1I3QJ

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1i3qJ00
2O9LA 1RKWA 3HEFA 3JRAA 2N8GA 5C44J 5JLWA 5M3FJ 3OSFA 2VKEA 3BG5A 3M4OJ 2VI6A 4I6ZA 5EGOA 3LNQA 4FISA 1FIAA 2G0EA 1R9TJ 1H8AC 2D5VA 5IP7J 1PUFB 4J19A 1GV5A 4A3FJ 9ANTA 3HOZJ 2R5YA 1SANA 4A93J 1GUUA 1RR7A 1TC3C 3MN2A 3L1PA 5J1UA 3K7AJ 2JWTA 2FQ4A 1U78A 3HOYJ 4AYBN 2XPVA 4C2MJ 2DA6A 1ORKA 3HGYA 4DYQA 3FKIJ 4JYKA 4BY7J 3A01B 4BBSJ 2ELKA 2XB0X 3GTGJ 1MNMC 1QVUA 3HB9A 4A3JJ 5F27A 2H1KA 2HDDA 3S2HJ 4AUXA 1NK2P 2K9SA 3HGGA 2HXIA 1HLVA 2HI3A 3S15J 5BNGA 3NARA 1JKQC 1MBJA 3BTIA 1EF4A 4B1RA 2XSDC 2M9HA 4MLOA 1TWGJ 1AKHA 3WHBA 1TWAJ 3GTLJ 4BY1J 3E7LA 5EEAA 1ZK8A 1VFCA 2DTZA 4JP0A 2WAQN 3Q0WA 1TWCJ 2IBDA 5M5YJ 4RBOA 3S17J 4D7NA 3HBLA 4A3BJ 2I10A 2LP0A 3C2BA 3SJMA 5IP6A 2ME6A 1JUSA 3M3YJ 1RESA 3JRHA 4QSHA 2AHQA 4Y52J 4AC0A 5K7FA 4A3CJ 1QVTA 5M5XJ 2ECBA 4EEFG 4RDUA 1BW6A 4DW6A 3BT9A 2TRTA 4A3KJ 3TW7A 1B8IA 1WI3A 3ZQFA 3HOVJ 2FJ1A 4MO7A 2IEKA 1JKOC 2HYJA 2KT0A 1P7IA 1IRZA 1HDDC 1W0UA 4BBRJ 3G1LA 3RQIA 2R5ZA 3IV5A 4Y7NJ 2DMUA 1QRYA 4C3IJ 1ZKGA 5EG0B 2R0QC 5E3OA 2FX0A 1Z0XA 1ENHA 2DA1A 5F1JA 1DU6A 2CJJA 1X2NA 2EBIA 2VKVA 4MFDA 4A3EJ 5EG0A 3BG3A 4W97A 3BR0A 4DYRA 3BTJA 2DA7A 1WCMJ 3BR6A 4M6VA 3JRCA 2HXOA 2WV1A 1IV6A 4GFBA 1ZR4A 1MBEA 1MSFC 3JRIA 2CQQA 1XC5A 3ZQIA 1ETXA 2E2IJ 5EZHA 2NVXJ 2NOGA 1DU0A 5E3LA 4M3EA 2MW8A 2EH3A 3DCFA 2E19A 1AHDP 2GM4A 1JJ6C 1LE8B 4V2FA 3BR2A 1ZQ3P 3S2DJ 3Q0VA 3A02A 5IP9J 2GBYA 1NK3P 4BXXJ 5F0CA 2DMPA 2COBA 3BTLA 4M3BA 5F0FA 1Q1VA 4DZPA 1BL0A 5F0HA 1APLC 1MH3A 5DS9A 1B72B 3F0CA 2WB1N 3GTPJ 1GT0C 3SDGA 1GVDA 3TP0A 3UKGA 2JA6J 4MIMA 1MBFA 4JX4A 4A3GJ 1CQTA 5IPAA 3W6VA 2NVYJ 3BR5A 1XG1A 3GBGA 2XPWA 3S16J 5M3MJ 3ZQCA 3CQZJ 2XGDA 5JLXA 4UUSB 1RPWA 3S1NJ 1JUMA 2X9DA 5FKKA 1U8BA 1X2MA 1RETA 3HDDA 3TEDA 2NS8A 1IG7A 3S1QJ 2Y2ZA 1IDYA 2QF7A 1FTZA 2LK2A 1JGGA 1T56A 5K7HA 2E1OA 2XB5A 2NVTJ 2NS7A 4JX5A 1YRNA 3B6CA 2DMQA 3FISA 2MSYA 3I4MJ 4LOCA 5HODA 3VPRA 3RZDJ 2E2JJ 2DMTA 4D5FA 3QPLA 2YU9J 1ITYA 1ETVA 1K83J 3BTCA 3H0GJ 2LFBA 2DA5A 1MBKA 4W1UA 2XRLA 2EZIA 3K2AA 5GPAA 3LSRA 4IEJA 1U9OA 3FIWA 1HDPA 3GTJJ 4FE7A 2Y9ZA 1P7JA 4QTRA 2DMNA 2L7ZA 3QPSA 1JJ8C 3PO2J 1K61A 2ZB9A 2TCTA 4L5EA 3BR3A 1WPKA 2ID6A 1UMQA 2JN6A 5EZGA 1ZGWA 2O8KA 1I3QJ 3A01A 2JA5J 1VNDA 1FJLA 1OJLA 1UG2A 3OOUA 2QCOA 4B4CA 1Y1WJ 2OPTA 1HOMA 2ME0A 2LKXA 2PMZN 5K7ZA 2CUEA 1JTYA 3TP3A 4S0HB 1JKPC 3LSJA 2HOAA 1FIPA 1UHSA 3B6AA 3ZOBA 4A3DJ 2HOSA 2YS9A 1FEXA 5GPCA 5GP9A 1D5YA 3SFIA 1IJWC 2XGEA 2VPRA 3I4NJ 1SFOJ 1U9NA 3JREA 3IH2A 4G12A 2MGQA 1A5JA 2O7OA 2GLOA 1OCTC 2LLKA 4FCYA 2DJNA 4M3GA 3GTOJ 5FLMJ 1OFCX 4C3HJ 1H88C 4DZJA 1T33A 3JRFA 1JUPA 1POGA 2YUSA 1ETWA 2LY9A 1ETYA 2LVSA 2EQRA 3CMYA 5EDNA 1WGXA 1WH7A 3JR9A 2R5ZB 2CU7A 2IAIA 1BJZA 5IYBJ 3HOUJ 2JJ7A 2JA7J 1JT0A 3GTKJ 5E3NA 1JTXA 4X1EA 4X6AJ 5IYCJ 5FKLA 5FJ8J 1Y1VJ 4XICA 3NAUA 2NVQJ 4I76A 1BA5A 3O8GA 4UUTA 1I6HJ 4XIDA 4A3MJ 1G2HA 2Y31A 1S7EA 4IHWA 2EZLA 3HOWJ 2L9RA 4A3LJ 1VF9A 3WHCA 4XRMA 1BW5A 2R5YB 3D1NI 1ETOA 3TW6A 2EZHA 1B72A 4QIWN 3JRBA 4B3AA 2ECCA 3PM1A 2HQ5A 3G1MA 2AO9A 5EF6A 3CDLA 3PO3J 5J1RA 4A3IJ 4XRSG 1FTTA 5FKNA 2XGCA 4D5CA 2B63J 1IDZA 3GTMJ 3H3VK 1E3OC 3LSGA 2M2EA 1MH4A 3DEWA 4XK4A 1QPIA 3O8HA 1LFUP 3Q0UA 3MVPA 4MFEA 2KDZA 2K40A 5FLVA 2DA3A 3S14J 3BQZA 4D7MA 2JK3A 3LOCA 5IYDJ 2LR8A 3MKLA 3FK6A 2JA8J 4M3FA 1AU7A 2M0CA 1OCPA 2DN0A 2EZKA 3LSPA 3ZQGA 1NTCA 1AKHB 1ZR2A 2K9QA 3A03A 3Q3SA 2K9NA 5FKMA 4XRSA 2CQXA 4CYCB 3S1RJ 1IC8A 3JRDA 2X6OA 4FTHA 1TWFJ 2DA2A 2MG4A 2CUFA 2M34A 1MBGA 3FK7A 5IOYA 4IHVA 4V2GA 3BR1A 3IH3A 4UUSA 1LE8A 4FE4A 1A6IA 1B8IB 1LFBA 3BQYA 1X58A 2R92J 1ETKA 4IHXA 3HKZN 1F36A 4JX6A 5IOZA 2OF7A 4ABZA 1XS9A 5DTDA 3JRGA 2ID3A 5J3LA 1H89C 3HOXJ 1MBHA 1YRNB 2E2HJ 1GV2A 3GTQJ 2H8RA 1O4XA 1I50J 2VUMJ 1MSEC 2XPUA 4NDLA 4BKXA 5EYRA 1PUFA 2L7FP 1Z77A 3BG9A 2W48A 1HCRA 5EGOB 2R93J 2HOTA 4A69C 1IGNA 3RKQA 1ETQA 1TWHJ 4IHYA 2P81A 5F04A 3ZQHA 1IUFA 3S1MJ 3IH4A 3G1OA 1F43A 2CRGA 1ZTRA 4C3JJ 4CYCA 4HNVA 1RKTA 3CCYA 1WH5A 2L7MP 2LTPA 3OIOA 2Y0SN 3ZQLA 1HF0A 5FKOA 2RAEA 5C3EJ 5C4XJ 2FD5A 2X48A 1VI0A 2LD5A 1JT6A 1JKRC 5C4JJ 3QQAA 4DYCA 2L0KA 2M8GX 3HM5A 1GDTA 3RZOJ 5E3MA 2Y30A 2JMWA 2Y9YA 3OSGA 2R7ZJ 4M3DA 5F08A 5J1YA 1W0TA 2DA4A 5M5WJ
chains in the Genus database with same CATH superfamily
4ESJA 2O9LA 1OPCA 2HDCA 5LEJA 2QVOA 5ICGA 3G6EI 2O3FA 3FBNB 5D6FA 5HLIA 5M3FJ 1MW7A 1S29A 2E1MB 4OIOF 2VI6A 1ODDA 5CYVA 3CUOA 3M7GA 3CCEI 3GWZA 1ON1A 5IP7J 3S8PA 4HNUA 4PFOA 1YITI 1SAUA 4A3FJ 9ANTA 2Y69H 1FBSA 3DP7A 3GF2A 2FOWA 2X6XA 2R5YA 1SANA 3MZ8A 1RR7A 1WWXA 2DBBA 4IOAF 1OKRA 3K7AJ 3F22A 1YYVA 2VQCA 3C1DA 4Q5SF 1P4WA 2FQ4A 3OOPA 2FBKA 3GFIA 3S93A 3J80Z 4C2UA 4E7HA 1D3YA 4XNFA 2EPFA 4PSXA 4ZZDA 4G6QA 3B02A 4JYKA 2CWEA 3S3MA 2DAOA 3A01B 1TL8A 2ELKA 1RRJA 4WX9A 1MNMC 5CQEA 1QVUA 1IUYA 1Z7UA 4CCLA 2H1KA 2F5CA 4F55A 3S2HJ 1OMIA 2HWVA 2K9SA 1LFPA 3OS2A 1V54H 3DLLF 3HGGA 1NK2P 1NHAA 4AIJA 2LKSA 1HLVA 2HS5A 2ESNA 4M9SA 3RPQA 3ABMH 3FWEA 2M9HA 4BJ6C 1TWGJ 3WHBA 4M73A 1WVRA 3E7LA 5EEAA 2FOKA 3CDHA 2WAQN 3KFWX 3Q0WA 1FMVA 3MKYB 4P55A 3LAPA 1EH7A 1A31A 2I10A 2LP0A 4ANJA 2G7HA 1IXRC 2YPRA 4XKVA 3DTKA 5IP6A 3E6MA 3TDZC 3M3YJ 3Q5FA 1IN6A 2ZXWH 2KP6A 4UUVA 4QSHA 2WA0A 3BP8A 4XKCA 3ECOA 2MABA 4XLHA 4Y52J 2IW5A 5M5XJ 2ECBA 3VSKA 1E3HA 3T0YA 1XN7A 3BT9A 3ECHA 4N9IA 2LF8A 3K4JA 5ILVA 3HOVJ 2PFBA 2FJ1A 1ZHFA 4MO7A 2IEKA 1IRZA 4H4KC 1CGPA 4LG0A 3OY9A 3KPHA 2P4WA 4Y7NJ 3A4CA 2DMUA 4HEA2 3D0SA 4XM3A 1YO5C 3ML6A 3QODA 5F1JA 2CV1A 3CC2I 3OWTA 3QAHA 4XN0A 3CLQA 2F5VA 2HEOA 2HR3A 2DA7A 2QSGX 2LDUA 2HXOA 1T39A 2IRFG 2OV7A 3PSFA 4II3A 4QPOA 2D1HA 4RM2A 1QNTA 3KP3A 3RTRA 2F4MB 3JRIA 1XC5A 3DV8A 5EZHA 2DODA 2P7VB 1DU0A 2VL8A 5F64A 4M3EA 2O6GE 5ILUA 3N4MA 2HFHA 3DLAA 2K9MA 2MW8A 4ENMA 2XHKA 1R71A 2EJRA 5D8KB 3PJRA 3F3XA 1AHDP 1U3EM 2CV2A 3ZMUA 2BY2A 4HSTA 4CA0A 1LE8B 1Z7LA 3CC7I 2KFDA 3CMMA 3PNTA 3F72A 2WBMA 5IP9J 1TLHB 3R61A 3OYDA 1MMSA 1NK3P 2BY3A 3IKVA 3LFUA 3K4BA 4E70A 1BL0A 1APLC 1MH3A 1FNNA 4A0YA 5DS9A 1B72B 4XR6A 3HG9A 3NWTA 1IRFA 3GTPJ 3J81K 1GT0C 5DUIA 5IY5H 2JT1A 2BYVE 4MIMA 3F23A 1T0FC 1CQTA 3HUGB 2NVYJ 4BJTA 4PSWA 3I59A 3PFIA 1Z1DA 3ZQCA 4NBQA 1RNLA 1HW2A 3CZ6A 5K5QA 1RPWA 1X3ZB 2DK8A 3H5RA 1WFXA 3EUHA 3F8BA 2M5WA 2LKPA 3HDDA 2FA5A 3GCMA 4RAYA 2V1UA 5GTIC 2QF7A 1UJ8A 5K7HA 2E1OA 1RZ4A 2X6WA 2HVSA 2RNJA 2DMQA 3NRVA 3T5XA 4LOCA 2DYSH 1VQPI 1T08B 1TW2A 2X6YA 3OYEA 2GOXB 1MJAA 5CLSA 2YU9J 5L3EA 4EM0B 2RGVA 3FXMA 1ETVA 1K83J 5D4RA 3U9GA 2V1DA 3P7NA 3BTCA 3CF5F 3H0GJ 2LFBA 3D5LA 1H0MA 1T95A 2DA5A 1MBKA 3M8JA 4AVPA 3JAMZ 3K2AA 2FMYA 5GPAA 3L2CA 1HDPA 3TBIA 1K6OA 2Y9ZA 3EUAA 5H20A 5D6EA 1S5LC 3ROUA 2P7CB 2DMNA 1BI0A 2E7XA 2IGNA 4L0ZB 4BXFA 2P5LC 3VODA 1I1GA 2JN6A 4G94A 1JXSA 1FJLA 3OOUA 4AWXB 1IRXA 1IO2A 2OPTA 2IA2A 4N0BA 3TP3A 3RKXA 4YRVA 3LSJA 1FIPA 2LMDA 3B6AA 2L7KA 3ZQQA 1B4AA 2HOSA 4C30A 4F91B 1D5YA 2BEOA 2XGEA 2V9VA 2JQ7A 1D0ZA 5BPIA 2PG4A 2X4HA 4ZTFA 4XL9A 5FO5A 2MGQA 3HC7A 3CC4I 4KYWA 2VC0A 2QSHX 2GLOA 1A5JA 4PZJA 1XB4A 2UXXA 1OCTC 2H27A 1RI7A 4M3GA 3EYIA 1R6RA 2H94A 1I1SA 2V1XA 2ELJA 3M8FA 3ULQB 3N05A 4DZJA 1DP7P 2VE8A 1JUPA 2CQ7A 3M8EA 2VKHA 3K4KA 4LB5A 2LY9A 3CCMI 4EVIA 4XLNF 4FETA 1Y8QB 1SFXA 2BZTA 3KX2A 3L7WA 2W82A 2CU7A 2VC1A 1SD5A 2IAIA 2Q8KA 5IYBJ 2NNYA 2MYSA 1QZZA 1O3RA 1XCBA 1JI8A 5FJ8J 1BA5A 2MH2A 4LLNA 4BHBA 1HQCA 1Y8RB 4RAFA 4MGRA 3REOA 2EZLA 1KA8A 2L9RA 1TT0A 4XLFA 1W5SA 1J09A 2R5YB 3D1NI 2PEXA 3TW6A 1UFMA 4QIWN 5J4YA 3JRBA 1B72A 2HQ5A 4LG0B 2VBYA 3RYRA 1VQOI 1D1AA 4PDKA 5J1RA 2ZXHA 4A3IJ 2WAQA 1FYLA 3VOEA 1ZAOA 2GQQA 4LFUA 1P6RA 1OYWA 1FTTA 2XGCA 3VYRB 1T6SA 1OR7A 1IDZA 2KJCA 3H3VK 2IGMA 2OCEA 1A04A 3LSGA 1MH4A 1ERDA 3S3OA 1EV7A 2GAUA 1BIBA 4EQQA 4MFEA 5A2QZ 1USSA 3E1SA 2XAGA 3FXLA 2JK3A 3LOCA 3LQQA 5H6QA 1G3TA 2V6EA 5IYDJ 2Q1ZB 3FXQA 1ZH5A 1V4RA 2VXZA 3FK6A 4CH7A 2QQ8A 4M3FA 1LB2A 2M4KA 1HKTA 2X1DA 3WGHA 1TTYA 4ZYHA 3MWMA 1SD6A 1PP7U 3BJ6A 4CYCB 2LH9A 3WTWC 1YJ9I 4CO8A 2CQXA 3S1RJ 4UVAA 4L0YB 2DFIA 1MMAA 4N4OB 4P96A 3TKYA 5IOYA 2ZMEB 4IHVA 3PIOF 5B1BH 2Z33A 3HPHA 2O8XA 1XTAA 3BJAA 3QU3A 1UHMA 4U0VA 2DFEA 2WAFA 3IWZA 2FF4A 4DIQA 2XF7A 5IOZA 5FB2A 2LC2A 3LSIA 2DYRH 2W4SA 1HA8A 1QBJA 1YRNB 4E7SA 3S3NA 2LNBA 4D1QA 3LFKA 2Z3YA 3CCSI 1G3SA 3PQJA 1DUXC 3LAJA 4NDLA 4R8HA 4ZDOA 3RCOA 2XROA 1L0OC 4Q4ZF 2L7FP 2RQPA 1MJBA 5TJJA 3SZGA 1JGSA 1WI9A 5DCMB 1HCRA 2L9NA 3FXRA 5FLXK 4A69C 4KMFA 2WY7Q 1EKEA 1TZLA 4IHYA 2BW3A 2CRGA 3HRTA 2A07F 2LYCA 2HPMA 3A2KA 3E6DA 1S7AA 1WH5A 3M1CA 3QYBA 2LTPA 3OIOA 2ZFUA 2UUZA 1DQUA 2XIGA 2ZJ2A 3PNVA 3ZQLA 4BQNA 1TNSA 2HKOA 3CP8A 4KN4X 4XKBA 5FKOA 4B3XA 4U7DA 5C4XJ 2PJPA 2VT2A 3I5UA 5LRSA 4XKWA 2LD5A 1D0XA 