1I3QJ

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1i3qJ00
1A6IA 3HDDA 1WH5A 2L9RA 1JKOC 2XPWA 3OSGA 2NVXJ 1UG2A 1QPIA 2DMQA 1G2HA 3G1LA 2MW8A 3NAUA 1AU7A 2GM4A 2L0KA 1HF0A 1ZQ3P 1MH4A 2LVSA 2E1OA 3A03A 3RZDJ 1GDTA 4NDLA 3RQIA 1JGGA 2H8RA 2I10A 4D5FA 5F04A 1K83J 3LSPA 2ZB9A 4A3EJ 1ZGWA 2L7MP 4XRMA 5F0CA 3LOCA 2X6OA 3BTLA 4J19A 4A3GJ 3HEFA 4JX5A 3SJMA 3O8HA 2O9LA 3K2AA 3GBGA 5IYCJ 4DYQA 1VNDA 1RPWA 2HI3A 3LSRA 4DZJA 3JRDA 3OOUA 3L1PA 1DU6A 3BTIA 4Y7NJ 1RETA 1IUFA 3M4OJ 2FQ4A 1IV6A 4MO7A 3LNQA 3CDLA 1U9NA 2Y9YA 1XG1A 4QSHA 4IHXA 2CJJA 1MSFC 1ETQA 4A3DJ 3JR9A 4FCYA 3ZQFA 4BKXA 2JMWA 1RKWA 3FKIJ 2XB5A 1OJLA 1I3QJ 1IC8A 3E7LA 1JJ6C 3GTPJ 2X9DA 2DMUA 1TWGJ 4JP0A 5K7ZA 2R5ZA 5FKOA 3FISA 4FTHA 2VKEA 4BBSJ 1GV5A 4EEFG 5C44J 5E3NA 1HOMA 3VPRA 2XGCA 2JWTA 1MBEA 5K7HA 4A3IJ 5IYBJ 1MH3A 1R9TJ 4AC0A 1ETVA 2X48A 1FJLA 3H3VK 5FLVA 1JTYA 4C3IJ 3ZQLA 3RKQA 5JLXA 3JRGA 2E2JJ 2JA5J 2DMNA 4V2FA 3JRHA 5IOYA 1VF9A 1FIAA 2ECCA 5M3MJ 2R0QC 1MBHA 1AKHB 5EF6A 3CMYA 2HQ5A 2L7FP 1AKHA 4FISA 3HOZJ 3O8GA 1FTTA 3PO3J 3ZQIA 2K9SA 4UUTA 2EQRA 2CQQA 1Q1VA 4UUSB 3IH3A 1U78A 2P81A 4JX6A 4UUSA 1BW5A 2YUSA 1I50J 3BTJA 1JUMA 1X2MA 2EH3A 4MFDA 3G1OA 2D5VA 3Q3SA 1PUFB 1HDPA 3S15J 2M8GX 3BR3A 4QTRA 1FEXA 4C3HJ 1HCRA 4DZPA 3ZQHA 3BQZA 2JJ7A 4BY1J 1A5JA 3H0GJ 3HM5A 1ZKGA 2YS9A 1H88C 5F0FA 1JJ8C 1VI0A 2Y0SN 3JRFA 2R93J 1T33A 4A3JJ 1XC5A 4M3EA 1LFUP 4DW6A 1X58A 3HB9A 2MGQA 3TW7A 2Y2ZA 1GT0C 1CQTA 4MFEA 4DYCA 1TWCJ 4JYKA 1WH7A 4G12A 1AHDP 1IG7A 3S2DJ 3BTCA 2R7ZJ 5GP9A 2Y30A 3HOXJ 2JA7J 2W48A 3BG3A 2ELKA 2JK3A 2M0CA 4RDUA 1LFBA 2EZHA 2CRGA 1Y1WJ 5F1JA 2CU7A 3TEDA 1LE8B 2TRTA 5FJ8J 5M3FJ 1LE8A 2CQXA 3SFIA 4A3KJ 2E2IJ 2OPTA 3WHCA 2NVQJ 2DA7A 4RBOA 4Y52J 2LY9A 1TWAJ 1O4XA 3S16J 2ID3A 1ETOA 3BT9A 5IP9J 5EYRA 3D1NI 3HOWJ 2DA4A 1U8BA 2HDDA 2XB0X 4W1UA 3BR5A 4B1RA 2WB1N 3TW6A 3DEWA 1JT6A 4A3BJ 3TP3A 2NS7A 3IH2A 1I6HJ 2EZKA 2DA6A 4AYBN 3HOYJ 2DTZA 3FIWA 2M34A 4V2GA 1OCPA 4XRSA 1FTZA 4GFBA 5M5WJ 1NTCA 3BR2A 3MVPA 2ME6A 2LD5A 3I4MJ 3DCFA 5EGOB 4M3BA 1JT0A 5EGOA 2H1KA 1MNMC 2DA1A 3JRAA 3K7AJ 2JA8J 2LLKA 1WCMJ 2LR8A 2COBA 2DMPA 2IAIA 1EF4A 2VI6A 1H8AC 1BA5A 4A3CJ 1T56A 2DMTA 2LFBA 1K61A 5DS9A 5J3LA 2VKVA 1GVDA 3S14J 2GBYA 5FKNA 4D5CA 3C2BA 3GTLJ 1ZR2A 4IEJA 2WAQN 2EBIA 2ID6A 2XPUA 4A3MJ 5FLMJ 2KDZA 3S1MJ 1P7JA 1B72B 1BL0A 2CUFA 1MBJA 4XRSG 5JLWA 1B72A 5EZHA 2WV1A 1VFCA 1NK3P 1Z0XA 2O7OA 2FX0A 3BR0A 5IPAA 1B8IB 3A01B 1HDDC 2VUMJ 1QVUA 5C4XJ 2EZIA 2KT0A 1B8IA 1F43A 4HNVA 1W0UA 1APLC 1ETYA 5IP7J 5J1UA 1H89C 2VPRA 2DA2A 5K7FA 2E2HJ 5F27A 1FIPA 5EG0B 2K9NA 1MBFA 2EZLA 2OF7A 2IEKA 1PUFA 4QIWN 2NOGA 3IH4A 2G0EA 3B6CA 5EZGA 3HKZN 1HLVA 4C2MJ 3GTOJ 1ZR4A 3S2HJ 3GTJJ 4I6ZA 3PM1A 2YU9J 4FE4A 3BQYA 4B3AA 2FJ1A 2XGDA 3JREA 2R5YB 3QQAA 3Q0VA 1BJZA 3FK6A 1ETWA 4BY7J 2LTPA 2K40A 2R92J 4CYCB 5FKMA 5BNGA 4DYRA 3RZOJ 4CYCA 2FD5A 2N8GA 1ORKA 4AUXA 5J1YA 1UMQA 2XSDC 1P7IA 5IYDJ 2O8KA 2M9HA 2IBDA 1MBGA 4A3FJ 2E19A 3CQZJ 4A3LJ 4L5EA 4BBRJ 3BG5A 2K9QA 4D7MA 4LOCA 1ZTRA 2NS8A 3HGGA 3SDGA 1POGA 2LKXA 3LSJA 1IDYA 3QPSA 2XRLA 1GUUA 4M3FA 1Y1VJ 4IHVA 1GV2A 3WHBA 2XGEA 4XICA 4A69C 1JTXA 1SFOJ 1JUPA 1JUSA 2RAEA 4IHYA 5HODA 2QCOA 1JKPC 5C4JJ 3GTGJ 3ZQCA 3BG9A 3Q0UA 2DN0A 4C3JJ 2JN6A 3MN2A 4MIMA 3M3YJ 5E3OA 1E3OC 1F36A 1ENHA 3IV5A 1JKQC 1TWFJ 4I76A 5F08A 1OFCX 3B6AA 5C3EJ 1TWHJ 1ITYA 2Y9ZA 3I4NJ 2CUEA 2LP0A 3Q0WA 3HOUJ 2HXOA 1X2NA 5E3MA 3BR1A 9ANTA 2HYJA 3NARA 3S1NJ 1WGXA 4B4CA 1RKTA 1IJWC 4IHWA 3GTQJ 3S1QJ 1W0TA 1Z77A 1IRZA 4S0HB 1UHSA 5E3LA 2B63J 5F0HA 2LK2A 2R5ZB 2MG4A 3HOVJ 3S1RJ 4X1EA 4D7NA 1YRNB 3CCYA 1IGNA 5GPCA 1QVTA 3OSFA 1YRNA 1WI3A 3HGYA 1WPKA 5IP6A 3JRIA 3ZOBA 1BW6A 3GTKJ 3QPLA 5M5YJ 4A93J 1ETKA 4JX4A 3A02A 4FE7A 3TP0A 5EDNA 1QRYA 2JA6J 2TCTA 3S17J 2XPVA 4M3GA 5DTDA 2M2EA 5GPAA 2HOAA 4XK4A 1RR7A 4XIDA 1OCTC 2AHQA 2DJNA 2MSYA 4M6VA 3BR6A 3LSGA 3A01A 3PO2J 3G1MA 2HXIA 2DA3A 2Y31A 5M5XJ 3F0CA 1DU0A 1NK2P 4BXXJ 1RESA 2DA5A 1ETXA 2HOTA 1XS9A 3GTMJ 2ECBA 4M3DA 2HOSA 2L7ZA 5EG0A 2ME0A 1D5YA 2NVTJ 1MBKA 1SANA 1TC3C 1IDZA 3JRCA 2PMZN 5IOZA 3OIOA 5EEAA 1MSEC 4ABZA 2QF7A 5FKKA 3HBLA 2AO9A 5FKLA 3UKGA 3FK7A 2R5YA 3W6VA 1ZK8A 1S7EA 4W97A 5J1RA 3JRBA 3ZQGA 3MKLA 1JKRC 2GLOA 4X6AJ 1U9OA 4MLOA 2NVYJ
chains in the Genus database with same CATH superfamily
4B09A 4BQAA 3CDHA 3HOSA 2NVXJ 3QODA 3G4SI 4LG0A 2DJIA 3G1LA 5KCMA 3VODA 1AU7A 2DDBA 2HYGD 5ED4A 2L0KA 2BV6A 3ELKA 2E1MC 2IGNA 2E1OA 3K4MA 3GW2A 3TOAA 2Q8KA 4AIKA 1ON2A 3GCMA 4A3EJ 5HS7A 2L7MP 1LKXA 2M4GA 2W84A 3V7RA 3TQNA 2BE5F 4RGXA 2FNPA 3ZMSA 2WY7Q 2O9LA 3K2AA 4ANJA 3EUAA 5IYCJ 1TQMA 1MMSA 4FT8A 1RNLA 4F91B 3CCUI 4HF2A 3FM5A 2NS0A 4DYQA 1VNDA 4RA2A 3BP8A 1X19A 1ZARA 1N78A 5IT9K 4G6QA 1SMYF 3KZYA 1R23A 2BOLA 4XOTA 3W6JB 4HX4A 5TJJA 1XGNA 5J8CA 3C18A 1IXRC 5KVRA 3RKYA 1LEAA 4I09A 2FQ4A 4LGWA 2FNAA 3LNQA 3CDLA 5HDGA 2P5VA 5B3SH 1U9NA 2EV6A 1Z1DA 4KICA 2HEOA 4HLXA 4ESBA 4IHXA 2CJJA 2E5NA 4A3DJ 3JR9A 3H9JA 3BC8A 1BC8C 3KE2A 2JMWA 2K4JA 3FKJA 3LQQA 3FKIJ 2FQ3A 2VBWA 2DT5A 1TQPA 2X9DA 5K7ZA 4MEYF 5FKOA 3FISA 1ONVA 4F52A 3L9FA 4FTHA 1S3JA 3ERED 3FZVA 2VB6A 4IKFA 3M07A 1I39A 2W1OA 1JHHA 5E3NA 4CZZA 1TL8A 1V5EA 1U0JA 4BEHB 4UY8I 3WG9A 1MMAA 4BJ5C 1Z3XA 5IYBJ 2NNYA 1R9TJ 4ETSA 3X2QH 4AC0A 4XBFA 4AWXB 1FJLA 3GF2A 3Q9VA 3RCOA 4U7BA 1LQ1A 5DDGA 3DPUA 3BROA 4E7ZA 3U9GA 5HS8A 4XLNF 2CUJA 3BG6A 3TKYA 3H5RA 1MD0A 3K69A 1FMVA 2R0QC 1SC7A 3QPHA 1TNSA 1QZYA 2L7KA 1T38A 2EFQA 3KYCB 2IGOA 1FTTA 1D1CA 4MTDA 1X3WB 1K78A 3PO3J 2DK8A 1QU3A 3HTUA 2LBFB 3IH3A 4EGYA 1CF7B 3ZPLA 2DAOA 1BW5A 1JGSA 1I50J 3DBLB 1K79A 4B43A 2K9MA 5E20A 2RQQA 3SZGA 1HDPA 4XOPA 3DLAA 3BR3A 1FEXA 5DYMA 4E7JA 5IT3A 1RUNA 4L18B 2JJ7A 4KN4X 3DU6A 1DDNA 3TO9A 2KJBA 3J81Z 1A5JA 3H0GJ 4F93B 4I99C 3M8EA 3AG2H 1UZCA 2ZXWH 1JJ8C 1P92A 4AVZA 5AIQA 3S3MA 1E17A 4IOAF 4A3JJ 2X6WA 5H6QA 1I6XA 3CJNA 2KRCA 4CYDA 3DKYA 3HB9A 1X1AA 3TW7A 1WJAA 2OCCH 1CQTA 1LEBA 5D6FA 5K5OA 2P0WA 5ICEA 2RC4A 5JVGF 2HPIA 3BTCA 4XN3A 2R7ZJ 2VT2A 4ASNA 4BQOA 2P6SA 2JK3A 3NQOA 2JZYA 3MKYB 1T6SA 1T0FA 2CRGA 4EJWA 3LSTA 2DT7B 3HXLA 2GZWA 1R7JA 2KFDA 3BJ6A 3DPTA 3BCBA 5HDKA 3GLLA 3SFIA 1QO0D 3L7WA 2MC4A 4A3KJ 4XNFA 2WAEA 2DA7A 3I58A 3DWLE 3OS0A 3CJTB 2Z3YA 3PL8A 4M6YA 3PIOF 1A36A 4L5JA 1XCBA 1O4XA 3S16J 3T1BA 1ETOA 5IP9J 4MNUA 1WJ5A 4W1UA 3BR5A 2OU2A 2OTJI 2HVSA 1SMTA 2MABA 3E5XA 4PJ0C 4B48A 5GAGJ 3ZQQA 2VBYA 5LBQA 2EIKH 4V2GA 1VQ7I 3PQKA 4XRSA 5L3CA 1IV8A 2ME6A 2RGVA 3PSIA 4A6EA 3DCFA 2L9SA 4YFXF 2LOOA 3TL4X 5EGOA 2OJED 2V9VA 3FMRA 2QSGX 1FPQA 3SZTA 2JA8J 1ZGAA 4MTEA 1ZRFA 1W36D 4DOZA 3O3KA 1KQ8A 5LLQA 5D6EA 2PG4A 2ZSIB 4A3CJ 3F8NA 2BY3A 2E7WA 4UVBA 3PUBA 1T39A 2EILH 3EETA 2D1VA 1S9HA 1BOBA 2GBYA 5TGTA 4KT6A 3BZ6A 3R4KA 1ZR2A 4IEJA 2V1DA 1SD7A 2ID6A 1KU3A 3DTEA 4LB5A 4RMNA 4UUVA 4CDGA 1MBJA 5L3BA 1Z6TA 4E7KA 5EZHA 1KYWA 2WV1A 3S3NA 3I64A 4RB2C 4IRIA 1A6QA 2FX0A 2ESNA 3HIFA 5L3EA 1O7LA 1J2XA 1J75A 4B3XA 4IRHA 4RGSA 2R7RA 1YX5A 3A01B 2VUMJ 1QVUA 1F43A 4HQEA 1CF7A 1TT0A 1ETYA 4ENMA 3I59A 2K5CA 2VQLA 3QOEA 1H89C 4MHGA 1F5TA 2CG4A 4ZTFA 4I98B 3JAMZ 5EG0B 2K9NA 4P9FA 4WCGA 3JTGA 2BY2A 4S05A 4IHSA 2V79A 1STZA 3DKWA 3IH4A 4ZYEA 2CUZA 1ZAOA 2F5FA 2EV0A 4WWCA 3WG7H 3GTOJ 5BQTA 2HS5A 2M45A 2W25A 3KEYA 1WJEA 1IUYA 1HSJA 4FE4A 3P7NA 4A5MA 2WV0A 3JREA 2H94A 2R5YB 1O7FA 3QQAA 4NBQA 2L54A 2ZKZA 1MGTA 1RC9A 3VB2A 3VWBA 2JPCA 3FK6A 4BY7J 1EJ9A 1KZHA 2NXNB 2XF6A 4Y13A 1G59A 4BACA 2KIMA 1FYKA 5LHIA 3ABUA 4YFNF 3HG9A 3V8LA 1ORKA 5IYDJ 2O8KA 2M9HA 3T8RA 4AM3A 3D5SC 3OIPA 3DP7A 2Z9OA 4A3LJ 1J09A 1UJ8A 3HYIA 2DOFA 2EA2A 3MZYA 2XGEA 1UELB 1R4NB 3MQ0A 4PJJA 2A5YB 2XKPA 1FBSA 1OCRH 1RZ4A 4HV6A 3F72A 2EV5A 3CD6I 4IL6C 3L2WA 1JKPC 5C4JJ 1L0OC 3ZQCA 2Z5UA 1R5GA 3MEXA 2FMLA 3H35A 3FX3A 2CW8A 2CQNA 2K3FA 2VJJA 1SVMA 4PGGA 4E7HA 2MBFA 5FLXK 3WTXC 5E79C 4HEA2 5ILVA 1OFCX 5J4VA 1I1SA 2CFOA 5HNHA 5CVUA 3MMYB 2CUEA 4GYIA 3OV8A 4L0YB 3NARA 2DTRA 1YW8A 3CCLI 1MJBA 2IT0A 3S1NJ 1DGRM 3KPHA 2I5UA 3P9KA 1X1BA 1ULYA 4S0HB 1J9IA 1HSTA 5E3LA 4O6JA 4OINF 4AIDA 2LK2A 2M7BA 2R5ZB 2F4OB 4AD9A 3CCRI 3BPXA 1VQ9I 1WJBA 1WQ2A 2K3PA 2V7FA 5GPCA 3H5AA 2LKSA 2YR2A 3GXOA 4BNCA 3HGYA 1WPKA 1FY7A 3CZ6A 2LDUA 2JQ7A 4MQVA 3ROUA 2OV7A 4RGUA 3ABLH 1NHAA 1BC7C 5FRMA 2XF5A 5IY5H 5TISC 4C30A 4O3MA 1HA8A 1X4OA 3OR1C 3TP0A 5EDNA 2JA6J 2IGKA 2TCTA 3LWFA 2XPVA 2QM3A 4NC6A 3OIQA 4XK4A 3QWLA 4XIDA 4OWRB 2DJNA 4M72A 4BE0A 2O5RA 3BR6A 2ICWG 3A01A 4L9JA 3PO2J 1IN6A 5M5XJ 4BE2A 1X1PA 3CO7C 1XS9A 3GTMJ 3MAJA 2HOSA 3NWTA 1RR8C 6PAXA 5EG0A 2OZ6A 5L3FA 1FMWA 1VQLI 5CKTA 4XL9A 3HPHA 3UR3C 3CLOA 4LIUA 2X6YA 1AOYA 1ZLJA 1FYLA 3BCAA 4BGDA 1ZH5A 5EEAA 2D45A 5DD4A 1NH3A 1MSEC 1EKEA 4KT5C 5FKKA 1ZN2A 