5FFXA

S. aureus mepr g34k mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
138
structure length
138
Chain Sequence
EFTYSYLFRMISHEMKQKADQKLEQFDITNEQKHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRNLERKKLIYRYVDAQDTRRKNIGLTTSGIKLVEAFTSIFDEMEQTLVSQLSEEENEQMKANLTKMLSSLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title S. aureus MepR G34K Mutant
rcsb
source organism Staphylococcus aureus
molecule tags Transcription regulator
molecule keywords MarR family regulatory protein
total genus 54
structure length 138
sequence length 138
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5ffxA00
3KP5A 4L9VA 2PMUA 2EV0A 2NYXA 4EM1A 4HF1A 1R1TA 3ZMVA 1UFMA 4G8XA 2Q2EA 3IWFA 5IT9Z 1E2XA 3GFLA 5AONA 3K0LA 3LA2A 2VBZA 5LHHA 1U8RA 3RDIA 4ESFA 2NAZA 5LRRA 5ED4A 1G3YA 1V3FA 3L2CA 1UHMA 4CYDA 1U5TB 1YO5C 1G3WA 2A61A 3W6KB 5ILUA 2Y0MA 1IRFA 5ERIA 4XBFA 4KDPA 5BPDA 4RGRA 2STTA 5HOOA 1K79A 4M73A 2VOPA 1KU2A 1STZA 4O3MA 3QU6A 4MNUA 4LLGF 3K69A 3E97A 2FBHA 2JPBA 2Z99A 2GQQA 1PDNC 1Z6RA 2KJCA 1FYKA 3TOAA 2XKOA 3J81K 5A2QZ 2L54A 2Z9OA 2UXNA 2QM3A 1ZLKA 4M9SA 1FSEA 1QO0D 3KLNA 2F5CA 1BI3A 4GYIA 4HF0A 1B6AA 2IA1A 1TNTA 3ZMUA 3BP8A 5DCMB 2UXXA 3OOPA 3I59B 2LF8A 3RKWA 3KP3A 3BJOA 2L3DA 1SD7A 2FBIA 3K9TA 3RIRA 4CXFA 1GXQA 2IRFG 2PFBA 5JFRA 1P4XA 2G7UA 4RS8A 1JXSA 1EH7A 3L9FA 3COAC 1R7JA 3I54A 6PAXA 1FNNA 1BIBA 4JQFA 3ERED 1KQ9A 5HDGA 3BJ6A 2HTSA 5ILVA 3ZP5A 3HOSA 2KIFA 3ZMDA 4M71A 2F5FA 4L0ZB 1EV7A 3H92A 2M8EA 3T8TA 2FMYA 1O7FA 3MZHA 3RYRA 4GXOA 3JTHA 4KIBA 4WXHA 4RAYA 3OV8A 3QOPA 4HLXA 3QP6A 2C6YA 2MLKA 2G7HA 4GCVA 4FT8A 1YW7A 5L3GA 1PP7U 4DQ2A 5E17F 2DQLA 4CHUA 4CZZA 4LB6B 3VB2A 3ZPLA 1BI0A 2RQPA 4L5IA 1UHWA 1HW1A 1QNTA 4LG0B 2VC0A 2PBIA 3W6JB 5L3BA 4Q5SF 3MWMA 3ABUA 3WG9A 4LJZF 1ZH5A 2OZ6A 1YS6A 3R0AA 4UV9A 5KVRA 1J7KA 5J6XA 1MJAA 4L18B 2HYGD 4ENKA 1O7LA 4U0WA 2L4AA 1W7PA 4WK8F 2QVOA 3RKXA 3BPVA 3BOQA 4AIHA 2PN6A 2LSOA 5D6FA 3HIFA 1ZG3A 2D2WA 4IRHA 2PQ8A 4WF2A 2W24A 4RGXA 2NS0A 2BGCA 2P5LC 2COMA 5DD8A 3F8BA 4NQWA 1QQIA 4I09A 4OINF 5LHIA 5DUKA 1D3YA 2FA5A 4LK0F 3N4MA 4OMYA 3J81Z 2IPQX 5FB2A 5D8LB 1XGOA 4AIJA 3ULQB 2MD5A 2W84A 1XCVA 5DDGA 4EGYA 2PMHA 3CUOA 4BNCA 1JHHA 5BQTA 2Y48A 1IN6A 1NHAA 4HAMA 3I53A 4I7HA 1J9IA 4HOBA 2ZNYA 2PLYA 1R1UA 4OIPF 5F64A 3WE2A 5CVRA 3BJAA 4HQMA 1RUNA 4G7OF 2V1UA 4B8XA 4G7HF 4LB5A 3GWZA 2J5OA 1LJ9A 1W5SA 5JVTA 4LLNA 2P6TA 3IRRA 4BXUA 1BJAA 5DV5A 3WODF 2DU9A 4BYYA 4U0VA 2A6EF 2ESHA 5KK1A 2EK5A 2O6GE 3TO6A 3FM5A 1FBQA 3LAPA 1B9MA 4HDVA 1WWXA 2Q0OA 3P9KA 2AS5F 1BM9A 1R23A 3IKVA 1RIOH 2ACJA 2HQRA 2CYYA 4EMSA 1W5TA 4O5VA 3GVAA 4ASNA 3H3ZA 4BHBA 2PG4A 4HDUA 1YW9A 2P5VA 4EVIA 2GA1A 4MEXF 1W7PB 1YW8A 3WTTC 3N97A 3BWGA 2VE8A 4JBAA 4PGGA 2DO7A 4ZYHA 1AOYA 4S05A 3WU0A 2DI3A 4CDGA 1W4MA 4A12A 3TOBA 4EJOA 4LGWA 3IC7A 4N0BA 2EA2A 1P6RA 4FX4A 5EEGA 3M8EA 4WXCA 4H0EA 3CJNA 1LB2A 3Q5FA 4BQAA 3Q9SA 1G3TA 4KICA 5K5OA 4HV5A 5E8GA 1FYLA 3CDHA 1DPUA 2M30A 1FBSA 4N9IA 1U6GA 3I71A 3V4GA 1ZG5A 2RV8A 3GO5A 3WTSC 4B09A 2HKOA 1J75A 4IXAA 2A07F 2L01A 2DBBA 3E6BA 4MEYF 3ML6A 1USTA 4I0BA 3HRSA 5HLHA 5L3FA 1B9NA 3T1BA 2HEOA 1ZGJA 1O3TA 1J0RA 3B73A 3HTUA 1IW7F 4ETSA 3VFZA 2XIGA 4ZYEA 1BI1A 4CGZA 4OU0A 1J2XA 1YS7A 1S8NA 5J8FA 3HUGA 3SZTA 2IA0A 1XDUA 2XRNA 1U3EM 3HHHA 4KMUX 3DKWA 2QYOA 2RDPA 2W25A 4HBLA 4BHCA 2MH2A 2P5KA 3GW2A 1TQIA 1KGSA 2CO5A 3K2ZA 3WTWC 4KFCA 1I27A 2DW4A 1IN4A 1KYWA 3KETA 4R1HA 3IRQA 5E20A 1YQAA 3GZ6A 1LEAA 3FWEA 2X0LA 3MQ0A 5CYVA 2HDCA 1S3JA 1S7OA 1ODDA 2XROA 2EFOA 3RYPA 2XAGA 3KP7A 3IHUA 3LQQA 2ESNA 3E5XA 1HW5A 5L3EA 1PUEE 1IXCA 2H09A 4A0YA 3I58A 2M1BA 1WKMA 2HOEA 2OQRA 1IN8A 3LA3A 1FSHA 4HV6A 4ESJA 5HDNA 2VE9A 1OR7A 1YIOA 3V7RA 2HZTA 3WTZA 1DP7P 3O3KA 1P2FA 1BBYA 2VBWA 5D5UB 1IZ1A 3F8CA 1IXSB 5FFZA 1SD6A 2XVCA 3J80K 5H6QA 2VONA 3IWZA 3FXUA 1D8JA 4A2UA 3Q9VA 5D5XB 5IT9K 1W7PD 3HSFA 3QP5A 1ZRCA 4E70A 2Z3YA 3MZYA 2K7LA 1TBXA 2VN2A 4EJUA 4YIFA 3LWFA 1Z9CA 2FU4A 4YFKF 4KNYA 1KU9A 4A0XA 4KN7X 3I4PA 3LAJA 1SD5A 3GUDA 2V1XA 4RB1A 4RB0A 5E1ZB 1OPCA 1R58A 2IT0A 5TJJA 5DCMA 5LLQA 3AAFA 1MGTA 3O6BB 5ICFA 5LHGA 3BROA 1I5ZA 1XN7A 3QRFF 1P4WA 1K7AA 1TTYA 5FLXZ 3GZ5A 3QU3A 3WTUC 1B4AA 4U88A 1BI2A 2FNPA 3F8MA 3KFWX 5H20A 1FOKA 2A5YB 2WWYA 3TO9A 2BYVE 3V7SA 3J80Z 1XGSA 4XSZF 2R7DA 4IHSA 2DFIA 2Q8KA 1K6OA 5HVQC 3E3VA 3WGIA 1XCBA 3NRVA 2CSOA 5LGTA 2XAFA 4L9JA 2VODA 1QPMA 4UV8A 3CUQA 3KE2A 2E7XA 4Y17A 3SZPA 3WU1B 2LDUA 2VT3A 3PQKA 3GFIA 2HGCA 3LSTA 2EV6A 4P9UA 4YFNF 2EFPA 3E6DA 1U78A 1JHFA 1XSVA 4I98B 2QENA 1T38A 5D5WB 3I64A 3CLOA 3IKTA 5HS7A 4Q4ZF 4I2OA 1R22A 1TW2A 5D4SA 3IL2A 2YU3A 3TKYA 1XDSA 4BHPA 2OA4A 1SMTA 3CUQC 2Z33A 4LG0A 1IUYA 3HSEA 3BPXA 1K78A 3T5XA 1DPRA 4YIIA 1GVJA 1WSUA 4WCGA 2M45A 3P7NA 2BEOA 1YLFA 4HX4A 4M9XA 1F5TA 1P92A 4HF2A 3QAHA 2P6SA 1U2WA 5ICEA 5FD5A 1GXPA 2EJRA 2QBYA 4Q47A 1LDKB 2A6HF 2FEZA 3F22A 4IRIA 3FZVA 2V6CA 4KIFA 2JZYA 1R36A 1KYZA 2H6CA 3GX4X 5J8CA 2M5WA 3DPLC 2QLZA 1I6XA 1ULYA 1Q1HA 3DPTA 1F1ZA 3M8FA 2JTVA 3S2WA 2BBYA 2H27A 4RB2C 4XLPF 2LKPA 3F72A 4ENMA 1TNSA 3R61A 5CVUA 5DCFA 2VC1A 1R5HA 4A0ZA 2FXAA 1F4KA 4UHTA 3FF5A 4M6XA 3MFKA 2FE3A 2HQNA 5ICCA 2RGVA 2CG4A 2A69F 1BOAA 3GLXA 2LNBA 1LNWA 3REOA 1QBJA 3LQRA 3I59A 4L9TA 3U9GA 4A6EA 1ONVA 1JE8A 2ZMEA 5AIPA 5D8KB 5FD6A 3M9AA 2MBFA 1T6SA 3R0JA 3EUHA 4ENNA 4AVPA 3U1DA 3DF8A 3F23A 2DAOA 1ZRDA 3G73A 3R6SA 4BH9A 1XGMA 4EM2A 2ISZA 2O03A 3GF2A 4P5OA 1B1BA 2F5EA 2HTJA 1WQ2A 1KQ8A 1BC7C 2G9WA 2CFXA 1RNLA 3CUQB 4MQVA 1BN5A 5E8IA 3SHFA 5CLSA 3L00A 5L3DA 5HLGA 2DPUA 2KKOA 4UXNA 2CW0F 3FMSA 3KLOA 1RUOA 3GFJA 1HSJA 3FMRA 4L0YB 1USSA 1PP8F 1MKMA 2QZ8A 4ON0A 3WGGA 5LGUA 3VEPA 2F5DA 1T98A 4ESBA 3HTSB 1L0OC 3F3XA 5K5QA 3GEZA 4BAYA 5HS9A 4OMZA 4G7ZF 2V9VA 3L09A 1MD0A 3JSOA 3QPHA 2BE5F 4P96A 3MAJA 4G94A 3SXYA 1FYMA 1FP2A 3TQNA 4RB3C 3RI4A 2GXBA 3J7AO 3NEUA 2DLLA 4M74A 3WTYC 5FFXA 3K1MA 1S29A 1MZBA 2YX4A 5D5VB 4ZZLA 1DUXC 1X3UA 4MQ9F 2FF4A 2R7FA 3MCZA 4OIOF 1KQ0A 4YG2F 3VOEA 4P9FA 1KU3A 4LD5A 2F2EA 1SFUA 3V7CA 3KEQA 4MGRA 1HQCA 1HW2A 3K1NA 2HFHA 3RKYA 2K27A 5DEQA 3JTGA 3O2PE 2JT1A 1SFXA 4EGZA 2HWVA 4HYEA 4PGHA 2RN7A 3KP6A 1T2KA 2ZNZA 1CF7B 2YR2A 1SFEA 2KJBA 4HX8A 1LVAA 3QPTA 2X4HA 2XGXA 1LDJA 4K2EA 1IF1A 3DV8A 4IVNA 1H0MA 4WXDA 4L5JA 5DD4A 4FHTA 1KA8A 1VTNC 4N9HA 5DUIA 4UVBA 3FHZA 3F6OA 1CF7A 2GAUA 4UNOA 3C18A 2IVMA 1T39A 2IJLA 3HRUA 5ILSA 2DQRA 4F7ZA 3ROUA 5LBQA 2E7WA 3FM3A 2P7CB 4UUVA 3CTAA 4XRFA 2EWNA 2D1HA 3E5UA 4YFXF 4PDKA 5AIQA 3KZYA 1XSDA 1EH8A 2JSCA 2FBKA 2ZBKA 3E6MA 2FQ3A 1QGPA 4KIGA 2JPCA 1ZARA 1TW3A 3V8KA 1HKTA 1E17A 1Z05A 3T8RA 2ZCWA 2XAQA 3MEXA 2VOOA 1XD7A 3DQVC 4G6DA 1J59A 1FC3A 4HLYA 1XMKA 2YSRA 1FPQA 4OIQF 1OKRA 4EJVA 1KU7A 4M9ZA 3M7GA 5ICGA 3V8LA 1QZZA 2MH9A 1K78B 2XAHA 2GXGA 4U7BA 3E6CC 1LQ1A 2V79A 3FMQA 3C7JA 3HHGA 1ZG1A 2ZMEB 1AWCA 2STWA 2XUBA 2YX7A 2ISYA 3ELKA 5CJ9A 5JR3A 4S04A 5L3CA 4MTEA 2P7VB 2O3FA 2XHKA 4EJTA 4IPAA 2QWWA 1S6LA 2DPDA 3RTRA 2MC3A 4AWXB 1D8KA 1G3SA 3NQOA 2R3SA 1SAXA 4LMYA 2D1VA 3PFIA 4PCQA 1YYVA 4JK1X 4FX0A 3HOTA 3KCCA 3WTVC 3C1DA 2EV5A 3F6VA 3WTXC 4M72A 5HS8A 3SFZA 2XASA 1B59A 2YPRA 1XGNA 2WV0A 2VBXA 4KUMA 1HXDA 2KRFA 4UVAA 2QQAA 1TQPA 1BIAA 1MJBA 3F21A 2OQGA 2HKXA 3FX3A 3GXOA 1RI7A 3BZ6A 3LA7A 4I01A 2O61A 2RVCA 1G4DA 2EFWA 3EYIA 1REPC 3EYYA 4GO1A 4A6DA 4MTDA 4EQQA 2J5PA 1FLIA 5EEHA 3RPUA 3VODA 4HX7A 4CICA 2QUFA 2OAZA 3C3WA 3U2RA 3R4KA 1O3SA 2GIVA 1A04A 4EV0A 1MJ9A 4PZJA 1XMAA 3ZMSA 1ZGAA 3F8FA 3F8NA 2TDXA 1I1SA 2PEXA 3B02A 1HKQA 4KA4A 1YFHA 4AIKA 3FXQA 2BV6A 2AXLA 1MDMB 2MA3A 1MDMA 1SMYF 2L4MA 1V4RA 3R60A 4DNCA 2NNNA 5JHUA 5HLIA 4LK1F 5BOXA 3H3UA 1D5VA 5E1WA 4HA8A 5H6RA 1IN7A 4OIRF 4WWCA 2VXZA 3L7WA 4EM0B 3KEOA 4KMFA 4CO8A 3HRTA 1IXRC 2FSWA 2ELHA 2H94A 1I1GA 2JRTA 2K4BA 4A5MA 4KYWA 4AD9A 2QBYB 3V8JA 3ABTA 4GGGA 3KP4A 3TDZC 5HDKA 1Z91A 4O6JA 1FBUA 1OYWA 1G6NA 4IHTA 1IRGA 5BMZA 3PQJA 5F6FA 1IAWA 1H9TA 3KZZA 3RJPA 2HYFA 1ZRFA 2HS5A 4MHGA 5D4RA 5CVJA 2EFNA 2QQBA 1P4AA 4LFUA 3EDPA 5BS6A 2DT5A 2EA4A 1LDDA 1OMIA 2OU2A 3D0SA 4IRGA 1ZLJA 1LEBA 2OD5A 5IT3A 4ZYGA 2O8XA 2Z5UA 4A5NA 1O57A 1YTYA 3ECOA 4Z2YA 2MLGA 2RC4A 1FWZA 5LEJA 4U7DA 2GWRA 2NNYA 1FZPB 1ZHFA 1HKSA 2IA2A 2ZJ2A 4G6QA 3I0TA 3FXRA 2QQ9A 3LFKA 3JAMZ 5E1XA 1U5TA 2FMLA 5K1YA 5F1RA 3TO7A 5FGMA 2UZKA 3HYIA 4Y15A 1R00A 4RGUA 4KN4X 3DP7A 2FOKA 3ZQ7A 1C0WA 4GYGA 5LRSA 3P9CA 3T0YA 1YG2A 1GHCA 2ZKZA 2FRHA 1Z7UA 4HW0A 4R79A 1BC8C 2P4WA 2DTRA 3ISPA 1L3LA 2HR3A 3I5UA 2OBPA 5K5RA 3JW4A 2CQKA 1ZN2A 4I02A 3HRMA 4IF4A 3ZN0A 2P8TA 2PJPA 3EETA 2XKPA 2H6BA 2GA2A 5LEKA 1FY7A 5TRDA 2CGPA 3WE3A 4NB5A 1ON1A 1QZYA 4IJAA 1H9GA 1UB9A 3BY6A 2DK5A 3KP2A 4QWQA 4ZYDA 1OYYA 3EQLF 1U5TC 1HBXG 2ZFWA 2DK8A 1ZYRF 4UVCA 3ZMTA 5LGNA 3JSPA 4L9NA 1FT9A 4XSXF 2UWMA 4RAZA 4ZZDA 1WRJA 1SD4A 2KIMA 4NHJA 5BPIA 4LLLA 4RGSA 2O0YA 1XB4A 1EH6A 1O3RA 4TV7A 1TLHB 3G3ZA 2FNAA 4U0YA 3GYHX 1Z1DA 4Q48A 5FO5A 2KIUA 2CWEA 1S7AA 4P55A 2V1DA 4ZH4F 2B0LA 3HSRA 2K02A 4WX9A 2A68F 1JGSA 2PI0A 2EFQA 3WGHA 1OYIA 2ZO4A 3E5QA 1RZ4A 3CO7C 1FP1D 2IP2A 1HSTA 5A2QK 4EJWA 3K1PA 3BDDA 1XSXA 1CGPA 2K86A 3ZN1A 1J5YA 1F9NA 2E1NA 4XLNF 5FLXK 2EB7A 4M6YA 4G9YA 2W57A 2Y75A 3D5LA 2L02A 3DEUA 3CO6C 2RKHA 3DFGA 1T0FA 3ECHA 5JI6A 3DXJF 5CVVA 4HZFA 1ON2A 4ENJA 5E18F 4Y13A 2ADUA 1FX7A 2OZUA 2XAJA 2IW5A 2VT2A 3GFMA 3RPQA 5D6EA 4OOIA 2GZWA 1R1VA 2WTEA 2XV4S 2M87A 2ETHA 1Y0UA 2LF7A 1ZAOA 2WC2A 1WI9A 5DYMA 3P9IA 4D0PA 3TDUC 1R5GA 4R8HA 2VBYA 2E1CA 1TQMA 2K4JA 5CVIA 2ZXJA 3JAMK 1O3QA 2D45A 4I0AA 4QLCU 3ZMZA 1DDNA 4KT5C 4HQEA 1IN5A 2NRAC 1Z6TA 3TGNA 3SQNA 1UCRA 2W85A 3M1EA 2A3SA 2RNJA 1ZREA
chains in the Genus database with same CATH superfamily
3KP5A 2DA7A 4L9VA 2XB0X 2PMUA 2LP0A 2EV0A 3H9GA 2NYXA 5J47A 3MKYB 4EM1A 2W7NA 2E2JJ 4HF1A 1R1TA 2CV0A 3ZMVA 3HPGA 1UFMA 3IP4B 2Q2EA 4G8XA 3S3NA 4E7IA 3IWFA 5IT9Z 1E2XA 3GFLA 5AONA 2KZVA 3K0LA 3LA2A 2XDVA 4MFEA 2VBZA 5K7HA 5LHHA 1LE8A 1U8RA 3RDIA 4ESFA 2NAZA 1QZEA 5B1AH 5H2FC 2LFBA 5LRRA 4F52A 5ED4A 1Z21A 2QGUA 3DKYA 3DBHB 1G3YA 5GPCA 4DBQA 1V3FA 1X1DA 1DGWY 2VIXA 3L2CA 1FOXA 2KLOA 1JT6A 1V55H 1GLNA 1MBHA 3WHCA 1UHMA 4CYDA 1U5TB 3HG9A 2I8DA 2YUSA 1YO5C 1G3WA 3HOVJ 3MN2A 3OYNA 2A61A 2X9DA 3W6KB 2PJRA 5ILUA 2L7MP 2Y0MA 3HC7A 1IRFA 3AL0B 1PYVA 2B63J 3EUAA 2DMUA 5ERIA 3BG5A 4XBFA 5BPDA 4KDPA 2DMNA 3KYLA 3TW7A 4BQQA 4RGRA 3G71I 4I99C 2STTA 5HOOA 1K79A 3G2BA 1XX5A 4M73A 3CMEI 4ZTJA 1KU2A 2VOPA 1STZA 2B9SA 1OCZH 5C3EJ 4O3MA 3QU6A 2R7TA 4MNUA 3CCQI 4LLGF 1ETXA 3K69A 3E97A 4ZJZA 1FOWA 4XKWA 3HOYJ 1BA5A 2FBHA 1BR1A 2JA8J 4QSHA 4XN3A 1FIPA 2JPBA 2I10A 2Z99A 3OS2A 4MLOA 2GQQA 1PDNC 1Z6RA 2KJCA 2ZMEC 1FYKA 2ZJRF 3TOAA 3CMAI 2XKOA 3RZDJ 3J81K 5A2QZ 2L54A 3BLYA 3OR2C 1JTXA 2Z9OA 2UXNA 2QM3A 3BG7A 1ZLKA 2XF6A 3BQZA 2XPVA 2L9VA 4M9SA 1FSEA 1QO0D 2BVLA 3CP8A 3KLNA 2F5CA 5IP6A 3ZR8X 1BI3A 4GYIA 2F48A 2NXNB 4HF0A 1B6AA 2IA1A 3WHBA 1TNTA 2K9SA 3ZMUA 4J00A 3BP8A 1BOBA 1U9OA 2UXXA 3DTIA 3OOPA 2Y2ZA 5DCMB 1NK3P 1HOMA 3I59B 5GPAA 1VQ6I 2LF8A 3CESA 3U21A 3RKWA 3KP3A 1X1PA 3CMMA 3BJOA 2L3DA 4B1RA 1SD7A 2FBIA 3K9TA 3RIRA 4CXFA 1GXQA 2IRFG 4N4OB 2PFBA 1POGA 5JFRA 2FQ4A 1P4XA 5CQEA 2G7UA 2E5NA 2R7OA 3BR3A 4RS8A 3L2UA 2NVXJ 2KL4A 3A2KA 1JXSA 4FE4A 1EH7A 3L9FA 2CUFA 4RLQA 3COAC 1R7JA 2AXTC 2HOAA 3OYEA 4AM3A 3I54A 1VNDA 1NK2P 2E71A 4PK4A 2DYSH 6PAXA 1FNNA 2FD5A 5FKMA 4EEFG 1BIBA 4JQFA 3ERED 1SEUA 4FE7A 4S0HB 1KQ9A 5HDGA 4ZYAA 3BZCA 2ELJA 1W36C 3BJ6A 2HTSA 5ILVA 3ZP5A 3HOSA 2KIFA 3ZMDA 2DJNA 3KPHA 4M71A 2F5FA 5EGOA 4L0ZB 1EV7A 1YJ9I 3VPRA 3H92A 3HOUJ 2M8EA 3T8TA 2FMYA 1O7FA 3MZHA 3RYRA 4GFBA 2JQ7A 2N8GA 4GXOA 3JTHA 4KIBA 4CCMA 4WXHA 4RAYA 3HEFA 3OV8A 1WH7A 2VQGA 3QOPA 4HLXA 3QP6A 3S14J 5FJ8J 2C6YA 2MLKA 3NWTA 1LFPA 2G7HA 2E19A 4GCVA 2VL8A 4FT8A 