1DP3A 1OCRH 2IS6A 4IRGA 1X3UA 4HF0A 3LMMA 5L3DA 2M8GX 5ICFA 5C4JJ 1YJNI 3JSPA 1BI3A 3SZPA 2PN6A 3LA7A 4FHTA 5LGNA 2JMWA 2OQRA 4BAYA 5F08A 5LEKA 2VIXA 3KIOA 4BUPA 5M5WJ 5L3GA 1RKWA 3QYEA 3JRAA 2N8GA 5JLWA 1K79A 3EQLF 4L9VA 1TQPA 3ESWB 3OSFA 2VKEA 1GXQA 3H36A 3ONQA 4I6ZA 1MDMB 4LIVA 2BY1A 2G0EA 1JE8A 4IKFA 2D5VA 1G8XA 3L2WA 5DDGA 4IHSA 3GEZA 1PUFB 4RGXA 4UNOA 1MDMA 1K78A 1XPXA 1E3PA 3H35A 1GUUA 4A93J 3HHHA 3L2RA 2M7BA 5DM7F 3L1PA 5J1UA 3BJOA 1H9TA 1USTA 2FRHA 3ZMTA 4JOMA 5D5VB 2XAQA 4UV9A 2KIUA 3H9JA 1R58A 3HOYJ 1I6XA 2F4IA 3QOEA 2JRTA 1TW3A 2UXNA 3OMYA 1WZ2A 2HQAA 2Y75A 4AYBN 3DTIA 2DA6A 3SHFA 4KISA 3V8JA 3AG2H 2F5FA 3JAMK 2Z2SB 4BBSJ 4EJTA 1LJ9A 1QZEA 1O3QA 3GTGJ 3PUBA 4CSWA 4XOTA 2KRHA 3COAC 4A3JJ 4IPAA 1XMAA 2B7EA 3GZ5A 1Y0UA 4IVNA 2PX9A 3EYYA 2HXIA 3F8MA 1QHGA 1KONA 2HI3A 4R1HA 3DKWA 1FP2A 3MKZA 1WSUA 2VQHA 3B73A 2ZBKA 3OYBA 2ISYA 2NOJB 3NARA 1JKQC 1EF4A 3UR3C 4YELA 3J81Z 3GTLJ 1S9HA 1TWAJ 2JVGA 3ZMSA 4BY1J 3ABTA 2OTJI 3MZYA 2H8WA 3KP6A 3QOPA 4GRIA 4OIQF 4LITA 3WG9A 3O2PE 1TWCJ 2YSRA 3DU6A 2P8TA 4RBOA 3SYTA 2CMPA 2XKOA 2FE3A 3JTHA 2DXIA 2MLGA 2Q2EA 2XAUA 4M71A 3GFMA 3H5NA 1LPQA 1OCOH 2H1LA 1MGTA 4WCGA 3JRHA 1LEAA 2R7WA 3KP4A 2AHQA 1IF1A 1R1VA 4AC0A 2NXNB 3DKYA 1EH8A 2ZNYA 1G4DA 1KZHA 2CUZA 4HW0A 4PJMA 2ZJPF 2HPIA 3BG6A 3U2RA 4EEFG 1BW6A 4DW6A 5B3SH 5E8GA 4BEHB 5BMZA 4IRIA 2E35A 4A3KJ 1WI3A 2WWYA 3LA3A 3F6VA 3V7RA 4E7JA 3OL4A 1P7IA 1U5TA 3RQIA 3K4MA 4AIDA 3QP6A 4EV0A 1FYKA 3BOQA 2R7UA 4EJOA 3GUDA 2R0QC 1LDDA 3ELKA 3T8RA 3CJTB 4PJJA 1Z0XA 1U6GA 3ABUA 4RB2C 1ENHA 3GX4X 5CQGA 1R49A 1E17A 2DA1A 4IXAA 2CYYA 3H9GA 3SEQA 1NG7A 4MFDA 4LB6B 2XC7A 3DU5A 1V5GA 3BG3A 1R1UA 2VONA 3BR0A 1OISA 5HNHA 1WCMJ 2D45A 2CGPA 1BC7C 4LLGF 4MQVA 4CHUA 3DFGA 2KJBA 2EFQA 4BHPA 3K1MA 4AM3A 3VYTB 4BQOA 2VLAA 1ETXA 1TNTA 2F4OB 3ZMDA 2IGKA 4M72A 3HYIA 1D1CA 2BBYA 2NOGA 1HC8A 3IWFA 5E3LA 4CGZA 2VOOA 2EH3A 3WE2A 3BROA 3HOSA 1FBQA 2W00A 4LK1F 3V7CA 1JJ6C 2VBXA 4I0BA 4CICA 2X85A 3ABKH 5HNFA 2LY1A 3S2DJ 4NC8A 5GAGJ 1PP8F 4BXXJ 5F0CA 3OV8A 1ON2A 3BTLA 4M3BA 2ELHA 2R3SA 5F0FA 4CYDA 3RI4A 3OR1C 2M30A 1KGSA 4ZTJA 3BPVA 3F0CA 2D2WA 4IF4A 3ZRGA 3OYKA 3UKGA 4BE2A 1MBFA 1YW7A 2R7QA 5J8CA 3TOAA 3ABLH 2E71A 4E7LA 2HQRA 5EEHA 4RB0A 3BC8A 3GBGA 4PGHA 1STZA 4A0ZA 3D5SC 2P5KA 1VQ7I 1W7PB 2MD0A 3FDYA 2X51A 1VQ8I 2XGDA 3BZ6A 5JLXA 2R93J 5L3BA 1U8BA 1YHQI 1X2MA 2UZKA 1RETA 3TEDA 5CJ9A 1IG7A 1IN8A 5FGMA 4RLFA 1JGGA 2K3PA 1LVAA 4MTEA 2NVTJ 2NS7A 1YRNA 2MBFA 3FISA 2KLOA 3HRMA 3VPRA 4V19K 2DMTA 2E1MC 4D5FA 2LF7A 4Z6YA 1ITYA 3ZQ7A 1W4MA 4RGRA 5JR3A 2KKOA 2K9LA 5DCMA 2DO7A 4WF2A 4DBRA 4EGYA 5J47A 3LSRA 1U9OA 1QHHD 4BS9A 3GTJJ 3ZP5A 2EILH 5HS9A 4S05A 1OLTA 1S7OA 4KICA 1ZG3A 1ZGAA 2V6CA 4WK8F 1JJ8C 1K61A 2M45A 4OMZA 5FRNA 5F1RA 2MC3A 2ID6A 1UMQA 4BJ5C 1KU2A 5FLXZ 1I3QJ 2JA5J 2Q0OA 2DQLA 5FD5A 2QENA 4IJAA 3AG1H 1G3YA 5BS6A 1HOMA 2ME0A 3OIPA 4UB8C 4GYIA 2PMZN 2LRDA 5B5EC 5K7ZA 2CUEA 2FU4A 3HRSA 4HNTA 2WAEA 2YS9A 1R5ID 3FBIB 3RQ4A 3DBHB 4XN3A 1WQ2A 2NYXA 2TDXA 4QWQA 1GHCA 3R60A 4ZDLA 3WU2C 4XMYA 4E7IA 1QU3A 3HJEA 5K5RA 1SFOJ 1U9NA 2VBWA 1YIOA 3K1PA 1IZ1A 3BG7A 2O7OA 5LBQA 2QEXI 1SC7A 2LLKA 3GTOJ 1LKXA 4B8XA 3L2QA 2QWWA 2RQQA 1UHWA 1ZLJA 5CVUA 5FLMJ 2K7LA 3TQNA 5FRMA 2OC6A 1LUJB 4ESBA 4NB5A 3CCQI 5HLGA 1ZG1A 2YUSA 3OYJA 2FQ3A 2BHYA 2PQ8A 2XAFA 4WXCA 3HSEA 3GLXA 4I98B 2EV6A 5LRRA 3QYFA 2BXYA 2HZTA 1KU3A 3I58A 3HL2A 4G6DA 1RIOH 3O6BB 1BJZA 3I56I 3EETA 3E5XA 3CMAI 3I55I 3HOUJ 2PLYA 2JJ7A 3CJNA 4UV8A 1JTXA 4X1EA 2LG4A 3J7YJ 2BY0A 2EIKH 1Y1VJ 1SFKA 2FBIA 1MNEA 1OR7C 3BZCA 3NAUA 1DDNA 3EPZA 4WXDA 3KZYA 1REPC 3E5QA 2Y31A 5CVRA 5J6XA 3V7SA 4U0WA 1X1DA 4IO9F 1ACIA 3LSTA 4A3LJ 1H9GA 4Y33A 1YIJI 4XRMA 1BW5A 1X1CA 3K1NA 4RAZA 2V79A 1U5TB 3WTTC 4FX4A 3JCUC 2AO9A 3LSMA 2KIMA 2EIMH 4XRSG 1FOWA 4XLEA 2XVCA 2KIFA 2QSFX 3GTMJ 4G7HF 4P1WA 4XBFA 1Y56A 1SMYF 3P9CA 2C6YA 4L9JA 3DEWA 3J7ZI 1QPIA 3I71A 2XUBA 4ENJA 1FLIA 3P5JA 3E6CC 2LBFB 2KDZA 4WWCA 4D7MA 2RKHA 2HYGD 2RNGA 3KE2A 2NAZA 1T2KA 3LSHA 2A5YB 1BIAA 1W5CC 2ZC2A 3SXYA 2OAZA 4CCMA 4OMYA 2LY2A 2M0MA 1HW1A 4LD5A 1HSTA 2EZKA 4A5NA 2YX4A 1UCRA 3ZQGA 3VYSB 4F52A 2K9QA 3E6BA 3OS0A 3W2WA 1R22A 4JK1X 4XRSA 5FKMA 2DOFA 1UG0A 3JRDA 1TWFJ 4YFXF 1FOXA 4HZFA 2MG4A 4F3QA 2Q2EB 2KZGA 2QQBA 3FK7A 4YIFA 1VQNI 2K27A 2IVMA 3VFZA 4UUSA 2EFWA 1KQ8A 2DPDA 2V7FA 1T8IA 4XLAA 1LFBA 1X58A 3ZCOA 1ETKA 2R92J 4BGDA 3K9TA 4IHXA 1F36A 4U87A 4ABZA 5GAHJ 1G59A 2ISZA 3JRGA 3PSIA 2XF6A 3RJPA 3KP2A 4AU7A 2VE9A 3G73A 2WB1A 2DW4A 4Z2YA 2ZXIA 2STTA 3HRUA 1YTYA 3G3ZA 2H8RA 4EGZA 3T1BA 1I50J 1NH3A 1ONVA 4AD9A 2VPLA 4KMUX 1FSEA 3PIPF 2DT5A 3AFHA 2MD5A 2OD5A 2V9PA 3OIQA 5EYRA 1Z77A 2EFOA 2NNNA 4KUMA 4Y17A 1D5VA 3MMYB 4J01A 5F04A 3ZQHA 1IUFA 2KRCA 1P92A 3IH4A 3G1OA 2D1VA 4CUGA 4KJZA 4C3JJ 3IC7A 2A6EF 2CS3A 3CUQB 4HNVA 1ULYA 2JTVA 2QGUA 2IS1A 3GW2A 4G6TB 2L7MP 1W36D 4R79A 4HLXA 4YFNF 4XSXF 2OCCH 3FMQA 1HF0A 5C3EJ 1QGPA 2M1BA 1CF7B 4II2A 4HOBA 1JKRC 2VKDA 3RZOJ 3A0BC 3GVAA 2Y30A 1BN5A 3FXJA 3OSGA 1W36C 4X6AJ 3BLYA 3ZMVA 2HNHA 1FY7A 4NNJA 4BQQA 3H1CA 4GXOA 5JHUA 3I53A 4ITVA 2CUJA 4O6JA 1HSJA 1IW7F 5D5XB 4XORA 1Z6TA 3FMSA 4AIKA 3W2AA 4O3MA 4CZZA 2L5QA 1RUOA 1ZGJA 5EGOA 4FISA 1FIAA 1H8AC 1YS6A 2QYOA 3OYNA 1GV5A 2OU2A 2W57A 3HOZJ 2ZO4A 3F6OA 3FXKA 1F4KA 5CPRB 1JHHA 3MN2A 3QPHA 3E0JB 2W85A 5LHIA 2EFNA 1Y0NA 2JWTA 2QM3A 4BDZA 1R4MB 1WJFA 4HDUA 1X1AA 3E5UA 2FBHA 1K4SA 4CCJA 2A61A 4C2MJ 1IN4A 4XONA 2EA4A 5D5UB 1BBYA 3SDBA 3IAS2 1ORKA 3HGYA 4HV6A 3K0LA 4DYQA 4OIPF 3FKIJ 2VODA 3HTSB 3MD2A 2K02A 2IGOA 2XB0X 3DPLC 4NQWB 3VEPA 3CUQC 3OL3A 6PAXA 1DGWY 5IT9Z 2LREA 2Z9OA 1UB9A 1Z6RA 4AUXA 1X4OA 2P5VA 3BZKA 1MMDA 4DGWB 5D4SA 5HVQC 5KNLA 2EIJH 5BNGA 3H5AA 2XSDC 1BC8C 4MLOA 1AKHA 3OYCA 2OA4A 1YFHA 3KLNA 1ZK8A 2VQGA 4JP0A 1XD7A 3F8FA 3R0AA 2PMZA 2VJJA 2UWMA 2J5OA 5M5YJ 4D7NA 3HBLA 2MH9A 4HV5A 4JQFA 1I5ZA 2KPMA 3C2BA 5HLHA 2K5CA 4HRIA 2EB7A 1FP1D 1FOKA 2LBFA 2Z16A 5DD4A 1FYMA 1YX5A 3FKJA 2VJ5A 5K7FA 3IL2A 2WC2A 1DGRM 2A6HF 5EEGA 5H2FC 2W1OA 3H3UA 2CW7A 3TW7A 1LQ1A 1B8IA 2BOLA 2L9VA 3IAM2 2QA4I 2H09A 1JKOC 2DU9A 2KT0A 5LHHA 2LSOA 2VB6A 1W0UA 1HDDC 1MIJA 3QRFF 1B6AA 1V5FA 1ZN2A 4N4NB 4BBRJ 2HVQA 2GA2A 3G1LA 1RC9A 4XOPA 3O3KA 3IV5A 5BOXA 3OYHA 5CVJA 1QRYA 4C3IJ 2QZ8A 5EG0B 4DNCA 1BR2A 1W1WE 5IT9K 1IN5A 2M3AA 3WTSC 2EBIA 4Q48A 1PJRA 2BE5F 3L09A 5DM6F 4A3EJ 2M7AA 3NEUA 5EG0A 4LIUA 3F9KA 2DLLA 3K4CA 4DYRA 3BTJA 3BR6A 5GTHC 2DT7B 3JRCA 2JPBA 2WV1A 1IV6A 3AG3H 1ZR4A 1SAXA 2IT0A 1W7PA 2OQGA 1MBEA 4HDVA 1R36A 3VDXA 1WJEA 1Z05A 2DCEA 2CQQA 2Y0SA 3ZQIA 5EJCA 3K4LA 2E2IJ 2DQRA 1D1BA 3I4PA 4BH9A 1W7PD 1D0YA 2GIVA 2G9WA 2ZFWA 3GMEA 3CJRB 3DCFA 4KIBA 1O7FA 3KZIC 1XSXA 3J7AY 4I0AA 1ZQ3P 3Q0VA 3A02A 4ZDPA 2GBYA 2GA1A 2HU9A 5FROA 3HZJA 4LLLA 2DMPA 2COBA 1GXPA 1L3LA 1KQ9A 4DZPA 5F0HA 2GXBA 1LVKA 4HF1A 3HPGA 4IQ4A 3ASNH 3SDGA 3TP0A 2LOOA 1OYIA 2RREA 2JA6J 3JSOA 2QBYA 4A3GJ 4JX4A 3OR2C 3SZTA 3HKZA 1YQAA 3RKWA 3K6GA 2FEZA 3DQVC 3U1KA 3BR5A 3C2HA 2DTRA 3TL4X 2XAJA 1SVLA 4ZYAA 4HLYA 1O57A 3V8LA 4C9YA 5TISC 3WGIA 3M1EA 1JUMA 2RC4A 5FKKA 5JVTA 1YE9A 2NS8A 3LWFA 4EM1A 3S1QJ 1J5YA 1FWZA 2Y2ZA 4ZYDA 1IDYA 2PMUA 2LK2A 1OCZH 4Y15A 1FTZA 3MZHA 4IQJA 2V4JC 2XB5A 2BHZA 5CVIA 4MNUA 1S6LA 4RGSA 4JX5A 3B6CA 3I4MJ 3C18A 2Z99A 1Z21A 3RZDJ 2EA2A 1FMWA 2E2JJ 4UVCA 4P9FA 3ERED 1N78A 5ICEA 1QA6A 2EWNA 3HSRA 3U21A 2CFXA 3J80K 2ZSHB 3WU1B 4XSZF 3RYPA 3GXOA 4KT6A 4HG2A 2COMA 2ZMEA 1GLNA 3M07A 4W1UA 1MMGA 4KDPA 4NHJA 3I0TA 3EUHC 2ZJRF 3J7AO 5K1YA 4QTRA 3BDDA 2OUMA 2L7ZA 2ZMEC 3E3VA 4LGWA 4YG2F 3PO2J 2MFZA 2FUG2 4UHTA 1TT5B 5F6FA 4L5EA 1A6QA 3HHGA 1FT9A 4NQWA 1WPKA 1ZGWA 3A01A 1J9IA 1VNDA 5ILSA 2XRNA 2OJED 1KQ0A 5HDKA 4MEXF 1AOYA 3ZN0A 4PFPA 5E1XA 4IZZA 1U5TC 1XSVA 2YX7A 4HBLA 1QQIA 4RLQA 4S0HB 1JKPC 1TQIA 1FX7A 3ZXSA 2HOAA 2HVRA 2G7UA 4A3DJ 3MKWB 3L00A 4PGGA 2RV8A 3DWLE 4EATA 1FEXA 4L9TA 5GP9A 3P9KA 4NUBA 2VPRA 2OBPA 1U0JA 4BU2A 3FXOA 3JREA 2DK5A 3IH2A 1FSHA 4X0GA 4HX8A 2A6TA 4A6EA 4P5OA 3MFKA 3VSLA 3K69A 4FCYA 1AA7A 2CW0F 4ZC3A 1AWCA 3TOBA 3K2ZA 5D8LB 1PYVA 4EJUA 1OFCX 5CVVA 2JSCA 2K3FA 5FD6A 3R0JA 2K86A 1T33A 4OU0A 4M9ZA 1SVOA 4DOZA 1XGNA 2FNPA 1POGA 1ETWA 4AYBA 2O61A 5A2QK 2E5ZA 3G71I 3R6SA 2LVSA 4M74A 3CMYA 5DD8A 2XASA 3K10A 5EDNA 1MNDA 2VN2A 4CXFA 3SFZA 3WTZA 1WH7A 2Z1DA 1A36A 2NRAC 1FZPB 4BACA 2XSJC 4D0PA 1YW8A 4DBQA 3K70D 2JVHA 3LQRA 1JT0A 1OCCH 4I99C 3GTKJ 2F5EA 4P9UA 2E60A 4G9YA 5IYCJ 1BM9A 4XICA 3WTVC 1P4XA 3NWSA 2BGCA 1O3TA 1ZG5A 4I2OA 4A3MJ 3MAJA 2IS4A 4XLPF 5KAFC 1NG6A 2AQFA 2R7OA 4ZZLA 2DT6A 2O5RA 4UXNA 4K2EA 3KYDB 3WHCA 4KIFA 3KYCB 1ETOA 2EZHA 1HXDA 4B3AA 3IRRA 2ECCA 4HX4A 4TV7A 5GADJ 3G4SI 3Q9VA 5EF6A 1T0FA 