1I3QJ

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1i3qJ00
4FISA 2B63J 1NK3P 5EGOB 1FIPA 1RR7A 2MG4A 1MSEC 5J1UA 1BW5A 4CYCB 3BTCA 3JRDA 2XGCA 3S17J 2W48A 5EG0B 3S2HJ 5J3LA 4DYCA 5F0HA 3JR9A 3QPSA 2R5ZB 4BY7J 1Y1VJ 2FD5A 4A3BJ 3A02A 2R5YB 1D5YA 2L7FP 3HEFA 2CUEA 2XSDC 5JLWA 2H1KA 2ID6A 4A3JJ 1RKWA 4X6AJ 3JRHA 1HOMA 2DMPA 3CDLA 3TW7A 1JUPA 2NVTJ 5IPAA 5EZGA 2LKXA 2HI3A 2KDZA 4IHXA 3IH4A 4EEFG 2HXIA 3HGGA 1DU6A 1Q1VA 2ME0A 4A3LJ 1ETKA 5IYCJ 3OSFA 3GTKJ 1K61A 2EBIA 2M0CA 4XRMA 4RDUA 1AHDP 3BTLA 2IEKA 5J1RA 3G1LA 1ZK8A 1HDDC 1Y1WJ 5IP7J 1TC3C 2JA7J 5IP6A 4DYQA 4JYKA 3ZQFA 2CUFA 1FTZA 3TW6A 3ZQGA 2DA7A 3GTMJ 1BA5A 1AU7A 5F1JA 5HODA 1JJ6C 3BQZA 3G1MA 1LE8B 4MIMA 1MBGA 1MH3A 2L7MP 2LTPA 3ZQCA 4FE7A 1QVTA 3K7AJ 3LSGA 2PMZN 2DA1A 1FTTA 3ZQHA 1ETWA 4DW6A 1U9NA 4RBOA 4C2MJ 1BJZA 3HOVJ 1IG7A 2DMUA 3JRAA 2H8RA 1HLVA 5F27A 3GTPJ 5E3MA 1B72A 3O8HA 3WHCA 3B6CA 1JUMA 3G1OA 2E2JJ 2LP0A 2DMTA 4UUTA 1ETQA 4NDLA 3ZOBA 1IUFA 3VPRA 4A3CJ 2WB1N 5JLXA 2LK2A 3OOUA 2JJ7A 2LR8A 4MLOA 3S1RJ 3HGYA 4BXXJ 3QPLA 2NOGA 3BR1A 3BTJA 1WPKA 2K9NA 4M3GA 1LFBA 1UHSA 1MBFA 2COBA 2XGEA 4MO7A 4GFBA 3W6VA 2WV1A 5J1YA 4M3BA 2XRLA 4I6ZA 1JKOC 2EZLA 2X6OA 1ZR4A 4B4CA 1QRYA 1TWFJ 3LOCA 4XRSG 1IV6A 3CCYA 2I10A 2YS9A 1ORKA 1FIAA 2EH3A 2DTZA 5M5YJ 5FKOA 1WCMJ 1VFCA 4DZJA 3JRBA 3LSPA 2EZHA 2MGQA 1T56A 1B8IB 1W0TA 1BW6A 3FKIJ 5M5XJ 2K9SA 2JA8J 3JRGA 2DA5A 3RKQA 4IHWA 2OPTA 2EZKA 4AYBN 3BR0A 1W0UA 1FEXA 2FJ1A 2GLOA 2CRGA 4FCYA 4D5FA 1R9TJ 3HOYJ 2TCTA 5FKLA 5GPAA 3LNQA 3RZDJ 5M3FJ 3NAUA 2KT0A 3BT9A 2K40A 1MBHA 1JT0A 2YU9J 1VI0A 4QSHA 5K7ZA 4IHVA 2ELKA 1O4XA 2M9HA 1HF0A 4A3GJ 3NARA 4M3FA 3A01A 3CMYA 5EZHA 3S1MJ 4M6VA 3RQIA 3GBGA 1WI3A 2WAQN 3D1NI 4D7MA 2VPRA 5K7HA 2CJJA 1JTXA 3SFIA 5IOYA 3TEDA 4A3KJ 2AHQA 4M3EA 4G12A 1H8AC 1NK2P 1JT6A 2NVQJ 2D5VA 5F0CA 5FLMJ 3HOXJ 2JWTA 5EDNA 5DTDA 4QIWN 3S14J 3OIOA 3I4NJ 3FISA 4XICA 2LVSA 3BR2A 2ECBA 1U8BA 5FJ8J 5F04A 4A3IJ 5FKNA 2R0QC 1Z0XA 2CQXA 2XB5A 1F36A 3S15J 1X2NA 1JKQC 1GV2A 3DCFA 1JJ8C 4Y7NJ 1JGGA 3H3VK 5F08A 3RZOJ 5EF6A 2JMWA 2ME6A 3GTOJ 2L0KA 1IGNA 1X2MA 5EYRA 5FKKA 2DN0A 4XIDA 5FLVA 1ENHA 2EZIA 4FE4A 2E1OA 2ID3A 2DA3A 5GP9A 2IBDA 2XPWA 1GVDA 1ETYA 1IJWC 3TP3A 2VI6A 4BY1J 2TRTA 3CQZJ 2JK3A 4A3MJ 4AUXA 5K7FA 1AKHA 4X1EA 1OFCX 3GTJJ 4FTHA 2IAIA 1VNDA 3S1QJ 2XB0X 2LLKA 2OF7A 3BR5A 5EGOA 4ABZA 1BL0A 4JX4A 3BTIA 2HQ5A 9ANTA 3GTLJ 2O8KA 1WGXA 5EG0A 5IYBJ 2R5ZA 2HOTA 2ECCA 2HXOA 2K9QA 4HNVA 2Y9YA 3H0GJ 1GUUA 4Y52J 2EQRA 2LD5A 3PO2J 1OCTC 4XK4A 3B6AA 4JX6A 1MBEA 3HB9A 4L5EA 3JRCA 1UG2A 1JTYA 5IOZA 4V2GA 2Y0SN 3MKLA 1POGA 2MSYA 1ZGWA 3JREA 2CU7A 3Q0WA 2JA6J 1PUFA 4V2FA 3S2DJ 2DMNA 1TWGJ 1ETVA 2L9RA 2HOSA 4A3FJ 3MVPA 1ZQ3P 3JRIA 4S0HB 1P7IA 4A3EJ 1F43A 3BG3A 2O9LA 3FK7A 5C4XJ 1MH4A 1SFOJ 3HM5A 4C3HJ 5FKMA 1LFUP 3ZQIA 3PM1A 3Q0VA 4M3DA 2N8GA 3SJMA 5M5WJ 3Q0UA 4BKXA 1E3OC 3GTQJ 2DA2A 1WH7A 1QPIA 3Q3SA 5IP9J 2DA6A 2VKVA 3BR3A 4JP0A 1MNMC 1ETOA 1OCPA 4W1UA 3JRFA 2Y31A 1MSFC 2FX0A 1VF9A 3C2BA 2P81A 1AKHB 2NS8A 3I4MJ 1B72B 1I3QJ 3HKZN 4BBRJ 4MFDA 3HOZJ 1U9OA 1RETA 2LY9A 4B1RA 2M34A 5C44J 5BNGA 1JUSA 2XGDA 3FIWA 3DEWA 2E19A 1NTCA 2GM4A 4QTRA 1QVUA 1IDZA 3A03A 1SANA 1WH5A 1U78A 1OJLA 3HBLA 2QF7A 3IH2A 2GBYA 5EEAA 1Z77A 2XPVA 4W97A 1IRZA 2ZB9A 2E2IJ 2JN6A 2QCOA 3IH3A 2VUMJ 2M8GX 1PUFB 2LFBA 3F0CA 2FQ4A 5C4JJ 5M3MJ 5IYDJ 1IDYA 4UUSA 2DMQA 3O8GA 1TWHJ 3ZQLA 1JKPC 1I6HJ 4LOCA 3M4OJ 1P7JA 1APLC 4IHYA 1G2HA 2X48A 1EF4A 1ZKGA 2R92J 1XG1A 1YRNA 4B3AA 1S7EA 4A93J 1A6IA 1B8IA 5DS9A 3HOUJ 3BQYA 2R93J 1CQTA 5F0FA 3L1PA 3MN2A 4C3JJ 3BG9A 2X9DA 3FK6A 1GT0C 1ETXA 3IV5A 1RKTA 1RPWA 4D7NA 4CYCA 3GTGJ 3M3YJ 4BBSJ 3A01B 3E7LA 4DYRA 1ZR2A 2NVXJ 3LSRA 4DZPA 2DJNA 2HYJA 1UMQA 1XC5A 4A69C 3LSJA 2NVYJ 2R5YA 2MW8A 2O7OA 1GV5A 5GPCA 3PO3J 5E3NA 2DA4A 3QQAA 2XPUA 1JKRC 2M2EA 3WHBA 1HCRA 2AO9A 3UKGA 4A3DJ 2JA5J 1A5JA 2HDDA 2YUSA 1HDPA 1DU0A 1H88C 2VKEA 2L7ZA 1ITYA 1MBKA 1I50J 4MFEA 2E2HJ 4I76A 1TWAJ 1MBJA 5E3LA 1GDTA 1XS9A 1RESA 3OSGA 4J19A 4IEJA 1FJLA 2G0EA 1ZTRA 2NS7A 4AC0A 2Y30A 3HDDA 4C3IJ 3K2AA 2CQQA 4UUSB 2R7ZJ 4D5CA 3BR6A 3HOWJ 5E3OA 3S16J 2HOAA 1IC8A 1TWCJ 1X58A 2RAEA 3BG5A 1YRNB 3SDGA 3TP0A 1LE8A 4XRSA 5C3EJ 2Y9ZA 4JX5A 1H89C 1T33A 3S1NJ 2Y2ZA 1K83J
chains in the Genus database with same CATH superfamily
4FASD 1XMAA 4BAYA 4JOMA 4PGHA 2VONA 1FIPA 2MG4A 5J1UA 5JHUA 3GEZA 5DCFA 3H5AA 2JPCA 3BTCA 2BEOA 4CO8A 3ESWB 3L00A 5A2QZ 3OS0A 4DIQA 1R5HA 2W48A 4KNYA 3S2HJ 5J3LA 2KLOA 3QPSA 2R5ZB 4C9YA 1P6RA 4BH9A 4HV6A 4BY7J 4BHBA 2BY0A 3HSRA 3RYRA 1P4XA 4B3XA 3SHFA 4M71A 4EJOA 4E7HA 1D5YA 5J4VA 2L7FP 3HEFA 2BY3A 2XSDC 2EV6A 4NQWA 2EILH 3TO9A 2WY7Q 1RKWA 4IVNA 1Y0NA 1VQPI 4UHTA 5LHGA 4LJZF 2M7AA 4I7HA 2IGKA 4XL9A 1K4TA 4HX7A 2HGCA 4IHXA 4AD9A 3S8PA 3OL3A 5J40A 2JVGA 4XM3A 5LEJA 1DU6A 1Q1VA 1TT5B 2ME0A 2FRHA 5GTHC 3OSFA 2HKXA 1TLHB 3DU6A 2EBIA 1FOWA 3T5XA 4LG0B 1AHDP 2KFDA 3QYEA 3OYBA 1ZK8A 3OYKA 1HDDC 3NWSA 1R7JA 2CUFA 1BI3A 4ITVA 5J6XA 2R7XA 3KP6A 3F8NA 4HBLA 5HS7A 2P5LC 3GTMJ 1BA5A 3CCUI 2HNHA 2VT2A 2E34A 1XDSA 4WCGA 1JJ6C 2AQEA 4RM3A 1MH3A 1QHGA 2WA0A 4XLNF 2DT6A 4Q5SF 2XVCA 2PMZN 2DA1A 4EGYA 3KYCB 3ZQHA 1O3QA 4MTDA 2H8WA 5LHHA 3LAJA 2BVMA 5LGTA 1Z9CA 2VJ5A 4YEJA 1BJZA 2BXZA 1TT0A 1IG7A 4BJTA 1HLVA 5F27A 3PIPF 1U5TB 4KICA 5HDKA 4X0GA 3T8TA 5E3MA 2RNGA 3M8EA 3WHCA 2VBWA 5L3BA 3KYDB 1I6XA 3W2AA 3DBLB 2BY2A 2HDWA 3ZOBA 4A3CJ 1JE8A 3RI4A 3C18A 3BC8A 1P9QC 2ZKZA 2EFQA 3QPLA 2EA2A 2IS4A 2IS1A 2A05A 2K9NA 4EJUA 4M3GA 4G6DA 4EV0A 1HW5A 1ZRFA 4MO7A 4IRIA 3LQQA 2KZGA 2XSJC 4K2EA 4M3BA 2QKMB 1JKOC 1ZR4A 1SFKA 1I5ZA 4EATA 3LSIA 4HG2A 1XPXA 2MLGA 5ICGA 2BVLA 3S3OA 2UXXA 3RYPA 1FP1D 1ORKA 3LA2A 2DTZA 4OAZA 2F5DA 4FHTA 3KPHA 4QLCU 1BBYA 3R6SA 3QYBA 3CLQA 4UV9A 1RI7A 3I71A 2MD0A 1HQCA 1T56A 2CS3A 1W0TA 1BW6A 5IT9K 1IRXA 3WODF 3HXLA 3DV8A 3DEUA 2HDCA 2LNBA 3RKQA 4OIOF 4IHWA 1RNLA 1Y39A 3J80Z 3HJEA 1YITI 2EZKA 2F48A 2A68F 4AYBN 1PYVA 2QQ9A 4CYDA 2QYOA 3SQNA 1W0UA 5J4YA 2KMUA 4D1QA 2DW4A 2RC4A 2GLOA 2R7VA 1D8KA 1V4RA 1R9TJ 1HKTA 5FKLA 1V55H 1BR1A 2EJRA 2MC4A 4D0PA 3NAUA 5K5OA 2KIQA 4B8XA 5GAGJ 2RQPA 1IN4A 3PNVA 4IHVA 5HOOA 1H9GA 2ELKA 3VYUB 4P55A 1FP2A 1O4XA 4N0BA 3AKZA 3S1MJ 3RQIA 4HA8A 4MHGA 1WI3A 5K7HA 4XMYA 2BZTA 1RR8C 4M9ZA 3I53A 3TEDA 5EEGA 2HQNA 4XOTA 2QM3A 1WJFA 2OBPA 3E1SA 1H8AC 1JT6A 3VSKA 1MGTA 3HOXJ 1YJ9I 4BXUA 5DTDA 2JZYA 4R79A 2F4IA 1TNSA 1DPRA 4PZJA 3GFMA 3M8FA 1NHAA 5B66C 2CQXA 2Y0SA 2KJBA 1ULYA 2XUBA 2XC7A 3QRFF 1MMAA 3V4GA 3CP8A 5CQGA 2JMWA 1V54H 2L0KA 2K3FA 5EYRA 1MD0A 2DN0A 1VQKI 4XIDA 2Q1ZB 4ZYAA 4ZZLA 2ID3A 3GF2A 3GMEA 1X4OA 5GP9A 1HXDA 3FXRA 1HSJA 2XPWA 4A0XA 4HF2A 4OMYA 1IJWC 1DGWY 4XSXF 3CQZJ 5A2QK 2LH9A 1Z6RA 5LLQA 4X1EA 1D5VA 3GTJJ 1XSDA 2KHMA 3ZQQA 4FTHA 1ZREA 4FX4A 2XB0X 2VKHA 4L0ZB 4JX4A 3VYTB 3HHGA 1ERDA 3OYAA 3H0DA 3MMYB 3DTIA 3J81Z 5EG0A 3R61A 1FBQA 3DWLE 3ZR8X 2ZMEA 2ECCA 3DPLC 2K9QA 1J59A 2BOLA 4L9VA 4LITA 3WGHA 4CCOA 1HKQA 1YW7A 2R7OA 2MA3A 4RB0A 1LFPA 4Y52J 1CGPA 2LD5A 2IGMA 3L2VA 1OCTC 5JI6A 4XK4A 2I5UA 3AFHA 1P2FA 2M45A 4XKVA 4N4NB 2R7QA 4XORA 4AWXB 1I3AA 2BE5F 2EV0A 2IS2A 3BZCA 4L5EA 4PSXA 2DYSH 4II3A 4CXFA 4F52A 2JA6J 3WTYC 4O5VA 5D8KB 1ZGJA 3HTUA 3IC7A 3G4SI 2XAJA 1WJBA 2L9RA 2ZCWA 3KYLA 2LDUA 1QZYA 1DP7P 1TP4A 1UAAA 2V1DA 1ZQ3P 3O2PE 3KZIC 1P7IA 1F1ZA 2Z2SB 3X2QH 3V8JA 1IO2A 3BG3A 3FK7A 1MKMA 5C4XJ 4HLYA 2PJRA 1HW2A 1RIOH 1LFUP 2GQQA 5ED4A 3PM1A 3SJMA 4M3DA 2JRTA 5M5WJ 3GTQJ 3KCCA 3BZ6A 3H3UA 3FXJA 2CW0F 1RUNA 5IP9J 4JP0A 4LG3A 1K78B 2DQRA 4RAYA 4G7OF 2O3FA 1V5GA 5J8FA 4XKCA 2WBMA 2HKOA 1OCZH 3I4MJ 3RCOA 2E1NA 1O7LA 1JHFA 4IJAA 1DQUA 1JHHA 1WWXA 5HVQC 3OYHA 2FBIA 2O6GE 1U9OA 1E17A 1YOVB 4CSWA 2A3SA 1TNTA 4HOBA 2JSPA 2XGDA 2MC3A 3I55I 4S05A 2V1UA 2MYSA 3W3CA 2IGNA 3EETA 3GWZA 4QTRA 2BBYA 4RB1A 3A2KA 1IDZA 1UELB 1FBSA 1MNDA 3HBLA 2KIFA 4E4HA 3IH2A 2ZFUA 2B0LA 2ADUA 4JQFA 2LBFB 1MMGA 1Z77A 3CZ6A 2FMYA 4RGSA 2DBBA 2E2IJ 4YIFA 1Y56A 5CLSA 4I02A 3IH3A 1XB4A 2PEXA 2VUMJ 1ZARA 2CH0A 2V4JC 4ANJA 4HZFA 1PUFB 3HSFA 2LFBA 4BGDA 2DPDA 3I64A 3HUGA 2IA0A 2LREA 1WVRA 2ZSHB 3KP4A 3OR2C 2L3DA 1G3YA 3O8GA 1FPQA 4LIVA 5LRRA 1IXCA 3IHUA 2X85A 4LOCA 3L2UA 4JBAA 2A5WA 2CG4A 2IGOA 3J80K 4IHYA 2X48A 4EJWA 1J09A 3HRTA 4OMZA 1R49A 2ZBKA 3QOPA 2K02A 1BI0A 1B8IA 4DGWB 3HOUJ 3BQYA 1T0FC 4YFNF 3TDUC 4AM3A 3MN2A 4RS8A 2X9DA 4CCKA 2WAEA 2C6YA 2LMDA 1YYVA 3CCQI 3OYFA 1GHCA 3FXQA 4NC8A 3ZXSA 5DCMB 5H6QA 3K4BA 4XLPF 1FMWA 4MQVA 3E7LA 3I0TA 2UWMA 2M5WA 3AG3H 1D0YA 3FWEA 1X19A 4DZPA 4NB5A 1OYWA 3SEQA 3CD6I 1T08B 2DOFA 1MZBA 2O7OA 1USTA 2M30A 3IAS2 5LGNA 4FQGA 3QQAA 1A35A 4I98B 2M2EA 2AO9A 2Y69H 3UKGA 1IAWA 3C3WA 3BY6A 5FRMA 1DU0A 3ML6A 1KU7A 2NVUB 