1I3QJ

Rna polymerase ii crystal form i at 3.1 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1i3qJ00
1MBGA 5JLXA 1ITYA 2L7FP 1ZK8A 3G1LA 2HDDA 3HDDA 1HDDC 4FE7A 5FLVA 3FK7A 1GVDA 1POGA 1ORKA 2ID3A 4AC0A 3Q3SA 5F27A 4GFBA 4JP0A 5F1JA 1EF4A 5F0CA 3HKZN 1JT6A 2R92J 4B4CA 1QPIA 4JX4A 1WH7A 5M5YJ 1X2MA 2LK2A 4J19A 1TC3C 5EF6A 2ME0A 1B8IB 2DMPA 1ETKA 4FCYA 2DJNA 1G2HA 5IPAA 4M3EA 2OPTA 3GTLJ 2L9RA 3RKQA 3OSGA 1OCTC 5EG0A 9ANTA 4C2MJ 4NDLA 4IHWA 3HOZJ 1I50J 4Y7NJ 3BTCA 2I10A 1APLC 1MBKA 3H0GJ 3UKGA 3RZOJ 1Y1WJ 2IEKA 3O8HA 2YUSA 1ETWA 2DN0A 3NAUA 3BT9A 3O8GA 2E19A 1IDZA 1TWGJ 2X48A 2JJ7A 2O9LA 1HLVA 5IYBJ 4X1EA 4A3EJ 2ELKA 2K40A 3LOCA 1PUFB 5EG0B 3OIOA 2MG4A 3JRFA 4A3BJ 3IH3A 1NK3P 1MBFA 3D1NI 2JMWA 2LKXA 1WI3A 4D7NA 3CMYA 3ZQLA 1RR7A 2QCOA 5K7FA 3F0CA 2Y2ZA 4JYKA 2D5VA 2NS7A 3FISA 1B72B 1X58A 2LD5A 2G0EA 3JRBA 5E3NA 4C3HJ 1HCRA 2DMQA 1RKWA 4V2GA 2HI3A 1TWHJ 2R93J 3TP0A 3LSGA 1AKHA 2R7ZJ 1OFCX 3PO3J 3HB9A 3BQZA 2K9SA 2VKVA 1AHDP 2L7ZA 2H1KA 2XSDC 4XRSA 4QSHA 3RZDJ 1HF0A 2OF7A 3MKLA 4M3FA 3B6CA 1IG7A 1ETOA 1MNMC 3BR6A 2N8GA 4D5FA 4V2FA 2WAQN 2MW8A 4A3LJ 2EH3A 2ECCA 4BKXA 1ZR2A 2NVYJ 2B63J 4MFEA 1GT0C 1ENHA 5IYDJ 1IJWC 4ABZA 3QPSA 3BG3A 1WGXA 5JLWA 2YU9J 1DU6A 3S1RJ 4A3FJ 2NS8A 5C3EJ 3SFIA 2E2IJ 2L0KA 1UHSA 1W0TA 1WPKA 4AYBN 3GTMJ 3JRHA 4X6AJ 2EZIA 3L1PA 3ZOBA 2KT0A 5EGOB 4JX6A 2H8RA 3M4OJ 1WH5A 3OOUA 4IEJA 2YS9A 5F0HA 3GBGA 3BQYA 4BY1J 2IBDA 5DS9A 3SDGA 1WCMJ 2HQ5A 2ID6A 2VPRA 1R9TJ 3LSJA 3S16J 1MSEC 3JRAA 1LE8A 1CQTA 1PUFA 4UUTA 3GTJJ 3TW7A 2JA7J 1ZTRA 2ECBA 3S14J 3NARA 1QVTA 1GV5A 5HODA 2LLKA 5K7ZA 5EEAA 2M0CA 2M9HA 4W1UA 1DU0A 5E3LA 1YRNB 4MFDA 4BBRJ 2R0QC 3HOUJ 3CQZJ 1S7EA 2EZHA 3BR1A 5EZHA 3CCYA 5E3MA 5IOYA 4IHVA 2DA5A 1BW6A 2WV1A 3HOVJ 5M3MJ 4HNVA 1LE8B 1YRNA 1T56A 1F36A 1IUFA 1ZKGA 1U78A 2GLOA 5FKLA 1AKHB 4A93J 1TWFJ 5FKKA 2LTPA 2TRTA 1VNDA 1IRZA 3I4MJ 2XPWA 4S0HB 3B6AA 4RBOA 1A5JA 1P7JA 4A3GJ 2NVTJ 3BR5A 3A01A 1MH3A 2DA4A 1H89C 2FJ1A 2KDZA 4XK4A 1JUSA 3TEDA 4M3BA 5C4XJ 4B1RA 1JUPA 2Y30A 2X6OA 3LSRA 5J1UA 3QQAA 2TCTA 4L5EA 3QPLA 3HOWJ 2JA5J 4DYQA 4MIMA 2W48A 3G1MA 2GM4A 2JWTA 4QIWN 1TWCJ 1LFBA 2NVXJ 3HOYJ 2HXIA 1SANA 2DMNA 4BBSJ 4C3JJ 3LNQA 1JUMA 1FJLA 3HM5A 2HOTA 2DA7A 2LFBA 1XG1A 3A03A 3TP3A 3IH2A 3S1MJ 1OJLA 1IGNA 3A02A 3ZQCA 2LY9A 1BJZA 4EEFG 1ETYA 1JTYA 4I76A 2HXOA 5F0FA 3OSFA 1XS9A 1D5YA 1MH4A 2EZKA 2EZLA 3CDLA 4D7MA 2Y0SN 3FK6A 3K2AA 5DTDA 4XRMA 2E1OA 3RQIA 3HBLA 3FIWA 3WHCA 3GTQJ 1UG2A 1FTZA 5M5WJ 2XB0X 4RDUA 2NOGA 4A3DJ 3S1QJ 3MVPA 5E3OA 3BTJA 2WB1N 2VKEA 1JKRC 2M34A 3JR9A 4G12A 3GTGJ 2ZB9A 4BY7J 3JREA 1JJ8C 1JKQC 3HOXJ 4M6VA 1LFUP 1E3OC 4XIDA 1H88C 4XRSG 2GBYA 3S17J 2CRGA 5GPAA 1HOMA 2VI6A 3JRDA 1NTCA 1A6IA 3H3VK 1B72A 4AUXA 3GTKJ 1OCPA 3S1NJ 5FKOA 1SFOJ 3JRCA 2K9QA 5EDNA 5FLMJ 1Q1VA 4DYCA 2Y9ZA 2XRLA 3Q0WA 4XICA 2M2EA 3S2DJ 1T33A 3S2HJ 1K83J 3HGYA 3ZQHA 1ZQ3P 4A69C 1F43A 2RAEA 5GPCA 2CUFA 3TW6A 3M3YJ 2CU7A 5EZGA 2DA3A 2X9DA 2XGEA 3S15J 2IAIA 1RKTA 2MGQA 4Y52J 5J1YA 1FTTA 1QRYA 2DTZA 5IP7J 5FJ8J 3GTPJ 5IP6A 3WHBA 3I4NJ 5IYCJ 2JN6A 2CJJA 4CYCA 1MSFC 2AO9A 1H8AC 3Q0VA 2XGDA 3BG5A 3ZQFA 3VPRA 2AHQA 4DZJA 1O4XA 2XGCA 3BR2A 3JRIA 2L7MP 3FKIJ 4JX5A 1JGGA 3DCFA 5FKNA 1Z77A 5IOZA 3C2BA 1VFCA 4IHYA 5M3FJ 3HGGA 2E2HJ 4IHXA 2DA6A 2HOAA 1JKPC 4QTRA 1QVUA 1FIPA 2PMZN 4FE4A 3ZQGA 3W6VA 2CUEA 2Y9YA 1IV6A 5K7HA 1JTXA 4M3DA 1GV2A 5C44J 1JT0A 5F04A 1GUUA 3BR3A 2O7OA 4CYCB 4LOCA 1IC8A 1W0UA 1HDPA 1MBHA 5BNGA 5FKMA 1X2NA 2Y31A 3A01B 2K9NA 4MO7A 5IP9J 2XPUA 3PM1A 4I6ZA 2E2JJ 2R5ZA 4A3MJ 2O8KA 3JRGA 5M5XJ 3MN2A 1U8BA 1RESA 1Z0XA 2EBIA 2R5YB 1MBEA 2FD5A 2JA6J 3GTOJ 4D5CA 1BW5A 1K61A 1JJ6C 1ETXA 4UUSB 3LSPA 2QF7A 3Q0UA 4W97A 2COBA 2R5YA 1GDTA 3G1OA 3HEFA 4FISA 1B8IA 1MBJA 2ME6A 5EGOA 2DA1A 2LVSA 1TWAJ 1I6HJ 2JA8J 3BTIA 1VI0A 2XPVA 4MLOA 2HOSA 2CQXA 1U9OA 2M8GX 4A3IJ 1P7IA 5J3LA 2NVQJ 4A3JJ 2FQ4A 5EYRA 3E7LA 1ZR4A 1ETQA 5C4JJ 4A3CJ 1BA5A 1RPWA 4DW6A 4DYRA 1ZGWA 4UUSA 4DZPA 2EQRA 1AU7A 3K7AJ 2JK3A 1I3QJ 3IH4A 3BTLA 5J1RA 4M3GA 4A3KJ 2DA2A 3IV5A 1BL0A 3SJMA 1U9NA 3DEWA 2LP0A 3BR0A 2R5ZB 1JKOC 4B3AA 1Y1VJ 3BG9A 1UMQA 4FTHA 2XB5A 2LR8A 2VUMJ 5GP9A 2DMUA 1ETVA 1VF9A 4C3IJ 2CQQA 3ZQIA 1XC5A 1RETA 1FIAA 2MSYA 1NK2P 2HYJA 5F08A 2DMTA 4BXXJ 3PO2J 1IDYA 2P81A 1FEXA 2FX0A
chains in the Genus database with same CATH superfamily
2DFFA 2L7FP 2HDDA 3M9AA 1HDDC 1RRJA 1KQ0A 2GAUA 2H6BA 1GVDA 3KCCA 3RQ4A 1R1TA 2QSFX 4B48A 1LDJA 2EFQA 5LBQA 3QOEA 2ID3A 3ULQB 4AC0A 3IWZA 4C2UA 1G59A 3CUQB 4JP0A 3EYIA 2KIFA 5F0CA 2EB7A 1XGSA 3DTKA 1XX5A 4B4CA 4J19A 4LLGF 2PJPA 2DYSH 2ZFUA 1Y8QB 5EF6A 4FASD 2ME0A 1B8IB 2DMPA 1ETKA 4IVNA 3K0LA 1J75A 4N0BA 3GTLJ 5GTIC 2QKLB 2FQ3A 3A0HC 2L9RA 2YSRA 3OMYA 3RKQA 5E1ZB 1YFHA 4C2MJ 4NDLA 2LF8A 3M07A 2I10A 4HNTA 2PN6A 1REPC 2ICWG 3E5XA 3H0GJ 1T6SA 1USTA 1X4PA 3UKGA 2HYFA 1YS6A 4MQVA 4MTDA 3T1BA 3RZOJ 1SEUA 3E3VA 1HQCA 3NAUA 2W4SA 5F6FA 2R7XA 4D0PA 3JW4A 3MZHA 1IDZA 1FOXA 1UB9A 4A3EJ 2K40A 2FSWA 3LOCA 3AFHA 4OIQF 3OYJA 5D5UB 4E7ZA 3OIOA 4FHTA 3RIRA 5BPIA 3EYYA 5CJ9A 2JRMA 3VB2A 4A3BJ 2ZO4A 2AS5F 1MBFA 2LKXA 4D7NA 2OD5A 4XQFA 3F3XA 3DU6A 5K7FA 2Y2ZA 1YO5C 2AXTC 3COAC 5AONA 2VQCA 4RM2A 4O6JA 1ZRFA 2NS0A 4FT8A 3T8TA 2F5VA 3WTSC 5FLXZ 4HLYA 2A6HF 5HLTA 3I54A 3VYSB 3HSFA 2A05A 1IRFA 2W00A 3TO7A 1USSA 4KN7X 5D8KB 2L02A 3CCVI 5HDKA 5ICGA 1TTYA 5D5WB 3VDXA 4M9ZA 1HW2A 2R7ZJ 3WTYC 1OFCX 3PO3J 4CO8A 1AHDP 4LB5A 1Z21A 5FD6A 3ZR8X 5HLGA 4I0BA 4E7SA 3WU1B 3HKZA 4S04A 2F5DA 2IGOA 2RQPA 4KT6A 4ZYHA 3I53A 1JHFA 1F4KA 1OKRA 4G8XA 1SFKA 2O0YA 3EUHC 2NVYJ 1T8IA 2MABA 1WKMA 4UB8C 3H5AA 4ABZA 3BG3A 4E7JA 5JLWA 1IN8A 3SFIA 4D9JA 2E2IJ 4PK4A 2L0KA 1U5TA 1WPKA 3C18A 1D3YA 1P6RA 1X1DA 1U0JA 1J2XA 4OAZA 3IWFA 1M1EB 4P9UA 2KT0A 5EGOB 2H8RA 2CQNA 5JVGF 2CW0F 2VBWA 4RMNA 2M7BA 1AA7A 4Y3OA 1D8JA 3GBGA 4I7HA 4P1WA 4DJAA 2R4GA 4KFCA 3P7NA 3F6OA 1WCMJ 3LSJA 3QAHA 3P9IA 3IRQA 2R3SA 3TL4X 2OCCH 1CQTA 4XKCA 2RVCA 3TW7A 2JA7J 3L00A 3GZNB 2Z99A 1W5SA 1RC9A 2H94A 1X1CA 4XONA 2KISA 5HODA 1MDMA 4HDUA 1R36A 3LFKA 4Q47A 1D1AA 3L7WA 2ZSHB 4E70A 2G7UA 3S3NA 2ADUA 4OIPF 1X4OA 1YRNB 3H5NA 3QYBA 1OLTA 4E7LA 1FPQA 2FBKA 2X6WA 5J4YA 1IZ1A 3CQZJ 4LG0A 1S7EA 3F72A 3FF5A 5D5XB 4KDPA 5EZHA 2ZMEC 2OJED 2HTSA 5IOYA 2UXNA 1BW6A 2WV1A 1LE8B 1FLIA 1T56A 1HSTA 1ZKGA 2BHZA 4NB5A 2DT6A 4CZCA 2LTPA 4GCVA 5H2FC 2KJCA 3WGGA 3OS1A 4I09A 3AKZA 1A5JA 5CQGA 3K4BA 3QWLA 3Q5FA 2QUFA 4A3GJ 3BR5A 3KPHA 1ZRDA 4G7HF 1VQLI 5DYMA 1DPRA 4E6KG 1E0EA 2VOOA 4JBAA 2IT0A 4XK4A 1JUSA 3PNTA 5C4XJ 4U7DA 4DNCA 2X6OA 5J1UA 2TCTA 1KU7A 3OYFA 1B59A 3HOWJ 3FXQA 3TBIA 3HOSA 3BJAA 1OPCA 4P96A 2ELHA 2PFBA 2JWTA 4B47A 4QIWN 2JQ7A 4Q5SF 1QQIA 2Q1ZB 3HOYJ 1SANA 2F6CA 3MKYB 4C3JJ 3NWTA 1BR4A 2DA7A 3S2WA 2R7WA 4XSZF 4HSTA 1YITI 3F21A 2HEOA 2FEZA 3IH2A 4G9YA 3CZ6A 2EK5A 1BIBA 3IKVA 2LY9A 3DBLB 3K4JA 5F0FA 3N97A 3OSFA 1D5YA 1TLHB 1R71A 2A68F 2HQAA 1TZLA 2WBMA 4D7MA 5DTDA 1Z6RA 4BJ6C 1RI7A 1T0FC 3RQIA 2VXZA 5HLHA 1UG2A 3HSEA 4B43A 3CLOA 3S1QJ 3K4MA 1SAUA 3LSIA 4ENMA 1LKXA 5LLQA 1FYKA 3GTGJ 3LA3A 4BY7J 3J7AO 1JKQC 1XGMA 2DAOA 2FA5A 2OTJI 3BPVA 4CHUA 4M6VA 1LFUP 4XIDA 4XRSG 1WJ5A 4GO1A 4YG2F 3H36A 2EV5A 2DOEA 2VI6A 4XR6A 2M4KA 2OTLI 4BDZA 2VOPA 2MD0A 1A6IA 2W7NA 4YRVA 4YIIA 4RGXA 3DKYA 4Y17A 5FKOA 3LAPA 3JRCA 4UNOA 1KGSA 2WAFA 5FLMJ 4E7HA 1Q1VA 2BEOA 2VQGA 4F91B 1YE9A 2M5WA 2XRLA 2M2EA 3S2DJ 1HA8A 1ACIA 1WWXA 2RQQA 4C9YA 2HS5A 2ISYA 2XAFA 2DK5A 2R7DA 2VL8A 2RAEA 5GPCA 2A6TA 1KYWA 2DTRA 2V4JC 1MW7A 4G6TB 3VWBA 4JOMA 5DD4A 4ZDOA 2X9DA 3S15J 2XGEA 3FHZA 2IAIA 2VT2A 2RNJA 1RKTA 1WJAA 3V8LA 1SVLA 5J1YA 1SFUA 1XTAA 5TISC 2VJJA 1FTTA 2CS3A 4AM3A 2UWMA 5FJ8J 2LKPA 1P92A 1V3FA 4Z6YA 1X3UA 3WHBA 2M1BA 3I4NJ 5IYCJ 2CJJA 2AQEA 2DFEA 1BOBA 4PSXA 3BG5A 4EQQA 4ZC3A 4EJOA 5A2QK 4BQQA 2ZKZA 2XGCA 1K78B 2M4GA 4ZTFA 5FKNA 3H9QA 1FBUA 3CUQC 3C2HA 4BEHB 3OYAA 2HOAA 4EM0B 4QTRA 1QVUA 3O2PE 2EFPA 1FIPA 1MMAA 2VBXA 3SZTA 4FE4A 2LF7A 2NAZA 3GFMA 4N4OB 1IV6A 1S9HA 1BR1A 1JT0A 4BAYA 5F04A 3FM3A 1Y39A 2CGPA 5K5OA 1PVEA 1HXDA 3SYTA 3RSNA 2XUBA 5LD2C 4U7BA 3BR3A 2O7OA 3KYDB 2LRDA 1KQ8A 2VBZA 2XAUA 2Y31A 3TO9A 3A01B 4MO7A 5IP9J 3I9V2 2ZCWA 4Q4ZF 2DXIA 4WF2A 3FKJA 2JVHA 2ZNZA 2ZXWH 1EH7A 4A3MJ 2O8KA 2YX7A 3EUKL 4A0ZA 4AVZA 1XD7A 2EBIA 1Y0UA 1S6LA 3B02A 4XL9A 1LB2A 3ML6A 3GTOJ 2VQLA 3I0TA 3B73A 3BCBA 4IHSA 5LRRA 2CMPA 1V4RA 4FX0A 2EA2A 5LRSA 3FX3A 4W97A 4Y4RA 4PZJA 3CCEI 1E3HA 1JHHA 4Y15A 1G6NA 4FISA 1YJWI 3KEQA 1YG2A 1L3LA 2O8XA 2DA1A 3CUQA 3U9GA 1RNLA 3LSKA 2KRFA 3LA7A 3HOTA 4XORA 1VI0A 4MLOA 1HW1A 1MNDA 3IHUA 2V26A 3VODA 1U9OA 3MZ8A 3T0YA 1J0RA 4A3JJ 2FQ4A 1TW3A 2CFOA 3E7LA 1R49A 1RPWA 2CWEA 5LGNA 1G3YA 3I59A 5CVIA 2KZGA 5D5VB 