4G7HF 2WAQA 1OYYA 3KLOA 2EIJH 3JSPA 4WX9A 2AXTC 2R5YA 2VQHA 1FOXA 1S8NA 2VPLA 2IP2A 3ECOA 4W97A 1Y39A 1FOKA 3W6VA 5ILUA 1BBYA 2DOAA 4HV5A 1MW7A 2NRAC 1UHMA 4HOBA 3IKVA 1A6IA 4X0GA 1HW2A 3GVAA 2KL4A 3OS2A 2XPWA 2HZDA 4LG0B 1UG2A 2CWEA 3ONQA 1QPIA 2BW3B 3ULQB 2OBPA 2DMQA 4EVIA 1G2HA 2NVUB 4M73A 3PNYA 4XR6A 2E71A 1VQOI 2IS4A 2HQAA 3NAUA 5HDNA 4A0XA 1YS6A 1W7PD 2Y75A 5KAFC 3ERMA 3I71A 4IF4A 3JAMK 3RZDJ 4NDLA 1HQCA 2I10A 3DTIA 3H5NA 3HKZA 2J5PA 2QQ8A 5F0CA 3LOCA 3H0DA 5LGTA 2NYXA 1VQMI 2JUCA 3L2QA 3GBGA 3DBRB 2XVCA 3KETA 4DZJA 3E5QA 5J8FA 2L9VA 4BUPA 1UHWA 1Z21A 1LJ9A 3TMOA 3QAHA 4Y17A 3OL4A 1RETA 2MH9A 1LVAA 4LLNA 1MNEA 3K9TA 1DPUA 2ISZA 2JA2A 2B9SA 4HA8A 3K70C 4LD5A 2GIVA 1XG1A 1QQIA 4QSHA 5DM6F 4C2TA 1ZGJA 2DCEA 5ICGA 3COAC 3KEQA 3M9AA 5KNLA 1Z3YA 5JHFA 2PBIA 4OIQF 5E17F 4EM0B 1TWGJ 4JP0A 1BN5A 3TO7A 2R5ZA 4F7ZA 4UB6C 3GX4X 3PJRA 3M7GA 4HNUA 3B02A 3TBIA 1W5TA 2K9LA 4LK1F 3E6CC 3OYBA 1S5LC 2FBKA 5C44J 5F64A 2F4MB 1HOMA 3GFLA 3VPRA 2XGCA 1MBEA 3KCCA 2CS3A 1ZYRF 3ZGKA 1S72I 1MH3A 4E6KG 3RKXA 5D4SA 3ZMUA 1FSHA 2X48A 5FLVA 3KLNA 4CCKA 3ZQLA 5JLXA 3LSKA 2JA5J 2M87A 4BHPA 3JRHA 2ZNZA 3I9V2 3OYFA 2HOEA 2ECCA 1G4DA 4A0YA 1MBHA 1WI9A 3VFZA 3CMYA 2L7FP 2X1EA 2JT1A 3HPGA 1R1TA 1K78B 2FU4A 4FISA 4FQGA 3HOZJ 1TW3A 4XRFA 3ZQIA 2YX7A 4ZTJA 2DODA 3GZ5A 2K9SA 4WXDA 1VQ4I 2EQRA 3E6DA 2BVMA 2CQQA 4GYGA 2DPUA 2UXNA 1D0XA 1GVJA 2P81A 2GOXB 4JX6A 1IRXA 3WE2A 4EM2A 3AG3H 4NHJA 5FB2A 2QQ9A 1JUMA 2EH3A 3ASNH 4HZFA 5CYVA 1FSEA 1WZ2A 3Q3SA 4M9ZA 3ASOH 2KIQA 2YPRA 3DF8A 5D4RA 2M8GX 2A05A 1UB9A 1HCRA 4PUSA 4EGZA 3HL2A 2PMUA 2P5LC 2UUZA 5E1ZB 4BY1J 5E1WA 4DJAA 3QRFF 1O3RA 2BXYA 2YS9A 1H88C 1F9NA 3VDXA 1J7KA 2QGUA 3OY9A 2X4HA 2JSPA 2BW3A 4M3EA 3HTSB 2W00A 4DW6A 4LJZF 2DDAA 2L4AA 3SZPA 4HNTA 5B66C 1V5FA 2K7LA 2O0YA 4IXAA 1IZ1A 5LD2C 3BY6A 1WH7A 4G12A 5FROA 3V4GA 4HAMA 3ZMTA 4R79A 5CQEA 3OYNA 3GFIA 3R60A 2ETHA 3EDPA 2W48A 2JRTA 4CZCA 1W36C 1VQPI 4NC7A 3GLXA 3Q9SA 2DBBA 4O5VA 3H9QA 3PQJA 2EZHA 1Y1WJ 2CU7A 3TEDA 5DUIA 4OAYA 4LMYA 1RRJA 5FJ8J 1Z7LA 2IRFG 4KA4A 4BQQA 2W85A 2QSHX 4BL0B 4HF1A 1OKRA 2DOEA 1TWAJ 2UV1A 2WADA 2EB7A 2XDVA 1QZEA 4R8HA 5H2FC 3HOWJ 3VSKA 1KGSA 3A2KA 2XB0X 2ZBKA 2TDXA 3TOBA 3WTWC 3TW6A 2VE9A 3DEWA 5J40A 3TP3A 2NS7A 3KFWX 4IZZA 2X1DA 1W1WE 3NWSA 3HOTA 1GLNA 3IL2A 1G3SA 5FD6A 1OISA 3RQ4A 4V19K 1OCPA 1FTZA 1WKMA 2OAZA 4CH7A 5DV5A 2RREA 2WC2A 2DO7A 3MVPA 4A2UA 2OCEA 4NQWA 2LD5A 5B5EC 2M4KA 5EGOB 1ON1A 1UG0A 3QU6A 4BHCA 4BQNA 1JT0A 4RAFA 1XDUA 3E6MA 3F8CA 1ODDA 4CUGA 1TW2A 1T2KA 5EEHA 4LB6B 2COBA 4HRIA 2ADUA 2DMPA 1WFXA 2O6GE 1EF4A 2A3SA 2F5EA 1T56A 2LFBA 1EA3A 2K85A 5BPDA 5J3LA 2VKVA 3M8FA 1XMAA 4LITA 1GVDA 3KP7A 2D2WA 2X51A 4PFPA 5D5VB 3TDZC 4A6DA 1I5ZA 4LLGF 3GTLJ 1P6RA 2WAQN 3KP4A 4A3MJ 1FBUA 2DK5A 2KDZA 4G94A 4IHTA 1W7PA 2CUFA 4UV9A 2R3SA 5JLWA 2V1NA 2JUGA 2X85A 1IN5A 2O8XA 2QLZA 2ZFWA 1UAAA 2VOPA 5AIPA 1Z0XA 4Y4RA 5IPAA 2KZGA 1L3LA 4IPAA 3F6OA 3OYMA 2KT0A 5FFXA 4L9VA 3I59B 3WTYC 5IP7J 3GMEA 2KMUA 2ZSHB 2IA2A 1F4KA 1C0WA 2L9NA 2DFHA 4JK1X 2VN2A 1B9MA 3IAS2 3ZMVA 3P9CA 2R4GA 3IP4B 3L00A 4JOMA 2CMPA 4BHBA 2GA2A 2R7UA 4HPQA 3HKZN 5EZGA 5FGMA 2IS2A 1R5ID 1X3ZB 3K1PA 3GTJJ 2E35A 5D5UB 2YU9J 3SQNA 2XGDA 4PJMA 2QWWA 2Z99A 4HF0A 5F1RA 4IOCF 2RKHA 2EFNA 2K4BA 1BJZA 3CTAA 4RGRA 1BJAA 2A6HF 1SD5A 3H3ZA 5FKMA 4DYRA 3RIRA 2Z33A 2M5WA 3DTKA 4CYCA 2A61A 3K10A 3I0TA 2N8GA 1I3AA 4M6XA 5J1YA 4NB5A 2K27A 1X3UA 2ZXJA 4PFOA 1MBGA 4DIQA 4A3FJ 2VJIA 3CQZJ 4BBRJ 2K9QA 1Z67A 2ZJPF 3SDGA 1EV7A 4OMYA 3QPSA 1D1AA 2OUMA 4M3FA 2F5DA 1G6NA 1GV2A 4BXFA 3F21A 1SFXA 1TZLA 2HR3A 3KYDB 3E5UA 2R7XA 1R22A 5LHGA 4FHTA 4PK4A 1SFOJ 1JUSA 5FRNA 1OMIA 2RAEA 2CGPA 1T95A 3GTGJ 3IRRA 1HKQA 2P6TA 3BZKA 3OOPA 3CMMA 2ELHA 2Y0SA 4DGWB 1EH6A 3Q0UA 3E0JB 5CPRB 4MIMA 1OYWA 3H9GA 3SHFA 1BI3A 4RAYA 1KU7A 3L2VA 2A6EF 1ENHA 3IV5A 1JKQC 1MMNA 1TWFJ 1YE9A 4G9YA 4ZDLA 5F08A 3K4LA 1YO5C 3SDBA 2DW4A 5C3EJ 2G7UA 1V54H 1D8KA 1ITYA 2XAQA 2FBIA 3I4NJ 5JI6A 1XGMA 3T5XA 1X2NA 3ZR8X 5E3MA 3AL0B 4YFKF 1R6RA 5K5RA 2HDWA 3LFUA 2AQEA 1FYMA 3HHGA 1W0TA 4P96A 1Z77A 2HGCA 1FP1D 2QQAA 4KUMA 3J7YJ 2EJRA 3W6KB 4CO8A 5DCMA 1U2WA 2MG4A 3QOPA 2LC2A 4YEJA 3S93A 1FP2A 4WK8F 2PFBA 4X1EA 4D7NA 1IAWA 1YRNA 4RM2A 3LFKA 5L3GA 3GZ6A 4HW0A 5IP6A 4HYEA 3GTKJ 1WJFA 1WVRA 3J7AO 4UVCA 4A93J 1FZPB 2R7WA 2XAUA 3ABKH 2OA4A 3A0HC 1LDDA 1EH7A 2ZMEA 3JW4A 5DD8A 3WU2C 3S17J 3K4JA 5GPAA 2LYCA 1Q1HA 3CCVI 3T8TA 1XSDA 2MSYA 4HX7A 4II3A 3EUHA 5GTHC 3GZNB 4G6TB 4UVAA 2VC0A 5CQGA 1XB4A 3G1MA 5BS6A 4F92B 2XKOA 1DU0A 3LSHA 3G73A 2VOOA 4RLFA 3RKWA 2HOTA 4P1WA 2ECBA 5HLIA 2V6CA 4XN0A 3ZRGA 1G3WA 2B0LA 2PQ8A 2X0LA 1BR2A 1IRFA 1LNWA 4EV0A 1YFHA 1ACIA 4OMZA 1SANA 2R7DA 3DLLF 3RI4A 2VASA 3KZIC 2VBXA 1YJNI 3JRCA 2PMZN 3OIOA 1ZRDA 3UNGC 2QF7A 3HBLA 2PJRA 1K7AA 1K6YA 2RNGA 3UKGA 4Y33A 4RAGA 1XPXA 2GXAA 1OR7A 2DYSH 2X1CA 3OMYA 4BYYA 2FE3A 2QYOA 3WTVC 4R1HA 3MKLA 3LA2A 2GLOA 5ICFA 1U9OA 3D0SA 4EQQA 3PNVA 3HDDA 1J0RA 1WH5A 2KPMA 2IA1A 5D5XB 2H27A 2PLYA 2XF7A 5E18F 1W5CC 1OCCH 3ML6A 2ESHA 2MW8A 2PI0A 2BEOA 4BS9A 2KKOA 3CJRB 3H1CA 4G6DA 2DI3A 1HF0A 2R7FA 3E3VA 1ZQ3P 4CHUA 1GDTA 3A03A 3W2WA 3RQIA 1JGGA 2H8RA 4HLYA 1T0FC 1K83J 4CXFA 3CCEI 1G3YA 1QZZA 1FNNA 2R7TA 4IRGA 2XAJA 4CGZA 3BTLA 4Z6YA 4A3GJ 3J81K 4UB8C 3SJMA 1FOYA 5JHUA 3E97A 1WRJA 3K0LA 1H9GA 3GEZA 1PDNC 5CVIA 3SEZA 3OR2C 1WJDA 5HOOA 3NRVA 3OYHA 2HI3A 3LSRA 1P4AA 2HYFA 3JRDA 4ZZDA 3A1YA 3L1PA 4RB3C 1SEUA 5DUKA 1K6OA 1R36A 3BTIA 3AKZA 5JFRA 2HFHA 3M4OJ 2XHKA 3QP5A 3CJQB 1TLHB 2K02A 3I55I 1IV6A 2HVQA 3HHHA 4L9NA 3OYLA 3G71I 3J7ZI 1YW9A 1MSFC 4FCYA 2AXLA 4BKXA 1RKWA 2CH0A 2XB5A 1OJLA 2XUBA 4HDVA 1IC8A 5LGUA 1JJ6C 3AAFA 2DMUA 4ZZLA 4ZH4F 3KIOA 2VXZA 3RTRA 4ZDPA 4ENJA 1TNTA 3DQVC 3E1SA 3P9IA 3V8JA 4FX0A 3SFZA 2VODA 4EM1A 4XKCA 5K7HA 2XIGA 3O6BB 3MKZA 3MCZA 3BG7A 1GHCA 2WA0A 1ETVA 3T0YA 2QVOA 2KIFA 4AU7A 1YG2A 2R7OA 4C3IJ 2IW5A 3JRGA 3RKQA 2E2JJ 4Y3OA 3VOEA 4U88A 5IOYA 2UXXA 2VIXA 1VF9A 1FIAA 2BVLA 3C1DA 5M3MJ 1J59A 3W2AA 1HKTA 2M0MA 5EF6A 2HQ5A 1LVKA 3FM3A 4M9SA 2NOJB 1AKHA 3O8GA 2VQCA 4GDFA 4WXHA 5B1AH 3HZJA 4YIRX 1XN7A 2DFFA 4U87A 4UUTA 4UHTA 3FXRA 5LRRA 2JRMA 3LMMA 1Z05A 4ESFA 3J7AY 1XTAA 3CF2A 3WODF 4UUSA 2OTLI 2YUSA 4RM3A 1VQ6I 2ZO4A 3EQLF 2HKXA 4L9TA 4XLAA 1QBJA 5FO5A 3ECHA 2MA3A 2B7EA 4MFDA 2D5VA 2XASA 3KP2A 2M1BA 2COMA 3HRUA 2OC6A 2R7SA 1OCOH 2XROA 4DZPA 3DU5A 3ZQHA 3OWTA 3BQZA 3LL7A 1PP7U 1R49A 3CC7I 3CC2I 3HM5A 5B1BH 3G3ZA 5HNFA 3U1DA 2EFOA 2H6CA 4I0BA 1TTYA 1VI0A 2GOMA 2Y0SN 4IJAA 4RB0A 5LEKA 3I4PA 3JRFA 3QYFA 1FC3A 3CUQA 3QU3A 4M74A 1YOVB 2RNJA 5HS9A 3RYRA 1IF1A 1DQUA 1GT0C 2Y2ZA 4DQ2A 1XX5A 1IRGA 4MFEA 3CDIA 4DYCA 2V1UA 5IT9Z 3WGIA 1TWCJ 1AHDP 1S7OA 3R0JA 4XQFA 1MZBA 1IG7A 1V4RA 2WBMA 3S2DJ 5GP9A 3SYTA 1V55H 1FX7A 2UZKA 3TDUC 3BG3A 2ELKA 2EA4A 2CV1A 1ZHFA 3CUOA 1LFBA 1BI0A 3PIPF 4JBAA 4LLLA 5F1JA 2F2EA 3C2HA 3R0AA 2QQBA 3D5LA 1MDMA 1WSUA 5AONA 5BMZA 1LE8A 3HRTA 1D0ZA 2CQXA 4PSXA 5GAEJ 3LAPA 2OPTA 3WHCA 4DBRA 2ZCWA 1BOAA 4RBOA 4H4KC 4Y52J 1YLFA 3L09A 2LY9A 4EJVA 1XD7A 2CFXA 2Z16A 2ID3A 3BT9A 2DA4A 2Q2EA 4I02A 4B1RA 2YU3A 1RIOH 5GTIC 1TT5B 2V26A 5KHDA 1Z9CA 4A12A 3V7SA 4A3BJ 3AG4H 5EJCA 1SVOA 2H09A 3IH2A 3RYPA 1I6HJ 1BM9A 2EZKA 2MLGA 3HOYJ 2DTZA 3ESWB 5HLTA 2Y69H 3FIWA 2RDPA 5CLSA 2A69F 4GFBA 4NQWB 3FXMA 1NTCA 2VKDA 5DEQA 3AL0C 1GXPA 1HXDA 3H92A 5J4YA 4C2UA 3FMSA 2RVCA 4I01A 2G7HA 1BR1A 3HRSA 4OOIA 1VQKI 2H1KA 1S7AA 2HU9A 4II2A 3JRAA 3K7AJ 2W4SA 4KIFA 2ZFUA 1WCMJ 2LR8A 3U2RA 2J5OA 2IAIA 4WXCA 3K1MA 4IQ4A 2W57A 2DXIA 2LNBA 1P9QC 2VJ4A 3S14J 1LB2A 4RB1A 1U5TB 5FKNA 4D5CA 1BI1A 3C2BA 4ZYGA 1QNTA 3F22A 1W7PB 3C3WA 5FLMJ 3S1MJ 3EUKL 1AA7A 2FSWA 3M8JA 1BL0A 1G8XA 4XRSG 1B72A 1EH8A 1VFCA 3N05A 2XRNA 2IA0A 4EATA 3BR0A 4ZC3A 4I0AA 3FBIB 3KP3A 1XSVA 3WTSC 1H9TA 2PEXA 3HJEA 1B8IA 4HNVA 3VYTB 2VL8A 2LY2A 5J1UA 2WWYA 3LA7A 1HBXG 1VQ8I 5K7FA 2E2HJ 5F27A 1FIPA 1WHUA 2CSOA 4LK0F 5K5QA 3RDIA 4U0WA 2OQGA 2IEKA 1AWCA 2EINH 2NOGA 2G0EA 1G3TA 1NG7A 4FETA 3GO5A 1DGWY 1OPCA 2O03A 2WY8Q 4C2MJ 1VQ5I 4BXUA 4PJLA 2XGXA 2FEZA 1FBQA 4DNCA 1ZR4A 3LSIA 1USTA 4XKBA 3CESA 3W2VA 2RQPA 4D9JA 4EJUA 4BJTA 3RPQA 3E6BA 3HUGA 3WE3A 4CCJA 1ETWA 4PDKA 2LTPA 4AVPA 4GCVA 4KISA 4CYCB 2LSOA 4BDZA 3RZOJ 4IO9F 2HTJA 2LF7A 4KYWA 4CCMA 3QYBA 5CVJA 4XMYA 4A5NA 3CCMI 1P7IA 4B47A 5GADJ 4F3QA 4BDYA 2E60A 2IBDA 3PFYA 2PMZA 2E19A 5JVTA 3GFJA 5HVQC 2KP6A 3VYSB 3BG5A 2IJLA 4D7MA 4LOCA 1ZTRA 2NS8A 1XGOA 3BJOA 3BOQA 3K1NA 1POGA 2BGCA 2FOKA 2XRLA 1GUUA 1Y1VJ 4IHVA 1FOWA 1B1BA 3WHBA 4ENNA 2YSRA 2VLAA 3WU1B 4G8XA 1YI2I 2PN6A 4A69C 4N0BA 4U7DA 2LKPA 2IVMA 4Q48A 2D1HA 2P7VB 3BWGA 2O3FA 4DBQA 1JUPA 1YJWI 1O57A 2M8EA 2QENA 