1W36C 4HX8A 1MBKA 2XAFA 1X1AA 1I50J 4Y3OA 1KU9A 2RQQA 3ABMH 3N4MA 1GDTA 4OINF 4UV8A 1WJCA 3SXYA 1T95A 2L9NA 5EJCA 5HLHA 3FM5A 4J19A 3FMQA 2NS7A 1J75A 4BQNA 2L9SA 1F5TA 3KP5A 3K2AA 3DBHB 4A5MA 4ESJA 2ZXWH 3OS2A 4D5CA 3HOWJ 3IWZA 5JHFA 2BXYA 2WV0A 3BWGA 5KHDA 4KT5C 3S16J 2XAHA 4WXHA 3TOBA 2EFNA 4B44A 2HTSA 3BG5A 1YRNB 2FNAA 3L2CA 3TP0A 2V9KA 3LL7A 4XRSA 4BE1A 3I54A 1G59A 3ZRGA 1TQIA 2Y2ZA 2TDXA 5CYVA 4FISA 3DKYA 1ZG5A 2LKPA 2B63J 5HLTA 2E5NA 1MSEC 5CQEA 5KAIC 1EA3A 3FX3A 3KEOA 4CYCB 3F23A 2AXTC 4ZJZA 1YIOA 4HX4A 5D6FA 2IPQX 4MGRA 4CA0A 5F1RA 5D5WB 3J81K 2LG4A 3F22A 5EG0B 1SC7A 3S17J 4WXCA 1BOBA 1Z3XA 3SZPA 4DYCA 5F0HA 1AOYA 2QZ8A 1U5TA 2ZMEB 4M9XA 4UB8C 2VBZA 5GTIC 2W7NA 4EM0B 4CZZA 2VLAA 1T0FA 2K27A 2XDVA 2EPFA 4BL0B 2VC0A 3K70D 1W4MA 2H1KA 3C7JA 2GIVA 4B43A 4IOAF 2VQHA 1YO5C 2RKHA 1X3ZB 3U1KA 3FBNB 1ON1A 3I56I 1UHWA 2CW7A 2DMPA 1ZG1A 3ELKA 6PAXA 3TW7A 1X1DA 4YRVA 2NVTJ 4RGXA 4F93B 2JTVA 3FF5A 2LF8A 3W2VA 1OMIA 3HIFA 1KZHA 2HI3A 2KDZA 3PNYA 3IH4A 3DPTA 2H09A 4I0BA 4EEFG 2E36A 2PLYA 1NG6A 1YQAA 4XLHA 1Z7UA 2Y75A 4A3LJ 4G6QA 3K4KA 2FQ3A 3GTKJ 1FC3A 1Z6TA 3L2RA 2DPUA 2M0CA 4XRMA 2PJRB 2EK5A 4FT8A 3BTLA 4UNOA 1IRFA 5IP7J 4HAMA 1ZRCA 4LLLA 3GCMA 3VB2A 3TW6A 4I01A 4XLEA 1LVAA 1ZRDA 1FSHA 1I1SA 1SMYF 4MTEA 1AU7A 1FBUA 5ILSA 5HODA 1E0EA 1XD7A 2D45A 3FXLA 3G1MA 2HEOA 4A5NA 2F4MB 1FWZA 1OQYA 1EH6A 2GA2A 4GRIA 3FMSA 2VN2A 2DDBA 3PFIA 4J00A 1B9MA 2FU4A 2G7UA 2YR2A 4AYBA 3BJ6A 4RBOA 4C2TA 4C2MJ 3EPZA 2DMUA 3JRAA 2H8RA 2O8XA 3WG7H 2VASA 1R1VA 1WRJA 1MNEA 3RSNA 2QQBA 3O8HA 1WFXA 3B6CA 1JUMA 3HPGA 2LP0A 5E18F 2DMTA 4UUTA 1UCRA 3KLOA 1BIAA 2MFZA 4NC7A 3BLYA 3OOUA 4KN7X 3WU0A 3S1RJ 1JGSA 4BXXJ 4CH7A 3BR1A 1Z21A 3I9V2 3BTJA 3OMYA 1BOAA 1DGRM 4NBQA 3SEZA 2R7SA 1K6YA 5H20A 2W4SA 3HL2A 1OYYA 3W6VA 4ENNA 2WV1A 3TO6A 2B9SA 2FBKA 3CCEI 2EZLA 2V1NA 2X6OA 4B4CA 1TWFJ 2FA5A 4PCQA 2OJED 4XRSG 1IV6A 1D0ZA 3CCYA 1NG7A 1U2WA 3WU2C 2X1EA 1IZ1A 4DOZA 4N9HA 3OYCA 4YFKF 5FKOA 1YW8A 4XLAA 4CHUA 4M6XA 3K10A 4BDZA 2VQLA 4DZJA 3JRBA 3LSPA 2W82A 3ZGKA 4BS9A 2AQFA 1T98A 3E6CC 3FMRA 3KEYA 1B8IB 4PFPA 1LDKB 2V79A 5M5XJ 4I2OA 4PGGA 3JRGA 2JA8J 2DA5A 2IP2A 2FXAA 3P9CA 2DYRH 3TO7A 3OYLA 3IRRA 1DUXC 4E7JA 2KISA 4IHSA 3KFWX 2H94A 2MH9A 1SFEA 4FCYA 4D5FA 4DBQA 3LNQA 4MEXF 2KJCA 4Y33A 5DEQA 1FSEA 2M4GA 1BM9A 2E35A 1FNNA 2VJIA 1MBHA 4LMYA 1R1TA 2CFXA 3DQVC 1VI0A 4QSHA 3V7SA 5K7ZA 1IN6A 3QYFA 2L4AA 2M9HA 3A01A 4BJ6C 2DFHA 4M9SA 2WY8Q 4M6VA 2VBYA 2G7HA 5D5UB 4KMUX 2R7WA 2VPRA 2ZNZA 3K1PA 2CJJA 3JW4A 1FX7A 3ROUA 2OC6A 2EB7A 3KETA 3VWBA 3HZJA 2QLZA 3PNTA 2YPRA 5CVRA 2L5QA 2IXSA 1E2XA 1NK2P 2NVQJ 2D5VA 1OR7C 5F0CA 3ZPLA 3WE3A 1QHHD 4CCLA 2ESHA 5EDNA 2VE9A 2XAGA 2ZJ2A 1LNWA 3S14J 2OZUA 2DDAA 4ZDPA 3I4NJ 4RAFA 2LVSA 1O57A 2DLLA 2X6XA 2DCEA 1U8BA 5FJ8J 3DPUA 4A3IJ 2CQ7A 5FKNA 3H5RA 1Z0XA 3ERED 2R0QC 1S8NA 2ZJPF 1F36A 1XSXA 1OCOH 2LSOA 2H6CA 3CF5F 2VPLA 1GV2A 3T8RA 1JJ8C 4Y7NJ 2HPMA 1VQ9I 5LFAA 4A12A 1SAUA 3RZOJ 2ME6A 3GTOJ 2JUCA 3K6GA 2NS0A 4LIUA 3V42A 2R7FA 3I4PA 5TRDA 4FE4A 3KZYA 2IBDA 1K78A 4KMFA 1G3WA 1MIJA 1X3WB 5LRSA 1GVDA 2X6WA 3LA3A 4A6DA 3IKVA 4BE2A 3TP3A 3A0HC 2TRTA 2JK3A 5ILVA 4L5JA 3VYSB 1OFCX 1BJAA 5ICEA 1T2KA 1VNDA 2OF7A 2QQ8A 5EGOA 3CESA 3VSLA 3L2QA 3P7NA 4GYGA 9ANTA 3K4NA 3QP6A 2O8KA 2CV2A 2DOAA 2KPMA 1REPC 2F5FA 1SD4A 4HNVA 4KYWA 1VQ7I 1GXQA 4UVCA 4KIBA 2VIXA 4P9UA 2WAQA 3RTRA 3V7RA 3K1NA 1HBXG 3PO2J 2V26A 3OYNA 1R23A 2LBFA 5FB2A 2PI0A 3TKYA 3REOA 2XGXA 3HB9A 1CF7A 4U0WA 4F91B 2FNPA 3ZN1A 1UG2A 2M7BA 1R4MB 3MKLA 2MSYA 3Q0WA 1RZ4A 3IAM2 4O3MA 1PUFA 3E5XA 5CJ9A 1A04A 3ABKH 1TWGJ 3JSOA 1IV8A 1ODDA 1SD5A 2LYCA 3GYHX 2Z99A 3BROA 3AG4H 1J7KA 2X4HA 1YG2A 3EQLF 4U7DA 2CSOA 3JRIA 4MQ9F 4A3EJ 1F43A 4M74A 2W25A 2O9LA 1PP8F 1MH4A 2X1DA 5FKMA 5L3CA 3QU3A 4HW0A 3CO7C 3CLOA 3Q0UA 1E3OC 2I8DA 4U7BA 2IRFG 2JRMA 3JTGA 3LMMA 1EV7A 1QPIA 3Q3SA 5LD2C 3WTXC 4LFUA 3D5SC 3CJTB 1KYWA 2LC2A 2JSCA 3TQNA 1R5GA 1X1BA 1VF9A 1S5LC 2DK8A 3F72A 1AKHB 1QA6A 5DCMA 3OYDA 2A69F 4A6EA 5FD6A 4A2UA 2M87A 1I3QJ 1VQ8I 4MFDA 3Q9VA 3HOZJ 2M0MA 5HNFA 3EYIA 3E3VA 5C44J 5BNGA 1JUSA 2IW5A 3FIWA 1TBXA 1O7FA 2FF4A 3DTKA 4ZYHA 1NTCA 1SD6A 2H1LA 3AL0C 1STZA 4WF2A 4ESFA 4Q47A 3A03A 1SANA 2HQAA 2QF7A 5DM6F 3KX2A 2GBYA 2V9PA 4AVZA 4BHPA 5EEAA 4DNCA 2GZWA 4CICA 2NAZA 5E1XA 4JK1X 3WTSC 3CTAA 4XBFA 4KJZA 5BQTA 2HU9A 2D1VA 3Q5FA 5M3MJ 5IYDJ 4ESBA 2FOWA 2W57A 5HDGA 1XGNA 2V9VA 4U88A 4AIJA 4M6YA 1TWHJ 5KVRA 1JKPC 2Z3YA 4BXFA 2GIZA 3RKYA 2CGPA 3M4OJ 1VQ5I 1Y8QB 4DJAA 5DM7F 2R92J 2YSRA 3EUHC 3K9TA 1XG1A 2XKPA 3K4JA 1YRNA 3VDXA 4A93J 4LD5A 5LHIA 3OOPA 4A0YA 3H3ZA 1IXSB 3C2GA 4MNUA 5JR3A 4PK4A 2OD5A 3IV5A 2O5RA 3HOSA 2COMA 2GWRA 2ZFWA 3L7WA 2X6YA 4D7NA 4CYCA 3WU1B 5HS9A 2Q8KA 4BBSJ 4ETSA 4HF1A 1J5YA 3A01B 3OYEA 4GCVA 1Z91A 2F5EA 1ONVA 3ZMZA 3GVAA 3HKZA 2CUZA 2HQRA 4KN4X 1QZZA 2MD5A 5CPRB 1TQPA 1FY7A 4XOPA 3I5UA 2MW8A 1GV5A 5E3NA 2DA4A 4BQOA 3CC7I 2XPUA 3HSEA 4L9JA 3BG6A 3OYGA 1I1GA 3M1CA 2JA5J 4P96A 2HDDA 3IUOA 3LFUA 3K69A 3CCJI 1H88C 3I59A 5DV5A 1XSVA 2VKEA 4FETA 2ZXJA 2NXNB 1YTYA 1B9NA 1ITYA 2CV1A 2E2HJ 3O6BB 3HYIA 1MBJA 3TDZC 2X51A 3H35A 4ZDLA 5HNHA 4E7LA 2G0EA 1WJ5A 5BOXA 4XLFA 2Y30A 3HDDA 4NNJA 4KFCA 4L18B 3WE2A 4HQMA 3BR6A 1BC7C 1D1BA 3RKWA 2BHZA 2B7EA 3QODA 2QKLB 3DLLF 1TWCJ 1X58A 3GFLA 3OR1C 3QP5A 2WADA 3CUOA 1MJAA 3N05A 1H89C 1HC8A 3DXJF 1K83J 3U2RA 4PJ0C 2ICWG 5EGOB 1RR7A 1BIBA 3LA7A 1BW5A 2OTLI 1GVJA 3JRDA 4KITB 3EDPA 3M07A 1KA8A 1D8JA 2RVCA 2NRAC 3EUHA 2NOJB 3KEQA 1XGMA 1Y1VJ 1R5ID 1D1AA 2HTJA 4A3BJ 3A02A 1YS7A 3D5LA 3GFJA 1VTNC 1B4AA 3R4KA 4WWCA 1XMXA 4HNTA 1LVKA 4U0VA 1XCVA 3W6KB 4J01A 3WTZA 5E20A 2CFOA 2FOKA 1CF7B 2ID6A 2PX9A 3CDIA 4X6AJ 3JRHA 2VOPA 1E3PA 1HOMA 3QWLA 4XN0A 3CCVI 5IPAA 1FYMA 2IA2A 3D0SA 2XIGA 5EZGA 5J47A 2LKXA 2F5VA 1VQOI 2OQRA 4IPAA 2HPIA 1U3EM 3F8CA 1P92A 1XMKA 4ZYGA 1ETKA 4XLCA 4NUBA 2UZKA 4AIDA 1MDMB 3MFKA 2CWEA 5J1RA 3G1LA 4XN3A 2VXZA 5FROA 2JA7J 5IP6A 4DYQA 2IJLA 3G3ZA 4JYKA 4BU2A 2FEZA 4HF0A 3LSTA 4IF4A 5IT3A 1S7OA 1XX5A 3IKTA 4UVAA 1AWCA 3QPTA 3IL2A 1S7AA 1TW3A 5TGTA 4IO9F 1LE8B 1MBGA 4GXOA 1YLFA 2UUZA 5L3DA 3WGGA 2PQ8A 1WKMA 1XN7A 3ZQCA 1QVTA 2J5OA 2X1CA 2UV1A 3H92A 2MBFA 4BE0A 3K2ZA 1IF1A 1U6GA 1ETWA 4RM2A 1U9NA 2QQAA 5LGUA 3L2WA 1ACIA 3BPVA 5ICFA 2NYXA 2BV6A 1ZG3A 3R0JA 5AIPA 3B73A 2JQ7A 3CJNA 3HRSA 5CKTA 3ECHA 3FXKA 5E1ZB 3SZGA 4HQEA 4ZH4F 4G9YA 3G1OA 1MW7A 2E2JJ 4UUVA 4XONA 1ETQA 2JVHA 5KAFC 1IUFA 3VPRA 2WB1N 5JLXA 5D8LB 3F8BA 3MD2A 3IRQA 4XNFA 1WHUA 3ULQB 1LFBA 1YS6A 2COBA 2XGEA 3F21A 4GFBA 3RPQA 1TZLA 3J7YJ 4HRIA 2STWA 2Z1DA 2ISYA 3MZHA 1H9TA 5J1YA 1IN7A 1OLTA 1X3UA 2BYVE 5ILUA 2K85A 4I6ZA 4ENMA 3E5UA 2JA2A 2O0YA 1A6QA 3LOCA 1SD7A 1U0JA 1XTAA 2K9LA 4E7SA 3JTHA 2I10A 2JPBA 3M8JA 3J7ZI 1DP3A 2VL8A 3LSMA 1W1WE 3BCBA 1FIAA 3K4MA 2EH3A 4PJLA 5M5YJ 3FBIB 1FZPB 1J9IA 4NHJA 1WCMJ 2EINH 1VFCA 4KIFA 2CW8A 1G3TA 2CMPA 5TISC 2CQNA 3TL4X 2HVRA 3MQ0A 2QVOA 2VB6A 3M7GA 1VQ4I 1IUYA 2QEXI 2OPTA 4BDYA 4ZTFA 2KP6A 4PDKA 1FEXA 2BHYA 2ZJRF 3K0LA 2GXGA 2CRGA 2KQRA 2OZ6A 3A4CA 2VT3A 3V7CA 3J7AY 3HOYJ 4IQ4A 2VJ4A 5GPAA 4BJ5C 1YX3A 1BR2A 2PMZA 3CO6C 5DD8A 2W24A 3BT9A 2GXBA 2V6CA 3KE2A 1KU2A 1JT0A 3BOQA 1FOKA 1KQ9A 4HYEA 3T1BA 4ZZDA 5BS6A 1B59A 4Z6YA 4NC6A 2J5PA 5D4RA 3TBIA 1HF0A 4A3GJ 1IN5A 3SYTA 5EZHA 3GBGA 2OQGA 4XKWA 4P5OA 4D7MA 5H2FC 3I59B 3D1NI 4ENJA 1SMTA 1JTXA 3LQRA 3SFIA 5IOYA 4A3KJ 4XSZF 2AHQA 2HFHA 4EQQA 3VYRB 2CV0A 3AG1H 5FLMJ 1B1BA 2L9VA 1UB9A 2IS6A 3WTUC 4QIWN 3OIOA 3ABUA 2L01A 3FKJA 3ZN0A 1LJ9A 2VQCA 4XQFA 1A36A 4OIPF 2BY1A 5F04A 5D6EA 1T38A 2XB5A 2A07F 4B48A 2X0LA 3S15J 1X2NA 1KU3A 3DCFA 2ZSIB 4BACA 4B09A 1JGGA 2CYYA 3H3VK 4F7ZA 5EF6A 1LKXA 2DU9A 2E1CA 3PUBA 1X2MA 2XRNA 5FKKA 1VQNI 5FLVA 1ENHA 2EZIA 3Q9SA 2EFOA 3CMAI 4M72A 2PN6A 1W36D 3BDDA 1ETYA 3OIQA 1QU3A 2F5CA 1X1CA 2VI6A 4BY1J 1VQMI 4R1HA 2DFIA 4A3MJ 3H9QA 4Y17A 1AKHA 3J7AO 1T6SA 3DP7A 3RQ4A 4ZC3A 1S72I 3DFGA 1NH3A 2JT1A 2LLKA 1BL0A 3BR5A 4QWQA 4ABZA 1G4DA 5J8CA 3BTIA 2IT0A 3G73A 4YFXF 1EH7A 3FHZA 3GW2A 1EKEA 1KYZA 3W2WA 2P6SA 4A0ZA 1O3SA 1TQMA 4O6JA 2IVMA 4I0AA 2RDPA 2HXOA 3CDHA 3R0AA 3E6DA 4CUGA 2Z5UA 1HKSA 2EQRA 1FOYA 2UXNA 4AVPA 4CZCA 1KQ0A 3S2WA 4LK0F 3OYMA 1N75A 4JX6A 4E70A 1QQIA 3OYIA 2PJPA 4BNCA 4E7IA 3NQOA 1Y6IA 3JRCA 1JTYA 4V2GA 5E17F 1D0XA 2CU7A 4LLGF 4KIGA 2P4WA 4YIIA 2P7VB 5E1WA 3E6MA 2LRDA 1I39A 3C2HA 4AIHA 3L09A 5DDGA 3MVPA 2K9MA 4KA4A 4S0HB 3H9JA 1P4WA 4E7ZA 2HYGD 5ICCA 2VE8A 1QPMA 2OV7A 4RB2C 1WJDA 4C3HJ 5AONA 5E8IA 1L3LA 2N8GA 3UNGC 4BKXA 4OWRB 4U87A 2DA6A 1WQ2A 3BR3A 1ETOA 5GADJ 5L3FA 1OCPA 4W1UA 4AU7A 2OCCH 2L54A 4QPQA 1MSFC 3HPHA 4RLFA 1SFUA 3G6EI 4YG2F 3HHHA 4RMNA 1WJAA 4KISA 