTA 4KDPA 5DV5A 3WTXC 3V8JA 2CFXA 3B73A 3M8EA 3FZVA 1C0WA 4RGUA 3K2ZA 4OMZA 4ZYGA 1U5TA 4CICA 2RN7A 4HA8A 1HSJA 4RB3C 3R0JA 2FMLA 4S04A 3FX3A 1IXCA 2Z33A 2HFHA 2UXXA 2O3FA 1BN5A 2Z99A 1EH8A 4U88A 2RVCA 3SZTA 3I53A 3QP5A 1ZGAA 3O6BB 1E17A 2DK5A 3TO9A 2OQGA 3HOSA 4HX4A 1SFUA 1LJ9A 2AXLA 4CHUA 2Y0MA 4PZJA 2L01A 4JK1X 4N9IA 1G3TA 5LHGA 2RKHA 3BOQA 2EFWA 2VC1A 2ZXJA 1XGMA 2MLKA 2VE9A 1U78A 4DNCA 3RYRA 4M74A 2Y48A 4P96A 1P6RA 3ABUA 3I0TA 1LNWA 2K27A 3LA3A 2XASA 3E5XA 2JRTA 2VBWA 2F5EA 2FOKA 2W85A 4PDKA 1K6OA 1JHHA 4L9TA 3HTSB 3HRTA 2BEOA 2HYGD 1ULYA 2VC0A 4BH9A 5DDGA 1FYKA 3LA2A 5H6QA 1YS7A 5J8CA 3F6OA 4L5JA 4KICA 2V9VA 1BC7C 1O3TA 2FRHA 1SFXA 1FSEA 1YG2A 3HRSA 1FBQA 4ETSA 1EV7A 1A04A 1REPC 2HQNA 2M1BA 4WXHA 4HLYA 3IKVA 3LAPA 3D5LA 1I1GA 2A5YB 1KYZA 2IJLA 3QU6A 2EFQA 2LSOA 3W6JB 3ZMTA 1DUXC 3KP5A 1MJ9A 4BNCA 1ONVA 1YQAA 1LB2A 3C3WA 1YS6A 3ZPLA 3M7GA 2FBHA 4KT5C 5FFZA 4Y15A 3F8MA 2V79A 4IXAA 2FU4A 3H3UA 1ON1A 1UHMA 4N9HA 2E1CA 5E20A 5FGMA 3MQ0A 2O8XA 4EGZA 3D0SA 4WX9A 4UV9A 5ED4A 2VOPA 3WGHA 1QZYA 1YW7A 4UXNA 3CTAA 1UCRA 1G3WA 1I27A 1R22A 4G9YA 4S05A 3U9GA 2UXNA 4M73A 5J6XA 2LNBA 5ILVA 1YW8A 2XHKA 1O3SA 4MQ9F 2H6CA 3RKXA 5E8IA 1TTYA 3IL2A 3ZMDA 1WKMA 1P92A 4RGXA 4XBFA 5CLSA 4LLGF 4LJZF 3GYHX 1R00A 1F9NA 4OIPF 2HTJA 4RGRA 1GHCA 1FWZA 2DPUA 1K7AA 5TRDA 1IN4A 1OYYA 3REOA 4U7DA 2NNNA 3K1PA 1T6SA 5D5UB 2BE5F 1LVAA 2P5LC 4XLPF 1FP1D 2R7FA 3TO6A 3C7JA 2QUFA 3KP2A 1QPMA 2HYFA 4Y17A 2PI0A 2FBIA 1PP8F 1PP7U 2Z3YA 1XMAA 3GX4X 3KZYA 5ERIA 3KLNA 1BOAA 1TW2A 3ZMSA 3RPQA 2WV0A 4ZYEA 2PQ8A 4GYIA 1H0MA 1QZZA 2XUBA 1B9NA 1HW2A 2D1HA 4CDGA 1LQ1A 2JZYA 4IRGA 3KLOA 4MHGA 3I54A 3LQRA 4L9NA 5E1XA 2EB7A 1MKMA 4ESFA 3ELKA 3F6VA 3E6CC 1KU7A 1B59A 1BM9A 4ZH4F 1IN6A 5HDNA 1SD5A 1H9GA 5HLGA 2DPDA 1BI2A 2Z9OA 1D5VA 3ZN1A 1J5YA 1TLHB 5A2QZ 5LGNA 1Z7UA 2MH2A 1FC3A 3QOPA 5E1WA 5BOXA 3LAJA 3IRRA 2M87A 5F6FA 5ICGA 4KNYA 4IHSA 1P4XA 3CO6C 1W5TA 1KQ8A 3K9TA 1XSVA 2A3SA 4EM1A 1WSUA 2PN6A 3GF2A 2RGVA 3CLOA 3H3ZA 1QGPA 3QPHA 3RIRA 3ZMZA 1ZLJA 3Q9SA 3IC7A 1HKQA 3M8FA 3MZYA 3KE2A 4OIOF 2KRFA 3LA7A 2JTVA 4G6DA 3GLXA 3F72A 4LFUA 1BIBA 3DEUA 2KIUA 3ULQB 2HR3A 3COAC 4R8HA 2CG4A 4U0YA 2EFOA 5IT3A 5L3CA 4I7HA 5D6FA 2GA2A 1ZN2A 3E5UA 3V7SA 4L0YB 4XSXF 1DPUA 4KMUX 4EVIA 5L3BA 3P7NA 4HAMA 5F1RA 1P4AA 1RUNA 3RKYA 2VE8A 3J80Z 1Z1DA 3DFGA 3ZMVA 3E3VA 4M6XA 1HKTA 2IA2A 2EV0A 3VODA 2HTSA 3Q5FA 4MNUA 1R23A 2H94A 4I01A 5HS8A 2EA2A 2L4MA 4KIBA 2O0YA 3HUGA 1USTA 2FQ3A 3EDPA 3KETA 4YIIA 1YW9A 4QWQA 4PCQA 3V7RA 1F5TA 2P4WA
chains in the Genus database with same CATH superfamily
1R7JA 1APLC 1OISA 4YIRX 1OCRH 2V1UA 3VDXA 3WTWC 2QVOA 2XF5A 5L3EA 4UUTA 4XN3A 3CDIA 2XRNA 5K7ZA 1SD6A 2EA4A 2Y30A 3OIOA 3QQAA 4UUSB 2FQ4A 4I76A 2DYSH 1SD4A 3HKZN 6PAXA 1OCCH 4KITB 4X0GA 4RB2C 5K5QA 1W7PA 4BY1J 2LY1A 4G7OF 4Q48A 1B8IA 2L9NA 1FP2A 2DO7A 3KYDB 5CVRA 4RLFA 2F48A 3SFZA 3K70C 2BY0A 2L0KA 2JPBA 2JUCA 3J7AY 4U7BA 2W7NA 3RPUA 3LSIA 5K5RA 3L7WA 1K4TA 3C18A 2F4MB 1TWCJ 5K7HA 3JRAA 1TWGJ 3E97A 2E2HJ 2VASA 4B3XA 2A68F 1S9HA 5J8FA 4B48A 2XIGA 1Y1VJ 1VI0A 3DKXA 1T56A 4P55A 2EV6A 1IW7F 1NK2P 5K5OA 1KU3A 2XSDC 1JUSA 3JTHA 4FX0A 3OYLA 1ZKGA 4I0BA 3ECHA 3HOTA 3GUDA 4DQ2A 3S16J 4WF2A 2L02A 1Y0UA 1WFXA 2DFEA 4Z6YA 1GXQA 5H6RA 4A5MA 3JAMZ 2DQLA 5K1YA 3AAFA 1L3LA 2P6TA 3TBIA 5B1BH 4A3GJ 2EJRA 3F21A 3U1DA 1IUYA 4MFEA 4A3EJ 2ISZA 3KZZA 4M3BA 1ZELA 1B9MA 5IP9J 1KQ9A 5DCMB 3GZ5A 1ODDA 3GTPJ 4G6QA 4ASNA 1T39A 1RZ4A 1RI7A 2IBDA 4I98B 4YG2F 2R5YB 2XF6A 1X3UA 4IHTA 1YITI 1LFUP 4N4OB 4MTDA 3AL0B 1PVEA 4QPOA 2CQNA 2IXSA 1Z67A 3BY6A 2B63J 1ZH5A 4UNOA 3W2AA 4LGWA 2QQBA 5HLHA 2JPCA 3CDHA 2LFBA 1WVRA 3JCUC 1NK3P 1ETYA 1NHAA 2R7RA 2RREA 3WTVC 4RM3A 2NYXA 4A6EA 2EINH 3BCBA 5EZGA 4UY8I 1X1BA 1LVKA 1RPWA 5LEKA 4I0AA 4WCGA 1WJBA 2CWEA 5BPIA 1SFKA 4OINF 2KPMA 3MCZA 2ZSHB 3LWFA 5E3NA 2GIVA 4HF2A 4F92B 2M8EA 2VIXA 1R49A 2JRMA 2QENA 3Q0VA 3P9IA 5E3OA 3MFKA 5ICFA 3OIQA 1YRNA 4BYYA 3CDLA 5CYVA 1YIOA 4O6JA 1MMSA 2E60A 2Z16A 2ISYA 4V2GA 3A4CA 2LF8A 1U0JA 1Y56A 5GTIC 2X48A 2BY1A 2MABA 1XGNA 4CGZA 5K7FA 3HOVJ 2EH3A 3FXRA 3TP0A 4GO1A 5DS9A 1GUUA 3FISA 4CCMA 2DXIA 2ZC2A 1GVJA 3VOEA 4XL9A 1QA6A 2TDXA 4KFCA 2PBIA 1RR7A 4IRIA 3TEDA 2GOXB 2I10A 1G8XA 1EH7A 3DKWA 4PK4A 1MBEA 2QLZA 1W7PB 2IGMA 5CVVA 3L2VA 2ZJPF 4XLNF 4GRIA 5FD6A 4AIJA 5B5EC 3LFUA 3SDBA 4A3LJ 4LG0B 2HKOA 4BY7J 4JYKA 3L2QA 4GFBA 3CMMA 2IGNA 2KIQA 1VQMI 1STZA 3ASOH 3CO7C 1HXDA 4XM3A 2EWNA 2NS8A 3L00A 3J80K 1MBJA 2ACJA 2MSYA 4YFNF 2DA3A 2R7WA 1BJAA 2R0QC 1FSHA 4PGHA 2IT0A 5HDKA 3BG7A 2ZBKA 4IHWA 1R6RA 3B02A 4CYDA 1BI0A 1MZBA 3MZHA 4BQOA 5JVGF 4XRFA 1YX5A 4IVNA 1O7LA 4UV8A 2E7XA 3G71I 1LFBA 4M6YA 5ILUA 3A1YA 2MA3A 3F8BA 3AG2H 3K4KA 3SYTA 4B43A 2A6EF 2DQRA 2YS9A 1RIOH 5LGTA 2LMDA 3SEQA 1FZPB 2LY9A 3OYCA 3FM3A 4GXOA 1NG7A 1IV8A 1PYVA 2I8DA 4LB6B 3G1OA 4I2OA 1JKPC 2HQ5A 4IOCF 3HPHA 2K9SA 1MH3A 2XAHA 2CJJA 3W6KB 4AD9A 3HKZA 1DU6A 1EKEA 5HDGA 3QPLA 3AKZA 2ZKZA 4IF4A 1GLNA 3MKZA 3F8CA 2FNPA 1D0ZA 2YX4A 2COMA 3G73A 3CCUI 1K78B 2ZMEB 1P4WA 3LQQA 2P6SA 3WE2A 3IP4B 4U0VA 4R1HA 2DT6A 3JRHA 1FEXA 1G2HA 4A0YA 5H2FC 3OS0A 2Q2EB 1FOWA 1YLFA 3FBNB 2P5KA 2CW0F 3WU0A 3S3NA 1DU0A 2JWTA 3R4KA 3L2UA 3IAS2 1S6LA 2LG4A 1V55H 4CYCA 4YIFA 2FMYA 2HYJA 5CVIA 3F8NA 1YTYA 2DMNA 3ZQFA 3DBRB 1O3RA 3TOAA 4H0EA 2E35A 2K9LA 3CUQB 1H9TA 2H6BA 1B72B 4KYWA 4HDUA 3GFIA 4B3AA 5JHUA 4E7IA 1BOBA 4E6KG 2XGEA 4XICA 3BG9A 1BW5A 3G3ZA 3LSTA 1XG1A 2YPRA 1MDMA 4DZJA 3B6AA 4F3QA 1BA5A 2VB6A 4F93B 3GLLA 4ZDOA 3KEQA 2DA6A 2B0LA 4L5EA 3TQNA 3ZXSA 3BZ6A 2DK8A 1MMAA 2EILH 1Y1WJ 1A5JA 3HRMA 5HS9A 4MEXF 1BR2A 1XD7A 2V9KA 4JQFA 2KLOA 2CQKA 5ILSA 2V6CA 1K61A 2LLKA 2OU2A 2L54A 2QSHX 1MH4A 1H88C 2ETHA 4II2A 3CCSI 2W24A 3WTTC 3HDDA 1W5CC 4M9XA 4FHTA 4XNFA 4EM2A 4ESBA 4RB0A 1X1DA 1UJ8A 3EYYA 2LKSA 2CRGA 2GXBA 1BI1A 4A6DA 3RYPA 4Y13A 1J75A 5IYCJ 3VFZA 3OSGA 1HDDC 3VEPA 1ZGWA 3MKYB 5E79C 3PFYA 2ZMEA 3EUAA 1RETA 2H27A 5EEGA 1JJ6C 1DPRA 5FKKA 5JHFA 1WI9A 3DU5A 1X1PA 3CCJI 1Z0XA 3T1BA 2WB1A 1TC3C 1RESA 5HLIA 4CSWA 2IRFG 3S1RJ 3TGNA 4IPAA 4M71A 1SVMA 1T0FC 1F36A 4M3DA 3W3CA 5D8LB 2NXNB 5GPAA 4B47A 2XV4S 1TQIA 1K6YA 2XVCA 1UG0A 1ZTRA 2R7UA 3FHZA 2R93J 2A69F 1RNLA 1BIAA 3WTZA 2XROA 4KIFA 1IRXA 3KP4A 5J1YA 4RAZA 1V5GA 4HW0A 4I99C 4BAYA 1U5TC 1JKOC 2VJ4A 3F0CA 2R7SA 3SDGA 2A07F 2KQRA 5KVRA 2EQRA 3H5NA 3HUGB 3I5UA 2DLLA 4KIGA 2DMTA 4A5NA 4UHTA 3WTUC 4A0ZA 2CQQA 1SFOJ 4U0WA 1YOVB 3BTJA 2R5ZB 3S1NJ 3DF8A 1OR7A 3UR3C 2F6CA 2BW3B 5D8KB 3GWZA 1KZHA 2IAIA 3WG9A 4A3MJ 3IRQA 4O3MA 4MGRA 3IAM2 4HX7A 1FNNA 1FOKA 3PQKA 4BACA 2V9PA 3VSKA 4OU0A 3RTRA 5CVJA 1ZLKA 1UAAA 2VL8A 4ESJA 2EPFA 1W4MA 2P8TA 3EQLF 4BDZA 1MJAA 2LK2A 2VUMJ 1IV6A 1IGNA 2HDDA 4Y52J 1SVLA 2K40A 4CO8A 1QO0D 2DT5A 2WY7Q 2VI6A 2FOWA 2LC2A 1V5EA 2JA8J 2BOLA 1J59A 3FXKA 4BE0A 1HKSA 1JXSA 5EEHA 2AO9A 1VQOI 2VQHA 3S17J 1F1ZA 3FXLA 4AIKA 2NVTJ 4XIDA 2M30A 2ME0A 1XSXA 3JTGA 3GTLJ 5CKTA 2DU9A 4ZYHA 4HRIA 3NWSA 4L5IA 4OIQF 3RKQA 2RQPA 1S72I 4BXUA 1GV2A 3K4CA 1FY7A 1OPCA 3NQOA 2XAGA 3F9KA 4J19A 1O3QA 2ELJA 3E5QA 2GA1A 2WADA 1MNEA 4RS8A 4HNVA 3MKWB 2ZJ2A 2ZXIA 2HZDA 2M8GX 2VBXA 3T0YA 1M1EB 3FMQA 1HLVA 1XSDA 1EF4A 3QYBA 2G7UA 1Z3YA 2XDVA 5EGOB 2HDCA 3TDUC 4II3A 3H9QA 1JKRC 5JVTA 1IG7A 4PJJA 1A6QA 4LB5A 1IF1A 1SEUA 4BUPA 1WH5A 1YX3A 3LSRA 4MFDA 1QHGA 3DEWA 4B8XA 3V4GA 5M5XJ 5FLXK 3L09A 2C6YA 3EYIA 1N78A 4M6VA 3OS2A 3MZ8A 1ITYA 1MMGA 1I39A 2P7VB 4L18B 2DOFA 2OAZA 4BHBA 2MLGA 1ZAOA 4F52A 1OCTC 1T2KA 3CC4I 2D45A 2AS5F 2QBYA 1QNTA 2V4JC 1WRJA 4P9FA 3J81K 2R7OA 3QWLA 4V19K 3TO7A 1B1BA 1WQ2A 2Q1ZB 2QYOA 1YFHA 2NOJB 3K4JA 3DPLC 5HOOA 3LOCA 4N0BA 1OCPA 2CUJA 1EJ9A 1ETKA 2ECCA 3RZDJ 1XN7A 3BPVA 1AA7A 3U21A 1XGSA 4IHXA 3O8GA 1ZYRF 3A0BC 3OOPA 4Q4ZF 4BHCA 2FE3A 3K1MA 3M1EA 3BR0A 2DMQA 2M2EA 4IL6C 3N05A 4IX7A 1MBGA 3GW2A 3CUOA 1ETVA 4EJWA 2FJ1A 3N97A 1W36D 2LKPA 3FXUA 4I02A 3ECOA 3TW6A 2HZTA 1U9OA 4HV6A 3X2QH 3V42A 3QYEA 2Y31A 3ASNH 1J7KA 3HL2A 2PEXA 3BTLA 3K4BA 2X1DA 2ZJQF 3S93A 3CF2A 5EJCA 1WJAA 4BS9A 2M0CA 2VBZA 3BDDA 2KIMA 3BG6A 3OYEA 3FXJA 2CMPA 2XAUA 1VNDA 3E0JB 3CCEI 1RR8C 1FPQA 1HSTA 2F2EA 3KP6A 2L5QA 5H20A 1YO5C 4B1RA 2DTRA 2KZVA 3GFLA 2R4GA 3H36A 4BDYA 4JP0A 2M0MA 4RAYA 1QU3A 1Y8QB 2RC4A 4UB8C 2GWRA 4G7ZF 9ANTA 2R7DA 2BVLA 3K10A 3ML6A 4JOMA 1IRZA 2Y75A 3IWFA 3ZQ7A 4XMYA 2HEOA 2LRDA 3GO5A 4WXDA 1TQMA 3JRDA 3OL3A 3OR2C 5IP6A 2VT2A 2CH0A 4IRHA 2HVRA 1YYVA 2OUMA 1XS9A 1Z9CA 4EMSA 2CYYA 2ZXWH 4LD5A 4LIVA 5BPDA 2G9WA 1OYIA 3QYFA 1VQ5I 3Q9VA 2UWMA 2AQFA 1PUEE 3P5JA 2YU3A 4G8XA 3E6BA 3OYFA 1R5ID 2JSCA 1X4OA 3W6VA 1IJWC 2NNYA 1VQ6I 3CCRI 3KP7A 4EJTA 2IP2A 3BR5A 2ZFWA 4X1EA 2NRAC 2D1VA 4XKVA 3T8RA 2XGCA 5L3DA 5A2QK 2DDBA 2ZO4A 3CCYA 3HSFA 2K4JA 3BR3A 1I6HJ 1KA8A 2K7LA 2OBPA 4EJOA 1T38A 2WTEA 2KKOA 4JX4A 3GCMA 1X58A 2O5RA 3WU1B 1MGTA 2ADUA 3ZQQA 5LHHA 4AYBA 4AM3A 4BU2A 2IA0A 4IKFA 3GMEA 3F3XA 4BGDA 3OS1A 3PNVA 2BY2A 3PSIA 4FETA 3ESWB 4FQGA 3DCFA 3WODF 3CESA 1B6AA 2H09A 4ZYAA 1A36A 1SAXA 1FTZA 5DEQA 2QSFX 2A61A 4EJVA 3EPZA 3CMAI 1X1CA 4BKXA 5E17F 3S3OA 3RKWA 1ORKA 4I6ZA 4I09A 3FXMA 2DFIA 2KJBA 4OOIA 1DQUA 1VQ7I 1AU7A 4TV7A 1LUJB 4CXFA 3PM1A 4RAFA 4Y7NJ 2NAZA 4DOZA 4P9UA 4XLFA 2K4BA 3QPSA 4EM0B 5IYDJ 2QKMB 3DV8A 3CJQB 2WC2A 1LDJA 4KUMA 1D0XA 2Z1DA 1YJ9I 4MQVA 2DBBA 2ICWG 2RQQA 3SZGA 1T08B 3ZR8X 3ABKH 2Q2EA 4LK1F 4S0HB 2QWWA 2KDZA 5M5WJ 4D5FA 2DN0A 3MAJA 1JGGA 2EZHA 5L3FA 3H92A 3ABTA 2XAFA 2L4AA 1N77A 1E3OC 1TQPA 4O5VA 2ME6A 2HNHA 4A0XA 3CUQA 5IOYA 2GQQA 2P5VA 4E4HA 2CSOA 4E7ZA 3LMMA 1J09A 1BI3A 5HS7A 2NVUB 1XGOA 4XRSA 4KISA 1WH7A 4XSZF 1HQCA 1FJLA 2DDAA 4HEA2 4A2UA 1SFEA 3OYJA 1P9QC 2HI3A 2QGUA 4KN4X 3JSPA 5AIPA 4UVBA 4BJ6C 3EUKL 1R1TA 1IN5A 1AOYA 5DM7F 1G6NA 2R5ZA 1WGXA 3K1NA 1MBFA 5F08A 1E0EA 1LFPA 5CQGA 1SANA 2KJCA 2R3SA 3CMEI 2A05A 4HF1A 4MLOA 2H8RA 2X51A 3BTIA 2GXAA 1XDUA 2Y9ZA 2EFNA 1LPQA 3CP8A 2Z2SB 2MC3A 4LIUA 4LLLA 3RSNA 5FKMA 3VWBA 1ZARA 2MG4A 4ENMA 4PGGA 2DTZA 1RC9A 4D7NA 3NEUA 2QQ9A 4CCLA 1BC8C 1TL8A 3KCCA 2GXGA 4GGGA 3O2PE 1AKHA 2E36A 5J4VA 3EUHA 2BBYA 2E1OA 2X4HA 3GTQJ 1I6XA 1VFCA 4F7ZA 2Z5UA 3VYTB 1U3EM 1W5SA 2LBFB 1HW5A 1I50J 1WJ5A 2Q8KA 1Q1HA 4XOTA 2IPQX 3U2RA 2LDUA 1AWCA 1TT0A 4MEYF 1YJNI 2O61A 2OV7A 5AIQA 4M9SA 1LE8B 1L0OC 3IHUA 3DWLE 2P7CB 3PQJA 1ETWA 3BPXA 1IN8A 3V8LA 1U5TB 3C2HA 3CJNA 4DYQA 3GBGA 3ZQGA 2L9SA 2YSRA 2DA7A 3I55I 3K2AA 3C1DA 3FXQA 3H1CA 3ABLH 4RGSA 5D6EA 4FX4A 1VTNC 2HVSA 5KNLA 2HOSA 3OOUA 1TNSA 5LBQA 2PJPA 5HVQC 2W48A 4HLXA 2VBYA 3MEXA 2HPMA 2STTA 3AFHA 4XKBA 2K85A 1NTCA 3GVAA 4GYGA 1R58A 4HNUA 3ZCOA 2XRLA 2L7MP 2FXAA 3E6DA 2QQ8A 3CCMI 1FMWA 2EV5A 4CZZA 5D4SA 4YFXF 5BNGA 1K79A 1MD0A 3HEFA 3A02A 3DXJF 1T0FA 3BJOA 3CD6I 1X3ZB 2YR2A 3BR1A 3JRGA 1TWAJ 2CQXA 4FT8A 3CC7I 3HBLA 1FTTA 1S29A 5LFAA 1VZ0A 4E70A 2JN6A 3NRVA 2DT7B 2PMUA 2J5OA 4PSXA 4XLAA 3WU2C 2P0WA 1IXRC 1Y8RB 4X6AJ 