4XLHA 4IHYA 2Y48A 4OIOF 2QCOA 1X4PA 2MD0A 1HW5A 4IQJA 1VTNC 4XM3A 4B44A 1KU2A 2DQRA 4C3JJ 1KQ9A 4I2OA 2JN6A 3MN2A 4RAZA 1E3PA 3ZQ7A 1D1BA 1W4MA 3DEEA 3JTHA 3G6EI 2P5KA 2A68F 3BPVA 3DV8A 4HG2A 1E3OC 4Q5SF 2VC1A 1JXSA 1MJAA 2QBYB 4I76A 2V4JC 2P8TA 4L5IA 4ESJA 4PCQA 2DQLA 2VT3A 1TWHJ 3CMAI 2E1CA 2Y9ZA 2H8WA 4YELA 3FF5A 2LP0A 3FXOA 3Q0WA 4M9XA 4Z2YA 3TGNA 4ZYDA 9ANTA 2HYJA 3MFKA 4CSWA 2LH9A 4NC8A 2QUFA 3HRMA 3U21A 3DKXA 1RKTA 5KK1A 3S1QJ 2E1NA 2W24A 2IGMA 2X6XA 1O3TA 1IRZA 4PJNA 1UHSA 1XDSA 5DCMB 3I56I 2DPDA 2KIUA 2B63J 1PYVA 3F6VA 5F0HA 2OQRA 3S8PA 1BI2A 5KAIC 3ZMDA 4UNOA 1N25A 3K4BA 3HOVJ 3S1RJ 3LQRA 5EEGA 1DP7P 1YRNB 2Y0MA 1X1CA 3CCYA 1A35A 2LRDA 3OSFA 3V42A 1V3FA 2LREA 1WI3A 3DXJF 1SAXA 2WB1A 2CQKA 3JRIA 1T8IA 1U5TA 1BW6A 1QHHD 3QPLA 3F8BA 2AQFA 4IVNA 1OQYA 4H0EA 1ETKA 3CP8A 4AYBA 3CF5F 2ZMEB 2BHZA 3W3CA 2JVHA 3GYHX 4P9UA 2H6BA 1QRYA 4WF2A 3K2ZA 1Z7UA 2CO5A 4M3GA 2HOAA 4B8XA 1RR7A 1OCTC 2HQNA 3ABTA 3CO6C 2QKLB 2DA3A 2JVGA 4OIRF 1NK2P 3FWEA 1RESA 2DA5A 3S2WA 3BLYA 4BXXJ 1D3YA 3VEPA 4M3DA 3TO6A 1SD6A 5CJ9A 2UWMA 1P4WA 1XGSA 4A0ZA 4D1QA 3K70D 1MBKA 1I1GA 1YIJI 4OIPF 1ZG5A 3GWZA 3M1CA 4E4HA 2PJRB 1OCZH 2PMHA 2M30A 3MKWB 4ABZA 2KDOA 3MWMA 2AO9A 4ZYAA 4XLFA 5FKLA 2XSJC 2XAFA 4E7SA 3FK7A 3CP2A 4XLCA 3OL3A 4NNJA 3GFMA 2LG4A 1WJCA 4KN7X 2VONA 2E34A 3JRBA 5LGNA 1KA8A 1BR4A 1Y8QB 1OYIA 1PJRA 2L9RA 4LIVA 1JKOC 3OSGA 2CV2A 3FXLA 2FBHA 2P7CB 3KP5A 2VE8A 3OYCA 1MNDA 2GM4A 1IXCA 2KQRA 1USSA 5FLXZ 2IXSA 5D8LB 1MH4A 2LVSA 4N4NB 4D5FA 5F04A 1PP8F 3PSFA 4PGHA 2ZB9A 2Q0OA 3LSPA 1ZGWA 2GIZA 1WWXA 4XRMA 2IPQX 1W5SA 2X6OA 4J19A 2IS6A 3HEFA 1SFUA 4JX5A 3JCUC 3K6GA 3O8HA 3BZCA 2DYRH 2JPBA 4YG2F 2FF4A 3KX2A 1YIOA 1ZREA 2KZVA 2EIMH 3K4NA 3IC7A 5E1XA 2CV0A 4OU0A 2HWVA 5ICCA 1HKSA 4UXNA 1RPWA 1LFPA 3OOUA 3OYDA 1Y6IA 1KYZA 4U0VA 3RPUD 3PUFA 3MZ8A 2E7XA 2QBYA 2GWRA 1DU6A 1UFMA 4FASD 4Y7NJ 4J00A 1R4MB 1IUFA 3N97A 4MO7A 4ZYHA 2HVRA 2V6EA 1U8RA 2Y9YA 4KIGA 3DFGA 4QWQA 4D0PA 1QA6A 1A04A 4UV8A 1ETQA 3ZN1A 1YJ9I 4KDPA 4GRIA 3S3OA 3VYUB 3ZQFA 1IN4A 1O3QA 5CVRA 3I3LA 1V5GA 3LSMA 1Y56A 1I3QJ 3GTPJ 3E7LA 2XAHA 1SAUA 3H36A 4CCNA 3IRQA 1CGPA 3DPLC 2VKHA 5D8KB 1N77A 4KIBA 3V7CA 1Z91A 1U3EM 3L2CA 2BY0A 3KZZA 2L02A 5HLHA 2STWA 2VKEA 4BBSJ 3ZMZA 1GV5A 4EEFG 2W82A 3Q5FA 3FMQA 2HDCA 2V9KA 1IXSB 2JWTA 4A3IJ 4BEHA 2NAZA 1U5TC 2R7VA 1K4TA 1P4XA 4N9HA 1J5YA 4N4OB 2KHMA 4P5OA 3H3VK 1D8JA 2VJ5A 1JTYA 3JSOA 2BY1A 2VXDA 2DMNA 4V2FA 2M3AA 4E7IA 1YYVA 4U0YA 5DM7F 2ISYA 3V8KA 1AKHB 2HZTA 2F5CA 2R7QA 3CCSI 3EYYA 2A07F 1D5VA 1LDKB 1NG6A 2QKMB 3EYIA 2HNHA 2ACJA 1E3HA 1YW7A 2MLKA 1Q1VA 1B6AA 4UUSB 4RLQA 4BU2A 1FLIA 3ABMH 1U78A 2DFEA 3FXQA 1FWZA 2RV8A 2LBFA 2ZNYA 3MD2A 1LDJA 3BTJA 1X2MA 3SEQA 3QYEA 3CMEI 3BDDA 3G1OA 5E8IA 1PUFB 1Z6RA 3S15J 1ERDA 3QP6A 2IS1A 3CCJI 4QTRA 4PZJA 1ZRCA 1VQNI 3C7JA 4C3HJ 2HTSA 1IN8A 4E7LA 1D0YA 2LMDA 2QSFX 4E70A 2M7AA 2KLOA 4LG3A 4HQMA 2BZTA 3RSNA 1KONA 1U6GA 1ZKGA 3DBHB 5F0FA 3CUQB 3IWFA 4GO1A 3IHUA 5H6RA 2FXAA 2KJCA 2QEXI 1T33A 1XC5A 1LFUP 4JQFA 1X58A 2MGQA 1Y0UA 2CQ7A 4JYKA 1R58A 4F55A 1DUXC 4L0ZB 4ZJZA 1SFEA 2Y30A 3HOXJ 2JA7J 2E1MB 1XSXA 3FXUA 1S6LA 2V1XA 3LAJA 5LFAA 2M0CA 2Q1ZB 4RDUA 2ZJQF 1LPQA 2CW0F 1MDMB 4KJZA 1LE8B 5BOXA 2TRTA 5E8GA 4KMFA 5M3FJ 3ISPA 4CICA 1BIBA 4Y15A 3FXKA 2E2IJ 2NVQJ 3R6SA 4HSTA 3IAM2 1IW7F 2CW7A 1E2XA 2G9WA 1ZG3A 2Q2EB 2PJPA 5EYRA 4MQ9F 2F4IA 3D1NI 1BIAA 5D5WB 1U8BA 2HDDA 2WB1N 1FT9A 3M1EA 3ZCOA 1IN7A 1JT6A 2L01A 2W7NA 2XV4S 3PNTA 1QGPA 4ON0A 2DA6A 4AYBN 1T98A 1XMKA 2MC3A 3C2GA 2M34A 3DEUA 1VZ0A 4YRVA 4BAYA 5M5WJ 1B9NA 3BR2A 2KRHA 3WGHA 3MZHA 3I4MJ 4XONA 4HDUA 2MFZA 2BBYA 3U1KA 4M3BA 1R5HA 2V9PA 2F5VA 1TP4A 2DA1A 3VYRB 3J80Z 4AIJA 2A6TA 1MNMC 2DFIA 4ENKA 4ZDOA 2JTVA 3WTUC 2LLKA 2DT6A 4CCOA 4XORA 4BJ6C 1DP3A 4GXOA 2MD5A 4YIFA 2H1LA 5J47A 1GXQA 2VBZA 4S04A 1ZELA 2VI6A 1H8AC 1SD4A 1BA5A 1JI8A 5CVVA 2PX9A 2DMTA 1N75A 2GXBA 1B4AA 5GAHJ 1K61A 5DS9A 3OYJA 5FFZA 4KNYA 3CC4I 2L5QA 1YHQI 5DCFA 1REPC 2ZMEC 3OS1A 2HQRA 3ZP5A 3F8FA 2EBIA 2XPUA 2QZ8A 3QPTA 3WTZA 1RI7A 5A2QZ 1P7JA 2FMYA 1B72B 4C9YA 3EUHC 1XMXA 3BJAA 3A0BC 2YX4A 4OAZA 1NK3P 4K2EA 4QPQA 2L2OA 2O7OA 4G7OF 1B8IB 1T08B 4PSWA 3VSLA 1HDDC 3LA3A 5C4XJ 2EZIA 1QHGA 1W0UA 1APLC 4XKVA 3S32A 1TQIA 1MKMA 4XSZF 1PUEE 4XLPF 2VPRA 3F9KA 2DA2A 1H0MA 3FDYA 5H20A 4XLEA 1IO2A 2MYSA 3D5RC 4HSRA 1MBFA 2EZLA 3P5JA 2OF7A 5F6FA 1PUFA 2KRFA 4M71A 3RPUA 2F6CA 4YIIA 4QIWN 3GUDA 3B6CA 4NUBA 1HW1A 4TV7A 1O3SA 1HLVA 2BYVE 1OR7C 1MIJA 3S2HJ 4I6ZA 3O2PE 3PM1A 3HC7A 5ILSA 3BQYA 3N4MA 4B3AA 2FJ1A 3HUGB 3G2BA 2EFPA 3Q0VA 4LFUA 3L2UA 3K4CA 2K40A 2R92J 1DPRA 2E5ZA 1MMDA 1LUJB 5BNGA 4BE1A 2WTEA 3FHNA 2HKOA 5ERIA 2FD5A 2RN7A 4AUXA 1UMQA 2XSDC 2CYYA 2KISA 1R1VA 1TBXA 2L3DA 2LY1A 5TRDA 1X1DA 4MGRA 1A31A 5FD5A 1XCVA 4L5EA 2GQQA 2EWNA 4HX8A 5LRSA 3SXYA 3IKTA 1R71A 3HGGA 3OYEA 3FBNB 3RJPA 3K4KA 2LKXA 3LSJA 1IDYA 3ZN0A 3KP6A 2Z1DA 4XICA 1E0EA 2EFWA 2STTA 2VQGA 3KEOA 1JTXA 2O61A 4Q4ZF 1Y8RB 4FX4A 5HODA 4EMSA 3OYAA 4KMUX 1R00A 4I7HA 3BG9A 1B59A 2DN0A 2GAUA 1YQAA 2BHYA 1YX3A 3H3UA 3I54A 3PFIA 3REOA 2EK5A 2BXZA 2ZC2A 3M3YJ 2L4MA 2I8DA 5E3OA 2HPMA 4Q47A 1F36A 4J01A 2MH2A 5J6XA 3EPZA 3B6AA 1ZG1A 1MMGA 3AFHA 1OLTA 2ELJA 3HSEA 4G7ZF 2AS5F 1RUOA 3IUOA 5LEJA 4CCLA 3HOUJ 2HXOA 3I53A 1HC8A 2GXGA 3BR1A 4EJOA 2A5WA 4AIHA 1WGXA 1R1UA 4B4CA 4ITVA 1IJWC 4IHWA 1Y0NA 3GTQJ 5K1YA 4XKWA 4BH9A 3A4CA 1I27A 1K4SA 2P4WA 3CLQA 2ZXIA 4KITB 3HSFA 1SVLA 3B73A 3OYGA 5JR3A 1QVTA 1IGNA 4KFCA 2ZXHA 2LF8A 4N9IA 3HSRA 1JHFA 1SFKA 3AG1H 4XSXF 3I5UA 2FOWA 3ZXSA 3ZOBA 1KU9A 5M5YJ 3IWZA 1YTYA 4GGGA 4QPOA 3R61A 4JX4A 2FUG2 2OD5A 5HLGA 3L2RA 3A02A 2XAGA 4FE7A 2EPFA 2M2EA 1UCRA 5DTDA 1YITI 2GA1A 2AHQA 3F3XA 3FXJA 3LSGA 4M6VA 4IX7A 4EJTA 4MEXF 1ZLKA 2HXIA 2Y31A 2JSCA 3F0CA 2C6YA 4P55A 1MJ9A 1ETXA 2FRHA 2OZUA 3J80K 3F8MA 2E36A 3CCQI 3WTTC 3WGGA 2L7ZA 2DLLA 4RS8A 2K86A 3F23A 2DU9A 2ME0A 1D5YA 2NVTJ 1PVEA 4CA0A 1TC3C 2FA5A 1IDZA 3KYLA 1F1ZA 5IOZA 1JE8A 2F48A 2Z2SB 2NNNA 4HBLA 1QPMA 4QLCU 5L3DA 2R93J 3OYKA 2QA4I 3WU0A 3FHZA 3OYIA 5A2QK 2ZJ2A 1ZK8A 1P2FA 1S7EA 5BPIA 5J1RA 1KQ0A 2WAFA 3CUQC 1M1EB 1YS7A 3ZQGA 2XC7A 2ZJRF 1JKRC 4X6AJ 1S29A 4MLOA 2NVYJ 3NEUA 5LHHA
chains in the Genus database with same CATH topology
1A6IA 3HDDA 1WH5A 2L9RA 1JKOC 2XPWA 3OSGA 2NVXJ 1UG2A 1QPIA 2DMQA 1G2HA 3G1LA 2MW8A 3NAUA 1AU7A 2GM4A 2L0KA 1HF0A 1ZQ3P 1MH4A 2LVSA 2E1OA 3A03A 3RZDJ 1GDTA 4NDLA 3RQIA 1JGGA 2H8RA 2I10A 4D5FA 5F04A 1K83J 3LSPA 2ZB9A 4A3EJ 1ZGWA 2L7MP 4XRMA 5F0CA 3LOCA 2X6OA 3BTLA 4J19A 4A3GJ 3HEFA 4JX5A 3SJMA 3O8HA 2O9LA 3K2AA 3GBGA 5IYCJ 4DYQA 1VNDA 1RPWA 2HI3A 3LSRA 4DZJA 3JRDA 3OOUA 3L1PA 1DU6A 3BTIA 4Y7NJ 1RETA 1IUFA 3M4OJ 2FQ4A 1IV6A 4MO7A 3LNQA 3CDLA 1U9NA 2Y9YA 1XG1A 4QSHA 4IHXA 2CJJA 1MSFC 1ETQA 4A3DJ 3JR9A 4FCYA 3ZQFA 4BKXA 2JMWA 1RKWA 3FKIJ 2XB5A 1OJLA 1I3QJ 1IC8A 3E7LA 1JJ6C 3GTPJ 2X9DA 2DMUA 1TWGJ 4JP0A 5K7ZA 2R5ZA 5FKOA 3FISA 4FTHA 2VKEA 4BBSJ 1GV5A 4EEFG 5C44J 5E3NA 1HOMA 3VPRA 2XGCA 2JWTA 1MBEA 5K7HA 4A3IJ 5IYBJ 1MH3A 1R9TJ 4AC0A 1ETVA 2X48A 1FJLA 3H3VK 5FLVA 1JTYA 4C3IJ 3ZQLA 3RKQA 5JLXA 3JRGA 2E2JJ 2JA5J 2DMNA 4V2FA 3JRHA 5IOYA 1VF9A 1FIAA 2ECCA 5M3MJ 2R0QC 1MBHA 1AKHB 5EF6A 3CMYA 2HQ5A 2L7FP 1AKHA 4FISA 3HOZJ 3O8GA 1FTTA 3PO3J 3ZQIA 2K9SA 4UUTA 2EQRA 2CQQA 1Q1VA 4UUSB 3IH3A 1U78A 2P81A 4JX6A 4UUSA 1BW5A 2YUSA 1I50J 3BTJA 1JUMA 1X2MA 2EH3A 4MFDA 3G1OA 2D5VA 3Q3SA 1PUFB 1HDPA 3S15J 2M8GX 3BR3A 4QTRA 1FEXA 4C3HJ 1HCRA 4DZPA 3ZQHA 3BQZA 2JJ7A 4BY1J 1A5JA 3H0GJ 3HM5A 1ZKGA 2YS9A 1H88C 5F0FA 1JJ8C 1VI0A 2Y0SN 3JRFA 2R93J 1T33A 4A3JJ 1XC5A 4M3EA 1LFUP 4DW6A 1X58A 3HB9A 2MGQA 3TW7A 2Y2ZA 1GT0C 1CQTA 4MFEA 4DYCA 1TWCJ 4JYKA 1WH7A 4G12A 1AHDP 1IG7A 3S2DJ 3BTCA 2R7ZJ 5GP9A 2Y30A 3HOXJ 2JA7J 2W48A 3BG3A 2ELKA 2JK3A 2M0CA 4RDUA 1LFBA 2EZHA 2CRGA 1Y1WJ 5F1JA 2CU7A 3TEDA 1LE8B 2TRTA 5FJ8J 5M3FJ 1LE8A 2CQXA 3SFIA 4A3KJ 2E2IJ 2OPTA 3WHCA 2NVQJ 2DA7A 4RBOA 4Y52J 2LY9A 1TWAJ 1O4XA 3S16J 2ID3A 1ETOA 3BT9A 5IP9J 5EYRA 3D1NI 3HOWJ 2DA4A 1U8BA 2HDDA 2XB0X 4W1UA 3BR5A 4B1RA 2WB1N 3TW6A 3DEWA 1JT6A 4A3BJ 3TP3A 2NS7A 3IH2A 1I6HJ 2EZKA 2DA6A 4AYBN 3HOYJ 2DTZA 3FIWA 2M34A 4V2GA 1OCPA 4XRSA 1FTZA 4GFBA 5M5WJ 1NTCA 3BR2A 3MVPA 2ME6A 2LD5A 3I4MJ 3DCFA 5EGOB 4M3BA 1JT0A 5EGOA 2H1KA 1MNMC 2DA1A 3JRAA 3K7AJ 2JA8J 2LLKA 1WCMJ 2LR8A 2COBA 2DMPA 2IAIA 1EF4A 2VI6A 1H8AC 1BA5A 4A3CJ 1T56A 2DMTA 2LFBA 1K61A 5DS9A 5J3LA 2VKVA 1GVDA 3S14J 2GBYA 5FKNA 4D5CA 3C2BA 3GTLJ 1ZR2A 4IEJA 2WAQN 2EBIA 2ID6A 2XPUA 4A3MJ 5FLMJ 2KDZA 3S1MJ 1P7JA 1B72B 1BL0A 2CUFA 1MBJA 4XRSG 5JLWA 1B72A 5EZHA 2WV1A 1VFCA 1NK3P 1Z0XA 2O7OA 2FX0A 3BR0A 5IPAA 1B8IB 3A01B 1HDDC 2VUMJ 1QVUA 5C4XJ 2EZIA 