3BP8A 3TOAA 3DF8A 4BEHA 4BBRJ 3VFZA 2LY9A 1OCRH 1ON2A 4B1RA 5D5VB 4CDGA 1FOXA 1VZ0A 2M34A 1ZLJA 4R8HA 3ZMSA 3DEWA 2E19A 2E5ZA 4IHTA 1X4PA 5FLXZ 3HC7A 2E1MC 1WH5A 2A5YB 3GO5A 1U78A 1OJLA 2R7TA 1DDNA 2K3PA 1VQLI 4CCMA 4HDVA 4XR6A 4HSTA 2L7KA 2PBIA 2VJJA 4II2A 2XPVA 1R36A 2ZB9A 5HDNA 1IRZA 4I09A 3TGNA 3ZMVA 5BMZA 4IOCF 3VEPA 1L0OC 3SFZA 4UB6C 1WZ2A 2O03A 3NRVA 1MJBA 1R4NB 2E60A 3FDYA 2FQ4A 3HRUA 3OWTA 1YHQI 3AAFA 3H9GA 4I99C 3FM3A 5DUKA 2EFPA 1BI1A 2Z9OA 2ZO4A 5EEHA 5LEKA 1LDJA 4EMSA 5KNLA 2WC2A 2XAUA 1P7JA 2M8EA 1G2HA 1EF4A 5FFXA 2R4GA 2XHKA 4G6TB 2FUG2 1ZH5A 1A6IA 3PQKA 5DS9A 2R93J 3PSIA 1BI2A 5DYMA 5F0FA 3L1PA 2F2EA 4C3JJ 3ZMTA 4Y13A 2OCEA 2A6TA 1Q1HA 2FMLA 1RPWA 2R7RA 2FSWA 2ELHA 3GTGJ 3M3YJ 4B47A 4HV5A 2QGUA 2L2OA 3QPHA 3LSRA 2VXDA 3S93A 4WXDA 2DJNA 3FXUA 1UMQA 4ON0A 4RGUA 1LEAA 3LSJA 2GOXB 2E7XA 4A69C 5GAEJ 2HVQA 2NVYJ 3ERMA 5GPCA 3RIRA 1FLIA 2OUMA 2HVSA 3DKXA 3FXMA 2ZXHA 3FHNA 1JKRC 2KIUA 1Y8RB 4A3DJ 3ECOA 4OOIA 5CVJA 3M1EA 1RRJA 2YUSA 1HDPA 4C30A 1W7PB 3M9AA 2DT5A 3DKWA 3ZCOA 2XF7A 3BJOA 3V8LA 2Z16A 2WWYA 3PQJA 5JVGF 1K7AA 2MH2A 3CF2A 4E6KG 3DU5A 2WTEA 4V19K 2DT7B 1TWAJ 1QBJA 5E3LA 5KK1A 1XS9A 3CJRB 1SVOA 1ZTRA 3WTWC 4C3IJ 1OISA 4IRHA 2Y0MA 1MDMA 5FRNA 1FYLA 2CQQA 4UUSB 3RDIA 5F64A 4P1WA 2ETHA 2RREA 5E3OA 3P5JA 4UVBA 1OR7A 3MZ8A 2P8TA 2VC1A 3JCUC 1IW7F 5CVUA 2RN7A 5GAHJ 2BGCA 4IX7A 2K86A 2YX4A 2RAEA 2Y48A 4H0EA 4RA2A 2W1OA 2BW3B 1I27A 1LE8A 2VQGA 3KP2A 2XF5A 1J2XA 3TMOA 3JAMZ 3N97A 4EJVA 3P9KA 1HSTA 2W00A 3HTSB 3E5QA 1QZEA 1USSA 1NK3P 3CCLI 2ZMEC 1R1UA 1S6LA 2DQLA 3QU6A 3EYYA 4OIRF 2XGCA 1PP7U 3F8FA 4RLQA 4EJTA 5FGMA 3B02A 3I3LA 3PIOF 3JR9A 3R60A 1BN5A 3EUKL 4YELA 4GO1A 2FD5A 2Q2EB 3IWFA 2R5YB 2ELJA 4BUPA 4IKFA 1MMNA 2CUEA 3KZZA 1Z05A 2KKOA 5JLWA 4L0YB 4A3JJ 1G3SA 2HR3A 2W84A 3PSFA 3ABTA 3WTVC 1XCBA 4FX0A 3CDLA 1JUPA 1MMDA 5IY5H 3GX4X 2PMUA 2ESNA 1UJ8A 3CCRI 1K79A 4IQJA 4HEA2 2WB1A 2R3SA 1R71A 2GAUA 2WAFA 2JUGA 2KRCA 5K1YA 2LY2A 3GXOA 3KP3A 1D1CA 3K4LA 4LB5A 1MJ9A 1IXRC 1Z67A 2HXIA 3NEUA 3HGGA 5KCMA 1F4KA 4HLXA 1KONA 4ZYEA 2P5VA 4XRFA 4UY8I 5IYCJ 3LSHA 3PUFA 2KRFA 1K61A 4CGZA 2ZXIA 3BZKA 3KP7A 4RDUA 1H0MA 2IEKA 2OU2A 1V5FA 4Q4ZF 1Y1WJ 1BR4A 1TC3C 3OIPA 2HWVA 3MZYA 3ZQFA 2EIMH 2XF6A 5B5EC 3K4CA 3CJQB 1FTZA 3ZQGA 2DA7A 3DBRB 5F1JA 1VQ6I 2G9WA 2FBHA 3S3NA 1AA7A 3BQZA 3V8KA 4MIMA 4IZZA 3NWTA 2QA4I 2L7MP 2L02A 2LOOA 2LTPA 2D1HA 5L3GA 1QNTA 3K7AJ 4FE7A 2E7WA 3LSGA 3RPUA 1ZELA 2P5KA 2LY1A 3F3XA 4HNUA 2XASA 3LSKA 1FTTA 4RGRA 5DD4A 4BEHB 4DW6A 3VOEA 4MEYF 3ZP5A 5JFRA 3WGIA 1K6OA 4ZYDA 3HOVJ 3ABLH 2GOMA 3U21A 3GTPJ 4LB6B 2E71A 5FLXK 3RPUD 1B72A 1Z3YA 3IP4B 4NDLA 3CCMI 1C0WA 3LFKA 4GYIA 5B3SH 1SVLA 3PL8A 2LK2A 1X1PA 3H1CA 2QSFX 2JJ7A 2LR8A 4MLOA 4NQWB 3HGYA 2FE3A 2NOGA 1KQ8A 2F6CA 1WPKA 5HLIA 1UHSA 1MBFA 2DFFA 4OU0A 5L3EA 4YIRX 1SEUA 5E79C 3I58A 2XRLA 2M4KA 3MEXA 1QRYA 2DFEA 1M1EB 1G6NA 2EIJH 3KIOA 3CUQC 4PJMA 2YS9A 4DQ2A 2K4JA 4E7KA 1YIJI 2PMHA 2HZTA 2OTJI 3ZMDA 5AIQA 2EZHA 2MGQA 4IL6C 4EVIA 4L5IA 3F8MA 3ONQA 3FKIJ 1R6RA 3WG9A 2K9SA 3GLXA 4BQQA 3COAC 2DI3A 4L9NA 1LPQA 2IA1A 3BR0A 3E97A 1TW2A 2FJ1A 3A1YA 3DEEA 4KT6A 5HLGA 4WX9A 1RC9A 4F92B 3U9GA 2TCTA 3F9KA 3RZDJ 2ACJA 4BHCA 5M3FJ 3CCSI 3LWFA 2KT0A 4EGZA 2VODA 2K40A 2YU9J 1G8XA 1O3RA 5FD5A 2ZC2A 5ERIA 2MLKA 2OA4A 2H27A 3RKXA 3DTEA 1PJRA 1K4SA 2QENA 3NARA 4M3FA 2DXIA 2R7UA 3CMYA 5FO5A 2VOOA 1XGSA 1HA8A 2WAQN 1ZN2A 3ASOH 3L9FA 1LQ1A 1EJ9A 2P0WA 2RV8A 3SDBA 2VBXA 2YU3A 4P9FA 1PDNC 1A31A 3BG7A 5BPIA 4M3EA 4G12A 1UG0A 2QBYA 3H36A 3E6BA 1S3JA 2JWTA 4RAGA 3MKZA 1XDUA 2K5CA 2RNJA 3FISA 4XICA 2E1MB 1PUEE 1XGOA 3BR2A 5K5QA 4GDFA 2ECBA 1IRGA 2A6HF 5B1AH 1LB2A 4KDPA 1UHMA 1TL8A 2V7FA 5TJJA 3T0YA 5H6RA 1ZHFA 2O61A 1JXSA 1BC8C 5CVVA 2QUFA 5D4SA 1YE9A 1JKQC 1ZGAA 3ISPA 4EM2A 4U0YA 3BJAA 5F08A 4N4OB 4M73A 3JAMK 1IGNA 2DAOA 3HRMA 4ZTJA 3K70C 2E1OA 3FZVA 1LUJB 3E0JB 2DA3A 1U5TC 3CMEI 2HOEA 3CUQA 4PJNA 3ZMUA 2GA1A 3W6JB 3MCZA 3D5RC 2XAQA 4ENKA 1SFXA 4AUXA 5K7FA 1N25A 1V5EA 2IAIA 2P7CB 1GLNA 1HW1A 3S1QJ 4G7ZF 1T39A 3A0BC 1WSUA 1LEBA 2VKDA 2DTRA 2R7DA 2HQ5A 3JSPA 3GTLJ 1Y0UA 1MMSA 1WGXA 2K4BA 2QSGX 1V3FA 4UXNA 5IYBJ 2STTA 2ISZA 3SZTA 2R5ZA 2HOTA 1QO0D 1YW9A 1S29A 2Y9YA 2CUJA 3H0GJ 4Z2YA 1GUUA 3K1MA 2Q0OA 2ZNYA 4RB3C 3O3KA 1E3HA 1P4AA 3B6AA 4C2UA 1J0RA 1MBEA 2DK5A 3VODA 3EUAA 3F6OA 1W5CC 5IOZA 2Y0SN 1ZGWA 1POGA 1Z7LA 3JREA 5E8GA 3BPXA 4BYYA 3ZQ7A 1RUOA 1R00A 2AXLA 2YX7A 4V2FA 3S2DJ 1WI9A 2DMNA 1N77A 1IN8A 1ETVA 2KIMA 3CC2I 2PFBA 2HOSA 3RJPA 4A3FJ 4OAYA 3BCAA 3OV8A 4L9TA 2AS5F 3C1DA 2DJIA 2ZJQF 1WJEA 1SFOJ 2QSHX 3HM5A 4LG0A 1D3YA 2PG4A 3ZQIA 1S9HA 3MKWB 3Q0VA 4PFOA 1UFMA 3GZ5A 4XKBA 2DA2A 4HSRA 1R22A 1WH7A 2QWWA 4PJJA 1KGSA 1UZCA 4QPOA 4IRGA 2VKVA 4F3QA 1MNMC 2KZVA 4G7HF 2HZDA 4LK1F 3JRFA 2Y31A 2A6EF 2FX0A 1T8IA 3C2BA 1OPCA 2P81A 1SVMA 2NS8A 1W5SA 3AG2H 4G8XA 1U8RA 3OS1A 1B72B 3OYJA 2M1BA 4AIKA 3HKZN 2DO7A 1RETA 3DLAA 2M3AA 3MAJA 3OL4A 2NNYA 4ASNA 5HS8A 2P6TA 3MKYB 1N78A 1TTYA 4PSWA 3HOTA 3GLLA 2GM4A 1QVUA 2LF7A 3ASNH 2EWNA 1ZLKA 5D5XB 1JI8A 2KDOA 1W7PA 3CP2A 5FFZA 4TV7A 3WTTC 1SAXA 4W97A 3AL0B 2D2WA 4LLNA 2JN6A 2GXAA 2EFWA 3MWMA 2QCOA 2EA4A 3G2BA 2CQKA 4Q48A 2M8GX 2V1XA 4DBRA 1ZAOA 3PFYA 2EIKH 4Y4RA 3GFIA 1EH8A 2HS5A 2A61A 3F0CA 1W7PD 2EV5A 3CC4I 1F9NA 1Z1DA 5C4JJ 3H5NA 5B1BH 1IDYA 1YX5A 4UUSA 2DMQA 1W5TA 1ZYRF 3ZQLA 1I6HJ 4D9JA 1YJWI 4PUSA 3GUDA 1APLC 4WK8F 1ZKGA 2NNNA 1R58A 4GGGA 2LKSA 4OIQF 2BW3A 4B3AA 1S7EA 2Z33A 2K7LA 3CMMA 5F6FA 5IT9Z 1OCCH 3PJRA 3UR3C 1CQTA 3S32A 3BG9A 1OYIA 1FYKA 2DODA 2L4MA 3FK6A 1GT0C 1ETXA 1YJNI 5BPDA 2MABA 1FT9A 1RKTA 1GXPA 3F6VA 4EM1A 4DYRA 1DPUA 1OKRA 1ZR2A 2NVXJ 2XKOA 2HYJA 4CCJA 1XC5A 4KUMA 5CVIA 2V6EA 3OY9A 2Q2EA 4ZDOA 2R5YA 2RGVA 3PO3J 1YI2I 1PVEA 3WHBA 1HCRA 3KLNA 3QOEA 1A5JA 2QBYB 2CO5A 4RAZA 5K5RA 3S3MA 3P9IA 2F4OB 1YFHA 1B6AA 2L7ZA 3GZNB 2XROA 2H6BA 2KL4A 4MFEA 4CCNA 4I76A 4F55A 4IXAA 1QGPA 1RESA 3OSGA 2HYFA 4HPQA 4IEJA 3HG9A 3GZ6A 1FJLA 5DUIA 3HUGB 4AC0A 1O3TA 4H4KC 4LGWA 4G94A 2R7ZJ 2DOEA 4Y15A 4S04A 3LAPA 1LDDA 1FMVA 2XV4S 2HOAA 1IC8A 3G71I 3CUQB 2OAZA 3FXOA 3SDGA 4HDUA 5JVTA 2KRHA 5C3EJ 4N9IA 2Y9ZA 5LBQA 4JX5A 3S1NJ 1T33A 4BQAA 2W85A 3QAHA 3U1DA
chains in the Genus database with same CATH topology
4FISA 2B63J 1NK3P 5EGOB 1FIPA 1RR7A 2MG4A 1MSEC 5J1UA 1BW5A 4CYCB 3BTCA 3JRDA 2XGCA 3S17J 2W48A 5EG0B 3S2HJ 5J3LA 4DYCA 5F0HA 3JR9A 3QPSA 2R5ZB 4BY7J 1Y1VJ 2FD5A 4A3BJ 3A02A 2R5YB 1D5YA 2L7FP 3HEFA 2CUEA 2XSDC 5JLWA 2H1KA 2ID6A 4A3JJ 1RKWA 4X6AJ 3JRHA 1HOMA 2DMPA 3CDLA 3TW7A 1JUPA 2NVTJ 5IPAA 5EZGA 2LKXA 2HI3A 2KDZA 4IHXA 3IH4A 4EEFG 2HXIA 3HGGA 1DU6A 1Q1VA 2ME0A 4A3LJ 1ETKA 5IYCJ 3OSFA 3GTKJ 1K61A 2EBIA 2M0CA 4XRMA 4RDUA 1AHDP 3BTLA 2IEKA 5J1RA 3G1LA 1ZK8A 1HDDC 1Y1WJ 5IP7J 1TC3C 2JA7J 5IP6A 4DYQA 4JYKA 3ZQFA 2CUFA 1FTZA 3TW6A 3ZQGA 2DA7A 3GTMJ 1BA5A 1AU7A 5F1JA 5HODA 1JJ6C 3BQZA 3G1MA 1LE8B 4MIMA 1MBGA 1MH3A 2L7MP 2LTPA 3ZQCA 4FE7A 1QVTA 3K7AJ 3LSGA 2PMZN 2DA1A 1FTTA 3ZQHA 1ETWA 4DW6A 1U9NA 4RBOA 4C2MJ 1BJZA 3HOVJ 1IG7A 2DMUA 3JRAA 2H8RA 1HLVA 5F27A 3GTPJ 5E3MA 1B72A 3O8HA 3WHCA 3B6CA 1JUMA 3G1OA 2E2JJ 2LP0A 2DMTA 4UUTA 1ETQA 4NDLA 3ZOBA 1IUFA 3VPRA 4A3CJ 2WB1N 5JLXA 2LK2A 3OOUA 2JJ7A 2LR8A 4MLOA 3S1RJ 3HGYA 4BXXJ 3QPLA 2NOGA 3BR1A 3BTJA 1WPKA 2K9NA 4M3GA 1LFBA 1UHSA 1MBFA 2COBA 2XGEA 4MO7A 4GFBA 3W6VA 2WV1A 5J1YA 4M3BA 2XRLA 4I6ZA 1JKOC 2EZLA 2X6OA 1ZR4A 4B4CA 1QRYA 1TWFJ 3LOCA 4XRSG 1IV6A 3CCYA 2I10A 2YS9A 1ORKA 1FIAA 2EH3A 2DTZA 5M5YJ 5FKOA 1WCMJ 1VFCA 4DZJA 3JRBA 3LSPA 2EZHA 2MGQA 1T56A 1B8IB 1W0TA 1BW6A 3FKIJ 5M5XJ 2K9SA 2JA8J 3JRGA 2DA5A 3RKQA 4IHWA 2OPTA 2EZKA 4AYBN 3BR0A 1W0UA 1FEXA 2FJ1A 2GLOA 2CRGA 4FCYA 4D5FA 1R9TJ 3HOYJ 2TCTA 5FKLA 5GPAA 3LNQA 3RZDJ 5M3FJ 3NAUA 2KT0A 3BT9A 2K40A 1MBHA 1JT0A 2YU9J 1VI0A 4QSHA 5K7ZA 4IHVA 2ELKA 1O4XA 2M9HA 1HF0A 4A3GJ 3NARA 4M3FA 3A01A 3CMYA 5EZHA 3S1MJ 4M6VA 3RQIA 3GBGA 1WI3A 2WAQN 3D1NI 4D7MA 2VPRA 5K7HA 2CJJA 1JTXA 3SFIA 5IOYA 3TEDA 4A3KJ 2AHQA 4M3EA 4G12A 1H8AC 1NK2P 1JT6A 2NVQJ 2D5VA 5F0CA 5FLMJ 3HOXJ 2JWTA 5EDNA 5DTDA 4QIWN 3S14J 3OIOA 3I4NJ 3FISA 4XICA 2LVSA 3BR2A 2ECBA 1U8BA 5FJ8J 5F04A 4A3IJ 5FKNA 2R0QC 1Z0XA 2CQXA 2XB5A 1F36A 3S15J 1X2NA 1JKQC 1GV2A 3DCFA 1JJ8C 4Y7NJ 1JGGA 3H3VK 5F08A 3RZOJ 5EF6A 2JMWA 2ME6A 3GTOJ 2L0KA 1IGNA 1X2MA 5EYRA 5FKKA 2DN0A 4XIDA 5FLVA 1ENHA 2EZIA 4FE4A 2E1OA 2ID3A 2DA3A 5GP9A 2IBDA 2XPWA 1GVDA 1ETYA 1IJWC 3TP3A 2VI6A 4BY1J 2TRTA 3CQZJ 2JK3A 4A3MJ 4AUXA 5K7FA 1AKHA 4X1EA 1OFCX 3GTJJ 4FTHA 2IAIA 1VNDA 3S1QJ 2XB0X 2LLKA 2OF7A 3BR5A 5EGOA 4ABZA 1BL0A 4JX4A 3BTIA 2HQ5A 9ANTA 3GTLJ 2O8KA 1WGXA 5EG0A 5IYBJ 2R5ZA 2HOTA 2ECCA 2HXOA 2K9QA 4HNVA 2Y9YA 3H0GJ 