4HOBA 4PSWA 3E97A 2LY1A 3QPHA 4G7OF 4M3GA 2PI0A 1YHQI 2DA2A 1XN7A 3SJMA 2F4MB 3MFKA 3BR0A 4N9HA 5ICCA 4RB1A 4L9NA 3M1EA 3ZRGA 1Y1VJ 4YELA 2QZ8A 2Y75A 1TP4A 1G4DA 2VPLA 2BYVE 2HPMA 3WGHA 3NWSA 2XB5A 1VQOI 1E2XA 3I5UA 1FBSA 1OCZH 3V42A 3DV8A 2A07F 4RB2C 1CF7A 3K70C 1PJRA 3ASNH 4QLCU 3P9KA 2XAJA 2RC4A 3KLOA 5DM7F 1GLNA 3ZQIA 4WCGA 3DLAA 1BI3A 2IW5A 2WTEA 2VLAA 2MSYA 4IRGA 4BE0A 1KQ9A 2FUG2 4HX7A 3GUDA 2CSOA 4I99C 1K7AA 1FT9A 1N78A 4JQFA 2DI3A 5H6RA 1W4MA 2E71A 5D6FA 3W3CA 3E6MA 4AWXB 1A36A 1MBGA 2P5KA 4F3QA 1ITYA 2UV1A 1ZK8A 3BZKA 2IS1A 2W82A 3BOQA 3EQLF 1D0XA 2LSOA 3FK7A 4QPQA 2CV0A 2ZXHA 2GXBA 1OYWA 2XF7A 2BZTA 3Q3SA 2XIGA 5F27A 5KAFC 4GFBA 5F1JA 1EF4A 3QYEA 1O3TA 3HKZN 1E3PA 2R92J 3M8FA 1YTYA 1SD5A 1WH7A 3H9JA 3M1CA 4JX4A 5M5YJ 4UUVA 3TQNA 2CV1A 4HX4A 3DQVC 5IPAA 1MMNA 2GIVA 2OPTA 1WJDA 3ZQ7A 3CCJI 2B7EA 2F2EA 3GFJA 3OSGA 1OCTC 2R7UA 1BM9A 2HZDA 5EG0A 5LGUA 1I50J 4Y7NJ 3OWTA 4UXNA 2BXZA 3OYKA 3KYLA 3KE2A 4ON0A 1VQ4I 3HUGB 2Q2EA 1LDDA 4DQ2A 1QHHD 4BUPA 2IEKA 2CQKA 1ETWA 2DN0A 2YUSA 1XCVA 4BJ5C 3F8FA 4KN4X 2X48A 2YU3A 2O9LA 1HKQA 5HDGA 3M8EA 2ELKA 2L9NA 3F8NA 2PLYA 3DEEA 2QQ9A 1VQMI 4IJAA 3IH3A 5TGTA 3D1NI 2K4JA 1WI3A 3S8PA 1MIJA 2XVCA 3CMYA 1RR7A 5LHIA 2QCOA 2G7HA 3F0CA 3H3ZA 1XDSA 1XMXA 4YIFA 1UCRA 1L0OC 1D5VA 1I39A 1YI2I 3SXYA 1B72B 4WXCA 2PMZA 1X58A 2MC4A 2X85A 2CG4A 2P6TA 2LD5A 4F92B 5CVVA 2JRTA 4GXOA 1GXPA 4EJTA 1BN5A 2AXLA 2E36A 2F5EA 2IPQX 2X1DA 3L09A 4XLNF 5JR3A 3JSPA 4X0GA 3TP0A 4HF1A 3J7AY 1H9TA 1Y8RB 1LDKB 2ZSIB 3BQZA 3HB9A 4ENKA 2FBIA 5EJCA 2L7ZA 4BXFA 2L9SA 5DUKA 4MEXF 5B66C 2NRAC 5GAEJ 3RZDJ 2GA1A 2OF7A 2OQRA 3GMEA 4MEYF 3KP5A 2K5CA 3ROUA 1XSXA 1IG7A 1ETOA 4IKFA 2N8GA 3GO5A 4D5FA 1IW7F 3FMRA 4V2FA 3K70D 3OS2A 1XSDA 4A3LJ 1K79A 4BKXA 4L5IA 1W7PD 3CJTB 1ENHA 2LY2A 5HVQC 1IJWC 1GHCA 4YFXF 3CCUI 2O3FA 5CVUA 3FXUA 1DU6A 4A3FJ 5C3EJ 3HSRA 1ZH5A 4XSXF 4E4HA 4RM3A 3DFGA 2Y0MA 1UHSA 4PJMA 3W6KB 1IXSB 4C30A 3GTMJ 2Z5UA 2L3DA 2VJ5A 2OQGA 3JRHA 5E1XA 3GZ6A 4X6AJ 2OA4A 4PGGA 2R7TA 2VQHA 5ICFA 4LB6B 2EZIA 2JZYA 2EILH 4NUBA 2ACJA 4JX6A 2QKMB 3J7YJ 2XAGA 1Z67A 4RAYA 5D6EA 2JPBA 3K1NA 5F0HA 4A2UA 4HG2A 3AG1H 3CP2A 3Q9SA 5IT9K 2GQQA 3D5LA 3F8CA 3M8JA 1KONA 1EKEA 2F5CA 2HQ5A 2KMUA 2ID6A 2VPRA 3S16J 3WE2A 2E35A 1MSEC 2K7LA 3J80K 4UUTA 1H9GA 1W5CC 3GTJJ 5E17F 1ZG1A 1ZTRA 1OYIA 1DGRM 1SVMA 3GFIA 3NARA 1QVTA 1G3WA 1YIJI 1B1BA 2LBFB 4H0EA 1WJEA 1R4MB 3K9TA 2WB1A 3BC8A 4M74A 1BJAA 1D0ZA 2K4BA 2MLGA 4W1UA 1JGSA 2XDVA 5E3LA 4BU2A 3PL8A 1X1AA 4LMYA 4MFDA 4B09A 5FFZA 3MKZA 4UY8I 2IS4A 2R0QC 3HOUJ 2KP6A 5HOOA 4KICA 2EZHA 2IGNA 3KLNA 3BLYA 5KNLA 3H9GA 2DA5A 5HLIA 3HOVJ 5M3MJ 4HNVA 1XB4A 1IUFA 5DM6F 2GLOA 3LWFA 5FKLA 1AKHB 2KIQA 2TRTA 5FKKA 4UB6C 1IRZA 4FX4A 4RLFA 2XSJC 4UHTA 4HYEA 1T0FA 3FMSA 4FETA 5KAIC 2VIXA 4ZJZA 5KHDA 3PSFA 2W25A 3FXMA 3TEDA 4M3BA 1FMVA 5DDGA 1O3RA 3LSRA 2LOOA 2RN7A 1ZG3A 2QQBA 4CCOA 4PFOA 3WG7H 2DFHA 4L5EA 3G71I 4II2A 3L2UA 4DYQA 3RTRA 1YW8A 2Q8KA 4HQMA 5J47A 4BBSJ 4XM3A 1JUMA 2Y0SA 2K27A 2HOTA 2OAZA 3H1CA 4CH7A 1BI2A 2LFBA 1Z3XA 1XG1A 2BVLA 1O7FA 4XN3A 1SAXA 2QGUA 2VT3A 3ZGKA 2D1VA 2EFNA 4CYDA 4UVBA 4O3MA 1OR7A 3HPGA 3S1MJ 5DUIA 5GTHC 1FX7A 2DQLA 2QYOA 2I5UA 4EEFG 5L3DA 1KZHA 3D5SC 3V8KA 1A6QA 2EZKA 2EZLA 4M9XA 3K2AA 4YFNF 4B8XA 5BMZA 1TQMA 4XRMA 2E1OA 1SD4A 1YX5A 2JUCA 1R5GA 3G3ZA 3HBLA 5DD8A 3FIWA 4KNYA 3WHCA 2V1DA 1S7OA 2A3SA 3HUGA 2NOGA 1RIOH 5E3OA 3CF2A 2IS6A 2LBFA 2WB1N 1OMIA 3JR9A 3HXLA 3BP8A 4Y33A 4L0YB 4JK1X 3IKTA 1R22A 2QM3A 2KL4A 1G3TA 3RPQA 4U0VA 2Y69H 2GBYA 3ZN1A 3S17J 5J8CA 1XGNA 2V7FA 5GPAA 1HOMA 1LNWA 1IRGA 4IPAA 1NTCA 1LPQA 5FGMA 3H3VK 2FMYA 2LH9A 1B9NA 4I0AA 1T08B 2NNYA 2ZC2A 1SD6A 2RREA 1QA6A 3K4NA 1ZG5A 2K85A 2STWA 2VE9A 3MCZA 2VJ4A 2QWWA 3HGYA 3CMAI 3ZQHA 2E5ZA 3FXJA 4ZYDA 1F43A 1X3WB 3TW6A 1EV7A 2L4AA 3BY6A 1KU2A 3KP4A 5EZGA 2DA3A 3PQKA 1DDNA 1AOYA 1W36D 4Y52J 4IOAF 2Q0OA 4EVIA 1HW5A 1IO2A 3KP2A 4BQOA 2KKOA 2GOXB 4OINF 3F23A 1ZLJA 3GTPJ 1TL8A 4PJLA 4AD9A 2JN6A 2VC0A 2AO9A 1MSFC 2KFDA 1H8AC 1F9NA 3OL3A 3VPRA 3AAFA 1DPUA 1O4XA 3ABUA 4V19K 3JRIA 2WAEA 2X6XA 2L54A 2QSGX 5AIPA 3PIPF 4HDVA 3OS0A 1U6GA 4FQGA 3ABMH 1JGGA 5IOZA 1XPXA 3C1DA 2W85A 2HVQA 4EMSA 2GOMA 2E2HJ 2BE5F 2OCEA 4KITB 1O3QA 3DP7A 4Y13A 1H0MA 1WRJA 2UUZA 3ZQGA 3MAJA 1N77A 1S72I 1WSUA 2QSHX 1MD0A 1Z05A 2YR2A 3BDDA 2FOKA 2ZXIA 1IXRC 2HNHA 4EJUA 2P5LC 1W0UA 1MBHA 1F5TA 2K9NA 5DCMA 2K9MA 2XPUA 2E2JJ 3CJQB 1XSVA 1NHAA 2R5ZA 4AIHA 3D0SA 1W1WE 2J5OA 5L3GA 3JRGA 1R1VA 1QBJA 3MN2A 1Z0XA 1UFMA 3FMQA 2R5YB 2CW8A 4IL6C 2H27A 2FD5A 2VKDA 2JA6J 1ZREA 1K4SA 4A12A 3EUAA 1JJ6C 3HHGA 3LFUA 4UUSB 6PAXA 2QF7A 2V6EA 1LVKA 3DBHB 1K6OA 2ZNYA 2W24A 3Q0UA 2COBA 1QZZA 3BPXA 5BPDA 2D2WA 3HEFA 2QBYB 1AWCA 4XRFA 1XMAA 2FNPA 3JCUC 2ME6A 3CLQA 5GADJ 2XV4S 4CUGA 1ZELA 3EPZA 3LQQA 1DP7P 2ZMEA 3BTIA 4NHJA 2XPVA 4PUSA 1STZA 4ASNA 5ILVA 2CQXA 1P7IA 3JTHA 1HKTA 3TO6A 4KIGA 4ZYEA 3S93A 3V8JA 2CV2A 1FYLA 5C4JJ 3K10A 1RUOA 2X1EA 3AG4H 2L4MA 3TDUC 1AU7A 3FXOA 3K7AJ 2JK3A 4ZH4F 3ABLH 3HL2A 2GXAA 3GLLA 4A3KJ 5E8IA 3IV5A 1I1GA 2HDWA 1BL0A 3VSKA 2B9SA 2CYYA 1U9NA 1IN4A 2OV7A 2VN2A 1JKOC 2M45A 4B3AA 3BG9A 2EFWA 5E1WA 2VBYA 3JAMZ 3V7RA 4FTHA 4G6DA 3ZMSA 4HX8A 4HW0A 2FMLA 2GWRA 2F48A 3DKWA 2DCEA 1OCCH 1ETVA 5JHFA 4C3IJ 4EGYA 4EM2A 1V5EA 1FIAA 2M7AA 2LYCA 4B3XA 3G6EI 5F08A 1A35A 4BXXJ 3PO2J 2P7CB 2R7OA 4XKVA 1LEBA 2P81A 3FHNA 2FX0A 1FEXA 2OUMA 3HJEA 3ABKH 4P5OA 3GVAA 1X19A 3RPUA 1I3AA 1Y6IA 3G1LA 3E5QA 4FE7A 4L9JA 3ERED 1POGA 2V6CA 3X2QH 3OYNA 3HIFA 1R00A 4E7KA 1YIOA 1S5LC 3CJNA 4GRIA 4XNFA 3RKYA 2JUGA 1ZRCA 3NEUA 4I2OA 1T38A 1JT6A 3EETA 2PMUA 1MDMB 2R7QA 1X2MA 3F8BA 3TGNA 2JPCA 3O6BB 4DGWB 1J9IA 3TOBA 4ZTJA 4UVAA 3J81K 3SFZA 4FCYA 2DJNA 4I98B 5H6QA 1G2HA 1T95A 1EH8A 3O3KA 2RNGA 4HF0A 2X51A 4F55A 3A1YA 3FM5A 2X4HA 5J6XA 2QEXI 4HV6A 1APLC 1ZARA 2ISZA 5IT9Z 5LFAA 2NNNA 1QZYA 1Y1WJ 4OOIA 4ESFA 3O8HA 2OU2A 2P8TA 2X0LA 3QP5A 3BT9A 3CCMI 1S29A 1Z7UA 4EJVA 1TWGJ 2JJ7A 5IYBJ 4X1EA 1N25A 1T2KA 3MQ0A 2BW3B 3ZMTA 1K78A 2BHYA 2DO7A 4R8HA 2JMWA 2KJBA 2ZBKA 3H92A 1JE8A 1TT0A 1MGTA 2P5VA 1VQNI 5FRMA 4HPQA 5CVJA 3BJ6A 1V5FA 4KIFA 4CICA 4LK1F 2D5VA 5B1BH 3CC7I 1LFPA 4CCLA 2BGCA 2MH9A 4MHGA 1ERDA 1K6YA 2G0EA 3JRBA 1O7LA 4IO9F 1LVAA 5E3NA 3ZPLA 1PUEE 1TNSA 5ILSA 4C3HJ 1HCRA 1GXQA 1YS7A 1BBYA 1IN5A 2DMQA 1RKWA 3HZJA 1SMTA 2HI3A 1WFXA 2PQ8A 3PSIA 1AKHA 2HKXA 3WTWC 3L2QA 1WI9A 2K9SA 2VKVA 1U2WA 3JSOA 2HGCA 2X6YA 4LFUA 2H1KA 2BW3A 4QSHA 2FBHA 2E34A 1HF0A 2E7WA 3MKLA 4M3FA 3B6CA 5JHUA 3BR6A 3OIQA 3QODA 4CCMA 4RB0A 1YLFA 4KMUX 3V4GA 2MW8A 2NVUB 3PUBA 2B63J 4MFEA 4ZZLA 3OR2C 3HRTA 1YX3A 3J7ZI 2RV8A 2FU4A 2CQ7A 3QPSA 3W2VA 3TDZC 5HNFA 3HC7A 3S1RJ 2DJIA 2B0LA 2NS8A 3ZN0A 2ETHA 2E5NA 2XF6A 3P5JA 1R1UA 4HRIA 2IGMA 4AYBN 2XRNA 2HWVA 4PDKA 2DDAA 3LMMA 3QOPA 3WODF 2Z2SB 2D45A 4R79A 5E18F 3ABTA 1RUNA 3M4OJ 2PG4A 5CKTA 3OOUA 4OMYA 2GXGA 1B4AA 4IEJA 4MTEA 4HLXA 1OCOH 3IC7A 2M3AA 3CDHA 2Z1DA 4OMZA 5DCMB 3BQYA 4BY1J 4BXUA 5CLSA 4ESBA 4M73A 5DS9A 3SDGA 2DQRA 2EWNA 1R9TJ 2E1CA 1UAAA 5HS9A 4IX7A 1YW9A 3R0JA 3K1PA 3JRAA 4S05A 4KYWA 4LG0B 4M71A 5TJJA 3DBRB 2ECBA 1IXCA 3S14J 2R7RA 2XAQA 3RKXA 1GV5A 4DBQA 4Q48A 4AVPA 3CO7C 3AL0C 5K7ZA 5J4VA 2DDBA 2H6CA 1KA8A 5EEAA 4F93B 2M9HA 3WTVC 4ZDPA 3U21A 2ELJA 3I71A 1SMYF 1Z6TA 3SZPA 4B44A 5A2QZ 4J01A 3I55I 2Z3YA 2KDOA 3KETA 4PJNA 2VONA 3CJRB 3KIOA 2K86A 2WY7Q 2EA4A 2KRCA 3OYCA 2DU9A 1EJ9A 2O61A 4IHVA 3U2RA 3GEZA 1ULYA 3K69A 3R61A 4N4NB 1YRNA 4A93J 1TWFJ 1Y0NA 2W84A 2ZFWA 2VODA 3I4MJ 5HNHA 5LGTA 2WV0A 3B6AA 3K2ZA 4RBOA 1QZEA 2WWYA 4OU0A 2NVTJ 3R60A 3AL0B 2XGXA 2NYXA 4A0XA 5ICEA 2HVSA 4L0ZB 1MH3A 1H89C 1XDUA 5TRDA 4BGDA 3TMOA 2IRFG 2BY3A 1OQYA 4RAFA 1QPMA 1S7AA 1FSEA 4B1RA 2HTJA 4XOPA 5HS7A 2O6GE 1VQ7I 1TW2A 2HU9A 2XHKA 2V1UA 3GW2A 3K4CA 4ENNA 2DLLA 4MIMA 3G1MA 3GYHX 1TWCJ 5BOXA 3BCAA 1LQ1A 2PJRB 1R23A 1KU3A 3HG9A 3OYEA 2IVMA 4NBQA 4CSWA 3A03A 3TP3A 3P9CA 4RA2A 4AIJA 4HF2A 2EPFA 1W36C 1OJLA 3A02A 3KP3A 3ZQCA 2M0MA 1BJZA 2CUJA 1Z3YA 3WU2C 4ETSA 2IS2A 1ETYA 1JTYA 1KYZA 4LLLA 1MH4A 4XN0A 5GAHJ 3R6SA 2CFXA 3FK6A 1WHUA 2L2OA 4I01A 4UVCA 3C2GA 3K4KA 4CXFA 2LMDA 2ZXJA 1BR2A 1QO0D 5LHGA 5M5WJ 4ZZDA 4CDGA 4A3DJ 2HKOA 4MQ9F 4L9VA 3BTJA 2IJLA 2DT5A 3BG6A 2VKEA 1BOAA 4BHCA 3LAJA 4G12A 3IAM2 2W57A 2ZB9A 2STTA 3FBIB 4IQJA 2VASA 3DXJF 2R7SA 4XLPF 2JT1A 3JREA 1XGOA 1VQKI 1E3OC 1VQ6I 1H88C 4G7ZF 2CRGA 1IAWA 3S32A 2A69F 3QPTA 4CA0A 1T98A 3F22A 1Z91A 3JRDA 2OBPA 3BJOA 4EM1A 2BBYA 4BL0B 1X1PA 1B72A 4AUXA 3HRSA 2L7KA 1OCPA 1V54H 3AG2H 4RGRA 3REOA 3S1NJ 1SFOJ 4RAGA 2WA0A 2XF5A 2K9QA 4XLCA 5L3BA 4HAMA 1SFEA 3Q0WA 1VQ9I 2WY8Q 1K83J 5BQTA 3C3WA 1ZQ3P 3TOAA 4XKBA 3M3YJ 3PFYA 1VQPI 