3OYHA 2G0EA 1YW7A 2MFZA 5L3GA 1PP7U 3PL8A 2HQ5A 4DQ2A 2DA6A 5E17F 2DQLA 4CHUA 3B6AA 1WJEA 3ZQHA 4CZZA 3MZ8A 2VQCA 4LB6B 3FK6A 3VB2A 2VQHA 5J4VA 2R7WA 3I4NJ 3ZPLA 1BI0A 1X2MA 2XPUA 2RQPA 1QA6A 3HDDA 1MBEA 3LSMA 1UHWA 4L5IA 3FXJA 1HW1A 5KHDA 1QNTA 4LG0B 3PUBA 1WGXA 4XORA 2VC0A 2CS3A 2E5ZA 1S5LC 2PBIA 3GTGJ 3W6JB 2XGEA 4PFOA 5L3BA 4Q5SF 3CCMI 3MWMA 2IS6A 3ABUA 3WG9A 2E1MC 4LJZF 2OF7A 4Z6YA 5E3OA 1ZH5A 4PJJA 2OZ6A 1YS6A 3R0AA 4UV9A 5KVRA 1J7KA 1MMAA 2JMWA 5J6XA 1MJAA 4L18B 2HYGD 4XIDA 4ENKA 1O7LA 4MFDA 4U0WA 2L4AA 5IY5H 3ZQLA 1W7PA 2QVOA 4WK8F 3FHNA 1A5JA 3RKXA 1MNMC 3BPVA 3BOQA 4AIHA 2P0WA 4PJNA 2PN6A 2LSOA 4IOAF 5IYCJ 5D6FA 3HIFA 1ZG3A 2D2WA 3CCVI 4IRHA 2PQ8A 2X48A 4WF2A 2W24A 5KCMA 1W5CC 3OYDA 2XF5A 2NS0A 4RGXA 2BGCA 2P5LC 2COMA 5DD8A 3F8BA 2M9HA 3CCUI 3TW6A 4NQWA 1QQIA 4AYBA 4OWRB 4I09A 3D5SC 4OINF 3HGGA 3K10A 5LHIA 5DUKA 1D3YA 2FA5A 5IP9J 3K4JA 4LK0F 3N4MA 4OMYA 4XNFA 3J81Z 2IPQX 4BE2A 5FB2A 5D8LB 3LSJA 1XGOA 4AIJA 3J7AY 3H9JA 1S7EA 3ULQB 2MD5A 4IL6C 1Y8RB 3TP0A 2W84A 1XCVA 1HA8A 5DDGA 4EGYA 1SAUA 2PMHA 4CZCA 2X6OA 1GT0C 1JGGA 3CUOA 3DLAA 2HYJA 4BNCA 4ITVA 1JHHA 5BQTA 2Y48A 4E4HA 3G1MA 2WAFA 3OMYA 1IN6A 1NHAA 4HAMA 2R92J 2QSGX 2IGOA 5F04A 3RKQA 1Z77A 1HF0A 2W82A 2M4KA 3I53A 4CUGA 4M3BA 4I7HA 2EIJH 3DKXA 1J9IA 4HOBA 4Y52J 4RA2A 2ZNYA 2PLYA 3HKZA 2CJJA 5C4XJ 3FKIJ 1R1UA 4OIPF 3S2HJ 5F64A 4IQ4A 3WE2A 5CVRA 3BJAA 4HQMA 4CCJA 1RUNA 4G7OF 3A02A 2V1UA 4B8XA 5EGOB 3OIPA 4G7HF 4LB5A 3GWZA 2J5OA 1LJ9A 1W5SA 5JVTA 4LLNA 3OYAA 2P6TA 2QSFX 3IRRA 4BXUA 2UV1A 4NC7A 1BJAA 1U0JA 1RRJA 5DV5A 3WODF 1TWGJ 1DP3A 2DU9A 1JI8A 4BYYA 1A6IA 4U0VA 1ETVA 1QVUA 2VUMJ 3LSGA 2A6EF 2ESHA 5KK1A 5GTHC 2EK5A 3BTJA 2O6GE 3TO6A 5B1BH 3FM5A 1FBQA 2W4SA 3LAPA 1B9MA 1AHDP 2LREA 1FTZA 4HDVA 3M07A 1WWXA 3CMYA 2Q0OA 3P9KA 1VQMI 1SVLA 2L2OA 1WFXA 1MSFC 2AS5F 1X4PA 1BM9A 4Y4RA 1R23A 3IKVA 1I50J 1RIOH 4BUPA 2ACJA 1BR2A 2HQRA 2CYYA 4EMSA 1W5TA 4CA0A 3A0HC 4O5VA 3HOZJ 2KRCA 3GVAA 1VQ7I 1HDPA 3VYSB 5GAGJ 2YS9A 5FKKA 4ASNA 3H3ZA 3ZQFA 4AU7A 4BHBA 3ZQGA 2PG4A 4QTRA 4C2MJ 4HDUA 1YW9A 2P5VA 5JLXA 4EVIA 2GA1A 4W1UA 2QF7A 1X58A 2DDBA 4MEXF 1W7PB 1IDZA 1YW8A 3S93A 2KT0A 3WTTC 3GTOJ 3N97A 1WJFA 2KIQA 2W1OA 3BWGA 2VE8A 4UUSB 4JBAA 3SEQA 4PGGA 2DO7A 2TCTA 2OC6A 4ZYHA 1AOYA 3ASNH 3B6CA 4S05A 3WU0A 2DI3A 3VYUB 1W4MA 4CDGA 1GUUA 3SJMA 4A12A 1UHSA 3OY9A 3TOBA 2WAEA 4LGWA 4EJOA 3IC7A 5M5WJ 4N0BA 3RZOJ 2DFHA 2EA2A 1P6RA 4FX4A 5EEGA 3GZNB 3DWLE 2MG4A 3M8EA 4WXCA 4H0EA 3CJNA 2R4GA 1LB2A 1MBKA 3K4KA 4B44A 1TC3C 3MKWB 4A69C 4E7HA 3BQYA 4BACA 1LUJB 3Q0WA 1OJLA 3Q5FA 1H8AC 3PSIA 3LNQA 3KEYA 3JR9A 4BQAA 3Q9SA 1R5ID 1G3TA 4KICA 4BGDA 5K5OA 1JKRC 2K85A 3LL7A 4HV5A 5DM7F 4FISA 5E8GA 1QPIA 1FYLA 4XOTA 1VFCA 4UB8C 4ZDPA 1MH4A 2AO9A 3CDHA 3QYEA 1YJNI 2M30A 1FBSA 2ZFUA 4N9IA 1U6GA 1DPUA 3I71A 3V4GA 1Y1VJ 1ZG5A 2RV8A 3GO5A 3OS1A 3J7ZI 3WTSC 4B09A 5EF6A 2HKOA 2DA5A 1J75A 4IXAA 4XLEA 2L01A 2A07F 2DBBA 3E6BA 2NOGA 4MEYF 1UJ8A 5CPRB 2WY7Q 3TL4X 3ML6A 2F5VA 1VQ9I 1USTA 3FKJA 4I0BA 3HRSA 1E3PA 2H8WA 4H4KC 5HLHA 3LSPA 5L3FA 1B9NA 1OISA 1FJLA 3T1BA 5F27A 1FEXA 2HEOA 1ZGJA 2MD0A 1O3TA 1BR4A 2OCEA 2VJIA 1J0RA 3B73A 2VJ4A 1FMWA 4M3FA 3HTUA 3CP2A 1YITI 2ELKA 2K9QA 1TZLA 1D0ZA 1IW7F 4ETSA 3VFZA 2XIGA 4ZYEA 1BI1A 2KP6A 4QPOA 4CGZA 4OU0A 1J2XA 1YS7A 3FDYA 2M3AA 2JUGA 1S8NA 3K4CA 5J8FA 3HUGA 1R6RA 2E2HJ 2BVMA 1MMDA 3SZTA 4BS9A 2O7OA 2IA0A 1XDUA 1RPWA 2XRNA 4XRMA 1U3EM 1HCRA 2M0MA 3HHHA 4RDUA 3ZQCA 2GM4A 4KMUX 5FLMJ 3K4NA 3DKWA 4J19A 4NQWB 2QYOA 2RDPA 4CCKA 2W25A 4HBLA 4BHCA 1N78A 2MH2A 3HM5A 4PJLA 3RCOA 2P5KA 1AA7A 2VKEA 3GW2A 1TQIA 2BW3B 1KGSA 1SVMA 2CO5A 2EPFA 3K2ZA 2IBDA 1DQUA 2ZC2A 3BTCA 3WTWC 4KFCA 2R5ZB 1I27A 1HLVA 5GAEJ 3CDIA 4FCYA 3S1MJ 3K4BA 2DW4A 1IN4A 1KYWA 3QPLA 3KETA 4BY7J 3HBLA 3AL0C 2BHZA 4AVZA 1OCPA 2NVYJ 4R1HA 3IRQA 2CW8A 5E20A 1YQAA 4NUBA 3GZ6A 1LEAA 3FWEA 2E35A 1EF4A 2GLOA 4IOCF 4A3BJ 2LRDA 2MGQA 3FXLA 2X0LA 3MQ0A 2DODA 5CYVA 1U8BA 2HDCA 1S3JA 1S7OA 2Y31A 2IS2A 1ODDA 4W97A 4XRSG 5IOYA 1ZELA 2EZKA 2EFOA 2VPRA 3RYPA 2XROA 2XAGA 2X6YA 2ZB9A 3OYIA 4A3IJ 3KP7A 3OOUA 3IHUA 2QA4I 3VSLA 3ABLH 5F0HA 4FETA 3LQQA 3LSRA 1K4TA 4D5FA 2ESNA 2PJRB 2VQLA 1ITYA 3E5XA 1PJRA 1HW5A 4A3EJ 5L3EA 1PUEE 2CV1A 5EZGA 1IXCA 2X1EA 1XTAA 3TEDA 1FMVA 2V4JC 4AUXA 4E6KG 2H09A 4A0YA 3I58A 2M1BA 1WKMA 2HOEA 2OQRA 1J09A 4XLFA 1IN8A 3FISA 1VQOI 4ZDOA 3SDBA 3LA3A 2R7XA 1FSHA 4HV6A 4ESJA 1VQ5I 1S9HA 3DTKA 2L7KA 5HDNA 1YOVB 1OR7A 2VE9A 1ENHA 1YIOA 4X6AJ 3V7RA 1BW5A 2HZTA 5HLTA 3CF5F 4PFPA 4RM2A 2JK3A 4BEHB 4BEHA 2EH3A 5EG0B 2Y69H 3WTZA 2KDZA 1DP7P 1X1AA 3O3KA 5IP7J 1P2FA 5IYBJ 1BBYA 2VBWA 5D5UB 1IZ1A 3WU2C 3F8CA 1IXSB 5FFZA 1SD6A 2OCCH 2XVCA 2LC2A 5H6QA 3J80K 3HL2A 1GDTA 2VONA 4IHWA 1A31A 2QEXI 4JOMA 3IWZA 4BJTA 2ZSIB 1BW6A 1Q1VA 3ZCOA 3FXUA 1JT0A 1D8JA 4A2UA 3Q9VA 1XMXA 5D5XB 5IT9K 1W7PD 3HSFA 2M2EA 2ZSHB 3QP5A 1ZRCA 4E70A 2VKVA 1R9TJ 2Z3YA 4RMNA 3MZYA 1WJAA 2K7LA 3BC8A 3JRHA 1TBXA 2VN2A 4YELA 4EJUA 3ZQQA 3S8PA 4YIFA 4XRSA 5F1JA 5J4YA 2NS7A 3LWFA 4I6ZA 5KNLA 3QPSA 1WZ2A 2WADA 1Z9CA 2FU4A 1B8IA 3W6VA 3JCUC 2E2IJ 4HRIA 2Z2SB 3HZJA 2DA2A 3RSNA 4YFKF 1JKOC 4KNYA 5DS9A 1KU9A 2A6TA 4A0XA 3L2RA 5TISC 3OYJA 2EIMH 5KAIC 1ERDA 4KN7X 3I4PA 3LAJA 1SD5A 2OPTA 3PO3J 1JTYA 3GUDA 4B3AA 2V1XA 3F0CA 4RB0A 4RB1A 1N75A 4AC0A 1PUFA 1P7IA 2QCOA 5E1ZB 1OPCA 1AKHB 1R58A 2KRHA 2IT0A 5TJJA 5DCMA 5LLQA 3AAFA 1MGTA 4XKCA 4HNUA 3KZIC 3O6BB 5ICFA 5LHGA 3BROA 1I5ZA 1XN7A 3CC2I 1P4WA 3QRFF 1K7AA 1TTYA 4PJMA 5FLXZ 3CCLI 3E7LA 4II3A 3GZ5A 3QU3A 2XSDC 1OR7C 1W0TA 2LY2A 5E3LA 2QKLB 3WTUC 1B4AA 4U88A 1UG0A 1BI2A 2FNPA 3F8MA 3KFWX 5H20A 1FOKA 3A4CA 4DBRA 1Z0XA 2A5YB 4JX5A 1K6YA 1MW7A 1UELB 2WWYA 1EA3A 2HQAA 2K3FA 2K5CA 3TO9A 2BYVE 3V7SA 1JJ6C 3J80Z 1XGSA 4I76A 4M3DA 1T0FC 2R7DA 4XSZF 3PIPF 4IHSA 1SFOJ 2DFIA 2Q8KA 1K6OA 1QHHD 5HVQC 3E3VA 4F91B 3WGIA 1XCBA 5FLVA 1MIJA 2CSOA 2P81A 3NRVA 5LGTA 1AKHA 2XB5A 2AQEA 2OTJI 1WPKA 1WCMJ 2XAFA 4L9JA 4NBQA 3BTIA 2VODA 1QPMA 4UV8A 1K4SA 1X3WB 3CUQA 1YX3A 3KE2A 4L5EA 1IRZA 2E7XA 4XLAA 4Y17A 3SZPA 1TT0A 3BR2A 4B4CA 3WU1B 1JUMA 2LDUA 3S2DJ 1VZ0A 3GLLA 2VT3A 3PQKA 3GFIA 2HGCA 3LSTA 2EV6A 4P9UA 2GXAA 1VQNI 2Q2EB 2DJIA 4YFNF 2EFPA 3E6DA 2HZDA 1U78A 1ZK8A 1JHFA 1OCCH 4YIRX 1XSVA 4I98B 2QENA 3OYKA 1RKWA 5D5WB 1T38A 3I64A 3K4LA 5HNFA 1SFKA 2WB1A 3H1CA 1TWFJ 2ECCA 1Y1WJ 3CLOA 3CC4I 4JP0A 4XQFA 4F93B 1Y56A 4HPQA 3IKTA 5HS7A 1MH3A 4Q4ZF 4I2OA 1R22A 2Y9YA 4M3EA 3A01B 1Y0NA 1X1BA 1TW2A 2F4IA 2DT6A 5D4SA 3IL2A 2YU3A 3EUKL 3GTPJ 1D0YA 3TKYA 1XDSA 4BKXA 3A1YA 4BHPA 2OA4A 1SMTA 3CUQC 2Z33A 2NVTJ 4LG0A 1IUYA 2CRGA 2PMZA 3GBGA 2IEKA 4BDYA 3HSEA 2GOMA 3BPXA 4A3MJ 3M1CA 1K78A 3T5XA 1DPRA 2CUEA 2CH0A 4YIIA 1GVJA 1WSUA 3GTQJ 4WCGA 4BY1J 2M45A 2DOFA 3P7NA 3S32A 2BEOA 1YLFA 2OUMA 4HX4A 4M9XA 1F5TA 1P92A 4HF2A 3QAHA 1ORKA 1WJ5A 2EZLA 2E34A 1U2WA 2JWTA 2P6SA 5ICEA 5FD5A 3OYFA 1YRNA 3L2VA 2HDDA 1GXPA 3JRBA 4C2TA 2DFFA 2EJRA 3BR6A 3AKZA 1S72I 3I3LA 3G4SI 2M34A 2QBYA 3CLQA 4Q47A 1LDKB 2A6HF 2FEZA 3ERMA 3F22A 2HPMA 4IRIA 3FZVA 2V6CA 4KIFA 2JZYA 4OAYA 1R36A 1KYZA 2H6CA 5M5XJ 5J8CA 3GX4X 3DU5A 1D1AA 1FTTA 2M5WA 3M8JA 2DT7B 3DPLC 4DOZA 2LK2A 2QLZA 1I6XA 1ULYA 4B47A 1Q1HA 2QQ8A 1JKQC 1M1EB 2HDWA 2JSPA 2WAQN 3DPTA 2M0CA 1F1ZA 3M8FA 2JTVA 1I39A 1D1BA 3S2WA 2BBYA 2H27A 4RB2C 4BBSJ 5K7FA 4XLPF 2LKPA 2DA4A 3F72A 4IHXA 4ENMA 3HUGB 1TNSA 3R61A 2LMDA 2HI3A 4LOCA 5CVUA 5DCFA 3GTKJ 2VC1A 1VQ4I 1R5HA 4A0ZA 2R93J 3CF2A 2FXAA 1F4KA 5E79C 4UHTA 3FF5A 4M6XA 3MFKA 3TP3A 4AYBN 1NG7A 2FE3A 2IGNA 2HQNA 4A3GJ 5FKNA 3CZ6A 5ICCA 2RGVA 1IUFA 2CG4A 2A69F 1BOAA 4C2UA 3GLXA 2LNBA 1LNWA 3OIQA 3REOA 2EILH 1QBJA 2CMPA 2WAQA 1LE8B 3LQRA 3I59A 4L9TA 3I4MJ 2KZGA 3U9GA 2K3PA 1QRYA 2XGDA 2K40A 1ONVA 4A6EA 2ZMEA 5AIPA 1JE8A 1OQYA 2VPLA 4II2A 5D8KB 3M9AA 5FD6A 2MBFA 1Y8QB 1T6SA 3D5RC 3L2QA 3C2GA 3R0JA 3JRFA 2HPIA 3EUHA 2LLKA 4IZZA 3OSFA 2Q1ZB 2KPMA 4ENNA 4AVPA 2E1OA 3U1DA 3DF8A 3F23A 2JA2A 1H88C 1TWHJ 2DAOA 3LMMA 1Y39A 1ZRDA 3OWTA 3G73A 1P9QC 4IEJA 3R6SA 3W2VA 4BH9A 4Y3OA 1XGMA 4EM2A 2DXIA 2ISZA 3HB9A 2O03A 3GF2A 4BE0A 1MNEA 2X85A 4P5OA 1B1BA 3CCYA 2BY1A 2F5EA 2HTJA 1WVRA 1WQ2A 1KQ8A 3O8HA 2PX9A 1BC7C 3RQ4A 2CFXA 2G9WA 1RNLA 3CUQB 4MQVA 4V2FA 1BN5A 2ID6A 2MABA 1I3QJ 5E8IA 2OTLI 2XRLA 5F0CA 3SHFA 5CLSA 3L00A 1R4MB 3FXKA 5L3DA 1XC5A 5HLGA 4BQOA 2DPUA 4YRVA 2KKOA 3JRAA 5B3SH 3OIOA 4UXNA 5M3MJ 2R5ZA 1Z3XA 2CW0F 3FMSA 2NVQJ 2O5RA 3KLOA 4BU2A 1RUOA 4B43A 3GFJA 3ZGKA 1B72A 1HSJA 3FMRA 2L7ZA 2VKHA 1W0UA 1T08B 1USSA 4QPQA 4L0YB 1PP8F 1MKMA 4CCOA 2QZ8A 4ON0A 3CCJI 3WGGA 5LGUA 3VEPA 3PO2J 2WBMA 5DM6F 4HNTA 2F5DA 4CCLA 1YRNB 3P5JA 1T98A 4ESBA 2CQXA 2DA1A 4ZC3A 3HTSB 4FQGA 1QHGA 2V9PA 3NAUA 2L9NA 1L0OC 3F3XA 5JLWA 3L2WA 2BHYA 5K5QA 2DOEA 3GEZA 4DYRA 2WA0A 5LD2C 4BAYA 5HS9A 4OMZA 4G7ZF 4XLCA 1ETWA 1CQTA 1IJWC 2DYRH 3DLLF 4UUSA 1OFCX 1YX5A 2CUJA 2V9VA 3L09A 1MD0A 3JSOA 3QPHA 1F36A 2BE5F 2V26A 4P96A 3ZQIA 3MAJA 4G94A 1LFBA 2DA3A 4XONA 3SXYA 3S3OA 1FYMA 2JRMA 1VQLI 1FP2A 4NC8A 1A6QA 4DIQA 3TQNA 3AG2H 2RQQA 3DU6A 4RB3C 3RI4A 1VQKI 2GXBA 3J7AO 3NEUA 3PNTA 2DLLA 4M74A 3WTYC 2HXIA 5FFXA 3K1MA 1T8IA 2L9SA 2ZXIA 4NC6A 4E7LA 3PNVA 3UNGC 3MKLA 1S29A 1MZBA 2YX4A 5D5VB 4ZZLA 1FIAA 1X3UA 1DUXC 4MQ9F 2YU9J 1ACIA 2FF4A 2R7FA 3CCRI 4QIWN 3MCZA 1IG7A 4DW6A 4OIOF 1KQ0A 4YG2F 4CH7A 3VOEA 3PFYA 4P9FA 1KU3A 4LD5A 2F2EA 1MBGA 4A3FJ 1SFUA 3V7CA 3KEQA 1GVDA 3JRDA 4MGRA 2LOOA 2K9NA 1HQCA 2JA6J 1HW2A 3HGYA 3K1NA 2HFHA 3QOEA 1GV2A 1DGRM 4DZPA 3F9KA 3RKYA 1X1CA 3K7AJ 3S17J 2K27A 3BG6A 2EINH 5DEQA 3UR3C 3JTGA 1K61A 3VSKA 3O2PE 2JT1A 1SFXA 1XS9A 4A3LJ 4EGZA 1H89C 2HWVA 4Y7NJ 2BY3A 4HYEA 2ID3A 4PGHA 3C2BA 3MMYB 3PJRA 2RN7A 3KP6A 1T2KA 1Y6IA 1D5YA 4G6TB 2ZNZA 5FROA 1CF7B 2V1NA 3S15J 2YR2A 3H3VK 3X2QH 1SFEA 9ANTA 4XKVA 3BG3A 5B5EC 3ABMH 2KJBA 4HX8A 1LVAA 3QPTA 2NOJB 2X4HA 2XGXA 4V2GA 2ZJPF 1LDJA 4K2EA 1IF1A 4HG2A 3DV8A 5GP9A 4KISA 3GTJJ 4IVNA 1ETYA 1H0MA 2DTZA 4WXDA 4L5JA 5CKTA 5J1RA 2ECBA 2LYCA 2LTPA 1JKPC 2AHQA 5DD4A 3GTLJ 4FHTA 2WV1A 1KA8A 2IGMA 3E1SA 1VTNC 3BZKA 1OCOH 4N9HA 4J01A 3DBRB 1I6HJ 4PJ0C 5DUIA 4UVBA 3FHZA 3F6OA 1CF7A 2GAUA 4UNOA 3C18A 2KHMA 2IVMA 4RAFA 1T39A 2HOSA 2IJLA 3HRUA 1DU6A 5ILSA 3BCBA 2DQRA 3ROUA 3PSFA 4F7ZA 5LBQA 2E7WA 4BJ6C 3FM3A 2R5YB 2P7CB 4UUVA 4KJZA 3CTAA 4XRFA 2EWNA 4UUTA 2Y30A 4BQNA 2D1HA 3E5UA 1X3ZB 2CUZA 4YFXF 3H0GJ 4PDKA 3E0JB 5AIQA 3KZYA 1XSDA 4DJAA 1EH8A 2JSCA 2FBKA 2ZBKA 3E6MA 2FQ3A 2X6XA 3BG9A 1QGPA 4KIGA 2VLAA 2QKMB 3LSIA 2JPCA 1ZARA 1G2HA 1TW3A 1UMQA 2LKSA 3V8KA 3CCSI 3SFIA 4BL0B 1HKTA 2ZJQF 1E17A 3SYTA 4N4NB 1T56A 1GV5A 1Z05A 2D5VA 2CQ7A 2L7FP 1NH3A 2L5QA 3T8RA 5EDNA 5EG0A 4BE1A 4XMYA 2V7FA 3FBNB 2ZCWA 2XAQA 3MEXA 3SEZA 2KFDA 3AG3H 1WHUA 2VOOA 1XD7A 4A93J 3DQVC 5GADJ 3OSGA 4G6DA 2H1LA 1A36A 1J59A 1FC3A 4HLYA 1XMKA 2YSRA 1FPQA 2E36A 4F3QA 4OIQF 3S1NJ 1OKRA 4EJVA 4FTHA 1KU7A 1ETKA 1Z67A 3PIOF 2HVRA 4M9ZA 1N77A 3M7GA 5ICGA 3V8LA 4D7NA 4XK4A 3ZXSA 4E7ZA 1QZZA 1OCRH 2MH9A 1K78B 2XAHA 3QODA 2GXGA 1NTCA 2XSJC 1V5FA 5GTIC 4U7BA 3E6CC 1LQ1A 1WJDA 3DEEA 2V79A 3FMQA 5EYRA 3C7JA 3LOCA 3HHGA 5C44J 1ZG1A 5K7ZA 1W36D 2ZMEB 3IH4A 5DTDA 5M3FJ 4BXXJ 5KAFC 1MBFA 1ETOA 3AFHA 1AWCA 2STWA 2YX7A 3ELKA 2XUBA 2ISYA 2LBFA 4XR6A 4M6VA 5CJ9A 5JR3A 4S04A 5L3CA 3VYRB 4MTEA 3JRIA 4IHVA 3KX2A 2CQQA 1SVOA 1YIJI 2EZHA 4A3DJ 1QU3A 2P7VB 2O3FA 3TMOA 4IX7A 2XHKA 2DMPA 2DFEA 1TP4A 2O9LA 1Z3YA 3DCFA 4U87A 4EJTA 3K70D 4IPAA 2O8KA 2QWWA 3JREA 1S6LA 2LY9A 2DPDA 3RTRA 2MC3A 4AWXB 2XF7A 2PMZN 5F0FA 3EPZA 3ESWB 1D8KA 1G3SA 1B8IB 3OYBA 3NQOA 2R3SA 2BW3A 3FBIB 1SAXA 4LMYA 2D1VA 3PFIA 4PCQA 1YYVA 2JA5J 5C4JJ 1D1CA 2JVGA 4UB6C 4JK1X 5TGTA 4FX0A 3HOTA 3BR5A 4RAGA 2A5WA 2HVQA 3KCCA 2L9RA 3WTVC 2L0KA 3C1DA 4XL9A 5EJCA 2EV5A 2CV2A 3N05A 