1GUUA 4Y52J 2EQRA 2LD5A 3PO2J 1OCTC 4XK4A 3B6AA 4JX6A 1MBEA 3HB9A 4L5EA 3JRCA 1UG2A 1JTYA 5IOZA 4V2GA 2Y0SN 3MKLA 1POGA 2MSYA 1ZGWA 3JREA 2CU7A 3Q0WA 2JA6J 1PUFA 4V2FA 3S2DJ 2DMNA 1TWGJ 1ETVA 2L9RA 2HOSA 4A3FJ 3MVPA 1ZQ3P 3JRIA 4S0HB 1P7IA 4A3EJ 1F43A 3BG3A 2O9LA 3FK7A 5C4XJ 1MH4A 1SFOJ 3HM5A 4C3HJ 5FKMA 1LFUP 3ZQIA 3PM1A 3Q0VA 4M3DA 2N8GA 3SJMA 5M5WJ 3Q0UA 4BKXA 1E3OC 3GTQJ 2DA2A 1WH7A 1QPIA 3Q3SA 5IP9J 2DA6A 2VKVA 3BR3A 4JP0A 1MNMC 1ETOA 1OCPA 4W1UA 3JRFA 2Y31A 1MSFC 2FX0A 1VF9A 3C2BA 2P81A 1AKHB 2NS8A 3I4MJ 1B72B 1I3QJ 3HKZN 4BBRJ 4MFDA 3HOZJ 1U9OA 1RETA 2LY9A 4B1RA 2M34A 5C44J 5BNGA 1JUSA 2XGDA 3FIWA 3DEWA 2E19A 1NTCA 2GM4A 4QTRA 1QVUA 1IDZA 3A03A 1SANA 1WH5A 1U78A 1OJLA 3HBLA 2QF7A 3IH2A 2GBYA 5EEAA 1Z77A 2XPVA 4W97A 1IRZA 2ZB9A 2E2IJ 2JN6A 2QCOA 3IH3A 2VUMJ 2M8GX 1PUFB 2LFBA 3F0CA 2FQ4A 5C4JJ 5M3MJ 5IYDJ 1IDYA 4UUSA 2DMQA 3O8GA 1TWHJ 3ZQLA 1JKPC 1I6HJ 4LOCA 3M4OJ 1P7JA 1APLC 4IHYA 1G2HA 2X48A 1EF4A 1ZKGA 2R92J 1XG1A 1YRNA 4B3AA 1S7EA 4A93J 1A6IA 1B8IA 5DS9A 3HOUJ 3BQYA 2R93J 1CQTA 5F0FA 3L1PA 3MN2A 4C3JJ 3BG9A 2X9DA 3FK6A 1GT0C 1ETXA 3IV5A 1RKTA 1RPWA 4D7NA 4CYCA 3GTGJ 3M3YJ 4BBSJ 3A01B 3E7LA 4DYRA 1ZR2A 2NVXJ 3LSRA 4DZPA 2DJNA 2HYJA 1UMQA 1XC5A 4A69C 3LSJA 2NVYJ 2R5YA 2MW8A 2O7OA 1GV5A 5GPCA 3PO3J 5E3NA 2DA4A 3QQAA 2XPUA 1JKRC 2M2EA 3WHBA 1HCRA 2AO9A 3UKGA 4A3DJ 2JA5J 1A5JA 2HDDA 2YUSA 1HDPA 1DU0A 1H88C 2VKEA 2L7ZA 1ITYA 1MBKA 1I50J 4MFEA 2E2HJ 4I76A 1TWAJ 1MBJA 5E3LA 1GDTA 1XS9A 1RESA 3OSGA 4J19A 4IEJA 1FJLA 2G0EA 1ZTRA 2NS7A 4AC0A 2Y30A 3HDDA 4C3IJ 3K2AA 2CQQA 4UUSB 2R7ZJ 4D5CA 3BR6A 3HOWJ 5E3OA 3S16J 2HOAA 1IC8A 1TWCJ 1X58A 2RAEA 3BG5A 1YRNB 3SDGA 3TP0A 1LE8A 4XRSA 5C3EJ 2Y9ZA 4JX5A 1H89C 1T33A 3S1NJ 2Y2ZA 1K83J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIS A;  2B63 J;  1NK3 P;  5EGO B;  1FIP A;  1RR7 A;  2MG4 A;  1MSE C;  5J1U A;  1BW5 A;  4CYC B;  3BTC A;  3JRD A;  2XGC A;  3S17 J;  2W48 A;  5EG0 B;  3S2H J;  5J3L A;  4DYC A;  5F0H A;  3JR9 A;  3QPS A;  2R5Z B;  4BY7 J;  1Y1V J;  2FD5 A;  4A3B J;  3A02 A;  2R5Y B;  1D5Y A;  2L7F P;  3HEF A;  2CUE A;  2XSD C;  5JLW A;  2H1K A;  2ID6 A;  4A3J J;  1RKW A;  4X6A J;  3JRH A;  1HOM A;  2DMP A;  3CDL A;  3TW7 A;  1JUP A;  2NVT J;  5IPA A;  5EZG A;  2LKX A;  2HI3 A;  2KDZ A;  4IHX A;  3IH4 A;  4EEF G;  2HXI A;  3HGG A;  1DU6 A;  1Q1V A;  2ME0 A;  4A3L J;  1ETK A;  5IYC J;  3OSF A;  3GTK J;  1K61 A;  2EBI A;  2M0C A;  4XRM A;  4RDU A;  1AHD P;  3BTL A;  2IEK A;  5J1R A;  3G1L A;  1ZK8 A;  1HDD C;  1Y1W J;  5IP7 J;  1TC3 C;  2JA7 J;  5IP6 A;  4DYQ A;  4JYK A;  3ZQF A;  2CUF A;  1FTZ A;  3TW6 A;  3ZQG A;  2DA7 A;  3GTM J;  1BA5 A;  1AU7 A;  5F1J A;  5HOD A;  1JJ6 C;  3BQZ A;  3G1M A;  1LE8 B;  4MIM A;  1MBG A;  1MH3 A;  2L7M P;  2LTP A;  3ZQC A;  4FE7 A;  1QVT A;  3K7A J;  3LSG A;  2PMZ N;  2DA1 A;  1FTT A;  3ZQH A;  1ETW A;  4DW6 A;  1U9N A;  4RBO A;  4C2M J;  1BJZ A;  3HOV J;  1IG7 A;  2DMU A;  3JRA A;  2H8R A;  1HLV A;  5F27 A;  3GTP J;  5E3M A;  1B72 A;  3O8H A;  3WHC A;  3B6C A;  1JUM A;  3G1O A;  2E2J J;  2LP0 A;  2DMT A;  4UUT A;  1ETQ A;  4NDL A;  3ZOB A;  1IUF A;  3VPR A;  4A3C J;  2WB1 N;  5JLX A;  2LK2 A;  3OOU A;  2JJ7 A;  2LR8 A;  4MLO A;  3S1R J;  3HGY A;  4BXX J;  3QPL A;  2NOG A;  3BR1 A;  3BTJ A;  1WPK A;  2K9N A;  4M3G A;  1LFB A;  1UHS A;  1MBF A;  2COB A;  2XGE A;  4MO7 A;  4GFB A;  3W6V A;  2WV1 A;  5J1Y A;  4M3B A;  2XRL A;  4I6Z A;  1JKO C;  2EZL A;  2X6O A;  1ZR4 A;  4B4C A;  1QRY A;  1TWF J;  3LOC A;  4XRS G;  1IV6 A;  3CCY A;  2I10 A;  2YS9 A;  1ORK A;  1FIA A;  2EH3 A;  2DTZ A;  5M5Y J;  5FKO A;  1WCM J;  1VFC A;  4DZJ A;  3JRB A;  3LSP A;  2EZH A;  2MGQ A;  1T56 A;  1B8I B;  1W0T A;  1BW6 A;  3FKI J;  5M5X J;  2K9S A;  2JA8 J;  3JRG A;  2DA5 A;  3RKQ A;  4IHW A;  2OPT A;  2EZK A;  4AYB N;  3BR0 A;  1W0U A;  1FEX A;  2FJ1 A;  2GLO A;  2CRG A;  4FCY A;  4D5F A;  1R9T J;  3HOY J;  2TCT A;  5FKL A;  5GPA A;  3LNQ A;  3RZD J;  5M3F J;  3NAU A;  2KT0 A;  3BT9 A;  2K40 A;  1MBH A;  1JT0 A;  2YU9 J;  1VI0 A;  4QSH A;  5K7Z A;  4IHV A;  2ELK A;  1O4X A;  2M9H A;  1HF0 A;  4A3G J;  3NAR A;  4M3F A;  3A01 A;  3CMY A;  5EZH A;  3S1M J;  4M6V A;  3RQI A;  3GBG A;  1WI3 A;  2WAQ N;  3D1N I;  4D7M A;  2VPR A;  5K7H A;  2CJJ A;  1JTX A;  3SFI A;  5IOY A;  3TED A;  4A3K J;  2AHQ A;  4M3E A;  4G12 A;  1H8A C;  1NK2 P;  1JT6 A;  2NVQ J;  2D5V A;  5F0C A;  5FLM J;  3HOX J;  2JWT A;  5EDN A;  5DTD A;  4QIW N;  3S14 J;  3OIO A;  3I4N J;  3FIS A;  4XIC A;  2LVS A;  3BR2 A;  2ECB A;  1U8B A;  5FJ8 J;  5F04 A;  4A3I J;  5FKN A;  2R0Q C;  1Z0X A;  2CQX A;  2XB5 A;  1F36 A;  3S15 J;  1X2N A;  1JKQ C;  1GV2 A;  3DCF A;  1JJ8 C;  4Y7N J;  1JGG A;  3H3V K;  5F08 A;  3RZO J;  5EF6 A;  2JMW A;  2ME6 A;  3GTO J;  2L0K A;  1IGN A;  1X2M A;  5EYR A;  5FKK A;  2DN0 A;  4XID A;  5FLV A;  1ENH A;  2EZI A;  4FE4 A;  2E1O A;  2ID3 A;  2DA3 A;  5GP9 A;  2IBD A;  2XPW A;  1GVD A;  1ETY A;  1IJW C;  3TP3 A;  2VI6 A;  4BY1 J;  2TRT A;  3CQZ J;  2JK3 A;  4A3M J;  4AUX A;  5K7F A;  1AKH A;  4X1E A;  1OFC X;  3GTJ J;  4FTH A;  2IAI A;  1VND A;  3S1Q J;  2XB0 X;  2LLK A;  2OF7 A;  3BR5 A;  5EGO A;  4ABZ A;  1BL0 A;  4JX4 A;  3BTI A;  2HQ5 A;  9ANT A;  3GTL J;  2O8K A;  1WGX A;  5EG0 A;  5IYB J;  2R5Z A;  2HOT A;  2ECC A;  2HXO A;  2K9Q A;  4HNV A;  2Y9Y A;  3H0G J;  1GUU A;  4Y52 J;  2EQR A;  2LD5 A;  3PO2 J;  1OCT C;  4XK4 A;  3B6A A;  4JX6 A;  1MBE A;  3HB9 A;  4L5E A;  3JRC A;  1UG2 A;  1JTY A;  5IOZ A;  4V2G A;  2Y0S N;  3MKL A;  1POG A;  2MSY A;  1ZGW A;  3JRE A;  2CU7 A;  3Q0W A;  2JA6 J;  1PUF A;  4V2F A;  3S2D J;  2DMN A;  1TWG J;  1ETV A;  2L9R A;  2HOS A;  4A3F J;  3MVP A;  1ZQ3 P;  3JRI A;  4S0H B;  1P7I A;  4A3E J;  1F43 A;  3BG3 A;  2O9L A;  3FK7 A;  5C4X J;  1MH4 A;  1SFO J;  3HM5 A;  4C3H J;  5FKM A;  1LFU P;  3ZQI A;  3PM1 A;  3Q0V A;  4M3D A;  2N8G A;  3SJM A;  5M5W J;  3Q0U A;  4BKX A;  1E3O C;  3GTQ J;  2DA2 A;  1WH7 A;  1QPI A;  3Q3S A;  5IP9 J;  2DA6 A;  2VKV A;  3BR3 A;  4JP0 A;  1MNM C;  1ETO A;  1OCP A;  4W1U A;  3JRF A;  2Y31 A;  1MSF C;  2FX0 A;  1VF9 A;  3C2B A;  2P81 A;  1AKH B;  2NS8 A;  3I4M J;  1B72 B;  1I3Q J;  3HKZ N;  4BBR J;  4MFD A;  3HOZ J;  1U9O A;  1RET A;  2LY9 A;  4B1R A;  2M34 A;  5C44 J;  5BNG A;  1JUS A;  2XGD A;  3FIW A;  3DEW A;  2E19 A;  1NTC A;  2GM4 A;  4QTR A;  1QVU A;  1IDZ A;  3A03 A;  1SAN A;  1WH5 A;  1U78 A;  1OJL A;  3HBL A;  2QF7 A;  3IH2 A;  2GBY A;  5EEA A;  1Z77 A;  2XPV A;  4W97 A;  1IRZ A;  2ZB9 A;  2E2I J;  2JN6 A;  2QCO A;  3IH3 A;  2VUM J;  2M8G X;  1PUF B;  2LFB A;  3F0C A;  2FQ4 A;  5C4J J;  5M3M J;  5IYD J;  1IDY A;  4UUS A;  2DMQ A;  3O8G A;  1TWH J;  3ZQL A;  1JKP C;  1I6H J;  4LOC A;  3M4O J;  1P7J A;  1APL C;  4IHY A;  1G2H A;  2X48 A;  1EF4 A;  1ZKG A;  2R92 J;  1XG1 A;  1YRN A;  4B3A A;  1S7E A;  4A93 J;  1A6I A;  1B8I A;  5DS9 A;  3HOU J;  3BQY A;  2R93 J;  1CQT A;  5F0F A;  3L1P A;  3MN2 A;  4C3J J;  3BG9 A;  2X9D A;  3FK6 A;  1GT0 C;  1ETX A;  3IV5 A;  1RKT A;  1RPW A;  4D7N A;  4CYC A;  3GTG J;  3M3Y J;  4BBS J;  3A01 B;  3E7L A;  4DYR A;  1ZR2 A;  2NVX J;  3LSR A;  4DZP A;  2DJN A;  2HYJ A;  1UMQ A;  1XC5 A;  4A69 C;  3LSJ A;  2NVY J;  2R5Y A;  2MW8 A;  2O7O A;  1GV5 A;  5GPC A;  3PO3 J;  5E3N A;  2DA4 A;  3QQA A;  2XPU A;  1JKR C;  2M2E A;  3WHB A;  1HCR A;  2AO9 A;  3UKG A;  4A3D J;  2JA5 J;  1A5J A;  2HDD A;  2YUS A;  1HDP A;  1DU0 A;  1H88 C;  2VKE A;  2L7Z A;  1ITY A;  1MBK A;  1I50 J;  4MFE A;  2E2H J;  4I76 A;  1TWA J;  1MBJ A;  5E3L A;  1GDT A;  1XS9 A;  1RES A;  3OSG A;  4J19 A;  4IEJ A;  1FJL A;  2G0E A;  1ZTR A;  2NS7 A;  4AC0 A;  2Y30 A;  3HDD A;  4C3I J;  3K2A A;  2CQQ A;  4UUS B;  2R7Z J;  4D5C A;  3BR6 A;  3HOW J;  5E3O A;  3S16 J;  2HOA A;  1IC8 A;  1TWC J;  1X58 A;  2RAE A;  3BG5 A;  1YRN B;  3SDG A;  3TP0 A;  1LE8 A;  4XRS A;  5C3E J;  2Y9Z A;  4JX5 A;  1H89 C;  1T33 A;  3S1N J;  2Y2Z A;  1K83 J; 
#chains in the Genus database with same CATH topology