1TNTA 2DPDA 1ON1A 2HQNA 1RR8C 1U5TC 1FNNA 3ECHA 2M8EA 3CO6C 4GGGA 3A2KA 2QBYA 2DFIA 1IV8A 2PX9A 2XASA 3HYIA 3IP4B 5IP6A 1FP2A 3CCRI 4DIQA 1X3ZB 2HOEA 4CYCA 4ENJA 2IA1A 3MWMA 4NQWB 3LSMA 4DZJA 3J80Z 3RYRA 4WXHA 3CMEI 3BR2A 2COMA 3RI4A 3ZMUA 3DWLE 2BVMA 3FKIJ 4JX5A 3DCFA 3RDIA 3OYIA 2PBIA 3C2BA 2Z9OA 2FRHA 4IHYA 5M3FJ 3HGGA 2F5FA 1X1BA 2CH0A 4IHXA 3OYGA 4KA4A 1J7KA 3HPHA 3ZMZA 3H5RA 3W6VA 4CGZA 1JTXA 4M3DA 2BXYA 2KPMA 5C44J 1WJBA 3JTGA 1UG0A 4G6QA 4HZFA 2QQAA 3KEOA 2DK8A 2KIMA 4CYCB 1IC8A 3OL4A 1VQ8I 5HS8A 3Q9VA 3RPUD 2LNBA 3CMMA 4LIUA 4RAZA 5F1RA 3MKWB 4GYIA 4XLEA 4II3A 3LQRA 1TQIA 1ZLKA 2Q2EB 5M5XJ 1U8BA 1RESA 1ZGAA 4IF4A 2P7VB 1QGPA 3MMYB 1HKSA 3PJRA 2ZJ2A 3RJPA 3CCLI 4D5CA 1BW5A 1K61A 2PMHA 3CC2I 1ETXA 3LSPA 4PJ0C 1R4NB 2DODA 2C6YA 4HV5A 1XCBA 4KT5C 2E1MB 2MFZA 4C2TA 3DEUA 4GDFA 4LIVA 1Z9CA 3JAMK 4PJJA 1VTNC 3MZYA 1GDTA 1Q1HA 3CP8A 3VEPA 1MMDA 3E5UA 5EGOA 1FY7A 3ONQA 2O03A 3V7CA 4BE2A 2Y48A 4LD5A 2OC6A 2JA8J 3ISPA 4ESJA 2V79A 3L2VA 2M8GX 2R7VA 4ANJA 5J3LA 3OYHA 2NVQJ 4DBRA 5EYRA 2MC3A 5CPRB 4YEJA 3VSLA 1P2FA 1ZR4A 1ETQA 3BZCA 4A3CJ 4DW6A 4DYRA 1ZGWA 5E20A 4UUSA 1PYVA 1HBXG 5FROA 1S3JA 3TKYA 4PCQA 3LL7A 1BC7C 1LJ9A 4D1QA 1I3QJ 1I6XA 3ERMA 1ZHFA 4BJTA 2H8WA 1J59A 1O3SA 5B5EC 2YPRA 2R5ZB 3K4LA 1Z7LA 3ZQQA 4YFKF 1CF7B 1A31A 5F64A 3OY9A 1LEAA 1UMQA 1ZN2A 3I59B 3E6BA 3D5RC 2MLKA 4U88A 3A0BC 1IF1A 4XOTA 5GP9A 3I64A 1FC3A 4WX9A 4NC6A 3OIPA 1XC5A 4K2EA 3KX2A 1NK2P 1PDNC 2HYJA 1QNTA 2EJRA 5D8LB 5EEGA 4HNUA 4IHTA 1D1BA 1IN7A 4BH9A 3KZZA 4M6XA 4MNUA 4QWQA 3S3MA 1SD7A 2BY0A 3I58A 1B9MA 2CO5A 5K5QA 5JLXA 1C0WA 3AG3H 2P0WA 2XAHA 2DYRH 4ZYAA 3HDDA 1FSHA 5FLVA 1MMGA 4QPOA 3WTTC 1ORKA 2WAQA 2NOJB 3BG7A 3L2RA 4EATA 4N9IA 2O5RA 1TQPA 3EDPA 3H3UA 4HBLA 1PP7U 1QPIA 4XMYA 3SZGA 2OZ6A 2LK2A 4IRHA 1TC3C 1NH3A 5ED4A 3ZCOA 1RZ4A 2JSPA 4M3EA 1NG7A 5GAGJ 3PNVA 4EV0A 3KFWX 3T8RA 1IUYA 9ANTA 4IHWA 3HOZJ 3UNGC 3BTCA 3ZP5A 3WGIA 3VFZA 4XBFA 1MBKA 4LG3A 4L5JA 2EV6A 1PP8F 1QHGA 4AIKA 2GA2A 1IRXA 2M30A 1R6RA 4BS9A 4OIOF 4KUMA 3KZIC 3O8GA 4G94A 2E19A 3SHFA 3U1DA 2LREA 1S8NA 2FXAA 1OR7C 3FBNB 1HLVA 3G4SI 1GVJA 2BOLA 1PUFB 2HR3A 5EG0B 2DT7B 4IXAA 2CW7A 3DTIA 2MG4A 5J8FA 3JRFA 3HRMA 1DQUA 4H4KC 5L3FA 1HSJA 2QVOA 4LITA 5K1YA 1NK3P 3ZQLA 2EV0A 1KU9A 3M7GA 4UV9A 1MJAA 3DPTA 3GXOA 5CVRA 4A6DA 2A5WA 1WJCA 4JYKA 2NS7A 3FISA 1YQAA 4LK0F 2P4WA 4AU7A 3NRVA 3OYLA 1R5ID 3WTUC 1ODDA 2L01A 2E1NA 1IN6A 1FWZA 2FOWA 4I02A 3G73A 4UV8A 2VXDA 4RGUA 2QA4I 1T39A 1MKMA 2K3PA 4V2GA 5J40A 1LUJB 1TWHJ 4HA8A 2E7XA 3BZ6A 2R93J 4OWRB 3LSGA 5JFRA 4BHPA 3SEQA 3OYMA 4RLQA 2ESNA 1UHWA 2XSDC 1P4AA 4XRSA 2ZMEB 2IXSA 1MNMC 1P4XA 1WVRA 1MJ9A 2WAQN 2EH3A 2ECCA 1ZR2A 3QU3A 2LDUA 3GLXA 3NQOA 3SQNA 4HQEA 1GT0C 5B3SH 4NC8A 5IYDJ 3GX4X 4L9TA 4IQ4A 1SFXA 4TV7A 1WGXA 2YU9J 4M72A 5FLXK 5E8GA 5KK1A 2G9WA 3IL2A 1W0TA 3MD2A 1ZYRF 3E0JB 2KQRA 3ELKA 4LLNA 3J81Z 2PJRA 3L1PA 4GYGA 3ZOBA 4E7IA 3QP6A 1BI0A 2VJIA 1WH5A 3ZMVA 1V55H 2YS9A 3DLLF 1I1SA 5DCFA 2IBDA 3LA2A 4RB3C 1A04A 4CZZA 1VZ0A 4AYBA 1DP3A 1LE8A 1PUFA 2L5QA 2RKHA 2JVGA 4RGSA 1N75A 2MBFA 5BS6A 2LLKA 2KZVA 5ILUA 3EUHA 4U0YA 4KMFA 3QRFF 3WTXC 2M0CA 2QQ8A 3F6VA 1DU0A 3HTSB 3W2AA 2GIZA 3FXKA 1OISA 2KHMA 5JVTA 4BBRJ 3BR1A 3CCYA 2IA0A 5E3MA 5LEJA 3GZ5A 3R0AA 2ZJQF 2IA2A 4NQWA 3HHHA 2MD5A 1F36A 1TT5B 3KP7A 3FWEA 1U78A 5B1AH 1E17A 1VNDA 1JXSA 2XKOA 2XPWA 4S0HB 4IZZA 1EH6A 3OYDA 1P7JA 5FFXA 1CGPA 3QYFA 3GF2A 1D0YA 3A01A 2VB6A 2DA4A 2VKHA 5AIQA 3GFLA 4HSRA 2FJ1A 4P55A 2KDZA 1FP1D 2FNAA 5ERIA 2K02A 1O57A 4M6YA 1JUPA 3RYPA 3PNYA 2Y30A 4XLHA 3QQAA 2E1MC 4WXDA 1W5TA 2JSCA 1OYYA 3WE3A 3QPLA 3K6GA 1FOWA 3G2BA 2JA5J 1D1CA 2UZKA 2F4OB 3QU6A 5FRNA 4CCNA 5L3EA 2W48A 2GM4A 1LFBA 2NVXJ 2HFHA 2HXIA 2GZWA 1XMKA 2DMNA 5DEQA 3LNQA 3E1SA 1FJLA 3HM5A 5E79C 5LEKA 4U0WA 5FB2A 4IOCF 3DU5A 2HVRA 1WZ2A 1UJ8A 3I4PA 2RGVA 3CTAA 3WG9A 2A6EF 1IGNA 1VQ5I 4WWCA 4PGHA 3HRUA 1YJNI 2V9VA 5JI6A 4I76A 2IP2A 2HXOA 1XS9A 1HC8A 2ESHA 4CCJA 1F1ZA 3CDLA 1G8XA 3HTUA 2PEXA 2Y0SN 3H35A 3PIOF 2BY2A 3L9FA 3LSHA 3GTQJ 2I8DA 1FTZA 2XB0X 4RDUA 3E6DA 3V7SA 3MVPA 2DOFA 3VYRB 2V9KA 2R7FA 1MNEA 3MEXA 1JKRC 2M34A 2E60A 2OZUA 1YOVB 1MJBA 1JJ8C 3KEYA 3HOXJ 2P6SA 2MYSA 2DW4A 2A61A 3I56I 2UXXA 2J5PA 2DOAA 2CUZA 4KJZA 4LJZF 2KIUA 1Z1DA 3PFIA 1I5ZA 5CQEA 5KCMA 4M9SA 3GTKJ 3N05A 2VC1A 5L3CA 2K3FA 5D4SA 1JI8A 3CUOA 3VYTB 3N4MA 1UELB 3W6JB 5EDNA 3FXRA 3I3LA 1R58A 4DYCA 2Y9ZA 4BQAA 4XICA 3S2HJ 1T33A 3PUFA 4AIDA 4F7ZA 3CD6I 2TDXA 3GCMA 5LHHA 4A69C 1SC7A 1Y56A 2HYGD 2CUFA 3W2WA 2CU7A 2LG4A 3KYCB 2QLZA 4PFPA 2BV6A 1TBXA 2MGQA 1BI1A 1W7PB 4L18B 2FE3A 1QRYA 1B6AA 2DTZA 5IP7J 3OR1C 2KLOA 2EIMH 5IT3A 3CESA 2LC2A 2KRHA 1BC8C 3Q0VA 4BACA 2XGDA 5CYVA 3ZQFA 2AHQA 2BY1A 2X1CA 3F9KA 2L7MP 3DF8A 3H0DA 4OIRF 2EIJH 1EA3A 2A5YB 4U87A 3E6CC 3ESWB 3RCOA 2VE8A 1I27A 1Z77A 1YJ9I 3UR3C 3ECOA 1DGWY 1V5GA 1YYVA 3CCSI 5EEHA 1VFCA 1ONVA 3IUOA 2EIKH 4BDYA 4EJWA 2M87A 1P4WA 4NC7A 3CDIA 2DA6A 4LGWA 1JKPC 2PMZN 3BWGA 2CUEA 3L2CA 2Y9YA 2Z16A 5K7HA 2HZTA 4KISA 1DUXC 4BE1A 2HPIA 1GV2A 2DPUA 2FF4A 3PQJA 2K9LA 4O5VA 4ZDLA 1GUUA 3VYUB 4HEA2 4LOCA 1FBQA 3WTZA 1U8RA 1HDPA 5BNGA 1OCRH 5FKMA 1X2NA 2LKSA 3PM1A 4I6ZA 3SEZA 2ZJRF 3VOEA 2D1HA 3K1MA 3ZXSA 1WJFA 1J5YA 1WQ2A 4Z2YA 4IRIA 2V9PA 4EGZA 4YIRX 2JA2A 1U5TB 5DV5A 1MBEA 1BIAA 4R1HA 3GWZA 2WC2A 1YW7A 5H20A 1UHMA 3CC4I 2F4IA 5HDNA 2V1XA 5D4RA 2L9VA 4A5MA 1K4TA 1D8KA 3KP6A 2R5YA 2RDPA 3R4KA 3G1OA 1R7JA 4RS8A 2HDCA 2MA3A 4MGRA 1B8IA 2W1OA 1MBJA 4XKWA 4BNCA 4BHBA 2LVSA 1TWAJ 1I6HJ 3OV8A 1W7PA 2XKPA 3IRRA 3C7JA 2DBBA 2HOSA 3KZYA 3FZVA 2EINH 4A3IJ 2IGKA 1G3SA 2WADA 3WU0A 2QENA 4CCKA 1BA5A 3CF5F 3SDBA 1FZPB 4DOZA 2EFOA 3ASOH 4DZPA 2XC7A 3ZMDA 2EQRA 2YX4A 3FDYA 1MMSA 3RKWA 2Z33A 3IH4A 3BTLA 1FYMA 5J1RA 1UZCA 3A4CA 5FD5A 3T5XA 5IY5H 2NXNB 4BEHA 1FOYA 2H09A 3S3OA 3DEWA 1J09A 1P9QC 2LP0A 1ZAOA 2MH2A 3U1KA 4A6EA 3OYBA 3DPUA 1FMWA 4A5NA 1MZBA 1ON2A 2V1NA 4OAYA 1ZGJA 2XROA 2ZJPF 2LR8A 2VUMJ 4A0YA 2DMUA 1VF9A 3IAS2 2CQQA 1QU3A 4WK8F 2AQFA 4ITVA 3FXLA 3CCQI 4F52A 3L2WA 2H1LA 4J00A 3F8MA 1RETA 2HQRA 5FO5A 1NG6A 3DTEA 1R5HA 4P9FA 5KVRA 3DKXA 3OOPA 3DPLC 1FOKA 1U3EM 2DMTA 4BYYA 4XLFA 5K5RA 4NNJA 1SVOA 4BQNA 1IDYA 2JTVA 4ZYGA 4XLAA 3BROA 4KIBA 3LSTA
chains in the Genus database with same CATH topology
1MBGA 5JLXA 1ITYA 2L7FP 1ZK8A 3G1LA 2HDDA 3HDDA 1HDDC 4FE7A 5FLVA 3FK7A 1GVDA 1POGA 1ORKA 2ID3A 4AC0A 3Q3SA 5F27A 4GFBA 4JP0A 5F1JA 1EF4A 5F0CA 3HKZN 1JT6A 2R92J 4B4CA 1QPIA 4JX4A 1WH7A 5M5YJ 1X2MA 2LK2A 4J19A 1TC3C 5EF6A 2ME0A 1B8IB 2DMPA 1ETKA 4FCYA 2DJNA 1G2HA 5IPAA 4M3EA 2OPTA 3GTLJ 2L9RA 3RKQA 3OSGA 1OCTC 5EG0A 9ANTA 4C2MJ 4NDLA 4IHWA 3HOZJ 1I50J 4Y7NJ 3BTCA 2I10A 1APLC 1MBKA 3H0GJ 3UKGA 3RZOJ 1Y1WJ 2IEKA 3O8HA 2YUSA 1ETWA 2DN0A 3NAUA 3BT9A 3O8GA 2E19A 1IDZA 1TWGJ 2X48A 2JJ7A 2O9LA 1HLVA 5IYBJ 4X1EA 4A3EJ 2ELKA 2K40A 3LOCA 1PUFB 5EG0B 3OIOA 2MG4A 3JRFA 4A3BJ 3IH3A 1NK3P 1MBFA 3D1NI 2JMWA 2LKXA 1WI3A 4D7NA 3CMYA 3ZQLA 1RR7A 2QCOA 5K7FA 3F0CA 2Y2ZA 4JYKA 2D5VA 2NS7A 3FISA 1B72B 1X58A 2LD5A 2G0EA 3JRBA 5E3NA 4C3HJ 1HCRA 2DMQA 1RKWA 4V2GA 2HI3A 1TWHJ 2R93J 3TP0A 3LSGA 1AKHA 2R7ZJ 1OFCX 3PO3J 3HB9A 3BQZA 2K9SA 2VKVA 1AHDP 2L7ZA 2H1KA 2XSDC 4XRSA 4QSHA 3RZDJ 1HF0A 2OF7A 3MKLA 4M3FA 3B6CA 1IG7A 1ETOA 1MNMC 3BR6A 2N8GA 4D5FA 4V2FA 2WAQN 2MW8A 4A3LJ 2EH3A 2ECCA 4BKXA 1ZR2A 2NVYJ 2B63J 4MFEA 1GT0C 1ENHA 5IYDJ 1IJWC 4ABZA 3QPSA 3BG3A 1WGXA 5JLWA 2YU9J 1DU6A 3S1RJ 4A3FJ 2NS8A 5C3EJ 3SFIA 2E2IJ 2L0KA 1UHSA 1W0TA 1WPKA 4AYBN 3GTMJ 3JRHA 4X6AJ 2EZIA 3L1PA 3ZOBA 2KT0A 5EGOB 4JX6A 2H8RA 3M4OJ 1WH5A 3OOUA 4IEJA 2YS9A 5F0HA 3GBGA 3BQYA 4BY1J 2IBDA 5DS9A 3SDGA 1WCMJ 2HQ5A 2ID6A 2VPRA 1R9TJ 3LSJA 3S16J 1MSEC 3JRAA 1LE8A 1CQTA 1PUFA 4UUTA 3GTJJ 3TW7A 2JA7J 1ZTRA 2ECBA 3S14J 3NARA 1QVTA 1GV5A 5HODA 2LLKA 5K7ZA 5EEAA 2M0CA 2M9HA 4W1UA 1DU0A 5E3LA 1YRNB 4MFDA 4BBRJ 2R0QC 3HOUJ 3CQZJ 1S7EA 2EZHA 3BR1A 5EZHA 3CCYA 5E3MA 5IOYA 4IHVA 2DA5A 1BW6A 2WV1A 3HOVJ 5M3MJ 4HNVA 1LE8B 1YRNA 1T56A 1F36A 1IUFA 1ZKGA 1U78A 2GLOA 5FKLA 1AKHB 4A93J 1TWFJ 5FKKA 2LTPA 2TRTA 1VNDA 1IRZA 3I4MJ 2XPWA 4S0HB 3B6AA 4RBOA 1A5JA 1P7JA 4A3GJ 2NVTJ 3BR5A 3A01A 1MH3A 2DA4A 1H89C 2FJ1A 2KDZA 4XK4A 1JUSA 3TEDA 4M3BA 5C4XJ 4B1RA 1JUPA 2Y30A 2X6OA 3LSRA 5J1UA 3QQAA 2TCTA 4L5EA 3QPLA 3HOWJ 2JA5J 4DYQA 4MIMA 2W48A 3G1MA 2GM4A 2JWTA 4QIWN 1TWCJ 1LFBA 2NVXJ 3HOYJ 2HXIA 1SANA 2DMNA 4BBSJ 4C3JJ 3LNQA 1JUMA 1FJLA 3HM5A 2HOTA 2DA7A 2LFBA 1XG1A 3A03A 3TP3A 3IH2A 3S1MJ 1OJLA 1IGNA 3A02A 3ZQCA 2LY9A 1BJZA 4EEFG 1ETYA 1JTYA 4I76A 2HXOA 5F0FA 3OSFA 1XS9A 1D5YA 1MH4A 2EZKA 2EZLA 3CDLA 4D7MA 2Y0SN 3FK6A 3K2AA 5DTDA 4XRMA 2E1OA 3RQIA 3HBLA 3FIWA 3WHCA 3GTQJ 1UG2A 1FTZA 5M5WJ 