3F6VA 3WTXC 4M72A 5HS8A 2X1DA 2IS4A 3CJQB 3SFZA 2WY8Q 4HNVA 5J1YA 2XASA 3CC7I 3S3MA 4E7JA 2R7SA 4UY8I 1B59A 4HSRA 3G6EI 4D7MA 3K2AA 2HOTA 3HJEA 5FRNA 2BXZA 2YPRA 5JHFA 4DGWB 1XGNA 3BR1A 2V9KA 2ME6A 1XPXA 2GIZA 2LY1A 2WV0A 3IUOA 2VBXA 4KUMA 1HXDA 3L1PA 4EATA 3H0DA 2E60A 2KRFA 1O4XA 4UVAA 3H35A 2QQAA 3NARA 1TQPA 1EJ9A 1BIAA 1MJBA 3F21A 1YJWI 2GOXB 4CSWA 1W1WE 2OQGA 2HKXA 3FX3A 3GXOA 3MD2A 4C30A 2LKXA 3Q3SA 1RI7A 1A35A 3BZ6A 3LA7A 3PM1A 4I01A 2JJ7A 1IV8A 1PUFB 1NG6A 4D1QA 2O61A 3W2AA 2RVCA 2W48A 1G4DA 4NDLA 3K6GA 2EFWA 4BJ5C 3EYIA 4JX6A 3EYYA 4GO1A 3OYMA 1REPC 4A6DA 2R7QA 4MTDA 2HVSA 4EQQA 2J5PA 5BNGA 1FLIA 2FUG2 2HXOA 4ABZA 1JUPA 4PUSA 5EEHA 2JA7J 2FOWA 3RPUA 3VODA 4HX7A 5M5YJ 1PVEA 3K4MA 3OR1C 4CICA 2QUFA 5CQGA 2OAZA 3Q0VA 3C3WA 3U2RA 3I56I 3R4KA 1YE9A 3AG4H 3OYCA 1O3SA 2GIVA 1ZGWA 1A04A 2F4OB 4EV0A 3W2WA 3TBIA 1TL8A 1MJ9A 2K9LA 2MYSA 4PZJA 1VQPI 1XMAA 2LBFB 3H36A 3ZMSA 3H9QA 1ZGAA 3F8FA 1X19A 3F8NA 1E3OC 2Z1DA 2TDXA 1I1SA 2PEXA 3B02A 1HKQA 3IH3A 4KA4A 3PNYA 1YFHA 3A01A 4AIKA 3FXQA 4HSTA 1MNDA 2BV6A 2AXLA 2OV7A 4IHYA 1MDMB 2MA3A 1MDMA 3OYGA 1SMYF 2R7RA 2L4MA 1V4RA 3K70C 4X1EA 4ZTFA 1TWAJ 3M4OJ 1SC7A 3R60A 4Y33A 4DNCA 2NNNA 5JHUA 5HLIA 3DBLB 3CD6I 4LK1F 3GTMJ 5BOXA 3H3UA 4CCNA 1D5VA 2DOAA 5E1WA 4HA8A 4LIUA 5H6RA 1IN7A 4OIRF 4WWCA 2VXZA 3L7WA 4EM0B 3KEOA 2JUCA 4CO8A 1VQ8I 4KMFA 4V19K 1IC8A 4A3JJ 3HRTA 3MVPA 1IXRC 2FSWA 3ABKH 3FIWA 4C3IJ 2ELHA 2H94A 1I1GA 2E1MB 4BDZA 2JRTA 2A05A 4MIMA 1YI2I 2F6CA 3FXOA 4A3CJ 2VB6A 2K4BA 3U1KA 3LSKA 4B3XA 4A5MA 2M8GX 4AD9A 2QBYB 4KYWA 3V8JA 3KYCB 4E7SA 3ABTA 4GGGA 2NS8A 1KONA 1RR7A 3KP4A 1U9NA 2EBIA 3TDZC 3VYTB 4G12A 1RR8C 5HDKA 4GDFA 1Z91A 4O6JA 5FKLA 1FBUA 1OYWA 3UKGA 2M4GA 5IYDJ 1G6NA 4IHTA 1IRGA 2IGKA 2RREA 4PSWA 2BZTA 4YEJA 5BMZA 3PQJA 5F6FA 4CYCB 3ZRGA 1IAWA 1H9TA 2DDAA 3H5AA 3KZZA 3RJPA 2HYFA 1WI3A 2DCEA 3HOWJ 1ZRFA 2HS5A 2VXDA 3BT9A 5J1UA 4MHGA 5D4RA 5CVJA 4JYKA 2H8RA 2EFNA 2QQBA 1P4AA 4LFUA 1ZR2A 3EDPA 5BS6A 1BL0A 2DT5A 3S1RJ 2R5YA 2F4MB 2OJED 1R71A 1RKTA 4P1WA 3HPHA 2EA4A 1LDDA 2X6WA 2XC7A 1OMIA 2OU2A 4IKFA 2UUZA 3D0SA 5EZHA 4IRGA 1ZLJA 2X1CA 5HNHA 3OL4A 1LEBA 3OYLA 2TRTA 2OD5A 4CYCA 2MW8A 1MMNA 5IT3A 2CQNA 1G59A 5J40A 1T33A 2LH9A 4ZYGA 2O8XA 2Z5UA 2VI6A 3IH2A 4A5NA 5LFAA 1O57A 3HKZN 1YTYA 4JX4A 2WB1N 3ECOA 4Z2YA 2MLGA 2W00A 3ONQA 2RC4A 4ANJA 1FWZA 5LEJA 3QYBA 2KDOA 3NWSA 4XN0A 2GWRA 4U7DA 2NNYA 2R7VA 1FZPB 1ZHFA 2KMUA 1HKSA 2IA2A 2ZJ2A 4G6QA 3I0TA 3FXRA 1R4NB 2QQ9A 3LFKA 3JAMZ 3DEWA 5E1XA 4DZJA 1LFUP 1X4OA 3SZGA 1U5TA 2FMLA 5K1YA 4RM3A 5F1RA 3TO7A 5FGMA 2MC4A 2UZKA 3HYIA 3QQAA 4Y15A 2IXSA 2M7BA 1R00A 3H5NA 4RGUA 2VASA 3H5RA 1HC8A 4KN4X 2AQFA 3ZOBA 3J7YJ 3DP7A 2BXYA 1TT5B 2FOKA 2B7EA 2ME0A 2BOLA 5FRMA 3ZQ7A 1C0WA 1X2NA 4GYGA 4E7KA 2DMTA 2XAUA 4HEA2 4X0GA 1IGNA 5LRSA 5IPAA 1SANA 3P9CA 4GRIA 3T0YA 1YG2A 2KISA 1IDYA 2CU7A 1I3AA 1GHCA 3M3YJ 2ZKZA 1F43A 1VF9A 1KZHA 4F92B 2FRHA 1WJCA 1LKXA 1Z7UA 2X51A 4HW0A 2Y0SN 3BTLA 4IO9F 4R79A 1BC8C 2P4WA 2DTRA 3ISPA 1Z7LA 3CQZJ 1T95A 1L3LA 2HR3A 1ZTRA 3I5UA 1MBJA 3OL3A 2OBPA 4B48A 5K5RA 3JW4A 2CQKA 1ZN2A 2COBA 4KITB 3IV5A 1HDDC 3AG1H 4I02A 3IAM2 3HRMA 4D9JA 2BY0A 4OAZA 1WJBA 4DYCA 4IF4A 1BJZA 3ZN0A 2P8TA 4ZDLA 3S16J 1ZR4A 2PJPA 3EETA 2FX0A 4BBRJ 2XKPA 2H6BA 2GA2A 5LEKA 5GAHJ 1ZQ3P 1FY7A 5TRDA 3IAS2 3O8GA 4XKBA 3JRGA 2CGPA 4IQJA 4NB5A 3WE3A 1ON1A 1QZYA 4IJAA 3CCEI 2CFOA 3EUHC 1H9GA 1UB9A 2DMQA 2JN6A 3I9V2 2XPWA 2I5UA 3BY6A 2DK5A 3KP2A 3JRCA 4QWQA 2V6EA 3DTEA 1D0XA 3EQLF 1OYYA 4ZYDA 2Z16A 1VI0A 2HNHA 1U5TC 5E3MA 4LIVA 1HBXG 2GBYA 3BR0A 1RC9A 3C2HA 3FK7A 3D1NI 4LG3A 4FASD 2ZFWA 3G1LA 3QWLA 2DK8A 2IAIA 4NNJA 1ZYRF 4UVCA 3I55I 2LD5A 1UZCA 3ZMTA 5LGNA 2ZXWH 1DU0A 3JSPA 4L9NA 1FT9A 1TWCJ 4XSXF 3MKZA 2UWMA 4RAZA 1IRXA 2XGCA 3A03A 4ZZDA 2CW7A 1WRJA 1SD4A 2KIMA 4NHJA 5BPIA 3W3CA 3QYFA 4LLLA 1MSEC 2VKDA 1RESA 2MSYA 3CJRB 4A3KJ 1IV6A 1P7JA 2KQRA 4RGSA 2O0YA 1XB4A 1EH6A 1O3RA 4TV7A 1R49A 2HU9A 2RNGA 1TLHB 3SDGA 3G3ZA 2FNAA 4U0YA 1G8XA 1V54H 3GYHX 3CDLA 1Z1DA 4Q48A 5FO5A 5B66C 2KIUA 3GCMA 3KYDB 2CWEA 2R0QC 1S7AA 4P55A 2VJJA 2V1DA 4XOPA 4ZH4F 2QSHX 2B0LA 3HSRA 5J3LA 2K02A 1APLC 1ZKGA 4WX9A 3CJTB 1QVTA 2A68F 1JGSA 1K83J 2PI0A 3RPUD 2EFQA 4RLFA 3WGHA 1OYIA 2LR8A 2ZO4A 3E5QA 4LITA 1RZ4A 4D5CA 3CO7C 1FP1D 5IOZA 3VDXA 3V42A 2IS1A 2IP2A 1HSTA 5A2QK 4EJWA 2R7ZJ 3K1PA 3BDDA 1XSXA 1CGPA 5F08A 2K86A 3ZN1A 1J5YA 4C3JJ 1F9NA 2E1NA 4XLNF 5EEAA 5FLXK 2EB7A 4M6YA 4G9YA 2W57A 1B72B 2Y75A 3D5LA 3A0BC 2K9MA 1N25A 5HODA 4XICA 2VJ5A 1V5EA 4F55A 2LG4A 2L02A 1V5GA 3DEUA 3CO6C 3VWBA 2RKHA 2R7UA 3DFGA 3LSHA 1T0FA 4PSXA 3ECHA 5JI6A 1WH5A 3DXJF 2EIKH 2BY2A 4AIDA 1FOYA 5CVVA 4HZFA 1ON2A 4ENJA 1YHQI 5E18F 4Y13A 4C3HJ 1UAAA 3Q0UA 1IO2A 1OLTA 2ADUA 1FX7A 4MO7A 2OZUA 4XLHA 2XAJA 4DYQA 2NVUB 2IW5A 2VT2A 2RAEA 1E3HA 3GFMA 3RPQA 5D6EA 5E3NA 4OOIA 2Y9ZA 3G1OA 3PUFA 3WG7H 2GZWA 1R1VA 2WTEA 3GMEA 2FJ1A 1EKEA 3RQIA 3DPUA 1MMSA 1OCTC 2DN0A 2XV4S 2M87A 1UG2A 2ETHA 1Y0UA 2LF7A 3ASOH 1ZAOA 2WC2A 3KIOA 1WI9A 3LFUA 5DYMA 5FKOA 2EQRA 3P9IA 1LVKA 1AU7A 2ZXHA 4D0PA 3TDUC 4M3GA 4RBOA 1ETQA 1R5GA 4R8HA 2H1KA 2VBYA 2EZIA 1JUSA 2E1CA 1TQMA 2K4JA 2M7AA 3BCAA 3HOXJ 5CVIA 2ZXJA 3JAMK 1MMGA 1O3QA 2D45A 3S1QJ 4I0AA 1JJ8C 4QLCU 1LPQA 2JVHA 3ZMZA 1DDNA 4XM3A 4KT5C 5JVGF 4HQEA 2Y0SA 1IN5A 4C9YA 2NRAC 3OS0A 1RETA 2ICWG 1Z6TA 3HXLA 3TGNA 3SQNA 3FXMA 1UCRA 4KT6A 4BXFA 2W85A 1XG1A 2A3SA 2RNJA 3M1EA 1ZREA 1E0EA 2LVSA
chains in the Genus database with same CATH topology
3KP5A 4L9VA 2PMUA 2EV0A 2NYXA 4EM1A 4HF1A 1R1TA 3ZMVA 1UFMA 4G8XA 2Q2EA 3IWFA 5IT9Z 1E2XA 3GFLA 5AONA 3K0LA 3LA2A 2VBZA 5LHHA 1U8RA 3RDIA 4ESFA 2NAZA 5LRRA 5ED4A 1G3YA 1V3FA 3L2CA 1UHMA 4CYDA 1U5TB 1YO5C 1G3WA 2A61A 3W6KB 5ILUA 2Y0MA 1IRFA 5ERIA 4XBFA 4KDPA 5BPDA 4RGRA 2STTA 5HOOA 1K79A 4M73A 2VOPA 1KU2A 1STZA 4O3MA 3QU6A 4MNUA 4LLGF 3K69A 3E97A 2FBHA 2JPBA 2Z99A 2GQQA 1PDNC 1Z6RA 2KJCA 1FYKA 3TOAA 2XKOA 3J81K 5A2QZ 2L54A 2Z9OA 2UXNA 2QM3A 1ZLKA 4M9SA 1FSEA 1QO0D 3KLNA 2F5CA 1BI3A 4GYIA 4HF0A 1B6AA 2IA1A 1TNTA 3ZMUA 3BP8A 5DCMB 2UXXA 3OOPA 3I59B 2LF8A 3RKWA 3KP3A 3BJOA 2L3DA 1SD7A 2FBIA 3K9TA 3RIRA 4CXFA 1GXQA 2IRFG 2PFBA 5JFRA 1P4XA 2G7UA 4RS8A 1JXSA 1EH7A 3L9FA 3COAC 1R7JA 3I54A 6PAXA 1FNNA 1BIBA 4JQFA 3ERED 1KQ9A 5HDGA 3BJ6A 2HTSA 5ILVA 3ZP5A 3HOSA 2KIFA 3ZMDA 4M71A 2F5FA 4L0ZB 1EV7A 3H92A 2M8EA 3T8TA 2FMYA 1O7FA 3MZHA 3RYRA 4GXOA 3JTHA 4KIBA 4WXHA 4RAYA 3OV8A 3QOPA 4HLXA 3QP6A 2C6YA 2MLKA 2G7HA 4GCVA 4FT8A 1YW7A 5L3GA 1PP7U 4DQ2A 5E17F 2DQLA 4CHUA 4CZZA 4LB6B 3VB2A 3ZPLA 1BI0A 2RQPA 4L5IA 1UHWA 1HW1A 1QNTA 4LG0B 2VC0A 2PBIA 3W6JB 5L3BA 4Q5SF 3MWMA 3ABUA 3WG9A 4LJZF 1ZH5A 2OZ6A 1YS6A 3R0AA 4UV9A 5KVRA 1J7KA 5J6XA 1MJAA 4L18B 2HYGD 4ENKA 1O7LA 4U0WA 2L4AA 1W7PA 4WK8F 2QVOA 3RKXA 3BPVA 3BOQA 4AIHA 2PN6A 2LSOA 5D6FA 3HIFA 1ZG3A 2D2WA 4IRHA 2PQ8A 4WF2A 2W24A 4RGXA 2NS0A 2BGCA 2P5LC 2COMA 5DD8A 3F8BA 4NQWA 1QQIA 4I09A 4OINF 5LHIA 5DUKA 1D3YA 2FA5A 4LK0F 3N4MA 4OMYA 3J81Z 2IPQX 5FB2A 5D8LB 1XGOA 4AIJA 3ULQB 2MD5A 2W84A 1XCVA 5DDGA 4EGYA 2PMHA 3CUOA 4BNCA 1JHHA 5BQTA 2Y48A 1IN6A 1NHAA 4HAMA 3I53A 4I7HA 1J9IA 4HOBA 2ZNYA 2PLYA 1R1UA 4OIPF 5F64A 3WE2A 5CVRA 3BJAA 4HQMA 1RUNA 4G7OF 2V1UA 4B8XA 4G7HF 4LB5A 3GWZA 2J5OA 1LJ9A 1W5SA 5JVTA 4LLNA 2P6TA 3IRRA 4BXUA 1BJAA 5DV5A 3WODF 2DU9A 4BYYA 4U0VA 2A6EF 2ESHA 5KK1A 2EK5A 2O6GE 3TO6A 3FM5A 1FBQA 3LAPA 1B9MA 4HDVA 1WWXA 2Q0OA 3P9KA 2AS5F 1BM9A 1R23A 3IKVA 1RIOH 2ACJA 2HQRA 2CYYA 4EMSA 1W5TA 4O5VA 3GVAA 4ASNA 3H3ZA 4BHBA 2PG4A 4HDUA 1YW9A 2P5VA 4EVIA 2GA1A 4MEXF 1W7PB 1YW8A 3WTTC 3N97A 3BWGA 2VE8A 4JBAA 4PGGA 2DO7A 4ZYHA 1AOYA 4S05A 3WU0A 2DI3A 4CDGA 1W4MA 4A12A 3TOBA 4EJOA 4LGWA 3IC7A 4N0BA 2EA2A 1P6RA 4FX4A 5EEGA 3M8EA 4WXCA 4H0EA 3CJNA 1LB2A 3Q5FA 4BQAA 3Q9SA 1G3TA 4KICA 5K5OA 4HV5A 5E8GA 1FYLA 3CDHA 1DPUA 2M30A 1FBSA 4N9IA 1U6GA 3I71A 3V4GA 1ZG5A 2RV8A 3GO5A 3WTSC 4B09A 2HKOA 1J75A 4IXAA 2A07F 2L01A 2DBBA 3E6BA 4MEYF 3ML6A 1USTA 4I0BA 3HRSA 5HLHA 5L3FA 1B9NA 3T1BA 2HEOA 1ZGJA 1O3TA 1J0RA 3B73A 3HTUA 1IW7F 4ETSA 3VFZA 2XIGA 4ZYEA 1BI1A 4CGZA 4OU0A 1J2XA 1YS7A 1S8NA 5J8FA 3HUGA 3SZTA 2IA0A 1XDUA 2XRNA 1U3EM 3HHHA 4KMUX 3DKWA 2QYOA 2RDPA 2W25A 4HBLA 4BHCA 2MH2A 2P5KA 3GW2A 1TQIA 1KGSA 2CO5A 3K2ZA 3WTWC 4KFCA 1I27A 2DW4A 1IN4A 1KYWA 3KETA 4R1HA 3IRQA 5E20A 1YQAA 3GZ6A 1LEAA 3FWEA 2X0LA 3MQ0A 5CYVA 2HDCA 1S3JA 1S7OA 1ODDA 2XROA 2EFOA 3RYPA 2XAGA 3KP7A 3IHUA 3LQQA 2ESNA 3E5XA 1HW5A 5L3EA 1PUEE 1IXCA 2H09A 4A0YA 3I58A 2M1BA 1WKMA 2HOEA 2OQRA 1IN8A 3LA3A 1FSHA 4HV6A 4ESJA 5HDNA 2VE9A 1OR7A 1YIOA 3V7RA 2HZTA 3WTZA 1DP7P 3O3KA 1P2FA 1BBYA 2VBWA 5D5UB 1IZ1A 3F8CA 1IXSB 5FFZA 1SD6A 2XVCA 3J80K 5H6QA 2VONA 3IWZA 3FXUA 1D8JA 4A2UA 3Q9VA 5D5XB 5IT9K 1W7PD 3HSFA 3QP5A 1ZRCA 4E70A 2Z3YA 3MZYA 2K7LA 1TBXA 2VN2A 4EJUA 4YIFA 3LWFA 1Z9CA 2FU4A 4YFKF 4KNYA 1KU9A 4A0XA 4KN7X 3I4PA 3LAJA 1SD5A 3GUDA 2V1XA 4RB1A 4RB0A 5E1ZB 1OPCA 1R58A 2IT0A 5TJJA 5DCMA 5LLQA 3AAFA 1MGTA 3O6BB 5ICFA 5LHGA 3BROA 1I5ZA 1XN7A 3QRFF 1P4WA 1K7AA 1TTYA 5FLXZ 3GZ5A 3QU3A 3WTUC 1B4AA 4U88A 1BI2A 2FNPA 3F8MA 3KFWX 5H20A 1FOKA 2A5YB 2WWYA 3TO9A 2BYVE 3V7SA 3J80Z 1XGSA 4XSZF 2R7DA 4IHSA 2DFIA 2Q8KA 1K6OA 5HVQC 3E3VA 3WGIA 1XCBA 3NRVA 2CSOA 5LGTA 2XAFA 4L9JA 2VODA 1QPMA 4UV8A 3CUQA 3KE2A 2E7XA 4Y17A 3SZPA 3WU1B 2LDUA 2VT3A 3PQKA 3GFIA 2HGCA 3LSTA 2EV6A 4P9UA 4YFNF 2EFPA 3E6DA 1U78A 1JHFA 1XSVA 4I98B 2QENA 1T38A 5D5WB 3I64A 3CLOA 3IKTA 5HS7A 4Q4ZF 4I2OA 1R22A 1TW2A 5D4SA 3IL2A 2YU3A 3TKYA 1XDSA 4BHPA 2OA4A 1SMTA 3CUQC 2Z33A 4LG0A 1IUYA 3HSEA 3BPXA 1K78A 3T5XA 1DPRA 4YIIA 1GVJA 1WSUA 4WCGA 2M45A 3P7NA 2BEOA 1YLFA 4HX4A 4M9XA 1F5TA 1P92A 4HF2A 3QAHA 2P6SA 1U2WA 5ICEA 5FD5A 1GXPA 2EJRA 2QBYA 4Q47A 1LDKB 2A6HF 2FEZA 3F22A 4IRIA 3FZVA 2V6CA 4KIFA 2JZYA 1R36A 1KYZA 2H6CA 3GX4X 5J8CA 2M5WA 3DPLC 2QLZA 1I6XA 1ULYA 1Q1HA 3DPTA 1F1ZA 3M8FA 2JTVA 3S2WA 2BBYA 2H27A 4RB2C 4XLPF 2LKPA 3F72A 4ENMA 1TNSA 3R61A 5CVUA 5DCFA 2VC1A 1R5HA 4A0ZA 2FXAA 1F4KA 4UHTA 3FF5A 4M6XA 3MFKA 2FE3A 2HQNA 5ICCA 2RGVA 2CG4A 2A69F 1BOAA 3GLXA 2LNBA 1LNWA 3REOA 1QBJA 3LQRA 3I59A 4L9TA 3U9GA 4A6EA 1ONVA 1JE8A 2ZMEA 5AIPA 5D8KB 5FD6A 3M9AA 2MBFA 1T6SA 3R0JA 3EUHA 4ENNA 4AVPA 3U1DA 3DF8A 3F23A 2DAOA 1ZRDA 3G73A 3R6SA 4BH9A 1XGMA 4EM2A 2ISZA 2O03A 3GF2A 4P5OA 1B1BA 2F5EA 2HTJA 1WQ2A 1KQ8A 1BC7C 2G9WA 2CFXA 1RNLA 3CUQB 4MQVA 1BN5A 5E8IA 3SHFA 5CLSA 3L00A 5L3DA 5HLGA 2DPUA 2KKOA 4UXNA 2CW0F 3FMSA 3KLOA 1RUOA 3GFJA 1HSJA 3FMRA 4L0YB 1USSA 1PP8F 1MKMA 2QZ8A 4ON0A 3WGGA 5LGUA 3VEPA 2F5DA 1T98A 4ESBA 3HTSB 1L0OC 3F3XA 5K5QA 3GEZA 4BAYA 5HS9A 4OMZA 4G7ZF 2V9VA 3L09A 1MD0A 3JSOA 3QPHA 2BE5F 4P96A 3MAJA 4G94A 3SXYA 1FYMA 1FP2A 3TQNA 4RB3C 3RI4A 2GXBA 3J7AO 3NEUA 2DLLA 4M74A 3WTYC 5FFXA 3K1MA 1S29A 1MZBA 2YX4A 5D5VB 4ZZLA 1DUXC 1X3UA 4MQ9F 2FF4A 2R7FA 3MCZA 4OIOF 1KQ0A 4YG2F 3VOEA 4P9FA 1KU3A 4LD5A 2F2EA 1SFUA 3V7CA 3KEQA 4MGRA 1HQCA 1HW2A 3K1NA 2HFHA 3RKYA 2K27A 5DEQA 3JTGA 3O2PE 2JT1A 1SFXA 4EGZA 2HWVA 4HYEA 4PGHA 2RN7A 3KP6A 1T2KA 2ZNZA 1CF7B 2YR2A 1SFEA 2KJBA 4HX8A 1LVAA 3QPTA 2X4HA 2XGXA 1LDJA 4K2EA 1IF1A 3DV8A 4IVNA 1H0MA 4WXDA 4L5JA 5DD4A 4FHTA 1KA8A 1VTNC 4N9HA 5DUIA 4UVBA 3FHZA 3F6OA 1CF7A 2GAUA 4UNOA 3C18A 2IVMA 1T39A 2IJLA 3HRUA 5ILSA 2DQRA 4F7ZA 3ROUA 5LBQA 2E7WA 3FM3A 2P7CB 4UUVA 3CTAA 4XRFA 2EWNA 2D1HA 3E5UA 4YFXF 4PDKA 5AIQA 3KZYA 1XSDA 1EH8A 2JSCA 2FBKA 2ZBKA 3E6MA 2FQ3A 1QGPA 4KIGA 2JPCA 1ZARA 1TW3A 3V8KA 1HKTA 1E17A 1Z05A 3T8RA 2ZCWA 2XAQA 3MEXA 2VOOA 1XD7A 3DQVC 4G6DA 1J59A 1FC3A 4HLYA 1XMKA 2YSRA 1FPQA 4OIQF 1OKRA 4EJVA 1KU7A 4M9ZA 3M7GA 5ICGA 3V8LA 1QZZA 2MH9A 1K78B 2XAHA 2GXGA 4U7BA 3E6CC 1LQ1A 2V79A 3FMQA 3C7JA 3HHGA 1ZG1A 2ZMEB 1AWCA 2STWA 2XUBA 2YX7A 2ISYA 3ELKA 5CJ9A 5JR3A 