2MH9A 5FO5A 1FOYA 1OMIA 1A35A 2W1OA 3M07A 1TP4A 2A5WA 2ID6A 2LH9A 1S8NA 1SMYF 1MMNA 4IO9F 3LFKA 3VYUB 4LG0A 3CCQI 3MVPA 3IKTA 3OYBA 3E6MA 4Q5SF 1BW6A 4EATA 1KGSA 4HOBA 2ELHA 1RUOA 2MBFA 1WCMJ 3H9JA 3WGGA 4AUXA 4GCVA 5CJ9A 2PJRA 2M34A 4CYCB 3HTUA 4ZZDA 1D8KA 1UFMA 5CQEA 2OCCH 2WWYA 1LDDA 4IQ4A 4Q47A 2HGCA 4ZJZA 3KIOA 1IZ1A 4CZCA 3O3KA 1ZREA 5DUKA 1KQ0A 2CUFA 3KFWX 3ZMUA 4M9ZA 4ENKA 4ZYDA 4E7HA 1IO2A 3K4LA 2AQEA 1QPIA 5DD4A 3CLQA 1T98A 1TNTA 3HHGA 4QIWN 1PUFA 1ZRDA 4XLHA 2BGCA 2DAOA 5EG0B 1V4RA 1XDSA 4IEJA 3PNTA 1HBXG 3RCOA 4A12A 1VQKI 1FBUA 1S3JA 3HG9A 5D4RA 5E1ZB 3GZ6A 5FLVA 2K3FA 1R36A 5DYMA 3OSFA 1A31A 4WK8F 2KZGA 1YIJI 2BHZA 3V7CA 3NARA 2XKPA 3HC7A 3ZQLA 3CCVI 2OQRA 3PNYA 1AKHB 2V1XA 5LRSA 1WWXA 1ETOA 4WXCA 5FROA 1FBSA 3BP8A 2QEXI 2R92J 4HDVA 1XB4A 1X2MA 2X6OA 1ZHFA 1IRFA 2JA2A 5TJJA 2DOEA 2R7VA 4LG3A 2F4OB 4RMNA 4C30A 4CCJA 3OYKA 2E71A 1U8RA 5M3FJ 2XF7A 2MD5A 2F5CA 2LTPA 2OZ6A 3HRUA 5J4YA 3J81Z 1CF7A 3I4MJ 1Y39A 1TW3A 1MIJA 1Q1VA 4Y3OA 3VYRB 5C4JJ 1Z05A 1H8AC 2HWVA 1ZG5A 2JMWA 1I3QJ 1O57A 3MN2A 3ZQCA 3WG7H 4G7HF 1U8BA 5FLXZ 2HOTA 2FD5A 3NWTA 2NVYJ 4D9JA 2HQRA 4YELA 4A3KJ 4A3IJ 5EDNA 1ZG3A 5BMZA 1K4SA 5M3MJ 2EBIA 2X1CA 3IH4A 5F0CA 2GBYA 1XCBA 5B3SH 4DGWB 3M9AA 1R5GA 2VPRA 3P9KA 2W57A 4M3EA 1JUPA 3IWZA 2HKXA 2X6YA 2NVXJ 3I59A 3QP6A 2IGKA 4HF0A 5KCMA 1JTXA 4LOCA 5FD5A 2VOOA 1D3YA 1H89C 2E7WA 4JX6A 2O6GE 4ZDPA 2G0EA 1MMDA 2OPTA 3BQYA 2IS6A 4ANJA 2VODA 3RJPA 2ZXHA 2K9NA 4ZTJA 2CO5A 1T33A 3VSLA 1LDKB 5LEJA 4IQJA 1XC5A 2JT1A 2IS4A 2LR8A 2PX9A 4WWCA 3HSRA 1OKRA 1USSA 3F8FA 5JI6A 1FIPA 4Z2YA 2VONA 3HOZJ 2ZCWA 3SXYA 3JRBA 3W2VA 2JJ7A 1GXPA 4L9JA 2CV1A 4W97A 5FB2A 4HQEA 4MTEA 2R5YA 1B4AA 3K7AJ 2DA5A 1OLTA 5D5VB 1CQTA 2KFDA 2DMPA 5J3LA 4F91B 1LEBA 1R1UA 2HS5A 4BJTA 4D7MA 1GV5A 2LREA 5KK1A 1YJWI 3QRFF 1JKQC 3K6GA 2K5CA 3M4OJ 2KIFA 1JE8A 4NB5A 2O03A 2W25A 1U6GA 2M5WA 3H9GA 4PFPA 1G4DA 4DBRA 2BXYA 4BBRJ 2LF7A 4ON0A 3SHFA 5GAGJ 1VQ9I 4F55A 5J1UA 1D1CA 3S32A 2F5FA 2GAUA 2H1KA 2HOEA 3A2KA 5BS6A 2BW3A 3M8JA 3OV8A 3OWTA 4DJAA 1P2FA 1DGRM 1KU9A 1R1VA 3OYGA 3ZP5A 5DM6F 3RI4A 1VQ8I 3H5AA 3WTYC 3KYCB 1UHWA 1TT5B 2CUEA 3DTIA 2XAJA 1I1SA 1OCOH 1IAWA 2FNAA 4AVPA 3GTGJ 1JJ8C 3PSFA 1D8JA 4QLCU 2FBKA 4P5OA 2JVGA 2M9HA 4B09A 5L3GA 4G12A 1Y0NA 1FLIA 1ETXA 2EZLA 3DLLF 3GEZA 2K9QA 3AG1H 3BJ6A 1ZG1A 2M45A 4G94A 3HOUJ 4N4NB 2J5PA 2PMZN 2FF4A 2IVMA 2QQAA 4C2TA 2E1MC 5AONA 4JX5A 1Z91A 3BWGA 1PDNC 3QPTA 2LVSA 5D5WB 2UV1A 2K3PA 3FWEA 1ON2A 1BBYA 1V3FA 3FF5A 2BHYA 3K4MA 4NDLA 2EFPA 4A69C 2NS0A 2KMUA 2OD5A 1BR1A 5DTDA 2L2OA 3HZJA 1VQLI 1XMKA 2XKOA 3A03A 1ZRFA 3MKLA 3B6CA 3GFJA 4H4KC 2E1NA 4BHPA 5LGUA 2E19A 4RLQA 3KZIC 1S5LC 4AIHA 2DA1A 3ZN0A 3OMYA 3QAHA 2RV8A 1I5ZA 5ICEA 1E2XA 2QM3A 1LE8A 3AG4H 2E5NA 1VQNI 2OC6A 4ZC3A 2BV6A 2O9LA 2OZUA 4UVCA 2Y0SN 4RB1A 3AG3H 3R61A 1SD7A 3H0DA 3C2BA 2IW5A 3ZGKA 2ELKA 4PJ0C 1NG6A 4EQQA 2DI3A 1S7AA 1FYMA 2DJIA 5B1AH 5EGOA 5DUIA 3RDIA 5JFRA 3HIFA 5J1RA 1S7EA 3M3YJ 3OY9A 5DD8A 3PIPF 3P9CA 4LLNA 5E8GA 3GZNB 4CA0A 1DP7P 1ZRCA 5FKLA 2RDPA 3T8TA 3QODA 4P1WA 1QBJA 5EZHA 1F4KA 1I3AA 3ONQA 2FEZA 1E3HA 3CC2I 2JA5J 1UB9A 4G6TB 1HW1A 4R79A 2BYVE 2O7OA 2W84A 3JAMK 2HOAA 3ROUA 3HGYA 3GTJJ 2FUG2 2VXZA 4DIQA 5E3MA 3J7AO 3HYIA 4BXXJ 2JVHA 3FMSA 3T5XA 2OTJI 5CVUA 3LSHA 5JR3A 5LHIA 1R5HA 3FM5A 3R0AA 2K86A 3WHBA 3H5RA 1U2WA 4HBLA 2PLYA 5DCMA 1J9IA 1DDNA 4ITVA 1CGPA 1JT0A 5FJ8J 3JSOA 3SZPA 4PUSA 4EJUA 1MDMB 4BEHB 5IT9K 1J2XA 3O8HA 1RKWA 3I71A 1X2NA 1UHSA 5IYBJ 3I56I 1B72A 5E18F 3GFMA 1YHQI 4M72A 4NQWA 2VQGA 1ETQA 3OYNA 3WHCA 4FE7A 3OIPA 4E7SA 3L2WA 2CGPA 4KN7X 5F04A 1JGSA 3DBLB 4KMFA 3SEZA 3K69A 4FTHA 3PFIA 2H1LA 1OYWA 3ISPA 1P7JA 4AYBN 1BL0A 3H35A 2ESHA 4RM2A 2F5VA 2JK3A 4BQNA 3FK7A 4KA4A 2XPWA 1ZR4A 1T8IA 2D5VA 3ERED 3MD2A 2A6TA 4HYEA 1K78A 1BR4A 3I64A 4JBAA 4D0PA 5D5XB 1X3WB 5IT9Z 2QA4I 3L9FA 3OL4A 1J0RA 3R60A 1XCVA 1JHFA 2VPLA 1KYWA 3ZOBA 5DCFA 2XGXA 2STWA 2CUZA 4UUSA 1XTAA 2TRTA 2UZKA 4A3JJ 2EZKA 4HX8A 1Z6RA 2F5DA 3D5SC 3E7LA 1GDTA 1IN7A 5GTHC 1F43A 2VT3A 1Z21A 1S7OA 2BZTA 4HSRA 4QPQA 1IXSB 1FT9A 2QBYB 4XLEA 1TBXA 2FA5A 3TKYA 2ZNYA 4OIRF 1MJBA 2KRHA 3MWMA 4LK0F 3SQNA 5EYRA 2IA1A 3V8KA 1EH6A 3DPTA 3WE3A 3OYIA 4BQAA 3C2GA 1XX5A 1IRGA 4L0ZB 2AHQA 1OR7C 3K0LA 2K02A 3N4MA 1Z6TA 3I58A 4YFKF 5LLQA 2R7XA 2V1DA 3DEEA 2YX7A 3L2CA 2QZ8A 3DP7A 2ZNZA 1SC7A 3HHHA 3DTEA 2DFHA 3HGGA 2PMHA 2HPIA 2CW7A 2GZWA 4D5CA 3HOXJ 4ABZA 3HOWJ 3J7YJ 3Q3SA 5F64A 3EETA 1W7PD 2DW4A 2FX0A 5LRRA 2R7QA 3VB2A 3S2WA 3CP2A 4ZZLA 1G3YA 5FRNA 3BCAA 4L9VA 4HSTA 1FX7A 2X0LA 4MIMA 3MMYB 3OYAA 2KT0A 2ESNA 5KAFC 2VJ5A 3KX2A 3CUQC 4C3HJ 1WPKA 1MBHA 3GXOA 4E7JA 4FISA 5B66C 2A6HF 1QHHD 3I4PA 4NHJA 3HSEA 3K70D 4A3CJ 2G7HA 4IHYA 4OMYA 1WJEA 1X1AA 2L3DA 1MNDA 1ZGJA 2IS1A 2CFOA 2OA4A 3DU6A 1HA8A 2EK5A 4AWXB 2K9MA 3S8PA 2VXDA 1LEAA 1QQIA 2D2WA 2B9SA 1HCRA 2CV2A 2FSWA 1KU2A 3BZCA 1E3PA 2VJIA 4E7LA 2E2JJ 2XSJC 2PFBA 4A3BJ 1SMTA 4ENJA 2LBFA 3F23A 4NQWB 3QU3A 2L7KA 3BROA 1JUMA 4HQMA 3FMRA 4K2EA 2RNJA 4PJMA 2CQ7A 3HOYJ 4EV0A 4UVAA 2VN2A 3TOBA 1XMXA 5FFXA 3KEOA 5F0HA 4QSHA 1FYLA 3DQVC 5ICCA 2V6EA 3R6SA 4LMYA 4ENNA 2PG4A 3BJAA 4BBSJ 4IJAA 3PUFA 4EGYA 3I59B 3KYLA 1O7FA 2VQLA 3DBHB 3KP3A 3TDZC 4UUVA 3LL7A 4HZFA 3JW4A 5GAHJ 2XAQA 3F22A 2Y9YA 3WGIA 5GP9A 4C2MJ 3JRCA 1G3SA 1CF7B 3KPHA 2COBA 2Q0OA 4HV5A 3WTSC 5BQTA 4KDPA 5DV5A 1G59A 1YE9A 3WTXC 3DKYA 3V8JA 2WAQN 2CFXA 3B73A 2XB0X 3FZVA 3M8EA 4B4CA 4A3DJ 2M7BA 1C0WA 4RGUA 3K2ZA 2KDOA 4Y33A 4OMZA 2V7FA 4RBOA 3RZOJ 4M3FA 3IH2A 4ZYGA 1U5TA 3BG3A 4CICA 2N8GA 2RN7A 4HA8A 3E1SA 2ZB9A 1HSJA 4RB3C 1NH3A 4CCKA 3R0JA 2FMLA 4S04A 1HF0A 3BR6A 1Z7LA 3FX3A 1IXCA 2LKXA 5GPCA 2LY2A 2QCOA 4BQQA 2HFHA 2UXXA 4U87A 2Z33A 3G6EI 4XOPA 2O3FA 1BN5A 3JRFA 2Z99A 1EH8A 4U88A 4BJ5C 2RVCA 4PFOA 1QZEA 3SZTA 3I53A 3QP5A 1ZGAA 2HU9A 3O6BB 1E17A 3G1LA 4PJNA 3BLYA 2DK5A 3TO9A 2OQGA 3HOSA 2E5ZA 4HX4A 3CF5F 2I5UA 1SFUA 1O4XA 2DODA 1LJ9A 2AXLA 4DYCA 1Z77A 2VKHA 4CHUA 3LSMA 3ZQIA 3OR1C 2Y0MA 4PZJA 2QSGX 4BE1A 2JSPA 2L01A 4JK1X 4N9IA 1G3TA 2L9RA 3CJTB 4NC6A 4XONA 5EEAA 2H8WA 2OTLI 5LHGA 1QRYA 2R7ZJ 2RKHA 3UKGA 1T95A 3BOQA 1AHDP 5IP7J 2EFWA 2VC1A 2ZXJA 1XGMA 2Y2ZA 4IZZA 2MLKA 3JR9A 3M1CA 4BL0B 2VE9A 1Y6IA 3PUBA 4MO7A 1ERDA 4IOAF 1DP3A 2VKEA 4DNCA 3RYRA 1U78A 4XR6A 4M74A 3RQIA 4YRVA 2Y48A 2V26A 4P96A 1MW7A 3Q0WA 1P6RA 2JUGA 3ABUA 2DYRH 3I0TA 1LNWA 2MYSA 2E1MB 2K27A 3LA3A 4XN0A 4Y4RA 2XASA 2Y0SA 3E5XA 2GIZA 2M7AA 2O8KA 2JRTA 5FRMA 4FCYA 4DZPA 2XGDA 3LSPA 5IPAA 2VBWA 2HVQA 4XKCA 2F5EA 2FOKA 2W85A 2XPVA 4PDKA 1K6OA 2KISA 1JHHA 5CPRB 4L9TA 3HTSB 3HRTA 2BEOA 3TW7A 2WY8Q 4KJZA 2HYGD 4BEHA 1GT0C 5EG0A 4OAZA 3S3MA 1R71A 2WA0A 3VYSB 3DTKA 1ULYA 1SVOA 2CU7A 2VC0A 1N75A 5TISC 2BVMA 4RDUA 5F27A 4ZDLA 4BH9A 3TMOA 1WJCA 1V54H 5DDGA 2JQ7A 1FYKA 2M4KA 3LA2A 5H6QA 1YS7A 3PL8A 3CQZJ 3OYMA 5J8CA 1MBKA 3F6OA 4L5JA 4KICA 3I4NJ 2V9VA 3D5RC 5GAEJ 1BC7C 4NBQA 3S2DJ 5JLWA 1O3TA 2FRHA 1SFXA 1OQYA 1MSFC 2RNGA 1FSEA 1YG2A 3HRSA 3HB9A 2EIKH 3G4SI 1FBQA 4ETSA 3IUOA 1EV7A 1IDZA 4XKWA 1A04A 3G2BA 4NC8A 1REPC 2HQNA 2TCTA 2M1BA 1V5FA 2X6WA 3I3LA 4WXHA 4HG2A 4HLYA 2KHMA 3IKVA 3LAPA 3S1MJ 3D5LA 4UB6C 1I1GA 3DPUA 2A5YB 1KYZA 2WV1A 2MC4A 2IJLA 3QU6A 2MGQA 2EFQA 5JLXA 2LSOA 4OAYA 3W6JB 4V2FA 3ZMTA 4CCOA 1DUXC 3KP5A 1MJ9A 2XB5A 4BNCA 2BXZA 1ONVA 3CMYA 1FOXA 1YQAA 1LB2A 1GVDA 3C3WA 1YS6A 2HXOA 3FIWA 3ZPLA 3M7GA 2FBHA 4FASD 4PJLA 1OFCX 4OWRB 4BXFA 2Y69H 4KT5C 5FFZA 3SJMA 2WAQA 4Y15A 3S15J 1D1AA 3F8MA 2V79A 2MFZA 3BR2A 4IXAA 3J7ZI 5J40A 2XC7A 2FU4A 1BJZA 1VQ4I 3SFIA 1X4PA 3H3UA 1ON1A 3H0GJ 3L2RA 5FKOA 2ZSIB 4C2UA 1UHMA 4N9HA 2E1CA 5E20A 3CZ6A 2CW8A 5FGMA 2KRCA 3MQ0A 1VF9A 5HNFA 2O8XA 2X6XA 4EGZA 3D0SA 2GLOA 1JTYA 4UV9A 5ED4A 2MW8A 5M5YJ 4WX9A 2VOPA 3WGHA 1QZYA 1YW7A 2WAFA 1D5YA 3LSJA 4UXNA 5F0FA 4DYRA 5EF6A 3CTAA 1UCRA 1G3WA 1I27A 1R22A 4G9YA 4S05A 3U9GA 2CV0A 2UXNA 4M73A 5J6XA 4DBQA 1UELB 2LNBA 4CCNA 2ID3A 4CUGA 5ILVA 1IC8A 5GADJ 1YW8A 2XHKA 2GM4A 1O3SA 4MQ9F 2OCEA 2H6CA 5LD2C 2GOMA 1B8IB 3ERMA 3RKXA 1TTYA 5E8IA 3IL2A 4IHVA 3ZMDA 1WKMA 2DCEA 1P92A 4RGXA 4C3IJ 4XBFA 5CLSA 4LLGF 4LJZF 3GYHX 1R00A 1PJRA 2LYCA 4C9YA 1F9NA 3TL4X 4OIPF 2QF7A 2HTJA 3GTMJ 2DA4A 4RGRA 3FKIJ 1GHCA 1FWZA 2DPUA 1WJDA 4E7KA 1K7AA 1FMVA 1UMQA 1K83J 1PUFB 2PJRB 5TRDA 1IN4A 3HXLA 4A3FJ 1OYYA 3REOA 2IS2A 4U7DA 2NNNA 3K1PA 1T6SA 5D5UB 1ZK8A 2BE5F 1LVAA 4NNJA 2P5LC 3ZQHA 4XLPF 3H3VK 3FBIB 1FP1D 2R7FA 3TO6A 3KEYA 2EIJH 3C7JA 2QUFA 3VPRA 4CH7A 4AC0A 3KP2A 1QPMA 4AVZA 2HYFA 4Y17A 2PI0A 3A01B 5C4XJ 2IEKA 3BTCA 2FBIA 3ABMH 1PP8F 1PP7U 2Z3YA 4ZTFA 2EIMH 1OCZH 1XMAA 3GX4X 3KZYA 2HQAA 3W2WA 5ERIA 3KLNA 1BOAA 1TW2A 2CS3A 3ZMSA 3RPQA 4AU7A 1W36C 2WV0A 2EZIA 4ZYEA 3QOEA 2PQ8A 3LSKA 4GYIA 1H0MA 4DW6A 1QZZA 2XUBA 4W1UA 1B9NA 1DGWY 3A01A 1ZR2A 1HW2A 4C3JJ 2D1HA 2DA2A 3EUHC 5IOZA 4HPQA 4CDGA 1LQ1A 2JZYA 4IRGA 3TP3A 2WAEA 4RAGA 2XPUA 3KLOA 5J47A 2AXTC 2B7EA 4M3GA 4MHGA 3NAUA 3I54A 3LQRA 4L9NA 3Q0UA 2DJNA 2MD0A 1TZLA 5E1XA 4A93J 3BC8A 2EB7A 2NOGA 2NS7A 2DMUA 1SAUA 1IUFA 1MKMA 1RKTA 1ENHA 1R4NB 2QKLB 2VQCA 3ELKA 4ESFA 3F6VA 3E6CC 4J00A 1B59A 1KU7A 1BM9A 4NUBA 1YI2I 3S2HJ 3LSGA 4FE4A 4ZH4F 1IN6A 1WJFA 2LP0A 1EA3A 2NVQJ 5FLMJ 2E34A 3BZKA 4LITA 1POGA 1X19A 5HDNA 1SD5A 1H9GA 5HLGA 2OF7A 5FKNA 3JRIA 1U9NA 3HJEA 2DPDA 3G1MA 1BI2A 2VKVA 4XRSG 2Z9OA 3U1KA 1UG2A 1D5VA 2JA7J 4XORA 1W0TA 3ZN1A 1J5YA 1TLHB 5A2QZ 3I9V2 5LGNA 1Z7UA 2MH2A 3A0HC 1FC3A 4XQFA 3QOPA 5E1WA 4KT6A 1R9TJ 1FIAA 4EEFG 4PSWA 5BOXA 3LAJA 4J01A 3IRRA 2M87A 5F1JA 5F6FA 4XRMA 5ICGA 4KNYA 1OJLA 2DFFA 1VQPI 3HM5A 4IHSA 2ZFUA 1P4XA 1WHUA 3CO6C 1W5TA 2PMZA 1RRJA 1KQ8A 1W1WE 4BE2A 3K9TA 2YU9J 1ZQ3P 4XK4A 4GDFA 1XSVA 3PO2J 3DLAA 5E3LA 2A3SA 3PO3J 2VJJA 2RAEA 1IDYA 4EM1A 1WSUA 2M4GA 2PN6A 3HPGA 1JI8A 1MSEC 2V1NA 3FK6A 3GF2A 5C44J 2RGVA 3CLOA 2X9DA 3BT9A 3IH3A 3H3ZA 3FKJA 3FXOA 1QGPA 2X85A 3QPHA 1D1BA 3RIRA 2YUSA 2L7FP 3BG5A 3JREA 3ZMZA 1ZLJA 3Q9SA 2R7TA 1QVUA 3IC7A 1HKQA 3M8FA 3MZYA 5HLTA 1WZ2A 3KE2A 3OYHA 4OIOF 1R4MB 1QVTA 2KRFA 3LA7A 2JTVA 1P7IA 4G6DA 3GLXA 3F72A 4LFUA 1UZCA 1N25A 4XLCA 5KHDA 1BIBA 3DEUA 2VKDA 3AL0C 5HODA 2KIUA 3ULQB 2HR3A 3COAC 4R8HA 2CG4A 4U0YA 2EFOA 3IV5A 1WI3A 4YEJA 2BY3A 3GTKJ 3ZRGA 5IT3A 5L3CA 4I7HA 2P81A 2ECBA 3K4NA 2L7ZA 2WBMA 5D6FA 5HNHA 2GA2A 1ZN2A 3E5UA 3S1QJ 1A6IA 4QTRA 3V7SA 4L0YB 1ACIA 3RPUD 4XSXF 1DPUA 3L1PA 1TWHJ 4KMUX 4EVIA 5L3BA 1LKXA 3UNGC 2KL4A 2W4SA 2WB1N 3P7NA 4HAMA 1TWFJ 3CJRB 5F1RA 2LOOA 4B44A 2UUZA 1P4AA 3CCLI 2X1EA 2KP6A 5KAIC 1RUNA 3RKYA 1HDPA 2VE8A 3PJRA 2E2IJ 2L9VA 3GTOJ 3J80Z 5TGTA 2ZMEC 1D0YA 1MNMC 1Z1DA 2HXIA 3DFGA 3ZMVA 3E3VA 3PIOF 2W00A 4M6XA 2F4IA 2HDWA 4HNTA 1HKTA 2W82A 2IA2A 2EV0A 3VODA 2HTSA 3Q5FA 4MNUA 1R23A 2JA6J 1Z3XA 3S14J 2H94A 3FHNA 4I01A 4NC7A 5HS8A 2EA2A 2L4MA 4KIBA 1HC8A 2O0YA 1HOMA 3HUGA 3BQZA 3LNQA 2DOAA 1USTA 2FQ3A 2IGOA 5C3EJ 1KONA 2M3AA 4RA2A 1JT6A 1XPXA 3D1NI 1YRNB 3EDPA 3KETA 4AIDA 4YIIA 1YW9A 4QWQA 5IY5H 2ZJRF 2LD5A 4PCQA 1W0UA 2OJED 3V7RA 4D1QA 3FDYA 3OYDA 1F5TA 2P4WA 3RQ4A 2VLAA