3CDLA 4HA8A 4PCQA 2PJRB 3PO3J 2CQNA 2W24A 1VQ5I 5FKNA 1QO0D 4D5CA 2K4JA 1YOVB 2B63J 2AXTC 3GFLA 1IAWA 4L5IA 4Y3OA 2A68F 1K4TA 1JHFA 1DPUA 4OOIA 2R7SA 3C7JA 4ZYEA 1LFUP 4NC7A 1FOYA 2ZKZA 3Q0UA 3MVPA 2HYFA 4LK0F 1MZBA 3AAFA 2K40A 5FLVA 1P4AA 3FM5A 2WADA 1WRJA 2JRMA 3WU0A 2LR8A 2L2OA 3MKLA 5BQTA 4U0YA 1X19A 5DUKA 2JA8J 1AU7A 2HTSA 5CKTA 2DDBA 2DN0A 3FMRA 1WHUA 1AKHB 1ZREA 1X1PA 2XAHA 1SD4A 4HPQA 5B1AH 5DCFA 1OQYA 3DXJF 3TO7A 2DFFA 2HOEA 4PJLA 4EJWA 4YIRX 1FBUA 3IHUA 3A03A 3CMEI 1IC8A 3G2BA 3I3LA 2X6OA 1J75A 1IXSB 4A2UA 2CUFA 1MBGA 2IA1A 5E1ZB 5IT3A 2JUGA 3BR1A 5E79C 4DQ2A 2ESHA 4ZYGA 1D8KA 3HKZN 4CZCA 3FZVA 4ENKA 5DTDA 2A5WA 1ZRFA 1KYWA 2E2HJ 4A12A 2IXSA 5KCMA 3GFJA 1N75A 1MSEC 2MLKA 3IRQA 2XPUA 1J0RA 1K6YA 3MCZA 2B9SA 1N25A 1HBXG 3OYIA 5E17F 2FSWA 3TO9A 2UV1A 1V3FA 2MC4A 3LL7A 2E1CA 3BG9A 1LDKB 4L18B 2DDAA 2W48A 4HQEA 2GXGA 2CO5A 2L4MA 4M6XA 2HOTA 3TGNA 1IGNA 4BNCA 2JZYA 3HSFA 4BEHA 2P81A 3WGGA 3S1MJ 4FASD 2CV0A 2NS0A 1F43A 3F21A 2W7NA 3CCYA 3KP5A 4ESFA 2ACJA 4HF2A 2Y0SN 2Z5UA 2F5DA 2WTEA 2V26A 1G3WA 2WY8Q 1XSDA 2AQEA 4G8XA 5HLTA 2RAEA 4MQ9F 5E1WA 1BOAA 1VQ4I 1VI0A 1JT6A 2R7RA 3VWBA 4E4HA 2V1NA 4A0XA 1GVJA 3QQAA 4OWRB 4DYCA 3HM5A 4CCOA 3MQ0A 1S3JA 3GYHX 2KIQA 2Y9YA 5J1YA 2OZ6A 3ZN1A 1W0TA 3W6KB 2HGCA 1TBXA 1Z91A 3C2GA 3HEFA 4F92B 1SMTA 4MEYF 3BY6A 5DYMA 5C44J 4RMNA 2A3SA 5HOOA 4HX7A 2L54A 1XDUA 3M4OJ 3BG5A 4L9NA 1LNWA 2A05A 3CDIA 3LNQA 1R7JA 1Z67A 1R9TJ 2XF5A 3BPXA 4GO1A 4J19A 1R00A 2QLZA 4KNYA 3OYGA 2W25A 1F1ZA 1I27A 3AKZA 4A5MA 2Y0MA 5KVRA 5LLQA 1TC3C 3KETA 1T38A 4FT8A 2F48A 1YLFA 2L4AA 3PL8A 3IUOA 1U78A 2YR2A 3H9QA 3FHZA 4QLCU 4G7OF 3DPUA 4B44A 2CW8A 2XPVA 5FFZA 4G7ZF 3KCCA 1Z3XA 3VYUB 4BY7J 3CCJI 3W2VA 3EDPA 1WJBA 2IP2A 3ZMZA 3ZGKA 2GOMA 3HB9A 3QPTA 1BR4A 5F27A 4ZJZA 2HDDA 2GZWA 3PQKA 4BYYA 2ZXJA 4IOCF 3S15J 4YIIA 1W5TA 1MBJA 3BTIA 4B1RA 4C2TA 1FC3A 2VOPA 2ETHA 1X1BA 4Y4RA 1ZLKA 1VFCA 2DTZA 3GO5A 5DV5A 4MHGA 5DEQA 2QQAA 2IBDA 2KRFA 1K78B 3S17J 1G6NA 2HZDA 2VQLA 4A3BJ 3WG7H 1ZYRF 2GIZA 3OYAA 3T8TA 3U1DA 2YU3A 5B66C 3SJMA 2ME6A 1JUSA 3CTAA 4ON0A 2EV0A 3HOTA 2WV0A 1RESA 3HUGA 1YS7A 3UNGC 3M9AA 2QBYB 4A3CJ 1QVTA 3LSKA 2F6CA 2JPCA 4RDUA 3A0HC 3SQNA 1LDJA 1VQ9I 2TRTA 4EMSA 3RDIA 2BW3B 3ZQFA 4XLCA 4LG3A 4KIGA 1KU7A 1A35A 2I5UA 3KEYA 2HYJA 5JFRA 1X3WB 1WKMA 4Q47A 2FNAA 4KITB 2R5ZA 2OTLI 1BOBA 2FXAA 1ZKGA 3L2VA 4BXUA 1ZARA 3F8NA 5E3OA 2XDVA 2FX0A 1I3AA 2RVCA 2CG4A 1IN7A 1P9QC 3QWLA 1DU6A 1V55H 2CJJA 1X2NA 3RIRA 4NC6A 2VKVA 2W84A 2EINH 4L5JA 2CQKA 4W97A 3FF5A 2EFPA 2VASA 1J2XA 3MEXA 3BCAA 4M6VA 1YX3A 3KP7A 2JSPA 3KYLA 2PJRA 1TP4A 4LMYA 4GFBA 2HQNA 1F9NA 5HDNA 2NVUB 1RUNA 3IP4B 3RPUA 2KL4A 4EJVA 1MSFC 1BR1A 2NVXJ 2ADUA 4BE0A 3FM3A 3DF8A 5H6RA 3P9IA 2P0WA 4CCKA 4GDFA 3AG4H 2QKMB 2VXDA 5E18F 2E19A 3I9V2 1VQKI 2GM4A 3D5RC 1IXCA 3OS1A 1YG2A 2R7FA 4UB6C 4B48A 4V2FA 3BR2A 3C3WA 3H92A 1P2FA 2EV5A 1EH6A 1Q1VA 2H6BA 3JW4A 3X2QH 2WB1N 3OYMA 4BL0B 3KEQA 4MTDA 1O3SA 1GVDA 1MKMA 5E8IA 2VJ4A 5ICCA 3KLOA 2KZVA 5IPAA 3W6VA 4GGGA 4I7HA 5KAIC 3JTGA 1XG1A 3CJQB 3S16J 2XPWA 4BHCA 2E1NA 1U2WA 5M3MJ 1BJAA 3CQZJ 4UUSB 3S1NJ 2RDPA 5J40A 1VQ6I 2X9DA 1Z9CA 4I01A 1UZCA 2STWA 2R7VA 3R4KA 3W6JB 1T56A 2E5NA 5J4VA 1B9MA 4E7KA 4IHTA 5L3FA 1R23A 4QPQA 2MSYA 3PFYA 4RB1A 3TDUC 1Q1HA 1ZELA 5HODA 4IX7A 4BQAA 2DJIA 2P6SA 3QPLA 4RA2A 4CCNA 2K4BA 3ISPA 3RPUD 3V8KA 4KT5C 3FX3A 1WJCA 2E7WA 5K5OA 5KHDA 2ZSIB 3CCLI 5TRDA 1YI2I 2IS2A 2XRLA 2EZIA 3S32A 1F5TA 3CD6I 5JVGF 1WJ5A 3TO6A 1KU9A 2E36A 4IEJA 3FIWA 3ZR8X 3IKTA 3DBLB 3LA2A 4FE7A 1R4NB 1P7JA 3RSNA 2L01A 1XGSA 2QUFA 3QPSA 2BVMA 2DOEA 1S72I 2BV6A 2VBZA 3BCBA 2ZB9A 2IA0A 3RKYA 2TCTA 2HDWA 3BR3A 1SD7A 2O8KA 5EZGA 1YW9A 3NQOA 4E6KG 5TGTA 2DFHA 4KFCA 1TQMA 1OJLA 1UG2A 3TMOA 2QCOA 4B4CA 1J7KA 1Y1WJ 3FHNA 5ED4A 1CF7A 2LKXA 4OIRF 2O0YA 3I54A 1R5GA 4EM2A 1JTYA 5LFAA 4WXHA 1UHSA 5D5WB 2A69F 1XCVA 3ZOBA 1O7LA 5AONA 2X0LA 3CO6C 5GPCA 3CCVI 2R7XA 4I02A 3SFIA 1R5HA 1IJWC 2L9SA 3I4NJ 2DPUA 4ETSA 4XRFA 4BDYA 2IPQX 4G12A 4OINF 2I8DA 4RAGA 3SEZA 2VJIA 4J00A 2DJNA 2L02A 1ZRCA 1SFUA 2M4GA 4GCVA 1VQLI 4C3HJ 5LHGA 2F2EA 2HKXA 1H88C 3L9FA 4ENNA 2QQ9A 1N77A 3JRFA 1U8RA 5JI6A 4UY8I 1HKSA 1T98A 2M8EA 1PVEA 2E34A 3DKXA 1VZ0A 1UAAA 1ETYA 3E97A 1LEBA 2EQRA 3QU6A 4O5VA 2IJLA 3DBRB 4PJ0C 1WGXA 5LGTA 3JR9A 3CCUI 5ERIA 2R5ZB 3DEEA 5L3CA 5LD2C 3AL0C 2JA7J 5E3NA 3DTEA 2CSOA 4M6YA 1XGMA 5FKLA 5BPDA 3DEUA 2NVQJ 3I64A 4H0EA 2K85A 4I76A 1E2XA 4B47A 3O8GA 1MMNA 4UUTA 5AIQA 2CFOA 3V42A 1I6HJ 2ZJQF 4XIDA 3CP2A 1HW5A 1G2HA 4OAYA 1XX5A 1SVMA 1S7EA 4IHWA 4N9HA 1MJ9A 3GZNB 1ZRDA 2QKLB 3HOWJ 2KISA 3N97A 4I09A 1UELB 1VF9A 2XV4S 3HXLA 4RGUA 1V5EA 4RS8A 3HTUA 3PM1A 2JA2A 3G1MA 2O03A 2KDOA 3KZZA 5KK1A 1VQMI 4U88A 3Q9SA 1XDSA 2XGXA 1M1EB 1EA3A 2BXZA 2PBIA 1IV8A 3K70C 2CH0A 1B9NA 5J8FA 4UVBA 3WTUC 4JBAA 5HDGA 3W3CA 1E3OC 2M2EA 4GYGA 5JHFA 1K7AA 3QP5A 4IRHA 1Y39A 2M87A 4YFKF 4XK4A 3EUKL 2AXLA 3O8HA 4M9XA 2Y48A 3CLOA 1MD0A 4YEJA 3WODF 3WE3A 3CESA 1BI2A 1FPQA 1D8JA 4ASNA 4CDGA 1KYZA 2DA3A 3S14J 3BQZA 4XQFA 3V4GA 3ZPLA 4A6DA 2ICWG 3VB2A 4HSRA 4Y13A 5E20A 2GXAA 1B59A 2X1EA 4PJNA 2KMUA 1XMXA 1B1BA 2M0CA 1I39A 1OCPA 2ZCWA 3GZ6A 3LSPA 1NTCA 1ZR2A 4OAZA 3H0DA 3WTXC 1RR8C 1J59A 2R7TA 3PUFA 4PK4A 1PDNC 2JUCA 2R4GA 3K4NA 3S2WA 3Q3SA 2K9NA 4FQGA 1EJ9A 1Y6IA 4RB3C 3AL0B 4FTHA 3CUQA 2DA2A 2M34A 5FFXA 3CO7C 3H3ZA 1QPMA 2HTJA 4BE1A 3WTYC 4S04A 4KA4A 3I59B 4V2GA 2PMHA 3IH3A 1LE8A 1E0EA 2DOAA 4FE4A 1QZYA 1A6IA 1HKQA 5HS7A 3BQYA 3KEOA 4IL6C 1B8IB 1PUEE 1C0WA 2R7DA 5AIPA 4F93B 2B0LA 1OYYA 4D9JA 1SFEA 4JX6A 2OF7A 1XS9A 2P6TA 2ID3A 5J3LA 1H89C 2OZUA 3HOXJ 3HIFA 1MBHA 4U7BA 2PI0A 2KQRA 4KN7X 1BI1A 1GV2A 1SEUA 3GTQJ 3PNYA 1O4XA 5GAEJ 2VUMJ 2VT3A 4BKXA 1WJDA 1Z3YA 2KHMA 1VTNC 2AS5F 2MA3A 4ZH4F 1PUFA 2GWRA 2J5PA 1S8NA 4RM3A 5EGOB 2H6CA 4AIHA 4B09A 3RKQA 1ETQA 1TWHJ 2FMLA 2BVLA 3GLLA 4F7ZA 5HS8A 1X4PA 5LGUA 4DJAA 1IRGA 1ZTRA 2X1CA 4CYCA 3A1YA 1XGOA 4AVZA 3ERMA 1RKTA 3DPTA 3L2UA 2RN7A 2ZNZA 3OYLA 3FXUA 4HYEA 1WJAA 2L3DA 3ASOH 4B43A 4E7ZA 3OYFA 1DPRA 2FD5A 2EK5A 2X48A 2DI3A 1XMKA 3CCRI 3BWGA 4LJZF 2XKPA 1GDTA 2L0KA 4HAMA 5E3MA 4PUSA 2V9KA 1R1TA 4HQMA 2R7ZJ 4M3DA 1YJWI 3CF2A 3F8CA 2DA4A 4FX0A
chains in the Genus database with same CATH topology
2O9LA 1RKWA 3HEFA 3JRAA 2N8GA 5C44J 5JLWA 5M3FJ 3OSFA 2VKEA 3BG5A 3M4OJ 2VI6A 4I6ZA 5EGOA 3LNQA 4FISA 1FIAA 2G0EA 1R9TJ 1H8AC 2D5VA 5IP7J 1PUFB 4J19A 1GV5A 4A3FJ 9ANTA 3HOZJ 2R5YA 1SANA 4A93J 1GUUA 1RR7A 1TC3C 3MN2A 3L1PA 5J1UA 3K7AJ 2JWTA 2FQ4A 1U78A 3HOYJ 4AYBN 2XPVA 4C2MJ 2DA6A 1ORKA 3HGYA 4DYQA 3FKIJ 4JYKA 4BY7J 3A01B 4BBSJ 2ELKA 2XB0X 3GTGJ 1MNMC 1QVUA 3HB9A 4A3JJ 5F27A 2H1KA 2HDDA 3S2HJ 4AUXA 1NK2P 2K9SA 3HGGA 2HXIA 1HLVA 2HI3A 3S15J 5BNGA 3NARA 1JKQC 1MBJA 3BTIA 1EF4A 4B1RA 2XSDC 2M9HA 4MLOA 1TWGJ 1AKHA 3WHBA 1TWAJ 3GTLJ 4BY1J 3E7LA 5EEAA 1ZK8A 1VFCA 2DTZA 4JP0A 2WAQN 3Q0WA 1TWCJ 2IBDA 5M5YJ 4RBOA 3S17J 4D7NA 3HBLA 4A3BJ 2I10A 2LP0A 3C2BA 3SJMA 5IP6A 2ME6A 1JUSA 3M3YJ 1RESA 3JRHA 4QSHA 2AHQA 4Y52J 4AC0A 5K7FA 4A3CJ 1QVTA 5M5XJ 2ECBA 4EEFG 4RDUA 1BW6A 4DW6A 3BT9A 2TRTA 4A3KJ 3TW7A 1B8IA 1WI3A 3ZQFA 3HOVJ 2FJ1A 4MO7A 2IEKA 1JKOC 2HYJA 2KT0A 1P7IA 1IRZA 1HDDC 1W0UA 4BBRJ 3G1LA 3RQIA 2R5ZA 3IV5A 4Y7NJ 2DMUA 1QRYA 4C3IJ 1ZKGA 5EG0B 2R0QC 5E3OA 2FX0A 1Z0XA 1ENHA 2DA1A 5F1JA 1DU6A 2CJJA 1X2NA 2EBIA 2VKVA 4MFDA 4A3EJ 5EG0A 3BG3A 4W97A 3BR0A 4DYRA 3BTJA 2DA7A 1WCMJ 3BR6A 4M6VA 3JRCA 2HXOA 2WV1A 1IV6A 4GFBA 1ZR4A 1MBEA 1MSFC 3JRIA 2CQQA 1XC5A 3ZQIA 1ETXA 2E2IJ 5EZHA 2NVXJ 2NOGA 1DU0A 5E3LA 4M3EA 2MW8A 2EH3A 3DCFA 2E19A 1AHDP 2GM4A 1JJ6C 1LE8B 4V2FA 3BR2A 1ZQ3P 3S2DJ 3Q0VA 3A02A 5IP9J 2GBYA 1NK3P 4BXXJ 5F0CA 2DMPA 2COBA 3BTLA 4M3BA 5F0FA 1Q1VA 4DZPA 1BL0A 5F0HA 1APLC 1MH3A 5DS9A 1B72B 3F0CA 2WB1N 3GTPJ 1GT0C 3SDGA 1GVDA 3TP0A 3UKGA 2JA6J 4MIMA 1MBFA 4JX4A 4A3GJ 1CQTA 5IPAA 3W6VA 2NVYJ 3BR5A 1XG1A 3GBGA 2XPWA 3S16J 5M3MJ 3ZQCA 3CQZJ 2XGDA 5JLXA 4UUSB 1RPWA 3S1NJ 1JUMA 2X9DA 5FKKA 1U8BA 1X2MA 1RETA 3HDDA 3TEDA 2NS8A 1IG7A 3S1QJ 2Y2ZA 1IDYA 2QF7A 1FTZA 2LK2A 1JGGA 1T56A 5K7HA 2E1OA 2XB5A 2NVTJ 2NS7A 4JX5A 1YRNA 3B6CA 2DMQA 3FISA 2MSYA 3I4MJ 4LOCA 5HODA 3VPRA 3RZDJ 2E2JJ 2DMTA 4D5FA 3QPLA 2YU9J 1ITYA 1ETVA 1K83J 3BTCA 3H0GJ 2LFBA 2DA5A 1MBKA 4W1UA 2XRLA 2EZIA 3K2AA 5GPAA 3LSRA 4IEJA 1U9OA 3FIWA 1HDPA 3GTJJ 4FE7A 2Y9ZA 1P7JA 4QTRA 2DMNA 2L7ZA 3QPSA 1JJ8C 3PO2J 1K61A 2ZB9A 2TCTA 4L5EA 3BR3A 1WPKA 2ID6A 1UMQA 2JN6A 5EZGA 1ZGWA 2O8KA 1I3QJ 3A01A 2JA5J 1VNDA 1FJLA 1OJLA 1UG2A 3OOUA 2QCOA 4B4CA 1Y1WJ 2OPTA 1HOMA 2ME0A 2LKXA 2PMZN 5K7ZA 2CUEA 1JTYA 3TP3A 4S0HB 1JKPC 3LSJA 2HOAA 1FIPA 1UHSA 3B6AA 3ZOBA 4A3DJ 2HOSA 2YS9A 1FEXA 5GPCA 5GP9A 1D5YA 