2KT0A 1B8IA 1F43A 4HNVA 1W0UA 1APLC 1ETYA 5IP7J 5J1UA 1H89C 2VPRA 2DA2A 5K7FA 2E2HJ 5F27A 1FIPA 5EG0B 2K9NA 1MBFA 2EZLA 2OF7A 2IEKA 1PUFA 4QIWN 2NOGA 3IH4A 2G0EA 3B6CA 5EZGA 3HKZN 1HLVA 4C2MJ 3GTOJ 1ZR4A 3S2HJ 3GTJJ 4I6ZA 3PM1A 2YU9J 4FE4A 3BQYA 4B3AA 2FJ1A 2XGDA 3JREA 2R5YB 3QQAA 3Q0VA 1BJZA 3FK6A 1ETWA 4BY7J 2LTPA 2K40A 2R92J 4CYCB 5FKMA 5BNGA 4DYRA 3RZOJ 4CYCA 2FD5A 2N8GA 1ORKA 4AUXA 5J1YA 1UMQA 2XSDC 1P7IA 5IYDJ 2O8KA 2M9HA 2IBDA 1MBGA 4A3FJ 2E19A 3CQZJ 4A3LJ 4L5EA 4BBRJ 3BG5A 2K9QA 4D7MA 4LOCA 1ZTRA 2NS8A 3HGGA 3SDGA 1POGA 2LKXA 3LSJA 1IDYA 3QPSA 2XRLA 1GUUA 4M3FA 1Y1VJ 4IHVA 1GV2A 3WHBA 2XGEA 4XICA 4A69C 1JTXA 1SFOJ 1JUPA 1JUSA 2RAEA 4IHYA 5HODA 2QCOA 1JKPC 5C4JJ 3GTGJ 3ZQCA 3BG9A 3Q0UA 2DN0A 4C3JJ 2JN6A 3MN2A 4MIMA 3M3YJ 5E3OA 1E3OC 1F36A 1ENHA 3IV5A 1JKQC 1TWFJ 4I76A 5F08A 1OFCX 3B6AA 5C3EJ 1TWHJ 1ITYA 2Y9ZA 3I4NJ 2CUEA 2LP0A 3Q0WA 3HOUJ 2HXOA 1X2NA 5E3MA 3BR1A 9ANTA 2HYJA 3NARA 3S1NJ 1WGXA 4B4CA 1RKTA 1IJWC 4IHWA 3GTQJ 3S1QJ 1W0TA 1Z77A 1IRZA 4S0HB 1UHSA 5E3LA 2B63J 5F0HA 2LK2A 2R5ZB 2MG4A 3HOVJ 3S1RJ 4X1EA 4D7NA 1YRNB 3CCYA 1IGNA 5GPCA 1QVTA 3OSFA 1YRNA 1WI3A 3HGYA 1WPKA 5IP6A 3JRIA 3ZOBA 1BW6A 3GTKJ 3QPLA 5M5YJ 4A93J 1ETKA 4JX4A 3A02A 4FE7A 3TP0A 5EDNA 1QRYA 2JA6J 2TCTA 3S17J 2XPVA 4M3GA 5DTDA 2M2EA 5GPAA 2HOAA 4XK4A 1RR7A 4XIDA 1OCTC 2AHQA 2DJNA 2MSYA 4M6VA 3BR6A 3LSGA 3A01A 3PO2J 3G1MA 2HXIA 2DA3A 2Y31A 5M5XJ 3F0CA 1DU0A 1NK2P 4BXXJ 1RESA 2DA5A 1ETXA 2HOTA 1XS9A 3GTMJ 2ECBA 4M3DA 2HOSA 2L7ZA 5EG0A 2ME0A 1D5YA 2NVTJ 1MBKA 1SANA 1TC3C 1IDZA 3JRCA 2PMZN 5IOZA 3OIOA 5EEAA 1MSEC 4ABZA 2QF7A 5FKKA 3HBLA 2AO9A 5FKLA 3UKGA 3FK7A 2R5YA 3W6VA 1ZK8A 1S7EA 4W97A 5J1RA 3JRBA 3ZQGA 3MKLA 1JKRC 2GLOA 4X6AJ 1U9OA 4MLOA 2NVYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A6I A;  3HDD A;  1WH5 A;  2L9R A;  1JKO C;  2XPW A;  3OSG A;  2NVX J;  1UG2 A;  1QPI A;  2DMQ A;  1G2H A;  3G1L A;  2MW8 A;  3NAU A;  1AU7 A;  2GM4 A;  2L0K A;  1HF0 A;  1ZQ3 P;  1MH4 A;  2LVS A;  2E1O A;  3A03 A;  3RZD J;  1GDT A;  4NDL A;  3RQI A;  1JGG A;  2H8R A;  2I10 A;  4D5F A;  5F04 A;  1K83 J;  3LSP A;  2ZB9 A;  4A3E J;  1ZGW A;  2L7M P;  4XRM A;  5F0C A;  3LOC A;  2X6O A;  3BTL A;  4J19 A;  4A3G J;  3HEF A;  4JX5 A;  3SJM A;  3O8H A;  2O9L A;  3K2A A;  3GBG A;  5IYC J;  4DYQ A;  1VND A;  1RPW A;  2HI3 A;  3LSR A;  4DZJ A;  3JRD A;  3OOU A;  3L1P A;  1DU6 A;  3BTI A;  4Y7N J;  1RET A;  1IUF A;  3M4O J;  2FQ4 A;  1IV6 A;  4MO7 A;  3LNQ A;  3CDL A;  1U9N A;  2Y9Y A;  1XG1 A;  4QSH A;  4IHX A;  2CJJ A;  1MSF C;  1ETQ A;  4A3D J;  3JR9 A;  4FCY A;  3ZQF A;  4BKX A;  2JMW A;  1RKW A;  3FKI J;  2XB5 A;  1OJL A;  1I3Q J;  1IC8 A;  3E7L A;  1JJ6 C;  3GTP J;  2X9D A;  2DMU A;  1TWG J;  4JP0 A;  5K7Z A;  2R5Z A;  5FKO A;  3FIS A;  4FTH A;  2VKE A;  4BBS J;  1GV5 A;  4EEF G;  5C44 J;  5E3N A;  1HOM A;  3VPR A;  2XGC A;  2JWT A;  1MBE A;  5K7H A;  4A3I J;  5IYB J;  1MH3 A;  1R9T J;  4AC0 A;  1ETV A;  2X48 A;  1FJL A;  3H3V K;  5FLV A;  1JTY A;  4C3I J;  3ZQL A;  3RKQ A;  5JLX A;  3JRG A;  2E2J J;  2JA5 J;  2DMN A;  4V2F A;  3JRH A;  5IOY A;  1VF9 A;  1FIA A;  2ECC A;  5M3M J;  2R0Q C;  1MBH A;  1AKH B;  5EF6 A;  3CMY A;  2HQ5 A;  2L7F P;  1AKH A;  4FIS A;  3HOZ J;  3O8G A;  1FTT A;  3PO3 J;  3ZQI A;  2K9S A;  4UUT A;  2EQR A;  2CQQ A;  1Q1V A;  4UUS B;  3IH3 A;  1U78 A;  2P81 A;  4JX6 A;  4UUS A;  1BW5 A;  2YUS A;  1I50 J;  3BTJ A;  1JUM A;  1X2M A;  2EH3 A;  4MFD A;  3G1O A;  2D5V A;  3Q3S A;  1PUF B;  1HDP A;  3S15 J;  2M8G X;  3BR3 A;  4QTR A;  1FEX A;  4C3H J;  1HCR A;  4DZP A;  3ZQH A;  3BQZ A;  2JJ7 A;  4BY1 J;  1A5J A;  3H0G J;  3HM5 A;  1ZKG A;  2YS9 A;  1H88 C;  5F0F A;  1JJ8 C;  1VI0 A;  2Y0S N;  3JRF A;  2R93 J;  1T33 A;  4A3J J;  1XC5 A;  4M3E A;  1LFU P;  4DW6 A;  1X58 A;  3HB9 A;  2MGQ A;  3TW7 A;  2Y2Z A;  1GT0 C;  1CQT A;  4MFE A;  4DYC A;  1TWC J;  4JYK A;  1WH7 A;  4G12 A;  1AHD P;  1IG7 A;  3S2D J;  3BTC A;  2R7Z J;  5GP9 A;  2Y30 A;  3HOX J;  2JA7 J;  2W48 A;  3BG3 A;  2ELK A;  2JK3 A;  2M0C A;  4RDU A;  1LFB A;  2EZH A;  2CRG A;  1Y1W J;  5F1J A;  2CU7 A;  3TED A;  1LE8 B;  2TRT A;  5FJ8 J;  5M3F J;  1LE8 A;  2CQX A;  3SFI A;  4A3K J;  2E2I J;  2OPT A;  3WHC A;  2NVQ J;  2DA7 A;  4RBO A;  4Y52 J;  2LY9 A;  1TWA J;  1O4X A;  3S16 J;  2ID3 A;  1ETO A;  3BT9 A;  5IP9 J;  5EYR A;  3D1N I;  3HOW J;  2DA4 A;  1U8B A;  2HDD A;  2XB0 X;  4W1U A;  3BR5 A;  4B1R A;  2WB1 N;  3TW6 A;  3DEW A;  1JT6 A;  4A3B J;  3TP3 A;  2NS7 A;  3IH2 A;  1I6H J;  2EZK A;  2DA6 A;  4AYB N;  3HOY J;  2DTZ A;  3FIW A;  2M34 A;  4V2G A;  1OCP A;  4XRS A;  1FTZ A;  4GFB A;  5M5W J;  1NTC A;  3BR2 A;  3MVP A;  2ME6 A;  2LD5 A;  3I4M J;  3DCF A;  5EGO B;  4M3B A;  1JT0 A;  5EGO A;  2H1K A;  1MNM C;  2DA1 A;  3JRA A;  3K7A J;  2JA8 J;  2LLK A;  1WCM J;  2LR8 A;  2COB A;  2DMP A;  2IAI A;  1EF4 A;  2VI6 A;  1H8A C;  1BA5 A;  4A3C J;  1T56 A;  2DMT A;  2LFB A;  1K61 A;  5DS9 A;  5J3L A;  2VKV A;  1GVD A;  3S14 J;  2GBY A;  5FKN A;  4D5C A;  3C2B A;  3GTL J;  1ZR2 A;  4IEJ A;  2WAQ N;  2EBI A;  2ID6 A;  2XPU A;  4A3M J;  5FLM J;  2KDZ A;  3S1M J;  1P7J A;  1B72 B;  1BL0 A;  2CUF A;  1MBJ A;  4XRS G;  5JLW A;  1B72 A;  5EZH A;  2WV1 A;  1VFC A;  1NK3 P;  1Z0X A;  2O7O A;  2FX0 A;  3BR0 A;  5IPA A;  1B8I B;  3A01 B;  1HDD C;  2VUM J;  1QVU A;  5C4X J;  2EZI A;  2KT0 A;  1B8I A;  1F43 A;  4HNV A;  1W0U A;  1APL C;  1ETY A;  5IP7 J;  5J1U A;  1H89 C;  2VPR A;  2DA2 A;  5K7F A;  2E2H J;  5F27 A;  1FIP A;  5EG0 B;  2K9N A;  1MBF A;  2EZL A;  2OF7 A;  2IEK A;  1PUF A;  4QIW N;  2NOG A;  3IH4 A;  2G0E A;  3B6C A;  5EZG A;  3HKZ N;  1HLV A;  4C2M J;  3GTO J;  1ZR4 A;  3S2H J;  3GTJ J;  4I6Z A;  3PM1 A;  2YU9 J;  4FE4 A;  3BQY A;  4B3A A;  2FJ1 A;  2XGD A;  3JRE A;  2R5Y B;  3QQA A;  3Q0V A;  1BJZ A;  3FK6 A;  1ETW A;  4BY7 J;  2LTP A;  2K40 A;  2R92 J;  4CYC B;  5FKM A;  5BNG A;  4DYR A;  3RZO J;  4CYC A;  2FD5 A;  2N8G A;  1ORK A;  4AUX A;  5J1Y A;  1UMQ A;  2XSD C;  1P7I A;  5IYD J;  2O8K A;  2M9H A;  2IBD A;  1MBG A;  4A3F J;  2E19 A;  3CQZ J;  4A3L J;  4L5E A;  4BBR J;  3BG5 A;  2K9Q A;  4D7M A;  4LOC A;  1ZTR A;  2NS8 A;  3HGG A;  3SDG A;  1POG A;  2LKX A;  3LSJ A;  1IDY A;  3QPS A;  2XRL A;  1GUU A;  4M3F A;  1Y1V J;  4IHV A;  1GV2 A;  3WHB A;  2XGE A;  4XIC A;  4A69 C;  1JTX A;  1SFO J;  1JUP A;  1JUS A;  2RAE A;  4IHY A;  5HOD A;  2QCO A;  1JKP C;  5C4J J;  3GTG J;  3ZQC A;  3BG9 A;  3Q0U A;  2DN0 A;  4C3J J;  2JN6 A;  3MN2 A;  4MIM A;  3M3Y J;  5E3O A;  1E3O C;  1F36 A;  1ENH A;  3IV5 A;  1JKQ C;  1TWF J;  4I76 A;  5F08 A;  1OFC X;  3B6A A;  5C3E J;  1TWH J;  1ITY A;  2Y9Z A;  3I4N J;  2CUE A;  2LP0 A;  3Q0W A;  3HOU J;  2HXO A;  1X2N A;  5E3M A;  3BR1 A;  9ANT A;  2HYJ A;  3NAR A;  3S1N J;  1WGX A;  4B4C A;  1RKT A;  1IJW C;  4IHW A;  3GTQ J;  3S1Q J;  1W0T A;  1Z77 A;  1IRZ A;  4S0H B;  1UHS A;  5E3L A;  2B63 J;  5F0H A;  2LK2 A;  2R5Z B;  2MG4 A;  3HOV J;  3S1R J;  4X1E A;  4D7N A;  1YRN B;  3CCY A;  1IGN A;  5GPC A;  1QVT A;  3OSF A;  1YRN A;  1WI3 A;  3HGY A;  1WPK A;  5IP6 A;  3JRI A;  3ZOB A;  1BW6 A;  3GTK J;  3QPL A;  5M5Y J;  4A93 J;  1ETK A;  4JX4 A;  3A02 A;  4FE7 A;  3TP0 A;  5EDN A;  1QRY A;  2JA6 J;  2TCT A;  3S17 J;  2XPV A;  4M3G A;  5DTD A;  2M2E A;  5GPA A;  2HOA A;  4XK4 A;  1RR7 A;  4XID A;  1OCT C;  2AHQ A;  2DJN A;  2MSY A;  4M6V A;  3BR6 A;  3LSG A;  3A01 A;  3PO2 J;  3G1M A;  2HXI A;  2DA3 A;  2Y31 A;  5M5X J;  3F0C A;  1DU0 A;  1NK2 P;  4BXX J;  1RES A;  2DA5 A;  1ETX A;  2HOT A;  1XS9 A;  3GTM J;  2ECB A;  4M3D A;  2HOS A;  2L7Z A;  5EG0 A;  2ME0 A;  1D5Y A;  2NVT J;  1MBK A;  1SAN A;  1TC3 C;  1IDZ A;  3JRC A;  2PMZ N;  5IOZ A;  3OIO A;  5EEA A;  1MSE C;  4ABZ A;  2QF7 A;  5FKK A;  3HBL A;  2AO9 A;  5FKL A;  3UKG A;  3FK7 A;  2R5Y A;  3W6V A;  1ZK8 A;  1S7E A;  4W97 A;  5J1R A;  3JRB A;  3ZQG A;  3MKL A;  1JKR C;  2GLO A;  4X6A J;  1U9O A;  4MLO A;  2NVY J; 
#chains in the Genus database with same CATH topology