chains in the Genus database with same CATH topology
1R7JA 2V1UA 3WTWC 2QVOA 5L3EA 2XRNA 1SD6A 2EA4A 1SD4A 6PAXA 4RB2C 5K5QA 1W7PA 4G7OF 4Q48A 1FP2A 2DO7A 5CVRA 3SFZA 2JPBA 4U7BA 3RPUA 5K5RA 3L7WA 3C18A 3E97A 2A68F 5J8FA 2XIGA 4P55A 2EV6A 1IW7F 5K5OA 1KU3A 3JTHA 4FX0A 4I0BA 3ECHA 3HOTA 3GUDA 4DQ2A 4WF2A 2L02A 1Y0UA 1GXQA 5H6RA 4A5MA 3JAMZ 2DQLA 5K1YA 3AAFA 1L3LA 2P6TA 2EJRA 3F21A 3U1DA 1IUYA 2ISZA 3KZZA 1B9MA 1KQ9A 5DCMB 3GZ5A 1ODDA 4G6QA 4ASNA 1T39A 1RZ4A 1RI7A 4I98B 4YG2F 1X3UA 4IHTA 4MTDA 3BY6A 1ZH5A 4UNOA 4LGWA 2QQBA 5HLHA 2JPCA 3CDHA 1NHAA 3WTVC 2NYXA 4A6EA 5LEKA 4I0AA 4WCGA 2CWEA 5BPIA 4OINF 3MCZA 3LWFA 2GIVA 4HF2A 2M8EA 2QENA 3P9IA 3MFKA 5ICFA 4BYYA 5CYVA 1YIOA 4O6JA 2ISYA 2LF8A 1XGNA 4CGZA 3FXRA 4GO1A 1GVJA 3VOEA 2TDXA 4KFCA 2PBIA 4IRIA 1EH7A 3DKWA 2QLZA 1W7PB 5CVVA 4XLNF 5FD6A 4AIJA 4LG0B 2HKOA 1STZA 3CO7C 1HXDA 2EWNA 3J80K 3L00A 2ACJA 4YFNF 1BJAA 1FSHA 4PGHA 2IT0A 5HDKA 2ZBKA 3B02A 4CYDA 1BI0A 1MZBA 3MZHA 4XRFA 4IVNA 1O7LA 4UV8A 2E7XA 5ILUA 4M6YA 3F8BA 2MA3A 2DQRA 2A6EF 1RIOH 5LGTA 1FZPB 3FM3A 4GXOA 4LB6B 4I2OA 2XAHA 3W6KB 4AD9A 5HDGA 2ZKZA 4IF4A 3F8CA 2FNPA 2YX4A 2COMA 3G73A 1K78B 2ZMEB 1P4WA 3LQQA 2P6SA 3WE2A 4U0VA 4R1HA 4A0YA 1YLFA 2P5KA 2CW0F 3WU0A 3R4KA 1S6LA 4YIFA 2FMYA 5CVIA 3F8NA 1YTYA 1O3RA 3TOAA 4H0EA 3CUQB 1H9TA 2H6BA 4KYWA 4HDUA 3GFIA 5JHUA 3G3ZA 3LSTA 2YPRA 1MDMA 3KEQA 2B0LA 3TQNA 3BZ6A 2DK8A 3HRMA 5HS9A 4MEXF 1XD7A 4JQFA 2CQKA 5ILSA 2V6CA 2OU2A 2L54A 2ETHA 2W24A 3WTTC 4M9XA 4FHTA 4EM2A 4ESBA 4RB0A 3EYYA 2GXBA 1BI1A 4A6DA 3RYPA 4Y13A 1J75A 3VFZA 3VEPA 2ZMEA 2H27A 5EEGA 1DPRA 1WI9A 3T1BA 2IRFG 5HLIA 3TGNA 4IPAA 4M71A 5D8LB 2XV4S 1TQIA 2XVCA 3FHZA 2A69F 1RNLA 1BIAA 3WTZA 2XROA 4KIFA 3KP4A 4RAZA 4HW0A 4BAYA 1U5TC 2A07F 5KVRA 3I5UA 2DLLA 4KIGA 4A5NA 4UHTA 3WTUC 4A0ZA 4U0WA 3DF8A 1OR7A 5D8KB 3GWZA 3WG9A 3IRQA 4O3MA 4MGRA 4HX7A 1FNNA 1FOKA 3PQKA 4OU0A 3RTRA 5CVJA 1ZLKA 4ESJA 1W4MA 2P8TA 3EQLF 1MJAA 4CO8A 1QO0D 2DT5A 1J59A 1HKSA 1JXSA 5EEHA 1F1ZA 4AIKA 2M30A 1XSXA 3JTGA 2DU9A 4ZYHA 4L5IA 4OIQF 2RQPA 4BXUA 1FY7A 1OPCA 3NQOA 2XAGA 1O3QA 3E5QA 2GA1A 4RS8A 2ZJ2A 2VBXA 3T0YA 3FMQA 1XSDA 2G7UA 2HDCA 3TDUC 5JVTA 4LB5A 1IF1A 4B8XA 3V4GA 5FLXK 3L09A 2C6YA 3EYIA 2P7VB 4L18B 2OAZA 4BHBA 2MLGA 1ZAOA 1T2KA 2D45A 2AS5F 2QBYA 1QNTA 1WRJA 4P9FA 3J81K 3TO7A 1B1BA 1WQ2A 2QYOA 1YFHA 3DPLC 5HOOA 4N0BA 1XN7A 3BPVA 1XGSA 1ZYRF 3OOPA 4Q4ZF 4BHCA 2FE3A 3K1MA 3M1EA 3GW2A 3CUOA 4EJWA 3N97A 2LKPA 3FXUA 4I02A 3ECOA 2HZTA 4HV6A 1J7KA 2PEXA 2VBZA 3BDDA 2KIMA 1FPQA 1HSTA 2F2EA 3KP6A 5H20A 1YO5C 2DTRA 3GFLA 4RAYA 2RC4A 2GWRA 4G7ZF 2R7DA 3ML6A 2Y75A 3IWFA 3ZQ7A 2HEOA 3GO5A 4WXDA 1TQMA 2VT2A 4IRHA 1YYVA 1Z9CA 4EMSA 2CYYA 4LD5A 5BPDA 2G9WA 1OYIA 3Q9VA 2UWMA 1PUEE 2YU3A 4G8XA 3E6BA 2JSCA 2NNYA 3KP7A 4EJTA 2IP2A 2ZFWA 2NRAC 2D1VA 3T8RA 5L3DA 5A2QK 2ZO4A 3HSFA 2K4JA 1KA8A 2K7LA 2OBPA 1T38A 4EJOA 2WTEA 2KKOA 3WU1B 1MGTA 2ADUA 5LHHA 2IA0A 3F3XA 3WODF 1B6AA 2H09A 1SAXA 5DEQA 2A61A 4EJVA 5E17F 3RKWA 4I09A 2DFIA 2KJBA 4OOIA 4TV7A 4CXFA 2NAZA 4P9UA 2K4BA 4EM0B 3DV8A 2WC2A 1LDJA 4KUMA 4MQVA 2DBBA 2Q2EA 4LK1F 2QWWA 3MAJA 5L3FA 3H92A 3ABTA 2XAFA 2L4AA 1TQPA 4O5VA 4A0XA 3CUQA 2GQQA 2P5VA 2CSOA 1BI3A 5HS7A 1XGOA 4XSZF 1HQCA 4A2UA 1SFEA 4KN4X 3JSPA 5AIPA 4UVBA 1R1TA 1IN5A 1AOYA 1G6NA 3K1NA 2KJCA 2R3SA 4HF1A 1XDUA 2EFNA 2MC3A 4LLLA 1ZARA 4ENMA 4PGGA 3NEUA 2QQ9A 1BC8C 3KCCA 2GXGA 4GGGA 3O2PE 3EUHA 2BBYA 2X4HA 1I6XA 4F7ZA 2Z5UA 1U3EM 1W5SA 1HW5A 2Q8KA 1Q1HA 3U2RA 2IPQX 2LDUA 1AWCA 4MEYF 2O61A 5AIQA 4M9SA 1L0OC 3IHUA 2P7CB 3PQJA 3BPXA 1IN8A 3V8LA 1U5TB 3CJNA 2YSRA 3C1DA 3FXQA 4RGSA 5D6EA 4FX4A 1VTNC 5LBQA 1TNSA 2PJPA 5HVQC 4HLXA 2VBYA 3MEXA 2STTA 3GVAA 4GYGA 1R58A 2FXAA 3E6DA 2EV5A 4CZZA 5D4SA 4YFXF 1K79A 1MD0A 3DXJF 1T0FA 3BJOA 2YR2A 4FT8A 1S29A 4E70A 3NRVA 2PMUA 2J5OA 1IXRC 2MH9A 5FO5A 1OMIA 1S8NA 1SMYF 3LFKA 4LG0A 3IKTA 3E6MA 4Q5SF 1KGSA 4HOBA 2ELHA 1RUOA 2MBFA 3WGGA 4GCVA 5CJ9A 3HTUA 4ZZDA 1D8KA 1UFMA 2WWYA 1LDDA 4Q47A 2HGCA 1IZ1A 3O3KA 1ZREA 5DUKA 1KQ0A 3KFWX 3ZMUA 4M9ZA 4ENKA 4ZYDA 5DD4A 1T98A 1TNTA 1ZRDA 3HHGA 2BGCA 2DAOA 1V4RA 1XDSA 1HBXG 4A12A 1FBUA 1S3JA 5D4RA 3GZ6A 5E1ZB 1R36A 5DYMA 4WK8F 3V7CA 2XKPA 2OQRA 2V1XA 5LRSA 1WWXA 4WXCA 1FBSA 3BP8A 4HDVA 1XB4A 1ZHFA 1IRFA 5TJJA 1U8RA 1CF7A 2MD5A 2F5CA 2OZ6A 3HRUA 3J81Z 1TW3A 1Z05A 2HWVA 1ZG5A 1O57A 4G7HF 5FLXZ 2HQRA 1ZG3A 5BMZA 1XCBA 3M9AA 1R5GA 3P9KA 2W57A 3IWZA 2HKXA 3I59A 3QP6A 4HF0A 5FD5A 2VOOA 1D3YA 2E7WA 2O6GE 2VODA 3RJPA 2CO5A 1LDKB 5LEJA 2JT1A 4WWCA 3HSRA 1OKRA 1USSA 3F8FA 5JI6A 4Z2YA 2VONA 2ZCWA 3SXYA 1GXPA 4L9JA 5FB2A 4HQEA 4MTEA 1B4AA 5D5VB 1LEBA 1R1UA 2HS5A 5KK1A 3QRFF 2KIFA 1JE8A 4NB5A 2O03A 2W25A 1U6GA 2M5WA 1G4DA 2LF7A 4ON0A 3SHFA 2F5FA 2GAUA 2HOEA 5BS6A 3OV8A 1P2FA 1KU9A 1R1VA 3ZP5A 3RI4A 3WTYC 1UHWA 2XAJA 1I1SA 1IAWA 2FNAA 4AVPA 1D8JA 4QLCU 2FBKA 4P5OA 4B09A 5L3GA 1FLIA 3GEZA 3BJ6A 1ZG1A 2M45A 4G94A 2J5PA 2FF4A 2IVMA 2QQAA 5AONA 1Z91A 3BWGA 1PDNC 3QPTA 5D5WB 3FWEA 1ON2A 1BBYA 1V3FA 3FF5A 2EFPA 2NS0A 2OD5A 1XMKA 2XKOA 1ZRFA 3GFJA 2E1NA 4BHPA 5LGUA 4AIHA 3ZN0A 3QAHA 2RV8A 1I5ZA 5ICEA 1E2XA 2QM3A 2BV6A 2OZUA 4UVCA 4RB1A 3R61A 1SD7A 2IW5A 4EQQA 2DI3A 1S7AA 1FYMA 5DUIA 3RDIA 5JFRA 3HIFA 5DD8A 3P9CA 4LLNA 5E8GA 1DP7P 1ZRCA 2RDPA 3T8TA 1QBJA 1F4KA 2FEZA 1UB9A 3JAMK 1HW1A 4R79A 2BYVE 2W84A 3ROUA 2VXZA 3J7AO 3HYIA 3FMSA 3T5XA 5CVUA 5JR3A 5LHIA 1R5HA 3FM5A 3R0AA 2K86A 1U2WA 4HBLA 2PLYA 5DCMA 1J9IA 1DDNA 1CGPA 3JSOA 1MDMB 3SZPA 4EJUA 5IT9K 1J2XA 3I71A 5E18F 3GFMA 4M72A 4NQWA 2CGPA 4KN7X 1JGSA 4KMFA 3K69A 3PFIA 1OYWA 3ISPA 2ESHA 4KA4A 3ERED 1K78A 4HYEA 3I64A 4JBAA 4D0PA 5D5XB 5IT9Z 3L9FA 1J0RA 3R60A 1XCVA 1JHFA 1KYWA 5DCFA 2XGXA 2STWA 2UZKA 4HX8A 1Z6RA 2F5DA 1IN7A 2VT3A 1S7OA 1IXSB 1FT9A 2QBYB 1TBXA 2FA5A 3TKYA 2ZNYA 4OIRF 1MJBA 3MWMA 4LK0F 3SQNA 3V8KA 2IA1A 1EH6A 3DPTA 3WE3A 4BQAA 1IRGA 4L0ZB 3K0LA 2K02A 3N4MA 1Z6TA 3I58A 4YFKF 5LLQA 2V1DA 2YX7A 3L2CA 2QZ8A 3DP7A 2ZNZA 3HHHA 2PMHA 2GZWA 5F64A 3EETA 1W7PD 2DW4A 5LRRA 3VB2A 3S2WA 4ZZLA 1G3YA 4L9VA 1FX7A 2X0LA 2ESNA 3CUQC 3GXOA 2A6HF 3I4PA 4NHJA 3HSEA 2G7HA 4OMYA 2L3DA 1ZGJA 2OA4A 2EK5A 4AWXB 1LEAA 1QQIA 2D2WA 2FSWA 1KU2A 2PFBA 1SMTA 4ENJA 3F23A 3QU3A 3BROA 4HQMA 3FMRA 4K2EA 2RNJA 4EV0A 4UVAA 2VN2A 3TOBA 5FFXA 3KEOA 1FYLA 3DQVC 5ICCA 3R6SA 4LMYA 4ENNA 2PG4A 3BJAA 4IJAA 4EGYA 3I59B 1O7FA 4UUVA 3KP3A 3TDZC 4HZFA 3JW4A 2XAQA 3F22A 3WGIA 1G3SA 1CF7B 2Q0OA 4HV5A 3WTSC 5BQTA 4KDPA 5DV5A 3WTXC 3V8JA 2CFXA 3B73A 3M8EA 3FZVA 1C0WA 4RGUA 3K2ZA 4OMZA 4ZYGA 1U5TA 4CICA 2RN7A 4HA8A 1HSJA 4RB3C 3R0JA 2FMLA 4S04A 3FX3A 1IXCA 2Z33A 2HFHA 2UXXA 2O3FA 1BN5A 2Z99A 1EH8A 4U88A 2RVCA 3SZTA 3I53A 3QP5A 1ZGAA 3O6BB 1E17A 2DK5A 3TO9A 2OQGA 3HOSA 4HX4A 1SFUA 1LJ9A 2AXLA 4CHUA 2Y0MA 4PZJA 2L01A 4JK1X 4N9IA 1G3TA 5LHGA 2RKHA 3BOQA 2EFWA 2VC1A 2ZXJA 1XGMA 2MLKA 2VE9A 1U78A 4DNCA 3RYRA 4M74A 2Y48A 4P96A 1P6RA 3ABUA 3I0TA 1LNWA 2K27A 3LA3A 2XASA 3E5XA 2JRTA 2VBWA 2F5EA 2FOKA 2W85A 4PDKA 1K6OA 1JHHA 4L9TA 3HTSB 3HRTA 2BEOA 2HYGD 1ULYA 2VC0A 4BH9A 5DDGA 1FYKA 3LA2A 5H6QA 1YS7A 5J8CA 3F6OA 4L5JA 4KICA 2V9VA 1BC7C 1O3TA 2FRHA 1SFXA 1FSEA 1YG2A 3HRSA 1FBQA 4ETSA 1EV7A 1A04A 1REPC 2HQNA 2M1BA 4WXHA 4HLYA 3IKVA 3LAPA 3D5LA 1I1GA 2A5YB 1KYZA 2IJLA 3QU6A 2EFQA 2LSOA 3W6JB 3ZMTA 1DUXC 3KP5A 1MJ9A 4BNCA 1ONVA 1YQAA 1LB2A 3C3WA 1YS6A 3ZPLA 3M7GA 2FBHA 4KT5C 5FFZA 4Y15A 3F8MA 2V79A 4IXAA 2FU4A 3H3UA 1ON1A 1UHMA 4N9HA 2E1CA 5E20A 5FGMA 3MQ0A 2O8XA 4EGZA 3D0SA 4WX9A 4UV9A 5ED4A 2VOPA 3WGHA 1QZYA 1YW7A 4UXNA 3CTAA 1UCRA 1G3WA 1I27A 1R22A 4G9YA 4S05A 3U9GA 2UXNA 4M73A 5J6XA 2LNBA 5ILVA 1YW8A 2XHKA 1O3SA 4MQ9F 2H6CA 3RKXA 5E8IA 1TTYA 3IL2A 3ZMDA 1WKMA 1P92A 4RGXA 4XBFA 5CLSA 4LLGF 4LJZF 3GYHX 1R00A 1F9NA 4OIPF 2HTJA 4RGRA 1GHCA 1FWZA 2DPUA 1K7AA 5TRDA 1IN4A 1OYYA 3REOA 4U7DA 2NNNA 3K1PA 1T6SA 5D5UB 2BE5F 1LVAA 2P5LC 4XLPF 1FP1D 2R7FA 3TO6A 3C7JA 2QUFA 3KP2A 1QPMA 2HYFA 4Y17A 2PI0A 2FBIA 1PP8F 1PP7U 2Z3YA 1XMAA 3GX4X 3KZYA 5ERIA 3KLNA 1BOAA 1TW2A 3ZMSA 3RPQA 2WV0A 4ZYEA 2PQ8A 4GYIA 1H0MA 1QZZA 2XUBA 1B9NA 1HW2A 2D1HA 4CDGA 1LQ1A 2JZYA 4IRGA 3KLOA 4MHGA 3I54A 3LQRA 4L9NA 5E1XA 2EB7A 1MKMA 4ESFA 3ELKA 3F6VA 3E6CC 1KU7A 1B59A 1BM9A 4ZH4F 1IN6A 5HDNA 1SD5A 1H9GA 5HLGA 2DPDA 1BI2A 2Z9OA 1D5VA 3ZN1A 1J5YA 1TLHB 5A2QZ 5LGNA 1Z7UA 2MH2A 1FC3A 3QOPA 5E1WA 5BOXA 3LAJA 3IRRA 2M87A 5F6FA 5ICGA 4KNYA 4IHSA 1P4XA 3CO6C 1W5TA 1KQ8A 3K9TA 1XSVA 2A3SA 4EM1A 1WSUA 2PN6A 3GF2A 2RGVA 3CLOA 3H3ZA 1QGPA 3QPHA 3RIRA 3ZMZA 1ZLJA 3Q9SA 3IC7A 1HKQA 3M8FA 3MZYA 3KE2A 4OIOF 2KRFA 3LA7A 2JTVA 4G6DA 3GLXA 3F72A 4LFUA 1BIBA 3DEUA 2KIUA 3ULQB 2HR3A 3COAC 4R8HA 2CG4A 4U0YA 2EFOA 5IT3A 5L3CA 4I7HA 5D6FA 2GA2A 1ZN2A 3E5UA 3V7SA 4L0YB 4XSXF 1DPUA 4KMUX 4EVIA 5L3BA 3P7NA 4HAMA 5F1RA 1P4AA 1RUNA 3RKYA 2VE8A 3J80Z 1Z1DA 3DFGA 3ZMVA 3E3VA 4M6XA 1HKTA 2IA2A 2EV0A 3VODA 2HTSA 3Q5FA 4MNUA 1R23A 2H94A 4I01A 5HS8A 2EA2A 2L4MA 4KIBA 2O0YA 3HUGA 1USTA 2FQ3A 3EDPA 3KETA 4YIIA 1YW9A 4QWQA 4PCQA 3V7RA 1F5TA 2P4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R7J A;  2V1U A;  3WTW C;  2QVO A;  5L3E A;  2XRN A;  1SD6 A;  2EA4 A;  1SD4 A;  6PAX A;  4RB2 C;  5K5Q A;  1W7P A;  4G7O F;  4Q48 A;  1FP2 A;  2DO7 A;  5CVR A;  3SFZ A;  2JPB A;  4U7B A;  3RPU A;  5K5R A;  3L7W A;  3C18 A;  3E97 A;  2A68 F;  5J8F A;  2XIG A;  4P55 A;  2EV6 A;  1IW7 F;  5K5O A;  1KU3 A;  3JTH A;  4FX0 A;  4I0B A;  3ECH A;  3HOT A;  3GUD A;  4DQ2 A;  4WF2 A;  2L02 A;  1Y0U A;  1GXQ A;  5H6R A;  4A5M A;  3JAM Z;  2DQL A;  5K1Y A;  3AAF A;  1L3L A;  2P6T A;  2EJR A;  3F21 A;  3U1D A;  1IUY A;  2ISZ A;  3KZZ A;  1B9M A;  1KQ9 A;  5DCM B;  3GZ5 A;  1ODD A;  4G6Q A;  4ASN A;  1T39 A;  1RZ4 A;  1RI7 A;  4I98 B;  4YG2 F;  1X3U A;  4IHT A;  4MTD A;  3BY6 A;  1ZH5 A;  4UNO A;  4LGW A;  2QQB A;  5HLH A;  2JPC A;  3CDH A;  1NHA A;  3WTV C;  2NYX A;  4A6E A;  5LEK A;  4I0A A;  4WCG A;  2CWE A;  5BPI A;  4OIN F;  3MCZ A;  3LWF A;  2GIV A;  4HF2 A;  2M8E A;  2QEN A;  3P9I A;  3MFK A;  5ICF A;  4BYY A;  5CYV A;  1YIO A;  4O6J A;  2ISY A;  2LF8 A;  1XGN A;  4CGZ A;  3FXR A;  4GO1 A;  1GVJ A;  3VOE A;  2TDX A;  4KFC A;  2PBI A;  4IRI A;  1EH7 A;  3DKW A;  2QLZ A;  1W7P B;  5CVV A;  4XLN F;  5FD6 A;  4AIJ A;  4LG0 B;  2HKO A;  1STZ A;  3CO7 C;  1HXD A;  2EWN A;  3J80 K;  3L00 A;  2ACJ A;  4YFN F;  1BJA A;  1FSH A;  4PGH A;  2IT0 A;  5HDK A;  2ZBK A;  3B02 A;  4CYD A;  1BI0 A;  1MZB A;  3MZH A;  4XRF A;  4IVN A;  1O7L A;  4UV8 A;  2E7X A;  5ILU A;  4M6Y A;  3F8B A;  2MA3 A;  2DQR A;  2A6E F;  1RIO H;  5LGT A;  1FZP B;  3FM3 A;  4GXO A;  4LB6 B;  4I2O A;  2XAH A;  3W6K B;  4AD9 A;  5HDG A;  2ZKZ A;  4IF4 A;  