3SFIA 1IJWC 2XGEA 2VPRA 3I4NJ 1SFOJ 1U9NA 3JREA 3IH2A 4G12A 2MGQA 1A5JA 2O7OA 2GLOA 1OCTC 2LLKA 4FCYA 2DJNA 4M3GA 3GTOJ 5FLMJ 1OFCX 4C3HJ 1H88C 4DZJA 1T33A 3JRFA 1JUPA 1POGA 2YUSA 1ETWA 2LY9A 1ETYA 2LVSA 2EQRA 3CMYA 5EDNA 1WGXA 1WH7A 3JR9A 2R5ZB 2CU7A 2IAIA 1BJZA 5IYBJ 3HOUJ 2JJ7A 2JA7J 1JT0A 3GTKJ 5E3NA 1JTXA 4X1EA 4X6AJ 5IYCJ 5FKLA 5FJ8J 1Y1VJ 4XICA 3NAUA 2NVQJ 4I76A 1BA5A 3O8GA 4UUTA 1I6HJ 4XIDA 4A3MJ 1G2HA 2Y31A 1S7EA 4IHWA 2EZLA 3HOWJ 2L9RA 4A3LJ 1VF9A 3WHCA 4XRMA 1BW5A 2R5YB 3D1NI 1ETOA 3TW6A 2EZHA 1B72A 4QIWN 3JRBA 4B3AA 2ECCA 3PM1A 2HQ5A 3G1MA 2AO9A 5EF6A 3CDLA 3PO3J 5J1RA 4A3IJ 4XRSG 1FTTA 5FKNA 2XGCA 4D5CA 2B63J 1IDZA 3GTMJ 3H3VK 1E3OC 3LSGA 2M2EA 1MH4A 3DEWA 4XK4A 1QPIA 3O8HA 1LFUP 3Q0UA 3MVPA 4MFEA 2KDZA 2K40A 5FLVA 2DA3A 3S14J 3BQZA 4D7MA 2JK3A 3LOCA 5IYDJ 2LR8A 3MKLA 3FK6A 2JA8J 4M3FA 1AU7A 2M0CA 1OCPA 2DN0A 2EZKA 3LSPA 3ZQGA 1NTCA 1AKHB 1ZR2A 2K9QA 3A03A 3Q3SA 2K9NA 5FKMA 4XRSA 2CQXA 4CYCB 3S1RJ 1IC8A 3JRDA 2X6OA 4FTHA 1TWFJ 2DA2A 2MG4A 2CUFA 2M34A 1MBGA 3FK7A 5IOYA 4IHVA 4V2GA 3BR1A 3IH3A 4UUSA 1LE8A 4FE4A 1A6IA 1B8IB 1LFBA 3BQYA 1X58A 2R92J 1ETKA 4IHXA 3HKZN 1F36A 4JX6A 5IOZA 2OF7A 4ABZA 1XS9A 5DTDA 3JRGA 2ID3A 5J3LA 1H89C 3HOXJ 1MBHA 1YRNB 2E2HJ 1GV2A 3GTQJ 2H8RA 1O4XA 1I50J 2VUMJ 1MSEC 2XPUA 4NDLA 4BKXA 5EYRA 1PUFA 2L7FP 1Z77A 3BG9A 2W48A 1HCRA 5EGOB 2R93J 2HOTA 4A69C 1IGNA 3RKQA 1ETQA 1TWHJ 4IHYA 2P81A 5F04A 3ZQHA 1IUFA 3S1MJ 3IH4A 3G1OA 1F43A 2CRGA 1ZTRA 4C3JJ 4CYCA 4HNVA 1RKTA 3CCYA 1WH5A 2L7MP 2LTPA 3OIOA 2Y0SN 3ZQLA 1HF0A 5FKOA 2RAEA 5C3EJ 5C4XJ 2FD5A 2X48A 1VI0A 2LD5A 1JT6A 1JKRC 5C4JJ 3QQAA 4DYCA 2L0KA 2M8GX 3HM5A 1GDTA 3RZOJ 5E3MA 2Y30A 2JMWA 2Y9YA 3OSGA 2R7ZJ 4M3DA 5F08A 5J1YA 1W0TA 2DA4A 5M5WJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9L A;  1RKW A;  3HEF A;  3JRA A;  2N8G A;  5C44 J;  5JLW A;  5M3F J;  3OSF A;  2VKE A;  3BG5 A;  3M4O J;  2VI6 A;  4I6Z A;  5EGO A;  3LNQ A;  4FIS A;  1FIA A;  2G0E A;  1R9T J;  1H8A C;  2D5V A;  5IP7 J;  1PUF B;  4J19 A;  1GV5 A;  4A3F J;  9ANT A;  3HOZ J;  2R5Y A;  1SAN A;  4A93 J;  1GUU A;  1RR7 A;  1TC3 C;  3MN2 A;  3L1P A;  5J1U A;  3K7A J;  2JWT A;  2FQ4 A;  1U78 A;  3HOY J;  4AYB N;  2XPV A;  4C2M J;  2DA6 A;  1ORK A;  3HGY A;  4DYQ A;  3FKI J;  4JYK A;  4BY7 J;  3A01 B;  4BBS J;  2ELK A;  2XB0 X;  3GTG J;  1MNM C;  1QVU A;  3HB9 A;  4A3J J;  5F27 A;  2H1K A;  2HDD A;  3S2H J;  4AUX A;  1NK2 P;  2K9S A;  3HGG A;  2HXI A;  1HLV A;  2HI3 A;  3S15 J;  5BNG A;  3NAR A;  1JKQ C;  1MBJ A;  3BTI A;  1EF4 A;  4B1R A;  2XSD C;  2M9H A;  4MLO A;  1TWG J;  1AKH A;  3WHB A;  1TWA J;  3GTL J;  4BY1 J;  3E7L A;  5EEA A;  1ZK8 A;  1VFC A;  2DTZ A;  4JP0 A;  2WAQ N;  3Q0W A;  1TWC J;  2IBD A;  5M5Y J;  4RBO A;  3S17 J;  4D7N A;  3HBL A;  4A3B J;  2I10 A;  2LP0 A;  3C2B A;  3SJM A;  5IP6 A;  2ME6 A;  1JUS A;  3M3Y J;  1RES A;  3JRH A;  4QSH A;  2AHQ A;  4Y52 J;  4AC0 A;  5K7F A;  4A3C J;  1QVT A;  5M5X J;  2ECB A;  4EEF G;  4RDU A;  1BW6 A;  4DW6 A;  3BT9 A;  2TRT A;  4A3K J;  3TW7 A;  1B8I A;  1WI3 A;  3ZQF A;  3HOV J;  2FJ1 A;  4MO7 A;  2IEK A;  1JKO C;  2HYJ A;  2KT0 A;  1P7I A;  1IRZ A;  1HDD C;  1W0U A;  4BBR J;  3G1L A;  3RQI A;  2R5Z A;  3IV5 A;  4Y7N J;  2DMU A;  1QRY A;  4C3I J;  1ZKG A;  5EG0 B;  2R0Q C;  5E3O A;  2FX0 A;  1Z0X A;  1ENH A;  2DA1 A;  5F1J A;  1DU6 A;  2CJJ A;  1X2N A;  2EBI A;  2VKV A;  4MFD A;  4A3E J;  5EG0 A;  3BG3 A;  4W97 A;  3BR0 A;  4DYR A;  3BTJ A;  2DA7 A;  1WCM J;  3BR6 A;  4M6V A;  3JRC A;  2HXO A;  2WV1 A;  1IV6 A;  4GFB A;  1ZR4 A;  1MBE A;  1MSF C;  3JRI A;  2CQQ A;  1XC5 A;  3ZQI A;  1ETX A;  2E2I J;  5EZH A;  2NVX J;  2NOG A;  1DU0 A;  5E3L A;  4M3E A;  2MW8 A;  2EH3 A;  3DCF A;  2E19 A;  1AHD P;  2GM4 A;  1JJ6 C;  1LE8 B;  4V2F A;  3BR2 A;  1ZQ3 P;  3S2D J;  3Q0V A;  3A02 A;  5IP9 J;  2GBY A;  1NK3 P;  4BXX J;  5F0C A;  2DMP A;  2COB A;  3BTL A;  4M3B A;  5F0F A;  1Q1V A;  4DZP A;  1BL0 A;  5F0H A;  1APL C;  1MH3 A;  5DS9 A;  1B72 B;  3F0C A;  2WB1 N;  3GTP J;  1GT0 C;  3SDG A;  1GVD A;  3TP0 A;  3UKG A;  2JA6 J;  4MIM A;  1MBF A;  4JX4 A;  4A3G J;  1CQT A;  5IPA A;  3W6V A;  2NVY J;  3BR5 A;  1XG1 A;  3GBG A;  2XPW A;  3S16 J;  5M3M J;  3ZQC A;  3CQZ J;  2XGD A;  5JLX A;  4UUS B;  1RPW A;  3S1N J;  1JUM A;  2X9D A;  5FKK A;  1U8B A;  1X2M A;  1RET A;  3HDD A;  3TED A;  2NS8 A;  1IG7 A;  3S1Q J;  2Y2Z A;  1IDY A;  2QF7 A;  1FTZ A;  2LK2 A;  1JGG A;  1T56 A;  5K7H A;  2E1O A;  2XB5 A;  2NVT J;  2NS7 A;  4JX5 A;  1YRN A;  3B6C A;  2DMQ A;  3FIS A;  2MSY A;  3I4M J;  4LOC A;  5HOD A;  3VPR A;  3RZD J;  2E2J J;  2DMT A;  4D5F A;  3QPL A;  2YU9 J;  1ITY A;  1ETV A;  1K83 J;  3BTC A;  3H0G J;  2LFB A;  2DA5 A;  1MBK A;  4W1U A;  2XRL A;  2EZI A;  3K2A A;  5GPA A;  3LSR A;  4IEJ A;  1U9O A;  3FIW A;  1HDP A;  3GTJ J;  4FE7 A;  2Y9Z A;  1P7J A;  4QTR A;  2DMN A;  2L7Z A;  3QPS A;  1JJ8 C;  3PO2 J;  1K61 A;  2ZB9 A;  2TCT A;  4L5E A;  3BR3 A;  1WPK A;  2ID6 A;  1UMQ A;  2JN6 A;  5EZG A;  1ZGW A;  2O8K A;  1I3Q J;  3A01 A;  2JA5 J;  1VND A;  1FJL A;  1OJL A;  1UG2 A;  3OOU A;  2QCO A;  4B4C A;  1Y1W J;  2OPT A;  1HOM A;  2ME0 A;  2LKX A;  2PMZ N;  5K7Z A;  2CUE A;  1JTY A;  3TP3 A;  4S0H B;  1JKP C;  3LSJ A;  2HOA A;  1FIP A;  1UHS A;  3B6A A;  3ZOB A;  4A3D J;  2HOS A;  2YS9 A;  1FEX A;  5GPC A;  5GP9 A;  1D5Y A;  3SFI A;  1IJW C;  2XGE A;  2VPR A;  3I4N J;  1SFO J;  1U9N A;  3JRE A;  3IH2 A;  4G12 A;  2MGQ A;  1A5J A;  2O7O A;  2GLO A;  1OCT C;  2LLK A;  4FCY A;  2DJN A;  4M3G A;  3GTO J;  5FLM J;  1OFC X;  4C3H J;  1H88 C;  4DZJ A;  1T33 A;  3JRF A;  1JUP A;  1POG A;  2YUS A;  1ETW A;  2LY9 A;  1ETY A;  2LVS A;  2EQR A;  3CMY A;  5EDN A;  1WGX A;  1WH7 A;  3JR9 A;  2R5Z B;  2CU7 A;  2IAI A;  1BJZ A;  5IYB J;  3HOU J;  2JJ7 A;  2JA7 J;  1JT0 A;  3GTK J;  5E3N A;  1JTX A;  4X1E A;  4X6A J;  5IYC J;  5FKL A;  5FJ8 J;  1Y1V J;  4XIC A;  3NAU A;  2NVQ J;  4I76 A;  1BA5 A;  3O8G A;  4UUT A;  1I6H J;  4XID A;  4A3M J;  1G2H A;  2Y31 A;  1S7E A;  4IHW A;  2EZL A;  3HOW J;  2L9R A;  4A3L J;  1VF9 A;  3WHC A;  4XRM A;  1BW5 A;  2R5Y B;  3D1N I;  1ETO A;  3TW6 A;  2EZH A;  1B72 A;  4QIW N;  3JRB A;  4B3A A;  2ECC A;  3PM1 A;  2HQ5 A;  3G1M A;  2AO9 A;  5EF6 A;  3CDL A;  3PO3 J;  5J1R A;  4A3I J;  4XRS G;  1FTT A;  5FKN A;  2XGC A;  4D5C A;  2B63 J;  1IDZ A;  3GTM J;  3H3V K;  1E3O C;  3LSG A;  2M2E A;  1MH4 A;  3DEW A;  4XK4 A;  1QPI A;  3O8H A;  1LFU P;  3Q0U A;  3MVP A;  4MFE A;  2KDZ A;  2K40 A;  5FLV A;  2DA3 A;  3S14 J;  3BQZ A;  4D7M A;  2JK3 A;  3LOC A;  5IYD J;  2LR8 A;  3MKL A;  3FK6 A;  2JA8 J;  4M3F A;  1AU7 A;  2M0C A;  1OCP A;  2DN0 A;  2EZK A;  3LSP A;  3ZQG A;  1NTC A;  1AKH B;  1ZR2 A;  2K9Q A;  3A03 A;  3Q3S A;  2K9N A;  5FKM A;  4XRS A;  2CQX A;  4CYC B;  3S1R J;  1IC8 A;  3JRD A;  2X6O A;  4FTH A;  1TWF J;  2DA2 A;  2MG4 A;  2CUF A;  2M34 A;  1MBG A;  3FK7 A;  5IOY A;  4IHV A;  4V2G A;  3BR1 A;  3IH3 A;  4UUS A;  1LE8 A;  4FE4 A;  1A6I A;  1B8I B;  1LFB A;  3BQY A;  1X58 A;  2R92 J;  1ETK A;  4IHX A;  3HKZ N;  1F36 A;  4JX6 A;  5IOZ A;  2OF7 A;  4ABZ A;  1XS9 A;  5DTD A;  3JRG A;  2ID3 A;  5J3L A;  1H89 C;  3HOX J;  1MBH A;  1YRN B;  2E2H J;  1GV2 A;  3GTQ J;  2H8R A;  1O4X A;  1I50 J;  2VUM J;  1MSE C;  2XPU A;  4NDL A;  4BKX A;  5EYR A;  1PUF A;  2L7F P;  1Z77 A;  3BG9 A;  2W48 A;  1HCR A;  5EGO B;  2R93 J;  2HOT A;  4A69 C;  1IGN A;  3RKQ A;  1ETQ A;  1TWH J;  4IHY A;  2P81 A;  5F04 A;  3ZQH A;  1IUF A;  3S1M J;  3IH4 A;  3G1O A;  1F43 A;  2CRG A;  1ZTR A;  4C3J J;  4CYC A;  4HNV A;  1RKT A;  3CCY A;  1WH5 A;  2L7M P;  2LTP A;  3OIO A;  2Y0S N;  3ZQL A;  1HF0 A;  5FKO A;  2RAE A;  5C3E J;  5C4X J;  2FD5 A;  2X48 A;  1VI0 A;  2LD5 A;  1JT6 A;  1JKR C;  5C4J J;  3QQA A;  4DYC A;  2L0K A;  2M8G X;  3HM5 A;  1GDT A;  3RZO J;  5E3M A;  2Y30 A;  2JMW A;  2Y9Y A;  3OSG A;  2R7Z J;  4M3D A;  5F08 A;  5J1Y A;  1W0T A;  2DA4 A;  5M5W J; 
#chains in the Genus database with same CATH topology