 4FAS D;  1XMA A;  4BAY A;  4JOM A;  4PGH A;  2VON A;  1FIP A;  2MG4 A;  5J1U A;  5JHU A;  3GEZ A;  5DCF A;  3H5A A;  2JPC A;  3BTC A;  2BEO A;  4CO8 A;  3ESW B;  3L00 A;  5A2Q Z;  3OS0 A;  4DIQ A;  1R5H A;  2W48 A;  4KNY A;  3S2H J;  5J3L A;  2KLO A;  3QPS A;  2R5Z B;  4C9Y A;  1P6R A;  4BH9 A;  4HV6 A;  4BY7 J;  4BHB A;  2BY0 A;  3HSR A;  3RYR A;  1P4X A;  4B3X A;  3SHF A;  4M71 A;  4EJO A;  4E7H A;  1D5Y A;  5J4V A;  2L7F P;  3HEF A;  2BY3 A;  2XSD C;  2EV6 A;  4NQW A;  2EIL H;  3TO9 A;  2WY7 Q;  1RKW A;  4IVN A;  1Y0N A;  1VQP I;  4UHT A;  5LHG A;  4LJZ F;  2M7A A;  4I7H A;  2IGK A;  4XL9 A;  1K4T A;  4HX7 A;  2HGC A;  4IHX A;  4AD9 A;  3S8P A;  3OL3 A;  5J40 A;  2JVG A;  4XM3 A;  5LEJ A;  1DU6 A;  1Q1V A;  1TT5 B;  2ME0 A;  2FRH A;  5GTH C;  3OSF A;  2HKX A;  1TLH B;  3DU6 A;  2EBI A;  1FOW A;  3T5X A;  4LG0 B;  1AHD P;  2KFD A;  3QYE A;  3OYB A;  1ZK8 A;  3OYK A;  1HDD C;  3NWS A;  1R7J A;  2CUF A;  1BI3 A;  4ITV A;  5J6X A;  2R7X A;  3KP6 A;  3F8N A;  4HBL A;  5HS7 A;  2P5L C;  3GTM J;  1BA5 A;  3CCU I;  2HNH A;  2VT2 A;  2E34 A;  1XDS A;  4WCG A;  1JJ6 C;  2AQE A;  4RM3 A;  1MH3 A;  1QHG A;  2WA0 A;  4XLN F;  2DT6 A;  4Q5S F;  2XVC A;  2PMZ N;  2DA1 A;  4EGY A;  3KYC B;  3ZQH A;  1O3Q A;  4MTD A;  2H8W A;  5LHH A;  3LAJ A;  2BVM A;  5LGT A;  1Z9C A;  2VJ5 A;  4YEJ A;  1BJZ A;  2BXZ A;  1TT0 A;  1IG7 A;  4BJT A;  1HLV A;  5F27 A;  3PIP F;  1U5T B;  4KIC A;  5HDK A;  4X0G A;  3T8T A;  5E3M A;  2RNG A;  3M8E A;  3WHC A;  2VBW A;  5L3B A;  3KYD B;  1I6X A;  3W2A A;  3DBL B;  2BY2 A;  2HDW A;  3ZOB A;  4A3C J;  1JE8 A;  3RI4 A;  3C18 A;  3BC8 A;  1P9Q C;  2ZKZ A;  2EFQ A;  3QPL A;  2EA2 A;  2IS4 A;  2IS1 A;  2A05 A;  2K9N A;  4EJU A;  4M3G A;  4G6D A;  4EV0 A;  1HW5 A;  1ZRF A;  4MO7 A;  4IRI A;  3LQQ A;  2KZG A;  2XSJ C;  4K2E A;  4M3B A;  2QKM B;  1JKO C;  1ZR4 A;  1SFK A;  1I5Z A;  4EAT A;  3LSI A;  4HG2 A;  1XPX A;  2MLG A;  5ICG A;  2BVL A;  3S3O A;  2UXX A;  3RYP A;  1FP1 D;  1ORK A;  3LA2 A;  2DTZ A;  4OAZ A;  2F5D A;  4FHT A;  3KPH A;  4QLC U;  1BBY A;  3R6S A;  3QYB A;  3CLQ A;  4UV9 A;  1RI7 A;  3I71 A;  2MD0 A;  1HQC A;  1T56 A;  2CS3 A;  1W0T A;  1BW6 A;  5IT9 K;  1IRX A;  3WOD F;  3HXL A;  3DV8 A;  3DEU A;  2HDC A;  2LNB A;  3RKQ A;  4OIO F;  4IHW A;  1RNL A;  1Y39 A;  3J80 Z;  3HJE A;  1YIT I;  2EZK A;  2F48 A;  2A68 F;  4AYB N;  1PYV A;  2QQ9 A;  4CYD A;  2QYO A;  3SQN A;  1W0U A;  5J4Y A;  2KMU A;  4D1Q A;  2DW4 A;  2RC4 A;  2GLO A;  2R7V A;  1D8K A;  1V4R A;  1R9T J;  1HKT A;  5FKL A;  1V55 H;  1BR1 A;  2EJR A;  2MC4 A;  4D0P A;  3NAU A;  5K5O A;  2KIQ A;  4B8X A;  5GAG J;  2RQP A;  1IN4 A;  3PNV A;  4IHV A;  5HOO A;  1H9G A;  2ELK A;  3VYU B;  4P55 A;  1FP2 A;  1O4X A;  4N0B A;  3AKZ A;  3S1M J;  3RQI A;  4HA8 A;  4MHG A;  1WI3 A;  5K7H A;  4XMY A;  2BZT A;  1RR8 C;  4M9Z A;  3I53 A;  3TED A;  5EEG A;  2HQN A;  4XOT A;  2QM3 A;  1WJF A;  2OBP A;  3E1S A;  1H8A C;  1JT6 A;  3VSK A;  1MGT A;  3HOX J;  1YJ9 I;  4BXU A;  5DTD A;  2JZY A;  4R79 A;  2F4I A;  1TNS A;  1DPR A;  4PZJ A;  3GFM A;  3M8F A;  1NHA A;  5B66 C;  2CQX A;  2Y0S A;  2KJB A;  1ULY A;  2XUB A;  2XC7 A;  3QRF F;  1MMA A;  3V4G A;  3CP8 A;  5CQG A;  2JMW A;  1V54 H;  2L0K A;  2K3F A;  5EYR A;  1MD0 A;  2DN0 A;  1VQK I;  4XID A;  2Q1Z B;  4ZYA A;  4ZZL A;  2ID3 A;  3GF2 A;  3GME A;  1X4O A;  5GP9 A;  1HXD A;  3FXR A;  1HSJ A;  2XPW A;  4A0X A;  4HF2 A;  4OMY A;  1IJW C;  1DGW Y;  4XSX F;  3CQZ J;  5A2Q K;  2LH9 A;  1Z6R A;  5LLQ A;  4X1E A;  1D5V A;  3GTJ J;  1XSD A;  2KHM A;  3ZQQ A;  4FTH A;  1ZRE A;  4FX4 A;  2XB0 X;  2VKH A;  4L0Z B;  4JX4 A;  3VYT B;  3HHG A;  1ERD A;  3OYA A;  3H0D A;  3MMY B;  3DTI A;  3J81 Z;  5EG0 A;  3R61 A;  1FBQ A;  3DWL E;  3ZR8 X;  2ZME A;  2ECC A;  3DPL C;  2K9Q A;  1J59 A;  2BOL A;  4L9V A;  4LIT A;  3WGH A;  4CCO A;  1HKQ A;  1YW7 A;  2R7O A;  2MA3 A;  4RB0 A;  1LFP A;  4Y52 J;  1CGP A;  2LD5 A;  2IGM A;  3L2V A;  1OCT C;  5JI6 A;  4XK4 A;  2I5U A;  3AFH A;  1P2F A;  2M45 A;  4XKV A;  4N4N B;  2R7Q A;  4XOR A;  4AWX B;  1I3A A;  2BE5 F;  2EV0 A;  2IS2 A;  3BZC A;  4L5E A;  4PSX A;  2DYS H;  4II3 A;  4CXF A;  4F52 A;  2JA6 J;  3WTY C;  4O5V A;  5D8K B;  1ZGJ A;  3HTU A;  3IC7 A;  3G4S I;  2XAJ A;  1WJB A;  2L9R A;  2ZCW A;  3KYL A;  2LDU A;  1QZY A;  1DP7 P;  1TP4 A;  1UAA A;  2V1D A;  1ZQ3 P;  3O2P E;  3KZI C;  1P7I A;  1F1Z A;  2Z2S B;  3X2Q H;  3V8J A;  1IO2 A;  3BG3 A;  3FK7 A;  1MKM A;  5C4X J;  4HLY A;  2PJR A;  1HW2 A;  1RIO H;  1LFU P;  2GQQ A;  5ED4 A;  3PM1 A;  3SJM A;  4M3D A;  2JRT A;  5M5W J;  3GTQ J;  3KCC A;  3BZ6 A;  3H3U A;  3FXJ A;  2CW0 F;  1RUN A;  5IP9 J;  4JP0 A;  4LG3 A;  1K78 B;  2DQR A;  4RAY A;  4G7O F;  2O3F A;  1V5G A;  5J8F A;  4XKC A;  2WBM A;  2HKO A;  1OCZ H;  3I4M J;  3RCO A;  2E1N A;  1O7L A;  1JHF A;  4IJA A;  1DQU A;  1JHH A;  1WWX A;  5HVQ C;  3OYH A;  2FBI A;  2O6G E;  1U9O A;  1E17 A;  1YOV B;  4CSW A;  2A3S A;  1TNT A;  4HOB A;  2JSP A;  2XGD A;  2MC3 A;  3I55 I;  4S05 A;  2V1U A;  2MYS A;  3W3C A;  2IGN A;  3EET A;  3GWZ A;  4QTR A;  2BBY A;  4RB1 A;  3A2K A;  1IDZ A;  1UEL B;  1FBS A;  1MND A;  3HBL A;  2KIF A;  4E4H A;  3IH2 A;  2ZFU A;  2B0L A;  2ADU A;  4JQF A;  2LBF B;  1MMG A;  1Z77 A;  3CZ6 A;  2FMY A;  4RGS A;  2DBB A;  2E2I J;  4YIF A;  1Y56 A;  5CLS A;  4I02 A;  3IH3 A;  1XB4 A;  2PEX A;  2VUM J;  1ZAR A;  2CH0 A;  2V4J C;  4ANJ A;  4HZF A;  1PUF B;  3HSF A;  2LFB A;  4BGD A;  2DPD A;  3I64 A;  3HUG A;  2IA0 A;  2LRE A;  1WVR A;  2ZSH B;  3KP4 A;  3OR2 C;  2L3D A;  1G3Y A;  3O8G A;  1FPQ A;  4LIV A;  5LRR A;  1IXC A;  3IHU A;  2X85 A;  4LOC A;  3L2U A;  4JBA A;  2A5W A;  2CG4 A;  2IGO A;  3J80 K;  4IHY A;  2X48 A;  4EJW A;  1J09 A;  3HRT A;  4OMZ A;  1R49 A;  2ZBK A;  3QOP A;  2K02 A;  1BI0 A;  1B8I A;  4DGW B;  3HOU J;  3BQY A;  1T0F C;  4YFN F;  3TDU C;  4AM3 A;  3MN2 A;  4RS8 A;  2X9D A;  4CCK A;  2WAE A;  2C6Y A;  2LMD A;  1YYV A;  3CCQ I;  3OYF A;  1GHC A;  3FXQ A;  4NC8 A;  3ZXS A;  5DCM B;  5H6Q A;  3K4B A;  4XLP F;  1FMW A;  4MQV A;  3E7L A;  3I0T A;  2UWM A;  2M5W A;  3AG3 H;  1D0Y A;  3FWE A;  1X19 A;  4DZP A;  4NB5 A;  1OYW A;  3SEQ A;  3CD6 I;  1T08 B;  2DOF A;  1MZB A;  2O7O A;  1UST A;  2M30 A;  3IAS 2;  5LGN A;  4FQG A;  3QQA A;  1A35 A;  4I98 B;  2M2E A;  2AO9 A;  2Y69 H;  3UKG A;  1IAW A;  3C3W A;  3BY6 A;  5FRM A;  1DU0 A;  3ML6 A;  1KU7 A;  2NVU B;  1W36 C;  4HX8 A;  1MBK A;  2XAF A;  1X1A A;  1I50 J;  4Y3O A;  1KU9 A;  2RQQ A;  3ABM H;  3N4M A;  1GDT A;  4OIN F;  4UV8 A;  1WJC A;  3SXY A;  1T95 A;  2L9N A;  5EJC A;  5HLH A;  3FM5 A;  4J19 A;  3FMQ A;  2NS7 A;  1J75 A;  4BQN A;  2L9S A;  1F5T A;  3KP5 A;  3K2A A;  3DBH B;  4A5M A;  4ESJ A;  2ZXW H;  3OS2 A;  4D5C A;  3HOW J;  3IWZ A;  5JHF A;  2BXY A;  2WV0 A;  3BWG A;  5KHD A;  4KT5 C;  3S16 J;  2XAH A;  4WXH A;  3TOB A;  2EFN A;  4B44 A;  2HTS A;  3BG5 A;  1YRN B;  2FNA A;  3L2C A;  3TP0 A;  2V9K A;  3LL7 A;  4XRS A;  4BE1 A;  3I54 A;  1G59 A;  3ZRG A;  1TQI A;  2Y2Z A;  2TDX A;  5CYV A;  4FIS A;  3DKY A;  1ZG5 A;  2LKP A;  2B63 J;  5HLT A;  2E5N A;  1MSE C;  5CQE A;  5KAI C;  1EA3 A;  3FX3 A;  3KEO A;  4CYC B;  3F23 A;  2AXT C;  4ZJZ A;  1YIO A;  4HX4 A;  5D6F A;  2IPQ X;  4MGR A;  4CA0 A;  5F1R A;  5D5W B;  3J81 K;  2LG4 A;  3F22 A;  5EG0 B;  1SC7 A;  3S17 J;  4WXC A;  1BOB A;  1Z3X A;  3SZP A;  4DYC A;  5F0H A;  1AOY A;  2QZ8 A;  1U5T A;  2ZME B;  4M9X A;  4UB8 C;  2VBZ A;  5GTI C;  2W7N A;  4EM0 B;  4CZZ A;  2VLA A;  1T0F A;  2K27 A;  2XDV A;  2EPF A;  4BL0 B;  2VC0 A;  3K70 D;  1W4M A;  2H1K A;  3C7J A;  2GIV A;  4B43 A;  4IOA F;  2VQH A;  1YO5 C;  2RKH A;  1X3Z B;  3U1K A;  3FBN B;  1ON1 A;  3I56 I;  1UHW A;  2CW7 A;  2DMP A;  1ZG1 A;  3ELK A;  6PAX A;  3TW7 A;  1X1D A;  4YRV A;  2NVT J;  4RGX A;  4F93 B;  2JTV A;  3FF5 A;  2LF8 A;  3W2V A;  1OMI A;  3HIF A;  1KZH A;  2HI3 A;  2KDZ A;  3PNY A;  3IH4 A;  3DPT A;  2H09 A;  4I0B A;  4EEF G;  2E36 A;  2PLY A;  1NG6 A;  1YQA A;  4XLH A;  1Z7U A;  2Y75 A;  4A3L J;  4G6Q A;  3K4K A;  2FQ3 A;  3GTK J;  1FC3 A;  1Z6T A;  3L2R A;  2DPU A;  2M0C A;  4XRM A;  2PJR B;  2EK5 A;  4FT8 A;  3BTL A;  4UNO A;  1IRF A;  5IP7 J;  4HAM A;  1ZRC A;  4LLL A;  3GCM A;  3VB2 A;  3TW6 A;  4I01 A;  4XLE A;  1LVA A;  1ZRD A;  1FSH A;  1I1S A;  1SMY F;  4MTE A;  1AU7 A;  1FBU A;  5ILS A;  5HOD A;  1E0E A;  1XD7 A;  2D45 A;  3FXL A;  3G1M A;  2HEO A;  4A5N A;  2F4M B;  1FWZ A;  1OQY A;  1EH6 A;  2GA2 A;  4GRI A;  3FMS A;  2VN2 A;  2DDB A;  3PFI A;  4J00 A;  1B9M A;  2FU4 A;  2G7U A;  2YR2 A;  4AYB A;  3BJ6 A;  4RBO A;  4C2T A;  4C2M J;  3EPZ A;  2DMU A;  3JRA A;  2H8R A;  2O8X A;  3WG7 H;  2VAS A;  1R1V A;  1WRJ A;  1MNE A;  3RSN A;  2QQB A;  3O8H A;  1WFX A;  3B6C A;  1JUM A;  3HPG A;  2LP0 A;  5E18 F;  2DMT A;  4UUT A;  1UCR A;  3KLO A;  1BIA A;  2MFZ A;  4NC7 A;  3BLY A;  3OOU A;  4KN7 X;  3WU0 A;  3S1R J;  1JGS A;  4BXX J;  4CH7 A;  3BR1 A;  1Z21 A;  3I9V 2;  3BTJ A;  3OMY A;  1BOA A;  1DGR M;  4NBQ A;  3SEZ A;  2R7S A;  