3F8C A;  2FNP A;  2YX4 A;  2COM A;  3G73 A;  1K78 B;  2ZME B;  1P4W A;  3LQQ A;  2P6S A;  3WE2 A;  4U0V A;  4R1H A;  4A0Y A;  1YLF A;  2P5K A;  2CW0 F;  3WU0 A;  3R4K A;  1S6L A;  4YIF A;  2FMY A;  5CVI A;  3F8N A;  1YTY A;  1O3R A;  3TOA A;  4H0E A;  3CUQ B;  1H9T A;  2H6B A;  4KYW A;  4HDU A;  3GFI A;  5JHU A;  3G3Z A;  3LST A;  2YPR A;  1MDM A;  3KEQ A;  2B0L A;  3TQN A;  3BZ6 A;  2DK8 A;  3HRM A;  5HS9 A;  4MEX F;  1XD7 A;  4JQF A;  2CQK A;  5ILS A;  2V6C A;  2OU2 A;  2L54 A;  2ETH A;  2W24 A;  3WTT C;  4M9X A;  4FHT A;  4EM2 A;  4ESB A;  4RB0 A;  3EYY A;  2GXB A;  1BI1 A;  4A6D A;  3RYP A;  4Y13 A;  1J75 A;  3VFZ A;  3VEP A;  2ZME A;  2H27 A;  5EEG A;  1DPR A;  1WI9 A;  3T1B A;  2IRF G;  5HLI A;  3TGN A;  4IPA A;  4M71 A;  5D8L B;  2XV4 S;  1TQI A;  2XVC A;  3FHZ A;  2A69 F;  1RNL A;  1BIA A;  3WTZ A;  2XRO A;  4KIF A;  3KP4 A;  4RAZ A;  4HW0 A;  4BAY A;  1U5T C;  2A07 F;  5KVR A;  3I5U A;  2DLL A;  4KIG A;  4A5N A;  4UHT A;  3WTU C;  4A0Z A;  4U0W A;  3DF8 A;  1OR7 A;  5D8K B;  3GWZ A;  3WG9 A;  3IRQ A;  4O3M A;  4MGR A;  4HX7 A;  1FNN A;  1FOK A;  3PQK A;  4OU0 A;  3RTR A;  5CVJ A;  1ZLK A;  4ESJ A;  1W4M A;  2P8T A;  3EQL F;  1MJA A;  4CO8 A;  1QO0 D;  2DT5 A;  1J59 A;  1HKS A;  1JXS A;  5EEH A;  1F1Z A;  4AIK A;  2M30 A;  1XSX A;  3JTG A;  2DU9 A;  4ZYH A;  4L5I A;  4OIQ F;  2RQP A;  4BXU A;  1FY7 A;  1OPC A;  3NQO A;  2XAG A;  1O3Q A;  3E5Q A;  2GA1 A;  4RS8 A;  2ZJ2 A;  2VBX A;  3T0Y A;  3FMQ A;  1XSD A;  2G7U A;  2HDC A;  3TDU C;  5JVT A;  4LB5 A;  1IF1 A;  4B8X A;  3V4G A;  5FLX K;  3L09 A;  2C6Y A;  3EYI A;  2P7V B;  4L18 B;  2OAZ A;  4BHB A;  2MLG A;  1ZAO A;  1T2K A;  2D45 A;  2AS5 F;  2QBY A;  1QNT A;  1WRJ A;  4P9F A;  3J81 K;  3TO7 A;  1B1B A;  1WQ2 A;  2QYO A;  1YFH A;  3DPL C;  5HOO A;  4N0B A;  1XN7 A;  3BPV A;  1XGS A;  1ZYR F;  3OOP A;  4Q4Z F;  4BHC A;  2FE3 A;  3K1M A;  3M1E A;  3GW2 A;  3CUO A;  4EJW A;  3N97 A;  2LKP A;  3FXU A;  4I02 A;  3ECO A;  2HZT A;  4HV6 A;  1J7K A;  2PEX A;  2VBZ A;  3BDD A;  2KIM A;  1FPQ A;  1HST A;  2F2E A;  3KP6 A;  5H20 A;  1YO5 C;  2DTR A;  3GFL A;  4RAY A;  2RC4 A;  2GWR A;  4G7Z F;  2R7D A;  3ML6 A;  2Y75 A;  3IWF A;  3ZQ7 A;  2HEO A;  3GO5 A;  4WXD A;  1TQM A;  2VT2 A;  4IRH A;  1YYV A;  1Z9C A;  4EMS A;  2CYY A;  4LD5 A;  5BPD A;  2G9W A;  1OYI A;  3Q9V A;  2UWM A;  1PUE E;  2YU3 A;  4G8X A;  3E6B A;  2JSC A;  2NNY A;  3KP7 A;  4EJT A;  2IP2 A;  2ZFW A;  2NRA C;  2D1V A;  3T8R A;  5L3D A;  5A2Q K;  2ZO4 A;  3HSF A;  2K4J A;  1KA8 A;  2K7L A;  2OBP A;  1T38 A;  4EJO A;  2WTE A;  2KKO A;  3WU1 B;  1MGT A;  2ADU A;  5LHH A;  2IA0 A;  3F3X A;  3WOD F;  1B6A A;  2H09 A;  1SAX A;  5DEQ A;  2A61 A;  4EJV A;  5E17 F;  3RKW A;  4I09 A;  2DFI A;  2KJB A;  4OOI A;  4TV7 A;  4CXF A;  2NAZ A;  4P9U A;  2K4B A;  4EM0 B;  3DV8 A;  2WC2 A;  1LDJ A;  4KUM A;  4MQV A;  2DBB A;  2Q2E A;  4LK1 F;  2QWW A;  3MAJ A;  5L3F A;  3H92 A;  3ABT A;  2XAF A;  2L4A A;  1TQP A;  4O5V A;  4A0X A;  3CUQ A;  2GQQ A;  2P5V A;  2CSO A;  1BI3 A;  5HS7 A;  1XGO A;  4XSZ F;  1HQC A;  4A2U A;  1SFE A;  4KN4 X;  3JSP A;  5AIP A;  4UVB A;  1R1T A;  1IN5 A;  1AOY A;  1G6N A;  3K1N A;  2KJC A;  2R3S A;  4HF1 A;  1XDU A;  2EFN A;  2MC3 A;  4LLL A;  1ZAR A;  4ENM A;  4PGG A;  3NEU A;  2QQ9 A;  1BC8 C;  3KCC A;  2GXG A;  4GGG A;  3O2P E;  3EUH A;  2BBY A;  2X4H A;  1I6X A;  4F7Z A;  2Z5U A;  1U3E M;  1W5S A;  1HW5 A;  2Q8K A;  1Q1H A;  3U2R A;  2IPQ X;  2LDU A;  1AWC A;  4MEY F;  2O61 A;  5AIQ A;  4M9S A;  1L0O C;  3IHU A;  2P7C B;  3PQJ A;  3BPX A;  1IN8 A;  3V8L A;  1U5T B;  3CJN A;  2YSR A;  3C1D A;  3FXQ A;  4RGS A;  5D6E A;  4FX4 A;  1VTN C;  5LBQ A;  1TNS A;  2PJP A;  5HVQ C;  4HLX A;  2VBY A;  3MEX A;  2STT A;  3GVA A;  4GYG A;  1R58 A;  2FXA A;  3E6D A;  2EV5 A;  4CZZ A;  5D4S A;  4YFX F;  1K79 A;  1MD0 A;  3DXJ F;  1T0F A;  3BJO A;  2YR2 A;  4FT8 A;  1S29 A;  4E70 A;  3NRV A;  2PMU A;  2J5O A;  1IXR C;  2MH9 A;  5FO5 A;  1OMI A;  1S8N A;  1SMY F;  3LFK A;  4LG0 A;  3IKT A;  3E6M A;  4Q5S F;  1KGS A;  4HOB A;  2ELH A;  1RUO A;  2MBF A;  3WGG A;  4GCV A;  5CJ9 A;  3HTU A;  4ZZD A;  1D8K A;  1UFM A;  2WWY A;  1LDD A;  4Q47 A;  2HGC A;  1IZ1 A;  3O3K A;  1ZRE A;  5DUK A;  1KQ0 A;  3KFW X;  3ZMU A;  4M9Z A;  4ENK A;  4ZYD A;  5DD4 A;  1T98 A;  1TNT A;  1ZRD A;  3HHG A;  2BGC A;  2DAO A;  1V4R A;  1XDS A;  1HBX G;  4A12 A;  1FBU A;  1S3J A;  5D4R A;  3GZ6 A;  5E1Z B;  1R36 A;  5DYM A;  4WK8 F;  3V7C A;  2XKP A;  2OQR A;  2V1X A;  5LRS A;  1WWX A;  4WXC A;  1FBS A;  3BP8 A;  4HDV A;  1XB4 A;  1ZHF A;  1IRF A;  5TJJ A;  1U8R A;  1CF7 A;  2MD5 A;  2F5C A;  2OZ6 A;  3HRU A;  3J81 Z;  1TW3 A;  1Z05 A;  2HWV A;  1ZG5 A;  1O57 A;  4G7H F;  5FLX Z;  2HQR A;  1ZG3 A;  5BMZ A;  1XCB A;  3M9A A;  1R5G A;  3P9K A;  2W57 A;  3IWZ A;  2HKX A;  3I59 A;  3QP6 A;  4HF0 A;  5FD5 A;  2VOO A;  1D3Y A;  2E7W A;  2O6G E;  2VOD A;  3RJP A;  2CO5 A;  1LDK B;  5LEJ A;  2JT1 A;  4WWC A;  3HSR A;  1OKR A;  1USS A;  3F8F A;  5JI6 A;  4Z2Y A;  2VON A;  2ZCW A;  3SXY A;  1GXP A;  4L9J A;  5FB2 A;  4HQE A;  4MTE A;  1B4A A;  5D5V B;  1LEB A;  1R1U A;  2HS5 A;  5KK1 A;  3QRF F;  2KIF A;  1JE8 A;  4NB5 A;  2O03 A;  2W25 A;  1U6G A;  2M5W A;  1G4D A;  2LF7 A;  4ON0 A;  3SHF A;  2F5F A;  2GAU A;  2HOE A;  5BS6 A;  3OV8 A;  1P2F A;  1KU9 A;  1R1V A;  3ZP5 A;  3RI4 A;  3WTY C;  1UHW A;  2XAJ A;  1I1S A;  1IAW A;  2FNA A;  4AVP A;  1D8J A;  4QLC U;  2FBK A;  4P5O A;  4B09 A;  5L3G A;  1FLI A;  3GEZ A;  3BJ6 A;  1ZG1 A;  2M45 A;  4G94 A;  2J5P A;  2FF4 A;  2IVM A;  2QQA A;  5AON A;  1Z91 A;  3BWG A;  1PDN C;  3QPT A;  5D5W B;  3FWE A;  1ON2 A;  1BBY A;  1V3F A;  3FF5 A;  2EFP A;  2NS0 A;  2OD5 A;  1XMK A;  2XKO A;  1ZRF A;  3GFJ A;  2E1N A;  4BHP A;  5LGU A;  4AIH A;  3ZN0 A;  3QAH A;  2RV8 A;  1I5Z A;  5ICE A;  1E2X A;  2QM3 A;  2BV6 A;  2OZU A;  4UVC A;  4RB1 A;  3R61 A;  1SD7 A;  2IW5 A;  4EQQ A;  2DI3 A;  1S7A A;  1FYM A;  5DUI A;  3RDI A;  5JFR A;  3HIF A;  5DD8 A;  3P9C A;  4LLN A;  5E8G A;  1DP7 P;  1ZRC A;  2RDP A;  3T8T A;  1QBJ A;  1F4K A;  2FEZ A;  1UB9 A;  3JAM K;  1HW1 A;  4R79 A;  2BYV E;  2W84 A;  3ROU A;  2VXZ A;  3J7A O;  3HYI A;  3FMS A;  3T5X A;  5CVU A;  5JR3 A;  5LHI A;  1R5H A;  3FM5 A;  3R0A A;  2K86 A;  1U2W A;  4HBL A;  2PLY A;  5DCM A;  1J9I A;  1DDN A;  1CGP A;  3JSO A;  1MDM B;  3SZP A;  4EJU A;  5IT9 K;  1J2X A;  3I71 A;  5E18 F;  3GFM A;  4M72 A;  4NQW A;  2CGP A;  4KN7 X;  1JGS A;  4KMF A;  3K69 A;  3PFI A;  1OYW A;  3ISP A;  2ESH A;  4KA4 A;  3ERE D;  1K78 A;  4HYE A;  3I64 A;  4JBA A;  4D0P A;  5D5X B;  5IT9 Z;  3L9F A;  1J0R A;  3R60 A;  1XCV A;  1JHF A;  1KYW A;  5DCF A;  2XGX A;  2STW A;  2UZK A;  4HX8 A;  1Z6R A;  2F5D A;  1IN7 A;  2VT3 A;  1S7O A;  1IXS B;  1FT9 A;  2QBY B;  1TBX A;  2FA5 A;  3TKY A;  2ZNY A;  4OIR F;  1MJB A;  3MWM A;  4LK0 F;  3SQN A;  3V8K A;  2IA1 A;  1EH6 A;  3DPT A;  3WE3 A;  4BQA A;  1IRG A;  4L0Z B;  3K0L A;  2K02 A;  3N4M A;  1Z6T A;  3I58 A;  4YFK F;  5LLQ A;  2V1D A;  2YX7 A;  3L2C A;  2QZ8 A;  3DP7 A;  2ZNZ A;  3HHH A;  2PMH A;  2GZW A;  5F64 A;  3EET A;  1W7P D;  2DW4 A;  5LRR A;  3VB2 A;  3S2W A;  4ZZL A;  1G3Y A;  4L9V A;  1FX7 A;  2X0L A;  2ESN A;  3CUQ C;  3GXO A;  2A6H F;  3I4P A;  4NHJ A;  3HSE A;  2G7H A;  4OMY A;  2L3D A;  1ZGJ A;  2OA4 A;  2EK5 A;  4AWX B;  1LEA A;  1QQI A;  2D2W A;  2FSW A;  1KU2 A;  2PFB A;  1SMT A;  4ENJ A;  3F23 A;  3QU3 A;  3BRO A;  4HQM A;  3FMR A;  4K2E A;  2RNJ A;  4EV0 A;  4UVA A;  2VN2 A;  3TOB A;  5FFX A;  3KEO A;  1FYL A;  3DQV C;  5ICC A;  3R6S A;  4LMY A;  4ENN A;  2PG4 A;  3BJA A;  4IJA A;  4EGY A;  3I59 B;  1O7F A;  4UUV A;  3KP3 A;  3TDZ C;  4HZF A;  3JW4 A;  2XAQ A;  3F22 A;  3WGI A;  1G3S A;  1CF7 B;  2Q0O A;  4HV5 A;  3WTS C;  5BQT A;  4KDP A;  5DV5 A;  3WTX C;  3V8J A;  2CFX A;  3B73 A;  3M8E A;  3FZV A;  1C0W A;  4RGU A;  3K2Z A;  4OMZ A;  4ZYG A;  1U5T A;  4CIC A;  2RN7 A;  4HA8 A;  1HSJ A;  4RB3 C;  3R0J A;  2FML A;  4S04 A;  3FX3 A;  1IXC A;  2Z33 A;  2HFH A;  2UXX A;  2O3F A;  1BN5 A;  2Z99 A;  1EH8 A;  4U88 A;  2RVC A;  3SZT A;  3I53 A;  3QP5 A;  1ZGA A;  3O6B B;  1E17 A;  2DK5 A;  3TO9 A;  2OQG A;  3HOS A;  4HX4 A;  1SFU A;  1LJ9 A;  2AXL A;  4CHU A;  2Y0M A;  4PZJ A;  2L01 A;  4JK1 X;  4N9I A;  1G3T A;  5LHG A;  2RKH A;  3BOQ A;  2EFW A;  2VC1 A;  2ZXJ A;  1XGM A;  2MLK A;  2VE9 A;  1U78 A;  4DNC A;  3RYR A;  4M74 A;  2Y48 A;  4P96 A;  1P6R A;  3ABU A;  3I0T A;  1LNW A;  2K27 A;  3LA3 A;  2XAS A;  3E5X A;  2JRT A;  2VBW A;  2F5E A;  2FOK A;  2W85 A;  4PDK A;  1K6O A;  1JHH A;  4L9T A;  3HTS B;  3HRT A;  2BEO A;  2HYG D;  1ULY A;  2VC0 A;  4BH9 A;  5DDG A;  1FYK A;  3LA2 A;  5H6Q A;  1YS7 A;  5J8C A;  3F6O A;  4L5J A;  4KIC A;  2V9V A;  1BC7 C;  1O3T A;  2FRH A;  1SFX A;  1FSE A;  1YG2 A;  3HRS A;  1FBQ A;  4ETS A;  1EV7 A;  1A04 A;  1REP C;  2HQN A;  2M1B A;  4WXH A;  4HLY A;  3IKV A;  3LAP A;  3D5L A;  1I1G A;  2A5Y B;  1KYZ A;  2IJL A;  3QU6 A;  2EFQ A;  2LSO A;  3W6J B;  3ZMT A;  1DUX C;  3KP5 A;  1MJ9 A;  4BNC A;  1ONV A;  1YQA A;  1LB2 A;  3C3W A;  1YS6 A;  3ZPL A;  3M7G A;  2FBH A;  4KT5 C;  5FFZ A;  4Y15 A;  3F8M A;  2V79 A;  4IXA A;  2FU4 A;  3H3U A;  1ON1 A;  1UHM A;  4N9H A;  2E1C A;  5E20 A;  5FGM A;  3MQ0 A;  2O8X A;  4EGZ A;  3D0S A;  4WX9 A;  4UV9 A;  5ED4 A;  2VOP A;  3WGH A;  1QZY A;  1YW7 A;  4UXN A;  3CTA A;  1UCR A;  1G3W A;  1I27 A;  1R22 A;  4G9Y A;  4S05 A;  3U9G A;  2UXN A;  4M73 A;  5J6X A;  2LNB A;  5ILV A;  1YW8 A;  2XHK A;  1O3S A;  4MQ9 F;  2H6C A;  3RKX A;  5E8I A;  1TTY A;  3IL2 A;  3ZMD A;  1WKM A;  1P92 A;  4RGX A;  4XBF A;  5CLS A;  4LLG F;  4LJZ F;  3GYH X;  1R00 A;  1F9N A;  4OIP F;  2HTJ A;  4RGR A;  1GHC A;  1FWZ A;  2DPU A;  1K7A A;  5TRD A;  1IN4 A;  1OYY A;  3REO A;  4U7D A;  2NNN A;  3K1P A;  1T6S A;  5D5U B;  2BE5 F;  1LVA A;  2P5L C;  4XLP F;  1FP1 D;  2R7F A;  3TO6 A;  3C7J A;  2QUF A;  3KP2 A;  1QPM A;  2HYF A;  4Y17 A;  2PI0 A;  2FBI A;  1PP8 F;  1PP7 U;  2Z3Y A;  1XMA A;  3GX4 X;  3KZY A;  5ERI A;  3KLN A;  1BOA A;  1TW2 A;  3ZMS A;  3RPQ A;  2WV0 A;  4ZYE A;  2PQ8 A;  4GYI A;  1H0M A;  1QZZ A;  2XUB A;  1B9N A;  1HW2 A;  2D1H A;  4CDG A;  1LQ1 A;  2JZY A;  4IRG A;  3KLO A;  4MHG A;  3I54 A;  3LQR A;  4L9N A;  5E1X A;  2EB7 A;  1MKM A;  4ESF A;  3ELK A;  3F6V A;  3E6C C;  1KU7 A;  1B59 A;  1BM9 A;  4ZH4 F;  1IN6 A;  5HDN A;  1SD5 A;  1H9G A;  5HLG A;  2DPD A;  1BI2 A;  2Z9O A;  1D5V A;  3ZN1 A;  1J5Y A;  1TLH B;  5A2Q Z;  5LGN A;  1Z7U A;  2MH2 A;  1FC3 A;  3QOP A;  5E1W A;  5BOX A;  3LAJ A;  3IRR A;  2M87 A;  5F6F A;  5ICG A;  4KNY A;  4IHS A;  1P4X A;  3CO6 C;  1W5T A;  1KQ8 A;  3K9T A;  1XSV A;  2A3S A;  4EM1 A;  1WSU A;  2PN6 A;  3GF2 A;  2RGV A;  3CLO A;  3H3Z A;  1QGP A;  3QPH A;  3RIR A;  3ZMZ A;  1ZLJ A;  3Q9S A;  3IC7 A;  1HKQ A;  3M8F A;  3MZY A;  3KE2 A;  4OIO F;  2KRF A;  3LA7 A;  2JTV A;  4G6D A;  3GLX A;  3F72 A;  4LFU A;  1BIB A;  3DEU A;  2KIU A;  3ULQ B;  2HR3 A;  3COA C;  4R8H A;  2CG4 A;  4U0Y A;  2EFO A;  5IT3 A;  5L3C A;  4I7H A;  5D6F A;  2GA2 A;  1ZN2 A;  3E5U A;  3V7S A;  4L0Y B;  4XSX F;  1DPU A;  4KMU X;  4EVI A;  5L3B A;  3P7N A;  4HAM A;  5F1R A;  1P4A A;  1RUN A;  3RKY A;  2VE8 A;  3J80 Z;  1Z1D A;  3DFG A;  3ZMV A;  3E3V A;  4M6X A;  1HKT A;  2IA2 A;  2EV0 A;  3VOD A;  2HTS A;  3Q5F A;  4MNU A;  1R23 A;  2H94 A;  4I01 A;  5HS8 A;  2EA2 A;  2L4M A;  4KIB A;  2O0Y A;  3HUG A;  1UST A;  2FQ3 A;  3EDP A;  3KET A;  4YII A;  1YW9 A;  4QWQ A;  4PCQ A;  3V7R A;  1F5T A;  2P4W A; 