 4ESJ A;  2O9L A;  1OPC A;  2HDC A;  5LEJ A;  2QVO A;  5ICG A;  3G6E I;  2O3F A;  3FBN B;  5D6F A;  5HLI A;  5M3F J;  1MW7 A;  1S29 A;  2E1M B;  4OIO F;  2VI6 A;  1ODD A;  5CYV A;  3CUO A;  3M7G A;  3CCE I;  3GWZ A;  1ON1 A;  5IP7 J;  3S8P A;  4HNU A;  4PFO A;  1YIT I;  1SAU A;  4A3F J;  9ANT A;  2Y69 H;  1FBS A;  3DP7 A;  3GF2 A;  2FOW A;  2X6X A;  2R5Y A;  1SAN A;  3MZ8 A;  1RR7 A;  1WWX A;  2DBB A;  4IOA F;  1OKR A;  3K7A J;  3F22 A;  1YYV A;  2VQC A;  3C1D A;  4Q5S F;  1P4W A;  2FQ4 A;  3OOP A;  2FBK A;  3GFI A;  3S93 A;  3J80 Z;  4C2U A;  4E7H A;  1D3Y A;  4XNF A;  2EPF A;  4PSX A;  4ZZD A;  4G6Q A;  3B02 A;  4JYK A;  2CWE A;  3S3M A;  2DAO A;  3A01 B;  1TL8 A;  2ELK A;  1RRJ A;  4WX9 A;  1MNM C;  5CQE A;  1QVU A;  1IUY A;  1Z7U A;  4CCL A;  2H1K A;  2F5C A;  4F55 A;  3S2H J;  1OMI A;  2HWV A;  2K9S A;  1LFP A;  3OS2 A;  1V54 H;  3DLL F;  3HGG A;  1NK2 P;  1NHA A;  4AIJ A;  2LKS A;  1HLV A;  2HS5 A;  2ESN A;  4M9S A;  3RPQ A;  3ABM H;  3FWE A;  2M9H A;  4BJ6 C;  1TWG J;  3WHB A;  4M73 A;  1WVR A;  3E7L A;  5EEA A;  2FOK A;  3CDH A;  2WAQ N;  3KFW X;  3Q0W A;  1FMV A;  3MKY B;  4P55 A;  3LAP A;  1EH7 A;  1A31 A;  2I10 A;  2LP0 A;  4ANJ A;  2G7H A;  1IXR C;  2YPR A;  4XKV A;  3DTK A;  5IP6 A;  3E6M A;  3TDZ C;  3M3Y J;  3Q5F A;  1IN6 A;  2ZXW H;  2KP6 A;  4UUV A;  4QSH A;  2WA0 A;  3BP8 A;  4XKC A;  3ECO A;  2MAB A;  4XLH A;  4Y52 J;  2IW5 A;  5M5X J;  2ECB A;  3VSK A;  1E3H A;  3T0Y A;  1XN7 A;  3BT9 A;  3ECH A;  4N9I A;  2LF8 A;  3K4J A;  5ILV A;  3HOV J;  2PFB A;  2FJ1 A;  1ZHF A;  4MO7 A;  2IEK A;  1IRZ A;  4H4K C;  1CGP A;  4LG0 A;  3OY9 A;  3KPH A;  2P4W A;  4Y7N J;  3A4C A;  2DMU A;  4HEA 2;  3D0S A;  4XM3 A;  1YO5 C;  3ML6 A;  3QOD A;  5F1J A;  2CV1 A;  3CC2 I;  3OWT A;  3QAH A;  4XN0 A;  3CLQ A;  2F5V A;  2HEO A;  2HR3 A;  2DA7 A;  2QSG X;  2LDU A;  2HXO A;  1T39 A;  2IRF G;  2OV7 A;  3PSF A;  4II3 A;  4QPO A;  2D1H A;  4RM2 A;  1QNT A;  3KP3 A;  3RTR A;  2F4M B;  3JRI A;  1XC5 A;  3DV8 A;  5EZH A;  2DOD A;  2P7V B;  1DU0 A;  2VL8 A;  5F64 A;  4M3E A;  2O6G E;  5ILU A;  3N4M A;  2HFH A;  3DLA A;  2K9M A;  2MW8 A;  4ENM A;  2XHK A;  1R71 A;  2EJR A;  5D8K B;  3PJR A;  3F3X A;  1AHD P;  1U3E M;  2CV2 A;  3ZMU A;  2BY2 A;  4HST A;  4CA0 A;  1LE8 B;  1Z7L A;  3CC7 I;  2KFD A;  3CMM A;  3PNT A;  3F72 A;  2WBM A;  5IP9 J;  1TLH B;  3R61 A;  3OYD A;  1MMS A;  1NK3 P;  2BY3 A;  3IKV A;  3LFU A;  3K4B A;  4E70 A;  1BL0 A;  1APL C;  1MH3 A;  1FNN A;  4A0Y A;  5DS9 A;  1B72 B;  4XR6 A;  3HG9 A;  3NWT A;  1IRF A;  3GTP J;  3J81 K;  1GT0 C;  5DUI A;  5IY5 H;  2JT1 A;  2BYV E;  4MIM A;  3F23 A;  1T0F C;  1CQT A;  3HUG B;  2NVY J;  4BJT A;  4PSW A;  3I59 A;  3PFI A;  1Z1D A;  3ZQC A;  4NBQ A;  1RNL A;  1HW2 A;  3CZ6 A;  5K5Q A;  1RPW A;  1X3Z B;  2DK8 A;  3H5R A;  1WFX A;  3EUH A;  3F8B A;  2M5W A;  2LKP A;  3HDD A;  2FA5 A;  3GCM A;  4RAY A;  2V1U A;  5GTI C;  2QF7 A;  1UJ8 A;  5K7H A;  2E1O A;  1RZ4 A;  2X6W A;  2HVS A;  2RNJ A;  2DMQ A;  3NRV A;  3T5X A;  4LOC A;  2DYS H;  1VQP I;  1T08 B;  1TW2 A;  2X6Y A;  3OYE A;  2GOX B;  1MJA A;  5CLS A;  2YU9 J;  5L3E A;  4EM0 B;  2RGV A;  3FXM A;  1ETV A;  1K83 J;  5D4R A;  3U9G A;  2V1D A;  3P7N A;  3BTC A;  3CF5 F;  3H0G J;  2LFB A;  3D5L A;  1H0M A;  1T95 A;  2DA5 A;  1MBK A;  3M8J A;  4AVP A;  3JAM Z;  3K2A A;  2FMY A;  5GPA A;  3L2C A;  1HDP A;  3TBI A;  1K6O A;  2Y9Z A;  3EUA A;  5H20 A;  5D6E A;  1S5L C;  3ROU A;  2P7C B;  2DMN A;  1BI0 A;  2E7X A;  2IGN A;  4L0Z B;  4BXF A;  2P5L C;  3VOD A;  1I1G A;  2JN6 A;  4G94 A;  1JXS A;  1FJL A;  3OOU A;  4AWX B;  1IRX A;  1IO2 A;  2OPT A;  2IA2 A;  4N0B A;  3TP3 A;  3RKX A;  4YRV A;  3LSJ A;  1FIP A;  2LMD A;  3B6A A;  2L7K A;  3ZQQ A;  1B4A A;  2HOS A;  4C30 A;  4F91 B;  1D5Y A;  2BEO A;  2XGE A;  2V9V A;  2JQ7 A;  1D0Z A;  5BPI A;  2PG4 A;  2X4H A;  4ZTF A;  4XL9 A;  5FO5 A;  2MGQ A;  3HC7 A;  3CC4 I;  4KYW A;  2VC0 A;  2QSH X;  2GLO A;  1A5J A;  4PZJ A;  1XB4 A;  2UXX A;  1OCT C;  2H27 A;  1RI7 A;  4M3G A;  3EYI A;  1R6R A;  2H94 A;  1I1S A;  2V1X A;  2ELJ A;  3M8F A;  3ULQ B;  3N05 A;  4DZJ A;  1DP7 P;  2VE8 A;  1JUP A;  2CQ7 A;  3M8E A;  2VKH A;  3K4K A;  4LB5 A;  2LY9 A;  3CCM I;  4EVI A;  4XLN F;  4FET A;  1Y8Q B;  1SFX A;  2BZT A;  3KX2 A;  3L7W A;  2W82 A;  2CU7 A;  2VC1 A;  1SD5 A;  2IAI A;  2Q8K A;  5IYB J;  2NNY A;  2MYS A;  1QZZ A;  1O3R A;  1XCB A;  1JI8 A;  5FJ8 J;  1BA5 A;  2MH2 A;  4LLN A;  4BHB A;  1HQC A;  1Y8R B;  4RAF A;  4MGR A;  3REO A;  2EZL A;  1KA8 A;  2L9R A;  1TT0 A;  4XLF A;  1W5S A;  1J09 A;  2R5Y B;  3D1N I;  2PEX A;  3TW6 A;  1UFM A;  4QIW N;  5J4Y A;  3JRB A;  1B72 A;  2HQ5 A;  4LG0 B;  2VBY A;  3RYR A;  1VQO I;  1D1A A;  4PDK A;  5J1R A;  2ZXH A;  4A3I J;  2WAQ A;  1FYL A;  3VOE A;  1ZAO A;  2GQQ A;  4LFU A;  1P6R A;  1OYW A;  1FTT A;  2XGC A;  3VYR B;  1T6S A;  1OR7 A;  1IDZ A;  2KJC A;  3H3V K;  2IGM A;  2OCE A;  1A04 A;  3LSG A;  1MH4 A;  1ERD A;  3S3O A;  1EV7 A;  2GAU A;  1BIB A;  4EQQ A;  4MFE A;  5A2Q Z;  1USS A;  3E1S A;  2XAG A;  3FXL A;  2JK3 A;  3LOC A;  3LQQ A;  5H6Q A;  1G3T A;  2V6E A;  5IYD J;  2Q1Z B;  3FXQ A;  1ZH5 A;  1V4R A;  2VXZ A;  3FK6 A;  4CH7 A;  2QQ8 A;  4M3F A;  1LB2 A;  2M4K A;  1HKT A;  2X1D A;  3WGH A;  1TTY A;  4ZYH A;  3MWM A;  1SD6 A;  1PP7 U;  3BJ6 A;  4CYC B;  2LH9 A;  3WTW C;  1YJ9 I;  4CO8 A;  2CQX A;  3S1R J;  4UVA A;  4L0Y B;  2DFI A;  1MMA A;  4N4O B;  4P96 A;  3TKY A;  5IOY A;  2ZME B;  4IHV A;  3PIO F;  5B1B H;  2Z33 A;  3HPH A;  2O8X A;  1XTA A;  3BJA A;  3QU3 A;  1UHM A;  4U0V A;  2DFE A;  2WAF A;  3IWZ A;  2FF4 A;  4DIQ A;  2XF7 A;  5IOZ A;  5FB2 A;  2LC2 A;  3LSI A;  2DYR H;  2W4S A;  1HA8 A;  1QBJ A;  1YRN B;  4E7S A;  3S3N A;  2LNB A;  4D1Q A;  3LFK A;  2Z3Y A;  3CCS I;  1G3S A;  3PQJ A;  1DUX C;  3LAJ A;  4NDL A;  4R8H A;  4ZDO A;  3RCO A;  2XRO A;  1L0O C;  4Q4Z F;  2L7F P;  2RQP A;  1MJB A;  5TJJ A;  3SZG A;  1JGS A;  1WI9 A;  5DCM B;  1HCR A;  2L9N A;  3FXR A;  5FLX K;  4A69 C;  4KMF A;  2WY7 Q;  1EKE A;  1TZL A;  4IHY A;  2BW3 A;  2CRG A;  3HRT A;  2A07 F;  2LYC A;  2HPM A;  3A2K A;  3E6D A;  1S7A A;  1WH5 A;  3M1C A;  3QYB A;  2LTP A;  3OIO A;  2ZFU A;  2UUZ A;  1DQU A;  2XIG A;  2ZJ2 A;  3PNV A;  3ZQL A;  4BQN A;  1TNS A;  2HKO A;  3CP8 A;  4KN4 X;  4XKB A;  5FKO A;  4B3X A;  4U7D A;  5C4X J;  2PJP A;  2VT2 A;  3I5U A;  5LRS A;  4XKW A;  2LD5 A;  1D0X A;  1DP3 A;  1OCR H;  2IS6 A;  4IRG A;  1X3U A;  4HF0 A;  3LMM A;  5L3D A;  2M8G X;  5ICF A;  5C4J J;  1YJN I;  3JSP A;  1BI3 A;  3SZP A;  2PN6 A;  3LA7 A;  4FHT A;  5LGN A;  2JMW A;  2OQR A;  4BAY A;  5F08 A;  5LEK A;  2VIX A;  3KIO A;  4BUP A;  5M5W J;  5L3G A;  1RKW A;  3QYE A;  3JRA A;  2N8G A;  5JLW A;  1K79 A;  3EQL F;  4L9V A;  1TQP A;  3ESW B;  3OSF A;  2VKE A;  1GXQ A;  3H36 A;  3ONQ A;  4I6Z A;  1MDM B;  4LIV A;  2BY1 A;  2G0E A;  1JE8 A;  4IKF A;  2D5V A;  1G8X A;  3L2W A;  5DDG A;  4IHS A;  3GEZ A;  1PUF B;  4RGX A;  4UNO A;  1MDM A;  1K78 A;  1XPX A;  1E3P A;  3H35 A;  1GUU A;  4A93 J;  3HHH A;  3L2R A;  2M7B A;  5DM7 F;  3L1P A;  5J1U A;  3BJO A;  1H9T A;  1UST A;  2FRH A;  3ZMT A;  4JOM A;  5D5V B;  2XAQ A;  4UV9 A;  2KIU A;  3H9J A;  1R58 A;  3HOY J;  1I6X A;  2F4I A;  3QOE A;  2JRT A;  1TW3 A;  2UXN A;  3OMY A;  1WZ2 A;  2HQA A;  2Y75 A;  4AYB N;  3DTI A;  2DA6 A;  3SHF A;  4KIS A;  3V8J A;  3AG2 H;  2F5F A;  3JAM K;  2Z2S B;  4BBS J;  4EJT A;  1LJ9 A;  1QZE A;  1O3Q A;  3GTG J;  3PUB A;  4CSW A;  4XOT A;  2KRH A;  3COA C;  4A3J J;  4IPA A;  1XMA A;  2B7E A;  3GZ5 A;  1Y0U A;  4IVN A;  2PX9 A;  3EYY A;  2HXI A;  3F8M A;  1QHG A;  1KON A;  2HI3 A;  4R1H A;  3DKW A;  1FP2 A;  3MKZ A;  1WSU A;  2VQH A;  3B73 A;  2ZBK A;  3OYB A;  2ISY A;  2NOJ B;  3NAR A;  1JKQ C;  1EF4 A;  3UR3 C;  4YEL A;  3J81 Z;  3GTL J;  1S9H A;  1TWA J;  2JVG A;  3ZMS A;  4BY1 J;  3ABT A;  2OTJ I;  3MZY A;  2H8W A;  3KP6 A;  3QOP A;  4GRI A;  4OIQ F;  4LIT A;  3WG9 A;  3O2P E;  1TWC J;  2YSR A;  3DU6 A;  2P8T A;  4RBO A;  3SYT A;  2CMP A;  2XKO A;  2FE3 A;  3JTH A;  2DXI A;  2MLG A;  2Q2E A;  2XAU A;  4M71 A;  3GFM A;  3H5N A;  1LPQ A;  1OCO H;  2H1L A;  1MGT A;  4WCG A;  3JRH A;  1LEA A;  2R7W A;  3KP4 A;  2AHQ A;  1IF1 A;  1R1V A;  4AC0 A;  2NXN B;  3DKY A;  1EH8 A;  2ZNY A;  1G4D A;  1KZH A;  2CUZ A;  4HW0 A;  4PJM A;  2ZJP F;  2HPI A;  3BG6 A;  3U2R A;  4EEF G;  1BW6 A;  4DW6 A;  5B3S H;  5E8G A;  4BEH B;  5BMZ A;  4IRI A;  2E35 A;  4A3K J;  1WI3 A;  2WWY A;  3LA3 A;  3F6V A;  3V7R A;  4E7J A;  3OL4 A;  1P7I A;  1U5T A;  3RQI A;  3K4M A;  4AID A;  3QP6 A;  4EV0 A;  1FYK A;  3BOQ A;  2R7U A;  4EJO A;  3GUD A;  2R0Q C;  1LDD A;  3ELK A;  3T8R A;  3CJT B;  4PJJ A;  1Z0X A;  1U6G A;  3ABU A;  4RB2 C;  1ENH A;  3GX4 X;  5CQG A;  1R49 A;  1E17 A;  2DA1 A;  4IXA A;  2CYY A;  3H9G A;  3SEQ A;  1NG7 A;  4MFD A;  4LB6 B;  2XC7 A;  3DU5 A;  1V5G A;  3BG3 A;  1R1U A;  2VON A;  3BR0 A;  1OIS A;  5HNH A;  1WCM J;  2D45 A;  2CGP A;  1BC7 C;  4LLG F;  4MQV A;  4CHU A;  3DFG A;  2KJB A;  