4S04A 5L3CA 4MTEA 2P7VB 2O3FA 2XHKA 4EJTA 4IPAA 2QWWA 1S6LA 2DPDA 3RTRA 2MC3A 4AWXB 1D8KA 1G3SA 3NQOA 2R3SA 1SAXA 4LMYA 2D1VA 3PFIA 4PCQA 1YYVA 4JK1X 4FX0A 3HOTA 3KCCA 3WTVC 3C1DA 2EV5A 3F6VA 3WTXC 4M72A 5HS8A 3SFZA 2XASA 1B59A 2YPRA 1XGNA 2WV0A 2VBXA 4KUMA 1HXDA 2KRFA 4UVAA 2QQAA 1TQPA 1BIAA 1MJBA 3F21A 2OQGA 2HKXA 3FX3A 3GXOA 1RI7A 3BZ6A 3LA7A 4I01A 2O61A 2RVCA 1G4DA 2EFWA 3EYIA 1REPC 3EYYA 4GO1A 4A6DA 4MTDA 4EQQA 2J5PA 1FLIA 5EEHA 3RPUA 3VODA 4HX7A 4CICA 2QUFA 2OAZA 3C3WA 3U2RA 3R4KA 1O3SA 2GIVA 1A04A 4EV0A 1MJ9A 4PZJA 1XMAA 3ZMSA 1ZGAA 3F8FA 3F8NA 2TDXA 1I1SA 2PEXA 3B02A 1HKQA 4KA4A 1YFHA 4AIKA 3FXQA 2BV6A 2AXLA 1MDMB 2MA3A 1MDMA 1SMYF 2L4MA 1V4RA 3R60A 4DNCA 2NNNA 5JHUA 5HLIA 4LK1F 5BOXA 3H3UA 1D5VA 5E1WA 4HA8A 5H6RA 1IN7A 4OIRF 4WWCA 2VXZA 3L7WA 4EM0B 3KEOA 4KMFA 4CO8A 3HRTA 1IXRC 2FSWA 2ELHA 2H94A 1I1GA 2JRTA 2K4BA 4A5MA 4KYWA 4AD9A 2QBYB 3V8JA 3ABTA 4GGGA 3KP4A 3TDZC 5HDKA 1Z91A 4O6JA 1FBUA 1OYWA 1G6NA 4IHTA 1IRGA 5BMZA 3PQJA 5F6FA 1IAWA 1H9TA 3KZZA 3RJPA 2HYFA 1ZRFA 2HS5A 4MHGA 5D4RA 5CVJA 2EFNA 2QQBA 1P4AA 4LFUA 3EDPA 5BS6A 2DT5A 2EA4A 1LDDA 1OMIA 2OU2A 3D0SA 4IRGA 1ZLJA 1LEBA 2OD5A 5IT3A 4ZYGA 2O8XA 2Z5UA 4A5NA 1O57A 1YTYA 3ECOA 4Z2YA 2MLGA 2RC4A 1FWZA 5LEJA 4U7DA 2GWRA 2NNYA 1FZPB 1ZHFA 1HKSA 2IA2A 2ZJ2A 4G6QA 3I0TA 3FXRA 2QQ9A 3LFKA 3JAMZ 5E1XA 1U5TA 2FMLA 5K1YA 5F1RA 3TO7A 5FGMA 2UZKA 3HYIA 4Y15A 1R00A 4RGUA 4KN4X 3DP7A 2FOKA 3ZQ7A 1C0WA 4GYGA 5LRSA 3P9CA 3T0YA 1YG2A 1GHCA 2ZKZA 2FRHA 1Z7UA 4HW0A 4R79A 1BC8C 2P4WA 2DTRA 3ISPA 1L3LA 2HR3A 3I5UA 2OBPA 5K5RA 3JW4A 2CQKA 1ZN2A 4I02A 3HRMA 4IF4A 3ZN0A 2P8TA 2PJPA 3EETA 2XKPA 2H6BA 2GA2A 5LEKA 1FY7A 5TRDA 2CGPA 3WE3A 4NB5A 1ON1A 1QZYA 4IJAA 1H9GA 1UB9A 3BY6A 2DK5A 3KP2A 4QWQA 4ZYDA 1OYYA 3EQLF 1U5TC 1HBXG 2ZFWA 2DK8A 1ZYRF 4UVCA 3ZMTA 5LGNA 3JSPA 4L9NA 1FT9A 4XSXF 2UWMA 4RAZA 4ZZDA 1WRJA 1SD4A 2KIMA 4NHJA 5BPIA 4LLLA 4RGSA 2O0YA 1XB4A 1EH6A 1O3RA 4TV7A 1TLHB 3G3ZA 2FNAA 4U0YA 3GYHX 1Z1DA 4Q48A 5FO5A 2KIUA 2CWEA 1S7AA 4P55A 2V1DA 4ZH4F 2B0LA 3HSRA 2K02A 4WX9A 2A68F 1JGSA 2PI0A 2EFQA 3WGHA 1OYIA 2ZO4A 3E5QA 1RZ4A 3CO7C 1FP1D 2IP2A 1HSTA 5A2QK 4EJWA 3K1PA 3BDDA 1XSXA 1CGPA 2K86A 3ZN1A 1J5YA 1F9NA 2E1NA 4XLNF 5FLXK 2EB7A 4M6YA 4G9YA 2W57A 2Y75A 3D5LA 2L02A 3DEUA 3CO6C 2RKHA 3DFGA 1T0FA 3ECHA 5JI6A 3DXJF 5CVVA 4HZFA 1ON2A 4ENJA 5E18F 4Y13A 2ADUA 1FX7A 2OZUA 2XAJA 2IW5A 2VT2A 3GFMA 3RPQA 5D6EA 4OOIA 2GZWA 1R1VA 2WTEA 2XV4S 2M87A 2ETHA 1Y0UA 2LF7A 1ZAOA 2WC2A 1WI9A 5DYMA 3P9IA 4D0PA 3TDUC 1R5GA 4R8HA 2VBYA 2E1CA 1TQMA 2K4JA 5CVIA 2ZXJA 3JAMK 1O3QA 2D45A 4I0AA 4QLCU 3ZMZA 1DDNA 4KT5C 4HQEA 1IN5A 2NRAC 1Z6TA 3TGNA 3SQNA 1UCRA 2W85A 3M1EA 2A3SA 2RNJA 1ZREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP5 A;  4L9V A;  2PMU A;  2EV0 A;  2NYX A;  4EM1 A;  4HF1 A;  1R1T A;  3ZMV A;  1UFM A;  4G8X A;  2Q2E A;  3IWF A;  5IT9 Z;  1E2X A;  3GFL A;  5AON A;  3K0L A;  3LA2 A;  2VBZ A;  5LHH A;  1U8R A;  3RDI A;  4ESF A;  2NAZ A;  5LRR A;  5ED4 A;  1G3Y A;  1V3F A;  3L2C A;  1UHM A;  4CYD A;  1U5T B;  1YO5 C;  1G3W A;  2A61 A;  3W6K B;  5ILU A;  2Y0M A;  1IRF A;  5ERI A;  4XBF A;  4KDP A;  5BPD A;  4RGR A;  2STT A;  5HOO A;  1K79 A;  4M73 A;  2VOP A;  1KU2 A;  1STZ A;  4O3M A;  3QU6 A;  4MNU A;  4LLG F;  3K69 A;  3E97 A;  2FBH A;  2JPB A;  2Z99 A;  2GQQ A;  1PDN C;  1Z6R A;  2KJC A;  1FYK A;  3TOA A;  2XKO A;  3J81 K;  5A2Q Z;  2L54 A;  2Z9O A;  2UXN A;  2QM3 A;  1ZLK A;  4M9S A;  1FSE A;  1QO0 D;  3KLN A;  2F5C A;  1BI3 A;  4GYI A;  4HF0 A;  1B6A A;  2IA1 A;  1TNT A;  3ZMU A;  3BP8 A;  5DCM B;  2UXX A;  3OOP A;  3I59 B;  2LF8 A;  3RKW A;  3KP3 A;  3BJO A;  2L3D A;  1SD7 A;  2FBI A;  3K9T A;  3RIR A;  4CXF A;  1GXQ A;  2IRF G;  2PFB A;  5JFR A;  1P4X A;  2G7U A;  4RS8 A;  1JXS A;  1EH7 A;  3L9F A;  3COA C;  1R7J A;  3I54 A;  6PAX A;  1FNN A;  1BIB A;  4JQF A;  3ERE D;  1KQ9 A;  5HDG A;  3BJ6 A;  2HTS A;  5ILV A;  3ZP5 A;  3HOS A;  2KIF A;  3ZMD A;  4M71 A;  2F5F A;  4L0Z B;  1EV7 A;  3H92 A;  2M8E A;  3T8T A;  2FMY A;  1O7F A;  3MZH A;  3RYR A;  4GXO A;  3JTH A;  4KIB A;  4WXH A;  4RAY A;  3OV8 A;  3QOP A;  4HLX A;  3QP6 A;  2C6Y A;  2MLK A;  2G7H A;  4GCV A;  4FT8 A;  1YW7 A;  5L3G A;  1PP7 U;  4DQ2 A;  5E17 F;  2DQL A;  4CHU A;  4CZZ A;  4LB6 B;  3VB2 A;  3ZPL A;  1BI0 A;  2RQP A;  4L5I A;  1UHW A;  1HW1 A;  1QNT A;  4LG0 B;  2VC0 A;  2PBI A;  3W6J B;  5L3B A;  4Q5S F;  3MWM A;  3ABU A;  3WG9 A;  4LJZ F;  1ZH5 A;  2OZ6 A;  1YS6 A;  3R0A A;  4UV9 A;  5KVR A;  1J7K A;  5J6X A;  1MJA A;  4L18 B;  2HYG D;  4ENK A;  1O7L A;  4U0W A;  2L4A A;  1W7P A;  4WK8 F;  2QVO A;  3RKX A;  3BPV A;  3BOQ A;  4AIH A;  2PN6 A;  2LSO A;  5D6F A;  3HIF A;  1ZG3 A;  2D2W A;  4IRH A;  2PQ8 A;  4WF2 A;  2W24 A;  4RGX A;  2NS0 A;  2BGC A;  2P5L C;  2COM A;  5DD8 A;  3F8B A;  4NQW A;  1QQI A;  4I09 A;  4OIN F;  5LHI A;  5DUK A;  1D3Y A;  2FA5 A;  4LK0 F;  3N4M A;  4OMY A;  3J81 Z;  2IPQ X;  5FB2 A;  5D8L B;  1XGO A;  4AIJ A;  3ULQ B;  2MD5 A;  2W84 A;  1XCV A;  5DDG A;  4EGY A;  2PMH A;  3CUO A;  4BNC A;  1JHH A;  5BQT A;  2Y48 A;  1IN6 A;  1NHA A;  4HAM A;  3I53 A;  4I7H A;  1J9I A;  4HOB A;  2ZNY A;  2PLY A;  1R1U A;  4OIP F;  5F64 A;  3WE2 A;  5CVR A;  3BJA A;  4HQM A;  1RUN A;  4G7O F;  2V1U A;  4B8X A;  4G7H F;  4LB5 A;  3GWZ A;  2J5O A;  1LJ9 A;  1W5S A;  5JVT A;  4LLN A;  2P6T A;  3IRR A;  4BXU A;  1BJA A;  5DV5 A;  3WOD F;  2DU9 A;  4BYY A;  4U0V A;  2A6E F;  2ESH A;  5KK1 A;  2EK5 A;  2O6G E;  3TO6 A;  3FM5 A;  1FBQ A;  3LAP A;  1B9M A;  4HDV A;  1WWX A;  2Q0O A;  3P9K A;  2AS5 F;  1BM9 A;  1R23 A;  3IKV A;  1RIO H;  2ACJ A;  2HQR A;  2CYY A;  4EMS A;  1W5T A;  4O5V A;  3GVA A;  4ASN A;  3H3Z A;  4BHB A;  2PG4 A;  4HDU A;  1YW9 A;  2P5V A;  4EVI A;  2GA1 A;  4MEX F;  1W7P B;  1YW8 A;  3WTT C;  3N97 A;  3BWG A;  2VE8 A;  4JBA A;  4PGG A;  2DO7 A;  4ZYH A;  1AOY A;  4S05 A;  3WU0 A;  2DI3 A;  4CDG A;  1W4M A;  4A12 A;  3TOB A;  4EJO A;  4LGW A;  3IC7 A;  4N0B A;  2EA2 A;  1P6R A;  4FX4 A;  5EEG A;  3M8E A;  4WXC A;  4H0E A;  3CJN A;  1LB2 A;  3Q5F A;  4BQA A;  3Q9S A;  1G3T A;  4KIC A;  5K5O A;  4HV5 A;  5E8G A;  1FYL A;  3CDH A;  1DPU A;  2M30 A;  1FBS A;  4N9I A;  1U6G A;  3I71 A;  3V4G A;  1ZG5 A;  2RV8 A;  3GO5 A;  3WTS C;  4B09 A;  2HKO A;  1J75 A;  4IXA A;  2A07 F;  2L01 A;  2DBB A;  3E6B A;  4MEY F;  3ML6 A;  1UST A;  4I0B A;  3HRS A;  5HLH A;  5L3F A;  1B9N A;  3T1B A;  2HEO A;  1ZGJ A;  1O3T A;  1J0R A;  3B73 A;  3HTU A;  1IW7 F;  4ETS A;  3VFZ A;  2XIG A;  4ZYE A;  1BI1 A;  4CGZ A;  4OU0 A;  1J2X A;  1YS7 A;  1S8N A;  5J8F A;  3HUG A;  3SZT A;  2IA0 A;  1XDU A;  2XRN A;  1U3E M;  3HHH A;  4KMU X;  3DKW A;  2QYO A;  2RDP A;  2W25 A;  4HBL A;  4BHC A;  2MH2 A;  2P5K A;  3GW2 A;  1TQI A;  1KGS A;  2CO5 A;  3K2Z A;  3WTW C;  4KFC A;  1I27 A;  2DW4 A;  1IN4 A;  1KYW A;  3KET A;  4R1H A;  3IRQ A;  5E20 A;  1YQA A;  3GZ6 A;  1LEA A;  3FWE A;  2X0L A;  3MQ0 A;  5CYV A;  2HDC A;  1S3J A;  1S7O A;  1ODD A;  2XRO A;  2EFO A;  3RYP A;  2XAG A;  3KP7 A;  3IHU A;  3LQQ A;  2ESN A;  3E5X A;  1HW5 A;  5L3E A;  1PUE E;  1IXC A;  2H09 A;  4A0Y A;  3I58 A;  2M1B A;  1WKM A;  2HOE A;  2OQR A;  1IN8 A;  3LA3 A;  1FSH A;  4HV6 A;  4ESJ A;  5HDN A;  2VE9 A;  1OR7 A;  1YIO A;  3V7R A;  2HZT A;  3WTZ A;  1DP7 P;  3O3K A;  1P2F A;  1BBY A;  2VBW A;  5D5U B;  1IZ1 A;  3F8C A;  1IXS B;  5FFZ A;  1SD6 A;  2XVC A;  3J80 K;  5H6Q A;  2VON A;  3IWZ A;  3FXU A;  1D8J A;  4A2U A;  3Q9V A;  5D5X B;  5IT9 K;  1W7P D;  3HSF A;  3QP5 A;  1ZRC A;  4E70 A;  2Z3Y A;  3MZY A;  2K7L A;  1TBX A;  2VN2 A;  4EJU A;  4YIF A;  3LWF A;  1Z9C A;  2FU4 A;  4YFK F;  4KNY A;  1KU9 A;  4A0X A;  4KN7 X;  3I4P A;  3LAJ A;  1SD5 A;  3GUD A;  2V1X A;  4RB1 A;  4RB0 A;  5E1Z B;  1OPC A;  1R58 A;  2IT0 A;  5TJJ A;  5DCM A;  5LLQ A;  3AAF A;  1MGT A;  3O6B B;  5ICF A;  5LHG A;  3BRO A;  1I5Z A;  1XN7 A;  3QRF F;  1P4W A;  1K7A A;  1TTY A;  5FLX Z;  3GZ5 A;  3QU3 A;  3WTU C;  1B4A A;  4U88 A;  1BI2 A;  2FNP A;  3F8M A;  3KFW X;  5H20 A;  1FOK A;  2A5Y B;  2WWY A;  3TO9 A;  2BYV E;  3V7S A;  3J80 Z;  1XGS A;  4XSZ F;  2R7D A;  4IHS A;  2DFI A;  2Q8K A;  1K6O A;  5HVQ C;  3E3V A;  3WGI A;  1XCB A;  3NRV A;  2CSO A;  5LGT A;  2XAF A;  4L9J A;  2VOD A;  1QPM A;  4UV8 A;  3CUQ A;  3KE2 A;  2E7X A;  4Y17 A;  3SZP A;  3WU1 B;  2LDU A;  2VT3 A;  3PQK A;  3GFI A;  2HGC A;  3LST A;  2EV6 A;  4P9U A;  4YFN F;  2EFP A;  3E6D A;  1U78 A;  1JHF A;  1XSV A;  4I98 B;  2QEN A;  1T38 A;  5D5W B;  3I64 A;  3CLO A;  3IKT A;  5HS7 A;  4Q4Z F;  4I2O A;  1R22 A;  1TW2 A;  5D4S A;  3IL2 A;  2YU3 A;  3TKY A;  1XDS A;  4BHP A;  2OA4 A;  1SMT A;  3CUQ C;  2Z33 A;  4LG0 A;  1IUY A;  3HSE A;  3BPX A;  1K78 A;  3T5X A;  1DPR A;  4YII A;  1GVJ A;  1WSU A;  4WCG A;  2M45 A;  3P7N A;  2BEO A;  1YLF A;  4HX4 A;  4M9X A;  1F5T A;  1P92 A;  4HF2 A;  3QAH A;  2P6S A;  1U2W A;  5ICE A;  5FD5 A;  1GXP A;  2EJR A;  2QBY A;  4Q47 A;  1LDK B;  2A6H F;  2FEZ A;  3F22 A;  4IRI A;  3FZV A;  2V6C A;  4KIF A;  2JZY A;  1R36 A;  1KYZ A;  2H6C A;  3GX4 X;  5J8C A;  2M5W A;  3DPL C;  2QLZ A;  1I6X A;  1ULY A;  1Q1H A;  3DPT A;  1F1Z A;  3M8F A;  2JTV A;  3S2W A;  2BBY A;  2H27 A;  4RB2 C;  4XLP F;  2LKP A;  3F72 A;  4ENM A;  1TNS A;  3R61 A;  5CVU A;  5DCF A;  2VC1 A;  1R5H A;  4A0Z A;  2FXA A;  1F4K A;  4UHT A;  3FF5 A;  4M6X A;  3MFK A;  2FE3 A;  2HQN A;  5ICC A;  2RGV A;  2CG4 A;  2A69 F;  1BOA A;  3GLX A;  2LNB A;  1LNW A;  3REO A;  1QBJ A;  3LQR A;  3I59 A;  4L9T A;  3U9G A;  4A6E A;  1ONV A;  1JE8 A;  2ZME A;  5AIP A;  5D8K B;  5FD6 A;  3M9A A;  2MBF A;  1T6S A;  3R0J A;  3EUH A;  4ENN A;  4AVP A;  3U1D A;  3DF8 A;  3F23 A;  2DAO A;  1ZRD A;  3G73 A;  3R6S A;  4BH9 A;  1XGM A;  4EM2 A;  2ISZ A;  2O03 A;  3GF2 A;  4P5O A;  1B1B A;  2F5E A;  2HTJ A;  1WQ2 A;  1KQ8 A;  1BC7 C;  2G9W A;  2CFX A;  1RNL A;  3CUQ B;  4MQV A;  1BN5 A;  5E8I A;  3SHF A;  5CLS A;  3L00 A;  5L3D A;  5HLG A;  2DPU A;  2KKO A;  4UXN A;  2CW0 F;  3FMS A;  3KLO A;  1RUO A;  3GFJ A;  1HSJ A;  3FMR A;  4L0Y B;  1USS A;  1PP8 F;  1MKM A;  2QZ8 A;  4ON0 A;  3WGG A;  5LGU A;  3VEP A;  2F5D A;  1T98 A;  4ESB A;  3HTS B;  1L0O C;  3F3X A;  5K5Q A;  3GEZ A;  4BAY A;  5HS9 A;  4OMZ A;  4G7Z F;  2V9V A;  3L09 A;  1MD0 A;  3JSO A;  3QPH A;  2BE5 F;  4P96 A;  3MAJ A;  4G94 A;  3SXY A;  1FYM A;  1FP2 A;  3TQN A;  4RB3 C;  3RI4 A;  2GXB A;  3J7A O;  3NEU A;  2DLL A;  4M74 A;  3WTY C;  5FFX A;  3K1M A;  1S29 A;  1MZB A;  2YX4 A;  5D5V B;  4ZZL A;  1DUX C;  1X3U A;  4MQ9 F;  2FF4 A;  2R7F A;  3MCZ A;  4OIO F;  1KQ0 A;  4YG2 F;  3VOE A;  4P9F A;  1KU3 A;  4LD5 A;  2F2E A;  1SFU A;  3V7C A;  3KEQ A;  4MGR A;  1HQC A;  1HW2 A;  3K1N A;  2HFH A;  3RKY A;  2K27 A;  5DEQ A;  3JTG A;  3O2P E;  2JT1 A;  1SFX A;  4EGZ A;  2HWV A;  4HYE A;  4PGH A;  2RN7 A;  3KP6 A;  1T2K A;  2ZNZ A;  1CF7 B;  2YR2 A;  1SFE A;  2KJB A;  4HX8 A;  1LVA A;  3QPT A;  2X4H A;  2XGX A;  1LDJ A;  4K2E A;  1IF1 A;  3DV8 A;  4IVN A;  1H0M A;  4WXD A;  4L5J A;  5DD4 A;  4FHT A;  1KA8 A;  1VTN C;  4N9H A;  5DUI A;  4UVB A;  3FHZ A;  3F6O A;  1CF7 A;  2GAU A;  4UNO A;  3C18 A;  2IVM A;  1T39 A;  2IJL A;  3HRU A;  5ILS A;  2DQR A;  4F7Z A;  3ROU A;  5LBQ A;  2E7W A;  3FM3 A;  2P7C B;  4UUV A;  3CTA A;  4XRF A;  2EWN A;  2D1H A;  3E5U A;  4YFX F;  4PDK A;  5AIQ A;  3KZY A;  1XSD A;  1EH8 A;  2JSC A;  2FBK A;  2ZBK A;  3E6M A;  2FQ3 A;  1QGP A;  4KIG A;  2JPC A;  1ZAR A;  1TW3 A;  3V8K A;  1HKT A;  1E17 A;  1Z05 A;  3T8R A;  2ZCW A;  2XAQ A;  3MEX A;  