2XB0X 4RDUA 2NOGA 4A3DJ 3S1QJ 3MVPA 5E3OA 3BTJA 2WB1N 2VKEA 1JKRC 2M34A 3JR9A 4G12A 3GTGJ 2ZB9A 4BY7J 3JREA 1JJ8C 1JKQC 3HOXJ 4M6VA 1LFUP 1E3OC 4XIDA 1H88C 4XRSG 2GBYA 3S17J 2CRGA 5GPAA 1HOMA 2VI6A 3JRDA 1NTCA 1A6IA 3H3VK 1B72A 4AUXA 3GTKJ 1OCPA 3S1NJ 5FKOA 1SFOJ 3JRCA 2K9QA 5EDNA 5FLMJ 1Q1VA 4DYCA 2Y9ZA 2XRLA 3Q0WA 4XICA 2M2EA 3S2DJ 1T33A 3S2HJ 1K83J 3HGYA 3ZQHA 1ZQ3P 4A69C 1F43A 2RAEA 5GPCA 2CUFA 3TW6A 3M3YJ 2CU7A 5EZGA 2DA3A 2X9DA 2XGEA 3S15J 2IAIA 1RKTA 2MGQA 4Y52J 5J1YA 1FTTA 1QRYA 2DTZA 5IP7J 5FJ8J 3GTPJ 5IP6A 3WHBA 3I4NJ 5IYCJ 2JN6A 2CJJA 4CYCA 1MSFC 2AO9A 1H8AC 3Q0VA 2XGDA 3BG5A 3ZQFA 3VPRA 2AHQA 4DZJA 1O4XA 2XGCA 3BR2A 3JRIA 2L7MP 3FKIJ 4JX5A 1JGGA 3DCFA 5FKNA 1Z77A 5IOZA 3C2BA 1VFCA 4IHYA 5M3FJ 3HGGA 2E2HJ 4IHXA 2DA6A 2HOAA 1JKPC 4QTRA 1QVUA 1FIPA 2PMZN 4FE4A 3ZQGA 3W6VA 2CUEA 2Y9YA 1IV6A 5K7HA 1JTXA 4M3DA 1GV2A 5C44J 1JT0A 5F04A 1GUUA 3BR3A 2O7OA 4CYCB 4LOCA 1IC8A 1W0UA 1HDPA 1MBHA 5BNGA 5FKMA 1X2NA 2Y31A 3A01B 2K9NA 4MO7A 5IP9J 2XPUA 3PM1A 4I6ZA 2E2JJ 2R5ZA 4A3MJ 2O8KA 3JRGA 5M5XJ 3MN2A 1U8BA 1RESA 1Z0XA 2EBIA 2R5YB 1MBEA 2FD5A 2JA6J 3GTOJ 4D5CA 1BW5A 1K61A 1JJ6C 1ETXA 4UUSB 3LSPA 2QF7A 3Q0UA 4W97A 2COBA 2R5YA 1GDTA 3G1OA 3HEFA 4FISA 1B8IA 1MBJA 2ME6A 5EGOA 2DA1A 2LVSA 1TWAJ 1I6HJ 2JA8J 3BTIA 1VI0A 2XPVA 4MLOA 2HOSA 2CQXA 1U9OA 2M8GX 4A3IJ 1P7IA 5J3LA 2NVQJ 4A3JJ 2FQ4A 5EYRA 3E7LA 1ZR4A 1ETQA 5C4JJ 4A3CJ 1BA5A 1RPWA 4DW6A 4DYRA 1ZGWA 4UUSA 4DZPA 2EQRA 1AU7A 3K7AJ 2JK3A 1I3QJ 3IH4A 3BTLA 5J1RA 4M3GA 4A3KJ 2DA2A 3IV5A 1BL0A 3SJMA 1U9NA 3DEWA 2LP0A 3BR0A 2R5ZB 1JKOC 4B3AA 1Y1VJ 3BG9A 1UMQA 4FTHA 2XB5A 2LR8A 2VUMJ 5GP9A 2DMUA 1ETVA 1VF9A 4C3IJ 2CQQA 3ZQIA 1XC5A 1RETA 1FIAA 2MSYA 1NK2P 2HYJA 5F08A 2DMTA 4BXXJ 3PO2J 1IDYA 2P81A 1FEXA 2FX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBG A;  5JLX A;  1ITY A;  2L7F P;  1ZK8 A;  3G1L A;  2HDD A;  3HDD A;  1HDD C;  4FE7 A;  5FLV A;  3FK7 A;  1GVD A;  1POG A;  1ORK A;  2ID3 A;  4AC0 A;  3Q3S A;  5F27 A;  4GFB A;  4JP0 A;  5F1J A;  1EF4 A;  5F0C A;  3HKZ N;  1JT6 A;  2R92 J;  4B4C A;  1QPI A;  4JX4 A;  1WH7 A;  5M5Y J;  1X2M A;  2LK2 A;  4J19 A;  1TC3 C;  5EF6 A;  2ME0 A;  1B8I B;  2DMP A;  1ETK A;  4FCY A;  2DJN A;  1G2H A;  5IPA A;  4M3E A;  2OPT A;  3GTL J;  2L9R A;  3RKQ A;  3OSG A;  1OCT C;  5EG0 A;  9ANT A;  4C2M J;  4NDL A;  4IHW A;  3HOZ J;  1I50 J;  4Y7N J;  3BTC A;  2I10 A;  1APL C;  1MBK A;  3H0G J;  3UKG A;  3RZO J;  1Y1W J;  2IEK A;  3O8H A;  2YUS A;  1ETW A;  2DN0 A;  3NAU A;  3BT9 A;  3O8G A;  2E19 A;  1IDZ A;  1TWG J;  2X48 A;  2JJ7 A;  2O9L A;  1HLV A;  5IYB J;  4X1E A;  4A3E J;  2ELK A;  2K40 A;  3LOC A;  1PUF B;  5EG0 B;  3OIO A;  2MG4 A;  3JRF A;  4A3B J;  3IH3 A;  1NK3 P;  1MBF A;  3D1N I;  2JMW A;  2LKX A;  1WI3 A;  4D7N A;  3CMY A;  3ZQL A;  1RR7 A;  2QCO A;  5K7F A;  3F0C A;  2Y2Z A;  4JYK A;  2D5V A;  2NS7 A;  3FIS A;  1B72 B;  1X58 A;  2LD5 A;  2G0E A;  3JRB A;  5E3N A;  4C3H J;  1HCR A;  2DMQ A;  1RKW A;  4V2G A;  2HI3 A;  1TWH J;  2R93 J;  3TP0 A;  3LSG A;  1AKH A;  2R7Z J;  1OFC X;  3PO3 J;  3HB9 A;  3BQZ A;  2K9S A;  2VKV A;  1AHD P;  2L7Z A;  2H1K A;  2XSD C;  4XRS A;  4QSH A;  3RZD J;  1HF0 A;  2OF7 A;  3MKL A;  4M3F A;  3B6C A;  1IG7 A;  1ETO A;  1MNM C;  3BR6 A;  2N8G A;  4D5F A;  4V2F A;  2WAQ N;  2MW8 A;  4A3L J;  2EH3 A;  2ECC A;  4BKX A;  1ZR2 A;  2NVY J;  2B63 J;  4MFE A;  1GT0 C;  1ENH A;  5IYD J;  1IJW C;  4ABZ A;  3QPS A;  3BG3 A;  1WGX A;  5JLW A;  2YU9 J;  1DU6 A;  3S1R J;  4A3F J;  2NS8 A;  5C3E J;  3SFI A;  2E2I J;  2L0K A;  1UHS A;  1W0T A;  1WPK A;  4AYB N;  3GTM J;  3JRH A;  4X6A J;  2EZI A;  3L1P A;  3ZOB A;  2KT0 A;  5EGO B;  4JX6 A;  2H8R A;  3M4O J;  1WH5 A;  3OOU A;  4IEJ A;  2YS9 A;  5F0H A;  3GBG A;  3BQY A;  4BY1 J;  2IBD A;  5DS9 A;  3SDG A;  1WCM J;  2HQ5 A;  2ID6 A;  2VPR A;  1R9T J;  3LSJ A;  3S16 J;  1MSE C;  3JRA A;  1LE8 A;  1CQT A;  1PUF A;  4UUT A;  3GTJ J;  3TW7 A;  2JA7 J;  1ZTR A;  2ECB A;  3S14 J;  3NAR A;  1QVT A;  1GV5 A;  5HOD A;  2LLK A;  5K7Z A;  5EEA A;  2M0C A;  2M9H A;  4W1U A;  1DU0 A;  5E3L A;  1YRN B;  4MFD A;  4BBR J;  2R0Q C;  3HOU J;  3CQZ J;  1S7E A;  2EZH A;  3BR1 A;  5EZH A;  3CCY A;  5E3M A;  5IOY A;  4IHV A;  2DA5 A;  1BW6 A;  2WV1 A;  3HOV J;  5M3M J;  4HNV A;  1LE8 B;  1YRN A;  1T56 A;  1F36 A;  1IUF A;  1ZKG A;  1U78 A;  2GLO A;  5FKL A;  1AKH B;  4A93 J;  1TWF J;  5FKK A;  2LTP A;  2TRT A;  1VND A;  1IRZ A;  3I4M J;  2XPW A;  4S0H B;  3B6A A;  4RBO A;  1A5J A;  1P7J A;  4A3G J;  2NVT J;  3BR5 A;  3A01 A;  1MH3 A;  2DA4 A;  1H89 C;  2FJ1 A;  2KDZ A;  4XK4 A;  1JUS A;  3TED A;  4M3B A;  5C4X J;  4B1R A;  1JUP A;  2Y30 A;  2X6O A;  3LSR A;  5J1U A;  3QQA A;  2TCT A;  4L5E A;  3QPL A;  3HOW J;  2JA5 J;  4DYQ A;  4MIM A;  2W48 A;  3G1M A;  2GM4 A;  2JWT A;  4QIW N;  1TWC J;  1LFB A;  2NVX J;  3HOY J;  2HXI A;  1SAN A;  2DMN A;  4BBS J;  4C3J J;  3LNQ A;  1JUM A;  1FJL A;  3HM5 A;  2HOT A;  2DA7 A;  2LFB A;  1XG1 A;  3A03 A;  3TP3 A;  3IH2 A;  3S1M J;  1OJL A;  1IGN A;  3A02 A;  3ZQC A;  2LY9 A;  1BJZ A;  4EEF G;  1ETY A;  1JTY A;  4I76 A;  2HXO A;  5F0F A;  3OSF A;  1XS9 A;  1D5Y A;  1MH4 A;  2EZK A;  2EZL A;  3CDL A;  4D7M A;  2Y0S N;  3FK6 A;  3K2A A;  5DTD A;  4XRM A;  2E1O A;  3RQI A;  3HBL A;  3FIW A;  3WHC A;  3GTQ J;  1UG2 A;  1FTZ A;  5M5W J;  2XB0 X;  4RDU A;  2NOG A;  4A3D J;  3S1Q J;  3MVP A;  5E3O A;  3BTJ A;  2WB1 N;  2VKE A;  1JKR C;  2M34 A;  3JR9 A;  4G12 A;  3GTG J;  2ZB9 A;  4BY7 J;  3JRE A;  1JJ8 C;  1JKQ C;  3HOX J;  4M6V A;  1LFU P;  1E3O C;  4XID A;  1H88 C;  4XRS G;  2GBY A;  3S17 J;  2CRG A;  5GPA A;  1HOM A;  2VI6 A;  3JRD A;  1NTC A;  1A6I A;  3H3V K;  1B72 A;  4AUX A;  3GTK J;  1OCP A;  3S1N J;  5FKO A;  1SFO J;  3JRC A;  2K9Q A;  5EDN A;  5FLM J;  1Q1V A;  4DYC A;  2Y9Z A;  2XRL A;  3Q0W A;  4XIC A;  2M2E A;  3S2D J;  1T33 A;  3S2H J;  1K83 J;  3HGY A;  3ZQH A;  1ZQ3 P;  4A69 C;  1F43 A;  2RAE A;  5GPC A;  2CUF A;  3TW6 A;  3M3Y J;  2CU7 A;  5EZG A;  2DA3 A;  2X9D A;  2XGE A;  3S15 J;  2IAI A;  1RKT A;  2MGQ A;  4Y52 J;  5J1Y A;  1FTT A;  1QRY A;  2DTZ A;  5IP7 J;  5FJ8 J;  3GTP J;  5IP6 A;  3WHB A;  3I4N J;  5IYC J;  2JN6 A;  2CJJ A;  4CYC A;  1MSF C;  2AO9 A;  1H8A C;  3Q0V A;  2XGD A;  3BG5 A;  3ZQF A;  3VPR A;  2AHQ A;  4DZJ A;  1O4X A;  2XGC A;  3BR2 A;  3JRI A;  2L7M P;  3FKI J;  4JX5 A;  1JGG A;  3DCF A;  5FKN A;  1Z77 A;  5IOZ A;  3C2B A;  1VFC A;  4IHY A;  5M3F J;  3HGG A;  2E2H J;  4IHX A;  2DA6 A;  2HOA A;  1JKP C;  4QTR A;  1QVU A;  1FIP A;  2PMZ N;  4FE4 A;  3ZQG A;  3W6V A;  2CUE A;  2Y9Y A;  1IV6 A;  5K7H A;  1JTX A;  4M3D A;  1GV2 A;  5C44 J;  1JT0 A;  5F04 A;  1GUU A;  3BR3 A;  2O7O A;  4CYC B;  4LOC A;  1IC8 A;  1W0U A;  1HDP A;  1MBH A;  5BNG A;  5FKM A;  1X2N A;  2Y31 A;  3A01 B;  2K9N A;  4MO7 A;  5IP9 J;  2XPU A;  3PM1 A;  4I6Z A;  2E2J J;  2R5Z A;  4A3M J;  2O8K A;  3JRG A;  5M5X J;  3MN2 A;  1U8B A;  1RES A;  1Z0X A;  2EBI A;  2R5Y B;  1MBE A;  2FD5 A;  2JA6 J;  3GTO J;  4D5C A;  1BW5 A;  1K61 A;  1JJ6 C;  1ETX A;  4UUS B;  3LSP A;  2QF7 A;  3Q0U A;  4W97 A;  2COB A;  2R5Y A;  1GDT A;  3G1O A;  3HEF A;  4FIS A;  1B8I A;  1MBJ A;  2ME6 A;  5EGO A;  2DA1 A;  2LVS A;  1TWA J;  1I6H J;  2JA8 J;  3BTI A;  1VI0 A;  2XPV A;  4MLO A;  2HOS A;  2CQX A;  1U9O A;  2M8G X;  4A3I J;  1P7I A;  5J3L A;  2NVQ J;  4A3J J;  2FQ4 A;  5EYR A;  3E7L A;  1ZR4 A;  1ETQ A;  5C4J J;  4A3C J;  1BA5 A;  1RPW A;  4DW6 A;  4DYR A;  1ZGW A;  4UUS A;  4DZP A;  2EQR A;  1AU7 A;  3K7A J;  2JK3 A;  1I3Q J;  3IH4 A;  3BTL A;  5J1R A;  4M3G A;  4A3K J;  2DA2 A;  3IV5 A;  1BL0 A;  3SJM A;  1U9N A;  3DEW A;  2LP0 A;  3BR0 A;  2R5Z B;  1JKO C;  4B3A A;  1Y1V J;  3BG9 A;  1UMQ A;  4FTH A;  2XB5 A;  2LR8 A;  2VUM J;  5GP9 A;  2DMU A;  1ETV A;  1VF9 A;  4C3I J;  2CQQ A;  3ZQI A;  1XC5 A;  1RET A;  1FIA A;  2MSY A;  1NK2 P;  2HYJ A;  5F08 A;  2DMT A;  4BXX J;  3PO2 J;  1IDY A;  2P81 A;  1FEX A;  2FX0 A; 
#chains in the Genus database with same CATH topology