1K6Y A;  5H20 A;  2W4S A;  3HL2 A;  1OYY A;  3W6V A;  4ENN A;  2WV1 A;  3TO6 A;  2B9S A;  2FBK A;  3CCE I;  2EZL A;  2V1N A;  2X6O A;  4B4C A;  1TWF J;  2FA5 A;  4PCQ A;  2OJE D;  4XRS G;  1IV6 A;  1D0Z A;  3CCY A;  1NG7 A;  1U2W A;  3WU2 C;  2X1E A;  1IZ1 A;  4DOZ A;  4N9H A;  3OYC A;  4YFK F;  5FKO A;  1YW8 A;  4XLA A;  4CHU A;  4M6X A;  3K10 A;  4BDZ A;  2VQL A;  4DZJ A;  3JRB A;  3LSP A;  2W82 A;  3ZGK A;  4BS9 A;  2AQF A;  1T98 A;  3E6C C;  3FMR A;  3KEY A;  1B8I B;  4PFP A;  1LDK B;  2V79 A;  5M5X J;  4I2O A;  4PGG A;  3JRG A;  2JA8 J;  2DA5 A;  2IP2 A;  2FXA A;  3P9C A;  2DYR H;  3TO7 A;  3OYL A;  3IRR A;  1DUX C;  4E7J A;  2KIS A;  4IHS A;  3KFW X;  2H94 A;  2MH9 A;  1SFE A;  4FCY A;  4D5F A;  4DBQ A;  3LNQ A;  4MEX F;  2KJC A;  4Y33 A;  5DEQ A;  1FSE A;  2M4G A;  1BM9 A;  2E35 A;  1FNN A;  2VJI A;  1MBH A;  4LMY A;  1R1T A;  2CFX A;  3DQV C;  1VI0 A;  4QSH A;  3V7S A;  5K7Z A;  1IN6 A;  3QYF A;  2L4A A;  2M9H A;  3A01 A;  4BJ6 C;  2DFH A;  4M9S A;  2WY8 Q;  4M6V A;  2VBY A;  2G7H A;  5D5U B;  4KMU X;  2R7W A;  2VPR A;  2ZNZ A;  3K1P A;  2CJJ A;  3JW4 A;  1FX7 A;  3ROU A;  2OC6 A;  2EB7 A;  3KET A;  3VWB A;  3HZJ A;  2QLZ A;  3PNT A;  2YPR A;  5CVR A;  2L5Q A;  2IXS A;  1E2X A;  1NK2 P;  2NVQ J;  2D5V A;  1OR7 C;  5F0C A;  3ZPL A;  3WE3 A;  1QHH D;  4CCL A;  2ESH A;  5EDN A;  2VE9 A;  2XAG A;  2ZJ2 A;  1LNW A;  3S14 J;  2OZU A;  2DDA A;  4ZDP A;  3I4N J;  4RAF A;  2LVS A;  1O57 A;  2DLL A;  2X6X A;  2DCE A;  1U8B A;  5FJ8 J;  3DPU A;  4A3I J;  2CQ7 A;  5FKN A;  3H5R A;  1Z0X A;  3ERE D;  2R0Q C;  1S8N A;  2ZJP F;  1F36 A;  1XSX A;  1OCO H;  2LSO A;  2H6C A;  3CF5 F;  2VPL A;  1GV2 A;  3T8R A;  1JJ8 C;  4Y7N J;  2HPM A;  1VQ9 I;  5LFA A;  4A12 A;  1SAU A;  3RZO J;  2ME6 A;  3GTO J;  2JUC A;  3K6G A;  2NS0 A;  4LIU A;  3V42 A;  2R7F A;  3I4P A;  5TRD A;  4FE4 A;  3KZY A;  2IBD A;  1K78 A;  4KMF A;  1G3W A;  1MIJ A;  1X3W B;  5LRS A;  1GVD A;  2X6W A;  3LA3 A;  4A6D A;  3IKV A;  4BE2 A;  3TP3 A;  3A0H C;  2TRT A;  2JK3 A;  5ILV A;  4L5J A;  3VYS B;  1OFC X;  1BJA A;  5ICE A;  1T2K A;  1VND A;  2OF7 A;  2QQ8 A;  5EGO A;  3CES A;  3VSL A;  3L2Q A;  3P7N A;  4GYG A;  9ANT A;  3K4N A;  3QP6 A;  2O8K A;  2CV2 A;  2DOA A;  2KPM A;  1REP C;  2F5F A;  1SD4 A;  4HNV A;  4KYW A;  1VQ7 I;  1GXQ A;  4UVC A;  4KIB A;  2VIX A;  4P9U A;  2WAQ A;  3RTR A;  3V7R A;  3K1N A;  1HBX G;  3PO2 J;  2V26 A;  3OYN A;  1R23 A;  2LBF A;  5FB2 A;  2PI0 A;  3TKY A;  3REO A;  2XGX A;  3HB9 A;  1CF7 A;  4U0W A;  4F91 B;  2FNP A;  3ZN1 A;  1UG2 A;  2M7B A;  1R4M B;  3MKL A;  2MSY A;  3Q0W A;  1RZ4 A;  3IAM 2;  4O3M A;  1PUF A;  3E5X A;  5CJ9 A;  1A04 A;  3ABK H;  1TWG J;  3JSO A;  1IV8 A;  1ODD A;  1SD5 A;  2LYC A;  3GYH X;  2Z99 A;  3BRO A;  3AG4 H;  1J7K A;  2X4H A;  1YG2 A;  3EQL F;  4U7D A;  2CSO A;  3JRI A;  4MQ9 F;  4A3E J;  1F43 A;  4M74 A;  2W25 A;  2O9L A;  1PP8 F;  1MH4 A;  2X1D A;  5FKM A;  5L3C A;  3QU3 A;  4HW0 A;  3CO7 C;  3CLO A;  3Q0U A;  1E3O C;  2I8D A;  4U7B A;  2IRF G;  2JRM A;  3JTG A;  3LMM A;  1EV7 A;  1QPI A;  3Q3S A;  5LD2 C;  3WTX C;  4LFU A;  3D5S C;  3CJT B;  1KYW A;  2LC2 A;  2JSC A;  3TQN A;  1R5G A;  1X1B A;  1VF9 A;  1S5L C;  2DK8 A;  3F72 A;  1AKH B;  1QA6 A;  5DCM A;  3OYD A;  2A69 F;  4A6E A;  5FD6 A;  4A2U A;  2M87 A;  1I3Q J;  1VQ8 I;  4MFD A;  3Q9V A;  3HOZ J;  2M0M A;  5HNF A;  3EYI A;  3E3V A;  5C44 J;  5BNG A;  1JUS A;  2IW5 A;  3FIW A;  1TBX A;  1O7F A;  2FF4 A;  3DTK A;  4ZYH A;  1NTC A;  1SD6 A;  2H1L A;  3AL0 C;  1STZ A;  4WF2 A;  4ESF A;  4Q47 A;  3A03 A;  1SAN A;  2HQA A;  2QF7 A;  5DM6 F;  3KX2 A;  2GBY A;  2V9P A;  4AVZ A;  4BHP A;  5EEA A;  4DNC A;  2GZW A;  4CIC A;  2NAZ A;  5E1X A;  4JK1 X;  3WTS C;  3CTA A;  4XBF A;  4KJZ A;  5BQT A;  2HU9 A;  2D1V A;  3Q5F A;  5M3M J;  5IYD J;  4ESB A;  2FOW A;  2W57 A;  5HDG A;  1XGN A;  2V9V A;  4U88 A;  4AIJ A;  4M6Y A;  1TWH J;  5KVR A;  1JKP C;  2Z3Y A;  4BXF A;  2GIZ A;  3RKY A;  2CGP A;  3M4O J;  1VQ5 I;  1Y8Q B;  4DJA A;  5DM7 F;  2R92 J;  2YSR A;  3EUH C;  3K9T A;  1XG1 A;  2XKP A;  3K4J A;  1YRN A;  3VDX A;  4A93 J;  4LD5 A;  5LHI A;  3OOP A;  4A0Y A;  3H3Z A;  1IXS B;  3C2G A;  4MNU A;  5JR3 A;  4PK4 A;  2OD5 A;  3IV5 A;  2O5R A;  3HOS A;  2COM A;  2GWR A;  2ZFW A;  3L7W A;  2X6Y A;  4D7N A;  4CYC A;  3WU1 B;  5HS9 A;  2Q8K A;  4BBS J;  4ETS A;  4HF1 A;  1J5Y A;  3A01 B;  3OYE A;  4GCV A;  1Z91 A;  2F5E A;  1ONV A;  3ZMZ A;  3GVA A;  3HKZ A;  2CUZ A;  2HQR A;  4KN4 X;  1QZZ A;  2MD5 A;  5CPR B;  1TQP A;  1FY7 A;  4XOP A;  3I5U A;  2MW8 A;  1GV5 A;  5E3N A;  2DA4 A;  4BQO A;  3CC7 I;  2XPU A;  3HSE A;  4L9J A;  3BG6 A;  3OYG A;  1I1G A;  3M1C A;  2JA5 J;  4P96 A;  2HDD A;  3IUO A;  3LFU A;  3K69 A;  3CCJ I;  1H88 C;  3I59 A;  5DV5 A;  1XSV A;  2VKE A;  4FET A;  2ZXJ A;  2NXN B;  1YTY A;  1B9N A;  1ITY A;  2CV1 A;  2E2H J;  3O6B B;  3HYI A;  1MBJ A;  3TDZ C;  2X51 A;  3H35 A;  4ZDL A;  5HNH A;  4E7L A;  2G0E A;  1WJ5 A;  5BOX A;  4XLF A;  2Y30 A;  3HDD A;  4NNJ A;  4KFC A;  4L18 B;  3WE2 A;  4HQM A;  3BR6 A;  1BC7 C;  1D1B A;  3RKW A;  2BHZ A;  2B7E A;  3QOD A;  2QKL B;  3DLL F;  1TWC J;  1X58 A;  3GFL A;  3OR1 C;  3QP5 A;  2WAD A;  3CUO A;  1MJA A;  3N05 A;  1H89 C;  1HC8 A;  3DXJ F;  1K83 J;  3U2R A;  4PJ0 C;  2ICW G;  5EGO B;  1RR7 A;  1BIB A;  3LA7 A;  1BW5 A;  2OTL I;  1GVJ A;  3JRD A;  4KIT B;  3EDP A;  3M07 A;  1KA8 A;  1D8J A;  2RVC A;  2NRA C;  3EUH A;  2NOJ B;  3KEQ A;  1XGM A;  1Y1V J;  1R5I D;  1D1A A;  2HTJ A;  4A3B J;  3A02 A;  1YS7 A;  3D5L A;  3GFJ A;  1VTN C;  1B4A A;  3R4K A;  4WWC A;  1XMX A;  4HNT A;  1LVK A;  4U0V A;  1XCV A;  3W6K B;  4J01 A;  3WTZ A;  5E20 A;  2CFO A;  2FOK A;  1CF7 B;  2ID6 A;  2PX9 A;  3CDI A;  4X6A J;  3JRH A;  2VOP A;  1E3P A;  1HOM A;  3QWL A;  4XN0 A;  3CCV I;  5IPA A;  1FYM A;  2IA2 A;  3D0S A;  2XIG A;  5EZG A;  5J47 A;  2LKX A;  2F5V A;  1VQO I;  2OQR A;  4IPA A;  2HPI A;  1U3E M;  3F8C A;  1P92 A;  1XMK A;  4ZYG A;  1ETK A;  4XLC A;  4NUB A;  2UZK A;  4AID A;  1MDM B;  3MFK A;  2CWE A;  5J1R A;  3G1L A;  4XN3 A;  2VXZ A;  5FRO A;  2JA7 J;  5IP6 A;  4DYQ A;  2IJL A;  3G3Z A;  4JYK A;  4BU2 A;  2FEZ A;  4HF0 A;  3LST A;  4IF4 A;  5IT3 A;  1S7O A;  1XX5 A;  3IKT A;  4UVA A;  1AWC A;  3QPT A;  3IL2 A;  1S7A A;  1TW3 A;  5TGT A;  4IO9 F;  1LE8 B;  1MBG A;  4GXO A;  1YLF A;  2UUZ A;  5L3D A;  3WGG A;  2PQ8 A;  1WKM A;  1XN7 A;  3ZQC A;  1QVT A;  2J5O A;  2X1C A;  2UV1 A;  3H92 A;  2MBF A;  4BE0 A;  3K2Z A;  1IF1 A;  1U6G A;  1ETW A;  4RM2 A;  1U9N A;  2QQA A;  5LGU A;  3L2W A;  1ACI A;  3BPV A;  5ICF A;  2NYX A;  2BV6 A;  1ZG3 A;  3R0J A;  5AIP A;  3B73 A;  2JQ7 A;  3CJN A;  3HRS A;  5CKT A;  3ECH A;  3FXK A;  5E1Z B;  3SZG A;  4HQE A;  4ZH4 F;  4G9Y A;  3G1O A;  1MW7 A;  2E2J J;  4UUV A;  4XON A;  1ETQ A;  2JVH A;  5KAF C;  1IUF A;  3VPR A;  2WB1 N;  5JLX A;  5D8L B;  3F8B A;  3MD2 A;  3IRQ A;  4XNF A;  1WHU A;  3ULQ B;  1LFB A;  1YS6 A;  2COB A;  2XGE A;  3F21 A;  4GFB A;  3RPQ A;  1TZL A;  3J7Y J;  4HRI A;  2STW A;  2Z1D A;  2ISY A;  3MZH A;  1H9T A;  5J1Y A;  1IN7 A;  1OLT A;  1X3U A;  2BYV E;  5ILU A;  2K85 A;  4I6Z A;  4ENM A;  3E5U A;  2JA2 A;  2O0Y A;  1A6Q A;  3LOC A;  1SD7 A;  1U0J A;  1XTA A;  2K9L A;  4E7S A;  3JTH A;  2I10 A;  2JPB A;  3M8J A;  3J7Z I;  1DP3 A;  2VL8 A;  3LSM A;  1W1W E;  3BCB A;  1FIA A;  3K4M A;  2EH3 A;  4PJL A;  5M5Y J;  3FBI B;  1FZP B;  1J9I A;  4NHJ A;  1WCM J;  2EIN H;  1VFC A;  4KIF A;  2CW8 A;  1G3T A;  2CMP A;  5TIS C;  2CQN A;  3TL4 X;  2HVR A;  3MQ0 A;  2QVO A;  2VB6 A;  3M7G A;  1VQ4 I;  1IUY A;  2QEX I;  2OPT A;  4BDY A;  4ZTF A;  2KP6 A;  4PDK A;  1FEX A;  2BHY A;  2ZJR F;  3K0L A;  2GXG A;  2CRG A;  2KQR A;  2OZ6 A;  3A4C A;  2VT3 A;  3V7C A;  3J7A Y;  3HOY J;  4IQ4 A;  2VJ4 A;  5GPA A;  4BJ5 C;  1YX3 A;  1BR2 A;  2PMZ A;  3CO6 C;  5DD8 A;  2W24 A;  3BT9 A;  2GXB A;  2V6C A;  3KE2 A;  1KU2 A;  1JT0 A;  3BOQ A;  1FOK A;  1KQ9 A;  4HYE A;  3T1B A;  4ZZD A;  5BS6 A;  1B59 A;  4Z6Y A;  4NC6 A;  2J5P A;  5D4R A;  3TBI A;  1HF0 A;  4A3G J;  1IN5 A;  3SYT A;  5EZH A;  3GBG A;  2OQG A;  4XKW A;  4P5O A;  4D7M A;  5H2F C;  3I59 B;  3D1N I;  4ENJ A;  1SMT A;  1JTX A;  3LQR A;  3SFI A;  5IOY A;  4A3K J;  4XSZ F;  2AHQ A;  2HFH A;  4EQQ A;  3VYR B;  2CV0 A;  3AG1 H;  5FLM J;  1B1B A;  2L9V A;  1UB9 A;  2IS6 A;  3WTU C;  4QIW N;  3OIO A;  3ABU A;  2L01 A;  3FKJ A;  3ZN0 A;  1LJ9 A;  2VQC A;  4XQF A;  1A36 A;  4OIP F;  2BY1 A;  5F04 A;  