 4B09 A;  4BQA A;  3CDH A;  3HOS A;  2NVX J;  3QOD A;  3G4S I;  4LG0 A;  2DJI A;  3G1L A;  5KCM A;  3VOD A;  1AU7 A;  2DDB A;  2HYG D;  5ED4 A;  2L0K A;  2BV6 A;  3ELK A;  2E1M C;  2IGN A;  2E1O A;  3K4M A;  3GW2 A;  3TOA A;  2Q8K A;  4AIK A;  1ON2 A;  3GCM A;  4A3E J;  5HS7 A;  2L7M P;  1LKX A;  2M4G A;  2W84 A;  3V7R A;  3TQN A;  2BE5 F;  4RGX A;  2FNP A;  3ZMS A;  2WY7 Q;  2O9L A;  3K2A A;  4ANJ A;  3EUA A;  5IYC J;  1TQM A;  1MMS A;  4FT8 A;  1RNL A;  4F91 B;  3CCU I;  4HF2 A;  3FM5 A;  2NS0 A;  4DYQ A;  1VND A;  4RA2 A;  3BP8 A;  1X19 A;  1ZAR A;  1N78 A;  5IT9 K;  4G6Q A;  1SMY F;  3KZY A;  1R23 A;  2BOL A;  4XOT A;  3W6J B;  4HX4 A;  5TJJ A;  1XGN A;  5J8C A;  3C18 A;  1IXR C;  5KVR A;  3RKY A;  1LEA A;  4I09 A;  2FQ4 A;  4LGW A;  2FNA A;  3LNQ A;  3CDL A;  5HDG A;  2P5V A;  5B3S H;  1U9N A;  2EV6 A;  1Z1D A;  4KIC A;  2HEO A;  4HLX A;  4ESB A;  4IHX A;  2CJJ A;  2E5N A;  4A3D J;  3JR9 A;  3H9J A;  3BC8 A;  1BC8 C;  3KE2 A;  2JMW A;  2K4J A;  3FKJ A;  3LQQ A;  3FKI J;  2FQ3 A;  2VBW A;  2DT5 A;  1TQP A;  2X9D A;  5K7Z A;  4MEY F;  5FKO A;  3FIS A;  1ONV A;  4F52 A;  3L9F A;  4FTH A;  1S3J A;  3ERE D;  3FZV A;  2VB6 A;  4IKF A;  3M07 A;  1I39 A;  2W1O A;  1JHH A;  5E3N A;  4CZZ A;  1TL8 A;  1V5E A;  1U0J A;  4BEH B;  4UY8 I;  3WG9 A;  1MMA A;  4BJ5 C;  1Z3X A;  5IYB J;  2NNY A;  1R9T J;  4ETS A;  3X2Q H;  4AC0 A;  4XBF A;  4AWX B;  1FJL A;  3GF2 A;  3Q9V A;  3RCO A;  4U7B A;  1LQ1 A;  5DDG A;  3DPU A;  3BRO A;  4E7Z A;  3U9G A;  5HS8 A;  4XLN F;  2CUJ A;  3BG6 A;  3TKY A;  3H5R A;  1MD0 A;  3K69 A;  1FMV A;  2R0Q C;  1SC7 A;  3QPH A;  1TNS A;  1QZY A;  2L7K A;  1T38 A;  2EFQ A;  3KYC B;  2IGO A;  1FTT A;  1D1C A;  4MTD A;  1X3W B;  1K78 A;  3PO3 J;  2DK8 A;  1QU3 A;  3HTU A;  2LBF B;  3IH3 A;  4EGY A;  1CF7 B;  3ZPL A;  2DAO A;  1BW5 A;  1JGS A;  1I50 J;  3DBL B;  1K79 A;  4B43 A;  2K9M A;  5E20 A;  2RQQ A;  3SZG A;  1HDP A;  4XOP A;  3DLA A;  3BR3 A;  1FEX A;  5DYM A;  4E7J A;  5IT3 A;  1RUN A;  4L18 B;  2JJ7 A;  4KN4 X;  3DU6 A;  1DDN A;  3TO9 A;  2KJB A;  3J81 Z;  1A5J A;  3H0G J;  4F93 B;  4I99 C;  3M8E A;  3AG2 H;  1UZC A;  2ZXW H;  1JJ8 C;  1P92 A;  4AVZ A;  5AIQ A;  3S3M A;  1E17 A;  4IOA F;  4A3J J;  2X6W A;  5H6Q A;  1I6X A;  3CJN A;  2KRC A;  4CYD A;  3DKY A;  3HB9 A;  1X1A A;  3TW7 A;  1WJA A;  2OCC H;  1CQT A;  1LEB A;  5D6F A;  5K5O A;  2P0W A;  5ICE A;  2RC4 A;  5JVG F;  2HPI A;  3BTC A;  4XN3 A;  2R7Z J;  2VT2 A;  4ASN A;  4BQO A;  2P6S A;  2JK3 A;  3NQO A;  2JZY A;  3MKY B;  1T6S A;  1T0F A;  2CRG A;  4EJW A;  3LST A;  2DT7 B;  3HXL A;  2GZW A;  1R7J A;  2KFD A;  3BJ6 A;  3DPT A;  3BCB A;  5HDK A;  3GLL A;  3SFI A;  1QO0 D;  3L7W A;  2MC4 A;  4A3K J;  4XNF A;  2WAE A;  2DA7 A;  3I58 A;  3DWL E;  3OS0 A;  3CJT B;  2Z3Y A;  3PL8 A;  4M6Y A;  3PIO F;  1A36 A;  4L5J A;  1XCB A;  1O4X A;  3S16 J;  3T1B A;  1ETO A;  5IP9 J;  4MNU A;  1WJ5 A;  4W1U A;  3BR5 A;  2OU2 A;  2OTJ I;  2HVS A;  1SMT A;  2MAB A;  3E5X A;  4PJ0 C;  4B48 A;  5GAG J;  3ZQQ A;  2VBY A;  5LBQ A;  2EIK H;  4V2G A;  1VQ7 I;  3PQK A;  4XRS A;  5L3C A;  1IV8 A;  2ME6 A;  2RGV A;  3PSI A;  4A6E A;  3DCF A;  2L9S A;  4YFX F;  2LOO A;  3TL4 X;  5EGO A;  2OJE D;  2V9V A;  3FMR A;  2QSG X;  1FPQ A;  3SZT A;  2JA8 J;  1ZGA A;  4MTE A;  1ZRF A;  1W36 D;  4DOZ A;  3O3K A;  1KQ8 A;  5LLQ A;  5D6E A;  2PG4 A;  2ZSI B;  4A3C J;  3F8N A;  2BY3 A;  2E7W A;  4UVB A;  3PUB A;  1T39 A;  2EIL H;  3EET A;  2D1V A;  1S9H A;  1BOB A;  2GBY A;  5TGT A;  4KT6 A;  3BZ6 A;  3R4K A;  1ZR2 A;  4IEJ A;  2V1D A;  1SD7 A;  2ID6 A;  1KU3 A;  3DTE A;  4LB5 A;  4RMN A;  4UUV A;  4CDG A;  1MBJ A;  5L3B A;  1Z6T A;  4E7K A;  5EZH A;  1KYW A;  2WV1 A;  3S3N A;  3I64 A;  4RB2 C;  4IRI A;  1A6Q A;  2FX0 A;  2ESN A;  3HIF A;  5L3E A;  1O7L A;  1J2X A;  1J75 A;  4B3X A;  4IRH A;  4RGS A;  2R7R A;  1YX5 A;  3A01 B;  2VUM J;  1QVU A;  1F43 A;  4HQE A;  1CF7 A;  1TT0 A;  1ETY A;  4ENM A;  3I59 A;  2K5C A;  2VQL A;  3QOE A;  1H89 C;  4MHG A;  1F5T A;  2CG4 A;  4ZTF A;  4I98 B;  3JAM Z;  5EG0 B;  2K9N A;  4P9F A;  4WCG A;  3JTG A;  2BY2 A;  4S05 A;  4IHS A;  2V79 A;  1STZ A;  3DKW A;  3IH4 A;  4ZYE A;  2CUZ A;  1ZAO A;  2F5F A;  2EV0 A;  4WWC A;  3WG7 H;  3GTO J;  5BQT A;  2HS5 A;  2M45 A;  2W25 A;  3KEY A;  1WJE A;  1IUY A;  1HSJ A;  4FE4 A;  3P7N A;  4A5M A;  2WV0 A;  3JRE A;  2H94 A;  2R5Y B;  1O7F A;  3QQA A;  4NBQ A;  2L54 A;  2ZKZ A;  1MGT A;  1RC9 A;  3VB2 A;  3VWB A;  2JPC A;  3FK6 A;  4BY7 J;  1EJ9 A;  1KZH A;  2NXN B;  2XF6 A;  4Y13 A;  1G59 A;  4BAC A;  2KIM A;  1FYK A;  5LHI A;  3ABU A;  4YFN F;  3HG9 A;  3V8L A;  1ORK A;  5IYD J;  2O8K A;  2M9H A;  3T8R A;  4AM3 A;  3D5S C;  3OIP A;  3DP7 A;  2Z9O A;  4A3L J;  1J09 A;  1UJ8 A;  3HYI A;  2DOF A;  2EA2 A;  3MZY A;  2XGE A;  1UEL B;  1R4N B;  3MQ0 A;  4PJJ A;  2A5Y B;  2XKP A;  1FBS A;  1OCR H;  1RZ4 A;  4HV6 A;  3F72 A;  2EV5 A;  3CD6 I;  4IL6 C;  3L2W A;  1JKP C;  5C4J J;  1L0O C;  3ZQC A;  2Z5U A;  1R5G A;  3MEX A;  2FML A;  3H35 A;  3FX3 A;  2CW8 A;  2CQN A;  2K3F A;  2VJJ A;  1SVM A;  4PGG A;  4E7H A;  2MBF A;  5FLX K;  3WTX C;  5E79 C;  4HEA 2;  5ILV A;  1OFC X;  5J4V A;  1I1S A;  2CFO A;  5HNH A;  5CVU A;  3MMY B;  2CUE A;  4GYI A;  3OV8 A;  4L0Y B;  3NAR A;  2DTR A;  1YW8 A;  3CCL I;  1MJB A;  2IT0 A;  3S1N J;  1DGR M;  3KPH A;  2I5U A;  3P9K A;  1X1B A;  1ULY A;  4S0H B;  1J9I A;  1HST A;  5E3L A;  4O6J A;  4OIN F;  4AID A;  2LK2 A;  2M7B A;  2R5Z B;  2F4O B;  4AD9 A;  3CCR I;  3BPX A;  1VQ9 I;  1WJB A;  1WQ2 A;  2K3P A;  2V7F A;  5GPC A;  3H5A A;  2LKS A;  2YR2 A;  3GXO A;  4BNC A;  3HGY A;  1WPK A;  1FY7 A;  3CZ6 A;  2LDU A;  2JQ7 A;  4MQV A;  3ROU A;  2OV7 A;  4RGU A;  3ABL H;  1NHA A;  1BC7 C;  5FRM A;  2XF5 A;  5IY5 H;  5TIS C;  4C30 A;  4O3M A;  1HA8 A;  1X4O A;  3OR1 C;  3TP0 A;  5EDN A;  2JA6 J;  2IGK A;  2TCT A;  3LWF A;  2XPV A;  2QM3 A;  4NC6 A;  3OIQ A;  4XK4 A;  3QWL A;  4XID A;  4OWR B;  2DJN A;  4M72 A;  4BE0 A;  2O5R A;  3BR6 A;  2ICW G;  3A01 A;  4L9J A;  3PO2 J;  1IN6 A;  5M5X J;  4BE2 A;  1X1P A;  3CO7 C;  1XS9 A;  3GTM J;  3MAJ A;  2HOS A;  3NWT A;  1RR8 C;  6PAX A;  5EG0 A;  2OZ6 A;  5L3F A;  1FMW A;  1VQL I;  5CKT A;  4XL9 A;  3HPH A;  3UR3 C;  3CLO A;  4LIU A;  2X6Y A;  1AOY A;  1ZLJ A;  1FYL A;  3BCA A;  4BGD A;  1ZH5 A;  5EEA A;  2D45 A;  5DD4 A;  1NH3 A;  1MSE C;  1EKE A;  4KT5 C;  5FKK A;  1ZN2 A;  4G7H F;  2WAQ A;  1OYY A;  3KLO A;  2EIJ H;  3JSP A;  4WX9 A;  2AXT C;  2R5Y A;  2VQH A;  1FOX A;  1S8N A;  2VPL A;  2IP2 A;  3ECO A;  4W97 A;  1Y39 A;  1FOK A;  3W6V A;  5ILU A;  1BBY A;  2DOA A;  4HV5 A;  1MW7 A;  2NRA C;  1UHM A;  4HOB A;  3IKV A;  1A6I A;  4X0G A;  1HW2 A;  3GVA A;  2KL4 A;  3OS2 A;  2XPW A;  2HZD A;  4LG0 B;  1UG2 A;  2CWE A;  3ONQ A;  1QPI A;  2BW3 B;  3ULQ B;  2OBP A;  2DMQ A;  4EVI A;  1G2H A;  2NVU B;  4M73 A;  3PNY A;  4XR6 A;  2E71 A;  1VQO I;  2IS4 A;  2HQA A;  3NAU A;  5HDN A;  4A0X A;  1YS6 A;  1W7P D;  2Y75 A;  5KAF C;  3ERM A;  3I71 A;  4IF4 A;  3JAM K;  3RZD J;  4NDL A;  1HQC A;  2I10 A;  3DTI A;  3H5N A;  3HKZ A;  2J5P A;  2QQ8 A;  5F0C A;  3LOC A;  3H0D A;  5LGT A;  2NYX A;  1VQM I;  2JUC A;  3L2Q A;  3GBG A;  3DBR B;  2XVC A;  3KET A;  4DZJ A;  3E5Q A;  5J8F A;  2L9V A;  4BUP A;  1UHW A;  1Z21 A;  1LJ9 A;  3TMO A;  3QAH A;  4Y17 A;  3OL4 A;  1RET A;  2MH9 A;  1LVA A;  4LLN A;  1MNE A;  3K9T A;  1DPU A;  2ISZ A;  2JA2 A;  2B9S A;  4HA8 A;  3K70 C;  4LD5 A;  2GIV A;  1XG1 A;  1QQI A;  4QSH A;  5DM6 F;  4C2T A;  1ZGJ A;  2DCE A;  5ICG A;  3COA C;  3KEQ A;  3M9A A;  5KNL A;  1Z3Y A;  5JHF A;  2PBI A;  4OIQ F;  5E17 F;  4EM0 B;  1TWG J;  4JP0 A;  1BN5 A;  3TO7 A;  2R5Z A;  4F7Z A;  4UB6 C;  3GX4 X;  3PJR A;  3M7G A;  4HNU A;  3B02 A;  3TBI A;  1W5T A;  2K9L A;  4LK1 F;  3E6C C;  3OYB A;  1S5L C;  2FBK A;  5C44 J;  5F64 A;  2F4M B;  1HOM A;  3GFL A;  3VPR A;  2XGC A;  1MBE A;  3KCC A;  2CS3 A;  1ZYR F;  3ZGK A;  1S72 I;  1MH3 A;  4E6K G;  3RKX A;  5D4S A;  3ZMU A;  1FSH A;  2X48 A;  5FLV A;  3KLN A;  4CCK A;  3ZQL A;  5JLX A;  3LSK A;  2JA5 J;  2M87 A;  4BHP A;  3JRH A;  2ZNZ A;  3I9V 2;  3OYF A;  2HOE A;  2ECC A;  1G4D A;  4A0Y A;  1MBH A;  1WI9 A;  3VFZ A;  3CMY A;  2L7F P;  2X1E A;  2JT1 A;  3HPG A;  1R1T A;  1K78 B;  2FU4 A;  4FIS A;  4FQG A;  3HOZ J;  1TW3 A;  4XRF A;  3ZQI A;  2YX7 A;  4ZTJ A;  2DOD A;  3GZ5 A;  2K9S A;  4WXD A;  1VQ4 I;  2EQR A;  3E6D A;  2BVM A;  2CQQ A;  4GYG A;  2DPU A;  2UXN A;  1D0X A;  1GVJ A;  2P81 A;  2GOX B;  4JX6 A;  1IRX A;  3WE2 A;  4EM2 A;  3AG3 H;  4NHJ A;  5FB2 A;  2QQ9 A;  1JUM A;  2EH3 A;  3ASN H;  4HZF A;  5CYV A;  1FSE A;  1WZ2 A;  3Q3S A;  4M9Z A;  3ASO H;  2KIQ A;  2YPR A;  3DF8 A;  5D4R A;  2M8G X;  2A05 A;  1UB9 A;  1HCR A;  4PUS A;  4EGZ A;  3HL2 A;  2PMU A;  2P5L C;  2UUZ A;  5E1Z B;  4BY1 J;  5E1W A;  4DJA A;  3QRF F;  1O3R A;  2BXY A;  2YS9 A;  1H88 C;  1F9N A;  3VDX A;  1J7K A;  2QGU A;  3OY9 A;  2X4H A;  2JSP A;  2BW3 A;  4M3E A;  3HTS B;  2W00 A;  4DW6 A;  4LJZ F;  2DDA