2VOO A;  1XD7 A;  3DQV C;  4G6D A;  1J59 A;  1FC3 A;  4HLY A;  1XMK A;  2YSR A;  1FPQ A;  4OIQ F;  1OKR A;  4EJV A;  1KU7 A;  4M9Z A;  3M7G A;  5ICG A;  3V8L A;  1QZZ A;  2MH9 A;  1K78 B;  2XAH A;  2GXG A;  4U7B A;  3E6C C;  1LQ1 A;  2V79 A;  3FMQ A;  3C7J A;  3HHG A;  1ZG1 A;  2ZME B;  1AWC A;  2STW A;  2XUB A;  2YX7 A;  2ISY A;  3ELK A;  5CJ9 A;  5JR3 A;  4S04 A;  5L3C A;  4MTE A;  2P7V B;  2O3F A;  2XHK A;  4EJT A;  4IPA A;  2QWW A;  1S6L A;  2DPD A;  3RTR A;  2MC3 A;  4AWX B;  1D8K A;  1G3S A;  3NQO A;  2R3S A;  1SAX A;  4LMY A;  2D1V A;  3PFI A;  4PCQ A;  1YYV A;  4JK1 X;  4FX0 A;  3HOT A;  3KCC A;  3WTV C;  3C1D A;  2EV5 A;  3F6V A;  3WTX C;  4M72 A;  5HS8 A;  3SFZ A;  2XAS A;  1B59 A;  2YPR A;  1XGN A;  2WV0 A;  2VBX A;  4KUM A;  1HXD A;  2KRF A;  4UVA A;  2QQA A;  1TQP A;  1BIA A;  1MJB A;  3F21 A;  2OQG A;  2HKX A;  3FX3 A;  3GXO A;  1RI7 A;  3BZ6 A;  3LA7 A;  4I01 A;  2O61 A;  2RVC A;  1G4D A;  2EFW A;  3EYI A;  1REP C;  3EYY A;  4GO1 A;  4A6D A;  4MTD A;  4EQQ A;  2J5P A;  1FLI A;  5EEH A;  3RPU A;  3VOD A;  4HX7 A;  4CIC A;  2QUF A;  2OAZ A;  3C3W A;  3U2R A;  3R4K A;  1O3S A;  2GIV A;  1A04 A;  4EV0 A;  1MJ9 A;  4PZJ A;  1XMA A;  3ZMS A;  1ZGA A;  3F8F A;  3F8N A;  2TDX A;  1I1S A;  2PEX A;  3B02 A;  1HKQ A;  4KA4 A;  1YFH A;  4AIK A;  3FXQ A;  2BV6 A;  2AXL A;  1MDM B;  2MA3 A;  1MDM A;  1SMY F;  2L4M A;  1V4R A;  3R60 A;  4DNC A;  2NNN A;  5JHU A;  5HLI A;  4LK1 F;  5BOX A;  3H3U A;  1D5V A;  5E1W A;  4HA8 A;  5H6R A;  1IN7 A;  4OIR F;  4WWC A;  2VXZ A;  3L7W A;  4EM0 B;  3KEO A;  4KMF A;  4CO8 A;  3HRT A;  1IXR C;  2FSW A;  2ELH A;  2H94 A;  1I1G A;  2JRT A;  2K4B A;  4A5M A;  4KYW A;  4AD9 A;  2QBY B;  3V8J A;  3ABT A;  4GGG A;  3KP4 A;  3TDZ C;  5HDK A;  1Z91 A;  4O6J A;  1FBU A;  1OYW A;  1G6N A;  4IHT A;  1IRG A;  5BMZ A;  3PQJ A;  5F6F A;  1IAW A;  1H9T A;  3KZZ A;  3RJP A;  2HYF A;  1ZRF A;  2HS5 A;  4MHG A;  5D4R A;  5CVJ A;  2EFN A;  2QQB A;  1P4A A;  4LFU A;  3EDP A;  5BS6 A;  2DT5 A;  2EA4 A;  1LDD A;  1OMI A;  2OU2 A;  3D0S A;  4IRG A;  1ZLJ A;  1LEB A;  2OD5 A;  5IT3 A;  4ZYG A;  2O8X A;  2Z5U A;  4A5N A;  1O57 A;  1YTY A;  3ECO A;  4Z2Y A;  2MLG A;  2RC4 A;  1FWZ A;  5LEJ A;  4U7D A;  2GWR A;  2NNY A;  1FZP B;  1ZHF A;  1HKS A;  2IA2 A;  2ZJ2 A;  4G6Q A;  3I0T A;  3FXR A;  2QQ9 A;  3LFK A;  3JAM Z;  5E1X A;  1U5T A;  2FML A;  5K1Y A;  5F1R A;  3TO7 A;  5FGM A;  2UZK A;  3HYI A;  4Y15 A;  1R00 A;  4RGU A;  4KN4 X;  3DP7 A;  2FOK A;  3ZQ7 A;  1C0W A;  4GYG A;  5LRS A;  3P9C A;  3T0Y A;  1YG2 A;  1GHC A;  2ZKZ A;  2FRH A;  1Z7U A;  4HW0 A;  4R79 A;  1BC8 C;  2P4W A;  2DTR A;  3ISP A;  1L3L A;  2HR3 A;  3I5U A;  2OBP A;  5K5R A;  3JW4 A;  2CQK A;  1ZN2 A;  4I02 A;  3HRM A;  4IF4 A;  3ZN0 A;  2P8T A;  2PJP A;  3EET A;  2XKP A;  2H6B A;  2GA2 A;  5LEK A;  1FY7 A;  5TRD A;  2CGP A;  3WE3 A;  4NB5 A;  1ON1 A;  1QZY A;  4IJA A;  1H9G A;  1UB9 A;  3BY6 A;  2DK5 A;  3KP2 A;  4QWQ A;  4ZYD A;  1OYY A;  3EQL F;  1U5T C;  1HBX G;  2ZFW A;  2DK8 A;  1ZYR F;  4UVC A;  3ZMT A;  5LGN A;  3JSP A;  4L9N A;  1FT9 A;  4XSX F;  2UWM A;  4RAZ A;  4ZZD A;  1WRJ A;  1SD4 A;  2KIM A;  4NHJ A;  5BPI A;  4LLL A;  4RGS A;  2O0Y A;  1XB4 A;  1EH6 A;  1O3R A;  4TV7 A;  1TLH B;  3G3Z A;  2FNA A;  4U0Y A;  3GYH X;  1Z1D A;  4Q48 A;  5FO5 A;  2KIU A;  2CWE A;  1S7A A;  4P55 A;  2V1D A;  4ZH4 F;  2B0L A;  3HSR A;  2K02 A;  4WX9 A;  2A68 F;  1JGS A;  2PI0 A;  2EFQ A;  3WGH A;  1OYI A;  2ZO4 A;  3E5Q A;  1RZ4 A;  3CO7 C;  1FP1 D;  2IP2 A;  1HST A;  5A2Q K;  4EJW A;  3K1P A;  3BDD A;  1XSX A;  1CGP A;  2K86 A;  3ZN1 A;  1J5Y A;  1F9N A;  2E1N A;  4XLN F;  5FLX K;  2EB7 A;  4M6Y A;  4G9Y A;  2W57 A;  2Y75 A;  3D5L A;  2L02 A;  3DEU A;  3CO6 C;  2RKH A;  3DFG A;  1T0F A;  3ECH A;  5JI6 A;  3DXJ F;  5CVV A;  4HZF A;  1ON2 A;  4ENJ A;  5E18 F;  4Y13 A;  2ADU A;  1FX7 A;  2OZU A;  2XAJ A;  2IW5 A;  2VT2 A;  3GFM A;  3RPQ A;  5D6E A;  4OOI A;  2GZW A;  1R1V A;  2WTE A;  2XV4 S;  2M87 A;  2ETH A;  1Y0U A;  2LF7 A;  1ZAO A;  2WC2 A;  1WI9 A;  5DYM A;  3P9I A;  4D0P A;  3TDU C;  1R5G A;  4R8H A;  2VBY A;  2E1C A;  1TQM A;  2K4J A;  5CVI A;  2ZXJ A;  3JAM K;  1O3Q A;  2D45 A;  4I0A A;  4QLC U;  3ZMZ A;  1DDN A;  4KT5 C;  4HQE A;  1IN5 A;  2NRA C;  1Z6T A;  3TGN A;  3SQN A;  1UCR A;  2W85 A;  3M1E A;  2A3S A;  2RNJ A;  1ZRE A; 
#chains in the Genus database with same CATH topology
 3KP5 A;  2DA7 A;  4L9V A;  2XB0 X;  2PMU A;  2LP0 A;  2EV0 A;  3H9G A;  2NYX A;  5J47 A;  3MKY B;  4EM1 A;  2W7N A;  2E2J J;  4HF1 A;  1R1T A;  2CV0 A;  3ZMV A;  3HPG A;  1UFM A;  3IP4 B;  2Q2E A;  4G8X A;  3S3N A;  4E7I A;  3IWF A;  5IT9 Z;  1E2X A;  3GFL A;  5AON A;  2KZV A;  3K0L A;  3LA2 A;  2XDV A;  4MFE A;  2VBZ A;  5K7H A;  5LHH A;  1LE8 A;  1U8R A;  3RDI A;  4ESF A;  2NAZ A;  1QZE A;  5B1A H;  5H2F C;  2LFB A;  5LRR A;  4F52 A;  5ED4 A;  1Z21 A;  2QGU A;  3DKY A;  3DBH B;  1G3Y A;  5GPC A;  4DBQ A;  1V3F A;  1X1D A;  1DGW Y;  2VIX A;  3L2C A;  1FOX A;  2KLO A;  1JT6 A;  1V55 H;  1GLN A;  1MBH A;  3WHC A;  1UHM A;  4CYD A;  1U5T B;  3HG9 A;  2I8D A;  2YUS A;  1YO5 C;  1G3W A;  3HOV J;  3MN2 A;  3OYN A;  2A61 A;  2X9D A;  3W6K B;  2PJR A;  5ILU A;  2L7M P;  2Y0M A;  3HC7 A;  1IRF A;  3AL0 B;  1PYV A;  2B63 J;  3EUA A;  2DMU A;  5ERI A;  3BG5 A;  4XBF A;  5BPD A;  4KDP A;  2DMN A;  3KYL A;  3TW7 A;  4BQQ A;  4RGR A;  3G71 I;  4I99 C;  2STT A;  5HOO A;  1K79 A;  3G2B A;  1XX5 A;  4M73 A;  3CME I;  4ZTJ A;  1KU2 A;  2VOP A;  1STZ A;  2B9S A;  1OCZ H;  5C3E J;  4O3M A;  3QU6 A;  2R7T A;  4MNU A;  3CCQ I;  4LLG F;  1ETX A;  3K69 A;  3E97 A;  4ZJZ A;  1FOW A;  4XKW A;  3HOY J;  1BA5 A;  2FBH A;  1BR1 A;  2JA8 J;  4QSH A;  4XN3 A;  1FIP A;  2JPB A;  2I10 A;  2Z99 A;  3OS2 A;  4MLO A;  2GQQ A;  1PDN C;  1Z6R A;  2KJC A;  2ZME C;  1FYK A;  2ZJR F;  3TOA A;  3CMA I;  2XKO A;  3RZD J;  3J81 K;  5A2Q Z;  2L54 A;  3BLY A;  3OR2 C;  1JTX A;  2Z9O A;  2UXN A;  2QM3 A;  3BG7 A;  1ZLK A;  2XF6 A;  3BQZ A;  2XPV A;  2L9V A;  4M9S A;  1FSE A;  1QO0 D;  2BVL A;  3CP8 A;  3KLN A;  2F5C A;  5IP6 A;  3ZR8 X;  1BI3 A;  4GYI A;  2F48 A;  2NXN B;  4HF0 A;  1B6A A;  2IA1 A;  3WHB A;  1TNT A;  2K9S A;  3ZMU A;  4J00 A;  3BP8 A;  1BOB A;  1U9O A;  2UXX A;  3DTI A;  3OOP A;  2Y2Z A;  5DCM B;  1NK3 P;  1HOM A;  3I59 B;  5GPA A;  1VQ6 I;  2LF8 A;  3CES A;  3U21 A;  3RKW A;  3KP3 A;  1X1P A;  3CMM A;  3BJO A;  2L3D A;  4B1R A;  1SD7 A;  2FBI A;  3K9T A;  3RIR A;  4CXF A;  1GXQ A;  2IRF G;  4N4O B;  2PFB A;  1POG A;  5JFR A;  2FQ4 A;  1P4X A;  5CQE A;  2G7U A;  2E5N A;  2R7O A;  3BR3 A;  4RS8 A;  3L2U A;  2NVX J;  2KL4 A;  3A2K A;  1JXS A;  4FE4 A;  1EH7 A;  3L9F A;  2CUF A;  4RLQ A;  3COA C;  1R7J A;  2AXT C;  2HOA A;  3OYE A;  4AM3 A;  3I54 A;  1VND A;  1NK2 P;  2E71 A;  4PK4 A;  2DYS H;  6PAX A;  1FNN A;  2FD5 A;  5FKM A;  4EEF G;  1BIB A;  4JQF A;  3ERE D;  1SEU A;  4FE7 A;  4S0H B;  1KQ9 A;  5HDG A;  4ZYA A;  3BZC A;  2ELJ A;  1W36 C;  3BJ6 A;  2HTS A;  5ILV A;  3ZP5 A;  3HOS A;  2KIF A;  3ZMD A;  2DJN A;  3KPH A;  4M71 A;  2F5F A;  5EGO A;  4L0Z B;  1EV7 A;  1YJ9 I;  3VPR A;  3H92 A;  3HOU J;  2M8E A;  3T8T A;  2FMY A;  1O7F A;  3MZH A;  3RYR A;  4GFB A;  2JQ7 A;  2N8G A;  4GXO A;  3JTH A;  4KIB A;  4CCM A;  4WXH A;  4RAY A;  3HEF A;  3OV8 A;  1WH7 A;  2VQG A;  3QOP A;  4HLX A;  3QP6 A;  3S14 J;  5FJ8 J;  2C6Y A;  2MLK A;  3NWT A;  1LFP A;  2G7H A;  2E19 A;  4GCV A;  2VL8 A;  4FT8 A;  3OYH A;  2G0E A;  1YW7 A;  2MFZ A;  5L3G A;  1PP7 U;  3PL8 A;  2HQ5 A;  4DQ2 A;  2DA6 A;  5E17 F;  2DQL A;  4CHU A;  3B6A A;  1WJE A;  3ZQH A;  4CZZ A;  3MZ8 A;  2VQC A;  4LB6 B;  3FK6 A;  3VB2 A;  2VQH A;  5J4V A;  2R7W A;  3I4N J;  3ZPL A;  1BI0 A;  1X2M A;  2XPU A;  2RQP A;  1QA6 A;  3HDD A;  1MBE A;  3LSM A;  1UHW A;  4L5I A;  3FXJ A;  1HW1 A;  5KHD A;  1QNT A;  4LG0 B;  3PUB A;  1WGX A;  4XOR A;  2VC0 A;  2CS3 A;  2E5Z A;  1S5L C;  2PBI A;  3GTG J;  3W6J B;  2XGE A;  4PFO A;  5L3B A;  4Q5S F;  3CCM I;  3MWM A;  2IS6 A;  3ABU A;  3WG9 A;  2E1M C;  4LJZ F;  2OF7 A;  4Z6Y A;  5E3O A;  1ZH5 A;  4PJJ A;  2OZ6 A;  1YS6 A;  3R0A A;  4UV9 A;  5KVR A;  1J7K A;  1MMA A;  2JMW A;  5J6X A;  1MJA A;  4L18 B;  2HYG D;  4XID A;  4ENK A;  1O7L A;  4MFD A;  4U0W A;  2L4A A;  5IY5 H;  3ZQL A;  1W7P A;  2QVO A;  4WK8 F;  3FHN A;  1A5J A;  3RKX A;  1MNM C;  3BPV A;  3BOQ A;  4AIH A;  2P0W A;  4PJN A;  2PN6 A;  2LSO A;  4IOA F;  5IYC J;  5D6F A;  3HIF A;  1ZG3 A;  2D2W A;  3CCV I;  4IRH A;  2PQ8 A;  2X48 A;  4WF2 A;  2W24 A;  5KCM A;  1W5C C;  3OYD A;  2XF5 A;  2NS0 A;  4RGX A;  2BGC A;  2P5L C;  2COM A;  5DD8 A;  3F8B A;  2M9H A;  3CCU I;  3TW6 A;  4NQW A;  1QQI A;  4AYB A;  4OWR B;  4I09 A;  3D5S C;  4OIN F;  3HGG A;  3K10 A;  5LHI A;  5DUK A;  1D3Y A;  2FA5 A;  5IP9 J;  3K4J A;  4LK0 F;  3N4M A;  4OMY A;  4XNF A;  3J81 Z;  2IPQ X;  4BE2 A;  5FB2 A;  5D8L B;  3LSJ A;  1XGO A;  4AIJ A;  3J7A Y;  3H9J A;  1S7E A;  3ULQ B;  2MD5 A;  4IL6 C;  1Y8R B;  3TP0 A;  2W84 A;  1XCV A;  1HA8 A;  5DDG A;  4EGY A;  1SAU A;  2PMH A;  4CZC A;  2X6O A;  1GT0 C;  1JGG A;  3CUO A;  3DLA A;  2HYJ A;  4BNC A;  4ITV A;  1JHH A;  5BQT A;  2Y48 A;  4E4H A;  3G1M A;  2WAF A;  3OMY A;  1IN6 A;  1NHA A;  4HAM A;  2R92 J;  2QSG X;  2IGO A;  5F04 A;  3RKQ A;  1Z77 A;  1HF0 A;  2W82 A;  2M4K A;  3I53 A;  4CUG A;  4M3B A;  4I7H A;  2EIJ H;  3DKX A;  1J9I A;  4HOB A;  4Y52 J;  4RA2 A;  2ZNY A;  2PLY A;  3HKZ A;  2CJJ A;  5C4X J;  3FKI J;  1R1U A;  4OIP F;  3S2H J;  5F64 A;  4IQ4 A;  3WE2 A;  5CVR A;  3BJA A;  4HQM A;  4CCJ A;  1RUN A;  4G7O F;  3A02 A;  2V1U A;  4B8X A;  5EGO B;  3OIP A;  4G7H F;  4LB5 A;  3GWZ A;  2J5O A;  1LJ9 A;  1W5S A;  5JVT A;  4LLN A;  3OYA A;  2P6T A;  2QSF X;  3IRR A;  4BXU A;  2UV1 A;  4NC7 A;  1BJA A;  1U0J A;  1RRJ A;  5DV5 A;  3WOD F;  1TWG J;  1DP3 A;  2DU9 A;  1JI8 A;  4BYY A;  1A6I A;  4U0V A;  1ETV A;  1QVU A;  2VUM J;  3LSG A;  2A6E F;  2ESH A;  5KK1 A;  5GTH C;  2EK5 A;  3BTJ A;  2O6G E;  3TO6 A;  5B1B H;  3FM5 A;  1FBQ A;  2W4S A;  3LAP A;  1B9M A;  1AHD P;  2LRE A;  1FTZ A;  4HDV A;  3M07 A;  1WWX A;  3CMY A;  2Q0O A;  3P9K A;  1VQM I;  1SVL A;  2L2O A;  1WFX A;  1MSF C;  2AS5 F;  1X4P A;  1BM9 A;  4Y4R A;  1R23 A;  3IKV A;  1I50 J;  1RIO H;  4BUP A;  2ACJ A;  1BR2 A;  2HQR A;  2CYY A;  4EMS A;  1W5T A;  4CA0 A;  3A0H C;  4O5V A;  3HOZ J;  2KRC A;  3GVA A;  1VQ7 I;  1HDP A;  3VYS B;  5GAG J;  2YS9 A;  5FKK A;  4ASN A;  3H3Z A;  3ZQF A;  4AU7 A;  4BHB A;  3ZQG A;  2PG4 A;  4QTR A;  4C2M J;  4HDU A;  1YW9 A;  2P5V A;  5JLX A;  4EVI A;  2GA1 A;  4W1U A;  2QF7 A;  1X58 A;  2DDB A;  4MEX F;  1W7P B;  1IDZ A;  1YW8 A;  3S93 A;  2KT0 A;  3WTT C;  3GTO J;  3N97 A;  1WJF A;  2KIQ A;  2W1O A;  3BWG A;  2VE8 A;  4UUS B;  4JBA A;  3SEQ A;  4PGG A;  2DO7 A;  2TCT A;  2OC6 A;  4ZYH A;  1AOY A;  3ASN H;  3B6C A;  4S05 A;  3WU0 A;  2DI3 A;  3VYU B;  1W4M A;  4CDG A;  1GUU A;  3SJM A;  4A12 A;  1UHS A;  3OY9 A;  3TOB A;  2WAE A;  4LGW A;  4EJO A;  3IC7 A;  5M5W J;  4N0B A;  3RZO J;  2DFH A;  2EA2 A;  1P6R A;  4FX4 A;  5EEG A;  3GZN B;  3DWL E;  2MG4 A;  3M8E A;  4WXC A;  4H0E A;  3CJN A;  2R4G A;  1LB2 A;  1MBK A;  3K4K A;  4B44 A;  1TC3 C;  3MKW B;  4A69 C;  4E7H A;  3BQY A;  4BAC A;  1LUJ B;  3Q0W A;  1OJL A;  3Q5F A;  1H8A C;  3PSI A;  3LNQ A;  3KEY A;  3JR9 A;  4BQA A;  3Q9S A;  1R5I D;  1G3T A;  4KIC A;  4BGD A;  5K5O A;  1JKR C;  2K85 A;  3LL7 A;  4HV5 A;  5DM7 F;  4FIS A;  5E8G A;  1QPI A;  1FYL