2EFQ A;  4BHP A;  3K1M A;  4AM3 A;  3VYT B;  4BQO A;  2VLA A;  1ETX A;  1TNT A;  2F4O B;  3ZMD A;  2IGK A;  4M72 A;  3HYI A;  1D1C A;  2BBY A;  2NOG A;  1HC8 A;  3IWF A;  5E3L A;  4CGZ A;  2VOO A;  2EH3 A;  3WE2 A;  3BRO A;  3HOS A;  1FBQ A;  2W00 A;  4LK1 F;  3V7C A;  1JJ6 C;  2VBX A;  4I0B A;  4CIC A;  2X85 A;  3ABK H;  5HNF A;  2LY1 A;  3S2D J;  4NC8 A;  5GAG J;  1PP8 F;  4BXX J;  5F0C A;  3OV8 A;  1ON2 A;  3BTL A;  4M3B A;  2ELH A;  2R3S A;  5F0F A;  4CYD A;  3RI4 A;  3OR1 C;  2M30 A;  1KGS A;  4ZTJ A;  3BPV A;  3F0C A;  2D2W A;  4IF4 A;  3ZRG A;  3OYK A;  3UKG A;  4BE2 A;  1MBF A;  1YW7 A;  2R7Q A;  5J8C A;  3TOA A;  3ABL H;  2E71 A;  4E7L A;  2HQR A;  5EEH A;  4RB0 A;  3BC8 A;  3GBG A;  4PGH A;  1STZ A;  4A0Z A;  3D5S C;  2P5K A;  1VQ7 I;  1W7P B;  2MD0 A;  3FDY A;  2X51 A;  1VQ8 I;  2XGD A;  3BZ6 A;  5JLX A;  2R93 J;  5L3B A;  1U8B A;  1YHQ I;  1X2M A;  2UZK A;  1RET A;  3TED A;  5CJ9 A;  1IG7 A;  1IN8 A;  5FGM A;  4RLF A;  1JGG A;  2K3P A;  1LVA A;  4MTE A;  2NVT J;  2NS7 A;  1YRN A;  2MBF A;  3FIS A;  2KLO A;  3HRM A;  3VPR A;  4V19 K;  2DMT A;  2E1M C;  4D5F A;  2LF7 A;  4Z6Y A;  1ITY A;  3ZQ7 A;  1W4M A;  4RGR A;  5JR3 A;  2KKO A;  2K9L A;  5DCM A;  2DO7 A;  4WF2 A;  4DBR A;  4EGY A;  5J47 A;  3LSR A;  1U9O A;  1QHH D;  4BS9 A;  3GTJ J;  3ZP5 A;  2EIL H;  5HS9 A;  4S05 A;  1OLT A;  1S7O A;  4KIC A;  1ZG3 A;  1ZGA A;  2V6C A;  4WK8 F;  1JJ8 C;  1K61 A;  2M45 A;  4OMZ A;  5FRN A;  5F1R A;  2MC3 A;  2ID6 A;  1UMQ A;  4BJ5 C;  1KU2 A;  5FLX Z;  1I3Q J;  2JA5 J;  2Q0O A;  2DQL A;  5FD5 A;  2QEN A;  4IJA A;  3AG1 H;  1G3Y A;  5BS6 A;  1HOM A;  2ME0 A;  3OIP A;  4UB8 C;  4GYI A;  2PMZ N;  2LRD A;  5B5E C;  5K7Z A;  2CUE A;  2FU4 A;  3HRS A;  4HNT A;  2WAE A;  2YS9 A;  1R5I D;  3FBI B;  3RQ4 A;  3DBH B;  4XN3 A;  1WQ2 A;  2NYX A;  2TDX A;  4QWQ A;  1GHC A;  3R60 A;  4ZDL A;  3WU2 C;  4XMY A;  4E7I A;  1QU3 A;  3HJE A;  5K5R A;  1SFO J;  1U9N A;  2VBW A;  1YIO A;  3K1P A;  1IZ1 A;  3BG7 A;  2O7O A;  5LBQ A;  2QEX I;  1SC7 A;  2LLK A;  3GTO J;  1LKX A;  4B8X A;  3L2Q A;  2QWW A;  2RQQ A;  1UHW A;  1ZLJ A;  5CVU A;  5FLM J;  2K7L A;  3TQN A;  5FRM A;  2OC6 A;  1LUJ B;  4ESB A;  4NB5 A;  3CCQ I;  5HLG A;  1ZG1 A;  2YUS A;  3OYJ A;  2FQ3 A;  2BHY A;  2PQ8 A;  2XAF A;  4WXC A;  3HSE A;  3GLX A;  4I98 B;  2EV6 A;  5LRR A;  3QYF A;  2BXY A;  2HZT A;  1KU3 A;  3I58 A;  3HL2 A;  4G6D A;  1RIO H;  3O6B B;  1BJZ A;  3I56 I;  3EET A;  3E5X A;  3CMA I;  3I55 I;  3HOU J;  2PLY A;  2JJ7 A;  3CJN A;  4UV8 A;  1JTX A;  4X1E A;  2LG4 A;  3J7Y J;  2BY0 A;  2EIK H;  1Y1V J;  1SFK A;  2FBI A;  1MNE A;  1OR7 C;  3BZC A;  3NAU A;  1DDN A;  3EPZ A;  4WXD A;  3KZY A;  1REP C;  3E5Q A;  2Y31 A;  5CVR A;  5J6X A;  3V7S A;  4U0W A;  1X1D A;  4IO9 F;  1ACI A;  3LST A;  4A3L J;  1H9G A;  4Y33 A;  1YIJ I;  4XRM A;  1BW5 A;  1X1C A;  3K1N A;  4RAZ A;  2V79 A;  1U5T B;  3WTT C;  4FX4 A;  3JCU C;  2AO9 A;  3LSM A;  2KIM A;  2EIM H;  4XRS G;  1FOW A;  4XLE A;  2XVC A;  2KIF A;  2QSF X;  3GTM J;  4G7H F;  4P1W A;  4XBF A;  1Y56 A;  1SMY F;  3P9C A;  2C6Y A;  4L9J A;  3DEW A;  3J7Z I;  1QPI A;  3I71 A;  2XUB A;  4ENJ A;  1FLI A;  3P5J A;  3E6C C;  2LBF B;  2KDZ A;  4WWC A;  4D7M A;  2RKH A;  2HYG D;  2RNG A;  3KE2 A;  2NAZ A;  1T2K A;  3LSH A;  2A5Y B;  1BIA A;  1W5C C;  2ZC2 A;  3SXY A;  2OAZ A;  4CCM A;  4OMY A;  2LY2 A;  2M0M A;  1HW1 A;  4LD5 A;  1HST A;  2EZK A;  4A5N A;  2YX4 A;  1UCR A;  3ZQG A;  3VYS B;  4F52 A;  2K9Q A;  3E6B A;  3OS0 A;  3W2W A;  1R22 A;  4JK1 X;  4XRS A;  5FKM A;  2DOF A;  1UG0 A;  3JRD A;  1TWF J;  4YFX F;  1FOX A;  4HZF A;  2MG4 A;  4F3Q A;  2Q2E B;  2KZG A;  2QQB A;  3FK7 A;  4YIF A;  1VQN I;  2K27 A;  2IVM A;  3VFZ A;  4UUS A;  2EFW A;  1KQ8 A;  2DPD A;  2V7F A;  1T8I A;  4XLA A;  1LFB A;  1X58 A;  3ZCO A;  1ETK A;  2R92 J;  4BGD A;  3K9T A;  4IHX A;  1F36 A;  4U87 A;  4ABZ A;  5GAH J;  1G59 A;  2ISZ A;  3JRG A;  3PSI A;  2XF6 A;  3RJP A;  3KP2 A;  4AU7 A;  2VE9 A;  3G73 A;  2WB1 A;  2DW4 A;  4Z2Y A;  2ZXI A;  2STT A;  3HRU A;  1YTY A;  3G3Z A;  2H8R A;  4EGZ A;  3T1B A;  1I50 J;  1NH3 A;  1ONV A;  4AD9 A;  2VPL A;  4KMU X;  1FSE A;  3PIP F;  2DT5 A;  3AFH A;  2MD5 A;  2OD5 A;  2V9P A;  3OIQ A;  5EYR A;  1Z77 A;  2EFO A;  2NNN A;  4KUM A;  4Y17 A;  1D5V A;  3MMY B;  4J01 A;  5F04 A;  3ZQH A;  1IUF A;  2KRC A;  1P92 A;  3IH4 A;  3G1O A;  2D1V A;  4CUG A;  4KJZ A;  4C3J J;  3IC7 A;  2A6E F;  2CS3 A;  3CUQ B;  4HNV A;  1ULY A;  2JTV A;  2QGU A;  2IS1 A;  3GW2 A;  4G6T B;  2L7M P;  1W36 D;  4R79 A;  4HLX A;  4YFN F;  4XSX F;  2OCC H;  3FMQ A;  1HF0 A;  5C3E J;  1QGP A;  2M1B A;  1CF7 B;  4II2 A;  4HOB A;  1JKR C;  2VKD A;  3RZO J;  3A0B C;  3GVA A;  2Y30 A;  1BN5 A;  3FXJ A;  3OSG A;  1W36 C;  4X6A J;  3BLY A;  3ZMV A;  2HNH A;  1FY7 A;  4NNJ A;  4BQQ A;  3H1C A;  4GXO A;  5JHU A;  3I53 A;  4ITV A;  2CUJ A;  4O6J A;  1HSJ A;  1IW7 F;  5D5X B;  4XOR A;  1Z6T A;  3FMS A;  4AIK A;  3W2A A;  4O3M A;  4CZZ A;  2L5Q A;  1RUO A;  1ZGJ A;  5EGO A;  4FIS A;  1FIA A;  1H8A C;  1YS6 A;  2QYO A;  3OYN A;  1GV5 A;  2OU2 A;  2W57 A;  3HOZ J;  2ZO4 A;  3F6O A;  3FXK A;  1F4K A;  5CPR B;  1JHH A;  3MN2 A;  3QPH A;  3E0J B;  2W85 A;  5LHI A;  2EFN A;  1Y0N A;  2JWT A;  2QM3 A;  4BDZ A;  1R4M B;  1WJF A;  4HDU A;  1X1A A;  3E5U A;  2FBH A;  1K4S A;  4CCJ A;  2A61 A;  4C2M J;  1IN4 A;  4XON A;  2EA4 A;  5D5U B;  1BBY A;  3SDB A;  3IAS 2;  1ORK A;  3HGY A;  4HV6 A;  3K0L A;  4DYQ A;  4OIP F;  3FKI J;  2VOD A;  3HTS B;  3MD2 A;  2K02 A;  2IGO A;  2XB0 X;  3DPL C;  4NQW B;  3VEP A;  3CUQ C;  3OL3 A;  6PAX A;  1DGW Y;  5IT9 Z;  2LRE A;  2Z9O A;  1UB9 A;  1Z6R A;  4AUX A;  1X4O A;  2P5V A;  3BZK A;  1MMD A;  4DGW B;  5D4S A;  5HVQ C;  5KNL A;  2EIJ H;  5BNG A;  3H5A A;  2XSD C;  1BC8 C;  4MLO A;  1AKH A;  3OYC A;  2OA4 A;  1YFH A;  3KLN A;  1ZK8 A;  2VQG A;  4JP0 A;  1XD7 A;  3F8F A;  3R0A A;  2PMZ A;  2VJJ A;  2UWM A;  2J5O A;  5M5Y J;  4D7N A;  3HBL A;  2MH9 A;  4HV5 A;  4JQF A;  1I5Z A;  2KPM A;  3C2B A;  5HLH A;  2K5C A;  4HRI A;  2EB7 A;  1FP1 D;  1FOK A;  2LBF A;  2Z16 A;  5DD4 A;  1FYM A;  1YX5 A;  3FKJ A;  2VJ5 A;  5K7F A;  3IL2 A;  2WC2 A;  1DGR M;  2A6H F;  5EEG A;  5H2F C;  2W1O A;  3H3U A;  2CW7 A;  3TW7 A;  1LQ1 A;  1B8I A;  2BOL A;  2L9V A;  3IAM 2;  2QA4 I;  2H09 A;  1JKO C;  2DU9 A;  2KT0 A;  5LHH A;  2LSO A;  2VB6 A;  1W0U A;  1HDD C;  1MIJ A;  3QRF F;  1B6A A;  1V5F A;  1ZN2 A;  4N4N B;  4BBR J;  2HVQ A;  2GA2 A;  3G1L A;  1RC9 A;  4XOP A;  3O3K A;  3IV5 A;  5BOX A;  3OYH A;  5CVJ A;  1QRY A;  4C3I J;  2QZ8 A;  5EG0 B;  4DNC A;  1BR2 A;  1W1W E;  5IT9 K;  1IN5 A;  2M3A A;  3WTS C;  2EBI A;  4Q48 A;  1PJR A;  2BE5 F;  3L09 A;  5DM6 F;  4A3E J;  2M7A A;  3NEU A;  5EG0 A;  4LIU A;  3F9K A;  2DLL A;  3K4C A;  4DYR A;  3BTJ A;  3BR6 A;  5GTH C;  2DT7 B;  3JRC A;  2JPB A;  2WV1 A;  1IV6 A;  3AG3 H;  1ZR4 A;  1SAX A;  2IT0 A;  1W7P A;  2OQG A;  1MBE A;  4HDV A;  1R36 A;  3VDX A;  1WJE A;  1Z05 A;  2DCE A;  2CQQ A;  2Y0S A;  3ZQI A;  5EJC A;  3K4L A;  2E2I J;  2DQR A;  1D1B A;  3I4P A;  4BH9 A;  1W7P D;  1D0Y A;  2GIV A;  2G9W A;  2ZFW A;  3GME A;  3CJR B;  3DCF A;  4KIB A;  1O7F A;  3KZI C;  1XSX A;  3J7A Y;  4I0A A;  1ZQ3 P;  3Q0V A;  3A02 A;  4ZDP A;  2GBY A;  2GA1 A;  2HU9 A;  5FRO A;  3HZJ A;  4LLL A;  2DMP A;  2COB A;  1GXP A;  1L3L A;  1KQ9 A;  4DZP A;  5F0H A;  2GXB A;  1LVK A;  4HF1 A;  3HPG A;  4IQ4 A;  3ASN H;  3SDG A;  3TP0 A;  2LOO A;  1OYI A;  2RRE A;  2JA6 J;  3JSO A;  2QBY A;  4A3G J;  4JX4 A;  3OR2 C;  3SZT A;  3HKZ A;  1YQA A;  3RKW A;  3K6G A;  2FEZ A;  3DQV C;  3U1K A;  3BR5 A;  3C2H A;  2DTR A;  3TL4 X;  2XAJ A;  1SVL A;  4ZYA A;  4HLY A;  1O57 A;  3V8L A;  4C9Y A;  5TIS C;  3WGI A;  3M1E A;  1JUM A;  2RC4 A;  5FKK A;  5JVT A;  1YE9 A;  2NS8 A;  3LWF A;  4EM1 A;  3S1Q J;  1J5Y A;  1FWZ A;  2Y2Z A;  4ZYD A;  1IDY A;  2PMU A;  2LK2 A;  1OCZ H;  4Y15 A;  1FTZ A;  3MZH A;  4IQJ A;  2V4J C;  2XB5 A;  2BHZ A;  5CVI A;  4MNU A;  1S6L A;  4RGS A;  4JX5 A;  3B6C A;  3I4M J;  3C18 A;  2Z99 A;  1Z21 A;  3RZD J;  2EA2 A;  1FMW A;  2E2J J;  4UVC A;  4P9F A;  3ERE D;  1N78 A;  5ICE A;  1QA6 A;  2EWN A;  3HSR A;  3U21 A;  2CFX A;  3J80 K;  2ZSH B;  3WU1 B;  4XSZ F;  3RYP A;  3GXO A;  4KT6 A;  4HG2 A;  2COM A;  2ZME A;  1GLN A;  3M07 A;  4W1U A;  1MMG A;  4KDP A;  4NHJ A;  3I0T A;  3EUH C;  2ZJR F;  3J7A O;  5K1Y A;  4QTR A;  3BDD A;  2OUM A;  2L7Z A;  2ZME C;  3E3V A;  4LGW A;  4YG2 F;  3PO2 J;  