A;  2L4A A;  3SZP A;  4HNT A;  5B66 C;  1V5F A;  2K7L A;  2O0Y A;  4IXA A;  1IZ1 A;  5LD2 C;  3BY6 A;  1WH7 A;  4G12 A;  5FRO A;  3V4G A;  4HAM A;  3ZMT A;  4R79 A;  5CQE A;  3OYN A;  3GFI A;  3R60 A;  2ETH A;  3EDP A;  2W48 A;  2JRT A;  4CZC A;  1W36 C;  1VQP I;  4NC7 A;  3GLX A;  3Q9S A;  2DBB A;  4O5V A;  3H9Q A;  3PQJ A;  2EZH A;  1Y1W J;  2CU7 A;  3TED A;  5DUI A;  4OAY A;  4LMY A;  1RRJ A;  5FJ8 J;  1Z7L A;  2IRF G;  4KA4 A;  4BQQ A;  2W85 A;  2QSH X;  4BL0 B;  4HF1 A;  1OKR A;  2DOE A;  1TWA J;  2UV1 A;  2WAD A;  2EB7 A;  2XDV A;  1QZE A;  4R8H A;  5H2F C;  3HOW J;  3VSK A;  1KGS A;  3A2K A;  2XB0 X;  2ZBK A;  2TDX A;  3TOB A;  3WTW C;  3TW6 A;  2VE9 A;  3DEW A;  5J40 A;  3TP3 A;  2NS7 A;  3KFW X;  4IZZ A;  2X1D A;  1W1W E;  3NWS A;  3HOT A;  1GLN A;  3IL2 A;  1G3S A;  5FD6 A;  1OIS A;  3RQ4 A;  4V19 K;  1OCP A;  1FTZ A;  1WKM A;  2OAZ A;  4CH7 A;  5DV5 A;  2RRE A;  2WC2 A;  2DO7 A;  3MVP A;  4A2U A;  2OCE A;  4NQW A;  2LD5 A;  5B5E C;  2M4K A;  5EGO B;  1ON1 A;  1UG0 A;  3QU6 A;  4BHC A;  4BQN A;  1JT0 A;  4RAF A;  1XDU A;  3E6M A;  3F8C A;  1ODD A;  4CUG A;  1TW2 A;  1T2K A;  5EEH A;  4LB6 B;  2COB A;  4HRI A;  2ADU A;  2DMP A;  1WFX A;  2O6G E;  1EF4 A;  2A3S A;  2F5E A;  1T56 A;  2LFB A;  1EA3 A;  2K85 A;  5BPD A;  5J3L A;  2VKV A;  3M8F A;  1XMA A;  4LIT A;  1GVD A;  3KP7 A;  2D2W A;  2X51 A;  4PFP A;  5D5V B;  3TDZ C;  4A6D A;  1I5Z A;  4LLG F;  3GTL J;  1P6R A;  2WAQ N;  3KP4 A;  4A3M J;  1FBU A;  2DK5 A;  2KDZ A;  4G94 A;  4IHT A;  1W7P A;  2CUF A;  4UV9 A;  2R3S A;  5JLW A;  2V1N A;  2JUG A;  2X85 A;  1IN5 A;  2O8X A;  2QLZ A;  2ZFW A;  1UAA A;  2VOP A;  5AIP A;  1Z0X A;  4Y4R A;  5IPA A;  2KZG A;  1L3L A;  4IPA A;  3F6O A;  3OYM A;  2KT0 A;  5FFX A;  4L9V A;  3I59 B;  3WTY C;  5IP7 J;  3GME A;  2KMU A;  2ZSH B;  2IA2 A;  1F4K A;  1C0W A;  2L9N A;  2DFH A;  4JK1 X;  2VN2 A;  1B9M A;  3IAS 2;  3ZMV A;  3P9C A;  2R4G A;  3IP4 B;  3L00 A;  4JOM A;  2CMP A;  4BHB A;  2GA2 A;  2R7U A;  4HPQ A;  3HKZ N;  5EZG A;  5FGM A;  2IS2 A;  1R5I D;  1X3Z B;  3K1P A;  3GTJ J;  2E35 A;  5D5U B;  2YU9 J;  3SQN A;  2XGD A;  4PJM A;  2QWW A;  2Z99 A;  4HF0 A;  5F1R A;  4IOC F;  2RKH A;  2EFN A;  2K4B A;  1BJZ A;  3CTA A;  4RGR A;  1BJA A;  2A6H F;  1SD5 A;  3H3Z A;  5FKM A;  4DYR A;  3RIR A;  2Z33 A;  2M5W A;  3DTK A;  4CYC A;  2A61 A;  3K10 A;  3I0T A;  2N8G A;  1I3A A;  4M6X A;  5J1Y A;  4NB5 A;  2K27 A;  1X3U A;  2ZXJ A;  4PFO A;  1MBG A;  4DIQ A;  4A3F J;  2VJI A;  3CQZ J;  4BBR J;  2K9Q A;  1Z67 A;  2ZJP F;  3SDG A;  1EV7 A;  4OMY A;  3QPS A;  1D1A A;  2OUM A;  4M3F A;  2F5D A;  1G6N A;  1GV2 A;  4BXF A;  3F21 A;  1SFX A;  1TZL A;  2HR3 A;  3KYD B;  3E5U A;  2R7X A;  1R22 A;  5LHG A;  4FHT A;  4PK4 A;  1SFO J;  1JUS A;  5FRN A;  1OMI A;  2RAE A;  2CGP A;  1T95 A;  3GTG J;  3IRR A;  1HKQ A;  2P6T A;  3BZK A;  3OOP A;  3CMM A;  2ELH A;  2Y0S A;  4DGW B;  1EH6 A;  3Q0U A;  3E0J B;  5CPR B;  4MIM A;  1OYW A;  3H9G A;  3SHF A;  1BI3 A;  4RAY A;  1KU7 A;  3L2V A;  2A6E F;  1ENH A;  3IV5 A;  1JKQ C;  1MMN A;  1TWF J;  1YE9 A;  4G9Y A;  4ZDL A;  5F08 A;  3K4L A;  1YO5 C;  3SDB A;  2DW4 A;  5C3E J;  2G7U A;  1V54 H;  1D8K A;  1ITY A;  2XAQ A;  2FBI A;  3I4N J;  5JI6 A;  1XGM A;  3T5X A;  1X2N A;  3ZR8 X;  5E3M A;  3AL0 B;  4YFK F;  1R6R A;  5K5R A;  2HDW A;  3LFU A;  2AQE A;  1FYM A;  3HHG A;  1W0T A;  4P96 A;  1Z77 A;  2HGC A;  1FP1 D;  2QQA A;  4KUM A;  3J7Y J;  2EJR A;  3W6K B;  4CO8 A;  5DCM A;  1U2W A;  2MG4 A;  3QOP A;  2LC2 A;  4YEJ A;  3S93 A;  1FP2 A;  4WK8 F;  2PFB A;  4X1E A;  4D7N A;  1IAW A;  1YRN A;  4RM2 A;  3LFK A;  5L3G A;  3GZ6 A;  4HW0 A;  5IP6 A;  4HYE A;  3GTK J;  1WJF A;  1WVR A;  3J7A O;  4UVC A;  4A93 J;  1FZP B;  2R7W A;  2XAU A;  3ABK H;  2OA4 A;  3A0H C;  1LDD A;  1EH7 A;  2ZME A;  3JW4 A;  5DD8 A;  3WU2 C;  3S17 J;  3K4J A;  5GPA A;  2LYC A;  1Q1H A;  3CCV I;  3T8T A;  1XSD A;  2MSY A;  4HX7 A;  4II3 A;  3EUH A;  5GTH C;  3GZN B;  4G6T B;  4UVA A;  2VC0 A;  5CQG A;  1XB4 A;  3G1M A;  5BS6 A;  4F92 B;  2XKO A;  1DU0 A;  3LSH A;  3G73 A;  2VOO A;  4RLF A;  3RKW A;  2HOT A;  4P1W A;  2ECB A;  5HLI A;  2V6C A;  4XN0 A;  3ZRG A;  1G3W A;  2B0L A;  2PQ8 A;  2X0L A;  1BR2 A;  1IRF A;  1LNW A;  4EV0 A;  1YFH A;  1ACI A;  4OMZ A;  1SAN A;  2R7D A;  3DLL F;  3RI4 A;  2VAS A;  3KZI C;  2VBX A;  1YJN I;  3JRC A;  2PMZ N;  3OIO A;  1ZRD A;  3UNG C;  2QF7 A;  3HBL A;  2PJR A;  1K7A A;  1K6Y A;  2RNG A;  3UKG A;  4Y33 A;  4RAG A;  1XPX A;  2GXA A;  1OR7 A;  2DYS H;  2X1C A;  3OMY A;  4BYY A;  2FE3 A;  2QYO A;  3WTV C;  4R1H A;  3MKL A;  3LA2 A;  2GLO A;  5ICF A;  1U9O A;  3D0S A;  4EQQ A;  3PNV A;  3HDD A;  1J0R A;  1WH5 A;  2KPM A;  2IA1 A;  5D5X B;  2H27 A;  2PLY A;  2XF7 A;  5E18 F;  1W5C C;  1OCC H;  3ML6 A;  2ESH A;  2MW8 A;  2PI0 A;  2BEO A;  4BS9 A;  2KKO A;  3CJR B;  3H1C A;  4G6D A;  2DI3 A;  1HF0 A;  2R7F A;  3E3V A;  1ZQ3 P;  4CHU A;  1GDT A;  3A03 A;  3W2W A;  3RQI A;  1JGG A;  2H8R A;  4HLY A;  1T0F C;  1K83 J;  4CXF A;  3CCE I;  1G3Y A;  1QZZ A;  1FNN A;  2R7T A;  4IRG A;  2XAJ A;  4CGZ A;  3BTL A;  4Z6Y A;  4A3G J;  3J81 K;  4UB8 C;  3SJM A;  1FOY A;  5JHU A;  3E97 A;  1WRJ A;  3K0L A;  1H9G A;  3GEZ A;  1PDN C;  5CVI A;  3SEZ A;  3OR2 C;  1WJD A;  5HOO A;  3NRV A;  3OYH A;  2HI3 A;  3LSR A;  1P4A A;  2HYF A;  3JRD A;  4ZZD A;  3A1Y A;  3L1P A;  4RB3 C;  1SEU A;  5DUK A;  1K6O A;  1R36 A;  3BTI A;  3AKZ A;  5JFR A;  2HFH A;  3M4O J;  2XHK A;  3QP5 A;  3CJQ B;  1TLH B;  2K02 A;  3I55 I;  1IV6 A;  2HVQ A;  3HHH A;  4L9N A;  3OYL A;  3G71 I;  3J7Z I;  1YW9 A;  1MSF C;  4FCY A;  2AXL A;  4BKX A;  1RKW A;  2CH0 A;  2XB5 A;  1OJL A;  2XUB A;  4HDV A;  1IC8 A;  5LGU A;  1JJ6 C;  3AAF A;  2DMU A;  4ZZL A;  4ZH4 F;  3KIO A;  2VXZ A;  3RTR A;  4ZDP A;  4ENJ A;  1TNT A;  3DQV C;  3E1S A;  3P9I A;  3V8J A;  4FX0 A;  3SFZ A;  2VOD A;  4EM1 A;  4XKC A;  5K7H A;  2XIG A;  3O6B B;  3MKZ A;  3MCZ A;  3BG7 A;  1GHC A;  2WA0 A;  1ETV A;  3T0Y A;  2QVO A;  2KIF A;  4AU7 A;  1YG2 A;  2R7O A;  4C3I J;  2IW5 A;  3JRG A;  3RKQ A;  2E2J J;  4Y3O A;  3VOE A;  4U88 A;  5IOY A;  2UXX A;  2VIX A;  1VF9 A;  1FIA A;  2BVL A;  3C1D A;  5M3M J;  1J59 A;  3W2A A;  1HKT A;  2M0M A;  5EF6 A;  2HQ5 A;  1LVK A;  3FM3 A;  4M9S A;  2NOJ B;  1AKH A;  3O8G A;  2VQC A;  4GDF A;  4WXH A;  5B1A H;  3HZJ A;  4YIR X;  1XN7 A;  2DFF A;  4U87 A;  4UUT A;  4UHT A;  3FXR A;  5LRR A;  2JRM A;  3LMM A;  1Z05 A;  4ESF A;  3J7A Y;  1XTA A;  3CF2 A;  3WOD F;  4UUS A;  2OTL I;  2YUS A;  4RM3 A;  1VQ6 I;  2ZO4 A;  3EQL F;  2HKX A;  4L9T A;  4XLA A;  1QBJ A;  5FO5 A;  3ECH A;  2MA3 A;  2B7E A;  4MFD A;  2D5V A;  2XAS A;  3KP2 A;  2M1B A;  2COM A;  3HRU A;  2OC6 A;  2R7S A;  1OCO H;  2XRO A;  4DZP A;  3DU5 A;  3ZQH A;  3OWT A;  3BQZ A;  3LL7 A;  1PP7 U;  1R49 A;  3CC7 I;  3CC2 I;  3HM5 A;  5B1B H;  3G3Z A;  5HNF A;  3U1D A;  2EFO A;  2H6C A;  4I0B A;  1TTY A;  1VI0 A;  2GOM A;  2Y0S N;  4IJA A;  4RB0 A;  5LEK A;  3I4P A;  3JRF A;  3QYF A;  1FC3 A;  3CUQ A;  3QU3 A;  4M74 A;  1YOV B;  2RNJ A;  5HS9 A;  3RYR A;  1IF1 A;  1DQU A;  1GT0 C;  2Y2Z A;  4DQ2 A;  1XX5 A;  1IRG A;  4MFE A;  3CDI A;  4DYC A;  2V1U A;  5IT9 Z;  3WGI A;  1TWC J;  1AHD P;  1S7O A;  3R0J A;  4XQF A;  1MZB A;  1IG7 A;  1V4R A;  2WBM A;  3S2D J;  5GP9 A;  3SYT A;  1V55 H;  1FX7 A;  2UZK A;  3TDU C;  3BG3 A;  2ELK A;  2EA4 A;  2CV1 A;  1ZHF A;  3CUO A;  1LFB A;  1BI0 A;  3PIP F;  4JBA A;  4LLL A;  5F1J A;  2F2E A;  3C2H A;  3R0A A;  2QQB A;  3D5L A;  1MDM A;  1WSU A;  5AON A;  5BMZ A;  1LE8 A;  3HRT A;  1D0Z A;  2CQX A;  4PSX A;  5GAE J;  3LAP A;  2OPT A;  3WHC A;  4DBR A;  2ZCW A;  1BOA A;  4RBO A;  4H4K C;  4Y52 J;  1YLF A;  3L09 A;  2LY9 A;  4EJV A;  1XD7 A;  2CFX A;  2Z16 A;  2ID3 A;  3BT9 A;  2DA4 A;  2Q2E A;  4I02 A;  4B1R A;  2YU3 A;  1RIO H;  5GTI C;  1TT5 B;  2V26 A;  5KHD A;  1Z9C A;  4A12 A;  3V7S A;  4A3B J;  3AG4 H;  5EJC A;  1SVO A;  2H09 A;  3IH2 A;  3RYP A;  1I6H J;  1BM9 A;  2EZK A;  2MLG A;  3HOY J;  2DTZ A;  3ESW B;  5HLT A;  2Y69 H;  3FIW A;  2RDP A;  5CLS A;  2A69 F;  4GFB A;  4NQW B;  3FXM A;  1NTC A;  2VKD A;  5DEQ A;  3AL0 C;  1GXP A;  1HXD A;  3H92 A;  5J4Y A;  4C2U A;  3FMS A;  2RVC A;  4I01 A;  2G7H A;  1BR1 A;  3HRS A;  4OOI A;  1VQK I;  2H1K A;  1S7A A;  2HU9 A;  4II2 A;  3JRA A;  3K7A J;  2W4S A;  4KIF A;  2ZFU A;  1WCM J;  2LR8 A;  3U2R A;  2J5O A;  2IAI A;  4WXC A;  3K1M A;  4IQ4 A;  2W57 A;  2DXI A;  2LNB A;  1P9Q C;  2VJ4 A;  