#chains in the Genus database with same CATH topology
 1R7J A;  1APL C;  1OIS A;  4YIR X;  1OCR H;  2V1U A;  3VDX A;  3WTW C;  2QVO A;  2XF5 A;  5L3E A;  4UUT A;  4XN3 A;  3CDI A;  2XRN A;  5K7Z A;  1SD6 A;  2EA4 A;  2Y30 A;  3OIO A;  3QQA A;  4UUS B;  2FQ4 A;  4I76 A;  2DYS H;  1SD4 A;  3HKZ N;  6PAX A;  1OCC H;  4KIT B;  4X0G A;  4RB2 C;  5K5Q A;  1W7P A;  4BY1 J;  2LY1 A;  4G7O F;  4Q48 A;  1B8I A;  2L9N A;  1FP2 A;  2DO7 A;  3KYD B;  5CVR A;  4RLF A;  2F48 A;  3SFZ A;  3K70 C;  2BY0 A;  2L0K A;  2JPB A;  2JUC A;  3J7A Y;  4U7B A;  2W7N A;  3RPU A;  3LSI A;  5K5R A;  3L7W A;  1K4T A;  3C18 A;  2F4M B;  1TWC J;  5K7H A;  3JRA A;  1TWG J;  3E97 A;  2E2H J;  2VAS A;  4B3X A;  2A68 F;  1S9H A;  5J8F A;  4B48 A;  2XIG A;  1Y1V J;  1VI0 A;  3DKX A;  1T56 A;  4P55 A;  2EV6 A;  1IW7 F;  1NK2 P;  5K5O A;  1KU3 A;  2XSD C;  1JUS A;  3JTH A;  4FX0 A;  3OYL A;  1ZKG A;  4I0B A;  3ECH A;  3HOT A;  3GUD A;  4DQ2 A;  3S16 J;  4WF2 A;  2L02 A;  1Y0U A;  1WFX A;  2DFE A;  4Z6Y A;  1GXQ A;  5H6R A;  4A5M A;  3JAM Z;  2DQL A;  5K1Y A;  3AAF A;  1L3L A;  2P6T A;  3TBI A;  5B1B H;  4A3G J;  2EJR A;  3F21 A;  3U1D A;  1IUY A;  4MFE A;  4A3E J;  2ISZ A;  3KZZ A;  4M3B A;  1ZEL A;  1B9M A;  5IP9 J;  1KQ9 A;  5DCM B;  3GZ5 A;  1ODD A;  3GTP J;  4G6Q A;  4ASN A;  1T39 A;  1RZ4 A;  1RI7 A;  2IBD A;  4I98 B;  4YG2 F;  2R5Y B;  2XF6 A;  1X3U A;  4IHT A;  1YIT I;  1LFU P;  4N4O B;  4MTD A;  3AL0 B;  1PVE A;  4QPO A;  2CQN A;  2IXS A;  1Z67 A;  3BY6 A;  2B63 J;  1ZH5 A;  4UNO A;  3W2A A;  4LGW A;  2QQB A;  5HLH A;  2JPC A;  3CDH A;  2LFB A;  1WVR A;  3JCU C;  1NK3 P;  1ETY A;  1NHA A;  2R7R A;  2RRE A;  3WTV C;  4RM3 A;  2NYX A;  4A6E A;  2EIN H;  3BCB A;  5EZG A;  4UY8 I;  1X1B A;  1LVK A;  1RPW A;  5LEK A;  4I0A A;  4WCG A;  1WJB A;  2CWE A;  5BPI A;  1SFK A;  4OIN F;  2KPM A;  3MCZ A;  2ZSH B;  3LWF A;  5E3N A;  2GIV A;  4HF2 A;  4F92 B;  2M8E A;  2VIX A;  1R49 A;  2JRM A;  2QEN A;  3Q0V A;  3P9I A;  5E3O A;  3MFK A;  5ICF A;  3OIQ A;  1YRN A;  4BYY A;  3CDL A;  5CYV A;  1YIO A;  4O6J A;  1MMS A;  2E60 A;  2Z16 A;  2ISY A;  4V2G A;  3A4C A;  2LF8 A;  1U0J A;  1Y56 A;  5GTI C;  2X48 A;  2BY1 A;  2MAB A;  1XGN A;  4CGZ A;  5K7F A;  3HOV J;  2EH3 A;  3FXR A;  3TP0 A;  4GO1 A;  5DS9 A;  1GUU A;  3FIS A;  4CCM A;  2DXI A;  2ZC2 A;  1GVJ A;  3VOE A;  4XL9 A;  1QA6 A;  2TDX A;  4KFC A;  2PBI A;  1RR7 A;  4IRI A;  3TED A;  2GOX B;  2I10 A;  1G8X A;  1EH7 A;  3DKW A;  4PK4 A;  1MBE A;  2QLZ A;  1W7P B;  2IGM A;  5CVV A;  3L2V A;  2ZJP F;  4XLN F;  4GRI A;  5FD6 A;  4AIJ A;  5B5E C;  3LFU A;  3SDB A;  4A3L J;  4LG0 B;  2HKO A;  4BY7 J;  4JYK A;  3L2Q A;  4GFB A;  3CMM A;  2IGN A;  2KIQ A;  1VQM I;  1STZ A;  3ASO H;  3CO7 C;  1HXD A;  4XM3 A;  2EWN A;  2NS8 A;  3L00 A;  3J80 K;  1MBJ A;  2ACJ A;  2MSY A;  4YFN F;  2DA3 A;  2R7W A;  1BJA A;  2R0Q C;  1FSH A;  4PGH A;  2IT0 A;  5HDK A;  3BG7 A;  2ZBK A;  4IHW A;  1R6R A;  3B02 A;  4CYD A;  1BI0 A;  1MZB A;  3MZH A;  4BQO A;  5JVG F;  4XRF A;  1YX5 A;  4IVN A;  1O7L A;  4UV8 A;  2E7X A;  3G71 I;  1LFB A;  4M6Y A;  5ILU A;  3A1Y A;  2MA3 A;  3F8B A;  3AG2 H;  3K4K A;  3SYT A;  4B43 A;  2A6E F;  2DQR A;  2YS9 A;  1RIO H;  5LGT A;  2LMD A;  3SEQ A;  1FZP B;  2LY9 A;  3OYC A;  3FM3 A;  4GXO A;  1NG7 A;  1IV8 A;  1PYV A;  2I8D A;  4LB6 B;  3G1O A;  4I2O A;  1JKP C;  2HQ5 A;  4IOC F;  3HPH A;  2K9S A;  1MH3 A;  2XAH A;  2CJJ A;  3W6K B;  4AD9 A;  3HKZ A;  1DU6 A;  1EKE A;  5HDG A;  3QPL A;  3AKZ A;  2ZKZ A;  4IF4 A;  1GLN A;  3MKZ A;  3F8C A;  2FNP A;  1D0Z A;  2YX4 A;  2COM A;  3G73 A;  3CCU I;  1K78 B;  2ZME B;  1P4W A;  3LQQ A;  2P6S A;  3WE2 A;  3IP4 B;  4U0V A;  4R1H A;  2DT6 A;  3JRH A;  1FEX A;  1G2H A;  4A0Y A;  5H2F C;  3OS0 A;  2Q2E B;  1FOW A;  1YLF A;  3FBN B;  2P5K A;  2CW0 F;  3WU0 A;  3S3N A;  1DU0 A;  2JWT A;  3R4K A;  3L2U A;  3IAS 2;  1S6L A;  2LG4 A;  1V55 H;  4CYC A;  4YIF A;  2FMY A;  2HYJ A;  5CVI A;  3F8N A;  1YTY A;  2DMN A;  3ZQF A;  3DBR B;  1O3R A;  3TOA A;  4H0E A;  2E35 A;  2K9L A;  3CUQ B;  1H9T A;  2H6B A;  1B72 B;  4KYW A;  4HDU A;  3GFI A;  4B3A A;  5JHU A;  4E7I A;  1BOB A;  4E6K G;  2XGE A;  4XIC A;  3BG9 A;  1BW5 A;  3G3Z A;  3LST A;  1XG1 A;  2YPR A;  1MDM A;  4DZJ A;  3B6A A;  4F3Q A;  1BA5 A;  2VB6 A;  4F93 B;  3GLL A;  4ZDO A;  3KEQ A;  2DA6 A;  2B0L A;  4L5E A;  3TQN A;  3ZXS A;  3BZ6 A;  2DK8 A;  1MMA A;  2EIL H;  1Y1W J;  1A5J A;  3HRM A;  5HS9 A;  4MEX F;  1BR2 A;  1XD7 A;  2V9K A;  4JQF A;  2KLO A;  2CQK A;  5ILS A;  2V6C A;  1K61 A;  2LLK A;  2OU2 A;  2L54 A;  2QSH X;  1MH4 A;  1H88 C;  2ETH A;  4II2 A;  3CCS I;  2W24 A;  3WTT C;  3HDD A;  1W5C C;  4M9X A;  4FHT A;  4XNF A;  4EM2 A;  4ESB A;  4RB0 A;  1X1D A;  1UJ8 A;  3EYY A;  2LKS A;  2CRG A;  2GXB A;  1BI1 A;  4A6D A;  3RYP A;  4Y13 A;  1J75 A;  5IYC J;  3VFZ A;  3OSG A;  1HDD C;  3VEP A;  1ZGW A;  3MKY B;  5E79 C;  3PFY A;  2ZME A;  3EUA A;  1RET A;  2H27 A;  5EEG A;  1JJ6 C;  1DPR A;  5FKK A;  5JHF A;  1WI9 A;  3DU5 A;  1X1P A;  3CCJ I;  1Z0X A;  3T1B A;  2WB1 A;  1TC3 C;  1RES A;  5HLI A;  4CSW A;  2IRF G;  3S1R J;  3TGN A;  4IPA A;  4M71 A;  1SVM A;  1T0F C;  1F36 A;  4M3D A;  3W3C A;  5D8L B;  2NXN B;  5GPA A;  4B47 A;  2XV4 S;  1TQI A;  1K6Y A;  2XVC A;  1UG0 A;  1ZTR A;  2R7U A;  3FHZ A;  2R93 J;  2A69 F;  1RNL A;  1BIA A;  3WTZ A;  2XRO A;  4KIF A;  1IRX A;  3KP4 A;  5J1Y A;  4RAZ A;  1V5G A;  4HW0 A;  4I99 C;  4BAY A;  1U5T C;  1JKO C;  2VJ4 A;  3F0C A;  2R7S A;  3SDG A;  2A07 F;  2KQR A;  5KVR A;  2EQR A;  3H5N A;  3HUG B;  3I5U A;  2DLL A;  4KIG A;  2DMT A;  4A5N A;  4UHT A;  3WTU C;  4A0Z A;  2CQQ A;  1SFO J;  4U0W A;  1YOV B;  3BTJ A;  2R5Z B;  3S1N J;  3DF8 A;  1OR7 A;  3UR3 C;  2F6C A;  2BW3 B;  5D8K B;  3GWZ A;  1KZH A;  2IAI A;  3WG9 A;  4A3M J;  3IRQ A;  4O3M A;  4MGR A;  3IAM 2;  4HX7 A;  1FNN A;  1FOK A;  3PQK A;  4BAC A;  2V9P A;  3VSK A;  4OU0 A;  3RTR A;  5CVJ A;  1ZLK A;  1UAA A;  2VL8 A;  4ESJ A;  2EPF A;  1W4M A;  2P8T A;  3EQL F;  4BDZ A;  1MJA A;  2LK2 A;  2VUM J;  1IV6 A;  1IGN A;  2HDD A;  4Y52 J;  1SVL A;  2K40 A;  4CO8 A;  1QO0 D;  2DT5 A;  2WY7 Q;  2VI6 A;  2FOW A;  2LC2 A;  1V5E A;  2JA8 J;  2BOL A;  1J59 A;  3FXK A;  4BE0 A;  1HKS A;  1JXS A;  5EEH A;  2AO9 A;  1VQO I;  2VQH A;  3S17 J;  1F1Z A;  3FXL A;  4AIK A;  2NVT J;  4XID A;  2M30 A;  2ME0 A;  1XSX A;  3JTG A;  3GTL J;  5CKT A;  2DU9 A;  4ZYH A;  4HRI A;  3NWS A;  4L5I A;  4OIQ F;  3RKQ A;  2RQP A;  1S72 I;  4BXU A;  1GV2 A;  3K4C A;  1FY7 A;  1OPC A;  3NQO A;  2XAG A;  3F9K A;  4J19 A;  1O3Q A;  2ELJ A;  3E5Q A;  2GA1 A;  2WAD A;  1MNE A;  4RS8 A;  4HNV A;  3MKW B;  2ZJ2 A;  2ZXI A;  2HZD A;  2M8G X;  2VBX A;  3T0Y A;  1M1E B;  3FMQ A;  1HLV A;  1XSD A;  1EF4 A;  3QYB A;  2G7U A;  1Z3Y A;  2XDV A;  5EGO B;  2HDC A;  3TDU C;  4II3 A;  3H9Q A;  1JKR C;  5JVT A;  1IG7 A;  4PJJ A;  1A6Q A;  4LB5 A;  1IF1 A;  1SEU A;  4BUP A;  1WH5 A;  1YX3 A;  3LSR A;  4MFD A;  1QHG A;  3DEW A;  4B8X A;  3V4G A;  5M5X J;  5FLX K;  3L09 A;  2C6Y A;  3EYI A;  1N78 A;  4M6V A;  3OS2 A;  3MZ8 A;  1ITY A;  1MMG A;  1I39 A;  2P7V B;  4L18 B;  2DOF A;  2OAZ A;  4BHB A;  2MLG A;  1ZAO A;  4F52 A;  1OCT C;  1T2K A;  3CC4 I;  2D45 A;  2AS5 F;  2QBY A;  1QNT A;  2V4J C;  1WRJ A;  4P9F A;  3J81 K;  2R7O A;  3QWL A;  4V19 K;  3TO7 A;  1B1B A;  1WQ2 A;  2Q1Z B;  2QYO A;  1YFH A;  2NOJ B;  3K4J A;  3DPL C;  5HOO A;  3LOC A;  4N0B A;  1OCP A;  2CUJ A;  1EJ9 A;  1ETK A;  2ECC A;  3RZD J;  1XN7 A;  3BPV A;  1AA7 A;  3U21 A;  1XGS A;  4IHX A;  3O8G A;  1ZYR F;  3A0B C;  3OOP A;  4Q4Z F;  4BHC A;  2FE3 A;  3K1M A;  3M1E A;  3BR0 A;  2DMQ A;  2M2E A;  4IL6 C;  3N05 A;  4IX7 A;  1MBG A;  3GW2 A;  3CUO A;  1ETV A;  4EJW A;  2FJ1 A;  3N97 A;  1W36 D;  2LKP A;  3FXU A;  4I02 A;  3ECO A;  3TW6 A;  2HZT A;  1U9O A;  4HV6 A;  3X2Q H;  3V42 A;  3QYE A;  2Y31 A;  3ASN H;  1J7K A;  3HL2 A;  2PEX A;  3BTL A;  3K4B A;  2X1D A;  2ZJQ F;  3S93 A;  3CF2 A;  5EJC A;  1WJA A;  4BS9 A;  2M0C A;  2VBZ A;  3BDD A;  2KIM A;  3BG6 A;  3OYE A;  3FXJ A;  2CMP A;  2XAU A;  1VND A;  3E0J B;  3CCE I;  1RR8 C;  1FPQ A;  1HST A;  2F2E A;  3KP6 A;  2L5Q A;  5H20 A;  1YO5 C;  4B1R A;  2DTR A;  2KZV A;  3GFL A;  2R4G A;  3H36 A;  4BDY A;  4JP0 A;  2M0M A;  4RAY A;  1QU3 A;  1Y8Q B;  2RC4 A;  4UB8 C;  2GWR A;  4G7Z F;  9ANT A;  2R7D A;  2BVL A;  3K10 A;  3ML6 A;  4JOM A;  1IRZ A;  2Y75 A;  3IWF A;  3ZQ7 A;  4XMY A;  2HEO A;  2LRD A;  3GO5 A;  4WXD A;  1TQM A;  3JRD A;  3OL3 A;  3OR2 C;  5IP6 A;  2VT2 A;  2CH0 A;  4IRH A;  2HVR A;  1YYV A;  2OUM A;  1XS9 A;  1Z9C A;  4EMS A;  2CYY A;  2ZXW H;  4LD5 A;  4LIV A;  5BPD A;  2G9W A;  1OYI A;  3QYF A;  1VQ5 I;  3Q9V A;  2UWM A;  2AQF A;  1PUE E;  3P5J A;  2YU3 A;  4G8X A;  3E6B A;  3OYF A;  1R5I D;  2JSC A;  1X4O A;  3W6V A;  1IJW C;  2NNY A;  1VQ6 I;  3CCR I;  3KP7 A;  4EJT A;  2IP2 A;  3BR5 A;  2ZFW A;  4X1E A;  2NRA C;  2D1V A;  4XKV A;  3T8R A;  2XGC A;  5L3D A;  5A2Q K;  2DDB A;  2ZO4 A;  3CCY A;  3HSF A;  2K4J A;  3BR3 A;  1I6H J;  1KA8 A;  2K7L A;  2OBP A;  4EJO A;  1T38 A;  2WTE A;  2KKO A;  4JX4 A;  3GCM A;  1X58 A;  2O5R A;  3WU1 B;  1MGT A;  2ADU A;  3ZQQ A;  5LHH A;  4AYB A;  4AM3 A;  4BU2 A;  2IA0 A;  4IKF A;  3GME A;  3F3X A;  4BGD A;  3OS1 A;  3PNV A;  2BY2 A;  3PSI A;  4FET A;  3ESW B;  4FQG A;  3DCF A;  3WOD F;  3CES A;  1B6A A;  2H09 A;  4ZYA A;  1A36 A;  1SAX A;  1FTZ A;  5DEQ A;  2QSF X;  2A61 A;  4EJV A;  3EPZ A;  3CMA I;  1X1C A;  4BKX A;  5E17 F;  3S3O A;  3RKW A;  1ORK A;  4I6Z A;  4I09 A;  3FXM A;  2DFI A;  2KJB A;  4OOI A;  1DQU A;  1VQ7 I;  1AU7 A;  4TV7 A;  1LUJ B;  4CXF A;  3PM1 A;  4RAF A;  4Y7N J;  2NAZ A;  4DOZ A;  4P9U A;  