A;  4XOT A;  1VFC A;  4UB8 C;  4ZDP A;  1MH4 A;  2AO9 A;  3CDH A;  3QYE A;  1YJN I;  2M30 A;  1FBS A;  2ZFU A;  4N9I A;  1U6G A;  1DPU A;  3I71 A;  3V4G A;  1Y1V J;  1ZG5 A;  2RV8 A;  3GO5 A;  3OS1 A;  3J7Z I;  3WTS C;  4B09 A;  5EF6 A;  2HKO A;  2DA5 A;  1J75 A;  4IXA A;  4XLE A;  2L01 A;  2A07 F;  2DBB A;  3E6B A;  2NOG A;  4MEY F;  1UJ8 A;  5CPR B;  2WY7 Q;  3TL4 X;  3ML6 A;  2F5V A;  1VQ9 I;  1UST A;  3FKJ A;  4I0B A;  3HRS A;  1E3P A;  2H8W A;  4H4K C;  5HLH A;  3LSP A;  5L3F A;  1B9N A;  1OIS A;  1FJL A;  3T1B A;  5F27 A;  1FEX A;  2HEO A;  1ZGJ A;  2MD0 A;  1O3T A;  1BR4 A;  2OCE A;  2VJI A;  1J0R A;  3B73 A;  2VJ4 A;  1FMW A;  4M3F A;  3HTU A;  3CP2 A;  1YIT I;  2ELK A;  2K9Q A;  1TZL A;  1D0Z A;  1IW7 F;  4ETS A;  3VFZ A;  2XIG A;  4ZYE A;  1BI1 A;  2KP6 A;  4QPO A;  4CGZ A;  4OU0 A;  1J2X A;  1YS7 A;  3FDY A;  2M3A A;  2JUG A;  1S8N A;  3K4C A;  5J8F A;  3HUG A;  1R6R A;  2E2H J;  2BVM A;  1MMD A;  3SZT A;  4BS9 A;  2O7O A;  2IA0 A;  1XDU A;  1RPW A;  2XRN A;  4XRM A;  1U3E M;  1HCR A;  2M0M A;  3HHH A;  4RDU A;  3ZQC A;  2GM4 A;  4KMU X;  5FLM J;  3K4N A;  3DKW A;  4J19 A;  4NQW B;  2QYO A;  2RDP A;  4CCK A;  2W25 A;  4HBL A;  4BHC A;  1N78 A;  2MH2 A;  3HM5 A;  4PJL A;  3RCO A;  2P5K A;  1AA7 A;  2VKE A;  3GW2 A;  1TQI A;  2BW3 B;  1KGS A;  1SVM A;  2CO5 A;  2EPF A;  3K2Z A;  2IBD A;  1DQU A;  2ZC2 A;  3BTC A;  3WTW C;  4KFC A;  2R5Z B;  1I27 A;  1HLV A;  5GAE J;  3CDI A;  4FCY A;  3S1M J;  3K4B A;  2DW4 A;  1IN4 A;  1KYW A;  3QPL A;  3KET A;  4BY7 J;  3HBL A;  3AL0 C;  2BHZ A;  4AVZ A;  1OCP A;  2NVY J;  4R1H A;  3IRQ A;  2CW8 A;  5E20 A;  1YQA A;  4NUB A;  3GZ6 A;  1LEA A;  3FWE A;  2E35 A;  1EF4 A;  2GLO A;  4IOC F;  4A3B J;  2LRD A;  2MGQ A;  3FXL A;  2X0L A;  3MQ0 A;  2DOD A;  5CYV A;  1U8B A;  2HDC A;  1S3J A;  1S7O A;  2Y31 A;  2IS2 A;  1ODD A;  4W97 A;  4XRS G;  5IOY A;  1ZEL A;  2EZK A;  2EFO A;  2VPR A;  3RYP A;  2XRO A;  2XAG A;  2X6Y A;  2ZB9 A;  3OYI A;  4A3I J;  3KP7 A;  3OOU A;  3IHU A;  2QA4 I;  3VSL A;  3ABL H;  5F0H A;  4FET A;  3LQQ A;  3LSR A;  1K4T A;  4D5F A;  2ESN A;  2PJR B;  2VQL A;  1ITY A;  3E5X A;  1PJR A;  1HW5 A;  4A3E J;  5L3E A;  1PUE E;  2CV1 A;  5EZG A;  1IXC A;  2X1E A;  1XTA A;  3TED A;  1FMV A;  2V4J C;  4AUX A;  4E6K G;  2H09 A;  4A0Y A;  3I58 A;  2M1B A;  1WKM A;  2HOE A;  2OQR A;  1J09 A;  4XLF A;  1IN8 A;  3FIS A;  1VQO I;  4ZDO A;  3SDB A;  3LA3 A;  2R7X A;  1FSH A;  4HV6 A;  4ESJ A;  1VQ5 I;  1S9H A;  3DTK A;  2L7K A;  5HDN A;  1YOV B;  1OR7 A;  2VE9 A;  1ENH A;  1YIO A;  4X6A J;  3V7R A;  1BW5 A;  2HZT A;  5HLT A;  3CF5 F;  4PFP A;  4RM2 A;  2JK3 A;  4BEH B;  4BEH A;  2EH3 A;  5EG0 B;  2Y69 H;  3WTZ A;  2KDZ A;  1DP7 P;  1X1A A;  3O3K A;  5IP7 J;  1P2F A;  5IYB J;  1BBY A;  2VBW A;  5D5U B;  1IZ1 A;  3WU2 C;  3F8C A;  1IXS B;  5FFZ A;  1SD6 A;  2OCC H;  2XVC A;  2LC2 A;  5H6Q A;  3J80 K;  3HL2 A;  1GDT A;  2VON A;  4IHW A;  1A31 A;  2QEX I;  4JOM A;  3IWZ A;  4BJT A;  2ZSI B;  1BW6 A;  1Q1V A;  3ZCO A;  3FXU A;  1JT0 A;  1D8J A;  4A2U A;  3Q9V A;  1XMX A;  5D5X B;  5IT9 K;  1W7P D;  3HSF A;  2M2E A;  2ZSH B;  3QP5 A;  1ZRC A;  4E70 A;  2VKV A;  1R9T J;  2Z3Y A;  4RMN A;  3MZY A;  1WJA A;  2K7L A;  3BC8 A;  3JRH A;  1TBX A;  2VN2 A;  4YEL A;  4EJU A;  3ZQQ A;  3S8P A;  4YIF A;  4XRS A;  5F1J A;  5J4Y A;  2NS7 A;  3LWF A;  4I6Z A;  5KNL A;  3QPS A;  1WZ2 A;  2WAD A;  1Z9C A;  2FU4 A;  1B8I A;  3W6V A;  3JCU C;  2E2I J;  4HRI A;  2Z2S B;  3HZJ A;  2DA2 A;  3RSN A;  4YFK F;  1JKO C;  4KNY A;  5DS9 A;  1KU9 A;  2A6T A;  4A0X A;  3L2R A;  5TIS C;  3OYJ A;  2EIM H;  5KAI C;  1ERD A;  4KN7 X;  3I4P A;  3LAJ A;  1SD5 A;  2OPT A;  3PO3 J;  1JTY A;  3GUD A;  4B3A A;  2V1X A;  3F0C A;  4RB0 A;  4RB1 A;  1N75 A;  4AC0 A;  1PUF A;  1P7I A;  2QCO A;  5E1Z B;  1OPC A;  1AKH B;  1R58 A;  2KRH A;  2IT0 A;  5TJJ A;  5DCM A;  5LLQ A;  3AAF A;  1MGT A;  4XKC A;  4HNU A;  3KZI C;  3O6B B;  5ICF A;  5LHG A;  3BRO A;  1I5Z A;  1XN7 A;  3CC2 I;  1P4W A;  3QRF F;  1K7A A;  1TTY A;  4PJM A;  5FLX Z;  3CCL I;  3E7L A;  4II3 A;  3GZ5 A;  3QU3 A;  2XSD C;  1OR7 C;  1W0T A;  2LY2 A;  5E3L A;  2QKL B;  3WTU C;  1B4A A;  4U88 A;  1UG0 A;  1BI2 A;  2FNP A;  3F8M A;  3KFW X;  5H20 A;  1FOK A;  3A4C A;  4DBR A;  1Z0X A;  2A5Y B;  4JX5 A;  1K6Y A;  1MW7 A;  1UEL B;  2WWY A;  1EA3 A;  2HQA A;  2K3F A;  2K5C A;  3TO9 A;  2BYV E;  3V7S A;  1JJ6 C;  3J80 Z;  1XGS A;  4I76 A;  4M3D A;  1T0F C;  2R7D A;  4XSZ F;  3PIP F;  4IHS A;  1SFO J;  2DFI A;  2Q8K A;  1K6O A;  1QHH D;  5HVQ C;  3E3V A;  4F91 B;  3WGI A;  1XCB A;  5FLV A;  1MIJ A;  2CSO A;  2P81 A;  3NRV A;  5LGT A;  1AKH A;  2XB5 A;  2AQE A;  2OTJ I;  1WPK A;  1WCM J;  2XAF A;  4L9J A;  4NBQ A;  3BTI A;  2VOD A;  1QPM A;  4UV8 A;  1K4S A;  1X3W B;  3CUQ A;  1YX3 A;  3KE2 A;  4L5E A;  1IRZ A;  2E7X A;  4XLA A;  4Y17 A;  3SZP A;  1TT0 A;  3BR2 A;  4B4C A;  3WU1 B;  1JUM A;  2LDU A;  3S2D J;  1VZ0 A;  3GLL A;  2VT3 A;  3PQK A;  3GFI A;  2HGC A;  3LST A;  2EV6 A;  4P9U A;  2GXA A;  1VQN I;  2Q2E B;  2DJI A;  4YFN F;  2EFP A;  3E6D A;  2HZD A;  1U78 A;  1ZK8 A;  1JHF A;  1OCC H;  4YIR X;  1XSV A;  4I98 B;  2QEN A;  3OYK A;  1RKW A;  5D5W B;  1T38 A;  3I64 A;  3K4L A;  5HNF A;  1SFK A;  2WB1 A;  3H1C A;  1TWF J;  2ECC A;  1Y1W J;  3CLO A;  3CC4 I;  4JP0 A;  4XQF A;  4F93 B;  1Y56 A;  4HPQ A;  3IKT A;  5HS7 A;  1MH3 A;  4Q4Z F;  4I2O A;  1R22 A;  2Y9Y A;  4M3E A;  3A01 B;  1Y0N A;  1X1B A;  1TW2 A;  2F4I A;  2DT6 A;  5D4S A;  3IL2 A;  2YU3 A;  3EUK L;  3GTP J;  1D0Y A;  3TKY A;  1XDS A;  4BKX A;  3A1Y A;  4BHP A;  2OA4 A;  1SMT A;  3CUQ C;  2Z33 A;  2NVT J;  4LG0 A;  1IUY A;  2CRG A;  2PMZ A;  3GBG A;  2IEK A;  4BDY A;  3HSE A;  2GOM A;  3BPX A;  4A3M J;  3M1C A;  1K78 A;  3T5X A;  1DPR A;  2CUE A;  2CH0 A;  4YII A;  1GVJ A;  1WSU A;  3GTQ J;  4WCG A;  4BY1 J;  2M45 A;  2DOF A;  3P7N A;  3S32 A;  2BEO A;  1YLF A;  2OUM A;  4HX4 A;  4M9X A;  1F5T A;  1P92 A;  4HF2 A;  3QAH A;  1ORK A;  1WJ5 A;  2EZL A;  2E34 A;  1U2W A;  2JWT A;  2P6S A;  5ICE A;  5FD5 A;  3OYF A;  1YRN A;  3L2V A;  2HDD A;  1GXP A;  3JRB A;  4C2T A;  2DFF A;  2EJR A;  3BR6 A;  3AKZ A;  1S72 I;  3I3L A;  3G4S I;  2M34 A;  2QBY A;  3CLQ A;  4Q47 A;  1LDK B;  2A6H F;  2FEZ A;  3ERM A;  3F22 A;  2HPM A;  4IRI A;  3FZV A;  2V6C A;  4KIF A;  2JZY A;  4OAY A;  1R36 A;  1KYZ A;  2H6C A;  5M5X J;  5J8C A;  3GX4 X;  3DU5 A;  1D1A A;  1FTT A;  2M5W A;  3M8J A;  2DT7 B;  3DPL C;  4DOZ A;  2LK2 A;  2QLZ A;  1I6X A;  1ULY A;  4B47 A;  1Q1H A;  2QQ8 A;  1JKQ C;  1M1E B;  2HDW A;  2JSP A;  2WAQ N;  3DPT A;  2M0C A;  1F1Z A;  3M8F A;  2JTV A;  1I39 A;  1D1B A;  3S2W A;  2BBY A;  2H27 A;  4RB2 C;  4BBS J;  5K7F A;  4XLP F;  2LKP A;  2DA4 A;  3F72 A;  4IHX A;  4ENM A;  3HUG B;  1TNS A;  3R61 A;  2LMD A;  2HI3 A;  4LOC A;  5CVU A;  5DCF A;  3GTK J;  2VC1 A;  1VQ4 I;  1R5H A;  4A0Z A;  2R93 J;  3CF2 A;  2FXA A;  1F4K A;  5E79 C;  4UHT A;  3FF5 A;  4M6X A;  3MFK A;  3TP3 A;  4AYB N;  1NG7 A;  2FE3 A;  2IGN A;  2HQN A;  4A3G J;  5FKN A;  3CZ6 A;  5ICC A;  2RGV A;  1IUF A;  2CG4 A;  2A69 F;  1BOA A;  4C2U A;  3GLX A;  2LNB A;  1LNW A;  3OIQ A;  3REO A;  2EIL H;  1QBJ A;  2CMP A;  2WAQ A;  1LE8 B;  3LQR A;  3I59 A;  4L9T A;  3I4M J;  2KZG A;  3U9G A;  2K3P A;  1QRY A;  2XGD A;  2K40 A;  1ONV A;  4A6E A;  2ZME A;  5AIP A;  1JE8 A;  1OQY A;  2VPL A;  4II2 A;  5D8K B;  3M9A A;  5FD6 A;  2MBF A;  1Y8Q B;  1T6S A;  3D5R C;  3L2Q A;  3C2G A;  3R0J A;  3JRF A;  2HPI A;  3EUH A;  2LLK A;  4IZZ A;  3OSF A;  2Q1Z B;  2KPM A;  4ENN A;  4AVP A;  2E1O A;  3U1D A;  3DF8 A;  3F23 A;  2JA2 A;  1H88 C;  1TWH J;  2DAO A;  3LMM A;  1Y39 A;  1ZRD A;  3OWT A;  3G73 A;  1P9Q C;  4IEJ A;  3R6S A;  3W2V A;  4BH9 A;  4Y3O A;  1XGM A;  4EM2 A;  2DXI A;  2ISZ A;  3HB9 A;  2O03 A;  3GF2 A;  4BE0 A;  1MNE A;  2X85 A;  4P5O A;  1B1B A;  3CCY A;  2BY1 A;  2F5E A;  2HTJ A;  1WVR A;  1WQ2 A;  1KQ8 A;  3O8H A;  2PX9 A;  1BC7 C;  3RQ4 A;  2CFX A;  2G9W A;  1RNL A;  3CUQ B;  4MQV A;  4V2F A;  1BN5 A;  2ID6 A;  2MAB A;  1I3Q J;  5E8I A;  2OTL I;  2XRL A;  5F0C A;  3SHF A;  5CLS A;  3L00 A;  1R4M B;  3FXK A;  5L3D A;  1XC5 A;  5HLG A;  4BQO A;  2DPU A;  4YRV A;  2KKO A;  3JRA A;  5B3S H;  3OIO A;  4UXN A;  5M3M J;  2R5Z A;  1Z3X A;  2CW0 F;  3FMS A;  2NVQ J;  2O5R A;  3KLO A;  4BU2 A;  1RUO A;  4B43 A;  3GFJ A;  3ZGK A;  1B72 A;  1HSJ A;  3FMR A;  2L7Z A;  2VKH A;  1W0U A;  1T08 B;  1USS A;  4QPQ A;  4L0Y B;  1PP8 F;  1MKM A;  4CCO A;  2QZ8 A;  4ON0 A;  3CCJ I;  3WGG A;  5LGU A;  3VEP A;  3PO2 J;  2WBM A;  5DM6 F;  4HNT A;  2F5D A;  4CCL A;  1YRN B;  3P5J A;  1T98 A;  4ESB A;  2CQX A;  2DA1 A;  4ZC3 A;  3HTS B;  4FQG A;  1QHG A;  2V9P A;  3NAU A;  2L9N A;  1L0O C;  3F3X A;  5JLW A;  3L2W A;  2BHY A;  5K5Q A;  2DOE A;  3GEZ A;  4DYR A;  2WA0 A;  5LD2 C;  4BAY A;  5HS9 A;  4OMZ A;  4G7Z F;  4XLC A;  1ETW A;  1CQT A;  1IJW C;  2DYR H;  3DLL F;  4UUS A;  1OFC X;  1YX5 A;  2CUJ A;  2V9V A;  3L09 A;  1MD0 A;  3JSO A;  3QPH A;  1F36 A;  2BE5 F;  2V26 A;  4P96 A;  3ZQI A;  3MAJ A;  4G94 A;  1LFB A;  2DA3 A;  4XON A;  3SXY A;  3S3O A;  1FYM A;  2JRM A;  1VQL I;  1FP2 A;  4NC8 A;  1A6Q A;  4DIQ A;  3TQN A;  3AG2 H;  2RQQ A;  3DU6 A;  4RB3 C;  3RI4 A;  1VQK I;  2GXB A;  3J7A O;  3NEU A;  3PNT A;  2DLL A;  4M74 A;  3WTY C;  2HXI A;  5FFX A;  3K1M A;  1T8I A;  2L9S A;  2ZXI A;  4NC6 A;  4E7L A;  3PNV A;  3UNG C;  3MKL A;  1S29 A;  1MZB A;  2YX4 A;  5D5V B;  4ZZL A;  1FIA A;  1X3U A;  1DUX C;  4MQ9 F;  2YU9 J;  1ACI A;  2FF4 A;  2R7F A;  3CCR I;  4QIW N;  3MCZ A;  1IG7 A;  4DW6 A;  4OIO F;  1KQ0 A;  4YG2 F;  4CH7 A;  3VOE A;  3PFY A;  4P9F A;  1KU3 A;  4LD5 A;  2F2E A;  1MBG A;  4A3F J;  1SFU A;  3V7C A;  3KEQ A;  1GVD A;  3JRD A;  4MGR A;  2LOO A;  2K9N A;  1HQC A;  2JA6 J;  1HW2 A;  3HGY A;  3K1N A;  2HFH A;  3QOE A;  1GV2 A;  1DGR M;  4DZP A;  3F9K A;  3RKY A;  1X1C A;  3K7A J;  3S17 J;  2K27 A;  3BG6 A;  2EIN H;  5DEQ A;  3UR3 C;  3JTG A;  1K61 A;  3VSK A;  3O2P E;  2JT1 A;  1SFX A;  1XS9 A;  4A3L J;  4EGZ A;  1H89 C;  2HWV A;  4Y7N J;  2BY3 A;  4HYE A;  2ID3 A;  4PGH A;  3C2B A;  3MMY B;  3PJR A;  2RN7 A;  3KP6 A;  1T2K A;  1Y6I A;  1D5Y A;  4G6T B;  2ZNZ A;  5FRO A;  1CF7 B;  2V1N A;  3S15 J;  2YR2 A;  3H3V K;  3X2Q H;  1SFE A;  9ANT A;  4XKV A;  3BG3 A;  5B5E C;  3ABM H;  2KJB A;  4HX8 A;  1LVA A;  3QPT A;  2NOJ B;  2X4H A;  2XGX A;  4V2G A;  2ZJP F;  1LDJ A;  4K2E A;  1IF1 A;  4HG2 A;  3DV8 A;  5GP9 A;  4KIS A;  3GTJ J;  4IVN A;  1ETY A;  1H0M A;  2DTZ A;  4WXD A;  4L5J A;  5CKT A;  5J1R A;  2ECB A;  2LYC A;  2LTP A;  1JKP C;  2AHQ A;  5DD4 A;  3GTL J;  4FHT A;  2WV1 A;  1KA8 A;  2IGM A;  3E1S A;  1VTN C;  3BZK A;  1OCO H;  4N9H A;  4J01 A;  3DBR B;  1I6H J;  4PJ0 C;  5DUI A;  4UVB A;  3FHZ A;  3F6O A;  1CF7 A;  2GAU A;  4UNO A;  3C18 A;  2KHM A;  2IVM A;  4RAF A;  1T39 A;  2HOS A;  2IJL A;  3HRU A;  1DU6 A;  5ILS A;  3BCB A;  2DQR A;  3ROU A;  3PSF A;  4F7Z A;  5LBQ A;  2E7W A;  4BJ6 C;  3FM3 A;  2R5Y B;  2P7C B;  4UUV A;  4KJZ A;  3CTA A;  4XRF A;  2EWN A;  4UUT A;  2Y30 A;  4BQN A;  2D1H A;  3E5U A;  1X3Z B;  2CUZ A;  4YFX F;  3H0G J;  4PDK A;  3E0J B;  5AIQ A;  3KZY A;  1XSD A;  4DJA A;  1EH8 A;  2JSC A;  2FBK A;  2ZBK A;  3E6M A;  2FQ3 A;  2X6X A;  3BG9 A;  1QGP A;  4KIG A;  2VLA A;  2QKM B;  3LSI A;  2JPC A;  1ZAR A;  1G2H A;  1TW3 A;  1UMQ A;  2LKS A;  3V8K A;  3CCS I;  3SFI A;  4BL0 B;  1HKT A;  2ZJQ F;  1E17 A;  3SYT A;  