 2DFF A;  2L7F P;  2HDD A;  3M9A A;  1HDD C;  1RRJ A;  1KQ0 A;  2GAU A;  2H6B A;  1GVD A;  3KCC A;  3RQ4 A;  1R1T A;  2QSF X;  4B48 A;  1LDJ A;  2EFQ A;  5LBQ A;  3QOE A;  2ID3 A;  3ULQ B;  4AC0 A;  3IWZ A;  4C2U A;  1G59 A;  3CUQ B;  4JP0 A;  3EYI A;  2KIF A;  5F0C A;  2EB7 A;  1XGS A;  3DTK A;  1XX5 A;  4B4C A;  4J19 A;  4LLG F;  2PJP A;  2DYS H;  2ZFU A;  1Y8Q B;  5EF6 A;  4FAS D;  2ME0 A;  1B8I B;  2DMP A;  1ETK A;  4IVN A;  3K0L A;  1J75 A;  4N0B A;  3GTL J;  5GTI C;  2QKL B;  2FQ3 A;  3A0H C;  2L9R A;  2YSR A;  3OMY A;  3RKQ A;  5E1Z B;  1YFH A;  4C2M J;  4NDL A;  2LF8 A;  3M07 A;  2I10 A;  4HNT A;  2PN6 A;  1REP C;  2ICW G;  3E5X A;  3H0G J;  1T6S A;  1UST A;  1X4P A;  3UKG A;  2HYF A;  1YS6 A;  4MQV A;  4MTD A;  3T1B A;  3RZO J;  1SEU A;  3E3V A;  1HQC A;  3NAU A;  2W4S A;  5F6F A;  2R7X A;  4D0P A;  3JW4 A;  3MZH A;  1IDZ A;  1FOX A;  1UB9 A;  4A3E J;  2K40 A;  2FSW A;  3LOC A;  3AFH A;  4OIQ F;  3OYJ A;  5D5U B;  4E7Z A;  3OIO A;  4FHT A;  3RIR A;  5BPI A;  3EYY A;  5CJ9 A;  2JRM A;  3VB2 A;  4A3B J;  2ZO4 A;  2AS5 F;  1MBF A;  2LKX A;  4D7N A;  2OD5 A;  4XQF A;  3F3X A;  3DU6 A;  5K7F A;  2Y2Z A;  1YO5 C;  2AXT C;  3COA C;  5AON A;  2VQC A;  4RM2 A;  4O6J A;  1ZRF A;  2NS0 A;  4FT8 A;  3T8T A;  2F5V A;  3WTS C;  5FLX Z;  4HLY A;  2A6H F;  5HLT A;  3I54 A;  3VYS B;  3HSF A;  2A05 A;  1IRF A;  2W00 A;  3TO7 A;  1USS A;  4KN7 X;  5D8K B;  2L02 A;  3CCV I;  5HDK A;  5ICG A;  1TTY A;  5D5W B;  3VDX A;  4M9Z A;  1HW2 A;  2R7Z J;  3WTY C;  1OFC X;  3PO3 J;  4CO8 A;  1AHD P;  4LB5 A;  1Z21 A;  5FD6 A;  3ZR8 X;  5HLG A;  4I0B A;  4E7S A;  3WU1 B;  3HKZ A;  4S04 A;  2F5D A;  2IGO A;  2RQP A;  4KT6 A;  4ZYH A;  3I53 A;  1JHF A;  1F4K A;  1OKR A;  4G8X A;  1SFK A;  2O0Y A;  3EUH C;  2NVY J;  1T8I A;  2MAB A;  1WKM A;  4UB8 C;  3H5A A;  4ABZ A;  3BG3 A;  4E7J A;  5JLW A;  1IN8 A;  3SFI A;  4D9J A;  2E2I J;  4PK4 A;  2L0K A;  1U5T A;  1WPK A;  3C18 A;  1D3Y A;  1P6R A;  1X1D A;  1U0J A;  1J2X A;  4OAZ A;  3IWF A;  1M1E B;  4P9U A;  2KT0 A;  5EGO B;  2H8R A;  2CQN A;  5JVG F;  2CW0 F;  2VBW A;  4RMN A;  2M7B A;  1AA7 A;  4Y3O A;  1D8J A;  3GBG A;  4I7H A;  4P1W A;  4DJA A;  2R4G A;  4KFC A;  3P7N A;  3F6O A;  1WCM J;  3LSJ A;  3QAH A;  3P9I A;  3IRQ A;  2R3S A;  3TL4 X;  2OCC H;  1CQT A;  4XKC A;  2RVC A;  3TW7 A;  2JA7 J;  3L00 A;  3GZN B;  2Z99 A;  1W5S A;  1RC9 A;  2H94 A;  1X1C A;  4XON A;  2KIS A;  5HOD A;  1MDM A;  4HDU A;  1R36 A;  3LFK A;  4Q47 A;  1D1A A;  3L7W A;  2ZSH B;  4E70 A;  2G7U A;  3S3N A;  2ADU A;  4OIP F;  1X4O A;  1YRN B;  3H5N A;  3QYB A;  1OLT A;  4E7L A;  1FPQ A;  2FBK A;  2X6W A;  5J4Y A;  1IZ1 A;  3CQZ J;  4LG0 A;  1S7E A;  3F72 A;  3FF5 A;  5D5X B;  4KDP A;  5EZH A;  2ZME C;  2OJE D;  2HTS A;  5IOY A;  2UXN A;  1BW6 A;  2WV1 A;  1LE8 B;  1FLI A;  1T56 A;  1HST A;  1ZKG A;  2BHZ A;  4NB5 A;  2DT6 A;  4CZC A;  2LTP A;  4GCV A;  5H2F C;  2KJC A;  3WGG A;  3OS1 A;  4I09 A;  3AKZ A;  1A5J A;  5CQG A;  3K4B A;  3QWL A;  3Q5F A;  2QUF A;  4A3G J;  3BR5 A;  3KPH A;  1ZRD A;  4G7H F;  1VQL I;  5DYM A;  1DPR A;  4E6K G;  1E0E A;  2VOO A;  4JBA A;  2IT0 A;  4XK4 A;  1JUS A;  3PNT A;  5C4X J;  4U7D A;  4DNC A;  2X6O A;  5J1U A;  2TCT A;  1KU7 A;  3OYF A;  1B59 A;  3HOW J;  3FXQ A;  3TBI A;  3HOS A;  3BJA A;  1OPC A;  4P96 A;  2ELH A;  2PFB A;  2JWT A;  4B47 A;  4QIW N;  2JQ7 A;  4Q5S F;  1QQI A;  2Q1Z B;  3HOY J;  1SAN A;  2F6C A;  3MKY B;  4C3J J;  3NWT A;  1BR4 A;  2DA7 A;  3S2W A;  2R7W A;  4XSZ F;  4HST A;  1YIT I;  3F21 A;  2HEO A;  2FEZ A;  3IH2 A;  4G9Y A;  3CZ6 A;  2EK5 A;  1BIB A;  3IKV A;  2LY9 A;  3DBL B;  3K4J A;  5F0F A;  3N97 A;  3OSF A;  1D5Y A;  1TLH B;  1R71 A;  2A68 F;  2HQA A;  1TZL A;  2WBM A;  4D7M A;  5DTD A;  1Z6R A;  4BJ6 C;  1RI7 A;  1T0F C;  3RQI A;  2VXZ A;  5HLH A;  1UG2 A;  3HSE A;  4B43 A;  3CLO A;  3S1Q J;  3K4M A;  1SAU A;  3LSI A;  4ENM A;  1LKX A;  5LLQ A;  1FYK A;  3GTG J;  3LA3 A;  4BY7 J;  3J7A O;  1JKQ C;  1XGM A;  2DAO A;  2FA5 A;  2OTJ I;  3BPV A;  4CHU A;  4M6V A;  1LFU P;  4XID A;  4XRS G;  1WJ5 A;  4GO1 A;  4YG2 F;  3H36 A;  2EV5 A;  2DOE A;  2VI6 A;  4XR6 A;  2M4K A;  2OTL I;  4BDZ A;  2VOP A;  2MD0 A;  1A6I A;  2W7N A;  4YRV A;  4YII A;  4RGX A;  3DKY A;  4Y17 A;  5FKO A;  3LAP A;  3JRC A;  4UNO A;  1KGS A;  2WAF A;  5FLM J;  4E7H A;  1Q1V A;  2BEO A;  2VQG A;  4F91 B;  1YE9 A;  2M5W A;  2XRL A;  2M2E A;  3S2D J;  1HA8 A;  1ACI A;  1WWX A;  2RQQ A;  4C9Y A;  2HS5 A;  2ISY A;  2XAF A;  2DK5 A;  2R7D A;  2VL8 A;  2RAE A;  5GPC A;  2A6T A;  1KYW A;  2DTR A;  2V4J C;  1MW7 A;  4G6T B;  3VWB A;  4JOM A;  5DD4 A;  4ZDO A;  2X9D A;  3S15 J;  2XGE A;  3FHZ A;  2IAI A;  2VT2 A;  2RNJ A;  1RKT A;  1WJA A;  3V8L A;  1SVL A;  5J1Y A;  1SFU A;  1XTA A;  5TIS C;  2VJJ A;  1FTT A;  2CS3 A;  4AM3 A;  2UWM A;  5FJ8 J;  2LKP A;  1P92 A;  1V3F A;  4Z6Y A;  1X3U A;  3WHB A;  2M1B A;  3I4N J;  5IYC J;  2CJJ A;  2AQE A;  2DFE A;  1BOB A;  4PSX A;  3BG5 A;  4EQQ A;  4ZC3 A;  4EJO A;  5A2Q K;  4BQQ A;  2ZKZ A;  2XGC A;  1K78 B;  2M4G A;  4ZTF A;  5FKN A;  3H9Q A;  1FBU A;  3CUQ C;  3C2H A;  4BEH B;  3OYA A;  2HOA A;  4EM0 B;  4QTR A;  1QVU A;  3O2P E;  2EFP A;  1FIP A;  1MMA A;  2VBX A;  3SZT A;  4FE4 A;  2LF7 A;  2NAZ A;  3GFM A;  4N4O B;  1IV6 A;  1S9H A;  1BR1 A;  1JT0 A;  4BAY A;  5F04 A;  3FM3 A;  1Y39 A;  2CGP A;  5K5O A;  1PVE A;  1HXD A;  3SYT A;  3RSN A;  2XUB A;  5LD2 C;  4U7B A;  3BR3 A;  2O7O A;  3KYD B;  2LRD A;  1KQ8 A;  2VBZ A;  2XAU A;  2Y31 A;  3TO9 A;  3A01 B;  4MO7 A;  5IP9 J;  3I9V 2;  2ZCW A;  4Q4Z F;  2DXI A;  4WF2 A;  3FKJ A;  2JVH A;  2ZNZ A;  2ZXW H;  1EH7 A;  4A3M J;  2O8K A;  2YX7 A;  3EUK L;  4A0Z A;  4AVZ A;  1XD7 A;  2EBI A;  1Y0U A;  1S6L A;  3B02 A;  4XL9 A;  1LB2 A;  3ML6 A;  3GTO J;  2VQL A;  3I0T A;  3B73 A;  3BCB A;  4IHS A;  5LRR A;  2CMP A;  1V4R A;  4FX0 A;  2EA2 A;  5LRS A;  3FX3 A;  4W97 A;  4Y4R A;  4PZJ A;  3CCE I;  1E3H A;  1JHH A;  4Y15 A;  1G6N A;  4FIS A;  1YJW I;  3KEQ A;  1YG2 A;  1L3L A;  2O8X A;  2DA1 A;  3CUQ A;  3U9G A;  1RNL A;  3LSK A;  2KRF A;  3LA7 A;  3HOT A;  4XOR A;  1VI0 A;  4MLO A;  1HW1 A;  1MND A;  3IHU A;  2V26 A;  3VOD A;  1U9O A;  3MZ8 A;  3T0Y A;  1J0R A;  4A3J J;  2FQ4 A;  1TW3 A;  2CFO A;  3E7L A;  1R49 A;  1RPW A;  2CWE A;  5LGN A;  1G3Y A;  3I59 A;  5CVI A;  2KZG A;  5D5V B;  4HOB A;  4PSW A;  3E97 A;  2LY1 A;  3QPH A;  4G7O F;  4M3G A;  2PI0 A;  1YHQ I;  2DA2 A;  1XN7 A;  3SJM A;  2F4M B;  3MFK A;  3BR0 A;  4N9H A;  5ICC A;  4RB1 A;  4L9N A;  3M1E A;  3ZRG A;  1Y1V J;  4YEL A;  2QZ8 A;  2Y75 A;  1TP4 A;  1G4D A;  2VPL A;  2BYV E;  2HPM A;  3WGH A;  3NWS A;  2XB5 A;  1VQO I;  1E2X A;  3I5U A;  1FBS A;  1OCZ H;  3V42 A;  3DV8 A;  2A07 F;  4RB2 C;  1CF7 A;  3K70 C;  1PJR A;  3ASN H;  4QLC U;  3P9K A;  2XAJ A;  2RC4 A;  3KLO A;  5DM7 F;  1GLN A;  3ZQI A;  4WCG A;  3DLA A;  1BI3 A;  2IW5 A;  2WTE A;  2VLA A;  2MSY A;  4IRG A;  4BE0 A;  1KQ9 A;  2FUG 2;  4HX7 A;  3GUD A;  2CSO A;  4I99 C;  1K7A A;  1FT9 A;  1N78 A;  4JQF A;  2DI3 A;  5H6R A;  1W4M A;  2E71 A;  5D6F A;  3W3C A;  3E6M A;  4AWX B;  1A36 A;  1MBG A;  2P5K A;  4F3Q A;  1ITY A;  2UV1 A;  1ZK8 A;  3BZK A;  2IS1 A;  2W82 A;  3BOQ A;  3EQL F;  1D0X A;  2LSO A;  3FK7 A;  4QPQ A;  2CV0 A;  2ZXH A;  2GXB A;  1OYW A;  2XF7 A;  2BZT A;  3Q3S A;  2XIG A;  5F27 A;  5KAF C;  4GFB A;  5F1J A;  1EF4 A;  3QYE A;  1O3T A;  3HKZ N;  1E3P A;  2R92 J;  3M8F A;  1YTY A;  1SD5 A;  1WH7 A;  3H9J A;  3M1C A;  4JX4 A;  5M5Y J;  4UUV A;  3TQN A;  2CV1 A;  4HX4 A;  3DQV C;  5IPA A;  1MMN A;  2GIV A;  2OPT A;  1WJD A;  3ZQ7 A;  3CCJ I;  2B7E A;  2F2E A;  3GFJ A;  3OSG A;  1OCT C;  2R7U A;  1BM9 A;  2HZD A;  5EG0 A;  5LGU A;  1I50 J;  4Y7N J;  3OWT A;  4UXN A;  2BXZ A;  3OYK A;  3KYL A;  3KE2 A;  4ON0 A;  1VQ4 I;  3HUG B;  2Q2E A;  1LDD A;  4DQ2 A;  1QHH D;  4BUP A;  2IEK A;  2CQK A;  1ETW A;  2DN0 A;  2YUS A;  1XCV A;  4BJ5 C;  3F8F A;  4KN4 X;  2X48 A;  2YU3 A;  2O9L A;  1HKQ A;  5HDG A;  3M8E A;  2ELK A;  2L9N A;  3F8N A;  2PLY A;  3DEE A;  2QQ9 A;  1VQM I;  4IJA A;  3IH3 A;  5TGT A;  3D1N I;  2K4J A;  1WI3 A;  3S8P A;  1MIJ A;  2XVC A;  3CMY A;  1RR7 A;  5LHI A;  2QCO A;  2G7H A;  3F0C A;  3H3Z A;  1XDS A;  1XMX A;  4YIF A;  1UCR A;  1L0O C;  1D5V A;  1I39 A;  1YI2 I;  3SXY A;  1B72 B;  4WXC A;  2PMZ A;  1X58 A;  2MC4 A;  2X85 A;  2CG4 A;  2P6T A;  2LD5 A;  4F92 B;  5CVV A;  2JRT A;  4GXO A;  1GXP A;  4EJT A;  1BN5 A;  2AXL A;  2E36 A;  2F5E A;  2IPQ X;  2X1D A;  3L09 A;  4XLN F;  5JR3 A;  3JSP A;  4X0G A;  3TP0 A;  4HF1 A;  3J7A Y;  1H9T A;  1Y8R B;  1LDK B;  2ZSI B;  3BQZ A;  3HB9 A;  4ENK A;  2FBI A;  5EJC A;  2L7Z A;  4BXF A;  2L9S A;  5DUK A;  4MEX F;  5B66 C;  2NRA C;  5GAE J;  3RZD J;  2GA1 A;  2OF7 A;  2OQR A;  3GME A;  4MEY F;  3KP5 A;  2K5C A;  3ROU A;  1XSX A;  1IG7 A;  1ETO A;  4IKF A;  2N8G A;  3GO5 A;  4D5F A;  1IW7 F;  3FMR A;  4V2F A;  3K70 D;  3OS2 A;  1XSD A;  4A3L J;  1K79 A;  4BKX A;  4L5I A;  1W7P D;  3CJT B;  