4XLF A;  2K4B A;  3QPS A;  4EM0 B;  5IYD J;  2QKM B;  3DV8 A;  3CJQ B;  2WC2 A;  1LDJ A;  4KUM A;  1D0X A;  2Z1D A;  1YJ9 I;  4MQV A;  2DBB A;  2ICW G;  2RQQ A;  3SZG A;  1T08 B;  3ZR8 X;  3ABK H;  2Q2E A;  4LK1 F;  4S0H B;  2QWW A;  2KDZ A;  5M5W J;  4D5F A;  2DN0 A;  3MAJ A;  1JGG A;  2EZH A;  5L3F A;  3H92 A;  3ABT A;  2XAF A;  2L4A A;  1N77 A;  1E3O C;  1TQP A;  4O5V A;  2ME6 A;  2HNH A;  4A0X A;  3CUQ A;  5IOY A;  2GQQ A;  2P5V A;  4E4H A;  2CSO A;  4E7Z A;  3LMM A;  1J09 A;  1BI3 A;  5HS7 A;  2NVU B;  1XGO A;  4XRS A;  4KIS A;  1WH7 A;  4XSZ F;  1HQC A;  1FJL A;  2DDA A;  4HEA 2;  4A2U A;  1SFE A;  3OYJ A;  1P9Q C;  2HI3 A;  2QGU A;  4KN4 X;  3JSP A;  5AIP A;  4UVB A;  4BJ6 C;  3EUK L;  1R1T A;  1IN5 A;  1AOY A;  5DM7 F;  1G6N A;  2R5Z A;  1WGX A;  3K1N A;  1MBF A;  5F08 A;  1E0E A;  1LFP A;  5CQG A;  1SAN A;  2KJC A;  2R3S A;  3CME I;  2A05 A;  4HF1 A;  4MLO A;  2H8R A;  2X51 A;  3BTI A;  2GXA A;  1XDU A;  2Y9Z A;  2EFN A;  1LPQ A;  3CP8 A;  2Z2S B;  2MC3 A;  4LIU A;  4LLL A;  3RSN A;  5FKM A;  3VWB A;  1ZAR A;  2MG4 A;  4ENM A;  4PGG A;  2DTZ A;  1RC9 A;  4D7N A;  3NEU A;  2QQ9 A;  4CCL A;  1BC8 C;  1TL8 A;  3KCC A;  2GXG A;  4GGG A;  3O2P E;  1AKH A;  2E36 A;  5J4V A;  3EUH A;  2BBY A;  2E1O A;  2X4H A;  3GTQ J;  1I6X A;  1VFC A;  4F7Z A;  2Z5U A;  3VYT B;  1U3E M;  1W5S A;  2LBF B;  1HW5 A;  1I50 J;  1WJ5 A;  2Q8K A;  1Q1H A;  4XOT A;  2IPQ X;  3U2R A;  2LDU A;  1AWC A;  1TT0 A;  4MEY F;  1YJN I;  2O61 A;  2OV7 A;  5AIQ A;  4M9S A;  1LE8 B;  1L0O C;  3IHU A;  3DWL E;  2P7C B;  3PQJ A;  1ETW A;  3BPX A;  1IN8 A;  3V8L A;  1U5T B;  3C2H A;  3CJN A;  4DYQ A;  3GBG A;  3ZQG A;  2L9S A;  2YSR A;  2DA7 A;  3I55 I;  3K2A A;  3C1D A;  3FXQ A;  3H1C A;  3ABL H;  4RGS A;  5D6E A;  4FX4 A;  1VTN C;  2HVS A;  5KNL A;  2HOS A;  3OOU A;  1TNS A;  5LBQ A;  2PJP A;  5HVQ C;  2W48 A;  4HLX A;  2VBY A;  3MEX A;  2HPM A;  2STT A;  3AFH A;  4XKB A;  2K85 A;  1NTC A;  3GVA A;  4GYG A;  1R58 A;  4HNU A;  3ZCO A;  2XRL A;  2L7M P;  2FXA A;  3E6D A;  2QQ8 A;  3CCM I;  1FMW A;  2EV5 A;  4CZZ A;  5D4S A;  4YFX F;  5BNG A;  1K79 A;  1MD0 A;  3HEF A;  3A02 A;  3DXJ F;  1T0F A;  3BJO A;  3CD6 I;  1X3Z B;  2YR2 A;  3BR1 A;  3JRG A;  1TWA J;  2CQX A;  4FT8 A;  3CC7 I;  3HBL A;  1FTT A;  1S29 A;  5LFA A;  1VZ0 A;  4E70 A;  2JN6 A;  3NRV A;  2DT7 B;  2PMU A;  2J5O A;  4PSX A;  4XLA A;  3WU2 C;  2P0W A;  1IXR C;  1Y8R B;  4X6A J;  2MH9 A;  5FO5 A;  1FOY A;  1OMI A;  1A35 A;  2W1O A;  3M07 A;  1TP4 A;  2A5W A;  2ID6 A;  2LH9 A;  1S8N A;  1SMY F;  1MMN A;  4IO9 F;  3LFK A;  3VYU B;  4LG0 A;  3CCQ I;  3MVP A;  3IKT A;  3OYB A;  3E6M A;  4Q5S F;  1BW6 A;  4EAT A;  1KGS A;  4HOB A;  2ELH A;  1RUO A;  2MBF A;  1WCM J;  3H9J A;  3WGG A;  4AUX A;  4GCV A;  5CJ9 A;  2PJR A;  2M34 A;  4CYC B;  3HTU A;  4ZZD A;  1D8K A;  1UFM A;  5CQE A;  2OCC H;  2WWY A;  1LDD A;  4IQ4 A;  4Q47 A;  2HGC A;  4ZJZ A;  3KIO A;  1IZ1 A;  4CZC A;  3O3K A;  1ZRE A;  5DUK A;  1KQ0 A;  2CUF A;  3KFW X;  3ZMU A;  4M9Z A;  4ENK A;  4ZYD A;  4E7H A;  1IO2 A;  3K4L A;  2AQE A;  1QPI A;  5DD4 A;  3CLQ A;  1T98 A;  1TNT A;  3HHG A;  4QIW N;  1PUF A;  1ZRD A;  4XLH A;  2BGC A;  2DAO A;  5EG0 B;  1V4R A;  1XDS A;  4IEJ A;  3PNT A;  1HBX G;  3RCO A;  4A12 A;  1VQK I;  1FBU A;  1S3J A;  3HG9 A;  5D4R A;  5E1Z B;  3GZ6 A;  5FLV A;  2K3F A;  1R36 A;  5DYM A;  3OSF A;  1A31 A;  4WK8 F;  2KZG A;  1YIJ I;  2BHZ A;  3V7C A;  3NAR A;  2XKP A;  3HC7 A;  3ZQL A;  3CCV I;  2OQR A;  3PNY A;  1AKH B;  2V1X A;  5LRS A;  1WWX A;  1ETO A;  4WXC A;  5FRO A;  1FBS A;  3BP8 A;  2QEX I;  2R92 J;  4HDV A;  1XB4 A;  1X2M A;  2X6O A;  1ZHF A;  1IRF A;  2JA2 A;  5TJJ A;  2DOE A;  2R7V A;  4LG3 A;  2F4O B;  4RMN A;  4C30 A;  4CCJ A;  3OYK A;  2E71 A;  1U8R A;  5M3F J;  2XF7 A;  2MD5 A;  2F5C A;  2LTP A;  2OZ6 A;  3HRU A;  5J4Y A;  3J81 Z;  1CF7 A;  3I4M J;  1Y39 A;  1TW3 A;  1MIJ A;  1Q1V A;  4Y3O A;  3VYR B;  5C4J J;  1Z05 A;  1H8A C;  2HWV A;  1ZG5 A;  2JMW A;  1I3Q J;  1O57 A;  3MN2 A;  3ZQC A;  3WG7 H;  4G7H F;  1U8B A;  5FLX Z;  2HOT A;  2FD5 A;  3NWT A;  2NVY J;  4D9J A;  2HQR A;  4YEL A;  4A3K J;  4A3I J;  5EDN A;  1ZG3 A;  5BMZ A;  1K4S A;  5M3M J;  2EBI A;  2X1C A;  3IH4 A;  5F0C A;  2GBY A;  1XCB A;  5B3S H;  4DGW B;  3M9A A;  1R5G A;  2VPR A;  3P9K A;  2W57 A;  4M3E A;  1JUP A;  3IWZ A;  2HKX A;  2X6Y A;  2NVX J;  3I59 A;  3QP6 A;  2IGK A;  4HF0 A;  5KCM A;  1JTX A;  4LOC A;  5FD5 A;  2VOO A;  1D3Y A;  1H89 C;  2E7W A;  4JX6 A;  2O6G E;  4ZDP A;  2G0E A;  1MMD A;  2OPT A;  3BQY A;  2IS6 A;  4ANJ A;  2VOD A;  3RJP A;  2ZXH A;  2K9N A;  4ZTJ A;  2CO5 A;  1T33 A;  3VSL A;  1LDK B;  5LEJ A;  4IQJ A;  1XC5 A;  2JT1 A;  2IS4 A;  2LR8 A;  2PX9 A;  4WWC A;  3HSR A;  1OKR A;  1USS A;  3F8F A;  5JI6 A;  1FIP A;  4Z2Y A;  2VON A;  3HOZ J;  2ZCW A;  3SXY A;  3JRB A;  3W2V A;  2JJ7 A;  1GXP A;  4L9J A;  2CV1 A;  4W97 A;  5FB2 A;  4HQE A;  4MTE A;  2R5Y A;  1B4A A;  3K7A J;  2DA5 A;  1OLT A;  5D5V B;  1CQT A;  2KFD A;  2DMP A;  5J3L A;  4F91 B;  1LEB A;  1R1U A;  2HS5 A;  4BJT A;  4D7M A;  1GV5 A;  2LRE A;  5KK1 A;  1YJW I;  3QRF F;  1JKQ C;  3K6G A;  2K5C A;  3M4O J;  2KIF A;  1JE8 A;  4NB5 A;  2O03 A;  2W25 A;  1U6G A;  2M5W A;  3H9G A;  4PFP A;  1G4D A;  4DBR A;  2BXY A;  4BBR J;  2LF7 A;  4ON0 A;  3SHF A;  5GAG J;  1VQ9 I;  4F55 A;  5J1U A;  1D1C A;  3S32 A;  2F5F A;  2GAU A;  2H1K A;  2HOE A;  3A2K A;  5BS6 A;  2BW3 A;  3M8J A;  3OV8 A;  3OWT A;  4DJA A;  1P2F A;  1DGR M;  1KU9 A;  1R1V A;  3OYG A;  3ZP5 A;  5DM6 F;  3RI4 A;  1VQ8 I;  3H5A A;  3WTY C;  3KYC B;  1UHW A;  1TT5 B;  2CUE A;  3DTI A;  2XAJ A;  1I1S A;  1OCO H;  1IAW A;  2FNA A;  4AVP A;  3GTG J;  1JJ8 C;  3PSF A;  1D8J A;  4QLC U;  2FBK A;  4P5O A;  2JVG A;  2M9H A;  4B09 A;  5L3G A;  4G12 A;  1Y0N A;  1FLI A;  1ETX A;  2EZL A;  3DLL F;  3GEZ A;  2K9Q A;  3AG1 H;  3BJ6 A;  1ZG1 A;  2M45 A;  4G94 A;  3HOU J;  4N4N B;  2J5P A;  2PMZ N;  2FF4 A;  2IVM A;  2QQA A;  4C2T A;  2E1M C;  5AON A;  4JX5 A;  1Z91 A;  3BWG A;  1PDN C;  3QPT A;  2LVS A;  5D5W B;  2UV1 A;  2K3P A;  3FWE A;  1ON2 A;  1BBY A;  1V3F A;  3FF5 A;  2BHY A;  3K4M A;  4NDL A;  2EFP A;  4A69 C;  2NS0 A;  2KMU A;  2OD5 A;  1BR1 A;  5DTD A;  2L2O A;  3HZJ A;  1VQL I;  1XMK A;  2XKO A;  3A03 A;  1ZRF A;  3MKL A;  3B6C A;  3GFJ A;  4H4K C;  2E1N A;  4BHP A;  5LGU A;  2E19 A;  4RLQ A;  3KZI C;  1S5L C;  4AIH A;  2DA1 A;  3ZN0 A;  3OMY A;  3QAH A;  2RV8 A;  1I5Z A;  5ICE A;  1E2X A;  2QM3 A;  1LE8 A;  3AG4 H;  2E5N A;  1VQN I;  2OC6 A;  4ZC3 A;  2BV6 A;  2O9L A;  2OZU A;  4UVC A;  2Y0S N;  4RB1 A;  3AG3 H;  3R61 A;  1SD7 A;  3H0D A;  3C2B A;  2IW5 A;  3ZGK A;  2ELK A;  4PJ0 C;  1NG6 A;  4EQQ A;  2DI3 A;  1S7A A;  1FYM A;  2DJI A;  5B1A H;  5EGO A;  5DUI A;  3RDI A;  5JFR A;  3HIF A;  5J1R A;  1S7E A;  3M3Y J;  3OY9 A;  5DD8 A;  3PIP F;  3P9C A;  4LLN A;  5E8G A;  3GZN B;  4CA0 A;  1DP7 P;  1ZRC A;  5FKL A;  2RDP A;  3T8T A;  3QOD A;  4P1W A;  1QBJ A;  5EZH A;  1F4K A;  1I3A A;  3ONQ A;  2FEZ A;  1E3H A;  3CC2 I;  2JA5 J;  1UB9 A;  4G6T B;  1HW1 A;  4R79 A;  2BYV E;  2O7O A;  2W84 A;  3JAM K;  2HOA A;  3ROU A;  3HGY A;  3GTJ J;  2FUG 2;  2VXZ A;  4DIQ A;  5E3M A;  3J7A O;  3HYI A;  4BXX J;  2JVH A;  3FMS A;  3T5X A;  2OTJ I;  5CVU A;  3LSH A;  5JR3 A;  5LHI A;  1R5H A;  3FM5 A;  3R0A A;  2K86 A;  3WHB A;  3H5R A;  1U2W A;  4HBL A;  2PLY A;  5DCM A;  1J9I A;  1DDN A;  4ITV A;  1CGP A;  1JT0 A;  5FJ8 J;  3JSO A;  3SZP A;  4PUS A;  4EJU A;  1MDM B;  4BEH B;  5IT9 K;  1J2X A;  3O8H A;  1RKW A;  3I71 A;  1X2N A;  1UHS A;  5IYB J;  3I56 I;  1B72 A;  5E18 F;  3GFM A;  1YHQ I;  4M72 A;  4NQW A;  2VQG A;  1ETQ A;  3OYN A;  3WHC A;  4FE7 A;  3OIP A;  4E7S A;  3L2W A;  2CGP A;  4KN7 X;  5F04 A;  1JGS A;  3DBL B;  4KMF A;  3SEZ A;  3K69 A;  4FTH A;  3PFI A;  2H1L A;  1OYW A;  3ISP A;  1P7J A;  4AYB N;  1BL0 A;  3H35 A;  2ESH A;  4RM2 A;  2F5V A;  2JK3 A;  4BQN A;  3FK7 A;  4KA4 A;  2XPW A;  1ZR4 A;  1T8I A;  2D5V A;  3ERE D;  3MD2 A;  2A6T A;  4HYE A;  1K78 A;  1BR4 A;  3I64 A;  4JBA A;  4D0P A;  5D5X B;  1X3W B;  5IT9 Z;  2QA4 I;  3L9F A;  3OL4 A;  1J0R A;  3R60 A;  1XCV A;  1JHF A;  2VPL A;  1KYW A;  3ZOB A;  5DCF A;  2XGX A;  2STW A;  2CUZ A;  4UUS A;  1XTA A;  2TRT A;  2UZK A;  4A3J J;  2EZK A;  4HX8 A;  1Z6R A;  2F5D A;  3D5S C;  3E7L A;  1GDT A;  1IN7 A;  5GTH C;  1F43 A;  2VT3 A;  1Z21 A;  1S7O A;  2BZT A;  4HSR A;  4QPQ A;  1IXS B;  1FT9 A;  2QBY B;  4XLE A;  1TBX A;  2FA5 A;  3TKY A;  2ZNY A;  4OIR F;  1MJB A;  2KRH A;  3MWM A;  4LK0 F;  3SQN A;  5EYR A;  2IA1 A;  3V8K A;  1EH6 A;  3DPT A;  3WE3 A;  3OYI A;  4BQA A;  3C2G A;  1XX5 A;  1IRG A;  4L0Z B;  2AHQ A;  1OR7 C;  3K0L A;  2K02 A;  3N4M A;  1Z6T A;  3I58 A;  4YFK F;  5LLQ A;  2R7X A;  2V1D A;  3DEE A;  2YX7 A;  3L2C A;  2QZ8 A;  3DP7 A;  2ZNZ A;  1SC7 A;  3HHH A;  3DTE A;  2DFH A;  3HGG A;  2PMH A;  2HPI A;  2CW7 A;  2GZW A;  4D5C A;  3HOX J;  4ABZ A;  3HOW J;  3J7Y J;  3Q3S A;  5F64 A;  3EET A;  1W7P D;  2DW4 A;  2FX0 A;  5LRR A;  2R7Q A;  3VB2 A;  3S2W A;  3CP2 A;  4ZZL A;  1G3Y A;  5FRN A;  3BCA A;  4L9V A;  4HST A;  1FX7 A;  2X0L A;  4MIM A;  3MMY B;  3OYA A;  2KT0 A;  2ESN A;  5KAF C;  2VJ5 A;  3KX2 A;  3CUQ C;  4C3H J;  1WPK A;  1MBH A;  3GXO A;  4E7J A;  4FIS A;  5B66 C;  2A6H F;  1QHH D;  3I4P A;  4NHJ A;  3HSE A;  3K70 D;  4A3C J;  2G7H A;  4IHY A;  4OMY A;  1WJE A;  1X1A A;  2L3D A;  1MND A;  1ZGJ A;  2IS1 A;  2CFO A;  2OA4 A;  3DU6 A;  1HA8 A;  2EK5 A;  4AWX B;  2K9M A;  3S8P A;  2VXD A;  1LEA A;  1QQI A;  2D2W A;  2B9S A;  1HCR A;  2CV2 A;  2FSW A;  1KU2 A;  3BZC A;  1E3P A;  2VJI A;  4E7L A;  2E2J J;  2XSJ C;  2PFB A;  4A3B J;  1SMT A;  4ENJ A;  2LBF A;  3F23 A;  4NQW B;  3QU3 A;  2L7K A;  3BRO A;  1JUM A;  4HQM A;  3FMR A;  4K2E A;  2RNJ A;  4PJM A;  2CQ7 A;  3HOY J;  4EV0 A;  4UVA A;  2VN2 A;  3TOB A;  1XMX A;  5FFX A;  3KEO A;  5F0H A;  4QSH A;  1FYL A;  3DQV C;  5ICC A;  2V6E A;  3R6S A;  4LMY A;  4ENN A;  2PG4 A;  3BJA A;  4BBS J;  4IJA A;  3PUF A;  4EGY A;  3I59 B;  3KYL A;  1O7F A;  2VQL A;  3DBH B;  3KP3 A;  3TDZ C;  4UUV A;  3LL7 A;  4HZF A;  3JW4 A;  5GAH J;  2XAQ A;  3F22 A;  2Y9Y A;  3WGI A;  5GP9 A;  4C2M J;  3JRC A;  1G3S A;  1CF7 B;  3KPH A;  2COB A;  2Q0O A;  4HV5 A;  3WTS C;  5BQT A;  4KDP A;  5DV5 A;  1G59 A;  1YE9 A;  3WTX C;  3DKY A;  3V8J A;  2WAQ N;  2CFX A;  3B73 A;  2XB0 X;  3FZV A;  3M8E A;  4B4C A;  4A3D J;  2M7B A;  1C0W A;  4RGU A;  3K2Z A;  2KDO A;  4Y33 A;  4OMZ A;  2V7F A;  4RBO A;  3RZO J;  4M3F A;  3IH2 A;  4ZYG A;  1U5T A;  3BG3 A;  4CIC A;  2N8G A;  2RN7 A;  