4N4N B;  1T56 A;  1GV5 A;  1Z05 A;  2D5V A;  2CQ7 A;  2L7F P;  1NH3 A;  2L5Q A;  3T8R A;  5EDN A;  5EG0 A;  4BE1 A;  4XMY A;  2V7F A;  3FBN B;  2ZCW A;  2XAQ A;  3MEX A;  3SEZ A;  2KFD A;  3AG3 H;  1WHU A;  2VOO A;  1XD7 A;  4A93 J;  3DQV C;  5GAD J;  3OSG A;  4G6D A;  2H1L A;  1A36 A;  1J59 A;  1FC3 A;  4HLY A;  1XMK A;  2YSR A;  1FPQ A;  2E36 A;  4F3Q A;  4OIQ F;  3S1N J;  1OKR A;  4EJV A;  4FTH A;  1KU7 A;  1ETK A;  1Z67 A;  3PIO F;  2HVR A;  4M9Z A;  1N77 A;  3M7G A;  5ICG A;  3V8L A;  4D7N A;  4XK4 A;  3ZXS A;  4E7Z A;  1QZZ A;  1OCR H;  2MH9 A;  1K78 B;  2XAH A;  3QOD A;  2GXG A;  1NTC A;  2XSJ C;  1V5F A;  5GTI C;  4U7B A;  3E6C C;  1LQ1 A;  1WJD A;  3DEE A;  2V79 A;  3FMQ A;  5EYR A;  3C7J A;  3LOC A;  3HHG A;  5C44 J;  1ZG1 A;  5K7Z A;  1W36 D;  2ZME B;  3IH4 A;  5DTD A;  5M3F J;  4BXX J;  5KAF C;  1MBF A;  1ETO A;  3AFH A;  1AWC A;  2STW A;  2YX7 A;  3ELK A;  2XUB A;  2ISY A;  2LBF A;  4XR6 A;  4M6V A;  5CJ9 A;  5JR3 A;  4S04 A;  5L3C A;  3VYR B;  4MTE A;  3JRI A;  4IHV A;  3KX2 A;  2CQQ A;  1SVO A;  1YIJ I;  2EZH A;  4A3D J;  1QU3 A;  2P7V B;  2O3F A;  3TMO A;  4IX7 A;  2XHK A;  2DMP A;  2DFE A;  1TP4 A;  2O9L A;  1Z3Y A;  3DCF A;  4U87 A;  4EJT A;  3K70 D;  4IPA A;  2O8K A;  2QWW A;  3JRE A;  1S6L A;  2LY9 A;  2DPD A;  3RTR A;  2MC3 A;  4AWX B;  2XF7 A;  2PMZ N;  5F0F A;  3EPZ A;  3ESW B;  1D8K A;  1G3S A;  1B8I B;  3OYB A;  3NQO A;  2R3S A;  2BW3 A;  3FBI B;  1SAX A;  4LMY A;  2D1V A;  3PFI A;  4PCQ A;  1YYV A;  2JA5 J;  5C4J J;  1D1C A;  2JVG A;  4UB6 C;  4JK1 X;  5TGT A;  4FX0 A;  3HOT A;  3BR5 A;  4RAG A;  2A5W A;  2HVQ A;  3KCC A;  2L9R A;  3WTV C;  2L0K A;  3C1D A;  4XL9 A;  5EJC A;  2EV5 A;  2CV2 A;  3N05 A;  3F6V A;  3WTX C;  4M72 A;  5HS8 A;  2X1D A;  2IS4 A;  3CJQ B;  3SFZ A;  2WY8 Q;  4HNV A;  5J1Y A;  2XAS A;  3CC7 I;  3S3M A;  4E7J A;  2R7S A;  4UY8 I;  1B59 A;  4HSR A;  3G6E I;  4D7M A;  3K2A A;  2HOT A;  3HJE A;  5FRN A;  2BXZ A;  2YPR A;  5JHF A;  4DGW B;  1XGN A;  3BR1 A;  2V9K A;  2ME6 A;  1XPX A;  2GIZ A;  2LY1 A;  2WV0 A;  3IUO A;  2VBX A;  4KUM A;  1HXD A;  3L1P A;  4EAT A;  3H0D A;  2E60 A;  2KRF A;  1O4X A;  4UVA A;  3H35 A;  2QQA A;  3NAR A;  1TQP A;  1EJ9 A;  1BIA A;  1MJB A;  3F21 A;  1YJW I;  2GOX B;  4CSW A;  1W1W E;  2OQG A;  2HKX A;  3FX3 A;  3GXO A;  3MD2 A;  4C30 A;  2LKX A;  3Q3S A;  1RI7 A;  1A35 A;  3BZ6 A;  3LA7 A;  3PM1 A;  4I01 A;  2JJ7 A;  1IV8 A;  1PUF B;  1NG6 A;  4D1Q A;  2O61 A;  3W2A A;  2RVC A;  2W48 A;  1G4D A;  4NDL A;  3K6G A;  2EFW A;  4BJ5 C;  3EYI A;  4JX6 A;  3EYY A;  4GO1 A;  3OYM A;  1REP C;  4A6D A;  2R7Q A;  4MTD A;  2HVS A;  4EQQ A;  2J5P A;  5BNG A;  1FLI A;  2FUG 2;  2HXO A;  4ABZ A;  1JUP A;  4PUS A;  5EEH A;  2JA7 J;  2FOW A;  3RPU A;  3VOD A;  4HX7 A;  5M5Y J;  1PVE A;  3K4M A;  3OR1 C;  4CIC A;  2QUF A;  5CQG A;  2OAZ A;  3Q0V A;  3C3W A;  3U2R A;  3I56 I;  3R4K A;  1YE9 A;  3AG4 H;  3OYC A;  1O3S A;  2GIV A;  1ZGW A;  1A04 A;  2F4O B;  4EV0 A;  3W2W A;  3TBI A;  1TL8 A;  1MJ9 A;  2K9L A;  2MYS A;  4PZJ A;  1VQP I;  1XMA A;  2LBF B;  3H36 A;  3ZMS A;  3H9Q A;  1ZGA A;  3F8F A;  1X19 A;  3F8N A;  1E3O C;  2Z1D A;  2TDX A;  1I1S A;  2PEX A;  3B02 A;  1HKQ A;  3IH3 A;  4KA4 A;  3PNY A;  1YFH A;  3A01 A;  4AIK A;  3FXQ A;  4HST A;  1MND A;  2BV6 A;  2AXL A;  2OV7 A;  4IHY A;  1MDM B;  2MA3 A;  1MDM A;  3OYG A;  1SMY F;  2R7R A;  2L4M A;  1V4R A;  3K70 C;  4X1E A;  4ZTF A;  1TWA J;  3M4O J;  1SC7 A;  3R60 A;  4Y33 A;  4DNC A;  2NNN A;  5JHU A;  5HLI A;  3DBL B;  3CD6 I;  4LK1 F;  3GTM J;  5BOX A;  3H3U A;  4CCN A;  1D5V A;  2DOA A;  5E1W A;  4HA8 A;  4LIU A;  5H6R A;  1IN7 A;  4OIR F;  4WWC A;  2VXZ A;  3L7W A;  4EM0 B;  3KEO A;  2JUC A;  4CO8 A;  1VQ8 I;  4KMF A;  4V19 K;  1IC8 A;  4A3J J;  3HRT A;  3MVP A;  1IXR C;  2FSW A;  3ABK H;  3FIW A;  4C3I J;  2ELH A;  2H94 A;  1I1G A;  2E1M B;  4BDZ A;  2JRT A;  2A05 A;  4MIM A;  1YI2 I;  2F6C A;  3FXO A;  4A3C J;  2VB6 A;  2K4B A;  3U1K A;  3LSK A;  4B3X A;  4A5M A;  2M8G X;  4AD9 A;  2QBY B;  4KYW A;  3V8J A;  3KYC B;  4E7S A;  3ABT A;  4GGG A;  2NS8 A;  1KON A;  1RR7 A;  3KP4 A;  1U9N A;  2EBI A;  3TDZ C;  3VYT B;  4G12 A;  1RR8 C;  5HDK A;  4GDF A;  1Z91 A;  4O6J A;  5FKL A;  1FBU A;  1OYW A;  3UKG A;  2M4G A;  5IYD J;  1G6N A;  4IHT A;  1IRG A;  2IGK A;  2RRE A;  4PSW A;  2BZT A;  4YEJ A;  5BMZ A;  3PQJ A;  5F6F A;  4CYC B;  3ZRG A;  1IAW A;  1H9T A;  2DDA A;  3H5A A;  3KZZ A;  3RJP A;  2HYF A;  1WI3 A;  2DCE A;  3HOW J;  1ZRF A;  2HS5 A;  2VXD A;  3BT9 A;  5J1U A;  4MHG A;  5D4R A;  5CVJ A;  4JYK A;  2H8R A;  2EFN A;  2QQB A;  1P4A A;  4LFU A;  1ZR2 A;  3EDP A;  5BS6 A;  1BL0 A;  2DT5 A;  3S1R J;  2R5Y A;  2F4M B;  2OJE D;  1R71 A;  1RKT A;  4P1W A;  3HPH A;  2EA4 A;  1LDD A;  2X6W A;  2XC7 A;  1OMI A;  2OU2 A;  4IKF A;  2UUZ A;  3D0S A;  5EZH A;  4IRG A;  1ZLJ A;  2X1C A;  5HNH A;  3OL4 A;  1LEB A;  3OYL A;  2TRT A;  2OD5 A;  4CYC A;  2MW8 A;  1MMN A;  5IT3 A;  2CQN A;  1G59 A;  5J40 A;  1T33 A;  2LH9 A;  4ZYG A;  2O8X A;  2Z5U A;  2VI6 A;  3IH2 A;  4A5N A;  5LFA A;  1O57 A;  3HKZ N;  1YTY A;  4JX4 A;  2WB1 N;  3ECO A;  4Z2Y A;  2MLG A;  2W00 A;  3ONQ A;  2RC4 A;  4ANJ A;  1FWZ A;  5LEJ A;  3QYB A;  2KDO A;  3NWS A;  4XN0 A;  2GWR A;  4U7D A;  2NNY A;  2R7V A;  1FZP B;  1ZHF A;  2KMU A;  1HKS A;  2IA2 A;  2ZJ2 A;  4G6Q A;  3I0T A;  3FXR A;  1R4N B;  2QQ9 A;  3LFK A;  3JAM Z;  3DEW A;  5E1X A;  4DZJ A;  1LFU P;  1X4O A;  3SZG A;  1U5T A;  2FML A;  5K1Y A;  4RM3 A;  5F1R A;  3TO7 A;  5FGM A;  2MC4 A;  2UZK A;  3HYI A;  3QQA A;  4Y15 A;  2IXS A;  2M7B A;  1R00 A;  3H5N A;  4RGU A;  2VAS A;  3H5R A;  1HC8 A;  4KN4 X;  2AQF A;  3ZOB A;  3J7Y J;  3DP7 A;  2BXY A;  1TT5 B;  2FOK A;  2B7E A;  2ME0 A;  2BOL A;  5FRM A;  3ZQ7 A;  1C0W A;  1X2N A;  4GYG A;  4E7K A;  2DMT A;  2XAU A;  4HEA 2;  4X0G A;  1IGN A;  5LRS A;  5IPA A;  1SAN A;  3P9C A;  4GRI A;  3T0Y A;  1YG2 A;  2KIS A;  1IDY A;  2CU7 A;  1I3A A;  1GHC A;  3M3Y J;  2ZKZ A;  1F43 A;  1VF9 A;  1KZH A;  4F92 B;  2FRH A;  1WJC A;  1LKX A;  1Z7U A;  2X51 A;  4HW0 A;  2Y0S N;  3BTL A;  4IO9 F;  4R79 A;  1BC8 C;  2P4W A;  2DTR A;  3ISP A;  1Z7L A;  3CQZ J;  1T95 A;  1L3L A;  2HR3 A;  1ZTR A;  3I5U A;  1MBJ A;  3OL3 A;  2OBP A;  4B48 A;  5K5R A;  3JW4 A;  2CQK A;  1ZN2 A;  2COB A;  4KIT B;  3IV5 A;  1HDD C;  3AG1 H;  4I02 A;  3IAM 2;  3HRM A;  4D9J A;  2BY0 A;  4OAZ A;  1WJB A;  4DYC A;  4IF4 A;  1BJZ A;  3ZN0 A;  2P8T A;  4ZDL A;  3S16 J;  1ZR4 A;  2PJP A;  3EET A;  2FX0 A;  4BBR J;  2XKP A;  2H6B A;  2GA2 A;  5LEK A;  5GAH J;  1ZQ3 P;  1FY7 A;  5TRD A;  3IAS 2;  3O8G A;  4XKB A;  3JRG A;  2CGP A;  4IQJ A;  4NB5 A;  3WE3 A;  1ON1 A;  1QZY A;  4IJA A;  3CCE I;  2CFO A;  3EUH C;  1H9G A;  1UB9 A;  2DMQ A;  2JN6 A;  3I9V 2;  2XPW A;  2I5U A;  3BY6 A;  2DK5 A;  3KP2 A;  3JRC A;  4QWQ A;  2V6E A;  3DTE A;  1D0X A;  3EQL F;  1OYY A;  4ZYD A;  2Z16 A;  1VI0 A;  2HNH A;  1U5T C;  5E3M A;  4LIV A;  1HBX G;  2GBY A;  3BR0 A;  1RC9 A;  3C2H A;  3FK7 A;  3D1N I;  4LG3 A;  4FAS D;  2ZFW A;  3G1L A;  3QWL A;  2DK8 A;  2IAI A;  4NNJ A;  1ZYR F;  4UVC A;  3I55 I;  2LD5 A;  1UZC A;  3ZMT A;  5LGN A;  2ZXW H;  1DU0 A;  3JSP A;  4L9N A;  1FT9 A;  1TWC J;  4XSX F;  3MKZ A;  2UWM A;  4RAZ A;  1IRX A;  2XGC A;  3A03 A;  4ZZD A;  2CW7 A;  1WRJ A;  1SD4 A;  2KIM A;  4NHJ A;  5BPI A;  3W3C A;  3QYF A;  4LLL A;  1MSE C;  2VKD A;  1RES A;  2MSY A;  3CJR B;  4A3K J;  1IV6 A;  1P7J A;  2KQR A;  4RGS A;  2O0Y A;  1XB4 A;  1EH6 A;  1O3R A;  4TV7 A;  1R49 A;  2HU9 A;  2RNG A;  1TLH B;  3SDG A;  3G3Z A;  2FNA A;  4U0Y A;  1G8X A;  1V54 H;  3GYH X;  3CDL A;  1Z1D A;  4Q48 A;  5FO5 A;  5B66 C;  2KIU A;  3GCM A;  3KYD B;  2CWE A;  2R0Q C;  1S7A A;  4P55 A;  2VJJ A;  2V1D A;  4XOP A;  4ZH4 F;  2QSH X;  2B0L A;  3HSR A;  5J3L A;  2K02 A;  1APL C;  1ZKG A;  4WX9 A;  3CJT B;  1QVT A;  2A68 F;  1JGS A;  1K83 J;  2PI0 A;  3RPU D;  2EFQ A;  4RLF A;  3WGH A;  1OYI A;  2LR8 A;  2ZO4 A;  3E5Q A;  4LIT A;  1RZ4 A;  4D5C A;  3CO7 C;  1FP1 D;  5IOZ A;  3VDX A;  3V42 A;  2IS1 A;  2IP2 A;  1HST A;  5A2Q K;  4EJW A;  2R7Z J;  3K1P A;  3BDD A;  1XSX A;  1CGP A;  5F08 A;  2K86 A;  3ZN1 A;  1J5Y A;  4C3J J;  1F9N A;  2E1N A;  4XLN F;  5EEA A;  5FLX K;  2EB7 A;  4M6Y A;  4G9Y A;  2W57 A;  1B72 B;  2Y75 A;  3D5L A;  3A0B C;  2K9M A;  1N25 A;  5HOD A;  4XIC A;  2VJ5 A;  1V5E A;  4F55 A;  2LG4 A;  2L02 A;  1V5G A;  3DEU A;  3CO6 C;  3VWB A;  2RKH A;  2R7U A;  3DFG A;  3LSH A;  1T0F A;  4PSX A;  3ECH A;  5JI6 A;  1WH5 A;  3DXJ F;  2EIK H;  2BY2 A;  4AID A;  1FOY A;  5CVV A;  4HZF A;  1ON2 A;  4ENJ A;  1YHQ I;  5E18 F;  4Y13 A;  4C3H J;  1UAA A;  3Q0U A;  1IO2 A;  1OLT A;  2ADU A;  1FX7 A;  4MO7 A;  2OZU A;  4XLH A;  2XAJ A;  4DYQ A;  2NVU B;  2IW5 A;  2VT2 A;  2RAE A;  1E3H A;  3GFM A;  3RPQ A;  5D6E A;  5E3N A;  4OOI A;  2Y9Z A;  3G1O A;  3PUF A;  3WG7 H;  2GZW A;  1R1V A;  2WTE A;  3GME A;  2FJ1 A;  1EKE A;  3RQI A;  3DPU A;  1MMS A;  1OCT C;  2DN0 A;  2XV4 S;  2M87 A;  1UG2 A;  2ETH A;  1Y0U A;  2LF7 A;  3ASO H;  1ZAO A;  2WC2 A;  3KIO A;  1WI9 A;  3LFU A;  5DYM A;  5FKO A;  2EQR A;  3P9I A;  1LVK A;  1AU7 A;  2ZXH A;  4D0P A;  3TDU C;  4M3G A;  4RBO A;  1ETQ A;  1R5G A;  4R8H A;  2H1K A;  2VBY A;  2EZI A;  1JUS A;  2E1C A;  1TQM A;  2K4J A;  2M7A A;  3BCA A;  3HOX J;  5CVI A;  2ZXJ A;  3JAM K;  1MMG A;  1O3Q A;  2D45 A;  3S1Q J;  4I0A A;  1JJ8 C;  4QLC U;  1LPQ A;  2JVH A;  3ZMZ A;  1DDN A;  4XM3 A;  4KT5 C;  5JVG F;  4HQE A;  2Y0S A;  1IN5 A;  4C9Y A;  2NRA C;  3OS0 A;  1RET A;  2ICW G;  1Z6T A;  3HXL A;  3TGN A;  3SQN A;  3FXM A;  1UCR A;  4KT6 A;  4BXF A;  2W85 A;  1XG1 A;  2A3S A;  2RNJ A;  3M1E A;  1ZRE A;  1E0E A;  2LVS A; 
#chains in the Genus database with same CATH homology