2MFZ A;  2FUG 2;  4UHT A;  1TT5 B;  5F6F A;  4L5E A;  1A6Q A;  3HHG A;  1FT9 A;  4NQW A;  1WPK A;  1ZGW A;  3A01 A;  1J9I A;  1VND A;  5ILS A;  2XRN A;  2OJE D;  1KQ0 A;  5HDK A;  4MEX F;  1AOY A;  3ZN0 A;  4PFP A;  5E1X A;  4IZZ A;  1U5T C;  1XSV A;  2YX7 A;  4HBL A;  1QQI A;  4RLQ A;  4S0H B;  1JKP C;  1TQI A;  1FX7 A;  3ZXS A;  2HOA A;  2HVR A;  2G7U A;  4A3D J;  3MKW B;  3L00 A;  4PGG A;  2RV8 A;  3DWL E;  4EAT A;  1FEX A;  4L9T A;  5GP9 A;  3P9K A;  4NUB A;  2VPR A;  2OBP A;  1U0J A;  4BU2 A;  3FXO A;  3JRE A;  2DK5 A;  3IH2 A;  1FSH A;  4X0G A;  4HX8 A;  2A6T A;  4A6E A;  4P5O A;  3MFK A;  3VSL A;  3K69 A;  4FCY A;  1AA7 A;  2CW0 F;  4ZC3 A;  1AWC A;  3TOB A;  3K2Z A;  5D8L B;  1PYV A;  4EJU A;  1OFC X;  5CVV A;  2JSC A;  2K3F A;  5FD6 A;  3R0J A;  2K86 A;  1T33 A;  4OU0 A;  4M9Z A;  1SVO A;  4DOZ A;  1XGN A;  2FNP A;  1POG A;  1ETW A;  4AYB A;  2O61 A;  5A2Q K;  2E5Z A;  3G71 I;  3R6S A;  2LVS A;  4M74 A;  3CMY A;  5DD8 A;  2XAS A;  3K10 A;  5EDN A;  1MND A;  2VN2 A;  4CXF A;  3SFZ A;  3WTZ A;  1WH7 A;  2Z1D A;  1A36 A;  2NRA C;  1FZP B;  4BAC A;  2XSJ C;  4D0P A;  1YW8 A;  4DBQ A;  3K70 D;  2JVH A;  3LQR A;  1JT0 A;  1OCC H;  4I99 C;  3GTK J;  2F5E A;  4P9U A;  2E60 A;  4G9Y A;  5IYC J;  1BM9 A;  4XIC A;  3WTV C;  1P4X A;  3NWS A;  2BGC A;  1O3T A;  1ZG5 A;  4I2O A;  4A3M J;  3MAJ A;  2IS4 A;  4XLP F;  5KAF C;  1NG6 A;  2AQF A;  2R7O A;  4ZZL A;  2DT6 A;  2O5R A;  4UXN A;  4K2E A;  3KYD B;  3WHC A;  4KIF A;  3KYC B;  1ETO A;  2EZH A;  1HXD A;  4B3A A;  3IRR A;  2ECC A;  4HX4 A;  4TV7 A;  5GAD J;  3G4S I;  3Q9V A;  5EF6 A;  1T0F A;  3CDL A;  4HA8 A;  4PCQ A;  2PJR B;  3PO3 J;  2CQN A;  2W24 A;  1VQ5 I;  5FKN A;  1QO0 D;  4D5C A;  2K4J A;  1YOV B;  2B63 J;  2AXT C;  3GFL A;  1IAW A;  4L5I A;  4Y3O A;  2A68 F;  1K4T A;  1JHF A;  1DPU A;  4OOI A;  2R7S A;  3C7J A;  4ZYE A;  1LFU P;  4NC7 A;  1FOY A;  2ZKZ A;  3Q0U A;  3MVP A;  2HYF A;  4LK0 F;  1MZB A;  3AAF A;  2K40 A;  5FLV A;  1P4A A;  3FM5 A;  2WAD A;  1WRJ A;  2JRM A;  3WU0 A;  2LR8 A;  2L2O A;  3MKL A;  5BQT A;  4U0Y A;  1X19 A;  5DUK A;  2JA8 J;  1AU7 A;  2HTS A;  5CKT A;  2DDB A;  2DN0 A;  3FMR A;  1WHU A;  1AKH B;  1ZRE A;  1X1P A;  2XAH A;  1SD4 A;  4HPQ A;  5B1A H;  5DCF A;  1OQY A;  3DXJ F;  3TO7 A;  2DFF A;  2HOE A;  4PJL A;  4EJW A;  4YIR X;  1FBU A;  3IHU A;  3A03 A;  3CME I;  1IC8 A;  3G2B A;  3I3L A;  2X6O A;  1J75 A;  1IXS B;  4A2U A;  2CUF A;  1MBG A;  2IA1 A;  5E1Z B;  5IT3 A;  2JUG A;  3BR1 A;  5E79 C;  4DQ2 A;  2ESH A;  4ZYG A;  1D8K A;  3HKZ N;  4CZC A;  3FZV A;  4ENK A;  5DTD A;  2A5W A;  1ZRF A;  1KYW A;  2E2H J;  4A12 A;  2IXS A;  5KCM A;  3GFJ A;  1N75 A;  1MSE C;  2MLK A;  3IRQ A;  2XPU A;  1J0R A;  1K6Y A;  3MCZ A;  2B9S A;  1N25 A;  1HBX G;  3OYI A;  5E17 F;  2FSW A;  3TO9 A;  2UV1 A;  1V3F A;  2MC4 A;  3LL7 A;  2E1C A;  3BG9 A;  1LDK B;  4L18 B;  2DDA A;  2W48 A;  4HQE A;  2GXG A;  2CO5 A;  2L4M A;  4M6X A;  2HOT A;  3TGN A;  1IGN A;  4BNC A;  2JZY A;  3HSF A;  4BEH A;  2P81 A;  3WGG A;  3S1M J;  4FAS D;  2CV0 A;  2NS0 A;  1F43 A;  3F21 A;  2W7N A;  3CCY A;  3KP5 A;  4ESF A;  2ACJ A;  4HF2 A;  2Y0S N;  2Z5U A;  2F5D A;  2WTE A;  2V26 A;  1G3W A;  2WY8 Q;  1XSD A;  2AQE A;  4G8X A;  5HLT A;  2RAE A;  4MQ9 F;  5E1W A;  1BOA A;  1VQ4 I;  1VI0 A;  1JT6 A;  2R7R A;  3VWB A;  4E4H A;  2V1N A;  4A0X A;  1GVJ A;  3QQA A;  4OWR B;  4DYC A;  3HM5 A;  4CCO A;  3MQ0 A;  1S3J A;  3GYH X;  2KIQ A;  2Y9Y A;  5J1Y A;  2OZ6 A;  3ZN1 A;  1W0T A;  3W6K B;  2HGC A;  1TBX A;  1Z91 A;  3C2G A;  3HEF A;  4F92 B;  1SMT A;  4MEY F;  3BY6 A;  5DYM A;  5C44 J;  4RMN A;  2A3S A;  5HOO A;  4HX7 A;  2L54 A;  1XDU A;  3M4O J;  3BG5 A;  4L9N A;  1LNW A;  2A05 A;  3CDI A;  3LNQ A;  1R7J A;  1Z67 A;  1R9T J;  2XF5 A;  3BPX A;  4GO1 A;  4J19 A;  1R00 A;  2QLZ A;  4KNY A;  3OYG A;  2W25 A;  1F1Z A;  1I27 A;  3AKZ A;  4A5M A;  2Y0M A;  5KVR A;  5LLQ A;  1TC3 C;  3KET A;  1T38 A;  4FT8 A;  2F48 A;  1YLF A;  2L4A A;  3PL8 A;  3IUO A;  1U78 A;  2YR2 A;  3H9Q A;  3FHZ A;  4QLC U;  4G7O F;  3DPU A;  4B44 A;  2CW8 A;  2XPV A;  5FFZ A;  4G7Z F;  3KCC A;  1Z3X A;  3VYU B;  4BY7 J;  3CCJ I;  3W2V A;  3EDP A;  1WJB A;  2IP2 A;  3ZMZ A;  3ZGK A;  2GOM A;  3HB9 A;  3QPT A;  1BR4 A;  5F27 A;  4ZJZ A;  2HDD A;  2GZW A;  3PQK A;  4BYY A;  2ZXJ A;  4IOC F;  3S15 J;  4YII A;  1W5T A;  1MBJ A;  3BTI A;  4B1R A;  4C2T A;  1FC3 A;  2VOP A;  2ETH A;  1X1B A;  4Y4R A;  1ZLK A;  1VFC A;  2DTZ A;  3GO5 A;  5DV5 A;  4MHG A;  5DEQ A;  2QQA A;  2IBD A;  2KRF A;  1K78 B;  3S17 J;  1G6N A;  2HZD A;  2VQL A;  4A3B J;  3WG7 H;  1ZYR F;  2GIZ A;  3OYA A;  3T8T A;  3U1D A;  2YU3 A;  5B66 C;  3SJM A;  2ME6 A;  1JUS A;  3CTA A;  4ON0 A;  2EV0 A;  3HOT A;  2WV0 A;  1RES A;  3HUG A;  1YS7 A;  3UNG C;  3M9A A;  2QBY B;  4A3C J;  1QVT A;  3LSK A;  2F6C A;  2JPC A;  4RDU A;  3A0H C;  3SQN A;  1LDJ A;  1VQ9 I;  2TRT A;  4EMS A;  3RDI A;  2BW3 B;  3ZQF A;  4XLC A;  4LG3 A;  4KIG A;  1KU7 A;  1A35 A;  2I5U A;  3KEY A;  2HYJ A;  5JFR A;  1X3W B;  1WKM A;  4Q47 A;  2FNA A;  4KIT B;  2R5Z A;  2OTL I;  1BOB A;  2FXA A;  1ZKG A;  3L2V A;  4BXU A;  1ZAR A;  3F8N A;  5E3O A;  2XDV A;  2FX0 A;  1I3A A;  2RVC A;  2CG4 A;  1IN7 A;  1P9Q C;  3QWL A;  1DU6 A;  1V55 H;  2CJJ A;  1X2N A;  3RIR A;  4NC6 A;  2VKV A;  2W84 A;  2EIN H;  4L5J A;  2CQK A;  4W97 A;  3FF5 A;  2EFP A;  2VAS A;  1J2X A;  3MEX A;  3BCA A;  4M6V A;  1YX3 A;  3KP7 A;  2JSP A;  3KYL A;  2PJR A;  1TP4 A;  4LMY A;  4GFB A;  2HQN A;  1F9N A;  5HDN A;  2NVU B;  1RUN A;  3IP4 B;  3RPU A;  2KL4 A;  4EJV A;  1MSF C;  1BR1 A;  2NVX J;  2ADU A;  4BE0 A;  3FM3 A;  3DF8 A;  5H6R A;  3P9I A;  2P0W A;  4CCK A;  4GDF A;  3AG4 H;  2QKM B;  2VXD A;  5E18 F;  2E19 A;  3I9V 2;  1VQK I;  2GM4 A;  3D5R C;  1IXC A;  3OS1 A;  1YG2 A;  2R7F A;  4UB6 C;  4B48 A;  4V2F A;  3BR2 A;  3C3W A;  3H92 A;  1P2F A;  2EV5 A;  1EH6 A;  1Q1V A;  2H6B A;  3JW4 A;  3X2Q H;  2WB1 N;  3OYM A;  4BL0 B;  3KEQ A;  4MTD A;  1O3S A;  1GVD A;  1MKM A;  5E8I A;  2VJ4 A;  5ICC A;  3KLO A;  2KZV A;  5IPA A;  3W6V A;  4GGG A;  4I7H A;  5KAI C;  3JTG A;  1XG1 A;  3CJQ B;  3S16 J;  2XPW A;  4BHC A;  2E1N A;  1U2W A;  5M3M J;  1BJA A;  3CQZ J;  4UUS B;  3S1N J;  2RDP A;  5J40 A;  1VQ6 I;  2X9D A;  1Z9C A;  4I01 A;  1UZC A;  2STW A;  2R7V A;  3R4K A;  3W6J B;  1T56 A;  2E5N A;  5J4V A;  1B9M A;  4E7K A;  4IHT A;  5L3F A;  1R23 A;  4QPQ A;  2MSY A;  3PFY A;  4RB1 A;  3TDU C;  1Q1H A;  1ZEL A;  5HOD A;  4IX7 A;  4BQA A;  2DJI A;  2P6S A;  3QPL A;  4RA2 A;  4CCN A;  2K4B A;  3ISP A;  3RPU D;  3V8K A;  4KT5 C;  3FX3 A;  1WJC A;  2E7W A;  5K5O A;  5KHD A;  2ZSI B;  3CCL I;  5TRD A;  1YI2 I;  2IS2 A;  2XRL A;  2EZI A;  3S32 A;  1F5T A;  3CD6 I;  5JVG F;  1WJ5 A;  3TO6 A;  1KU9 A;  2E36 A;  4IEJ A;  3FIW A;  3ZR8 X;  3IKT A;  3DBL B;  3LA2 A;  4FE7 A;  1R4N B;  1P7J A;  3RSN A;  2L01 A;  1XGS A;  2QUF A;  3QPS A;  2BVM A;  2DOE A;  1S72 I;  2BV6 A;  2VBZ A;  3BCB A;  2ZB9 A;  2IA0 A;  3RKY A;  2TCT A;  2HDW A;  3BR3 A;  1SD7 A;  2O8K A;  5EZG A;  1YW9 A;  3NQO A;  4E6K G;  5TGT A;  2DFH A;  4KFC A;  1TQM A;  1OJL A;  1UG2 A;  3TMO A;  2QCO A;  4B4C A;  1J7K A;  1Y1W J;  3FHN A;  5ED4 A;  1CF7 A;  2LKX A;  4OIR F;  2O0Y A;  3I54 A;  1R5G A;  4EM2 A;  1JTY A;  5LFA A;  4WXH A;  1UHS A;  5D5W B;  2A69 F;  1XCV A;  3ZOB A;  1O7L A;  5AON A;  2X0L A;  3CO6 C;  5GPC A;  3CCV I;  2R7X A;  4I02 A;  3SFI A;  1R5H A;  1IJW C;  2L9S A;  3I4N J;  2DPU A;  4ETS A;  4XRF A;  4BDY A;  2IPQ X;  4G12 A;  4OIN F;  2I8D A;  4RAG A;  3SEZ A;  2VJI A;  4J00 A;  2DJN A;  2L02 A;  1ZRC A;  1SFU A;  2M4G A;  4GCV A;  1VQL I;  4C3H J;  5LHG A;  2F2E A;  2HKX A;  1H88 C;  3L9F A;  4ENN A;  2QQ9 A;  1N77 A;  3JRF A;  1U8R A;  5JI6 A;  4UY8 I;  1HKS A;  1T98 A;  2M8E A;  1PVE A;  2E34 A;  3DKX A;  1VZ0 A;  1UAA A;  1ETY A;  3E97 A;  1LEB A;  2EQR A;  3QU6 A;  4O5V A;  2IJL A;  3DBR B;  4PJ0 C;  1WGX A;  5LGT A;  3JR9 A;  3CCU I;  5ERI A;  2R5Z B;  3DEE A;  5L3C A;  5LD2 C;  3AL0 C;  2JA7 J;  5E3N A;  3DTE A;  2CSO A;  4M6Y A;  1XGM A;  5FKL A;  5BPD A;  3DEU A;  2NVQ J;  3I64 A;  4H0E A;  2K85 A;  4I76 A;  1E2X A;  4B47 A;  3O8G A;  1MMN A;  4UUT A;  5AIQ A;  2CFO A;  3V42 A;  1I6H J;  2ZJQ F;  4XID A;  3CP2 A;  1HW5 A;  1G2H A;  4OAY A;  1XX5 A;  1SVM A;  1S7E A;  4IHW A;  4N9H A;  1MJ9 A;  3GZN B;  1ZRD A;  2QKL B;  3HOW J;  2KIS A;  3N97 A;  4I09 A;  1UEL B;  1VF9 A;  2XV4 S;  3HXL A;  4RGU A;  1V5E A;  4RS8 