3S14 J;  1LB2 A;  4RB1 A;  1U5T B;  5FKN A;  4D5C A;  1BI1 A;  3C2B A;  4ZYG A;  1QNT A;  3F22 A;  1W7P B;  3C3W A;  5FLM J;  3S1M J;  3EUK L;  1AA7 A;  2FSW A;  3M8J A;  1BL0 A;  1G8X A;  4XRS G;  1B72 A;  1EH8 A;  1VFC A;  3N05 A;  2XRN A;  2IA0 A;  4EAT A;  3BR0 A;  4ZC3 A;  4I0A A;  3FBI B;  3KP3 A;  1XSV A;  3WTS C;  1H9T A;  2PEX A;  3HJE A;  1B8I A;  4HNV A;  3VYT B;  2VL8 A;  2LY2 A;  5J1U A;  2WWY A;  3LA7 A;  1HBX G;  1VQ8 I;  5K7F A;  2E2H J;  5F27 A;  1FIP A;  1WHU A;  2CSO A;  4LK0 F;  5K5Q A;  3RDI A;  4U0W A;  2OQG A;  2IEK A;  1AWC A;  2EIN H;  2NOG A;  2G0E A;  1G3T A;  1NG7 A;  4FET A;  3GO5 A;  1DGW Y;  1OPC A;  2O03 A;  2WY8 Q;  4C2M J;  1VQ5 I;  4BXU A;  4PJL A;  2XGX A;  2FEZ A;  1FBQ A;  4DNC A;  1ZR4 A;  3LSI A;  1UST A;  4XKB A;  3CES A;  3W2V A;  2RQP A;  4D9J A;  4EJU A;  4BJT A;  3RPQ A;  3E6B A;  3HUG A;  3WE3 A;  4CCJ A;  1ETW A;  4PDK A;  2LTP A;  4AVP A;  4GCV A;  4KIS A;  4CYC B;  2LSO A;  4BDZ A;  3RZO J;  4IO9 F;  2HTJ A;  2LF7 A;  4KYW A;  4CCM A;  3QYB A;  5CVJ A;  4XMY A;  4A5N A;  3CCM I;  1P7I A;  4B47 A;  5GAD J;  4F3Q A;  4BDY A;  2E60 A;  2IBD A;  3PFY A;  2PMZ A;  2E19 A;  5JVT A;  3GFJ A;  5HVQ C;  2KP6 A;  3VYS B;  3BG5 A;  2IJL A;  4D7M A;  4LOC A;  1ZTR A;  2NS8 A;  1XGO A;  3BJO A;  3BOQ A;  3K1N A;  1POG A;  2BGC A;  2FOK A;  2XRL A;  1GUU A;  1Y1V J;  4IHV A;  1FOW A;  1B1B A;  3WHB A;  4ENN A;  2YSR A;  2VLA A;  3WU1 B;  4G8X A;  1YI2 I;  2PN6 A;  4A69 C;  4N0B A;  4U7D A;  2LKP A;  2IVM A;  4Q48 A;  2D1H A;  2P7V B;  3BWG A;  2O3F A;  4DBQ A;  1JUP A;  1YJW I;  1O57 A;  2M8E A;  2QEN A;  4XLH A;  4IHY A;  2Y48 A;  4OIO F;  2QCO A;  1X4P A;  2MD0 A;  1HW5 A;  4IQJ A;  1VTN C;  4XM3 A;  4B44 A;  1KU2 A;  2DQR A;  4C3J J;  1KQ9 A;  4I2O A;  2JN6 A;  3MN2 A;  4RAZ A;  1E3P A;  3ZQ7 A;  1D1B A;  1W4M A;  3DEE A;  3JTH A;  3G6E I;  2P5K A;  2A68 F;  3BPV A;  3DV8 A;  4HG2 A;  1E3O C;  4Q5S F;  2VC1 A;  1JXS A;  1MJA A;  2QBY B;  4I76 A;  2V4J C;  2P8T A;  4L5I A;  4ESJ A;  4PCQ A;  2DQL A;  2VT3 A;  1TWH J;  3CMA I;  2E1C A;  2Y9Z A;  2H8W A;  4YEL A;  3FF5 A;  2LP0 A;  3FXO A;  3Q0W A;  4M9X A;  4Z2Y A;  3TGN A;  4ZYD A;  9ANT A;  2HYJ A;  3MFK A;  4CSW A;  2LH9 A;  4NC8 A;  2QUF A;  3HRM A;  3U21 A;  3DKX A;  1RKT A;  5KK1 A;  3S1Q J;  2E1N A;  2W24 A;  2IGM A;  2X6X A;  1O3T A;  1IRZ A;  4PJN A;  1UHS A;  1XDS A;  5DCM B;  3I56 I;  2DPD A;  2KIU A;  2B63 J;  1PYV A;  3F6V A;  5F0H A;  2OQR A;  3S8P A;  1BI2 A;  5KAI C;  3ZMD A;  4UNO A;  1N25 A;  3K4B A;  3HOV J;  3S1R J;  3LQR A;  5EEG A;  1DP7 P;  1YRN B;  2Y0M A;  1X1C A;  3CCY A;  1A35 A;  2LRD A;  3OSF A;  3V42 A;  1V3F A;  2LRE A;  1WI3 A;  3DXJ F;  1SAX A;  2WB1 A;  2CQK A;  3JRI A;  1T8I A;  1U5T A;  1BW6 A;  1QHH D;  3QPL A;  3F8B A;  2AQF A;  4IVN A;  1OQY A;  4H0E A;  1ETK A;  3CP8 A;  4AYB A;  3CF5 F;  2ZME B;  2BHZ A;  3W3C A;  2JVH A;  3GYH X;  4P9U A;  2H6B A;  1QRY A;  4WF2 A;  3K2Z A;  1Z7U A;  2CO5 A;  4M3G A;  2HOA A;  4B8X A;  1RR7 A;  1OCT C;  2HQN A;  3ABT A;  3CO6 C;  2QKL B;  2DA3 A;  2JVG A;  4OIR F;  1NK2 P;  3FWE A;  1RES A;  2DA5 A;  3S2W A;  3BLY A;  4BXX J;  1D3Y A;  3VEP A;  4M3D A;  3TO6 A;  1SD6 A;  5CJ9 A;  2UWM A;  1P4W A;  1XGS A;  4A0Z A;  4D1Q A;  3K70 D;  1MBK A;  1I1G A;  1YIJ I;  4OIP F;  1ZG5 A;  3GWZ A;  3M1C A;  4E4H A;  2PJR B;  1OCZ H;  2PMH A;  2M30 A;  3MKW B;  4ABZ A;  2KDO A;  3MWM A;  2AO9 A;  4ZYA A;  4XLF A;  5FKL A;  2XSJ C;  2XAF A;  4E7S A;  3FK7 A;  3CP2 A;  4XLC A;  3OL3 A;  4NNJ A;  3GFM A;  2LG4 A;  1WJC A;  4KN7 X;  2VON A;  2E34 A;  3JRB A;  5LGN A;  1KA8 A;  1BR4 A;  1Y8Q B;  1OYI A;  1PJR A;  2L9R A;  4LIV A;  1JKO C;  3OSG A;  2CV2 A;  3FXL A;  2FBH A;  2P7C B;  3KP5 A;  2VE8 A;  3OYC A;  1MND A;  2GM4 A;  1IXC A;  2KQR A;  1USS A;  5FLX Z;  2IXS A;  5D8L B;  1MH4 A;  2LVS A;  4N4N B;  4D5F A;  5F04 A;  1PP8 F;  3PSF A;  4PGH A;  2ZB9 A;  2Q0O A;  3LSP A;  1ZGW A;  2GIZ A;  1WWX A;  4XRM A;  2IPQ X;  1W5S A;  2X6O A;  4J19 A;  2IS6 A;  3HEF A;  1SFU A;  4JX5 A;  3JCU C;  3K6G A;  3O8H A;  3BZC A;  2DYR H;  2JPB A;  4YG2 F;  2FF4 A;  3KX2 A;  1YIO A;  1ZRE A;  2KZV A;  2EIM H;  3K4N A;  3IC7 A;  5E1X A;  2CV0 A;  4OU0 A;  2HWV A;  5ICC A;  1HKS A;  4UXN A;  1RPW A;  1LFP A;  3OOU A;  3OYD A;  1Y6I A;  1KYZ A;  4U0V A;  3RPU D;  3PUF A;  3MZ8 A;  2E7X A;  2QBY A;  2GWR A;  1DU6 A;  1UFM A;  4FAS D;  4Y7N J;  4J00 A;  1R4M B;  1IUF A;  3N97 A;  4MO7 A;  4ZYH A;  2HVR A;  2V6E A;  1U8R A;  2Y9Y A;  4KIG A;  3DFG A;  4QWQ A;  4D0P A;  1QA6 A;  1A04 A;  4UV8 A;  1ETQ A;  3ZN1 A;  1YJ9 I;  4KDP A;  4GRI A;  3S3O A;  3VYU B;  3ZQF A;  1IN4 A;  1O3Q A;  5CVR A;  3I3L A;  1V5G A;  3LSM A;  1Y56 A;  1I3Q J;  3GTP J;  3E7L A;  2XAH A;  1SAU A;  3H36 A;  4CCN A;  3IRQ A;  1CGP A;  3DPL C;  2VKH A;  5D8K B;  1N77 A;  4KIB A;  3V7C A;  1Z91 A;  1U3E M;  3L2C A;  2BY0 A;  3KZZ A;  2L02 A;  5HLH A;  2STW A;  2VKE A;  4BBS J;  3ZMZ A;  1GV5 A;  4EEF G;  2W82 A;  3Q5F A;  3FMQ A;  2HDC A;  2V9K A;  1IXS B;  2JWT A;  4A3I J;  4BEH A;  2NAZ A;  1U5T C;  2R7V A;  1K4T A;  1P4X A;  4N9H A;  1J5Y A;  4N4O B;  2KHM A;  4P5O A;  3H3V K;  1D8J A;  2VJ5 A;  1JTY A;  3JSO A;  2BY1 A;  2VXD A;  2DMN A;  4V2F A;  2M3A A;  4E7I A;  1YYV A;  4U0Y A;  5DM7 F;  2ISY A;  3V8K A;  1AKH B;  2HZT A;  2F5C A;  2R7Q A;  3CCS I;  3EYY A;  2A07 F;  1D5V A;  1LDK B;  1NG6 A;  2QKM B;  3EYI A;  2HNH A;  2ACJ A;  1E3H A;  1YW7 A;  2MLK A;  1Q1V A;  1B6A A;  4UUS B;  4RLQ A;  4BU2 A;  1FLI A;  3ABM H;  1U78 A;  2DFE A;  3FXQ A;  1FWZ A;  2RV8 A;  2LBF A;  2ZNY A;  3MD2 A;  1LDJ A;  3BTJ A;  1X2M A;  3SEQ A;  3QYE A;  3CME I;  3BDD A;  3G1O A;  5E8I A;  1PUF B;  1Z6R A;  3S15 J;  1ERD A;  3QP6 A;  2IS1 A;  3CCJ I;  4QTR A;  4PZJ A;  1ZRC A;  1VQN I;  3C7J A;  4C3H J;  2HTS A;  1IN8 A;  4E7L A;  1D0Y A;  2LMD A;  2QSF X;  4E70 A;  2M7A A;  2KLO A;  4LG3 A;  4HQM A;  2BZT A;  3RSN A;  1KON A;  1U6G A;  1ZKG A;  3DBH B;  5F0F A;  3CUQ B;  3IWF A;  4GO1 A;  3IHU A;  5H6R A;  2FXA A;  2KJC A;  2QEX I;  1T33 A;  1XC5 A;  1LFU P;  4JQF A;  1X58 A;  2MGQ A;  1Y0U A;  2CQ7 A;  4JYK A;  1R58 A;  4F55 A;  1DUX C;  4L0Z B;  4ZJZ A;  1SFE A;  2Y30 A;  3HOX J;  2JA7 J;  2E1M B;  1XSX A;  3FXU A;  1S6L A;  2V1X A;  3LAJ A;  5LFA A;  2M0C A;  2Q1Z B;  4RDU A;  2ZJQ F;  1LPQ A;  2CW0 F;  1MDM B;  4KJZ A;  1LE8 B;  5BOX A;  2TRT A;  5E8G A;  4KMF A;  5M3F J;  3ISP A;  4CIC A;  1BIB A;  4Y15 A;  3FXK A;  2E2I J;  2NVQ J;  3R6S A;  4HST A;  3IAM 2;  1IW7 F;  2CW7 A;  1E2X A;  2G9W A;  1ZG3 A;  2Q2E B;  2PJP A;  5EYR A;  4MQ9 F;  2F4I A;  3D1N I;  1BIA A;  5D5W B;  1U8B A;  2HDD A;  2WB1 N;  1FT9 A;  3M1E A;  3ZCO A;  1IN7 A;  1JT6 A;  2L01 A;  2W7N A;  2XV4 S;  3PNT A;  1QGP A;  4ON0 A;  2DA6 A;  4AYB N;  1T98 A;  1XMK A;  2MC3 A;  3C2G A;  2M34 A;  3DEU A;  1VZ0 A;  4YRV A;  4BAY A;  5M5W J;  1B9N A;  3BR2 A;  2KRH A;  3WGH A;  3MZH A;  3I4M J;  4XON A;  4HDU A;  2MFZ A;  2BBY A;  3U1K A;  4M3B A;  1R5H A;  2V9P A;  2F5V A;  1TP4 A;  2DA1 A;  3VYR B;  3J80 Z;  4AIJ A;  2A6T A;  1MNM C;  2DFI A;  4ENK A;  4ZDO A;  2JTV A;  3WTU C;  2LLK A;  2DT6 A;  4CCO A;  4XOR A;  4BJ6 C;  1DP3 A;  4GXO A;  2MD5 A;  4YIF A;  2H1L A;  5J47 A;  1GXQ A;  2VBZ A;  4S04 A;  1ZEL A;  2VI6 A;  1H8A C;  1SD4 A;  1BA5 A;  1JI8 A;  5CVV A;  2PX9 A;  2DMT A;  1N75 A;  2GXB A;  1B4A A;  5GAH J;  1K61 A;  5DS9 A;  3OYJ A;  5FFZ A;  4KNY A;  3CC4 I;  2L5Q A;  1YHQ I;  5DCF A;  1REP C;  2ZME C;  3OS1 A;  2HQR A;  3ZP5 A;  3F8F A;  2EBI A;  2XPU A;  2QZ8 A;  3QPT A;  3WTZ A;  1RI7 A;  5A2Q Z;  1P7J A;  2FMY A;  1B72 B;  4C9Y A;  3EUH C;  1XMX A;  3BJA A;  3A0B C;  2YX4 A;  4OAZ A;  1NK3 P;  4K2E A;  4QPQ A;  2L2O A;  2O7O A;  4G7O F;  1B8I B;  1T08 B;  4PSW A;  3VSL A;  1HDD C;  3LA3 A;  5C4X J;  2EZI A;  1QHG A;  1W0U A;  1APL C;  4XKV A;  3S32 A;  1TQI A;  1MKM A;  4XSZ F;  1PUE E;  4XLP F;  2VPR A;  3F9K A;  2DA2 A;  1H0M A;  3FDY A;  5H20 A;  4XLE A;  1IO2 A;  2MYS A;  3D5R C;  4HSR A;  1MBF A;  2EZL A;  3P5J A;  2OF7 A;  5F6F A;  1PUF A;  2KRF A;  4M71 A;  3RPU A;  2F6C A;  4YII A;  4QIW N;  3GUD A;  3B6C A;  4NUB A;  1HW1 A;  4TV7 A;  1O3S A;  1HLV A;  2BYV E;  1OR7 C;  1MIJ A;  3S2H J;  4I6Z A;  3O2P E;  3PM1 A;  3HC7 A;  5ILS A;  3BQY A;  3N4M A;  4B3A A;  2FJ1 A;  3HUG B;  3G2B A;  2EFP A;  3Q0V A;  4LFU A;  3L2U A;  3K4C A;  2K40 A;  2R92 J;  1DPR A;  2E5Z A;  1MMD A;  1LUJ B;  5BNG A;  4BE1 A;  2WTE A;  3FHN