 3KP5 A;  4L9V A;  2PMU A;  2EV0 A;  2NYX A;  4EM1 A;  4HF1 A;  1R1T A;  3ZMV A;  1UFM A;  4G8X A;  2Q2E A;  3IWF A;  5IT9 Z;  1E2X A;  3GFL A;  5AON A;  3K0L A;  3LA2 A;  2VBZ A;  5LHH A;  1U8R A;  3RDI A;  4ESF A;  2NAZ A;  5LRR A;  5ED4 A;  1G3Y A;  1V3F A;  3L2C A;  1UHM A;  4CYD A;  1U5T B;  1YO5 C;  1G3W A;  2A61 A;  3W6K B;  5ILU A;  2Y0M A;  1IRF A;  5ERI A;  4XBF A;  4KDP A;  5BPD A;  4RGR A;  2STT A;  5HOO A;  1K79 A;  4M73 A;  2VOP A;  1KU2 A;  1STZ A;  4O3M A;  3QU6 A;  4MNU A;  4LLG F;  3K69 A;  3E97 A;  2FBH A;  2JPB A;  2Z99 A;  2GQQ A;  1PDN C;  1Z6R A;  2KJC A;  1FYK A;  3TOA A;  2XKO A;  3J81 K;  5A2Q Z;  2L54 A;  2Z9O A;  2UXN A;  2QM3 A;  1ZLK A;  4M9S A;  1FSE A;  1QO0 D;  3KLN A;  2F5C A;  1BI3 A;  4GYI A;  4HF0 A;  1B6A A;  2IA1 A;  1TNT A;  3ZMU A;  3BP8 A;  5DCM B;  2UXX A;  3OOP A;  3I59 B;  2LF8 A;  3RKW A;  3KP3 A;  3BJO A;  2L3D A;  1SD7 A;  2FBI A;  3K9T A;  3RIR A;  4CXF A;  1GXQ A;  2IRF G;  2PFB A;  5JFR A;  1P4X A;  2G7U A;  4RS8 A;  1JXS A;  1EH7 A;  3L9F A;  3COA C;  1R7J A;  3I54 A;  6PAX A;  1FNN A;  1BIB A;  4JQF A;  3ERE D;  1KQ9 A;  5HDG A;  3BJ6 A;  2HTS A;  5ILV A;  3ZP5 A;  3HOS A;  2KIF A;  3ZMD A;  4M71 A;  2F5F A;  4L0Z B;  1EV7 A;  3H92 A;  2M8E A;  3T8T A;  2FMY A;  1O7F A;  3MZH A;  3RYR A;  4GXO A;  3JTH A;  4KIB A;  4WXH A;  4RAY A;  3OV8 A;  3QOP A;  4HLX A;  3QP6 A;  2C6Y A;  2MLK A;  2G7H A;  4GCV A;  4FT8 A;  1YW7 A;  5L3G A;  1PP7 U;  4DQ2 A;  5E17 F;  2DQL A;  4CHU A;  4CZZ A;  4LB6 B;  3VB2 A;  3ZPL A;  1BI0 A;  2RQP A;  4L5I A;  1UHW A;  1HW1 A;  1QNT A;  4LG0 B;  2VC0 A;  2PBI A;  3W6J B;  5L3B A;  4Q5S F;  3MWM A;  3ABU A;  3WG9 A;  4LJZ F;  1ZH5 A;  2OZ6 A;  1YS6 A;  3R0A A;  4UV9 A;  5KVR A;  1J7K A;  5J6X A;  1MJA A;  4L18 B;  2HYG D;  4ENK A;  1O7L A;  4U0W A;  2L4A A;  1W7P A;  4WK8 F;  2QVO A;  3RKX A;  3BPV A;  3BOQ A;  4AIH A;  2PN6 A;  2LSO A;  5D6F A;  3HIF A;  1ZG3 A;  2D2W A;  4IRH A;  2PQ8 A;  4WF2 A;  2W24 A;  4RGX A;  2NS0 A;  2BGC A;  2P5L C;  2COM A;  5DD8 A;  3F8B A;  4NQW A;  1QQI A;  4I09 A;  4OIN F;  5LHI A;  5DUK A;  1D3Y A;  2FA5 A;  4LK0 F;  3N4M A;  4OMY A;  3J81 Z;  2IPQ X;  5FB2 A;  5D8L B;  1XGO A;  4AIJ A;  3ULQ B;  2MD5 A;  2W84 A;  1XCV A;  5DDG A;  4EGY A;  2PMH A;  3CUO A;  4BNC A;  1JHH A;  5BQT A;  2Y48 A;  1IN6 A;  1NHA A;  4HAM A;  3I53 A;  4I7H A;  1J9I A;  4HOB A;  2ZNY A;  2PLY A;  1R1U A;  4OIP F;  5F64 A;  3WE2 A;  5CVR A;  3BJA A;  4HQM A;  1RUN A;  4G7O F;  2V1U A;  4B8X A;  4G7H F;  4LB5 A;  3GWZ A;  2J5O A;  1LJ9 A;  1W5S A;  5JVT A;  4LLN A;  2P6T A;  3IRR A;  4BXU A;  1BJA A;  5DV5 A;  3WOD F;  2DU9 A;  4BYY A;  4U0V A;  2A6E F;  2ESH A;  5KK1 A;  2EK5 A;  2O6G E;  3TO6 A;  3FM5 A;  1FBQ A;  3LAP A;  1B9M A;  4HDV A;  1WWX A;  2Q0O A;  3P9K A;  2AS5 F;  1BM9 A;  1R23 A;  3IKV A;  1RIO H;  2ACJ A;  2HQR A;  2CYY A;  4EMS A;  1W5T A;  4O5V A;  3GVA A;  4ASN A;  3H3Z A;  4BHB A;  2PG4 A;  4HDU A;  1YW9 A;  2P5V A;  4EVI A;  2GA1 A;  4MEX F;  1W7P B;  1YW8 A;  3WTT C;  3N97 A;  3BWG A;  2VE8 A;  4JBA A;  4PGG A;  2DO7 A;  4ZYH A;  1AOY A;  4S05 A;  3WU0 A;  2DI3 A;  4CDG A;  1W4M A;  4A12 A;  3TOB A;  4EJO A;  4LGW A;  3IC7 A;  4N0B A;  2EA2 A;  1P6R A;  4FX4 A;  5EEG A;  3M8E A;  4WXC A;  4H0E A;  3CJN A;  1LB2 A;  3Q5F A;  4BQA A;  3Q9S A;  1G3T A;  4KIC A;  5K5O A;  4HV5 A;  5E8G A;  1FYL A;  3CDH A;  1DPU A;  2M30 A;  1FBS A;  4N9I A;  1U6G A;  3I71 A;  3V4G A;  1ZG5 A;  2RV8 A;  3GO5 A;  3WTS C;  4B09 A;  2HKO A;  1J75 A;  4IXA A;  2A07 F;  2L01 A;  2DBB A;  3E6B A;  4MEY F;  3ML6 A;  1UST A;  4I0B A;  3HRS A;  5HLH A;  5L3F A;  1B9N A;  3T1B A;  2HEO A;  1ZGJ A;  1O3T A;  1J0R A;  3B73 A;  3HTU A;  1IW7 F;  4ETS A;  3VFZ A;  2XIG A;  4ZYE A;  1BI1 A;  4CGZ A;  4OU0 A;  1J2X A;  1YS7 A;  1S8N A;  5J8F A;  3HUG A;  3SZT A;  2IA0 A;  1XDU A;  2XRN A;  1U3E M;  3HHH A;  4KMU X;  3DKW A;  2QYO A;  2RDP A;  2W25 A;  4HBL A;  4BHC A;  2MH2 A;  2P5K A;  3GW2 A;  1TQI A;  1KGS A;  2CO5 A;  3K2Z A;  3WTW C;  4KFC A;  1I27 A;  2DW4 A;  1IN4 A;  1KYW A;  3KET A;  4R1H A;  3IRQ A;  5E20 A;  1YQA A;  3GZ6 A;  1LEA A;  3FWE A;  2X0L A;  3MQ0 A;  5CYV A;  2HDC A;  1S3J A;  1S7O A;  1ODD A;  2XRO A;  2EFO A;  3RYP A;  2XAG A;  3KP7 A;  3IHU A;  3LQQ A;  2ESN A;  3E5X A;  1HW5 A;  5L3E A;  1PUE E;  1IXC A;  2H09 A;  4A0Y A;  3I58 A;  2M1B A;  1WKM A;  2HOE A;  2OQR A;  1IN8 A;  3LA3 A;  1FSH A;  4HV6 A;  4ESJ A;  5HDN A;  2VE9 A;  1OR7 A;  1YIO A;  3V7R A;  2HZT A;  3WTZ A;  1DP7 P;  3O3K A;  1P2F A;  1BBY A;  2VBW A;  5D5U B;  1IZ1 A;  3F8C A;  1IXS B;  5FFZ A;  1SD6 A;  2XVC A;  3J80 K;  5H6Q A;  2VON A;  3IWZ A;  3FXU A;  1D8J A;  4A2U A;  3Q9V A;  5D5X B;  5IT9 K;  1W7P D;  3HSF A;  3QP5 A;  1ZRC A;  4E70 A;  2Z3Y A;  3MZY A;  2K7L A;  1TBX A;  2VN2 A;  4EJU A;  4YIF A;  3LWF A;  1Z9C A;  2FU4 A;  4YFK F;  4KNY A;  1KU9 A;  4A0X A;  4KN7 X;  3I4P A;  3LAJ A;  1SD5 A;  3GUD A;  2V1X A;  4RB1 A;  4RB0 A;  5E1Z B;  1OPC A;  1R58 A;  2IT0 A;  5TJJ A;  5DCM A;  5LLQ A;  3AAF A;  1MGT A;  3O6B B;  5ICF A;  5LHG A;  3BRO A;  1I5Z A;  1XN7 A;  3QRF F;  1P4W A;  1K7A A;  1TTY A;  5FLX Z;  3GZ5 A;  3QU3 A;  3WTU C;  1B4A A;  4U88 A;  1BI2 A;  2FNP A;  3F8M A;  3KFW X;  5H20 A;  1FOK A;  2A5Y B;  2WWY A;  3TO9 A;  2BYV E;  3V7S A;  3J80 Z;  1XGS A;  4XSZ F;  2R7D A;  4IHS A;  2DFI A;  2Q8K A;  1K6O A;  5HVQ C;  3E3V A;  3WGI A;  1XCB A;  3NRV A;  2CSO A;  5LGT A;  2XAF A;  4L9J A;  2VOD A;  1QPM A;  4UV8 A;  3CUQ A;  3KE2 A;  2E7X A;  4Y17 A;  3SZP A;  3WU1 B;  2LDU A;  2VT3 A;  3PQK A;  3GFI A;  2HGC A;  3LST A;  2EV6 A;  4P9U A;  4YFN F;  2EFP A;  3E6D A;  1U78 A;  1JHF A;  1XSV A;  4I98 B;  2QEN A;  1T38 A;  5D5W B;  3I64 A;  3CLO A;  3IKT A;  5HS7 A;  4Q4Z F;  4I2O A;  1R22 A;  1TW2 A;  5D4S A;  3IL2 A;  2YU3 A;  3TKY A;  1XDS A;  4BHP A;  2OA4 A;  1SMT A;  3CUQ C;  2Z33 A;  4LG0 A;  1IUY A;  3HSE A;  3BPX A;  1K78 A;  3T5X A;  1DPR A;  4YII A;  1GVJ A;  1WSU A;  4WCG A;  2M45 A;  3P7N A;  2BEO A;  1YLF A;  4HX4 A;  4M9X A;  1F5T A;  1P92 A;  4HF2 A;  3QAH A;  2P6S A;  1U2W A;  5ICE A;  5FD5 A;  1GXP A;  2EJR A;  2QBY A;  4Q47 A;  1LDK B;  2A6H F;  2FEZ A;  3F22 A;  4IRI A;  3FZV A;  2V6C A;  4KIF A;  2JZY A;  1R36 A;  1KYZ A;  2H6C A;  3GX4 X;  5J8C A;  2M5W A;  3DPL C;  2QLZ A;  1I6X A;  1ULY A;  1Q1H A;  3DPT A;  1F1Z A;  3M8F A;  2JTV A;  3S2W A;  2BBY A;  2H27 A;  4RB2 C;  4XLP F;  2LKP A;  3F72 A;  4ENM A;  1TNS A;  3R61 A;  5CVU A;  5DCF A;  2VC1 A;  1R5H A;  4A0Z A;  2FXA A;  1F4K A;  4UHT A;  3FF5 A;  4M6X A;  3MFK A;  2FE3 A;  2HQN A;  5ICC A;  2RGV A;  2CG4 A;  2A69 F;  1BOA A;  3GLX A;  2LNB A;  1LNW A;  3REO A;  1QBJ A;  3LQR A;  3I59 A;  4L9T A;  3U9G A;  4A6E A;  1ONV A;  1JE8 A;  2ZME A;  5AIP A;  5D8K B;  5FD6 A;  3M9A A;  2MBF A;  1T6S A;  3R0J A;  3EUH A;  4ENN A;  4AVP A;  3U1D A;  3DF8 A;  3F23 A;  2DAO A;  1ZRD A;  3G73 A;  3R6S A;  4BH9 A;  1XGM A;  4EM2 A;  2ISZ A;  2O03 A;  3GF2 A;  4P5O A;  1B1B A;  2F5E A;  2HTJ A;  1WQ2 A;  1KQ8 A;  1BC7 C;  2G9W A;  2CFX A;  1RNL A;  3CUQ B;  4MQV A;  1BN5 A;  5E8I A;  3SHF A;  5CLS A;  3L00 A;  5L3D A;  5HLG A;  2DPU A;  2KKO A;  4UXN A;  2CW0 F;  3FMS A;  3KLO A;  1RUO A;  3GFJ A;  1HSJ A;  3FMR A;  4L0Y B;  1USS A;  1PP8 F;  1MKM A;  2QZ8 A;  4ON0 A;  3WGG A;  5LGU A;  3VEP A;  2F5D A;  1T98 A;  4ESB A;  3HTS B;  1L0O C;  3F3X A;  5K5Q A;  3GEZ A;  4BAY A;  5HS9 A;  4OMZ A;  4G7Z F;  2V9V A;  3L09 A;  1MD0 A;  3JSO A;  3QPH A;  2BE5 F;  4P96 A;  3MAJ A;  4G94 A;  3SXY A;  1FYM A;  1FP2 A;  3TQN A;  4RB3 C;  3RI4 A;  2GXB A;  3J7A O;  3NEU A;  2DLL A;  4M74 A;  3WTY C;  5FFX A;  3K1M A;  1S29 A;  1MZB A;  2YX4 A;  5D5V B;  4ZZL A;  1DUX C;  1X3U A;  4MQ9 F;  2FF4 A;  2R7F A;  3MCZ A;  4OIO F;  1KQ0 A;  4YG2 F;  3VOE A;  4P9F A;  1KU3 A;  4LD5 A;  2F2E A;  1SFU A;  3V7C A;  3KEQ A;  4MGR A;  1HQC A;  1HW2 A;  3K1N A;  2HFH A;  3RKY A;  2K27 A;  5DEQ A;  3JTG A;  3O2P E;  2JT1 A;  1SFX A;  4EGZ A;  2HWV A;  4HYE A;  4PGH A;  2RN7 A;  3KP6 A;  1T2K A;  2ZNZ A;  1CF7 B;  2YR2 A;  1SFE A;  2KJB A;  4HX8 A;  1LVA A;  3QPT A;  2X4H A;  2XGX A;  1LDJ A;  4K2E A;  1IF1 A;  3DV8 A;  4IVN A;  1H0M A;  4WXD A;  4L5J A;  5DD4 A;  4FHT A;  1KA8 A;  1VTN C;  4N9H A;  5DUI A;  4UVB A;  3FHZ A;  3F6O A;  1CF7 A;  2GAU A;  4UNO A;  3C18 A;  2IVM A;  1T39 A;  2IJL A;  3HRU A;  5ILS A;  2DQR A;  4F7Z A;  3ROU A;  5LBQ A;  2E7W A;  3FM3 A;  2P7C B;  4UUV A;  3CTA A;  4XRF A;  2EWN A;  2D1H A;  3E5U A;  4YFX F;  4PDK A;  5AIQ A;  3KZY A;  1XSD A;  1EH8 A;  2JSC A;  2FBK A;  2ZBK A;  3E6M A;  2FQ3 A;  1QGP A;  4KIG A;  2JPC A;  1ZAR A;  1TW3 A;  3V8K A;  1HKT A;  1E17 A;  1Z05 A;  3T8R A;  2ZCW A;  2XAQ A;  3MEX A;  2VOO A;  1XD7 A;  3DQV C;  4G6D A;  1J59 A;  1FC3 A;  4HLY A;  1XMK A;  2YSR A;  1FPQ A;  4OIQ F;  1OKR A;  4EJV A;  1KU7 A;  4M9Z A;  3M7G A;  5ICG A;  3V8L A;  1QZZ A;  2MH9 A;  1K78 B;  2XAH A;  2GXG A;  4U7B A;  3E6C C;  1LQ1 A;  2V79 A;  3FMQ A;  3C7J A;  3HHG A;  1ZG1 A;  2ZME B;  1AWC A;  2STW A;  2XUB A;  2YX7 A;  2ISY A;  3ELK A;  5CJ9 A;  5JR3 A;  4S04 A;  5L3C A;  4MTE A;  2P7V B;  2O3F A;  2XHK A;  4EJT A;  4IPA A;  2QWW A;  1S6L A;  2DPD A;  3RTR A;  2MC3 A;  4AWX B;  1D8K A;  1G3S A;  3NQO A;  2R3S A;  1SAX A;  4LMY A;  2D1V A;  3PFI A;  4PCQ A;  1YYV A;  4JK1 X;  4FX0 A;  3HOT A;  3KCC A;  3WTV C;  3C1D A;  2EV5 A;  3F6V A;  3WTX C;  4M72 A;  5HS8 A;  3SFZ A;  2XAS A;  1B59 A;  2YPR A;  1XGN A;  2WV0 A;  2VBX A;  4KUM A;  1HXD A;  2KRF A;  4UVA A;  2QQA A;  1TQP A;  1BIA A;  1MJB A;  3F21 A;  2OQG A;  2HKX A;  3FX3 A;  3GXO A;  1RI7 A;  3BZ6 A;  3LA7 A;  4I01 A;  2O61 A;  2RVC A;  1G4D A;  2EFW A;  3EYI A;  1REP C;  3EYY A;  4GO1 A;  4A6D A;  4MTD A;  4EQQ A;  2J5P A;  1FLI A;  5EEH A;  3RPU A;  3VOD A;  4HX7 A;  4CIC A;  2QUF A;  2OAZ A;  3C3W A;  3U2R A;  3R4K A;  1O3S A;  2GIV A;  1A04 A;  4EV0 A;  1MJ9 A;  4PZJ A;  1XMA A;  3ZMS A;  1ZGA A;  3F8F A;  3F8N A;  2TDX A;  1I1S A;  2PEX A;  3B02 A;  1HKQ A;  4KA4 A;  1YFH A;  4AIK A;  3FXQ A;  2BV6 A;  2AXL A;  1MDM B;  2MA3 A;  1MDM A;  1SMY F;  2L4M A;  1V4R A;  3R60 A;  4DNC A;  2NNN A;  5JHU A;  5HLI A;  4LK1 F;  5BOX A;  3H3U A;  1D5V A;  5E1W A;  4HA8 A;  5H6R A;  1IN7 A;  4OIR F;  4WWC A;  2VXZ A;  3L7W A;  4EM0 B;  3KEO A;  4KMF A;  4CO8 A;  3HRT A;  1IXR C;  2FSW A;  2ELH A;  2H94 A;  1I1G A;  2JRT A;  2K4B A;  4A5M A;  4KYW A;  4AD9 A;  2QBY B;  3V8J A;  3ABT A;  4GGG A;  3KP4 A;  3TDZ C;  5HDK A;  1Z91 A;  4O6J A;  1FBU A;  1OYW A;  1G6N A;  4IHT A;  1IRG A;  5BMZ A;  3PQJ A;  5F6F A;  1IAW A;  1H9T A;  3KZZ A;  3RJP A;  2HYF A;  1ZRF A;  2HS5 A;  4MHG A;  5D4R A;  5CVJ A;  2EFN A;  2QQB A;  1P4A A;  4LFU A;  3EDP A;  5BS6 A;  2DT5 A;  2EA4 A;  1LDD A;  1OMI A;  2OU2 A;  3D0S A;  4IRG A;  1ZLJ A;  1LEB A;  2OD5 A;  5IT3 A;  4ZYG A;  2O8X A;  2Z5U A;  4A5N A;  1O57 A;  1YTY A;  3ECO A;  4Z2Y A;  2MLG A;  2RC4 A;  1FWZ A;  5LEJ A;  4U7D A;  2GWR A;  2NNY A;  1FZP B;  1ZHF A;  1HKS A;  2IA2 A;  2ZJ2 A;  4G6Q A;  3I0T A;  3FXR A;  2QQ9 A;  3LFK A;  3JAM Z;  5E1X A;  1U5T A;  2FML A;  5K1Y A;  5F1R A;  3TO7 A;  5FGM A;  2UZK A;  3HYI A;  4Y15 A;  1R00 A;  4RGU A;  4KN4 X;  3DP7 A;  2FOK A;  3ZQ7 A;  1C0W A;  4GYG A;  5LRS A;  3P9C A;  3T0Y A;  1YG2 A;  1GHC A;  2ZKZ A;  2FRH A;  1Z7U A;  4HW0 A;  4R79 A;  1BC8 C;  2P4W A;  2DTR A;  3ISP A;  1L3L A;  2HR3 A;  3I5U A;  2OBP A;  5K5R A;  3JW4 A;  2CQK A;  1ZN2 A;  4I02 A;  3HRM A;  4IF4 A;  3ZN0 A;  2P8T A;  2PJP A;  3EET A;  2XKP A;  2H6B A;  2GA2 A;  5LEK A;  1FY7 A;  5TRD A;  2CGP A;  3WE3 A;  4NB5 A;  1ON1 A;  1QZY A;  4IJA A;  1H9G A;  1UB9 A;  3BY6 A;  2DK5 A;  3KP2 A;  4QWQ A;  4ZYD A;  1OYY A;  3EQL F;  1U5T C;  1HBX G;  2ZFW A;  2DK8 A;  1ZYR F;  4UVC A;  3ZMT A;  5LGN A;  3JSP A;  4L9N A;  1FT9 A;  4XSX F;  2UWM A;  4RAZ A;  4ZZD A;  1WRJ A;  1SD4 A;  2KIM A;  4NHJ A;  5BPI A;  4LLL A;  4RGS A;  2O0Y A;  1XB4 A;  1EH6 A;  1O3R A;  4TV7 A;  1TLH B;  3G3Z A;  2FNA A;  4U0Y A;  3GYH X;  1Z1D A;  4Q48 A;  5FO5 A;  2KIU A;  2CWE A;  1S7A A;  4P55 A;  2V1D A;  4ZH4 F;  2B0L A;  3HSR A;  2K02 A;  4WX9 A;  2A68 F;  1JGS A;  2PI0 A;  2EFQ A;  3WGH A;  1OYI A;  2ZO4 A;  3E5Q A;  1RZ4 A;  3CO7 C;  1FP1 D;  2IP2 A;  1HST A;  5A2Q K;  4EJW A;  3K1P A;  3BDD A;  1XSX A;  1CGP A;  2K86 A;  3ZN1 A;  1J5Y A;  1F9N A;  2E1N A;  4XLN F;  5FLX K;  2EB7 A;  4M6Y A;  4G9Y A;  2W57 A;  2Y75 A;  3D5L A;  2L02 A;  3DEU A;  3CO6 C;  2RKH A;  3DFG A;  1T0F A;  3ECH A;  5JI6 A;  3DXJ F;  5CVV A;  4HZF A;  1ON2 A;  4ENJ A;  5E18 F;  4Y13 A;  2ADU A;  1FX7 A;  2OZU A;  2XAJ A;  2IW5 A;  2VT2 A;  3GFM A;  3RPQ A;  5D6E A;  4OOI A;  2GZW A;  1R1V A;  2WTE A;  2XV4 S;  2M87 A;  2ETH A;  1Y0U A;  2LF7 A;  1ZAO A;  2WC2 A;  1WI9 A;  5DYM A;  3P9I A;  4D0P A;  3TDU C;  1R5G A;  4R8H A;  2VBY A;  2E1C A;  1TQM A;  2K4J A;  5CVI A;  2ZXJ A;  3JAM K;  1O3Q A;  2D45 A;  4I0A A;  4QLC U;  3ZMZ A;  1DDN A;  4KT5 C;  4HQE A;  1IN5 A;  2NRA C;  1Z6T A;  3TGN A;  3SQN A;  1UCR A;  2W85 A;  3M1E A;  2A3S A;  2RNJ A;  1ZRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...