4HA8 A;  3E1S A;  2ZB9 A;  1HSJ A;  4RB3 C;  1NH3 A;  4CCK A;  3R0J A;  2FML A;  4S04 A;  1HF0 A;  3BR6 A;  1Z7L A;  3FX3 A;  1IXC A;  2LKX A;  5GPC A;  2LY2 A;  2QCO A;  4BQQ A;  2HFH A;  2UXX A;  4U87 A;  2Z33 A;  3G6E I;  4XOP A;  2O3F A;  1BN5 A;  3JRF A;  2Z99 A;  1EH8 A;  4U88 A;  4BJ5 C;  2RVC A;  4PFO A;  1QZE A;  3SZT A;  3I53 A;  3QP5 A;  1ZGA A;  2HU9 A;  3O6B B;  1E17 A;  3G1L A;  4PJN A;  3BLY A;  2DK5 A;  3TO9 A;  2OQG A;  3HOS A;  2E5Z A;  4HX4 A;  3CF5 F;  2I5U A;  1SFU A;  1O4X A;  2DOD A;  1LJ9 A;  2AXL A;  4DYC A;  1Z77 A;  2VKH A;  4CHU A;  3LSM A;  3ZQI A;  3OR1 C;  2Y0M A;  4PZJ A;  2QSG X;  4BE1 A;  2JSP A;  2L01 A;  4JK1 X;  4N9I A;  1G3T A;  2L9R A;  3CJT B;  4NC6 A;  4XON A;  5EEA A;  2H8W A;  2OTL I;  5LHG A;  1QRY A;  2R7Z J;  2RKH A;  3UKG A;  1T95 A;  3BOQ A;  1AHD P;  5IP7 J;  2EFW A;  2VC1 A;  2ZXJ A;  1XGM A;  2Y2Z A;  4IZZ A;  2MLK A;  3JR9 A;  3M1C A;  4BL0 B;  2VE9 A;  1Y6I A;  3PUB A;  4MO7 A;  1ERD A;  4IOA F;  1DP3 A;  2VKE A;  4DNC A;  3RYR A;  1U78 A;  4XR6 A;  4M74 A;  3RQI A;  4YRV A;  2Y48 A;  2V26 A;  4P96 A;  1MW7 A;  3Q0W A;  1P6R A;  2JUG A;  3ABU A;  2DYR H;  3I0T A;  1LNW A;  2MYS A;  2E1M B;  2K27 A;  3LA3 A;  4XN0 A;  4Y4R A;  2XAS A;  2Y0S A;  3E5X A;  2GIZ A;  2M7A A;  2O8K A;  2JRT A;  5FRM A;  4FCY A;  4DZP A;  2XGD A;  3LSP A;  5IPA A;  2VBW A;  2HVQ A;  4XKC A;  2F5E A;  2FOK A;  2W85 A;  2XPV A;  4PDK A;  1K6O A;  2KIS A;  1JHH A;  5CPR B;  4L9T A;  3HTS B;  3HRT A;  2BEO A;  3TW7 A;  2WY8 Q;  4KJZ A;  2HYG D;  4BEH A;  1GT0 C;  5EG0 A;  4OAZ A;  3S3M A;  1R71 A;  2WA0 A;  3VYS B;  3DTK A;  1ULY A;  1SVO A;  2CU7 A;  2VC0 A;  1N75 A;  5TIS C;  2BVM A;  4RDU A;  5F27 A;  4ZDL A;  4BH9 A;  3TMO A;  1WJC A;  1V54 H;  5DDG A;  2JQ7 A;  1FYK A;  2M4K A;  3LA2 A;  5H6Q A;  1YS7 A;  3PL8 A;  3CQZ J;  3OYM A;  5J8C A;  1MBK A;  3F6O A;  4L5J A;  4KIC A;  3I4N J;  2V9V A;  3D5R C;  5GAE J;  1BC7 C;  4NBQ A;  3S2D J;  5JLW A;  1O3T A;  2FRH A;  1SFX A;  1OQY A;  1MSF C;  2RNG A;  1FSE A;  1YG2 A;  3HRS A;  3HB9 A;  2EIK H;  3G4S I;  1FBQ A;  4ETS A;  3IUO A;  1EV7 A;  1IDZ A;  4XKW A;  1A04 A;  3G2B A;  4NC8 A;  1REP C;  2HQN A;  2TCT A;  2M1B A;  1V5F A;  2X6W A;  3I3L A;  4WXH A;  4HG2 A;  4HLY A;  2KHM A;  3IKV A;  3LAP A;  3S1M J;  3D5L A;  4UB6 C;  1I1G A;  3DPU A;  2A5Y B;  1KYZ A;  2WV1 A;  2MC4 A;  2IJL A;  3QU6 A;  2MGQ A;  2EFQ A;  5JLX A;  2LSO A;  4OAY A;  3W6J B;  4V2F A;  3ZMT A;  4CCO A;  1DUX C;  3KP5 A;  1MJ9 A;  2XB5 A;  4BNC A;  2BXZ A;  1ONV A;  3CMY A;  1FOX A;  1YQA A;  1LB2 A;  1GVD A;  3C3W A;  1YS6 A;  2HXO A;  3FIW A;  3ZPL A;  3M7G A;  2FBH A;  4FAS D;  4PJL A;  1OFC X;  4OWR B;  4BXF A;  2Y69 H;  4KT5 C;  5FFZ A;  3SJM A;  2WAQ A;  4Y15 A;  3S15 J;  1D1A A;  3F8M A;  2V79 A;  2MFZ A;  3BR2 A;  4IXA A;  3J7Z I;  5J40 A;  2XC7 A;  2FU4 A;  1BJZ A;  1VQ4 I;  3SFI A;  1X4P A;  3H3U A;  1ON1 A;  3H0G J;  3L2R A;  5FKO A;  2ZSI B;  4C2U A;  1UHM A;  4N9H A;  2E1C A;  5E20 A;  3CZ6 A;  2CW8 A;  5FGM A;  2KRC A;  3MQ0 A;  1VF9 A;  5HNF A;  2O8X A;  2X6X A;  4EGZ A;  3D0S A;  2GLO A;  1JTY A;  4UV9 A;  5ED4 A;  2MW8 A;  5M5Y J;  4WX9 A;  2VOP A;  3WGH A;  1QZY A;  1YW7 A;  2WAF A;  1D5Y A;  3LSJ A;  4UXN A;  5F0F A;  4DYR A;  5EF6 A;  3CTA A;  1UCR A;  1G3W A;  1I27 A;  1R22 A;  4G9Y A;  4S05 A;  3U9G A;  2CV0 A;  2UXN A;  4M73 A;  5J6X A;  4DBQ A;  1UEL B;  2LNB A;  4CCN A;  2ID3 A;  4CUG A;  5ILV A;  1IC8 A;  5GAD J;  1YW8 A;  2XHK A;  2GM4 A;  1O3S A;  4MQ9 F;  2OCE A;  2H6C A;  5LD2 C;  2GOM A;  1B8I B;  3ERM A;  3RKX A;  1TTY A;  5E8I A;  3IL2 A;  4IHV A;  3ZMD A;  1WKM A;  2DCE A;  1P92 A;  4RGX A;  4C3I J;  4XBF A;  5CLS A;  4LLG F;  4LJZ F;  3GYH X;  1R00 A;  1PJR A;  2LYC A;  4C9Y A;  1F9N A;  3TL4 X;  4OIP F;  2QF7 A;  2HTJ A;  3GTM J;  2DA4 A;  4RGR A;  3FKI J;  1GHC A;  1FWZ A;  2DPU A;  1WJD A;  4E7K A;  1K7A A;  1FMV A;  1UMQ A;  1K83 J;  1PUF B;  2PJR B;  5TRD A;  1IN4 A;  3HXL A;  4A3F J;  1OYY A;  3REO A;  2IS2 A;  4U7D A;  2NNN A;  3K1P A;  1T6S A;  5D5U B;  1ZK8 A;  2BE5 F;  1LVA A;  4NNJ A;  2P5L C;  3ZQH A;  4XLP F;  3H3V K;  3FBI B;  1FP1 D;  2R7F A;  3TO6 A;  3KEY A;  2EIJ H;  3C7J A;  2QUF A;  3VPR A;  4CH7 A;  4AC0 A;  3KP2 A;  1QPM A;  4AVZ A;  2HYF A;  4Y17 A;  2PI0 A;  3A01 B;  5C4X J;  2IEK A;  3BTC A;  2FBI A;  3ABM H;  1PP8 F;  1PP7 U;  2Z3Y A;  4ZTF A;  2EIM H;  1OCZ H;  1XMA A;  3GX4 X;  3KZY A;  2HQA A;  3W2W A;  5ERI A;  3KLN A;  1BOA A;  1TW2 A;  2CS3 A;  3ZMS A;  3RPQ A;  4AU7 A;  1W36 C;  2WV0 A;  2EZI A;  4ZYE A;  3QOE A;  2PQ8 A;  3LSK A;  4GYI A;  1H0M A;  4DW6 A;  1QZZ A;  2XUB A;  4W1U A;  1B9N A;  1DGW Y;  3A01 A;  1ZR2 A;  1HW2 A;  4C3J J;  2D1H A;  2DA2 A;  3EUH C;  5IOZ A;  4HPQ A;  4CDG A;  1LQ1 A;  2JZY A;  4IRG A;  3TP3 A;  2WAE A;  4RAG A;  2XPU A;  3KLO A;  5J47 A;  2AXT C;  2B7E A;  4M3G A;  4MHG A;  3NAU A;  3I54 A;  3LQR A;  4L9N A;  3Q0U A;  2DJN A;  2MD0 A;  1TZL A;  5E1X A;  4A93 J;  3BC8 A;  2EB7 A;  2NOG A;  2NS7 A;  2DMU A;  1SAU A;  1IUF A;  1MKM A;  1RKT A;  1ENH A;  1R4N B;  2QKL B;  2VQC A;  3ELK A;  4ESF A;  3F6V A;  3E6C C;  4J00 A;  1B59 A;  1KU7 A;  1BM9 A;  4NUB A;  1YI2 I;  3S2H J;  3LSG A;  4FE4 A;  4ZH4 F;  1IN6 A;  1WJF A;  2LP0 A;  1EA3 A;  2NVQ J;  5FLM J;  2E34 A;  3BZK A;  4LIT A;  1POG A;  1X19 A;  5HDN A;  1SD5 A;  1H9G A;  5HLG A;  2OF7 A;  5FKN A;  3JRI A;  1U9N A;  3HJE A;  2DPD A;  3G1M A;  1BI2 A;  2VKV A;  4XRS G;  2Z9O A;  3U1K A;  1UG2 A;  1D5V A;  2JA7 J;  4XOR A;  1W0T A;  3ZN1 A;  1J5Y A;  1TLH B;  5A2Q Z;  3I9V 2;  5LGN A;  1Z7U A;  2MH2 A;  3A0H C;  1FC3 A;  4XQF A;  3QOP A;  5E1W A;  4KT6 A;  1R9T J;  1FIA A;  4EEF G;  4PSW A;  5BOX A;  3LAJ A;  4J01 A;  3IRR A;  2M87 A;  5F1J A;  5F6F A;  4XRM A;  5ICG A;  4KNY A;  1OJL A;  2DFF A;  1VQP I;  3HM5 A;  4IHS A;  2ZFU A;  1P4X A;  1WHU A;  3CO6 C;  1W5T A;  2PMZ A;  1RRJ A;  1KQ8 A;  1W1W E;  4BE2 A;  3K9T A;  2YU9 J;  1ZQ3 P;  4XK4 A;  4GDF A;  1XSV A;  3PO2 J;  3DLA A;  5E3L A;  2A3S A;  3PO3 J;  2VJJ A;  2RAE A;  1IDY A;  4EM1 A;  1WSU A;  2M4G A;  2PN6 A;  3HPG A;  1JI8 A;  1MSE C;  2V1N A;  3FK6 A;  3GF2 A;  5C44 J;  2RGV A;  3CLO A;  2X9D A;  3BT9 A;  3IH3 A;  3H3Z A;  3FKJ A;  3FXO A;  1QGP A;  2X85 A;  3QPH A;  1D1B A;  3RIR A;  2YUS A;  2L7F P;  3BG5 A;  3JRE A;  3ZMZ A;  1ZLJ A;  3Q9S A;  2R7T A;  1QVU A;  3IC7 A;  1HKQ A;  3M8F A;  3MZY A;  5HLT A;  1WZ2 A;  3KE2 A;  3OYH A;  4OIO F;  1R4M B;  1QVT A;  2KRF A;  3LA7 A;  2JTV A;  1P7I A;  4G6D A;  3GLX A;  3F72 A;  4LFU A;  1UZC A;  1N25 A;  4XLC A;  5KHD A;  1BIB A;  3DEU A;  2VKD A;  3AL0 C;  5HOD A;  2KIU A;  3ULQ B;  2HR3 A;  3COA C;  4R8H A;  2CG4 A;  4U0Y A;  2EFO A;  3IV5 A;  1WI3 A;  4YEJ A;  2BY3 A;  3GTK J;  3ZRG A;  5IT3 A;  5L3C A;  4I7H A;  2P81 A;  2ECB A;  3K4N A;  2L7Z A;  2WBM A;  5D6F A;  5HNH A;  2GA2 A;  1ZN2 A;  3E5U A;  3S1Q J;  1A6I A;  4QTR A;  3V7S A;  4L0Y B;  1ACI A;  3RPU D;  4XSX F;  1DPU A;  3L1P A;  1TWH J;  4KMU X;  4EVI A;  5L3B A;  1LKX A;  3UNG C;  2KL4 A;  2W4S A;  2WB1 N;  3P7N A;  4HAM A;  1TWF J;  3CJR B;  5F1R A;  2LOO A;  4B44 A;  2UUZ A;  1P4A A;  3CCL I;  2X1E A;  2KP6 A;  5KAI C;  1RUN A;  3RKY A;  1HDP A;  2VE8 A;  3PJR A;  2E2I J;  2L9V A;  3GTO J;  3J80 Z;  5TGT A;  2ZME C;  1D0Y A;  1MNM C;  1Z1D A;  2HXI A;  3DFG A;  3ZMV A;  3E3V A;  3PIO F;  2W00 A;  4M6X A;  2F4I A;  2HDW A;  4HNT A;  1HKT A;  2W82 A;  2IA2 A;  2EV0 A;  3VOD A;  2HTS A;  3Q5F A;  4MNU A;  1R23 A;  2JA6 J;  1Z3X A;  3S14 J;  2H94 A;  3FHN A;  4I01 A;  4NC7 A;  5HS8 A;  2EA2 A;  2L4M A;  4KIB A;  1HC8 A;  2O0Y A;  1HOM A;  3HUG A;  3BQZ A;  3LNQ A;  2DOA A;  1UST A;  2FQ3 A;  2IGO A;  5C3E J;  1KON A;  2M3A A;  4RA2 A;  1JT6 A;  1XPX A;  3D1N I;  1YRN B;  3EDP A;  3KET A;  4AID A;  4YII A;  1YW9 A;  4QWQ A;  5IY5 H;  2ZJR F;  2LD5 A;  4PCQ A;  1W0U A;  2OJE D;  3V7R A;  4D1Q A;  3FDY A;  3OYD A;  1F5T A;  2P4W A;  3RQ4 A;  2VLA A; 
#chains in the Genus database with same CATH homology
 1R7J A;  2V1U A;  3WTW C;  2QVO A;  5L3E A;  2XRN A;  1SD6 A;  2EA4 A;  1SD4 A;  6PAX A;  4RB2 C;  5K5Q A;  1W7P A;  4G7O F;  4Q48 A;  1FP2 A;  2DO7 A;  5CVR A;  3SFZ A;  2JPB A;  4U7B A;  3RPU A;  5K5R A;  3L7W A;  3C18 A;  3E97 A;  2A68 F;  5J8F A;  2XIG A;  4P55 A;  2EV6 A;  1IW7 F;  5K5O A;  1KU3 A;  3JTH A;  4FX0 A;  4I0B A;  3ECH A;  3HOT A;  3GUD A;  4DQ2 A;  4WF2 A;  2L02 A;  1Y0U A;  1GXQ A;  5H6R A;  4A5M A;  3JAM Z;  2DQL A;  5K1Y A;  3AAF A;  1L3L A;  2P6T A;  2EJR A;  3F21 A;  3U1D A;  1IUY A;  2ISZ A;  3KZZ A;  1B9M A;  1KQ9 A;  5DCM B;  3GZ5 A;  1ODD A;  4G6Q A;  4ASN A;  1T39 A;  1RZ4 A;  1RI7 A;  4I98 B;  4YG2 F;  1X3U A;  4IHT A;  4MTD A;  3BY6 A;  1ZH5 A;  4UNO A;  4LGW A;  2QQB A;  5HLH A;  2JPC A;  3CDH A;  1NHA A;  3WTV C;  2NYX A;  4A6E A;  5LEK A;  4I0A A;  4WCG A;  2CWE A;  5BPI A;  4OIN F;  3MCZ A;  3LWF A;  2GIV A;  4HF2 A;  2M8E A;  2QEN A;  3P9I A;  3MFK A;  5ICF A;  4BYY A;  5CYV A;  1YIO A;  4O6J A;  2ISY A;  2LF8 A;  1XGN A;  4CGZ A;  3FXR A;  4GO1 A;  1GVJ A;  3VOE A;  2TDX A;  4KFC A;  2PBI A;  4IRI A;  1EH7 A;  3DKW A;  2QLZ A;  1W7P B;  5CVV A;  4XLN F;  5FD6 A;  4AIJ A;  4LG0 B;  2HKO A;  1STZ A;  3CO7 C;  1HXD A;  2EWN A;  3J80 K;  3L00 A;  2ACJ A;  4YFN F;  1BJA A;  1FSH A;  4PGH A;  2IT0 A;  5HDK A;  2ZBK A;  3B02 A;  4CYD A;  1BI0 A;  1MZB A;  3MZH A;  4XRF A;  4IVN A;  1O7L A;  4UV8 A;  2E7X A;  5ILU A;  4M6Y A;  3F8B A;  2MA3 A;  2DQR A;  2A6E F;  1RIO H;  5LGT A;  1FZP B;  3FM3 A;  4GXO A;  4LB6 B;  4I2O A;  2XAH A;  3W6K B;  4AD9 A;  5HDG A;  2ZKZ A;  4IF4 A;  3F8C A;  2FNP A;  2YX4 A;  2COM A;  3G73 A;  1K78 B;  2ZME B;  1P4W A;  3LQQ A;  2P6S A;  3WE2 A;  4U0V A;  4R1H A;  4A0Y A;  1YLF A;  2P5K A;  2CW0 F;  3WU0 A;  3R4K A;  1S6L A;  4YIF A;  2FMY A;  5CVI A;  3F8N A;  1YTY A;  1O3R A;  3TOA A;  4H0E A;  3CUQ B;  1H9T A;  2H6B A;  4KYW A;  4HDU A;  3GFI A;  5JHU A;  3G3Z A;  3LST A;  2YPR A;  1MDM A;  3KEQ A;  2B0L A;  3TQN A;  3BZ6 A;  2DK8 A;  3HRM A;  5HS9 A;  4MEX F;  1XD7 A;  4JQF A;  2CQK A;  5ILS A;  2V6C A;  2OU2 A;  2L54 A;  2ETH A;  2W24 A;  3WTT C;  4M9X A;  4FHT A;  4EM2 A;  4ESB A;  4RB0 A;  3EYY A;  2GXB A;  1BI1 A;  4A6D A;  3RYP A;  4Y13 A;  1J75 A;  3VFZ A;  3VEP A;  2ZME A;  2H27 A;  5EEG A;  1DPR A;  1WI9 A;  3T1B A;  2IRF G;  5HLI A;  3TGN A;  4IPA A;  4M71 A;  5D8L B;  2XV4 S;  1TQI A;  2XVC A;  3FHZ A;  2A69 F;  1RNL A;  1BIA A;  3WTZ A;  2XRO A;  4KIF A;  3KP4 A;  4RAZ A;  4HW0 A;  4BAY A;  1U5T C;  2A07 F;  5KVR A;  3I5U A;  2DLL A;  4KIG A;  4A5N