5D6E A;  1T38 A;  2XB5 A;  2A07 F;  4B48 A;  2X0L A;  3S15 J;  1X2N A;  1KU3 A;  3DCF A;  2ZSI B;  4BAC A;  4B09 A;  1JGG A;  2CYY A;  3H3V K;  4F7Z A;  5EF6 A;  1LKX A;  2DU9 A;  2E1C A;  3PUB A;  1X2M A;  2XRN A;  5FKK A;  1VQN I;  5FLV A;  1ENH A;  2EZI A;  3Q9S A;  2EFO A;  3CMA I;  4M72 A;  2PN6 A;  1W36 D;  3BDD A;  1ETY A;  3OIQ A;  1QU3 A;  2F5C A;  1X1C A;  2VI6 A;  4BY1 J;  1VQM I;  4R1H A;  2DFI A;  4A3M J;  3H9Q A;  4Y17 A;  1AKH A;  3J7A O;  1T6S A;  3DP7 A;  3RQ4 A;  4ZC3 A;  1S72 I;  3DFG A;  1NH3 A;  2JT1 A;  2LLK A;  1BL0 A;  3BR5 A;  4QWQ A;  4ABZ A;  1G4D A;  5J8C A;  3BTI A;  2IT0 A;  3G73 A;  4YFX F;  1EH7 A;  3FHZ A;  3GW2 A;  1EKE A;  1KYZ A;  3W2W A;  2P6S A;  4A0Z A;  1O3S A;  1TQM A;  4O6J A;  2IVM A;  4I0A A;  2RDP A;  2HXO A;  3CDH A;  3R0A A;  3E6D A;  4CUG A;  2Z5U A;  1HKS A;  2EQR A;  1FOY A;  2UXN A;  4AVP A;  4CZC A;  1KQ0 A;  3S2W A;  4LK0 F;  3OYM A;  1N75 A;  4JX6 A;  4E70 A;  1QQI A;  3OYI A;  2PJP A;  4BNC A;  4E7I A;  3NQO A;  1Y6I A;  3JRC A;  1JTY A;  4V2G A;  5E17 F;  1D0X A;  2CU7 A;  4LLG F;  4KIG A;  2P4W A;  4YII A;  2P7V B;  5E1W A;  3E6M A;  2LRD A;  1I39 A;  3C2H A;  4AIH A;  3L09 A;  5DDG A;  3MVP A;  2K9M A;  4KA4 A;  4S0H B;  3H9J A;  1P4W A;  4E7Z A;  2HYG D;  5ICC A;  2VE8 A;  1QPM A;  2OV7 A;  4RB2 C;  1WJD A;  4C3H J;  5AON A;  5E8I A;  1L3L A;  2N8G A;  3UNG C;  4BKX A;  4OWR B;  4U87 A;  2DA6 A;  1WQ2 A;  3BR3 A;  1ETO A;  5GAD J;  5L3F A;  1OCP A;  4W1U A;  4AU7 A;  2OCC H;  2L54 A;  4QPQ A;  1MSF C;  3HPH A;  4RLF A;  1SFU A;  3G6E I;  4YG2 F;  3HHH A;  4RMN A;  1WJA A;  4KIS A;  3BP8 A;  3TOA A;  3DF8 A;  4BEH A;  4BBR J;  3VFZ A;  2LY9 A;  1OCR H;  1ON2 A;  4B1R A;  5D5V B;  4CDG A;  1FOX A;  1VZ0 A;  2M34 A;  1ZLJ A;  4R8H A;  3ZMS A;  3DEW A;  2E19 A;  2E5Z A;  4IHT A;  1X4P A;  5FLX Z;  3HC7 A;  2E1M C;  1WH5 A;  2A5Y B;  3GO5 A;  1U78 A;  1OJL A;  2R7T A;  1DDN A;  2K3P A;  1VQL I;  4CCM A;  4HDV A;  4XR6 A;  4HST A;  2L7K A;  2PBI A;  2VJJ A;  4II2 A;  2XPV A;  1R36 A;  2ZB9 A;  5HDN A;  1IRZ A;  4I09 A;  3TGN A;  3ZMV A;  5BMZ A;  4IOC F;  3VEP A;  1L0O C;  3SFZ A;  4UB6 C;  1WZ2 A;  2O03 A;  3NRV A;  1MJB A;  1R4N B;  2E60 A;  3FDY A;  2FQ4 A;  3HRU A;  3OWT A;  1YHQ I;  3AAF A;  3H9G A;  4I99 C;  3FM3 A;  5DUK A;  2EFP A;  1BI1 A;  2Z9O A;  2ZO4 A;  5EEH A;  5LEK A;  1LDJ A;  4EMS A;  5KNL A;  2WC2 A;  2XAU A;  1P7J A;  2M8E A;  1G2H A;  1EF4 A;  5FFX A;  2R4G A;  2XHK A;  4G6T B;  2FUG 2;  1ZH5 A;  1A6I A;  3PQK A;  5DS9 A;  2R93 J;  3PSI A;  1BI2 A;  5DYM A;  5F0F A;  3L1P A;  2F2E A;  4C3J J;  3ZMT A;  4Y13 A;  2OCE A;  2A6T A;  1Q1H A;  2FML A;  1RPW A;  2R7R A;  2FSW A;  2ELH A;  3GTG J;  3M3Y J;  4B47 A;  4HV5 A;  2QGU A;  2L2O A;  3QPH A;  3LSR A;  2VXD A;  3S93 A;  4WXD A;  2DJN A;  3FXU A;  1UMQ A;  4ON0 A;  4RGU A;  1LEA A;  3LSJ A;  2GOX B;  2E7X A;  4A69 C;  5GAE J;  2HVQ A;  2NVY J;  3ERM A;  5GPC A;  3RIR A;  1FLI A;  2OUM A;  2HVS A;  3DKX A;  3FXM A;  2ZXH A;  3FHN A;  1JKR C;  2KIU A;  1Y8R B;  4A3D J;  3ECO A;  4OOI A;  5CVJ A;  3M1E A;  1RRJ A;  2YUS A;  1HDP A;  4C30 A;  1W7P B;  3M9A A;  2DT5 A;  3DKW A;  3ZCO A;  2XF7 A;  3BJO A;  3V8L A;  2Z16 A;  2WWY A;  3PQJ A;  5JVG F;  1K7A A;  2MH2 A;  3CF2 A;  4E6K G;  3DU5 A;  2WTE A;  4V19 K;  2DT7 B;  1TWA J;  1QBJ A;  5E3L A;  5KK1 A;  1XS9 A;  3CJR B;  1SVO A;  1ZTR A;  3WTW C;  4C3I J;  1OIS A;  4IRH A;  2Y0M A;  1MDM A;  5FRN A;  1FYL A;  2CQQ A;  4UUS B;  3RDI A;  5F64 A;  4P1W A;  2ETH A;  2RRE A;  5E3O A;  3P5J A;  4UVB A;  1OR7 A;  3MZ8 A;  2P8T A;  2VC1 A;  3JCU C;  1IW7 F;  5CVU A;  2RN7 A;  5GAH J;  2BGC A;  4IX7 A;  2K86 A;  2YX4 A;  2RAE A;  2Y48 A;  4H0E A;  4RA2 A;  2W1O A;  2BW3 B;  1I27 A;  1LE8 A;  2VQG A;  3KP2 A;  2XF5 A;  1J2X A;  3TMO A;  3JAM Z;  3N97 A;  4EJV A;  3P9K A;  1HST A;  2W00 A;  3HTS B;  3E5Q A;  1QZE A;  1USS A;  1NK3 P;  3CCL I;  2ZME C;  1R1U A;  1S6L A;  2DQL A;  3QU6 A;  3EYY A;  4OIR F;  2XGC A;  1PP7 U;  3F8F A;  4RLQ A;  4EJT A;  5FGM A;  3B02 A;  3I3L A;  3PIO F;  3JR9 A;  3R60 A;  1BN5 A;  3EUK L;  4YEL A;  4GO1 A;  2FD5 A;  2Q2E B;  3IWF A;  2R5Y B;  2ELJ A;  4BUP A;  4IKF A;  1MMN A;  2CUE A;  3KZZ A;  1Z05 A;  2KKO A;  5JLW A;  4L0Y B;  4A3J J;  1G3S A;  2HR3 A;  2W84 A;  3PSF A;  3ABT A;  3WTV C;  1XCB A;  4FX0 A;  3CDL A;  1JUP A;  1MMD A;  5IY5 H;  3GX4 X;  2PMU A;  2ESN A;  1UJ8 A;  3CCR I;  1K79 A;  4IQJ A;  4HEA 2;  2WB1 A;  2R3S A;  1R71 A;  2GAU A;  2WAF A;  2JUG A;  2KRC A;  5K1Y A;  2LY2 A;  3GXO A;  3KP3 A;  1D1C A;  3K4L A;  4LB5 A;  1MJ9 A;  1IXR C;  1Z67 A;  2HXI A;  3NEU A;  3HGG A;  5KCM A;  1F4K A;  4HLX A;  1KON A;  4ZYE A;  2P5V A;  4XRF A;  4UY8 I;  5IYC J;  3LSH A;  3PUF A;  2KRF A;  1K61 A;  4CGZ A;  2ZXI A;  3BZK A;  3KP7 A;  4RDU A;  1H0M A;  2IEK A;  2OU2 A;  1V5F A;  4Q4Z F;  1Y1W J;  1BR4 A;  1TC3 C;  3OIP A;  2HWV A;  3MZY A;  3ZQF A;  2EIM H;  2XF6 A;  5B5E C;  3K4C A;  3CJQ B;  1FTZ A;  3ZQG A;  2DA7 A;  3DBR B;  5F1J A;  1VQ6 I;  2G9W A;  2FBH A;  3S3N A;  1AA7 A;  3BQZ A;  3V8K A;  4MIM A;  4IZZ A;  3NWT A;  2QA4 I;  2L7M P;  2L02 A;  2LOO A;  2LTP A;  2D1H A;  5L3G A;  1QNT A;  3K7A J;  4FE7 A;  2E7W A;  3LSG A;  3RPU A;  1ZEL A;  2P5K A;  2LY1 A;  3F3X A;  4HNU A;  2XAS A;  3LSK A;  1FTT A;  4RGR A;  5DD4 A;  4BEH B;  4DW6 A;  3VOE A;  4MEY F;  3ZP5 A;  5JFR A;  3WGI A;  1K6O A;  4ZYD A;  3HOV J;  3ABL H;  2GOM A;  3U21 A;  3GTP J;  4LB6 B;  2E71 A;  5FLX K;  3RPU D;  1B72 A;  1Z3Y A;  3IP4 B;  4NDL A;  3CCM I;  1C0W A;  3LFK A;  4GYI A;  5B3S H;  1SVL A;  3PL8 A;  2LK2 A;  1X1P A;  3H1C A;  2QSF X;  2JJ7 A;  2LR8 A;  4MLO A;  4NQW B;  3HGY A;  2FE3 A;  2NOG A;  1KQ8 A;  2F6C A;  1WPK A;  5HLI A;  1UHS A;  1MBF A;  2DFF A;  4OU0 A;  5L3E A;  4YIR X;  1SEU A;  5E79 C;  3I58 A;  2XRL A;  2M4K A;  3MEX A;  1QRY A;  2DFE A;  1M1E B;  1G6N A;  2EIJ H;  3KIO A;  3CUQ C;  4PJM A;  2YS9 A;  4DQ2 A;  2K4J A;  4E7K A;  1YIJ I;  2PMH A;  2HZT A;  2OTJ I;  3ZMD A;  5AIQ A;  2EZH A;  2MGQ A;  4IL6 C;  4EVI A;  4L5I A;  3F8M A;  3ONQ A;  3FKI J;  1R6R A;  3WG9 A;  2K9S A;  3GLX A;  4BQQ A;  3COA C;  2DI3 A;  4L9N A;  1LPQ A;  2IA1 A;  3BR0 A;  3E97 A;  1TW2 A;  2FJ1 A;  3A1Y A;  3DEE A;  4KT6 A;  5HLG A;  4WX9 A;  1RC9 A;  4F92 B;  3U9G A;  2TCT A;  3F9K A;  3RZD J;  2ACJ A;  4BHC A;  5M3F J;  3CCS I;  3LWF A;  2KT0 A;  4EGZ A;  2VOD A;  2K40 A;  2YU9 J;  1G8X A;  1O3R A;  5FD5 A;  2ZC2 A;  5ERI A;  2MLK A;  2OA4 A;  2H27 A;  3RKX A;  3DTE A;  1PJR A;  1K4S A;  2QEN A;  3NAR A;  4M3F A;  2DXI A;  2R7U A;  3CMY A;  5FO5 A;  2VOO A;  1XGS A;  1HA8 A;  2WAQ N;  1ZN2 A;  3ASO H;  3L9F A;  1LQ1 A;  1EJ9 A;  2P0W A;  2RV8 A;  3SDB A;  2VBX A;  2YU3 A;  4P9F A;  1PDN C;  1A31 A;  3BG7 A;  5BPI A;  4M3E A;  4G12 A;  1UG0 A;  2QBY A;  3H36 A;  3E6B A;  1S3J A;  2JWT A;  4RAG A;  3MKZ A;  1XDU A;  2K5C A;  2RNJ A;  3FIS A;  4XIC A;  2E1M B;  1PUE E;  1XGO A;  3BR2 A;  5K5Q A;  4GDF A;  2ECB A;  1IRG A;  2A6H F;  5B1A H;  1LB2 A;  4KDP A;  1UHM A;  1TL8 A;  2V7F A;  5TJJ A;  3T0Y A;  5H6R A;  1ZHF A;  2O61 A;  1JXS A;  1BC8 C;  5CVV A;  2QUF A;  5D4S A;  1YE9 A;  1JKQ C;  1ZGA A;  3ISP A;  4EM2 A;  4U0Y A;  3BJA A;  5F08 A;  4N4O B;  4M73 A;  3JAM K;  1IGN A;  2DAO A;  3HRM A;  4ZTJ A;  3K70 C;  2E1O A;  3FZV A;  1LUJ B;  3E0J B;  2DA3 A;  1U5T C;  3CME I;  2HOE A;  3CUQ A;  4PJN A;  3ZMU A;  2GA1 A;  3W6J B;  3MCZ A;  3D5R C;  2XAQ A;  4ENK A;  1SFX A;  4AUX A;  5K7F A;  1N25 A;  1V5E A;  2IAI A;  2P7C B;  1GLN A;  1HW1 A;  3S1Q J;  4G7Z F;  1T39 A;  3A0B C;  1WSU A;  1LEB A;  2VKD A;  2DTR A;  2R7D A;  2HQ5 A;  3JSP A;  3GTL J;  1Y0U A;  1MMS A;  1WGX A;  2K4B A;  2QSG X;  1V3F A;  4UXN A;  5IYB J;  2STT A;  2ISZ A;  3SZT A;  2R5Z A;  2HOT A;  1QO0 D;  1YW9 A;  1S29 A;  2Y9Y A;  2CUJ A;  3H0G J;  4Z2Y A;  1GUU A;  3K1M A;  2Q0O A;  2ZNY A;  4RB3 C;  3O3K A;  1E3H A;  1P4A A;  3B6A A;  4C2U A;  1J0R A;  1MBE A;  2DK5 A;  3VOD A;  3EUA A;  3F6O A;  1W5C C;  5IOZ A;  2Y0S N;  1ZGW A;  1POG A;  1Z7L A;  3JRE A;  5E8G A;  3BPX A;  4BYY A;  3ZQ7 A;  1RUO A;  1R00 A;  2AXL A;  2YX7 A;  4V2F A;  3S2D J;  1WI9 A;  2DMN A;  1N77 A;  1IN8 A;  1ETV A;  2KIM A;  3CC2 I;  2PFB A;  2HOS A;  3RJP A;  4A3F J;  4OAY A;  3BCA A;  3OV8 A;  4L9T A;  2AS5 F;  3C1D A;  2DJI A;  2ZJQ F;  1WJE A;  1SFO J;  2QSH X;  3HM5 A;  4LG0 A;  1D3Y A;  2PG4 A;  3ZQI A;  1S9H A;  3MKW B;  3Q0V A;  4PFO A;  1UFM A;  3GZ5 A;  4XKB