1ENH A;  2LY2 A;  5HVQ C;  1IJW C;  1GHC A;  4YFX F;  3CCU I;  2O3F A;  5CVU A;  3FXU A;  1DU6 A;  4A3F J;  5C3E J;  3HSR A;  1ZH5 A;  4XSX F;  4E4H A;  4RM3 A;  3DFG A;  2Y0M A;  1UHS A;  4PJM A;  3W6K B;  1IXS B;  4C30 A;  3GTM J;  2Z5U A;  2L3D A;  2VJ5 A;  2OQG A;  3JRH A;  5E1X A;  3GZ6 A;  4X6A J;  2OA4 A;  4PGG A;  2R7T A;  2VQH A;  5ICF A;  4LB6 B;  2EZI A;  2JZY A;  2EIL H;  4NUB A;  2ACJ A;  4JX6 A;  2QKM B;  3J7Y J;  2XAG A;  1Z67 A;  4RAY A;  5D6E A;  2JPB A;  3K1N A;  5F0H A;  4A2U A;  4HG2 A;  3AG1 H;  3CP2 A;  3Q9S A;  5IT9 K;  2GQQ A;  3D5L A;  3F8C A;  3M8J A;  1KON A;  1EKE A;  2F5C A;  2HQ5 A;  2KMU A;  2ID6 A;  2VPR A;  3S16 J;  3WE2 A;  2E35 A;  1MSE C;  2K7L A;  3J80 K;  4UUT A;  1H9G A;  1W5C C;  3GTJ J;  5E17 F;  1ZG1 A;  1ZTR A;  1OYI A;  1DGR M;  1SVM A;  3GFI A;  3NAR A;  1QVT A;  1G3W A;  1YIJ I;  1B1B A;  2LBF B;  4H0E A;  1WJE A;  1R4M B;  3K9T A;  2WB1 A;  3BC8 A;  4M74 A;  1BJA A;  1D0Z A;  2K4B A;  2MLG A;  4W1U A;  1JGS A;  2XDV A;  5E3L A;  4BU2 A;  3PL8 A;  1X1A A;  4LMY A;  4MFD A;  4B09 A;  5FFZ A;  3MKZ A;  4UY8 I;  2IS4 A;  2R0Q C;  3HOU J;  2KP6 A;  5HOO A;  4KIC A;  2EZH A;  2IGN A;  3KLN A;  3BLY A;  5KNL A;  3H9G A;  2DA5 A;  5HLI A;  3HOV J;  5M3M J;  4HNV A;  1XB4 A;  1IUF A;  5DM6 F;  2GLO A;  3LWF A;  5FKL A;  1AKH B;  2KIQ A;  2TRT A;  5FKK A;  4UB6 C;  1IRZ A;  4FX4 A;  4RLF A;  2XSJ C;  4UHT A;  4HYE A;  1T0F A;  3FMS A;  4FET A;  5KAI C;  2VIX A;  4ZJZ A;  5KHD A;  3PSF A;  2W25 A;  3FXM A;  3TED A;  4M3B A;  1FMV A;  5DDG A;  1O3R A;  3LSR A;  2LOO A;  2RN7 A;  1ZG3 A;  2QQB A;  4CCO A;  4PFO A;  3WG7 H;  2DFH A;  4L5E A;  3G71 I;  4II2 A;  3L2U A;  4DYQ A;  3RTR A;  1YW8 A;  2Q8K A;  4HQM A;  5J47 A;  4BBS J;  4XM3 A;  1JUM A;  2Y0S A;  2K27 A;  2HOT A;  2OAZ A;  3H1C A;  4CH7 A;  1BI2 A;  2LFB A;  1Z3X A;  1XG1 A;  2BVL A;  1O7F A;  4XN3 A;  1SAX A;  2QGU A;  2VT3 A;  3ZGK A;  2D1V A;  2EFN A;  4CYD A;  4UVB A;  4O3M A;  1OR7 A;  3HPG A;  3S1M J;  5DUI A;  5GTH C;  1FX7 A;  2DQL A;  2QYO A;  2I5U A;  4EEF G;  5L3D A;  1KZH A;  3D5S C;  3V8K A;  1A6Q A;  2EZK A;  2EZL A;  4M9X A;  3K2A A;  4YFN F;  4B8X A;  5BMZ A;  1TQM A;  4XRM A;  2E1O A;  1SD4 A;  1YX5 A;  2JUC A;  1R5G A;  3G3Z A;  3HBL A;  5DD8 A;  3FIW A;  4KNY A;  3WHC A;  2V1D A;  1S7O A;  2A3S A;  3HUG A;  2NOG A;  1RIO H;  5E3O A;  3CF2 A;  2IS6 A;  2LBF A;  2WB1 N;  1OMI A;  3JR9 A;  3HXL A;  3BP8 A;  4Y33 A;  4L0Y B;  4JK1 X;  3IKT A;  1R22 A;  2QM3 A;  2KL4 A;  1G3T A;  3RPQ A;  4U0V A;  2Y69 H;  2GBY A;  3ZN1 A;  3S17 J;  5J8C A;  1XGN A;  2V7F A;  5GPA A;  1HOM A;  1LNW A;  1IRG A;  4IPA A;  1NTC A;  1LPQ A;  5FGM A;  3H3V K;  2FMY A;  2LH9 A;  1B9N A;  4I0A A;  1T08 B;  2NNY A;  2ZC2 A;  1SD6 A;  2RRE A;  1QA6 A;  3K4N A;  1ZG5 A;  2K85 A;  2STW A;  2VE9 A;  3MCZ A;  2VJ4 A;  2QWW A;  3HGY A;  3CMA I;  3ZQH A;  2E5Z A;  3FXJ A;  4ZYD A;  1F43 A;  1X3W B;  3TW6 A;  1EV7 A;  2L4A A;  3BY6 A;  1KU2 A;  3KP4 A;  5EZG A;  2DA3 A;  3PQK A;  1DDN A;  1AOY A;  1W36 D;  4Y52 J;  4IOA F;  2Q0O A;  4EVI A;  1HW5 A;  1IO2 A;  3KP2 A;  4BQO A;  2KKO A;  2GOX B;  4OIN F;  3F23 A;  1ZLJ A;  3GTP J;  1TL8 A;  4PJL A;  4AD9 A;  2JN6 A;  2VC0 A;  2AO9 A;  1MSF C;  2KFD A;  1H8A C;  1F9N A;  3OL3 A;  3VPR A;  3AAF A;  1DPU A;  1O4X A;  3ABU A;  4V19 K;  3JRI A;  2WAE A;  2X6X A;  2L54 A;  2QSG X;  5AIP A;  3PIP F;  4HDV A;  3OS0 A;  1U6G A;  4FQG A;  3ABM H;  1JGG A;  5IOZ A;  1XPX A;  3C1D A;  2W85 A;  2HVQ A;  4EMS A;  2GOM A;  2E2H J;  2BE5 F;  2OCE A;  4KIT B;  1O3Q A;  3DP7 A;  4Y13 A;  1H0M A;  1WRJ A;  2UUZ A;  3ZQG A;  3MAJ A;  1N77 A;  1S72 I;  1WSU A;  2QSH X;  1MD0 A;  1Z05 A;  2YR2 A;  3BDD A;  2FOK A;  2ZXI A;  1IXR C;  2HNH A;  4EJU A;  2P5L C;  1W0U A;  1MBH A;  1F5T A;  2K9N A;  5DCM A;  2K9M A;  2XPU A;  2E2J J;  3CJQ B;  1XSV A;  1NHA A;  2R5Z A;  4AIH A;  3D0S A;  1W1W E;  2J5O A;  5L3G A;  3JRG A;  1R1V A;  1QBJ A;  3MN2 A;  1Z0X A;  1UFM A;  3FMQ A;  2R5Y B;  2CW8 A;  4IL6 C;  2H27 A;  2FD5 A;  2VKD A;  2JA6 J;  1ZRE A;  1K4S A;  4A12 A;  3EUA A;  1JJ6 C;  3HHG A;  3LFU A;  4UUS B;  6PAX A;  2QF7 A;  2V6E A;  1LVK A;  3DBH B;  1K6O A;  2ZNY A;  2W24 A;  3Q0U A;  2COB A;  1QZZ A;  3BPX A;  5BPD A;  2D2W A;  3HEF A;  2QBY B;  1AWC A;  4XRF A;  1XMA A;  2FNP A;  3JCU C;  2ME6 A;  3CLQ A;  5GAD J;  2XV4 S;  4CUG A;  1ZEL A;  3EPZ A;  3LQQ A;  1DP7 P;  2ZME A;  3BTI A;  4NHJ A;  2XPV A;  4PUS A;  1STZ A;  4ASN A;  5ILV A;  2CQX A;  1P7I A;  3JTH A;  1HKT A;  3TO6 A;  4KIG A;  4ZYE A;  3S93 A;  3V8J A;  2CV2 A;  1FYL A;  5C4J J;  3K10 A;  1RUO A;  2X1E A;  3AG4 H;  2L4M A;  3TDU C;  1AU7 A;  3FXO A;  3K7A J;  2JK3 A;  4ZH4 F;  3ABL H;  3HL2 A;  2GXA A;  3GLL A;  4A3K J;  5E8I A;  3IV5 A;  1I1G A;  2HDW A;  1BL0 A;  3VSK A;  2B9S A;  2CYY A;  1U9N A;  1IN4 A;  2OV7 A;  2VN2 A;  1JKO C;  2M45 A;  4B3A A;  3BG9 A;  2EFW A;  5E1W A;  2VBY A;  3JAM Z;  3V7R A;  4FTH A;  4G6D A;  3ZMS A;  4HX8 A;  4HW0 A;  2FML A;  2GWR A;  2F48 A;  3DKW A;  2DCE A;  1OCC H;  1ETV A;  5JHF A;  4C3I J;  4EGY A;  4EM2 A;  1V5E A;  1FIA A;  2M7A A;  2LYC A;  4B3X A;  3G6E I;  5F08 A;  1A35 A;  4BXX J;  3PO2 J;  2P7C B;  2R7O A;  4XKV A;  1LEB A;  2P81 A;  3FHN A;  2FX0 A;  1FEX A;  2OUM A;  3HJE A;  3ABK H;  4P5O A;  3GVA A;  1X19 A;  3RPU A;  1I3A A;  1Y6I A;  3G1L A;  3E5Q A;  4FE7 A;  4L9J A;  3ERE D;  1POG A;  2V6C A;  3X2Q H;  3OYN A;  3HIF A;  1R00 A;  4E7K A;  1YIO A;  1S5L C;  3CJN A;  4GRI A;  4XNF A;  3RKY A;  2JUG A;  1ZRC A;  3NEU A;  4I2O A;  1T38 A;  1JT6 A;  3EET A;  2PMU A;  1MDM B;  2R7Q A;  1X2M A;  3F8B A;  3TGN A;  2JPC A;  3O6B B;  4DGW B;  1J9I A;  3TOB A;  4ZTJ A;  4UVA A;  3J81 K;  3SFZ A;  4FCY A;  2DJN A;  4I98 B;  5H6Q A;  1G2H A;  1T95 A;  1EH8 A;  3O3K A;  2RNG A;  4HF0 A;  2X51 A;  4F55 A;  3A1Y A;  3FM5 A;  2X4H A;  5J6X A;  2QEX I;  4HV6 A;  1APL C;  1ZAR A;  2ISZ A;  5IT9 Z;  5LFA A;  2NNN A;  1QZY A;  1Y1W J;  4OOI A;  4ESF A;  3O8H A;  2OU2 A;  2P8T A;  2X0L A;  3QP5 A;  3BT9 A;  3CCM I;  1S29 A;  1Z7U A;  4EJV A;  1TWG J;  2JJ7 A;  5IYB J;  4X1E A;  1N25 A;  1T2K A;  3MQ0 A;  2BW3 B;  3ZMT A;  1K78 A;  2BHY A;  2DO7 A;  4R8H A;  2JMW A;  2KJB A;  2ZBK A;  3H92 A;  1JE8 A;  1TT0 A;  1MGT A;  2P5V A;  1VQN I;  5FRM A;  4HPQ A;  5CVJ A;  3BJ6 A;  1V5F A;  4KIF A;  4CIC A;  4LK1 F;  2D5V A;  5B1B H;  3CC7 I;  1LFP A;  4CCL A;  2BGC A;  2MH9 A;  4MHG A;  1ERD A;  1K6Y A;  2G0E A;  3JRB A;  1O7L A;  4IO9 F;  1LVA A;  5E3N A;  3ZPL A;  1PUE E;  1TNS A;  5ILS A;  4C3H J;  1HCR A;  1GXQ A;  1YS7 A;  1BBY A;  1IN5 A;  2DMQ A;  1RKW A;  3HZJ A;  1SMT A;  2HI3 A;  1WFX A;  2PQ8 A;  3PSI A;  1AKH A;  2HKX A;  3WTW C;  3L2Q A;  1WI9 A;  2K9S A;  2VKV A;  1U2W A;  3JSO A;  2HGC A;  2X6Y A;  4LFU A;  2H1K A;  2BW3 A;  4QSH A;  2FBH A;  2E34 A;  1HF0 A;  2E7W A;  3MKL A;  4M3F A;  3B6C A;  5JHU A;  3BR6 A;  3OIQ A;  3QOD A;  4CCM A;  4RB0 A;  1YLF A;  4KMU X;  3V4G A;  2MW8 A;  2NVU B;  3PUB A;  2B63 J;  4MFE A;  4ZZL A;  3OR2 C;  3HRT A;  1YX3 A;  3J7Z I;  2RV8 A;  2FU4 A;  2CQ7 A;  3QPS A;  3W2V A;  3TDZ C;  5HNF A;  3HC7 A;  3S1R J;  2DJI A;  2B0L A;  2NS8 A;  3ZN0 A;  2ETH A;  2E5N A;  2XF6 A;  3P5J A;  1R1U A;  4HRI A;  2IGM A;  4AYB N;  2XRN A;  2HWV A;  4PDK A;  2DDA A;  3LMM A;  3QOP A;  3WOD F;  2Z2S B;  2D45 A;  4R79 A;  5E18 F;  3ABT A;  1RUN A;  3M4O J;  2PG4 A;  5CKT A;  3OOU A;  4OMY A;  2GXG A;  1B4A A;  4IEJ A;  4MTE A;  4HLX A;  1OCO H;  3IC7 A;  2M3A A;  3CDH A;  2Z1D A;  4OMZ A;  5DCM B;  3BQY A;  4BY1 J;  4BXU A;  5CLS A;  4ESB A;  4M73 A;  5DS9 A;  3SDG A;  2DQR A;  2EWN A;  1R9T J;  2E1C A;  1UAA A;  5HS9 A;  4IX7 A;  1YW9 A;  3R0J A;  3K1P A;  3JRA A;  4S05 A;  4KYW A;  4LG0 B;  4M71 A;  5TJJ A;  3DBR B;  2ECB A;  1IXC A;  3S14 J;  2R7R A;  2XAQ A;  3RKX A;  1GV5 A;  4DBQ A;  4Q48 A;  4AVP A;  3CO7 C;  3AL0 C;  5K7Z A;  5J4V A;  2DDB A;  2H6C A;  1KA8 A;  5EEA A;  4F93 B;  2M9H A;  3WTV C;  4ZDP A;  3U21 A;  2ELJ A;  3I71 A;  1SMY F;  1Z6T A;  3SZP A;  4B44 A;  5A2Q Z;  4J01 A;  3I55 I;  2Z3Y A;  2KDO A;  3KET A;  4PJN A;  2VON A;  3CJR B;  3KIO A;  2K86 A;  2WY7 Q;  2EA4 A;  2KRC A;  3OYC A;  2DU9 A;  1EJ9 A;  2O61 A;  4IHV A;  3U2R A;  3GEZ A;  1ULY A;  3K69 A;  3R61 A;  4N4N B;  1YRN A;  4A93 J;  1TWF J;  1Y0N A;  2W84 A;  2ZFW A;  2VOD A;  3I4M J;  5HNH A;  5LGT A;  2WV0 A;  3B6A A;  3K2Z A;  4RBO A;  1QZE A;  2WWY A;  4OU0 A;  2NVT J;  3R60 A;  3AL0 B;  