A;  3HTU A;  3PM1 A;  2JA2 A;  3G1M A;  2O03 A;  2KDO A;  3KZZ A;  5KK1 A;  1VQM I;  4U88 A;  3Q9S A;  1XDS A;  2XGX A;  1M1E B;  1EA3 A;  2BXZ A;  2PBI A;  1IV8 A;  3K70 C;  2CH0 A;  1B9N A;  5J8F A;  4UVB A;  3WTU C;  4JBA A;  5HDG A;  3W3C A;  1E3O C;  2M2E A;  4GYG A;  5JHF A;  1K7A A;  3QP5 A;  4IRH A;  1Y39 A;  2M87 A;  4YFK F;  4XK4 A;  3EUK L;  2AXL A;  3O8H A;  4M9X A;  2Y48 A;  3CLO A;  1MD0 A;  4YEJ A;  3WOD F;  3WE3 A;  3CES A;  1BI2 A;  1FPQ A;  1D8J A;  4ASN A;  4CDG A;  1KYZ A;  2DA3 A;  3S14 J;  3BQZ A;  4XQF A;  3V4G A;  3ZPL A;  4A6D A;  2ICW G;  3VB2 A;  4HSR A;  4Y13 A;  5E20 A;  2GXA A;  1B59 A;  2X1E A;  4PJN A;  2KMU A;  1XMX A;  1B1B A;  2M0C A;  1I39 A;  1OCP A;  2ZCW A;  3GZ6 A;  3LSP A;  1NTC A;  1ZR2 A;  4OAZ A;  3H0D A;  3WTX C;  1RR8 C;  1J59 A;  2R7T A;  3PUF A;  4PK4 A;  1PDN C;  2JUC A;  2R4G A;  3K4N A;  3S2W A;  3Q3S A;  2K9N A;  4FQG A;  1EJ9 A;  1Y6I A;  4RB3 C;  3AL0 B;  4FTH A;  3CUQ A;  2DA2 A;  2M34 A;  5FFX A;  3CO7 C;  3H3Z A;  1QPM A;  2HTJ A;  4BE1 A;  3WTY C;  4S04 A;  4KA4 A;  3I59 B;  4V2G A;  2PMH A;  3IH3 A;  1LE8 A;  1E0E A;  2DOA A;  4FE4 A;  1QZY A;  1A6I A;  1HKQ A;  5HS7 A;  3BQY A;  3KEO A;  4IL6 C;  1B8I B;  1PUE E;  1C0W A;  2R7D A;  5AIP A;  4F93 B;  2B0L A;  1OYY A;  4D9J A;  1SFE A;  4JX6 A;  2OF7 A;  1XS9 A;  2P6T A;  2ID3 A;  5J3L A;  1H89 C;  2OZU A;  3HOX J;  3HIF A;  1MBH A;  4U7B A;  2PI0 A;  2KQR A;  4KN7 X;  1BI1 A;  1GV2 A;  1SEU A;  3GTQ J;  3PNY A;  1O4X A;  5GAE J;  2VUM J;  2VT3 A;  4BKX A;  1WJD A;  1Z3Y A;  2KHM A;  1VTN C;  2AS5 F;  2MA3 A;  4ZH4 F;  1PUF A;  2GWR A;  2J5P A;  1S8N A;  4RM3 A;  5EGO B;  2H6C A;  4AIH A;  4B09 A;  3RKQ A;  1ETQ A;  1TWH J;  2FML A;  2BVL A;  3GLL A;  4F7Z A;  5HS8 A;  1X4P A;  5LGU A;  4DJA A;  1IRG A;  1ZTR A;  2X1C A;  4CYC A;  3A1Y A;  1XGO A;  4AVZ A;  3ERM A;  1RKT A;  3DPT A;  3L2U A;  2RN7 A;  2ZNZ A;  3OYL A;  3FXU A;  4HYE A;  1WJA A;  2L3D A;  3ASO H;  4B43 A;  4E7Z A;  3OYF A;  1DPR A;  2FD5 A;  2EK5 A;  2X48 A;  2DI3 A;  1XMK A;  3CCR I;  3BWG A;  4LJZ F;  2XKP A;  1GDT A;  2L0K A;  4HAM A;  5E3M A;  4PUS A;  2V9K A;  1R1T A;  4HQM A;  2R7Z J;  4M3D A;  1YJW I;  3CF2 A;  3F8C A;  2DA4 A;  4FX0 A; 
#chains in the Genus database with same CATH homology
 2O9L A;  1RKW A;  3HEF A;  3JRA A;  2N8G A;  5C44 J;  5JLW A;  5M3F J;  3OSF A;  2VKE A;  3BG5 A;  3M4O J;  2VI6 A;  4I6Z A;  5EGO A;  3LNQ A;  4FIS A;  1FIA A;  2G0E A;  1R9T J;  1H8A C;  2D5V A;  5IP7 J;  1PUF B;  4J19 A;  1GV5 A;  4A3F J;  9ANT A;  3HOZ J;  2R5Y A;  1SAN A;  4A93 J;  1GUU A;  1RR7 A;  1TC3 C;  3MN2 A;  3L1P A;  5J1U A;  3K7A J;  2JWT A;  2FQ4 A;  1U78 A;  3HOY J;  4AYB N;  2XPV A;  4C2M J;  2DA6 A;  1ORK A;  3HGY A;  4DYQ A;  3FKI J;  4JYK A;  4BY7 J;  3A01 B;  4BBS J;  2ELK A;  2XB0 X;  3GTG J;  1MNM C;  1QVU A;  3HB9 A;  4A3J J;  5F27 A;  2H1K A;  2HDD A;  3S2H J;  4AUX A;  1NK2 P;  2K9S A;  3HGG A;  2HXI A;  1HLV A;  2HI3 A;  3S15 J;  5BNG A;  3NAR A;  1JKQ C;  1MBJ A;  3BTI A;  1EF4 A;  4B1R A;  2XSD C;  2M9H A;  4MLO A;  1TWG J;  1AKH A;  3WHB A;  1TWA J;  3GTL J;  4BY1 J;  3E7L A;  5EEA A;  1ZK8 A;  1VFC A;  2DTZ A;  4JP0 A;  2WAQ N;  3Q0W A;  1TWC J;  2IBD A;  5M5Y J;  4RBO A;  3S17 J;  4D7N A;  3HBL A;  4A3B J;  2I10 A;  2LP0 A;  3C2B A;  3SJM A;  5IP6 A;  2ME6 A;  1JUS A;  3M3Y J;  1RES A;  3JRH A;  4QSH A;  2AHQ A;  4Y52 J;  4AC0 A;  5K7F A;  4A3C J;  1QVT A;  5M5X J;  2ECB A;  4EEF G;  4RDU A;  1BW6 A;  4DW6 A;  3BT9 A;  2TRT A;  4A3K J;  3TW7 A;  1B8I A;  1WI3 A;  3ZQF A;  3HOV J;  2FJ1 A;  4MO7 A;  2IEK A;  1JKO C;  2HYJ A;  2KT0 A;  1P7I A;  1IRZ A;  1HDD C;  1W0U A;  4BBR J;  3G1L A;  3RQI A;  2R5Z A;  3IV5 A;  4Y7N J;  2DMU A;  1QRY A;  4C3I J;  1ZKG A;  5EG0 B;  2R0Q C;  5E3O A;  2FX0 A;  1Z0X A;  1ENH A;  2DA1 A;  5F1J A;  1DU6 A;  2CJJ A;  1X2N A;  2EBI A;  2VKV A;  4MFD A;  4A3E J;  5EG0 A;  3BG3 A;  4W97 A;  3BR0 A;  4DYR A;  3BTJ A;  2DA7 A;  1WCM J;  3BR6 A;  4M6V A;  3JRC A;  2HXO A;  2WV1 A;  1IV6 A;  4GFB A;  1ZR4 A;  1MBE A;  1MSF C;  3JRI A;  2CQQ A;  1XC5 A;  3ZQI A;  1ETX A;  2E2I J;  5EZH A;  2NVX J;  2NOG A;  1DU0 A;  5E3L A;  4M3E A;  2MW8 A;  2EH3 A;  3DCF A;  2E19 A;  1AHD P;  2GM4 A;  1JJ6 C;  1LE8 B;  4V2F A;  3BR2 A;  1ZQ3 P;  3S2D J;  3Q0V A;  3A02 A;  5IP9 J;  2GBY A;  1NK3 P;  4BXX J;  5F0C A;  2DMP A;  2COB A;  3BTL A;  4M3B A;  5F0F A;  1Q1V A;  4DZP A;  1BL0 A;  5F0H A;  1APL C;  1MH3 A;  5DS9 A;  1B72 B;  3F0C A;  2WB1 N;  3GTP J;  1GT0 C;  3SDG A;  1GVD A;  3TP0 A;  3UKG A;  2JA6 J;  4MIM A;  1MBF A;  4JX4 A;  4A3G J;  1CQT A;  5IPA A;  3W6V A;  2NVY J;  3BR5 A;  1XG1 A;  3GBG A;  2XPW A;  3S16 J;  5M3M J;  3ZQC A;  3CQZ J;  2XGD A;  5JLX A;  4UUS B;  1RPW A;  3S1N J;  1JUM A;  2X9D A;  5FKK A;  1U8B A;  1X2M A;  1RET A;  3HDD A;  3TED A;  2NS8 A;  1IG7 A;  3S1Q J;  2Y2Z A;  1IDY A;  2QF7 A;  1FTZ A;  2LK2 A;  1JGG A;  1T56 A;  5K7H A;  2E1O A;  2XB5 A;  2NVT J;  2NS7 A;  4JX5 A;  1YRN A;  3B6C A;  2DMQ A;  3FIS A;  2MSY A;  3I4M J;  4LOC A;  5HOD A;  3VPR A;  3RZD J;  2E2J J;  2DMT A;  4D5F A;  3QPL A;  2YU9 J;  1ITY A;  1ETV A;  1K83 J;  3BTC A;  3H0G J;  2LFB A;  2DA5 A;  1MBK A;  4W1U A;  2XRL A;  2EZI A;  3K2A A;  5GPA A;  3LSR A;  4IEJ A;  1U9O A;  3FIW A;  1HDP A;  3GTJ J;  4FE7 A;  2Y9Z A;  1P7J A;  4QTR A;  2DMN A;  2L7Z A;  3QPS A;  1JJ8 C;  3PO2 J;  1K61 A;  2ZB9 A;  2TCT A;  4L5E A;  3BR3 A;  1WPK A;  2ID6 A;  1UMQ A;  2JN6 A;  5EZG A;  1ZGW A;  2O8K A;  1I3Q J;  3A01 A;  2JA5 J;  1VND A;  1FJL A;  1OJL A;  1UG2 A;  3OOU A;  2QCO A;  4B4C A;  1Y1W J;  2OPT A;  1HOM A;  2ME0 A;  2LKX A;  2PMZ N;  5K7Z A;  2CUE A;  1JTY A;  3TP3 A;  4S0H B;  1JKP C;  3LSJ A;  2HOA A;  1FIP A;  1UHS A;  3B6A A;  3ZOB A;  4A3D J;  2HOS A;  2YS9 A;  1FEX A;  5GPC A;  5GP9 A;  1D5Y A;  3SFI A;  1IJW C;  2XGE A;  2VPR A;  3I4N J;  1SFO J;  1U9N A;  3JRE A;  3IH2 A;  4G12 A;  2MGQ A;  1A5J A;  2O7O A;  2GLO A;  1OCT C;  2LLK A;  4FCY A;  2DJN A;  4M3G A;  3GTO J;  5FLM J;  1OFC X;  4C3H J;  1H88 C;  4DZJ A;  1T33 A;  3JRF A;  1JUP A;  1POG A;  2YUS A;  1ETW A;  2LY9 A;  1ETY A;  2LVS A;  2EQR A;  3CMY A;  5EDN A;  1WGX A;  1WH7 A;  3JR9 A;  2R5Z B;  2CU7 A;  2IAI A;  1BJZ A;  5IYB J;  3HOU J;  2JJ7 A;  2JA7 J;  1JT0 A;  3GTK J;  5E3N A;  1JTX A;  4X1E A;  4X6A J;  5IYC J;  5FKL A;  5FJ8 J;  1Y1V J;  4XIC A;  3NAU A;  2NVQ J;  4I76 A;  1BA5 A;  3O8G A;  4UUT A;  1I6H J;  4XID A;  4A3M J;  1G2H A;  2Y31 A;  1S7E A;  4IHW A;  2EZL A;  3HOW J;  2L9R A;  4A3L J;  1VF9 A;  3WHC A;  4XRM A;  1BW5 A;  2R5Y B;  3D1N I;  1ETO A;  3TW6 A;  2EZH A;  1B72 A;  4QIW N;  3JRB A;  4B3A A;  2ECC A;  3PM1 A;  2HQ5 A;  3G1M A;  2AO9 A;  5EF6 A;  3CDL A;  3PO3 J;  5J1R A;  4A3I J;  4XRS G;  1FTT A;  5FKN A;  2XGC A;  4D5C A;  2B63 J;  1IDZ A;  3GTM J;  3H3V K;  1E3O C;  3LSG A;  2M2E A;  1MH4 A;  3DEW A;  4XK4 A;  1QPI A;  3O8H A;  1LFU P;  3Q0U A;  3MVP A;  4MFE A;  2KDZ A;  2K40 A;  5FLV A;  2DA3 A;  3S14 J;  3BQZ A;  4D7M A;  2JK3 A;  3LOC A;  5IYD J;  2LR8 A;  3MKL A;  3FK6 A;  2JA8 J;  4M3F A;  1AU7 A;  2M0C A;  1OCP A;  2DN0 A;  2EZK A;  3LSP A;  3ZQG A;  1NTC A;  1AKH B;  1ZR2 A;  2K9Q A;  3A03 A;  3Q3S A;  2K9N A;  5FKM A;  4XRS A;  2CQX A;  4CYC B;  3S1R J;  1IC8 A;  3JRD A;  2X6O A;  4FTH A;  1TWF J;  2DA2 A;  2MG4 A;  2CUF A;  2M34 A;  1MBG A;  3FK7 A;  5IOY A;  4IHV A;  4V2G A;  3BR1 A;  3IH3 A;  4UUS A;  1LE8 A;  4FE4 A;  1A6I A;  1B8I B;  1LFB A;  3BQY A;  1X58 A;  2R92 J;  1ETK A;  4IHX A;  3HKZ N;  1F36 A;  4JX6 A;  5IOZ A;  2OF7 A;  4ABZ A;  1XS9 A;  5DTD A;  3JRG A;  2ID3 A;  5J3L A;  1H89 C;  3HOX J;  1MBH A;  1YRN B;  2E2H J;  1GV2 A;  3GTQ J;  2H8R A;  1O4X A;  1I50 J;  2VUM J;  1MSE C;  2XPU A;  4NDL A;  4BKX A;  5EYR A;  1PUF A;  2L7F P;  1Z77 A;  3BG9 A;  2W48 A;  1HCR A;  5EGO B;  2R93 J;  2HOT A;  4A69 C;  1IGN A;  3RKQ A;  1ETQ A;  1TWH J;  4IHY A;  2P81 A;  5F04 A;  3ZQH A;  1IUF A;  3S1M J;  3IH4 A;  3G1O A;  1F43 A;  2CRG A;  1ZTR A;  4C3J J;  4CYC A;  4HNV A;  1RKT A;  3CCY A;  1WH5 A;  2L7M P;  2LTP A;  3OIO A;  2Y0S N;  3ZQL A;  1HF0 A;  5FKO A;  2RAE A;  5C3E J;  5C4X J;  2FD5 A;  2X48 A;  1VI0 A;  2LD5 A;  1JT6 A;  1JKR C;  5C4J J;  3QQA A;  4DYC A;  2L0K A;  2M8G X;  3HM5 A;  1GDT A;  3RZO J;  5E3M A;  2Y30 A;  2JMW A;  2Y9Y A;  3OSG A;  2R7Z J;  4M3D A;  5F08 A;  5J1Y A;  1W0T A;  2DA4 A;  5M5W J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...