A;  2DA2 A;  4HSR A;  1R22 A;  1WH7 A;  2QWW A;  4PJJ A;  1KGS A;  1UZC A;  4QPO A;  4IRG A;  2VKV A;  4F3Q A;  1MNM C;  2KZV A;  4G7H F;  2HZD A;  4LK1 F;  3JRF A;  2Y31 A;  2A6E F;  2FX0 A;  1T8I A;  3C2B A;  1OPC A;  2P81 A;  1SVM A;  2NS8 A;  1W5S A;  3AG2 H;  4G8X A;  1U8R A;  3OS1 A;  1B72 B;  3OYJ A;  2M1B A;  4AIK A;  3HKZ N;  2DO7 A;  1RET A;  3DLA A;  2M3A A;  3MAJ A;  3OL4 A;  2NNY A;  4ASN A;  5HS8 A;  2P6T A;  3MKY B;  1N78 A;  1TTY A;  4PSW A;  3HOT A;  3GLL A;  2GM4 A;  1QVU A;  2LF7 A;  3ASN H;  2EWN A;  1ZLK A;  5D5X B;  1JI8 A;  2KDO A;  1W7P A;  3CP2 A;  5FFZ A;  4TV7 A;  3WTT C;  1SAX A;  4W97 A;  3AL0 B;  2D2W A;  4LLN A;  2JN6 A;  2GXA A;  2EFW A;  3MWM A;  2QCO A;  2EA4 A;  3G2B A;  2CQK A;  4Q48 A;  2M8G X;  2V1X A;  4DBR A;  1ZAO A;  3PFY A;  2EIK H;  4Y4R A;  3GFI A;  1EH8 A;  2HS5 A;  2A61 A;  3F0C A;  1W7P D;  2EV5 A;  3CC4 I;  1F9N A;  1Z1D A;  5C4J J;  3H5N A;  5B1B H;  1IDY A;  1YX5 A;  4UUS A;  2DMQ A;  1W5T A;  1ZYR F;  3ZQL A;  1I6H J;  4D9J A;  1YJW I;  4PUS A;  3GUD A;  1APL C;  4WK8 F;  1ZKG A;  2NNN A;  1R58 A;  4GGG A;  2LKS A;  4OIQ F;  2BW3 A;  4B3A A;  1S7E A;  2Z33 A;  2K7L A;  3CMM A;  5F6F A;  5IT9 Z;  1OCC H;  3PJR A;  3UR3 C;  1CQT A;  3S32 A;  3BG9 A;  1OYI A;  1FYK A;  2DOD A;  2L4M A;  3FK6 A;  1GT0 C;  1ETX A;  1YJN I;  5BPD A;  2MAB A;  1FT9 A;  1RKT A;  1GXP A;  3F6V A;  4EM1 A;  4DYR A;  1DPU A;  1OKR A;  1ZR2 A;  2NVX J;  2XKO A;  2HYJ A;  4CCJ A;  1XC5 A;  4KUM A;  5CVI A;  2V6E A;  3OY9 A;  2Q2E A;  4ZDO A;  2R5Y A;  2RGV A;  3PO3 J;  1YI2 I;  1PVE A;  3WHB A;  1HCR A;  3KLN A;  3QOE A;  1A5J A;  2QBY B;  2CO5 A;  4RAZ A;  5K5R A;  3S3M A;  3P9I A;  2F4O B;  1YFH A;  1B6A A;  2L7Z A;  3GZN B;  2XRO A;  2H6B A;  2KL4 A;  4MFE A;  4CCN A;  4I76 A;  4F55 A;  4IXA A;  1QGP A;  1RES A;  3OSG A;  2HYF A;  4HPQ A;  4IEJ A;  3HG9 A;  3GZ6 A;  1FJL A;  5DUI A;  3HUG B;  4AC0 A;  1O3T A;  4H4K C;  4LGW A;  4G94 A;  2R7Z J;  2DOE A;  4Y15 A;  4S04 A;  3LAP A;  1LDD A;  1FMV A;  2XV4 S;  2HOA A;  1IC8 A;  3G71 I;  3CUQ B;  2OAZ A;  3FXO A;  3SDG A;  4HDU A;  5JVT A;  2KRH A;  5C3E J;  4N9I A;  2Y9Z A;  5LBQ A;  4JX5 A;  3S1N J;  1T33 A;  4BQA A;  2W85 A;  3QAH A;  3U1D A; 
#chains in the Genus database with same CATH homology
 4FIS A;  2B63 J;  1NK3 P;  5EGO B;  1FIP A;  1RR7 A;  2MG4 A;  1MSE C;  5J1U A;  1BW5 A;  4CYC B;  3BTC A;  3JRD A;  2XGC A;  3S17 J;  2W48 A;  5EG0 B;  3S2H J;  5J3L A;  4DYC A;  5F0H A;  3JR9 A;  3QPS A;  2R5Z B;  4BY7 J;  1Y1V J;  2FD5 A;  4A3B J;  3A02 A;  2R5Y B;  1D5Y A;  2L7F P;  3HEF A;  2CUE A;  2XSD C;  5JLW A;  2H1K A;  2ID6 A;  4A3J J;  1RKW A;  4X6A J;  3JRH A;  1HOM A;  2DMP A;  3CDL A;  3TW7 A;  1JUP A;  2NVT J;  5IPA A;  5EZG A;  2LKX A;  2HI3 A;  2KDZ A;  4IHX A;  3IH4 A;  4EEF G;  2HXI A;  3HGG A;  1DU6 A;  1Q1V A;  2ME0 A;  4A3L J;  1ETK A;  5IYC J;  3OSF A;  3GTK J;  1K61 A;  2EBI A;  2M0C A;  4XRM A;  4RDU A;  1AHD P;  3BTL A;  2IEK A;  5J1R A;  3G1L A;  1ZK8 A;  1HDD C;  1Y1W J;  5IP7 J;  1TC3 C;  2JA7 J;  5IP6 A;  4DYQ A;  4JYK A;  3ZQF A;  2CUF A;  1FTZ A;  3TW6 A;  3ZQG A;  2DA7 A;  3GTM J;  1BA5 A;  1AU7 A;  5F1J A;  5HOD A;  1JJ6 C;  3BQZ A;  3G1M A;  1LE8 B;  4MIM A;  1MBG A;  1MH3 A;  2L7M P;  2LTP A;  3ZQC A;  4FE7 A;  1QVT A;  3K7A J;  3LSG A;  2PMZ N;  2DA1 A;  1FTT A;  3ZQH A;  1ETW A;  4DW6 A;  1U9N A;  4RBO A;  4C2M J;  1BJZ A;  3HOV J;  1IG7 A;  2DMU A;  3JRA A;  2H8R A;  1HLV A;  5F27 A;  3GTP J;  5E3M A;  1B72 A;  3O8H A;  3WHC A;  3B6C A;  1JUM A;  3G1O A;  2E2J J;  2LP0 A;  2DMT A;  4UUT A;  1ETQ A;  4NDL A;  3ZOB A;  1IUF A;  3VPR A;  4A3C J;  2WB1 N;  5JLX A;  2LK2 A;  3OOU A;  2JJ7 A;  2LR8 A;  4MLO A;  3S1R J;  3HGY A;  4BXX J;  3QPL A;  2NOG A;  3BR1 A;  3BTJ A;  1WPK A;  2K9N A;  4M3G A;  1LFB A;  1UHS A;  1MBF A;  2COB A;  2XGE A;  4MO7 A;  4GFB A;  3W6V A;  2WV1 A;  5J1Y A;  4M3B A;  2XRL A;  4I6Z A;  1JKO C;  2EZL A;  2X6O A;  1ZR4 A;  4B4C A;  1QRY A;  1TWF J;  3LOC A;  4XRS G;  1IV6 A;  3CCY A;  2I10 A;  2YS9 A;  1ORK A;  1FIA A;  2EH3 A;  2DTZ A;  5M5Y J;  5FKO A;  1WCM J;  1VFC A;  4DZJ A;  3JRB A;  3LSP A;  2EZH A;  2MGQ A;  1T56 A;  1B8I B;  1W0T A;  1BW6 A;  3FKI J;  5M5X J;  2K9S A;  2JA8 J;  3JRG A;  2DA5 A;  3RKQ A;  4IHW A;  2OPT A;  2EZK A;  4AYB N;  3BR0 A;  1W0U A;  1FEX A;  2FJ1 A;  2GLO A;  2CRG A;  4FCY A;  4D5F A;  1R9T J;  3HOY J;  2TCT A;  5FKL A;  5GPA A;  3LNQ A;  3RZD J;  5M3F J;  3NAU A;  2KT0 A;  3BT9 A;  2K40 A;  1MBH A;  1JT0 A;  2YU9 J;  1VI0 A;  4QSH A;  5K7Z A;  4IHV A;  2ELK A;  1O4X A;  2M9H A;  1HF0 A;  4A3G J;  3NAR A;  4M3F A;  3A01 A;  3CMY A;  5EZH A;  3S1M J;  4M6V A;  3RQI A;  3GBG A;  1WI3 A;  2WAQ N;  3D1N I;  4D7M A;  2VPR A;  5K7H A;  2CJJ A;  1JTX A;  3SFI A;  5IOY A;  3TED A;  4A3K J;  2AHQ A;  4M3E A;  4G12 A;  1H8A C;  1NK2 P;  1JT6 A;  2NVQ J;  2D5V A;  5F0C A;  5FLM J;  3HOX J;  2JWT A;  5EDN A;  5DTD A;  4QIW N;  3S14 J;  3OIO A;  3I4N J;  3FIS A;  4XIC A;  2LVS A;  3BR2 A;  2ECB A;  1U8B A;  5FJ8 J;  5F04 A;  4A3I J;  5FKN A;  2R0Q C;  1Z0X A;  2CQX A;  2XB5 A;  1F36 A;  3S15 J;  1X2N A;  1JKQ C;  1GV2 A;  3DCF A;  1JJ8 C;  4Y7N J;  1JGG A;  3H3V K;  5F08 A;  3RZO J;  5EF6 A;  2JMW A;  2ME6 A;  3GTO J;  2L0K A;  1IGN A;  1X2M A;  5EYR A;  5FKK A;  2DN0 A;  4XID A;  5FLV A;  1ENH A;  2EZI A;  4FE4 A;  2E1O A;  2ID3 A;  2DA3 A;  5GP9 A;  2IBD A;  2XPW A;  1GVD A;  1ETY A;  1IJW C;  3TP3 A;  2VI6 A;  4BY1 J;  2TRT A;  3CQZ J;  2JK3 A;  4A3M J;  4AUX A;  5K7F A;  1AKH A;  4X1E A;  1OFC X;  3GTJ J;  4FTH A;  2IAI A;  1VND A;  3S1Q J;  2XB0 X;  2LLK A;  2OF7 A;  3BR5 A;  5EGO A;  4ABZ A;  1BL0 A;  4JX4 A;  3BTI A;  2HQ5 A;  9ANT A;  3GTL J;  2O8K A;  1WGX A;  5EG0 A;  5IYB J;  2R5Z A;  2HOT A;  2ECC A;  2HXO A;  2K9Q A;  4HNV A;  2Y9Y A;  3H0G J;  1GUU A;  4Y52 J;  2EQR A;  2LD5 A;  3PO2 J;  1OCT C;  4XK4 A;  3B6A A;  4JX6 A;  1MBE A;  3HB9 A;  4L5E A;  3JRC A;  1UG2 A;  1JTY A;  5IOZ A;  4V2G A;  2Y0S N;  3MKL A;  1POG A;  2MSY A;  1ZGW A;  3JRE A;  2CU7 A;  3Q0W A;  2JA6 J;  1PUF A;  4V2F A;  3S2D J;  2DMN A;  1TWG J;  1ETV A;  2L9R A;  2HOS A;  4A3F J;  3MVP A;  1ZQ3 P;  3JRI A;  4S0H B;  1P7I A;  4A3E J;  1F43 A;  3BG3 A;  2O9L A;  3FK7 A;  5C4X J;  1MH4 A;  1SFO J;  3HM5 A;  4C3H J;  5FKM A;  1LFU P;  3ZQI A;  3PM1 A;  3Q0V A;  4M3D A;  2N8G A;  3SJM A;  5M5W J;  3Q0U A;  4BKX A;  1E3O C;  3GTQ J;  2DA2 A;  1WH7 A;  1QPI A;  3Q3S A;  5IP9 J;  2DA6 A;  2VKV A;  3BR3 A;  4JP0 A;  1MNM C;  1ETO A;  1OCP A;  4W1U A;  3JRF A;  2Y31 A;  1MSF C;  2FX0 A;  1VF9 A;  3C2B A;  2P81 A;  1AKH B;  2NS8 A;  3I4M J;  1B72 B;  1I3Q J;  3HKZ N;  4BBR J;  4MFD A;  3HOZ J;  1U9O A;  1RET A;  2LY9 A;  4B1R A;  2M34 A;  5C44 J;  5BNG A;  1JUS A;  2XGD A;  3FIW A;  3DEW A;  2E19 A;  1NTC A;  2GM4 A;  4QTR A;  1QVU A;  1IDZ A;  3A03 A;  1SAN A;  1WH5 A;  1U78 A;  1OJL A;  3HBL A;  2QF7 A;  3IH2 A;  2GBY A;  5EEA A;  1Z77 A;  2XPV A;  4W97 A;  1IRZ A;  2ZB9 A;  2E2I J;  2JN6 A;  2QCO A;  3IH3 A;  2VUM J;  2M8G X;  1PUF B;  2LFB A;  3F0C A;  2FQ4 A;  5C4J J;  5M3M J;  5IYD J;  1IDY A;  4UUS A;  2DMQ A;  3O8G A;  1TWH J;  3ZQL A;  1JKP C;  1I6H J;  4LOC A;  3M4O J;  1P7J A;  1APL C;  4IHY A;  1G2H A;  2X48 A;  1EF4 A;  1ZKG A;  2R92 J;  1XG1 A;  1YRN A;  4B3A A;  1S7E A;  4A93 J;  1A6I A;  1B8I A;  5DS9 A;  3HOU J;  3BQY A;  2R93 J;  1CQT A;  5F0F A;  3L1P A;  3MN2 A;  4C3J J;  3BG9 A;  2X9D A;  3FK6 A;  1GT0 C;  1ETX A;  3IV5 A;  1RKT A;  1RPW A;  4D7N A;  4CYC A;  3GTG J;  3M3Y J;  4BBS J;  3A01 B;  3E7L A;  4DYR A;  1ZR2 A;  2NVX J;  3LSR A;  4DZP A;  2DJN A;  2HYJ A;  1UMQ A;  1XC5 A;  4A69 C;  3LSJ A;  2NVY J;  2R5Y A;  2MW8 A;  2O7O A;  1GV5 A;  5GPC A;  3PO3 J;  5E3N A;  2DA4 A;  3QQA A;  2XPU A;  1JKR C;  2M2E A;  3WHB A;  1HCR A;  2AO9 A;  3UKG A;  4A3D J;  2JA5 J;  1A5J A;  2HDD A;  2YUS A;  1HDP A;  1DU0 A;  1H88 C;  2VKE A;  2L7Z A;  1ITY A;  1MBK A;  1I50 J;  4MFE A;  2E2H J;  4I76 A;  1TWA J;  1MBJ A;  5E3L A;  1GDT A;  1XS9 A;  1RES A;  3OSG A;  4J19 A;  4IEJ A;  1FJL A;  2G0E A;  1ZTR A;  2NS7 A;  4AC0 A;  2Y30 A;  3HDD A;  4C3I J;  3K2A A;  2CQQ A;  4UUS B;  2R7Z J;  4D5C A;  3BR6 A;  3HOW J;  5E3O A;  3S16 J;  2HOA A;  1IC8 A;  1TWC J;  1X58 A;  2RAE A;  3BG5 A;  1YRN B;  3SDG A;  3TP0 A;  1LE8 A;  4XRS A;  5C3E J;  2Y9Z A;  4JX5 A;  1H89 C;  1T33 A;  3S1N J;  2Y2Z A;  1K83 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...