2XGX A;  2NYX A;  4A0X A;  5ICE A;  2HVS A;  4L0Z B;  1MH3 A;  1H89 C;  1XDU A;  5TRD A;  4BGD A;  3TMO A;  2IRF G;  2BY3 A;  1OQY A;  4RAF A;  1QPM A;  1S7A A;  1FSE A;  4B1R A;  2HTJ A;  4XOP A;  5HS7 A;  2O6G E;  1VQ7 I;  1TW2 A;  2HU9 A;  2XHK A;  2V1U A;  3GW2 A;  3K4C A;  4ENN A;  2DLL A;  4MIM A;  3G1M A;  3GYH X;  1TWC J;  5BOX A;  3BCA A;  1LQ1 A;  2PJR B;  1R23 A;  1KU3 A;  3HG9 A;  3OYE A;  2IVM A;  4NBQ A;  4CSW A;  3A03 A;  3TP3 A;  3P9C A;  4RA2 A;  4AIJ A;  4HF2 A;  2EPF A;  1W36 C;  1OJL A;  3A02 A;  3KP3 A;  3ZQC A;  2M0M A;  1BJZ A;  2CUJ A;  1Z3Y A;  3WU2 C;  4ETS A;  2IS2 A;  1ETY A;  1JTY A;  1KYZ A;  4LLL A;  1MH4 A;  4XN0 A;  5GAH J;  3R6S A;  2CFX A;  3FK6 A;  1WHU A;  2L2O A;  4I01 A;  4UVC A;  3C2G A;  3K4K A;  4CXF A;  2LMD A;  2ZXJ A;  1BR2 A;  1QO0 D;  5LHG A;  5M5W J;  4ZZD A;  4CDG A;  4A3D J;  2HKO A;  4MQ9 F;  4L9V A;  3BTJ A;  2IJL A;  2DT5 A;  3BG6 A;  2VKE A;  1BOA A;  4BHC A;  3LAJ A;  4G12 A;  3IAM 2;  2W57 A;  2ZB9 A;  2STT A;  3FBI B;  4IQJ A;  2VAS A;  3DXJ F;  2R7S A;  4XLP F;  2JT1 A;  3JRE A;  1XGO A;  1VQK I;  1E3O C;  1VQ6 I;  1H88 C;  4G7Z F;  2CRG A;  1IAW A;  3S32 A;  2A69 F;  3QPT A;  4CA0 A;  1T98 A;  3F22 A;  1Z91 A;  3JRD A;  2OBP A;  3BJO A;  4EM1 A;  2BBY A;  4BL0 B;  1X1P A;  1B72 A;  4AUX A;  3HRS A;  2L7K A;  1OCP A;  1V54 H;  3AG2 H;  4RGR A;  3REO A;  3S1N J;  1SFO J;  4RAG A;  2WA0 A;  2XF5 A;  2K9Q A;  4XLC A;  5L3B A;  4HAM A;  1SFE A;  3Q0W A;  1VQ9 I;  2WY8 Q;  1K83 J;  5BQT A;  3C3W A;  1ZQ3 P;  3TOA A;  4XKB A;  3M3Y J;  3PFY A;  1VQP I;  1TNT A;  2DPD A;  1ON1 A;  2HQN A;  1RR8 C;  1U5T C;  1FNN A;  3ECH A;  2M8E A;  3CO6 C;  4GGG A;  3A2K A;  2QBY A;  2DFI A;  1IV8 A;  2PX9 A;  2XAS A;  3HYI A;  3IP4 B;  5IP6 A;  1FP2 A;  3CCR I;  4DIQ A;  1X3Z B;  2HOE A;  4CYC A;  4ENJ A;  2IA1 A;  3MWM A;  4NQW B;  3LSM A;  4DZJ A;  3J80 Z;  3RYR A;  4WXH A;  3CME I;  3BR2 A;  2COM A;  3RI4 A;  3ZMU A;  3DWL E;  2BVM A;  3FKI J;  4JX5 A;  3DCF A;  3RDI A;  3OYI A;  2PBI A;  3C2B A;  2Z9O A;  2FRH A;  4IHY A;  5M3F J;  3HGG A;  2F5F A;  1X1B A;  2CH0 A;  4IHX A;  3OYG A;  4KA4 A;  1J7K A;  3HPH A;  3ZMZ A;  3H5R A;  3W6V A;  4CGZ A;  1JTX A;  4M3D A;  2BXY A;  2KPM A;  5C44 J;  1WJB A;  3JTG A;  1UG0 A;  4G6Q A;  4HZF A;  2QQA A;  3KEO A;  2DK8 A;  2KIM A;  4CYC B;  1IC8 A;  3OL4 A;  1VQ8 I;  5HS8 A;  3Q9V A;  3RPU D;  2LNB A;  3CMM A;  4LIU A;  4RAZ A;  5F1R A;  3MKW B;  4GYI A;  4XLE A;  4II3 A;  3LQR A;  1TQI A;  1ZLK A;  2Q2E B;  5M5X J;  1U8B A;  1RES A;  1ZGA A;  4IF4 A;  2P7V B;  1QGP A;  3MMY B;  1HKS A;  3PJR A;  2ZJ2 A;  3RJP A;  3CCL I;  4D5C A;  1BW5 A;  1K61 A;  2PMH A;  3CC2 I;  1ETX A;  3LSP A;  4PJ0 C;  1R4N B;  2DOD A;  2C6Y A;  4HV5 A;  1XCB A;  4KT5 C;  2E1M B;  2MFZ A;  4C2T A;  3DEU A;  4GDF A;  4LIV A;  1Z9C A;  3JAM K;  4PJJ A;  1VTN C;  3MZY A;  1GDT A;  1Q1H A;  3CP8 A;  3VEP A;  1MMD A;  3E5U A;  5EGO A;  1FY7 A;  3ONQ A;  2O03 A;  3V7C A;  4BE2 A;  2Y48 A;  4LD5 A;  2OC6 A;  2JA8 J;  3ISP A;  4ESJ A;  2V79 A;  3L2V A;  2M8G X;  2R7V A;  4ANJ A;  5J3L A;  3OYH A;  2NVQ J;  4DBR A;  5EYR A;  2MC3 A;  5CPR B;  4YEJ A;  3VSL A;  1P2F A;  1ZR4 A;  1ETQ A;  3BZC A;  4A3C J;  4DW6 A;  4DYR A;  1ZGW A;  5E20 A;  4UUS A;  1PYV A;  1HBX G;  5FRO A;  1S3J A;  3TKY A;  4PCQ A;  3LL7 A;  1BC7 C;  1LJ9 A;  4D1Q A;  1I3Q J;  1I6X A;  3ERM A;  1ZHF A;  4BJT A;  2H8W A;  1J59 A;  1O3S A;  5B5E C;  2YPR A;  2R5Z B;  3K4L A;  1Z7L A;  3ZQQ A;  4YFK F;  1CF7 B;  1A31 A;  5F64 A;  3OY9 A;  1LEA A;  1UMQ A;  1ZN2 A;  3I59 B;  3E6B A;  3D5R C;  2MLK A;  4U88 A;  3A0B C;  1IF1 A;  4XOT A;  5GP9 A;  3I64 A;  1FC3 A;  4WX9 A;  4NC6 A;  3OIP A;  1XC5 A;  4K2E A;  3KX2 A;  1NK2 P;  1PDN C;  2HYJ A;  1QNT A;  2EJR A;  5D8L B;  5EEG A;  4HNU A;  4IHT A;  1D1B A;  1IN7 A;  4BH9 A;  3KZZ A;  4M6X A;  4MNU A;  4QWQ A;  3S3M A;  1SD7 A;  2BY0 A;  3I58 A;  1B9M A;  2CO5 A;  5K5Q A;  5JLX A;  1C0W A;  3AG3 H;  2P0W A;  2XAH A;  2DYR H;  4ZYA A;  3HDD A;  1FSH A;  5FLV A;  1MMG A;  4QPO A;  3WTT C;  1ORK A;  2WAQ A;  2NOJ B;  3BG7 A;  3L2R A;  4EAT A;  4N9I A;  2O5R A;  1TQP A;  3EDP A;  3H3U A;  4HBL A;  1PP7 U;  1QPI A;  4XMY A;  3SZG A;  2OZ6 A;  2LK2 A;  4IRH A;  1TC3 C;  1NH3 A;  5ED4 A;  3ZCO A;  1RZ4 A;  2JSP A;  4M3E A;  1NG7 A;  5GAG J;  3PNV A;  4EV0 A;  3KFW X;  3T8R A;  1IUY A;  9ANT A;  4IHW A;  3HOZ J;  3UNG C;  3BTC A;  3ZP5 A;  3WGI A;  3VFZ A;  4XBF A;  1MBK A;  4LG3 A;  4L5J A;  2EV6 A;  1PP8 F;  1QHG A;  4AIK A;  2GA2 A;  1IRX A;  2M30 A;  1R6R A;  4BS9 A;  4OIO F;  4KUM A;  3KZI C;  3O8G A;  4G94 A;  2E19 A;  3SHF A;  3U1D A;  2LRE A;  1S8N A;  2FXA A;  1OR7 C;  3FBN B;  1HLV A;  3G4S I;  1GVJ A;  2BOL A;  1PUF B;  2HR3 A;  5EG0 B;  2DT7 B;  4IXA A;  2CW7 A;  3DTI A;  2MG4 A;  5J8F A;  3JRF A;  3HRM A;  1DQU A;  4H4K C;  5L3F A;  1HSJ A;  2QVO A;  4LIT A;  5K1Y A;  1NK3 P;  3ZQL A;  2EV0 A;  1KU9 A;  3M7G A;  4UV9 A;  1MJA A;  3DPT A;  3GXO A;  5CVR A;  4A6D A;  2A5W A;  1WJC A;  4JYK A;  2NS7 A;  3FIS A;  1YQA A;  4LK0 F;  2P4W A;  4AU7 A;  3NRV A;  3OYL A;  1R5I D;  3WTU C;  1ODD A;  2L01 A;  2E1N A;  1IN6 A;  1FWZ A;  2FOW A;  4I02 A;  3G73 A;  4UV8 A;  2VXD A;  4RGU A;  2QA4 I;  1T39 A;  1MKM A;  2K3P A;  4V2G A;  5J40 A;  1LUJ B;  1TWH J;  4HA8 A;  2E7X A;  3BZ6 A;  2R93 J;  4OWR B;  3LSG A;  5JFR A;  4BHP A;  3SEQ A;  3OYM A;  4RLQ A;  2ESN A;  1UHW A;  2XSD C;  1P4A A;  4XRS A;  2ZME B;  2IXS A;  1MNM C;  1P4X A;  1WVR A;  1MJ9 A;  2WAQ N;  2EH3 A;  2ECC A;  1ZR2 A;  3QU3 A;  2LDU A;  3GLX A;  3NQO A;  3SQN A;  4HQE A;  1GT0 C;  5B3S H;  4NC8 A;  5IYD J;  3GX4 X;  4L9T A;  4IQ4 A;  1SFX A;  4TV7 A;  1WGX A;  2YU9 J;  4M72 A;  5FLX K;  5E8G A;  5KK1 A;  2G9W A;  3IL2 A;  1W0T A;  3MD2 A;  1ZYR F;  3E0J B;  2KQR A;  3ELK A;  4LLN A;  3J81 Z;  2PJR A;  3L1P A;  4GYG A;  3ZOB A;  4E7I A;  3QP6 A;  1BI0 A;  2VJI A;  1WH5 A;  3ZMV A;  1V55 H;  2YS9 A;  3DLL F;  1I1S A;  5DCF A;  2IBD A;  3LA2 A;  4RB3 C;  1A04 A;  4CZZ A;  1VZ0 A;  4AYB A;  1DP3 A;  1LE8 A;  1PUF A;  2L5Q A;  2RKH A;  2JVG A;  4RGS A;  1N75 A;  2MBF A;  5BS6 A;  2LLK A;  2KZV A;  5ILU A;  3EUH A;  4U0Y A;  4KMF A;  3QRF F;  3WTX C;  2M0C A;  2QQ8 A;  3F6V A;  1DU0 A;  3HTS B;  3W2A A;  2GIZ A;  3FXK A;  1OIS A;  2KHM A;  5JVT A;  4BBR J;  3BR1 A;  3CCY A;  2IA0 A;  5E3M A;  5LEJ A;  3GZ5 A;  3R0A A;  2ZJQ F;  2IA2 A;  4NQW A;  3HHH A;  2MD5 A;  1F36 A;  1TT5 B;  3KP7 A;  3FWE A;  1U78 A;  5B1A H;  1E17 A;  1VND A;  1JXS A;  2XKO A;  2XPW A;  4S0H B;  4IZZ A;  1EH6 A;  3OYD A;  1P7J A;  5FFX A;  1CGP A;  3QYF A;  3GF2 A;  1D0Y A;  3A01 A;  2VB6 A;  2DA4 A;  2VKH A;  5AIQ A;  3GFL A;  4HSR A;  2FJ1 A;  4P55 A;  2KDZ A;  1FP1 D;  2FNA A;  5ERI A;  2K02 A;  1O57 A;  4M6Y A;  1JUP A;  3RYP A;  3PNY A;  2Y30 A;  4XLH A;  3QQA A;  2E1M C;  4WXD A;  1W5T A;  2JSC A;  1OYY A;  3WE3 A;  3QPL A;  3K6G A;  1FOW A;  3G2B A;  2JA5 J;  1D1C A;  2UZK A;  2F4O B;  3QU6 A;  5FRN A;  4CCN A;  5L3E A;  2W48 A;  2GM4 A;  1LFB A;  2NVX J;  2HFH A;  2HXI A;  2GZW A;  1XMK A;  2DMN A;  5DEQ A;  3LNQ A;  3E1S A;  1FJL A;  3HM5 A;  5E79 C;  5LEK A;  4U0W A;  5FB2 A;  4IOC F;  3DU5 A;  2HVR A;  1WZ2 A;  1UJ8 A;  3I4P A;  2RGV A;  3CTA A;  3WG9 A;  2A6E F;  1IGN A;  1VQ5 I;  4WWC A;  4PGH A;  3HRU A;  1YJN I;  2V9V A;  5JI6 A;  4I76 A;  2IP2 A;  2HXO A;  1XS9 A;  1HC8 A;  2ESH A;  4CCJ A;  1F1Z A;  3CDL A;  1G8X A;  3HTU A;  2PEX A;  2Y0S N;  3H35 A;  3PIO F;  2BY2 A;  3L9F A;  3LSH A;  3GTQ J;  2I8D A;  1FTZ A;  2XB0 X;  4RDU A;  3E6D A;  3V7S A;  3MVP A;  2DOF A;  3VYR B;  2V9K A;  2R7F A;  1MNE A;  3MEX A;  1JKR C;  2M34 A;  2E60 A;  2OZU A;  1YOV B;  1MJB A;  1JJ8 C;  3KEY A;  3HOX J;  2P6S A;  2MYS A;  2DW4 A;  2A61 A;  3I56 I;  2UXX A;  2J5P A;  2DOA A;  2CUZ A;  4KJZ A;  4LJZ F;  2KIU A;  1Z1D A;  3PFI A;  1I5Z A;  5CQE A;  5KCM A;  4M9S A;  3GTK J;  3N05 A;  2VC1 A;  5L3C A;  2K3F A;  5D4S A;  1JI8 A;  3CUO A;  3VYT B;  3N4M A;  1UEL B;  3W6J B;  5EDN A;  3FXR A;  3I3L A;  1R58 A;  4DYC A;  2Y9Z A;  4BQA A;  4XIC A;  3S2H J;  1T33 A;  3PUF A;  4AID A;  4F7Z A;  3CD6 I;  2TDX A;  3GCM A;  5LHH A;  4A69 C;  1SC7 A;  1Y56 A;  2HYG D;  2CUF A;  3W2W A;  2CU7 A;  2LG4 A;  3KYC B;  2QLZ A;  4PFP A;  2BV6 A;  1TBX A;  2MGQ A;  1BI1 A;  1W7P B;  4L18 B;  2FE3 A;  1QRY A;  1B6A A;  2DTZ A;  5IP7 J;  3OR1 C;  2KLO A;  2EIM H;  5IT3 A;  3CES A;  2LC2 A;  2KRH A;  1BC8 C;  3Q0V A;  4BAC A;  