A;  2HKO A;  5ERI A;  2FD5 A;  2RN7 A;  4AUX A;  1UMQ A;  2XSD C;  2CYY A;  2KIS A;  1R1V A;  1TBX A;  2L3D A;  2LY1 A;  5TRD A;  1X1D A;  4MGR A;  1A31 A;  5FD5 A;  1XCV A;  4L5E A;  2GQQ A;  2EWN A;  4HX8 A;  5LRS A;  3SXY A;  3IKT A;  1R71 A;  3HGG A;  3OYE A;  3FBN B;  3RJP A;  3K4K A;  2LKX A;  3LSJ A;  1IDY A;  3ZN0 A;  3KP6 A;  2Z1D A;  4XIC A;  1E0E A;  2EFW A;  2STT A;  2VQG A;  3KEO A;  1JTX A;  2O61 A;  4Q4Z F;  1Y8R B;  4FX4 A;  5HOD A;  4EMS A;  3OYA A;  4KMU X;  1R00 A;  4I7H A;  3BG9 A;  1B59 A;  2DN0 A;  2GAU A;  1YQA A;  2BHY A;  1YX3 A;  3H3U A;  3I54 A;  3PFI A;  3REO A;  2EK5 A;  2BXZ A;  2ZC2 A;  3M3Y J;  2L4M A;  2I8D A;  5E3O A;  2HPM A;  4Q47 A;  1F36 A;  4J01 A;  2MH2 A;  5J6X A;  3EPZ A;  3B6A A;  1ZG1 A;  1MMG A;  3AFH A;  1OLT A;  2ELJ A;  3HSE A;  4G7Z F;  2AS5 F;  1RUO A;  3IUO A;  5LEJ A;  4CCL A;  3HOU J;  2HXO A;  3I53 A;  1HC8 A;  2GXG A;  3BR1 A;  4EJO A;  2A5W A;  4AIH A;  1WGX A;  1R1U A;  4B4C A;  4ITV A;  1IJW C;  4IHW A;  1Y0N A;  3GTQ J;  5K1Y A;  4XKW A;  4BH9 A;  3A4C A;  1I27 A;  1K4S A;  2P4W A;  3CLQ A;  2ZXI A;  4KIT B;  3HSF A;  1SVL A;  3B73 A;  3OYG A;  5JR3 A;  1QVT A;  1IGN A;  4KFC A;  2ZXH A;  2LF8 A;  4N9I A;  3HSR A;  1JHF A;  1SFK A;  3AG1 H;  4XSX F;  3I5U A;  2FOW A;  3ZXS A;  3ZOB A;  1KU9 A;  5M5Y J;  3IWZ A;  1YTY A;  4GGG A;  4QPO A;  3R61 A;  4JX4 A;  2FUG 2;  2OD5 A;  5HLG A;  3L2R A;  3A02 A;  2XAG A;  4FE7 A;  2EPF A;  2M2E A;  1UCR A;  5DTD A;  1YIT I;  2GA1 A;  2AHQ A;  3F3X A;  3FXJ A;  3LSG A;  4M6V A;  4IX7 A;  4EJT A;  4MEX F;  1ZLK A;  2HXI A;  2Y31 A;  2JSC A;  3F0C A;  2C6Y A;  4P55 A;  1MJ9 A;  1ETX A;  2FRH A;  2OZU A;  3J80 K;  3F8M A;  2E36 A;  3CCQ I;  3WTT C;  3WGG A;  2L7Z A;  2DLL A;  4RS8 A;  2K86 A;  3F23 A;  2DU9 A;  2ME0 A;  1D5Y A;  2NVT J;  1PVE A;  4CA0 A;  1TC3 C;  2FA5 A;  1IDZ A;  3KYL A;  1F1Z A;  5IOZ A;  1JE8 A;  2F48 A;  2Z2S B;  2NNN A;  4HBL A;  1QPM A;  4QLC U;  5L3D A;  2R93 J;  3OYK A;  2QA4 I;  3WU0 A;  3FHZ A;  3OYI A;  5A2Q K;  2ZJ2 A;  1ZK8 A;  1P2F A;  1S7E A;  5BPI A;  5J1R A;  1KQ0 A;  2WAF A;  3CUQ C;  1M1E B;  1YS7 A;  3ZQG A;  2XC7 A;  2ZJR F;  1JKR C;  4X6A J;  1S29 A;  4MLO A;  2NVY J;  3NEU A;  5LHH A; 
#chains in the Genus database with same CATH homology
 1A6I A;  3HDD A;  1WH5 A;  2L9R A;  1JKO C;  2XPW A;  3OSG A;  2NVX J;  1UG2 A;  1QPI A;  2DMQ A;  1G2H A;  3G1L A;  2MW8 A;  3NAU A;  1AU7 A;  2GM4 A;  2L0K A;  1HF0 A;  1ZQ3 P;  1MH4 A;  2LVS A;  2E1O A;  3A03 A;  3RZD J;  1GDT A;  4NDL A;  3RQI A;  1JGG A;  2H8R A;  2I10 A;  4D5F A;  5F04 A;  1K83 J;  3LSP A;  2ZB9 A;  4A3E J;  1ZGW A;  2L7M P;  4XRM A;  5F0C A;  3LOC A;  2X6O A;  3BTL A;  4J19 A;  4A3G J;  3HEF A;  4JX5 A;  3SJM A;  3O8H A;  2O9L A;  3K2A A;  3GBG A;  5IYC J;  4DYQ A;  1VND A;  1RPW A;  2HI3 A;  3LSR A;  4DZJ A;  3JRD A;  3OOU A;  3L1P A;  1DU6 A;  3BTI A;  4Y7N J;  1RET A;  1IUF A;  3M4O J;  2FQ4 A;  1IV6 A;  4MO7 A;  3LNQ A;  3CDL A;  1U9N A;  2Y9Y A;  1XG1 A;  4QSH A;  4IHX A;  2CJJ A;  1MSF C;  1ETQ A;  4A3D J;  3JR9 A;  4FCY A;  3ZQF A;  4BKX A;  2JMW A;  1RKW A;  3FKI J;  2XB5 A;  1OJL A;  1I3Q J;  1IC8 A;  3E7L A;  1JJ6 C;  3GTP J;  2X9D A;  2DMU A;  1TWG J;  4JP0 A;  5K7Z A;  2R5Z A;  5FKO A;  3FIS A;  4FTH A;  2VKE A;  4BBS J;  1GV5 A;  4EEF G;  5C44 J;  5E3N A;  1HOM A;  3VPR A;  2XGC A;  2JWT A;  1MBE A;  5K7H A;  4A3I J;  5IYB J;  1MH3 A;  1R9T J;  4AC0 A;  1ETV A;  2X48 A;  1FJL A;  3H3V K;  5FLV A;  1JTY A;  4C3I J;  3ZQL A;  3RKQ A;  5JLX A;  3JRG A;  2E2J J;  2JA5 J;  2DMN A;  4V2F A;  3JRH A;  5IOY A;  1VF9 A;  1FIA A;  2ECC A;  5M3M J;  2R0Q C;  1MBH A;  1AKH B;  5EF6 A;  3CMY A;  2HQ5 A;  2L7F P;  1AKH A;  4FIS A;  3HOZ J;  3O8G A;  1FTT A;  3PO3 J;  3ZQI A;  2K9S A;  4UUT A;  2EQR A;  2CQQ A;  1Q1V A;  4UUS B;  3IH3 A;  1U78 A;  2P81 A;  4JX6 A;  4UUS A;  1BW5 A;  2YUS A;  1I50 J;  3BTJ A;  1JUM A;  1X2M A;  2EH3 A;  4MFD A;  3G1O A;  2D5V A;  3Q3S A;  1PUF B;  1HDP A;  3S15 J;  2M8G X;  3BR3 A;  4QTR A;  1FEX A;  4C3H J;  1HCR A;  4DZP A;  3ZQH A;  3BQZ A;  2JJ7 A;  4BY1 J;  1A5J A;  3H0G J;  3HM5 A;  1ZKG A;  2YS9 A;  1H88 C;  5F0F A;  1JJ8 C;  1VI0 A;  2Y0S N;  3JRF A;  2R93 J;  1T33 A;  4A3J J;  1XC5 A;  4M3E A;  1LFU P;  4DW6 A;  1X58 A;  3HB9 A;  2MGQ A;  3TW7 A;  2Y2Z A;  1GT0 C;  1CQT A;  4MFE A;  4DYC A;  1TWC J;  4JYK A;  1WH7 A;  4G12 A;  1AHD P;  1IG7 A;  3S2D J;  3BTC A;  2R7Z J;  5GP9 A;  2Y30 A;  3HOX J;  2JA7 J;  2W48 A;  3BG3 A;  2ELK A;  2JK3 A;  2M0C A;  4RDU A;  1LFB A;  2EZH A;  2CRG A;  1Y1W J;  5F1J A;  2CU7 A;  3TED A;  1LE8 B;  2TRT A;  5FJ8 J;  5M3F J;  1LE8 A;  2CQX A;  3SFI A;  4A3K J;  2E2I J;  2OPT A;  3WHC A;  2NVQ J;  2DA7 A;  4RBO A;  4Y52 J;  2LY9 A;  1TWA J;  1O4X A;  3S16 J;  2ID3 A;  1ETO A;  3BT9 A;  5IP9 J;  5EYR A;  3D1N I;  3HOW J;  2DA4 A;  1U8B A;  2HDD A;  2XB0 X;  4W1U A;  3BR5 A;  4B1R A;  2WB1 N;  3TW6 A;  3DEW A;  1JT6 A;  4A3B J;  3TP3 A;  2NS7 A;  3IH2 A;  1I6H J;  2EZK A;  2DA6 A;  4AYB N;  3HOY J;  2DTZ A;  3FIW A;  2M34 A;  4V2G A;  1OCP A;  4XRS A;  1FTZ A;  4GFB A;  5M5W J;  1NTC A;  3BR2 A;  3MVP A;  2ME6 A;  2LD5 A;  3I4M J;  3DCF A;  5EGO B;  4M3B A;  1JT0 A;  5EGO A;  2H1K A;  1MNM C;  2DA1 A;  3JRA A;  3K7A J;  2JA8 J;  2LLK A;  1WCM J;  2LR8 A;  2COB A;  2DMP A;  2IAI A;  1EF4 A;  2VI6 A;  1H8A C;  1BA5 A;  4A3C J;  1T56 A;  2DMT A;  2LFB A;  1K61 A;  5DS9 A;  5J3L A;  2VKV A;  1GVD A;  3S14 J;  2GBY A;  5FKN A;  4D5C A;  3C2B A;  3GTL J;  1ZR2 A;  4IEJ A;  2WAQ N;  2EBI A;  2ID6 A;  2XPU A;  4A3M J;  5FLM J;  2KDZ A;  3S1M J;  1P7J A;  1B72 B;  1BL0 A;  2CUF A;  1MBJ A;  4XRS G;  5JLW A;  1B72 A;  5EZH A;  2WV1 A;  1VFC A;  1NK3 P;  1Z0X A;  2O7O A;  2FX0 A;  3BR0 A;  5IPA A;  1B8I B;  3A01 B;  1HDD C;  2VUM J;  1QVU A;  5C4X J;  2EZI A;  2KT0 A;  1B8I A;  1F43 A;  4HNV A;  1W0U A;  1APL C;  1ETY A;  5IP7 J;  5J1U A;  1H89 C;  2VPR A;  2DA2 A;  5K7F A;  2E2H J;  5F27 A;  1FIP A;  5EG0 B;  2K9N A;  1MBF A;  2EZL A;  2OF7 A;  2IEK A;  1PUF A;  4QIW N;  2NOG A;  3IH4 A;  2G0E A;  3B6C A;  5EZG A;  3HKZ N;  1HLV A;  4C2M J;  3GTO J;  1ZR4 A;  3S2H J;  3GTJ J;  4I6Z A;  3PM1 A;  2YU9 J;  4FE4 A;  3BQY A;  4B3A A;  2FJ1 A;  2XGD A;  3JRE A;  2R5Y B;  3QQA A;  3Q0V A;  1BJZ A;  3FK6 A;  1ETW A;  4BY7 J;  2LTP A;  2K40 A;  2R92 J;  4CYC B;  5FKM A;  5BNG A;  4DYR A;  3RZO J;  4CYC A;  2FD5 A;  2N8G A;  1ORK A;  4AUX A;  5J1Y A;  1UMQ A;  2XSD C;  1P7I A;  5IYD J;  2O8K A;  2M9H A;  2IBD A;  1MBG A;  4A3F J;  2E19 A;  3CQZ J;  4A3L J;  4L5E A;  4BBR J;  3BG5 A;  2K9Q A;  4D7M A;  4LOC A;  1ZTR A;  2NS8 A;  3HGG A;  3SDG A;  1POG A;  2LKX A;  3LSJ A;  1IDY A;  3QPS A;  2XRL A;  1GUU A;  4M3F A;  1Y1V J;  4IHV A;  1GV2 A;  3WHB A;  2XGE A;  4XIC A;  4A69 C;  1JTX A;  1SFO J;  1JUP A;  1JUS A;  2RAE A;  4IHY A;  5HOD A;  2QCO A;  1JKP C;  5C4J J;  3GTG J;  3ZQC A;  3BG9 A;  3Q0U A;  2DN0 A;  4C3J J;  2JN6 A;  3MN2 A;  4MIM A;  3M3Y J;  5E3O A;  1E3O C;  1F36 A;  1ENH A;  3IV5 A;  1JKQ C;  1TWF J;  4I76 A;  5F08 A;  1OFC X;  3B6A A;  5C3E J;  1TWH J;  1ITY A;  2Y9Z A;  3I4N J;  2CUE A;  2LP0 A;  3Q0W A;  3HOU J;  2HXO A;  1X2N A;  5E3M A;  3BR1 A;  9ANT A;  2HYJ A;  3NAR A;  3S1N J;  1WGX A;  4B4C A;  1RKT A;  1IJW C;  4IHW A;  3GTQ J;  3S1Q J;  1W0T A;  1Z77 A;  1IRZ A;  4S0H B;  1UHS A;  5E3L A;  2B63 J;  5F0H A;  2LK2 A;  2R5Z B;  2MG4 A;  3HOV J;  3S1R J;  4X1E A;  4D7N A;  1YRN B;  3CCY A;  1IGN A;  5GPC A;  1QVT A;  3OSF A;  1YRN A;  1WI3 A;  3HGY A;  1WPK A;  5IP6 A;  3JRI A;  3ZOB A;  1BW6 A;  3GTK J;  3QPL A;  5M5Y J;  4A93 J;  1ETK A;  4JX4 A;  3A02 A;  4FE7 A;  3TP0 A;  5EDN A;  1QRY A;  2JA6 J;  2TCT A;  3S17 J;  2XPV A;  4M3G A;  5DTD A;  2M2E A;  5GPA A;  2HOA A;  4XK4 A;  1RR7 A;  4XID A;  1OCT C;  2AHQ A;  2DJN A;  2MSY A;  4M6V A;  3BR6 A;  3LSG A;  3A01 A;  3PO2 J;  3G1M A;  2HXI A;  2DA3 A;  2Y31 A;  5M5X J;  3F0C A;  1DU0 A;  1NK2 P;  4BXX J;  1RES A;  2DA5 A;  1ETX A;  2HOT A;  1XS9 A;  3GTM J;  2ECB A;  4M3D A;  2HOS A;  2L7Z A;  5EG0 A;  2ME0 A;  1D5Y A;  2NVT J;  1MBK A;  1SAN A;  1TC3 C;  1IDZ A;  3JRC A;  2PMZ N;  5IOZ A;  3OIO A;  5EEA A;  1MSE C;  4ABZ A;  2QF7 A;  5FKK A;  3HBL A;  2AO9 A;  5FKL A;  3UKG A;  3FK7 A;  2R5Y A;  3W6V A;  1ZK8 A;  1S7E A;  4W97 A;  5J1R A;  3JRB A;  3ZQG A;  3MKL A;  1JKR C;  2GLO A;  4X6A J;  1U9O A;  4MLO A;  2NVY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...