A;  4UHT A;  3WTU C;  4A0Z A;  4U0W A;  3DF8 A;  1OR7 A;  5D8K B;  3GWZ A;  3WG9 A;  3IRQ A;  4O3M A;  4MGR A;  4HX7 A;  1FNN A;  1FOK A;  3PQK A;  4OU0 A;  3RTR A;  5CVJ A;  1ZLK A;  4ESJ A;  1W4M A;  2P8T A;  3EQL F;  1MJA A;  4CO8 A;  1QO0 D;  2DT5 A;  1J59 A;  1HKS A;  1JXS A;  5EEH A;  1F1Z A;  4AIK A;  2M30 A;  1XSX A;  3JTG A;  2DU9 A;  4ZYH A;  4L5I A;  4OIQ F;  2RQP A;  4BXU A;  1FY7 A;  1OPC A;  3NQO A;  2XAG A;  1O3Q A;  3E5Q A;  2GA1 A;  4RS8 A;  2ZJ2 A;  2VBX A;  3T0Y A;  3FMQ A;  1XSD A;  2G7U A;  2HDC A;  3TDU C;  5JVT A;  4LB5 A;  1IF1 A;  4B8X A;  3V4G A;  5FLX K;  3L09 A;  2C6Y A;  3EYI A;  2P7V B;  4L18 B;  2OAZ A;  4BHB A;  2MLG A;  1ZAO A;  1T2K A;  2D45 A;  2AS5 F;  2QBY A;  1QNT A;  1WRJ A;  4P9F A;  3J81 K;  3TO7 A;  1B1B A;  1WQ2 A;  2QYO A;  1YFH A;  3DPL C;  5HOO A;  4N0B A;  1XN7 A;  3BPV A;  1XGS A;  1ZYR F;  3OOP A;  4Q4Z F;  4BHC A;  2FE3 A;  3K1M A;  3M1E A;  3GW2 A;  3CUO A;  4EJW A;  3N97 A;  2LKP A;  3FXU A;  4I02 A;  3ECO A;  2HZT A;  4HV6 A;  1J7K A;  2PEX A;  2VBZ A;  3BDD A;  2KIM A;  1FPQ A;  1HST A;  2F2E A;  3KP6 A;  5H20 A;  1YO5 C;  2DTR A;  3GFL A;  4RAY A;  2RC4 A;  2GWR A;  4G7Z F;  2R7D A;  3ML6 A;  2Y75 A;  3IWF A;  3ZQ7 A;  2HEO A;  3GO5 A;  4WXD A;  1TQM A;  2VT2 A;  4IRH A;  1YYV A;  1Z9C A;  4EMS A;  2CYY A;  4LD5 A;  5BPD A;  2G9W A;  1OYI A;  3Q9V A;  2UWM A;  1PUE E;  2YU3 A;  4G8X A;  3E6B A;  2JSC A;  2NNY A;  3KP7 A;  4EJT A;  2IP2 A;  2ZFW A;  2NRA C;  2D1V A;  3T8R A;  5L3D A;  5A2Q K;  2ZO4 A;  3HSF A;  2K4J A;  1KA8 A;  2K7L A;  2OBP A;  1T38 A;  4EJO A;  2WTE A;  2KKO A;  3WU1 B;  1MGT A;  2ADU A;  5LHH A;  2IA0 A;  3F3X A;  3WOD F;  1B6A A;  2H09 A;  1SAX A;  5DEQ A;  2A61 A;  4EJV A;  5E17 F;  3RKW A;  4I09 A;  2DFI A;  2KJB A;  4OOI A;  4TV7 A;  4CXF A;  2NAZ A;  4P9U A;  2K4B A;  4EM0 B;  3DV8 A;  2WC2 A;  1LDJ A;  4KUM A;  4MQV A;  2DBB A;  2Q2E A;  4LK1 F;  2QWW A;  3MAJ A;  5L3F A;  3H92 A;  3ABT A;  2XAF A;  2L4A A;  1TQP A;  4O5V A;  4A0X A;  3CUQ A;  2GQQ A;  2P5V A;  2CSO A;  1BI3 A;  5HS7 A;  1XGO A;  4XSZ F;  1HQC A;  4A2U A;  1SFE A;  4KN4 X;  3JSP A;  5AIP A;  4UVB A;  1R1T A;  1IN5 A;  1AOY A;  1G6N A;  3K1N A;  2KJC A;  2R3S A;  4HF1 A;  1XDU A;  2EFN A;  2MC3 A;  4LLL A;  1ZAR A;  4ENM A;  4PGG A;  3NEU A;  2QQ9 A;  1BC8 C;  3KCC A;  2GXG A;  4GGG A;  3O2P E;  3EUH A;  2BBY A;  2X4H A;  1I6X A;  4F7Z A;  2Z5U A;  1U3E M;  1W5S A;  1HW5 A;  2Q8K A;  1Q1H A;  3U2R A;  2IPQ X;  2LDU A;  1AWC A;  4MEY F;  2O61 A;  5AIQ A;  4M9S A;  1L0O C;  3IHU A;  2P7C B;  3PQJ A;  3BPX A;  1IN8 A;  3V8L A;  1U5T B;  3CJN A;  2YSR A;  3C1D A;  3FXQ A;  4RGS A;  5D6E A;  4FX4 A;  1VTN C;  5LBQ A;  1TNS A;  2PJP A;  5HVQ C;  4HLX A;  2VBY A;  3MEX A;  2STT A;  3GVA A;  4GYG A;  1R58 A;  2FXA A;  3E6D A;  2EV5 A;  4CZZ A;  5D4S A;  4YFX F;  1K79 A;  1MD0 A;  3DXJ F;  1T0F A;  3BJO A;  2YR2 A;  4FT8 A;  1S29 A;  4E70 A;  3NRV A;  2PMU A;  2J5O A;  1IXR C;  2MH9 A;  5FO5 A;  1OMI A;  1S8N A;  1SMY F;  3LFK A;  4LG0 A;  3IKT A;  3E6M A;  4Q5S F;  1KGS A;  4HOB A;  2ELH A;  1RUO A;  2MBF A;  3WGG A;  4GCV A;  5CJ9 A;  3HTU A;  4ZZD A;  1D8K A;  1UFM A;  2WWY A;  1LDD A;  4Q47 A;  2HGC A;  1IZ1 A;  3O3K A;  1ZRE A;  5DUK A;  1KQ0 A;  3KFW X;  3ZMU A;  4M9Z A;  4ENK A;  4ZYD A;  5DD4 A;  1T98 A;  1TNT A;  1ZRD A;  3HHG A;  2BGC A;  2DAO A;  1V4R A;  1XDS A;  1HBX G;  4A12 A;  1FBU A;  1S3J A;  5D4R A;  3GZ6 A;  5E1Z B;  1R36 A;  5DYM A;  4WK8 F;  3V7C A;  2XKP A;  2OQR A;  2V1X A;  5LRS A;  1WWX A;  4WXC A;  1FBS A;  3BP8 A;  4HDV A;  1XB4 A;  1ZHF A;  1IRF A;  5TJJ A;  1U8R A;  1CF7 A;  2MD5 A;  2F5C A;  2OZ6 A;  3HRU A;  3J81 Z;  1TW3 A;  1Z05 A;  2HWV A;  1ZG5 A;  1O57 A;  4G7H F;  5FLX Z;  2HQR A;  1ZG3 A;  5BMZ A;  1XCB A;  3M9A A;  1R5G A;  3P9K A;  2W57 A;  3IWZ A;  2HKX A;  3I59 A;  3QP6 A;  4HF0 A;  5FD5 A;  2VOO A;  1D3Y A;  2E7W A;  2O6G E;  2VOD A;  3RJP A;  2CO5 A;  1LDK B;  5LEJ A;  2JT1 A;  4WWC A;  3HSR A;  1OKR A;  1USS A;  3F8F A;  5JI6 A;  4Z2Y A;  2VON A;  2ZCW A;  3SXY A;  1GXP A;  4L9J A;  5FB2 A;  4HQE A;  4MTE A;  1B4A A;  5D5V B;  1LEB A;  1R1U A;  2HS5 A;  5KK1 A;  3QRF F;  2KIF A;  1JE8 A;  4NB5 A;  2O03 A;  2W25 A;  1U6G A;  2M5W A;  1G4D A;  2LF7 A;  4ON0 A;  3SHF A;  2F5F A;  2GAU A;  2HOE A;  5BS6 A;  3OV8 A;  1P2F A;  1KU9 A;  1R1V A;  3ZP5 A;  3RI4 A;  3WTY C;  1UHW A;  2XAJ A;  1I1S A;  1IAW A;  2FNA A;  4AVP A;  1D8J A;  4QLC U;  2FBK A;  4P5O A;  4B09 A;  5L3G A;  1FLI A;  3GEZ A;  3BJ6 A;  1ZG1 A;  2M45 A;  4G94 A;  2J5P A;  2FF4 A;  2IVM A;  2QQA A;  5AON A;  1Z91 A;  3BWG A;  1PDN C;  3QPT A;  5D5W B;  3FWE A;  1ON2 A;  1BBY A;  1V3F A;  3FF5 A;  2EFP A;  2NS0 A;  2OD5 A;  1XMK A;  2XKO A;  1ZRF A;  3GFJ A;  2E1N A;  4BHP A;  5LGU A;  4AIH A;  3ZN0 A;  3QAH A;  2RV8 A;  1I5Z A;  5ICE A;  1E2X A;  2QM3 A;  2BV6 A;  2OZU A;  4UVC A;  4RB1 A;  3R61 A;  1SD7 A;  2IW5 A;  4EQQ A;  2DI3 A;  1S7A A;  1FYM A;  5DUI A;  3RDI A;  5JFR A;  3HIF A;  5DD8 A;  3P9C A;  4LLN A;  5E8G A;  1DP7 P;  1ZRC A;  2RDP A;  3T8T A;  1QBJ A;  1F4K A;  2FEZ A;  1UB9 A;  3JAM K;  1HW1 A;  4R79 A;  2BYV E;  2W84 A;  3ROU A;  2VXZ A;  3J7A O;  3HYI A;  3FMS A;  3T5X A;  5CVU A;  5JR3 A;  5LHI A;  1R5H A;  3FM5 A;  3R0A A;  2K86 A;  1U2W A;  4HBL A;  2PLY A;  5DCM A;  1J9I A;  1DDN A;  1CGP A;  3JSO A;  1MDM B;  3SZP A;  4EJU A;  5IT9 K;  1J2X A;  3I71 A;  5E18 F;  3GFM A;  4M72 A;  4NQW A;  2CGP A;  4KN7 X;  1JGS A;  4KMF A;  3K69 A;  3PFI A;  1OYW A;  3ISP A;  2ESH A;  4KA4 A;  3ERE D;  1K78 A;  4HYE A;  3I64 A;  4JBA A;  4D0P A;  5D5X B;  5IT9 Z;  3L9F A;  1J0R A;  3R60 A;  1XCV A;  1JHF A;  1KYW A;  5DCF A;  2XGX A;  2STW A;  2UZK A;  4HX8 A;  1Z6R A;  2F5D A;  1IN7 A;  2VT3 A;  1S7O A;  1IXS B;  1FT9 A;  2QBY B;  1TBX A;  2FA5 A;  3TKY A;  2ZNY A;  4OIR F;  1MJB A;  3MWM A;  4LK0 F;  3SQN A;  3V8K A;  2IA1 A;  1EH6 A;  3DPT A;  3WE3 A;  4BQA A;  1IRG A;  4L0Z B;  3K0L A;  2K02 A;  3N4M A;  1Z6T A;  3I58 A;  4YFK F;  5LLQ A;  2V1D A;  2YX7 A;  3L2C A;  2QZ8 A;  3DP7 A;  2ZNZ A;  3HHH A;  2PMH A;  2GZW A;  5F64 A;  3EET A;  1W7P D;  2DW4 A;  5LRR A;  3VB2 A;  3S2W A;  4ZZL A;  1G3Y A;  4L9V A;  1FX7 A;  2X0L A;  2ESN A;  3CUQ C;  3GXO A;  2A6H F;  3I4P A;  4NHJ A;  3HSE A;  2G7H A;  4OMY A;  2L3D A;  1ZGJ A;  2OA4 A;  2EK5 A;  4AWX B;  1LEA A;  1QQI A;  2D2W A;  2FSW A;  1KU2 A;  2PFB A;  1SMT A;  4ENJ A;  3F23 A;  3QU3 A;  3BRO A;  4HQM A;  3FMR A;  4K2E A;  2RNJ A;  4EV0 A;  4UVA A;  2VN2 A;  3TOB A;  5FFX A;  3KEO A;  1FYL A;  3DQV C;  5ICC A;  3R6S A;  4LMY A;  4ENN A;  2PG4 A;  3BJA A;  4IJA A;  4EGY A;  3I59 B;  1O7F A;  4UUV A;  3KP3 A;  3TDZ C;  4HZF A;  3JW4 A;  2XAQ A;  3F22 A;  3WGI A;  1G3S A;  1CF7 B;  2Q0O A;  4HV5 A;  3WTS C;  5BQT A;  4KDP A;  5DV5 A;  3WTX C;  3V8J A;  2CFX A;  3B73 A;  3M8E A;  3FZV A;  1C0W A;  4RGU A;  3K2Z A;  4OMZ A;  4ZYG A;  1U5T A;  4CIC A;  2RN7 A;  4HA8 A;  1HSJ A;  4RB3 C;  3R0J A;  2FML A;  4S04 A;  3FX3 A;  1IXC A;  2Z33 A;  2HFH A;  2UXX A;  2O3F A;  1BN5 A;  2Z99 A;  1EH8 A;  4U88 A;  2RVC A;  3SZT A;  3I53 A;  3QP5 A;  1ZGA A;  3O6B B;  1E17 A;  2DK5 A;  3TO9 A;  2OQG A;  3HOS A;  4HX4 A;  1SFU A;  1LJ9 A;  2AXL A;  4CHU A;  2Y0M A;  4PZJ A;  2L01 A;  4JK1 X;  4N9I A;  1G3T A;  5LHG A;  2RKH A;  3BOQ A;  2EFW A;  2VC1 A;  2ZXJ A;  1XGM A;  2MLK A;  2VE9 A;  1U78 A;  4DNC A;  3RYR A;  4M74 A;  2Y48 A;  4P96 A;  1P6R A;  3ABU A;  3I0T A;  1LNW A;  2K27 A;  3LA3 A;  2XAS A;  3E5X A;  2JRT A;  2VBW A;  2F5E A;  2FOK A;  2W85 A;  4PDK A;  1K6O A;  1JHH A;  4L9T A;  3HTS B;  3HRT A;  2BEO A;  2HYG D;  1ULY A;  2VC0 A;  4BH9 A;  5DDG A;  1FYK A;  3LA2 A;  5H6Q A;  1YS7 A;  5J8C A;  3F6O A;  4L5J A;  4KIC A;  2V9V A;  1BC7 C;  1O3T A;  2FRH A;  1SFX A;  1FSE A;  1YG2 A;  3HRS A;  1FBQ A;  4ETS A;  1EV7 A;  1A04 A;  1REP C;  2HQN A;  2M1B A;  4WXH A;  4HLY A;  3IKV A;  3LAP A;  3D5L A;  1I1G A;  2A5Y B;  1KYZ A;  2IJL A;  3QU6 A;  2EFQ A;  2LSO A;  3W6J B;  3ZMT A;  1DUX C;  3KP5 A;  1MJ9 A;  4BNC A;  1ONV A;  1YQA A;  1LB2 A;  3C3W A;  1YS6 A;  3ZPL A;  3M7G A;  2FBH A;  4KT5 C;  5FFZ A;  4Y15 A;  3F8M A;  2V79 A;  4IXA A;  2FU4 A;  3H3U A;  1ON1 A;  1UHM A;  4N9H A;  2E1C A;  5E20 A;  5FGM A;  3MQ0 A;  2O8X A;  4EGZ A;  3D0S A;  4WX9 A;  4UV9 A;  5ED4 A;  2VOP A;  3WGH A;  1QZY A;  1YW7 A;  4UXN A;  3CTA A;  1UCR A;  1G3W A;  1I27 A;  1R22 A;  4G9Y A;  4S05 A;  3U9G A;  2UXN A;  4M73 A;  5J6X A;  2LNB A;  5ILV A;  1YW8 A;  2XHK A;  1O3S A;  4MQ9 F;  2H6C A;  3RKX A;  5E8I A;  1TTY A;  3IL2 A;  3ZMD A;  1WKM A;  1P92 A;  4RGX A;  4XBF A;  5CLS A;  4LLG F;  4LJZ F;  3GYH X;  1R00 A;  1F9N A;  4OIP F;  2HTJ A;  4RGR A;  1GHC A;  1FWZ A;  2DPU A;  1K7A A;  5TRD A;  1IN4 A;  1OYY A;  3REO A;  4U7D A;  2NNN A;  3K1P A;  1T6S A;  5D5U B;  2BE5 F;  1LVA A;  2P5L C;  4XLP F;  1FP1 D;  2R7F A;  3TO6 A;  3C7J A;  2QUF A;  3KP2 A;  1QPM A;  2HYF A;  4Y17 A;  2PI0 A;  2FBI A;  1PP8 F;  1PP7 U;  2Z3Y A;  1XMA A;  3GX4 X;  3KZY A;  5ERI A;  3KLN A;  1BOA A;  1TW2 A;  3ZMS A;  3RPQ A;  2WV0 A;  4ZYE A;  2PQ8 A;  4GYI A;  1H0M A;  1QZZ A;  2XUB A;  1B9N A;  1HW2 A;  2D1H A;  4CDG A;  1LQ1 A;  2JZY A;  4IRG A;  3KLO A;  4MHG A;  3I54 A;  3LQR A;  4L9N A;  5E1X A;  2EB7 A;  1MKM A;  4ESF A;  3ELK A;  3F6V A;  3E6C C;  1KU7 A;  1B59 A;  1BM9 A;  4ZH4 F;  1IN6 A;  5HDN A;  1SD5 A;  1H9G A;  5HLG A;  2DPD A;  1BI2 A;  2Z9O A;  1D5V A;  3ZN1 A;  1J5Y A;  1TLH B;  5A2Q Z;  5LGN A;  1Z7U A;  2MH2 A;  1FC3 A;  3QOP A;  5E1W A;  5BOX A;  3LAJ A;  3IRR A;  2M87 A;  5F6F A;  5ICG A;  4KNY A;  4IHS A;  1P4X A;  3CO6 C;  1W5T A;  1KQ8 A;  3K9T A;  1XSV A;  2A3S A;  4EM1 A;  1WSU A;  2PN6 A;  3GF2 A;  2RGV A;  3CLO A;  3H3Z A;  1QGP A;  3QPH A;  3RIR A;  3ZMZ A;  1ZLJ A;  3Q9S A;  3IC7 A;  1HKQ A;  3M8F A;  3MZY A;  3KE2 A;  4OIO F;  2KRF A;  3LA7 A;  2JTV A;  4G6D A;  3GLX A;  3F72 A;  4LFU A;  1BIB A;  3DEU A;  2KIU A;  3ULQ B;  2HR3 A;  3COA C;  4R8H A;  2CG4 A;  4U0Y A;  2EFO A;  5IT3 A;  5L3C A;  4I7H A;  5D6F A;  2GA2 A;  1ZN2 A;  3E5U A;  3V7S A;  4L0Y B;  4XSX F;  1DPU A;  4KMU X;  4EVI A;  5L3B A;  3P7N A;  4HAM A;  5F1R A;  1P4A A;  1RUN A;  3RKY A;  2VE8 A;  3J80 Z;  1Z1D A;  3DFG A;  3ZMV A;  3E3V A;  4M6X A;  1HKT A;  2IA2 A;  2EV0 A;  3VOD A;  2HTS A;  3Q5F A;  4MNU A;  1R23 A;  2H94 A;  4I01 A;  5HS8 A;  2EA2 A;  2L4M A;  4KIB A;  2O0Y A;  3HUG A;  1UST A;  2FQ3 A;  3EDP A;  3KET A;  4YII A;  1YW9 A;  4QWQ A;  4PCQ A;  3V7R A;  1F5T A;  2P4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...