2XGD A;  5CYV A;  3ZQF A;  2AHQ A;  2BY1 A;  2X1C A;  3F9K A;  2L7M P;  3DF8 A;  3H0D A;  4OIR F;  2EIJ H;  1EA3 A;  2A5Y B;  4U87 A;  3E6C C;  3ESW B;  3RCO A;  2VE8 A;  1I27 A;  1Z77 A;  1YJ9 I;  3UR3 C;  3ECO A;  1DGW Y;  1V5G A;  1YYV A;  3CCS I;  5EEH A;  1VFC A;  1ONV A;  3IUO A;  2EIK H;  4BDY A;  4EJW A;  2M87 A;  1P4W A;  4NC7 A;  3CDI A;  2DA6 A;  4LGW A;  1JKP C;  2PMZ N;  3BWG A;  2CUE A;  3L2C A;  2Y9Y A;  2Z16 A;  5K7H A;  2HZT A;  4KIS A;  1DUX C;  4BE1 A;  2HPI A;  1GV2 A;  2DPU A;  2FF4 A;  3PQJ A;  2K9L A;  4O5V A;  4ZDL A;  1GUU A;  3VYU B;  4HEA 2;  4LOC A;  1FBQ A;  3WTZ A;  1U8R A;  1HDP A;  5BNG A;  1OCR H;  5FKM A;  1X2N A;  2LKS A;  3PM1 A;  4I6Z A;  3SEZ A;  2ZJR F;  3VOE A;  2D1H A;  3K1M A;  3ZXS A;  1WJF A;  1J5Y A;  1WQ2 A;  4Z2Y A;  4IRI A;  2V9P A;  4EGZ A;  4YIR X;  2JA2 A;  1U5T B;  5DV5 A;  1MBE A;  1BIA A;  4R1H A;  3GWZ A;  2WC2 A;  1YW7 A;  5H20 A;  1UHM A;  3CC4 I;  2F4I A;  5HDN A;  2V1X A;  5D4R A;  2L9V A;  4A5M A;  1K4T A;  1D8K A;  3KP6 A;  2R5Y A;  2RDP A;  3R4K A;  3G1O A;  1R7J A;  4RS8 A;  2HDC A;  2MA3 A;  4MGR A;  1B8I A;  2W1O A;  1MBJ A;  4XKW A;  4BNC A;  4BHB A;  2LVS A;  1TWA J;  1I6H J;  3OV8 A;  1W7P A;  2XKP A;  3IRR A;  3C7J A;  2DBB A;  2HOS A;  3KZY A;  3FZV A;  2EIN H;  4A3I J;  2IGK A;  1G3S A;  2WAD A;  3WU0 A;  2QEN A;  4CCK A;  1BA5 A;  3CF5 F;  3SDB A;  1FZP B;  4DOZ A;  2EFO A;  3ASO H;  4DZP A;  2XC7 A;  3ZMD A;  2EQR A;  2YX4 A;  3FDY A;  1MMS A;  3RKW A;  2Z33 A;  3IH4 A;  3BTL A;  1FYM A;  5J1R A;  1UZC A;  3A4C A;  5FD5 A;  3T5X A;  5IY5 H;  2NXN B;  4BEH A;  1FOY A;  2H09 A;  3S3O A;  3DEW A;  1J09 A;  1P9Q C;  2LP0 A;  1ZAO A;  2MH2 A;  3U1K A;  4A6E A;  3OYB A;  3DPU A;  1FMW A;  4A5N A;  1MZB A;  1ON2 A;  2V1N A;  4OAY A;  1ZGJ A;  2XRO A;  2ZJP F;  2LR8 A;  2VUM J;  4A0Y A;  2DMU A;  1VF9 A;  3IAS 2;  2CQQ A;  1QU3 A;  4WK8 F;  2AQF A;  4ITV A;  3FXL A;  3CCQ I;  4F52 A;  3L2W A;  2H1L A;  4J00 A;  3F8M A;  1RET A;  2HQR A;  5FO5 A;  1NG6 A;  3DTE A;  1R5H A;  4P9F A;  5KVR A;  3DKX A;  3OOP A;  3DPL C;  1FOK A;  1U3E M;  2DMT A;  4BYY A;  4XLF A;  5K5R A;  4NNJ A;  1SVO A;  4BQN A;  1IDY A;  2JTV A;  4ZYG A;  4XLA A;  3BRO A;  4KIB A;  3LST A; 
#chains in the Genus database with same CATH homology
 1MBG A;  5JLX A;  1ITY A;  2L7F P;  1ZK8 A;  3G1L A;  2HDD A;  3HDD A;  1HDD C;  4FE7 A;  5FLV A;  3FK7 A;  1GVD A;  1POG A;  1ORK A;  2ID3 A;  4AC0 A;  3Q3S A;  5F27 A;  4GFB A;  4JP0 A;  5F1J A;  1EF4 A;  5F0C A;  3HKZ N;  1JT6 A;  2R92 J;  4B4C A;  1QPI A;  4JX4 A;  1WH7 A;  5M5Y J;  1X2M A;  2LK2 A;  4J19 A;  1TC3 C;  5EF6 A;  2ME0 A;  1B8I B;  2DMP A;  1ETK A;  4FCY A;  2DJN A;  1G2H A;  5IPA A;  4M3E A;  2OPT A;  3GTL J;  2L9R A;  3RKQ A;  3OSG A;  1OCT C;  5EG0 A;  9ANT A;  4C2M J;  4NDL A;  4IHW A;  3HOZ J;  1I50 J;  4Y7N J;  3BTC A;  2I10 A;  1APL C;  1MBK A;  3H0G J;  3UKG A;  3RZO J;  1Y1W J;  2IEK A;  3O8H A;  2YUS A;  1ETW A;  2DN0 A;  3NAU A;  3BT9 A;  3O8G A;  2E19 A;  1IDZ A;  1TWG J;  2X48 A;  2JJ7 A;  2O9L A;  1HLV A;  5IYB J;  4X1E A;  4A3E J;  2ELK A;  2K40 A;  3LOC A;  1PUF B;  5EG0 B;  3OIO A;  2MG4 A;  3JRF A;  4A3B J;  3IH3 A;  1NK3 P;  1MBF A;  3D1N I;  2JMW A;  2LKX A;  1WI3 A;  4D7N A;  3CMY A;  3ZQL A;  1RR7 A;  2QCO A;  5K7F A;  3F0C A;  2Y2Z A;  4JYK A;  2D5V A;  2NS7 A;  3FIS A;  1B72 B;  1X58 A;  2LD5 A;  2G0E A;  3JRB A;  5E3N A;  4C3H J;  1HCR A;  2DMQ A;  1RKW A;  4V2G A;  2HI3 A;  1TWH J;  2R93 J;  3TP0 A;  3LSG A;  1AKH A;  2R7Z J;  1OFC X;  3PO3 J;  3HB9 A;  3BQZ A;  2K9S A;  2VKV A;  1AHD P;  2L7Z A;  2H1K A;  2XSD C;  4XRS A;  4QSH A;  3RZD J;  1HF0 A;  2OF7 A;  3MKL A;  4M3F A;  3B6C A;  1IG7 A;  1ETO A;  1MNM C;  3BR6 A;  2N8G A;  4D5F A;  4V2F A;  2WAQ N;  2MW8 A;  4A3L J;  2EH3 A;  2ECC A;  4BKX A;  1ZR2 A;  2NVY J;  2B63 J;  4MFE A;  1GT0 C;  1ENH A;  5IYD J;  1IJW C;  4ABZ A;  3QPS A;  3BG3 A;  1WGX A;  5JLW A;  2YU9 J;  1DU6 A;  3S1R J;  4A3F J;  2NS8 A;  5C3E J;  3SFI A;  2E2I J;  2L0K A;  1UHS A;  1W0T A;  1WPK A;  4AYB N;  3GTM J;  3JRH A;  4X6A J;  2EZI A;  3L1P A;  3ZOB A;  2KT0 A;  5EGO B;  4JX6 A;  2H8R A;  3M4O J;  1WH5 A;  3OOU A;  4IEJ A;  2YS9 A;  5F0H A;  3GBG A;  3BQY A;  4BY1 J;  2IBD A;  5DS9 A;  3SDG A;  1WCM J;  2HQ5 A;  2ID6 A;  2VPR A;  1R9T J;  3LSJ A;  3S16 J;  1MSE C;  3JRA A;  1LE8 A;  1CQT A;  1PUF A;  4UUT A;  3GTJ J;  3TW7 A;  2JA7 J;  1ZTR A;  2ECB A;  3S14 J;  3NAR A;  1QVT A;  1GV5 A;  5HOD A;  2LLK A;  5K7Z A;  5EEA A;  2M0C A;  2M9H A;  4W1U A;  1DU0 A;  5E3L A;  1YRN B;  4MFD A;  4BBR J;  2R0Q C;  3HOU J;  3CQZ J;  1S7E A;  2EZH A;  3BR1 A;  5EZH A;  3CCY A;  5E3M A;  5IOY A;  4IHV A;  2DA5 A;  1BW6 A;  2WV1 A;  3HOV J;  5M3M J;  4HNV A;  1LE8 B;  1YRN A;  1T56 A;  1F36 A;  1IUF A;  1ZKG A;  1U78 A;  2GLO A;  5FKL A;  1AKH B;  4A93 J;  1TWF J;  5FKK A;  2LTP A;  2TRT A;  1VND A;  1IRZ A;  3I4M J;  2XPW A;  4S0H B;  3B6A A;  4RBO A;  1A5J A;  1P7J A;  4A3G J;  2NVT J;  3BR5 A;  3A01 A;  1MH3 A;  2DA4 A;  1H89 C;  2FJ1 A;  2KDZ A;  4XK4 A;  1JUS A;  3TED A;  4M3B A;  5C4X J;  4B1R A;  1JUP A;  2Y30 A;  2X6O A;  3LSR A;  5J1U A;  3QQA A;  2TCT A;  4L5E A;  3QPL A;  3HOW J;  2JA5 J;  4DYQ A;  4MIM A;  2W48 A;  3G1M A;  2GM4 A;  2JWT A;  4QIW N;  1TWC J;  1LFB A;  2NVX J;  3HOY J;  2HXI A;  1SAN A;  2DMN A;  4BBS J;  4C3J J;  3LNQ A;  1JUM A;  1FJL A;  3HM5 A;  2HOT A;  2DA7 A;  2LFB A;  1XG1 A;  3A03 A;  3TP3 A;  3IH2 A;  3S1M J;  1OJL A;  1IGN A;  3A02 A;  3ZQC A;  2LY9 A;  1BJZ A;  4EEF G;  1ETY A;  1JTY A;  4I76 A;  2HXO A;  5F0F A;  3OSF A;  1XS9 A;  1D5Y A;  1MH4 A;  2EZK A;  2EZL A;  3CDL A;  4D7M A;  2Y0S N;  3FK6 A;  3K2A A;  5DTD A;  4XRM A;  2E1O A;  3RQI A;  3HBL A;  3FIW A;  3WHC A;  3GTQ J;  1UG2 A;  1FTZ A;  5M5W J;  2XB0 X;  4RDU A;  2NOG A;  4A3D J;  3S1Q J;  3MVP A;  5E3O A;  3BTJ A;  2WB1 N;  2VKE A;  1JKR C;  2M34 A;  3JR9 A;  4G12 A;  3GTG J;  2ZB9 A;  4BY7 J;  3JRE A;  1JJ8 C;  1JKQ C;  3HOX J;  4M6V A;  1LFU P;  1E3O C;  4XID A;  1H88 C;  4XRS G;  2GBY A;  3S17 J;  2CRG A;  5GPA A;  1HOM A;  2VI6 A;  3JRD A;  1NTC A;  1A6I A;  3H3V K;  1B72 A;  4AUX A;  3GTK J;  1OCP A;  3S1N J;  5FKO A;  1SFO J;  3JRC A;  2K9Q A;  5EDN A;  5FLM J;  1Q1V A;  4DYC A;  2Y9Z A;  2XRL A;  3Q0W A;  4XIC A;  2M2E A;  3S2D J;  1T33 A;  3S2H J;  1K83 J;  3HGY A;  3ZQH A;  1ZQ3 P;  4A69 C;  1F43 A;  2RAE A;  5GPC A;  2CUF A;  3TW6 A;  3M3Y J;  2CU7 A;  5EZG A;  2DA3 A;  2X9D A;  2XGE A;  3S15 J;  2IAI A;  1RKT A;  2MGQ A;  4Y52 J;  5J1Y A;  1FTT A;  1QRY A;  2DTZ A;  5IP7 J;  5FJ8 J;  3GTP J;  5IP6 A;  3WHB A;  3I4N J;  5IYC J;  2JN6 A;  2CJJ A;  4CYC A;  1MSF C;  2AO9 A;  1H8A C;  3Q0V A;  2XGD A;  3BG5 A;  3ZQF A;  3VPR A;  2AHQ A;  4DZJ A;  1O4X A;  2XGC A;  3BR2 A;  3JRI A;  2L7M P;  3FKI J;  4JX5 A;  1JGG A;  3DCF A;  5FKN A;  1Z77 A;  5IOZ A;  3C2B A;  1VFC A;  4IHY A;  5M3F J;  3HGG A;  2E2H J;  4IHX A;  2DA6 A;  2HOA A;  1JKP C;  4QTR A;  1QVU A;  1FIP A;  2PMZ N;  4FE4 A;  3ZQG A;  3W6V A;  2CUE A;  2Y9Y A;  1IV6 A;  5K7H A;  1JTX A;  4M3D A;  1GV2 A;  5C44 J;  1JT0 A;  5F04 A;  1GUU A;  3BR3 A;  2O7O A;  4CYC B;  4LOC A;  1IC8 A;  1W0U A;  1HDP A;  1MBH A;  5BNG A;  5FKM A;  1X2N A;  2Y31 A;  3A01 B;  2K9N A;  4MO7 A;  5IP9 J;  2XPU A;  3PM1 A;  4I6Z A;  2E2J J;  2R5Z A;  4A3M J;  2O8K A;  3JRG A;  5M5X J;  3MN2 A;  1U8B A;  1RES A;  1Z0X A;  2EBI A;  2R5Y B;  1MBE A;  2FD5 A;  2JA6 J;  3GTO J;  4D5C A;  1BW5 A;  1K61 A;  1JJ6 C;  1ETX A;  4UUS B;  3LSP A;  2QF7 A;  3Q0U A;  4W97 A;  2COB A;  2R5Y A;  1GDT A;  3G1O A;  3HEF A;  4FIS A;  1B8I A;  1MBJ A;  2ME6 A;  5EGO A;  2DA1 A;  2LVS A;  1TWA J;  1I6H J;  2JA8 J;  3BTI A;  1VI0 A;  2XPV A;  4MLO A;  2HOS A;  2CQX A;  1U9O A;  2M8G X;  4A3I J;  1P7I A;  5J3L A;  2NVQ J;  4A3J J;  2FQ4 A;  5EYR A;  3E7L A;  1ZR4 A;  1ETQ A;  5C4J J;  4A3C J;  1BA5 A;  1RPW A;  4DW6 A;  4DYR A;  1ZGW A;  4UUS A;  4DZP A;  2EQR A;  1AU7 A;  3K7A J;  2JK3 A;  1I3Q J;  3IH4 A;  3BTL A;  5J1R A;  4M3G A;  4A3K J;  2DA2 A;  3IV5 A;  1BL0 A;  3SJM A;  1U9N A;  3DEW A;  2LP0 A;  3BR0 A;  2R5Z B;  1JKO C;  4B3A A;  1Y1V J;  3BG9 A;  1UMQ A;  4FTH A;  2XB5 A;  2LR8 A;  2VUM J;  5GP9 A;  2DMU A;  1ETV A;  1VF9 A;  4C3I J;  2CQQ A;  3ZQI A;  1XC5 A;  1RET A;  1FIA A;  2MSY A;  1NK2 P;  2HYJ A;  5F08 A;  2DMT A;  4BXX J;  3PO2 J;  1IDY A;  2P81 A;  1FEX A;  2FX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...